2JYOA

Nmr solution structure of human mip-3alpha/ccl20
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
b'ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 20 (Small-inducible cytokine A20) (Macro
publication title Human macrophage inflammatory protein 3alpha: protein and peptide nuclear magnetic resonance solution structures, dimerization, dynamics, and anti-infective properties.
pubmed doi rcsb
molecule tags Cytokine
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jyoA00
5T1IA 1B3AA 4X3UA 1B53A 1HUMA 1U4RA 3D6WA 3N52A 4OIKA 5EPJA 1WVLA 1DONA 2NZ1D 2KVMA 2L11A 2M2LA 5EKIA 1B50A 1BO0A 2B2UC 2FHTA 2K03A 3GV3A 5EPLA 5T1GA 3F2UA 4ZKCB 1WTOA 3MWYW 2EOTA 2KEDA 4MHEA 4CJ1B 2KECA 4O42A 1WTQA 1EL0A 1U4LA 1QG7A 1C8CA 2X6LA 1X3PA 2X6GA 4IUQA 3FPUB 3DM1A 1DZ1A 1BF4A 1ILQA 4ZKBB 1QE6A 1EOTA 4ZAIA 1NR4A 1DOMA 2D9UA 2IL8A 4RWSC 3R93A 3TZDA 3G7LA 2FMMA 4IURA 1IKLA 4IUPA 1ZXTA 3MTSA 2X69A 1HFNA 1QNKA 5CMDA 1O7YA 1XX8A 3UI2A 1VMPA 1WTRA 2B2UA 2JP1A 2R3ZA 4XT1B 1SDFA 4DN4M 2Q8RE 1X32A 5CBAE 1CA5A 2EPBA 4RA8A 2RA4A 1O80A 1ESRA 5CORA 5E4WC 5COYA 1EIGA 1X3QA 1CA6A 3TN2A 2K01A 3IFDA 3I90A 3Q6SA 1F2LA 3DEPA 1M8AA 2BDNA 2MGSA 4QUCA 1SAPA 4X3KA 1ILPA 3H91A 1NR2A 2HCIA 5D65A 1AZQA 1IL8A 1PDQA 2RSOA 4XDXA 2HDMA 1KNAA 1E0BA 2L1BA 5DNFA 2B2WC 1U4MA 2FJ2A 4OIJA 2L4NA 1B4OA 1PLFA 2HDLA 4R9WA 2KUMA 5E4XA 2K04A 1ICWA 4R8IA 1J9OA 1KNEA 1NCVA 2DY8A 4LMQD 3GV6A 4IUVA 1G2TA 2MPMA 3I3CA 4RAUC 4CJ0B 5CBEE 1EQTA 2JYOA 1MSHA 4HAEA 5D14A 2L12A 2K28A 1WTXA 1F9SA 1G91A 1G2SA 1J8IA 1F9RA 4QUFA 2B2YC 1DOLA 1HHVA 1JE4A 1DOKA 2FINB 2K05A 3KBXA 2B2WA 3IL8A 2VXWA 2FFKB 2K1BA 2L9HA 1MSGA 2N55A 1ML0D 4CJ2C 2HUGA 2H1EA 1VMCA 1Q3LA 4HCSA 1LV9A 1PFBA 1U4PA 1BNZA 3FDTA 4U68A 4XT3B 4ZK9B 4HSVA 4IUTA 1CM9A 1WD0A 2N88A 2B2TC 3DEOA 1MI2A 3ONAB 4UAIA 1HFGA 2KOLA 2RSNA 1G6ZA 1WTWA 5EPKA 2NYZD 2B2YA 1AP0A 2B2VA 2KEEA 2SDFA 1RODA 2MJ8A 1PFMA 3I8ZA 5EJWA 2HCCA 1F9QA 3QO2A 4X3SA 1NAPA 5AFWA 1WTVA 2EE1A 1SSOA 3LWEA 3HP3A 2CVRA 1B2TA 4X3TA 1RHPA 1A15A 1RTOA 1S4ZA 2B2VC 2J7ZA 3I91A 2Q8TA 4ZLTF 1WD1A 4NW2A 1WTPA 2NWGA 1AZPA 1HA6A 1F9PA 1PFNA 2B2TA 2XIWA 1MGSA 5EQ0A 1HUNA 3SVMA 4MN3A 3KUPA 1O7ZA 1RJTA 1IKMA 4HEDA 2RVLA 1HRJA 5JJZA 3P7JA 1BBXC 1XYIA 1GUWA 4IUUA 1TVXA 1EIHA 1RTNA 1JICA 2DY7A 2MP1A
chains in the Genus database with same CATH superfamily
1T9HA 4A3DH 4ALPA 2DNCA 5CC4A 2F0IA 1H9KA 5T1GA 1KDAA 4RGMA 1TXYA 4PZ6A 2HQLA 2PZUA 1SNMA 3GTMH 1BUVT 4B3TQ 1BQQT 5IGDA 4JI2L 1HPCA 5JJKA 1DZ1A 1ICFB 4KHZA 4R4IA 4IPHA 3GTKB 2IX3A 2WKDA 2EYHA 3J80E 2JA7H 5CGKA 3OTOL 1QNKA 1O7YA 5NUCA 1VMPA 3ND8A 4XT1B 5IT9c 5C0XJ 2YTYA 5FO8B 2Q8RE 1KDBA 3EN2A 3D31A 1D1KA 1O80A 4RCOA 4OO1H 1ESRA 1B44D 2CHBD 2I07B 1EIGA 4Y7NB 3P1HA 3TSSA 3BVGA 1F2LA 3STBD 1XNRQ 1Q7YC 1GUNA 4Z9CB 4JI8Q 5HGQA 2PNRC 3HOZG 1HA5A 1N33Q 1TY0A 4X65Q 4YY3L 4RG1A 1XPOA 5DNFA 3GTOB 1KQSA 5A2QL 1Z9FA 4P75A 2IX1A 1G2TA 2RDHA 3G6JB 1X3GA 3CCSA 1MSHA 4HAEA 4KD3A 1F9SA 2VQFQ 5C4HA 2ASBA 3NHHA 3I70A 4QCLA 3IRBA 5BR8L 4R4OA 1PXUA 1SR3A 5C4XG 1K28A 2FINB 3S16B 2F0NA 3Q24A 4G57A 5EBDA 4LNQA 5E1FA 1FR3A 1EY8A 1MKHA 2A6HC 3TP8A 2R7ZH 1E2WA 1U4PA 5HY6A 1STEA 5IGCA 4MNOA 1Q1BA 5DM73 3DEOA 3M4PA 2RSNA 4DUYQ 4LJZC 4C3HB 4GLAC 5I9OA 1TS2A 1D5ZC 3U58A 4JYAL 1J5EQ 1LTGD 2PW7A 3P75A 2SNMA 4GOPA 4IPCA 1PTOD 2XWJB 1Y1VB 4DK1A 2J7ZA 3NUCA 2R61A 3S17H 1C9OA 5IP7G 1PFNA 2XIWA 4X66Q 2EY1A 4FVMA 1SNPA 5EQ0A 4KD4A 1RJTA 4WJWA 1XYIA 3PIO3 1R9TH 3UE0A 4DU9A 3NWTA 3F1ZA 1KIXA 2HHHL 1JE5A 3KDFB 4ZKCB 3PQIA 3SK6A 2KEDA 2HT1A 5EKKA 1EL0A 1I94Q 1Y8OB 1Y8PB 2EDGA 3MA2B 4LUVA 1QE6A 3I4MG 3T1YQ 4DXGA 4ZAIA 4EGVA 2R92B 4LF6Q 3M9BA 4B3SL 3EQLC 4A3GH 2KENA 3IKJA 2WB1B 5IYDG 3UDGA 3T16A 1D2BA 1U0LA 2AUJD 4C3IG 1YIJA 2JA6H 2VB3X 4ZQ3A 1AW7A 1X3QA 3CXCA 3PMFA 4AYBG 1Y1WH 1IW7D 3B6YA 3VA5A 1KNAA 1S5BD 2K52A 3SEBA 3TRZA 2DJFC 1JQYD 2BA1A 1GUGA 4CDEC 2E2IB 2FMCA 2JA8G 4HMJA 5M3FB 4DAVA 2OQ0A 3K5OA 2R93B 2UU9Q 1W3SA 5C5LA 5HURA 3A56A 2IWHA 1SMXA 2EJFC 2NVXH 1D8LA 4JV5Q 5K36G 4GN3B 1DOKA 4FF1A 2NTTA 2R7DA 1RD9D 1CKNA 1H9JA 4DV5Q 2H1EA 3Q22A 3M4OB 1VF5C 1Q3LA 3BDLA 2B8GA 3SHLA 3W3AA 4XYOA 4RH6A 4A3FB 1OO9B 1HFGA 1UWVA 2F0DA 2O2LD 3GTQB 3GTGB 4JI4L 3HKZG 1ASZA 1N9WA 5EKLA 1BXTA 3O13A 3S2DH 1TS3A 1JR0D 5FLMG 5M3MG 3BVZA 5ISRA 5DM63 1C48A 1VQIA 1CKNB 1PZJD 5I2YA 3GTPB 4B3MQ 5CV8A 1V1PA 4A3JB 2B2TA 4JVZA 2K5QA 1IYJB 1DJRD 3PF4A 1C4QA 2K50A 3PO3B 2N78A 1NSNS 4YHHQ 1UEAB 3MVVA 1I6VC 2A74C 2DY7A 1TU2B 4L63B 1XJVA 4RGNA 1IXRA 4ME3A 2JA5H 2EYOA 4H13C 2QKIC 3SK8A 2UXDL 1N8RC 1CT1D 1M1KC 3KJOA 1V1PB 2QDLA 1GHKA 4DR1Q 4UY8C 2OEOA 2NZHA 2X69A 3A5ZB 2E5LL 1EZ8A 2R3ZA 2NN6I 3JAME 3AYHB 4KY5A 4DN4M 4X62L 3K0XA 1CK1A 1ZYRC 3FKIH 3ND9A 4B9WA 4OO1I 1Q46A 5LMUQ 2Y0SG 3BVMA 2Z9HA 3CCUA 4J6HA 1E7ZA 1X54A 1HZAA 4ODGA 2K5NA 4R4QA 3HOYG 4FO2A 2KUMA 2HD3A 1PH3A 4GKKL 3I2ZA 3I7FA 2E8GA 5KIXA 4JI7L 4IUVA 2KCNA 5I9PA 1A3VA 2UXBL 4J8QA 3VR6A 3OMGA 1B7YB 3NWSA 3SK4A 2B63H 1F2MA 1OXXK 1V1QA 4K5WA 4IFDI 1LT6D 4P2CB 2NB0A 1OXTA 2SEBD 3QOLA 4XT3B 4A3EH 1WD0A 4JI0L 3U4ZA 3CCVA 5IT9E 5C0XG 4IFDG 2TSSA 5EPKA 2B2YA 1YHBA 2SDFA 1TWGH 4HJ8A 1VDZA 5GQOA 2PW5A 2M00A 4KI0A 3CMAA 5M5XB 2NVTB 4BY1B 2K14A 2CFMA 3OWEB 3HOWB 1AZPA 1SJED 2RHQB 2Z4HA 1L0YB 2CWPA 5IY0A 5M5YB 1CZGA 2XWBB 3W1BA 5C4JH 4A3KG 2R93H 5IWAL 3H0GB 2DJGC 2Z6KA 1EIHA 1YVCA 1RTNA 2LY7A 4EX5A 3AFPA 3K5NA 3RZDB 1JWUD 3P20A 2VUMB 4EQ5A 3EBEA 2NZ1D 1KDCA 3AFQA 4DV1Q 2J0TD 4M8AA 1KXLA 1XMOQ 1N36L 1HTLD 4KHVA 1VQBA 2X6GA 4IUQA 3DM1A 2QCPX 3T13A 1HJPA 2JJQA 4ULLA 1AEXA 3OYYA 4RWSC 2D9UA 3G7LA 1VQ5A 1VS0A 5JEAH 4ID6A 2K32A 4LW1A 2B2UA 3WWVA 3F8TA 4A3IB 4P73A 1SRUA 4A3JH 1Q8IA 2DUDA 2K33A 2K5DA 3ITPA 4QMGA 4DR2L 1K83B 3VR4A 3I4NG 4DK6C 1TWHB 4KHPQ 4LF8L 3QIAA 3I90A 4B3RQ 1M8AA 4IQZA 4DAYA 1NNXA 4CDCC 1BCPD 4NPSA 1EWHA 2KHIA 4ZRZA 2LS01 2I5LX 3NEMA 4AIMA 2YU9H 1TWFB 4PZ7A 3CQZB 4G7HC 1UEBA 4KKUA 4DV0Q 1J8IA 2WFWA 1I3QB 3GP7A 2KCTA 3ICEA 1SLJA 4DAYB 1X6OA 2EJMA 3T53B 1QNUA 2LMCB 2F0FA 1LV9A 1VQ7A 2MO0A 1CQFA 1PYSB 2KBNA 4JI2Q 1E22A 1XMQL 4ILWA 4H7BA 1YJ9A 1GD7A 4BBSB 5K5PA 1X3EA 1SNDA 3I8ZA 2KCMA 3QO2A 1NAPA 5JVH3 1ENAA 2EE1A 1RCVD 3ZYYX 1BCPB 3KF8A 4JBJA 3L7ZC 3EA6A 3CCQA 1BOSA 4EVOA 3TZUA 1F77A 1NUCA 4A3DB 4GZYC 2BH8A 4FF3A 1XPUA 1UAPA 4TVAB 3HOXG 5JPMC 1EZ6A 4DR3L 3GTMB 4C1NK 1SE2A 4DV7L 3J81i 1CHPD 2O4XA 3N52A 1JCKB 5EKIA 4LFBQ 3EROA 2JA7B 5FLXc 5F2DA 1CQVA 1WFQA 1FD7D 2A68D 3UE1A 1YNJD 2Q2IA 1ILQA 4ZKBB 1MJEA 3R8BA 1I6HB 1DM0B 4GNXB 1IKLA 2DN8A 2AQ1B 3GTLH 4BWGB 1CSQA 4C3JH 1XX8A 2Q8IB 1MHWC 5KYIA 3QB3A 4DAMA 5IP7H 3OSOA 2QA4A 1E2ZA 3LGJA 2RF4A 4A3BH 2RHSB 5CORA 3L0OA 3H0GH 4XQJA 1TKWB 4JYAQ 1NR2A 1DGSA 4K5XA 5KYLA 3D6CA 1EYCA 2K04A 1ICWA 1W6JA 1NCVA 4A3LH 3GV6A 1T5EA 2P5ZX 3WDNA 3PIOA 2YYZA 4DUZL 1AE3A 4BA2I 4ABNA 1WTXA 4CGYB 2QEXA 4JI6Q 1FGUA 4QY7A 3L2PA 4CBVA 1LTAD 4POGA 1PV4A 1KLUD 1PRTC 3IL8A 1LACA 5IYDH 2HUGA 4UP7A 1HH2P 2UUBQ 4CHTB 3RLFA 3DWPA 4U68A 3J7A5 2F3VA 3PCOB 1MI2A 1TT2A 3UDIA 2WB1G 3VR3A 3S17B 2MJ8A 3U4VA 1EFID 4V0BA 4C2MH 4X64L 3HOVH 2V4DA 2A6ED 3ZJYC 1SSOA 1K0RA 3K5LA 1J6QA 2CVRA 4DR7L 1B2TA 3AQQA 4JI5Q 1ILPA 1R9TB 2Q8TA 1SBBB 2ZM6L 4DR5L 1TWFH 4BBRH 2QDBA 1XNQL 4AQYQ 1EY0A 4DFAA 2ENBA 1LTBD 4LF5L 4K2KA 5K36H 3P7JA 4KKTA 5ELBA 1ENFA 4DKAC 3T1HL 1F2YA 2Q2HA 1EOVA 1JICA 1HHVA 5FLXL 1KL9A 1NE3A 4OONA 5M3FG 3BS1A 1RDPD 5EPJA 4Q0FA 1GM5A 2FHTA 3GV3A 4DXFA 5KGUA 1EFWA 1PFSA 3STBC 4A3GB 1QG7A 1X3PA 3RLOA 4N9TA 3K80C 3J7YW 4BBSH 1P8LA 5FK9C 3SE0A 1HR0L 4K14A 2JA6B 3ER0A 2EYFA 4A3FG 3C1FA 1Y1WB 3E9HA 1FJGL 2JP1A 4NP5A 1Y69U 1KTKA 2A8VA 3ERQA 3F2CA 4LF9L 2LKVA 1SYGA 3A74A 4JI4Q 2K5VA 1FGBD 1A0IA 3M4YA 4X3KA 1VQ9A 3H91A 4N8X1 1XXGA 1AZQA 1QUQB 1PDQA 2L1BA 2TMPA 2EZVA 2NVXB 3BYYB 2FJ2A 2HDLA 1PZKD 3PO3G 1RKNA 4LF4Q 2F0PA 4F87A 1A8VA 3EIVA 3MHBA 1VQCA 4IFDJ 4DA2A 4O0AA 1YI2A 2L12A 2BOSA 1I50H 1PTOC 1I6HH 1WTHA 3PV0A 2BE5C 3KBXA 2F4VL 5J22A 2IW3A 4LWCA 1FYCA 4HIKA 3H94A 1B9NA 5L37A 3X3NA 3AMUA 3S2DB 3A5UA 2E74C 4K5VA 4U673 4HSVA 3ERSX 3CC2A 4IALA 5GROA 3E9IA 2HQEA 5E3FA 4YCUA 1HZ9A 3DWQA 4RKBA 5A35A 1RODA 3KLSX 4DV3Q 1GUSA 3G6EA 3HOYH 1NJIC 1STNA 2E5LQ 1UE7A 3PGZA 3D0FA 3SGIA 4YWMA 5BN3A 4DK0A 4NKLA 5I4DA 3AEVA 2F3IA 1LO5D 3TEHB 2JE6I 3F2BA 4A4IA 4YWKA 3AB9A 2JA5B 3KUPA 3FP9A 1A62A 5LMNL 2KJXA 2VW9A 2UUAL 4NXML 2L15A 2F0QA 1WCMG 3TZDA 1H95A 3L3OC 1E1TA 1V8QA 1VQ6A 4GKKQ 1STYA 1MBYA 4OHJA 1SNOA 3NSWA 4NMZA 4JK1C 2ATWA 1OTCA 5C3EG 3CRLC 1IW7C 3ULPA 2Q2TA 4HR7B 1SYEA 4K8IA 3HFZB 1JOQA 3FKIB 3QWNA 3MFGA 1U5KA 5I6WA 5IGFA 4KJOA 1PH4A 4JOIC 4PV1C 1V9PA 1QVFA 1GUTA 4L5SA 3CCJA 4K0KQ 2BA0A 4HIDA 1TQOA 1HNZL 1TWAH 3NENA 1N34L 4JI0Q 1VQEA 4A3KH 2RA4A 4LK1C 4GOPB 1YHQA 4POFA 2K01A 2QEJC 3CCEA 1O7IA 4BY1G 3CCRA 1S40A 3HOWG 1PMRA 1JC7A 5M5WH 1SN8A 3FRPB 5D65A 1M4VA 1GXDC 2JSOA 2B3GA 1D6EC 1U4MA 3GTJH 1PLFA 1Q86C 1IBLL 2ZJRA 3DUZA 4BXXG 1DYQA 2C5CA 3H15A 3MZ5A 2B63B 1AE2A 3CHBD 4TKOB 2K7VA 5GAHC 3CAMA 4L5QA 1HNXQ 5EBCA 4A3EB 3M85A 1JE4A 4CKCA 5CV9A 3H6MA 1KC8C 1MSGA 5CV7A 1YHAA 4ZUJA 1JORA 1WOCA 1TWGB 2K4KA 3PO2G 4CKBA 2MNAA 3HG9A 3I4NH 2UUCL 1N36Q 5EAYA 2A69C 1EQQA 1SFOH 5FKAC 2RBMA 1EYAA 1PFMA 5C4JB 1H9RA 3HP3A 4LFCQ 2GN5A 1S4ZA 4A93H 4CDFC 3PUXA 1HZBA 1ENCA 4OX9L 4LF8Q 4HEDA 1I4QA 4OWWB 4DV4Q 4GKJL 5C3WA 4KLKA 1U9RA 4RGOS 2F0KA 1CI3M 2WAQE 1WVLA 1QCBD 1S5DD 3PF5A 3W5OA 2PCFB 5EPLA 1BDOA 2E2JH 4YCWA 1TS5A 4CJ1B 3Q23A 3BZDB 3HS0C 4NDXA 3URYA 3HOUG 2PMZE 1NMFA 4RCNA 3CU7A 3QG1A 1NR4A 1DOMA 3NK9A 4IURA 2OTJA 3RN5A 4IUPA 2DNEA 3NTKA 2IPKD 1WTRA 1PHJA 4R8NA 1EY5A 2AUKA 3DXJC 5A2QE 1BCPF 1A6XA 4A3MG 2PYKA 3HOXH 5IP9H 1S5FD 3KLWA 4XYQA 3TN2A 1YEZA 4QF4A 2YU9B 3Q6SA 3M3YB 1VF7A 2ZT9C 4PMBA 1SAPA 1GVPA 4A3DG 1IL8A 1GJXA 2PZTA 3A0JA 1K8GA 1E0BA 2EY2A 5LL6S 1SE3A 2OQKA 1RIPA 5JJIA 4DNRB 2JN4A 5D3IB 4QIWE 4LFAQ 3VR2A 5D14A 1G291 4PG3A 1STAA 2MO1A 3U9SA 2JA7G 4UHVA 1B8AA 4DV7Q 3SXHA 1DOLA 1JJ2A 2K05A 3DMUA 2NN6G 1HXYD 3A7LA 3NQTA 2YV5A 2EXDA 3E0JA 3NE5B 4OO1G 4PZ8A 2KCCA 4ZK9B 3CW2C 4TRDA 3NP8A 2N8NA 1G6ZA 2QGQA 4G7OC 2QF7A 1GHJA 3M7GA 1Q1EA 1D1IA 3PUVA 3MXUA 2F0EA 2WINB 4X3TA 4A3CH 3I56A 1JB3A 1JJCB 1Z7TA 1Q81C 1E3PA 4P72A 3OOCA 4DPGA 2Z4IA 2JQOA 2VB2X 3ULJA 4F8MA 3NXWA 4I7AA 2EYLA 2EYJA 3S15H 1KAAA 5KNBA 2IT1A 5T1IA 5C44H 4DV6L 2R7ZG 4LUZA 4X66L 2M2LA 3GTLB 2EOTA 1X9NA 4C3JB 3VA7A 4DUZQ 2BCOA 4PNYA 1SE8A 1BF4A 1K3RA 4RGTA 4A3BB 1L0XB 1Z47A 4GLXA 3NTHA 2WKCA 4C56C 1JJGA 5CMDA 4IPGA 1JWMD 3UI2A 1SE4A 2GVAA 1PVOA 5IODA 1SYDA 3A54A 1ZYRD 1CA5A 3J81c 1SYBA 4OGQC 1EY4A 3T1YL 5COYA 5IYCG 2CH4A 3DWAA 1K0SA 2EJGC 2HIXA 4PMCA 3VYSA 5C4ZA 4BY7G 3G4SA 2Z1CA 4X64Q 4QJFA 3I4MB 3J81j 4IO9A 1VQ8A 2B2WC 4DR7Q 2I0QA 3RZOH 4KV6A 2ZM6Q 2IX0A 2ALYB 5FJ8H 1HZCA 4DR5Q 4LUOA 5EGTA 1XNQQ 2CH4W 2XNAC 3SDZA 2JA9A 4I65A 3DM3A 3BYTB 1IYUA 4LF5Q 4MTKA 3U50C 2B39A 1V1OA 3I4OA 3T1HQ 4K2LA 1SMYC 2VXWA 1KAWA 1S72A 2AQ2B 1FNVA 4C2MB 4ZYSA 3HOVB 2UU9L 1Q12A 4B9XA 4JI3L 2F0HA 1CKMA 1CUKA 3PUZA 4JI1Q 4UAIA 1L1OC 3KJPA 4IUNA 2JA8B 2OCEA 4KY7A 4DAPA 4BBRB 3M3YH 2KHSA 4UP8A 3K7AH 3WOEA 1WTVA 2EIFA 1HCZA 3CP0A 2SOBA 2YTXA 2A68C 1A15A 4ZLTF 1YNJC 1WTPA 3W2DA 2L55A 2MFIA 3K0YA 4LF9Q 3T51B 1HUNA 5H1SE 2ICIA 4APVA 2RVLA 3KLRA 1VCIA 4KN7C 3RUZA 1UE1A 1PH8A 3RLNA 3KBGA 3HKZB 3TS0A 1A2UA 4OIKA 3HOZH 2WAQB 2KVMA 4AH6A 2NVQB 2JEBI 4IZ8A 1YJWA 4GS3A 1G8ZD 2JK8A 3OTOQ 3DHQA 5C5MA 2ZJQA 3M4QA 1WJJA 2A1AA 3BZKA 1R4PB 1YNND 1WI5A 1VQKA 3FPUB 1AFPA 2B8FA 2PMZB 3D4DA 2IL8A 2FMMA 3UDXA 3J81L 2F4VQ 3MTSA 1X56A 5C4XH 1VQPA 2F0JA 3GD7A 1STHA 2UXCL 5AJ3L 4LF7L 4YY3Q 5CBAE 4DNTB 4NB3A 4NXNL 1EIYB 4DR1L 3S1NH 3KF8B 4PQXA 3RD4A 4N9PA 4QQBX 2A5HA 3J80L 1H9SA 4IJHA 2RCNA 1LTID 4OWTB 2I5MX 4FF2A 5DAUA 4XXEA 2HDMA 1I50B 3MXNA 3J80i 5BR8Q 2L4NA 4F7XA 1PYWD 1A3UA 5LMUL 1J9OA 1X55A 2ZTEA 3MFYA 1LTRD 1OXUA 4C3HG 3LNNA 4OELB 5C3EH 4CJ0B 5CBEE 1I4PA 3W1GA 3G71A 2XTIA 4QIWB 2A6EC 2OTLA 3PIP3 1D7QA 4HJ7A 1G2SA 4CKEA 3NBHA 3NBIA 2UUAQ 4QUFA 1LT3D 1Y1VG 4KN4C 2N49A 2VQEL 1H9SB 1G6PA 2L9HA 3E6ZX 1VMCA 3HOYB 1LTSD 1D5XC 2O5JC 1EQRA 1JOKA 2EXZA 4G4KA 2DGYA 3V96A 1HNWL 4JBWA 1DD2A 3K81C 2AWNA 4XIGS 4L6TB 1QZGA 2NYZD 3T4AC 1I4RA 2KEEA 3CPWA 3I4MH 4TSSA 3FHWA 5AFWA 1FL0A 1RHPA 4BXXH 2B2VC 2G9HD 2E75C 3HRZC 1HNZQ 1N34Q 1ZEQX 3RMHA 4FDBA 2HHHQ 1MGSA 1C0AA 2R92G 4C3IH 1HRJA 2A73B 2OF1A 1BBUA 4IUUA 2OT2A 5BN5A 5CV5A 1XTDA 1B53A 5FO9B 5G3LD 1PA6A 3QOJA 2L11A 4S3SA 3PO2H 3J7AV 1BO0A 3H3VC 1X3FA 3MWYW 1KABA 2E2HH 4B3SQ 2MUYA 4O42A 2ID0A 4E6IA 1U4LA 5E7NA 2JA8H 1TWAB 5FOBB 1Q82C 1GOZA 1K8MA 4A3KB 1IBML 1BVSA 1LUZA 4WRDA 4JBKA 1JWSD 1L2FA 5JAVA 1UE6A 1MD2D 4WJ3M 2NBFA 3QJYA 5M5WB 4P71A 2WP8J 3VYUA 2E76C 2R93G 2UUCQ 3CC4A 3GTJB 2VY3A 1K8AC 1R4QB 3HZXA 2WIIB 3DEPA 1SEBD 2F4IA 4ZCKA 5FLMH 2NVQH 5M3MH 1IBKL 5HGTA 1AN8A 1VQHA 1HTPA 4KHPL 3BU2A 4RAUC 5ELCA 4B3RL 1WYDA 2JYOA 3HOUH 3JAMc 2RDFA 2XGTA 4OX9Q 4A76A 2R6GA 2EY6A 1EQVA 5IOCA 5C6AA 2B29A 1K3BC 3I4NB 1VQAA 1SFOB 2K1BA 2I46A 4KKSA 1VQOA 1YJNA 5IIFA 4ME5A 4A3JG 5LL6X 4A3MH 3D4WA 5I2XA 4A93B 1B9MA 2G5DA 4KY6A 4OEMB 2F1MA 3MXGA 3PUWA 3J81E 2B2VA 3MXPA 3MC0B 2HCCA 1F9QA 5J1ZA 4FXGC 3NPPA 3I55A 2D0PA 2F0GA 2CW0D 5ELOA 4N8FA 3JC66 3TMEA 1TY2A 2UXDQ 2E2JB 1VQJA 2ZXOA 2LSSA 4V190 1BBXC 3EFXD 1GUWA 2NN6H 4DF7A 1VQFA 3KOJA 4X3UA 1Q90A 5JOBA 1PRTB 3G48A 3RN2A 4FF4A 2N3SA 1B50A 1NMGA 2K03A 1WTOA 1EU4A 2F0TA 4MHEA 1WTQA 1QZHA 1I4HA 2Z6BA 1A3TA 2RDGA 2J4XA 4B08A 4X62Q 3A55A 2CQAA 1LYLA 1VQGA 3CCMA 4LFBL 3HOXB 4DR6L 5M9OA 2F0VA 1HFNA 2VZAA 5GAEC 3L9AX 3FPPA 4GLVB 3S1QH 5E4WC 1CZWA 2H5XA 1CA6A 3IFDA 4JI7Q 3S1RH 3S24A 2Z8LA 3GDEA 2BDNA 4YIJA 5C0XH 4QUCA 2UXBQ 4IFDH 1EEID 1GO3E 2RKSA 5KRUA 4IOCA 3JAML 4OIJA 1TWCH 4P74A 3RR5A 5IYBG 1AH9A 3E0EA 1LLRD 3IFTA 4R8IA 4DNIA 1FNWA 2DY8A 3JAMi 3J7ZC 3I3CA 3I4LA 1EQTA 1Y14B 1CSPA 2K28A 2M9VA 3A7AB 3KDFA 2K5HA 3S14H 1F9RA 4HCEA 4C3JG 1Z6HA 1PH6A 2BE5D 4DV6Q 2KHJA 4A3BG 2AHOB 1B70B 3SK5A 1P16A 4JI6L 4IUTA 3H0GG 4UDUC 5IYCH 2B2TC 1VQLA 3ONAB 2R7FA 1A63A 2RQXA 1IL2A 4BY7H 2OWOA 4R1JA 3GO5A 2VUMG 2UUBL 2VL6A 5TSSA 5IWAQ 3IAYA 1DCZA 4UPAA 1SYCA 5FLXE 5IGBA 1BBWA 4A3LG 1STGA 4LAAA 4AYBE 3S15B 1WD1A 1HQRD 5C44B 5IT9L 3CCLA 2ZXPA 2A6HD 4H44C 1O7ZA 4MTNA 1YBYA 4JI5L 1TVXA 4DV2L 1PTOB 2PNHA 2VNUD 2MP1A 1N32L 3C2PA 4A3IG 3VR5A 4L5RC 2XVSA 4HTHA 3KK7A 4DGZA 5JVG3 2F3WA 4AQYL 4CDDC 3A8IE 2QILA 1C8CA 4HIMA 3K8AA 3VYTA 2WV6D 4DR2Q 3HOVG 3M7NA 4C1NI 2JEAI 5ELDA 1ZXTA 4DR4L 1CKOA 3CF5A 4BBRG 4K6DA 1Y8NB 2KA7A 3HKZE 3DLLA 4RMFA 1X32A 3BDOA 4JI3Q 3VDYA 1PH9A 3GTKH 1LT4D 3RZOB 1EWCA 2V1CC 1LT5D 2A19A 4RHRA 3KLSA 1QILA 2MGSA 3A8JE 3RNUA 1BR9A 1EWIA 4JOIA 1PH2A 1K8OA 4J15A 3CPFA 3A8KE 1JT8A 1LTLA 5J39A 4Y7NH 3HGBA 2F03A 5GADC 3OIQA 3TQYA 1HQMC 2JXMB 3U9OA 4B3TL 4BBSG 3FMCA 2WAQG 3I73A 2F0LA 3GQBA 3R3OA 3K6OA 3GTOH 5KNDA 4KK7A 2D62A 1ASYA 1XMQQ 2B2YC 1XTCD 5IGEA 5ELFA 4RKLA 1QVGA 4LF4L 1SNCA 3C1EA 3H3VH 2FFKB 2LXJA 1VQMA 1ML0D 1A2TA 1ESFA 3T56B 1LABA 3K7AB 3Q0AA 1PFBA 3F2DA 3D8GA 2O5IC 1EY7A 1O78A 2PPBC 1IYVA 3S16H 2A69D 4JW0A 3CRKC 3I72A 1AP0A 5C3XA 3V2TA 2Z6KC 1XNRL 2EY5A 4JI8L 2ZTDA 3QR8A 1NBWA 1N33L 4WORA 4X65L 1KRSA 2Y0SE 4HMIA 4DR3Q 1QWYA 2HIVA 5AJ3Q 2UXCQ 3I91A 3D3RA 1JOOA 4C3HH 4LF7Q 2AWOA 1Q8KA 1ET6A 3HOZB 3HKSA 4NXNQ 4DV3L 3SVMA 4HSPA 2MHVA 2VQFL 5FO7B 3S1MB 2CWAA 2EYPA 4OWXB 1Y1VH 3MAQA 1PYBA 3NTIA 1RF2D 1HUMA 3D6WA 2L0CA 1SROA 1FVIA 2B2UC 5KNCA 3OHXC 2KQ3A 3PIPA 1RL2A 1QB5D 4X6AH 5C4XB 4WJ4A 2CCZA 4DUYL 1SJHD 4GN5A 5CYUA 3K58A 3R93A 3S1NB 4HJ9A 1J5EL 3BJUA 2VQEQ 2F0SA 2GA4B 4KTAA 1WCMB 4RFBA 5IGGA 1YZ6A 3KFUA 2AMCB 2ZXRA 1S5CD 2EPBA 1FNUA 4RA8A 4EQPA 3BZCA 1SNQA 4JG2A 3HEJA 2R92H 1HNWQ 2L5TA 4H0LC 4KJNA 1D5MC 5JEAJ 2XN9C 5C3EB 5C0XI 1PTOH 3MEHA 2HCIA 4K0KL 2RSOA 1BCPC 1I4GA 1T5XD 5KEEA 4BA1I 2F0MA 1KRTA 2NTSA 3H09A 1W2BA 2MQHA 1I94L 4GN4B 2EQSA 2XRQD 3K7UC 1CTMA 4Q5VA 1X65A 1EY9A 3LX0A 1M90C 4JPBW 4EQNA 4LF6L 2LFNA 3FVQA 2E2IH 2N55A 2Q2UA 5M3FH 4FYDA 2NZOA 4HCSA 4HJ5A 1PH7A 2G9DA 3FDTA 1II3A 1HNXL 3CKIB 2N88A 1LM0A 2ZTCA 3J80c 3E3XA 1K9MC 4GNXC 1IBMQ 3M4OH 3SR1A 5CR3A 4X3SA 1B1ZA 1V43A 4C3IB 3D4RA 1GKHA 1I4XA 1LTTD 1YNNC 4A3FH 3N6RA 3KF6A 4JC0A 2ZJPA 3GTGH 4AYBB 3GTQH 4A3GG 1NY4A 2NWGA 1GUOA 1HA6A 4DK3C 5G3LF 3PUYA 3PO2B 1E24A 4YCVA 1ZKOA 3K57A 2JA6G 1EEFD 1HR0W 2E2HB 3OPOA 1TS4A 4LFCL 1Y1WG 4JV5L 3GTPH 2K5WA 1U4RA 5JJLA 4DV5L 1DONA 1OXVA 1HR0Q 1IBKQ 1UNSA 2PI2E 3F2UA 2PQAA 5ELEA 4G7ZC 3PO3H 3KF6B 2KECA 3PSIA 1FJGQ 1STBA 4DV4L 2WACA 1KLGD 4RHSA 1C7YA 1YNXA 1SXTA 2X6LA 4MIUA 1EOTA 1PZID 1NTGA 3NQIA 2CKZB 2IJ0A 3CMEA 2D2CC 3VYRA 3NELA 4OXPA 2IHFA 3WOFA 4A93G 1JB7A 5CV6A 1SDFA 1XWEA 3BG3A 3S2HB 4B3ML 4J1MA 1L0WA 3UDFA 4H02A 4HJAA 2H4OA 2PQAB 5M3MB 1KD1C 1E2VA 3OMCA 3S1MH 2AKWB 3K59A 4YHHL 3HOUB 2I5HA 5JPNC 1B4OA 4R9WA 5E4XA 2NVYB 1VQNA 3S9WA 4LMQD 3CC7A 1PRTF 1UUPA 4XQQA 3TP7A 4PMWA 4HN7A 5DEHA 4A3MB 4F88A 3ULLA 4YWLA 3E5SA 5I6YA 1OXSC 3MEFA 3H3VI 1SMYD 2B2WA 4HIOA 4IN3A 2C9OA 3TBIB 1WCMH 4IJLA 1MIUA 4LFAL 2JA5G 1ET9A 5IP9G 4GNXA 2XRSD 2RCFA 2C35B 4IPDA 2CQOA 1YITA 1W6KA 5LMNW 3C46A 4DR6Q 5IYBH 5LMNQ 2EYMA 2Y0SB 5GAGC 2F52A 2F0UA 4NXMQ 4ZUIA 1F9PA 1TIID 5J3BA 1CFMA 3FKIG 1L1OA 4TQUS 1F2ZA 3MXNB 4I7ZC 1BKBA 1MJCA 5JJZA 2YTVA 5M5XH 2NVTH 2K6AA 4BY1H 4MN3A 3HOWH 2IY5B 1B3AA 4KMUC 4UP9A 1I5FA 5M5YH 2ES2A 3NBHB 1VQDA 2K75A 1EYDA 3FEWX 2IHEA 4FXKC 3TS2A 5BN4A 4O1NA 3RZDH 3OW2A 4FP5D 2VUMH 1L1OB 1JMCA 2PO4A 4M1UB 3J7AF 3S1QB 1IHZA 3EJIA 5IE8A 3OIPA 2SNSA 3TP6A 4A3CG 3S1RB 2WB1E 4K8JA 2ICEC 2B63G 4QGUA 5ELNA 3OWFA 2NUCA 2R7ZB 2AQ3B 4A75A 3C3LA 3BDCA 3R2TA 1TWCB 1IBLQ 2FXQA 4A3EG 1PH1A 4L5TA 1EUJA 3AU7A 5C44G 4FXDA 4JCVE 1KHIA 1DXMA 4XTCS 1B3QA 4BS9A 4A3IH 2XSCA 2F0WA 4XDXA 1G51A 2F0OA 4O2DA 3S14B 1EIFA 1K83H 1PTOF 5D3DA 1TWHH 1KNEA 4QB4A 4DV1L 4JBMA 2MPMA 1EY6A 1S3OA 3TREA 2D5DA 1XMOL 1IZ6A 4Y52H 5LHY1 1G91A 1QJOA 2BDOA 3CD6A 4DV2Q 2Z0SA 3KYHC 2CW0C 1N32Q 3X3MA 3Q8DA 2QW7A 4BY7B 3CQZH 4CJ2C 4IOAA 4XQNA 3TP5A 2PZWA 5DLQE 1UE5A 3S2HH 1BNZA 1S5ED 3R2IA 1CM9A 1E1OA 1I3QH 1H9MA 1PH5A 1O7LA 2KOLA 2EVBA 1TR5A 3V05A 1K73C 2VS1A 4OL7A 4EQOA 1WTWA 2GVBA 4WFN3 1EU3A 4K6LA 2OXPA 4L8JA 4R4CA 5EJWA 4DR4Q 4R4TA 3K5MA 1VQ4A 5JEAG 3LWEA 5FJ8G 3TDQA 1XPRA 2PI2A 4GKJQ 1QOHA 1RTOA 4FNFA 2NVYH 2BH2A 4JI1L 4NW2A 1QVCA 1PRTD 2D0OA 2LXKA 4GOPC 1QUQA 5CV4A 2E2DC 1EYGA 1SYFA 4QL5A 1CHQD 3EVQA 3LWUA 3OW7A 4DV0L 1IKMA 1ONLA 2PQEA 4MZ9A
chains in the Genus database with same CATH topology
2DNCA 5CC4A 2F0IA 1H9KA 5T1GA 1KDAA 4RGMA 2PZUA 1SNMA 1BUVT 1BQQT 5IGDA 1HPCA 1DZ1A 4KHZA 3GTKB 2IX3A 2WKDA 2EYHA 3J80E 5CGKA 1QNKA 1O7YA 5NUCA 1VMPA 3ND8A 4XT1B 5C0XJ 5FO8B 2Q8RE 1KDBA 3D31A 1D1KA 1O80A 4RCOA 4OO1H 1ESRA 1B44D 2CHBD 2I07B 1EIGA 4Y7NB 3P1HA 3TSSA 3BVGA 1F2LA 1GUNA 4Z9CB 2PNRC 1HA5A 1TY0A 3GTOB 5DNFA 5A2QL 2IX1A 1G2TA 2RDHA 3G6JB 1MSHA 4HAEA 4KD3A 1F9SA 5C4HA 3NHHA 3I70A 4QCLA 1PXUA 2FINB 3S16B 2F0NA 3Q24A 4G57A 5EBDA 5E1FA 1FR3A 1EY8A 2A6HC 3TP8A 1E2WA 1U4PA 1STEA 5IGCA 1Q1BA 5DM73 3DEOA 2RSNA 4LJZC 4C3HB 5I9OA 1TS2A 1D5ZC 1LTGD 2PW7A 3P75A 2SNMA 1PTOD 2XWJB 4DK1A 1Y1VB 2J7ZA 3NUCA 2R61A 1PFNA 2XIWA 2EY1A 4FVMA 1SNPA 5EQ0A 4KD4A 1RJTA 4WJWA 1XYIA 3PIO3 4DU9A 3NWTA 4ZKCB 3SK6A 2KEDA 5EKKA 1EL0A 1Y8OB 1Y8PB 2EDGA 3MA2B 1QE6A 4DXGA 4ZAIA 4EGVA 2R92B 3EQLC 3IKJA 2WB1B 3T16A 1D2BA 2AUJD 4C3IG 2VB3X 4ZQ3A 1AW7A 1X3QA 3PMFA 1IW7D 3VA5A 1KNAA 1S5BD 3SEBA 1JQYD 2BA1A 1GUGA 2E2IB 2FMCA 4HMJA 5M3FB 4DAVA 3K5OA 2R93B 5C5LA 5HURA 3A56A 2IWHA 2EJFC 5K36G 1DOKA 4FF1A 2NTTA 1RD9D 1H9JA 2H1EA 3Q22A 3M4OB 1VF5C 1Q3LA 3BDLA 2B8GA 3SHLA 3W3AA 4XYOA 4RH6A 4A3FB 1OO9B 1HFGA 2F0DA 2O2LD 3GTQB 3GTGB 5EKLA 1BXTA 3O13A 1TS3A 1JR0D 3BVZA 5ISRA 5DM63 1C48A 1PZJD 5I2YA 3GTPB 5CV8A 1V1PA 4A3JB 2B2TA 2K5QA 1DJRD 1C4QA 3PO3B 1NSNS 1UEAB 3MVVA 1I6VC 2A74C 2DY7A 1TU2B 4L63B 4RGNA 2EYOA 4H13C 2QKIC 3SK8A 1CT1D 1V1PB 1GHKA 2OEOA 2X69A 1EZ8A 2R3ZA 2NN6I 3JAME 4KY5A 4DN4M 1CK1A 1ZYRC 3ND9A 4B9WA 4OO1I 3BVMA 4J6HA 4ODGA 4FO2A 2KUMA 5KIXA 4IUVA 2KCNA 5I9PA 1A3VA 4J8QA 3VR6A 3OMGA 3NWSA 3SK4A 1F2MA 1OXXK 4K5WA 4IFDI 1LT6D 4P2CB 2NB0A 1OXTA 2SEBD 3QOLA 4XT3B 1WD0A 5IT9E 5C0XG 4IFDG 2TSSA 5EPKA 2B2YA 2SDFA 1VDZA 2PW5A 2M00A 4KI0A 5M5XB 2NVTB 4BY1B 3OWEB 3HOWB 1AZPA 1SJED 2Z4HA 1L0YB 5M5YB 1CZGA 2XWBB 3H0GB 1EIHA 1RTNA 2LY7A 3K5NA 3RZDB 1JWUD 3P20A 2VUMB 2NZ1D 1KDCA 2J0TD 4M8AA 1HTLD 4KHVA 2X6GA 4IUQA 3DM1A 2QCPX 3T13A 4ULLA 1AEXA 4RWSC 2D9UA 3G7LA 5JEAH 4ID6A 2K32A 2B2UA 4A3IB 1Q8IA 4QMGA 2K33A 2K5DA 3ITPA 1K83B 3VR4A 1TWHB 3QIAA 3I90A 1M8AA 4IQZA 4DAYA 1BCPD 1EWHA 4ZRZA 2LS01 1TWFB 3CQZB 4G7HC 4KKUA 1J8IA 1I3QB 3GP7A 2EJMA 3T53B 1QNUA 2LMCB 2F0FA 1LV9A 1CQFA 4ILWA 4H7BA 4BBSB 5K5PA 1SNDA 3I8ZA 3QO2A 1NAPA 5JVH3 1ENAA 2EE1A 1RCVD 3ZYYX 1BCPB 3KF8A 3L7ZC 3EA6A 1BOSA 4EVOA 3TZUA 1F77A 1NUCA 4A3DB 4GZYC 4FF3A 1UAPA 5JPMC 1EZ6A 3GTMB 4C1NK 1SE2A 1CHPD 2O4XA 3N52A 1JCKB 5EKIA 3EROA 2JA7B 5F2DA 1CQVA 1FD7D 2A68D 1YNJD 1ILQA 4ZKBB 3R8BA 1I6HB 1DM0B 1IKLA 2DN8A 2AQ1B 4BWGB 1XX8A 2Q8IB 5KYIA 3QB3A 3OSOA 1E2ZA 5CORA 4XQJA 1TKWB 1NR2A 4K5XA 5KYLA 3D6CA 1EYCA 2K04A 1ICWA 1W6JA 1NCVA 3GV6A 1T5EA 3WDNA 2YYZA 4BA2I 4ABNA 1WTXA 4CGYB 4CBVA 1LTAD 1KLUD 1PRTC 3IL8A 1LACA 2HUGA 4CHTB 3RLFA 3DWPA 4U68A 2F3VA 1MI2A 1TT2A 3VR3A 3S17B 2MJ8A 1EFID 4V0BA 2V4DA 2A6ED 1SSOA 3K5LA 2CVRA 1B2TA 1ILPA 1R9TB 2Q8TA 1SBBB 2QDBA 1EY0A 4DFAA 2ENBA 1LTBD 4K2KA 5K36H 3P7JA 4KKTA 5ELBA 1ENFA 1F2YA 1HHVA 1JICA 5FLXL 3BS1A 1RDPD 5EPJA 4Q0FA 2FHTA 3GV3A 4DXFA 5KGUA 4A3GB 1QG7A 1X3PA 4N9TA 3J7YW 3SE0A 5FK9C 4K14A 2JA6B 2EYFA 3C1FA 1Y1WB 2JP1A 4NP5A 1Y69U 1KTKA 3ERQA 2LKVA 1SYGA 1FGBD 3M4YA 4X3KA 3H91A 1XXGA 1AZQA 1PDQA 2L1BA 2TMPA 2EZVA 2NVXB 3BYYB 2FJ2A 2HDLA 1PZKD 1RKNA 2F0PA 4F87A 3MHBA 4IFDJ 4DA2A 2L12A 2BOSA 1PTOC 3PV0A 2BE5C 3KBXA 5J22A 2IW3A 1FYCA 3H94A 1B9NA 3X3NA 3AMUA 3S2DB 2E74C 4K5VA 4U673 4HSVA 4IALA 2HQEA 5E3FA 4RKBA 3DWQA 5A35A 1RODA 3KLSX 1GUSA 1STNA 5BN3A 4DK0A 4NKLA 5I4DA 1LO5D 2JE6I 3AB9A 2JA5B 3KUPA 2KJXA 3TZDA 2F0QA 3L3OC 1V8QA 1STYA 1MBYA 4OHJA 1SNOA 3NSWA 4NMZA 4JK1C 3CRLC 1IW7C 4HR7B 1SYEA 4K8IA 1JOQA 3FKIB 3QWNA 3MFGA 5I6WA 5IGFA 4KJOA 4PV1C 1GUTA 2BA0A 1TQOA 2RA4A 4LK1C 2K01A 2QEJC 1PMRA 1JC7A 3FRPB 5D65A 1M4VA 1GXDC 2JSOA 1D6EC 1U4MA 1PLFA 3DUZA 1DYQA 2C5CA 2B63B 3MZ5A 3CHBD 4TKOB 2K7VA 5EBCA 4A3EB 3M85A 1JE4A 4CKCA 5CV9A 3H6MA 1MSGA 5CV7A 4ZUJA 1JORA 1TWGB 4CKBA 3HG9A 2A69C 5FKAC 2RBMA 1EYAA 1PFMA 5C4JB 1H9RA 3HP3A 1S4ZA 3PUXA 1ENCA 4HEDA 1I4QA 5C3WA 1U9RA 2F0KA 1CI3M 1WVLA 1QCBD 1S5DD 2PCFB 5EPLA 1BDOA 1TS5A 4CJ1B 3Q23A 3BZDB 3URYA 3HS0C 4NDXA 4RCNA 3CU7A 3QG1A 1NR4A 1DOMA 3NK9A 4IURA 4IUPA 2DNEA 3NTKA 2IPKD 1WTRA 4R8NA 1EY5A 2AUKA 3DXJC 5A2QE 1BCPF 1A6XA 2PYKA 1S5FD 4XYQA 3TN2A 4QF4A 2YU9B 3Q6SA 3M3YB 1VF7A 2ZT9C 4PMBA 1SAPA 1IL8A 1GJXA 2PZTA 1E0BA 2EY2A 5LL6S 1SE3A 4DNRB 5D3IB 3VR2A 5D14A 1G291 1STAA 3U9SA 3SXHA 1DOLA 2K05A 3DMUA 2NN6G 1HXYD 3A7LA 3NQTA 3E0JA 3NE5B 4OO1G 2KCCA 4ZK9B 4TRDA 3NP8A 1G6ZA 4G7OC 2QF7A 1GHJA 3M7GA 1Q1EA 1D1IA 3PUVA 3MXUA 2F0EA 2WINB 4X3TA 1JB3A 1Z7TA 3OOCA 2Z4IA 2VB2X 4F8MA 3NXWA 2EYLA 2EYJA 1KAAA 5KNBA 2IT1A 5T1IA 2M2LA 3GTLB 2EOTA 4C3JB 3VA7A 2BCOA 4PNYA 1BF4A 4RGTA 4A3BB 1L0XB 1Z47A 3NTHA 2WKCA 4C56C 5CMDA 1JWMD 3UI2A 1SE4A 5IODA 1SYDA 3A54A 1ZYRD 1CA5A 1SYBA 4OGQC 1EY4A 5COYA 3DWAA 2EJGC 4PMCA 3VYSA 5C4ZA 2Z1CA 3I4MB 2B2WC 4KV6A 2IX0A 5EGTA 2XNAC 3SDZA 4I65A 3BYTB 1IYUA 2B39A 1V1OA 4K2LA 1SMYC 2VXWA 2AQ2B 1FNVA 4C2MB 4ZYSA 3HOVB 1Q12A 4B9XA 2F0HA 3PUZA 4UAIA 4IUNA 2JA8B 4KY7A 4DAPA 4BBRB 2KHSA 3WOEA 1WTVA 1HCZA 2SOBA 2A68C 4ZLTF 1A15A 1YNJC 1WTPA 3W2DA 2L55A 3K0YA 3T51B 1HUNA 2ICIA 2RVLA 3KLRA 1VCIA 4KN7C 3RUZA 3KBGA 3HKZB 1A2UA 4OIKA 2WAQB 2KVMA 2NVQB 2JEBI 4IZ8A 1G8ZD 3DHQA 5C5MA 1R4PB 1YNND 3FPUB 1AFPA 2B8FA 2PMZB 3D4DA 2IL8A 2FMMA 3J81L 3MTSA 2F0JA 3GD7A 1STHA 5CBAE 4DNTB 4PQXA 3RD4A 4N9PA 2A5HA 3J80L 1H9SA 1LTID 4FF2A 5DAUA 4XXEA 2HDMA 1I50B 3MXNA 2L4NA 4F7XA 1PYWD 1A3UA 1J9OA 1LTRD 3MFYA 1OXUA 4C3HG 3LNNA 4CJ0B 5CBEE 1I4PA 4QIWB 2A6EC 3PIP3 1G2SA 4CKEA 3NBHA 3NBIA 4QUFA 1LT3D 4KN4C 1H9SB 2L9HA 3E6ZX 1VMCA 3HOYB 1LTSD 1D5XC 2O5JC 1JOKA 2EXZA 4G4KA 3V96A 4JBWA 1DD2A 2AWNA 4XIGS 4L6TB 2NYZD 3T4AC 1I4RA 2KEEA 4TSSA 5AFWA 1RHPA 2B2VC 2G9HD 2E75C 3HRZC 1ZEQX 3RMHA 1MGSA 1HRJA 2A73B 2OF1A 4IUUA 2OT2A 5BN5A 5CV5A 1B53A 5FO9B 5G3LD 3QOJA 2L11A 4S3SA 3J7AV 1BO0A 3H3VC 3MWYW 1KABA 2MUYA 4O42A 2ID0A 4E6IA 1U4LA 1TWAB 5FOBB 1GOZA 1K8MA 4A3KB 4WRDA 1JWSD 5JAVA 1MD2D 2NBFA 3QJYA 5M5WB 2WP8J 3VYUA 2E76C 3GTJB 1R4QB 3HZXA 2WIIB 3DEPA 1SEBD 2F4IA 5HGTA 1AN8A 1HTPA 4RAUC 5ELCA 2JYOA 2RDFA 2R6GA 2EY6A 1EQVA 5IOCA 5C6AA 3I4NB 1SFOB 2K1BA 2I46A 4KKSA 5IIFA 4ME5A 5LL6X 3D4WA 5I2XA 4A93B 1B9MA 4KY6A 2F1MA 3MXGA 3PUWA 3J81E 2B2VA 3MXPA 3MC0B 2HCCA 1F9QA 5J1ZA 4FXGC 3NPPA 2F0GA 2CW0D 3TMEA 1TY2A 2E2JB 2ZXOA 4V190 1BBXC 3EFXD 1GUWA 2NN6H 4DF7A 4X3UA 1Q90A 5JOBA 1PRTB 4FF4A 1B50A 2K03A 1WTOA 1EU4A 2F0TA 4MHEA 1WTQA 1I4HA 1A3TA 2RDGA 2J4XA 4B08A 3A55A 2CQAA 3HOXB 5M9OA 2F0VA 1HFNA 3L9AX 3FPPA 5E4WC 1CZWA 1CA6A 3IFDA 2Z8LA 4YIJA 2BDNA 5C0XH 4QUCA 4IFDH 1EEID 2RKSA 5KRUA 3JAML 4OIJA 1LLRD 3IFTA 4R8IA 1FNWA 2DY8A 3I3CA 3I4LA 1EQTA 2K28A 2M9VA 3A7AB 1F9RA 4HCEA 4C3JG 1Z6HA 2BE5D 3SK5A 4IUTA 4UDUC 2B2TC 3ONAB 2RQXA 3GO5A 5TSSA 3IAYA 1DCZA 1SYCA 5FLXE 5IGBA 1STGA 4LAAA 3S15B 1WD1A 1HQRD 5C44B 5IT9L 2ZXPA 2A6HD 4H44C 1O7ZA 1TVXA 1PTOB 2VNUD 2MP1A 3C2PA 3VR5A 2XVSA 4HTHA 3KK7A 4DGZA 5JVG3 2F3WA 3A8IE 2QILA 1C8CA 3M7NA 3VYTA 2WV6D 4C1NI 2JEAI 5ELDA 1ZXTA 4K6DA 1Y8NB 2KA7A 1X32A 3BDOA 1LT4D 3RZOB 1EWCA 1LT5D 4RHRA 3KLSA 1QILA 2MGSA 3A8JE 1BR9A 1K8OA 3A8KE 5J39A 2F03A 3HGBA 3OIQA 3U9OA 1HQMC 2JXMB 3FMCA 3I73A 2F0LA 3GQBA 3R3OA 3K6OA 5KNDA 4KK7A 2D62A 2B2YC 1XTCD 5IGEA 5ELFA 4RKLA 1SNCA 3C1EA 2FFKB 1ML0D 1A2TA 1ESFA 3T56B 1LABA 3K7AB 3Q0AA 1PFBA 3D8GA 2O5IC 1EY7A 1O78A 2PPBC 1IYVA 2A69D 3CRKC 3I72A 1AP0A 5C3XA 3V2TA 2EY5A 4WORA 4HMIA 1QWYA 3I91A 3D3RA 1JOOA 2AWOA 1ET6A 3HOZB 3SVMA 4HSPA 2MHVA 5FO7B 3S1MB 2EYPA 3MAQA 3NTIA 1RF2D 1HUMA 3D6WA 2L0CA 2B2UC 5KNCA 3OHXC 2KQ3A 1QB5D 5C4XB 1SJHD 5CYUA 3K58A 3R93A 3S1NB 2F0SA 2GA4B 4KTAA 1WCMB 4RFBA 5IGGA 2ZXRA 1S5CD 2EPBA 1FNUA 4RA8A 4EQPA 1SNQA 3HEJA 2L5TA 4H0LC 4KJNA 1D5MC 5JEAJ 2XN9C 5C3EB 5C0XI 1PTOH 3MEHA 2HCIA 2RSOA 1BCPC 1I4GA 1T5XD 5KEEA 4BA1I 2F0MA 2NTSA 3H09A 2XRQD 4Q5VA 1CTMA 3LX0A 1EY9A 4EQNA 2LFNA 3FVQA 2N55A 4FYDA 4HCSA 2G9DA 3FDTA 1II3A 3CKIB 2N88A 3SR1A 5CR3A 4X3SA 1B1ZA 1V43A 4C3IB 3D4RA 1I4XA 1LTTD 1YNNC 3N6RA 4AYBB 2NWGA 1GUOA 1HA6A 5G3LF 3PUYA 3PO2B 1ZKOA 3K57A 1EEFD 2E2HB 3OPOA 1TS4A 2K5WA 1U4RA 1DONA 1OXVA 1UNSA 3F2UA 5ELEA 4G7ZC 2KECA 1STBA 2WACA 1KLGD 4RHSA 2X6LA 1SXTA 4MIUA 1EOTA 1PZID 3NQIA 2IJ0A 2D2CC 3VYRA 3WOFA 5CV6A 1SDFA 1XWEA 3BG3A 3S2HB 4J1MA 2H4OA 5M3MB 1E2VA 3OMCA 3K59A 3HOUB 5JPNC 1B4OA 4R9WA 5E4XA 2NVYB 3S9WA 4LMQD 1PRTF 1UUPA 4XQQA 3TP7A 4PMWA 4HN7A 5DEHA 4A3MB 4F88A 3E5SA 5I6YA 1OXSC 1SMYD 2B2WA 4IN3A 2C9OA 3TBIB 1ET9A 2XRSD 1W6KA 3C46A 2EYMA 2Y0SB 2F0UA 4ZUIA 1F9PA 1TIID 1CFMA 4TQUS 1F2ZA 4I7ZC 5JJZA 2K6AA 4MN3A 1B3AA 4KMUC 4FXKC 1EYDA 3FEWX 5BN4A 4O1NA 4FP5D 2PO4A 4M1UB 3J7AF 3S1QB 1IHZA 3EJIA 3OIPA 2SNSA 3TP6A 3S1RB 4K8JA 2ICEC 3OWFA 2NUCA 2R7ZB 2AQ3B 3C3LA 3BDCA 3R2TA 1TWCB 3AU7A 4FXDA 4XTCS 1DXMA 4BS9A 2XSCA 2F0WA 4XDXA 2F0OA 3S14B 1PTOF 5D3DA 1KNEA 4QB4A 2MPMA 1EY6A 2D5DA 5LHY1 1G91A 1QJOA 2BDOA 2CW0C 3X3MA 4BY7B 4CJ2C 4XQNA 3TP5A 2PZWA 1BNZA 1S5ED 3R2IA 1CM9A 1H9MA 1O7LA 2KOLA 2EVBA 1TR5A 3V05A 4OL7A 4EQOA 1WTWA 4WFN3 1EU3A 4K6LA 2OXPA 4L8JA 5EJWA 3K5MA 5JEAG 3LWEA 3TDQA 1QOHA 1RTOA 4FNFA 4NW2A 1PRTD 5CV4A 2E2DC 1SYFA 1CHQD 3EVQA 3LWUA 3OW7A 1IKMA 1ONLA 2PQEA 4RGOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1I A;  1B3A A;  4X3U A;  1B53 A;  1HUM A;  1U4R A;  3D6W A;  3N52 A;  4OIK A;  5EPJ A;  1WVL A;  1DON A;  2NZ1 D;  2KVM A;  2L11 A;  2M2L A;  5EKI A;  1B50 A;  1BO0 A;  2B2U C;  2FHT A;  2K03 A;  3GV3 A;  5EPL A;  5T1G A;  3F2U A;  4ZKC B;  1WTO A;  3MWY W;  2EOT A;  2KED A;  4MHE A;  4CJ1 B;  2KEC A;  4O42 A;  1WTQ A;  1EL0 A;  1U4L A;  1QG7 A;  1C8C A;  2X6L A;  1X3P A;  2X6G A;  4IUQ A;  3FPU B;  3DM1 A;  1DZ1 A;  1BF4 A;  1ILQ A;  4ZKB B;  1QE6 A;  1EOT A;  4ZAI A;  1NR4 A;  1DOM A;  2D9U A;  2IL8 A;  4RWS C;  3R93 A;  3TZD A;  3G7L A;  2FMM A;  4IUR A;  1IKL A;  4IUP A;  1ZXT A;  3MTS A;  2X69 A;  1HFN A;  1QNK A;  5CMD A;  1O7Y A;  1XX8 A;  3UI2 A;  1VMP A;  1WTR A;  2B2U A;  2JP1 A;  2R3Z A;  4XT1 B;  1SDF A;  4DN4 M;  2Q8R E;  1X32 A;  5CBA E;  1CA5 A;  2EPB A;  4RA8 A;  2RA4 A;  1O80 A;  1ESR A;  5COR A;  5E4W C;  5COY A;  1EIG A;  1X3Q A;  1CA6 A;  3TN2 A;  2K01 A;  3IFD A;  3I90 A;  3Q6S A;  1F2L A;  3DEP A;  1M8A A;  2BDN A;  2MGS A;  4QUC A;  1SAP A;  4X3K A;  1ILP A;  3H91 A;  1NR2 A;  2HCI A;  5D65 A;  1AZQ A;  1IL8 A;  1PDQ A;  2RSO A;  4XDX A;  2HDM A;  1KNA A;  1E0B A;  2L1B A;  5DNF A;  2B2W C;  1U4M A;  2FJ2 A;  4OIJ A;  2L4N A;  1B4O A;  1PLF A;  2HDL A;  4R9W A;  2KUM A;  5E4X A;  2K04 A;  1ICW A;  4R8I A;  1J9O A;  1KNE A;  1NCV A;  2DY8 A;  4LMQ D;  3GV6 A;  4IUV A;  1G2T A;  2MPM A;  3I3C A;  4RAU C;  4CJ0 B;  5CBE E;  1EQT A;  2JYO A;  1MSH A;  4HAE A;  5D14 A;  2L12 A;  2K28 A;  1WTX A;  1F9S A;  1G91 A;  1G2S A;  1J8I A;  1F9R A;  4QUF A;  2B2Y C;  1DOL A;  1HHV A;  1JE4 A;  1DOK A;  2FIN B;  2K05 A;  3KBX A;  2B2W A;  3IL8 A;  2VXW A;  2FFK B;  2K1B A;  2L9H A;  1MSG A;  2N55 A;  1ML0 D;  4CJ2 C;  2HUG A;  2H1E A;  1VMC A;  1Q3L A;  4HCS A;  1LV9 A;  1PFB A;  1U4P A;  1BNZ A;  3FDT A;  4U68 A;  4XT3 B;  4ZK9 B;  4HSV A;  4IUT A;  1CM9 A;  1WD0 A;  2N88 A;  2B2T C;  3DEO A;  1MI2 A;  3ONA B;  4UAI A;  1HFG A;  2KOL A;  2RSN A;  1G6Z A;  1WTW A;  5EPK A;  2NYZ D;  2B2Y A;  1AP0 A;  2B2V A;  2KEE A;  2SDF A;  1ROD A;  2MJ8 A;  1PFM A;  3I8Z A;  5EJW A;  2HCC A;  1F9Q A;  3QO2 A;  4X3S A;  1NAP A;  5AFW A;  1WTV A;  2EE1 A;  1SSO A;  3LWE A;  3HP3 A;  2CVR A;  1B2T A;  4X3T A;  1RHP A;  1A15 A;  1RTO A;  1S4Z A;  2B2V C;  2J7Z A;  3I91 A;  2Q8T A;  4ZLT F;  1WD1 A;  4NW2 A;  1WTP A;  2NWG A;  1AZP A;  1HA6 A;  1F9P A;  1PFN A;  2B2T A;  2XIW A;  1MGS A;  5EQ0 A;  1HUN A;  3SVM A;  4MN3 A;  3KUP A;  1O7Z A;  1RJT A;  1IKM A;  4HED A;  2RVL A;  1HRJ A;  5JJZ A;  3P7J A;  1BBX C;  1XYI A;  1GUW A;  4IUU A;  1TVX A;  1EIH A;  1RTN A;  1JIC A;  2DY7 A;  2MP1 A; 
#chains in the Genus database with same CATH topology
 1T9H A;  4A3D H;  4ALP A;  2DNC A;  5CC4 A;  2F0I A;  1H9K A;  5T1G A;  1KDA A;  4RGM A;  1TXY A;  4PZ6 A;  2HQL A;  2PZU A;  1SNM A;  3GTM H;  1BUV T;  4B3T Q;  1BQQ T;  5IGD A;  4JI2 L;  1HPC A;  5JJK A;  1DZ1 A;  1ICF B;  4KHZ A;  4R4I A;  4IPH A;  3GTK B;  2IX3 A;  2WKD A;  2EYH A;  3J80 E;  2JA7 H;  5CGK A;  3OTO L;  1QNK A;  1O7Y A;  5NUC A;  1VMP A;  3ND8 A;  4XT1 B;  5IT9 c;  5C0X J;  2YTY A;  5FO8 B;  2Q8R E;  1KDB A;  3EN2 A;  3D31 A;  1D1K A;  1O80 A;  4RCO A;  4OO1 H;  1ESR A;  1B44 D;  2CHB D;  2I07 B;  1EIG A;  4Y7N B;  3P1H A;  3TSS A;  3BVG A;  1F2L A;  3STB D;  1XNR Q;  1Q7Y C;  1GUN A;  4Z9C B;  4JI8 Q;  5HGQ A;  2PNR C;  3HOZ G;  1HA5 A;  1N33 Q;  1TY0 A;  4X65 Q;  4YY3 L;  4RG1 A;  1XPO A;  5DNF A;  3GTO B;  1KQS A;  5A2Q L;  1Z9F A;  4P75 A;  2IX1 A;  1G2T A;  2RDH A;  3G6J B;  1X3G A;  3CCS A;  1MSH A;  4HAE A;  4KD3 A;  1F9S A;  2VQF Q;  5C4H A;  2ASB A;  3NHH A;  3I70 A;  4QCL A;  3IRB A;  5BR8 L;  4R4O A;  1PXU A;  1SR3 A;  5C4X G;  1K28 A;  2FIN B;  3S16 B;  2F0N A;  3Q24 A;  4G57 A;  5EBD A;  4LNQ A;  5E1F A;  1FR3 A;  1EY8 A;  1MKH A;  2A6H C;  3TP8 A;  2R7Z H;  1E2W A;  1U4P A;  5HY6 A;  1STE A;  5IGC A;  4MNO A;  1Q1B A;  5DM7 3;  3DEO A;  3M4P A;  2RSN A;  4DUY Q;  4LJZ C;  4C3H B;  4GLA C;  5I9O A;  1TS2 A;  1D5Z C;  3U58 A;  4JYA L;  1J5E Q;  1LTG D;  2PW7 A;  3P75 A;  2SNM A;  4GOP A;  4IPC A;  1PTO D;  2XWJ B;  1Y1V B;  4DK1 A;  2J7Z A;  3NUC A;  2R61 A;  3S17 H;  1C9O A;  5IP7 G;  1PFN A;  2XIW A;  4X66 Q;  2EY1 A;  4FVM A;  1SNP A;  5EQ0 A;  4KD4 A;  1RJT A;  4WJW A;  1XYI A;  3PIO 3;  1R9T H;  3UE0 A;  4DU9 A;  3NWT A;  3F1Z A;  1KIX A;  2HHH L;  1JE5 A;  3KDF B;  4ZKC B;  3PQI A;  3SK6 A;  2KED A;  2HT1 A;  5EKK A;  1EL0 A;  1I94 Q;  1Y8O B;  1Y8P B;  2EDG A;  3MA2 B;  4LUV A;  1QE6 A;  3I4M G;  3T1Y Q;  4DXG A;  4ZAI A;  4EGV A;  2R92 B;  4LF6 Q;  3M9B A;  4B3S L;  3EQL C;  4A3G H;  2KEN A;  3IKJ A;  2WB1 B;  5IYD G;  3UDG A;  3T16 A;  1D2B A;  1U0L A;  2AUJ D;  4C3I G;  1YIJ A;  2JA6 H;  2VB3 X;  4ZQ3 A;  1AW7 A;  1X3Q A;  3CXC A;  3PMF A;  4AYB G;  1Y1W H;  1IW7 D;  3B6Y A;  3VA5 A;  1KNA A;  1S5B D;  2K52 A;  3SEB A;  3TRZ A;  2DJF C;  1JQY D;  2BA1 A;  1GUG A;  4CDE C;  2E2I B;  2FMC A;  2JA8 G;  4HMJ A;  5M3F B;  4DAV A;  2OQ0 A;  3K5O A;  2R93 B;  2UU9 Q;  1W3S A;  5C5L A;  5HUR A;  3A56 A;  2IWH A;  1SMX A;  2EJF C;  2NVX H;  1D8L A;  4JV5 Q;  5K36 G;  4GN3 B;  1DOK A;  4FF1 A;  2NTT A;  2R7D A;  1RD9 D;  1CKN A;  1H9J A;  4DV5 Q;  2H1E A;  3Q22 A;  3M4O B;  1VF5 C;  1Q3L A;  3BDL A;  2B8G A;  3SHL A;  3W3A A;  4XYO A;  4RH6 A;  4A3F B;  1OO9 B;  1HFG A;  1UWV A;  2F0D A;  2O2L D;  3GTQ B;  3GTG B;  4JI4 L;  3HKZ G;  1ASZ A;  1N9W A;  5EKL A;  1BXT A;  3O13 A;  3S2D H;  1TS3 A;  1JR0 D;  5FLM G;  5M3M G;  3BVZ A;  5ISR A;  5DM6 3;  1C48 A;  1VQI A;  1CKN B;  1PZJ D;  5I2Y A;  3GTP B;  4B3M Q;  5CV8 A;  1V1P A;  4A3J B;  2B2T A;  4JVZ A;  2K5Q A;  1IYJ B;  1DJR D;  3PF4 A;  1C4Q A;  2K50 A;  3PO3 B;  2N78 A;  1NSN S;  4YHH Q;  1UEA B;  3MVV A;  1I6V C;  2A74 C;  2DY7 A;  1TU2 B;  4L63 B;  1XJV A;  4RGN A;  1IXR A;  4ME3 A;  2JA5 H;  2EYO A;  4H13 C;  2QKI C;  3SK8 A;  2UXD L;  1N8R C;  1CT1 D;  1M1K C;  3KJO A;  1V1P B;  2QDL A;  1GHK A;  4DR1 Q;  4UY8 C;  2OEO A;  2NZH A;  2X69 A;  3A5Z B;  2E5L L;  1EZ8 A;  2R3Z A;  2NN6 I;  3JAM E;  3AYH B;  4KY5 A;  4DN4 M;  4X62 L;  3K0X A;  1CK1 A;  1ZYR C;  3FKI H;  3ND9 A;  4B9W A;  4OO1 I;  1Q46 A;  5LMU Q;  2Y0S G;  3BVM A;  2Z9H A;  3CCU A;  4J6H A;  1E7Z A;  1X54 A;  1HZA A;  4ODG A;  2K5N A;  4R4Q A;  3HOY G;  4FO2 A;  2KUM A;  2HD3 A;  1PH3 A;  4GKK L;  3I2Z A;  3I7F A;  2E8G A;  5KIX A;  4JI7 L;  4IUV A;  2KCN A;  5I9P A;  1A3V A;  2UXB L;  4J8Q A;  3VR6 A;  3OMG A;  1B7Y B;  3NWS A;  3SK4 A;  2B63 H;  1F2M A;  1OXX K;  1V1Q A;  4K5W A;  4IFD I;  1LT6 D;  4P2C B;  2NB0 A;  1OXT A;  2SEB D;  3QOL A;  4XT3 B;  4A3E H;  1WD0 A;  4JI0 L;  3U4Z A;  3CCV A;  5IT9 E;  5C0X G;  4IFD G;  2TSS A;  5EPK A;  2B2Y A;  1YHB A;  2SDF A;  1TWG H;  4HJ8 A;  1VDZ A;  5GQO A;  2PW5 A;  2M00 A;  4KI0 A;  3CMA A;  5M5X B;  2NVT B;  4BY1 B;  2K14 A;  2CFM A;  3OWE B;  3HOW B;  1AZP A;  1SJE D;  2RHQ B;  2Z4H A;  1L0Y B;  2CWP A;  5IY0 A;  5M5Y B;  1CZG A;  2XWB B;  3W1B A;  5C4J H;  4A3K G;  2R93 H;  5IWA L;  3H0G B;  2DJG C;  2Z6K A;  1EIH A;  1YVC A;  1RTN A;  2LY7 A;  4EX5 A;  3AFP A;  3K5N A;  3RZD B;  1JWU D;  3P20 A;  2VUM B;  4EQ5 A;  3EBE A;  2NZ1 D;  1KDC A;  3AFQ A;  4DV1 Q;  2J0T D;  4M8A A;  1KXL A;  1XMO Q;  1N36 L;  1HTL D;  4KHV A;  1VQB A;  2X6G A;  4IUQ A;  3DM1 A;  2QCP X;  3T13 A;  1HJP A;  2JJQ A;  4ULL A;  1AEX A;  3OYY A;  4RWS C;  2D9U A;  3G7L A;  1VQ5 A;  1VS0 A;  5JEA H;  4ID6 A;  2K32 A;  4LW1 A;  2B2U A;  3WWV A;  3F8T A;  4A3I B;  4P73 A;  1SRU A;  4A3J H;  1Q8I A;  2DUD A;  2K33 A;  2K5D A;  3ITP A;  4QMG A;  4DR2 L;  1K83 B;  3VR4 A;  3I4N G;  4DK6 C;  1TWH B;  4KHP Q;  4LF8 L;  3QIA A;  3I90 A;  4B3R Q;  1M8A A;  4IQZ A;  4DAY A;  1NNX A;  4CDC C;  1BCP D;  4NPS A;  1EWH A;  2KHI A;  4ZRZ A;  2LS0 1;  2I5L X;  3NEM A;  4AIM A;  2YU9 H;  1TWF B;  4PZ7 A;  3CQZ B;  4G7H C;  1UEB A;  4KKU A;  4DV0 Q;  1J8I A;  2WFW A;  1I3Q B;  3GP7 A;  2KCT A;  3ICE A;  1SLJ A;  4DAY B;  1X6O A;  2EJM A;  3T53 B;  1QNU A;  2LMC B;  2F0F A;  1LV9 A;  1VQ7 A;  2MO0 A;  1CQF A;  1PYS B;  2KBN A;  4JI2 Q;  1E22 A;  1XMQ L;  4ILW A;  4H7B A;  1YJ9 A;  1GD7 A;  4BBS B;  5K5P A;  1X3E A;  1SND A;  3I8Z A;  2KCM A;  3QO2 A;  1NAP A;  5JVH 3;  1ENA A;  2EE1 A;  1RCV D;  3ZYY X;  1BCP B;  3KF8 A;  4JBJ A;  3L7Z C;  3EA6 A;  3CCQ A;  1BOS A;  4EVO A;  3TZU A;  1F77 A;  1NUC A;  4A3D B;  4GZY C;  2BH8 A;  4FF3 A;  1XPU A;  1UAP A;  4TVA B;  3HOX G;  5JPM C;  1EZ6 A;  4DR3 L;  3GTM B;  4C1N K;  1SE2 A;  4DV7 L;  3J81 i;  1CHP D;  2O4X A;  3N52 A;  1JCK B;  5EKI A;  4LFB Q;  3ERO A;  2JA7 B;  5FLX c;  5F2D A;  1CQV A;  1WFQ A;  1FD7 D;  2A68 D;  3UE1 A;  1YNJ D;  2Q2I A;  1ILQ A;  4ZKB B;  1MJE A;  3R8B A;  1I6H B;  1DM0 B;  4GNX B;  1IKL A;  2DN8 A;  2AQ1 B;  3GTL H;  4BWG B;  1CSQ A;  4C3J H;  1XX8 A;  2Q8I B;  1MHW C;  5KYI A;  3QB3 A;  4DAM A;  5IP7 H;  3OSO A;  2QA4 A;  1E2Z A;  3LGJ A;  2RF4 A;  4A3B H;  2RHS B;  5COR A;  3L0O A;  3H0G H;  4XQJ A;  1TKW B;  4JYA Q;  1NR2 A;  1DGS A;  4K5X A;  5KYL A;  3D6C A;  1EYC A;  2K04 A;  1ICW A;  1W6J A;  1NCV A;  4A3L H;  3GV6 A;  1T5E A;  2P5Z X;  3WDN A;  3PIO A;  2YYZ A;  4DUZ L;  1AE3 A;  4BA2 I;  4ABN A;  1WTX A;  4CGY B;  2QEX A;  4JI6 Q;  1FGU A;  4QY7 A;  3L2P A;  4CBV A;  1LTA D;  4POG A;  1PV4 A;  1KLU D;  1PRT C;  3IL8 A;  1LAC A;  5IYD H;  2HUG A;  4UP7 A;  1HH2 P;  2UUB Q;  4CHT B;  3RLF A;  3DWP A;  4U68 A;  3J7A 5;  2F3V A;  3PCO B;  1MI2 A;  1TT2 A;  3UDI A;  2WB1 G;  3VR3 A;  3S17 B;  2MJ8 A;  3U4V A;  1EFI D;  4V0B A;  4C2M H;  4X64 L;  3HOV H;  2V4D A;  2A6E D;  3ZJY C;  1SSO A;  1K0R A;  3K5L A;  1J6Q A;  2CVR A;  4DR7 L;  1B2T A;  3AQQ A;  4JI5 Q;  1ILP A;  1R9T B;  2Q8T A;  1SBB B;  2ZM6 L;  4DR5 L;  1TWF H;  4BBR H;  2QDB A;  1XNQ L;  4AQY Q;  1EY0 A;  4DFA A;  2ENB A;  1LTB D;  4LF5 L;  4K2K A;  5K36 H;  3P7J A;  4KKT A;  5ELB A;  1ENF A;  4DKA C;  3T1H L;  1F2Y A;  2Q2H A;  1EOV A;  1JIC A;  1HHV A;  5FLX L;  1KL9 A;  1NE3 A;  4OON A;  5M3F G;  3BS1 A;  1RDP D;  5EPJ A;  4Q0F A;  1GM5 A;  2FHT A;  3GV3 A;  4DXF A;  5KGU A;  1EFW A;  1PFS A;  3STB C;  4A3G B;  1QG7 A;  1X3P A;  3RLO A;  4N9T A;  3K80 C;  3J7Y W;  4BBS H;  1P8L A;  5FK9 C;  3SE0 A;  1HR0 L;  4K14 A;  2JA6 B;  3ER0 A;  2EYF A;  4A3F G;  3C1F A;  1Y1W B;  3E9H A;  1FJG L;  2JP1 A;  4NP5 A;  1Y69 U;  1KTK A;  2A8V A;  3ERQ A;  3F2C A;  4LF9 L;  2LKV A;  1SYG A;  3A74 A;  4JI4 Q;  2K5V A;  1FGB D;  1A0I A;  3M4Y A;  4X3K A;  1VQ9 A;  3H91 A;  4N8X 1;  1XXG A;  1AZQ A;  1QUQ B;  1PDQ A;  2L1B A;  2TMP A;  2EZV A;  2NVX B;  3BYY B;  2FJ2 A;  2HDL A;  1PZK D;  3PO3 G;  1RKN A;  4LF4 Q;  2F0P A;  4F87 A;  1A8V A;  3EIV A;  3MHB A;  1VQC A;  4IFD J;  4DA2 A;  4O0A A;  1YI2 A;  2L12 A;  2BOS A;  1I50 H;  1PTO C;  1I6H H;  1WTH A;  3PV0 A;  2BE5 C;  3KBX A;  2F4V L;  5J22 A;  2IW3 A;  4LWC A;  1FYC A;  4HIK A;  3H94 A;  1B9N A;  5L37 A;  3X3N A;  3AMU A;  3S2D B;  3A5U A;  2E74 C;  4K5V A;  4U67 3;  4HSV A;  3ERS X;  3CC2 A;  4IAL A;  5GRO A;  3E9I A;  2HQE A;  5E3F A;  4YCU A;  1HZ9 A;  3DWQ A;  4RKB A;  5A35 A;  1ROD A;  3KLS X;  4DV3 Q;  1GUS A;  3G6E A;  3HOY H;  1NJI C;  1STN A;  2E5L Q;  1UE7 A;  3PGZ A;  3D0F A;  3SGI A;  4YWM A;  5BN3 A;  4DK0 A;  4NKL A;  5I4D A;  3AEV A;  2F3I A;  1LO5 D;  3TEH B;  2JE6 I;  3F2B A;  4A4I A;  4YWK A;  3AB9 A;  2JA5 B;  3KUP A;  3FP9 A;  1A62 A;  5LMN L;  2KJX A;  2VW9 A;  2UUA L;  4NXM L;  2L15 A;  2F0Q A;  1WCM G;  3TZD A;  1H95 A;  3L3O C;  1E1T A;  1V8Q A;  1VQ6 A;  4GKK Q;  1STY A;  1MBY A;  4OHJ A;  1SNO A;  3NSW A;  4NMZ A;  4JK1 C;  2ATW A;  1OTC A;  5C3E G;  3CRL C;  1IW7 C;  3ULP A;  2Q2T A;  4HR7 B;  1SYE A;  4K8I A;  3HFZ B;  1JOQ A;  3FKI B;  3QWN A;  3MFG A;  1U5K A;  5I6W A;  5IGF A;  4KJO A;  1PH4 A;  4JOI C;  4PV1 C;  1V9P A;  1QVF A;  1GUT A;  4L5S A;  3CCJ A;  4K0K Q;  2BA0 A;  4HID A;  1TQO A;  1HNZ L;  1TWA H;  3NEN A;  1N34 L;  4JI0 Q;  1VQE A;  4A3K H;  2RA4 A;  4LK1 C;  4GOP B;  1YHQ A;  4POF A;  2K01 A;  2QEJ C;  3CCE A;  1O7I A;  4BY1 G;  3CCR A;  1S40 A;  3HOW G;  1PMR A;  1JC7 A;  5M5W H;  1SN8 A;  3FRP B;  5D65 A;  1M4V A;  1GXD C;  2JSO A;  2B3G A;  1D6E C;  1U4M A;  3GTJ H;  1PLF A;  1Q86 C;  1IBL L;  2ZJR A;  3DUZ A;  4BXX G;  1DYQ A;  2C5C A;  3H15 A;  3MZ5 A;  2B63 B;  1AE2 A;  3CHB D;  4TKO B;  2K7V A;  5GAH C;  3CAM A;  4L5Q A;  1HNX Q;  5EBC A;  4A3E B;  3M85 A;  1JE4 A;  4CKC A;  5CV9 A;  3H6M A;  1KC8 C;  1MSG A;  5CV7 A;  1YHA A;  4ZUJ A;  1JOR A;  1WOC A;  1TWG B;  2K4K A;  3PO2 G;  4CKB A;  2MNA A;  3HG9 A;  3I4N H;  2UUC L;  1N36 Q;  5EAY A;  2A69 C;  1EQQ A;  1SFO H;  5FKA C;  2RBM A;  1EYA A;  1PFM A;  5C4J B;  1H9R A;  3HP3 A;  4LFC Q;  2GN5 A;  1S4Z A;  4A93 H;  4CDF C;  3PUX A;  1HZB A;  1ENC A;  4OX9 L;  4LF8 Q;  4HED A;  1I4Q A;  4OWW B;  4DV4 Q;  4GKJ L;  5C3W A;  4KLK A;  1U9R A;  4RGO S;  2F0K A;  1CI3 M;  2WAQ E;  1WVL A;  1QCB D;  1S5D D;  3PF5 A;  3W5O A;  2PCF B;  5EPL A;  1BDO A;  2E2J H;  4YCW A;  1TS5 A;  4CJ1 B;  3Q23 A;  3BZD B;  3HS0 C;  4NDX A;  3URY A;  3HOU G;  2PMZ E;  1NMF A;  4RCN A;  3CU7 A;  3QG1 A;  1NR4 A;  1DOM A;  3NK9 A;  4IUR A;  2OTJ A;  3RN5 A;  4IUP A;  2DNE A;  3NTK A;  2IPK D;  1WTR A;  1PHJ A;  4R8N A;  1EY5 A;  2AUK A;  3DXJ C;  5A2Q E;  1BCP F;  1A6X A;  4A3M G;  2PYK A;  3HOX H;  5IP9 H;  1S5F D;  3KLW A;  4XYQ A;  3TN2 A;  1YEZ A;  4QF4 A;  2YU9 B;  3Q6S A;  3M3Y B;  1VF7 A;  2ZT9 C;  4PMB A;  1SAP A;  1GVP A;  4A3D G;  1IL8 A;  1GJX A;  2PZT A;  3A0J A;  1K8G A;  1E0B A;  2EY2 A;  5LL6 S;  1SE3 A;  2OQK A;  1RIP A;  5JJI A;  4DNR B;  2JN4 A;  5D3I B;  4QIW E;  4LFA Q;  3VR2 A;  5D14 A;  1G29 1;  4PG3 A;  1STA A;  2MO1 A;  3U9S A;  2JA7 G;  4UHV A;  1B8A A;  4DV7 Q;  3SXH A;  1DOL A;  1JJ2 A;  2K05 A;  3DMU A;  2NN6 G;  1HXY D;  3A7L A;  3NQT A;  2YV5 A;  2EXD A;  3E0J A;  3NE5 B;  4OO1 G;  4PZ8 A;  2KCC A;  4ZK9 B;  3CW2 C;  4TRD A;  3NP8 A;  2N8N A;  1G6Z A;  2QGQ A;  4G7O C;  2QF7 A;  1GHJ A;  3M7G A;  1Q1E A;  1D1I A;  3PUV A;  3MXU A;  2F0E A;  2WIN B;  4X3T A;  4A3C H;  3I56 A;  1JB3 A;  1JJC B;  1Z7T A;  1Q81 C;  1E3P A;  4P72 A;  3OOC A;  4DPG A;  2Z4I A;  2JQO A;  2VB2 X;  3ULJ A;  4F8M A;  3NXW A;  4I7A A;  2EYL A;  2EYJ A;  3S15 H;  1KAA A;  5KNB A;  2IT1 A;  5T1I A;  5C44 H;  4DV6 L;  2R7Z G;  4LUZ A;  4X66 L;  2M2L A;  3GTL B;  2EOT A;  1X9N A;  4C3J B;  3VA7 A;  4DUZ Q;  2BCO A;  4PNY A;  1SE8 A;  1BF4 A;  1K3R A;  4RGT A;  4A3B B;  1L0X B;  1Z47 A;  4GLX A;  3NTH A;  2WKC A;  4C56 C;  1JJG A;  5CMD A;  4IPG A;  1JWM D;  3UI2 A;  1SE4 A;  2GVA A;  1PVO A;  5IOD A;  1SYD A;  3A54 A;  1ZYR D;  1CA5 A;  3J81 c;  1SYB A;  4OGQ C;  1EY4 A;  3T1Y L;  5COY A;  5IYC G;  2CH4 A;  3DWA A;  1K0S A;  2EJG C;  2HIX A;  4PMC A;  3VYS A;  5C4Z A;  4BY7 G;  3G4S A;  2Z1C A;  4X64 Q;  4QJF A;  3I4M B;  3J81 j;  4IO9 A;  1VQ8 A;  2B2W C;  4DR7 Q;  2I0Q A;  3RZO H;  4KV6 A;  2ZM6 Q;  2IX0 A;  2ALY B;  5FJ8 H;  1HZC A;  4DR5 Q;  4LUO A;  5EGT A;  1XNQ Q;  2CH4 W;  2XNA C;  3SDZ A;  2JA9 A;  4I65 A;  3DM3 A;  3BYT B;  1IYU A;  4LF5 Q;  4MTK A;  3U50 C;  2B39 A;  1V1O A;  3I4O A;  3T1H Q;  4K2L A;  1SMY C;  2VXW A;  1KAW A;  1S72 A;  2AQ2 B;  1FNV A;  4C2M B;  4ZYS A;  3HOV B;  2UU9 L;  1Q12 A;  4B9X A;  4JI3 L;  2F0H A;  1CKM A;  1CUK A;  3PUZ A;  4JI1 Q;  4UAI A;  1L1O C;  3KJP A;  4IUN A;  2JA8 B;  2OCE A;  4KY7 A;  4DAP A;  4BBR B;  3M3Y H;  2KHS A;  4UP8 A;  3K7A H;  3WOE A;  1WTV A;  2EIF A;  1HCZ A;  3CP0 A;  2SOB A;  2YTX A;  2A68 C;  1A15 A;  4ZLT F;  1YNJ C;  1WTP A;  3W2D A;  2L55 A;  2MFI A;  3K0Y A;  4LF9 Q;  3T51 B;  1HUN A;  5H1S E;  2ICI A;  4APV A;  2RVL A;  3KLR A;  1VCI A;  4KN7 C;  3RUZ A;  1UE1 A;  1PH8 A;  3RLN A;  3KBG A;  3HKZ B;  3TS0 A;  1A2U A;  4OIK A;  3HOZ H;  2WAQ B;  2KVM A;  4AH6 A;  2NVQ B;  2JEB I;  4IZ8 A;  1YJW A;  4GS3 A;  1G8Z D;  2JK8 A;  3OTO Q;  3DHQ A;  5C5M A;  2ZJQ A;  3M4Q A;  1WJJ A;  2A1A A;  3BZK A;  1R4P B;  1YNN D;  1WI5 A;  1VQK A;  3FPU B;  1AFP A;  2B8F A;  2PMZ B;  3D4D A;  2IL8 A;  2FMM A;  3UDX A;  3J81 L;  2F4V Q;  3MTS A;  1X56 A;  5C4X H;  1VQP A;  2F0J A;  3GD7 A;  1STH A;  2UXC L;  5AJ3 L;  4LF7 L;  4YY3 Q;  5CBA E;  4DNT B;  4NB3 A;  4NXN L;  1EIY B;  4DR1 L;  3S1N H;  3KF8 B;  4PQX A;  3RD4 A;  4N9P A;  4QQB X;  2A5H A;  3J80 L;  1H9S A;  4IJH A;  2RCN A;  1LTI D;  4OWT B;  2I5M X;  4FF2 A;  5DAU A;  4XXE A;  2HDM A;  1I50 B;  3MXN A;  3J80 i;  5BR8 Q;  2L4N A;  4F7X A;  1PYW D;  1A3U A;  5LMU L;  1J9O A;  1X55 A;  2ZTE A;  3MFY A;  1LTR D;  1OXU A;  4C3H G;  3LNN A;  4OEL B;  5C3E H;  4CJ0 B;  5CBE E;  1I4P A;  3W1G A;  3G71 A;  2XTI A;  4QIW B;  2A6E C;  2OTL A;  3PIP 3;  1D7Q A;  4HJ7 A;  1G2S A;  4CKE A;  3NBH A;  3NBI A;  2UUA Q;  4QUF A;  1LT3 D;  1Y1V G;  4KN4 C;  2N49 A;  2VQE L;  1H9S B;  1G6P A;  2L9H A;  3E6Z X;  1VMC A;  3HOY B;  1LTS D;  1D5X C;  2O5J C;  1EQR A;  1JOK A;  2EXZ A;  4G4K A;  2DGY A;  3V96 A;  1HNW L;  4JBW A;  1DD2 A;  3K81 C;  2AWN A;  4XIG S;  4L6T B;  1QZG A;  2NYZ D;  3T4A C;  1I4R A;  2KEE A;  3CPW A;  3I4M H;  4TSS A;  3FHW A;  5AFW A;  1FL0 A;  1RHP A;  4BXX H;  2B2V C;  2G9H D;  2E75 C;  3HRZ C;  1HNZ Q;  1N34 Q;  1ZEQ X;  3RMH A;  4FDB A;  2HHH Q;  1MGS A;  1C0A A;  2R92 G;  4C3I H;  1HRJ A;  2A73 B;  2OF1 A;  1BBU A;  4IUU A;  2OT2 A;  5BN5 A;  5CV5 A;  1XTD A;  1B53 A;  5FO9 B;  5G3L D;  1PA6 A;  3QOJ A;  2L11 A;  4S3S A;  3PO2 H;  3J7A V;  1BO0 A;  3H3V C;  1X3F A;  3MWY W;  1KAB A;  2E2H H;  4B3S Q;  2MUY A;  4O42 A;  2ID0 A;  4E6I A;  1U4L A;  5E7N A;  2JA8 H;  1TWA B;  5FOB B;  1Q82 C;  1GOZ A;  1K8M A;  4A3K B;  1IBM L;  1BVS A;  1LUZ A;  4WRD A;  4JBK A;  1JWS D;  1L2F A;  5JAV A;  1UE6 A;  1MD2 D;  4WJ3 M;  2NBF A;  3QJY A;  5M5W B;  4P71 A;  2WP8 J;  3VYU A;  2E76 C;  2R93 G;  2UUC Q;  3CC4 A;  3GTJ B;  2VY3 A;  1K8A C;  1R4Q B;  3HZX A;  2WII B;  3DEP A;  1SEB D;  2F4I A;  4ZCK A;  5FLM H;  2NVQ H;  5M3M H;  1IBK L;  5HGT A;  1AN8 A;  1VQH A;  1HTP A;  4KHP L;  3BU2 A;  4RAU C;  5ELC A;  4B3R L;  1WYD A;  2JYO A;  3HOU H;  3JAM c;  2RDF A;  2XGT A;  4OX9 Q;  4A76 A;  2R6G A;  2EY6 A;  1EQV A;  5IOC A;  5C6A A;  2B29 A;  1K3B C;  3I4N B;  1VQA A;  1SFO B;  2K1B A;  2I46 A;  4KKS A;  1VQO A;  1YJN A;  5IIF A;  4ME5 A;  4A3J G;  5LL6 X;  4A3M H;  3D4W A;  5I2X A;  4A93 B;  1B9M A;  2G5D A;  4KY6 A;  4OEM B;  2F1M A;  3MXG A;  3PUW A;  3J81 E;  2B2V A;  3MXP A;  3MC0 B;  2HCC A;  1F9Q A;  5J1Z A;  4FXG C;  3NPP A;  3I55 A;  2D0P A;  2F0G A;  2CW0 D;  5ELO A;  4N8F A;  3JC6 6;  3TME A;  1TY2 A;  2UXD Q;  2E2J B;  1VQJ A;  2ZXO A;  2LSS A;  4V19 0;  1BBX C;  3EFX D;  1GUW A;  2NN6 H;  4DF7 A;  1VQF A;  3KOJ A;  4X3U A;  1Q90 A;  5JOB A;  1PRT B;  3G48 A;  3RN2 A;  4FF4 A;  2N3S A;  1B50 A;  1NMG A;  2K03 A;  1WTO A;  1EU4 A;  2F0T A;  4MHE A;  1WTQ A;  1QZH A;  1I4H A;  2Z6B A;  1A3T A;  2RDG A;  2J4X A;  4B08 A;  4X62 Q;  3A55 A;  2CQA A;  1LYL A;  1VQG A;  3CCM A;  4LFB L;  3HOX B;  4DR6 L;  5M9O A;  2F0V A;  1HFN A;  2VZA A;  5GAE C;  3L9A X;  3FPP A;  4GLV B;  3S1Q H;  5E4W C;  1CZW A;  2H5X A;  1CA6 A;  3IFD A;  4JI7 Q;  3S1R H;  3S24 A;  2Z8L A;  3GDE A;  2BDN A;  4YIJ A;  5C0X H;  4QUC A;  2UXB Q;  4IFD H;  1EEI D;  1GO3 E;  2RKS A;  5KRU A;  4IOC A;  3JAM L;  4OIJ A;  1TWC H;  4P74 A;  3RR5 A;  5IYB G;  1AH9 A;  3E0E A;  1LLR D;  3IFT A;  4R8I A;  4DNI A;  1FNW A;  2DY8 A;  3JAM i;  3J7Z C;  3I3C A;  3I4L A;  1EQT A;  1Y14 B;  1CSP A;  2K28 A;  2M9V A;  3A7A B;  3KDF A;  2K5H A;  3S14 H;  1F9R A;  4HCE A;  4C3J G;  1Z6H A;  1PH6 A;  2BE5 D;  4DV6 Q;  2KHJ A;  4A3B G;  2AHO B;  1B70 B;  3SK5 A;  1P16 A;  4JI6 L;  4IUT A;  3H0G G;  4UDU C;  5IYC H;  2B2T C;  1VQL A;  3ONA B;  2R7F A;  1A63 A;  2RQX A;  1IL2 A;  4BY7 H;  2OWO A;  4R1J A;  3GO5 A;  2VUM G;  2UUB L;  2VL6 A;  5TSS A;  5IWA Q;  3IAY A;  1DCZ A;  4UPA A;  1SYC A;  5FLX E;  5IGB A;  1BBW A;  4A3L G;  1STG A;  4LAA A;  4AYB E;  3S15 B;  1WD1 A;  1HQR D;  5C44 B;  5IT9 L;  3CCL A;  2ZXP A;  2A6H D;  4H44 C;  1O7Z A;  4MTN A;  1YBY A;  4JI5 L;  1TVX A;  4DV2 L;  1PTO B;  2PNH A;  2VNU D;  2MP1 A;  1N32 L;  3C2P A;  4A3I G;  3VR5 A;  4L5R C;  2XVS A;  4HTH A;  3KK7 A;  4DGZ A;  5JVG 3;  2F3W A;  4AQY L;  4CDD C;  3A8I E;  2QIL A;  1C8C A;  4HIM A;  3K8A A;  3VYT A;  2WV6 D;  4DR2 Q;  3HOV G;  3M7N A;  4C1N I;  2JEA I;  5ELD A;  1ZXT A;  4DR4 L;  1CKO A;  3CF5 A;  4BBR G;  4K6D A;  1Y8N B;  2KA7 A;  3HKZ E;  3DLL A;  4RMF A;  1X32 A;  3BDO A;  4JI3 Q;  3VDY A;  1PH9 A;  3GTK H;  1LT4 D;  3RZO B;  1EWC A;  2V1C C;  1LT5 D;  2A19 A;  4RHR A;  3KLS A;  1QIL A;  2MGS A;  3A8J E;  3RNU A;  1BR9 A;  1EWI A;  4JOI A;  1PH2 A;  1K8O A;  4J15 A;  3CPF A;  3A8K E;  1JT8 A;  1LTL A;  5J39 A;  4Y7N H;  3HGB A;  2F03 A;  5GAD C;  3OIQ A;  3TQY A;  1HQM C;  2JXM B;  3U9O A;  4B3T L;  4BBS G;  3FMC A;  2WAQ G;  3I73 A;  2F0L A;  3GQB A;  3R3O A;  3K6O A;  3GTO H;  5KND A;  4KK7 A;  2D62 A;  1ASY A;  1XMQ Q;  2B2Y C;  1XTC D;  5IGE A;  5ELF A;  4RKL A;  1QVG A;  4LF4 L;  1SNC A;  3C1E A;  3H3V H;  2FFK B;  2LXJ A;  1VQM A;  1ML0 D;  1A2T A;  1ESF A;  3T56 B;  1LAB A;  3K7A B;  3Q0A A;  1PFB A;  3F2D A;  3D8G A;  2O5I C;  1EY7 A;  1O78 A;  2PPB C;  1IYV A;  3S16 H;  2A69 D;  4JW0 A;  3CRK C;  3I72 A;  1AP0 A;  5C3X A;  3V2T A;  2Z6K C;  1XNR L;  2EY5 A;  4JI8 L;  2ZTD A;  3QR8 A;  1NBW A;  1N33 L;  4WOR A;  4X65 L;  1KRS A;  2Y0S E;  4HMI A;  4DR3 Q;  1QWY A;  2HIV A;  5AJ3 Q;  2UXC Q;  3I91 A;  3D3R A;  1JOO A;  4C3H H;  4LF7 Q;  2AWO A;  1Q8K A;  1ET6 A;  3HOZ B;  3HKS A;  4NXN Q;  4DV3 L;  3SVM A;  4HSP A;  2MHV A;  2VQF L;  5FO7 B;  3S1M B;  2CWA A;  2EYP A;  4OWX B;  1Y1V H;  3MAQ A;  1PYB A;  3NTI A;  1RF2 D;  1HUM A;  3D6W A;  2L0C A;  1SRO A;  1FVI A;  2B2U C;  5KNC A;  3OHX C;  2KQ3 A;  3PIP A;  1RL2 A;  1QB5 D;  4X6A H;  5C4X B;  4WJ4 A;  2CCZ A;  4DUY L;  1SJH D;  4GN5 A;  5CYU A;  3K58 A;  3R93 A;  3S1N B;  4HJ9 A;  1J5E L;  3BJU A;  2VQE Q;  2F0S A;  2GA4 B;  4KTA A;  1WCM B;  4RFB A;  5IGG A;  1YZ6 A;  3KFU A;  2AMC B;  2ZXR A;  1S5C D;  2EPB A;  1FNU A;  4RA8 A;  4EQP A;  3BZC A;  1SNQ A;  4JG2 A;  3HEJ A;  2R92 H;  1HNW Q;  2L5T A;  4H0L C;  4KJN A;  1D5M C;  5JEA J;  2XN9 C;  5C3E B;  5C0X I;  1PTO H;  3MEH A;  2HCI A;  4K0K L;  2RSO A;  1BCP C;  1I4G A;  1T5X D;  5KEE A;  4BA1 I;  2F0M A;  1KRT A;  2NTS A;  3H09 A;  1W2B A;  2MQH A;  1I94 L;  4GN4 B;  2EQS A;  2XRQ D;  3K7U C;  1CTM A;  4Q5V A;  1X65 A;  1EY9 A;  3LX0 A;  1M90 C;  4JPB W;  4EQN A;  4LF6 L;  2LFN A;  3FVQ A;  2E2I H;  2N55 A;  2Q2U A;  5M3F H;  4FYD A;  2NZO A;  4HCS A;  4HJ5 A;  1PH7 A;  2G9D A;  3FDT A;  1II3 A;  1HNX L;  3CKI B;  2N88 A;  1LM0 A;  2ZTC A;  3J80 c;  3E3X A;  1K9M C;  4GNX C;  1IBM Q;  3M4O H;  3SR1 A;  5CR3 A;  4X3S A;  1B1Z A;  1V43 A;  4C3I B;  3D4R A;  1GKH A;  1I4X A;  1LTT D;  1YNN C;  4A3F H;  3N6R A;  3KF6 A;  4JC0 A;  2ZJP A;  3GTG H;  4AYB B;  3GTQ H;  4A3G G;  1NY4 A;  2NWG A;  1GUO A;  1HA6 A;  4DK3 C;  5G3L F;  3PUY A;  3PO2 B;  1E24 A;  4YCV A;  1ZKO A;  3K57 A;  2JA6 G;  1EEF D;  1HR0 W;  2E2H B;  3OPO A;  1TS4 A;  4LFC L;  1Y1W G;  4JV5 L;  3GTP H;  2K5W A;  1U4R A;  5JJL A;  4DV5 L;  1DON A;  1OXV A;  1HR0 Q;  1IBK Q;  1UNS A;  2PI2 E;  3F2U A;  2PQA A;  5ELE A;  4G7Z C;  3PO3 H;  3KF6 B;  2KEC A;  3PSI A;  1FJG Q;  1STB A;  4DV4 L;  2WAC A;  1KLG D;  4RHS A;  1C7Y A;  1YNX A;  1SXT A;  2X6L A;  4MIU A;  1EOT A;  1PZI D;  1NTG A;  3NQI A;  2CKZ B;  2IJ0 A;  3CME A;  2D2C C;  3VYR A;  3NEL A;  4OXP A;  2IHF A;  3WOF A;  4A93 G;  1JB7 A;  5CV6 A;  1SDF A;  1XWE A;  3BG3 A;  3S2H B;  4B3M L;  4J1M A;  1L0W A;  3UDF A;  4H02 A;  4HJA A;  2H4O A;  2PQA B;  5M3M B;  1KD1 C;  1E2V A;  3OMC A;  3S1M H;  2AKW B;  3K59 A;  4YHH L;  3HOU B;  2I5H A;  5JPN C;  1B4O A;  4R9W A;  5E4X A;  2NVY B;  1VQN A;  3S9W A;  4LMQ D;  3CC7 A;  1PRT F;  1UUP A;  4XQQ A;  3TP7 A;  4PMW A;  4HN7 A;  5DEH A;  4A3M B;  4F88 A;  3ULL A;  4YWL A;  3E5S A;  5I6Y A;  1OXS C;  3MEF A;  3H3V I;  1SMY D;  2B2W A;  4HIO A;  4IN3 A;  2C9O A;  3TBI B;  1WCM H;  4IJL A;  1MIU A;  4LFA L;  2JA5 G;  1ET9 A;  5IP9 G;  4GNX A;  2XRS D;  2RCF A;  2C35 B;  4IPD A;  2CQO A;  1YIT A;  1W6K A;  5LMN W;  3C46 A;  4DR6 Q;  5IYB H;  5LMN Q;  2EYM A;  2Y0S B;  5GAG C;  2F52 A;  2F0U A;  4NXM Q;  4ZUI A;  1F9P A;  1TII D;  5J3B A;  1CFM A;  3FKI G;  1L1O A;  4TQU S;  1F2Z A;  3MXN B;  4I7Z C;  1BKB A;  1MJC A;  5JJZ A;  2YTV A;  5M5X H;  2NVT H;  2K6A A;  4BY1 H;  4MN3 A;  3HOW H;  2IY5 B;  1B3A A;  4KMU C;  4UP9 A;  1I5F A;  5M5Y H;  2ES2 A;  3NBH B;  1VQD A;  2K75 A;  1EYD A;  3FEW X;  2IHE A;  4FXK C;  3TS2 A;  5BN4 A;  4O1N A;  3RZD H;  3OW2 A;  4FP5 D;  2VUM H;  1L1O B;  1JMC A;  2PO4 A;  4M1U B;  3J7A F;  3S1Q B;  1IHZ A;  3EJI A;  5IE8 A;  3OIP A;  2SNS A;  3TP6 A;  4A3C G;  3S1R B;  2WB1 E;  4K8J A;  2ICE C;  2B63 G;  4QGU A;  5ELN A;  3OWF A;  2NUC A;  2R7Z B;  2AQ3 B;  4A75 A;  3C3L A;  3BDC A;  3R2T A;  1TWC B;  1IBL Q;  2FXQ A;  4A3E G;  1PH1 A;  4L5T A;  1EUJ A;  3AU7 A;  5C44 G;  4FXD A;  4JCV E;  1KHI A;  1DXM A;  4XTC S;  1B3Q A;  4BS9 A;  4A3I H;  2XSC A;  2F0W A;  4XDX A;  1G51 A;  2F0O A;  4O2D A;  3S14 B;  1EIF A;  1K83 H;  1PTO F;  5D3D A;  1TWH H;  1KNE A;  4QB4 A;  4DV1 L;  4JBM A;  2MPM A;  1EY6 A;  1S3O A;  3TRE A;  2D5D A;  1XMO L;  1IZ6 A;  4Y52 H;  5LHY 1;  1G91 A;  1QJO A;  2BDO A;  3CD6 A;  4DV2 Q;  2Z0S A;  3KYH C;  2CW0 C;  1N32 Q;  3X3M A;  3Q8D A;  2QW7 A;  4BY7 B;  3CQZ H;  4CJ2 C;  4IOA A;  4XQN A;  3TP5 A;  2PZW A;  5DLQ E;  1UE5 A;  3S2H H;  1BNZ A;  1S5E D;  3R2I A;  1CM9 A;  1E1O A;  1I3Q H;  1H9M A;  1PH5 A;  1O7L A;  2KOL A;  2EVB A;  1TR5 A;  3V05 A;  1K73 C;  2VS1 A;  4OL7 A;  4EQO A;  1WTW A;  2GVB A;  4WFN 3;  1EU3 A;  4K6L A;  2OXP A;  4L8J A;  4R4C A;  5EJW A;  4DR4 Q;  4R4T A;  3K5M A;  1VQ4 A;  5JEA G;  3LWE A;  5FJ8 G;  3TDQ A;  1XPR A;  2PI2 A;  4GKJ Q;  1QOH A;  1RTO A;  4FNF A;  2NVY H;  2BH2 A;  4JI1 L;  4NW2 A;  1QVC A;  1PRT D;  2D0O A;  2LXK A;  4GOP C;  1QUQ A;  5CV4 A;  2E2D C;  1EYG A;  1SYF A;  4QL5 A;  1CHQ D;  3EVQ A;  3LWU A;  3OW7 A;  4DV0 L;  1IKM A;  1ONL A;  2PQE A;  4MZ9 A; 
#chains in the Genus database with same CATH homology
 2DNC A;  5CC4 A;  2F0I A;  1H9K A;  5T1G A;  1KDA A;  4RGM A;  2PZU A;  1SNM A;  1BUV T;  1BQQ T;  5IGD A;  1HPC A;  1DZ1 A;  4KHZ A;  3GTK B;  2IX3 A;  2WKD A;  2EYH A;  3J80 E;  5CGK A;  1QNK A;  1O7Y A;  5NUC A;  1VMP A;  3ND8 A;  4XT1 B;  5C0X J;  5FO8 B;  2Q8R E;  1KDB A;  3D31 A;  1D1K A;  1O80 A;  4RCO A;  4OO1 H;  1ESR A;  1B44 D;  2CHB D;  2I07 B;  1EIG A;  4Y7N B;  3P1H A;  3TSS A;  3BVG A;  1F2L A;  1GUN A;  4Z9C B;  2PNR C;  1HA5 A;  1TY0 A;  3GTO B;  5DNF A;  5A2Q L;  2IX1 A;  1G2T A;  2RDH A;  3G6J B;  1MSH A;  4HAE A;  4KD3 A;  1F9S A;  5C4H A;  3NHH A;  3I70 A;  4QCL A;  1PXU A;  2FIN B;  3S16 B;  2F0N A;  3Q24 A;  4G57 A;  5EBD A;  5E1F A;  1FR3 A;  1EY8 A;  2A6H C;  3TP8 A;  1E2W A;  1U4P A;  1STE A;  5IGC A;  1Q1B A;  5DM7 3;  3DEO A;  2RSN A;  4LJZ C;  4C3H B;  5I9O A;  1TS2 A;  1D5Z C;  1LTG D;  2PW7 A;  3P75 A;  2SNM A;  1PTO D;  2XWJ B;  4DK1 A;  1Y1V B;  2J7Z A;  3NUC A;  2R61 A;  1PFN A;  2XIW A;  2EY1 A;  4FVM A;  1SNP A;  5EQ0 A;  4KD4 A;  1RJT A;  4WJW A;  1XYI A;  3PIO 3;  4DU9 A;  3NWT A;  4ZKC B;  3SK6 A;  2KED A;  5EKK A;  1EL0 A;  1Y8O B;  1Y8P B;  2EDG A;  3MA2 B;  1QE6 A;  4DXG A;  4ZAI A;  4EGV A;  2R92 B;  3EQL C;  3IKJ A;  2WB1 B;  3T16 A;  1D2B A;  2AUJ D;  4C3I G;  2VB3 X;  4ZQ3 A;  1AW7 A;  1X3Q A;  3PMF A;  1IW7 D;  3VA5 A;  1KNA A;  1S5B D;  3SEB A;  1JQY D;  2BA1 A;  1GUG A;  2E2I B;  2FMC A;  4HMJ A;  5M3F B;  4DAV A;  3K5O A;  2R93 B;  5C5L A;  5HUR A;  3A56 A;  2IWH A;  2EJF C;  5K36 G;  1DOK A;  4FF1 A;  2NTT A;  1RD9 D;  1H9J A;  2H1E A;  3Q22 A;  3M4O B;  1VF5 C;  1Q3L A;  3BDL A;  2B8G A;  3SHL A;  3W3A A;  4XYO A;  4RH6 A;  4A3F B;  1OO9 B;  1HFG A;  2F0D A;  2O2L D;  3GTQ B;  3GTG B;  5EKL A;  1BXT A;  3O13 A;  1TS3 A;  1JR0 D;  3BVZ A;  5ISR A;  5DM6 3;  1C48 A;  1PZJ D;  5I2Y A;  3GTP B;  5CV8 A;  1V1P A;  4A3J B;  2B2T A;  2K5Q A;  1DJR D;  1C4Q A;  3PO3 B;  1NSN S;  1UEA B;  3MVV A;  1I6V C;  2A74 C;  2DY7 A;  1TU2 B;  4L63 B;  4RGN A;  2EYO A;  4H13 C;  2QKI C;  3SK8 A;  1CT1 D;  1V1P B;  1GHK A;  2OEO A;  2X69 A;  1EZ8 A;  2R3Z A;  2NN6 I;  3JAM E;  4KY5 A;  4DN4 M;  1CK1 A;  1ZYR C;  3ND9 A;  4B9W A;  4OO1 I;  3BVM A;  4J6H A;  4ODG A;  4FO2 A;  2KUM A;  5KIX A;  4IUV A;  2KCN A;  5I9P A;  1A3V A;  4J8Q A;  3VR6 A;  3OMG A;  3NWS A;  3SK4 A;  1F2M A;  1OXX K;  4K5W A;  4IFD I;  1LT6 D;  4P2C B;  2NB0 A;  1OXT A;  2SEB D;  3QOL A;  4XT3 B;  1WD0 A;  5IT9 E;  5C0X G;  4IFD G;  2TSS A;  5EPK A;  2B2Y A;  2SDF A;  1VDZ A;  2PW5 A;  2M00 A;  4KI0 A;  5M5X B;  2NVT B;  4BY1 B;  3OWE B;  3HOW B;  1AZP A;  1SJE D;  2Z4H A;  1L0Y B;  5M5Y B;  1CZG A;  2XWB B;  3H0G B;  1EIH A;  1RTN A;  2LY7 A;  3K5N A;  3RZD B;  1JWU D;  3P20 A;  2VUM B;  2NZ1 D;  1KDC A;  2J0T D;  4M8A A;  1HTL D;  4KHV A;  2X6G A;  4IUQ A;  3DM1 A;  2QCP X;  3T13 A;  4ULL A;  1AEX A;  4RWS C;  2D9U A;  3G7L A;  5JEA H;  4ID6 A;  2K32 A;  2B2U A;  4A3I B;  1Q8I A;  4QMG A;  2K33 A;  2K5D A;  3ITP A;  1K83 B;  3VR4 A;  1TWH B;  3QIA A;  3I90 A;  1M8A A;  4IQZ A;  4DAY A;  1BCP D;  1EWH A;  4ZRZ A;  2LS0 1;  1TWF B;  3CQZ B;  4G7H C;  4KKU A;  1J8I A;  1I3Q B;  3GP7 A;  2EJM A;  3T53 B;  1QNU A;  2LMC B;  2F0F A;  1LV9 A;  1CQF A;  4ILW A;  4H7B A;  4BBS B;  5K5P A;  1SND A;  3I8Z A;  3QO2 A;  1NAP A;  5JVH 3;  1ENA A;  2EE1 A;  1RCV D;  3ZYY X;  1BCP B;  3KF8 A;  3L7Z C;  3EA6 A;  1BOS A;  4EVO A;  3TZU A;  1F77 A;  1NUC A;  4A3D B;  4GZY C;  4FF3 A;  1UAP A;  5JPM C;  1EZ6 A;  3GTM B;  4C1N K;  1SE2 A;  1CHP D;  2O4X A;  3N52 A;  1JCK B;  5EKI A;  3ERO A;  2JA7 B;  5F2D A;  1CQV A;  1FD7 D;  2A68 D;  1YNJ D;  1ILQ A;  4ZKB B;  3R8B A;  1I6H B;  1DM0 B;  1IKL A;  2DN8 A;  2AQ1 B;  4BWG B;  1XX8 A;  2Q8I B;  5KYI A;  3QB3 A;  3OSO A;  1E2Z A;  5COR A;  4XQJ A;  1TKW B;  1NR2 A;  4K5X A;  5KYL A;  3D6C A;  1EYC A;  2K04 A;  1ICW A;  1W6J A;  1NCV A;  3GV6 A;  1T5E A;  3WDN A;  2YYZ A;  4BA2 I;  4ABN A;  1WTX A;  4CGY B;  4CBV A;  1LTA D;  1KLU D;  1PRT C;  3IL8 A;  1LAC A;  2HUG A;  4CHT B;  3RLF A;  3DWP A;  4U68 A;  2F3V A;  1MI2 A;  1TT2 A;  3VR3 A;  3S17 B;  2MJ8 A;  1EFI D;  4V0B A;  2V4D A;  2A6E D;  1SSO A;  3K5L A;  2CVR A;  1B2T A;  1ILP A;  1R9T B;  2Q8T A;  1SBB B;  2QDB A;  1EY0 A;  4DFA A;  2ENB A;  1LTB D;  4K2K A;  5K36 H;  3P7J A;  4KKT A;  5ELB A;  1ENF A;  1F2Y A;  1HHV A;  1JIC A;  5FLX L;  3BS1 A;  1RDP D;  5EPJ A;  4Q0F A;  2FHT A;  3GV3 A;  4DXF A;  5KGU A;  4A3G B;  1QG7 A;  1X3P A;  4N9T A;  3J7Y W;  3SE0 A;  5FK9 C;  4K14 A;  2JA6 B;  2EYF A;  3C1F A;  1Y1W B;  2JP1 A;  4NP5 A;  1Y69 U;  1KTK A;  3ERQ A;  2LKV A;  1SYG A;  1FGB D;  3M4Y A;  4X3K A;  3H91 A;  1XXG A;  1AZQ A;  1PDQ A;  2L1B A;  2TMP A;  2EZV A;  2NVX B;  3BYY B;  2FJ2 A;  2HDL A;  1PZK D;  1RKN A;  2F0P A;  4F87 A;  3MHB A;  4IFD J;  4DA2 A;  2L12 A;  2BOS A;  1PTO C;  3PV0 A;  2BE5 C;  3KBX A;  5J22 A;  2IW3 A;  1FYC A;  3H94 A;  1B9N A;  3X3N A;  3AMU A;  3S2D B;  2E74 C;  4K5V A;  4U67 3;  4HSV A;  4IAL A;  2HQE A;  5E3F A;  4RKB A;  3DWQ A;  5A35 A;  1ROD A;  3KLS X;  1GUS A;  1STN A;  5BN3 A;  4DK0 A;  4NKL A;  5I4D A;  1LO5 D;  2JE6 I;  3AB9 A;  2JA5 B;  3KUP A;  2KJX A;  3TZD A;  2F0Q A;  3L3O C;  1V8Q A;  1STY A;  1MBY A;  4OHJ A;  1SNO A;  3NSW A;  4NMZ A;  4JK1 C;  3CRL C;  1IW7 C;  4HR7 B;  1SYE A;  4K8I A;  1JOQ A;  3FKI B;  3QWN A;  3MFG A;  5I6W A;  5IGF A;  4KJO A;  4PV1 C;  1GUT A;  2BA0 A;  1TQO A;  2RA4 A;  4LK1 C;  2K01 A;  2QEJ C;  1PMR A;  1JC7 A;  3FRP B;  5D65 A;  1M4V A;  1GXD C;  2JSO A;  1D6E C;  1U4M A;  1PLF A;  3DUZ A;  1DYQ A;  2C5C A;  2B63 B;  3MZ5 A;  3CHB D;  4TKO B;  2K7V A;  5EBC A;  4A3E B;  3M85 A;  1JE4 A;  4CKC A;  5CV9 A;  3H6M A;  1MSG A;  5CV7 A;  4ZUJ A;  1JOR A;  1TWG B;  4CKB A;  3HG9 A;  2A69 C;  5FKA C;  2RBM A;  1EYA A;  1PFM A;  5C4J B;  1H9R A;  3HP3 A;  1S4Z A;  3PUX A;  1ENC A;  4HED A;  1I4Q A;  5C3W A;  1U9R A;  2F0K A;  1CI3 M;  1WVL A;  1QCB D;  1S5D D;  2PCF B;  5EPL A;  1BDO A;  1TS5 A;  4CJ1 B;  3Q23 A;  3BZD B;  3URY A;  3HS0 C;  4NDX A;  4RCN A;  3CU7 A;  3QG1 A;  1NR4 A;  1DOM A;  3NK9 A;  4IUR A;  4IUP A;  2DNE A;  3NTK A;  2IPK D;  1WTR A;  4R8N A;  1EY5 A;  2AUK A;  3DXJ C;  5A2Q E;  1BCP F;  1A6X A;  2PYK A;  1S5F D;  4XYQ A;  3TN2 A;  4QF4 A;  2YU9 B;  3Q6S A;  3M3Y B;  1VF7 A;  2ZT9 C;  4PMB A;  1SAP A;  1IL8 A;  1GJX A;  2PZT A;  1E0B A;  2EY2 A;  5LL6 S;  1SE3 A;  4DNR B;  5D3I B;  3VR2 A;  5D14 A;  1G29 1;  1STA A;  3U9S A;  3SXH A;  1DOL A;  2K05 A;  3DMU A;  2NN6 G;  1HXY D;  3A7L A;  3NQT A;  3E0J A;  3NE5 B;  4OO1 G;  2KCC A;  4ZK9 B;  4TRD A;  3NP8 A;  1G6Z A;  4G7O C;  2QF7 A;  1GHJ A;  3M7G A;  1Q1E A;  1D1I A;  3PUV A;  3MXU A;  2F0E A;  2WIN B;  4X3T A;  1JB3 A;  1Z7T A;  3OOC A;  2Z4I A;  2VB2 X;  4F8M A;  3NXW A;  2EYL A;  2EYJ A;  1KAA A;  5KNB A;  2IT1 A;  5T1I A;  2M2L A;  3GTL B;  2EOT A;  4C3J B;  3VA7 A;  2BCO A;  4PNY A;  1BF4 A;  4RGT A;  4A3B B;  1L0X B;  1Z47 A;  3NTH A;  2WKC A;  4C56 C;  5CMD A;  1JWM D;  3UI2 A;  1SE4 A;  5IOD A;  1SYD A;  3A54 A;  1ZYR D;  1CA5 A;  1SYB A;  4OGQ C;  1EY4 A;  5COY A;  3DWA A;  2EJG C;  4PMC A;  3VYS A;  5C4Z A;  2Z1C A;  3I4M B;  2B2W C;  4KV6 A;  2IX0 A;  5EGT A;  2XNA C;  3SDZ A;  4I65 A;  3BYT B;  1IYU A;  2B39 A;  1V1O A;  4K2L A;  1SMY C;  2VXW A;  2AQ2 B;  1FNV A;  4C2M B;  4ZYS A;  3HOV B;  1Q12 A;  4B9X A;  2F0H A;  3PUZ A;  4UAI A;  4IUN A;  2JA8 B;  4KY7 A;  4DAP A;  4BBR B;  2KHS A;  3WOE A;  1WTV A;  1HCZ A;  2SOB A;  2A68 C;  4ZLT F;  1A15 A;  1YNJ C;  1WTP A;  3W2D A;  2L55 A;  3K0Y A;  3T51 B;  1HUN A;  2ICI A;  2RVL A;  3KLR A;  1VCI A;  4KN7 C;  3RUZ A;  3KBG A;  3HKZ B;  1A2U A;  4OIK A;  2WAQ B;  2KVM A;  2NVQ B;  2JEB I;  4IZ8 A;  1G8Z D;  3DHQ A;  5C5M A;  1R4P B;  1YNN D;  3FPU B;  1AFP A;  2B8F A;  2PMZ B;  3D4D A;  2IL8 A;  2FMM A;  3J81 L;  3MTS A;  2F0J A;  3GD7 A;  1STH A;  5CBA E;  4DNT B;  4PQX A;  3RD4 A;  4N9P A;  2A5H A;  3J80 L;  1H9S A;  1LTI D;  4FF2 A;  5DAU A;  4XXE A;  2HDM A;  1I50 B;  3MXN A;  2L4N A;  4F7X A;  1PYW D;  1A3U A;  1J9O A;  1LTR D;  3MFY A;  1OXU A;  4C3H G;  3LNN A;  4CJ0 B;  5CBE E;  1I4P A;  4QIW B;  2A6E C;  3PIP 3;  1G2S A;  4CKE A;  3NBH A;  3NBI A;  4QUF A;  1LT3 D;  4KN4 C;  1H9S B;  2L9H A;  3E6Z X;  1VMC A;  3HOY B;  1LTS D;  1D5X C;  2O5J C;  1JOK A;  2EXZ A;  4G4K A;  3V96 A;  4JBW A;  1DD2 A;  2AWN A;  4XIG S;  4L6T B;  2NYZ D;  3T4A C;  1I4R A;  2KEE A;  4TSS A;  5AFW A;  1RHP A;  2B2V C;  2G9H D;  2E75 C;  3HRZ C;  1ZEQ X;  3RMH A;  1MGS A;  1HRJ A;  2A73 B;  2OF1 A;  4IUU A;  2OT2 A;  5BN5 A;  5CV5 A;  1B53 A;  5FO9 B;  5G3L D;  3QOJ A;  2L11 A;  4S3S A;  3J7A V;  1BO0 A;  3H3V C;  3MWY W;  1KAB A;  2MUY A;  4O42 A;  2ID0 A;  4E6I A;  1U4L A;  1TWA B;  5FOB B;  1GOZ A;  1K8M A;  4A3K B;  4WRD A;  1JWS D;  5JAV A;  1MD2 D;  2NBF A;  3QJY A;  5M5W B;  2WP8 J;  3VYU A;  2E76 C;  3GTJ B;  1R4Q B;  3HZX A;  2WII B;  3DEP A;  1SEB D;  2F4I A;  5HGT A;  1AN8 A;  1HTP A;  4RAU C;  5ELC A;  2JYO A;  2RDF A;  2R6G A;  2EY6 A;  1EQV A;  5IOC A;  5C6A A;  3I4N B;  1SFO B;  2K1B A;  2I46 A;  4KKS A;  5IIF A;  4ME5 A;  5LL6 X;  3D4W A;  5I2X A;  4A93 B;  1B9M A;  4KY6 A;  2F1M A;  3MXG A;  3PUW A;  3J81 E;  2B2V A;  3MXP A;  3MC0 B;  2HCC A;  1F9Q A;  5J1Z A;  4FXG C;  3NPP A;  2F0G A;  2CW0 D;  3TME A;  1TY2 A;  2E2J B;  2ZXO A;  4V19 0;  1BBX C;  3EFX D;  1GUW A;  2NN6 H;  4DF7 A;  4X3U A;  1Q90 A;  5JOB A;  1PRT B;  4FF4 A;  1B50 A;  2K03 A;  1WTO A;  1EU4 A;  2F0T A;  4MHE A;  1WTQ A;  1I4H A;  1A3T A;  2RDG A;  2J4X A;  4B08 A;  3A55 A;  2CQA A;  3HOX B;  5M9O A;  2F0V A;  1HFN A;  3L9A X;  3FPP A;  5E4W C;  1CZW A;  1CA6 A;  3IFD A;  2Z8L A;  4YIJ A;  2BDN A;  5C0X H;  4QUC A;  4IFD H;  1EEI D;  2RKS A;  5KRU A;  3JAM L;  4OIJ A;  1LLR D;  3IFT A;  4R8I A;  1FNW A;  2DY8 A;  3I3C A;  3I4L A;  1EQT A;  2K28 A;  2M9V A;  3A7A B;  1F9R A;  4HCE A;  4C3J G;  1Z6H A;  2BE5 D;  3SK5 A;  4IUT A;  4UDU C;  2B2T C;  3ONA B;  2RQX A;  3GO5 A;  5TSS A;  3IAY A;  1DCZ A;  1SYC A;  5FLX E;  5IGB A;  1STG A;  4LAA A;  3S15 B;  1WD1 A;  1HQR D;  5C44 B;  5IT9 L;  2ZXP A;  2A6H D;  4H44 C;  1O7Z A;  1TVX A;  1PTO B;  2VNU D;  2MP1 A;  3C2P A;  3VR5 A;  2XVS A;  4HTH A;  3KK7 A;  4DGZ A;  5JVG 3;  2F3W A;  3A8I E;  2QIL A;  1C8C A;  3M7N A;  3VYT A;  2WV6 D;  4C1N I;  2JEA I;  5ELD A;  1ZXT A;  4K6D A;  1Y8N B;  2KA7 A;  1X32 A;  3BDO A;  1LT4 D;  3RZO B;  1EWC A;  1LT5 D;  4RHR A;  3KLS A;  1QIL A;  2MGS A;  3A8J E;  1BR9 A;  1K8O A;  3A8K E;  5J39 A;  2F03 A;  3HGB A;  3OIQ A;  3U9O A;  1HQM C;  2JXM B;  3FMC A;  3I73 A;  2F0L A;  3GQB A;  3R3O A;  3K6O A;  5KND A;  4KK7 A;  2D62 A;  2B2Y C;  1XTC D;  5IGE A;  5ELF A;  4RKL A;  1SNC A;  3C1E A;  2FFK B;  1ML0 D;  1A2T A;  1ESF A;  3T56 B;  1LAB A;  3K7A B;  3Q0A A;  1PFB A;  3D8G A;  2O5I C;  1EY7 A;  1O78 A;  2PPB C;  1IYV A;  2A69 D;  3CRK C;  3I72 A;  1AP0 A;  5C3X A;  3V2T A;  2EY5 A;  4WOR A;  4HMI A;  1QWY A;  3I91 A;  3D3R A;  1JOO A;  2AWO A;  1ET6 A;  3HOZ B;  3SVM A;  4HSP A;  2MHV A;  5FO7 B;  3S1M B;  2EYP A;  3MAQ A;  3NTI A;  1RF2 D;  1HUM A;  3D6W A;  2L0C A;  2B2U C;  5KNC A;  3OHX C;  2KQ3 A;  1QB5 D;  5C4X B;  1SJH D;  5CYU A;  3K58 A;  3R93 A;  3S1N B;  2F0S A;  2GA4 B;  4KTA A;  1WCM B;  4RFB A;  5IGG A;  2ZXR A;  1S5C D;  2EPB A;  1FNU A;  4RA8 A;  4EQP A;  1SNQ A;  3HEJ A;  2L5T A;  4H0L C;  4KJN A;  1D5M C;  5JEA J;  2XN9 C;  5C3E B;  5C0X I;  1PTO H;  3MEH A;  2HCI A;  2RSO A;  1BCP C;  1I4G A;  1T5X D;  5KEE A;  4BA1 I;  2F0M A;  2NTS A;  3H09 A;  2XRQ D;  4Q5V A;  1CTM A;  3LX0 A;  1EY9 A;  4EQN A;  2LFN A;  3FVQ A;  2N55 A;  4FYD A;  4HCS A;  2G9D A;  3FDT A;  1II3 A;  3CKI B;  2N88 A;  3SR1 A;  5CR3 A;  4X3S A;  1B1Z A;  1V43 A;  4C3I B;  3D4R A;  1I4X A;  1LTT D;  1YNN C;  3N6R A;  4AYB B;  2NWG A;  1GUO A;  1HA6 A;  5G3L F;  3PUY A;  3PO2 B;  1ZKO A;  3K57 A;  1EEF D;  2E2H B;  3OPO A;  1TS4 A;  2K5W A;  1U4R A;  1DON A;  1OXV A;  1UNS A;  3F2U A;  5ELE A;  4G7Z C;  2KEC A;  1STB A;  2WAC A;  1KLG D;  4RHS A;  2X6L A;  1SXT A;  4MIU A;  1EOT A;  1PZI D;  3NQI A;  2IJ0 A;  2D2C C;  3VYR A;  3WOF A;  5CV6 A;  1SDF A;  1XWE A;  3BG3 A;  3S2H B;  4J1M A;  2H4O A;  5M3M B;  1E2V A;  3OMC A;  3K59 A;  3HOU B;  5JPN C;  1B4O A;  4R9W A;  5E4X A;  2NVY B;  3S9W A;  4LMQ D;  1PRT F;  1UUP A;  4XQQ A;  3TP7 A;  4PMW A;  4HN7 A;  5DEH A;  4A3M B;  4F88 A;  3E5S A;  5I6Y A;  1OXS C;  1SMY D;  2B2W A;  4IN3 A;  2C9O A;  3TBI B;  1ET9 A;  2XRS D;  1W6K A;  3C46 A;  2EYM A;  2Y0S B;  2F0U A;  4ZUI A;  1F9P A;  1TII D;  1CFM A;  4TQU S;  1F2Z A;  4I7Z C;  5JJZ A;  2K6A A;  4MN3 A;  1B3A A;  4KMU C;  4FXK C;  1EYD A;  3FEW X;  5BN4 A;  4O1N A;  4FP5 D;  2PO4 A;  4M1U B;  3J7A F;  3S1Q B;  1IHZ A;  3EJI A;  3OIP A;  2SNS A;  3TP6 A;  3S1R B;  4K8J A;  2ICE C;  3OWF A;  2NUC A;  2R7Z B;  2AQ3 B;  3C3L A;  3BDC A;  3R2T A;  1TWC B;  3AU7 A;  4FXD A;  4XTC S;  1DXM A;  4BS9 A;  2XSC A;  2F0W A;  4XDX A;  2F0O A;  3S14 B;  1PTO F;  5D3D A;  1KNE A;  4QB4 A;  2MPM A;  1EY6 A;  2D5D A;  5LHY 1;  1G91 A;  1QJO A;  2BDO A;  2CW0 C;  3X3M A;  4BY7 B;  4CJ2 C;  4XQN A;  3TP5 A;  2PZW A;  1BNZ A;  1S5E D;  3R2I A;  1CM9 A;  1H9M A;  1O7L A;  2KOL A;  2EVB A;  1TR5 A;  3V05 A;  4OL7 A;  4EQO A;  1WTW A;  4WFN 3;  1EU3 A;  4K6L A;  2OXP A;  4L8J A;  5EJW A;  3K5M A;  5JEA G;  3LWE A;  3TDQ A;  1QOH A;  1RTO A;  4FNF A;  4NW2 A;  1PRT D;  5CV4 A;  2E2D C;  1SYF A;  1CHQ D;  3EVQ A;  3LWU A;  3OW7 A;  1IKM A;  1ONL A;  2PQE A;  4RGO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...