2JYOA

Nmr solution structure of human mip-3alpha/ccl20
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 20 (Small-inducible cytokine A20) (Macro
publication title Human macrophage inflammatory protein 3alpha: protein and peptide nuclear magnetic resonance solution structures, dimerization, dynamics, and anti-infective properties.
pubmed doi rcsb
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jyoA00
3MTSA 2KUMA 5T1IA 4CJ1B 4DN4M 4ZKBB 2B2YC 1B3AA 1HA6A 1NAPA 1HHVA 4IUVA 1JE4A 1MI2A 1G2SA 2RSNA 5D65A 4O42A 1BO0A 2K28A 1RJTA 1HFGA 1KNEA 4HSVA 1GUWA 1CA6A 1DOMA 2HDMA 1BNZA 5JJZA 2JP1A 1RTOA 1HUNA 1HUMA 2MGSA 1AP0A 4IURA 1DOLA 2B2UA 1QNKA 1U4MA 1X3QA 2FINB 1SAPA 2JYOA 5DNFA 1F9RA 5CORA 2HDLA 1G2TA 1RHPA 1WTXA 2B2UC 1F2LA 1F9QA 1E0BA 1U4RA 2K04A 2N88A 1WTRA 2K01A 1CM9A 1CA5A 1DOKA 2HCCA 2NYZD 3G7LA 4XT1B 1PFBA 2B2YA 2KOLA 2RVLA 4IUPA 1BBXC 4RWSC 1X3PA 4LMQD 5E4XA 4ZLTF 1M8AA 3KUPA 1NR4A 1X32A 1B53A 3DEOA 3I91A 3I90A 1PFMA 2L4NA 2K03A 1PDQA 2R3ZA 2L1BA 3I3CA 1F9PA 1SDFA 2KECA 3IFDA 4IUTA 1EQTA 2Q8RE 1U4PA 1QE6A 4OIJA 5COYA 1LV9A 2EOTA 2MJ8A 4X3SA 1WTWA 4UAIA 3MWYW 3ONAB 4IUQA 5EKIA 2N55A 1G6ZA 4CJ2C 4QUFA 1S4ZA 3DEPA 1J8IA 1EL0A 3H91A 2DY8A 1MGSA 4IUUA 1WD0A 2FHTA 2NWGA 3QO2A 3I8ZA 2EPBA 5CMDA 1O7ZA 1J9OA 1SSOA 4U68A 4ZK9B 4NW2A 1XYIA 1NR2A 4X3KA 2VXWA 1RTNA 2DY7A 2K05A 4HCSA 5EPLA 4RA8A 3UI2A 4RAUC 5E4WC 2X69A 2XIWA 2IL8A 4OIKA 1AZPA 3LWEA 1ICWA 1ZXTA 1C8CA 1TVXA 2HUGA 2RSOA 3HP3A 1B4OA 1PFNA 1MSHA 2NZ1D 1B2TA 1EIGA 5EPJA 1G91A 1VMPA 2D9UA 5D14A 2RA4A 4ZAIA 4HAEA 1ILPA 1ESRA 1HFNA 2B2WC 1WTOA 1MSGA 1JICA 4X3UA 3Q6SA 1Q3LA 3F2UA 3FDTA 2K1BA 2FMMA 2J7ZA 2L9HA 2B2VA 4MN3A 1WTQA 2Q8TA 1BF4A 3R93A 4R8IA 2M2LA 3DM1A 1ML0D 2H1EA 2L12A 5EPKA 1IKLA 2B2VC 4CJ0B 1ILQA 2FFKB 2MPMA 3KBXA 4HEDA 1EIHA 1QG7A 2KEDA 3P7JA 1WTVA 2B2TA 1O80A 4XDXA 2L11A 2X6LA 2EE1A 5AFWA 1PLFA 2BDNA 1VMCA 2B2TC 3GV3A 3TZDA 2KVMA 1HRJA 2HCIA 1RODA 1XX8A 1B50A 2CVRA 1KNAA 4XT3B 2SDFA 4R9WA 3TN2A 3SVMA 1A15A 2B2WA 4QUCA 4X3TA 1U4LA 3IL8A 3D6WA 5T1GA 1WVLA 2MP1A 3FPUB 5EJWA 1O7YA 1DZ1A 1IL8A 1F9SA 2X6GA 5CBEE 1NCVA 5CBAE 1EOTA 1IKMA 1DONA 3GV6A 4MHEA 2KEEA 5EQ0A 4ZKCB 1AZQA 1WTPA 3N52A 1WD1A 2FJ2A
chains in the Genus database with same CATH superfamily
1LACA 2RBMA 5KNCA 5A35A 2E74C 3IFTA 2OQKA 4JI0L 2Y0SE 4B3ML 1SNPA 1K9MC 4DA2A 2NVYH 4A3BH 1CKNB 4NXMQ 3OMGA 1DOMA 5FO7B 1STHA 5GADC 3P75A 2UXCQ 3EFXD 2ASBA 5GAHC 2UXBL 1EFWA 1YNXA 2NUCA 2B2UA 3OTOL 1SNMA 3ITPA 1F2LA 5CYUA 3T1YQ 3CC2A 4MNOA 4DAVA 4A3DH 4XT1B 1HPCA 1PFBA 1SXTA 2B2YA 4UDUC 2RVLA 1IBMQ 1S5ED 3B6YA 1X3PA 1KRTA 1PYSB 3EN2A 4Q5VA 3HOWG 4JBJA 2IPKD 4GOPC 3MVVA 1IHZA 1EZ8A 4LF5Q 4C3HB 1Y14B 2F3WA 5LL6S 4IPGA 1B9MA 4L63B 4HJ5A 3BZKA 4ODGA 2NVXH 4FYDA 1SYEA 2D62A 1FYCA 1D8LA 4GLVB 2A69C 4YWKA 4IFDI 2NN6I 1CTMA 1VQ5A 1QVGA 3FKIH 3I8ZA 3CCEA 3D0FA 4RA8A 1ESFA 4YCUA 2J4XA 2WB1B 3KOJA 5CR3A 1W3SA 4UY8C 1D2BA 2F0DA 4JI4L 1HJPA 1YHAA 4GN5A 2JQOA 5JAVA 1LT3D 1E7ZA 1EWIA 2KBNA 4RKBA 3D4WA 4R8NA 4HJAA 5EPKA 2RQXA 1ILQA 4DV4Q 2K5VA 1YHQA 4G7OC 2B2TA 2WFWA 4NMZA 4XDXA 3I4NB 3RZOB 2L11A 1A3UA 3FRPB 1LTAD 1HTLD 1B44D 2O5IC 1SE3A 1LTTD 1VMCA 1QNUA 2RDHA 3K5MA 1XX8A 2UU9L 4JBWA 1S40A 1YZ6A 3AQQA 4PNYA 1F77A 4BA1I 3KJPA 5K5PA 1NCVA 5CBAE 1KAWA 1A6XA 1CFMA 1GJXA 3DXJC 3ZJYC 3HOVB 2F0GA 4OHJA 1L0YB 3NWTA 5I2XA 4DV7L 4DR3L 1VQCA 2SOBA 4IPHA 3A56A 1NMFA 1K73C 2ZXOA 4YCWA 2JA7G 1KABA 1X56A 3TZUA 4Y7NB 2A6HC 3AB9A 1Y1WG 4XTCS 1HUMA 1JMCA 4NB3A 5CORA 3BVZA 2BH2A 2B2UC 2WAQB 1EWCA 4DUYQ 5IP7H 4ME5A 1EU4A 5LMNL 3RLOA 2VL6A 2KOLA 4HMIA 4C3HH 1SYFA 5G3LD 5E4XA 4DU9A 3I91A 1SROA 4DKAC 4XYOA 3CCQA 1D1IA 2SNSA 3GTJB 4JV5L 3BZDB 4IUTA 1TY0A 1I4PA 1DXMA 4RKLA 4A3GB 2F0MA 3QR8A 1P8LA 5EKKA 1WJJA 3MXGA 4HTHA 4M8AA 1H9SB 3CKIB 1XPOA 1IBKL 2E2HB 3MC0B 5GROA 1E22A 3T1HL 4KMUC 4IUUA 1N34Q 3H94A 1V1QA 4P73A 4YHHL 4NW2A 3FMCA 1JOOA 5ELNA 3I72A 1Z6HA 1LT5D 4OWWB 4DK1A 1XMOL 4BBSB 2JSOA 4EVOA 1O78A 3OW2A 5EPJA 1HXYD 2Z8LA 3U4VA 4DPGA 1PRTD 3OYYA 2EDGA 1AFPA 2BOSA 4GN4B 2EY5A 2L9HA 1D6EC 3I4NH 4LF8Q 1YEZA 1QJOA 1WFQA 4GKKL 4X6AH 1FR3A 4LF7Q 4OO1H 2B2TC 2ZXRA 1BDOA 2HCIA 5C6AA 5AJ3L 5C4JB 1KNAA 1IL2A 4I7ZC 4R9WA 2D5DA 2LMCB 4L5RC 3CCUA 4LUOA 5EQ0A 2PQAB 5IP9H 3HRZC 3N52A 5C3EH 2L5TA 4DN4M 4Y7NH 1XNQL 1K83B 2IX0A 2UUCL 5E7NA 1KTKA 3ZYYX 5D65A 3RLFA 4L8JA 2RDGA 2Z6KC 4DAYA 4DUZQ 2EZVA 4KY5A 1HZBA 1DOLA 2JYOA 4WRDA 1MBYA 3J7AV 3TS0A 1D5XC 4LFAL 3AMUA 1S5DD 2QA4A 4H44C 1LO5D 2A68C 3KDFB 1KDBA 3GTJH 3PCOB 4BXXG 2IT1A 1XTCD 4H02A 4ZLTF 4A3MB 4A3GH 3J80E 5I9OA 3DWPA 2K6AA 2M9VA 2NTSA 3I4LA 1SDFA 1IYVA 2E2HH 1G8ZD 3P1HA 3LGJA 1TR5A 4A3EG 5FLXE 3S16B 2MJ8A 1S5CD 1HZCA 4IUQA 5JJKA 5KRUA 4Q0FA 2ZT9C 1PTOC 2PI2A 3HGBA 1Y8NB 5KYLA 2H4OA 2DGYA 1QCBD 4DF7A 4DV3Q 4PMCA 1OXSC 2KCNA 3C3LA 5EPLA 3UI2A 2IWHA 2RDFA 2XRQD 4KY6A 1JWUD 3HOXB 4A3FB 1S5FD 2F1MA 1VF7A 3BDCA 1ZYRC 4HIDA 2F0EA 4PZ8A 2PW5A 3HKZG 1EIGA 1HQMC 2BA1A 1K8GA 2C5CA 4K6DA 4A93B 4JC0A 1PHJA 1IZ6A 2CW0C 1I50B 2F0JA 4WJ3M 3NP8A 5HGTA 1FNUA 3RUZA 1SYBA 2A6ED 2YTVA 4TQUS 2DNCA 2OTLA 2BE5D 4K14A 5CV8A 2AQ2B 2H1EA 2L12A 2HT1A 4A3DG 1ENFA 5C4JH 2KVMA 1I4QA 4GLXA 1SLJA 1T5EA 5C5MA 3FP9A 3S15B 4JI5L 2D0OA 1TWHH 3M4OH 3NTIA 4X3TA 1TWCB 5FOBB 2SNMA 2E2JB 2A74C 3SK5A 1K0SA 2OF1A 2X6GA 3J81E 3FKIG 1DONA 1K83H 2KEEA 4DV0L 2CKZB 3SEBA 3AYHB 3K6OA 4KKUA 2A19A 4OGQC 1FGBD 3I4OA 1FNVA 4IPDA 3K58A 2E76C 1UEAB 5JOBA 3Q24A 4QGUA 3OMCA 3J81j 4KN7C 1UE6A 3K81C 1BO0A 4O42A 2K28A 1HNWQ 1SJHD 1Q8IA 3A5UA 1CA6A 1FJGL 1GUWA 4J6HA 2Q2TA 3UDFA 2UUBL 1C9OA 2OT2A 1JB7A 2N88A 4BY1B 2ZM6L 5CGKA 3W1BA 1X32A 4KHPQ 1LM0A 2QDLA 3S16H 3C1FA 2DN8A 5ELDA 4EX5A 2LSSA 5BN3A 3AEVA 4RGMA 2L1BA 2EYHA 4YCVA 1LLRD 3K7UC 5C3WA 3ONAB 3CP0A 1SMXA 4UHVA 2DY8A 3L9AX 3V05A 1XTDA 4EGVA 1IW7C 4FNFA 4R4QA 3HOXH 4A3FH 1JWSD 1MIUA 4BY7B 1D5MC 4NP5A 2ID0A 4HCSA 4A93H 1EY8A 4DR7Q 2XIWA 3HOYB 4A3CH 4JI1L 1ZXTA 5M5WB 4NKLA 4B3SL 1CSQA 4KN4C 1JJCB 1HNZL 1YNJD 1IXRA 1JOKA 4G4KA 4DAMA 1KDAA 2R7ZH 4A3LG 2N8NA 5E1FA 1ILPA 3H0GB 1WTOA 3FDTA 4NXNL 3WDNA 1K0RA 3GTOB 3VR3A 5IP7G 2R93B 3RLNA 1Q81C 3RZDB 3M3YB 2FFKB 2MPMA 2F0QA 4C3HG 3V96A 4C3JB 4JBMA 3TMEA 4A3IB 1EZ6A 1D5ZC 1TWCH 2EJFC 3HOZB 1SYCA 1KQSA 5CV6A 5IT9E 2J0TD 5EBDA 3FPUB 5M5YB 2XN9C 1BBWA 1PH8A 2IY5B 4B3RQ 1EEID 2WB1G 3Q23A 4OWXB 3HFZB 2L55A 1WD1A 4IZ8A 2AQ1B 1PH2A 4CJ1B 2F4VL 1HHVA 4GKJQ 5I4DA 1LTBD 5C4HA 2R92B 1QVFA 1R4PB 3PUXA 4HSVA 1EQQA 4C3IB 1YHBA 3J7A5 1Y69U 2VB2X 1RTOA 5KGUA 5F2DA 3VYTA 2ZTDA 2VW9A 3TS2A 4DR6Q 1UE1A 4HIOA 1VQIA 3I4NG 1F9QA 4NPSA 3A8JE 1WTRA 4DXGA 4B3MQ 1CSPA 4C1NK 3KLRA 2C9OA 2ZTCA 5FJ8G 1QUQB 1VQEA 3TP6A 1NY4A 1A63A 1KIXA 3GQBA 1FD7D 4DV6L 5JEAG 4JYAL 5FO9B 3S1QB 4WJWA 3CCSA 4DR1Q 3HOVG 4C1NI 1PZJD 2EYFA 4GNXA 2NVYB 4BY7H 4A3BB 1KDCA 3E9IA 1SMYD 1J8IA 1XWEA 3QOJA 5IE8A 1KHIA 4LF6L 3MEHA 5IP9G 3HOYH 2EPBA 3M4PA 2D0PA 3QIAA 1PTOF 5M5WH 1XJVA 4JCVE 5BR8Q 1RIPA 4KKTA 5E4WC 4X66L 2X69A 3I55A 1WI5A 4GOPA 5M3MB 4A3KB 2YTXA 3NQTA 1EIYB 4R4TA 5JPNC 3TQYA 3U58A 3GDEA 3QOLA 1MHWC 3EROA 2WAQG 4ILWA 3J81L 4LF4Q 3GTOH 4K5WA 1HZ9A 3M3YH 4H0LC 1GHJA 4WJ4A 3WOEA 1JQYD 3F2BA 2IW3A 2J7ZA 3J7ZC 2Q8TA 4A3IH 2NVXB 2M2LA 5C0XG 1ML0D 1PH6A 1IKLA 3RN2A 1EIHA 3SK8A 3GTGB 3L3OC 1YNNC 3GTQB 3HOZH 5K36G 1VQ6A 1VQDA 4A3GG 1QVCA 2EE1A 2MHVA 1HRJA 4ME3A 1TU2B 1EUJA 3W3AA 5M5YH 4GLAC 5KNDA 3KBGA 2UUAL 3H3VI 4JI3Q 4QUCA 1I3QH 1UE7A 4K8IA 1DGSA 4X65Q 3ND8A 5CC4A 4B3TQ 1E2VA 3FHWA 4JI2L 1Q7YC 1X3FA 4ZQ3A 3CC4A 4BBSG 1K28A 3D6CA 4LFCL 3S1NH 1S3OA 5T1IA 1GKHA 4C3IH 2PNHA 2L0CA 1F2ZA 1SE4A 4M1UB 5EAYA 3JAMc 3PSIA 4CGYB 2H5XA 4OX9Q 2ENBA 1XPUA 1V8QA 1PRTB 3JC66 3PUZA 3PO2B 2CQOA 5M3FB 1EY0A 1YJWA 4RGTA 3SK6A 3VA7A 3M4QA 1CZWA 1YITA 4PG3A 4DR4L 2O5JC 1CM9A 3Q22A 1CA5A 4K2LA 2OCEA 4CDDC 3TREA 4YY3L 1ET6A 2VNUD 4V190 1EY4A 3S1QH 4DXFA 3G71A 1NUCA 1SEBD 2FMCA 1VQKA 1PH9A 1EQTA 1VQ9A 4JI7L 4X3SA 2KA7A 4AQYL 1B8AA 4GZYC 1PYBA 1S4ZA 4GNXC 2NZHA 1H9RA 3S2DB 1WD0A 1XNRL 1DM0B 2FHTA 3K0YA 5M3MH 4A3KH 4JPBW 1V1OA 3DWAA 1GUSA 2VXWA 3PIOA 2DY7A 3F1ZA 4WFN3 1YJ9A 4KLKA 5IIFA 2GA4B 3U9SA 1GD7A 1ICWA 3T51B 2HUGA 2LS01 4GN3B 1SNDA 4KKSA 4YIJA 1HR0W 3W1GA 1CQFA 2C35B 1JE5A 1GM5A 1R9TB 3BDLA 5IGCA 1YVCA 4HAEA 3JAML 3EBEA 2I5LX 4FF1A 3TP8A 3GTGH 3H3VC 4X3UA 3GTQH 3STBC 1S5BD 4A3MG 3KFUA 2EYLA 4JI6L 1TIID 1A8VA 5IODA 2KEDA 2NZOA 3NK9A 1A62A 2EY2A 2LKVA 5IGEA 1UE5A 3KF6A 4IO9A 1GUTA 3M4YA 1N33L 4QB4A 1D1KA 3ULLA 2VY3A 3NHHA 3CCRA 1EQVA 3GTMH 1JJGA 5EJWA 3DHQA 2F3IA 4DK0A 3PV0A 4APVA 5BN5A 1LT4D 2XTIA 3BU2A 4RGOS 2OWOA 4K0KL 4ZKCB 4ZUJA 3MTSA 4A93G 4DR5Q 5I6YA 1HA6A 1YBYA 3PO2H 2EIFA 1EYCA 5M3FH 3A55A 3RNUA 3PF5A 4OL7A 2GVAA 1WCMB 5I9PA 2E5LL 1STNA 3PIP3 1BCPB 5LMUL 1IBLL 2JA5G 4ZYSA 1N9WA 1X55A 1G2TA 1U4RA 1DOKA 1STYA 2NYZD 3BYTB 3EJIA 4GS3A 1NR4A 3NTKA 1K8OA 2BDOA 1SR3A 3S24A 5H1SE 2CFMA 2DUDA 2Z6KA 4PZ6A 1K8AC 3IFDA 4FO2A 5C3EB 3S2DH 2KHJA 2QW7A 2VQFQ 5ISRA 1WTWA 4X64Q 3K59A 1F2YA 3ULPA 1PH7A 4HIKA 2V1CC 3GP7A 3F2DA 4DV1L 1EL0A 2YYZA 5D3IB 3VYRA 4ALPA 2WKDA 5JPMC 2HQLA 1PFSA 1MD2D 2M00A 1AZPA 1R9TH 1DCZA 3A7LA 1I4XA 1TVXA 2RSOA 3K80C 1MSHA 2NZ1D 4J8QA 1B2TA 1X3EA 5C4XB 3D4DA 5IYCG 1BVSA 2G5DA 4BY1G 2BCOA 2EVBA 2UXCL 5IYDG 3OPOA 3C1EA 4XQQA 2B8FA 2HHHL 1QG7A 4QIWE 1WTVA 3MZ5A 3T1YL 1PLFA 1VS0A 1IBML 2F0HA 1OXTA 4LWCA 4CBVA 1N36Q 1ENAA 1B50A 4DV5Q 3J80i 4NDXA 3H6MA 1F2MA 1X65A 2E8GA 1NSNS 4LF5L 4LAAA 3TBIB 4G7HC 4BY7G 1WVLA 2AQ3B 2CWAA 5KNBA 2D2CC 3TP5A 3A8IE 4R4OA 3ICEA 3HOYG 4BBRH 2EY1A 1WCMH 5C44H 1XMQQ 4KHVA 5A2QE 2R6GA 2K5QA 3H0GG 2AUKA 2JA8G 3SR1A 2R93G 1BUVT 4DV0Q 4XYQA 3HEJA 3S17B 4JOIC 1NJIC 1JJ2A 4C3JG 4R4CA 4A3IG 1TWHB 3M4OB 2CQAA 5FO8B 4RWSC 3CMAA 4CHTB 4DV4L 1R4QB 1JB3A 2A73B 3K8AA 1N8RC 2B63B 4HJ8A 2R3ZA 5COYA 4AIMA 3EA6A 1LV9A 2Y0SG 3T4AC 3GTPB 4DAPA 1KLUD 3TDQA 1AN8A 2ATWA 4DV2Q 1CI3M 2JA6H 1L1OB 3MEFA 1N32Q 3QO2A 3LWUA 2R92G 4KHZA 3VYSA 1TS3A 3NE5B 1JWMD 1T5XD 2A68D 3J81i 3CRLC 5C4XH 1PXUA 1HCZA 3ER0A 3LWEA 4FXDA 1JCKB 2BH8A 3DM3A 2IX3A 4N8FA 3KLSX 2AKWB 4A3JB 4UPAA 3HOWB 3DWQA 4IALA 4RCNA 1PH3A 1SE8A 1H9MA 2FMMA 1BF4A 1WOCA 1QILA 1C0AA 4IQZA 1Q1EA 1Q8KA 4O1NA 1EY5A 3KBXA 4KJOA 1Q12A 1HNZQ 2ICEC 5C0XI 5JVG3 3OOCA 4A3BG 2QEXA 2VUMB 1W2BA 4F8MA 4F88A 1LTSD 1I94Q 3SVMA 1OTCA 4L5SA 1IYJB 4TRDA 1IL8A 3D8GA 1BCPD 2R61A 1VCIA 2K5DA 5M3MG 4A3KG 2R7ZB 1ONLA 2K5NA 2G9HD 3PIO3 4EQOA 2JJQA 1EY9A 2MO1A 2Z4IA 1N34L 4AYBE 5I2YA 4IUVA 3BG3A 5EGTA 3V2TA 1RJTA 3S17H 1EOVA 3HG9A 4KI0A 2F0SA 1BNZA 2EYOA 2BE5C 2QEJC 1SAPA 3TP7A 1TT2A 4DNRB 2DNEA 1E0BA 4LFBQ 2NVTB 4XQJA 3AFPA 4OWTB 1V1PA 1Y8OB 5IWAQ 3EVQA 4B9WA 2B63H 2F0NA 4IUPA 1YJNA 2A1AA 4LF8L 2E2IB 2GVBA 4JG2A 4KV6A 2PI2E 1ICFB 4DNTB 3UDXA 1K3RA 4J1MA 4LF7L 1DJRD 3EIVA 3GTPH 2KECA 5CBEE 2VQEL 3G4SA 4L5QA 4MTNA 4X62Q 1C7YA 4N9PA 3K5OA 3QG1A 2N55A 5CV4A 1CT1D 5J3BA 1XPRA 1Q82C 4A76A 3ULJA 5CMDA 1I4HA 3C2PA 1J5EQ 1L0XB 4O0AA 1ASZA 5JJLA 1TKWB 4JK1C 3PO2G 4A3JH 3OW7A 5M3FG 3HOWH 1AE2A 1EYAA 2KENA 3I2ZA 3W2DA 1ENCA 1SNCA 3JAMi 3CCLA 4BA2I 1PFNA 1FL0A 1XXGA 1PH5A 2D9UA 1PYWD 1VQ4A 3CXCA 3J80c 3H15A 5IYBH 4DR2L 4DUZL 2A5HA 4MN3A 4CKBA 2NBFA 1HH2P 1JR0D 3DM1A 3M9BA 3DLLA 2ZJQA 5FLXc 2JXMB 4HSPA 2O4XA 3KF8B 3CHBD 4CDFC 2DJFC 2VUMH 3CCJA 1C4QA 1KD1C 4R1JA 1RODA 3IKJA 5IY0A 4XT3B 2UXDQ 1QZGA 5HURA 2R7FA 1VQGA 1B7YB 3BVGA 4G57A 3UDGA 2CWPA 2QDBA 3GV6A 3MAQA 2HIXA 3A54A 4DNIA 5IGBA 2TMPA 4GOPB 1G2SA 1EWHA 1YNJC 4DV3L 3KK7A 2CCZA 1KNEA 1QOHA 2VZAA 5JJZA 3N6RA 2NVTH 4IURA 3SK4A 3E6ZX 2JEAI 2F0WA 1F9RA 2N49A 5ELBA 2E2IH 5L37A 3J80L 1Y1VB 1I3QB 3CW2C 1JC7A 2Z1CA 1A2TA 1TWGH 2MO0A 5FLXL 3J81c 3S1NB 3NBHA 4DR4Q 3GTLB 2EOTA 1MKHA 1GO3E 3NENA 3NQIA 2Q8IB 4LF9L 3RN5A 1G6ZA 1NE3A 1G291 1TWAB 3OIPA 5EBCA 3OIQA 4DGZA 4JI0Q 3LX0A 4ZK9B 1WCMG 4OO1G 1AEXA 3PO3B 3KYHC 1LTLA 1NNXA 2QGQA 4AQYQ 2UXBQ 1Q46A 3A7AB 1QZHA 3MFGA 3OTOQ 3IAYA 2K33A 1G6PA 2K75A 1H9KA 1HNWL 2RA4A 4FP5D 1ESRA 1ZKOA 1HFNA 1JICA 1SNOA 4A3EB 1JOQA 1UEBA 2K14A 2MQHA 4HEDA 1E1OA 2NVQB 3P7JA 2XNAC 5C3EG 3VR4A 3U50C 1HNXL 3DMUA 4RHRA 2PZUA 4DK3C 1BBUA 4KHPL 2RHSB 1S72A 1JT8A 1GUNA 3PQIA 1ZEQX 1SMYC 1U4LA 3IL8A 2WV6D 4PV1C 3NTHA 2G9DA 3HKZB 1HR0L 4MHEA 4S3SA 1UNSA 4O2DA 1ASYA 1SYDA 5IGDA 4BWGB 5C4XG 4IOCA 1VQMA 4JI4Q 1MI2A 4FF3A 4LJZC 3H3VH 4OXPA 4DR7L 3J7YW 2AWOA 2JP1A 2EY6A 4K0KQ 1Y1VH 2VB3X 4IPCA 4JW0A 2HDLA 4DK6C 5J22A 2ZJPA 4R4IA 1H95A 1U9RA 3G7LA 5IT9c 3GTMB 3EQLC 2PZWA 3QB3A 5LL6X 2UU9Q 1U0LA 3TEHB 3GTLH 3SGIA 2L4NA 2AWNA 1I6VC 1PDQA 1F9PA 4YWLA 2Q8RE 4IUNA 4LUVA 2F03A 3S1MH 2P5ZX 1TWAH 2RHQB 4I7AA 4UAIA 1LUZA 4J15A 5M5XB 1L0WA 2CH4A 2B3GA 4JI8L 3PO3H 3M7NA 1T9HA 2NWGA 2HIVA 3T13A 4DV7Q 2WINB 1SSOA 3NPPA 4DR3Q 3NEMA 4BXXH 2KCTA 4B9XA 2Z0SA 3MXNA 3M85A 4HIMA 4B3RL 2LY7A 1X6OA 1B4OA 5IGFA 1VQ7A 1O7LA 4K6LA 1G91A 4A3EH 4DV1Q 2I46A 1DYQA 2JE6I 4ZAIA 1Q1BA 2B2WC 5LMNQ 4K2KA 2NVQH 1GXDC 4QIWB 2OTJA 4RG1A 3I56A 4DR6L 4EQPA 3VA5A 3MHBA 2YV5A 3BJUA 1I4RA 2B63G 1QWYA 4PMBA 2F0OA 5CV5A 5EKLA 4JV5Q 1EQRA 2Q2UA 4CKEA 1TS2A 1LTGD 2K7VA 2EXZA 5IT9L 1EY7A 2AUJD 3D3RA 3MA2B 1IBKQ 4MIUA 3T1HQ 3TN2A 3T56B 3HOUB 4IFDH 3D4RA 2NN6H 2LXJA 3VR2A 1RL2A 3D6WA 4IJLA 4UP7A 4FDBA 4YHHQ 2HHHQ 4DR1L 1W6JA 2WKCA 3QJYA 3R3OA 3TSSA 4LK1C 1B3QA 2A69D 3STBD 5TSSA 1WTPA 1XMOQ 2QKIC 1B9NA 1VQBA 4A3JG 4ZKBB 1L2FA 1JE4A 2RSNA 4A75A 4LNQA 4N9TA 5BR8L 3BDOA 2MNAA 1EU3A 2F0FA 3H09A 1OXUA 4TKOB 5LHY1 1CKMA 5BN4A 1GOZA 3F8TA 2FINB 5IYBG 4LF4L 4GKKQ 4PZ7A 1X9NA 1PTOB 1RHPA 4V0BA 4P2CB 1KXLA 5KEEA 1STAA 5ELOA 3HOXG 4HR7B 4A3FG 5GAGC 3HKZE 2VUMG 1BBXC 3UDIA 5AJ3Q 3U9OA 2O2LD 4A3CG 4BBRB 2PPBC 3WWVA 5J39A 5IGGA 4IFDJ 1Z47A 5M5XH 4OIJA 1U4PA 1QE6A 4QF4A 3A5ZB 5C44B 3L2PA 1CKOA 2R7ZG 5FLMH 1VQAA 3TRZA 4JOIA 1TY2A 3MWYW 1Q90A 3ND9A 4QJFA 3BS1A 5E3FA 1JORA 4F7XA 4JI3L 1XNQQ 4U68A 4X65L 4B3TL 3OWFA 2UUCQ 3CCMA 1MJEA 1II3A 3DUZA 1UAPA 3R2TA 2HD3A 4RAUC 4ID6A 4POGA 2EJMA 4ZUIA 1M90C 3L7ZC 1CKNA 3AFQA 2AMCB 4UP8A 1Z9FA 1GVPA 1SYGA 5NUCA 4LFAQ 1KLGD 5C4ZA 3C46A 4OX9L 2A6HD 4PQXA 3MXPA 1Q3LA 5IOCA 2NB0A 3P20A 2YTYA 4FF2A 3S1RB 3R93A 1NTGA 4KY7A 2E2DC 2PMZB 2JA6B 2JK8A 1BQQT 3E0JA 2PCFB 4C56C 3HOUH 3K7AB 2ICIA 1E3PA 4A3LH 4LUZA 3FEWX 4DAYB 2ES2A 2XWBB 4EQNA 4HCEA 1V9PA 2MP1A 5KYIA 4NXML 4I65A 3A74A 1IKMA 3GTKB 4AYBB 1AZQA 1CZGA 3PGZA 2PW7A 5GQOA 1QB5D 2FJ2A 3S9WA 2B2YC 2QF7A 3NELA 1PMRA 3X3MA 1YIJA 1GUOA 1STBA 1PTOH 4ZRZA 1HA5A 3PUWA 3I4MB 1HUNA 2MGSA 4HMJA 2GN5A 2ZTEA 1KC8C 5DNFA 2F0TA 4HN7A 1WTXA 3Q0AA 5C5LA 2K01A 1RF2D 2HCCA 2I07B 2K5HA 3ERSX 3RR5A 2XVSA 1FNWA 4Y52H 1PZKD 1M8AA 1B53A 2JN4A 3R2IA 4JI5Q 1IYUA 1M1KC 1EIFA 5J1ZA 1V43A 4H7BA 1VQFA 3IRBA 1PRTC 3CRKC 1TXYA 2K5WA 1E24A 4UP9A 5EKIA 3BVMA 4QMGA 1BR9A 3RZOH 3DEPA 3SHLA 3H91A 2IX1A 4IN3A 4Z9CB 4RCOA 3LNNA 4X3KA 1RTNA 5FJ8H 2NTTA 2EQSA 3HOZG 2VQEQ 4TVAB 4XXEA 4HJ9A 2Z6BA 4FXGC 3SE0A 2I0QA 1FJGQ 1B1ZA 1Z7TA 1VQ8A 1O7IA 3A0JA 4RHSA 4OO1I 4DR5L 5JEAH 2TSSA 3O13A 2UUBQ 1B70B 2LFNA 3FVQA 4P71A 1DD2A 1VMPA 2WB1E 3HOVH 3S1RH 1KL9A 1BOSA 1Y1VG 1EFID 3FPPA 2B2VA 1STGA 2ZM6Q 4KK7A 3CQZB 4R8IA 4CJ0B 2KHSA 4MTKA 1V1PB 1E2ZA 1E1TA 4B08A 3K7AH 4MZ9A 3G48A 2OQ0A 4C3IG 5AFWA 2XGTA 4KD4A 2EYJA 5DLQE 1C48A 1E2WA 1EYGA 2F0PA 4DR2Q 2EXDA 3WOFA 1CHQD 5LMNW 3GTKH 1H9SA 2XRSD 1MJCA 1PH1A 2VQFL 3PO3G 1EOTA 4X64L 4JVZA 5C0XH 2WACA 1PTOD 4JI1Q 1CQVA 2K4KA 4N8X1 4B3SQ 2F0VA 2KUMA 3F2CA 5K36H 4DUYL 5JEAJ 1B3AA 4CDCC 4CDEC 3T53B 3I4MH 2E75C 1HFGA 2PMZE 1NMGA 3L0OA 4NXNQ 4A4IA 1ZYRD 4FF4A 1TS5A 3NUCA 3RD4A 4BS9A 1U5KA 2N78A 1VDZA 1SNQA 4IOAA 3RMHA 2CW0D 2PQEA 3UE1A 5KIXA 1BXTA 1I4GA 4JBKA 5ELCA 3NBIA 4BBSH 2K50A 4U673 1SFOB 2KQ3A 1A3VA 4AH6A 2XSCA 4P74A 4C2MB 2WAQE 4F87A 4KTAA 2I5MX 3KUPA 3URYA 3A8KE 3ERQA 1PFMA 2MUYA 4OEMB 3Q8DA 2KCMA 4QCLA 3I7FA 1CUKA 4IFDG 2NN6G 3G6JB 1GUGA 2JA9A 1N36L 2A6EC 1NBWA 1BCPC 5C0XJ 2FXQA 4DV5L 1FVIA 4LW1A 3MXUA 5C3XA 2PQAA 2F4VQ 3X3NA 1HTPA 3KLSA 3OHXC 1LYLA 1XYIA 1NR2A 2JA5B 4K5VA 2L15A 4FVMA 3S14B 4WORA 1P16A 4RMFA 1C8CA 3I73A 3HP3A 3CCVA 3BZCA 3MFYA 5ELFA 2CH4W 4LF9Q 1XMQL 4CKCA 1TWGB 3CQZH 4RGNA 4POFA 5GAEC 1L1OA 1TWFB 3NWSA 2JA7B 3K5LA 3Q6SA 1CK1A 1LTRD 2SEBD 1AH9A 5DAUA 3VR6A 1Y1WB 5CV7A 1VQOA 2K52A 3KDFA 1LT6D 2B2VC 3SXHA 1Q86C 1X3GA 2ZXPA 2OEOA 4FXKC 3PUVA 1FGUA 1OXVA 2X6LA 4DV6Q 4JYAQ 1H9JA 2F4IA 1BKBA 4OELB 4QL5A 3TZDA 1W6KA 4OONA 2WIIB 3OWEB 1VQHA 4ULLA 2SDFA 3NBHB 5FLMG 2Q2IA 5I6WA 4LF6Q 1A15A 3T16A 4RH6A 1F9SA 1K3BC 4A3MH 2DJGC 4X66Q 2LXKA 3E5SA 2PNRC 5A2QL 1RD9D 4DV2L 1HNXQ 1DZ1A 1PV4A 3NSWA 1IW7D 1N32L 1NAPA 1KAAA 5G3LF 4EQ5A 2JEBI 2Q2HA 3E3XA 2ALYB 3KLWA 3CD6A 3OSOA 3K57A 4IJHA 2HDMA 1VQLA 2EYMA 1HR0Q 3S2HB 1ET9A 1QNKA 1SFOH 1SRUA 1U4MA 1X3QA 4C2MH 4GNXB 1AE3A 2K04A 2B8GA 3HS0C 2K32A 4E6IA 2R7DA 1PVOA 1WTHA 1J6QA 2QILA 1SN8A 3VR5A 4LMQD 4QY7A 3UE0A 1VF5C 3R8BA 3HOUG 2N3SA 1I50H 3I90A 5D3DA 2F0IA 3CAMA 2UUAQ 1Y8PB 2K03A 3I3CA 4TSSA 2QCPX 2F3VA 4JI2Q 1RDPD 1I6HB 5DM73 3PIPA 1HZAA 4KD3A 2JA8B 1PRTF 2JA5H 4LFCQ 1LTID 1RCVD 2PO4A 2AHOB 1I94L 4L6TB 2KJXA 3S14H 1TQOA 2Z4HA 4KJNA 3CMEA 3VDYA 2B39A 2K05A 3U4ZA 3S15H 2F0LA 3PF4A 1VQJA 1RKNA 3I70A 2IHEA 3W5OA 2E2JH 2RF4A 3QWNA 3PUYA 1TWFH 2JA7H 1KRSA 4YWMA 1PH4A 4JI8Q 1WYDA 1Y1WH 2F52A 3E0EA 2HQEA 2YU9B 1MSGA 5JJIA 5HY6A 3F2UA 3CPWA 2V4DA 1L1OC 1SE2A 4YY3Q 2OXPA 1YI2A 1WTQA 4K5XA 1PA6A 3S1MB 4BBRG 2Y0SB 3CF5A 3KJOA 3JAME 1OXXK 2KCCA 4LFBL 5C44G 4XIGS 5IWAL 4P72A 2EYPA 3GO5A 1VQPA 2MFIA 4K8JA 4JI7Q 1EYDA 1EY6A 2I5HA 3K5NA 2CVRA 3M7GA 2A8VA 5IYCH 1A3TA 2B2WA 1XNRQ 2RKSA 4HJ7A 4BY1H 3CU7A 1O7YA 5IYDH 4X62L 1SJED 2IJ0A 4L5TA 1CHPD 3KF8A 2BA0A 2VS1A 3AU7A 3BYYB 2WP8J 4ABNA 3J7AF 3MXNB 2IHFA 1GHKA 4QQBX 3K0XA 3SDZA 1J5EL 3S2HH 1AW7A 1UUPA 5DEHA 2CHBD 4XQNA 4JI6Q 1AP0A 1X54A 2JA6G 5CV9A 4RFBA 5FK9C 3D31A 1N33Q 1YNND 3DEOA 3NXWA 2F0KA 1TS4A 1I6HH 2PZTA 5DM63 3H0GH 4PMWA 4A3DB 5JVH3 3GD7A 2JA8H 1PZID 5FKAC 2R93H 1OO9B 4AYBG 2EJGC 5HGQA 4P75A 3RZDH 3CPFA 4H13C 3VYUA 2UXDL 4CJ2C 4C3JH 2XWJB 1MGSA 1BCPF 3HZXA 1O7ZA 1J9OA 1SBBB 2KHIA 1G51A 3HKSA 5M9OA 3PMFA 4DFAA 1D7QA 2IL8A 3FKIB 4OIKA 2E5LQ 3I4MG 3G6EA 2YU9H 3KF6B 5LMUQ 1IBLQ 3E9HA 5D14A 1STEA 4G7ZC 1VQNA 4ZCKA 2K1BA 3CC7A 2PYKA 1I5FA 1UWVA 1EEFD 2R92H 1A0IA 1LABA 1HQRD 2RCNA 1QUQA 2F0UA 1O80A 2BDNA 1K8MA 3GV3A 2ZJRA 5ELEA 2Z9HA 4GKJL 5T1GA 1A2UA 2B29A 1M4VA 2RCFA 4QUFA
chains in the Genus database with same CATH topology
1LACA 2RBMA 5KNCA 5A35A 2E74C 3IFTA 1SNPA 4DA2A 3OMGA 1DOMA 5FO7B 1STHA 3P75A 3EFXD 2NUCA 2B2UA 1SNMA 3ITPA 1F2LA 5CYUA 4DAVA 4XT1B 1HPCA 1PFBA 1SXTA 2B2YA 4UDUC 2RVLA 1S5ED 1X3PA 4Q5VA 2IPKD 3MVVA 1IHZA 1EZ8A 4C3HB 2F3WA 5LL6S 1B9MA 4L63B 4ODGA 4FYDA 1SYEA 2D62A 1FYCA 2A69C 4IFDI 2NN6I 1CTMA 3I8ZA 4RA8A 1ESFA 2J4XA 2WB1B 5CR3A 1D2BA 2F0DA 5JAVA 1LT3D 4RKBA 3D4WA 4R8NA 5EPKA 2RQXA 1ILQA 4G7OC 2B2TA 4NMZA 4XDXA 3I4NB 3RZOB 2L11A 1A3UA 3FRPB 1LTAD 1HTLD 1B44D 2O5IC 1SE3A 1LTTD 1VMCA 1QNUA 2RDHA 3K5MA 1XX8A 4JBWA 4PNYA 1F77A 4BA1I 5K5PA 1NCVA 5CBAE 1A6XA 1GJXA 1CFMA 3DXJC 3HOVB 2F0GA 4OHJA 1L0YB 3NWTA 5I2XA 2SOBA 3A56A 2ZXOA 1KABA 3TZUA 4Y7NB 2A6HC 3AB9A 4XTCS 1HUMA 5CORA 3BVZA 2B2UC 2WAQB 1EWCA 4ME5A 1EU4A 2KOLA 4HMIA 1SYFA 5G3LD 5E4XA 4DU9A 3I91A 4XYOA 1D1IA 2SNSA 3GTJB 3BZDB 4IUTA 1TY0A 1I4PA 1DXMA 4RKLA 4A3GB 2F0MA 5EKKA 3MXGA 4M8AA 4HTHA 1H9SB 3CKIB 2E2HB 3MC0B 4KMUC 4IUUA 3H94A 4NW2A 3FMCA 1JOOA 3I72A 1Z6HA 1LT5D 4DK1A 4BBSB 2JSOA 4EVOA 1O78A 5EPJA 1HXYD 2Z8LA 1PRTD 2EDGA 1AFPA 2BOSA 2EY5A 2L9HA 1D6EC 1QJOA 1FR3A 4OO1H 2B2TC 2ZXRA 1BDOA 2HCIA 5C6AA 5C4JB 1KNAA 4I7ZC 4R9WA 2D5DA 2LMCB 5EQ0A 3HRZC 3N52A 2L5TA 4DN4M 1K83B 2IX0A 1KTKA 3ZYYX 5D65A 3RLFA 4L8JA 2RDGA 4DAYA 2EZVA 4KY5A 1DOLA 2JYOA 4WRDA 1MBYA 3J7AV 3AMUA 1D5XC 1S5DD 4H44C 1LO5D 2A68C 1KDBA 2IT1A 1XTCD 4ZLTF 4A3MB 3J80E 5I9OA 3DWPA 2K6AA 2M9VA 2NTSA 3I4LA 1SDFA 1IYVA 1G8ZD 3P1HA 1TR5A 5FLXE 3S16B 2MJ8A 1S5CD 4IUQA 5KRUA 4Q0FA 2ZT9C 1PTOC 3HGBA 1Y8NB 5KYLA 2H4OA 1QCBD 4DF7A 4PMCA 1OXSC 2KCNA 3C3LA 5EPLA 3UI2A 2IWHA 2RDFA 2XRQD 4KY6A 1JWUD 3HOXB 4A3FB 1S5FD 2F1MA 1VF7A 3BDCA 1ZYRC 2F0EA 2PW5A 4A93B 1EIGA 1HQMC 2BA1A 2C5CA 4K6DA 2CW0C 1I50B 2F0JA 3NP8A 5HGTA 1FNUA 3RUZA 1SYBA 2A6ED 4TQUS 2DNCA 2BE5D 4K14A 5CV8A 2AQ2B 2H1EA 2L12A 1ENFA 2KVMA 1I4QA 1T5EA 5C5MA 3S15B 3NTIA 4X3TA 1TWCB 5FOBB 2SNMA 2E2JB 2A74C 3SK5A 2OF1A 2X6GA 3J81E 1DONA 2KEEA 3SEBA 3K6OA 4KKUA 4OGQC 1FGBD 1FNVA 3K58A 2E76C 1UEAB 5JOBA 3Q24A 3OMCA 4KN7C 4O42A 1BO0A 2K28A 1SJHD 1Q8IA 1GUWA 1CA6A 4J6HA 2OT2A 2N88A 4BY1B 5CGKA 1X32A 3C1FA 2DN8A 5ELDA 5BN3A 4RGMA 2L1BA 2EYHA 1LLRD 5C3WA 3ONAB 2DY8A 3L9AX 3V05A 4EGVA 1IW7C 4FNFA 1JWSD 4BY7B 1D5MC 4NP5A 2ID0A 4HCSA 1EY8A 2XIWA 3HOYB 1ZXTA 5M5WB 4NKLA 4KN4C 1YNJD 1JOKA 4G4KA 1KDAA 5E1FA 1ILPA 3H0GB 1WTOA 3FDTA 3WDNA 3GTOB 3VR3A 2R93B 3RZDB 3M3YB 2FFKB 2MPMA 2F0QA 4C3HG 3V96A 4C3JB 3TMEA 4A3IB 1EZ6A 1D5ZC 2EJFC 3HOZB 1SYCA 5CV6A 5IT9E 2J0TD 5EBDA 3FPUB 5M5YB 2XN9C 1EEID 3Q23A 2L55A 1WD1A 4IZ8A 2AQ1B 4CJ1B 1HHVA 5I4DA 1LTBD 5C4HA 2R92B 1R4PB 3PUXA 4HSVA 4C3IB 1Y69U 2VB2X 1RTOA 5KGUA 5F2DA 3VYTA 1F9QA 3A8JE 1WTRA 4DXGA 4C1NK 3KLRA 2C9OA 3TP6A 3GQBA 1FD7D 5JEAG 5FO9B 3S1QB 4WJWA 4C1NI 1PZJD 2EYFA 2NVYB 4A3BB 1KDCA 1SMYD 1J8IA 1XWEA 3QOJA 3MEHA 2EPBA 3QIAA 1PTOF 4KKTA 5E4WC 2X69A 5M3MB 4A3KB 3NQTA 5JPNC 3QOLA 4ILWA 3EROA 3J81L 4K5WA 4H0LC 1GHJA 3WOEA 1JQYD 2IW3A 2J7ZA 2Q8TA 2NVXB 2M2LA 5C0XG 1ML0D 1IKLA 1EIHA 3SK8A 3GTGB 3L3OC 1YNNC 3GTQB 5K36G 2EE1A 2MHVA 1HRJA 1TU2B 3W3AA 5KNDA 3KBGA 4QUCA 4K8IA 3ND8A 5CC4A 1E2VA 4ZQ3A 3D6CA 5T1IA 2L0CA 1F2ZA 1SE4A 4M1UB 4CGYB 2ENBA 1V8QA 1PRTB 3PUZA 3PO2B 5M3FB 1EY0A 4RGTA 3SK6A 3VA7A 1CZWA 2O5JC 1CM9A 3Q22A 1CA5A 4K2LA 1ET6A 2VNUD 4V190 1EY4A 4DXFA 1NUCA 1SEBD 2FMCA 1EQTA 4X3SA 2KA7A 4GZYC 1S4ZA 1H9RA 3S2DB 1WD0A 1DM0B 2FHTA 3K0YA 1V1OA 3DWAA 1GUSA 2VXWA 2DY7A 4WFN3 5IIFA 2GA4B 3U9SA 1ICWA 3T51B 2HUGA 2LS01 4YIJA 1SNDA 4KKSA 1CQFA 1R9TB 3BDLA 5IGCA 4HAEA 3JAML 4FF1A 3TP8A 3H3VC 4X3UA 1S5BD 2EYLA 1TIID 5IODA 2KEDA 3NK9A 2EY2A 2LKVA 5IGEA 1GUTA 3M4YA 4QB4A 1D1KA 3NHHA 1EQVA 5EJWA 3DHQA 4DK0A 3PV0A 5BN5A 1LT4D 4RGOS 4ZKCB 4ZUJA 3MTSA 5I6YA 1HA6A 1EYCA 3A55A 4OL7A 1WCMB 5I9PA 1STNA 3PIP3 1BCPB 4ZYSA 1G2TA 1U4RA 1DOKA 1STYA 2NYZD 3BYTB 3EJIA 1NR4A 3NTKA 1K8OA 2BDOA 3IFDA 4FO2A 5C3EB 5ISRA 1WTWA 3K59A 1F2YA 3GP7A 1EL0A 2YYZA 5D3IB 3VYRA 2WKDA 5JPMC 1MD2D 2M00A 1AZPA 1DCZA 3A7LA 1I4XA 1TVXA 2RSOA 1MSHA 2NZ1D 4J8QA 1B2TA 5C4XB 3D4DA 2BCOA 2EVBA 3OPOA 3C1EA 4XQQA 2B8FA 1QG7A 1WTVA 3MZ5A 1PLFA 2F0HA 1OXTA 4CBVA 1B50A 1ENAA 4NDXA 3H6MA 1F2MA 1NSNS 4LAAA 3TBIB 4G7HC 1WVLA 2AQ3B 5KNBA 2D2CC 3TP5A 3A8IE 2EY1A 4KHVA 5A2QE 2R6GA 2K5QA 2AUKA 3SR1A 1BUVT 4XYQA 3HEJA 3S17B 4C3JG 1TWHB 3M4OB 2CQAA 5FO8B 4RWSC 4CHTB 1R4QB 1JB3A 2A73B 2B63B 2R3ZA 5COYA 3EA6A 1LV9A 3T4AC 3GTPB 4DAPA 1KLUD 3TDQA 1AN8A 1CI3M 3QO2A 3LWUA 4KHZA 3VYSA 1TS3A 3NE5B 1JWMD 1T5XD 2A68D 3CRLC 1PXUA 1HCZA 3LWEA 4FXDA 1JCKB 2IX3A 3KLSX 4A3JB 3HOWB 3DWQA 4IALA 4RCNA 1H9MA 2FMMA 1BF4A 1QILA 4IQZA 1Q1EA 4O1NA 1EY5A 3KBXA 4KJOA 1Q12A 2ICEC 5C0XI 5JVG3 3OOCA 2VUMB 4F8MA 4F88A 1LTSD 3SVMA 4TRDA 1IL8A 3D8GA 1BCPD 2R61A 1VCIA 2K5DA 2R7ZB 1ONLA 2G9HD 3PIO3 4EQOA 1EY9A 2Z4IA 5I2YA 4IUVA 3BG3A 5EGTA 3V2TA 1RJTA 3HG9A 4KI0A 2F0SA 1BNZA 2EYOA 2BE5C 2QEJC 1SAPA 3TP7A 1TT2A 4DNRB 2DNEA 1E0BA 2NVTB 4XQJA 1V1PA 1Y8OB 3EVQA 4B9WA 2F0NA 4IUPA 2E2IB 4KV6A 4DNTB 4J1MA 1DJRD 2KECA 5CBEE 4N9PA 3K5OA 3QG1A 2N55A 5CV4A 1CT1D 5CMDA 1I4HA 3C2PA 1L0XB 1TKWB 4JK1C 3OW7A 1EYAA 3W2DA 1ENCA 1SNCA 4BA2I 1PFNA 1XXGA 2D9UA 1PYWD 2A5HA 4MN3A 4CKBA 2NBFA 1JR0D 3DM1A 2JXMB 4HSPA 2O4XA 3CHBD 1C4QA 1RODA 3IKJA 4XT3B 5HURA 3BVGA 4G57A 2QDBA 3GV6A 3MAQA 3A54A 5IGBA 2TMPA 1G2SA 1EWHA 1YNJC 3KK7A 1KNEA 1QOHA 5JJZA 3N6RA 4IURA 3SK4A 3E6ZX 2JEAI 2F0WA 1F9RA 5ELBA 3J80L 1Y1VB 1I3QB 1JC7A 2Z1CA 1A2TA 5FLXL 3S1NB 3NBHA 3GTLB 2EOTA 3NQIA 2Q8IB 1G6ZA 1G291 1TWAB 3OIPA 5EBCA 3OIQA 4DGZA 3LX0A 4ZK9B 4OO1G 1AEXA 3PO3B 3A7AB 3MFGA 3IAYA 2K33A 1H9KA 2RA4A 4FP5D 1ESRA 1ZKOA 1HFNA 1JICA 1SNOA 4A3EB 1JOQA 4HEDA 2NVQB 3P7JA 2XNAC 3VR4A 3DMUA 4RHRA 2PZUA 1GUNA 1ZEQX 1SMYC 1U4LA 3IL8A 2WV6D 4PV1C 3NTHA 2G9DA 3HKZB 4MHEA 4S3SA 1UNSA 1SYDA 5IGDA 4BWGB 1MI2A 4FF3A 4LJZC 3J7YW 2AWOA 2JP1A 2EY6A 2VB3X 2HDLA 5J22A 1U9RA 3G7LA 3GTMB 3EQLC 2PZWA 3QB3A 5LL6X 2L4NA 2AWNA 1I6VC 1PDQA 1F9PA 2Q8RE 4IUNA 2F03A 4UAIA 5M5XB 3M7NA 2NWGA 3T13A 2WINB 1SSOA 3NPPA 4B9XA 3MXNA 3M85A 2LY7A 1B4OA 5IGFA 1O7LA 4K6LA 1G91A 2I46A 1DYQA 2JE6I 4ZAIA 1Q1BA 2B2WC 4K2KA 1GXDC 4QIWB 4EQPA 3VA5A 3MHBA 1I4RA 1QWYA 4PMBA 2F0OA 5CV5A 5EKLA 4CKEA 1TS2A 1LTGD 2K7VA 2EXZA 5IT9L 1EY7A 2AUJD 3D3RA 3MA2B 4MIUA 3TN2A 3T56B 3HOUB 4IFDH 3VR2A 2NN6H 3D4RA 3D6WA 1W6JA 2WKCA 3QJYA 3R3OA 3TSSA 4LK1C 2A69D 5TSSA 1WTPA 2QKIC 1B9NA 4ZKBB 1JE4A 2RSNA 4N9TA 3BDOA 1EU3A 2F0FA 3H09A 1OXUA 4TKOB 5LHY1 5BN4A 1GOZA 2FINB 1PTOB 1RHPA 4V0BA 4P2CB 5KEEA 1STAA 4HR7B 1BBXC 3U9OA 2O2LD 4BBRB 2PPBC 5J39A 4IFDJ 5IGGA 1Z47A 4OIJA 1U4PA 1QE6A 4QF4A 5C44B 1TY2A 3MWYW 1Q90A 3ND9A 3BS1A 5E3FA 1JORA 4F7XA 4U68A 3OWFA 1II3A 3DUZA 1UAPA 3R2TA 4RAUC 4ID6A 2EJMA 4ZUIA 3L7ZC 1SYGA 5NUCA 1KLGD 5C4ZA 3C46A 2A6HD 4PQXA 3MXPA 1Q3LA 5IOCA 2NB0A 3P20A 4FF2A 3S1RB 3R93A 4KY7A 2E2DC 2PMZB 2JA6B 1BQQT 3E0JA 2PCFB 4C56C 3K7AB 2ICIA 3FEWX 2XWBB 4EQNA 4HCEA 2MP1A 5KYIA 4I65A 1IKMA 3GTKB 4AYBB 1AZQA 1CZGA 2PW7A 1QB5D 2FJ2A 3S9WA 2B2YC 2QF7A 1PMRA 3X3MA 1GUOA 1STBA 1PTOH 4ZRZA 1HA5A 3PUWA 3I4MB 1HUNA 2MGSA 4HMJA 5DNFA 2F0TA 4HN7A 1WTXA 3Q0AA 5C5LA 2K01A 1RF2D 2HCCA 2I07B 2XVSA 1FNWA 1PZKD 1M8AA 1B53A 3R2IA 1IYUA 5J1ZA 1V43A 4H7BA 1PRTC 3CRKC 2K5WA 5EKIA 3BVMA 4QMGA 1BR9A 3DEPA 3SHLA 3H91A 2IX1A 4IN3A 4Z9CB 4RCOA 3LNNA 4X3KA 1RTNA 2NTTA 4XXEA 4FXGC 3SE0A 1B1ZA 1Z7TA 4RHSA 4OO1I 5JEAH 2TSSA 3O13A 2LFNA 1DD2A 3FVQA 1VMPA 1BOSA 1EFID 3FPPA 2B2VA 1STGA 4KK7A 3CQZB 4R8IA 4CJ0B 2KHSA 1V1PB 1E2ZA 4B08A 4C3IG 5AFWA 4KD4A 2EYJA 1C48A 1E2WA 2F0PA 3WOFA 1CHQD 1H9SA 2XRSD 1EOTA 5C0XH 2WACA 1PTOD 1CQVA 2F0VA 2KUMA 5K36H 5JEAJ 1B3AA 3T53B 2E75C 1HFGA 1ZYRD 4FF4A 1TS5A 3NUCA 3RD4A 4BS9A 1VDZA 1SNQA 3RMHA 2CW0D 2PQEA 5KIXA 1BXTA 1I4GA 5ELCA 3NBIA 4U673 1SFOB 2KQ3A 1A3VA 2XSCA 4C2MB 4F87A 4KTAA 3KUPA 3URYA 3A8KE 3ERQA 1PFMA 2MUYA 4QCLA 4IFDG 2NN6G 3G6JB 1GUGA 2A6EC 1BCPC 5C0XJ 3MXUA 5C3XA 3X3NA 1HTPA 3KLSA 3OHXC 1XYIA 1NR2A 2JA5B 4K5VA 4FVMA 3S14B 4WORA 1C8CA 3I73A 3HP3A 3MFYA 5ELFA 4CKCA 1TWGB 4RGNA 1TWFB 3NWSA 2JA7B 3K5LA 3Q6SA 1CK1A 1LTRD 2SEBD 5DAUA 3VR6A 1Y1WB 5CV7A 1LT6D 2B2VC 3SXHA 2ZXPA 2OEOA 4FXKC 3PUVA 1OXVA 2X6LA 1H9JA 2F4IA 3TZDA 1W6KA 2WIIB 3OWEB 4ULLA 2SDFA 5I6WA 1A15A 3T16A 4RH6A 1F9SA 3E5SA 2PNRC 5A2QL 1RD9D 1DZ1A 3NSWA 1IW7D 1NAPA 1KAAA 5G3LF 2JEBI 3OSOA 3K57A 2HDMA 2EYMA 3S2HB 1ET9A 1QNKA 1U4MA 1X3QA 2K04A 2B8GA 3HS0C 2K32A 4E6IA 2QILA 3VR5A 4LMQD 1VF5C 3R8BA 3I90A 5D3DA 2F0IA 1Y8PB 2K03A 3I3CA 4TSSA 2QCPX 2F3VA 1RDPD 1I6HB 5DM73 4KD3A 2JA8B 1PRTF 1LTID 1RCVD 2PO4A 4L6TB 2KJXA 1TQOA 2Z4HA 4KJNA 2B39A 2K05A 2F0LA 1RKNA 3I70A 3QWNA 3PUYA 2HQEA 2YU9B 1MSGA 3F2UA 2V4DA 1SE2A 2OXPA 1WTQA 3S1MB 4K5XA 2Y0SB 3JAME 1OXXK 2KCCA 4XIGS 2EYPA 3GO5A 4K8JA 1EYDA 1EY6A 3K5NA 2CVRA 3M7GA 1A3TA 2B2WA 2RKSA 3CU7A 1O7YA 1SJED 2IJ0A 1CHPD 3KF8A 2BA0A 3AU7A 3BYYB 2WP8J 4ABNA 3J7AF 1GHKA 3SDZA 1AW7A 1UUPA 5DEHA 2CHBD 4XQNA 1AP0A 5CV9A 4RFBA 5FK9C 3D31A 1YNND 3DEOA 3NXWA 2F0KA 1TS4A 2PZTA 5DM63 4PMWA 4A3DB 5JVH3 3GD7A 1PZID 5FKAC 1OO9B 2EJGC 4H13C 3VYUA 4CJ2C 2XWJB 1MGSA 1BCPF 3HZXA 1O7ZA 1J9OA 1SBBB 5M9OA 4DFAA 3PMFA 2IL8A 3FKIB 4OIKA 5D14A 1STEA 4G7ZC 2K1BA 2PYKA 1EEFD 1LABA 1HQRD 2F0UA 1O80A 2BDNA 1K8MA 3GV3A 5ELEA 5T1GA 1A2UA 1M4VA 4QUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTS A;  2KUM A;  5T1I A;  4CJ1 B;  4DN4 M;  4ZKB B;  2B2Y C;  1B3A A;  1HA6 A;  1NAP A;  1HHV A;  4IUV A;  1JE4 A;  1MI2 A;  1G2S A;  2RSN A;  5D65 A;  4O42 A;  1BO0 A;  2K28 A;  1RJT A;  1HFG A;  1KNE A;  4HSV A;  1GUW A;  1CA6 A;  1DOM A;  2HDM A;  1BNZ A;  5JJZ A;  2JP1 A;  1RTO A;  1HUN A;  1HUM A;  2MGS A;  1AP0 A;  4IUR A;  1DOL A;  2B2U A;  1QNK A;  1U4M A;  1X3Q A;  2FIN B;  1SAP A;  2JYO A;  5DNF A;  1F9R A;  5COR A;  2HDL A;  1G2T A;  1RHP A;  1WTX A;  2B2U C;  1F2L A;  1F9Q A;  1E0B A;  1U4R A;  2K04 A;  2N88 A;  1WTR A;  2K01 A;  1CM9 A;  1CA5 A;  1DOK A;  2HCC A;  2NYZ D;  3G7L A;  4XT1 B;  1PFB A;  2B2Y A;  2KOL A;  2RVL A;  4IUP A;  1BBX C;  4RWS C;  1X3P A;  4LMQ D;  5E4X A;  4ZLT F;  1M8A A;  3KUP A;  1NR4 A;  1X32 A;  1B53 A;  3DEO A;  3I91 A;  3I90 A;  1PFM A;  2L4N A;  2K03 A;  1PDQ A;  2R3Z A;  2L1B A;  3I3C A;  1F9P A;  1SDF A;  2KEC A;  3IFD A;  4IUT A;  1EQT A;  2Q8R E;  1U4P A;  1QE6 A;  4OIJ A;  5COY A;  1LV9 A;  2EOT A;  2MJ8 A;  4X3S A;  1WTW A;  4UAI A;  3MWY W;  3ONA B;  4IUQ A;  5EKI A;  2N55 A;  1G6Z A;  4CJ2 C;  4QUF A;  1S4Z A;  3DEP A;  1J8I A;  1EL0 A;  3H91 A;  2DY8 A;  1MGS A;  4IUU A;  1WD0 A;  2FHT A;  2NWG A;  3QO2 A;  3I8Z A;  2EPB A;  5CMD A;  1O7Z A;  1J9O A;  1SSO A;  4U68 A;  4ZK9 B;  4NW2 A;  1XYI A;  1NR2 A;  4X3K A;  2VXW A;  1RTN A;  2DY7 A;  2K05 A;  4HCS A;  5EPL A;  4RA8 A;  3UI2 A;  4RAU C;  5E4W C;  2X69 A;  2XIW A;  2IL8 A;  4OIK A;  1AZP A;  3LWE A;  1ICW A;  1ZXT A;  1C8C A;  1TVX A;  2HUG A;  2RSO A;  3HP3 A;  1B4O A;  1PFN A;  1MSH A;  2NZ1 D;  1B2T A;  1EIG A;  5EPJ A;  1G91 A;  1VMP A;  2D9U A;  5D14 A;  2RA4 A;  4ZAI A;  4HAE A;  1ILP A;  1ESR A;  1HFN A;  2B2W C;  1WTO A;  1MSG A;  1JIC A;  4X3U A;  3Q6S A;  1Q3L A;  3F2U A;  3FDT A;  2K1B A;  2FMM A;  2J7Z A;  2L9H A;  2B2V A;  4MN3 A;  1WTQ A;  2Q8T A;  1BF4 A;  3R93 A;  4R8I A;  2M2L A;  3DM1 A;  1ML0 D;  2H1E A;  2L12 A;  5EPK A;  1IKL A;  2B2V C;  4CJ0 B;  1ILQ A;  2FFK B;  2MPM A;  3KBX A;  4HED A;  1EIH A;  1QG7 A;  2KED A;  3P7J A;  1WTV A;  2B2T A;  1O80 A;  4XDX A;  2L11 A;  2X6L A;  2EE1 A;  5AFW A;  1PLF A;  2BDN A;  1VMC A;  2B2T C;  3GV3 A;  3TZD A;  2KVM A;  1HRJ A;  2HCI A;  1ROD A;  1XX8 A;  1B50 A;  2CVR A;  1KNA A;  4XT3 B;  2SDF A;  4R9W A;  3TN2 A;  3SVM A;  1A15 A;  2B2W A;  4QUC A;  4X3T A;  1U4L A;  3IL8 A;  3D6W A;  5T1G A;  1WVL A;  2MP1 A;  3FPU B;  5EJW A;  1O7Y A;  1DZ1 A;  1IL8 A;  1F9S A;  2X6G A;  5CBE E;  1NCV A;  5CBA E;  1EOT A;  1IKM A;  1DON A;  3GV6 A;  4MHE A;  2KEE A;  5EQ0 A;  4ZKC B;  1AZQ A;  1WTP A;  3N52 A;  1WD1 A;  2FJ2 A; 
#chains in the Genus database with same CATH topology
 1LAC A;  2RBM A;  5KNC A;  5A35 A;  2E74 C;  3IFT A;  2OQK A;  4JI0 L;  2Y0S E;  4B3M L;  1SNP A;  1K9M C;  4DA2 A;  2NVY H;  4A3B H;  1CKN B;  4NXM Q;  3OMG A;  1DOM A;  5FO7 B;  1STH A;  5GAD C;  3P75 A;  2UXC Q;  3EFX D;  2ASB A;  5GAH C;  2UXB L;  1EFW A;  1YNX A;  2NUC A;  2B2U A;  3OTO L;  1SNM A;  3ITP A;  1F2L A;  5CYU A;  3T1Y Q;  3CC2 A;  4MNO A;  4DAV A;  4A3D H;  4XT1 B;  1HPC A;  1PFB A;  1SXT A;  2B2Y A;  4UDU C;  2RVL A;  1IBM Q;  1S5E D;  3B6Y A;  1X3P A;  1KRT A;  1PYS B;  3EN2 A;  4Q5V A;  3HOW G;  4JBJ A;  2IPK D;  4GOP C;  3MVV A;  1IHZ A;  1EZ8 A;  4LF5 Q;  4C3H B;  1Y14 B;  2F3W A;  5LL6 S;  4IPG A;  1B9M A;  4L63 B;  4HJ5 A;  3BZK A;  4ODG A;  2NVX H;  4FYD A;  1SYE A;  2D62 A;  1FYC A;  1D8L A;  4GLV B;  2A69 C;  4YWK A;  4IFD I;  2NN6 I;  1CTM A;  1VQ5 A;  1QVG A;  3FKI H;  3I8Z A;  3CCE A;  3D0F A;  4RA8 A;  1ESF A;  4YCU A;  2J4X A;  2WB1 B;  3KOJ A;  5CR3 A;  1W3S A;  4UY8 C;  1D2B A;  2F0D A;  4JI4 L;  1HJP A;  1YHA A;  4GN5 A;  2JQO A;  5JAV A;  1LT3 D;  1E7Z A;  1EWI A;  2KBN A;  4RKB A;  3D4W A;  4R8N A;  4HJA A;  5EPK A;  2RQX A;  1ILQ A;  4DV4 Q;  2K5V A;  1YHQ A;  4G7O C;  2B2T A;  2WFW A;  4NMZ A;  4XDX A;  3I4N B;  3RZO B;  2L11 A;  1A3U A;  3FRP B;  1LTA D;  1HTL D;  1B44 D;  2O5I C;  1SE3 A;  1LTT D;  1VMC A;  1QNU A;  2RDH A;  3K5M A;  1XX8 A;  2UU9 L;  4JBW A;  1S40 A;  1YZ6 A;  3AQQ A;  4PNY A;  1F77 A;  4BA1 I;  3KJP A;  5K5P A;  1NCV A;  5CBA E;  1KAW A;  1A6X A;  1CFM A;  1GJX A;  3DXJ C;  3ZJY C;  3HOV B;  2F0G A;  4OHJ A;  1L0Y B;  3NWT A;  5I2X A;  4DV7 L;  4DR3 L;  1VQC A;  2SOB A;  4IPH A;  3A56 A;  1NMF A;  1K73 C;  2ZXO A;  4YCW A;  2JA7 G;  1KAB A;  1X56 A;  3TZU A;  4Y7N B;  2A6H C;  3AB9 A;  1Y1W G;  4XTC S;  1HUM A;  1JMC A;  4NB3 A;  5COR A;  3BVZ A;  2BH2 A;  2B2U C;  2WAQ B;  1EWC A;  4DUY Q;  5IP7 H;  4ME5 A;  1EU4 A;  5LMN L;  3RLO A;  2VL6 A;  2KOL A;  4HMI A;  4C3H H;  1SYF A;  5G3L D;  5E4X A;  4DU9 A;  3I91 A;  1SRO A;  4DKA C;  4XYO A;  3CCQ A;  1D1I A;  2SNS A;  3GTJ B;  4JV5 L;  3BZD B;  4IUT A;  1TY0 A;  1I4P A;  1DXM A;  4RKL A;  4A3G B;  2F0M A;  3QR8 A;  1P8L A;  5EKK A;  1WJJ A;  3MXG A;  4HTH A;  4M8A A;  1H9S B;  3CKI B;  1XPO A;  1IBK L;  2E2H B;  3MC0 B;  5GRO A;  1E22 A;  3T1H L;  4KMU C;  4IUU A;  1N34 Q;  3H94 A;  1V1Q A;  4P73 A;  4YHH L;  4NW2 A;  3FMC A;  1JOO A;  5ELN A;  3I72 A;  1Z6H A;  1LT5 D;  4OWW B;  4DK1 A;  1XMO L;  4BBS B;  2JSO A;  4EVO A;  1O78 A;  3OW2 A;  5EPJ A;  1HXY D;  2Z8L A;  3U4V A;  4DPG A;  1PRT D;  3OYY A;  2EDG A;  1AFP A;  2BOS A;  4GN4 B;  2EY5 A;  2L9H A;  1D6E C;  3I4N H;  4LF8 Q;  1YEZ A;  1QJO A;  1WFQ A;  4GKK L;  4X6A H;  1FR3 A;  4LF7 Q;  4OO1 H;  2B2T C;  2ZXR A;  1BDO A;  2HCI A;  5C6A A;  5AJ3 L;  5C4J B;  1KNA A;  1IL2 A;  4I7Z C;  4R9W A;  2D5D A;  2LMC B;  4L5R C;  3CCU A;  4LUO A;  5EQ0 A;  2PQA B;  5IP9 H;  3HRZ C;  3N52 A;  5C3E H;  2L5T A;  4DN4 M;  4Y7N H;  1XNQ L;  1K83 B;  2IX0 A;  2UUC L;  5E7N A;  1KTK A;  3ZYY X;  5D65 A;  3RLF A;  4L8J A;  2RDG A;  2Z6K C;  4DAY A;  4DUZ Q;  2EZV A;  4KY5 A;  1HZB A;  1DOL A;  2JYO A;  4WRD A;  1MBY A;  3J7A V;  3TS0 A;  1D5X C;  4LFA L;  3AMU A;  1S5D D;  2QA4 A;  4H44 C;  1LO5 D;  2A68 C;  3KDF B;  1KDB A;  3GTJ H;  3PCO B;  4BXX G;  2IT1 A;  1XTC D;  4H02 A;  4ZLT F;  4A3M B;  4A3G H;  3J80 E;  5I9O A;  3DWP A;  2K6A A;  2M9V A;  2NTS A;  3I4L A;  1SDF A;  1IYV A;  2E2H H;  1G8Z D;  3P1H A;  3LGJ A;  1TR5 A;  4A3E G;  5FLX E;  3S16 B;  2MJ8 A;  1S5C D;  1HZC A;  4IUQ A;  5JJK A;  5KRU A;  4Q0F A;  2ZT9 C;  1PTO C;  2PI2 A;  3HGB A;  1Y8N B;  5KYL A;  2H4O A;  2DGY A;  1QCB D;  4DF7 A;  4DV3 Q;  4PMC A;  1OXS C;  2KCN A;  3C3L A;  5EPL A;  3UI2 A;  2IWH A;  2RDF A;  2XRQ D;  4KY6 A;  1JWU D;  3HOX B;  4A3F B;  1S5F D;  2F1M A;  1VF7 A;  3BDC A;  1ZYR C;  4HID A;  2F0E A;  4PZ8 A;  2PW5 A;  3HKZ G;  1EIG A;  1HQM C;  2BA1 A;  1K8G A;  2C5C A;  4K6D A;  4A93 B;  4JC0 A;  1PHJ A;  1IZ6 A;  2CW0 C;  1I50 B;  2F0J A;  4WJ3 M;  3NP8 A;  5HGT A;  1FNU A;  3RUZ A;  1SYB A;  2A6E D;  2YTV A;  4TQU S;  2DNC A;  2OTL A;  2BE5 D;  4K14 A;  5CV8 A;  2AQ2 B;  2H1E A;  2L12 A;  2HT1 A;  4A3D G;  1ENF A;  5C4J H;  2KVM A;  1I4Q A;  4GLX A;  1SLJ A;  1T5E A;  5C5M A;  3FP9 A;  3S15 B;  4JI5 L;  2D0O A;  1TWH H;  3M4O H;  3NTI A;  4X3T A;  1TWC B;  5FOB B;  2SNM A;  2E2J B;  2A74 C;  3SK5 A;  1K0S A;  2OF1 A;  2X6G A;  3J81 E;  3FKI G;  1DON A;  1K83 H;  2KEE A;  4DV0 L;  2CKZ B;  3SEB A;  3AYH B;  3K6O A;  4KKU A;  2A19 A;  4OGQ C;  1FGB D;  3I4O A;  1FNV A;  4IPD A;  3K58 A;  2E76 C;  1UEA B;  5JOB A;  3Q24 A;  4QGU A;  3OMC A;  3J81 j;  4KN7 C;  1UE6 A;  3K81 C;  1BO0 A;  4O42 A;  2K28 A;  1HNW Q;  1SJH D;  1Q8I A;  3A5U A;  1CA6 A;  1FJG L;  1GUW A;  4J6H A;  2Q2T A;  3UDF A;  2UUB L;  1C9O A;  2OT2 A;  1JB7 A;  2N88 A;  4BY1 B;  2ZM6 L;  5CGK A;  3W1B A;  1X32 A;  4KHP Q;  1LM0 A;  2QDL A;  3S16 H;  3C1F A;  2DN8 A;  5ELD A;  4EX5 A;  2LSS A;  5BN3 A;  3AEV A;  4RGM A;  2L1B A;  2EYH A;  4YCV A;  1LLR D;  3K7U C;  5C3W A;  3ONA B;  3CP0 A;  1SMX A;  4UHV A;  2DY8 A;  3L9A X;  3V05 A;  1XTD A;  4EGV A;  1IW7 C;  4FNF A;  4R4Q A;  3HOX H;  4A3F H;  1JWS D;  1MIU A;  4BY7 B;  1D5M C;  4NP5 A;  2ID0 A;  4HCS A;  4A93 H;  1EY8 A;  4DR7 Q;  2XIW A;  3HOY B;  4A3C H;  4JI1 L;  1ZXT A;  5M5W B;  4NKL A;  4B3S L;  1CSQ A;  4KN4 C;  1JJC B;  1HNZ L;  1YNJ D;  1IXR A;  1JOK A;  4G4K A;  4DAM A;  1KDA A;  2R7Z H;  4A3L G;  2N8N A;  5E1F A;  1ILP A;  3H0G B;  1WTO A;  3FDT A;  4NXN L;  3WDN A;  1K0R A;  3GTO B;  3VR3 A;  5IP7 G;  2R93 B;  3RLN A;  1Q81 C;  3RZD B;  3M3Y B;  2FFK B;  2MPM A;  2F0Q A;  4C3H G;  3V96 A;  4C3J B;  4JBM A;  3TME A;  4A3I B;  1EZ6 A;  1D5Z C;  1TWC H;  2EJF C;  3HOZ B;  1SYC A;  1KQS A;  5CV6 A;  5IT9 E;  2J0T D;  5EBD A;  3FPU B;  5M5Y B;  2XN9 C;  1BBW A;  1PH8 A;  2IY5 B;  4B3R Q;  1EEI D;  2WB1 G;  3Q23 A;  4OWX B;  3HFZ B;  2L55 A;  1WD1 A;  4IZ8 A;  2AQ1 B;  1PH2 A;  4CJ1 B;  2F4V L;  1HHV A;  4GKJ Q;  5I4D A;  1LTB D;  5C4H A;  2R92 B;  1QVF A;  1R4P B;  3PUX A;  4HSV A;  1EQQ A;  4C3I B;  1YHB A;  3J7A 5;  1Y69 U;  2VB2 X;  1RTO A;  5KGU A;  5F2D A;  3VYT A;  2ZTD A;  2VW9 A;  3TS2 A;  4DR6 Q;  1UE1 A;  4HIO A;  1VQI A;  3I4N G;  1F9Q A;  4NPS A;  3A8J E;  1WTR A;  4DXG A;  4B3M Q;  1CSP A;  4C1N K;  3KLR A;  2C9O A;  2ZTC A;  5FJ8 G;  1QUQ B;  1VQE A;  3TP6 A;  1NY4 A;  1A63 A;  1KIX A;  3GQB A;  1FD7 D;  4DV6 L;  5JEA G;  4JYA L;  5FO9 B;  3S1Q B;  4WJW A;  3CCS A;  4DR1 Q;  3HOV G;  4C1N I;  1PZJ D;  2EYF A;  4GNX A;  2NVY B;  4BY7 H;  4A3B B;  1KDC A;  3E9I A;  1SMY D;  1J8I A;  1XWE A;  3QOJ A;  5IE8 A;  1KHI A;  4LF6 L;  3MEH A;  5IP9 G;  3HOY H;  2EPB A;  3M4P A;  2D0P A;  3QIA A;  1PTO F;  5M5W H;  1XJV A;  4JCV E;  5BR8 Q;  1RIP A;  4KKT A;  5E4W C;  4X66 L;  2X69 A;  3I55 A;  1WI5 A;  4GOP A;  5M3M B;  4A3K B;  2YTX A;  3NQT A;  1EIY B;  4R4T A;  5JPN C;  3TQY A;  3U58 A;  3GDE A;  3QOL A;  1MHW C;  3ERO A;  2WAQ G;  4ILW A;  3J81 L;  4LF4 Q;  3GTO H;  4K5W A;  1HZ9 A;  3M3Y H;  4H0L C;  1GHJ A;  4WJ4 A;  3WOE A;  1JQY D;  3F2B A;  2IW3 A;  2J7Z A;  3J7Z C;  2Q8T A;  4A3I H;  2NVX B;  2M2L A;  5C0X G;  1ML0 D;  1PH6 A;  1IKL A;  3RN2 A;  1EIH A;  3SK8 A;  3GTG B;  3L3O C;  1YNN C;  3GTQ B;  3HOZ H;  5K36 G;  1VQ6 A;  1VQD A;  4A3G G;  1QVC A;  2EE1 A;  2MHV A;  1HRJ A;  4ME3 A;  1TU2 B;  1EUJ A;  3W3A A;  5M5Y H;  4GLA C;  5KND A;  3KBG A;  2UUA L;  3H3V I;  4JI3 Q;  4QUC A;  1I3Q H;  1UE7 A;  4K8I A;  1DGS A;  4X65 Q;  3ND8 A;  5CC4 A;  4B3T Q;  1E2V A;  3FHW A;  4JI2 L;  1Q7Y C;  1X3F A;  4ZQ3 A;  3CC4 A;  4BBS G;  1K28 A;  3D6C A;  4LFC L;  3S1N H;  1S3O A;  5T1I A;  1GKH A;  4C3I H;  2PNH A;  2L0C A;  1F2Z A;  1SE4 A;  4M1U B;  5EAY A;  3JAM c;  3PSI A;  4CGY B;  2H5X A;  4OX9 Q;  2ENB A;  1XPU A;  1V8Q A;  1PRT B;  3JC6 6;  3PUZ A;  3PO2 B;  2CQO A;  5M3F B;  1EY0 A;  1YJW A;  4RGT A;  3SK6 A;  3VA7 A;  3M4Q A;  1CZW A;  1YIT A;  4PG3 A;  4DR4 L;  2O5J C;  1CM9 A;  3Q22 A;  1CA5 A;  4K2L A;  2OCE A;  4CDD C;  3TRE A;  4YY3 L;  1ET6 A;  2VNU D;  4V19 0;  1EY4 A;  3S1Q H;  4DXF A;  3G71 A;  1NUC A;  1SEB D;  2FMC A;  1VQK A;  1PH9 A;  1EQT A;  1VQ9 A;  4JI7 L;  4X3S A;  2KA7 A;  4AQY L;  1B8A A;  4GZY C;  1PYB A;  1S4Z A;  4GNX C;  2NZH A;  1H9R A;  3S2D B;  1WD0 A;  1XNR L;  1DM0 B;  2FHT A;  3K0Y A;  5M3M H;  4A3K H;  4JPB W;  1V1O A;  3DWA A;  1GUS A;  2VXW A;  3PIO A;  2DY7 A;  3F1Z A;  4WFN 3;  1YJ9 A;  4KLK A;  5IIF A;  2GA4 B;  3U9S A;  1GD7 A;  1ICW A;  3T51 B;  2HUG A;  2LS0 1;  4GN3 B;  1SND A;  4KKS A;  4YIJ A;  1HR0 W;  3W1G A;  1CQF A;  2C35 B;  1JE5 A;  1GM5 A;  1R9T B;  3BDL A;  5IGC A;  1YVC A;  4HAE A;  3JAM L;  3EBE A;  2I5L X;  4FF1 A;  3TP8 A;  3GTG H;  3H3V C;  4X3U A;  3GTQ H;  3STB C;  1S5B D;  4A3M G;  3KFU A;  2EYL A;  4JI6 L;  1TII D;  1A8V A;  5IOD A;  2KED A;  2NZO A;  3NK9 A;  1A62 A;  2EY2 A;  2LKV A;  5IGE A;  1UE5 A;  3KF6 A;  4IO9 A;  1GUT A;  3M4Y A;  1N33 L;  4QB4 A;  1D1K A;  3ULL A;  2VY3 A;  3NHH A;  3CCR A;  1EQV A;  3GTM H;  1JJG A;  5EJW A;  3DHQ A;  2F3I A;  4DK0 A;  3PV0 A;  4APV A;  5BN5 A;  1LT4 D;  2XTI A;  3BU2 A;  4RGO S;  2OWO A;  4K0K L;  4ZKC B;  4ZUJ A;  3MTS A;  4A93 G;  4DR5 Q;  5I6Y A;  1HA6 A;  1YBY A;  3PO2 H;  2EIF A;  1EYC A;  5M3F H;  3A55 A;  3RNU A;  3PF5 A;  4OL7 A;  2GVA A;  1WCM B;  5I9P A;  2E5L L;  1STN A;  3PIP 3;  1BCP B;  5LMU L;  1IBL L;  2JA5 G;  4ZYS A;  1N9W A;  1X55 A;  1G2T A;  1U4R A;  1DOK A;  1STY A;  2NYZ D;  3BYT B;  3EJI A;  4GS3 A;  1NR4 A;  3NTK A;  1K8O A;  2BDO A;  1SR3 A;  3S24 A;  5H1S E;  2CFM A;  2DUD A;  2Z6K A;  4PZ6 A;  1K8A C;  3IFD A;  4FO2 A;  5C3E B;  3S2D H;  2KHJ A;  2QW7 A;  2VQF Q;  5ISR A;  1WTW A;  4X64 Q;  3K59 A;  1F2Y A;  3ULP A;  1PH7 A;  4HIK A;  2V1C C;  3GP7 A;  3F2D A;  4DV1 L;  1EL0 A;  2YYZ A;  5D3I B;  3VYR A;  4ALP A;  2WKD A;  5JPM C;  2HQL A;  1PFS A;  1MD2 D;  2M00 A;  1AZP A;  1R9T H;  1DCZ A;  3A7L A;  1I4X A;  1TVX A;  2RSO A;  3K80 C;  1MSH A;  2NZ1 D;  4J8Q A;  1B2T A;  1X3E A;  5C4X B;  3D4D A;  5IYC G;  1BVS A;  2G5D A;  4BY1 G;  2BCO A;  2EVB A;  2UXC L;  5IYD G;  3OPO A;  3C1E A;  4XQQ A;  2B8F A;  2HHH L;  1QG7 A;  4QIW E;  1WTV A;  3MZ5 A;  3T1Y L;  1PLF A;  1VS0 A;  1IBM L;  2F0H A;  1OXT A;  4LWC A;  4CBV A;  1N36 Q;  1ENA A;  1B50 A;  4DV5 Q;  3J80 i;  4NDX A;  3H6M A;  1F2M A;  1X65 A;  2E8G A;  1NSN S;  4LF5 L;  4LAA A;  3TBI B;  4G7H C;  4BY7 G;  1WVL A;  2AQ3 B;  2CWA A;  5KNB A;  2D2C C;  3TP5 A;  3A8I E;  4R4O A;  3ICE A;  3HOY G;  4BBR H;  2EY1 A;  1WCM H;  5C44 H;  1XMQ Q;  4KHV A;  5A2Q E;  2R6G A;  2K5Q A;  3H0G G;  2AUK A;  2JA8 G;  3SR1 A;  2R93 G;  1BUV T;  4DV0 Q;  4XYQ A;  3HEJ A;  3S17 B;  4JOI C;  1NJI C;  1JJ2 A;  4C3J G;  4R4C A;  4A3I G;  1TWH B;  3M4O B;  2CQA A;  5FO8 B;  4RWS C;  3CMA A;  4CHT B;  4DV4 L;  1R4Q B;  1JB3 A;  2A73 B;  3K8A A;  1N8R C;  2B63 B;  4HJ8 A;  2R3Z A;  5COY A;  4AIM A;  3EA6 A;  1LV9 A;  2Y0S G;  3T4A C;  3GTP B;  4DAP A;  1KLU D;  3TDQ A;  1AN8 A;  2ATW A;  4DV2 Q;  1CI3 M;  2JA6 H;  1L1O B;  3MEF A;  1N32 Q;  3QO2 A;  3LWU A;  2R92 G;  4KHZ A;  3VYS A;  1TS3 A;  3NE5 B;  1JWM D;  1T5X D;  2A68 D;  3J81 i;  3CRL C;  5C4X H;  1PXU A;  1HCZ A;  3ER0 A;  3LWE A;  4FXD A;  1JCK B;  2BH8 A;  3DM3 A;  2IX3 A;  4N8F A;  3KLS X;  2AKW B;  4A3J B;  4UPA A;  3HOW B;  3DWQ A;  4IAL A;  4RCN A;  1PH3 A;  1SE8 A;  1H9M A;  2FMM A;  1BF4 A;  1WOC A;  1QIL A;  1C0A A;  4IQZ A;  1Q1E A;  1Q8K A;  4O1N A;  1EY5 A;  3KBX A;  4KJO A;  1Q12 A;  1HNZ Q;  2ICE C;  5C0X I;  5JVG 3;  3OOC A;  4A3B G;  2QEX A;  2VUM B;  1W2B A;  4F8M A;  4F88 A;  1LTS D;  1I94 Q;  3SVM A;  1OTC A;  4L5S A;  1IYJ B;  4TRD A;  1IL8 A;  3D8G A;  1BCP D;  2R61 A;  1VCI A;  2K5D A;  5M3M G;  4A3K G;  2R7Z B;  1ONL A;  2K5N A;  2G9H D;  3PIO 3;  4EQO A;  2JJQ A;  1EY9 A;  2MO1 A;  2Z4I A;  1N34 L;  4AYB E;  5I2Y A;  4IUV A;  3BG3 A;  5EGT A;  3V2T A;  1RJT A;  3S17 H;  1EOV A;  3HG9 A;  4KI0 A;  2F0S A;  1BNZ A;  2EYO A;  2BE5 C;  2QEJ C;  1SAP A;  3TP7 A;  1TT2 A;  4DNR B;  2DNE A;  1E0B A;  4LFB Q;  2NVT B;  4XQJ A;  3AFP A;  4OWT B;  1V1P A;  1Y8O B;  5IWA Q;  3EVQ A;  4B9W A;  2B63 H;  2F0N A;  4IUP A;  1YJN A;  2A1A A;  4LF8 L;  2E2I B;  2GVB A;  4JG2 A;  4KV6 A;  2PI2 E;  1ICF B;  4DNT B;  3UDX A;  1K3R A;  4J1M A;  4LF7 L;  1DJR D;  3EIV A;  3GTP H;  2KEC A;  5CBE E;  2VQE L;  3G4S A;  4L5Q A;  4MTN A;  4X62 Q;  1C7Y A;  4N9P A;  3K5O A;  3QG1 A;  2N55 A;  5CV4 A;  1CT1 D;  5J3B A;  1XPR A;  1Q82 C;  4A76 A;  3ULJ A;  5CMD A;  1I4H A;  3C2P A;  1J5E Q;  1L0X B;  4O0A A;  1ASZ A;  5JJL A;  1TKW B;  4JK1 C;  3PO2 G;  4A3J H;  3OW7 A;  5M3F G;  3HOW H;  1AE2 A;  1EYA A;  2KEN A;  3I2Z A;  3W2D A;  1ENC A;  1SNC A;  3JAM i;  3CCL A;  4BA2 I;  1PFN A;  1FL0 A;  1XXG A;  1PH5 A;  2D9U A;  1PYW D;  1VQ4 A;  3CXC A;  3J80 c;  3H15 A;  5IYB H;  4DR2 L;  4DUZ L;  2A5H A;  4MN3 A;  4CKB A;  2NBF A;  1HH2 P;  1JR0 D;  3DM1 A;  3M9B A;  3DLL A;  2ZJQ A;  5FLX c;  2JXM B;  4HSP A;  2O4X A;  3KF8 B;  3CHB D;  4CDF C;  2DJF C;  2VUM H;  3CCJ A;  1C4Q A;  1KD1 C;  4R1J A;  1ROD A;  3IKJ A;  5IY0 A;  4XT3 B;  2UXD Q;  1QZG A;  5HUR A;  2R7F A;  1VQG A;  1B7Y B;  3BVG A;  4G57 A;  3UDG A;  2CWP A;  2QDB A;  3GV6 A;  3MAQ A;  2HIX A;  3A54 A;  4DNI A;  5IGB A;  2TMP A;  4GOP B;  1G2S A;  1EWH A;  1YNJ C;  4DV3 L;  3KK7 A;  2CCZ A;  1KNE A;  1QOH A;  2VZA A;  5JJZ A;  3N6R A;  2NVT H;  4IUR A;  3SK4 A;  3E6Z X;  2JEA I;  2F0W A;  1F9R A;  2N49 A;  5ELB A;  2E2I H;  5L37 A;  3J80 L;  1Y1V B;  1I3Q B;  3CW2 C;  1JC7 A;  2Z1C A;  1A2T A;  1TWG H;  2MO0 A;  5FLX L;  3J81 c;  3S1N B;  3NBH A;  4DR4 Q;  3GTL B;  2EOT A;  1MKH A;  1GO3 E;  3NEN A;  3NQI A;  2Q8I B;  4LF9 L;  3RN5 A;  1G6Z A;  1NE3 A;  1G29 1;  1TWA B;  3OIP A;  5EBC A;  3OIQ A;  4DGZ A;  4JI0 Q;  3LX0 A;  4ZK9 B;  1WCM G;  4OO1 G;  1AEX A;  3PO3 B;  3KYH C;  1LTL A;  1NNX A;  2QGQ A;  4AQY Q;  2UXB Q;  1Q46 A;  3A7A B;  1QZH A;  3MFG A;  3OTO Q;  3IAY A;  2K33 A;  1G6P A;  2K75 A;  1H9K A;  1HNW L;  2RA4 A;  4FP5 D;  1ESR A;  1ZKO A;  1HFN A;  1JIC A;  1SNO A;  4A3E B;  1JOQ A;  1UEB A;  2K14 A;  2MQH A;  4HED A;  1E1O A;  2NVQ B;  3P7J A;  2XNA C;  5C3E G;  3VR4 A;  3U50 C;  1HNX L;  3DMU A;  4RHR A;  2PZU A;  4DK3 C;  1BBU A;  4KHP L;  2RHS B;  1S72 A;  1JT8 A;  1GUN A;  3PQI A;  1ZEQ X;  1SMY C;  1U4L A;  3IL8 A;  2WV6 D;  4PV1 C;  3NTH A;  2G9D A;  3HKZ B;  1HR0 L;  4MHE A;  4S3S A;  1UNS A;  4O2D A;  1ASY A;  1SYD A;  5IGD A;  4BWG B;  5C4X G;  4IOC A;  1VQM A;  4JI4 Q;  1MI2 A;  4FF3 A;  4LJZ C;  3H3V H;  4OXP A;  4DR7 L;  3J7Y W;  2AWO A;  2JP1 A;  2EY6 A;  4K0K Q;  1Y1V H;  2VB3 X;  4IPC A;  4JW0 A;  2HDL A;  4DK6 C;  5J22 A;  2ZJP A;  4R4I A;  1H95 A;  1U9R A;  3G7L A;  5IT9 c;  3GTM B;  3EQL C;  2PZW A;  3QB3 A;  5LL6 X;  2UU9 Q;  1U0L A;  3TEH B;  3GTL H;  3SGI A;  2L4N A;  2AWN A;  1I6V C;  1PDQ A;  1F9P A;  4YWL A;  2Q8R E;  4IUN A;  4LUV A;  2F03 A;  3S1M H;  2P5Z X;  1TWA H;  2RHQ B;  4I7A A;  4UAI A;  1LUZ A;  4J15 A;  5M5X B;  1L0W A;  2CH4 A;  2B3G A;  4JI8 L;  3PO3 H;  3M7N A;  1T9H A;  2NWG A;  2HIV A;  3T13 A;  4DV7 Q;  2WIN B;  1SSO A;  3NPP A;  4DR3 Q;  3NEM A;  4BXX H;  2KCT A;  4B9X A;  2Z0S A;  3MXN A;  3M85 A;  4HIM A;  4B3R L;  2LY7 A;  1X6O A;  1B4O A;  5IGF A;  1VQ7 A;  1O7L A;  4K6L A;  1G91 A;  4A3E H;  4DV1 Q;  2I46 A;  1DYQ A;  2JE6 I;  4ZAI A;  1Q1B A;  2B2W C;  5LMN Q;  4K2K A;  2NVQ H;  1GXD C;  4QIW B;  2OTJ A;  4RG1 A;  3I56 A;  4DR6 L;  4EQP A;  3VA5 A;  3MHB A;  2YV5 A;  3BJU A;  1I4R A;  2B63 G;  1QWY A;  4PMB A;  2F0O A;  5CV5 A;  5EKL A;  4JV5 Q;  1EQR A;  2Q2U A;  4CKE A;  1TS2 A;  1LTG D;  2K7V A;  2EXZ A;  5IT9 L;  1EY7 A;  2AUJ D;  3D3R A;  3MA2 B;  1IBK Q;  4MIU A;  3T1H Q;  3TN2 A;  3T56 B;  3HOU B;  4IFD H;  3D4R A;  2NN6 H;  2LXJ A;  3VR2 A;  1RL2 A;  3D6W A;  4IJL A;  4UP7 A;  4FDB A;  4YHH Q;  2HHH Q;  4DR1 L;  1W6J A;  2WKC A;  3QJY A;  3R3O A;  3TSS A;  4LK1 C;  1B3Q A;  2A69 D;  3STB D;  5TSS A;  1WTP A;  1XMO Q;  2QKI C;  1B9N A;  1VQB A;  4A3J G;  4ZKB B;  1L2F A;  1JE4 A;  2RSN A;  4A75 A;  4LNQ A;  4N9T A;  5BR8 L;  3BDO A;  2MNA A;  1EU3 A;  2F0F A;  3H09 A;  1OXU A;  4TKO B;  5LHY 1;  1CKM A;  5BN4 A;  1GOZ A;  3F8T A;  2FIN B;  5IYB G;  4LF4 L;  4GKK Q;  4PZ7 A;  1X9N A;  1PTO B;  1RHP A;  4V0B A;  4P2C B;  1KXL A;  5KEE A;  1STA A;  5ELO A;  3HOX G;  4HR7 B;  4A3F G;  5GAG C;  3HKZ E;  2VUM G;  1BBX C;  3UDI A;  5AJ3 Q;  3U9O A;  2O2L D;  4A3C G;  4BBR B;  2PPB C;  3WWV A;  5J39 A;  5IGG A;  4IFD J;  1Z47 A;  5M5X H;  4OIJ A;  1U4P A;  1QE6 A;  4QF4 A;  3A5Z B;  5C44 B;  3L2P A;  1CKO A;  2R7Z G;  5FLM H;  1VQA A;  3TRZ A;  4JOI A;  1TY2 A;  3MWY W;  1Q90 A;  3ND9 A;  4QJF A;  3BS1 A;  5E3F A;  1JOR A;  4F7X A;  4JI3 L;  1XNQ Q;  4U68 A;  4X65 L;  4B3T L;  3OWF A;  2UUC Q;  3CCM A;  1MJE A;  1II3 A;  3DUZ A;  1UAP A;  3R2T A;  2HD3 A;  4RAU C;  4ID6 A;  4POG A;  2EJM A;  4ZUI A;  1M90 C;  3L7Z C;  1CKN A;  3AFQ A;  2AMC B;  4UP8 A;  1Z9F A;  1GVP A;  1SYG A;  5NUC A;  4LFA Q;  1KLG D;  5C4Z A;  3C46 A;  4OX9 L;  2A6H D;  4PQX A;  3MXP A;  1Q3L A;  5IOC A;  2NB0 A;  3P20 A;  2YTY A;  4FF2 A;  3S1R B;  3R93 A;  1NTG A;  4KY7 A;  2E2D C;  2PMZ B;  2JA6 B;  2JK8 A;  1BQQ T;  3E0J A;  2PCF B;  4C56 C;  3HOU H;  3K7A B;  2ICI A;  1E3P A;  4A3L H;  4LUZ A;  3FEW X;  4DAY B;  2ES2 A;  2XWB B;  4EQN A;  4HCE A;  1V9P A;  2MP1 A;  5KYI A;  4NXM L;  4I65 A;  3A74 A;  1IKM A;  3GTK B;  4AYB B;  1AZQ A;  1CZG A;  3PGZ A;  2PW7 A;  5GQO A;  1QB5 D;  2FJ2 A;  3S9W A;  2B2Y C;  2QF7 A;  3NEL A;  1PMR A;  3X3M A;  1YIJ A;  1GUO A;  1STB A;  1PTO H;  4ZRZ A;  1HA5 A;  3PUW A;  3I4M B;  1HUN A;  2MGS A;  4HMJ A;  2GN5 A;  2ZTE A;  1KC8 C;  5DNF A;  2F0T A;  4HN7 A;  1WTX A;  3Q0A A;  5C5L A;  2K01 A;  1RF2 D;  2HCC A;  2I07 B;  2K5H A;  3ERS X;  3RR5 A;  2XVS A;  1FNW A;  4Y52 H;  1PZK D;  1M8A A;  1B53 A;  2JN4 A;  3R2I A;  4JI5 Q;  1IYU A;  1M1K C;  1EIF A;  5J1Z A;  1V43 A;  4H7B A;  1VQF A;  3IRB A;  1PRT C;  3CRK C;  1TXY A;  2K5W A;  1E24 A;  4UP9 A;  5EKI A;  3BVM A;  4QMG A;  1BR9 A;  3RZO H;  3DEP A;  3SHL A;  3H91 A;  2IX1 A;  4IN3 A;  4Z9C B;  4RCO A;  3LNN A;  4X3K A;  1RTN A;  5FJ8 H;  2NTT A;  2EQS A;  3HOZ G;  2VQE Q;  4TVA B;  4XXE A;  4HJ9 A;  2Z6B A;  4FXG C;  3SE0 A;  2I0Q A;  1FJG Q;  1B1Z A;  1Z7T A;  1VQ8 A;  1O7I A;  3A0J A;  4RHS A;  4OO1 I;  4DR5 L;  5JEA H;  2TSS A;  3O13 A;  2UUB Q;  1B70 B;  2LFN A;  3FVQ A;  4P71 A;  1DD2 A;  1VMP A;  2WB1 E;  3HOV H;  3S1R H;  1KL9 A;  1BOS A;  1Y1V G;  1EFI D;  3FPP A;  2B2V A;  1STG A;  2ZM6 Q;  4KK7 A;  3CQZ B;  4R8I A;  4CJ0 B;  2KHS A;  4MTK A;  1V1P B;  1E2Z A;  1E1T A;  4B08 A;  3K7A H;  4MZ9 A;  3G48 A;  2OQ0 A;  4C3I G;  5AFW A;  2XGT A;  4KD4 A;  2EYJ A;  5DLQ E;  1C48 A;  1E2W A;  1EYG A;  2F0P A;  4DR2 Q;  2EXD A;  3WOF A;  1CHQ D;  5LMN W;  3GTK H;  1H9S A;  2XRS D;  1MJC A;  1PH1 A;  2VQF L;  3PO3 G;  1EOT A;  4X64 L;  4JVZ A;  5C0X H;  2WAC A;  1PTO D;  4JI1 Q;  1CQV A;  2K4K A;  4N8X 1;  4B3S Q;  2F0V A;  2KUM A;  3F2C A;  5K36 H;  4DUY L;  5JEA J;  1B3A A;  4CDC C;  4CDE C;  3T53 B;  3I4M H;  2E75 C;  1HFG A;  2PMZ E;  1NMG A;  3L0O A;  4NXN Q;  4A4I A;  1ZYR D;  4FF4 A;  1TS5 A;  3NUC A;  3RD4 A;  4BS9 A;  1U5K A;  2N78 A;  1VDZ A;  1SNQ A;  4IOA A;  3RMH A;  2CW0 D;  2PQE A;  3UE1 A;  5KIX A;  1BXT A;  1I4G A;  4JBK A;  5ELC A;  3NBI A;  4BBS H;  2K50 A;  4U67 3;  1SFO B;  2KQ3 A;  1A3V A;  4AH6 A;  2XSC A;  4P74 A;  4C2M B;  2WAQ E;  4F87 A;  4KTA A;  2I5M X;  3KUP A;  3URY A;  3A8K E;  3ERQ A;  1PFM A;  2MUY A;  4OEM B;  3Q8D A;  2KCM A;  4QCL A;  3I7F A;  1CUK A;  4IFD G;  2NN6 G;  3G6J B;  1GUG A;  2JA9 A;  1N36 L;  2A6E C;  1NBW A;  1BCP C;  5C0X J;  2FXQ A;  4DV5 L;  1FVI A;  4LW1 A;  3MXU A;  5C3X A;  2PQA A;  2F4V Q;  3X3N A;  1HTP A;  3KLS A;  3OHX C;  1LYL A;  1XYI A;  1NR2 A;  2JA5 B;  4K5V A;  2L15 A;  4FVM A;  3S14 B;  4WOR A;  1P16 A;  4RMF A;  1C8C A;  3I73 A;  3HP3 A;  3CCV A;  3BZC A;  3MFY A;  5ELF A;  2CH4 W;  4LF9 Q;  1XMQ L;  4CKC A;  1TWG B;  3CQZ H;  4RGN A;  4POF A;  5GAE C;  1L1O A;  1TWF B;  3NWS A;  2JA7 B;  3K5L A;  3Q6S A;  1CK1 A;  1LTR D;  2SEB D;  1AH9 A;  5DAU A;  3VR6 A;  1Y1W B;  5CV7 A;  1VQO A;  2K52 A;  3KDF A;  1LT6 D;  2B2V C;  3SXH A;  1Q86 C;  1X3G A;  2ZXP A;  2OEO A;  4FXK C;  3PUV A;  1FGU A;  1OXV A;  2X6L A;  4DV6 Q;  4JYA Q;  1H9J A;  2F4I A;  1BKB A;  4OEL B;  4QL5 A;  3TZD A;  1W6K A;  4OON A;  2WII B;  3OWE B;  1VQH A;  4ULL A;  2SDF A;  3NBH B;  5FLM G;  2Q2I A;  5I6W A;  4LF6 Q;  1A15 A;  3T16 A;  4RH6 A;  1F9S A;  1K3B C;  4A3M H;  2DJG C;  4X66 Q;  2LXK A;  3E5S A;  2PNR C;  5A2Q L;  1RD9 D;  4DV2 L;  1HNX Q;  1DZ1 A;  1PV4 A;  3NSW A;  1IW7 D;  1N32 L;  1NAP A;  1KAA A;  5G3L F;  4EQ5 A;  2JEB I;  2Q2H A;  3E3X A;  2ALY B;  3KLW A;  3CD6 A;  3OSO A;  3K57 A;  4IJH A;  2HDM A;  1VQL A;  2EYM A;  1HR0 Q;  3S2H B;  1ET9 A;  1QNK A;  1SFO H;  1SRU A;  1U4M A;  1X3Q A;  4C2M H;  4GNX B;  1AE3 A;  2K04 A;  2B8G A;  3HS0 C;  2K32 A;  4E6I A;  2R7D A;  1PVO A;  1WTH A;  1J6Q A;  2QIL A;  1SN8 A;  3VR5 A;  4LMQ D;  4QY7 A;  3UE0 A;  1VF5 C;  3R8B A;  3HOU G;  2N3S A;  1I50 H;  3I90 A;  5D3D A;  2F0I A;  3CAM A;  2UUA Q;  1Y8P B;  2K03 A;  3I3C A;  4TSS A;  2QCP X;  2F3V A;  4JI2 Q;  1RDP D;  1I6H B;  5DM7 3;  3PIP A;  1HZA A;  4KD3 A;  2JA8 B;  1PRT F;  2JA5 H;  4LFC Q;  1LTI D;  1RCV D;  2PO4 A;  2AHO B;  1I94 L;  4L6T B;  2KJX A;  3S14 H;  1TQO A;  2Z4H A;  4KJN A;  3CME A;  3VDY A;  2B39 A;  2K05 A;  3U4Z A;  3S15 H;  2F0L A;  3PF4 A;  1VQJ A;  1RKN A;  3I70 A;  2IHE A;  3W5O A;  2E2J H;  2RF4 A;  3QWN A;  3PUY A;  1TWF H;  2JA7 H;  1KRS A;  4YWM A;  1PH4 A;  4JI8 Q;  1WYD A;  1Y1W H;  2F52 A;  3E0E A;  2HQE A;  2YU9 B;  1MSG A;  5JJI A;  5HY6 A;  3F2U A;  3CPW A;  2V4D A;  1L1O C;  1SE2 A;  4YY3 Q;  2OXP A;  1YI2 A;  1WTQ A;  4K5X A;  1PA6 A;  3S1M B;  4BBR G;  2Y0S B;  3CF5 A;  3KJO A;  3JAM E;  1OXX K;  2KCC A;  4LFB L;  5C44 G;  4XIG S;  5IWA L;  4P72 A;  2EYP A;  3GO5 A;  1VQP A;  2MFI A;  4K8J A;  4JI7 Q;  1EYD A;  1EY6 A;  2I5H A;  3K5N A;  2CVR A;  3M7G A;  2A8V A;  5IYC H;  1A3T A;  2B2W A;  1XNR Q;  2RKS A;  4HJ7 A;  4BY1 H;  3CU7 A;  1O7Y A;  5IYD H;  4X62 L;  1SJE D;  2IJ0 A;  4L5T A;  1CHP D;  3KF8 A;  2BA0 A;  2VS1 A;  3AU7 A;  3BYY B;  2WP8 J;  4ABN A;  3J7A F;  3MXN B;  2IHF A;  1GHK A;  4QQB X;  3K0X A;  3SDZ A;  1J5E L;  3S2H H;  1AW7 A;  1UUP A;  5DEH A;  2CHB D;  4XQN A;  4JI6 Q;  1AP0 A;  1X54 A;  2JA6 G;  5CV9 A;  4RFB A;  5FK9 C;  3D31 A;  1N33 Q;  1YNN D;  3DEO A;  3NXW A;  2F0K A;  1TS4 A;  1I6H H;  2PZT A;  5DM6 3;  3H0G H;  4PMW A;  4A3D B;  5JVH 3;  3GD7 A;  2JA8 H;  1PZI D;  5FKA C;  2R93 H;  1OO9 B;  4AYB G;  2EJG C;  5HGQ A;  4P75 A;  3RZD H;  3CPF A;  4H13 C;  3VYU A;  2UXD L;  4CJ2 C;  4C3J H;  2XWJ B;  1MGS A;  1BCP F;  3HZX A;  1O7Z A;  1J9O A;  1SBB B;  2KHI A;  1G51 A;  3HKS A;  5M9O A;  3PMF A;  4DFA A;  1D7Q A;  2IL8 A;  3FKI B;  4OIK A;  2E5L Q;  3I4M G;  3G6E A;  2YU9 H;  3KF6 B;  5LMU Q;  1IBL Q;  3E9H A;  5D14 A;  1STE A;  4G7Z C;  1VQN A;  4ZCK A;  2K1B A;  3CC7 A;  2PYK A;  1I5F A;  1UWV A;  1EEF D;  2R92 H;  1A0I A;  1LAB A;  1HQR D;  2RCN A;  1QUQ A;  2F0U A;  1O80 A;  2BDN A;  1K8M A;  3GV3 A;  2ZJR A;  5ELE A;  2Z9H A;  4GKJ L;  5T1G A;  1A2U A;  2B29 A;  1M4V A;  2RCF A;  4QUF A; 
#chains in the Genus database with same CATH homology
 1LAC A;  2RBM A;  5KNC A;  5A35 A;  2E74 C;  3IFT A;  1SNP A;  4DA2 A;  3OMG A;  1DOM A;  5FO7 B;  1STH A;  3P75 A;  3EFX D;  2NUC A;  2B2U A;  1SNM A;  3ITP A;  1F2L A;  5CYU A;  4DAV A;  4XT1 B;  1HPC A;  1PFB A;  1SXT A;  2B2Y A;  4UDU C;  2RVL A;  1S5E D;  1X3P A;  4Q5V A;  2IPK D;  3MVV A;  1IHZ A;  1EZ8 A;  4C3H B;  2F3W A;  5LL6 S;  1B9M A;  4L63 B;  4ODG A;  4FYD A;  1SYE A;  2D62 A;  1FYC A;  2A69 C;  4IFD I;  2NN6 I;  1CTM A;  3I8Z A;  4RA8 A;  1ESF A;  2J4X A;  2WB1 B;  5CR3 A;  1D2B A;  2F0D A;  5JAV A;  1LT3 D;  4RKB A;  3D4W A;  4R8N A;  5EPK A;  2RQX A;  1ILQ A;  4G7O C;  2B2T A;  4NMZ A;  4XDX A;  3I4N B;  3RZO B;  2L11 A;  1A3U A;  3FRP B;  1LTA D;  1HTL D;  1B44 D;  2O5I C;  1SE3 A;  1LTT D;  1VMC A;  1QNU A;  2RDH A;  3K5M A;  1XX8 A;  4JBW A;  4PNY A;  1F77 A;  4BA1 I;  5K5P A;  1NCV A;  5CBA E;  1A6X A;  1GJX A;  1CFM A;  3DXJ C;  3HOV B;  2F0G A;  4OHJ A;  1L0Y B;  3NWT A;  5I2X A;  2SOB A;  3A56 A;  2ZXO A;  1KAB A;  3TZU A;  4Y7N B;  2A6H C;  3AB9 A;  4XTC S;  1HUM A;  5COR A;  3BVZ A;  2B2U C;  2WAQ B;  1EWC A;  4ME5 A;  1EU4 A;  2KOL A;  4HMI A;  1SYF A;  5G3L D;  5E4X A;  4DU9 A;  3I91 A;  4XYO A;  1D1I A;  2SNS A;  3GTJ B;  3BZD B;  4IUT A;  1TY0 A;  1I4P A;  1DXM A;  4RKL A;  4A3G B;  2F0M A;  5EKK A;  3MXG A;  4M8A A;  4HTH A;  1H9S B;  3CKI B;  2E2H B;  3MC0 B;  4KMU C;  4IUU A;  3H94 A;  4NW2 A;  3FMC A;  1JOO A;  3I72 A;  1Z6H A;  1LT5 D;  4DK1 A;  4BBS B;  2JSO A;  4EVO A;  1O78 A;  5EPJ A;  1HXY D;  2Z8L A;  1PRT D;  2EDG A;  1AFP A;  2BOS A;  2EY5 A;  2L9H A;  1D6E C;  1QJO A;  1FR3 A;  4OO1 H;  2B2T C;  2ZXR A;  1BDO A;  2HCI A;  5C6A A;  5C4J B;  1KNA A;  4I7Z C;  4R9W A;  2D5D A;  2LMC B;  5EQ0 A;  3HRZ C;  3N52 A;  2L5T A;  4DN4 M;  1K83 B;  2IX0 A;  1KTK A;  3ZYY X;  5D65 A;  3RLF A;  4L8J A;  2RDG A;  4DAY A;  2EZV A;  4KY5 A;  1DOL A;  2JYO A;  4WRD A;  1MBY A;  3J7A V;  3AMU A;  1D5X C;  1S5D D;  4H44 C;  1LO5 D;  2A68 C;  1KDB A;  2IT1 A;  1XTC D;  4ZLT F;  4A3M B;  3J80 E;  5I9O A;  3DWP A;  2K6A A;  2M9V A;  2NTS A;  3I4L A;  1SDF A;  1IYV A;  1G8Z D;  3P1H A;  1TR5 A;  5FLX E;  3S16 B;  2MJ8 A;  1S5C D;  4IUQ A;  5KRU A;  4Q0F A;  2ZT9 C;  1PTO C;  3HGB A;  1Y8N B;  5KYL A;  2H4O A;  1QCB D;  4DF7 A;  4PMC A;  1OXS C;  2KCN A;  3C3L A;  5EPL A;  3UI2 A;  2IWH A;  2RDF A;  2XRQ D;  4KY6 A;  1JWU D;  3HOX B;  4A3F B;  1S5F D;  2F1M A;  1VF7 A;  3BDC A;  1ZYR C;  2F0E A;  2PW5 A;  4A93 B;  1EIG A;  1HQM C;  2BA1 A;  2C5C A;  4K6D A;  2CW0 C;  1I50 B;  2F0J A;  3NP8 A;  5HGT A;  1FNU A;  3RUZ A;  1SYB A;  2A6E D;  4TQU S;  2DNC A;  2BE5 D;  4K14 A;  5CV8 A;  2AQ2 B;  2H1E A;  2L12 A;  1ENF A;  2KVM A;  1I4Q A;  1T5E A;  5C5M A;  3S15 B;  3NTI A;  4X3T A;  1TWC B;  5FOB B;  2SNM A;  2E2J B;  2A74 C;  3SK5 A;  2OF1 A;  2X6G A;  3J81 E;  1DON A;  2KEE A;  3SEB A;  3K6O A;  4KKU A;  4OGQ C;  1FGB D;  1FNV A;  3K58 A;  2E76 C;  1UEA B;  5JOB A;  3Q24 A;  3OMC A;  4KN7 C;  4O42 A;  1BO0 A;  2K28 A;  1SJH D;  1Q8I A;  1GUW A;  1CA6 A;  4J6H A;  2OT2 A;  2N88 A;  4BY1 B;  5CGK A;  1X32 A;  3C1F A;  2DN8 A;  5ELD A;  5BN3 A;  4RGM A;  2L1B A;  2EYH A;  1LLR D;  5C3W A;  3ONA B;  2DY8 A;  3L9A X;  3V05 A;  4EGV A;  1IW7 C;  4FNF A;  1JWS D;  4BY7 B;  1D5M C;  4NP5 A;  2ID0 A;  4HCS A;  1EY8 A;  2XIW A;  3HOY B;  1ZXT A;  5M5W B;  4NKL A;  4KN4 C;  1YNJ D;  1JOK A;  4G4K A;  1KDA A;  5E1F A;  1ILP A;  3H0G B;  1WTO A;  3FDT A;  3WDN A;  3GTO B;  3VR3 A;  2R93 B;  3RZD B;  3M3Y B;  2FFK B;  2MPM A;  2F0Q A;  4C3H G;  3V96 A;  4C3J B;  3TME A;  4A3I B;  1EZ6 A;  1D5Z C;  2EJF C;  3HOZ B;  1SYC A;  5CV6 A;  5IT9 E;  2J0T D;  5EBD A;  3FPU B;  5M5Y B;  2XN9 C;  1EEI D;  3Q23 A;  2L55 A;  1WD1 A;  4IZ8 A;  2AQ1 B;  4CJ1 B;  1HHV A;  5I4D A;  1LTB D;  5C4H A;  2R92 B;  1R4P B;  3PUX A;  4HSV A;  4C3I B;  1Y69 U;  2VB2 X;  1RTO A;  5KGU A;  5F2D A;  3VYT A;  1F9Q A;  3A8J E;  1WTR A;  4DXG A;  4C1N K;  3KLR A;  2C9O A;  3TP6 A;  3GQB A;  1FD7 D;  5JEA G;  5FO9 B;  3S1Q B;  4WJW A;  4C1N I;  1PZJ D;  2EYF A;  2NVY B;  4A3B B;  1KDC A;  1SMY D;  1J8I A;  1XWE A;  3QOJ A;  3MEH A;  2EPB A;  3QIA A;  1PTO F;  4KKT A;  5E4W C;  2X69 A;  5M3M B;  4A3K B;  3NQT A;  5JPN C;  3QOL A;  4ILW A;  3ERO A;  3J81 L;  4K5W A;  4H0L C;  1GHJ A;  3WOE A;  1JQY D;  2IW3 A;  2J7Z A;  2Q8T A;  2NVX B;  2M2L A;  5C0X G;  1ML0 D;  1IKL A;  1EIH A;  3SK8 A;  3GTG B;  3L3O C;  1YNN C;  3GTQ B;  5K36 G;  2EE1 A;  2MHV A;  1HRJ A;  1TU2 B;  3W3A A;  5KND A;  3KBG A;  4QUC A;  4K8I A;  3ND8 A;  5CC4 A;  1E2V A;  4ZQ3 A;  3D6C A;  5T1I A;  2L0C A;  1F2Z A;  1SE4 A;  4M1U B;  4CGY B;  2ENB A;  1V8Q A;  1PRT B;  3PUZ A;  3PO2 B;  5M3F B;  1EY0 A;  4RGT A;  3SK6 A;  3VA7 A;  1CZW A;  2O5J C;  1CM9 A;  3Q22 A;  1CA5 A;  4K2L A;  1ET6 A;  2VNU D;  4V19 0;  1EY4 A;  4DXF A;  1NUC A;  1SEB D;  2FMC A;  1EQT A;  4X3S A;  2KA7 A;  4GZY C;  1S4Z A;  1H9R A;  3S2D B;  1WD0 A;  1DM0 B;  2FHT A;  3K0Y A;  1V1O A;  3DWA A;  1GUS A;  2VXW A;  2DY7 A;  4WFN 3;  5IIF A;  2GA4 B;  3U9S A;  1ICW A;  3T51 B;  2HUG A;  2LS0 1;  4YIJ A;  1SND A;  4KKS A;  1CQF A;  1R9T B;  3BDL A;  5IGC A;  4HAE A;  3JAM L;  4FF1 A;  3TP8 A;  3H3V C;  4X3U A;  1S5B D;  2EYL A;  1TII D;  5IOD A;  2KED A;  3NK9 A;  2EY2 A;  2LKV A;  5IGE A;  1GUT A;  3M4Y A;  4QB4 A;  1D1K A;  3NHH A;  1EQV A;  5EJW A;  3DHQ A;  4DK0 A;  3PV0 A;  5BN5 A;  1LT4 D;  4RGO S;  4ZKC B;  4ZUJ A;  3MTS A;  5I6Y A;  1HA6 A;  1EYC A;  3A55 A;  4OL7 A;  1WCM B;  5I9P A;  1STN A;  3PIP 3;  1BCP B;  4ZYS A;  1G2T A;  1U4R A;  1DOK A;  1STY A;  2NYZ D;  3BYT B;  3EJI A;  1NR4 A;  3NTK A;  1K8O A;  2BDO A;  3IFD A;  4FO2 A;  5C3E B;  5ISR A;  1WTW A;  3K59 A;  1F2Y A;  3GP7 A;  1EL0 A;  2YYZ A;  5D3I B;  3VYR A;  2WKD A;  5JPM C;  1MD2 D;  2M00 A;  1AZP A;  1DCZ A;  3A7L A;  1I4X A;  1TVX A;  2RSO A;  1MSH A;  2NZ1 D;  4J8Q A;  1B2T A;  5C4X B;  3D4D A;  2BCO A;  2EVB A;  3OPO A;  3C1E A;  4XQQ A;  2B8F A;  1QG7 A;  1WTV A;  3MZ5 A;  1PLF A;  2F0H A;  1OXT A;  4CBV A;  1B50 A;  1ENA A;  4NDX A;  3H6M A;  1F2M A;  1NSN S;  4LAA A;  3TBI B;  4G7H C;  1WVL A;  2AQ3 B;  5KNB A;  2D2C C;  3TP5 A;  3A8I E;  2EY1 A;  4KHV A;  5A2Q E;  2R6G A;  2K5Q A;  2AUK A;  3SR1 A;  1BUV T;  4XYQ A;  3HEJ A;  3S17 B;  4C3J G;  1TWH B;  3M4O B;  2CQA A;  5FO8 B;  4RWS C;  4CHT B;  1R4Q B;  1JB3 A;  2A73 B;  2B63 B;  2R3Z A;  5COY A;  3EA6 A;  1LV9 A;  3T4A C;  3GTP B;  4DAP A;  1KLU D;  3TDQ A;  1AN8 A;  1CI3 M;  3QO2 A;  3LWU A;  4KHZ A;  3VYS A;  1TS3 A;  3NE5 B;  1JWM D;  1T5X D;  2A68 D;  3CRL C;  1PXU A;  1HCZ A;  3LWE A;  4FXD A;  1JCK B;  2IX3 A;  3KLS X;  4A3J B;  3HOW B;  3DWQ A;  4IAL A;  4RCN A;  1H9M A;  2FMM A;  1BF4 A;  1QIL A;  4IQZ A;  1Q1E A;  4O1N A;  1EY5 A;  3KBX A;  4KJO A;  1Q12 A;  2ICE C;  5C0X I;  5JVG 3;  3OOC A;  2VUM B;  4F8M A;  4F88 A;  1LTS D;  3SVM A;  4TRD A;  1IL8 A;  3D8G A;  1BCP D;  2R61 A;  1VCI A;  2K5D A;  2R7Z B;  1ONL A;  2G9H D;  3PIO 3;  4EQO A;  1EY9 A;  2Z4I A;  5I2Y A;  4IUV A;  3BG3 A;  5EGT A;  3V2T A;  1RJT A;  3HG9 A;  4KI0 A;  2F0S A;  1BNZ A;  2EYO A;  2BE5 C;  2QEJ C;  1SAP A;  3TP7 A;  1TT2 A;  4DNR B;  2DNE A;  1E0B A;  2NVT B;  4XQJ A;  1V1P A;  1Y8O B;  3EVQ A;  4B9W A;  2F0N A;  4IUP A;  2E2I B;  4KV6 A;  4DNT B;  4J1M A;  1DJR D;  2KEC A;  5CBE E;  4N9P A;  3K5O A;  3QG1 A;  2N55 A;  5CV4 A;  1CT1 D;  5CMD A;  1I4H A;  3C2P A;  1L0X B;  1TKW B;  4JK1 C;  3OW7 A;  1EYA A;  3W2D A;  1ENC A;  1SNC A;  4BA2 I;  1PFN A;  1XXG A;  2D9U A;  1PYW D;  2A5H A;  4MN3 A;  4CKB A;  2NBF A;  1JR0 D;  3DM1 A;  2JXM B;  4HSP A;  2O4X A;  3CHB D;  1C4Q A;  1ROD A;  3IKJ A;  4XT3 B;  5HUR A;  3BVG A;  4G57 A;  2QDB A;  3GV6 A;  3MAQ A;  3A54 A;  5IGB A;  2TMP A;  1G2S A;  1EWH A;  1YNJ C;  3KK7 A;  1KNE A;  1QOH A;  5JJZ A;  3N6R A;  4IUR A;  3SK4 A;  3E6Z X;  2JEA I;  2F0W A;  1F9R A;  5ELB A;  3J80 L;  1Y1V B;  1I3Q B;  1JC7 A;  2Z1C A;  1A2T A;  5FLX L;  3S1N B;  3NBH A;  3GTL B;  2EOT A;  3NQI A;  2Q8I B;  1G6Z A;  1G29 1;  1TWA B;  3OIP A;  5EBC A;  3OIQ A;  4DGZ A;  3LX0 A;  4ZK9 B;  4OO1 G;  1AEX A;  3PO3 B;  3A7A B;  3MFG A;  3IAY A;  2K33 A;  1H9K A;  2RA4 A;  4FP5 D;  1ESR A;  1ZKO A;  1HFN A;  1JIC A;  1SNO A;  4A3E B;  1JOQ A;  4HED A;  2NVQ B;  3P7J A;  2XNA C;  3VR4 A;  3DMU A;  4RHR A;  2PZU A;  1GUN A;  1ZEQ X;  1SMY C;  1U4L A;  3IL8 A;  2WV6 D;  4PV1 C;  3NTH A;  2G9D A;  3HKZ B;  4MHE A;  4S3S A;  1UNS A;  1SYD A;  5IGD A;  4BWG B;  1MI2 A;  4FF3 A;  4LJZ C;  3J7Y W;  2AWO A;  2JP1 A;  2EY6 A;  2VB3 X;  2HDL A;  5J22 A;  1U9R A;  3G7L A;  3GTM B;  3EQL C;  2PZW A;  3QB3 A;  5LL6 X;  2L4N A;  2AWN A;  1I6V C;  1PDQ A;  1F9P A;  2Q8R E;  4IUN A;  2F03 A;  4UAI A;  5M5X B;  3M7N A;  2NWG A;  3T13 A;  2WIN B;  1SSO A;  3NPP A;  4B9X A;  3MXN A;  3M85 A;  2LY7 A;  1B4O A;  5IGF A;  1O7L A;  4K6L A;  1G91 A;  2I46 A;  1DYQ A;  2JE6 I;  4ZAI A;  1Q1B A;  2B2W C;  4K2K A;  1GXD C;  4QIW B;  4EQP A;  3VA5 A;  3MHB A;  1I4R A;  1QWY A;  4PMB A;  2F0O A;  5CV5 A;  5EKL A;  4CKE A;  1TS2 A;  1LTG D;  2K7V A;  2EXZ A;  5IT9 L;  1EY7 A;  2AUJ D;  3D3R A;  3MA2 B;  4MIU A;  3TN2 A;  3T56 B;  3HOU B;  4IFD H;  3VR2 A;  2NN6 H;  3D4R A;  3D6W A;  1W6J A;  2WKC A;  3QJY A;  3R3O A;  3TSS A;  4LK1 C;  2A69 D;  5TSS A;  1WTP A;  2QKI C;  1B9N A;  4ZKB B;  1JE4 A;  2RSN A;  4N9T A;  3BDO A;  1EU3 A;  2F0F A;  3H09 A;  1OXU A;  4TKO B;  5LHY 1;  5BN4 A;  1GOZ A;  2FIN B;  1PTO B;  1RHP A;  4V0B A;  4P2C B;  5KEE A;  1STA A;  4HR7 B;  1BBX C;  3U9O A;  2O2L D;  4BBR B;  2PPB C;  5J39 A;  4IFD J;  5IGG A;  1Z47 A;  4OIJ A;  1U4P A;  1QE6 A;  4QF4 A;  5C44 B;  1TY2 A;  3MWY W;  1Q90 A;  3ND9 A;  3BS1 A;  5E3F A;  1JOR A;  4F7X A;  4U68 A;  3OWF A;  1II3 A;  3DUZ A;  1UAP A;  3R2T A;  4RAU C;  4ID6 A;  2EJM A;  4ZUI A;  3L7Z C;  1SYG A;  5NUC A;  1KLG D;  5C4Z A;  3C46 A;  2A6H D;  4PQX A;  3MXP A;  1Q3L A;  5IOC A;  2NB0 A;  3P20 A;  4FF2 A;  3S1R B;  3R93 A;  4KY7 A;  2E2D C;  2PMZ B;  2JA6 B;  1BQQ T;  3E0J A;  2PCF B;  4C56 C;  3K7A B;  2ICI A;  3FEW X;  2XWB B;  4EQN A;  4HCE A;  2MP1 A;  5KYI A;  4I65 A;  1IKM A;  3GTK B;  4AYB B;  1AZQ A;  1CZG A;  2PW7 A;  1QB5 D;  2FJ2 A;  3S9W A;  2B2Y C;  2QF7 A;  1PMR A;  3X3M A;  1GUO A;  1STB A;  1PTO H;  4ZRZ A;  1HA5 A;  3PUW A;  3I4M B;  1HUN A;  2MGS A;  4HMJ A;  5DNF A;  2F0T A;  4HN7 A;  1WTX A;  3Q0A A;  5C5L A;  2K01 A;  1RF2 D;  2HCC A;  2I07 B;  2XVS A;  1FNW A;  1PZK D;  1M8A A;  1B53 A;  3R2I A;  1IYU A;  5J1Z A;  1V43 A;  4H7B A;  1PRT C;  3CRK C;  2K5W A;  5EKI A;  3BVM A;  4QMG A;  1BR9 A;  3DEP A;  3SHL A;  3H91 A;  2IX1 A;  4IN3 A;  4Z9C B;  4RCO A;  3LNN A;  4X3K A;  1RTN A;  2NTT A;  4XXE A;  4FXG C;  3SE0 A;  1B1Z A;  1Z7T A;  4RHS A;  4OO1 I;  5JEA H;  2TSS A;  3O13 A;  2LFN A;  1DD2 A;  3FVQ A;  1VMP A;  1BOS A;  1EFI D;  3FPP A;  2B2V A;  1STG A;  4KK7 A;  3CQZ B;  4R8I A;  4CJ0 B;  2KHS A;  1V1P B;  1E2Z A;  4B08 A;  4C3I G;  5AFW A;  4KD4 A;  2EYJ A;  1C48 A;  1E2W A;  2F0P A;  3WOF A;  1CHQ D;  1H9S A;  2XRS D;  1EOT A;  5C0X H;  2WAC A;  1PTO D;  1CQV A;  2F0V A;  2KUM A;  5K36 H;  5JEA J;  1B3A A;  3T53 B;  2E75 C;  1HFG A;  1ZYR D;  4FF4 A;  1TS5 A;  3NUC A;  3RD4 A;  4BS9 A;  1VDZ A;  1SNQ A;  3RMH A;  2CW0 D;  2PQE A;  5KIX A;  1BXT A;  1I4G A;  5ELC A;  3NBI A;  4U67 3;  1SFO B;  2KQ3 A;  1A3V A;  2XSC A;  4C2M B;  4F87 A;  4KTA A;  3KUP A;  3URY A;  3A8K E;  3ERQ A;  1PFM A;  2MUY A;  4QCL A;  4IFD G;  2NN6 G;  3G6J B;  1GUG A;  2A6E C;  1BCP C;  5C0X J;  3MXU A;  5C3X A;  3X3N A;  1HTP A;  3KLS A;  3OHX C;  1XYI A;  1NR2 A;  2JA5 B;  4K5V A;  4FVM A;  3S14 B;  4WOR A;  1C8C A;  3I73 A;  3HP3 A;  3MFY A;  5ELF A;  4CKC A;  1TWG B;  4RGN A;  1TWF B;  3NWS A;  2JA7 B;  3K5L A;  3Q6S A;  1CK1 A;  1LTR D;  2SEB D;  5DAU A;  3VR6 A;  1Y1W B;  5CV7 A;  1LT6 D;  2B2V C;  3SXH A;  2ZXP A;  2OEO A;  4FXK C;  3PUV A;  1OXV A;  2X6L A;  1H9J A;  2F4I A;  3TZD A;  1W6K A;  2WII B;  3OWE B;  4ULL A;  2SDF A;  5I6W A;  1A15 A;  3T16 A;  4RH6 A;  1F9S A;  3E5S A;  2PNR C;  5A2Q L;  1RD9 D;  1DZ1 A;  3NSW A;  1IW7 D;  1NAP A;  1KAA A;  5G3L F;  2JEB I;  3OSO A;  3K57 A;  2HDM A;  2EYM A;  3S2H B;  1ET9 A;  1QNK A;  1U4M A;  1X3Q A;  2K04 A;  2B8G A;  3HS0 C;  2K32 A;  4E6I A;  2QIL A;  3VR5 A;  4LMQ D;  1VF5 C;  3R8B A;  3I90 A;  5D3D A;  2F0I A;  1Y8P B;  2K03 A;  3I3C A;  4TSS A;  2QCP X;  2F3V A;  1RDP D;  1I6H B;  5DM7 3;  4KD3 A;  2JA8 B;  1PRT F;  1LTI D;  1RCV D;  2PO4 A;  4L6T B;  2KJX A;  1TQO A;  2Z4H A;  4KJN A;  2B39 A;  2K05 A;  2F0L A;  1RKN A;  3I70 A;  3QWN A;  3PUY A;  2HQE A;  2YU9 B;  1MSG A;  3F2U A;  2V4D A;  1SE2 A;  2OXP A;  1WTQ A;  3S1M B;  4K5X A;  2Y0S B;  3JAM E;  1OXX K;  2KCC A;  4XIG S;  2EYP A;  3GO5 A;  4K8J A;  1EYD A;  1EY6 A;  3K5N A;  2CVR A;  3M7G A;  1A3T A;  2B2W A;  2RKS A;  3CU7 A;  1O7Y A;  1SJE D;  2IJ0 A;  1CHP D;  3KF8 A;  2BA0 A;  3AU7 A;  3BYY B;  2WP8 J;  4ABN A;  3J7A F;  1GHK A;  3SDZ A;  1AW7 A;  1UUP A;  5DEH A;  2CHB D;  4XQN A;  1AP0 A;  5CV9 A;  4RFB A;  5FK9 C;  3D31 A;  1YNN D;  3DEO A;  3NXW A;  2F0K A;  1TS4 A;  2PZT A;  5DM6 3;  4PMW A;  4A3D B;  5JVH 3;  3GD7 A;  1PZI D;  5FKA C;  1OO9 B;  2EJG C;  4H13 C;  3VYU A;  4CJ2 C;  2XWJ B;  1MGS A;  1BCP F;  3HZX A;  1O7Z A;  1J9O A;  1SBB B;  5M9O A;  4DFA A;  3PMF A;  2IL8 A;  3FKI B;  4OIK A;  5D14 A;  1STE A;  4G7Z C;  2K1B A;  2PYK A;  1EEF D;  1LAB A;  1HQR D;  2F0U A;  1O80 A;  2BDN A;  1K8M A;  3GV3 A;  5ELE A;  5T1G A;  1A2U A;  1M4V A;  4QUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...