2JYOA

Nmr solution structure of human mip-3alpha/ccl20
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 20 (Small-inducible cytokine A20) (Macro
publication title Human macrophage inflammatory protein 3alpha: protein and peptide nuclear magnetic resonance solution structures, dimerization, dynamics, and anti-infective properties.
pubmed doi rcsb
molecule tags Cytokine
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jyoA00
1WD1A 2R3ZA 3F2UA 5T1IA 1PFNA 1U4PA 1IL8A 2L9HA 4X3SA 1WTQA 3DEPA 1BF4A 2HCCA 1A15A 1ILQA 1EQTA 2EOTA 2K05A 1DOKA 1NAPA 1RHPA 2CVRA 2X6LA 3I8ZA 4IUTA 1HUNA 4DN4M 1QG7A 4X3UA 2RSOA 1WTVA 4ZKCB 2B2UC 1O7YA 2H1EA 1KNAA 1O80A 3QO2A 3I91A 2HUGA 2HCIA 1AZQA 2FINB 1RTOA 1X3PA 5CBEE 4X3TA 1LV9A 4QUFA 1BNZA 2JYOA 4U68A 1MGSA 2FJ2A 4XT1B 1G6ZA 2D9UA 1Q3LA 1SAPA 4RAUC 3R93A 2B2VA 3Q6SA 1MSHA 1PFBA 4OIKA 2KUMA 2B2YC 3ONAB 4CJ0B 5EKIA 4IUVA 1WTXA 5D14A 2JP1A 4O42A 2K03A 2MJ8A 3D6WA 5EJWA 1B50A 5T1GA 3N52A 2M2LA 1HUMA 4IURA 1X3QA 1NR4A 4R9WA 2K01A 4UAIA 4ZK9B 2FMMA 1F2LA 3FDTA 1O7ZA 5D65A 1HHVA 3MTSA 3I90A 4ZKBB 2N55A 1G2SA 2K1BA 2KOLA 1B3AA 1PDQA 5E4WC 2DY8A 4RWSC 1RODA 5DNFA 3DM1A 3LWEA 5E4XA 2MP1A 5EPJA 2NYZD 4LMQD 1WTOA 1TVXA 1EIHA 1NCVA 2B2UA 2FFKB 4HCSA 1ML0D 2B2TC 4IUPA 1CA6A 4MN3A 2BDNA 2EE1A 2K28A 4MHEA 1F9RA 2L1BA 1G91A 1QNKA 1RTNA 1ESRA 2VXWA 5AFWA 1ZXTA 1AZPA 1HFGA 2KVMA 2Q8TA 3SVMA 1WD0A 1DZ1A 2KECA 4HSVA 1U4RA 4IUUA 3GV6A 5CBAE 1VMPA 4OIJA 2MPMA 2X69A 2B2YA 5EPKA 2B2WC 4CJ2C 1X32A 2Q8RE 4IUQA 1B2TA 1MSGA 4RA8A 3IL8A 2L11A 2N88A 1E0BA 2X6GA 1GUWA 2NWGA 3KUPA 1NR2A 1IKMA 1IKLA 1WTWA 1G2TA 3H91A 4QUCA 5COYA 4ZLTF 4NW2A 1DOLA 2RVLA 1WTPA 3TZDA 1WTRA 1SDFA 1F9SA 1M8AA 1DONA 1EL0A 1DOMA 3DEOA 2NZ1D 2HDMA 4CJ1B 4XT3B 1JE4A 5CORA 4HAEA 3P7JA 1U4LA 2RSNA 1F9QA 1PLFA 2HDLA 1AP0A 1CA5A 3UI2A 1VMCA 3TN2A 1EIGA 2EPBA 2B2TA 2XIWA 1CM9A 2IL8A 1BBXC 1KNEA 4ZAIA 3IFDA 3KBXA 1BO0A 2L12A 1HFNA 1JICA 1PFMA 1RJTA 1C8CA 2B2VC 5EPLA 3FPUB 1B4OA 3GV3A 3I3CA 4HEDA 1EOTA 1WVLA 2RA4A 5EQ0A 2KEDA 3MWYW 1HRJA 1S4ZA 1MI2A 5JJZA 1J9OA 2DY7A 1F9PA 2K04A 2J7ZA 1ICWA 1SSOA 1XX8A 2MGSA 3HP3A 2KEEA 3G7LA 2SDFA 4X3KA 1ILPA 1J8IA 1QE6A 1U4MA 4XDXA 5CMDA 1HA6A 1B53A 2FHTA 2B2WA 4R8IA 2L4NA 1XYIA
chains in the Genus database with same CATH superfamily
1RF2D 3EFXD 4M1UB 2I0QA 4C3HH 5H1SE 1EIFA 5C4XH 2K4KA 5FLXL 1EQVA 5BR8Q 1JQYD 3I8ZA 1IBKQ 3S1QB 5CV8A 3PQIA 3H3VH 4QIWE 2LY7A 3CRLC 3QOLA 5C4XB 1JWMD 1QVGA 1NNXA 2FINB 1EWIA 1EFWA 4OONA 1SYBA 3CRKC 2J4XA 3H09A 4L5QA 5EKIA 5LL6S 1PZKD 5C4XG 2E2HH 1UNSA 1E22A 4A3KB 1BXTA 5KNDA 4ZQ3A 4OWXB 3A8JE 2C5CA 3C46A 4DR7L 4HCEA 2XWBB 4GOPC 5M3MG 2A6HD 4ZKBB 1SYFA 1YNXA 2G5DA 4A3KG 1G2SA 4I65A 1N34L 2EYLA 3UE1A 4HTHA 2IJ0A 4XYQA 2B2TC 3GTLH 4GS3A 2L1BA 1EUJA 3OW2A 3U58A 3NK9A 2K14A 4DNRB 4OX9L 2QA4A 4IUNA 2KECA 2PI2E 4KK7A 5D3DA 5GAEC 2MQHA 3DLLA 2D0PA 3JAMc 3GTLB 3RUZA 2R7FA 3KJPA 5J39A 2N88A 1SR3A 2NWGA 5M5XB 1LYLA 4JVZA 4A76A 1EOVA 1JC7A 1CHQD 3A0JA 3KFUA 2E5LQ 3ERSX 2H5XA 4NDXA 2K5HA 4FDBA 2QKIC 2QEJC 4RGOS 3G6JB 1JJGA 3EA6A 4KHPQ 1EY6A 2BDOA 4G4KA 4ZAIA 3PIPA 1Y14B 5JJIA 3ND8A 3VR2A 2KCCA 2UUBQ 1IBLL 4NXMQ 3CKIB 3STBD 1MI2A 2K6AA 3NUCA 1G8ZD 2N49A 2A69D 2EYPA 3TZUA 1N32Q 1JWSD 2R3ZA 3AU7A 1CQVA 1IL8A 2YTVA 3MFYA 3MXGA 3U50C 2EYJA 1SE3A 1C0AA 1ZYRC 2CVRA 1W2BA 1A0IA 1SROA 1XMQL 2G9DA 1EY4A 3D0FA 4K2KA 1QILA 1PZID 1FNVA 2K7VA 4UP9A 5E1FA 1TS4A 1IXRA 2JYOA 1EU4A 2KHSA 4LWCA 1G6ZA 3OMGA 4RAUC 5JPNC 3Q8DA 1WCMB 3HKSA 3DUZA 4DA2A 4CGYB 3HEJA 1B50A 3NTHA 3T1YL 3PMFA 4HN7A 1BR9A 1WCMG 4JBWA 3FDTA 1K9MC 4ME5A 2AMCB 4R4QA 1F2MA 1OO9B 3A7LA 4ULLA 1MJEA 4LK1C 4LF8L 3DM1A 3H0GB 1WTOA 1XXGA 2RHQB 1NJIC 3CD6A 1K83H 2Z4IA 2BDNA 1SEBD 3G71A 1W6KA 3S14H 1HTLD 4EVOA 3H0GG 4K5XA 1CKMA 5GAHC 1IBMQ 3PO2B 1K83B 2JA8H 4ME3A 2QDLA 3CHBD 4GKKL 3A5ZB 3T13A 1GUWA 3J81j 3PO2G 1F2ZA 1L0YB 4JC0A 1UAPA 3UDXA 1WTWA 4DV0Q 1YVCA 5CV4A 1YBYA 5J3BA 2PW5A 4JI8Q 2Q2UA 4H02A 4K0KL 2F0JA 3T53B 2NZ1D 4QY7A 4RKBA 3NBIA 2KHJA 3BVZA 5I9OA 1JT8A 1LUZA 4LW1A 3ND9A 2F0MA 4IPCA 2WIIB 3TMEA 1ENAA 3QR8A 4KY7A 1D2BA 1LTTD 4WJWA 2RA4A 3U4ZA 2NN6G 3PIOA 5C3WA 1HR0Q 3K80C 4N9PA 1X3EA 1U4MA 2I07B 3A7AB 1QWYA 3OHXC 4HSPA 2VQFL 4B08A 3TP8A 3AQQA 4YHHL 4JG2A 3FVQA 1VQKA 3FPPA 2UUAQ 1PFNA 2O5JC 1XTCD 3NP8A 4OEMB 3FKIH 3GDEA 3I73A 2CH4W 2X6LA 2CQAA 3JAME 1BVSA 4ZKCB 4RHSA 1E1OA 3J81L 1KNAA 1RD9D 4DR5L 5CR3A 1BBWA 2F1MA 2GN5A 1CZWA 4L5TA 1FNUA 3O13A 4P74A 4OWTB 1YHQA 3RD4A 1OXVA 2M2LA 5GADC 1TY2A 2N78A 3LNNA 4DNIA 3FRPB 3NHHA 1LTGD 1GUGA 2Z0SA 4RWSC 5E3FA 1RODA 1TS5A 3EBEA 2RQXA 4NKLA 2A8VA 2NVTH 3SDZA 2VS1A 3HOYH 2NZOA 1L1OA 2PZUA 4HCSA 1STBA 3CCSA 2RBMA 1SXTA 5IY0A 2VQEQ 3F2BA 1X6OA 4J15A 1U4RA 2WV6D 3S2DB 2NVTB 3HOYB 5JPMC 3PUVA 4N8FA 4HJ5A 3JAMi 4EQOA 1W3SA 2LXJA 3GTJH 1X32A 4DR6Q 2L11A 3ICEA 2AKWB 3HOYG 1IKLA 5IGEA 1G2TA 3WDNA 4DUZQ 3K5NA 2L5TA 1F9SA 4TVAB 1K8GA 3DEOA 3CCQA 2HDMA 3GTJB 5CV6A 4RMFA 3G6EA 2GA4B 4S3SA 4TRDA 3K7UC 3CMAA 2F0UA 4B3RQ 1KNEA 1GVPA 3EN2A 1C8CA 4HJAA 3I3CA 4LAAA 4G7HC 1KDCA 1PMRA 2QGQA 2QF7A 2IWHA 4AYBE 1TWHH 1RKNA 1OXXK 3T4AC 2NVYB 3I2ZA 1S3OA 2F4VQ 1YNND 2ZTDA 3NELA 4R8IA 5M3FH 3PIP3 4GOPA 1XNRL 3EVQA 3GTOH 1WD1A 3PCOB 5T1IA 4AYBB 1TWHB 1JOKA 2D2CC 1WOCA 1PHJA 2F0DA 3J80c 5I2YA 4IUTA 2B8GA 3GTMH 1CZGA 3D4WA 3K0XA 4AYBG 1Z6HA 3GTOB 3QO2A 2WFWA 1VQFA 1L0WA 4IALA 1Y1WH 5IP7H 4QB4A 1KD1C 2D9UA 3GTMB 4JPBW 3E3XA 3VA7A 5AJ3Q 4J8QA 1WTXA 1STEA 3I4LA 2DJGC 1Y1WB 3OYYA 1H95A 5T1GA 3S1NH 3N52A 1JR0D 4JI4L 1HUMA 4X65Q 4DXGA 5C5LA 2JXMB 1O7ZA 5DAUA 2UXDQ 1NY4A 1Y1WG 3SGIA 1I4GA 1KIXA 4A93H 3CC7A 1O78A 3RZOH 4DR4Q 1D1KA 4B3ML 2O4XA 3LWEA 3S1NB 1GM5A 2JEAI 3DWAA 4B3TQ 1HTPA 1YJWA 2UUCL 4K5VA 4MN3A 3MXNB 2PYKA 2EE1A 2OTJA 3AEVA 1ASZA 4A93B 3MXNA 2VXWA 4F8MA 4O2DA 2Q8TA 4IN3A 3RZOB 2G9HD 4PMCA 3SVMA 1WD0A 1S5FD 3TBIB 1LTSD 1SMYD 3C1FA 5EBCA 1XNQL 1N33Q 4LF4Q 4MNOA 3AMUA 2KJXA 4A93G 3RMHA 4JYAL 3K7AH 4DAMA 4A3JH 4Q0FA 3HKZE 2NVQH 3DMUA 3R3OA 4HMJA 1DOLA 4OO1I 3KLWA 2R93G 2ENBA 1SFOH 1J5EL 1E2VA 2IY5B 3HKZB 1VQBA 3RLFA 4A3JB 3SE0A 2NVQB 2Z4HA 1SNDA 2UXBL 1HFNA 1SFOB 3HKZG 4A3FH 4A3JG 1R4QB 2F4IA 1P8LA 5EQ0A 1GUTA 2R7DA 3A55A 3KLRA 3B6YA 2NZHA 2J7ZA 1ICWA 4JBJA 5EKLA 1STGA 4A3MH 2FHTA 2F0GA 4FF1A 2M00A 2XSCA 2F0TA 4HMIA 3A5UA 4A3FB 4BY1H 1VQAA 1ET6A 2E2IH 1D5MC 4JI7Q 1ILQA 5BN4A 5BR8L 5C4ZA 1DOKA 3LX0A 1IBKL 3L2PA 4PZ8A 4A3FG 3OWFA 4P75A 4BY1B 1QNUA 1PRTF 1HR0W 2E2IB 4GLXA 1A3VA 3K59A 4IO9A 1Q3LA 2KA7A 5I6YA 3NTIA 1IW7C 4DK6C 4WORA 3L7ZC 3S15H 3SEBA 2LFNA 5C0XH 5FLXc 4FO2A 2SNSA 2NVXH 1F2LA 3IAYA 3J7AV 4CDCC 2EJGC 3S15B 1N36Q 2ZT9C 1PH1A 1B3AA 1SJHD 2IT1A 4HIKA 1PH9A 2B2UA 3W1BA 1ML0D 1I94Q 1CFMA 4GNXB 1RTNA 4LFBQ 5C0XG 2MNAA 4DUYQ 2KVMA 4IFDI 4GNXA 4DPGA 1LACA 3CCJA 3J80E 2AUKA 4CDEC 2K5DA 1SLJA 4KMUC 3V2TA 2JA6H 2A6HC 4RA8A 4A3IH 3E9HA 4GKJL 3BJUA 1NBWA 4NB3A 4JI3Q 2E5LL 1H9SB 3TP7A 4FXKC 1N8RC 3P7JA 1H9SA 1V8QA 3U4VA 1ICFB 1VQEA 2F0WA 2RSNA 4A3IB 5CGKA 1KDBA 3G4SA 3CMEA 3BZDB 1KHIA 3VR4A 2ASBA 5LL6X 3F2CA 3HOUH 5EPLA 4A3IG 2XRQD 1V1OA 1RIPA 2KEDA 1QJOA 3DHQA 4NXML 2PZWA 1CSPA 1F9PA 1RDPD 2IHFA 4Y7NH 4LFCQ 1HA6A 4DXFA 4YWKA 1N32L 1L0XB 1Q1BA 5L37A 1IZ6A 3K58A 2F0HA 4G7OC 4KLKA 2E8GA 2WP8J 2EJFC 1SYDA 2M9VA 3T1HL 4Y7NB 2FMCA 1A63A 1VQ9A 3TREA 4POGA 3CCLA 2ATWA 2JE6I 1Q1EA 2F3VA 3STBC 3TEHB 4H0LC 3J7ZC 2I5HA 4XT1B 1GD7A 4NP5A 3ER0A 2A69C 2F3WA 1LTID 1I50H 3ONAB 1KQSA 3J7AF 3Q24A 4R1JA 3A8IE 1OXSC 4UPAA 3PO3H 4LJZC 1X3QA 2F0QA 4XXEA 1Q90A 4JI1Q 1I50B 1PRTD 5HY6A 3NEMA 2I5MX 4KI0A 4ID6A 4KHVA 4C3HB 1KAAA 1DD2A 3PO3B 4DKAC 2MP1A 4NPSA 4R8NA 4Z9CB 4IPGA 3GD7A 1B44D 1EY8A 4RGMA 1OTCA 4AH6A 4JI5Q 1Y8NB 4QIWB 4C3HG 4DV1Q 3JC66 1MD2D 3PO3G 1XPUA 3PUXA 1DZ1A 4OHJA 1Q46A 4HSVA 4B3SL 1EYAA 2MPMA 2RF4A 2IX0A 1PTOH 4DR2Q 4DR3Q 5C4HA 4IUQA 5DLQE 4G57A 2E2HB 3KUPA 1MIUA 1BQQT 1XJVA 4DV0L 2YU9H 2EY2A 4JI8L 2PZTA 4DK3C 2EIFA 1PTOB 4CJ1B 4CDDC 5IYCH 1EY5A 1GJXA 3NXWA 4GN4B 1A3TA 5FLXE 1SE2A 3PF5A 1CHPD 2YU9B 1NUCA 4DV4Q 2SEBD 1HNZQ 1B9NA 1TXYA 2AQ2B 4FXDA 2WACA 3HOXH 1M90C 3TS0A 2ZM6Q 5ELOA 1TWFH 1S5ED 4UHVA 4F87A 1HRJA 1HR0L 1T9HA 3PUWA 4QJFA 5K36H 1ILPA 3NWSA 1TKWB 2KCMA 5LMUQ 2PI2A 4CBVA 4FNFA 3HOXB 4IPDA 5IYCG 1XYIA 1X3GA 3BDLA 2UUAL 3DEPA 1S5CD 3IKJA 2HD3A 1QUQB 4JI6Q 4IPHA 4EQPA 1GOZA 1X55A 2WB1E 3A74A 1STYA 1CI3M 1QUQA 4QF4A 4A4IA 3HOXG 4X3UA 1LT4D 2XWJB 3VA5A 1I4RA 4OL7A 3F2DA 2AUJD 4LF6Q 3S9WA 2ZXOA 4POFA 4DV5Q 1VQGA 4A3GH 4O0AA 2WB1B 3E0JA 1S5DD 4BS9A 5ELBA 1A2UA 1NTGA 2ZXPA 3MHBA 3Q6SA 1AFPA 4R4IA 3NENA 1FYCA 3HZXA 5EGTA 2WB1G 1QB5D 3J7YW 4A3GB 4LFAL 1ZKOA 3RZDH 4WFN3 1JB7A 2F0NA 4DU9A 5KIXA 2CFMA 1O7IA 5LHY1 2JA9A 3J81c 1A3UA 5IOCA 2L55A 2PMZE 4A3GG 2KOLA 1Q8KA 1I4HA 2LS01 2CKZB 5DEHA 3K5MA 3I4NH 1TWGH 4LMQD 4IJLA 4U673 3H94A 5LMNQ 3SR1A 2EXZA 2VB2X 5FKAC 2F0KA 2PMZB 4YWLA 1QNKA 5AFWA 5DM63 4DFAA 3HOZH 3KYHC 5IT9L 2H4OA 2VQEL 3W2DA 1HNXL 2YTXA 3I4NB 1TWGB 2EYOA 5J1ZA 3H6MA 2X69A 1HZAA 1SNCA 1R9TH 2OXPA 3HOZB 1QVFA 1U9RA 5ELCA 3ZJYC 4DR6L 1E0BA 4IFDH 3ULLA 3I4NG 3VYRA 4A3EH 1HQRD 3UDGA 5KEEA 5ELNA 2RDHA 4NXNL 1LTBD 1M1KC 1H9MA 1UEBA 4H44C 1R9TB 2EVBA 3HOZG 4CKEA 5CORA 1KTKA 3S1MH 1G51A 5I4DA 1VQPA 3UE0A 2BA0A 1A62A 3Q23A 2A5HA 3W3AA 2EJMA 4B3RL 1I6VC 4KN4C 5CC4A 2DGYA 1PH5A 1SJED 3VR6A 4KHZA 1E7ZA 3QWNA 5C0XJ 2JK8A 1ESFA 3S14B 3PF4A 3T56B 1J9OA 5CYUA 3KBXA 1KLUD 1TWCH 2Y0SE 4X3KA 4F7XA 3IRBA 1QE6A 1PRTB 2A1AA 2WKDA 4JW0A 2JA8B 2AWOA 1WTQA 4A3CH 3P1HA 2Y0SB 4DV7Q 3EROA 5JEAJ 1EQTA 1XTDA 2A6EC 4B9WA 3Q0AA 1D5XC 3GTQH 3K8AA 2HQLA 2JA8G 3KF6B 1K8AC 3GTPH 2B2UC 3OIQA 3CCVA 2Y0SG 1UWVA 5CV7A 1LLRD 4LF9Q 5CBEE 3BDCA 4FYDA 4QUFA 4GNXC 3GTQB 4TKOB 1B8AA 4EX5A 1YNNC 1VCIA 2KENA 1PV4A 1SE4A 4J1MA 1ONLA 4PNYA 3RN2A 5FJ8H 1D6EC 1UE5A 4P71A 1EIYB 3VYUA 2N8NA 1XPOA 4UAIA 4X65L 2ZJQA 3DXJC 2JA5H 3CPWA 1Y8PB 4CDFC 2N55A 4KJOA 1Z7TA 1FD7D 4L8JA 2UXDL 1SN8A 3NE5B 3HOWH 2LXKA 3FKIB 5E4XA 4L5SA 1EFID 4B3TL 3D31A 5HGQA 1NCVA 1WTHA 5IWAL 3E6ZX 1YHBA 1YNJD 1XPRA 1VQNA 3TDQA 3S16H 1G91A 1VQ7A 1UE7A 2IHEA 3N6RA 3FKIG 3HOWB 3SK4A 4IOAA 2NUCA 3W1GA 1VQJA 5A35A 1YJ9A 2HHHQ 2R6GA 1N33L 1SNMA 4LF4L 3OTOQ 1B2TA 4GN5A 2WKCA 3W5OA 5FO7B 3URYA 1WTPA 4HIDA 3QB3A 2JSOA 1VDZA 4XT3B 1DCZA 3M3YH 2HDLA 1A8VA 1CM9A 2IL8A 1IHZA 4DAYB 1XMQQ 1K8MA 2ES2A 3A8KE 3J81E 1SMYC 4K2LA 4DAYA 3SXHA 1WVLA 2ZJPA 3M3YB 1DM0B 3BVGA 2K04A 1HJPA 2ZJRA 1F2YA 3E5SA 5CMDA 4LF7L 5ELDA 2MO1A 1LO5D 1B70B 3T1YQ 3MXUA 1I4PA 4OELB 3BZKA 4JI2L 2A6ED 2JQOA 1IYVA 2HIVA 4K6DA 1QG7A 1O7YA 1PTOF 5A2QL 2HQEA 3KDFB 4RHRA 2FJ2A 3H3VC 3KDFA 1GO3E 1PFBA 2LSSA 4O42A 1FGBD 4XIGS 1FL0A 1QVCA 1TQOA 2PPBC 5I6WA 2PQAB 4BA2I 5M3FB 2EZVA 3J81i 4DK1A 2PQAA 1N36L 1PXUA 3G48A 4LUOA 4HJ8A 1LT6D 1PTOC 4FF2A 5DNFA 3DWQA 4P72A 2NYZD 2VL6A 4C3IH 1Q8IA 1SRUA 5M3FG 4K0KQ 1I94L 3ULJA 2R92H 1FGUA 1F9RA 4DF7A 2VY3A 1ESRA 3K5OA 4LFBL 1S40A 4DUYL 3DWPA 3L9AX 3MC0B 5IYDH 2KCTA 2O2LD 4JK1C 1V1PB 1LTLA 4RGNA 4C3IB 3HOVH 1S72A 5ELEA 2TSSA 3C2PA 3KJOA 2R92B 1CT1D 1WFQA 5KYIA 4JBMA 2E2JH 4XQNA 1Y69U 5IP7G 2K5QA 3GO5A 4C3IG 1NR2A 3TS2A 1ENFA 5LMNW 3H91A 3P20A 3HOVB 4NW2A 2R92G 1SDFA 4JI3L 5JVG3 1KXLA 3VR5A 1LABA 4BA1I 2SNMA 2E2JB 2BCOA 2ZTEA 3M4PA 1VQCA 1KABA 3MEFA 4Y52H 4C1NI 1T5XD 5BN3A 1CA5A 4KKTA 4JV5Q 3HOVG 3TN2A 1FVIA 4ALPA 3FHWA 4MZ9A 1D5ZC 1U0LA 3Q22A 3BU2A 2QW7A 3IFDA 2UXCL 2CW0D 1EOTA 4N9TA 3MWYW 1S4ZA 4DR1Q 2EYHA 4HEDA 1VQDA 4JI0Q 2BH8A 2C9OA 2GVBA 1NE3A 3K81C 3D4RA 5IGGA 1E2ZA 4RGTA 3U9OA 3K7AB 1JMCA 4DV6Q 4IOCA 3RLOA 2ZXRA 5HGTA 2RSOA 2Z6BA 2OQ0A 4QL5A 2JA7H 2HCIA 2AWNA 2O5IC 1BBUA 3S17H 1OXTA 3PV0A 4F88A 3TP5A 5HURA 4IFDJ 2B2VA 4AIMA 2V1CC 2Z6KA 2PQEA 1YZ6A 2KUMA 5FK9C 3RR5A 1EEID 2K5NA 5JVH3 1VQ8A 2JA7B 4EQNA 5FLMH 4QQBX 2JP1A 5C44H 1P16A 2K03A 3D6WA 5EKKA 3I56A 4DGZA 4A3DH 3S17B 2QDBA 2BH2A 1VQIA 3M85A 2K01A 4JCVE 3R2TA 4RKLA 4A3MB 2JA7G 4JI1L 5IGFA 3CCEA 1U5KA 5IP9H 1PDQA 2A19A 1PTOD 4IZ8A 2NBFA 2K33A 4A3MG 1Q7YC 1IYUA 4PZ7A 1EIHA 2RDFA 2B8FA 4BY1G 3X3MA 2XN9C 1EU3A 1ZXTA 1PH2A 1KL9A 3MAQA 2P5ZX 1CUKA 2F0PA 1E3PA 1HXYD 5CBAE 2DNEA 1Z47A 1V9PA 2EY5A 5IP9G 4DR2L 1E1TA 1MSGA 1PRTC 4JBKA 1IKMA 4C1NK 1EYDA 2NVXB 3GTKH 1SBBB 2FXQA 2SOBA 4PG3A 1AE3A 5IODA 3X3NA 5JEAH 1U4LA 1PLFA 1PYBA 2CWAA 1CKNB 3R2IA 4IJHA 1JOOA 5TSSA 1JORA 4DV4L 1HNZL 4X62Q 2OCEA 5KYLA 1FNWA 1EY9A 4XYOA 4K6LA 5JJZA 1KRSA 1SE8A 4RG1A 3M7NA 1XX8A 1I3QH 2DN8A 3I70A 4RCOA 3G7LA 5C3EH 1R4PB 1ASYA 1Q86C 3AYHB 2JN4A 5LMUL 1B53A 1X9NA 1CQFA 1NSNS 5JEAG 3F2UA 2L9HA 2JA6B 2BA1A 4XQJA 1I3QB 4L6TB 4JI6L 5C3EB 2K05A 1IL2A 1NAPA 1CKOA 4OXPA 4DN4M 1EWCA 1CTMA 4KHPL 2PO4A 1X54A 4EQ5A 3BYTB 5M9OA 2JA6G 4LF6L 1O80A 3I91A 3S1RH 1BCPD 2UUBL 4TQUS 4DV5L 5C3EG 2K75A 3RNUA 4B3MQ 1Q81C 1LV9A 5K5PA 4X64Q 1BNZA 4R4CA 2UUCQ 4A3LH 3OMCA 2NB0A 3CC4A 2NTTA 3VYSA 3WWVA 3HOUB 3S1RB 1JWUD 2TMPA 5D14A 1K0RA 2NN6I 2K5VA 2F3IA 1K3BC 1LTAD 1C9OA 4KJNA 4R9WA 3VR3A 1STAA 1TIID 5D65A 3I7FA 2Z8LA 3CF5A 3HOUG 3BS1A 3MTSA 4FF3A 1EYCA 2K1BA 4K5WA 1HZBA 4QGUA 5E4WC 3U9SA 3TSSA 4LF5Q 4WRDA 4KKSA 3MA2B 2WAQE 4G7ZC 1GXDC 3CP0A 1WI5A 2MHVA 3M9BA 1VF7A 1K28A 2A73B 4TSSA 2OWOA 3CCUA 1AZPA 2B3GA 2V4DA 2F0FA 4BBRH 4BBSH 4MTNA 5FOBB 4DAVA 4DV3Q 2WAQB 1Y1VH 4RFBA 3GV6A 1KDAA 3PGZA 4BWGB 5JJKA 2Q2IA 2Z9HA 3SHLA 3CW2C 2N3SA 5J22A 2Q8RE 4L63B 1BUVT 3IFTA 1SMXA 2WAQG 4BBRB 4BBSB 4CKCA 1Y1VB 4QUCA 5EAYA 5JOBA 1FJGQ 1PYSB 5CV5A 3NWTA 1DOMA 4FXGC 4IQZA 1Q12A 2EYFA 5IT9c 4BBRG 5C6AA 4BBSG 1AP0A 1Y1VG 2KCNA 5IYBH 2XIWA 4V190 1IBML 1RCVD 1JICA 1RJTA 1I4XA 5M3MH 3GV3A 4A3KH 4YY3Q 1SSOA 5CV9A 1JE5A 4K14A 2AQ1B 1VQMA 1JCKB 1HA5A 2YTYA 4HIMA 4ZUIA 1E24A 5M3MB 2MO0A 1HNWQ 4J6HA 3QJYA 5IYBG 1BF4A 4DV7L 4KY5A 3GP7A 2HCCA 5JAVA 3D3RA 1RHPA 3ULPA 4P73A 4OO1H 2F0LA 4KD3A 1VQHA 3UDFA 4UP7A 2AHOB 4DV2Q 1EWHA 2ALYB 4LF9L 3CAMA 1X3PA 1A6XA 4PV1C 5NUCA 3DM3A 3OWEB 1SAPA 3V05A 2IX1A 3OOCA 4CJ0B 1MKHA 3V96A 4IUVA 1TWFB 2MJ8A 5M5XH 2XGTA 1AN8A 1JJ2A 2VB3X 2A68D 4OO1G 1XMOQ 5IIFA 1K73C 4K8IA 2L0CA 1K0SA 4GKJQ 5K36G 1FR3A 4ZYSA 4KV6A 3T16A 1IYJB 2YYZA 5ELFA 3M4OH 3F8TA 3BG3A 2B29A 2MFIA 3CXCA 1GUSA 3FMCA 3HGBA 3UDIA 1G6PA 3FEWX 1HQMC 1AE2A 2HHHL 1VMPA 2C35B 3M4OB 2UU9Q 4L5RC 1CSQA 1QZGA 2RCNA 2VW9A 1Q82C 4CJ2C 2NTSA 3OTOL 3GTGH 2F52A 3IL8A 3CC2A 3KF8B 4CKBA 1PZJD 4ZLTF 3RZDB 1TS2A 3KF8A 1C48A 3KK7A 3OPOA 1BCPB 4GN3B 2QILA 1YNJC 3GTGB 3S2HH 3UI2A 1O7LA 2D5DA 3T1HQ 1D7QA 5IE8A 1UEAB 3MXPA 1AW7A 4X66Q 1QOHA 1BO0A 4XTCS 1WCMH 2B2VC 1G291 4WJ3M 2Z6KC 4KKUA 3ZYYX 4HIOA 1YI2A 3S2HB 2E2DC 2MGSA 3HP3A 5C4JH 4E6IA 2LMCB 2SDFA 4GLVB 2PNHA 2ICEC 4DUZL 4AQYQ 3I55A 4QMGA 1K8OA 1DYQA 1LM0A 1U4PA 4ABNA 2LKVA 3WOEA 3A54A 5C4JB 3H0GH 4RH6A 4UDUC 4HJ7A 1PH8A 2F0OA 4A3EB 4FP5D 2H1EA 4ZUJA 3TRZA 4K8JA 4P2CB 4BXXH 4MIUA 1VQ4A 2JJQA 3WOFA 4O1NA 3S1MB 4IFDG 2L15A 4WJ4A 1AZQA 4A3EG 3PO2H 1RL2A 2CQOA 1MGSA 3R93A 2F4VL 1MSHA 1PA6A 1TU2B 2XRSD 2MUYA 1EZ8A 5IT9E 4EGVA 1A2TA 4B3SQ 1TWCB 4H7BA 2XNAC 3RN5A 1ENCA 4DR7Q 3JAML 1MBYA 4GZYC 4BXXG 3KF6A 2NN6H 1JOQA 1N34Q 2J0TD 3HS0C 4N8X1 1EQQA 2YV5A 3RLNA 3TQYA 5IGDA 3GTPB 5AJ3L 4DNTB 4DK0A 2Q2TA 4A3CG 1LT3D 3H15A 2BE5C 1YIJA 2Z1CA 4OX9Q 1JB3A 1N9WA 4I7ZC 2PW7A 4R4OA 2B2YA 4ZCKA 4PQXA 5EPKA 4GLAC 4I7AA 4R4TA 1HCZA 2DJFC 4C56C 3M4QA 3ITPA 4DR4L 1PVOA 1B3QA 2D62A 3MZ5A 3TZDA 2K52A 5IGCA 4NMZA 2R61A 1EL0A 3T51B 3VDYA 2JA5B 4HAEA 2I46A 1V1QA 1ZYRD 2D0OA 3OSOA 1VF5C 4CHTB 4JV5L 5FJ8G 1VQ5A 3AFQA 3NPPA 3SK8A 3AB9A 2JA5G 2L12A 1YHAA 1SNOA 2IW3A 1IBLQ 3S16B 3HOWG 1EY7A 5C0XI 4DR1L 2DY7A 4JI0L 3HG9A 4HJ9A 3NBHB 2B2WA 2L4NA 2OQKA 3NBHA 1QCBD 1YEZA 5M5YH 2B39A 3EQLC 4KTAA 4LFAQ 3AFPA 2PNRC 1A15A 2E76C 4DV6L 1WTVA 5C3XA 1I5FA 5KRUA 2CW0C 5KGUA 5M5YB 2HUGA 1L1OB 4X3TA 1B1ZA 2HIXA 3NQIA 4MTKA 3S2DH 1SYGA 3L0OA 4YWMA 2ZTCA 4JOIA 4OIKA 3R8BA 4A75A 5EBDA 3HRZC 3M7GA 1C7YA 3NQTA 5EJWA 1HNXQ 1D1IA 4JI7L 3QOJA 3K5LA 4IURA 2FMMA 2WINB 1HHVA 3D8GA 1QZHA 2EY1A 1X56A 2DY8A 4LF8Q 1HZ9A 3KBGA 1TVXA 1DJRD 2A74C 4NXNQ 2B63H 1ET9A 1CA6A 4KY6A 4V0BA 5M5WH 3LWUA 3PSIA 5D3IB 2XTIA 1HZCA 1SNPA 1I6HH 2BE5D 2E75C 2NVYH 1OXUA 1X3FA 2B63B 4OIJA 2AQ3B 1C4QA 2K50A 5M5WB 5GQOA 4GKKQ 3CCMA 1TY0A 1I6HB 2X6GA 3EJIA 3D4DA 3KOJA 4HR7B 4GOPB 2B63G 1W6JA 2IPKD 4X6AH 1YITA 3I4OA 3K0YA 2QEXA 2KBNA 2I5LX 1PFSA 2OEOA 1EIGA 2B2TA 2EDGA 1GHKA 2IX3A 4ZRZA 4X62L 1V1PA 1Z9FA 4FF4A 1B4OA 1EQRA 1CK1A 5A2QE 1BDOA 4PZ6A 1XWEA 2Q2HA 1GUNA 3K6OA 2KEEA 5G3LF 1J8IA 4XDXA 4APVA 1TT2A 1V43A 1T5EA 4UP8A 3SK5A 4QCLA 1H9KA 2VQFQ 4ILWA 3BDOA 3KLSA 1DXMA 2DNCA 3D6CA 4YHHQ 1PYWD 1VQOA 1PH3A 3H3VI 1VQLA 3F1ZA 1EZ6A 5IYDG 2CWPA 2PCFB 3TP6A 3CU7A 1HUNA 1UE6A 5FO8B 4YCWA 2F0VA 4DR5Q 4LUVA 1B7YB 1KAWA 2Q8IB 1RTOA 1BCPF 4M8AA 4X64L 1J6QA 4U68A 1AH9A 1LTRD 3BZCA 5IWAQ 4C3JH 4ODGA 1L2FA 4LFCL 3QG1A 2R93H 4DAPA 5GAGC 4RCNA 4H13C 1EEFD 3CPFA 4UY8C 1D8LA 3FP9A 1TR5A 4C3JB 1NR4A 4ZK9B 2VUMH 1SNQA 3CQZH 3OIPA 2R93B 1MHWC 1SYEA 3QIAA 5ISRA 2K5WA 1BCPC 2KQ3A 4C3JG 4LF5L 4C2MH 1X65A 2VUMB 2BOSA 4PMWA 2RHSB 4IUPA 4YIJA 1E2WA 3BYYB 3CQZB 1TS3A 2K28A 3HFZB 1BKBA 5C5MA 1HFGA 3NTKA 3OW7A 5F2DA 1LT5D 4DV3L 4C2MB 2VUMG 2ID0A 4LNQA 4YCVA 2R7ZH 1S5BD 5C44B 5KNBA 2VNUD 1SYCA 4A3DB 5COYA 2GVAA 2OT2A 1STNA 1FJGL 1WTRA 3PUYA 1K3RA 1M8AA 4LUZA 5E7NA 3E9IA 2F0SA 4LF7Q 5FLMG 1KC8C 4JI5L 2ICIA 5C44G 4DV1L 2R7ZB 3PIO3 4A3DG 4JI2Q 1VS0A 1VMCA 1BBXC 2OTLA 3J80L 1PFMA 1KRTA 1UUPA 3FPUB 2R7ZG 1M4VA 4DR3L 3S24A 3ERQA 4FVMA 5JJLA 4YY3L 2CHBD 1DGSA 3MEHA 4KD4A 2QCPX 2EY6A 3C3LA 1EY0A 1HPCA 3C1EA 1XNRQ 2CH4A 2DUDA 3E0EA 1HNWL 4X3SA 5IGBA 1F77A 2K32A 4BY7H 5DM73 1PH6A 2EOTA 4YCUA 5GROA 1WJJA 1CKNA 4A3BH 1VQ6A 3BVMA 3GTKB 1GUOA 2F0IA 1GKHA 4DV2L 2ZM6L 1KLGD 2CCZA 1MJCA 4BY7B 5G3LD 5I2XA 3PUZA 4XQQA 4A3BB 2B2YC 4BY7G 1UE1A 4JI4Q 4A3BG 1EYGA 1XMOL 3M4YA 3I90A 4OWWB 2HT1A 1WYDA 1I4QA 5EPJA 2EXDA 2KHIA 2FFKB 3NSWA 5FO9B 2RKSA 5BN5A 3EIVA 5KNCA 1NMFA 3I4MH 1JJCB 4MHEA 3GQBA 5I9PA 3MFGA 2VZAA 2F03A 3J7A5 2F0EA 3P75A 2RDGA 2XVSA 4IUUA 3VYTA 1H9RA 3KLSX 4OGQC 2EQSA 3SK6A 2UXCQ 1XNQQ 2A68C 1GHJA 3I4MB 2UU9L 2EYMA 1TWAH 2B2WC 4JYAQ 1Y8OB 1PH7A 1B9MA 4A3LG 2RVLA 3I4MG 2OF1A 1HH2P 1BOSA 1NMGA 1DONA 4B9XA 5LMNL 1TWAB 1JE4A 1J5EQ 1F9QA 1PH4A 1YJNA 2EPBA 1II3A 4Q5VA 3A56A 3J80i 4X66L 2RCFA 3CCRA 3LGJA 2UXBQ 1L1OC 4JOIC 1STHA 2E74C 4KN7C 1H9JA 2JEBI 4PMBA 1ZEQX 3L3OC 1IW7D 4AQYL 3MVVA 3K57A 3S1QH 1AEXA 3I72A
chains in the Genus database with same CATH topology
1RF2D 3EFXD 4M1UB 5FLXL 1EQVA 1JQYD 3I8ZA 3S1QB 5CV8A 2LY7A 3CRLC 3QOLA 5C4XB 1JWMD 2FINB 1SYBA 3CRKC 2J4XA 3H09A 5EKIA 5LL6S 1PZKD 1UNSA 4A3KB 1BXTA 5KNDA 4ZQ3A 3A8JE 2C5CA 3C46A 4HCEA 2XWBB 2A6HD 4ZKBB 1SYFA 1G2SA 4I65A 2EYLA 4HTHA 2IJ0A 4XYQA 2B2TC 2L1BA 3NK9A 4DNRB 4IUNA 2KECA 4KK7A 5D3DA 3GTLB 3RUZA 5J39A 2N88A 2NWGA 5M5XB 1JC7A 1CHQD 4NDXA 2QEJC 2QKIC 4RGOS 3G6JB 3EA6A 1EY6A 2BDOA 4G4KA 4ZAIA 3ND8A 3VR2A 2KCCA 3CKIB 1MI2A 2K6AA 3NUCA 1G8ZD 2A69D 2EYPA 3TZUA 1JWSD 2R3ZA 3AU7A 1CQVA 1IL8A 3MFYA 3MXGA 2EYJA 1SE3A 1ZYRC 2CVRA 2G9DA 1EY4A 4K2KA 1QILA 1PZID 1FNVA 2K7VA 5E1FA 1TS4A 2JYOA 1EU4A 2KHSA 1G6ZA 3OMGA 4RAUC 5JPNC 1WCMB 3DUZA 4DA2A 4CGYB 3HEJA 1B50A 3NTHA 3PMFA 4HN7A 1BR9A 4JBWA 3FDTA 4ME5A 1F2MA 1OO9B 3A7LA 4ULLA 4LK1C 3DM1A 3H0GB 1WTOA 1XXGA 2Z4IA 2BDNA 1SEBD 1W6KA 1HTLD 4EVOA 4K5XA 3PO2B 1K83B 3CHBD 3T13A 1GUWA 1F2ZA 1L0YB 1WTWA 1UAPA 5CV4A 2PW5A 2F0JA 3T53B 2NZ1D 4RKBA 3NBIA 3BVZA 5I9OA 3ND9A 2F0MA 2WIIB 3TMEA 1ENAA 4KY7A 1D2BA 1LTTD 4WJWA 2RA4A 2NN6G 5C3WA 4N9PA 1U4MA 2I07B 3A7AB 1QWYA 3OHXC 4HSPA 4B08A 3TP8A 3FVQA 3FPPA 1PFNA 2O5JC 1XTCD 3NP8A 3I73A 2X6LA 2CQAA 3JAME 4ZKCB 4RHSA 3J81L 1KNAA 1RD9D 5CR3A 2F1MA 1CZWA 1FNUA 3O13A 3RD4A 1OXVA 2M2LA 1TY2A 3LNNA 3FRPB 3NHHA 1LTGD 1GUGA 4RWSC 5E3FA 1RODA 1TS5A 2RQXA 4NKLA 3SDZA 4HCSA 2PZUA 1STBA 2RBMA 1SXTA 1U4RA 2WV6D 3S2DB 2NVTB 3HOYB 5JPMC 3PUVA 4EQOA 1X32A 2L11A 1IKLA 5IGEA 1G2TA 3WDNA 3K5NA 2L5TA 1F9SA 3DEOA 2HDMA 3GTJB 5CV6A 2GA4B 4S3SA 4TRDA 2F0UA 1KNEA 1C8CA 3I3CA 4LAAA 4G7HC 1KDCA 1PMRA 2QF7A 2IWHA 1RKNA 1OXXK 3T4AC 2NVYB 1YNND 4R8IA 3PIP3 3EVQA 1WD1A 5T1IA 4AYBB 1TWHB 1JOKA 2D2CC 2F0DA 5I2YA 4IUTA 2B8GA 1CZGA 3D4WA 1Z6HA 3GTOB 3QO2A 4IALA 4QB4A 2D9UA 3GTMB 3VA7A 4J8QA 1WTXA 1STEA 3I4LA 1Y1WB 5T1GA 3N52A 1JR0D 1HUMA 4DXGA 5C5LA 2JXMB 1O7ZA 5DAUA 1I4GA 1O78A 1D1KA 2O4XA 3LWEA 3S1NB 2JEAI 3DWAA 1HTPA 4K5VA 4MN3A 2PYKA 2EE1A 4A93B 3MXNA 2VXWA 4F8MA 2Q8TA 4IN3A 3RZOB 2G9HD 4PMCA 3SVMA 1WD0A 1S5FD 3TBIB 1LTSD 1SMYD 3C1FA 5EBCA 3AMUA 2KJXA 3RMHA 4Q0FA 3DMUA 3R3OA 4HMJA 1DOLA 4OO1I 2ENBA 1E2VA 3HKZB 3RLFA 4A3JB 3SE0A 2NVQB 2Z4HA 1SNDA 1HFNA 1SFOB 1R4QB 2F4IA 5EQ0A 1GUTA 3A55A 3KLRA 2J7ZA 1ICWA 5EKLA 1STGA 2FHTA 2F0GA 4FF1A 2M00A 2XSCA 2F0TA 4HMIA 4A3FB 1ET6A 1D5MC 1ILQA 5BN4A 5C4ZA 1DOKA 3LX0A 3OWFA 4BY1B 1QNUA 1PRTF 2E2IB 1A3VA 3K59A 1Q3LA 2KA7A 5I6YA 3NTIA 1IW7C 4WORA 3L7ZC 3SEBA 2LFNA 5C0XH 4FO2A 2SNSA 1F2LA 3IAYA 3J7AV 2EJGC 3S15B 2ZT9C 1B3AA 1SJHD 2IT1A 2B2UA 1ML0D 1CFMA 1RTNA 5C0XG 2KVMA 4IFDI 1LACA 3J80E 2AUKA 2K5DA 4KMUC 3V2TA 2A6HC 4RA8A 1H9SB 3TP7A 4FXKC 3P7JA 1H9SA 1V8QA 4A3IB 2RSNA 2F0WA 5CGKA 1KDBA 3BZDB 3VR4A 5LL6X 5EPLA 2XRQD 1V1OA 2KEDA 1QJOA 3DHQA 2PZWA 1F9PA 1RDPD 1HA6A 4DXFA 1L0XB 1Q1BA 3K58A 2F0HA 4G7OC 2WP8J 2EJFC 1SYDA 2M9VA 4Y7NB 2FMCA 2JE6I 1Q1EA 2F3VA 4H0LC 4XT1B 4NP5A 2A69C 2F3WA 1LTID 3ONAB 3J7AF 3Q24A 3A8IE 1OXSC 4LJZC 1X3QA 2F0QA 4XXEA 1Q90A 1I50B 1PRTD 4KI0A 4ID6A 4KHVA 4C3HB 1KAAA 1DD2A 3PO3B 2MP1A 4R8NA 4Z9CB 3GD7A 1B44D 1EY8A 4RGMA 1Y8NB 4QIWB 4C3HG 1MD2D 3PUXA 1DZ1A 4OHJA 4HSVA 1EYAA 2MPMA 2IX0A 1PTOH 5C4HA 4IUQA 4G57A 2E2HB 3KUPA 1BQQT 2EY2A 2PZTA 1PTOB 4CJ1B 1EY5A 1GJXA 3NXWA 1A3TA 5FLXE 1SE2A 1CHPD 2YU9B 1NUCA 2SEBD 1B9NA 2AQ2B 4FXDA 2WACA 1S5ED 4F87A 1HRJA 3PUWA 5K36H 1ILPA 3NWSA 1TKWB 4CBVA 4FNFA 3HOXB 1XYIA 3BDLA 3DEPA 1S5CD 3IKJA 4EQPA 1GOZA 1STYA 1CI3M 4QF4A 4X3UA 1LT4D 2XWJB 3VA5A 1I4RA 4OL7A 2AUJD 3S9WA 2ZXOA 2WB1B 3E0JA 1S5DD 4BS9A 5ELBA 1A2UA 2ZXPA 3MHBA 3Q6SA 1AFPA 1FYCA 3HZXA 5EGTA 1QB5D 3J7YW 4A3GB 1ZKOA 4WFN3 2F0NA 4DU9A 5KIXA 5LHY1 1A3UA 5IOCA 2L55A 2KOLA 1I4HA 2LS01 5DEHA 3K5MA 4LMQD 4U673 3H94A 3SR1A 5FKAC 2EXZA 2VB2X 2F0KA 2PMZB 1QNKA 5AFWA 5DM63 4DFAA 5IT9L 2H4OA 3W2DA 3I4NB 1TWGB 2EYOA 5J1ZA 3H6MA 2X69A 1SNCA 2OXPA 3HOZB 1U9RA 5ELCA 4IFDH 1E0BA 3VYRA 1HQRD 5KEEA 2RDHA 1LTBD 1H9MA 4H44C 1R9TB 2EVBA 4CKEA 5CORA 1KTKA 5I4DA 2BA0A 3Q23A 2A5HA 3W3AA 2EJMA 1I6VC 4KN4C 5CC4A 1SJED 3VR6A 4KHZA 5C0XJ 3QWNA 1ESFA 3S14B 3T56B 1J9OA 5CYUA 3KBXA 1KLUD 4X3KA 4F7XA 1QE6A 1PRTB 2WKDA 2JA8B 2AWOA 1WTQA 3P1HA 2Y0SB 3EROA 5JEAJ 1EQTA 4B9WA 2A6EC 3Q0AA 1D5XC 2B2UC 3OIQA 5CV7A 1LLRD 5CBEE 3BDCA 4FYDA 4QUFA 3GTQB 4TKOB 1YNNC 1VCIA 1SE4A 4J1MA 1ONLA 4PNYA 1D6EC 3VYUA 4UAIA 3DXJC 1Y8PB 2N55A 4KJOA 1Z7TA 1FD7D 4L8JA 3NE5B 3FKIB 5E4XA 1EFID 3D31A 1NCVA 3E6ZX 1YNJD 3TDQA 1G91A 3N6RA 3HOWB 3SK4A 2NUCA 5A35A 2R6GA 1SNMA 1B2TA 2WKCA 5FO7B 3URYA 1WTPA 3QB3A 2JSOA 1VDZA 4XT3B 1DCZA 2HDLA 1CM9A 2IL8A 1IHZA 1K8MA 3A8KE 3J81E 1SMYC 4K2LA 4DAYA 3SXHA 1WVLA 3M3YB 1DM0B 3BVGA 2K04A 1F2YA 3E5SA 5CMDA 5ELDA 1LO5D 3MXUA 1I4PA 2A6ED 1IYVA 4K6DA 1QG7A 1O7YA 1PTOF 5A2QL 2HQEA 4RHRA 2FJ2A 3H3VC 1PFBA 4O42A 1FGBD 4XIGS 1TQOA 2PPBC 5I6WA 4BA2I 5M3FB 2EZVA 4DK1A 1PXUA 1LT6D 1PTOC 4FF2A 5DNFA 3DWQA 2NYZD 1Q8IA 1F9RA 4DF7A 1ESRA 3K5OA 3DWPA 3L9AX 3MC0B 2O2LD 4JK1C 1V1PB 4RGNA 4C3IB 5ELEA 2TSSA 3C2PA 2R92B 1CT1D 5KYIA 4XQNA 1Y69U 2K5QA 3GO5A 4C3IG 1NR2A 1ENFA 3H91A 3P20A 3HOVB 4NW2A 1SDFA 5JVG3 3VR5A 1LABA 4BA1I 2SNMA 2E2JB 2BCOA 1KABA 4C1NI 1T5XD 5BN3A 1CA5A 4KKTA 3TN2A 1D5ZC 3Q22A 3IFDA 2CW0D 1EOTA 4N9TA 3MWYW 1S4ZA 2EYHA 4HEDA 2C9OA 3D4RA 5IGGA 1E2ZA 4RGTA 3U9OA 3K7AB 2ZXRA 5HGTA 2RSOA 2HCIA 2AWNA 2O5IC 1OXTA 3PV0A 4F88A 3TP5A 5HURA 4IFDJ 2B2VA 2PQEA 2KUMA 5FK9C 1EEID 5JVH3 2JA7B 4EQNA 2JP1A 2K03A 3D6WA 5EKKA 4DGZA 3S17B 2QDBA 3M85A 2K01A 3R2TA 4RKLA 4A3MB 5IGFA 1PDQA 1PTOD 4IZ8A 2NBFA 2K33A 1IYUA 1EIHA 2RDFA 2B8FA 3X3MA 2XN9C 1EU3A 1ZXTA 3MAQA 2F0PA 1HXYD 5CBAE 2DNEA 1Z47A 2EY5A 1MSGA 1PRTC 1IKMA 4C1NK 1EYDA 2NVXB 1SBBB 2SOBA 5JEAH 5IODA 3X3NA 1U4LA 1PLFA 3R2IA 5TSSA 1JOOA 1JORA 5KYLA 1FNWA 1EY9A 4XYOA 4K6LA 5JJZA 3M7NA 1XX8A 2DN8A 3I70A 4RCOA 3G7LA 1R4PB 1B53A 1CQFA 1NSNS 5JEAG 3F2UA 2L9HA 2JA6B 2BA1A 4XQJA 1I3QB 4L6TB 5C3EB 2K05A 1NAPA 4DN4M 1EWCA 1CTMA 2PO4A 3BYTB 5M9OA 1O80A 3I91A 1BCPD 4TQUS 1LV9A 5K5PA 1BNZA 3OMCA 2NB0A 2NTTA 3VYSA 3HOUB 3S1RB 1JWUD 2TMPA 5D14A 2NN6I 1LTAD 4KJNA 4R9WA 3VR3A 1STAA 1TIID 5D65A 2Z8LA 3BS1A 3MTSA 4FF3A 1EYCA 2K1BA 4K5WA 5E4WC 3U9SA 3TSSA 4WRDA 4KKSA 3MA2B 4G7ZC 1GXDC 2MHVA 1VF7A 2A73B 4TSSA 1AZPA 2V4DA 2F0FA 5FOBB 4DAVA 2WAQB 4RFBA 3GV6A 1KDAA 4BWGB 3SHLA 5J22A 2Q8RE 4L63B 1BUVT 3IFTA 4BBRB 4BBSB 4CKCA 1Y1VB 4QUCA 5JOBA 5CV5A 3NWTA 1DOMA 4FXGC 4IQZA 1Q12A 2EYFA 5C6AA 1AP0A 2KCNA 2XIWA 4V190 1RCVD 1JICA 1RJTA 1I4XA 3GV3A 1SSOA 5CV9A 4K14A 2AQ1B 1JCKB 1HA5A 4ZUIA 5M3MB 4J6HA 3QJYA 1BF4A 4KY5A 3GP7A 2HCCA 5JAVA 3D3RA 1RHPA 4OO1H 2F0LA 4KD3A 1EWHA 1X3PA 1A6XA 4PV1C 5NUCA 3OWEB 1SAPA 3V05A 2IX1A 3OOCA 4CJ0B 3V96A 4IUVA 1TWFB 2MJ8A 1AN8A 2VB3X 2A68D 4OO1G 5IIFA 4K8IA 2L0CA 5K36G 1FR3A 4ZYSA 4KV6A 3T16A 2YYZA 5ELFA 3BG3A 1GUSA 3FMCA 3HGBA 3FEWX 1HQMC 1VMPA 3M4OB 4CJ2C 2NTSA 3IL8A 4CKBA 1PZJD 4ZLTF 3RZDB 1TS2A 3KF8A 1C48A 3KK7A 3OPOA 1BCPB 2QILA 1YNJC 3GTGB 3UI2A 1O7LA 2D5DA 1UEAB 3MXPA 1AW7A 1QOHA 1BO0A 4XTCS 2B2VC 1G291 4KKUA 3ZYYX 3S2HB 2E2DC 2MGSA 3HP3A 4E6IA 2LMCB 2SDFA 2ICEC 4QMGA 1K8OA 1DYQA 1U4PA 4ABNA 2LKVA 3WOEA 3A54A 5C4JB 4RH6A 4UDUC 2F0OA 4A3EB 4FP5D 2H1EA 4ZUJA 4K8JA 4P2CB 4MIUA 4IFDG 3WOFA 3S1MB 4O1NA 1AZQA 1MGSA 3R93A 1MSHA 1TU2B 2XRSD 2MUYA 1EZ8A 5IT9E 4EGVA 1A2TA 1TWCB 4H7BA 2XNAC 1ENCA 3JAML 1MBYA 4GZYC 2NN6H 1JOQA 2J0TD 3HS0C 5IGDA 3GTPB 4DNTB 4DK0A 1LT3D 2BE5C 2Z1CA 1JB3A 4I7ZC 2PW7A 2B2YA 4PQXA 5EPKA 1HCZA 4C56C 3ITPA 2D62A 3MZ5A 3TZDA 5IGCA 4NMZA 2R61A 1EL0A 3T51B 2JA5B 4HAEA 2I46A 1ZYRD 3OSOA 1VF5C 4CHTB 3SK8A 3NPPA 3AB9A 2L12A 1SNOA 2IW3A 3S16B 1EY7A 5C0XI 2DY7A 3HG9A 2B2WA 2L4NA 3NBHA 1QCBD 2B39A 3EQLC 4KTAA 2PNRC 1A15A 2E76C 1WTVA 5C3XA 5KRUA 2CW0C 5KGUA 5M5YB 2HUGA 4X3TA 1B1ZA 3NQIA 1SYGA 4OIKA 3R8BA 5EBDA 3HRZC 3M7GA 3NQTA 5EJWA 1D1IA 3QOJA 3K5LA 4IURA 2FMMA 2WINB 1HHVA 3D8GA 2EY1A 2DY8A 3KBGA 1TVXA 1DJRD 2A74C 1ET9A 1CA6A 4KY6A 4V0BA 3LWUA 5D3IB 1SNPA 2BE5D 2E75C 1OXUA 2B63B 4OIJA 2AQ3B 1C4QA 5M5WB 1TY0A 1I6HB 2X6GA 3EJIA 3D4DA 4HR7B 1W6JA 2IPKD 3K0YA 2OEOA 1EIGA 2B2TA 2EDGA 1GHKA 2IX3A 4ZRZA 1V1PA 4FF4A 1B4OA 1CK1A 5A2QE 1BDOA 1XWEA 1GUNA 3K6OA 2KEEA 5G3LF 1J8IA 4XDXA 1TT2A 1V43A 1T5EA 3SK5A 4QCLA 1H9KA 4ILWA 3BDOA 3KLSA 1DXMA 2DNCA 3D6CA 1PYWD 1EZ6A 2PCFB 3TP6A 3CU7A 1HUNA 5FO8B 2F0VA 2Q8IB 1RTOA 1BCPF 4M8AA 4U68A 1LTRD 4ODGA 3QG1A 4DAPA 4RCNA 4H13C 1EEFD 1TR5A 4C3JB 1NR4A 4ZK9B 1SNQA 3OIPA 2R93B 1SYEA 3QIAA 5ISRA 2K5WA 1BCPC 2KQ3A 4C3JG 2VUMB 2BOSA 4PMWA 4IUPA 4YIJA 1E2WA 3BYYB 3CQZB 1TS3A 2K28A 5C5MA 1HFGA 3NTKA 3OW7A 5F2DA 1LT5D 4C2MB 2ID0A 1S5BD 5C44B 5KNBA 2VNUD 1SYCA 4A3DB 5COYA 2OT2A 1STNA 1WTRA 3PUYA 1M8AA 2F0SA 2ICIA 2R7ZB 3PIO3 1VMCA 1BBXC 3J80L 1PFMA 1UUPA 3FPUB 1M4VA 3ERQA 4FVMA 2CHBD 3MEHA 4KD4A 2QCPX 2EY6A 3C3LA 1EY0A 1HPCA 3C1EA 4X3SA 5IGBA 1F77A 2K32A 5DM73 2EOTA 3BVMA 3GTKB 1GUOA 2F0IA 1KLGD 4BY7B 5G3LD 5I2XA 3PUZA 4XQQA 4A3BB 2B2YC 3M4YA 3I90A 1I4QA 5EPJA 2FFKB 3NSWA 5FO9B 2RKSA 5BN5A 5KNCA 4MHEA 3GQBA 5I9PA 3MFGA 2F03A 2F0EA 3P75A 2RDGA 3VYTA 2XVSA 4IUUA 1H9RA 3KLSX 4OGQC 3SK6A 2A68C 1GHJA 3I4MB 2EYMA 2B2WC 1Y8OB 1B9MA 2RVLA 2OF1A 1BOSA 1DONA 4B9XA 1TWAB 1JE4A 1F9QA 2EPBA 1II3A 4Q5VA 3A56A 1STHA 2E74C 4KN7C 1H9JA 2JEBI 4PMBA 1ZEQX 3L3OC 1IW7D 3MVVA 3K57A 1AEXA 3I72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD1 A;  2R3Z A;  3F2U A;  5T1I A;  1PFN A;  1U4P A;  1IL8 A;  2L9H A;  4X3S A;  1WTQ A;  3DEP A;  1BF4 A;  2HCC A;  1A15 A;  1ILQ A;  1EQT A;  2EOT A;  2K05 A;  1DOK A;  1NAP A;  1RHP A;  2CVR A;  2X6L A;  3I8Z A;  4IUT A;  1HUN A;  4DN4 M;  1QG7 A;  4X3U A;  2RSO A;  1WTV A;  4ZKC B;  2B2U C;  1O7Y A;  2H1E A;  1KNA A;  1O80 A;  3QO2 A;  3I91 A;  2HUG A;  2HCI A;  1AZQ A;  2FIN B;  1RTO A;  1X3P A;  5CBE E;  4X3T A;  1LV9 A;  4QUF A;  1BNZ A;  2JYO A;  4U68 A;  1MGS A;  2FJ2 A;  4XT1 B;  1G6Z A;  2D9U A;  1Q3L A;  1SAP A;  4RAU C;  3R93 A;  2B2V A;  3Q6S A;  1MSH A;  1PFB A;  4OIK A;  2KUM A;  2B2Y C;  3ONA B;  4CJ0 B;  5EKI A;  4IUV A;  1WTX A;  5D14 A;  2JP1 A;  4O42 A;  2K03 A;  2MJ8 A;  3D6W A;  5EJW A;  1B50 A;  5T1G A;  3N52 A;  2M2L A;  1HUM A;  4IUR A;  1X3Q A;  1NR4 A;  4R9W A;  2K01 A;  4UAI A;  4ZK9 B;  2FMM A;  1F2L A;  3FDT A;  1O7Z A;  5D65 A;  1HHV A;  3MTS A;  3I90 A;  4ZKB B;  2N55 A;  1G2S A;  2K1B A;  2KOL A;  1B3A A;  1PDQ A;  5E4W C;  2DY8 A;  4RWS C;  1ROD A;  5DNF A;  3DM1 A;  3LWE A;  5E4X A;  2MP1 A;  5EPJ A;  2NYZ D;  4LMQ D;  1WTO A;  1TVX A;  1EIH A;  1NCV A;  2B2U A;  2FFK B;  4HCS A;  1ML0 D;  2B2T C;  4IUP A;  1CA6 A;  4MN3 A;  2BDN A;  2EE1 A;  2K28 A;  4MHE A;  1F9R A;  2L1B A;  1G91 A;  1QNK A;  1RTN A;  1ESR A;  2VXW A;  5AFW A;  1ZXT A;  1AZP A;  1HFG A;  2KVM A;  2Q8T A;  3SVM A;  1WD0 A;  1DZ1 A;  2KEC A;  4HSV A;  1U4R A;  4IUU A;  3GV6 A;  5CBA E;  1VMP A;  4OIJ A;  2MPM A;  2X69 A;  2B2Y A;  5EPK A;  2B2W C;  4CJ2 C;  1X32 A;  2Q8R E;  4IUQ A;  1B2T A;  1MSG A;  4RA8 A;  3IL8 A;  2L11 A;  2N88 A;  1E0B A;  2X6G A;  1GUW A;  2NWG A;  3KUP A;  1NR2 A;  1IKM A;  1IKL A;  1WTW A;  1G2T A;  3H91 A;  4QUC A;  5COY A;  4ZLT F;  4NW2 A;  1DOL A;  2RVL A;  1WTP A;  3TZD A;  1WTR A;  1SDF A;  1F9S A;  1M8A A;  1DON A;  1EL0 A;  1DOM A;  3DEO A;  2NZ1 D;  2HDM A;  4CJ1 B;  4XT3 B;  1JE4 A;  5COR A;  4HAE A;  3P7J A;  1U4L A;  2RSN A;  1F9Q A;  1PLF A;  2HDL A;  1AP0 A;  1CA5 A;  3UI2 A;  1VMC A;  3TN2 A;  1EIG A;  2EPB A;  2B2T A;  2XIW A;  1CM9 A;  2IL8 A;  1BBX C;  1KNE A;  4ZAI A;  3IFD A;  3KBX A;  1BO0 A;  2L12 A;  1HFN A;  1JIC A;  1PFM A;  1RJT A;  1C8C A;  2B2V C;  5EPL A;  3FPU B;  1B4O A;  3GV3 A;  3I3C A;  4HED A;  1EOT A;  1WVL A;  2RA4 A;  5EQ0 A;  2KED A;  3MWY W;  1HRJ A;  1S4Z A;  1MI2 A;  5JJZ A;  1J9O A;  2DY7 A;  1F9P A;  2K04 A;  2J7Z A;  1ICW A;  1SSO A;  1XX8 A;  2MGS A;  3HP3 A;  2KEE A;  3G7L A;  2SDF A;  4X3K A;  1ILP A;  1J8I A;  1QE6 A;  1U4M A;  4XDX A;  5CMD A;  1HA6 A;  1B53 A;  2FHT A;  2B2W A;  4R8I A;  2L4N A;  1XYI A; 
#chains in the Genus database with same CATH topology
 1RF2 D;  3EFX D;  4M1U B;  2I0Q A;  4C3H H;  5H1S E;  1EIF A;  5C4X H;  2K4K A;  5FLX L;  1EQV A;  5BR8 Q;  1JQY D;  3I8Z A;  1IBK Q;  3S1Q B;  5CV8 A;  3PQI A;  3H3V H;  4QIW E;  2LY7 A;  3CRL C;  3QOL A;  5C4X B;  1JWM D;  1QVG A;  1NNX A;  2FIN B;  1EWI A;  1EFW A;  4OON A;  1SYB A;  3CRK C;  2J4X A;  3H09 A;  4L5Q A;  5EKI A;  5LL6 S;  1PZK D;  5C4X G;  2E2H H;  1UNS A;  1E22 A;  4A3K B;  1BXT A;  5KND A;  4ZQ3 A;  4OWX B;  3A8J E;  2C5C A;  3C46 A;  4DR7 L;  4HCE A;  2XWB B;  4GOP C;  5M3M G;  2A6H D;  4ZKB B;  1SYF A;  1YNX A;  2G5D A;  4A3K G;  1G2S A;  4I65 A;  1N34 L;  2EYL A;  3UE1 A;  4HTH A;  2IJ0 A;  4XYQ A;  2B2T C;  3GTL H;  4GS3 A;  2L1B A;  1EUJ A;  3OW2 A;  3U58 A;  3NK9 A;  2K14 A;  4DNR B;  4OX9 L;  2QA4 A;  4IUN A;  2KEC A;  2PI2 E;  4KK7 A;  5D3D A;  5GAE C;  2MQH A;  3DLL A;  2D0P A;  3JAM c;  3GTL B;  3RUZ A;  2R7F A;  3KJP A;  5J39 A;  2N88 A;  1SR3 A;  2NWG A;  5M5X B;  1LYL A;  4JVZ A;  4A76 A;  1EOV A;  1JC7 A;  1CHQ D;  3A0J A;  3KFU A;  2E5L Q;  3ERS X;  2H5X A;  4NDX A;  2K5H A;  4FDB A;  2QKI C;  2QEJ C;  4RGO S;  3G6J B;  1JJG A;  3EA6 A;  4KHP Q;  1EY6 A;  2BDO A;  4G4K A;  4ZAI A;  3PIP A;  1Y14 B;  5JJI A;  3ND8 A;  3VR2 A;  2KCC A;  2UUB Q;  1IBL L;  4NXM Q;  3CKI B;  3STB D;  1MI2 A;  2K6A A;  3NUC A;  1G8Z D;  2N49 A;  2A69 D;  2EYP A;  3TZU A;  1N32 Q;  1JWS D;  2R3Z A;  3AU7 A;  1CQV A;  1IL8 A;  2YTV A;  3MFY A;  3MXG A;  3U50 C;  2EYJ A;  1SE3 A;  1C0A A;  1ZYR C;  2CVR A;  1W2B A;  1A0I A;  1SRO A;  1XMQ L;  2G9D A;  1EY4 A;  3D0F A;  4K2K A;  1QIL A;  1PZI D;  1FNV A;  2K7V A;  4UP9 A;  5E1F A;  1TS4 A;  1IXR A;  2JYO A;  1EU4 A;  2KHS A;  4LWC A;  1G6Z A;  3OMG A;  4RAU C;  5JPN C;  3Q8D A;  1WCM B;  3HKS A;  3DUZ A;  4DA2 A;  4CGY B;  3HEJ A;  1B50 A;  3NTH A;  3T1Y L;  3PMF A;  4HN7 A;  1BR9 A;  1WCM G;  4JBW A;  3FDT A;  1K9M C;  4ME5 A;  2AMC B;  4R4Q A;  1F2M A;  1OO9 B;  3A7L A;  4ULL A;  1MJE A;  4LK1 C;  4LF8 L;  3DM1 A;  3H0G B;  1WTO A;  1XXG A;  2RHQ B;  1NJI C;  3CD6 A;  1K83 H;  2Z4I A;  2BDN A;  1SEB D;  3G71 A;  1W6K A;  3S14 H;  1HTL D;  4EVO A;  3H0G G;  4K5X A;  1CKM A;  5GAH C;  1IBM Q;  3PO2 B;  1K83 B;  2JA8 H;  4ME3 A;  2QDL A;  3CHB D;  4GKK L;  3A5Z B;  3T13 A;  1GUW A;  3J81 j;  3PO2 G;  1F2Z A;  1L0Y B;  4JC0 A;  1UAP A;  3UDX A;  1WTW A;  4DV0 Q;  1YVC A;  5CV4 A;  1YBY A;  5J3B A;  2PW5 A;  4JI8 Q;  2Q2U A;  4H02 A;  4K0K L;  2F0J A;  3T53 B;  2NZ1 D;  4QY7 A;  4RKB A;  3NBI A;  2KHJ A;  3BVZ A;  5I9O A;  1JT8 A;  1LUZ A;  4LW1 A;  3ND9 A;  2F0M A;  4IPC A;  2WII B;  3TME A;  1ENA A;  3QR8 A;  4KY7 A;  1D2B A;  1LTT D;  4WJW A;  2RA4 A;  3U4Z A;  2NN6 G;  3PIO A;  5C3W A;  1HR0 Q;  3K80 C;  4N9P A;  1X3E A;  1U4M A;  2I07 B;  3A7A B;  1QWY A;  3OHX C;  4HSP A;  2VQF L;  4B08 A;  3TP8 A;  3AQQ A;  4YHH L;  4JG2 A;  3FVQ A;  1VQK A;  3FPP A;  2UUA Q;  1PFN A;  2O5J C;  1XTC D;  3NP8 A;  4OEM B;  3FKI H;  3GDE A;  3I73 A;  2CH4 W;  2X6L A;  2CQA A;  3JAM E;  1BVS A;  4ZKC B;  4RHS A;  1E1O A;  3J81 L;  1KNA A;  1RD9 D;  4DR5 L;  5CR3 A;  1BBW A;  2F1M A;  2GN5 A;  1CZW A;  4L5T A;  1FNU A;  3O13 A;  4P74 A;  4OWT B;  1YHQ A;  3RD4 A;  1OXV A;  2M2L A;  5GAD C;  1TY2 A;  2N78 A;  3LNN A;  4DNI A;  3FRP B;  3NHH A;  1LTG D;  1GUG A;  2Z0S A;  4RWS C;  5E3F A;  1ROD A;  1TS5 A;  3EBE A;  2RQX A;  4NKL A;  2A8V A;  2NVT H;  3SDZ A;  2VS1 A;  3HOY H;  2NZO A;  1L1O A;  2PZU A;  4HCS A;  1STB A;  3CCS A;  2RBM A;  1SXT A;  5IY0 A;  2VQE Q;  3F2B A;  1X6O A;  4J15 A;  1U4R A;  2WV6 D;  3S2D B;  2NVT B;  3HOY B;  5JPM C;  3PUV A;  4N8F A;  4HJ5 A;  3JAM i;  4EQO A;  1W3S A;  2LXJ A;  3GTJ H;  1X32 A;  4DR6 Q;  2L11 A;  3ICE A;  2AKW B;  3HOY G;  1IKL A;  5IGE A;  1G2T A;  3WDN A;  4DUZ Q;  3K5N A;  2L5T A;  1F9S A;  4TVA B;  1K8G A;  3DEO A;  3CCQ A;  2HDM A;  3GTJ B;  5CV6 A;  4RMF A;  3G6E A;  2GA4 B;  4S3S A;  4TRD A;  3K7U C;  3CMA A;  2F0U A;  4B3R Q;  1KNE A;  1GVP A;  3EN2 A;  1C8C A;  4HJA A;  3I3C A;  4LAA A;  4G7H C;  1KDC A;  1PMR A;  2QGQ A;  2QF7 A;  2IWH A;  4AYB E;  1TWH H;  1RKN A;  1OXX K;  3T4A C;  2NVY B;  3I2Z A;  1S3O A;  2F4V Q;  1YNN D;  2ZTD A;  3NEL A;  4R8I A;  5M3F H;  3PIP 3;  4GOP A;  1XNR L;  3EVQ A;  3GTO H;  1WD1 A;  3PCO B;  5T1I A;  4AYB B;  1TWH B;  1JOK A;  2D2C C;  1WOC A;  1PHJ A;  2F0D A;  3J80 c;  5I2Y A;  4IUT A;  2B8G A;  3GTM H;  1CZG A;  3D4W A;  3K0X A;  4AYB G;  1Z6H A;  3GTO B;  3QO2 A;  2WFW A;  1VQF A;  1L0W A;  4IAL A;  1Y1W H;  5IP7 H;  4QB4 A;  1KD1 C;  2D9U A;  3GTM B;  4JPB W;  3E3X A;  3VA7 A;  5AJ3 Q;  4J8Q A;  1WTX A;  1STE A;  3I4L A;  2DJG C;  1Y1W B;  3OYY A;  1H95 A;  5T1G A;  3S1N H;  3N52 A;  1JR0 D;  4JI4 L;  1HUM A;  4X65 Q;  4DXG A;  5C5L A;  2JXM B;  1O7Z A;  5DAU A;  2UXD Q;  1NY4 A;  1Y1W G;  3SGI A;  1I4G A;  1KIX A;  4A93 H;  3CC7 A;  1O78 A;  3RZO H;  4DR4 Q;  1D1K A;  4B3M L;  2O4X A;  3LWE A;  3S1N B;  1GM5 A;  2JEA I;  3DWA A;  4B3T Q;  1HTP A;  1YJW A;  2UUC L;  4K5V A;  4MN3 A;  3MXN B;  2PYK A;  2EE1 A;  2OTJ A;  3AEV A;  1ASZ A;  4A93 B;  3MXN A;  2VXW A;  4F8M A;  4O2D A;  2Q8T A;  4IN3 A;  3RZO B;  2G9H D;  4PMC A;  3SVM A;  1WD0 A;  1S5F D;  3TBI B;  1LTS D;  1SMY D;  3C1F A;  5EBC A;  1XNQ L;  1N33 Q;  4LF4 Q;  4MNO A;  3AMU A;  2KJX A;  4A93 G;  3RMH A;  4JYA L;  3K7A H;  4DAM A;  4A3J H;  4Q0F A;  3HKZ E;  2NVQ H;  3DMU A;  3R3O A;  4HMJ A;  1DOL A;  4OO1 I;  3KLW A;  2R93 G;  2ENB A;  1SFO H;  1J5E L;  1E2V A;  2IY5 B;  3HKZ B;  1VQB A;  3RLF A;  4A3J B;  3SE0 A;  2NVQ B;  2Z4H A;  1SND A;  2UXB L;  1HFN A;  1SFO B;  3HKZ G;  4A3F H;  4A3J G;  1R4Q B;  2F4I A;  1P8L A;  5EQ0 A;  1GUT A;  2R7D A;  3A55 A;  3KLR A;  3B6Y A;  2NZH A;  2J7Z A;  1ICW A;  4JBJ A;  5EKL A;  1STG A;  4A3M H;  2FHT A;  2F0G A;  4FF1 A;  2M00 A;  2XSC A;  2F0T A;  4HMI A;  3A5U A;  4A3F B;  4BY1 H;  1VQA A;  1ET6 A;  2E2I H;  1D5M C;  4JI7 Q;  1ILQ A;  5BN4 A;  5BR8 L;  5C4Z A;  1DOK A;  3LX0 A;  1IBK L;  3L2P A;  4PZ8 A;  4A3F G;  3OWF A;  4P75 A;  4BY1 B;  1QNU A;  1PRT F;  1HR0 W;  2E2I B;  4GLX A;  1A3V A;  3K59 A;  4IO9 A;  1Q3L A;  2KA7 A;  5I6Y A;  3NTI A;  1IW7 C;  4DK6 C;  4WOR A;  3L7Z C;  3S15 H;  3SEB A;  2LFN A;  5C0X H;  5FLX c;  4FO2 A;  2SNS A;  2NVX H;  1F2L A;  3IAY A;  3J7A V;  4CDC C;  2EJG C;  3S15 B;  1N36 Q;  2ZT9 C;  1PH1 A;  1B3A A;  1SJH D;  2IT1 A;  4HIK A;  1PH9 A;  2B2U A;  3W1B A;  1ML0 D;  1I94 Q;  1CFM A;  4GNX B;  1RTN A;  4LFB Q;  5C0X G;  2MNA A;  4DUY Q;  2KVM A;  4IFD I;  4GNX A;  4DPG A;  1LAC A;  3CCJ A;  3J80 E;  2AUK A;  4CDE C;  2K5D A;  1SLJ A;  4KMU C;  3V2T A;  2JA6 H;  2A6H C;  4RA8 A;  4A3I H;  3E9H A;  4GKJ L;  3BJU A;  1NBW A;  4NB3 A;  4JI3 Q;  2E5L L;  1H9S B;  3TP7 A;  4FXK C;  1N8R C;  3P7J A;  1H9S A;  1V8Q A;  3U4V A;  1ICF B;  1VQE A;  2F0W A;  2RSN A;  4A3I B;  5CGK A;  1KDB A;  3G4S A;  3CME A;  3BZD B;  1KHI A;  3VR4 A;  2ASB A;  5LL6 X;  3F2C A;  3HOU H;  5EPL A;  4A3I G;  2XRQ D;  1V1O A;  1RIP A;  2KED A;  1QJO A;  3DHQ A;  4NXM L;  2PZW A;  1CSP A;  1F9P A;  1RDP D;  2IHF A;  4Y7N H;  4LFC Q;  1HA6 A;  4DXF A;  4YWK A;  1N32 L;  1L0X B;  1Q1B A;  5L37 A;  1IZ6 A;  3K58 A;  2F0H A;  4G7O C;  4KLK A;  2E8G A;  2WP8 J;  2EJF C;  1SYD A;  2M9V A;  3T1H L;  4Y7N B;  2FMC A;  1A63 A;  1VQ9 A;  3TRE A;  4POG A;  3CCL A;  2ATW A;  2JE6 I;  1Q1E A;  2F3V A;  3STB C;  3TEH B;  4H0L C;  3J7Z C;  2I5H A;  4XT1 B;  1GD7 A;  4NP5 A;  3ER0 A;  2A69 C;  2F3W A;  1LTI D;  1I50 H;  3ONA B;  1KQS A;  3J7A F;  3Q24 A;  4R1J A;  3A8I E;  1OXS C;  4UPA A;  3PO3 H;  4LJZ C;  1X3Q A;  2F0Q A;  4XXE A;  1Q90 A;  4JI1 Q;  1I50 B;  1PRT D;  5HY6 A;  3NEM A;  2I5M X;  4KI0 A;  4ID6 A;  4KHV A;  4C3H B;  1KAA A;  1DD2 A;  3PO3 B;  4DKA C;  2MP1 A;  4NPS A;  4R8N A;  4Z9C B;  4IPG A;  3GD7 A;  1B44 D;  1EY8 A;  4RGM A;  1OTC A;  4AH6 A;  4JI5 Q;  1Y8N B;  4QIW B;  4C3H G;  4DV1 Q;  3JC6 6;  1MD2 D;  3PO3 G;  1XPU A;  3PUX A;  1DZ1 A;  4OHJ A;  1Q46 A;  4HSV A;  4B3S L;  1EYA A;  2MPM A;  2RF4 A;  2IX0 A;  1PTO H;  4DR2 Q;  4DR3 Q;  5C4H A;  4IUQ A;  5DLQ E;  4G57 A;  2E2H B;  3KUP A;  1MIU A;  1BQQ T;  1XJV A;  4DV0 L;  2YU9 H;  2EY2 A;  4JI8 L;  2PZT A;  4DK3 C;  2EIF A;  1PTO B;  4CJ1 B;  4CDD C;  5IYC H;  1EY5 A;  1GJX A;  3NXW A;  4GN4 B;  1A3T A;  5FLX E;  1SE2 A;  3PF5 A;  1CHP D;  2YU9 B;  1NUC A;  4DV4 Q;  2SEB D;  1HNZ Q;  1B9N A;  1TXY A;  2AQ2 B;  4FXD A;  2WAC A;  3HOX H;  1M90 C;  3TS0 A;  2ZM6 Q;  5ELO A;  1TWF H;  1S5E D;  4UHV A;  4F87 A;  1HRJ A;  1HR0 L;  1T9H A;  3PUW A;  4QJF A;  5K36 H;  1ILP A;  3NWS A;  1TKW B;  2KCM A;  5LMU Q;  2PI2 A;  4CBV A;  4FNF A;  3HOX B;  4IPD A;  5IYC G;  1XYI A;  1X3G A;  3BDL A;  2UUA L;  3DEP A;  1S5C D;  3IKJ A;  2HD3 A;  1QUQ B;  4JI6 Q;  4IPH A;  4EQP A;  1GOZ A;  1X55 A;  2WB1 E;  3A74 A;  1STY A;  1CI3 M;  1QUQ A;  4QF4 A;  4A4I A;  3HOX G;  4X3U A;  1LT4 D;  2XWJ B;  3VA5 A;  1I4R A;  4OL7 A;  3F2D A;  2AUJ D;  4LF6 Q;  3S9W A;  2ZXO A;  4POF A;  4DV5 Q;  1VQG A;  4A3G H;  4O0A A;  2WB1 B;  3E0J A;  1S5D D;  4BS9 A;  5ELB A;  1A2U A;  1NTG A;  2ZXP A;  3MHB A;  3Q6S A;  1AFP A;  4R4I A;  3NEN A;  1FYC A;  3HZX A;  5EGT A;  2WB1 G;  1QB5 D;  3J7Y W;  4A3G B;  4LFA L;  1ZKO A;  3RZD H;  4WFN 3;  1JB7 A;  2F0N A;  4DU9 A;  5KIX A;  2CFM A;  1O7I A;  5LHY 1;  2JA9 A;  3J81 c;  1A3U A;  5IOC A;  2L55 A;  2PMZ E;  4A3G G;  2KOL A;  1Q8K A;  1I4H A;  2LS0 1;  2CKZ B;  5DEH A;  3K5M A;  3I4N H;  1TWG H;  4LMQ D;  4IJL A;  4U67 3;  3H94 A;  5LMN Q;  3SR1 A;  2EXZ A;  2VB2 X;  5FKA C;  2F0K A;  2PMZ B;  4YWL A;  1QNK A;  5AFW A;  5DM6 3;  4DFA A;  3HOZ H;  3KYH C;  5IT9 L;  2H4O A;  2VQE L;  3W2D A;  1HNX L;  2YTX A;  3I4N B;  1TWG B;  2EYO A;  5J1Z A;  3H6M A;  2X69 A;  1HZA A;  1SNC A;  1R9T H;  2OXP A;  3HOZ B;  1QVF A;  1U9R A;  5ELC A;  3ZJY C;  4DR6 L;  1E0B A;  4IFD H;  3ULL A;  3I4N G;  3VYR A;  4A3E H;  1HQR D;  3UDG A;  5KEE A;  5ELN A;  2RDH A;  4NXN L;  1LTB D;  1M1K C;  1H9M A;  1UEB A;  4H44 C;  1R9T B;  2EVB A;  3HOZ G;  4CKE A;  5COR A;  1KTK A;  3S1M H;  1G51 A;  5I4D A;  1VQP A;  3UE0 A;  2BA0 A;  1A62 A;  3Q23 A;  2A5H A;  3W3A A;  2EJM A;  4B3R L;  1I6V C;  4KN4 C;  5CC4 A;  2DGY A;  1PH5 A;  1SJE D;  3VR6 A;  4KHZ A;  1E7Z A;  3QWN A;  5C0X J;  2JK8 A;  1ESF A;  3S14 B;  3PF4 A;  3T56 B;  1J9O A;  5CYU A;  3KBX A;  1KLU D;  1TWC H;  2Y0S E;  4X3K A;  4F7X A;  3IRB A;  1QE6 A;  1PRT B;  2A1A A;  2WKD A;  4JW0 A;  2JA8 B;  2AWO A;  1WTQ A;  4A3C H;  3P1H A;  2Y0S B;  4DV7 Q;  3ERO A;  5JEA J;  1EQT A;  1XTD A;  2A6E C;  4B9W A;  3Q0A A;  1D5X C;  3GTQ H;  3K8A A;  2HQL A;  2JA8 G;  3KF6 B;  1K8A C;  3GTP H;  2B2U C;  3OIQ A;  3CCV A;  2Y0S G;  1UWV A;  5CV7 A;  1LLR D;  4LF9 Q;  5CBE E;  3BDC A;  4FYD A;  4QUF A;  4GNX C;  3GTQ B;  4TKO B;  1B8A A;  4EX5 A;  1YNN C;  1VCI A;  2KEN A;  1PV4 A;  1SE4 A;  4J1M A;  1ONL A;  4PNY A;  3RN2 A;  5FJ8 H;  1D6E C;  1UE5 A;  4P71 A;  1EIY B;  3VYU A;  2N8N A;  1XPO A;  4UAI A;  4X65 L;  2ZJQ A;  3DXJ C;  2JA5 H;  3CPW A;  1Y8P B;  4CDF C;  2N55 A;  4KJO A;  1Z7T A;  1FD7 D;  4L8J A;  2UXD L;  1SN8 A;  3NE5 B;  3HOW H;  2LXK A;  3FKI B;  5E4X A;  4L5S A;  1EFI D;  4B3T L;  3D31 A;  5HGQ A;  1NCV A;  1WTH A;  5IWA L;  3E6Z X;  1YHB A;  1YNJ D;  1XPR A;  1VQN A;  3TDQ A;  3S16 H;  1G91 A;  1VQ7 A;  1UE7 A;  2IHE A;  3N6R A;  3FKI G;  3HOW B;  3SK4 A;  4IOA A;  2NUC A;  3W1G A;  1VQJ A;  5A35 A;  1YJ9 A;  2HHH Q;  2R6G A;  1N33 L;  1SNM A;  4LF4 L;  3OTO Q;  1B2T A;  4GN5 A;  2WKC A;  3W5O A;  5FO7 B;  3URY A;  1WTP A;  4HID A;  3QB3 A;  2JSO A;  1VDZ A;  4XT3 B;  1DCZ A;  3M3Y H;  2HDL A;  1A8V A;  1CM9 A;  2IL8 A;  1IHZ A;  4DAY B;  1XMQ Q;  1K8M A;  2ES2 A;  3A8K E;  3J81 E;  1SMY C;  4K2L A;  4DAY A;  3SXH A;  1WVL A;  2ZJP A;  3M3Y B;  1DM0 B;  3BVG A;  2K04 A;  1HJP A;  2ZJR A;  1F2Y A;  3E5S A;  5CMD A;  4LF7 L;  5ELD A;  2MO1 A;  1LO5 D;  1B70 B;  3T1Y Q;  3MXU A;  1I4P A;  4OEL B;  3BZK A;  4JI2 L;  2A6E D;  2JQO A;  1IYV A;  2HIV A;  4K6D A;  1QG7 A;  1O7Y A;  1PTO F;  5A2Q L;  2HQE A;  3KDF B;  4RHR A;  2FJ2 A;  3H3V C;  3KDF A;  1GO3 E;  1PFB A;  2LSS A;  4O42 A;  1FGB D;  4XIG S;  1FL0 A;  1QVC A;  1TQO A;  2PPB C;  5I6W A;  2PQA B;  4BA2 I;  5M3F B;  2EZV A;  3J81 i;  4DK1 A;  2PQA A;  1N36 L;  1PXU A;  3G48 A;  4LUO A;  4HJ8 A;  1LT6 D;  1PTO C;  4FF2 A;  5DNF A;  3DWQ A;  4P72 A;  2NYZ D;  2VL6 A;  4C3I H;  1Q8I A;  1SRU A;  5M3F G;  4K0K Q;  1I94 L;  3ULJ A;  2R92 H;  1FGU A;  1F9R A;  4DF7 A;  2VY3 A;  1ESR A;  3K5O A;  4LFB L;  1S40 A;  4DUY L;  3DWP A;  3L9A X;  3MC0 B;  5IYD H;  2KCT A;  2O2L D;  4JK1 C;  1V1P B;  1LTL A;  4RGN A;  4C3I B;  3HOV H;  1S72 A;  5ELE A;  2TSS A;  3C2P A;  3KJO A;  2R92 B;  1CT1 D;  1WFQ A;  5KYI A;  4JBM A;  2E2J H;  4XQN A;  1Y69 U;  5IP7 G;  2K5Q A;  3GO5 A;  4C3I G;  1NR2 A;  3TS2 A;  1ENF A;  5LMN W;  3H91 A;  3P20 A;  3HOV B;  4NW2 A;  2R92 G;  1SDF A;  4JI3 L;  5JVG 3;  1KXL A;  3VR5 A;  1LAB A;  4BA1 I;  2SNM A;  2E2J B;  2BCO A;  2ZTE A;  3M4P A;  1VQC A;  1KAB A;  3MEF A;  4Y52 H;  4C1N I;  1T5X D;  5BN3 A;  1CA5 A;  4KKT A;  4JV5 Q;  3HOV G;  3TN2 A;  1FVI A;  4ALP A;  3FHW A;  4MZ9 A;  1D5Z C;  1U0L A;  3Q22 A;  3BU2 A;  2QW7 A;  3IFD A;  2UXC L;  2CW0 D;  1EOT A;  4N9T A;  3MWY W;  1S4Z A;  4DR1 Q;  2EYH A;  4HED A;  1VQD A;  4JI0 Q;  2BH8 A;  2C9O A;  2GVB A;  1NE3 A;  3K81 C;  3D4R A;  5IGG A;  1E2Z A;  4RGT A;  3U9O A;  3K7A B;  1JMC A;  4DV6 Q;  4IOC A;  3RLO A;  2ZXR A;  5HGT A;  2RSO A;  2Z6B A;  2OQ0 A;  4QL5 A;  2JA7 H;  2HCI A;  2AWN A;  2O5I C;  1BBU A;  3S17 H;  1OXT A;  3PV0 A;  4F88 A;  3TP5 A;  5HUR A;  4IFD J;  2B2V A;  4AIM A;  2V1C C;  2Z6K A;  2PQE A;  1YZ6 A;  2KUM A;  5FK9 C;  3RR5 A;  1EEI D;  2K5N A;  5JVH 3;  1VQ8 A;  2JA7 B;  4EQN A;  5FLM H;  4QQB X;  2JP1 A;  5C44 H;  1P16 A;  2K03 A;  3D6W A;  5EKK A;  3I56 A;  4DGZ A;  4A3D H;  3S17 B;  2QDB A;  2BH2 A;  1VQI A;  3M85 A;  2K01 A;  4JCV E;  3R2T A;  4RKL A;  4A3M B;  2JA7 G;  4JI1 L;  5IGF A;  3CCE A;  1U5K A;  5IP9 H;  1PDQ A;  2A19 A;  1PTO D;  4IZ8 A;  2NBF A;  2K33 A;  4A3M G;  1Q7Y C;  1IYU A;  4PZ7 A;  1EIH A;  2RDF A;  2B8F A;  4BY1 G;  3X3M A;  2XN9 C;  1EU3 A;  1ZXT A;  1PH2 A;  1KL9 A;  3MAQ A;  2P5Z X;  1CUK A;  2F0P A;  1E3P A;  1HXY D;  5CBA E;  2DNE A;  1Z47 A;  1V9P A;  2EY5 A;  5IP9 G;  4DR2 L;  1E1T A;  1MSG A;  1PRT C;  4JBK A;  1IKM A;  4C1N K;  1EYD A;  2NVX B;  3GTK H;  1SBB B;  2FXQ A;  2SOB A;  4PG3 A;  1AE3 A;  5IOD A;  3X3N A;  5JEA H;  1U4L A;  1PLF A;  1PYB A;  2CWA A;  1CKN B;  3R2I A;  4IJH A;  1JOO A;  5TSS A;  1JOR A;  4DV4 L;  1HNZ L;  4X62 Q;  2OCE A;  5KYL A;  1FNW A;  1EY9 A;  4XYO A;  4K6L A;  5JJZ A;  1KRS A;  1SE8 A;  4RG1 A;  3M7N A;  1XX8 A;  1I3Q H;  2DN8 A;  3I70 A;  4RCO A;  3G7L A;  5C3E H;  1R4P B;  1ASY A;  1Q86 C;  3AYH B;  2JN4 A;  5LMU L;  1B53 A;  1X9N A;  1CQF A;  1NSN S;  5JEA G;  3F2U A;  2L9H A;  2JA6 B;  2BA1 A;  4XQJ A;  1I3Q B;  4L6T B;  4JI6 L;  5C3E B;  2K05 A;  1IL2 A;  1NAP A;  1CKO A;  4OXP A;  4DN4 M;  1EWC A;  1CTM A;  4KHP L;  2PO4 A;  1X54 A;  4EQ5 A;  3BYT B;  5M9O A;  2JA6 G;  4LF6 L;  1O80 A;  3I91 A;  3S1R H;  1BCP D;  2UUB L;  4TQU S;  4DV5 L;  5C3E G;  2K75 A;  3RNU A;  4B3M Q;  1Q81 C;  1LV9 A;  5K5P A;  4X64 Q;  1BNZ A;  4R4C A;  2UUC Q;  4A3L H;  3OMC A;  2NB0 A;  3CC4 A;  2NTT A;  3VYS A;  3WWV A;  3HOU B;  3S1R B;  1JWU D;  2TMP A;  5D14 A;  1K0R A;  2NN6 I;  2K5V A;  2F3I A;  1K3B C;  1LTA D;  1C9O A;  4KJN A;  4R9W A;  3VR3 A;  1STA A;  1TII D;  5D65 A;  3I7F A;  2Z8L A;  3CF5 A;  3HOU G;  3BS1 A;  3MTS A;  4FF3 A;  1EYC A;  2K1B A;  4K5W A;  1HZB A;  4QGU A;  5E4W C;  3U9S A;  3TSS A;  4LF5 Q;  4WRD A;  4KKS A;  3MA2 B;  2WAQ E;  4G7Z C;  1GXD C;  3CP0 A;  1WI5 A;  2MHV A;  3M9B A;  1VF7 A;  1K28 A;  2A73 B;  4TSS A;  2OWO A;  3CCU A;  1AZP A;  2B3G A;  2V4D A;  2F0F A;  4BBR H;  4BBS H;  4MTN A;  5FOB B;  4DAV A;  4DV3 Q;  2WAQ B;  1Y1V H;  4RFB A;  3GV6 A;  1KDA A;  3PGZ A;  4BWG B;  5JJK A;  2Q2I A;  2Z9H A;  3SHL A;  3CW2 C;  2N3S A;  5J22 A;  2Q8R E;  4L63 B;  1BUV T;  3IFT A;  1SMX A;  2WAQ G;  4BBR B;  4BBS B;  4CKC A;  1Y1V B;  4QUC A;  5EAY A;  5JOB A;  1FJG Q;  1PYS B;  5CV5 A;  3NWT A;  1DOM A;  4FXG C;  4IQZ A;  1Q12 A;  2EYF A;  5IT9 c;  4BBR G;  5C6A A;  4BBS G;  1AP0 A;  1Y1V G;  2KCN A;  5IYB H;  2XIW A;  4V19 0;  1IBM L;  1RCV D;  1JIC A;  1RJT A;  1I4X A;  5M3M H;  3GV3 A;  4A3K H;  4YY3 Q;  1SSO A;  5CV9 A;  1JE5 A;  4K14 A;  2AQ1 B;  1VQM A;  1JCK B;  1HA5 A;  2YTY A;  4HIM A;  4ZUI A;  1E24 A;  5M3M B;  2MO0 A;  1HNW Q;  4J6H A;  3QJY A;  5IYB G;  1BF4 A;  4DV7 L;  4KY5 A;  3GP7 A;  2HCC A;  5JAV A;  3D3R A;  1RHP A;  3ULP A;  4P73 A;  4OO1 H;  2F0L A;  4KD3 A;  1VQH A;  3UDF A;  4UP7 A;  2AHO B;  4DV2 Q;  1EWH A;  2ALY B;  4LF9 L;  3CAM A;  1X3P A;  1A6X A;  4PV1 C;  5NUC A;  3DM3 A;  3OWE B;  1SAP A;  3V05 A;  2IX1 A;  3OOC A;  4CJ0 B;  1MKH A;  3V96 A;  4IUV A;  1TWF B;  2MJ8 A;  5M5X H;  2XGT A;  1AN8 A;  1JJ2 A;  2VB3 X;  2A68 D;  4OO1 G;  1XMO Q;  5IIF A;  1K73 C;  4K8I A;  2L0C A;  1K0S A;  4GKJ Q;  5K36 G;  1FR3 A;  4ZYS A;  4KV6 A;  3T16 A;  1IYJ B;  2YYZ A;  5ELF A;  3M4O H;  3F8T A;  3BG3 A;  2B29 A;  2MFI A;  3CXC A;  1GUS A;  3FMC A;  3HGB A;  3UDI A;  1G6P A;  3FEW X;  1HQM C;  1AE2 A;  2HHH L;  1VMP A;  2C35 B;  3M4O B;  2UU9 Q;  4L5R C;  1CSQ A;  1QZG A;  2RCN A;  2VW9 A;  1Q82 C;  4CJ2 C;  2NTS A;  3OTO L;  3GTG H;  2F52 A;  3IL8 A;  3CC2 A;  3KF8 B;  4CKB A;  1PZJ D;  4ZLT F;  3RZD B;  1TS2 A;  3KF8 A;  1C48 A;  3KK7 A;  3OPO A;  1BCP B;  4GN3 B;  2QIL A;  1YNJ C;  3GTG B;  3S2H H;  3UI2 A;  1O7L A;  2D5D A;  3T1H Q;  1D7Q A;  5IE8 A;  1UEA B;  3MXP A;  1AW7 A;  4X66 Q;  1QOH A;  1BO0 A;  4XTC S;  1WCM H;  2B2V C;  1G29 1;  4WJ3 M;  2Z6K C;  4KKU A;  3ZYY X;  4HIO A;  1YI2 A;  3S2H B;  2E2D C;  2MGS A;  3HP3 A;  5C4J H;  4E6I A;  2LMC B;  2SDF A;  4GLV B;  2PNH A;  2ICE C;  4DUZ L;  4AQY Q;  3I55 A;  4QMG A;  1K8O A;  1DYQ A;  1LM0 A;  1U4P A;  4ABN A;  2LKV A;  3WOE A;  3A54 A;  5C4J B;  3H0G H;  4RH6 A;  4UDU C;  4HJ7 A;  1PH8 A;  2F0O A;  4A3E B;  4FP5 D;  2H1E A;  4ZUJ A;  3TRZ A;  4K8J A;  4P2C B;  4BXX H;  4MIU A;  1VQ4 A;  2JJQ A;  3WOF A;  4O1N A;  3S1M B;  4IFD G;  2L15 A;  4WJ4 A;  1AZQ A;  4A3E G;  3PO2 H;  1RL2 A;  2CQO A;  1MGS A;  3R93 A;  2F4V L;  1MSH A;  1PA6 A;  1TU2 B;  2XRS D;  2MUY A;  1EZ8 A;  5IT9 E;  4EGV A;  1A2T A;  4B3S Q;  1TWC B;  4H7B A;  2XNA C;  3RN5 A;  1ENC A;  4DR7 Q;  3JAM L;  1MBY A;  4GZY C;  4BXX G;  3KF6 A;  2NN6 H;  1JOQ A;  1N34 Q;  2J0T D;  3HS0 C;  4N8X 1;  1EQQ A;  2YV5 A;  3RLN A;  3TQY A;  5IGD A;  3GTP B;  5AJ3 L;  4DNT B;  4DK0 A;  2Q2T A;  4A3C G;  1LT3 D;  3H15 A;  2BE5 C;  1YIJ A;  2Z1C A;  4OX9 Q;  1JB3 A;  1N9W A;  4I7Z C;  2PW7 A;  4R4O A;  2B2Y A;  4ZCK A;  4PQX A;  5EPK A;  4GLA C;  4I7A A;  4R4T A;  1HCZ A;  2DJF C;  4C56 C;  3M4Q A;  3ITP A;  4DR4 L;  1PVO A;  1B3Q A;  2D62 A;  3MZ5 A;  3TZD A;  2K52 A;  5IGC A;  4NMZ A;  2R61 A;  1EL0 A;  3T51 B;  3VDY A;  2JA5 B;  4HAE A;  2I46 A;  1V1Q A;  1ZYR D;  2D0O A;  3OSO A;  1VF5 C;  4CHT B;  4JV5 L;  5FJ8 G;  1VQ5 A;  3AFQ A;  3NPP A;  3SK8 A;  3AB9 A;  2JA5 G;  2L12 A;  1YHA A;  1SNO A;  2IW3 A;  1IBL Q;  3S16 B;  3HOW G;  1EY7 A;  5C0X I;  4DR1 L;  2DY7 A;  4JI0 L;  3HG9 A;  4HJ9 A;  3NBH B;  2B2W A;  2L4N A;  2OQK A;  3NBH A;  1QCB D;  1YEZ A;  5M5Y H;  2B39 A;  3EQL C;  4KTA A;  4LFA Q;  3AFP A;  2PNR C;  1A15 A;  2E76 C;  4DV6 L;  1WTV A;  5C3X A;  1I5F A;  5KRU A;  2CW0 C;  5KGU A;  5M5Y B;  2HUG A;  1L1O B;  4X3T A;  1B1Z A;  2HIX A;  3NQI A;  4MTK A;  3S2D H;  1SYG A;  3L0O A;  4YWM A;  2ZTC A;  4JOI A;  4OIK A;  3R8B A;  4A75 A;  5EBD A;  3HRZ C;  3M7G A;  1C7Y A;  3NQT A;  5EJW A;  1HNX Q;  1D1I A;  4JI7 L;  3QOJ A;  3K5L A;  4IUR A;  2FMM A;  2WIN B;  1HHV A;  3D8G A;  1QZH A;  2EY1 A;  1X56 A;  2DY8 A;  4LF8 Q;  1HZ9 A;  3KBG A;  1TVX A;  1DJR D;  2A74 C;  4NXN Q;  2B63 H;  1ET9 A;  1CA6 A;  4KY6 A;  4V0B A;  5M5W H;  3LWU A;  3PSI A;  5D3I B;  2XTI A;  1HZC A;  1SNP A;  1I6H H;  2BE5 D;  2E75 C;  2NVY H;  1OXU A;  1X3F A;  2B63 B;  4OIJ A;  2AQ3 B;  1C4Q A;  2K50 A;  5M5W B;  5GQO A;  4GKK Q;  3CCM A;  1TY0 A;  1I6H B;  2X6G A;  3EJI A;  3D4D A;  3KOJ A;  4HR7 B;  4GOP B;  2B63 G;  1W6J A;  2IPK D;  4X6A H;  1YIT A;  3I4O A;  3K0Y A;  2QEX A;  2KBN A;  2I5L X;  1PFS A;  2OEO A;  1EIG A;  2B2T A;  2EDG A;  1GHK A;  2IX3 A;  4ZRZ A;  4X62 L;  1V1P A;  1Z9F A;  4FF4 A;  1B4O A;  1EQR A;  1CK1 A;  5A2Q E;  1BDO A;  4PZ6 A;  1XWE A;  2Q2H A;  1GUN A;  3K6O A;  2KEE A;  5G3L F;  1J8I A;  4XDX A;  4APV A;  1TT2 A;  1V43 A;  1T5E A;  4UP8 A;  3SK5 A;  4QCL A;  1H9K A;  2VQF Q;  4ILW A;  3BDO A;  3KLS A;  1DXM A;  2DNC A;  3D6C A;  4YHH Q;  1PYW D;  1VQO A;  1PH3 A;  3H3V I;  1VQL A;  3F1Z A;  1EZ6 A;  5IYD G;  2CWP A;  2PCF B;  3TP6 A;  3CU7 A;  1HUN A;  1UE6 A;  5FO8 B;  4YCW A;  2F0V A;  4DR5 Q;  4LUV A;  1B7Y B;  1KAW A;  2Q8I B;  1RTO A;  1BCP F;  4M8A A;  4X64 L;  1J6Q A;  4U68 A;  1AH9 A;  1LTR D;  3BZC A;  5IWA Q;  4C3J H;  4ODG A;  1L2F A;  4LFC L;  3QG1 A;  2R93 H;  4DAP A;  5GAG C;  4RCN A;  4H13 C;  1EEF D;  3CPF A;  4UY8 C;  1D8L A;  3FP9 A;  1TR5 A;  4C3J B;  1NR4 A;  4ZK9 B;  2VUM H;  1SNQ A;  3CQZ H;  3OIP A;  2R93 B;  1MHW C;  1SYE A;  3QIA A;  5ISR A;  2K5W A;  1BCP C;  2KQ3 A;  4C3J G;  4LF5 L;  4C2M H;  1X65 A;  2VUM B;  2BOS A;  4PMW A;  2RHS B;  4IUP A;  4YIJ A;  1E2W A;  3BYY B;  3CQZ B;  1TS3 A;  2K28 A;  3HFZ B;  1BKB A;  5C5M A;  1HFG A;  3NTK A;  3OW7 A;  5F2D A;  1LT5 D;  4DV3 L;  4C2M B;  2VUM G;  2ID0 A;  4LNQ A;  4YCV A;  2R7Z H;  1S5B D;  5C44 B;  5KNB A;  2VNU D;  1SYC A;  4A3D B;  5COY A;  2GVA A;  2OT2 A;  1STN A;  1FJG L;  1WTR A;  3PUY A;  1K3R A;  1M8A A;  4LUZ A;  5E7N A;  3E9I A;  2F0S A;  4LF7 Q;  5FLM G;  1KC8 C;  4JI5 L;  2ICI A;  5C44 G;  4DV1 L;  2R7Z B;  3PIO 3;  4A3D G;  4JI2 Q;  1VS0 A;  1VMC A;  1BBX C;  2OTL A;  3J80 L;  1PFM A;  1KRT A;  1UUP A;  3FPU B;  2R7Z G;  1M4V A;  4DR3 L;  3S24 A;  3ERQ A;  4FVM A;  5JJL A;  4YY3 L;  2CHB D;  1DGS A;  3MEH A;  4KD4 A;  2QCP X;  2EY6 A;  3C3L A;  1EY0 A;  1HPC A;  3C1E A;  1XNR Q;  2CH4 A;  2DUD A;  3E0E A;  1HNW L;  4X3S A;  5IGB A;  1F77 A;  2K32 A;  4BY7 H;  5DM7 3;  1PH6 A;  2EOT A;  4YCU A;  5GRO A;  1WJJ A;  1CKN A;  4A3B H;  1VQ6 A;  3BVM A;  3GTK B;  1GUO A;  2F0I A;  1GKH A;  4DV2 L;  2ZM6 L;  1KLG D;  2CCZ A;  1MJC A;  4BY7 B;  5G3L D;  5I2X A;  3PUZ A;  4XQQ A;  4A3B B;  2B2Y C;  4BY7 G;  1UE1 A;  4JI4 Q;  4A3B G;  1EYG A;  1XMO L;  3M4Y A;  3I90 A;  4OWW B;  2HT1 A;  1WYD A;  1I4Q A;  5EPJ A;  2EXD A;  2KHI A;  2FFK B;  3NSW A;  5FO9 B;  2RKS A;  5BN5 A;  3EIV A;  5KNC A;  1NMF A;  3I4M H;  1JJC B;  4MHE A;  3GQB A;  5I9P A;  3MFG A;  2VZA A;  2F03 A;  3J7A 5;  2F0E A;  3P75 A;  2RDG A;  2XVS A;  4IUU A;  3VYT A;  1H9R A;  3KLS X;  4OGQ C;  2EQS A;  3SK6 A;  2UXC Q;  1XNQ Q;  2A68 C;  1GHJ A;  3I4M B;  2UU9 L;  2EYM A;  1TWA H;  2B2W C;  4JYA Q;  1Y8O B;  1PH7 A;  1B9M A;  4A3L G;  2RVL A;  3I4M G;  2OF1 A;  1HH2 P;  1BOS A;  1NMG A;  1DON A;  4B9X A;  5LMN L;  1TWA B;  1JE4 A;  1J5E Q;  1F9Q A;  1PH4 A;  1YJN A;  2EPB A;  1II3 A;  4Q5V A;  3A56 A;  3J80 i;  4X66 L;  2RCF A;  3CCR A;  3LGJ A;  2UXB Q;  1L1O C;  4JOI C;  1STH A;  2E74 C;  4KN7 C;  1H9J A;  2JEB I;  4PMB A;  1ZEQ X;  3L3O C;  1IW7 D;  4AQY L;  3MVV A;  3K57 A;  3S1Q H;  1AEX A;  3I72 A; 
#chains in the Genus database with same CATH homology
 1RF2 D;  3EFX D;  4M1U B;  5FLX L;  1EQV A;  1JQY D;  3I8Z A;  3S1Q B;  5CV8 A;  2LY7 A;  3CRL C;  3QOL A;  5C4X B;  1JWM D;  2FIN B;  1SYB A;  3CRK C;  2J4X A;  3H09 A;  5EKI A;  5LL6 S;  1PZK D;  1UNS A;  4A3K B;  1BXT A;  5KND A;  4ZQ3 A;  3A8J E;  2C5C A;  3C46 A;  4HCE A;  2XWB B;  2A6H D;  4ZKB B;  1SYF A;  1G2S A;  4I65 A;  2EYL A;  4HTH A;  2IJ0 A;  4XYQ A;  2B2T C;  2L1B A;  3NK9 A;  4DNR B;  4IUN A;  2KEC A;  4KK7 A;  5D3D A;  3GTL B;  3RUZ A;  5J39 A;  2N88 A;  2NWG A;  5M5X B;  1JC7 A;  1CHQ D;  4NDX A;  2QEJ C;  2QKI C;  4RGO S;  3G6J B;  3EA6 A;  1EY6 A;  2BDO A;  4G4K A;  4ZAI A;  3ND8 A;  3VR2 A;  2KCC A;  3CKI B;  1MI2 A;  2K6A A;  3NUC A;  1G8Z D;  2A69 D;  2EYP A;  3TZU A;  1JWS D;  2R3Z A;  3AU7 A;  1CQV A;  1IL8 A;  3MFY A;  3MXG A;  2EYJ A;  1SE3 A;  1ZYR C;  2CVR A;  2G9D A;  1EY4 A;  4K2K A;  1QIL A;  1PZI D;  1FNV A;  2K7V A;  5E1F A;  1TS4 A;  2JYO A;  1EU4 A;  2KHS A;  1G6Z A;  3OMG A;  4RAU C;  5JPN C;  1WCM B;  3DUZ A;  4DA2 A;  4CGY B;  3HEJ A;  1B50 A;  3NTH A;  3PMF A;  4HN7 A;  1BR9 A;  4JBW A;  3FDT A;  4ME5 A;  1F2M A;  1OO9 B;  3A7L A;  4ULL A;  4LK1 C;  3DM1 A;  3H0G B;  1WTO A;  1XXG A;  2Z4I A;  2BDN A;  1SEB D;  1W6K A;  1HTL D;  4EVO A;  4K5X A;  3PO2 B;  1K83 B;  3CHB D;  3T13 A;  1GUW A;  1F2Z A;  1L0Y B;  1WTW A;  1UAP A;  5CV4 A;  2PW5 A;  2F0J A;  3T53 B;  2NZ1 D;  4RKB A;  3NBI A;  3BVZ A;  5I9O A;  3ND9 A;  2F0M A;  2WII B;  3TME A;  1ENA A;  4KY7 A;  1D2B A;  1LTT D;  4WJW A;  2RA4 A;  2NN6 G;  5C3W A;  4N9P A;  1U4M A;  2I07 B;  3A7A B;  1QWY A;  3OHX C;  4HSP A;  4B08 A;  3TP8 A;  3FVQ A;  3FPP A;  1PFN A;  2O5J C;  1XTC D;  3NP8 A;  3I73 A;  2X6L A;  2CQA A;  3JAM E;  4ZKC B;  4RHS A;  3J81 L;  1KNA A;  1RD9 D;  5CR3 A;  2F1M A;  1CZW A;  1FNU A;  3O13 A;  3RD4 A;  1OXV A;  2M2L A;  1TY2 A;  3LNN A;  3FRP B;  3NHH A;  1LTG D;  1GUG A;  4RWS C;  5E3F A;  1ROD A;  1TS5 A;  2RQX A;  4NKL A;  3SDZ A;  4HCS A;  2PZU A;  1STB A;  2RBM A;  1SXT A;  1U4R A;  2WV6 D;  3S2D B;  2NVT B;  3HOY B;  5JPM C;  3PUV A;  4EQO A;  1X32 A;  2L11 A;  1IKL A;  5IGE A;  1G2T A;  3WDN A;  3K5N A;  2L5T A;  1F9S A;  3DEO A;  2HDM A;  3GTJ B;  5CV6 A;  2GA4 B;  4S3S A;  4TRD A;  2F0U A;  1KNE A;  1C8C A;  3I3C A;  4LAA A;  4G7H C;  1KDC A;  1PMR A;  2QF7 A;  2IWH A;  1RKN A;  1OXX K;  3T4A C;  2NVY B;  1YNN D;  4R8I A;  3PIP 3;  3EVQ A;  1WD1 A;  5T1I A;  4AYB B;  1TWH B;  1JOK A;  2D2C C;  2F0D A;  5I2Y A;  4IUT A;  2B8G A;  1CZG A;  3D4W A;  1Z6H A;  3GTO B;  3QO2 A;  4IAL A;  4QB4 A;  2D9U A;  3GTM B;  3VA7 A;  4J8Q A;  1WTX A;  1STE A;  3I4L A;  1Y1W B;  5T1G A;  3N52 A;  1JR0 D;  1HUM A;  4DXG A;  5C5L A;  2JXM B;  1O7Z A;  5DAU A;  1I4G A;  1O78 A;  1D1K A;  2O4X A;  3LWE A;  3S1N B;  2JEA I;  3DWA A;  1HTP A;  4K5V A;  4MN3 A;  2PYK A;  2EE1 A;  4A93 B;  3MXN A;  2VXW A;  4F8M A;  2Q8T A;  4IN3 A;  3RZO B;  2G9H D;  4PMC A;  3SVM A;  1WD0 A;  1S5F D;  3TBI B;  1LTS D;  1SMY D;  3C1F A;  5EBC A;  3AMU A;  2KJX A;  3RMH A;  4Q0F A;  3DMU A;  3R3O A;  4HMJ A;  1DOL A;  4OO1 I;  2ENB A;  1E2V A;  3HKZ B;  3RLF A;  4A3J B;  3SE0 A;  2NVQ B;  2Z4H A;  1SND A;  1HFN A;  1SFO B;  1R4Q B;  2F4I A;  5EQ0 A;  1GUT A;  3A55 A;  3KLR A;  2J7Z A;  1ICW A;  5EKL A;  1STG A;  2FHT A;  2F0G A;  4FF1 A;  2M00 A;  2XSC A;  2F0T A;  4HMI A;  4A3F B;  1ET6 A;  1D5M C;  1ILQ A;  5BN4 A;  5C4Z A;  1DOK A;  3LX0 A;  3OWF A;  4BY1 B;  1QNU A;  1PRT F;  2E2I B;  1A3V A;  3K59 A;  1Q3L A;  2KA7 A;  5I6Y A;  3NTI A;  1IW7 C;  4WOR A;  3L7Z C;  3SEB A;  2LFN A;  5C0X H;  4FO2 A;  2SNS A;  1F2L A;  3IAY A;  3J7A V;  2EJG C;  3S15 B;  2ZT9 C;  1B3A A;  1SJH D;  2IT1 A;  2B2U A;  1ML0 D;  1CFM A;  1RTN A;  5C0X G;  2KVM A;  4IFD I;  1LAC A;  3J80 E;  2AUK A;  2K5D A;  4KMU C;  3V2T A;  2A6H C;  4RA8 A;  1H9S B;  3TP7 A;  4FXK C;  3P7J A;  1H9S A;  1V8Q A;  4A3I B;  2RSN A;  2F0W A;  5CGK A;  1KDB A;  3BZD B;  3VR4 A;  5LL6 X;  5EPL A;  2XRQ D;  1V1O A;  2KED A;  1QJO A;  3DHQ A;  2PZW A;  1F9P A;  1RDP D;  1HA6 A;  4DXF A;  1L0X B;  1Q1B A;  3K58 A;  2F0H A;  4G7O C;  2WP8 J;  2EJF C;  1SYD A;  2M9V A;  4Y7N B;  2FMC A;  2JE6 I;  1Q1E A;  2F3V A;  4H0L C;  4XT1 B;  4NP5 A;  2A69 C;  2F3W A;  1LTI D;  3ONA B;  3J7A F;  3Q24 A;  3A8I E;  1OXS C;  4LJZ C;  1X3Q A;  2F0Q A;  4XXE A;  1Q90 A;  1I50 B;  1PRT D;  4KI0 A;  4ID6 A;  4KHV A;  4C3H B;  1KAA A;  1DD2 A;  3PO3 B;  2MP1 A;  4R8N A;  4Z9C B;  3GD7 A;  1B44 D;  1EY8 A;  4RGM A;  1Y8N B;  4QIW B;  4C3H G;  1MD2 D;  3PUX A;  1DZ1 A;  4OHJ A;  4HSV A;  1EYA A;  2MPM A;  2IX0 A;  1PTO H;  5C4H A;  4IUQ A;  4G57 A;  2E2H B;  3KUP A;  1BQQ T;  2EY2 A;  2PZT A;  1PTO B;  4CJ1 B;  1EY5 A;  1GJX A;  3NXW A;  1A3T A;  5FLX E;  1SE2 A;  1CHP D;  2YU9 B;  1NUC A;  2SEB D;  1B9N A;  2AQ2 B;  4FXD A;  2WAC A;  1S5E D;  4F87 A;  1HRJ A;  3PUW A;  5K36 H;  1ILP A;  3NWS A;  1TKW B;  4CBV A;  4FNF A;  3HOX B;  1XYI A;  3BDL A;  3DEP A;  1S5C D;  3IKJ A;  4EQP A;  1GOZ A;  1STY A;  1CI3 M;  4QF4 A;  4X3U A;  1LT4 D;  2XWJ B;  3VA5 A;  1I4R A;  4OL7 A;  2AUJ D;  3S9W A;  2ZXO A;  2WB1 B;  3E0J A;  1S5D D;  4BS9 A;  5ELB A;  1A2U A;  2ZXP A;  3MHB A;  3Q6S A;  1AFP A;  1FYC A;  3HZX A;  5EGT A;  1QB5 D;  3J7Y W;  4A3G B;  1ZKO A;  4WFN 3;  2F0N A;  4DU9 A;  5KIX A;  5LHY 1;  1A3U A;  5IOC A;  2L55 A;  2KOL A;  1I4H A;  2LS0 1;  5DEH A;  3K5M A;  4LMQ D;  4U67 3;  3H94 A;  3SR1 A;  5FKA C;  2EXZ A;  2VB2 X;  2F0K A;  2PMZ B;  1QNK A;  5AFW A;  5DM6 3;  4DFA A;  5IT9 L;  2H4O A;  3W2D A;  3I4N B;  1TWG B;  2EYO A;  5J1Z A;  3H6M A;  2X69 A;  1SNC A;  2OXP A;  3HOZ B;  1U9R A;  5ELC A;  4IFD H;  1E0B A;  3VYR A;  1HQR D;  5KEE A;  2RDH A;  1LTB D;  1H9M A;  4H44 C;  1R9T B;  2EVB A;  4CKE A;  5COR A;  1KTK A;  5I4D A;  2BA0 A;  3Q23 A;  2A5H A;  3W3A A;  2EJM A;  1I6V C;  4KN4 C;  5CC4 A;  1SJE D;  3VR6 A;  4KHZ A;  5C0X J;  3QWN A;  1ESF A;  3S14 B;  3T56 B;  1J9O A;  5CYU A;  3KBX A;  1KLU D;  4X3K A;  4F7X A;  1QE6 A;  1PRT B;  2WKD A;  2JA8 B;  2AWO A;  1WTQ A;  3P1H A;  2Y0S B;  3ERO A;  5JEA J;  1EQT A;  4B9W A;  2A6E C;  3Q0A A;  1D5X C;  2B2U C;  3OIQ A;  5CV7 A;  1LLR D;  5CBE E;  3BDC A;  4FYD A;  4QUF A;  3GTQ B;  4TKO B;  1YNN C;  1VCI A;  1SE4 A;  4J1M A;  1ONL A;  4PNY A;  1D6E C;  3VYU A;  4UAI A;  3DXJ C;  1Y8P B;  2N55 A;  4KJO A;  1Z7T A;  1FD7 D;  4L8J A;  3NE5 B;  3FKI B;  5E4X A;  1EFI D;  3D31 A;  1NCV A;  3E6Z X;  1YNJ D;  3TDQ A;  1G91 A;  3N6R A;  3HOW B;  3SK4 A;  2NUC A;  5A35 A;  2R6G A;  1SNM A;  1B2T A;  2WKC A;  5FO7 B;  3URY A;  1WTP A;  3QB3 A;  2JSO A;  1VDZ A;  4XT3 B;  1DCZ A;  2HDL A;  1CM9 A;  2IL8 A;  1IHZ A;  1K8M A;  3A8K E;  3J81 E;  1SMY C;  4K2L A;  4DAY A;  3SXH A;  1WVL A;  3M3Y B;  1DM0 B;  3BVG A;  2K04 A;  1F2Y A;  3E5S A;  5CMD A;  5ELD A;  1LO5 D;  3MXU A;  1I4P A;  2A6E D;  1IYV A;  4K6D A;  1QG7 A;  1O7Y A;  1PTO F;  5A2Q L;  2HQE A;  4RHR A;  2FJ2 A;  3H3V C;  1PFB A;  4O42 A;  1FGB D;  4XIG S;  1TQO A;  2PPB C;  5I6W A;  4BA2 I;  5M3F B;  2EZV A;  4DK1 A;  1PXU A;  1LT6 D;  1PTO C;  4FF2 A;  5DNF A;  3DWQ A;  2NYZ D;  1Q8I A;  1F9R A;  4DF7 A;  1ESR A;  3K5O A;  3DWP A;  3L9A X;  3MC0 B;  2O2L D;  4JK1 C;  1V1P B;  4RGN A;  4C3I B;  5ELE A;  2TSS A;  3C2P A;  2R92 B;  1CT1 D;  5KYI A;  4XQN A;  1Y69 U;  2K5Q A;  3GO5 A;  4C3I G;  1NR2 A;  1ENF A;  3H91 A;  3P20 A;  3HOV B;  4NW2 A;  1SDF A;  5JVG 3;  3VR5 A;  1LAB A;  4BA1 I;  2SNM A;  2E2J B;  2BCO A;  1KAB A;  4C1N I;  1T5X D;  5BN3 A;  1CA5 A;  4KKT A;  3TN2 A;  1D5Z C;  3Q22 A;  3IFD A;  2CW0 D;  1EOT A;  4N9T A;  3MWY W;  1S4Z A;  2EYH A;  4HED A;  2C9O A;  3D4R A;  5IGG A;  1E2Z A;  4RGT A;  3U9O A;  3K7A B;  2ZXR A;  5HGT A;  2RSO A;  2HCI A;  2AWN A;  2O5I C;  1OXT A;  3PV0 A;  4F88 A;  3TP5 A;  5HUR A;  4IFD J;  2B2V A;  2PQE A;  2KUM A;  5FK9 C;  1EEI D;  5JVH 3;  2JA7 B;  4EQN A;  2JP1 A;  2K03 A;  3D6W A;  5EKK A;  4DGZ A;  3S17 B;  2QDB A;  3M85 A;  2K01 A;  3R2T A;  4RKL A;  4A3M B;  5IGF A;  1PDQ A;  1PTO D;  4IZ8 A;  2NBF A;  2K33 A;  1IYU A;  1EIH A;  2RDF A;  2B8F A;  3X3M A;  2XN9 C;  1EU3 A;  1ZXT A;  3MAQ A;  2F0P A;  1HXY D;  5CBA E;  2DNE A;  1Z47 A;  2EY5 A;  1MSG A;  1PRT C;  1IKM A;  4C1N K;  1EYD A;  2NVX B;  1SBB B;  2SOB A;  5JEA H;  5IOD A;  3X3N A;  1U4L A;  1PLF A;  3R2I A;  5TSS A;  1JOO A;  1JOR A;  5KYL A;  1FNW A;  1EY9 A;  4XYO A;  4K6L A;  5JJZ A;  3M7N A;  1XX8 A;  2DN8 A;  3I70 A;  4RCO A;  3G7L A;  1R4P B;  1B53 A;  1CQF A;  1NSN S;  5JEA G;  3F2U A;  2L9H A;  2JA6 B;  2BA1 A;  4XQJ A;  1I3Q B;  4L6T B;  5C3E B;  2K05 A;  1NAP A;  4DN4 M;  1EWC A;  1CTM A;  2PO4 A;  3BYT B;  5M9O A;  1O80 A;  3I91 A;  1BCP D;  4TQU S;  1LV9 A;  5K5P A;  1BNZ A;  3OMC A;  2NB0 A;  2NTT A;  3VYS A;  3HOU B;  3S1R B;  1JWU D;  2TMP A;  5D14 A;  2NN6 I;  1LTA D;  4KJN A;  4R9W A;  3VR3 A;  1STA A;  1TII D;  5D65 A;  2Z8L A;  3BS1 A;  3MTS A;  4FF3 A;  1EYC A;  2K1B A;  4K5W A;  5E4W C;  3U9S A;  3TSS A;  4WRD A;  4KKS A;  3MA2 B;  4G7Z C;  1GXD C;  2MHV A;  1VF7 A;  2A73 B;  4TSS A;  1AZP A;  2V4D A;  2F0F A;  5FOB B;  4DAV A;  2WAQ B;  4RFB A;  3GV6 A;  1KDA A;  4BWG B;  3SHL A;  5J22 A;  2Q8R E;  4L63 B;  1BUV T;  3IFT A;  4BBR B;  4BBS B;  4CKC A;  1Y1V B;  4QUC A;  5JOB A;  5CV5 A;  3NWT A;  1DOM A;  4FXG C;  4IQZ A;  1Q12 A;  2EYF A;  5C6A A;  1AP0 A;  2KCN A;  2XIW A;  4V19 0;  1RCV D;  1JIC A;  1RJT A;  1I4X A;  3GV3 A;  1SSO A;  5CV9 A;  4K14 A;  2AQ1 B;  1JCK B;  1HA5 A;  4ZUI A;  5M3M B;  4J6H A;  3QJY A;  1BF4 A;  4KY5 A;  3GP7 A;  2HCC A;  5JAV A;  3D3R A;  1RHP A;  4OO1 H;  2F0L A;  4KD3 A;  1EWH A;  1X3P A;  1A6X A;  4PV1 C;  5NUC A;  3OWE B;  1SAP A;  3V05 A;  2IX1 A;  3OOC A;  4CJ0 B;  3V96 A;  4IUV A;  1TWF B;  2MJ8 A;  1AN8 A;  2VB3 X;  2A68 D;  4OO1 G;  5IIF A;  4K8I A;  2L0C A;  5K36 G;  1FR3 A;  4ZYS A;  4KV6 A;  3T16 A;  2YYZ A;  5ELF A;  3BG3 A;  1GUS A;  3FMC A;  3HGB A;  3FEW X;  1HQM C;  1VMP A;  3M4O B;  4CJ2 C;  2NTS A;  3IL8 A;  4CKB A;  1PZJ D;  4ZLT F;  3RZD B;  1TS2 A;  3KF8 A;  1C48 A;  3KK7 A;  3OPO A;  1BCP B;  2QIL A;  1YNJ C;  3GTG B;  3UI2 A;  1O7L A;  2D5D A;  1UEA B;  3MXP A;  1AW7 A;  1QOH A;  1BO0 A;  4XTC S;  2B2V C;  1G29 1;  4KKU A;  3ZYY X;  3S2H B;  2E2D C;  2MGS A;  3HP3 A;  4E6I A;  2LMC B;  2SDF A;  2ICE C;  4QMG A;  1K8O A;  1DYQ A;  1U4P A;  4ABN A;  2LKV A;  3WOE A;  3A54 A;  5C4J B;  4RH6 A;  4UDU C;  2F0O A;  4A3E B;  4FP5 D;  2H1E A;  4ZUJ A;  4K8J A;  4P2C B;  4MIU A;  4IFD G;  3WOF A;  3S1M B;  4O1N A;  1AZQ A;  1MGS A;  3R93 A;  1MSH A;  1TU2 B;  2XRS D;  2MUY A;  1EZ8 A;  5IT9 E;  4EGV A;  1A2T A;  1TWC B;  4H7B A;  2XNA C;  1ENC A;  3JAM L;  1MBY A;  4GZY C;  2NN6 H;  1JOQ A;  2J0T D;  3HS0 C;  5IGD A;  3GTP B;  4DNT B;  4DK0 A;  1LT3 D;  2BE5 C;  2Z1C A;  1JB3 A;  4I7Z C;  2PW7 A;  2B2Y A;  4PQX A;  5EPK A;  1HCZ A;  4C56 C;  3ITP A;  2D62 A;  3MZ5 A;  3TZD A;  5IGC A;  4NMZ A;  2R61 A;  1EL0 A;  3T51 B;  2JA5 B;  4HAE A;  2I46 A;  1ZYR D;  3OSO A;  1VF5 C;  4CHT B;  3SK8 A;  3NPP A;  3AB9 A;  2L12 A;  1SNO A;  2IW3 A;  3S16 B;  1EY7 A;  5C0X I;  2DY7 A;  3HG9 A;  2B2W A;  2L4N A;  3NBH A;  1QCB D;  2B39 A;  3EQL C;  4KTA A;  2PNR C;  1A15 A;  2E76 C;  1WTV A;  5C3X A;  5KRU A;  2CW0 C;  5KGU A;  5M5Y B;  2HUG A;  4X3T A;  1B1Z A;  3NQI A;  1SYG A;  4OIK A;  3R8B A;  5EBD A;  3HRZ C;  3M7G A;  3NQT A;  5EJW A;  1D1I A;  3QOJ A;  3K5L A;  4IUR A;  2FMM A;  2WIN B;  1HHV A;  3D8G A;  2EY1 A;  2DY8 A;  3KBG A;  1TVX A;  1DJR D;  2A74 C;  1ET9 A;  1CA6 A;  4KY6 A;  4V0B A;  3LWU A;  5D3I B;  1SNP A;  2BE5 D;  2E75 C;  1OXU A;  2B63 B;  4OIJ A;  2AQ3 B;  1C4Q A;  5M5W B;  1TY0 A;  1I6H B;  2X6G A;  3EJI A;  3D4D A;  4HR7 B;  1W6J A;  2IPK D;  3K0Y A;  2OEO A;  1EIG A;  2B2T A;  2EDG A;  1GHK A;  2IX3 A;  4ZRZ A;  1V1P A;  4FF4 A;  1B4O A;  1CK1 A;  5A2Q E;  1BDO A;  1XWE A;  1GUN A;  3K6O A;  2KEE A;  5G3L F;  1J8I A;  4XDX A;  1TT2 A;  1V43 A;  1T5E A;  3SK5 A;  4QCL A;  1H9K A;  4ILW A;  3BDO A;  3KLS A;  1DXM A;  2DNC A;  3D6C A;  1PYW D;  1EZ6 A;  2PCF B;  3TP6 A;  3CU7 A;  1HUN A;  5FO8 B;  2F0V A;  2Q8I B;  1RTO A;  1BCP F;  4M8A A;  4U68 A;  1LTR D;  4ODG A;  3QG1 A;  4DAP A;  4RCN A;  4H13 C;  1EEF D;  1TR5 A;  4C3J B;  1NR4 A;  4ZK9 B;  1SNQ A;  3OIP A;  2R93 B;  1SYE A;  3QIA A;  5ISR A;  2K5W A;  1BCP C;  2KQ3 A;  4C3J G;  2VUM B;  2BOS A;  4PMW A;  4IUP A;  4YIJ A;  1E2W A;  3BYY B;  3CQZ B;  1TS3 A;  2K28 A;  5C5M A;  1HFG A;  3NTK A;  3OW7 A;  5F2D A;  1LT5 D;  4C2M B;  2ID0 A;  1S5B D;  5C44 B;  5KNB A;  2VNU D;  1SYC A;  4A3D B;  5COY A;  2OT2 A;  1STN A;  1WTR A;  3PUY A;  1M8A A;  2F0S A;  2ICI A;  2R7Z B;  3PIO 3;  1VMC A;  1BBX C;  3J80 L;  1PFM A;  1UUP A;  3FPU B;  1M4V A;  3ERQ A;  4FVM A;  2CHB D;  3MEH A;  4KD4 A;  2QCP X;  2EY6 A;  3C3L A;  1EY0 A;  1HPC A;  3C1E A;  4X3S A;  5IGB A;  1F77 A;  2K32 A;  5DM7 3;  2EOT A;  3BVM A;  3GTK B;  1GUO A;  2F0I A;  1KLG D;  4BY7 B;  5G3L D;  5I2X A;  3PUZ A;  4XQQ A;  4A3B B;  2B2Y C;  3M4Y A;  3I90 A;  1I4Q A;  5EPJ A;  2FFK B;  3NSW A;  5FO9 B;  2RKS A;  5BN5 A;  5KNC A;  4MHE A;  3GQB A;  5I9P A;  3MFG A;  2F03 A;  2F0E A;  3P75 A;  2RDG A;  3VYT A;  2XVS A;  4IUU A;  1H9R A;  3KLS X;  4OGQ C;  3SK6 A;  2A68 C;  1GHJ A;  3I4M B;  2EYM A;  2B2W C;  1Y8O B;  1B9M A;  2RVL A;  2OF1 A;  1BOS A;  1DON A;  4B9X A;  1TWA B;  1JE4 A;  1F9Q A;  2EPB A;  1II3 A;  4Q5V A;  3A56 A;  1STH A;  2E74 C;  4KN7 C;  1H9J A;  2JEB I;  4PMB A;  1ZEQ X;  3L3O C;  1IW7 D;  3MVV A;  3K57 A;  1AEX A;  3I72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...