2JYOA

Nmr solution structure of human mip-3alpha/ccl20
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human macrophage inflammatory protein 3alpha: protein and peptide nuclear magnetic resonance solution structures, dimerization, dynamics, and anti-infective properties.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords C-C motif chemokine 20 (Small-inducible cytokine A20) (Macro
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2jyoA00
4ZK9B 1BO0A 1S4ZA 3G7LA 2DY7A 1DONA 1DZ1A 1WTVA 1WTRA 2L4NA 2EOTA 1WTQA 2HUGA 2B2VC 3IL8A 4X3UA 1PFMA 3UI2A 3I3CA 2Q8RE 1WTPA 2N88A 1X3PA 4UAIA 3R93A 1BNZA 1F9SA 2L12A 2IL8A 3I8ZA 1B4OA 1HUMA 2MGSA 2HCCA 4MN3A 1WTXA 3DM1A 5EQ0A 1NR2A 1TVXA 3MWYW 2HCIA 3D6WA 2DY8A 1C8CA 1HHVA 5D14A 1J9OA 2B2YA 2EPBA 2B2VA 5EKIA 5T1GA 3GV3A 2R3ZA 4QUFA 3I91A 4MHEA 1PLFA 2K03A 1G91A 3N52A 1CM9A 4HAEA 4U68A 1KNEA 1F9RA 1WTWA 1WD0A 2B2TA 2KECA 1B3AA 1G2SA 1X32A 1EL0A 2JP1A 1EOTA 4RA8A 1U4LA 4X3SA 1CA5A 2J7ZA 2RVLA 1F2LA 1XX8A 3P7JA 1IKMA 2B2UA 1Q3LA 1SSOA 3HP3A 4IUUA 2B2YC 4XT1B 4CJ1B 1XYIA 1AP0A 1MGSA 5DNFA 4CJ2C 1EIHA 2L11A 4XDXA 3LWEA 1HA6A 1WTOA 1PDQA 1IL8A 1JE4A 3QO2A 2RA4A 1HFGA 1SDFA 2RSOA 2X6LA 4X3KA 4X3TA 1B2TA 1F9QA 1ICWA 4NW2A 2K28A 1EIGA 1KNAA 1U4RA 2K01A 3H91A 4HEDA 2N55A 2D9UA 2FJ2A 1U4MA 2NWGA 1PFNA 1JICA 1A15A 1ILQA 5EPLA 1NAPA 2Q8TA 2XIWA 2JYOA 3TZDA 2K04A 1QNKA 2M2LA 1PFBA 1DOMA 5D65A 2NYZD 3DEOA 4LMQD 1AZPA 1B50A 1HFNA 2L1BA 3KUPA 5E4XA 2B2WA 1ZXTA 1NCVA 1F9PA 1G2TA 4IURA 3MTSA 4OIKA 1MSGA 1O7YA 1RJTA 2FINB 3GV6A 4IUVA 4OIJA 1BBXC 1SAPA 4HCSA 1M8AA 4CJ0B 1RODA 1GUWA 1EQTA 5JJZA 2HDMA 1G6ZA 1LV9A 2NZ1D 1HUNA 1MSHA 2X69A 4QUCA 3I90A 5CBEE 2B2UC 4ZAIA 3ONAB 1ML0D 1MI2A 4IUTA 1IKLA 4O42A 1RHPA 2KEEA 5T1IA 2KOLA 1BF4A 4HSVA 3F2UA 3FPUB 1AZQA 1RTNA 1DOKA 1E0BA 3TN2A 1O80A 1U4PA 4DN4M 1CA6A 1B53A 2K05A 4ZKBB 2MPMA 1J8IA 2SDFA 4ZLTF 1ILPA 5CBAE 5E4WC 4R8IA 2FFKB 1VMCA 4R9WA 1HRJA 4IUQA 3IFDA 5CORA 4ZKCB 2K1BA 3DEPA 1RTOA 2EE1A 1NR4A 2MP1A 2HDLA 4XT3B 2B2TC 3SVMA 5EJWA 3KBXA 5AFWA 1O7ZA 2B2WC 2BDNA 2MJ8A 2RSNA 1WVLA 3Q6SA 2KVMA 2KUMA 2H1EA 2X6GA 1QG7A 2CVRA 1VMPA 2FHTA 1ESRA 2KEDA 3FDTA 2VXWA 4RWSC 1QE6A 5COYA 5EPJA 5EPKA 5CMDA 1WD1A 4RAUC 2FMMA 1DOLA 1X3QA 2L9HA 4IUPA
chains in the Genus database with same CATH superfamily
4ZK9B 2VUMH 1QVGA 1UEBA 1WTRA 1L1OB 2ZJRA 4OO1G 2B63B 2PW7A 5ELCA 2K75A 2Z4HA 3I3CA 3NUCA 3K7UC 4BY7H 1BNZA 3K57A 2RDFA 1B4OA 3TS0A 1SJED 4IFDJ 4RFBA 2MO1A 3D6WA 1PYSB 4FF4A 2F0IA 5M5YH 3I91A 4DV0L 1H9RA 2A6HD 2TMPA 1F9RA 2IHEA 1WTWA 3K6OA 1ET6A 2N78A 2J7ZA 1H9MA 1Q3LA 1Z6HA 3EIVA 4JYAL 4XDXA 1IBLL 1DXMA 2PI2A 1EWCA 2EY1A 1ICWA 3EROA 4I65A 4HJ8A 3S1NH 4DAMA 4L5QA 4L5SA 4FF3A 1E24A 1FGBD 5H1SE 1KDAA 2EYOA 1PVOA 1N33L 4I7AA 1LLRD 4DFAA 3V96A 1IYUA 4OIKA 1CI3M 1CKNB 2AUKA 2VQFQ 1GUOA 3KDFA 4HCSA 2F0PA 2F1MA 1BUVT 2NUCA 2NZ1D 2OTJA 5I6YA 4LF7Q 2I07B 1EQVA 3CC2A 5DAUA 1SNPA 4GOPB 3M3YH 1R9TH 1IXRA 4N9TA 4JI8L 5C3EG 2SEBD 3G4SA 3Q8DA 5C0XG 5IP7G 1O78A 2F0QA 5IY0A 5E4WC 1QWYA 4OONA 4DF7A 2RDGA 1Y8NB 5A2QL 2D5DA 3CCMA 4B3RL 5IGBA 1KAAA 4H44C 1HNZL 3S15H 1C4QA 3DWQA 2E2HB 3GP7A 3GTKH 3C1EA 2F0GA 1GJXA 2Z8LA 4C2MH 1TWHH 1EFWA 3BZCA 4J1MA 2LXKA 4B3RQ 3MXNA 2CH4A 4P2CB 5NUCA 4A3KG 3EA6A 5GROA 2KHSA 3I73A 1DONA 4DV5L 1STHA 2HUGA 2Y0SB 3CC4A 1BCPD 3VR2A 4FF1A 3UI2A 2VZAA 1WTPA 2D0PA 1SMXA 2N88A 3CKIB 4H02A 4NP5A 1WTXA 4HMJA 4YIJA 1QCBD 2RCFA 4XYOA 3Q0AA 1B1ZA 2HCIA 2PMZB 5D14A 3RLNA 4HJ7A 2A6HC 2JEAI 4PG3A 1B7YB 3N52A 2V4DA 4DV5Q 1PTOH 3EBEA 3J7A5 1X32A 2I5MX 4BBRB 1D7QA 5LMNL 5DNFA 3SEBA 4DV3Q 1SBBB 3EN2A 3GQBA 2MFIA 2Z0SA 4OO1H 2LS01 2EJFC 1MJEA 1HNZQ 4A3LG 1AN8A 1SYCA 4LF6Q 4DR1Q 5EPLA 3K7AB 4B9XA 1IBLQ 4Y52H 4LK1C 1LTTD 4YCWA 4LF5L 4RH6A 4DU9A 1MJCA 2QF7A 3NQTA 2YYZA 1I3QB 1SR3A 3MFGA 2LKVA 4X65L 1J5EL 2O4XA 2CFMA 3CQZH 4JI8Q 1FJGL 4GZYC 1CFMA 3PF5A 1G6ZA 3TDQA 4RGMA 4BY1B 4KN7C 2UXDQ 2F0EA 1B70B 5CBEE 3S17B 3GTMH 1OXTA 3DMUA 1ENFA 3E3XA 2F3VA 2R7ZG 4DAYB 1STBA 2PZUA 2AMCB 4BY1H 2B39A 4A3DH 3TN2A 4JVZA 3PIOA 4DV3L 5M5XH 1MD2D 1VF7A 3MAQA 2GVAA 4DV6L 1N33Q 2FFKB 2Z9HA 4IUQA 1N34L 4GN4B 3KYHC 1Y1WH 4XTCS 1JC7A 3TREA 5EJWA 5FLXL 3T56B 3J80L 1F2YA 5IYCH 4A3EG 1QG7A 1KRSA 1EQQA 4BY1G 3FDTA 5K5PA 3BU2A 4A3BG 2E75C 1XPOA 5I4DA 1YNJC 4A3IH 4B3TL 3G7LA 3Q24A 1EY9A 1EIYB 2H5XA 4A3FB 2LY7A 2EJGC 4DA2A 1VF5C 3IL8A 1SYDA 2PQAB 5EBDA 4LF5Q 2ALYB 4MIUA 2LMCB 5IT9E 3I8ZA 2OWOA 3KLRA 2Q2IA 2EY2A 5FO7B 4GKKQ 4LFCL 5C4HA 4RGTA 2B2YA 4IPHA 4V190 3CMEA 4HIOA 3TZUA 4DNTB 1M90C 2KQ3A 2B2TA 4BBRG 1TQOA 3J7ZC 1XNRL 2RVLA 1F2LA 2YV5A 3HOZB 2VY3A 4YY3L 4HMIA 4F87A 1GOZA 4WRDA 1HA6A 2R92G 1A2UA 2UXBL 3HOUG 4POGA 5IYDG 1EUJA 1EFID 1EQRA 4K8IA 3HOYG 2DGYA 1TIID 4H13C 2QEXA 5E7NA 1PFBA 1LUZA 4Z9CB 1HFNA 1STAA 3A5ZB 1IYVA 2QKIC 2L1BA 2A69C 1G2TA 4DV1Q 1VQBA 4R4OA 3CXCA 1HR0L 3D4WA 4DKAC 3T1HQ 1RODA 1KHIA 5JJZA 4R4IA 2Q8IB 2JN4A 2LXJA 4RHSA 1Y69U 2PZWA 3PUWA 4M1UB 2SOBA 2J4XA 4RKLA 2WIIB 1E2ZA 4YCVA 4O42A 5C44G 4ZUJA 3FPPA 2RCNA 4EQPA 4WJ3M 1RTNA 3H0GB 3CP0A 1HH2P 5C5MA 2DNEA 3H3VH 4JYAQ 4GOPA 5FKAC 5ELBA 3M7NA 1FGUA 2Z4IA 3IFDA 3RLFA 3PO3G 3HOUB 4GLAC 1NR4A 3KBGA 2JA6B 4N8X1 1SJHD 1JT8A 1BDOA 4YWMA 3K7AH 2OQ0A 3MXPA 3S1NB 1IW7D 3MHBA 5EPJA 4PQXA 1TWHB 1UEAB 2K5HA 2R6GA 4OWWB 3BDLA 3TP8A 3STBC 2DY7A 4AQYQ 4FYDA 4JI2Q 1IBMQ 1PZKD 3A8JE 2EZVA 3GTLH 4UAIA 1BCPC 3E9HA 1X9NA 2WKDA 4PNYA 1SE2A 3KF8B 3J7AF 1HHVA 1SYBA 2EPBA 2L0CA 1FNUA 2R3ZA 2B8FA 4MHEA 1PTOF 5GAHC 2F3IA 2V1CC 3S14H 1YVCA 4RCOA 4LF4L 1GD7A 3HG9A 4X3SA 1JORA 1PH5A 3JAME 4IUUA 1WYDA 4XT1B 4CBVA 4IQZA 4KJNA 1AP0A 1EIFA 1K0RA 5FO9B 1PDQA 4RCNA 4C3HG 2R92H 2F0SA 5CV5A 4ME3A 3HEJA 2KHJA 1RL2A 2K5NA 3KF6B 3VYRA 2QGQA 1E7ZA 3OOCA 1VS0A 4DUZL 2PO4A 1QZGA 2KCCA 2E2HH 4P75A 4A93B 2I0QA 1YNND 1S5BD 4DV4L 3NPPA 4JI6L 5JEAH 1ZEQX 4BBSB 2NN6H 1PZID 1DGSA 2F0KA 3KOJA 5CV4A 3ZYYX 5EAYA 2AWOA 2NN6G 2Y0SE 4NB3A 2B2UC 4DV7Q 3LGJA 4EQOA 5BN4A 1O7IA 2KOLA 1BF4A 4LW1A 5JJIA 1SFOH 3AMUA 3E0JA 4Q0FA 1E2VA 1RIPA 1AE3A 3FKIG 2F0MA 4R9WA 2KCNA 4KHVA 1H9KA 4L6TB 1JOOA 5BN5A 1VQGA 1PZJD 3I4NG 3GTQB 4XQNA 4EGVA 3SVMA 4B3SL 2WFWA 1KLGD 4RKBA 1LYLA 4ODGA 2JJQA 4LF4Q 4AYBG 4RWSC 5COYA 2EXZA 3PMFA 2B8GA 1XTDA 1BBWA 1B8AA 1S4ZA 3ND9A 5C44H 3HOWG 3P75A 1AE2A 2L4NA 2RQXA 3S2DB 2F0TA 1UNSA 1BKBA 2I5HA 5D3DA 2GN5A 3DHQA 4CKCA 3D8GA 2A69D 4DR2L 3QWNA 5M5XB 1CQFA 3OTOQ 5JJKA 5K36G 3J7YW 5DLQE 2WAQB 2G5DA 1HNWQ 1U9RA 1VQ6A 4OELB 1L1OC 4HAEA 4U68A 1II3A 3RUZA 1KNEA 5L37A 2JP1A 3CCRA 5C3EH 3BVZA 1KIXA 3HP3A 4DR4L 3F2DA 4HIKA 1TS4A 3CRKC 3CCUA 3LWEA 1JE4A 1B9MA 1QB5D 1YNXA 4CDEC 2MQHA 2QA4A 1PFNA 2VB3X 2E76C 4X62Q 3PGZA 3PCOB 1GUGA 2NZHA 2A6ED 3MFYA 1XMOL 5C4XH 4KJOA 5GAGC 3KUPA 4IURA 1GO3E 3BZKA 4LFCQ 2C9OA 1HTPA 3FEWX 4G7OC 2NVQH 2N8NA 3SK4A 3T16A 1VQ4A 2E5LL 3HKSA 1EZ6A 1A6XA 5G3LD 2WB1E 3HRZC 2OF1A 3WDNA 2IX0A 2E2JH 1HZBA 4DXFA 3EVQA 1ML0D 2AQ1B 4B3TQ 2K4KA 5LMUQ 1YJWA 4HSVA 3F2UA 4L63B 2CQAA 3H0GH 1LT4D 1O80A 3X3MA 1CZWA 5J39A 1AW7A 1LTLA 4KV6A 1SNMA 3SK8A 4XIGS 4JI4L 3CU7A 3KLSX 2F03A 1PH2A 1ZYRC 1T5EA 4B3MQ 4ZCKA 4KKTA 1HNWL 2JQOA 2CCZA 2O5JC 4GS3A 2BDNA 3Q6SA 1TS5A 3OTOL 4KHPQ 1LT3D 3F8TA 4JOIC 1P8LA 3F2BA 4BBSH 2K5QA 1DOLA 1E3PA 1X3QA 3KLSA 3QIAA 4IUPA 5EKKA 3U9OA 4ILWA 5M9OA 1TT2A 4A3JB 5LMNW 1YHBA 2UXBQ 5C5LA 3NENA 4DR7L 1BVSA 3AFQA 2A19A 2JA8H 4MNOA 3PUVA 4A3FG 1I6HH 2CQOA 3NEMA 3J81L 1KAWA 4OL7A 2N3SA 1D1IA 3H09A 2JA9A 1A62A 4KY6A 3RN5A 3AEVA 2HD3A 3R8BA 4GKKL 1B3AA 4DR1L 1V9PA 1IZ6A 1TWCB 4K5WA 3JC66 3O13A 1ONLA 3KFUA 2SNMA 4QF4A 3NTIA 2ZT9C 4NDXA 5JEAJ 1VQ5A 2B63H 1H9SB 2XN9C 3BVMA 1KL9A 1IBKQ 3M4OH 1EY0A 1H9SA 1T9HA 3WWVA 4A3JG 2EYFA 4IUVA 4OIJA 3OWEB 2UXDL 3CW2C 1N34Q 1PYWD 2ZTDA 2VNUD 1XWEA 2YTYA 2X69A 5F2DA 1VQ8A 1EY5A 5LMUL 1NSNS 1IHZA 2F52A 3GTJH 2F3WA 1MI2A 4IUTA 1Y1VG 2KEEA 2ZXRA 3EJIA 5DM73 3CMAA 3CCLA 1CKMA 1U0LA 4X66Q 3BS1A 3FKIB 1Y1VH 2L5TA 5C3WA 1A8VA 5FLMG 1TY2A 1VMCA 1D2BA 4ALPA 1FJGQ 1G6PA 4LF9Q 4K2KA 2A8VA 4HJ5A 4DUYL 4KKSA 1VQIA 2KVMA 1M1KC 3ZJYC 4A75A 4YHHQ 1L0XB 3A7LA 3RZOH 1N9WA 3T53B 5C44B 4C56C 4G7ZC 3PIO3 4DR4Q 2JA7H 4X64Q 1R9TB 3GO5A 2BH8A 2AHOB 3NHHA 2K5VA 5LMNQ 2A6EC 5IODA 2K52A 2I46A 3U4VA 3T51B 5FJ8G 1TWGH 2UUBL 3C3LA 1JB3A 3OHXC 2ES2A 1C8CA 5KIXA 5I2YA 3A54A 3NBHB 2TSSA 3A56A 1PLFA 3GTPH 4QY7A 5TSSA 2NVQB 1GUNA 3S1QH 4LUVA 4RA8A 5A2QE 1SFOB 3P7JA 1STGA 3AYHB 3NBIA 1BR9A 3FMCA 3HGBA 5C4JB 3NK9A 1EIHA 2HHHQ 5I6WA 4V0BA 4OWTB 3DUZA 1QOHA 1F9QA 2K7VA 1VQJA 3J7AV 3H91A 4R1JA 4LJZC 1E22A 3ND8A 1GM5A 1EOVA 2CH4W 1ILQA 2E2IH 2XIWA 2JYOA 1QNKA 4IPDA 2XRSD 4A3FH 2NYZD 3NBHA 3VYUA 4FVMA 2NB0A 2MHVA 2EIFA 3VR4A 2Z6KA 3R3OA 3W3AA 1MIUA 3D31A 4NKLA 1LT5D 5HURA 5HGTA 1EY6A 5IWAQ 4JPBW 1HUNA 1F2ZA 2UUCL 3BG3A 4AYBB 3E6ZX 4IN3A 4PMWA 3H15A 3L7ZC 1VQPA 4ZAIA 2F4VL 2R93G 1RHPA 3BYYB 1Z9FA 3GTGH 3HKZE 3FPUB 4E6IA 4K6LA 1XTCD 4A4IA 2H4OA 2JK8A 2JA5G 1PTOD 2PI2E 5LL6X 1CT1D 4ZLTF 3UDIA 4ZKCB 1SYGA 2DN8A 3NTKA 4IOCA 5FLXE 2PPBC 4JBMA 1JJCB 2QDLA 1SNCA 2VW9A 2B2TC 4UP7A 2E8GA 2OEOA 2E74C 4P73A 4BWGB 3U9SA 3NTHA 2KUMA 4KK7A 4A3KH 3GTOB 2AKWB 4JBWA 4RGOS 1I6VC 2KEDA 1PRTF 2FHTA 2VXWA 1ASZA 4OXPA 3FRPB 4FXKC 1VQ7A 3NE5B 2R7ZB 2AWNA 4Q5VA 5M5WB 2NTTA 1WTVA 4OWXB 1J6QA 4JCVE 4C1NI 3M4PA 2OXPA 3WOEA 2ICEC 4QB4A 4OEMB 3UE1A 3BJUA 5FK9C 1NR2A 3KLWA 4YWKA 3J80c 3CD6A 2F0NA 1KQSA 2EQSA 4KI0A 1IL2A 1DD2A 5ELDA 3VR5A 4I7ZC 3L3OC 1RCVD 4UY8C 4C2MB 3AQQA 1NBWA 4JI5L 3A5UA 1S40A 2UUCQ 2ZJQA 4DV7L 4A3GB 2WINB 1N32Q 4R4CA 2K01A 3NWTA 1EWHA 3RLOA 5IIFA 1LTRD 4FO2A 4L8JA 1Q1EA 1JB7A 1HNXL 4A3GH 1HJPA 4OGQC 3UDFA 1Q86C 1NCVA 1MSGA 1RJTA 3RR5A 4HJ9A 3GV6A 4LFAL 1M8AA 4PZ7A 4A3MH 4JI3L 3S1RB 1K8OA 5C4ZA 2CKZB 4Y7NH 4A3EB 4BY7G 3STBD 3J81i 1GHJA 4A3MG 2K14A 4MZ9A 2R7FA 3GTJB 1PH6A 4EQ5A 4A3DG 2C5CA 4B9WA 1JOQA 1SEBD 5T1IA 3OSOA 5BN3A 2BCOA 2XVSA 4NXNL 1I94L 2R93B 5E1FA 1DYQA 1Q8IA 2K05A 1STYA 2MPMA 3H6MA 5GAEC 3K81C 3FHWA 3T4AC 4DK3C 5CORA 2ICIA 2K50A 2K1BA 3ULJA 2UU9L 4AYBE 4KD3A 2F0HA 1Y14B 2P5ZX 3PF4A 1KDCA 4AIMA 1CKOA 4X64L 1X54A 3A0JA 3DLLA 3CF5A 2DJFC 3MVVA 4U673 4QGUA 5HGQA 5KNBA 4JI2L 2L9HA 1MHWC 3D4RA 1ZKOA 4GNXB 1FL0A 1SE4A 4JI0L 1AFPA 1ESFA 1HZ9A 4KHZA 5K36H 1OXSC 1PRTD 1WTQA 5IP9H 4A3CH 3HOXB 3KF8A 5M3FB 4JV5L 1EYDA 1Q46A 5IGEA 4LF9L 5KYIA 1XNQL 3PQIA 4QIWE 3DM1A 5EQ0A 3MWYW 1CSPA 5G3LF 4F8MA 4R4TA 1XJVA 3HKZB 4DR2Q 4IPGA 2R93H 1C0AA 1K8GA 1SE3A 1VDZA 1L2FA 2HQEA 1XMQQ 5C0XH 4DR5Q 3NELA 3M9BA 1TXYA 2B2UA 4K5VA 3HOUH 1MKHA 3DWAA 5ISRA 2OQKA 3TP7A 5C4JH 1PH1A 3M4QA 3E5SA 3OMGA 1BOSA 1JR0D 1HFGA 3NP8A 1K28A 4X3TA 4PMCA 3U58A 3NSWA 1U4RA 4GLVB 2N55A 5C0XI 3KK7A 1I50H 3F2CA 1RKNA 2A68D 2NWGA 1B44D 5CV7A 3IKJA 2UUAQ 1KC8C 5M5WH 3TZDA 5D65A 4OX9L 1B50A 1DOMA 1TWGB 1FR3A 2JE6I 2WAQG 2UUBQ 3D3RA 4POFA 1LTSD 1WTHA 1QILA 5A35A 4BY7B 1OO9B 3GTOH 1N32L 4J15A 3S1QB 2HDMA 1XPUA 5JVH3 5IYBH 3FKIH 1X3EA 2RF4A 1V1PB 2JA7B 2I5LX 1EU3A 2EDGA 2JSOA 3HOWH 4YHHL 4KN4C 3K0YA 1N36Q 5JVG3 1VQDA 3L2PA 2DJGC 1TY0A 1PH8A 3CCQA 4DUYQ 4DV4Q 2SDFA 2GVBA 5ELFA 1VQOA 5IYDH 4K5XA 2EYMA 3I7FA 2E2IB 4BA2I 1RTOA 4HN7A 4F7XA 2D2CC 2HDLA 5D3IB 1K83H 1EY8A 3MEHA 1YZ6A 4PMBA 3K5NA 4NXMQ 1PXUA 1LACA 1ICFB 4DR3L 1S3OA 3C1FA 1U5KA 2B63G 2JA8G 4IALA 5FLXc 3CAMA 4DGZA 2B2VC 1NMGA 5CGKA 2VL6A 3GTGB 4RGNA 1N36L 2JXMB 1X3PA 3I2ZA 3R93A 2L12A 4B3ML 1YJNA 4FDBA 3GD7A 3LWUA 4A93H 1SROA 5T1GA 4QIWB 3W2DA 2O2LD 2PZTA 1C7YA 2K33A 4WJ4A 3TP6A 2F4VQ 4HCEA 1CA5A 1KLUD 3MXNB 3V05A 1IKMA 2ATWA 4IPCA 1SSOA 3D6CA 3HOZH 4CJ1B 1YJ9A 1NUCA 1PTOB 1Q1BA 1I4PA 4NXML 1Z7TA 4FF2A 1SDFA 1WI5A 2F0LA 1EWIA 5KNDA 4ME5A 1XPRA 1W6KA 5IP9G 4HEDA 3IAYA 1GXDC 5C0XJ 1U4MA 5FO8B 1Y8OB 3GDEA 1ZYRD 1PH9A 4X65Q 1J5EQ 1G51A 2NN6I 1AZPA 1YBYA 5JOBA 4LUOA 4C3JG 2ZM6L 4TKOB 1TS3A 4LAAA 3PSIA 1EQTA 1ET9A 3G6EA 4JI7Q 3S14B 2JA7G 4IUNA 5EBCA 2NVXH 5C3EB 3GTLB 1HTLD 3PO2H 2F0OA 1H95A 5ELOA 3VR6A 4JBKA 3V2TA 3HOXG 3HS0C 1SNDA 3T1HL 3A8IE 2CW0D 2HIXA 1G291 4C3IB 3K59A 3SHLA 2VQFL 2JA6H 2QW7A 4OX9Q 5CBAE 2OT2A 1FVIA 1PMRA 5CYUA 4H7BA 3H3VI 3H3VC 2EE1A 4JI4Q 1QUQB 1EYAA 1PFSA 2EY6A 4XYQA 2MJ8A 3SR1A 3OWFA 4HR7B 4PZ8A 4O0AA 1VQHA 1M4VA 1WCMB 2WP8J 3DWPA 3DXJC 1TWFB 1LTGD 1N8RC 4DV2Q 4LNQA 3S16H 4UP8A 3P1HA 3T13A 4DAYA 3ULLA 1LTAD 4IFDG 1R4PB 1UAPA 1HR0W 3MZ5A 4UP9A 2A68C 2PCFB 3ERQA 4DR5L 1DZ1A 2J0TD 1UE6A 2EOTA 3N6RA 3PIP3 3L9AX 4P71A 4M8AA 1F9SA 1CUKA 4ULLA 4ABNA 3KDFB 2QILA 3L0OA 3K5OA 4RMFA 3HOWB 1I4XA 4QQBX 5IT9L 1XNQQ 3GV3A 3G48A 1HZAA 1X56A 4BS9A 2K03A 5M3FG 2Q2HA 1Q12A 1HPCA 2AUJD 3FVQA 3PUYA 3SK6A 4N8FA 3TMEA 4QCLA 2VQEQ 5IGGA 3I4NH 1K9MC 4B3SQ 4OO1I 4L5TA 1JCKB 1Y1WG 4ZYSA 1K73C 4DAPA 3J81j 1WTOA 3Q23A 4F88A 4X3KA 5M3MB 2MNAA 1B2TA 5IGDA 1TS2A 1S72A 5KNCA 4RHRA 5M3FH 5C4XG 2F0WA 2B29A 4JW0A 2QCPX 2Q8TA 2BE5C 2M2LA 3S15B 5ELEA 3DEOA 5I9PA 3OIQA 4LMQD 2YU9B 1TR5A 1OXVA 4DNRB 2RHQB 2AQ3B 3U50C 1I3QH 1I94Q 2NVTH 1STEA 2K5DA 1HCZA 1LTID 1GUWA 1PRTB 3OPOA 4LFBL 3VYSA 1FNVA 2HQLA 1ENAA 2XWBB 2Z6KC 3ULPA 5CV6A 4P72A 1CTMA 1BCPB 3SXHA 1Q82C 4WORA 5KGUA 1DOKA 3VA7A 1IW7C 1JWSD 1U4PA 3T1YL 1V1PA 1VQMA 3GTQH 1JOKA 5DM63 3C2PA 5FJ8H 1I6HB 4BXXH 1AEXA 4HJAA 2JA5B 2R7DA 5GADC 5M3MG 1K0SA 4MTKA 2R61A 4LF6L 4XT3B 1L0YB 1K3BC 1Y8PB 1GHKA 2RSNA 4IOAA 4CKBA 3TBIB 1PTOC 3A7AB 1ESRA 2B3GA 4CDCC 5I9OA 5EPKA 1YITA 3MA2B 3RZOB 1W2BA 4CHTB 4GKJL 4ID6A 1QZHA 3TS2A 4JI1Q 2ID0A 2MUYA 2K6AA 3K5LA 3FP9A 1S5CD 1L1OA 1NY4A 4N9PA 4C3JH 5JEAG 3W1BA 1DJRD 2SNSA 2PMZE 1TVXA 1UE5A 4O2DA 5J3BA 1EEFD 4HSPA 5JPMC 3QR8A 3NWSA 3SK5A 1PH4A 1CHPD 2KHIA 3M7GA 1WD0A 1G2SA 1JQYD 1U4LA 1LM0A 1XX8A 2FMCA 4C3IG 3MXGA 2ZJPA 1R4QB 1YIJA 3K80C 4LF8L 3URYA 1S5FD 3QO2A 5JPNC 1C9OA 5C6AA 4QJFA 1PH7A 1B3QA 1KNAA 2MO0A 4K8JA 4HIDA 3UE0A 3ERSX 1JICA 1A15A 2CWAA 5BR8L 1I4RA 3MEFA 3NQIA 3M4OB 4IFDI 5GQOA 1D8LA 1F9PA 2EYJA 3AFPA 4FXGC 1QNUA 2FINB 3S9WA 3RZDH 3VYTA 3CQZB 1OTCA 1SNOA 2NVYB 4A3CG 1HNXQ 3I4OA 4KMUC 3I90A 2WAQE 3TP5A 3S17H 2PNRC 2K5WA 5FOBB 1E1TA 1A3TA 3A8KE 4A3BH 2UU9Q 2WB1G 1PYBA 5BR8Q 5KRUA 2BA0A 1V1QA 2A1AA 4YCUA 1HQMC 4JG2A 3SDZA 3BVGA 1KABA 3HOVH 5IOCA 4JI7L 5E3FA 3B6YA 5J22A 3Q22A 1X3FA 2PQAA 3HOVG 1NNXA 2B2WC 1V43A 2IHFA 2JA5H 5FLMH 1DM0B 1YI2A 1BXTA 1WCMH 1WOCA 2CVRA 3I4MG 4A3JH 3W1GA 1Q8KA 1HA5A 4DNIA 1A3VA 2K32A 1SN8A 3I55A 3CC7A 5HY6A 2F0UA 1X65A 1GUTA 1XXGA 3OYYA 3I70A 4X66L 1QJOA 2DNCA 4APVA 2IL8A 1HR0Q 2O5IC 1HUMA 4YWLA 1BCPF 4DXGA 3SE0A 3F1ZA 5EKIA 3DM3A 3RN2A 1WJJA 1B9NA 2KENA 1K8AC 1KD1C 1YHQA 1DCZA 3BYTB 3PV0A 4K2LA 4NPSA 3VDYA 3HOYH 1STNA 2IX1A 4R4QA 3OW7A 3ICEA 2RBMA 2RA4A 2KCTA 5M3MH 4A3IB 2ZXPA 1Y1WB 4NW2A 4IJLA 1NTGA 5DEHA 3S24A 2ENBA 1LT6D 2VUMG 1I4GA 3G6JB 4ZQ3A 1NAPA 1F77A 2NZOA 3VA5A 2K04A 5CC4A 4WJWA 2YU9H 1HRJA 1X55A 4DR6Q 1TKWB 4J8QA 1KXLA 2WKCA 2WACA 2IWHA 4JOIA 4CGYB 1SRUA 4XQQA 1QVCA 1VQLA 4CJ0B 1TWFH 2RHSB 3TEHB 4H0LC 1V8QA 5IGFA 1Q90A 3IRBA 4DK6C 1A0IA 2M00A 1CZGA 4FXDA 4LWCA 2GA4B 4QMGA 2CHBD 4G7HC 1UE7A 4DN4M 4DV2L 1VQNA 4UDUC 4A3LH 3A74A 1CQVA 3WOFA 1ILPA 4LFBQ 3HOVB 3S2HH 1VQ9A 2XWJB 4DV6Q 3HKZG 1ASYA 1IBML 3PO3H 2EXDA 2VQEL 4AQYL 4G57A 2X6GA 1O7LA 1QE6A 5C4XB 1RDPD 4Y7NB 4A3EH 1FYCA 3JAML 2BH2A 3I4MH 1D5XC 2XNAC 2R7ZH 4ZRZA 1KTKA 4ZUIA 1TWAB 5IE8A 1GKHA 1PFMA 1SLJA 2Q8RE 3VR3A 1PH3A 2F0VA 1E1OA 1NJIC 4MN3A 2A5HA 3LNNA 4GOPC 2ZM6Q 2F4IA 2DY8A 3HOZG 1CSQA 5CV8A 1J9OA 4S3SA 3K5MA 3EQLC 2PNHA 4DR7Q 1AH9A 3H0GG 2QDBA 3MXUA 3EFXD 3ITPA 1T5XD 1V1OA 1EL0A 3PUZA 3RD4A 2AQ2B 3P20A 2FXQA 4TRDA 4EX5A 3J81c 4JK1C 4TSSA 3K8AA 1EY7A 1MGSA 4CJ2C 1I5FA 1X6OA 3PO3B 2F0DA 4LF7L 2RSOA 3NXWA 2Y0SG 3M85A 4CDDC 4BBRH 2XGTA 4DV1L 3CCSA 2D9UA 4HIMA 2XRQD 4MTNA 1WCMG 4A3KB 1FD7D 1TU2B 2IPKD 2IX3A 1F2MA 3CCVA 5JAVA 4XXEA 3UDXA 1JJGA 1SXTA 1D5ZC 3MTSA 2G9DA 3IFTA 5EGTA 1QUQA 2KCMA 3UDGA 3S1RH 4A3MB 2EJMA 2JEBI 4KY5A 2UXCL 1LV9A 2BDOA 3QJYA 3BDCA 4C3JB 2LSSA 1NE3A 1KRTA 2EYHA 3PUXA 3ONAB 1JJ2A 1SE8A 4A3GG 3RNUA 2QEJC 4TQUS 1E0BA 3I72A 2KBNA 3HOYB 2IW3A 1PV4A 3I56A 3S1MB 1PHJA 1KDBA 2EYPA 4CDFC 5LL6S 1JMCA 1SYFA 1YNJD 5LHY1 3D4DA 4LFAQ 3K58A 5AFWA 1O7ZA 2G9HD 1WVLA 4WFN3 1VCIA 1VQKA 4IJHA 2ZTEA 2F0FA 2EVBA 2PYKA 2RKSA 3CCEA 1VQAA 4IZ8A 5IYCG 4GN3B 2WV6D 1D6EC 4GNXC 3S16B 2E2DC 3PIPA 1IBKL 1K8MA 3JAMc 4AH6A 1I4QA 1A2TA 1YEZA 2IT1A 4B08A 2NTSA 3HZXA 3K0XA 4DK0A 3TRZA 1C48A 4EQNA 4KHPL 4K0KL 1I4HA 3C46A 1QVFA 4DR3Q 2OTLA 4LUZA 1WFQA 3KF6A 3QOLA 4JC0A 4DPGA 4EVOA 2B2YC 2A74C 3AB9A 4DUZQ 3T1YQ 3PO2G 2BA1A 2L11A 4NMZA 1IL8A 3CRLC 2IJ0A 3OIPA 2X6LA 3E0EA 1CK1A 3M4YA 2VUMB 1OXXK 1EIGA 3X3NA 2EY5A 5J1ZA 1BQQT 2IY5B 2VS1A 1EEID 4C3HB 4A3IG 3KJPA 4DV0Q 3S2HB 1K3RA 2A73B 4OHJA 3G71A 4KY7A 1ENCA 2B2WA 1D5MC 2HIVA 5CR3A 1O7YA 1BBXC 1EU4A 5CV9A 4GN5A 5IYBG 2WB1B 1NMFA 3I4MB 1JWUD 3R2IA 4QUCA 2HT1A 4JBJA 4X62L 1D1KA 2Z6BA 4TVAB 1UUPA 2M9VA 4G4KA 4BXXG 4GLXA 1IKLA 1HXYD 1JE5A 4JI0Q 4BBSG 3CCJA 3SGIA 3OMCA 1EYCA 3HFZB 1Z47A 1AZQA 2UUAL 3KJOA 2UXCQ 4JI6Q 1IYJB 1LTBD 2DUDA 4FNFA 3QOJA 2OCEA 1BBUA 2RDHA 3CHBD 4R8IA 2XTIA 5IGCA 3J80E 4KLKA 5IWAL 2ZTCA 2C35B 5EKLA 4C3IH 3ER0A 3S1MH 3KBXA 5I2XA 3E9IA 3GTKB 2YTVA 1E2WA 1RF2D 1SMYD 3A55A 2JA6G 1YNNC 1S5ED 1UWVA 1H9JA 1YHAA 1WD1A 1CKNA 5CMDA 4IFDH 4C1NK 2E5LQ 4NXNQ 4RAUC 2CW0C 3MC0B 5KEEA 2NVXB 1BO0A 4P74A 2CWPA 4DAVA 1Q81C 1TWAH 2Q2UA 1I50B 4IO9A 1PA6A 2L15A 4X3UA 1XMOQ 4KTAA 2PQEA 2HHHL 1GVPA 5ELNA 1P16A 2MGSA 2HCCA 2ZXOA 3AU7A 1Q7YC 1SYEA 1XMQL 3RMHA 2B2VA 1W3SA 2Z1CA 1PRTC 4CKEA 4L5RC 3GTPB 1CHQD 5M5YB 3M3YB 1GUSA 1CM9A 1HQRD 4FP5D 2KECA 1EOTA 4KD4A 2ASBA 2E2JB 4PZ6A 4DK1A 1TWCH 1X3GA 4BA1I 4J6HA 5AJ3Q 4JI1L 1EZ8A 2VB2X 4KKUA 3JAMi 1XYIA 4JV5Q 4GKJQ 3U4ZA 2EYLA 2KA7A 5AJ3L 3CPWA 4A76A 1G8ZD 2K28A 3CPFA 3BZDB 3I4LA 4JI5Q 1LABA 3W5OA 4UHVA 2FJ2A 4XQJA 3OW2A 1VQEA 1MBYA 3J81E 1VQFA 2BOSA 2R92B 3J80i 1RD9D 3TSSA 2N49A 1OXUA 1EY4A 1LO5D 5E4XA 1SNQA 1ZXTA 1FNWA 4QL5A 1EYGA 1XNRQ 1UE1A 1SAPA 2L55A 4RG1A 4A93G 2XSCA 4K6DA 4O1NA 1MSHA 2D0OA 3RZDB 4A3BB 2F0JA 3PO2B 2NVTB 1A3UA 4HTHA 3GTMB 2JA8B 3R2TA 2YTXA 4PV1C 2BE5D 4R8NA 4X6AH 5IP7H 2NVYH 5C3XA 4LF8Q 4A3DB 1A63A 3D0FA 1W6JA 1Y1VB 1CA6A 3BDOA 3QB3A 2PW5A 1B53A 4UPAA 4ZKBB 1VQCA 1J8IA 1JWMD 4C3HH 1K83B 4DR6L 4JI3Q 3DEPA 5JJLA 1HZCA 2NBFA 2MP1A 3QG1A 2LFNA 3LX0A 1SMYC 3TQYA 1L0WA 1S5DD 2D62A 2Q2TA 4K14A 2KJXA 5IT9c 3I4NB 2H1EA 4GNXA 1VMPA 4QUFA 1G91A 3S2DH 2FMMA 3HOXH 4YY3Q 5KYLA 3H94A 4K0KQ
chains in the Genus database with same CATH topology
4ZK9B 1WTRA 4OO1G 2B63B 2PW7A 5ELCA 2Z4HA 3I3CA 3NUCA 1BNZA 3K57A 2RDFA 1B4OA 1SJED 4IFDJ 4RFBA 3D6WA 4FF4A 2F0IA 3I91A 1H9RA 2A6HD 2TMPA 1F9RA 1WTWA 3K6OA 1ET6A 2J7ZA 1H9MA 1Q3LA 1Z6HA 4XDXA 1DXMA 1EWCA 2EY1A 1ICWA 3EROA 4I65A 4FF3A 1FGBD 1KDAA 2EYOA 1LLRD 4DFAA 3V96A 1IYUA 4OIKA 1CI3M 2AUKA 1GUOA 4HCSA 2F0PA 2F1MA 1BUVT 2NUCA 2NZ1D 5I6YA 2I07B 1EQVA 5DAUA 1SNPA 4N9TA 2SEBD 5C0XG 1O78A 2F0QA 5E4WC 1QWYA 4DF7A 2RDGA 1Y8NB 5A2QL 2D5DA 5IGBA 1KAAA 4H44C 1C4QA 3DWQA 2E2HB 3GP7A 3C1EA 2F0GA 1GJXA 2Z8LA 4J1MA 3MXNA 4P2CB 5NUCA 3EA6A 2KHSA 3I73A 1DONA 1STHA 2HUGA 2Y0SB 1BCPD 3VR2A 4FF1A 3UI2A 1WTPA 2N88A 3CKIB 4NP5A 1WTXA 4HMJA 4YIJA 1QCBD 4XYOA 3Q0AA 1B1ZA 2HCIA 2PMZB 5D14A 2A6HC 2JEAI 3N52A 2V4DA 1PTOH 1X32A 4BBRB 5DNFA 3SEBA 1SBBB 3GQBA 4OO1H 2LS01 2EJFC 1AN8A 1SYCA 5EPLA 3K7AB 4B9XA 4LK1C 1LTTD 4RH6A 4DU9A 2QF7A 3NQTA 2YYZA 1I3QB 3MFGA 2LKVA 2O4XA 4GZYC 1CFMA 1G6ZA 3TDQA 4RGMA 4BY1B 4KN7C 2F0EA 5CBEE 3S17B 1OXTA 3DMUA 1ENFA 2F3VA 1STBA 2PZUA 2B39A 3TN2A 1MD2D 1VF7A 3MAQA 2FFKB 4IUQA 4XTCS 1JC7A 5EJWA 5FLXL 3T56B 3J80L 1F2YA 1QG7A 3FDTA 5K5PA 2E75C 5I4DA 1YNJC 3G7LA 3Q24A 1EY9A 4A3FB 2LY7A 2EJGC 4DA2A 1VF5C 3IL8A 1SYDA 5EBDA 4MIUA 2LMCB 5IT9E 3I8ZA 3KLRA 2EY2A 5FO7B 5C4HA 4RGTA 2B2YA 4V190 3TZUA 4DNTB 2KQ3A 2B2TA 1TQOA 2RVLA 1F2LA 3HOZB 4HMIA 4F87A 1GOZA 4WRDA 1HA6A 1A2UA 1EFID 4K8IA 1TIID 4H13C 1PFBA 4Z9CB 1HFNA 1STAA 1IYVA 2QKIC 2L1BA 2A69C 1G2TA 3D4WA 1RODA 5JJZA 2Q8IB 4RHSA 1Y69U 2PZWA 3PUWA 4M1UB 2SOBA 2J4XA 4RKLA 2WIIB 1E2ZA 4O42A 4ZUJA 3FPPA 4EQPA 1RTNA 3H0GB 5C5MA 2DNEA 5FKAC 5ELBA 3M7NA 2Z4IA 3IFDA 3RLFA 3HOUB 1NR4A 3KBGA 2JA6B 1SJHD 1BDOA 3MXPA 3S1NB 1IW7D 3MHBA 5EPJA 4PQXA 1TWHB 1UEAB 2R6GA 3BDLA 3TP8A 2DY7A 4FYDA 1PZKD 3A8JE 2EZVA 4UAIA 1BCPC 2WKDA 4PNYA 1SE2A 3J7AF 1HHVA 1SYBA 2EPBA 2L0CA 1FNUA 2R3ZA 2B8FA 4MHEA 1PTOF 4RCOA 3HG9A 4X3SA 1JORA 3JAME 4IUUA 4XT1B 4CBVA 4IQZA 4KJNA 1AP0A 5FO9B 1PDQA 4RCNA 4C3HG 2F0SA 5CV5A 3HEJA 3VYRA 3OOCA 2PO4A 2KCCA 4A93B 1YNND 1S5BD 3NPPA 5JEAH 1ZEQX 4BBSB 2NN6H 1PZID 2F0KA 3ZYYX 5CV4A 2AWOA 2NN6G 2B2UC 4EQOA 5BN4A 2KOLA 1BF4A 3AMUA 3E0JA 4Q0FA 1E2VA 2F0MA 4R9WA 2KCNA 4KHVA 1H9KA 4L6TB 1JOOA 5BN5A 1PZJD 3GTQB 4XQNA 4EGVA 3SVMA 1KLGD 4RKBA 4ODGA 4RWSC 5COYA 2EXZA 3PMFA 2B8GA 1S4ZA 3ND9A 3P75A 2L4NA 2RQXA 3S2DB 2F0TA 1UNSA 5D3DA 3DHQA 4CKCA 3D8GA 2A69D 3QWNA 5M5XB 1CQFA 5K36G 3J7YW 2WAQB 1U9RA 4HAEA 4U68A 1II3A 3RUZA 1KNEA 2JP1A 3BVZA 3HP3A 1TS4A 3CRKC 3LWEA 1JE4A 1B9MA 1QB5D 1PFNA 2VB3X 2E76C 1GUGA 2A6ED 3MFYA 4KJOA 3KUPA 4IURA 2C9OA 1HTPA 3FEWX 4G7OC 3SK4A 3T16A 1EZ6A 1A6XA 5G3LD 3HRZC 2OF1A 3WDNA 2IX0A 4DXFA 3EVQA 1ML0D 2AQ1B 4HSVA 3F2UA 4L63B 2CQAA 1LT4D 1O80A 3X3MA 1CZWA 5J39A 1AW7A 4KV6A 1SNMA 3SK8A 4XIGS 3CU7A 3KLSX 2F03A 1ZYRC 1T5EA 4KKTA 2O5JC 2BDNA 3Q6SA 1TS5A 1LT3D 2K5QA 1DOLA 1X3QA 3KLSA 3QIAA 4IUPA 5EKKA 3U9OA 4ILWA 5M9OA 1TT2A 4A3JB 5C5LA 3PUVA 3J81L 4OL7A 1D1IA 3H09A 4KY6A 3R8BA 1B3AA 1TWCB 4K5WA 3O13A 1ONLA 2SNMA 4QF4A 3NTIA 2ZT9C 4NDXA 5JEAJ 1H9SB 2XN9C 3BVMA 1EY0A 1H9SA 2EYFA 4IUVA 4OIJA 3OWEB 1PYWD 2VNUD 1XWEA 5F2DA 2X69A 1EY5A 1NSNS 1IHZA 2F3WA 1MI2A 4IUTA 2KEEA 2ZXRA 3EJIA 5DM73 3BS1A 3FKIB 2L5TA 5C3WA 1TY2A 1VMCA 1D2BA 4K2KA 4KKSA 2KVMA 1L0XB 3A7LA 3T53B 5C44B 4C56C 4G7ZC 3PIO3 1R9TB 3GO5A 3NHHA 2A6EC 5IODA 2I46A 3T51B 3C3LA 1JB3A 3OHXC 1C8CA 5KIXA 5I2YA 3A54A 2TSSA 3A56A 1PLFA 5TSSA 2NVQB 1GUNA 4RA8A 5A2QE 1SFOB 3P7JA 1STGA 3NBIA 1BR9A 3FMCA 3HGBA 5C4JB 3NK9A 1EIHA 5I6WA 4V0BA 3DUZA 1QOHA 1F9QA 2K7VA 3J7AV 3H91A 4LJZC 3ND8A 1ILQA 2XIWA 2JYOA 1QNKA 2XRSD 2NYZD 3NBHA 3VYUA 4FVMA 2NB0A 2MHVA 3VR4A 3R3OA 3W3AA 3D31A 4NKLA 1LT5D 5HURA 5HGTA 1EY6A 1HUNA 1F2ZA 4AYBB 3BG3A 3E6ZX 4IN3A 4PMWA 3L7ZC 4ZAIA 1RHPA 3BYYB 3FPUB 4E6IA 4K6LA 1XTCD 2H4OA 1PTOD 5LL6X 1CT1D 4ZLTF 4ZKCB 1SYGA 2DN8A 3NTKA 5FLXE 2PPBC 1SNCA 2B2TC 2OEOA 2E74C 4BWGB 3U9SA 3NTHA 2KUMA 4KK7A 3GTOB 4JBWA 4RGOS 1I6VC 1PRTF 2FHTA 2KEDA 2VXWA 3FRPB 4FXKC 3NE5B 2R7ZB 2AWNA 4Q5VA 5M5WB 2NTTA 1WTVA 4C1NI 2OXPA 3WOEA 2ICEC 4QB4A 5FK9C 1NR2A 2F0NA 4KI0A 1DD2A 5ELDA 3VR5A 4I7ZC 3L3OC 1RCVD 4C2MB 4A3GB 2WINB 2K01A 3NWTA 1EWHA 5IIFA 1LTRD 4FO2A 4L8JA 1Q1EA 4OGQC 1NCVA 1MSGA 1RJTA 3GV6A 1M8AA 3S1RB 1K8OA 5C4ZA 4A3EB 1GHJA 3GTJB 2C5CA 4B9WA 1JOQA 1SEBD 5T1IA 3OSOA 5BN3A 2BCOA 2XVSA 2R93B 5E1FA 1DYQA 1Q8IA 2K05A 1STYA 2MPMA 3H6MA 3T4AC 5CORA 2ICIA 2K1BA 4KD3A 2F0HA 1KDCA 3MVVA 4U673 5KNBA 2L9HA 3D4RA 1ZKOA 1AFPA 1SE4A 1ESFA 4KHZA 5K36H 1OXSC 1PRTD 1WTQA 3HOXB 3KF8A 5M3FB 1EYDA 5IGEA 5KYIA 3DM1A 5EQ0A 3MWYW 5G3LF 4F8MA 3HKZB 1SE3A 1VDZA 2HQEA 5C0XH 2B2UA 4K5VA 3DWAA 5ISRA 3TP7A 3E5SA 3OMGA 1BOSA 1JR0D 1HFGA 3NP8A 4X3TA 4PMCA 3NSWA 1U4RA 2N55A 5C0XI 3KK7A 1RKNA 2A68D 2NWGA 1B44D 5CV7A 3IKJA 3TZDA 5D65A 1B50A 1DOMA 1TWGB 1FR3A 2JE6I 3D3RA 5A35A 1LTSD 1QILA 4BY7B 1OO9B 3S1QB 2HDMA 5JVH3 1V1PB 2JA7B 1EU3A 2EDGA 2JSOA 4KN4C 3K0YA 5JVG3 1TY0A 2SDFA 5ELFA 4K5XA 2EYMA 2E2IB 4BA2I 1RTOA 4HN7A 4F7XA 2D2CC 2HDLA 5D3IB 1EY8A 3MEHA 4PMBA 3K5NA 1PXUA 1LACA 3C1FA 4IALA 4DGZA 2B2VC 5CGKA 3GTGB 4RGNA 2JXMB 1X3PA 3R93A 2L12A 3GD7A 3LWUA 5T1GA 4QIWB 3W2DA 2O2LD 2PZTA 2K33A 3TP6A 4HCEA 1CA5A 1KLUD 3V05A 1IKMA 1SSOA 3D6CA 4CJ1B 1NUCA 1PTOB 1Q1BA 1I4PA 1Z7TA 4FF2A 1SDFA 2F0LA 5KNDA 4ME5A 1W6KA 4HEDA 3IAYA 1GXDC 5C0XJ 1U4MA 5FO8B 1Y8OB 1ZYRD 2NN6I 1AZPA 5JOBA 4C3JG 4TKOB 1TS3A 4LAAA 1EQTA 1ET9A 3S14B 4IUNA 5EBCA 3GTLB 5C3EB 1HTLD 2F0OA 3VR6A 3V2TA 3HS0C 1SNDA 3A8IE 2CW0D 1G291 4C3IB 3K59A 3SHLA 5CBAE 2OT2A 1PMRA 5CYUA 4H7BA 3H3VC 2EE1A 1EYAA 2EY6A 4XYQA 2MJ8A 3SR1A 3OWFA 4HR7B 1M4VA 1WCMB 2WP8J 3DWPA 3DXJC 1TWFB 1LTGD 3P1HA 3T13A 4DAYA 1LTAD 4IFDG 1R4PB 1UAPA 3MZ5A 2A68C 2PCFB 3ERQA 1DZ1A 2J0TD 2EOTA 3N6RA 3PIP3 3L9AX 4M8AA 1F9SA 4ULLA 4ABNA 2QILA 3K5OA 3HOWB 1I4XA 5IT9L 3GV3A 4BS9A 2K03A 1Q12A 1HPCA 2AUJD 3FVQA 3PUYA 3SK6A 3TMEA 4QCLA 5IGGA 4OO1I 1JCKB 4ZYSA 4DAPA 1WTOA 3Q23A 4F88A 4X3KA 5M3MB 1B2TA 5IGDA 1TS2A 5KNCA 4RHRA 2F0WA 2Q8TA 2QCPX 2BE5C 2M2LA 3S15B 5I9PA 2YU9B 5ELEA 3DEOA 3OIQA 4LMQD 1TR5A 1OXVA 4DNRB 2AQ3B 1STEA 2K5DA 1HCZA 1LTID 1GUWA 1PRTB 3OPOA 3VYSA 1FNVA 1ENAA 2XWBB 5CV6A 1CTMA 1BCPB 3SXHA 5KGUA 4WORA 1DOKA 3VA7A 1IW7C 1JWSD 1U4PA 1V1PA 1JOKA 5DM63 3C2PA 1I6HB 1AEXA 2JA5B 2R61A 4XT3B 1L0YB 1Y8PB 1GHKA 2RSNA 4CKBA 3TBIB 1PTOC 3A7AB 1ESRA 5I9OA 5EPKA 3MA2B 3RZOB 4CHTB 4ID6A 2ID0A 2MUYA 2K6AA 3K5LA 1S5CD 4N9PA 5JEAG 1DJRD 2SNSA 1TVXA 1EEFD 4HSPA 5JPMC 3NWSA 3SK5A 1CHPD 3M7GA 1WD0A 1G2SA 1JQYD 1U4LA 1XX8A 2FMCA 4C3IG 3MXGA 1R4QB 3URYA 1S5FD 3QO2A 5JPNC 5C6AA 1KNAA 4K8JA 1JICA 1A15A 1I4RA 3NQIA 3M4OB 4IFDI 1F9PA 2EYJA 4FXGC 1QNUA 2FINB 3S9WA 3VYTA 3CQZB 1SNOA 2NVYB 4KMUC 3I90A 3TP5A 2PNRC 2K5WA 5FOBB 1A3TA 3A8KE 5KRUA 2BA0A 1HQMC 3SDZA 3BVGA 1KABA 5IOCA 5E3FA 5J22A 3Q22A 2B2WC 1V43A 1DM0B 1BXTA 2CVRA 1HA5A 1A3VA 2K32A 2F0UA 1GUTA 1XXGA 3I70A 1QJOA 2DNCA 2IL8A 2O5IC 1HUMA 1BCPF 4DXGA 3SE0A 5EKIA 1B9NA 1DCZA 3BYTB 3PV0A 4K2LA 1STNA 2IX1A 3OW7A 2RBMA 2RA4A 4A3IB 2ZXPA 1Y1WB 4NW2A 5DEHA 2ENBA 1LT6D 1I4GA 3G6JB 4ZQ3A 1NAPA 1F77A 3VA5A 2K04A 5CC4A 4WJWA 1HRJA 1TKWB 4J8QA 2WKCA 2WACA 2IWHA 4CGYB 4XQQA 4CJ0B 4H0LC 1V8QA 5IGFA 1Q90A 2M00A 1CZGA 4FXDA 2GA4B 4QMGA 2CHBD 4G7HC 4DN4M 4UDUC 1CQVA 3WOFA 1ILPA 3HOVB 2XWJB 4G57A 2X6GA 1O7LA 1QE6A 5C4XB 1RDPD 4Y7NB 1FYCA 3JAML 1D5XC 2XNAC 4ZRZA 1KTKA 4ZUIA 1TWAB 1PFMA 2Q8RE 3VR3A 2F0VA 4MN3A 2A5HA 3LNNA 2F4IA 2DY8A 5CV8A 1J9OA 4S3SA 3K5MA 3EQLC 2QDBA 3MXUA 3EFXD 3ITPA 1T5XD 1V1OA 1EL0A 3PUZA 3RD4A 2AQ2B 3P20A 4TRDA 4JK1C 4TSSA 1EY7A 1MGSA 4CJ2C 3PO3B 2F0DA 2RSOA 3NXWA 3M85A 2D9UA 2XRQD 4A3KB 1FD7D 1TU2B 2IPKD 2IX3A 1F2MA 5JAVA 4XXEA 1SXTA 1D5ZC 3MTSA 2G9DA 3IFTA 5EGTA 4A3MB 2EJMA 2JEBI 4KY5A 1LV9A 2BDOA 3QJYA 3BDCA 4C3JB 2EYHA 3PUXA 3ONAB 2QEJC 4TQUS 1E0BA 3I72A 3HOYB 2IW3A 3S1MB 1KDBA 2EYPA 5LL6S 1SYFA 1YNJD 5LHY1 3D4DA 3K58A 5AFWA 1O7ZA 2G9HD 1WVLA 4WFN3 1VCIA 2F0FA 2EVBA 2PYKA 2RKSA 4IZ8A 2WV6D 1D6EC 3S16B 2E2DC 1K8MA 1I4QA 1A2TA 4B08A 2IT1A 2NTSA 3HZXA 4DK0A 1C48A 4EQNA 1I4HA 3C46A 3QOLA 4EVOA 2B2YC 2A74C 3AB9A 2BA1A 2L11A 4NMZA 1IL8A 3CRLC 2IJ0A 3OIPA 2X6LA 1CK1A 3M4YA 2VUMB 1OXXK 1EIGA 3X3NA 2EY5A 5J1ZA 1BQQT 1EEID 4C3HB 3S2HB 2A73B 4OHJA 4KY7A 1ENCA 2B2WA 1D5MC 5CR3A 1O7YA 1BBXC 1EU4A 5CV9A 2WB1B 3I4MB 1JWUD 3R2IA 4QUCA 1D1KA 1UUPA 2M9VA 4G4KA 1IKLA 1HXYD 1EYCA 1AZQA 1Z47A 3OMCA 1LTBD 4FNFA 3QOJA 2RDHA 3CHBD 4R8IA 5IGCA 3J80E 5EKLA 3KBXA 5I2XA 3GTKB 1E2WA 1RF2D 1SMYD 3A55A 1YNNC 1S5ED 1H9JA 1WD1A 5CMDA 4IFDH 4C1NK 4RAUC 2CW0C 3MC0B 5KEEA 2NVXB 1BO0A 4DAVA 1I50B 4X3UA 4KTAA 2PQEA 2MGSA 2HCCA 2ZXOA 3AU7A 1SYEA 3RMHA 2B2VA 2Z1CA 1PRTC 4CKEA 3GTPB 1CHQD 5M5YB 3M3YB 1GUSA 1CM9A 1HQRD 4FP5D 2KECA 1EOTA 4KD4A 2E2JB 4DK1A 4BA1I 4J6HA 1EZ8A 2VB2X 4KKUA 1XYIA 2EYLA 2KA7A 1G8ZD 2K28A 3I4LA 3BZDB 1LABA 2FJ2A 4XQJA 1MBYA 3J81E 2BOSA 2R92B 1RD9D 3TSSA 1OXUA 1EY4A 1LO5D 5E4XA 1SNQA 1ZXTA 1FNWA 1SAPA 2L55A 2XSCA 4K6DA 4O1NA 1MSHA 3RZDB 4A3BB 2F0JA 3PO2B 2NVTB 1A3UA 4HTHA 3GTMB 2JA8B 3R2TA 4PV1C 2BE5D 4R8NA 5C3XA 4A3DB 1W6JA 1Y1VB 1CA6A 3BDOA 3QB3A 2PW5A 1B53A 4ZKBB 1J8IA 1JWMD 1K83B 3DEPA 2NBFA 2MP1A 3QG1A 2LFNA 3LX0A 1SMYC 1S5DD 2D62A 4K14A 2KJXA 3I4NB 2H1EA 1VMPA 4QUFA 1G91A 2FMMA 5KYLA 3H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK9 B;  1BO0 A;  1S4Z A;  3G7L A;  2DY7 A;  1DON A;  1DZ1 A;  1WTV A;  1WTR A;  2L4N A;  2EOT A;  1WTQ A;  2HUG A;  2B2V C;  3IL8 A;  4X3U A;  1PFM A;  3UI2 A;  3I3C A;  2Q8R E;  1WTP A;  2N88 A;  1X3P A;  4UAI A;  3R93 A;  1BNZ A;  1F9S A;  2L12 A;  2IL8 A;  3I8Z A;  1B4O A;  1HUM A;  2MGS A;  2HCC A;  4MN3 A;  1WTX A;  3DM1 A;  5EQ0 A;  1NR2 A;  1TVX A;  3MWY W;  2HCI A;  3D6W A;  2DY8 A;  1C8C A;  1HHV A;  5D14 A;  1J9O A;  2B2Y A;  2EPB A;  2B2V A;  5EKI A;  5T1G A;  3GV3 A;  2R3Z A;  4QUF A;  3I91 A;  4MHE A;  1PLF A;  2K03 A;  1G91 A;  3N52 A;  1CM9 A;  4HAE A;  4U68 A;  1KNE A;  1F9R A;  1WTW A;  1WD0 A;  2B2T A;  2KEC A;  1B3A A;  1G2S A;  1X32 A;  1EL0 A;  2JP1 A;  1EOT A;  4RA8 A;  1U4L A;  4X3S A;  1CA5 A;  2J7Z A;  2RVL A;  1F2L A;  1XX8 A;  3P7J A;  1IKM A;  2B2U A;  1Q3L A;  1SSO A;  3HP3 A;  4IUU A;  2B2Y C;  4XT1 B;  4CJ1 B;  1XYI A;  1AP0 A;  1MGS A;  5DNF A;  4CJ2 C;  1EIH A;  2L11 A;  4XDX A;  3LWE A;  1HA6 A;  1WTO A;  1PDQ A;  1IL8 A;  1JE4 A;  3QO2 A;  2RA4 A;  1HFG A;  1SDF A;  2RSO A;  2X6L A;  4X3K A;  4X3T A;  1B2T A;  1F9Q A;  1ICW A;  4NW2 A;  2K28 A;  1EIG A;  1KNA A;  1U4R A;  2K01 A;  3H91 A;  4HED A;  2N55 A;  2D9U A;  2FJ2 A;  1U4M A;  2NWG A;  1PFN A;  1JIC A;  1A15 A;  1ILQ A;  5EPL A;  1NAP A;  2Q8T A;  2XIW A;  2JYO A;  3TZD A;  2K04 A;  1QNK A;  2M2L A;  1PFB A;  1DOM A;  5D65 A;  2NYZ D;  3DEO A;  4LMQ D;  1AZP A;  1B50 A;  1HFN A;  2L1B A;  3KUP A;  5E4X A;  2B2W A;  1ZXT A;  1NCV A;  1F9P A;  1G2T A;  4IUR A;  3MTS A;  4OIK A;  1MSG A;  1O7Y A;  1RJT A;  2FIN B;  3GV6 A;  4IUV A;  4OIJ A;  1BBX C;  1SAP A;  4HCS A;  1M8A A;  4CJ0 B;  1ROD A;  1GUW A;  1EQT A;  5JJZ A;  2HDM A;  1G6Z A;  1LV9 A;  2NZ1 D;  1HUN A;  1MSH A;  2X69 A;  4QUC A;  3I90 A;  5CBE E;  2B2U C;  4ZAI A;  3ONA B;  1ML0 D;  1MI2 A;  4IUT A;  1IKL A;  4O42 A;  1RHP A;  2KEE A;  5T1I A;  2KOL A;  1BF4 A;  4HSV A;  3F2U A;  3FPU B;  1AZQ A;  1RTN A;  1DOK A;  1E0B A;  3TN2 A;  1O80 A;  1U4P A;  4DN4 M;  1CA6 A;  1B53 A;  2K05 A;  4ZKB B;  2MPM A;  1J8I A;  2SDF A;  4ZLT F;  1ILP A;  5CBA E;  5E4W C;  4R8I A;  2FFK B;  1VMC A;  4R9W A;  1HRJ A;  4IUQ A;  3IFD A;  5COR A;  4ZKC B;  2K1B A;  3DEP A;  1RTO A;  2EE1 A;  1NR4 A;  2MP1 A;  2HDL A;  4XT3 B;  2B2T C;  3SVM A;  5EJW A;  3KBX A;  5AFW A;  1O7Z A;  2B2W C;  2BDN A;  2MJ8 A;  2RSN A;  1WVL A;  3Q6S A;  2KVM A;  2KUM A;  2H1E A;  2X6G A;  1QG7 A;  2CVR A;  1VMP A;  2FHT A;  1ESR A;  2KED A;  3FDT A;  2VXW A;  4RWS C;  1QE6 A;  5COY A;  5EPJ A;  5EPK A;  5CMD A;  1WD1 A;  4RAU C;  2FMM A;  1DOL A;  1X3Q A;  2L9H A;  4IUP A; 
#chains in the Genus database with same CATH topology
 4ZK9 B;  2VUM H;  1QVG A;  1UEB A;  1WTR A;  1L1O B;  2ZJR A;  4OO1 G;  2B63 B;  2PW7 A;  5ELC A;  2K75 A;  2Z4H A;  3I3C A;  3NUC A;  3K7U C;  4BY7 H;  1BNZ A;  3K57 A;  2RDF A;  1B4O A;  3TS0 A;  1SJE D;  4IFD J;  4RFB A;  2MO1 A;  3D6W A;  1PYS B;  4FF4 A;  2F0I A;  5M5Y H;  3I91 A;  4DV0 L;  1H9R A;  2A6H D;  2TMP A;  1F9R A;  2IHE A;  1WTW A;  3K6O A;  1ET6 A;  2N78 A;  2J7Z A;  1H9M A;  1Q3L A;  1Z6H A;  3EIV A;  4JYA L;  4XDX A;  1IBL L;  1DXM A;  2PI2 A;  1EWC A;  2EY1 A;  1ICW A;  3ERO A;  4I65 A;  4HJ8 A;  3S1N H;  4DAM A;  4L5Q A;  4L5S A;  4FF3 A;  1E24 A;  1FGB D;  5H1S E;  1KDA A;  2EYO A;  1PVO A;  1N33 L;  4I7A A;  1LLR D;  4DFA A;  3V96 A;  1IYU A;  4OIK A;  1CI3 M;  1CKN B;  2AUK A;  2VQF Q;  1GUO A;  3KDF A;  4HCS A;  2F0P A;  2F1M A;  1BUV T;  2NUC A;  2NZ1 D;  2OTJ A;  5I6Y A;  4LF7 Q;  2I07 B;  1EQV A;  3CC2 A;  5DAU A;  1SNP A;  4GOP B;  3M3Y H;  1R9T H;  1IXR A;  4N9T A;  4JI8 L;  5C3E G;  2SEB D;  3G4S A;  3Q8D A;  5C0X G;  5IP7 G;  1O78 A;  2F0Q A;  5IY0 A;  5E4W C;  1QWY A;  4OON A;  4DF7 A;  2RDG A;  1Y8N B;  5A2Q L;  2D5D A;  3CCM A;  4B3R L;  5IGB A;  1KAA A;  4H44 C;  1HNZ L;  3S15 H;  1C4Q A;  3DWQ A;  2E2H B;  3GP7 A;  3GTK H;  3C1E A;  2F0G A;  1GJX A;  2Z8L A;  4C2M H;  1TWH H;  1EFW A;  3BZC A;  4J1M A;  2LXK A;  4B3R Q;  3MXN A;  2CH4 A;  4P2C B;  5NUC A;  4A3K G;  3EA6 A;  5GRO A;  2KHS A;  3I73 A;  1DON A;  4DV5 L;  1STH A;  2HUG A;  2Y0S B;  3CC4 A;  1BCP D;  3VR2 A;  4FF1 A;  3UI2 A;  2VZA A;  1WTP A;  2D0P A;  1SMX A;  2N88 A;  3CKI B;  4H02 A;  4NP5 A;  1WTX A;  4HMJ A;  4YIJ A;  1QCB D;  2RCF A;  4XYO A;  3Q0A A;  1B1Z A;  2HCI A;  2PMZ B;  5D14 A;  3RLN A;  4HJ7 A;  2A6H C;  2JEA I;  4PG3 A;  1B7Y B;  3N52 A;  2V4D A;  4DV5 Q;  1PTO H;  3EBE A;  3J7A 5;  1X32 A;  2I5M X;  4BBR B;  1D7Q A;  5LMN L;  5DNF A;  3SEB A;  4DV3 Q;  1SBB B;  3EN2 A;  3GQB A;  2MFI A;  2Z0S A;  4OO1 H;  2LS0 1;  2EJF C;  1MJE A;  1HNZ Q;  4A3L G;  1AN8 A;  1SYC A;  4LF6 Q;  4DR1 Q;  5EPL A;  3K7A B;  4B9X A;  1IBL Q;  4Y52 H;  4LK1 C;  1LTT D;  4YCW A;  4LF5 L;  4RH6 A;  4DU9 A;  1MJC A;  2QF7 A;  3NQT A;  2YYZ A;  1I3Q B;  1SR3 A;  3MFG A;  2LKV A;  4X65 L;  1J5E L;  2O4X A;  2CFM A;  3CQZ H;  4JI8 Q;  1FJG L;  4GZY C;  1CFM A;  3PF5 A;  1G6Z A;  3TDQ A;  4RGM A;  4BY1 B;  4KN7 C;  2UXD Q;  2F0E A;  1B70 B;  5CBE E;  3S17 B;  3GTM H;  1OXT A;  3DMU A;  1ENF A;  3E3X A;  2F3V A;  2R7Z G;  4DAY B;  1STB A;  2PZU A;  2AMC B;  4BY1 H;  2B39 A;  4A3D H;  3TN2 A;  4JVZ A;  3PIO A;  4DV3 L;  5M5X H;  1MD2 D;  1VF7 A;  3MAQ A;  2GVA A;  4DV6 L;  1N33 Q;  2FFK B;  2Z9H A;  4IUQ A;  1N34 L;  4GN4 B;  3KYH C;  1Y1W H;  4XTC S;  1JC7 A;  3TRE A;  5EJW A;  5FLX L;  3T56 B;  3J80 L;  1F2Y A;  5IYC H;  4A3E G;  1QG7 A;  1KRS A;  1EQQ A;  4BY1 G;  3FDT A;  5K5P A;  3BU2 A;  4A3B G;  2E75 C;  1XPO A;  5I4D A;  1YNJ C;  4A3I H;  4B3T L;  3G7L A;  3Q24 A;  1EY9 A;  1EIY B;  2H5X A;  4A3F B;  2LY7 A;  2EJG C;  4DA2 A;  1VF5 C;  3IL8 A;  1SYD A;  2PQA B;  5EBD A;  4LF5 Q;  2ALY B;  4MIU A;  2LMC B;  5IT9 E;  3I8Z A;  2OWO A;  3KLR A;  2Q2I A;  2EY2 A;  5FO7 B;  4GKK Q;  4LFC L;  5C4H A;  4RGT A;  2B2Y A;  4IPH A;  4V19 0;  3CME A;  4HIO A;  3TZU A;  4DNT B;  1M90 C;  2KQ3 A;  2B2T A;  4BBR G;  1TQO A;  3J7Z C;  1XNR L;  2RVL A;  1F2L A;  2YV5 A;  3HOZ B;  2VY3 A;  4YY3 L;  4HMI A;  4F87 A;  1GOZ A;  4WRD A;  1HA6 A;  2R92 G;  1A2U A;  2UXB L;  3HOU G;  4POG A;  5IYD G;  1EUJ A;  1EFI D;  1EQR A;  4K8I A;  3HOY G;  2DGY A;  1TII D;  4H13 C;  2QEX A;  5E7N A;  1PFB A;  1LUZ A;  4Z9C B;  1HFN A;  1STA A;  3A5Z B;  1IYV A;  2QKI C;  2L1B A;  2A69 C;  1G2T A;  4DV1 Q;  1VQB A;  4R4O A;  3CXC A;  1HR0 L;  3D4W A;  4DKA C;  3T1H Q;  1ROD A;  1KHI A;  5JJZ A;  4R4I A;  2Q8I B;  2JN4 A;  2LXJ A;  4RHS A;  1Y69 U;  2PZW A;  3PUW A;  4M1U B;  2SOB A;  2J4X A;  4RKL A;  2WII B;  1E2Z A;  4YCV A;  4O42 A;  5C44 G;  4ZUJ A;  3FPP A;  2RCN A;  4EQP A;  4WJ3 M;  1RTN A;  3H0G B;  3CP0 A;  1HH2 P;  5C5M A;  2DNE A;  3H3V H;  4JYA Q;  4GOP A;  5FKA C;  5ELB A;  3M7N A;  1FGU A;  2Z4I A;  3IFD A;  3RLF A;  3PO3 G;  3HOU B;  4GLA C;  1NR4 A;  3KBG A;  2JA6 B;  4N8X 1;  1SJH D;  1JT8 A;  1BDO A;  4YWM A;  3K7A H;  2OQ0 A;  3MXP A;  3S1N B;  1IW7 D;  3MHB A;  5EPJ A;  4PQX A;  1TWH B;  1UEA B;  2K5H A;  2R6G A;  4OWW B;  3BDL A;  3TP8 A;  3STB C;  2DY7 A;  4AQY Q;  4FYD A;  4JI2 Q;  1IBM Q;  1PZK D;  3A8J E;  2EZV A;  3GTL H;  4UAI A;  1BCP C;  3E9H A;  1X9N A;  2WKD A;  4PNY A;  1SE2 A;  3KF8 B;  3J7A F;  1HHV A;  1SYB A;  2EPB A;  2L0C A;  1FNU A;  2R3Z A;  2B8F A;  4MHE A;  1PTO F;  5GAH C;  2F3I A;  2V1C C;  3S14 H;  1YVC A;  4RCO A;  4LF4 L;  1GD7 A;  3HG9 A;  4X3S A;  1JOR A;  1PH5 A;  3JAM E;  4IUU A;  1WYD A;  4XT1 B;  4CBV A;  4IQZ A;  4KJN A;  1AP0 A;  1EIF A;  1K0R A;  5FO9 B;  1PDQ A;  4RCN A;  4C3H G;  2R92 H;  2F0S A;  5CV5 A;  4ME3 A;  3HEJ A;  2KHJ A;  1RL2 A;  2K5N A;  3KF6 B;  3VYR A;  2QGQ A;  1E7Z A;  3OOC A;  1VS0 A;  4DUZ L;  2PO4 A;  1QZG A;  2KCC A;  2E2H H;  4P75 A;  4A93 B;  2I0Q A;  1YNN D;  1S5B D;  4DV4 L;  3NPP A;  4JI6 L;  5JEA H;  1ZEQ X;  4BBS B;  2NN6 H;  1PZI D;  1DGS A;  2F0K A;  3KOJ A;  5CV4 A;  3ZYY X;  5EAY A;  2AWO A;  2NN6 G;  2Y0S E;  4NB3 A;  2B2U C;  4DV7 Q;  3LGJ A;  4EQO A;  5BN4 A;  1O7I A;  2KOL A;  1BF4 A;  4LW1 A;  5JJI A;  1SFO H;  3AMU A;  3E0J A;  4Q0F A;  1E2V A;  1RIP A;  1AE3 A;  3FKI G;  2F0M A;  4R9W A;  2KCN A;  4KHV A;  1H9K A;  4L6T B;  1JOO A;  5BN5 A;  1VQG A;  1PZJ D;  3I4N G;  3GTQ B;  4XQN A;  4EGV A;  3SVM A;  4B3S L;  2WFW A;  1KLG D;  4RKB A;  1LYL A;  4ODG A;  2JJQ A;  4LF4 Q;  4AYB G;  4RWS C;  5COY A;  2EXZ A;  3PMF A;  2B8G A;  1XTD A;  1BBW A;  1B8A A;  1S4Z A;  3ND9 A;  5C44 H;  3HOW G;  3P75 A;  1AE2 A;  2L4N A;  2RQX A;  3S2D B;  2F0T A;  1UNS A;  1BKB A;  2I5H A;  5D3D A;  2GN5 A;  3DHQ A;  4CKC A;  3D8G A;  2A69 D;  4DR2 L;  3QWN A;  5M5X B;  1CQF A;  3OTO Q;  5JJK A;  5K36 G;  3J7Y W;  5DLQ E;  2WAQ B;  2G5D A;  1HNW Q;  1U9R A;  1VQ6 A;  4OEL B;  1L1O C;  4HAE A;  4U68 A;  1II3 A;  3RUZ A;  1KNE A;  5L37 A;  2JP1 A;  3CCR A;  5C3E H;  3BVZ A;  1KIX A;  3HP3 A;  4DR4 L;  3F2D A;  4HIK A;  1TS4 A;  3CRK C;  3CCU A;  3LWE A;  1JE4 A;  1B9M A;  1QB5 D;  1YNX A;  4CDE C;  2MQH A;  2QA4 A;  1PFN A;  2VB3 X;  2E76 C;  4X62 Q;  3PGZ A;  3PCO B;  1GUG A;  2NZH A;  2A6E D;  3MFY A;  1XMO L;  5C4X H;  4KJO A;  5GAG C;  3KUP A;  4IUR A;  1GO3 E;  3BZK A;  4LFC Q;  2C9O A;  1HTP A;  3FEW X;  4G7O C;  2NVQ H;  2N8N A;  3SK4 A;  3T16 A;  1VQ4 A;  2E5L L;  3HKS A;  1EZ6 A;  1A6X A;  5G3L D;  2WB1 E;  3HRZ C;  2OF1 A;  3WDN A;  2IX0 A;  2E2J H;  1HZB A;  4DXF A;  3EVQ A;  1ML0 D;  2AQ1 B;  4B3T Q;  2K4K A;  5LMU Q;  1YJW A;  4HSV A;  3F2U A;  4L63 B;  2CQA A;  3H0G H;  1LT4 D;  1O80 A;  3X3M A;  1CZW A;  5J39 A;  1AW7 A;  1LTL A;  4KV6 A;  1SNM A;  3SK8 A;  4XIG S;  4JI4 L;  3CU7 A;  3KLS X;  2F03 A;  1PH2 A;  1ZYR C;  1T5E A;  4B3M Q;  4ZCK A;  4KKT A;  1HNW L;  2JQO A;  2CCZ A;  2O5J C;  4GS3 A;  2BDN A;  3Q6S A;  1TS5 A;  3OTO L;  4KHP Q;  1LT3 D;  3F8T A;  4JOI C;  1P8L A;  3F2B A;  4BBS H;  2K5Q A;  1DOL A;  1E3P A;  1X3Q A;  3KLS A;  3QIA A;  4IUP A;  5EKK A;  3U9O A;  4ILW A;  5M9O A;  1TT2 A;  4A3J B;  5LMN W;  1YHB A;  2UXB Q;  5C5L A;  3NEN A;  4DR7 L;  1BVS A;  3AFQ A;  2A19 A;  2JA8 H;  4MNO A;  3PUV A;  4A3F G;  1I6H H;  2CQO A;  3NEM A;  3J81 L;  1KAW A;  4OL7 A;  2N3S A;  1D1I A;  3H09 A;  2JA9 A;  1A62 A;  4KY6 A;  3RN5 A;  3AEV A;  2HD3 A;  3R8B A;  4GKK L;  1B3A A;  4DR1 L;  1V9P A;  1IZ6 A;  1TWC B;  4K5W A;  3JC6 6;  3O13 A;  1ONL A;  3KFU A;  2SNM A;  4QF4 A;  3NTI A;  2ZT9 C;  4NDX A;  5JEA J;  1VQ5 A;  2B63 H;  1H9S B;  2XN9 C;  3BVM A;  1KL9 A;  1IBK Q;  3M4O H;  1EY0 A;  1H9S A;  1T9H A;  3WWV A;  4A3J G;  2EYF A;  4IUV A;  4OIJ A;  3OWE B;  2UXD L;  3CW2 C;  1N34 Q;  1PYW D;  2ZTD A;  2VNU D;  1XWE A;  2YTY A;  2X69 A;  5F2D A;  1VQ8 A;  1EY5 A;  5LMU L;  1NSN S;  1IHZ A;  2F52 A;  3GTJ H;  2F3W A;  1MI2 A;  4IUT A;  1Y1V G;  2KEE A;  2ZXR A;  3EJI A;  5DM7 3;  3CMA A;  3CCL A;  1CKM A;  1U0L A;  4X66 Q;  3BS1 A;  3FKI B;  1Y1V H;  2L5T A;  5C3W A;  1A8V A;  5FLM G;  1TY2 A;  1VMC A;  1D2B A;  4ALP A;  1FJG Q;  1G6P A;  4LF9 Q;  4K2K A;  2A8V A;  4HJ5 A;  4DUY L;  4KKS A;  1VQI A;  2KVM A;  1M1K C;  3ZJY C;  4A75 A;  4YHH Q;  1L0X B;  3A7L A;  3RZO H;  1N9W A;  3T53 B;  5C44 B;  4C56 C;  4G7Z C;  3PIO 3;  4DR4 Q;  2JA7 H;  4X64 Q;  1R9T B;  3GO5 A;  2BH8 A;  2AHO B;  3NHH A;  2K5V A;  5LMN Q;  2A6E C;  5IOD A;  2K52 A;  2I46 A;  3U4V A;  3T51 B;  5FJ8 G;  1TWG H;  2UUB L;  3C3L A;  1JB3 A;  3OHX C;  2ES2 A;  1C8C A;  5KIX A;  5I2Y A;  3A54 A;  3NBH B;  2TSS A;  3A56 A;  1PLF A;  3GTP H;  4QY7 A;  5TSS A;  2NVQ B;  1GUN A;  3S1Q H;  4LUV A;  4RA8 A;  5A2Q E;  1SFO B;  3P7J A;  1STG A;  3AYH B;  3NBI A;  1BR9 A;  3FMC A;  3HGB A;  5C4J B;  3NK9 A;  1EIH A;  2HHH Q;  5I6W A;  4V0B A;  4OWT B;  3DUZ A;  1QOH A;  1F9Q A;  2K7V A;  1VQJ A;  3J7A V;  3H91 A;  4R1J A;  4LJZ C;  1E22 A;  3ND8 A;  1GM5 A;  1EOV A;  2CH4 W;  1ILQ A;  2E2I H;  2XIW A;  2JYO A;  1QNK A;  4IPD A;  2XRS D;  4A3F H;  2NYZ D;  3NBH A;  3VYU A;  4FVM A;  2NB0 A;  2MHV A;  2EIF A;  3VR4 A;  2Z6K A;  3R3O A;  3W3A A;  1MIU A;  3D31 A;  4NKL A;  1LT5 D;  5HUR A;  5HGT A;  1EY6 A;  5IWA Q;  4JPB W;  1HUN A;  1F2Z A;  2UUC L;  3BG3 A;  4AYB B;  3E6Z X;  4IN3 A;  4PMW A;  3H15 A;  3L7Z C;  1VQP A;  4ZAI A;  2F4V L;  2R93 G;  1RHP A;  3BYY B;  1Z9F A;  3GTG H;  3HKZ E;  3FPU B;  4E6I A;  4K6L A;  1XTC D;  4A4I A;  2H4O A;  2JK8 A;  2JA5 G;  1PTO D;  2PI2 E;  5LL6 X;  1CT1 D;  4ZLT F;  3UDI A;  4ZKC B;  1SYG A;  2DN8 A;  3NTK A;  4IOC A;  5FLX E;  2PPB C;  4JBM A;  1JJC B;  2QDL A;  1SNC A;  2VW9 A;  2B2T C;  4UP7 A;  2E8G A;  2OEO A;  2E74 C;  4P73 A;  4BWG B;  3U9S A;  3NTH A;  2KUM A;  4KK7 A;  4A3K H;  3GTO B;  2AKW B;  4JBW A;  4RGO S;  1I6V C;  2KED A;  1PRT F;  2FHT A;  2VXW A;  1ASZ A;  4OXP A;  3FRP B;  4FXK C;  1VQ7 A;  3NE5 B;  2R7Z B;  2AWN A;  4Q5V A;  5M5W B;  2NTT A;  1WTV A;  4OWX B;  1J6Q A;  4JCV E;  4C1N I;  3M4P A;  2OXP A;  3WOE A;  2ICE C;  4QB4 A;  4OEM B;  3UE1 A;  3BJU A;  5FK9 C;  1NR2 A;  3KLW A;  4YWK A;  3J80 c;  3CD6 A;  2F0N A;  1KQS A;  2EQS A;  4KI0 A;  1IL2 A;  1DD2 A;  5ELD A;  3VR5 A;  4I7Z C;  3L3O C;  1RCV D;  4UY8 C;  4C2M B;  3AQQ A;  1NBW A;  4JI5 L;  3A5U A;  1S40 A;  2UUC Q;  2ZJQ A;  4DV7 L;  4A3G B;  2WIN B;  1N32 Q;  4R4C A;  2K01 A;  3NWT A;  1EWH A;  3RLO A;  5IIF A;  1LTR D;  4FO2 A;  4L8J A;  1Q1E A;  1JB7 A;  1HNX L;  4A3G H;  1HJP A;  4OGQ C;  3UDF A;  1Q86 C;  1NCV A;  1MSG A;  1RJT A;  3RR5 A;  4HJ9 A;  3GV6 A;  4LFA L;  1M8A A;  4PZ7 A;  4A3M H;  4JI3 L;  3S1R B;  1K8O A;  5C4Z A;  2CKZ B;  4Y7N H;  4A3E B;  4BY7 G;  3STB D;  3J81 i;  1GHJ A;  4A3M G;  2K14 A;  4MZ9 A;  2R7F A;  3GTJ B;  1PH6 A;  4EQ5 A;  4A3D G;  2C5C A;  4B9W A;  1JOQ A;  1SEB D;  5T1I A;  3OSO A;  5BN3 A;  2BCO A;  2XVS A;  4NXN L;  1I94 L;  2R93 B;  5E1F A;  1DYQ A;  1Q8I A;  2K05 A;  1STY A;  2MPM A;  3H6M A;  5GAE C;  3K81 C;  3FHW A;  3T4A C;  4DK3 C;  5COR A;  2ICI A;  2K50 A;  2K1B A;  3ULJ A;  2UU9 L;  4AYB E;  4KD3 A;  2F0H A;  1Y14 B;  2P5Z X;  3PF4 A;  1KDC A;  4AIM A;  1CKO A;  4X64 L;  1X54 A;  3A0J A;  3DLL A;  3CF5 A;  2DJF C;  3MVV A;  4U67 3;  4QGU A;  5HGQ A;  5KNB A;  4JI2 L;  2L9H A;  1MHW C;  3D4R A;  1ZKO A;  4GNX B;  1FL0 A;  1SE4 A;  4JI0 L;  1AFP A;  1ESF A;  1HZ9 A;  4KHZ A;  5K36 H;  1OXS C;  1PRT D;  1WTQ A;  5IP9 H;  4A3C H;  3HOX B;  3KF8 A;  5M3F B;  4JV5 L;  1EYD A;  1Q46 A;  5IGE A;  4LF9 L;  5KYI A;  1XNQ L;  3PQI A;  4QIW E;  3DM1 A;  5EQ0 A;  3MWY W;  1CSP A;  5G3L F;  4F8M A;  4R4T A;  1XJV A;  3HKZ B;  4DR2 Q;  4IPG A;  2R93 H;  1C0A A;  1K8G A;  1SE3 A;  1VDZ A;  1L2F A;  2HQE A;  1XMQ Q;  5C0X H;  4DR5 Q;  3NEL A;  3M9B A;  1TXY A;  2B2U A;  4K5V A;  3HOU H;  1MKH A;  3DWA A;  5ISR A;  2OQK A;  3TP7 A;  5C4J H;  1PH1 A;  3M4Q A;  3E5S A;  3OMG A;  1BOS A;  1JR0 D;  1HFG A;  3NP8 A;  1K28 A;  4X3T A;  4PMC A;  3U58 A;  3NSW A;  1U4R A;  4GLV B;  2N55 A;  5C0X I;  3KK7 A;  1I50 H;  3F2C A;  1RKN A;  2A68 D;  2NWG A;  1B44 D;  5CV7 A;  3IKJ A;  2UUA Q;  1KC8 C;  5M5W H;  3TZD A;  5D65 A;  4OX9 L;  1B50 A;  1DOM A;  1TWG B;  1FR3 A;  2JE6 I;  2WAQ G;  2UUB Q;  3D3R A;  4POF A;  1LTS D;  1WTH A;  1QIL A;  5A35 A;  4BY7 B;  1OO9 B;  3GTO H;  1N32 L;  4J15 A;  3S1Q B;  2HDM A;  1XPU A;  5JVH 3;  5IYB H;  3FKI H;  1X3E A;  2RF4 A;  1V1P B;  2JA7 B;  2I5L X;  1EU3 A;  2EDG A;  2JSO A;  3HOW H;  4YHH L;  4KN4 C;  3K0Y A;  1N36 Q;  5JVG 3;  1VQD A;  3L2P A;  2DJG C;  1TY0 A;  1PH8 A;  3CCQ A;  4DUY Q;  4DV4 Q;  2SDF A;  2GVB A;  5ELF A;  1VQO A;  5IYD H;  4K5X A;  2EYM A;  3I7F A;  2E2I B;  4BA2 I;  1RTO A;  4HN7 A;  4F7X A;  2D2C C;  2HDL A;  5D3I B;  1K83 H;  1EY8 A;  3MEH A;  1YZ6 A;  4PMB A;  3K5N A;  4NXM Q;  1PXU A;  1LAC A;  1ICF B;  4DR3 L;  1S3O A;  3C1F A;  1U5K A;  2B63 G;  2JA8 G;  4IAL A;  5FLX c;  3CAM A;  4DGZ A;  2B2V C;  1NMG A;  5CGK A;  2VL6 A;  3GTG B;  4RGN A;  1N36 L;  2JXM B;  1X3P A;  3I2Z A;  3R93 A;  2L12 A;  4B3M L;  1YJN A;  4FDB A;  3GD7 A;  3LWU A;  4A93 H;  1SRO A;  5T1G A;  4QIW B;  3W2D A;  2O2L D;  2PZT A;  1C7Y A;  2K33 A;  4WJ4 A;  3TP6 A;  2F4V Q;  4HCE A;  1CA5 A;  1KLU D;  3MXN B;  3V05 A;  1IKM A;  2ATW A;  4IPC A;  1SSO A;  3D6C A;  3HOZ H;  4CJ1 B;  1YJ9 A;  1NUC A;  1PTO B;  1Q1B A;  1I4P A;  4NXM L;  1Z7T A;  4FF2 A;  1SDF A;  1WI5 A;  2F0L A;  1EWI A;  5KND A;  4ME5 A;  1XPR A;  1W6K A;  5IP9 G;  4HED A;  3IAY A;  1GXD C;  5C0X J;  1U4M A;  5FO8 B;  1Y8O B;  3GDE A;  1ZYR D;  1PH9 A;  4X65 Q;  1J5E Q;  1G51 A;  2NN6 I;  1AZP A;  1YBY A;  5JOB A;  4LUO A;  4C3J G;  2ZM6 L;  4TKO B;  1TS3 A;  4LAA A;  3PSI A;  1EQT A;  1ET9 A;  3G6E A;  4JI7 Q;  3S14 B;  2JA7 G;  4IUN A;  5EBC A;  2NVX H;  5C3E B;  3GTL B;  1HTL D;  3PO2 H;  2F0O A;  1H95 A;  5ELO A;  3VR6 A;  4JBK A;  3V2T A;  3HOX G;  3HS0 C;  1SND A;  3T1H L;  3A8I E;  2CW0 D;  2HIX A;  1G29 1;  4C3I B;  3K59 A;  3SHL A;  2VQF L;  2JA6 H;  2QW7 A;  4OX9 Q;  5CBA E;  2OT2 A;  1FVI A;  1PMR A;  5CYU A;  4H7B A;  3H3V I;  3H3V C;  2EE1 A;  4JI4 Q;  1QUQ B;  1EYA A;  1PFS A;  2EY6 A;  4XYQ A;  2MJ8 A;  3SR1 A;  3OWF A;  4HR7 B;  4PZ8 A;  4O0A A;  1VQH A;  1M4V A;  1WCM B;  2WP8 J;  3DWP A;  3DXJ C;  1TWF B;  1LTG D;  1N8R C;  4DV2 Q;  4LNQ A;  3S16 H;  4UP8 A;  3P1H A;  3T13 A;  4DAY A;  3ULL A;  1LTA D;  4IFD G;  1R4P B;  1UAP A;  1HR0 W;  3MZ5 A;  4UP9 A;  2A68 C;  2PCF B;  3ERQ A;  4DR5 L;  1DZ1 A;  2J0T D;  1UE6 A;  2EOT A;  3N6R A;  3PIP 3;  3L9A X;  4P71 A;  4M8A A;  1F9S A;  1CUK A;  4ULL A;  4ABN A;  3KDF B;  2QIL A;  3L0O A;  3K5O A;  4RMF A;  3HOW B;  1I4X A;  4QQB X;  5IT9 L;  1XNQ Q;  3GV3 A;  3G48 A;  1HZA A;  1X56 A;  4BS9 A;  2K03 A;  5M3F G;  2Q2H A;  1Q12 A;  1HPC A;  2AUJ D;  3FVQ A;  3PUY A;  3SK6 A;  4N8F A;  3TME A;  4QCL A;  2VQE Q;  5IGG A;  3I4N H;  1K9M C;  4B3S Q;  4OO1 I;  4L5T A;  1JCK B;  1Y1W G;  4ZYS A;  1K73 C;  4DAP A;  3J81 j;  1WTO A;  3Q23 A;  4F88 A;  4X3K A;  5M3M B;  2MNA A;  1B2T A;  5IGD A;  1TS2 A;  1S72 A;  5KNC A;  4RHR A;  5M3F H;  5C4X G;  2F0W A;  2B29 A;  4JW0 A;  2QCP X;  2Q8T A;  2BE5 C;  2M2L A;  3S15 B;  5ELE A;  3DEO A;  5I9P A;  3OIQ A;  4LMQ D;  2YU9 B;  1TR5 A;  1OXV A;  4DNR B;  2RHQ B;  2AQ3 B;  3U50 C;  1I3Q H;  1I94 Q;  2NVT H;  1STE A;  2K5D A;  1HCZ A;  1LTI D;  1GUW A;  1PRT B;  3OPO A;  4LFB L;  3VYS A;  1FNV A;  2HQL A;  1ENA A;  2XWB B;  2Z6K C;  3ULP A;  5CV6 A;  4P72 A;  1CTM A;  1BCP B;  3SXH A;  1Q82 C;  4WOR A;  5KGU A;  1DOK A;  3VA7 A;  1IW7 C;  1JWS D;  1U4P A;  3T1Y L;  1V1P A;  1VQM A;  3GTQ H;  1JOK A;  5DM6 3;  3C2P A;  5FJ8 H;  1I6H B;  4BXX H;  1AEX A;  4HJA A;  2JA5 B;  2R7D A;  5GAD C;  5M3M G;  1K0S A;  4MTK A;  2R61 A;  4LF6 L;  4XT3 B;  1L0Y B;  1K3B C;  1Y8P B;  1GHK A;  2RSN A;  4IOA A;  4CKB A;  3TBI B;  1PTO C;  3A7A B;  1ESR A;  2B3G A;  4CDC C;  5I9O A;  5EPK A;  1YIT A;  3MA2 B;  3RZO B;  1W2B A;  4CHT B;  4GKJ L;  4ID6 A;  1QZH A;  3TS2 A;  4JI1 Q;  2ID0 A;  2MUY A;  2K6A A;  3K5L A;  3FP9 A;  1S5C D;  1L1O A;  1NY4 A;  4N9P A;  4C3J H;  5JEA G;  3W1B A;  1DJR D;  2SNS A;  2PMZ E;  1TVX A;  1UE5 A;  4O2D A;  5J3B A;  1EEF D;  4HSP A;  5JPM C;  3QR8 A;  3NWS A;  3SK5 A;  1PH4 A;  1CHP D;  2KHI A;  3M7G A;  1WD0 A;  1G2S A;  1JQY D;  1U4L A;  1LM0 A;  1XX8 A;  2FMC A;  4C3I G;  3MXG A;  2ZJP A;  1R4Q B;  1YIJ A;  3K80 C;  4LF8 L;  3URY A;  1S5F D;  3QO2 A;  5JPN C;  1C9O A;  5C6A A;  4QJF A;  1PH7 A;  1B3Q A;  1KNA A;  2MO0 A;  4K8J A;  4HID A;  3UE0 A;  3ERS X;  1JIC A;  1A15 A;  2CWA A;  5BR8 L;  1I4R A;  3MEF A;  3NQI A;  3M4O B;  4IFD I;  5GQO A;  1D8L A;  1F9P A;  2EYJ A;  3AFP A;  4FXG C;  1QNU A;  2FIN B;  3S9W A;  3RZD H;  3VYT A;  3CQZ B;  1OTC A;  1SNO A;  2NVY B;  4A3C G;  1HNX Q;  3I4O A;  4KMU C;  3I90 A;  2WAQ E;  3TP5 A;  3S17 H;  2PNR C;  2K5W A;  5FOB B;  1E1T A;  1A3T A;  3A8K E;  4A3B H;  2UU9 Q;  2WB1 G;  1PYB A;  5BR8 Q;  5KRU A;  2BA0 A;  1V1Q A;  2A1A A;  4YCU A;  1HQM C;  4JG2 A;  3SDZ A;  3BVG A;  1KAB A;  3HOV H;  5IOC A;  4JI7 L;  5E3F A;  3B6Y A;  5J22 A;  3Q22 A;  1X3F A;  2PQA A;  3HOV G;  1NNX A;  2B2W C;  1V43 A;  2IHF A;  2JA5 H;  5FLM H;  1DM0 B;  1YI2 A;  1BXT A;  1WCM H;  1WOC A;  2CVR A;  3I4M G;  4A3J H;  3W1G A;  1Q8K A;  1HA5 A;  4DNI A;  1A3V A;  2K32 A;  1SN8 A;  3I55 A;  3CC7 A;  5HY6 A;  2F0U A;  1X65 A;  1GUT A;  1XXG A;  3OYY A;  3I70 A;  4X66 L;  1QJO A;  2DNC A;  4APV A;  2IL8 A;  1HR0 Q;  2O5I C;  1HUM A;  4YWL A;  1BCP F;  4DXG A;  3SE0 A;  3F1Z A;  5EKI A;  3DM3 A;  3RN2 A;  1WJJ A;  1B9N A;  2KEN A;  1K8A C;  1KD1 C;  1YHQ A;  1DCZ A;  3BYT B;  3PV0 A;  4K2L A;  4NPS A;  3VDY A;  3HOY H;  1STN A;  2IX1 A;  4R4Q A;  3OW7 A;  3ICE A;  2RBM A;  2RA4 A;  2KCT A;  5M3M H;  4A3I B;  2ZXP A;  1Y1W B;  4NW2 A;  4IJL A;  1NTG A;  5DEH A;  3S24 A;  2ENB A;  1LT6 D;  2VUM G;  1I4G A;  3G6J B;  4ZQ3 A;  1NAP A;  1F77 A;  2NZO A;  3VA5 A;  2K04 A;  5CC4 A;  4WJW A;  2YU9 H;  1HRJ A;  1X55 A;  4DR6 Q;  1TKW B;  4J8Q A;  1KXL A;  2WKC A;  2WAC A;  2IWH A;  4JOI A;  4CGY B;  1SRU A;  4XQQ A;  1QVC A;  1VQL A;  4CJ0 B;  1TWF H;  2RHS B;  3TEH B;  4H0L C;  1V8Q A;  5IGF A;  1Q90 A;  3IRB A;  4DK6 C;  1A0I A;  2M00 A;  1CZG A;  4FXD A;  4LWC A;  2GA4 B;  4QMG A;  2CHB D;  4G7H C;  1UE7 A;  4DN4 M;  4DV2 L;  1VQN A;  4UDU C;  4A3L H;  3A74 A;  1CQV A;  3WOF A;  1ILP A;  4LFB Q;  3HOV B;  3S2H H;  1VQ9 A;  2XWJ B;  4DV6 Q;  3HKZ G;  1ASY A;  1IBM L;  3PO3 H;  2EXD A;  2VQE L;  4AQY L;  4G57 A;  2X6G A;  1O7L A;  1QE6 A;  5C4X B;  1RDP D;  4Y7N B;  4A3E H;  1FYC A;  3JAM L;  2BH2 A;  3I4M H;  1D5X C;  2XNA C;  2R7Z H;  4ZRZ A;  1KTK A;  4ZUI A;  1TWA B;  5IE8 A;  1GKH A;  1PFM A;  1SLJ A;  2Q8R E;  3VR3 A;  1PH3 A;  2F0V A;  1E1O A;  1NJI C;  4MN3 A;  2A5H A;  3LNN A;  4GOP C;  2ZM6 Q;  2F4I A;  2DY8 A;  3HOZ G;  1CSQ A;  5CV8 A;  1J9O A;  4S3S A;  3K5M A;  3EQL C;  2PNH A;  4DR7 Q;  1AH9 A;  3H0G G;  2QDB A;  3MXU A;  3EFX D;  3ITP A;  1T5X D;  1V1O A;  1EL0 A;  3PUZ A;  3RD4 A;  2AQ2 B;  3P20 A;  2FXQ A;  4TRD A;  4EX5 A;  3J81 c;  4JK1 C;  4TSS A;  3K8A A;  1EY7 A;  1MGS A;  4CJ2 C;  1I5F A;  1X6O A;  3PO3 B;  2F0D A;  4LF7 L;  2RSO A;  3NXW A;  2Y0S G;  3M85 A;  4CDD C;  4BBR H;  2XGT A;  4DV1 L;  3CCS A;  2D9U A;  4HIM A;  2XRQ D;  4MTN A;  1WCM G;  4A3K B;  1FD7 D;  1TU2 B;  2IPK D;  2IX3 A;  1F2M A;  3CCV A;  5JAV A;  4XXE A;  3UDX A;  1JJG A;  1SXT A;  1D5Z C;  3MTS A;  2G9D A;  3IFT A;  5EGT A;  1QUQ A;  2KCM A;  3UDG A;  3S1R H;  4A3M B;  2EJM A;  2JEB I;  4KY5 A;  2UXC L;  1LV9 A;  2BDO A;  3QJY A;  3BDC A;  4C3J B;  2LSS A;  1NE3 A;  1KRT A;  2EYH A;  3PUX A;  3ONA B;  1JJ2 A;  1SE8 A;  4A3G G;  3RNU A;  2QEJ C;  4TQU S;  1E0B A;  3I72 A;  2KBN A;  3HOY B;  2IW3 A;  1PV4 A;  3I56 A;  3S1M B;  1PHJ A;  1KDB A;  2EYP A;  4CDF C;  5LL6 S;  1JMC A;  1SYF A;  1YNJ D;  5LHY 1;  3D4D A;  4LFA Q;  3K58 A;  5AFW A;  1O7Z A;  2G9H D;  1WVL A;  4WFN 3;  1VCI A;  1VQK A;  4IJH A;  2ZTE A;  2F0F A;  2EVB A;  2PYK A;  2RKS A;  3CCE A;  1VQA A;  4IZ8 A;  5IYC G;  4GN3 B;  2WV6 D;  1D6E C;  4GNX C;  3S16 B;  2E2D C;  3PIP A;  1IBK L;  1K8M A;  3JAM c;  4AH6 A;  1I4Q A;  1A2T A;  1YEZ A;  2IT1 A;  4B08 A;  2NTS A;  3HZX A;  3K0X A;  4DK0 A;  3TRZ A;  1C48 A;  4EQN A;  4KHP L;  4K0K L;  1I4H A;  3C46 A;  1QVF A;  4DR3 Q;  2OTL A;  4LUZ A;  1WFQ A;  3KF6 A;  3QOL A;  4JC0 A;  4DPG A;  4EVO A;  2B2Y C;  2A74 C;  3AB9 A;  4DUZ Q;  3T1Y Q;  3PO2 G;  2BA1 A;  2L11 A;  4NMZ A;  1IL8 A;  3CRL C;  2IJ0 A;  3OIP A;  2X6L A;  3E0E A;  1CK1 A;  3M4Y A;  2VUM B;  1OXX K;  1EIG A;  3X3N A;  2EY5 A;  5J1Z A;  1BQQ T;  2IY5 B;  2VS1 A;  1EEI D;  4C3H B;  4A3I G;  3KJP A;  4DV0 Q;  3S2H B;  1K3R A;  2A73 B;  4OHJ A;  3G71 A;  4KY7 A;  1ENC A;  2B2W A;  1D5M C;  2HIV A;  5CR3 A;  1O7Y A;  1BBX C;  1EU4 A;  5CV9 A;  4GN5 A;  5IYB G;  2WB1 B;  1NMF A;  3I4M B;  1JWU D;  3R2I A;  4QUC A;  2HT1 A;  4JBJ A;  4X62 L;  1D1K A;  2Z6B A;  4TVA B;  1UUP A;  2M9V A;  4G4K A;  4BXX G;  4GLX A;  1IKL A;  1HXY D;  1JE5 A;  4JI0 Q;  4BBS G;  3CCJ A;  3SGI A;  3OMC A;  1EYC A;  3HFZ B;  1Z47 A;  1AZQ A;  2UUA L;  3KJO A;  2UXC Q;  4JI6 Q;  1IYJ B;  1LTB D;  2DUD A;  4FNF A;  3QOJ A;  2OCE A;  1BBU A;  2RDH A;  3CHB D;  4R8I A;  2XTI A;  5IGC A;  3J80 E;  4KLK A;  5IWA L;  2ZTC A;  2C35 B;  5EKL A;  4C3I H;  3ER0 A;  3S1M H;  3KBX A;  5I2X A;  3E9I A;  3GTK B;  2YTV A;  1E2W A;  1RF2 D;  1SMY D;  3A55 A;  2JA6 G;  1YNN C;  1S5E D;  1UWV A;  1H9J A;  1YHA A;  1WD1 A;  1CKN A;  5CMD A;  4IFD H;  4C1N K;  2E5L Q;  4NXN Q;  4RAU C;  2CW0 C;  3MC0 B;  5KEE A;  2NVX B;  1BO0 A;  4P74 A;  2CWP A;  4DAV A;  1Q81 C;  1TWA H;  2Q2U A;  1I50 B;  4IO9 A;  1PA6 A;  2L15 A;  4X3U A;  1XMO Q;  4KTA A;  2PQE A;  2HHH L;  1GVP A;  5ELN A;  1P16 A;  2MGS A;  2HCC A;  2ZXO A;  3AU7 A;  1Q7Y C;  1SYE A;  1XMQ L;  3RMH A;  2B2V A;  1W3S A;  2Z1C A;  1PRT C;  4CKE A;  4L5R C;  3GTP B;  1CHQ D;  5M5Y B;  3M3Y B;  1GUS A;  1CM9 A;  1HQR D;  4FP5 D;  2KEC A;  1EOT A;  4KD4 A;  2ASB A;  2E2J B;  4PZ6 A;  4DK1 A;  1TWC H;  1X3G A;  4BA1 I;  4J6H A;  5AJ3 Q;  4JI1 L;  1EZ8 A;  2VB2 X;  4KKU A;  3JAM i;  1XYI A;  4JV5 Q;  4GKJ Q;  3U4Z A;  2EYL A;  2KA7 A;  5AJ3 L;  3CPW A;  4A76 A;  1G8Z D;  2K28 A;  3CPF A;  3BZD B;  3I4L A;  4JI5 Q;  1LAB A;  3W5O A;  4UHV A;  2FJ2 A;  4XQJ A;  3OW2 A;  1VQE A;  1MBY A;  3J81 E;  1VQF A;  2BOS A;  2R92 B;  3J80 i;  1RD9 D;  3TSS A;  2N49 A;  1OXU A;  1EY4 A;  1LO5 D;  5E4X A;  1SNQ A;  1ZXT A;  1FNW A;  4QL5 A;  1EYG A;  1XNR Q;  1UE1 A;  1SAP A;  2L55 A;  4RG1 A;  4A93 G;  2XSC A;  4K6D A;  4O1N A;  1MSH A;  2D0O A;  3RZD B;  4A3B B;  2F0J A;  3PO2 B;  2NVT B;  1A3U A;  4HTH A;  3GTM B;  2JA8 B;  3R2T A;  2YTX A;  4PV1 C;  2BE5 D;  4R8N A;  4X6A H;  5IP7 H;  2NVY H;  5C3X A;  4LF8 Q;  4A3D B;  1A63 A;  3D0F A;  1W6J A;  1Y1V B;  1CA6 A;  3BDO A;  3QB3 A;  2PW5 A;  1B53 A;  4UPA A;  4ZKB B;  1VQC A;  1J8I A;  1JWM D;  4C3H H;  1K83 B;  4DR6 L;  4JI3 Q;  3DEP A;  5JJL A;  1HZC A;  2NBF A;  2MP1 A;  3QG1 A;  2LFN A;  3LX0 A;  1SMY C;  3TQY A;  1L0W A;  1S5D D;  2D62 A;  2Q2T A;  4K14 A;  2KJX A;  5IT9 c;  3I4N B;  2H1E A;  4GNX A;  1VMP A;  4QUF A;  1G91 A;  3S2D H;  2FMM A;  3HOX H;  4YY3 Q;  5KYL A;  3H94 A;  4K0K Q; 
#chains in the Genus database with same CATH homology
 4ZK9 B;  1WTR A;  4OO1 G;  2B63 B;  2PW7 A;  5ELC A;  2Z4H A;  3I3C A;  3NUC A;  1BNZ A;  3K57 A;  2RDF A;  1B4O A;  1SJE D;  4IFD J;  4RFB A;  3D6W A;  4FF4 A;  2F0I A;  3I91 A;  1H9R A;  2A6H D;  2TMP A;  1F9R A;  1WTW A;  3K6O A;  1ET6 A;  2J7Z A;  1H9M A;  1Q3L A;  1Z6H A;  4XDX A;  1DXM A;  1EWC A;  2EY1 A;  1ICW A;  3ERO A;  4I65 A;  4FF3 A;  1FGB D;  1KDA A;  2EYO A;  1LLR D;  4DFA A;  3V96 A;  1IYU A;  4OIK A;  1CI3 M;  2AUK A;  1GUO A;  4HCS A;  2F0P A;  2F1M A;  1BUV T;  2NUC A;  2NZ1 D;  5I6Y A;  2I07 B;  1EQV A;  5DAU A;  1SNP A;  4N9T A;  2SEB D;  5C0X G;  1O78 A;  2F0Q A;  5E4W C;  1QWY A;  4DF7 A;  2RDG A;  1Y8N B;  5A2Q L;  2D5D A;  5IGB A;  1KAA A;  4H44 C;  1C4Q A;  3DWQ A;  2E2H B;  3GP7 A;  3C1E A;  2F0G A;  1GJX A;  2Z8L A;  4J1M A;  3MXN A;  4P2C B;  5NUC A;  3EA6 A;  2KHS A;  3I73 A;  1DON A;  1STH A;  2HUG A;  2Y0S B;  1BCP D;  3VR2 A;  4FF1 A;  3UI2 A;  1WTP A;  2N88 A;  3CKI B;  4NP5 A;  1WTX A;  4HMJ A;  4YIJ A;  1QCB D;  4XYO A;  3Q0A A;  1B1Z A;  2HCI A;  2PMZ B;  5D14 A;  2A6H C;  2JEA I;  3N52 A;  2V4D A;  1PTO H;  1X32 A;  4BBR B;  5DNF A;  3SEB A;  1SBB B;  3GQB A;  4OO1 H;  2LS0 1;  2EJF C;  1AN8 A;  1SYC A;  5EPL A;  3K7A B;  4B9X A;  4LK1 C;  1LTT D;  4RH6 A;  4DU9 A;  2QF7 A;  3NQT A;  2YYZ A;  1I3Q B;  3MFG A;  2LKV A;  2O4X A;  4GZY C;  1CFM A;  1G6Z A;  3TDQ A;  4RGM A;  4BY1 B;  4KN7 C;  2F0E A;  5CBE E;  3S17 B;  1OXT A;  3DMU A;  1ENF A;  2F3V A;  1STB A;  2PZU A;  2B39 A;  3TN2 A;  1MD2 D;  1VF7 A;  3MAQ A;  2FFK B;  4IUQ A;  4XTC S;  1JC7 A;  5EJW A;  5FLX L;  3T56 B;  3J80 L;  1F2Y A;  1QG7 A;  3FDT A;  5K5P A;  2E75 C;  5I4D A;  1YNJ C;  3G7L A;  3Q24 A;  1EY9 A;  4A3F B;  2LY7 A;  2EJG C;  4DA2 A;  1VF5 C;  3IL8 A;  1SYD A;  5EBD A;  4MIU A;  2LMC B;  5IT9 E;  3I8Z A;  3KLR A;  2EY2 A;  5FO7 B;  5C4H A;  4RGT A;  2B2Y A;  4V19 0;  3TZU A;  4DNT B;  2KQ3 A;  2B2T A;  1TQO A;  2RVL A;  1F2L A;  3HOZ B;  4HMI A;  4F87 A;  1GOZ A;  4WRD A;  1HA6 A;  1A2U A;  1EFI D;  4K8I A;  1TII D;  4H13 C;  1PFB A;  4Z9C B;  1HFN A;  1STA A;  1IYV A;  2QKI C;  2L1B A;  2A69 C;  1G2T A;  3D4W A;  1ROD A;  5JJZ A;  2Q8I B;  4RHS A;  1Y69 U;  2PZW A;  3PUW A;  4M1U B;  2SOB A;  2J4X A;  4RKL A;  2WII B;  1E2Z A;  4O42 A;  4ZUJ A;  3FPP A;  4EQP A;  1RTN A;  3H0G B;  5C5M A;  2DNE A;  5FKA C;  5ELB A;  3M7N A;  2Z4I A;  3IFD A;  3RLF A;  3HOU B;  1NR4 A;  3KBG A;  2JA6 B;  1SJH D;  1BDO A;  3MXP A;  3S1N B;  1IW7 D;  3MHB A;  5EPJ A;  4PQX A;  1TWH B;  1UEA B;  2R6G A;  3BDL A;  3TP8 A;  2DY7 A;  4FYD A;  1PZK D;  3A8J E;  2EZV A;  4UAI A;  1BCP C;  2WKD A;  4PNY A;  1SE2 A;  3J7A F;  1HHV A;  1SYB A;  2EPB A;  2L0C A;  1FNU A;  2R3Z A;  2B8F A;  4MHE A;  1PTO F;  4RCO A;  3HG9 A;  4X3S A;  1JOR A;  3JAM E;  4IUU A;  4XT1 B;  4CBV A;  4IQZ A;  4KJN A;  1AP0 A;  5FO9 B;  1PDQ A;  4RCN A;  4C3H G;  2F0S A;  5CV5 A;  3HEJ A;  3VYR A;  3OOC A;  2PO4 A;  2KCC A;  4A93 B;  1YNN D;  1S5B D;  3NPP A;  5JEA H;  1ZEQ X;  4BBS B;  2NN6 H;  1PZI D;  2F0K A;  3ZYY X;  5CV4 A;  2AWO A;  2NN6 G;  2B2U C;  4EQO A;  5BN4 A;  2KOL A;  1BF4 A;  3AMU A;  3E0J A;  4Q0F A;  1E2V A;  2F0M A;  4R9W A;  2KCN A;  4KHV A;  1H9K A;  4L6T B;  1JOO A;  5BN5 A;  1PZJ D;  3GTQ B;  4XQN A;  4EGV A;  3SVM A;  1KLG D;  4RKB A;  4ODG A;  4RWS C;  5COY A;  2EXZ A;  3PMF A;  2B8G A;  1S4Z A;  3ND9 A;  3P75 A;  2L4N A;  2RQX A;  3S2D B;  2F0T A;  1UNS A;  5D3D A;  3DHQ A;  4CKC A;  3D8G A;  2A69 D;  3QWN A;  5M5X B;  1CQF A;  5K36 G;  3J7Y W;  2WAQ B;  1U9R A;  4HAE A;  4U68 A;  1II3 A;  3RUZ A;  1KNE A;  2JP1 A;  3BVZ A;  3HP3 A;  1TS4 A;  3CRK C;  3LWE A;  1JE4 A;  1B9M A;  1QB5 D;  1PFN A;  2VB3 X;  2E76 C;  1GUG A;  2A6E D;  3MFY A;  4KJO A;  3KUP A;  4IUR A;  2C9O A;  1HTP A;  3FEW X;  4G7O C;  3SK4 A;  3T16 A;  1EZ6 A;  1A6X A;  5G3L D;  3HRZ C;  2OF1 A;  3WDN A;  2IX0 A;  4DXF A;  3EVQ A;  1ML0 D;  2AQ1 B;  4HSV A;  3F2U A;  4L63 B;  2CQA A;  1LT4 D;  1O80 A;  3X3M A;  1CZW A;  5J39 A;  1AW7 A;  4KV6 A;  1SNM A;  3SK8 A;  4XIG S;  3CU7 A;  3KLS X;  2F03 A;  1ZYR C;  1T5E A;  4KKT A;  2O5J C;  2BDN A;  3Q6S A;  1TS5 A;  1LT3 D;  2K5Q A;  1DOL A;  1X3Q A;  3KLS A;  3QIA A;  4IUP A;  5EKK A;  3U9O A;  4ILW A;  5M9O A;  1TT2 A;  4A3J B;  5C5L A;  3PUV A;  3J81 L;  4OL7 A;  1D1I A;  3H09 A;  4KY6 A;  3R8B A;  1B3A A;  1TWC B;  4K5W A;  3O13 A;  1ONL A;  2SNM A;  4QF4 A;  3NTI A;  2ZT9 C;  4NDX A;  5JEA J;  1H9S B;  2XN9 C;  3BVM A;  1EY0 A;  1H9S A;  2EYF A;  4IUV A;  4OIJ A;  3OWE B;  1PYW D;  2VNU D;  1XWE A;  5F2D A;  2X69 A;  1EY5 A;  1NSN S;  1IHZ A;  2F3W A;  1MI2 A;  4IUT A;  2KEE A;  2ZXR A;  3EJI A;  5DM7 3;  3BS1 A;  3FKI B;  2L5T A;  5C3W A;  1TY2 A;  1VMC A;  1D2B A;  4K2K A;  4KKS A;  2KVM A;  1L0X B;  3A7L A;  3T53 B;  5C44 B;  4C56 C;  4G7Z C;  3PIO 3;  1R9T B;  3GO5 A;  3NHH A;  2A6E C;  5IOD A;  2I46 A;  3T51 B;  3C3L A;  1JB3 A;  3OHX C;  1C8C A;  5KIX A;  5I2Y A;  3A54 A;  2TSS A;  3A56 A;  1PLF A;  5TSS A;  2NVQ B;  1GUN A;  4RA8 A;  5A2Q E;  1SFO B;  3P7J A;  1STG A;  3NBI A;  1BR9 A;  3FMC A;  3HGB A;  5C4J B;  3NK9 A;  1EIH A;  5I6W A;  4V0B A;  3DUZ A;  1QOH A;  1F9Q A;  2K7V A;  3J7A V;  3H91 A;  4LJZ C;  3ND8 A;  1ILQ A;  2XIW A;  2JYO A;  1QNK A;  2XRS D;  2NYZ D;  3NBH A;  3VYU A;  4FVM A;  2NB0 A;  2MHV A;  3VR4 A;  3R3O A;  3W3A A;  3D31 A;  4NKL A;  1LT5 D;  5HUR A;  5HGT A;  1EY6 A;  1HUN A;  1F2Z A;  4AYB B;  3BG3 A;  3E6Z X;  4IN3 A;  4PMW A;  3L7Z C;  4ZAI A;  1RHP A;  3BYY B;  3FPU B;  4E6I A;  4K6L A;  1XTC D;  2H4O A;  1PTO D;  5LL6 X;  1CT1 D;  4ZLT F;  4ZKC B;  1SYG A;  2DN8 A;  3NTK A;  5FLX E;  2PPB C;  1SNC A;  2B2T C;  2OEO A;  2E74 C;  4BWG B;  3U9S A;  3NTH A;  2KUM A;  4KK7 A;  3GTO B;  4JBW A;  4RGO S;  1I6V C;  1PRT F;  2FHT A;  2KED A;  2VXW A;  3FRP B;  4FXK C;  3NE5 B;  2R7Z B;  2AWN A;  4Q5V A;  5M5W B;  2NTT A;  1WTV A;  4C1N I;  2OXP A;  3WOE A;  2ICE C;  4QB4 A;  5FK9 C;  1NR2 A;  2F0N A;  4KI0 A;  1DD2 A;  5ELD A;  3VR5 A;  4I7Z C;  3L3O C;  1RCV D;  4C2M B;  4A3G B;  2WIN B;  2K01 A;  3NWT A;  1EWH A;  5IIF A;  1LTR D;  4FO2 A;  4L8J A;  1Q1E A;  4OGQ C;  1NCV A;  1MSG A;  1RJT A;  3GV6 A;  1M8A A;  3S1R B;  1K8O A;  5C4Z A;  4A3E B;  1GHJ A;  3GTJ B;  2C5C A;  4B9W A;  1JOQ A;  1SEB D;  5T1I A;  3OSO A;  5BN3 A;  2BCO A;  2XVS A;  2R93 B;  5E1F A;  1DYQ A;  1Q8I A;  2K05 A;  1STY A;  2MPM A;  3H6M A;  3T4A C;  5COR A;  2ICI A;  2K1B A;  4KD3 A;  2F0H A;  1KDC A;  3MVV A;  4U67 3;  5KNB A;  2L9H A;  3D4R A;  1ZKO A;  1AFP A;  1SE4 A;  1ESF A;  4KHZ A;  5K36 H;  1OXS C;  1PRT D;  1WTQ A;  3HOX B;  3KF8 A;  5M3F B;  1EYD A;  5IGE A;  5KYI A;  3DM1 A;  5EQ0 A;  3MWY W;  5G3L F;  4F8M A;  3HKZ B;  1SE3 A;  1VDZ A;  2HQE A;  5C0X H;  2B2U A;  4K5V A;  3DWA A;  5ISR A;  3TP7 A;  3E5S A;  3OMG A;  1BOS A;  1JR0 D;  1HFG A;  3NP8 A;  4X3T A;  4PMC A;  3NSW A;  1U4R A;  2N55 A;  5C0X I;  3KK7 A;  1RKN A;  2A68 D;  2NWG A;  1B44 D;  5CV7 A;  3IKJ A;  3TZD A;  5D65 A;  1B50 A;  1DOM A;  1TWG B;  1FR3 A;  2JE6 I;  3D3R A;  5A35 A;  1LTS D;  1QIL A;  4BY7 B;  1OO9 B;  3S1Q B;  2HDM A;  5JVH 3;  1V1P B;  2JA7 B;  1EU3 A;  2EDG A;  2JSO A;  4KN4 C;  3K0Y A;  5JVG 3;  1TY0 A;  2SDF A;  5ELF A;  4K5X A;  2EYM A;  2E2I B;  4BA2 I;  1RTO A;  4HN7 A;  4F7X A;  2D2C C;  2HDL A;  5D3I B;  1EY8 A;  3MEH A;  4PMB A;  3K5N A;  1PXU A;  1LAC A;  3C1F A;  4IAL A;  4DGZ A;  2B2V C;  5CGK A;  3GTG B;  4RGN A;  2JXM B;  1X3P A;  3R93 A;  2L12 A;  3GD7 A;  3LWU A;  5T1G A;  4QIW B;  3W2D A;  2O2L D;  2PZT A;  2K33 A;  3TP6 A;  4HCE A;  1CA5 A;  1KLU D;  3V05 A;  1IKM A;  1SSO A;  3D6C A;  4CJ1 B;  1NUC A;  1PTO B;  1Q1B A;  1I4P A;  1Z7T A;  4FF2 A;  1SDF A;  2F0L A;  5KND A;  4ME5 A;  1W6K A;  4HED A;  3IAY A;  1GXD C;  5C0X J;  1U4M A;  5FO8 B;  1Y8O B;  1ZYR D;  2NN6 I;  1AZP A;  5JOB A;  4C3J G;  4TKO B;  1TS3 A;  4LAA A;  1EQT A;  1ET9 A;  3S14 B;  4IUN A;  5EBC A;  3GTL B;  5C3E B;  1HTL D;  2F0O A;  3VR6 A;  3V2T A;  3HS0 C;  1SND A;  3A8I E;  2CW0 D;  1G29 1;  4C3I B;  3K59 A;  3SHL A;  5CBA E;  2OT2 A;  1PMR A;  5CYU A;  4H7B A;  3H3V C;  2EE1 A;  1EYA A;  2EY6 A;  4XYQ A;  2MJ8 A;  3SR1 A;  3OWF A;  4HR7 B;  1M4V A;  1WCM B;  2WP8 J;  3DWP A;  3DXJ C;  1TWF B;  1LTG D;  3P1H A;  3T13 A;  4DAY A;  1LTA D;  4IFD G;  1R4P B;  1UAP A;  3MZ5 A;  2A68 C;  2PCF B;  3ERQ A;  1DZ1 A;  2J0T D;  2EOT A;  3N6R A;  3PIP 3;  3L9A X;  4M8A A;  1F9S A;  4ULL A;  4ABN A;  2QIL A;  3K5O A;  3HOW B;  1I4X A;  5IT9 L;  3GV3 A;  4BS9 A;  2K03 A;  1Q12 A;  1HPC A;  2AUJ D;  3FVQ A;  3PUY A;  3SK6 A;  3TME A;  4QCL A;  5IGG A;  4OO1 I;  1JCK B;  4ZYS A;  4DAP A;  1WTO A;  3Q23 A;  4F88 A;  4X3K A;  5M3M B;  1B2T A;  5IGD A;  1TS2 A;  5KNC A;  4RHR A;  2F0W A;  2Q8T A;  2QCP X;  2BE5 C;  2M2L A;  3S15 B;  5I9P A;  2YU9 B;  5ELE A;  3DEO A;  3OIQ A;  4LMQ D;  1TR5 A;  1OXV A;  4DNR B;  2AQ3 B;  1STE A;  2K5D A;  1HCZ A;  1LTI D;  1GUW A;  1PRT B;  3OPO A;  3VYS A;  1FNV A;  1ENA A;  2XWB B;  5CV6 A;  1CTM A;  1BCP B;  3SXH A;  5KGU A;  4WOR A;  1DOK A;  3VA7 A;  1IW7 C;  1JWS D;  1U4P A;  1V1P A;  1JOK A;  5DM6 3;  3C2P A;  1I6H B;  1AEX A;  2JA5 B;  2R61 A;  4XT3 B;  1L0Y B;  1Y8P B;  1GHK A;  2RSN A;  4CKB A;  3TBI B;  1PTO C;  3A7A B;  1ESR A;  5I9O A;  5EPK A;  3MA2 B;  3RZO B;  4CHT B;  4ID6 A;  2ID0 A;  2MUY A;  2K6A A;  3K5L A;  1S5C D;  4N9P A;  5JEA G;  1DJR D;  2SNS A;  1TVX A;  1EEF D;  4HSP A;  5JPM C;  3NWS A;  3SK5 A;  1CHP D;  3M7G A;  1WD0 A;  1G2S A;  1JQY D;  1U4L A;  1XX8 A;  2FMC A;  4C3I G;  3MXG A;  1R4Q B;  3URY A;  1S5F D;  3QO2 A;  5JPN C;  5C6A A;  1KNA A;  4K8J A;  1JIC A;  1A15 A;  1I4R A;  3NQI A;  3M4O B;  4IFD I;  1F9P A;  2EYJ A;  4FXG C;  1QNU A;  2FIN B;  3S9W A;  3VYT A;  3CQZ B;  1SNO A;  2NVY B;  4KMU C;  3I90 A;  3TP5 A;  2PNR C;  2K5W A;  5FOB B;  1A3T A;  3A8K E;  5KRU A;  2BA0 A;  1HQM C;  3SDZ A;  3BVG A;  1KAB A;  5IOC A;  5E3F A;  5J22 A;  3Q22 A;  2B2W C;  1V43 A;  1DM0 B;  1BXT A;  2CVR A;  1HA5 A;  1A3V A;  2K32 A;  2F0U A;  1GUT A;  1XXG A;  3I70 A;  1QJO A;  2DNC A;  2IL8 A;  2O5I C;  1HUM A;  1BCP F;  4DXG A;  3SE0 A;  5EKI A;  1B9N A;  1DCZ A;  3BYT B;  3PV0 A;  4K2L A;  1STN A;  2IX1 A;  3OW7 A;  2RBM A;  2RA4 A;  4A3I B;  2ZXP A;  1Y1W B;  4NW2 A;  5DEH A;  2ENB A;  1LT6 D;  1I4G A;  3G6J B;  4ZQ3 A;  1NAP A;  1F77 A;  3VA5 A;  2K04 A;  5CC4 A;  4WJW A;  1HRJ A;  1TKW B;  4J8Q A;  2WKC A;  2WAC A;  2IWH A;  4CGY B;  4XQQ A;  4CJ0 B;  4H0L C;  1V8Q A;  5IGF A;  1Q90 A;  2M00 A;  1CZG A;  4FXD A;  2GA4 B;  4QMG A;  2CHB D;  4G7H C;  4DN4 M;  4UDU C;  1CQV A;  3WOF A;  1ILP A;  3HOV B;  2XWJ B;  4G57 A;  2X6G A;  1O7L A;  1QE6 A;  5C4X B;  1RDP D;  4Y7N B;  1FYC A;  3JAM L;  1D5X C;  2XNA C;  4ZRZ A;  1KTK A;  4ZUI A;  1TWA B;  1PFM A;  2Q8R E;  3VR3 A;  2F0V A;  4MN3 A;  2A5H A;  3LNN A;  2F4I A;  2DY8 A;  5CV8 A;  1J9O A;  4S3S A;  3K5M A;  3EQL C;  2QDB A;  3MXU A;  3EFX D;  3ITP A;  1T5X D;  1V1O A;  1EL0 A;  3PUZ A;  3RD4 A;  2AQ2 B;  3P20 A;  4TRD A;  4JK1 C;  4TSS A;  1EY7 A;  1MGS A;  4CJ2 C;  3PO3 B;  2F0D A;  2RSO A;  3NXW A;  3M85 A;  2D9U A;  2XRQ D;  4A3K B;  1FD7 D;  1TU2 B;  2IPK D;  2IX3 A;  1F2M A;  5JAV A;  4XXE A;  1SXT A;  1D5Z C;  3MTS A;  2G9D A;  3IFT A;  5EGT A;  4A3M B;  2EJM A;  2JEB I;  4KY5 A;  1LV9 A;  2BDO A;  3QJY A;  3BDC A;  4C3J B;  2EYH A;  3PUX A;  3ONA B;  2QEJ C;  4TQU S;  1E0B A;  3I72 A;  3HOY B;  2IW3 A;  3S1M B;  1KDB A;  2EYP A;  5LL6 S;  1SYF A;  1YNJ D;  5LHY 1;  3D4D A;  3K58 A;  5AFW A;  1O7Z A;  2G9H D;  1WVL A;  4WFN 3;  1VCI A;  2F0F A;  2EVB A;  2PYK A;  2RKS A;  4IZ8 A;  2WV6 D;  1D6E C;  3S16 B;  2E2D C;  1K8M A;  1I4Q A;  1A2T A;  4B08 A;  2IT1 A;  2NTS A;  3HZX A;  4DK0 A;  1C48 A;  4EQN A;  1I4H A;  3C46 A;  3QOL A;  4EVO A;  2B2Y C;  2A74 C;  3AB9 A;  2BA1 A;  2L11 A;  4NMZ A;  1IL8 A;  3CRL C;  2IJ0 A;  3OIP A;  2X6L A;  1CK1 A;  3M4Y A;  2VUM B;  1OXX K;  1EIG A;  3X3N A;  2EY5 A;  5J1Z A;  1BQQ T;  1EEI D;  4C3H B;  3S2H B;  2A73 B;  4OHJ A;  4KY7 A;  1ENC A;  2B2W A;  1D5M C;  5CR3 A;  1O7Y A;  1BBX C;  1EU4 A;  5CV9 A;  2WB1 B;  3I4M B;  1JWU D;  3R2I A;  4QUC A;  1D1K A;  1UUP A;  2M9V A;  4G4K A;  1IKL A;  1HXY D;  1EYC A;  1AZQ A;  1Z47 A;  3OMC A;  1LTB D;  4FNF A;  3QOJ A;  2RDH A;  3CHB D;  4R8I A;  5IGC A;  3J80 E;  5EKL A;  3KBX A;  5I2X A;  3GTK B;  1E2W A;  1RF2 D;  1SMY D;  3A55 A;  1YNN C;  1S5E D;  1H9J A;  1WD1 A;  5CMD A;  4IFD H;  4C1N K;  4RAU C;  2CW0 C;  3MC0 B;  5KEE A;  2NVX B;  1BO0 A;  4DAV A;  1I50 B;  4X3U A;  4KTA A;  2PQE A;  2MGS A;  2HCC A;  2ZXO A;  3AU7 A;  1SYE A;  3RMH A;  2B2V A;  2Z1C A;  1PRT C;  4CKE A;  3GTP B;  1CHQ D;  5M5Y B;  3M3Y B;  1GUS A;  1CM9 A;  1HQR D;  4FP5 D;  2KEC A;  1EOT A;  4KD4 A;  2E2J B;  4DK1 A;  4BA1 I;  4J6H A;  1EZ8 A;  2VB2 X;  4KKU A;  1XYI A;  2EYL A;  2KA7 A;  1G8Z D;  2K28 A;  3I4L A;  3BZD B;  1LAB A;  2FJ2 A;  4XQJ A;  1MBY A;  3J81 E;  2BOS A;  2R92 B;  1RD9 D;  3TSS A;  1OXU A;  1EY4 A;  1LO5 D;  5E4X A;  1SNQ A;  1ZXT A;  1FNW A;  1SAP A;  2L55 A;  2XSC A;  4K6D A;  4O1N A;  1MSH A;  3RZD B;  4A3B B;  2F0J A;  3PO2 B;  2NVT B;  1A3U A;  4HTH A;  3GTM B;  2JA8 B;  3R2T A;  4PV1 C;  2BE5 D;  4R8N A;  5C3X A;  4A3D B;  1W6J A;  1Y1V B;  1CA6 A;  3BDO A;  3QB3 A;  2PW5 A;  1B53 A;  4ZKB B;  1J8I A;  1JWM D;  1K83 B;  3DEP A;  2NBF A;  2MP1 A;  3QG1 A;  2LFN A;  3LX0 A;  1SMY C;  1S5D D;  2D62 A;  4K14 A;  2KJX A;  3I4N B;  2H1E A;  1VMP A;  4QUF A;  1G91 A;  2FMM A;  5KYL A;  3H94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...