1EYDA

Structure of wild-type s. nuclease at 1.7 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eydA00
3SK8A 2F0SA 4J1MA 4J6HA 4K2KA 2EY2A 4F7XA 2EYFA 2F0PA 2PZTA 2F0HA 1ENAA 4QF4A 2F0OA 5C3XA 1EY7A 4K5WA 3T13A 4QB4A 3D8GA 2F0MA 5CV5A 5I6WA 1SNPA 2F3WA 3D4WA 3OWFA 4S3SA 5K5PA 1SYCA 4LAAA 4B9WA 2F0JA 5IGEA 1SYGA 3RUZA 1F2ZA 4K5XA 4N9PA 5KEEA 3HZXA 5M9OA 5J39A 3C1FA 1F2MA 3NUCA 4KJOA 3VA5A 5IGFA 1EY9A 2EY1A 5EKLA 1EYAA 2OF1A 1F2YA 3T16A 1JOOA 5CGKA 5IGDA 2F0TA 2F0UA 2F0EA 4K6DA 3TP6A 1NUCA 2LKVA 3EVQA 2O4XA 1EY8A 3P75A 2PZUA 1KAAA 4H7BA 5IODA 4EQNA 3H6MA 2F0KA 4I65A 1NSNS 1STAA 3TP5A 3D4DA 5F2DA 5KIXA 1STYA 4KV6A 4TRDA 4K5VA 5IIFA 1EYDA 3BDLA 5C5MA 1STBA 3R3OA 2F0NA 1SYDA 2EYHA 4DGZA 5C4ZA 4KD3A 3SR1A 2F0QA 4K2LA 5KYLA 4IALA 5CV8A 4HMIA 3TP8A 4ID6A 3QB3A 4K8JA 4G57A 1EZ6A 3S9WA 3MVVA 1SNCA 2F0DA 2QDBA 3D6CA 4KY6A 5JAVA 5CC4A 3NXWA 4HTHA 3NQTA 3ITPA 5IGGA 4N9TA 3QOLA 2F0VA 2SNMA 3DHQA 1SNDA 1KDBA 1STNA 3EROA 3EJIA 3NK9A 3P1HA 2EY5A 3MHBA 4EQPA 5C3WA 1JOQA 2F0GA 2KQ3A 4RKLA 4EVOA 5HURA 1SNMA 3LX0A 2WACA 3OSOA 1A3UA 5EGTA 4ODGA 5I9PA 1KDAA 3E5SA 3SHLA 1EY5A 2HQEA 1A2UA 1SNQA 4WRDA 4F8MA 5C6AA 3C1EA 2F0WA 3OMCA 4EQOA 4PMCA 2SOBA 4NP5A 4YIJA 1IHZA 3ERQA 4ME5A 5HGTA 1A2TA 1STGA 4K14A 4K8IA 2RDFA 5DAUA 4OL7A 4E6IA 5IGCA 1SYEA 3SK6A 4DF7A 3BDCA 1JOKA 2PW7A 4ZUIA 4RKBA 5IGBA 1SNOA 4ZQ3A 5KYIA 1EZ8A 4NMZA 2PZWA 5C4HA 2PW5A 2F0IA 2RBMA 2EYLA 2PQEA 1U9RA 3NP8A 4DFAA 2RKSA 2M00A 1EY4A 3DMUA 5I9OA 5IOCA 5J22A 2NUCA 4KD4A 4KHVA 1ENCA 2F0FA 2OEOA 5E1FA 5JOBA 4NDXA 2EY6A 2EYJA 1TR5A 5CV6A 3NHHA 5E3FA 3MEHA 4WORA 4ZUJA 1TT2A 5EKKA 3SK5A 2EXZA 4MIUA 3V2TA 1KABA 1II3A 3OMGA 3PMFA 5KRUA 1TQOA 5CV9A 4HMJA 4IUNA 5I6YA 2EYOA 5DEHA 4PNYA 4KJNA 4DU9A 1AEXA 1RKNA 5J1ZA 1EY0A 3MXPA 5CV4A 5KGUA 2EYPA 1KDCA 2F0LA 1EQVA 1SYFA 2PYKA 3HEJA 4KY7A 5ISRA 1SYBA 4KY5A 4KTAA 5C5LA 4PMBA 4B9XA 3SXHA 3TP7A 5NUCA 4NKLA 4QMGA 3QOJA 2SNSA 4IZ8A 3TMEA 5CR3A 3U9OA 3SK4A 3MZ5A 4R8NA 2F3VA 1A3VA 1EYCA 1EY6A 2ENBA 2KHSA 1JORA 2OXPA 1A3TA 5CV7A 1STHA 2EYMA
chains in the Genus database with same CATH superfamily
2JXMB 4I7ZC 4HAEA 3CPWA 4GNXB 4OO1I 1WD0A 4N8FA 2H4OA 3P7JA 2KA7A 1NMFA 4P72A 1D2BA 3OOCA 1W2BA 1DXMA 3D4RA 5E4XA 1WD1A 2NWGA 4KJOA 4A3BG 5EKLA 3A7LA 3C2PA 5IGDA 1UUPA 4FYDA 4GZYC 1B8AA 2IX1A 5EQ0A 1Q3LA 3P75A 5FLMH 2L12A 4M8AA 5F2DA 2B29A 4TRDA 2WKCA 1KL9A 1EYDA 1CSPA 4KK7A 3VYUA 1QJOA 1HTPA 1DJRD 4K2LA 1YEZA 1PTOD 2JA7H 1Q8IA 1YJWA 1SEBD 4A3BB 3GQBA 3I4MG 2HT1A 3N6RA 1H9SA 2SEBD 1CUKA 3VR5A 3NQTA 4JI4Q 1BXTA 1STNA 1F77A 1Y8OB 1LLRD 3DEOA 1Y1WH 1D6EC 1VS0A 4NPSA 1TS4A 2Z0SA 3C1EA 2KUMA 4L6TB 3OMCA 3K58A 3I4MB 4AQYQ 5IYDH 1A2TA 3TSSA 3CXCA 4YWMA 1YZ6A 4BBRG 1WTQA 2K5NA 1EZ8A 1TS5A 2FFKB 3KDFB 5C4HA 3A5UA 5I9OA 2R93G 4KHVA 1BVSA 5E1FA 1X6OA 3NWTA 4A3JB 4JI0L 1TR5A 2G9HD 4DKAC 2AMCB 2K5WA 4UP7A 2EZVA 1K83B 2KCCA 1HR0Q 2EXZA 4A3GG 3CCUA 1MSGA 3PMFA 4DR2Q 4ABNA 3ULLA 4KJNA 3HOXB 4OX9L 2BH2A 3MXPA 2AKWB 5IY0A 3RZOB 1DOLA 3HEJA 5IT9L 3N52A 2R93B 4YHHQ 1QOHA 3U9OA 3RZDB 4DV7Q 4G7ZC 4DAVA 1CZGA 4A3GB 3PF5A 1B9MA 4J1MA 2EPBA 3ZYYX 2OT2A 1PDQA 1XX8A 3GTOB 4U673 4JOIC 1ZYRD 1S4ZA 2NZOA 3UDIA 4A3JH 1S5CD 4IJLA 3OWFA 1K83H 1EWIA 3STBD 2HHHQ 1I5FA 2E2HH 4RA8A 2K50A 3JC66 5D65A 5FOBB 4QGUA 3URYA 3NE5B 4FXDA 2KVMA 5LMNW 1VDZA 3HOXH 3T16A 4CGYB 1BKBA 2CH4W 2E8GA 3CU7A 1N34Q 3RZOH 3FEWX 4KN7C 4LFAL 1HNWQ 5IODA 2NVTB 4DXFA 2KENA 4EX5A 1STAA 4A4IA 1KQSA 3HFZB 1CZWA 5KIXA 3CF5A 4KV6A 1PLFA 4RGOS 4DNRB 4FO2A 3OHXC 4OWXB 3HOUH 1VQ8A 3V05A 1EZ6A 4QIWB 2QCPX 1JQYD 3MC0B 3ERSX 1UNSA 5CC4A 2EIFA 1BCPD 1SNDA 1H9RA 2CFMA 2ZTDA 5C3WA 3CC4A 4Q5VA 3G4SA 3RD4A 1H95A 1A3UA 4HJ7A 3CD6A 3EA6A 1GO3E 4NP5A 1I6HB 2IHFA 2RHSB 5IWAL 2KJXA 1K3BC 3C3LA 5M5WB 1EEID 1B4OA 1WTHA 1LTTD 3VYTA 1JOKA 2LSSA 4IO9A 2JA8H 1SNOA 1QG7A 4RAUC 4AYBB 3FKIB 2PW5A 2F0IA 4R4IA 4KKSA 2RKSA 1S72A 5C44B 4R4OA 2EVBA 4HEDA 4R4QA 1JJGA 2Z4IA 2FMCA 4C3JH 3H91A 3V2TA 1VQDA 1HRJA 1UE6A 3BDOA 3JAML 4JBKA 4BBSB 2C9OA 1DGSA 1LTGD 5E7NA 1SYFA 3UDXA 1TWGB 1EL0A 1I94L 3KF8A 1H9MA 4B9XA 4PMBA 4G7HC 1I50B 3NBIA 4A3FB 4NXMQ 1I6HH 5GQOA 4JI8L 5M5WH 4LF7Q 1X3EA 2F3VA 2KHSA 1EYCA 2BDOA 3IFTA 4A3MH 3CC2A 2IJ0A 2N49A 4EGVA 3FKIH 2CH4A 1FVIA 1RTOA 4GN3B 3DUZA 2KECA 1EWHA 1XNRQ 5C44H 2R92H 1HZAA 2CVRA 5IT9c 3D3RA 3PO2B 2GN5A 1HA6A 3LGJA 1V1OA 3LNNA 1EU4A 1EY9A 1SAPA 1PTOC 4BBSH 2YTYA 3W3AA 2YU9B 4IUVA 1L0XB 3I2ZA 1TWGH 4B3RL 4A3FH 1I50H 5C4JB 4JV5L 4DUYL 4DPGA 2Z8LA 4HN7A 2QEJC 1CT1D 3R3OA 5D14A 2B2YA 2JN4A 2K01A 1RIPA 5C4XH 1YNJD 1AE2A 1BBUA 3HOWB 5JJIA 4X66Q 1YHAA 3D6CA 2K04A 5EBCA 2B63H 2NN6H 4KY6A 1PH9A 2RDHA 1UE5A 3PO2H 2EOTA 4IFDI 4X62L 2D5DA 1HUMA 1SE3A 3NK9A 1W3SA 1YHBA 1M90C 2WKDA 2CQAA 5IYCH 1H9SB 4QY7A 1ZEQX 4IFDJ 1TWCB 2BE5D 1W6JA 3R8BA 1YNND 3WOEA 2E2IH 4GKKL 1AE3A 3E9IA 1C7YA 4PMCA 2MGSA 2B2UC 1GUTA 1R4QB 4X3KA 1Q46A 3NBHA 5IGCA 3Q0AA 2RQXA 4C2MB 4HJAA 3WDNA 5JPNC 1MBYA 3HKZG 4F87A 2Q2UA 2TMPA 3HOWH 1YJ9A 3T1YQ 1VMPA 1WVLA 1G6PA 4FVMA 4K0KL 2CWAA 1XTDA 4CBVA 2RVLA 2V1CC 3BVZA 1IYUA 2K5DA 3FHWA 2JP1A 4IQZA 3J7ZC 1RF2D 1TXYA 2EYOA 2FINB 5EPKA 3S1QB 5A2QE 1KIXA 3OPOA 3HKZB 4P2CB 5HGQA 1SROA 2QGQA 3G48A 1ZYRC 2ALYB 4DUZQ 3FPUB 3NELA 3D6WA 2B8GA 3STBC 4C2MH 4XIGS 1KXLA 2EYMA 1HZ9A 2A19A 4V0BA 3KFUA 3JAMc 1B3AA 1AN8A 4LMQD 4XYQA 5C3XA 4CDEC 1LTSD 2VB3X 2Q2IA 1LTID 2I46A 1YNXA 2HIVA 5FKAC 4DV3Q 1VQKA 2E76C 1MIUA 1HZBA 3VA5A 3J81L 1JR0D 1OO9B 3PUYA 1F2YA 4NXNQ 3EN2A 4ZKCB 4POFA 1PV4A 2PPBC 3TP5A 1Q86C 3H94A 2NBFA 1BCPC 4DR6Q 3GTQH 2OQ0A 3IAYA 1S5BD 2DNEA 1KTKA 5COYA 2XWBB 3MVVA 1Q12A 4C1NI 4RG1A 5IP7G 1PVOA 4DV2Q 5A2QL 3DM1A 3A54A 2UUCL 3PV0A 4LF6Q 1JOQA 3MHBA 4LF4L 1L2FA 3AFPA 1WTPA 1FR3A 3BVMA 4DR7Q 3NWSA 1SNMA 1F9SA 2WACA 3RNUA 2VQEL 5ELDA 4L5QA 4KN4C 2WB1G 4A3KG 4UPAA 4K8IA 4JI3L 4E6IA 2A6HD 5AJ3Q 3S1RB 1SLJA 2PZWA 1AW7A 1U0LA 3J7A5 1RCVD 4OGQC 3PUXA 3DWAA 1NTGA 2D62A 2VUMH 3MEHA 2TSSA 3AYHB 1FNVA 4ZUJA 2Q2HA 3M4YA 5EKKA 3WOFA 2IW3A 4MIUA 2XIWA 2A68D 4A3KB 3HOVH 1HTLD 1UEBA 5FLXL 4L5TA 3MFYA 1JC7A 5DEHA 3UDFA 2X69A 1AEXA 4IN3A 1EQQA 3CCJA 1K0SA 1Y1VG 4C3HH 2NTTA 2BH8A 5C5LA 1TY2A 1HNZQ 4YY3Q 5I2XA 4B3SL 4FF2A 1XMQQ 2K7VA 2AWNA 3KJPA 2OTLA 4KKTA 3I8ZA 3KF8B 2EY2A 1T5EA 2PZTA 3D31A 2A74C 1JWSD 2DJFC 3NTKA 4CJ1B 1ET9A 1ICWA 1EOVA 3M3YH 3NTHA 5GAHC 1HFNA 2I5LX 3HZXA 3CP0A 3NUCA 4DNTB 2B2VA 1IBLL 1YNJC 2CHBD 5FO7B 2OF1A 1U4PA 2HIXA 2F0EA 3CQZB 3GD7A 1EYGA 1F9QA 1PH4A 5DLQE 2A73B 1N32L 3OW7A 5G3LF 1V1PA 3H6MA 3TZDA 2F4VQ 4GNXC 1J9OA 3HGBA 5IIFA 2XVSA 1HA5A 4WFN3 4JI7Q 2EYHA 2ZXRA 2LXJA 4CKEA 2A6EC 4J8QA 1KLUD 1G6ZA 4P75A 1YVCA 2BE5C 3J81c 1OXXK 2BDNA 2MNAA 1MD2D 3FPPA 4IPDA 1PFMA 5C3EB 1RL2A 3SVMA 1JB3A 5A35A 4RMFA 1VQMA 4X3UA 4EQPA 4YWLA 2WAQG 1D5ZC 1YI2A 3E5SA 1E7ZA 2VY3A 1X3PA 3VR4A 1A0IA 1CKNA 3M4OB 3U9SA 3KLWA 3ND8A 3GTKB 3TBIB 2AUKA 3ERQA 5HGTA 1JE5A 2N78A 4DV6Q 4DAPA 5M5YH 4DF7A 4ZLTF 1PA6A 1E1TA 3A5ZB 2BCOA 5I9PA 3T1HL 2PNRC 2PQEA 4AQYL 1JJCB 1Q8KA 1X3FA 2I5MX 4OELB 5M5XB 4R4TA 2F0FA 3NBHB 5BN4A 1PZID 4B3MQ 1I4HA 1EOTA 2UXBQ 3BU2A 5C3EH 4DK6C 2WFWA 2IPKD 1VQHA 1VCIA 2ZM6Q 2K6AA 1U4RA 3BG3A 3HOYH 4RCNA 2UUBQ 2Z6BA 3I91A 3W1GA 1D5XC 3G6EA 2ZJPA 1TU2B 1HR0L 3VYRA 1U4LA 3CCQA 5JJKA 3G7LA 3D0FA 2WIIB 4X3TA 1AZQA 3CRKC 4NKLA 1J8IA 4WJ3M 4XQJA 2K33A 4R8NA 2MJ8A 2XRSD 4ZRZA 2I07B 4DN4M 3D4WA 1GD7A 2MPMA 1P16A 2R7DA 3S2DH 1EIFA 4OEMB 5FLXc 3GTPH 2HCIA 3F2BA 1D5MC 2F0HA 1ENAA 1HZCA 2Y0SE 4DV5Q 1N36Q 2DY7A 2K03A 1FJGQ 1HNXQ 1BNZA 2JA7G 4LAAA 1X3QA 3J7YW 5C0XI 1NY4A 1PXUA 5M9OA 1F2MA 2XRQD 4H44C 1HH2P 1RHPA 2WINB 4GN4B 4OXPA 1RDPD 5D3DA 2J4XA 4JYAQ 2LMCB 1SMYD 4JPBW 1WOCA 1J6QA 3L0OA 1Y1WG 2O4XA 5ELEA 1B9NA 1B70B 4I65A 1EIGA 3IFDA 5ELCA 1GJXA 2JA7B 2XGTA 4K5VA 1FD7D 1N34L 1SYDA 5IYDG 3PUWA 4HIMA 1HNWL 4L5SA 2HUGA 2PMZE 1TKWB 1RODA 3K7UC 5M3MB 1UAPA 1Y1WB 2B2WA 4PQXA 2A6HC 1TS2A 4JK1C 4ZK9B 5JEAH 1EQRA 3J7AV 2RCFA 5EGTA 2H5XA 1SNQA 5EJWA 1VQ9A 1IBKL 3M4QA 3TRZA 1C48A 5ELOA 1QCBD 1IHZA 4IUTA 2VQFQ 4ME5A 5IT9E 1AP0A 4XXEA 1QILA 1E3PA 4A3DH 2A68C 4ZUIA 4LFCQ 4BXXH 5T1IA 1BBXC 2MHVA 3FVQA 2CW0D 3UE1A 1SXTA 1AH9A 4WORA 4LK1C 3TEHB 5M3MH 2B2TA 1OXSC 2WP8J 1I4GA 2Q8IB 5CBAE 3NEMA 4A3JG 2QILA 1BO0A 1II3A 4IUNA 2KCNA 5EKIA 1V9PA 1EFID 2D2CC 4QQBX 3MTSA 1XNQQ 1EQVA 3J81j 2SDFA 1CHPD 3HOXG 3SXHA 1XPOA 2JEBI 5CR3A 3SK4A 4X64Q 3MZ5A 1IBMQ 5LMUQ 4XTCS 2ENBA 1JORA 1TWAH 3IKJA 4ZAIA 4BA1I 4NXML 3JAMi 3GV3A 4LF7L 3J80L 3AB9A 4DR3Q 1QVGA 5GAEC 2E2HB 3HOUG 4S3SA 4DR4L 4NW2A 4B9WA 1RJTA 1SYGA 3RUZA 4DV4Q 4ULLA 1ET6A 4UP9A 3EFXD 4A3CH 1L1OB 3I4NH 1E22A 2UU9Q 3L9AX 1HQMC 1B50A 2F0TA 2O2LD 5C0XH 3KBXA 1BOSA 1EY8A 4PG3A 3Q23A 4KHZA 4IPCA 3HOUB 1K3RA 1STEA 4GOPA 2X6GA 4KKUA 1AZPA 2Z4HA 4L5RC 3VR6A 4HMIA 3O13A 1V1PB 2JA8G 5FO9B 5JAVA 4OO1H 3U50C 1UE1A 3MWYW 1K0RA 3QOJA 2RSNA 4X66L 1DM0B 1FYCA 5HURA 4B3TQ 4C3JG 5JJLA 2DGYA 4ODGA 1KDAA 2L11A 3JAME 1F2LA 1IKLA 1NBWA 3M7NA 4JI1L 2NVQH 2JA8B 3PO3H 4LJZC 3U58A 5AFWA 2MO0A 1B53A 2PW7A 1CKNB 1VF7A 2PCFB 4ZQ3A 3GTMH 3GTLH 3RLNA 3CRLC 1PZJD 1B44D 1PYWD 1SSOA 4A3MG 4C3JB 2MFIA 1MJCA 4AYBG 4POGA 3FKIG 5G3LD 4HCEA 4CDCC 1F9PA 5C44G 1J5EQ 3KUPA 4DK0A 2R92G 2JE6I 4IUUA 3T1YL 1TQOA 1MSHA 5LMNQ 2DN8A 2PYKA 1MJEA 4FF3A 4BY7H 4A3MB 1PRTF 2JEAI 4BBSG 2L9HA 3A8IE 2EJGC 3BVGA 1IXRA 1A3VA 4A3FG 1PRTB 2OXPA 3PCOB 5FO8B 1W6KA 1I3QH 2R92B 3S16H 3FP9A 3M85A 1E2VA 4RGTA 1BBWA 1VQNA 1SMYC 2PI2E 5GADC 5K36H 4K5WA 1VF5C 4QB4A 4B08A 5I6WA 5C4XG 1SNPA 2F3WA 1KLGD 4MTKA 5IGEA 2F3IA 4MHEA 1EWCA 3CMEA 2NN6G 4N9PA 2B63G 1LACA 4A75A 3OTOQ 1EQTA 2UXCQ 3PO2G 1KNAA 2JA5B 1O7YA 3MXGA 4KLKA 3E0JA 5IYCG 2E2DC 4DV3L 3J80c 2QDLA 3E3XA 3ND9A 5C4XB 2QA4A 4NXNL 5C5MA 5JVG3 2B63B 4DA2A 4N8X1 2F0QA 4HIOA 3K0XA 1LT6D 4IALA 3PIPA 1VQGA 4OWTB 3QB3A 3C46A 3J81i 4JI0Q 2QDBA 1PYSB 2WV6D 3S1NH 3DWPA 1MHWC 3HOWG 3BZDB 3CMAA 3RLOA 1K73C 1S40A 2RCNA 1B7YB 4L63B 2EY5A 2JYOA 1X65A 2KQ3A 2E2IB 1B2TA 3EBEA 4UP8A 4MTNA 1MI2A 3TS0A 2JA5H 2I0QA 4ZKBB 2AWOA 4LF6L 2CW0C 1Q1BA 4DR1Q 2PNHA 2N55A 2F0WA 2IT1A 4DR7L 3BYTB 1EEFD 1G2TA 2GVAA 4C1NK 4YIJA 2ATWA 1DZ1A 4OL7A 2NVXB 1SYEA 3PIOA 3KYHC 3EIVA 3OWEB 1CI3M 3PUZA 1V8QA 4JI5L 4L8JA 1U9RA 1TWHB 4LUZA 5JOBA 4CJ0B 1ASZA 1NR2A 3I73A 5AJ3L 1D1KA 3NHHA 4X6AH 2CCZA 2A6ED 3I55A 4JBWA 1KABA 2ZJRA 3IL8A 1QVFA 3K5OA 4DU9A 3BJUA 5L37A 4DR5Q 3S1MH 3J81E 3QO2A 1SJHD 4LFBQ 3HRZC 4H02A 4DNIA 2NVXH 4ZCKA 2FXQA 3M7GA 4JI6Q 4C3IB 2K4KA 3F2DA 1A62A 1ENFA 1QNKA 3R2IA 4P74A 1FL0A 2A1AA 1TWHH 4BY1H 1IYJB 4YCUA 1HNZL 3H3VC 1LO5D 1Q90A 3PIP3 1WTOA 1LV9A 5K5PA 3CCVA 5CV5A 1GUSA 4GS3A 3K5LA 1ILQA 1QVCA 3MEFA 2L55A 2NTSA 1Q1EA 1EYAA 1JOOA 1MGSA 3SE0A 1KNEA 4XQQA 1FNUA 1GM5A 1NUCA 3GTQB 3PQIA 1TY0A 4JBMA 1KAAA 4XT3B 2H1EA 4QL5A 3D4DA 3LWEA 3T53B 4FNFA 4PZ7A 4IPGA 4C3IH 2QEXA 3MXNA 3PIO3 5KYLA 4AH6A 1L0YB 3TP8A 2F4VL 2IHEA 4IURA 1BUVT 1Z47A 1SNCA 2E74C 2F0DA 4UDUC 5J3BA 4GOPB 4JI7L 1I4QA 3NXWA 1N33Q 1VQ6A 4A3EH 1YITA 2XNAC 5M3FH 1WJJA 2VUMG 4RKLA 4PV1C 3H3VI 3NTIA 3OSOA 3WWVA 3HOVG 1HFGA 1WYDA 5FLXE 1DYQA 1I94Q 4CJ2C 2E5LL 2R7ZH 4DV0Q 4EQOA 4GN5A 3K5NA 4HJ8A 4HJ9A 4IUQA 2PO4A 4C3HG 1M4VA 2ID0A 5KYIA 4HJ5A 1X9NA 2B2YC 2VUMB 2M00A 1D1IA 4LNQA 2NUCA 4KD4A 1YIJA 2OCEA 1QWYA 3HOVB 5LL6S 4TSSA 1YJNA 3K0YA 3KF6A 4UHVA 3GTJB 1PZKD 3TN2A 4IFDH 4B3ML 4C3HB 4P71A 2MQHA 2UXDL 1SE4A 2EYPA 2K05A 2VNUD 2ZM6L 1XMOL 1CKOA 3S2HB 2C35B 4JV5Q 3W5OA 1WCMH 2R7FA 3TMEA 3I90A 2EXDA 2DY8A 2G9DA 2XWJB 5JPMC 2BA1A 3KLRA 4DV1Q 3SK8A 1QZGA 1PTOH 1SFOH 1TVXA 2ZTCA 2QKIC 3M3YB 2F0OA 4GKJL 1VQBA 1EU3A 1GHKA 2RSOA 1EUJA 1I4XA 3NENA 4X62Q 1F2ZA 3S14H 3GTJH 4A3LH 1UEAB 3W1BA 1A63A 2KCMA 4XT1B 1HCZA 4R8IA 3HS0C 2Z6KA 3L3OC 3KLSA 3S2HH 1ICFB 2PZUA 3A55A 2HDLA 1HUNA 1X54A 4LF9L 2Y0SG 4JYAL 1CSQA 1STBA 4FXGC 1KHIA 2JA6B 1L1OA 3BYYB 1XTCD 2F52A 1YBYA 1SE8A 2FMMA 3AEVA 4LF8Q 2PI2A 2E2JB 4K0KQ 1EIYB 1PRTD 5IYBH 4QJFA 5IP7H 3ITPA 3G71A 4F88A 1VQEA 3EJIA 5C3EG 1BR9A 4CDFC 1O7IA 1FNWA 2Y0SB 4WJ4A 1IKMA 3HOYG 5IP9H 3SHLA 2HQEA 3A7AB 3H09A 1BF4A 5M5YB 2D9UA 2RA4A 3CCMA 4LF5Q 4TKOB 2IX0A 1O78A 2JA6H 2AUJD 4XYOA 2AQ1B 2Z1CA 4KI0A 2E2JH 3HOYB 4Y52H 1LT4D 2PQAA 1R9TH 4G4KA 1S5ED 3F8TA 4JI4L 4DXGA 3TQYA 3RR5A 3UI2A 4RHRA 2N3SA 3P20A 5I6YA 4PNYA 2PMZB 3Q6SA 2F1MA 3OIQA 3VA7A 4QUFA 2AQ3B 2KHIA 3CAMA 3QR8A 3TP7A 3BS1A 3S2DB 1NE3A 2KEEA 4X65Q 2R3ZA 4KMUC 2OTJA 5JEAJ 3UE0A 3RN2A 3GTPB 4DK3C 4A3IB 1LTBD 1EY6A 1Y8NB 3I4OA 2K5QA 3DWQA 3TS2A 4X64L 1M1KC 2Q8TA 3OW2A 1X55A 1CFMA 1SJED 2WB1E 2RDGA 4FF1A 3H15A 2MUYA 3BZCA 2R6GA 2VQEQ 3GDEA 4DR2L 2EY1A 3HG9A 1UWVA 3F2UA 2YYZA 1PFBA 3TDQA 4KHPQ 5JEAG 3EVQA 5FLMG 3H0GH 5FJ8H 4UAIA 1VQ5A 4HIDA 4JI3Q 2UU9L 2YTXA 4YHHL 3ER0A 4LUOA 4A3IH 1L0WA 4JG2A 1GKHA 4DGZA 4DV7L 4KD3A 1DOKA 3L2PA 4A3DG 4G57A 1PH8A 4BXXG 2QF7A 1LYLA 1SR3A 2D0OA 3MXNB 5T1GA 2K5VA 4MNOA 4N9TA 5IGGA 3EROA 4LW1A 2HHHL 5M3MG 4EVOA 1O80A 1GUNA 2E75C 3HOZH 5KNBA 2B2VC 1X32A 5BR8Q 1EY5A 2ES2A 2DJGC 4JI2Q 4RGMA 4A3DB 5C6AA 1AFPA 3I3CA 3CHBD 4JCVE 1KD1C 1PH6A 1K8AC 3T51B 1SBBB 4NMZA 5I2YA 2RBMA 2NZHA 3NP8A 1ILPA 5IOCA 5J22A 3Q24A 4HIKA 4JOIA 2HCCA 2NVYH 1QUQA 1CHQD 2EY6A 1C8CA 3QIAA 1VQ4A 3J80E 3QJYA 1TT2A 4H13C 4JW0A 2NB0A 1N9WA 2L1BA 1RTNA 2QW7A 4HMJA 3A8JE 1IBLQ 1SN8A 1CTMA 3S17H 3RN5A 1RD9D 1GOZA 4A3CG 1KDCA 1J5EL 1K9MC 3KF6B 1N32Q 5ISRA 3I4NG 4KY5A 1TWAB 2I5HA 3S15H 1GVPA 5LMNL 5C0XG 4R9WA 4A93H 3PGZA 2WAQE 1B1ZA 2VW9A 4J6HA 4K2KA 1G8ZD 2UUAQ 1M8AA 1XWEA 1V1QA 4RHSA 5CYUA 1HR0W 3I4NB 2F4IA 2N88A 4HSPA 1V43A 2A69D 3T56B 4OO1G 3C1FA 1SMXA 3I56A 3T4AC 5IGFA 1CKMA 1Z6HA 1TIID 2K52A 4ILWA 4APVA 4RCOA 1I4RA 3SDZA 1Q7YC 3AFQA 1PRTC 1TS3A 3OTOL 1ML0D 2K75A 4ZYSA 2UXCL 4IJHA 4EQNA 4RH6A 2DNCA 1I6VC 3EQLC 1STYA 2KCTA 3F1ZA 3PO3G 2F0NA 1CA5A 2B8FA 3T1HQ 3SR1A 4ALPA 1WTRA 3M9BA 2LFNA 4K8JA 2CQOA 3Q22A 3K8AA 3I70A 1LUZA 3G6JB 4HTHA 1XNRL 3PUVA 3B6YA 1XJVA 1JE4A 2L4NA 1PHJA 4A3BH 1JJ2A 3P1HA 2F0GA 5ELFA 2NVQB 3PO3B 4WRDA 1IZ6A 2O5JC 2N8NA 1CM9A 3UDGA 1G291 4DK1A 2ICIA 3GTMB 1IYVA 4BS9A 3J7AF 1Y14B 4BBRB 3AQQA 3GTLB 4K14A 5DAUA 4JC0A 4BY7G 5ELNA 2M2LA 3VR2A 5LL6X 3TREA 4CDDC 4DR1L 4R4CA 3I4MH 3K81C 1XPRA 4IPHA 4DFAA 4RWSC 3PSIA 1ENCA 4NDXA 4M1UB 2LY7A 4O1NA 1QZHA 3K6OA 5E3FA 5TSSA 5K36G 2B2WC 3FDTA 5BN5A 3SGIA 1Z7TA 5CV9A 4BY7B 2CKZB 2PQAB 1GHJA 1T5XD 2F0LA 4HR7B 1IL2A 1SYBA 4YWKA 4CHTB 1D7QA 1I3QB 4QMGA 4BBRH 3S16B 4DR5L 4WJWA 1X56A 1ZKOA 5HY6A 2R93H 3DLLA 1ESFA 5I4DA 2VXWA 1K28A 3RZDH 2EYFA 2NN6I 4LFBL 5D3IB 4PMWA 1GXDC 2VB2X 2EQSA 1EY7A 3T13A 4JI6L 2F0MA 4A3GH 2IY5B 4XQNA 1BQQT 1SYCA 2X6LA 1JMCA 3VR3A 2B2TC 3I72A 3M4PA 1Y69U 3GTOH 1A8VA 3TZUA 4FDBA 3I4LA 4IOAA 1Q81C 1IBKQ 1XXGA 1TWFB 3TP6A 1ONLA 4RGNA 2B2UA 1IW7D 4H7BA 2FHTA 1WTVA 2JA5G 4DUZL 3IRBA 4OHJA 1PH7A 2NVTH 4O42A 2A8VA 3S1NB 2ZJQA 2K1BA 2KOLA 3CW2C 3V96A 2IX3A 1OXTA 3S9WA 3PF4A 1JT8A 3BZKA 4EQ5A 3K80C 3ZJYC 4LUVA 1H9JA 2P5ZX 3DHQA 2GA4B 4FF4A 1N33L 1VQCA 4JVZA 2L5TA 4FP5D 2FJ2A 1TWFH 2YV5A 4BA2I 2RF4A 2RDFA 3SK6A 4PZ6A 1O7ZA 1WI5A 4DR6L 1DD2A 4GOPC 4RKBA 4DV0L 4OIKA 4TQUS 2ASBA 2KBNA 3A0JA 3DMUA 1EY4A 1QE6A 1SRUA 1KAWA 2RHQB 3CC7A 1VMCA 4DR4Q 2EYJA 5CV6A 1PYBA 4BY1G 1VQAA 4OX9Q 4DV2L 2EJMA 3S1MB 2Q2TA 2JSOA 5KRUA 4ME3A 1BDOA 2R61A 1U5KA 1QUQB 2NZ1D 2JQOA 1EY0A 3RMHA 3NPPA 2HQLA 2J7ZA 2MO1A 4R1JA 1DOMA 4KTAA 3RLFA 2JJQA 1CA6A 4QIWE 2KEDA 5NUCA 4BWGB 1LTLA 1VQPA 2B3GA 3CCEA 4IZ8A 4J15A 2A69C 1LTRD 4GLVB 1NCVA 4IOCA 3DXJC 4BY1B 2F0SA 4C3IG 2EJFC 5CBEE 3A8KE 3D8GA 1C4QA 1G2SA 1E2ZA 3K7AB 4DV1L 3MXUA 1ASYA 3CCLA 3F2CA 4K5XA 5KEEA 3NQIA 2EDGA 4LFAQ 1LM0A 5J39A 1OXUA 3ULPA 4A3EG 2KHJA 2K5HA 5M3FG 1KRSA 3E0EA 3CKIB 2L15A 1KRTA 1LT3D 4K6DA 4JI1Q 4AYBE 5CMDA 3KK7A 4DAYA 2F0KA 3KJOA 5IE8A 2R7ZG 1JWMD 2YU9H 2JA9A 5GROA 1I4PA 1YHQA 3BDLA 4YCVA 2IWHA 1VQJA 4QCLA 4YY3L 1XMQL 2XN9C 5C4JH 4A3EB 2XSCA 1E24A 3MA2B 4JBJA 5M3FB 3K7AH 1R4PB 3E9HA 2F0VA 3QOLA 4LF8L 5JVH3 2R7ZB 3ULJA 3GP7A 2VL6A 3LX0A 5IWAQ 2F03A 3QWNA 1CK1A 4FXKC 4IFDG 3DM3A 3AMUA 2SOBA 3VDYA 1E0BA 1TWCH 1STGA 1PH1A 1NJIC 3W2DA 3BDCA 3KBGA 1WCMG 4O2DA 5GAGC 1SE2A 1E2WA 4LF5L 2ZTEA 1DONA 4CKCA 5BN3A 1GUGA 1D8LA 2BA0A 2ZT9C 3SEBA 1NMGA 3K5MA 2VZAA 3KLSX 3Q8DA 2K14A 5KNDA 4JI8Q 1WCMB 4A3LG 2ICEC 1PTOF 5CV4A 5KGUA 4KY7A 4Y7NB 5ELBA 4GNXA 3U4VA 1Y8PB 3X3NA 2HDMA 1PTOB 3S1QH 1SFOB 4DV6L 4AIMA 2L0CA 1A3TA 1PFSA 3X3MA 4X65L 2F0PA 1S5FD 4HCSA 3S14B 4QF4A 1VQOA 3L7ZC 4DAMA 1IW7C 1LT5D 4NB3A 2F0JA 2UXBL 5IYBG 2K28A 4B3RQ 1KC8C 5KNCA 1GUWA 2JK8A 2UUBL 4DUYQ 1EIHA 3R2TA 4Y7NH 1QNUA 5IP9G 3E6ZX 1NSNS 1WTXA 4QUCA 1EFWA 2MP1A 4KHPL 4JI5Q 3CCRA 1FGBD 3FRPB 5CV8A 1WTWA 5E4WC 3GTGB 4ID6A 1S5DD 2JA6G 1CQFA 1HHVA 3U4ZA 4DV5L 1NAPA 4XDXA 1N36L 1FJGL 1HNXL 1JWUD 3HKZE 3AU7A 2SNMA 1XPUA 1E1OA 1VQLA 4GKKQ 3OIPA 1JB7A 1Q82C 1CQVA 1K8GA 3FMCA 1A2UA 1NR4A 2WB1B 3MAQA 3KDFA 3GV6A 2OWOA 4OWWB 3VYSA 1N8RC 4MN3A 2BOSA 2EE1A 1VQIA 4PZ8A 5BR8L 1C0AA 3GO5A 4JI2L 3A56A 4HSVA 1QB5D 1R9TB 2OQKA 1F9RA 3GTGH 2NYZD 2DUDA 3R93A 1A15A 1PMRA 2IL8A 3S1RH 1K8MA 5FK9C 4YCWA 2HD3A 2LS01 1DCZA 2ZXOA 3SK5A 4GLAC 1G91A 1Y1VB 3ICEA 1T9HA 3HKSA 2CWPA 1RKNA 1WFQA 2O5IC 3H3VH 1LTAD 5CORA 4A3KH 2V4DA 2XTIA 4OIJA 3I7FA 5JJZA 2SNSA 2VQFL 1HXYD 3H0GG 5FJ8G 1BCPF 4C56C 1O7LA 2K32A 2ZXPA 4LFCL 1OTCA 4X3SA 4V190 1OXVA 4F7XA 4A3IG 1BCPB 4O0AA 5EPLA 5EPJA 4H0LC 1U4MA 5H1SE 4GLXA 1MKHA 3S24A 1YNNC 4LWCA 1FGUA 1C9OA 2M9VA 2UUAL 1VQ7A 1Y1VH 3H0GB 3NSWA 1S3OA 3MFGA 5CGKA 2E5LQ 2VS1A 2F0UA 4MZ9A 4CKBA 2LKVA 3HOZG 1IL8A 1NNXA 4P73A 1GUOA 4TVAB 1XNQL 2J0TD 1K8OA 2Q8RE 5DNFA 2A5HA 1P8LA 3CQZH 1UE7A 1IBML 5LMUL 5C4ZA 1ZXTA 1A6XA 1HJPA 2Z9HA 2UUCQ 4DAYB 3A74A 4LF4Q 3HP3A 1VQFA 5DM73 4IUPA 3ONAB 4OONA 2C5CA 4DR3L 3LWUA 3HOZB 2WAQB 1KDBA 4RFBA 4DV4L 4I7AA 3DEPA 2UXDQ 3J80i 2AHOB 1XMOQ 2AQ2B 2Z6KC 4F8MA 1PFNA 1LABA 1PH5A 3CCSA 4U68A 3M4OH 1H9KA 1PH2A 4UY8C 3K59A 5IGBA 2LXKA 4G7OC 2GVBA 2NVYB 3GTKH 1L1OC 2EYLA 3CPFA 3QG1A 4A93G 4GKJQ 1HPCA 4K6LA 1ESRA 5EAYA 1HQRD 2OEOA 5M5XH 4Q0FA 3S17B 1SDFA 3OMGA 2G5DA 4Z9CB 1G51A 2D0PA 3K57A 5LHY1 4A76A 4B3TL 5EBDA 5J1ZA 3S15B 1JCKB 4B3SQ 2B39A 1XYIA 2YTVA 1B3QA 1PH3A 4A93B 1JICA 3OYYA 1Z9FA 1X3GA 4LF9Q 5C0XJ 5DM63 3KOJA 5CV7A 1STHA
chains in the Genus database with same CATH topology
2JXMB 4I7ZC 4HAEA 4OO1I 1WD0A 2H4OA 3P7JA 2KA7A 1D2BA 3OOCA 1DXMA 3D4RA 5E4XA 1WD1A 2NWGA 4KJOA 5EKLA 3A7LA 3C2PA 5IGDA 1UUPA 4FYDA 4GZYC 2IX1A 5EQ0A 1Q3LA 3P75A 2L12A 4M8AA 5F2DA 4TRDA 2WKCA 1EYDA 3VYUA 4KK7A 1QJOA 1HTPA 1DJRD 4K2LA 1PTOD 1Q8IA 1SEBD 4A3BB 3GQBA 3N6RA 1H9SA 2SEBD 3VR5A 3NQTA 1BXTA 1STNA 1F77A 1Y8OB 1LLRD 3DEOA 1D6EC 1TS4A 3C1EA 2KUMA 4L6TB 3OMCA 3K58A 3I4MB 1A2TA 3TSSA 1WTQA 1EZ8A 1TS5A 2FFKB 5C4HA 5I9OA 4KHVA 5E1FA 4A3JB 3NWTA 1TR5A 2G9HD 2EZVA 2K5WA 1K83B 2KCCA 2EXZA 1MSGA 3PMFA 4ABNA 4KJNA 3HOXB 3MXPA 3RZOB 1DOLA 3HEJA 5IT9L 3N52A 2R93B 1QOHA 3U9OA 3RZDB 4G7ZC 4DAVA 1CZGA 4A3GB 1B9MA 4J1MA 2EPBA 3ZYYX 2OT2A 1PDQA 1XX8A 3GTOB 4U673 1ZYRD 1S4ZA 1S5CD 3OWFA 4RA8A 5D65A 5FOBB 3URYA 3NE5B 4FXDA 2KVMA 1VDZA 3T16A 4CGYB 3CU7A 3FEWX 4KN7C 5IODA 2NVTB 4DXFA 1STAA 1CZWA 5KIXA 4KV6A 1PLFA 4RGOS 4DNRB 4FO2A 3OHXC 3V05A 1EZ6A 4QIWB 2QCPX 1JQYD 3MC0B 1UNSA 5CC4A 1BCPD 1SNDA 1H9RA 5C3WA 4Q5VA 3RD4A 1A3UA 3EA6A 4NP5A 1I6HB 2KJXA 3C3LA 5M5WB 1EEID 1B4OA 1LTTD 3VYTA 1JOKA 1SNOA 1QG7A 4RAUC 4AYBB 3FKIB 2PW5A 2F0IA 4KKSA 2RKSA 5C44B 2EVBA 4HEDA 2Z4IA 2FMCA 3H91A 3V2TA 1HRJA 3BDOA 3JAML 4BBSB 2C9OA 1LTGD 1SYFA 1TWGB 1EL0A 3KF8A 1H9MA 4B9XA 4PMBA 4G7HC 1I50B 3NBIA 4A3FB 2F3VA 2KHSA 1EYCA 2BDOA 3IFTA 2IJ0A 4EGVA 1RTOA 3DUZA 2KECA 1EWHA 2CVRA 3D3RA 3PO2B 1HA6A 1V1OA 3LNNA 1EU4A 1EY9A 1SAPA 1PTOC 3W3AA 2YU9B 4IUVA 1L0XB 5C4JB 2Z8LA 4HN7A 2QEJC 1CT1D 3R3OA 5D14A 2B2YA 2K01A 1YNJD 3HOWB 3D6CA 2K04A 5EBCA 2NN6H 4KY6A 2RDHA 4IFDI 2EOTA 2D5DA 1HUMA 1SE3A 3NK9A 2WKDA 2CQAA 1H9SB 1ZEQX 4IFDJ 1TWCB 2BE5D 1W6JA 3R8BA 1YNND 3WOEA 4PMCA 2MGSA 2B2UC 1GUTA 1R4QB 4X3KA 5IGCA 3NBHA 3Q0AA 2RQXA 4C2MB 3WDNA 5JPNC 1MBYA 4F87A 2TMPA 1VMPA 1WVLA 4FVMA 4CBVA 2RVLA 3BVZA 1IYUA 2K5DA 2JP1A 4IQZA 1RF2D 2EYOA 2FINB 5EPKA 3S1QB 5A2QE 3OPOA 3HKZB 4P2CB 1ZYRC 3FPUB 3D6WA 2B8GA 4XIGS 2EYMA 4V0BA 1B3AA 1AN8A 4LMQD 4XYQA 5C3XA 1LTSD 2VB3X 1LTID 2I46A 5FKAC 2E76C 3VA5A 3J81L 1JR0D 1OO9B 1F2YA 3PUYA 4ZKCB 2PPBC 3TP5A 3H94A 2NBFA 1BCPC 3IAYA 1S5BD 2DNEA 1KTKA 5COYA 2XWBB 3MVVA 1Q12A 4C1NI 5A2QL 3DM1A 3A54A 3PV0A 1JOQA 3MHBA 1WTPA 1FR3A 3BVMA 3NWSA 1SNMA 1F9SA 2WACA 5ELDA 4KN4C 4K8IA 4E6IA 2A6HD 3S1RB 2PZWA 1AW7A 1RCVD 4OGQC 3PUXA 3DWAA 2D62A 3MEHA 2TSSA 1FNVA 4ZUJA 5EKKA 3M4YA 3WOFA 2IW3A 4MIUA 2XIWA 2A68D 4A3KB 1HTLD 5FLXL 3MFYA 1JC7A 5DEHA 2X69A 1AEXA 4IN3A 2NTTA 5C5LA 1TY2A 5I2XA 4FF2A 2K7VA 2AWNA 4KKTA 3I8ZA 2EY2A 1T5EA 2PZTA 3D31A 2A74C 1JWSD 3NTKA 4CJ1B 1ET9A 1ICWA 3NTHA 1HFNA 3HZXA 3NUCA 4DNTB 2B2VA 1YNJC 2CHBD 5FO7B 2OF1A 1U4PA 2F0EA 3CQZB 3GD7A 1F9QA 2A73B 3OW7A 5G3LF 1V1PA 3H6MA 3TZDA 1J9OA 3HGBA 5IIFA 2XVSA 1HA5A 4WFN3 2EYHA 2ZXRA 4CKEA 2A6EC 4J8QA 1KLUD 1G6ZA 2BE5C 1OXXK 2BDNA 1MD2D 3FPPA 1PFMA 5C3EB 3SVMA 1JB3A 5A35A 4X3UA 4EQPA 1D5ZC 3E5SA 1X3PA 3VR4A 3M4OB 3U9SA 3ND8A 3GTKB 3TBIB 2AUKA 3ERQA 5HGTA 4DAPA 4DF7A 4ZLTF 2BCOA 5I9PA 2PNRC 2PQEA 5M5XB 2F0FA 5BN4A 1PZID 1I4HA 1EOTA 2IPKD 1VCIA 2K6AA 1U4RA 3BG3A 4RCNA 3I91A 1D5XC 1TU2B 3VYRA 1U4LA 3G7LA 2WIIB 4X3TA 1AZQA 3CRKC 4NKLA 1J8IA 4XQJA 2K33A 4R8NA 2MJ8A 2XRSD 4ZRZA 2I07B 4DN4M 3D4WA 2MPMA 2HCIA 1D5MC 2F0HA 1ENAA 2DY7A 2K03A 1BNZA 4LAAA 1X3QA 3J7YW 5C0XI 1PXUA 5M9OA 1F2MA 2XRQD 4H44C 1RHPA 2WINB 1RDPD 5D3DA 2J4XA 2LMCB 1SMYD 2O4XA 5ELEA 1B9NA 4I65A 1EIGA 3IFDA 5ELCA 1GJXA 2JA7B 4K5VA 1FD7D 1SYDA 3PUWA 2HUGA 1TKWB 1RODA 5M3MB 1UAPA 1Y1WB 2B2WA 4PQXA 2A6HC 1TS2A 4JK1C 4ZK9B 5JEAH 3J7AV 5EGTA 1SNQA 5EJWA 1C48A 1QCBD 1IHZA 4IUTA 4ME5A 5IT9E 1AP0A 4XXEA 1QILA 2A68C 4ZUIA 5T1IA 1BBXC 2MHVA 3FVQA 2CW0D 1SXTA 4WORA 4LK1C 2B2TA 1OXSC 2WP8J 1I4GA 2Q8IB 5CBAE 2QILA 1BO0A 1II3A 4IUNA 2KCNA 5EKIA 1EFID 2D2CC 3MTSA 1EQVA 2SDFA 1CHPD 3SXHA 2JEBI 5CR3A 3SK4A 3MZ5A 4XTCS 2ENBA 1JORA 3IKJA 4ZAIA 4BA1I 3GV3A 3J80L 3AB9A 2E2HB 4S3SA 4NW2A 4B9WA 1RJTA 1SYGA 3RUZA 4ULLA 1ET6A 3EFXD 3L9AX 1HQMC 1B50A 2F0TA 2O2LD 5C0XH 3KBXA 1BOSA 1EY8A 3Q23A 4KHZA 3HOUB 1STEA 2X6GA 4KKUA 1AZPA 2Z4HA 3VR6A 4HMIA 3O13A 1V1PB 5FO9B 5JAVA 4OO1H 3MWYW 3QOJA 2RSNA 1DM0B 1FYCA 5HURA 4C3JG 4ODGA 1KDAA 2L11A 3JAME 1F2LA 1IKLA 3M7NA 2JA8B 4LJZC 5AFWA 1B53A 2PW7A 1VF7A 2PCFB 4ZQ3A 3CRLC 1PZJD 1B44D 1PYWD 1SSOA 4C3JB 5G3LD 4HCEA 1F9PA 3KUPA 4DK0A 2JE6I 4IUUA 1TQOA 1MSHA 2DN8A 2PYKA 4FF3A 4A3MB 1PRTF 2JEAI 2L9HA 3A8IE 2EJGC 3BVGA 1A3VA 1PRTB 2OXPA 5FO8B 1W6KA 2R92B 3M85A 1E2VA 4RGTA 1SMYC 5K36H 4K5WA 1VF5C 4QB4A 4B08A 5I6WA 1SNPA 2F3WA 1KLGD 5IGEA 4MHEA 1EWCA 2NN6G 4N9PA 1LACA 1EQTA 1KNAA 2JA5B 1O7YA 3MXGA 3E0JA 2E2DC 3ND9A 5C4XB 5C5MA 5JVG3 2B63B 4DA2A 2F0QA 1LT6D 4IALA 3QB3A 3C46A 2QDBA 2WV6D 3DWPA 3BZDB 4L63B 2EY5A 2JYOA 2KQ3A 2E2IB 1B2TA 1MI2A 4ZKBB 2AWOA 2CW0C 1Q1BA 2N55A 2F0WA 2IT1A 3BYTB 1EEFD 1G2TA 4C1NK 4YIJA 1DZ1A 4OL7A 2NVXB 1SYEA 3OWEB 1CI3M 3PUZA 1V8QA 4L8JA 1U9RA 1TWHB 5JOBA 4CJ0B 1NR2A 3I73A 1D1KA 3NHHA 2A6ED 4JBWA 1KABA 3IL8A 3K5OA 4DU9A 3J81E 3QO2A 1SJHD 3HRZC 3M7GA 4C3IB 1ENFA 1QNKA 3R2IA 3H3VC 1LO5D 1Q90A 3PIP3 1WTOA 1LV9A 5K5PA 5CV5A 1GUSA 3K5LA 1ILQA 2L55A 2NTSA 1Q1EA 1EYAA 1JOOA 1MGSA 3SE0A 1KNEA 4XQQA 1FNUA 3GTQB 1NUCA 1TY0A 1KAAA 4XT3B 2H1EA 3D4DA 3LWEA 3T53B 4FNFA 3MXNA 3PIO3 5KYLA 1L0YB 3TP8A 4IURA 1BUVT 1Z47A 1SNCA 2E74C 2F0DA 4UDUC 1I4QA 3NXWA 2XNAC 4RKLA 4PV1C 3NTIA 3OSOA 1HFGA 5FLXE 1DYQA 4CJ2C 4EQOA 3K5NA 4IUQA 2PO4A 4C3HG 1M4VA 2ID0A 5KYIA 2B2YC 2VUMB 2M00A 1D1IA 2NUCA 4KD4A 1QWYA 3HOVB 5LL6S 4TSSA 3K0YA 3GTJB 1PZKD 3TN2A 4IFDH 4C3HB 1SE4A 2EYPA 2K05A 2VNUD 3S2HB 3TMEA 3I90A 2DY8A 2G9DA 2XWJB 5JPMC 2BA1A 3KLRA 3SK8A 1PTOH 1TVXA 2QKIC 3M3YB 2F0OA 1EU3A 1GHKA 2RSOA 1I4XA 1F2ZA 1UEAB 4XT1B 1HCZA 4R8IA 3HS0C 3L3OC 3KLSA 2PZUA 3A55A 2HDLA 1HUNA 1STBA 4FXGC 2JA6B 3BYYB 1XTCD 2FMMA 2E2JB 1PRTD 3ITPA 4F88A 3EJIA 1BR9A 2Y0SB 1FNWA 1IKMA 3SHLA 2HQEA 3A7AB 3H09A 1BF4A 5M5YB 2D9UA 2RA4A 4TKOB 2IX0A 1O78A 2AUJD 4XYOA 2AQ1B 2Z1CA 4KI0A 3HOYB 1LT4D 4G4KA 1S5ED 4DXGA 3UI2A 4RHRA 3P20A 5I6YA 4PNYA 2PMZB 3Q6SA 2F1MA 3OIQA 3VA7A 4QUFA 2AQ3B 3TP7A 3BS1A 3S2DB 2KEEA 2R3ZA 4KMUC 5JEAJ 3GTPB 4A3IB 1LTBD 1EY6A 1Y8NB 2K5QA 3DWQA 2Q8TA 1CFMA 1SJED 2RDGA 4FF1A 2MUYA 2R6GA 2EY1A 3HG9A 3F2UA 2YYZA 1PFBA 3TDQA 5JEAG 3EVQA 4UAIA 4DGZA 4KD3A 1DOKA 4G57A 2QF7A 5T1GA 5IGGA 4N9TA 3EROA 4EVOA 1O80A 1GUNA 2E75C 5KNBA 2B2VC 1X32A 1EY5A 4RGMA 4A3DB 5C6AA 1AFPA 3I3CA 3CHBD 3T51B 1SBBB 4NMZA 5I2YA 2RBMA 3NP8A 1ILPA 5IOCA 5J22A 3Q24A 2HCCA 1C8CA 1CHQD 2EY6A 3QIAA 3J80E 3QJYA 1TT2A 4H13C 2NB0A 2L1BA 1RTNA 4HMJA 3A8JE 1CTMA 1RD9D 1GOZA 1KDCA 5ISRA 4KY5A 1TWAB 5C0XG 4R9WA 1B1ZA 4J6HA 4K2KA 1G8ZD 1M8AA 1XWEA 4RHSA 5CYUA 3I4NB 2F4IA 2N88A 4HSPA 1V43A 2A69D 3T56B 4OO1G 3C1FA 3T4AC 5IGFA 1Z6HA 1TIID 4ILWA 4RCOA 1I4RA 3SDZA 1PRTC 1TS3A 1ML0D 4ZYSA 4EQNA 4RH6A 2DNCA 1I6VC 3EQLC 1STYA 2F0NA 1CA5A 2B8FA 3SR1A 1WTRA 2LFNA 4K8JA 3Q22A 3I70A 3G6JB 4HTHA 3PUVA 1JE4A 2L4NA 3P1HA 2F0GA 5ELFA 2NVQB 3PO3B 4WRDA 2O5JC 1CM9A 1G291 4DK1A 2ICIA 3GTMB 1IYVA 4BS9A 3J7AF 4BBRB 3GTLB 4K14A 5DAUA 2M2LA 3VR2A 5LL6X 4DFAA 4RWSC 1ENCA 4NDXA 4M1UB 2LY7A 4O1NA 3K6OA 5E3FA 5TSSA 5K36G 2B2WC 3FDTA 5BN5A 1Z7TA 5CV9A 4BY7B 1GHJA 1T5XD 2F0LA 4HR7B 1SYBA 4CHTB 1I3QB 4QMGA 3S16B 4WJWA 1ZKOA 1ESFA 5I4DA 2VXWA 2EYFA 2NN6I 5D3IB 4PMWA 1GXDC 2VB2X 1EY7A 3T13A 2F0MA 4XQNA 1BQQT 1SYCA 2X6LA 3VR3A 2B2TC 3I72A 1Y69U 3TZUA 3I4LA 1XXGA 1TWFB 3TP6A 1ONLA 4RGNA 2B2UA 1IW7D 4H7BA 2FHTA 1WTVA 4OHJA 4O42A 3S1NB 2K1BA 2KOLA 3V96A 2IX3A 1OXTA 3S9WA 1H9JA 3DHQA 2GA4B 4FF4A 2L5TA 4FP5D 2FJ2A 4BA2I 2RDFA 3SK6A 1O7ZA 1DD2A 4RKBA 4OIKA 4TQUS 3DMUA 1EY4A 1QE6A 1VMCA 2EYJA 5CV6A 2EJMA 3S1MB 2JSOA 5KRUA 1BDOA 2R61A 2NZ1D 1EY0A 3RMHA 3NPPA 2J7ZA 3RLFA 1DOMA 4KTAA 1CA6A 2KEDA 5NUCA 4BWGB 4IZ8A 2A69C 1LTRD 4BY1B 1NCVA 3DXJC 2F0SA 4C3IG 2EJFC 5CBEE 3A8KE 3D8GA 1C4QA 1G2SA 1E2ZA 3K7AB 3MXUA 4K5XA 5KEEA 3NQIA 2EDGA 5J39A 1OXUA 3CKIB 1LT3D 4K6DA 5CMDA 3KK7A 4DAYA 2F0KA 1JWMD 1I4PA 3BDLA 2IWHA 4QCLA 2XN9C 4A3EB 2XSCA 3MA2B 5M3FB 1R4PB 3QOLA 2F0VA 5JVH3 2R7ZB 3GP7A 3LX0A 2F03A 3QWNA 1CK1A 4FXKC 4IFDG 3AMUA 2SOBA 1E0BA 1STGA 3W2DA 3BDCA 3KBGA 1SE2A 1E2WA 1DONA 4CKCA 5BN3A 1GUGA 2BA0A 2ZT9C 3SEBA 3K5MA 3KLSX 5KNDA 1WCMB 2ICEC 1PTOF 5CV4A 5KGUA 4KY7A 4Y7NB 5ELBA 1Y8PB 3X3NA 2HDMA 1PTOB 1SFOB 2L0CA 1A3TA 3X3MA 2F0PA 1S5FD 4HCSA 3S14B 4QF4A 3L7ZC 1IW7C 1LT5D 2F0JA 2K28A 5KNCA 1GUWA 1EIHA 3R2TA 1QNUA 3E6ZX 1NSNS 1WTXA 4QUCA 2MP1A 1FGBD 3FRPB 5CV8A 1WTWA 5E4WC 3GTGB 4ID6A 1S5DD 1CQFA 1HHVA 1NAPA 4XDXA 1JWUD 3AU7A 2SNMA 3OIPA 1CQVA 3FMCA 1A2UA 1NR4A 2WB1B 3MAQA 3GV6A 3VYSA 4MN3A 2BOSA 2EE1A 3GO5A 3A56A 4HSVA 1QB5D 1R9TB 1F9RA 2NYZD 3R93A 1A15A 1PMRA 2IL8A 1K8MA 5FK9C 2LS01 1DCZA 2ZXOA 3SK5A 1G91A 1Y1VB 1RKNA 2O5IC 1LTAD 5CORA 2V4DA 4OIJA 5JJZA 2SNSA 1HXYD 1BCPF 4C56C 1O7LA 2K32A 2ZXPA 4V190 4X3SA 1OXVA 4F7XA 1BCPB 5EPLA 5EPJA 4H0LC 1U4MA 1YNNC 2M9VA 3H0GB 3NSWA 3MFGA 5CGKA 2F0UA 4CKBA 2LKVA 1IL8A 1GUOA 2J0TD 1K8OA 2Q8RE 5DNFA 2A5HA 5C4ZA 1ZXTA 1A6XA 3HP3A 5DM73 4IUPA 3ONAB 2C5CA 3LWUA 3HOZB 2WAQB 1KDBA 4RFBA 3DEPA 2AQ2B 4F8MA 1PFNA 1LABA 4U68A 1H9KA 3K59A 5IGBA 4G7OC 2NVYB 2EYLA 3QG1A 1HPCA 4K6LA 1ESRA 1HQRD 2OEOA 4Q0FA 3S17B 1SDFA 3OMGA 4Z9CB 3K57A 5LHY1 5EBDA 5J1ZA 3S15B 1JCKB 2B39A 1XYIA 4A93B 1JICA 5C0XJ 5DM63 5CV7A 1STHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK8 A;  2F0S A;  4J1M A;  4J6H A;  4K2K A;  2EY2 A;  4F7X A;  2EYF A;  2F0P A;  2PZT A;  2F0H A;  1ENA A;  4QF4 A;  2F0O A;  5C3X A;  1EY7 A;  4K5W A;  3T13 A;  4QB4 A;  3D8G A;  2F0M A;  5CV5 A;  5I6W A;  1SNP A;  2F3W A;  3D4W A;  3OWF A;  4S3S A;  5K5P A;  1SYC A;  4LAA A;  4B9W A;  2F0J A;  5IGE A;  1SYG A;  3RUZ A;  1F2Z A;  4K5X A;  4N9P A;  5KEE A;  3HZX A;  5M9O A;  5J39 A;  3C1F A;  1F2M A;  3NUC A;  4KJO A;  3VA5 A;  5IGF A;  1EY9 A;  2EY1 A;  5EKL A;  1EYA A;  2OF1 A;  1F2Y A;  3T16 A;  1JOO A;  5CGK A;  5IGD A;  2F0T A;  2F0U A;  2F0E A;  4K6D A;  3TP6 A;  1NUC A;  2LKV A;  3EVQ A;  2O4X A;  1EY8 A;  3P75 A;  2PZU A;  1KAA A;  4H7B A;  5IOD A;  4EQN A;  3H6M A;  2F0K A;  4I65 A;  1NSN S;  1STA A;  3TP5 A;  3D4D A;  5F2D A;  5KIX A;  1STY A;  4KV6 A;  4TRD A;  4K5V A;  5IIF A;  1EYD A;  3BDL A;  5C5M A;  1STB A;  3R3O A;  2F0N A;  1SYD A;  2EYH A;  4DGZ A;  5C4Z A;  4KD3 A;  3SR1 A;  2F0Q A;  4K2L A;  5KYL A;  4IAL A;  5CV8 A;  4HMI A;  3TP8 A;  4ID6 A;  3QB3 A;  4K8J A;  4G57 A;  1EZ6 A;  3S9W A;  3MVV A;  1SNC A;  2F0D A;  2QDB A;  3D6C A;  4KY6 A;  5JAV A;  5CC4 A;  3NXW A;  4HTH A;  3NQT A;  3ITP A;  5IGG A;  4N9T A;  3QOL A;  2F0V A;  2SNM A;  3DHQ A;  1SND A;  1KDB A;  1STN A;  3ERO A;  3EJI A;  3NK9 A;  3P1H A;  2EY5 A;  3MHB A;  4EQP A;  5C3W A;  1JOQ A;  2F0G A;  2KQ3 A;  4RKL A;  4EVO A;  5HUR A;  1SNM A;  3LX0 A;  2WAC A;  3OSO A;  1A3U A;  5EGT A;  4ODG A;  5I9P A;  1KDA A;  3E5S A;  3SHL A;  1EY5 A;  2HQE A;  1A2U A;  1SNQ A;  4WRD A;  4F8M A;  5C6A A;  3C1E A;  2F0W A;  3OMC A;  4EQO A;  4PMC A;  2SOB A;  4NP5 A;  4YIJ A;  1IHZ A;  3ERQ A;  4ME5 A;  5HGT A;  1A2T A;  1STG A;  4K14 A;  4K8I A;  2RDF A;  5DAU A;  4OL7 A;  4E6I A;  5IGC A;  1SYE A;  3SK6 A;  4DF7 A;  3BDC A;  1JOK A;  2PW7 A;  4ZUI A;  4RKB A;  5IGB A;  1SNO A;  4ZQ3 A;  5KYI A;  1EZ8 A;  4NMZ A;  2PZW A;  5C4H A;  2PW5 A;  2F0I A;  2RBM A;  2EYL A;  2PQE A;  1U9R A;  3NP8 A;  4DFA A;  2RKS A;  2M00 A;  1EY4 A;  3DMU A;  5I9O A;  5IOC A;  5J22 A;  2NUC A;  4KD4 A;  4KHV A;  1ENC A;  2F0F A;  2OEO A;  5E1F A;  5JOB A;  4NDX A;  2EY6 A;  2EYJ A;  1TR5 A;  5CV6 A;  3NHH A;  5E3F A;  3MEH A;  4WOR A;  4ZUJ A;  1TT2 A;  5EKK A;  3SK5 A;  2EXZ A;  4MIU A;  3V2T A;  1KAB A;  1II3 A;  3OMG A;  3PMF A;  5KRU A;  1TQO A;  5CV9 A;  4HMJ A;  4IUN A;  5I6Y A;  2EYO A;  5DEH A;  4PNY A;  4KJN A;  4DU9 A;  1AEX A;  1RKN A;  5J1Z A;  1EY0 A;  3MXP A;  5CV4 A;  5KGU A;  2EYP A;  1KDC A;  2F0L A;  1EQV A;  1SYF A;  2PYK A;  3HEJ A;  4KY7 A;  5ISR A;  1SYB A;  4KY5 A;  4KTA A;  5C5L A;  4PMB A;  4B9X A;  3SXH A;  3TP7 A;  5NUC A;  4NKL A;  4QMG A;  3QOJ A;  2SNS A;  4IZ8 A;  3TME A;  5CR3 A;  3U9O A;  3SK4 A;  3MZ5 A;  4R8N A;  2F3V A;  1A3V A;  1EYC A;  1EY6 A;  2ENB A;  2KHS A;  1JOR A;  2OXP A;  1A3T A;  5CV7 A;  1STH A;  2EYM A; 
#chains in the Genus database with same CATH topology
 2JXM B;  4I7Z C;  4HAE A;  3CPW A;  4GNX B;  4OO1 I;  1WD0 A;  4N8F A;  2H4O A;  3P7J A;  2KA7 A;  1NMF A;  4P72 A;  1D2B A;  3OOC A;  1W2B A;  1DXM A;  3D4R A;  5E4X A;  1WD1 A;  2NWG A;  4KJO A;  4A3B G;  5EKL A;  3A7L A;  3C2P A;  5IGD A;  1UUP A;  4FYD A;  4GZY C;  1B8A A;  2IX1 A;  5EQ0 A;  1Q3L A;  3P75 A;  5FLM H;  2L12 A;  4M8A A;  5F2D A;  2B29 A;  4TRD A;  2WKC A;  1KL9 A;  1EYD A;  1CSP A;  4KK7 A;  3VYU A;  1QJO A;  1HTP A;  1DJR D;  4K2L A;  1YEZ A;  1PTO D;  2JA7 H;  1Q8I A;  1YJW A;  1SEB D;  4A3B B;  3GQB A;  3I4M G;  2HT1 A;  3N6R A;  1H9S A;  2SEB D;  1CUK A;  3VR5 A;  3NQT A;  4JI4 Q;  1BXT A;  1STN A;  1F77 A;  1Y8O B;  1LLR D;  3DEO A;  1Y1W H;  1D6E C;  1VS0 A;  4NPS A;  1TS4 A;  2Z0S A;  3C1E A;  2KUM A;  4L6T B;  3OMC A;  3K58 A;  3I4M B;  4AQY Q;  5IYD H;  1A2T A;  3TSS A;  3CXC A;  4YWM A;  1YZ6 A;  4BBR G;  1WTQ A;  2K5N A;  1EZ8 A;  1TS5 A;  2FFK B;  3KDF B;  5C4H A;  3A5U A;  5I9O A;  2R93 G;  4KHV A;  1BVS A;  5E1F A;  1X6O A;  3NWT A;  4A3J B;  4JI0 L;  1TR5 A;  2G9H D;  4DKA C;  2AMC B;  2K5W A;  4UP7 A;  2EZV A;  1K83 B;  2KCC A;  1HR0 Q;  2EXZ A;  4A3G G;  3CCU A;  1MSG A;  3PMF A;  4DR2 Q;  4ABN A;  3ULL A;  4KJN A;  3HOX B;  4OX9 L;  2BH2 A;  3MXP A;  2AKW B;  5IY0 A;  3RZO B;  1DOL A;  3HEJ A;  5IT9 L;  3N52 A;  2R93 B;  4YHH Q;  1QOH A;  3U9O A;  3RZD B;  4DV7 Q;  4G7Z C;  4DAV A;  1CZG A;  4A3G B;  3PF5 A;  1B9M A;  4J1M A;  2EPB A;  3ZYY X;  2OT2 A;  1PDQ A;  1XX8 A;  3GTO B;  4U67 3;  4JOI C;  1ZYR D;  1S4Z A;  2NZO A;  3UDI A;  4A3J H;  1S5C D;  4IJL A;  3OWF A;  1K83 H;  1EWI A;  3STB D;  2HHH Q;  1I5F A;  2E2H H;  4RA8 A;  2K50 A;  3JC6 6;  5D65 A;  5FOB B;  4QGU A;  3URY A;  3NE5 B;  4FXD A;  2KVM A;  5LMN W;  1VDZ A;  3HOX H;  3T16 A;  4CGY B;  1BKB A;  2CH4 W;  2E8G A;  3CU7 A;  1N34 Q;  3RZO H;  3FEW X;  4KN7 C;  4LFA L;  1HNW Q;  5IOD A;  2NVT B;  4DXF A;  2KEN A;  4EX5 A;  1STA A;  4A4I A;  1KQS A;  3HFZ B;  1CZW A;  5KIX A;  3CF5 A;  4KV6 A;  1PLF A;  4RGO S;  4DNR B;  4FO2 A;  3OHX C;  4OWX B;  3HOU H;  1VQ8 A;  3V05 A;  1EZ6 A;  4QIW B;  2QCP X;  1JQY D;  3MC0 B;  3ERS X;  1UNS A;  5CC4 A;  2EIF A;  1BCP D;  1SND A;  1H9R A;  2CFM A;  2ZTD A;  5C3W A;  3CC4 A;  4Q5V A;  3G4S A;  3RD4 A;  1H95 A;  1A3U A;  4HJ7 A;  3CD6 A;  3EA6 A;  1GO3 E;  4NP5 A;  1I6H B;  2IHF A;  2RHS B;  5IWA L;  2KJX A;  1K3B C;  3C3L A;  5M5W B;  1EEI D;  1B4O A;  1WTH A;  1LTT D;  3VYT A;  1JOK A;  2LSS A;  4IO9 A;  2JA8 H;  1SNO A;  1QG7 A;  4RAU C;  4AYB B;  3FKI B;  2PW5 A;  2F0I A;  4R4I A;  4KKS A;  2RKS A;  1S72 A;  5C44 B;  4R4O A;  2EVB A;  4HED A;  4R4Q A;  1JJG A;  2Z4I A;  2FMC A;  4C3J H;  3H91 A;  3V2T A;  1VQD A;  1HRJ A;  1UE6 A;  3BDO A;  3JAM L;  4JBK A;  4BBS B;  2C9O A;  1DGS A;  1LTG D;  5E7N A;  1SYF A;  3UDX A;  1TWG B;  1EL0 A;  1I94 L;  3KF8 A;  1H9M A;  4B9X A;  4PMB A;  4G7H C;  1I50 B;  3NBI A;  4A3F B;  4NXM Q;  1I6H H;  5GQO A;  4JI8 L;  5M5W H;  4LF7 Q;  1X3E A;  2F3V A;  2KHS A;  1EYC A;  2BDO A;  3IFT A;  4A3M H;  3CC2 A;  2IJ0 A;  2N49 A;  4EGV A;  3FKI H;  2CH4 A;  1FVI A;  1RTO A;  4GN3 B;  3DUZ A;  2KEC A;  1EWH A;  1XNR Q;  5C44 H;  2R92 H;  1HZA A;  2CVR A;  5IT9 c;  3D3R A;  3PO2 B;  2GN5 A;  1HA6 A;  3LGJ A;  1V1O A;  3LNN A;  1EU4 A;  1EY9 A;  1SAP A;  1PTO C;  4BBS H;  2YTY A;  3W3A A;  2YU9 B;  4IUV A;  1L0X B;  3I2Z A;  1TWG H;  4B3R L;  4A3F H;  1I50 H;  5C4J B;  4JV5 L;  4DUY L;  4DPG A;  2Z8L A;  4HN7 A;  2QEJ C;  1CT1 D;  3R3O A;  5D14 A;  2B2Y A;  2JN4 A;  2K01 A;  1RIP A;  5C4X H;  1YNJ D;  1AE2 A;  1BBU A;  3HOW B;  5JJI A;  4X66 Q;  1YHA A;  3D6C A;  2K04 A;  5EBC A;  2B63 H;  2NN6 H;  4KY6 A;  1PH9 A;  2RDH A;  1UE5 A;  3PO2 H;  2EOT A;  4IFD I;  4X62 L;  2D5D A;  1HUM A;  1SE3 A;  3NK9 A;  1W3S A;  1YHB A;  1M90 C;  2WKD A;  2CQA A;  5IYC H;  1H9S B;  4QY7 A;  1ZEQ X;  4IFD J;  1TWC B;  2BE5 D;  1W6J A;  3R8B A;  1YNN D;  3WOE A;  2E2I H;  4GKK L;  1AE3 A;  3E9I A;  1C7Y A;  4PMC A;  2MGS A;  2B2U C;  1GUT A;  1R4Q B;  4X3K A;  1Q46 A;  3NBH A;  5IGC A;  3Q0A A;  2RQX A;  4C2M B;  4HJA A;  3WDN A;  5JPN C;  1MBY A;  3HKZ G;  4F87 A;  2Q2U A;  2TMP A;  3HOW H;  1YJ9 A;  3T1Y Q;  1VMP A;  1WVL A;  1G6P A;  4FVM A;  4K0K L;  2CWA A;  1XTD A;  4CBV A;  2RVL A;  2V1C C;  3BVZ A;  1IYU A;  2K5D A;  3FHW A;  2JP1 A;  4IQZ A;  3J7Z C;  1RF2 D;  1TXY A;  2EYO A;  2FIN B;  5EPK A;  3S1Q B;  5A2Q E;  1KIX A;  3OPO A;  3HKZ B;  4P2C B;  5HGQ A;  1SRO A;  2QGQ A;  3G48 A;  1ZYR C;  2ALY B;  4DUZ Q;  3FPU B;  3NEL A;  3D6W A;  2B8G A;  3STB C;  4C2M H;  4XIG S;  1KXL A;  2EYM A;  1HZ9 A;  2A19 A;  4V0B A;  3KFU A;  3JAM c;  1B3A A;  1AN8 A;  4LMQ D;  4XYQ A;  5C3X A;  4CDE C;  1LTS D;  2VB3 X;  2Q2I A;  1LTI D;  2I46 A;  1YNX A;  2HIV A;  5FKA C;  4DV3 Q;  1VQK A;  2E76 C;  1MIU A;  1HZB A;  3VA5 A;  3J81 L;  1JR0 D;  1OO9 B;  3PUY A;  1F2Y A;  4NXN Q;  3EN2 A;  4ZKC B;  4POF A;  1PV4 A;  2PPB C;  3TP5 A;  1Q86 C;  3H94 A;  2NBF A;  1BCP C;  4DR6 Q;  3GTQ H;  2OQ0 A;  3IAY A;  1S5B D;  2DNE A;  1KTK A;  5COY A;  2XWB B;  3MVV A;  1Q12 A;  4C1N I;  4RG1 A;  5IP7 G;  1PVO A;  4DV2 Q;  5A2Q L;  3DM1 A;  3A54 A;  2UUC L;  3PV0 A;  4LF6 Q;  1JOQ A;  3MHB A;  4LF4 L;  1L2F A;  3AFP A;  1WTP A;  1FR3 A;  3BVM A;  4DR7 Q;  3NWS A;  1SNM A;  1F9S A;  2WAC A;  3RNU A;  2VQE L;  5ELD A;  4L5Q A;  4KN4 C;  2WB1 G;  4A3K G;  4UPA A;  4K8I A;  4JI3 L;  4E6I A;  2A6H D;  5AJ3 Q;  3S1R B;  1SLJ A;  2PZW A;  1AW7 A;  1U0L A;  3J7A 5;  1RCV D;  4OGQ C;  3PUX A;  3DWA A;  1NTG A;  2D62 A;  2VUM H;  3MEH A;  2TSS A;  3AYH B;  1FNV A;  4ZUJ A;  2Q2H A;  3M4Y A;  5EKK A;  3WOF A;  2IW3 A;  4MIU A;  2XIW A;  2A68 D;  4A3K B;  3HOV H;  1HTL D;  1UEB A;  5FLX L;  4L5T A;  3MFY A;  1JC7 A;  5DEH A;  3UDF A;  2X69 A;  1AEX A;  4IN3 A;  1EQQ A;  3CCJ A;  1K0S A;  1Y1V G;  4C3H H;  2NTT A;  2BH8 A;  5C5L A;  1TY2 A;  1HNZ Q;  4YY3 Q;  5I2X A;  4B3S L;  4FF2 A;  1XMQ Q;  2K7V A;  2AWN A;  3KJP A;  2OTL A;  4KKT A;  3I8Z A;  3KF8 B;  2EY2 A;  1T5E A;  2PZT A;  3D31 A;  2A74 C;  1JWS D;  2DJF C;  3NTK A;  4CJ1 B;  1ET9 A;  1ICW A;  1EOV A;  3M3Y H;  3NTH A;  5GAH C;  1HFN A;  2I5L X;  3HZX A;  3CP0 A;  3NUC A;  4DNT B;  2B2V A;  1IBL L;  1YNJ C;  2CHB D;  5FO7 B;  2OF1 A;  1U4P A;  2HIX A;  2F0E A;  3CQZ B;  3GD7 A;  1EYG A;  1F9Q A;  1PH4 A;  5DLQ E;  2A73 B;  1N32 L;  3OW7 A;  5G3L F;  1V1P A;  3H6M A;  3TZD A;  2F4V Q;  4GNX C;  1J9O A;  3HGB A;  5IIF A;  2XVS A;  1HA5 A;  4WFN 3;  4JI7 Q;  2EYH A;  2ZXR A;  2LXJ A;  4CKE A;  2A6E C;  4J8Q A;  1KLU D;  1G6Z A;  4P75 A;  1YVC A;  2BE5 C;  3J81 c;  1OXX K;  2BDN A;  2MNA A;  1MD2 D;  3FPP A;  4IPD A;  1PFM A;  5C3E B;  1RL2 A;  3SVM A;  1JB3 A;  5A35 A;  4RMF A;  1VQM A;  4X3U A;  4EQP A;  4YWL A;  2WAQ G;  1D5Z C;  1YI2 A;  3E5S A;  1E7Z A;  2VY3 A;  1X3P A;  3VR4 A;  1A0I A;  1CKN A;  3M4O B;  3U9S A;  3KLW A;  3ND8 A;  3GTK B;  3TBI B;  2AUK A;  3ERQ A;  5HGT A;  1JE5 A;  2N78 A;  4DV6 Q;  4DAP A;  5M5Y H;  4DF7 A;  4ZLT F;  1PA6 A;  1E1T A;  3A5Z B;  2BCO A;  5I9P A;  3T1H L;  2PNR C;  2PQE A;  4AQY L;  1JJC B;  1Q8K A;  1X3F A;  2I5M X;  4OEL B;  5M5X B;  4R4T A;  2F0F A;  3NBH B;  5BN4 A;  1PZI D;  4B3M Q;  1I4H A;  1EOT A;  2UXB Q;  3BU2 A;  5C3E H;  4DK6 C;  2WFW A;  2IPK D;  1VQH A;  1VCI A;  2ZM6 Q;  2K6A A;  1U4R A;  3BG3 A;  3HOY H;  4RCN A;  2UUB Q;  2Z6B A;  3I91 A;  3W1G A;  1D5X C;  3G6E A;  2ZJP A;  1TU2 B;  1HR0 L;  3VYR A;  1U4L A;  3CCQ A;  5JJK A;  3G7L A;  3D0F A;  2WII B;  4X3T A;  1AZQ A;  3CRK C;  4NKL A;  1J8I A;  4WJ3 M;  4XQJ A;  2K33 A;  4R8N A;  2MJ8 A;  2XRS D;  4ZRZ A;  2I07 B;  4DN4 M;  3D4W A;  1GD7 A;  2MPM A;  1P16 A;  2R7D A;  3S2D H;  1EIF A;  4OEM B;  5FLX c;  3GTP H;  2HCI A;  3F2B A;  1D5M C;  2F0H A;  1ENA A;  1HZC A;  2Y0S E;  4DV5 Q;  1N36 Q;  2DY7 A;  2K03 A;  1FJG Q;  1HNX Q;  1BNZ A;  2JA7 G;  4LAA A;  1X3Q A;  3J7Y W;  5C0X I;  1NY4 A;  1PXU A;  5M9O A;  1F2M A;  2XRQ D;  4H44 C;  1HH2 P;  1RHP A;  2WIN B;  4GN4 B;  4OXP A;  1RDP D;  5D3D A;  2J4X A;  4JYA Q;  2LMC B;  1SMY D;  4JPB W;  1WOC A;  1J6Q A;  3L0O A;  1Y1W G;  2O4X A;  5ELE A;  1B9N A;  1B70 B;  4I65 A;  1EIG A;  3IFD A;  5ELC A;  1GJX A;  2JA7 B;  2XGT A;  4K5V A;  1FD7 D;  1N34 L;  1SYD A;  5IYD G;  3PUW A;  4HIM A;  1HNW L;  4L5S A;  2HUG A;  2PMZ E;  1TKW B;  1ROD A;  3K7U C;  5M3M B;  1UAP A;  1Y1W B;  2B2W A;  4PQX A;  2A6H C;  1TS2 A;  4JK1 C;  4ZK9 B;  5JEA H;  1EQR A;  3J7A V;  2RCF A;  5EGT A;  2H5X A;  1SNQ A;  5EJW A;  1VQ9 A;  1IBK L;  3M4Q A;  3TRZ A;  1C48 A;  5ELO A;  1QCB D;  1IHZ A;  4IUT A;  2VQF Q;  4ME5 A;  5IT9 E;  1AP0 A;  4XXE A;  1QIL A;  1E3P A;  4A3D H;  2A68 C;  4ZUI A;  4LFC Q;  4BXX H;  5T1I A;  1BBX C;  2MHV A;  3FVQ A;  2CW0 D;  3UE1 A;  1SXT A;  1AH9 A;  4WOR A;  4LK1 C;  3TEH B;  5M3M H;  2B2T A;  1OXS C;  2WP8 J;  1I4G A;  2Q8I B;  5CBA E;  3NEM A;  4A3J G;  2QIL A;  1BO0 A;  1II3 A;  4IUN A;  2KCN A;  5EKI A;  1V9P A;  1EFI D;  2D2C C;  4QQB X;  3MTS A;  1XNQ Q;  1EQV A;  3J81 j;  2SDF A;  1CHP D;  3HOX G;  3SXH A;  1XPO A;  2JEB I;  5CR3 A;  3SK4 A;  4X64 Q;  3MZ5 A;  1IBM Q;  5LMU Q;  4XTC S;  2ENB A;  1JOR A;  1TWA H;  3IKJ A;  4ZAI A;  4BA1 I;  4NXM L;  3JAM i;  3GV3 A;  4LF7 L;  3J80 L;  3AB9 A;  4DR3 Q;  1QVG A;  5GAE C;  2E2H B;  3HOU G;  4S3S A;  4DR4 L;  4NW2 A;  4B9W A;  1RJT A;  1SYG A;  3RUZ A;  4DV4 Q;  4ULL A;  1ET6 A;  4UP9 A;  3EFX D;  4A3C H;  1L1O B;  3I4N H;  1E22 A;  2UU9 Q;  3L9A X;  1HQM C;  1B50 A;  2F0T A;  2O2L D;  5C0X H;  3KBX A;  1BOS A;  1EY8 A;  4PG3 A;  3Q23 A;  4KHZ A;  4IPC A;  3HOU B;  1K3R A;  1STE A;  4GOP A;  2X6G A;  4KKU A;  1AZP A;  2Z4H A;  4L5R C;  3VR6 A;  4HMI A;  3O13 A;  1V1P B;  2JA8 G;  5FO9 B;  5JAV A;  4OO1 H;  3U50 C;  1UE1 A;  3MWY W;  1K0R A;  3QOJ A;  2RSN A;  4X66 L;  1DM0 B;  1FYC A;  5HUR A;  4B3T Q;  4C3J G;  5JJL A;  2DGY A;  4ODG A;  1KDA A;  2L11 A;  3JAM E;  1F2L A;  1IKL A;  1NBW A;  3M7N A;  4JI1 L;  2NVQ H;  2JA8 B;  3PO3 H;  4LJZ C;  3U58 A;  5AFW A;  2MO0 A;  1B53 A;  2PW7 A;  1CKN B;  1VF7 A;  2PCF B;  4ZQ3 A;  3GTM H;  3GTL H;  3RLN A;  3CRL C;  1PZJ D;  1B44 D;  1PYW D;  1SSO A;  4A3M G;  4C3J B;  2MFI A;  1MJC A;  4AYB G;  4POG A;  3FKI G;  5G3L D;  4HCE A;  4CDC C;  1F9P A;  5C44 G;  1J5E Q;  3KUP A;  4DK0 A;  2R92 G;  2JE6 I;  4IUU A;  3T1Y L;  1TQO A;  1MSH A;  5LMN Q;  2DN8 A;  2PYK A;  1MJE A;  4FF3 A;  4BY7 H;  4A3M B;  1PRT F;  2JEA I;  4BBS G;  2L9H A;  3A8I E;  2EJG C;  3BVG A;  1IXR A;  1A3V A;  4A3F G;  1PRT B;  2OXP A;  3PCO B;  5FO8 B;  1W6K A;  1I3Q H;  2R92 B;  3S16 H;  3FP9 A;  3M85 A;  1E2V A;  4RGT A;  1BBW A;  1VQN A;  1SMY C;  2PI2 E;  5GAD C;  5K36 H;  4K5W A;  1VF5 C;  4QB4 A;  4B08 A;  5I6W A;  5C4X G;  1SNP A;  2F3W A;  1KLG D;  4MTK A;  5IGE A;  2F3I A;  4MHE A;  1EWC A;  3CME A;  2NN6 G;  4N9P A;  2B63 G;  1LAC A;  4A75 A;  3OTO Q;  1EQT A;  2UXC Q;  3PO2 G;  1KNA A;  2JA5 B;  1O7Y A;  3MXG A;  4KLK A;  3E0J A;  5IYC G;  2E2D C;  4DV3 L;  3J80 c;  2QDL A;  3E3X A;  3ND9 A;  5C4X B;  2QA4 A;  4NXN L;  5C5M A;  5JVG 3;  2B63 B;  4DA2 A;  4N8X 1;  2F0Q A;  4HIO A;  3K0X A;  1LT6 D;  4IAL A;  3PIP A;  1VQG A;  4OWT B;  3QB3 A;  3C46 A;  3J81 i;  4JI0 Q;  2QDB A;  1PYS B;  2WV6 D;  3S1N H;  3DWP A;  1MHW C;  3HOW G;  3BZD B;  3CMA A;  3RLO A;  1K73 C;  1S40 A;  2RCN A;  1B7Y B;  4L63 B;  2EY5 A;  2JYO A;  1X65 A;  2KQ3 A;  2E2I B;  1B2T A;  3EBE A;  4UP8 A;  4MTN A;  1MI2 A;  3TS0 A;  2JA5 H;  2I0Q A;  4ZKB B;  2AWO A;  4LF6 L;  2CW0 C;  1Q1B A;  4DR1 Q;  2PNH A;  2N55 A;  2F0W A;  2IT1 A;  4DR7 L;  3BYT B;  1EEF D;  1G2T A;  2GVA A;  4C1N K;  4YIJ A;  2ATW A;  1DZ1 A;  4OL7 A;  2NVX B;  1SYE A;  3PIO A;  3KYH C;  3EIV A;  3OWE B;  1CI3 M;  3PUZ A;  1V8Q A;  4JI5 L;  4L8J A;  1U9R A;  1TWH B;  4LUZ A;  5JOB A;  4CJ0 B;  1ASZ A;  1NR2 A;  3I73 A;  5AJ3 L;  1D1K A;  3NHH A;  4X6A H;  2CCZ A;  2A6E D;  3I55 A;  4JBW A;  1KAB A;  2ZJR A;  3IL8 A;  1QVF A;  3K5O A;  4DU9 A;  3BJU A;  5L37 A;  4DR5 Q;  3S1M H;  3J81 E;  3QO2 A;  1SJH D;  4LFB Q;  3HRZ C;  4H02 A;  4DNI A;  2NVX H;  4ZCK A;  2FXQ A;  3M7G A;  4JI6 Q;  4C3I B;  2K4K A;  3F2D A;  1A62 A;  1ENF A;  1QNK A;  3R2I A;  4P74 A;  1FL0 A;  2A1A A;  1TWH H;  4BY1 H;  1IYJ B;  4YCU A;  1HNZ L;  3H3V C;  1LO5 D;  1Q90 A;  3PIP 3;  1WTO A;  1LV9 A;  5K5P A;  3CCV A;  5CV5 A;  1GUS A;  4GS3 A;  3K5L A;  1ILQ A;  1QVC A;  3MEF A;  2L55 A;  2NTS A;  1Q1E A;  1EYA A;  1JOO A;  1MGS A;  3SE0 A;  1KNE A;  4XQQ A;  1FNU A;  1GM5 A;  1NUC A;  3GTQ B;  3PQI A;  1TY0 A;  4JBM A;  1KAA A;  4XT3 B;  2H1E A;  4QL5 A;  3D4D A;  3LWE A;  3T53 B;  4FNF A;  4PZ7 A;  4IPG A;  4C3I H;  2QEX A;  3MXN A;  3PIO 3;  5KYL A;  4AH6 A;  1L0Y B;  3TP8 A;  2F4V L;  2IHE A;  4IUR A;  1BUV T;  1Z47 A;  1SNC A;  2E74 C;  2F0D A;  4UDU C;  5J3B A;  4GOP B;  4JI7 L;  1I4Q A;  3NXW A;  1N33 Q;  1VQ6 A;  4A3E H;  1YIT A;  2XNA C;  5M3F H;  1WJJ A;  2VUM G;  4RKL A;  4PV1 C;  3H3V I;  3NTI A;  3OSO A;  3WWV A;  3HOV G;  1HFG A;  1WYD A;  5FLX E;  1DYQ A;  1I94 Q;  4CJ2 C;  2E5L L;  2R7Z H;  4DV0 Q;  4EQO A;  4GN5 A;  3K5N A;  4HJ8 A;  4HJ9 A;  4IUQ A;  2PO4 A;  4C3H G;  1M4V A;  2ID0 A;  5KYI A;  4HJ5 A;  1X9N A;  2B2Y C;  2VUM B;  2M00 A;  1D1I A;  4LNQ A;  2NUC A;  4KD4 A;  1YIJ A;  2OCE A;  1QWY A;  3HOV B;  5LL6 S;  4TSS A;  1YJN A;  3K0Y A;  3KF6 A;  4UHV A;  3GTJ B;  1PZK D;  3TN2 A;  4IFD H;  4B3M L;  4C3H B;  4P71 A;  2MQH A;  2UXD L;  1SE4 A;  2EYP A;  2K05 A;  2VNU D;  2ZM6 L;  1XMO L;  1CKO A;  3S2H B;  2C35 B;  4JV5 Q;  3W5O A;  1WCM H;  2R7F A;  3TME A;  3I90 A;  2EXD A;  2DY8 A;  2G9D A;  2XWJ B;  5JPM C;  2BA1 A;  3KLR A;  4DV1 Q;  3SK8 A;  1QZG A;  1PTO H;  1SFO H;  1TVX A;  2ZTC A;  2QKI C;  3M3Y B;  2F0O A;  4GKJ L;  1VQB A;  1EU3 A;  1GHK A;  2RSO A;  1EUJ A;  1I4X A;  3NEN A;  4X62 Q;  1F2Z A;  3S14 H;  3GTJ H;  4A3L H;  1UEA B;  3W1B A;  1A63 A;  2KCM A;  4XT1 B;  1HCZ A;  4R8I A;  3HS0 C;  2Z6K A;  3L3O C;  3KLS A;  3S2H H;  1ICF B;  2PZU A;  3A55 A;  2HDL A;  1HUN A;  1X54 A;  4LF9 L;  2Y0S G;  4JYA L;  1CSQ A;  1STB A;  4FXG C;  1KHI A;  2JA6 B;  1L1O A;  3BYY B;  1XTC D;  2F52 A;  1YBY A;  1SE8 A;  2FMM A;  3AEV A;  4LF8 Q;  2PI2 A;  2E2J B;  4K0K Q;  1EIY B;  1PRT D;  5IYB H;  4QJF A;  5IP7 H;  3ITP A;  3G71 A;  4F88 A;  1VQE A;  3EJI A;  5C3E G;  1BR9 A;  4CDF C;  1O7I A;  1FNW A;  2Y0S B;  4WJ4 A;  1IKM A;  3HOY G;  5IP9 H;  3SHL A;  2HQE A;  3A7A B;  3H09 A;  1BF4 A;  5M5Y B;  2D9U A;  2RA4 A;  3CCM A;  4LF5 Q;  4TKO B;  2IX0 A;  1O78 A;  2JA6 H;  2AUJ D;  4XYO A;  2AQ1 B;  2Z1C A;  4KI0 A;  2E2J H;  3HOY B;  4Y52 H;  1LT4 D;  2PQA A;  1R9T H;  4G4K A;  1S5E D;  3F8T A;  4JI4 L;  4DXG A;  3TQY A;  3RR5 A;  3UI2 A;  4RHR A;  2N3S A;  3P20 A;  5I6Y A;  4PNY A;  2PMZ B;  3Q6S A;  2F1M A;  3OIQ A;  3VA7 A;  4QUF A;  2AQ3 B;  2KHI A;  3CAM A;  3QR8 A;  3TP7 A;  3BS1 A;  3S2D B;  1NE3 A;  2KEE A;  4X65 Q;  2R3Z A;  4KMU C;  2OTJ A;  5JEA J;  3UE0 A;  3RN2 A;  3GTP B;  4DK3 C;  4A3I B;  1LTB D;  1EY6 A;  1Y8N B;  3I4O A;  2K5Q A;  3DWQ A;  3TS2 A;  4X64 L;  1M1K C;  2Q8T A;  3OW2 A;  1X55 A;  1CFM A;  1SJE D;  2WB1 E;  2RDG A;  4FF1 A;  3H15 A;  2MUY A;  3BZC A;  2R6G A;  2VQE Q;  3GDE A;  4DR2 L;  2EY1 A;  3HG9 A;  1UWV A;  3F2U A;  2YYZ A;  1PFB A;  3TDQ A;  4KHP Q;  5JEA G;  3EVQ A;  5FLM G;  3H0G H;  5FJ8 H;  4UAI A;  1VQ5 A;  4HID A;  4JI3 Q;  2UU9 L;  2YTX A;  4YHH L;  3ER0 A;  4LUO A;  4A3I H;  1L0W A;  4JG2 A;  1GKH A;  4DGZ A;  4DV7 L;  4KD3 A;  1DOK A;  3L2P A;  4A3D G;  4G57 A;  1PH8 A;  4BXX G;  2QF7 A;  1LYL A;  1SR3 A;  2D0O A;  3MXN B;  5T1G A;  2K5V A;  4MNO A;  4N9T A;  5IGG A;  3ERO A;  4LW1 A;  2HHH L;  5M3M G;  4EVO A;  1O80 A;  1GUN A;  2E75 C;  3HOZ H;  5KNB A;  2B2V C;  1X32 A;  5BR8 Q;  1EY5 A;  2ES2 A;  2DJG C;  4JI2 Q;  4RGM A;  4A3D B;  5C6A A;  1AFP A;  3I3C A;  3CHB D;  4JCV E;  1KD1 C;  1PH6 A;  1K8A C;  3T51 B;  1SBB B;  4NMZ A;  5I2Y A;  2RBM A;  2NZH A;  3NP8 A;  1ILP A;  5IOC A;  5J22 A;  3Q24 A;  4HIK A;  4JOI A;  2HCC A;  2NVY H;  1QUQ A;  1CHQ D;  2EY6 A;  1C8C A;  3QIA A;  1VQ4 A;  3J80 E;  3QJY A;  1TT2 A;  4H13 C;  4JW0 A;  2NB0 A;  1N9W A;  2L1B A;  1RTN A;  2QW7 A;  4HMJ A;  3A8J E;  1IBL Q;  1SN8 A;  1CTM A;  3S17 H;  3RN5 A;  1RD9 D;  1GOZ A;  4A3C G;  1KDC A;  1J5E L;  1K9M C;  3KF6 B;  1N32 Q;  5ISR A;  3I4N G;  4KY5 A;  1TWA B;  2I5H A;  3S15 H;  1GVP A;  5LMN L;  5C0X G;  4R9W A;  4A93 H;  3PGZ A;  2WAQ E;  1B1Z A;  2VW9 A;  4J6H A;  4K2K A;  1G8Z D;  2UUA Q;  1M8A A;  1XWE A;  1V1Q A;  4RHS A;  5CYU A;  1HR0 W;  3I4N B;  2F4I A;  2N88 A;  4HSP A;  1V43 A;  2A69 D;  3T56 B;  4OO1 G;  3C1F A;  1SMX A;  3I56 A;  3T4A C;  5IGF A;  1CKM A;  1Z6H A;  1TII D;  2K52 A;  4ILW A;  4APV A;  4RCO A;  1I4R A;  3SDZ A;  1Q7Y C;  3AFQ A;  1PRT C;  1TS3 A;  3OTO L;  1ML0 D;  2K75 A;  4ZYS A;  2UXC L;  4IJH A;  4EQN A;  4RH6 A;  2DNC A;  1I6V C;  3EQL C;  1STY A;  2KCT A;  3F1Z A;  3PO3 G;  2F0N A;  1CA5 A;  2B8F A;  3T1H Q;  3SR1 A;  4ALP A;  1WTR A;  3M9B A;  2LFN A;  4K8J A;  2CQO A;  3Q22 A;  3K8A A;  3I70 A;  1LUZ A;  3G6J B;  4HTH A;  1XNR L;  3PUV A;  3B6Y A;  1XJV A;  1JE4 A;  2L4N A;  1PHJ A;  4A3B H;  1JJ2 A;  3P1H A;  2F0G A;  5ELF A;  2NVQ B;  3PO3 B;  4WRD A;  1IZ6 A;  2O5J C;  2N8N A;  1CM9 A;  3UDG A;  1G29 1;  4DK1 A;  2ICI A;  3GTM B;  1IYV A;  4BS9 A;  3J7A F;  1Y14 B;  4BBR B;  3AQQ A;  3GTL B;  4K14 A;  5DAU A;  4JC0 A;  4BY7 G;  5ELN A;  2M2L A;  3VR2 A;  5LL6 X;  3TRE A;  4CDD C;  4DR1 L;  4R4C A;  3I4M H;  3K81 C;  1XPR A;  4IPH A;  4DFA A;  4RWS C;  3PSI A;  1ENC A;  4NDX A;  4M1U B;  2LY7 A;  4O1N A;  1QZH A;  3K6O A;  5E3F A;  5TSS A;  5K36 G;  2B2W C;  3FDT A;  5BN5 A;  3SGI A;  1Z7T A;  5CV9 A;  4BY7 B;  2CKZ B;  2PQA B;  1GHJ A;  1T5X D;  2F0L A;  4HR7 B;  1IL2 A;  1SYB A;  4YWK A;  4CHT B;  1D7Q A;  1I3Q B;  4QMG A;  4BBR H;  3S16 B;  4DR5 L;  4WJW A;  1X56 A;  1ZKO A;  5HY6 A;  2R93 H;  3DLL A;  1ESF A;  5I4D A;  2VXW A;  1K28 A;  3RZD H;  2EYF A;  2NN6 I;  4LFB L;  5D3I B;  4PMW A;  1GXD C;  2VB2 X;  2EQS A;  1EY7 A;  3T13 A;  4JI6 L;  2F0M A;  4A3G H;  2IY5 B;  4XQN A;  1BQQ T;  1SYC A;  2X6L A;  1JMC A;  3VR3 A;  2B2T C;  3I72 A;  3M4P A;  1Y69 U;  3GTO H;  1A8V A;  3TZU A;  4FDB A;  3I4L A;  4IOA A;  1Q81 C;  1IBK Q;  1XXG A;  1TWF B;  3TP6 A;  1ONL A;  4RGN A;  2B2U A;  1IW7 D;  4H7B A;  2FHT A;  1WTV A;  2JA5 G;  4DUZ L;  3IRB A;  4OHJ A;  1PH7 A;  2NVT H;  4O42 A;  2A8V A;  3S1N B;  2ZJQ A;  2K1B A;  2KOL A;  3CW2 C;  3V96 A;  2IX3 A;  1OXT A;  3S9W A;  3PF4 A;  1JT8 A;  3BZK A;  4EQ5 A;  3K80 C;  3ZJY C;  4LUV A;  1H9J A;  2P5Z X;  3DHQ A;  2GA4 B;  4FF4 A;  1N33 L;  1VQC A;  4JVZ A;  2L5T A;  4FP5 D;  2FJ2 A;  1TWF H;  2YV5 A;  4BA2 I;  2RF4 A;  2RDF A;  3SK6 A;  4PZ6 A;  1O7Z A;  1WI5 A;  4DR6 L;  1DD2 A;  4GOP C;  4RKB A;  4DV0 L;  4OIK A;  4TQU S;  2ASB A;  2KBN A;  3A0J A;  3DMU A;  1EY4 A;  1QE6 A;  1SRU A;  1KAW A;  2RHQ B;  3CC7 A;  1VMC A;  4DR4 Q;  2EYJ A;  5CV6 A;  1PYB A;  4BY1 G;  1VQA A;  4OX9 Q;  4DV2 L;  2EJM A;  3S1M B;  2Q2T A;  2JSO A;  5KRU A;  4ME3 A;  1BDO A;  2R61 A;  1U5K A;  1QUQ B;  2NZ1 D;  2JQO A;  1EY0 A;  3RMH A;  3NPP A;  2HQL A;  2J7Z A;  2MO1 A;  4R1J A;  1DOM A;  4KTA A;  3RLF A;  2JJQ A;  1CA6 A;  4QIW E;  2KED A;  5NUC A;  4BWG B;  1LTL A;  1VQP A;  2B3G A;  3CCE A;  4IZ8 A;  4J15 A;  2A69 C;  1LTR D;  4GLV B;  1NCV A;  4IOC A;  3DXJ C;  4BY1 B;  2F0S A;  4C3I G;  2EJF C;  5CBE E;  3A8K E;  3D8G A;  1C4Q A;  1G2S A;  1E2Z A;  3K7A B;  4DV1 L;  3MXU A;  1ASY A;  3CCL A;  3F2C A;  4K5X A;  5KEE A;  3NQI A;  2EDG A;  4LFA Q;  1LM0 A;  5J39 A;  1OXU A;  3ULP A;  4A3E G;  2KHJ A;  2K5H A;  5M3F G;  1KRS A;  3E0E A;  3CKI B;  2L15 A;  1KRT A;  1LT3 D;  4K6D A;  4JI1 Q;  4AYB E;  5CMD A;  3KK7 A;  4DAY A;  2F0K A;  3KJO A;  5IE8 A;  2R7Z G;  1JWM D;  2YU9 H;  2JA9 A;  5GRO A;  1I4P A;  1YHQ A;  3BDL A;  4YCV A;  2IWH A;  1VQJ A;  4QCL A;  4YY3 L;  1XMQ L;  2XN9 C;  5C4J H;  4A3E B;  2XSC A;  1E24 A;  3MA2 B;  4JBJ A;  5M3F B;  3K7A H;  1R4P B;  3E9H A;  2F0V A;  3QOL A;  4LF8 L;  5JVH 3;  2R7Z B;  3ULJ A;  3GP7 A;  2VL6 A;  3LX0 A;  5IWA Q;  2F03 A;  3QWN A;  1CK1 A;  4FXK C;  4IFD G;  3DM3 A;  3AMU A;  2SOB A;  3VDY A;  1E0B A;  1TWC H;  1STG A;  1PH1 A;  1NJI C;  3W2D A;  3BDC A;  3KBG A;  1WCM G;  4O2D A;  5GAG C;  1SE2 A;  1E2W A;  4LF5 L;  2ZTE A;  1DON A;  4CKC A;  5BN3 A;  1GUG A;  1D8L A;  2BA0 A;  2ZT9 C;  3SEB A;  1NMG A;  3K5M A;  2VZA A;  3KLS X;  3Q8D A;  2K14 A;  5KND A;  4JI8 Q;  1WCM B;  4A3L G;  2ICE C;  1PTO F;  5CV4 A;  5KGU A;  4KY7 A;  4Y7N B;  5ELB A;  4GNX A;  3U4V A;  1Y8P B;  3X3N A;  2HDM A;  1PTO B;  3S1Q H;  1SFO B;  4DV6 L;  4AIM A;  2L0C A;  1A3T A;  1PFS A;  3X3M A;  4X65 L;  2F0P A;  1S5F D;  4HCS A;  3S14 B;  4QF4 A;  1VQO A;  3L7Z C;  4DAM A;  1IW7 C;  1LT5 D;  4NB3 A;  2F0J A;  2UXB L;  5IYB G;  2K28 A;  4B3R Q;  1KC8 C;  5KNC A;  1GUW A;  2JK8 A;  2UUB L;  4DUY Q;  1EIH A;  3R2T A;  4Y7N H;  1QNU A;  5IP9 G;  3E6Z X;  1NSN S;  1WTX A;  4QUC A;  1EFW A;  2MP1 A;  4KHP L;  4JI5 Q;  3CCR A;  1FGB D;  3FRP B;  5CV8 A;  1WTW A;  5E4W C;  3GTG B;  4ID6 A;  1S5D D;  2JA6 G;  1CQF A;  1HHV A;  3U4Z A;  4DV5 L;  1NAP A;  4XDX A;  1N36 L;  1FJG L;  1HNX L;  1JWU D;  3HKZ E;  3AU7 A;  2SNM A;  1XPU A;  1E1O A;  1VQL A;  4GKK Q;  3OIP A;  1JB7 A;  1Q82 C;  1CQV A;  1K8G A;  3FMC A;  1A2U A;  1NR4 A;  2WB1 B;  3MAQ A;  3KDF A;  3GV6 A;  2OWO A;  4OWW B;  3VYS A;  1N8R C;  4MN3 A;  2BOS A;  2EE1 A;  1VQI A;  4PZ8 A;  5BR8 L;  1C0A A;  3GO5 A;  4JI2 L;  3A56 A;  4HSV A;  1QB5 D;  1R9T B;  2OQK A;  1F9R A;  3GTG H;  2NYZ D;  2DUD A;  3R93 A;  1A15 A;  1PMR A;  2IL8 A;  3S1R H;  1K8M A;  5FK9 C;  4YCW A;  2HD3 A;  2LS0 1;  1DCZ A;  2ZXO A;  3SK5 A;  4GLA C;  1G91 A;  1Y1V B;  3ICE A;  1T9H A;  3HKS A;  2CWP A;  1RKN A;  1WFQ A;  2O5I C;  3H3V H;  1LTA D;  5COR A;  4A3K H;  2V4D A;  2XTI A;  4OIJ A;  3I7F A;  5JJZ A;  2SNS A;  2VQF L;  1HXY D;  3H0G G;  5FJ8 G;  1BCP F;  4C56 C;  1O7L A;  2K32 A;  2ZXP A;  4LFC L;  1OTC A;  4X3S A;  4V19 0;  1OXV A;  4F7X A;  4A3I G;  1BCP B;  4O0A A;  5EPL A;  5EPJ A;  4H0L C;  1U4M A;  5H1S E;  4GLX A;  1MKH A;  3S24 A;  1YNN C;  4LWC A;  1FGU A;  1C9O A;  2M9V A;  2UUA L;  1VQ7 A;  1Y1V H;  3H0G B;  3NSW A;  1S3O A;  3MFG A;  5CGK A;  2E5L Q;  2VS1 A;  2F0U A;  4MZ9 A;  4CKB A;  2LKV A;  3HOZ G;  1IL8 A;  1NNX A;  4P73 A;  1GUO A;  4TVA B;  1XNQ L;  2J0T D;  1K8O A;  2Q8R E;  5DNF A;  2A5H A;  1P8L A;  3CQZ H;  1UE7 A;  1IBM L;  5LMU L;  5C4Z A;  1ZXT A;  1A6X A;  1HJP A;  2Z9H A;  2UUC Q;  4DAY B;  3A74 A;  4LF4 Q;  3HP3 A;  1VQF A;  5DM7 3;  4IUP A;  3ONA B;  4OON A;  2C5C A;  4DR3 L;  3LWU A;  3HOZ B;  2WAQ B;  1KDB A;  4RFB A;  4DV4 L;  4I7A A;  3DEP A;  2UXD Q;  3J80 i;  2AHO B;  1XMO Q;  2AQ2 B;  2Z6K C;  4F8M A;  1PFN A;  1LAB A;  1PH5 A;  3CCS A;  4U68 A;  3M4O H;  1H9K A;  1PH2 A;  4UY8 C;  3K59 A;  5IGB A;  2LXK A;  4G7O C;  2GVB A;  2NVY B;  3GTK H;  1L1O C;  2EYL A;  3CPF A;  3QG1 A;  4A93 G;  4GKJ Q;  1HPC A;  4K6L A;  1ESR A;  5EAY A;  1HQR D;  2OEO A;  5M5X H;  4Q0F A;  3S17 B;  1SDF A;  3OMG A;  2G5D A;  4Z9C B;  1G51 A;  2D0P A;  3K57 A;  5LHY 1;  4A76 A;  4B3T L;  5EBD A;  5J1Z A;  3S15 B;  1JCK B;  4B3S Q;  2B39 A;  1XYI A;  2YTV A;  1B3Q A;  1PH3 A;  4A93 B;  1JIC A;  3OYY A;  1Z9F A;  1X3G A;  4LF9 Q;  5C0X J;  5DM6 3;  3KOJ A;  5CV7 A;  1STH A; 
#chains in the Genus database with same CATH homology
 2JXM B;  4I7Z C;  4HAE A;  4OO1 I;  1WD0 A;  2H4O A;  3P7J A;  2KA7 A;  1D2B A;  3OOC A;  1DXM A;  3D4R A;  5E4X A;  1WD1 A;  2NWG A;  4KJO A;  5EKL A;  3A7L A;  3C2P A;  5IGD A;  1UUP A;  4FYD A;  4GZY C;  2IX1 A;  5EQ0 A;  1Q3L A;  3P75 A;  2L12 A;  4M8A A;  5F2D A;  4TRD A;  2WKC A;  1EYD A;  3VYU A;  4KK7 A;  1QJO A;  1HTP A;  1DJR D;  4K2L A;  1PTO D;  1Q8I A;  1SEB D;  4A3B B;  3GQB A;  3N6R A;  1H9S A;  2SEB D;  3VR5 A;  3NQT A;  1BXT A;  1STN A;  1F77 A;  1Y8O B;  1LLR D;  3DEO A;  1D6E C;  1TS4 A;  3C1E A;  2KUM A;  4L6T B;  3OMC A;  3K58 A;  3I4M B;  1A2T A;  3TSS A;  1WTQ A;  1EZ8 A;  1TS5 A;  2FFK B;  5C4H A;  5I9O A;  4KHV A;  5E1F A;  4A3J B;  3NWT A;  1TR5 A;  2G9H D;  2EZV A;  2K5W A;  1K83 B;  2KCC A;  2EXZ A;  1MSG A;  3PMF A;  4ABN A;  4KJN A;  3HOX B;  3MXP A;  3RZO B;  1DOL A;  3HEJ A;  5IT9 L;  3N52 A;  2R93 B;  1QOH A;  3U9O A;  3RZD B;  4G7Z C;  4DAV A;  1CZG A;  4A3G B;  1B9M A;  4J1M A;  2EPB A;  3ZYY X;  2OT2 A;  1PDQ A;  1XX8 A;  3GTO B;  4U67 3;  1ZYR D;  1S4Z A;  1S5C D;  3OWF A;  4RA8 A;  5D65 A;  5FOB B;  3URY A;  3NE5 B;  4FXD A;  2KVM A;  1VDZ A;  3T16 A;  4CGY B;  3CU7 A;  3FEW X;  4KN7 C;  5IOD A;  2NVT B;  4DXF A;  1STA A;  1CZW A;  5KIX A;  4KV6 A;  1PLF A;  4RGO S;  4DNR B;  4FO2 A;  3OHX C;  3V05 A;  1EZ6 A;  4QIW B;  2QCP X;  1JQY D;  3MC0 B;  1UNS A;  5CC4 A;  1BCP D;  1SND A;  1H9R A;  5C3W A;  4Q5V A;  3RD4 A;  1A3U A;  3EA6 A;  4NP5 A;  1I6H B;  2KJX A;  3C3L A;  5M5W B;  1EEI D;  1B4O A;  1LTT D;  3VYT A;  1JOK A;  1SNO A;  1QG7 A;  4RAU C;  4AYB B;  3FKI B;  2PW5 A;  2F0I A;  4KKS A;  2RKS A;  5C44 B;  2EVB A;  4HED A;  2Z4I A;  2FMC A;  3H91 A;  3V2T A;  1HRJ A;  3BDO A;  3JAM L;  4BBS B;  2C9O A;  1LTG D;  1SYF A;  1TWG B;  1EL0 A;  3KF8 A;  1H9M A;  4B9X A;  4PMB A;  4G7H C;  1I50 B;  3NBI A;  4A3F B;  2F3V A;  2KHS A;  1EYC A;  2BDO A;  3IFT A;  2IJ0 A;  4EGV A;  1RTO A;  3DUZ A;  2KEC A;  1EWH A;  2CVR A;  3D3R A;  3PO2 B;  1HA6 A;  1V1O A;  3LNN A;  1EU4 A;  1EY9 A;  1SAP A;  1PTO C;  3W3A A;  2YU9 B;  4IUV A;  1L0X B;  5C4J B;  2Z8L A;  4HN7 A;  2QEJ C;  1CT1 D;  3R3O A;  5D14 A;  2B2Y A;  2K01 A;  1YNJ D;  3HOW B;  3D6C A;  2K04 A;  5EBC A;  2NN6 H;  4KY6 A;  2RDH A;  4IFD I;  2EOT A;  2D5D A;  1HUM A;  1SE3 A;  3NK9 A;  2WKD A;  2CQA A;  1H9S B;  1ZEQ X;  4IFD J;  1TWC B;  2BE5 D;  1W6J A;  3R8B A;  1YNN D;  3WOE A;  4PMC A;  2MGS A;  2B2U C;  1GUT A;  1R4Q B;  4X3K A;  5IGC A;  3NBH A;  3Q0A A;  2RQX A;  4C2M B;  3WDN A;  5JPN C;  1MBY A;  4F87 A;  2TMP A;  1VMP A;  1WVL A;  4FVM A;  4CBV A;  2RVL A;  3BVZ A;  1IYU A;  2K5D A;  2JP1 A;  4IQZ A;  1RF2 D;  2EYO A;  2FIN B;  5EPK A;  3S1Q B;  5A2Q E;  3OPO A;  3HKZ B;  4P2C B;  1ZYR C;  3FPU B;  3D6W A;  2B8G A;  4XIG S;  2EYM A;  4V0B A;  1B3A A;  1AN8 A;  4LMQ D;  4XYQ A;  5C3X A;  1LTS D;  2VB3 X;  1LTI D;  2I46 A;  5FKA C;  2E76 C;  3VA5 A;  3J81 L;  1JR0 D;  1OO9 B;  1F2Y A;  3PUY A;  4ZKC B;  2PPB C;  3TP5 A;  3H94 A;  2NBF A;  1BCP C;  3IAY A;  1S5B D;  2DNE A;  1KTK A;  5COY A;  2XWB B;  3MVV A;  1Q12 A;  4C1N I;  5A2Q L;  3DM1 A;  3A54 A;  3PV0 A;  1JOQ A;  3MHB A;  1WTP A;  1FR3 A;  3BVM A;  3NWS A;  1SNM A;  1F9S A;  2WAC A;  5ELD A;  4KN4 C;  4K8I A;  4E6I A;  2A6H D;  3S1R B;  2PZW A;  1AW7 A;  1RCV D;  4OGQ C;  3PUX A;  3DWA A;  2D62 A;  3MEH A;  2TSS A;  1FNV A;  4ZUJ A;  5EKK A;  3M4Y A;  3WOF A;  2IW3 A;  4MIU A;  2XIW A;  2A68 D;  4A3K B;  1HTL D;  5FLX L;  3MFY A;  1JC7 A;  5DEH A;  2X69 A;  1AEX A;  4IN3 A;  2NTT A;  5C5L A;  1TY2 A;  5I2X A;  4FF2 A;  2K7V A;  2AWN A;  4KKT A;  3I8Z A;  2EY2 A;  1T5E A;  2PZT A;  3D31 A;  2A74 C;  1JWS D;  3NTK A;  4CJ1 B;  1ET9 A;  1ICW A;  3NTH A;  1HFN A;  3HZX A;  3NUC A;  4DNT B;  2B2V A;  1YNJ C;  2CHB D;  5FO7 B;  2OF1 A;  1U4P A;  2F0E A;  3CQZ B;  3GD7 A;  1F9Q A;  2A73 B;  3OW7 A;  5G3L F;  1V1P A;  3H6M A;  3TZD A;  1J9O A;  3HGB A;  5IIF A;  2XVS A;  1HA5 A;  4WFN 3;  2EYH A;  2ZXR A;  4CKE A;  2A6E C;  4J8Q A;  1KLU D;  1G6Z A;  2BE5 C;  1OXX K;  2BDN A;  1MD2 D;  3FPP A;  1PFM A;  5C3E B;  3SVM A;  1JB3 A;  5A35 A;  4X3U A;  4EQP A;  1D5Z C;  3E5S A;  1X3P A;  3VR4 A;  3M4O B;  3U9S A;  3ND8 A;  3GTK B;  3TBI B;  2AUK A;  3ERQ A;  5HGT A;  4DAP A;  4DF7 A;  4ZLT F;  2BCO A;  5I9P A;  2PNR C;  2PQE A;  5M5X B;  2F0F A;  5BN4 A;  1PZI D;  1I4H A;  1EOT A;  2IPK D;  1VCI A;  2K6A A;  1U4R A;  3BG3 A;  4RCN A;  3I91 A;  1D5X C;  1TU2 B;  3VYR A;  1U4L A;  3G7L A;  2WII B;  4X3T A;  1AZQ A;  3CRK C;  4NKL A;  1J8I A;  4XQJ A;  2K33 A;  4R8N A;  2MJ8 A;  2XRS D;  4ZRZ A;  2I07 B;  4DN4 M;  3D4W A;  2MPM A;  2HCI A;  1D5M C;  2F0H A;  1ENA A;  2DY7 A;  2K03 A;  1BNZ A;  4LAA A;  1X3Q A;  3J7Y W;  5C0X I;  1PXU A;  5M9O A;  1F2M A;  2XRQ D;  4H44 C;  1RHP A;  2WIN B;  1RDP D;  5D3D A;  2J4X A;  2LMC B;  1SMY D;  2O4X A;  5ELE A;  1B9N A;  4I65 A;  1EIG A;  3IFD A;  5ELC A;  1GJX A;  2JA7 B;  4K5V A;  1FD7 D;  1SYD A;  3PUW A;  2HUG A;  1TKW B;  1ROD A;  5M3M B;  1UAP A;  1Y1W B;  2B2W A;  4PQX A;  2A6H C;  1TS2 A;  4JK1 C;  4ZK9 B;  5JEA H;  3J7A V;  5EGT A;  1SNQ A;  5EJW A;  1C48 A;  1QCB D;  1IHZ A;  4IUT A;  4ME5 A;  5IT9 E;  1AP0 A;  4XXE A;  1QIL A;  2A68 C;  4ZUI A;  5T1I A;  1BBX C;  2MHV A;  3FVQ A;  2CW0 D;  1SXT A;  4WOR A;  4LK1 C;  2B2T A;  1OXS C;  2WP8 J;  1I4G A;  2Q8I B;  5CBA E;  2QIL A;  1BO0 A;  1II3 A;  4IUN A;  2KCN A;  5EKI A;  1EFI D;  2D2C C;  3MTS A;  1EQV A;  2SDF A;  1CHP D;  3SXH A;  2JEB I;  5CR3 A;  3SK4 A;  3MZ5 A;  4XTC S;  2ENB A;  1JOR A;  3IKJ A;  4ZAI A;  4BA1 I;  3GV3 A;  3J80 L;  3AB9 A;  2E2H B;  4S3S A;  4NW2 A;  4B9W A;  1RJT A;  1SYG A;  3RUZ A;  4ULL A;  1ET6 A;  3EFX D;  3L9A X;  1HQM C;  1B50 A;  2F0T A;  2O2L D;  5C0X H;  3KBX A;  1BOS A;  1EY8 A;  3Q23 A;  4KHZ A;  3HOU B;  1STE A;  2X6G A;  4KKU A;  1AZP A;  2Z4H A;  3VR6 A;  4HMI A;  3O13 A;  1V1P B;  5FO9 B;  5JAV A;  4OO1 H;  3MWY W;  3QOJ A;  2RSN A;  1DM0 B;  1FYC A;  5HUR A;  4C3J G;  4ODG A;  1KDA A;  2L11 A;  3JAM E;  1F2L A;  1IKL A;  3M7N A;  2JA8 B;  4LJZ C;  5AFW A;  1B53 A;  2PW7 A;  1VF7 A;  2PCF B;  4ZQ3 A;  3CRL C;  1PZJ D;  1B44 D;  1PYW D;  1SSO A;  4C3J B;  5G3L D;  4HCE A;  1F9P A;  3KUP A;  4DK0 A;  2JE6 I;  4IUU A;  1TQO A;  1MSH A;  2DN8 A;  2PYK A;  4FF3 A;  4A3M B;  1PRT F;  2JEA I;  2L9H A;  3A8I E;  2EJG C;  3BVG A;  1A3V A;  1PRT B;  2OXP A;  5FO8 B;  1W6K A;  2R92 B;  3M85 A;  1E2V A;  4RGT A;  1SMY C;  5K36 H;  4K5W A;  1VF5 C;  4QB4 A;  4B08 A;  5I6W A;  1SNP A;  2F3W A;  1KLG D;  5IGE A;  4MHE A;  1EWC A;  2NN6 G;  4N9P A;  1LAC A;  1EQT A;  1KNA A;  2JA5 B;  1O7Y A;  3MXG A;  3E0J A;  2E2D C;  3ND9 A;  5C4X B;  5C5M A;  5JVG 3;  2B63 B;  4DA2 A;  2F0Q A;  1LT6 D;  4IAL A;  3QB3 A;  3C46 A;  2QDB A;  2WV6 D;  3DWP A;  3BZD B;  4L63 B;  2EY5 A;  2JYO A;  2KQ3 A;  2E2I B;  1B2T A;  1MI2 A;  4ZKB B;  2AWO A;  2CW0 C;  1Q1B A;  2N55 A;  2F0W A;  2IT1 A;  3BYT B;  1EEF D;  1G2T A;  4C1N K;  4YIJ A;  1DZ1 A;  4OL7 A;  2NVX B;  1SYE A;  3OWE B;  1CI3 M;  3PUZ A;  1V8Q A;  4L8J A;  1U9R A;  1TWH B;  5JOB A;  4CJ0 B;  1NR2 A;  3I73 A;  1D1K A;  3NHH A;  2A6E D;  4JBW A;  1KAB A;  3IL8 A;  3K5O A;  4DU9 A;  3J81 E;  3QO2 A;  1SJH D;  3HRZ C;  3M7G A;  4C3I B;  1ENF A;  1QNK A;  3R2I A;  3H3V C;  1LO5 D;  1Q90 A;  3PIP 3;  1WTO A;  1LV9 A;  5K5P A;  5CV5 A;  1GUS A;  3K5L A;  1ILQ A;  2L55 A;  2NTS A;  1Q1E A;  1EYA A;  1JOO A;  1MGS A;  3SE0 A;  1KNE A;  4XQQ A;  1FNU A;  3GTQ B;  1NUC A;  1TY0 A;  1KAA A;  4XT3 B;  2H1E A;  3D4D A;  3LWE A;  3T53 B;  4FNF A;  3MXN A;  3PIO 3;  5KYL A;  1L0Y B;  3TP8 A;  4IUR A;  1BUV T;  1Z47 A;  1SNC A;  2E74 C;  2F0D A;  4UDU C;  1I4Q A;  3NXW A;  2XNA C;  4RKL A;  4PV1 C;  3NTI A;  3OSO A;  1HFG A;  5FLX E;  1DYQ A;  4CJ2 C;  4EQO A;  3K5N A;  4IUQ A;  2PO4 A;  4C3H G;  1M4V A;  2ID0 A;  5KYI A;  2B2Y C;  2VUM B;  2M00 A;  1D1I A;  2NUC A;  4KD4 A;  1QWY A;  3HOV B;  5LL6 S;  4TSS A;  3K0Y A;  3GTJ B;  1PZK D;  3TN2 A;  4IFD H;  4C3H B;  1SE4 A;  2EYP A;  2K05 A;  2VNU D;  3S2H B;  3TME A;  3I90 A;  2DY8 A;  2G9D A;  2XWJ B;  5JPM C;  2BA1 A;  3KLR A;  3SK8 A;  1PTO H;  1TVX A;  2QKI C;  3M3Y B;  2F0O A;  1EU3 A;  1GHK A;  2RSO A;  1I4X A;  1F2Z A;  1UEA B;  4XT1 B;  1HCZ A;  4R8I A;  3HS0 C;  3L3O C;  3KLS A;  2PZU A;  3A55 A;  2HDL A;  1HUN A;  1STB A;  4FXG C;  2JA6 B;  3BYY B;  1XTC D;  2FMM A;  2E2J B;  1PRT D;  3ITP A;  4F88 A;  3EJI A;  1BR9 A;  2Y0S B;  1FNW A;  1IKM A;  3SHL A;  2HQE A;  3A7A B;  3H09 A;  1BF4 A;  5M5Y B;  2D9U A;  2RA4 A;  4TKO B;  2IX0 A;  1O78 A;  2AUJ D;  4XYO A;  2AQ1 B;  2Z1C A;  4KI0 A;  3HOY B;  1LT4 D;  4G4K A;  1S5E D;  4DXG A;  3UI2 A;  4RHR A;  3P20 A;  5I6Y A;  4PNY A;  2PMZ B;  3Q6S A;  2F1M A;  3OIQ A;  3VA7 A;  4QUF A;  2AQ3 B;  3TP7 A;  3BS1 A;  3S2D B;  2KEE A;  2R3Z A;  4KMU C;  5JEA J;  3GTP B;  4A3I B;  1LTB D;  1EY6 A;  1Y8N B;  2K5Q A;  3DWQ A;  2Q8T A;  1CFM A;  1SJE D;  2RDG A;  4FF1 A;  2MUY A;  2R6G A;  2EY1 A;  3HG9 A;  3F2U A;  2YYZ A;  1PFB A;  3TDQ A;  5JEA G;  3EVQ A;  4UAI A;  4DGZ A;  4KD3 A;  1DOK A;  4G57 A;  2QF7 A;  5T1G A;  5IGG A;  4N9T A;  3ERO A;  4EVO A;  1O80 A;  1GUN A;  2E75 C;  5KNB A;  2B2V C;  1X32 A;  1EY5 A;  4RGM A;  4A3D B;  5C6A A;  1AFP A;  3I3C A;  3CHB D;  3T51 B;  1SBB B;  4NMZ A;  5I2Y A;  2RBM A;  3NP8 A;  1ILP A;  5IOC A;  5J22 A;  3Q24 A;  2HCC A;  1C8C A;  1CHQ D;  2EY6 A;  3QIA A;  3J80 E;  3QJY A;  1TT2 A;  4H13 C;  2NB0 A;  2L1B A;  1RTN A;  4HMJ A;  3A8J E;  1CTM A;  1RD9 D;  1GOZ A;  1KDC A;  5ISR A;  4KY5 A;  1TWA B;  5C0X G;  4R9W A;  1B1Z A;  4J6H A;  4K2K A;  1G8Z D;  1M8A A;  1XWE A;  4RHS A;  5CYU A;  3I4N B;  2F4I A;  2N88 A;  4HSP A;  1V43 A;  2A69 D;  3T56 B;  4OO1 G;  3C1F A;  3T4A C;  5IGF A;  1Z6H A;  1TII D;  4ILW A;  4RCO A;  1I4R A;  3SDZ A;  1PRT C;  1TS3 A;  1ML0 D;  4ZYS A;  4EQN A;  4RH6 A;  2DNC A;  1I6V C;  3EQL C;  1STY A;  2F0N A;  1CA5 A;  2B8F A;  3SR1 A;  1WTR A;  2LFN A;  4K8J A;  3Q22 A;  3I70 A;  3G6J B;  4HTH A;  3PUV A;  1JE4 A;  2L4N A;  3P1H A;  2F0G A;  5ELF A;  2NVQ B;  3PO3 B;  4WRD A;  2O5J C;  1CM9 A;  1G29 1;  4DK1 A;  2ICI A;  3GTM B;  1IYV A;  4BS9 A;  3J7A F;  4BBR B;  3GTL B;  4K14 A;  5DAU A;  2M2L A;  3VR2 A;  5LL6 X;  4DFA A;  4RWS C;  1ENC A;  4NDX A;  4M1U B;  2LY7 A;  4O1N A;  3K6O A;  5E3F A;  5TSS A;  5K36 G;  2B2W C;  3FDT A;  5BN5 A;  1Z7T A;  5CV9 A;  4BY7 B;  1GHJ A;  1T5X D;  2F0L A;  4HR7 B;  1SYB A;  4CHT B;  1I3Q B;  4QMG A;  3S16 B;  4WJW A;  1ZKO A;  1ESF A;  5I4D A;  2VXW A;  2EYF A;  2NN6 I;  5D3I B;  4PMW A;  1GXD C;  2VB2 X;  1EY7 A;  3T13 A;  2F0M A;  4XQN A;  1BQQ T;  1SYC A;  2X6L A;  3VR3 A;  2B2T C;  3I72 A;  1Y69 U;  3TZU A;  3I4L A;  1XXG A;  1TWF B;  3TP6 A;  1ONL A;  4RGN A;  2B2U A;  1IW7 D;  4H7B A;  2FHT A;  1WTV A;  4OHJ A;  4O42 A;  3S1N B;  2K1B A;  2KOL A;  3V96 A;  2IX3 A;  1OXT A;  3S9W A;  1H9J A;  3DHQ A;  2GA4 B;  4FF4 A;  2L5T A;  4FP5 D;  2FJ2 A;  4BA2 I;  2RDF A;  3SK6 A;  1O7Z A;  1DD2 A;  4RKB A;  4OIK A;  4TQU S;  3DMU A;  1EY4 A;  1QE6 A;  1VMC A;  2EYJ A;  5CV6 A;  2EJM A;  3S1M B;  2JSO A;  5KRU A;  1BDO A;  2R61 A;  2NZ1 D;  1EY0 A;  3RMH A;  3NPP A;  2J7Z A;  3RLF A;  1DOM A;  4KTA A;  1CA6 A;  2KED A;  5NUC A;  4BWG B;  4IZ8 A;  2A69 C;  1LTR D;  4BY1 B;  1NCV A;  3DXJ C;  2F0S A;  4C3I G;  2EJF C;  5CBE E;  3A8K E;  3D8G A;  1C4Q A;  1G2S A;  1E2Z A;  3K7A B;  3MXU A;  4K5X A;  5KEE A;  3NQI A;  2EDG A;  5J39 A;  1OXU A;  3CKI B;  1LT3 D;  4K6D A;  5CMD A;  3KK7 A;  4DAY A;  2F0K A;  1JWM D;  1I4P A;  3BDL A;  2IWH A;  4QCL A;  2XN9 C;  4A3E B;  2XSC A;  3MA2 B;  5M3F B;  1R4P B;  3QOL A;  2F0V A;  5JVH 3;  2R7Z B;  3GP7 A;  3LX0 A;  2F03 A;  3QWN A;  1CK1 A;  4FXK C;  4IFD G;  3AMU A;  2SOB A;  1E0B A;  1STG A;  3W2D A;  3BDC A;  3KBG A;  1SE2 A;  1E2W A;  1DON A;  4CKC A;  5BN3 A;  1GUG A;  2BA0 A;  2ZT9 C;  3SEB A;  3K5M A;  3KLS X;  5KND A;  1WCM B;  2ICE C;  1PTO F;  5CV4 A;  5KGU A;  4KY7 A;  4Y7N B;  5ELB A;  1Y8P B;  3X3N A;  2HDM A;  1PTO B;  1SFO B;  2L0C A;  1A3T A;  3X3M A;  2F0P A;  1S5F D;  4HCS A;  3S14 B;  4QF4 A;  3L7Z C;  1IW7 C;  1LT5 D;  2F0J A;  2K28 A;  5KNC A;  1GUW A;  1EIH A;  3R2T A;  1QNU A;  3E6Z X;  1NSN S;  1WTX A;  4QUC A;  2MP1 A;  1FGB D;  3FRP B;  5CV8 A;  1WTW A;  5E4W C;  3GTG B;  4ID6 A;  1S5D D;  1CQF A;  1HHV A;  1NAP A;  4XDX A;  1JWU D;  3AU7 A;  2SNM A;  3OIP A;  1CQV A;  3FMC A;  1A2U A;  1NR4 A;  2WB1 B;  3MAQ A;  3GV6 A;  3VYS A;  4MN3 A;  2BOS A;  2EE1 A;  3GO5 A;  3A56 A;  4HSV A;  1QB5 D;  1R9T B;  1F9R A;  2NYZ D;  3R93 A;  1A15 A;  1PMR A;  2IL8 A;  1K8M A;  5FK9 C;  2LS0 1;  1DCZ A;  2ZXO A;  3SK5 A;  1G91 A;  1Y1V B;  1RKN A;  2O5I C;  1LTA D;  5COR A;  2V4D A;  4OIJ A;  5JJZ A;  2SNS A;  1HXY D;  1BCP F;  4C56 C;  1O7L A;  2K32 A;  2ZXP A;  4V19 0;  4X3S A;  1OXV A;  4F7X A;  1BCP B;  5EPL A;  5EPJ A;  4H0L C;  1U4M A;  1YNN C;  2M9V A;  3H0G B;  3NSW A;  3MFG A;  5CGK A;  2F0U A;  4CKB A;  2LKV A;  1IL8 A;  1GUO A;  2J0T D;  1K8O A;  2Q8R E;  5DNF A;  2A5H A;  5C4Z A;  1ZXT A;  1A6X A;  3HP3 A;  5DM7 3;  4IUP A;  3ONA B;  2C5C A;  3LWU A;  3HOZ B;  2WAQ B;  1KDB A;  4RFB A;  3DEP A;  2AQ2 B;  4F8M A;  1PFN A;  1LAB A;  4U68 A;  1H9K A;  3K59 A;  5IGB A;  4G7O C;  2NVY B;  2EYL A;  3QG1 A;  1HPC A;  4K6L A;  1ESR A;  1HQR D;  2OEO A;  4Q0F A;  3S17 B;  1SDF A;  3OMG A;  4Z9C B;  3K57 A;  5LHY 1;  5EBD A;  5J1Z A;  3S15 B;  1JCK B;  2B39 A;  1XYI A;  4A93 B;  1JIC A;  5C0X J;  5DM6 3;  5CV7 A;  1STH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...