1EYDA

Structure of wild-type s. nuclease at 1.7 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eydA00
1EY7A 1STYA 3V2TA 5E1FA 5DEHA 2HQEA 2F0DA 1EYAA 4PMCA 4S3SA 1SNDA 1STHA 4DU9A 3D8GA 4KD3A 4HTHA 1KDAA 3SHLA 1RKNA 3SK5A 1NSNS 3TP8A 5CGKA 1EY0A 2OXPA 1EY6A 3MEHA 1KABA 1SYCA 2EYJA 4QMGA 3TMEA 5CV9A 3TP7A 5NUCA 1SYBA 3OWFA 4K5WA 5HGTA 4K8JA 4RKBA 3SK8A 2F0MA 4F8MA 1KAAA 2RDFA 2F0GA 4KJOA 4E6IA 5M9OA 5J22A 2F0WA 4B9XA 4K2LA 1F2MA 4N9PA 2F0NA 1SYGA 3BDCA 2F3WA 4K5XA 2F0VA 3C1FA 4R8NA 1STNA 2EY6A 3C1EA 3SXHA 1A2UA 4ME5A 3OMGA 5IOCA 5IODA 3T16A 3MHBA 4NP5A 2F0TA 5C5LA 5IGCA 1STAA 2EYMA 2F0UA 1TQOA 2OF1A 4EQPA 3EVQA 5CR3A 4B9WA 4DFAA 5I9PA 3MXPA 4DF7A 2EYHA 2F0HA 5CV4A 3EROA 5C3XA 1U9RA 2PW7A 2F0KA 3E5SA 4MIUA 4KHVA 4KY5A 4K6DA 5KEEA 3PMFA 4QB4A 3NQTA 4K14A 5EGTA 3ITPA 4EVOA 2EYFA 3MZ5A 4K8IA 3SK6A 5IGBA 3NP8A 2SNMA 4H7BA 3HEJA 4ZQ3A 1ENAA 5EKKA 1SNPA 5ISRA 4EQNA 3OSOA 4KY6A 2WACA 1SNMA 5EKLA 5F2DA 1EY9A 4KV6A 4OL7A 1EZ8A 1JOKA 4NKLA 5C5MA 2SOBA 2SNSA 5J39A 1SYEA 3QOJA 4ID6A 4J1MA 4PNYA 5J1ZA 4PMBA 3VA5A 4J6HA 5I6YA 4QF4A 1A3VA 4TRDA 4WRDA 3NXWA 3MVVA 3RUZA 5K5PA 3LX0A 1JORA 1EQVA 2M00A 2PZTA 4WORA 5IGDA 5KYLA 4NDXA 1EY5A 1KDCA 3D4DA 3ERQA 4G57A 2O4XA 5IGFA 1STGA 5CV6A 1NUCA 4K2KA 5CV5A 3NUCA 5C3WA 3P75A 3R3OA 2F0OA 2EYLA 2RKSA 3TP6A 4IZ8A 4DGZA 2F0LA 1AEXA 4NMZA 2EYOA 2QDBA 5KIXA 3QB3A 1A3TA 2RBMA 1JOQA 1F2ZA 4IALA 2F0IA 2F0JA 5DAUA 5KYIA 2KHSA 1EY8A 2ENBA 5I9OA 4EQOA 2PYKA 1EYCA 1JOOA 5IIFA 2EY5A 4HMIA 5CV8A 1SNCA 3OMCA 2F3VA 4ZUJA 3EJIA 2PZUA 5IGEA 4ZUIA 1II3A 1A3UA 5E3FA 3TP5A 5C4ZA 4ODGA 4KY7A 4I65A 3D6CA 5JOBA 2PQEA 2PW5A 4N9TA 1A2TA 3BDLA 1STBA 5I6WA 3SR1A 5JAVA 2F0PA 3H6MA 3P1HA 4K5VA 1EY4A 4LAAA 4RKLA 5C4HA 3HZXA 5C6AA 5CC4A 2EY2A 2KQ3A 2LKVA 2NUCA 5KGUA 1IHZA 3U9OA 5CV7A 1SYDA 3S9WA 1F2YA 1SYFA 1TT2A 1EZ6A 4KD4A 3T13A 2EXZA 2EY1A 2F0SA 2OEOA 4IUNA 2F0QA 4YIJA 1ENCA 3D4WA 3SK4A 2F0EA 5IGGA 1EYDA 3DMUA 5HURA 1SNOA 4HMJA 2PZWA 4F7XA 1KDBA 3NHHA 3DHQA 2F0FA 3NK9A 3QOLA 5KRUA 1SNQA 2EYPA 4KTAA 1TR5A 4KJNA
chains in the Genus database with same CATH superfamily
3R8BA 1KIXA 3V2TA 1TVXA 1JJ2A 1I4HA 2NZOA 5EQ0A 2IX0A 3WWVA 3M3YB 1RKNA 4OWWB 1XPOA 1BCPB 4IPDA 3S17H 2F0MA 3OW2A 4BXXH 1ILQA 3A5ZB 5EBCA 3M7NA 4M1UB 2F0WA 4B9XA 4QGUA 1O7LA 1TIID 1NNXA 4QY7A 4PZ8A 1J5EL 3SDZA 1CHQD 3GTOB 4RHSA 1S40A 1VQ4A 5IYBH 3CXCA 1UNSA 5C3EH 3J80c 2L55A 2YTXA 4A3JH 1YNJD 4JOIA 4EQPA 3SVMA 3GTJH 1MBYA 1IBMQ 3FPPA 3S1MB 4HSVA 3PO3B 3RLNA 1Q8KA 3H09A 1TS2A 1PYWD 2ID0A 4A3IG 3G6JB 5I2XA 3P7JA 1A6XA 1Z9FA 3R2IA 2WB1G 1JJCB 3URYA 4DV1L 3EN2A 2R93B 4A3FH 2HCCA 5M5YB 3K58A 3H3VI 5J39A 4CJ0B 3VA5A 4JI0L 1XNRL 2IW3A 4BY1B 1ZXTA 1DJRD 3DEPA 1JORA 4YWMA 2D0OA 3GTKH 2VUMB 4JPBW 2DY8A 3H3VC 3GTPH 1E22A 2A69C 2B2YA 4IUQA 1K3RA 4IQZA 3RLOA 1HJPA 1PTOF 2BOSA 3R3OA 1QVCA 2R92B 1KNAA 4IZ8A 4NMZA 1Q1BA 3GP7A 3KLSX 1LACA 3CMEA 3J7AV 2OTJA 2AQ2B 4R8IA 1SMYC 3EIVA 2UUAL 1JB7A 3O13A 2EJFC 4HCSA 5I4DA 2PZUA 5C44H 2RVLA 2NB0A 4OWTB 2BH2A 1XNQL 4GKKL 2JP1A 1QVFA 4R4QA 3X3NA 2PQAB 1EIYB 4LW1A 4DNRB 3CC4A 4XTCS 5CC4A 1U5KA 4IFDH 1Q7YC 1E0BA 4KD4A 2X69A 2OEOA 1PZID 5EPJA 4YIJA 3K7AB 3SE0A 1GUSA 4YHHQ 3OW7A 1C48A 1EYDA 2A8VA 4C3HG 4QUFA 1TWFB 2HQEA 3S16H 2R61A 4IFDI 3PO3G 1CKNB 2Z4IA 1NSNS 4UP9A 2QA4A 1E2ZA 1EY6A 1GHKA 1KABA 3CCRA 3AU7A 1QUQA 2Z6BA 4UP8A 3JAME 4WJ4A 4A3MG 4RKBA 1QNKA 3DLLA 4CDEC 2F0NA 1JQYD 5GQOA 3LNNA 4N8FA 3C1FA 4B3RL 4X65Q 4PZ7A 4KK7A 5JJZA 3KLSA 2QILA 5IOCA 3J81E 4BY1G 1STAA 2XRQD 3MXNB 4DFAA 2JXMB 2WKDA 4AQYL 2IHEA 2R92G 1Q8IA 4RAUC 2R6GA 3KBXA 1QOHA 2E5LQ 1Q3LA 3STBC 1HNWQ 3MEFA 1EWIA 3T1HL 4B3SQ 3DWPA 1LABA 5EKKA 1EQTA 4JI1L 1MSGA 2L12A 5AJ3L 4GKJL 3NQIA 4DV0Q 5BN3A 4YWKA 1SYEA 3NSWA 4R4TA 4JI4Q 5JVG3 1X6OA 1K8OA 3LWUA 3CRKC 4TRDA 4WRDA 3ULJA 4HJ5A 2BDOA 4GLAC 3S14B 1R4QB 1I3QH 3LX0A 2M00A 5D14A 3I4OA 2NVXB 1GVPA 2TMPA 2CHBD 3TS0A 1MKHA 4JI8L 4IALA 4JW0A 3BS1A 3CC7A 2HIVA 5DAUA 4DUYQ 3FKIG 1ET9A 2GN5A 5I9OA 1B1ZA 2LMCB 1SR3A 1WD1A 4ZKBB 3CCMA 1SJHD 4DR6L 3VR4A 1AZPA 2ZJQA 4IOAA 2JK8A 2PQEA 1NE3A 4GN5A 3P1HA 3GV3A 1WTRA 4BBRG 5FJ8G 1LTAD 2L11A 1YJWA 3K57A 4CGYB 2PI2E 4RG1A 1N36L 1PHJA 4NXML 3DMUA 4JI4L 5KRUA 3PIPA 4H13C 4A76A 1RHPA 5JPMC 3RR5A 3IFDA 1P16A 4UAIA 1SE3A 4BWGB 4IURA 2HIXA 1G6ZA 3M4YA 3S2HH 3NEMA 4HTHA 3U50C 1J9OA 1O7ZA 5ELBA 5G3LD 4XQNA 2IPKD 1R9TB 4RHRA 1WJJA 2K75A 4RGNA 4DNTB 1SAPA 5IYCH 1VQ8A 4JI5Q 2F0VA 2MQHA 3E0EA 3I4NG 1TY2A 1G51A 1EU3A 1Y1VH 2KVMA 1PA6A 3S2DB 4A3MH 1I6VC 5K36H 4HJ8A 2EJMA 3M85A 1HTLD 5C5LA 5CBEE 1BR9A 4NXMQ 4B9WA 3HOZG 3DWAA 3EROA 3GTQH 3DM3A 1X3QA 2VQEL 3RZDH 1S5CD 1B53A 1EOTA 2JA5H 3QJYA 1K0RA 3ITPA 2JN4A 1A63A 5IGBA 2EYFA 1VQNA 3SK6A 2NVTH 3I8ZA 1YEZA 1PRTD 1X56A 2R92H 4G7OC 2WACA 5F2DA 5EKLA 4WFN3 1GM5A 1PZKD 3VA7A 3QOJA 1M90C 4JI7Q 3CRLC 4J6HA 3UE0A 2L9HA 2MP1A 1YNNC 4M8AA 3CQZB 4PMWA 1NUCA 3I4MH 1JCKB 1D5XC 1GUGA 4JV5Q 1K9MC 1JOQA 4XXEA 5E7NA 1DZ1A 3OOCA 1EY8A 1PFMA 3HOUH 2A5HA 4CJ2C 3ONAB 1IXRA 1Y14B 2XN9C 4DAPA 4G7ZC 4LMQD 1CHPD 4MZ9A 5C4ZA 3UI2A 4BA2I 3TZUA 4LFAQ 3D6CA 1Y8NB 4L63B 1FVIA 2A73B 1N33L 1IKLA 2J0TD 1EEFD 1GD7A 2R7ZG 5KGUA 2JQOA 3FDTA 4FF2A 1L0YB 1CSQA 1SYDA 4CDDC 2EVBA 3KJOA 2WINB 4CJ1B 1IW7C 1WTHA 1PH7A 5DNFA 4R1JA 3GTOH 1U4PA 4BBRH 4A3LG 3CCVA 3Q23A 4IFDJ 4GZYC 2MGSA 1GKHA 4OXPA 4IN3A 1BBXC 2F4IA 3CMAA 2K6AA 1YNJC 3K7UC 5ELNA 4A3GH 2UXDQ 3T1YL 4A3CG 1EY0A 1Y8PB 1SYCA 2HQLA 2KECA 2F4VQ 5NUCA 3OWFA 2HDMA 3SK8A 1G8ZD 1L0WA 5EAYA 1JB3A 4YCWA 5FKAC 2QGQA 2WIIB 3CPWA 3KF6A 1VQ6A 3RN2A 2CCZA 1JWSD 4KKSA 4LF7Q 1CZWA 2XNAC 2KCTA 2F0TA 4DR7L 2JSOA 2EYMA 3BYTB 4DAVA 1MHWC 4OWXB 2FHTA 2F0HA 4JVZA 3GTPB 5EPKA 4MIUA 3DXJC 1SE2A 2JA7H 3KLWA 5M3MG 1R9TH 4X62Q 4FF1A 3GTGH 3PSIA 5EGTA 2R3ZA 4A75A 2UUCL 2Z8LA 1H9MA 2IL8A 4JBKA 2J4XA 2K5NA 4KY6A 3UDFA 3I91A 1FNWA 1FGBD 1G291 3FRPB 4X66L 2B2VC 5J1ZA 4PMBA 4B3SL 4CHTB 1MJCA 1XTDA 1Y1WB 2EJGC 3H91A 3MVVA 2AWOA 1TWGH 2R7ZB 3G4SA 3ERQA 3PO2G 3IL8A 4Y52H 2L4NA 5CV5A 3KJPA 1EFID 3F2DA 2N8NA 1F2ZA 2NVYB 2E74C 2VQEQ 5GAEC 4DR3L 5KYIA 1V43A 5BR8Q 2MNAA 1PH9A 2ENBA 2RHQB 3PV0A 4UDUC 3VYRA 2E2HB 1BCPC 3H0GH 1WD0A 1VQPA 3BJUA 4A3BH 5M3MH 1CZGA 5E3FA 3TP5A 1LUZA 2F52A 4N9TA 1WOCA 5GAHC 2EY2A 4GNXB 2K52A 1AE2A 3BU2A 2NVQB 1QB5D 2FJ2A 4EQ5A 1D5ZC 4A3KG 1B3QA 1Q82C 1NR2A 2B39A 1O78A 2ZXRA 5COYA 2VL6A 1B2TA 3JAMi 3C2PA 1DXMA 3TBIB 4JYAL 3VR2A 3GTLB 5M3MB 3UDIA 5CGKA 1VMCA 2FINB 3J80i 5LMNL 1CQFA 2Z9HA 5HGTA 5LMUL 5M9OA 2PNHA 2JA6G 1IBKQ 3Q0AA 4E6IA 1KLUD 5E4XA 4A3GG 3S1QH 2F3WA 3VYSA 4YY3Q 1M4VA 2A74C 5JJIA 3GTKB 4ZAIA 1Y1WG 1QZHA 5A35A 3WOFA 4DV6Q 4JI3L 2K5VA 2IJ0A 5CBAE 4A3KH 1LTLA 1U9RA 2F0KA 4K6DA 4YY3L 3OTOQ 1QZGA 4B3MQ 5ELCA 3GTLH 4HJ7A 2K32A 4X64L 3VR3A 2G9DA 3NELA 2QKIC 1J6QA 3NWSA 5HY6A 3J7YW 4A3EH 4KV6A 5AFWA 1EZ8A 2CWAA 3H3VH 1HR0Q 2HHHL 1SFOH 1V9PA 1X3EA 2QEXA 3HOWB 3DM1A 4TSSA 5FOBB 4A93H 4P74A 1KDCA 4FDBA 5FLXL 4H02A 3TP6A 1TXYA 2XSCA 2IX1A 3OPOA 1CT1D 1I6HH 1UEAB 1O7IA 1TWCH 4EQOA 4UY8C 2EY5A 4FP5D 5IGEA 4JOIC 4ZUIA 1I4GA 2LSSA 4IPGA 1A15A 2G5DA 2I5LX 2CH4W 1VQAA 4X3SA 5C3EB 3J81L 1KLGD 5CV7A 3CF5A 1YHBA 3BYYB 2E2IH 2VB3X 4R4OA 3T4AC 1SBBB 2UUBQ 3U9SA 1AW7A 1H95A 4U673 1PFNA 1KDBA 3FKIB 2HDLA 2EYPA 1CFMA 5FO8B 1TR5A 5H1SE 4L6TB 4JK1C 4ME3A 1ENFA 4Z9CB 3S16B 4DNIA 2N88A 3NWTA 2L1BA 1S5BD 4DU9A 2YTYA 1KDAA 3A8KE 3F2UA 2B2VA 4DR5L 2NBFA 1JICA 4V190 2BA0A 4K8JA 1VDZA 3A55A 1KAAA 1TWHB 2F0GA 4BBSH 4N9PA 2JA7B 3BVGA 1PH3A 2PI2A 1EFWA 5ELEA 2EY6A 2HCIA 3SXHA 4AYBG 3I2ZA 3K5OA 1F9PA 3S1NB 1Y8OB 1PH8A 2ZXPA 1WTOA 1TQOA 1Z7TA 3KFUA 3A0JA 3QR8A 2VY3A 2MO1A 2Q8IB 3TN2A 3E5SA 3CP0A 4R4IA 1XX8A 4KI0A 4AH6A 1ILPA 1GOZA 3NQTA 1PYBA 4DK6C 3NENA 5IYCG 2SNMA 2V4DA 4CKEA 5D65A 2A68D 2JA9A 5IYDG 2B2YC 1V1PB 4DK1A 4OL7A 4AQYQ 1X3PA 1EQRA 1N8RC 2NZ1D 1GHJA 5M3FG 3HOZH 2M9VA 1QILA 3MAQA 1YI2A 1B44D 5EKIA 3EBEA 4DUZQ 2IT1A 1QE6A 1I5FA 1UEBA 4C56C 3EFXD 2K14A 1NCVA 2MJ8A 3D31A 3MFYA 3CQZH 3R93A 2NWGA 1XPRA 1I50B 1I4RA 1GJXA 1ZEQX 3HOWH 3OMCA 3QO2A 4BA1I 4Y7NB 1ML0D 1SMXA 3H94A 2E8GA 2ALYB 4OELB 1A2TA 3CU7A 5KNBA 1F9QA 2RCNA 1VQ7A 1WCMH 4NB3A 1SYFA 1PDQA 4QIWB 1BO0A 4HR7B 5IWAQ 3J81j 5EBDA 4DV4Q 2UU9Q 5M3FH 3MTSA 3E9HA 5M5WB 4A3BB 1RDPD 4HMJA 2Z0SA 3C3LA 1AZQA 1RTOA 4P71A 4GKKQ 2NN6G 2UUBL 4FYDA 1HZ9A 2OWOA 1EWCA 3J7AF 1K28A 2P5ZX 2SDFA 3HOVH 4B3TL 1IBKL 2C9OA 2LFNA 5ELOA 1WFQA 3M4OB 1IYUA 5FO7B 2NTSA 1SE8A 5LMNQ 4KJOA 4LFCL 1SXTA 2PCFB 4DV5L 4LF8Q 4RGMA 4POGA 3S2DH 5M3FB 3G6EA 1LT6D 3HKZB 4Q0FA 1BQQT 1E1OA 3OIQA 2E2JH 5C4XB 2B63G 4X66Q 3KUPA 3RZOB 3RZDB 3WOEA 4QL5A 4PV1C 2NVQH 2BH8A 1W6KA 1PRTC 2RSOA 3MZ5A 2EPBA 3DWQA 4DR5Q 4DAYB 2JA8B 2WB1E 4QIWE 1BKBA 2Z4HA 1JWUD 2B29A 2D5DA 2ZT9C 5I6YA 1QNUA 4C2MB 2BDNA 2OCEA 3CCUA 3D3RA 5J3BA 1F2LA 4ZLTF 4C3JH 2VB2X 3KDFA 2EYLA 3STBD 3U4ZA 2N49A 2F0LA 5KIXA 1HPCA 4YWLA 3IFTA 2JJQA 4DXGA 4DR2Q 1HUNA 4FO2A 3KK7A 1ASZA 4OX9Q 5KNCA 1X3FA 1YNXA 2ES2A 2KUMA 3OIPA 1HRJA 3CD6A 2ZTDA 2L5TA 4A3KB 1NAPA 1EY4A 4RKLA 2B8FA 4V0BA 3GTMB 4RMFA 2NUCA 3PIP3 3AQQA 3L2PA 1DONA 3NBHB 3PQIA 2KHJA 1AFPA 4L5TA 1B70B 2EY1A 3VR5A 5T1IA 4U68A 2DNEA 1PLFA 1QUQB 2PZWA 4X3TA 4MHEA 4F7XA 4GLVB 1KHIA 3F2CA 2K1BA 1E2VA 3A74A 4UPAA 1I94Q 2UUCQ 1UAPA 3M4PA 5E1FA 1NR4A 4PMCA 1SNDA 1SROA 3D8GA 4OHJA 1Q46A 1QWYA 4KD3A 5C4JB 2O5JC 4QMGA 2KCCA 2VW9A 1CUKA 2RDFA 4OIKA 5M5WH 1CM9A 1S5FD 3OTOL 1HCZA 1OXTA 3HOVG 1KAWA 4K5XA 1N34L 4LFBL 1PMRA 1HR0L 5BN4A 5EJWA 1CKMA 1A2UA 1OXUA 5BR8L 3OMGA 3TQYA 4NP5A 4MTKA 4Q5VA 1HA6A 2OF1A 3T53B 1F77A 5CV4A 1SEBD 1N32L 1C4QA 2Q2IA 4DR1Q 1GUNA 4LF6Q 3I70A 1LO5D 2R93G 2WAQG 1D2BA 4B3TQ 2K5WA 1ESFA 2EIFA 4LF4Q 2UXCL 2PPBC 1ENAA 1TWCB 3OSOA 4JI6L 4RGOS 4JYAQ 4IPHA 2ATWA 3M3YH 1XJVA 4GNXC 3G7LA 3TEHB 4X6AH 4C3IB 1VF7A 2MPMA 1T9HA 3NXWA 1CK1A 3RUZA 4WJWA 2KEEA 4ZKCB 2R7ZH 4C1NI 1B9NA 4G57A 2Q2UA 5IGFA 4PQXA 1RCVD 3T51B 2A6EC 4A93B 4LUZA 2K5QA 2QDBA 4DR7Q 1ZYRC 3F1ZA 4HIDA 3FKIH 4LF7L 1IYVA 2XTIA 1EIHA 5D3DA 1HZAA 2VS1A 3CPFA 3RLFA 1QJOA 4OEMB 1X65A 3UDXA 4LK1C 2KBNA 4K5VA 2PQAA 4QUCA 2QF7A 5IT9c 1YIJA 1MSHA 1XXGA 2LKVA 5FJ8H 1IHZA 2LY7A 1SLJA 2EXZA 3I7FA 4C3HB 3J81c 4RGTA 5BN5A 3ERSX 4DUYL 5JEAJ 2WV6D 3I72A 3NBHA 1PXUA 2ZTCA 1EY7A 4DR3Q 1FJGQ 4FF4A 4GN4B 2B2WA 1XPUA 2UXDL 3QG1A 1S5DD 1XTCD 1C0AA 2JYOA 3SK5A 2JA7G 2ZJPA 1YITA 1VQEA 1VQCA 1N33Q 5C3EG 1TWFH 3HKSA 4DXFA 4CDFC 4LFAL 1IYJB 1GXDC 1N34Q 4LFBQ 1QG7A 3S15B 2AWNA 5C0XJ 1JC7A 4R8NA 2A19A 1KTKA 4K0KL 3L3OC 3P20A 1JE5A 4C3IG 4ME5A 4UHVA 4A3JB 2E5LL 1EQQA 5I9PA 3I55A 3Q8DA 1U0LA 3C46A 3J80L 3A56A 5C3XA 4IUPA 3ND9A 4X62L 2B2TA 4A3FG 3AFPA 3K7AH 3AMUA 2ZTEA 1J5EQ 1STEA 1OXXK 5AJ3Q 1DOMA 1HQMC 1I6HB 4IO9A 2WP8J 4HJAA 1A8VA 4DAYA 5LMNW 5LL6S 1I50H 1HNWL 1K73C 4JI2Q 1EY9A 4OONA 1HNXL 4NKLA 5M5XH 2L0CA 4ID6A 4Y7NH 4DV6L 1E24A 1V1OA 1X3GA 1YHAA 2VUMH 1CTMA 1ET6A 1DOKA 2JA8H 4ULLA 1HNXQ 1WTXA 2N3SA 3CKIB 3E0JA 4BS9A 3KLRA 2NVXH 2KHSA 5IP9G 1HNZL 3J81i 2A1AA 2I46A 4PG3A 4TVAB 3PUVA 1SN8A 5DM63 1JOOA 1VQGA 3FMCA 4YCVA 1U4MA 5C44B 3K0YA 2E75C 5A2QE 2AUJD 1XMQQ 4HIKA 1I4XA 3KYHC 1G2SA 4ZCKA 2PMZE 1OXVA 1B3AA 2JA6H 1VQ5A 4F88A 1HHVA 4DV7Q 4KHPQ 5JPNC 3X3MA 4XIGS 1BBWA 5A2QL 1I3QB 4LF9L 2RHSB 1PTOB 1LTSD 3MC0B 3ULPA 4CKBA 3T1HQ 4A3DB 1KRTA 1JWMD 1JR0D 3DUZA 3JAMc 4S3SA 2HUGA 4FF3A 2JA5B 1HUMA 5IP9H 3HOXH 1T5XD 5CV9A 4LF8L 1VQ9A 1CA5A 1F2MA 4DUZL 1VQLA 2I0QA 3BDCA 1LLRD 4L5QA 1FGUA 4JI7L 2EQSA 3S1MH 3C1EA 1X55A 1YVCA 2NN6H 2XGTA 4JI8Q 1BBUA 3RD4A 4HJ9A 3N52A 3MXUA 3HP3A 3MXPA 3J7ZC 3HKZE 3W5OA 2FMMA 4C3IH 1K83B 3CHBD 2ZM6L 1V1PA 4IJLA 4JCVE 4K8IA 1CI3M 4DK0A 2PMZB 1A0IA 5IWAL 2NYZD 3ICEA 2M2LA 3PGZA 3HRZC 1FR3A 1UE1A 4GN3B 4FXKC 4C1NK 3HKZG 3FVQA 3K5NA 3U4VA 1EQVA 2PZTA 3NTHA 4WORA 3D4DA 4OO1G 1STGA 1EUJA 1HZCA 3VYUA 3NUCA 4DK3C 4CKCA 1BDOA 1FD7D 1N9WA 1C8CA 5E4WC 3QB3A 3E9IA 2VUMG 1VQJA 2HD3A 1VMPA 5HGQA 3K0XA 1VS0A 4RWSC 4I7ZC 2JA8G 5M5YH 4BBSB 2AMCB 3MXGA 3H15A 1G2TA 2TSSA 4K6LA 2MFIA 1V8QA 2CQAA 1LTRD 1B7YB 3CW2C 2NZHA 4DR4L 5JAVA 2F0PA 3H6MA 5D3IB 1U4RA 3BVZA 5JEAG 3PUXA 1F2YA 4L8JA 1YHQA 1QCBD 3FPUB 4JBJA 1S72A 1S3OA 4J8QA 4MNOA 3QOLA 5I2YA 3PO2H 1L1OB 4DV2L 3VDYA 2O2LD 4RA8A 4DPGA 4F87A 3TSSA 4O1NA 1PRTB 4DV0L 1IW7D 4PZ6A 1RTNA 4AIMA 1ZKOA 1PH4A 1E3PA 2XWBB 4KHZA 4LUOA 1NJIC 1BXTA 1ICFB 2UU9L 3D6WA 5K36G 1NY4A 2VXWA 5FLXc 1J8IA 2NN6I 1PFSA 3VYTA 1BCPD 2A69D 3M7GA 1IBLQ 1CSPA 1TS4A 4GOPC 2LS01 1EIGA 1XWEA 3I4LA 2J7ZA 5FLXE 3B6YA 4JI6Q 1Y1WH 5CYUA 3M4QA 1HZBA 2GVBA 5ELFA 3RZOH 4OX9L 1PH6A 2B2UA 4A3IH 3BZKA 4DR1L 4QB4A 1AP0A 5G3LF 5CORA 2K04A 3HS0C 4DV5Q 2UUAQ 4DR4Q 5LMUQ 1MIUA 1SNPA 5T1GA 4EQNA 2RSNA 4LUVA 2K03A 2K33A 1S4ZA 1Y69U 3E6ZX 3NE5B 2JEBI 4X3KA 1G91A 4NDXA 5IP7H 4DV3Q 2OTLA 4C3JB 1VQDA 4JI0Q 1XNRQ 2R7FA 5C3WA 4JI5L 1B9MA 1KQSA 3K5MA 3S15H 3I73A 4O42A 1RF2D 2A68C 4J15A 2VNUD 3PCOB 5CMDA 2CVRA 2AKWB 1Z6HA 3EJIA 3FP9A 1II3A 2XVSA 3QIAA 4O0AA 4QJFA 2PW5A 2E2HH 1FYCA 4TQUS 1XMQL 1TY0A 5DM73 3U9OA 1Q86C 4EGVA 3T13A 1XYIA 4KLKA 3S1QB 3A7LA 1WTQA 4LWCA 2WKCA 3L7ZC 2YU9B 1ENCA 4JBMA 3J80E 3Q6SA 4BBRB 2F0FA 5IE8A 1UE7A 5IP7G 4GNXA 3K80C 3J7A5 1G6PA 1XMOQ 1SFOB 1L0XB 2Z1CA 2JA6B 1TU2B 1TWAB 4HCEA 4BY7B 1HA5A 4L5RC 3SHLA 1KRSA 3I56A 4A3GB 1KL9A 3K5LA 4DV1Q 5JJKA 3MEHA 3BVMA 1FNVA 4C2MH 2KCNA 5TSSA 3U58A 4RFBA 1YZ6A 5FK9C 3I4MB 5M5XB 2O5IC 2Q2TA 3PUWA 2B2UC 3I3CA 4A3FB 1RODA 2PO4A 4HIMA 1WTVA 3A8JE 4JBWA 3T16A 1L2FA 5IGCA 2H1EA 5CR3A 3ULLA 3RNUA 4ZYSA 3E3XA 4NW2A 4NPSA 4C3JG 2KHIA 3NTIA 3M4OH 3HOYH 5KEEA 2B8GA 4JG2A 1W6JA 3NP8A 4H7BA 3HEJA 3ER0A 1F9RA 1SMYD 2A6HD 1JOKA 3W1GA 2SNSA 4GLXA 3NPPA 4CDCC 1D8LA 1PH5A 4UP7A 3S17B 1EIFA 3F8TA 5KYLA 5JVH3 1GO3E 2O4XA 3ND8A 2Y0SB 3IRBA 1NMGA 1SJED 1IKMA 1ZYRD 3KF6B 2DY7A 1PRTF 2JEAI 3D0FA 2DGYA 4G4KA 2RA4A 2DUDA 4RH6A 1I4QA 2PYKA 1VQBA 3FEWX 4P2CB 1CQVA 5CV8A 2F3VA 1ASYA 3JC66 3BG3A 1TS3A 1LM0A 1MI2A 1PV4A 4XDXA 1STBA 3GTQB 1Q90A 4IPCA 2DN8A 5C4HA 5C6AA 1T5EA 3LWEA 1EOVA 1BOSA 2QW7A 1EZ6A 1E1TA 4H0LC 2F0QA 2F0EA 1D5MC 1KD1C 3S1NH 2ZXOA 3D4RA 2OQKA 4H44C 3MXNA 2JA5G 2PNRC 5LHY1 2QDLA 3A7AB 3CC2A 3BZDB 3W3AA 4HN7A 3TREA 5C44G 4DN4M 1GUWA 1GUOA 1HR0W 1K0SA 4P75A 2HHHQ 1IL2A 2EYJA 3TP7A 3MWYW 3R2TA 4K5WA 2OT2A 4IFDG 4F8MA 5J22A 1UE5A 3EA6A 4FNFA 1SYGA 2CW0C 1KXLA 3HOXB 3G48A 3HOUB 1STNA 4P72A 1HNZQ 1WCMG 3T1YQ 4X65L 1C7YA 3I90A 2C35B 4ALPA 2F0UA 4ZRZA 1F9SA 1X9NA 2F3IA 2K5DA 3AEVA 3Q24A 4HEDA 2E2IB 1LTTD 2Q8TA 3PO3H 3H0GB 1K3BC 4N8X1 4KHVA 3DEOA 3L9AX 1Q81C 1DYQA 2CWPA 1OXSC 2XIWA 4IUVA 2I5HA 5ISRA 1HFNA 2VQFL 1SNMA 3CCSA 2LXKA 2SOBA 4RCNA 4YHHL 3CCLA 4C3HH 2E76C 4QF4A 2CW0D 4BY1H 1GUTA 5K5PA 1HTPA 2D9UA 3AYHB 3TDQA 4KN7C 3PUYA 1DD2A 1YJNA 5CV6A 1EWHA 4A4IA 3P75A 4B08A 3PF5A 2RKSA 1EYGA 4R9WA 2EYOA 2K4KA 2RBMA 1HXYD 3PO2B 2R7DA 4MN3A 3N6RA 3A5UA 1JT8A 3S1RB 4ILWA 1A3UA 4DR2L 1H9JA 1JMCA 1I4PA 1WTWA 3V96A 3BDLA 4X3UA 4DV2Q 1N36Q 3K59A 4LAAA 1VQMA 3KDFB 4HSPA 5GADC 2Q2HA 4OIJA 3NTKA 1K8GA 4XYQA 3S9WA 1KC8C 2C5CA 2GVAA 2K5HA 5HURA 2V1CC 1WCMB 3T56B 3JAML 1H9SA 3A8IE 3UDGA 1Y1VB 3S24A 1WVLA 1U4LA 1K8AC 5IYBG 4WJ3M 1STYA 1YJ9A 4BBSG 5DEHA 1CA6A 1EYAA 2UXBL 2HT1A 3ZYYX 1STHA 3V05A 4I7AA 1NMFA 2RQXA 4A3IB 4A3CH 2XWJB 1R4PB 1TKWB 5GROA 4DV7L 4KHPL 2I5MX 2WB1B 2FXQA 2QCPX 1LV9A 2H4OA 1EL0A 1JE4A 4K2LA 4EX5A 1SRUA 3IAYA 2UXBQ 1PH1A 1WTPA 1TWAH 4BY7H 2B63B 1LTBD 5C4XG 1MJEA 1SSOA 1PFBA 4JI1Q 1SE4A 2KCMA 2X6LA 1D1KA 4K0KQ 2KA7A 1RJTA 4LJZC 2BE5C 4XQJA 4GOPA 3GTMH 4B3RQ 2R93H 1NTGA 3EQLC 1BCPF 5DLQE 4LF6L 3HGBA 4EVOA 3TZDA 3MA2B 2RDGA 2MO0A 2DJGC 3UE1A 3NBIA 2K28A 2BCOA 1O80A 4J1MA 3RMHA 4LF4L 2UXCQ 1KNEA 2B2WC 2Q8RE 2WFWA 1UE6A 5L37A 4DR6Q 5C4JH 1E2WA 3PF4A 1D6EC 2I07B 3GV6A 1DCZA 2ASBA 3HOWG 1VCIA 2D2CC 1PYSB 3VR6A 1B8AA 3KF8A 1M1KC 3GQBA 1OO9B 2BE5D 4IOCA 2EXDA 2AQ3B 1EEID 1Y1VG 1VQHA 3AFQA 1EYCA 1Q1EA 4A3EB 4AYBE 5IIFA 4HMIA 4NXNQ 2MHVA 5C0XI 4KMUC 4ODGA 1CKNA 2K50A 3SR1A 4GS3A 4TKOB 1VQFA 2DNCA 2YV5A 3RN5A 5FLMG 3HOYB 2KQ3A 2RCFA 5JJLA 2EDGA 2DJFC 3SGIA 3PIOA 4APVA 3SK4A 1EU4A 5C0XH 4NXNL 3AB9A 1LTGD 1IL8A 5ELDA 1MGSA 1SNQA 2NTTA 2GA4B 1C9OA 5KNDA 1M8AA 4POFA 2F0DA 2A6ED 2CQOA 3HOVB 1DOLA 1PTOD 2RDHA 3I4MG 3HFZB 1D7QA 2CH4A 1SYBA 4JI2L 1Z47A 1OTCA 2JE6I 4IJHA 1BF4A 4RCOA 1H9KA 4DKAC 1FL0A 3MFGA 2IX3A 4A3MB 1PVOA 4IUUA 2AUKA 5IODA 5IY0A 1IBML 4FXGC 2OQ0A 3OYYA 1B50A 2WAQB 2XRSD 2EYHA 4KN4C 4P73A 2EZVA 4AYBB 3OHXC 5C4XH 4BY7G 1BNZA 3CAMA 3PUZA 1BVSA 1MD2D 3CCJA 4HAEA 1LT5D 1LT3D 5JEAH 5LL6X 1RIPA 3BDOA 4XT1B 1E7ZA 2BA1A 2N55A 1PH2A 4HIOA 4JV5L 2B63H 2Z6KA 4A3EG 4A3LH 2G9HD 3OWEB 5C5MA 1K8MA 4DA2A 2ZM6Q 2F03A 3WDNA 1I94L 4DAMA 1VQIA 2LXJA 4A93G 4GKJQ 1VQKA 3K81C 4FVMA 3HOYG 4KKUA 3IKJA 3ZJYC 1EY5A 1YNND 2CFMA 4LFCQ 4ABNA 2YU9H 4K2KA 2AQ1B 1RD9D 2F0OA 2E2DC 3Q22A 1A3TA 2Y0SE 4OO1I 3GDEA 2F0IA 3M9BA 2F0JA 1L1OA 1P8LA 1IZ6A 1YBYA 4IUTA 2X6GA 4XT3B 4L5SA 5IT9L 2B2TC 1SNCA 4ZUJA 2QEJC 3W2DA 4LF5L 2F4VL 2F1MA 1NBWA 4G7HC 1UUPA 1HH2P 5I6WA 2EE1A 4FXDA 2CKZB 3HZXA 2WAQE 1W3SA 1ONLA 1TT2A 1RL2A 1W2BA 3SEBA 2F0SA 2L15A 2Y0SG 3CCQA 4IUNA 4LF9Q 3D4WA 1FNUA 3S1RH 5IGGA 5FO9B 5FLMH 3KOJA 3QWNA 1VF5C 3DHQA 3K6OA 3I4NH 4KTAA 2K05A 4KJNA 1X32A 3HOZB 4QCLA 4A3BG 3KF8B 5C0XG 2B3GA 4BXXG 4DV3L 1ESRA 2K7VA 2D0PA 2D62A 1D1IA 3TP8A 4MTNA 4ZK9B 4B3ML 2EOTA 2OXPA 1L1OC 3TMEA 1AN8A 4R4CA 2IHFA 3L0OA 2IWHA 1X54A 5EPLA 1QVGA 2FFKB 4A3JG 1UWVA 1HQRD 2E2JB 1XMOL 2H5XA 1CKOA 1PZJD 3H0GG 1WI5A 1LYLA 2VQFQ 3MHBA 1TS5A 1DGSA 3KBGA 3G71A 3EVQA 3GO5A 3I4NB 4DF7A 4KKTA 2KJXA 1Q12A 2Z6KC 2PW7A 3F2BA 4KY5A 4GOPB 4JI3Q 1JJGA 3S14H 3PMFA 4K14A 3LGJA 4XQQA 4ZQ3A 1LT4D 1O7YA 2A6HC 5IYDH 3HOXG 1IBLL 3HOUG 2RF4A 2MUYA 1N32Q 4OGQC 4PNYA 3K8AA 4A3DH 1DM0B 1A3VA 1SDFA 3PIO3 3TS2A 1VQOA 2AHOB 5IGDA 1WYDA 1V1QA 2K01A 4QQBX 3FHWA 4OO1H 1PTOC 4DV4L 1XNQQ 2ZJRA 4DGZA 1AEXA 1AH9A 1HFGA 2YTVA 2NVTB 1BUVT 4CBVA 3GTGB 1H9RA 1PTOH 3HG9A 2FMCA 1H9SB 1AE3A 4JC0A 1ICWA 2VZAA 5IT9E 4LNQA 3A54A 1S5ED 4O2DA 4KY7A 4I65A 5JOBA 3GD7A 3W1BA 2N78A 2ICEC 4X64Q 2SEBD 1B4OA 1K83H 3S2HB 4XYOA 1LTID 1FJGL 2IY5B 1TWGB 3TRZA 3CCEA 2KENA 3BZCA 4A3DG 1TWHH 2KOLA 1SNOA 4YCUA 2ICIA 3NHHA 1A62A 3NK9A 2KEDA 5GAGC 3GTJB 2YYZA 4LF5Q 2NVYH
chains in the Genus database with same CATH topology
3R8BA 3V2TA 1TVXA 1I4HA 5EQ0A 2IX0A 3M3YB 1RKNA 1BCPB 2F0MA 1ILQA 5EBCA 3M7NA 4M1UB 2F0WA 4B9XA 1O7LA 1TIID 3SDZA 1CHQD 3GTOB 4RHSA 1UNSA 2L55A 1YNJD 4EQPA 3SVMA 1MBYA 3FPPA 3S1MB 4HSVA 3PO3B 3H09A 1TS2A 1PYWD 2ID0A 3G6JB 5I2XA 3P7JA 1A6XA 3R2IA 3URYA 2R93B 2HCCA 5M5YB 3K58A 5J39A 4CJ0B 3VA5A 2IW3A 4BY1B 1ZXTA 1DJRD 3DEPA 1JORA 2VUMB 2DY8A 3H3VC 2A69C 4IUQA 2B2YA 4IQZA 1PTOF 2BOSA 3R3OA 2R92B 1KNAA 4IZ8A 4NMZA 1Q1BA 3GP7A 3KLSX 1LACA 3J7AV 2AQ2B 4R8IA 1SMYC 3O13A 2EJFC 4HCSA 5I4DA 2PZUA 2RVLA 2NB0A 2JP1A 3X3NA 4DNRB 4XTCS 5CC4A 4IFDH 1E0BA 4KD4A 2X69A 2OEOA 1PZID 5EPJA 4YIJA 3K7AB 3SE0A 1GUSA 3OW7A 1C48A 1EYDA 4C3HG 4QUFA 1TWFB 2HQEA 4IFDI 2R61A 2Z4IA 1NSNS 1E2ZA 1EY6A 1GHKA 1KABA 3AU7A 3JAME 4RKBA 1QNKA 2F0NA 1JQYD 3LNNA 3C1FA 4KK7A 5JJZA 3KLSA 2QILA 5IOCA 3J81E 1STAA 2XRQD 4DFAA 2JXMB 2WKDA 1Q8IA 4RAUC 2R6GA 3KBXA 1QOHA 1Q3LA 3DWPA 1LABA 5EKKA 1EQTA 1MSGA 2L12A 3NQIA 5BN3A 1SYEA 3NSWA 5JVG3 1K8OA 3LWUA 3CRKC 4TRDA 4WRDA 3S14B 2BDOA 1R4QB 3LX0A 2M00A 5D14A 2NVXB 2TMPA 2CHBD 4IALA 3BS1A 5DAUA 1ET9A 5I9OA 1B1ZA 2LMCB 1WD1A 4ZKBB 1SJHD 3VR4A 1AZPA 2PQEA 3P1HA 3GV3A 1WTRA 1LTAD 2L11A 3K57A 4CGYB 3DMUA 5KRUA 4H13C 1RHPA 5JPMC 3IFDA 4UAIA 1SE3A 4BWGB 4IURA 1G6ZA 3M4YA 4HTHA 1J9OA 1O7ZA 5ELBA 5G3LD 4XQNA 2IPKD 1R9TB 4RHRA 4RGNA 4DNTB 1SAPA 2F0VA 1TY2A 1EU3A 2KVMA 3S2DB 1I6VC 5K36H 2EJMA 3M85A 1HTLD 5C5LA 5CBEE 1BR9A 4B9WA 3DWAA 3EROA 1X3QA 1S5CD 1B53A 1EOTA 3QJYA 3ITPA 5IGBA 2EYFA 3SK6A 3I8ZA 1PRTD 4G7OC 2WACA 5F2DA 5EKLA 4WFN3 1PZKD 3VA7A 3QOJA 3CRLC 4J6HA 2L9HA 2MP1A 1YNNC 4M8AA 3CQZB 4PMWA 1NUCA 1JCKB 1D5XC 1GUGA 1JOQA 4XXEA 1DZ1A 3OOCA 1EY8A 1PFMA 2A5HA 4CJ2C 3ONAB 2XN9C 4DAPA 4G7ZC 4LMQD 1CHPD 5C4ZA 3UI2A 4BA2I 3TZUA 3D6CA 1Y8NB 4L63B 2A73B 1IKLA 2J0TD 1EEFD 5KGUA 3FDTA 4FF2A 1L0YB 1SYDA 2EVBA 2WINB 4CJ1B 1IW7C 5DNFA 1U4PA 3Q23A 4IFDJ 4GZYC 2MGSA 1BBXC 4IN3A 2F4IA 2K6AA 1YNJC 1EY0A 1Y8PB 1SYCA 2KECA 5NUCA 3OWFA 2HDMA 3SK8A 1G8ZD 1JB3A 5FKAC 2WIIB 1JWSD 4KKSA 1CZWA 2XNAC 2F0TA 2JSOA 2EYMA 3BYTB 4DAVA 2FHTA 2F0HA 3GTPB 5EPKA 4MIUA 3DXJC 1SE2A 4FF1A 5EGTA 2R3ZA 2Z8LA 1H9MA 2IL8A 2J4XA 4KY6A 3I91A 1FNWA 1FGBD 1G291 3FRPB 2B2VC 5J1ZA 4PMBA 4CHTB 1Y1WB 2EJGC 3H91A 3MVVA 2AWOA 2R7ZB 3ERQA 3IL8A 2L4NA 5CV5A 1EFID 1F2ZA 2NVYB 2E74C 5KYIA 1V43A 2ENBA 3PV0A 4UDUC 3VYRA 2E2HB 1BCPC 1WD0A 1CZGA 5E3FA 3TP5A 4N9TA 2EY2A 2NVQB 1QB5D 2FJ2A 1D5ZC 1NR2A 2B39A 1O78A 2ZXRA 5COYA 1B2TA 3C2PA 1DXMA 3TBIB 3VR2A 3GTLB 5M3MB 5CGKA 1VMCA 2FINB 1CQFA 5HGTA 5M9OA 3Q0AA 4E6IA 1KLUD 5E4XA 2F3WA 3VYSA 1M4VA 2A74C 3GTKB 4ZAIA 5A35A 3WOFA 2IJ0A 5CBAE 1U9RA 2F0KA 4K6DA 5ELCA 2K32A 3VR3A 2G9DA 2QKIC 3NWSA 3J7YW 4KV6A 5AFWA 1EZ8A 3HOWB 3DM1A 4TSSA 5FOBB 1KDCA 5FLXL 3TP6A 2XSCA 2IX1A 3OPOA 1CT1D 1UEAB 4EQOA 2EY5A 4FP5D 5IGEA 4ZUIA 1I4GA 1A15A 4X3SA 5C3EB 3J81L 1KLGD 5CV7A 3BYYB 2VB3X 3T4AC 1SBBB 3U9SA 1AW7A 4U673 1PFNA 1KDBA 3FKIB 2HDLA 2EYPA 1CFMA 5FO8B 1TR5A 4L6TB 4JK1C 1ENFA 4Z9CB 3S16B 2N88A 3NWTA 2L1BA 1S5BD 4DU9A 1KDAA 3A8KE 3F2UA 2B2VA 2NBFA 1JICA 4V190 2BA0A 3A55A 1VDZA 4K8JA 1KAAA 1TWHB 2F0GA 4N9PA 2JA7B 3BVGA 5ELEA 2EY6A 2HCIA 3SXHA 3K5OA 1F9PA 3S1NB 1Y8OB 2ZXPA 1WTOA 1TQOA 1Z7TA 2Q8IB 3TN2A 3E5SA 1XX8A 4KI0A 1ILPA 1GOZA 3NQTA 2SNMA 2V4DA 4CKEA 5D65A 2A68D 2B2YC 1V1PB 4DK1A 4OL7A 1X3PA 2NZ1D 1GHJA 2M9VA 1QILA 3MAQA 1B44D 5EKIA 2IT1A 1QE6A 4C56C 3EFXD 1NCVA 2MJ8A 3D31A 3MFYA 3R93A 2NWGA 1I50B 1I4RA 1GJXA 1ZEQX 3OMCA 3QO2A 4BA1I 4Y7NB 1ML0D 3H94A 1A2TA 3CU7A 5KNBA 1F9QA 1SYFA 1PDQA 4QIWB 1BO0A 4HR7B 5EBDA 3MTSA 5M5WB 4A3BB 1RDPD 4HMJA 3C3LA 1AZQA 1RTOA 2NN6G 4FYDA 1EWCA 3J7AF 2SDFA 2C9OA 2LFNA 3M4OB 1IYUA 5FO7B 2NTSA 4KJOA 1SXTA 2PCFB 4RGMA 5M3FB 1LT6D 3HKZB 4Q0FA 1BQQT 3OIQA 5C4XB 3KUPA 3RZOB 3RZDB 3WOEA 4PV1C 2RSOA 1W6KA 1PRTC 3MZ5A 2EPBA 3DWQA 2JA8B 2Z4HA 1JWUD 2D5DA 2ZT9C 5I6YA 1QNUA 4C2MB 2BDNA 3D3RA 1F2LA 4ZLTF 2VB2X 2EYLA 2F0LA 5KIXA 1HPCA 3IFTA 4DXGA 1HUNA 4FO2A 3KK7A 5KNCA 2KUMA 3OIPA 1HRJA 2L5TA 4A3KB 1NAPA 1EY4A 4RKLA 2B8FA 4V0BA 3GTMB 2NUCA 3PIP3 1DONA 1AFPA 2EY1A 3VR5A 5T1IA 4U68A 2DNEA 1PLFA 2PZWA 4X3TA 4MHEA 4F7XA 2K1BA 1E2VA 1UAPA 5E1FA 1NR4A 4PMCA 1SNDA 3D8GA 4OHJA 1QWYA 4KD3A 5C4JB 2O5JC 4QMGA 2KCCA 2RDFA 4OIKA 1CM9A 1S5FD 1HCZA 1OXTA 4K5XA 1PMRA 5BN4A 5EJWA 1A2UA 1OXUA 3OMGA 4NP5A 4Q5VA 1HA6A 2OF1A 3T53B 1F77A 5CV4A 1SEBD 1C4QA 1GUNA 3I70A 1LO5D 1D2BA 2K5WA 1ESFA 2PPBC 1ENAA 1TWCB 3OSOA 4RGOS 3G7LA 4C3IB 1VF7A 2MPMA 3NXWA 1CK1A 3RUZA 4WJWA 2KEEA 4ZKCB 4C1NI 1B9NA 4G57A 5IGFA 4PQXA 1RCVD 3T51B 2A6EC 4A93B 2K5QA 2QDBA 1ZYRC 1IYVA 1EIHA 5D3DA 3RLFA 1QJOA 4LK1C 4K5VA 4QUCA 2QF7A 1MSHA 1XXGA 2LKVA 1IHZA 2LY7A 2EXZA 4C3HB 4RGTA 5BN5A 5JEAJ 2WV6D 3I72A 3NBHA 1PXUA 1EY7A 4FF4A 2B2WA 3QG1A 1S5DD 1XTCD 2JYOA 3SK5A 4DXFA 1GXDC 1QG7A 3S15B 2AWNA 5C0XJ 1JC7A 4R8NA 1KTKA 3L3OC 3P20A 4C3IG 4ME5A 4A3JB 5I9PA 3C46A 3J80L 3A56A 5C3XA 4IUPA 3ND9A 2B2TA 3AMUA 1STEA 1OXXK 1DOMA 1HQMC 1I6HB 2WP8J 4DAYA 5LL6S 1EY9A 4NKLA 2L0CA 4ID6A 1V1OA 1CTMA 1ET6A 1DOKA 4ULLA 1WTXA 3CKIB 3E0JA 4BS9A 3KLRA 2KHSA 2I46A 3PUVA 5DM63 1JOOA 3FMCA 1U4MA 5C44B 3K0YA 2E75C 5A2QE 2AUJD 1I4XA 1G2SA 1OXVA 1B3AA 4F88A 1HHVA 5JPNC 3X3MA 4XIGS 5A2QL 1I3QB 1PTOB 1LTSD 3MC0B 4CKBA 4A3DB 1JWMD 1JR0D 3DUZA 4S3SA 2HUGA 4FF3A 2JA5B 1HUMA 1T5XD 5CV9A 1CA5A 1F2MA 3BDCA 1LLRD 3C1EA 2NN6H 3RD4A 3N52A 3MXUA 3HP3A 3MXPA 2FMMA 1K83B 3CHBD 1V1PA 4K8IA 1CI3M 4DK0A 2PMZB 2NYZD 2M2LA 3HRZC 1FR3A 4FXKC 4C1NK 3K5NA 3FVQA 1EQVA 2PZTA 3NTHA 4WORA 3D4DA 4OO1G 1STGA 3VYUA 3NUCA 4CKCA 1BDOA 1FD7D 1C8CA 5E4WC 3QB3A 1VMPA 4RWSC 4I7ZC 4BBSB 3MXGA 1G2TA 2TSSA 4K6LA 1V8QA 2CQAA 1LTRD 5JAVA 2F0PA 3H6MA 5D3IB 1U4RA 3BVZA 5JEAG 3PUXA 1F2YA 4L8JA 1QCBD 3FPUB 4J8QA 3QOLA 5I2YA 2O2LD 4RA8A 4F87A 3TSSA 4O1NA 1PRTB 1IW7D 1RTNA 1ZKOA 4KHZA 2XWBB 1BXTA 3D6WA 5K36G 2VXWA 1J8IA 2NN6I 3VYTA 1BCPD 2A69D 3M7GA 1TS4A 2LS01 1EIGA 1XWEA 3I4LA 2J7ZA 5FLXE 5CYUA 5ELFA 2B2UA 4QB4A 1AP0A 5G3LF 5CORA 2K04A 3HS0C 1SNPA 5T1GA 4EQNA 2RSNA 2K03A 2K33A 1S4ZA 1Y69U 3E6ZX 3NE5B 2JEBI 4X3KA 1G91A 4NDXA 4C3JB 5C3WA 1B9MA 3K5MA 3I73A 4O42A 1RF2D 2A68C 2VNUD 5CMDA 2CVRA 1Z6HA 3EJIA 1II3A 2XVSA 3QIAA 2PW5A 1FYCA 4TQUS 1TY0A 5DM73 3U9OA 4EGVA 3T13A 1XYIA 3S1QB 3A7LA 1WTQA 2WKCA 3L7ZC 2YU9B 1ENCA 3J80E 3Q6SA 4BBRB 2F0FA 1SFOB 1L0XB 2Z1CA 2JA6B 1TU2B 1TWAB 4HCEA 4BY7B 1HA5A 3SHLA 4A3GB 3K5LA 3MEHA 3BVMA 1FNVA 2KCNA 5TSSA 4RFBA 5FK9C 3I4MB 5M5XB 2O5IC 3PUWA 2B2UC 3I3CA 4A3FB 1RODA 2PO4A 1WTVA 3A8JE 4JBWA 3T16A 5IGCA 2H1EA 5CR3A 4ZYSA 4NW2A 4C3JG 3NTIA 5KEEA 2B8GA 1W6JA 3NP8A 4H7BA 3HEJA 1F9RA 1SMYD 2A6HD 1JOKA 2SNSA 3NPPA 3S17B 5KYLA 5JVH3 2O4XA 3ND8A 2Y0SB 1SJED 1IKMA 1ZYRD 2DY7A 1PRTF 2JEAI 2RA4A 4G4KA 4RH6A 1I4QA 2PYKA 4P2CB 3FEWX 1CQVA 5CV8A 2F3VA 3BG3A 1TS3A 1MI2A 4XDXA 1STBA 3GTQB 1Q90A 2DN8A 5C4HA 5C6AA 1T5EA 3LWEA 1BOSA 1EZ6A 4H0LC 2F0QA 2F0EA 1D5MC 2ZXOA 3D4RA 4H44C 3MXNA 2PNRC 5LHY1 3A7AB 3BZDB 3W3AA 4HN7A 1GUWA 4DN4M 1GUOA 2EYJA 3TP7A 3MWYW 3R2TA 4K5WA 2OT2A 4IFDG 4F8MA 5J22A 3EA6A 4FNFA 1SYGA 2CW0C 3HOXB 3HOUB 1STNA 3I90A 2F0UA 4ZRZA 1F9SA 2K5DA 3Q24A 4HEDA 2E2IB 1LTTD 2Q8TA 3H0GB 4KHVA 3DEOA 3L9AX 1DYQA 1OXSC 2XIWA 4IUVA 5ISRA 1HFNA 1SNMA 2SOBA 4RCNA 2E76C 4QF4A 2CW0D 1GUTA 5K5PA 1HTPA 2D9UA 3TDQA 4KN7C 3PUYA 1DD2A 5CV6A 1EWHA 3P75A 4B08A 2RKSA 4R9WA 2EYOA 2RBMA 1HXYD 3PO2B 4MN3A 3N6RA 3S1RB 4ILWA 1A3UA 1H9JA 1I4PA 1WTWA 3V96A 3BDLA 4X3UA 3K59A 4LAAA 4HSPA 4OIJA 3NTKA 4XYQA 3S9WA 2C5CA 5HURA 1WCMB 3T56B 3JAML 1H9SA 3A8IE 1Y1VB 1WVLA 1U4LA 1STYA 5DEHA 1CA6A 1EYAA 3ZYYX 1STHA 3V05A 2RQXA 4A3IB 2XWJB 1R4PB 1TKWB 2WB1B 2QCPX 1LV9A 2H4OA 1EL0A 1JE4A 4K2LA 3IAYA 1WTPA 2B63B 1LTBD 1SSOA 1PFBA 1SE4A 2X6LA 1D1KA 2KA7A 1RJTA 4LJZC 2BE5C 4XQJA 3EQLC 1BCPF 3HGBA 4EVOA 3TZDA 3MA2B 2RDGA 3NBIA 2K28A 2BCOA 1O80A 4J1MA 3RMHA 1KNEA 2B2WC 2Q8RE 1E2WA 1D6EC 2I07B 3GV6A 1DCZA 1VCIA 2D2CC 3VR6A 3KF8A 3GQBA 1OO9B 2BE5D 2AQ3B 1EEID 1EYCA 1Q1EA 4A3EB 5IIFA 4HMIA 2MHVA 5C0XI 4KMUC 4ODGA 3SR1A 4TKOB 2DNCA 3HOYB 2KQ3A 2EDGA 3SK4A 1EU4A 5C0XH 3AB9A 1LTGD 1IL8A 5ELDA 1MGSA 1SNQA 2NTTA 2GA4B 5KNDA 1M8AA 2F0DA 2A6ED 3HOVB 1DOLA 1PTOD 2RDHA 1SYBA 1Z47A 2JE6I 1BF4A 4RCOA 1H9KA 3MFGA 2IX3A 4A3MB 4IUUA 2AUKA 5IODA 4FXGC 1B50A 2WAQB 2XRSD 2EYHA 4KN4C 2EZVA 4AYBB 3OHXC 1BNZA 3PUZA 1MD2D 4HAEA 1LT5D 1LT3D 5JEAH 5LL6X 3BDOA 4XT1B 2BA1A 2N55A 2G9HD 3OWEB 5C5MA 1K8MA 4DA2A 2F03A 3WDNA 4FVMA 4KKUA 3IKJA 1EY5A 1YNND 4ABNA 4K2KA 2AQ1B 1RD9D 2F0OA 2E2DC 3Q22A 1A3TA 4OO1I 2F0IA 2F0JA 4IUTA 2X6GA 4XT3B 5IT9L 2B2TC 1SNCA 4ZUJA 2QEJC 3W2DA 2F1MA 4G7HC 1UUPA 5I6WA 2EE1A 4FXDA 3HZXA 1ONLA 1TT2A 3SEBA 2F0SA 4IUNA 3D4WA 1FNUA 5IGGA 5FO9B 3QWNA 1VF5C 3DHQA 3K6OA 4KTAA 2K05A 4KJNA 1X32A 3HOZB 4QCLA 5C0XG 1ESRA 2K7VA 2D62A 1D1IA 3TP8A 4ZK9B 2EOTA 2OXPA 3TMEA 1AN8A 2IWHA 5EPLA 2FFKB 1HQRD 2E2JB 1PZJD 3MHBA 1TS5A 3KBGA 3EVQA 3GO5A 3I4NB 4DF7A 4KKTA 2KJXA 1Q12A 2PW7A 4KY5A 3PMFA 4K14A 4XQQA 4ZQ3A 1LT4D 1O7YA 2A6HC 2MUYA 4OGQC 4PNYA 1DM0B 1A3VA 1SDFA 3PIO3 5IGDA 2K01A 4OO1H 1PTOC 4DGZA 1AEXA 1HFGA 2NVTB 1BUVT 4CBVA 3GTGB 1H9RA 1PTOH 3HG9A 2FMCA 1H9SB 1ICWA 5IT9E 3A54A 1S5ED 4KY7A 4I65A 5JOBA 3GD7A 2ICEC 2SEBD 1B4OA 3S2HB 4XYOA 1LTID 1TWGB 2KOLA 1SNOA 2ICIA 3NHHA 2KEDA 3NK9A 3GTJB 2YYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  1STY A;  3V2T A;  5E1F A;  5DEH A;  2HQE A;  2F0D A;  1EYA A;  4PMC A;  4S3S A;  1SND A;  1STH A;  4DU9 A;  3D8G A;  4KD3 A;  4HTH A;  1KDA A;  3SHL A;  1RKN A;  3SK5 A;  1NSN S;  3TP8 A;  5CGK A;  1EY0 A;  2OXP A;  1EY6 A;  3MEH A;  1KAB A;  1SYC A;  2EYJ A;  4QMG A;  3TME A;  5CV9 A;  3TP7 A;  5NUC A;  1SYB A;  3OWF A;  4K5W A;  5HGT A;  4K8J A;  4RKB A;  3SK8 A;  2F0M A;  4F8M A;  1KAA A;  2RDF A;  2F0G A;  4KJO A;  4E6I A;  5M9O A;  5J22 A;  2F0W A;  4B9X A;  4K2L A;  1F2M A;  4N9P A;  2F0N A;  1SYG A;  3BDC A;  2F3W A;  4K5X A;  2F0V A;  3C1F A;  4R8N A;  1STN A;  2EY6 A;  3C1E A;  3SXH A;  1A2U A;  4ME5 A;  3OMG A;  5IOC A;  5IOD A;  3T16 A;  3MHB A;  4NP5 A;  2F0T A;  5C5L A;  5IGC A;  1STA A;  2EYM A;  2F0U A;  1TQO A;  2OF1 A;  4EQP A;  3EVQ A;  5CR3 A;  4B9W A;  4DFA A;  5I9P A;  3MXP A;  4DF7 A;  2EYH A;  2F0H A;  5CV4 A;  3ERO A;  5C3X A;  1U9R A;  2PW7 A;  2F0K A;  3E5S A;  4MIU A;  4KHV A;  4KY5 A;  4K6D A;  5KEE A;  3PMF A;  4QB4 A;  3NQT A;  4K14 A;  5EGT A;  3ITP A;  4EVO A;  2EYF A;  3MZ5 A;  4K8I A;  3SK6 A;  5IGB A;  3NP8 A;  2SNM A;  4H7B A;  3HEJ A;  4ZQ3 A;  1ENA A;  5EKK A;  1SNP A;  5ISR A;  4EQN A;  3OSO A;  4KY6 A;  2WAC A;  1SNM A;  5EKL A;  5F2D A;  1EY9 A;  4KV6 A;  4OL7 A;  1EZ8 A;  1JOK A;  4NKL A;  5C5M A;  2SOB A;  2SNS A;  5J39 A;  1SYE A;  3QOJ A;  4ID6 A;  4J1M A;  4PNY A;  5J1Z A;  4PMB A;  3VA5 A;  4J6H A;  5I6Y A;  4QF4 A;  1A3V A;  4TRD A;  4WRD A;  3NXW A;  3MVV A;  3RUZ A;  5K5P A;  3LX0 A;  1JOR A;  1EQV A;  2M00 A;  2PZT A;  4WOR A;  5IGD A;  5KYL A;  4NDX A;  1EY5 A;  1KDC A;  3D4D A;  3ERQ A;  4G57 A;  2O4X A;  5IGF A;  1STG A;  5CV6 A;  1NUC A;  4K2K A;  5CV5 A;  3NUC A;  5C3W A;  3P75 A;  3R3O A;  2F0O A;  2EYL A;  2RKS A;  3TP6 A;  4IZ8 A;  4DGZ A;  2F0L A;  1AEX A;  4NMZ A;  2EYO A;  2QDB A;  5KIX A;  3QB3 A;  1A3T A;  2RBM A;  1JOQ A;  1F2Z A;  4IAL A;  2F0I A;  2F0J A;  5DAU A;  5KYI A;  2KHS A;  1EY8 A;  2ENB A;  5I9O A;  4EQO A;  2PYK A;  1EYC A;  1JOO A;  5IIF A;  2EY5 A;  4HMI A;  5CV8 A;  1SNC A;  3OMC A;  2F3V A;  4ZUJ A;  3EJI A;  2PZU A;  5IGE A;  4ZUI A;  1II3 A;  1A3U A;  5E3F A;  3TP5 A;  5C4Z A;  4ODG A;  4KY7 A;  4I65 A;  3D6C A;  5JOB A;  2PQE A;  2PW5 A;  4N9T A;  1A2T A;  3BDL A;  1STB A;  5I6W A;  3SR1 A;  5JAV A;  2F0P A;  3H6M A;  3P1H A;  4K5V A;  1EY4 A;  4LAA A;  4RKL A;  5C4H A;  3HZX A;  5C6A A;  5CC4 A;  2EY2 A;  2KQ3 A;  2LKV A;  2NUC A;  5KGU A;  1IHZ A;  3U9O A;  5CV7 A;  1SYD A;  3S9W A;  1F2Y A;  1SYF A;  1TT2 A;  1EZ6 A;  4KD4 A;  3T13 A;  2EXZ A;  2EY1 A;  2F0S A;  2OEO A;  4IUN A;  2F0Q A;  4YIJ A;  1ENC A;  3D4W A;  3SK4 A;  2F0E A;  5IGG A;  1EYD A;  3DMU A;  5HUR A;  1SNO A;  4HMJ A;  2PZW A;  4F7X A;  1KDB A;  3NHH A;  3DHQ A;  2F0F A;  3NK9 A;  3QOL A;  5KRU A;  1SNQ A;  2EYP A;  4KTA A;  1TR5 A;  4KJN A; 
#chains in the Genus database with same CATH topology
 3R8B A;  1KIX A;  3V2T A;  1TVX A;  1JJ2 A;  1I4H A;  2NZO A;  5EQ0 A;  2IX0 A;  3WWV A;  3M3Y B;  1RKN A;  4OWW B;  1XPO A;  1BCP B;  4IPD A;  3S17 H;  2F0M A;  3OW2 A;  4BXX H;  1ILQ A;  3A5Z B;  5EBC A;  3M7N A;  4M1U B;  2F0W A;  4B9X A;  4QGU A;  1O7L A;  1TII D;  1NNX A;  4QY7 A;  4PZ8 A;  1J5E L;  3SDZ A;  1CHQ D;  3GTO B;  4RHS A;  1S40 A;  1VQ4 A;  5IYB H;  3CXC A;  1UNS A;  5C3E H;  3J80 c;  2L55 A;  2YTX A;  4A3J H;  1YNJ D;  4JOI A;  4EQP A;  3SVM A;  3GTJ H;  1MBY A;  1IBM Q;  3FPP A;  3S1M B;  4HSV A;  3PO3 B;  3RLN A;  1Q8K A;  3H09 A;  1TS2 A;  1PYW D;  2ID0 A;  4A3I G;  3G6J B;  5I2X A;  3P7J A;  1A6X A;  1Z9F A;  3R2I A;  2WB1 G;  1JJC B;  3URY A;  4DV1 L;  3EN2 A;  2R93 B;  4A3F H;  2HCC A;  5M5Y B;  3K58 A;  3H3V I;  5J39 A;  4CJ0 B;  3VA5 A;  4JI0 L;  1XNR L;  2IW3 A;  4BY1 B;  1ZXT A;  1DJR D;  3DEP A;  1JOR A;  4YWM A;  2D0O A;  3GTK H;  2VUM B;  4JPB W;  2DY8 A;  3H3V C;  3GTP H;  1E22 A;  2A69 C;  2B2Y A;  4IUQ A;  1K3R A;  4IQZ A;  3RLO A;  1HJP A;  1PTO F;  2BOS A;  3R3O A;  1QVC A;  2R92 B;  1KNA A;  4IZ8 A;  4NMZ A;  1Q1B A;  3GP7 A;  3KLS X;  1LAC A;  3CME A;  3J7A V;  2OTJ A;  2AQ2 B;  4R8I A;  1SMY C;  3EIV A;  2UUA L;  1JB7 A;  3O13 A;  2EJF C;  4HCS A;  5I4D A;  2PZU A;  5C44 H;  2RVL A;  2NB0 A;  4OWT B;  2BH2 A;  1XNQ L;  4GKK L;  2JP1 A;  1QVF A;  4R4Q A;  3X3N A;  2PQA B;  1EIY B;  4LW1 A;  4DNR B;  3CC4 A;  4XTC S;  5CC4 A;  1U5K A;  4IFD H;  1Q7Y C;  1E0B A;  4KD4 A;  2X69 A;  2OEO A;  1PZI D;  5EPJ A;  4YIJ A;  3K7A B;  3SE0 A;  1GUS A;  4YHH Q;  3OW7 A;  1C48 A;  1EYD A;  2A8V A;  4C3H G;  4QUF A;  1TWF B;  2HQE A;  3S16 H;  2R61 A;  4IFD I;  3PO3 G;  1CKN B;  2Z4I A;  1NSN S;  4UP9 A;  2QA4 A;  1E2Z A;  1EY6 A;  1GHK A;  1KAB A;  3CCR A;  3AU7 A;  1QUQ A;  2Z6B A;  4UP8 A;  3JAM E;  4WJ4 A;  4A3M G;  4RKB A;  1QNK A;  3DLL A;  4CDE C;  2F0N A;  1JQY D;  5GQO A;  3LNN A;  4N8F A;  3C1F A;  4B3R L;  4X65 Q;  4PZ7 A;  4KK7 A;  5JJZ A;  3KLS A;  2QIL A;  5IOC A;  3J81 E;  4BY1 G;  1STA A;  2XRQ D;  3MXN B;  4DFA A;  2JXM B;  2WKD A;  4AQY L;  2IHE A;  2R92 G;  1Q8I A;  4RAU C;  2R6G A;  3KBX A;  1QOH A;  2E5L Q;  1Q3L A;  3STB C;  1HNW Q;  3MEF A;  1EWI A;  3T1H L;  4B3S Q;  3DWP A;  1LAB A;  5EKK A;  1EQT A;  4JI1 L;  1MSG A;  2L12 A;  5AJ3 L;  4GKJ L;  3NQI A;  4DV0 Q;  5BN3 A;  4YWK A;  1SYE A;  3NSW A;  4R4T A;  4JI4 Q;  5JVG 3;  1X6O A;  1K8O A;  3LWU A;  3CRK C;  4TRD A;  4WRD A;  3ULJ A;  4HJ5 A;  2BDO A;  4GLA C;  3S14 B;  1R4Q B;  1I3Q H;  3LX0 A;  2M00 A;  5D14 A;  3I4O A;  2NVX B;  1GVP A;  2TMP A;  2CHB D;  3TS0 A;  1MKH A;  4JI8 L;  4IAL A;  4JW0 A;  3BS1 A;  3CC7 A;  2HIV A;  5DAU A;  4DUY Q;  3FKI G;  1ET9 A;  2GN5 A;  5I9O A;  1B1Z A;  2LMC B;  1SR3 A;  1WD1 A;  4ZKB B;  3CCM A;  1SJH D;  4DR6 L;  3VR4 A;  1AZP A;  2ZJQ A;  4IOA A;  2JK8 A;  2PQE A;  1NE3 A;  4GN5 A;  3P1H A;  3GV3 A;  1WTR A;  4BBR G;  5FJ8 G;  1LTA D;  2L11 A;  1YJW A;  3K57 A;  4CGY B;  2PI2 E;  4RG1 A;  1N36 L;  1PHJ A;  4NXM L;  3DMU A;  4JI4 L;  5KRU A;  3PIP A;  4H13 C;  4A76 A;  1RHP A;  5JPM C;  3RR5 A;  3IFD A;  1P16 A;  4UAI A;  1SE3 A;  4BWG B;  4IUR A;  2HIX A;  1G6Z A;  3M4Y A;  3S2H H;  3NEM A;  4HTH A;  3U50 C;  1J9O A;  1O7Z A;  5ELB A;  5G3L D;  4XQN A;  2IPK D;  1R9T B;  4RHR A;  1WJJ A;  2K75 A;  4RGN A;  4DNT B;  1SAP A;  5IYC H;  1VQ8 A;  4JI5 Q;  2F0V A;  2MQH A;  3E0E A;  3I4N G;  1TY2 A;  1G51 A;  1EU3 A;  1Y1V H;  2KVM A;  1PA6 A;  3S2D B;  4A3M H;  1I6V C;  5K36 H;  4HJ8 A;  2EJM A;  3M85 A;  1HTL D;  5C5L A;  5CBE E;  1BR9 A;  4NXM Q;  4B9W A;  3HOZ G;  3DWA A;  3ERO A;  3GTQ H;  3DM3 A;  1X3Q A;  2VQE L;  3RZD H;  1S5C D;  1B53 A;  1EOT A;  2JA5 H;  3QJY A;  1K0R A;  3ITP A;  2JN4 A;  1A63 A;  5IGB A;  2EYF A;  1VQN A;  3SK6 A;  2NVT H;  3I8Z A;  1YEZ A;  1PRT D;  1X56 A;  2R92 H;  4G7O C;  2WAC A;  5F2D A;  5EKL A;  4WFN 3;  1GM5 A;  1PZK D;  3VA7 A;  3QOJ A;  1M90 C;  4JI7 Q;  3CRL C;  4J6H A;  3UE0 A;  2L9H A;  2MP1 A;  1YNN C;  4M8A A;  3CQZ B;  4PMW A;  1NUC A;  3I4M H;  1JCK B;  1D5X C;  1GUG A;  4JV5 Q;  1K9M C;  1JOQ A;  4XXE A;  5E7N A;  1DZ1 A;  3OOC A;  1EY8 A;  1PFM A;  3HOU H;  2A5H A;  4CJ2 C;  3ONA B;  1IXR A;  1Y14 B;  2XN9 C;  4DAP A;  4G7Z C;  4LMQ D;  1CHP D;  4MZ9 A;  5C4Z A;  3UI2 A;  4BA2 I;  3TZU A;  4LFA Q;  3D6C A;  1Y8N B;  4L63 B;  1FVI A;  2A73 B;  1N33 L;  1IKL A;  2J0T D;  1EEF D;  1GD7 A;  2R7Z G;  5KGU A;  2JQO A;  3FDT A;  4FF2 A;  1L0Y B;  1CSQ A;  1SYD A;  4CDD C;  2EVB A;  3KJO A;  2WIN B;  4CJ1 B;  1IW7 C;  1WTH A;  1PH7 A;  5DNF A;  4R1J A;  3GTO H;  1U4P A;  4BBR H;  4A3L G;  3CCV A;  3Q23 A;  4IFD J;  4GZY C;  2MGS A;  1GKH A;  4OXP A;  4IN3 A;  1BBX C;  2F4I A;  3CMA A;  2K6A A;  1YNJ C;  3K7U C;  5ELN A;  4A3G H;  2UXD Q;  3T1Y L;  4A3C G;  1EY0 A;  1Y8P B;  1SYC A;  2HQL A;  2KEC A;  2F4V Q;  5NUC A;  3OWF A;  2HDM A;  3SK8 A;  1G8Z D;  1L0W A;  5EAY A;  1JB3 A;  4YCW A;  5FKA C;  2QGQ A;  2WII B;  3CPW A;  3KF6 A;  1VQ6 A;  3RN2 A;  2CCZ A;  1JWS D;  4KKS A;  4LF7 Q;  1CZW A;  2XNA C;  2KCT A;  2F0T A;  4DR7 L;  2JSO A;  2EYM A;  3BYT B;  4DAV A;  1MHW C;  4OWX B;  2FHT A;  2F0H A;  4JVZ A;  3GTP B;  5EPK A;  4MIU A;  3DXJ C;  1SE2 A;  2JA7 H;  3KLW A;  5M3M G;  1R9T H;  4X62 Q;  4FF1 A;  3GTG H;  3PSI A;  5EGT A;  2R3Z A;  4A75 A;  2UUC L;  2Z8L A;  1H9M A;  2IL8 A;  4JBK A;  2J4X A;  2K5N A;  4KY6 A;  3UDF A;  3I91 A;  1FNW A;  1FGB D;  1G29 1;  3FRP B;  4X66 L;  2B2V C;  5J1Z A;  4PMB A;  4B3S L;  4CHT B;  1MJC A;  1XTD A;  1Y1W B;  2EJG C;  3H91 A;  3MVV A;  2AWO A;  1TWG H;  2R7Z B;  3G4S A;  3ERQ A;  3PO2 G;  3IL8 A;  4Y52 H;  2L4N A;  5CV5 A;  3KJP A;  1EFI D;  3F2D A;  2N8N A;  1F2Z A;  2NVY B;  2E74 C;  2VQE Q;  5GAE C;  4DR3 L;  5KYI A;  1V43 A;  5BR8 Q;  2MNA A;  1PH9 A;  2ENB A;  2RHQ B;  3PV0 A;  4UDU C;  3VYR A;  2E2H B;  1BCP C;  3H0G H;  1WD0 A;  1VQP A;  3BJU A;  4A3B H;  5M3M H;  1CZG A;  5E3F A;  3TP5 A;  1LUZ A;  2F52 A;  4N9T A;  1WOC A;  5GAH C;  2EY2 A;  4GNX B;  2K52 A;  1AE2 A;  3BU2 A;  2NVQ B;  1QB5 D;  2FJ2 A;  4EQ5 A;  1D5Z C;  4A3K G;  1B3Q A;  1Q82 C;  1NR2 A;  2B39 A;  1O78 A;  2ZXR A;  5COY A;  2VL6 A;  1B2T A;  3JAM i;  3C2P A;  1DXM A;  3TBI B;  4JYA L;  3VR2 A;  3GTL B;  5M3M B;  3UDI A;  5CGK A;  1VMC A;  2FIN B;  3J80 i;  5LMN L;  1CQF A;  2Z9H A;  5HGT A;  5LMU L;  5M9O A;  2PNH A;  2JA6 G;  1IBK Q;  3Q0A A;  4E6I A;  1KLU D;  5E4X A;  4A3G G;  3S1Q H;  2F3W A;  3VYS A;  4YY3 Q;  1M4V A;  2A74 C;  5JJI A;  3GTK B;  4ZAI A;  1Y1W G;  1QZH A;  5A35 A;  3WOF A;  4DV6 Q;  4JI3 L;  2K5V A;  2IJ0 A;  5CBA E;  4A3K H;  1LTL A;  1U9R A;  2F0K A;  4K6D A;  4YY3 L;  3OTO Q;  1QZG A;  4B3M Q;  5ELC A;  3GTL H;  4HJ7 A;  2K32 A;  4X64 L;  3VR3 A;  2G9D A;  3NEL A;  2QKI C;  1J6Q A;  3NWS A;  5HY6 A;  3J7Y W;  4A3E H;  4KV6 A;  5AFW A;  1EZ8 A;  2CWA A;  3H3V H;  1HR0 Q;  2HHH L;  1SFO H;  1V9P A;  1X3E A;  2QEX A;  3HOW B;  3DM1 A;  4TSS A;  5FOB B;  4A93 H;  4P74 A;  1KDC A;  4FDB A;  5FLX L;  4H02 A;  3TP6 A;  1TXY A;  2XSC A;  2IX1 A;  3OPO A;  1CT1 D;  1I6H H;  1UEA B;  1O7I A;  1TWC H;  4EQO A;  4UY8 C;  2EY5 A;  4FP5 D;  5IGE A;  4JOI C;  4ZUI A;  1I4G A;  2LSS A;  4IPG A;  1A15 A;  2G5D A;  2I5L X;  2CH4 W;  1VQA A;  4X3S A;  5C3E B;  3J81 L;  1KLG D;  5CV7 A;  3CF5 A;  1YHB A;  3BYY B;  2E2I H;  2VB3 X;  4R4O A;  3T4A C;  1SBB B;  2UUB Q;  3U9S A;  1AW7 A;  1H95 A;  4U67 3;  1PFN A;  1KDB A;  3FKI B;  2HDL A;  2EYP A;  1CFM A;  5FO8 B;  1TR5 A;  5H1S E;  4L6T B;  4JK1 C;  4ME3 A;  1ENF A;  4Z9C B;  3S16 B;  4DNI A;  2N88 A;  3NWT A;  2L1B A;  1S5B D;  4DU9 A;  2YTY A;  1KDA A;  3A8K E;  3F2U A;  2B2V A;  4DR5 L;  2NBF A;  1JIC A;  4V19 0;  2BA0 A;  4K8J A;  1VDZ A;  3A55 A;  1KAA A;  1TWH B;  2F0G A;  4BBS H;  4N9P A;  2JA7 B;  3BVG A;  1PH3 A;  2PI2 A;  1EFW A;  5ELE A;  2EY6 A;  2HCI A;  3SXH A;  4AYB G;  3I2Z A;  3K5O A;  1F9P A;  3S1N B;  1Y8O B;  1PH8 A;  2ZXP A;  1WTO A;  1TQO A;  1Z7T A;  3KFU A;  3A0J A;  3QR8 A;  2VY3 A;  2MO1 A;  2Q8I B;  3TN2 A;  3E5S A;  3CP0 A;  4R4I A;  1XX8 A;  4KI0 A;  4AH6 A;  1ILP A;  1GOZ A;  3NQT A;  1PYB A;  4DK6 C;  3NEN A;  5IYC G;  2SNM A;  2V4D A;  4CKE A;  5D65 A;  2A68 D;  2JA9 A;  5IYD G;  2B2Y C;  1V1P B;  4DK1 A;  4OL7 A;  4AQY Q;  1X3P A;  1EQR A;  1N8R C;  2NZ1 D;  1GHJ A;  5M3F G;  3HOZ H;  2M9V A;  1QIL A;  3MAQ A;  1YI2 A;  1B44 D;  5EKI A;  3EBE A;  4DUZ Q;  2IT1 A;  1QE6 A;  1I5F A;  1UEB A;  4C56 C;  3EFX D;  2K14 A;  1NCV A;  2MJ8 A;  3D31 A;  3MFY A;  3CQZ H;  3R93 A;  2NWG A;  1XPR A;  1I50 B;  1I4R A;  1GJX A;  1ZEQ X;  3HOW H;  3OMC A;  3QO2 A;  4BA1 I;  4Y7N B;  1ML0 D;  1SMX A;  3H94 A;  2E8G A;  2ALY B;  4OEL B;  1A2T A;  3CU7 A;  5KNB A;  1F9Q A;  2RCN A;  1VQ7 A;  1WCM H;  4NB3 A;  1SYF A;  1PDQ A;  4QIW B;  1BO0 A;  4HR7 B;  5IWA Q;  3J81 j;  5EBD A;  4DV4 Q;  2UU9 Q;  5M3F H;  3MTS A;  3E9H A;  5M5W B;  4A3B B;  1RDP D;  4HMJ A;  2Z0S A;  3C3L A;  1AZQ A;  1RTO A;  4P71 A;  4GKK Q;  2NN6 G;  2UUB L;  4FYD A;  1HZ9 A;  2OWO A;  1EWC A;  3J7A F;  1K28 A;  2P5Z X;  2SDF A;  3HOV H;  4B3T L;  1IBK L;  2C9O A;  2LFN A;  5ELO A;  1WFQ A;  3M4O B;  1IYU A;  5FO7 B;  2NTS A;  1SE8 A;  5LMN Q;  4KJO A;  4LFC L;  1SXT A;  2PCF B;  4DV5 L;  4LF8 Q;  4RGM A;  4POG A;  3S2D H;  5M3F B;  3G6E A;  1LT6 D;  3HKZ B;  4Q0F A;  1BQQ T;  1E1O A;  3OIQ A;  2E2J H;  5C4X B;  2B63 G;  4X66 Q;  3KUP A;  3RZO B;  3RZD B;  3WOE A;  4QL5 A;  4PV1 C;  2NVQ H;  2BH8 A;  1W6K A;  1PRT C;  2RSO A;  3MZ5 A;  2EPB A;  3DWQ A;  4DR5 Q;  4DAY B;  2JA8 B;  2WB1 E;  4QIW E;  1BKB A;  2Z4H A;  1JWU D;  2B29 A;  2D5D A;  2ZT9 C;  5I6Y A;  1QNU A;  4C2M B;  2BDN A;  2OCE A;  3CCU A;  3D3R A;  5J3B A;  1F2L A;  4ZLT F;  4C3J H;  2VB2 X;  3KDF A;  2EYL A;  3STB D;  3U4Z A;  2N49 A;  2F0L A;  5KIX A;  1HPC A;  4YWL A;  3IFT A;  2JJQ A;  4DXG A;  4DR2 Q;  1HUN A;  4FO2 A;  3KK7 A;  1ASZ A;  4OX9 Q;  5KNC A;  1X3F A;  1YNX A;  2ES2 A;  2KUM A;  3OIP A;  1HRJ A;  3CD6 A;  2ZTD A;  2L5T A;  4A3K B;  1NAP A;  1EY4 A;  4RKL A;  2B8F A;  4V0B A;  3GTM B;  4RMF A;  2NUC A;  3PIP 3;  3AQQ A;  3L2P A;  1DON A;  3NBH B;  3PQI A;  2KHJ A;  1AFP A;  4L5T A;  1B70 B;  2EY1 A;  3VR5 A;  5T1I A;  4U68 A;  2DNE A;  1PLF A;  1QUQ B;  2PZW A;  4X3T A;  4MHE A;  4F7X A;  4GLV B;  1KHI A;  3F2C A;  2K1B A;  1E2V A;  3A74 A;  4UPA A;  1I94 Q;  2UUC Q;  1UAP A;  3M4P A;  5E1F A;  1NR4 A;  4PMC A;  1SND A;  1SRO A;  3D8G A;  4OHJ A;  1Q46 A;  1QWY A;  4KD3 A;  5C4J B;  2O5J C;  4QMG A;  2KCC A;  2VW9 A;  1CUK A;  2RDF A;  4OIK A;  5M5W H;  1CM9 A;  1S5F D;  3OTO L;  1HCZ A;  1OXT A;  3HOV G;  1KAW A;  4K5X A;  1N34 L;  4LFB L;  1PMR A;  1HR0 L;  5BN4 A;  5EJW A;  1CKM A;  1A2U A;  1OXU A;  5BR8 L;  3OMG A;  3TQY A;  4NP5 A;  4MTK A;  4Q5V A;  1HA6 A;  2OF1 A;  3T53 B;  1F77 A;  5CV4 A;  1SEB D;  1N32 L;  1C4Q A;  2Q2I A;  4DR1 Q;  1GUN A;  4LF6 Q;  3I70 A;  1LO5 D;  2R93 G;  2WAQ G;  1D2B A;  4B3T Q;  2K5W A;  1ESF A;  2EIF A;  4LF4 Q;  2UXC L;  2PPB C;  1ENA A;  1TWC B;  3OSO A;  4JI6 L;  4RGO S;  4JYA Q;  4IPH A;  2ATW A;  3M3Y H;  1XJV A;  4GNX C;  3G7L A;  3TEH B;  4X6A H;  4C3I B;  1VF7 A;  2MPM A;  1T9H A;  3NXW A;  1CK1 A;  3RUZ A;  4WJW A;  2KEE A;  4ZKC B;  2R7Z H;  4C1N I;  1B9N A;  4G57 A;  2Q2U A;  5IGF A;  4PQX A;  1RCV D;  3T51 B;  2A6E C;  4A93 B;  4LUZ A;  2K5Q A;  2QDB A;  4DR7 Q;  1ZYR C;  3F1Z A;  4HID A;  3FKI H;  4LF7 L;  1IYV A;  2XTI A;  1EIH A;  5D3D A;  1HZA A;  2VS1 A;  3CPF A;  3RLF A;  1QJO A;  4OEM B;  1X65 A;  3UDX A;  4LK1 C;  2KBN A;  4K5V A;  2PQA A;  4QUC A;  2QF7 A;  5IT9 c;  1YIJ A;  1MSH A;  1XXG A;  2LKV A;  5FJ8 H;  1IHZ A;  2LY7 A;  1SLJ A;  2EXZ A;  3I7F A;  4C3H B;  3J81 c;  4RGT A;  5BN5 A;  3ERS X;  4DUY L;  5JEA J;  2WV6 D;  3I72 A;  3NBH A;  1PXU A;  2ZTC A;  1EY7 A;  4DR3 Q;  1FJG Q;  4FF4 A;  4GN4 B;  2B2W A;  1XPU A;  2UXD L;  3QG1 A;  1S5D D;  1XTC D;  1C0A A;  2JYO A;  3SK5 A;  2JA7 G;  2ZJP A;  1YIT A;  1VQE A;  1VQC A;  1N33 Q;  5C3E G;  1TWF H;  3HKS A;  4DXF A;  4CDF C;  4LFA L;  1IYJ B;  1GXD C;  1N34 Q;  4LFB Q;  1QG7 A;  3S15 B;  2AWN A;  5C0X J;  1JC7 A;  4R8N A;  2A19 A;  1KTK A;  4K0K L;  3L3O C;  3P20 A;  1JE5 A;  4C3I G;  4ME5 A;  4UHV A;  4A3J B;  2E5L L;  1EQQ A;  5I9P A;  3I55 A;  3Q8D A;  1U0L A;  3C46 A;  3J80 L;  3A56 A;  5C3X A;  4IUP A;  3ND9 A;  4X62 L;  2B2T A;  4A3F G;  3AFP A;  3K7A H;  3AMU A;  2ZTE A;  1J5E Q;  1STE A;  1OXX K;  5AJ3 Q;  1DOM A;  1HQM C;  1I6H B;  4IO9 A;  2WP8 J;  4HJA A;  1A8V A;  4DAY A;  5LMN W;  5LL6 S;  1I50 H;  1HNW L;  1K73 C;  4JI2 Q;  1EY9 A;  4OON A;  1HNX L;  4NKL A;  5M5X H;  2L0C A;  4ID6 A;  4Y7N H;  4DV6 L;  1E24 A;  1V1O A;  1X3G A;  1YHA A;  2VUM H;  1CTM A;  1ET6 A;  1DOK A;  2JA8 H;  4ULL A;  1HNX Q;  1WTX A;  2N3S A;  3CKI B;  3E0J A;  4BS9 A;  3KLR A;  2NVX H;  2KHS A;  5IP9 G;  1HNZ L;  3J81 i;  2A1A A;  2I46 A;  4PG3 A;  4TVA B;  3PUV A;  1SN8 A;  5DM6 3;  1JOO A;  1VQG A;  3FMC A;  4YCV A;  1U4M A;  5C44 B;  3K0Y A;  2E75 C;  5A2Q E;  2AUJ D;  1XMQ Q;  4HIK A;  1I4X A;  3KYH C;  1G2S A;  4ZCK A;  2PMZ E;  1OXV A;  1B3A A;  2JA6 H;  1VQ5 A;  4F88 A;  1HHV A;  4DV7 Q;  4KHP Q;  5JPN C;  3X3M A;  4XIG S;  1BBW A;  5A2Q L;  1I3Q B;  4LF9 L;  2RHS B;  1PTO B;  1LTS D;  3MC0 B;  3ULP A;  4CKB A;  3T1H Q;  4A3D B;  1KRT A;  1JWM D;  1JR0 D;  3DUZ A;  3JAM c;  4S3S A;  2HUG A;  4FF3 A;  2JA5 B;  1HUM A;  5IP9 H;  3HOX H;  1T5X D;  5CV9 A;  4LF8 L;  1VQ9 A;  1CA5 A;  1F2M A;  4DUZ L;  1VQL A;  2I0Q A;  3BDC A;  1LLR D;  4L5Q A;  1FGU A;  4JI7 L;  2EQS A;  3S1M H;  3C1E A;  1X55 A;  1YVC A;  2NN6 H;  2XGT A;  4JI8 Q;  1BBU A;  3RD4 A;  4HJ9 A;  3N52 A;  3MXU A;  3HP3 A;  3MXP A;  3J7Z C;  3HKZ E;  3W5O A;  2FMM A;  4C3I H;  1K83 B;  3CHB D;  2ZM6 L;  1V1P A;  4IJL A;  4JCV E;  4K8I A;  1CI3 M;  4DK0 A;  2PMZ B;  1A0I A;  5IWA L;  2NYZ D;  3ICE A;  2M2L A;  3PGZ A;  3HRZ C;  1FR3 A;  1UE1 A;  4GN3 B;  4FXK C;  4C1N K;  3HKZ G;  3FVQ A;  3K5N A;  3U4V A;  1EQV A;  2PZT A;  3NTH A;  4WOR A;  3D4D A;  4OO1 G;  1STG A;  1EUJ A;  1HZC A;  3VYU A;  3NUC A;  4DK3 C;  4CKC A;  1BDO A;  1FD7 D;  1N9W A;  1C8C A;  5E4W C;  3QB3 A;  3E9I A;  2VUM G;  1VQJ A;  2HD3 A;  1VMP A;  5HGQ A;  3K0X A;  1VS0 A;  4RWS C;  4I7Z C;  2JA8 G;  5M5Y H;  4BBS B;  2AMC B;  3MXG A;  3H15 A;  1G2T A;  2TSS A;  4K6L A;  2MFI A;  1V8Q A;  2CQA A;  1LTR D;  1B7Y B;  3CW2 C;  2NZH A;  4DR4 L;  5JAV A;  2F0P A;  3H6M A;  5D3I B;  1U4R A;  3BVZ A;  5JEA G;  3PUX A;  1F2Y A;  4L8J A;  1YHQ A;  1QCB D;  3FPU B;  4JBJ A;  1S72 A;  1S3O A;  4J8Q A;  4MNO A;  3QOL A;  5I2Y A;  3PO2 H;  1L1O B;  4DV2 L;  3VDY A;  2O2L D;  4RA8 A;  4DPG A;  4F87 A;  3TSS A;  4O1N A;  1PRT B;  4DV0 L;  1IW7 D;  4PZ6 A;  1RTN A;  4AIM A;  1ZKO A;  1PH4 A;  1E3P A;  2XWB B;  4KHZ A;  4LUO A;  1NJI C;  1BXT A;  1ICF B;  2UU9 L;  3D6W A;  5K36 G;  1NY4 A;  2VXW A;  5FLX c;  1J8I A;  2NN6 I;  1PFS A;  3VYT A;  1BCP D;  2A69 D;  3M7G A;  1IBL Q;  1CSP A;  1TS4 A;  4GOP C;  2LS0 1;  1EIG A;  1XWE A;  3I4L A;  2J7Z A;  5FLX E;  3B6Y A;  4JI6 Q;  1Y1W H;  5CYU A;  3M4Q A;  1HZB A;  2GVB A;  5ELF A;  3RZO H;  4OX9 L;  1PH6 A;  2B2U A;  4A3I H;  3BZK A;  4DR1 L;  4QB4 A;  1AP0 A;  5G3L F;  5COR A;  2K04 A;  3HS0 C;  4DV5 Q;  2UUA Q;  4DR4 Q;  5LMU Q;  1MIU A;  1SNP A;  5T1G A;  4EQN A;  2RSN A;  4LUV A;  2K03 A;  2K33 A;  1S4Z A;  1Y69 U;  3E6Z X;  3NE5 B;  2JEB I;  4X3K A;  1G91 A;  4NDX A;  5IP7 H;  4DV3 Q;  2OTL A;  4C3J B;  1VQD A;  4JI0 Q;  1XNR Q;  2R7F A;  5C3W A;  4JI5 L;  1B9M A;  1KQS A;  3K5M A;  3S15 H;  3I73 A;  4O42 A;  1RF2 D;  2A68 C;  4J15 A;  2VNU D;  3PCO B;  5CMD A;  2CVR A;  2AKW B;  1Z6H A;  3EJI A;  3FP9 A;  1II3 A;  2XVS A;  3QIA A;  4O0A A;  4QJF A;  2PW5 A;  2E2H H;  1FYC A;  4TQU S;  1XMQ L;  1TY0 A;  5DM7 3;  3U9O A;  1Q86 C;  4EGV A;  3T13 A;  1XYI A;  4KLK A;  3S1Q B;  3A7L A;  1WTQ A;  4LWC A;  2WKC A;  3L7Z C;  2YU9 B;  1ENC A;  4JBM A;  3J80 E;  3Q6S A;  4BBR B;  2F0F A;  5IE8 A;  1UE7 A;  5IP7 G;  4GNX A;  3K80 C;  3J7A 5;  1G6P A;  1XMO Q;  1SFO B;  1L0X B;  2Z1C A;  2JA6 B;  1TU2 B;  1TWA B;  4HCE A;  4BY7 B;  1HA5 A;  4L5R C;  3SHL A;  1KRS A;  3I56 A;  4A3G B;  1KL9 A;  3K5L A;  4DV1 Q;  5JJK A;  3MEH A;  3BVM A;  1FNV A;  4C2M H;  2KCN A;  5TSS A;  3U58 A;  4RFB A;  1YZ6 A;  5FK9 C;  3I4M B;  5M5X B;  2O5I C;  2Q2T A;  3PUW A;  2B2U C;  3I3C A;  4A3F B;  1ROD A;  2PO4 A;  4HIM A;  1WTV A;  3A8J E;  4JBW A;  3T16 A;  1L2F A;  5IGC A;  2H1E A;  5CR3 A;  3ULL A;  3RNU A;  4ZYS A;  3E3X A;  4NW2 A;  4NPS A;  4C3J G;  2KHI A;  3NTI A;  3M4O H;  3HOY H;  5KEE A;  2B8G A;  4JG2 A;  1W6J A;  3NP8 A;  4H7B A;  3HEJ A;  3ER0 A;  1F9R A;  1SMY D;  2A6H D;  1JOK A;  3W1G A;  2SNS A;  4GLX A;  3NPP A;  4CDC C;  1D8L A;  1PH5 A;  4UP7 A;  3S17 B;  1EIF A;  3F8T A;  5KYL A;  5JVH 3;  1GO3 E;  2O4X A;  3ND8 A;  2Y0S B;  3IRB A;  1NMG A;  1SJE D;  1IKM A;  1ZYR D;  3KF6 B;  2DY7 A;  1PRT F;  2JEA I;  3D0F A;  2DGY A;  4G4K A;  2RA4 A;  2DUD A;  4RH6 A;  1I4Q A;  2PYK A;  1VQB A;  3FEW X;  4P2C B;  1CQV A;  5CV8 A;  2F3V A;  1ASY A;  3JC6 6;  3BG3 A;  1TS3 A;  1LM0 A;  1MI2 A;  1PV4 A;  4XDX A;  1STB A;  3GTQ B;  1Q90 A;  4IPC A;  2DN8 A;  5C4H A;  5C6A A;  1T5E A;  3LWE A;  1EOV A;  1BOS A;  2QW7 A;  1EZ6 A;  1E1T A;  4H0L C;  2F0Q A;  2F0E A;  1D5M C;  1KD1 C;  3S1N H;  2ZXO A;  3D4R A;  2OQK A;  4H44 C;  3MXN A;  2JA5 G;  2PNR C;  5LHY 1;  2QDL A;  3A7A B;  3CC2 A;  3BZD B;  3W3A A;  4HN7 A;  3TRE A;  5C44 G;  4DN4 M;  1GUW A;  1GUO A;  1HR0 W;  1K0S A;  4P75 A;  2HHH Q;  1IL2 A;  2EYJ A;  3TP7 A;  3MWY W;  3R2T A;  4K5W A;  2OT2 A;  4IFD G;  4F8M A;  5J22 A;  1UE5 A;  3EA6 A;  4FNF A;  1SYG A;  2CW0 C;  1KXL A;  3HOX B;  3G48 A;  3HOU B;  1STN A;  4P72 A;  1HNZ Q;  1WCM G;  3T1Y Q;  4X65 L;  1C7Y A;  3I90 A;  2C35 B;  4ALP A;  2F0U A;  4ZRZ A;  1F9S A;  1X9N A;  2F3I A;  2K5D A;  3AEV A;  3Q24 A;  4HED A;  2E2I B;  1LTT D;  2Q8T A;  3PO3 H;  3H0G B;  1K3B C;  4N8X 1;  4KHV A;  3DEO A;  3L9A X;  1Q81 C;  1DYQ A;  2CWP A;  1OXS C;  2XIW A;  4IUV A;  2I5H A;  5ISR A;  1HFN A;  2VQF L;  1SNM A;  3CCS A;  2LXK A;  2SOB A;  4RCN A;  4YHH L;  3CCL A;  4C3H H;  2E76 C;  4QF4 A;  2CW0 D;  4BY1 H;  1GUT A;  5K5P A;  1HTP A;  2D9U A;  3AYH B;  3TDQ A;  4KN7 C;  3PUY A;  1DD2 A;  1YJN A;  5CV6 A;  1EWH A;  4A4I A;  3P75 A;  4B08 A;  3PF5 A;  2RKS A;  1EYG A;  4R9W A;  2EYO A;  2K4K A;  2RBM A;  1HXY D;  3PO2 B;  2R7D A;  4MN3 A;  3N6R A;  3A5U A;  1JT8 A;  3S1R B;  4ILW A;  1A3U A;  4DR2 L;  1H9J A;  1JMC A;  1I4P A;  1WTW A;  3V96 A;  3BDL A;  4X3U A;  4DV2 Q;  1N36 Q;  3K59 A;  4LAA A;  1VQM A;  3KDF B;  4HSP A;  5GAD C;  2Q2H A;  4OIJ A;  3NTK A;  1K8G A;  4XYQ A;  3S9W A;  1KC8 C;  2C5C A;  2GVA A;  2K5H A;  5HUR A;  2V1C C;  1WCM B;  3T56 B;  3JAM L;  1H9S A;  3A8I E;  3UDG A;  1Y1V B;  3S24 A;  1WVL A;  1U4L A;  1K8A C;  5IYB G;  4WJ3 M;  1STY A;  1YJ9 A;  4BBS G;  5DEH A;  1CA6 A;  1EYA A;  2UXB L;  2HT1 A;  3ZYY X;  1STH A;  3V05 A;  4I7A A;  1NMF A;  2RQX A;  4A3I B;  4A3C H;  2XWJ B;  1R4P B;  1TKW B;  5GRO A;  4DV7 L;  4KHP L;  2I5M X;  2WB1 B;  2FXQ A;  2QCP X;  1LV9 A;  2H4O A;  1EL0 A;  1JE4 A;  4K2L A;  4EX5 A;  1SRU A;  3IAY A;  2UXB Q;  1PH1 A;  1WTP A;  1TWA H;  4BY7 H;  2B63 B;  1LTB D;  5C4X G;  1MJE A;  1SSO A;  1PFB A;  4JI1 Q;  1SE4 A;  2KCM A;  2X6L A;  1D1K A;  4K0K Q;  2KA7 A;  1RJT A;  4LJZ C;  2BE5 C;  4XQJ A;  4GOP A;  3GTM H;  4B3R Q;  2R93 H;  1NTG A;  3EQL C;  1BCP F;  5DLQ E;  4LF6 L;  3HGB A;  4EVO A;  3TZD A;  3MA2 B;  2RDG A;  2MO0 A;  2DJG C;  3UE1 A;  3NBI A;  2K28 A;  2BCO A;  1O80 A;  4J1M A;  3RMH A;  4LF4 L;  2UXC Q;  1KNE A;  2B2W C;  2Q8R E;  2WFW A;  1UE6 A;  5L37 A;  4DR6 Q;  5C4J H;  1E2W A;  3PF4 A;  1D6E C;  2I07 B;  3GV6 A;  1DCZ A;  2ASB A;  3HOW G;  1VCI A;  2D2C C;  1PYS B;  3VR6 A;  1B8A A;  3KF8 A;  1M1K C;  3GQB A;  1OO9 B;  2BE5 D;  4IOC A;  2EXD A;  2AQ3 B;  1EEI D;  1Y1V G;  1VQH A;  3AFQ A;  1EYC A;  1Q1E A;  4A3E B;  4AYB E;  5IIF A;  4HMI A;  4NXN Q;  2MHV A;  5C0X I;  4KMU C;  4ODG A;  1CKN A;  2K50 A;  3SR1 A;  4GS3 A;  4TKO B;  1VQF A;  2DNC A;  2YV5 A;  3RN5 A;  5FLM G;  3HOY B;  2KQ3 A;  2RCF A;  5JJL A;  2EDG A;  2DJF C;  3SGI A;  3PIO A;  4APV A;  3SK4 A;  1EU4 A;  5C0X H;  4NXN L;  3AB9 A;  1LTG D;  1IL8 A;  5ELD A;  1MGS A;  1SNQ A;  2NTT A;  2GA4 B;  1C9O A;  5KND A;  1M8A A;  4POF A;  2F0D A;  2A6E D;  2CQO A;  3HOV B;  1DOL A;  1PTO D;  2RDH A;  3I4M G;  3HFZ B;  1D7Q A;  2CH4 A;  1SYB A;  4JI2 L;  1Z47 A;  1OTC A;  2JE6 I;  4IJH A;  1BF4 A;  4RCO A;  1H9K A;  4DKA C;  1FL0 A;  3MFG A;  2IX3 A;  4A3M B;  1PVO A;  4IUU A;  2AUK A;  5IOD A;  5IY0 A;  1IBM L;  4FXG C;  2OQ0 A;  3OYY A;  1B50 A;  2WAQ B;  2XRS D;  2EYH A;  4KN4 C;  4P73 A;  2EZV A;  4AYB B;  3OHX C;  5C4X H;  4BY7 G;  1BNZ A;  3CAM A;  3PUZ A;  1BVS A;  1MD2 D;  3CCJ A;  4HAE A;  1LT5 D;  1LT3 D;  5JEA H;  5LL6 X;  1RIP A;  3BDO A;  4XT1 B;  1E7Z A;  2BA1 A;  2N55 A;  1PH2 A;  4HIO A;  4JV5 L;  2B63 H;  2Z6K A;  4A3E G;  4A3L H;  2G9H D;  3OWE B;  5C5M A;  1K8M A;  4DA2 A;  2ZM6 Q;  2F03 A;  3WDN A;  1I94 L;  4DAM A;  1VQI A;  2LXJ A;  4A93 G;  4GKJ Q;  1VQK A;  3K81 C;  4FVM A;  3HOY G;  4KKU A;  3IKJ A;  3ZJY C;  1EY5 A;  1YNN D;  2CFM A;  4LFC Q;  4ABN A;  2YU9 H;  4K2K A;  2AQ1 B;  1RD9 D;  2F0O A;  2E2D C;  3Q22 A;  1A3T A;  2Y0S E;  4OO1 I;  3GDE A;  2F0I A;  3M9B A;  2F0J A;  1L1O A;  1P8L A;  1IZ6 A;  1YBY A;  4IUT A;  2X6G A;  4XT3 B;  4L5S A;  5IT9 L;  2B2T C;  1SNC A;  4ZUJ A;  2QEJ C;  3W2D A;  4LF5 L;  2F4V L;  2F1M A;  1NBW A;  4G7H C;  1UUP A;  1HH2 P;  5I6W A;  2EE1 A;  4FXD A;  2CKZ B;  3HZX A;  2WAQ E;  1W3S A;  1ONL A;  1TT2 A;  1RL2 A;  1W2B A;  3SEB A;  2F0S A;  2L15 A;  2Y0S G;  3CCQ A;  4IUN A;  4LF9 Q;  3D4W A;  1FNU A;  3S1R H;  5IGG A;  5FO9 B;  5FLM H;  3KOJ A;  3QWN A;  1VF5 C;  3DHQ A;  3K6O A;  3I4N H;  4KTA A;  2K05 A;  4KJN A;  1X32 A;  3HOZ B;  4QCL A;  4A3B G;  3KF8 B;  5C0X G;  2B3G A;  4BXX G;  4DV3 L;  1ESR A;  2K7V A;  2D0P A;  2D62 A;  1D1I A;  3TP8 A;  4MTN A;  4ZK9 B;  4B3M L;  2EOT A;  2OXP A;  1L1O C;  3TME A;  1AN8 A;  4R4C A;  2IHF A;  3L0O A;  2IWH A;  1X54 A;  5EPL A;  1QVG A;  2FFK B;  4A3J G;  1UWV A;  1HQR D;  2E2J B;  1XMO L;  2H5X A;  1CKO A;  1PZJ D;  3H0G G;  1WI5 A;  1LYL A;  2VQF Q;  3MHB A;  1TS5 A;  1DGS A;  3KBG A;  3G71 A;  3EVQ A;  3GO5 A;  3I4N B;  4DF7 A;  4KKT A;  2KJX A;  1Q12 A;  2Z6K C;  2PW7 A;  3F2B A;  4KY5 A;  4GOP B;  4JI3 Q;  1JJG A;  3S14 H;  3PMF A;  4K14 A;  3LGJ A;  4XQQ A;  4ZQ3 A;  1LT4 D;  1O7Y A;  2A6H C;  5IYD H;  3HOX G;  1IBL L;  3HOU G;  2RF4 A;  2MUY A;  1N32 Q;  4OGQ C;  4PNY A;  3K8A A;  4A3D H;  1DM0 B;  1A3V A;  1SDF A;  3PIO 3;  3TS2 A;  1VQO A;  2AHO B;  5IGD A;  1WYD A;  1V1Q A;  2K01 A;  4QQB X;  3FHW A;  4OO1 H;  1PTO C;  4DV4 L;  1XNQ Q;  2ZJR A;  4DGZ A;  1AEX A;  1AH9 A;  1HFG A;  2YTV A;  2NVT B;  1BUV T;  4CBV A;  3GTG B;  1H9R A;  1PTO H;  3HG9 A;  2FMC A;  1H9S B;  1AE3 A;  4JC0 A;  1ICW A;  2VZA A;  5IT9 E;  4LNQ A;  3A54 A;  1S5E D;  4O2D A;  4KY7 A;  4I65 A;  5JOB A;  3GD7 A;  3W1B A;  2N78 A;  2ICE C;  4X64 Q;  2SEB D;  1B4O A;  1K83 H;  3S2H B;  4XYO A;  1LTI D;  1FJG L;  2IY5 B;  1TWG B;  3TRZ A;  3CCE A;  2KEN A;  3BZC A;  4A3D G;  1TWH H;  2KOL A;  1SNO A;  4YCU A;  2ICI A;  3NHH A;  1A62 A;  3NK9 A;  2KED A;  5GAG C;  3GTJ B;  2YYZ A;  4LF5 Q;  2NVY H; 
#chains in the Genus database with same CATH homology
 3R8B A;  3V2T A;  1TVX A;  1I4H A;  5EQ0 A;  2IX0 A;  3M3Y B;  1RKN A;  1BCP B;  2F0M A;  1ILQ A;  5EBC A;  3M7N A;  4M1U B;  2F0W A;  4B9X A;  1O7L A;  1TII D;  3SDZ A;  1CHQ D;  3GTO B;  4RHS A;  1UNS A;  2L55 A;  1YNJ D;  4EQP A;  3SVM A;  1MBY A;  3FPP A;  3S1M B;  4HSV A;  3PO3 B;  3H09 A;  1TS2 A;  1PYW D;  2ID0 A;  3G6J B;  5I2X A;  3P7J A;  1A6X A;  3R2I A;  3URY A;  2R93 B;  2HCC A;  5M5Y B;  3K58 A;  5J39 A;  4CJ0 B;  3VA5 A;  2IW3 A;  4BY1 B;  1ZXT A;  1DJR D;  3DEP A;  1JOR A;  2VUM B;  2DY8 A;  3H3V C;  2A69 C;  4IUQ A;  2B2Y A;  4IQZ A;  1PTO F;  2BOS A;  3R3O A;  2R92 B;  1KNA A;  4IZ8 A;  4NMZ A;  1Q1B A;  3GP7 A;  3KLS X;  1LAC A;  3J7A V;  2AQ2 B;  4R8I A;  1SMY C;  3O13 A;  2EJF C;  4HCS A;  5I4D A;  2PZU A;  2RVL A;  2NB0 A;  2JP1 A;  3X3N A;  4DNR B;  4XTC S;  5CC4 A;  4IFD H;  1E0B A;  4KD4 A;  2X69 A;  2OEO A;  1PZI D;  5EPJ A;  4YIJ A;  3K7A B;  3SE0 A;  1GUS A;  3OW7 A;  1C48 A;  1EYD A;  4C3H G;  4QUF A;  1TWF B;  2HQE A;  4IFD I;  2R61 A;  2Z4I A;  1NSN S;  1E2Z A;  1EY6 A;  1GHK A;  1KAB A;  3AU7 A;  3JAM E;  4RKB A;  1QNK A;  2F0N A;  1JQY D;  3LNN A;  3C1F A;  4KK7 A;  5JJZ A;  3KLS A;  2QIL A;  5IOC A;  3J81 E;  1STA A;  2XRQ D;  4DFA A;  2JXM B;  2WKD A;  1Q8I A;  4RAU C;  2R6G A;  3KBX A;  1QOH A;  1Q3L A;  3DWP A;  1LAB A;  5EKK A;  1EQT A;  1MSG A;  2L12 A;  3NQI A;  5BN3 A;  1SYE A;  3NSW A;  5JVG 3;  1K8O A;  3LWU A;  3CRK C;  4TRD A;  4WRD A;  3S14 B;  2BDO A;  1R4Q B;  3LX0 A;  2M00 A;  5D14 A;  2NVX B;  2TMP A;  2CHB D;  4IAL A;  3BS1 A;  5DAU A;  1ET9 A;  5I9O A;  1B1Z A;  2LMC B;  1WD1 A;  4ZKB B;  1SJH D;  3VR4 A;  1AZP A;  2PQE A;  3P1H A;  3GV3 A;  1WTR A;  1LTA D;  2L11 A;  3K57 A;  4CGY B;  3DMU A;  5KRU A;  4H13 C;  1RHP A;  5JPM C;  3IFD A;  4UAI A;  1SE3 A;  4BWG B;  4IUR A;  1G6Z A;  3M4Y A;  4HTH A;  1J9O A;  1O7Z A;  5ELB A;  5G3L D;  4XQN A;  2IPK D;  1R9T B;  4RHR A;  4RGN A;  4DNT B;  1SAP A;  2F0V A;  1TY2 A;  1EU3 A;  2KVM A;  3S2D B;  1I6V C;  5K36 H;  2EJM A;  3M85 A;  1HTL D;  5C5L A;  5CBE E;  1BR9 A;  4B9W A;  3DWA A;  3ERO A;  1X3Q A;  1S5C D;  1B53 A;  1EOT A;  3QJY A;  3ITP A;  5IGB A;  2EYF A;  3SK6 A;  3I8Z A;  1PRT D;  4G7O C;  2WAC A;  5F2D A;  5EKL A;  4WFN 3;  1PZK D;  3VA7 A;  3QOJ A;  3CRL C;  4J6H A;  2L9H A;  2MP1 A;  1YNN C;  4M8A A;  3CQZ B;  4PMW A;  1NUC A;  1JCK B;  1D5X C;  1GUG A;  1JOQ A;  4XXE A;  1DZ1 A;  3OOC A;  1EY8 A;  1PFM A;  2A5H A;  4CJ2 C;  3ONA B;  2XN9 C;  4DAP A;  4G7Z C;  4LMQ D;  1CHP D;  5C4Z A;  3UI2 A;  4BA2 I;  3TZU A;  3D6C A;  1Y8N B;  4L63 B;  2A73 B;  1IKL A;  2J0T D;  1EEF D;  5KGU A;  3FDT A;  4FF2 A;  1L0Y B;  1SYD A;  2EVB A;  2WIN B;  4CJ1 B;  1IW7 C;  5DNF A;  1U4P A;  3Q23 A;  4IFD J;  4GZY C;  2MGS A;  1BBX C;  4IN3 A;  2F4I A;  2K6A A;  1YNJ C;  1EY0 A;  1Y8P B;  1SYC A;  2KEC A;  5NUC A;  3OWF A;  2HDM A;  3SK8 A;  1G8Z D;  1JB3 A;  5FKA C;  2WII B;  1JWS D;  4KKS A;  1CZW A;  2XNA C;  2F0T A;  2JSO A;  2EYM A;  3BYT B;  4DAV A;  2FHT A;  2F0H A;  3GTP B;  5EPK A;  4MIU A;  3DXJ C;  1SE2 A;  4FF1 A;  5EGT A;  2R3Z A;  2Z8L A;  1H9M A;  2IL8 A;  2J4X A;  4KY6 A;  3I91 A;  1FNW A;  1FGB D;  1G29 1;  3FRP B;  2B2V C;  5J1Z A;  4PMB A;  4CHT B;  1Y1W B;  2EJG C;  3H91 A;  3MVV A;  2AWO A;  2R7Z B;  3ERQ A;  3IL8 A;  2L4N A;  5CV5 A;  1EFI D;  1F2Z A;  2NVY B;  2E74 C;  5KYI A;  1V43 A;  2ENB A;  3PV0 A;  4UDU C;  3VYR A;  2E2H B;  1BCP C;  1WD0 A;  1CZG A;  5E3F A;  3TP5 A;  4N9T A;  2EY2 A;  2NVQ B;  1QB5 D;  2FJ2 A;  1D5Z C;  1NR2 A;  2B39 A;  1O78 A;  2ZXR A;  5COY A;  1B2T A;  3C2P A;  1DXM A;  3TBI B;  3VR2 A;  3GTL B;  5M3M B;  5CGK A;  1VMC A;  2FIN B;  1CQF A;  5HGT A;  5M9O A;  3Q0A A;  4E6I A;  1KLU D;  5E4X A;  2F3W A;  3VYS A;  1M4V A;  2A74 C;  3GTK B;  4ZAI A;  5A35 A;  3WOF A;  2IJ0 A;  5CBA E;  1U9R A;  2F0K A;  4K6D A;  5ELC A;  2K32 A;  3VR3 A;  2G9D A;  2QKI C;  3NWS A;  3J7Y W;  4KV6 A;  5AFW A;  1EZ8 A;  3HOW B;  3DM1 A;  4TSS A;  5FOB B;  1KDC A;  5FLX L;  3TP6 A;  2XSC A;  2IX1 A;  3OPO A;  1CT1 D;  1UEA B;  4EQO A;  2EY5 A;  4FP5 D;  5IGE A;  4ZUI A;  1I4G A;  1A15 A;  4X3S A;  5C3E B;  3J81 L;  1KLG D;  5CV7 A;  3BYY B;  2VB3 X;  3T4A C;  1SBB B;  3U9S A;  1AW7 A;  4U67 3;  1PFN A;  1KDB A;  3FKI B;  2HDL A;  2EYP A;  1CFM A;  5FO8 B;  1TR5 A;  4L6T B;  4JK1 C;  1ENF A;  4Z9C B;  3S16 B;  2N88 A;  3NWT A;  2L1B A;  1S5B D;  4DU9 A;  1KDA A;  3A8K E;  3F2U A;  2B2V A;  2NBF A;  1JIC A;  4V19 0;  2BA0 A;  3A55 A;  1VDZ A;  4K8J A;  1KAA A;  1TWH B;  2F0G A;  4N9P A;  2JA7 B;  3BVG A;  5ELE A;  2EY6 A;  2HCI A;  3SXH A;  3K5O A;  1F9P A;  3S1N B;  1Y8O B;  2ZXP A;  1WTO A;  1TQO A;  1Z7T A;  2Q8I B;  3TN2 A;  3E5S A;  1XX8 A;  4KI0 A;  1ILP A;  1GOZ A;  3NQT A;  2SNM A;  2V4D A;  4CKE A;  5D65 A;  2A68 D;  2B2Y C;  1V1P B;  4DK1 A;  4OL7 A;  1X3P A;  2NZ1 D;  1GHJ A;  2M9V A;  1QIL A;  3MAQ A;  1B44 D;  5EKI A;  2IT1 A;  1QE6 A;  4C56 C;  3EFX D;  1NCV A;  2MJ8 A;  3D31 A;  3MFY A;  3R93 A;  2NWG A;  1I50 B;  1I4R A;  1GJX A;  1ZEQ X;  3OMC A;  3QO2 A;  4BA1 I;  4Y7N B;  1ML0 D;  3H94 A;  1A2T A;  3CU7 A;  5KNB A;  1F9Q A;  1SYF A;  1PDQ A;  4QIW B;  1BO0 A;  4HR7 B;  5EBD A;  3MTS A;  5M5W B;  4A3B B;  1RDP D;  4HMJ A;  3C3L A;  1AZQ A;  1RTO A;  2NN6 G;  4FYD A;  1EWC A;  3J7A F;  2SDF A;  2C9O A;  2LFN A;  3M4O B;  1IYU A;  5FO7 B;  2NTS A;  4KJO A;  1SXT A;  2PCF B;  4RGM A;  5M3F B;  1LT6 D;  3HKZ B;  4Q0F A;  1BQQ T;  3OIQ A;  5C4X B;  3KUP A;  3RZO B;  3RZD B;  3WOE A;  4PV1 C;  2RSO A;  1W6K A;  1PRT C;  3MZ5 A;  2EPB A;  3DWQ A;  2JA8 B;  2Z4H A;  1JWU D;  2D5D A;  2ZT9 C;  5I6Y A;  1QNU A;  4C2M B;  2BDN A;  3D3R A;  1F2L A;  4ZLT F;  2VB2 X;  2EYL A;  2F0L A;  5KIX A;  1HPC A;  3IFT A;  4DXG A;  1HUN A;  4FO2 A;  3KK7 A;  5KNC A;  2KUM A;  3OIP A;  1HRJ A;  2L5T A;  4A3K B;  1NAP A;  1EY4 A;  4RKL A;  2B8F A;  4V0B A;  3GTM B;  2NUC A;  3PIP 3;  1DON A;  1AFP A;  2EY1 A;  3VR5 A;  5T1I A;  4U68 A;  2DNE A;  1PLF A;  2PZW A;  4X3T A;  4MHE A;  4F7X A;  2K1B A;  1E2V A;  1UAP A;  5E1F A;  1NR4 A;  4PMC A;  1SND A;  3D8G A;  4OHJ A;  1QWY A;  4KD3 A;  5C4J B;  2O5J C;  4QMG A;  2KCC A;  2RDF A;  4OIK A;  1CM9 A;  1S5F D;  1HCZ A;  1OXT A;  4K5X A;  1PMR A;  5BN4 A;  5EJW A;  1A2U A;  1OXU A;  3OMG A;  4NP5 A;  4Q5V A;  1HA6 A;  2OF1 A;  3T53 B;  1F77 A;  5CV4 A;  1SEB D;  1C4Q A;  1GUN A;  3I70 A;  1LO5 D;  1D2B A;  2K5W A;  1ESF A;  2PPB C;  1ENA A;  1TWC B;  3OSO A;  4RGO S;  3G7L A;  4C3I B;  1VF7 A;  2MPM A;  3NXW A;  1CK1 A;  3RUZ A;  4WJW A;  2KEE A;  4ZKC B;  4C1N I;  1B9N A;  4G57 A;  5IGF A;  4PQX A;  1RCV D;  3T51 B;  2A6E C;  4A93 B;  2K5Q A;  2QDB A;  1ZYR C;  1IYV A;  1EIH A;  5D3D A;  3RLF A;  1QJO A;  4LK1 C;  4K5V A;  4QUC A;  2QF7 A;  1MSH A;  1XXG A;  2LKV A;  1IHZ A;  2LY7 A;  2EXZ A;  4C3H B;  4RGT A;  5BN5 A;  5JEA J;  2WV6 D;  3I72 A;  3NBH A;  1PXU A;  1EY7 A;  4FF4 A;  2B2W A;  3QG1 A;  1S5D D;  1XTC D;  2JYO A;  3SK5 A;  4DXF A;  1GXD C;  1QG7 A;  3S15 B;  2AWN A;  5C0X J;  1JC7 A;  4R8N A;  1KTK A;  3L3O C;  3P20 A;  4C3I G;  4ME5 A;  4A3J B;  5I9P A;  3C46 A;  3J80 L;  3A56 A;  5C3X A;  4IUP A;  3ND9 A;  2B2T A;  3AMU A;  1STE A;  1OXX K;  1DOM A;  1HQM C;  1I6H B;  2WP8 J;  4DAY A;  5LL6 S;  1EY9 A;  4NKL A;  2L0C A;  4ID6 A;  1V1O A;  1CTM A;  1ET6 A;  1DOK A;  4ULL A;  1WTX A;  3CKI B;  3E0J A;  4BS9 A;  3KLR A;  2KHS A;  2I46 A;  3PUV A;  5DM6 3;  1JOO A;  3FMC A;  1U4M A;  5C44 B;  3K0Y A;  2E75 C;  5A2Q E;  2AUJ D;  1I4X A;  1G2S A;  1OXV A;  1B3A A;  4F88 A;  1HHV A;  5JPN C;  3X3M A;  4XIG S;  5A2Q L;  1I3Q B;  1PTO B;  1LTS D;  3MC0 B;  4CKB A;  4A3D B;  1JWM D;  1JR0 D;  3DUZ A;  4S3S A;  2HUG A;  4FF3 A;  2JA5 B;  1HUM A;  1T5X D;  5CV9 A;  1CA5 A;  1F2M A;  3BDC A;  1LLR D;  3C1E A;  2NN6 H;  3RD4 A;  3N52 A;  3MXU A;  3HP3 A;  3MXP A;  2FMM A;  1K83 B;  3CHB D;  1V1P A;  4K8I A;  1CI3 M;  4DK0 A;  2PMZ B;  2NYZ D;  2M2L A;  3HRZ C;  1FR3 A;  4FXK C;  4C1N K;  3K5N A;  3FVQ A;  1EQV A;  2PZT A;  3NTH A;  4WOR A;  3D4D A;  4OO1 G;  1STG A;  3VYU A;  3NUC A;  4CKC A;  1BDO A;  1FD7 D;  1C8C A;  5E4W C;  3QB3 A;  1VMP A;  4RWS C;  4I7Z C;  4BBS B;  3MXG A;  1G2T A;  2TSS A;  4K6L A;  1V8Q A;  2CQA A;  1LTR D;  5JAV A;  2F0P A;  3H6M A;  5D3I B;  1U4R A;  3BVZ A;  5JEA G;  3PUX A;  1F2Y A;  4L8J A;  1QCB D;  3FPU B;  4J8Q A;  3QOL A;  5I2Y A;  2O2L D;  4RA8 A;  4F87 A;  3TSS A;  4O1N A;  1PRT B;  1IW7 D;  1RTN A;  1ZKO A;  4KHZ A;  2XWB B;  1BXT A;  3D6W A;  5K36 G;  2VXW A;  1J8I A;  2NN6 I;  3VYT A;  1BCP D;  2A69 D;  3M7G A;  1TS4 A;  2LS0 1;  1EIG A;  1XWE A;  3I4L A;  2J7Z A;  5FLX E;  5CYU A;  5ELF A;  2B2U A;  4QB4 A;  1AP0 A;  5G3L F;  5COR A;  2K04 A;  3HS0 C;  1SNP A;  5T1G A;  4EQN A;  2RSN A;  2K03 A;  2K33 A;  1S4Z A;  1Y69 U;  3E6Z X;  3NE5 B;  2JEB I;  4X3K A;  1G91 A;  4NDX A;  4C3J B;  5C3W A;  1B9M A;  3K5M A;  3I73 A;  4O42 A;  1RF2 D;  2A68 C;  2VNU D;  5CMD A;  2CVR A;  1Z6H A;  3EJI A;  1II3 A;  2XVS A;  3QIA A;  2PW5 A;  1FYC A;  4TQU S;  1TY0 A;  5DM7 3;  3U9O A;  4EGV A;  3T13 A;  1XYI A;  3S1Q B;  3A7L A;  1WTQ A;  2WKC A;  3L7Z C;  2YU9 B;  1ENC A;  3J80 E;  3Q6S A;  4BBR B;  2F0F A;  1SFO B;  1L0X B;  2Z1C A;  2JA6 B;  1TU2 B;  1TWA B;  4HCE A;  4BY7 B;  1HA5 A;  3SHL A;  4A3G B;  3K5L A;  3MEH A;  3BVM A;  1FNV A;  2KCN A;  5TSS A;  4RFB A;  5FK9 C;  3I4M B;  5M5X B;  2O5I C;  3PUW A;  2B2U C;  3I3C A;  4A3F B;  1ROD A;  2PO4 A;  1WTV A;  3A8J E;  4JBW A;  3T16 A;  5IGC A;  2H1E A;  5CR3 A;  4ZYS A;  4NW2 A;  4C3J G;  3NTI A;  5KEE A;  2B8G A;  1W6J A;  3NP8 A;  4H7B A;  3HEJ A;  1F9R A;  1SMY D;  2A6H D;  1JOK A;  2SNS A;  3NPP A;  3S17 B;  5KYL A;  5JVH 3;  2O4X A;  3ND8 A;  2Y0S B;  1SJE D;  1IKM A;  1ZYR D;  2DY7 A;  1PRT F;  2JEA I;  2RA4 A;  4G4K A;  4RH6 A;  1I4Q A;  2PYK A;  4P2C B;  3FEW X;  1CQV A;  5CV8 A;  2F3V A;  3BG3 A;  1TS3 A;  1MI2 A;  4XDX A;  1STB A;  3GTQ B;  1Q90 A;  2DN8 A;  5C4H A;  5C6A A;  1T5E A;  3LWE A;  1BOS A;  1EZ6 A;  4H0L C;  2F0Q A;  2F0E A;  1D5M C;  2ZXO A;  3D4R A;  4H44 C;  3MXN A;  2PNR C;  5LHY 1;  3A7A B;  3BZD B;  3W3A A;  4HN7 A;  1GUW A;  4DN4 M;  1GUO A;  2EYJ A;  3TP7 A;  3MWY W;  3R2T A;  4K5W A;  2OT2 A;  4IFD G;  4F8M A;  5J22 A;  3EA6 A;  4FNF A;  1SYG A;  2CW0 C;  3HOX B;  3HOU B;  1STN A;  3I90 A;  2F0U A;  4ZRZ A;  1F9S A;  2K5D A;  3Q24 A;  4HED A;  2E2I B;  1LTT D;  2Q8T A;  3H0G B;  4KHV A;  3DEO A;  3L9A X;  1DYQ A;  1OXS C;  2XIW A;  4IUV A;  5ISR A;  1HFN A;  1SNM A;  2SOB A;  4RCN A;  2E76 C;  4QF4 A;  2CW0 D;  1GUT A;  5K5P A;  1HTP A;  2D9U A;  3TDQ A;  4KN7 C;  3PUY A;  1DD2 A;  5CV6 A;  1EWH A;  3P75 A;  4B08 A;  2RKS A;  4R9W A;  2EYO A;  2RBM A;  1HXY D;  3PO2 B;  4MN3 A;  3N6R A;  3S1R B;  4ILW A;  1A3U A;  1H9J A;  1I4P A;  1WTW A;  3V96 A;  3BDL A;  4X3U A;  3K59 A;  4LAA A;  4HSP A;  4OIJ A;  3NTK A;  4XYQ A;  3S9W A;  2C5C A;  5HUR A;  1WCM B;  3T56 B;  3JAM L;  1H9S A;  3A8I E;  1Y1V B;  1WVL A;  1U4L A;  1STY A;  5DEH A;  1CA6 A;  1EYA A;  3ZYY X;  1STH A;  3V05 A;  2RQX A;  4A3I B;  2XWJ B;  1R4P B;  1TKW B;  2WB1 B;  2QCP X;  1LV9 A;  2H4O A;  1EL0 A;  1JE4 A;  4K2L A;  3IAY A;  1WTP A;  2B63 B;  1LTB D;  1SSO A;  1PFB A;  1SE4 A;  2X6L A;  1D1K A;  2KA7 A;  1RJT A;  4LJZ C;  2BE5 C;  4XQJ A;  3EQL C;  1BCP F;  3HGB A;  4EVO A;  3TZD A;  3MA2 B;  2RDG A;  3NBI A;  2K28 A;  2BCO A;  1O80 A;  4J1M A;  3RMH A;  1KNE A;  2B2W C;  2Q8R E;  1E2W A;  1D6E C;  2I07 B;  3GV6 A;  1DCZ A;  1VCI A;  2D2C C;  3VR6 A;  3KF8 A;  3GQB A;  1OO9 B;  2BE5 D;  2AQ3 B;  1EEI D;  1EYC A;  1Q1E A;  4A3E B;  5IIF A;  4HMI A;  2MHV A;  5C0X I;  4KMU C;  4ODG A;  3SR1 A;  4TKO B;  2DNC A;  3HOY B;  2KQ3 A;  2EDG A;  3SK4 A;  1EU4 A;  5C0X H;  3AB9 A;  1LTG D;  1IL8 A;  5ELD A;  1MGS A;  1SNQ A;  2NTT A;  2GA4 B;  5KND A;  1M8A A;  2F0D A;  2A6E D;  3HOV B;  1DOL A;  1PTO D;  2RDH A;  1SYB A;  1Z47 A;  2JE6 I;  1BF4 A;  4RCO A;  1H9K A;  3MFG A;  2IX3 A;  4A3M B;  4IUU A;  2AUK A;  5IOD A;  4FXG C;  1B50 A;  2WAQ B;  2XRS D;  2EYH A;  4KN4 C;  2EZV A;  4AYB B;  3OHX C;  1BNZ A;  3PUZ A;  1MD2 D;  4HAE A;  1LT5 D;  1LT3 D;  5JEA H;  5LL6 X;  3BDO A;  4XT1 B;  2BA1 A;  2N55 A;  2G9H D;  3OWE B;  5C5M A;  1K8M A;  4DA2 A;  2F03 A;  3WDN A;  4FVM A;  4KKU A;  3IKJ A;  1EY5 A;  1YNN D;  4ABN A;  4K2K A;  2AQ1 B;  1RD9 D;  2F0O A;  2E2D C;  3Q22 A;  1A3T A;  4OO1 I;  2F0I A;  2F0J A;  4IUT A;  2X6G A;  4XT3 B;  5IT9 L;  2B2T C;  1SNC A;  4ZUJ A;  2QEJ C;  3W2D A;  2F1M A;  4G7H C;  1UUP A;  5I6W A;  2EE1 A;  4FXD A;  3HZX A;  1ONL A;  1TT2 A;  3SEB A;  2F0S A;  4IUN A;  3D4W A;  1FNU A;  5IGG A;  5FO9 B;  3QWN A;  1VF5 C;  3DHQ A;  3K6O A;  4KTA A;  2K05 A;  4KJN A;  1X32 A;  3HOZ B;  4QCL A;  5C0X G;  1ESR A;  2K7V A;  2D62 A;  1D1I A;  3TP8 A;  4ZK9 B;  2EOT A;  2OXP A;  3TME A;  1AN8 A;  2IWH A;  5EPL A;  2FFK B;  1HQR D;  2E2J B;  1PZJ D;  3MHB A;  1TS5 A;  3KBG A;  3EVQ A;  3GO5 A;  3I4N B;  4DF7 A;  4KKT A;  2KJX A;  1Q12 A;  2PW7 A;  4KY5 A;  3PMF A;  4K14 A;  4XQQ A;  4ZQ3 A;  1LT4 D;  1O7Y A;  2A6H C;  2MUY A;  4OGQ C;  4PNY A;  1DM0 B;  1A3V A;  1SDF A;  3PIO 3;  5IGD A;  2K01 A;  4OO1 H;  1PTO C;  4DGZ A;  1AEX A;  1HFG A;  2NVT B;  1BUV T;  4CBV A;  3GTG B;  1H9R A;  1PTO H;  3HG9 A;  2FMC A;  1H9S B;  1ICW A;  5IT9 E;  3A54 A;  1S5E D;  4KY7 A;  4I65 A;  5JOB A;  3GD7 A;  2ICE C;  2SEB D;  1B4O A;  3S2H B;  4XYO A;  1LTI D;  1TWG B;  2KOL A;  1SNO A;  2ICI A;  3NHH A;  2KED A;  3NK9 A;  3GTJ B;  2YYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...