1EYDA

Structure of wild-type s. nuclease at 1.7 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eydA00
1SYGA 1EY9A 3D6CA 1EYAA 3RUZA 3T13A 3R3OA 4KV6A 4DFAA 4K8JA 4DF7A 2SNMA 2F3VA 2M00A 3ITPA 2F0UA 4TRDA 5CV9A 2EYHA 3V2TA 5CV6A 2F0OA 5C4HA 2F0WA 3OWFA 3PMFA 5J1ZA 5I6WA 5KYLA 4IALA 1TQOA 1TT2A 2O4XA 1U9RA 3SK6A 2EYLA 3C1FA 4LAAA 4PNYA 5M9OA 4KJNA 4I65A 2SNSA 2F0IA 5DEHA 3NUCA 2EYJA 1EY5A 4F7XA 3NXWA 3TP7A 1F2MA 4MIUA 4ZUIA 1RKNA 2HQEA 1JOKA 2PZWA 4K8IA 3TP6A 4KY6A 4E6IA 1STBA 5IGBA 4DGZA 2F0GA 1KABA 2EXZA 2LKVA 4KHVA 4QB4A 5KYIA 3T16A 5J39A 3HZXA 5CC4A 4IUNA 3VA5A 3QOJA 5IGFA 2EYPA 1NSNS 4B9XA 4HMJA 1EY6A 4NMZA 3ERQA 5E3FA 1SYCA 4HTHA 3TP8A 1IHZA 5C4ZA 2EYOA 3D4WA 3EROA 4IZ8A 5HURA 4QF4A 5C5LA 3TP5A 1A2UA 3MHBA 4KTAA 2F0FA 5J22A 1EZ8A 4ODGA 4YIJA 2QDBA 2F0VA 2PYKA 3DHQA 4WRDA 5IGEA 2WACA 2F0DA 5KEEA 2F0KA 5IOCA 5C5MA 2F3WA 3QB3A 5I9OA 2ENBA 1KAAA 2F0HA 3SXHA 2F0LA 3BDCA 2RDFA 4HMIA 1F2ZA 3MVVA 3P75A 1EY7A 4H7BA 4RKBA 1STAA 5CV7A 3SK8A 5KIXA 4EVOA 2EY2A 4N9PA 1EZ6A 1STYA 4NDXA 1JORA 2EY6A 1ENAA 4F8MA 2EY1A 2NUCA 3SHLA 2EYFA 2OXPA 1EY4A 4RKLA 3C1EA 5KRUA 3NP8A 3P1HA 4KD4A 1II3A 1KDCA 1SYEA 3OSOA 4ZUJA 5EKLA 2OF1A 2F0TA 1EY8A 4K2KA 4K2LA 4K5XA 1EY0A 3NHHA 4KY7A 5CV8A 3SK4A 5JAVA 3QOLA 2SOBA 4KJOA 5EGTA 4G57A 1NUCA 1A3UA 4R8NA 4EQOA 4ID6A 4ZQ3A 1AEXA 3BDLA 5I6YA 1EQVA 1STGA 3HEJA 3SR1A 1A3VA 2KHSA 1A3TA 5ISRA 2PZTA 4N9TA 3D8GA 3LX0A 2PW7A 5C3XA 1ENCA 4NKLA 1F2YA 5NUCA 4K14A 3S9WA 1KDBA 1KDAA 3MXPA 5CR3A 1SNCA 1SNDA 4PMCA 5C6AA 4PMBA 4DU9A 4KY5A 1SNQA 2F0PA 5E1FA 2F0EA 3OMGA 5DAUA 1SNPA 1SNMA 1JOOA 4ME5A 4KD3A 2EYMA 2F0MA 5IGGA 3SK5A 5K5PA 1A2TA 3EVQA 1JOQA 3TMEA 1SNOA 3NK9A 4J1MA 2F0QA 4K5VA 4WORA 5F2DA 3U9OA 3E5SA 4J6HA 4QMGA 4S3SA 4EQNA 5HGTA 2RKSA 4OL7A 1EYCA 1SYBA 4B9WA 5IODA 4NP5A 4EQPA 2OEOA 3EJIA 1SYDA 3MEHA 5CV5A 1SYFA 2F0JA 1STHA 1TR5A 2F0NA 1EYDA 2PZUA 3D4DA 3NQTA 2PQEA 3OMCA 4K6DA 5CV4A 5EKKA 5JOBA 5C3WA 5CGKA 5IIFA 5IGCA 2RBMA 2EY5A 2PW5A 3MZ5A 2F0SA 4K5WA 3H6MA 5KGUA 5I9PA 5IGDA 1STNA 3DMUA 2KQ3A
chains in the Genus database with same CATH superfamily
4RWSC 1SYGA 5M3MH 5C4JH 1FR3A 5IP9H 1H9SA 4K8JA 4DF7A 3NWSA 2B2VA 1ZXTA 4DR6L 3TDQA 2JSOA 1CTMA 3MWYW 2Q2IA 4X66L 4JC0A 1H9RA 4TSSA 2RSOA 5JVH3 2QKIC 4RHRA 1D8LA 1RTNA 3KBGA 4ZUIA 1RKNA 2HQEA 5DNFA 4A3MH 2VS1A 4QB4A 4KHVA 4DV5Q 4GZYC 1PA6A 1SXTA 1HA5A 2NB0A 4C3JG 5M3FH 2A69D 3IL8A 3TZDA 1O78A 4BXXG 4ZK9B 2K75A 2JP1A 3NBHB 2E2IH 3CQZH 4PZ6A 1X56A 2J4XA 5KEEA 2NN6H 1PH5A 1K83H 1VQ8A 3FPUB 3HKSA 1B4OA 2KHJA 4DAYB 1A6XA 3MVVA 3FKIH 4EVOA 4A3EG 1NMFA 1EZ6A 1IKLA 1L1OA 1T5EA 2AQ2B 2F4IA 4X6AH 1B9MA 1PTOH 3S15B 5M3FB 2VQFL 1RHPA 1EIGA 1V8QA 1O7LA 2QILA 1MKHA 1O7YA 4C3IB 1WTHA 1VF5C 2B63H 1MJCA 3G48A 1TKWB 5C3XA 3GTOB 2XSCA 3ZJYC 3ULPA 1GUSA 4JI8Q 5C0XJ 3NELA 2R6GA 2B2UA 3BYTB 2PO4A 1OTCA 3I4NG 1QVCA 2K32A 2JA5B 5FO7B 1L2FA 4RHSA 4S3SA 1GUTA 1SYBA 3PUYA 1BDOA 3KLWA 4DAMA 1UAPA 3I4MG 1VQMA 3R93A 4C3IH 4PV1C 4X3SA 5LMUL 4OX9L 4A3DG 1LTAD 4AIMA 1N32Q 1D7QA 5CMDA 1NR4A 1BVSA 2K4KA 1O7ZA 3BDOA 1CFMA 1ESRA 4LF7Q 4LMQD 4DV5L 2F0IA 5A2QE 1H9MA 1SMYC 5BR8Q 2PZWA 1SROA 4FXDA 4JK1C 5BN4A 3WOFA 4GKKL 4A75A 3HFZB 3TP8A 2WKCA 3IRBA 3MXNB 5C3EG 2E2HH 3HS0C 1XYIA 5GQOA 2AQ1B 4GN4B 1XNQL 3T1YL 4BA2I 3DWAA 2F0VA 1GJXA 2DN8A 1J9OA 1RDPD 2WACA 4A3EH 1B7YB 5I9OA 2VUMH 2JA7B 4HMIA 2PPBC 5JPNC 4HJ5A 1HCZA 4K0KQ 4Z9CB 4HJ7A 2E5LQ 4A93B 1E24A 3TSSA 4XXEA 2YU9B 4L6TB 1HNZL 4ZUJA 4RA8A 2KCMA 2MNAA 4BXXH 2OF1A 1LTID 1F9SA 2H5XA 1EY0A 1NCVA 3AFQA 1GVPA 4A3JG 4AYBB 4ZQ3A 5LMNL 4A3KH 3K58A 2HQLA 3CCRA 1HZAA 3MC0B 1DOKA 2G5DA 4L5RC 4NKLA 1S5BD 5C6AA 3I72A 1YHBA 1SNQA 3G71A 1HJPA 1A63A 4BY7B 2F0QA 1CQFA 2FINB 4B3MQ 2IX0A 4LW1A 4DR7L 1E3PA 4L5SA 3NTKA 5BN3A 1EU4A 1EYDA 1X3QA 1IBKL 3D31A 4KKSA 1T9HA 2RBMA 2EY5A 1GHKA 4CDFC 2UUBL 3UE0A 4FYDA 5FLXL 4AH6A 4K0KL 4OO1G 4JI3L 1YIJA 1WYDA 3I4LA 2QEJC 4TRDA 5ELDA 4OGQC 2VZAA 1W2BA 2O4XA 4ILWA 1M1KC 4KHZA 4I65A 3F2CA 4NXNL 2B2YC 1JE5A 1ASZA 2VL6A 4MTNA 4MHEA 3KLRA 5EAYA 1LT6D 3KJPA 4DR4Q 3K81C 4JG2A 4CDCC 4LF9Q 3I91A 1WTWA 4NMZA 2NVTH 1LT4D 3PO2H 2D62A 2KCCA 4RG1A 5JPMC 3K7UC 3JAMi 4CJ2C 4LFAQ 3HOXB 3TP5A 3S2DB 3EQLC 3K8AA 2ES2A 4X65L 4R4QA 1L0WA 2UXBL 2JA8H 2I07B 3VYRA 3QB3A 3E9HA 1SEBD 4J15A 2WIIB 1CKMA 4R9WA 2N8NA 1X9NA 5FLMH 1Y8NB 4A3IG 1A62A 2VXWA 5LL6S 2E2JH 1PLFA 1DM0B 2A68C 2CKZB 2DY7A 3PGZA 5IYDG 3C2PA 1IBML 3I3CA 1HFNA 4A3KG 4DV7Q 3PO2B 1S5FD 1HNXQ 4HSVA 3QOLA 5E4WC 4FDBA 2EIFA 4KN4C 1Q86C 4F87A 3S1RB 1PH8A 4WJ4A 1PH6A 3HKZG 3L0OA 2KCTA 4A4IA 1Q46A 3MXPA 4BY1H 3PV0A 2I5HA 1Y8PB 1OXVA 1K8OA 1Y1VB 3OMGA 1WCMB 1HA6A 2L5TA 5K5PA 5C4JB 1A2TA 4K5VA 3BYYB 1PYWD 4DN4M 1CKOA 1VQHA 1S40A 3K5NA 3CCUA 3HKZE 1LTRD 1BR9A 1TWGH 1DOLA 1UEBA 3AQQA 4K5XA 3IAYA 1S4ZA 3NQTA 3N52A 4QIWB 5FJ8H 1XMOL 2IHEA 4OIJA 2E2DC 3H09A 1OO9B 1I4RA 1GHJA 1TWFH 2ZTCA 1XTDA 1PH3A 1SN8A 1E0BA 1PDQA 2K5NA 4RGMA 4MTKA 1Y1WB 4PMWA 5M9OA 2ATWA 4FF4A 2AUKA 5LMNQ 1BCPB 2EYJA 4F7XA 1YNJD 4K8IA 2K14A 1FVIA 1B3QA 2JA9A 2LKVA 2NVXB 1U5KA 1M90C 1NE3A 1WI5A 3GTPB 3I56A 1O80A 2ASBA 1YHAA 5IGFA 4A3BB 4HMJA 3SEBA 1XPUA 4IZ8A 2ZXPA 1BF4A 4X64Q 4DR3L 2A8VA 3A74A 3H0GH 1NY4A 2F0KA 1EOVA 2F3WA 2D9UA 4BWGB 3H3VH 4R4CA 4H7BA 4RKBA 3KOJA 3PCOB 5M3MG 3ZYYX 3VR6A 2HT1A 1Z47A 4GOPC 3JAMc 2B2YA 1VQLA 4F8MA 2DUDA 3ER0A 3GTPH 4BBRG 2OXPA 3HOVH 2ZJRA 3DUZA 4C2MB 3CRKC 5KRUA 2K5DA 1WD1A 2C9OA 1IYJB 2B2UC 4M1UB 2JA8B 2WAQG 4K2KA 1AZQA 5CV8A 3VR2A 1U4MA 1S5CD 4R8NA 3RLOA 1AEXA 3K6OA 5I4DA 2DJFC 3I4OA 1BNZA 3D8GA 2KJXA 1Q8KA 3PIOA 5A35A 4GLXA 1KDBA 2KCNA 4RAUC 1B44D 2GN5A 3LWEA 1DYQA 1XWEA 4A3DB 2LFNA 2R7DA 1SDFA 4ME5A 1V1OA 3ND9A 2F0MA 2ID0A 1SE3A 3OWEB 4LFBQ 4HAEA 2N88A 1YNND 2PMZE 3OIPA 2R7ZB 3J80L 3S17B 3A54A 3E5SA 2D5DA 1AE2A 3FRPB 4QMGA 4DV1L 3S1RH 4JI1Q 2E75C 3HOWB 2QF7A 3OPOA 4XYQA 1WCMG 1FNVA 4YWKA 3J81j 1PYBA 5IIFA 5EKKA 5C3WA 1CA6A 2D0OA 4A93G 1R9TB 2OTJA 3M4OH 3WOEA 3NBHA 1Y1VH 4C1NK 3H6MA 1B53A 1STNA 4GKJL 5IT9L 3RUZA 4NXML 1X6OA 5EQ0A 2R92G 4A3DH 2M00A 5DM63 4JI2L 4B3TQ 4H0LC 1WTVA 5ELBA 4CJ0B 2B2TC 2A6HC 1AP0A 2HCCA 2BDOA 1BCPF 2NYZD 5M5YH 4CKCA 1F2MA 1SJED 2OQ0A 1PZKD 2B8GA 1VQ4A 3STBC 1TWFB 2EXZA 2K04A 3J80i 3DEOA 4H13C 2CH4A 1NSNS 2EYPA 3J80c 3M4OB 2AWNA 1IHZA 3HRZC 3H15A 3D4WA 5HURA 2LS01 1VQJA 5D3IB 4B3SQ 5FLXE 4YY3L 1I4PA 1XTCD 4HIOA 3JAME 4B3ML 1Q90A 1RIPA 1YITA 2VQEL 2R3ZA 1LTGD 4N8X1 1YHQA 1KAAA 5C0XH 5LMUQ 2F0LA 3M4YA 3U58A 4L5QA 3I55A 5KIXA 4ZKCB 3BZKA 4DR1L 1LO5D 5D3DA 4BBSH 1J8IA 4DK3C 2UU9Q 3M4PA 4YWMA 2Z4IA 1JB7A 5E4XA 4ABNA 1H9KA 2AKWB 1BBXC 4A3FH 3NBIA 2Q8RE 1D1KA 2QDLA 2R7FA 4G57A 1EYGA 4NXNQ 5I6YA 1G6ZA 4LF5Q 1CKNA 1L0YB 4CKBA 3K0YA 1E22A 3M7NA 1LABA 3ND8A 4PZ7A 5C44H 1VMPA 5EPJA 2FMCA 4NPSA 4JOIA 1SNOA 3S16B 1C0AA 3RLFA 1U4PA 3CXCA 1V1QA 1G2TA 2ZTEA 1PYSB 4EQPA 1KLGD 3K7AB 2L9HA 1HZBA 1E2VA 1LT3D 4UAIA 4DR6Q 2B63B 5FO8B 4ZAIA 4ZCKA 3O13A 5I9PA 1Z9FA 3RLNA 2UXCL 2NTTA 3D6CA 3KBXA 5M5XH 3CCQA 3R3OA 2ZJQA 4IUPA 3G6EA 4K6LA 2CQOA 1HQMC 3VYTA 3CD6A 1MD2D 4GOPB 1XJVA 3OWFA 2UUAQ 4DV2Q 2DY8A 2IX3A 2A73B 4LAAA 1IL8A 3S2DH 4GKJQ 4IFDJ 1MHWC 1C8CA 1I5FA 1CKNB 3FVQA 1UUPA 3IFTA 3TP6A 4CJ1B 1Q8IA 3G4SA 4XIGS 2X6LA 1TWAH 2V1CC 4CDDC 4X65Q 1K9MC 5E3FA 4KLKA 2O5IC 4KI0A 3TREA 4XQNA 5EBDA 3F2DA 2XIWA 3VA7A 1VF7A 2NTSA 4JPBW 2XVSA 4JYAQ 1F2LA 1EZ8A 4A3JH 5COYA 3NTIA 2CVRA 1Q1EA 1F9QA 4KKTA 1JWSD 1TWCH 1K73C 1UE5A 3URYA 3SXHA 2KENA 2ZTDA 4OX9Q 3BZDB 4DV6L 1H9JA 3I7FA 1IBLL 3GTKH 3Q8DA 4DXFA 1STYA 3CCSA 1JJ2A 1DZ1A 3CU7A 4OIKA 3TZUA 3CC7A 4C3HH 1QG7A 1VMCA 2F0TA 3F1ZA 1JQYD 4KY7A 2A68D 4DK0A 4PZ8A 4BBRB 1UE6A 2RDHA 4ID6A 1PH4A 2C35B 2B39A 1B3AA 3LX0A 4DV7L 2HHHL 2YV5A 4QQBX 4BBSB 2Q8TA 2VUMB 4HEDA 2JA7H 3N6RA 4DUYL 3E9IA 4OWWB 4TKOB 3PQIA 5EKIA 2H4OA 3SK5A 3J81c 3NK9A 4JOIC 2IX1A 3NQIA 1B50A 3HOYG 1A8VA 2RKSA 1EU3A 4G7HC 1K3RA 1K8GA 1Y14B 2ICEC 4IOAA 1N8RC 4NB3A 2IY5B 2K28A 3M9BA 1G291 1PH7A 2F0NA 3BVZA 5IP9G 2KECA 5IGCA 3W1GA 3R2IA 5FLMG 1VQ9A 1N34Q 2J0TD 2B2VC 4C3JB 3S1QB 5KGUA 1X3GA 2M9VA 4C1NI 2FFKB 3T13A 4LUVA 1LV9A 1EIHA 5ELNA 1ILQA 4UHVA 3ITPA 5FJ8G 2RCFA 3GO5A 4JBKA 1XPRA 1SR3A 1FJGL 1HNXL 4IALA 2F3IA 4UP9A 1LACA 2SNSA 4XTCS 2UXCQ 1ZYRC 2QW7A 3GTQB 1X3EA 3GTJH 2K05A 2VY3A 1XPOA 3HP3A 3K0XA 1BCPC 1U4LA 2Z6BA 4GN5A 5J39A 2EZVA 3VA5A 1Q12A 3VDYA 3QOJA 3H91A 2IT1A 2L0CA 2NN6I 3GQBA 4HCEA 3HGBA 3BJUA 4IPDA 5C4ZA 1IW7C 4GNXA 4Y7NH 1IZ6A 2WAQB 2Y0SE 4V0BA 5L37A 1KC8C 2H1EA 4YIJA 4DNRB 2PYKA 3BS1A 3I4NB 1G51A 3KF6A 1P16A 2F0DA 2PI2A 3HOXG 3NPPA 2GA4B 1KAWA 3VR4A 3CRLC 3CCJA 4LF8Q 4DA2A 4JYAL 2O5JC 2NZ1D 5FLXc 3HKZB 3AU7A 1YVCA 2ZT9C 2A6HD 4NDXA 4X62L 1H9SB 2EY6A 2JJQA 1V43A 1EY4A 3C1EA 3FP9A 4BS9A 1KDCA 4DV6Q 3L3OC 3PUXA 1TWCB 5LHY1 3CMEA 2EJGC 2K6AA 1ZYRD 4MN3A 5DLQE 3PF5A 3H94A 2NWGA 3KLSX 1N36L 1A3VA 5BR8L 4JI7Q 1QCBD 1PTOD 1F2YA 4HIKA 1C4QA 2KEDA 4DXGA 1WVLA 1BXTA 3Q0AA 5AJ3Q 1VQ7A 1EQTA 5D14A 4OWTB 2BH2A 5H1SE 2HHHQ 2EDGA 1QNUA 1HR0L 4OL7A 1EYCA 1M8AA 2YTYA 1PZID 1QUQA 3U4VA 1PFMA 3PIP3 1VQ6A 4LFBL 1HUMA 5I2YA 3AFPA 3T56B 3P20A 4A3MB 1H95A 4DV1Q 1IYVA 2OTLA 1HR0W 2F4VL 2JA6G 1EY9A 1G2SA 2K01A 2ZJPA 4LF4L 2CFMA 3H0GG 3MFYA 3OHXC 2R93B 5C4HA 4CKEA 1DONA 1EQQA 1TQOA 3SK6A 4Y52H 4KJNA 5CBAE 4P72A 4IOCA 3EBEA 5DEHA 3HOYH 4X3UA 4O0AA 1EY5A 3H3VI 4MIUA 1VQBA 5K36H 4F88A 3ERSX 1PH1A 1SRUA 1K83B 3T16A 3M7GA 1NJIC 3HOZG 4HR7B 4LJZC 4RCNA 3W2DA 2VW9A 5CYUA 1BO0A 2RA4A 5C5LA 1Q3LA 2FHTA 4DV3Q 4ODGA 4X3KA 4DR4L 3GTJB 1JE4A 4ZKBB 1MI2A 5IGEA 3RD4A 5C5MA 2NVQB 4JV5Q 1R4QB 1R4PB 4FO2A 3BDCA 1F2ZA 4YY3Q 2PNHA 4N9PA 3GTGH 2F4VQ 4Y7NB 3X3MA 1J6QA 4DKAC 4UY8C 2O2LD 2I0QA 1EEID 2CW0C 3P1HA 1PMRA 3OSOA 1B9NA 4LF7L 4X3TA 4A3GB 4X66Q 3K5MA 2R61A 4X62Q 2FMMA 1BKBA 2K7VA 4AQYL 1W6JA 4XDXA 1AN8A 1GOZA 1ENCA 2Q2TA 3A56A 1KLUD 3PUZA 3J81L 4PMCA 1B2TA 2PQAB 1T5XD 2B63G 4XT1B 1UE7A 5JJZA 1UEAB 1JOOA 1V9PA 1HFGA 3J7ZC 4DV3L 3G7LA 3T1HQ 2GVBA 1HUNA 1JJCB 4A76A 3S1NB 2WFWA 4ZYSA 2UXBQ 5FKAC 3OMCA 1TS3A 3J81E 2F0SA 3MXUA 1S3OA 3PIPA 3I2ZA 1ICFB 2UU9L 4B3RL 1TWAB 4JI0Q 1S5ED 2K5WA 5CV9A 1EFID 5J1ZA 5IYCG 3UDIA 3RZOB 1HTLD 3PSIA 3IKJA 5HY6A 3D3RA 4UDUC 1ASYA 3PUWA 4LF6Q 4P75A 1F9PA 2WP8J 3A8JE 1JOKA 5JEAH 4A3EB 5FK9C 2EQSA 4FNFA 4BBSG 5C44G 2BH8A 4R4TA 1PVOA 2HDLA 3S15H 1X32A 3E0EA 4KHPL 4IFDI 4BY1G 2CCZA 1G6PA 1PRTD 5IT9c 3CP0A 4QF4A 2CQAA 3GV3A 1HHVA 1SMXA 2AMCB 3R8BA 3AMUA 2CWPA 4V190 4GKKQ 3BVMA 2A69C 2EVBA 2IHFA 1WTXA 1EIYB 1K0RA 2RF4A 4DR7Q 3RZOH 2VB2X 2UXDQ 3QJYA 4BBRH 4JI6L 4DR5Q 1E7ZA 4L5TA 3R2TA 2EY1A 3C3LA 2G9DA 1X3FA 1X55A 2IJ0A 1QB5D 4JI0L 4IPHA 3D4RA 3FKIG 3GTLH 3MXGA 4JI2Q 1TU2B 5M5WH 4OEMB 1EY8A 1Q1BA 1RODA 3I4MH 1GO3E 1PHJA 2E5LL 1EQVA 3HEJA 4DR2Q 1TS2A 2K52A 1HNZQ 1VQPA 2B3GA 1FNUA 4IURA 2K33A 2L4NA 2HUGA 1JT8A 3BG3A 4RH6A 1TWHH 2F0EA 3VYSA 4C3JH 2XTIA 3S1QH 2EYMA 3PO3H 4PG3A 1IBKQ 3ICEA 4POGA 1JOQA 2HD3A 1GM5A 4IUTA 2IL8A 1RCVD 3VYUA 2BCOA 1MSHA 5IODA 1BQQT 2N49A 1MGSA 1EUJA 2J7ZA 3UDXA 1WFQA 5CV5A 2JA6B 3E0JA 2F0JA 3D4DA 3TMEA 2UXDL 2PZUA 1Z6HA 3A5ZB 5E7NA 2CH4W 1ET6A 1D5ZC 3NE5B 2N55A 3NSWA 1C7YA 1N33Q 2JE6I 3P7JA 3Q6SA 3OW7A 4A3CG 3C46A 4MZ9A 4JI5L 4OHJA 1BUVT 5GROA 4QUCA 4A3JB 2EPBA 3V2TA 5KYLA 4ZRZA 5K36G 2JA8G 2PI2E 1CQVA 3OW2A 1GXDC 2JA5G 1KXLA 1HPCA 1WOCA 2AWOA 1SLJA 4DV0L 4DV4L 1DJRD 1YJNA 4IPGA 1XNRL 4FF1A 3GTKB 3K57A 4RGNA 5M3MB 3J81i 1AE3A 1DCZA 3DM1A 5C4XB 3TQYA 2HIVA 4HCSA 5AJ3L 2F52A 3M3YH 2TMPA 1KRTA 4U68A 3RMHA 4A3KB 1IYUA 1VQKA 2MO1A 3A5UA 4Q0FA 3EFXD 1HTPA 1J5EL 5ELEA 3CPWA 2NVYB 4LK1C 3HOZB 2RDFA 3EIVA 2KOLA 5JEAG 5AFWA 2HIXA 3OOCA 2EY2A 2Y0SG 5DM73 1DD2A 1K0SA 5LMNW 2JK8A 4B3RQ 2B8FA 1NAPA 2HDMA 4RKLA 1Q81C 4LF4Q 1VS0A 2A19A 3F2BA 1II3A 5C3EH 4YHHQ 5D65A 1YNJC 1CSQA 4DAYA 2YYZA 4LUZA 3M3YB 1E1TA 1UWVA 5EGTA 1KHIA 3CC4A 1NTGA 2KHSA 1A3TA 3FKIB 1DGSA 2PW7A 2QA4A 4HJAA 4IPCA 2K5HA 4K14A 4GS3A 2OT2A 5CR3A 1HR0Q 4C56C 3DM3A 3W1BA 1MSGA 1LTSD 1SNMA 3TBIB 4GOPA 3KYHC 4JI7L 5IGGA 1CI3M 4LFAL 3I4MB 5F2DA 2DJGC 3UI2A 2CW0D 2NZHA 1UNSA 4C3HG 5HGTA 3WDNA 5C3EB 2OCEA 1YI2A 4QL5A 4JI5Q 1TR5A 1U0LA 5CV4A 4K6DA 4OO1H 2A74C 2MJ8A 1VQDA 4DV2L 1D5XC 4FF2A 3RR5A 2G9HD 2JA5H 2SNMA 4QIWE 1X54A 2VQFQ 3ONAB 2EYHA 1EWCA 3I4NH 4BA1I 1KNAA 1I3QH 3K7AH 2PQAA 1TT2A 5A2QL 1VCIA 1WTQA 4BY7G 4IUQA 2RSNA 4CBVA 3K80C 3WWVA 3QWNA 3VR3A 2WB1B 2JEAI 5EPLA 3DLLA 1C48A 1JMCA 4ALPA 1GUGA 4J8QA 2ALYB 1SBBB 3T1YQ 1SFOH 2KUMA 2DNEA 3CAMA 4FVMA 4G4KA 4DUYQ 4P74A 3T53B 1IL2A 1EY6A 4DV0Q 4UP8A 2EYOA 3EROA 1OXUA 2A6EC 3UDFA 3HOVB 1QVFA 4OXPA 1SE2A 1LLRD 3PIO3 1AZPA 4I7ZC 4L8JA 1Y1WG 4DUZL 4GN3B 1ONLA 2V4DA 5IT9E 2Z9HA 4IUVA 4X64L 4BY1B 5C4XH 5CV7A 1I94L 1EEFD 5ELOA 1PH2A 5IYBG 3OYYA 2WB1G 4LNQA 4JV5L 4OO1I 3UE1A 1HXYD 4P73A 5FO9B 4QCLA 2ZM6Q 1TWGB 2LXKA 5JAVA 3KLSA 3L9AX 1VQIA 1B70B 1GUOA 1VQNA 1HNWQ 5GAEC 2MFIA 3S24A 5NUCA 4P71A 3K59A 3KFUA 1JC7A 2OWOA 3K5OA 1SNDA 3X3NA 4KY5A 1PZJD 4XQQA 1JICA 3L2PA 3HG9A 3MXNA 4EX5A 5GAGC 4GNXB 4R4IA 4B3SL 3RZDB 1FNWA 3Q24A 1KTKA 2AHOB 2DNCA 1XMQL 2X69A 1J5EQ 1STHA 3B6YA 3CC2A 2C5CA 4JW0A 5ELFA 3MZ5A 4DR5L 1CM9A 3KK7A 1L1OC 4OWXB 3DMUA 4JVZA 4LWCA 2NBFA 1CZWA 3STBD 4QGUA 4HJ8A 3OTOQ 1CA5A 3HOUB 1PTOF 2EJFC 2YTVA 2Z1CA 3RNUA 5CV6A 2IW3A 1U9RA 1SAPA 2EYLA 1PRTB 2FJ2A 4P2CB 1PFNA 1D5MC 2KA7A 2XWJB 3MAQA 3RZDH 3TP7A 2R93G 4GLVB 3CHBD 3M85A 2PCFB 3I73A 1VQOA 3S2HH 2JN4A 2F0GA 5KYIA 3F2UA 3HZXA 4IUNA 1I6VC 4XT3B 4RMFA 3ERQA 5TSSA 1TS4A 4DNIA 1I3QB 2MUYA 4IN3A 3QIAA 1V1PB 4JI6Q 1CUKA 2XRSD 5J22A 1NMGA 2F03A 1I94Q 2QDBA 4UP7A 4YCWA 5M5WB 4DAVA 1YJWA 1VQEA 2P5ZX 2OQKA 4Q5VA 3KF8B 4KK7A 4A3IB 1EY7A 2L12A 1GUWA 1I6HH 3GTOH 1O7IA 1QILA 2NUCA 4A3BH 3NP8A 1WTRA 5GADC 4B3TL 1M4VA 1SYEA 3S1NH 1LTLA 3HOWG 1WJJA 3NHHA 2IPKD 1Y69U 2E74C 3LGJA 4CGYB 3ULJA 4LF6L 2MHVA 3HOUG 1VQAA 3AB9A 1RF2D 1EWIA 2SEBD 2EJMA 1CZGA 4N9TA 4A3FG 3I70A 3PF4A 1K8AC 3S9WA 3TS0A 1A0IA 3KDFB 2E2JB 5KNDA 1KDAA 1SNCA 4HJ9A 4A3LG 3NTHA 4A3IH 3K5LA 5DAUA 1RD9D 1CSPA 2EE1A 4LF5L 4FF3A 5M5XB 2SDFA 3BZCA 4DR3Q 4B9WA 2A6ED 1L0XB 2N78A 3E3XA 3ULLA 1DXMA 4DUZQ 3PO3G 4A3GH 2X6GA 3J7A5 1TY0A 3TS2A 2XGTA 4PQXA 1F77A 3DWPA 1WCMH 1YEZA 1KIXA 1ET9A 1UE1A 1EYAA 1TVXA 4KV6A 2AUJD 2MPMA 2K5VA 2D0PA 3GP7A 4TVAB 1EIFA 3PMFA 1XMOQ 5BN5A 4A3CH 4PNYA 3RN5A 3NUCA 2DGYA 1LTBD 1CHPD 3IFDA 4B08A 4E6IA 3MA2B 1HNWL 3FMCA 4R4OA 1E2WA 3E6ZX 4GLAC 1XNQQ 1PTOB 1I50B 2L1BA 3GTLB 1SYCA 1TIID 4HTHA 2B29A 2ZXOA 3DXJC 4QY7A 5T1IA 2RCNA 3I90A 1Y1WH 2N3SA 3CW2C 1ZEQX 2R92H 3GD7A 1FGBD 4C3HB 4GNXC 4JI4L 3L7ZC 2KVMA 1GUNA 4LUOA 2A1AA 1QZHA 3D6WA 2NVXH 1YZ6A 2F0HA 4MNOA 3S1MH 2M2LA 5C44B 5JVG3 3P75A 1VQCA 4JBJA 4RFBA 4EGVA 3GDEA 2VUMG 3UDGA 4YWLA 4WFN3 1L1OB 1EWHA 1NNXA 1WTOA 3A8IE 1JJGA 2I46A 2RDGA 4U673 4RCOA 5JJIA 2NVQH 3MEFA 1CHQD 3FHWA 2R92B 3TEHB 4EQOA 2E2IB 3CQZB 1STGA 3SR1A 3V96A 3H3VC 1LTTD 3EA6A 3GTGB 3J7AV 2D2CC 3S1MB 4PMBA 4DU9A 5EPKA 2ICIA 2Z6KC 3QO2A 2Z4HA 4KD3A 1E1OA 5KNCA 1OXXK 3EVQA 5J3BA 2IWHA 1EQRA 3GV6A 4J1MA 2RHSB 4C3IG 4ULLA 4J6HA 4R8IA 1PRTF 4NP5A 4LFCL 1CK1A 1SYDA 3MEHA 4EQ5A 2XN9C 5CGKA 1YJ9A 4NXMQ 1TS5A 4ME3A 1HZ9A 2BDNA 1EOTA 4M8AA 2PW5A 3TN2A 1FJGQ 5IYBH 2QEXA 2K03A 1QWYA 2FXQA 4JI1L 1BOSA 1STEA 4R1JA 1N9WA 4KMUC 3TRZA 2UUCL 2F0OA 5I6WA 1K3BC 1P8LA 3QR8A 1Y8OB 2LMCB 1OXSC 3HOXH 1KNEA 1JR0D 3S16H 1WD0A 1FGUA 4HIMA 4KY6A 2A5HA 1STBA 2JQOA 3EN2A 4DNTB 1VQ5A 3W3AA 3S14H 3D0FA 4RGTA 1TY2A 5JJKA 4AYBE 3A0JA 3U9SA 2EOTA 4OELB 2MO0A 4IJLA 1A2UA 4KTAA 2F0FA 5C0XG 1KD1C 5ELCA 1IXRA 2MP1A 1PFSA 4WRDA 5GAHC 1RJTA 4POFA 3T51B 2JXMB 2F1MA 2ENBA 2MGSA 2Q8IB 3J7YW 4O42A 2BA0A 1NBWA 1JB3A 2VQEQ 1E2ZA 4LF8L 1ICWA 4UPAA 2K1BA 3AEVA 1AW7A 2I5MX 3AYHB 1QNKA 2QGQA 4K2LA 4DR1Q 2E8GA 1PFBA 3LNNA 5ISRA 1ENFA 4CDEC 2QCPX 4IFDH 3HOZH 4JCVE 3U50C 3SDZA 2F0PA 1LT5D 2L15A 3V05A 2B2WA 1SNPA 1I4XA 1I4HA 4A3FB 1FL0A 1FD7D 2B2TA 4XQJA 2NZOA 3A55A 3NWTA 4XYOA 4QUFA 2RVLA 1BBWA 2GVAA 4A93H 4AYBG 2RHQB 5IE8A 3GTQH 1JWUD 2BOSA 1FYCA 4A3LH 3CPFA 2R93H 1IKMA 4JI4Q 3OIQA 3CKIB 1SFOB 2Z6KA 2UUAL 2CWAA 1TWHB 3A8KE 1V1PA 1LM0A 4DPGA 5IGDA 1A15A 4DAPA 3PO3B 3DWQA 4DFAA 1SMYD 2VNUD 3PUVA 5JEAJ 5CC4A 3T4AC 1XNRQ 1LYLA 3KJOA 2JA6H 1X3PA 2R7ZG 1N32L 4FXKC 4IQZA 1MJEA 1BBUA 1MBYA 2XRQD 3LWUA 5M3FG 2KBNA 3NXWA 1Q82C 4AQYQ 2WINB 1AH9A 1I4GA 1VQFA 1PRTC 2PMZB 1CT1D 3A7AB 5IGBA 4DGZA 4JBWA 1KABA 2WKDA 1G8ZD 4JBMA 1I6HB 1ESFA 4G7OC 4IJHA 4I7AA 3SGIA 5IP7G 3MHBA 4C2MH 4CHTB 3DEPA 1SSOA 4H44C 3DHQA 1AFPA 1S5DD 2BE5D 1XMQQ 2LSSA 2WV6D 3S14B 5IP7H 2HCIA 2VB3X 1QZGA 3Q22A 1D6EC 1STAA 4H02A 1B8AA 3J80E 2E2HB 3I8ZA 3JC66 2MQHA 3NENA 4HSPA 3SHLA 2EYFA 3W5OA 1S72A 4JI3Q 1PV4A 4OONA 1D1IA 2K5QA 2NVTB 3PO2G 1YNXA 4TQUS 1IBLQ 1VQGA 1Z7TA 4DK6C 4A3GG 5IYDH 2JYOA 2R7ZH 2NVYH 4IFDG 1NUCA 1HQRD 3BDLA 1ILPA 3VR5A 2PZTA 2WAQE 3HOWH 1Y1VG 4IUUA 3MFGA 3FPPA 4YHHL 1SE4A 1QOHA 3CCLA 4O2DA 3HOUH 1KQSA 2WB1E 1GKHA 2YU9H 4ZLTF 1PH9A 2YTXA 4WORA 3HOYB 1N34L 2BA1A 3BU2A 4EQNA 2BE5C 5IWAQ 3KDFA 3KUPA 5IY0A 3S2HB 3EJIA 1ZKOA 2Q2HA 1C9OA 2PQEA 5JOBA 4YCVA 4QJFA 1ML0D 4WJ3M 3T1HL 3Q23A 3GTMB 5C4XG 2Q2UA 2I5LX 4L63B 4K5WA 2KQ3A 2L11A 3JAML 3CF5A 1VDZA 4BY7H 1KRSA 2PNRC 2F3VA 1IBMQ 5KNBA 2F0UA 4APVA 5HGQA 2F0WA 5T1GA 4RGOS 2UUBQ 1I4QA 5C0XI 3C1FA 2ZM6L 4HIDA 5G3LF 4G7ZC 3BVGA 4FXGC 4O1NA 1GD7A 4N8FA 2L55A 1N36Q 1HH2P 1QVGA 5I2XA 3CCVA 1QJOA 2Y0SB 3NEMA 3A7LA 2CHBD 5CBEE 3FEWX 2K50A 4B9XA 4A3MG 2JA7G 3GTMH 2RQXA 2TSSA 1PTOC 1HZCA 1LUZA 4YCUA 4KN7C 5LL6X 3FDTA 1D2BA 2KEEA 1PXUA 3RN2A 4LF9L 4KHPQ 3KF8A 4NW2A 3G6JB 3CMAA 5IOCA 3KF6B 1K8MA 5JJLA 1NR2A 4FP5D 2XNAC 3MTSA 3SE0A 4A3BG 3SK8A 3SVMA 1F9RA 2LY7A 1G91A 1JORA 1U4RA 1ENAA 3M4QA 4IO9A 3OTOL 3S17H 3QG1A 1XXGA 4DR2L 1WTPA 1K28A 1YBYA 4KD4A 2UUCQ 1EL0A 1W6KA 5EKLA 1XX8A 3CCMA 3SK4A 3HOVG 2LXJA 1TXYA 2SOBA 4KJOA 3H0GB 1A3UA 1QUQB 4DV4Q 1R9TH 1X65A 5EJWA 1Q7YC 2JEBI 1SJHD 3U4ZA 2ZXRA 1RTOA 3F8TA 1YNNC 1EFWA 1JWMD 4DK1A 2KHIA 1W3SA 4KKUA 5IWAL 3J7AF 1QE6A 4LFCQ 5E1FA 2AQ3B 1BCPD 1DOMA 4WJWA 5IYCH 3U9OA 5G3LD 1MIUA 2Z0SA 4JI8L 5M5YB 1N33L 2B2WC 1JCKB 2NN6G 2OEOA 1IW7D 1SE8A 2E76C 2XWBB 5EBCA 1SYFA 2EXDA 5CORA 1HRJA 2Z8LA 1I50H 3CCEA 4HN7A 1B1ZA 5FOBB 1OXTA 1KL9A 1RL2A
chains in the Genus database with same CATH topology
4RWSC 1SYGA 1FR3A 1H9SA 4K8JA 4DF7A 3NWSA 2B2VA 1ZXTA 3TDQA 2JSOA 1CTMA 3MWYW 1H9RA 4TSSA 2RSOA 5JVH3 2QKIC 4RHRA 1RTNA 3KBGA 4ZUIA 1RKNA 2HQEA 5DNFA 4QB4A 4KHVA 4GZYC 1SXTA 1HA5A 2NB0A 4C3JG 2A69D 3IL8A 3TZDA 1O78A 4ZK9B 2JP1A 2J4XA 5KEEA 2NN6H 3FPUB 1B4OA 1A6XA 3MVVA 4EVOA 1EZ6A 1IKLA 1T5EA 2AQ2B 2F4IA 1B9MA 1PTOH 3S15B 5M3FB 1RHPA 1EIGA 1V8QA 1O7LA 2QILA 1O7YA 4C3IB 1VF5C 1TKWB 5C3XA 3GTOB 2XSCA 1GUSA 5C0XJ 2R6GA 2B2UA 3BYTB 2PO4A 2K32A 2JA5B 5FO7B 4RHSA 4S3SA 1GUTA 1SYBA 3PUYA 1BDOA 1UAPA 3R93A 4PV1C 4X3SA 1LTAD 5CMDA 1NR4A 1O7ZA 3BDOA 1CFMA 1ESRA 4LMQD 2F0IA 5A2QE 1H9MA 1SMYC 2PZWA 4FXDA 4JK1C 5BN4A 3WOFA 3TP8A 2WKCA 3HS0C 1XYIA 2AQ1B 4BA2I 3DWAA 2F0VA 1GJXA 2DN8A 1J9OA 1RDPD 2WACA 5I9OA 2JA7B 4HMIA 2PPBC 5JPNC 1HCZA 4Z9CB 4A93B 3TSSA 4XXEA 2YU9B 4L6TB 4ZUJA 4RA8A 2OF1A 1LTID 1F9SA 1EY0A 1NCVA 4AYBB 4ZQ3A 3K58A 3MC0B 1DOKA 4NKLA 1S5BD 5C6AA 3I72A 1SNQA 4BY7B 2F0QA 1CQFA 2FINB 2IX0A 3NTKA 5BN3A 1EU4A 1EYDA 1X3QA 3D31A 4KKSA 1GHKA 2RBMA 2EY5A 4FYDA 5FLXL 4OO1G 3I4LA 2QEJC 4TRDA 5ELDA 4OGQC 2O4XA 4ILWA 4KHZA 4I65A 2B2YC 4MHEA 3KLRA 1LT6D 1WTWA 3I91A 4NMZA 1LT4D 2D62A 2KCCA 5JPMC 4CJ2C 3HOXB 3TP5A 3S2DB 3EQLC 2I07B 3VYRA 3QB3A 1SEBD 2WIIB 4R9WA 1Y8NB 2VXWA 5LL6S 1PLFA 1DM0B 2A68C 2DY7A 3C2PA 3I3CA 1HFNA 3PO2B 1S5FD 4HSVA 3QOLA 5E4WC 4KN4C 4F87A 3S1RB 3MXPA 3PV0A 1Y8PB 1OXVA 1K8OA 1Y1VB 3OMGA 1WCMB 1HA6A 2L5TA 5K5PA 5C4JB 1A2TA 4K5VA 3BYYB 1PYWD 4DN4M 3K5NA 1LTRD 1BR9A 3IAYA 1DOLA 4K5XA 1S4ZA 3NQTA 3N52A 4QIWB 4OIJA 2E2DC 3H09A 1OO9B 1I4RA 1GHJA 1E0BA 1PDQA 4RGMA 1Y1WB 4PMWA 5M9OA 4FF4A 2AUKA 1BCPB 2EYJA 4F7XA 1YNJD 4K8IA 2LKVA 2NVXB 3GTPB 1O80A 5IGFA 4A3BB 4HMJA 3SEBA 4IZ8A 2ZXPA 1BF4A 2F0KA 2F3WA 2D9UA 4BWGB 4H7BA 4RKBA 3ZYYX 3VR6A 1Z47A 2B2YA 4F8MA 2OXPA 3DUZA 4C2MB 3CRKC 5KRUA 2K5DA 1WD1A 2C9OA 2B2UC 4M1UB 2JA8B 4K2KA 1AZQA 5CV8A 3VR2A 1U4MA 1S5CD 4R8NA 1AEXA 3K6OA 5I4DA 1BNZA 3D8GA 2KJXA 5A35A 1KDBA 2KCNA 4RAUC 1B44D 3LWEA 1DYQA 1XWEA 4A3DB 2LFNA 1SDFA 4ME5A 1V1OA 3ND9A 2F0MA 2ID0A 1SE3A 3OWEB 4HAEA 2N88A 1YNND 3OIPA 2R7ZB 3J80L 3S17B 3A54A 3E5SA 2D5DA 3FRPB 4QMGA 2E75C 3HOWB 2QF7A 3OPOA 4XYQA 1FNVA 5IIFA 5EKKA 5C3WA 1CA6A 1R9TB 3WOEA 3NBHA 4C1NK 3H6MA 1B53A 1STNA 5IT9L 3RUZA 5EQ0A 2M00A 5DM63 4H0LC 1WTVA 5ELBA 4CJ0B 2B2TC 2A6HC 1AP0A 2HCCA 2BDOA 1BCPF 2NYZD 4CKCA 1F2MA 1SJED 1PZKD 2B8GA 1TWFB 2EXZA 2K04A 3DEOA 4H13C 1NSNS 2EYPA 3M4OB 2AWNA 1IHZA 3HRZC 3D4WA 5HURA 2LS01 5D3IB 5FLXE 1I4PA 1XTCD 3JAME 1Q90A 2R3ZA 1LTGD 1KAAA 5C0XH 2F0LA 3M4YA 5KIXA 4ZKCB 1LO5D 5D3DA 1J8IA 2Z4IA 5E4XA 4ABNA 1H9KA 1BBXC 3NBIA 2Q8RE 1D1KA 4G57A 5I6YA 1G6ZA 1L0YB 4CKBA 3K0YA 3M7NA 1LABA 3ND8A 1VMPA 5EPJA 2FMCA 3S16B 1SNOA 3RLFA 1U4PA 1G2TA 4EQPA 1KLGD 3K7AB 2L9HA 1E2VA 1LT3D 4UAIA 2B63B 5FO8B 4ZAIA 3O13A 5I9PA 2NTTA 3D6CA 3KBXA 3R3OA 4IUPA 4K6LA 1HQMC 3VYTA 1MD2D 3OWFA 2DY8A 2IX3A 2A73B 4LAAA 1IL8A 4IFDJ 1C8CA 3FVQA 1UUPA 3IFTA 3TP6A 4CJ1B 1Q8IA 4XIGS 2X6LA 5E3FA 2O5IC 4KI0A 4XQNA 5EBDA 2XIWA 3VA7A 1VF7A 2NTSA 2XVSA 1F2LA 1EZ8A 5COYA 3NTIA 2CVRA 1Q1EA 1F9QA 4KKTA 1JWSD 3URYA 3SXHA 3BZDB 1H9JA 4DXFA 1STYA 1DZ1A 3CU7A 4OIKA 3TZUA 1QG7A 1VMCA 2F0TA 1JQYD 4KY7A 2A68D 4DK0A 4BBRB 2RDHA 4ID6A 2B39A 1B3AA 3LX0A 4BBSB 2Q8TA 2VUMB 4HEDA 3N6RA 4TKOB 5EKIA 2H4OA 3SK5A 3NK9A 2IX1A 3NQIA 1B50A 2RKSA 1EU3A 4G7HC 2ICEC 2K28A 1G291 2F0NA 3BVZA 2KECA 5IGCA 3R2IA 2J0TD 2B2VC 4C3JB 3S1QB 5KGUA 2M9VA 4C1NI 2FFKB 3T13A 1LV9A 1EIHA 1ILQA 3ITPA 3GO5A 4IALA 1LACA 2SNSA 4XTCS 1ZYRC 3GTQB 2K05A 3HP3A 1BCPC 1U4LA 5J39A 2EZVA 3VA5A 1Q12A 3QOJA 3H91A 2IT1A 2L0CA 2NN6I 3GQBA 4HCEA 3HGBA 5C4ZA 1IW7C 2WAQB 4V0BA 2H1EA 4YIJA 4DNRB 2PYKA 3BS1A 3I4NB 2F0DA 3NPPA 2GA4B 3VR4A 3CRLC 4DA2A 2O5JC 2NZ1D 3HKZB 3AU7A 2ZT9C 2A6HD 4NDXA 1H9SB 2EY6A 1V43A 1EY4A 3C1EA 4BS9A 1KDCA 3L3OC 3PUXA 1TWCB 5LHY1 2EJGC 2K6AA 1ZYRD 4MN3A 3H94A 2NWGA 3KLSX 1A3VA 1QCBD 1PTOD 1F2YA 1C4QA 2KEDA 4DXGA 1WVLA 1BXTA 3Q0AA 1EQTA 5D14A 2EDGA 1QNUA 4OL7A 1EYCA 1M8AA 1PZID 1PFMA 3PIP3 1HUMA 5I2YA 3T56B 3P20A 4A3MB 1IYVA 1EY9A 1G2SA 2K01A 3MFYA 3OHXC 2R93B 5C4HA 4CKEA 1DONA 1TQOA 3SK6A 4KJNA 5CBAE 5DEHA 4X3UA 1EY5A 4MIUA 5K36H 4F88A 1K83B 3T16A 3M7GA 4HR7B 4LJZC 4RCNA 3W2DA 5CYUA 1BO0A 2RA4A 5C5LA 1Q3LA 2FHTA 4ODGA 4X3KA 3GTJB 1JE4A 4ZKBB 1MI2A 5IGEA 3RD4A 5C5MA 2NVQB 1R4QB 1R4PB 4FO2A 3BDCA 1F2ZA 4N9PA 4Y7NB 3X3MA 2O2LD 1EEID 2CW0C 3P1HA 1PMRA 3OSOA 1B9NA 4X3TA 4A3GB 3K5MA 2R61A 2FMMA 2K7VA 1W6JA 4XDXA 1AN8A 1GOZA 1ENCA 3A56A 1KLUD 3J81L 3PUZA 4PMCA 1B2TA 1T5XD 4XT1B 5JJZA 1UEAB 1JOOA 1HFGA 3G7LA 1HUNA 3S1NB 4ZYSA 5FKAC 3OMCA 1TS3A 3J81E 2F0SA 3MXUA 1TWAB 1S5ED 2K5WA 5CV9A 1EFID 5J1ZA 3RZOB 1HTLD 3IKJA 3D3RA 4UDUC 3PUWA 1F9PA 2WP8J 3A8JE 1JOKA 5JEAH 4A3EB 5FK9C 4FNFA 2HDLA 1X32A 4IFDI 1PRTD 4QF4A 2CQAA 3GV3A 1HHVA 3R8BA 3AMUA 4V190 3BVMA 2A69C 2EVBA 1WTXA 2VB2X 3QJYA 3R2TA 2EY1A 3C3LA 2G9DA 2IJ0A 1QB5D 3D4RA 3MXGA 1TU2B 1EY8A 1Q1BA 1RODA 1EQVA 3HEJA 1TS2A 1FNUA 4IURA 2K33A 2L4NA 2HUGA 3BG3A 4RH6A 3VYSA 2F0EA 2EYMA 1JOQA 4IUTA 2IL8A 1RCVD 3VYUA 2BCOA 1MSHA 5IODA 1BQQT 1MGSA 2JA6B 2J7ZA 5CV5A 3E0JA 2F0JA 3D4DA 3TMEA 2PZUA 1Z6HA 1ET6A 1D5ZC 3NE5B 2N55A 3NSWA 2JE6I 3P7JA 3Q6SA 3OW7A 3C46A 4OHJA 1BUVT 4QUCA 4A3JB 2EPBA 3V2TA 5KYLA 4ZRZA 5K36G 1CQVA 1GXDC 1HPCA 2AWOA 1DJRD 4FF1A 3GTKB 3K57A 4RGNA 5M3MB 1DCZA 3DM1A 5C4XB 4HCSA 2TMPA 4U68A 3RMHA 4A3KB 1IYUA 4Q0FA 3EFXD 1HTPA 5ELEA 2NVYB 4LK1C 3HOZB 2RDFA 2KOLA 5JEAG 5AFWA 3OOCA 2EY2A 5DM73 1DD2A 2B8FA 1NAPA 2HDMA 4RKLA 1II3A 5D65A 1YNJC 4DAYA 2YYZA 3M3YB 5EGTA 2KHSA 1A3TA 3FKIB 2PW7A 4K14A 2OT2A 5CR3A 4C56C 1MSGA 1LTSD 1SNMA 3TBIB 5IGGA 1CI3M 3I4MB 5F2DA 3UI2A 2CW0D 1UNSA 4C3HG 5HGTA 3WDNA 5C3EB 1TR5A 5CV4A 4K6DA 4OO1H 2A74C 2MJ8A 1D5XC 4FF2A 2G9HD 2SNMA 3ONAB 2EYHA 1EWCA 4BA1I 1KNAA 1WTQA 1TT2A 5A2QL 1VCIA 4IUQA 2RSNA 4CBVA 3QWNA 3VR3A 2WB1B 2JEAI 5EPLA 1C48A 1GUGA 4J8QA 1SBBB 2KUMA 2DNEA 4FVMA 4G4KA 3T53B 1EY6A 2EYOA 3EROA 1OXUA 2A6EC 3HOVB 1SE2A 1LLRD 3PIO3 1AZPA 4I7ZC 4L8JA 1ONLA 2V4DA 5IT9E 4IUVA 4BY1B 5CV7A 1EEFD 4OO1I 1HXYD 5FO9B 4QCLA 1TWGB 5JAVA 3KLSA 3L9AX 1GUOA 5NUCA 3K59A 1JC7A 3K5OA 1SNDA 3X3NA 4KY5A 1PZJD 4XQQA 1JICA 3HG9A 3MXNA 3RZDB 1FNWA 3Q24A 1KTKA 2DNCA 2X69A 1STHA 2C5CA 5ELFA 3MZ5A 1CM9A 3KK7A 3DMUA 2NBFA 1CZWA 1CA5A 3HOUB 1PTOF 2EJFC 2Z1CA 5CV6A 2IW3A 1U9RA 1SAPA 2EYLA 1PRTB 2FJ2A 4P2CB 1PFNA 3MAQA 1D5MC 2KA7A 2XWJB 3TP7A 3CHBD 3M85A 2PCFB 3I73A 2F0GA 5KYIA 3F2UA 3HZXA 4IUNA 1I6VC 4XT3B 3ERQA 5TSSA 1TS4A 1I3QB 2MUYA 4IN3A 3QIAA 1V1PB 2XRSD 5J22A 2F03A 2QDBA 5M5WB 4DAVA 4Q5VA 4KK7A 4A3IB 1EY7A 2L12A 1GUWA 1QILA 2NUCA 3NP8A 1WTRA 1M4VA 1SYEA 3NHHA 2IPKD 1Y69U 2E74C 4CGYB 2MHVA 3AB9A 1RF2D 2SEBD 2EJMA 1CZGA 4N9TA 3I70A 3S9WA 2E2JB 5KNDA 1KDAA 1SNCA 3NTHA 3K5LA 5DAUA 1RD9D 2EE1A 4FF3A 5M5XB 2SDFA 4B9WA 2A6ED 1L0XB 1DXMA 2X6GA 1TY0A 4PQXA 1F77A 3DWPA 1ET9A 1EYAA 1TVXA 4KV6A 2AUJD 2MPMA 3GP7A 3PMFA 5BN5A 4PNYA 3NUCA 1LTBD 1CHPD 3IFDA 4B08A 4E6IA 3MA2B 3FMCA 1E2WA 3E6ZX 1PTOB 1I50B 2L1BA 3GTLB 1SYCA 1TIID 4HTHA 2ZXOA 3DXJC 5T1IA 3I90A 1ZEQX 3GD7A 1FGBD 4C3HB 3L7ZC 2KVMA 1GUNA 3D6WA 2F0HA 2M2LA 5C44B 5JVG3 3P75A 4RFBA 4EGVA 4WFN3 1EWHA 1WTOA 3A8IE 2I46A 2RDGA 4U673 4RCOA 1CHQD 2R92B 4EQOA 2E2IB 3CQZB 1STGA 3SR1A 3V96A 3H3VC 1LTTD 3EA6A 3GTGB 3J7AV 2D2CC 3S1MB 4PMBA 4DU9A 5EPKA 2ICIA 3QO2A 2Z4HA 4KD3A 5KNCA 1OXXK 3EVQA 2IWHA 3GV6A 4J1MA 4C3IG 4ULLA 4J6HA 4R8IA 1PRTF 4NP5A 1CK1A 1SYDA 3MEHA 2XN9C 5CGKA 1TS5A 2BDNA 1EOTA 4M8AA 2PW5A 3TN2A 2K03A 1QWYA 1BOSA 1STEA 4KMUC 2F0OA 5I6WA 1Y8OB 2LMCB 1OXSC 1KNEA 1JR0D 1WD0A 4KY6A 2A5HA 1STBA 4DNTB 3W3AA 4RGTA 1TY2A 3U9SA 2EOTA 1A2UA 4KTAA 2F0FA 5C0XG 5ELCA 2MP1A 4WRDA 1RJTA 3T51B 2JXMB 2F1MA 2ENBA 2MGSA 2Q8IB 3J7YW 4O42A 2BA0A 1JB3A 1E2ZA 1ICWA 2K1BA 1AW7A 1QNKA 4K2LA 1PFBA 3LNNA 5ISRA 1ENFA 2QCPX 4IFDH 3V05A 3SDZA 2F0PA 1LT5D 2B2WA 1SNPA 1I4XA 1I4HA 4A3FB 1FD7D 2B2TA 4XQJA 3A55A 3NWTA 4XYOA 4QUFA 2RVLA 1JWUD 2BOSA 1FYCA 1IKMA 3OIQA 3CKIB 1SFOB 1TWHB 3A8KE 1V1PA 5IGDA 1A15A 4DAPA 3PO3B 3DWQA 4DFAA 1SMYD 2VNUD 3PUVA 5JEAJ 5CC4A 3T4AC 1X3PA 4FXKC 4IQZA 1MBYA 2XRQD 3LWUA 3NXWA 2WINB 1I4GA 1PRTC 2PMZB 1CT1D 3A7AB 5IGBA 4DGZA 4JBWA 1KABA 2WKDA 1G8ZD 1I6HB 1ESFA 4G7OC 3MHBA 4CHTB 3DEPA 1SSOA 4H44C 3DHQA 1AFPA 1S5DD 2BE5D 2WV6D 3S14B 2HCIA 2VB3X 3Q22A 1D6EC 1STAA 3J80E 2E2HB 3I8ZA 4HSPA 3SHLA 2EYFA 1D1IA 2K5QA 2NVTB 4TQUS 1Z7TA 2JYOA 4IFDG 1NUCA 1HQRD 3BDLA 1ILPA 3VR5A 2PZTA 4IUUA 3MFGA 3FPPA 1SE4A 1QOHA 4ZLTF 4WORA 3HOYB 2BA1A 4EQNA 2BE5C 3KUPA 3S2HB 3EJIA 1ZKOA 2PQEA 5JOBA 1ML0D 3Q23A 3GTMB 4L63B 2KQ3A 4K5WA 2L11A 3JAML 1VDZA 2PNRC 2F3VA 5KNBA 2F0UA 2F0WA 5T1GA 4RGOS 1I4QA 5C0XI 3C1FA 5G3LF 4G7ZC 3BVGA 4FXGC 4O1NA 2L55A 5I2XA 1QJOA 2Y0SB 3A7LA 2CHBD 5CBEE 3FEWX 4B9XA 2RQXA 2TSSA 1PTOC 4KN7C 5LL6X 3FDTA 1D2BA 2KEEA 1PXUA 3KF8A 4NW2A 3G6JB 5IOCA 1K8MA 1NR2A 4FP5D 2XNAC 3MTSA 3SE0A 3SK8A 3SVMA 1F9RA 2LY7A 1G91A 1JORA 1U4RA 1ENAA 3QG1A 1XXGA 1WTPA 4KD4A 1EL0A 1W6KA 5EKLA 1XX8A 3SK4A 2SOBA 4KJOA 3H0GB 1A3UA 5EJWA 2JEBI 1SJHD 2ZXRA 1RTOA 1YNNC 1JWMD 4DK1A 4KKUA 3J7AF 1QE6A 5E1FA 2AQ3B 1BCPD 1DOMA 4WJWA 3U9OA 5G3LD 5M5YB 2B2WC 1JCKB 2NN6G 2OEOA 1IW7D 2E76C 2XWBB 5EBCA 1SYFA 5CORA 1HRJA 2Z8LA 4HN7A 1B1ZA 5FOBB 1OXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYG A;  1EY9 A;  3D6C A;  1EYA A;  3RUZ A;  3T13 A;  3R3O A;  4KV6 A;  4DFA A;  4K8J A;  4DF7 A;  2SNM A;  2F3V A;  2M00 A;  3ITP A;  2F0U A;  4TRD A;  5CV9 A;  2EYH A;  3V2T A;  5CV6 A;  2F0O A;  5C4H A;  2F0W A;  3OWF A;  3PMF A;  5J1Z A;  5I6W A;  5KYL A;  4IAL A;  1TQO A;  1TT2 A;  2O4X A;  1U9R A;  3SK6 A;  2EYL A;  3C1F A;  4LAA A;  4PNY A;  5M9O A;  4KJN A;  4I65 A;  2SNS A;  2F0I A;  5DEH A;  3NUC A;  2EYJ A;  1EY5 A;  4F7X A;  3NXW A;  3TP7 A;  1F2M A;  4MIU A;  4ZUI A;  1RKN A;  2HQE A;  1JOK A;  2PZW A;  4K8I A;  3TP6 A;  4KY6 A;  4E6I A;  1STB A;  5IGB A;  4DGZ A;  2F0G A;  1KAB A;  2EXZ A;  2LKV A;  4KHV A;  4QB4 A;  5KYI A;  3T16 A;  5J39 A;  3HZX A;  5CC4 A;  4IUN A;  3VA5 A;  3QOJ A;  5IGF A;  2EYP A;  1NSN S;  4B9X A;  4HMJ A;  1EY6 A;  4NMZ A;  3ERQ A;  5E3F A;  1SYC A;  4HTH A;  3TP8 A;  1IHZ A;  5C4Z A;  2EYO A;  3D4W A;  3ERO A;  4IZ8 A;  5HUR A;  4QF4 A;  5C5L A;  3TP5 A;  1A2U A;  3MHB A;  4KTA A;  2F0F A;  5J22 A;  1EZ8 A;  4ODG A;  4YIJ A;  2QDB A;  2F0V A;  2PYK A;  3DHQ A;  4WRD A;  5IGE A;  2WAC A;  2F0D A;  5KEE A;  2F0K A;  5IOC A;  5C5M A;  2F3W A;  3QB3 A;  5I9O A;  2ENB A;  1KAA A;  2F0H A;  3SXH A;  2F0L A;  3BDC A;  2RDF A;  4HMI A;  1F2Z A;  3MVV A;  3P75 A;  1EY7 A;  4H7B A;  4RKB A;  1STA A;  5CV7 A;  3SK8 A;  5KIX A;  4EVO A;  2EY2 A;  4N9P A;  1EZ6 A;  1STY A;  4NDX A;  1JOR A;  2EY6 A;  1ENA A;  4F8M A;  2EY1 A;  2NUC A;  3SHL A;  2EYF A;  2OXP A;  1EY4 A;  4RKL A;  3C1E A;  5KRU A;  3NP8 A;  3P1H A;  4KD4 A;  1II3 A;  1KDC A;  1SYE A;  3OSO A;  4ZUJ A;  5EKL A;  2OF1 A;  2F0T A;  1EY8 A;  4K2K A;  4K2L A;  4K5X A;  1EY0 A;  3NHH A;  4KY7 A;  5CV8 A;  3SK4 A;  5JAV A;  3QOL A;  2SOB A;  4KJO A;  5EGT A;  4G57 A;  1NUC A;  1A3U A;  4R8N A;  4EQO A;  4ID6 A;  4ZQ3 A;  1AEX A;  3BDL A;  5I6Y A;  1EQV A;  1STG A;  3HEJ A;  3SR1 A;  1A3V A;  2KHS A;  1A3T A;  5ISR A;  2PZT A;  4N9T A;  3D8G A;  3LX0 A;  2PW7 A;  5C3X A;  1ENC A;  4NKL A;  1F2Y A;  5NUC A;  4K14 A;  3S9W A;  1KDB A;  1KDA A;  3MXP A;  5CR3 A;  1SNC A;  1SND A;  4PMC A;  5C6A A;  4PMB A;  4DU9 A;  4KY5 A;  1SNQ A;  2F0P A;  5E1F A;  2F0E A;  3OMG A;  5DAU A;  1SNP A;  1SNM A;  1JOO A;  4ME5 A;  4KD3 A;  2EYM A;  2F0M A;  5IGG A;  3SK5 A;  5K5P A;  1A2T A;  3EVQ A;  1JOQ A;  3TME A;  1SNO A;  3NK9 A;  4J1M A;  2F0Q A;  4K5V A;  4WOR A;  5F2D A;  3U9O A;  3E5S A;  4J6H A;  4QMG A;  4S3S A;  4EQN A;  5HGT A;  2RKS A;  4OL7 A;  1EYC A;  1SYB A;  4B9W A;  5IOD A;  4NP5 A;  4EQP A;  2OEO A;  3EJI A;  1SYD A;  3MEH A;  5CV5 A;  1SYF A;  2F0J A;  1STH A;  1TR5 A;  2F0N A;  1EYD A;  2PZU A;  3D4D A;  3NQT A;  2PQE A;  3OMC A;  4K6D A;  5CV4 A;  5EKK A;  5JOB A;  5C3W A;  5CGK A;  5IIF A;  5IGC A;  2RBM A;  2EY5 A;  2PW5 A;  3MZ5 A;  2F0S A;  4K5W A;  3H6M A;  5KGU A;  5I9P A;  5IGD A;  1STN A;  3DMU A;  2KQ3 A; 
#chains in the Genus database with same CATH topology
 4RWS C;  1SYG A;  5M3M H;  5C4J H;  1FR3 A;  5IP9 H;  1H9S A;  4K8J A;  4DF7 A;  3NWS A;  2B2V A;  1ZXT A;  4DR6 L;  3TDQ A;  2JSO A;  1CTM A;  3MWY W;  2Q2I A;  4X66 L;  4JC0 A;  1H9R A;  4TSS A;  2RSO A;  5JVH 3;  2QKI C;  4RHR A;  1D8L A;  1RTN A;  3KBG A;  4ZUI A;  1RKN A;  2HQE A;  5DNF A;  4A3M H;  2VS1 A;  4QB4 A;  4KHV A;  4DV5 Q;  4GZY C;  1PA6 A;  1SXT A;  1HA5 A;  2NB0 A;  4C3J G;  5M3F H;  2A69 D;  3IL8 A;  3TZD A;  1O78 A;  4BXX G;  4ZK9 B;  2K75 A;  2JP1 A;  3NBH B;  2E2I H;  3CQZ H;  4PZ6 A;  1X56 A;  2J4X A;  5KEE A;  2NN6 H;  1PH5 A;  1K83 H;  1VQ8 A;  3FPU B;  3HKS A;  1B4O A;  2KHJ A;  4DAY B;  1A6X A;  3MVV A;  3FKI H;  4EVO A;  4A3E G;  1NMF A;  1EZ6 A;  1IKL A;  1L1O A;  1T5E A;  2AQ2 B;  2F4I A;  4X6A H;  1B9M A;  1PTO H;  3S15 B;  5M3F B;  2VQF L;  1RHP A;  1EIG A;  1V8Q A;  1O7L A;  2QIL A;  1MKH A;  1O7Y A;  4C3I B;  1WTH A;  1VF5 C;  2B63 H;  1MJC A;  3G48 A;  1TKW B;  5C3X A;  3GTO B;  2XSC A;  3ZJY C;  3ULP A;  1GUS A;  4JI8 Q;  5C0X J;  3NEL A;  2R6G A;  2B2U A;  3BYT B;  2PO4 A;  1OTC A;  3I4N G;  1QVC A;  2K32 A;  2JA5 B;  5FO7 B;  1L2F A;  4RHS A;  4S3S A;  1GUT A;  1SYB A;  3PUY A;  1BDO A;  3KLW A;  4DAM A;  1UAP A;  3I4M G;  1VQM A;  3R93 A;  4C3I H;  4PV1 C;  4X3S A;  5LMU L;  4OX9 L;  4A3D G;  1LTA D;  4AIM A;  1N32 Q;  1D7Q A;  5CMD A;  1NR4 A;  1BVS A;  2K4K A;  1O7Z A;  3BDO A;  1CFM A;  1ESR A;  4LF7 Q;  4LMQ D;  4DV5 L;  2F0I A;  5A2Q E;  1H9M A;  1SMY C;  5BR8 Q;  2PZW A;  1SRO A;  4FXD A;  4JK1 C;  5BN4 A;  3WOF A;  4GKK L;  4A75 A;  3HFZ B;  3TP8 A;  2WKC A;  3IRB A;  3MXN B;  5C3E G;  2E2H H;  3HS0 C;  1XYI A;  5GQO A;  2AQ1 B;  4GN4 B;  1XNQ L;  3T1Y L;  4BA2 I;  3DWA A;  2F0V A;  1GJX A;  2DN8 A;  1J9O A;  1RDP D;  2WAC A;  4A3E H;  1B7Y B;  5I9O A;  2VUM H;  2JA7 B;  4HMI A;  2PPB C;  5JPN C;  4HJ5 A;  1HCZ A;  4K0K Q;  4Z9C B;  4HJ7 A;  2E5L Q;  4A93 B;  1E24 A;  3TSS A;  4XXE A;  2YU9 B;  4L6T B;  1HNZ L;  4ZUJ A;  4RA8 A;  2KCM A;  2MNA A;  4BXX H;  2OF1 A;  1LTI D;  1F9S A;  2H5X A;  1EY0 A;  1NCV A;  3AFQ A;  1GVP A;  4A3J G;  4AYB B;  4ZQ3 A;  5LMN L;  4A3K H;  3K58 A;  2HQL A;  3CCR A;  1HZA A;  3MC0 B;  1DOK A;  2G5D A;  4L5R C;  4NKL A;  1S5B D;  5C6A A;  3I72 A;  1YHB A;  1SNQ A;  3G71 A;  1HJP A;  1A63 A;  4BY7 B;  2F0Q A;  1CQF A;  2FIN B;  4B3M Q;  2IX0 A;  4LW1 A;  4DR7 L;  1E3P A;  4L5S A;  3NTK A;  5BN3 A;  1EU4 A;  1EYD A;  1X3Q A;  1IBK L;  3D31 A;  4KKS A;  1T9H A;  2RBM A;  2EY5 A;  1GHK A;  4CDF C;  2UUB L;  3UE0 A;  4FYD A;  5FLX L;  4AH6 A;  4K0K L;  4OO1 G;  4JI3 L;  1YIJ A;  1WYD A;  3I4L A;  2QEJ C;  4TRD A;  5ELD A;  4OGQ C;  2VZA A;  1W2B A;  2O4X A;  4ILW A;  1M1K C;  4KHZ A;  4I65 A;  3F2C A;  4NXN L;  2B2Y C;  1JE5 A;  1ASZ A;  2VL6 A;  4MTN A;  4MHE A;  3KLR A;  5EAY A;  1LT6 D;  3KJP A;  4DR4 Q;  3K81 C;  4JG2 A;  4CDC C;  4LF9 Q;  3I91 A;  1WTW A;  4NMZ A;  2NVT H;  1LT4 D;  3PO2 H;  2D62 A;  2KCC A;  4RG1 A;  5JPM C;  3K7U C;  3JAM i;  4CJ2 C;  4LFA Q;  3HOX B;  3TP5 A;  3S2D B;  3EQL C;  3K8A A;  2ES2 A;  4X65 L;  4R4Q A;  1L0W A;  2UXB L;  2JA8 H;  2I07 B;  3VYR A;  3QB3 A;  3E9H A;  1SEB D;  4J15 A;  2WII B;  1CKM A;  4R9W A;  2N8N A;  1X9N A;  5FLM H;  1Y8N B;  4A3I G;  1A62 A;  2VXW A;  5LL6 S;  2E2J H;  1PLF A;  1DM0 B;  2A68 C;  2CKZ B;  2DY7 A;  3PGZ A;  5IYD G;  3C2P A;  1IBM L;  3I3C A;  1HFN A;  4A3K G;  4DV7 Q;  3PO2 B;  1S5F D;  1HNX Q;  4HSV A;  3QOL A;  5E4W C;  4FDB A;  2EIF A;  4KN4 C;  1Q86 C;  4F87 A;  3S1R B;  1PH8 A;  4WJ4 A;  1PH6 A;  3HKZ G;  3L0O A;  2KCT A;  4A4I A;  1Q46 A;  3MXP A;  4BY1 H;  3PV0 A;  2I5H A;  1Y8P B;  1OXV A;  1K8O A;  1Y1V B;  3OMG A;  1WCM B;  1HA6 A;  2L5T A;  5K5P A;  5C4J B;  1A2T A;  4K5V A;  3BYY B;  1PYW D;  4DN4 M;  1CKO A;  1VQH A;  1S40 A;  3K5N A;  3CCU A;  3HKZ E;  1LTR D;  1BR9 A;  1TWG H;  1DOL A;  1UEB A;  3AQQ A;  4K5X A;  3IAY A;  1S4Z A;  3NQT A;  3N52 A;  4QIW B;  5FJ8 H;  1XMO L;  2IHE A;  4OIJ A;  2E2D C;  3H09 A;  1OO9 B;  1I4R A;  1GHJ A;  1TWF H;  2ZTC A;  1XTD A;  1PH3 A;  1SN8 A;  1E0B A;  1PDQ A;  2K5N A;  4RGM A;  4MTK A;  1Y1W B;  4PMW A;  5M9O A;  2ATW A;  4FF4 A;  2AUK A;  5LMN Q;  1BCP B;  2EYJ A;  4F7X A;  1YNJ D;  4K8I A;  2K14 A;  1FVI A;  1B3Q A;  2JA9 A;  2LKV A;  2NVX B;  1U5K A;  1M90 C;  1NE3 A;  1WI5 A;  3GTP B;  3I56 A;  1O80 A;  2ASB A;  1YHA A;  5IGF A;  4A3B B;  4HMJ A;  3SEB A;  1XPU A;  4IZ8 A;  2ZXP A;  1BF4 A;  4X64 Q;  4DR3 L;  2A8V A;  3A74 A;  3H0G H;  1NY4 A;  2F0K A;  1EOV A;  2F3W A;  2D9U A;  4BWG B;  3H3V H;  4R4C A;  4H7B A;  4RKB A;  3KOJ A;  3PCO B;  5M3M G;  3ZYY X;  3VR6 A;  2HT1 A;  1Z47 A;  4GOP C;  3JAM c;  2B2Y A;  1VQL A;  4F8M A;  2DUD A;  3ER0 A;  3GTP H;  4BBR G;  2OXP A;  3HOV H;  2ZJR A;  3DUZ A;  4C2M B;  3CRK C;  5KRU A;  2K5D A;  1WD1 A;  2C9O A;  1IYJ B;  2B2U C;  4M1U B;  2JA8 B;  2WAQ G;  4K2K A;  1AZQ A;  5CV8 A;  3VR2 A;  1U4M A;  1S5C D;  4R8N A;  3RLO A;  1AEX A;  3K6O A;  5I4D A;  2DJF C;  3I4O A;  1BNZ A;  3D8G A;  2KJX A;  1Q8K A;  3PIO A;  5A35 A;  4GLX A;  1KDB A;  2KCN A;  4RAU C;  1B44 D;  2GN5 A;  3LWE A;  1DYQ A;  1XWE A;  4A3D B;  2LFN A;  2R7D A;  1SDF A;  4ME5 A;  1V1O A;  3ND9 A;  2F0M A;  2ID0 A;  1SE3 A;  3OWE B;  4LFB Q;  4HAE A;  2N88 A;  1YNN D;  2PMZ E;  3OIP A;  2R7Z B;  3J80 L;  3S17 B;  3A54 A;  3E5S A;  2D5D A;  1AE2 A;  3FRP B;  4QMG A;  4DV1 L;  3S1R H;  4JI1 Q;  2E75 C;  3HOW B;  2QF7 A;  3OPO A;  4XYQ A;  1WCM G;  1FNV A;  4YWK A;  3J81 j;  1PYB A;  5IIF A;  5EKK A;  5C3W A;  1CA6 A;  2D0O A;  4A93 G;  1R9T B;  2OTJ A;  3M4O H;  3WOE A;  3NBH A;  1Y1V H;  4C1N K;  3H6M A;  1B53 A;  1STN A;  4GKJ L;  5IT9 L;  3RUZ A;  4NXM L;  1X6O A;  5EQ0 A;  2R92 G;  4A3D H;  2M00 A;  5DM6 3;  4JI2 L;  4B3T Q;  4H0L C;  1WTV A;  5ELB A;  4CJ0 B;  2B2T C;  2A6H C;  1AP0 A;  2HCC A;  2BDO A;  1BCP F;  2NYZ D;  5M5Y H;  4CKC A;  1F2M A;  1SJE D;  2OQ0 A;  1PZK D;  2B8G A;  1VQ4 A;  3STB C;  1TWF B;  2EXZ A;  2K04 A;  3J80 i;  3DEO A;  4H13 C;  2CH4 A;  1NSN S;  2EYP A;  3J80 c;  3M4O B;  2AWN A;  1IHZ A;  3HRZ C;  3H15 A;  3D4W A;  5HUR A;  2LS0 1;  1VQJ A;  5D3I B;  4B3S Q;  5FLX E;  4YY3 L;  1I4P A;  1XTC D;  4HIO A;  3JAM E;  4B3M L;  1Q90 A;  1RIP A;  1YIT A;  2VQE L;  2R3Z A;  1LTG D;  4N8X 1;  1YHQ A;  1KAA A;  5C0X H;  5LMU Q;  2F0L A;  3M4Y A;  3U58 A;  4L5Q A;  3I55 A;  5KIX A;  4ZKC B;  3BZK A;  4DR1 L;  1LO5 D;  5D3D A;  4BBS H;  1J8I A;  4DK3 C;  2UU9 Q;  3M4P A;  4YWM A;  2Z4I A;  1JB7 A;  5E4X A;  4ABN A;  1H9K A;  2AKW B;  1BBX C;  4A3F H;  3NBI A;  2Q8R E;  1D1K A;  2QDL A;  2R7F A;  4G57 A;  1EYG A;  4NXN Q;  5I6Y A;  1G6Z A;  4LF5 Q;  1CKN A;  1L0Y B;  4CKB A;  3K0Y A;  1E22 A;  3M7N A;  1LAB A;  3ND8 A;  4PZ7 A;  5C44 H;  1VMP A;  5EPJ A;  2FMC A;  4NPS A;  4JOI A;  1SNO A;  3S16 B;  1C0A A;  3RLF A;  1U4P A;  3CXC A;  1V1Q A;  1G2T A;  2ZTE A;  1PYS B;  4EQP A;  1KLG D;  3K7A B;  2L9H A;  1HZB A;  1E2V A;  1LT3 D;  4UAI A;  4DR6 Q;  2B63 B;  5FO8 B;  4ZAI A;  4ZCK A;  3O13 A;  5I9P A;  1Z9F A;  3RLN A;  2UXC L;  2NTT A;  3D6C A;  3KBX A;  5M5X H;  3CCQ A;  3R3O A;  2ZJQ A;  4IUP A;  3G6E A;  4K6L A;  2CQO A;  1HQM C;  3VYT A;  3CD6 A;  1MD2 D;  4GOP B;  1XJV A;  3OWF A;  2UUA Q;  4DV2 Q;  2DY8 A;  2IX3 A;  2A73 B;  4LAA A;  1IL8 A;  3S2D H;  4GKJ Q;  4IFD J;  1MHW C;  1C8C A;  1I5F A;  1CKN B;  3FVQ A;  1UUP A;  3IFT A;  3TP6 A;  4CJ1 B;  1Q8I A;  3G4S A;  4XIG S;  2X6L A;  1TWA H;  2V1C C;  4CDD C;  4X65 Q;  1K9M C;  5E3F A;  4KLK A;  2O5I C;  4KI0 A;  3TRE A;  4XQN A;  5EBD A;  3F2D A;  2XIW A;  3VA7 A;  1VF7 A;  2NTS A;  4JPB W;  2XVS A;  4JYA Q;  1F2L A;  1EZ8 A;  4A3J H;  5COY A;  3NTI A;  2CVR A;  1Q1E A;  1F9Q A;  4KKT A;  1JWS D;  1TWC H;  1K73 C;  1UE5 A;  3URY A;  3SXH A;  2KEN A;  2ZTD A;  4OX9 Q;  3BZD B;  4DV6 L;  1H9J A;  3I7F A;  1IBL L;  3GTK H;  3Q8D A;  4DXF A;  1STY A;  3CCS A;  1JJ2 A;  1DZ1 A;  3CU7 A;  4OIK A;  3TZU A;  3CC7 A;  4C3H H;  1QG7 A;  1VMC A;  2F0T A;  3F1Z A;  1JQY D;  4KY7 A;  2A68 D;  4DK0 A;  4PZ8 A;  4BBR B;  1UE6 A;  2RDH A;  4ID6 A;  1PH4 A;  2C35 B;  2B39 A;  1B3A A;  3LX0 A;  4DV7 L;  2HHH L;  2YV5 A;  4QQB X;  4BBS B;  2Q8T A;  2VUM B;  4HED A;  2JA7 H;  3N6R A;  4DUY L;  3E9I A;  4OWW B;  4TKO B;  3PQI A;  5EKI A;  2H4O A;  3SK5 A;  3J81 c;  3NK9 A;  4JOI C;  2IX1 A;  3NQI A;  1B50 A;  3HOY G;  1A8V A;  2RKS A;  1EU3 A;  4G7H C;  1K3R A;  1K8G A;  1Y14 B;  2ICE C;  4IOA A;  1N8R C;  4NB3 A;  2IY5 B;  2K28 A;  3M9B A;  1G29 1;  1PH7 A;  2F0N A;  3BVZ A;  5IP9 G;  2KEC A;  5IGC A;  3W1G A;  3R2I A;  5FLM G;  1VQ9 A;  1N34 Q;  2J0T D;  2B2V C;  4C3J B;  3S1Q B;  5KGU A;  1X3G A;  2M9V A;  4C1N I;  2FFK B;  3T13 A;  4LUV A;  1LV9 A;  1EIH A;  5ELN A;  1ILQ A;  4UHV A;  3ITP A;  5FJ8 G;  2RCF A;  3GO5 A;  4JBK A;  1XPR A;  1SR3 A;  1FJG L;  1HNX L;  4IAL A;  2F3I A;  4UP9 A;  1LAC A;  2SNS A;  4XTC S;  2UXC Q;  1ZYR C;  2QW7 A;  3GTQ B;  1X3E A;  3GTJ H;  2K05 A;  2VY3 A;  1XPO A;  3HP3 A;  3K0X A;  1BCP C;  1U4L A;  2Z6B A;  4GN5 A;  5J39 A;  2EZV A;  3VA5 A;  1Q12 A;  3VDY A;  3QOJ A;  3H91 A;  2IT1 A;  2L0C A;  2NN6 I;  3GQB A;  4HCE A;  3HGB A;  3BJU A;  4IPD A;  5C4Z A;  1IW7 C;  4GNX A;  4Y7N H;  1IZ6 A;  2WAQ B;  2Y0S E;  4V0B A;  5L37 A;  1KC8 C;  2H1E A;  4YIJ A;  4DNR B;  2PYK A;  3BS1 A;  3I4N B;  1G51 A;  3KF6 A;  1P16 A;  2F0D A;  2PI2 A;  3HOX G;  3NPP A;  2GA4 B;  1KAW A;  3VR4 A;  3CRL C;  3CCJ A;  4LF8 Q;  4DA2 A;  4JYA L;  2O5J C;  2NZ1 D;  5FLX c;  3HKZ B;  3AU7 A;  1YVC A;  2ZT9 C;  2A6H D;  4NDX A;  4X62 L;  1H9S B;  2EY6 A;  2JJQ A;  1V43 A;  1EY4 A;  3C1E A;  3FP9 A;  4BS9 A;  1KDC A;  4DV6 Q;  3L3O C;  3PUX A;  1TWC B;  5LHY 1;  3CME A;  2EJG C;  2K6A A;  1ZYR D;  4MN3 A;  5DLQ E;  3PF5 A;  3H94 A;  2NWG A;  3KLS X;  1N36 L;  1A3V A;  5BR8 L;  4JI7 Q;  1QCB D;  1PTO D;  1F2Y A;  4HIK A;  1C4Q A;  2KED A;  4DXG A;  1WVL A;  1BXT A;  3Q0A A;  5AJ3 Q;  1VQ7 A;  1EQT A;  5D14 A;  4OWT B;  2BH2 A;  5H1S E;  2HHH Q;  2EDG A;  1QNU A;  1HR0 L;  4OL7 A;  1EYC A;  1M8A A;  2YTY A;  1PZI D;  1QUQ A;  3U4V A;  1PFM A;  3PIP 3;  1VQ6 A;  4LFB L;  1HUM A;  5I2Y A;  3AFP A;  3T56 B;  3P20 A;  4A3M B;  1H95 A;  4DV1 Q;  1IYV A;  2OTL A;  1HR0 W;  2F4V L;  2JA6 G;  1EY9 A;  1G2S A;  2K01 A;  2ZJP A;  4LF4 L;  2CFM A;  3H0G G;  3MFY A;  3OHX C;  2R93 B;  5C4H A;  4CKE A;  1DON A;  1EQQ A;  1TQO A;  3SK6 A;  4Y52 H;  4KJN A;  5CBA E;  4P72 A;  4IOC A;  3EBE A;  5DEH A;  3HOY H;  4X3U A;  4O0A A;  1EY5 A;  3H3V I;  4MIU A;  1VQB A;  5K36 H;  4F88 A;  3ERS X;  1PH1 A;  1SRU A;  1K83 B;  3T16 A;  3M7G A;  1NJI C;  3HOZ G;  4HR7 B;  4LJZ C;  4RCN A;  3W2D A;  2VW9 A;  5CYU A;  1BO0 A;  2RA4 A;  5C5L A;  1Q3L A;  2FHT A;  4DV3 Q;  4ODG A;  4X3K A;  4DR4 L;  3GTJ B;  1JE4 A;  4ZKB B;  1MI2 A;  5IGE A;  3RD4 A;  5C5M A;  2NVQ B;  4JV5 Q;  1R4Q B;  1R4P B;  4FO2 A;  3BDC A;  1F2Z A;  4YY3 Q;  2PNH A;  4N9P A;  3GTG H;  2F4V Q;  4Y7N B;  3X3M A;  1J6Q A;  4DKA C;  4UY8 C;  2O2L D;  2I0Q A;  1EEI D;  2CW0 C;  3P1H A;  1PMR A;  3OSO A;  1B9N A;  4LF7 L;  4X3T A;  4A3G B;  4X66 Q;  3K5M A;  2R61 A;  4X62 Q;  2FMM A;  1BKB A;  2K7V A;  4AQY L;  1W6J A;  4XDX A;  1AN8 A;  1GOZ A;  1ENC A;  2Q2T A;  3A56 A;  1KLU D;  3PUZ A;  3J81 L;  4PMC A;  1B2T A;  2PQA B;  1T5X D;  2B63 G;  4XT1 B;  1UE7 A;  5JJZ A;  1UEA B;  1JOO A;  1V9P A;  1HFG A;  3J7Z C;  4DV3 L;  3G7L A;  3T1H Q;  2GVB A;  1HUN A;  1JJC B;  4A76 A;  3S1N B;  2WFW A;  4ZYS A;  2UXB Q;  5FKA C;  3OMC A;  1TS3 A;  3J81 E;  2F0S A;  3MXU A;  1S3O A;  3PIP A;  3I2Z A;  1ICF B;  2UU9 L;  4B3R L;  1TWA B;  4JI0 Q;  1S5E D;  2K5W A;  5CV9 A;  1EFI D;  5J1Z A;  5IYC G;  3UDI A;  3RZO B;  1HTL D;  3PSI A;  3IKJ A;  5HY6 A;  3D3R A;  4UDU C;  1ASY A;  3PUW A;  4LF6 Q;  4P75 A;  1F9P A;  2WP8 J;  3A8J E;  1JOK A;  5JEA H;  4A3E B;  5FK9 C;  2EQS A;  4FNF A;  4BBS G;  5C44 G;  2BH8 A;  4R4T A;  1PVO A;  2HDL A;  3S15 H;  1X32 A;  3E0E A;  4KHP L;  4IFD I;  4BY1 G;  2CCZ A;  1G6P A;  1PRT D;  5IT9 c;  3CP0 A;  4QF4 A;  2CQA A;  3GV3 A;  1HHV A;  1SMX A;  2AMC B;  3R8B A;  3AMU A;  2CWP A;  4V19 0;  4GKK Q;  3BVM A;  2A69 C;  2EVB A;  2IHF A;  1WTX A;  1EIY B;  1K0R A;  2RF4 A;  4DR7 Q;  3RZO H;  2VB2 X;  2UXD Q;  3QJY A;  4BBR H;  4JI6 L;  4DR5 Q;  1E7Z A;  4L5T A;  3R2T A;  2EY1 A;  3C3L A;  2G9D A;  1X3F A;  1X55 A;  2IJ0 A;  1QB5 D;  4JI0 L;  4IPH A;  3D4R A;  3FKI G;  3GTL H;  3MXG A;  4JI2 Q;  1TU2 B;  5M5W H;  4OEM B;  1EY8 A;  1Q1B A;  1ROD A;  3I4M H;  1GO3 E;  1PHJ A;  2E5L L;  1EQV A;  3HEJ A;  4DR2 Q;  1TS2 A;  2K52 A;  1HNZ Q;  1VQP A;  2B3G A;  1FNU A;  4IUR A;  2K33 A;  2L4N A;  2HUG A;  1JT8 A;  3BG3 A;  4RH6 A;  1TWH H;  2F0E A;  3VYS A;  4C3J H;  2XTI A;  3S1Q H;  2EYM A;  3PO3 H;  4PG3 A;  1IBK Q;  3ICE A;  4POG A;  1JOQ A;  2HD3 A;  1GM5 A;  4IUT A;  2IL8 A;  1RCV D;  3VYU A;  2BCO A;  1MSH A;  5IOD A;  1BQQ T;  2N49 A;  1MGS A;  1EUJ A;  2J7Z A;  3UDX A;  1WFQ A;  5CV5 A;  2JA6 B;  3E0J A;  2F0J A;  3D4D A;  3TME A;  2UXD L;  2PZU A;  1Z6H A;  3A5Z B;  5E7N A;  2CH4 W;  1ET6 A;  1D5Z C;  3NE5 B;  2N55 A;  3NSW A;  1C7Y A;  1N33 Q;  2JE6 I;  3P7J A;  3Q6S A;  3OW7 A;  4A3C G;  3C46 A;  4MZ9 A;  4JI5 L;  4OHJ A;  1BUV T;  5GRO A;  4QUC A;  4A3J B;  2EPB A;  3V2T A;  5KYL A;  4ZRZ A;  5K36 G;  2JA8 G;  2PI2 E;  1CQV A;  3OW2 A;  1GXD C;  2JA5 G;  1KXL A;  1HPC A;  1WOC A;  2AWO A;  1SLJ A;  4DV0 L;  4DV4 L;  1DJR D;  1YJN A;  4IPG A;  1XNR L;  4FF1 A;  3GTK B;  3K57 A;  4RGN A;  5M3M B;  3J81 i;  1AE3 A;  1DCZ A;  3DM1 A;  5C4X B;  3TQY A;  2HIV A;  4HCS A;  5AJ3 L;  2F52 A;  3M3Y H;  2TMP A;  1KRT A;  4U68 A;  3RMH A;  4A3K B;  1IYU A;  1VQK A;  2MO1 A;  3A5U A;  4Q0F A;  3EFX D;  1HTP A;  1J5E L;  5ELE A;  3CPW A;  2NVY B;  4LK1 C;  3HOZ B;  2RDF A;  3EIV A;  2KOL A;  5JEA G;  5AFW A;  2HIX A;  3OOC A;  2EY2 A;  2Y0S G;  5DM7 3;  1DD2 A;  1K0S A;  5LMN W;  2JK8 A;  4B3R Q;  2B8F A;  1NAP A;  2HDM A;  4RKL A;  1Q81 C;  4LF4 Q;  1VS0 A;  2A19 A;  3F2B A;  1II3 A;  5C3E H;  4YHH Q;  5D65 A;  1YNJ C;  1CSQ A;  4DAY A;  2YYZ A;  4LUZ A;  3M3Y B;  1E1T A;  1UWV A;  5EGT A;  1KHI A;  3CC4 A;  1NTG A;  2KHS A;  1A3T A;  3FKI B;  1DGS A;  2PW7 A;  2QA4 A;  4HJA A;  4IPC A;  2K5H A;  4K14 A;  4GS3 A;  2OT2 A;  5CR3 A;  1HR0 Q;  4C56 C;  3DM3 A;  3W1B A;  1MSG A;  1LTS D;  1SNM A;  3TBI B;  4GOP A;  3KYH C;  4JI7 L;  5IGG A;  1CI3 M;  4LFA L;  3I4M B;  5F2D A;  2DJG C;  3UI2 A;  2CW0 D;  2NZH A;  1UNS A;  4C3H G;  5HGT A;  3WDN A;  5C3E B;  2OCE A;  1YI2 A;  4QL5 A;  4JI5 Q;  1TR5 A;  1U0L A;  5CV4 A;  4K6D A;  4OO1 H;  2A74 C;  2MJ8 A;  1VQD A;  4DV2 L;  1D5X C;  4FF2 A;  3RR5 A;  2G9H D;  2JA5 H;  2SNM A;  4QIW E;  1X54 A;  2VQF Q;  3ONA B;  2EYH A;  1EWC A;  3I4N H;  4BA1 I;  1KNA A;  1I3Q H;  3K7A H;  2PQA A;  1TT2 A;  5A2Q L;  1VCI A;  1WTQ A;  4BY7 G;  4IUQ A;  2RSN A;  4CBV A;  3K80 C;  3WWV A;  3QWN A;  3VR3 A;  2WB1 B;  2JEA I;  5EPL A;  3DLL A;  1C48 A;  1JMC A;  4ALP A;  1GUG A;  4J8Q A;  2ALY B;  1SBB B;  3T1Y Q;  1SFO H;  2KUM A;  2DNE A;  3CAM A;  4FVM A;  4G4K A;  4DUY Q;  4P74 A;  3T53 B;  1IL2 A;  1EY6 A;  4DV0 Q;  4UP8 A;  2EYO A;  3ERO A;  1OXU A;  2A6E C;  3UDF A;  3HOV B;  1QVF A;  4OXP A;  1SE2 A;  1LLR D;  3PIO 3;  1AZP A;  4I7Z C;  4L8J A;  1Y1W G;  4DUZ L;  4GN3 B;  1ONL A;  2V4D A;  5IT9 E;  2Z9H A;  4IUV A;  4X64 L;  4BY1 B;  5C4X H;  5CV7 A;  1I94 L;  1EEF D;  5ELO A;  1PH2 A;  5IYB G;  3OYY A;  2WB1 G;  4LNQ A;  4JV5 L;  4OO1 I;  3UE1 A;  1HXY D;  4P73 A;  5FO9 B;  4QCL A;  2ZM6 Q;  1TWG B;  2LXK A;  5JAV A;  3KLS A;  3L9A X;  1VQI A;  1B70 B;  1GUO A;  1VQN A;  1HNW Q;  5GAE C;  2MFI A;  3S24 A;  5NUC A;  4P71 A;  3K59 A;  3KFU A;  1JC7 A;  2OWO A;  3K5O A;  1SND A;  3X3N A;  4KY5 A;  1PZJ D;  4XQQ A;  1JIC A;  3L2P A;  3HG9 A;  3MXN A;  4EX5 A;  5GAG C;  4GNX B;  4R4I A;  4B3S L;  3RZD B;  1FNW A;  3Q24 A;  1KTK A;  2AHO B;  2DNC A;  1XMQ L;  2X69 A;  1J5E Q;  1STH A;  3B6Y A;  3CC2 A;  2C5C A;  4JW0 A;  5ELF A;  3MZ5 A;  4DR5 L;  1CM9 A;  3KK7 A;  1L1O C;  4OWX B;  3DMU A;  4JVZ A;  4LWC A;  2NBF A;  1CZW A;  3STB D;  4QGU A;  4HJ8 A;  3OTO Q;  1CA5 A;  3HOU B;  1PTO F;  2EJF C;  2YTV A;  2Z1C A;  3RNU A;  5CV6 A;  2IW3 A;  1U9R A;  1SAP A;  2EYL A;  1PRT B;  2FJ2 A;  4P2C B;  1PFN A;  1D5M C;  2KA7 A;  2XWJ B;  3MAQ A;  3RZD H;  3TP7 A;  2R93 G;  4GLV B;  3CHB D;  3M85 A;  2PCF B;  3I73 A;  1VQO A;  3S2H H;  2JN4 A;  2F0G A;  5KYI A;  3F2U A;  3HZX A;  4IUN A;  1I6V C;  4XT3 B;  4RMF A;  3ERQ A;  5TSS A;  1TS4 A;  4DNI A;  1I3Q B;  2MUY A;  4IN3 A;  3QIA A;  1V1P B;  4JI6 Q;  1CUK A;  2XRS D;  5J22 A;  1NMG A;  2F03 A;  1I94 Q;  2QDB A;  4UP7 A;  4YCW A;  5M5W B;  4DAV A;  1YJW A;  1VQE A;  2P5Z X;  2OQK A;  4Q5V A;  3KF8 B;  4KK7 A;  4A3I B;  1EY7 A;  2L12 A;  1GUW A;  1I6H H;  3GTO H;  1O7I A;  1QIL A;  2NUC A;  4A3B H;  3NP8 A;  1WTR A;  5GAD C;  4B3T L;  1M4V A;  1SYE A;  3S1N H;  1LTL A;  3HOW G;  1WJJ A;  3NHH A;  2IPK D;  1Y69 U;  2E74 C;  3LGJ A;  4CGY B;  3ULJ A;  4LF6 L;  2MHV A;  3HOU G;  1VQA A;  3AB9 A;  1RF2 D;  1EWI A;  2SEB D;  2EJM A;  1CZG A;  4N9T A;  4A3F G;  3I70 A;  3PF4 A;  1K8A C;  3S9W A;  3TS0 A;  1A0I A;  3KDF B;  2E2J B;  5KND A;  1KDA A;  1SNC A;  4HJ9 A;  4A3L G;  3NTH A;  4A3I H;  3K5L A;  5DAU A;  1RD9 D;  1CSP A;  2EE1 A;  4LF5 L;  4FF3 A;  5M5X B;  2SDF A;  3BZC A;  4DR3 Q;  4B9W A;  2A6E D;  1L0X B;  2N78 A;  3E3X A;  3ULL A;  1DXM A;  4DUZ Q;  3PO3 G;  4A3G H;  2X6G A;  3J7A 5;  1TY0 A;  3TS2 A;  2XGT A;  4PQX A;  1F77 A;  3DWP A;  1WCM H;  1YEZ A;  1KIX A;  1ET9 A;  1UE1 A;  1EYA A;  1TVX A;  4KV6 A;  2AUJ D;  2MPM A;  2K5V A;  2D0P A;  3GP7 A;  4TVA B;  1EIF A;  3PMF A;  1XMO Q;  5BN5 A;  4A3C H;  4PNY A;  3RN5 A;  3NUC A;  2DGY A;  1LTB D;  1CHP D;  3IFD A;  4B08 A;  4E6I A;  3MA2 B;  1HNW L;  3FMC A;  4R4O A;  1E2W A;  3E6Z X;  4GLA C;  1XNQ Q;  1PTO B;  1I50 B;  2L1B A;  3GTL B;  1SYC A;  1TII D;  4HTH A;  2B29 A;  2ZXO A;  3DXJ C;  4QY7 A;  5T1I A;  2RCN A;  3I90 A;  1Y1W H;  2N3S A;  3CW2 C;  1ZEQ X;  2R92 H;  3GD7 A;  1FGB D;  4C3H B;  4GNX C;  4JI4 L;  3L7Z C;  2KVM A;  1GUN A;  4LUO A;  2A1A A;  1QZH A;  3D6W A;  2NVX H;  1YZ6 A;  2F0H A;  4MNO A;  3S1M H;  2M2L A;  5C44 B;  5JVG 3;  3P75 A;  1VQC A;  4JBJ A;  4RFB A;  4EGV A;  3GDE A;  2VUM G;  3UDG A;  4YWL A;  4WFN 3;  1L1O B;  1EWH A;  1NNX A;  1WTO A;  3A8I E;  1JJG A;  2I46 A;  2RDG A;  4U67 3;  4RCO A;  5JJI A;  2NVQ H;  3MEF A;  1CHQ D;  3FHW A;  2R92 B;  3TEH B;  4EQO A;  2E2I B;  3CQZ B;  1STG A;  3SR1 A;  3V96 A;  3H3V C;  1LTT D;  3EA6 A;  3GTG B;  3J7A V;  2D2C C;  3S1M B;  4PMB A;  4DU9 A;  5EPK A;  2ICI A;  2Z6K C;  3QO2 A;  2Z4H A;  4KD3 A;  1E1O A;  5KNC A;  1OXX K;  3EVQ A;  5J3B A;  2IWH A;  1EQR A;  3GV6 A;  4J1M A;  2RHS B;  4C3I G;  4ULL A;  4J6H A;  4R8I A;  1PRT F;  4NP5 A;  4LFC L;  1CK1 A;  1SYD A;  3MEH A;  4EQ5 A;  2XN9 C;  5CGK A;  1YJ9 A;  4NXM Q;  1TS5 A;  4ME3 A;  1HZ9 A;  2BDN A;  1EOT A;  4M8A A;  2PW5 A;  3TN2 A;  1FJG Q;  5IYB H;  2QEX A;  2K03 A;  1QWY A;  2FXQ A;  4JI1 L;  1BOS A;  1STE A;  4R1J A;  1N9W A;  4KMU C;  3TRZ A;  2UUC L;  2F0O A;  5I6W A;  1K3B C;  1P8L A;  3QR8 A;  1Y8O B;  2LMC B;  1OXS C;  3HOX H;  1KNE A;  1JR0 D;  3S16 H;  1WD0 A;  1FGU A;  4HIM A;  4KY6 A;  2A5H A;  1STB A;  2JQO A;  3EN2 A;  4DNT B;  1VQ5 A;  3W3A A;  3S14 H;  3D0F A;  4RGT A;  1TY2 A;  5JJK A;  4AYB E;  3A0J A;  3U9S A;  2EOT A;  4OEL B;  2MO0 A;  4IJL A;  1A2U A;  4KTA A;  2F0F A;  5C0X G;  1KD1 C;  5ELC A;  1IXR A;  2MP1 A;  1PFS A;  4WRD A;  5GAH C;  1RJT A;  4POF A;  3T51 B;  2JXM B;  2F1M A;  2ENB A;  2MGS A;  2Q8I B;  3J7Y W;  4O42 A;  2BA0 A;  1NBW A;  1JB3 A;  2VQE Q;  1E2Z A;  4LF8 L;  1ICW A;  4UPA A;  2K1B A;  3AEV A;  1AW7 A;  2I5M X;  3AYH B;  1QNK A;  2QGQ A;  4K2L A;  4DR1 Q;  2E8G A;  1PFB A;  3LNN A;  5ISR A;  1ENF A;  4CDE C;  2QCP X;  4IFD H;  3HOZ H;  4JCV E;  3U50 C;  3SDZ A;  2F0P A;  1LT5 D;  2L15 A;  3V05 A;  2B2W A;  1SNP A;  1I4X A;  1I4H A;  4A3F B;  1FL0 A;  1FD7 D;  2B2T A;  4XQJ A;  2NZO A;  3A55 A;  3NWT A;  4XYO A;  4QUF A;  2RVL A;  1BBW A;  2GVA A;  4A93 H;  4AYB G;  2RHQ B;  5IE8 A;  3GTQ H;  1JWU D;  2BOS A;  1FYC A;  4A3L H;  3CPF A;  2R93 H;  1IKM A;  4JI4 Q;  3OIQ A;  3CKI B;  1SFO B;  2Z6K A;  2UUA L;  2CWA A;  1TWH B;  3A8K E;  1V1P A;  1LM0 A;  4DPG A;  5IGD A;  1A15 A;  4DAP A;  3PO3 B;  3DWQ A;  4DFA A;  1SMY D;  2VNU D;  3PUV A;  5JEA J;  5CC4 A;  3T4A C;  1XNR Q;  1LYL A;  3KJO A;  2JA6 H;  1X3P A;  2R7Z G;  1N32 L;  4FXK C;  4IQZ A;  1MJE A;  1BBU A;  1MBY A;  2XRQ D;  3LWU A;  5M3F G;  2KBN A;  3NXW A;  1Q82 C;  4AQY Q;  2WIN B;  1AH9 A;  1I4G A;  1VQF A;  1PRT C;  2PMZ B;  1CT1 D;  3A7A B;  5IGB A;  4DGZ A;  4JBW A;  1KAB A;  2WKD A;  1G8Z D;  4JBM A;  1I6H B;  1ESF A;  4G7O C;  4IJH A;  4I7A A;  3SGI A;  5IP7 G;  3MHB A;  4C2M H;  4CHT B;  3DEP A;  1SSO A;  4H44 C;  3DHQ A;  1AFP A;  1S5D D;  2BE5 D;  1XMQ Q;  2LSS A;  2WV6 D;  3S14 B;  5IP7 H;  2HCI A;  2VB3 X;  1QZG A;  3Q22 A;  1D6E C;  1STA A;  4H02 A;  1B8A A;  3J80 E;  2E2H B;  3I8Z A;  3JC6 6;  2MQH A;  3NEN A;  4HSP A;  3SHL A;  2EYF A;  3W5O A;  1S72 A;  4JI3 Q;  1PV4 A;  4OON A;  1D1I A;  2K5Q A;  2NVT B;  3PO2 G;  1YNX A;  4TQU S;  1IBL Q;  1VQG A;  1Z7T A;  4DK6 C;  4A3G G;  5IYD H;  2JYO A;  2R7Z H;  2NVY H;  4IFD G;  1NUC A;  1HQR D;  3BDL A;  1ILP A;  3VR5 A;  2PZT A;  2WAQ E;  3HOW H;  1Y1V G;  4IUU A;  3MFG A;  3FPP A;  4YHH L;  1SE4 A;  1QOH A;  3CCL A;  4O2D A;  3HOU H;  1KQS A;  2WB1 E;  1GKH A;  2YU9 H;  4ZLT F;  1PH9 A;  2YTX A;  4WOR A;  3HOY B;  1N34 L;  2BA1 A;  3BU2 A;  4EQN A;  2BE5 C;  5IWA Q;  3KDF A;  3KUP A;  5IY0 A;  3S2H B;  3EJI A;  1ZKO A;  2Q2H A;  1C9O A;  2PQE A;  5JOB A;  4YCV A;  4QJF A;  1ML0 D;  4WJ3 M;  3T1H L;  3Q23 A;  3GTM B;  5C4X G;  2Q2U A;  2I5L X;  4L63 B;  4K5W A;  2KQ3 A;  2L11 A;  3JAM L;  3CF5 A;  1VDZ A;  4BY7 H;  1KRS A;  2PNR C;  2F3V A;  1IBM Q;  5KNB A;  2F0U A;  4APV A;  5HGQ A;  2F0W A;  5T1G A;  4RGO S;  2UUB Q;  1I4Q A;  5C0X I;  3C1F A;  2ZM6 L;  4HID A;  5G3L F;  4G7Z C;  3BVG A;  4FXG C;  4O1N A;  1GD7 A;  4N8F A;  2L55 A;  1N36 Q;  1HH2 P;  1QVG A;  5I2X A;  3CCV A;  1QJO A;  2Y0S B;  3NEM A;  3A7L A;  2CHB D;  5CBE E;  3FEW X;  2K50 A;  4B9X A;  4A3M G;  2JA7 G;  3GTM H;  2RQX A;  2TSS A;  1PTO C;  1HZC A;  1LUZ A;  4YCU A;  4KN7 C;  5LL6 X;  3FDT A;  1D2B A;  2KEE A;  1PXU A;  3RN2 A;  4LF9 L;  4KHP Q;  3KF8 A;  4NW2 A;  3G6J B;  3CMA A;  5IOC A;  3KF6 B;  1K8M A;  5JJL A;  1NR2 A;  4FP5 D;  2XNA C;  3MTS A;  3SE0 A;  4A3B G;  3SK8 A;  3SVM A;  1F9R A;  2LY7 A;  1G91 A;  1JOR A;  1U4R A;  1ENA A;  3M4Q A;  4IO9 A;  3OTO L;  3S17 H;  3QG1 A;  1XXG A;  4DR2 L;  1WTP A;  1K28 A;  1YBY A;  4KD4 A;  2UUC Q;  1EL0 A;  1W6K A;  5EKL A;  1XX8 A;  3CCM A;  3SK4 A;  3HOV G;  2LXJ A;  1TXY A;  2SOB A;  4KJO A;  3H0G B;  1A3U A;  1QUQ B;  4DV4 Q;  1R9T H;  1X65 A;  5EJW A;  1Q7Y C;  2JEB I;  1SJH D;  3U4Z A;  2ZXR A;  1RTO A;  3F8T A;  1YNN C;  1EFW A;  1JWM D;  4DK1 A;  2KHI A;  1W3S A;  4KKU A;  5IWA L;  3J7A F;  1QE6 A;  4LFC Q;  5E1F A;  2AQ3 B;  1BCP D;  1DOM A;  4WJW A;  5IYC H;  3U9O A;  5G3L D;  1MIU A;  2Z0S A;  4JI8 L;  5M5Y B;  1N33 L;  2B2W C;  1JCK B;  2NN6 G;  2OEO A;  1IW7 D;  1SE8 A;  2E76 C;  2XWB B;  5EBC A;  1SYF A;  2EXD A;  5COR A;  1HRJ A;  2Z8L A;  1I50 H;  3CCE A;  4HN7 A;  1B1Z A;  5FOB B;  1OXT A;  1KL9 A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 4RWS C;  1SYG A;  1FR3 A;  1H9S A;  4K8J A;  4DF7 A;  3NWS A;  2B2V A;  1ZXT A;  3TDQ A;  2JSO A;  1CTM A;  3MWY W;  1H9R A;  4TSS A;  2RSO A;  5JVH 3;  2QKI C;  4RHR A;  1RTN A;  3KBG A;  4ZUI A;  1RKN A;  2HQE A;  5DNF A;  4QB4 A;  4KHV A;  4GZY C;  1SXT A;  1HA5 A;  2NB0 A;  4C3J G;  2A69 D;  3IL8 A;  3TZD A;  1O78 A;  4ZK9 B;  2JP1 A;  2J4X A;  5KEE A;  2NN6 H;  3FPU B;  1B4O A;  1A6X A;  3MVV A;  4EVO A;  1EZ6 A;  1IKL A;  1T5E A;  2AQ2 B;  2F4I A;  1B9M A;  1PTO H;  3S15 B;  5M3F B;  1RHP A;  1EIG A;  1V8Q A;  1O7L A;  2QIL A;  1O7Y A;  4C3I B;  1VF5 C;  1TKW B;  5C3X A;  3GTO B;  2XSC A;  1GUS A;  5C0X J;  2R6G A;  2B2U A;  3BYT B;  2PO4 A;  2K32 A;  2JA5 B;  5FO7 B;  4RHS A;  4S3S A;  1GUT A;  1SYB A;  3PUY A;  1BDO A;  1UAP A;  3R93 A;  4PV1 C;  4X3S A;  1LTA D;  5CMD A;  1NR4 A;  1O7Z A;  3BDO A;  1CFM A;  1ESR A;  4LMQ D;  2F0I A;  5A2Q E;  1H9M A;  1SMY C;  2PZW A;  4FXD A;  4JK1 C;  5BN4 A;  3WOF A;  3TP8 A;  2WKC A;  3HS0 C;  1XYI A;  2AQ1 B;  4BA2 I;  3DWA A;  2F0V A;  1GJX A;  2DN8 A;  1J9O A;  1RDP D;  2WAC A;  5I9O A;  2JA7 B;  4HMI A;  2PPB C;  5JPN C;  1HCZ A;  4Z9C B;  4A93 B;  3TSS A;  4XXE A;  2YU9 B;  4L6T B;  4ZUJ A;  4RA8 A;  2OF1 A;  1LTI D;  1F9S A;  1EY0 A;  1NCV A;  4AYB B;  4ZQ3 A;  3K58 A;  3MC0 B;  1DOK A;  4NKL A;  1S5B D;  5C6A A;  3I72 A;  1SNQ A;  4BY7 B;  2F0Q A;  1CQF A;  2FIN B;  2IX0 A;  3NTK A;  5BN3 A;  1EU4 A;  1EYD A;  1X3Q A;  3D31 A;  4KKS A;  1GHK A;  2RBM A;  2EY5 A;  4FYD A;  5FLX L;  4OO1 G;  3I4L A;  2QEJ C;  4TRD A;  5ELD A;  4OGQ C;  2O4X A;  4ILW A;  4KHZ A;  4I65 A;  2B2Y C;  4MHE A;  3KLR A;  1LT6 D;  1WTW A;  3I91 A;  4NMZ A;  1LT4 D;  2D62 A;  2KCC A;  5JPM C;  4CJ2 C;  3HOX B;  3TP5 A;  3S2D B;  3EQL C;  2I07 B;  3VYR A;  3QB3 A;  1SEB D;  2WII B;  4R9W A;  1Y8N B;  2VXW A;  5LL6 S;  1PLF A;  1DM0 B;  2A68 C;  2DY7 A;  3C2P A;  3I3C A;  1HFN A;  3PO2 B;  1S5F D;  4HSV A;  3QOL A;  5E4W C;  4KN4 C;  4F87 A;  3S1R B;  3MXP A;  3PV0 A;  1Y8P B;  1OXV A;  1K8O A;  1Y1V B;  3OMG A;  1WCM B;  1HA6 A;  2L5T A;  5K5P A;  5C4J B;  1A2T A;  4K5V A;  3BYY B;  1PYW D;  4DN4 M;  3K5N A;  1LTR D;  1BR9 A;  3IAY A;  1DOL A;  4K5X A;  1S4Z A;  3NQT A;  3N52 A;  4QIW B;  4OIJ A;  2E2D C;  3H09 A;  1OO9 B;  1I4R A;  1GHJ A;  1E0B A;  1PDQ A;  4RGM A;  1Y1W B;  4PMW A;  5M9O A;  4FF4 A;  2AUK A;  1BCP B;  2EYJ A;  4F7X A;  1YNJ D;  4K8I A;  2LKV A;  2NVX B;  3GTP B;  1O80 A;  5IGF A;  4A3B B;  4HMJ A;  3SEB A;  4IZ8 A;  2ZXP A;  1BF4 A;  2F0K A;  2F3W A;  2D9U A;  4BWG B;  4H7B A;  4RKB A;  3ZYY X;  3VR6 A;  1Z47 A;  2B2Y A;  4F8M A;  2OXP A;  3DUZ A;  4C2M B;  3CRK C;  5KRU A;  2K5D A;  1WD1 A;  2C9O A;  2B2U C;  4M1U B;  2JA8 B;  4K2K A;  1AZQ A;  5CV8 A;  3VR2 A;  1U4M A;  1S5C D;  4R8N A;  1AEX A;  3K6O A;  5I4D A;  1BNZ A;  3D8G A;  2KJX A;  5A35 A;  1KDB A;  2KCN A;  4RAU C;  1B44 D;  3LWE A;  1DYQ A;  1XWE A;  4A3D B;  2LFN A;  1SDF A;  4ME5 A;  1V1O A;  3ND9 A;  2F0M A;  2ID0 A;  1SE3 A;  3OWE B;  4HAE A;  2N88 A;  1YNN D;  3OIP A;  2R7Z B;  3J80 L;  3S17 B;  3A54 A;  3E5S A;  2D5D A;  3FRP B;  4QMG A;  2E75 C;  3HOW B;  2QF7 A;  3OPO A;  4XYQ A;  1FNV A;  5IIF A;  5EKK A;  5C3W A;  1CA6 A;  1R9T B;  3WOE A;  3NBH A;  4C1N K;  3H6M A;  1B53 A;  1STN A;  5IT9 L;  3RUZ A;  5EQ0 A;  2M00 A;  5DM6 3;  4H0L C;  1WTV A;  5ELB A;  4CJ0 B;  2B2T C;  2A6H C;  1AP0 A;  2HCC A;  2BDO A;  1BCP F;  2NYZ D;  4CKC A;  1F2M A;  1SJE D;  1PZK D;  2B8G A;  1TWF B;  2EXZ A;  2K04 A;  3DEO A;  4H13 C;  1NSN S;  2EYP A;  3M4O B;  2AWN A;  1IHZ A;  3HRZ C;  3D4W A;  5HUR A;  2LS0 1;  5D3I B;  5FLX E;  1I4P A;  1XTC D;  3JAM E;  1Q90 A;  2R3Z A;  1LTG D;  1KAA A;  5C0X H;  2F0L A;  3M4Y A;  5KIX A;  4ZKC B;  1LO5 D;  5D3D A;  1J8I A;  2Z4I A;  5E4X A;  4ABN A;  1H9K A;  1BBX C;  3NBI A;  2Q8R E;  1D1K A;  4G57 A;  5I6Y A;  1G6Z A;  1L0Y B;  4CKB A;  3K0Y A;  3M7N A;  1LAB A;  3ND8 A;  1VMP A;  5EPJ A;  2FMC A;  3S16 B;  1SNO A;  3RLF A;  1U4P A;  1G2T A;  4EQP A;  1KLG D;  3K7A B;  2L9H A;  1E2V A;  1LT3 D;  4UAI A;  2B63 B;  5FO8 B;  4ZAI A;  3O13 A;  5I9P A;  2NTT A;  3D6C A;  3KBX A;  3R3O A;  4IUP A;  4K6L A;  1HQM C;  3VYT A;  1MD2 D;  3OWF A;  2DY8 A;  2IX3 A;  2A73 B;  4LAA A;  1IL8 A;  4IFD J;  1C8C A;  3FVQ A;  1UUP A;  3IFT A;  3TP6 A;  4CJ1 B;  1Q8I A;  4XIG S;  2X6L A;  5E3F A;  2O5I C;  4KI0 A;  4XQN A;  5EBD A;  2XIW A;  3VA7 A;  1VF7 A;  2NTS A;  2XVS A;  1F2L A;  1EZ8 A;  5COY A;  3NTI A;  2CVR A;  1Q1E A;  1F9Q A;  4KKT A;  1JWS D;  3URY A;  3SXH A;  3BZD B;  1H9J A;  4DXF A;  1STY A;  1DZ1 A;  3CU7 A;  4OIK A;  3TZU A;  1QG7 A;  1VMC A;  2F0T A;  1JQY D;  4KY7 A;  2A68 D;  4DK0 A;  4BBR B;  2RDH A;  4ID6 A;  2B39 A;  1B3A A;  3LX0 A;  4BBS B;  2Q8T A;  2VUM B;  4HED A;  3N6R A;  4TKO B;  5EKI A;  2H4O A;  3SK5 A;  3NK9 A;  2IX1 A;  3NQI A;  1B50 A;  2RKS A;  1EU3 A;  4G7H C;  2ICE C;  2K28 A;  1G29 1;  2F0N A;  3BVZ A;  2KEC A;  5IGC A;  3R2I A;  2J0T D;  2B2V C;  4C3J B;  3S1Q B;  5KGU A;  2M9V A;  4C1N I;  2FFK B;  3T13 A;  1LV9 A;  1EIH A;  1ILQ A;  3ITP A;  3GO5 A;  4IAL A;  1LAC A;  2SNS A;  4XTC S;  1ZYR C;  3GTQ B;  2K05 A;  3HP3 A;  1BCP C;  1U4L A;  5J39 A;  2EZV A;  3VA5 A;  1Q12 A;  3QOJ A;  3H91 A;  2IT1 A;  2L0C A;  2NN6 I;  3GQB A;  4HCE A;  3HGB A;  5C4Z A;  1IW7 C;  2WAQ B;  4V0B A;  2H1E A;  4YIJ A;  4DNR B;  2PYK A;  3BS1 A;  3I4N B;  2F0D A;  3NPP A;  2GA4 B;  3VR4 A;  3CRL C;  4DA2 A;  2O5J C;  2NZ1 D;  3HKZ B;  3AU7 A;  2ZT9 C;  2A6H D;  4NDX A;  1H9S B;  2EY6 A;  1V43 A;  1EY4 A;  3C1E A;  4BS9 A;  1KDC A;  3L3O C;  3PUX A;  1TWC B;  5LHY 1;  2EJG C;  2K6A A;  1ZYR D;  4MN3 A;  3H94 A;  2NWG A;  3KLS X;  1A3V A;  1QCB D;  1PTO D;  1F2Y A;  1C4Q A;  2KED A;  4DXG A;  1WVL A;  1BXT A;  3Q0A A;  1EQT A;  5D14 A;  2EDG A;  1QNU A;  4OL7 A;  1EYC A;  1M8A A;  1PZI D;  1PFM A;  3PIP 3;  1HUM A;  5I2Y A;  3T56 B;  3P20 A;  4A3M B;  1IYV A;  1EY9 A;  1G2S A;  2K01 A;  3MFY A;  3OHX C;  2R93 B;  5C4H A;  4CKE A;  1DON A;  1TQO A;  3SK6 A;  4KJN A;  5CBA E;  5DEH A;  4X3U A;  1EY5 A;  4MIU A;  5K36 H;  4F88 A;  1K83 B;  3T16 A;  3M7G A;  4HR7 B;  4LJZ C;  4RCN A;  3W2D A;  5CYU A;  1BO0 A;  2RA4 A;  5C5L A;  1Q3L A;  2FHT A;  4ODG A;  4X3K A;  3GTJ B;  1JE4 A;  4ZKB B;  1MI2 A;  5IGE A;  3RD4 A;  5C5M A;  2NVQ B;  1R4Q B;  1R4P B;  4FO2 A;  3BDC A;  1F2Z A;  4N9P A;  4Y7N B;  3X3M A;  2O2L D;  1EEI D;  2CW0 C;  3P1H A;  1PMR A;  3OSO A;  1B9N A;  4X3T A;  4A3G B;  3K5M A;  2R61 A;  2FMM A;  2K7V A;  1W6J A;  4XDX A;  1AN8 A;  1GOZ A;  1ENC A;  3A56 A;  1KLU D;  3J81 L;  3PUZ A;  4PMC A;  1B2T A;  1T5X D;  4XT1 B;  5JJZ A;  1UEA B;  1JOO A;  1HFG A;  3G7L A;  1HUN A;  3S1N B;  4ZYS A;  5FKA C;  3OMC A;  1TS3 A;  3J81 E;  2F0S A;  3MXU A;  1TWA B;  1S5E D;  2K5W A;  5CV9 A;  1EFI D;  5J1Z A;  3RZO B;  1HTL D;  3IKJ A;  3D3R A;  4UDU C;  3PUW A;  1F9P A;  2WP8 J;  3A8J E;  1JOK A;  5JEA H;  4A3E B;  5FK9 C;  4FNF A;  2HDL A;  1X32 A;  4IFD I;  1PRT D;  4QF4 A;  2CQA A;  3GV3 A;  1HHV A;  3R8B A;  3AMU A;  4V19 0;  3BVM A;  2A69 C;  2EVB A;  1WTX A;  2VB2 X;  3QJY A;  3R2T A;  2EY1 A;  3C3L A;  2G9D A;  2IJ0 A;  1QB5 D;  3D4R A;  3MXG A;  1TU2 B;  1EY8 A;  1Q1B A;  1ROD A;  1EQV A;  3HEJ A;  1TS2 A;  1FNU A;  4IUR A;  2K33 A;  2L4N A;  2HUG A;  3BG3 A;  4RH6 A;  3VYS A;  2F0E A;  2EYM A;  1JOQ A;  4IUT A;  2IL8 A;  1RCV D;  3VYU A;  2BCO A;  1MSH A;  5IOD A;  1BQQ T;  1MGS A;  2JA6 B;  2J7Z A;  5CV5 A;  3E0J A;  2F0J A;  3D4D A;  3TME A;  2PZU A;  1Z6H A;  1ET6 A;  1D5Z C;  3NE5 B;  2N55 A;  3NSW A;  2JE6 I;  3P7J A;  3Q6S A;  3OW7 A;  3C46 A;  4OHJ A;  1BUV T;  4QUC A;  4A3J B;  2EPB A;  3V2T A;  5KYL A;  4ZRZ A;  5K36 G;  1CQV A;  1GXD C;  1HPC A;  2AWO A;  1DJR D;  4FF1 A;  3GTK B;  3K57 A;  4RGN A;  5M3M B;  1DCZ A;  3DM1 A;  5C4X B;  4HCS A;  2TMP A;  4U68 A;  3RMH A;  4A3K B;  1IYU A;  4Q0F A;  3EFX D;  1HTP A;  5ELE A;  2NVY B;  4LK1 C;  3HOZ B;  2RDF A;  2KOL A;  5JEA G;  5AFW A;  3OOC A;  2EY2 A;  5DM7 3;  1DD2 A;  2B8F A;  1NAP A;  2HDM A;  4RKL A;  1II3 A;  5D65 A;  1YNJ C;  4DAY A;  2YYZ A;  3M3Y B;  5EGT A;  2KHS A;  1A3T A;  3FKI B;  2PW7 A;  4K14 A;  2OT2 A;  5CR3 A;  4C56 C;  1MSG A;  1LTS D;  1SNM A;  3TBI B;  5IGG A;  1CI3 M;  3I4M B;  5F2D A;  3UI2 A;  2CW0 D;  1UNS A;  4C3H G;  5HGT A;  3WDN A;  5C3E B;  1TR5 A;  5CV4 A;  4K6D A;  4OO1 H;  2A74 C;  2MJ8 A;  1D5X C;  4FF2 A;  2G9H D;  2SNM A;  3ONA B;  2EYH A;  1EWC A;  4BA1 I;  1KNA A;  1WTQ A;  1TT2 A;  5A2Q L;  1VCI A;  4IUQ A;  2RSN A;  4CBV A;  3QWN A;  3VR3 A;  2WB1 B;  2JEA I;  5EPL A;  1C48 A;  1GUG A;  4J8Q A;  1SBB B;  2KUM A;  2DNE A;  4FVM A;  4G4K A;  3T53 B;  1EY6 A;  2EYO A;  3ERO A;  1OXU A;  2A6E C;  3HOV B;  1SE2 A;  1LLR D;  3PIO 3;  1AZP A;  4I7Z C;  4L8J A;  1ONL A;  2V4D A;  5IT9 E;  4IUV A;  4BY1 B;  5CV7 A;  1EEF D;  4OO1 I;  1HXY D;  5FO9 B;  4QCL A;  1TWG B;  5JAV A;  3KLS A;  3L9A X;  1GUO A;  5NUC A;  3K59 A;  1JC7 A;  3K5O A;  1SND A;  3X3N A;  4KY5 A;  1PZJ D;  4XQQ A;  1JIC A;  3HG9 A;  3MXN A;  3RZD B;  1FNW A;  3Q24 A;  1KTK A;  2DNC A;  2X69 A;  1STH A;  2C5C A;  5ELF A;  3MZ5 A;  1CM9 A;  3KK7 A;  3DMU A;  2NBF A;  1CZW A;  1CA5 A;  3HOU B;  1PTO F;  2EJF C;  2Z1C A;  5CV6 A;  2IW3 A;  1U9R A;  1SAP A;  2EYL A;  1PRT B;  2FJ2 A;  4P2C B;  1PFN A;  3MAQ A;  1D5M C;  2KA7 A;  2XWJ B;  3TP7 A;  3CHB D;  3M85 A;  2PCF B;  3I73 A;  2F0G A;  5KYI A;  3F2U A;  3HZX A;  4IUN A;  1I6V C;  4XT3 B;  3ERQ A;  5TSS A;  1TS4 A;  1I3Q B;  2MUY A;  4IN3 A;  3QIA A;  1V1P B;  2XRS D;  5J22 A;  2F03 A;  2QDB A;  5M5W B;  4DAV A;  4Q5V A;  4KK7 A;  4A3I B;  1EY7 A;  2L12 A;  1GUW A;  1QIL A;  2NUC A;  3NP8 A;  1WTR A;  1M4V A;  1SYE A;  3NHH A;  2IPK D;  1Y69 U;  2E74 C;  4CGY B;  2MHV A;  3AB9 A;  1RF2 D;  2SEB D;  2EJM A;  1CZG A;  4N9T A;  3I70 A;  3S9W A;  2E2J B;  5KND A;  1KDA A;  1SNC A;  3NTH A;  3K5L A;  5DAU A;  1RD9 D;  2EE1 A;  4FF3 A;  5M5X B;  2SDF A;  4B9W A;  2A6E D;  1L0X B;  1DXM A;  2X6G A;  1TY0 A;  4PQX A;  1F77 A;  3DWP A;  1ET9 A;  1EYA A;  1TVX A;  4KV6 A;  2AUJ D;  2MPM A;  3GP7 A;  3PMF A;  5BN5 A;  4PNY A;  3NUC A;  1LTB D;  1CHP D;  3IFD A;  4B08 A;  4E6I A;  3MA2 B;  3FMC A;  1E2W A;  3E6Z X;  1PTO B;  1I50 B;  2L1B A;  3GTL B;  1SYC A;  1TII D;  4HTH A;  2ZXO A;  3DXJ C;  5T1I A;  3I90 A;  1ZEQ X;  3GD7 A;  1FGB D;  4C3H B;  3L7Z C;  2KVM A;  1GUN A;  3D6W A;  2F0H A;  2M2L A;  5C44 B;  5JVG 3;  3P75 A;  4RFB A;  4EGV A;  4WFN 3;  1EWH A;  1WTO A;  3A8I E;  2I46 A;  2RDG A;  4U67 3;  4RCO A;  1CHQ D;  2R92 B;  4EQO A;  2E2I B;  3CQZ B;  1STG A;  3SR1 A;  3V96 A;  3H3V C;  1LTT D;  3EA6 A;  3GTG B;  3J7A V;  2D2C C;  3S1M B;  4PMB A;  4DU9 A;  5EPK A;  2ICI A;  3QO2 A;  2Z4H A;  4KD3 A;  5KNC A;  1OXX K;  3EVQ A;  2IWH A;  3GV6 A;  4J1M A;  4C3I G;  4ULL A;  4J6H A;  4R8I A;  1PRT F;  4NP5 A;  1CK1 A;  1SYD A;  3MEH A;  2XN9 C;  5CGK A;  1TS5 A;  2BDN A;  1EOT A;  4M8A A;  2PW5 A;  3TN2 A;  2K03 A;  1QWY A;  1BOS A;  1STE A;  4KMU C;  2F0O A;  5I6W A;  1Y8O B;  2LMC B;  1OXS C;  1KNE A;  1JR0 D;  1WD0 A;  4KY6 A;  2A5H A;  1STB A;  4DNT B;  3W3A A;  4RGT A;  1TY2 A;  3U9S A;  2EOT A;  1A2U A;  4KTA A;  2F0F A;  5C0X G;  5ELC A;  2MP1 A;  4WRD A;  1RJT A;  3T51 B;  2JXM B;  2F1M A;  2ENB A;  2MGS A;  2Q8I B;  3J7Y W;  4O42 A;  2BA0 A;  1JB3 A;  1E2Z A;  1ICW A;  2K1B A;  1AW7 A;  1QNK A;  4K2L A;  1PFB A;  3LNN A;  5ISR A;  1ENF A;  2QCP X;  4IFD H;  3V05 A;  3SDZ A;  2F0P A;  1LT5 D;  2B2W A;  1SNP A;  1I4X A;  1I4H A;  4A3F B;  1FD7 D;  2B2T A;  4XQJ A;  3A55 A;  3NWT A;  4XYO A;  4QUF A;  2RVL A;  1JWU D;  2BOS A;  1FYC A;  1IKM A;  3OIQ A;  3CKI B;  1SFO B;  1TWH B;  3A8K E;  1V1P A;  5IGD A;  1A15 A;  4DAP A;  3PO3 B;  3DWQ A;  4DFA A;  1SMY D;  2VNU D;  3PUV A;  5JEA J;  5CC4 A;  3T4A C;  1X3P A;  4FXK C;  4IQZ A;  1MBY A;  2XRQ D;  3LWU A;  3NXW A;  2WIN B;  1I4G A;  1PRT C;  2PMZ B;  1CT1 D;  3A7A B;  5IGB A;  4DGZ A;  4JBW A;  1KAB A;  2WKD A;  1G8Z D;  1I6H B;  1ESF A;  4G7O C;  3MHB A;  4CHT B;  3DEP A;  1SSO A;  4H44 C;  3DHQ A;  1AFP A;  1S5D D;  2BE5 D;  2WV6 D;  3S14 B;  2HCI A;  2VB3 X;  3Q22 A;  1D6E C;  1STA A;  3J80 E;  2E2H B;  3I8Z A;  4HSP A;  3SHL A;  2EYF A;  1D1I A;  2K5Q A;  2NVT B;  4TQU S;  1Z7T A;  2JYO A;  4IFD G;  1NUC A;  1HQR D;  3BDL A;  1ILP A;  3VR5 A;  2PZT A;  4IUU A;  3MFG A;  3FPP A;  1SE4 A;  1QOH A;  4ZLT F;  4WOR A;  3HOY B;  2BA1 A;  4EQN A;  2BE5 C;  3KUP A;  3S2H B;  3EJI A;  1ZKO A;  2PQE A;  5JOB A;  1ML0 D;  3Q23 A;  3GTM B;  4L63 B;  2KQ3 A;  4K5W A;  2L11 A;  3JAM L;  1VDZ A;  2PNR C;  2F3V A;  5KNB A;  2F0U A;  2F0W A;  5T1G A;  4RGO S;  1I4Q A;  5C0X I;  3C1F A;  5G3L F;  4G7Z C;  3BVG A;  4FXG C;  4O1N A;  2L55 A;  5I2X A;  1QJO A;  2Y0S B;  3A7L A;  2CHB D;  5CBE E;  3FEW X;  4B9X A;  2RQX A;  2TSS A;  1PTO C;  4KN7 C;  5LL6 X;  3FDT A;  1D2B A;  2KEE A;  1PXU A;  3KF8 A;  4NW2 A;  3G6J B;  5IOC A;  1K8M A;  1NR2 A;  4FP5 D;  2XNA C;  3MTS A;  3SE0 A;  3SK8 A;  3SVM A;  1F9R A;  2LY7 A;  1G91 A;  1JOR A;  1U4R A;  1ENA A;  3QG1 A;  1XXG A;  1WTP A;  4KD4 A;  1EL0 A;  1W6K A;  5EKL A;  1XX8 A;  3SK4 A;  2SOB A;  4KJO A;  3H0G B;  1A3U A;  5EJW A;  2JEB I;  1SJH D;  2ZXR A;  1RTO A;  1YNN C;  1JWM D;  4DK1 A;  4KKU A;  3J7A F;  1QE6 A;  5E1F A;  2AQ3 B;  1BCP D;  1DOM A;  4WJW A;  3U9O A;  5G3L D;  5M5Y B;  2B2W C;  1JCK B;  2NN6 G;  2OEO A;  1IW7 D;  2E76 C;  2XWB B;  5EBC A;  1SYF A;  5COR A;  1HRJ A;  2Z8L A;  4HN7 A;  1B1Z A;  5FOB B;  1OXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...