1EYDA

Structure of wild-type s. nuclease at 1.7 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eydA00
2SNMA 3EROA 2M00A 2KQ3A 1EYAA 4WORA 1JOKA 2SNSA 2PZTA 5EKLA 5KYIA 5C4HA 1AEXA 1EY8A 4WRDA 1EY4A 4R8NA 3U9OA 1SNCA 1F2MA 3P75A 1TR5A 3EVQA 5IOCA 5I6WA 2F0OA 4B9XA 5C4ZA 1NUCA 4EQOA 1SYEA 1TQOA 1JORA 1IHZA 4PMCA 2WACA 1RKNA 3QOJA 1EYDA 2EYMA 1TT2A 4KTAA 2F0DA 1KDCA 4K8JA 4QF4A 5CV8A 5E3FA 3TP7A 2PQEA 2F0IA 1A3TA 4S3SA 4ME5A 1EZ6A 3HEJA 2F3VA 4H7BA 3V2TA 2F0MA 1A3UA 1EY9A 3NP8A 3SK8A 2EYJA 5F2DA 1EY6A 2F0HA 2F0VA 5DEHA 5IGGA 5NUCA 3TMEA 1STNA 4G57A 3E5SA 3SK5A 5IGDA 1SNMA 2EYHA 4IUNA 2F0JA 2EYPA 4KD3A 4YIJA 4K2LA 3NQTA 5CR3A 2F0LA 4KD4A 4KJOA 4DGZA 5J1ZA 3NXWA 1SNOA 2PW7A 2KHSA 3EJIA 3HZXA 3QOLA 5C6AA 3MVVA 5ISRA 4J6HA 5KYLA 4K5VA 4KJNA 4RKBA 5M9OA 3NUCA 2F0UA 5KGUA 2QDBA 4ZQ3A 3VA5A 4B9WA 5DAUA 1EZ8A 3ITPA 1U9RA 1KABA 5IGCA 4KY7A 2O4XA 1SNQA 2HQEA 1F2ZA 2EYFA 2F0WA 2NUCA 3NK9A 4ID6A 1KDAA 3T16A 3TP8A 1KAAA 1STYA 2EY1A 2PW5A 2RDFA 4KHVA 4NP5A 4RKLA 3C1EA 5CV6A 3RUZA 1SYFA 5HGTA 4J1MA 4ODGA 4OL7A 3MXPA 5I6YA 1NSNS 2ENBA 4K2KA 4HMJA 3OWFA 4LAAA 3SR1A 3OSOA 3LX0A 5CV9A 2EYOA 1STAA 3C1FA 4F7XA 2LKVA 1ENAA 1A2TA 1STGA 4DF7A 5EKKA 1STBA 2RKSA 2PYKA 1SNDA 3SHLA 3BDCA 3D8GA 3H6MA 2F0KA 3OMCA 4EQNA 5I9OA 2OXPA 4I65A 1EY0A 3DMUA 3SK6A 5CV4A 5C3WA 2F0SA 3R3OA 2PZWA 4TRDA 5JAVA 3OMGA 5KIXA 2OEOA 3NHHA 4K5XA 4K8IA 4ZUJA 4ZUIA 1SNPA 4EQPA 2RBMA 1EYCA 2F0GA 1STHA 4DU9A 5HURA 1EY5A 4DFAA 2PZUA 3D4WA 3DHQA 5C5LA 5C3XA 5IODA 1JOQA 1SYGA 4MIUA 3D6CA 3QB3A 2EY5A 4HMIA 2EY2A 4N9PA 4NDXA 4PNYA 4QMGA 5EGTA 4HTHA 3TP6A 3BDLA 2EXZA 3TP5A 4QB4A 5JOBA 3MHBA 5C5MA 5CV7A 4K5WA 3D4DA 1EY7A 1II3A 5J22A 2EYLA 5IGBA 5E1FA 4E6IA 5IIFA 2SOBA 2F0TA 3P1HA 3S9WA 4K6DA 4F8MA 4PMBA 1A2UA 4KV6A 1SYCA 1SYDA 4EVOA 1SYBA 2F0PA 4N9TA 5K5PA 1EQVA 4IZ8A 3PMFA 5CGKA 5IGEA 3SXHA 3T13A 4KY5A 3ERQA 2F3WA 1ENCA 1JOOA 2F0QA 4NMZA 5CC4A 5I9PA 5KEEA 3MEHA 1A3VA 1KDBA 2F0EA 2EY6A 2F0NA 4NKLA 1F2YA 3MZ5A 4KY6A 4IALA 3SK4A 2OF1A 4K14A 5IGFA 5CV5A 5J39A 2F0FA 5KRUA
chains in the Genus database with same CATH superfamily
3BDOA 3HKZG 2YTXA 4JI5Q 3FVQA 5E4WC 4LUVA 4GLVB 4IUTA 1SAPA 4ZYSA 1E2WA 4WRDA 4KKSA 2B2VA 1O78A 3EQLC 2AQ1B 3PGZA 4JBKA 1GVPA 4HEDA 3H15A 3M4OH 2DJGC 4X65L 5FLMG 3BZDB 4KTAA 1QNUA 2A8VA 4DR7Q 2R7DA 1GUGA 3KLRA 1KIXA 1YJNA 2AHOB 2F0HA 1M1KC 2K50A 3E5SA 4FNFA 1AFPA 1QUQB 2VZAA 1QILA 4JBWA 2BDNA 1B8AA 3CD6A 2OCEA 4C3IB 3MVVA 5H1SE 4K5VA 4LF8L 3S1MH 5FO7B 4JI2L 3KDFA 4XYQA 2O4XA 1L0YB 1QOHA 5ELEA 4LFAL 4LF7Q 2CW0D 4DV3L 1SMYD 4RKLA 1P16A 4R1JA 1H9RA 3HG9A 4DUZL 1VQKA 4JI3Q 1AZQA 1VQ9A 3Q6SA 3NBHA 1V1PB 1I94L 1X3FA 1EOTA 2C5CA 2PQAA 1G2TA 2XIWA 3M7GA 5CV4A 3HOWG 3HS0C 1EL0A 3S14H 2MGSA 4ZUIA 2HIXA 2RBMA 3HOWH 4A3EG 1L1OA 4EX5A 1STHA 1IBMQ 3OPOA 2ZJPA 4U673 1JOQA 4A3EH 3QB3A 1G8ZD 4PNYA 2N8NA 5JOBA 2VQFQ 2Q2IA 3GD7A 2JN4A 2BE5D 5LMUL 1NR4A 4A3FG 4FF3A 4X6AH 1A2UA 4IFDG 1N34L 1SYCA 2LFNA 3W1GA 1SEBD 2F0PA 2CH4W 4N9TA 5LMNQ 4A3FH 4LW1A 4LF6Q 4IFDH 4KY5A 1HNWQ 5HGQA 3PUZA 2UXDL 1G6PA 1HFNA 4IALA 2WINB 2Z6BA 5M3FB 1CZWA 1KAWA 3NELA 1XMOQ 1EY8A 1PMRA 2MJ8A 1AH9A 4GLXA 1LACA 1HRJA 1TVXA 1WI5A 2UUAL 4Q5VA 2EVBA 1S5FD 4GN4B 2F0IA 1A3TA 2B2YA 3HEJA 1PH8A 1X3EA 1V43A 3J80E 1NR2A 1A3UA 3AYHB 2K6AA 2YU9B 4JI4L 5C0XJ 4G57A 1V8QA 2JA7G 3S2DH 3W2DA 3PUYA 3I7FA 1BBWA 4KJOA 5CORA 2JA7H 3GTOH 1VQLA 4KJNA 3GDEA 5KGUA 4JK1C 4DV2L 4RCNA 3S16H 2QILA 1Z6HA 1PH6A 5IGCA 1YHQA 1RTNA 3IKJA 5FO8B 1PZKD 4NPSA 4ID6A 1KDAA 2PCFB 3DEPA 2XNAC 1EIFA 3NBHB 3C1EA 4X3UA 3R2TA 1J5EQ 4LF4Q 2PQAB 2WB1G 5IE8A 1UE5A 1ENAA 2HCCA 1VQOA 4IPCA 4FXGC 1L1OB 3SHLA 3CQZH 1BBXC 2H5XA 3KYHC 3BS1A 3W5OA 4YHHL 3M3YH 2IL8A 2VQEL 3LGJA 3DLLA 1PHJA 4TRDA 2AWNA 4UDUC 3N52A 2NVQH 3HOVG 4ZUJA 1LLRD 2K28A 3WOEA 4POGA 2X6GA 4DU9A 2R7ZB 1ILPA 4DFAA 3I8ZA 3HOVH 2FXQA 3N6RA 5AJ3Q 4LF9L 2K75A 3TP5A 1R4PB 4X66Q 3QJYA 2KCTA 4DR3Q 4JV5L 1OXSC 2FJ2A 1FR3A 1E1TA 1RF2D 2B8GA 1KLUD 1Y1VG 5CGKA 3CC4A 2E75C 2WP8J 2A5HA 1UAPA 2F3WA 1Y1VH 1PVOA 2WFWA 3E6ZX 2F0EA 2FMCA 4IJHA 1SRUA 2BCOA 1NMGA 1XTCD 2OWOA 1C7YA 2R92H 2L12A 2R7FA 3KLWA 1EIGA 3EROA 4KLKA 4DA2A 1HNZL 1HNXL 3S1RB 3GTMH 1SE2A 2YV5A 4A3JG 4LFBL 1PH2A 2LS01 4QUFA 4LFCQ 2NYZD 4GN5A 4A3JH 2UXBL 4FF1A 3I4MB 5IOCA 3G7LA 4DR1Q 3T56B 3NENA 5BN3A 2CVRA 1VQ4A 1PH9A 1NNXA 2B2WA 1EFID 1E7ZA 2KCNA 4IUUA 5ELOA 2NVTH 2F0VA 2IY5B 1T5XD 2EJGC 2Q8RE 3B6YA 2IWHA 1DD2A 4LUZA 2J7ZA 3KLSX 4IO9A 3J80i 2JA5G 2JA5H 2RHQB 3CCEA 4C3HB 2LXKA 1VQJA 4KY7A 3A56A 5CMDA 1FGUA 3J7AV 1SMXA 1H9SB 4H44C 2A69C 4GN3B 4RGTA 1PA6A 3BYYB 4AH6A 1VQ6A 1NSNS 2IX3A 4HMJA 3VA7A 3RLFA 5JJIA 4RGNA 3SR1A 3CPWA 1HZBA 1XNQL 4CBVA 4AQYQ 4Y52H 1SDFA 3IAYA 2K05A 1I50H 4EQNA 1EYGA 2AUJD 3D8GA 3H6MA 2Q2TA 4BBSG 1ILQA 1LTTD 1WD1A 3HOUB 3SK6A 3L3OC 5GAEC 5C3WA 4BBSH 4HSVA 2EQSA 4K8IA 4JW0A 2DN8A 3A54A 2RDGA 3E3XA 4RAUC 3DHQA 4DR2Q 4UP9A 1AZPA 4OIJA 4UHVA 4DUYQ 5FOBB 1FJGQ 3CRLC 2PMZB 1U0LA 2LSSA 1KXLA 1I4PA 3FHWA 1PTOD 4DR4Q 2KHIA 1D7QA 1PRTC 3C2PA 3JAME 1XJVA 2KUMA 3P20A 3NPPA 2A68D 2K14A 3RN2A 1IYUA 3CCJA 4NKLA 3PF4A 1BBUA 4MZ9A 1SFOB 1N36Q 2ZJRA 2AQ2B 3WDNA 2SNSA 4QCLA 3U4ZA 2V4DA 5FLXE 2QA4A 2VB2X 2XRSD 3R93A 1SE3A 2NTTA 4JI8Q 4JI7Q 1TQOA 1PTOB 4JC0A 2NVYB 4KMUC 2EYMA 4NW2A 5E3FA 4NXMQ 1QE6A 2L4NA 3CW2C 3PO3B 3Q8DA 3KF8B 1L2FA 4RGOS 1B50A 4DR6Q 2X69A 1PH3A 3X3MA 3NQTA 5T1GA 4DAYB 2F0LA 3RZOB 1YJWA 1IW7D 5C6AA 2NZ1D 4P75A 4R4QA 3D31A 4RKBA 3HOZG 4B9WA 5BR8L 1L0WA 1GKHA 1EFWA 1I6HB 3UE1A 2O5IC 3WWVA 3MFYA 3HOZH 1SN8A 1YVCA 1Q82C 3QR8A 1NJIC 5M5YH 1VQPA 1TY0A 1CQFA 1JT8A 2JK8A 4XT3B 2K4KA 3M9BA 2FMMA 4TSSA 2B63G 3H0GG 5M3MG 2YTVA 1K83B 2B63H 3H0GH 1N33Q 4DV1Q 5M3MH 3C1FA 1MI2A 4AYBE 1A2TA 5EKKA 1MD2D 1LTLA 4XTCS 1HPCA 3FP9A 4OIKA 2E5LL 4B3RQ 4ILWA 1I4RA 1JWUD 4X3KA 2Z4IA 1X9NA 3J7ZC 5EPLA 1HQMC 1TIID 3OMGA 4FYDA 3NHHA 5IP7G 2M9VA 1GHJA 3K0XA 2R93B 2QEXA 2E8GA 5IP7H 2JEBI 1X55A 1XWEA 2HHHL 4Z9CB 2F4VL 3TP6A 1SE8A 3MWYW 3HOYB 2CWPA 4DV5Q 5HY6A 2VL6A 5E1FA 3WOFA 2N88A 4RFBA 1PFNA 1SYDA 2G9HD 3MXGA 4QIWE 4JYAL 2VS1A 2F0QA 1F9PA 1IYJB 5GADC 1VMCA 4A3BG 3MEHA 3I55A 1G291 4KY6A 3MZ5A 4H13C 4A3BH 1B44D 3J80L 5KRUA 2JA6B 1SROA 4IOCA 2HDLA 4JI1L 1IBKL 4YWKA 1JOKA 1W3SA 3FKIG 2I5LX 2B2VC 3AFQA 4YCWA 3L7ZC 3GTKB 1GUSA 3FKIH 4DK6C 1JICA 3KF6B 3M4YA 2F0OA 5C4ZA 2JJQA 1UWVA 3M85A 2H4OA 4TVAB 3T4AC 4QF4A 1TT2A 3I4NG 2F0DA 2JSOA 1FD7D 4HJ9A 4L5QA 4DV7Q 1VDZA 3CHBD 3I4NH 4OHJA 2JXMB 5F2DA 1HXYD 5BN4A 4K0KL 1SNMA 4HIOA 2IPKD 2ZT9C 3F1ZA 3RN5A 3GTLH 4IPGA 3CPFA 4IN3A 4GKKL 2EE1A 1KRTA 4LF5Q 4FDBA 2QDBA 4GNXA 5EBDA 4IUPA 1BVSA 1QB5D 1U9RA 1LT4D 2VW9A 1HA5A 3CCSA 3G71A 3E0JA 1RCVD 5EPJA 2JE6I 3V05A 1FNWA 1EUJA 1S5CD 4KI0A 4B3TL 3D4RA 4DK0A 1F2LA 1UUPA 3RZDH 4CJ1B 4N8FA 2ATWA 3ONAB 1JJ2A 1AP0A 3BU2A 3K5LA 1WYDA 1TWCH 4BY1B 4IQZA 1YNXA 2UUCL 3K6OA 3BYTB 3HKZB 2UU9L 2NTSA 1L1OC 4A3DG 5IT9c 5LL6X 5DLQE 2K5NA 4XXEA 1XNRL 2KCCA 5C4XG 2F0GA 4A3DH 3M4OB 1EY5A 1D5XC 3VDYA 2PZUA 2CH4A 1TWHH 3VYRA 4WJ3M 5C4XH 1GJXA 1F9RA 1EOVA 3F2UA 1UE1A 4JI0L 4P72A 3M4QA 4B3ML 4DR5L 4JVZA 4V190 3OIPA 4HJAA 2A19A 3D4DA 5J22A 5C44G 3J81c 1PH5A 3ULJA 2F0TA 2KBNA 4DV6L 1N32L 1XXGA 4ME3A 5C44H 2N78A 4JOIC 2ZTCA 3DM3A 3K8AA 4B3SL 1E3PA 4L6TB 1D2BA 1Z47A 3STBC 1F2YA 1Y69U 4DV0Q 5CV5A 2F0FA 5IYCG 1TS5A 3D3RA 4EQ5A 1G2SA 2F3IA 5IYCH 4R4TA 1JMCA 2GVBA 5EPKA 1MIUA 4R8NA 3T1HL 1LT3D 2BDOA 3MFGA 3CXCA 4OX9Q 4PZ7A 1RKNA 3QOJA 1TS4A 2B2YC 2ZM6Q 5CV8A 3HKSA 4S3SA 4H7BA 2K5QA 4KKUA 3NP8A 4A3CG 4EGVA 2NVXB 3TMEA 3VR4A 4GNXB 1R9TH 4A3CH 5KNBA 4YWMA 3HOWB 3FPPA 1UE6A 2E74C 2EIFA 2EOTA 3HZXA 1NCVA 3I4OA 4OWTB 4A3EB 1BF4A 3S2HB 4KKTA 1E22A 4BY7G 1S5ED 2VUMB 2KENA 1VQCA 2ZXPA 4BY7H 1W6JA 1B3AA 2A6EC 2QF7A 2ASBA 1RODA 5LL6S 2PNRC 3TZDA 4AYBG 3M4PA 2IX1A 1UEBA 1UNSA 1TWFB 1B2TA 4CDEC 1AW7A 1AN8A 3AMUA 3MA2B 1YNJD 4X64L 1WTOA 4HAEA 3K5OA 1SXTA 1DOMA 1JJGA 3S17H 3OMCA 5A2QE 3IRBA 3MXNB 5LMNW 3OYYA 1KNEA 4JI5L 1F9SA 1I4XA 5EGTA 2ID0A 3MHBA 1OXVA 2KVMA 2EYLA 1PTOF 5FLXL 2SOBA 2UUBQ 1E2VA 3KLSA 4RGMA 3S2DB 1SYBA 1EQVA 2E2JH 1RIPA 3GTOB 2JA7B 4DR7L 3U58A 3NTKA 3G48A 4CDFC 4C3JG 3S16B 4LK1C 3Q23A 5DM73 4C3JH 1TWGB 5D3DA 1F77A 2R61A 1KTKA 2QEJC 2M00A 1XPOA 4MNOA 1YBYA 2IT1A 3AU7A 4IJLA 4OXPA 1VF5C 2RSNA 2F52A 2NB0A 1LTRD 1I3QH 4J8QA 5C3EG 1N9WA 1WTPA 4NXNQ 4B9XA 3ULLA 5C3EH 5CBAE 2WKCA 1VQ5A 4LF7L 2B2WC 4HCEA 2Z9HA 5D65A 3KBXA 2N3SA 1MJEA 1LM0A 3M3YB 4JI3L 3SK8A 1CKOA 1CM9A 1HJPA 2L15A 2XSCA 2RCFA 5I2XA 4JPBW 2F0JA 3K80C 1IL8A 1VQ7A 3NXWA 3FEWX 4KN4C 3J7A5 1YHAA 2WAQE 3NTHA 1JR0D 2Y0SE 1VF7A 4X62Q 1IBML 2NUCA 2BA1A 1C48A 1BOSA 2HQLA 4WFN3 1MBYA 5HGTA 2MQHA 4J1MA 1JE5A 4G7OC 1DOKA 3MXPA 5I6YA 2X6LA 4X3TA 2VQFL 3OWFA 1D5MC 1WTRA 2DY7A 1I5FA 2K5VA 3O13A 1VQMA 1W2BA 1S40A 1FNVA 2MHVA 5LMNL 2PYKA 1Q7YC 3BDCA 4X3SA 4LF6L 3S24A 2H1EA 1BDOA 2IX0A 1NY4A 3AB9A 3R8BA 1HNWL 1OO9B 1HFGA 2WIIB 3HOXB 1A62A 4A3GG 1IBLQ 5HURA 2E2DC 3RD4A 5C5LA 4I7AA 1XMOL 4ABNA 4MIUA 4A3GH 3A8KE 4NDXA 1WTHA 4HTHA 4P74A 3I91A 1H9SA 4QB4A 1HUNA 1BKBA 1M4VA 1Y1WB 2VY3A 1BCPD 3CMEA 2GA4B 1U4PA 2KHJA 3PSIA 3PMFA 3W1BA 4C1NI 3FPUB 4IPHA 2JA5B 1A3VA 2AQ3B 3K58A 1EQRA 2PMZE 5A35A 1Q1EA 1ZYRC 5FJ8G 4GKJQ 3E0EA 3LWUA 4WORA 2F4IA 5FJ8H 2QKIC 1AEXA 1JQYD 1LUZA 1K8OA 1YNND 1TR5A 2QCPX 1X3PA 2HIVA 3LNNA 4CKCA 4PMCA 2PI2A 3PCOB 3NSWA 4JCVE 1I50B 1CSQA 5IWAQ 3UDXA 4ME5A 1EZ6A 2J0TD 1O7YA 1J5EL 2Q8TA 2R92G 1K3RA 1WVLA 3RMHA 1EY6A 1U5KA 2YTYA 4LF4L 3SE0A 3BG3A 1WCMG 3A7LA 3SK5A 5KNDA 2N55A 1WCMH 4ULLA 4LUOA 2CWAA 4YY3Q 1DXMA 1JJCB 1CI3M 3KJPA 1KABA 1GXDC 4FP5D 2YU9H 4A76A 3NWTA 2XVSA 1HR0Q 4L8JA 3RLNA 3I90A 2UXCQ 4F88A 4JBMA 5AJ3L 1XPUA 2MUYA 5JEAG 3S15H 1SJHD 1YHBA 4X66L 4K2KA 3TRZA 1HH2P 4DR3L 4BS9A 4F7XA 5JEAH 4APVA 1STAA 3HGBA 1NAPA 2Z4HA 3ULPA 3CU7A 3KF8A 2RKSA 3K57A 4ZKBB 2MO1A 5IYBG 1TS3A 3K7AH 3PO2B 4DAYA 1VQHA 1D1KA 5IYBH 5C4JH 1EWIA 3PIO3 4Y7NB 5BN5A 3SDZA 2FINB 2A74C 1H9MA 3CRKC 4LFCL 2EXZA 1BO0A 4XQQA 1WD0A 1CQVA 4K5WA 1XPRA 1S72A 1JC7A 1FYCA 4DR1L 5IIFA 3A8IE 3QWNA 4KV6A 1I4HA 4CJ2C 1O80A 4G7ZC 2L0CA 1MHWC 1TWAB 3UI2A 3HOZB 5IGFA 3DWPA 1K28A 2SNMA 3OTOQ 4RHRA 5M5YB 4BA2I 2ZXRA 1X6OA 4Q0FA 2K03A 2MNAA 1S5BD 2ICEC 3E9IA 2P5ZX 1PH1A 1KHIA 1Y8OB 4NB3A 2E2IH 2B63B 2OTJA 3OIQA 4IOAA 1FGBD 3ND9A 1O7ZA 3U9OA 3S1RH 3I70A 1JE4A 1LV9A 1Q81C 2JA8G 3PIOA 4OONA 2RDHA 4AQYL 1PH4A 2XRQD 5GAGC 2EYPA 2JA8H 5CR3A 2WAQG 4BBRB 1ET6A 4GNXC 1VQAA 2Y0SG 5KYLA 1EU4A 1A8VA 2F0UA 5EBCA 4GS3A 5A2QL 2EYFA 1XMQQ 4DR2L 2A6HC 4C3HG 3KF6A 4DUYL 1X65A 3A5UA 1SE4A 3TREA 1FJGL 1RD9D 4OL7A 2TMPA 1E0BA 4C3HH 4CDCC 1G51A 3OSOA 3L2PA 1B1ZA 3H94A 1GOZA 4RHSA 3KBGA 1IXRA 1NMFA 3QO2A 4DR4L 3KFUA 3L9AX 1BNZA 4KHPQ 3A74A 4ZKCB 3OWEB 5G3LD 4A93B 1KLGD 3G4SA 1EY0A 3DMUA 3FKIB 2F0SA 1VMPA 2GN5A 3TZUA 1GUWA 3I73A 4BWGB 5IP9G 1N36L 2I0QA 4A3MB 5C3XA 3CMAA 5IP9H 2D5DA 2K04A 2EXDA 5L37A 1LYLA 4HIMA 1AE3A 3GV3A 4L63B 3HKZE 2AKWB 1GD7A 1II3A 4JI8L 3S9WA 3P1HA 4JI7L 5FKAC 4FXDA 3ZYYX 3BZCA 3A7AB 4DV4Q 3GTLB 2C9OA 4NXML 1CKNB 2ZXOA 4ZCKA 3SXHA 5K36G 2QW7A 4A4IA 5T1IA 5CC4A 5I9PA 1Z9FA 5K36H 3L0OA 3J80c 3SK4A 2OF1A 1MSHA 4DR6L 4LJZC 4FVMA 4HJ5A 3TQYA 2B2TA 2WV6D 2CW0C 1F2MA 1SMYC 3DXJC 4JI6Q 3VYTA 1PFMA 3EBEA 1SYEA 2FFKB 1SFOH 1QJOA 2RCNA 1BR9A 1HZ9A 2E2HH 2KECA 4AIMA 1Z7TA 3GTGB 5M5XB 2F0MA 2L1BA 3OHXC 4KHZA 3JAMi 1LT5D 1ASZA 1P8LA 1N33L 2KCMA 1VQGA 2ES2A 2NVYH 4B3RL 1QVFA 1TWHB 5C4XB 3PO3G 4H0LC 1PFBA 1X56A 3GTJH 2LY7A 2CCZA 3PO3H 2CQAA 1QNKA 1Q8IA 3IFTA 4DN4M 3T51B 1D5ZC 1LO5D 1TKWB 2AWOA 3EA6A 2HD3A 2RSOA 1DONA 3CC2A 4DPGA 5C44B 2EY1A 2BE5C 1X3QA 2RDFA 1D8LA 2PPBC 3TDQA 3DWQA 1I4GA 1R4QB 4DV5L 2KA7A 2MPMA 2Z6KA 4O1NA 2D0OA 3ERSX 2K5DA 2DNEA 3QG1A 2OTLA 3F8TA 1DM0B 1MGSA 1I6VC 3D6WA 4A75A 3V96A 2Q8IB 3GTQH 1EEID 1K3BC 1JB3A 1A63A 2N49A 1CFMA 1K83H 3A0JA 2OEOA 2UU9Q 1O7IA 5E4XA 4R8IA 2RHSB 1RJTA 1PYBA 3M7NA 2I46A 4LNQA 3FMCA 2EY2A 3S1QH 4G7HC 4RMFA 2F1MA 2A69D 5IGBA 3A5ZB 5C0XI 1R9TB 1AE2A 2NZOA 3D0FA 1TY2A 4DK1A 3H3VC 1KC8C 5IGEA 1W6KA 4DV7L 1GUTA 1C4QA 1MKHA 4P2CB 4NMZA 3OOCA 4U68A 1BQQT 5ELDA 1WTWA 4PG3A 1PXUA 2PNHA 3KJOA 3HP3A 3MXNA 1B9MA 3CCMA 3MC0B 2D2CC 1X3GA 2B29A 3MXUA 1VS0A 1OXUA 1SR3A 4LF5L 3CKIB 1EY4A 4C2MH 1X32A 1EU3A 1LTGD 1Y8PB 1HUMA 2I5HA 4QY7A 1NUCA 4P73A 2BH8A 1EIYB 5JPNC 3S1MB 1JCKB 3GTKH 1EY9A 1M8AA 1BUVT 2EPBA 1PRTD 5NUCA 3T1YQ 2ICIA 3KK7A 4F87A 2NWGA 3GP7A 4UPAA 1VQFA 1OXXK 2KHSA 1M90C 4QJFA 4J6HA 3DUZA 3GTPH 4GOPA 4HSPA 4UAIA 1DYQA 4PV1C 1U4MA 4X65Q 1STYA 4KHVA 4BA1I 2A73B 4A3IG 1MJCA 1T9HA 1D6EC 1DJRD 4IUQA 4K6LA 1PRTB 4UY8C 3S14B 1HHVA 4RG1A 4A3IH 1TXYA 1VQEA 3JC66 3J81j 4QQBX 2MP1A 4PQXA 1SNDA 4HIKA 2F0KA 5I9OA 4I65A 4LF8Q 1LTSD 1TU2B 5KNCA 4C56C 2M2LA 3CCUA 5TSSA 4JI2Q 1HA6A 1WTQA 5AFWA 3K0YA 4DV0L 3I3CA 4CKEA 1J6QA 4LFAQ 5C3EB 5IODA 4BY1G 4O42A 2Q2HA 4A3FB 4DV3Q 2JP1A 4H02A 4BY1H 4RCOA 1A6XA 1QVCA 4DUZQ 1IKLA 3U4VA 1NE3A 5FLXc 4OX9L 2EJMA 2Z8LA 2L5TA 4F8MA 1V1QA 4PMBA 1MSGA 3AFPA 2ZM6L 1I94Q 2XTIA 4OWWB 5CBEE 3JAML 4DXGA 1EWCA 5FLMH 3URYA 4BXXG 3H3VI 2AMCB 1J8IA 1IZ6A 2IHFA 2HUGA 4BXXH 1Q46A 2PZTA 1LABA 2BH2A 1A0IA 4IUVA 5FO9B 1H95A 2XN9C 1E2ZA 4PMWA 2GVAA 1JORA 5LMUQ 3IL8A 1N34Q 2B39A 1PDQA 3PIPA 1EYDA 3EIVA 2BA0A 2PQEA 2F3VA 3C3LA 2UXDQ 2DJFC 4GOPB 3GV6A 2JEAI 2R6GA 1FNUA 4DGZA 5J1ZA 1SNOA 3EJIA 3G6JB 4A3GB 2V1CC 1EEFD 5M5WH 1K8GA 2XWJB 5DAUA 5LHY1 4A3KG 3S1NH 3ITPA 3RNUA 1QVGA 1PZJD 2HQEA 1B53A 2NVXH 1D1IA 4A3KH 1N8RC 2WB1B 2UUAQ 3CQZB 4NP5A 3BVMA 1PTOC 1DZ1A 1CA6A 1Q3LA 2VUMG 4DAPA 4GLAC 3S2HH 1CTMA 4JI4Q 1QWYA 2NVQB 2VUMH 2Z0SA 1EQQA 2EYOA 2LKVA 3SEBA 3K81C 1ZKOA 2A68C 3UDGA 2UUBL 2RQXA 3HOVB 4IFDJ 1STBA 5G3LF 3A55A 4DK3C 2BOSA 1U4LA 2LMCB 2MO0A 2K01A 3E9HA 4JOIA 4DV2Q 1TWFH 4RH6A 3TEHB 2B2UA 3C46A 1GM5A 4C3IG 1VQDA 4XIGS 3I4LA 3D4WA 2DNCA 5D14A 4C3IH 2ZTDA 1YZ6A 4FF2A 2HCIA 4HMIA 1WFQA 4QMGA 1Y1VB 2JYOA 5C0XG 5C5MA 5GQOA 4NXNL 4E6IA 5C0XH 2R92B 2J4XA 5IYDG 1JB7A 1Q86C 3BVZA 1CKMA 1WCMB 2ZJQA 3GTMB 5IYDH 3TN2A 2K1BA 4I7ZC 3F2DA 4YHHQ 4OO1I 2VQEQ 1IW7C 4A3JB 4L5SA 3I72A 1KDBA 4N8X1 1O7LA 1HTLD 1Y14B 2K32A 2A1AA 1IYVA 5JJZA 2NN6I 1ZEQX 2KQ3A 2EDGA 3KDFB 1PYWD 3DWAA 4QL5A 1DGSA 4LF9Q 3S15B 2NVTB 3P75A 3RR5A 2DY8A 4FO2A 4JV5Q 1CSPA 4X62L 1TWGH 3F2BA 4KN7C 4CDDC 4DKAC 1QZGA 1HR0W 3TP7A 1KL9A 4J15A 2PI2E 2EYJA 3K7AB 2JQOA 2L11A 3CCLA 1K0RA 3G6EA 4IUNA 5C4JB 4K2LA 1J9OA 1WJJA 1RTOA 1HNZQ 5GAHC 1WTVA 1HNXQ 4ZLTF 5I2YA 3STBD 4JG2A 4LFBQ 2VB3X 1ML0D 3VA5A 2OT2A 3EFXD 5M3FG 2UXBQ 1KQSA 1YITA 1QZHA 1IKMA 3OW2A 2QGQA 1BCPB 5M3FH 1B3QA 3NK9A 1YI2A 1IBLL 1ZXTA 1GUNA 4UP7A 3CF5A 2PW5A 5CV6A 3RUZA 1SYFA 4ODGA 3EN2A 4YCUA 4BBSB 4LAAA 3DEOA 3CCRA 3IFDA 1I4QA 2TSSA 2OXPA 1ASYA 1V1OA 2K5HA 1GHKA 3P7JA 5E7NA 1E24A 2E2IB 1TS2A 4GKJL 3KUPA 1SLJA 3KOJA 1CZGA 2CHBD 3GQBA 1PH7A 1SYGA 1RL2A 1VQ8A 3K7UC 3HOXG 4WJWA 3CCVA 2A6ED 4PZ8A 3HOXH 1B4OA 3DM1A 1XNQQ 4A3LG 4HCSA 4R4IA 1H9JA 4EVOA 3CCQA 5JVG3 2JA8B 4R4CA 3PQIA 4O2DA 2XWBB 1C8CA 4A3LH 4IZ8A 5IWAL 3VR5A 1HZCA 3T13A 5IT9E 1ENCA 2WAQB 2K33A 1Y1WG 5JEAJ 4YCVA 1KD1C 2Y0SB 2F0NA 1CHQD 3H3VH 4MTKA 4DAMA 1ICFB 1Y1WH 1G6ZA 2KJXA 2FHTA 2B2TC 3U50C 3ZJYC 4YY3L 2ALYB 2F03A 3J81E 1Y8NB 1SNCA 3FDTA 4MHEA 3EVQA 3BJUA 2R7ZG 1HR0L 2R7ZH 3H09A 4EQOA 1IHZA 1CHPD 2WACA 3Q24A 1C9OA 2UXCL 1KDCA 2NBFA 4OELB 3NWSA 4HR7B 1LTID 3CC7A 2VNUD 1STEA 1PRTF 2KEDA 5IGGA 4FXKC 4OGQC 1CKNA 5IGDA 2RA4A 4YIJA 4KD4A 4TKOB 3CP0A 3BZKA 1XX8A 2JA9A 4XQJA 5M9OA 1VQIA 4ALPA 3U9SA 3H0GB 1ENFA 1S5DD 5D3IB 4RA8A 5M3MB 1GO3E 1KNAA 1F9QA 1OXTA 1DOLA 1CUKA 2Z1CA 1YIJA 1Q1BA 2C35B 3I4MG 1K73C 2Z6KC 3VR2A 2L9HA 1Q12A 3I4MH 1PYSB 2K7VA 4MTNA 3LX0A 5CYUA 4DF7A 3K5MA 2Q2UA 3BVGA 2IJ0A 2OQKA 4XQNA 1CT1D 3PUXA 1U4RA 3NQIA 1QCBD 5JPMC 3ER0A 3UDIA 3VR3A 5BR8Q 5JAVA 2IW3A 4K5XA 2E76C 3K59A 3OTOL 1G91A 1X54A 1L0XB 1E1OA 2RVLA 1KRSA 3D6CA 3PO2G 2E2HB 5JJKA 1FL0A 5J3BA 3TSSA 3BDLA 2KOLA 3PO2H 4YWLA 1SSOA 4A3BB 4Y7NH 5I4DA 4OO1G 3PUWA 4L5RC 1FVIA 2PO4A 5EQ0A 2E5LQ 4LMQD 1A15A 1OTCA 4OO1H 3ERQA 1ONLA 1ICWA 1PZID 1JOOA 5KEEA 3X3NA 3GTJB 5EJWA 2NN6G 2EY6A 2XGTA 3PF5A 2K5WA 2NN6H 5DM63 3R2IA 2D9UA 3HOUG 1EYAA 1EWHA 5EKLA 5C4HA 3PV0A 2HHHQ 3HOUH 4XYOA 2KEEA 2F4VQ 3I4NB 1TWAH 1GUOA 3RLOA 3NTIA 1XMQL 3J81i 4L5TA 1NBWA 1WTXA 1YNJC 4K8JA 4JYAQ 4PZ6A 2L55A 3V2TA 4GZYC 1NTGA 3GTQB 4O0AA 1YEZA 4FF4A 1RHPA 1STNA 2D62A 3GO5A 3QIAA 1UEAB 1C0AA 2EYHA 3UDFA 4RWSC 2EZVA 4C1NK 5ELFA 4KHPL 3Q0AA 4JI1Q 1IBKQ 2PW7A 2LXJA 3QOLA 1VCIA 4DNIA 4DXFA 4GOPC 1V9PA 2R3ZA 3S1QB 4CHTB 3PUVA 1ZYRD 5ELCA 4CKBA 1XYIA 4R9WA 4ZRZA 1EQTA 4B08A 1SNQA 1B7YB 4BBRG 5COYA 1T5EA 3RZDB 4HN7A 1KAAA 5FK9C 4BBRH 1TWCB 5JJLA 5EAYA 4DV1L 3T53B 1B9NA 4IPDA 3J7YW 2G9DA 3H91A 4K0KQ 1STGA 1PTOH 1WOCA 4A3DB 2D0PA 4DV4L 1S3OA 1ESRA 1HZAA 3W3AA 4GKKQ 3VR6A 4WJ4A 4DAVA 3AQQA 4C2MB 3R3OA 3NBIA 3AEVA 2IHEA 4XT1B 1SNPA 1EYCA 2EJFC 4V0BA 3RZOH 2VXWA 3TBIB 4A93G 4QUCA 1YJ9A 3UE0A 4N9PA 4A93H 1HCZA 1QG7A 3VYSA 4B3TQ 1I6HH 4JI6L 2HT1A 3Q22A 1EY7A 2O2LD 4A3MG 3I2ZA 5DNFA 1ESFA 2OQ0A 4A3MH 4DNRB 2SEBD 5K5PA 1PFSA 2DUDA 3NEMA 1DCZA 4IFDI 2UUCQ 3GTPB 3MEFA 1SJED 2I07B 2I5MX 5J39A 1RDPD 4K14A 4QGUA 3TP8A 1XNRQ 2ZTEA 5ELBA 1Q8KA 4M8AA 5KYIA 1LT6D 4JI0Q 2R93G 1K8AC 4G4KA 4B3MQ 4DR5Q 3MTSA 3OW7A 2NZHA 2R93H 1BCPF 3J7AF 2YYZA 2QDLA 5I6WA 2B8FA 4DV6Q 1N32Q 4A3IB 3HOYG 4HIDA 4ZK9B 2MFIA 3HOYH 2DGYA 4B3SQ 5GROA 3F2CA 3TS0A 5DEHA 2SDFA 4BY7B 4CJ0B 2CQOA 4KD3A 4ZAIA 5ISRA 1K9MC 3NUCA 3HFZB 3GTGH 5M5XH 4ZQ3A 4JBJA 1EZ8A 1QUQA 4R4OA 1UE7A 2RF4A 4AYBB 3T1HQ 2JA6G 1K8MA 1SBBB 3LWEA 2JA6H 1XTDA 1HQRD 1F2ZA 2F0WA 3T16A 3S17B 3VYUA 3SVMA 4OEMB 1BCPC 1ET9A 3HRZC 1PLFA 2ENBA 2K52A 5CV9A 3SGIA 4M1UB 4POFA 4CGYB 1CK1A 1LTBD 3K5NA 3FRPB 1JWSD 2WB1E 1EIHA 4LWCA 4UP8A 2WKDA 3CAMA 2B2UC 1IL2A 4P71A 2PZWA 5KIXA 4XDXA 5EKIA 1V1PA 2O5JC 5IT9L 1JWMD 4EQPA 5IY0A 1YNNC 4QIWB 1B70B 2G5DA 3TS2A 4MN3A 2E2JB 1CA5A 1H9KA 2EY5A 3A8JE 1S4ZA 2CKZB 2B3GA 1VQNA 4OWXB 1HTPA 5ELNA 1LTAD 3ND8A 5CV7A 4HJ7A 4C3JB 3J81L 3NE5B 5JVH3 2A6HD 4HJ8A 4X64Q 1VQBA 4K6DA 3PIP3 4TQUS 3ICEA 4IURA 1PV4A 3JAMc 5M5WB 1I3QB 1Q90A 4KK7A 2AUKA 4DNTB 3MAQA 3S1NB 2HDMA 3T1YL 1BXTA 2CFMA 1K0SA 3I56A 4A3KB
chains in the Genus database with same CATH topology
3BDOA 3FVQA 5E4WC 4IUTA 1SAPA 4ZYSA 1E2WA 4WRDA 4KKSA 2B2VA 1O78A 3EQLC 2AQ1B 4HEDA 3BZDB 4KTAA 1QNUA 1GUGA 3KLRA 2F0HA 3E5SA 4FNFA 1AFPA 1QILA 4JBWA 2BDNA 4C3IB 3MVVA 4K5VA 5FO7B 4XYQA 2O4XA 1L0YB 1QOHA 5ELEA 2CW0D 1SMYD 4RKLA 1H9RA 3HG9A 1AZQA 3Q6SA 3NBHA 1V1PB 1EOTA 2C5CA 1G2TA 2XIWA 3M7GA 5CV4A 3HS0C 1EL0A 2MGSA 4ZUIA 2RBMA 1STHA 3OPOA 4U673 1JOQA 3QB3A 1G8ZD 4PNYA 5JOBA 3GD7A 2BE5D 1NR4A 4FF3A 1A2UA 4IFDG 1SYCA 2LFNA 1SEBD 2F0PA 4N9TA 4IFDH 4KY5A 3PUZA 1HFNA 4IALA 2WINB 5M3FB 1CZWA 1EY8A 1PMRA 2MJ8A 1LACA 1HRJA 1TVXA 4Q5VA 2EVBA 1S5FD 2F0IA 1A3TA 2B2YA 3HEJA 1V43A 3J80E 1NR2A 1A3UA 2K6AA 2YU9B 5C0XJ 4G57A 1V8QA 3W2DA 3PUYA 4KJOA 5CORA 4KJNA 5KGUA 4JK1C 4RCNA 2QILA 1Z6HA 5IGCA 1RTNA 3IKJA 5FO8B 1PZKD 4ID6A 1KDAA 2PCFB 3DEPA 2XNAC 3C1EA 4X3UA 3R2TA 1ENAA 2HCCA 4FXGC 3SHLA 1BBXC 3BS1A 2IL8A 4TRDA 2AWNA 4UDUC 3N52A 4ZUJA 1LLRD 2K28A 3WOEA 2X6GA 4DU9A 2R7ZB 1ILPA 4DFAA 3I8ZA 3N6RA 3TP5A 1R4PB 3QJYA 1OXSC 2FJ2A 1FR3A 1RF2D 2B8GA 1KLUD 5CGKA 2E75C 2WP8J 2A5HA 1UAPA 2F3WA 3E6ZX 2F0EA 2FMCA 2BCOA 1XTCD 2L12A 1EIGA 3EROA 4DA2A 3S1RB 1SE2A 4QUFA 2LS01 2NYZD 4FF1A 3I4MB 5IOCA 3G7LA 3T56B 5BN3A 2CVRA 2B2WA 1EFID 2KCNA 4IUUA 2F0VA 1T5XD 2EJGC 2Q8RE 1DD2A 2IWHA 2J7ZA 3KLSX 4C3HB 4KY7A 3A56A 5CMDA 3J7AV 1H9SB 4H44C 2A69C 4RGTA 3BYYB 1NSNS 2IX3A 4HMJA 3VA7A 3RLFA 4RGNA 3SR1A 4CBVA 1SDFA 3IAYA 2K05A 4EQNA 2AUJD 3D8GA 3H6MA 1ILQA 1LTTD 1WD1A 3HOUB 3SK6A 3L3OC 5C3WA 4HSVA 4K8IA 2DN8A 3A54A 2RDGA 4RAUC 3DHQA 1AZPA 4OIJA 5FOBB 3CRLC 2PMZB 1I4PA 1PTOD 1PRTC 3C2PA 3JAME 2KUMA 3P20A 3NPPA 2A68D 1IYUA 4NKLA 1SFOB 2AQ2B 3WDNA 2SNSA 4QCLA 2V4DA 5FLXE 2VB2X 2XRSD 3R93A 1SE3A 2NTTA 1TQOA 1PTOB 2NVYB 4KMUC 2EYMA 4NW2A 5E3FA 1QE6A 2L4NA 3PO3B 4RGOS 1B50A 2X69A 3X3MA 3NQTA 5T1GA 3RZOB 2F0LA 1IW7D 5C6AA 2NZ1D 3D31A 4RKBA 4B9WA 1I6HB 2O5IC 3MFYA 1TY0A 1CQFA 4XT3B 4TSSA 2FMMA 1K83B 3C1FA 1MI2A 1A2TA 5EKKA 1MD2D 4XTCS 1HPCA 4OIKA 4ILWA 1I4RA 1JWUD 4X3KA 2Z4IA 5EPLA 1HQMC 1TIID 3OMGA 4FYDA 3NHHA 2M9VA 1GHJA 2R93B 2JEBI 1XWEA 4Z9CB 3TP6A 3MWYW 3HOYB 5E1FA 3WOFA 2N88A 4RFBA 1PFNA 1SYDA 2G9HD 3MXGA 2F0QA 1F9PA 1VMCA 3MEHA 1G291 4KY6A 3MZ5A 4H13C 1B44D 3J80L 5KRUA 2JA6B 2HDLA 1JOKA 2B2VC 3L7ZC 3GTKB 1GUSA 1JICA 3M4YA 2F0OA 5C4ZA 3M85A 2H4OA 3T4AC 4QF4A 1TT2A 2F0DA 2JSOA 1FD7D 1VDZA 3CHBD 4OHJA 2JXMB 5F2DA 1HXYD 5BN4A 1SNMA 2IPKD 2ZT9C 4IN3A 2EE1A 2QDBA 5EBDA 4IUPA 1QB5D 1U9RA 1LT4D 1HA5A 3E0JA 1RCVD 5EPJA 2JE6I 3V05A 1FNWA 1S5CD 4KI0A 3D4RA 4DK0A 1F2LA 1UUPA 4CJ1B 3ONAB 1AP0A 3K5LA 4BY1B 4IQZA 3K6OA 3BYTB 3HKZB 2NTSA 5LL6X 4XXEA 2KCCA 2F0GA 3M4OB 1EY5A 1D5XC 2PZUA 3VYRA 1GJXA 1F9RA 3F2UA 4V190 3OIPA 3D4DA 5J22A 2F0TA 1XXGA 4L6TB 1D2BA 1Z47A 1F2YA 1Y69U 5CV5A 2F0FA 1TS5A 3D3RA 1G2SA 5EPKA 4R8NA 1LT3D 2BDOA 3MFGA 1RKNA 3QOJA 1TS4A 2B2YC 5CV8A 4S3SA 4H7BA 2K5QA 4KKUA 3NP8A 4EGVA 2NVXB 3TMEA 3VR4A 5KNBA 3HOWB 3FPPA 2E74C 2EOTA 3HZXA 1BF4A 1NCVA 4A3EB 3S2HB 4KKTA 1S5ED 2VUMB 2ZXPA 1W6JA 1B3AA 2A6EC 2QF7A 1RODA 5LL6S 2PNRC 3TZDA 2IX1A 1UNSA 1TWFB 1B2TA 1AW7A 1AN8A 3AMUA 3MA2B 1YNJD 1WTOA 4HAEA 3K5OA 1SXTA 1DOMA 3OMCA 5A2QE 1KNEA 1F9SA 1I4XA 5EGTA 2ID0A 3MHBA 1OXVA 2KVMA 2EYLA 1PTOF 5FLXL 2SOBA 1E2VA 3KLSA 4RGMA 3S2DB 1SYBA 1EQVA 2JA7B 3GTOB 3NTKA 4C3JG 3S16B 4LK1C 3Q23A 5DM73 1TWGB 5D3DA 1F77A 2R61A 1KTKA 2QEJC 2M00A 2IT1A 3AU7A 1VF5C 2RSNA 2NB0A 1LTRD 4J8QA 1WTPA 4B9XA 5CBAE 2WKCA 2B2WC 4HCEA 5D65A 3KBXA 3M3YB 3SK8A 1CM9A 2XSCA 5I2XA 2F0JA 1IL8A 3NXWA 3FEWX 4KN4C 3NTHA 1JR0D 1VF7A 2NUCA 2BA1A 1C48A 1BOSA 4WFN3 1MBYA 5HGTA 4J1MA 4G7OC 1DOKA 3MXPA 5I6YA 2X6LA 4X3TA 3OWFA 1D5MC 1WTRA 2DY7A 3O13A 1FNVA 2MHVA 2PYKA 3BDCA 4X3SA 2H1EA 1BDOA 2IX0A 3AB9A 3R8BA 1OO9B 1HFGA 2WIIB 3HOXB 5HURA 2E2DC 3RD4A 5C5LA 4ABNA 4MIUA 3A8KE 4NDXA 4HTHA 3I91A 1H9SA 4QB4A 1HUNA 1M4VA 1Y1WB 1BCPD 2GA4B 1U4PA 3PMFA 4C1NI 3FPUB 2JA5B 1A3VA 2AQ3B 3K58A 5A35A 1Q1EA 1ZYRC 3LWUA 4WORA 2F4IA 2QKIC 1AEXA 1JQYD 1K8OA 1YNND 1TR5A 2QCPX 1X3PA 3LNNA 4CKCA 4PMCA 3NSWA 1I50B 4ME5A 1EZ6A 2J0TD 1O7YA 2Q8TA 1WVLA 3RMHA 1EY6A 3SE0A 3BG3A 3A7LA 3SK5A 5KNDA 2N55A 4ULLA 1DXMA 1CI3M 1KABA 1GXDC 4FP5D 3NWTA 2XVSA 4L8JA 3I90A 4F88A 2MUYA 5JEAG 1SJHD 4K2KA 4BS9A 4F7XA 5JEAH 1STAA 3HGBA 1NAPA 2Z4HA 3CU7A 3KF8A 2RKSA 3K57A 4ZKBB 1TS3A 3PO2B 4DAYA 1D1KA 3PIO3 4Y7NB 5BN5A 3SDZA 2FINB 2A74C 1H9MA 3CRKC 2EXZA 1BO0A 4XQQA 1WD0A 1CQVA 4K5WA 1JC7A 1FYCA 5IIFA 3A8IE 3QWNA 4KV6A 1I4HA 4CJ2C 1O80A 4G7ZC 2L0CA 1TWAB 3UI2A 3HOZB 5IGFA 3DWPA 2SNMA 4RHRA 5M5YB 4BA2I 2ZXRA 4Q0FA 2K03A 1S5BD 2ICEC 1Y8OB 2B63B 3OIQA 1FGBD 3ND9A 1O7ZA 3U9OA 3I70A 1JE4A 1LV9A 2RDHA 2XRQD 2EYPA 5CR3A 4BBRB 1ET6A 5KYLA 1EU4A 2F0UA 5EBCA 5A2QL 2EYFA 2A6HC 4C3HG 1SE4A 1RD9D 4OL7A 2TMPA 1E0BA 3OSOA 1B1ZA 3H94A 1GOZA 4RHSA 3KBGA 3QO2A 3L9AX 1BNZA 4ZKCB 3OWEB 5G3LD 4A93B 1KLGD 1EY0A 3DMUA 3FKIB 2F0SA 1VMPA 3TZUA 1GUWA 3I73A 4BWGB 4A3MB 5C3XA 2D5DA 2K04A 3GV3A 4L63B 1II3A 3S9WA 3P1HA 5FKAC 4FXDA 3ZYYX 3A7AB 3GTLB 2C9OA 2ZXOA 3SXHA 5K36G 5T1IA 5CC4A 5I9PA 5K36H 3SK4A 2OF1A 1MSHA 4LJZC 4FVMA 2B2TA 2WV6D 2CW0C 1F2MA 1SMYC 3DXJC 3VYTA 1PFMA 1SYEA 2FFKB 1QJOA 1BR9A 2KECA 1Z7TA 3GTGB 5M5XB 2F0MA 2L1BA 3OHXC 4KHZA 1LT5D 1TWHB 5C4XB 4H0LC 1PFBA 2LY7A 2CQAA 1QNKA 1Q8IA 3IFTA 4DN4M 3T51B 1D5ZC 1LO5D 1TKWB 2AWOA 3EA6A 2RSOA 1DONA 5C44B 2EY1A 2BE5C 1X3QA 2RDFA 2PPBC 3TDQA 3DWQA 1I4GA 1R4QB 2KA7A 2MPMA 4O1NA 2K5DA 2DNEA 3QG1A 1DM0B 1MGSA 1I6VC 3D6WA 3V96A 2Q8IB 1EEID 1JB3A 1CFMA 2OEOA 5E4XA 4R8IA 1RJTA 3M7NA 2I46A 3FMCA 2EY2A 4G7HC 2F1MA 2A69D 5IGBA 5C0XI 1R9TB 1TY2A 4DK1A 3H3VC 5IGEA 1W6KA 1GUTA 1C4QA 4P2CB 1WTWA 4NMZA 3OOCA 5ELDA 1BQQT 4U68A 1PXUA 3HP3A 1B9MA 3MXNA 3MC0B 2D2CC 3MXUA 1OXUA 3CKIB 1EY4A 1X32A 1EU3A 1LTGD 1Y8PB 1HUMA 1NUCA 5JPNC 3S1MB 1JCKB 1EY9A 1M8AA 1BUVT 2EPBA 1PRTD 5NUCA 2ICIA 3KK7A 4F87A 2NWGA 3GP7A 1OXXK 2KHSA 4J6HA 3DUZA 4HSPA 4UAIA 1DYQA 4PV1C 1U4MA 1STYA 4KHVA 4BA1I 2A73B 1D6EC 1DJRD 4IUQA 4K6LA 1PRTB 3S14B 1HHVA 2MP1A 4PQXA 1SNDA 2F0KA 5I9OA 4I65A 1LTSD 1TU2B 5KNCA 4C56C 2M2LA 5TSSA 1HA6A 1WTQA 5AFWA 3K0YA 3I3CA 4CKEA 5C3EB 5IODA 4O42A 4A3FB 2JP1A 4RCOA 1A6XA 1IKLA 2EJMA 2Z8LA 2L5TA 4F8MA 4PMBA 1MSGA 5CBEE 3JAML 4DXGA 1EWCA 3URYA 1J8IA 2HUGA 2PZTA 1LABA 4IUVA 5FO9B 2XN9C 1E2ZA 4PMWA 1JORA 3IL8A 2B39A 1PDQA 1EYDA 2BA0A 2PQEA 2F3VA 3C3LA 3GV6A 2JEAI 2R6GA 1FNUA 4DGZA 5J1ZA 1SNOA 3EJIA 3G6JB 4A3GB 1EEFD 2XWJB 5DAUA 5LHY1 3ITPA 1PZJD 2HQEA 1B53A 1D1IA 2WB1B 3CQZB 4NP5A 3BVMA 1PTOC 1DZ1A 1CA6A 1Q3LA 4DAPA 1CTMA 2NVQB 1QWYA 2EYOA 2LKVA 3SEBA 1ZKOA 2A68C 2RQXA 3HOVB 4IFDJ 1STBA 5G3LF 3A55A 2BOSA 1U4LA 2LMCB 2K01A 4RH6A 2B2UA 3C46A 4C3IG 4XIGS 3I4LA 3D4WA 2DNCA 5D14A 4FF2A 2HCIA 4HMIA 4QMGA 1Y1VB 2JYOA 5C0XG 5C5MA 4E6IA 5C0XH 2R92B 2J4XA 3BVZA 1WCMB 3GTMB 3TN2A 2K1BA 4I7ZC 4OO1I 1IW7C 4A3JB 3I72A 1KDBA 1O7LA 1HTLD 2K32A 1IYVA 5JJZA 2NN6I 1ZEQX 2KQ3A 2EDGA 1PYWD 3DWAA 3S15B 2NVTB 3P75A 2DY8A 4FO2A 4KN7C 3TP7A 2EYJA 3K7AB 2L11A 4IUNA 5C4JB 4K2LA 1J9OA 1RTOA 1WTVA 4ZLTF 5I2YA 2VB3X 1ML0D 3VA5A 2OT2A 3EFXD 1IKMA 1BCPB 3NK9A 1ZXTA 1GUNA 2PW5A 5CV6A 3RUZA 1SYFA 4ODGA 4BBSB 4LAAA 3DEOA 3IFDA 1I4QA 2TSSA 2OXPA 1V1OA 1GHKA 3P7JA 2E2IB 1TS2A 3KUPA 1CZGA 2CHBD 3GQBA 1SYGA 4WJWA 2A6ED 1B4OA 3DM1A 4HCSA 1H9JA 4EVOA 5JVG3 2JA8B 2XWBB 1C8CA 4IZ8A 3VR5A 3T13A 5IT9E 1ENCA 2WAQB 2K33A 5JEAJ 2Y0SB 2F0NA 1CHQD 1G6ZA 2KJXA 2FHTA 2B2TC 2F03A 3J81E 1Y8NB 1SNCA 3FDTA 4MHEA 3EVQA 3H09A 4EQOA 1IHZA 1CHPD 2WACA 3Q24A 1KDCA 2NBFA 3NWSA 4HR7B 1LTID 2VNUD 1STEA 1PRTF 2KEDA 5IGGA 4FXKC 4OGQC 5IGDA 2RA4A 4YIJA 4KD4A 4TKOB 1XX8A 4XQJA 5M9OA 3U9SA 3H0GB 1ENFA 1S5DD 5D3IB 4RA8A 5M3MB 1KNAA 1F9QA 1OXTA 1DOLA 2Z1CA 1Q1BA 3VR2A 2L9HA 1Q12A 2K7VA 3LX0A 5CYUA 4DF7A 3K5MA 3BVGA 2IJ0A 4XQNA 1CT1D 3PUXA 1U4RA 3NQIA 1QCBD 5JPMC 5JAVA 3VR3A 2IW3A 4K5XA 2E76C 3K59A 1G91A 1L0XB 2RVLA 3D6CA 2E2HB 3TSSA 3BDLA 2KOLA 1SSOA 4A3BB 5I4DA 4OO1G 3PUWA 2PO4A 5EQ0A 4LMQD 1A15A 4OO1H 3ERQA 1ICWA 1ONLA 1PZID 1JOOA 5KEEA 3X3NA 3GTJB 5EJWA 2NN6G 2EY6A 2K5WA 2NN6H 5DM63 3R2IA 2D9UA 1EYAA 1EWHA 5EKLA 5C4HA 3PV0A 4XYOA 2KEEA 3I4NB 1GUOA 3NTIA 1WTXA 1YNJC 4K8JA 2L55A 3V2TA 4GZYC 3GTQB 4FF4A 1RHPA 1STNA 2D62A 3GO5A 3QIAA 1UEAB 2EYHA 4RWSC 2EZVA 4C1NK 5ELFA 3Q0AA 2PW7A 3QOLA 1VCIA 4DXFA 2R3ZA 3S1QB 4CHTB 3PUVA 1ZYRD 5ELCA 4CKBA 1XYIA 4R9WA 4ZRZA 1EQTA 4B08A 1SNQA 5COYA 1T5EA 3RZDB 4HN7A 1KAAA 5FK9C 1TWCB 3T53B 1B9NA 3J7YW 2G9DA 3H91A 1STGA 1PTOH 4A3DB 1ESRA 3W3AA 3VR6A 4DAVA 4C2MB 3R3OA 3NBIA 4XT1B 1SNPA 1EYCA 2EJFC 4V0BA 2VXWA 3TBIB 4QUCA 4N9PA 1HCZA 1QG7A 3VYSA 3Q22A 1EY7A 2O2LD 5DNFA 1ESFA 4DNRB 2SEBD 5K5PA 1DCZA 4IFDI 3GTPB 1SJED 2I07B 5J39A 1RDPD 4K14A 3TP8A 5ELBA 4M8AA 5KYIA 1LT6D 4G4KA 3MTSA 3OW7A 1BCPF 3J7AF 2YYZA 5I6WA 2B8FA 4A3IB 4ZK9B 5DEHA 2SDFA 4BY7B 4CJ0B 4KD3A 4ZAIA 5ISRA 3NUCA 4ZQ3A 1EZ8A 4AYBB 1K8MA 1SBBB 3LWEA 1HQRD 1F2ZA 2F0WA 3T16A 3S17B 3VYUA 3SVMA 1BCPC 1ET9A 3HRZC 1PLFA 2ENBA 5CV9A 4M1UB 4CGYB 1CK1A 1LTBD 3K5NA 3FRPB 1JWSD 1EIHA 2WKDA 2B2UC 2PZWA 5KIXA 4XDXA 5EKIA 1V1PA 2O5JC 5IT9L 1JWMD 4EQPA 1YNNC 4QIWB 4MN3A 2E2JB 1CA5A 1H9KA 2EY5A 3A8JE 1S4ZA 1HTPA 1LTAD 3ND8A 5CV7A 4C3JB 3J81L 3NE5B 5JVH3 2A6HD 4K6DA 3PIP3 4TQUS 4IURA 5M5WB 1I3QB 1Q90A 4KK7A 2AUKA 4DNTB 3MAQA 3S1NB 2HDMA 1BXTA 4A3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SNM A;  3ERO A;  2M00 A;  2KQ3 A;  1EYA A;  4WOR A;  1JOK A;  2SNS A;  2PZT A;  5EKL A;  5KYI A;  5C4H A;  1AEX A;  1EY8 A;  4WRD A;  1EY4 A;  4R8N A;  3U9O A;  1SNC A;  1F2M A;  3P75 A;  1TR5 A;  3EVQ A;  5IOC A;  5I6W A;  2F0O A;  4B9X A;  5C4Z A;  1NUC A;  4EQO A;  1SYE A;  1TQO A;  1JOR A;  1IHZ A;  4PMC A;  2WAC A;  1RKN A;  3QOJ A;  1EYD A;  2EYM A;  1TT2 A;  4KTA A;  2F0D A;  1KDC A;  4K8J A;  4QF4 A;  5CV8 A;  5E3F A;  3TP7 A;  2PQE A;  2F0I A;  1A3T A;  4S3S A;  4ME5 A;  1EZ6 A;  3HEJ A;  2F3V A;  4H7B A;  3V2T A;  2F0M A;  1A3U A;  1EY9 A;  3NP8 A;  3SK8 A;  2EYJ A;  5F2D A;  1EY6 A;  2F0H A;  2F0V A;  5DEH A;  5IGG A;  5NUC A;  3TME A;  1STN A;  4G57 A;  3E5S A;  3SK5 A;  5IGD A;  1SNM A;  2EYH A;  4IUN A;  2F0J A;  2EYP A;  4KD3 A;  4YIJ A;  4K2L A;  3NQT A;  5CR3 A;  2F0L A;  4KD4 A;  4KJO A;  4DGZ A;  5J1Z A;  3NXW A;  1SNO A;  2PW7 A;  2KHS A;  3EJI A;  3HZX A;  3QOL A;  5C6A A;  3MVV A;  5ISR A;  4J6H A;  5KYL A;  4K5V A;  4KJN A;  4RKB A;  5M9O A;  3NUC A;  2F0U A;  5KGU A;  2QDB A;  4ZQ3 A;  3VA5 A;  4B9W A;  5DAU A;  1EZ8 A;  3ITP A;  1U9R A;  1KAB A;  5IGC A;  4KY7 A;  2O4X A;  1SNQ A;  2HQE A;  1F2Z A;  2EYF A;  2F0W A;  2NUC A;  3NK9 A;  4ID6 A;  1KDA A;  3T16 A;  3TP8 A;  1KAA A;  1STY A;  2EY1 A;  2PW5 A;  2RDF A;  4KHV A;  4NP5 A;  4RKL A;  3C1E A;  5CV6 A;  3RUZ A;  1SYF A;  5HGT A;  4J1M A;  4ODG A;  4OL7 A;  3MXP A;  5I6Y A;  1NSN S;  2ENB A;  4K2K A;  4HMJ A;  3OWF A;  4LAA A;  3SR1 A;  3OSO A;  3LX0 A;  5CV9 A;  2EYO A;  1STA A;  3C1F A;  4F7X A;  2LKV A;  1ENA A;  1A2T A;  1STG A;  4DF7 A;  5EKK A;  1STB A;  2RKS A;  2PYK A;  1SND A;  3SHL A;  3BDC A;  3D8G A;  3H6M A;  2F0K A;  3OMC A;  4EQN A;  5I9O A;  2OXP A;  4I65 A;  1EY0 A;  3DMU A;  3SK6 A;  5CV4 A;  5C3W A;  2F0S A;  3R3O A;  2PZW A;  4TRD A;  5JAV A;  3OMG A;  5KIX A;  2OEO A;  3NHH A;  4K5X A;  4K8I A;  4ZUJ A;  4ZUI A;  1SNP A;  4EQP A;  2RBM A;  1EYC A;  2F0G A;  1STH A;  4DU9 A;  5HUR A;  1EY5 A;  4DFA A;  2PZU A;  3D4W A;  3DHQ A;  5C5L A;  5C3X A;  5IOD A;  1JOQ A;  1SYG A;  4MIU A;  3D6C A;  3QB3 A;  2EY5 A;  4HMI A;  2EY2 A;  4N9P A;  4NDX A;  4PNY A;  4QMG A;  5EGT A;  4HTH A;  3TP6 A;  3BDL A;  2EXZ A;  3TP5 A;  4QB4 A;  5JOB A;  3MHB A;  5C5M A;  5CV7 A;  4K5W A;  3D4D A;  1EY7 A;  1II3 A;  5J22 A;  2EYL A;  5IGB A;  5E1F A;  4E6I A;  5IIF A;  2SOB A;  2F0T A;  3P1H A;  3S9W A;  4K6D A;  4F8M A;  4PMB A;  1A2U A;  4KV6 A;  1SYC A;  1SYD A;  4EVO A;  1SYB A;  2F0P A;  4N9T A;  5K5P A;  1EQV A;  4IZ8 A;  3PMF A;  5CGK A;  5IGE A;  3SXH A;  3T13 A;  4KY5 A;  3ERQ A;  2F3W A;  1ENC A;  1JOO A;  2F0Q A;  4NMZ A;  5CC4 A;  5I9P A;  5KEE A;  3MEH A;  1A3V A;  1KDB A;  2F0E A;  2EY6 A;  2F0N A;  4NKL A;  1F2Y A;  3MZ5 A;  4KY6 A;  4IAL A;  3SK4 A;  2OF1 A;  4K14 A;  5IGF A;  5CV5 A;  5J39 A;  2F0F A;  5KRU A; 
#chains in the Genus database with same CATH topology
 3BDO A;  3HKZ G;  2YTX A;  4JI5 Q;  3FVQ A;  5E4W C;  4LUV A;  4GLV B;  4IUT A;  1SAP A;  4ZYS A;  1E2W A;  4WRD A;  4KKS A;  2B2V A;  1O78 A;  3EQL C;  2AQ1 B;  3PGZ A;  4JBK A;  1GVP A;  4HED A;  3H15 A;  3M4O H;  2DJG C;  4X65 L;  5FLM G;  3BZD B;  4KTA A;  1QNU A;  2A8V A;  4DR7 Q;  2R7D A;  1GUG A;  3KLR A;  1KIX A;  1YJN A;  2AHO B;  2F0H A;  1M1K C;  2K50 A;  3E5S A;  4FNF A;  1AFP A;  1QUQ B;  2VZA A;  1QIL A;  4JBW A;  2BDN A;  1B8A A;  3CD6 A;  2OCE A;  4C3I B;  3MVV A;  5H1S E;  4K5V A;  4LF8 L;  3S1M H;  5FO7 B;  4JI2 L;  3KDF A;  4XYQ A;  2O4X A;  1L0Y B;  1QOH A;  5ELE A;  4LFA L;  4LF7 Q;  2CW0 D;  4DV3 L;  1SMY D;  4RKL A;  1P16 A;  4R1J A;  1H9R A;  3HG9 A;  4DUZ L;  1VQK A;  4JI3 Q;  1AZQ A;  1VQ9 A;  3Q6S A;  3NBH A;  1V1P B;  1I94 L;  1X3F A;  1EOT A;  2C5C A;  2PQA A;  1G2T A;  2XIW A;  3M7G A;  5CV4 A;  3HOW G;  3HS0 C;  1EL0 A;  3S14 H;  2MGS A;  4ZUI A;  2HIX A;  2RBM A;  3HOW H;  4A3E G;  1L1O A;  4EX5 A;  1STH A;  1IBM Q;  3OPO A;  2ZJP A;  4U67 3;  1JOQ A;  4A3E H;  3QB3 A;  1G8Z D;  4PNY A;  2N8N A;  5JOB A;  2VQF Q;  2Q2I A;  3GD7 A;  2JN4 A;  2BE5 D;  5LMU L;  1NR4 A;  4A3F G;  4FF3 A;  4X6A H;  1A2U A;  4IFD G;  1N34 L;  1SYC A;  2LFN A;  3W1G A;  1SEB D;  2F0P A;  2CH4 W;  4N9T A;  5LMN Q;  4A3F H;  4LW1 A;  4LF6 Q;  4IFD H;  4KY5 A;  1HNW Q;  5HGQ A;  3PUZ A;  2UXD L;  1G6P A;  1HFN A;  4IAL A;  2WIN B;  2Z6B A;  5M3F B;  1CZW A;  1KAW A;  3NEL A;  1XMO Q;  1EY8 A;  1PMR A;  2MJ8 A;  1AH9 A;  4GLX A;  1LAC A;  1HRJ A;  1TVX A;  1WI5 A;  2UUA L;  4Q5V A;  2EVB A;  1S5F D;  4GN4 B;  2F0I A;  1A3T A;  2B2Y A;  3HEJ A;  1PH8 A;  1X3E A;  1V43 A;  3J80 E;  1NR2 A;  1A3U A;  3AYH B;  2K6A A;  2YU9 B;  4JI4 L;  5C0X J;  4G57 A;  1V8Q A;  2JA7 G;  3S2D H;  3W2D A;  3PUY A;  3I7F A;  1BBW A;  4KJO A;  5COR A;  2JA7 H;  3GTO H;  1VQL A;  4KJN A;  3GDE A;  5KGU A;  4JK1 C;  4DV2 L;  4RCN A;  3S16 H;  2QIL A;  1Z6H A;  1PH6 A;  5IGC A;  1YHQ A;  1RTN A;  3IKJ A;  5FO8 B;  1PZK D;  4NPS A;  4ID6 A;  1KDA A;  2PCF B;  3DEP A;  2XNA C;  1EIF A;  3NBH B;  3C1E A;  4X3U A;  3R2T A;  1J5E Q;  4LF4 Q;  2PQA B;  2WB1 G;  5IE8 A;  1UE5 A;  1ENA A;  2HCC A;  1VQO A;  4IPC A;  4FXG C;  1L1O B;  3SHL A;  3CQZ H;  1BBX C;  2H5X A;  3KYH C;  3BS1 A;  3W5O A;  4YHH L;  3M3Y H;  2IL8 A;  2VQE L;  3LGJ A;  3DLL A;  1PHJ A;  4TRD A;  2AWN A;  4UDU C;  3N52 A;  2NVQ H;  3HOV G;  4ZUJ A;  1LLR D;  2K28 A;  3WOE A;  4POG A;  2X6G A;  4DU9 A;  2R7Z B;  1ILP A;  4DFA A;  3I8Z A;  3HOV H;  2FXQ A;  3N6R A;  5AJ3 Q;  4LF9 L;  2K75 A;  3TP5 A;  1R4P B;  4X66 Q;  3QJY A;  2KCT A;  4DR3 Q;  4JV5 L;  1OXS C;  2FJ2 A;  1FR3 A;  1E1T A;  1RF2 D;  2B8G A;  1KLU D;  1Y1V G;  5CGK A;  3CC4 A;  2E75 C;  2WP8 J;  2A5H A;  1UAP A;  2F3W A;  1Y1V H;  1PVO A;  2WFW A;  3E6Z X;  2F0E A;  2FMC A;  4IJH A;  1SRU A;  2BCO A;  1NMG A;  1XTC D;  2OWO A;  1C7Y A;  2R92 H;  2L12 A;  2R7F A;  3KLW A;  1EIG A;  3ERO A;  4KLK A;  4DA2 A;  1HNZ L;  1HNX L;  3S1R B;  3GTM H;  1SE2 A;  2YV5 A;  4A3J G;  4LFB L;  1PH2 A;  2LS0 1;  4QUF A;  4LFC Q;  2NYZ D;  4GN5 A;  4A3J H;  2UXB L;  4FF1 A;  3I4M B;  5IOC A;  3G7L A;  4DR1 Q;  3T56 B;  3NEN A;  5BN3 A;  2CVR A;  1VQ4 A;  1PH9 A;  1NNX A;  2B2W A;  1EFI D;  1E7Z A;  2KCN A;  4IUU A;  5ELO A;  2NVT H;  2F0V A;  2IY5 B;  1T5X D;  2EJG C;  2Q8R E;  3B6Y A;  2IWH A;  1DD2 A;  4LUZ A;  2J7Z A;  3KLS X;  4IO9 A;  3J80 i;  2JA5 G;  2JA5 H;  2RHQ B;  3CCE A;  4C3H B;  2LXK A;  1VQJ A;  4KY7 A;  3A56 A;  5CMD A;  1FGU A;  3J7A V;  1SMX A;  1H9S B;  4H44 C;  2A69 C;  4GN3 B;  4RGT A;  1PA6 A;  3BYY B;  4AH6 A;  1VQ6 A;  1NSN S;  2IX3 A;  4HMJ A;  3VA7 A;  3RLF A;  5JJI A;  4RGN A;  3SR1 A;  3CPW A;  1HZB A;  1XNQ L;  4CBV A;  4AQY Q;  4Y52 H;  1SDF A;  3IAY A;  2K05 A;  1I50 H;  4EQN A;  1EYG A;  2AUJ D;  3D8G A;  3H6M A;  2Q2T A;  4BBS G;  1ILQ A;  1LTT D;  1WD1 A;  3HOU B;  3SK6 A;  3L3O C;  5GAE C;  5C3W A;  4BBS H;  4HSV A;  2EQS A;  4K8I A;  4JW0 A;  2DN8 A;  3A54 A;  2RDG A;  3E3X A;  4RAU C;  3DHQ A;  4DR2 Q;  4UP9 A;  1AZP A;  4OIJ A;  4UHV A;  4DUY Q;  5FOB B;  1FJG Q;  3CRL C;  2PMZ B;  1U0L A;  2LSS A;  1KXL A;  1I4P A;  3FHW A;  1PTO D;  4DR4 Q;  2KHI A;  1D7Q A;  1PRT C;  3C2P A;  3JAM E;  1XJV A;  2KUM A;  3P20 A;  3NPP A;  2A68 D;  2K14 A;  3RN2 A;  1IYU A;  3CCJ A;  4NKL A;  3PF4 A;  1BBU A;  4MZ9 A;  1SFO B;  1N36 Q;  2ZJR A;  2AQ2 B;  3WDN A;  2SNS A;  4QCL A;  3U4Z A;  2V4D A;  5FLX E;  2QA4 A;  2VB2 X;  2XRS D;  3R93 A;  1SE3 A;  2NTT A;  4JI8 Q;  4JI7 Q;  1TQO A;  1PTO B;  4JC0 A;  2NVY B;  4KMU C;  2EYM A;  4NW2 A;  5E3F A;  4NXM Q;  1QE6 A;  2L4N A;  3CW2 C;  3PO3 B;  3Q8D A;  3KF8 B;  1L2F A;  4RGO S;  1B50 A;  4DR6 Q;  2X69 A;  1PH3 A;  3X3M A;  3NQT A;  5T1G A;  4DAY B;  2F0L A;  3RZO B;  1YJW A;  1IW7 D;  5C6A A;  2NZ1 D;  4P75 A;  4R4Q A;  3D31 A;  4RKB A;  3HOZ G;  4B9W A;  5BR8 L;  1L0W A;  1GKH A;  1EFW A;  1I6H B;  3UE1 A;  2O5I C;  3WWV A;  3MFY A;  3HOZ H;  1SN8 A;  1YVC A;  1Q82 C;  3QR8 A;  1NJI C;  5M5Y H;  1VQP A;  1TY0 A;  1CQF A;  1JT8 A;  2JK8 A;  4XT3 B;  2K4K A;  3M9B A;  2FMM A;  4TSS A;  2B63 G;  3H0G G;  5M3M G;  2YTV A;  1K83 B;  2B63 H;  3H0G H;  1N33 Q;  4DV1 Q;  5M3M H;  3C1F A;  1MI2 A;  4AYB E;  1A2T A;  5EKK A;  1MD2 D;  1LTL A;  4XTC S;  1HPC A;  3FP9 A;  4OIK A;  2E5L L;  4B3R Q;  4ILW A;  1I4R A;  1JWU D;  4X3K A;  2Z4I A;  1X9N A;  3J7Z C;  5EPL A;  1HQM C;  1TII D;  3OMG A;  4FYD A;  3NHH A;  5IP7 G;  2M9V A;  1GHJ A;  3K0X A;  2R93 B;  2QEX A;  2E8G A;  5IP7 H;  2JEB I;  1X55 A;  1XWE A;  2HHH L;  4Z9C B;  2F4V L;  3TP6 A;  1SE8 A;  3MWY W;  3HOY B;  2CWP A;  4DV5 Q;  5HY6 A;  2VL6 A;  5E1F A;  3WOF A;  2N88 A;  4RFB A;  1PFN A;  1SYD A;  2G9H D;  3MXG A;  4QIW E;  4JYA L;  2VS1 A;  2F0Q A;  1F9P A;  1IYJ B;  5GAD C;  1VMC A;  4A3B G;  3MEH A;  3I55 A;  1G29 1;  4KY6 A;  3MZ5 A;  4H13 C;  4A3B H;  1B44 D;  3J80 L;  5KRU A;  2JA6 B;  1SRO A;  4IOC A;  2HDL A;  4JI1 L;  1IBK L;  4YWK A;  1JOK A;  1W3S A;  3FKI G;  2I5L X;  2B2V C;  3AFQ A;  4YCW A;  3L7Z C;  3GTK B;  1GUS A;  3FKI H;  4DK6 C;  1JIC A;  3KF6 B;  3M4Y A;  2F0O A;  5C4Z A;  2JJQ A;  1UWV A;  3M85 A;  2H4O A;  4TVA B;  3T4A C;  4QF4 A;  1TT2 A;  3I4N G;  2F0D A;  2JSO A;  1FD7 D;  4HJ9 A;  4L5Q A;  4DV7 Q;  1VDZ A;  3CHB D;  3I4N H;  4OHJ A;  2JXM B;  5F2D A;  1HXY D;  5BN4 A;  4K0K L;  1SNM A;  4HIO A;  2IPK D;  2ZT9 C;  3F1Z A;  3RN5 A;  3GTL H;  4IPG A;  3CPF A;  4IN3 A;  4GKK L;  2EE1 A;  1KRT A;  4LF5 Q;  4FDB A;  2QDB A;  4GNX A;  5EBD A;  4IUP A;  1BVS A;  1QB5 D;  1U9R A;  1LT4 D;  2VW9 A;  1HA5 A;  3CCS A;  3G71 A;  3E0J A;  1RCV D;  5EPJ A;  2JE6 I;  3V05 A;  1FNW A;  1EUJ A;  1S5C D;  4KI0 A;  4B3T L;  3D4R A;  4DK0 A;  1F2L A;  1UUP A;  3RZD H;  4CJ1 B;  4N8F A;  2ATW A;  3ONA B;  1JJ2 A;  1AP0 A;  3BU2 A;  3K5L A;  1WYD A;  1TWC H;  4BY1 B;  4IQZ A;  1YNX A;  2UUC L;  3K6O A;  3BYT B;  3HKZ B;  2UU9 L;  2NTS A;  1L1O C;  4A3D G;  5IT9 c;  5LL6 X;  5DLQ E;  2K5N A;  4XXE A;  1XNR L;  2KCC A;  5C4X G;  2F0G A;  4A3D H;  3M4O B;  1EY5 A;  1D5X C;  3VDY A;  2PZU A;  2CH4 A;  1TWH H;  3VYR A;  4WJ3 M;  5C4X H;  1GJX A;  1F9R A;  1EOV A;  3F2U A;  1UE1 A;  4JI0 L;  4P72 A;  3M4Q A;  4B3M L;  4DR5 L;  4JVZ A;  4V19 0;  3OIP A;  4HJA A;  2A19 A;  3D4D A;  5J22 A;  5C44 G;  3J81 c;  1PH5 A;  3ULJ A;  2F0T A;  2KBN A;  4DV6 L;  1N32 L;  1XXG A;  4ME3 A;  5C44 H;  2N78 A;  4JOI C;  2ZTC A;  3DM3 A;  3K8A A;  4B3S L;  1E3P A;  4L6T B;  1D2B A;  1Z47 A;  3STB C;  1F2Y A;  1Y69 U;  4DV0 Q;  5CV5 A;  2F0F A;  5IYC G;  1TS5 A;  3D3R A;  4EQ5 A;  1G2S A;  2F3I A;  5IYC H;  4R4T A;  1JMC A;  2GVB A;  5EPK A;  1MIU A;  4R8N A;  3T1H L;  1LT3 D;  2BDO A;  3MFG A;  3CXC A;  4OX9 Q;  4PZ7 A;  1RKN A;  3QOJ A;  1TS4 A;  2B2Y C;  2ZM6 Q;  5CV8 A;  3HKS A;  4S3S A;  4H7B A;  2K5Q A;  4KKU A;  3NP8 A;  4A3C G;  4EGV A;  2NVX B;  3TME A;  3VR4 A;  4GNX B;  1R9T H;  4A3C H;  5KNB A;  4YWM A;  3HOW B;  3FPP A;  1UE6 A;  2E74 C;  2EIF A;  2EOT A;  3HZX A;  1NCV A;  3I4O A;  4OWT B;  4A3E B;  1BF4 A;  3S2H B;  4KKT A;  1E22 A;  4BY7 G;  1S5E D;  2VUM B;  2KEN A;  1VQC A;  2ZXP A;  4BY7 H;  1W6J A;  1B3A A;  2A6E C;  2QF7 A;  2ASB A;  1ROD A;  5LL6 S;  2PNR C;  3TZD A;  4AYB G;  3M4P A;  2IX1 A;  1UEB A;  1UNS A;  1TWF B;  1B2T A;  4CDE C;  1AW7 A;  1AN8 A;  3AMU A;  3MA2 B;  1YNJ D;  4X64 L;  1WTO A;  4HAE A;  3K5O A;  1SXT A;  1DOM A;  1JJG A;  3S17 H;  3OMC A;  5A2Q E;  3IRB A;  3MXN B;  5LMN W;  3OYY A;  1KNE A;  4JI5 L;  1F9S A;  1I4X A;  5EGT A;  2ID0 A;  3MHB A;  1OXV A;  2KVM A;  2EYL A;  1PTO F;  5FLX L;  2SOB A;  2UUB Q;  1E2V A;  3KLS A;  4RGM A;  3S2D B;  1SYB A;  1EQV A;  2E2J H;  1RIP A;  3GTO B;  2JA7 B;  4DR7 L;  3U58 A;  3NTK A;  3G48 A;  4CDF C;  4C3J G;  3S16 B;  4LK1 C;  3Q23 A;  5DM7 3;  4C3J H;  1TWG B;  5D3D A;  1F77 A;  2R61 A;  1KTK A;  2QEJ C;  2M00 A;  1XPO A;  4MNO A;  1YBY A;  2IT1 A;  3AU7 A;  4IJL A;  4OXP A;  1VF5 C;  2RSN A;  2F52 A;  2NB0 A;  1LTR D;  1I3Q H;  4J8Q A;  5C3E G;  1N9W A;  1WTP A;  4NXN Q;  4B9X A;  3ULL A;  5C3E H;  5CBA E;  2WKC A;  1VQ5 A;  4LF7 L;  2B2W C;  4HCE A;  2Z9H A;  5D65 A;  3KBX A;  2N3S A;  1MJE A;  1LM0 A;  3M3Y B;  4JI3 L;  3SK8 A;  1CKO A;  1CM9 A;  1HJP A;  2L15 A;  2XSC A;  2RCF A;  5I2X A;  4JPB W;  2F0J A;  3K80 C;  1IL8 A;  1VQ7 A;  3NXW A;  3FEW X;  4KN4 C;  3J7A 5;  1YHA A;  2WAQ E;  3NTH A;  1JR0 D;  2Y0S E;  1VF7 A;  4X62 Q;  1IBM L;  2NUC A;  2BA1 A;  1C48 A;  1BOS A;  2HQL A;  4WFN 3;  1MBY A;  5HGT A;  2MQH A;  4J1M A;  1JE5 A;  4G7O C;  1DOK A;  3MXP A;  5I6Y A;  2X6L A;  4X3T A;  2VQF L;  3OWF A;  1D5M C;  1WTR A;  2DY7 A;  1I5F A;  2K5V A;  3O13 A;  1VQM A;  1W2B A;  1S40 A;  1FNV A;  2MHV A;  5LMN L;  2PYK A;  1Q7Y C;  3BDC A;  4X3S A;  4LF6 L;  3S24 A;  2H1E A;  1BDO A;  2IX0 A;  1NY4 A;  3AB9 A;  3R8B A;  1HNW L;  1OO9 B;  1HFG A;  2WII B;  3HOX B;  1A62 A;  4A3G G;  1IBL Q;  5HUR A;  2E2D C;  3RD4 A;  5C5L A;  4I7A A;  1XMO L;  4ABN A;  4MIU A;  4A3G H;  3A8K E;  4NDX A;  1WTH A;  4HTH A;  4P74 A;  3I91 A;  1H9S A;  4QB4 A;  1HUN A;  1BKB A;  1M4V A;  1Y1W B;  2VY3 A;  1BCP D;  3CME A;  2GA4 B;  1U4P A;  2KHJ A;  3PSI A;  3PMF A;  3W1B A;  4C1N I;  3FPU B;  4IPH A;  2JA5 B;  1A3V A;  2AQ3 B;  3K58 A;  1EQR A;  2PMZ E;  5A35 A;  1Q1E A;  1ZYR C;  5FJ8 G;  4GKJ Q;  3E0E A;  3LWU A;  4WOR A;  2F4I A;  5FJ8 H;  2QKI C;  1AEX A;  1JQY D;  1LUZ A;  1K8O A;  1YNN D;  1TR5 A;  2QCP X;  1X3P A;  2HIV A;  3LNN A;  4CKC A;  4PMC A;  2PI2 A;  3PCO B;  3NSW A;  4JCV E;  1I50 B;  1CSQ A;  5IWA Q;  3UDX A;  4ME5 A;  1EZ6 A;  2J0T D;  1O7Y A;  1J5E L;  2Q8T A;  2R92 G;  1K3R A;  1WVL A;  3RMH A;  1EY6 A;  1U5K A;  2YTY A;  4LF4 L;  3SE0 A;  3BG3 A;  1WCM G;  3A7L A;  3SK5 A;  5KND A;  2N55 A;  1WCM H;  4ULL A;  4LUO A;  2CWA A;  4YY3 Q;  1DXM A;  1JJC B;  1CI3 M;  3KJP A;  1KAB A;  1GXD C;  4FP5 D;  2YU9 H;  4A76 A;  3NWT A;  2XVS A;  1HR0 Q;  4L8J A;  3RLN A;  3I90 A;  2UXC Q;  4F88 A;  4JBM A;  5AJ3 L;  1XPU A;  2MUY A;  5JEA G;  3S15 H;  1SJH D;  1YHB A;  4X66 L;  4K2K A;  3TRZ A;  1HH2 P;  4DR3 L;  4BS9 A;  4F7X A;  5JEA H;  4APV A;  1STA A;  3HGB A;  1NAP A;  2Z4H A;  3ULP A;  3CU7 A;  3KF8 A;  2RKS A;  3K57 A;  4ZKB B;  2MO1 A;  5IYB G;  1TS3 A;  3K7A H;  3PO2 B;  4DAY A;  1VQH A;  1D1K A;  5IYB H;  5C4J H;  1EWI A;  3PIO 3;  4Y7N B;  5BN5 A;  3SDZ A;  2FIN B;  2A74 C;  1H9M A;  3CRK C;  4LFC L;  2EXZ A;  1BO0 A;  4XQQ A;  1WD0 A;  1CQV A;  4K5W A;  1XPR A;  1S72 A;  1JC7 A;  1FYC A;  4DR1 L;  5IIF A;  3A8I E;  3QWN A;  4KV6 A;  1I4H A;  4CJ2 C;  1O80 A;  4G7Z C;  2L0C A;  1MHW C;  1TWA B;  3UI2 A;  3HOZ B;  5IGF A;  3DWP A;  1K28 A;  2SNM A;  3OTO Q;  4RHR A;  5M5Y B;  4BA2 I;  2ZXR A;  1X6O A;  4Q0F A;  2K03 A;  2MNA A;  1S5B D;  2ICE C;  3E9I A;  2P5Z X;  1PH1 A;  1KHI A;  1Y8O B;  4NB3 A;  2E2I H;  2B63 B;  2OTJ A;  3OIQ A;  4IOA A;  1FGB D;  3ND9 A;  1O7Z A;  3U9O A;  3S1R H;  3I70 A;  1JE4 A;  1LV9 A;  1Q81 C;  2JA8 G;  3PIO A;  4OON A;  2RDH A;  4AQY L;  1PH4 A;  2XRQ D;  5GAG C;  2EYP A;  2JA8 H;  5CR3 A;  2WAQ G;  4BBR B;  1ET6 A;  4GNX C;  1VQA A;  2Y0S G;  5KYL A;  1EU4 A;  1A8V A;  2F0U A;  5EBC A;  4GS3 A;  5A2Q L;  2EYF A;  1XMQ Q;  4DR2 L;  2A6H C;  4C3H G;  3KF6 A;  4DUY L;  1X65 A;  3A5U A;  1SE4 A;  3TRE A;  1FJG L;  1RD9 D;  4OL7 A;  2TMP A;  1E0B A;  4C3H H;  4CDC C;  1G51 A;  3OSO A;  3L2P A;  1B1Z A;  3H94 A;  1GOZ A;  4RHS A;  3KBG A;  1IXR A;  1NMF A;  3QO2 A;  4DR4 L;  3KFU A;  3L9A X;  1BNZ A;  4KHP Q;  3A74 A;  4ZKC B;  3OWE B;  5G3L D;  4A93 B;  1KLG D;  3G4S A;  1EY0 A;  3DMU A;  3FKI B;  2F0S A;  1VMP A;  2GN5 A;  3TZU A;  1GUW A;  3I73 A;  4BWG B;  5IP9 G;  1N36 L;  2I0Q A;  4A3M B;  5C3X A;  3CMA A;  5IP9 H;  2D5D A;  2K04 A;  2EXD A;  5L37 A;  1LYL A;  4HIM A;  1AE3 A;  3GV3 A;  4L63 B;  3HKZ E;  2AKW B;  1GD7 A;  1II3 A;  4JI8 L;  3S9W A;  3P1H A;  4JI7 L;  5FKA C;  4FXD A;  3ZYY X;  3BZC A;  3A7A B;  4DV4 Q;  3GTL B;  2C9O A;  4NXM L;  1CKN B;  2ZXO A;  4ZCK A;  3SXH A;  5K36 G;  2QW7 A;  4A4I A;  5T1I A;  5CC4 A;  5I9P A;  1Z9F A;  5K36 H;  3L0O A;  3J80 c;  3SK4 A;  2OF1 A;  1MSH A;  4DR6 L;  4LJZ C;  4FVM A;  4HJ5 A;  3TQY A;  2B2T A;  2WV6 D;  2CW0 C;  1F2M A;  1SMY C;  3DXJ C;  4JI6 Q;  3VYT A;  1PFM A;  3EBE A;  1SYE A;  2FFK B;  1SFO H;  1QJO A;  2RCN A;  1BR9 A;  1HZ9 A;  2E2H H;  2KEC A;  4AIM A;  1Z7T A;  3GTG B;  5M5X B;  2F0M A;  2L1B A;  3OHX C;  4KHZ A;  3JAM i;  1LT5 D;  1ASZ A;  1P8L A;  1N33 L;  2KCM A;  1VQG A;  2ES2 A;  2NVY H;  4B3R L;  1QVF A;  1TWH B;  5C4X B;  3PO3 G;  4H0L C;  1PFB A;  1X56 A;  3GTJ H;  2LY7 A;  2CCZ A;  3PO3 H;  2CQA A;  1QNK A;  1Q8I A;  3IFT A;  4DN4 M;  3T51 B;  1D5Z C;  1LO5 D;  1TKW B;  2AWO A;  3EA6 A;  2HD3 A;  2RSO A;  1DON A;  3CC2 A;  4DPG A;  5C44 B;  2EY1 A;  2BE5 C;  1X3Q A;  2RDF A;  1D8L A;  2PPB C;  3TDQ A;  3DWQ A;  1I4G A;  1R4Q B;  4DV5 L;  2KA7 A;  2MPM A;  2Z6K A;  4O1N A;  2D0O A;  3ERS X;  2K5D A;  2DNE A;  3QG1 A;  2OTL A;  3F8T A;  1DM0 B;  1MGS A;  1I6V C;  3D6W A;  4A75 A;  3V96 A;  2Q8I B;  3GTQ H;  1EEI D;  1K3B C;  1JB3 A;  1A63 A;  2N49 A;  1CFM A;  1K83 H;  3A0J A;  2OEO A;  2UU9 Q;  1O7I A;  5E4X A;  4R8I A;  2RHS B;  1RJT A;  1PYB A;  3M7N A;  2I46 A;  4LNQ A;  3FMC A;  2EY2 A;  3S1Q H;  4G7H C;  4RMF A;  2F1M A;  2A69 D;  5IGB A;  3A5Z B;  5C0X I;  1R9T B;  1AE2 A;  2NZO A;  3D0F A;  1TY2 A;  4DK1 A;  3H3V C;  1KC8 C;  5IGE A;  1W6K A;  4DV7 L;  1GUT A;  1C4Q A;  1MKH A;  4P2C B;  4NMZ A;  3OOC A;  4U68 A;  1BQQ T;  5ELD A;  1WTW A;  4PG3 A;  1PXU A;  2PNH A;  3KJO A;  3HP3 A;  3MXN A;  1B9M A;  3CCM A;  3MC0 B;  2D2C C;  1X3G A;  2B29 A;  3MXU A;  1VS0 A;  1OXU A;  1SR3 A;  4LF5 L;  3CKI B;  1EY4 A;  4C2M H;  1X32 A;  1EU3 A;  1LTG D;  1Y8P B;  1HUM A;  2I5H A;  4QY7 A;  1NUC A;  4P73 A;  2BH8 A;  1EIY B;  5JPN C;  3S1M B;  1JCK B;  3GTK H;  1EY9 A;  1M8A A;  1BUV T;  2EPB A;  1PRT D;  5NUC A;  3T1Y Q;  2ICI A;  3KK7 A;  4F87 A;  2NWG A;  3GP7 A;  4UPA A;  1VQF A;  1OXX K;  2KHS A;  1M90 C;  4QJF A;  4J6H A;  3DUZ A;  3GTP H;  4GOP A;  4HSP A;  4UAI A;  1DYQ A;  4PV1 C;  1U4M A;  4X65 Q;  1STY A;  4KHV A;  4BA1 I;  2A73 B;  4A3I G;  1MJC A;  1T9H A;  1D6E C;  1DJR D;  4IUQ A;  4K6L A;  1PRT B;  4UY8 C;  3S14 B;  1HHV A;  4RG1 A;  4A3I H;  1TXY A;  1VQE A;  3JC6 6;  3J81 j;  4QQB X;  2MP1 A;  4PQX A;  1SND A;  4HIK A;  2F0K A;  5I9O A;  4I65 A;  4LF8 Q;  1LTS D;  1TU2 B;  5KNC A;  4C56 C;  2M2L A;  3CCU A;  5TSS A;  4JI2 Q;  1HA6 A;  1WTQ A;  5AFW A;  3K0Y A;  4DV0 L;  3I3C A;  4CKE A;  1J6Q A;  4LFA Q;  5C3E B;  5IOD A;  4BY1 G;  4O42 A;  2Q2H A;  4A3F B;  4DV3 Q;  2JP1 A;  4H02 A;  4BY1 H;  4RCO A;  1A6X A;  1QVC A;  4DUZ Q;  1IKL A;  3U4V A;  1NE3 A;  5FLX c;  4OX9 L;  2EJM A;  2Z8L A;  2L5T A;  4F8M A;  1V1Q A;  4PMB A;  1MSG A;  3AFP A;  2ZM6 L;  1I94 Q;  2XTI A;  4OWW B;  5CBE E;  3JAM L;  4DXG A;  1EWC A;  5FLM H;  3URY A;  4BXX G;  3H3V I;  2AMC B;  1J8I A;  1IZ6 A;  2IHF A;  2HUG A;  4BXX H;  1Q46 A;  2PZT A;  1LAB A;  2BH2 A;  1A0I A;  4IUV A;  5FO9 B;  1H95 A;  2XN9 C;  1E2Z A;  4PMW A;  2GVA A;  1JOR A;  5LMU Q;  3IL8 A;  1N34 Q;  2B39 A;  1PDQ A;  3PIP A;  1EYD A;  3EIV A;  2BA0 A;  2PQE A;  2F3V A;  3C3L A;  2UXD Q;  2DJF C;  4GOP B;  3GV6 A;  2JEA I;  2R6G A;  1FNU A;  4DGZ A;  5J1Z A;  1SNO A;  3EJI A;  3G6J B;  4A3G B;  2V1C C;  1EEF D;  5M5W H;  1K8G A;  2XWJ B;  5DAU A;  5LHY 1;  4A3K G;  3S1N H;  3ITP A;  3RNU A;  1QVG A;  1PZJ D;  2HQE A;  1B53 A;  2NVX H;  1D1I A;  4A3K H;  1N8R C;  2WB1 B;  2UUA Q;  3CQZ B;  4NP5 A;  3BVM A;  1PTO C;  1DZ1 A;  1CA6 A;  1Q3L A;  2VUM G;  4DAP A;  4GLA C;  3S2H H;  1CTM A;  4JI4 Q;  1QWY A;  2NVQ B;  2VUM H;  2Z0S A;  1EQQ A;  2EYO A;  2LKV A;  3SEB A;  3K81 C;  1ZKO A;  2A68 C;  3UDG A;  2UUB L;  2RQX A;  3HOV B;  4IFD J;  1STB A;  5G3L F;  3A55 A;  4DK3 C;  2BOS A;  1U4L A;  2LMC B;  2MO0 A;  2K01 A;  3E9H A;  4JOI A;  4DV2 Q;  1TWF H;  4RH6 A;  3TEH B;  2B2U A;  3C46 A;  1GM5 A;  4C3I G;  1VQD A;  4XIG S;  3I4L A;  3D4W A;  2DNC A;  5D14 A;  4C3I H;  2ZTD A;  1YZ6 A;  4FF2 A;  2HCI A;  4HMI A;  1WFQ A;  4QMG A;  1Y1V B;  2JYO A;  5C0X G;  5C5M A;  5GQO A;  4NXN L;  4E6I A;  5C0X H;  2R92 B;  2J4X A;  5IYD G;  1JB7 A;  1Q86 C;  3BVZ A;  1CKM A;  1WCM B;  2ZJQ A;  3GTM B;  5IYD H;  3TN2 A;  2K1B A;  4I7Z C;  3F2D A;  4YHH Q;  4OO1 I;  2VQE Q;  1IW7 C;  4A3J B;  4L5S A;  3I72 A;  1KDB A;  4N8X 1;  1O7L A;  1HTL D;  1Y14 B;  2K32 A;  2A1A A;  1IYV A;  5JJZ A;  2NN6 I;  1ZEQ X;  2KQ3 A;  2EDG A;  3KDF B;  1PYW D;  3DWA A;  4QL5 A;  1DGS A;  4LF9 Q;  3S15 B;  2NVT B;  3P75 A;  3RR5 A;  2DY8 A;  4FO2 A;  4JV5 Q;  1CSP A;  4X62 L;  1TWG H;  3F2B A;  4KN7 C;  4CDD C;  4DKA C;  1QZG A;  1HR0 W;  3TP7 A;  1KL9 A;  4J15 A;  2PI2 E;  2EYJ A;  3K7A B;  2JQO A;  2L11 A;  3CCL A;  1K0R A;  3G6E A;  4IUN A;  5C4J B;  4K2L A;  1J9O A;  1WJJ A;  1RTO A;  1HNZ Q;  5GAH C;  1WTV A;  1HNX Q;  4ZLT F;  5I2Y A;  3STB D;  4JG2 A;  4LFB Q;  2VB3 X;  1ML0 D;  3VA5 A;  2OT2 A;  3EFX D;  5M3F G;  2UXB Q;  1KQS A;  1YIT A;  1QZH A;  1IKM A;  3OW2 A;  2QGQ A;  1BCP B;  5M3F H;  1B3Q A;  3NK9 A;  1YI2 A;  1IBL L;  1ZXT A;  1GUN A;  4UP7 A;  3CF5 A;  2PW5 A;  5CV6 A;  3RUZ A;  1SYF A;  4ODG A;  3EN2 A;  4YCU A;  4BBS B;  4LAA A;  3DEO A;  3CCR A;  3IFD A;  1I4Q A;  2TSS A;  2OXP A;  1ASY A;  1V1O A;  2K5H A;  1GHK A;  3P7J A;  5E7N A;  1E24 A;  2E2I B;  1TS2 A;  4GKJ L;  3KUP A;  1SLJ A;  3KOJ A;  1CZG A;  2CHB D;  3GQB A;  1PH7 A;  1SYG A;  1RL2 A;  1VQ8 A;  3K7U C;  3HOX G;  4WJW A;  3CCV A;  2A6E D;  4PZ8 A;  3HOX H;  1B4O A;  3DM1 A;  1XNQ Q;  4A3L G;  4HCS A;  4R4I A;  1H9J A;  4EVO A;  3CCQ A;  5JVG 3;  2JA8 B;  4R4C A;  3PQI A;  4O2D A;  2XWB B;  1C8C A;  4A3L H;  4IZ8 A;  5IWA L;  3VR5 A;  1HZC A;  3T13 A;  5IT9 E;  1ENC A;  2WAQ B;  2K33 A;  1Y1W G;  5JEA J;  4YCV A;  1KD1 C;  2Y0S B;  2F0N A;  1CHQ D;  3H3V H;  4MTK A;  4DAM A;  1ICF B;  1Y1W H;  1G6Z A;  2KJX A;  2FHT A;  2B2T C;  3U50 C;  3ZJY C;  4YY3 L;  2ALY B;  2F03 A;  3J81 E;  1Y8N B;  1SNC A;  3FDT A;  4MHE A;  3EVQ A;  3BJU A;  2R7Z G;  1HR0 L;  2R7Z H;  3H09 A;  4EQO A;  1IHZ A;  1CHP D;  2WAC A;  3Q24 A;  1C9O A;  2UXC L;  1KDC A;  2NBF A;  4OEL B;  3NWS A;  4HR7 B;  1LTI D;  3CC7 A;  2VNU D;  1STE A;  1PRT F;  2KED A;  5IGG A;  4FXK C;  4OGQ C;  1CKN A;  5IGD A;  2RA4 A;  4YIJ A;  4KD4 A;  4TKO B;  3CP0 A;  3BZK A;  1XX8 A;  2JA9 A;  4XQJ A;  5M9O A;  1VQI A;  4ALP A;  3U9S A;  3H0G B;  1ENF A;  1S5D D;  5D3I B;  4RA8 A;  5M3M B;  1GO3 E;  1KNA A;  1F9Q A;  1OXT A;  1DOL A;  1CUK A;  2Z1C A;  1YIJ A;  1Q1B A;  2C35 B;  3I4M G;  1K73 C;  2Z6K C;  3VR2 A;  2L9H A;  1Q12 A;  3I4M H;  1PYS B;  2K7V A;  4MTN A;  3LX0 A;  5CYU A;  4DF7 A;  3K5M A;  2Q2U A;  3BVG A;  2IJ0 A;  2OQK A;  4XQN A;  1CT1 D;  3PUX A;  1U4R A;  3NQI A;  1QCB D;  5JPM C;  3ER0 A;  3UDI A;  3VR3 A;  5BR8 Q;  5JAV A;  2IW3 A;  4K5X A;  2E76 C;  3K59 A;  3OTO L;  1G91 A;  1X54 A;  1L0X B;  1E1O A;  2RVL A;  1KRS A;  3D6C A;  3PO2 G;  2E2H B;  5JJK A;  1FL0 A;  5J3B A;  3TSS A;  3BDL A;  2KOL A;  3PO2 H;  4YWL A;  1SSO A;  4A3B B;  4Y7N H;  5I4D A;  4OO1 G;  3PUW A;  4L5R C;  1FVI A;  2PO4 A;  5EQ0 A;  2E5L Q;  4LMQ D;  1A15 A;  1OTC A;  4OO1 H;  3ERQ A;  1ONL A;  1ICW A;  1PZI D;  1JOO A;  5KEE A;  3X3N A;  3GTJ B;  5EJW A;  2NN6 G;  2EY6 A;  2XGT A;  3PF5 A;  2K5W A;  2NN6 H;  5DM6 3;  3R2I A;  2D9U A;  3HOU G;  1EYA A;  1EWH A;  5EKL A;  5C4H A;  3PV0 A;  2HHH Q;  3HOU H;  4XYO A;  2KEE A;  2F4V Q;  3I4N B;  1TWA H;  1GUO A;  3RLO A;  3NTI A;  1XMQ L;  3J81 i;  4L5T A;  1NBW A;  1WTX A;  1YNJ C;  4K8J A;  4JYA Q;  4PZ6 A;  2L55 A;  3V2T A;  4GZY C;  1NTG A;  3GTQ B;  4O0A A;  1YEZ A;  4FF4 A;  1RHP A;  1STN A;  2D62 A;  3GO5 A;  3QIA A;  1UEA B;  1C0A A;  2EYH A;  3UDF A;  4RWS C;  2EZV A;  4C1N K;  5ELF A;  4KHP L;  3Q0A A;  4JI1 Q;  1IBK Q;  2PW7 A;  2LXJ A;  3QOL A;  1VCI A;  4DNI A;  4DXF A;  4GOP C;  1V9P A;  2R3Z A;  3S1Q B;  4CHT B;  3PUV A;  1ZYR D;  5ELC A;  4CKB A;  1XYI A;  4R9W A;  4ZRZ A;  1EQT A;  4B08 A;  1SNQ A;  1B7Y B;  4BBR G;  5COY A;  1T5E A;  3RZD B;  4HN7 A;  1KAA A;  5FK9 C;  4BBR H;  1TWC B;  5JJL A;  5EAY A;  4DV1 L;  3T53 B;  1B9N A;  4IPD A;  3J7Y W;  2G9D A;  3H91 A;  4K0K Q;  1STG A;  1PTO H;  1WOC A;  4A3D B;  2D0P A;  4DV4 L;  1S3O A;  1ESR A;  1HZA A;  3W3A A;  4GKK Q;  3VR6 A;  4WJ4 A;  4DAV A;  3AQQ A;  4C2M B;  3R3O A;  3NBI A;  3AEV A;  2IHE A;  4XT1 B;  1SNP A;  1EYC A;  2EJF C;  4V0B A;  3RZO H;  2VXW A;  3TBI B;  4A93 G;  4QUC A;  1YJ9 A;  3UE0 A;  4N9P A;  4A93 H;  1HCZ A;  1QG7 A;  3VYS A;  4B3T Q;  1I6H H;  4JI6 L;  2HT1 A;  3Q22 A;  1EY7 A;  2O2L D;  4A3M G;  3I2Z A;  5DNF A;  1ESF A;  2OQ0 A;  4A3M H;  4DNR B;  2SEB D;  5K5P A;  1PFS A;  2DUD A;  3NEM A;  1DCZ A;  4IFD I;  2UUC Q;  3GTP B;  3MEF A;  1SJE D;  2I07 B;  2I5M X;  5J39 A;  1RDP D;  4K14 A;  4QGU A;  3TP8 A;  1XNR Q;  2ZTE A;  5ELB A;  1Q8K A;  4M8A A;  5KYI A;  1LT6 D;  4JI0 Q;  2R93 G;  1K8A C;  4G4K A;  4B3M Q;  4DR5 Q;  3MTS A;  3OW7 A;  2NZH A;  2R93 H;  1BCP F;  3J7A F;  2YYZ A;  2QDL A;  5I6W A;  2B8F A;  4DV6 Q;  1N32 Q;  4A3I B;  3HOY G;  4HID A;  4ZK9 B;  2MFI A;  3HOY H;  2DGY A;  4B3S Q;  5GRO A;  3F2C A;  3TS0 A;  5DEH A;  2SDF A;  4BY7 B;  4CJ0 B;  2CQO A;  4KD3 A;  4ZAI A;  5ISR A;  1K9M C;  3NUC A;  3HFZ B;  3GTG H;  5M5X H;  4ZQ3 A;  4JBJ A;  1EZ8 A;  1QUQ A;  4R4O A;  1UE7 A;  2RF4 A;  4AYB B;  3T1H Q;  2JA6 G;  1K8M A;  1SBB B;  3LWE A;  2JA6 H;  1XTD A;  1HQR D;  1F2Z A;  2F0W A;  3T16 A;  3S17 B;  3VYU A;  3SVM A;  4OEM B;  1BCP C;  1ET9 A;  3HRZ C;  1PLF A;  2ENB A;  2K52 A;  5CV9 A;  3SGI A;  4M1U B;  4POF A;  4CGY B;  1CK1 A;  1LTB D;  3K5N A;  3FRP B;  1JWS D;  2WB1 E;  1EIH A;  4LWC A;  4UP8 A;  2WKD A;  3CAM A;  2B2U C;  1IL2 A;  4P71 A;  2PZW A;  5KIX A;  4XDX A;  5EKI A;  1V1P A;  2O5J C;  5IT9 L;  1JWM D;  4EQP A;  5IY0 A;  1YNN C;  4QIW B;  1B70 B;  2G5D A;  3TS2 A;  4MN3 A;  2E2J B;  1CA5 A;  1H9K A;  2EY5 A;  3A8J E;  1S4Z A;  2CKZ B;  2B3G A;  1VQN A;  4OWX B;  1HTP A;  5ELN A;  1LTA D;  3ND8 A;  5CV7 A;  4HJ7 A;  4C3J B;  3J81 L;  3NE5 B;  5JVH 3;  2A6H D;  4HJ8 A;  4X64 Q;  1VQB A;  4K6D A;  3PIP 3;  4TQU S;  3ICE A;  4IUR A;  1PV4 A;  3JAM c;  5M5W B;  1I3Q B;  1Q90 A;  4KK7 A;  2AUK A;  4DNT B;  3MAQ A;  3S1N B;  2HDM A;  3T1Y L;  1BXT A;  2CFM A;  1K0S A;  3I56 A;  4A3K B; 
#chains in the Genus database with same CATH homology
 3BDO A;  3FVQ A;  5E4W C;  4IUT A;  1SAP A;  4ZYS A;  1E2W A;  4WRD A;  4KKS A;  2B2V A;  1O78 A;  3EQL C;  2AQ1 B;  4HED A;  3BZD B;  4KTA A;  1QNU A;  1GUG A;  3KLR A;  2F0H A;  3E5S A;  4FNF A;  1AFP A;  1QIL A;  4JBW A;  2BDN A;  4C3I B;  3MVV A;  4K5V A;  5FO7 B;  4XYQ A;  2O4X A;  1L0Y B;  1QOH A;  5ELE A;  2CW0 D;  1SMY D;  4RKL A;  1H9R A;  3HG9 A;  1AZQ A;  3Q6S A;  3NBH A;  1V1P B;  1EOT A;  2C5C A;  1G2T A;  2XIW A;  3M7G A;  5CV4 A;  3HS0 C;  1EL0 A;  2MGS A;  4ZUI A;  2RBM A;  1STH A;  3OPO A;  4U67 3;  1JOQ A;  3QB3 A;  1G8Z D;  4PNY A;  5JOB A;  3GD7 A;  2BE5 D;  1NR4 A;  4FF3 A;  1A2U A;  4IFD G;  1SYC A;  2LFN A;  1SEB D;  2F0P A;  4N9T A;  4IFD H;  4KY5 A;  3PUZ A;  1HFN A;  4IAL A;  2WIN B;  5M3F B;  1CZW A;  1EY8 A;  1PMR A;  2MJ8 A;  1LAC A;  1HRJ A;  1TVX A;  4Q5V A;  2EVB A;  1S5F D;  2F0I A;  1A3T A;  2B2Y A;  3HEJ A;  1V43 A;  3J80 E;  1NR2 A;  1A3U A;  2K6A A;  2YU9 B;  5C0X J;  4G57 A;  1V8Q A;  3W2D A;  3PUY A;  4KJO A;  5COR A;  4KJN A;  5KGU A;  4JK1 C;  4RCN A;  2QIL A;  1Z6H A;  5IGC A;  1RTN A;  3IKJ A;  5FO8 B;  1PZK D;  4ID6 A;  1KDA A;  2PCF B;  3DEP A;  2XNA C;  3C1E A;  4X3U A;  3R2T A;  1ENA A;  2HCC A;  4FXG C;  3SHL A;  1BBX C;  3BS1 A;  2IL8 A;  4TRD A;  2AWN A;  4UDU C;  3N52 A;  4ZUJ A;  1LLR D;  2K28 A;  3WOE A;  2X6G A;  4DU9 A;  2R7Z B;  1ILP A;  4DFA A;  3I8Z A;  3N6R A;  3TP5 A;  1R4P B;  3QJY A;  1OXS C;  2FJ2 A;  1FR3 A;  1RF2 D;  2B8G A;  1KLU D;  5CGK A;  2E75 C;  2WP8 J;  2A5H A;  1UAP A;  2F3W A;  3E6Z X;  2F0E A;  2FMC A;  2BCO A;  1XTC D;  2L12 A;  1EIG A;  3ERO A;  4DA2 A;  3S1R B;  1SE2 A;  4QUF A;  2LS0 1;  2NYZ D;  4FF1 A;  3I4M B;  5IOC A;  3G7L A;  3T56 B;  5BN3 A;  2CVR A;  2B2W A;  1EFI D;  2KCN A;  4IUU A;  2F0V A;  1T5X D;  2EJG C;  2Q8R E;  1DD2 A;  2IWH A;  2J7Z A;  3KLS X;  4C3H B;  4KY7 A;  3A56 A;  5CMD A;  3J7A V;  1H9S B;  4H44 C;  2A69 C;  4RGT A;  3BYY B;  1NSN S;  2IX3 A;  4HMJ A;  3VA7 A;  3RLF A;  4RGN A;  3SR1 A;  4CBV A;  1SDF A;  3IAY A;  2K05 A;  4EQN A;  2AUJ D;  3D8G A;  3H6M A;  1ILQ A;  1LTT D;  1WD1 A;  3HOU B;  3SK6 A;  3L3O C;  5C3W A;  4HSV A;  4K8I A;  2DN8 A;  3A54 A;  2RDG A;  4RAU C;  3DHQ A;  1AZP A;  4OIJ A;  5FOB B;  3CRL C;  2PMZ B;  1I4P A;  1PTO D;  1PRT C;  3C2P A;  3JAM E;  2KUM A;  3P20 A;  3NPP A;  2A68 D;  1IYU A;  4NKL A;  1SFO B;  2AQ2 B;  3WDN A;  2SNS A;  4QCL A;  2V4D A;  5FLX E;  2VB2 X;  2XRS D;  3R93 A;  1SE3 A;  2NTT A;  1TQO A;  1PTO B;  2NVY B;  4KMU C;  2EYM A;  4NW2 A;  5E3F A;  1QE6 A;  2L4N A;  3PO3 B;  4RGO S;  1B50 A;  2X69 A;  3X3M A;  3NQT A;  5T1G A;  3RZO B;  2F0L A;  1IW7 D;  5C6A A;  2NZ1 D;  3D31 A;  4RKB A;  4B9W A;  1I6H B;  2O5I C;  3MFY A;  1TY0 A;  1CQF A;  4XT3 B;  4TSS A;  2FMM A;  1K83 B;  3C1F A;  1MI2 A;  1A2T A;  5EKK A;  1MD2 D;  4XTC S;  1HPC A;  4OIK A;  4ILW A;  1I4R A;  1JWU D;  4X3K A;  2Z4I A;  5EPL A;  1HQM C;  1TII D;  3OMG A;  4FYD A;  3NHH A;  2M9V A;  1GHJ A;  2R93 B;  2JEB I;  1XWE A;  4Z9C B;  3TP6 A;  3MWY W;  3HOY B;  5E1F A;  3WOF A;  2N88 A;  4RFB A;  1PFN A;  1SYD A;  2G9H D;  3MXG A;  2F0Q A;  1F9P A;  1VMC A;  3MEH A;  1G29 1;  4KY6 A;  3MZ5 A;  4H13 C;  1B44 D;  3J80 L;  5KRU A;  2JA6 B;  2HDL A;  1JOK A;  2B2V C;  3L7Z C;  3GTK B;  1GUS A;  1JIC A;  3M4Y A;  2F0O A;  5C4Z A;  3M85 A;  2H4O A;  3T4A C;  4QF4 A;  1TT2 A;  2F0D A;  2JSO A;  1FD7 D;  1VDZ A;  3CHB D;  4OHJ A;  2JXM B;  5F2D A;  1HXY D;  5BN4 A;  1SNM A;  2IPK D;  2ZT9 C;  4IN3 A;  2EE1 A;  2QDB A;  5EBD A;  4IUP A;  1QB5 D;  1U9R A;  1LT4 D;  1HA5 A;  3E0J A;  1RCV D;  5EPJ A;  2JE6 I;  3V05 A;  1FNW A;  1S5C D;  4KI0 A;  3D4R A;  4DK0 A;  1F2L A;  1UUP A;  4CJ1 B;  3ONA B;  1AP0 A;  3K5L A;  4BY1 B;  4IQZ A;  3K6O A;  3BYT B;  3HKZ B;  2NTS A;  5LL6 X;  4XXE A;  2KCC A;  2F0G A;  3M4O B;  1EY5 A;  1D5X C;  2PZU A;  3VYR A;  1GJX A;  1F9R A;  3F2U A;  4V19 0;  3OIP A;  3D4D A;  5J22 A;  2F0T A;  1XXG A;  4L6T B;  1D2B A;  1Z47 A;  1F2Y A;  1Y69 U;  5CV5 A;  2F0F A;  1TS5 A;  3D3R A;  1G2S A;  5EPK A;  4R8N A;  1LT3 D;  2BDO A;  3MFG A;  1RKN A;  3QOJ A;  1TS4 A;  2B2Y C;  5CV8 A;  4S3S A;  4H7B A;  2K5Q A;  4KKU A;  3NP8 A;  4EGV A;  2NVX B;  3TME A;  3VR4 A;  5KNB A;  3HOW B;  3FPP A;  2E74 C;  2EOT A;  3HZX A;  1BF4 A;  1NCV A;  4A3E B;  3S2H B;  4KKT A;  1S5E D;  2VUM B;  2ZXP A;  1W6J A;  1B3A A;  2A6E C;  2QF7 A;  1ROD A;  5LL6 S;  2PNR C;  3TZD A;  2IX1 A;  1UNS A;  1TWF B;  1B2T A;  1AW7 A;  1AN8 A;  3AMU A;  3MA2 B;  1YNJ D;  1WTO A;  4HAE A;  3K5O A;  1SXT A;  1DOM A;  3OMC A;  5A2Q E;  1KNE A;  1F9S A;  1I4X A;  5EGT A;  2ID0 A;  3MHB A;  1OXV A;  2KVM A;  2EYL A;  1PTO F;  5FLX L;  2SOB A;  1E2V A;  3KLS A;  4RGM A;  3S2D B;  1SYB A;  1EQV A;  2JA7 B;  3GTO B;  3NTK A;  4C3J G;  3S16 B;  4LK1 C;  3Q23 A;  5DM7 3;  1TWG B;  5D3D A;  1F77 A;  2R61 A;  1KTK A;  2QEJ C;  2M00 A;  2IT1 A;  3AU7 A;  1VF5 C;  2RSN A;  2NB0 A;  1LTR D;  4J8Q A;  1WTP A;  4B9X A;  5CBA E;  2WKC A;  2B2W C;  4HCE A;  5D65 A;  3KBX A;  3M3Y B;  3SK8 A;  1CM9 A;  2XSC A;  5I2X A;  2F0J A;  1IL8 A;  3NXW A;  3FEW X;  4KN4 C;  3NTH A;  1JR0 D;  1VF7 A;  2NUC A;  2BA1 A;  1C48 A;  1BOS A;  4WFN 3;  1MBY A;  5HGT A;  4J1M A;  4G7O C;  1DOK A;  3MXP A;  5I6Y A;  2X6L A;  4X3T A;  3OWF A;  1D5M C;  1WTR A;  2DY7 A;  3O13 A;  1FNV A;  2MHV A;  2PYK A;  3BDC A;  4X3S A;  2H1E A;  1BDO A;  2IX0 A;  3AB9 A;  3R8B A;  1OO9 B;  1HFG A;  2WII B;  3HOX B;  5HUR A;  2E2D C;  3RD4 A;  5C5L A;  4ABN A;  4MIU A;  3A8K E;  4NDX A;  4HTH A;  3I91 A;  1H9S A;  4QB4 A;  1HUN A;  1M4V A;  1Y1W B;  1BCP D;  2GA4 B;  1U4P A;  3PMF A;  4C1N I;  3FPU B;  2JA5 B;  1A3V A;  2AQ3 B;  3K58 A;  5A35 A;  1Q1E A;  1ZYR C;  3LWU A;  4WOR A;  2F4I A;  2QKI C;  1AEX A;  1JQY D;  1K8O A;  1YNN D;  1TR5 A;  2QCP X;  1X3P A;  3LNN A;  4CKC A;  4PMC A;  3NSW A;  1I50 B;  4ME5 A;  1EZ6 A;  2J0T D;  1O7Y A;  2Q8T A;  1WVL A;  3RMH A;  1EY6 A;  3SE0 A;  3BG3 A;  3A7L A;  3SK5 A;  5KND A;  2N55 A;  4ULL A;  1DXM A;  1CI3 M;  1KAB A;  1GXD C;  4FP5 D;  3NWT A;  2XVS A;  4L8J A;  3I90 A;  4F88 A;  2MUY A;  5JEA G;  1SJH D;  4K2K A;  4BS9 A;  4F7X A;  5JEA H;  1STA A;  3HGB A;  1NAP A;  2Z4H A;  3CU7 A;  3KF8 A;  2RKS A;  3K57 A;  4ZKB B;  1TS3 A;  3PO2 B;  4DAY A;  1D1K A;  3PIO 3;  4Y7N B;  5BN5 A;  3SDZ A;  2FIN B;  2A74 C;  1H9M A;  3CRK C;  2EXZ A;  1BO0 A;  4XQQ A;  1WD0 A;  1CQV A;  4K5W A;  1JC7 A;  1FYC A;  5IIF A;  3A8I E;  3QWN A;  4KV6 A;  1I4H A;  4CJ2 C;  1O80 A;  4G7Z C;  2L0C A;  1TWA B;  3UI2 A;  3HOZ B;  5IGF A;  3DWP A;  2SNM A;  4RHR A;  5M5Y B;  4BA2 I;  2ZXR A;  4Q0F A;  2K03 A;  1S5B D;  2ICE C;  1Y8O B;  2B63 B;  3OIQ A;  1FGB D;  3ND9 A;  1O7Z A;  3U9O A;  3I70 A;  1JE4 A;  1LV9 A;  2RDH A;  2XRQ D;  2EYP A;  5CR3 A;  4BBR B;  1ET6 A;  5KYL A;  1EU4 A;  2F0U A;  5EBC A;  5A2Q L;  2EYF A;  2A6H C;  4C3H G;  1SE4 A;  1RD9 D;  4OL7 A;  2TMP A;  1E0B A;  3OSO A;  1B1Z A;  3H94 A;  1GOZ A;  4RHS A;  3KBG A;  3QO2 A;  3L9A X;  1BNZ A;  4ZKC B;  3OWE B;  5G3L D;  4A93 B;  1KLG D;  1EY0 A;  3DMU A;  3FKI B;  2F0S A;  1VMP A;  3TZU A;  1GUW A;  3I73 A;  4BWG B;  4A3M B;  5C3X A;  2D5D A;  2K04 A;  3GV3 A;  4L63 B;  1II3 A;  3S9W A;  3P1H A;  5FKA C;  4FXD A;  3ZYY X;  3A7A B;  3GTL B;  2C9O A;  2ZXO A;  3SXH A;  5K36 G;  5T1I A;  5CC4 A;  5I9P A;  5K36 H;  3SK4 A;  2OF1 A;  1MSH A;  4LJZ C;  4FVM A;  2B2T A;  2WV6 D;  2CW0 C;  1F2M A;  1SMY C;  3DXJ C;  3VYT A;  1PFM A;  1SYE A;  2FFK B;  1QJO A;  1BR9 A;  2KEC A;  1Z7T A;  3GTG B;  5M5X B;  2F0M A;  2L1B A;  3OHX C;  4KHZ A;  1LT5 D;  1TWH B;  5C4X B;  4H0L C;  1PFB A;  2LY7 A;  2CQA A;  1QNK A;  1Q8I A;  3IFT A;  4DN4 M;  3T51 B;  1D5Z C;  1LO5 D;  1TKW B;  2AWO A;  3EA6 A;  2RSO A;  1DON A;  5C44 B;  2EY1 A;  2BE5 C;  1X3Q A;  2RDF A;  2PPB C;  3TDQ A;  3DWQ A;  1I4G A;  1R4Q B;  2KA7 A;  2MPM A;  4O1N A;  2K5D A;  2DNE A;  3QG1 A;  1DM0 B;  1MGS A;  1I6V C;  3D6W A;  3V96 A;  2Q8I B;  1EEI D;  1JB3 A;  1CFM A;  2OEO A;  5E4X A;  4R8I A;  1RJT A;  3M7N A;  2I46 A;  3FMC A;  2EY2 A;  4G7H C;  2F1M A;  2A69 D;  5IGB A;  5C0X I;  1R9T B;  1TY2 A;  4DK1 A;  3H3V C;  5IGE A;  1W6K A;  1GUT A;  1C4Q A;  4P2C B;  1WTW A;  4NMZ A;  3OOC A;  5ELD A;  1BQQ T;  4U68 A;  1PXU A;  3HP3 A;  1B9M A;  3MXN A;  3MC0 B;  2D2C C;  3MXU A;  1OXU A;  3CKI B;  1EY4 A;  1X32 A;  1EU3 A;  1LTG D;  1Y8P B;  1HUM A;  1NUC A;  5JPN C;  3S1M B;  1JCK B;  1EY9 A;  1M8A A;  1BUV T;  2EPB A;  1PRT D;  5NUC A;  2ICI A;  3KK7 A;  4F87 A;  2NWG A;  3GP7 A;  1OXX K;  2KHS A;  4J6H A;  3DUZ A;  4HSP A;  4UAI A;  1DYQ A;  4PV1 C;  1U4M A;  1STY A;  4KHV A;  4BA1 I;  2A73 B;  1D6E C;  1DJR D;  4IUQ A;  4K6L A;  1PRT B;  3S14 B;  1HHV A;  2MP1 A;  4PQX A;  1SND A;  2F0K A;  5I9O A;  4I65 A;  1LTS D;  1TU2 B;  5KNC A;  4C56 C;  2M2L A;  5TSS A;  1HA6 A;  1WTQ A;  5AFW A;  3K0Y A;  3I3C A;  4CKE A;  5C3E B;  5IOD A;  4O42 A;  4A3F B;  2JP1 A;  4RCO A;  1A6X A;  1IKL A;  2EJM A;  2Z8L A;  2L5T A;  4F8M A;  4PMB A;  1MSG A;  5CBE E;  3JAM L;  4DXG A;  1EWC A;  3URY A;  1J8I A;  2HUG A;  2PZT A;  1LAB A;  4IUV A;  5FO9 B;  2XN9 C;  1E2Z A;  4PMW A;  1JOR A;  3IL8 A;  2B39 A;  1PDQ A;  1EYD A;  2BA0 A;  2PQE A;  2F3V A;  3C3L A;  3GV6 A;  2JEA I;  2R6G A;  1FNU A;  4DGZ A;  5J1Z A;  1SNO A;  3EJI A;  3G6J B;  4A3G B;  1EEF D;  2XWJ B;  5DAU A;  5LHY 1;  3ITP A;  1PZJ D;  2HQE A;  1B53 A;  1D1I A;  2WB1 B;  3CQZ B;  4NP5 A;  3BVM A;  1PTO C;  1DZ1 A;  1CA6 A;  1Q3L A;  4DAP A;  1CTM A;  2NVQ B;  1QWY A;  2EYO A;  2LKV A;  3SEB A;  1ZKO A;  2A68 C;  2RQX A;  3HOV B;  4IFD J;  1STB A;  5G3L F;  3A55 A;  2BOS A;  1U4L A;  2LMC B;  2K01 A;  4RH6 A;  2B2U A;  3C46 A;  4C3I G;  4XIG S;  3I4L A;  3D4W A;  2DNC A;  5D14 A;  4FF2 A;  2HCI A;  4HMI A;  4QMG A;  1Y1V B;  2JYO A;  5C0X G;  5C5M A;  4E6I A;  5C0X H;  2R92 B;  2J4X A;  3BVZ A;  1WCM B;  3GTM B;  3TN2 A;  2K1B A;  4I7Z C;  4OO1 I;  1IW7 C;  4A3J B;  3I72 A;  1KDB A;  1O7L A;  1HTL D;  2K32 A;  1IYV A;  5JJZ A;  2NN6 I;  1ZEQ X;  2KQ3 A;  2EDG A;  1PYW D;  3DWA A;  3S15 B;  2NVT B;  3P75 A;  2DY8 A;  4FO2 A;  4KN7 C;  3TP7 A;  2EYJ A;  3K7A B;  2L11 A;  4IUN A;  5C4J B;  4K2L A;  1J9O A;  1RTO A;  1WTV A;  4ZLT F;  5I2Y A;  2VB3 X;  1ML0 D;  3VA5 A;  2OT2 A;  3EFX D;  1IKM A;  1BCP B;  3NK9 A;  1ZXT A;  1GUN A;  2PW5 A;  5CV6 A;  3RUZ A;  1SYF A;  4ODG A;  4BBS B;  4LAA A;  3DEO A;  3IFD A;  1I4Q A;  2TSS A;  2OXP A;  1V1O A;  1GHK A;  3P7J A;  2E2I B;  1TS2 A;  3KUP A;  1CZG A;  2CHB D;  3GQB A;  1SYG A;  4WJW A;  2A6E D;  1B4O A;  3DM1 A;  4HCS A;  1H9J A;  4EVO A;  5JVG 3;  2JA8 B;  2XWB B;  1C8C A;  4IZ8 A;  3VR5 A;  3T13 A;  5IT9 E;  1ENC A;  2WAQ B;  2K33 A;  5JEA J;  2Y0S B;  2F0N A;  1CHQ D;  1G6Z A;  2KJX A;  2FHT A;  2B2T C;  2F03 A;  3J81 E;  1Y8N B;  1SNC A;  3FDT A;  4MHE A;  3EVQ A;  3H09 A;  4EQO A;  1IHZ A;  1CHP D;  2WAC A;  3Q24 A;  1KDC A;  2NBF A;  3NWS A;  4HR7 B;  1LTI D;  2VNU D;  1STE A;  1PRT F;  2KED A;  5IGG A;  4FXK C;  4OGQ C;  5IGD A;  2RA4 A;  4YIJ A;  4KD4 A;  4TKO B;  1XX8 A;  4XQJ A;  5M9O A;  3U9S A;  3H0G B;  1ENF A;  1S5D D;  5D3I B;  4RA8 A;  5M3M B;  1KNA A;  1F9Q A;  1OXT A;  1DOL A;  2Z1C A;  1Q1B A;  3VR2 A;  2L9H A;  1Q12 A;  2K7V A;  3LX0 A;  5CYU A;  4DF7 A;  3K5M A;  3BVG A;  2IJ0 A;  4XQN A;  1CT1 D;  3PUX A;  1U4R A;  3NQI A;  1QCB D;  5JPM C;  5JAV A;  3VR3 A;  2IW3 A;  4K5X A;  2E76 C;  3K59 A;  1G91 A;  1L0X B;  2RVL A;  3D6C A;  2E2H B;  3TSS A;  3BDL A;  2KOL A;  1SSO A;  4A3B B;  5I4D A;  4OO1 G;  3PUW A;  2PO4 A;  5EQ0 A;  4LMQ D;  1A15 A;  4OO1 H;  3ERQ A;  1ICW A;  1ONL A;  1PZI D;  1JOO A;  5KEE A;  3X3N A;  3GTJ B;  5EJW A;  2NN6 G;  2EY6 A;  2K5W A;  2NN6 H;  5DM6 3;  3R2I A;  2D9U A;  1EYA A;  1EWH A;  5EKL A;  5C4H A;  3PV0 A;  4XYO A;  2KEE A;  3I4N B;  1GUO A;  3NTI A;  1WTX A;  1YNJ C;  4K8J A;  2L55 A;  3V2T A;  4GZY C;  3GTQ B;  4FF4 A;  1RHP A;  1STN A;  2D62 A;  3GO5 A;  3QIA A;  1UEA B;  2EYH A;  4RWS C;  2EZV A;  4C1N K;  5ELF A;  3Q0A A;  2PW7 A;  3QOL A;  1VCI A;  4DXF A;  2R3Z A;  3S1Q B;  4CHT B;  3PUV A;  1ZYR D;  5ELC A;  4CKB A;  1XYI A;  4R9W A;  4ZRZ A;  1EQT A;  4B08 A;  1SNQ A;  5COY A;  1T5E A;  3RZD B;  4HN7 A;  1KAA A;  5FK9 C;  1TWC B;  3T53 B;  1B9N A;  3J7Y W;  2G9D A;  3H91 A;  1STG A;  1PTO H;  4A3D B;  1ESR A;  3W3A A;  3VR6 A;  4DAV A;  4C2M B;  3R3O A;  3NBI A;  4XT1 B;  1SNP A;  1EYC A;  2EJF C;  4V0B A;  2VXW A;  3TBI B;  4QUC A;  4N9P A;  1HCZ A;  1QG7 A;  3VYS A;  3Q22 A;  1EY7 A;  2O2L D;  5DNF A;  1ESF A;  4DNR B;  2SEB D;  5K5P A;  1DCZ A;  4IFD I;  3GTP B;  1SJE D;  2I07 B;  5J39 A;  1RDP D;  4K14 A;  3TP8 A;  5ELB A;  4M8A A;  5KYI A;  1LT6 D;  4G4K A;  3MTS A;  3OW7 A;  1BCP F;  3J7A F;  2YYZ A;  5I6W A;  2B8F A;  4A3I B;  4ZK9 B;  5DEH A;  2SDF A;  4BY7 B;  4CJ0 B;  4KD3 A;  4ZAI A;  5ISR A;  3NUC A;  4ZQ3 A;  1EZ8 A;  4AYB B;  1K8M A;  1SBB B;  3LWE A;  1HQR D;  1F2Z A;  2F0W A;  3T16 A;  3S17 B;  3VYU A;  3SVM A;  1BCP C;  1ET9 A;  3HRZ C;  1PLF A;  2ENB A;  5CV9 A;  4M1U B;  4CGY B;  1CK1 A;  1LTB D;  3K5N A;  3FRP B;  1JWS D;  1EIH A;  2WKD A;  2B2U C;  2PZW A;  5KIX A;  4XDX A;  5EKI A;  1V1P A;  2O5J C;  5IT9 L;  1JWM D;  4EQP A;  1YNN C;  4QIW B;  4MN3 A;  2E2J B;  1CA5 A;  1H9K A;  2EY5 A;  3A8J E;  1S4Z A;  1HTP A;  1LTA D;  3ND8 A;  5CV7 A;  4C3J B;  3J81 L;  3NE5 B;  5JVH 3;  2A6H D;  4K6D A;  3PIP 3;  4TQU S;  4IUR A;  5M5W B;  1I3Q B;  1Q90 A;  4KK7 A;  2AUK A;  4DNT B;  3MAQ A;  3S1N B;  2HDM A;  1BXT A;  4A3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...