1EYDA

Structure of wild-type s. nuclease at 1.7 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eydA00
2F3VA 4PMCA 2EYOA 5HURA 5ISRA 5M9OA 2SOBA 2SNSA 4G57A 4KD3A 3HEJA 3SXHA 4K2KA 2F0DA 4IALA 5CV7A 5KGUA 2F0OA 1JOOA 5EKKA 2F0GA 5CV5A 3TP8A 5DAUA 4LAAA 4ODGA 4EQPA 2F0VA 1ENAA 4DU9A 4B9XA 1NUCA 1STAA 2EY6A 1SYBA 1EZ6A 1SYEA 2F0KA 5C5MA 1SNPA 2QDBA 4B9WA 2EYLA 5IGBA 4NDXA 1STGA 2EYFA 2EY1A 2SNMA 4J6HA 4MIUA 5JOBA 5C3XA 4IUNA 2O4XA 4KY5A 5C4HA 2EXZA 2PW5A 3C1FA 5CV4A 3TP6A 2WACA 3OMCA 4NP5A 4H7BA 2LKVA 3NQTA 1A3VA 4J1MA 5C5LA 3T13A 5KEEA 1JORA 1F2MA 3NHHA 3RUZA 4KY7A 1STNA 1EY5A 3SK5A 2F0IA 4PMBA 5CR3A 1EY6A 4EQOA 2F0PA 2NUCA 3D6CA 3EVQA 1F2YA 2KHSA 3NK9A 3BDLA 3SK6A 5KYIA 1U9RA 3H6MA 2F0UA 2F0SA 4K6DA 5C6AA 5F2DA 5CV8A 4DGZA 3MVVA 4KJOA 3NXWA 2PYKA 4ZUJA 5I9OA 5IGGA 4EVOA 1SNCA 3ERQA 2F0NA 4IZ8A 4DFAA 5HGTA 4KHVA 1A2UA 2EY2A 3MEHA 3OMGA 4PNYA 5IGEA 2EY5A 3NUCA 4K2LA 4N9PA 4QB4A 4QMGA 1SYDA 5EKLA 2RBMA 3QOLA 5J39A 3D4WA 4K5VA 3SK8A 1F2ZA 5CV6A 1IHZA 5IGDA 1STBA 1ENCA 2F0QA 4HMJA 3VA5A 5C3WA 5KRUA 1EY8A 4K8JA 1KABA 4K5WA 5J1ZA 3DMUA 1NSNS 3MHBA 4WORA 3SR1A 1EYAA 5IIFA 5IOCA 3R3OA 5I9PA 1SYFA 3TP5A 4ZQ3A 1JOKA 5IGFA 1AEXA 1TQOA 3DHQA 3ITPA 5EGTA 2F0MA 2RKSA 3LX0A 4I65A 3MXPA 2RDFA 5IODA 2PW7A 1A2TA 2F0JA 1EY9A 1KAAA 3BDCA 4R8NA 4DF7A 5I6WA 1KDBA 3P75A 4HMIA 4HTHA 4K5XA 5DEHA 4RKBA 2PZWA 4ZUIA 2EYJA 4YIJA 2PZTA 3HZXA 5IGCA 2EYHA 2OXPA 4K14A 1EYDA 4KJNA 4QF4A 2F0WA 3TMEA 1JOQA 1SNMA 2ENBA 2OF1A 3D8GA 1EY7A 3C1EA 3EJIA 4RKLA 3TP7A 4K8IA 3SK4A 5CC4A 1II3A 1KDAA 1EQVA 2F0LA 4S3SA 3SHLA 1SNOA 3T16A 2HQEA 1STYA 5K5PA 2EYMA 4F7XA 2OEOA 3QOJA 5KIXA 1EZ8A 5J22A 4EQNA 1SNDA 4KD4A 2F3WA 3MZ5A 5C4ZA 2F0HA 5KYLA 1EYCA 1SYCA 3V2TA 2F0EA 3OWFA 1TT2A 1STHA 3OSOA 3U9OA 4E6IA 3P1HA 5CGKA 5I6YA 3S9WA 3E5SA 4F8MA 1EY0A 1KDCA 3D4DA 1EY4A 4ID6A 4KV6A 3QB3A 4ME5A 5E1FA 5E3FA 5JAVA 2F0TA 3EROA 4NMZA 4N9TA 4WRDA 5NUCA 3PMFA 1A3UA 4TRDA 5CV9A 1A3TA 1TR5A 1RKNA 1SYGA 2KQ3A 4NKLA 2F0FA 4KTAA 2M00A 2EYPA 4OL7A 3NP8A 2PZUA 2PQEA 4KY6A 1SNQA
chains in the Genus database with same CATH superfamily
4OEMB 4BXXG 1EU4A 4G57A 3KBXA 1SFOB 1YHAA 4IPCA 3PIO3 4LF4L 3KLSA 5C0XH 2B2YC 1C48A 2JA7G 3OW2A 3VYTA 4F88A 2F0GA 1PDQA 3TBIB 4C3HG 4DAMA 1O80A 3VDYA 3E0EA 4FXKC 1JE5A 3CF5A 1G8ZD 1N32Q 3O13A 1EZ6A 4ABNA 1LYLA 3HOYB 2I5LX 5H1SE 3V05A 4JI6Q 5G3LD 3L7ZC 1BVSA 3I4LA 4FNFA 3KJPA 1JT8A 1VQCA 5C4HA 2PMZE 2Z9HA 1I5FA 1N33L 1XNQQ 2I0QA 5C5LA 2Z6KC 1ZXTA 1A62A 1F77A 3TZDA 4A3BB 3A5UA 3AQQA 4L6TB 2C35B 1ONLA 3H3VI 1LTRD 1YNND 2B2VA 3EIVA 4KJOA 4GKKQ 3KF8A 1HNXQ 1HZBA 3R93A 2F0NA 4NXNQ 2IT1A 3I73A 1E1TA 4PNYA 4KKUA 2CW0C 2QCPX 3PQIA 4RHSA 4YCWA 3GTJB 1XWEA 5T1GA 1R4PB 4HMJA 4O0AA 3HGBA 3HOWG 1LT5D 1NSNS 3CRKC 1EYAA 5IOCA 4L5SA 2N49A 4HIMA 3IKJA 1Q82C 2KVMA 2PI2A 5EGTA 2JA9A 4A3JG 4A3JH 4IJHA 4DV4L 3LGJA 5ELFA 2LS01 2UXCL 4X3TA 3K58A 3H94A 2E8GA 2PZWA 1OXVA 3Q22A 1GO3E 1NMGA 2JA7B 4IPHA 4QF4A 2L12A 3MC0B 2LXJA 4PMWA 3I4NH 2QILA 4O1NA 2ENBA 4C3HB 2BH2A 2L4NA 1P8LA 4OONA 3HOZH 1E7ZA 1JORA 3W1GA 2A1AA 3S15B 1TWAH 3D4RA 2DNEA 1NY4A 1VQLA 3S1NH 3T4AC 4ALPA 5DM73 1YZ6A 5T1IA 1AW7A 1X6OA 4A3DB 4U673 3MZ5A 2IL8A 2HHHL 1RTNA 4CDFC 2ZJRA 4QL5A 5E3FA 1U4MA 2AWOA 1SXTA 2OTJA 3S1MH 1G91A 2Q8TA 4TRDA 1TR5A 1BCPF 1ENFA 4DV0L 4PZ8A 2BE5D 5C4JH 1K0RA 1UE5A 1KC8C 4JI2L 2NVXH 1WTQA 5CBAE 1G2SA 4XYQA 2F0OA 5FLMG 3OIQA 2A69D 4A4IA 4C3IH 2FMMA 4LAAA 1QNUA 2A6EC 2IWHA 4LNQA 1ENAA 1KRSA 3CMAA 1V43A 3K81C 3JAMi 4JBKA 3HOWB 4ZCKA 3Q8DA 1SNPA 1N32L 4B3SQ 1CZGA 4MIUA 4A3MH 3K6OA 4BS9A 2L11A 1DOLA 3KLSX 2Z4HA 4IJLA 1MJCA 5KEEA 3VR5A 2E2HH 3A8JE 4IOAA 1F2MA 1XNQL 5CR3A 1PRTC 4KHZA 2BA1A 1SSOA 1BDOA 3I3CA 4L5TA 1JB7A 2R7ZH 4JV5Q 3K5NA 5IYBG 4DGZA 3MVVA 5IYBH 3NXWA 3I4OA 3CCUA 1JCKB 1TWFB 2MUYA 4GKKL 1HNXL 3QWNA 5J39A 4LF6Q 2NVQH 4U68A 1IL8A 1BO0A 3D6WA 4NXNL 3SK8A 1NJIC 2IX3A 3SDZA 1JMCA 3PO3H 2AQ2B 5BN4A 3CQZH 3G6EA 2MJ8A 2Q2TA 2E2IH 2F0MA 1I6HB 2KUMA 2DJFC 5EPKA 2MFIA 2NVYB 1HR0W 5LMUQ 3F2DA 2CVRA 3BVZA 3J7YW 2WB1G 1EIFA 2QDLA 1WOCA 3NTIA 1LTGD 2FJ2A 4OO1G 3UI2A 1UAPA 3CCLA 2RDHA 2BA0A 4JBWA 4LWCA 3J80E 1I3QH 3L3OC 2XRSD 3D31A 2EYMA 5JVG3 5M3MB 3T1YQ 1S3OA 3V96A 2IX1A 4HR7B 3Q24A 3NE5B 2FFKB 4MNOA 3ZJYC 4A75A 1NAPA 4A3KH 2F4VQ 4NMZA 1TS2A 4PZ7A 2KQ3A 3I91A 2AHOB 3OOCA 1PTOB 3A74A 1GD7A 4G7ZC 1DOKA 2R7FA 1IW7D 1L0YB 4PMCA 3DWAA 1X32A 2F0DA 2VS1A 4DR2Q 4B3RQ 4M1UB 1PTOD 1HH2P 2IPKD 3PUZA 4ODGA 1EQRA 1SDFA 2GVAA 2V1CC 4LF9Q 1MSGA 4L5QA 4B9XA 1AP0A 4FO2A 3CAMA 3MXGA 2IY5B 2QDBA 4JI4Q 2UXBQ 1G6ZA 4DR6Q 2O4XA 1HQRD 1SE3A 4B3SL 4NXML 4NP5A 5DM63 1I94L 2PNRC 3NHHA 4A3FB 3SK5A 2WB1B 3T1HQ 1KQSA 3EVQA 1DONA 1U0LA 4JV5L 3OIPA 3ERQA 2PZUA 1ZEQX 3HKSA 1Y1VH 3WOEA 3ONAB 2Y0SG 3IRBA 3GTPH 1EEFD 2DJGC 2NVTB 4C2MB 1N34L 2N88A 4K8JA 3GD7A 3DMUA 2AUJD 3KK7A 5GAEC 4I65A 3BYYB 5FO9B 1VQBA 2M9VA 1K83B 4OGQC 1K8OA 1ZYRC 4FF1A 4HTHA 4TQUS 5LMUL 4GKJL 2ZTDA 1EYDA 2XWJB 2WB1E 4DNTB 4L8JA 2MGSA 4HJAA 3PUVA 4ILWA 5CC4A 4GLXA 5FLXL 4UP9A 4S3SA 1Y1WG 3S14H 3ULPA 3CC2A 3L0OA 2HQEA 1Y8PB 3I4MG 2KCTA 4JOIA 1PFSA 3RMHA 3M4YA 1SLJA 1SNDA 2A68D 1S5CD 5C4ZA 2R3ZA 1K3RA 3QO2A 5IT9L 3T1YL 2CCZA 3L9AX 3UDIA 1VQNA 3TS2A 1SMYC 1A3TA 1SYGA 1SRUA 2F0FA 1SE4A 4CDCC 2R92G 5M3FG 2Q8RE 4XXEA 1M1KC 1LO5D 4HCSA 1RIPA 5JPMC 4DR2L 2Y0SB 1O7ZA 3M4OB 2K5WA 4C3JG 3S24A 3DM3A 3F2UA 1SYEA 5D3IB 1G51A 1ML0D 4B9WA 2EYLA 2FXQA 1AE2A 1H9RA 4JI4L 2UXBL 4CJ1B 1HHVA 3S1RB 1VDZA 3UE0A 2VUMH 1LV9A 4EQOA 1H95A 3ND9A 1TS4A 4BBSG 5C4XG 3FRPB 5I4DA 1U9RA 3MXNA 4A3CH 1EIHA 2Z4IA 2DY8A 3VA7A 2XVSA 2V4DA 3CKIB 1YNJC 1Y1WB 1SNCA 4PG3A 1CUKA 2DN8A 3I4MB 1QVFA 3S17H 5EPJA 4A3EH 1LTLA 4RG1A 1YIJA 1CKNB 3C46A 1STBA 4DUZQ 5KRUA 2EXDA 2K03A 2NTSA 1EY8A 1RCVD 4JYAQ 2Y0SE 2UUBL 1JOKA 4J15A 3DHQA 4LF7Q 1BOSA 2K5QA 4X64L 5DEHA 3GTKH 2D62A 2J7ZA 2R92B 5M3FB 1MSHA 3A5ZB 2G5DA 1GHKA 5EAYA 4POGA 2QGQA 4PZ6A 3K5MA 4WFN3 2Z6BA 4X65Q 4LFBQ 3CC4A 1JC7A 4C3JB 4RCOA 1ASZA 1MI2A 3FVQA 3QIAA 3BVGA 4NB3A 3HRZC 1EYCA 3OSOA 2XSCA 2JA8G 1S5BD 3P1HA 1WTXA 1C8CA 1E3PA 3QB3A 4DAPA 3EN2A 3CP0A 4WRDA 2B29A 3NELA 2K1BA 2KBNA 1KLGD 3H0GH 2K5VA 5HURA 3JC66 1LUZA 3R2TA 3CCVA 2ZTEA 1FYCA 5CV7A 2HUGA 1TY0A 5ELDA 4Y7NB 4NW2A 4HIDA 2B2WC 2RHQB 3KLWA 4MHEA 4EQPA 4JI8L 3PSIA 4H02A 2A6HD 3AEVA 1NUCA 2NWGA 4QGUA 4RGMA 2PPBC 5M5WH 5ELOA 3STBD 4DK1A 1L1OC 4ZKCB 2J4XA 2NN6I 1CKMA 1SE2A 5IWAQ 1Q81C 5JEAH 1BCPB 1QJOA 2XNAC 3U4ZA 1YBYA 2E74C 4L63B 3AYHB 5CBEE 1BCPD 4ZYSA 1H9KA 4ZUJA 1HTLD 3PO2G 5JJIA 4I7AA 1W2BA 4QCLA 1WCMB 1ZKOA 2FMCA 2UXDQ 1VQEA 4OELB 1QUQA 4HJ9A 1VMPA 2E5LQ 1ENCA 2NN6G 2JA8B 1PH8A 2B2TC 1PLFA 1TWHH 1I50H 4CKBA 1PH4A 4DUZL 1CM9A 1SE8A 1PXUA 3BVMA 3GP7A 2B39A 4JYAL 2R93G 3GTGB 2PCFB 2N55A 2CFMA 1N36Q 4IQZA 2EOTA 4LUOA 1IBKL 3S1QH 1Z7TA 4IUUA 4LF7L 1X56A 4L5RC 4K0KL 2HDLA 2L5TA 1SFOH 2EYJA 1VQIA 4N8X1 4IFDJ 5M5XB 2WV6D 3TMEA 1EQTA 2L0CA 4LJZC 4RWSC 5M5YH 3U4VA 4TKOB 1RD9D 2K01A 3F2BA 4GS3A 2VB3X 3I56A 2IHEA 4X65L 1VQ7A 2WKCA 3HOYG 1STYA 1YJWA 5K5PA 1E2WA 1XJVA 4XT1B 2CH4A 1B50A 3TRZA 1NBWA 1KRTA 3W2DA 2K14A 4IUTA 4E6IA 1STHA 2LFNA 2H4OA 3HKZG 4JBMA 1IBLQ 3PMFA 4QJFA 4OHJA 2CQAA 3S16B 4A3BG 4KY6A 3F1ZA 2CQOA 2F3VA 5GQOA 2SNSA 1WTOA 5LHY1 3A7LA 3J80L 2C9OA 5J3BA 3EBEA 1BF4A 1SJHD 2EJMA 5CV5A 5FJ8H 1H9SB 2WAQG 1GXDC 1QUQB 4DK3C 4DAYA 1B7YB 3CCSA 2JN4A 3BZCA 5JOBA 3GV3A 1HTPA 2ID0A 2B3GA 2EQSA 3I2ZA 1SBBB 3RLFA 2R93B 2JJQA 4H7BA 1A3VA 1UNSA 3G4SA 1IBMQ 5COYA 3NWTA 3AMUA 1I4HA 1NR2A 2WFWA 3NQIA 5IWAL 4BXXH 2F0IA 2XRQD 3DM1A 1F2YA 2JA7H 4ZLTF 4XDXA 1BQQT 2F0SA 4C3HH 1HA5A 4JI3Q 4JVZA 1DXMA 2D5DA 2K5NA 1UE1A 1X3QA 1A0IA 4KKSA 4GNXA 1TWGB 4XYOA 3RN5A 3ICEA 1CA5A 4A3DG 5EKLA 1Q12A 2K6AA 2O5JC 4K5VA 2UXDL 5CV6A 5BR8Q 4UY8C 3BZKA 4EGVA 4I7ZC 3HKZB 1CHQD 2E5LL 3VR3A 1SYFA 2B2VC 1X3PA 2JEAI 1HZ9A 3HP3A 2JYOA 4LF8Q 1KAAA 1WD0A 4NPSA 1XMQQ 1PZKD 2MNAA 2Q2HA 4K5XA 3PV0A 1PFMA 3HZXA 4A3GG 1K8GA 3W1BA 2F03A 2WAQB 3EJIA 2F0LA 4OWXB 5GAGC 1E1OA 3HOVG 3HOWH 4CHTB 3J7A5 3H3VC 4F7XA 4DAYB 3HOXG 3LNNA 1W6JA 1S4ZA 4B3ML 3V2TA 1LABA 5CORA 1TT2A 5EJWA 4LF5Q 1EY0A 5C44G 4KV6A 4R4QA 3H3VH 4A3IG 1AZPA 1EOTA 3X3NA 2G9HD 3EFXD 3HKZE 3CW2C 3RLOA 3GTOB 3H09A 2EJFC 2NYZD 1QILA 4EQ5A 5ISRA 5C3EG 3KBGA 5K36G 3KF6B 2KEEA 3NTKA 1TWFH 1B9MA 1JOOA 4GNXB 4DR3Q 5FK9C 2RHSB 3QR8A 1U4PA 2EDGA 3J7AV 5I2YA 2CWAA 2WAQE 4RAUC 4NDXA 5I2XA 4JG2A 1T5XD 4N8FA 3PUXA 3TSSA 4CDDC 1O7IA 5CV4A 2OQ0A 3RD4A 1I6HH 4Z9CB 2NVYH 5IYDG 4JBJA 5JJLA 5IYDH 2RCFA 1EY6A 2F0PA 4A3GB 1WTRA 5FLMH 2N3SA 5KYIA 1X54A 2XTIA 2BCOA 5C6AA 5D3DA 3TQYA 4ZRZA 1TS5A 3K0YA 5I9OA 2ZXPA 1V1PB 5HGTA 3HOVB 5LL6S 2NTTA 2LY7A 5M3MG 3MFYA 3HOXB 4N9PA 4YWMA 4LFAQ 1PTOC 1FVIA 5EQ0A 4JI6L 1VQ4A 5BN5A 1HZCA 3PIPA 4AQYQ 1WTVA 4JI7Q 1X55A 5C44B 2YTVA 2YYZA 3D0FA 1IZ6A 5I9PA 3GTMB 2GN5A 4A3IB 4OWWB 2B8GA 3TS0A 2IJ0A 1PTOH 4V0BA 1KNEA 5C3EB 4QY7A 4IN3A 3K7AH 4OO1I 1NTGA 4WJWA 4X3SA 1I4PA 1WVLA 3QG1A 3E6ZX 4R8IA 2GVBA 2K7VA 4HIOA 1JJCB 4X6AH 4X3KA 1J6QA 1TWAB 2B8FA 2QA4A 1HXYD 4A3LG 2B2UA 4FF3A 5EPLA 1KDCA 4A3FG 4YWLA 3K8AA 4LF5L 1RHPA 4CBVA 5C0XJ 3KUPA 3BJUA 4OL7A 4DR1Q 2PQEA 1W6KA 5CMDA 4OO1H 4UPAA 3CCEA 4RGNA 2G9DA 2X6LA 4APVA 5A2QE 4RHRA 4IO9A 1CSPA 1R9TB 1AH9A 3S2HB 3TP8A 3OTOQ 3OWEB 1HFNA 2NVXB 4C2MH 3E9IA 3Q6SA 4C56C 1XMOQ 4DR3L 4AYBG 1CTMA 4C3IB 1HRJA 1HUMA 1YITA 5C3XA 3C1FA 2Z1CA 1I4RA 4J1MA 1EUJA 5AFWA 1YJ9A 3RUZA 1YHBA 2JEBI 1Y14B 4CJ0B 4A3MB 1T5EA 1B44D 1FD7D 3HOUG 1F9QA 1S40A 4K6DA 2X6GA 4Q0FA 3JAME 4DUYQ 4EVOA 1Q1BA 2D0OA 1TVXA 1V9PA 1RF2D 4BY1G 3PF4A 4DFAA 3ULLA 2F3IA 3RNUA 4BA2I 1V1OA 3SGIA 4BBRG 2BH8A 2I46A 5EBDA 4LFAL 1IKMA 2CHBD 5AJ3Q 4JI7L 1TQOA 1C7YA 3ITPA 3U50C 4KN4C 2R61A 2HD3A 2RCNA 2RKSA 1Y8OB 2XN9C 1A2TA 3PO3B 1EY9A 1XPOA 1QZHA 1GJXA 2J0TD 3RR5A 3CQZB 2E2JH 3OW7A 3PIP3 4UDUC 2NZHA 2K75A 1MGSA 4FDBA 2K05A 1EL0A 5FLXc 1FL0A 2OF1A 1YVCA 1EY7A 2HCCA 3M4OH 3I72A 4A93G 1GUTA 4LF6L 1B3QA 1JR0D 4DPGA 4AYBB 1BUVT 2D9UA 5IT9c 1UE6A 4X62Q 1YHQA 3B6YA 3FPUB 2FINB 2JA6G 3S1RH 3PUWA 4ME5A 2WIIB 5ELNA 3FMCA 3MXUA 2JA5B 3K5OA 3GTQB 1JB3A 3HOUB 1X9NA 2OWOA 3I90A 4JOIC 1WD1A 2SOBA 2SEBD 1D2BA 3HEJA 4DR1L 5JJZA 1Y1WH 1PH5A 4BY1B 2OCEA 3KOJA 2NB0A 1CKNA 3SE0A 3I4MH 1I4GA 1VQJA 2MO0A 2D0PA 5E4WC 5DAUA 1CFMA 1I4QA 4R1JA 4BBRB 5JVH3 3GTLB 2KA7A 3I8ZA 3M7NA 1K8MA 3OTOL 3TREA 3NWSA 3TN2A 3TZUA 4YY3Q 1PHJA 2X69A 3KFUA 2HT1A 1VS0A 4IUQA 2AQ1B 1HNZQ 3TP6A 2F4VL 2LKVA 4AYBE 1D6EC 3BS1A 1FNUA 1B1ZA 4G7HC 5LL6X 2GA4B 2YU9B 1STNA 4TVAB 2R92H 5M3FH 4GZYC 1X3EA 2EZVA 3R2IA 1IYVA 4C1NI 2ES2A 4BY7B 3SEBA 2RSOA 4B3RL 2NZ1D 4C3JH 4DKAC 4A93B 1IXRA 1PH3A 2O5IC 4P75A 1PH6A 4LF9L 2EVBA 2EY5A 4DV7Q 1S5FD 4R4OA 2OQKA 3L2PA 3VYUA 2Q2IA 3CPWA 1A8VA 4DR6L 2JA6B 3A56A 5IIFA 4IFDG 1CT1D 1Y1VB 4Q5VA 1VQOA 3STBC 4ZK9B 4BBSH 5C4XH 2RDFA 3T1HL 5AJ3L 2F0JA 4R8NA 3E9HA 5I6WA 4YHHQ 4HMIA 5LMNQ 5IYCG 1KLUD 2EYHA 1Q3LA 2EIFA 1GM5A 4RGOS 3URYA 3G48A 1II3A 3SHLA 1BCPC 3W3AA 2KOLA 1OXTA 1T9HA 3ZYYX 1EQQA 4FP5D 4DNRB 1NE3A 1SMXA 2ASBA 1KIXA 4GLVB 3U9OA 3S9WA 1EWCA 1HA6A 3J7AF 4DV1Q 3X3MA 2K32A 5JAVA 4X62L 3TEHB 2KCCA 3EROA 4IPGA 3IFDA 1A3UA 5DLQE 1D5ZC 2PNHA 1ZYRD 3NP8A 5E4XA 1ASYA 3EQLC 2LMCB 3FKIG 4R9WA 4KD3A 3M3YB 4RFBA 4DV5Q 2HCIA 2VW9A 1B70B 1WCMG 2AKWB 3PGZA 5KNBA 1Y8NB 4P73A 2AWNA 2JSOA 1PYBA 1U4LA 3I70A 3MEFA 2EY6A 1SYBA 2JA8H 1NR4A 4FXDA 1STGA 2PW5A 3GTGH 3ERSX 1MKHA 4R4IA 1PFBA 1QG7A 4LMQD 2IHFA 3A0JA 4HSVA 1WTPA 5M5XH 4B3TQ 1Q8KA 4KHPQ 3CCRA 1M4VA 3A55A 4KHVA 3KJOA 5JPNC 2I07B 3AFQA 4JI1Q 1PRTF 1WI5A 2YV5A 3DWQA 3VA5A 4DV7L 1U4RA 4RGTA 2WKDA 5J1ZA 3R3OA 3A7AB 3GV6A 3S17B 4HN7A 1E2ZA 1SJED 4ZAIA 1LTSD 3NPPA 1TWCB 3S16H 4R4CA 2K28A 3SVMA 3BYTB 1FJGQ 1CI3M 1LT3D 3FKIB 3P75A 3RZOB 3TDQA 3PO2H 3IL8A 3RZDB 2DGYA 1H9SA 4YHHL 2MP1A 3CPFA 2IX0A 4KJNA 2F0WA 1XX8A 3LWUA 2OT2A 4LF4Q 1YNJD 3J81c 1V1QA 4K8IA 1KDAA 2K4KA 1GKHA 1SNOA 4CDEC 2NN6H 2LSSA 3C3LA 2VB2X 3DUZA 2CH4W 1GUGA 3RN2A 4HJ7A 1EIGA 2F0HA 2R93H 1SYCA 5JJKA 2YTXA 4H0LC 1EY4A 2K50A 1JWUD 5E1FA 1N33Q 1HUNA 2H1EA 4N9TA 2M2LA 4UHVA 3K5LA 4DXFA 1FGUA 3WDNA 1QWYA 4DV1L 2ZXOA 1J8IA 4MTNA 3J80c 3FP9A 3K59A 2VL6A 1QE6A 1CKOA 4R4TA 3I7FA 3AU7A 3NEMA 1YNNC 1JJGA 4IALA 3KYHC 5IP7G 4LFBL 3HOYH 1TU2B 1TWGH 2SDFA 3H0GB 5IP9G 4DV5L 4GOPA 2B63G 1GOZA 3MTSA 4QQBX 1ET9A 4PV1C 1UE7A 1M8AA 1NNXA 5HGQA 4LUZA 2RSNA 4JI5Q 2EY1A 2MPMA 2JE6I 4BWGB 2A74C 2AQ3B 2RQXA 4A3BH 2TSSA 1LLRD 5CYUA 1PH1A 3W5OA 2UXCQ 1DZ1A 5A2QL 1Z47A 2Z8LA 3H6MA 3GTJH 2KHIA 1WFQA 4RCNA 1C9OA 4KHPL 2K52A 3BDOA 4QMGA 4K2LA 1HJPA 3VR6A 2RBMA 3KLRA 3S2DB 3K7UC 1F9RA 5C3WA 2F0QA 1VQMA 1LTAD 1XNRQ 3CCMA 1K9MC 2VNUD 4DK6C 1IKLA 2RA4A 3SR1A 3FEWX 1D1IA 3TP5A 2JQOA 4CKCA 1VQ8A 4MN3A 4JPBW 1XPUA 3GTOH 4GNXC 2PW7A 3KF6A 1VF5C 2Z0SA 1TWHB 3VYRA 1PH2A 1GUWA 4ZUIA 2BE5C 3JAML 5A35A 3S15H 1VQHA 4P2CB 1FJGL 4ULLA 4K14A 4A3DH 2B63B 1V8QA 1EOVA 1HR0Q 4JK1C 2A69C 4GOPB 2HIXA 5C0XG 1HNWQ 4WJ4A 1AFPA 5M5YB 1EZ8A 2R6GA 2HQLA 5E7NA 2B2YA 2F1MA 3NTHA 4FXGC 2PQAA 1N36L 4PQXA 2E76C 1RKNA 1RL2A 3FPPA 5ELCA 4KTAA 3CXCA 4A3GH 1PZID 4XT3B 1V1PA 3M4PA 1SNQA 1L0WA 3DXJC 3G7LA 1GHJA 1G291 1KTKA 1W3SA 1KD1C 2UU9Q 3HOVH 1L2FA 2BOSA 5EKKA 2KCNA 2Z6KA 3CD6A 3HOXH 2ZM6Q 4RMFA 2A8VA 4JC0A 4YCUA 1HPCA 1CA6A 1E22A 4DU9A 1MHWC 1RTOA 1RODA 5JEAJ 3M7GA 5C44H 1VCIA 3GO5A 1J5EQ 1KL9A 3GTMH 1N9WA 4DV2Q 4A3IH 4HEDA 4ME3A 4KY5A 1AZQA 4Y52H 1O78A 2WACA 3OMCA 1MBYA 4JI5L 1IBLL 1HQMC 2KCMA 3J81i 1Q90A 2A73B 2JXMB 5C3EH 1S5DD 5K36H 4B08A 1LTTD 4FVMA 3SK6A 3CRLC 1Y69U 2NZOA 1E2VA 5HY6A 2K5DA 3UE1A 1UWVA 4IZ8A 1TKWB 3I4NG 1A2UA 2MO1A 4KKTA 1ESFA 1VQDA 3HOZG 1BBUA 1PYWD 4IOCA 3J80i 5D65A 5FO7B 1LM0A 1XNRL 2PQAB 1IBML 4FF2A 4M8AA 1DGSA 4O42A 3PUYA 1EWHA 3M9BA 3R8BA 1D8LA 4O2DA 3H91A 3J81j 1IW7C 1ILPA 1E0BA 5GADC 2KECA 3G6JB 4JI3L 1PMRA 1R9TH 4X3UA 4DR4Q 4HCEA 5M3MH 3S2HH 4F87A 5FO8B 4RKLA 3TP7A 3SK4A 4RA8A 1HR0L 3KF8B 4QUFA 5BR8L 3NBHA 4C3IG 5J22A 3CHBD 4EQNA 1HNWL 5IE8A 3NBIA 2H5XA 4XTCS 2ATWA 1QVCA 1K28A 1CZWA 1RDPD 2EPBA 4F8MA 3MWYW 3UDGA 5EKIA 3AB9A 4NXMQ 2VY3A 4A3MG 5NUCA 4H44C 1I94Q 1XMQL 4LF8L 4LUVA 5ELEA 4A3JB 2UUAQ 1KXLA 1I4XA 3DLLA 2JP1A 2HDMA 4CKEA 4K2KA 2CW0D 4CJ2C 2YTYA 5KGUA 3I4NB 2B2UC 2R7ZG 3PF5A 1D5MC 2KJXA 2WP8J 2OTLA 4KMUC 2UU9L 3HOZB 1YI2A 2F0VA 1OXXK 4TSSA 2ZM6L 4A3LH 3VR4A 3S1NB 4G4KA 1VQ5A 4CGYB 1Q8IA 4A3FH 4DXGA 1GVPA 4J6HA 2QF7A 1N34Q 4IPDA 4P72A 1PYSB 1JICA 1J5EL 4A76A 1IL2A 2IW3A 3ND8A 3J81E 3PO3G 4DV2L 2Q8IB 3ER0A 3PCOB 1OXUA 5BN3A 1D5XC 3S1MB 4DA2A 1EY5A 1WYDA 1A63A 1JQYD 1S5ED 3D6CA 1QZGA 1K3BC 2KHSA 5C4JB 3OYYA 4HSPA 2C5CA 5F2DA 3IAYA 4GKJQ 2PYKA 2NVTH 1KNAA 4P74A 2PI2E 3MEHA 1VQFA 3CU7A 1PH7A 2VQEQ 1SROA 1SN8A 3D4WA 3M4QA 1K73C 1F2ZA 1IHZA 2VZAA 3NBHB 2A68C 3NENA 3U9SA 5M9OA 1VQGA 1K83H 4XQJA 3GQBA 1C4QA 1BNZA 1B8AA 2JA5G 2JA5H 1OO9B 3GTQH 3HOUH 5IODA 1X3FA 2E2HB 4J8QA 1F9SA 3E3XA 4A3KG 1IYJB 4YIJA 2PZTA 5IGCA 4BY1H 1JE4A 1F2LA 2R7ZB 3BZDB 2A6ED 3OPOA 4BBRH 3C1EA 3QJYA 4DR4L 3GTLH 5G3LF 4G7OC 3K7AB 4OXPA 4BA1I 3A54A 1PRTB 4KN7C 4WJ3M 2DY7A 3QOJA 5KIXA 4AQYL 2NVQB 3F8TA 1JJ2A 2F0EA 2I5HA 1WJJA 2P5ZX 1OTCA 1PRTD 4ID6A 3I55A 3Q0AA 1B9NA 2YU9H 2F0TA 3CC7A 2EJGC 2E2IB 2K33A 1A15A 1R4QB 4BY7G 4BY7H 2O2LD 4DV6Q 4IURA 1B3AA 2UUAL 1BBWA 4A93H 2RVLA 3BG3A 4OWTB 1LT4D 2K04A 4H13C 4C1NK 2D2CC 1SAPA 2ALYB 4HIKA 2L9HA 1I3QB 1XTCD 1DD2A 2KENA 1XTDA 2JA6H 2ZT9C 5C5MA 4DAVA 4XQNA 1Y1VG 2EXZA 2DNCA 3LWEA 3UDXA 2UUBQ 3T13A 3A8KE 4IUVA 4KY7A 4A3KB 4X64Q 1XXGA 4GN4B 2NUCA 4YCVA 3KDFA 1WTWA 2RDGA 5TSSA 4JCVE 1EFWA 3OHXC 1QVGA 3NK9A 3BDLA 4JW0A 2AUKA 3N52A 3J7ZC 1XYIA 1TXYA 1MJEA 3CCJA 1QOHA 3RLNA 1JOQA 1O7YA 3FHWA 3QOLA 2BDOA 1XMOL 1YJNA 1H9MA 4ZKBB 2VQEL 4IFDI 1B2TA 1Z6HA 3VR2A 4WORA 1VQ9A 4GN5A 4ZQ3A 4UAIA 5IGFA 1AE3A 3DEPA 1K0SA 2FHTA 3MXPA 5FOBB 1PA6A 1KDBA 2VQFQ 1VQAA 4RKBA 3M3YH 2L15A 1EIYB 3BU2A 4EX5A 1VQPA 4DUYL 1Q1EA 3ULJA 1OXSC 1FR3A 4MZ9A 4UP8A 3D8GA 3HS0C 2E2JB 1DJRD 3K0XA 3T16A 2A6HC 4JI8Q 1X65A 4IFDH 1ILQA 3UDFA 1DYQA 1CSQA 1SR3A 2F3WA 3GTPB 3CCQA 3E5SA 3D4DA 4FYDA 2A5HA 1NCVA 1UUPA 1FNVA 5IYCH 1PH9A 4KK7A 3NSWA 1MD2D 1B4OA 1AN8A 2M00A 1BBXC 1D7QA 1ICFB 4Y7NH 3KDFB 2N78A 1GUSA 2EYOA 4DV3Q 2VUMG 1I6VC 3HFZB 1KHIA 5DNFA 3SXHA 4DV6L 3WWVA 1EEID 2QW7A 1XPRA 1H9JA 3DEOA 4A3CG 2KEDA 5IY0A 1B53A 3S14B 1EFID 2HIVA 2F0KA 2XWBB 2ZJQA 2XGTA 1A6XA 3MA2B 4MTKA 4RH6A 1TY2A 1C0AA 2SNMA 4A3EG 4OIJA 1PZJD 4IUNA 1BKBA 4YWKA 1U5KA 4LW1A 1TWCH 5ELBA 1EWIA 3E0JA 2ZTCA 3FKIH 1N8RC 2ICIA 3RZOH 4POFA 3T51B 3T56B 1IBKQ 3P20A 3RZDH 2EE1A 1WCMH 1O7LA 3MAQA 4K0KQ 1YEZA 5GROA 4IUPA 2NBFA 1UEAB 2AMCB 3CMEA 4X66Q 1Q86C 2F52A 3GDEA 1LTID 5EBCA 2EY2A 3OMGA 5IGEA 5KNDA 1G2TA 3NUCA 1SYDA 1DCZA 4YY3L 3C2PA 1QB5D 2A19A 4AH6A 1SMYD 4AIMA 1BR9A 2ZXRA 4OX9Q 2F4IA 4K5WA 1BXTA 1ESRA 1HNZL 3MFGA 1DOMA 2LXKA 1AEXA 3K57A 4DR5Q 1S72A 4JI0Q 1FNWA 3H15A 2E75C 3LX0A 2CKZB 1NMFA 4DF7A 2ZJPA 3F2CA 1QNKA 1Q7YC 2VUMB 1PTOF 2L55A 1CQVA 1F9PA 1ET6A 2VQFL 3H0GG 4BBSB 1D1KA 4KI0A 4DR7Q 5C4XB 1SNMA 3K80C 1JWMD 1GUNA 3MXNB 1VF7A 5GAHC 2OEOA 1VQ6A 1X3GA 4V190 4A3EB 1GUOA 4KD4A 5KYLA 1LT6D 4UP7A 4LFCQ 3OWFA 3PIOA 2UUCQ 1HFGA 1YNXA 3U58A 1Q46A 2B2WA 4QUCA 2K5HA 2KHJA 3P7JA 4NKLA 1MIUA 2DUDA 3N6RA 5L37A 5LMNL 5JEAG 1LTBD 1L1OA 1FGBD 3GTKB 2QEJC 3HG9A 4DV3L 1M90C 1ICWA 4QIWB 4GLAC 2N8NA 4KLKA 2R7DA 1G6PA 2BDNA 3S2DH 1VMCA 1STAA 3T53B 1CQFA 5IGBA 2EYFA 2QEXA 2TMPA 4FF4A 2MHVA 3NQTA 4GOPC 2JK8A 1STEA 1EYGA 4OIKA 1L0XB 1TIID 1UEBA 4PMBA 5D14A 5IP7H 2E2DC 1CK1A 2I5MX 4LK1C 4HJ5A 2B2TA 1PV4A 5IP9H 1JWSD 2F0UA 1CHPD 3FDTA 2B63H 5CV8A 3DWPA 4DK0A 3AFPA 5IGGA 1J9OA 3M85A 2L1BA 4X66L 4QB4A 5FLXE 1PFNA 1LACA 4XQQA 5IGDA 4QIWE 1PVOA 4HJ8A 1E24A 1EU3A 3WOFA 5M5WB 1KABA 3J81L 3MHBA 4B3MQ 5LMNW 1Z9FA 3Q23A 4DV4Q 4OX9L 4DNIA 5IT9E 1IYUA 3VYSA 1HCZA 3JAMc 3BDCA 4DR5L 4JI0L 3EA6A 2RF4A 4DN4M 5FKAC 4B3TL 2PO4A 4HAEA 1L1OB 4P71A 2OXPA 2Q2UA 1SEBD 1HZAA 2CWPA 5C0XI 2QKIC 2ICEC 4DR7L 1EQVA 3PO2B 2PMZB 2VXWA 4JI1L 5KNCA 3G71A 2MQHA 2WINB 2HHHQ 3A8IE 5FJ8G 2XIWA 4XIGS 1DM0B 3D3RA 5I6YA 5CGKA 1WTHA 4DV0Q 1RJTA 1KAWA 1I50B 3IFTA 4LFCL 4K6LA 1VQKA 1P16A 1TS3A 1QCBD 5CV9A 2UUCL 4JI2Q 1K8AC 2EYPA 3S1QB 4GN3B
chains in the Genus database with same CATH topology
1EU4A 4G57A 3KBXA 1SFOB 3PIO3 3KLSA 5C0XH 2B2YC 1C48A 3VYTA 4F88A 2F0GA 1PDQA 3TBIB 4C3HG 1O80A 4FXKC 1G8ZD 3O13A 1EZ6A 4ABNA 3HOYB 3V05A 5G3LD 3L7ZC 3I4LA 4FNFA 5C4HA 5C5LA 1ZXTA 1F77A 3TZDA 4A3BB 4L6TB 1ONLA 1LTRD 1YNND 2B2VA 4KJOA 3KF8A 3R93A 2F0NA 2IT1A 3I73A 4PNYA 4KKUA 2CW0C 2QCPX 4RHSA 3GTJB 1XWEA 5T1GA 1R4PB 4HMJA 3HGBA 1LT5D 1NSNS 3CRKC 1EYAA 5IOCA 3IKJA 2KVMA 5EGTA 5ELFA 2LS01 4X3TA 3K58A 3H94A 2PZWA 1OXVA 3Q22A 2JA7B 4QF4A 2L12A 3MC0B 4PMWA 2QILA 4O1NA 2ENBA 4C3HB 2L4NA 1JORA 3S15B 3D4RA 2DNEA 3T4AC 5DM73 5T1IA 1AW7A 4A3DB 4U673 3MZ5A 2IL8A 1RTNA 5E3FA 1U4MA 2AWOA 1SXTA 1G91A 2Q8TA 4TRDA 1TR5A 1BCPF 1ENFA 2BE5D 1WTQA 5CBAE 1G2SA 4XYQA 2F0OA 3OIQA 2A69D 2FMMA 4LAAA 1QNUA 2A6EC 2IWHA 1ENAA 1V43A 3HOWB 1SNPA 1CZGA 4MIUA 3K6OA 4BS9A 2L11A 1DOLA 3KLSX 2Z4HA 5KEEA 3VR5A 3A8JE 1F2MA 5CR3A 1PRTC 4KHZA 2BA1A 1SSOA 1BDOA 3I3CA 3K5NA 4DGZA 3MVVA 3NXWA 1JCKB 1TWFB 2MUYA 3QWNA 5J39A 4U68A 1IL8A 1BO0A 3D6WA 3SK8A 2IX3A 3SDZA 2AQ2B 5BN4A 2MJ8A 2F0MA 1I6HB 2KUMA 5EPKA 2NVYB 2CVRA 3BVZA 3J7YW 3NTIA 1LTGD 2FJ2A 4OO1G 3UI2A 1UAPA 2RDHA 2BA0A 4JBWA 3J80E 3L3OC 2XRSD 3D31A 2EYMA 5JVG3 5M3MB 3V96A 2IX1A 4HR7B 3Q24A 3NE5B 2FFKB 1NAPA 4NMZA 1TS2A 2KQ3A 3I91A 3OOCA 1PTOB 4G7ZC 1DOKA 1IW7D 1L0YB 4PMCA 3DWAA 1X32A 2F0DA 4M1UB 1PTOD 2IPKD 3PUZA 4ODGA 1SDFA 1MSGA 4B9XA 1AP0A 4FO2A 3MXGA 2QDBA 1G6ZA 2O4XA 1HQRD 1SE3A 4NP5A 5DM63 2PNRC 3NHHA 4A3FB 3SK5A 2WB1B 3EVQA 1DONA 3OIPA 3ERQA 1ZEQX 3WOEA 3ONAB 1EEFD 2NVTB 4C2MB 2N88A 4K8JA 3GD7A 3DMUA 2AUJD 3KK7A 4I65A 3BYYB 5FO9B 2M9VA 1K83B 4OGQC 1K8OA 1ZYRC 4FF1A 4HTHA 4TQUS 1EYDA 2XWJB 4DNTB 4L8JA 2MGSA 3PUVA 4ILWA 5CC4A 5FLXL 4S3SA 2HQEA 1Y8PB 3RMHA 3M4YA 2A68D 1SNDA 1S5CD 5C4ZA 2R3ZA 3QO2A 5IT9L 3L9AX 1SMYC 1A3TA 1SYGA 2F0FA 1SE4A 2Q8RE 4XXEA 1LO5D 4HCSA 5JPMC 2Y0SB 1O7ZA 3M4OB 2K5WA 4C3JG 3F2UA 1SYEA 5D3IB 1ML0D 4B9WA 2EYLA 1H9RA 4CJ1B 1HHVA 3S1RB 1VDZA 1LV9A 4EQOA 3ND9A 1TS4A 3FRPB 5I4DA 1U9RA 3MXNA 1EIHA 2Z4IA 2DY8A 3VA7A 2XVSA 2V4DA 3CKIB 1YNJC 1Y1WB 1SNCA 2DN8A 3I4MB 5EPJA 3C46A 1STBA 5KRUA 2K03A 2NTSA 1EY8A 1RCVD 1JOKA 3DHQA 1BOSA 2K5QA 5DEHA 2D62A 2J7ZA 2R92B 5M3FB 1MSHA 1GHKA 3K5MA 4WFN3 1JC7A 4C3JB 4RCOA 1MI2A 3FVQA 3QIAA 3BVGA 3HRZC 1EYCA 3OSOA 2XSCA 1S5BD 3P1HA 1WTXA 1C8CA 3QB3A 4DAPA 4WRDA 2K1BA 1KLGD 5HURA 3R2TA 1FYCA 5CV7A 2HUGA 1TY0A 5ELDA 4Y7NB 4NW2A 2B2WC 4MHEA 4EQPA 2A6HD 1NUCA 2NWGA 4RGMA 2PPBC 4DK1A 4ZKCB 2J4XA 2NN6I 1SE2A 5JEAH 1BCPB 1QJOA 2XNAC 2E74C 4L63B 5CBEE 1BCPD 4ZYSA 1H9KA 4ZUJA 1HTLD 4QCLA 1WCMB 1ZKOA 2FMCA 1VMPA 1ENCA 2NN6G 2JA8B 2B2TC 1PLFA 4CKBA 1CM9A 1PXUA 3BVMA 3GP7A 2B39A 3GTGB 2PCFB 2N55A 4IQZA 2EOTA 1Z7TA 4IUUA 2HDLA 2L5TA 2EYJA 4IFDJ 5M5XB 3TMEA 2WV6D 1EQTA 2L0CA 4LJZC 4RWSC 4TKOB 1RD9D 2K01A 2VB3X 2WKCA 1STYA 5K5PA 1E2WA 4XT1B 1B50A 3W2DA 4IUTA 4E6IA 1STHA 2LFNA 2H4OA 3PMFA 4OHJA 2CQAA 3S16B 4KY6A 2F3VA 2SNSA 1WTOA 5LHY1 3A7LA 3J80L 2C9OA 1BF4A 1SJHD 2EJMA 5CV5A 1H9SB 1GXDC 4DAYA 5JOBA 3GV3A 1HTPA 2ID0A 1SBBB 3RLFA 2R93B 4H7BA 1A3VA 1UNSA 5COYA 3NWTA 3AMUA 1I4HA 1NR2A 3NQIA 2F0IA 2XRQD 3DM1A 1F2YA 4ZLTF 4XDXA 1BQQT 2F0SA 1HA5A 1DXMA 2D5DA 1X3QA 4KKSA 1TWGB 4XYOA 1CA5A 5EKLA 1Q12A 2K6AA 2O5JC 4K5VA 5CV6A 4EGVA 4I7ZC 3HKZB 1CHQD 3VR3A 1SYFA 2B2VC 1X3PA 2JEAI 3HP3A 2JYOA 1KAAA 1WD0A 1PZKD 4K5XA 3PV0A 1PFMA 3HZXA 2F03A 2WAQB 3EJIA 2F0LA 4CHTB 3H3VC 4F7XA 3LNNA 1W6JA 1S4ZA 3V2TA 1LABA 5CORA 1TT2A 5EJWA 1EY0A 4KV6A 1AZPA 1EOTA 3X3NA 2G9HD 3EFXD 3GTOB 3H09A 2EJFC 2NYZD 1QILA 5ISRA 5K36G 3KBGA 2KEEA 3NTKA 1B9MA 1JOOA 5FK9C 1U4PA 2EDGA 3J7AV 5I2YA 4RAUC 4NDXA 5I2XA 1T5XD 3PUXA 3TSSA 5CV4A 3RD4A 4Z9CB 1EY6A 2F0PA 4A3GB 1WTRA 5KYIA 5C6AA 2BCOA 5D3DA 4ZRZA 1TS5A 3K0YA 5I9OA 2ZXPA 1V1PB 5HGTA 3HOVB 5LL6S 2NTTA 2LY7A 3MFYA 3HOXB 4N9PA 1PTOC 5EQ0A 5BN5A 1WTVA 5C44B 2YYZA 5I9PA 3GTMB 4A3IB 2B8GA 2IJ0A 1PTOH 4V0BA 1KNEA 5C3EB 4IN3A 4OO1I 4WJWA 4X3SA 1I4PA 1WVLA 3QG1A 3E6ZX 4R8IA 2K7VA 4X3KA 1TWAB 2B8FA 1HXYD 2B2UA 4FF3A 5EPLA 1KDCA 1RHPA 4CBVA 5C0XJ 3KUPA 4OL7A 2PQEA 1W6KA 5CMDA 4OO1H 4RGNA 2G9DA 2X6LA 5A2QE 4RHRA 1R9TB 3S2HB 3TP8A 3OWEB 1HFNA 2NVXB 3Q6SA 4C56C 1CTMA 4C3IB 1HRJA 1HUMA 5C3XA 3C1FA 2Z1CA 1I4RA 4J1MA 5AFWA 3RUZA 2JEBI 4CJ0B 4A3MB 1T5EA 1B44D 1FD7D 1F9QA 4K6DA 2X6GA 4Q0FA 3JAME 4EVOA 1Q1BA 1TVXA 1RF2D 4DFAA 4BA2I 1V1OA 2I46A 5EBDA 1IKMA 2CHBD 1TQOA 3ITPA 4KN4C 2R61A 2RKSA 1Y8OB 2XN9C 1A2TA 3PO3B 1EY9A 1GJXA 2J0TD 3CQZB 3OW7A 3PIP3 4UDUC 1MGSA 2K05A 1EL0A 2OF1A 1EY7A 2HCCA 3I72A 1GUTA 1JR0D 4AYBB 1BUVT 2D9UA 3FPUB 2FINB 3PUWA 4ME5A 2WIIB 3FMCA 3MXUA 2JA5B 3K5OA 3GTQB 1JB3A 3HOUB 3I90A 1WD1A 2SOBA 2SEBD 1D2BA 3HEJA 5JJZA 4BY1B 2NB0A 3SE0A 1I4GA 5E4WC 5JVH3 5DAUA 1CFMA 1I4QA 4BBRB 3GTLB 2KA7A 3I8ZA 3M7NA 1K8MA 3NWSA 3TN2A 3TZUA 2X69A 4IUQA 2AQ1B 3TP6A 2LKVA 1D6EC 3BS1A 1FNUA 1B1ZA 4G7HC 5LL6X 2GA4B 2YU9B 1STNA 4GZYC 2EZVA 3R2IA 1IYVA 4C1NI 4BY7B 3SEBA 2RSOA 2NZ1D 4A93B 2O5IC 2EVBA 2EY5A 1S5FD 3VYUA 2JA6B 3A56A 5IIFA 4IFDG 1CT1D 1Y1VB 4Q5VA 4ZK9B 2RDFA 2F0JA 4R8NA 5I6WA 4HMIA 1KLUD 2EYHA 1Q3LA 4RGOS 3URYA 1II3A 3SHLA 1BCPC 3W3AA 2KOLA 1OXTA 3ZYYX 4FP5D 4DNRB 3U9OA 3S9WA 1EWCA 1HA6A 3J7AF 3X3MA 2K32A 5JAVA 2KCCA 3EROA 3IFDA 1A3UA 1D5ZC 1ZYRD 3NP8A 5E4XA 3EQLC 2LMCB 4R9WA 4KD3A 3M3YB 4RFBA 2HCIA 5KNBA 1Y8NB 2AWNA 2JSOA 1U4LA 3I70A 2EY6A 1SYBA 1NR4A 4FXDA 1STGA 2PW5A 1PFBA 1QG7A 4LMQD 4HSVA 1WTPA 1M4VA 3A55A 4KHVA 5JPNC 2I07B 1PRTF 3DWQA 3VA5A 1U4RA 4RGTA 2WKDA 5J1ZA 3R3OA 3A7AB 3GV6A 3S17B 4HN7A 1E2ZA 1SJED 4ZAIA 1LTSD 3NPPA 1TWCB 2K28A 3SVMA 3BYTB 1CI3M 1LT3D 3FKIB 3P75A 3RZOB 3TDQA 3IL8A 3RZDB 1H9SA 2MP1A 4KJNA 2IX0A 2F0WA 1XX8A 3LWUA 2OT2A 1YNJD 4K8IA 1KDAA 1SNOA 2NN6H 3C3LA 2VB2X 3DUZA 1GUGA 1EIGA 2F0HA 1SYCA 4H0LC 1EY4A 5E1FA 1JWUD 1HUNA 2H1EA 4N9TA 2M2LA 3K5LA 4DXFA 3WDNA 1QWYA 2ZXOA 1J8IA 3K59A 1QE6A 3AU7A 1YNNC 4IALA 1TU2B 2SDFA 3H0GB 1GOZA 3MTSA 1ET9A 4PV1C 1M8AA 2RSNA 2EY1A 2MPMA 2JE6I 4BWGB 2A74C 2AQ3B 2RQXA 2TSSA 1LLRD 5CYUA 1DZ1A 5A2QL 1Z47A 2Z8LA 3H6MA 4RCNA 3BDOA 4QMGA 4K2LA 3VR6A 2RBMA 3KLRA 3S2DB 1F9RA 5C3WA 2F0QA 1LTAD 2VNUD 1IKLA 2RA4A 3SR1A 3FEWX 1D1IA 3TP5A 4CKCA 4MN3A 2PW7A 1VF5C 1TWHB 3VYRA 1GUWA 4ZUIA 2BE5C 3JAML 5A35A 4P2CB 4ULLA 4K14A 2B63B 1V8QA 4JK1C 2A69C 5C0XG 1AFPA 5M5YB 1EZ8A 2R6GA 2B2YA 2F1MA 3NTHA 4FXGC 4PQXA 2E76C 1RKNA 3FPPA 5ELCA 4KTAA 1PZID 4XT3B 1V1PA 1SNQA 3DXJC 3G7LA 1GHJA 1G291 1KTKA 2BOSA 5EKKA 2KCNA 1HPCA 1CA6A 4DU9A 1RTOA 1RODA 5JEAJ 3M7GA 1VCIA 3GO5A 1AZQA 4HEDA 4KY5A 1O78A 2WACA 3OMCA 1MBYA 1HQMC 1Q90A 2A73B 2JXMB 5K36H 1S5DD 4B08A 1LTTD 4FVMA 3SK6A 3CRLC 1Y69U 1E2VA 2K5DA 4IZ8A 1TKWB 1A2UA 4KKTA 1ESFA 1PYWD 5D65A 5FO7B 4FF2A 4M8AA 4O42A 3PUYA 1EWHA 3R8BA 3H91A 1IW7C 1ILPA 1E0BA 2KECA 3G6JB 1PMRA 4X3UA 4HCEA 4F87A 5FO8B 4RKLA 3TP7A 3SK4A 4RA8A 4QUFA 3NBHA 4C3IG 5J22A 3CHBD 4EQNA 3NBIA 4XTCS 1CZWA 1RDPD 2EPBA 4F8MA 3MWYW 5EKIA 3AB9A 5NUCA 4H44C 5ELEA 4A3JB 1I4XA 2JP1A 2HDMA 4CKEA 4K2KA 2CW0D 4CJ2C 5KGUA 3I4NB 2B2UC 1D5MC 2KJXA 2WP8J 4KMUC 3HOZB 2F0VA 1OXXK 4TSSA 3VR4A 3S1NB 4G4KA 4CGYB 1Q8IA 4DXGA 4J6HA 2QF7A 1JICA 2IW3A 3ND8A 3J81E 2Q8IB 1OXUA 5BN3A 1D5XC 3S1MB 4DA2A 1EY5A 1JQYD 1S5ED 3D6CA 2KHSA 5C4JB 4HSPA 2C5CA 5F2DA 3IAYA 2PYKA 1KNAA 3MEHA 3CU7A 3D4WA 1F2ZA 1IHZA 2A68C 3U9SA 5M9OA 4XQJA 3GQBA 1C4QA 1BNZA 1OO9B 5IODA 2E2HB 4J8QA 1F9SA 4YIJA 2PZTA 5IGCA 1JE4A 1F2LA 2R7ZB 3BZDB 2A6ED 3OPOA 3C1EA 3QJYA 5G3LF 4G7OC 3K7AB 4BA1I 3A54A 1PRTB 4KN7C 2DY7A 3QOJA 5KIXA 2NVQB 2F0EA 1PRTD 4ID6A 3Q0AA 1B9NA 2F0TA 2EJGC 2E2IB 2K33A 1A15A 1R4QB 2O2LD 4IURA 1B3AA 2RVLA 3BG3A 1LT4D 2K04A 4H13C 4C1NK 2D2CC 1SAPA 2L9HA 1I3QB 1XTCD 1DD2A 2ZT9C 5C5MA 4DAVA 4XQNA 2EXZA 2DNCA 3LWEA 3T13A 3A8KE 4IUVA 4KY7A 4A3KB 1XXGA 2NUCA 1WTWA 2RDGA 5TSSA 3OHXC 3NK9A 3BDLA 2AUKA 3N52A 1XYIA 1QOHA 1JOQA 1O7YA 3QOLA 2BDOA 1H9MA 4ZKBB 4IFDI 1B2TA 1Z6HA 3VR2A 4WORA 4ZQ3A 4UAIA 5IGFA 3DEPA 2FHTA 3MXPA 5FOBB 1KDBA 4RKBA 1Q1EA 1OXSC 1FR3A 3D8GA 3HS0C 2E2JB 1DJRD 3T16A 2A6HC 4IFDH 1ILQA 1DYQA 2F3WA 3GTPB 3E5SA 3D4DA 4FYDA 2A5HA 1NCVA 1UUPA 1FNVA 4KK7A 3NSWA 1MD2D 1B4OA 1AN8A 2M00A 1BBXC 1GUSA 2EYOA 1I6VC 5DNFA 3SXHA 1EEID 1H9JA 3DEOA 2KEDA 1B53A 3S14B 1EFID 2F0KA 2XWBB 1A6XA 3MA2B 4RH6A 1TY2A 2SNMA 4OIJA 1PZJD 4IUNA 5ELBA 3E0JA 2ICIA 3T51B 3T56B 3P20A 2EE1A 3MAQA 1O7LA 4IUPA 2NBFA 1UEAB 1LTID 5EBCA 2EY2A 3OMGA 5IGEA 5KNDA 1G2TA 3NUCA 1SYDA 1DCZA 3C2PA 1QB5D 1SMYD 1BR9A 2ZXRA 2F4IA 4K5WA 1BXTA 1ESRA 3MFGA 1DOMA 1AEXA 3K57A 1FNWA 2E75C 3LX0A 4DF7A 1QNKA 2VUMB 1PTOF 2L55A 1CQVA 1F9PA 1ET6A 4BBSB 1D1KA 4KI0A 5C4XB 1SNMA 1JWMD 1GUNA 1VF7A 2OEOA 4V190 4A3EB 1GUOA 4KD4A 5KYLA 1LT6D 3OWFA 1HFGA 2B2WA 4QUCA 3P7JA 4NKLA 3N6RA 5JEAG 1LTBD 1FGBD 3GTKB 2QEJC 3HG9A 1ICWA 4QIWB 2BDNA 1VMCA 1STAA 3T53B 1CQFA 5IGBA 2EYFA 2TMPA 4FF4A 2MHVA 3NQTA 1STEA 4OIKA 1L0XB 1TIID 4PMBA 5D14A 2E2DC 1CK1A 4LK1C 2B2TA 1JWSD 2F0UA 1CHPD 3FDTA 5CV8A 3DWPA 4DK0A 5IGGA 1J9OA 3M85A 2L1BA 4QB4A 5FLXE 1PFNA 1LACA 4XQQA 5IGDA 1EU3A 3WOFA 5M5WB 1KABA 3J81L 3MHBA 3Q23A 5IT9E 1IYUA 3VYSA 1HCZA 3BDCA 3EA6A 4DN4M 5FKAC 2PO4A 4HAEA 2OXPA 1SEBD 5C0XI 2QKIC 2ICEC 1EQVA 3PO2B 2PMZB 2VXWA 5KNCA 2WINB 3A8IE 2XIWA 4XIGS 1DM0B 3D3RA 5I6YA 5CGKA 1RJTA 1I50B 3IFTA 4K6LA 1TS3A 1QCBD 5CV9A 2EYPA 3S1QB 2PZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3V A;  4PMC A;  2EYO A;  5HUR A;  5ISR A;  5M9O A;  2SOB A;  2SNS A;  4G57 A;  4KD3 A;  3HEJ A;  3SXH A;  4K2K A;  2F0D A;  4IAL A;  5CV7 A;  5KGU A;  2F0O A;  1JOO A;  5EKK A;  2F0G A;  5CV5 A;  3TP8 A;  5DAU A;  4LAA A;  4ODG A;  4EQP A;  2F0V A;  1ENA A;  4DU9 A;  4B9X A;  1NUC A;  1STA A;  2EY6 A;  1SYB A;  1EZ6 A;  1SYE A;  2F0K A;  5C5M A;  1SNP A;  2QDB A;  4B9W A;  2EYL A;  5IGB A;  4NDX A;  1STG A;  2EYF A;  2EY1 A;  2SNM A;  4J6H A;  4MIU A;  5JOB A;  5C3X A;  4IUN A;  2O4X A;  4KY5 A;  5C4H A;  2EXZ A;  2PW5 A;  3C1F A;  5CV4 A;  3TP6 A;  2WAC A;  3OMC A;  4NP5 A;  4H7B A;  2LKV A;  3NQT A;  1A3V A;  4J1M A;  5C5L A;  3T13 A;  5KEE A;  1JOR A;  1F2M A;  3NHH A;  3RUZ A;  4KY7 A;  1STN A;  1EY5 A;  3SK5 A;  2F0I A;  4PMB A;  5CR3 A;  1EY6 A;  4EQO A;  2F0P A;  2NUC A;  3D6C A;  3EVQ A;  1F2Y A;  2KHS A;  3NK9 A;  3BDL A;  3SK6 A;  5KYI A;  1U9R A;  3H6M A;  2F0U A;  2F0S A;  4K6D A;  5C6A A;  5F2D A;  5CV8 A;  4DGZ A;  3MVV A;  4KJO A;  3NXW A;  2PYK A;  4ZUJ A;  5I9O A;  5IGG A;  4EVO A;  1SNC A;  3ERQ A;  2F0N A;  4IZ8 A;  4DFA A;  5HGT A;  4KHV A;  1A2U A;  2EY2 A;  3MEH A;  3OMG A;  4PNY A;  5IGE A;  2EY5 A;  3NUC A;  4K2L A;  4N9P A;  4QB4 A;  4QMG A;  1SYD A;  5EKL A;  2RBM A;  3QOL A;  5J39 A;  3D4W A;  4K5V A;  3SK8 A;  1F2Z A;  5CV6 A;  1IHZ A;  5IGD A;  1STB A;  1ENC A;  2F0Q A;  4HMJ A;  3VA5 A;  5C3W A;  5KRU A;  1EY8 A;  4K8J A;  1KAB A;  4K5W A;  5J1Z A;  3DMU A;  1NSN S;  3MHB A;  4WOR A;  3SR1 A;  1EYA A;  5IIF A;  5IOC A;  3R3O A;  5I9P A;  1SYF A;  3TP5 A;  4ZQ3 A;  1JOK A;  5IGF A;  1AEX A;  1TQO A;  3DHQ A;  3ITP A;  5EGT A;  2F0M A;  2RKS A;  3LX0 A;  4I65 A;  3MXP A;  2RDF A;  5IOD A;  2PW7 A;  1A2T A;  2F0J A;  1EY9 A;  1KAA A;  3BDC A;  4R8N A;  4DF7 A;  5I6W A;  1KDB A;  3P75 A;  4HMI A;  4HTH A;  4K5X A;  5DEH A;  4RKB A;  2PZW A;  4ZUI A;  2EYJ A;  4YIJ A;  2PZT A;  3HZX A;  5IGC A;  2EYH A;  2OXP A;  4K14 A;  1EYD A;  4KJN A;  4QF4 A;  2F0W A;  3TME A;  1JOQ A;  1SNM A;  2ENB A;  2OF1 A;  3D8G A;  1EY7 A;  3C1E A;  3EJI A;  4RKL A;  3TP7 A;  4K8I A;  3SK4 A;  5CC4 A;  1II3 A;  1KDA A;  1EQV A;  2F0L A;  4S3S A;  3SHL A;  1SNO A;  3T16 A;  2HQE A;  1STY A;  5K5P A;  2EYM A;  4F7X A;  2OEO A;  3QOJ A;  5KIX A;  1EZ8 A;  5J22 A;  4EQN A;  1SND A;  4KD4 A;  2F3W A;  3MZ5 A;  5C4Z A;  2F0H A;  5KYL A;  1EYC A;  1SYC A;  3V2T A;  2F0E A;  3OWF A;  1TT2 A;  1STH A;  3OSO A;  3U9O A;  4E6I A;  3P1H A;  5CGK A;  5I6Y A;  3S9W A;  3E5S A;  4F8M A;  1EY0 A;  1KDC A;  3D4D A;  1EY4 A;  4ID6 A;  4KV6 A;  3QB3 A;  4ME5 A;  5E1F A;  5E3F A;  5JAV A;  2F0T A;  3ERO A;  4NMZ A;  4N9T A;  4WRD A;  5NUC A;  3PMF A;  1A3U A;  4TRD A;  5CV9 A;  1A3T A;  1TR5 A;  1RKN A;  1SYG A;  2KQ3 A;  4NKL A;  2F0F A;  4KTA A;  2M00 A;  2EYP A;  4OL7 A;  3NP8 A;  2PZU A;  2PQE A;  4KY6 A;  1SNQ A; 
#chains in the Genus database with same CATH topology
 4OEM B;  4BXX G;  1EU4 A;  4G57 A;  3KBX A;  1SFO B;  1YHA A;  4IPC A;  3PIO 3;  4LF4 L;  3KLS A;  5C0X H;  2B2Y C;  1C48 A;  2JA7 G;  3OW2 A;  3VYT A;  4F88 A;  2F0G A;  1PDQ A;  3TBI B;  4C3H G;  4DAM A;  1O80 A;  3VDY A;  3E0E A;  4FXK C;  1JE5 A;  3CF5 A;  1G8Z D;  1N32 Q;  3O13 A;  1EZ6 A;  4ABN A;  1LYL A;  3HOY B;  2I5L X;  5H1S E;  3V05 A;  4JI6 Q;  5G3L D;  3L7Z C;  1BVS A;  3I4L A;  4FNF A;  3KJP A;  1JT8 A;  1VQC A;  5C4H A;  2PMZ E;  2Z9H A;  1I5F A;  1N33 L;  1XNQ Q;  2I0Q A;  5C5L A;  2Z6K C;  1ZXT A;  1A62 A;  1F77 A;  3TZD A;  4A3B B;  3A5U A;  3AQQ A;  4L6T B;  2C35 B;  1ONL A;  3H3V I;  1LTR D;  1YNN D;  2B2V A;  3EIV A;  4KJO A;  4GKK Q;  3KF8 A;  1HNX Q;  1HZB A;  3R93 A;  2F0N A;  4NXN Q;  2IT1 A;  3I73 A;  1E1T A;  4PNY A;  4KKU A;  2CW0 C;  2QCP X;  3PQI A;  4RHS A;  4YCW A;  3GTJ B;  1XWE A;  5T1G A;  1R4P B;  4HMJ A;  4O0A A;  3HGB A;  3HOW G;  1LT5 D;  1NSN S;  3CRK C;  1EYA A;  5IOC A;  4L5S A;  2N49 A;  4HIM A;  3IKJ A;  1Q82 C;  2KVM A;  2PI2 A;  5EGT A;  2JA9 A;  4A3J G;  4A3J H;  4IJH A;  4DV4 L;  3LGJ A;  5ELF A;  2LS0 1;  2UXC L;  4X3T A;  3K58 A;  3H94 A;  2E8G A;  2PZW A;  1OXV A;  3Q22 A;  1GO3 E;  1NMG A;  2JA7 B;  4IPH A;  4QF4 A;  2L12 A;  3MC0 B;  2LXJ A;  4PMW A;  3I4N H;  2QIL A;  4O1N A;  2ENB A;  4C3H B;  2BH2 A;  2L4N A;  1P8L A;  4OON A;  3HOZ H;  1E7Z A;  1JOR A;  3W1G A;  2A1A A;  3S15 B;  1TWA H;  3D4R A;  2DNE A;  1NY4 A;  1VQL A;  3S1N H;  3T4A C;  4ALP A;  5DM7 3;  1YZ6 A;  5T1I A;  1AW7 A;  1X6O A;  4A3D B;  4U67 3;  3MZ5 A;  2IL8 A;  2HHH L;  1RTN A;  4CDF C;  2ZJR A;  4QL5 A;  5E3F A;  1U4M A;  2AWO A;  1SXT A;  2OTJ A;  3S1M H;  1G91 A;  2Q8T A;  4TRD A;  1TR5 A;  1BCP F;  1ENF A;  4DV0 L;  4PZ8 A;  2BE5 D;  5C4J H;  1K0R A;  1UE5 A;  1KC8 C;  4JI2 L;  2NVX H;  1WTQ A;  5CBA E;  1G2S A;  4XYQ A;  2F0O A;  5FLM G;  3OIQ A;  2A69 D;  4A4I A;  4C3I H;  2FMM A;  4LAA A;  1QNU A;  2A6E C;  2IWH A;  4LNQ A;  1ENA A;  1KRS A;  3CMA A;  1V43 A;  3K81 C;  3JAM i;  4JBK A;  3HOW B;  4ZCK A;  3Q8D A;  1SNP A;  1N32 L;  4B3S Q;  1CZG A;  4MIU A;  4A3M H;  3K6O A;  4BS9 A;  2L11 A;  1DOL A;  3KLS X;  2Z4H A;  4IJL A;  1MJC A;  5KEE A;  3VR5 A;  2E2H H;  3A8J E;  4IOA A;  1F2M A;  1XNQ L;  5CR3 A;  1PRT C;  4KHZ A;  2BA1 A;  1SSO A;  1BDO A;  3I3C A;  4L5T A;  1JB7 A;  2R7Z H;  4JV5 Q;  3K5N A;  5IYB G;  4DGZ A;  3MVV A;  5IYB H;  3NXW A;  3I4O A;  3CCU A;  1JCK B;  1TWF B;  2MUY A;  4GKK L;  1HNX L;  3QWN A;  5J39 A;  4LF6 Q;  2NVQ H;  4U68 A;  1IL8 A;  1BO0 A;  3D6W A;  4NXN L;  3SK8 A;  1NJI C;  2IX3 A;  3SDZ A;  1JMC A;  3PO3 H;  2AQ2 B;  5BN4 A;  3CQZ H;  3G6E A;  2MJ8 A;  2Q2T A;  2E2I H;  2F0M A;  1I6H B;  2KUM A;  2DJF C;  5EPK A;  2MFI A;  2NVY B;  1HR0 W;  5LMU Q;  3F2D A;  2CVR A;  3BVZ A;  3J7Y W;  2WB1 G;  1EIF A;  2QDL A;  1WOC A;  3NTI A;  1LTG D;  2FJ2 A;  4OO1 G;  3UI2 A;  1UAP A;  3CCL A;  2RDH A;  2BA0 A;  4JBW A;  4LWC A;  3J80 E;  1I3Q H;  3L3O C;  2XRS D;  3D31 A;  2EYM A;  5JVG 3;  5M3M B;  3T1Y Q;  1S3O A;  3V96 A;  2IX1 A;  4HR7 B;  3Q24 A;  3NE5 B;  2FFK B;  4MNO A;  3ZJY C;  4A75 A;  1NAP A;  4A3K H;  2F4V Q;  4NMZ A;  1TS2 A;  4PZ7 A;  2KQ3 A;  3I91 A;  2AHO B;  3OOC A;  1PTO B;  3A74 A;  1GD7 A;  4G7Z C;  1DOK A;  2R7F A;  1IW7 D;  1L0Y B;  4PMC A;  3DWA A;  1X32 A;  2F0D A;  2VS1 A;  4DR2 Q;  4B3R Q;  4M1U B;  1PTO D;  1HH2 P;  2IPK D;  3PUZ A;  4ODG A;  1EQR A;  1SDF A;  2GVA A;  2V1C C;  4LF9 Q;  1MSG A;  4L5Q A;  4B9X A;  1AP0 A;  4FO2 A;  3CAM A;  3MXG A;  2IY5 B;  2QDB A;  4JI4 Q;  2UXB Q;  1G6Z A;  4DR6 Q;  2O4X A;  1HQR D;  1SE3 A;  4B3S L;  4NXM L;  4NP5 A;  5DM6 3;  1I94 L;  2PNR C;  3NHH A;  4A3F B;  3SK5 A;  2WB1 B;  3T1H Q;  1KQS A;  3EVQ A;  1DON A;  1U0L A;  4JV5 L;  3OIP A;  3ERQ A;  2PZU A;  1ZEQ X;  3HKS A;  1Y1V H;  3WOE A;  3ONA B;  2Y0S G;  3IRB A;  3GTP H;  1EEF D;  2DJG C;  2NVT B;  4C2M B;  1N34 L;  2N88 A;  4K8J A;  3GD7 A;  3DMU A;  2AUJ D;  3KK7 A;  5GAE C;  4I65 A;  3BYY B;  5FO9 B;  1VQB A;  2M9V A;  1K83 B;  4OGQ C;  1K8O A;  1ZYR C;  4FF1 A;  4HTH A;  4TQU S;  5LMU L;  4GKJ L;  2ZTD A;  1EYD A;  2XWJ B;  2WB1 E;  4DNT B;  4L8J A;  2MGS A;  4HJA A;  3PUV A;  4ILW A;  5CC4 A;  4GLX A;  5FLX L;  4UP9 A;  4S3S A;  1Y1W G;  3S14 H;  3ULP A;  3CC2 A;  3L0O A;  2HQE A;  1Y8P B;  3I4M G;  2KCT A;  4JOI A;  1PFS A;  3RMH A;  3M4Y A;  1SLJ A;  1SND A;  2A68 D;  1S5C D;  5C4Z A;  2R3Z A;  1K3R A;  3QO2 A;  5IT9 L;  3T1Y L;  2CCZ A;  3L9A X;  3UDI A;  1VQN A;  3TS2 A;  1SMY C;  1A3T A;  1SYG A;  1SRU A;  2F0F A;  1SE4 A;  4CDC C;  2R92 G;  5M3F G;  2Q8R E;  4XXE A;  1M1K C;  1LO5 D;  4HCS A;  1RIP A;  5JPM C;  4DR2 L;  2Y0S B;  1O7Z A;  3M4O B;  2K5W A;  4C3J G;  3S24 A;  3DM3 A;  3F2U A;  1SYE A;  5D3I B;  1G51 A;  1ML0 D;  4B9W A;  2EYL A;  2FXQ A;  1AE2 A;  1H9R A;  4JI4 L;  2UXB L;  4CJ1 B;  1HHV A;  3S1R B;  1VDZ A;  3UE0 A;  2VUM H;  1LV9 A;  4EQO A;  1H95 A;  3ND9 A;  1TS4 A;  4BBS G;  5C4X G;  3FRP B;  5I4D A;  1U9R A;  3MXN A;  4A3C H;  1EIH A;  2Z4I A;  2DY8 A;  3VA7 A;  2XVS A;  2V4D A;  3CKI B;  1YNJ C;  1Y1W B;  1SNC A;  4PG3 A;  1CUK A;  2DN8 A;  3I4M B;  1QVF A;  3S17 H;  5EPJ A;  4A3E H;  1LTL A;  4RG1 A;  1YIJ A;  1CKN B;  3C46 A;  1STB A;  4DUZ Q;  5KRU A;  2EXD A;  2K03 A;  2NTS A;  1EY8 A;  1RCV D;  4JYA Q;  2Y0S E;  2UUB L;  1JOK A;  4J15 A;  3DHQ A;  4LF7 Q;  1BOS A;  2K5Q A;  4X64 L;  5DEH A;  3GTK H;  2D62 A;  2J7Z A;  2R92 B;  5M3F B;  1MSH A;  3A5Z B;  2G5D A;  1GHK A;  5EAY A;  4POG A;  2QGQ A;  4PZ6 A;  3K5M A;  4WFN 3;  2Z6B A;  4X65 Q;  4LFB Q;  3CC4 A;  1JC7 A;  4C3J B;  4RCO A;  1ASZ A;  1MI2 A;  3FVQ A;  3QIA A;  3BVG A;  4NB3 A;  3HRZ C;  1EYC A;  3OSO A;  2XSC A;  2JA8 G;  1S5B D;  3P1H A;  1WTX A;  1C8C A;  1E3P A;  3QB3 A;  4DAP A;  3EN2 A;  3CP0 A;  4WRD A;  2B29 A;  3NEL A;  2K1B A;  2KBN A;  1KLG D;  3H0G H;  2K5V A;  5HUR A;  3JC6 6;  1LUZ A;  3R2T A;  3CCV A;  2ZTE A;  1FYC A;  5CV7 A;  2HUG A;  1TY0 A;  5ELD A;  4Y7N B;  4NW2 A;  4HID A;  2B2W C;  2RHQ B;  3KLW A;  4MHE A;  4EQP A;  4JI8 L;  3PSI A;  4H02 A;  2A6H D;  3AEV A;  1NUC A;  2NWG A;  4QGU A;  4RGM A;  2PPB C;  5M5W H;  5ELO A;  3STB D;  4DK1 A;  1L1O C;  4ZKC B;  2J4X A;  2NN6 I;  1CKM A;  1SE2 A;  5IWA Q;  1Q81 C;  5JEA H;  1BCP B;  1QJO A;  2XNA C;  3U4Z A;  1YBY A;  2E74 C;  4L63 B;  3AYH B;  5CBE E;  1BCP D;  4ZYS A;  1H9K A;  4ZUJ A;  1HTL D;  3PO2 G;  5JJI A;  4I7A A;  1W2B A;  4QCL A;  1WCM B;  1ZKO A;  2FMC A;  2UXD Q;  1VQE A;  4OEL B;  1QUQ A;  4HJ9 A;  1VMP A;  2E5L Q;  1ENC A;  2NN6 G;  2JA8 B;  1PH8 A;  2B2T C;  1PLF A;  1TWH H;  1I50 H;  4CKB A;  1PH4 A;  4DUZ L;  1CM9 A;  1SE8 A;  1PXU A;  3BVM A;  3GP7 A;  2B39 A;  4JYA L;  2R93 G;  3GTG B;  2PCF B;  2N55 A;  2CFM A;  1N36 Q;  4IQZ A;  2EOT A;  4LUO A;  1IBK L;  3S1Q H;  1Z7T A;  4IUU A;  4LF7 L;  1X56 A;  4L5R C;  4K0K L;  2HDL A;  2L5T A;  1SFO H;  2EYJ A;  1VQI A;  4N8X 1;  4IFD J;  5M5X B;  2WV6 D;  3TME A;  1EQT A;  2L0C A;  4LJZ C;  4RWS C;  5M5Y H;  3U4V A;  4TKO B;  1RD9 D;  2K01 A;  3F2B A;  4GS3 A;  2VB3 X;  3I56 A;  2IHE A;  4X65 L;  1VQ7 A;  2WKC A;  3HOY G;  1STY A;  1YJW A;  5K5P A;  1E2W A;  1XJV A;  4XT1 B;  2CH4 A;  1B50 A;  3TRZ A;  1NBW A;  1KRT A;  3W2D A;  2K14 A;  4IUT A;  4E6I A;  1STH A;  2LFN A;  2H4O A;  3HKZ G;  4JBM A;  1IBL Q;  3PMF A;  4QJF A;  4OHJ A;  2CQA A;  3S16 B;  4A3B G;  4KY6 A;  3F1Z A;  2CQO A;  2F3V A;  5GQO A;  2SNS A;  1WTO A;  5LHY 1;  3A7L A;  3J80 L;  2C9O A;  5J3B A;  3EBE A;  1BF4 A;  1SJH D;  2EJM A;  5CV5 A;  5FJ8 H;  1H9S B;  2WAQ G;  1GXD C;  1QUQ B;  4DK3 C;  4DAY A;  1B7Y B;  3CCS A;  2JN4 A;  3BZC A;  5JOB A;  3GV3 A;  1HTP A;  2ID0 A;  2B3G A;  2EQS A;  3I2Z A;  1SBB B;  3RLF A;  2R93 B;  2JJQ A;  4H7B A;  1A3V A;  1UNS A;  3G4S A;  1IBM Q;  5COY A;  3NWT A;  3AMU A;  1I4H A;  1NR2 A;  2WFW A;  3NQI A;  5IWA L;  4BXX H;  2F0I A;  2XRQ D;  3DM1 A;  1F2Y A;  2JA7 H;  4ZLT F;  4XDX A;  1BQQ T;  2F0S A;  4C3H H;  1HA5 A;  4JI3 Q;  4JVZ A;  1DXM A;  2D5D A;  2K5N A;  1UE1 A;  1X3Q A;  1A0I A;  4KKS A;  4GNX A;  1TWG B;  4XYO A;  3RN5 A;  3ICE A;  1CA5 A;  4A3D G;  5EKL A;  1Q12 A;  2K6A A;  2O5J C;  4K5V A;  2UXD L;  5CV6 A;  5BR8 Q;  4UY8 C;  3BZK A;  4EGV A;  4I7Z C;  3HKZ B;  1CHQ D;  2E5L L;  3VR3 A;  1SYF A;  2B2V C;  1X3P A;  2JEA I;  1HZ9 A;  3HP3 A;  2JYO A;  4LF8 Q;  1KAA A;  1WD0 A;  4NPS A;  1XMQ Q;  1PZK D;  2MNA A;  2Q2H A;  4K5X A;  3PV0 A;  1PFM A;  3HZX A;  4A3G G;  1K8G A;  3W1B A;  2F03 A;  2WAQ B;  3EJI A;  2F0L A;  4OWX B;  5GAG C;  1E1O A;  3HOV G;  3HOW H;  4CHT B;  3J7A 5;  3H3V C;  4F7X A;  4DAY B;  3HOX G;  3LNN A;  1W6J A;  1S4Z A;  4B3M L;  3V2T A;  1LAB A;  5COR A;  1TT2 A;  5EJW A;  4LF5 Q;  1EY0 A;  5C44 G;  4KV6 A;  4R4Q A;  3H3V H;  4A3I G;  1AZP A;  1EOT A;  3X3N A;  2G9H D;  3EFX D;  3HKZ E;  3CW2 C;  3RLO A;  3GTO B;  3H09 A;  2EJF C;  2NYZ D;  1QIL A;  4EQ5 A;  5ISR A;  5C3E G;  3KBG A;  5K36 G;  3KF6 B;  2KEE A;  3NTK A;  1TWF H;  1B9M A;  1JOO A;  4GNX B;  4DR3 Q;  5FK9 C;  2RHS B;  3QR8 A;  1U4P A;  2EDG A;  3J7A V;  5I2Y A;  2CWA A;  2WAQ E;  4RAU C;  4NDX A;  5I2X A;  4JG2 A;  1T5X D;  4N8F A;  3PUX A;  3TSS A;  4CDD C;  1O7I A;  5CV4 A;  2OQ0 A;  3RD4 A;  1I6H H;  4Z9C B;  2NVY H;  5IYD G;  4JBJ A;  5JJL A;  5IYD H;  2RCF A;  1EY6 A;  2F0P A;  4A3G B;  1WTR A;  5FLM H;  2N3S A;  5KYI A;  1X54 A;  2XTI A;  2BCO A;  5C6A A;  5D3D A;  3TQY A;  4ZRZ A;  1TS5 A;  3K0Y A;  5I9O A;  2ZXP A;  1V1P B;  5HGT A;  3HOV B;  5LL6 S;  2NTT A;  2LY7 A;  5M3M G;  3MFY A;  3HOX B;  4N9P A;  4YWM A;  4LFA Q;  1PTO C;  1FVI A;  5EQ0 A;  4JI6 L;  1VQ4 A;  5BN5 A;  1HZC A;  3PIP A;  4AQY Q;  1WTV A;  4JI7 Q;  1X55 A;  5C44 B;  2YTV A;  2YYZ A;  3D0F A;  1IZ6 A;  5I9P A;  3GTM B;  2GN5 A;  4A3I B;  4OWW B;  2B8G A;  3TS0 A;  2IJ0 A;  1PTO H;  4V0B A;  1KNE A;  5C3E B;  4QY7 A;  4IN3 A;  3K7A H;  4OO1 I;  1NTG A;  4WJW A;  4X3S A;  1I4P A;  1WVL A;  3QG1 A;  3E6Z X;  4R8I A;  2GVB A;  2K7V A;  4HIO A;  1JJC B;  4X6A H;  4X3K A;  1J6Q A;  1TWA B;  2B8F A;  2QA4 A;  1HXY D;  4A3L G;  2B2U A;  4FF3 A;  5EPL A;  1KDC A;  4A3F G;  4YWL A;  3K8A A;  4LF5 L;  1RHP A;  4CBV A;  5C0X J;  3KUP A;  3BJU A;  4OL7 A;  4DR1 Q;  2PQE A;  1W6K A;  5CMD A;  4OO1 H;  4UPA A;  3CCE A;  4RGN A;  2G9D A;  2X6L A;  4APV A;  5A2Q E;  4RHR A;  4IO9 A;  1CSP A;  1R9T B;  1AH9 A;  3S2H B;  3TP8 A;  3OTO Q;  3OWE B;  1HFN A;  2NVX B;  4C2M H;  3E9I A;  3Q6S A;  4C56 C;  1XMO Q;  4DR3 L;  4AYB G;  1CTM A;  4C3I B;  1HRJ A;  1HUM A;  1YIT A;  5C3X A;  3C1F A;  2Z1C A;  1I4R A;  4J1M A;  1EUJ A;  5AFW A;  1YJ9 A;  3RUZ A;  1YHB A;  2JEB I;  1Y14 B;  4CJ0 B;  4A3M B;  1T5E A;  1B44 D;  1FD7 D;  3HOU G;  1F9Q A;  1S40 A;  4K6D A;  2X6G A;  4Q0F A;  3JAM E;  4DUY Q;  4EVO A;  1Q1B A;  2D0O A;  1TVX A;  1V9P A;  1RF2 D;  4BY1 G;  3PF4 A;  4DFA A;  3ULL A;  2F3I A;  3RNU A;  4BA2 I;  1V1O A;  3SGI A;  4BBR G;  2BH8 A;  2I46 A;  5EBD A;  4LFA L;  1IKM A;  2CHB D;  5AJ3 Q;  4JI7 L;  1TQO A;  1C7Y A;  3ITP A;  3U50 C;  4KN4 C;  2R61 A;  2HD3 A;  2RCN A;  2RKS A;  1Y8O B;  2XN9 C;  1A2T A;  3PO3 B;  1EY9 A;  1XPO A;  1QZH A;  1GJX A;  2J0T D;  3RR5 A;  3CQZ B;  2E2J H;  3OW7 A;  3PIP 3;  4UDU C;  2NZH A;  2K75 A;  1MGS A;  4FDB A;  2K05 A;  1EL0 A;  5FLX c;  1FL0 A;  2OF1 A;  1YVC A;  1EY7 A;  2HCC A;  3M4O H;  3I72 A;  4A93 G;  1GUT A;  4LF6 L;  1B3Q A;  1JR0 D;  4DPG A;  4AYB B;  1BUV T;  2D9U A;  5IT9 c;  1UE6 A;  4X62 Q;  1YHQ A;  3B6Y A;  3FPU B;  2FIN B;  2JA6 G;  3S1R H;  3PUW A;  4ME5 A;  2WII B;  5ELN A;  3FMC A;  3MXU A;  2JA5 B;  3K5O A;  3GTQ B;  1JB3 A;  3HOU B;  1X9N A;  2OWO A;  3I90 A;  4JOI C;  1WD1 A;  2SOB A;  2SEB D;  1D2B A;  3HEJ A;  4DR1 L;  5JJZ A;  1Y1W H;  1PH5 A;  4BY1 B;  2OCE A;  3KOJ A;  2NB0 A;  1CKN A;  3SE0 A;  3I4M H;  1I4G A;  1VQJ A;  2MO0 A;  2D0P A;  5E4W C;  5DAU A;  1CFM A;  1I4Q A;  4R1J A;  4BBR B;  5JVH 3;  3GTL B;  2KA7 A;  3I8Z A;  3M7N A;  1K8M A;  3OTO L;  3TRE A;  3NWS A;  3TN2 A;  3TZU A;  4YY3 Q;  1PHJ A;  2X69 A;  3KFU A;  2HT1 A;  1VS0 A;  4IUQ A;  2AQ1 B;  1HNZ Q;  3TP6 A;  2F4V L;  2LKV A;  4AYB E;  1D6E C;  3BS1 A;  1FNU A;  1B1Z A;  4G7H C;  5LL6 X;  2GA4 B;  2YU9 B;  1STN A;  4TVA B;  2R92 H;  5M3F H;  4GZY C;  1X3E A;  2EZV A;  3R2I A;  1IYV A;  4C1N I;  2ES2 A;  4BY7 B;  3SEB A;  2RSO A;  4B3R L;  2NZ1 D;  4C3J H;  4DKA C;  4A93 B;  1IXR A;  1PH3 A;  2O5I C;  4P75 A;  1PH6 A;  4LF9 L;  2EVB A;  2EY5 A;  4DV7 Q;  1S5F D;  4R4O A;  2OQK A;  3L2P A;  3VYU A;  2Q2I A;  3CPW A;  1A8V A;  4DR6 L;  2JA6 B;  3A56 A;  5IIF A;  4IFD G;  1CT1 D;  1Y1V B;  4Q5V A;  1VQO A;  3STB C;  4ZK9 B;  4BBS H;  5C4X H;  2RDF A;  3T1H L;  5AJ3 L;  2F0J A;  4R8N A;  3E9H A;  5I6W A;  4YHH Q;  4HMI A;  5LMN Q;  5IYC G;  1KLU D;  2EYH A;  1Q3L A;  2EIF A;  1GM5 A;  4RGO S;  3URY A;  3G48 A;  1II3 A;  3SHL A;  1BCP C;  3W3A A;  2KOL A;  1OXT A;  1T9H A;  3ZYY X;  1EQQ A;  4FP5 D;  4DNR B;  1NE3 A;  1SMX A;  2ASB A;  1KIX A;  4GLV B;  3U9O A;  3S9W A;  1EWC A;  1HA6 A;  3J7A F;  4DV1 Q;  3X3M A;  2K32 A;  5JAV A;  4X62 L;  3TEH B;  2KCC A;  3ERO A;  4IPG A;  3IFD A;  1A3U A;  5DLQ E;  1D5Z C;  2PNH A;  1ZYR D;  3NP8 A;  5E4X A;  1ASY A;  3EQL C;  2LMC B;  3FKI G;  4R9W A;  4KD3 A;  3M3Y B;  4RFB A;  4DV5 Q;  2HCI A;  2VW9 A;  1B70 B;  1WCM G;  2AKW B;  3PGZ A;  5KNB A;  1Y8N B;  4P73 A;  2AWN A;  2JSO A;  1PYB A;  1U4L A;  3I70 A;  3MEF A;  2EY6 A;  1SYB A;  2JA8 H;  1NR4 A;  4FXD A;  1STG A;  2PW5 A;  3GTG H;  3ERS X;  1MKH A;  4R4I A;  1PFB A;  1QG7 A;  4LMQ D;  2IHF A;  3A0J A;  4HSV A;  1WTP A;  5M5X H;  4B3T Q;  1Q8K A;  4KHP Q;  3CCR A;  1M4V A;  3A55 A;  4KHV A;  3KJO A;  5JPN C;  2I07 B;  3AFQ A;  4JI1 Q;  1PRT F;  1WI5 A;  2YV5 A;  3DWQ A;  3VA5 A;  4DV7 L;  1U4R A;  4RGT A;  2WKD A;  5J1Z A;  3R3O A;  3A7A B;  3GV6 A;  3S17 B;  4HN7 A;  1E2Z A;  1SJE D;  4ZAI A;  1LTS D;  3NPP A;  1TWC B;  3S16 H;  4R4C A;  2K28 A;  3SVM A;  3BYT B;  1FJG Q;  1CI3 M;  1LT3 D;  3FKI B;  3P75 A;  3RZO B;  3TDQ A;  3PO2 H;  3IL8 A;  3RZD B;  2DGY A;  1H9S A;  4YHH L;  2MP1 A;  3CPF A;  2IX0 A;  4KJN A;  2F0W A;  1XX8 A;  3LWU A;  2OT2 A;  4LF4 Q;  1YNJ D;  3J81 c;  1V1Q A;  4K8I A;  1KDA A;  2K4K A;  1GKH A;  1SNO A;  4CDE C;  2NN6 H;  2LSS A;  3C3L A;  2VB2 X;  3DUZ A;  2CH4 W;  1GUG A;  3RN2 A;  4HJ7 A;  1EIG A;  2F0H A;  2R93 H;  1SYC A;  5JJK A;  2YTX A;  4H0L C;  1EY4 A;  2K50 A;  1JWU D;  5E1F A;  1N33 Q;  1HUN A;  2H1E A;  4N9T A;  2M2L A;  4UHV A;  3K5L A;  4DXF A;  1FGU A;  3WDN A;  1QWY A;  4DV1 L;  2ZXO A;  1J8I A;  4MTN A;  3J80 c;  3FP9 A;  3K59 A;  2VL6 A;  1QE6 A;  1CKO A;  4R4T A;  3I7F A;  3AU7 A;  3NEM A;  1YNN C;  1JJG A;  4IAL A;  3KYH C;  5IP7 G;  4LFB L;  3HOY H;  1TU2 B;  1TWG H;  2SDF A;  3H0G B;  5IP9 G;  4DV5 L;  4GOP A;  2B63 G;  1GOZ A;  3MTS A;  4QQB X;  1ET9 A;  4PV1 C;  1UE7 A;  1M8A A;  1NNX A;  5HGQ A;  4LUZ A;  2RSN A;  4JI5 Q;  2EY1 A;  2MPM A;  2JE6 I;  4BWG B;  2A74 C;  2AQ3 B;  2RQX A;  4A3B H;  2TSS A;  1LLR D;  5CYU A;  1PH1 A;  3W5O A;  2UXC Q;  1DZ1 A;  5A2Q L;  1Z47 A;  2Z8L A;  3H6M A;  3GTJ H;  2KHI A;  1WFQ A;  4RCN A;  1C9O A;  4KHP L;  2K52 A;  3BDO A;  4QMG A;  4K2L A;  1HJP A;  3VR6 A;  2RBM A;  3KLR A;  3S2D B;  3K7U C;  1F9R A;  5C3W A;  2F0Q A;  1VQM A;  1LTA D;  1XNR Q;  3CCM A;  1K9M C;  2VNU D;  4DK6 C;  1IKL A;  2RA4 A;  3SR1 A;  3FEW X;  1D1I A;  3TP5 A;  2JQO A;  4CKC A;  1VQ8 A;  4MN3 A;  4JPB W;  1XPU A;  3GTO H;  4GNX C;  2PW7 A;  3KF6 A;  1VF5 C;  2Z0S A;  1TWH B;  3VYR A;  1PH2 A;  1GUW A;  4ZUI A;  2BE5 C;  3JAM L;  5A35 A;  3S15 H;  1VQH A;  4P2C B;  1FJG L;  4ULL A;  4K14 A;  4A3D H;  2B63 B;  1V8Q A;  1EOV A;  1HR0 Q;  4JK1 C;  2A69 C;  4GOP B;  2HIX A;  5C0X G;  1HNW Q;  4WJ4 A;  1AFP A;  5M5Y B;  1EZ8 A;  2R6G A;  2HQL A;  5E7N A;  2B2Y A;  2F1M A;  3NTH A;  4FXG C;  2PQA A;  1N36 L;  4PQX A;  2E76 C;  1RKN A;  1RL2 A;  3FPP A;  5ELC A;  4KTA A;  3CXC A;  4A3G H;  1PZI D;  4XT3 B;  1V1P A;  3M4P A;  1SNQ A;  1L0W A;  3DXJ C;  3G7L A;  1GHJ A;  1G29 1;  1KTK A;  1W3S A;  1KD1 C;  2UU9 Q;  3HOV H;  1L2F A;  2BOS A;  5EKK A;  2KCN A;  2Z6K A;  3CD6 A;  3HOX H;  2ZM6 Q;  4RMF A;  2A8V A;  4JC0 A;  4YCU A;  1HPC A;  1CA6 A;  1E22 A;  4DU9 A;  1MHW C;  1RTO A;  1ROD A;  5JEA J;  3M7G A;  5C44 H;  1VCI A;  3GO5 A;  1J5E Q;  1KL9 A;  3GTM H;  1N9W A;  4DV2 Q;  4A3I H;  4HED A;  4ME3 A;  4KY5 A;  1AZQ A;  4Y52 H;  1O78 A;  2WAC A;  3OMC A;  1MBY A;  4JI5 L;  1IBL L;  1HQM C;  2KCM A;  3J81 i;  1Q90 A;  2A73 B;  2JXM B;  5C3E H;  1S5D D;  5K36 H;  4B08 A;  1LTT D;  4FVM A;  3SK6 A;  3CRL C;  1Y69 U;  2NZO A;  1E2V A;  5HY6 A;  2K5D A;  3UE1 A;  1UWV A;  4IZ8 A;  1TKW B;  3I4N G;  1A2U A;  2MO1 A;  4KKT A;  1ESF A;  1VQD A;  3HOZ G;  1BBU A;  1PYW D;  4IOC A;  3J80 i;  5D65 A;  5FO7 B;  1LM0 A;  1XNR L;  2PQA B;  1IBM L;  4FF2 A;  4M8A A;  1DGS A;  4O42 A;  3PUY A;  1EWH A;  3M9B A;  3R8B A;  1D8L A;  4O2D A;  3H91 A;  3J81 j;  1IW7 C;  1ILP A;  1E0B A;  5GAD C;  2KEC A;  3G6J B;  4JI3 L;  1PMR A;  1R9T H;  4X3U A;  4DR4 Q;  4HCE A;  5M3M H;  3S2H H;  4F87 A;  5FO8 B;  4RKL A;  3TP7 A;  3SK4 A;  4RA8 A;  1HR0 L;  3KF8 B;  4QUF A;  5BR8 L;  3NBH A;  4C3I G;  5J22 A;  3CHB D;  4EQN A;  1HNW L;  5IE8 A;  3NBI A;  2H5X A;  4XTC S;  2ATW A;  1QVC A;  1K28 A;  1CZW A;  1RDP D;  2EPB A;  4F8M A;  3MWY W;  3UDG A;  5EKI A;  3AB9 A;  4NXM Q;  2VY3 A;  4A3M G;  5NUC A;  4H44 C;  1I94 Q;  1XMQ L;  4LF8 L;  4LUV A;  5ELE A;  4A3J B;  2UUA Q;  1KXL A;  1I4X A;  3DLL A;  2JP1 A;  2HDM A;  4CKE A;  4K2K A;  2CW0 D;  4CJ2 C;  2YTY A;  5KGU A;  3I4N B;  2B2U C;  2R7Z G;  3PF5 A;  1D5M C;  2KJX A;  2WP8 J;  2OTL A;  4KMU C;  2UU9 L;  3HOZ B;  1YI2 A;  2F0V A;  1OXX K;  4TSS A;  2ZM6 L;  4A3L H;  3VR4 A;  3S1N B;  4G4K A;  1VQ5 A;  4CGY B;  1Q8I A;  4A3F H;  4DXG A;  1GVP A;  4J6H A;  2QF7 A;  1N34 Q;  4IPD A;  4P72 A;  1PYS B;  1JIC A;  1J5E L;  4A76 A;  1IL2 A;  2IW3 A;  3ND8 A;  3J81 E;  3PO3 G;  4DV2 L;  2Q8I B;  3ER0 A;  3PCO B;  1OXU A;  5BN3 A;  1D5X C;  3S1M B;  4DA2 A;  1EY5 A;  1WYD A;  1A63 A;  1JQY D;  1S5E D;  3D6C A;  1QZG A;  1K3B C;  2KHS A;  5C4J B;  3OYY A;  4HSP A;  2C5C A;  5F2D A;  3IAY A;  4GKJ Q;  2PYK A;  2NVT H;  1KNA A;  4P74 A;  2PI2 E;  3MEH A;  1VQF A;  3CU7 A;  1PH7 A;  2VQE Q;  1SRO A;  1SN8 A;  3D4W A;  3M4Q A;  1K73 C;  1F2Z A;  1IHZ A;  2VZA A;  3NBH B;  2A68 C;  3NEN A;  3U9S A;  5M9O A;  1VQG A;  1K83 H;  4XQJ A;  3GQB A;  1C4Q A;  1BNZ A;  1B8A A;  2JA5 G;  2JA5 H;  1OO9 B;  3GTQ H;  3HOU H;  5IOD A;  1X3F A;  2E2H B;  4J8Q A;  1F9S A;  3E3X A;  4A3K G;  1IYJ B;  4YIJ A;  2PZT A;  5IGC A;  4BY1 H;  1JE4 A;  1F2L A;  2R7Z B;  3BZD B;  2A6E D;  3OPO A;  4BBR H;  3C1E A;  3QJY A;  4DR4 L;  3GTL H;  5G3L F;  4G7O C;  3K7A B;  4OXP A;  4BA1 I;  3A54 A;  1PRT B;  4KN7 C;  4WJ3 M;  2DY7 A;  3QOJ A;  5KIX A;  4AQY L;  2NVQ B;  3F8T A;  1JJ2 A;  2F0E A;  2I5H A;  1WJJ A;  2P5Z X;  1OTC A;  1PRT D;  4ID6 A;  3I55 A;  3Q0A A;  1B9N A;  2YU9 H;  2F0T A;  3CC7 A;  2EJG C;  2E2I B;  2K33 A;  1A15 A;  1R4Q B;  4BY7 G;  4BY7 H;  2O2L D;  4DV6 Q;  4IUR A;  1B3A A;  2UUA L;  1BBW A;  4A93 H;  2RVL A;  3BG3 A;  4OWT B;  1LT4 D;  2K04 A;  4H13 C;  4C1N K;  2D2C C;  1SAP A;  2ALY B;  4HIK A;  2L9H A;  1I3Q B;  1XTC D;  1DD2 A;  2KEN A;  1XTD A;  2JA6 H;  2ZT9 C;  5C5M A;  4DAV A;  4XQN A;  1Y1V G;  2EXZ A;  2DNC A;  3LWE A;  3UDX A;  2UUB Q;  3T13 A;  3A8K E;  4IUV A;  4KY7 A;  4A3K B;  4X64 Q;  1XXG A;  4GN4 B;  2NUC A;  4YCV A;  3KDF A;  1WTW A;  2RDG A;  5TSS A;  4JCV E;  1EFW A;  3OHX C;  1QVG A;  3NK9 A;  3BDL A;  4JW0 A;  2AUK A;  3N52 A;  3J7Z C;  1XYI A;  1TXY A;  1MJE A;  3CCJ A;  1QOH A;  3RLN A;  1JOQ A;  1O7Y A;  3FHW A;  3QOL A;  2BDO A;  1XMO L;  1YJN A;  1H9M A;  4ZKB B;  2VQE L;  4IFD I;  1B2T A;  1Z6H A;  3VR2 A;  4WOR A;  1VQ9 A;  4GN5 A;  4ZQ3 A;  4UAI A;  5IGF A;  1AE3 A;  3DEP A;  1K0S A;  2FHT A;  3MXP A;  5FOB B;  1PA6 A;  1KDB A;  2VQF Q;  1VQA A;  4RKB A;  3M3Y H;  2L15 A;  1EIY B;  3BU2 A;  4EX5 A;  1VQP A;  4DUY L;  1Q1E A;  3ULJ A;  1OXS C;  1FR3 A;  4MZ9 A;  4UP8 A;  3D8G A;  3HS0 C;  2E2J B;  1DJR D;  3K0X A;  3T16 A;  2A6H C;  4JI8 Q;  1X65 A;  4IFD H;  1ILQ A;  3UDF A;  1DYQ A;  1CSQ A;  1SR3 A;  2F3W A;  3GTP B;  3CCQ A;  3E5S A;  3D4D A;  4FYD A;  2A5H A;  1NCV A;  1UUP A;  1FNV A;  5IYC H;  1PH9 A;  4KK7 A;  3NSW A;  1MD2 D;  1B4O A;  1AN8 A;  2M00 A;  1BBX C;  1D7Q A;  1ICF B;  4Y7N H;  3KDF B;  2N78 A;  1GUS A;  2EYO A;  4DV3 Q;  2VUM G;  1I6V C;  3HFZ B;  1KHI A;  5DNF A;  3SXH A;  4DV6 L;  3WWV A;  1EEI D;  2QW7 A;  1XPR A;  1H9J A;  3DEO A;  4A3C G;  2KED A;  5IY0 A;  1B53 A;  3S14 B;  1EFI D;  2HIV A;  2F0K A;  2XWB B;  2ZJQ A;  2XGT A;  1A6X A;  3MA2 B;  4MTK A;  4RH6 A;  1TY2 A;  1C0A A;  2SNM A;  4A3E G;  4OIJ A;  1PZJ D;  4IUN A;  1BKB A;  4YWK A;  1U5K A;  4LW1 A;  1TWC H;  5ELB A;  1EWI A;  3E0J A;  2ZTC A;  3FKI H;  1N8R C;  2ICI A;  3RZO H;  4POF A;  3T51 B;  3T56 B;  1IBK Q;  3P20 A;  3RZD H;  2EE1 A;  1WCM H;  1O7L A;  3MAQ A;  4K0K Q;  1YEZ A;  5GRO A;  4IUP A;  2NBF A;  1UEA B;  2AMC B;  3CME A;  4X66 Q;  1Q86 C;  2F52 A;  3GDE A;  1LTI D;  5EBC A;  2EY2 A;  3OMG A;  5IGE A;  5KND A;  1G2T A;  3NUC A;  1SYD A;  1DCZ A;  4YY3 L;  3C2P A;  1QB5 D;  2A19 A;  4AH6 A;  1SMY D;  4AIM A;  1BR9 A;  2ZXR A;  4OX9 Q;  2F4I A;  4K5W A;  1BXT A;  1ESR A;  1HNZ L;  3MFG A;  1DOM A;  2LXK A;  1AEX A;  3K57 A;  4DR5 Q;  1S72 A;  4JI0 Q;  1FNW A;  3H15 A;  2E75 C;  3LX0 A;  2CKZ B;  1NMF A;  4DF7 A;  2ZJP A;  3F2C A;  1QNK A;  1Q7Y C;  2VUM B;  1PTO F;  2L55 A;  1CQV A;  1F9P A;  1ET6 A;  2VQF L;  3H0G G;  4BBS B;  1D1K A;  4KI0 A;  4DR7 Q;  5C4X B;  1SNM A;  3K80 C;  1JWM D;  1GUN A;  3MXN B;  1VF7 A;  5GAH C;  2OEO A;  1VQ6 A;  1X3G A;  4V19 0;  4A3E B;  1GUO A;  4KD4 A;  5KYL A;  1LT6 D;  4UP7 A;  4LFC Q;  3OWF A;  3PIO A;  2UUC Q;  1HFG A;  1YNX A;  3U58 A;  1Q46 A;  2B2W A;  4QUC A;  2K5H A;  2KHJ A;  3P7J A;  4NKL A;  1MIU A;  2DUD A;  3N6R A;  5L37 A;  5LMN L;  5JEA G;  1LTB D;  1L1O A;  1FGB D;  3GTK B;  2QEJ C;  3HG9 A;  4DV3 L;  1M90 C;  1ICW A;  4QIW B;  4GLA C;  2N8N A;  4KLK A;  2R7D A;  1G6P A;  2BDN A;  3S2D H;  1VMC A;  1STA A;  3T53 B;  1CQF A;  5IGB A;  2EYF A;  2QEX A;  2TMP A;  4FF4 A;  2MHV A;  3NQT A;  4GOP C;  2JK8 A;  1STE A;  1EYG A;  4OIK A;  1L0X B;  1TII D;  1UEB A;  4PMB A;  5D14 A;  5IP7 H;  2E2D C;  1CK1 A;  2I5M X;  4LK1 C;  4HJ5 A;  2B2T A;  1PV4 A;  5IP9 H;  1JWS D;  2F0U A;  1CHP D;  3FDT A;  2B63 H;  5CV8 A;  3DWP A;  4DK0 A;  3AFP A;  5IGG A;  1J9O A;  3M85 A;  2L1B A;  4X66 L;  4QB4 A;  5FLX E;  1PFN A;  1LAC A;  4XQQ A;  5IGD A;  4QIW E;  1PVO A;  4HJ8 A;  1E24 A;  1EU3 A;  3WOF A;  5M5W B;  1KAB A;  3J81 L;  3MHB A;  4B3M Q;  5LMN W;  1Z9F A;  3Q23 A;  4DV4 Q;  4OX9 L;  4DNI A;  5IT9 E;  1IYU A;  3VYS A;  1HCZ A;  3JAM c;  3BDC A;  4DR5 L;  4JI0 L;  3EA6 A;  2RF4 A;  4DN4 M;  5FKA C;  4B3T L;  2PO4 A;  4HAE A;  1L1O B;  4P71 A;  2OXP A;  2Q2U A;  1SEB D;  1HZA A;  2CWP A;  5C0X I;  2QKI C;  2ICE C;  4DR7 L;  1EQV A;  3PO2 B;  2PMZ B;  2VXW A;  4JI1 L;  5KNC A;  3G71 A;  2MQH A;  2WIN B;  2HHH Q;  3A8I E;  5FJ8 G;  2XIW A;  4XIG S;  1DM0 B;  3D3R A;  5I6Y A;  5CGK A;  1WTH A;  4DV0 Q;  1RJT A;  1KAW A;  1I50 B;  3IFT A;  4LFC L;  4K6L A;  1VQK A;  1P16 A;  1TS3 A;  1QCB D;  5CV9 A;  2UUC L;  4JI2 Q;  1K8A C;  2EYP A;  3S1Q B;  4GN3 B; 
#chains in the Genus database with same CATH homology
 1EU4 A;  4G57 A;  3KBX A;  1SFO B;  3PIO 3;  3KLS A;  5C0X H;  2B2Y C;  1C48 A;  3VYT A;  4F88 A;  2F0G A;  1PDQ A;  3TBI B;  4C3H G;  1O80 A;  4FXK C;  1G8Z D;  3O13 A;  1EZ6 A;  4ABN A;  3HOY B;  3V05 A;  5G3L D;  3L7Z C;  3I4L A;  4FNF A;  5C4H A;  5C5L A;  1ZXT A;  1F77 A;  3TZD A;  4A3B B;  4L6T B;  1ONL A;  1LTR D;  1YNN D;  2B2V A;  4KJO A;  3KF8 A;  3R93 A;  2F0N A;  2IT1 A;  3I73 A;  4PNY A;  4KKU A;  2CW0 C;  2QCP X;  4RHS A;  3GTJ B;  1XWE A;  5T1G A;  1R4P B;  4HMJ A;  3HGB A;  1LT5 D;  1NSN S;  3CRK C;  1EYA A;  5IOC A;  3IKJ A;  2KVM A;  5EGT A;  5ELF A;  2LS0 1;  4X3T A;  3K58 A;  3H94 A;  2PZW A;  1OXV A;  3Q22 A;  2JA7 B;  4QF4 A;  2L12 A;  3MC0 B;  4PMW A;  2QIL A;  4O1N A;  2ENB A;  4C3H B;  2L4N A;  1JOR A;  3S15 B;  3D4R A;  2DNE A;  3T4A C;  5DM7 3;  5T1I A;  1AW7 A;  4A3D B;  4U67 3;  3MZ5 A;  2IL8 A;  1RTN A;  5E3F A;  1U4M A;  2AWO A;  1SXT A;  1G91 A;  2Q8T A;  4TRD A;  1TR5 A;  1BCP F;  1ENF A;  2BE5 D;  1WTQ A;  5CBA E;  1G2S A;  4XYQ A;  2F0O A;  3OIQ A;  2A69 D;  2FMM A;  4LAA A;  1QNU A;  2A6E C;  2IWH A;  1ENA A;  1V43 A;  3HOW B;  1SNP A;  1CZG A;  4MIU A;  3K6O A;  4BS9 A;  2L11 A;  1DOL A;  3KLS X;  2Z4H A;  5KEE A;  3VR5 A;  3A8J E;  1F2M A;  5CR3 A;  1PRT C;  4KHZ A;  2BA1 A;  1SSO A;  1BDO A;  3I3C A;  3K5N A;  4DGZ A;  3MVV A;  3NXW A;  1JCK B;  1TWF B;  2MUY A;  3QWN A;  5J39 A;  4U68 A;  1IL8 A;  1BO0 A;  3D6W A;  3SK8 A;  2IX3 A;  3SDZ A;  2AQ2 B;  5BN4 A;  2MJ8 A;  2F0M A;  1I6H B;  2KUM A;  5EPK A;  2NVY B;  2CVR A;  3BVZ A;  3J7Y W;  3NTI A;  1LTG D;  2FJ2 A;  4OO1 G;  3UI2 A;  1UAP A;  2RDH A;  2BA0 A;  4JBW A;  3J80 E;  3L3O C;  2XRS D;  3D31 A;  2EYM A;  5JVG 3;  5M3M B;  3V96 A;  2IX1 A;  4HR7 B;  3Q24 A;  3NE5 B;  2FFK B;  1NAP A;  4NMZ A;  1TS2 A;  2KQ3 A;  3I91 A;  3OOC A;  1PTO B;  4G7Z C;  1DOK A;  1IW7 D;  1L0Y B;  4PMC A;  3DWA A;  1X32 A;  2F0D A;  4M1U B;  1PTO D;  2IPK D;  3PUZ A;  4ODG A;  1SDF A;  1MSG A;  4B9X A;  1AP0 A;  4FO2 A;  3MXG A;  2QDB A;  1G6Z A;  2O4X A;  1HQR D;  1SE3 A;  4NP5 A;  5DM6 3;  2PNR C;  3NHH A;  4A3F B;  3SK5 A;  2WB1 B;  3EVQ A;  1DON A;  3OIP A;  3ERQ A;  1ZEQ X;  3WOE A;  3ONA B;  1EEF D;  2NVT B;  4C2M B;  2N88 A;  4K8J A;  3GD7 A;  3DMU A;  2AUJ D;  3KK7 A;  4I65 A;  3BYY B;  5FO9 B;  2M9V A;  1K83 B;  4OGQ C;  1K8O A;  1ZYR C;  4FF1 A;  4HTH A;  4TQU S;  1EYD A;  2XWJ B;  4DNT B;  4L8J A;  2MGS A;  3PUV A;  4ILW A;  5CC4 A;  5FLX L;  4S3S A;  2HQE A;  1Y8P B;  3RMH A;  3M4Y A;  2A68 D;  1SND A;  1S5C D;  5C4Z A;  2R3Z A;  3QO2 A;  5IT9 L;  3L9A X;  1SMY C;  1A3T A;  1SYG A;  2F0F A;  1SE4 A;  2Q8R E;  4XXE A;  1LO5 D;  4HCS A;  5JPM C;  2Y0S B;  1O7Z A;  3M4O B;  2K5W A;  4C3J G;  3F2U A;  1SYE A;  5D3I B;  1ML0 D;  4B9W A;  2EYL A;  1H9R A;  4CJ1 B;  1HHV A;  3S1R B;  1VDZ A;  1LV9 A;  4EQO A;  3ND9 A;  1TS4 A;  3FRP B;  5I4D A;  1U9R A;  3MXN A;  1EIH A;  2Z4I A;  2DY8 A;  3VA7 A;  2XVS A;  2V4D A;  3CKI B;  1YNJ C;  1Y1W B;  1SNC A;  2DN8 A;  3I4M B;  5EPJ A;  3C46 A;  1STB A;  5KRU A;  2K03 A;  2NTS A;  1EY8 A;  1RCV D;  1JOK A;  3DHQ A;  1BOS A;  2K5Q A;  5DEH A;  2D62 A;  2J7Z A;  2R92 B;  5M3F B;  1MSH A;  1GHK A;  3K5M A;  4WFN 3;  1JC7 A;  4C3J B;  4RCO A;  1MI2 A;  3FVQ A;  3QIA A;  3BVG A;  3HRZ C;  1EYC A;  3OSO A;  2XSC A;  1S5B D;  3P1H A;  1WTX A;  1C8C A;  3QB3 A;  4DAP A;  4WRD A;  2K1B A;  1KLG D;  5HUR A;  3R2T A;  1FYC A;  5CV7 A;  2HUG A;  1TY0 A;  5ELD A;  4Y7N B;  4NW2 A;  2B2W C;  4MHE A;  4EQP A;  2A6H D;  1NUC A;  2NWG A;  4RGM A;  2PPB C;  4DK1 A;  4ZKC B;  2J4X A;  2NN6 I;  1SE2 A;  5JEA H;  1BCP B;  1QJO A;  2XNA C;  2E74 C;  4L63 B;  5CBE E;  1BCP D;  4ZYS A;  1H9K A;  4ZUJ A;  1HTL D;  4QCL A;  1WCM B;  1ZKO A;  2FMC A;  1VMP A;  1ENC A;  2NN6 G;  2JA8 B;  2B2T C;  1PLF A;  4CKB A;  1CM9 A;  1PXU A;  3BVM A;  3GP7 A;  2B39 A;  3GTG B;  2PCF B;  2N55 A;  4IQZ A;  2EOT A;  1Z7T A;  4IUU A;  2HDL A;  2L5T A;  2EYJ A;  4IFD J;  5M5X B;  3TME A;  2WV6 D;  1EQT A;  2L0C A;  4LJZ C;  4RWS C;  4TKO B;  1RD9 D;  2K01 A;  2VB3 X;  2WKC A;  1STY A;  5K5P A;  1E2W A;  4XT1 B;  1B50 A;  3W2D A;  4IUT A;  4E6I A;  1STH A;  2LFN A;  2H4O A;  3PMF A;  4OHJ A;  2CQA A;  3S16 B;  4KY6 A;  2F3V A;  2SNS A;  1WTO A;  5LHY 1;  3A7L A;  3J80 L;  2C9O A;  1BF4 A;  1SJH D;  2EJM A;  5CV5 A;  1H9S B;  1GXD C;  4DAY A;  5JOB A;  3GV3 A;  1HTP A;  2ID0 A;  1SBB B;  3RLF A;  2R93 B;  4H7B A;  1A3V A;  1UNS A;  5COY A;  3NWT A;  3AMU A;  1I4H A;  1NR2 A;  3NQI A;  2F0I A;  2XRQ D;  3DM1 A;  1F2Y A;  4ZLT F;  4XDX A;  1BQQ T;  2F0S A;  1HA5 A;  1DXM A;  2D5D A;  1X3Q A;  4KKS A;  1TWG B;  4XYO A;  1CA5 A;  5EKL A;  1Q12 A;  2K6A A;  2O5J C;  4K5V A;  5CV6 A;  4EGV A;  4I7Z C;  3HKZ B;  1CHQ D;  3VR3 A;  1SYF A;  2B2V C;  1X3P A;  2JEA I;  3HP3 A;  2JYO A;  1KAA A;  1WD0 A;  1PZK D;  4K5X A;  3PV0 A;  1PFM A;  3HZX A;  2F03 A;  2WAQ B;  3EJI A;  2F0L A;  4CHT B;  3H3V C;  4F7X A;  3LNN A;  1W6J A;  1S4Z A;  3V2T A;  1LAB A;  5COR A;  1TT2 A;  5EJW A;  1EY0 A;  4KV6 A;  1AZP A;  1EOT A;  3X3N A;  2G9H D;  3EFX D;  3GTO B;  3H09 A;  2EJF C;  2NYZ D;  1QIL A;  5ISR A;  5K36 G;  3KBG A;  2KEE A;  3NTK A;  1B9M A;  1JOO A;  5FK9 C;  1U4P A;  2EDG A;  3J7A V;  5I2Y A;  4RAU C;  4NDX A;  5I2X A;  1T5X D;  3PUX A;  3TSS A;  5CV4 A;  3RD4 A;  4Z9C B;  1EY6 A;  2F0P A;  4A3G B;  1WTR A;  5KYI A;  5C6A A;  2BCO A;  5D3D A;  4ZRZ A;  1TS5 A;  3K0Y A;  5I9O A;  2ZXP A;  1V1P B;  5HGT A;  3HOV B;  5LL6 S;  2NTT A;  2LY7 A;  3MFY A;  3HOX B;  4N9P A;  1PTO C;  5EQ0 A;  5BN5 A;  1WTV A;  5C44 B;  2YYZ A;  5I9P A;  3GTM B;  4A3I B;  2B8G A;  2IJ0 A;  1PTO H;  4V0B A;  1KNE A;  5C3E B;  4IN3 A;  4OO1 I;  4WJW A;  4X3S A;  1I4P A;  1WVL A;  3QG1 A;  3E6Z X;  4R8I A;  2K7V A;  4X3K A;  1TWA B;  2B8F A;  1HXY D;  2B2U A;  4FF3 A;  5EPL A;  1KDC A;  1RHP A;  4CBV A;  5C0X J;  3KUP A;  4OL7 A;  2PQE A;  1W6K A;  5CMD A;  4OO1 H;  4RGN A;  2G9D A;  2X6L A;  5A2Q E;  4RHR A;  1R9T B;  3S2H B;  3TP8 A;  3OWE B;  1HFN A;  2NVX B;  3Q6S A;  4C56 C;  1CTM A;  4C3I B;  1HRJ A;  1HUM A;  5C3X A;  3C1F A;  2Z1C A;  1I4R A;  4J1M A;  5AFW A;  3RUZ A;  2JEB I;  4CJ0 B;  4A3M B;  1T5E A;  1B44 D;  1FD7 D;  1F9Q A;  4K6D A;  2X6G A;  4Q0F A;  3JAM E;  4EVO A;  1Q1B A;  1TVX A;  1RF2 D;  4DFA A;  4BA2 I;  1V1O A;  2I46 A;  5EBD A;  1IKM A;  2CHB D;  1TQO A;  3ITP A;  4KN4 C;  2R61 A;  2RKS A;  1Y8O B;  2XN9 C;  1A2T A;  3PO3 B;  1EY9 A;  1GJX A;  2J0T D;  3CQZ B;  3OW7 A;  3PIP 3;  4UDU C;  1MGS A;  2K05 A;  1EL0 A;  2OF1 A;  1EY7 A;  2HCC A;  3I72 A;  1GUT A;  1JR0 D;  4AYB B;  1BUV T;  2D9U A;  3FPU B;  2FIN B;  3PUW A;  4ME5 A;  2WII B;  3FMC A;  3MXU A;  2JA5 B;  3K5O A;  3GTQ B;  1JB3 A;  3HOU B;  3I90 A;  1WD1 A;  2SOB A;  2SEB D;  1D2B A;  3HEJ A;  5JJZ A;  4BY1 B;  2NB0 A;  3SE0 A;  1I4G A;  5E4W C;  5JVH 3;  5DAU A;  1CFM A;  1I4Q A;  4BBR B;  3GTL B;  2KA7 A;  3I8Z A;  3M7N A;  1K8M A;  3NWS A;  3TN2 A;  3TZU A;  2X69 A;  4IUQ A;  2AQ1 B;  3TP6 A;  2LKV A;  1D6E C;  3BS1 A;  1FNU A;  1B1Z A;  4G7H C;  5LL6 X;  2GA4 B;  2YU9 B;  1STN A;  4GZY C;  2EZV A;  3R2I A;  1IYV A;  4C1N I;  4BY7 B;  3SEB A;  2RSO A;  2NZ1 D;  4A93 B;  2O5I C;  2EVB A;  2EY5 A;  1S5F D;  3VYU A;  2JA6 B;  3A56 A;  5IIF A;  4IFD G;  1CT1 D;  1Y1V B;  4Q5V A;  4ZK9 B;  2RDF A;  2F0J A;  4R8N A;  5I6W A;  4HMI A;  1KLU D;  2EYH A;  1Q3L A;  4RGO S;  3URY A;  1II3 A;  3SHL A;  1BCP C;  3W3A A;  2KOL A;  1OXT A;  3ZYY X;  4FP5 D;  4DNR B;  3U9O A;  3S9W A;  1EWC A;  1HA6 A;  3J7A F;  3X3M A;  2K32 A;  5JAV A;  2KCC A;  3ERO A;  3IFD A;  1A3U A;  1D5Z C;  1ZYR D;  3NP8 A;  5E4X A;  3EQL C;  2LMC B;  4R9W A;  4KD3 A;  3M3Y B;  4RFB A;  2HCI A;  5KNB A;  1Y8N B;  2AWN A;  2JSO A;  1U4L A;  3I70 A;  2EY6 A;  1SYB A;  1NR4 A;  4FXD A;  1STG A;  2PW5 A;  1PFB A;  1QG7 A;  4LMQ D;  4HSV A;  1WTP A;  1M4V A;  3A55 A;  4KHV A;  5JPN C;  2I07 B;  1PRT F;  3DWQ A;  3VA5 A;  1U4R A;  4RGT A;  2WKD A;  5J1Z A;  3R3O A;  3A7A B;  3GV6 A;  3S17 B;  4HN7 A;  1E2Z A;  1SJE D;  4ZAI A;  1LTS D;  3NPP A;  1TWC B;  2K28 A;  3SVM A;  3BYT B;  1CI3 M;  1LT3 D;  3FKI B;  3P75 A;  3RZO B;  3TDQ A;  3IL8 A;  3RZD B;  1H9S A;  2MP1 A;  4KJN A;  2IX0 A;  2F0W A;  1XX8 A;  3LWU A;  2OT2 A;  1YNJ D;  4K8I A;  1KDA A;  1SNO A;  2NN6 H;  3C3L A;  2VB2 X;  3DUZ A;  1GUG A;  1EIG A;  2F0H A;  1SYC A;  4H0L C;  1EY4 A;  5E1F A;  1JWU D;  1HUN A;  2H1E A;  4N9T A;  2M2L A;  3K5L A;  4DXF A;  3WDN A;  1QWY A;  2ZXO A;  1J8I A;  3K59 A;  1QE6 A;  3AU7 A;  1YNN C;  4IAL A;  1TU2 B;  2SDF A;  3H0G B;  1GOZ A;  3MTS A;  1ET9 A;  4PV1 C;  1M8A A;  2RSN A;  2EY1 A;  2MPM A;  2JE6 I;  4BWG B;  2A74 C;  2AQ3 B;  2RQX A;  2TSS A;  1LLR D;  5CYU A;  1DZ1 A;  5A2Q L;  1Z47 A;  2Z8L A;  3H6M A;  4RCN A;  3BDO A;  4QMG A;  4K2L A;  3VR6 A;  2RBM A;  3KLR A;  3S2D B;  1F9R A;  5C3W A;  2F0Q A;  1LTA D;  2VNU D;  1IKL A;  2RA4 A;  3SR1 A;  3FEW X;  1D1I A;  3TP5 A;  4CKC A;  4MN3 A;  2PW7 A;  1VF5 C;  1TWH B;  3VYR A;  1GUW A;  4ZUI A;  2BE5 C;  3JAM L;  5A35 A;  4P2C B;  4ULL A;  4K14 A;  2B63 B;  1V8Q A;  4JK1 C;  2A69 C;  5C0X G;  1AFP A;  5M5Y B;  1EZ8 A;  2R6G A;  2B2Y A;  2F1M A;  3NTH A;  4FXG C;  4PQX A;  2E76 C;  1RKN A;  3FPP A;  5ELC A;  4KTA A;  1PZI D;  4XT3 B;  1V1P A;  1SNQ A;  3DXJ C;  3G7L A;  1GHJ A;  1G29 1;  1KTK A;  2BOS A;  5EKK A;  2KCN A;  1HPC A;  1CA6 A;  4DU9 A;  1RTO A;  1ROD A;  5JEA J;  3M7G A;  1VCI A;  3GO5 A;  1AZQ A;  4HED A;  4KY5 A;  1O78 A;  2WAC A;  3OMC A;  1MBY A;  1HQM C;  1Q90 A;  2A73 B;  2JXM B;  5K36 H;  1S5D D;  4B08 A;  1LTT D;  4FVM A;  3SK6 A;  3CRL C;  1Y69 U;  1E2V A;  2K5D A;  4IZ8 A;  1TKW B;  1A2U A;  4KKT A;  1ESF A;  1PYW D;  5D65 A;  5FO7 B;  4FF2 A;  4M8A A;  4O42 A;  3PUY A;  1EWH A;  3R8B A;  3H91 A;  1IW7 C;  1ILP A;  1E0B A;  2KEC A;  3G6J B;  1PMR A;  4X3U A;  4HCE A;  4F87 A;  5FO8 B;  4RKL A;  3TP7 A;  3SK4 A;  4RA8 A;  4QUF A;  3NBH A;  4C3I G;  5J22 A;  3CHB D;  4EQN A;  3NBI A;  4XTC S;  1CZW A;  1RDP D;  2EPB A;  4F8M A;  3MWY W;  5EKI A;  3AB9 A;  5NUC A;  4H44 C;  5ELE A;  4A3J B;  1I4X A;  2JP1 A;  2HDM A;  4CKE A;  4K2K A;  2CW0 D;  4CJ2 C;  5KGU A;  3I4N B;  2B2U C;  1D5M C;  2KJX A;  2WP8 J;  4KMU C;  3HOZ B;  2F0V A;  1OXX K;  4TSS A;  3VR4 A;  3S1N B;  4G4K A;  4CGY B;  1Q8I A;  4DXG A;  4J6H A;  2QF7 A;  1JIC A;  2IW3 A;  3ND8 A;  3J81 E;  2Q8I B;  1OXU A;  5BN3 A;  1D5X C;  3S1M B;  4DA2 A;  1EY5 A;  1JQY D;  1S5E D;  3D6C A;  2KHS A;  5C4J B;  4HSP A;  2C5C A;  5F2D A;  3IAY A;  2PYK A;  1KNA A;  3MEH A;  3CU7 A;  3D4W A;  1F2Z A;  1IHZ A;  2A68 C;  3U9S A;  5M9O A;  4XQJ A;  3GQB A;  1C4Q A;  1BNZ A;  1OO9 B;  5IOD A;  2E2H B;  4J8Q A;  1F9S A;  4YIJ A;  2PZT A;  5IGC A;  1JE4 A;  1F2L A;  2R7Z B;  3BZD B;  2A6E D;  3OPO A;  3C1E A;  3QJY A;  5G3L F;  4G7O C;  3K7A B;  4BA1 I;  3A54 A;  1PRT B;  4KN7 C;  2DY7 A;  3QOJ A;  5KIX A;  2NVQ B;  2F0E A;  1PRT D;  4ID6 A;  3Q0A A;  1B9N A;  2F0T A;  2EJG C;  2E2I B;  2K33 A;  1A15 A;  1R4Q B;  2O2L D;  4IUR A;  1B3A A;  2RVL A;  3BG3 A;  1LT4 D;  2K04 A;  4H13 C;  4C1N K;  2D2C C;  1SAP A;  2L9H A;  1I3Q B;  1XTC D;  1DD2 A;  2ZT9 C;  5C5M A;  4DAV A;  4XQN A;  2EXZ A;  2DNC A;  3LWE A;  3T13 A;  3A8K E;  4IUV A;  4KY7 A;  4A3K B;  1XXG A;  2NUC A;  1WTW A;  2RDG A;  5TSS A;  3OHX C;  3NK9 A;  3BDL A;  2AUK A;  3N52 A;  1XYI A;  1QOH A;  1JOQ A;  1O7Y A;  3QOL A;  2BDO A;  1H9M A;  4ZKB B;  4IFD I;  1B2T A;  1Z6H A;  3VR2 A;  4WOR A;  4ZQ3 A;  4UAI A;  5IGF A;  3DEP A;  2FHT A;  3MXP A;  5FOB B;  1KDB A;  4RKB A;  1Q1E A;  1OXS C;  1FR3 A;  3D8G A;  3HS0 C;  2E2J B;  1DJR D;  3T16 A;  2A6H C;  4IFD H;  1ILQ A;  1DYQ A;  2F3W A;  3GTP B;  3E5S A;  3D4D A;  4FYD A;  2A5H A;  1NCV A;  1UUP A;  1FNV A;  4KK7 A;  3NSW A;  1MD2 D;  1B4O A;  1AN8 A;  2M00 A;  1BBX C;  1GUS A;  2EYO A;  1I6V C;  5DNF A;  3SXH A;  1EEI D;  1H9J A;  3DEO A;  2KED A;  1B53 A;  3S14 B;  1EFI D;  2F0K A;  2XWB B;  1A6X A;  3MA2 B;  4RH6 A;  1TY2 A;  2SNM A;  4OIJ A;  1PZJ D;  4IUN A;  5ELB A;  3E0J A;  2ICI A;  3T51 B;  3T56 B;  3P20 A;  2EE1 A;  3MAQ A;  1O7L A;  4IUP A;  2NBF A;  1UEA B;  1LTI D;  5EBC A;  2EY2 A;  3OMG A;  5IGE A;  5KND A;  1G2T A;  3NUC A;  1SYD A;  1DCZ A;  3C2P A;  1QB5 D;  1SMY D;  1BR9 A;  2ZXR A;  2F4I A;  4K5W A;  1BXT A;  1ESR A;  3MFG A;  1DOM A;  1AEX A;  3K57 A;  1FNW A;  2E75 C;  3LX0 A;  4DF7 A;  1QNK A;  2VUM B;  1PTO F;  2L55 A;  1CQV A;  1F9P A;  1ET6 A;  4BBS B;  1D1K A;  4KI0 A;  5C4X B;  1SNM A;  1JWM D;  1GUN A;  1VF7 A;  2OEO A;  4V19 0;  4A3E B;  1GUO A;  4KD4 A;  5KYL A;  1LT6 D;  3OWF A;  1HFG A;  2B2W A;  4QUC A;  3P7J A;  4NKL A;  3N6R A;  5JEA G;  1LTB D;  1FGB D;  3GTK B;  2QEJ C;  3HG9 A;  1ICW A;  4QIW B;  2BDN A;  1VMC A;  1STA A;  3T53 B;  1CQF A;  5IGB A;  2EYF A;  2TMP A;  4FF4 A;  2MHV A;  3NQT A;  1STE A;  4OIK A;  1L0X B;  1TII D;  4PMB A;  5D14 A;  2E2D C;  1CK1 A;  4LK1 C;  2B2T A;  1JWS D;  2F0U A;  1CHP D;  3FDT A;  5CV8 A;  3DWP A;  4DK0 A;  5IGG A;  1J9O A;  3M85 A;  2L1B A;  4QB4 A;  5FLX E;  1PFN A;  1LAC A;  4XQQ A;  5IGD A;  1EU3 A;  3WOF A;  5M5W B;  1KAB A;  3J81 L;  3MHB A;  3Q23 A;  5IT9 E;  1IYU A;  3VYS A;  1HCZ A;  3BDC A;  3EA6 A;  4DN4 M;  5FKA C;  2PO4 A;  4HAE A;  2OXP A;  1SEB D;  5C0X I;  2QKI C;  2ICE C;  1EQV A;  3PO2 B;  2PMZ B;  2VXW A;  5KNC A;  2WIN B;  3A8I E;  2XIW A;  4XIG S;  1DM0 B;  3D3R A;  5I6Y A;  5CGK A;  1RJT A;  1I50 B;  3IFT A;  4K6L A;  1TS3 A;  1QCB D;  5CV9 A;  2EYP A;  3S1Q B;  2PZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...