2N49A

Ec-nmr structure of erwinia carotovora eca1580 n-terminal domain determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ewr156a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
b'MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cold-shock protein
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Structural genomics, unknown function
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n49A00
3CPFA 1FVIA 3CQZH 1YI2A 1LUZA 1YBYA 4LUVA 1KAWA 1PFSA 4A76A 4JC0A 1XNRQ 1Q46A 5M3MH 1X54A 4HJ5A 1EIYB 1VQMA 2IY5B 3KJPA 5IP7H 1JJ2A 2WP8J 2JA7H 1K0RA 2OWOA 4MTNA 5IY0A 5JJIA 1VQAA 4YWLA 4DNIA 3H3VI 2L15A 3HOVG 2Q2IA 2B3GA 4A3GH 1Q7YC 2CWAA 1NTGA 1PH1A 1PHJA 1N32Q 2JA9A 1QZHA 2Y0SG 2K4KA 3BZKA 2K52A 4X64L 3CAMA 4KI0A 4BBSG 1VQJA 5IT9c 3PV0A 3CP0A 1K8GA 1N9WA 1UE6A 2WAQG 1M1KC 2F4VQ 1HZAA 3I4NH 1N32L 5FJ8G 3E9IA 1HR0L 3I7FA 4HJ7A 5C3EH 3CC2A 4UP9A 1K83H 2F3IA 1IL2A 1YJ9A 1CSPA 2F4VL 1VQOA 2AKWB 4JYAQ 4A3EG 2AMCB 4NXML 1FGUA 1WCMG 2JA5G 3HOUH 1V43A 2ZTDA 3S24A 2ZM6L 3BZCA 1A62A 1HZCA 4GN5A 2PNHA 4Y52H 1VQGA 2R92G 4EQ5A 2KCMA 2VQEQ 5J3BA 4NPSA 5IYDG 3K8AA 1AE3A 2I5MX 3UDGA 1IXRA 1WOCA 2OQ0A 1N34Q 2VQEL 1E1TA 2B63G 3S1NH 1E22A 1XMOL 1ASZA 4H02A 4IPGA 1KXLA 1J6QA 4HIDA 4A3MH 4DR7Q 3PO2H 4DR2L 3CCQA 2LXKA 4GNXC 2YTXA 3CXCA 3TREA 4JG2A 5M5WH 4BBRH 5GADC 2PQAA 1YJWA 4DV6Q 5H1SE 4C3HH 1HNWQ 4DR7L 4BA2I 1KRTA 2JA6H 2MO0A 3K7UC 4DKAC 4DK3C 1NBWA 2BA0A 3A74A 4DV6L 2I0QA 2VW9A 4JI4Q 3ULLA 4GNXA 4LUZA 1J5EQ 3HOZH 1PH4A 4OWWB 2ZTCA 2WFWA 1S72A 1QVFA 2B29A 4NXNQ 3PF4A 2MNAA 1B70B 4KHPQ 3RLOA 5JEAG 1HNXL 1C9OA 1A0IA 4DAYB 4X66Q 1VS0A 1Y1WH 4DUZQ 1J5EL 1TXYA 3HFZB 3CCEA 5IP7G 2Y0SE 4NXNL 2JA7G 4GKKQ 4KHPL 4X62Q 1LTLA 3J80c 3TS2A 1X65A 4YY3Q 3PO3H 1JT8A 4X66L 4B3MQ 2WAQE 2VS1A 1SE8A 3JC66 4GN4B 3CMAA 4DUZL 1CKNA 1TWCH 3TRZA 4BY1H 2UXDL 2QA4A 4GKKL 2UUAQ 4OX9Q 5EAYA 4DV0Q 4A93G 4X62L 2Q2TA 4UP8A 3TEHB 4JI0Q 1B7YB 1TWGH 4B3ML 1YEZA 4P72A 3D31A 1IYJB 4IFDJ 4LW1A 4R1JA 3PIPA 2UUAL 4DV0L 2XGTA 1IBLL 1BBUA 4JI0L 1XPUA 4XIGS 4MNOA 4JBKA 2R7ZH 3EIVA 3I4OA 1A8VA 3RLNA 3RR5A 1GM5A 2ES2A 1UE1A 2D0OA 1BVSA 2RCNA 1UEBA 2WB1G 4OWTB 4A3IG 2NVQH 4LF6L 3J7ZC 3E9HA 2OTJA 2KBNA 2CFMA 1OXUA 2OQKA 2GVAA 2VZAA 2QGQA 4GN3B 4DAMA 1KC8C 1VCIA 4IPCA 3U4ZA 4A3KG 2ALYB 2NN6G 3PIOA 1CUKA 3H0GH 4XTCS 3CPWA 1HH2P 2OCEA 1MJCA 3AEVA 4A3DG 1VQEA 1CKOA 1SN8A 5IP9G 4B3SQ 2XTIA 4OO1G 2K75A 1E3PA 4R4IA 1PH6A 5C0XJ 3PUWA 4LF7L 1UE7A 3T1YQ 1G51A 2UXBQ 4UP7A 3GTPH 4P71A 3LGJA 4B3SL 3CCSA 4JBJA 3BJUA 1XMQL 1VQ5A 4JBMA 2NVTH 4BXXH 4R4OA 4JI1Q 3OTOQ 1X55A 1VQ9A 5C4XH 2I5HA 4GOPC 4DR1Q 1QUQB 4JI1L 2JA6G 4DV5Q 1VQLA 3L0OA 1SRUA 1L1OA 2MQHA 5M5XH 1Q86C 3KOJA 1X3FA 2HQLA 1L1OB 4JOIC 4DR1L 3KYHC 4DV5L 2RHSB 3RN2A 5FLMG 3G71A 3CC7A 1BBWA 1KRSA 1SMXA 1Y1VG 3H15A 4DR3Q 1PH3A 3CCRA 1UE5A 2Z0SA 4L5SA 1A63A 1EOVA 4YHHQ 5IWAQ 3S16H 1FL0A 1Y1WG 4DV1L 4APVA 4JOIA 4DR5Q 4A3LH 2E5LQ 1YZ6A 4DR3L 4JI2Q 2IX0A 2JQOA 3KF6A 4OONA 4PMWA 5IWAL 4X64Q 5GAEC 2CQOA 4YHHL 1VQ7A 5IYBH 3KF6B 5C44G 2VY3A 4A3FH 3CMEA 4DR5L 4DPGA 4BY1G 5M3FG 2E5LL 4JI2L 3HOWH 2V1CC 3GTQH 3G48A 1HR0Q 1I5FA 2VQFQ 1K73C 3CC4A 1V1QA 2WB1E 3D0FA 4IPDA 1X3GA 2R93H 3FKIH 4X6AH 1Q1EA 1MJEA 4TVAB 3M4QA 3UE0A 2VQFL 2N8NA 1QZGA 1Q81C 4NXMQ 2OTLA 3SGIA 1D7QA 3EBEA 2ZM6Q 1K8AC 2JA8G 4KHZA 1PA6A 2CKZB 3NENA 5HY6A 3W1GA 2E8GA 3I2ZA 3ICEA 2KHJA 4A3BH 1XNQQ 3HOYH 4MZ9A 4HIOA 4IFDI 1WFQA 4J15A 3G4SA 5ELNA 2YU9H 4DR4Q 1E1OA 4A3JG 2ZJPA 1XMOQ 1XNQL 4AYBG 4JV5Q 4GLVB 4DR2Q 4POFA 4DR4L 1PVOA 1VQHA 1YHBA 3GTGH 1VQPA 2UU9Q 4JV5L 2UUCQ 3F2BA 1EUJA 4QL5A 4RMFA 5IYCH 1D8LA 1KHIA 2K50A 2VUMH 3S2DH 4LFBQ 4BXXG 4YCWA 2UU9L 4DUYL 1UWVA 3I4MH 1WI5A 2KCTA 2PQAB 2UUCL 2PI2E 2GVBA 2BH2A 5C4XG 1PH8A 4TQUS 1TWAH 2A8VA 1P8LA 4JI8Q 1KQSA 3GTOH 1XTDA 2GN5A 3M4OH 3J80i 1FJGQ 4LFBL 2PMZE 1GVPA 3PUVA 4C2MH 5C0XI 1HNXQ 3GTLH 3WWVA 3M85A 1H95A 2F52A 2YYZA 3AQQA 3U4VA 4GNXB 4JI8L 2JK8A 3BU2A 1HNZQ 1FJGL 3STBD 1HR0W 2LXJA 2YTVA 5M3MG 1JJGA 1JE5A 4POGA 3HOXH 2UXDQ 2K5VA 1HNZL 1JB7A 1KL9A 4K0KL 3PGZA 1PYSB 2KENA 1SFOH 1HZ9A 2ID0A 4LUOA 3DLLA 5LMNQ 3T1HL 1CKNB 2ASBA 4P75A 4B3TQ 1IBLQ 2HT1A 4A3GG 4A3FG 4ME3A 1VQCA 1I3QH 5LMNL 1W3SA 2K14A 4AIMA 5JJLA 1YHQA 3K81C 3OYYA 5JJKA 4B3TL 3KDFA 3PCOB 3I4NG 2R93G 1YITA 1EQRA 3NBHB 2PI2A 4QIWE 1N8RC 4LF6Q 3ZJYC 1S40A 2E2JH 5C3EG 3K80C 3OW2A 2ZJQA 4A3CH 1E7ZA 4IOCA 3HOVH 4B3RL 1U0LA 4AYBE 4JI6Q 2UUBQ 4R4TA 3HOUG 1TWHH 2YV5A 5GQOA 3UDXA 3MEFA 3HOYG 1VQKA 4LF7Q 3J7A5 4JI6L 3I55A 5GAGC 3CF5A 2E2HH 2UUBL 4GKJL 5JEAJ 2A19A 3HKSA 5FJ8H 3RN5A 1WJJA 1YNXA 2EIFA 3CW2C 2Z6KC 2IT1A 3VDYA 1XMQQ 4LF5Q 1KIXA 3S1MH 1I94Q 1VQIA 1XPRA 2N3SA 1OXSC 4JI3L 3AFQA 4HIKA 2C35B 3M4PA 4A3EH 2JJQA 1WCMH 2BH8A 1AE2A 3CCUA 4A3MG 1I94L 2JA5H 1CKMA 4LF5L 3GTKH 3PO2G 2VUMG 3KF8B 4BBRG 4DV3Q 1Q12A 4QJFA 5IYDH 4JCVE 4QGUA 2R7DA 3IRBA 5GROA 1X6OA 5C4JH 2HHHL 1EWIA 4JI5Q 3GDEA 4IPHA 4DV3L 1VQ8A 5LMNW 3F2CA 1X3EA 2B63H 1Z47A 3MXNB 3A5UA 4DV1Q 4WJ4A 1AH9A 4JI5L 1W2BA 3HOZG 1SLJA 2VL6A 4GOPA 3TQYA 1SROA 3UDIA 5IE8A 5BR8L 1MIUA 5ELOA 4DV7Q 4AQYL 4GOPB 3S1QH 3K0XA 3HKZG 1GO3E 4LF8Q 4BY7H 1EYGA 3EN2A 3L2PA 3I56A 3HOXG 2IHEA 3F8TA 3RLFA 1IBMQ 1PYBA 3DM3A 4DV7L 3PO3G 1IBKL 4LWCA 4OWXB 5E7NA 4LF8L 1GKHA 1MKHA 1QVCA 1E24A 2BA1A 3ER0A 1C7YA 3M7NA 1IBML 4IO9A 3GO5A 3GTMH 3S17H 3S2HH 2EQSA 1C0AA 4UPAA 4YWKA 1VQDA 3JAMc 5AJ3Q 3J81i 2IHFA 4A4IA 1X56A 4R4CA 3CCLA 2R7ZG 4LF9Q 2DUDA 2E2IH 1G6PA 2N78A 4IJLA 1XJVA 4FDBA 3L7ZC 1EFWA 5AJ3L 1XNRL 4A3CG 1PH5A 4L5TA 4LF9L 2FXQA 4A93H 1GD7A 1NY4A 3G6EA 1M90C 1K9MC 2MO1A 1P16A 3FHWA 3NEMA 2I5LX 3CCMA 3J81c 2H5XA 4PZ7A 1I6HH 4HJ9A 3B6YA 1RL2A 2K5HA 3H0GG 5M5YH 2JE6I 1JMCA 2A1AA 4L5QA 5FLXc 2JEBI 2NVYH 1VQBA 2ZTEA 1OXXK 1R9TH 2KHIA 3PSIA 1LM0A 4O2DA 4R4QA 4DK6C 4DUYQ 3RNUA 4A3IH 4NB3A 3S14H 1B8AA 1VQ6A 3ULPA 1RIPA 1PH7A 1Q8KA 2RF4A 3KFUA 3GTJH 3S15H 4A3KH 1DGSA 4JYAL 4EX5A 3CCVA 4YCUA 4A3DH 2CWPA 4A75A 3E0EA 3M3YH 4DV4Q 5IP9H 1VQFA 3HKZE 3STBC 2UXCQ 3AFPA 2MFIA 4RG1A 5DLQE 4YWMA 4DV4L 4IFDG 4K0KQ 2VNUD 4AH6A 1T9HA 4LF4Q 2UXCL 1Q82C 4O0AA 1O7IA 1VQ4A 3T1HQ 4X65Q 1N34L 4JI7Q 1OXTA 4BY7G 1CSQA 4LF4L 2HIXA 4PG3A 4A3LG 1KD1C 2R7FA 4X65L 1Q1BA 2K5NA 4JI7L 1U5KA 5IYBG 1YIJA 2NZOA 1V9PA 3U58A 4LNQA 1NJIC 1OXVA 2IX1A 3HOWG 1X9NA 1HNWL 4C3JH 5FLMH 3RZOH 1Y1VH 3UE1A 4ALPA 4P73A 1Z9FA 3FKIG 4PZ8A 4JI4L 2NZHA 3GD7A 3KDFB 4C3IH 1NMGA 3A5ZB 4B3RQ 2R6GA 4JBWA 5C0XG 4HJ8A 3AYHB 1PH2A 4UY8C 2NN6I 4DR6Q 1YVCA 1N33Q 2Q2HA 3NELA 2NVXH 4OO1I 2LSSA 3ULJA 4KLKA 5C44H 1PH9A 4P74A 4LFAQ 3Q8DA 3CD6A 4GKJQ 1G291 5M3FH 1N33L 4DR6L 4A3BG 3J81j 2RHQB 4YY3L 1LYLA 4BBSH 2D0PA 3U50C 4GLAC 1IZ6A 1EIFA 2AHOB 1TWFH 3PUZA 4LFAL 4Y7NH 1VQNA 1OTCA 5GAHC 4OX9L 3PUXA 4JI3Q 4QQBX 2N49A 1K3RA 4L5RC 4LFCQ 2AWOA 3RZDH 5K36G 1YHAA 2AWNA 1NE3A 3CCJA 1WYDA 2JA8H 2D62A 4PZ6A 1NMFA 4LFCL 2ZJRA 2CCZA 4GLXA 3KLWA 1S3OA 3S1RH 3ERSX 5IYCG 3W1BA 1ASYA 1YJNA 2HHHQ 1L2FA 4OXPA 1HJPA 2Q2UA 2ATWA 2Z6KA 2QEXA 1I50H 3I4MG 2R92H 4HJAA 4IJHA 3W5OA 1JJCB 3A0JA 1HZBA 4A3JH 2JEAI 2DGYA 3H3VH 2HIVA 4AQYQ 5BR8Q 1Y14B 1N36Q 1BKBA 5LMUQ 3UDFA 3K7AH 4BA1I 3M9BA 4GS3A 1SR3A 1N36L 4DV2Q 4IOAA 1L1OC 4YCVA 5LMUL 1IBKQ 3T1YL 2UXBL 4HIMA 3F1ZA 2EXDA 3JAMi 3F2DA 4WJ3M 4DV2L 3PF5A 1L0WA 1QUQA 3PUYA 3FP9A 1QVGA 2YTYA 4QY7A 3TS0A 1PV4A 3KJOA 1XPOA 3OTOL 5HGQA 1EQQA
chains in the Genus database with same CATH superfamily
3CPFA 2EE1A 4J6HA 1YBYA 3TSSA 3NUCA 3OHXC 5EPKA 1PFSA 4JC0A 3QR8A 4WRDA 1X54A 4HJ5A 2IY5B 3KJPA 2MUYA 3QO2A 5IP7H 2JA7H 1K0RA 5E4XA 5IY0A 1VQAA 4R9WA 3NTHA 5M3MB 3V05A 1JWSD 3HOVG 2Q2IA 1IYUA 1NTGA 1PHJA 2K4KA 2K52A 3CP0A 1K8GA 2F4VQ 2KVMA 1HZAA 2MPMA 2O5JC 1GJXA 4X3KA 4JPBW 5FJ8G 1CFMA 4WFN3 5C3EH 1CT1D 1D1IA 2F3IA 2G9HD 4HR7B 1JORA 1SYFA 4KHVA 1G2SA 2JA5G 4ZUIA 1V43A 5E4WC 1HTLD 2ZTDA 2ZM6L 2ZT9C 3BZCA 2QCPX 1HZCA 2PNHA 1AP0A 3MC0B 5J3BA 4N8X1 4NPSA 3U9SA 4HTHA 3K8AA 2VQEQ 2I5MX 3UDGA 2B63G 1B3AA 2YU9B 4PMBA 1ASZA 2F0VA 4F88A 3PO2H 3A7AB 2PQAA 4C3HH 1BR9A 1KRTA 2VUMB 2BA0A 2QF7A 2I0QA 2VW9A 4IUUA 3OSOA 4GNXA 2RA4A 2K5QA 3HOZH 5KRUA 2ZTCA 2FHTA 4NXNQ 2MNAA 3RLOA 1C9OA 4X66Q 3QG1A 5KNDA 4GKKQ 4KHPL 2BOSA 1WTXA 3QJYA 3JC66 3TBIB 4DUZL 3TRZA 1VF5C 2UXDL 2QA4A 3HP3A 3NK9A 2KEEA 2DJFC 4UP8A 5BN4A 4JI0Q 1B7YB 3MVVA 4B3ML 1YEZA 4P72A 1D5ZC 4HCSA 2DY7A 3PIPA 2NBFA 5CR3A 2WV6D 4KN7C 4XIGS 4MNOA 1HCZA 4DFAA 3QB3A 1A8VA 1A3VA 1UE1A 3VYUA 2RCNA 1UEBA 3CU7A 1ET6A 3OWEB 2HUGA 3MAQA 2CFMA 2VZAA 2GVAA 2F0OA 1F9QA 3DWQA 4N8FA 4A3KG 4XTCS 4A3DG 1MJCA 4OO1G 4B3SQ 3KBXA 4RHRA 2KJXA 4PV1C 2MJ8A 2G9DA 4LF7L 3H0GB 1CQVA 4IUTA 3LGJA 4DK1A 1QWYA 3SK6A 2OF1A 3EROA 3BJUA 1XMQL 5G3LF 5JOBA 5J1ZA 1SBBB 4X3TA 1TR5A 4DR1Q 3NP8A 3GTKB 2F0DA 4K14A 1OO9B 3MXNA 3KYHC 2PNRC 1BBWA 4OEMB 3H15A 4L5SA 4DR3Q 3NBIA 3VR3A 1BBXC 5IWAQ 1K8MA 4DV1L 2XRQD 2BDNA 4DR5Q 4A3LH 4CDEC 3KF6A 1VQ7A 1O7YA 3BDLA 2VY3A 3CMEA 5M3FG 3V2TA 4JI2L 1XWEA 4K6DA 2K32A 2WB1E 1MJEA 3L3OC 4TVAB 5CBAE 4NXMQ 1Q81C 3JAME 2E74C 3SGIA 4KHZA 1Y8NB 1F2LA 5HY6A 1NR2A 2GA4B 2E8GA 3ICEA 3URYA 2E2IB 4HIOA 2KEDA 3G4SA 2YU9H 1EYDA 4LMQD 4H7BA 1XMOQ 1XNQL 1BCPB 3M4YA 1PVOA 2ZXRA 1BUVT 4NMZA 1S5FD 1PDQA 2VUMH 2RCFA 5I4DA 4BXXG 1Q90A 3BVGA 3I4MH 1M8AA 2UUCL 1HA6A 5C4XG 1PMRA 3SHLA 2A8VA 1P8LA 1KQSA 4LFBL 1SNMA 5C0XI 1SE3A 3S15B 3GTJB 1H95A 2R61A 4TRDA 2F52A 2YYZA 2K7VA 1MBYA 1TWAB 5LHY1 1FJGL 2NUCA 1YNNC 3QOJA 3HGBA 2YTVA 4K2KA 1JJGA 2TMPA 1JE5A 1ENAA 4RHSA 3G6JB 1FNWA 2WINB 4B3TQ 4A3FG 4ME3A 1F9SA 5LMNL 4AIMA 1YHQA 4G7HC 1SAPA 4HMJA 1EY8A 3KDFA 1WVLA 1UNSA 1EQRA 1N8RC 4LF6Q 1S40A 5C3EG 2ZJQA 4A3CH 2FMCA 1E7ZA 4RA8A 1NAPA 2UUBQ 2AQ3B 2QDBA 3HOYG 2Q8IB 3HOVB 2NVXB 1QCBD 5JEAJ 2A19A 1B1ZA 2EIFA 1MHWC 2DN8A 1KIXA 2QKIC 5EKLA 1VQIA 1XPRA 4JI3L 4CJ1B 3AFQA 4HIKA 1EOTA 4EQNA 2BH8A 1AE2A 5DNFA 3CCUA 4EQPA 3GTKH 3PO2G 2LS01 4KJNA 2HDLA 2E75C 4C3HG 4QJFA 5IYDH 2F0MA 2JA5B 1STYA 1EWIA 3GDEA 1K8OA 2B2VC 3OMGA 4WJ4A 1DJRD 2EY1A 4FVMA 5C4JB 3HOZG 3TQYA 3UDIA 3BZDB 3HKZG 4JW0A 2B63B 5C5MA 3IFTA 3IAYA 3RLFA 3DM3A 3HRZC 4LF8L 1E2ZA 4IO9A 2K1BA 1HUMA 3WDNA 2RDGA 5IIFA 1VQDA 3JAMc 4RGOS 5C0XH 1JCKB 4A4IA 4LF9Q 2F0SA 2E2IH 1LT3D 3L7ZC 4HSPA 2AUJD 4O42A 3VYRA 3FHWA 3CCMA 2RDFA 2K5WA 1STNA 2PZTA 1QNUA 4HJ9A 4CGYB 4ZLTF 1ZKOA 1I4GA 3J7AF 2F0PA 1VQBA 4MIUA 1F2YA 4DK6C 4DUYQ 4NB3A 3I4NB 1FR3A 3HG9A 2D9UA 4RAUC 2AQ2B 3S15H 3GTJH 3MXPA 4EX5A 5COYA 3CCVA 4YCUA 4A75A 4IUPA 3A8KE 1VQFA 2UXCQ 1SNPA 3AFPA 4XT3B 2MFIA 4RG1A 2IJ0A 1T9HA 4IALA 1G2TA 1Q82C 3NWTA 1O7IA 5I6WA 3T1HQ 4BY7G 1CSQA 1RDPD 1TQOA 1RODA 4QCLA 2HIXA 4ILWA 4A3LG 1ONLA 2RDHA 5C3WA 4A3MB 4JI7L 1A3UA 1YIJA 3MXUA 3T16A 3OWFA 5FLMH 1SE4A 3UE1A 4PZ8A 1Z9FA 3J7YW 1TKWB 4ZK9B 1LT5D 4HJ8A 3K0YA 3D8GA 1C48A 2NVXH 4OO1I 1KNEA 2LSSA 4KLKA 4N9TA 3ULJA 5C44H 1PH9A 3Q8DA 3L9AX 3J81j 1SNDA 1SYGA 2D0PA 3U50C 4GLAC 1IZ6A 2K28A 4Y7NH 3MFYA 2NZ1D 1Y8PB 2KQ3A 4LFCQ 1TWGB 2F3WA 3KK7A 3FPUB 3RZDH 1KNAA 1WYDA 2B2YA 2D62A 4OIKA 1U4PA 3R2IA 3W1BA 1YJNA 2HHHQ 1L2FA 4S3SA 2Q2UA 2QEXA 3I4MG 1QILA 3E6ZX 3A0JA 4A3JH 2JEAI 2NVQB 1E2WA 4MTKA 1XYIA 4AQYQ 4CBVA 1Y14B 4KY6A 5LMUQ 1JR0D 4ZRZA 4BA1I 5E3FA 3M9BA 4F8MA 5IGEA 3C2PA 2B2VA 2EXDA 3F1ZA 3JAMi 3PF5A 1L0WA 3PUYA 2K5DA 3KJOA 1XPOA 4K8JA 2NVTB 5HGQA 2KCCA 1YI2A 1LUZA 5C4XB 1KAAA 4KMUC 4LUVA 1SJHD 3IL8A 4CDFC 1JJ2A 2WP8J 2EJFC 4MTNA 1EQVA 5JJIA 1PLFA 1PZKD 2L15A 1JOOA 4A3GH 2WKDA 1Q7YC 1BF4A 1D2BA 1FNUA 1PH1A 2PZWA 2A68D 3U9OA 1N32Q 1QZHA 2PPBC 1AZQA 2A74C 4KI0A 1VQJA 5IT9c 1PTOB 1UE6A 3I4NH 1M1KC 4ZUJA 3H6MA 4A3FB 1LABA 1EIHA 1BOSA 3IFDA 3CC2A 1B9NA 1LLRD 1IL2A 3NE5B 3NSWA 2AKWB 3FKIB 3A7LA 4DXFA 4JYAQ 1K3BC 4NXML 3HOUH 5C3EB 1GHJA 2QILA 4Y52H 3SEBA 1VQGA 4EQ5A 1ML0D 5IYDG 2RKSA 1AE3A 3HOYB 1IXRA 2OQ0A 1EEID 3ONAB 1NUCA 1IW7D 1XMOL 4H02A 4IPGA 4A3MH 4DR7Q 4GNXC 2X69A 4I65A 3TREA 1YJWA 1D5XC 1R4PB 1IHZA 2MO0A 3K7UC 3MTSA 3PO2B 4DK3C 4IZ8A 3S2DB 4DNTB 2SDFA 4DV6L 4JI4Q 4C3HB 4LUZA 2J4XA 3PF4A 2WFWA 5JJLA 2B29A 3M4OB 5JEAG 4K5WA 1J5EL 4B9XA 3CCEA 2FJ2A 4X62Q 1JT8A 2XN9C 1SE8A 3HKZB 1LTSD 1EY7A 2PQEA 4OX9Q 4DV0Q 2Q2TA 1TWGH 1KDBA 1TY2A 3D31A 2L9HA 2J0TD 4R1JA 2UUAL 3I70A 2B2TC 2F3VA 2C5CA 3HEJA 1RJTA 4RGMA 3RR5A 2JP1A 4M8AA 3DXJC 4LK1C 1B2TA 3DHQA 2NVQH 4LF6L 4XYOA 1T5EA 3E9HA 2OTJA 2KBNA 2L5TA 4IURA 4DGZA 2OQKA 5CBEE 2E2JB 3J81L 2EYPA 2QGQA 1KC8C 1GOZA 4IPCA 2ALYB 2OCEA 5JJZA 5CV4A 1SN8A 2HCIA 2F0WA 1EFID 2UXBQ 4UP7A 3C1EA 4P71A 2KUMA 3QIAA 4JBMA 2NVTH 4BXXH 3OTOQ 1RKNA 5C4XH 2I5HA 1STAA 2MP1A 5T1GA 4JI1L 2L11A 3L0OA 1SRUA 2MQHA 5DM63 2Q8TA 1X3FA 2HQLA 1L1OB 4RCOA 4DV5L 2RHSB 5FLMG 3G71A 1EWHA 1KRSA 1IKMA 2Z0SA 3MFGA 1EY4A 1EOVA 5EQ0A 4YHHQ 4JOIA 2F0LA 5CGKA 2JQOA 4X64Q 1PTOH 5GAEC 1VF7A 5C44G 4A3FH 2EY6A 4BY7B 2E5LL 1W6KA 1I5FA 1GUWA 3D0FA 4IPDA 3EFXD 3FKIH 4ODGA 4X6AH 3PIO3 3M4QA 2VQFL 2PYKA 2N8NA 3NQTA 1QZGA 1D7QA 3S2HB 3EBEA 1K8AC 4DAVA 1QOHA 3NENA 1JWMD 5EBCA 3W1GA 2KHJA 4O1NA 3HOYH 1A6XA 1WFQA 4J15A 5ELNA 5C3XA 4DR4Q 5FO7B 3FVQA 4A3JG 2ZJPA 3K57A 1H9KA 3ERQA 5K36H 4GLVB 1M4VA 4DR2Q 4POFA 2A6EC 3X3NA 4JV5L 4RMFA 5IYCH 1D8LA 5FOBB 3S2DH 4QF4A 1B3QA 4DUYL 2UU9L 4A3IB 1BCPD 2PI2E 1NSNS 1SMYC 2K03A 3R8BA 4JI8Q 2GN5A 3M4OH 1H9RA 1HNXQ 2KA7A 3I4MB 3WWVA 3M85A 3U4VA 1HNZQ 4FF2A 1HR0W 4B9WA 4POGA 3K5LA 1CZWA 1KL9A 1SFOH 1LT6D 4LUOA 5G3LD 3A8JE 3T1HL 1VMCA 1CKNB 4A3GG 4P75A 1DOLA 3NWSA 3G7LA 4KKSA 1I4XA 4NW2A 3SK8A 3J7AV 5KGUA 3PCOB 3I4NG 2R93G 4UHVA 2PI2A 1ICWA 2E2JH 4C3JB 3TN2A 1Y1VB 3D6CA 1BCPF 2PMZB 1U4RA 5IGBA 2B2TA 1SNCA 3HOUG 3DUZA 3UDXA 1VQKA 4JI6L 3I55A 5GAGC 2E2HH 4QUCA 5FLXL 2K33A 3HKSA 1HFGA 3RN5A 3CW2C 5D14A 2V4DA 4WJWA 2N3SA 2C35B 4CKBA 3RMHA 4LF5L 4A3MG 3KF8A 1I94L 2Z4IA 5D65A 4DV3Q 4JCVE 4QGUA 1X6OA 2HHHL 4IPHA 5LMNW 1WTQA 3F2CA 4JI5L 1W2BA 1X32A 4AYBB 4AQYL 1MIUA 5ELOA 4DV7Q 5JPNC 4GOPB 3S1QH 4RKLA 4BY7H 3DWPA 1EYGA 5DEHA 4OELB 3I56A 3HOXG 2IHEA 1R4QB 3F8TA 2A68C 1IBMQ 4M1UB 1CA5A 4LWCA 4OWXB 5E7NA 4U673 1GKHA 1SSOA 1QVCA 5K5PA 4L8JA 3M7NA 1C7YA 4QB4A 2XNAC 4KV6A 3S2HH 2EQSA 4ABNA 4G57A 4PQXA 1F9PA 2IHFA 4CKEA 3CCLA 1XJVA 1U4LA 3I90A 5AJ3L 4FYDA 4L5TA 4XYQA 2KOLA 1NY4A 1XTCD 1PFNA 2OEOA 1EEFD 3C3LA 2H5XA 2B39A 4PNYA 2IX3A 1RL2A 1IW7C 1S4ZA 3KLSX 2JEBI 1W6JA 3RD4A 1R9TH 1SNOA 1OXXK 5I2YA 3PSIA 1LM0A 4A3IH 3S14H 1B8AA 4FNFA 3BYTB 1GUGA 1EYCA 4C1NK 2RSNA 2RF4A 2EDGA 3DEPA 5FK9C 1DGSA 2NN6H 4JYAL 3E0EA 3K6OA 1LTBD 3HKZE 2E2DC 5I6YA 5BN5A 4YWMA 5DLQE 4DV4L 5D3DA 1ICFB 1HTPA 3H94A 1WTVA 4X65Q 4OHJA 3R93A 4LF4L 3S1NB 1EY5A 1A15A 1T5XD 2R7FA 2K5NA 3FDTA 3ZYYX 5M5WB 4LNQA 1NJIC 1OXVA 1X9NA 4C3JH 5JPMC 1MGSA 1ENFA 1Y1VH 4DU9A 1TS4A 4JI4L 3FKIG 3GD7A 4B3RQ 1ZXTA 3A5ZB 4UY8C 3I3CA 1J8IA 4DR6Q 1YVCA 1N33Q 2CVRA 3NELA 4H13C 5IGCA 1PRTB 4K2LA 1STHA 1I4PA 2EYFA 1SEBD 3CD6A 4RGTA 2ENBA 2B2YC 4LFAL 2AHOB 1TWFH 5C44B 4DK0A 4OX9L 3PUXA 4XDXA 4QQBX 2H4OA 4L5RC 4FP5D 4RWSC 5K36G 1FYCA 3MHBA 2JA8H 4Y7NB 1NMFA 4KN4C 4GLXA 2F03A 5IYCG 3RZDB 2R7ZB 4OXPA 4QMGA 2ATWA 2F0JA 1O78A 4IJHA 3W5OA 3T56B 3H3VH 2DGYA 4QIWB 2PCFB 4CJ2C 4IN3A 1BKBA 5CV6A 1WTRA 3UDFA 3K7AH 4A3JB 1SR3A 1N36L 3VYTA 2HDMA 4KKTA 2UXBL 4HIMA 1FNVA 4WJ3M 4DV2L 1C4QA 1QVGA 1AEXA 2IPKD 3TS0A 2L55A 1E2VA 3CRLC 3OTOL 1EQQA 1RHPA 1FVIA 2EYMA 1ESRA 2A69C 1KAWA 2KECA 5JEAH 5CMDA 2ZXPA 1XNRQ 1SDFA 1VQMA 1TVXA 4C3IG 3J80L 4YWLA 4DNIA 1B50A 4JVZA 2B3GA 3N52A 2O2LD 4WORA 2F0HA 3BS1A 2Y0SG 4X64L 1B9MA 3CAMA 4BBSG 3RZOB 4A3GB 2WAQG 1RD9D 3DMUA 3SE0A 3I7FA 3GTQB 2F4VL 2JYOA 1BCPC 2R93B 3X3MA 1VQOA 1Z7TA 5LL6X 2IL8A 1D6EC 1FGUA 3A54A 3ITPA 4HCEA 5L37A 1TIID 3S24A 3CHBD 4X3UA 3RUZA 2R92G 2KCMA 4F7XA 2EYLA 3HOUB 3BDCA 1EZ8A 4F87A 4ID6A 4YIJA 3WOFA 3FEWX 2VQEL 1E1TA 2DNCA 3S1NH 1XXGA 1MD2D 1KXLA 1I4QA 1J6QA 4HIDA 1QG7A 4DR2L 3CCQA 2LXKA 2YTXA 3CXCA 2A6ED 5M5WH 4BBRH 5GADC 5H1SE 3DWAA 1HNWQ 3HS0C 1DZ1A 4DKAC 1LTAD 1NBWA 3A74A 5T1IA 5EGTA 1GHKA 1RCVD 3T4AC 4ZAIA 1SMYD 4NP5A 1PH4A 2DY8A 2Z9HA 1O7LA 4KHPQ 1HNXL 3OIQA 1A0IA 1VS0A 4DUZQ 2QEJC 1GUSA 1WD0A 5JVH3 1PTOF 4NXNL 1LTLA 3TS2A 3TZDA 4YY3Q 4X66L 4B3MQ 4GN4B 1CKNA 3K5MA 3HOXB 4GKKL 5NUCA 2F0FA 3MZ5A 3TEHB 2PW5A 1IYJB 4IFDJ 1G8ZD 4LW1A 2PO4A 5KYLA 4EGVA 4JI0L 2JSOA 1CI3M 4JBKA 2SOBA 2R7ZH 3EIVA 4C1NI 2ES2A 1I3QB 1CA6A 2ZXOA 4A3IG 3O13A 3TP8A 1SJED 4TSSA 1OXUA 4GN3B 4DAMA 1L0YB 4EVOA 1KDAA 1UEAB 1VCIA 2NN6G 3PIOA 1HH2P 3Q6SA 1CKOA 3LWEA 1ILQA 2XTIA 4L6TB 3ND8A 1PH6A 1FD7D 3PUWA 4H44C 3SR1A 3T1YQ 1HRJA 2FFKB 3MA2B 4B3SL 1YNJC 4R8NA 4R4OA 1EIGA 1X55A 1VQ9A 2K05A 2EZVA 1QUQB 2HQEA 2JA6G 1VQLA 5C5LA 5M5XH 3H09A 1Q86C 4JOIC 4DR1L 2CW0C 2F1MA 4IFDH 3RN2A 4C3JG 1WTOA 1SMXA 1Y1VG 2J7ZA 4DA2A 1PH3A 1A63A 1EYAA 2F0EA 2QDLA 1FL0A 1PFBA 2EYOA 2RVLA 1Y1WG 4BWGB 1YZ6A 4DR3L 4JI2Q 3RZOH 3VR5A 4PMWA 5IWAL 5IYBH 3KF6B 4FO2A 1SYCA 4DR5L 2L1BA 4BY1G 3HOWH 3GTQH 3M7GA 3G48A 1HR0Q 1STGA 1K73C 3CC4A 1X3GA 3WOEA 4C56C 3MWYW 2R93H 1CTMA 4L63B 3UE0A 5JAVA 3GTMB 5ISRA 2OTLA 1HQMC 1ZYRD 2JA8G 1Z6HA 1PA6A 4IUQA 2EY5A 4A3BH 2EYHA 5KNCA 1XNQQ 4MZ9A 1JB3A 1LO5D 1E0BA 4A93B 4AYBG 1JE4A 1TS3A 5FLXE 1I6HB 1YHBA 1VQPA 1H9SB 5M5YB 2UUCQ 1EUJA 2I07B 4QL5A 1KHIA 3EJIA 4XT1B 2NTTA 4LFBQ 4YCWA 4V0BA 1UWVA 1WI5A 2KCTA 2WB1B 3A8IE 3T53B 5KEEA 3SK4A 1XTDA 1UUPA 1FJGQ 1GVPA 3PUVA 1I4HA 3GTLH 1H9MA 1VMPA 3I4LA 1TY0A 4B08A 2JK8A 5JVG3 3QWNA 3SXHA 1WTHA 3HOXH 1JB7A 2PW7A 1PYSB 5C4HA 1BNZA 1CQFA 2NB0A 3DLLA 5LMNQ 4XQNA 4HMIA 3C1FA 1IL8A 5IODA 1IBLQ 4RGNA 3D3RA 1SFOB 1VQCA 1EWCA 1I3QH 1W3SA 3AB9A 3K81C 3OYYA 5JJKA 2M2LA 4B3TL 4Z9CB 4OIJA 4K5XA 3VYSA 1YITA 3NBHB 4QIWE 2K01A 1Y69U 3W3AA 4IOCA 4RFBA 2ICIA 4B3RL 4IUVA 5HURA 4C3IB 5GQOA 3CRKC 1TS2A 5IT9L 5IGDA 3J7A5 4G7OC 2UUBL 3CF5A 5DAUA 1YNXA 2Y0SB 1SNQA 2L12A 3GP7A 4BBSB 1X3QA 2XWJB 2Z8LA 2WAQB 2E2HB 1PZID 4A3EH 4K6LA 2G5DA 2JJQA 1AZPA 1WCMH 1CKMA 3BDOA 4BBRG 1Q12A 3NXWA 5GROA 3IRBA 5HGTA 1VQ8A 1BXTA 1I50B 3I8ZA 5J39A 2R92B 3A5UA 1BDOA 1ESFA 1SLJA 2VL6A 4ZYSA 2EVBA 1TT2A 1GO3E 4LF8Q 4FXKC 1RF2D 3L2PA 5FKAC 3F2UA 5EKKA 4DF7A 1B4OA 3S1QB 4U68A 1MKHA 1E24A 2BA1A 3ER0A 3S17H 3K5NA 3GO5A 3GTMH 1LTGD 2SEBD 4DXGA 2JN4A 4UPAA 4YWKA 5C4ZA 1V1PB 3J81i 3CQZB 2A69D 1X56A 3ND9A 4KD4A 2R7ZG 1PTOC 4IJLA 1G6ZA 2F0TA 5A2QL 1XNRL 2EJGC 2XSCA 4LF9L 2FXQA 4A93H 3G6EA 2MO1A 1P16A 2I5LX 3S9WA 4PZ7A 1I6HH 2HD3A 1HQRD 1LTTD 3B6YA 4UDUC 2DNEA 5M5YH 4ZQ3A 4ZCKA 1JMCA 2A1AA 4L5QA 5FLXc 2NVYH 3T51B 2ZTEA 2KHIA 3RNUA 4R4QA 4JK1C 2EOTA 1R9TB 3TZUA 1Q8KA 1K83B 3S14B 5KYIA 2CWPA 2K04A 2F0KA 4PMCA 5CYUA 2HCCA 5IP9H 2A6HC 5E1FA 3STBC 1U9RA 3FPPA 4QUFA 4V190 2B8GA 2JXMB 2VNUD 4IFDG 4K0KQ 5TSSA 1F77A 2UXCL 4ZKCB 4FXGC 1VQ4A 3CKIB 4JI7Q 1OXTA 3OIPA 4PG3A 1ZEQX 4KTAA 1KD1C 2R3ZA 5CV8A 1U5KA 5IYBG 5CORA 1V9PA 3U58A 5D3IB 1HHVA 1HNWL 2IX1A 3HOWG 1AW7A 3H91A 1J9OA 2JA6B 4H0LC 1ENCA 4P73A 4HEDA 5FO8B 4C3IH 1D5MC 2R6GA 4JBWA 3AYHB 1PH2A 2NN6I 2Q2HA 2NTSA 3I91A 1LV9A 1Y1WB 3J80E 4GKJQ 4HAEA 4A3BG 2SNSA 3KUPA 3IKJA 4YY3L 4KK7A 1DXMA 4BBSH 3PO3B 1VQNA 3P1HA 1GUOA 2BE5C 3OW7A 1TWCB 5GAHC 1WTWA 1OTCA 4BY1B 3NTIA 1C8CA 4KJOA 1PRTD 1YHAA 1NE3A 1F9RA 1IKLA 1TWFB 1HFNA 1UAPA 2EPBA 4PZ6A 4LFCL 3BVMA 1A2TA 1D1KA 5IGFA 4R8IA 3S1RH 1TS5A 1CK1A 3MEHA 1HJPA 2JA8B 4J1MA 1I50H 3KBGA 2R92H 1NNXA 3GQBA 3LNNA 1JJCB 1HZBA 2BDOA 4Q0FA 2HIVA 3EA6A 2VB2X 5BR8Q 5KNBA 2D5DA 2K6AA 4K5VA 2F0NA 2B2WA 2CH4A 3C46A 1PFMA 3P7JA 4IOAA 1L1OC 1IBKQ 5LMUL 3T1YL 3UI2A 3K7AB 3F2DA 3GTPB 2LMCB 4DN4M 3LX0A 1QUQA 3FP9A 5CV9A 1YNJD 4QY7A 4RH6A 3CQZH 1A3TA 5DM73 2Z6BA 1PRTF 4A76A 4CJ0B 1ZYRC 1Q46A 5M3MH 2F4IA 1EIYB 2CW0D 4EQOA 2OWOA 2RSOA 1NR4A 3QOLA 3H3VI 4ZKBB 1K0SA 2PZUA 1QB5D 3LWUA 3S16B 2CWAA 3VR2A 2JA9A 1GUNA 3BZKA 5EKIA 3NQIA 5ELCA 1X3PA 3PV0A 3BYYB 1N9WA 3TDQA 1N32L 2C9OA 3E9IA 1HR0L 1L0XB 4HJ7A 1SYBA 4UP9A 1K83H 1YJ9A 1CSPA 4KY5A 3FRPB 2M00A 3A56A 2AMCB 4A3EG 1WCMG 1QJOA 1BO0A 1NCVA 1A62A 4GN5A 2NYZD 2F0GA 3OPOA 1WOCA 1N34Q 1H9SA 3Q0AA 1E22A 1F2MA 5EPLA 2CH4W 1KLUD 2A5HA 4JG2A 4KD3A 4DV6Q 3GTGB 4DR7L 4BA2I 2JA6H 1S5ED 2IWHA 4BBRB 1K28A 4E6IA 3ULLA 1VDZA 2F0IA 3W2DA 1J5EQ 4OWWB 1S72A 1QVFA 3GTOB 1B70B 4C2MB 4MHEA 4DAYB 1Y1WH 2AUKA 2WACA 1TXYA 3HFZB 5IP7G 2Y0SE 2JA7G 3TP7A 3J80c 1X65A 3PO3H 3D4WA 2WAQE 2VS1A 3GV3A 3CMAA 1TWCH 1Y8OB 4BY1H 1JICA 2UUAQ 4A93G 5EAYA 4ULLA 4X62L 4N9PA 3KLSA 3DM1A 2P5ZX 1CZGA 2B8FA 1TU2B 2MGSA 4P2CB 4DV0L 2XGTA 1IBLL 4FF1A 1BBUA 5ELDA 3NBHA 1XPUA 1RTNA 3I4OA 3NTKA 3RLNA 4BS9A 1GM5A 2D0OA 1BVSA 1S5BD 3BVZA 5I2XA 4CDCC 2WB1G 4OWTB 2VB3X 1DD2A 2EJMA 3J7ZC 4I7AA 2XIWA 2LY7A 3VA5A 1IYVA 3U4ZA 1G91A 1CUKA 3H0GH 3CPWA 3AEVA 1VQEA 5IP9G 2K75A 2LKVA 1TWHB 1E3PA 4CHTB 4DAPA 4R4IA 2A73B 2DJGC 5C0XJ 1UE7A 1G51A 1MI2A 5CV7A 3GTPH 3SK5A 2FINB 3CCSA 3P20A 1RTOA 4JBJA 4FF4A 1VQ5A 1EY6A 4JI1Q 3S1MB 5IOCA 3AU7A 3H3VC 3SVMA 4GOPC 2BCOA 3I73A 4DV5Q 2XRSD 1L1OA 3KOJA 1KDCA 3CC7A 5M5XB 3KLRA 5FO9B 3TP6A 3CCRA 1UE5A 1DCZA 3S16H 3PIP3 4APVA 3E5SA 1PYWD 2E5LQ 1EU4A 2X6GA 2IX0A 1GUTA 4OONA 4YHHL 2CQOA 4G4KA 5EPJA 5IGGA 3GV6A 4DPGA 3Q22A 1SYEA 2V1CC 2VQFQ 1V1QA 5M9OA 1SYDA 1V1PA 1Q1EA 3HOWB 3NPPA 4XQQA 2ZM6Q 1DYQA 2OT2A 2CKZB 1CHQD 2F0UA 3I2ZA 1PTOD 1WD1A 4IFDI 4FXDA 1E1OA 3J81E 4A3BB 3PMFA 4JV5Q 5IT9E 4CKCA 4DR4L 1VQHA 3GTGH 2UU9Q 3D4RA 3F2BA 1STBA 2K50A 5LL6S 2PQAB 4XQJA 2GVBA 2BH2A 3A55A 1PH8A 4TQUS 1TWAH 3GTOH 1HA5A 3J80i 2PMZE 4C2MH 2H1EA 2WKCA 1KTKA 1HUNA 4A3KB 2X6LA 3AQQA 4GNXB 3AMUA 4A3DB 4JI8L 2A6HD 3BU2A 3M3YB 4IUNA 3STBD 1EU3A 1KABA 3GTLB 2LXJA 5M3MG 3Q23A 1Q3LA 1V1OA 2UXDQ 2K5VA 1HNZL 4K0KL 5AFWA 4GZYC 3PGZA 2KENA 2KCNA 1HZ9A 2VXWA 2ID0A 1Q8IA 2B2UC 4OL7A 2RBMA 2ASBA 2HT1A 2M9VA 4ME5A 1PRTC 2K14A 4DNRB 2Q8RE 3JAML 1CM9A 1DONA 1B44D 1MSHA 4LJZC 4K8IA 3ZJYC 2E76C 3K80C 3OW2A 1SXTA 3HOVH 1U0LA 4AYBE 1JQYD 4JI6Q 4R4TA 5A2QE 1TWHH 2YV5A 5A35A 3MEFA 4LF7Q 2TSSA 4GKJL 1DOMA 3P75A 5M3FB 3MXGA 5FJ8H 1WJJA 3VDYA 1XMQQ 2Z6KC 2IT1A 3BG3A 4LF5Q 3S1MH 1I94Q 2RQXA 1JOQA 3SDZA 2BE5D 2ICEC 1A2UA 5C6AA 1OXSC 1U4MA 3R3OA 3M4PA 2JA5H 5F2DA 2VUMG 1S5DD 3KF8B 2OXPA 4RCNA 4A3EB 1FGBD 2AQ1B 1WCMB 2O4XA 2R7DA 5C4JH 2I46A 4NKLA 4JI5Q 4J8QA 4DV3L 1X3EA 2B63H 1Z47A 3MXNB 3N6RA 4DV1Q 1AH9A 3T13A 2MHVA 2Z4HA 3DEOA 4GOPA 1SROA 5IE8A 5BR8L 5BN3A 3D4DA 3K0XA 1KLGD 3EN2A 1EQTA 5KIXA 1ET9A 4RKBA 5CC4A 4I7ZC 1PYBA 4DV7L 3PO3G 1IBKL 4CDDC 2XVSA 4HN7A 1IBML 1JWUD 3V96A 2IW3A 1C0AA 3VR4A 1AN8A 4G7ZC 5AJ3Q 3OOCA 3S17B 2Z1CA 4HSVA 3OMCA 2LFNA 4FF3A 4R4CA 2DUDA 1G6PA 2N78A 2EY2A 4FDBA 1EFWA 5I9OA 4A3CG 1PH5A 1XX8A 1GD7A 2CHBD 3PQIA 1F2ZA 1M90C 2JA7B 1S5CD 1K9MC 3NEMA 5J22A 3J81c 3E0JA 3K59A 3VR6A 1JC7A 2K5HA 2KHSA 5ELEA 3H0GG 2JE6I 4UAIA 1GXDC 1DOKA 3TMEA 3TP5A 2EYJA 4X3SA 3K58A 1EZ6A 1PZJD 1LTRD 4O2DA 1LTID 2N55A 2N88A 1VQ6A 1HPCA 1O7ZA 2FMMA 5EJWA 3ULPA 1RIPA 2NVYB 2QW7A 1PH7A 3VA7A 3KFUA 5EBDA 3EQLC 1H9JA 4A3KH 1V8QA 2NWGA 4A3DH 3M3YH 4DV4Q 2L4NA 4OO1H 2L0CA 2CQAA 2XWBB 2SNMA 4AH6A 3R2TA 4LF4Q 1LACA 1MSGA 4O0AA 1N34L 1EY9A 1WTPA 1STEA 1B53A 2O5IC 4XXEA 4X65L 1Q1BA 5ELFA 2NZOA 2F0QA 4LAAA 1DM0B 1ILPA 3FMCA 1BQQT 4ALPA 2B2UA 4DAYA 2NZHA 3KDFB 1NMGA 3Q24A 5C0XG 3HOZB 3K5OA 1YNND 2D2CC 1I4RA 4P74A 4LFAQ 1G291 4KY7A 5M3FH 1N33L 4DR6L 1I6VC 2RHQB 1LYLA 3PUZA 1EIFA 5I9PA 3EVQA 3E3XA 4JI3Q 2N49A 1K3RA 3D6WA 2AWOA 3HZXA 2AWNA 1QE6A 1JOKA 3CCJA 5ELBA 1O80A 1HXYD 2ZJRA 2CCZA 4IQZA 3KLWA 1II3A 1S3OA 1LT4D 3ERSX 1ASYA 1AFPA 2B2WC 5CV5A 2Z6KA 4NDXA 4KKUA 4HJAA 4MN3A 1EY0A 1SE2A 3S1RB 1PXUA 1N36Q 1CHPD 4TKOB 4Q5VA 3NHHA 1QNKA 3I72A 4GS3A 4DV2Q 2WIIB 4YCVA 2EXZA 4OGQC 2YTYA 1PV4A 1EL0A
chains in the Genus database with same CATH topology
3CPFA 1FVIA 3CQZH 1YI2A 1LUZA 1YBYA 4LUVA 1KAWA 1PFSA 4A76A 4JC0A 1XNRQ 1Q46A 5M3MH 1X54A 4HJ5A 1EIYB 1VQMA 2IY5B 3KJPA 5IP7H 1JJ2A 2WP8J 2JA7H 1K0RA 2OWOA 4MTNA 5IY0A 5JJIA 1VQAA 4YWLA 4DNIA 3H3VI 2L15A 3HOVG 2Q2IA 2B3GA 4A3GH 1Q7YC 2CWAA 1NTGA 1PH1A 1PHJA 1N32Q 2JA9A 1QZHA 2Y0SG 2K4KA 3BZKA 2K52A 4X64L 3CAMA 4KI0A 4BBSG 1VQJA 5IT9c 3PV0A 3CP0A 1K8GA 1N9WA 1UE6A 2WAQG 1M1KC 2F4VQ 1HZAA 3I4NH 1N32L 5FJ8G 3E9IA 1HR0L 3I7FA 4HJ7A 5C3EH 3CC2A 4UP9A 1K83H 2F3IA 1IL2A 1YJ9A 1CSPA 2F4VL 1VQOA 2AKWB 4JYAQ 4A3EG 2AMCB 4NXML 1FGUA 1WCMG 2JA5G 3HOUH 1V43A 2ZTDA 3S24A 2ZM6L 3BZCA 1A62A 1HZCA 4GN5A 2PNHA 4Y52H 1VQGA 2R92G 4EQ5A 2KCMA 2VQEQ 5J3BA 4NPSA 5IYDG 3K8AA 1AE3A 2I5MX 3UDGA 1IXRA 1WOCA 2OQ0A 1N34Q 2VQEL 1E1TA 2B63G 3S1NH 1E22A 1XMOL 1ASZA 4H02A 4IPGA 1KXLA 1J6QA 4HIDA 4A3MH 4DR7Q 3PO2H 4DR2L 3CCQA 2LXKA 4GNXC 2YTXA 3CXCA 3TREA 4JG2A 5M5WH 4BBRH 5GADC 2PQAA 1YJWA 4DV6Q 5H1SE 4C3HH 1HNWQ 4DR7L 4BA2I 1KRTA 2JA6H 2MO0A 3K7UC 4DKAC 4DK3C 1NBWA 2BA0A 3A74A 4DV6L 2I0QA 2VW9A 4JI4Q 3ULLA 4GNXA 4LUZA 1J5EQ 3HOZH 1PH4A 4OWWB 2ZTCA 2WFWA 1S72A 1QVFA 2B29A 4NXNQ 3PF4A 2MNAA 1B70B 4KHPQ 3RLOA 5JEAG 1HNXL 1C9OA 1A0IA 4DAYB 4X66Q 1VS0A 1Y1WH 4DUZQ 1J5EL 1TXYA 3HFZB 3CCEA 5IP7G 2Y0SE 4NXNL 2JA7G 4GKKQ 4KHPL 4X62Q 1LTLA 3J80c 3TS2A 1X65A 4YY3Q 3PO3H 1JT8A 4X66L 4B3MQ 2WAQE 2VS1A 1SE8A 3JC66 4GN4B 3CMAA 4DUZL 1CKNA 1TWCH 3TRZA 4BY1H 2UXDL 2QA4A 4GKKL 2UUAQ 4OX9Q 5EAYA 4DV0Q 4A93G 4X62L 2Q2TA 4UP8A 3TEHB 4JI0Q 1B7YB 1TWGH 4B3ML 1YEZA 4P72A 3D31A 1IYJB 4IFDJ 4LW1A 4R1JA 3PIPA 2UUAL 4DV0L 2XGTA 1IBLL 1BBUA 4JI0L 1XPUA 4XIGS 4MNOA 4JBKA 2R7ZH 3EIVA 3I4OA 1A8VA 3RLNA 3RR5A 1GM5A 2ES2A 1UE1A 2D0OA 1BVSA 2RCNA 1UEBA 2WB1G 4OWTB 4A3IG 2NVQH 4LF6L 3J7ZC 3E9HA 2OTJA 2KBNA 2CFMA 1OXUA 2OQKA 2GVAA 2VZAA 2QGQA 4GN3B 4DAMA 1KC8C 1VCIA 4IPCA 3U4ZA 4A3KG 2ALYB 2NN6G 3PIOA 1CUKA 3H0GH 4XTCS 3CPWA 1HH2P 2OCEA 1MJCA 3AEVA 4A3DG 1VQEA 1CKOA 1SN8A 5IP9G 4B3SQ 2XTIA 4OO1G 2K75A 1E3PA 4R4IA 1PH6A 5C0XJ 3PUWA 4LF7L 1UE7A 3T1YQ 1G51A 2UXBQ 4UP7A 3GTPH 4P71A 3LGJA 4B3SL 3CCSA 4JBJA 3BJUA 1XMQL 1VQ5A 4JBMA 2NVTH 4BXXH 4R4OA 4JI1Q 3OTOQ 1X55A 1VQ9A 5C4XH 2I5HA 4GOPC 4DR1Q 1QUQB 4JI1L 2JA6G 4DV5Q 1VQLA 3L0OA 1SRUA 1L1OA 2MQHA 5M5XH 1Q86C 3KOJA 1X3FA 2HQLA 1L1OB 4JOIC 4DR1L 3KYHC 4DV5L 2RHSB 3RN2A 5FLMG 3G71A 3CC7A 1BBWA 1KRSA 1SMXA 1Y1VG 3H15A 4DR3Q 1PH3A 3CCRA 1UE5A 2Z0SA 4L5SA 1A63A 1EOVA 4YHHQ 5IWAQ 3S16H 1FL0A 1Y1WG 4DV1L 4APVA 4JOIA 4DR5Q 4A3LH 2E5LQ 1YZ6A 4DR3L 4JI2Q 2IX0A 2JQOA 3KF6A 4OONA 4PMWA 5IWAL 4X64Q 5GAEC 2CQOA 4YHHL 1VQ7A 5IYBH 3KF6B 5C44G 2VY3A 4A3FH 3CMEA 4DR5L 4DPGA 4BY1G 5M3FG 2E5LL 4JI2L 3HOWH 2V1CC 3GTQH 3G48A 1HR0Q 1I5FA 2VQFQ 1K73C 3CC4A 1V1QA 2WB1E 3D0FA 4IPDA 1X3GA 2R93H 3FKIH 4X6AH 1Q1EA 1MJEA 4TVAB 3M4QA 3UE0A 2VQFL 2N8NA 1QZGA 1Q81C 4NXMQ 2OTLA 3SGIA 1D7QA 3EBEA 2ZM6Q 1K8AC 2JA8G 4KHZA 1PA6A 2CKZB 3NENA 5HY6A 3W1GA 2E8GA 3I2ZA 3ICEA 2KHJA 4A3BH 1XNQQ 3HOYH 4MZ9A 4HIOA 4IFDI 1WFQA 4J15A 3G4SA 5ELNA 2YU9H 4DR4Q 1E1OA 4A3JG 2ZJPA 1XMOQ 1XNQL 4AYBG 4JV5Q 4GLVB 4DR2Q 4POFA 4DR4L 1PVOA 1VQHA 1YHBA 3GTGH 1VQPA 2UU9Q 4JV5L 2UUCQ 3F2BA 1EUJA 4QL5A 4RMFA 5IYCH 1D8LA 1KHIA 2K50A 2VUMH 3S2DH 4LFBQ 4BXXG 4YCWA 2UU9L 4DUYL 1UWVA 3I4MH 1WI5A 2KCTA 2PQAB 2UUCL 2PI2E 2GVBA 2BH2A 5C4XG 1PH8A 4TQUS 1TWAH 2A8VA 1P8LA 4JI8Q 1KQSA 3GTOH 1XTDA 2GN5A 3M4OH 3J80i 1FJGQ 4LFBL 2PMZE 1GVPA 3PUVA 4C2MH 5C0XI 1HNXQ 3GTLH 3WWVA 3M85A 1H95A 2F52A 2YYZA 3AQQA 3U4VA 4GNXB 4JI8L 2JK8A 3BU2A 1HNZQ 1FJGL 3STBD 1HR0W 2LXJA 2YTVA 5M3MG 1JJGA 1JE5A 4POGA 3HOXH 2UXDQ 2K5VA 1HNZL 1JB7A 1KL9A 4K0KL 3PGZA 1PYSB 2KENA 1SFOH 1HZ9A 2ID0A 4LUOA 3DLLA 5LMNQ 3T1HL 1CKNB 2ASBA 4P75A 4B3TQ 1IBLQ 2HT1A 4A3GG 4A3FG 4ME3A 1VQCA 1I3QH 5LMNL 1W3SA 2K14A 4AIMA 5JJLA 1YHQA 3K81C 3OYYA 5JJKA 4B3TL 3KDFA 3PCOB 3I4NG 2R93G 1YITA 1EQRA 3NBHB 2PI2A 4QIWE 1N8RC 4LF6Q 3ZJYC 1S40A 2E2JH 5C3EG 3K80C 3OW2A 2ZJQA 4A3CH 1E7ZA 4IOCA 3HOVH 4B3RL 1U0LA 4AYBE 4JI6Q 2UUBQ 4R4TA 3HOUG 1TWHH 2YV5A 5GQOA 3UDXA 3MEFA 3HOYG 1VQKA 4LF7Q 3J7A5 4JI6L 3I55A 5GAGC 3CF5A 2E2HH 2UUBL 4GKJL 5JEAJ 2A19A 3HKSA 5FJ8H 3RN5A 1WJJA 1YNXA 2EIFA 3CW2C 2Z6KC 2IT1A 3VDYA 1XMQQ 4LF5Q 1KIXA 3S1MH 1I94Q 1VQIA 1XPRA 2N3SA 1OXSC 4JI3L 3AFQA 4HIKA 2C35B 3M4PA 4A3EH 2JJQA 1WCMH 2BH8A 1AE2A 3CCUA 4A3MG 1I94L 2JA5H 1CKMA 4LF5L 3GTKH 3PO2G 2VUMG 3KF8B 4BBRG 4DV3Q 1Q12A 4QJFA 5IYDH 4JCVE 4QGUA 2R7DA 3IRBA 5GROA 1X6OA 5C4JH 2HHHL 1EWIA 4JI5Q 3GDEA 4IPHA 4DV3L 1VQ8A 5LMNW 3F2CA 1X3EA 2B63H 1Z47A 3MXNB 3A5UA 4DV1Q 4WJ4A 1AH9A 4JI5L 1W2BA 3HOZG 1SLJA 2VL6A 4GOPA 3TQYA 1SROA 3UDIA 5IE8A 5BR8L 1MIUA 5ELOA 4DV7Q 4AQYL 4GOPB 3S1QH 3K0XA 3HKZG 1GO3E 4LF8Q 4BY7H 1EYGA 3EN2A 3L2PA 3I56A 3HOXG 2IHEA 3F8TA 3RLFA 1IBMQ 1PYBA 3DM3A 4DV7L 3PO3G 1IBKL 4LWCA 4OWXB 5E7NA 4LF8L 1GKHA 1MKHA 1QVCA 1E24A 2BA1A 3ER0A 1C7YA 3M7NA 1IBML 4IO9A 3GO5A 3GTMH 3S17H 3S2HH 2EQSA 1C0AA 4UPAA 4YWKA 1VQDA 3JAMc 5AJ3Q 3J81i 2IHFA 4A4IA 1X56A 4R4CA 3CCLA 2R7ZG 4LF9Q 2DUDA 2E2IH 1G6PA 2N78A 4IJLA 1XJVA 4FDBA 3L7ZC 1EFWA 5AJ3L 1XNRL 4A3CG 1PH5A 4L5TA 4LF9L 2FXQA 4A93H 1GD7A 1NY4A 3G6EA 1M90C 1K9MC 2MO1A 1P16A 3FHWA 3NEMA 2I5LX 3CCMA 3J81c 2H5XA 4PZ7A 1I6HH 4HJ9A 3B6YA 1RL2A 2K5HA 3H0GG 5M5YH 2JE6I 1JMCA 2A1AA 4L5QA 5FLXc 2JEBI 2NVYH 1VQBA 2ZTEA 1OXXK 1R9TH 2KHIA 3PSIA 1LM0A 4O2DA 4R4QA 4DK6C 4DUYQ 3RNUA 4A3IH 4NB3A 3S14H 1B8AA 1VQ6A 3ULPA 1RIPA 1PH7A 1Q8KA 2RF4A 3KFUA 3GTJH 3S15H 4A3KH 1DGSA 4JYAL 4EX5A 3CCVA 4YCUA 4A3DH 2CWPA 4A75A 3E0EA 3M3YH 4DV4Q 5IP9H 1VQFA 3HKZE 3STBC 2UXCQ 3AFPA 2MFIA 4RG1A 5DLQE 4YWMA 4DV4L 4IFDG 4K0KQ 2VNUD 4AH6A 1T9HA 4LF4Q 2UXCL 1Q82C 4O0AA 1O7IA 1VQ4A 3T1HQ 4X65Q 1N34L 4JI7Q 1OXTA 4BY7G 1CSQA 4LF4L 2HIXA 4PG3A 4A3LG 1KD1C 2R7FA 4X65L 1Q1BA 2K5NA 4JI7L 1U5KA 5IYBG 1YIJA 2NZOA 1V9PA 3U58A 4LNQA 1NJIC 1OXVA 2IX1A 3HOWG 1X9NA 1HNWL 4C3JH 5FLMH 3RZOH 1Y1VH 3UE1A 4ALPA 4P73A 1Z9FA 3FKIG 4PZ8A 4JI4L 2NZHA 3GD7A 3KDFB 4C3IH 1NMGA 3A5ZB 4B3RQ 2R6GA 4JBWA 5C0XG 4HJ8A 3AYHB 1PH2A 4UY8C 2NN6I 4DR6Q 1YVCA 1N33Q 2Q2HA 3NELA 2NVXH 4OO1I 2LSSA 3ULJA 4KLKA 5C44H 1PH9A 4P74A 4LFAQ 3Q8DA 3CD6A 4GKJQ 1G291 5M3FH 1N33L 4DR6L 4A3BG 3J81j 2RHQB 4YY3L 1LYLA 4BBSH 2D0PA 3U50C 4GLAC 1IZ6A 1EIFA 2AHOB 1TWFH 3PUZA 4LFAL 4Y7NH 1VQNA 1OTCA 5GAHC 4OX9L 3PUXA 4JI3Q 4QQBX 2N49A 1K3RA 4L5RC 4LFCQ 2AWOA 3RZDH 5K36G 1YHAA 2AWNA 1NE3A 3CCJA 1WYDA 2JA8H 2D62A 4PZ6A 1NMFA 4LFCL 2ZJRA 2CCZA 4GLXA 3KLWA 1S3OA 3S1RH 3ERSX 5IYCG 3W1BA 1ASYA 1YJNA 2HHHQ 1L2FA 4OXPA 1HJPA 2Q2UA 2ATWA 2Z6KA 2QEXA 1I50H 3I4MG 2R92H 4HJAA 4IJHA 3W5OA 1JJCB 3A0JA 1HZBA 4A3JH 2JEAI 2DGYA 3H3VH 2HIVA 4AQYQ 5BR8Q 1Y14B 1N36Q 1BKBA 5LMUQ 3UDFA 3K7AH 4BA1I 3M9BA 4GS3A 1SR3A 1N36L 4DV2Q 4IOAA 1L1OC 4YCVA 5LMUL 1IBKQ 3T1YL 2UXBL 4HIMA 3F1ZA 2EXDA 3JAMi 3F2DA 4WJ3M 4DV2L 3PF5A 1L0WA 1QUQA 3PUYA 3FP9A 1QVGA 2YTYA 4QY7A 3TS0A 1PV4A 3KJOA 1XPOA 3OTOL 5HGQA 1EQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  1FVI A;  3CQZ H;  1YI2 A;  1LUZ A;  1YBY A;  4LUV A;  1KAW A;  1PFS A;  4A76 A;  4JC0 A;  1XNR Q;  1Q46 A;  5M3M H;  1X54 A;  4HJ5 A;  1EIY B;  1VQM A;  2IY5 B;  3KJP A;  5IP7 H;  1JJ2 A;  2WP8 J;  2JA7 H;  1K0R A;  2OWO A;  4MTN A;  5IY0 A;  5JJI A;  1VQA A;  4YWL A;  4DNI A;  3H3V I;  2L15 A;  3HOV G;  2Q2I A;  2B3G A;  4A3G H;  1Q7Y C;  2CWA A;  1NTG A;  1PH1 A;  1PHJ A;  1N32 Q;  2JA9 A;  1QZH A;  2Y0S G;  2K4K A;  3BZK A;  2K52 A;  4X64 L;  3CAM A;  4KI0 A;  4BBS G;  1VQJ A;  5IT9 c;  3PV0 A;  3CP0 A;  1K8G A;  1N9W A;  1UE6 A;  2WAQ G;  1M1K C;  2F4V Q;  1HZA A;  3I4N H;  1N32 L;  5FJ8 G;  3E9I A;  1HR0 L;  3I7F A;  4HJ7 A;  5C3E H;  3CC2 A;  4UP9 A;  1K83 H;  2F3I A;  1IL2 A;  1YJ9 A;  1CSP A;  2F4V L;  1VQO A;  2AKW B;  4JYA Q;  4A3E G;  2AMC B;  4NXM L;  1FGU A;  1WCM G;  2JA5 G;  3HOU H;  1V43 A;  2ZTD A;  3S24 A;  2ZM6 L;  3BZC A;  1A62 A;  1HZC A;  4GN5 A;  2PNH A;  4Y52 H;  1VQG A;  2R92 G;  4EQ5 A;  2KCM A;  2VQE Q;  5J3B A;  4NPS A;  5IYD G;  3K8A A;  1AE3 A;  2I5M X;  3UDG A;  1IXR A;  1WOC A;  2OQ0 A;  1N34 Q;  2VQE L;  1E1T A;  2B63 G;  3S1N H;  1E22 A;  1XMO L;  1ASZ A;  4H02 A;  4IPG A;  1KXL A;  1J6Q A;  4HID A;  4A3M H;  4DR7 Q;  3PO2 H;  4DR2 L;  3CCQ A;  2LXK A;  4GNX C;  2YTX A;  3CXC A;  3TRE A;  4JG2 A;  5M5W H;  4BBR H;  5GAD C;  2PQA A;  1YJW A;  4DV6 Q;  5H1S E;  4C3H H;  1HNW Q;  4DR7 L;  4BA2 I;  1KRT A;  2JA6 H;  2MO0 A;  3K7U C;  4DKA C;  4DK3 C;  1NBW A;  2BA0 A;  3A74 A;  4DV6 L;  2I0Q A;  2VW9 A;  4JI4 Q;  3ULL A;  4GNX A;  4LUZ A;  1J5E Q;  3HOZ H;  1PH4 A;  4OWW B;  2ZTC A;  2WFW A;  1S72 A;  1QVF A;  2B29 A;  4NXN Q;  3PF4 A;  2MNA A;  1B70 B;  4KHP Q;  3RLO A;  5JEA G;  1HNX L;  1C9O A;  1A0I A;  4DAY B;  4X66 Q;  1VS0 A;  1Y1W H;  4DUZ Q;  1J5E L;  1TXY A;  3HFZ B;  3CCE A;  5IP7 G;  2Y0S E;  4NXN L;  2JA7 G;  4GKK Q;  4KHP L;  4X62 Q;  1LTL A;  3J80 c;  3TS2 A;  1X65 A;  4YY3 Q;  3PO3 H;  1JT8 A;  4X66 L;  4B3M Q;  2WAQ E;  2VS1 A;  1SE8 A;  3JC6 6;  4GN4 B;  3CMA A;  4DUZ L;  1CKN A;  1TWC H;  3TRZ A;  4BY1 H;  2UXD L;  2QA4 A;  4GKK L;  2UUA Q;  4OX9 Q;  5EAY A;  4DV0 Q;  4A93 G;  4X62 L;  2Q2T A;  4UP8 A;  3TEH B;  4JI0 Q;  1B7Y B;  1TWG H;  4B3M L;  1YEZ A;  4P72 A;  3D31 A;  1IYJ B;  4IFD J;  4LW1 A;  4R1J A;  3PIP A;  2UUA L;  4DV0 L;  2XGT A;  1IBL L;  1BBU A;  4JI0 L;  1XPU A;  4XIG S;  4MNO A;  4JBK A;  2R7Z H;  3EIV A;  3I4O A;  1A8V A;  3RLN A;  3RR5 A;  1GM5 A;  2ES2 A;  1UE1 A;  2D0O A;  1BVS A;  2RCN A;  1UEB A;  2WB1 G;  4OWT B;  4A3I G;  2NVQ H;  4LF6 L;  3J7Z C;  3E9H A;  2OTJ A;  2KBN A;  2CFM A;  1OXU A;  2OQK A;  2GVA A;  2VZA A;  2QGQ A;  4GN3 B;  4DAM A;  1KC8 C;  1VCI A;  4IPC A;  3U4Z A;  4A3K G;  2ALY B;  2NN6 G;  3PIO A;  1CUK A;  3H0G H;  4XTC S;  3CPW A;  1HH2 P;  2OCE A;  1MJC A;  3AEV A;  4A3D G;  1VQE A;  1CKO A;  1SN8 A;  5IP9 G;  4B3S Q;  2XTI A;  4OO1 G;  2K75 A;  1E3P A;  4R4I A;  1PH6 A;  5C0X J;  3PUW A;  4LF7 L;  1UE7 A;  3T1Y Q;  1G51 A;  2UXB Q;  4UP7 A;  3GTP H;  4P71 A;  3LGJ A;  4B3S L;  3CCS A;  4JBJ A;  3BJU A;  1XMQ L;  1VQ5 A;  4JBM A;  2NVT H;  4BXX H;  4R4O A;  4JI1 Q;  3OTO Q;  1X55 A;  1VQ9 A;  5C4X H;  2I5H A;  4GOP C;  4DR1 Q;  1QUQ B;  4JI1 L;  2JA6 G;  4DV5 Q;  1VQL A;  3L0O A;  1SRU A;  1L1O A;  2MQH A;  5M5X H;  1Q86 C;  3KOJ A;  1X3F A;  2HQL A;  1L1O B;  4JOI C;  4DR1 L;  3KYH C;  4DV5 L;  2RHS B;  3RN2 A;  5FLM G;  3G71 A;  3CC7 A;  1BBW A;  1KRS A;  1SMX A;  1Y1V G;  3H15 A;  4DR3 Q;  1PH3 A;  3CCR A;  1UE5 A;  2Z0S A;  4L5S A;  1A63 A;  1EOV A;  4YHH Q;  5IWA Q;  3S16 H;  1FL0 A;  1Y1W G;  4DV1 L;  4APV A;  4JOI A;  4DR5 Q;  4A3L H;  2E5L Q;  1YZ6 A;  4DR3 L;  4JI2 Q;  2IX0 A;  2JQO A;  3KF6 A;  4OON A;  4PMW A;  5IWA L;  4X64 Q;  5GAE C;  2CQO A;  4YHH L;  1VQ7 A;  5IYB H;  3KF6 B;  5C44 G;  2VY3 A;  4A3F H;  3CME A;  4DR5 L;  4DPG A;  4BY1 G;  5M3F G;  2E5L L;  4JI2 L;  3HOW H;  2V1C C;  3GTQ H;  3G48 A;  1HR0 Q;  1I5F A;  2VQF Q;  1K73 C;  3CC4 A;  1V1Q A;  2WB1 E;  3D0F A;  4IPD A;  1X3G A;  2R93 H;  3FKI H;  4X6A H;  1Q1E A;  1MJE A;  4TVA B;  3M4Q A;  3UE0 A;  2VQF L;  2N8N A;  1QZG A;  1Q81 C;  4NXM Q;  2OTL A;  3SGI A;  1D7Q A;  3EBE A;  2ZM6 Q;  1K8A C;  2JA8 G;  4KHZ A;  1PA6 A;  2CKZ B;  3NEN A;  5HY6 A;  3W1G A;  2E8G A;  3I2Z A;  3ICE A;  2KHJ A;  4A3B H;  1XNQ Q;  3HOY H;  4MZ9 A;  4HIO A;  4IFD I;  1WFQ A;  4J15 A;  3G4S A;  5ELN A;  2YU9 H;  4DR4 Q;  1E1O A;  4A3J G;  2ZJP A;  1XMO Q;  1XNQ L;  4AYB G;  4JV5 Q;  4GLV B;  4DR2 Q;  4POF A;  4DR4 L;  1PVO A;  1VQH A;  1YHB A;  3GTG H;  1VQP A;  2UU9 Q;  4JV5 L;  2UUC Q;  3F2B A;  1EUJ A;  4QL5 A;  4RMF A;  5IYC H;  1D8L A;  1KHI A;  2K50 A;  2VUM H;  3S2D H;  4LFB Q;  4BXX G;  4YCW A;  2UU9 L;  4DUY L;  1UWV A;  3I4M H;  1WI5 A;  2KCT A;  2PQA B;  2UUC L;  2PI2 E;  2GVB A;  2BH2 A;  5C4X G;  1PH8 A;  4TQU S;  1TWA H;  2A8V A;  1P8L A;  4JI8 Q;  1KQS A;  3GTO H;  1XTD A;  2GN5 A;  3M4O H;  3J80 i;  1FJG Q;  4LFB L;  2PMZ E;  1GVP A;  3PUV A;  4C2M H;  5C0X I;  1HNX Q;  3GTL H;  3WWV A;  3M85 A;  1H95 A;  2F52 A;  2YYZ A;  3AQQ A;  3U4V A;  4GNX B;  4JI8 L;  2JK8 A;  3BU2 A;  1HNZ Q;  1FJG L;  3STB D;  1HR0 W;  2LXJ A;  2YTV A;  5M3M G;  1JJG A;  1JE5 A;  4POG A;  3HOX H;  2UXD Q;  2K5V A;  1HNZ L;  1JB7 A;  1KL9 A;  4K0K L;  3PGZ A;  1PYS B;  2KEN A;  1SFO H;  1HZ9 A;  2ID0 A;  4LUO A;  3DLL A;  5LMN Q;  3T1H L;  1CKN B;  2ASB A;  4P75 A;  4B3T Q;  1IBL Q;  2HT1 A;  4A3G G;  4A3F G;  4ME3 A;  1VQC A;  1I3Q H;  5LMN L;  1W3S A;  2K14 A;  4AIM A;  5JJL A;  1YHQ A;  3K81 C;  3OYY A;  5JJK A;  4B3T L;  3KDF A;  3PCO B;  3I4N G;  2R93 G;  1YIT A;  1EQR A;  3NBH B;  2PI2 A;  4QIW E;  1N8R C;  4LF6 Q;  3ZJY C;  1S40 A;  2E2J H;  5C3E G;  3K80 C;  3OW2 A;  2ZJQ A;  4A3C H;  1E7Z A;  4IOC A;  3HOV H;  4B3R L;  1U0L A;  4AYB E;  4JI6 Q;  2UUB Q;  4R4T A;  3HOU G;  1TWH H;  2YV5 A;  5GQO A;  3UDX A;  3MEF A;  3HOY G;  1VQK A;  4LF7 Q;  3J7A 5;  4JI6 L;  3I55 A;  5GAG C;  3CF5 A;  2E2H H;  2UUB L;  4GKJ L;  5JEA J;  2A19 A;  3HKS A;  5FJ8 H;  3RN5 A;  1WJJ A;  1YNX A;  2EIF A;  3CW2 C;  2Z6K C;  2IT1 A;  3VDY A;  1XMQ Q;  4LF5 Q;  1KIX A;  3S1M H;  1I94 Q;  1VQI A;  1XPR A;  2N3S A;  1OXS C;  4JI3 L;  3AFQ A;  4HIK A;  2C35 B;  3M4P A;  4A3E H;  2JJQ A;  1WCM H;  2BH8 A;  1AE2 A;  3CCU A;  4A3M G;  1I94 L;  2JA5 H;  1CKM A;  4LF5 L;  3GTK H;  3PO2 G;  2VUM G;  3KF8 B;  4BBR G;  4DV3 Q;  1Q12 A;  4QJF A;  5IYD H;  4JCV E;  4QGU A;  2R7D A;  3IRB A;  5GRO A;  1X6O A;  5C4J H;  2HHH L;  1EWI A;  4JI5 Q;  3GDE A;  4IPH A;  4DV3 L;  1VQ8 A;  5LMN W;  3F2C A;  1X3E A;  2B63 H;  1Z47 A;  3MXN B;  3A5U A;  4DV1 Q;  4WJ4 A;  1AH9 A;  4JI5 L;  1W2B A;  3HOZ G;  1SLJ A;  2VL6 A;  4GOP A;  3TQY A;  1SRO A;  3UDI A;  5IE8 A;  5BR8 L;  1MIU A;  5ELO A;  4DV7 Q;  4AQY L;  4GOP B;  3S1Q H;  3K0X A;  3HKZ G;  1GO3 E;  4LF8 Q;  4BY7 H;  1EYG A;  3EN2 A;  3L2P A;  3I56 A;  3HOX G;  2IHE A;  3F8T A;  3RLF A;  1IBM Q;  1PYB A;  3DM3 A;  4DV7 L;  3PO3 G;  1IBK L;  4LWC A;  4OWX B;  5E7N A;  4LF8 L;  1GKH A;  1MKH A;  1QVC A;  1E24 A;  2BA1 A;  3ER0 A;  1C7Y A;  3M7N A;  1IBM L;  4IO9 A;  3GO5 A;  3GTM H;  3S17 H;  3S2H H;  2EQS A;  1C0A A;  4UPA A;  4YWK A;  1VQD A;  3JAM c;  5AJ3 Q;  3J81 i;  2IHF A;  4A4I A;  1X56 A;  4R4C A;  3CCL A;  2R7Z G;  4LF9 Q;  2DUD A;  2E2I H;  1G6P A;  2N78 A;  4IJL A;  1XJV A;  4FDB A;  3L7Z C;  1EFW A;  5AJ3 L;  1XNR L;  4A3C G;  1PH5 A;  4L5T A;  4LF9 L;  2FXQ A;  4A93 H;  1GD7 A;  1NY4 A;  3G6E A;  1M90 C;  1K9M C;  2MO1 A;  1P16 A;  3FHW A;  3NEM A;  2I5L X;  3CCM A;  3J81 c;  2H5X A;  4PZ7 A;  1I6H H;  4HJ9 A;  3B6Y A;  1RL2 A;  2K5H A;  3H0G G;  5M5Y H;  2JE6 I;  1JMC A;  2A1A A;  4L5Q A;  5FLX c;  2JEB I;  2NVY H;  1VQB A;  2ZTE A;  1OXX K;  1R9T H;  2KHI A;  3PSI A;  1LM0 A;  4O2D A;  4R4Q A;  4DK6 C;  4DUY Q;  3RNU A;  4A3I H;  4NB3 A;  3S14 H;  1B8A A;  1VQ6 A;  3ULP A;  1RIP A;  1PH7 A;  1Q8K A;  2RF4 A;  3KFU A;  3GTJ H;  3S15 H;  4A3K H;  1DGS A;  4JYA L;  4EX5 A;  3CCV A;  4YCU A;  4A3D H;  2CWP A;  4A75 A;  3E0E A;  3M3Y H;  4DV4 Q;  5IP9 H;  1VQF A;  3HKZ E;  3STB C;  2UXC Q;  3AFP A;  2MFI A;  4RG1 A;  5DLQ E;  4YWM A;  4DV4 L;  4IFD G;  4K0K Q;  2VNU D;  4AH6 A;  1T9H A;  4LF4 Q;  2UXC L;  1Q82 C;  4O0A A;  1O7I A;  1VQ4 A;  3T1H Q;  4X65 Q;  1N34 L;  4JI7 Q;  1OXT A;  4BY7 G;  1CSQ A;  4LF4 L;  2HIX A;  4PG3 A;  4A3L G;  1KD1 C;  2R7F A;  4X65 L;  1Q1B A;  2K5N A;  4JI7 L;  1U5K A;  5IYB G;  1YIJ A;  2NZO A;  1V9P A;  3U58 A;  4LNQ A;  1NJI C;  1OXV A;  2IX1 A;  3HOW G;  1X9N A;  1HNW L;  4C3J H;  5FLM H;  3RZO H;  1Y1V H;  3UE1 A;  4ALP A;  4P73 A;  1Z9F A;  3FKI G;  4PZ8 A;  4JI4 L;  2NZH A;  3GD7 A;  3KDF B;  4C3I H;  1NMG A;  3A5Z B;  4B3R Q;  2R6G A;  4JBW A;  5C0X G;  4HJ8 A;  3AYH B;  1PH2 A;  4UY8 C;  2NN6 I;  4DR6 Q;  1YVC A;  1N33 Q;  2Q2H A;  3NEL A;  2NVX H;  4OO1 I;  2LSS A;  3ULJ A;  4KLK A;  5C44 H;  1PH9 A;  4P74 A;  4LFA Q;  3Q8D A;  3CD6 A;  4GKJ Q;  1G29 1;  5M3F H;  1N33 L;  4DR6 L;  4A3B G;  3J81 j;  2RHQ B;  4YY3 L;  1LYL A;  4BBS H;  2D0P A;  3U50 C;  4GLA C;  1IZ6 A;  1EIF A;  2AHO B;  1TWF H;  3PUZ A;  4LFA L;  4Y7N H;  1VQN A;  1OTC A;  5GAH C;  4OX9 L;  3PUX A;  4JI3 Q;  4QQB X;  2N49 A;  1K3R A;  4L5R C;  4LFC Q;  2AWO A;  3RZD H;  5K36 G;  1YHA A;  2AWN A;  1NE3 A;  3CCJ A;  1WYD A;  2JA8 H;  2D62 A;  4PZ6 A;  1NMF A;  4LFC L;  2ZJR A;  2CCZ A;  4GLX A;  3KLW A;  1S3O A;  3S1R H;  3ERS X;  5IYC G;  3W1B A;  1ASY A;  1YJN A;  2HHH Q;  1L2F A;  4OXP A;  1HJP A;  2Q2U A;  2ATW A;  2Z6K A;  2QEX A;  1I50 H;  3I4M G;  2R92 H;  4HJA A;  4IJH A;  3W5O A;  1JJC B;  3A0J A;  1HZB A;  4A3J H;  2JEA I;  2DGY A;  3H3V H;  2HIV A;  4AQY Q;  5BR8 Q;  1Y14 B;  1N36 Q;  1BKB A;  5LMU Q;  3UDF A;  3K7A H;  4BA1 I;  3M9B A;  4GS3 A;  1SR3 A;  1N36 L;  4DV2 Q;  4IOA A;  1L1O C;  4YCV A;  5LMU L;  1IBK Q;  3T1Y L;  2UXB L;  4HIM A;  3F1Z A;  2EXD A;  3JAM i;  3F2D A;  4WJ3 M;  4DV2 L;  3PF5 A;  1L0W A;  1QUQ A;  3PUY A;  3FP9 A;  1QVG A;  2YTY A;  4QY7 A;  3TS0 A;  1PV4 A;  3KJO A;  1XPO A;  3OTO L;  5HGQ A;  1EQQ A; 
#chains in the Genus database with same CATH topology
 3CPF A;  2EE1 A;  4J6H A;  1YBY A;  3TSS A;  3NUC A;  3OHX C;  5EPK A;  1PFS A;  4JC0 A;  3QR8 A;  4WRD A;  1X54 A;  4HJ5 A;  2IY5 B;  3KJP A;  2MUY A;  3QO2 A;  5IP7 H;  2JA7 H;  1K0R A;  5E4X A;  5IY0 A;  1VQA A;  4R9W A;  3NTH A;  5M3M B;  3V05 A;  1JWS D;  3HOV G;  2Q2I A;  1IYU A;  1NTG A;  1PHJ A;  2K4K A;  2K52 A;  3CP0 A;  1K8G A;  2F4V Q;  2KVM A;  1HZA A;  2MPM A;  2O5J C;  1GJX A;  4X3K A;  4JPB W;  5FJ8 G;  1CFM A;  4WFN 3;  5C3E H;  1CT1 D;  1D1I A;  2F3I A;  2G9H D;  4HR7 B;  1JOR A;  1SYF A;  4KHV A;  1G2S A;  2JA5 G;  4ZUI A;  1V43 A;  5E4W C;  1HTL D;  2ZTD A;  2ZM6 L;  2ZT9 C;  3BZC A;  2QCP X;  1HZC A;  2PNH A;  1AP0 A;  3MC0 B;  5J3B A;  4N8X 1;  4NPS A;  3U9S A;  4HTH A;  3K8A A;  2VQE Q;  2I5M X;  3UDG A;  2B63 G;  1B3A A;  2YU9 B;  4PMB A;  1ASZ A;  2F0V A;  4F88 A;  3PO2 H;  3A7A B;  2PQA A;  4C3H H;  1BR9 A;  1KRT A;  2VUM B;  2BA0 A;  2QF7 A;  2I0Q A;  2VW9 A;  4IUU A;  3OSO A;  4GNX A;  2RA4 A;  2K5Q A;  3HOZ H;  5KRU A;  2ZTC A;  2FHT A;  4NXN Q;  2MNA A;  3RLO A;  1C9O A;  4X66 Q;  3QG1 A;  5KND A;  4GKK Q;  4KHP L;  2BOS A;  1WTX A;  3QJY A;  3JC6 6;  3TBI B;  4DUZ L;  3TRZ A;  1VF5 C;  2UXD L;  2QA4 A;  3HP3 A;  3NK9 A;  2KEE A;  2DJF C;  4UP8 A;  5BN4 A;  4JI0 Q;  1B7Y B;  3MVV A;  4B3M L;  1YEZ A;  4P72 A;  1D5Z C;  4HCS A;  2DY7 A;  3PIP A;  2NBF A;  5CR3 A;  2WV6 D;  4KN7 C;  4XIG S;  4MNO A;  1HCZ A;  4DFA A;  3QB3 A;  1A8V A;  1A3V A;  1UE1 A;  3VYU A;  2RCN A;  1UEB A;  3CU7 A;  1ET6 A;  3OWE B;  2HUG A;  3MAQ A;  2CFM A;  2VZA A;  2GVA A;  2F0O A;  1F9Q A;  3DWQ A;  4N8F A;  4A3K G;  4XTC S;  4A3D G;  1MJC A;  4OO1 G;  4B3S Q;  3KBX A;  4RHR A;  2KJX A;  4PV1 C;  2MJ8 A;  2G9D A;  4LF7 L;  3H0G B;  1CQV A;  4IUT A;  3LGJ A;  4DK1 A;  1QWY A;  3SK6 A;  2OF1 A;  3ERO A;  3BJU A;  1XMQ L;  5G3L F;  5JOB A;  5J1Z A;  1SBB B;  4X3T A;  1TR5 A;  4DR1 Q;  3NP8 A;  3GTK B;  2F0D A;  4K14 A;  1OO9 B;  3MXN A;  3KYH C;  2PNR C;  1BBW A;  4OEM B;  3H15 A;  4L5S A;  4DR3 Q;  3NBI A;  3VR3 A;  1BBX C;  5IWA Q;  1K8M A;  4DV1 L;  2XRQ D;  2BDN A;  4DR5 Q;  4A3L H;  4CDE C;  3KF6 A;  1VQ7 A;  1O7Y A;  3BDL A;  2VY3 A;  3CME A;  5M3F G;  3V2T A;  4JI2 L;  1XWE A;  4K6D A;  2K32 A;  2WB1 E;  1MJE A;  3L3O C;  4TVA B;  5CBA E;  4NXM Q;  1Q81 C;  3JAM E;  2E74 C;  3SGI A;  4KHZ A;  1Y8N B;  1F2L A;  5HY6 A;  1NR2 A;  2GA4 B;  2E8G A;  3ICE A;  3URY A;  2E2I B;  4HIO A;  2KED A;  3G4S A;  2YU9 H;  1EYD A;  4LMQ D;  4H7B A;  1XMO Q;  1XNQ L;  1BCP B;  3M4Y A;  1PVO A;  2ZXR A;  1BUV T;  4NMZ A;  1S5F D;  1PDQ A;  2VUM H;  2RCF A;  5I4D A;  4BXX G;  1Q90 A;  3BVG A;  3I4M H;  1M8A A;  2UUC L;  1HA6 A;  5C4X G;  1PMR A;  3SHL A;  2A8V A;  1P8L A;  1KQS A;  4LFB L;  1SNM A;  5C0X I;  1SE3 A;  3S15 B;  3GTJ B;  1H95 A;  2R61 A;  4TRD A;  2F52 A;  2YYZ A;  2K7V A;  1MBY A;  1TWA B;  5LHY 1;  1FJG L;  2NUC A;  1YNN C;  3QOJ A;  3HGB A;  2YTV A;  4K2K A;  1JJG A;  2TMP A;  1JE5 A;  1ENA A;  4RHS A;  3G6J B;  1FNW A;  2WIN B;  4B3T Q;  4A3F G;  4ME3 A;  1F9S A;  5LMN L;  4AIM A;  1YHQ A;  4G7H C;  1SAP A;  4HMJ A;  1EY8 A;  3KDF A;  1WVL A;  1UNS A;  1EQR A;  1N8R C;  4LF6 Q;  1S40 A;  5C3E G;  2ZJQ A;  4A3C H;  2FMC A;  1E7Z A;  4RA8 A;  1NAP A;  2UUB Q;  2AQ3 B;  2QDB A;  3HOY G;  2Q8I B;  3HOV B;  2NVX B;  1QCB D;  5JEA J;  2A19 A;  1B1Z A;  2EIF A;  1MHW C;  2DN8 A;  1KIX A;  2QKI C;  5EKL A;  1VQI A;  1XPR A;  4JI3 L;  4CJ1 B;  3AFQ A;  4HIK A;  1EOT A;  4EQN A;  2BH8 A;  1AE2 A;  5DNF A;  3CCU A;  4EQP A;  3GTK H;  3PO2 G;  2LS0 1;  4KJN A;  2HDL A;  2E75 C;  4C3H G;  4QJF A;  5IYD H;  2F0M A;  2JA5 B;  1STY A;  1EWI A;  3GDE A;  1K8O A;  2B2V C;  3OMG A;  4WJ4 A;  1DJR D;  2EY1 A;  4FVM A;  5C4J B;  3HOZ G;  3TQY A;  3UDI A;  3BZD B;  3HKZ G;  4JW0 A;  2B63 B;  5C5M A;  3IFT A;  3IAY A;  3RLF A;  3DM3 A;  3HRZ C;  4LF8 L;  1E2Z A;  4IO9 A;  2K1B A;  1HUM A;  3WDN A;  2RDG A;  5IIF A;  1VQD A;  3JAM c;  4RGO S;  5C0X H;  1JCK B;  4A4I A;  4LF9 Q;  2F0S A;  2E2I H;  1LT3 D;  3L7Z C;  4HSP A;  2AUJ D;  4O42 A;  3VYR A;  3FHW A;  3CCM A;  2RDF A;  2K5W A;  1STN A;  2PZT A;  1QNU A;  4HJ9 A;  4CGY B;  4ZLT F;  1ZKO A;  1I4G A;  3J7A F;  2F0P A;  1VQB A;  4MIU A;  1F2Y A;  4DK6 C;  4DUY Q;  4NB3 A;  3I4N B;  1FR3 A;  3HG9 A;  2D9U A;  4RAU C;  2AQ2 B;  3S15 H;  3GTJ H;  3MXP A;  4EX5 A;  5COY A;  3CCV A;  4YCU A;  4A75 A;  4IUP A;  3A8K E;  1VQF A;  2UXC Q;  1SNP A;  3AFP A;  4XT3 B;  2MFI A;  4RG1 A;  2IJ0 A;  1T9H A;  4IAL A;  1G2T A;  1Q82 C;  3NWT A;  1O7I A;  5I6W A;  3T1H Q;  4BY7 G;  1CSQ A;  1RDP D;  1TQO A;  1ROD A;  4QCL A;  2HIX A;  4ILW A;  4A3L G;  1ONL A;  2RDH A;  5C3W A;  4A3M B;  4JI7 L;  1A3U A;  1YIJ A;  3MXU A;  3T16 A;  3OWF A;  5FLM H;  1SE4 A;  3UE1 A;  4PZ8 A;  1Z9F A;  3J7Y W;  1TKW B;  4ZK9 B;  1LT5 D;  4HJ8 A;  3K0Y A;  3D8G A;  1C48 A;  2NVX H;  4OO1 I;  1KNE A;  2LSS A;  4KLK A;  4N9T A;  3ULJ A;  5C44 H;  1PH9 A;  3Q8D A;  3L9A X;  3J81 j;  1SND A;  1SYG A;  2D0P A;  3U50 C;  4GLA C;  1IZ6 A;  2K28 A;  4Y7N H;  3MFY A;  2NZ1 D;  1Y8P B;  2KQ3 A;  4LFC Q;  1TWG B;  2F3W A;  3KK7 A;  3FPU B;  3RZD H;  1KNA A;  1WYD A;  2B2Y A;  2D62 A;  4OIK A;  1U4P A;  3R2I A;  3W1B A;  1YJN A;  2HHH Q;  1L2F A;  4S3S A;  2Q2U A;  2QEX A;  3I4M G;  1QIL A;  3E6Z X;  3A0J A;  4A3J H;  2JEA I;  2NVQ B;  1E2W A;  4MTK A;  1XYI A;  4AQY Q;  4CBV A;  1Y14 B;  4KY6 A;  5LMU Q;  1JR0 D;  4ZRZ A;  4BA1 I;  5E3F A;  3M9B A;  4F8M A;  5IGE A;  3C2P A;  2B2V A;  2EXD A;  3F1Z A;  3JAM i;  3PF5 A;  1L0W A;  3PUY A;  2K5D A;  3KJO A;  1XPO A;  4K8J A;  2NVT B;  5HGQ A;  2KCC A;  1YI2 A;  1LUZ A;  5C4X B;  1KAA A;  4KMU C;  4LUV A;  1SJH D;  3IL8 A;  4CDF C;  1JJ2 A;  2WP8 J;  2EJF C;  4MTN A;  1EQV A;  5JJI A;  1PLF A;  1PZK D;  2L15 A;  1JOO A;  4A3G H;  2WKD A;  1Q7Y C;  1BF4 A;  1D2B A;  1FNU A;  1PH1 A;  2PZW A;  2A68 D;  3U9O A;  1N32 Q;  1QZH A;  2PPB C;  1AZQ A;  2A74 C;  4KI0 A;  1VQJ A;  5IT9 c;  1PTO B;  1UE6 A;  3I4N H;  1M1K C;  4ZUJ A;  3H6M A;  4A3F B;  1LAB A;  1EIH A;  1BOS A;  3IFD A;  3CC2 A;  1B9N A;  1LLR D;  1IL2 A;  3NE5 B;  3NSW A;  2AKW B;  3FKI B;  3A7L A;  4DXF A;  4JYA Q;  1K3B C;  4NXM L;  3HOU H;  5C3E B;  1GHJ A;  2QIL A;  4Y52 H;  3SEB A;  1VQG A;  4EQ5 A;  1ML0 D;  5IYD G;  2RKS A;  1AE3 A;  3HOY B;  1IXR A;  2OQ0 A;  1EEI D;  3ONA B;  1NUC A;  1IW7 D;  1XMO L;  4H02 A;  4IPG A;  4A3M H;  4DR7 Q;  4GNX C;  2X69 A;  4I65 A;  3TRE A;  1YJW A;  1D5X C;  1R4P B;  1IHZ A;  2MO0 A;  3K7U C;  3MTS A;  3PO2 B;  4DK3 C;  4IZ8 A;  3S2D B;  4DNT B;  2SDF A;  4DV6 L;  4JI4 Q;  4C3H B;  4LUZ A;  2J4X A;  3PF4 A;  2WFW A;  5JJL A;  2B29 A;  3M4O B;  5JEA G;  4K5W A;  1J5E L;  4B9X A;  3CCE A;  2FJ2 A;  4X62 Q;  1JT8 A;  2XN9 C;  1SE8 A;  3HKZ B;  1LTS D;  1EY7 A;  2PQE A;  4OX9 Q;  4DV0 Q;  2Q2T A;  1TWG H;  1KDB A;  1TY2 A;  3D31 A;  2L9H A;  2J0T D;  4R1J A;  2UUA L;  3I70 A;  2B2T C;  2F3V A;  2C5C A;  3HEJ A;  1RJT A;  4RGM A;  3RR5 A;  2JP1 A;  4M8A A;  3DXJ C;  4LK1 C;  1B2T A;  3DHQ A;  2NVQ H;  4LF6 L;  4XYO A;  1T5E A;  3E9H A;  2OTJ A;  2KBN A;  2L5T A;  4IUR A;  4DGZ A;  2OQK A;  5CBE E;  2E2J B;  3J81 L;  2EYP A;  2QGQ A;  1KC8 C;  1GOZ A;  4IPC A;  2ALY B;  2OCE A;  5JJZ A;  5CV4 A;  1SN8 A;  2HCI A;  2F0W A;  1EFI D;  2UXB Q;  4UP7 A;  3C1E A;  4P71 A;  2KUM A;  3QIA A;  4JBM A;  2NVT H;  4BXX H;  3OTO Q;  1RKN A;  5C4X H;  2I5H A;  1STA A;  2MP1 A;  5T1G A;  4JI1 L;  2L11 A;  3L0O A;  1SRU A;  2MQH A;  5DM6 3;  2Q8T A;  1X3F A;  2HQL A;  1L1O B;  4RCO A;  4DV5 L;  2RHS B;  5FLM G;  3G71 A;  1EWH A;  1KRS A;  1IKM A;  2Z0S A;  3MFG A;  1EY4 A;  1EOV A;  5EQ0 A;  4YHH Q;  4JOI A;  2F0L A;  5CGK A;  2JQO A;  4X64 Q;  1PTO H;  5GAE C;  1VF7 A;  5C44 G;  4A3F H;  2EY6 A;  4BY7 B;  2E5L L;  1W6K A;  1I5F A;  1GUW A;  3D0F A;  4IPD A;  3EFX D;  3FKI H;  4ODG A;  4X6A H;  3PIO 3;  3M4Q A;  2VQF L;  2PYK A;  2N8N A;  3NQT A;  1QZG A;  1D7Q A;  3S2H B;  3EBE A;  1K8A C;  4DAV A;  1QOH A;  3NEN A;  1JWM D;  5EBC A;  3W1G A;  2KHJ A;  4O1N A;  3HOY H;  1A6X A;  1WFQ A;  4J15 A;  5ELN A;  5C3X A;  4DR4 Q;  5FO7 B;  3FVQ A;  4A3J G;  2ZJP A;  3K57 A;  1H9K A;  3ERQ A;  5K36 H;  4GLV B;  1M4V A;  4DR2 Q;  4POF A;  2A6E C;  3X3N A;  4JV5 L;  4RMF A;  5IYC H;  1D8L A;  5FOB B;  3S2D H;  4QF4 A;  1B3Q A;  4DUY L;  2UU9 L;  4A3I B;  1BCP D;  2PI2 E;  1NSN S;  1SMY C;  2K03 A;  3R8B A;  4JI8 Q;  2GN5 A;  3M4O H;  1H9R A;  1HNX Q;  2KA7 A;  3I4M B;  3WWV A;  3M85 A;  3U4V A;  1HNZ Q;  4FF2 A;  1HR0 W;  4B9W A;  4POG A;  3K5L A;  1CZW A;  1KL9 A;  1SFO H;  1LT6 D;  4LUO A;  5G3L D;  3A8J E;  3T1H L;  1VMC A;  1CKN B;  4A3G G;  4P75 A;  1DOL A;  3NWS A;  3G7L A;  4KKS A;  1I4X A;  4NW2 A;  3SK8 A;  3J7A V;  5KGU A;  3PCO B;  3I4N G;  2R93 G;  4UHV A;  2PI2 A;  1ICW A;  2E2J H;  4C3J B;  3TN2 A;  1Y1V B;  3D6C A;  1BCP F;  2PMZ B;  1U4R A;  5IGB A;  2B2T A;  1SNC A;  3HOU G;  3DUZ A;  3UDX A;  1VQK A;  4JI6 L;  3I55 A;  5GAG C;  2E2H H;  4QUC A;  5FLX L;  2K33 A;  3HKS A;  1HFG A;  3RN5 A;  3CW2 C;  5D14 A;  2V4D A;  4WJW A;  2N3S A;  2C35 B;  4CKB A;  3RMH A;  4LF5 L;  4A3M G;  3KF8 A;  1I94 L;  2Z4I A;  5D65 A;  4DV3 Q;  4JCV E;  4QGU A;  1X6O A;  2HHH L;  4IPH A;  5LMN W;  1WTQ A;  3F2C A;  4JI5 L;  1W2B A;  1X32 A;  4AYB B;  4AQY L;  1MIU A;  5ELO A;  4DV7 Q;  5JPN C;  4GOP B;  3S1Q H;  4RKL A;  4BY7 H;  3DWP A;  1EYG A;  5DEH A;  4OEL B;  3I56 A;  3HOX G;  2IHE A;  1R4Q B;  3F8T A;  2A68 C;  1IBM Q;  4M1U B;  1CA5 A;  4LWC A;  4OWX B;  5E7N A;  4U67 3;  1GKH A;  1SSO A;  1QVC A;  5K5P A;  4L8J A;  3M7N A;  1C7Y A;  4QB4 A;  2XNA C;  4KV6 A;  3S2H H;  2EQS A;  4ABN A;  4G57 A;  4PQX A;  1F9P A;  2IHF A;  4CKE A;  3CCL A;  1XJV A;  1U4L A;  3I90 A;  5AJ3 L;  4FYD A;  4L5T A;  4XYQ A;  2KOL A;  1NY4 A;  1XTC D;  1PFN A;  2OEO A;  1EEF D;  3C3L A;  2H5X A;  2B39 A;  4PNY A;  2IX3 A;  1RL2 A;  1IW7 C;  1S4Z A;  3KLS X;  2JEB I;  1W6J A;  3RD4 A;  1R9T H;  1SNO A;  1OXX K;  5I2Y A;  3PSI A;  1LM0 A;  4A3I H;  3S14 H;  1B8A A;  4FNF A;  3BYT B;  1GUG A;  1EYC A;  4C1N K;  2RSN A;  2RF4 A;  2EDG A;  3DEP A;  5FK9 C;  1DGS A;  2NN6 H;  4JYA L;  3E0E A;  3K6O A;  1LTB D;  3HKZ E;  2E2D C;  5I6Y A;  5BN5 A;  4YWM A;  5DLQ E;  4DV4 L;  5D3D A;  1ICF B;  1HTP A;  3H94 A;  1WTV A;  4X65 Q;  4OHJ A;  3R93 A;  4LF4 L;  3S1N B;  1EY5 A;  1A15 A;  1T5X D;  2R7F A;  2K5N A;  3FDT A;  3ZYY X;  5M5W B;  4LNQ A;  1NJI C;  1OXV A;  1X9N A;  4C3J H;  5JPM C;  1MGS A;  1ENF A;  1Y1V H;  4DU9 A;  1TS4 A;  4JI4 L;  3FKI G;  3GD7 A;  4B3R Q;  1ZXT A;  3A5Z B;  4UY8 C;  3I3C A;  1J8I A;  4DR6 Q;  1YVC A;  1N33 Q;  2CVR A;  3NEL A;  4H13 C;  5IGC A;  1PRT B;  4K2L A;  1STH A;  1I4P A;  2EYF A;  1SEB D;  3CD6 A;  4RGT A;  2ENB A;  2B2Y C;  4LFA L;  2AHO B;  1TWF H;  5C44 B;  4DK0 A;  4OX9 L;  3PUX A;  4XDX A;  4QQB X;  2H4O A;  4L5R C;  4FP5 D;  4RWS C;  5K36 G;  1FYC A;  3MHB A;  2JA8 H;  4Y7N B;  1NMF A;  4KN4 C;  4GLX A;  2F03 A;  5IYC G;  3RZD B;  2R7Z B;  4OXP A;  4QMG A;  2ATW A;  2F0J A;  1O78 A;  4IJH A;  3W5O A;  3T56 B;  3H3V H;  2DGY A;  4QIW B;  2PCF B;  4CJ2 C;  4IN3 A;  1BKB A;  5CV6 A;  1WTR A;  3UDF A;  3K7A H;  4A3J B;  1SR3 A;  1N36 L;  3VYT A;  2HDM A;  4KKT A;  2UXB L;  4HIM A;  1FNV A;  4WJ3 M;  4DV2 L;  1C4Q A;  1QVG A;  1AEX A;  2IPK D;  3TS0 A;  2L55 A;  1E2V A;  3CRL C;  3OTO L;  1EQQ A;  1RHP A;  1FVI A;  2EYM A;  1ESR A;  2A69 C;  1KAW A;  2KEC A;  5JEA H;  5CMD A;  2ZXP A;  1XNR Q;  1SDF A;  1VQM A;  1TVX A;  4C3I G;  3J80 L;  4YWL A;  4DNI A;  1B50 A;  4JVZ A;  2B3G A;  3N52 A;  2O2L D;  4WOR A;  2F0H A;  3BS1 A;  2Y0S G;  4X64 L;  1B9M A;  3CAM A;  4BBS G;  3RZO B;  4A3G B;  2WAQ G;  1RD9 D;  3DMU A;  3SE0 A;  3I7F A;  3GTQ B;  2F4V L;  2JYO A;  1BCP C;  2R93 B;  3X3M A;  1VQO A;  1Z7T A;  5LL6 X;  2IL8 A;  1D6E C;  1FGU A;  3A54 A;  3ITP A;  4HCE A;  5L37 A;  1TII D;  3S24 A;  3CHB D;  4X3U A;  3RUZ A;  2R92 G;  2KCM A;  4F7X A;  2EYL A;  3HOU B;  3BDC A;  1EZ8 A;  4F87 A;  4ID6 A;  4YIJ A;  3WOF A;  3FEW X;  2VQE L;  1E1T A;  2DNC A;  3S1N H;  1XXG A;  1MD2 D;  1KXL A;  1I4Q A;  1J6Q A;  4HID A;  1QG7 A;  4DR2 L;  3CCQ A;  2LXK A;  2YTX A;  3CXC A;  2A6E D;  5M5W H;  4BBR H;  5GAD C;  5H1S E;  3DWA A;  1HNW Q;  3HS0 C;  1DZ1 A;  4DKA C;  1LTA D;  1NBW A;  3A74 A;  5T1I A;  5EGT A;  1GHK A;  1RCV D;  3T4A C;  4ZAI A;  1SMY D;  4NP5 A;  1PH4 A;  2DY8 A;  2Z9H A;  1O7L A;  4KHP Q;  1HNX L;  3OIQ A;  1A0I A;  1VS0 A;  4DUZ Q;  2QEJ C;  1GUS A;  1WD0 A;  5JVH 3;  1PTO F;  4NXN L;  1LTL A;  3TS2 A;  3TZD A;  4YY3 Q;  4X66 L;  4B3M Q;  4GN4 B;  1CKN A;  3K5M A;  3HOX B;  4GKK L;  5NUC A;  2F0F A;  3MZ5 A;  3TEH B;  2PW5 A;  1IYJ B;  4IFD J;  1G8Z D;  4LW1 A;  2PO4 A;  5KYL A;  4EGV A;  4JI0 L;  2JSO A;  1CI3 M;  4JBK A;  2SOB A;  2R7Z H;  3EIV A;  4C1N I;  2ES2 A;  1I3Q B;  1CA6 A;  2ZXO A;  4A3I G;  3O13 A;  3TP8 A;  1SJE D;  4TSS A;  1OXU A;  4GN3 B;  4DAM A;  1L0Y B;  4EVO A;  1KDA A;  1UEA B;  1VCI A;  2NN6 G;  3PIO A;  1HH2 P;  3Q6S A;  1CKO A;  3LWE A;  1ILQ A;  2XTI A;  4L6T B;  3ND8 A;  1PH6 A;  1FD7 D;  3PUW A;  4H44 C;  3SR1 A;  3T1Y Q;  1HRJ A;  2FFK B;  3MA2 B;  4B3S L;  1YNJ C;  4R8N A;  4R4O A;  1EIG A;  1X55 A;  1VQ9 A;  2K05 A;  2EZV A;  1QUQ B;  2HQE A;  2JA6 G;  1VQL A;  5C5L A;  5M5X H;  3H09 A;  1Q86 C;  4JOI C;  4DR1 L;  2CW0 C;  2F1M A;  4IFD H;  3RN2 A;  4C3J G;  1WTO A;  1SMX A;  1Y1V G;  2J7Z A;  4DA2 A;  1PH3 A;  1A63 A;  1EYA A;  2F0E A;  2QDL A;  1FL0 A;  1PFB A;  2EYO A;  2RVL A;  1Y1W G;  4BWG B;  1YZ6 A;  4DR3 L;  4JI2 Q;  3RZO H;  3VR5 A;  4PMW A;  5IWA L;  5IYB H;  3KF6 B;  4FO2 A;  1SYC A;  4DR5 L;  2L1B A;  4BY1 G;  3HOW H;  3GTQ H;  3M7G A;  3G48 A;  1HR0 Q;  1STG A;  1K73 C;  3CC4 A;  1X3G A;  3WOE A;  4C56 C;  3MWY W;  2R93 H;  1CTM A;  4L63 B;  3UE0 A;  5JAV A;  3GTM B;  5ISR A;  2OTL A;  1HQM C;  1ZYR D;  2JA8 G;  1Z6H A;  1PA6 A;  4IUQ A;  2EY5 A;  4A3B H;  2EYH A;  5KNC A;  1XNQ Q;  4MZ9 A;  1JB3 A;  1LO5 D;  1E0B A;  4A93 B;  4AYB G;  1JE4 A;  1TS3 A;  5FLX E;  1I6H B;  1YHB A;  1VQP A;  1H9S B;  5M5Y B;  2UUC Q;  1EUJ A;  2I07 B;  4QL5 A;  1KHI A;  3EJI A;  4XT1 B;  2NTT A;  4LFB Q;  4YCW A;  4V0B A;  1UWV A;  1WI5 A;  2KCT A;  2WB1 B;  3A8I E;  3T53 B;  5KEE A;  3SK4 A;  1XTD A;  1UUP A;  1FJG Q;  1GVP A;  3PUV A;  1I4H A;  3GTL H;  1H9M A;  1VMP A;  3I4L A;  1TY0 A;  4B08 A;  2JK8 A;  5JVG 3;  3QWN A;  3SXH A;  1WTH A;  3HOX H;  1JB7 A;  2PW7 A;  1PYS B;  5C4H A;  1BNZ A;  1CQF A;  2NB0 A;  3DLL A;  5LMN Q;  4XQN A;  4HMI A;  3C1F A;  1IL8 A;  5IOD A;  1IBL Q;  4RGN A;  3D3R A;  1SFO B;  1VQC A;  1EWC A;  1I3Q H;  1W3S A;  3AB9 A;  3K81 C;  3OYY A;  5JJK A;  2M2L A;  4B3T L;  4Z9C B;  4OIJ A;  4K5X A;  3VYS A;  1YIT A;  3NBH B;  4QIW E;  2K01 A;  1Y69 U;  3W3A A;  4IOC A;  4RFB A;  2ICI A;  4B3R L;  4IUV A;  5HUR A;  4C3I B;  5GQO A;  3CRK C;  1TS2 A;  5IT9 L;  5IGD A;  3J7A 5;  4G7O C;  2UUB L;  3CF5 A;  5DAU A;  1YNX A;  2Y0S B;  1SNQ A;  2L12 A;  3GP7 A;  4BBS B;  1X3Q A;  2XWJ B;  2Z8L A;  2WAQ B;  2E2H B;  1PZI D;  4A3E H;  4K6L A;  2G5D A;  2JJQ A;  1AZP A;  1WCM H;  1CKM A;  3BDO A;  4BBR G;  1Q12 A;  3NXW A;  5GRO A;  3IRB A;  5HGT A;  1VQ8 A;  1BXT A;  1I50 B;  3I8Z A;  5J39 A;  2R92 B;  3A5U A;  1BDO A;  1ESF A;  1SLJ A;  2VL6 A;  4ZYS A;  2EVB A;  1TT2 A;  1GO3 E;  4LF8 Q;  4FXK C;  1RF2 D;  3L2P A;  5FKA C;  3F2U A;  5EKK A;  4DF7 A;  1B4O A;  3S1Q B;  4U68 A;  1MKH A;  1E24 A;  2BA1 A;  3ER0 A;  3S17 H;  3K5N A;  3GO5 A;  3GTM H;  1LTG D;  2SEB D;  4DXG A;  2JN4 A;  4UPA A;  4YWK A;  5C4Z A;  1V1P B;  3J81 i;  3CQZ B;  2A69 D;  1X56 A;  3ND9 A;  4KD4 A;  2R7Z G;  1PTO C;  4IJL A;  1G6Z A;  2F0T A;  5A2Q L;  1XNR L;  2EJG C;  2XSC A;  4LF9 L;  2FXQ A;  4A93 H;  3G6E A;  2MO1 A;  1P16 A;  2I5L X;  3S9W A;  4PZ7 A;  1I6H H;  2HD3 A;  1HQR D;  1LTT D;  3B6Y A;  4UDU C;  2DNE A;  5M5Y H;  4ZQ3 A;  4ZCK A;  1JMC A;  2A1A A;  4L5Q A;  5FLX c;  2NVY H;  3T51 B;  2ZTE A;  2KHI A;  3RNU A;  4R4Q A;  4JK1 C;  2EOT A;  1R9T B;  3TZU A;  1Q8K A;  1K83 B;  3S14 B;  5KYI A;  2CWP A;  2K04 A;  2F0K A;  4PMC A;  5CYU A;  2HCC A;  5IP9 H;  2A6H C;  5E1F A;  3STB C;  1U9R A;  3FPP A;  4QUF A;  4V19 0;  2B8G A;  2JXM B;  2VNU D;  4IFD G;  4K0K Q;  5TSS A;  1F77 A;  2UXC L;  4ZKC B;  4FXG C;  1VQ4 A;  3CKI B;  4JI7 Q;  1OXT A;  3OIP A;  4PG3 A;  1ZEQ X;  4KTA A;  1KD1 C;  2R3Z A;  5CV8 A;  1U5K A;  5IYB G;  5COR A;  1V9P A;  3U58 A;  5D3I B;  1HHV A;  1HNW L;  2IX1 A;  3HOW G;  1AW7 A;  3H91 A;  1J9O A;  2JA6 B;  4H0L C;  1ENC A;  4P73 A;  4HED A;  5FO8 B;  4C3I H;  1D5M C;  2R6G A;  4JBW A;  3AYH B;  1PH2 A;  2NN6 I;  2Q2H A;  2NTS A;  3I91 A;  1LV9 A;  1Y1W B;  3J80 E;  4GKJ Q;  4HAE A;  4A3B G;  2SNS A;  3KUP A;  3IKJ A;  4YY3 L;  4KK7 A;  1DXM A;  4BBS H;  3PO3 B;  1VQN A;  3P1H A;  1GUO A;  2BE5 C;  3OW7 A;  1TWC B;  5GAH C;  1WTW A;  1OTC A;  4BY1 B;  3NTI A;  1C8C A;  4KJO A;  1PRT D;  1YHA A;  1NE3 A;  1F9R A;  1IKL A;  1TWF B;  1HFN A;  1UAP A;  2EPB A;  4PZ6 A;  4LFC L;  3BVM A;  1A2T A;  1D1K A;  5IGF A;  4R8I A;  3S1R H;  1TS5 A;  1CK1 A;  3MEH A;  1HJP A;  2JA8 B;  4J1M A;  1I50 H;  3KBG A;  2R92 H;  1NNX A;  3GQB A;  3LNN A;  1JJC B;  1HZB A;  2BDO A;  4Q0F A;  2HIV A;  3EA6 A;  2VB2 X;  5BR8 Q;  5KNB A;  2D5D A;  2K6A A;  4K5V A;  2F0N A;  2B2W A;  2CH4 A;  3C46 A;  1PFM A;  3P7J A;  4IOA A;  1L1O C;  1IBK Q;  5LMU L;  3T1Y L;  3UI2 A;  3K7A B;  3F2D A;  3GTP B;  2LMC B;  4DN4 M;  3LX0 A;  1QUQ A;  3FP9 A;  5CV9 A;  1YNJ D;  4QY7 A;  4RH6 A;  3CQZ H;  1A3T A;  5DM7 3;  2Z6B A;  1PRT F;  4A76 A;  4CJ0 B;  1ZYR C;  1Q46 A;  5M3M H;  2F4I A;  1EIY B;  2CW0 D;  4EQO A;  2OWO A;  2RSO A;  1NR4 A;  3QOL A;  3H3V I;  4ZKB B;  1K0S A;  2PZU A;  1QB5 D;  3LWU A;  3S16 B;  2CWA A;  3VR2 A;  2JA9 A;  1GUN A;  3BZK A;  5EKI A;  3NQI A;  5ELC A;  1X3P A;  3PV0 A;  3BYY B;  1N9W A;  3TDQ A;  1N32 L;  2C9O A;  3E9I A;  1HR0 L;  1L0X B;  4HJ7 A;  1SYB A;  4UP9 A;  1K83 H;  1YJ9 A;  1CSP A;  4KY5 A;  3FRP B;  2M00 A;  3A56 A;  2AMC B;  4A3E G;  1WCM G;  1QJO A;  1BO0 A;  1NCV A;  1A62 A;  4GN5 A;  2NYZ D;  2F0G A;  3OPO A;  1WOC A;  1N34 Q;  1H9S A;  3Q0A A;  1E22 A;  1F2M A;  5EPL A;  2CH4 W;  1KLU D;  2A5H A;  4JG2 A;  4KD3 A;  4DV6 Q;  3GTG B;  4DR7 L;  4BA2 I;  2JA6 H;  1S5E D;  2IWH A;  4BBR B;  1K28 A;  4E6I A;  3ULL A;  1VDZ A;  2F0I A;  3W2D A;  1J5E Q;  4OWW B;  1S72 A;  1QVF A;  3GTO B;  1B70 B;  4C2M B;  4MHE A;  4DAY B;  1Y1W H;  2AUK A;  2WAC A;  1TXY A;  3HFZ B;  5IP7 G;  2Y0S E;  2JA7 G;  3TP7 A;  3J80 c;  1X65 A;  3PO3 H;  3D4W A;  2WAQ E;  2VS1 A;  3GV3 A;  3CMA A;  1TWC H;  1Y8O B;  4BY1 H;  1JIC A;  2UUA Q;  4A93 G;  5EAY A;  4ULL A;  4X62 L;  4N9P A;  3KLS A;  3DM1 A;  2P5Z X;  1CZG A;  2B8F A;  1TU2 B;  2MGS A;  4P2C B;  4DV0 L;  2XGT A;  1IBL L;  4FF1 A;  1BBU A;  5ELD A;  3NBH A;  1XPU A;  1RTN A;  3I4O A;  3NTK A;  3RLN A;  4BS9 A;  1GM5 A;  2D0O A;  1BVS A;  1S5B D;  3BVZ A;  5I2X A;  4CDC C;  2WB1 G;  4OWT B;  2VB3 X;  1DD2 A;  2EJM A;  3J7Z C;  4I7A A;  2XIW A;  2LY7 A;  3VA5 A;  1IYV A;  3U4Z A;  1G91 A;  1CUK A;  3H0G H;  3CPW A;  3AEV A;  1VQE A;  5IP9 G;  2K75 A;  2LKV A;  1TWH B;  1E3P A;  4CHT B;  4DAP A;  4R4I A;  2A73 B;  2DJG C;  5C0X J;  1UE7 A;  1G51 A;  1MI2 A;  5CV7 A;  3GTP H;  3SK5 A;  2FIN B;  3CCS A;  3P20 A;  1RTO A;  4JBJ A;  4FF4 A;  1VQ5 A;  1EY6 A;  4JI1 Q;  3S1M B;  5IOC A;  3AU7 A;  3H3V C;  3SVM A;  4GOP C;  2BCO A;  3I73 A;  4DV5 Q;  2XRS D;  1L1O A;  3KOJ A;  1KDC A;  3CC7 A;  5M5X B;  3KLR A;  5FO9 B;  3TP6 A;  3CCR A;  1UE5 A;  1DCZ A;  3S16 H;  3PIP 3;  4APV A;  3E5S A;  1PYW D;  2E5L Q;  1EU4 A;  2X6G A;  2IX0 A;  1GUT A;  4OON A;  4YHH L;  2CQO A;  4G4K A;  5EPJ A;  5IGG A;  3GV6 A;  4DPG A;  3Q22 A;  1SYE A;  2V1C C;  2VQF Q;  1V1Q A;  5M9O A;  1SYD A;  1V1P A;  1Q1E A;  3HOW B;  3NPP A;  4XQQ A;  2ZM6 Q;  1DYQ A;  2OT2 A;  2CKZ B;  1CHQ D;  2F0U A;  3I2Z A;  1PTO D;  1WD1 A;  4IFD I;  4FXD A;  1E1O A;  3J81 E;  4A3B B;  3PMF A;  4JV5 Q;  5IT9 E;  4CKC A;  4DR4 L;  1VQH A;  3GTG H;  2UU9 Q;  3D4R A;  3F2B A;  1STB A;  2K50 A;  5LL6 S;  2PQA B;  4XQJ A;  2GVB A;  2BH2 A;  3A55 A;  1PH8 A;  4TQU S;  1TWA H;  3GTO H;  1HA5 A;  3J80 i;  2PMZ E;  4C2M H;  2H1E A;  2WKC A;  1KTK A;  1HUN A;  4A3K B;  2X6L A;  3AQQ A;  4GNX B;  3AMU A;  4A3D B;  4JI8 L;  2A6H D;  3BU2 A;  3M3Y B;  4IUN A;  3STB D;  1EU3 A;  1KAB A;  3GTL B;  2LXJ A;  5M3M G;  3Q23 A;  1Q3L A;  1V1O A;  2UXD Q;  2K5V A;  1HNZ L;  4K0K L;  5AFW A;  4GZY C;  3PGZ A;  2KEN A;  2KCN A;  1HZ9 A;  2VXW A;  2ID0 A;  1Q8I A;  2B2U C;  4OL7 A;  2RBM A;  2ASB A;  2HT1 A;  2M9V A;  4ME5 A;  1PRT C;  2K14 A;  4DNR B;  2Q8R E;  3JAM L;  1CM9 A;  1DON A;  1B44 D;  1MSH A;  4LJZ C;  4K8I A;  3ZJY C;  2E76 C;  3K80 C;  3OW2 A;  1SXT A;  3HOV H;  1U0L A;  4AYB E;  1JQY D;  4JI6 Q;  4R4T A;  5A2Q E;  1TWH H;  2YV5 A;  5A35 A;  3MEF A;  4LF7 Q;  2TSS A;  4GKJ L;  1DOM A;  3P75 A;  5M3F B;  3MXG A;  5FJ8 H;  1WJJ A;  3VDY A;  1XMQ Q;  2Z6K C;  2IT1 A;  3BG3 A;  4LF5 Q;  3S1M H;  1I94 Q;  2RQX A;  1JOQ A;  3SDZ A;  2BE5 D;  2ICE C;  1A2U A;  5C6A A;  1OXS C;  1U4M A;  3R3O A;  3M4P A;  2JA5 H;  5F2D A;  2VUM G;  1S5D D;  3KF8 B;  2OXP A;  4RCN A;  4A3E B;  1FGB D;  2AQ1 B;  1WCM B;  2O4X A;  2R7D A;  5C4J H;  2I46 A;  4NKL A;  4JI5 Q;  4J8Q A;  4DV3 L;  1X3E A;  2B63 H;  1Z47 A;  3MXN B;  3N6R A;  4DV1 Q;  1AH9 A;  3T13 A;  2MHV A;  2Z4H A;  3DEO A;  4GOP A;  1SRO A;  5IE8 A;  5BR8 L;  5BN3 A;  3D4D A;  3K0X A;  1KLG D;  3EN2 A;  1EQT A;  5KIX A;  1ET9 A;  4RKB A;  5CC4 A;  4I7Z C;  1PYB A;  4DV7 L;  3PO3 G;  1IBK L;  4CDD C;  2XVS A;  4HN7 A;  1IBM L;  1JWU D;  3V96 A;  2IW3 A;  1C0A A;  3VR4 A;  1AN8 A;  4G7Z C;  5AJ3 Q;  3OOC A;  3S17 B;  2Z1C A;  4HSV A;  3OMC A;  2LFN A;  4FF3 A;  4R4C A;  2DUD A;  1G6P A;  2N78 A;  2EY2 A;  4FDB A;  1EFW A;  5I9O A;  4A3C G;  1PH5 A;  1XX8 A;  1GD7 A;  2CHB D;  3PQI A;  1F2Z A;  1M90 C;  2JA7 B;  1S5C D;  1K9M C;  3NEM A;  5J22 A;  3J81 c;  3E0J A;  3K59 A;  3VR6 A;  1JC7 A;  2K5H A;  2KHS A;  5ELE A;  3H0G G;  2JE6 I;  4UAI A;  1GXD C;  1DOK A;  3TME A;  3TP5 A;  2EYJ A;  4X3S A;  3K58 A;  1EZ6 A;  1PZJ D;  1LTR D;  4O2D A;  1LTI D;  2N55 A;  2N88 A;  1VQ6 A;  1HPC A;  1O7Z A;  2FMM A;  5EJW A;  3ULP A;  1RIP A;  2NVY B;  2QW7 A;  1PH7 A;  3VA7 A;  3KFU A;  5EBD A;  3EQL C;  1H9J A;  4A3K H;  1V8Q A;  2NWG A;  4A3D H;  3M3Y H;  4DV4 Q;  2L4N A;  4OO1 H;  2L0C A;  2CQA A;  2XWB B;  2SNM A;  4AH6 A;  3R2T A;  4LF4 Q;  1LAC A;  1MSG A;  4O0A A;  1N34 L;  1EY9 A;  1WTP A;  1STE A;  1B53 A;  2O5I C;  4XXE A;  4X65 L;  1Q1B A;  5ELF A;  2NZO A;  2F0Q A;  4LAA A;  1DM0 B;  1ILP A;  3FMC A;  1BQQ T;  4ALP A;  2B2U A;  4DAY A;  2NZH A;  3KDF B;  1NMG A;  3Q24 A;  5C0X G;  3HOZ B;  3K5O A;  1YNN D;  2D2C C;  1I4R A;  4P74 A;  4LFA Q;  1G29 1;  4KY7 A;  5M3F H;  1N33 L;  4DR6 L;  1I6V C;  2RHQ B;  1LYL A;  3PUZ A;  1EIF A;  5I9P A;  3EVQ A;  3E3X A;  4JI3 Q;  2N49 A;  1K3R A;  3D6W A;  2AWO A;  3HZX A;  2AWN A;  1QE6 A;  1JOK A;  3CCJ A;  5ELB A;  1O80 A;  1HXY D;  2ZJR A;  2CCZ A;  4IQZ A;  3KLW A;  1II3 A;  1S3O A;  1LT4 D;  3ERS X;  1ASY A;  1AFP A;  2B2W C;  5CV5 A;  2Z6K A;  4NDX A;  4KKU A;  4HJA A;  4MN3 A;  1EY0 A;  1SE2 A;  3S1R B;  1PXU A;  1N36 Q;  1CHP D;  4TKO B;  4Q5V A;  3NHH A;  1QNK A;  3I72 A;  4GS3 A;  4DV2 Q;  2WII B;  4YCV A;  2EXZ A;  4OGQ C;  2YTY A;  1PV4 A;  1EL0 A; 
#chains in the Genus database with same CATH homology
 3CPF A;  1FVI A;  3CQZ H;  1YI2 A;  1LUZ A;  1YBY A;  4LUV A;  1KAW A;  1PFS A;  4A76 A;  4JC0 A;  1XNR Q;  1Q46 A;  5M3M H;  1X54 A;  4HJ5 A;  1EIY B;  1VQM A;  2IY5 B;  3KJP A;  5IP7 H;  1JJ2 A;  2WP8 J;  2JA7 H;  1K0R A;  2OWO A;  4MTN A;  5IY0 A;  5JJI A;  1VQA A;  4YWL A;  4DNI A;  3H3V I;  2L15 A;  3HOV G;  2Q2I A;  2B3G A;  4A3G H;  1Q7Y C;  2CWA A;  1NTG A;  1PH1 A;  1PHJ A;  1N32 Q;  2JA9 A;  1QZH A;  2Y0S G;  2K4K A;  3BZK A;  2K52 A;  4X64 L;  3CAM A;  4KI0 A;  4BBS G;  1VQJ A;  5IT9 c;  3PV0 A;  3CP0 A;  1K8G A;  1N9W A;  1UE6 A;  2WAQ G;  1M1K C;  2F4V Q;  1HZA A;  3I4N H;  1N32 L;  5FJ8 G;  3E9I A;  1HR0 L;  3I7F A;  4HJ7 A;  5C3E H;  3CC2 A;  4UP9 A;  1K83 H;  2F3I A;  1IL2 A;  1YJ9 A;  1CSP A;  2F4V L;  1VQO A;  2AKW B;  4JYA Q;  4A3E G;  2AMC B;  4NXM L;  1FGU A;  1WCM G;  2JA5 G;  3HOU H;  1V43 A;  2ZTD A;  3S24 A;  2ZM6 L;  3BZC A;  1A62 A;  1HZC A;  4GN5 A;  2PNH A;  4Y52 H;  1VQG A;  2R92 G;  4EQ5 A;  2KCM A;  2VQE Q;  5J3B A;  4NPS A;  5IYD G;  3K8A A;  1AE3 A;  2I5M X;  3UDG A;  1IXR A;  1WOC A;  2OQ0 A;  1N34 Q;  2VQE L;  1E1T A;  2B63 G;  3S1N H;  1E22 A;  1XMO L;  1ASZ A;  4H02 A;  4IPG A;  1KXL A;  1J6Q A;  4HID A;  4A3M H;  4DR7 Q;  3PO2 H;  4DR2 L;  3CCQ A;  2LXK A;  4GNX C;  2YTX A;  3CXC A;  3TRE A;  4JG2 A;  5M5W H;  4BBR H;  5GAD C;  2PQA A;  1YJW A;  4DV6 Q;  5H1S E;  4C3H H;  1HNW Q;  4DR7 L;  4BA2 I;  1KRT A;  2JA6 H;  2MO0 A;  3K7U C;  4DKA C;  4DK3 C;  1NBW A;  2BA0 A;  3A74 A;  4DV6 L;  2I0Q A;  2VW9 A;  4JI4 Q;  3ULL A;  4GNX A;  4LUZ A;  1J5E Q;  3HOZ H;  1PH4 A;  4OWW B;  2ZTC A;  2WFW A;  1S72 A;  1QVF A;  2B29 A;  4NXN Q;  3PF4 A;  2MNA A;  1B70 B;  4KHP Q;  3RLO A;  5JEA G;  1HNX L;  1C9O A;  1A0I A;  4DAY B;  4X66 Q;  1VS0 A;  1Y1W H;  4DUZ Q;  1J5E L;  1TXY A;  3HFZ B;  3CCE A;  5IP7 G;  2Y0S E;  4NXN L;  2JA7 G;  4GKK Q;  4KHP L;  4X62 Q;  1LTL A;  3J80 c;  3TS2 A;  1X65 A;  4YY3 Q;  3PO3 H;  1JT8 A;  4X66 L;  4B3M Q;  2WAQ E;  2VS1 A;  1SE8 A;  3JC6 6;  4GN4 B;  3CMA A;  4DUZ L;  1CKN A;  1TWC H;  3TRZ A;  4BY1 H;  2UXD L;  2QA4 A;  4GKK L;  2UUA Q;  4OX9 Q;  5EAY A;  4DV0 Q;  4A93 G;  4X62 L;  2Q2T A;  4UP8 A;  3TEH B;  4JI0 Q;  1B7Y B;  1TWG H;  4B3M L;  1YEZ A;  4P72 A;  3D31 A;  1IYJ B;  4IFD J;  4LW1 A;  4R1J A;  3PIP A;  2UUA L;  4DV0 L;  2XGT A;  1IBL L;  1BBU A;  4JI0 L;  1XPU A;  4XIG S;  4MNO A;  4JBK A;  2R7Z H;  3EIV A;  3I4O A;  1A8V A;  3RLN A;  3RR5 A;  1GM5 A;  2ES2 A;  1UE1 A;  2D0O A;  1BVS A;  2RCN A;  1UEB A;  2WB1 G;  4OWT B;  4A3I G;  2NVQ H;  4LF6 L;  3J7Z C;  3E9H A;  2OTJ A;  2KBN A;  2CFM A;  1OXU A;  2OQK A;  2GVA A;  2VZA A;  2QGQ A;  4GN3 B;  4DAM A;  1KC8 C;  1VCI A;  4IPC A;  3U4Z A;  4A3K G;  2ALY B;  2NN6 G;  3PIO A;  1CUK A;  3H0G H;  4XTC S;  3CPW A;  1HH2 P;  2OCE A;  1MJC A;  3AEV A;  4A3D G;  1VQE A;  1CKO A;  1SN8 A;  5IP9 G;  4B3S Q;  2XTI A;  4OO1 G;  2K75 A;  1E3P A;  4R4I A;  1PH6 A;  5C0X J;  3PUW A;  4LF7 L;  1UE7 A;  3T1Y Q;  1G51 A;  2UXB Q;  4UP7 A;  3GTP H;  4P71 A;  3LGJ A;  4B3S L;  3CCS A;  4JBJ A;  3BJU A;  1XMQ L;  1VQ5 A;  4JBM A;  2NVT H;  4BXX H;  4R4O A;  4JI1 Q;  3OTO Q;  1X55 A;  1VQ9 A;  5C4X H;  2I5H A;  4GOP C;  4DR1 Q;  1QUQ B;  4JI1 L;  2JA6 G;  4DV5 Q;  1VQL A;  3L0O A;  1SRU A;  1L1O A;  2MQH A;  5M5X H;  1Q86 C;  3KOJ A;  1X3F A;  2HQL A;  1L1O B;  4JOI C;  4DR1 L;  3KYH C;  4DV5 L;  2RHS B;  3RN2 A;  5FLM G;  3G71 A;  3CC7 A;  1BBW A;  1KRS A;  1SMX A;  1Y1V G;  3H15 A;  4DR3 Q;  1PH3 A;  3CCR A;  1UE5 A;  2Z0S A;  4L5S A;  1A63 A;  1EOV A;  4YHH Q;  5IWA Q;  3S16 H;  1FL0 A;  1Y1W G;  4DV1 L;  4APV A;  4JOI A;  4DR5 Q;  4A3L H;  2E5L Q;  1YZ6 A;  4DR3 L;  4JI2 Q;  2IX0 A;  2JQO A;  3KF6 A;  4OON A;  4PMW A;  5IWA L;  4X64 Q;  5GAE C;  2CQO A;  4YHH L;  1VQ7 A;  5IYB H;  3KF6 B;  5C44 G;  2VY3 A;  4A3F H;  3CME A;  4DR5 L;  4DPG A;  4BY1 G;  5M3F G;  2E5L L;  4JI2 L;  3HOW H;  2V1C C;  3GTQ H;  3G48 A;  1HR0 Q;  1I5F A;  2VQF Q;  1K73 C;  3CC4 A;  1V1Q A;  2WB1 E;  3D0F A;  4IPD A;  1X3G A;  2R93 H;  3FKI H;  4X6A H;  1Q1E A;  1MJE A;  4TVA B;  3M4Q A;  3UE0 A;  2VQF L;  2N8N A;  1QZG A;  1Q81 C;  4NXM Q;  2OTL A;  3SGI A;  1D7Q A;  3EBE A;  2ZM6 Q;  1K8A C;  2JA8 G;  4KHZ A;  1PA6 A;  2CKZ B;  3NEN A;  5HY6 A;  3W1G A;  2E8G A;  3I2Z A;  3ICE A;  2KHJ A;  4A3B H;  1XNQ Q;  3HOY H;  4MZ9 A;  4HIO A;  4IFD I;  1WFQ A;  4J15 A;  3G4S A;  5ELN A;  2YU9 H;  4DR4 Q;  1E1O A;  4A3J G;  2ZJP A;  1XMO Q;  1XNQ L;  4AYB G;  4JV5 Q;  4GLV B;  4DR2 Q;  4POF A;  4DR4 L;  1PVO A;  1VQH A;  1YHB A;  3GTG H;  1VQP A;  2UU9 Q;  4JV5 L;  2UUC Q;  3F2B A;  1EUJ A;  4QL5 A;  4RMF A;  5IYC H;  1D8L A;  1KHI A;  2K50 A;  2VUM H;  3S2D H;  4LFB Q;  4BXX G;  4YCW A;  2UU9 L;  4DUY L;  1UWV A;  3I4M H;  1WI5 A;  2KCT A;  2PQA B;  2UUC L;  2PI2 E;  2GVB A;  2BH2 A;  5C4X G;  1PH8 A;  4TQU S;  1TWA H;  2A8V A;  1P8L A;  4JI8 Q;  1KQS A;  3GTO H;  1XTD A;  2GN5 A;  3M4O H;  3J80 i;  1FJG Q;  4LFB L;  2PMZ E;  1GVP A;  3PUV A;  4C2M H;  5C0X I;  1HNX Q;  3GTL H;  3WWV A;  3M85 A;  1H95 A;  2F52 A;  2YYZ A;  3AQQ A;  3U4V A;  4GNX B;  4JI8 L;  2JK8 A;  3BU2 A;  1HNZ Q;  1FJG L;  3STB D;  1HR0 W;  2LXJ A;  2YTV A;  5M3M G;  1JJG A;  1JE5 A;  4POG A;  3HOX H;  2UXD Q;  2K5V A;  1HNZ L;  1JB7 A;  1KL9 A;  4K0K L;  3PGZ A;  1PYS B;  2KEN A;  1SFO H;  1HZ9 A;  2ID0 A;  4LUO A;  3DLL A;  5LMN Q;  3T1H L;  1CKN B;  2ASB A;  4P75 A;  4B3T Q;  1IBL Q;  2HT1 A;  4A3G G;  4A3F G;  4ME3 A;  1VQC A;  1I3Q H;  5LMN L;  1W3S A;  2K14 A;  4AIM A;  5JJL A;  1YHQ A;  3K81 C;  3OYY A;  5JJK A;  4B3T L;  3KDF A;  3PCO B;  3I4N G;  2R93 G;  1YIT A;  1EQR A;  3NBH B;  2PI2 A;  4QIW E;  1N8R C;  4LF6 Q;  3ZJY C;  1S40 A;  2E2J H;  5C3E G;  3K80 C;  3OW2 A;  2ZJQ A;  4A3C H;  1E7Z A;  4IOC A;  3HOV H;  4B3R L;  1U0L A;  4AYB E;  4JI6 Q;  2UUB Q;  4R4T A;  3HOU G;  1TWH H;  2YV5 A;  5GQO A;  3UDX A;  3MEF A;  3HOY G;  1VQK A;  4LF7 Q;  3J7A 5;  4JI6 L;  3I55 A;  5GAG C;  3CF5 A;  2E2H H;  2UUB L;  4GKJ L;  5JEA J;  2A19 A;  3HKS A;  5FJ8 H;  3RN5 A;  1WJJ A;  1YNX A;  2EIF A;  3CW2 C;  2Z6K C;  2IT1 A;  3VDY A;  1XMQ Q;  4LF5 Q;  1KIX A;  3S1M H;  1I94 Q;  1VQI A;  1XPR A;  2N3S A;  1OXS C;  4JI3 L;  3AFQ A;  4HIK A;  2C35 B;  3M4P A;  4A3E H;  2JJQ A;  1WCM H;  2BH8 A;  1AE2 A;  3CCU A;  4A3M G;  1I94 L;  2JA5 H;  1CKM A;  4LF5 L;  3GTK H;  3PO2 G;  2VUM G;  3KF8 B;  4BBR G;  4DV3 Q;  1Q12 A;  4QJF A;  5IYD H;  4JCV E;  4QGU A;  2R7D A;  3IRB A;  5GRO A;  1X6O A;  5C4J H;  2HHH L;  1EWI A;  4JI5 Q;  3GDE A;  4IPH A;  4DV3 L;  1VQ8 A;  5LMN W;  3F2C A;  1X3E A;  2B63 H;  1Z47 A;  3MXN B;  3A5U A;  4DV1 Q;  4WJ4 A;  1AH9 A;  4JI5 L;  1W2B A;  3HOZ G;  1SLJ A;  2VL6 A;  4GOP A;  3TQY A;  1SRO A;  3UDI A;  5IE8 A;  5BR8 L;  1MIU A;  5ELO A;  4DV7 Q;  4AQY L;  4GOP B;  3S1Q H;  3K0X A;  3HKZ G;  1GO3 E;  4LF8 Q;  4BY7 H;  1EYG A;  3EN2 A;  3L2P A;  3I56 A;  3HOX G;  2IHE A;  3F8T A;  3RLF A;  1IBM Q;  1PYB A;  3DM3 A;  4DV7 L;  3PO3 G;  1IBK L;  4LWC A;  4OWX B;  5E7N A;  4LF8 L;  1GKH A;  1MKH A;  1QVC A;  1E24 A;  2BA1 A;  3ER0 A;  1C7Y A;  3M7N A;  1IBM L;  4IO9 A;  3GO5 A;  3GTM H;  3S17 H;  3S2H H;  2EQS A;  1C0A A;  4UPA A;  4YWK A;  1VQD A;  3JAM c;  5AJ3 Q;  3J81 i;  2IHF A;  4A4I A;  1X56 A;  4R4C A;  3CCL A;  2R7Z G;  4LF9 Q;  2DUD A;  2E2I H;  1G6P A;  2N78 A;  4IJL A;  1XJV A;  4FDB A;  3L7Z C;  1EFW A;  5AJ3 L;  1XNR L;  4A3C G;  1PH5 A;  4L5T A;  4LF9 L;  2FXQ A;  4A93 H;  1GD7 A;  1NY4 A;  3G6E A;  1M90 C;  1K9M C;  2MO1 A;  1P16 A;  3FHW A;  3NEM A;  2I5L X;  3CCM A;  3J81 c;  2H5X A;  4PZ7 A;  1I6H H;  4HJ9 A;  3B6Y A;  1RL2 A;  2K5H A;  3H0G G;  5M5Y H;  2JE6 I;  1JMC A;  2A1A A;  4L5Q A;  5FLX c;  2JEB I;  2NVY H;  1VQB A;  2ZTE A;  1OXX K;  1R9T H;  2KHI A;  3PSI A;  1LM0 A;  4O2D A;  4R4Q A;  4DK6 C;  4DUY Q;  3RNU A;  4A3I H;  4NB3 A;  3S14 H;  1B8A A;  1VQ6 A;  3ULP A;  1RIP A;  1PH7 A;  1Q8K A;  2RF4 A;  3KFU A;  3GTJ H;  3S15 H;  4A3K H;  1DGS A;  4JYA L;  4EX5 A;  3CCV A;  4YCU A;  4A3D H;  2CWP A;  4A75 A;  3E0E A;  3M3Y H;  4DV4 Q;  5IP9 H;  1VQF A;  3HKZ E;  3STB C;  2UXC Q;  3AFP A;  2MFI A;  4RG1 A;  5DLQ E;  4YWM A;  4DV4 L;  4IFD G;  4K0K Q;  2VNU D;  4AH6 A;  1T9H A;  4LF4 Q;  2UXC L;  1Q82 C;  4O0A A;  1O7I A;  1VQ4 A;  3T1H Q;  4X65 Q;  1N34 L;  4JI7 Q;  1OXT A;  4BY7 G;  1CSQ A;  4LF4 L;  2HIX A;  4PG3 A;  4A3L G;  1KD1 C;  2R7F A;  4X65 L;  1Q1B A;  2K5N A;  4JI7 L;  1U5K A;  5IYB G;  1YIJ A;  2NZO A;  1V9P A;  3U58 A;  4LNQ A;  1NJI C;  1OXV A;  2IX1 A;  3HOW G;  1X9N A;  1HNW L;  4C3J H;  5FLM H;  3RZO H;  1Y1V H;  3UE1 A;  4ALP A;  4P73 A;  1Z9F A;  3FKI G;  4PZ8 A;  4JI4 L;  2NZH A;  3GD7 A;  3KDF B;  4C3I H;  1NMG A;  3A5Z B;  4B3R Q;  2R6G A;  4JBW A;  5C0X G;  4HJ8 A;  3AYH B;  1PH2 A;  4UY8 C;  2NN6 I;  4DR6 Q;  1YVC A;  1N33 Q;  2Q2H A;  3NEL A;  2NVX H;  4OO1 I;  2LSS A;  3ULJ A;  4KLK A;  5C44 H;  1PH9 A;  4P74 A;  4LFA Q;  3Q8D A;  3CD6 A;  4GKJ Q;  1G29 1;  5M3F H;  1N33 L;  4DR6 L;  4A3B G;  3J81 j;  2RHQ B;  4YY3 L;  1LYL A;  4BBS H;  2D0P A;  3U50 C;  4GLA C;  1IZ6 A;  1EIF A;  2AHO B;  1TWF H;  3PUZ A;  4LFA L;  4Y7N H;  1VQN A;  1OTC A;  5GAH C;  4OX9 L;  3PUX A;  4JI3 Q;  4QQB X;  2N49 A;  1K3R A;  4L5R C;  4LFC Q;  2AWO A;  3RZD H;  5K36 G;  1YHA A;  2AWN A;  1NE3 A;  3CCJ A;  1WYD A;  2JA8 H;  2D62 A;  4PZ6 A;  1NMF A;  4LFC L;  2ZJR A;  2CCZ A;  4GLX A;  3KLW A;  1S3O A;  3S1R H;  3ERS X;  5IYC G;  3W1B A;  1ASY A;  1YJN A;  2HHH Q;  1L2F A;  4OXP A;  1HJP A;  2Q2U A;  2ATW A;  2Z6K A;  2QEX A;  1I50 H;  3I4M G;  2R92 H;  4HJA A;  4IJH A;  3W5O A;  1JJC B;  3A0J A;  1HZB A;  4A3J H;  2JEA I;  2DGY A;  3H3V H;  2HIV A;  4AQY Q;  5BR8 Q;  1Y14 B;  1N36 Q;  1BKB A;  5LMU Q;  3UDF A;  3K7A H;  4BA1 I;  3M9B A;  4GS3 A;  1SR3 A;  1N36 L;  4DV2 Q;  4IOA A;  1L1O C;  4YCV A;  5LMU L;  1IBK Q;  3T1Y L;  2UXB L;  4HIM A;  3F1Z A;  2EXD A;  3JAM i;  3F2D A;  4WJ3 M;  4DV2 L;  3PF5 A;  1L0W A;  1QUQ A;  3PUY A;  3FP9 A;  1QVG A;  2YTY A;  4QY7 A;  3TS0 A;  1PV4 A;  3KJO A;  1XPO A;  3OTO L;  5HGQ A;  1EQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...