2N49A

Ec-nmr structure of erwinia carotovora eca1580 n-terminal domain determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ewr156a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Structural genomics, unknown function
molecule keywords Putative cold-shock protein
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n49A00
1PH6A 4LF8Q 2WP8J 1J5EQ 4BY7G 3K0XA 3PUYA 4B3SL 5M3MH 1PH1A 4DR1L 2UUCQ 3HFZB 1J5EL 4JBWA 1XPUA 4HIDA 2OWOA 1XNRL 2QEXA 5M5WH 1IL2A 5K36G 1SR3A 4GKJQ 4NPSA 2JA7H 3F2DA 4LFAL 4A3EG 1CKNA 3RN2A 1YIJA 1YJWA 1X55A 4DV1Q 2ZTDA 4HJ7A 2VW9A 1YI2A 1N36Q 5GROA 2F4VL 1WJJA 2JEBI 2RHSB 2VZAA 1JB7A 4IPCA 1VQHA 4FDBA 2AWOA 3T1HL 1U0LA 4A3EH 3UDXA 4A3DH 1KL9A 4DKAC 3OW2A 3S16H 1YVCA 5IP7G 2JEAI 2PQAB 2KBNA 1RIPA 1T9HA 2JA6H 1IBKQ 1AE3A 1X56A 2HIVA 1XTDA 2I5HA 1Q7YC 4KHZA 5M5XH 2KCTA 1KQSA 1YBYA 1NJIC 1SROA 5IY0A 2MNAA 1NBWA 3PUWA 4DV3L 1YHBA 2XTIA 1WI5A 2WAQE 3K81C 5C44G 2N3SA 3KJPA 4DV4Q 1B70B 4A3FG 4B3MQ 4LFCQ 1WOCA 1HNZL 3RN5A 4WJ4A 4IFDI 5JEAJ 5C4XH 4LF7Q 2IX1A 4WJ3M 3RR5A 3KFUA 2Z6KA 4OXPA 4LW1A 5FJ8H 4GLXA 4B3RQ 2PI2A 3S24A 1HNWL 2R92G 1UWVA 3TS2A 4QY7A 2JA9A 2XGTA 4BY7H 4X62Q 4A3BG 1Q1BA 4R4OA 1CKNB 4P73A 1P8LA 1L1OA 1UE6A 1TWCH 1TWFH 1Y1VH 1I3QH 3BJUA 4X65L 3T1HQ 4DV1L 2C35B 1SMXA 1VQ4A 4KLKA 1X6OA 1HNZQ 4LWCA 1G6PA 4LF4L 4YHHL 1K8GA 4L5TA 1DGSA 3PF5A 4LF7L 1VQFA 1PH9A 4JYAQ 4OWTB 3PUZA 5C0XJ 4DV5Q 3UDGA 1N32Q 1FL0A 4OX9Q 3BZCA 1VQNA 1R9TH 2N49A 2ZTEA 4A93H 4X64L 2EXDA 2F3IA 4NXML 4A3DG 3S1QH 1CKOA 1MKHA 4AYBG 1K9MC 4GKKL 3J81j 5GQOA 4A76A 2YTXA 1FVIA 4DR1Q 3PF4A 3KDFB 4GN3B 2DGYA 4LUVA 2KHJA 3U58A 2JA7G 4LFBL 4GNXB 1Z47A 3RLNA 4EQ5A 2R92H 4A3JG 4A3BH 3I4OA 2E2HH 3EN2A 3RZOH 2QA4A 3U4VA 4NXNL 5LMNW 2Q2IA 1Y1WH 1OXUA 5IWAL 2ES2A 4DV6Q 4LF5L 3TRZA 4A3KG 1VQIA 5AJ3Q 2A19A 3RLFA 2GVAA 1MIUA 4A3FH 1A62A 4HIKA 1W2BA 4B3ML 4A3CG 3HKSA 2NN6I 1W3SA 4PZ8A 1CUKA 3HOUH 4AYBE 3S2HH 4A3GH 5GAHC 4X6AH 1XNRQ 2RHQB 5M3FH 4DV2L 3IRBA 4BA1I 1VQ8A 4LF4Q 4ALPA 3CC4A 4JOIC 4QJFA 5DLQE 3KLWA 1X9NA 1C7YA 1G51A 1H95A 4A3IG 5GAGC 2EIFA 4DAMA 4UPAA 2ATWA 2UXDL 2Z0SA 1QZGA 5JJIA 3D0FA 1P16A 2ZTCA 5IE8A 1LTLA 3HKZE 2CWPA 2F4VQ 3CCUA 2Y0SG 1EYGA 3CQZH 1L1OB 1UEBA 1Y14B 4BBRG 4OX9L 1PFSA 4APVA 4DK6C 1PH4A 5C4XG 1PYSB 4PG3A 2R7ZH 3CAMA 4UY8C 2KENA 3I56A 5IYDG 1SN8A 2V1CC 3G4SA 2HT1A 1OXSC 1BBWA 1BKBA 3F1ZA 3W5OA 4DV6L 1I94Q 4LF5Q 4A3CH 1HNXL 4JBKA 1D7QA 4L5RC 4DPGA 5IYBH 3CCQA 1ASZA 4JI2L 3M3YH 1EOVA 3B6YA 1PHJA 1X54A 3KYHC 2VS1A 2PQAA 2WAQG 1OXVA 3RZDH 3I4NG 1X3EA 4LFBQ 4DNIA 4HJAA 3M4PA 3CMAA 2CCZA 2ZJQA 2UUAQ 3NENA 4A3JH 1M90C 3M4OH 3EBEA 3H0GG 4B3RL 3FKIH 1OXTA 4GN5A 3ULPA 2VQEL 4R4IA 2Q2TA 1TWAH 2K5HA 4MNOA 4HJ9A 3S2DH 3AQQA 5GADC 4A3MH 2UXBL 1JJ2A 5HGQA 1QUQA 4YCWA 1VCIA 3PO3G 1YHAA 3JC66 4BXXG 5EAYA 2VNUD 5IWAQ 1IBMQ 3GTQH 3CMEA 2NVTH 4YCVA 1N9WA 2D0PA 3K80C 3HOWG 3STBC 5LMUL 4GLAC 4H02A 4HIMA 3T1YQ 1ASYA 1LM0A 3CCEA 3A5ZB 2VUMG 5LMNL 3S17H 4Y52H 5J3BA 4A3IH 2K14A 4YWMA 2R7FA 4GLVB 2K5VA 1G291 5IT9c 4HJ8A 1OTCA 1UE7A 4KHPQ 2UXCL 4UP8A 3J7ZC 2ZM6L 4LUZA 1BVSA 3L7ZC 2BA1A 1Q1EA 4DR5Q 4P74A 1N8RC 3PCOB 2YTVA 3CCVA 1KC8C 2YU9H 3HOUG 1EQRA 1JMCA 4DV5L 5C0XG 4UP7A 1PA6A 1J6QA 3CCRA 1IBML 1VQ7A 1QVCA 4JCVE 2Q2UA 1MJEA 1XNQL 2A8VA 3ERSX 2N78A 3ICEA 3BU2A 1V9PA 3M4QA 3E9HA 1XNQQ 3CW2C 2YV5A 4X65Q 2VQEQ 1QVGA 1VS0A 4YY3Q 4AQYL 4NXNQ 2HHHL 1IXRA 3S14H 1KHIA 5BR8L 3S1NH 1TWHH 1IZ6A 1XPOA 5IYCG 4LNQA 1Q12A 2QGQA 3KF8B 4BBRH 2FXQA 4DR3L 2VQFQ 5H1SE 2KHIA 1IYJB 1HNWQ 2EQSA 1TWGH 1S72A 1K3RA 5C3EH 3UDIA 1TXYA 5C4JH 4NXMQ 1GVPA 5FLXc 3F2BA 2AMCB 3A5UA 1VQPA 3PUVA 4X66Q 4IOCA 1LYLA 1VQLA 4A3MG 1B8AA 1I94L 3AEVA 2NN6G 5C44H 5ELOA 4JI4Q 1N32L 4GOPA 3HOYG 3CPFA 1E1OA 2MO1A 1WCMG 1HZBA 2OQ0A 3MXNB 4YHHQ 1NMFA 1NMGA 4GKJL 3KF6A 1NE3A 4LF9L 4DUYL 1EIFA 1X3GA 1XMOQ 4B3TQ 4A3LG 4IJLA 4BY1G 2I5LX 2ZM6Q 2ALYB 3KOJA 1LUZA 1OXXK 3W1BA 4B3TL 3CD6A 5LMNQ 4YCUA 4GKKQ 1N33Q 2PI2E 1K0RA 1L2FA 3KF6B 2N8NA 4LUOA 3JAMi 3FP9A 3CXCA 4DV0Q 3GTJH 4YWKA 3L0OA 3RLOA 4JI3Q 4IJHA 4BY1H 1VQEA 4DR4L 3HOZG 1PH5A 1KD1C 4DV3Q 2E5LL 1A8VA 1UE1A 3CP0A 3OTOL 3CCSA 1QZHA 1YZ6A 3Q8DA 4QIWE 1YEZA 4R1JA 4A93G 3ER0A 4DR7L 2GN5A 2R7DA 2HIXA 1QVFA 4KHPL 1GKHA 3HOZH 2D62A 1M1KC 2WB1G 3FHWA 2OTLA 3PUXA 5IYCH 2VQFL 1I5FA 1Q82C 2JQOA 3GO5A 4B3SQ 3S15H 1XJVA 4YWLA 2JA8G 3ULLA 4GNXA 1YJNA 3PO3H 3CPWA 4BBSG 2R93G 3CC2A 4DR2L 3CCMA 3MEFA 2UUBL 3JAMc 3I4MG 1I6HH 1RL2A 4DUYQ 2E2IH 3I55A 3SGIA 1K73C 2MQHA 2B3GA 3GTOH 2PMZE 4O2DA 4R4QA 1EWIA 1V43A 5FJ8G 2IY5B 1VQDA 1K83H 1L0WA 2BH8A 2YYZA 1PH8A 4KI0A 4A4IA 2H5XA 3CF5A 4JI4L 3HOXH 4IPGA 3TQYA 4JV5Q 4IO9A 1VQ6A 4JYAL 1GD7A 2AHOB 4EX5A 2OQKA 4J15A 4JI6Q 4PZ7A 4MTNA 2AKWB 1FGUA 2Z6KC 3H15A 4TQUS 4JOIA 4DR2Q 2UUBQ 1IBKL 1SRUA 4TVAB 1KAWA 2JE6I 3F2CA 1EQQA 1AE2A 4JI1Q 1U5KA 1N34L 3PO2H 4P71A 4JI2Q 1VQMA 4POFA 4OONA 4YY3L 4AQYQ 2L15A 3J7A5 4PZ6A 4DV2Q 1N36L 2VUMH 2I5MX 2YTYA 1MJCA 4DV7Q 3S1RH 1AH9A 3F8TA 3I4MH 2I0QA 2LSSA 3GDEA 2BA0A 5IP9G 1O7IA 4DR7Q 1JT8A 2A1AA 2LXJA 4UP9A 3M7NA 4OO1G 2D0OA 4IFDJ 2K50A 3I2ZA 2WB1E 3G48A 3KDFA 3FKIG 4DV0L 2K75A 3K7UC 2CQOA 4JI5Q 4C3JH 2JA5H 3HOVH 4IPHA 2E8GA 3CC7A 4HJ5A 1SE8A 2CWAA 2IHFA 4X66L 4L5SA 4L5QA 1YNXA 1PYBA 4X62L 1GO3E 3AYHB 1PV4A 2LXKA 3NELA 4PMWA 4AIMA 4GNXC 3I4NH 2UXCQ 3E9IA 2NVYH 1KRSA 1S3OA 2MO0A 1YITA 2MFIA 4JBJA 2CKZB 2VL6A 4OWWB 3CCLA 5HY6A 3TEHB 3J81i 2B29A 1WFQA 1PH3A 3AFQA 4XIGS 3BZKA 2NVXH 1A63A 5ELNA 3HOXG 4P75A 3W1GA 4JV5L 1Q8KA 3K8AA 2ASBA 4IOAA 1XMQL 1VQOA 5IP9H 1HH2P 4XTCS 2K5NA 4RG1A 4R4TA 2JJQA 3UDFA 2E2JH 5IP7H 2ZJRA 4JI0L 4QQBX 1S40A 4DV7L 3EIVA 4GN4B 4A75A 2F52A 4C3IH 1N33L 2JA5G 3HOVG 3PO2G 1C0AA 3I7FA 4QGUA 1SFOH 3D31A 1L1OC 1A0IA 3H0GH 1IBLQ 4AH6A 1HZ9A 4P72A 4LF8L 1D8LA 2AWNA 3S1MH 4DAYB 5C3EG 3J81c 1WYDA 4DUZQ 1V1QA 2K4KA 3NBHB 1XMQQ 1KRTA 4JI8L 5M5YH 2ZJPA 1SLJA 4A3KH 4JI6L 4DUZL 4HIOA 4QL5A 1BBUA 2UU9L 4JI7L 4LF6L 3H3VI 4NB3A 1E7ZA 3M85A 1GM5A 2NZHA 1JJGA 1HR0Q 2UXBQ 5JJLA 3WWVA 1HZCA 1N34Q 5IYDH 3H3VH 4A3GG 1K8AC 3HOYH 4GS3A 3GTPH 3J80i 4OO1I 3A0JA 2Q2HA 1Q86C 2IT1A 5LMUQ 3GTGH 2NVQH 3GTLH 1E3PA 1B7YB 4RMFA 3PIPA 3M9BA 2Y0SE 1I50H 2VY3A 2B63G 4C2MH 5M3MG 1Z9FA 3HKZG 3LGJA 3U50C 4DK3C 4Y7NH 3CCJA 5FLMH 3RNUA 3VDYA 2IHEA 5AJ3L 4JI5L 2OTJA 1E24A 3TREA 3AFPA 4IPDA 1PH2A 1VQ5A 1CKMA 2PNHA 4K0KL 3PV0A 3G71A 3DM3A 4BA2I 3U4ZA 1EIYB 4JI3L 3G6EA 2UUAL 4JI8Q 4POGA 2DUDA 1NY4A 1X65A 5M3FG 1KXLA 1Y1VG 5JEAG 3PSIA 4BXXH 4O0AA 4C3HH 4GOPB 3J80c 1VQJA 5IYBG 4MZ9A 1Y1WG 1HR0L 2GVBA 4JI0Q 1CSPA 2HHHQ 2OCEA 1C9OA 2NZOA 2BH2A 4LF6Q 4IFDG 1XPRA 1Q46A 1UE5A 3K7AH 1E22A 4LF9Q 1FJGQ 1WCMH 4K0KQ 2WFWA 1HZAA 1VQGA 4LFAQ 4JBMA 1VQCA 1X3FA 1NTGA 4JG2A 3OTOQ 3TS0A 3OYYA 2UU9Q 1PVOA 3GTKH 2JK8A 1VQKA 4A3LH 1EFWA 4DV4L 3NEMA 3KJOA 2K52A 1VQBA 3ZJYC 2UUCL 1E1TA 3A74A 3L2PA 1YJ9A 3HOWH 2RCNA 4DR6L 1CSQA 3STBD 3DLLA 1KIXA 1IBLL 1XMOL 2JA6G 2ID0A 4JI1L 2R6GA 4R4CA 2UXDQ 1VQAA 4BBSH 4DR6Q 2R93H 3GD7A 5E7NA 1VQ9A 2JA8H 3PGZA 3UE0A 5JJKA 5GAEC 1PH7A 4X64Q 4OWXB 2R7ZG 3T1YL 1EUJA 4JC0A 2B63H 1HJPA 1Q81C 1HR0W 5BR8Q 2RF4A 5FLMG 4JI7Q 2CFMA 1HNXQ 2KCMA 3E0EA 1QUQB 3PIOA 3ULJA 4DR4Q 2IX0A 4LFCL 1JE5A 1JJCB 4ME3A 3UE1A 2E5LQ 3GTMH 1FJGL 4GOPC 4DR5L 1YHQA 2HQLA 5C0XI 4DR3Q
chains in the Genus database with same CATH superfamily
4HAEA 1PH6A 1J5EQ 2K5WA 2SNSA 3D3RA 3EJIA 1STAA 3PUYA 1PH1A 2UUCQ 1ET6A 3H3VC 4GZYC 1J5EL 2XN9C 3BVMA 4JBWA 3A7AB 1XPUA 2OWOA 1O78A 3KLSX 4NPSA 3F2DA 3RN2A 1YIJA 3S9WA 4DV1Q 1YI2A 1PRTC 1N36Q 2J7ZA 2F0LA 2VZAA 2JEBI 1JB7A 2F4VL 5IGCA 4IPCA 2AWOA 4A3EH 4QCLA 1YVCA 4R9WA 2KBNA 3R2IA 2XNAC 3OOCA 5CV5A 5M5YB 3I4LA 3WOFA 1WTWA 2MNAA 3BDCA 3K81C 3K5LA 4JI6Q 1VMPA 5C44G 2N3SA 4DV4Q 4A3FG 3PO3B 2CVRA 5JPNC 3U9OA 4JW0A 5IODA 3KFUA 1X32A 4GLXA 4B3RQ 2PI2A 5KNDA 1HNWL 2R92G 4I7AA 3TS2A 3S14B 2XWBB 4X62Q 4CJ0B 1I4XA 1UE6A 1Y1VH 2PQEA 2E76C 4ZKBB 2WINB 2A68C 1F2MA 1K8GA 4L5TA 3K5NA 5C0XJ 2OEOA 4DV5Q 3UDGA 4PMBA 3D6WA 2F3IA 1NAPA 1K0SA 3M4OB 1TQOA 5CR3A 1CKOA 4AYBG 1F77A 4DR1Q 4LUVA 2KHJA 1DJRD 3RLNA 4EQ5A 4KKSA 4A3BH 2E2HH 3QIAA 1HXYD 4DF7A 5CORA 3U4VA 4NXNL 2QA4A 1S4ZA 5LMNW 1Y1WH 2CH4A 2MJ8A 1VQIA 5AJ3Q 1TWFB 2A19A 2F0PA 1MIUA 1HA6A 5KYLA 4A3FH 3OPOA 1A62A 3Q0AA 1KLGD 4C3IB 3G6JB 2K32A 1CUKA 3NTHA 2L5TA 5GAHC 5M3FH 3IRBA 4JOIC 5DEHA 3KLWA 2RKSA 2EIFA 4UPAA 2ATWA 2Z0SA 2N88A 5JJIA 3HOZB 1QWYA 4B9XA 3HKZE 2LY7A 4M8AA 2Y0SG 2B2UA 1UEBA 1ICWA 1EYCA 1JCKB 2KENA 5IYDG 3I56A 4ID6A 2CHBD 1D5ZC 4K6LA 2F0TA 1I94Q 4LF5Q 4A3CH 1HNXL 1D7QA 1S5CD 3S2HB 5FO9B 1EOVA 1SE2A 1X54A 4CKCA 2PZUA 2VS1A 1GUOA 2F0GA 3I4NG 4LFBQ 4DNIA 3CMAA 3NENA 3M4OH 3EBEA 2L9HA 1OXTA 4GN5A 1XWEA 2K5HA 4MNOA 4A3MH 2IWHA 4KMUC 3PO3G 1DOLA 2D0PA 4A3DB 1Y1WB 3HOWG 1GUWA 4HIMA 4EGVA 4Y52H 1Y69U 2F0DA 4KY6A 1EY0A 4BY1B 4C3IG 5FO7B 2UXCL 1BCPD 2FMCA 3AU7A 4UP8A 4LJZC 1KABA 4DR5Q 1N8RC 2YU9H 3HOUG 1EQRA 1JMCA 4DV5L 4UP7A 1VQ7A 2D9UA 1XNQL 5T1GA 4FF4A 1GHJA 2BDNA 3SHLA 3E9HA 2YV5A 3MEHA 1JORA 2VQEQ 3K59A 5ISRA 1QVGA 3S1NH 4CJ2C 3KF8B 4BBRH 1K83B 1PZID 4K5WA 5ELFA 1U4MA 2GA4B 1HNWQ 1D5MC 1K3RA 2HUGA 5C3EH 3UDIA 1TXYA 2B8FA 1DYQA 3F2BA 1BNZA 1B9MA 5FKAC 2F0KA 3PUVA 3AEVA 4JI4Q 3CPFA 4IQZA 1HZBA 4HMJA 3AMUA 1NMFA 1Z7TA 1STGA 3KF6A 4TRDA 4DUYL 3T16A 1JOKA 1X3GA 1PTOC 3J80E 1CA5A 4IJLA 1HA5A 4BY1G 3MTSA 2L11A 2PPBC 1N33Q 1K0RA 2N8NA 1U9RA 2XRSD 3HG9A 3GTJH 3ONAB 4YWKA 3L0OA 1II3A 4ZUJA 4BY1H 1VQEA 4C56C 3M4YA 3I70A 5F2DA 3VYRA 4DV3Q 2E5LL 3CP0A 4QIWE 3C46A 1QVFA 1TVXA 2D62A 1I4GA 1GHKA 1ZKOA 1B3AA 3M7GA 2VQFL 3GO5A 3SR1A 2KHSA 4GNXA 1ILPA 4NP5A 4DR2L 3MEFA 5C3WA 4DUYQ 1EY8A 3CRLC 3DEOA 5D65A 1PFBA 1DOKA 1K83H 1Y8NB 3A8KE 2H5XA 3TQYA 2WV6D 1SDFA 4F87A 1H9MA 2WIIB 2AKWB 1Y8OB 2X6GA 3H15A 4JOIA 1TS3A 5C44B 5KRUA 5EPKA 3PO2H 1U5KA 4POFA 1DXMA 4PZ6A 2YTYA 3S1RH 2WKCA 3F8TA 3I4MH 3RD4A 2LSSA 3GDEA 4DR7Q 3BVGA 1FR3A 1AZQA 3EQLC 2B2TA 3KDFA 2CQOA 3IFTA 3CC7A 1I6VC 5KEEA 3L3OC 1SE8A 1YNXA 2SOBA 3AYHB 1PV4A 4PMWA 5HGTA 3I4NH 2UXCQ 4A3FB 3J7AF 1KRSA 2MFIA 4CBVA 3CCLA 2RDHA 5C5MA 3TEHB 4DN4M 3J81i 3A56A 1PH3A 1MHWC 2VUMB 3NSWA 2PNRC 3HOXG 3MC0B 1LTBD 1IW7C 4JV5L 4DA2A 1WTRA 1XMQL 3VYTA 1F2ZA 5IP9H 2ENBA 1BXTA 2E2JH 1S40A 1N33L 2PCFB 3PO2G 3QB3A 1Q8IA 2MUYA 5I6YA 3D31A 5EKIA 4LF8L 2PW7A 4P72A 4Y7NB 3S1MH 2K1BA 1L0XB 1WYDA 4DXGA 4JI8L 5M5YH 2MHVA 3MXGA 4HCSA 5E1FA 1BBUA 4DUZL 4HIOA 1C8CA 2VXWA 4NB3A 1GM5A 1JJGA 3KK7A 3SDZA 5KNBA 3WWVA 1LV9A 1HZCA 5IYDH 1K8AC 5EBDA 3GTPH 4I65A 3J80i 2HDLA 2TSSA 2Q2HA 5C4HA 3DM1A 2CW0C 3GTGH 3IFDA 3M9BA 2DNCA 1I50H 2IPKD 3P75A 3HKZG 3U50C 1CHPD 4DK3C 3RNUA 2IHEA 1S5FD 4IPDA 2PNHA 1ZYRC 4A3JB 3GQBA 1EIYB 4JI3L 2CW0D 4JI8Q 4FYDA 3VYSA 3E5SA 5IOCA 1BR9A 2JA8B 3VA5A 4C3HH 4GOPB 3G7LA 1VQJA 4JI0Q 2HHHQ 2PZWA 1C9OA 3C1EA 2K5QA 2NZOA 3DEPA 5K36H 3VA7A 1E0BA 4K0KQ 1F9RA 5CYUA 1VQGA 1NTGA 2RSNA 2AUJD 3TS0A 4H7BA 4DNRB 5IGEA 2EYHA 5C3EB 2FFKB 2UUCL 2F1MA 5EBCA 2EJGC 1YJ9A 4DR6L 1CSQA 2IW3A 1IBLL 2JA6G 5JEAH 2R6GA 4DR6Q 5E7NA 1HFNA 3PGZA 1KAAA 3UE0A 5JJKA 4RFBA 3T1YL 1B44D 2FHTA 4JI7Q 4HSVA 1HNXQ 2JXMB 3T4AC 1QUQB 3PIOA 4MIUA 1XXGA 2A6HD 3GTMH 3W3AA 1CTMA 4DR5L 1C4QA 1I4HA 4DR3Q 1F9QA 3HP3A 1MBYA 1TT2A 4U673 4BY7G 3VR4A 4DR1L 4NDXA 3HFZB 4WRDA 4L8JA 1ET9A 4HIDA 5ELBA 1XNRL 5M5WH 1CI3M 1CT1D 1SR3A 3DHQA 4GKJQ 3TMEA 4EVOA 2F0UA 2JA7H 4A3EG 5GROA 3T56B 1WJJA 1JWUD 1VQHA 1WCMB 4FDBA 1MSHA 3R2TA 5JVH3 5L37A 5CV4A 1KDBA 3S16H 2JEAI 1TKWB 2PQAB 5I2XA 1RIPA 1T9HA 1IBKQ 4OEMB 1AE3A 1X56A 5FLXE 1KDCA 2HIVA 1XTDA 2DY8A 2F0FA 3HOWB 5ELCA 2EOTA 3PUWA 2XTIA 2PZTA 4LFCQ 4B3MQ 1QOHA 3NWSA 4IFDI 2BOSA 5C4XH 2IX1A 4WJ3M 2Z6KA 1QE6A 4OXPA 2A6ED 2XVSA 2CH4W 1UWVA 5E3FA 2ZXPA 1T5XD 2XGTA 4BY7H 4N9TA 5DAUA 4A3BG 1D2BA 4R4OA 1CKNB 1LLRD 1ZEQX 1P8LA 3BJUA 4C3JB 2B8GA 4X65L 2C35B 1SMXA 1HNZQ 4LWCA 1STEA 1DGSA 4LF7L 1PH9A 4JYAQ 1JWMD 1N32Q 1FL0A 2NYZD 3TDQA 5I9PA 1JC7A 4OX9Q 3BVZA 1EEID 4A93H 4X64L 2BCOA 2K01A 2XSCA 1UNSA 3HGBA 4IURA 3U58A 1W6KA 4LFBL 2F0MA 4XQQA 5D3DA 1I4PA 2K03A 5IWAL 4LF5L 1A3VA 1STBA 1SYGA 2QCPX 3WDNA 2GVAA 3FDTA 4N9PA 2D2CC 1W2BA 4A3CG 4RAUC 1W3SA 4EQOA 4X6AH 4K5XA 3D8GA 1VQ8A 3I90A 1AW7A 1X9NA 4A3IG 2N55A 4IUUA 4NW2A 1QZGA 3SEBA 4KN4C 1T5EA 5IE8A 1EIGA 2F4VQ 4X3SA 5E4XA 3CCUA 3PMFA 1L1OB 1I4QA 1PFSA 1O7LA 3FPPA 1DOMA 1PH4A 3CHBD 2R7ZH 3CAMA 4UY8C 1SSOA 3G4SA 2HT1A 1DCZA 1OXSC 1BBWA 1GUTA 3W5OA 1X3QA 3MXUA 3J81E 2HD3A 4L5RC 3HOUB 1ASZA 3B6YA 1PHJA 5M3MB 5M3FB 1C48A 1X3EA 4A3JH 1M90C 4B3RL 5ELEA 2VQEL 4KD3A 3TZDA 3S2DH 1UEAB 3QOLA 5IT9L 1KTKA 1LT6D 3CMEA 2NVTH 4HCEA 5CMDA 1YNJC 5LMUL 2G5DA 1A3TA 3T1YQ 1ASYA 4MHEA 3A5ZB 2VUMG 5LMNL 4FXKC 3S17H 1IW7D 4YWMA 4GLVB 1G291 4HJ8A 1OTCA 5D14A 3M3YB 3MA2B 4OL7A 5BN4A 5CBAE 4R8NA 2FINB 5C0XG 1IBML 1PA6A 2A8VA 4TSSA 1QVCA 5JVG3 1MJEA 3ERSX 2WAQB 4NMZA 1KNAA 2ZXOA 2SDFA 4A3MB 4OELB 4X65Q 4G7HC 4CJ1B 2KJXA 5BR8L 1RODA 4IZ8A 1IZ6A 1XPOA 5IYCG 1Q12A 1QB5D 1K8OA 4B08A 2EQSA 1TWGH 3OMCA 5C4JH 4Q5VA 1BDOA 2AMCB 1HFGA 1LYLA 5C4ZA 1VQLA 4A3MG 2NN6G 5C44H 5ELOA 2EY2A 4KKUA 1LTGD 1WCMG 5EKLA 3FKIB 3MXNB 4YHHQ 1NMGA 5KIXA 5M5WB 4A3LG 1LT5D 1IKLA 2JA7B 4IALA 2AQ1B 2EVBA 3MFGA 2ZM6Q 3CD6A 3HOYB 3IKJA 2PI2E 1L2FA 4E6IA 4KK7A 3JAMi 2K28A 4DV0Q 2RSOA 1JE4A 4ODGA 3RLOA 4XYOA 4JI3Q 1SYDA 3S16B 1A8VA 1UE1A 3CCSA 3C3LA 1AN8A 4A93G 4R1JA 3ER0A 1E2VA 2H1EA 1SYCA 4KHPL 2OTLA 2WB1G 3FHWA 3S15H 1GXDC 1LTID 4PNYA 4U68A 4L6TB 1YJNA 2JA8G 3CPWA 1I6HH 3H09A 1RL2A 2MQHA 2B3GA 2PMZE 3FEWX 4O2DA 1EWIA 5FJ8G 1L0WA 1PH8A 3CF5A 4BY7B 4IPGA 4JV5Q 1RTNA 1VQ6A 1ENAA 4RGOS 1GD7A 3DWQA 2OQKA 4XT3B 4PZ7A 1TWCB 1I3QB 4OHJA 3BDOA 2UUBQ 1SE4A 2EY5A 3P7JA 1IBKL 1SRUA 2A6HC 3URYA 3CKIB 3J7A5 1F9PA 2M9VA 3HRZC 1WVLA 4DV2Q 2I5MX 1AH9A 1O7IA 1LT3D 2A1AA 3NBIA 5KGUA 3M7NA 4OO1G 2D0OA 2K50A 4P2CB 2WB1E 3G48A 4ABNA 2L55A 3E6ZX 3K7UC 1Z6HA 4C3JH 4KJNA 4ULLA 2BE5C 1A6XA 2IHFA 4X66L 4C1NK 4X62L 2LXKA 2E75C 1HUMA 2MO0A 3BDLA 4A93B 4B9WA 1RCVD 2OT2A 1O7ZA 2VL6A 4HR7B 4OWWB 2EXZA 2EYMA 2F03A 4XIGS 3BZKA 4N8X1 5ELNA 4P75A 1IKMA 2EYFA 3K8AA 4IOAA 1ONLA 4XTCS 3K0YA 2QW7A 2JJQA 3UDFA 4LMQD 3VR3A 4HN7A 1E2WA 4A75A 2JA5G 1EY5A 5E4WC 1C0AA 4A3EB 1L1OC 1A0IA 3H0GH 1IBLQ 3I4NB 1HZ9A 4X3KA 2AWNA 4CKBA 4NKLA 1B9NA 3D6CA 2QEJC 4RA8A 4DUZQ 3NBHB 5I4DA 3TSSA 2ZJPA 1G8ZD 3H91A 3NTKA 4KV6A 3BS1A 2EYJA 3CQZB 3M85A 3P1HA 5EGTA 4QF4A 1HR0Q 2UXBQ 5DM73 1N34Q 1BUVT 3DUZA 5KYIA 3O13A 1JB3A 3A0JA 2F0EA 2IT1A 3TP5A 5HURA 2SNMA 1XTCD 3TBIB 4RMFA 1D5XC 3JAME 3SK8A 2B63G 4Y7NH 5M3MG 3LGJA 5IGGA 5AJ3L 4JI5L 3VR2A 3FMCA 1CKMA 1PZJD 1ESFA 3NUCA 3G71A 1RF2D 3U4ZA 3QWNA 2MPMA 4POGA 1CK1A 1NY4A 2DUDA 1MI2A 1KXLA 1O7YA 3JAML 1F9SA 2A68D 2WB1B 2JYOA 3QR8A 5IYBG 1HR0L 4FF2A 4PMCA 2KQ3A 1VF7A 2AQ2B 4LF6Q 1HUNA 3S17B 1XPRA 1SNDA 1Q46A 1UE5A 4HTHA 3X3NA 3GTGB 4IFDG 2E2HB 1WCMH 3R8BA 1AFPA 4JG2A 3OTOQ 3OYYA 2KEDA 4ILWA 3GTKH 4A3LH 1EFWA 2R3ZA 4PV1C 4DV4L 1EQTA 3NEMA 4CDCC 4S3SA 3A74A 3HOWH 2A73B 1KIXA 3TP8A 1XMOL 1BQQT 2ID0A 2NUCA 4R4CA 2UXDQ 3BZDB 1HCZA 2JA8H 2A74C 2B2VC 1V1PB 5GAEC 1ILQA 2F0JA 3SK6A 1NSNS 4HMIA 4KY5A 2KCMA 1LTAD 3FVQA 4G57A 2JA5B 4DR4Q 1S5DD 2IX0A 1STYA 4LFCL 1JE5A 1LTSD 3FRPB 4J1MA 4J6HA 4EQPA 1YHQA 2HQLA 2KCNA 4DK1A 3KLSA 4LF8Q 2WP8J 4H44C 1I4RA 3K0XA 4B3SL 1SYBA 3QO2A 2ZT9C 4KTAA 2QEXA 1IL2A 1HTLD 1RHPA 1YJWA 1X55A 1MD2D 2VB2X 3R93A 2ZTDA 4HJ7A 2VW9A 4H13C 5BN5A 2RHSB 1CZGA 1U0LA 4A3DH 3UDXA 3J7YW 2EY1A 3OW2A 5IP7G 4V0BA 2JA6H 2Y0SB 2RBMA 1Q7YC 5EKKA 5M5XH 1KQSA 2KCTA 1YBYA 1NJIC 1SROA 1G2SA 3HEJA 4DV3L 1YHBA 4ZAIA 1WI5A 2WAQE 1WOCA 4WJ4A 1EZ8A 1PFNA 5JEAJ 4LF7Q 2F0HA 5COYA 3OW7A 4F7XA 1QNKA 5FJ8H 3S24A 1RDPD 4QY7A 2DY7A 2D5DA 1SJED 2NTTA 2JSOA 3SK4A 1TS2A 4P73A 1MGSA 1L1OA 3T1HQ 1TWCH 1TWFH 1I3QH 3U9SA 2RDGA 4DV1L 1VQ4A 4KLKA 1X6OA 1G6PA 1YNND 4YHHL 1XYIA 1NNXA 3PF5A 4OWTB 3PUZA 1BO0A 2E74C 2N49A 2ZTEA 1JOOA 2EXDA 1BCPF 3OWEB 1A2UA 4DK0A 4A3DG 1LT4D 3I91A 1K9MC 4GKKL 4CDEC 5GQOA 3J81j 4A76A 3PF4A 3KDFB 2DGYA 4UAIA 1NR2A 4IUPA 2JA7G 4GNXB 4FO2A 3DXJC 2R92H 3I4OA 3RZOH 3UI2A 2Q2IA 2ES2A 3TRZA 4A3KG 1Y1VB 1U4RA 3RLFA 4HIKA 4QUFA 3S2HH 3PIP3 4XQJA 2NZ1D 3ND8A 4DV2L 4BA1I 4ALPA 3CC4A 5DLQE 3OSOA 1G51A 2BE5D 1H95A 2L0CA 5GAGC 4G7OC 1FD7D 1SJHD 1P16A 2ZTCA 5CV8A 5IGFA 1EYGA 3CQZH 1Y14B 3MXPA 1FYCA 3I72A 1IHZA 2K6AA 2AUKA 3J7AV 4PG3A 5C4XG 4HEDA 1NCVA 1A2TA 4RGMA 4DNTB 4OO1H 5EPLA 2KEEA 3T53B 1BKBA 3F1ZA 4DV6L 1SNQA 2FJ2A 3TP7A 4JBKA 4KKTA 4DPGA 5IYBH 4JI2L 2QDLA 4FF3A 2A6EC 5JJZA 1S5BD 4QUCA 3ZYYX 3GP7A 3KYHC 1PRTD 2PQAA 2WAQG 4JPBW 3Q24A 3RZDH 1G2TA 2L4NA 4H0LC 2K33A 4K8JA 1PMRA 2UUAQ 3N6RA 3K58A 1LTTD 2B2VA 3S1QB 1RJTA 3FKIH 3ULPA 2Q2TA 1VF5C 1LTRD 5CC4A 1HRJA 1TWAH 3AQQA 1JJ2A 4YCWA 2QKIC 1YHAA 4BXXG 5EAYA 3OWFA 1IBMQ 3GTQH 2RQXA 4YCVA 1N9WA 3NQTA 4GLAC 4H02A 4BBRB 4EQNA 1LM0A 3CCEA 1STHA 3Q22A 1DZ1A 4A3IH 3RUZA 2K5VA 4V190 5NUCA 2Z4IA 1B53A 1M8AA 4LUZA 2B2UC 3L7ZC 2BA1A 2I46A 1Q1EA 1WTXA 3PCOB 1KC8C 1R4PB 3PQIA 1J6QA 2LFNA 2XRQD 2Q2UA 2N78A 1QG7A 3BU2A 1V9PA 3J81L 4BBSB 2R93B 4C1NI 1VS0A 3KUPA 4YY3Q 4AQYL 2HHHL 1IXRA 4NXNQ 2CQAA 1TWHH 2B63B 4BS9A 4LNQA 2QGQA 2FXQA 3K57A 2VQFQ 3GTKB 5H1SE 4G4KA 1IYJB 5IGBA 2DN8A 2PO4A 2XIWA 2Z8LA 2KCCA 3A5UA 3IAYA 4IOCA 4K8IA 1B8AA 1I94L 2F3VA 2NB0A 1N32L 2H4OA 4GOPA 4QMGA 3HOYG 2MO1A 2ICEC 2OQ0A 4G7ZC 1GJXA 4GKJL 1ZXTA 1EIFA 3HKZB 1XMOQ 4A3BB 3GTQB 2I5LX 3KOJA 5AFWA 2O5JC 3W1BA 4WORA 5LMNQ 2KA7A 4YCUA 3OMGA 4GKKQ 3KF6B 1EEFD 3FP9A 3CXCA 3HOXB 4A3GB 3NBHA 4X3UA 3OHXC 4X3TA 3VYUA 2B2WC 1PRTB 2OF1A 3Q8DA 4ZCKA 1YEZA 1H9KA 4DR7L 2GN5A 1YNJD 1W6JA 2HIXA 2LKVA 3A8IE 3TP6A 3VR6A 3PIO3 1CQFA 3PUXA 5IYCH 1Q82C 1I5FA 3ITPA 1B50A 1XJVA 4YWLA 3ULLA 3S1RB 4BBSG 5G3LD 2R93G 3CCMA 4C3HB 3I4MG 3SGIA 1K73C 1ZYRD 1L0YB 1V43A 2F0OA 2IY5B 2BH8A 2JA6B 4JI4L 3WOEA 4IO9A 4R8IA 3GV3A 2AHOB 3D4DA 1SNPA 4J15A 4MTNA 4IUNA 1SYFA 2Z6KC 2Q8TA 4DR2Q 4CKEA 5DM63 1N34L 3F2CA 1EQQA 4JI1Q 2BDOA 4JI2Q 2K5DA 1STNA 1D6EC 5CV7A 1MJCA 1EY6A 2F0SA 5C6AA 2SEBD 2I0QA 5IP9G 1JT8A 1JICA 3ERQA 1VMCA 2RA4A 5I9OA 4IFDJ 2F0IA 3I2ZA 4OGQC 1O80A 4K2KA 3C1FA 4DV0L 2K75A 2XWJB 3EFXD 2E2JB 2NTSA 1IL8A 2IX3A 4IPHA 2JA5H 2E8GA 1F2YA 1WTQA 1ESRA 2R92B 3MZ5A 3GTMB 4L5QA 1FNWA 1GO3E 4GNXC 1SYEA 2NVYH 3S1MB 1S3OA 1YITA 1IYUA 2B29A 1WFQA 4FXDA 3VR5A 1JR0D 2NVXH 1A63A 2F0NA 3CRKC 4JK1C 5CV9A 3W1GA 3NK9A 2Z6BA 3S1NB 5C0XH 1PFMA 2K5NA 4R4TA 4QQBX 2ZJRA 1E2ZA 4DV7L 4GN4B 1EZ6A 2F52A 5FK9C 1B1ZA 4XT1B 3HOVG 4UDUC 3I7FA 4QGUA 1R4QB 1PYWD 3NQIA 3Q23A 5IGDA 4AH6A 1AZPA 4C2MB 5I6WA 1PTOD 4DAYB 5C3EG 4RCOA 1V1QA 1XMQQ 2F4IA 1KRTA 5M5XB 1SLJA 4JI7L 3RZDB 1S5ED 3H3VI 3NTIA 1H9RA 1E7ZA 4DAYA 4DGZA 5JPMC 5JOBA 2F0QA 1X3PA 2P5ZX 5JJLA 5C4XB 4GS3A 1CHQD 2F0VA 4OO1I 4I7ZC 2M2LA 1Q86C 2C5CA 5LMUQ 2NVQH 3GTLH 1EFID 2O5IC 5EPJA 2VY3A 2NWGA 4ZLTF 3DWAA 3CCJA 3VDYA 2OTJA 2Z4HA 1LO5D 1E24A 1PH2A 4K0KL 3LX0A 3PV0A 3DM3A 4BA2I 5EQ0A 1K3BC 1HPCA 1X65A 1Y1VG 3MWYW 1NR4A 5JEAG 2K7VA 4BXXH 1EY4A 3EVQA 4O0AA 5J39A 3J80c 5M9OA 1Y1WG 2GVBA 3GTPB 2A69C 1PLFA 4K14A 1A3UA 2OCEA 2LMCB 4RHSA 3K7AH 4LF9Q 4TKOB 1E22A 4UHVA 1CQVA 3RZOB 4MN3A 2L1BA 4JBMA 1VQCA 1HHVA 2UU9Q 1BCPB 2JK8A 1EU3A 4N8FA 1VQKA 2B2TC 1AP0A 2A69D 1VQBA 3ZJYC 3EA6A 3SXHA 4A3KB 1EY9A 2OXPA 4JI1L 4BBSH 2R93H 1D1IA 3GD7A 1VQ9A 4DU9A 1LABA 3T13A 2Q8RE 4X64Q 2R7ZG 4JC0A 3LWUA 2B63H 1HJPA 5BR8Q 2RF4A 1EYAA 3X3MA 3HOVB 3ULJA 5LL6S 2E5LQ 2L12A 2KECA 2HQEA 2IJ0A 1PTOB 4KD4A 2X6LA 3ND9A 1QILA 4K2LA 4FNFA 5LL6X 4J8QA 4XYQA 5M3MH 1DONA 1R9TB 5K36G 2B2YA 1V1OA 1K8MA 2DJFC 4LFAL 1AEXA 1CKNA 1TWAB 5A35A 3S2DB 4MTKA 3AB9A 1RTOA 4WFN3 2EJFC 3T1HL 3K6OA 1B4OA 1IYVA 2JN4A 1KL9A 4DKAC 5JAVA 4FXGC 1QNUA 3SK5A 1SNCA 2I5HA 4KHZA 3DMUA 2X69A 2EYPA 4KY7A 1XX8A 1EOTA 4FVMA 5IY0A 1NBWA 4IUVA 3TN2A 3KJPA 3LWEA 2KUMA 1KLUD 5DNFA 1B70B 1HNZL 3RN5A 2E2IB 2EYOA 5BN3A 1Q3LA 1CA6A 3RR5A 4LW1A 5IT9E 2MP1A 4CDDC 2JA9A 1LACA 3OIQA 1Q1BA 1TWHB 3E3XA 2ICIA 2G9DA 3DWPA 1EY7A 1GUSA 2EY6A 4LF4L 4OIKA 4AYBB 3V96A 3C2PA 1VQFA 4RGNA 3HS0C 2G9HD 1TY0A 2NVYB 3BZCA 5J22A 1R9TH 1VQNA 4NXML 2B39A 5TSSA 1HQMC 3S1QH 1MKHA 4F88A 2WKDA 5K5PA 1KNEA 5CV6A 2YTXA 5IIFA 1FVIA 2TMPA 4GN3B 1FGBD 3QOJA 5CGKA 1EQVA 1Z47A 2V4DA 4A3JG 3P20A 3EN2A 2PMZB 3OIPA 1OXUA 2O4XA 4DV6Q 1FNUA 2J4XA 2J0TD 5T1IA 4ZKCB 3J80L 4M1UB 4B3ML 2I07B 4RWSC 3T51B 3HKSA 3I8ZA 2NN6I 4PZ8A 3HOUH 4A3GH 4AYBE 1BF4A 4ZYSA 1XNRQ 1ENCA 2RHQB 4LF4Q 1SEBD 4RHRA 4QJFA 1SBBB 3FPUB 1C7YA 1QCBD 1PTOF 1ML0D 2M00A 4DAMA 2UXDL 4LAAA 3D0FA 5CBEE 5KNCA 1LTLA 3MHBA 2CWPA 2RCFA 4Z9CB 4BBRG 3KBXA 1YNNC 4OX9L 4APVA 4DK6C 1PYSB 3EROA 3BYYB 1SN8A 2V1CC 1DD2A 5FOBB 2KOLA 1TS5A 2HCCA 1A15A 3CCQA 3M3YH 3V2TA 1OXVA 4HJAA 3M4PA 2CCZA 2ZJQA 3I73A 4RH6A 3H0GG 2KVMA 1H9SB 1ICFB 4R4IA 4FF1A 2UXBL 4HJ9A 5GADC 1UAPA 5HGQA 1QUQA 2K04A 1VCIA 4XXEA 1B3QA 3JC66 4IUTA 4RKBA 4F8MA 1VDZA 5IWAQ 2VNUD 3K80C 1BOSA 3STBC 1EYDA 2EJMA 5J3BA 2K14A 1TU2B 2QDBA 2R7FA 5IT9c 1ENFA 1UE7A 5C5LA 4KHPQ 3J7ZC 2ZM6L 1BVSA 3MVVA 1J8IA 4KJOA 4P74A 2YTVA 3CCVA 4HSPA 3N52A 3CCRA 3SVMA 4JCVE 4RKLA 1V8QA 3ICEA 3BG3A 4JVZA 1RKNA 3M4QA 5D3IB 4CGYB 3CW2C 3Q6SA 1XNQQ 1PZKD 2K05A 3S14H 1KHIA 1WTHA 3D4RA 1H9SA 1WD1A 4RGTA 1JOQA 4DR3L 2EPBA 3A54A 2KHIA 4A3IB 1S72A 1U4PA 4NXMQ 1GVPA 5FLXc 1Q90A 3H0GB 3MXNA 1VQPA 3V05A 4X66Q 1KDAA 1HTPA 2EDGA 1NUCA 5EJWA 3KLRA 1E1OA 1EL0A 1QJOA 1NE3A 4LF9L 4B3TQ 3CU7A 4IUQA 2ALYB 1JWSD 1LUZA 1OXXK 4B3TL 4LUOA 4CHTB 1PTOH 1EWHA 1TWGB 5I2YA 2NVQB 1PDQA 3GTLB 4CDFC 4IJHA 1SE3A 4DR4L 2Q8IB 3HOZG 3HZXA 3TZUA 1PH5A 1KD1C 1Y8PB 4ME5A 1H9JA 3OTOL 1MSGA 1QZHA 1YZ6A 2VB3X 2R7DA 2DJGC 1WTPA 2LS01 4XDXA 1GKHA 4PQXA 3HOZH 1SNMA 5ELDA 1M1KC 4B3SQ 2JQOA 2EYLA 3PO3H 1TIID 4DXFA 3CC2A 2UUBL 3I4MB 3IL8A 3JAMc 2E2IH 3I55A 2R7ZB 5G3LF 1GUGA 1HQRD 3GTOH 4R4QA 2ZXRA 5C3XA 1VQDA 2YYZA 4KI0A 4A4IA 3HOXH 1SMYC 1CFMA 4C3HG 1SFOB 4JYAL 2PW5A 3QG1A 4EX5A 3A7LA 4LK1C 2WACA 1FGUA 4DFAA 4IFDH 4TQUS 2A5HA 4Q0FA 4TVAB 1KAWA 2JE6I 1AE2A 4P71A 1SMYD 1VQMA 1U4LA 4OONA 4YY3L 4AQYQ 2L15A 1N36L 2VUMH 4DV7Q 1CZWA 2F3WA 1EWCA 4ZUIA 1SXTA 2BA0A 1CM9A 2LXJA 2NVTB 4UP9A 3NWTA 4ZRZA 3FKIG 2B2WA 2EE1A 4JI5Q 4ZK9B 3HOVH 4HJ5A 3GTJB 2CWAA 4L5SA 3K5MA 1PYBA 4K5VA 3A55A 1EIHA 3NXWA 3NELA 3E0JA 4K6DA 4ZQ3A 4AIMA 3E9IA 2QF7A 4JBJA 2CKZB 3L9AX 1PRTF 5HY6A 1M4VA 3W2DA 3AFQA 4QIWB 5J1ZA 3KBGA 1Q8KA 3R3OA 2C9OA 2ASBA 3I3CA 1VQOA 2DNEA 1B2TA 1HH2P 1WTOA 3GTOB 4RG1A 4C3JG 4JI0L 5IP7H 3K7AB 3QJYA 3EIVA 3RMHA 2NN6H 4YIJA 4C3IH 1F2LA 5C4JB 1SFOH 3NHHA 1PXUA 3F2UA 1I50B 3LNNA 1D8LA 3BYTB 1BBXC 2NBFA 3J81c 2K4KA 3MFYA 2B2YC 4OIJA 3PO2B 4A3KH 4JI6L 4QL5A 2UU9L 2NVXB 4LF6L 5FLXL 1SNOA 1UUPA 2NZHA 4KHVA 4FP5D 4QB4A 2RDFA 3NP8A 3H3VH 4A3GG 3HOYH 4XQNA 4O42A 5A2QL 2F0WA 1GOZA 1K28A 1E3PA 1B7YB 2PYKA 5FO8B 3PIPA 2JP1A 2Y0SE 1DM0B 2AQ3B 4C2MH 1Z9FA 5FLMH 4RCNA 4DAVA 3TREA 3AFPA 1VQ5A 3K5OA 2R61A 3SE0A 3G6EA 2UUAL 2Z1CA 4DAPA 5M3FG 3S15B 2MGSA 4KN7C 3PSIA 1TR5A 3H94A 1WTVA 1I6HB 1G6ZA 1J9OA 1BCPC 2IL8A 1WD0A 4MZ9A 1CSPA 4O1NA 5A2QE 2BH2A 3H6MA 1FJGQ 2WFWA 1HZAA 4LFAQ 1X3FA 2Z9HA 1TY2A 1OO9B 5LHY1 1PVOA 1G91A 3KJOA 2K52A 3MAQA 4BWGB 2YU9B 2HDMA 1SAPA 1E1TA 2O2LD 3NE5B 3L2PA 2RCNA 3STBD 3DLLA 1VQAA 1TS4A 4IN3A 1PH7A 1D1KA 4OWXB 4L63B 1EUJA 2QILA 1Q81C 3KF8A 1RD9D 1HR0W 5FLMG 2CFMA 3E0EA 3GV6A 1FNVA 1EU4A 3D4WA 1GUNA 1V1PA 1JQYD 1JJCB 4ME3A 2E2DC 3UE1A 2EZVA 1FJGL 3A8JE 4GOPC 4WJWA 2RVLA 2FMMA 2HCIA 5C0XI 3NPPA
chains in the Genus database with same CATH topology
1PH6A 4LF8Q 2WP8J 1J5EQ 4BY7G 3K0XA 3PUYA 4B3SL 5M3MH 1PH1A 4DR1L 2UUCQ 3HFZB 1J5EL 4JBWA 1XPUA 4HIDA 2OWOA 1XNRL 2QEXA 5M5WH 1IL2A 5K36G 1SR3A 4GKJQ 4NPSA 2JA7H 3F2DA 4LFAL 4A3EG 1CKNA 3RN2A 1YIJA 1YJWA 1X55A 4DV1Q 2ZTDA 4HJ7A 2VW9A 1YI2A 1N36Q 5GROA 2F4VL 1WJJA 2JEBI 2RHSB 2VZAA 1JB7A 4IPCA 1VQHA 4FDBA 2AWOA 3T1HL 1U0LA 4A3EH 3UDXA 4A3DH 1KL9A 4DKAC 3OW2A 3S16H 1YVCA 5IP7G 2JEAI 2PQAB 2KBNA 1RIPA 1T9HA 2JA6H 1IBKQ 1AE3A 1X56A 2HIVA 1XTDA 2I5HA 1Q7YC 4KHZA 5M5XH 2KCTA 1KQSA 1YBYA 1NJIC 1SROA 5IY0A 2MNAA 1NBWA 3PUWA 4DV3L 1YHBA 2XTIA 1WI5A 2WAQE 3K81C 5C44G 2N3SA 3KJPA 4DV4Q 1B70B 4A3FG 4B3MQ 4LFCQ 1WOCA 1HNZL 3RN5A 4WJ4A 4IFDI 5JEAJ 5C4XH 4LF7Q 2IX1A 4WJ3M 3RR5A 3KFUA 2Z6KA 4OXPA 4LW1A 5FJ8H 4GLXA 4B3RQ 2PI2A 3S24A 1HNWL 2R92G 1UWVA 3TS2A 4QY7A 2JA9A 2XGTA 4BY7H 4X62Q 4A3BG 1Q1BA 4R4OA 1CKNB 4P73A 1P8LA 1L1OA 1UE6A 1TWCH 1TWFH 1Y1VH 1I3QH 3BJUA 4X65L 3T1HQ 4DV1L 2C35B 1SMXA 1VQ4A 4KLKA 1X6OA 1HNZQ 4LWCA 1G6PA 4LF4L 4YHHL 1K8GA 4L5TA 1DGSA 3PF5A 4LF7L 1VQFA 1PH9A 4JYAQ 4OWTB 3PUZA 5C0XJ 4DV5Q 3UDGA 1N32Q 1FL0A 4OX9Q 3BZCA 1VQNA 1R9TH 2N49A 2ZTEA 4A93H 4X64L 2EXDA 2F3IA 4NXML 4A3DG 3S1QH 1CKOA 1MKHA 4AYBG 1K9MC 4GKKL 3J81j 5GQOA 4A76A 2YTXA 1FVIA 4DR1Q 3PF4A 3KDFB 4GN3B 2DGYA 4LUVA 2KHJA 3U58A 2JA7G 4LFBL 4GNXB 1Z47A 3RLNA 4EQ5A 2R92H 4A3JG 4A3BH 3I4OA 2E2HH 3EN2A 3RZOH 2QA4A 3U4VA 4NXNL 5LMNW 2Q2IA 1Y1WH 1OXUA 5IWAL 2ES2A 4DV6Q 4LF5L 3TRZA 4A3KG 1VQIA 5AJ3Q 2A19A 3RLFA 2GVAA 1MIUA 4A3FH 1A62A 4HIKA 1W2BA 4B3ML 4A3CG 3HKSA 2NN6I 1W3SA 4PZ8A 1CUKA 3HOUH 4AYBE 3S2HH 4A3GH 5GAHC 4X6AH 1XNRQ 2RHQB 5M3FH 4DV2L 3IRBA 4BA1I 1VQ8A 4LF4Q 4ALPA 3CC4A 4JOIC 4QJFA 5DLQE 3KLWA 1X9NA 1C7YA 1G51A 1H95A 4A3IG 5GAGC 2EIFA 4DAMA 4UPAA 2ATWA 2UXDL 2Z0SA 1QZGA 5JJIA 3D0FA 1P16A 2ZTCA 5IE8A 1LTLA 3HKZE 2CWPA 2F4VQ 3CCUA 2Y0SG 1EYGA 3CQZH 1L1OB 1UEBA 1Y14B 4BBRG 4OX9L 1PFSA 4APVA 4DK6C 1PH4A 5C4XG 1PYSB 4PG3A 2R7ZH 3CAMA 4UY8C 2KENA 3I56A 5IYDG 1SN8A 2V1CC 3G4SA 2HT1A 1OXSC 1BBWA 1BKBA 3F1ZA 3W5OA 4DV6L 1I94Q 4LF5Q 4A3CH 1HNXL 4JBKA 1D7QA 4L5RC 4DPGA 5IYBH 3CCQA 1ASZA 4JI2L 3M3YH 1EOVA 3B6YA 1PHJA 1X54A 3KYHC 2VS1A 2PQAA 2WAQG 1OXVA 3RZDH 3I4NG 1X3EA 4LFBQ 4DNIA 4HJAA 3M4PA 3CMAA 2CCZA 2ZJQA 2UUAQ 3NENA 4A3JH 1M90C 3M4OH 3EBEA 3H0GG 4B3RL 3FKIH 1OXTA 4GN5A 3ULPA 2VQEL 4R4IA 2Q2TA 1TWAH 2K5HA 4MNOA 4HJ9A 3S2DH 3AQQA 5GADC 4A3MH 2UXBL 1JJ2A 5HGQA 1QUQA 4YCWA 1VCIA 3PO3G 1YHAA 3JC66 4BXXG 5EAYA 2VNUD 5IWAQ 1IBMQ 3GTQH 3CMEA 2NVTH 4YCVA 1N9WA 2D0PA 3K80C 3HOWG 3STBC 5LMUL 4GLAC 4H02A 4HIMA 3T1YQ 1ASYA 1LM0A 3CCEA 3A5ZB 2VUMG 5LMNL 3S17H 4Y52H 5J3BA 4A3IH 2K14A 4YWMA 2R7FA 4GLVB 2K5VA 1G291 5IT9c 4HJ8A 1OTCA 1UE7A 4KHPQ 2UXCL 4UP8A 3J7ZC 2ZM6L 4LUZA 1BVSA 3L7ZC 2BA1A 1Q1EA 4DR5Q 4P74A 1N8RC 3PCOB 2YTVA 3CCVA 1KC8C 2YU9H 3HOUG 1EQRA 1JMCA 4DV5L 5C0XG 4UP7A 1PA6A 1J6QA 3CCRA 1IBML 1VQ7A 1QVCA 4JCVE 2Q2UA 1MJEA 1XNQL 2A8VA 3ERSX 2N78A 3ICEA 3BU2A 1V9PA 3M4QA 3E9HA 1XNQQ 3CW2C 2YV5A 4X65Q 2VQEQ 1QVGA 1VS0A 4YY3Q 4AQYL 4NXNQ 2HHHL 1IXRA 3S14H 1KHIA 5BR8L 3S1NH 1TWHH 1IZ6A 1XPOA 5IYCG 4LNQA 1Q12A 2QGQA 3KF8B 4BBRH 2FXQA 4DR3L 2VQFQ 5H1SE 2KHIA 1IYJB 1HNWQ 2EQSA 1TWGH 1S72A 1K3RA 5C3EH 3UDIA 1TXYA 5C4JH 4NXMQ 1GVPA 5FLXc 3F2BA 2AMCB 3A5UA 1VQPA 3PUVA 4X66Q 4IOCA 1LYLA 1VQLA 4A3MG 1B8AA 1I94L 3AEVA 2NN6G 5C44H 5ELOA 4JI4Q 1N32L 4GOPA 3HOYG 3CPFA 1E1OA 2MO1A 1WCMG 1HZBA 2OQ0A 3MXNB 4YHHQ 1NMFA 1NMGA 4GKJL 3KF6A 1NE3A 4LF9L 4DUYL 1EIFA 1X3GA 1XMOQ 4B3TQ 4A3LG 4IJLA 4BY1G 2I5LX 2ZM6Q 2ALYB 3KOJA 1LUZA 1OXXK 3W1BA 4B3TL 3CD6A 5LMNQ 4YCUA 4GKKQ 1N33Q 2PI2E 1K0RA 1L2FA 3KF6B 2N8NA 4LUOA 3JAMi 3FP9A 3CXCA 4DV0Q 3GTJH 4YWKA 3L0OA 3RLOA 4JI3Q 4IJHA 4BY1H 1VQEA 4DR4L 3HOZG 1PH5A 1KD1C 4DV3Q 2E5LL 1A8VA 1UE1A 3CP0A 3OTOL 3CCSA 1QZHA 1YZ6A 3Q8DA 4QIWE 1YEZA 4R1JA 4A93G 3ER0A 4DR7L 2GN5A 2R7DA 2HIXA 1QVFA 4KHPL 1GKHA 3HOZH 2D62A 1M1KC 2WB1G 3FHWA 2OTLA 3PUXA 5IYCH 2VQFL 1I5FA 1Q82C 2JQOA 3GO5A 4B3SQ 3S15H 1XJVA 4YWLA 2JA8G 3ULLA 4GNXA 1YJNA 3PO3H 3CPWA 4BBSG 2R93G 3CC2A 4DR2L 3CCMA 3MEFA 2UUBL 3JAMc 3I4MG 1I6HH 1RL2A 4DUYQ 2E2IH 3I55A 3SGIA 1K73C 2MQHA 2B3GA 3GTOH 2PMZE 4O2DA 4R4QA 1EWIA 1V43A 5FJ8G 2IY5B 1VQDA 1K83H 1L0WA 2BH8A 2YYZA 1PH8A 4KI0A 4A4IA 2H5XA 3CF5A 4JI4L 3HOXH 4IPGA 3TQYA 4JV5Q 4IO9A 1VQ6A 4JYAL 1GD7A 2AHOB 4EX5A 2OQKA 4J15A 4JI6Q 4PZ7A 4MTNA 2AKWB 1FGUA 2Z6KC 3H15A 4TQUS 4JOIA 4DR2Q 2UUBQ 1IBKL 1SRUA 4TVAB 1KAWA 2JE6I 3F2CA 1EQQA 1AE2A 4JI1Q 1U5KA 1N34L 3PO2H 4P71A 4JI2Q 1VQMA 4POFA 4OONA 4YY3L 4AQYQ 2L15A 3J7A5 4PZ6A 4DV2Q 1N36L 2VUMH 2I5MX 2YTYA 1MJCA 4DV7Q 3S1RH 1AH9A 3F8TA 3I4MH 2I0QA 2LSSA 3GDEA 2BA0A 5IP9G 1O7IA 4DR7Q 1JT8A 2A1AA 2LXJA 4UP9A 3M7NA 4OO1G 2D0OA 4IFDJ 2K50A 3I2ZA 2WB1E 3G48A 3KDFA 3FKIG 4DV0L 2K75A 3K7UC 2CQOA 4JI5Q 4C3JH 2JA5H 3HOVH 4IPHA 2E8GA 3CC7A 4HJ5A 1SE8A 2CWAA 2IHFA 4X66L 4L5SA 4L5QA 1YNXA 1PYBA 4X62L 1GO3E 3AYHB 1PV4A 2LXKA 3NELA 4PMWA 4AIMA 4GNXC 3I4NH 2UXCQ 3E9IA 2NVYH 1KRSA 1S3OA 2MO0A 1YITA 2MFIA 4JBJA 2CKZB 2VL6A 4OWWB 3CCLA 5HY6A 3TEHB 3J81i 2B29A 1WFQA 1PH3A 3AFQA 4XIGS 3BZKA 2NVXH 1A63A 5ELNA 3HOXG 4P75A 3W1GA 4JV5L 1Q8KA 3K8AA 2ASBA 4IOAA 1XMQL 1VQOA 5IP9H 1HH2P 4XTCS 2K5NA 4RG1A 4R4TA 2JJQA 3UDFA 2E2JH 5IP7H 2ZJRA 4JI0L 4QQBX 1S40A 4DV7L 3EIVA 4GN4B 4A75A 2F52A 4C3IH 1N33L 2JA5G 3HOVG 3PO2G 1C0AA 3I7FA 4QGUA 1SFOH 3D31A 1L1OC 1A0IA 3H0GH 1IBLQ 4AH6A 1HZ9A 4P72A 4LF8L 1D8LA 2AWNA 3S1MH 4DAYB 5C3EG 3J81c 1WYDA 4DUZQ 1V1QA 2K4KA 3NBHB 1XMQQ 1KRTA 4JI8L 5M5YH 2ZJPA 1SLJA 4A3KH 4JI6L 4DUZL 4HIOA 4QL5A 1BBUA 2UU9L 4JI7L 4LF6L 3H3VI 4NB3A 1E7ZA 3M85A 1GM5A 2NZHA 1JJGA 1HR0Q 2UXBQ 5JJLA 3WWVA 1HZCA 1N34Q 5IYDH 3H3VH 4A3GG 1K8AC 3HOYH 4GS3A 3GTPH 3J80i 4OO1I 3A0JA 2Q2HA 1Q86C 2IT1A 5LMUQ 3GTGH 2NVQH 3GTLH 1E3PA 1B7YB 4RMFA 3PIPA 3M9BA 2Y0SE 1I50H 2VY3A 2B63G 4C2MH 5M3MG 1Z9FA 3HKZG 3LGJA 3U50C 4DK3C 4Y7NH 3CCJA 5FLMH 3RNUA 3VDYA 2IHEA 5AJ3L 4JI5L 2OTJA 1E24A 3TREA 3AFPA 4IPDA 1PH2A 1VQ5A 1CKMA 2PNHA 4K0KL 3PV0A 3G71A 3DM3A 4BA2I 3U4ZA 1EIYB 4JI3L 3G6EA 2UUAL 4JI8Q 4POGA 2DUDA 1NY4A 1X65A 5M3FG 1KXLA 1Y1VG 5JEAG 3PSIA 4BXXH 4O0AA 4C3HH 4GOPB 3J80c 1VQJA 5IYBG 4MZ9A 1Y1WG 1HR0L 2GVBA 4JI0Q 1CSPA 2HHHQ 2OCEA 1C9OA 2NZOA 2BH2A 4LF6Q 4IFDG 1XPRA 1Q46A 1UE5A 3K7AH 1E22A 4LF9Q 1FJGQ 1WCMH 4K0KQ 2WFWA 1HZAA 1VQGA 4LFAQ 4JBMA 1VQCA 1X3FA 1NTGA 4JG2A 3OTOQ 3TS0A 3OYYA 2UU9Q 1PVOA 3GTKH 2JK8A 1VQKA 4A3LH 1EFWA 4DV4L 3NEMA 3KJOA 2K52A 1VQBA 3ZJYC 2UUCL 1E1TA 3A74A 3L2PA 1YJ9A 3HOWH 2RCNA 4DR6L 1CSQA 3STBD 3DLLA 1KIXA 1IBLL 1XMOL 2JA6G 2ID0A 4JI1L 2R6GA 4R4CA 2UXDQ 1VQAA 4BBSH 4DR6Q 2R93H 3GD7A 5E7NA 1VQ9A 2JA8H 3PGZA 3UE0A 5JJKA 5GAEC 1PH7A 4X64Q 4OWXB 2R7ZG 3T1YL 1EUJA 4JC0A 2B63H 1HJPA 1Q81C 1HR0W 5BR8Q 2RF4A 5FLMG 4JI7Q 2CFMA 1HNXQ 2KCMA 3E0EA 1QUQB 3PIOA 3ULJA 4DR4Q 2IX0A 4LFCL 1JE5A 1JJCB 4ME3A 3UE1A 2E5LQ 3GTMH 1FJGL 4GOPC 4DR5L 1YHQA 2HQLA 5C0XI 4DR3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH6 A;  4LF8 Q;  2WP8 J;  1J5E Q;  4BY7 G;  3K0X A;  3PUY A;  4B3S L;  5M3M H;  1PH1 A;  4DR1 L;  2UUC Q;  3HFZ B;  1J5E L;  4JBW A;  1XPU A;  4HID A;  2OWO A;  1XNR L;  2QEX A;  5M5W H;  1IL2 A;  5K36 G;  1SR3 A;  4GKJ Q;  4NPS A;  2JA7 H;  3F2D A;  4LFA L;  4A3E G;  1CKN A;  3RN2 A;  1YIJ A;  1YJW A;  1X55 A;  4DV1 Q;  2ZTD A;  4HJ7 A;  2VW9 A;  1YI2 A;  1N36 Q;  5GRO A;  2F4V L;  1WJJ A;  2JEB I;  2RHS B;  2VZA A;  1JB7 A;  4IPC A;  1VQH A;  4FDB A;  2AWO A;  3T1H L;  1U0L A;  4A3E H;  3UDX A;  4A3D H;  1KL9 A;  4DKA C;  3OW2 A;  3S16 H;  1YVC A;  5IP7 G;  2JEA I;  2PQA B;  2KBN A;  1RIP A;  1T9H A;  2JA6 H;  1IBK Q;  1AE3 A;  1X56 A;  2HIV A;  1XTD A;  2I5H A;  1Q7Y C;  4KHZ A;  5M5X H;  2KCT A;  1KQS A;  1YBY A;  1NJI C;  1SRO A;  5IY0 A;  2MNA A;  1NBW A;  3PUW A;  4DV3 L;  1YHB A;  2XTI A;  1WI5 A;  2WAQ E;  3K81 C;  5C44 G;  2N3S A;  3KJP A;  4DV4 Q;  1B70 B;  4A3F G;  4B3M Q;  4LFC Q;  1WOC A;  1HNZ L;  3RN5 A;  4WJ4 A;  4IFD I;  5JEA J;  5C4X H;  4LF7 Q;  2IX1 A;  4WJ3 M;  3RR5 A;  3KFU A;  2Z6K A;  4OXP A;  4LW1 A;  5FJ8 H;  4GLX A;  4B3R Q;  2PI2 A;  3S24 A;  1HNW L;  2R92 G;  1UWV A;  3TS2 A;  4QY7 A;  2JA9 A;  2XGT A;  4BY7 H;  4X62 Q;  4A3B G;  1Q1B A;  4R4O A;  1CKN B;  4P73 A;  1P8L A;  1L1O A;  1UE6 A;  1TWC H;  1TWF H;  1Y1V H;  1I3Q H;  3BJU A;  4X65 L;  3T1H Q;  4DV1 L;  2C35 B;  1SMX A;  1VQ4 A;  4KLK A;  1X6O A;  1HNZ Q;  4LWC A;  1G6P A;  4LF4 L;  4YHH L;  1K8G A;  4L5T A;  1DGS A;  3PF5 A;  4LF7 L;  1VQF A;  1PH9 A;  4JYA Q;  4OWT B;  3PUZ A;  5C0X J;  4DV5 Q;  3UDG A;  1N32 Q;  1FL0 A;  4OX9 Q;  3BZC A;  1VQN A;  1R9T H;  2N49 A;  2ZTE A;  4A93 H;  4X64 L;  2EXD A;  2F3I A;  4NXM L;  4A3D G;  3S1Q H;  1CKO A;  1MKH A;  4AYB G;  1K9M C;  4GKK L;  3J81 j;  5GQO A;  4A76 A;  2YTX A;  1FVI A;  4DR1 Q;  3PF4 A;  3KDF B;  4GN3 B;  2DGY A;  4LUV A;  2KHJ A;  3U58 A;  2JA7 G;  4LFB L;  4GNX B;  1Z47 A;  3RLN A;  4EQ5 A;  2R92 H;  4A3J G;  4A3B H;  3I4O A;  2E2H H;  3EN2 A;  3RZO H;  2QA4 A;  3U4V A;  4NXN L;  5LMN W;  2Q2I A;  1Y1W H;  1OXU A;  5IWA L;  2ES2 A;  4DV6 Q;  4LF5 L;  3TRZ A;  4A3K G;  1VQI A;  5AJ3 Q;  2A19 A;  3RLF A;  2GVA A;  1MIU A;  4A3F H;  1A62 A;  4HIK A;  1W2B A;  4B3M L;  4A3C G;  3HKS A;  2NN6 I;  1W3S A;  4PZ8 A;  1CUK A;  3HOU H;  4AYB E;  3S2H H;  4A3G H;  5GAH C;  4X6A H;  1XNR Q;  2RHQ B;  5M3F H;  4DV2 L;  3IRB A;  4BA1 I;  1VQ8 A;  4LF4 Q;  4ALP A;  3CC4 A;  4JOI C;  4QJF A;  5DLQ E;  3KLW A;  1X9N A;  1C7Y A;  1G51 A;  1H95 A;  4A3I G;  5GAG C;  2EIF A;  4DAM A;  4UPA A;  2ATW A;  2UXD L;  2Z0S A;  1QZG A;  5JJI A;  3D0F A;  1P16 A;  2ZTC A;  5IE8 A;  1LTL A;  3HKZ E;  2CWP A;  2F4V Q;  3CCU A;  2Y0S G;  1EYG A;  3CQZ H;  1L1O B;  1UEB A;  1Y14 B;  4BBR G;  4OX9 L;  1PFS A;  4APV A;  4DK6 C;  1PH4 A;  5C4X G;  1PYS B;  4PG3 A;  2R7Z H;  3CAM A;  4UY8 C;  2KEN A;  3I56 A;  5IYD G;  1SN8 A;  2V1C C;  3G4S A;  2HT1 A;  1OXS C;  1BBW A;  1BKB A;  3F1Z A;  3W5O A;  4DV6 L;  1I94 Q;  4LF5 Q;  4A3C H;  1HNX L;  4JBK A;  1D7Q A;  4L5R C;  4DPG A;  5IYB H;  3CCQ A;  1ASZ A;  4JI2 L;  3M3Y H;  1EOV A;  3B6Y A;  1PHJ A;  1X54 A;  3KYH C;  2VS1 A;  2PQA A;  2WAQ G;  1OXV A;  3RZD H;  3I4N G;  1X3E A;  4LFB Q;  4DNI A;  4HJA A;  3M4P A;  3CMA A;  2CCZ A;  2ZJQ A;  2UUA Q;  3NEN A;  4A3J H;  1M90 C;  3M4O H;  3EBE A;  3H0G G;  4B3R L;  3FKI H;  1OXT A;  4GN5 A;  3ULP A;  2VQE L;  4R4I A;  2Q2T A;  1TWA H;  2K5H A;  4MNO A;  4HJ9 A;  3S2D H;  3AQQ A;  5GAD C;  4A3M H;  2UXB L;  1JJ2 A;  5HGQ A;  1QUQ A;  4YCW A;  1VCI A;  3PO3 G;  1YHA A;  3JC6 6;  4BXX G;  5EAY A;  2VNU D;  5IWA Q;  1IBM Q;  3GTQ H;  3CME A;  2NVT H;  4YCV A;  1N9W A;  2D0P A;  3K80 C;  3HOW G;  3STB C;  5LMU L;  4GLA C;  4H02 A;  4HIM A;  3T1Y Q;  1ASY A;  1LM0 A;  3CCE A;  3A5Z B;  2VUM G;  5LMN L;  3S17 H;  4Y52 H;  5J3B A;  4A3I H;  2K14 A;  4YWM A;  2R7F A;  4GLV B;  2K5V A;  1G29 1;  5IT9 c;  4HJ8 A;  1OTC A;  1UE7 A;  4KHP Q;  2UXC L;  4UP8 A;  3J7Z C;  2ZM6 L;  4LUZ A;  1BVS A;  3L7Z C;  2BA1 A;  1Q1E A;  4DR5 Q;  4P74 A;  1N8R C;  3PCO B;  2YTV A;  3CCV A;  1KC8 C;  2YU9 H;  3HOU G;  1EQR A;  1JMC A;  4DV5 L;  5C0X G;  4UP7 A;  1PA6 A;  1J6Q A;  3CCR A;  1IBM L;  1VQ7 A;  1QVC A;  4JCV E;  2Q2U A;  1MJE A;  1XNQ L;  2A8V A;  3ERS X;  2N78 A;  3ICE A;  3BU2 A;  1V9P A;  3M4Q A;  3E9H A;  1XNQ Q;  3CW2 C;  2YV5 A;  4X65 Q;  2VQE Q;  1QVG A;  1VS0 A;  4YY3 Q;  4AQY L;  4NXN Q;  2HHH L;  1IXR A;  3S14 H;  1KHI A;  5BR8 L;  3S1N H;  1TWH H;  1IZ6 A;  1XPO A;  5IYC G;  4LNQ A;  1Q12 A;  2QGQ A;  3KF8 B;  4BBR H;  2FXQ A;  4DR3 L;  2VQF Q;  5H1S E;  2KHI A;  1IYJ B;  1HNW Q;  2EQS A;  1TWG H;  1S72 A;  1K3R A;  5C3E H;  3UDI A;  1TXY A;  5C4J H;  4NXM Q;  1GVP A;  5FLX c;  3F2B A;  2AMC B;  3A5U A;  1VQP A;  3PUV A;  4X66 Q;  4IOC A;  1LYL A;  1VQL A;  4A3M G;  1B8A A;  1I94 L;  3AEV A;  2NN6 G;  5C44 H;  5ELO A;  4JI4 Q;  1N32 L;  4GOP A;  3HOY G;  3CPF A;  1E1O A;  2MO1 A;  1WCM G;  1HZB A;  2OQ0 A;  3MXN B;  4YHH Q;  1NMF A;  1NMG A;  4GKJ L;  3KF6 A;  1NE3 A;  4LF9 L;  4DUY L;  1EIF A;  1X3G A;  1XMO Q;  4B3T Q;  4A3L G;  4IJL A;  4BY1 G;  2I5L X;  2ZM6 Q;  2ALY B;  3KOJ A;  1LUZ A;  1OXX K;  3W1B A;  4B3T L;  3CD6 A;  5LMN Q;  4YCU A;  4GKK Q;  1N33 Q;  2PI2 E;  1K0R A;  1L2F A;  3KF6 B;  2N8N A;  4LUO A;  3JAM i;  3FP9 A;  3CXC A;  4DV0 Q;  3GTJ H;  4YWK A;  3L0O A;  3RLO A;  4JI3 Q;  4IJH A;  4BY1 H;  1VQE A;  4DR4 L;  3HOZ G;  1PH5 A;  1KD1 C;  4DV3 Q;  2E5L L;  1A8V A;  1UE1 A;  3CP0 A;  3OTO L;  3CCS A;  1QZH A;  1YZ6 A;  3Q8D A;  4QIW E;  1YEZ A;  4R1J A;  4A93 G;  3ER0 A;  4DR7 L;  2GN5 A;  2R7D A;  2HIX A;  1QVF A;  4KHP L;  1GKH A;  3HOZ H;  2D62 A;  1M1K C;  2WB1 G;  3FHW A;  2OTL A;  3PUX A;  5IYC H;  2VQF L;  1I5F A;  1Q82 C;  2JQO A;  3GO5 A;  4B3S Q;  3S15 H;  1XJV A;  4YWL A;  2JA8 G;  3ULL A;  4GNX A;  1YJN A;  3PO3 H;  3CPW A;  4BBS G;  2R93 G;  3CC2 A;  4DR2 L;  3CCM A;  3MEF A;  2UUB L;  3JAM c;  3I4M G;  1I6H H;  1RL2 A;  4DUY Q;  2E2I H;  3I55 A;  3SGI A;  1K73 C;  2MQH A;  2B3G A;  3GTO H;  2PMZ E;  4O2D A;  4R4Q A;  1EWI A;  1V43 A;  5FJ8 G;  2IY5 B;  1VQD A;  1K83 H;  1L0W A;  2BH8 A;  2YYZ A;  1PH8 A;  4KI0 A;  4A4I A;  2H5X A;  3CF5 A;  4JI4 L;  3HOX H;  4IPG A;  3TQY A;  4JV5 Q;  4IO9 A;  1VQ6 A;  4JYA L;  1GD7 A;  2AHO B;  4EX5 A;  2OQK A;  4J15 A;  4JI6 Q;  4PZ7 A;  4MTN A;  2AKW B;  1FGU A;  2Z6K C;  3H15 A;  4TQU S;  4JOI A;  4DR2 Q;  2UUB Q;  1IBK L;  1SRU A;  4TVA B;  1KAW A;  2JE6 I;  3F2C A;  1EQQ A;  1AE2 A;  4JI1 Q;  1U5K A;  1N34 L;  3PO2 H;  4P71 A;  4JI2 Q;  1VQM A;  4POF A;  4OON A;  4YY3 L;  4AQY Q;  2L15 A;  3J7A 5;  4PZ6 A;  4DV2 Q;  1N36 L;  2VUM H;  2I5M X;  2YTY A;  1MJC A;  4DV7 Q;  3S1R H;  1AH9 A;  3F8T A;  3I4M H;  2I0Q A;  2LSS A;  3GDE A;  2BA0 A;  5IP9 G;  1O7I A;  4DR7 Q;  1JT8 A;  2A1A A;  2LXJ A;  4UP9 A;  3M7N A;  4OO1 G;  2D0O A;  4IFD J;  2K50 A;  3I2Z A;  2WB1 E;  3G48 A;  3KDF A;  3FKI G;  4DV0 L;  2K75 A;  3K7U C;  2CQO A;  4JI5 Q;  4C3J H;  2JA5 H;  3HOV H;  4IPH A;  2E8G A;  3CC7 A;  4HJ5 A;  1SE8 A;  2CWA A;  2IHF A;  4X66 L;  4L5S A;  4L5Q A;  1YNX A;  1PYB A;  4X62 L;  1GO3 E;  3AYH B;  1PV4 A;  2LXK A;  3NEL A;  4PMW A;  4AIM A;  4GNX C;  3I4N H;  2UXC Q;  3E9I A;  2NVY H;  1KRS A;  1S3O A;  2MO0 A;  1YIT A;  2MFI A;  4JBJ A;  2CKZ B;  2VL6 A;  4OWW B;  3CCL A;  5HY6 A;  3TEH B;  3J81 i;  2B29 A;  1WFQ A;  1PH3 A;  3AFQ A;  4XIG S;  3BZK A;  2NVX H;  1A63 A;  5ELN A;  3HOX G;  4P75 A;  3W1G A;  4JV5 L;  1Q8K A;  3K8A A;  2ASB A;  4IOA A;  1XMQ L;  1VQO A;  5IP9 H;  1HH2 P;  4XTC S;  2K5N A;  4RG1 A;  4R4T A;  2JJQ A;  3UDF A;  2E2J H;  5IP7 H;  2ZJR A;  4JI0 L;  4QQB X;  1S40 A;  4DV7 L;  3EIV A;  4GN4 B;  4A75 A;  2F52 A;  4C3I H;  1N33 L;  2JA5 G;  3HOV G;  3PO2 G;  1C0A A;  3I7F A;  4QGU A;  1SFO H;  3D31 A;  1L1O C;  1A0I A;  3H0G H;  1IBL Q;  4AH6 A;  1HZ9 A;  4P72 A;  4LF8 L;  1D8L A;  2AWN A;  3S1M H;  4DAY B;  5C3E G;  3J81 c;  1WYD A;  4DUZ Q;  1V1Q A;  2K4K A;  3NBH B;  1XMQ Q;  1KRT A;  4JI8 L;  5M5Y H;  2ZJP A;  1SLJ A;  4A3K H;  4JI6 L;  4DUZ L;  4HIO A;  4QL5 A;  1BBU A;  2UU9 L;  4JI7 L;  4LF6 L;  3H3V I;  4NB3 A;  1E7Z A;  3M85 A;  1GM5 A;  2NZH A;  1JJG A;  1HR0 Q;  2UXB Q;  5JJL A;  3WWV A;  1HZC A;  1N34 Q;  5IYD H;  3H3V H;  4A3G G;  1K8A C;  3HOY H;  4GS3 A;  3GTP H;  3J80 i;  4OO1 I;  3A0J A;  2Q2H A;  1Q86 C;  2IT1 A;  5LMU Q;  3GTG H;  2NVQ H;  3GTL H;  1E3P A;  1B7Y B;  4RMF A;  3PIP A;  3M9B A;  2Y0S E;  1I50 H;  2VY3 A;  2B63 G;  4C2M H;  5M3M G;  1Z9F A;  3HKZ G;  3LGJ A;  3U50 C;  4DK3 C;  4Y7N H;  3CCJ A;  5FLM H;  3RNU A;  3VDY A;  2IHE A;  5AJ3 L;  4JI5 L;  2OTJ A;  1E24 A;  3TRE A;  3AFP A;  4IPD A;  1PH2 A;  1VQ5 A;  1CKM A;  2PNH A;  4K0K L;  3PV0 A;  3G71 A;  3DM3 A;  4BA2 I;  3U4Z A;  1EIY B;  4JI3 L;  3G6E A;  2UUA L;  4JI8 Q;  4POG A;  2DUD A;  1NY4 A;  1X65 A;  5M3F G;  1KXL A;  1Y1V G;  5JEA G;  3PSI A;  4BXX H;  4O0A A;  4C3H H;  4GOP B;  3J80 c;  1VQJ A;  5IYB G;  4MZ9 A;  1Y1W G;  1HR0 L;  2GVB A;  4JI0 Q;  1CSP A;  2HHH Q;  2OCE A;  1C9O A;  2NZO A;  2BH2 A;  4LF6 Q;  4IFD G;  1XPR A;  1Q46 A;  1UE5 A;  3K7A H;  1E22 A;  4LF9 Q;  1FJG Q;  1WCM H;  4K0K Q;  2WFW A;  1HZA A;  1VQG A;  4LFA Q;  4JBM A;  1VQC A;  1X3F A;  1NTG A;  4JG2 A;  3OTO Q;  3TS0 A;  3OYY A;  2UU9 Q;  1PVO A;  3GTK H;  2JK8 A;  1VQK A;  4A3L H;  1EFW A;  4DV4 L;  3NEM A;  3KJO A;  2K52 A;  1VQB A;  3ZJY C;  2UUC L;  1E1T A;  3A74 A;  3L2P A;  1YJ9 A;  3HOW H;  2RCN A;  4DR6 L;  1CSQ A;  3STB D;  3DLL A;  1KIX A;  1IBL L;  1XMO L;  2JA6 G;  2ID0 A;  4JI1 L;  2R6G A;  4R4C A;  2UXD Q;  1VQA A;  4BBS H;  4DR6 Q;  2R93 H;  3GD7 A;  5E7N A;  1VQ9 A;  2JA8 H;  3PGZ A;  3UE0 A;  5JJK A;  5GAE C;  1PH7 A;  4X64 Q;  4OWX B;  2R7Z G;  3T1Y L;  1EUJ A;  4JC0 A;  2B63 H;  1HJP A;  1Q81 C;  1HR0 W;  5BR8 Q;  2RF4 A;  5FLM G;  4JI7 Q;  2CFM A;  1HNX Q;  2KCM A;  3E0E A;  1QUQ B;  3PIO A;  3ULJ A;  4DR4 Q;  2IX0 A;  4LFC L;  1JE5 A;  1JJC B;  4ME3 A;  3UE1 A;  2E5L Q;  3GTM H;  1FJG L;  4GOP C;  4DR5 L;  1YHQ A;  2HQL A;  5C0X I;  4DR3 Q; 
#chains in the Genus database with same CATH topology
 4HAE A;  1PH6 A;  1J5E Q;  2K5W A;  2SNS A;  3D3R A;  3EJI A;  1STA A;  3PUY A;  1PH1 A;  2UUC Q;  1ET6 A;  3H3V C;  4GZY C;  1J5E L;  2XN9 C;  3BVM A;  4JBW A;  3A7A B;  1XPU A;  2OWO A;  1O78 A;  3KLS X;  4NPS A;  3F2D A;  3RN2 A;  1YIJ A;  3S9W A;  4DV1 Q;  1YI2 A;  1PRT C;  1N36 Q;  2J7Z A;  2F0L A;  2VZA A;  2JEB I;  1JB7 A;  2F4V L;  5IGC A;  4IPC A;  2AWO A;  4A3E H;  4QCL A;  1YVC A;  4R9W A;  2KBN A;  3R2I A;  2XNA C;  3OOC A;  5CV5 A;  5M5Y B;  3I4L A;  3WOF A;  1WTW A;  2MNA A;  3BDC A;  3K81 C;  3K5L A;  4JI6 Q;  1VMP A;  5C44 G;  2N3S A;  4DV4 Q;  4A3F G;  3PO3 B;  2CVR A;  5JPN C;  3U9O A;  4JW0 A;  5IOD A;  3KFU A;  1X32 A;  4GLX A;  4B3R Q;  2PI2 A;  5KND A;  1HNW L;  2R92 G;  4I7A A;  3TS2 A;  3S14 B;  2XWB B;  4X62 Q;  4CJ0 B;  1I4X A;  1UE6 A;  1Y1V H;  2PQE A;  2E76 C;  4ZKB B;  2WIN B;  2A68 C;  1F2M A;  1K8G A;  4L5T A;  3K5N A;  5C0X J;  2OEO A;  4DV5 Q;  3UDG A;  4PMB A;  3D6W A;  2F3I A;  1NAP A;  1K0S A;  3M4O B;  1TQO A;  5CR3 A;  1CKO A;  4AYB G;  1F77 A;  4DR1 Q;  4LUV A;  2KHJ A;  1DJR D;  3RLN A;  4EQ5 A;  4KKS A;  4A3B H;  2E2H H;  3QIA A;  1HXY D;  4DF7 A;  5COR A;  3U4V A;  4NXN L;  2QA4 A;  1S4Z A;  5LMN W;  1Y1W H;  2CH4 A;  2MJ8 A;  1VQI A;  5AJ3 Q;  1TWF B;  2A19 A;  2F0P A;  1MIU A;  1HA6 A;  5KYL A;  4A3F H;  3OPO A;  1A62 A;  3Q0A A;  1KLG D;  4C3I B;  3G6J B;  2K32 A;  1CUK A;  3NTH A;  2L5T A;  5GAH C;  5M3F H;  3IRB A;  4JOI C;  5DEH A;  3KLW A;  2RKS A;  2EIF A;  4UPA A;  2ATW A;  2Z0S A;  2N88 A;  5JJI A;  3HOZ B;  1QWY A;  4B9X A;  3HKZ E;  2LY7 A;  4M8A A;  2Y0S G;  2B2U A;  1UEB A;  1ICW A;  1EYC A;  1JCK B;  2KEN A;  5IYD G;  3I56 A;  4ID6 A;  2CHB D;  1D5Z C;  4K6L A;  2F0T A;  1I94 Q;  4LF5 Q;  4A3C H;  1HNX L;  1D7Q A;  1S5C D;  3S2H B;  5FO9 B;  1EOV A;  1SE2 A;  1X54 A;  4CKC A;  2PZU A;  2VS1 A;  1GUO A;  2F0G A;  3I4N G;  4LFB Q;  4DNI A;  3CMA A;  3NEN A;  3M4O H;  3EBE A;  2L9H A;  1OXT A;  4GN5 A;  1XWE A;  2K5H A;  4MNO A;  4A3M H;  2IWH A;  4KMU C;  3PO3 G;  1DOL A;  2D0P A;  4A3D B;  1Y1W B;  3HOW G;  1GUW A;  4HIM A;  4EGV A;  4Y52 H;  1Y69 U;  2F0D A;  4KY6 A;  1EY0 A;  4BY1 B;  4C3I G;  5FO7 B;  2UXC L;  1BCP D;  2FMC A;  3AU7 A;  4UP8 A;  4LJZ C;  1KAB A;  4DR5 Q;  1N8R C;  2YU9 H;  3HOU G;  1EQR A;  1JMC A;  4DV5 L;  4UP7 A;  1VQ7 A;  2D9U A;  1XNQ L;  5T1G A;  4FF4 A;  1GHJ A;  2BDN A;  3SHL A;  3E9H A;  2YV5 A;  3MEH A;  1JOR A;  2VQE Q;  3K59 A;  5ISR A;  1QVG A;  3S1N H;  4CJ2 C;  3KF8 B;  4BBR H;  1K83 B;  1PZI D;  4K5W A;  5ELF A;  1U4M A;  2GA4 B;  1HNW Q;  1D5M C;  1K3R A;  2HUG A;  5C3E H;  3UDI A;  1TXY A;  2B8F A;  1DYQ A;  3F2B A;  1BNZ A;  1B9M A;  5FKA C;  2F0K A;  3PUV A;  3AEV A;  4JI4 Q;  3CPF A;  4IQZ A;  1HZB A;  4HMJ A;  3AMU A;  1NMF A;  1Z7T A;  1STG A;  3KF6 A;  4TRD A;  4DUY L;  3T16 A;  1JOK A;  1X3G A;  1PTO C;  3J80 E;  1CA5 A;  4IJL A;  1HA5 A;  4BY1 G;  3MTS A;  2L11 A;  2PPB C;  1N33 Q;  1K0R A;  2N8N A;  1U9R A;  2XRS D;  3HG9 A;  3GTJ H;  3ONA B;  4YWK A;  3L0O A;  1II3 A;  4ZUJ A;  4BY1 H;  1VQE A;  4C56 C;  3M4Y A;  3I70 A;  5F2D A;  3VYR A;  4DV3 Q;  2E5L L;  3CP0 A;  4QIW E;  3C46 A;  1QVF A;  1TVX A;  2D62 A;  1I4G A;  1GHK A;  1ZKO A;  1B3A A;  3M7G A;  2VQF L;  3GO5 A;  3SR1 A;  2KHS A;  4GNX A;  1ILP A;  4NP5 A;  4DR2 L;  3MEF A;  5C3W A;  4DUY Q;  1EY8 A;  3CRL C;  3DEO A;  5D65 A;  1PFB A;  1DOK A;  1K83 H;  1Y8N B;  3A8K E;  2H5X A;  3TQY A;  2WV6 D;  1SDF A;  4F87 A;  1H9M A;  2WII B;  2AKW B;  1Y8O B;  2X6G A;  3H15 A;  4JOI A;  1TS3 A;  5C44 B;  5KRU A;  5EPK A;  3PO2 H;  1U5K A;  4POF A;  1DXM A;  4PZ6 A;  2YTY A;  3S1R H;  2WKC A;  3F8T A;  3I4M H;  3RD4 A;  2LSS A;  3GDE A;  4DR7 Q;  3BVG A;  1FR3 A;  1AZQ A;  3EQL C;  2B2T A;  3KDF A;  2CQO A;  3IFT A;  3CC7 A;  1I6V C;  5KEE A;  3L3O C;  1SE8 A;  1YNX A;  2SOB A;  3AYH B;  1PV4 A;  4PMW A;  5HGT A;  3I4N H;  2UXC Q;  4A3F B;  3J7A F;  1KRS A;  2MFI A;  4CBV A;  3CCL A;  2RDH A;  5C5M A;  3TEH B;  4DN4 M;  3J81 i;  3A56 A;  1PH3 A;  1MHW C;  2VUM B;  3NSW A;  2PNR C;  3HOX G;  3MC0 B;  1LTB D;  1IW7 C;  4JV5 L;  4DA2 A;  1WTR A;  1XMQ L;  3VYT A;  1F2Z A;  5IP9 H;  2ENB A;  1BXT A;  2E2J H;  1S40 A;  1N33 L;  2PCF B;  3PO2 G;  3QB3 A;  1Q8I A;  2MUY A;  5I6Y A;  3D31 A;  5EKI A;  4LF8 L;  2PW7 A;  4P72 A;  4Y7N B;  3S1M H;  2K1B A;  1L0X B;  1WYD A;  4DXG A;  4JI8 L;  5M5Y H;  2MHV A;  3MXG A;  4HCS A;  5E1F A;  1BBU A;  4DUZ L;  4HIO A;  1C8C A;  2VXW A;  4NB3 A;  1GM5 A;  1JJG A;  3KK7 A;  3SDZ A;  5KNB A;  3WWV A;  1LV9 A;  1HZC A;  5IYD H;  1K8A C;  5EBD A;  3GTP H;  4I65 A;  3J80 i;  2HDL A;  2TSS A;  2Q2H A;  5C4H A;  3DM1 A;  2CW0 C;  3GTG H;  3IFD A;  3M9B A;  2DNC A;  1I50 H;  2IPK D;  3P75 A;  3HKZ G;  3U50 C;  1CHP D;  4DK3 C;  3RNU A;  2IHE A;  1S5F D;  4IPD A;  2PNH A;  1ZYR C;  4A3J B;  3GQB A;  1EIY B;  4JI3 L;  2CW0 D;  4JI8 Q;  4FYD A;  3VYS A;  3E5S A;  5IOC A;  1BR9 A;  2JA8 B;  3VA5 A;  4C3H H;  4GOP B;  3G7L A;  1VQJ A;  4JI0 Q;  2HHH Q;  2PZW A;  1C9O A;  3C1E A;  2K5Q A;  2NZO A;  3DEP A;  5K36 H;  3VA7 A;  1E0B A;  4K0K Q;  1F9R A;  5CYU A;  1VQG A;  1NTG A;  2RSN A;  2AUJ D;  3TS0 A;  4H7B A;  4DNR B;  5IGE A;  2EYH A;  5C3E B;  2FFK B;  2UUC L;  2F1M A;  5EBC A;  2EJG C;  1YJ9 A;  4DR6 L;  1CSQ A;  2IW3 A;  1IBL L;  2JA6 G;  5JEA H;  2R6G A;  4DR6 Q;  5E7N A;  1HFN A;  3PGZ A;  1KAA A;  3UE0 A;  5JJK A;  4RFB A;  3T1Y L;  1B44 D;  2FHT A;  4JI7 Q;  4HSV A;  1HNX Q;  2JXM B;  3T4A C;  1QUQ B;  3PIO A;  4MIU A;  1XXG A;  2A6H D;  3GTM H;  3W3A A;  1CTM A;  4DR5 L;  1C4Q A;  1I4H A;  4DR3 Q;  1F9Q A;  3HP3 A;  1MBY A;  1TT2 A;  4U67 3;  4BY7 G;  3VR4 A;  4DR1 L;  4NDX A;  3HFZ B;  4WRD A;  4L8J A;  1ET9 A;  4HID A;  5ELB A;  1XNR L;  5M5W H;  1CI3 M;  1CT1 D;  1SR3 A;  3DHQ A;  4GKJ Q;  3TME A;  4EVO A;  2F0U A;  2JA7 H;  4A3E G;  5GRO A;  3T56 B;  1WJJ A;  1JWU D;  1VQH A;  1WCM B;  4FDB A;  1MSH A;  3R2T A;  5JVH 3;  5L37 A;  5CV4 A;  1KDB A;  3S16 H;  2JEA I;  1TKW B;  2PQA B;  5I2X A;  1RIP A;  1T9H A;  1IBK Q;  4OEM B;  1AE3 A;  1X56 A;  5FLX E;  1KDC A;  2HIV A;  1XTD A;  2DY8 A;  2F0F A;  3HOW B;  5ELC A;  2EOT A;  3PUW A;  2XTI A;  2PZT A;  4LFC Q;  4B3M Q;  1QOH A;  3NWS A;  4IFD I;  2BOS A;  5C4X H;  2IX1 A;  4WJ3 M;  2Z6K A;  1QE6 A;  4OXP A;  2A6E D;  2XVS A;  2CH4 W;  1UWV A;  5E3F A;  2ZXP A;  1T5X D;  2XGT A;  4BY7 H;  4N9T A;  5DAU A;  4A3B G;  1D2B A;  4R4O A;  1CKN B;  1LLR D;  1ZEQ X;  1P8L A;  3BJU A;  4C3J B;  2B8G A;  4X65 L;  2C35 B;  1SMX A;  1HNZ Q;  4LWC A;  1STE A;  1DGS A;  4LF7 L;  1PH9 A;  4JYA Q;  1JWM D;  1N32 Q;  1FL0 A;  2NYZ D;  3TDQ A;  5I9P A;  1JC7 A;  4OX9 Q;  3BVZ A;  1EEI D;  4A93 H;  4X64 L;  2BCO A;  2K01 A;  2XSC A;  1UNS A;  3HGB A;  4IUR A;  3U58 A;  1W6K A;  4LFB L;  2F0M A;  4XQQ A;  5D3D A;  1I4P A;  2K03 A;  5IWA L;  4LF5 L;  1A3V A;  1STB A;  1SYG A;  2QCP X;  3WDN A;  2GVA A;  3FDT A;  4N9P A;  2D2C C;  1W2B A;  4A3C G;  4RAU C;  1W3S A;  4EQO A;  4X6A H;  4K5X A;  3D8G A;  1VQ8 A;  3I90 A;  1AW7 A;  1X9N A;  4A3I G;  2N55 A;  4IUU A;  4NW2 A;  1QZG A;  3SEB A;  4KN4 C;  1T5E A;  5IE8 A;  1EIG A;  2F4V Q;  4X3S A;  5E4X A;  3CCU A;  3PMF A;  1L1O B;  1I4Q A;  1PFS A;  1O7L A;  3FPP A;  1DOM A;  1PH4 A;  3CHB D;  2R7Z H;  3CAM A;  4UY8 C;  1SSO A;  3G4S A;  2HT1 A;  1DCZ A;  1OXS C;  1BBW A;  1GUT A;  3W5O A;  1X3Q A;  3MXU A;  3J81 E;  2HD3 A;  4L5R C;  3HOU B;  1ASZ A;  3B6Y A;  1PHJ A;  5M3M B;  5M3F B;  1C48 A;  1X3E A;  4A3J H;  1M90 C;  4B3R L;  5ELE A;  2VQE L;  4KD3 A;  3TZD A;  3S2D H;  1UEA B;  3QOL A;  5IT9 L;  1KTK A;  1LT6 D;  3CME A;  2NVT H;  4HCE A;  5CMD A;  1YNJ C;  5LMU L;  2G5D A;  1A3T A;  3T1Y Q;  1ASY A;  4MHE A;  3A5Z B;  2VUM G;  5LMN L;  4FXK C;  3S17 H;  1IW7 D;  4YWM A;  4GLV B;  1G29 1;  4HJ8 A;  1OTC A;  5D14 A;  3M3Y B;  3MA2 B;  4OL7 A;  5BN4 A;  5CBA E;  4R8N A;  2FIN B;  5C0X G;  1IBM L;  1PA6 A;  2A8V A;  4TSS A;  1QVC A;  5JVG 3;  1MJE A;  3ERS X;  2WAQ B;  4NMZ A;  1KNA A;  2ZXO A;  2SDF A;  4A3M B;  4OEL B;  4X65 Q;  4G7H C;  4CJ1 B;  2KJX A;  5BR8 L;  1ROD A;  4IZ8 A;  1IZ6 A;  1XPO A;  5IYC G;  1Q12 A;  1QB5 D;  1K8O A;  4B08 A;  2EQS A;  1TWG H;  3OMC A;  5C4J H;  4Q5V A;  1BDO A;  2AMC B;  1HFG A;  1LYL A;  5C4Z A;  1VQL A;  4A3M G;  2NN6 G;  5C44 H;  5ELO A;  2EY2 A;  4KKU A;  1LTG D;  1WCM G;  5EKL A;  3FKI B;  3MXN B;  4YHH Q;  1NMG A;  5KIX A;  5M5W B;  4A3L G;  1LT5 D;  1IKL A;  2JA7 B;  4IAL A;  2AQ1 B;  2EVB A;  3MFG A;  2ZM6 Q;  3CD6 A;  3HOY B;  3IKJ A;  2PI2 E;  1L2F A;  4E6I A;  4KK7 A;  3JAM i;  2K28 A;  4DV0 Q;  2RSO A;  1JE4 A;  4ODG A;  3RLO A;  4XYO A;  4JI3 Q;  1SYD A;  3S16 B;  1A8V A;  1UE1 A;  3CCS A;  3C3L A;  1AN8 A;  4A93 G;  4R1J A;  3ER0 A;  1E2V A;  2H1E A;  1SYC A;  4KHP L;  2OTL A;  2WB1 G;  3FHW A;  3S15 H;  1GXD C;  1LTI D;  4PNY A;  4U68 A;  4L6T B;  1YJN A;  2JA8 G;  3CPW A;  1I6H H;  3H09 A;  1RL2 A;  2MQH A;  2B3G A;  2PMZ E;  3FEW X;  4O2D A;  1EWI A;  5FJ8 G;  1L0W A;  1PH8 A;  3CF5 A;  4BY7 B;  4IPG A;  4JV5 Q;  1RTN A;  1VQ6 A;  1ENA A;  4RGO S;  1GD7 A;  3DWQ A;  2OQK A;  4XT3 B;  4PZ7 A;  1TWC B;  1I3Q B;  4OHJ A;  3BDO A;  2UUB Q;  1SE4 A;  2EY5 A;  3P7J A;  1IBK L;  1SRU A;  2A6H C;  3URY A;  3CKI B;  3J7A 5;  1F9P A;  2M9V A;  3HRZ C;  1WVL A;  4DV2 Q;  2I5M X;  1AH9 A;  1O7I A;  1LT3 D;  2A1A A;  3NBI A;  5KGU A;  3M7N A;  4OO1 G;  2D0O A;  2K50 A;  4P2C B;  2WB1 E;  3G48 A;  4ABN A;  2L55 A;  3E6Z X;  3K7U C;  1Z6H A;  4C3J H;  4KJN A;  4ULL A;  2BE5 C;  1A6X A;  2IHF A;  4X66 L;  4C1N K;  4X62 L;  2LXK A;  2E75 C;  1HUM A;  2MO0 A;  3BDL A;  4A93 B;  4B9W A;  1RCV D;  2OT2 A;  1O7Z A;  2VL6 A;  4HR7 B;  4OWW B;  2EXZ A;  2EYM A;  2F03 A;  4XIG S;  3BZK A;  4N8X 1;  5ELN A;  4P75 A;  1IKM A;  2EYF A;  3K8A A;  4IOA A;  1ONL A;  4XTC S;  3K0Y A;  2QW7 A;  2JJQ A;  3UDF A;  4LMQ D;  3VR3 A;  4HN7 A;  1E2W A;  4A75 A;  2JA5 G;  1EY5 A;  5E4W C;  1C0A A;  4A3E B;  1L1O C;  1A0I A;  3H0G H;  1IBL Q;  3I4N B;  1HZ9 A;  4X3K A;  2AWN A;  4CKB A;  4NKL A;  1B9N A;  3D6C A;  2QEJ C;  4RA8 A;  4DUZ Q;  3NBH B;  5I4D A;  3TSS A;  2ZJP A;  1G8Z D;  3H91 A;  3NTK A;  4KV6 A;  3BS1 A;  2EYJ A;  3CQZ B;  3M85 A;  3P1H A;  5EGT A;  4QF4 A;  1HR0 Q;  2UXB Q;  5DM7 3;  1N34 Q;  1BUV T;  3DUZ A;  5KYI A;  3O13 A;  1JB3 A;  3A0J A;  2F0E A;  2IT1 A;  3TP5 A;  5HUR A;  2SNM A;  1XTC D;  3TBI B;  4RMF A;  1D5X C;  3JAM E;  3SK8 A;  2B63 G;  4Y7N H;  5M3M G;  3LGJ A;  5IGG A;  5AJ3 L;  4JI5 L;  3VR2 A;  3FMC A;  1CKM A;  1PZJ D;  1ESF A;  3NUC A;  3G71 A;  1RF2 D;  3U4Z A;  3QWN A;  2MPM A;  4POG A;  1CK1 A;  1NY4 A;  2DUD A;  1MI2 A;  1KXL A;  1O7Y A;  3JAM L;  1F9S A;  2A68 D;  2WB1 B;  2JYO A;  3QR8 A;  5IYB G;  1HR0 L;  4FF2 A;  4PMC A;  2KQ3 A;  1VF7 A;  2AQ2 B;  4LF6 Q;  1HUN A;  3S17 B;  1XPR A;  1SND A;  1Q46 A;  1UE5 A;  4HTH A;  3X3N A;  3GTG B;  4IFD G;  2E2H B;  1WCM H;  3R8B A;  1AFP A;  4JG2 A;  3OTO Q;  3OYY A;  2KED A;  4ILW A;  3GTK H;  4A3L H;  1EFW A;  2R3Z A;  4PV1 C;  4DV4 L;  1EQT A;  3NEM A;  4CDC C;  4S3S A;  3A74 A;  3HOW H;  2A73 B;  1KIX A;  3TP8 A;  1XMO L;  1BQQ T;  2ID0 A;  2NUC A;  4R4C A;  2UXD Q;  3BZD B;  1HCZ A;  2JA8 H;  2A74 C;  2B2V C;  1V1P B;  5GAE C;  1ILQ A;  2F0J A;  3SK6 A;  1NSN S;  4HMI A;  4KY5 A;  2KCM A;  1LTA D;  3FVQ A;  4G57 A;  2JA5 B;  4DR4 Q;  1S5D D;  2IX0 A;  1STY A;  4LFC L;  1JE5 A;  1LTS D;  3FRP B;  4J1M A;  4J6H A;  4EQP A;  1YHQ A;  2HQL A;  2KCN A;  4DK1 A;  3KLS A;  4LF8 Q;  2WP8 J;  4H44 C;  1I4R A;  3K0X A;  4B3S L;  1SYB A;  3QO2 A;  2ZT9 C;  4KTA A;  2QEX A;  1IL2 A;  1HTL D;  1RHP A;  1YJW A;  1X55 A;  1MD2 D;  2VB2 X;  3R93 A;  2ZTD A;  4HJ7 A;  2VW9 A;  4H13 C;  5BN5 A;  2RHS B;  1CZG A;  1U0L A;  4A3D H;  3UDX A;  3J7Y W;  2EY1 A;  3OW2 A;  5IP7 G;  4V0B A;  2JA6 H;  2Y0S B;  2RBM A;  1Q7Y C;  5EKK A;  5M5X H;  1KQS A;  2KCT A;  1YBY A;  1NJI C;  1SRO A;  1G2S A;  3HEJ A;  4DV3 L;  1YHB A;  4ZAI A;  1WI5 A;  2WAQ E;  1WOC A;  4WJ4 A;  1EZ8 A;  1PFN A;  5JEA J;  4LF7 Q;  2F0H A;  5COY A;  3OW7 A;  4F7X A;  1QNK A;  5FJ8 H;  3S24 A;  1RDP D;  4QY7 A;  2DY7 A;  2D5D A;  1SJE D;  2NTT A;  2JSO A;  3SK4 A;  1TS2 A;  4P73 A;  1MGS A;  1L1O A;  3T1H Q;  1TWC H;  1TWF H;  1I3Q H;  3U9S A;  2RDG A;  4DV1 L;  1VQ4 A;  4KLK A;  1X6O A;  1G6P A;  1YNN D;  4YHH L;  1XYI A;  1NNX A;  3PF5 A;  4OWT B;  3PUZ A;  1BO0 A;  2E74 C;  2N49 A;  2ZTE A;  1JOO A;  2EXD A;  1BCP F;  3OWE B;  1A2U A;  4DK0 A;  4A3D G;  1LT4 D;  3I91 A;  1K9M C;  4GKK L;  4CDE C;  5GQO A;  3J81 j;  4A76 A;  3PF4 A;  3KDF B;  2DGY A;  4UAI A;  1NR2 A;  4IUP A;  2JA7 G;  4GNX B;  4FO2 A;  3DXJ C;  2R92 H;  3I4O A;  3RZO H;  3UI2 A;  2Q2I A;  2ES2 A;  3TRZ A;  4A3K G;  1Y1V B;  1U4R A;  3RLF A;  4HIK A;  4QUF A;  3S2H H;  3PIP 3;  4XQJ A;  2NZ1 D;  3ND8 A;  4DV2 L;  4BA1 I;  4ALP A;  3CC4 A;  5DLQ E;  3OSO A;  1G51 A;  2BE5 D;  1H95 A;  2L0C A;  5GAG C;  4G7O C;  1FD7 D;  1SJH D;  1P16 A;  2ZTC A;  5CV8 A;  5IGF A;  1EYG A;  3CQZ H;  1Y14 B;  3MXP A;  1FYC A;  3I72 A;  1IHZ A;  2K6A A;  2AUK A;  3J7A V;  4PG3 A;  5C4X G;  4HED A;  1NCV A;  1A2T A;  4RGM A;  4DNT B;  4OO1 H;  5EPL A;  2KEE A;  3T53 B;  1BKB A;  3F1Z A;  4DV6 L;  1SNQ A;  2FJ2 A;  3TP7 A;  4JBK A;  4KKT A;  4DPG A;  5IYB H;  4JI2 L;  2QDL A;  4FF3 A;  2A6E C;  5JJZ A;  1S5B D;  4QUC A;  3ZYY X;  3GP7 A;  3KYH C;  1PRT D;  2PQA A;  2WAQ G;  4JPB W;  3Q24 A;  3RZD H;  1G2T A;  2L4N A;  4H0L C;  2K33 A;  4K8J A;  1PMR A;  2UUA Q;  3N6R A;  3K58 A;  1LTT D;  2B2V A;  3S1Q B;  1RJT A;  3FKI H;  3ULP A;  2Q2T A;  1VF5 C;  1LTR D;  5CC4 A;  1HRJ A;  1TWA H;  3AQQ A;  1JJ2 A;  4YCW A;  2QKI C;  1YHA A;  4BXX G;  5EAY A;  3OWF A;  1IBM Q;  3GTQ H;  2RQX A;  4YCV A;  1N9W A;  3NQT A;  4GLA C;  4H02 A;  4BBR B;  4EQN A;  1LM0 A;  3CCE A;  1STH A;  3Q22 A;  1DZ1 A;  4A3I H;  3RUZ A;  2K5V A;  4V19 0;  5NUC A;  2Z4I A;  1B53 A;  1M8A A;  4LUZ A;  2B2U C;  3L7Z C;  2BA1 A;  2I46 A;  1Q1E A;  1WTX A;  3PCO B;  1KC8 C;  1R4P B;  3PQI A;  1J6Q A;  2LFN A;  2XRQ D;  2Q2U A;  2N78 A;  1QG7 A;  3BU2 A;  1V9P A;  3J81 L;  4BBS B;  2R93 B;  4C1N I;  1VS0 A;  3KUP A;  4YY3 Q;  4AQY L;  2HHH L;  1IXR A;  4NXN Q;  2CQA A;  1TWH H;  2B63 B;  4BS9 A;  4LNQ A;  2QGQ A;  2FXQ A;  3K57 A;  2VQF Q;  3GTK B;  5H1S E;  4G4K A;  1IYJ B;  5IGB A;  2DN8 A;  2PO4 A;  2XIW A;  2Z8L A;  2KCC A;  3A5U A;  3IAY A;  4IOC A;  4K8I A;  1B8A A;  1I94 L;  2F3V A;  2NB0 A;  1N32 L;  2H4O A;  4GOP A;  4QMG A;  3HOY G;  2MO1 A;  2ICE C;  2OQ0 A;  4G7Z C;  1GJX A;  4GKJ L;  1ZXT A;  1EIF A;  3HKZ B;  1XMO Q;  4A3B B;  3GTQ B;  2I5L X;  3KOJ A;  5AFW A;  2O5J C;  3W1B A;  4WOR A;  5LMN Q;  2KA7 A;  4YCU A;  3OMG A;  4GKK Q;  3KF6 B;  1EEF D;  3FP9 A;  3CXC A;  3HOX B;  4A3G B;  3NBH A;  4X3U A;  3OHX C;  4X3T A;  3VYU A;  2B2W C;  1PRT B;  2OF1 A;  3Q8D A;  4ZCK A;  1YEZ A;  1H9K A;  4DR7 L;  2GN5 A;  1YNJ D;  1W6J A;  2HIX A;  2LKV A;  3A8I E;  3TP6 A;  3VR6 A;  3PIO 3;  1CQF A;  3PUX A;  5IYC H;  1Q82 C;  1I5F A;  3ITP A;  1B50 A;  1XJV A;  4YWL A;  3ULL A;  3S1R B;  4BBS G;  5G3L D;  2R93 G;  3CCM A;  4C3H B;  3I4M G;  3SGI A;  1K73 C;  1ZYR D;  1L0Y B;  1V43 A;  2F0O A;  2IY5 B;  2BH8 A;  2JA6 B;  4JI4 L;  3WOE A;  4IO9 A;  4R8I A;  3GV3 A;  2AHO B;  3D4D A;  1SNP A;  4J15 A;  4MTN A;  4IUN A;  1SYF A;  2Z6K C;  2Q8T A;  4DR2 Q;  4CKE A;  5DM6 3;  1N34 L;  3F2C A;  1EQQ A;  4JI1 Q;  2BDO A;  4JI2 Q;  2K5D A;  1STN A;  1D6E C;  5CV7 A;  1MJC A;  1EY6 A;  2F0S A;  5C6A A;  2SEB D;  2I0Q A;  5IP9 G;  1JT8 A;  1JIC A;  3ERQ A;  1VMC A;  2RA4 A;  5I9O A;  4IFD J;  2F0I A;  3I2Z A;  4OGQ C;  1O80 A;  4K2K A;  3C1F A;  4DV0 L;  2K75 A;  2XWJ B;  3EFX D;  2E2J B;  2NTS A;  1IL8 A;  2IX3 A;  4IPH A;  2JA5 H;  2E8G A;  1F2Y A;  1WTQ A;  1ESR A;  2R92 B;  3MZ5 A;  3GTM B;  4L5Q A;  1FNW A;  1GO3 E;  4GNX C;  1SYE A;  2NVY H;  3S1M B;  1S3O A;  1YIT A;  1IYU A;  2B29 A;  1WFQ A;  4FXD A;  3VR5 A;  1JR0 D;  2NVX H;  1A63 A;  2F0N A;  3CRK C;  4JK1 C;  5CV9 A;  3W1G A;  3NK9 A;  2Z6B A;  3S1N B;  5C0X H;  1PFM A;  2K5N A;  4R4T A;  4QQB X;  2ZJR A;  1E2Z A;  4DV7 L;  4GN4 B;  1EZ6 A;  2F52 A;  5FK9 C;  1B1Z A;  4XT1 B;  3HOV G;  4UDU C;  3I7F A;  4QGU A;  1R4Q B;  1PYW D;  3NQI A;  3Q23 A;  5IGD A;  4AH6 A;  1AZP A;  4C2M B;  5I6W A;  1PTO D;  4DAY B;  5C3E G;  4RCO A;  1V1Q A;  1XMQ Q;  2F4I A;  1KRT A;  5M5X B;  1SLJ A;  4JI7 L;  3RZD B;  1S5E D;  3H3V I;  3NTI A;  1H9R A;  1E7Z A;  4DAY A;  4DGZ A;  5JPM C;  5JOB A;  2F0Q A;  1X3P A;  2P5Z X;  5JJL A;  5C4X B;  4GS3 A;  1CHQ D;  2F0V A;  4OO1 I;  4I7Z C;  2M2L A;  1Q86 C;  2C5C A;  5LMU Q;  2NVQ H;  3GTL H;  1EFI D;  2O5I C;  5EPJ A;  2VY3 A;  2NWG A;  4ZLT F;  3DWA A;  3CCJ A;  3VDY A;  2OTJ A;  2Z4H A;  1LO5 D;  1E24 A;  1PH2 A;  4K0K L;  3LX0 A;  3PV0 A;  3DM3 A;  4BA2 I;  5EQ0 A;  1K3B C;  1HPC A;  1X65 A;  1Y1V G;  3MWY W;  1NR4 A;  5JEA G;  2K7V A;  4BXX H;  1EY4 A;  3EVQ A;  4O0A A;  5J39 A;  3J80 c;  5M9O A;  1Y1W G;  2GVB A;  3GTP B;  2A69 C;  1PLF A;  4K14 A;  1A3U A;  2OCE A;  2LMC B;  4RHS A;  3K7A H;  4LF9 Q;  4TKO B;  1E22 A;  4UHV A;  1CQV A;  3RZO B;  4MN3 A;  2L1B A;  4JBM A;  1VQC A;  1HHV A;  2UU9 Q;  1BCP B;  2JK8 A;  1EU3 A;  4N8F A;  1VQK A;  2B2T C;  1AP0 A;  2A69 D;  1VQB A;  3ZJY C;  3EA6 A;  3SXH A;  4A3K B;  1EY9 A;  2OXP A;  4JI1 L;  4BBS H;  2R93 H;  1D1I A;  3GD7 A;  1VQ9 A;  4DU9 A;  1LAB A;  3T13 A;  2Q8R E;  4X64 Q;  2R7Z G;  4JC0 A;  3LWU A;  2B63 H;  1HJP A;  5BR8 Q;  2RF4 A;  1EYA A;  3X3M A;  3HOV B;  3ULJ A;  5LL6 S;  2E5L Q;  2L12 A;  2KEC A;  2HQE A;  2IJ0 A;  1PTO B;  4KD4 A;  2X6L A;  3ND9 A;  1QIL A;  4K2L A;  4FNF A;  5LL6 X;  4J8Q A;  4XYQ A;  5M3M H;  1DON A;  1R9T B;  5K36 G;  2B2Y A;  1V1O A;  1K8M A;  2DJF C;  4LFA L;  1AEX A;  1CKN A;  1TWA B;  5A35 A;  3S2D B;  4MTK A;  3AB9 A;  1RTO A;  4WFN 3;  2EJF C;  3T1H L;  3K6O A;  1B4O A;  1IYV A;  2JN4 A;  1KL9 A;  4DKA C;  5JAV A;  4FXG C;  1QNU A;  3SK5 A;  1SNC A;  2I5H A;  4KHZ A;  3DMU A;  2X69 A;  2EYP A;  4KY7 A;  1XX8 A;  1EOT A;  4FVM A;  5IY0 A;  1NBW A;  4IUV A;  3TN2 A;  3KJP A;  3LWE A;  2KUM A;  1KLU D;  5DNF A;  1B70 B;  1HNZ L;  3RN5 A;  2E2I B;  2EYO A;  5BN3 A;  1Q3L A;  1CA6 A;  3RR5 A;  4LW1 A;  5IT9 E;  2MP1 A;  4CDD C;  2JA9 A;  1LAC A;  3OIQ A;  1Q1B A;  1TWH B;  3E3X A;  2ICI A;  2G9D A;  3DWP A;  1EY7 A;  1GUS A;  2EY6 A;  4LF4 L;  4OIK A;  4AYB B;  3V96 A;  3C2P A;  1VQF A;  4RGN A;  3HS0 C;  2G9H D;  1TY0 A;  2NVY B;  3BZC A;  5J22 A;  1R9T H;  1VQN A;  4NXM L;  2B39 A;  5TSS A;  1HQM C;  3S1Q H;  1MKH A;  4F88 A;  2WKD A;  5K5P A;  1KNE A;  5CV6 A;  2YTX A;  5IIF A;  1FVI A;  2TMP A;  4GN3 B;  1FGB D;  3QOJ A;  5CGK A;  1EQV A;  1Z47 A;  2V4D A;  4A3J G;  3P20 A;  3EN2 A;  2PMZ B;  3OIP A;  1OXU A;  2O4X A;  4DV6 Q;  1FNU A;  2J4X A;  2J0T D;  5T1I A;  4ZKC B;  3J80 L;  4M1U B;  4B3M L;  2I07 B;  4RWS C;  3T51 B;  3HKS A;  3I8Z A;  2NN6 I;  4PZ8 A;  3HOU H;  4A3G H;  4AYB E;  1BF4 A;  4ZYS A;  1XNR Q;  1ENC A;  2RHQ B;  4LF4 Q;  1SEB D;  4RHR A;  4QJF A;  1SBB B;  3FPU B;  1C7Y A;  1QCB D;  1PTO F;  1ML0 D;  2M00 A;  4DAM A;  2UXD L;  4LAA A;  3D0F A;  5CBE E;  5KNC A;  1LTL A;  3MHB A;  2CWP A;  2RCF A;  4Z9C B;  4BBR G;  3KBX A;  1YNN C;  4OX9 L;  4APV A;  4DK6 C;  1PYS B;  3ERO A;  3BYY B;  1SN8 A;  2V1C C;  1DD2 A;  5FOB B;  2KOL A;  1TS5 A;  2HCC A;  1A15 A;  3CCQ A;  3M3Y H;  3V2T A;  1OXV A;  4HJA A;  3M4P A;  2CCZ A;  2ZJQ A;  3I73 A;  4RH6 A;  3H0G G;  2KVM A;  1H9S B;  1ICF B;  4R4I A;  4FF1 A;  2UXB L;  4HJ9 A;  5GAD C;  1UAP A;  5HGQ A;  1QUQ A;  2K04 A;  1VCI A;  4XXE A;  1B3Q A;  3JC6 6;  4IUT A;  4RKB A;  4F8M A;  1VDZ A;  5IWA Q;  2VNU D;  3K80 C;  1BOS A;  3STB C;  1EYD A;  2EJM A;  5J3B A;  2K14 A;  1TU2 B;  2QDB A;  2R7F A;  5IT9 c;  1ENF A;  1UE7 A;  5C5L A;  4KHP Q;  3J7Z C;  2ZM6 L;  1BVS A;  3MVV A;  1J8I A;  4KJO A;  4P74 A;  2YTV A;  3CCV A;  4HSP A;  3N52 A;  3CCR A;  3SVM A;  4JCV E;  4RKL A;  1V8Q A;  3ICE A;  3BG3 A;  4JVZ A;  1RKN A;  3M4Q A;  5D3I B;  4CGY B;  3CW2 C;  3Q6S A;  1XNQ Q;  1PZK D;  2K05 A;  3S14 H;  1KHI A;  1WTH A;  3D4R A;  1H9S A;  1WD1 A;  4RGT A;  1JOQ A;  4DR3 L;  2EPB A;  3A54 A;  2KHI A;  4A3I B;  1S72 A;  1U4P A;  4NXM Q;  1GVP A;  5FLX c;  1Q90 A;  3H0G B;  3MXN A;  1VQP A;  3V05 A;  4X66 Q;  1KDA A;  1HTP A;  2EDG A;  1NUC A;  5EJW A;  3KLR A;  1E1O A;  1EL0 A;  1QJO A;  1NE3 A;  4LF9 L;  4B3T Q;  3CU7 A;  4IUQ A;  2ALY B;  1JWS D;  1LUZ A;  1OXX K;  4B3T L;  4LUO A;  4CHT B;  1PTO H;  1EWH A;  1TWG B;  5I2Y A;  2NVQ B;  1PDQ A;  3GTL B;  4CDF C;  4IJH A;  1SE3 A;  4DR4 L;  2Q8I B;  3HOZ G;  3HZX A;  3TZU A;  1PH5 A;  1KD1 C;  1Y8P B;  4ME5 A;  1H9J A;  3OTO L;  1MSG A;  1QZH A;  1YZ6 A;  2VB3 X;  2R7D A;  2DJG C;  1WTP A;  2LS0 1;  4XDX A;  1GKH A;  4PQX A;  3HOZ H;  1SNM A;  5ELD A;  1M1K C;  4B3S Q;  2JQO A;  2EYL A;  3PO3 H;  1TII D;  4DXF A;  3CC2 A;  2UUB L;  3I4M B;  3IL8 A;  3JAM c;  2E2I H;  3I55 A;  2R7Z B;  5G3L F;  1GUG A;  1HQR D;  3GTO H;  4R4Q A;  2ZXR A;  5C3X A;  1VQD A;  2YYZ A;  4KI0 A;  4A4I A;  3HOX H;  1SMY C;  1CFM A;  4C3H G;  1SFO B;  4JYA L;  2PW5 A;  3QG1 A;  4EX5 A;  3A7L A;  4LK1 C;  2WAC A;  1FGU A;  4DFA A;  4IFD H;  4TQU S;  2A5H A;  4Q0F A;  4TVA B;  1KAW A;  2JE6 I;  1AE2 A;  4P71 A;  1SMY D;  1VQM A;  1U4L A;  4OON A;  4YY3 L;  4AQY Q;  2L15 A;  1N36 L;  2VUM H;  4DV7 Q;  1CZW A;  2F3W A;  1EWC A;  4ZUI A;  1SXT A;  2BA0 A;  1CM9 A;  2LXJ A;  2NVT B;  4UP9 A;  3NWT A;  4ZRZ A;  3FKI G;  2B2W A;  2EE1 A;  4JI5 Q;  4ZK9 B;  3HOV H;  4HJ5 A;  3GTJ B;  2CWA A;  4L5S A;  3K5M A;  1PYB A;  4K5V A;  3A55 A;  1EIH A;  3NXW A;  3NEL A;  3E0J A;  4K6D A;  4ZQ3 A;  4AIM A;  3E9I A;  2QF7 A;  4JBJ A;  2CKZ B;  3L9A X;  1PRT F;  5HY6 A;  1M4V A;  3W2D A;  3AFQ A;  4QIW B;  5J1Z A;  3KBG A;  1Q8K A;  3R3O A;  2C9O A;  2ASB A;  3I3C A;  1VQO A;  2DNE A;  1B2T A;  1HH2 P;  1WTO A;  3GTO B;  4RG1 A;  4C3J G;  4JI0 L;  5IP7 H;  3K7A B;  3QJY A;  3EIV A;  3RMH A;  2NN6 H;  4YIJ A;  4C3I H;  1F2L A;  5C4J B;  1SFO H;  3NHH A;  1PXU A;  3F2U A;  1I50 B;  3LNN A;  1D8L A;  3BYT B;  1BBX C;  2NBF A;  3J81 c;  2K4K A;  3MFY A;  2B2Y C;  4OIJ A;  3PO2 B;  4A3K H;  4JI6 L;  4QL5 A;  2UU9 L;  2NVX B;  4LF6 L;  5FLX L;  1SNO A;  1UUP A;  2NZH A;  4KHV A;  4FP5 D;  4QB4 A;  2RDF A;  3NP8 A;  3H3V H;  4A3G G;  3HOY H;  4XQN A;  4O42 A;  5A2Q L;  2F0W A;  1GOZ A;  1K28 A;  1E3P A;  1B7Y B;  2PYK A;  5FO8 B;  3PIP A;  2JP1 A;  2Y0S E;  1DM0 B;  2AQ3 B;  4C2M H;  1Z9F A;  5FLM H;  4RCN A;  4DAV A;  3TRE A;  3AFP A;  1VQ5 A;  3K5O A;  2R61 A;  3SE0 A;  3G6E A;  2UUA L;  2Z1C A;  4DAP A;  5M3F G;  3S15 B;  2MGS A;  4KN7 C;  3PSI A;  1TR5 A;  3H94 A;  1WTV A;  1I6H B;  1G6Z A;  1J9O A;  1BCP C;  2IL8 A;  1WD0 A;  4MZ9 A;  1CSP A;  4O1N A;  5A2Q E;  2BH2 A;  3H6M A;  1FJG Q;  2WFW A;  1HZA A;  4LFA Q;  1X3F A;  2Z9H A;  1TY2 A;  1OO9 B;  5LHY 1;  1PVO A;  1G91 A;  3KJO A;  2K52 A;  3MAQ A;  4BWG B;  2YU9 B;  2HDM A;  1SAP A;  1E1T A;  2O2L D;  3NE5 B;  3L2P A;  2RCN A;  3STB D;  3DLL A;  1VQA A;  1TS4 A;  4IN3 A;  1PH7 A;  1D1K A;  4OWX B;  4L63 B;  1EUJ A;  2QIL A;  1Q81 C;  3KF8 A;  1RD9 D;  1HR0 W;  5FLM G;  2CFM A;  3E0E A;  3GV6 A;  1FNV A;  1EU4 A;  3D4W A;  1GUN A;  1V1P A;  1JQY D;  1JJC B;  4ME3 A;  2E2D C;  3UE1 A;  2EZV A;  1FJG L;  3A8J E;  4GOP C;  4WJW A;  2RVL A;  2FMM A;  2HCI A;  5C0X I;  3NPP A; 
#chains in the Genus database with same CATH homology
 1PH6 A;  4LF8 Q;  2WP8 J;  1J5E Q;  4BY7 G;  3K0X A;  3PUY A;  4B3S L;  5M3M H;  1PH1 A;  4DR1 L;  2UUC Q;  3HFZ B;  1J5E L;  4JBW A;  1XPU A;  4HID A;  2OWO A;  1XNR L;  2QEX A;  5M5W H;  1IL2 A;  5K36 G;  1SR3 A;  4GKJ Q;  4NPS A;  2JA7 H;  3F2D A;  4LFA L;  4A3E G;  1CKN A;  3RN2 A;  1YIJ A;  1YJW A;  1X55 A;  4DV1 Q;  2ZTD A;  4HJ7 A;  2VW9 A;  1YI2 A;  1N36 Q;  5GRO A;  2F4V L;  1WJJ A;  2JEB I;  2RHS B;  2VZA A;  1JB7 A;  4IPC A;  1VQH A;  4FDB A;  2AWO A;  3T1H L;  1U0L A;  4A3E H;  3UDX A;  4A3D H;  1KL9 A;  4DKA C;  3OW2 A;  3S16 H;  1YVC A;  5IP7 G;  2JEA I;  2PQA B;  2KBN A;  1RIP A;  1T9H A;  2JA6 H;  1IBK Q;  1AE3 A;  1X56 A;  2HIV A;  1XTD A;  2I5H A;  1Q7Y C;  4KHZ A;  5M5X H;  2KCT A;  1KQS A;  1YBY A;  1NJI C;  1SRO A;  5IY0 A;  2MNA A;  1NBW A;  3PUW A;  4DV3 L;  1YHB A;  2XTI A;  1WI5 A;  2WAQ E;  3K81 C;  5C44 G;  2N3S A;  3KJP A;  4DV4 Q;  1B70 B;  4A3F G;  4B3M Q;  4LFC Q;  1WOC A;  1HNZ L;  3RN5 A;  4WJ4 A;  4IFD I;  5JEA J;  5C4X H;  4LF7 Q;  2IX1 A;  4WJ3 M;  3RR5 A;  3KFU A;  2Z6K A;  4OXP A;  4LW1 A;  5FJ8 H;  4GLX A;  4B3R Q;  2PI2 A;  3S24 A;  1HNW L;  2R92 G;  1UWV A;  3TS2 A;  4QY7 A;  2JA9 A;  2XGT A;  4BY7 H;  4X62 Q;  4A3B G;  1Q1B A;  4R4O A;  1CKN B;  4P73 A;  1P8L A;  1L1O A;  1UE6 A;  1TWC H;  1TWF H;  1Y1V H;  1I3Q H;  3BJU A;  4X65 L;  3T1H Q;  4DV1 L;  2C35 B;  1SMX A;  1VQ4 A;  4KLK A;  1X6O A;  1HNZ Q;  4LWC A;  1G6P A;  4LF4 L;  4YHH L;  1K8G A;  4L5T A;  1DGS A;  3PF5 A;  4LF7 L;  1VQF A;  1PH9 A;  4JYA Q;  4OWT B;  3PUZ A;  5C0X J;  4DV5 Q;  3UDG A;  1N32 Q;  1FL0 A;  4OX9 Q;  3BZC A;  1VQN A;  1R9T H;  2N49 A;  2ZTE A;  4A93 H;  4X64 L;  2EXD A;  2F3I A;  4NXM L;  4A3D G;  3S1Q H;  1CKO A;  1MKH A;  4AYB G;  1K9M C;  4GKK L;  3J81 j;  5GQO A;  4A76 A;  2YTX A;  1FVI A;  4DR1 Q;  3PF4 A;  3KDF B;  4GN3 B;  2DGY A;  4LUV A;  2KHJ A;  3U58 A;  2JA7 G;  4LFB L;  4GNX B;  1Z47 A;  3RLN A;  4EQ5 A;  2R92 H;  4A3J G;  4A3B H;  3I4O A;  2E2H H;  3EN2 A;  3RZO H;  2QA4 A;  3U4V A;  4NXN L;  5LMN W;  2Q2I A;  1Y1W H;  1OXU A;  5IWA L;  2ES2 A;  4DV6 Q;  4LF5 L;  3TRZ A;  4A3K G;  1VQI A;  5AJ3 Q;  2A19 A;  3RLF A;  2GVA A;  1MIU A;  4A3F H;  1A62 A;  4HIK A;  1W2B A;  4B3M L;  4A3C G;  3HKS A;  2NN6 I;  1W3S A;  4PZ8 A;  1CUK A;  3HOU H;  4AYB E;  3S2H H;  4A3G H;  5GAH C;  4X6A H;  1XNR Q;  2RHQ B;  5M3F H;  4DV2 L;  3IRB A;  4BA1 I;  1VQ8 A;  4LF4 Q;  4ALP A;  3CC4 A;  4JOI C;  4QJF A;  5DLQ E;  3KLW A;  1X9N A;  1C7Y A;  1G51 A;  1H95 A;  4A3I G;  5GAG C;  2EIF A;  4DAM A;  4UPA A;  2ATW A;  2UXD L;  2Z0S A;  1QZG A;  5JJI A;  3D0F A;  1P16 A;  2ZTC A;  5IE8 A;  1LTL A;  3HKZ E;  2CWP A;  2F4V Q;  3CCU A;  2Y0S G;  1EYG A;  3CQZ H;  1L1O B;  1UEB A;  1Y14 B;  4BBR G;  4OX9 L;  1PFS A;  4APV A;  4DK6 C;  1PH4 A;  5C4X G;  1PYS B;  4PG3 A;  2R7Z H;  3CAM A;  4UY8 C;  2KEN A;  3I56 A;  5IYD G;  1SN8 A;  2V1C C;  3G4S A;  2HT1 A;  1OXS C;  1BBW A;  1BKB A;  3F1Z A;  3W5O A;  4DV6 L;  1I94 Q;  4LF5 Q;  4A3C H;  1HNX L;  4JBK A;  1D7Q A;  4L5R C;  4DPG A;  5IYB H;  3CCQ A;  1ASZ A;  4JI2 L;  3M3Y H;  1EOV A;  3B6Y A;  1PHJ A;  1X54 A;  3KYH C;  2VS1 A;  2PQA A;  2WAQ G;  1OXV A;  3RZD H;  3I4N G;  1X3E A;  4LFB Q;  4DNI A;  4HJA A;  3M4P A;  3CMA A;  2CCZ A;  2ZJQ A;  2UUA Q;  3NEN A;  4A3J H;  1M90 C;  3M4O H;  3EBE A;  3H0G G;  4B3R L;  3FKI H;  1OXT A;  4GN5 A;  3ULP A;  2VQE L;  4R4I A;  2Q2T A;  1TWA H;  2K5H A;  4MNO A;  4HJ9 A;  3S2D H;  3AQQ A;  5GAD C;  4A3M H;  2UXB L;  1JJ2 A;  5HGQ A;  1QUQ A;  4YCW A;  1VCI A;  3PO3 G;  1YHA A;  3JC6 6;  4BXX G;  5EAY A;  2VNU D;  5IWA Q;  1IBM Q;  3GTQ H;  3CME A;  2NVT H;  4YCV A;  1N9W A;  2D0P A;  3K80 C;  3HOW G;  3STB C;  5LMU L;  4GLA C;  4H02 A;  4HIM A;  3T1Y Q;  1ASY A;  1LM0 A;  3CCE A;  3A5Z B;  2VUM G;  5LMN L;  3S17 H;  4Y52 H;  5J3B A;  4A3I H;  2K14 A;  4YWM A;  2R7F A;  4GLV B;  2K5V A;  1G29 1;  5IT9 c;  4HJ8 A;  1OTC A;  1UE7 A;  4KHP Q;  2UXC L;  4UP8 A;  3J7Z C;  2ZM6 L;  4LUZ A;  1BVS A;  3L7Z C;  2BA1 A;  1Q1E A;  4DR5 Q;  4P74 A;  1N8R C;  3PCO B;  2YTV A;  3CCV A;  1KC8 C;  2YU9 H;  3HOU G;  1EQR A;  1JMC A;  4DV5 L;  5C0X G;  4UP7 A;  1PA6 A;  1J6Q A;  3CCR A;  1IBM L;  1VQ7 A;  1QVC A;  4JCV E;  2Q2U A;  1MJE A;  1XNQ L;  2A8V A;  3ERS X;  2N78 A;  3ICE A;  3BU2 A;  1V9P A;  3M4Q A;  3E9H A;  1XNQ Q;  3CW2 C;  2YV5 A;  4X65 Q;  2VQE Q;  1QVG A;  1VS0 A;  4YY3 Q;  4AQY L;  4NXN Q;  2HHH L;  1IXR A;  3S14 H;  1KHI A;  5BR8 L;  3S1N H;  1TWH H;  1IZ6 A;  1XPO A;  5IYC G;  4LNQ A;  1Q12 A;  2QGQ A;  3KF8 B;  4BBR H;  2FXQ A;  4DR3 L;  2VQF Q;  5H1S E;  2KHI A;  1IYJ B;  1HNW Q;  2EQS A;  1TWG H;  1S72 A;  1K3R A;  5C3E H;  3UDI A;  1TXY A;  5C4J H;  4NXM Q;  1GVP A;  5FLX c;  3F2B A;  2AMC B;  3A5U A;  1VQP A;  3PUV A;  4X66 Q;  4IOC A;  1LYL A;  1VQL A;  4A3M G;  1B8A A;  1I94 L;  3AEV A;  2NN6 G;  5C44 H;  5ELO A;  4JI4 Q;  1N32 L;  4GOP A;  3HOY G;  3CPF A;  1E1O A;  2MO1 A;  1WCM G;  1HZB A;  2OQ0 A;  3MXN B;  4YHH Q;  1NMF A;  1NMG A;  4GKJ L;  3KF6 A;  1NE3 A;  4LF9 L;  4DUY L;  1EIF A;  1X3G A;  1XMO Q;  4B3T Q;  4A3L G;  4IJL A;  4BY1 G;  2I5L X;  2ZM6 Q;  2ALY B;  3KOJ A;  1LUZ A;  1OXX K;  3W1B A;  4B3T L;  3CD6 A;  5LMN Q;  4YCU A;  4GKK Q;  1N33 Q;  2PI2 E;  1K0R A;  1L2F A;  3KF6 B;  2N8N A;  4LUO A;  3JAM i;  3FP9 A;  3CXC A;  4DV0 Q;  3GTJ H;  4YWK A;  3L0O A;  3RLO A;  4JI3 Q;  4IJH A;  4BY1 H;  1VQE A;  4DR4 L;  3HOZ G;  1PH5 A;  1KD1 C;  4DV3 Q;  2E5L L;  1A8V A;  1UE1 A;  3CP0 A;  3OTO L;  3CCS A;  1QZH A;  1YZ6 A;  3Q8D A;  4QIW E;  1YEZ A;  4R1J A;  4A93 G;  3ER0 A;  4DR7 L;  2GN5 A;  2R7D A;  2HIX A;  1QVF A;  4KHP L;  1GKH A;  3HOZ H;  2D62 A;  1M1K C;  2WB1 G;  3FHW A;  2OTL A;  3PUX A;  5IYC H;  2VQF L;  1I5F A;  1Q82 C;  2JQO A;  3GO5 A;  4B3S Q;  3S15 H;  1XJV A;  4YWL A;  2JA8 G;  3ULL A;  4GNX A;  1YJN A;  3PO3 H;  3CPW A;  4BBS G;  2R93 G;  3CC2 A;  4DR2 L;  3CCM A;  3MEF A;  2UUB L;  3JAM c;  3I4M G;  1I6H H;  1RL2 A;  4DUY Q;  2E2I H;  3I55 A;  3SGI A;  1K73 C;  2MQH A;  2B3G A;  3GTO H;  2PMZ E;  4O2D A;  4R4Q A;  1EWI A;  1V43 A;  5FJ8 G;  2IY5 B;  1VQD A;  1K83 H;  1L0W A;  2BH8 A;  2YYZ A;  1PH8 A;  4KI0 A;  4A4I A;  2H5X A;  3CF5 A;  4JI4 L;  3HOX H;  4IPG A;  3TQY A;  4JV5 Q;  4IO9 A;  1VQ6 A;  4JYA L;  1GD7 A;  2AHO B;  4EX5 A;  2OQK A;  4J15 A;  4JI6 Q;  4PZ7 A;  4MTN A;  2AKW B;  1FGU A;  2Z6K C;  3H15 A;  4TQU S;  4JOI A;  4DR2 Q;  2UUB Q;  1IBK L;  1SRU A;  4TVA B;  1KAW A;  2JE6 I;  3F2C A;  1EQQ A;  1AE2 A;  4JI1 Q;  1U5K A;  1N34 L;  3PO2 H;  4P71 A;  4JI2 Q;  1VQM A;  4POF A;  4OON A;  4YY3 L;  4AQY Q;  2L15 A;  3J7A 5;  4PZ6 A;  4DV2 Q;  1N36 L;  2VUM H;  2I5M X;  2YTY A;  1MJC A;  4DV7 Q;  3S1R H;  1AH9 A;  3F8T A;  3I4M H;  2I0Q A;  2LSS A;  3GDE A;  2BA0 A;  5IP9 G;  1O7I A;  4DR7 Q;  1JT8 A;  2A1A A;  2LXJ A;  4UP9 A;  3M7N A;  4OO1 G;  2D0O A;  4IFD J;  2K50 A;  3I2Z A;  2WB1 E;  3G48 A;  3KDF A;  3FKI G;  4DV0 L;  2K75 A;  3K7U C;  2CQO A;  4JI5 Q;  4C3J H;  2JA5 H;  3HOV H;  4IPH A;  2E8G A;  3CC7 A;  4HJ5 A;  1SE8 A;  2CWA A;  2IHF A;  4X66 L;  4L5S A;  4L5Q A;  1YNX A;  1PYB A;  4X62 L;  1GO3 E;  3AYH B;  1PV4 A;  2LXK A;  3NEL A;  4PMW A;  4AIM A;  4GNX C;  3I4N H;  2UXC Q;  3E9I A;  2NVY H;  1KRS A;  1S3O A;  2MO0 A;  1YIT A;  2MFI A;  4JBJ A;  2CKZ B;  2VL6 A;  4OWW B;  3CCL A;  5HY6 A;  3TEH B;  3J81 i;  2B29 A;  1WFQ A;  1PH3 A;  3AFQ A;  4XIG S;  3BZK A;  2NVX H;  1A63 A;  5ELN A;  3HOX G;  4P75 A;  3W1G A;  4JV5 L;  1Q8K A;  3K8A A;  2ASB A;  4IOA A;  1XMQ L;  1VQO A;  5IP9 H;  1HH2 P;  4XTC S;  2K5N A;  4RG1 A;  4R4T A;  2JJQ A;  3UDF A;  2E2J H;  5IP7 H;  2ZJR A;  4JI0 L;  4QQB X;  1S40 A;  4DV7 L;  3EIV A;  4GN4 B;  4A75 A;  2F52 A;  4C3I H;  1N33 L;  2JA5 G;  3HOV G;  3PO2 G;  1C0A A;  3I7F A;  4QGU A;  1SFO H;  3D31 A;  1L1O C;  1A0I A;  3H0G H;  1IBL Q;  4AH6 A;  1HZ9 A;  4P72 A;  4LF8 L;  1D8L A;  2AWN A;  3S1M H;  4DAY B;  5C3E G;  3J81 c;  1WYD A;  4DUZ Q;  1V1Q A;  2K4K A;  3NBH B;  1XMQ Q;  1KRT A;  4JI8 L;  5M5Y H;  2ZJP A;  1SLJ A;  4A3K H;  4JI6 L;  4DUZ L;  4HIO A;  4QL5 A;  1BBU A;  2UU9 L;  4JI7 L;  4LF6 L;  3H3V I;  4NB3 A;  1E7Z A;  3M85 A;  1GM5 A;  2NZH A;  1JJG A;  1HR0 Q;  2UXB Q;  5JJL A;  3WWV A;  1HZC A;  1N34 Q;  5IYD H;  3H3V H;  4A3G G;  1K8A C;  3HOY H;  4GS3 A;  3GTP H;  3J80 i;  4OO1 I;  3A0J A;  2Q2H A;  1Q86 C;  2IT1 A;  5LMU Q;  3GTG H;  2NVQ H;  3GTL H;  1E3P A;  1B7Y B;  4RMF A;  3PIP A;  3M9B A;  2Y0S E;  1I50 H;  2VY3 A;  2B63 G;  4C2M H;  5M3M G;  1Z9F A;  3HKZ G;  3LGJ A;  3U50 C;  4DK3 C;  4Y7N H;  3CCJ A;  5FLM H;  3RNU A;  3VDY A;  2IHE A;  5AJ3 L;  4JI5 L;  2OTJ A;  1E24 A;  3TRE A;  3AFP A;  4IPD A;  1PH2 A;  1VQ5 A;  1CKM A;  2PNH A;  4K0K L;  3PV0 A;  3G71 A;  3DM3 A;  4BA2 I;  3U4Z A;  1EIY B;  4JI3 L;  3G6E A;  2UUA L;  4JI8 Q;  4POG A;  2DUD A;  1NY4 A;  1X65 A;  5M3F G;  1KXL A;  1Y1V G;  5JEA G;  3PSI A;  4BXX H;  4O0A A;  4C3H H;  4GOP B;  3J80 c;  1VQJ A;  5IYB G;  4MZ9 A;  1Y1W G;  1HR0 L;  2GVB A;  4JI0 Q;  1CSP A;  2HHH Q;  2OCE A;  1C9O A;  2NZO A;  2BH2 A;  4LF6 Q;  4IFD G;  1XPR A;  1Q46 A;  1UE5 A;  3K7A H;  1E22 A;  4LF9 Q;  1FJG Q;  1WCM H;  4K0K Q;  2WFW A;  1HZA A;  1VQG A;  4LFA Q;  4JBM A;  1VQC A;  1X3F A;  1NTG A;  4JG2 A;  3OTO Q;  3TS0 A;  3OYY A;  2UU9 Q;  1PVO A;  3GTK H;  2JK8 A;  1VQK A;  4A3L H;  1EFW A;  4DV4 L;  3NEM A;  3KJO A;  2K52 A;  1VQB A;  3ZJY C;  2UUC L;  1E1T A;  3A74 A;  3L2P A;  1YJ9 A;  3HOW H;  2RCN A;  4DR6 L;  1CSQ A;  3STB D;  3DLL A;  1KIX A;  1IBL L;  1XMO L;  2JA6 G;  2ID0 A;  4JI1 L;  2R6G A;  4R4C A;  2UXD Q;  1VQA A;  4BBS H;  4DR6 Q;  2R93 H;  3GD7 A;  5E7N A;  1VQ9 A;  2JA8 H;  3PGZ A;  3UE0 A;  5JJK A;  5GAE C;  1PH7 A;  4X64 Q;  4OWX B;  2R7Z G;  3T1Y L;  1EUJ A;  4JC0 A;  2B63 H;  1HJP A;  1Q81 C;  1HR0 W;  5BR8 Q;  2RF4 A;  5FLM G;  4JI7 Q;  2CFM A;  1HNX Q;  2KCM A;  3E0E A;  1QUQ B;  3PIO A;  3ULJ A;  4DR4 Q;  2IX0 A;  4LFC L;  1JE5 A;  1JJC B;  4ME3 A;  3UE1 A;  2E5L Q;  3GTM H;  1FJG L;  4GOP C;  4DR5 L;  1YHQ A;  2HQL A;  5C0X I;  4DR3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...