2N49A

Ec-nmr structure of erwinia carotovora eca1580 n-terminal domain determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target ewr156a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative cold-shock protein
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Pectobacterium atrosepticum scri1043
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n49A00
4C2MH 4DR4Q 3M3YH 3UDIA 4X66L 1IBMQ 1IZ6A 1VQKA 2R6GA 2PMZE 3PO2G 2JEBI 3PGZA 2YTYA 3J7ZC 1AE3A 4POGA 1QZHA 1KRSA 4PMWA 1HR0Q 4LF8L 2BA0A 1VQMA 2KHIA 2ALYB 1HNXL 3A74A 4BBRG 2KCMA 3CPWA 4A3LH 2I0QA 3CCSA 4DUYQ 2R92H 1H95A 2CFMA 4GLAC 4UPAA 1Z47A 4B3ML 2WB1E 1XMOL 2JA6G 1LUZA 4DR1L 4APVA 1YIJA 3PCOB 4JI1L 4GOPB 3RZOH 1HZCA 1OXXK 2K52A 1E1OA 4JI5L 3PUXA 2UXCL 3H0GG 1Y1VH 4UP9A 2MFIA 2ZM6Q 2E5LQ 4UY8C 1Q46A 1LYLA 4JC0A 2L15A 5GAGC 4LUOA 2JA8H 4AYBE 4LFBL 1VQAA 3KDFB 3I2ZA 3ULJA 2JEAI 4GKKL 2HT1A 2F4VQ 3KF6A 3NBHB 3PV0A 3CC7A 1TWGH 4GLVB 2YU9H 2Q2HA 4JI4L 5GQOA 3JC66 2UUAL 2IHFA 2WB1G 4ALPA 1YHBA 2UUBL 4BBSG 3S2HH 3M4OH 5IYBG 1G291 4DV0L 2R7ZG 5IYDG 4YCWA 4DV3Q 1YNXA 4GNXB 3W1GA 1X56A 4OXPA 3J81j 1BBUA 1MJEA 3EIVA 1XNRL 2RHQB 4JBWA 2BA1A 4AIMA 3STBC 3A5UA 1W2BA 1L1OB 2R7DA 3HFZB 4LWCA 4TQUS 4AYBG 1WCMH 1EYGA 3K7UC 4B3TL 4NXNQ 4H02A 5M5YH 2NN6G 3AEVA 5C3EG 5M3FH 1X54A 4BY7G 1PHJA 2VW9A 4JI7L 2MQHA 1VQOA 3HKSA 5C4XH 2UXBL 3CMAA 2YTXA 2NZOA 2OWOA 1YI2A 1N34L 4IFDJ 1P8LA 3FKIH 5M5WH 5AJ3L 4A75A 4B3MQ 1KC8C 2OQ0A 1XMOQ 1M1KC 1K8GA 1IBKL 2JQOA 3W5OA 1SFOH 1CKOA 2PNHA 2RHSB 4A3BH 4DR7Q 1TWCH 4HIMA 5IP9H 2UXDL 1IBLQ 1NMGA 2OCEA 4OONA 5C0XI 1PYSB 1I5FA 3PIOA 4DV6L 1EFWA 4JI0Q 2JA7G 3MXNB 4DR6Q 1UE5A 3EN2A 1N36Q 4YHHQ 3CC2A 4IFDG 4A3LG 3GTMH 3J80c 3GO5A 4PZ8A 4IJLA 5HGQA 4DR3L 4KI0A 3MEFA 4A3FH 4YWKA 1QUQB 1U5KA 5M3MH 4UP7A 4GKKQ 4YWMA 4LF9Q 1HNWQ 3F8TA 2E2JH 5H1SE 4A3EH 4EQ5A 4DV4Q 1WJJA 3M85A 4PG3A 1OXVA 2IHEA 2KHJA 2UUAQ 4DR4L 2DGYA 4QIWE 1OXTA 5JEAJ 4HIDA 1KQSA 1MJCA 4A93H 5J3BA 4MTNA 3CAMA 4DR5Q 2JA8G 1VQDA 1XJVA 2RCNA 1N32L 3L0OA 1YZ6A 3RZDH 1AE2A 1OXSC 3S15H 4UP8A 2EQSA 3ER0A 5C44H 2B63H 2LXJA 4X6AH 1G6PA 1SLJA 2AHOB 1B70B 1TWAH 1PYBA 1SE8A 5JEAG 1JT8A 2PI2E 1E22A 3CPFA 3CW2C 2ZJPA 1XMQL 1A8VA 2NVQH 3GD7A 4B3SL 4KHZA 4P75A 2K5HA 3L7ZC 3CMEA 1GM5A 3S17H 3UDXA 3CCEA 1N34Q 3KYHC 1PH9A 5AJ3Q 3F2DA 3GTLH 1KIXA 2KCTA 2E5LL 3GTQH 2ZM6L 1WCMG 5GROA 1IBKQ 1N8RC 1D7QA 1Y14B 1S72A 3JAMi 2UXDQ 2N78A 1Q82C 4IJHA 3BJUA 4DV6Q 1X3FA 4NB3A 3RLFA 4DV1L 4LF7L 3HOYH 1EQQA 2CCZA 2NVXH 3UE0A 1C7YA 3ULLA 5BR8Q 2YYZA 3D0FA 4DV3L 1CSQA 4IPHA 1PH4A 3A5ZB 1NMFA 1KD1C 1VQCA 2EXDA 4BA1I 3OW2A 3TS2A 3DLLA 3I4MG 4KLKA 1VQ7A 3U4VA 3PIPA 3HKZE 4IOCA 4NXNL 5FJ8H 4R4TA 4QL5A 1E1TA 3K7AH 4OWTB 3J80i 4GLXA 4A3FG 1J5EL 1XNQQ 5M3MG 4BA2I 3E0EA 3WWVA 3L2PA 1WI5A 1KHIA 1IL2A 1N32Q 5EAYA 4A3EG 1VQLA 5JJKA 1Q8KA 1WFQA 4IO9A 1HJPA 2NN6I 1VQ4A 4HJ7A 3FP9A 2Y0SE 4L5QA 4A93G 1CKNA 3EBEA 4YY3Q 1XMQQ 3GTPH 4DR7L 4O0AA 4A3MG 1YJWA 4K0KL 4B3SQ 1HNZL 1IBLL 2ZTEA 3UDFA 4DR6L 4JI0L 4R4CA 3HKZG 1U0LA 1HZBA 1VQHA 5IP7H 4YHHL 3T1YQ 1N36L 1T9HA 4JOIA 1NBWA 2HIXA 3KJPA 3VDYA 1VQFA 4A3IH 1GD7A 2GN5A 1SRUA 3S24A 3PF4A 3ERSX 1UWVA 1AH9A 1FVIA 3DM3A 3BZKA 4LF9L 1HNWL 3CXCA 4IFDI 4DV1Q 2Z0SA 2ZTDA 4DV4L 4XTCS 4LF7Q 2Y0SG 1Q81C 1L0WA 3RNUA 3KFUA 4DR2Q 4QJFA 2V1CC 4DR5L 2VL6A 2IT1A 3GDEA 4GOPA 4GN4B 4R4QA 1YEZA 2ES2A 2A8VA 2A1AA 2I5HA 3PUVA 1VQ9A 4A3GH 1YVCA 2ASBA 1KL9A 3HOYG 3AFPA 1KXLA 5HY6A 3H3VH 2F3IA 4JBJA 3JAMc 4NXMQ 3KDFA 3HOWG 1J5EQ 1TXYA 3HOXH 4A4IA 1PH1A 3S14H 4A3KG 5FLMG 4ME3A 3I55A 2JA5G 2MO1A 1VCIA 4A76A 1EIYB 4NPSA 4LW1A 5IYCG 3CD6A 1JJCB 2WFWA 3CF5A 3CC4A 2HQLA 4PZ7A 4X62L 1A63A 3J81i 4IPCA 5FJ8G 4YCVA 4K0KQ 2OTLA 3OTOQ 3A0JA 4GNXA 1K9MC 1HNZQ 1NY4A 1UEBA 4JOIC 4OX9L 4B3RL 1QVFA 2E2HH 2IX1A 1L1OA 5M5XH 4R1JA 2R92G 4WJ4A 1JE5A 3CCLA 1FJGQ 1GO3E 1OXUA 3PO3H 4JYAQ 1O7IA 5BR8L 1PH6A 3GTGH 4BXXH 2ZJQA 4BY1H 4P74A 3GTJH 1BVSA 2CWPA 4JI8Q 4A3JH 1EQRA 2OTJA 5IP7G 2R93H 1Y1VG 4GOPC 3I4NH 4RMFA 1X55A 2VQFL 1QZGA 1PFSA 5LMNW 4EX5A 3KLWA 3UDGA 1XNQL 2PQAB 2RF4A 3ZJYC 2QGQA 1FL0A 4IPDA 1YJNA 4L5SA 2B29A 5K36G 3NELA 4DAMA 3G6EA 3GTOH 3PO2H 3RN2A 1E24A 1JMCA 3PUZA 1K73C 4JBMA 1QUQA 4DPGA 4YY3L 5LMNQ 2ATWA 2D62A 1VQNA 4BBRH 1S3OA 4LFAQ 1VQGA 3SGIA 1VQ5A 3NEMA 1X3GA 4LNQA 4X62Q 1Z9FA 3F1ZA 3T1YL 4GNXC 4RG1A 3TREA 2K50A 1PV4A 4A3CG 3J7A5 3E9IA 4LF6L 3B6YA 5M3FG 5ELNA 2DUDA 3NENA 4GN5A 1L1OC 3PSIA 4POFA 3HOXG 1Y1WH 4OX9Q 4A3DH 4B3RQ 3H0GH 2K5VA 4MNOA 5C4XG 1D8LA 1B7YB 2VY3A 3FKIG 5IE8A 4IPGA 4IOAA 3CQZH 1PVOA 4DR2L 3KJOA 1I94Q 5GAHC 3PF5A 5LMUL 4LF5Q 1X6OA 4A3BG 1EWIA 5IP9G 4DK6C 3FHWA 3S1RH 1Q7YC 2WP8J 3J81c 2E2IH 3W1BA 2I5MX 4BBSH 4JI3Q 5IYBH 2CWAA 2JA9A 5IWAQ 4HIKA 2R7ZH 5ELOA 2VQFQ 1CSPA 5IYDH 1Q12A 2K5NA 2ZTCA 4NXML 5JJIA 4LF4Q 3T1HL 1V43A 2VZAA 4GS3A 4JG2A 4DKAC 2EIFA 4X64L 4JBKA 4BXXG 4LUVA 4R4IA 4BY1G 3TRZA 2HHHQ 1E7ZA 2GVAA 2K75A 3CCUA 4A3JG 1KRTA 2OQKA 4HJ8A 3AYHB 1VQBA 4HJ9A 4JI2L 1L2FA 1N33Q 1HR0W 1SN8A 2AKWB 1XTDA 1YHAA 4TVAB 4OO1G 1FGUA 1S40A 3K81C 1GKHA 3OTOL 3H15A 1NE3A 4DNIA 4DV5Q 1PH2A 4P72A 2PI2A 2GVBA 1M90C 2R7FA 1EIFA 4QY7A 5C44G 2B63G 1MIUA 3HOVH 1FJGL 4LF6Q 1A0IA 1XPRA 2JA7H 1CUKA 2N8NA 3K0XA 4JYAL 2KBNA 3BZCA 3HOZH 3KF6B 1JB7A 2QA4A 3CCJA 4JI8L 1SR3A 3CCQA 4GKJQ 1PH7A 4X65Q 2CKZB 3IRBA 1E3PA 5LMUQ 1VS0A 3CCVA 3U58A 1QVCA 1V9PA 2C35B 3LGJA 1Y1WG 3S1NH 4A3DG 1LM0A 4L5RC 1YHQA 3OYYA 2YV5A 4L5TA 2UU9L 1YBYA 1J6QA 1PH5A 4QQBX 1TWFH 1MKHA 3TS0A 1VQIA 3T1HQ 4A3CH 1P16A 2D0PA 2N3SA 1V1QA 2WAQE 4DK3C 4X64Q 5LMNL 2IX0A 3M4PA 1VQ6A 2N49A 1YITA 3K8AA 3U50C 4LFAL 1G51A 4P71A 2NVTH 2XTIA 3GTKH 3M7NA 1JJGA 1LTLA 4Y7NH 2JK8A 4JI2Q 1ASZA 3STBD 4DAYB 1A62A 2UUCQ 5GAEC 4WJ3M 4LFCL 4Y52H 4PZ6A 4O2DA 1HZAA 2LXKA 4C3JH 5IT9c 2VQEQ 5JJLA 2NZHA 3KF8B 2F52A 4JV5Q 4HIOA 3F2BA 4DV2Q 1VQPA 4MZ9A 1QVGA 2VNUD 4X66Q 3H3VI 4XIGS 1EOVA 2XGTA 1X65A 2ID0A 1UE1A 2WAQG 1I94L 4LF8Q 3I56A 2Z6KA 1K8AC 2VUMH 1W3SA 3E9HA 4GN3B 5GADC 1HNXQ 4JI6L 4LF5L 2CQOA 1BKBA 4J15A 3BU2A 3HOUH 1RIPA 1YJ9A 4KHPL 1WYDA 2H5XA 3CP0A 2YTVA 1TWHH 4JI3L 1IYJB 3AFQA 5IWAL 3CCMA 2JJQA 2K14A 4HJAA 4DR1Q 3KOJA 4JCVE 4C3HH 4A3IG 1OTCA 3HOVG 2AMCB 3I7FA 3PUWA 4JI1Q 3S1QH 2JE6I 1HZ9A 2Q2IA 2QEXA 4LF4L 1DGSA 2AWOA 2I5LX 4JI5Q 3HOZG 3I4MH 1NTGA 2HHHL 4OWWB 2UXCQ 3UE1A 1VQJA 2KENA 4DUZL 1SMXA 1K3RA 2UU9Q 4LFBQ 1I3QH 1N33L 3M4QA 1CKMA 1UE7A 4YCUA 3G48A 4C3IH 1I50H 2BH8A 4AQYL 1XPUA 2BH2A 3S1MH 2UXBQ 1B8AA 3D31A 1X9NA 5IY0A 4DV7L 3RN5A 4DV5L 1NJIC 4JI4Q 2E8GA 2UUBQ 1Q1EA 1UE6A 4A3GG 1IBML 1K0RA 4OWXB 3RLOA 1PH8A 4OO1I 2JA6H 1IXRA 4LFCQ 1EUJA 4DV0Q 4A3MH 2FXQA 2A19A 2PQAA 3PUYA 1HR0L 2MO0A 3ICEA 3S16H 1XNRQ 1XPOA 2ZJRA 2NVYH 5C0XJ 3AQQA 3M9BA 1N9WA 1ASYA 4B3TQ 2HIVA 4DUYL 1C9OA 4HJ5A 2Z6KC 3G4SA 1JJ2A 1I6HH 4GKJL 3RR5A 4YWLA 4JI7Q 4X65L 1VQ8A 4FDBA 2Q2UA 1Q1BA 1R9TH 3RLNA 3TQYA 4JI6Q 3Q8DA 1X3EA 1K83H 3K80C 4LUZA 5C0XG 1HH2P 4KHPQ 2B3GA 4P73A 1Q86C 3I4OA 5FLXc 2Q2TA 2LSSA 1GVPA 3TEHB 1C0AA 1PA6A 3G71A 2VS1A 3F2CA 5DLQE 2VUMG 2F4VL 3PO3G 3CCRA 4AH6A 1VQEA 1SROA 4DUZQ 3HOUG 1BBWA 2AWNA 1PH3A 1WOCA 2K4KA 2D0OA 4QGUA 3S2DH 3HOWH 4BY7H 4DR3Q 5C3EH 1RL2A 3ULPA 2UUCL 3I4NG 2R93G 3U4ZA 1CKNB 1KAWA 5FLMH 2MNAA 4AQYQ 4A3KH 2VQEL 2JA5H 5C4JH 4DV7Q 4R4OA 5IYCH 2IY5B 4JV5L 4DV2L 5E7NA
chains in the Genus database with same CATH superfamily
4CKCA 3M3YH 3UDIA 1IZ6A 2HDLA 3NE5B 2WIIB 2QEJC 4I7AA 3FDTA 1AE3A 4C3HB 1HR0Q 2HCCA 1AN8A 1VQMA 3J81E 3A74A 1IHZA 3CPWA 4DUYQ 1H95A 4UPAA 3CHBD 4B3ML 4K6LA 3PO2B 2EZVA 4L8JA 4FP5D 3PCOB 3QIAA 4JI1L 1HFGA 3RZOH 1HZCA 1BF4A 4JI5L 3PUXA 3J7YW 3EFXD 1B4OA 2MFIA 1EU3A 4LFBL 1Q46A 1LYLA 4LUOA 2EDGA 3CRKC 3U9OA 4KKTA 3ULJA 5C4ZA 1JORA 1GHJA 4OHJA 1VF5C 3H3VC 2BE5D 2Q2HA 4JI4L 4K5WA 2WB1G 2UUBL 4ALPA 1YHBA 2XWJB 4Q0FA 2HCIA 1G291 1AW7A 2F1MA 4RGNA 5CMDA 4IALA 4YCWA 1YNXA 3W1GA 1X56A 3J81j 1K83B 3EIVA 4JBWA 3X3NA 4AIMA 3S1RB 3DM1A 2R7DA 4TQUS 1WCMH 1IL8A 4H02A 5M5YH 2NN6G 4ILWA 2MUYA 3QB3A 1MSGA 1PZKD 1PHJA 4JI7L 1VQOA 5C4XH 1KABA 3BYYB 5AJ3L 3E5SA 1M1KC 4OEMB 3F2UA 4DR7Q 1CKOA 2PNHA 4KKUA 5C0XI 1AZQA 3PIOA 4JI0Q 1H9KA 1UE5A 1BDOA 3EN2A 1N36Q 1R4QB 5IT9E 4IJLA 4XQQA 4YWKA 3TMEA 1HNWQ 4A3EH 1SNPA 5IGBA 1S5BD 4HR7B 1BCPC 2KHJA 4DR4L 3TZDA 1OXTA 1MJCA 5J3BA 2B2UC 1MI2A 4DR5Q 1VQDA 2K6AA 1J8IA 1D2BA 1EZ8A 3RZOB 1AE2A 1PZJD 3S15H 2EQSA 4IUQA 2B63H 4X6AH 1G6PA 1B70B 1PYBA 2PI2E 3C2PA 3CW2C 2H1EA 2F0UA 1XMQL 1A8VA 2NVQH 3GD7A 4B3SL 4P75A 3D4RA 3CMEA 2HQEA 3OIPA 1PH9A 1KIXA 2KCTA 1ET6A 1XWEA 4FXDA 4KN4C 4IUVA 1Y14B 4WRDA 2N78A 1Q82C 1X3FA 4NB3A 2N55A 1EQQA 1V1OA 1WCMB 5KIXA 3UE0A 5M5YB 1C7YA 2YYZA 3NPPA 1W6JA 5D65A 2FMMA 3A5ZB 1VQCA 2EXDA 4BA1I 3OW2A 3DLLA 1RKNA 2K28A 4WORA 1FR3A 5M3MG 3E0EA 3WWVA 3L2PA 3GP7A 1HJPA 4ME5A 4V0BA 5FLXE 1VQ4A 4HJ7A 1KTKA 5CV7A 1NSNS 4O0AA 2ZTEA 4A3EB 4RH6A 4KJNA 4DR6L 4CJ0B 3HKZG 5CV6A 1F77A 4YHHL 1T9HA 3VDYA 1GD7A 2C9OA 1SRUA 3S24A 5A2QE 3PF4A 3DM3A 3QO2A 2NZ1D 4DV1Q 2EYLA 2Z0SA 3M7GA 1ZYRD 5E1FA 4EQOA 2Y0SG 2B63B 1WD1A 1MSHA 2VL6A 1EWHA 4R4QA 2A1AA 2BE5C 2I5HA 4OL7A 1EYCA 1TU2B 4DXFA 1LTSD 3AB9A 2QCPX 2F3IA 4NXMQ 1IYUA 4JPBW 1J5EQ 3S14H 2OXPA 4ME3A 4A76A 1JE4A 4NPSA 4LW1A 1EIYB 1SE4A 2HUGA 4JK1C 4XYOA 5KYIA 3CF5A 3C1EA 3BDCA 4PZ7A 4FF4A 2PZTA 5ELEA 1A63A 1KDBA 4IPCA 4K6DA 1K9MC 2K03A 4JOIC 4OX9L 4WJWA 3K6OA 2QKIC 5M5XH 4R1JA 4R8NA 4CJ2C 1LT6D 3H09A 1OXUA 1O7IA 3MTSA 5BR8L 3GTGH 4BXXH 5A35A 2EJFC 3DWPA 1BVSA 5IOCA 4OIJA 3BYTB 5IP7G 4CHTB 2R93H 5FLXL 1GXDC 1X55A 1QZGA 1PFSA 2AUKA 1SNOA 3UDGA 1XNQL 3BDLA 3V96A 4ZAIA 3ZJYC 1EZ6A 1TS5A 1I4XA 3L9AX 4L5SA 3NELA 5IGEA 2MGSA 1E24A 1K73C 1SEBD 1EY5A 4YY3L 1ET9A 4C1NK 1S3OA 1Z6HA 3FVQA 4CKEA 3GV6A 3M4OB 4DN4M 2AQ2B 1LT4D 3VR2A 5ELNA 2DUDA 3HOXG 4B3RQ 1EOTA 1D8LA 1F9QA 5C4XG 1F9PA 1QWYA 1PDQA 5IE8A 4IPGA 2L55A 3CQZH 1PVOA 5C5LA 2CW0D 4U68A 1WTPA 1X6OA 4UHVA 3S14B 4I65A 2E2IH 2I5MX 3FKIB 5IYBH 2R7ZH 2VQFQ 5IYDH 5JJIA 3T1HL 4GS3A 1CA6A 2HHHQ 4B08A 3CCUA 4HJ9A 4IUUA 1T5XD 2JN4A 3VR3A 5CBAE 2AKWB 1XTDA 1SXTA 3GTGB 2LKVA 3A55A 2DNEA 1NE3A 4DNIA 2E2JB 2RBMA 2NTSA 1M90C 2B63G 1KLGD 1MIUA 5I9OA 3V2TA 2MP1A 4LF6Q 1CHQD 2EJGC 1JWUD 5KRUA 2PPBC 3KF6B 1JB7A 4JI8L 1HUMA 1DM0B 5C44B 2NWGA 3H91A 1D6EC 5KEEA 4ZK9B 1E3PA 1PTOH 1VS0A 3K5OA 3CCVA 3PIP3 3U58A 2SNMA 4A3DG 1ZYRC 3OYYA 4L5TA 3MA2B 4CGYB 4NP5A 3GTQB 2K5QA 2FFKB 1ESRA 2F0FA 1VQIA 4EQNA 1X3PA 3K5NA 2EY2A 2N49A 1YITA 4MHEA 4LFAL 2NVTH 1JJGA 3VYSA 2JK8A 5FKAC 4JI2Q 3STBD 4WJ3M 3CU7A 1H9RA 4LFCL 2LXKA 1AZPA 3KLRA 1LT5D 1DCZA 4DV2Q 3K5MA 2E2IB 3IFDA 4XYQA 4FYDA 2F0KA 2Z6KA 1G91A 1EY8A 1W3SA 4LF5L 4JI6L 3ITPA 4J15A 5C5MA 5BN3A 2KHSA 5DNFA 1WYDA 1SSOA 4JI3L 4UDUC 1ENAA 2B2YA 4JCVE 4R8IA 1VDZA 3I7FA 3PUWA 1TS3A 3GTPB 3S1QH 2F0VA 1IYVA 3NHHA 2AWOA 1QOHA 4YIJA 4KMUC 4ZUIA 4LJZC 5COYA 3UE1A 3KK7A 5E3FA 1D1KA 2BOSA 1XPUA 1X9NA 5IY0A 4MIUA 3TP6A 2E8GA 1S5ED 1UE6A 5EPLA 3MFGA 4A3MH 2EYMA 1YNJD 2A19A 1PTOB 1HR0L 2MO0A 2G9HD 2ZJRA 4LMQD 3AQQA 1A15A 3M9BA 4DUYL 1I6HH 3P75A 1G6ZA 1H9SB 1QB5D 2EXZA 4YWLA 4X65L 2RSOA 1Q1BA 1R9TH 1A2TA 3Q8DA 5DAUA 4LUZA 2NVTB 4KHPQ 1PRTB 2B3GA 4MTKA 4P73A 2CW0C 1PZID 2VXWA 4HCSA 2KA7A 4XQNA 4H44C 3G71A 3F2CA 1QILA 2EYJA 5DLQE 1PA6A 2VUMG 2KOLA 3N6RA 1SROA 1BBWA 3CRLC 3HOWH 2NN6H 4DR3Q 5C6AA 2R93G 3U4ZA 1KAWA 1BOSA 1MGSA 2MNAA 4FF3A 2VQEL 5CV8A 4DV7Q 2FJ2A 1EEID 4JV5L 4ABNA 2M9VA 1IBMQ 2R6GA 3I4NB 3BS1A 2X6LA 4POGA 4PMWA 5M9OA 4RCOA 2BA0A 2ALYB 1TKWB 2QF7A 4KTAA 1BBXC 3M4YA 2KCMA 5F2DA 2I0QA 2AQ3B 2CFMA 4H7BA 1D5ZC 2WB1E 2JA6G 4DR1L 1SAPA 4NMZA 1WTQA 1PXUA 2KQ3A 1Y1VH 2MPMA 4UP9A 4UY8C 5GAGC 2RVLA 1V1PB 5I2XA 3I2ZA 4ZYSA 2JEAI 2HT1A 2M2LA 1PRTD 4J6HA 1TWGH 4ZKCB 4WFN3 5IYBG 4QCLA 3NQIA 2R7ZG 3QOLA 1SE2A 5IYDG 1MHWC 5K5PA 2WB1B 3STBC 1V8QA 1L1OB 4A3CH 4KD4A 5C3EG 2Q8IB 4OGQC 3HKSA 1O78A 3CMAA 2YTXA 2DNCA 2NZOA 3EROA 5M5WH 4S3SA 2A73B 1KC8C 2OQ0A 1XMOQ 1K8GA 3W5OA 4A3BH 2SEBD 5IP9H 3KF8A 1IBLQ 1NMGA 4OONA 1I5FA 3MXNB 3CC2A 2FINB 4A3LG 4ZKBB 5FOBB 2KJXA 4PZ8A 1Q8IA 1QUQB 1DXMA 5M3MH 4UP7A 3K5LA 4YWMA 3NUCA 3F8TA 3G6JB 4DV4Q 4PG3A 1OXVA 2HD3A 2DGYA 4HIDA 1KQSA 2JA8G 2RCNA 3L0OA 3S1NB 2XRSD 1OXSC 1EU4A 3RUZA 3ER0A 1JT8A 3SK5A 5JEAG 1I4GA 1L0YB 3UDXA 1S5FD 3CCEA 1N34Q 3QOJA 2JXMB 3F2DA 3GTKB 3LWEA 3GTLH 1JWSD 1EY0A 2E5LL 2ZM6L 1IBKQ 1D7QA 3S9WA 2UXDQ 3JAMi 1BNZA 4IJHA 4QMGA 4DV6Q 4DV1L 1EY7A 1HXYD 3NSWA 2NVXH 1LTID 3QWNA 3ULLA 1RDPD 5I6YA 4DV3L 1CSQA 4IPHA 4KHVA 1NMFA 1QCBD 2RDGA 3MZ5A 5M5WB 1VQ7A 2ENBA 2A6HC 3W2DA 3HKZE 3PIPA 4NXNL 1O7LA 4QL5A 1E1TA 4X3KA 4GLXA 4A3FG 2ZXOA 1J5EL 1GUOA 3OSOA 1N32Q 1WI5A 2PZUA 4CBVA 1VQLA 1WFQA 5E4WC 2NN6I 2Y0SE 4A93G 4RHSA 5D3DA 5M3MB 4A3MG 3PMFA 3UDFA 4ZRZA 2XN9C 2F3WA 4FVMA 1HZBA 3BDOA 5IP7H 4J1MA 2ICIA 1M4VA 1NBWA 1PTOC 4A3IH 5HURA 2L9HA 1D1IA 3ERSX 1FVIA 4N8X1 4LF9L 4XT3B 4HSPA 3HKZB 1G8ZD 5KYLA 4K5VA 3NP8A 1L0WA 4K2KA 4DR2Q 4QJFA 4IUPA 2V1CC 1JOQA 4GOPA 1PRTC 3SDZA 2A8VA 1RTOA 3PUVA 3MVVA 5LL6S 3D6WA 1YVCA 2Y0SB 1E0BA 1KL9A 1U4PA 3AFPA 4A3GH 4XT1B 2PQEA 1F2LA 3DXJC 4QB4A 4JBJA 3HOWG 3KDFA 2OF1A 1TXYA 3HOXH 4HMIA 3NBHA 4IZ8A 3CD6A 3TSSA 2WFWA 2EY6A 2D2CC 3NTKA 1SYEA 1SYCA 3J81i 2B2WC 4DU9A 2NVXB 1X3QA 1LTGD 4GNXA 4B3RL 2J0TD 5C4JB 2E2HH 1XYIA 2IX1A 3DEPA 3M3YB 1K0SA 1JE5A 3UI2A 4EVOA 3PO3H 1QNUA 1AP0A 4P74A 4KY5A 2R3ZA 1EQRA 2OTJA 1FNVA 5J22A 1TQOA 1Y1VG 2F0GA 3A8JE 3N52A 4RMFA 2VQFL 1FNUA 2A5HA 2RF4A 3LNNA 4IPDA 5K36G 2HDMA 2AQ1B 2Q8TA 3GTOH 2JP1A 5JOBA 1JMCA 4A3IB 4FXKC 3DEOA 4DPGA 5EBCA 2Z4IA 1HCZA 1VQ5A 4KK7A 2CH4W 1CT1D 4X62Q 3T1YL 3F1ZA 4OIKA 4RG1A 2LY7A 2RA4A 1RD9D 1PV4A 4A3CG 4QUCA 1ENCA 4LF6L 3B6YA 3VYTA 3NENA 4A3DH 1L1OC 4DNTB 1K8OA 3H0GH 3D4WA 2OT2A 3KJOA 1I94Q 2E2DC 3HOXB 4A3BG 5IP9G 2PW7A 5C4XB 1Q7YC 2WP8J 4BBSH 4K8IA 2C5CA 2JA9A 2WKCA 1EY6A 5ELOA 1CSPA 1DOMA 1F2YA 3NBIA 1V43A 2PW5A 2VZAA 2QW7A 2EIFA 4R4IA 1FGBD 1E7ZA 2E2HB 3A7AB 5IGDA 3IKJA 1N33Q 1BUVT 2OQKA 4JI2L 1YNNC 2DY7A 2KUMA 1JICA 1FGUA 1S40A 3K81C 3PO3B 3OTOL 3H15A 2EVBA 5C3XA 3OWFA 2B8FA 5T1IA 1PH2A 1SJED 2O2LD 1EY9A 2GVBA 1B1ZA 4IN3A 4QY7A 2O5IC 2RKSA 1B3QA 4HN7A 4RWSC 1FJGL 5C4HA 2JA7H 1CUKA 4JYAL 5L37A 2K1BA 1TR5A 1RHPA 4GZYC 2XVSA 2B2TC 3S15B 2M00A 3CCQA 1LTAD 4GKJQ 3MAQA 5LMUQ 1SBBB 2XWBB 1QVCA 2NVQB 3LGJA 1Y1WG 2KECA 5DEHA 1YHQA 2YV5A 4M1UB 3FRPB 1PH5A 1C48A 1TWFH 1MKHA 1I4HA 1P16A 2D0PA 4DK3C 1V1QA 2R61A 5ELBA 4X64Q 5LMNL 4A3DB 3M4PA 2WINB 3K8AA 3U50C 4P71A 3MWYW 2XTIA 4NDXA 4TKOB 2UUCQ 4Y52H 2I07B 4O2DA 1HZAA 5JJLA 1CZWA 4CDDC 2F52A 1KDAA 1SJHD 3F2BA 1VQPA 4DA2A 3FEWX 1UE1A 3HEJA 2D9UA 1HA5A 2VUMH 1XX8A 4GN3B 4F88A 2DN8A 3SHLA 1SNMA 1ILPA 4KHPL 3A54A 2YTVA 1CK1A 3R2TA 5IWAL 4DF7A 2K14A 4A3IG 1R4PB 1TY0A 4JI1Q 2L4NA 2JE6I 1HZ9A 1BQQT 4LF4L 1DGSA 4JI5Q 3I4MH 1VF7A 1NTGA 4OWWB 3T51B 1VQJA 2KENA 1SMXA 3SK4A 1K3RA 1HPCA 5IODA 1I3QH 2UU9Q 4LFBQ 3M4QA 1CKMA 5ELFA 1UE7A 3VA5A 2IWHA 1LTRD 2K05A 2UXBQ 4TRDA 1B8AA 4X3UA 4DV7L 4DV5L 4JI4Q 2UUBQ 1Q1EA 4A3GG 1IBML 3RLOA 2NTTA 1AEXA 2JA6H 2RDHA 3A56A 3P1HA 1HA6A 2PQAA 3ICEA 1T5EA 3S16H 1PFNA 4R9WA 3TP5A 2HIVA 4HJ5A 3K58A 1JJ2A 3RR5A 4PV1C 4JI7Q 1TWFB 1VQ8A 4DXGA 3TQYA 3AMUA 1STNA 5EGTA 1X3EA 4ODGA 2XSCA 3I4OA 1Q86C 2K5WA 2Q2TA 2LSSA 3VR5A 1ZKOA 2VS1A 3PO3G 3CCRA 2A69C 4RGMA 3HOUG 4DUZQ 2WACA 2F0MA 2K4KA 4P2CB 2NB0A 1VMCA 5C3EH 1RL2A 5M5XB 4ULLA 5JJZA 1EYAA 5FLMH 3E3XA 2LS01 2JA5H 2VUMB 3IFTA 5IYCH 4C2MH 4DR4Q 3GV3A 4DAPA 2LMCB 4X66L 1A6XA 2R93B 2PMZE 5FO7B 2JEBI 3J7ZC 2V4DA 3C1FA 1KRSA 4C3IG 4LF8L 4IUTA 1HNXL 1EEFD 4PMBA 1SYBA 2B2VC 4A3LH 3EVQA 3OMGA 2PYKA 4GLAC 1I3QB 4HTHA 1KNAA 1XMOL 1BCPF 4APVA 1PFMA 1QE6A 1SDFA 3MFYA 3I72A 4NW2A 2K52A 4DFAA 3H0GG 2UXCL 4K2LA 2L15A 2JA8H 5EKIA 3WOEA 2JA6B 2A6ED 1F2ZA 2L0CA 1VQAA 3A7LA 2F4VQ 1SNQA 2DJGC 3TBIB 3D6CA 3PV0A 3CC7A 2KEEA 3S16B 2YU9H 1NNXA 1JB3A 2PMZB 3JC66 4HAEA 1EL0A 5JEAH 4BBSG 3S2HH 2P5ZX 3SXHA 3CQZB 2NUCA 3SR1A 4DV0L 1O7YA 5DM73 2B2UA 1XNRL 2RHQB 3IL8A 2BA1A 4AYBG 1EYGA 3HFZB 4B3TL 2RDFA 2F4IA 1ICFB 2F0WA 3K7UC 1WTVA 4BY7G 5M3FH 1X54A 2R7ZB 1I6VC 4DK1A 2MQHA 3DMUA 1Y8NB 2OWOA 3ND8A 1N34L 1P8LA 5C3EB 1IBKL 1SFOH 3DWQA 1TWCH 4HIMA 2EYOA 2L5TA 2UXDL 2JA5B 2OCEA 3MHBA 2JA7G 1PYSB 1CQVA 1Y8PB 2J4XA 4DV6L 4ZCKA 4DR6Q 1GJXA 4IFDG 1SE3A 4YHHQ 2IX3A 3NWTA 5HGQA 4KI0A 4A3FH 4RA8A 5CBEE 4GKKQ 5D14A 5H1SE 4EQ5A 1WJJA 1IW7D 3M85A 5G3LD 2UUAQ 1FD7D 4B9WA 5JEAJ 4UAIA 4A93H 4MTNA 1B9MA 1N32L 1EYDA 3RZDH 2DJFC 3HRZC 1SMYD 2IL8A 4UP8A 1TWAH 1SE8A 1WTXA 1C4QA 1E22A 2JA8B 3T56B 2ZJPA 3MXPA 4KHZA 1CI3M 1MBYA 2K5HA 1GM5A 1PFBA 3S2HB 1N8RC 3HP3A 2BDOA 3OIQA 1S72A 3BJUA 2CCZA 2A6HD 2L12A 5BR8Q 4X3SA 3LWUA 3A8KE 1PH4A 4M8AA 1OO9B 1KD1C 3C3LA 1LTBD 3I4MG 4KLKA 3EQLC 4R4TA 1EIGA 3K7AH 3J80i 1SFOB 4L63B 1XNQQ 3HS0C 4BA2I 3S1QB 5JJKA 1Q8KA 5CYUA 4IO9A 2A74C 5JVG3 1HTPA 3FP9A 1D5MC 1PTOD 4A3FB 1CKNA 4YY3Q 4DR7L 4ZQ3A 2X69A 1Q90A 4JI0L 4R4CA 1U0LA 1VQHA 4G7HC 1N36L 4JOIA 2HIXA 1VQFA 4A93B 1FNWA 4A3MB 1UWVA 1AH9A 3BZKA 4PNYA 3RZDB 3TZUA 1HNWL 2ZTDA 4LF7Q 4XTCS 5K36H 3VA7A 1Q81C 1GUTA 1RF2D 2A6EC 2KVMA 3L3OC 1I6HB 1F2MA 4DR5L 2IT1A 5JPMC 1YEZA 4I7ZC 1R9TB 4DNRB 4CJ1B 1VQ9A 3J7AF 1KAAA 3J80L 3HOYG 1TS2A 3T53B 3P20A 5HY6A 1A2UA 1QJOA 3KLSX 3GQBA 4FF1A 1PH1A 5CGKA 5FLMG 3I55A 2JA5G 2MO1A 3DUZA 4C56C 5IYCG 1JJCB 3CC4A 4ID6A 4X62L 4DAYA 4K14A 3HOWB 5FJ8G 4K0KQ 1LABA 2F3VA 3A0JA 5C3WA 1HNZQ 1NY4A 2XIWA 2H4OA 1QVFA 5ISRA 2KCCA 1U4RA 4KKSA 4DGZA 3GTJH 1A3UA 4JI8Q 4G7ZC 5KNBA 3P7JA 4RGTA 1IW7C 3SK6A 3D3RA 1UAPA 2B29A 3FMCA 3G6EA 1Y1VB 5LL6X 3PO2H 3PUZA 1SNCA 4JBMA 2XNAC 1CFMA 5D3IB 3Q24A 1ML0D 2ATWA 4G4KA 1SMYC 1VQNA 4BBRH 4LFAQ 3ONAB 4RCNA 1TWGB 3KUPA 5JPNC 4KJOA 3NQTA 2ZXRA 2OEOA 5M3FG 1Y1WH 4GN5A 1TIID 2F0TA 4MNOA 1HFNA 4RKBA 3HZXA 5KNDA 1DZ1A 4IOAA 2CHBD 2SNSA 1WTOA 4BS9A 5GAHC 5LMUL 4LF5Q 1EWIA 2Z1CA 2AUJD 3S1RH 5KNCA 1A3VA 4LAAA 4JI3Q 1FYCA 2CWAA 4HIKA 4RAUC 1Q12A 1YNND 4NXML 4A3BB 4CDCC 4DKAC 4X64L 4LUVA 4BY1G 3TRZA 2GVAA 2LFNA 2ZT9C 4A3JG 1KRTA 2EYPA 5CORA 4HJ8A 1HR0W 3O13A 1SN8A 4OO1G 4TVAB 1WTRA 1GKHA 3GTJB 1Y69U 2PI2A 2DY8A 1NR4A 1ESFA 3JAML 4XXEA 5DM63 1CQFA 3BZCA 2IPKD 2QA4A 3CCJA 1SR3A 5EJWA 1M8AA 1SYDA 3I70A 1PH7A 4X65Q 1VMPA 1JOKA 4F8MA 4H13C 1LM0A 4BBRB 4L5RC 2UU9L 1YBYA 3GTLB 5EKLA 1J6QA 1QNKA 5FO8B 1CZGA 2N3SA 2UXBL 1Y1WB 2BCOA 2IX0A 1Q3LA 1GOZA 1NR2A 4HCEA 4QF4A 1G51A 1ASZA 4DAYB 2F0IA 5GAEC 3H6MA 2VQEQ 2NZHA 2K32A 3KF8B 3RD4A 3FPUB 4JV5Q 1UNSA 4HIOA 1QVGA 2VNUD 2F0EA 5BN5A 2XGTA 1DONA 1X65A 3C46A 1BXTA 2WAQG 3I56A 3TN2A 2D5DA 2CQOA 1F9SA 3BU2A 3HOUH 1RIPA 2H5XA 3CP0A 1TWHH 1IYJB 3CCMA 4HJAA 2JJQA 4DR1Q 3TP7A 3MEHA 3HOVG 2AMCB 2KCNA 2QEXA 1U4LA 3QJYA 5NUCA 5IGFA 2HHHL 3HOZG 1H9MA 4DUZL 4E6IA 2Z6BA 5AFWA 4YCUA 4C3IH 5I9PA 1I50H 3E0JA 3S1MH 3D31A 3J81L 1WVLA 3E6ZX 1TS4A 1JOOA 1K0RA 4OWXB 1PH8A 1EUJA 1DOKA 5ELCA 3A8IE 4L6TB 2FHTA 1A3TA 5JAVA 1G2SA 2JSOA 1XPOA 2FMCA 4OELB 2NVYH 2EPBA 5IGGA 3K57A 1ASYA 4A3GB 2CQAA 2A68C 2Z6KC 2NYZD 2Z8LA 3EA6A 2RCFA 1E2VA 2Q2UA 4FDBA 4RKLA 4C3JG 3RLNA 1L0XB 1U4MA 5BN4A 1RJTA 2I46A 3K80C 5C0XG 1JR0D 2B2YC 2A69D 2TMPA 3TEHB 5J39A 2F4VL 2QILA 4AH6A 1VQEA 3I3CA 1KNEA 1PH3A 1WOCA 2D0OA 5I6WA 3Q22A 3S2DH 4BY7H 1DD2A 1CA5A 4C3HG 4A3KH 4AQYQ 1LLRD 4R4OA 1NAPA 4JW0A 3FPPA 1GHKA 3HOUB 4DV2L 5E7NA 1RTNA 4N8FA 2G9DA 1VQKA 1TWHB 2PCFB 1O80A 3VYRA 3PO2G 2E76C 3PGZA 2YTYA 5EBDA 1QZHA 2EE1A 4BWGB 1D5XC 2KHIA 2MJ8A 3I8ZA 4DAVA 4IFDH 4BBRG 2R92H 3WOFA 3CCSA 3GTOB 1Z47A 5IT9L 1LUZA 3HG9A 1YIJA 4C3IB 1I50B 4GOPB 3S1MB 2F0NA 3K0YA 1RCVD 1OXXK 1STAA 1EWCA 1E1OA 4N9TA 5G3LF 2E5LQ 2ZM6Q 1JCKB 4JC0A 4AYBE 2F0DA 3KDFB 3MC0B 4GKKL 3T13A 4B9XA 2TSSA 3KF6A 3NBHB 2QDBA 4GLVB 1G2TA 3H0GB 2NVYB 1B50A 5GQOA 2UUAL 2IHFA 2IW3A 2PO4A 2EJMA 3M4OH 3LX0A 1KLUD 1STHA 3I90A 5CV4A 4DV3Q 3NTHA 4GNXB 1GUGA 4OXPA 1BBUA 1MJEA 1W2BA 3A5UA 3VR6A 1ONLA 3BVGA 3OWEB 4LWCA 4BBSB 4NXNQ 2O5JC 3D8GA 3AEVA 1B9NA 1WTHA 3IAYA 2E75C 2VW9A 3I4LA 1S4ZA 2E74C 2F03A 4EGVA 1YI2A 4IFDJ 3FKIH 4AYBB 3BVMA 4A75A 3S2DB 4B3MQ 4BY7B 2JQOA 1EQVA 2RHSB 4A3KB 1EIHA 1EFWA 1CM9A 1LT3D 3GTMH 3J80c 2F0SA 3GO5A 2SOBA 1STGA 4DR3L 3MEFA 1U5KA 4FNFA 1HHVA 4LF9Q 1E2WA 2L1BA 2E2JH 1STEA 2JA7B 1I4PA 1F9RA 2IHEA 2R92B 4QIWE 3CAMA 1GUSA 1PTOF 1XJVA 2QDLA 1YZ6A 2PNRC 3DWAA 5IGCA 5C44H 2LXJA 1STYA 1SLJA 2AHOB 1JQYD 2Z4HA 3CPFA 5A2QL 1B44D 3OW7A 2K7VA 3L7ZC 3S17H 4TSSA 1PRTF 3KYHC 5AJ3Q 4JVZA 4H0LC 3GTQH 1WCMG 5GROA 2F0QA 3R2IA 4K5XA 3RLFA 4QIWB 4LF7L 3HOYH 3ERQA 5LHY1 1H9SA 4IQZA 3D0FA 2F0LA 3T16A 3TS2A 2EY1A 2O4XA 3U4VA 4IOCA 5FJ8H 4Q5VA 4C1NI 4OWTB 1IL2A 1KHIA 5EAYA 2NBFA 4A3EG 4FXGC 3I4MB 3QR8A 3GTMB 2ICEC 4L5QA 1DYQA 3EBEA 1GUNA 3GTPH 1XMQQ 4K0KL 1Y8OB 1YJWA 4RFBA 4B3SQ 2B2WA 1HNZL 1IBLL 1ILQA 1WD0A 3U9SA 3T1YQ 1J9OA 2F0PA 3KJPA 4K8JA 2X6GA 4N9PA 2GN5A 2G5DA 3Q0AA 3NTIA 1NCVA 3CXCA 3W3AA 4IFDI 3Q6SA 3R3OA 2CH4A 4DV4L 2L11A 1PYWD 3KLSA 5CV9A 1CHPD 5IIFA 1NUCA 3RNUA 3KFUA 3K59A 3PQIA 4CDFC 3GDEA 3OOCA 4GN4B 2ES2A 2EOTA 3S17B 5T1GA 1KXLA 1X32A 2ASBA 5FO9B 2RQXA 2EY5A 1HRJA 4CDEC 3BZDB 3H3VH 1V1PA 3JAMc 4A4IA 4A3KG 2B8GA 4O1NA 1LTTD 1VCIA 3Q23A 3HOYB 3URYA 5EPKA 2HQLA 1HUNA 3CKIB 3EJIA 4FO2A 1IKLA 4YCVA 3OPOA 2OTLA 3OTOQ 5EKKA 1UEBA 5CC4A 3SVMA 4LK1C 1L1OA 4C2MB 2R92G 4WJ4A 3CCLA 1ZEQX 2BDNA 1GO3E 3R93A 1E2ZA 1K8MA 1FJGQ 4JYAQ 1PH6A 2ZJQA 4BY1H 1DJRD 2CWPA 4A3JH 1DOLA 3OMCA 3J7AV 1S5DD 2CVRA 4GOPC 3I4NH 1I4QA 3MXUA 1MD2D 1I4RA 4OO1H 1JC7A 5LMNW 4EX5A 3KLWA 2PQAB 4MN3A 4EQPA 1CTMA 3MXNA 2QGQA 1FL0A 1YJNA 5HGTA 3BG3A 4DAMA 3T4AC 1TT2A 3RN2A 2F0OA 3KBGA 2KEDA 1QUQA 2GA4B 5LMNQ 2D62A 4G7OC 1VQGA 3SGIA 3J80E 3R8BA 3NEMA 2YU9B 1X3GA 4LNQA 1Z9FA 4GNXC 3TREA 3PIO3 1IKMA 2K01A 4O42A 2K50A 1JWMD 5CR3A 2MHVA 3J7A5 1Z7TA 3E9IA 4POFA 3PSIA 4HSVA 4OX9Q 2N88A 2K5VA 1B7YB 1HTLD 2VY3A 3FKIG 4DR2L 1UUPA 2B2TA 2K04A 5I4DA 5M3FB 3PF5A 1STBA 4RHRA 1SYFA 4DK6C 1EQTA 3TDQA 4V190 3FHWA 3J81c 1LACA 3W1BA 1W6KA 3HGBA 5IWAQ 1PLFA 4HMJA 2K5NA 2ZTCA 3TP8A 4LF4Q 4JG2A 1TWCB 4XDXA 4JBKA 4BXXG 1SYGA 1II3A 2K75A 4XQJA 4PQXA 4KD3A 3AYHB 1VQBA 4X3TA 1B2TA 1L2FA 3I73A 3KBXA 1EY4A 1YHAA 2K5DA 2ZXPA 4BY1B 4DV5Q 4P72A 4A3JB 2R7FA 1EIFA 5C44G 2F0JA 3HOVH 2VB3X 1A0IA 5ELDA 4QUFA 1XPRA 2N8NA 4KY6A 3K0XA 1WTWA 2KBNA 2K33A 3HOZH 2PZWA 4G57A 4J8QA 4DK0A 5EPJA 3X3MA 4F87A 3I91A 1B53A 1K28A 1TWAB 4U673 5I2YA 1BCPB 2CKZB 3IRBA 2SDFA 4KY7A 2EYHA 3S1NH 1K3BC 1V9PA 1XTCD 2C35B 4KV6A 3AU7A 4QQBX 3TS0A 3T1HQ 4ZUJA 2WAQE 3NWSA 1VQ6A 1S5CD 3VR4A 3M7NA 4NKLA 3GTKH 1LTLA 4Y7NH 1KDCA 3DHQA 2Q8RE 1A62A 1LV9A 4PZ6A 5IT9c 4C3JH 1U9RA 2EYFA 2F0HA 1GUWA 5C0XH 2XRQD 4MZ9A 4X66Q 3H3VI 4XIGS 1EOVA 1QG7A 2VB2X 4HEDA 2ID0A 3ND9A 1I94L 4LF8Q 1RODA 3K7AB 1K8AC 3E9HA 3MXGA 5GADC 1HNXQ 4FF2A 1BKBA 5CV5A 1YJ9A 1BR9A 2JYOA 3JAME 3AFQA 3ZYYX 3G7LA 1OTCA 2WAQB 3KOJA 4C3HH 2Q2IA 3D4DA 4RGOS 2I5LX 2UXCQ 2Z9HA 4KN7C 1BCPD 3VYUA 1N33L 1C8CA 3V05A 3HOVB 3BVZA 3G48A 2BH8A 4AQYL 3OHXC 2BH2A 3NXWA 3SK8A 1HQRD 4IUNA 3RN5A 1NJIC 3HOZB 2J7ZA 4OO1I 1IXRA 5EQ0A 4LFCQ 2A68D 4DV0Q 4IURA 4PMCA 2FXQA 3PUYA 1BO0A 3SEBA 1HQMC 1AFPA 1EFID 1XNRQ 3QG1A 1B3AA 3WDNA 5C0XJ 1XXGA 1N9WA 2RSNA 4B3TQ 1C9OA 3G4SA 4Z9CB 1YNJC 2B2VA 5J1ZA 4GKJL 1TY2A 5TSSA 1O7ZA 4JI6Q 1TVXA 3NK9A 1K83H 2B39A 2WV6D 1HH2P 4Y7NB 5FK9C 5FLXc 1GVPA 1SNDA 4C3JB 4ZLTF 1C0AA 1ICWA 1H9JA 1LO5D 2AWNA 5E4XA 5JVH3 2WKDA 4F7XA 1PMRA 4QGUA 1UEAB 3RMHA 3H94A 3ULPA 2UUCL 3I4NG 2IJ0A 3SE0A 1CKNB 1ZXTA 4CKBA 5KGUA 5C4JH 2IY5B 1ENFA
chains in the Genus database with same CATH topology
4C2MH 4DR4Q 3M3YH 3UDIA 4X66L 1IBMQ 1IZ6A 1VQKA 2R6GA 2PMZE 3PO2G 2JEBI 3PGZA 2YTYA 3J7ZC 1AE3A 4POGA 1QZHA 1KRSA 4PMWA 1HR0Q 4LF8L 2BA0A 1VQMA 2KHIA 2ALYB 1HNXL 3A74A 4BBRG 2KCMA 3CPWA 4A3LH 2I0QA 3CCSA 4DUYQ 2R92H 1H95A 2CFMA 4GLAC 4UPAA 1Z47A 4B3ML 2WB1E 1XMOL 2JA6G 1LUZA 4DR1L 4APVA 1YIJA 3PCOB 4JI1L 4GOPB 3RZOH 1HZCA 1OXXK 2K52A 1E1OA 4JI5L 3PUXA 2UXCL 3H0GG 1Y1VH 4UP9A 2MFIA 2ZM6Q 2E5LQ 4UY8C 1Q46A 1LYLA 4JC0A 2L15A 5GAGC 4LUOA 2JA8H 4AYBE 4LFBL 1VQAA 3KDFB 3I2ZA 3ULJA 2JEAI 4GKKL 2HT1A 2F4VQ 3KF6A 3NBHB 3PV0A 3CC7A 1TWGH 4GLVB 2YU9H 2Q2HA 4JI4L 5GQOA 3JC66 2UUAL 2IHFA 2WB1G 4ALPA 1YHBA 2UUBL 4BBSG 3S2HH 3M4OH 5IYBG 1G291 4DV0L 2R7ZG 5IYDG 4YCWA 4DV3Q 1YNXA 4GNXB 3W1GA 1X56A 4OXPA 3J81j 1BBUA 1MJEA 3EIVA 1XNRL 2RHQB 4JBWA 2BA1A 4AIMA 3STBC 3A5UA 1W2BA 1L1OB 2R7DA 3HFZB 4LWCA 4TQUS 4AYBG 1WCMH 1EYGA 3K7UC 4B3TL 4NXNQ 4H02A 5M5YH 2NN6G 3AEVA 5C3EG 5M3FH 1X54A 4BY7G 1PHJA 2VW9A 4JI7L 2MQHA 1VQOA 3HKSA 5C4XH 2UXBL 3CMAA 2YTXA 2NZOA 2OWOA 1YI2A 1N34L 4IFDJ 1P8LA 3FKIH 5M5WH 5AJ3L 4A75A 4B3MQ 1KC8C 2OQ0A 1XMOQ 1M1KC 1K8GA 1IBKL 2JQOA 3W5OA 1SFOH 1CKOA 2PNHA 2RHSB 4A3BH 4DR7Q 1TWCH 4HIMA 5IP9H 2UXDL 1IBLQ 1NMGA 2OCEA 4OONA 5C0XI 1PYSB 1I5FA 3PIOA 4DV6L 1EFWA 4JI0Q 2JA7G 3MXNB 4DR6Q 1UE5A 3EN2A 1N36Q 4YHHQ 3CC2A 4IFDG 4A3LG 3GTMH 3J80c 3GO5A 4PZ8A 4IJLA 5HGQA 4DR3L 4KI0A 3MEFA 4A3FH 4YWKA 1QUQB 1U5KA 5M3MH 4UP7A 4GKKQ 4YWMA 4LF9Q 1HNWQ 3F8TA 2E2JH 5H1SE 4A3EH 4EQ5A 4DV4Q 1WJJA 3M85A 4PG3A 1OXVA 2IHEA 2KHJA 2UUAQ 4DR4L 2DGYA 4QIWE 1OXTA 5JEAJ 4HIDA 1KQSA 1MJCA 4A93H 5J3BA 4MTNA 3CAMA 4DR5Q 2JA8G 1VQDA 1XJVA 2RCNA 1N32L 3L0OA 1YZ6A 3RZDH 1AE2A 1OXSC 3S15H 4UP8A 2EQSA 3ER0A 5C44H 2B63H 2LXJA 4X6AH 1G6PA 1SLJA 2AHOB 1B70B 1TWAH 1PYBA 1SE8A 5JEAG 1JT8A 2PI2E 1E22A 3CPFA 3CW2C 2ZJPA 1XMQL 1A8VA 2NVQH 3GD7A 4B3SL 4KHZA 4P75A 2K5HA 3L7ZC 3CMEA 1GM5A 3S17H 3UDXA 3CCEA 1N34Q 3KYHC 1PH9A 5AJ3Q 3F2DA 3GTLH 1KIXA 2KCTA 2E5LL 3GTQH 2ZM6L 1WCMG 5GROA 1IBKQ 1N8RC 1D7QA 1Y14B 1S72A 3JAMi 2UXDQ 2N78A 1Q82C 4IJHA 3BJUA 4DV6Q 1X3FA 4NB3A 3RLFA 4DV1L 4LF7L 3HOYH 1EQQA 2CCZA 2NVXH 3UE0A 1C7YA 3ULLA 5BR8Q 2YYZA 3D0FA 4DV3L 1CSQA 4IPHA 1PH4A 3A5ZB 1NMFA 1KD1C 1VQCA 2EXDA 4BA1I 3OW2A 3TS2A 3DLLA 3I4MG 4KLKA 1VQ7A 3U4VA 3PIPA 3HKZE 4IOCA 4NXNL 5FJ8H 4R4TA 4QL5A 1E1TA 3K7AH 4OWTB 3J80i 4GLXA 4A3FG 1J5EL 1XNQQ 5M3MG 4BA2I 3E0EA 3WWVA 3L2PA 1WI5A 1KHIA 1IL2A 1N32Q 5EAYA 4A3EG 1VQLA 5JJKA 1Q8KA 1WFQA 4IO9A 1HJPA 2NN6I 1VQ4A 4HJ7A 3FP9A 2Y0SE 4L5QA 4A93G 1CKNA 3EBEA 4YY3Q 1XMQQ 3GTPH 4DR7L 4O0AA 4A3MG 1YJWA 4K0KL 4B3SQ 1HNZL 1IBLL 2ZTEA 3UDFA 4DR6L 4JI0L 4R4CA 3HKZG 1U0LA 1HZBA 1VQHA 5IP7H 4YHHL 3T1YQ 1N36L 1T9HA 4JOIA 1NBWA 2HIXA 3KJPA 3VDYA 1VQFA 4A3IH 1GD7A 2GN5A 1SRUA 3S24A 3PF4A 3ERSX 1UWVA 1AH9A 1FVIA 3DM3A 3BZKA 4LF9L 1HNWL 3CXCA 4IFDI 4DV1Q 2Z0SA 2ZTDA 4DV4L 4XTCS 4LF7Q 2Y0SG 1Q81C 1L0WA 3RNUA 3KFUA 4DR2Q 4QJFA 2V1CC 4DR5L 2VL6A 2IT1A 3GDEA 4GOPA 4GN4B 4R4QA 1YEZA 2ES2A 2A8VA 2A1AA 2I5HA 3PUVA 1VQ9A 4A3GH 1YVCA 2ASBA 1KL9A 3HOYG 3AFPA 1KXLA 5HY6A 3H3VH 2F3IA 4JBJA 3JAMc 4NXMQ 3KDFA 3HOWG 1J5EQ 1TXYA 3HOXH 4A4IA 1PH1A 3S14H 4A3KG 5FLMG 4ME3A 3I55A 2JA5G 2MO1A 1VCIA 4A76A 1EIYB 4NPSA 4LW1A 5IYCG 3CD6A 1JJCB 2WFWA 3CF5A 3CC4A 2HQLA 4PZ7A 4X62L 1A63A 3J81i 4IPCA 5FJ8G 4YCVA 4K0KQ 2OTLA 3OTOQ 3A0JA 4GNXA 1K9MC 1HNZQ 1NY4A 1UEBA 4JOIC 4OX9L 4B3RL 1QVFA 2E2HH 2IX1A 1L1OA 5M5XH 4R1JA 2R92G 4WJ4A 1JE5A 3CCLA 1FJGQ 1GO3E 1OXUA 3PO3H 4JYAQ 1O7IA 5BR8L 1PH6A 3GTGH 4BXXH 2ZJQA 4BY1H 4P74A 3GTJH 1BVSA 2CWPA 4JI8Q 4A3JH 1EQRA 2OTJA 5IP7G 2R93H 1Y1VG 4GOPC 3I4NH 4RMFA 1X55A 2VQFL 1QZGA 1PFSA 5LMNW 4EX5A 3KLWA 3UDGA 1XNQL 2PQAB 2RF4A 3ZJYC 2QGQA 1FL0A 4IPDA 1YJNA 4L5SA 2B29A 5K36G 3NELA 4DAMA 3G6EA 3GTOH 3PO2H 3RN2A 1E24A 1JMCA 3PUZA 1K73C 4JBMA 1QUQA 4DPGA 4YY3L 5LMNQ 2ATWA 2D62A 1VQNA 4BBRH 1S3OA 4LFAQ 1VQGA 3SGIA 1VQ5A 3NEMA 1X3GA 4LNQA 4X62Q 1Z9FA 3F1ZA 3T1YL 4GNXC 4RG1A 3TREA 2K50A 1PV4A 4A3CG 3J7A5 3E9IA 4LF6L 3B6YA 5M3FG 5ELNA 2DUDA 3NENA 4GN5A 1L1OC 3PSIA 4POFA 3HOXG 1Y1WH 4OX9Q 4A3DH 4B3RQ 3H0GH 2K5VA 4MNOA 5C4XG 1D8LA 1B7YB 2VY3A 3FKIG 5IE8A 4IPGA 4IOAA 3CQZH 1PVOA 4DR2L 3KJOA 1I94Q 5GAHC 3PF5A 5LMUL 4LF5Q 1X6OA 4A3BG 1EWIA 5IP9G 4DK6C 3FHWA 3S1RH 1Q7YC 2WP8J 3J81c 2E2IH 3W1BA 2I5MX 4BBSH 4JI3Q 5IYBH 2CWAA 2JA9A 5IWAQ 4HIKA 2R7ZH 5ELOA 2VQFQ 1CSPA 5IYDH 1Q12A 2K5NA 2ZTCA 4NXML 5JJIA 4LF4Q 3T1HL 1V43A 2VZAA 4GS3A 4JG2A 4DKAC 2EIFA 4X64L 4JBKA 4BXXG 4LUVA 4R4IA 4BY1G 3TRZA 2HHHQ 1E7ZA 2GVAA 2K75A 3CCUA 4A3JG 1KRTA 2OQKA 4HJ8A 3AYHB 1VQBA 4HJ9A 4JI2L 1L2FA 1N33Q 1HR0W 1SN8A 2AKWB 1XTDA 1YHAA 4TVAB 4OO1G 1FGUA 1S40A 3K81C 1GKHA 3OTOL 3H15A 1NE3A 4DNIA 4DV5Q 1PH2A 4P72A 2PI2A 2GVBA 1M90C 2R7FA 1EIFA 4QY7A 5C44G 2B63G 1MIUA 3HOVH 1FJGL 4LF6Q 1A0IA 1XPRA 2JA7H 1CUKA 2N8NA 3K0XA 4JYAL 2KBNA 3BZCA 3HOZH 3KF6B 1JB7A 2QA4A 3CCJA 4JI8L 1SR3A 3CCQA 4GKJQ 1PH7A 4X65Q 2CKZB 3IRBA 1E3PA 5LMUQ 1VS0A 3CCVA 3U58A 1QVCA 1V9PA 2C35B 3LGJA 1Y1WG 3S1NH 4A3DG 1LM0A 4L5RC 1YHQA 3OYYA 2YV5A 4L5TA 2UU9L 1YBYA 1J6QA 1PH5A 4QQBX 1TWFH 1MKHA 3TS0A 1VQIA 3T1HQ 4A3CH 1P16A 2D0PA 2N3SA 1V1QA 2WAQE 4DK3C 4X64Q 5LMNL 2IX0A 3M4PA 1VQ6A 2N49A 1YITA 3K8AA 3U50C 4LFAL 1G51A 4P71A 2NVTH 2XTIA 3GTKH 3M7NA 1JJGA 1LTLA 4Y7NH 2JK8A 4JI2Q 1ASZA 3STBD 4DAYB 1A62A 2UUCQ 5GAEC 4WJ3M 4LFCL 4Y52H 4PZ6A 4O2DA 1HZAA 2LXKA 4C3JH 5IT9c 2VQEQ 5JJLA 2NZHA 3KF8B 2F52A 4JV5Q 4HIOA 3F2BA 4DV2Q 1VQPA 4MZ9A 1QVGA 2VNUD 4X66Q 3H3VI 4XIGS 1EOVA 2XGTA 1X65A 2ID0A 1UE1A 2WAQG 1I94L 4LF8Q 3I56A 2Z6KA 1K8AC 2VUMH 1W3SA 3E9HA 4GN3B 5GADC 1HNXQ 4JI6L 4LF5L 2CQOA 1BKBA 4J15A 3BU2A 3HOUH 1RIPA 1YJ9A 4KHPL 1WYDA 2H5XA 3CP0A 2YTVA 1TWHH 4JI3L 1IYJB 3AFQA 5IWAL 3CCMA 2JJQA 2K14A 4HJAA 4DR1Q 3KOJA 4JCVE 4C3HH 4A3IG 1OTCA 3HOVG 2AMCB 3I7FA 3PUWA 4JI1Q 3S1QH 2JE6I 1HZ9A 2Q2IA 2QEXA 4LF4L 1DGSA 2AWOA 2I5LX 4JI5Q 3HOZG 3I4MH 1NTGA 2HHHL 4OWWB 2UXCQ 3UE1A 1VQJA 2KENA 4DUZL 1SMXA 1K3RA 2UU9Q 4LFBQ 1I3QH 1N33L 3M4QA 1CKMA 1UE7A 4YCUA 3G48A 4C3IH 1I50H 2BH8A 4AQYL 1XPUA 2BH2A 3S1MH 2UXBQ 1B8AA 3D31A 1X9NA 5IY0A 4DV7L 3RN5A 4DV5L 1NJIC 4JI4Q 2E8GA 2UUBQ 1Q1EA 1UE6A 4A3GG 1IBML 1K0RA 4OWXB 3RLOA 1PH8A 4OO1I 2JA6H 1IXRA 4LFCQ 1EUJA 4DV0Q 4A3MH 2FXQA 2A19A 2PQAA 3PUYA 1HR0L 2MO0A 3ICEA 3S16H 1XNRQ 1XPOA 2ZJRA 2NVYH 5C0XJ 3AQQA 3M9BA 1N9WA 1ASYA 4B3TQ 2HIVA 4DUYL 1C9OA 4HJ5A 2Z6KC 3G4SA 1JJ2A 1I6HH 4GKJL 3RR5A 4YWLA 4JI7Q 4X65L 1VQ8A 4FDBA 2Q2UA 1Q1BA 1R9TH 3RLNA 3TQYA 4JI6Q 3Q8DA 1X3EA 1K83H 3K80C 4LUZA 5C0XG 1HH2P 4KHPQ 2B3GA 4P73A 1Q86C 3I4OA 5FLXc 2Q2TA 2LSSA 1GVPA 3TEHB 1C0AA 1PA6A 3G71A 2VS1A 3F2CA 5DLQE 2VUMG 2F4VL 3PO3G 3CCRA 4AH6A 1VQEA 1SROA 4DUZQ 3HOUG 1BBWA 2AWNA 1PH3A 1WOCA 2K4KA 2D0OA 4QGUA 3S2DH 3HOWH 4BY7H 4DR3Q 5C3EH 1RL2A 3ULPA 2UUCL 3I4NG 2R93G 3U4ZA 1CKNB 1KAWA 5FLMH 2MNAA 4AQYQ 4A3KH 2VQEL 2JA5H 5C4JH 4DV7Q 4R4OA 5IYCH 2IY5B 4JV5L 4DV2L 5E7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M H;  4DR4 Q;  3M3Y H;  3UDI A;  4X66 L;  1IBM Q;  1IZ6 A;  1VQK A;  2R6G A;  2PMZ E;  3PO2 G;  2JEB I;  3PGZ A;  2YTY A;  3J7Z C;  1AE3 A;  4POG A;  1QZH A;  1KRS A;  4PMW A;  1HR0 Q;  4LF8 L;  2BA0 A;  1VQM A;  2KHI A;  2ALY B;  1HNX L;  3A74 A;  4BBR G;  2KCM A;  3CPW A;  4A3L H;  2I0Q A;  3CCS A;  4DUY Q;  2R92 H;  1H95 A;  2CFM A;  4GLA C;  4UPA A;  1Z47 A;  4B3M L;  2WB1 E;  1XMO L;  2JA6 G;  1LUZ A;  4DR1 L;  4APV A;  1YIJ A;  3PCO B;  4JI1 L;  4GOP B;  3RZO H;  1HZC A;  1OXX K;  2K52 A;  1E1O A;  4JI5 L;  3PUX A;  2UXC L;  3H0G G;  1Y1V H;  4UP9 A;  2MFI A;  2ZM6 Q;  2E5L Q;  4UY8 C;  1Q46 A;  1LYL A;  4JC0 A;  2L15 A;  5GAG C;  4LUO A;  2JA8 H;  4AYB E;  4LFB L;  1VQA A;  3KDF B;  3I2Z A;  3ULJ A;  2JEA I;  4GKK L;  2HT1 A;  2F4V Q;  3KF6 A;  3NBH B;  3PV0 A;  3CC7 A;  1TWG H;  4GLV B;  2YU9 H;  2Q2H A;  4JI4 L;  5GQO A;  3JC6 6;  2UUA L;  2IHF A;  2WB1 G;  4ALP A;  1YHB A;  2UUB L;  4BBS G;  3S2H H;  3M4O H;  5IYB G;  1G29 1;  4DV0 L;  2R7Z G;  5IYD G;  4YCW A;  4DV3 Q;  1YNX A;  4GNX B;  3W1G A;  1X56 A;  4OXP A;  3J81 j;  1BBU A;  1MJE A;  3EIV A;  1XNR L;  2RHQ B;  4JBW A;  2BA1 A;  4AIM A;  3STB C;  3A5U A;  1W2B A;  1L1O B;  2R7D A;  3HFZ B;  4LWC A;  4TQU S;  4AYB G;  1WCM H;  1EYG A;  3K7U C;  4B3T L;  4NXN Q;  4H02 A;  5M5Y H;  2NN6 G;  3AEV A;  5C3E G;  5M3F H;  1X54 A;  4BY7 G;  1PHJ A;  2VW9 A;  4JI7 L;  2MQH A;  1VQO A;  3HKS A;  5C4X H;  2UXB L;  3CMA A;  2YTX A;  2NZO A;  2OWO A;  1YI2 A;  1N34 L;  4IFD J;  1P8L A;  3FKI H;  5M5W H;  5AJ3 L;  4A75 A;  4B3M Q;  1KC8 C;  2OQ0 A;  1XMO Q;  1M1K C;  1K8G A;  1IBK L;  2JQO A;  3W5O A;  1SFO H;  1CKO A;  2PNH A;  2RHS B;  4A3B H;  4DR7 Q;  1TWC H;  4HIM A;  5IP9 H;  2UXD L;  1IBL Q;  1NMG A;  2OCE A;  4OON A;  5C0X I;  1PYS B;  1I5F A;  3PIO A;  4DV6 L;  1EFW A;  4JI0 Q;  2JA7 G;  3MXN B;  4DR6 Q;  1UE5 A;  3EN2 A;  1N36 Q;  4YHH Q;  3CC2 A;  4IFD G;  4A3L G;  3GTM H;  3J80 c;  3GO5 A;  4PZ8 A;  4IJL A;  5HGQ A;  4DR3 L;  4KI0 A;  3MEF A;  4A3F H;  4YWK A;  1QUQ B;  1U5K A;  5M3M H;  4UP7 A;  4GKK Q;  4YWM A;  4LF9 Q;  1HNW Q;  3F8T A;  2E2J H;  5H1S E;  4A3E H;  4EQ5 A;  4DV4 Q;  1WJJ A;  3M85 A;  4PG3 A;  1OXV A;  2IHE A;  2KHJ A;  2UUA Q;  4DR4 L;  2DGY A;  4QIW E;  1OXT A;  5JEA J;  4HID A;  1KQS A;  1MJC A;  4A93 H;  5J3B A;  4MTN A;  3CAM A;  4DR5 Q;  2JA8 G;  1VQD A;  1XJV A;  2RCN A;  1N32 L;  3L0O A;  1YZ6 A;  3RZD H;  1AE2 A;  1OXS C;  3S15 H;  4UP8 A;  2EQS A;  3ER0 A;  5C44 H;  2B63 H;  2LXJ A;  4X6A H;  1G6P A;  1SLJ A;  2AHO B;  1B70 B;  1TWA H;  1PYB A;  1SE8 A;  5JEA G;  1JT8 A;  2PI2 E;  1E22 A;  3CPF A;  3CW2 C;  2ZJP A;  1XMQ L;  1A8V A;  2NVQ H;  3GD7 A;  4B3S L;  4KHZ A;  4P75 A;  2K5H A;  3L7Z C;  3CME A;  1GM5 A;  3S17 H;  3UDX A;  3CCE A;  1N34 Q;  3KYH C;  1PH9 A;  5AJ3 Q;  3F2D A;  3GTL H;  1KIX A;  2KCT A;  2E5L L;  3GTQ H;  2ZM6 L;  1WCM G;  5GRO A;  1IBK Q;  1N8R C;  1D7Q A;  1Y14 B;  1S72 A;  3JAM i;  2UXD Q;  2N78 A;  1Q82 C;  4IJH A;  3BJU A;  4DV6 Q;  1X3F A;  4NB3 A;  3RLF A;  4DV1 L;  4LF7 L;  3HOY H;  1EQQ A;  2CCZ A;  2NVX H;  3UE0 A;  1C7Y A;  3ULL A;  5BR8 Q;  2YYZ A;  3D0F A;  4DV3 L;  1CSQ A;  4IPH A;  1PH4 A;  3A5Z B;  1NMF A;  1KD1 C;  1VQC A;  2EXD A;  4BA1 I;  3OW2 A;  3TS2 A;  3DLL A;  3I4M G;  4KLK A;  1VQ7 A;  3U4V A;  3PIP A;  3HKZ E;  4IOC A;  4NXN L;  5FJ8 H;  4R4T A;  4QL5 A;  1E1T A;  3K7A H;  4OWT B;  3J80 i;  4GLX A;  4A3F G;  1J5E L;  1XNQ Q;  5M3M G;  4BA2 I;  3E0E A;  3WWV A;  3L2P A;  1WI5 A;  1KHI A;  1IL2 A;  1N32 Q;  5EAY A;  4A3E G;  1VQL A;  5JJK A;  1Q8K A;  1WFQ A;  4IO9 A;  1HJP A;  2NN6 I;  1VQ4 A;  4HJ7 A;  3FP9 A;  2Y0S E;  4L5Q A;  4A93 G;  1CKN A;  3EBE A;  4YY3 Q;  1XMQ Q;  3GTP H;  4DR7 L;  4O0A A;  4A3M G;  1YJW A;  4K0K L;  4B3S Q;  1HNZ L;  1IBL L;  2ZTE A;  3UDF A;  4DR6 L;  4JI0 L;  4R4C A;  3HKZ G;  1U0L A;  1HZB A;  1VQH A;  5IP7 H;  4YHH L;  3T1Y Q;  1N36 L;  1T9H A;  4JOI A;  1NBW A;  2HIX A;  3KJP A;  3VDY A;  1VQF A;  4A3I H;  1GD7 A;  2GN5 A;  1SRU A;  3S24 A;  3PF4 A;  3ERS X;  1UWV A;  1AH9 A;  1FVI A;  3DM3 A;  3BZK A;  4LF9 L;  1HNW L;  3CXC A;  4IFD I;  4DV1 Q;  2Z0S A;  2ZTD A;  4DV4 L;  4XTC S;  4LF7 Q;  2Y0S G;  1Q81 C;  1L0W A;  3RNU A;  3KFU A;  4DR2 Q;  4QJF A;  2V1C C;  4DR5 L;  2VL6 A;  2IT1 A;  3GDE A;  4GOP A;  4GN4 B;  4R4Q A;  1YEZ A;  2ES2 A;  2A8V A;  2A1A A;  2I5H A;  3PUV A;  1VQ9 A;  4A3G H;  1YVC A;  2ASB A;  1KL9 A;  3HOY G;  3AFP A;  1KXL A;  5HY6 A;  3H3V H;  2F3I A;  4JBJ A;  3JAM c;  4NXM Q;  3KDF A;  3HOW G;  1J5E Q;  1TXY A;  3HOX H;  4A4I A;  1PH1 A;  3S14 H;  4A3K G;  5FLM G;  4ME3 A;  3I55 A;  2JA5 G;  2MO1 A;  1VCI A;  4A76 A;  1EIY B;  4NPS A;  4LW1 A;  5IYC G;  3CD6 A;  1JJC B;  2WFW A;  3CF5 A;  3CC4 A;  2HQL A;  4PZ7 A;  4X62 L;  1A63 A;  3J81 i;  4IPC A;  5FJ8 G;  4YCV A;  4K0K Q;  2OTL A;  3OTO Q;  3A0J A;  4GNX A;  1K9M C;  1HNZ Q;  1NY4 A;  1UEB A;  4JOI C;  4OX9 L;  4B3R L;  1QVF A;  2E2H H;  2IX1 A;  1L1O A;  5M5X H;  4R1J A;  2R92 G;  4WJ4 A;  1JE5 A;  3CCL A;  1FJG Q;  1GO3 E;  1OXU A;  3PO3 H;  4JYA Q;  1O7I A;  5BR8 L;  1PH6 A;  3GTG H;  4BXX H;  2ZJQ A;  4BY1 H;  4P74 A;  3GTJ H;  1BVS A;  2CWP A;  4JI8 Q;  4A3J H;  1EQR A;  2OTJ A;  5IP7 G;  2R93 H;  1Y1V G;  4GOP C;  3I4N H;  4RMF A;  1X55 A;  2VQF L;  1QZG A;  1PFS A;  5LMN W;  4EX5 A;  3KLW A;  3UDG A;  1XNQ L;  2PQA B;  2RF4 A;  3ZJY C;  2QGQ A;  1FL0 A;  4IPD A;  1YJN A;  4L5S A;  2B29 A;  5K36 G;  3NEL A;  4DAM A;  3G6E A;  3GTO H;  3PO2 H;  3RN2 A;  1E24 A;  1JMC A;  3PUZ A;  1K73 C;  4JBM A;  1QUQ A;  4DPG A;  4YY3 L;  5LMN Q;  2ATW A;  2D62 A;  1VQN A;  4BBR H;  1S3O A;  4LFA Q;  1VQG A;  3SGI A;  1VQ5 A;  3NEM A;  1X3G A;  4LNQ A;  4X62 Q;  1Z9F A;  3F1Z A;  3T1Y L;  4GNX C;  4RG1 A;  3TRE A;  2K50 A;  1PV4 A;  4A3C G;  3J7A 5;  3E9I A;  4LF6 L;  3B6Y A;  5M3F G;  5ELN A;  2DUD A;  3NEN A;  4GN5 A;  1L1O C;  3PSI A;  4POF A;  3HOX G;  1Y1W H;  4OX9 Q;  4A3D H;  4B3R Q;  3H0G H;  2K5V A;  4MNO A;  5C4X G;  1D8L A;  1B7Y B;  2VY3 A;  3FKI G;  5IE8 A;  4IPG A;  4IOA A;  3CQZ H;  1PVO A;  4DR2 L;  3KJO A;  1I94 Q;  5GAH C;  3PF5 A;  5LMU L;  4LF5 Q;  1X6O A;  4A3B G;  1EWI A;  5IP9 G;  4DK6 C;  3FHW A;  3S1R H;  1Q7Y C;  2WP8 J;  3J81 c;  2E2I H;  3W1B A;  2I5M X;  4BBS H;  4JI3 Q;  5IYB H;  2CWA A;  2JA9 A;  5IWA Q;  4HIK A;  2R7Z H;  5ELO A;  2VQF Q;  1CSP A;  5IYD H;  1Q12 A;  2K5N A;  2ZTC A;  4NXM L;  5JJI A;  4LF4 Q;  3T1H L;  1V43 A;  2VZA A;  4GS3 A;  4JG2 A;  4DKA C;  2EIF A;  4X64 L;  4JBK A;  4BXX G;  4LUV A;  4R4I A;  4BY1 G;  3TRZ A;  2HHH Q;  1E7Z A;  2GVA A;  2K75 A;  3CCU A;  4A3J G;  1KRT A;  2OQK A;  4HJ8 A;  3AYH B;  1VQB A;  4HJ9 A;  4JI2 L;  1L2F A;  1N33 Q;  1HR0 W;  1SN8 A;  2AKW B;  1XTD A;  1YHA A;  4TVA B;  4OO1 G;  1FGU A;  1S40 A;  3K81 C;  1GKH A;  3OTO L;  3H15 A;  1NE3 A;  4DNI A;  4DV5 Q;  1PH2 A;  4P72 A;  2PI2 A;  2GVB A;  1M90 C;  2R7F A;  1EIF A;  4QY7 A;  5C44 G;  2B63 G;  1MIU A;  3HOV H;  1FJG L;  4LF6 Q;  1A0I A;  1XPR A;  2JA7 H;  1CUK A;  2N8N A;  3K0X A;  4JYA L;  2KBN A;  3BZC A;  3HOZ H;  3KF6 B;  1JB7 A;  2QA4 A;  3CCJ A;  4JI8 L;  1SR3 A;  3CCQ A;  4GKJ Q;  1PH7 A;  4X65 Q;  2CKZ B;  3IRB A;  1E3P A;  5LMU Q;  1VS0 A;  3CCV A;  3U58 A;  1QVC A;  1V9P A;  2C35 B;  3LGJ A;  1Y1W G;  3S1N H;  4A3D G;  1LM0 A;  4L5R C;  1YHQ A;  3OYY A;  2YV5 A;  4L5T A;  2UU9 L;  1YBY A;  1J6Q A;  1PH5 A;  4QQB X;  1TWF H;  1MKH A;  3TS0 A;  1VQI A;  3T1H Q;  4A3C H;  1P16 A;  2D0P A;  2N3S A;  1V1Q A;  2WAQ E;  4DK3 C;  4X64 Q;  5LMN L;  2IX0 A;  3M4P A;  1VQ6 A;  2N49 A;  1YIT A;  3K8A A;  3U50 C;  4LFA L;  1G51 A;  4P71 A;  2NVT H;  2XTI A;  3GTK H;  3M7N A;  1JJG A;  1LTL A;  4Y7N H;  2JK8 A;  4JI2 Q;  1ASZ A;  3STB D;  4DAY B;  1A62 A;  2UUC Q;  5GAE C;  4WJ3 M;  4LFC L;  4Y52 H;  4PZ6 A;  4O2D A;  1HZA A;  2LXK A;  4C3J H;  5IT9 c;  2VQE Q;  5JJL A;  2NZH A;  3KF8 B;  2F52 A;  4JV5 Q;  4HIO A;  3F2B A;  4DV2 Q;  1VQP A;  4MZ9 A;  1QVG A;  2VNU D;  4X66 Q;  3H3V I;  4XIG S;  1EOV A;  2XGT A;  1X65 A;  2ID0 A;  1UE1 A;  2WAQ G;  1I94 L;  4LF8 Q;  3I56 A;  2Z6K A;  1K8A C;  2VUM H;  1W3S A;  3E9H A;  4GN3 B;  5GAD C;  1HNX Q;  4JI6 L;  4LF5 L;  2CQO A;  1BKB A;  4J15 A;  3BU2 A;  3HOU H;  1RIP A;  1YJ9 A;  4KHP L;  1WYD A;  2H5X A;  3CP0 A;  2YTV A;  1TWH H;  4JI3 L;  1IYJ B;  3AFQ A;  5IWA L;  3CCM A;  2JJQ A;  2K14 A;  4HJA A;  4DR1 Q;  3KOJ A;  4JCV E;  4C3H H;  4A3I G;  1OTC A;  3HOV G;  2AMC B;  3I7F A;  3PUW A;  4JI1 Q;  3S1Q H;  2JE6 I;  1HZ9 A;  2Q2I A;  2QEX A;  4LF4 L;  1DGS A;  2AWO A;  2I5L X;  4JI5 Q;  3HOZ G;  3I4M H;  1NTG A;  2HHH L;  4OWW B;  2UXC Q;  3UE1 A;  1VQJ A;  2KEN A;  4DUZ L;  1SMX A;  1K3R A;  2UU9 Q;  4LFB Q;  1I3Q H;  1N33 L;  3M4Q A;  1CKM A;  1UE7 A;  4YCU A;  3G48 A;  4C3I H;  1I50 H;  2BH8 A;  4AQY L;  1XPU A;  2BH2 A;  3S1M H;  2UXB Q;  1B8A A;  3D31 A;  1X9N A;  5IY0 A;  4DV7 L;  3RN5 A;  4DV5 L;  1NJI C;  4JI4 Q;  2E8G A;  2UUB Q;  1Q1E A;  1UE6 A;  4A3G G;  1IBM L;  1K0R A;  4OWX B;  3RLO A;  1PH8 A;  4OO1 I;  2JA6 H;  1IXR A;  4LFC Q;  1EUJ A;  4DV0 Q;  4A3M H;  2FXQ A;  2A19 A;  2PQA A;  3PUY A;  1HR0 L;  2MO0 A;  3ICE A;  3S16 H;  1XNR Q;  1XPO A;  2ZJR A;  2NVY H;  5C0X J;  3AQQ A;  3M9B A;  1N9W A;  1ASY A;  4B3T Q;  2HIV A;  4DUY L;  1C9O A;  4HJ5 A;  2Z6K C;  3G4S A;  1JJ2 A;  1I6H H;  4GKJ L;  3RR5 A;  4YWL A;  4JI7 Q;  4X65 L;  1VQ8 A;  4FDB A;  2Q2U A;  1Q1B A;  1R9T H;  3RLN A;  3TQY A;  4JI6 Q;  3Q8D A;  1X3E A;  1K83 H;  3K80 C;  4LUZ A;  5C0X G;  1HH2 P;  4KHP Q;  2B3G A;  4P73 A;  1Q86 C;  3I4O A;  5FLX c;  2Q2T A;  2LSS A;  1GVP A;  3TEH B;  1C0A A;  1PA6 A;  3G71 A;  2VS1 A;  3F2C A;  5DLQ E;  2VUM G;  2F4V L;  3PO3 G;  3CCR A;  4AH6 A;  1VQE A;  1SRO A;  4DUZ Q;  3HOU G;  1BBW A;  2AWN A;  1PH3 A;  1WOC A;  2K4K A;  2D0O A;  4QGU A;  3S2D H;  3HOW H;  4BY7 H;  4DR3 Q;  5C3E H;  1RL2 A;  3ULP A;  2UUC L;  3I4N G;  2R93 G;  3U4Z A;  1CKN B;  1KAW A;  5FLM H;  2MNA A;  4AQY Q;  4A3K H;  2VQE L;  2JA5 H;  5C4J H;  4DV7 Q;  4R4O A;  5IYC H;  2IY5 B;  4JV5 L;  4DV2 L;  5E7N A; 
#chains in the Genus database with same CATH topology
 4CKC A;  3M3Y H;  3UDI A;  1IZ6 A;  2HDL A;  3NE5 B;  2WII B;  2QEJ C;  4I7A A;  3FDT A;  1AE3 A;  4C3H B;  1HR0 Q;  2HCC A;  1AN8 A;  1VQM A;  3J81 E;  3A74 A;  1IHZ A;  3CPW A;  4DUY Q;  1H95 A;  4UPA A;  3CHB D;  4B3M L;  4K6L A;  3PO2 B;  2EZV A;  4L8J A;  4FP5 D;  3PCO B;  3QIA A;  4JI1 L;  1HFG A;  3RZO H;  1HZC A;  1BF4 A;  4JI5 L;  3PUX A;  3J7Y W;  3EFX D;  1B4O A;  2MFI A;  1EU3 A;  4LFB L;  1Q46 A;  1LYL A;  4LUO A;  2EDG A;  3CRK C;  3U9O A;  4KKT A;  3ULJ A;  5C4Z A;  1JOR A;  1GHJ A;  4OHJ A;  1VF5 C;  3H3V C;  2BE5 D;  2Q2H A;  4JI4 L;  4K5W A;  2WB1 G;  2UUB L;  4ALP A;  1YHB A;  2XWJ B;  4Q0F A;  2HCI A;  1G29 1;  1AW7 A;  2F1M A;  4RGN A;  5CMD A;  4IAL A;  4YCW A;  1YNX A;  3W1G A;  1X56 A;  3J81 j;  1K83 B;  3EIV A;  4JBW A;  3X3N A;  4AIM A;  3S1R B;  3DM1 A;  2R7D A;  4TQU S;  1WCM H;  1IL8 A;  4H02 A;  5M5Y H;  2NN6 G;  4ILW A;  2MUY A;  3QB3 A;  1MSG A;  1PZK D;  1PHJ A;  4JI7 L;  1VQO A;  5C4X H;  1KAB A;  3BYY B;  5AJ3 L;  3E5S A;  1M1K C;  4OEM B;  3F2U A;  4DR7 Q;  1CKO A;  2PNH A;  4KKU A;  5C0X I;  1AZQ A;  3PIO A;  4JI0 Q;  1H9K A;  1UE5 A;  1BDO A;  3EN2 A;  1N36 Q;  1R4Q B;  5IT9 E;  4IJL A;  4XQQ A;  4YWK A;  3TME A;  1HNW Q;  4A3E H;  1SNP A;  5IGB A;  1S5B D;  4HR7 B;  1BCP C;  2KHJ A;  4DR4 L;  3TZD A;  1OXT A;  1MJC A;  5J3B A;  2B2U C;  1MI2 A;  4DR5 Q;  1VQD A;  2K6A A;  1J8I A;  1D2B A;  1EZ8 A;  3RZO B;  1AE2 A;  1PZJ D;  3S15 H;  2EQS A;  4IUQ A;  2B63 H;  4X6A H;  1G6P A;  1B70 B;  1PYB A;  2PI2 E;  3C2P A;  3CW2 C;  2H1E A;  2F0U A;  1XMQ L;  1A8V A;  2NVQ H;  3GD7 A;  4B3S L;  4P75 A;  3D4R A;  3CME A;  2HQE A;  3OIP A;  1PH9 A;  1KIX A;  2KCT A;  1ET6 A;  1XWE A;  4FXD A;  4KN4 C;  4IUV A;  1Y14 B;  4WRD A;  2N78 A;  1Q82 C;  1X3F A;  4NB3 A;  2N55 A;  1EQQ A;  1V1O A;  1WCM B;  5KIX A;  3UE0 A;  5M5Y B;  1C7Y A;  2YYZ A;  3NPP A;  1W6J A;  5D65 A;  2FMM A;  3A5Z B;  1VQC A;  2EXD A;  4BA1 I;  3OW2 A;  3DLL A;  1RKN A;  2K28 A;  4WOR A;  1FR3 A;  5M3M G;  3E0E A;  3WWV A;  3L2P A;  3GP7 A;  1HJP A;  4ME5 A;  4V0B A;  5FLX E;  1VQ4 A;  4HJ7 A;  1KTK A;  5CV7 A;  1NSN S;  4O0A A;  2ZTE A;  4A3E B;  4RH6 A;  4KJN A;  4DR6 L;  4CJ0 B;  3HKZ G;  5CV6 A;  1F77 A;  4YHH L;  1T9H A;  3VDY A;  1GD7 A;  2C9O A;  1SRU A;  3S24 A;  5A2Q E;  3PF4 A;  3DM3 A;  3QO2 A;  2NZ1 D;  4DV1 Q;  2EYL A;  2Z0S A;  3M7G A;  1ZYR D;  5E1F A;  4EQO A;  2Y0S G;  2B63 B;  1WD1 A;  1MSH A;  2VL6 A;  1EWH A;  4R4Q A;  2A1A A;  2BE5 C;  2I5H A;  4OL7 A;  1EYC A;  1TU2 B;  4DXF A;  1LTS D;  3AB9 A;  2QCP X;  2F3I A;  4NXM Q;  1IYU A;  4JPB W;  1J5E Q;  3S14 H;  2OXP A;  4ME3 A;  4A76 A;  1JE4 A;  4NPS A;  4LW1 A;  1EIY B;  1SE4 A;  2HUG A;  4JK1 C;  4XYO A;  5KYI A;  3CF5 A;  3C1E A;  3BDC A;  4PZ7 A;  4FF4 A;  2PZT A;  5ELE A;  1A63 A;  1KDB A;  4IPC A;  4K6D A;  1K9M C;  2K03 A;  4JOI C;  4OX9 L;  4WJW A;  3K6O A;  2QKI C;  5M5X H;  4R1J A;  4R8N A;  4CJ2 C;  1LT6 D;  3H09 A;  1OXU A;  1O7I A;  3MTS A;  5BR8 L;  3GTG H;  4BXX H;  5A35 A;  2EJF C;  3DWP A;  1BVS A;  5IOC A;  4OIJ A;  3BYT B;  5IP7 G;  4CHT B;  2R93 H;  5FLX L;  1GXD C;  1X55 A;  1QZG A;  1PFS A;  2AUK A;  1SNO A;  3UDG A;  1XNQ L;  3BDL A;  3V96 A;  4ZAI A;  3ZJY C;  1EZ6 A;  1TS5 A;  1I4X A;  3L9A X;  4L5S A;  3NEL A;  5IGE A;  2MGS A;  1E24 A;  1K73 C;  1SEB D;  1EY5 A;  4YY3 L;  1ET9 A;  4C1N K;  1S3O A;  1Z6H A;  3FVQ A;  4CKE A;  3GV6 A;  3M4O B;  4DN4 M;  2AQ2 B;  1LT4 D;  3VR2 A;  5ELN A;  2DUD A;  3HOX G;  4B3R Q;  1EOT A;  1D8L A;  1F9Q A;  5C4X G;  1F9P A;  1QWY A;  1PDQ A;  5IE8 A;  4IPG A;  2L55 A;  3CQZ H;  1PVO A;  5C5L A;  2CW0 D;  4U68 A;  1WTP A;  1X6O A;  4UHV A;  3S14 B;  4I65 A;  2E2I H;  2I5M X;  3FKI B;  5IYB H;  2R7Z H;  2VQF Q;  5IYD H;  5JJI A;  3T1H L;  4GS3 A;  1CA6 A;  2HHH Q;  4B08 A;  3CCU A;  4HJ9 A;  4IUU A;  1T5X D;  2JN4 A;  3VR3 A;  5CBA E;  2AKW B;  1XTD A;  1SXT A;  3GTG B;  2LKV A;  3A55 A;  2DNE A;  1NE3 A;  4DNI A;  2E2J B;  2RBM A;  2NTS A;  1M90 C;  2B63 G;  1KLG D;  1MIU A;  5I9O A;  3V2T A;  2MP1 A;  4LF6 Q;  1CHQ D;  2EJG C;  1JWU D;  5KRU A;  2PPB C;  3KF6 B;  1JB7 A;  4JI8 L;  1HUM A;  1DM0 B;  5C44 B;  2NWG A;  3H91 A;  1D6E C;  5KEE A;  4ZK9 B;  1E3P A;  1PTO H;  1VS0 A;  3K5O A;  3CCV A;  3PIP 3;  3U58 A;  2SNM A;  4A3D G;  1ZYR C;  3OYY A;  4L5T A;  3MA2 B;  4CGY B;  4NP5 A;  3GTQ B;  2K5Q A;  2FFK B;  1ESR A;  2F0F A;  1VQI A;  4EQN A;  1X3P A;  3K5N A;  2EY2 A;  2N49 A;  1YIT A;  4MHE A;  4LFA L;  2NVT H;  1JJG A;  3VYS A;  2JK8 A;  5FKA C;  4JI2 Q;  3STB D;  4WJ3 M;  3CU7 A;  1H9R A;  4LFC L;  2LXK A;  1AZP A;  3KLR A;  1LT5 D;  1DCZ A;  4DV2 Q;  3K5M A;  2E2I B;  3IFD A;  4XYQ A;  4FYD A;  2F0K A;  2Z6K A;  1G91 A;  1EY8 A;  1W3S A;  4LF5 L;  4JI6 L;  3ITP A;  4J15 A;  5C5M A;  5BN3 A;  2KHS A;  5DNF A;  1WYD A;  1SSO A;  4JI3 L;  4UDU C;  1ENA A;  2B2Y A;  4JCV E;  4R8I A;  1VDZ A;  3I7F A;  3PUW A;  1TS3 A;  3GTP B;  3S1Q H;  2F0V A;  1IYV A;  3NHH A;  2AWO A;  1QOH A;  4YIJ A;  4KMU C;  4ZUI A;  4LJZ C;  5COY A;  3UE1 A;  3KK7 A;  5E3F A;  1D1K A;  2BOS A;  1XPU A;  1X9N A;  5IY0 A;  4MIU A;  3TP6 A;  2E8G A;  1S5E D;  1UE6 A;  5EPL A;  3MFG A;  4A3M H;  2EYM A;  1YNJ D;  2A19 A;  1PTO B;  1HR0 L;  2MO0 A;  2G9H D;  2ZJR A;  4LMQ D;  3AQQ A;  1A15 A;  3M9B A;  4DUY L;  1I6H H;  3P75 A;  1G6Z A;  1H9S B;  1QB5 D;  2EXZ A;  4YWL A;  4X65 L;  2RSO A;  1Q1B A;  1R9T H;  1A2T A;  3Q8D A;  5DAU A;  4LUZ A;  2NVT B;  4KHP Q;  1PRT B;  2B3G A;  4MTK A;  4P73 A;  2CW0 C;  1PZI D;  2VXW A;  4HCS A;  2KA7 A;  4XQN A;  4H44 C;  3G71 A;  3F2C A;  1QIL A;  2EYJ A;  5DLQ E;  1PA6 A;  2VUM G;  2KOL A;  3N6R A;  1SRO A;  1BBW A;  3CRL C;  3HOW H;  2NN6 H;  4DR3 Q;  5C6A A;  2R93 G;  3U4Z A;  1KAW A;  1BOS A;  1MGS A;  2MNA A;  4FF3 A;  2VQE L;  5CV8 A;  4DV7 Q;  2FJ2 A;  1EEI D;  4JV5 L;  4ABN A;  2M9V A;  1IBM Q;  2R6G A;  3I4N B;  3BS1 A;  2X6L A;  4POG A;  4PMW A;  5M9O A;  4RCO A;  2BA0 A;  2ALY B;  1TKW B;  2QF7 A;  4KTA A;  1BBX C;  3M4Y A;  2KCM A;  5F2D A;  2I0Q A;  2AQ3 B;  2CFM A;  4H7B A;  1D5Z C;  2WB1 E;  2JA6 G;  4DR1 L;  1SAP A;  4NMZ A;  1WTQ A;  1PXU A;  2KQ3 A;  1Y1V H;  2MPM A;  4UP9 A;  4UY8 C;  5GAG C;  2RVL A;  1V1P B;  5I2X A;  3I2Z A;  4ZYS A;  2JEA I;  2HT1 A;  2M2L A;  1PRT D;  4J6H A;  1TWG H;  4ZKC B;  4WFN 3;  5IYB G;  4QCL A;  3NQI A;  2R7Z G;  3QOL A;  1SE2 A;  5IYD G;  1MHW C;  5K5P A;  2WB1 B;  3STB C;  1V8Q A;  1L1O B;  4A3C H;  4KD4 A;  5C3E G;  2Q8I B;  4OGQ C;  3HKS A;  1O78 A;  3CMA A;  2YTX A;  2DNC A;  2NZO A;  3ERO A;  5M5W H;  4S3S A;  2A73 B;  1KC8 C;  2OQ0 A;  1XMO Q;  1K8G A;  3W5O A;  4A3B H;  2SEB D;  5IP9 H;  3KF8 A;  1IBL Q;  1NMG A;  4OON A;  1I5F A;  3MXN B;  3CC2 A;  2FIN B;  4A3L G;  4ZKB B;  5FOB B;  2KJX A;  4PZ8 A;  1Q8I A;  1QUQ B;  1DXM A;  5M3M H;  4UP7 A;  3K5L A;  4YWM A;  3NUC A;  3F8T A;  3G6J B;  4DV4 Q;  4PG3 A;  1OXV A;  2HD3 A;  2DGY A;  4HID A;  1KQS A;  2JA8 G;  2RCN A;  3L0O A;  3S1N B;  2XRS D;  1OXS C;  1EU4 A;  3RUZ A;  3ER0 A;  1JT8 A;  3SK5 A;  5JEA G;  1I4G A;  1L0Y B;  3UDX A;  1S5F D;  3CCE A;  1N34 Q;  3QOJ A;  2JXM B;  3F2D A;  3GTK B;  3LWE A;  3GTL H;  1JWS D;  1EY0 A;  2E5L L;  2ZM6 L;  1IBK Q;  1D7Q A;  3S9W A;  2UXD Q;  3JAM i;  1BNZ A;  4IJH A;  4QMG A;  4DV6 Q;  4DV1 L;  1EY7 A;  1HXY D;  3NSW A;  2NVX H;  1LTI D;  3QWN A;  3ULL A;  1RDP D;  5I6Y A;  4DV3 L;  1CSQ A;  4IPH A;  4KHV A;  1NMF A;  1QCB D;  2RDG A;  3MZ5 A;  5M5W B;  1VQ7 A;  2ENB A;  2A6H C;  3W2D A;  3HKZ E;  3PIP A;  4NXN L;  1O7L A;  4QL5 A;  1E1T A;  4X3K A;  4GLX A;  4A3F G;  2ZXO A;  1J5E L;  1GUO A;  3OSO A;  1N32 Q;  1WI5 A;  2PZU A;  4CBV A;  1VQL A;  1WFQ A;  5E4W C;  2NN6 I;  2Y0S E;  4A93 G;  4RHS A;  5D3D A;  5M3M B;  4A3M G;  3PMF A;  3UDF A;  4ZRZ A;  2XN9 C;  2F3W A;  4FVM A;  1HZB A;  3BDO A;  5IP7 H;  4J1M A;  2ICI A;  1M4V A;  1NBW A;  1PTO C;  4A3I H;  5HUR A;  2L9H A;  1D1I A;  3ERS X;  1FVI A;  4N8X 1;  4LF9 L;  4XT3 B;  4HSP A;  3HKZ B;  1G8Z D;  5KYL A;  4K5V A;  3NP8 A;  1L0W A;  4K2K A;  4DR2 Q;  4QJF A;  4IUP A;  2V1C C;  1JOQ A;  4GOP A;  1PRT C;  3SDZ A;  2A8V A;  1RTO A;  3PUV A;  3MVV A;  5LL6 S;  3D6W A;  1YVC A;  2Y0S B;  1E0B A;  1KL9 A;  1U4P A;  3AFP A;  4A3G H;  4XT1 B;  2PQE A;  1F2L A;  3DXJ C;  4QB4 A;  4JBJ A;  3HOW G;  3KDF A;  2OF1 A;  1TXY A;  3HOX H;  4HMI A;  3NBH A;  4IZ8 A;  3CD6 A;  3TSS A;  2WFW A;  2EY6 A;  2D2C C;  3NTK A;  1SYE A;  1SYC A;  3J81 i;  2B2W C;  4DU9 A;  2NVX B;  1X3Q A;  1LTG D;  4GNX A;  4B3R L;  2J0T D;  5C4J B;  2E2H H;  1XYI A;  2IX1 A;  3DEP A;  3M3Y B;  1K0S A;  1JE5 A;  3UI2 A;  4EVO A;  3PO3 H;  1QNU A;  1AP0 A;  4P74 A;  4KY5 A;  2R3Z A;  1EQR A;  2OTJ A;  1FNV A;  5J22 A;  1TQO A;  1Y1V G;  2F0G A;  3A8J E;  3N52 A;  4RMF A;  2VQF L;  1FNU A;  2A5H A;  2RF4 A;  3LNN A;  4IPD A;  5K36 G;  2HDM A;  2AQ1 B;  2Q8T A;  3GTO H;  2JP1 A;  5JOB A;  1JMC A;  4A3I B;  4FXK C;  3DEO A;  4DPG A;  5EBC A;  2Z4I A;  1HCZ A;  1VQ5 A;  4KK7 A;  2CH4 W;  1CT1 D;  4X62 Q;  3T1Y L;  3F1Z A;  4OIK A;  4RG1 A;  2LY7 A;  2RA4 A;  1RD9 D;  1PV4 A;  4A3C G;  4QUC A;  1ENC A;  4LF6 L;  3B6Y A;  3VYT A;  3NEN A;  4A3D H;  1L1O C;  4DNT B;  1K8O A;  3H0G H;  3D4W A;  2OT2 A;  3KJO A;  1I94 Q;  2E2D C;  3HOX B;  4A3B G;  5IP9 G;  2PW7 A;  5C4X B;  1Q7Y C;  2WP8 J;  4BBS H;  4K8I A;  2C5C A;  2JA9 A;  2WKC A;  1EY6 A;  5ELO A;  1CSP A;  1DOM A;  1F2Y A;  3NBI A;  1V43 A;  2PW5 A;  2VZA A;  2QW7 A;  2EIF A;  4R4I A;  1FGB D;  1E7Z A;  2E2H B;  3A7A B;  5IGD A;  3IKJ A;  1N33 Q;  1BUV T;  2OQK A;  4JI2 L;  1YNN C;  2DY7 A;  2KUM A;  1JIC A;  1FGU A;  1S40 A;  3K81 C;  3PO3 B;  3OTO L;  3H15 A;  2EVB A;  5C3X A;  3OWF A;  2B8F A;  5T1I A;  1PH2 A;  1SJE D;  2O2L D;  1EY9 A;  2GVB A;  1B1Z A;  4IN3 A;  4QY7 A;  2O5I C;  2RKS A;  1B3Q A;  4HN7 A;  4RWS C;  1FJG L;  5C4H A;  2JA7 H;  1CUK A;  4JYA L;  5L37 A;  2K1B A;  1TR5 A;  1RHP A;  4GZY C;  2XVS A;  2B2T C;  3S15 B;  2M00 A;  3CCQ A;  1LTA D;  4GKJ Q;  3MAQ A;  5LMU Q;  1SBB B;  2XWB B;  1QVC A;  2NVQ B;  3LGJ A;  1Y1W G;  2KEC A;  5DEH A;  1YHQ A;  2YV5 A;  4M1U B;  3FRP B;  1PH5 A;  1C48 A;  1TWF H;  1MKH A;  1I4H A;  1P16 A;  2D0P A;  4DK3 C;  1V1Q A;  2R61 A;  5ELB A;  4X64 Q;  5LMN L;  4A3D B;  3M4P A;  2WIN B;  3K8A A;  3U50 C;  4P71 A;  3MWY W;  2XTI A;  4NDX A;  4TKO B;  2UUC Q;  4Y52 H;  2I07 B;  4O2D A;  1HZA A;  5JJL A;  1CZW A;  4CDD C;  2F52 A;  1KDA A;  1SJH D;  3F2B A;  1VQP A;  4DA2 A;  3FEW X;  1UE1 A;  3HEJ A;  2D9U A;  1HA5 A;  2VUM H;  1XX8 A;  4GN3 B;  4F88 A;  2DN8 A;  3SHL A;  1SNM A;  1ILP A;  4KHP L;  3A54 A;  2YTV A;  1CK1 A;  3R2T A;  5IWA L;  4DF7 A;  2K14 A;  4A3I G;  1R4P B;  1TY0 A;  4JI1 Q;  2L4N A;  2JE6 I;  1HZ9 A;  1BQQ T;  4LF4 L;  1DGS A;  4JI5 Q;  3I4M H;  1VF7 A;  1NTG A;  4OWW B;  3T51 B;  1VQJ A;  2KEN A;  1SMX A;  3SK4 A;  1K3R A;  1HPC A;  5IOD A;  1I3Q H;  2UU9 Q;  4LFB Q;  3M4Q A;  1CKM A;  5ELF A;  1UE7 A;  3VA5 A;  2IWH A;  1LTR D;  2K05 A;  2UXB Q;  4TRD A;  1B8A A;  4X3U A;  4DV7 L;  4DV5 L;  4JI4 Q;  2UUB Q;  1Q1E A;  4A3G G;  1IBM L;  3RLO A;  2NTT A;  1AEX A;  2JA6 H;  2RDH A;  3A56 A;  3P1H A;  1HA6 A;  2PQA A;  3ICE A;  1T5E A;  3S16 H;  1PFN A;  4R9W A;  3TP5 A;  2HIV A;  4HJ5 A;  3K58 A;  1JJ2 A;  3RR5 A;  4PV1 C;  4JI7 Q;  1TWF B;  1VQ8 A;  4DXG A;  3TQY A;  3AMU A;  1STN A;  5EGT A;  1X3E A;  4ODG A;  2XSC A;  3I4O A;  1Q86 C;  2K5W A;  2Q2T A;  2LSS A;  3VR5 A;  1ZKO A;  2VS1 A;  3PO3 G;  3CCR A;  2A69 C;  4RGM A;  3HOU G;  4DUZ Q;  2WAC A;  2F0M A;  2K4K A;  4P2C B;  2NB0 A;  1VMC A;  5C3E H;  1RL2 A;  5M5X B;  4ULL A;  5JJZ A;  1EYA A;  5FLM H;  3E3X A;  2LS0 1;  2JA5 H;  2VUM B;  3IFT A;  5IYC H;  4C2M H;  4DR4 Q;  3GV3 A;  4DAP A;  2LMC B;  4X66 L;  1A6X A;  2R93 B;  2PMZ E;  5FO7 B;  2JEB I;  3J7Z C;  2V4D A;  3C1F A;  1KRS A;  4C3I G;  4LF8 L;  4IUT A;  1HNX L;  1EEF D;  4PMB A;  1SYB A;  2B2V C;  4A3L H;  3EVQ A;  3OMG A;  2PYK A;  4GLA C;  1I3Q B;  4HTH A;  1KNA A;  1XMO L;  1BCP F;  4APV A;  1PFM A;  1QE6 A;  1SDF A;  3MFY A;  3I72 A;  4NW2 A;  2K52 A;  4DFA A;  3H0G G;  2UXC L;  4K2L A;  2L15 A;  2JA8 H;  5EKI A;  3WOE A;  2JA6 B;  2A6E D;  1F2Z A;  2L0C A;  1VQA A;  3A7L A;  2F4V Q;  1SNQ A;  2DJG C;  3TBI B;  3D6C A;  3PV0 A;  3CC7 A;  2KEE A;  3S16 B;  2YU9 H;  1NNX A;  1JB3 A;  2PMZ B;  3JC6 6;  4HAE A;  1EL0 A;  5JEA H;  4BBS G;  3S2H H;  2P5Z X;  3SXH A;  3CQZ B;  2NUC A;  3SR1 A;  4DV0 L;  1O7Y A;  5DM7 3;  2B2U A;  1XNR L;  2RHQ B;  3IL8 A;  2BA1 A;  4AYB G;  1EYG A;  3HFZ B;  4B3T L;  2RDF A;  2F4I A;  1ICF B;  2F0W A;  3K7U C;  1WTV A;  4BY7 G;  5M3F H;  1X54 A;  2R7Z B;  1I6V C;  4DK1 A;  2MQH A;  3DMU A;  1Y8N B;  2OWO A;  3ND8 A;  1N34 L;  1P8L A;  5C3E B;  1IBK L;  1SFO H;  3DWQ A;  1TWC H;  4HIM A;  2EYO A;  2L5T A;  2UXD L;  2JA5 B;  2OCE A;  3MHB A;  2JA7 G;  1PYS B;  1CQV A;  1Y8P B;  2J4X A;  4DV6 L;  4ZCK A;  4DR6 Q;  1GJX A;  4IFD G;  1SE3 A;  4YHH Q;  2IX3 A;  3NWT A;  5HGQ A;  4KI0 A;  4A3F H;  4RA8 A;  5CBE E;  4GKK Q;  5D14 A;  5H1S E;  4EQ5 A;  1WJJ A;  1IW7 D;  3M85 A;  5G3L D;  2UUA Q;  1FD7 D;  4B9W A;  5JEA J;  4UAI A;  4A93 H;  4MTN A;  1B9M A;  1N32 L;  1EYD A;  3RZD H;  2DJF C;  3HRZ C;  1SMY D;  2IL8 A;  4UP8 A;  1TWA H;  1SE8 A;  1WTX A;  1C4Q A;  1E22 A;  2JA8 B;  3T56 B;  2ZJP A;  3MXP A;  4KHZ A;  1CI3 M;  1MBY A;  2K5H A;  1GM5 A;  1PFB A;  3S2H B;  1N8R C;  3HP3 A;  2BDO A;  3OIQ A;  1S72 A;  3BJU A;  2CCZ A;  2A6H D;  2L12 A;  5BR8 Q;  4X3S A;  3LWU A;  3A8K E;  1PH4 A;  4M8A A;  1OO9 B;  1KD1 C;  3C3L A;  1LTB D;  3I4M G;  4KLK A;  3EQL C;  4R4T A;  1EIG A;  3K7A H;  3J80 i;  1SFO B;  4L63 B;  1XNQ Q;  3HS0 C;  4BA2 I;  3S1Q B;  5JJK A;  1Q8K A;  5CYU A;  4IO9 A;  2A74 C;  5JVG 3;  1HTP A;  3FP9 A;  1D5M C;  1PTO D;  4A3F B;  1CKN A;  4YY3 Q;  4DR7 L;  4ZQ3 A;  2X69 A;  1Q90 A;  4JI0 L;  4R4C A;  1U0L A;  1VQH A;  4G7H C;  1N36 L;  4JOI A;  2HIX A;  1VQF A;  4A93 B;  1FNW A;  4A3M B;  1UWV A;  1AH9 A;  3BZK A;  4PNY A;  3RZD B;  3TZU A;  1HNW L;  2ZTD A;  4LF7 Q;  4XTC S;  5K36 H;  3VA7 A;  1Q81 C;  1GUT A;  1RF2 D;  2A6E C;  2KVM A;  3L3O C;  1I6H B;  1F2M A;  4DR5 L;  2IT1 A;  5JPM C;  1YEZ A;  4I7Z C;  1R9T B;  4DNR B;  4CJ1 B;  1VQ9 A;  3J7A F;  1KAA A;  3J80 L;  3HOY G;  1TS2 A;  3T53 B;  3P20 A;  5HY6 A;  1A2U A;  1QJO A;  3KLS X;  3GQB A;  4FF1 A;  1PH1 A;  5CGK A;  5FLM G;  3I55 A;  2JA5 G;  2MO1 A;  3DUZ A;  4C56 C;  5IYC G;  1JJC B;  3CC4 A;  4ID6 A;  4X62 L;  4DAY A;  4K14 A;  3HOW B;  5FJ8 G;  4K0K Q;  1LAB A;  2F3V A;  3A0J A;  5C3W A;  1HNZ Q;  1NY4 A;  2XIW A;  2H4O A;  1QVF A;  5ISR A;  2KCC A;  1U4R A;  4KKS A;  4DGZ A;  3GTJ H;  1A3U A;  4JI8 Q;  4G7Z C;  5KNB A;  3P7J A;  4RGT A;  1IW7 C;  3SK6 A;  3D3R A;  1UAP A;  2B29 A;  3FMC A;  3G6E A;  1Y1V B;  5LL6 X;  3PO2 H;  3PUZ A;  1SNC A;  4JBM A;  2XNA C;  1CFM A;  5D3I B;  3Q24 A;  1ML0 D;  2ATW A;  4G4K A;  1SMY C;  1VQN A;  4BBR H;  4LFA Q;  3ONA B;  4RCN A;  1TWG B;  3KUP A;  5JPN C;  4KJO A;  3NQT A;  2ZXR A;  2OEO A;  5M3F G;  1Y1W H;  4GN5 A;  1TII D;  2F0T A;  4MNO A;  1HFN A;  4RKB A;  3HZX A;  5KND A;  1DZ1 A;  4IOA A;  2CHB D;  2SNS A;  1WTO A;  4BS9 A;  5GAH C;  5LMU L;  4LF5 Q;  1EWI A;  2Z1C A;  2AUJ D;  3S1R H;  5KNC A;  1A3V A;  4LAA A;  4JI3 Q;  1FYC A;  2CWA A;  4HIK A;  4RAU C;  1Q12 A;  1YNN D;  4NXM L;  4A3B B;  4CDC C;  4DKA C;  4X64 L;  4LUV A;  4BY1 G;  3TRZ A;  2GVA A;  2LFN A;  2ZT9 C;  4A3J G;  1KRT A;  2EYP A;  5COR A;  4HJ8 A;  1HR0 W;  3O13 A;  1SN8 A;  4OO1 G;  4TVA B;  1WTR A;  1GKH A;  3GTJ B;  1Y69 U;  2PI2 A;  2DY8 A;  1NR4 A;  1ESF A;  3JAM L;  4XXE A;  5DM6 3;  1CQF A;  3BZC A;  2IPK D;  2QA4 A;  3CCJ A;  1SR3 A;  5EJW A;  1M8A A;  1SYD A;  3I70 A;  1PH7 A;  4X65 Q;  1VMP A;  1JOK A;  4F8M A;  4H13 C;  1LM0 A;  4BBR B;  4L5R C;  2UU9 L;  1YBY A;  3GTL B;  5EKL A;  1J6Q A;  1QNK A;  5FO8 B;  1CZG A;  2N3S A;  2UXB L;  1Y1W B;  2BCO A;  2IX0 A;  1Q3L A;  1GOZ A;  1NR2 A;  4HCE A;  4QF4 A;  1G51 A;  1ASZ A;  4DAY B;  2F0I A;  5GAE C;  3H6M A;  2VQE Q;  2NZH A;  2K32 A;  3KF8 B;  3RD4 A;  3FPU B;  4JV5 Q;  1UNS A;  4HIO A;  1QVG A;  2VNU D;  2F0E A;  5BN5 A;  2XGT A;  1DON A;  1X65 A;  3C46 A;  1BXT A;  2WAQ G;  3I56 A;  3TN2 A;  2D5D A;  2CQO A;  1F9S A;  3BU2 A;  3HOU H;  1RIP A;  2H5X A;  3CP0 A;  1TWH H;  1IYJ B;  3CCM A;  4HJA A;  2JJQ A;  4DR1 Q;  3TP7 A;  3MEH A;  3HOV G;  2AMC B;  2KCN A;  2QEX A;  1U4L A;  3QJY A;  5NUC A;  5IGF A;  2HHH L;  3HOZ G;  1H9M A;  4DUZ L;  4E6I A;  2Z6B A;  5AFW A;  4YCU A;  4C3I H;  5I9P A;  1I50 H;  3E0J A;  3S1M H;  3D31 A;  3J81 L;  1WVL A;  3E6Z X;  1TS4 A;  1JOO A;  1K0R A;  4OWX B;  1PH8 A;  1EUJ A;  1DOK A;  5ELC A;  3A8I E;  4L6T B;  2FHT A;  1A3T A;  5JAV A;  1G2S A;  2JSO A;  1XPO A;  2FMC A;  4OEL B;  2NVY H;  2EPB A;  5IGG A;  3K57 A;  1ASY A;  4A3G B;  2CQA A;  2A68 C;  2Z6K C;  2NYZ D;  2Z8L A;  3EA6 A;  2RCF A;  1E2V A;  2Q2U A;  4FDB A;  4RKL A;  4C3J G;  3RLN A;  1L0X B;  1U4M A;  5BN4 A;  1RJT A;  2I46 A;  3K80 C;  5C0X G;  1JR0 D;  2B2Y C;  2A69 D;  2TMP A;  3TEH B;  5J39 A;  2F4V L;  2QIL A;  4AH6 A;  1VQE A;  3I3C A;  1KNE A;  1PH3 A;  1WOC A;  2D0O A;  5I6W A;  3Q22 A;  3S2D H;  4BY7 H;  1DD2 A;  1CA5 A;  4C3H G;  4A3K H;  4AQY Q;  1LLR D;  4R4O A;  1NAP A;  4JW0 A;  3FPP A;  1GHK A;  3HOU B;  4DV2 L;  5E7N A;  1RTN A;  4N8F A;  2G9D A;  1VQK A;  1TWH B;  2PCF B;  1O80 A;  3VYR A;  3PO2 G;  2E76 C;  3PGZ A;  2YTY A;  5EBD A;  1QZH A;  2EE1 A;  4BWG B;  1D5X C;  2KHI A;  2MJ8 A;  3I8Z A;  4DAV A;  4IFD H;  4BBR G;  2R92 H;  3WOF A;  3CCS A;  3GTO B;  1Z47 A;  5IT9 L;  1LUZ A;  3HG9 A;  1YIJ A;  4C3I B;  1I50 B;  4GOP B;  3S1M B;  2F0N A;  3K0Y A;  1RCV D;  1OXX K;  1STA A;  1EWC A;  1E1O A;  4N9T A;  5G3L F;  2E5L Q;  2ZM6 Q;  1JCK B;  4JC0 A;  4AYB E;  2F0D A;  3KDF B;  3MC0 B;  4GKK L;  3T13 A;  4B9X A;  2TSS A;  3KF6 A;  3NBH B;  2QDB A;  4GLV B;  1G2T A;  3H0G B;  2NVY B;  1B50 A;  5GQO A;  2UUA L;  2IHF A;  2IW3 A;  2PO4 A;  2EJM A;  3M4O H;  3LX0 A;  1KLU D;  1STH A;  3I90 A;  5CV4 A;  4DV3 Q;  3NTH A;  4GNX B;  1GUG A;  4OXP A;  1BBU A;  1MJE A;  1W2B A;  3A5U A;  3VR6 A;  1ONL A;  3BVG A;  3OWE B;  4LWC A;  4BBS B;  4NXN Q;  2O5J C;  3D8G A;  3AEV A;  1B9N A;  1WTH A;  3IAY A;  2E75 C;  2VW9 A;  3I4L A;  1S4Z A;  2E74 C;  2F03 A;  4EGV A;  1YI2 A;  4IFD J;  3FKI H;  4AYB B;  3BVM A;  4A75 A;  3S2D B;  4B3M Q;  4BY7 B;  2JQO A;  1EQV A;  2RHS B;  4A3K B;  1EIH A;  1EFW A;  1CM9 A;  1LT3 D;  3GTM H;  3J80 c;  2F0S A;  3GO5 A;  2SOB A;  1STG A;  4DR3 L;  3MEF A;  1U5K A;  4FNF A;  1HHV A;  4LF9 Q;  1E2W A;  2L1B A;  2E2J H;  1STE A;  2JA7 B;  1I4P A;  1F9R A;  2IHE A;  2R92 B;  4QIW E;  3CAM A;  1GUS A;  1PTO F;  1XJV A;  2QDL A;  1YZ6 A;  2PNR C;  3DWA A;  5IGC A;  5C44 H;  2LXJ A;  1STY A;  1SLJ A;  2AHO B;  1JQY D;  2Z4H A;  3CPF A;  5A2Q L;  1B44 D;  3OW7 A;  2K7V A;  3L7Z C;  3S17 H;  4TSS A;  1PRT F;  3KYH C;  5AJ3 Q;  4JVZ A;  4H0L C;  3GTQ H;  1WCM G;  5GRO A;  2F0Q A;  3R2I A;  4K5X A;  3RLF A;  4QIW B;  4LF7 L;  3HOY H;  3ERQ A;  5LHY 1;  1H9S A;  4IQZ A;  3D0F A;  2F0L A;  3T16 A;  3TS2 A;  2EY1 A;  2O4X A;  3U4V A;  4IOC A;  5FJ8 H;  4Q5V A;  4C1N I;  4OWT B;  1IL2 A;  1KHI A;  5EAY A;  2NBF A;  4A3E G;  4FXG C;  3I4M B;  3QR8 A;  3GTM B;  2ICE C;  4L5Q A;  1DYQ A;  3EBE A;  1GUN A;  3GTP H;  1XMQ Q;  4K0K L;  1Y8O B;  1YJW A;  4RFB A;  4B3S Q;  2B2W A;  1HNZ L;  1IBL L;  1ILQ A;  1WD0 A;  3U9S A;  3T1Y Q;  1J9O A;  2F0P A;  3KJP A;  4K8J A;  2X6G A;  4N9P A;  2GN5 A;  2G5D A;  3Q0A A;  3NTI A;  1NCV A;  3CXC A;  3W3A A;  4IFD I;  3Q6S A;  3R3O A;  2CH4 A;  4DV4 L;  2L11 A;  1PYW D;  3KLS A;  5CV9 A;  1CHP D;  5IIF A;  1NUC A;  3RNU A;  3KFU A;  3K59 A;  3PQI A;  4CDF C;  3GDE A;  3OOC A;  4GN4 B;  2ES2 A;  2EOT A;  3S17 B;  5T1G A;  1KXL A;  1X32 A;  2ASB A;  5FO9 B;  2RQX A;  2EY5 A;  1HRJ A;  4CDE C;  3BZD B;  3H3V H;  1V1P A;  3JAM c;  4A4I A;  4A3K G;  2B8G A;  4O1N A;  1LTT D;  1VCI A;  3Q23 A;  3HOY B;  3URY A;  5EPK A;  2HQL A;  1HUN A;  3CKI B;  3EJI A;  4FO2 A;  1IKL A;  4YCV A;  3OPO A;  2OTL A;  3OTO Q;  5EKK A;  1UEB A;  5CC4 A;  3SVM A;  4LK1 C;  1L1O A;  4C2M B;  2R92 G;  4WJ4 A;  3CCL A;  1ZEQ X;  2BDN A;  1GO3 E;  3R93 A;  1E2Z A;  1K8M A;  1FJG Q;  4JYA Q;  1PH6 A;  2ZJQ A;  4BY1 H;  1DJR D;  2CWP A;  4A3J H;  1DOL A;  3OMC A;  3J7A V;  1S5D D;  2CVR A;  4GOP C;  3I4N H;  1I4Q A;  3MXU A;  1MD2 D;  1I4R A;  4OO1 H;  1JC7 A;  5LMN W;  4EX5 A;  3KLW A;  2PQA B;  4MN3 A;  4EQP A;  1CTM A;  3MXN A;  2QGQ A;  1FL0 A;  1YJN A;  5HGT A;  3BG3 A;  4DAM A;  3T4A C;  1TT2 A;  3RN2 A;  2F0O A;  3KBG A;  2KED A;  1QUQ A;  2GA4 B;  5LMN Q;  2D62 A;  4G7O C;  1VQG A;  3SGI A;  3J80 E;  3R8B A;  3NEM A;  2YU9 B;  1X3G A;  4LNQ A;  1Z9F A;  4GNX C;  3TRE A;  3PIO 3;  1IKM A;  2K01 A;  4O42 A;  2K50 A;  1JWM D;  5CR3 A;  2MHV A;  3J7A 5;  1Z7T A;  3E9I A;  4POF A;  3PSI A;  4HSV A;  4OX9 Q;  2N88 A;  2K5V A;  1B7Y B;  1HTL D;  2VY3 A;  3FKI G;  4DR2 L;  1UUP A;  2B2T A;  2K04 A;  5I4D A;  5M3F B;  3PF5 A;  1STB A;  4RHR A;  1SYF A;  4DK6 C;  1EQT A;  3TDQ A;  4V19 0;  3FHW A;  3J81 c;  1LAC A;  3W1B A;  1W6K A;  3HGB A;  5IWA Q;  1PLF A;  4HMJ A;  2K5N A;  2ZTC A;  3TP8 A;  4LF4 Q;  4JG2 A;  1TWC B;  4XDX A;  4JBK A;  4BXX G;  1SYG A;  1II3 A;  2K75 A;  4XQJ A;  4PQX A;  4KD3 A;  3AYH B;  1VQB A;  4X3T A;  1B2T A;  1L2F A;  3I73 A;  3KBX A;  1EY4 A;  1YHA A;  2K5D A;  2ZXP A;  4BY1 B;  4DV5 Q;  4P72 A;  4A3J B;  2R7F A;  1EIF A;  5C44 G;  2F0J A;  3HOV H;  2VB3 X;  1A0I A;  5ELD A;  4QUF A;  1XPR A;  2N8N A;  4KY6 A;  3K0X A;  1WTW A;  2KBN A;  2K33 A;  3HOZ H;  2PZW A;  4G57 A;  4J8Q A;  4DK0 A;  5EPJ A;  3X3M A;  4F87 A;  3I91 A;  1B53 A;  1K28 A;  1TWA B;  4U67 3;  5I2Y A;  1BCP B;  2CKZ B;  3IRB A;  2SDF A;  4KY7 A;  2EYH A;  3S1N H;  1K3B C;  1V9P A;  1XTC D;  2C35 B;  4KV6 A;  3AU7 A;  4QQB X;  3TS0 A;  3T1H Q;  4ZUJ A;  2WAQ E;  3NWS A;  1VQ6 A;  1S5C D;  3VR4 A;  3M7N A;  4NKL A;  3GTK H;  1LTL A;  4Y7N H;  1KDC A;  3DHQ A;  2Q8R E;  1A62 A;  1LV9 A;  4PZ6 A;  5IT9 c;  4C3J H;  1U9R A;  2EYF A;  2F0H A;  1GUW A;  5C0X H;  2XRQ D;  4MZ9 A;  4X66 Q;  3H3V I;  4XIG S;  1EOV A;  1QG7 A;  2VB2 X;  4HED A;  2ID0 A;  3ND9 A;  1I94 L;  4LF8 Q;  1ROD A;  3K7A B;  1K8A C;  3E9H A;  3MXG A;  5GAD C;  1HNX Q;  4FF2 A;  1BKB A;  5CV5 A;  1YJ9 A;  1BR9 A;  2JYO A;  3JAM E;  3AFQ A;  3ZYY X;  3G7L A;  1OTC A;  2WAQ B;  3KOJ A;  4C3H H;  2Q2I A;  3D4D A;  4RGO S;  2I5L X;  2UXC Q;  2Z9H A;  4KN7 C;  1BCP D;  3VYU A;  1N33 L;  1C8C A;  3V05 A;  3HOV B;  3BVZ A;  3G48 A;  2BH8 A;  4AQY L;  3OHX C;  2BH2 A;  3NXW A;  3SK8 A;  1HQR D;  4IUN A;  3RN5 A;  1NJI C;  3HOZ B;  2J7Z A;  4OO1 I;  1IXR A;  5EQ0 A;  4LFC Q;  2A68 D;  4DV0 Q;  4IUR A;  4PMC A;  2FXQ A;  3PUY A;  1BO0 A;  3SEB A;  1HQM C;  1AFP A;  1EFI D;  1XNR Q;  3QG1 A;  1B3A A;  3WDN A;  5C0X J;  1XXG A;  1N9W A;  2RSN A;  4B3T Q;  1C9O A;  3G4S A;  4Z9C B;  1YNJ C;  2B2V A;  5J1Z A;  4GKJ L;  1TY2 A;  5TSS A;  1O7Z A;  4JI6 Q;  1TVX A;  3NK9 A;  1K83 H;  2B39 A;  2WV6 D;  1HH2 P;  4Y7N B;  5FK9 C;  5FLX c;  1GVP A;  1SND A;  4C3J B;  4ZLT F;  1C0A A;  1ICW A;  1H9J A;  1LO5 D;  2AWN A;  5E4X A;  5JVH 3;  2WKD A;  4F7X A;  1PMR A;  4QGU A;  1UEA B;  3RMH A;  3H94 A;  3ULP A;  2UUC L;  3I4N G;  2IJ0 A;  3SE0 A;  1CKN B;  1ZXT A;  4CKB A;  5KGU A;  5C4J H;  2IY5 B;  1ENF A; 
#chains in the Genus database with same CATH homology
 4C2M H;  4DR4 Q;  3M3Y H;  3UDI A;  4X66 L;  1IBM Q;  1IZ6 A;  1VQK A;  2R6G A;  2PMZ E;  3PO2 G;  2JEB I;  3PGZ A;  2YTY A;  3J7Z C;  1AE3 A;  4POG A;  1QZH A;  1KRS A;  4PMW A;  1HR0 Q;  4LF8 L;  2BA0 A;  1VQM A;  2KHI A;  2ALY B;  1HNX L;  3A74 A;  4BBR G;  2KCM A;  3CPW A;  4A3L H;  2I0Q A;  3CCS A;  4DUY Q;  2R92 H;  1H95 A;  2CFM A;  4GLA C;  4UPA A;  1Z47 A;  4B3M L;  2WB1 E;  1XMO L;  2JA6 G;  1LUZ A;  4DR1 L;  4APV A;  1YIJ A;  3PCO B;  4JI1 L;  4GOP B;  3RZO H;  1HZC A;  1OXX K;  2K52 A;  1E1O A;  4JI5 L;  3PUX A;  2UXC L;  3H0G G;  1Y1V H;  4UP9 A;  2MFI A;  2ZM6 Q;  2E5L Q;  4UY8 C;  1Q46 A;  1LYL A;  4JC0 A;  2L15 A;  5GAG C;  4LUO A;  2JA8 H;  4AYB E;  4LFB L;  1VQA A;  3KDF B;  3I2Z A;  3ULJ A;  2JEA I;  4GKK L;  2HT1 A;  2F4V Q;  3KF6 A;  3NBH B;  3PV0 A;  3CC7 A;  1TWG H;  4GLV B;  2YU9 H;  2Q2H A;  4JI4 L;  5GQO A;  3JC6 6;  2UUA L;  2IHF A;  2WB1 G;  4ALP A;  1YHB A;  2UUB L;  4BBS G;  3S2H H;  3M4O H;  5IYB G;  1G29 1;  4DV0 L;  2R7Z G;  5IYD G;  4YCW A;  4DV3 Q;  1YNX A;  4GNX B;  3W1G A;  1X56 A;  4OXP A;  3J81 j;  1BBU A;  1MJE A;  3EIV A;  1XNR L;  2RHQ B;  4JBW A;  2BA1 A;  4AIM A;  3STB C;  3A5U A;  1W2B A;  1L1O B;  2R7D A;  3HFZ B;  4LWC A;  4TQU S;  4AYB G;  1WCM H;  1EYG A;  3K7U C;  4B3T L;  4NXN Q;  4H02 A;  5M5Y H;  2NN6 G;  3AEV A;  5C3E G;  5M3F H;  1X54 A;  4BY7 G;  1PHJ A;  2VW9 A;  4JI7 L;  2MQH A;  1VQO A;  3HKS A;  5C4X H;  2UXB L;  3CMA A;  2YTX A;  2NZO A;  2OWO A;  1YI2 A;  1N34 L;  4IFD J;  1P8L A;  3FKI H;  5M5W H;  5AJ3 L;  4A75 A;  4B3M Q;  1KC8 C;  2OQ0 A;  1XMO Q;  1M1K C;  1K8G A;  1IBK L;  2JQO A;  3W5O A;  1SFO H;  1CKO A;  2PNH A;  2RHS B;  4A3B H;  4DR7 Q;  1TWC H;  4HIM A;  5IP9 H;  2UXD L;  1IBL Q;  1NMG A;  2OCE A;  4OON A;  5C0X I;  1PYS B;  1I5F A;  3PIO A;  4DV6 L;  1EFW A;  4JI0 Q;  2JA7 G;  3MXN B;  4DR6 Q;  1UE5 A;  3EN2 A;  1N36 Q;  4YHH Q;  3CC2 A;  4IFD G;  4A3L G;  3GTM H;  3J80 c;  3GO5 A;  4PZ8 A;  4IJL A;  5HGQ A;  4DR3 L;  4KI0 A;  3MEF A;  4A3F H;  4YWK A;  1QUQ B;  1U5K A;  5M3M H;  4UP7 A;  4GKK Q;  4YWM A;  4LF9 Q;  1HNW Q;  3F8T A;  2E2J H;  5H1S E;  4A3E H;  4EQ5 A;  4DV4 Q;  1WJJ A;  3M85 A;  4PG3 A;  1OXV A;  2IHE A;  2KHJ A;  2UUA Q;  4DR4 L;  2DGY A;  4QIW E;  1OXT A;  5JEA J;  4HID A;  1KQS A;  1MJC A;  4A93 H;  5J3B A;  4MTN A;  3CAM A;  4DR5 Q;  2JA8 G;  1VQD A;  1XJV A;  2RCN A;  1N32 L;  3L0O A;  1YZ6 A;  3RZD H;  1AE2 A;  1OXS C;  3S15 H;  4UP8 A;  2EQS A;  3ER0 A;  5C44 H;  2B63 H;  2LXJ A;  4X6A H;  1G6P A;  1SLJ A;  2AHO B;  1B70 B;  1TWA H;  1PYB A;  1SE8 A;  5JEA G;  1JT8 A;  2PI2 E;  1E22 A;  3CPF A;  3CW2 C;  2ZJP A;  1XMQ L;  1A8V A;  2NVQ H;  3GD7 A;  4B3S L;  4KHZ A;  4P75 A;  2K5H A;  3L7Z C;  3CME A;  1GM5 A;  3S17 H;  3UDX A;  3CCE A;  1N34 Q;  3KYH C;  1PH9 A;  5AJ3 Q;  3F2D A;  3GTL H;  1KIX A;  2KCT A;  2E5L L;  3GTQ H;  2ZM6 L;  1WCM G;  5GRO A;  1IBK Q;  1N8R C;  1D7Q A;  1Y14 B;  1S72 A;  3JAM i;  2UXD Q;  2N78 A;  1Q82 C;  4IJH A;  3BJU A;  4DV6 Q;  1X3F A;  4NB3 A;  3RLF A;  4DV1 L;  4LF7 L;  3HOY H;  1EQQ A;  2CCZ A;  2NVX H;  3UE0 A;  1C7Y A;  3ULL A;  5BR8 Q;  2YYZ A;  3D0F A;  4DV3 L;  1CSQ A;  4IPH A;  1PH4 A;  3A5Z B;  1NMF A;  1KD1 C;  1VQC A;  2EXD A;  4BA1 I;  3OW2 A;  3TS2 A;  3DLL A;  3I4M G;  4KLK A;  1VQ7 A;  3U4V A;  3PIP A;  3HKZ E;  4IOC A;  4NXN L;  5FJ8 H;  4R4T A;  4QL5 A;  1E1T A;  3K7A H;  4OWT B;  3J80 i;  4GLX A;  4A3F G;  1J5E L;  1XNQ Q;  5M3M G;  4BA2 I;  3E0E A;  3WWV A;  3L2P A;  1WI5 A;  1KHI A;  1IL2 A;  1N32 Q;  5EAY A;  4A3E G;  1VQL A;  5JJK A;  1Q8K A;  1WFQ A;  4IO9 A;  1HJP A;  2NN6 I;  1VQ4 A;  4HJ7 A;  3FP9 A;  2Y0S E;  4L5Q A;  4A93 G;  1CKN A;  3EBE A;  4YY3 Q;  1XMQ Q;  3GTP H;  4DR7 L;  4O0A A;  4A3M G;  1YJW A;  4K0K L;  4B3S Q;  1HNZ L;  1IBL L;  2ZTE A;  3UDF A;  4DR6 L;  4JI0 L;  4R4C A;  3HKZ G;  1U0L A;  1HZB A;  1VQH A;  5IP7 H;  4YHH L;  3T1Y Q;  1N36 L;  1T9H A;  4JOI A;  1NBW A;  2HIX A;  3KJP A;  3VDY A;  1VQF A;  4A3I H;  1GD7 A;  2GN5 A;  1SRU A;  3S24 A;  3PF4 A;  3ERS X;  1UWV A;  1AH9 A;  1FVI A;  3DM3 A;  3BZK A;  4LF9 L;  1HNW L;  3CXC A;  4IFD I;  4DV1 Q;  2Z0S A;  2ZTD A;  4DV4 L;  4XTC S;  4LF7 Q;  2Y0S G;  1Q81 C;  1L0W A;  3RNU A;  3KFU A;  4DR2 Q;  4QJF A;  2V1C C;  4DR5 L;  2VL6 A;  2IT1 A;  3GDE A;  4GOP A;  4GN4 B;  4R4Q A;  1YEZ A;  2ES2 A;  2A8V A;  2A1A A;  2I5H A;  3PUV A;  1VQ9 A;  4A3G H;  1YVC A;  2ASB A;  1KL9 A;  3HOY G;  3AFP A;  1KXL A;  5HY6 A;  3H3V H;  2F3I A;  4JBJ A;  3JAM c;  4NXM Q;  3KDF A;  3HOW G;  1J5E Q;  1TXY A;  3HOX H;  4A4I A;  1PH1 A;  3S14 H;  4A3K G;  5FLM G;  4ME3 A;  3I55 A;  2JA5 G;  2MO1 A;  1VCI A;  4A76 A;  1EIY B;  4NPS A;  4LW1 A;  5IYC G;  3CD6 A;  1JJC B;  2WFW A;  3CF5 A;  3CC4 A;  2HQL A;  4PZ7 A;  4X62 L;  1A63 A;  3J81 i;  4IPC A;  5FJ8 G;  4YCV A;  4K0K Q;  2OTL A;  3OTO Q;  3A0J A;  4GNX A;  1K9M C;  1HNZ Q;  1NY4 A;  1UEB A;  4JOI C;  4OX9 L;  4B3R L;  1QVF A;  2E2H H;  2IX1 A;  1L1O A;  5M5X H;  4R1J A;  2R92 G;  4WJ4 A;  1JE5 A;  3CCL A;  1FJG Q;  1GO3 E;  1OXU A;  3PO3 H;  4JYA Q;  1O7I A;  5BR8 L;  1PH6 A;  3GTG H;  4BXX H;  2ZJQ A;  4BY1 H;  4P74 A;  3GTJ H;  1BVS A;  2CWP A;  4JI8 Q;  4A3J H;  1EQR A;  2OTJ A;  5IP7 G;  2R93 H;  1Y1V G;  4GOP C;  3I4N H;  4RMF A;  1X55 A;  2VQF L;  1QZG A;  1PFS A;  5LMN W;  4EX5 A;  3KLW A;  3UDG A;  1XNQ L;  2PQA B;  2RF4 A;  3ZJY C;  2QGQ A;  1FL0 A;  4IPD A;  1YJN A;  4L5S A;  2B29 A;  5K36 G;  3NEL A;  4DAM A;  3G6E A;  3GTO H;  3PO2 H;  3RN2 A;  1E24 A;  1JMC A;  3PUZ A;  1K73 C;  4JBM A;  1QUQ A;  4DPG A;  4YY3 L;  5LMN Q;  2ATW A;  2D62 A;  1VQN A;  4BBR H;  1S3O A;  4LFA Q;  1VQG A;  3SGI A;  1VQ5 A;  3NEM A;  1X3G A;  4LNQ A;  4X62 Q;  1Z9F A;  3F1Z A;  3T1Y L;  4GNX C;  4RG1 A;  3TRE A;  2K50 A;  1PV4 A;  4A3C G;  3J7A 5;  3E9I A;  4LF6 L;  3B6Y A;  5M3F G;  5ELN A;  2DUD A;  3NEN A;  4GN5 A;  1L1O C;  3PSI A;  4POF A;  3HOX G;  1Y1W H;  4OX9 Q;  4A3D H;  4B3R Q;  3H0G H;  2K5V A;  4MNO A;  5C4X G;  1D8L A;  1B7Y B;  2VY3 A;  3FKI G;  5IE8 A;  4IPG A;  4IOA A;  3CQZ H;  1PVO A;  4DR2 L;  3KJO A;  1I94 Q;  5GAH C;  3PF5 A;  5LMU L;  4LF5 Q;  1X6O A;  4A3B G;  1EWI A;  5IP9 G;  4DK6 C;  3FHW A;  3S1R H;  1Q7Y C;  2WP8 J;  3J81 c;  2E2I H;  3W1B A;  2I5M X;  4BBS H;  4JI3 Q;  5IYB H;  2CWA A;  2JA9 A;  5IWA Q;  4HIK A;  2R7Z H;  5ELO A;  2VQF Q;  1CSP A;  5IYD H;  1Q12 A;  2K5N A;  2ZTC A;  4NXM L;  5JJI A;  4LF4 Q;  3T1H L;  1V43 A;  2VZA A;  4GS3 A;  4JG2 A;  4DKA C;  2EIF A;  4X64 L;  4JBK A;  4BXX G;  4LUV A;  4R4I A;  4BY1 G;  3TRZ A;  2HHH Q;  1E7Z A;  2GVA A;  2K75 A;  3CCU A;  4A3J G;  1KRT A;  2OQK A;  4HJ8 A;  3AYH B;  1VQB A;  4HJ9 A;  4JI2 L;  1L2F A;  1N33 Q;  1HR0 W;  1SN8 A;  2AKW B;  1XTD A;  1YHA A;  4TVA B;  4OO1 G;  1FGU A;  1S40 A;  3K81 C;  1GKH A;  3OTO L;  3H15 A;  1NE3 A;  4DNI A;  4DV5 Q;  1PH2 A;  4P72 A;  2PI2 A;  2GVB A;  1M90 C;  2R7F A;  1EIF A;  4QY7 A;  5C44 G;  2B63 G;  1MIU A;  3HOV H;  1FJG L;  4LF6 Q;  1A0I A;  1XPR A;  2JA7 H;  1CUK A;  2N8N A;  3K0X A;  4JYA L;  2KBN A;  3BZC A;  3HOZ H;  3KF6 B;  1JB7 A;  2QA4 A;  3CCJ A;  4JI8 L;  1SR3 A;  3CCQ A;  4GKJ Q;  1PH7 A;  4X65 Q;  2CKZ B;  3IRB A;  1E3P A;  5LMU Q;  1VS0 A;  3CCV A;  3U58 A;  1QVC A;  1V9P A;  2C35 B;  3LGJ A;  1Y1W G;  3S1N H;  4A3D G;  1LM0 A;  4L5R C;  1YHQ A;  3OYY A;  2YV5 A;  4L5T A;  2UU9 L;  1YBY A;  1J6Q A;  1PH5 A;  4QQB X;  1TWF H;  1MKH A;  3TS0 A;  1VQI A;  3T1H Q;  4A3C H;  1P16 A;  2D0P A;  2N3S A;  1V1Q A;  2WAQ E;  4DK3 C;  4X64 Q;  5LMN L;  2IX0 A;  3M4P A;  1VQ6 A;  2N49 A;  1YIT A;  3K8A A;  3U50 C;  4LFA L;  1G51 A;  4P71 A;  2NVT H;  2XTI A;  3GTK H;  3M7N A;  1JJG A;  1LTL A;  4Y7N H;  2JK8 A;  4JI2 Q;  1ASZ A;  3STB D;  4DAY B;  1A62 A;  2UUC Q;  5GAE C;  4WJ3 M;  4LFC L;  4Y52 H;  4PZ6 A;  4O2D A;  1HZA A;  2LXK A;  4C3J H;  5IT9 c;  2VQE Q;  5JJL A;  2NZH A;  3KF8 B;  2F52 A;  4JV5 Q;  4HIO A;  3F2B A;  4DV2 Q;  1VQP A;  4MZ9 A;  1QVG A;  2VNU D;  4X66 Q;  3H3V I;  4XIG S;  1EOV A;  2XGT A;  1X65 A;  2ID0 A;  1UE1 A;  2WAQ G;  1I94 L;  4LF8 Q;  3I56 A;  2Z6K A;  1K8A C;  2VUM H;  1W3S A;  3E9H A;  4GN3 B;  5GAD C;  1HNX Q;  4JI6 L;  4LF5 L;  2CQO A;  1BKB A;  4J15 A;  3BU2 A;  3HOU H;  1RIP A;  1YJ9 A;  4KHP L;  1WYD A;  2H5X A;  3CP0 A;  2YTV A;  1TWH H;  4JI3 L;  1IYJ B;  3AFQ A;  5IWA L;  3CCM A;  2JJQ A;  2K14 A;  4HJA A;  4DR1 Q;  3KOJ A;  4JCV E;  4C3H H;  4A3I G;  1OTC A;  3HOV G;  2AMC B;  3I7F A;  3PUW A;  4JI1 Q;  3S1Q H;  2JE6 I;  1HZ9 A;  2Q2I A;  2QEX A;  4LF4 L;  1DGS A;  2AWO A;  2I5L X;  4JI5 Q;  3HOZ G;  3I4M H;  1NTG A;  2HHH L;  4OWW B;  2UXC Q;  3UE1 A;  1VQJ A;  2KEN A;  4DUZ L;  1SMX A;  1K3R A;  2UU9 Q;  4LFB Q;  1I3Q H;  1N33 L;  3M4Q A;  1CKM A;  1UE7 A;  4YCU A;  3G48 A;  4C3I H;  1I50 H;  2BH8 A;  4AQY L;  1XPU A;  2BH2 A;  3S1M H;  2UXB Q;  1B8A A;  3D31 A;  1X9N A;  5IY0 A;  4DV7 L;  3RN5 A;  4DV5 L;  1NJI C;  4JI4 Q;  2E8G A;  2UUB Q;  1Q1E A;  1UE6 A;  4A3G G;  1IBM L;  1K0R A;  4OWX B;  3RLO A;  1PH8 A;  4OO1 I;  2JA6 H;  1IXR A;  4LFC Q;  1EUJ A;  4DV0 Q;  4A3M H;  2FXQ A;  2A19 A;  2PQA A;  3PUY A;  1HR0 L;  2MO0 A;  3ICE A;  3S16 H;  1XNR Q;  1XPO A;  2ZJR A;  2NVY H;  5C0X J;  3AQQ A;  3M9B A;  1N9W A;  1ASY A;  4B3T Q;  2HIV A;  4DUY L;  1C9O A;  4HJ5 A;  2Z6K C;  3G4S A;  1JJ2 A;  1I6H H;  4GKJ L;  3RR5 A;  4YWL A;  4JI7 Q;  4X65 L;  1VQ8 A;  4FDB A;  2Q2U A;  1Q1B A;  1R9T H;  3RLN A;  3TQY A;  4JI6 Q;  3Q8D A;  1X3E A;  1K83 H;  3K80 C;  4LUZ A;  5C0X G;  1HH2 P;  4KHP Q;  2B3G A;  4P73 A;  1Q86 C;  3I4O A;  5FLX c;  2Q2T A;  2LSS A;  1GVP A;  3TEH B;  1C0A A;  1PA6 A;  3G71 A;  2VS1 A;  3F2C A;  5DLQ E;  2VUM G;  2F4V L;  3PO3 G;  3CCR A;  4AH6 A;  1VQE A;  1SRO A;  4DUZ Q;  3HOU G;  1BBW A;  2AWN A;  1PH3 A;  1WOC A;  2K4K A;  2D0O A;  4QGU A;  3S2D H;  3HOW H;  4BY7 H;  4DR3 Q;  5C3E H;  1RL2 A;  3ULP A;  2UUC L;  3I4N G;  2R93 G;  3U4Z A;  1CKN B;  1KAW A;  5FLM H;  2MNA A;  4AQY Q;  4A3K H;  2VQE L;  2JA5 H;  5C4J H;  4DV7 Q;  4R4O A;  5IYC H;  2IY5 B;  4JV5 L;  4DV2 L;  5E7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...