5C0XI

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
284
structure length
222
Chain Sequence
PEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTDTVKNILVSVLPGTNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 42
structure length 222
sequence length 284
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xI01
3G4SA 1XNRQ 2Q2HA 2K5VA 3MXNB 3UE1A 2F4VQ 2JA7G 1Q7YC 1VQOA 5GAGC 4Y52H 4GKKL 2HIXA 4KI0A 2ES2A 1QVFA 4BBRH 3I56A 5GAHC 1VQ4A 2JE6I 4KHPQ 3HOVH 4GN5A 1GM5A 4GLAC 3K0XA 3KJOA 4X62Q 2VQEQ 5M3FH 1MKHA 1WOCA 1YHBA 4GOPA 5M3MH 4JI2L 2WB1E 5IE8A 2K14A 5IP9G 4J15A 5IYBG 4POFA 4B3TL 4JI3Q 3A0JA 1GO3E 3HFZB 5LMNQ 1Y1WH 4A3DG 4JI1Q 3D31A 1QUQA 3H0GH 5IY0A 4YY3L 4LF4Q 3CCVA 5C4XG 4DV5Q 3CP0A 5FJ8H 4GOPB 2VZAA 4GKKQ 2PI2A 2WP8J 3LGJA 2JA6G 1XTDA 3A5UA 3ULJA 4EX5A 3KF6A 1FVIA 4GLVB 2B3GA 2QEXA 1Z47A 5IP7G 2UU9L 1QUQB 2D62A 4AH6A 3S1NH 4NB3A 1K83H 2K52A 2R92G 4MTNA 4LFBQ 4X6AH 4HJ7A 1EFWA 4JBKA 4A3CG 1HNWL 4YCVA 4B3TQ 3CQZH 4APVA 2Q2UA 2LSSA 2N3SA 2R93G 4PZ8A 2BH8A 4LUVA 4C3JH 3HKZG 3K7UC 4LF6L 3CPWA 3CW2C 1IZ6A 3MEFA 1YI2A 1VQHA 5C0XG 1G51A 2VUMH 4A3BH 4IOAA 1YZ6A 5GQOA 4AQYL 3K81C 2CCZA 3UE0A 2MNAA 5IYCG 1SMXA 2VL6A 4RG1A 4IOCA 1W2BA 1VQ9A 1S72A 1Y1VG 2R7DA 2UXCQ 3HOWH 4OXPA 1Q86C 5M5YH 3CC4A 1BBUA 4JBWA 1HNZL 3M85A 1N34Q 2UU9Q 4UP9A 3S1QH 3HKZE 1I94Q 4JI0L 2B63H 4QIWE 3EBEA 1CSPA 4QQBX 4IPGA 1C0AA 2OQKA 1G6PA 2AWOA 1PH8A 1OXTA 1IBLL 1HNWQ 3IRBA 1U5KA 5HGQA 1KQSA 3AEVA 4MZ9A 4PMWA 4DV3Q 2UUBQ 4LF6Q 1KC8C 1OTCA 3FKIH 1PH5A 4HJAA 4WJ4A 2Z6KA 4UP8A 1LTLA 3J7A5 2QGQA 1S3OA 1UE5A 2JA5H 3CAMA 2CWPA 5M5WH 3ER0A 5AJ3Q 2HQLA 4A4IA 1K73C 2JA7H 1SR3A 3GDEA 1NJIC 1D7QA 1B7YB 1I6HH 1XMOQ 2EIFA 1FGUA 2KHJA 4B3RL 3GTMH 1VQDA 1MIUA 4JOIA 4JYAQ 1NBWA 4OONA 3CCUA 1N36L 5IYDG 1UE7A 3W1BA 3CCMA 4JV5L 1KHIA 4QL5A 2OQ0A 5IP9H 1PH7A 5IYBH 5BR8Q 3WWVA 4DUZL 1X6OA 3CXCA 3U4VA 5C4XH 4DV2Q 3AFPA 1QZHA 2UXBL 4DR4L 5LMNW 1KIXA 4A3LG 4LF7Q 1X3EA 4BA1I 2JA6H 1PVOA 1CKMA 1V9PA 3CMAA 1VCIA 4P74A 4B3RQ 1LYLA 4A3MG 1H95A 3PUVA 1IBML 1EIFA 3NELA 5GROA 3EN2A 4R4OA 1PH9A 3BZKA 1YITA 2UXDQ 1PH2A 2R92H 3GTPH 1XNRL 4JV5Q 2YV5A 4A3CH 4X66L 1L1OA 4JI4L 3GTOH 3S2DH 3J81j 5ELOA 4IFDI 2IHEA 3JC66 2R93H 4DV7Q 1J5EL 1K9MC 2HHHL 4BXXG 4NPSA 3Q8DA 4DUZQ 1KRTA 4X64L 2BA0A 1P16A 4DAYB 3RZOH 1NTGA 3KDFB 4DV6L 3RNUA 1JE5A 1YHAA 1OXUA 1HR0L 1L2FA 3HOYG 2Q2IA 1VQBA 5IYCH 1TWAH 2K5NA 3FHWA 4X65L 4LF9L 2QA4A 4OO1I 1L1OB 4OWTB 3T1HL 2JA9A 5JEAG 3CCSA 5K36G 1IBMQ 1YJNA 1S40A 1IYJB 4DR7Q 1Q82C 2JEAI 4JC0A 4NXNQ 3D0FA 2YTXA 3STBD 3KJPA 3CC7A 2VS1A 4DR3Q 4GN3B 1K0RA 3J80c 1UWVA 4P75A 1KD1C 4K0KL 3HOZG 2HHHQ 3J81c 2GVBA 1XPOA 3HOUG 3ULLA 1Z9FA 4X64Q 5J3BA 3RN5A 1FL0A 1HNXL 4DV6Q 3HOXG 2XTIA 1YIJA 1XMQQ 4LF9Q 1EQRA 2A8VA 1TXYA 4LFCL 4JI1L 3TS0A 4HJ5A 2BA1A 4C3HH 5C3EG 2RF4A 1SRUA 1YHQA 1B8AA 3HKSA 1IXRA 1KXLA 2PNHA 5FLXc 4DUYL 1A8VA 2MO0A 1Q1BA 4LUZA 5LMUL 3RN2A 5IYDH 3F2DA 3M4PA 1EYGA 3TQYA 2Y0SG 4DV0L 4IO9A 4BA2I 4ME3A 1T9HA 2UUAL 3S1MH 2GN5A 3NBHB 3TEHB 1SFOH 4A3LH 4JI2Q 1I5FA 2Z6KC 3E0EA 1ASYA 2JEBI 1VQPA 3K8AA 5EAYA 3RZDH 2Y0SE 3I4NG 1TWCH 3JAMi 2R7ZG 1A63A 4C2MH 4A3MH 4LF8L 4R4QA 4YY3Q 3OW2A 2UUCL 2OTJA 4NXML 1VQAA 1X3GA 4AIMA 3VDYA 5ELNA 2IT1A 4YWLA 1E1TA 3T1YL 5JJLA 3GTJH 4JOIC 4XIGS 4BXXH 2UUAQ 3I2ZA 3H3VH 1AH9A 3U58A 2KENA 1WFQA 4DR5L 1VQEA 1PA6A 3HOYH 1N32L 1LUZA 2VY3A 1QZGA 3K80C 3PCOB 1K8GA 3M7NA 1AE3A 4O2DA 2ID0A 2KCTA 4JI5L 1HZAA 1HH2P 4QY7A 4LF8Q 4R4CA 3EIVA 4B3ML 3PIOA 4WJ3M 3OYYA 4AQYQ 1VS0A 3BU2A 2RCNA 1IL2A 3PUYA 4OX9L 3GTKH 3CMEA 1YBYA 3M4OH 1U0LA 2I5HA 2ZJQA 1DGSA 1GD7A 5C44G 1VQMA 3HOZH 2I5LX 5GADC 1HNZQ 1HZCA 3HOUH 3FP9A 4IFDG 2KHIA 2NVYH 1VQFA 4EQ5A 4DR5Q 1VQLA 4JI0Q 1UEBA 5FLMG 3BJUA 1L1OC 3PUWA 4OWXB 1N32Q 4UY8C 1IBLQ 1YEZA 4P73A 3W1GA 5DLQE 4IPDA 1RIPA 2YU9H 5C3EH 2ATWA 1HZ9A 4OO1G 1C9OA 1IBKL 2HT1A 3J80i 2R7FA 1SE8A 4A3DH 3J81i 1Q8KA 2VQFL 3A5ZB 4R4IA 4A3FG 1WJJA 3S16H 5E7NA 3PF4A 3GTLH 3F1ZA 4QJFA 4DR6L 2CWAA 2YYZA 1CKNA 4HIDA 1A62A 4JI7L 3UDFA 4BBSG 1V43A 3PO2G 2E2IH 1X55A 1WI5A 3PV0A 3J7ZC 2PQAA 2NVXH 5IP7H 3KDFA 4DV4L 1BBWA 3S15H 4L5QA 1FJGL 1N36Q 3AQQA 2E5LL 4LF5L 2EXDA 4R1JA 3TS2A 3AFQA 4A3KG 1CKNB 3I4NH 2H5XA 1IBKQ 1G291 1JJGA 2AHOB 3TREA 2CQOA 1XJVA 2R7ZH 3PO3G 2VQFQ 1UE6A 1EIYB 4DK6C 2E2HH 1L0WA 2JJQA 2PQAB 2NN6I 1OXSC 2IX0A 2ZTDA 3E9HA 4A3IG 2HIVA 2UXBQ 4DR4Q 3A74A 4DR6Q 1CUKA 2AWNA 2E2JH 2RHQB 4GN4B 1TWGH 4LWCA 2ZTCA 4LFAL 1Y1VH 1VQ5A 1E3PA 1CKOA 4ALPA 2VNUD 4MNOA 4YCUA 5IWAL 1PHJA 1A0IA 5C4JH 2ZM6L 2BH2A 2XGTA 2IX1A 4TVAB 3UDXA 2NVQH 1VQ6A 2VUMG 3RLNA 1E22A 1W3SA 4JBJA 3CCLA 1JT8A 4HJ8A 1TWFH 2E8GA 2K5HA 4A75A 5JEAJ 2MQHA 1I50H 4X66Q 4JI4Q 1SLJA 1UE1A 2F4VL 1PV4A 1CSQA 4A3EG 5M5XH 1O7IA 1J5EQ 1N9WA 2KBNA 2Z0SA 4IJLA 4B3SL 1JJ2A 4JI6L 2A19A 5HY6A 2JQOA 2AKWB 1VQKA 2IY5B 3DM3A 2B29A 1HR0Q 2CFMA 1MJCA 1XPRA 4A3GG 4X62L 5JJIA 4X65Q 4LFAQ 4DNIA 3AYHB 3G71A 1MJEA 3T1HQ 2NZOA 3KF8B 5C44H 2ALYB 1HJPA 1GVPA 3S24A 4JI3L 5IWAQ 4BY7G 1X65A 5LMNL 1M90C 3DLLA 2MO1A 4JBMA 4LF4L 1YVCA 2F3IA 4DV5L 2WB1G 4HIMA 3CC2A 4K0KQ 1KRSA 1Q1EA 4B3SQ 1GKHA 4JI6Q 4HIOA 2RHSB 3ERSX 2N8NA 1HNXQ 4L5RC 4GNXA 1Y14B 1QVCA 1PH1A 1K8AC 2PI2E 4QGUA 4A3FH 1I3QH 3CCQA 1NY4A 2YTVA 3K7AH 3RLOA 4LFBL 1PYSB 4LFCQ 2YTYA 3H3VI 4L5TA 4BBSH 1VQIA 3PO2H 2KCMA 2NVTH 3ICEA 3TRZA 4YHHL 4GNXB 1B70B 4DR2L 4DR1L 1VQNA 4A3JG 4DUYQ 2VW9A 2I5MX 3NEMA 4GS3A 5LMUQ 3GTQH 3I4MG 4GLXA 1WYDA 1LM0A 2DUDA 4KHZA 4PZ7A 3F2CA 1YNXA 2K4KA 3SGIA 4DV0Q 3KLWA 3UDIA 4A3KH 4A93G 2UXCL 1KL9A 5IT9c 5C0XJ 1M1KC 1VQ7A 1N34L 3PO3H 1C7YA 1P8LA 1PFSA 3OTOL 3F2BA 1I94L 4DAMA 3M4QA 2F52A 3CCRA 3PSIA 4A3IH 4YWMA 2OCEA 4Y7NH 4RMFA 1R9TH 2D0OA 1N33L 1PH6A 2AMCB 5H1SE 1EUJA 4XTCS 4DV3L 3G6EA 2UUBL 2JA8G 2WFWA 5GAEC 3PUXA 2Q2TA 3KF6B 4YHHQ 4GKJL 4DR2Q 4DR1Q 1EWIA 2LXKA 2ZJPA 2UUCQ 4NXMQ 3RR5A 4AYBG 3S14H 2N78A 2OTLA 5AJ3L 1XNQL 2C35B 3T1YQ 3L2PA 3GO5A 3M3YH 4BY1G 4A3EH 3KYHC 2OWOA 1BVSA 1XMOL 2R6GA 4UP7A 3ZJYC 1V1QA 3OTOQ 1WCMG 1NE3A 3PGZA 4FDBA 4KLKA 4JI8L 1X54A 2PMZE 4POGA 1EOVA 1ASZA 4JYAL 3HOXH 3GTGH 2ASBA 4A3GH 2NN6G 4AYBE 1N33Q 2I0QA 3M9BA 1VQ8A 4HIKA 1PH3A 4IFDJ 2WAQG 1HR0W 4JI5Q 1TWHH 5BR8L 1EQQA 3L0OA 4BBRG 4B3MQ 4BY7H 4GKJQ 1OXXK 2LXJA 3ULPA 1PH4A 4IPCA 2FXQA 3CCEA 3HOVG 4DV2L 1XNQQ 4OX9Q 4DPGA 1D8LA 3KOJA 5M3FG 1Q81C 1JMCA 2GVAA 2V1CC 4LF7L 5M3MG 3F8TA 4L5SA 2CKZB 5C0XI 2EQSA 2WAQE 1Y1WG 4LUOA 4JI8Q 4LNQA 4P72A 3H0GG 1K3RA 1VQGA 4O0AA 3S2HH 2K75A 1KAWA 2UXDL 3STBC 3I55A 2A1AA 3PIPA 4DKAC 5FJ8G 1PYBA 3JAMc 1NMFA 2ZTEA 4JCVE 3PF5A 1AE2A 3E9IA 4DV7L 2D0PA 3CF5A 1YJ9A 4A76A 3U50C 1JB7A 3PUZA 3CD6A 1N8RC 4A3JH 1X56A 2K50A 1VQCA 4IJHA 2IHFA 1QVGA 1NMGA 3W5OA 3I4MH 4HJ9A 3S1RH 4JI7Q 4A93H 3GD7A 4JG2A 3CCJA 4YCWA 4C3IH 1SN8A 1J6QA 1E24A 3CPFA 1RL2A 2ZJRA 4DV1L 4DV4Q 4A3BG 4DR7L 4LW1A 1Q12A 1FJGQ 4NXNL 4P71A 2NZHA 2E5LQ 4LF5Q 5JJKA 1Q46A 3RLFA 1XPUA 1HZBA 4DR3L 4GNXC 2DGYA 3I4OA 4OWWB 2L15A 3HOWG 3G48A 3I7FA 2JA8H 3UDGA 3H15A 4GOPC 2B63G 4DK3C 4KHPL 4TQUS 3L7ZC 2JK8A 1SROA 3U4ZA 3BZCA 1E7ZA 1XMQL 3B6YA 2VQEL 2N49A 1BKBA 3KFUA 4H02A 1JJCB 2MFIA 4BY1H 1E1OA 4PZ6A 3S17H 1X3FA 4R4TA 4YWKA 3FKIG 2ZM6Q 1VQJA 4DV1Q 1YJWA 1WCMH 1OXVA 3NENA 4PG3A 4UPAA 5FLMH 1X9NA 4IPHA 2JA5G
chains in the Genus database with same CATH superfamily
3F2UA 3UE1A 3U9SA 2NN6H 1AN8A 1Q7YC 4Y52H 1STNA 1F77A 4A3IB 2ES2A 5ELCA 2JE6I 4KHPQ 1GM5A 1BF4A 4R9WA 1SNDA 1JCKB 3WOEA 5M3FH 1YHBA 4JI2L 2OF1A 3E6ZX 1GXDC 2V4DA 2Z6BA 1F2ZA 4JI1Q 3D31A 1QUQA 2KA7A 3CCVA 1C48A 5C4XG 2Z4HA 1VF7A 2VZAA 3K5NA 4K5VA 1F9PA 2JA6G 2E76C 5LL6X 2XWBB 1LACA 4DXFA 4GLVB 3C1EA 2MGSA 3S1NH 4ID6A 4TKOB 3RUZA 5C3EB 4MTNA 2NTTA 2L11A 4A3CG 1LT3D 1E0BA 3CQZH 4C3JH 4LUVA 4QUFA 1T5XD 1PLFA 2VUMH 1WTQA 2EDGA 5C0XG 2D9UA 5IGFA 3K81C 2CCZA 3UE0A 1CA6A 1D6EC 1BR9A 1B53A 1SMXA 4KKSA 1W2BA 2DY8A 1PDQA 1TQOA 4OXPA 1QOHA 5CGKA 4JBWA 4V0BA 3S1QH 1GUSA 3K59A 4QQBX 1B9MA 1OXTA 4ZK9B 3IRBA 1U5KA 4MTKA 1EU4A 4KKTA 2CQAA 3AEVA 4MZ9A 2UUBQ 2ICIA 1PTOB 5KNBA 1FD7D 1H9MA 2B2WC 2E2JB 5CYUA 2EY5A 2QGQA 1UE5A 3CAMA 5M5WH 1I4RA 1A2UA 1ENCA 1B44D 2EIFA 4LK1C 3GTMH 1TWFB 3W3AA 1NBWA 1N36L 5IYDG 3CCMA 1KHIA 2SNMA 5IP9H 2EY2A 5ELEA 3WWVA 2K04A 4AYBB 1C8CA 1RHPA 2B39A 4BY1B 5C44B 4DR4L 3S17B 1KIXA 1X3EA 1WCMB 3A54A 3SK5A 2F0NA 2IWHA 4DGZA 3H91A 1V9PA 1CZGA 2AQ2B 4V190 1K8OA 1IBML 1EIFA 4DAYA 1EY4A 4J1MA 5GROA 2OEOA 3NUCA 5ELBA 2UXDQ 1PH2A 3LNNA 3GTPH 1GUNA 2F0PA 2YV5A 4X66L 4OIJA 3MFYA 4IFDI 5ELOA 2R93H 3JC66 1IL8A 4HCSA 2BA0A 1P16A 3RZOH 3RNUA 1MSGA 1YNND 5CV8A 3SEBA 3HOYG 3RD4A 4HCEA 5CC4A 2K5NA 3QO2A 1YNJD 4OO1I 2JA9A 3CCSA 5NUCA 1IBMQ 3DEOA 1S40A 3OWEB 3URYA 3LX0A 4NXNQ 3CC7A 4N9PA 2Z8LA 4DAPA 4DR3Q 4K0KL 3J81c 3VR6A 1K83B 4KJOA 1FL0A 1H9SA 4Y7NB 4FXDA 3X3MA 1LTSD 4QCLA 2DNEA 5IGGA 1YIJA 3TP8A 1MGSA 1TXYA 4NKLA 3TS0A 4A3BB 2BA1A 5D65A 1YHQA 1IXRA 5FLXc 2MO0A 1AZPA 1PMRA 1MBYA 1EYGA 3TQYA 4ME3A 1T9HA 2G5DA 3S1MH 1B50A 3TZUA 3BDCA 1O78A 5E4WC 1FNVA 5I2YA 2A69D 4DU9A 1VQPA 3I4NG 3RZDH 2JA5B 1V1PB 1TWCH 2R7ZG 2WB1B 1WTPA 1DOKA 1PTOF 2UUCL 3FRPB 4OGQC 2IT1A 3IKJA 3T1YL 3EROA 4HEDA 3H3VH 2KENA 4DR5L 2NB0A 2KOLA 1N32L 1LUZA 1DCZA 1ML0D 1PRTD 1QZGA 1IKLA 1AE3A 2PO4A 4R4CA 3EIVA 3K0YA 4RGTA 2HUGA 3M7GA 3A8KE 1Q3LA 4OX9L 1F2LA 3M4OH 1U0LA 1DGSA 1GD7A 1EY5A 3X3NA 2R92B 5GADC 2KHIA 2NVYH 4DR5Q 1VQLA 4H13C 3MA2B 1N32Q 3HKZB 1DM0B 5CV4A 1U4PA 3W1GA 5DLQE 3GP7A 4KJNA 2HT1A 4ME5A 3J81i 1Q8KA 2VQFL 3SR1A 4N9TA 1WJJA 4HMJA 5C4ZA 5C6AA 1BBXC 1H9JA 4RGNA 3I8ZA 3Q23A 3I4LA 2NVXH 4CJ1B 5IP7H 4DV4L 3VR2A 3S15H 4XT3B 2WAQB 2DNCA 3AQQA 2E5LL 2EXDA 1A3TA 3KK7A 1G291 3H09A 3EQLC 1XJVA 4G7OC 2VQFQ 1EIYB 3IFTA 1Z7TA 2IX0A 4A3IG 1SBBB 3AMUA 1BCPC 1TWGH 2QKIC 1Y1VH 1E3PA 2KUMA 4ALPA 4F88A 4MNOA 1PHJA 2IX1A 1VQ6A 2VUMG 2BH2A 2EVBA 3RLNA 2L5TA 1W3SA 1STHA 5JEAJ 2MQHA 4JI4Q 5TSSA 1PV4A 4A3EG 1N9WA 2KBNA 5IGDA 2L1BA 4LAAA 4JI6L 1DYQA 2RSOA 5I2XA 2JQOA 2AKWB 1HFGA 3CRLC 1I4HA 3HS0C 3MXUA 2B29A 1ZEQX 2CFMA 1MJCA 2NZOA 2G9HD 1HJPA 3CRKC 4ZYSA 4ZAIA 4BY7G 2A74C 1D5ZC 4I7ZC 3GV3A 2F03A 2PZTA 1B3AA 3G7LA 3CC2A 2EJFC 1GKHA 2RA4A 1G8ZD 1EU3A 1II3A 4JI6Q 1HNXQ 4L5RC 2LY7A 4G57A 1EY7A 1ICFB 3MZ5A 1I3QH 4CDEC 3CU7A 2RKSA 2YTYA 3G6JB 1VQIA 4KMUC 2ZXRA 2KCMA 2NVTH 2EYJA 4ODGA 4GNXB 2VW9A 3GTQH 3ERQA 1KDAA 5A35A 5LMUQ 4O42A 4OEMB 3LWUA 1WYDA 1WTRA 2F0KA 2B2VC 4DV0Q 3UDIA 1VQ7A 3OTOL 3F2BA 2F0FA 4DAMA 3CCRA 2YU9B 3PSIA 4YWMA 3QIAA 1HUNA 3D4WA 3E3XA 3ND8A 4NDXA 5H1SE 3G6EA 2KHSA 3PUXA 2IJ0A 2Q2TA 2Y0SB 2JA6B 3RR5A 4AYBG 2OTLA 1NCVA 5AJ3L 1KDBA 3GO5A 4BY1G 1BVSA 1PRTB 3K5OA 4UP7A 3ZJYC 1V1QA 3OTOQ 1WCMG 1NE3A 3PGZA 3C3LA 1F9QA 4JI8L 3S2DB 1EOVA 3HOXH 1SYEA 4A3GH 1KNEA 1AFPA 3BDOA 1UEAB 5I9PA 1PH3A 4IFDJ 4JI5Q 5BR8L 2RDGA 3NP8A 5CBAE 2F0WA 1PH4A 2FXQA 3MHBA 3CCEA 4LF7L 1HXYD 5M3MG 3IL8A 5C0XI 2WAQE 3W2DA 4LUOA 4JI8Q 4P72A 2VXWA 4ZUIA 3JAMc 3E9IA 5E1FA 4ULLA 3R8BA 3PUZA 3CD6A 4IJHA 3I4MH 2KEEA 5JPMC 1G91A 2QDLA 4A93H 3GD7A 1JORA 2MUYA 4C3IH 1JB3A 2QF7A 4A3BG 4DR7L 2WKCA 3MXPA 1FJGQ 3RLFA 1F9RA 4HSPA 4M8AA 3G48A 2JA8H 3PIP3 3H15A 4DK3C 2ENBA 2F0TA 3PO2B 3QR8A 4KHVA 1EEID 2IL8A 1JJCB 2MFIA 4ZQ3A 2LS01 4B9XA 4PZ6A 1VQJA 3QB3A 1U4RA 3NENA 3SXHA 5L37A 1X9NA 2B2TC 2JA5G 1X3QA 3MXNB 5DM63 2F4VQ 2A68C 4JVZA 5GAGC 3VA7A 4RKLA 3I56A 3HOYB 1QILA 1B9NA 2JP1A 4GN5A 3HOVH 1LTAD 3K0XA 3TBIB 2HDMA 4X62Q 4GOPA 2A6HD 4EQOA 5IE8A 4CJ2C 4POFA 4JI3Q 4U68A 3S14B 4L6TB 1GO3E 1PYWD 4WORA 5C4HA 1Y1WH 2WV6D 1RDPD 4C1NK 4LF4Q 1G6ZA 4XT1B 2JXMB 3CKIB 3O13A 2F3WA 5FJ8H 2PI2A 1O80A 2WP8J 3LGJA 3I70A 1XTDA 2B2UC 4HAEA 3MEHA 3GTGB 4BS9A 2L4NA 2UU9L 5IP7G 1QUQB 1PRTF 4NB3A 4CKEA 2XRQD 2K52A 2R92G 4LFBQ 1HNWL 3QOJA 1WVLA 2LSSA 2N3SA 2Q2UA 4RWSC 1NR4A 3C2PA 3HKZG 3S16B 3MEFA 2EJGC 1YI2A 3GTLB 4IOAA 1G51A 3DMUA 3NQIA 4AQYL 2MNAA 4QF4A 4Z9CB 1KDCA 1Q90A 4IOCA 5CV9A 1S72A 1Y1VG 2UXCQ 1AW7A 3HOWH 2EOTA 3DUZA 5M5YH 3CC4A 2A6EC 1HNZL 2UU9Q 1N34Q 2PNRC 3KBXA 5JJZA 4JI0L 2B63H 3EBEA 3NPPA 4H7BA 1CSPA 4CDFC 2J0TD 1HNWQ 2PZUA 2CW0D 1WTVA 1PH5A 1BNZA 4WJ4A 1CT1D 5KNCA 1X32A 3DM1A 4QMGA 2CWPA 3ER0A 2KECA 2NVQB 2HQLA 3SK8A 4A4IA 2JA7H 3GDEA 4C3HG 4E6IA 1NJIC 1GOZA 2KHJA 1VQDA 1I50B 4OONA 3CCUA 3I90A 2PMZB 1PH7A 5IYBH 2HDLA 1J8IA 3K5LA 4DUZL 1ESFA 1LTTD 1FNWA 3I73A 2CH4W 1JICA 1PVOA 2MHVA 3CMAA 4P74A 1LYLA 1H95A 3PUVA 1B2TA 3NWSA 1YITA 2FFKB 1NAPA 3VR4A 1XNRL 1L1OA 3J81j 3HG9A 2IHEA 1WD0A 1TS2A 3J80E 1K9MC 4DUZQ 5M3FB 2LKVA 4DAYB 1NTGA 3KDFB 4DV6L 1TIID 2XRSD 5IYCH 1VQBA 4LF9L 3FHWA 2QA4A 3T1HL 3KLSA 2M9VA 5I9OA 3VYUA 5K36G 1CZWA 4C56C 1YJNA 4I7AA 3J80L 1Q82C 1KTKA 4JC0A 1EWHA 5BN4A 1C4QA 3KJPA 2VS1A 1UWVA 1S5BD 2GVBA 4KN4C 2F0VA 1Z9FA 3ULLA 3RN5A 4DV6Q 1R9TB 4RHRA 3HOXG 3VYRA 1SJHD 4C3JB 4LF9Q 1EQRA 3CHBD 2VUMB 2IW3A 4LFCL 4HJ5A 1Y8NB 3R93A 1H9SB 1B8AA 3BVGA 1PZJD 1XWEA 1PTOC 1Q1BA 4A3EB 1PZID 3S1QB 1VMCA 1SMYC 2Y0SG 2Z1CA 4IO9A 1KABA 4G7ZC 1QB5D 5BN3A 2GN5A 3TEHB 4PNYA 3C46A 1XXGA 4A3LH 4BY7B 4JI2Q 2L55A 4XDXA 3OMGA 2Z6KC 1XYIA 2JEBI 3N6RA 2OXPA 4C2MH 4A3MH 4R4QA 2EYOA 2OTJA 3FVQA 4AIMA 2K32A 3NBIA 2WKDA 1E1TA 3D6WA 1CI3M 2B8GA 4JOIC 4N8FA 1S5CD 4DFAA 4BXXH 1QE6A 2X6GA 3U58A 3MWYW 3J7AF 1PA6A 3PCOB 2F4IA 2DY7A 4O2DA 1HTLD 2KCTA 5JEAH 4B3ML 4O1NA 2HCIA 5EKLA 1VS0A 3BU2A 2RCNA 3CMEA 1YBYA 2ZJQA 1VQMA 3HOZH 3HOUH 3FMCA 3GTPB 3FP9A 4NMZA 1VQFA 3TN2A 1EZ6A 4EQ5A 2JN4A 3PUWA 4OWXB 5BN5A 2MPMA 2J7ZA 1Y8OB 3H94A 4QIWB 3BZDB 3NHHA 3RZOB 2BDNA 4IPDA 1RIPA 2ATWA 5C3EH 2BE5C 1CHPD 3T51B 1C9OA 2R7FA 4EVOA 4A3DH 3A5ZB 4A3FG 1HHVA 3OSOA 5E7NA 4DR6L 2CWAA 2YYZA 4JI7L 3UDFA 3PO2G 2RDFA 4WFN3 1X55A 3KDFA 5DNFA 1BBWA 2C9OA 1H9RA 1N36Q 2F0LA 2TMPA 3D6CA 3TS2A 3N52A 4A3KG 3SK4A 3TREA 3MFGA 2CQOA 4CJ0B 3PO3G 2XN9C 3TZDA 1UE6A 2L0CA 4NW2A 1U9RA 5M3MB 3E9HA 4DR4Q 3A74A 4DR6Q 4H44C 2EYLA 1HPCA 2AWNA 4KTAA 2RHQB 4GN4B 4KD4A 1MI2A 4LWCA 2E2JH 4LFAL 3TP6A 1M4VA 2VNUD 1IYUA 5IWAL 1HUMA 4TVAB 1CQFA 3L9AX 3I91A 4JBJA 4HJ8A 1TWFH 2E8GA 4X66Q 3KF8A 3S1MB 1UE1A 5M5XH 1O7IA 4IJLA 1H9KA 1VDZA 2ICEC 1EQTA 4FF3A 3GQBA 3RZDB 2SEBD 4X3SA 1DONA 1TWCB 3UI2A 4LFAQ 3AYHB 3SDZA 5C44H 2ALYB 5IWAQ 2XNAC 1HTPA 3EFXD 4IFDH 2DJFC 5LMNL 1BDOA 3I3CA 1IHZA 2MO1A 4JBMA 1YVCA 4DV5L 2CHBD 3NQTA 2B2YC 2DN8A 4X3TA 4HIMA 4K0KQ 1JQYD 2BCOA 1ZYRC 4OO1H 1D5XC 1Y14B 1QVCA 1PH1A 3NTKA 4UAIA 3K7AH 3RLOA 1QJOA 2Q8TA 3H3VI 5CV7A 1XTCD 1LTGD 5D14A 4BBSH 3D4RA 1QWYA 2LFNA 3ICEA 3TRZA 4YHHL 3M4OB 5J1ZA 4OELB 4RCOA 3NEMA 4IUTA 1TY0A 2NVYB 1SYDA 4GLXA 2DUDA 4PZ7A 2K4KA 2WIIB 3EVQA 1KL9A 1SNPA 1P8LA 1PFSA 3KBGA 1I94L 3M4QA 2F52A 1LT6D 3T13A 3RMHA 4Y7NH 4EQNA 3Q24A 1IW7C 1N33L 1O7LA 4DV3L 1KAAA 2WFWA 5GAEC 3KF6B 4YHHQ 1EWIA 2UUCQ 1XNQL 2C35B 3T1YQ 2J4XA 3M3YH 1HA5A 3MTSA 2OWOA 3KYHC 3S15B 1XMOL 2R6GA 4J6HA 5CBEE 4POGA 4DK1A 4JYAL 4DK0A 2PYKA 3R2IA 2K6AA 4PMCA 2NN6G 4AYBE 1N33Q 3M9BA 1VQ8A 1TWHH 2ZXOA 5IGEA 1OXXK 2LXJA 3ULPA 1TWGB 2X6LA 4HN7A 1I4XA 1Y1VB 1YNNC 4U673 4DV2L 1XNQQ 4OX9Q 4DPGA 3K58A 5M3FG 1JMCA 1YNJC 1HA6A 4LJZC 4X3UA 2CKZB 5JVH3 3HGBA 1VQGA 3FDTA 4XYQA 3S2HH 1KAWA 2MJ8A 1HQRD 1NMFA 2ZTEA 3PF5A 3MC0B 4DV7L 1EY0A 1YJ9A 4J8QA 3TDQA 2WINB 1JE4A 4A3JH 5EKIA 4C3HB 3Q22A 3QOLA 2B2WA 2IHFA 4HJ9A 1ICWA 4Q5VA 5AFWA 3S1RH 1CFMA 4C3JG 1PFBA 1SAPA 3CPFA 3T56B 4DV1L 1RL2A 4ZKBB 4K5WA 4DV4Q 2E5LQ 1ENFA 1NUCA 2LMCB 1HZBA 4GNXC 2DGYA 4TSSA 1SXTA 1ILPA 4HTHA 1I3QB 5FK9C 1QCBD 1SFOB 3K5MA 1TS4A 4GOPC 4FO2A 1SROA 2EE1A 2NVTB 2PW7A 1XMQL 2VQEL 2A69C 4QUCA 2EYPA 4EGVA 4YWKA 3GTQB 1R4QB 4DV1Q 1B1ZA 2E75C 5FLMH 1L0XB 2Q2HA 2K5VA 4L8JA 1VQOA 1FYCA 2HIXA 4KI0A 4F87A 1QVFA 4BBRH 2BDOA 3KJOA 1PRTC 2VQEQ 1WOCA 1S4ZA 1K8MA 2WB1E 2FMCA 5IP9G 3A0JA 4A3DG 3BYTB 3OOCA 3H0GH 4YY3L 2K5QA 2FHTA 5J39A 2O4XA 4MIUA 3CP0A 1TS3A 4IQZA 4ZUJA 4GOPB 2K33A 5HGTA 3A5UA 3HOXB 3ULJA 3KF6A 2QEXA 2IPKD 5JVG3 5G3LD 2A73B 5C5MA 4X6AH 4JW0A 5HURA 4YCVA 4APVA 2R93G 4K2LA 2BH8A 4PZ8A 4LF6L 4JPBW 3KLSX 1YZ6A 5GQOA 1GJXA 4OL7A 1S5DD 4RH6A 3DHQA 1NNXA 5EPKA 2R7DA 3OPOA 1Q86C 4C1NI 1BBUA 3HKZE 5IOCA 3A8IE 1C0AA 1G6PA 2AWOA 1IBLL 5HGQA 1KQSA 1UAPA 1DZ1A 1E2VA 3H6MA 1EYDA 4PMWA 4LF6Q 1OTCA 1EFID 3FKIH 3I4MB 3J7A5 4UP8A 1LTLA 3KUPA 3A55A 1L0YB 4A93B 5AJ3Q 4EQPA 3TMEA 1K0SA 5C4JB 1K73C 1TY2A 1B3QA 1B7YB 1I6HH 1WTWA 1FGUA 4FYDA 4FXGC 1MIUA 2L12A 5KYIA 1UE7A 4LMQD 4IUPA 2SOBA 5I6WA 4CKBA 2OQ0A 1SJED 5BR8Q 2F0MA 3KLRA 1X6OA 3D4DA 5IGCA 5C4XH 3AFPA 1QZHA 2UXBL 5LMNW 2PZWA 1T5EA 4LF7Q 4BA1I 1GHJA 2JA6H 1D1IA 4CKCA 1HFNA 1VCIA 1EEFD 1S5ED 2G9DA 4F8MA 3NELA 3EN2A 4R4OA 1LT5D 3BZKA 3SK6A 4IUQA 3T16A 5CR3A 4A3CH 3GTOH 3HOVB 1TS5A 3S2DH 1BUVT 1J5EL 4NPSA 3Q8DA 4A3FB 1KRTA 5C0XH 1YHAA 3TP7A 1OXUA 1HR0L 1L2FA 1ILQA 1TWAH 4X65L 2A5HA 1L1OB 4OWTB 4DAVA 5EPJA 1SEBD 1I4GA 2SNSA 1IYJB 4DR7Q 3DWQA 1J9OA 4A3KB 2JEAI 2XWJB 2YTXA 3STBD 1G2SA 1PFMA 3PO3B 1KD1C 4GN3B 3J80c 4P75A 1LT4D 1HRJA 1STYA 4XQQA 5J3BA 4KD3A 1BCPF 2XTIA 2A8VA 2VB2X 3WOFA 2KCNA 4RGMA 2RF4A 3NK9A 2O5IC 4K8JA 4KY5A 5EBCA 1KXLA 2EY6A 4MN3A 5FOBB 2PNHA 4DUYL 1A8VA 3MVVA 3RN2A 5IYDH 5M5YB 3R3OA 2B63B 2MP1A 2RDHA 3MXGA 3P7JA 4RAUC 1ET9A 3FPUB 4DXGA 2PPBC 3PQIA 1I5FA 1DD2A 1ASYA 2K05A 3K8AA 2Y0SE 3JAMi 1V1OA 4LF8L 1XX8A 3D3RA 5ELDA 4NXML 4KN7C 5ELNA 5JJLA 3GTJH 4XIGS 3L3OC 4IZ8A 1AH9A 4B9WA 1Y69U 1SE2A 3HOYH 1O7ZA 2VY3A 2ID0A 1W6JA 2OT2A 4KV6A 4CGYB 1HH2P 4QY7A 4LF8Q 3PIOA 2Q8RE 3OYYA 4AQYQ 2D2CC 1IL2A 4K2KA 1ET6A 3PUYA 3GTKH 4FF4A 3NTHA 2EPBA 1GUWA 1CA5A 4P2CB 1HNZQ 2D5DA 1CTMA 1MD2D 1STBA 4JI0Q 2B2VA 5FLMG 1JWUD 2F0SA 1D1KA 2F0JA 4X3KA 2EJMA 1YEZA 4QB4A 4K6DA 5DM73 1OO9B 3VR5A 3BS1A 4NP5A 1IBKL 2XIWA 3J80i 1SE8A 5C3WA 1RD9D 3VA5A 1A15A 4OIKA 1NSNS 3S16H 3PF4A 3GTLH 2I46A 4QJFA 1AP0A 1ESRA 1ZKOA 1CKNA 1TT2A 2E2IH 4WRDA 2QDBA 2PQAA 1EL0A 4L5QA 1SNCA 1SE3A 5CORA 3TP5A 4LF5L 2SDFA 4CDDC 1SYGA 4DA2A 2H5XA 1IBKQ 2C5CA 3I4NH 1JJGA 2AHOB 2R7ZH 4DK6C 2E2HH 2NN6I 1OXSC 2NUCA 2ZTDA 4B08A 2HIVA 1PXUA 4L63B 1RJTA 2K03A 2ZTCA 3FPPA 1VQ5A 2TSSA 1CKOA 2NVQH 1A0IA 2ZM6L 2XGTA 3UDXA 1E22A 4G4KA 2NTSA 1JT8A 3CCLA 4A75A 1XNRQ 2K5HA 1I50H 1SLJA 1JC7A 3S1NB 3MAQA 2KQ3A 1Z6HA 1JJ2A 2A19A 2O2LD 5FO8B 3E5SA 2IY5B 3DM3A 4K14A 3CQZB 4HMIA 4A3GG 4DNIA 3OIQA 4YIJA 4A3MB 1JOOA 1MJEA 3T1HQ 3KF8B 4G7HC 3S24A 2KEDA 5EGTA 1X65A 5LHY1 1QG7A 2BOSA 2F3IA 1D5MC 4R8IA 5ELFA 1Q1EA 2X69A 2RQXA 2RHSB 5IT9E 4IALA 1FNUA 5G3LF 1K8AC 4QGUA 3J7AV 1NY4A 4LFCQ 1WTOA 3BDLA 2CW0C 5M5WB 1B70B 4DR2L 1FGBD 4DR1L 1VQNA 3HOZB 5IT9L 4PMBA 2I5MX 4GS3A 3HOUB 3LWEA 4XQJA 3I4MG 4UDUC 2B2TA 3GTMB 3F2CA 2GA4B 1LTID 3KLWA 4A93G 5C0XJ 1M1KC 1GUTA 4C3IG 1C7YA 2K5DA 4A3IH 3HZXA 2RBMA 2ZXPA 4RMFA 1R9TH 2D0OA 4A3DB 1EUJA 2UUBL 2JA8G 2EXZA 1U4LA 4DR2Q 4DR1Q 1MHWC 2N78A 3BVMA 3L2PA 4A3EH 2F0IA 1ZYRD 3QJYA 1JOQA 4KLKA 3WDNA 4FNFA 2B2UA 2PMZE 1ASZA 1NR2A 2R93B 3K6OA 2ASBA 2NYZD 2I0QA 4F7XA 1HR0W 4BY7H 4B3MQ 3HOVG 1EY6A 3SE0A 4XXEA 1D8LA 3KOJA 2GVAA 1Q8IA 3F8TA 4L5SA 1Y1WG 1K3RA 4O0AA 4WJWA 1RTNA 2UXDL 4I65A 5M5XB 4XQNA 3I55A 3ZYYX 2A1AA 3PIPA 5FKAC 3R2TA 5FJ8G 1IW7D 5EPLA 1HCZA 1Y8PB 1EYCA 1JB7A 3U50C 3H3VC 4ZRZA 1N8RC 1PTOH 2K50A 4XYOA 1VQCA 1QVGA 4JI7Q 4JG2A 3CCJA 4YCWA 1SN8A 1J6QA 1E24A 1WTXA 4NXNL 1PFNA 5JJKA 5CV6A 1XPUA 1EWCA 4DR3L 3HOWG 1K3BC 3UDGA 3K7AB 2XSCA 2B63G 1SDFA 3L7ZC 2JK8A 3U4ZA 4BBSB 2EYFA 4PV1C 3B6YA 3VYTA 2M2LA 2AUKA 1BKBA 4BY1H 1E1OA 3S17H 1X3FA 4R4TA 1YJWA 1QNUA 1OXVA 1WCMH 5CV5A 3W1BA 3G4SA 4KY7A 1VF5C 5EJWA 2JA7G 1JWMD 4GKKL 2EYMA 4BWGB 5GAHC 1VQ4A 4GLAC 2DJGC 1TVXA 5KNDA 3K57A 1BCPD 1MKHA 2JSOA 5M3MH 5F2DA 3I72A 4B3TL 2K14A 4J15A 5I6YA 5IYBG 3HFZB 5LMNQ 3NSWA 3M3YB 5IY0A 5E4XA 4DV5Q 3VR3A 3QG1A 4GKKQ 2RCFA 1EQVA 4EX5A 1FVIA 2B3GA 1Z47A 1SYFA 2D62A 4AH6A 5K5PA 5JPNC 2QEJC 1TWHB 1K83H 1RF2D 4HJ7A 1EFWA 4JBKA 4B3TQ 5JAVA 2H4OA 3K7UC 3CPWA 3CW2C 1IZ6A 1VQHA 4A3BH 5KEEA 1R4PB 5IYCG 2VL6A 4RG1A 4S3SA 1VQ9A 2NVXB 3S2HB 1CM9A 3M85A 4N8X1 4UP9A 3E0JA 2FINB 1W6KA 3OW7A 1I94Q 1WTHA 3PMFA 4QIWE 5EQ0A 1EIHA 4IPGA 2OQKA 4KY6A 1PH8A 1EYAA 3AB9A 4DV3Q 4A3JB 1KC8C 5E3FA 4HJAA 1WD1A 2Z6KA 1S3OA 3S1RB 4MHEA 2JA5H 1LLRD 2EY1A 2K1BA 2EYHA 1U4MA 2Z4IA 2L9HA 1SR3A 3ND9A 5DEHA 1DOMA 4RA8A 5C3XA 2AUJD 1D7QA 1XMOQ 5C5LA 4B3RL 4JOIA 4JYAQ 3QWNA 1EY8A 1RTOA 4CDCC 3ONAB 4QL5A 4JV5L 1SSOA 5M9OA 1A3VA 3CXCA 3U4VA 5D3DA 4DV2Q 5IODA 1TU2B 4A3LG 3PIO3 2F0GA 1CKMA 1I6VC 4B3RQ 4A3MG 3A7AB 5T1IA 4FF1A 1PH9A 2F0DA 5EKKA 2R92H 3V2TA 1SYBA 4BBRB 4JV5Q 4ZKCB 4JI4L 2HD3A 4DV7Q 2HHHL 4BXXG 3J81E 1JOKA 1KNAA 3D8GA 4X64L 2CVRA 1JE5A 1BOSA 2Q2IA 1E2ZA 3S9WA 1EIGA 3H0GB 1QNKA 5JEAG 4K5XA 2CH4A 2HQEA 3J81L 4ABNA 3D0FA 5FLXE 1GUGA 5KGUA 2H1EA 1K0RA 3HOZG 5COYA 2HHHQ 1XPOA 3HOUG 4X64Q 4IUNA 1HNXL 5A2QE 4OHJA 4FXKC 1FR3A 1XMQQ 3TSSA 4JI1L 5FLXL 5JOBA 4C3HH 4DN4M 5C3EG 3Q0AA 4H0LC 1SRUA 3HKSA 2WACA 5A2QL 2NBFA 1JWSD 4LUZA 5LMUL 1IKMA 1EOTA 3F2DA 3M4PA 2KCCA 5IIFA 1LTBD 5I4DA 4DV0L 3BVZA 4BA2I 1V1PA 1BCPB 2UUAL 4A3GB 2FMMA 2KJXA 4DNRB 3NBHB 1SFOH 3FKIB 1STEA 3NE5B 2M00A 4FF2A 3E0EA 5KYLA 1MSHA 5EAYA 3ITPA 1UNSA 2ZT9C 1A63A 1STAA 4YY3Q 3OW2A 4GZYC 1GUOA 1VQAA 1X3GA 3VDYA 1I6HB 3OHXC 2A68D 4YWLA 4JK1C 2F0QA 1LV9A 5ISRA 2AQ3B 2B2YA 2K28A 2UUAQ 3I2ZA 1DOLA 1RODA 1WFQA 1VQEA 2FJ2A 2K5WA 2PQEA 3BYYB 2AQ1B 3M7NA 3K80C 1K8GA 5LL6S 5C4XB 3HP3A 4JI5L 5K36H 1HZAA 2E2DC 4FP5D 2N88A 1SNOA 4WJ3M 1DJRD 2R3ZA 4C3IB 2I5HA 2E74C 5C44G 2I5LX 1HZCA 4IFDG 1CQVA 4IUVA 2IX3A 2O5JC 1M8AA 1UEBA 3GV6A 3GTOB 3BJUA 5J22A 1KLUD 4Q0FA 1L1OC 1VMPA 1A3UA 1F2YA 4UY8C 3SHLA 1IBLQ 2JA8B 1TKWB 1B4OA 4P73A 2YU9H 1HZ9A 4OO1G 1G2TA 4FVMA 3V05A 1TWAB 2EZVA 4R4IA 3DWAA 3HRZC 3F1ZA 5KRUA 1RCVD 4HIDA 1A62A 4BBSG 1V43A 2K7VA 1WI5A 2A6ED 3PV0A 1LABA 3J7ZC 1FJGL 4R1JA 3AFQA 1CKNB 3DWPA 3P20A 3A8JE 3DEPA 2NWGA 2JJQA 2PQAB 2QCPX 1L0WA 2UXBQ 4ILWA 1CUKA 3AU7A 1Y1WB 2XVSA 5EBDA 2F0HA 4YCUA 2HCCA 1AEXA 5C4JH 1BQQT 3M4YA 2F4VL 5JJIA 4ZLTF 1CSQA 4IN3A 1J5EQ 1ENAA 2Z0SA 5IGBA 4B3SL 5HY6A 4RGOS 1VQKA 1HQMC 1HR0Q 5D3IB 1XPRA 4X62L 4X65Q 3G71A 4RCNA 1RKNA 4IUUA 1GVPA 3T53B 4R8NA 1A2TA 4JI3L 1ZXTA 2VB3X 1M90C 3DLLA 4LF4L 3NBHA 3HOWB 3GTJB 3P75A 2WB1G 3DXJC 3FEWX 2F3VA 5FO9B 1KRSA 4DNTB 4B3SQ 4HIOA 3ERSX 3OMCA 2N8NA 4HSVA 4GNXA 4IURA 1TR5A 1E2WA 2F0OA 2PI2E 1V8QA 4A3FH 1O7YA 1ONLA 3CCQA 2YTVA 1LTRD 4LFBL 1PYSB 3A56A 4L5TA 2R61A 4PQXA 3PO2H 3GTKB 1SNQA 2KVMA 2JA7B 4A3JG 4M1UB 4DUYQ 1I4PA 1BXTA 3NTIA 1LM0A 4KHZA 4A3KH 1YNXA 3SGIA 2UXCL 1LO5D 5IT9c 1GHKA 1N34L 3PO3H 4K8IA 2OCEA 3P1HA 1AZQA 1PH6A 2AMCB 4KKUA 4XTCS 4GKJL 4TRDA 2LXKA 2ZJPA 4HR7B 1SNMA 1BO0A 4NXMQ 3S14H 3EJIA 2QW7A 1EY9A 1PTOD 2E2IB 4DF7A 5T1GA 1IYVA 1SMYD 3IAYA 2P5ZX 1CHQD 3U9OA 4FDBA 1X54A 3GTGH 3I4NB 2NZ1D 3A7LA 2R7ZB 3BG3A 1EZ8A 3JAME 4HIKA 2E2HB 1F9SA 2WAQG 1EQQA 3L0OA 4BBRG 4GKJQ 3T4AC 4IPCA 1K28A 3OIPA 5DAUA 1JR0D 1Q81C 1X3PA 2V1CC 3Q6SA 2N55A 1PZKD 2EQSA 3NWTA 3JAML 2F0UA 2JYOA 3HEJA 4LNQA 3H0GG 2F1MA 2K75A 4UHVA 3IFDA 2F0EA 3STBC 4CHTB 4DKAC 1PYBA 3V96A 3VYSA 5FO7B 4JCVE 2QILA 1AE2A 2D0PA 2PCFB 3CF5A 3EA6A 4RFBA 4A76A 3OWFA 2I07B 1I4QA 1X56A 2RVLA 3SVMA 1NMGA 1SE4A 3W5OA 2A6HC 1SYCA 2PW5A 2Z9HA 5KIXA 2ZJRA 1DXMA 4LW1A 1Q12A 4P71A 2NZHA 4KK7A 4LF5Q 1Q46A 2RSNA 1KLGD 1A6XA 3I4OA 4OWWB 2L15A 3J7YW 3I7FA 4ZCKA 1D2BA 2BE5D 1CK1A 4KHPL 4TQUS 2K01A 3BZCA 3MXNA 1E7ZA 3C1FA 4K6LA 4C2MB 2N49A 3KFUA 4H02A 5CMDA 1UUPA 2B8FA 3NXWA 2Q8IB 4CBVA 4RHSA 1F2MA 1STGA 3FKIG 2ZM6Q 4PG3A 1S5FD 4UPAA 4RKBA 4IPHA
chains in the Genus database with same CATH topology
3F2UA 3UE1A 3U9SA 2NN6H 1AN8A 1Q7YC 4Y52H 1STNA 1F77A 4A3IB 2ES2A 5ELCA 2JE6I 4KHPQ 1GM5A 1BF4A 4R9WA 1SNDA 1JCKB 3WOEA 5M3FH 1YHBA 4JI2L 2OF1A 3E6ZX 1GXDC 2V4DA 1F2ZA 4JI1Q 3D31A 1QUQA 2KA7A 3CCVA 5C4XG 1C48A 2Z4HA 1VF7A 2VZAA 3K5NA 4K5VA 1F9PA 2JA6G 2E76C 5LL6X 2XWBB 1LACA 4DXFA 4GLVB 3C1EA 2MGSA 3S1NH 4ID6A 4TKOB 3RUZA 5C3EB 4MTNA 2NTTA 2L11A 4A3CG 1LT3D 1E0BA 3CQZH 4C3JH 4LUVA 4QUFA 1T5XD 1PLFA 2VUMH 1WTQA 5C0XG 2EDGA 2D9UA 5IGFA 3K81C 2CCZA 3UE0A 1CA6A 1D6EC 1SMXA 1B53A 1BR9A 4KKSA 1W2BA 2DY8A 1PDQA 1TQOA 4OXPA 1QOHA 5CGKA 4JBWA 3S1QH 4V0BA 1GUSA 3K59A 4QQBX 1B9MA 1OXTA 4ZK9B 3IRBA 1U5KA 1EU4A 4KKTA 2CQAA 3AEVA 4MZ9A 2UUBQ 2ICIA 1PTOB 5KNBA 1FD7D 1H9MA 2B2WC 2E2JB 5CYUA 2QGQA 2EY5A 1UE5A 3CAMA 5M5WH 1I4RA 1A2UA 1ENCA 2EIFA 1B44D 4LK1C 3GTMH 1TWFB 3W3AA 1NBWA 1N36L 5IYDG 3CCMA 1KHIA 2SNMA 5IP9H 2EY2A 5ELEA 3WWVA 2K04A 4AYBB 1C8CA 1RHPA 2B39A 4BY1B 5C44B 4DR4L 3S17B 1KIXA 1X3EA 1WCMB 3A54A 3SK5A 2F0NA 2IWHA 4DGZA 3H91A 1V9PA 1CZGA 2AQ2B 4V190 1K8OA 1IBML 1EIFA 4DAYA 1EY4A 4J1MA 5GROA 2OEOA 3NUCA 2UXDQ 5ELBA 1PH2A 3LNNA 3GTPH 1GUNA 2F0PA 2YV5A 4X66L 4OIJA 4IFDI 3MFYA 5ELOA 2R93H 3JC66 1IL8A 4HCSA 2BA0A 1P16A 3RZOH 3RNUA 1MSGA 1YNND 5CV8A 3HOYG 3SEBA 3RD4A 4HCEA 5CC4A 2K5NA 3QO2A 1YNJD 4OO1I 2JA9A 3CCSA 5NUCA 1IBMQ 3DEOA 1S40A 3OWEB 3URYA 3LX0A 4NXNQ 3CC7A 4N9PA 4DR3Q 2Z8LA 4DAPA 4K0KL 3J81c 3VR6A 1K83B 4KJOA 1FL0A 1H9SA 4Y7NB 4FXDA 3X3MA 1LTSD 4QCLA 2DNEA 1YIJA 5IGGA 3TP8A 1MGSA 1TXYA 3TS0A 4NKLA 4A3BB 2BA1A 5D65A 1YHQA 1IXRA 5FLXc 2MO0A 1AZPA 1PMRA 1MBYA 1EYGA 3TQYA 4ME3A 1T9HA 3S1MH 1B50A 3TZUA 3BDCA 1O78A 5E4WC 1FNVA 5I2YA 2A69D 4DU9A 1VQPA 3I4NG 3RZDH 2JA5B 1V1PB 1TWCH 2R7ZG 2WB1B 1WTPA 1DOKA 2UUCL 1PTOF 3FRPB 4OGQC 2IT1A 3IKJA 3T1YL 3EROA 4HEDA 3H3VH 2KENA 4DR5L 2NB0A 2KOLA 1N32L 1LUZA 1QZGA 1DCZA 1ML0D 1PRTD 1IKLA 1AE3A 2PO4A 4R4CA 3EIVA 3K0YA 4RGTA 2HUGA 3M7GA 3A8KE 1Q3LA 4OX9L 1F2LA 3M4OH 1U0LA 1DGSA 1GD7A 1EY5A 3X3NA 2R92B 5GADC 2KHIA 2NVYH 4DR5Q 1VQLA 4H13C 3MA2B 1N32Q 3HKZB 1DM0B 5CV4A 1U4PA 3W1GA 5DLQE 3GP7A 4KJNA 2HT1A 4ME5A 3J81i 1Q8KA 2VQFL 3SR1A 4N9TA 1WJJA 4HMJA 5C4ZA 5C6AA 1BBXC 1H9JA 4RGNA 3I8ZA 3Q23A 3I4LA 2NVXH 4CJ1B 5IP7H 4DV4L 3S15H 3VR2A 4XT3B 2WAQB 2DNCA 3AQQA 2E5LL 2EXDA 1A3TA 3KK7A 1G291 3H09A 3EQLC 1XJVA 4G7OC 2VQFQ 1EIYB 3IFTA 2IX0A 4A3IG 1Z7TA 1SBBB 3AMUA 1BCPC 1TWGH 2QKIC 1Y1VH 1E3PA 2KUMA 4ALPA 4F88A 4MNOA 1PHJA 2IX1A 1VQ6A 2VUMG 2BH2A 2EVBA 3RLNA 2L5TA 1W3SA 1STHA 5JEAJ 2MQHA 4JI4Q 5TSSA 1PV4A 4A3EG 1N9WA 2KBNA 5IGDA 2L1BA 4LAAA 4JI6L 1DYQA 2RSOA 5I2XA 2JQOA 2AKWB 1HFGA 3CRLC 1I4HA 3HS0C 3MXUA 2B29A 1ZEQX 2CFMA 1MJCA 2NZOA 2G9HD 1HJPA 3CRKC 4ZYSA 4BY7G 4ZAIA 2A74C 1D5ZC 4I7ZC 3GV3A 2F03A 2PZTA 1B3AA 3G7LA 3CC2A 2EJFC 1GKHA 2RA4A 4JI6Q 1EU3A 1G8ZD 1II3A 1HNXQ 4L5RC 2LY7A 4G57A 1EY7A 3MZ5A 1I3QH 3CU7A 2YTYA 2RKSA 3G6JB 1VQIA 4KMUC 2ZXRA 2KCMA 2NVTH 2EYJA 4GNXB 4ODGA 2VW9A 3GTQH 5LMUQ 1KDAA 3ERQA 5A35A 4O42A 3LWUA 1WYDA 1WTRA 4DV0Q 2B2VC 2F0KA 3UDIA 1VQ7A 3OTOL 3F2BA 2F0FA 4DAMA 3CCRA 2YU9B 3PSIA 4YWMA 3QIAA 1HUNA 3D4WA 3ND8A 4NDXA 5H1SE 3G6EA 2KHSA 3PUXA 2Q2TA 2IJ0A 2Y0SB 2JA6B 3RR5A 4AYBG 2OTLA 5AJ3L 1NCVA 3GO5A 1KDBA 4BY1G 1BVSA 1PRTB 3K5OA 4UP7A 3ZJYC 1V1QA 3OTOQ 1WCMG 1NE3A 3PGZA 3C3LA 1F9QA 4JI8L 3S2DB 1EOVA 3HOXH 1SYEA 4A3GH 1KNEA 1AFPA 3BDOA 1PH3A 4IFDJ 1UEAB 5I9PA 4JI5Q 5BR8L 2RDGA 3NP8A 5CBAE 2F0WA 1PH4A 2FXQA 3CCEA 3MHBA 4LF7L 5M3MG 1HXYD 3IL8A 5C0XI 2WAQE 3W2DA 4LUOA 4JI8Q 4P72A 2VXWA 4ZUIA 3JAMc 3E9IA 5E1FA 4ULLA 3R8BA 3PUZA 3CD6A 4IJHA 3I4MH 2KEEA 5JPMC 1G91A 4A93H 3GD7A 1JORA 2MUYA 4C3IH 1JB3A 2QF7A 4A3BG 4DR7L 2WKCA 3MXPA 1FJGQ 3RLFA 1F9RA 4HSPA 4M8AA 3G48A 2JA8H 3PIP3 3H15A 4DK3C 2ENBA 2F0TA 3PO2B 4KHVA 1EEID 2IL8A 1JJCB 2MFIA 4ZQ3A 2LS01 4B9XA 4PZ6A 1VQJA 3QB3A 1U4RA 3NENA 1X9NA 3SXHA 2B2TC 2JA5G 1X3QA 3MXNB 5DM63 2F4VQ 2A68C 5GAGC 3VA7A 4RKLA 3I56A 3HOYB 1QILA 1B9NA 3HOVH 4GN5A 2JP1A 1LTAD 3K0XA 3TBIB 2HDMA 4X62Q 4GOPA 2A6HD 4EQOA 5IE8A 4CJ2C 4POFA 4JI3Q 4U68A 3S14B 4L6TB 1GO3E 1PYWD 4WORA 1Y1WH 5C4HA 2WV6D 1RDPD 4C1NK 4LF4Q 1G6ZA 4XT1B 2JXMB 3CKIB 3O13A 2F3WA 5FJ8H 2PI2A 1O80A 2WP8J 3LGJA 3I70A 1XTDA 2B2UC 4HAEA 3MEHA 3GTGB 4BS9A 2L4NA 2UU9L 5IP7G 1QUQB 1PRTF 4NB3A 4CKEA 2XRQD 2K52A 2R92G 4LFBQ 1HNWL 2Q2UA 3QOJA 2LSSA 2N3SA 1WVLA 4RWSC 1NR4A 3C2PA 3HKZG 3S16B 3MEFA 1YI2A 2EJGC 3GTLB 4IOAA 1G51A 3DMUA 3NQIA 4AQYL 2MNAA 4QF4A 4Z9CB 1KDCA 1Q90A 4IOCA 5CV9A 1S72A 1Y1VG 2UXCQ 1AW7A 3HOWH 2EOTA 3DUZA 5M5YH 3CC4A 2A6EC 1HNZL 2UU9Q 1N34Q 2PNRC 3KBXA 5JJZA 4JI0L 2B63H 3EBEA 3NPPA 4H7BA 1CSPA 2J0TD 1HNWQ 2PZUA 2CW0D 1WTVA 1PH5A 1BNZA 4WJ4A 1CT1D 5KNCA 1X32A 3DM1A 4QMGA 2CWPA 3ER0A 2KECA 2NVQB 2HQLA 4A4IA 2JA7H 3SK8A 3GDEA 1NJIC 4C3HG 4E6IA 1GOZA 2KHJA 1VQDA 1I50B 4OONA 3CCUA 3I90A 2PMZB 1PH7A 5IYBH 2HDLA 1J8IA 3K5LA 4DUZL 1ESFA 1LTTD 1FNWA 3I73A 1JICA 1PVOA 2MHVA 3CMAA 4P74A 1LYLA 1H95A 3PUVA 1B2TA 3NWSA 1YITA 2FFKB 1NAPA 1XNRL 3VR4A 1L1OA 3J81j 3HG9A 2IHEA 1WD0A 1TS2A 3J80E 1K9MC 4DUZQ 5M3FB 2LKVA 4DAYB 1NTGA 3KDFB 4DV6L 1TIID 2XRSD 5IYCH 1VQBA 4LF9L 3FHWA 2QA4A 3T1HL 3KLSA 2M9VA 5K36G 3VYUA 5I9OA 1CZWA 1YJNA 4C56C 3J80L 1Q82C 1KTKA 4JC0A 1EWHA 5BN4A 1C4QA 3KJPA 2VS1A 1UWVA 1S5BD 2GVBA 4KN4C 3ULLA 1Z9FA 2F0VA 3RN5A 4DV6Q 1R9TB 4RHRA 3HOXG 3VYRA 1SJHD 4C3JB 4LF9Q 1EQRA 3CHBD 2VUMB 4LFCL 2IW3A 4HJ5A 1Y8NB 3R93A 1H9SB 1B8AA 3BVGA 1PZJD 1XWEA 1Q1BA 1PTOC 4A3EB 1PZID 3S1QB 1VMCA 1SMYC 2Y0SG 2Z1CA 4IO9A 1KABA 4G7ZC 1QB5D 5BN3A 2GN5A 3TEHB 4PNYA 3C46A 1XXGA 4A3LH 4BY7B 4JI2Q 2L55A 4XDXA 3OMGA 2Z6KC 1XYIA 2JEBI 3N6RA 2OXPA 4C2MH 4A3MH 4R4QA 2EYOA 2OTJA 3FVQA 4AIMA 2K32A 3NBIA 2WKDA 1E1TA 3D6WA 1CI3M 2B8GA 4JOIC 4DFAA 4BXXH 1S5CD 1QE6A 3U58A 2X6GA 3MWYW 3J7AF 1PA6A 3PCOB 4O2DA 2DY7A 2F4IA 1HTLD 2KCTA 5JEAH 4B3ML 4O1NA 2HCIA 5EKLA 1VS0A 3BU2A 2RCNA 3CMEA 1YBYA 2ZJQA 1VQMA 3HOZH 3HOUH 3FMCA 3GTPB 3FP9A 4NMZA 1VQFA 4EQ5A 1EZ6A 3TN2A 3PUWA 4OWXB 5BN5A 2MPMA 2J7ZA 1Y8OB 3H94A 4QIWB 3BZDB 3NHHA 3RZOB 4IPDA 2BDNA 1RIPA 2ATWA 5C3EH 2BE5C 1CHPD 3T51B 1C9OA 2R7FA 4A3DH 4EVOA 3A5ZB 4A3FG 1HHVA 5E7NA 3OSOA 4DR6L 2CWAA 2YYZA 4JI7L 3UDFA 3PO2G 2RDFA 4WFN3 1X55A 3KDFA 5DNFA 1BBWA 2C9OA 1N36Q 1H9RA 2F0LA 2TMPA 3D6CA 3TS2A 3N52A 4A3KG 3SK4A 3TREA 3MFGA 2CQOA 4CJ0B 3PO3G 2XN9C 3TZDA 1UE6A 2L0CA 4NW2A 1U9RA 5M3MB 3E9HA 4DR4Q 3A74A 4DR6Q 4H44C 2EYLA 1HPCA 2AWNA 2E2JH 2RHQB 4GN4B 4LWCA 1MI2A 4KD4A 4LFAL 4KTAA 3TP6A 1M4VA 2VNUD 1IYUA 5IWAL 1HUMA 4TVAB 1CQFA 3L9AX 4JBJA 3I91A 4HJ8A 1TWFH 2E8GA 4X66Q 3KF8A 3S1MB 1UE1A 5M5XH 1O7IA 4IJLA 1H9KA 1VDZA 2ICEC 1EQTA 4FF3A 3GQBA 3RZDB 2SEBD 4X3SA 1DONA 1TWCB 3UI2A 4LFAQ 3AYHB 3SDZA 5C44H 2ALYB 5IWAQ 2XNAC 1HTPA 3EFXD 4IFDH 5LMNL 1BDOA 3I3CA 1IHZA 2MO1A 4JBMA 1YVCA 4DV5L 2CHBD 3NQTA 2B2YC 2DN8A 4X3TA 4HIMA 4K0KQ 1JQYD 2BCOA 1ZYRC 4OO1H 1D5XC 1Y14B 1QVCA 1PH1A 3NTKA 4UAIA 3K7AH 3RLOA 1QJOA 2Q8TA 3H3VI 5CV7A 1XTCD 1LTGD 5D14A 4BBSH 3D4RA 1QWYA 3ICEA 2LFNA 3TRZA 4YHHL 3M4OB 5J1ZA 4RCOA 3NEMA 4IUTA 1TY0A 2NVYB 1SYDA 4GLXA 2DUDA 4PZ7A 2K4KA 2WIIB 3EVQA 1KL9A 1SNPA 1P8LA 1PFSA 1I94L 3KBGA 3M4QA 2F52A 1LT6D 3T13A 3RMHA 4Y7NH 4EQNA 3Q24A 1N33L 1IW7C 1O7LA 4DV3L 1KAAA 2WFWA 5GAEC 3KF6B 4YHHQ 1EWIA 2UUCQ 1XNQL 2C35B 3T1YQ 3M3YH 2J4XA 1HA5A 3MTSA 2OWOA 3KYHC 3S15B 1XMOL 2R6GA 4J6HA 4POGA 5CBEE 4DK1A 4JYAL 4DK0A 2PYKA 3R2IA 2K6AA 4PMCA 2NN6G 4AYBE 1N33Q 3M9BA 1VQ8A 1TWHH 2ZXOA 5IGEA 1OXXK 2LXJA 3ULPA 1TWGB 2X6LA 4HN7A 1I4XA 1Y1VB 1YNNC 4DV2L 4U673 1XNQQ 4OX9Q 4DPGA 5M3FG 3K58A 1JMCA 1YNJC 1HA6A 4LJZC 4X3UA 2CKZB 5JVH3 3HGBA 1VQGA 3S2HH 3FDTA 4XYQA 1KAWA 2MJ8A 1HQRD 1NMFA 2ZTEA 3PF5A 3MC0B 4DV7L 1YJ9A 1EY0A 4J8QA 3TDQA 2WINB 1JE4A 4A3JH 5EKIA 4C3HB 3Q22A 3QOLA 2B2WA 2IHFA 4HJ9A 1ICWA 3S1RH 5AFWA 4Q5VA 1CFMA 4C3JG 1PFBA 3CPFA 4DV1L 1SAPA 3T56B 1RL2A 4DV4Q 4K5WA 4ZKBB 2E5LQ 1ENFA 1NUCA 2LMCB 1HZBA 4GNXC 2DGYA 4TSSA 1SXTA 1ILPA 4HTHA 1I3QB 5FK9C 1QCBD 1SFOB 3K5MA 1TS4A 4GOPC 4FO2A 1SROA 2EE1A 2NVTB 2PW7A 1XMQL 2VQEL 2A69C 4QUCA 2EYPA 4EGVA 4YWKA 3GTQB 4DV1Q 1R4QB 1B1ZA 5FLMH 2E75C 1L0XB 2Q2HA 2K5VA 4L8JA 1VQOA 1FYCA 2HIXA 4KI0A 4F87A 1QVFA 4BBRH 2BDOA 3KJOA 2VQEQ 1PRTC 1WOCA 1S4ZA 1K8MA 2WB1E 5IP9G 2FMCA 3A0JA 4A3DG 3BYTB 3OOCA 3H0GH 4YY3L 2K5QA 2FHTA 5J39A 2O4XA 4MIUA 3CP0A 1TS3A 4IQZA 4GOPB 4ZUJA 2K33A 5HGTA 3A5UA 3HOXB 3ULJA 3KF6A 2QEXA 2IPKD 5JVG3 5G3LD 4X6AH 2A73B 5C5MA 5HURA 4YCVA 4APVA 2R93G 4PZ8A 2BH8A 4K2LA 4LF6L 3KLSX 1YZ6A 5GQOA 1GJXA 4OL7A 1S5DD 4RH6A 3DHQA 5EPKA 2R7DA 3OPOA 1Q86C 4C1NI 1BBUA 3HKZE 5IOCA 3A8IE 1C0AA 1G6PA 2AWOA 1IBLL 5HGQA 1KQSA 1UAPA 1DZ1A 1E2VA 3H6MA 1EYDA 4PMWA 4LF6Q 1OTCA 1EFID 3FKIH 3I4MB 3J7A5 4UP8A 1LTLA 3KUPA 3A55A 1L0YB 4A93B 5AJ3Q 4EQPA 3TMEA 1K73C 5C4JB 1TY2A 1B7YB 1I6HH 1WTWA 1FGUA 4FYDA 4FXGC 1MIUA 2L12A 5KYIA 1UE7A 4LMQD 4IUPA 2SOBA 5I6WA 4CKBA 2OQ0A 1SJED 5BR8Q 2F0MA 3KLRA 1X6OA 3D4DA 5IGCA 5C4XH 3AFPA 1QZHA 2UXBL 5LMNW 2PZWA 1T5EA 4LF7Q 4BA1I 1GHJA 2JA6H 1D1IA 4CKCA 1HFNA 1VCIA 1EEFD 1S5ED 2G9DA 4F8MA 3NELA 3EN2A 4R4OA 1LT5D 3BZKA 3SK6A 4IUQA 3T16A 5CR3A 4A3CH 3GTOH 3S2DH 1TS5A 3HOVB 1BUVT 1J5EL 4NPSA 3Q8DA 4A3FB 1KRTA 5C0XH 1YHAA 3TP7A 1OXUA 1HR0L 1L2FA 1ILQA 1TWAH 4X65L 2A5HA 1L1OB 4OWTB 4DAVA 5EPJA 1SEBD 1I4GA 2SNSA 1IYJB 4DR7Q 2JEAI 1J9OA 3DWQA 4A3KB 2XWJB 2YTXA 3STBD 1G2SA 1PFMA 3PO3B 1KD1C 4GN3B 3J80c 4P75A 1LT4D 1HRJA 1STYA 4XQQA 5J3BA 4KD3A 1BCPF 2XTIA 2A8VA 2VB2X 3WOFA 2KCNA 4RGMA 2RF4A 3NK9A 2O5IC 4K8JA 4KY5A 1KXLA 5EBCA 2EY6A 4MN3A 5FOBB 2PNHA 4DUYL 1A8VA 3RN2A 3MVVA 5IYDH 5M5YB 3R3OA 2B63B 2MP1A 2RDHA 3MXGA 3P7JA 4RAUC 1ET9A 3FPUB 4DXGA 2PPBC 1I5FA 1DD2A 1ASYA 2K05A 3K8AA 2Y0SE 3JAMi 1V1OA 4LF8L 1XX8A 3D3RA 5ELDA 4NXML 4KN7C 5ELNA 5JJLA 3GTJH 4XIGS 3L3OC 4IZ8A 1AH9A 4B9WA 1Y69U 1SE2A 3HOYH 1O7ZA 2VY3A 2ID0A 1W6JA 2OT2A 4KV6A 4CGYB 1HH2P 4QY7A 4LF8Q 3PIOA 2Q8RE 3OYYA 4AQYQ 1IL2A 3GTKH 2D2CC 3PUYA 1ET6A 4K2KA 4FF4A 3NTHA 2EPBA 1GUWA 1CA5A 4P2CB 1HNZQ 2D5DA 1CTMA 4JI0Q 1MD2D 1STBA 2B2VA 5FLMG 1JWUD 2F0SA 1D1KA 2F0JA 4X3KA 2EJMA 1YEZA 4QB4A 4K6DA 5DM73 1OO9B 3VR5A 3BS1A 4NP5A 1IBKL 3J80i 2XIWA 1SE8A 5C3WA 1RD9D 3VA5A 3S16H 1A15A 1NSNS 4OIKA 3PF4A 3GTLH 2I46A 4QJFA 1AP0A 1ESRA 1ZKOA 1CKNA 1TT2A 2E2IH 4WRDA 2QDBA 2PQAA 1EL0A 4L5QA 1SNCA 1SE3A 5CORA 4LF5L 3TP5A 2SDFA 4DA2A 3I4NH 1SYGA 2H5XA 1IBKQ 1JJGA 2C5CA 2AHOB 2R7ZH 4DK6C 2E2HH 2NN6I 1OXSC 2NUCA 2ZTDA 4B08A 2HIVA 1PXUA 4L63B 1RJTA 2K03A 2ZTCA 3FPPA 1VQ5A 2TSSA 1CKOA 2NVQH 1A0IA 2ZM6L 2XGTA 3UDXA 1E22A 4G4KA 2NTSA 1JT8A 3CCLA 4A75A 1XNRQ 2K5HA 1I50H 1SLJA 1JC7A 3S1NB 3MAQA 2KQ3A 1JJ2A 1Z6HA 2A19A 2O2LD 5FO8B 3E5SA 2IY5B 3DM3A 4K14A 3CQZB 4HMIA 4A3GG 4DNIA 3OIQA 4YIJA 4A3MB 1MJEA 1JOOA 3T1HQ 3KF8B 4G7HC 3S24A 2KEDA 5EGTA 1X65A 5LHY1 1QG7A 2BOSA 2F3IA 1D5MC 4R8IA 5ELFA 1Q1EA 2X69A 2RQXA 2RHSB 5IT9E 4IALA 1FNUA 5G3LF 1K8AC 4QGUA 3J7AV 1NY4A 4LFCQ 1WTOA 3BDLA 2CW0C 5M5WB 1B70B 4DR2L 4DR1L 1FGBD 1VQNA 3HOZB 5IT9L 4PMBA 2I5MX 4GS3A 3HOUB 3LWEA 4XQJA 3I4MG 4UDUC 2B2TA 3GTMB 3F2CA 2GA4B 1LTID 3KLWA 4A93G 5C0XJ 1M1KC 1GUTA 4C3IG 1C7YA 2K5DA 4A3IH 3HZXA 2RBMA 2ZXPA 4RMFA 1R9TH 2D0OA 4A3DB 1EUJA 2UUBL 2JA8G 2EXZA 1U4LA 4DR2Q 4DR1Q 2N78A 3BVMA 3L2PA 4A3EH 2F0IA 1ZYRD 3QJYA 1JOQA 4KLKA 3WDNA 4FNFA 2B2UA 2PMZE 1ASZA 1NR2A 2R93B 2ASBA 3K6OA 2I0QA 2NYZD 4F7XA 1HR0W 4BY7H 4B3MQ 3HOVG 1EY6A 3SE0A 4XXEA 1D8LA 3KOJA 2GVAA 1Q8IA 3F8TA 4L5SA 1Y1WG 1K3RA 4O0AA 4WJWA 1RTNA 2UXDL 4I65A 5M5XB 4XQNA 3I55A 3ZYYX 2A1AA 3PIPA 5FJ8G 3R2TA 5FKAC 1IW7D 5EPLA 1HCZA 1Y8PB 1EYCA 1JB7A 3U50C 3H3VC 4ZRZA 1N8RC 1PTOH 2K50A 4XYOA 1VQCA 1QVGA 4JI7Q 4JG2A 3CCJA 4YCWA 1SN8A 1J6QA 1E24A 1WTXA 4NXNL 1PFNA 5JJKA 1XPUA 5CV6A 1EWCA 4DR3L 3HOWG 3UDGA 3K7AB 2XSCA 2B63G 1SDFA 3L7ZC 2JK8A 3U4ZA 4BBSB 2EYFA 4PV1C 3B6YA 3VYTA 2M2LA 2AUKA 1BKBA 4BY1H 1E1OA 3S17H 1X3FA 4R4TA 1YJWA 1WCMH 1OXVA 1QNUA 5CV5A 3W1BA 3G4SA 4KY7A 1VF5C 5EJWA 2JA7G 1JWMD 4GKKL 2EYMA 4BWGB 5GAHC 1VQ4A 4GLAC 1TVXA 5KNDA 3K57A 1BCPD 1MKHA 2JSOA 5M3MH 5F2DA 3I72A 4B3TL 2K14A 4J15A 5IYBG 5I6YA 3HFZB 5LMNQ 3NSWA 3M3YB 5IY0A 5E4XA 4DV5Q 3VR3A 3QG1A 4GKKQ 1EQVA 4EX5A 1FVIA 2B3GA 1Z47A 1SYFA 2D62A 4AH6A 5K5PA 5JPNC 2QEJC 1TWHB 1K83H 1RF2D 4HJ7A 1EFWA 4JBKA 4B3TQ 5JAVA 2H4OA 3K7UC 3CPWA 3CW2C 1IZ6A 1VQHA 4A3BH 5KEEA 1R4PB 5IYCG 2VL6A 4RG1A 1VQ9A 4S3SA 2NVXB 3S2HB 1CM9A 3M85A 4UP9A 3E0JA 2FINB 1I94Q 1W6KA 3OW7A 3PMFA 4QIWE 5EQ0A 1EIHA 4IPGA 2OQKA 1PH8A 4KY6A 1EYAA 3AB9A 4DV3Q 4A3JB 1KC8C 5E3FA 4HJAA 1WD1A 2Z6KA 1S3OA 2JA5H 4MHEA 3S1RB 1LLRD 2EY1A 2K1BA 2EYHA 1U4MA 2Z4IA 2L9HA 1SR3A 3ND9A 5DEHA 1DOMA 4RA8A 5C3XA 1D7QA 2AUJD 1XMOQ 5C5LA 4B3RL 4JOIA 4JYAQ 3QWNA 1EY8A 1RTOA 4JV5L 3ONAB 4QL5A 1SSOA 5M9OA 3CXCA 1A3VA 3U4VA 5D3DA 4DV2Q 5IODA 1TU2B 4A3LG 3PIO3 2F0GA 1CKMA 4B3RQ 1I6VC 4A3MG 3A7AB 5T1IA 4FF1A 1PH9A 2F0DA 5EKKA 2R92H 3V2TA 1SYBA 4BBRB 4JV5Q 4ZKCB 4JI4L 4DV7Q 2HHHL 4BXXG 3J81E 1JOKA 1KNAA 4X64L 3D8GA 2CVRA 1JE5A 1BOSA 2Q2IA 1E2ZA 3S9WA 1EIGA 3H0GB 1QNKA 5JEAG 4K5XA 3J81L 2HQEA 4ABNA 3D0FA 5FLXE 1GUGA 5KGUA 2H1EA 1K0RA 3HOZG 2HHHQ 5COYA 1XPOA 3HOUG 4X64Q 1HNXL 4IUNA 5A2QE 4OHJA 4FXKC 1FR3A 1XMQQ 3TSSA 5FLXL 4C3HH 5C3EG 5JOBA 4DN4M 3Q0AA 4H0LC 1SRUA 3HKSA 2WACA 5A2QL 2NBFA 4LUZA 1JWSD 5LMUL 1IKMA 1EOTA 3F2DA 3M4PA 2KCCA 5IIFA 1LTBD 5I4DA 4DV0L 4BA2I 3BVZA 1V1PA 1BCPB 2UUAL 4A3GB 2FMMA 2KJXA 4DNRB 3NBHB 1SFOH 3FKIB 1STEA 3NE5B 2M00A 4FF2A 3E0EA 5KYLA 1MSHA 5EAYA 3ITPA 1UNSA 2ZT9C 1A63A 1STAA 4YY3Q 3OW2A 4GZYC 1GUOA 1VQAA 1X3GA 3VDYA 1I6HB 3OHXC 2A68D 4YWLA 4JK1C 2F0QA 1LV9A 5ISRA 2AQ3B 2B2YA 2K28A 2UUAQ 3I2ZA 1DOLA 1RODA 1WFQA 1VQEA 2FJ2A 2K5WA 2PQEA 3BYYB 3M7NA 2AQ1B 3K80C 1K8GA 5LL6S 5C4XB 4JI5L 3HP3A 5K36H 1HZAA 2E2DC 4FP5D 2N88A 4WJ3M 1SNOA 1DJRD 2R3ZA 4C3IB 2I5HA 2E74C 5C44G 2I5LX 1HZCA 4IFDG 1CQVA 4IUVA 2IX3A 2O5JC 1M8AA 1UEBA 3GV6A 3GTOB 3BJUA 5J22A 1KLUD 4Q0FA 1L1OC 1VMPA 1A3UA 1F2YA 4UY8C 3SHLA 1IBLQ 2JA8B 1TKWB 1B4OA 4P73A 2YU9H 1HZ9A 4OO1G 1G2TA 4FVMA 3V05A 1TWAB 2EZVA 4R4IA 3DWAA 3HRZC 3F1ZA 5KRUA 4HIDA 1RCVD 1A62A 4BBSG 1V43A 2K7VA 1WI5A 2A6ED 3PV0A 1LABA 3J7ZC 1FJGL 4R1JA 3AFQA 1CKNB 3DWPA 3P20A 3A8JE 3DEPA 1L0WA 2JJQA 2PQAB 2NWGA 2QCPX 2UXBQ 4ILWA 1CUKA 3AU7A 1Y1WB 2XVSA 5EBDA 2F0HA 4YCUA 2HCCA 1AEXA 5C4JH 1BQQT 3M4YA 2F4VL 5JJIA 4ZLTF 1CSQA 4IN3A 1J5EQ 1ENAA 2Z0SA 5IGBA 4B3SL 5HY6A 4RGOS 1VQKA 1HQMC 1HR0Q 5D3IB 1XPRA 4X62L 4X65Q 3G71A 4RCNA 1RKNA 4IUUA 1GVPA 3T53B 4JI3L 1A2TA 4R8NA 1ZXTA 2VB3X 1M90C 3DLLA 4LF4L 3NBHA 3HOWB 3GTJB 3P75A 2WB1G 3DXJC 3FEWX 2F3VA 5FO9B 1KRSA 4DNTB 4B3SQ 4HIOA 3ERSX 3OMCA 2N8NA 4HSVA 4GNXA 4IURA 1TR5A 1E2WA 2F0OA 2PI2E 1V8QA 4A3FH 1O7YA 1ONLA 3CCQA 2YTVA 4LFBL 1LTRD 1PYSB 3A56A 4L5TA 2R61A 4PQXA 3PO2H 3GTKB 1SNQA 2KVMA 2JA7B 4A3JG 4M1UB 4DUYQ 1I4PA 1BXTA 3NTIA 1LM0A 4KHZA 4A3KH 1YNXA 3SGIA 2UXCL 5IT9c 1LO5D 1GHKA 1N34L 3PO3H 4K8IA 2OCEA 3P1HA 1AZQA 1PH6A 2AMCB 4KKUA 4XTCS 4GKJL 4TRDA 2LXKA 2ZJPA 4HR7B 1SNMA 1BO0A 4NXMQ 3S14H 3EJIA 2E2IB 1EY9A 1PTOD 4DF7A 5T1GA 1IYVA 1SMYD 3IAYA 1CHQD 3U9OA 4FDBA 1X54A 3GTGH 3I4NB 2NZ1D 3A7LA 2R7ZB 3BG3A 1EZ8A 4HIKA 3JAME 2E2HB 1F9SA 2WAQG 1EQQA 3L0OA 4BBRG 4GKJQ 3T4AC 4IPCA 3OIPA 5DAUA 1JR0D 1Q81C 2V1CC 1X3PA 3Q6SA 2N55A 1PZKD 2EQSA 3NWTA 3JAML 2F0UA 2JYOA 3HEJA 4LNQA 3H0GG 2F1MA 2K75A 3IFDA 3STBC 2F0EA 4CHTB 4DKAC 1PYBA 3V96A 3VYSA 5FO7B 4JCVE 2QILA 1AE2A 2D0PA 2PCFB 3CF5A 3EA6A 4A76A 4RFBA 3OWFA 2I07B 1I4QA 1X56A 2RVLA 3SVMA 1NMGA 3W5OA 1SE4A 2A6HC 1SYCA 2PW5A 5KIXA 2ZJRA 1DXMA 4LW1A 1Q12A 4P71A 2NZHA 4KK7A 4LF5Q 1Q46A 2RSNA 1KLGD 1A6XA 3I4OA 4OWWB 2L15A 3J7YW 3I7FA 1D2BA 2BE5D 1CK1A 4KHPL 4TQUS 2K01A 3BZCA 3MXNA 1E7ZA 3C1FA 4K6LA 4C2MB 2N49A 3KFUA 4H02A 5CMDA 1UUPA 2B8FA 3NXWA 2Q8IB 4CBVA 4RHSA 1F2MA 1STGA 3FKIG 2ZM6Q 4PG3A 4UPAA 4JI1L 1S5FD 4RKBA 4IPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S A;  1XNR Q;  2Q2H A;  2K5V A;  3MXN B;  3UE1 A;  2F4V Q;  2JA7 G;  1Q7Y C;  1VQO A;  5GAG C;  4Y52 H;  4GKK L;  2HIX A;  4KI0 A;  2ES2 A;  1QVF A;  4BBR H;  3I56 A;  5GAH C;  1VQ4 A;  2JE6 I;  4KHP Q;  3HOV H;  4GN5 A;  1GM5 A;  4GLA C;  3K0X A;  3KJO A;  4X62 Q;  2VQE Q;  5M3F H;  1MKH A;  1WOC A;  1YHB A;  4GOP A;  5M3M H;  4JI2 L;  2WB1 E;  5IE8 A;  2K14 A;  5IP9 G;  4J15 A;  5IYB G;  4POF A;  4B3T L;  4JI3 Q;  3A0J A;  1GO3 E;  3HFZ B;  5LMN Q;  1Y1W H;  4A3D G;  4JI1 Q;  3D31 A;  1QUQ A;  3H0G H;  5IY0 A;  4YY3 L;  4LF4 Q;  3CCV A;  5C4X G;  4DV5 Q;  3CP0 A;  5FJ8 H;  4GOP B;  2VZA A;  4GKK Q;  2PI2 A;  2WP8 J;  3LGJ A;  2JA6 G;  1XTD A;  3A5U A;  3ULJ A;  4EX5 A;  3KF6 A;  1FVI A;  4GLV B;  2B3G A;  2QEX A;  1Z47 A;  5IP7 G;  2UU9 L;  1QUQ B;  2D62 A;  4AH6 A;  3S1N H;  4NB3 A;  1K83 H;  2K52 A;  2R92 G;  4MTN A;  4LFB Q;  4X6A H;  4HJ7 A;  1EFW A;  4JBK A;  4A3C G;  1HNW L;  4YCV A;  4B3T Q;  3CQZ H;  4APV A;  2Q2U A;  2LSS A;  2N3S A;  2R93 G;  4PZ8 A;  2BH8 A;  4LUV A;  4C3J H;  3HKZ G;  3K7U C;  4LF6 L;  3CPW A;  3CW2 C;  1IZ6 A;  3MEF A;  1YI2 A;  1VQH A;  5C0X G;  1G51 A;  2VUM H;  4A3B H;  4IOA A;  1YZ6 A;  5GQO A;  4AQY L;  3K81 C;  2CCZ A;  3UE0 A;  2MNA A;  5IYC G;  1SMX A;  2VL6 A;  4RG1 A;  4IOC A;  1W2B A;  1VQ9 A;  1S72 A;  1Y1V G;  2R7D A;  2UXC Q;  3HOW H;  4OXP A;  1Q86 C;  5M5Y H;  3CC4 A;  1BBU A;  4JBW A;  1HNZ L;  3M85 A;  1N34 Q;  2UU9 Q;  4UP9 A;  3S1Q H;  3HKZ E;  1I94 Q;  4JI0 L;  2B63 H;  4QIW E;  3EBE A;  1CSP A;  4QQB X;  4IPG A;  1C0A A;  2OQK A;  1G6P A;  2AWO A;  1PH8 A;  1OXT A;  1IBL L;  1HNW Q;  3IRB A;  1U5K A;  5HGQ A;  1KQS A;  3AEV A;  4MZ9 A;  4PMW A;  4DV3 Q;  2UUB Q;  4LF6 Q;  1KC8 C;  1OTC A;  3FKI H;  1PH5 A;  4HJA A;  4WJ4 A;  2Z6K A;  4UP8 A;  1LTL A;  3J7A 5;  2QGQ A;  1S3O A;  1UE5 A;  2JA5 H;  3CAM A;  2CWP A;  5M5W H;  3ER0 A;  5AJ3 Q;  2HQL A;  4A4I A;  1K73 C;  2JA7 H;  1SR3 A;  3GDE A;  1NJI C;  1D7Q A;  1B7Y B;  1I6H H;  1XMO Q;  2EIF A;  1FGU A;  2KHJ A;  4B3R L;  3GTM H;  1VQD A;  1MIU A;  4JOI A;  4JYA Q;  1NBW A;  4OON A;  3CCU A;  1N36 L;  5IYD G;  1UE7 A;  3W1B A;  3CCM A;  4JV5 L;  1KHI A;  4QL5 A;  2OQ0 A;  5IP9 H;  1PH7 A;  5IYB H;  5BR8 Q;  3WWV A;  4DUZ L;  1X6O A;  3CXC A;  3U4V A;  5C4X H;  4DV2 Q;  3AFP A;  1QZH A;  2UXB L;  4DR4 L;  5LMN W;  1KIX A;  4A3L G;  4LF7 Q;  1X3E A;  4BA1 I;  2JA6 H;  1PVO A;  1CKM A;  1V9P A;  3CMA A;  1VCI A;  4P74 A;  4B3R Q;  1LYL A;  4A3M G;  1H95 A;  3PUV A;  1IBM L;  1EIF A;  3NEL A;  5GRO A;  3EN2 A;  4R4O A;  1PH9 A;  3BZK A;  1YIT A;  2UXD Q;  1PH2 A;  2R92 H;  3GTP H;  1XNR L;  4JV5 Q;  2YV5 A;  4A3C H;  4X66 L;  1L1O A;  4JI4 L;  3GTO H;  3S2D H;  3J81 j;  5ELO A;  4IFD I;  2IHE A;  3JC6 6;  2R93 H;  4DV7 Q;  1J5E L;  1K9M C;  2HHH L;  4BXX G;  4NPS A;  3Q8D A;  4DUZ Q;  1KRT A;  4X64 L;  2BA0 A;  1P16 A;  4DAY B;  3RZO H;  1NTG A;  3KDF B;  4DV6 L;  3RNU A;  1JE5 A;  1YHA A;  1OXU A;  1HR0 L;  1L2F A;  3HOY G;  2Q2I A;  1VQB A;  5IYC H;  1TWA H;  2K5N A;  3FHW A;  4X65 L;  4LF9 L;  2QA4 A;  4OO1 I;  1L1O B;  4OWT B;  3T1H L;  2JA9 A;  5JEA G;  3CCS A;  5K36 G;  1IBM Q;  1YJN A;  1S40 A;  1IYJ B;  4DR7 Q;  1Q82 C;  2JEA I;  4JC0 A;  4NXN Q;  3D0F A;  2YTX A;  3STB D;  3KJP A;  3CC7 A;  2VS1 A;  4DR3 Q;  4GN3 B;  1K0R A;  3J80 c;  1UWV A;  4P75 A;  1KD1 C;  4K0K L;  3HOZ G;  2HHH Q;  3J81 c;  2GVB A;  1XPO A;  3HOU G;  3ULL A;  1Z9F A;  4X64 Q;  5J3B A;  3RN5 A;  1FL0 A;  1HNX L;  4DV6 Q;  3HOX G;  2XTI A;  1YIJ A;  1XMQ Q;  4LF9 Q;  1EQR A;  2A8V A;  1TXY A;  4LFC L;  4JI1 L;  3TS0 A;  4HJ5 A;  2BA1 A;  4C3H H;  5C3E G;  2RF4 A;  1SRU A;  1YHQ A;  1B8A A;  3HKS A;  1IXR A;  1KXL A;  2PNH A;  5FLX c;  4DUY L;  1A8V A;  2MO0 A;  1Q1B A;  4LUZ A;  5LMU L;  3RN2 A;  5IYD H;  3F2D A;  3M4P A;  1EYG A;  3TQY A;  2Y0S G;  4DV0 L;  4IO9 A;  4BA2 I;  4ME3 A;  1T9H A;  2UUA L;  3S1M H;  2GN5 A;  3NBH B;  3TEH B;  1SFO H;  4A3L H;  4JI2 Q;  1I5F A;  2Z6K C;  3E0E A;  1ASY A;  2JEB I;  1VQP A;  3K8A A;  5EAY A;  3RZD H;  2Y0S E;  3I4N G;  1TWC H;  3JAM i;  2R7Z G;  1A63 A;  4C2M H;  4A3M H;  4LF8 L;  4R4Q A;  4YY3 Q;  3OW2 A;  2UUC L;  2OTJ A;  4NXM L;  1VQA A;  1X3G A;  4AIM A;  3VDY A;  5ELN A;  2IT1 A;  4YWL A;  1E1T A;  3T1Y L;  5JJL A;  3GTJ H;  4JOI C;  4XIG S;  4BXX H;  2UUA Q;  3I2Z A;  3H3V H;  1AH9 A;  3U58 A;  2KEN A;  1WFQ A;  4DR5 L;  1VQE A;  1PA6 A;  3HOY H;  1N32 L;  1LUZ A;  2VY3 A;  1QZG A;  3K80 C;  3PCO B;  1K8G A;  3M7N A;  1AE3 A;  4O2D A;  2ID0 A;  2KCT A;  4JI5 L;  1HZA A;  1HH2 P;  4QY7 A;  4LF8 Q;  4R4C A;  3EIV A;  4B3M L;  3PIO A;  4WJ3 M;  3OYY A;  4AQY Q;  1VS0 A;  3BU2 A;  2RCN A;  1IL2 A;  3PUY A;  4OX9 L;  3GTK H;  3CME A;  1YBY A;  3M4O H;  1U0L A;  2I5H A;  2ZJQ A;  1DGS A;  1GD7 A;  5C44 G;  1VQM A;  3HOZ H;  2I5L X;  5GAD C;  1HNZ Q;  1HZC A;  3HOU H;  3FP9 A;  4IFD G;  2KHI A;  2NVY H;  1VQF A;  4EQ5 A;  4DR5 Q;  1VQL A;  4JI0 Q;  1UEB A;  5FLM G;  3BJU A;  1L1O C;  3PUW A;  4OWX B;  1N32 Q;  4UY8 C;  1IBL Q;  1YEZ A;  4P73 A;  3W1G A;  5DLQ E;  4IPD A;  1RIP A;  2YU9 H;  5C3E H;  2ATW A;  1HZ9 A;  4OO1 G;  1C9O A;  1IBK L;  2HT1 A;  3J80 i;  2R7F A;  1SE8 A;  4A3D H;  3J81 i;  1Q8K A;  2VQF L;  3A5Z B;  4R4I A;  4A3F G;  1WJJ A;  3S16 H;  5E7N A;  3PF4 A;  3GTL H;  3F1Z A;  4QJF A;  4DR6 L;  2CWA A;  2YYZ A;  1CKN A;  4HID A;  1A62 A;  4JI7 L;  3UDF A;  4BBS G;  1V43 A;  3PO2 G;  2E2I H;  1X55 A;  1WI5 A;  3PV0 A;  3J7Z C;  2PQA A;  2NVX H;  5IP7 H;  3KDF A;  4DV4 L;  1BBW A;  3S15 H;  4L5Q A;  1FJG L;  1N36 Q;  3AQQ A;  2E5L L;  4LF5 L;  2EXD A;  4R1J A;  3TS2 A;  3AFQ A;  4A3K G;  1CKN B;  3I4N H;  2H5X A;  1IBK Q;  1G29 1;  1JJG A;  2AHO B;  3TRE A;  2CQO A;  1XJV A;  2R7Z H;  3PO3 G;  2VQF Q;  1UE6 A;  1EIY B;  4DK6 C;  2E2H H;  1L0W A;  2JJQ A;  2PQA B;  2NN6 I;  1OXS C;  2IX0 A;  2ZTD A;  3E9H A;  4A3I G;  2HIV A;  2UXB Q;  4DR4 Q;  3A74 A;  4DR6 Q;  1CUK A;  2AWN A;  2E2J H;  2RHQ B;  4GN4 B;  1TWG H;  4LWC A;  2ZTC A;  4LFA L;  1Y1V H;  1VQ5 A;  1E3P A;  1CKO A;  4ALP A;  2VNU D;  4MNO A;  4YCU A;  5IWA L;  1PHJ A;  1A0I A;  5C4J H;  2ZM6 L;  2BH2 A;  2XGT A;  2IX1 A;  4TVA B;  3UDX A;  2NVQ H;  1VQ6 A;  2VUM G;  3RLN A;  1E22 A;  1W3S A;  4JBJ A;  3CCL A;  1JT8 A;  4HJ8 A;  1TWF H;  2E8G A;  2K5H A;  4A75 A;  5JEA J;  2MQH A;  1I50 H;  4X66 Q;  4JI4 Q;  1SLJ A;  1UE1 A;  2F4V L;  1PV4 A;  1CSQ A;  4A3E G;  5M5X H;  1O7I A;  1J5E Q;  1N9W A;  2KBN A;  2Z0S A;  4IJL A;  4B3S L;  1JJ2 A;  4JI6 L;  2A19 A;  5HY6 A;  2JQO A;  2AKW B;  1VQK A;  2IY5 B;  3DM3 A;  2B29 A;  1HR0 Q;  2CFM A;  1MJC A;  1XPR A;  4A3G G;  4X62 L;  5JJI A;  4X65 Q;  4LFA Q;  4DNI A;  3AYH B;  3G71 A;  1MJE A;  3T1H Q;  2NZO A;  3KF8 B;  5C44 H;  2ALY B;  1HJP A;  1GVP A;  3S24 A;  4JI3 L;  5IWA Q;  4BY7 G;  1X65 A;  5LMN L;  1M90 C;  3DLL A;  2MO1 A;  4JBM A;  4LF4 L;  1YVC A;  2F3I A;  4DV5 L;  2WB1 G;  4HIM A;  3CC2 A;  4K0K Q;  1KRS A;  1Q1E A;  4B3S Q;  1GKH A;  4JI6 Q;  4HIO A;  2RHS B;  3ERS X;  2N8N A;  1HNX Q;  4L5R C;  4GNX A;  1Y14 B;  1QVC A;  1PH1 A;  1K8A C;  2PI2 E;  4QGU A;  4A3F H;  1I3Q H;  3CCQ A;  1NY4 A;  2YTV A;  3K7A H;  3RLO A;  4LFB L;  1PYS B;  4LFC Q;  2YTY A;  3H3V I;  4L5T A;  4BBS H;  1VQI A;  3PO2 H;  2KCM A;  2NVT H;  3ICE A;  3TRZ A;  4YHH L;  4GNX B;  1B70 B;  4DR2 L;  4DR1 L;  1VQN A;  4A3J G;  4DUY Q;  2VW9 A;  2I5M X;  3NEM A;  4GS3 A;  5LMU Q;  3GTQ H;  3I4M G;  4GLX A;  1WYD A;  1LM0 A;  2DUD A;  4KHZ A;  4PZ7 A;  3F2C A;  1YNX A;  2K4K A;  3SGI A;  4DV0 Q;  3KLW A;  3UDI A;  4A3K H;  4A93 G;  2UXC L;  1KL9 A;  5IT9 c;  5C0X J;  1M1K C;  1VQ7 A;  1N34 L;  3PO3 H;  1C7Y A;  1P8L A;  1PFS A;  3OTO L;  3F2B A;  1I94 L;  4DAM A;  3M4Q A;  2F52 A;  3CCR A;  3PSI A;  4A3I H;  4YWM A;  2OCE A;  4Y7N H;  4RMF A;  1R9T H;  2D0O A;  1N33 L;  1PH6 A;  2AMC B;  5H1S E;  1EUJ A;  4XTC S;  4DV3 L;  3G6E A;  2UUB L;  2JA8 G;  2WFW A;  5GAE C;  3PUX A;  2Q2T A;  3KF6 B;  4YHH Q;  4GKJ L;  4DR2 Q;  4DR1 Q;  1EWI A;  2LXK A;  2ZJP A;  2UUC Q;  4NXM Q;  3RR5 A;  4AYB G;  3S14 H;  2N78 A;  2OTL A;  5AJ3 L;  1XNQ L;  2C35 B;  3T1Y Q;  3L2P A;  3GO5 A;  3M3Y H;  4BY1 G;  4A3E H;  3KYH C;  2OWO A;  1BVS A;  1XMO L;  2R6G A;  4UP7 A;  3ZJY C;  1V1Q A;  3OTO Q;  1WCM G;  1NE3 A;  3PGZ A;  4FDB A;  4KLK A;  4JI8 L;  1X54 A;  2PMZ E;  4POG A;  1EOV A;  1ASZ A;  4JYA L;  3HOX H;  3GTG H;  2ASB A;  4A3G H;  2NN6 G;  4AYB E;  1N33 Q;  2I0Q A;  3M9B A;  1VQ8 A;  4HIK A;  1PH3 A;  4IFD J;  2WAQ G;  1HR0 W;  4JI5 Q;  1TWH H;  5BR8 L;  1EQQ A;  3L0O A;  4BBR G;  4B3M Q;  4BY7 H;  4GKJ Q;  1OXX K;  2LXJ A;  3ULP A;  1PH4 A;  4IPC A;  2FXQ A;  3CCE A;  3HOV G;  4DV2 L;  1XNQ Q;  4OX9 Q;  4DPG A;  1D8L A;  3KOJ A;  5M3F G;  1Q81 C;  1JMC A;  2GVA A;  2V1C C;  4LF7 L;  5M3M G;  3F8T A;  4L5S A;  2CKZ B;  5C0X I;  2EQS A;  2WAQ E;  1Y1W G;  4LUO A;  4JI8 Q;  4LNQ A;  4P72 A;  3H0G G;  1K3R A;  1VQG A;  4O0A A;  3S2H H;  2K75 A;  1KAW A;  2UXD L;  3STB C;  3I55 A;  2A1A A;  3PIP A;  4DKA C;  5FJ8 G;  1PYB A;  3JAM c;  1NMF A;  2ZTE A;  4JCV E;  3PF5 A;  1AE2 A;  3E9I A;  4DV7 L;  2D0P A;  3CF5 A;  1YJ9 A;  4A76 A;  3U50 C;  1JB7 A;  3PUZ A;  3CD6 A;  1N8R C;  4A3J H;  1X56 A;  2K50 A;  1VQC A;  4IJH A;  2IHF A;  1QVG A;  1NMG A;  3W5O A;  3I4M H;  4HJ9 A;  3S1R H;  4JI7 Q;  4A93 H;  3GD7 A;  4JG2 A;  3CCJ A;  4YCW A;  4C3I H;  1SN8 A;  1J6Q A;  1E24 A;  3CPF A;  1RL2 A;  2ZJR A;  4DV1 L;  4DV4 Q;  4A3B G;  4DR7 L;  4LW1 A;  1Q12 A;  1FJG Q;  4NXN L;  4P71 A;  2NZH A;  2E5L Q;  4LF5 Q;  5JJK A;  1Q46 A;  3RLF A;  1XPU A;  1HZB A;  4DR3 L;  4GNX C;  2DGY A;  3I4O A;  4OWW B;  2L15 A;  3HOW G;  3G48 A;  3I7F A;  2JA8 H;  3UDG A;  3H15 A;  4GOP C;  2B63 G;  4DK3 C;  4KHP L;  4TQU S;  3L7Z C;  2JK8 A;  1SRO A;  3U4Z A;  3BZC A;  1E7Z A;  1XMQ L;  3B6Y A;  2VQE L;  2N49 A;  1BKB A;  3KFU A;  4H02 A;  1JJC B;  2MFI A;  4BY1 H;  1E1O A;  4PZ6 A;  3S17 H;  1X3F A;  4R4T A;  4YWK A;  3FKI G;  2ZM6 Q;  1VQJ A;  4DV1 Q;  1YJW A;  1WCM H;  1OXV A;  3NEN A;  4PG3 A;  4UPA A;  5FLM H;  1X9N A;  4IPH A;  2JA5 G; 
#chains in the Genus database with same CATH topology
 3F2U A;  3UE1 A;  3U9S A;  2NN6 H;  1AN8 A;  1Q7Y C;  4Y52 H;  1STN A;  1F77 A;  4A3I B;  2ES2 A;  5ELC A;  2JE6 I;  4KHP Q;  1GM5 A;  1BF4 A;  4R9W A;  1SND A;  1JCK B;  3WOE A;  5M3F H;  1YHB A;  4JI2 L;  2OF1 A;  3E6Z X;  1GXD C;  2V4D A;  2Z6B A;  1F2Z A;  4JI1 Q;  3D31 A;  1QUQ A;  2KA7 A;  3CCV A;  1C48 A;  5C4X G;  2Z4H A;  1VF7 A;  2VZA A;  3K5N A;  4K5V A;  1F9P A;  2JA6 G;  2E76 C;  5LL6 X;  2XWB B;  1LAC A;  4DXF A;  4GLV B;  3C1E A;  2MGS A;  3S1N H;  4ID6 A;  4TKO B;  3RUZ A;  5C3E B;  4MTN A;  2NTT A;  2L11 A;  4A3C G;  1LT3 D;  1E0B A;  3CQZ H;  4C3J H;  4LUV A;  4QUF A;  1T5X D;  1PLF A;  2VUM H;  1WTQ A;  2EDG A;  5C0X G;  2D9U A;  5IGF A;  3K81 C;  2CCZ A;  3UE0 A;  1CA6 A;  1D6E C;  1BR9 A;  1B53 A;  1SMX A;  4KKS A;  1W2B A;  2DY8 A;  1PDQ A;  1TQO A;  4OXP A;  1QOH A;  5CGK A;  4JBW A;  4V0B A;  3S1Q H;  1GUS A;  3K59 A;  4QQB X;  1B9M A;  1OXT A;  4ZK9 B;  3IRB A;  1U5K A;  4MTK A;  1EU4 A;  4KKT A;  2CQA A;  3AEV A;  4MZ9 A;  2UUB Q;  2ICI A;  1PTO B;  5KNB A;  1FD7 D;  1H9M A;  2B2W C;  2E2J B;  5CYU A;  2EY5 A;  2QGQ A;  1UE5 A;  3CAM A;  5M5W H;  1I4R A;  1A2U A;  1ENC A;  1B44 D;  2EIF A;  4LK1 C;  3GTM H;  1TWF B;  3W3A A;  1NBW A;  1N36 L;  5IYD G;  3CCM A;  1KHI A;  2SNM A;  5IP9 H;  2EY2 A;  5ELE A;  3WWV A;  2K04 A;  4AYB B;  1C8C A;  1RHP A;  2B39 A;  4BY1 B;  5C44 B;  4DR4 L;  3S17 B;  1KIX A;  1X3E A;  1WCM B;  3A54 A;  3SK5 A;  2F0N A;  2IWH A;  4DGZ A;  3H91 A;  1V9P A;  1CZG A;  2AQ2 B;  4V19 0;  1K8O A;  1IBM L;  1EIF A;  4DAY A;  1EY4 A;  4J1M A;  5GRO A;  2OEO A;  3NUC A;  5ELB A;  2UXD Q;  1PH2 A;  3LNN A;  3GTP H;  1GUN A;  2F0P A;  2YV5 A;  4X66 L;  4OIJ A;  3MFY A;  4IFD I;  5ELO A;  2R93 H;  3JC6 6;  1IL8 A;  4HCS A;  2BA0 A;  1P16 A;  3RZO H;  3RNU A;  1MSG A;  1YNN D;  5CV8 A;  3SEB A;  3HOY G;  3RD4 A;  4HCE A;  5CC4 A;  2K5N A;  3QO2 A;  1YNJ D;  4OO1 I;  2JA9 A;  3CCS A;  5NUC A;  1IBM Q;  3DEO A;  1S40 A;  3OWE B;  3URY A;  3LX0 A;  4NXN Q;  3CC7 A;  4N9P A;  2Z8L A;  4DAP A;  4DR3 Q;  4K0K L;  3J81 c;  3VR6 A;  1K83 B;  4KJO A;  1FL0 A;  1H9S A;  4Y7N B;  4FXD A;  3X3M A;  1LTS D;  4QCL A;  2DNE A;  5IGG A;  1YIJ A;  3TP8 A;  1MGS A;  1TXY A;  4NKL A;  3TS0 A;  4A3B B;  2BA1 A;  5D65 A;  1YHQ A;  1IXR A;  5FLX c;  2MO0 A;  1AZP A;  1PMR A;  1MBY A;  1EYG A;  3TQY A;  4ME3 A;  1T9H A;  2G5D A;  3S1M H;  1B50 A;  3TZU A;  3BDC A;  1O78 A;  5E4W C;  1FNV A;  5I2Y A;  2A69 D;  4DU9 A;  1VQP A;  3I4N G;  3RZD H;  2JA5 B;  1V1P B;  1TWC H;  2R7Z G;  2WB1 B;  1WTP A;  1DOK A;  1PTO F;  2UUC L;  3FRP B;  4OGQ C;  2IT1 A;  3IKJ A;  3T1Y L;  3ERO A;  4HED A;  3H3V H;  2KEN A;  4DR5 L;  2NB0 A;  2KOL A;  1N32 L;  1LUZ A;  1DCZ A;  1ML0 D;  1PRT D;  1QZG A;  1IKL A;  1AE3 A;  2PO4 A;  4R4C A;  3EIV A;  3K0Y A;  4RGT A;  2HUG A;  3M7G A;  3A8K E;  1Q3L A;  4OX9 L;  1F2L A;  3M4O H;  1U0L A;  1DGS A;  1GD7 A;  1EY5 A;  3X3N A;  2R92 B;  5GAD C;  2KHI A;  2NVY H;  4DR5 Q;  1VQL A;  4H13 C;  3MA2 B;  1N32 Q;  3HKZ B;  1DM0 B;  5CV4 A;  1U4P A;  3W1G A;  5DLQ E;  3GP7 A;  4KJN A;  2HT1 A;  4ME5 A;  3J81 i;  1Q8K A;  2VQF L;  3SR1 A;  4N9T A;  1WJJ A;  4HMJ A;  5C4Z A;  5C6A A;  1BBX C;  1H9J A;  4RGN A;  3I8Z A;  3Q23 A;  3I4L A;  2NVX H;  4CJ1 B;  5IP7 H;  4DV4 L;  3VR2 A;  3S15 H;  4XT3 B;  2WAQ B;  2DNC A;  3AQQ A;  2E5L L;  2EXD A;  1A3T A;  3KK7 A;  1G29 1;  3H09 A;  3EQL C;  1XJV A;  4G7O C;  2VQF Q;  1EIY B;  3IFT A;  1Z7T A;  2IX0 A;  4A3I G;  1SBB B;  3AMU A;  1BCP C;  1TWG H;  2QKI C;  1Y1V H;  1E3P A;  2KUM A;  4ALP A;  4F88 A;  4MNO A;  1PHJ A;  2IX1 A;  1VQ6 A;  2VUM G;  2BH2 A;  2EVB A;  3RLN A;  2L5T A;  1W3S A;  1STH A;  5JEA J;  2MQH A;  4JI4 Q;  5TSS A;  1PV4 A;  4A3E G;  1N9W A;  2KBN A;  5IGD A;  2L1B A;  4LAA A;  4JI6 L;  1DYQ A;  2RSO A;  5I2X A;  2JQO A;  2AKW B;  1HFG A;  3CRL C;  1I4H A;  3HS0 C;  3MXU A;  2B29 A;  1ZEQ X;  2CFM A;  1MJC A;  2NZO A;  2G9H D;  1HJP A;  3CRK C;  4ZYS A;  4ZAI A;  4BY7 G;  2A74 C;  1D5Z C;  4I7Z C;  3GV3 A;  2F03 A;  2PZT A;  1B3A A;  3G7L A;  3CC2 A;  2EJF C;  1GKH A;  2RA4 A;  1G8Z D;  1EU3 A;  1II3 A;  4JI6 Q;  1HNX Q;  4L5R C;  2LY7 A;  4G57 A;  1EY7 A;  1ICF B;  3MZ5 A;  1I3Q H;  4CDE C;  3CU7 A;  2RKS A;  2YTY A;  3G6J B;  1VQI A;  4KMU C;  2ZXR A;  2KCM A;  2NVT H;  2EYJ A;  4ODG A;  4GNX B;  2VW9 A;  3GTQ H;  3ERQ A;  1KDA A;  5A35 A;  5LMU Q;  4O42 A;  4OEM B;  3LWU A;  1WYD A;  1WTR A;  2F0K A;  2B2V C;  4DV0 Q;  3UDI A;  1VQ7 A;  3OTO L;  3F2B A;  2F0F A;  4DAM A;  3CCR A;  2YU9 B;  3PSI A;  4YWM A;  3QIA A;  1HUN A;  3D4W A;  3E3X A;  3ND8 A;  4NDX A;  5H1S E;  3G6E A;  2KHS A;  3PUX A;  2IJ0 A;  2Q2T A;  2Y0S B;  2JA6 B;  3RR5 A;  4AYB G;  2OTL A;  1NCV A;  5AJ3 L;  1KDB A;  3GO5 A;  4BY1 G;  1BVS A;  1PRT B;  3K5O A;  4UP7 A;  3ZJY C;  1V1Q A;  3OTO Q;  1WCM G;  1NE3 A;  3PGZ A;  3C3L A;  1F9Q A;  4JI8 L;  3S2D B;  1EOV A;  3HOX H;  1SYE A;  4A3G H;  1KNE A;  1AFP A;  3BDO A;  1UEA B;  5I9P A;  1PH3 A;  4IFD J;  4JI5 Q;  5BR8 L;  2RDG A;  3NP8 A;  5CBA E;  2F0W A;  1PH4 A;  2FXQ A;  3MHB A;  3CCE A;  4LF7 L;  1HXY D;  5M3M G;  3IL8 A;  5C0X I;  2WAQ E;  3W2D A;  4LUO A;  4JI8 Q;  4P72 A;  2VXW A;  4ZUI A;  3JAM c;  3E9I A;  5E1F A;  4ULL A;  3R8B A;  3PUZ A;  3CD6 A;  4IJH A;  3I4M H;  2KEE A;  5JPM C;  1G91 A;  2QDL A;  4A93 H;  3GD7 A;  1JOR A;  2MUY A;  4C3I H;  1JB3 A;  2QF7 A;  4A3B G;  4DR7 L;  2WKC A;  3MXP A;  1FJG Q;  3RLF A;  1F9R A;  4HSP A;  4M8A A;  3G48 A;  2JA8 H;  3PIP 3;  3H15 A;  4DK3 C;  2ENB A;  2F0T A;  3PO2 B;  3QR8 A;  4KHV A;  1EEI D;  2IL8 A;  1JJC B;  2MFI A;  4ZQ3 A;  2LS0 1;  4B9X A;  4PZ6 A;  1VQJ A;  3QB3 A;  1U4R A;  3NEN A;  3SXH A;  5L37 A;  1X9N A;  2B2T C;  2JA5 G;  1X3Q A;  3MXN B;  5DM6 3;  2F4V Q;  2A68 C;  4JVZ A;  5GAG C;  3VA7 A;  4RKL A;  3I56 A;  3HOY B;  1QIL A;  1B9N A;  2JP1 A;  4GN5 A;  3HOV H;  1LTA D;  3K0X A;  3TBI B;  2HDM A;  4X62 Q;  4GOP A;  2A6H D;  4EQO A;  5IE8 A;  4CJ2 C;  4POF A;  4JI3 Q;  4U68 A;  3S14 B;  4L6T B;  1GO3 E;  1PYW D;  4WOR A;  5C4H A;  1Y1W H;  2WV6 D;  1RDP D;  4C1N K;  4LF4 Q;  1G6Z A;  4XT1 B;  2JXM B;  3CKI B;  3O13 A;  2F3W A;  5FJ8 H;  2PI2 A;  1O80 A;  2WP8 J;  3LGJ A;  3I70 A;  1XTD A;  2B2U C;  4HAE A;  3MEH A;  3GTG B;  4BS9 A;  2L4N A;  2UU9 L;  5IP7 G;  1QUQ B;  1PRT F;  4NB3 A;  4CKE A;  2XRQ D;  2K52 A;  2R92 G;  4LFB Q;  1HNW L;  3QOJ A;  1WVL A;  2LSS A;  2N3S A;  2Q2U A;  4RWS C;  1NR4 A;  3C2P A;  3HKZ G;  3S16 B;  3MEF A;  2EJG C;  1YI2 A;  3GTL B;  4IOA A;  1G51 A;  3DMU A;  3NQI A;  4AQY L;  2MNA A;  4QF4 A;  4Z9C B;  1KDC A;  1Q90 A;  4IOC A;  5CV9 A;  1S72 A;  1Y1V G;  2UXC Q;  1AW7 A;  3HOW H;  2EOT A;  3DUZ A;  5M5Y H;  3CC4 A;  2A6E C;  1HNZ L;  2UU9 Q;  1N34 Q;  2PNR C;  3KBX A;  5JJZ A;  4JI0 L;  2B63 H;  3EBE A;  3NPP A;  4H7B A;  1CSP A;  4CDF C;  2J0T D;  1HNW Q;  2PZU A;  2CW0 D;  1WTV A;  1PH5 A;  1BNZ A;  4WJ4 A;  1CT1 D;  5KNC A;  1X32 A;  3DM1 A;  4QMG A;  2CWP A;  3ER0 A;  2KEC A;  2NVQ B;  2HQL A;  3SK8 A;  4A4I A;  2JA7 H;  3GDE A;  4C3H G;  4E6I A;  1NJI C;  1GOZ A;  2KHJ A;  1VQD A;  1I50 B;  4OON A;  3CCU A;  3I90 A;  2PMZ B;  1PH7 A;  5IYB H;  2HDL A;  1J8I A;  3K5L A;  4DUZ L;  1ESF A;  1LTT D;  1FNW A;  3I73 A;  2CH4 W;  1JIC A;  1PVO A;  2MHV A;  3CMA A;  4P74 A;  1LYL A;  1H95 A;  3PUV A;  1B2T A;  3NWS A;  1YIT A;  2FFK B;  1NAP A;  3VR4 A;  1XNR L;  1L1O A;  3J81 j;  3HG9 A;  2IHE A;  1WD0 A;  1TS2 A;  3J80 E;  1K9M C;  4DUZ Q;  5M3F B;  2LKV A;  4DAY B;  1NTG A;  3KDF B;  4DV6 L;  1TII D;  2XRS D;  5IYC H;  1VQB A;  4LF9 L;  3FHW A;  2QA4 A;  3T1H L;  3KLS A;  2M9V A;  5I9O A;  3VYU A;  5K36 G;  1CZW A;  4C56 C;  1YJN A;  4I7A A;  3J80 L;  1Q82 C;  1KTK A;  4JC0 A;  1EWH A;  5BN4 A;  1C4Q A;  3KJP A;  2VS1 A;  1UWV A;  1S5B D;  2GVB A;  4KN4 C;  2F0V A;  1Z9F A;  3ULL A;  3RN5 A;  4DV6 Q;  1R9T B;  4RHR A;  3HOX G;  3VYR A;  1SJH D;  4C3J B;  4LF9 Q;  1EQR A;  3CHB D;  2VUM B;  2IW3 A;  4LFC L;  4HJ5 A;  1Y8N B;  3R93 A;  1H9S B;  1B8A A;  3BVG A;  1PZJ D;  1XWE A;  1PTO C;  1Q1B A;  4A3E B;  1PZI D;  3S1Q B;  1VMC A;  1SMY C;  2Y0S G;  2Z1C A;  4IO9 A;  1KAB A;  4G7Z C;  1QB5 D;  5BN3 A;  2GN5 A;  3TEH B;  4PNY A;  3C46 A;  1XXG A;  4A3L H;  4BY7 B;  4JI2 Q;  2L55 A;  4XDX A;  3OMG A;  2Z6K C;  1XYI A;  2JEB I;  3N6R A;  2OXP A;  4C2M H;  4A3M H;  4R4Q A;  2EYO A;  2OTJ A;  3FVQ A;  4AIM A;  2K32 A;  3NBI A;  2WKD A;  1E1T A;  3D6W A;  1CI3 M;  2B8G A;  4JOI C;  4N8F A;  1S5C D;  4DFA A;  4BXX H;  1QE6 A;  2X6G A;  3U58 A;  3MWY W;  3J7A F;  1PA6 A;  3PCO B;  2F4I A;  2DY7 A;  4O2D A;  1HTL D;  2KCT A;  5JEA H;  4B3M L;  4O1N A;  2HCI A;  5EKL A;  1VS0 A;  3BU2 A;  2RCN A;  3CME A;  1YBY A;  2ZJQ A;  1VQM A;  3HOZ H;  3HOU H;  3FMC A;  3GTP B;  3FP9 A;  4NMZ A;  1VQF A;  3TN2 A;  1EZ6 A;  4EQ5 A;  2JN4 A;  3PUW A;  4OWX B;  5BN5 A;  2MPM A;  2J7Z A;  1Y8O B;  3H94 A;  4QIW B;  3BZD B;  3NHH A;  3RZO B;  2BDN A;  4IPD A;  1RIP A;  2ATW A;  5C3E H;  2BE5 C;  1CHP D;  3T51 B;  1C9O A;  2R7F A;  4EVO A;  4A3D H;  3A5Z B;  4A3F G;  1HHV A;  3OSO A;  5E7N A;  4DR6 L;  2CWA A;  2YYZ A;  4JI7 L;  3UDF A;  3PO2 G;  2RDF A;  4WFN 3;  1X55 A;  3KDF A;  5DNF A;  1BBW A;  2C9O A;  1H9R A;  1N36 Q;  2F0L A;  2TMP A;  3D6C A;  3TS2 A;  3N52 A;  4A3K G;  3SK4 A;  3TRE A;  3MFG A;  2CQO A;  4CJ0 B;  3PO3 G;  2XN9 C;  3TZD A;  1UE6 A;  2L0C A;  4NW2 A;  1U9R A;  5M3M B;  3E9H A;  4DR4 Q;  3A74 A;  4DR6 Q;  4H44 C;  2EYL A;  1HPC A;  2AWN A;  4KTA A;  2RHQ B;  4GN4 B;  4KD4 A;  1MI2 A;  4LWC A;  2E2J H;  4LFA L;  3TP6 A;  1M4V A;  2VNU D;  1IYU A;  5IWA L;  1HUM A;  4TVA B;  1CQF A;  3L9A X;  3I91 A;  4JBJ A;  4HJ8 A;  1TWF H;  2E8G A;  4X66 Q;  3KF8 A;  3S1M B;  1UE1 A;  5M5X H;  1O7I A;  4IJL A;  1H9K A;  1VDZ A;  2ICE C;  1EQT A;  4FF3 A;  3GQB A;  3RZD B;  2SEB D;  4X3S A;  1DON A;  1TWC B;  3UI2 A;  4LFA Q;  3AYH B;  3SDZ A;  5C44 H;  2ALY B;  5IWA Q;  2XNA C;  1HTP A;  3EFX D;  4IFD H;  2DJF C;  5LMN L;  1BDO A;  3I3C A;  1IHZ A;  2MO1 A;  4JBM A;  1YVC A;  4DV5 L;  2CHB D;  3NQT A;  2B2Y C;  2DN8 A;  4X3T A;  4HIM A;  4K0K Q;  1JQY D;  2BCO A;  1ZYR C;  4OO1 H;  1D5X C;  1Y14 B;  1QVC A;  1PH1 A;  3NTK A;  4UAI A;  3K7A H;  3RLO A;  1QJO A;  2Q8T A;  3H3V I;  5CV7 A;  1XTC D;  1LTG D;  5D14 A;  4BBS H;  3D4R A;  1QWY A;  2LFN A;  3ICE A;  3TRZ A;  4YHH L;  3M4O B;  5J1Z A;  4OEL B;  4RCO A;  3NEM A;  4IUT A;  1TY0 A;  2NVY B;  1SYD A;  4GLX A;  2DUD A;  4PZ7 A;  2K4K A;  2WII B;  3EVQ A;  1KL9 A;  1SNP A;  1P8L A;  1PFS A;  3KBG A;  1I94 L;  3M4Q A;  2F52 A;  1LT6 D;  3T13 A;  3RMH A;  4Y7N H;  4EQN A;  3Q24 A;  1IW7 C;  1N33 L;  1O7L A;  4DV3 L;  1KAA A;  2WFW A;  5GAE C;  3KF6 B;  4YHH Q;  1EWI A;  2UUC Q;  1XNQ L;  2C35 B;  3T1Y Q;  2J4X A;  3M3Y H;  1HA5 A;  3MTS A;  2OWO A;  3KYH C;  3S15 B;  1XMO L;  2R6G A;  4J6H A;  5CBE E;  4POG A;  4DK1 A;  4JYA L;  4DK0 A;  2PYK A;  3R2I A;  2K6A A;  4PMC A;  2NN6 G;  4AYB E;  1N33 Q;  3M9B A;  1VQ8 A;  1TWH H;  2ZXO A;  5IGE A;  1OXX K;  2LXJ A;  3ULP A;  1TWG B;  2X6L A;  4HN7 A;  1I4X A;  1Y1V B;  1YNN C;  4U67 3;  4DV2 L;  1XNQ Q;  4OX9 Q;  4DPG A;  3K58 A;  5M3F G;  1JMC A;  1YNJ C;  1HA6 A;  4LJZ C;  4X3U A;  2CKZ B;  5JVH 3;  3HGB A;  1VQG A;  3FDT A;  4XYQ A;  3S2H H;  1KAW A;  2MJ8 A;  1HQR D;  1NMF A;  2ZTE A;  3PF5 A;  3MC0 B;  4DV7 L;  1EY0 A;  1YJ9 A;  4J8Q A;  3TDQ A;  2WIN B;  1JE4 A;  4A3J H;  5EKI A;  4C3H B;  3Q22 A;  3QOL A;  2B2W A;  2IHF A;  4HJ9 A;  1ICW A;  4Q5V A;  5AFW A;  3S1R H;  1CFM A;  4C3J G;  1PFB A;  1SAP A;  3CPF A;  3T56 B;  4DV1 L;  1RL2 A;  4ZKB B;  4K5W A;  4DV4 Q;  2E5L Q;  1ENF A;  1NUC A;  2LMC B;  1HZB A;  4GNX C;  2DGY A;  4TSS A;  1SXT A;  1ILP A;  4HTH A;  1I3Q B;  5FK9 C;  1QCB D;  1SFO B;  3K5M A;  1TS4 A;  4GOP C;  4FO2 A;  1SRO A;  2EE1 A;  2NVT B;  2PW7 A;  1XMQ L;  2VQE L;  2A69 C;  4QUC A;  2EYP A;  4EGV A;  4YWK A;  3GTQ B;  1R4Q B;  4DV1 Q;  1B1Z A;  2E75 C;  5FLM H;  1L0X B;  2Q2H A;  2K5V A;  4L8J A;  1VQO A;  1FYC A;  2HIX A;  4KI0 A;  4F87 A;  1QVF A;  4BBR H;  2BDO A;  3KJO A;  1PRT C;  2VQE Q;  1WOC A;  1S4Z A;  1K8M A;  2WB1 E;  2FMC A;  5IP9 G;  3A0J A;  4A3D G;  3BYT B;  3OOC A;  3H0G H;  4YY3 L;  2K5Q A;  2FHT A;  5J39 A;  2O4X A;  4MIU A;  3CP0 A;  1TS3 A;  4IQZ A;  4ZUJ A;  4GOP B;  2K33 A;  5HGT A;  3A5U A;  3HOX B;  3ULJ A;  3KF6 A;  2QEX A;  2IPK D;  5JVG 3;  5G3L D;  2A73 B;  5C5M A;  4X6A H;  4JW0 A;  5HUR A;  4YCV A;  4APV A;  2R93 G;  4K2L A;  2BH8 A;  4PZ8 A;  4LF6 L;  4JPB W;  3KLS X;  1YZ6 A;  5GQO A;  1GJX A;  4OL7 A;  1S5D D;  4RH6 A;  3DHQ A;  1NNX A;  5EPK A;  2R7D A;  3OPO A;  1Q86 C;  4C1N I;  1BBU A;  3HKZ E;  5IOC A;  3A8I E;  1C0A A;  1G6P A;  2AWO A;  1IBL L;  5HGQ A;  1KQS A;  1UAP A;  1DZ1 A;  1E2V A;  3H6M A;  1EYD A;  4PMW A;  4LF6 Q;  1OTC A;  1EFI D;  3FKI H;  3I4M B;  3J7A 5;  4UP8 A;  1LTL A;  3KUP A;  3A55 A;  1L0Y B;  4A93 B;  5AJ3 Q;  4EQP A;  3TME A;  1K0S A;  5C4J B;  1K73 C;  1TY2 A;  1B3Q A;  1B7Y B;  1I6H H;  1WTW A;  1FGU A;  4FYD A;  4FXG C;  1MIU A;  2L12 A;  5KYI A;  1UE7 A;  4LMQ D;  4IUP A;  2SOB A;  5I6W A;  4CKB A;  2OQ0 A;  1SJE D;  5BR8 Q;  2F0M A;  3KLR A;  1X6O A;  3D4D A;  5IGC A;  5C4X H;  3AFP A;  1QZH A;  2UXB L;  5LMN W;  2PZW A;  1T5E A;  4LF7 Q;  4BA1 I;  1GHJ A;  2JA6 H;  1D1I A;  4CKC A;  1HFN A;  1VCI A;  1EEF D;  1S5E D;  2G9D A;  4F8M A;  3NEL A;  3EN2 A;  4R4O A;  1LT5 D;  3BZK A;  3SK6 A;  4IUQ A;  3T16 A;  5CR3 A;  4A3C H;  3GTO H;  3HOV B;  1TS5 A;  3S2D H;  1BUV T;  1J5E L;  4NPS A;  3Q8D A;  4A3F B;  1KRT A;  5C0X H;  1YHA A;  3TP7 A;  1OXU A;  1HR0 L;  1L2F A;  1ILQ A;  1TWA H;  4X65 L;  2A5H A;  1L1O B;  4OWT B;  4DAV A;  5EPJ A;  1SEB D;  1I4G A;  2SNS A;  1IYJ B;  4DR7 Q;  3DWQ A;  1J9O A;  4A3K B;  2JEA I;  2XWJ B;  2YTX A;  3STB D;  1G2S A;  1PFM A;  3PO3 B;  1KD1 C;  4GN3 B;  3J80 c;  4P75 A;  1LT4 D;  1HRJ A;  1STY A;  4XQQ A;  5J3B A;  4KD3 A;  1BCP F;  2XTI A;  2A8V A;  2VB2 X;  3WOF A;  2KCN A;  4RGM A;  2RF4 A;  3NK9 A;  2O5I C;  4K8J A;  4KY5 A;  5EBC A;  1KXL A;  2EY6 A;  4MN3 A;  5FOB B;  2PNH A;  4DUY L;  1A8V A;  3MVV A;  3RN2 A;  5IYD H;  5M5Y B;  3R3O A;  2B63 B;  2MP1 A;  2RDH A;  3MXG A;  3P7J A;  4RAU C;  1ET9 A;  3FPU B;  4DXG A;  2PPB C;  3PQI A;  1I5F A;  1DD2 A;  1ASY A;  2K05 A;  3K8A A;  2Y0S E;  3JAM i;  1V1O A;  4LF8 L;  1XX8 A;  3D3R A;  5ELD A;  4NXM L;  4KN7 C;  5ELN A;  5JJL A;  3GTJ H;  4XIG S;  3L3O C;  4IZ8 A;  1AH9 A;  4B9W A;  1Y69 U;  1SE2 A;  3HOY H;  1O7Z A;  2VY3 A;  2ID0 A;  1W6J A;  2OT2 A;  4KV6 A;  4CGY B;  1HH2 P;  4QY7 A;  4LF8 Q;  3PIO A;  2Q8R E;  3OYY A;  4AQY Q;  2D2C C;  1IL2 A;  4K2K A;  1ET6 A;  3PUY A;  3GTK H;  4FF4 A;  3NTH A;  2EPB A;  1GUW A;  1CA5 A;  4P2C B;  1HNZ Q;  2D5D A;  1CTM A;  1MD2 D;  1STB A;  4JI0 Q;  2B2V A;  5FLM G;  1JWU D;  2F0S A;  1D1K A;  2F0J A;  4X3K A;  2EJM A;  1YEZ A;  4QB4 A;  4K6D A;  5DM7 3;  1OO9 B;  3VR5 A;  3BS1 A;  4NP5 A;  1IBK L;  2XIW A;  3J80 i;  1SE8 A;  5C3W A;  1RD9 D;  3VA5 A;  1A15 A;  4OIK A;  1NSN S;  3S16 H;  3PF4 A;  3GTL H;  2I46 A;  4QJF A;  1AP0 A;  1ESR A;  1ZKO A;  1CKN A;  1TT2 A;  2E2I H;  4WRD A;  2QDB A;  2PQA A;  1EL0 A;  4L5Q A;  1SNC A;  1SE3 A;  5COR A;  3TP5 A;  4LF5 L;  2SDF A;  4CDD C;  1SYG A;  4DA2 A;  2H5X A;  1IBK Q;  2C5C A;  3I4N H;  1JJG A;  2AHO B;  2R7Z H;  4DK6 C;  2E2H H;  2NN6 I;  1OXS C;  2NUC A;  2ZTD A;  4B08 A;  2HIV A;  1PXU A;  4L63 B;  1RJT A;  2K03 A;  2ZTC A;  3FPP A;  1VQ5 A;  2TSS A;  1CKO A;  2NVQ H;  1A0I A;  2ZM6 L;  2XGT A;  3UDX A;  1E22 A;  4G4K A;  2NTS A;  1JT8 A;  3CCL A;  4A75 A;  1XNR Q;  2K5H A;  1I50 H;  1SLJ A;  1JC7 A;  3S1N B;  3MAQ A;  2KQ3 A;  1Z6H A;  1JJ2 A;  2A19 A;  2O2L D;  5FO8 B;  3E5S A;  2IY5 B;  3DM3 A;  4K14 A;  3CQZ B;  4HMI A;  4A3G G;  4DNI A;  3OIQ A;  4YIJ A;  4A3M B;  1JOO A;  1MJE A;  3T1H Q;  3KF8 B;  4G7H C;  3S24 A;  2KED A;  5EGT A;  1X65 A;  5LHY 1;  1QG7 A;  2BOS A;  2F3I A;  1D5M C;  4R8I A;  5ELF A;  1Q1E A;  2X69 A;  2RQX A;  2RHS B;  5IT9 E;  4IAL A;  1FNU A;  5G3L F;  1K8A C;  4QGU A;  3J7A V;  1NY4 A;  4LFC Q;  1WTO A;  3BDL A;  2CW0 C;  5M5W B;  1B70 B;  4DR2 L;  1FGB D;  4DR1 L;  1VQN A;  3HOZ B;  5IT9 L;  4PMB A;  2I5M X;  4GS3 A;  3HOU B;  3LWE A;  4XQJ A;  3I4M G;  4UDU C;  2B2T A;  3GTM B;  3F2C A;  2GA4 B;  1LTI D;  3KLW A;  4A93 G;  5C0X J;  1M1K C;  1GUT A;  4C3I G;  1C7Y A;  2K5D A;  4A3I H;  3HZX A;  2RBM A;  2ZXP A;  4RMF A;  1R9T H;  2D0O A;  4A3D B;  1EUJ A;  2UUB L;  2JA8 G;  2EXZ A;  1U4L A;  4DR2 Q;  4DR1 Q;  1MHW C;  2N78 A;  3BVM A;  3L2P A;  4A3E H;  2F0I A;  1ZYR D;  3QJY A;  1JOQ A;  4KLK A;  3WDN A;  4FNF A;  2B2U A;  2PMZ E;  1ASZ A;  1NR2 A;  2R93 B;  3K6O A;  2ASB A;  2NYZ D;  2I0Q A;  4F7X A;  1HR0 W;  4BY7 H;  4B3M Q;  3HOV G;  1EY6 A;  3SE0 A;  4XXE A;  1D8L A;  3KOJ A;  2GVA A;  1Q8I A;  3F8T A;  4L5S A;  1Y1W G;  1K3R A;  4O0A A;  4WJW A;  1RTN A;  2UXD L;  4I65 A;  5M5X B;  4XQN A;  3I55 A;  3ZYY X;  2A1A A;  3PIP A;  5FKA C;  3R2T A;  5FJ8 G;  1IW7 D;  5EPL A;  1HCZ A;  1Y8P B;  1EYC A;  1JB7 A;  3U50 C;  3H3V C;  4ZRZ A;  1N8R C;  1PTO H;  2K50 A;  4XYO A;  1VQC A;  1QVG A;  4JI7 Q;  4JG2 A;  3CCJ A;  4YCW A;  1SN8 A;  1J6Q A;  1E24 A;  1WTX A;  4NXN L;  1PFN A;  5JJK A;  5CV6 A;  1XPU A;  1EWC A;  4DR3 L;  3HOW G;  1K3B C;  3UDG A;  3K7A B;  2XSC A;  2B63 G;  1SDF A;  3L7Z C;  2JK8 A;  3U4Z A;  4BBS B;  2EYF A;  4PV1 C;  3B6Y A;  3VYT A;  2M2L A;  2AUK A;  1BKB A;  4BY1 H;  1E1O A;  3S17 H;  1X3F A;  4R4T A;  1YJW A;  1QNU A;  1OXV A;  1WCM H;  5CV5 A;  3W1B A;  3G4S A;  4KY7 A;  1VF5 C;  5EJW A;  2JA7 G;  1JWM D;  4GKK L;  2EYM A;  4BWG B;  5GAH C;  1VQ4 A;  4GLA C;  2DJG C;  1TVX A;  5KND A;  3K57 A;  1BCP D;  1MKH A;  2JSO A;  5M3M H;  5F2D A;  3I72 A;  4B3T L;  2K14 A;  4J15 A;  5I6Y A;  5IYB G;  3HFZ B;  5LMN Q;  3NSW A;  3M3Y B;  5IY0 A;  5E4X A;  4DV5 Q;  3VR3 A;  3QG1 A;  4GKK Q;  2RCF A;  1EQV A;  4EX5 A;  1FVI A;  2B3G A;  1Z47 A;  1SYF A;  2D62 A;  4AH6 A;  5K5P A;  5JPN C;  2QEJ C;  1TWH B;  1K83 H;  1RF2 D;  4HJ7 A;  1EFW A;  4JBK A;  4B3T Q;  5JAV A;  2H4O A;  3K7U C;  3CPW A;  3CW2 C;  1IZ6 A;  1VQH A;  4A3B H;  5KEE A;  1R4P B;  5IYC G;  2VL6 A;  4RG1 A;  4S3S A;  1VQ9 A;  2NVX B;  3S2H B;  1CM9 A;  3M85 A;  4N8X 1;  4UP9 A;  3E0J A;  2FIN B;  1W6K A;  3OW7 A;  1I94 Q;  1WTH A;  3PMF A;  4QIW E;  5EQ0 A;  1EIH A;  4IPG A;  2OQK A;  4KY6 A;  1PH8 A;  1EYA A;  3AB9 A;  4DV3 Q;  4A3J B;  1KC8 C;  5E3F A;  4HJA A;  1WD1 A;  2Z6K A;  1S3O A;  3S1R B;  4MHE A;  2JA5 H;  1LLR D;  2EY1 A;  2K1B A;  2EYH A;  1U4M A;  2Z4I A;  2L9H A;  1SR3 A;  3ND9 A;  5DEH A;  1DOM A;  4RA8 A;  5C3X A;  2AUJ D;  1D7Q A;  1XMO Q;  5C5L A;  4B3R L;  4JOI A;  4JYA Q;  3QWN A;  1EY8 A;  1RTO A;  4CDC C;  3ONA B;  4QL5 A;  4JV5 L;  1SSO A;  5M9O A;  1A3V A;  3CXC A;  3U4V A;  5D3D A;  4DV2 Q;  5IOD A;  1TU2 B;  4A3L G;  3PIO 3;  2F0G A;  1CKM A;  1I6V C;  4B3R Q;  4A3M G;  3A7A B;  5T1I A;  4FF1 A;  1PH9 A;  2F0D A;  5EKK A;  2R92 H;  3V2T A;  1SYB A;  4BBR B;  4JV5 Q;  4ZKC B;  4JI4 L;  2HD3 A;  4DV7 Q;  2HHH L;  4BXX G;  3J81 E;  1JOK A;  1KNA A;  3D8G A;  4X64 L;  2CVR A;  1JE5 A;  1BOS A;  2Q2I A;  1E2Z A;  3S9W A;  1EIG A;  3H0G B;  1QNK A;  5JEA G;  4K5X A;  2CH4 A;  2HQE A;  3J81 L;  4ABN A;  3D0F A;  5FLX E;  1GUG A;  5KGU A;  2H1E A;  1K0R A;  3HOZ G;  5COY A;  2HHH Q;  1XPO A;  3HOU G;  4X64 Q;  4IUN A;  1HNX L;  5A2Q E;  4OHJ A;  4FXK C;  1FR3 A;  1XMQ Q;  3TSS A;  4JI1 L;  5FLX L;  5JOB A;  4C3H H;  4DN4 M;  5C3E G;  3Q0A A;  4H0L C;  1SRU A;  3HKS A;  2WAC A;  5A2Q L;  2NBF A;  1JWS D;  4LUZ A;  5LMU L;  1IKM A;  1EOT A;  3F2D A;  3M4P A;  2KCC A;  5IIF A;  1LTB D;  5I4D A;  4DV0 L;  3BVZ A;  4BA2 I;  1V1P A;  1BCP B;  2UUA L;  4A3G B;  2FMM A;  2KJX A;  4DNR B;  3NBH B;  1SFO H;  3FKI B;  1STE A;  3NE5 B;  2M00 A;  4FF2 A;  3E0E A;  5KYL A;  1MSH A;  5EAY A;  3ITP A;  1UNS A;  2ZT9 C;  1A63 A;  1STA A;  4YY3 Q;  3OW2 A;  4GZY C;  1GUO A;  1VQA A;  1X3G A;  3VDY A;  1I6H B;  3OHX C;  2A68 D;  4YWL A;  4JK1 C;  2F0Q A;  1LV9 A;  5ISR A;  2AQ3 B;  2B2Y A;  2K28 A;  2UUA Q;  3I2Z A;  1DOL A;  1ROD A;  1WFQ A;  1VQE A;  2FJ2 A;  2K5W A;  2PQE A;  3BYY B;  2AQ1 B;  3M7N A;  3K80 C;  1K8G A;  5LL6 S;  5C4X B;  3HP3 A;  4JI5 L;  5K36 H;  1HZA A;  2E2D C;  4FP5 D;  2N88 A;  1SNO A;  4WJ3 M;  1DJR D;  2R3Z A;  4C3I B;  2I5H A;  2E74 C;  5C44 G;  2I5L X;  1HZC A;  4IFD G;  1CQV A;  4IUV A;  2IX3 A;  2O5J C;  1M8A A;  1UEB A;  3GV6 A;  3GTO B;  3BJU A;  5J22 A;  1KLU D;  4Q0F A;  1L1O C;  1VMP A;  1A3U A;  1F2Y A;  4UY8 C;  3SHL A;  1IBL Q;  2JA8 B;  1TKW B;  1B4O A;  4P73 A;  2YU9 H;  1HZ9 A;  4OO1 G;  1G2T A;  4FVM A;  3V05 A;  1TWA B;  2EZV A;  4R4I A;  3DWA A;  3HRZ C;  3F1Z A;  5KRU A;  1RCV D;  4HID A;  1A62 A;  4BBS G;  1V43 A;  2K7V A;  1WI5 A;  2A6E D;  3PV0 A;  1LAB A;  3J7Z C;  1FJG L;  4R1J A;  3AFQ A;  1CKN B;  3DWP A;  3P20 A;  3A8J E;  3DEP A;  2NWG A;  2JJQ A;  2PQA B;  2QCP X;  1L0W A;  2UXB Q;  4ILW A;  1CUK A;  3AU7 A;  1Y1W B;  2XVS A;  5EBD A;  2F0H A;  4YCU A;  2HCC A;  1AEX A;  5C4J H;  1BQQ T;  3M4Y A;  2F4V L;  5JJI A;  4ZLT F;  1CSQ A;  4IN3 A;  1J5E Q;  1ENA A;  2Z0S A;  5IGB A;  4B3S L;  5HY6 A;  4RGO S;  1VQK A;  1HQM C;  1HR0 Q;  5D3I B;  1XPR A;  4X62 L;  4X65 Q;  3G71 A;  4RCN A;  1RKN A;  4IUU A;  1GVP A;  3T53 B;  4R8N A;  1A2T A;  4JI3 L;  1ZXT A;  2VB3 X;  1M90 C;  3DLL A;  4LF4 L;  3NBH A;  3HOW B;  3GTJ B;  3P75 A;  2WB1 G;  3DXJ C;  3FEW X;  2F3V A;  5FO9 B;  1KRS A;  4DNT B;  4B3S Q;  4HIO A;  3ERS X;  3OMC A;  2N8N A;  4HSV A;  4GNX A;  4IUR A;  1TR5 A;  1E2W A;  2F0O A;  2PI2 E;  1V8Q A;  4A3F H;  1O7Y A;  1ONL A;  3CCQ A;  2YTV A;  1LTR D;  4LFB L;  1PYS B;  3A56 A;  4L5T A;  2R61 A;  4PQX A;  3PO2 H;  3GTK B;  1SNQ A;  2KVM A;  2JA7 B;  4A3J G;  4M1U B;  4DUY Q;  1I4P A;  1BXT A;  3NTI A;  1LM0 A;  4KHZ A;  4A3K H;  1YNX A;  3SGI A;  2UXC L;  1LO5 D;  5IT9 c;  1GHK A;  1N34 L;  3PO3 H;  4K8I A;  2OCE A;  3P1H A;  1AZQ A;  1PH6 A;  2AMC B;  4KKU A;  4XTC S;  4GKJ L;  4TRD A;  2LXK A;  2ZJP A;  4HR7 B;  1SNM A;  1BO0 A;  4NXM Q;  3S14 H;  3EJI A;  2QW7 A;  1EY9 A;  1PTO D;  2E2I B;  4DF7 A;  5T1G A;  1IYV A;  1SMY D;  3IAY A;  2P5Z X;  1CHQ D;  3U9O A;  4FDB A;  1X54 A;  3GTG H;  3I4N B;  2NZ1 D;  3A7L A;  2R7Z B;  3BG3 A;  1EZ8 A;  3JAM E;  4HIK A;  2E2H B;  1F9S A;  2WAQ G;  1EQQ A;  3L0O A;  4BBR G;  4GKJ Q;  3T4A C;  4IPC A;  1K28 A;  3OIP A;  5DAU A;  1JR0 D;  1Q81 C;  1X3P A;  2V1C C;  3Q6S A;  2N55 A;  1PZK D;  2EQS A;  3NWT A;  3JAM L;  2F0U A;  2JYO A;  3HEJ A;  4LNQ A;  3H0G G;  2F1M A;  2K75 A;  4UHV A;  3IFD A;  2F0E A;  3STB C;  4CHT B;  4DKA C;  1PYB A;  3V96 A;  3VYS A;  5FO7 B;  4JCV E;  2QIL A;  1AE2 A;  2D0P A;  2PCF B;  3CF5 A;  3EA6 A;  4RFB A;  4A76 A;  3OWF A;  2I07 B;  1I4Q A;  1X56 A;  2RVL A;  3SVM A;  1NMG A;  1SE4 A;  3W5O A;  2A6H C;  1SYC A;  2PW5 A;  2Z9H A;  5KIX A;  2ZJR A;  1DXM A;  4LW1 A;  1Q12 A;  4P71 A;  2NZH A;  4KK7 A;  4LF5 Q;  1Q46 A;  2RSN A;  1KLG D;  1A6X A;  3I4O A;  4OWW B;  2L15 A;  3J7Y W;  3I7F A;  4ZCK A;  1D2B A;  2BE5 D;  1CK1 A;  4KHP L;  4TQU S;  2K01 A;  3BZC A;  3MXN A;  1E7Z A;  3C1F A;  4K6L A;  4C2M B;  2N49 A;  3KFU A;  4H02 A;  5CMD A;  1UUP A;  2B8F A;  3NXW A;  2Q8I B;  4CBV A;  4RHS A;  1F2M A;  1STG A;  3FKI G;  2ZM6 Q;  4PG3 A;  1S5F D;  4UPA A;  4RKB A;  4IPH A; 
#chains in the Genus database with same CATH homology
 3F2U A;  3UE1 A;  3U9S A;  2NN6 H;  1AN8 A;  1Q7Y C;  4Y52 H;  1STN A;  1F77 A;  4A3I B;  2ES2 A;  5ELC A;  2JE6 I;  4KHP Q;  1GM5 A;  1BF4 A;  4R9W A;  1SND A;  1JCK B;  3WOE A;  5M3F H;  1YHB A;  4JI2 L;  2OF1 A;  3E6Z X;  1GXD C;  2V4D A;  1F2Z A;  4JI1 Q;  3D31 A;  1QUQ A;  2KA7 A;  3CCV A;  5C4X G;  1C48 A;  2Z4H A;  1VF7 A;  2VZA A;  3K5N A;  4K5V A;  1F9P A;  2JA6 G;  2E76 C;  5LL6 X;  2XWB B;  1LAC A;  4DXF A;  4GLV B;  3C1E A;  2MGS A;  3S1N H;  4ID6 A;  4TKO B;  3RUZ A;  5C3E B;  4MTN A;  2NTT A;  2L11 A;  4A3C G;  1LT3 D;  1E0B A;  3CQZ H;  4C3J H;  4LUV A;  4QUF A;  1T5X D;  1PLF A;  2VUM H;  1WTQ A;  5C0X G;  2EDG A;  2D9U A;  5IGF A;  3K81 C;  2CCZ A;  3UE0 A;  1CA6 A;  1D6E C;  1SMX A;  1B53 A;  1BR9 A;  4KKS A;  1W2B A;  2DY8 A;  1PDQ A;  1TQO A;  4OXP A;  1QOH A;  5CGK A;  4JBW A;  3S1Q H;  4V0B A;  1GUS A;  3K59 A;  4QQB X;  1B9M A;  1OXT A;  4ZK9 B;  3IRB A;  1U5K A;  1EU4 A;  4KKT A;  2CQA A;  3AEV A;  4MZ9 A;  2UUB Q;  2ICI A;  1PTO B;  5KNB A;  1FD7 D;  1H9M A;  2B2W C;  2E2J B;  5CYU A;  2QGQ A;  2EY5 A;  1UE5 A;  3CAM A;  5M5W H;  1I4R A;  1A2U A;  1ENC A;  2EIF A;  1B44 D;  4LK1 C;  3GTM H;  1TWF B;  3W3A A;  1NBW A;  1N36 L;  5IYD G;  3CCM A;  1KHI A;  2SNM A;  5IP9 H;  2EY2 A;  5ELE A;  3WWV A;  2K04 A;  4AYB B;  1C8C A;  1RHP A;  2B39 A;  4BY1 B;  5C44 B;  4DR4 L;  3S17 B;  1KIX A;  1X3E A;  1WCM B;  3A54 A;  3SK5 A;  2F0N A;  2IWH A;  4DGZ A;  3H91 A;  1V9P A;  1CZG A;  2AQ2 B;  4V19 0;  1K8O A;  1IBM L;  1EIF A;  4DAY A;  1EY4 A;  4J1M A;  5GRO A;  2OEO A;  3NUC A;  2UXD Q;  5ELB A;  1PH2 A;  3LNN A;  3GTP H;  1GUN A;  2F0P A;  2YV5 A;  4X66 L;  4OIJ A;  4IFD I;  3MFY A;  5ELO A;  2R93 H;  3JC6 6;  1IL8 A;  4HCS A;  2BA0 A;  1P16 A;  3RZO H;  3RNU A;  1MSG A;  1YNN D;  5CV8 A;  3HOY G;  3SEB A;  3RD4 A;  4HCE A;  5CC4 A;  2K5N A;  3QO2 A;  1YNJ D;  4OO1 I;  2JA9 A;  3CCS A;  5NUC A;  1IBM Q;  3DEO A;  1S40 A;  3OWE B;  3URY A;  3LX0 A;  4NXN Q;  3CC7 A;  4N9P A;  4DR3 Q;  2Z8L A;  4DAP A;  4K0K L;  3J81 c;  3VR6 A;  1K83 B;  4KJO A;  1FL0 A;  1H9S A;  4Y7N B;  4FXD A;  3X3M A;  1LTS D;  4QCL A;  2DNE A;  1YIJ A;  5IGG A;  3TP8 A;  1MGS A;  1TXY A;  3TS0 A;  4NKL A;  4A3B B;  2BA1 A;  5D65 A;  1YHQ A;  1IXR A;  5FLX c;  2MO0 A;  1AZP A;  1PMR A;  1MBY A;  1EYG A;  3TQY A;  4ME3 A;  1T9H A;  3S1M H;  1B50 A;  3TZU A;  3BDC A;  1O78 A;  5E4W C;  1FNV A;  5I2Y A;  2A69 D;  4DU9 A;  1VQP A;  3I4N G;  3RZD H;  2JA5 B;  1V1P B;  1TWC H;  2R7Z G;  2WB1 B;  1WTP A;  1DOK A;  2UUC L;  1PTO F;  3FRP B;  4OGQ C;  2IT1 A;  3IKJ A;  3T1Y L;  3ERO A;  4HED A;  3H3V H;  2KEN A;  4DR5 L;  2NB0 A;  2KOL A;  1N32 L;  1LUZ A;  1QZG A;  1DCZ A;  1ML0 D;  1PRT D;  1IKL A;  1AE3 A;  2PO4 A;  4R4C A;  3EIV A;  3K0Y A;  4RGT A;  2HUG A;  3M7G A;  3A8K E;  1Q3L A;  4OX9 L;  1F2L A;  3M4O H;  1U0L A;  1DGS A;  1GD7 A;  1EY5 A;  3X3N A;  2R92 B;  5GAD C;  2KHI A;  2NVY H;  4DR5 Q;  1VQL A;  4H13 C;  3MA2 B;  1N32 Q;  3HKZ B;  1DM0 B;  5CV4 A;  1U4P A;  3W1G A;  5DLQ E;  3GP7 A;  4KJN A;  2HT1 A;  4ME5 A;  3J81 i;  1Q8K A;  2VQF L;  3SR1 A;  4N9T A;  1WJJ A;  4HMJ A;  5C4Z A;  5C6A A;  1BBX C;  1H9J A;  4RGN A;  3I8Z A;  3Q23 A;  3I4L A;  2NVX H;  4CJ1 B;  5IP7 H;  4DV4 L;  3S15 H;  3VR2 A;  4XT3 B;  2WAQ B;  2DNC A;  3AQQ A;  2E5L L;  2EXD A;  1A3T A;  3KK7 A;  1G29 1;  3H09 A;  3EQL C;  1XJV A;  4G7O C;  2VQF Q;  1EIY B;  3IFT A;  2IX0 A;  4A3I G;  1Z7T A;  1SBB B;  3AMU A;  1BCP C;  1TWG H;  2QKI C;  1Y1V H;  1E3P A;  2KUM A;  4ALP A;  4F88 A;  4MNO A;  1PHJ A;  2IX1 A;  1VQ6 A;  2VUM G;  2BH2 A;  2EVB A;  3RLN A;  2L5T A;  1W3S A;  1STH A;  5JEA J;  2MQH A;  4JI4 Q;  5TSS A;  1PV4 A;  4A3E G;  1N9W A;  2KBN A;  5IGD A;  2L1B A;  4LAA A;  4JI6 L;  1DYQ A;  2RSO A;  5I2X A;  2JQO A;  2AKW B;  1HFG A;  3CRL C;  1I4H A;  3HS0 C;  3MXU A;  2B29 A;  1ZEQ X;  2CFM A;  1MJC A;  2NZO A;  2G9H D;  1HJP A;  3CRK C;  4ZYS A;  4BY7 G;  4ZAI A;  2A74 C;  1D5Z C;  4I7Z C;  3GV3 A;  2F03 A;  2PZT A;  1B3A A;  3G7L A;  3CC2 A;  2EJF C;  1GKH A;  2RA4 A;  4JI6 Q;  1EU3 A;  1G8Z D;  1II3 A;  1HNX Q;  4L5R C;  2LY7 A;  4G57 A;  1EY7 A;  3MZ5 A;  1I3Q H;  3CU7 A;  2YTY A;  2RKS A;  3G6J B;  1VQI A;  4KMU C;  2ZXR A;  2KCM A;  2NVT H;  2EYJ A;  4GNX B;  4ODG A;  2VW9 A;  3GTQ H;  5LMU Q;  1KDA A;  3ERQ A;  5A35 A;  4O42 A;  3LWU A;  1WYD A;  1WTR A;  4DV0 Q;  2B2V C;  2F0K A;  3UDI A;  1VQ7 A;  3OTO L;  3F2B A;  2F0F A;  4DAM A;  3CCR A;  2YU9 B;  3PSI A;  4YWM A;  3QIA A;  1HUN A;  3D4W A;  3ND8 A;  4NDX A;  5H1S E;  3G6E A;  2KHS A;  3PUX A;  2Q2T A;  2IJ0 A;  2Y0S B;  2JA6 B;  3RR5 A;  4AYB G;  2OTL A;  5AJ3 L;  1NCV A;  3GO5 A;  1KDB A;  4BY1 G;  1BVS A;  1PRT B;  3K5O A;  4UP7 A;  3ZJY C;  1V1Q A;  3OTO Q;  1WCM G;  1NE3 A;  3PGZ A;  3C3L A;  1F9Q A;  4JI8 L;  3S2D B;  1EOV A;  3HOX H;  1SYE A;  4A3G H;  1KNE A;  1AFP A;  3BDO A;  1PH3 A;  4IFD J;  1UEA B;  5I9P A;  4JI5 Q;  5BR8 L;  2RDG A;  3NP8 A;  5CBA E;  2F0W A;  1PH4 A;  2FXQ A;  3CCE A;  3MHB A;  4LF7 L;  5M3M G;  1HXY D;  3IL8 A;  5C0X I;  2WAQ E;  3W2D A;  4LUO A;  4JI8 Q;  4P72 A;  2VXW A;  4ZUI A;  3JAM c;  3E9I A;  5E1F A;  4ULL A;  3R8B A;  3PUZ A;  3CD6 A;  4IJH A;  3I4M H;  2KEE A;  5JPM C;  1G91 A;  4A93 H;  3GD7 A;  1JOR A;  2MUY A;  4C3I H;  1JB3 A;  2QF7 A;  4A3B G;  4DR7 L;  2WKC A;  3MXP A;  1FJG Q;  3RLF A;  1F9R A;  4HSP A;  4M8A A;  3G48 A;  2JA8 H;  3PIP 3;  3H15 A;  4DK3 C;  2ENB A;  2F0T A;  3PO2 B;  4KHV A;  1EEI D;  2IL8 A;  1JJC B;  2MFI A;  4ZQ3 A;  2LS0 1;  4B9X A;  4PZ6 A;  1VQJ A;  3QB3 A;  1U4R A;  3NEN A;  1X9N A;  3SXH A;  2B2T C;  2JA5 G;  1X3Q A;  3MXN B;  5DM6 3;  2F4V Q;  2A68 C;  5GAG C;  3VA7 A;  4RKL A;  3I56 A;  3HOY B;  1QIL A;  1B9N A;  3HOV H;  4GN5 A;  2JP1 A;  1LTA D;  3K0X A;  3TBI B;  2HDM A;  4X62 Q;  4GOP A;  2A6H D;  4EQO A;  5IE8 A;  4CJ2 C;  4POF A;  4JI3 Q;  4U68 A;  3S14 B;  4L6T B;  1GO3 E;  1PYW D;  4WOR A;  1Y1W H;  5C4H A;  2WV6 D;  1RDP D;  4C1N K;  4LF4 Q;  1G6Z A;  4XT1 B;  2JXM B;  3CKI B;  3O13 A;  2F3W A;  5FJ8 H;  2PI2 A;  1O80 A;  2WP8 J;  3LGJ A;  3I70 A;  1XTD A;  2B2U C;  4HAE A;  3MEH A;  3GTG B;  4BS9 A;  2L4N A;  2UU9 L;  5IP7 G;  1QUQ B;  1PRT F;  4NB3 A;  4CKE A;  2XRQ D;  2K52 A;  2R92 G;  4LFB Q;  1HNW L;  2Q2U A;  3QOJ A;  2LSS A;  2N3S A;  1WVL A;  4RWS C;  1NR4 A;  3C2P A;  3HKZ G;  3S16 B;  3MEF A;  1YI2 A;  2EJG C;  3GTL B;  4IOA A;  1G51 A;  3DMU A;  3NQI A;  4AQY L;  2MNA A;  4QF4 A;  4Z9C B;  1KDC A;  1Q90 A;  4IOC A;  5CV9 A;  1S72 A;  1Y1V G;  2UXC Q;  1AW7 A;  3HOW H;  2EOT A;  3DUZ A;  5M5Y H;  3CC4 A;  2A6E C;  1HNZ L;  2UU9 Q;  1N34 Q;  2PNR C;  3KBX A;  5JJZ A;  4JI0 L;  2B63 H;  3EBE A;  3NPP A;  4H7B A;  1CSP A;  2J0T D;  1HNW Q;  2PZU A;  2CW0 D;  1WTV A;  1PH5 A;  1BNZ A;  4WJ4 A;  1CT1 D;  5KNC A;  1X32 A;  3DM1 A;  4QMG A;  2CWP A;  3ER0 A;  2KEC A;  2NVQ B;  2HQL A;  4A4I A;  2JA7 H;  3SK8 A;  3GDE A;  1NJI C;  4C3H G;  4E6I A;  1GOZ A;  2KHJ A;  1VQD A;  1I50 B;  4OON A;  3CCU A;  3I90 A;  2PMZ B;  1PH7 A;  5IYB H;  2HDL A;  1J8I A;  3K5L A;  4DUZ L;  1ESF A;  1LTT D;  1FNW A;  3I73 A;  1JIC A;  1PVO A;  2MHV A;  3CMA A;  4P74 A;  1LYL A;  1H95 A;  3PUV A;  1B2T A;  3NWS A;  1YIT A;  2FFK B;  1NAP A;  1XNR L;  3VR4 A;  1L1O A;  3J81 j;  3HG9 A;  2IHE A;  1WD0 A;  1TS2 A;  3J80 E;  1K9M C;  4DUZ Q;  5M3F B;  2LKV A;  4DAY B;  1NTG A;  3KDF B;  4DV6 L;  1TII D;  2XRS D;  5IYC H;  1VQB A;  4LF9 L;  3FHW A;  2QA4 A;  3T1H L;  3KLS A;  2M9V A;  5K36 G;  3VYU A;  5I9O A;  1CZW A;  1YJN A;  4C56 C;  3J80 L;  1Q82 C;  1KTK A;  4JC0 A;  1EWH A;  5BN4 A;  1C4Q A;  3KJP A;  2VS1 A;  1UWV A;  1S5B D;  2GVB A;  4KN4 C;  3ULL A;  1Z9F A;  2F0V A;  3RN5 A;  4DV6 Q;  1R9T B;  4RHR A;  3HOX G;  3VYR A;  1SJH D;  4C3J B;  4LF9 Q;  1EQR A;  3CHB D;  2VUM B;  4LFC L;  2IW3 A;  4HJ5 A;  1Y8N B;  3R93 A;  1H9S B;  1B8A A;  3BVG A;  1PZJ D;  1XWE A;  1Q1B A;  1PTO C;  4A3E B;  1PZI D;  3S1Q B;  1VMC A;  1SMY C;  2Y0S G;  2Z1C A;  4IO9 A;  1KAB A;  4G7Z C;  1QB5 D;  5BN3 A;  2GN5 A;  3TEH B;  4PNY A;  3C46 A;  1XXG A;  4A3L H;  4BY7 B;  4JI2 Q;  2L55 A;  4XDX A;  3OMG A;  2Z6K C;  1XYI A;  2JEB I;  3N6R A;  2OXP A;  4C2M H;  4A3M H;  4R4Q A;  2EYO A;  2OTJ A;  3FVQ A;  4AIM A;  2K32 A;  3NBI A;  2WKD A;  1E1T A;  3D6W A;  1CI3 M;  2B8G A;  4JOI C;  4DFA A;  4BXX H;  1S5C D;  1QE6 A;  3U58 A;  2X6G A;  3MWY W;  3J7A F;  1PA6 A;  3PCO B;  4O2D A;  2DY7 A;  2F4I A;  1HTL D;  2KCT A;  5JEA H;  4B3M L;  4O1N A;  2HCI A;  5EKL A;  1VS0 A;  3BU2 A;  2RCN A;  3CME A;  1YBY A;  2ZJQ A;  1VQM A;  3HOZ H;  3HOU H;  3FMC A;  3GTP B;  3FP9 A;  4NMZ A;  1VQF A;  4EQ5 A;  1EZ6 A;  3TN2 A;  3PUW A;  4OWX B;  5BN5 A;  2MPM A;  2J7Z A;  1Y8O B;  3H94 A;  4QIW B;  3BZD B;  3NHH A;  3RZO B;  4IPD A;  2BDN A;  1RIP A;  2ATW A;  5C3E H;  2BE5 C;  1CHP D;  3T51 B;  1C9O A;  2R7F A;  4A3D H;  4EVO A;  3A5Z B;  4A3F G;  1HHV A;  5E7N A;  3OSO A;  4DR6 L;  2CWA A;  2YYZ A;  4JI7 L;  3UDF A;  3PO2 G;  2RDF A;  4WFN 3;  1X55 A;  3KDF A;  5DNF A;  1BBW A;  2C9O A;  1N36 Q;  1H9R A;  2F0L A;  2TMP A;  3D6C A;  3TS2 A;  3N52 A;  4A3K G;  3SK4 A;  3TRE A;  3MFG A;  2CQO A;  4CJ0 B;  3PO3 G;  2XN9 C;  3TZD A;  1UE6 A;  2L0C A;  4NW2 A;  1U9R A;  5M3M B;  3E9H A;  4DR4 Q;  3A74 A;  4DR6 Q;  4H44 C;  2EYL A;  1HPC A;  2AWN A;  2E2J H;  2RHQ B;  4GN4 B;  4LWC A;  1MI2 A;  4KD4 A;  4LFA L;  4KTA A;  3TP6 A;  1M4V A;  2VNU D;  1IYU A;  5IWA L;  1HUM A;  4TVA B;  1CQF A;  3L9A X;  4JBJ A;  3I91 A;  4HJ8 A;  1TWF H;  2E8G A;  4X66 Q;  3KF8 A;  3S1M B;  1UE1 A;  5M5X H;  1O7I A;  4IJL A;  1H9K A;  1VDZ A;  2ICE C;  1EQT A;  4FF3 A;  3GQB A;  3RZD B;  2SEB D;  4X3S A;  1DON A;  1TWC B;  3UI2 A;  4LFA Q;  3AYH B;  3SDZ A;  5C44 H;  2ALY B;  5IWA Q;  2XNA C;  1HTP A;  3EFX D;  4IFD H;  5LMN L;  1BDO A;  3I3C A;  1IHZ A;  2MO1 A;  4JBM A;  1YVC A;  4DV5 L;  2CHB D;  3NQT A;  2B2Y C;  2DN8 A;  4X3T A;  4HIM A;  4K0K Q;  1JQY D;  2BCO A;  1ZYR C;  4OO1 H;  1D5X C;  1Y14 B;  1QVC A;  1PH1 A;  3NTK A;  4UAI A;  3K7A H;  3RLO A;  1QJO A;  2Q8T A;  3H3V I;  5CV7 A;  1XTC D;  1LTG D;  5D14 A;  4BBS H;  3D4R A;  1QWY A;  3ICE A;  2LFN A;  3TRZ A;  4YHH L;  3M4O B;  5J1Z A;  4RCO A;  3NEM A;  4IUT A;  1TY0 A;  2NVY B;  1SYD A;  4GLX A;  2DUD A;  4PZ7 A;  2K4K A;  2WII B;  3EVQ A;  1KL9 A;  1SNP A;  1P8L A;  1PFS A;  1I94 L;  3KBG A;  3M4Q A;  2F52 A;  1LT6 D;  3T13 A;  3RMH A;  4Y7N H;  4EQN A;  3Q24 A;  1N33 L;  1IW7 C;  1O7L A;  4DV3 L;  1KAA A;  2WFW A;  5GAE C;  3KF6 B;  4YHH Q;  1EWI A;  2UUC Q;  1XNQ L;  2C35 B;  3T1Y Q;  3M3Y H;  2J4X A;  1HA5 A;  3MTS A;  2OWO A;  3KYH C;  3S15 B;  1XMO L;  2R6G A;  4J6H A;  4POG A;  5CBE E;  4DK1 A;  4JYA L;  4DK0 A;  2PYK A;  3R2I A;  2K6A A;  4PMC A;  2NN6 G;  4AYB E;  1N33 Q;  3M9B A;  1VQ8 A;  1TWH H;  2ZXO A;  5IGE A;  1OXX K;  2LXJ A;  3ULP A;  1TWG B;  2X6L A;  4HN7 A;  1I4X A;  1Y1V B;  1YNN C;  4DV2 L;  4U67 3;  1XNQ Q;  4OX9 Q;  4DPG A;  5M3F G;  3K58 A;  1JMC A;  1YNJ C;  1HA6 A;  4LJZ C;  4X3U A;  2CKZ B;  5JVH 3;  3HGB A;  1VQG A;  3S2H H;  3FDT A;  4XYQ A;  1KAW A;  2MJ8 A;  1HQR D;  1NMF A;  2ZTE A;  3PF5 A;  3MC0 B;  4DV7 L;  1YJ9 A;  1EY0 A;  4J8Q A;  3TDQ A;  2WIN B;  1JE4 A;  4A3J H;  5EKI A;  4C3H B;  3Q22 A;  3QOL A;  2B2W A;  2IHF A;  4HJ9 A;  1ICW A;  3S1R H;  5AFW A;  4Q5V A;  1CFM A;  4C3J G;  1PFB A;  3CPF A;  4DV1 L;  1SAP A;  3T56 B;  1RL2 A;  4DV4 Q;  4K5W A;  4ZKB B;  2E5L Q;  1ENF A;  1NUC A;  2LMC B;  1HZB A;  4GNX C;  2DGY A;  4TSS A;  1SXT A;  1ILP A;  4HTH A;  1I3Q B;  5FK9 C;  1QCB D;  1SFO B;  3K5M A;  1TS4 A;  4GOP C;  4FO2 A;  1SRO A;  2EE1 A;  2NVT B;  2PW7 A;  1XMQ L;  2VQE L;  2A69 C;  4QUC A;  2EYP A;  4EGV A;  4YWK A;  3GTQ B;  4DV1 Q;  1R4Q B;  1B1Z A;  5FLM H;  2E75 C;  1L0X B;  2Q2H A;  2K5V A;  4L8J A;  1VQO A;  1FYC A;  2HIX A;  4KI0 A;  4F87 A;  1QVF A;  4BBR H;  2BDO A;  3KJO A;  2VQE Q;  1PRT C;  1WOC A;  1S4Z A;  1K8M A;  2WB1 E;  5IP9 G;  2FMC A;  3A0J A;  4A3D G;  3BYT B;  3OOC A;  3H0G H;  4YY3 L;  2K5Q A;  2FHT A;  5J39 A;  2O4X A;  4MIU A;  3CP0 A;  1TS3 A;  4IQZ A;  4GOP B;  4ZUJ A;  2K33 A;  5HGT A;  3A5U A;  3HOX B;  3ULJ A;  3KF6 A;  2QEX A;  2IPK D;  5JVG 3;  5G3L D;  4X6A H;  2A73 B;  5C5M A;  5HUR A;  4YCV A;  4APV A;  2R93 G;  4PZ8 A;  2BH8 A;  4K2L A;  4LF6 L;  3KLS X;  1YZ6 A;  5GQO A;  1GJX A;  4OL7 A;  1S5D D;  4RH6 A;  3DHQ A;  5EPK A;  2R7D A;  3OPO A;  1Q86 C;  4C1N I;  1BBU A;  3HKZ E;  5IOC A;  3A8I E;  1C0A A;  1G6P A;  2AWO A;  1IBL L;  5HGQ A;  1KQS A;  1UAP A;  1DZ1 A;  1E2V A;  3H6M A;  1EYD A;  4PMW A;  4LF6 Q;  1OTC A;  1EFI D;  3FKI H;  3I4M B;  3J7A 5;  4UP8 A;  1LTL A;  3KUP A;  3A55 A;  1L0Y B;  4A93 B;  5AJ3 Q;  4EQP A;  3TME A;  1K73 C;  5C4J B;  1TY2 A;  1B7Y B;  1I6H H;  1WTW A;  1FGU A;  4FYD A;  4FXG C;  1MIU A;  2L12 A;  5KYI A;  1UE7 A;  4LMQ D;  4IUP A;  2SOB A;  5I6W A;  4CKB A;  2OQ0 A;  1SJE D;  5BR8 Q;  2F0M A;  3KLR A;  1X6O A;  3D4D A;  5IGC A;  5C4X H;  3AFP A;  1QZH A;  2UXB L;  5LMN W;  2PZW A;  1T5E A;  4LF7 Q;  4BA1 I;  1GHJ A;  2JA6 H;  1D1I A;  4CKC A;  1HFN A;  1VCI A;  1EEF D;  1S5E D;  2G9D A;  4F8M A;  3NEL A;  3EN2 A;  4R4O A;  1LT5 D;  3BZK A;  3SK6 A;  4IUQ A;  3T16 A;  5CR3 A;  4A3C H;  3GTO H;  3S2D H;  1TS5 A;  3HOV B;  1BUV T;  1J5E L;  4NPS A;  3Q8D A;  4A3F B;  1KRT A;  5C0X H;  1YHA A