5C0XI

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
284
structure length
222
Chain Sequence
PEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTDTVKNILVSVLPGTNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 42
structure length 222
sequence length 284
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xI01
3J81j 4GNXA 3UDFA 1X54A 2OCEA 2NZHA 2JA8G 1I6HH 4DUYL 1NY4A 1X55A 4K0KQ 4JI8Q 1JJGA 1X56A 3GTMH 2K5NA 3PIOA 5IP9H 4UPAA 3TREA 3HOYH 1KAWA 2VY3A 2ZTCA 1N36Q 4KHZA 2K52A 5IYCG 1N33L 4JI6L 1GVPA 2UUAL 2CQOA 5HY6A 1GO3E 1I5FA 1VQBA 1WCMG 4BY1G 4DV3Q 2PQAA 2JA5H 1CKNB 1L2FA 5J3BA 1O7IA 3K0XA 1XPRA 2MNAA 2YTYA 3PO2G 4RG1A 4OWWB 4IPGA 5M5WH 3G71A 1SRUA 3S1NH 1HZAA 2KENA 3NBHB 2MQHA 1UE6A 1EYGA 1Y1WH 2AWOA 2YTVA 2VL6A 4R4OA 4AQYQ 1JJCB 2RHQB 4YHHQ 5C3EG 2ID0A 2BA1A 4YWLA 1K3RA 3A5ZB 4A3FH 3L2PA 1PH9A 4DR2L 4FDBA 4QL5A 3KFUA 3RZDH 4A3EG 1J5EL 1AE2A 3L0OA 1WYDA 3S1MH 4IPCA 4PG3A 4DV0L 4A3BH 3STBD 4A3LH 5M3FG 3S17H 4BXXH 4NXNQ 3K7AH 3FP9A 2ZM6Q 2KCMA 4HIMA 1W2BA 1CUKA 1FL0A 2GN5A 4DAMA 4JI4Q 2HHHL 4IFDI 1OXUA 3PF5A 4LUVA 5GAGC 1KIXA 4R4IA 1G51A 4B3TQ 2ASBA 2I0QA 4A3GG 4JYAL 2VNUD 3I56A 1WI5A 2IHFA 4LF8Q 4KLKA 2ZTEA 1NTGA 4O2DA 1MIUA 1VQFA 1EWIA 4IFDG 1EQRA 1KQSA 4NB3A 1U0LA 4WJ3M 2H5XA 4LF7L 2HT1A 1XMQQ 1XMOL 1EIYB 1EUJA 2R7DA 1BKBA 2PNHA 1NMGA 1LTLA 1SR3A 3U58A 3GO5A 2ATWA 2IT1A 3KOJA 1N8RC 1IL2A 2RCNA 3BZCA 1Q81C 4DV5L 3A5UA 1XJVA 4DR1Q 1VQ8A 2WFWA 3STBC 3KF6A 4DR4L 5IP9G 1YBYA 4HJ8A 3KJOA 3HOYG 2KCTA 5JEAG 5BR8Q 4DNIA 2CWPA 3ZJYC 4KHPL 4LNQA 4BY7H 1I3QH 3EN2A 3M4PA 2JA5G 3RLFA 1A62A 2JE6I 4MTNA 4C3HH 1XPUA 3BJUA 1Q46A 1UE1A 1V9PA 3HFZB 1T9HA 3KJPA 1Y1WG 4IFDJ 3AQQA 1PA6A 2QGQA 5C0XG 4A3FG 1B8AA 3CC2A 4X62L 1XNQQ 2UXDL 1KHIA 2NZOA 4JI3L 2GVAA 5IP7H 1LYLA 4DV1Q 4DV6Q 1GM5A 1PFSA 1L1OA 4RMFA 4DPGA 2N8NA 4GOPC 1PH8A 1JJ2A 3KDFA 4A3BG 4DUYQ 4A3LG 2ES2A 3J81c 3VDYA 4DK6C 5IWAL 4BXXG 2UUBL 2VQFL 2B29A 2Y0SG 3H15A 1S40A 2IX0A 3HOXH 4A3CH 3J7ZC 4YCVA 4PZ8A 1OXXK 1IBML 1VQ4A 2K75A 3PCOB 1IYJB 4QJFA 4JI6Q 3S1QH 2ZJRA 5JJIA 4EQ5A 4APVA 4L5RC 1HNZL 1XNRQ 2AWNA 3I7FA 2R92H 4A3MH 3PUZA 4UY8C 1RL2A 4IOCA 1YEZA 3UDIA 1B7YB 4LF4L 2AHOB 1YNXA 3I4NH 3M9BA 4ME3A 1Z47A 2IHEA 4GLXA 4X65Q 2F4VQ 3GTLH 1A8VA 4JOIC 3I4OA 3ULJA 4GNXC 5C4JH 3CCSA 3J81i 3HKZE 4MZ9A 4DR2Q 3PSIA 4TVAB 1VQLA 4NXML 1BVSA 1JMCA 5H1SE 2VW9A 4YY3Q 1VQKA 4JI0Q 4LFCL 4A3DH 1SN8A 2A19A 4ALPA 4L5SA 2N49A 4P72A 4DV4L 3ULPA 3I2ZA 2N78A 4X64L 4DR7L 2E8GA 4BY7G 1I94Q 2GVBA 2CFMA 5IYBH 3PUWA 5FJ8H 5C44H 1Y14B 1K9MC 1K8AC 3PUXA 1GKHA 2OWOA 1RIPA 4GLVB 3CC4A 1TWGH 4JI2L 4B3SL 4JI7L 4LF6Q 2HIVA 4LF9L 1SMXA 2Q2TA 3MEFA 1FVIA 2KBNA 3HOVH 3H0GH 2R93H 1HZCA 1NBWA 1PV4A 3DLLA 2K5HA 5C4XH 3CPWA 4P73A 1IBLL 1N9WA 1EIFA 1P8LA 4O0AA 2D0PA 5IP7G 4LF7Q 3M7NA 2UXCL 1E7ZA 3NEMA 5GADC 1N32L 1SLJA 2HQLA 4JBJA 1SE8A 4R1JA 5DLQE 5LMUL 1VQ5A 5M5YH 4DR5L 1NE3A 2R6GA 4XIGS 2MO1A 1EFWA 1PYBA 3NELA 4R4TA 3M4QA 4DR4Q 2VQEL 3HOXG 2A8VA 1VQ6A 3S2HH 4A3CG 4DR3L 4YCWA 1H95A 5K36G 4HJ9A 2JA7H 1KD1C 2E2HH 1I50H 4KHPQ 3D31A 1QUQB 1YJ9A 4LF5Q 2RF4A 3CPFA 1CKOA 3I55A 4A3MG 1OXSC 2R92G 5IYDH 1S72A 1HH2P 2WAQG 3CF5A 3A0JA 2BH8A 4UP7A 1IBKL 3I4NG 3J7A5 4LFAQ 1Z9FA 4OWXB 5JJLA 4X62Q 1JB7A 4JI3Q 1N34L 5GAHC 4X66L 3OTOL 3RNUA 4JV5L 2OTLA 3RZOH 1L1OB 2FXQA 3BZKA 1VQGA 4A3DG 4QIWE 4GN5A 3G4SA 1MJCA 3GTKH 3UE1A 5LMNL 1C0AA 4DV7Q 4JI5Q 1VQOA 4H02A 1V1QA 2UUBQ 2VQFQ 2D0OA 3CC7A 4B3ML 4KI0A 4IOAA 2LXKA 4JBMA 4OX9L 1PVOA 2PI2A 2Q2HA 4A93H 4LWCA 3F2DA 1IBMQ 5IYBG 5FJ8G 4DR6Q 5C44G 3CMAA 1YJWA 4DV2Q 2HIXA 4LFBL 1PH5A 4BBSH 4B3RQ 4K0KL 1BBWA 1TWFH 3OW2A 4DUZQ 4GOPB 1VQAA 1KC8C 1D7QA 3HOVG 3H0GG 4XTCS 2OQKA 2VUMH 4POGA 2R93G 3KYHC 4GLAC 1N36L 1LM0A 1X65A 4J15A 2ZJQA 2N3SA 1HJPA 1E1OA 5C4XG 1PH4A 3TEHB 4HJAA 2A1AA 4YCUA 2ZTDA 1Y1VH 3CCEA 3FHWA 1L1OC 4DV3L 2B63H 1CKNA 3TS0A 3T1HQ 2DUDA 1PH1A 3HOZH 5AJ3Q 4QY7A 1PH2A 3F8TA 2C35B 2Z6KA 4IJLA 4LFCQ 3UE0A 2BH2A 3F2CA 4C2MH 1VQHA 1TWAH 2EXDA 1WOCA 2D62A 4YWKA 4DKAC 4YHHL 4AQYL 2UU9L 2R7FA 1JT8A 2JQOA 2JA7G 2K14A 1P16A 2K5VA 4GNXB 1X9NA 2CKZB 1U5KA 2CWAA 4OO1I 3PF4A 4Y7NH 1IZ6A 4IPHA 4BBRH 5M5XH 5IYDG 2V1CC 3CCMA 4A3JH 4LF9Q 4QGUA 4A3KH 1FJGL 3GDEA 5EAYA 4DK3C 4X6AH 1HZBA 4JI1L 1YHAA 3CCLA 4L5TA 1N33Q 1D8LA 3T1YL 2OQ0A 2VS1A 1VQMA 3M3YH 2UUAQ 4JI4L 1KRTA 4DR7Q 4OONA 2AMCB 1SROA 2PQAB 4GKKL 3SGIA 2UXCQ 2JA9A 3U50C 1OXTA 5LMNW 3RLNA 5LMUQ 1FGUA 1VS0A 2MFIA 2Q2IA 2I5LX 3BU2A 3PUVA 5GQOA 1K73C 4IJHA 5IY0A 3RR5A 4AYBE 2LSSA 1XMQL 3IRBA 4UP9A 4LUZA 4C3JH 2VQEQ 2JA6H 3WWVA 4DR3Q 2RHSB 3U4ZA 2F3IA 4A93G 1OXVA 5FLMH 3LGJA 3E9HA 1DGSA 3FKIH 1J5EQ 4BBSG 1VQ9A 4DV0Q 3TRZA 1X3EA 2YU9H 1TXYA 3AFQA 4GS3A 3ERSX 5IT9c 2VUMG 3GD7A 3MXNB 1X3GA 4BA1I 1XPOA 3S2DH 1CSQA 1E3PA 1S3OA 1R9TH 1JE5A 1A0IA 1HZ9A 1IBKQ 2WP8J 1VQIA 1Y1VG 2K4KA 1X3FA 3DM3A 3F1ZA 4R4QA 1VQPA 1MJEA 2HHHQ 2B63G 1SFOH 2R7ZH 4JYAQ 3HOZG 1N34Q 3CCRA 3PGZA 3CD6A 1VQJA 1HNWL 3B6YA 3W1GA 3GTPH 1M90C 3S15H 5LMNQ 1BBUA 2JEBI 3NENA 1XMOQ 1WFQA 4B3MQ 1UWVA 2E5LL 3S1RH 1MKHA 4DV6L 4OX9Q 3S14H 3KLWA 4R4CA 4JOIA 4GKJL 4NPSA 4BBRG 4DV5Q 2XTIA 3H3VH 2Y0SE 4LFBQ 3K80C 4A3JG 3CCUA 4A3KG 1M1KC 3KF6B 1HR0L 4A75A 4A3IH 5M3MH 1PH6A 2ZJPA 3HOWH 2F52A 1K8GA 3A74A 2VZAA 3G48A 1UE7A 3GTGH 4A4IA 1PHJA 2UUCL 4QQBX 3PV0A 2YV5A 1ASYA 1Q7YC 3HOUH 1XNRL 1X6OA 3EBEA 1W3SA 2OTJA 4HIKA 3Q8DA 4LUOA 1KRSA 4MNOA 3E9IA 2WB1E 5FLXc 1IXRA 1K83H 2UXBL 2I5MX 3AFPA 1ASZA 2NVXH 3RN5A 3EIVA 2NVYH 1YVCA 2AKWB 2UXDQ 3TQYA 4X65L 2JA6G 2F4VL 2DGYA 3D0FA 4POFA 2UU9Q 2NN6I 5FLMG 2Z0SA 3FKIG 4GN4B 1HNXL 4OXPA 4YY3L 4JI0L 3J80c 3KDFB 3GTQH 2LXJA 1J6QA 1L0WA 5IWAQ 1E24A 2NN6G 2BA0A 4EX5A 1FJGQ 1Q86C 1PH7A 3UDGA 1CSPA 4AH6A 1Q12A 4JI1Q 3CMEA 4JBWA 3T1YQ 1I94L 1C7YA 3RN2A 2R7ZG 3GTOH 1UEBA 4JI8L 3ICEA 1HNZQ 1C9OA 5IE8A 1VQ7A 4LF6L 4GKKQ 2IX1A 2Z6KC 3JAMc 1Q8KA 1VCIA 2XGTA 4L5QA 1E1TA 3G6EA 4LF4Q 2ALYB 4AIMA 3OYYA 3TS2A 5JJKA 2JK8A 3H3VI 3PIPA 1EOVA 4JCVE 5ELOA 4IPDA 4OWTB 1Q1EA 2PI2E 3J80i 4IO9A 1CKMA 3M85A 1YJNA 1QZHA 4Y52H 2NVTH 3I4MH 1VQEA 4AYBG 4NXMQ 1UE5A 4YWMA 2I5HA 3HKZG 1HR0W 2EQSA 2Q2UA 3HKSA 1XTDA 1YHQA 3UDXA 3M4OH 1QVGA 4A3IG 1YITA 5M3MG 4PMWA 4DV4Q 3HOWG 1PYSB 1K0RA 4X64Q 1WJJA 3PO3H 2B3GA 5HGQA 3AEVA 1B70B 1TWCH 3K81C 1AE3A 2JJQA 4P71A 3JAMi 4HJ7A 2JA8H 1QUQA 4PZ7A 4JI7Q 2WAQE 3ER0A 4JI2Q 3CCVA 3HOUG 3S24A 1YIJA 4P75A 4B3SQ 2YTXA 4GN3B 4HIDA 4LF5L 5C0XI 2IY5B 4NXNL 3F2BA 5GAEC 1YHBA 4JG2A 3W5OA 1NJIC 2E2JH 4OO1G 1G6PA 1HNWQ 1GD7A 4JC0A 2ZM6L 5ELNA 4JBKA 5IYCH 4LFAL 4GKJQ 1IBLQ 2CCZA 4DAYB 1VQCA 1Q82C 4TQUS 4B3TL 4WJ4A 4BY1H 1WCMH 4HIOA 4C3IH 2E5LQ 4LF8L 3E0EA 3ULLA 3W1BA 2KHIA 3PO2H 1N32Q 2K50A 3CAMA 4PZ6A 3JC66 4DR5Q 4P74A 2MO0A 3K7UC 4UP8A 2PMZE 3CXCA 3AYHB 3CCJA 1QVCA 4DV7L 4JI5L 1LUZA 1VQDA 3KF8B 5E7NA 1HR0Q 1VQNA 1A63A 1AH9A 4LW1A 5C3EH 1QZGA 1NMFA 5JEAJ 3GTJH 2UUCQ 4DR6L 4A3EH 4DV2L 4DR1L 4B3RL 2QA4A 1KL9A 4GOPA 4DUZL 2QEXA 3CCQA 5M3FH 3U4VA 3K8AA 3S16H 5BR8L 3CW2C 1OTCA 1G291 3PUYA 2UXBQ 2EIFA 1E22A 1Q1BA 5GROA 2YYZA 2WB1G 1V43A 5C0XJ 2E2IH 4HJ5A 3I4MG 3T1HL 4X66Q 3OTOQ 4A3GH 2NVQH 1YI2A 1KXLA 4JV5Q 5AJ3L 1QVFA 1HNXQ 1TWHH 1YZ6A 4A76A 1EQQA 2JEAI 3L7ZC 3RLOA 2L15A 4BA2I 1XNQL 3CP0A 3CQZH 1PH3A 2KHJA 4DV1L 3PO3G
chains in the Genus database with same CATH superfamily
3J81j 2F0NA 1EY0A 3J7AV 2HD3A 4DUYL 1UNSA 1B1ZA 1SXTA 3A8JE 3GTMH 5IP9H 3TZDA 1DJRD 2VY3A 4HCSA 5JEAH 1I4QA 4KTAA 1DCZA 3S9WA 4JI6L 1STEA 2UUAL 4XYQA 1I5FA 2JA5H 4QUCA 1L2FA 2K03A 4A3MB 5T1IA 4RG1A 3NHHA 4IPGA 4OWWB 1HFGA 2KENA 4IURA 4NP5A 3I4NB 2K05A 1Y1WH 1RF2D 3JAML 2AWOA 2RHQB 2BA1A 1K3RA 3A5ZB 4XDXA 1D5MC 1PH9A 2O4XA 4ID6A 1TWHB 3SXHA 1A3UA 5KYIA 4A3BH 2EJFC 5M3FG 3DWPA 2KCMA 4HIMA 1FL0A 2HHHL 4IFDI 1KIXA 1WTOA 5GAGC 4JYAL 1WI5A 1WTVA 4O2DA 1WD1A 1A3TA 1EWIA 2E76C 2FFKB 4PNYA 2F0GA 1KQSA 1FR3A 2WACA 1BKBA 1NMGA 1SR3A 3U58A 1E2ZA 3OSOA 4ZCKA 1IL2A 2B2UC 4WFN3 1EYDA 1GUOA 3A5UA 1E2VA 4DR1Q 1EY8A 3LWUA 3S2HB 2PYKA 2RBMA 2X6LA 1ICFB 2JA7B 2E2HB 1LTTD 4CDEC 5JOBA 4DAVA 3TP7A 3MXGA 3K59A 1XPUA 1Q46A 3U9SA 1V9PA 1T9HA 4CKCA 4EQNA 4IFDJ 5CBEE 3A8KE 4ZRZA 1XXGA 3I73A 2QGQA 5C0XG 3M4YA 2NZOA 1MBYA 2GVAA 4H44C 1LYLA 3VR6A 3RZOB 4OIKA 3GV6A 1D1KA 4GOPC 1AP0A 3KDFA 4XQQA 4DUYQ 2ES2A 2BE5C 4BXXG 2UUBL 2Y0SG 1QNKA 2IX0A 2RVLA 1DOMA 3T4AC 3HOXH 4A93B 4YCVA 4PZ8A 1EOTA 2B2WC 1VQ4A 3PCOB 4JI6Q 3S1QH 1TWFB 1EQVA 4EQ5A 4L5RC 1GUGA 4TSSA 3I7FA 1RL2A 4I65A 3MFGA 4IOCA 1YEZA 2M00A 1EY7A 1A15A 4LF4L 2PNRC 2IHEA 4CBVA 4GLXA 4X65Q 1I4GA 1A8VA 2EY6A 3VYSA 3BYTB 3J81i 4JPBW 1LTGD 3HKZE 3PSIA 1BVSA 3TN2A 5KRUA 1JMCA 1VQKA 1EEFD 4PQXA 1DXMA 1LT3D 4LFCL 5TSSA 4A3DH 5ELDA 1RODA 3K57A 2A19A 4DV4L 3MXPA 3I2ZA 4X64L 1E2WA 1XX8A 1DYQA 2E8GA 2BDOA 2GVBA 4J6HA 1I94Q 4BY7G 4PMCA 1F9QA 4DK0A 4C3HG 5C44H 1Y14B 1GKHA 4LF6Q 1RIPA 5HURA 2Q2TA 2KBNA 3HOVH 3H0GH 1BUVT 1PRTD 1NBWA 2F1MA 3H94A 3FMCA 3CPWA 1EIFA 5KNDA 5IP7G 2HQEA 1E7ZA 1N32L 4JBJA 1SE8A 1SJED 5LMUL 1VQ5A 5M5YH 3T51B 2LMCB 4RGNA 3NELA 2IX3A 5K36G 1VF5C 2WKDA 1GOZA 1IHZA 5FLXE 2YU9B 2SNSA 4LF5Q 2R92G 5IYDH 3E5SA 4QB4A 1EEID 1S72A 2WAQG 4IALA 5K5PA 1IBKL 2B2TC 4LFAQ 4EGVA 4F8MA 1KDCA 4OWXB 3J80E 3Q24A 1SFOB 2R7ZB 1JB7A 2K32A 1N34L 1L0YB 4ZQ3A 1ENAA 1EL0A 2RSOA 1B3QA 4U68A 3GTKH 1S5BD 4CJ2C 2F0WA 4FXKC 5J22A 3FEWX 3OIPA 1VQOA 2UUBQ 3WDNA 3CC7A 1JWMD 2G9HD 4OX9L 1SYBA 4DU9A 4DR6Q 5IYBG 5FJ8G 1B44D 3A8IE 3CMAA 4BBSH 4K0KL 1LTSD 4IZ8A 1VQAA 4DUZQ 2DY7A 2B8FA 2F0TA 4LMQD 4XTCS 3KYHC 4CHTB 2ZJQA 2D5DA 3GTGB 1F2ZA 1E1OA 1WTXA 1Y1VH 5CV4A 4N9PA 5C3WA 1QOHA 1KDAA 2B63H 2NB0A 2NTTA 4HN7A 4RFBA 2DUDA 1S5CD 3HOZH 5IIFA 1K83B 2L12A 2NVXB 4LFCQ 1SAPA 2BH2A 1NCVA 4C2MH 1VQHA 1WOCA 2UU9L 3H3VC 2JQOA 2NBFA 1X9NA 4FF3A 1U5KA 2SOBA 4E6IA 2V1CC 3O13A 1UEAB 4A3JH 1FJGL 4A3KH 2Z9HA 1HUNA 1YHAA 3CCLA 4L5TA 4RWSC 1N33Q 2OQ0A 2VS1A 4U673 3K5MA 3SHLA 2AMCB 1V1PB 2PQAB 4GKKL 2JA9A 3SR1A 5LMUQ 1FGUA 1VS0A 2Q2IA 3C1EA 3PUVA 1K73C 4KN7C 4IJHA 2A68C 1VDZA 3IRBA 4C3JH 4LUZA 2JA6H 1GJXA 2NVTB 2H1EA 5DM63 2F3IA 4K8JA 3E9HA 1Y8NB 1SSOA 2QILA 1QG7A 4ULLA 3M4OB 1LABA 1WTHA 1ZYRD 3AFQA 5IT9c 2VUMG 3GD7A 2CQAA 1X3GA 4BA1I 1BOSA 1I4XA 1E3PA 1R9TH 1L0XB 1JE5A 1EZ8A 1HZ9A 3BS1A 1IBKQ 5CC4A 3N6RA 4C1NK 2IL8A 1N34Q 2E2JB 3PGZA 5C5LA 3GTPH 5C6AA 2EYHA 1XWEA 3S15H 3NENA 1XMOQ 1TS2A 4K6DA 3M7GA 2WINB 1SNPA 2E5LL 3CRLC 4OX9Q 3S14H 2ICEC 3R2TA 4HMJA 4BBRG 4DK1A 2Z6BA 2SNMA 1AZPA 4A3IH 3HOWH 3FKIB 3A7AB 1EY4A 2VZAA 3GV3A 1FGBD 4A4IA 1PHJA 3PV0A 4WRDA 3HOUH 3EJIA 2JSOA 1W3SA 5M3FB 2OTJA 2G9DA 3S16B 3TP5A 4OO1H 2UXBL 5EQ0A 5BN3A 1F77A 2NVYH 2UXDQ 5C3XA 2F4VL 2E2IB 3D0FA 5J39A 2UU9Q 2NVQB 5FLMG 5I6YA 3HS0C 3I8ZA 3FPPA 2KJXA 2LXJA 2AQ1B 4RGTA 3KK7A 4LAAA 1FJGQ 1QCBD 1Q86C 1PH7A 3UDGA 2IJ0A 4AH6A 2DNCA 1CZGA 1QWYA 4OELB 1C9OA 4GKKQ 1STHA 3JAMc 5IGGA 3G6EA 4K14A 5KEEA 5JJKA 3PIPA 1O78A 1EYAA 2PI2E 4IO9A 3M85A 4XXEA 1UE5A 2F03A 2KHSA 3T56B 2I5HA 3DEOA 5NUCA 3DXJC 2MPMA 1XTDA 5M3MG 2JP1A 1PYWD 4XQNA 1K0RA 1WJJA 1B70B 2A73B 4P71A 3GTQB 2JJQA 2JA8H 3AB9A 4JI2Q 3ER0A 3CCVA 3S24A 4P75A 4B3SQ 4GN3B 3S17B 2Y0SB 4NXNL 3F2BA 5GAEC 1YHBA 3KLRA 1GD7A 1V1OA 4ABNA 2MGSA 4R8NA 4EVOA 1SYEA 3MVVA 4WJ4A 1BO0A 4K5VA 2E5LQ 3E0EA 3ULLA 3W1BA 2CHBD 2CH4W 4JVZA 5E4WC 4PZ6A 3JC66 4F7XA 3DUZA 2F0UA 4UP8A 5EGTA 2G5DA 3CXCA 2PW5A 2ZT9C 2WB1B 4DV7L 1AH9A 1SNDA 4LW1A 4WORA 1MD2D 3VR3A 3E6ZX 1XTCD 5D3IB 3CCQA 1CHQD 3U4VA 3PO3B 5BR8L 3PUYA 2UXBQ 1PTOF 1ML0D 1I3QB 2YYZA 3KUPA 3I4MG 1SDFA 4JV5Q 2AQ2B 4UAIA 1CTMA 1TWHH 5M9OA 2CVRA 3L7ZC 3RLOA 3PIO3 1WVLA 1PLFA 2F0PA 2L15A 1EY5A 1XNQL 3CP0A 3CQZH 1EZ6A 3R3OA 3EVQA 4GNXA 4HSPA 1X54A 2OCEA 1AW7A 1PTOH 1JE4A 2K01A 3J80L 4C56C 3TREA 3HOYH 2J4XA 2ZTCA 1N36Q 2K52A 3D4DA 5IYCG 4HEDA 3HRZC 2K5WA 3MFYA 1BNZA 3MZ5A 2CQOA 5HY6A 1VQBA 4BY1G 2IW3A 1XPRA 5J3BA 3K0XA 3BYYB 2WAQB 5M5WH 1SRUA 3S1NH 2YTVA 5I6WA 4R4OA 3W2DA 4AQYQ 4CJ1B 3GTLB 3PMFA 2ID0A 1JQYD 3BVMA 4FDBA 1RTNA 3OW7A 4A3EG 1AE2A 3L0OA 3S1MH 4IPCA 5CV5A 4PG3A 4DV0L 1UAPA 3F2UA 2PMZB 3MXNA 1IKLA 4NXNQ 4KKSA 1S5ED 2GN5A 4JI4Q 3EQLC 1OXUA 2EYJA 4RAUC 1TWGB 2ASBA 3NP8A 3K5NA 4KKTA 1LT4D 4IFDG 1EQRA 4NB3A 1U0LA 1EQTA 1EIYB 1D5ZC 2PNHA 5FKAC 1LTLA 3AU7A 1ESRA 3K0YA 3CU7A 4ZUJA 2K5QA 2BE5D 3KF6A 5IP9G 3KJOA 3GQBA 1BBXC 4ZK9B 5JEAG 5BR8Q 4G57A 1I4PA 1K8MA 3BG3A 1ET6A 2JA5G 3EN2A 3Q6SA 2JE6I 1SE4A 4QF4A 1TT2A 1UE1A 3HFZB 4CJ0B 1Y1WG 1F2MA 1U4LA 1B8AA 1XNQQ 1KHIA 1SNCA 4ZKBB 5EBCA 4PMBA 4DV6Q 1PFSA 3HGBA 3MWYW 2N8NA 1EFID 4A3BG 1JB3A 2RDFA 3VDYA 1HFNA 1FNUA 2X69A 1K0SA 4A3CH 2EOTA 1QB5D 4FYDA 1IYJB 1WTPA 2H4OA 1HNZL 1XNRQ 3SE0A 3UDIA 4OEMB 4CDFC 2HCIA 1B9MA 3M9BA 2DJGC 4JOIC 4GNXC 3DEPA 4TVAB 4NXML 3D3RA 4YY3Q 4JI0Q 1TWAB 2A6EC 1GUWA 4L5SA 4K2KA 3ULPA 1W6KA 2Z4IA 1ENFA 2FHTA 4Y7NB 3PUWA 2MUYA 1K9MC 3PUXA 2ENBA 1S4ZA 4ZLTF 1SMXA 2PO4A 1KTKA 4ZAIA 1PXUA 2R93H 1HZCA 3BDCA 4KMUC 3M3YB 4IN3A 1B9NA 5A35A 2F0DA 3DLLA 2K5HA 5C4XH 4GKJL 1A3VA 4DR7L 1N9WA 1P8LA 4O0AA 1Q8IA 2D0PA 4C3IG 4DAYA 4C1NI 1MSHA 2EDGA 3NEMA 2HQLA 2QDBA 4R1JA 4DR5L 5KGUA 1J8IA 4XIGS 3CKIB 5CBAE 1DONA 5C4JB 2VQEL 5I9PA 1EY9A 3HOXG 1CFMA 4DR3L 4YCWA 2Q8TA 4HJ9A 1KD1C 3TBIB 3NSWA 2RSNA 3D31A 4IUNA 1YJ9A 3OHXC 3P20A 1U4PA 1BCPF 3I55A 1OXSC 4RHRA 1ILQA 1X3QA 3E0JA 2BH8A 1CI3M 3EA6A 3J7A5 4G7ZC 1NUCA 5JJLA 4XQJA 5GAHC 3V2TA 2EPBA 1ICWA 1CZWA 4A3DG 4QIWE 4GN5A 4F88A 1V1QA 5JVH3 3W3AA 5CGKA 1JORA 3SK6A 2EYOA 4JBMA 1PVOA 2PI2A 5C44G 4DV2Q 2CW0C 2HIXA 1PH5A 3VR2A 1BBWA 1NR2A 1KC8C 4GOPB 3C3LA 1D7QA 2TMPA 3BDOA 5M3MB 2EYLA 3HOVG 1QILA 3H0GG 4POGA 1I50B 1GUSA 1CA5A 4J15A 2F0VA 2F3VA 5KIXA 3Q0AA 3SVMA 3TEHB 1BR9A 1ILPA 2ZTDA 5FK9C 4DXGA 1JWSD 3CCEA 3FHWA 2DJFC 5IGBA 4DV3L 1CKNA 4QY7A 3NBHA 4RKLA 4IJLA 1Q3LA 4FO2A 2A68D 1H9RA 4YHHL 4DKAC 1G6ZA 4CGYB 2B2YC 2R7FA 4YIJA 1TY0A 2CKZB 2KUMA 3C2PA 1EU3A 3PF4A 1IZ6A 4JW0A 1TS5A 5IYDG 3IKJA 3ND9A 3SK8A 5KYLA 4TKOB 3CCMA 4QGUA 3R93A 4DK3C 2K1BA 1YNJC 3KBGA 3T1YL 1VQMA 1KLUD 2UUAQ 2NUCA 4DR7Q 5EBDA 3Q22A 1JWUD 3UI2A 3KLSX 4P2CB 5E4XA 2RKSA 4AYBE 1XMQL 4XYOA 4UP9A 4HTHA 2VQEQ 3WWVA 4DR3Q 3U4ZA 3I4MB 4WJWA 3QB3A 1DGSA 3FKIH 5CORA 2L55A 4BBSG 4K5XA 1X3EA 3TRZA 1TXYA 2NN6H 3Q23A 3D4RA 1CSQA 3P1HA 1S3OA 2LS01 1A0IA 2I07B 2WV6D 1VQIA 2HHHQ 1Y1VG 5M5XB 3F1ZA 1MJEA 4R4QA 5BN4A 2B63G 4JYAQ 4V0BA 3I72A 3HOZG 3FPUB 4M1UB 1A2TA 1BBUA 4BY1B 1STYA 3MC0B 3NQIA 1CK1A 4R4CA 5G3LD 4NPSA 2E2DC 4A3JG 2OF1A 4A3KG 2I46A 1M1KC 2TSSA 4A75A 4XT1B 3ND8A 2HDMA 2ZJPA 5C5MA 3GTJB 2KCCA 2L0CA 1Q7YC 1J9OA 3S2DB 4HIKA 3Q8DA 1KRSA 4MNOA 1WTQA 5FLXc 5CV7A 3AFPA 3EIVA 2N88A 2AKWB 3TQYA 4C3JG 2JA6G 3U9OA 3K5OA 2NN6I 4KY5A 1EIGA 4OXPA 3J80c 3KDFB 3GTQH 2P5ZX 1L0WA 1E24A 1R4PB 4RHSA 3S1RB 1CSPA 3A56A 5EJWA 2QDLA 1DM0B 3T1YQ 3CHBD 5DAUA 2RQXA 4JI8L 3MHBA 3GTMB 5IE8A 1QE6A 3KLSA 5I2YA 4L5QA 1HTLD 1E1TA 4LF4Q 1SYFA 3OYYA 3TS2A 2OEOA 4JCVE 5ELOA 2JA5B 4IQZA 4Y52H 1JOOA 4FVMA 4OL7A 4AYBG 3HKZG 1Y1WB 3HKSA 1YHQA 3UDXA 4A3IG 1YITA 4DV4Q 3HOWG 1PYSB 3G7LA 4X64Q 3PO3H 4ILWA 2F0IA 1AE3A 3D4WA 3JAMi 1PFNA 4A3BB 1QUQA 1STNA 1K3BC 3HOUG 4IUUA 1TY2A 2IY5B 1TR5A 4HIDA 5C0XI 2RA4A 4OO1G 4EQPA 2OXPA 2ZM6L 3GTOB 1Q82C 1VQCA 4K6LA 4B3TL 3J81E 2L4NA 1WCMH 4HIOA 1N32Q 4LF8L 3PO2H 2K50A 2D2CC 2MO0A 5JPMC 3K7UC 3DHQA 4OHJA 1EY6A 4JI5L 1K8OA 2ZXOA 2EY2A 5C3EH 4Q5VA 1QZGA 2DY8A 1TS4A 5IGCA 1M4VA 4B3RL 5CV6A 1TIID 3URYA 2B2VA 3TSSA 1OTCA 2Z4HA 1OO9B 4N9TA 5ELCA 1UUPA 5C0XJ 4A3GH 3T1HL 1KXLA 5AJ3L 1BCPC 5KNBA 4PV1C 4BA2I 4C3IB 2KHJA 2NZ1D 2F0HA 5D14A 1A2UA 3R8BA 3LWEA 1B2TA 3UDFA 2JA8G 2NZHA 3TMEA 4K0KQ 4JI8Q 1EIHA 2K5NA 1X32A 3PIOA 1STAA 3HOXB 5EKLA 2AQ3B 3NPPA 4H13C 3S1QB 2L1BA 3RUZA 2DN8A 2MNAA 3D8GA 3HZXA 3G71A 1HZAA 2MQHA 1YNNC 3NBIA 5A2QE 5CV8A 3K58A 1AZQA 1ET9A 2FINB 4RCNA 4A3FH 1HRJA 3RD4A 3L9AX 3KFUA 3RZDH 1LTID 2A69D 1J5EL 4A3DB 1WYDA 3QOJA 4A3LH 3A7LA 4IUPA 1I6HB 2ZM6Q 4DAMA 2AUJD 4LUVA 4B3TQ 2I0QA 3I56A 1PZJD 2IHFA 3QJYA 4LF8Q 2ZTEA 3H0GB 1NTGA 3HOVB 2A6HC 2A74C 1VQFA 4WJ3M 4LF7L 2HT1A 1JR0D 1SNMA 1FNVA 1EUJA 1GUNA 1ESFA 3GO5A 3X3MA 3RMHA 1N8RC 3JAME 5M5YB 2RCNA 4JK1C 3MA2B 1Q81C 4DV5L 4NMZA 1XJVA 5COYA 4MTKA 2WFWA 3STBC 2KECA 2EYPA 3HOYG 4J8QA 2KCTA 3V96A 4DNIA 1LTBD 2CWPA 3ZJYC 1D2BA 4KHPL 2F4IA 4LNQA 2EYMA 1BF4A 3RLFA 1A62A 2Q8RE 1A6XA 3K7AB 1CT1D 4ODGA 3AQQA 3OWEB 1PA6A 3CC2A 1Y8OB 1G2SA 4JI3L 1GXDC 5EKIA 1RCVD 4KV6A 3GTKB 4RMFA 1DOLA 1KNAA 1HCZA 2B2VC 5IWAL 2QF7A 2A6ED 3H15A 5F2DA 1S40A 2M9VA 3J7ZC 1IBML 1CM9A 2K75A 4BBSB 2ZJRA 2FMCA 4APVA 2AWNA 4KD4A 1LT6D 5I2XA 4A3MH 3IFDA 2AHOB 4BY7B 3I4NH 4ME3A 1Y1VB 4C3HB 3OOCA 4H0LC 2F4VQ 2B63B 3I4OA 5C4JH 5C4ZA 3CCSA 4KK7A 3PQIA 1VQLA 2PQEA 2VW9A 2KQ3A 1CHPD 4NKLA 3I70A 4C2MB 5FLXL 4ALPA 2F0QA 3NK9A 2N49A 4P72A 4B9XA 2CFMA 1RKNA 4JI7L 4GLVB 4A3JB 4LF9L 1LTAD 1QNUA 1FVIA 2BCOA 2XWJB 1PV4A 3ZYYX 4P73A 1IBLL 4LF7Q 2R92B 4HR7B 1CQVA 1T5XD 2QCPX 2OT2A 5CMDA 5I4DA 2PCFB 4K2LA 1Y8PB 1NE3A 4N8X1 2MO1A 3H09A 1PYBA 4R4TA 2K28A 2EYFA 4C3JB 2JA6B 2B39A 4NW2A 2C9OA 3S2HH 4A3CG 1H95A 5CV9A 2JA7H 2E2HH 1C8CA 1I50H 3SK5A 4KHPQ 2CW0D 1GHKA 3CPFA 1HH2P 3CF5A 1R9TB 4FF2A 3A0JA 4UP7A 2QW7A 4KJOA 3NE5B 1B4OA 4ZKCB 4TRDA 4JI3Q 5D3DA 4X66L 3OTOL 3HEJA 3RZOH 1HQMC 2FXQA 3GTPB 3BZKA 3G4SA 3UE1A 5LMNL 2ZXRA 4DV7Q 1B3AA 1PTOD 4KI0A 1IL8A 2XNAC 4KJNA 4LJZC 4A93H 2A69C 1IBMQ 1HPCA 3HKZB 1U4RA 4LFBL 3NWSA 2EY5A 1TWFH 1PZID 3J81L 3HOWB 2R93G 1I4HA 1YNJD 5ISRA 3NTHA 2FMMA 2Z1CA 1HJPA 1FYCA 1PH4A 1EWCA 4HJAA 5C4XG 4YCUA 4ZYSA 3HOUB 4L63B 1SMYC 4DN4M 5E1FA 1O7ZA 4X3SA 1PH2A 3F8TA 2C35B 3UE0A 2NVYB 4FF1A 4I7ZC 3F2CA 2EXDA 1T5EA 4YWKA 3QG1A 1JT8A 3H91A 1P16A 4GNXB 4X3UA 1IW7C 1SE2A 4FXGC 5JAVA 1AFPA 5M5XH 3I90A 1O7YA 2F0LA 4LF9Q 2B2UA 1VMPA 5EAYA 4X6AH 4KKUA 1CA6A 3BZDB 2F0JA 4O1NA 4OONA 4HCEA 5IGEA 3SGIA 2ZXPA 3LX0A 2VUMB 1OXTA 3V05A 5LMNW 2EJMA 2MFIA 3BU2A 5GQOA 5IY0A 3RR5A 2LSSA 5LHY1 2RHSB 3I3CA 1QJOA 3LGJA 1VQ9A 4DV0Q 2JXMB 3T16A 2YU9H 4GS3A 3ERSX 1HHVA 2V4DA 3MXNB 3S2DH 2WKCA 2XRQD 4BBRB 3DM3A 1VQPA 4QUFA 4CDDC 1SFOH 5A2QL 2R7ZH 4Z9CB 4HMIA 1KAAA 2EE1A 1Z6HA 1M90C 5LMNQ 2EZVA 2JEBI 1II3A 3NTIA 1Y69U 3S1RH 1MKHA 2L9HA 4GZYC 3KLWA 2K33A 3J7YW 2XTIA 3H3VH 2Y0SE 4LFBQ 4R8IA 3K80C 3CCUA 1LTRD 3KBXA 3KF6B 3GP7A 4IUVA 1MHWC 1K28A 4HSVA 3AMUA 2F52A 1K8GA 3A74A 3G48A 3GTGH 2UUCL 1EWHA 3MAQA 1PZKD 1X6OA 3EBEA 2K04A 3EROA 3ONAB 2KA7A 2WB1E 1IXRA 1K83H 1I4RA 2I5MX 2NVXH 3OPOA 4X65L 2B8GA 2DGYA 1SE3A 2SDFA 4NDXA 2Z0SA 3FKIG 2QKIC 1PDQA 1J6QA 2NN6G 3CQZB 2BA0A 4RGMA 4DFAA 3MEHA 3BVGA 1Q12A 3CMEA 5DM73 4JBWA 1PTOB 1C7YA 2EY1A 1I94L 1X3PA 2PW7A 3GTOH 1UEBA 1HNZQ 4LF6L 3HOYB 1Q8KA 1VCIA 2XGTA 3A54A 3NQTA 3SEBA 4O42A 4AIMA 1LO5D 2XSCA 3H3VI 4OWTB 1Q1EA 3J80i 1CKMA 2B2TA 4RCOA 1QZHA 4HAEA 5M5WB 2NVTH 1VQEA 4NXMQ 3S1NB 2XN9C 2EQSA 4DNTB 2Q2UA 3VR4A 3M4OH 1PRTF 1QVGA 1PTOC 2B3GA 2ICIA 5HGQA 3K81C 3S1MB 3FDTA 4HJ7A 3VA7A 1ZKOA 4QMGA 5CYUA 2WAQE 3NUCA 1YIJA 4LF5L 5G3LF 2YTXA 4RKBA 1NJIC 2E2JH 3W5OA 3TDQA 1G6PA 1R4QB 3QR8A 2FJ2A 1D1IA 1EYCA 3C1FA 4B9WA 4JBKA 4LFAL 4GKJQ 4DAYB 1H9SA 3ERQA 4TQUS 1F9SA 1RD9D 4C3IH 2KHIA 4KD3A 4DR5Q 1BCPD 2PMZE 3AYHB 5E3FA 1QVCA 1PFMA 1LUZA 1VQNA 5D65A 1A63A 5HGTA 4B08A 3C46A 1DD2A 1SNOA 5JEAJ 1LACA 2D9UA 4DR6L 2UUCQ 1MSGA 2EVBA 5ELEA 4DUZL 2QEJC 5M3FH 3S16H 3TP8A 1TWCB 1G291 2EIFA 1Q1BA 1KLGD 2WB1G 3LNNA 1V43A 1SEBD 5C4HA 2E2IH 1SYCA 2NVQH 1QVFA 1YNND 3X3NA 4A76A 2JEAI 2O5IC 1AEXA 1IYVA 1JCKB 4DV1L 3PO3G 4K8IA 1I6HH 1NY4A 1X55A 1JJGA 1X56A 5EPLA 3T53B 1IKMA 4L6TB 1F2LA 4UPAA 1KAWA 2MP1A 4KHZA 2MJ8A 4A3EB 1N33L 1SNQA 4QCLA 1GVPA 4G7HC 3CD6A 1GO3E 1WCMG 1BDOA 1V1PA 2PQAA 4DV3Q 1CKNB 1O7IA 4M8AA 3PO2G 2YTYA 4IUQA 1I6VC 1F2YA 2NWGA 3NBHB 2A6HD 1UE6A 1EYGA 2VL6A 1JJCB 4YHHQ 5C3EG 5C0XH 4YWLA 3L2PA 4DR2L 4QL5A 2F0EA 4UDUC 3QOLA 5DNFA 2DNEA 4FP5D 3STBD 3S17H 4BXXH 2L5TA 1C4QA 1TVXA 3FP9A 3K7AH 3TZUA 1W2BA 1CUKA 4CKBA 2K7VA 3H6MA 3PF5A 4R4IA 1G51A 1H9SB 4A3GG 1TQOA 2VNUD 5J1ZA 5JPNC 4KLKA 1STBA 2F0SA 2BOSA 2R93B 1MIUA 5C4XB 2NTSA 4G4KA 2H5XA 4CKEA 1XMQQ 1XMOL 1CQFA 3FVQA 2R7DA 3VA5A 5FO9B 1S5DD 2ATWA 2IT1A 3KOJA 4G7OC 2LKVA 3BZCA 4S3SA 1WD0A 2K6AA 2LFNA 4KN4C 1VQ8A 1LLRD 1FD7D 4DR4L 1YBYA 4HJ8A 4BY7H 4Q0FA 1I3QH 3M4PA 1KNEA 1BQQT 1WTWA 1G8ZD 4C3HH 4MTNA 1IYUA 2SEBD 3BJUA 3ITPA 3KJPA 1B53A 4A3FG 2UXDL 4X62L 5IP7H 1BXTA 4I7AA 4DV1Q 2IWHA 1GM5A 1L1OA 2AUKA 4DPGA 1JJ2A 1Q90A 1PH8A 4L8JA 4A3LG 3J81c 4DK6C 1H9JA 3P7JA 1BCPB 2KEDA 1PMRA 2B29A 2VQFL 5K36H 1WTRA 1OXXK 5LL6S 4QJFA 4DAPA 5JJIA 3I91A 2R92H 3PUZA 4UY8C 3MXUA 1B7YB 1YNXA 3IAYA 1Z47A 3SK4A 4ME5A 3GTLH 3ULJA 4MZ9A 4DR2Q 5IT9E 3MTSA 5H1SE 5IODA 1SN8A 1NNXA 2BDNA 5ELFA 2N78A 5IYBH 1DOKA 5FJ8H 1K8AC 2JYOA 2OWOA 4JI2L 3CC4A 1TWGH 4B3SL 4FF4A 2HIVA 3N52A 2HDLA 3MEFA 3DMUA 5EPKA 4DXFA 5LL6X 1PRTB 3M7NA 2O2LD 2N55A 2PZWA 2UXCL 1AN8A 5GADC 1SLJA 5DLQE 1RJTA 1C48A 4FXDA 2R6GA 2MHVA 3IL8A 1O7LA 1EFWA 5I9OA 3VYUA 3M4QA 4DR4Q 2A8VA 1VQ6A 4V190 1FNWA 3TP6A 1U9RA 2EJGC 1GHJA 1QUQB 3OMCA 2RF4A 1CKOA 3QO2A 4A3MG 1PRTC 4DF7A 3I4NG 2KCNA 5C44B 1Z9FA 3VR5A 4RGOS 4X62Q 1SMYD 1VMCA 5DEHA 1JICA 3RNUA 2PZTA 4JV5L 2OTLA 1L1OB 1VQGA 4FNFA 1MJCA 1C0AA 4JI5Q 4H02A 2VQFQ 2D0OA 4B3ML 2NYZD 4IOAA 4H7BA 3K6OA 3NWTA 2LXKA 2E74C 2Q2HA 1HUMA 4LWCA 3R2IA 1IW7D 2XWBB 3F2DA 1G2TA 1YJWA 4B3RQ 4IUTA 3OW2A 4ZUIA 2OQKA 1H9MA 1M8AA 4OGQC 2VUMH 4GLAC 1N36L 1LM0A 1X65A 1HA6A 2N3SA 1KABA 3J7AF 2A1AA 2CH4A 1L1OC 3TS0A 3DWQA 3T1HQ 1PH1A 5AJ3Q 1U4MA 3BVZA 3OIQA 2Z6KA 3A55A 2K5DA 1KDBA 3DM1A 1TWAH 4AQYL 2D62A 5FOBB 2A5HA 2JA7G 2K14A 2K5VA 4OO1I 2CWAA 4UHVA 4Y7NH 3WOEA 4IPHA 4BBRH 3SDZA 3I4LA 3GDEA 3QWNA 1HZBA 4JI1L 1TU2B 5EKKA 3HP3A 1D8LA 1D6EC 3M3YH 2KEEA 4JI4L 1EU4A 2VB2X 1LT5D 1KRTA 1SROA 2UXCQ 1RDPD 1NR4A 3U50C 4KHVA 1SYGA 5KNCA 2F0KA 4F87A 3RLNA 1HA5A 4MN3A 5ELBA 2I5LX 1SBBB 1DZ1A 4CDCC 3HOZB 4A93G 1OXVA 5FLMH 1J5EQ 4QIWB 4N8FA 5CR3A 1XPOA 3D6CA 3P75A 2WP8J 3VYTA 3OWFA 2K4KA 1X3FA 1HXYD 2IPKD 2HCCA 4DA2A 4A3KB 1XYIA 3HG9A 1D5XC 3CCRA 2C5CA 5BN5A 1NAPA 1VQJA 1MGSA 1HNWL 3B6YA 3W1GA 2KOLA 1JOKA 4OIJA 1WFQA 1WCMB 4B3MQ 1UWVA 3PO2B 1V8QA 5JJZA 5JVG3 4DV6L 5FO8B 2EXZA 4JOIA 4BS9A 1SYDA 2PZUA 4DV5Q 1ONLA 2GA4B 1MI2A 3KF8A 1HR0L 1ZYRC 5C3EB 1SJHD 2KVMA 5M3MH 1PH6A 3VYRA 4EQOA 1TKWB 2RCFA 2R3ZA 3BDLA 4MHEA 1UE7A 4QQBX 5L37A 4RH6A 2YV5A 1ASYA 1XNRL 5FO7B 1F9PA 4LUOA 2PPBC 2F0MA 3E9IA 1ZEQX 2L11A 1ASZA 2VXWA 3RN5A 1YVCA 1NSNS 4POFA 4A3GB 2HUGA 3NTKA 2XRSD 4GN4B 1HNXL 2J7ZA 5IGDA 2E75C 4YY3L 2RDGA 4DNRB 4JI0L 3E3XA 3S15B 2XVSA 5IWAQ 4XT3B 2F3WA 1B50A 4EX5A 3S14B 2F0OA 4X3TA 1HQRD 4JI1Q 4AYBB 3PIP3 1Z7TA 1ENCA 3RN2A 1RTOA 2R7ZG 3ICEA 5IOCA 1VQ7A 2IX1A 4A3IB 2Z6KC 2Q8IB 4LK1C 4J1MA 2ALYB 2O5JC 2JK8A 3K5LA 1EOVA 3T13A 4IPDA 1YJNA 3I4MH 4YWMA 1HR0W 2M2LA 4MIUA 1O80A 2J0TD 4A3FB 3DWAA 4PMWA 2R61A 4R9WA 2RDHA 3RZDB 3AEVA 1TWCH 1GUTA 4PZ7A 4JI7Q 1ZXTA 3OMGA 1JC7A 3EFXD 5AFWA 1HTPA 4JG2A 3IFTA 5IGFA 1LV9A 1HNWQ 4JC0A 1H9KA 2JN4A 5ELNA 5IT9L 4X3KA 5IYCH 1F9RA 1IBLQ 2CCZA 4BY1H 1E0BA 3L3OC 4DGZA 3CAMA 1STGA 4BWGB 2LY7A 4P74A 3CCJA 1VQDA 3KF8B 5E7NA 1HR0Q 1W6JA 1NMFA 3WOFA 1G91A 1VF7A 3QIAA 5T1GA 2Z8LA 3GTJH 1RHPA 2B2YA 4A3EH 4DV2L 4DR1L 1PFBA 1KL9A 3CRKC 2QA4A 4GOPA 2QEXA 3K8AA 1JOQA 2X6GA 3CW2C 4KY7A 4K5WA 2JA8B 1E22A 5GROA 3FRPB 2XIWA 1S5FD 2VB3X 4RA8A 2B2WA 4HJ5A 4X66Q 3OTOQ 1YI2A 1HNXQ 1YZ6A 1EQQA 4KY6A 3NXWA 4IFDH 1TS3A 2WIIB 5EPJA 2F0FA 1PH3A 3G6JB 3D6WA
chains in the Genus database with same CATH topology
3J81j 2F0NA 1EY0A 3J7AV 4DUYL 1UNSA 1B1ZA 1SXTA 3A8JE 3GTMH 5IP9H 3TZDA 1DJRD 2VY3A 4HCSA 5JEAH 1I4QA 4KTAA 1DCZA 3S9WA 4JI6L 1STEA 2UUAL 4XYQA 1I5FA 2JA5H 4QUCA 1L2FA 2K03A 4A3MB 5T1IA 4RG1A 4OWWB 4IPGA 3NHHA 1HFGA 2KENA 4IURA 4NP5A 3I4NB 2K05A 1Y1WH 1RF2D 3JAML 2AWOA 2RHQB 2BA1A 1K3RA 3A5ZB 4XDXA 1D5MC 1PH9A 2O4XA 4ID6A 1TWHB 3SXHA 1A3UA 5KYIA 4A3BH 2EJFC 5M3FG 3DWPA 2KCMA 4HIMA 1FL0A 2HHHL 4IFDI 1KIXA 1WTOA 5GAGC 4JYAL 1WI5A 1WTVA 4O2DA 1WD1A 1EWIA 1A3TA 2E76C 2FFKB 4PNYA 2F0GA 1KQSA 1FR3A 2WACA 1BKBA 1NMGA 1SR3A 3U58A 1E2ZA 3OSOA 1IL2A 2B2UC 4WFN3 1EYDA 1GUOA 3A5UA 1E2VA 4DR1Q 1EY8A 3LWUA 3S2HB 2PYKA 2RBMA 2X6LA 2JA7B 2E2HB 1LTTD 5JOBA 4DAVA 3TP7A 3MXGA 3K59A 1XPUA 1Q46A 3U9SA 1V9PA 1T9HA 4CKCA 4EQNA 4IFDJ 5CBEE 3A8KE 4ZRZA 1XXGA 3I73A 2QGQA 5C0XG 3M4YA 2NZOA 1MBYA 2GVAA 4H44C 1LYLA 3VR6A 3RZOB 4OIKA 3GV6A 1D1KA 4GOPC 1AP0A 3KDFA 4DUYQ 4XQQA 2ES2A 2BE5C 4BXXG 2UUBL 2Y0SG 2IX0A 3HOXH 1QNKA 1DOMA 2RVLA 3T4AC 4A93B 4YCVA 4PZ8A 1EOTA 1VQ4A 4JI6Q 3PCOB 2B2WC 3S1QH 4EQ5A 4L5RC 1EQVA 1TWFB 1GUGA 4TSSA 3I7FA 1RL2A 4I65A 3MFGA 4IOCA 1YEZA 2M00A 1EY7A 1A15A 4LF4L 2PNRC 2IHEA 4GLXA 4CBVA 4X65Q 1I4GA 1A8VA 2EY6A 3VYSA 3BYTB 3J81i 3HKZE 1LTGD 3PSIA 1BVSA 1JMCA 3TN2A 5KRUA 1VQKA 1EEFD 4PQXA 1DXMA 1LT3D 4LFCL 4A3DH 5TSSA 5ELDA 1RODA 3K57A 2A19A 4DV4L 3MXPA 3I2ZA 4X64L 1E2WA 2E8GA 1DYQA 4BY7G 1I94Q 2GVBA 1XX8A 2BDOA 4J6HA 4PMCA 1F9QA 4DK0A 4C3HG 5C44H 1Y14B 1GKHA 4LF6Q 1RIPA 5HURA 2Q2TA 2KBNA 3HOVH 3H0GH 1BUVT 1PRTD 1NBWA 2F1MA 3H94A 3CPWA 3FMCA 1EIFA 5IP7G 5KNDA 2HQEA 1E7ZA 1N32L 4JBJA 1SE8A 5LMUL 1SJED 1VQ5A 5M5YH 3T51B 2LMCB 4RGNA 3NELA 2IX3A 5K36G 1VF5C 2WKDA 1GOZA 1IHZA 5FLXE 2YU9B 2SNSA 4LF5Q 2R92G 5IYDH 3E5SA 4QB4A 1EEID 1S72A 2WAQG 4IALA 5K5PA 1IBKL 2B2TC 4LFAQ 4EGVA 4F8MA 1KDCA 4OWXB 3J80E 3Q24A 1SFOB 2R7ZB 1JB7A 2K32A 1N34L 1L0YB 4ZQ3A 1ENAA 1EL0A 2RSOA 4U68A 3GTKH 1S5BD 4CJ2C 2F0WA 4FXKC 5J22A 3FEWX 1VQOA 3OIPA 2UUBQ 3WDNA 3CC7A 1JWMD 4OX9L 2G9HD 1SYBA 4DU9A 4DR6Q 5IYBG 5FJ8G 1B44D 3CMAA 3A8IE 4BBSH 4K0KL 4DUZQ 1LTSD 1VQAA 4IZ8A 2DY7A 2B8FA 2F0TA 4LMQD 4XTCS 3KYHC 4CHTB 2ZJQA 2D5DA 3GTGB 1F2ZA 1E1OA 1WTXA 1Y1VH 5CV4A 4N9PA 5C3WA 2B63H 1KDAA 1QOHA 2NB0A 2NTTA 4HN7A 4RFBA 2DUDA 1S5CD 3HOZH 5IIFA 1K83B 2L12A 2NVXB 4LFCQ 1SAPA 2BH2A 1NCVA 4C2MH 1VQHA 1WOCA 2UU9L 3H3VC 2JQOA 2NBFA 1X9NA 4FF3A 1U5KA 2SOBA 4E6IA 2V1CC 3O13A 1UEAB 4A3JH 1FJGL 4A3KH 1HUNA 1YHAA 3CCLA 4L5TA 1N33Q 4RWSC 2OQ0A 2VS1A 4U673 3K5MA 3SHLA 2AMCB 1V1PB 2PQAB 4GKKL 2JA9A 3SR1A 5LMUQ 1FGUA 1VS0A 2Q2IA 3PUVA 3C1EA 1K73C 4KN7C 4IJHA 2A68C 1VDZA 3IRBA 4C3JH 4LUZA 2JA6H 1GJXA 2NVTB 2H1EA 5DM63 2F3IA 4K8JA 3E9HA 1Y8NB 1SSOA 2QILA 1QG7A 4ULLA 3M4OB 1LABA 3AFQA 1ZYRD 5IT9c 2VUMG 3GD7A 4BA1I 1X3GA 2CQAA 1BOSA 1I4XA 1E3PA 1R9TH 1L0XB 1JE5A 1EZ8A 1HZ9A 1IBKQ 3BS1A 5CC4A 3N6RA 4C1NK 2IL8A 1N34Q 2E2JB 3PGZA 5C5LA 3GTPH 5C6AA 2EYHA 1XWEA 3S15H 3NENA 1XMOQ 1TS2A 4K6DA 3M7GA 2WINB 1SNPA 2E5LL 4OX9Q 3S14H 3CRLC 2ICEC 3R2TA 4HMJA 4BBRG 4DK1A 2SNMA 1AZPA 4A3IH 3HOWH 3FKIB 3A7AB 2VZAA 1EY4A 3GV3A 1FGBD 4A4IA 1PHJA 3PV0A 4WRDA 3HOUH 3EJIA 2JSOA 1W3SA 2OTJA 5M3FB 2G9DA 3S16B 3TP5A 4OO1H 2UXBL 5EQ0A 5BN3A 1F77A 2NVYH 2UXDQ 5C3XA 2F4VL 2E2IB 3D0FA 2UU9Q 5J39A 2NVQB 5FLMG 5I6YA 3HS0C 3I8ZA 3FPPA 2KJXA 2LXJA 2AQ1B 4RGTA 3KK7A 4LAAA 1FJGQ 1Q86C 1QCBD 1PH7A 3UDGA 4AH6A 2IJ0A 2DNCA 1CZGA 1QWYA 1C9OA 4GKKQ 1STHA 3JAMc 5IGGA 3G6EA 4K14A 5KEEA 5JJKA 3PIPA 1O78A 1EYAA 2PI2E 4IO9A 3M85A 4XXEA 1UE5A 2F03A 2KHSA 3T56B 2I5HA 3DEOA 5NUCA 3DXJC 2MPMA 1XTDA 5M3MG 2JP1A 1PYWD 4XQNA 1K0RA 1WJJA 1B70B 2A73B 4P71A 3GTQB 2JJQA 2JA8H 3AB9A 4JI2Q 3ER0A 3CCVA 3S24A 4P75A 4B3SQ 4GN3B 3S17B 2Y0SB 4NXNL 3F2BA 5GAEC 1YHBA 3KLRA 1GD7A 1V1OA 4ABNA 2MGSA 4R8NA 4EVOA 4WJ4A 1SYEA 3MVVA 1BO0A 4K5VA 2E5LQ 3E0EA 3ULLA 3W1BA 2CHBD 5E4WC 4PZ6A 3JC66 4F7XA 4UP8A 2F0UA 3DUZA 5EGTA 3CXCA 2PW5A 4DV7L 2WB1B 2ZT9C 1AH9A 4LW1A 1SNDA 4WORA 1MD2D 3VR3A 3E6ZX 1XTCD 5D3IB 3CCQA 1CHQD 3U4VA 3PO3B 5BR8L 3PUYA 2UXBQ 1PTOF 1ML0D 1I3QB 2YYZA 3KUPA 3I4MG 1SDFA 4JV5Q 2AQ2B 4UAIA 1CTMA 1TWHH 5M9OA 2CVRA 3L7ZC 3RLOA 3PIO3 1WVLA 1PLFA 2L15A 2F0PA 1EY5A 1XNQL 3CP0A 3CQZH 1EZ6A 3R3OA 3EVQA 4GNXA 4HSPA 1X54A 2OCEA 1AW7A 1PTOH 1JE4A 2K01A 3J80L 3HOYH 3TREA 4C56C 2J4XA 2ZTCA 1N36Q 2K52A 3D4DA 5IYCG 4HEDA 3HRZC 2K5WA 3MFYA 1BNZA 3MZ5A 2CQOA 5HY6A 1VQBA 4BY1G 2IW3A 1XPRA 5J3BA 3K0XA 3BYYB 2WAQB 5M5WH 1SRUA 3S1NH 2YTVA 5I6WA 4R4OA 3W2DA 4AQYQ 4CJ1B 3GTLB 3PMFA 2ID0A 1JQYD 3BVMA 4FDBA 1RTNA 3OW7A 4A3EG 1AE2A 3L0OA 3S1MH 4IPCA 5CV5A 4PG3A 4DV0L 1UAPA 3F2UA 2PMZB 3MXNA 1IKLA 4NXNQ 4KKSA 1S5ED 2GN5A 4JI4Q 3EQLC 1OXUA 2EYJA 4RAUC 2ASBA 1TWGB 3NP8A 3K5NA 4KKTA 4IFDG 1LT4D 1EQRA 4NB3A 1U0LA 1EQTA 1EIYB 1D5ZC 2PNHA 5FKAC 1LTLA 3AU7A 1ESRA 3K0YA 3CU7A 4ZUJA 2K5QA 3KF6A 2BE5D 5IP9G 3KJOA 3GQBA 1BBXC 4ZK9B 5JEAG 5BR8Q 4G57A 1I4PA 1K8MA 3BG3A 1ET6A 2JA5G 3EN2A 3Q6SA 2JE6I 1SE4A 4QF4A 1TT2A 1UE1A 3HFZB 4CJ0B 1Y1WG 1F2MA 1U4LA 1B8AA 1XNQQ 1KHIA 1SNCA 4ZKBB 5EBCA 4DV6Q 4PMBA 1PFSA 3HGBA 3MWYW 2N8NA 1EFID 4A3BG 1JB3A 2RDFA 3VDYA 1HFNA 1FNUA 2X69A 4A3CH 2EOTA 1QB5D 4FYDA 1IYJB 1WTPA 1HNZL 1XNRQ 2H4OA 3SE0A 3UDIA 2HCIA 1B9MA 3M9BA 4JOIC 4GNXC 3DEPA 4TVAB 4NXML 3D3RA 4YY3Q 4JI0Q 1TWAB 2A6EC 1GUWA 4L5SA 4K2KA 3ULPA 1W6KA 2Z4IA 1ENFA 2FHTA 4Y7NB 3PUWA 2MUYA 1K9MC 3PUXA 2ENBA 1S4ZA 4ZLTF 1SMXA 2PO4A 1KTKA 4ZAIA 1PXUA 2R93H 1HZCA 3BDCA 4KMUC 3M3YB 4IN3A 1B9NA 5A35A 2F0DA 3DLLA 2K5HA 5C4XH 4GKJL 4DR7L 1A3VA 1N9WA 1P8LA 4O0AA 1Q8IA 2D0PA 4C3IG 4DAYA 4C1NI 1MSHA 2EDGA 3NEMA 2HQLA 2QDBA 4R1JA 4DR5L 5KGUA 1J8IA 4XIGS 3CKIB 5CBAE 1DONA 5C4JB 2VQEL 3HOXG 1EY9A 5I9PA 1CFMA 4DR3L 4YCWA 2Q8TA 4HJ9A 1KD1C 3TBIB 3NSWA 3D31A 1YJ9A 2RSNA 4IUNA 3OHXC 3P20A 1U4PA 3I55A 1BCPF 1OXSC 4RHRA 1ILQA 1X3QA 3E0JA 2BH8A 1CI3M 3EA6A 3J7A5 4G7ZC 1NUCA 5JJLA 4XQJA 5GAHC 3V2TA 2EPBA 1ICWA 1CZWA 4A3DG 4QIWE 4GN5A 4F88A 1V1QA 5JVH3 3W3AA 5CGKA 1JORA 3SK6A 2EYOA 4JBMA 1PVOA 2PI2A 5C44G 4DV2Q 2HIXA 2CW0C 1PH5A 3VR2A 1BBWA 1KC8C 1NR2A 4GOPB 3C3LA 1D7QA 2TMPA 3BDOA 5M3MB 2EYLA 3HOVG 3H0GG 1QILA 4POGA 1I50B 1GUSA 1CA5A 4J15A 2F0VA 2F3VA 5KIXA 3Q0AA 3SVMA 3TEHB 1BR9A 1ILPA 2ZTDA 3CCEA 5FK9C 1JWSD 4DXGA 3FHWA 5IGBA 4DV3L 1CKNA 4QY7A 3NBHA 4RKLA 4IJLA 1Q3LA 4FO2A 2A68D 1H9RA 4YHHL 4DKAC 1G6ZA 4CGYB 2R7FA 2B2YC 4YIJA 1TY0A 2CKZB 2KUMA 3C2PA 3PF4A 1EU3A 1IZ6A 5IYDG 1TS5A 3CCMA 3IKJA 3ND9A 3SK8A 4TKOB 5KYLA 4QGUA 3R93A 4DK3C 2K1BA 1YNJC 3KBGA 3T1YL 1VQMA 1KLUD 2UUAQ 4DR7Q 2NUCA 5EBDA 3Q22A 1JWUD 3UI2A 3KLSX 4P2CB 5E4XA 2RKSA 4AYBE 1XMQL 2VQEQ 4UP9A 4HTHA 4XYOA 3WWVA 4DR3Q 3U4ZA 3I4MB 4WJWA 3QB3A 1DGSA 3FKIH 5CORA 2L55A 4BBSG 3TRZA 1X3EA 4K5XA 1TXYA 2NN6H 3Q23A 3D4RA 1CSQA 3P1HA 1S3OA 2LS01 1A0IA 2I07B 2WV6D 1VQIA 2HHHQ 1Y1VG 1MJEA 3F1ZA 5M5XB 4R4QA 5BN4A 2B63G 4JYAQ 4V0BA 3I72A 3HOZG 3FPUB 4M1UB 1A2TA 1BBUA 4BY1B 1STYA 3MC0B 3NQIA 1CK1A 4R4CA 5G3LD 4NPSA 2E2DC 4A3JG 4A3KG 1M1KC 2I46A 2OF1A 4A75A 2TSSA 4XT1B 3ND8A 2HDMA 2ZJPA 5C5MA 3GTJB 2KCCA 2L0CA 1Q7YC 1J9OA 3S2DB 4HIKA 3Q8DA 1KRSA 4MNOA 1WTQA 5FLXc 5CV7A 3AFPA 3EIVA 2N88A 2AKWB 3TQYA 2JA6G 4C3JG 3U9OA 3K5OA 2NN6I 4KY5A 1EIGA 4OXPA 3J80c 3KDFB 3GTQH 1L0WA 1E24A 1R4PB 4RHSA 3S1RB 1CSPA 3A56A 5EJWA 1DM0B 3T1YQ 3CHBD 5DAUA 4JI8L 2RQXA 3MHBA 3GTMB 5IE8A 1QE6A 3KLSA 5I2YA 4L5QA 1HTLD 1E1TA 4LF4Q 3OYYA 3TS2A 1SYFA 2OEOA 4JCVE 5ELOA 2JA5B 4IQZA 4Y52H 1JOOA 4FVMA 4OL7A 4AYBG 3HKZG 1Y1WB 3HKSA 1YHQA 3UDXA 4A3IG 1YITA 4DV4Q 3HOWG 1PYSB 4X64Q 3G7LA 3PO3H 4ILWA 2F0IA 1AE3A 3JAMi 3D4WA 1PFNA 4A3BB 1QUQA 1STNA 3HOUG 2IY5B 1TY2A 4IUUA 1TR5A 4HIDA 5C0XI 4OO1G 2RA4A 4EQPA 2OXPA 2ZM6L 3GTOB 1Q82C 1VQCA 4B3TL 4K6LA 3J81E 2L4NA 1WCMH 4HIOA 1N32Q 4LF8L 3PO2H 2K50A 2D2CC 2MO0A 5JPMC 3K7UC 3DHQA 4JI5L 1EY6A 4OHJA 1K8OA 2ZXOA 2EY2A 5C3EH 4Q5VA 1QZGA 2DY8A 1TS4A 5IGCA 1M4VA 4B3RL 5CV6A 1TIID 3URYA 2B2VA 3TSSA 1OTCA 2Z4HA 1OO9B 4N9TA 5ELCA 1UUPA 5C0XJ 4A3GH 3T1HL 1KXLA 5AJ3L 1BCPC 5KNBA 4PV1C 4BA2I 4C3IB 2KHJA 2F0HA 2NZ1D 5D14A 1A2UA 3R8BA 3LWEA 1B2TA 3UDFA 2JA8G 2NZHA 3TMEA 4K0KQ 4JI8Q 1EIHA 2K5NA 1X32A 3PIOA 1STAA 3HOXB 5EKLA 2AQ3B 3NPPA 4H13C 3S1QB 2L1BA 3RUZA 2DN8A 2MNAA 3D8GA 3G71A 3HZXA 1HZAA 2MQHA 1YNNC 3NBIA 5A2QE 5CV8A 3K58A 1AZQA 4A3FH 1ET9A 2FINB 4RCNA 1HRJA 3RD4A 3L9AX 3KFUA 3RZDH 1LTID 1J5EL 2A69D 4A3DB 1WYDA 4A3LH 3QOJA 3A7LA 4IUPA 1I6HB 2ZM6Q 4DAMA 2AUJD 4LUVA 4B3TQ 2I0QA 3I56A 2IHFA 4LF8Q 1PZJD 3QJYA 2ZTEA 3H0GB 1NTGA 3HOVB 2A6HC 2A74C 1VQFA 4WJ3M 4LF7L 2HT1A 1JR0D 1SNMA 1FNVA 1EUJA 1GUNA 1ESFA 3GO5A 3X3MA 3RMHA 1N8RC 3JAME 5M5YB 2RCNA 4JK1C 3MA2B 1Q81C 4DV5L 1XJVA 4NMZA 5COYA 2WFWA 3STBC 2KECA 3HOYG 2EYPA 4J8QA 2KCTA 3V96A 4DNIA 2CWPA 1LTBD 3ZJYC 1D2BA 4KHPL 2F4IA 4LNQA 2EYMA 1BF4A 3RLFA 1A62A 2Q8RE 1A6XA 3K7AB 1CT1D 4ODGA 3AQQA 3OWEB 1PA6A 3CC2A 1Y8OB 1G2SA 4JI3L 1GXDC 5EKIA 1RCVD 4KV6A 3GTKB 4RMFA 1DOLA 1KNAA 1HCZA 2B2VC 5IWAL 2QF7A 2A6ED 3H15A 1S40A 5F2DA 2M9VA 3J7ZC 1IBML 2K75A 1CM9A 4BBSB 2ZJRA 2FMCA 4APVA 2AWNA 4KD4A 1LT6D 5I2XA 4A3MH 3IFDA 2AHOB 4BY7B 3I4NH 4ME3A 1Y1VB 4C3HB 3OOCA 4H0LC 2F4VQ 2B63B 3I4OA 5C4JH 5C4ZA 3CCSA 4KK7A 1VQLA 2PQEA 2VW9A 2KQ3A 1CHPD 4NKLA 3I70A 4C2MB 5FLXL 4ALPA 2F0QA 3NK9A 2N49A 4P72A 4B9XA 2CFMA 1RKNA 4JI7L 4GLVB 4A3JB 4LF9L 1LTAD 1QNUA 1FVIA 2BCOA 2XWJB 1PV4A 3ZYYX 4P73A 1IBLL 4LF7Q 2R92B 4HR7B 1CQVA 1T5XD 2QCPX 2OT2A 5CMDA 5I4DA 2PCFB 4K2LA 1Y8PB 1NE3A 2MO1A 3H09A 1PYBA 4R4TA 2K28A 2EYFA 4C3JB 2JA6B 2B39A 4NW2A 2C9OA 3S2HH 4A3CG 1H95A 5CV9A 2JA7H 2E2HH 1C8CA 1I50H 4KHPQ 3SK5A 2CW0D 1GHKA 3CPFA 1HH2P 3CF5A 1R9TB 4FF2A 3A0JA 4UP7A 4KJOA 3NE5B 1B4OA 4ZKCB 4TRDA 4JI3Q 5D3DA 4X66L 3OTOL 3HEJA 3RZOH 1HQMC 2FXQA 3GTPB 3BZKA 3G4SA 3UE1A 5LMNL 2ZXRA 4DV7Q 1B3AA 1PTOD 4KI0A 1IL8A 2XNAC 4KJNA 4A93H 4LJZC 2A69C 1IBMQ 1HPCA 3HKZB 1U4RA 4LFBL 3NWSA 2EY5A 1TWFH 1PZID 3J81L 3HOWB 2R93G 1I4HA 1YNJD 5ISRA 3NTHA 2FMMA 2Z1CA 1HJPA 5C4XG 1PH4A 4HJAA 1EWCA 1FYCA 4YCUA 4ZYSA 3HOUB 4L63B 1SMYC 4DN4M 5E1FA 1O7ZA 4X3SA 1PH2A 3F8TA 2C35B 3UE0A 2NVYB 4FF1A 4I7ZC 3F2CA 2EXDA 4YWKA 1T5EA 3QG1A 1JT8A 3H91A 1P16A 4GNXB 4X3UA 1IW7C 1SE2A 4FXGC 5JAVA 1AFPA 5M5XH 3I90A 1O7YA 4LF9Q 2F0LA 2B2UA 1VMPA 5EAYA 4X6AH 4KKUA 1CA6A 3BZDB 2F0JA 4OONA 4O1NA 4HCEA 5IGEA 3SGIA 2ZXPA 3LX0A 2VUMB 1OXTA 3V05A 5LMNW 2EJMA 2MFIA 3BU2A 5GQOA 5IY0A 3RR5A 2LSSA 5LHY1 2RHSB 3I3CA 1QJOA 3LGJA 1VQ9A 4DV0Q 2JXMB 3T16A 2YU9H 4GS3A 3ERSX 1HHVA 3MXNB 2V4DA 3S2DH 2WKCA 2XRQD 4BBRB 3DM3A 1VQPA 4QUFA 1SFOH 2R7ZH 5A2QL 4Z9CB 4HMIA 1KAAA 2EE1A 1Z6HA 1M90C 5LMNQ 2EZVA 2JEBI 1II3A 3NTIA 1Y69U 3S1RH 1MKHA 2L9HA 4GZYC 3KLWA 2K33A 3J7YW 2XTIA 3H3VH 2Y0SE 4LFBQ 4R8IA 3K80C 3CCUA 1LTRD 3KF6B 3KBXA 3GP7A 4IUVA 4HSVA 3AMUA 2F52A 1K8GA 3A74A 3G48A 3GTGH 2UUCL 1EWHA 3MAQA 1PZKD 1X6OA 3EBEA 2K04A 3EROA 3ONAB 2KA7A 2WB1E 1IXRA 1K83H 1I4RA 2I5MX 2NVXH 3OPOA 4X65L 2DGYA 2B8GA 1SE3A 2SDFA 4NDXA 2Z0SA 3FKIG 2QKIC 1PDQA 1J6QA 2NN6G 3CQZB 2BA0A 4RGMA 4DFAA 3MEHA 3BVGA 1Q12A 3CMEA 5DM73 4JBWA 1PTOB 1C7YA 1I94L 2EY1A 1X3PA 2PW7A 3GTOH 1UEBA 1HNZQ 4LF6L 3HOYB 1Q8KA 1VCIA 2XGTA 3A54A 3NQTA 3SEBA 4O42A 4AIMA 3H3VI 1LO5D 2XSCA 4OWTB 1Q1EA 3J80i 1CKMA 2B2TA 1QZHA 4RCOA 4HAEA 2NVTH 5M5WB 1VQEA 4NXMQ 3S1NB 2XN9C 2EQSA 4DNTB 2Q2UA 3VR4A 3M4OH 1PRTF 1QVGA 1PTOC 2B3GA 5HGQA 2ICIA 3K81C 3S1MB 4HJ7A 3FDTA 3VA7A 1ZKOA 4QMGA 5CYUA 2WAQE 3NUCA 1YIJA 4LF5L 5G3LF 2YTXA 4RKBA 1NJIC 2E2JH 3W5OA 3TDQA 1G6PA 1R4QB 4JBKA 1D1IA 1EYCA 2FJ2A 3C1FA 4LFAL 4B9WA 4GKJQ 4DAYB 1H9SA 4TQUS 3ERQA 1F9SA 1RD9D 4C3IH 2KHIA 4KD3A 4DR5Q 1BCPD 2PMZE 3AYHB 5E3FA 1QVCA 1PFMA 1LUZA 1VQNA 5D65A 1A63A 5HGTA 4B08A 3C46A 1DD2A 1SNOA 5JEAJ 1LACA 2D9UA 4DR6L 2UUCQ 1MSGA 2EVBA 5ELEA 4DUZL 2QEJC 5M3FH 3S16H 3TP8A 1TWCB 1G291 2EIFA 1Q1BA 1KLGD 2WB1G 3LNNA 1V43A 1SEBD 5C4HA 2E2IH 1SYCA 2NVQH 1QVFA 1YNND 4A76A 2JEAI 3X3NA 2O5IC 1AEXA 1IYVA 1JCKB 4DV1L 3PO3G 4K8IA 1I6HH 1NY4A 1X55A 1JJGA 1X56A 5EPLA 3T53B 1IKMA 4L6TB 1F2LA 4UPAA 1KAWA 2MP1A 4KHZA 2MJ8A 4A3EB 1N33L 1SNQA 4QCLA 1GVPA 4G7HC 3CD6A 1GO3E 1WCMG 4DV3Q 1BDOA 2PQAA 1V1PA 1CKNB 1O7IA 3PO2G 4M8AA 2YTYA 4IUQA 1I6VC 1F2YA 2NWGA 3NBHB 2A6HD 1UE6A 1EYGA 2VL6A 1JJCB 4YHHQ 5C3EG 5C0XH 4YWLA 3L2PA 4DR2L 4QL5A 2F0EA 4UDUC 3QOLA 5DNFA 2DNEA 4FP5D 3STBD 3S17H 4BXXH 2L5TA 3K7AH 3FP9A 1C4QA 1TVXA 3TZUA 1W2BA 1CUKA 4CKBA 3PF5A 2K7VA 3H6MA 4R4IA 1G51A 1H9SB 4A3GG 1TQOA 2VNUD 5J1ZA 5JPNC 4KLKA 1STBA 2F0SA 2BOSA 2R93B 1MIUA 5C4XB 2NTSA 4G4KA 2H5XA 4CKEA 1XMQQ 1XMOL 1CQFA 3FVQA 2R7DA 3VA5A 5FO9B 1S5DD 2ATWA 2IT1A 3KOJA 4G7OC 3BZCA 2LKVA 4S3SA 1WD0A 2K6AA 2LFNA 1VQ8A 4KN4C 1LLRD 4DR4L 1FD7D 1YBYA 4HJ8A 4BY7H 4Q0FA 1I3QH 3M4PA 1KNEA 1BQQT 1WTWA 1G8ZD 4C3HH 4MTNA 1IYUA 2SEBD 3BJUA 3ITPA 3KJPA 1B53A 4A3FG 2UXDL 4X62L 5IP7H 1BXTA 4DV1Q 1GM5A 2IWHA 1L1OA 2AUKA 4DPGA 1JJ2A 1PH8A 1Q90A 4L8JA 4A3LG 3J81c 4DK6C 1H9JA 3P7JA 1BCPB 2VQFL 1PMRA 2B29A 2KEDA 5K36H 1WTRA 1OXXK 5LL6S 4QJFA 4DAPA 5JJIA 3I91A 2R92H 3PUZA 4UY8C 3MXUA 1B7YB 1YNXA 3IAYA 1Z47A 3SK4A 4ME5A 3GTLH 3ULJA 4MZ9A 4DR2Q 5IT9E 3MTSA 5H1SE 5IODA 1SN8A 2BDNA 5ELFA 2N78A 5IYBH 5FJ8H 1DOKA 1K8AC 2JYOA 2OWOA 4JI2L 3CC4A 1TWGH 4B3SL 4FF4A 2HIVA 3N52A 3MEFA 2HDLA 3DMUA 5EPKA 4DXFA 5LL6X 1PRTB 3M7NA 2O2LD 2UXCL 2N55A 2PZWA 5GADC 1AN8A 1SLJA 5DLQE 1RJTA 1C48A 4FXDA 2R6GA 2MHVA 1EFWA 1O7LA 3IL8A 5I9OA 3VYUA 3M4QA 4DR4Q 2A8VA 1VQ6A 4V190 1FNWA 3TP6A 1U9RA 2EJGC 1GHJA 1QUQB 3OMCA 2RF4A 1CKOA 4A3MG 3QO2A 1PRTC 3I4NG 4DF7A 2KCNA 5C44B 1Z9FA 3VR5A 4RGOS 4X62Q 1SMYD 1VMCA 5DEHA 1JICA 3RNUA 2PZTA 4JV5L 2OTLA 1L1OB 1VQGA 4FNFA 1MJCA 1C0AA 4JI5Q 4H02A 2VQFQ 2D0OA 4B3ML 2NYZD 4IOAA 4H7BA 3K6OA 3NWTA 2LXKA 2E74C 2Q2HA 1HUMA 4LWCA 3R2IA 3F2DA 1IW7D 2XWBB 1G2TA 1YJWA 4B3RQ 4IUTA 3OW2A 4ZUIA 2OQKA 2VUMH 1H9MA 1M8AA 4OGQC 4GLAC 1N36L 1LM0A 1X65A 1HA6A 2N3SA 1KABA 3J7AF 2A1AA 1L1OC 3TS0A 3T1HQ 3DWQA 1PH1A 5AJ3Q 1U4MA 3BVZA 3OIQA 2Z6KA 3A55A 2K5DA 1KDBA 3DM1A 1TWAH 4AQYL 2D62A 5FOBB 2A5HA 2JA7G 2K14A 2K5VA 4OO1I 2CWAA 4Y7NH 3WOEA 4IPHA 4BBRH 3SDZA 3I4LA 3GDEA 3QWNA 1HZBA 4JI1L 1TU2B 5EKKA 3HP3A 1D8LA 3M3YH 1D6EC 2KEEA 4JI4L 1EU4A 2VB2X 1KRTA 1LT5D 1SROA 2UXCQ 1RDPD 1NR4A 3U50C 4KHVA 1SYGA 5KNCA 2F0KA 4F87A 3RLNA 1HA5A 4MN3A 5ELBA 2I5LX 1SBBB 1DZ1A 3HOZB 4A93G 1OXVA 5FLMH 1J5EQ 4QIWB 5CR3A 1XPOA 3D6CA 3P75A 2WP8J 3VYTA 3OWFA 2K4KA 1X3FA 1HXYD 2IPKD 2HCCA 4DA2A 4A3KB 1XYIA 3HG9A 1D5XC 3CCRA 2C5CA 5BN5A 1NAPA 1VQJA 1MGSA 1HNWL 3B6YA 3W1GA 2KOLA 1JOKA 4OIJA 1WFQA 4B3MQ 1WCMB 1UWVA 3PO2B 1V8QA 5JJZA 4DV6L 5JVG3 5FO8B 4JOIA 2EXZA 4BS9A 4DV5Q 1SYDA 2PZUA 1ONLA 2GA4B 1MI2A 3KF8A 1HR0L 1ZYRC 5C3EB 1SJHD 2KVMA 5M3MH 1PH6A 3VYRA 4EQOA 1TKWB 2R3ZA 3BDLA 4MHEA 1UE7A 4QQBX 4RH6A 2YV5A 1ASYA 1XNRL 5FO7B 1F9PA 4LUOA 2PPBC 2F0MA 3E9IA 1ZEQX 2L11A 1ASZA 3RN5A 2VXWA 1YVCA 1NSNS 4POFA 4A3GB 2HUGA 3NTKA 2XRSD 4GN4B 1HNXL 2J7ZA 5IGDA 2E75C 4YY3L 2RDGA 4JI0L 4DNRB 3S15B 2XVSA 5IWAQ 4XT3B 2F3WA 1B50A 4EX5A 3S14B 2F0OA 4X3TA 4JI1Q 1HQRD 4AYBB 3PIP3 1Z7TA 1ENCA 3RN2A 2R7ZG 1RTOA 3ICEA 5IOCA 1VQ7A 2IX1A 4A3IB 2Z6KC 2Q8IB 4LK1C 4J1MA 2ALYB 2O5JC 2JK8A 3K5LA 1EOVA 3T13A 4IPDA 1YJNA 3I4MH 4YWMA 1HR0W 2M2LA 4MIUA 1O80A 2J0TD 4A3FB 3DWAA 4PMWA 2R61A 4R9WA 2RDHA 3RZDB 3AEVA 1TWCH 1GUTA 4PZ7A 4JI7Q 1ZXTA 3OMGA 1JC7A 3EFXD 5AFWA 1HTPA 4JG2A 3IFTA 5IGFA 1LV9A 1HNWQ 4JC0A 1H9KA 5ELNA 5IT9L 4X3KA 5IYCH 1F9RA 1IBLQ 2CCZA 4BY1H 1E0BA 3L3OC 4DGZA 3CAMA 1STGA 4BWGB 2LY7A 4P74A 3CCJA 1VQDA 3KF8B 5E7NA 1HR0Q 1W6JA 1NMFA 3WOFA 1G91A 1VF7A 3QIAA 5T1GA 2Z8LA 3GTJH 1RHPA 2B2YA 4A3EH 4DV2L 4DR1L 2QA4A 1KL9A 1PFBA 3CRKC 4GOPA 2QEXA 3K8AA 1JOQA 2X6GA 3CW2C 4KY7A 4K5WA 2JA8B 1E22A 5GROA 3FRPB 2XIWA 1S5FD 2VB3X 4RA8A 2B2WA 4HJ5A 4X66Q 3OTOQ 1YI2A 1HNXQ 1YZ6A 1EQQA 4KY6A 3NXWA 4IFDH 1TS3A 2WIIB 5EPJA 2F0FA 1PH3A 3G6JB 3D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 j;  4GNX A;  3UDF A;  1X54 A;  2OCE A;  2NZH A;  2JA8 G;  1I6H H;  4DUY L;  1NY4 A;  1X55 A;  4K0K Q;  4JI8 Q;  1JJG A;  1X56 A;  3GTM H;  2K5N A;  3PIO A;  5IP9 H;  4UPA A;  3TRE A;  3HOY H;  1KAW A;  2VY3 A;  2ZTC A;  1N36 Q;  4KHZ A;  2K52 A;  5IYC G;  1N33 L;  4JI6 L;  1GVP A;  2UUA L;  2CQO A;  5HY6 A;  1GO3 E;  1I5F A;  1VQB A;  1WCM G;  4BY1 G;  4DV3 Q;  2PQA A;  2JA5 H;  1CKN B;  1L2F A;  5J3B A;  1O7I A;  3K0X A;  1XPR A;  2MNA A;  2YTY A;  3PO2 G;  4RG1 A;  4OWW B;  4IPG A;  5M5W H;  3G71 A;  1SRU A;  3S1N H;  1HZA A;  2KEN A;  3NBH B;  2MQH A;  1UE6 A;  1EYG A;  1Y1W H;  2AWO A;  2YTV A;  2VL6 A;  4R4O A;  4AQY Q;  1JJC B;  2RHQ B;  4YHH Q;  5C3E G;  2ID0 A;  2BA1 A;  4YWL A;  1K3R A;  3A5Z B;  4A3F H;  3L2P A;  1PH9 A;  4DR2 L;  4FDB A;  4QL5 A;  3KFU A;  3RZD H;  4A3E G;  1J5E L;  1AE2 A;  3L0O A;  1WYD A;  3S1M H;  4IPC A;  4PG3 A;  4DV0 L;  4A3B H;  3STB D;  4A3L H;  5M3F G;  3S17 H;  4BXX H;  4NXN Q;  3K7A H;  3FP9 A;  2ZM6 Q;  2KCM A;  4HIM A;  1W2B A;  1CUK A;  1FL0 A;  2GN5 A;  4DAM A;  4JI4 Q;  2HHH L;  4IFD I;  1OXU A;  3PF5 A;  4LUV A;  5GAG C;  1KIX A;  4R4I A;  1G51 A;  4B3T Q;  2ASB A;  2I0Q A;  4A3G G;  4JYA L;  2VNU D;  3I56 A;  1WI5 A;  2IHF A;  4LF8 Q;  4KLK A;  2ZTE A;  1NTG A;  4O2D A;  1MIU A;  1VQF A;  1EWI A;  4IFD G;  1EQR A;  1KQS A;  4NB3 A;  1U0L A;  4WJ3 M;  2H5X A;  4LF7 L;  2HT1 A;  1XMQ Q;  1XMO L;  1EIY B;  1EUJ A;  2R7D A;  1BKB A;  2PNH A;  1NMG A;  1LTL A;  1SR3 A;  3U58 A;  3GO5 A;  2ATW A;  2IT1 A;  3KOJ A;  1N8R C;  1IL2 A;  2RCN A;  3BZC A;  1Q81 C;  4DV5 L;  3A5U A;  1XJV A;  4DR1 Q;  1VQ8 A;  2WFW A;  3STB C;  3KF6 A;  4DR4 L;  5IP9 G;  1YBY A;  4HJ8 A;  3KJO A;  3HOY G;  2KCT A;  5JEA G;  5BR8 Q;  4DNI A;  2CWP A;  3ZJY C;  4KHP L;  4LNQ A;  4BY7 H;  1I3Q H;  3EN2 A;  3M4P A;  2JA5 G;  3RLF A;  1A62 A;  2JE6 I;  4MTN A;  4C3H H;  1XPU A;  3BJU A;  1Q46 A;  1UE1 A;  1V9P A;  3HFZ B;  1T9H A;  3KJP A;  1Y1W G;  4IFD J;  3AQQ A;  1PA6 A;  2QGQ A;  5C0X G;  4A3F G;  1B8A A;  3CC2 A;  4X62 L;  1XNQ Q;  2UXD L;  1KHI A;  2NZO A;  4JI3 L;  2GVA A;  5IP7 H;  1LYL A;  4DV1 Q;  4DV6 Q;  1GM5 A;  1PFS A;  1L1O A;  4RMF A;  4DPG A;  2N8N A;  4GOP C;  1PH8 A;  1JJ2 A;  3KDF A;  4A3B G;  4DUY Q;  4A3L G;  2ES2 A;  3J81 c;  3VDY A;  4DK6 C;  5IWA L;  4BXX G;  2UUB L;  2VQF L;  2B29 A;  2Y0S G;  3H15 A;  1S40 A;  2IX0 A;  3HOX H;  4A3C H;  3J7Z C;  4YCV A;  4PZ8 A;  1OXX K;  1IBM L;  1VQ4 A;  2K75 A;  3PCO B;  1IYJ B;  4QJF A;  4JI6 Q;  3S1Q H;  2ZJR A;  5JJI A;  4EQ5 A;  4APV A;  4L5R C;  1HNZ L;  1XNR Q;  2AWN A;  3I7F A;  2R92 H;  4A3M H;  3PUZ A;  4UY8 C;  1RL2 A;  4IOC A;  1YEZ A;  3UDI A;  1B7Y B;  4LF4 L;  2AHO B;  1YNX A;  3I4N H;  3M9B A;  4ME3 A;  1Z47 A;  2IHE A;  4GLX A;  4X65 Q;  2F4V Q;  3GTL H;  1A8V A;  4JOI C;  3I4O A;  3ULJ A;  4GNX C;  5C4J H;  3CCS A;  3J81 i;  3HKZ E;  4MZ9 A;  4DR2 Q;  3PSI A;  4TVA B;  1VQL A;  4NXM L;  1BVS A;  1JMC A;  5H1S E;  2VW9 A;  4YY3 Q;  1VQK A;  4JI0 Q;  4LFC L;  4A3D H;  1SN8 A;  2A19 A;  4ALP A;  4L5S A;  2N49 A;  4P72 A;  4DV4 L;  3ULP A;  3I2Z A;  2N78 A;  4X64 L;  4DR7 L;  2E8G A;  4BY7 G;  1I94 Q;  2GVB A;  2CFM A;  5IYB H;  3PUW A;  5FJ8 H;  5C44 H;  1Y14 B;  1K9M C;  1K8A C;  3PUX A;  1GKH A;  2OWO A;  1RIP A;  4GLV B;  3CC4 A;  1TWG H;  4JI2 L;  4B3S L;  4JI7 L;  4LF6 Q;  2HIV A;  4LF9 L;  1SMX A;  2Q2T A;  3MEF A;  1FVI A;  2KBN A;  3HOV H;  3H0G H;  2R93 H;  1HZC A;  1NBW A;  1PV4 A;  3DLL A;  2K5H A;  5C4X H;  3CPW A;  4P73 A;  1IBL L;  1N9W A;  1EIF A;  1P8L A;  4O0A A;  2D0P A;  5IP7 G;  4LF7 Q;  3M7N A;  2UXC L;  1E7Z A;  3NEM A;  5GAD C;  1N32 L;  1SLJ A;  2HQL A;  4JBJ A;  1SE8 A;  4R1J A;  5DLQ E;  5LMU L;  1VQ5 A;  5M5Y H;  4DR5 L;  1NE3 A;  2R6G A;  4XIG S;  2MO1 A;  1EFW A;  1PYB A;  3NEL A;  4R4T A;  3M4Q A;  4DR4 Q;  2VQE L;  3HOX G;  2A8V A;  1VQ6 A;  3S2H H;  4A3C G;  4DR3 L;  4YCW A;  1H95 A;  5K36 G;  4HJ9 A;  2JA7 H;  1KD1 C;  2E2H H;  1I50 H;  4KHP Q;  3D31 A;  1QUQ B;  1YJ9 A;  4LF5 Q;  2RF4 A;  3CPF A;  1CKO A;  3I55 A;  4A3M G;  1OXS C;  2R92 G;  5IYD H;  1S72 A;  1HH2 P;  2WAQ G;  3CF5 A;  3A0J A;  2BH8 A;  4UP7 A;  1IBK L;  3I4N G;  3J7A 5;  4LFA Q;  1Z9F A;  4OWX B;  5JJL A;  4X62 Q;  1JB7 A;  4JI3 Q;  1N34 L;  5GAH C;  4X66 L;  3OTO L;  3RNU A;  4JV5 L;  2OTL A;  3RZO H;  1L1O B;  2FXQ A;  3BZK A;  1VQG A;  4A3D G;  4QIW E;  4GN5 A;  3G4S A;  1MJC A;  3GTK H;  3UE1 A;  5LMN L;  1C0A A;  4DV7 Q;  4JI5 Q;  1VQO A;  4H02 A;  1V1Q A;  2UUB Q;  2VQF Q;  2D0O A;  3CC7 A;  4B3M L;  4KI0 A;  4IOA A;  2LXK A;  4JBM A;  4OX9 L;  1PVO A;  2PI2 A;  2Q2H A;  4A93 H;  4LWC A;  3F2D A;  1IBM Q;  5IYB G;  5FJ8 G;  4DR6 Q;  5C44 G;  3CMA A;  1YJW A;  4DV2 Q;  2HIX A;  4LFB L;  1PH5 A;  4BBS H;  4B3R Q;  4K0K L;  1BBW A;  1TWF H;  3OW2 A;  4DUZ Q;  4GOP B;  1VQA A;  1KC8 C;  1D7Q A;  3HOV G;  3H0G G;  4XTC S;  2OQK A;  2VUM H;  4POG A;  2R93 G;  3KYH C;  4GLA C;  1N36 L;  1LM0 A;  1X65 A;  4J15 A;  2ZJQ A;  2N3S A;  1HJP A;  1E1O A;  5C4X G;  1PH4 A;  3TEH B;  4HJA A;  2A1A A;  4YCU A;  2ZTD A;  1Y1V H;  3CCE A;  3FHW A;  1L1O C;  4DV3 L;  2B63 H;  1CKN A;  3TS0 A;  3T1H Q;  2DUD A;  1PH1 A;  3HOZ H;  5AJ3 Q;  4QY7 A;  1PH2 A;  3F8T A;  2C35 B;  2Z6K A;  4IJL A;  4LFC Q;  3UE0 A;  2BH2 A;  3F2C A;  4C2M H;  1VQH A;  1TWA H;  2EXD A;  1WOC A;  2D62 A;  4YWK A;  4DKA C;  4YHH L;  4AQY L;  2UU9 L;  2R7F A;  1JT8 A;  2JQO A;  2JA7 G;  2K14 A;  1P16 A;  2K5V A;  4GNX B;  1X9N A;  2CKZ B;  1U5K A;  2CWA A;  4OO1 I;  3PF4 A;  4Y7N H;  1IZ6 A;  4IPH A;  4BBR H;  5M5X H;  5IYD G;  2V1C C;  3CCM A;  4A3J H;  4LF9 Q;  4QGU A;  4A3K H;  1FJG L;  3GDE A;  5EAY A;  4DK3 C;  4X6A H;  1HZB A;  4JI1 L;  1YHA A;  3CCL A;  4L5T A;  1N33 Q;  1D8L A;  3T1Y L;  2OQ0 A;  2VS1 A;  1VQM A;  3M3Y H;  2UUA Q;  4JI4 L;  1KRT A;  4DR7 Q;  4OON A;  2AMC B;  1SRO A;  2PQA B;  4GKK L;  3SGI A;  2UXC Q;  2JA9 A;  3U50 C;  1OXT A;  5LMN W;  3RLN A;  5LMU Q;  1FGU A;  1VS0 A;  2MFI A;  2Q2I A;  2I5L X;  3BU2 A;  3PUV A;  5GQO A;  1K73 C;  4IJH A;  5IY0 A;  3RR5 A;  4AYB E;  2LSS A;  1XMQ L;  3IRB A;  4UP9 A;  4LUZ A;  4C3J H;  2VQE Q;  2JA6 H;  3WWV A;  4DR3 Q;  2RHS B;  3U4Z A;  2F3I A;  4A93 G;  1OXV A;  5FLM H;  3LGJ A;  3E9H A;  1DGS A;  3FKI H;  1J5E Q;  4BBS G;  1VQ9 A;  4DV0 Q;  3TRZ A;  1X3E A;  2YU9 H;  1TXY A;  3AFQ A;  4GS3 A;  3ERS X;  5IT9 c;  2VUM G;  3GD7 A;  3MXN B;  1X3G A;  4BA1 I;  1XPO A;  3S2D H;  1CSQ A;  1E3P A;  1S3O A;  1R9T H;  1JE5 A;  1A0I A;  1HZ9 A;  1IBK Q;  2WP8 J;  1VQI A;  1Y1V G;  2K4K A;  1X3F A;  3DM3 A;  3F1Z A;  4R4Q A;  1VQP A;  1MJE A;  2HHH Q;  2B63 G;  1SFO H;  2R7Z H;  4JYA Q;  3HOZ G;  1N34 Q;  3CCR A;  3PGZ A;  3CD6 A;  1VQJ A;  1HNW L;  3B6Y A;  3W1G A;  3GTP H;  1M90 C;  3S15 H;  5LMN Q;  1BBU A;  2JEB I;  3NEN A;  1XMO Q;  1WFQ A;  4B3M Q;  1UWV A;  2E5L L;  3S1R H;  1MKH A;  4DV6 L;  4OX9 Q;  3S14 H;  3KLW A;  4R4C A;  4JOI A;  4GKJ L;  4NPS A;  4BBR G;  4DV5 Q;  2XTI A;  3H3V H;  2Y0S E;  4LFB Q;  3K80 C;  4A3J G;  3CCU A;  4A3K G;  1M1K C;  3KF6 B;  1HR0 L;  4A75 A;  4A3I H;  5M3M H;  1PH6 A;  2ZJP A;  3HOW H;  2F52 A;  1K8G A;  3A74 A;  2VZA A;  3G48 A;  1UE7 A;  3GTG H;  4A4I A;  1PHJ A;  2UUC L;  4QQB X;  3PV0 A;  2YV5 A;  1ASY A;  1Q7Y C;  3HOU H;  1XNR L;  1X6O A;  3EBE A;  1W3S A;  2OTJ A;  4HIK A;  3Q8D A;  4LUO A;  1KRS A;  4MNO A;  3E9I A;  2WB1 E;  5FLX c;  1IXR A;  1K83 H;  2UXB L;  2I5M X;  3AFP A;  1ASZ A;  2NVX H;  3RN5 A;  3EIV A;  2NVY H;  1YVC A;  2AKW B;  2UXD Q;  3TQY A;  4X65 L;  2JA6 G;  2F4V L;  2DGY A;  3D0F A;  4POF A;  2UU9 Q;  2NN6 I;  5FLM G;  2Z0S A;  3FKI G;  4GN4 B;  1HNX L;  4OXP A;  4YY3 L;  4JI0 L;  3J80 c;  3KDF B;  3GTQ H;  2LXJ A;  1J6Q A;  1L0W A;  5IWA Q;  1E24 A;  2NN6 G;  2BA0 A;  4EX5 A;  1FJG Q;  1Q86 C;  1PH7 A;  3UDG A;  1CSP A;  4AH6 A;  1Q12 A;  4JI1 Q;  3CME A;  4JBW A;  3T1Y Q;  1I94 L;  1C7Y A;  3RN2 A;  2R7Z G;  3GTO H;  1UEB A;  4JI8 L;  3ICE A;  1HNZ Q;  1C9O A;  5IE8 A;  1VQ7 A;  4LF6 L;  4GKK Q;  2IX1 A;  2Z6K C;  3JAM c;  1Q8K A;  1VCI A;  2XGT A;  4L5Q A;  1E1T A;  3G6E A;  4LF4 Q;  2ALY B;  4AIM A;  3OYY A;  3TS2 A;  5JJK A;  2JK8 A;  3H3V I;  3PIP A;  1EOV A;  4JCV E;  5ELO A;  4IPD A;  4OWT B;  1Q1E A;  2PI2 E;  3J80 i;  4IO9 A;  1CKM A;  3M85 A;  1YJN A;  1QZH A;  4Y52 H;  2NVT H;  3I4M H;  1VQE A;  4AYB G;  4NXM Q;  1UE5 A;  4YWM A;  2I5H A;  3HKZ G;  1HR0 W;  2EQS A;  2Q2U A;  3HKS A;  1XTD A;  1YHQ A;  3UDX A;  3M4O H;  1QVG A;  4A3I G;  1YIT A;  5M3M G;  4PMW A;  4DV4 Q;  3HOW G;  1PYS B;  1K0R A;  4X64 Q;  1WJJ A;  3PO3 H;  2B3G A;  5HGQ A;  3AEV A;  1B70 B;  1TWC H;  3K81 C;  1AE3 A;  2JJQ A;  4P71 A;  3JAM i;  4HJ7 A;  2JA8 H;  1QUQ A;  4PZ7 A;  4JI7 Q;  2WAQ E;  3ER0 A;  4JI2 Q;  3CCV A;  3HOU G;  3S24 A;  1YIJ A;  4P75 A;  4B3S Q;  2YTX A;  4GN3 B;  4HID A;  4LF5 L;  5C0X I;  2IY5 B;  4NXN L;  3F2B A;  5GAE C;  1YHB A;  4JG2 A;  3W5O A;  1NJI C;  2E2J H;  4OO1 G;  1G6P A;  1HNW Q;  1GD7 A;  4JC0 A;  2ZM6 L;  5ELN A;  4JBK A;  5IYC H;  4LFA L;  4GKJ Q;  1IBL Q;  2CCZ A;  4DAY B;  1VQC A;  1Q82 C;  4TQU S;  4B3T L;  4WJ4 A;  4BY1 H;  1WCM H;  4HIO A;  4C3I H;  2E5L Q;  4LF8 L;  3E0E A;  3ULL A;  3W1B A;  2KHI A;  3PO2 H;  1N32 Q;  2K50 A;  3CAM A;  4PZ6 A;  3JC6 6;  4DR5 Q;  4P74 A;  2MO0 A;  3K7U C;  4UP8 A;  2PMZ E;  3CXC A;  3AYH B;  3CCJ A;  1QVC A;  4DV7 L;  4JI5 L;  1LUZ A;  1VQD A;  3KF8 B;  5E7N A;  1HR0 Q;  1VQN A;  1A63 A;  1AH9 A;  4LW1 A;  5C3E H;  1QZG A;  1NMF A;  5JEA J;  3GTJ H;  2UUC Q;  4DR6 L;  4A3E H;  4DV2 L;  4DR1 L;  4B3R L;  2QA4 A;  1KL9 A;  4GOP A;  4DUZ L;  2QEX A;  3CCQ A;  5M3F H;  3U4V A;  3K8A A;  3S16 H;  5BR8 L;  3CW2 C;  1OTC A;  1G29 1;  3PUY A;  2UXB Q;  2EIF A;  1E22 A;  1Q1B A;  5GRO A;  2YYZ A;  2WB1 G;  1V43 A;  5C0X J;  2E2I H;  4HJ5 A;  3I4M G;  3T1H L;  4X66 Q;  3OTO Q;  4A3G H;  2NVQ H;  1YI2 A;  1KXL A;  4JV5 Q;  5AJ3 L;  1QVF A;  1HNX Q;  1TWH H;  1YZ6 A;  4A76 A;  1EQQ A;  2JEA I;  3L7Z C;  3RLO A;  2L15 A;  4BA2 I;  1XNQ L;  3CP0 A;  3CQZ H;  1PH3 A;  2KHJ A;  4DV1 L;  3PO3 G; 
#chains in the Genus database with same CATH topology
 3J81 j;  2F0N A;  1EY0 A;  3J7A V;  2HD3 A;  4DUY L;  1UNS A;  1B1Z A;  1SXT A;  3A8J E;  3GTM H;  5IP9 H;  3TZD A;  1DJR D;  2VY3 A;  4HCS A;  5JEA H;  1I4Q A;  4KTA A;  1DCZ A;  3S9W A;  4JI6 L;  1STE A;  2UUA L;  4XYQ A;  1I5F A;  2JA5 H;  4QUC A;  1L2F A;  2K03 A;  4A3M B;  5T1I A;  4RG1 A;  3NHH A;  4IPG A;  4OWW B;  1HFG A;  2KEN A;  4IUR A;  4NP5 A;  3I4N B;  2K05 A;  1Y1W H;  1RF2 D;  3JAM L;  2AWO A;  2RHQ B;  2BA1 A;  1K3R A;  3A5Z B;  4XDX A;  1D5M C;  1PH9 A;  2O4X A;  4ID6 A;  1TWH B;  3SXH A;  1A3U A;  5KYI A;  4A3B H;  2EJF C;  5M3F G;  3DWP A;  2KCM A;  4HIM A;  1FL0 A;  2HHH L;  4IFD I;  1KIX A;  1WTO A;  5GAG C;  4JYA L;  1WI5 A;  1WTV A;  4O2D A;  1WD1 A;  1A3T A;  1EWI A;  2E76 C;  2FFK B;  4PNY A;  2F0G A;  1KQS A;  1FR3 A;  2WAC A;  1BKB A;  1NMG A;  1SR3 A;  3U58 A;  1E2Z A;  3OSO A;  4ZCK A;  1IL2 A;  2B2U C;  4WFN 3;  1EYD A;  1GUO A;  3A5U A;  1E2V A;  4DR1 Q;  1EY8 A;  3LWU A;  3S2H B;  2PYK A;  2RBM A;  2X6L A;  1ICF B;  2JA7 B;  2E2H B;  1LTT D;  4CDE C;  5JOB A;  4DAV A;  3TP7 A;  3MXG A;  3K59 A;  1XPU A;  1Q46 A;  3U9S A;  1V9P A;  1T9H A;  4CKC A;  4EQN A;  4IFD J;  5CBE E;  3A8K E;  4ZRZ A;  1XXG A;  3I73 A;  2QGQ A;  5C0X G;  3M4Y A;  2NZO A;  1MBY A;  2GVA A;  4H44 C;  1LYL A;  3VR6 A;  3RZO B;  4OIK A;  3GV6 A;  1D1K A;  4GOP C;  1AP0 A;  3KDF A;  4XQQ A;  4DUY Q;  2ES2 A;  2BE5 C;  4BXX G;  2UUB L;  2Y0S G;  1QNK A;  2IX0 A;  2RVL A;  1DOM A;  3T4A C;  3HOX H;  4A93 B;  4YCV A;  4PZ8 A;  1EOT A;  2B2W C;  1VQ4 A;  3PCO B;  4JI6 Q;  3S1Q H;  1TWF B;  1EQV A;  4EQ5 A;  4L5R C;  1GUG A;  4TSS A;  3I7F A;  1RL2 A;  4I65 A;  3MFG A;  4IOC A;  1YEZ A;  2M00 A;  1EY7 A;  1A15 A;  4LF4 L;  2PNR C;  2IHE A;  4CBV A;  4GLX A;  4X65 Q;  1I4G A;  1A8V A;  2EY6 A;  3VYS A;  3BYT B;  3J81 i;  4JPB W;  1LTG D;  3HKZ E;  3PSI A;  1BVS A;  3TN2 A;  5KRU A;  1JMC A;  1VQK A;  1EEF D;  4PQX A;  1DXM A;  1LT3 D;  4LFC L;  5TSS A;  4A3D H;  5ELD A;  1ROD A;  3K57 A;  2A19 A;  4DV4 L;  3MXP A;  3I2Z A;  4X64 L;  1E2W A;  1XX8 A;  1DYQ A;  2E8G A;  2BDO A;  2GVB A;  4J6H A;  1I94 Q;  4BY7 G;  4PMC A;  1F9Q A;  4DK0 A;  4C3H G;  5C44 H;  1Y14 B;  1GKH A;  4LF6 Q;  1RIP A;  5HUR A;  2Q2T A;  2KBN A;  3HOV H;  3H0G H;  1BUV T;  1PRT D;  1NBW A;  2F1M A;  3H94 A;  3FMC A;  3CPW A;  1EIF A;  5KND A;  5IP7 G;  2HQE A;  1E7Z A;  1N32 L;  4JBJ A;  1SE8 A;  1SJE D;  5LMU L;  1VQ5 A;  5M5Y H;  3T51 B;  2LMC B;  4RGN A;  3NEL A;  2IX3 A;  5K36 G;  1VF5 C;  2WKD A;  1GOZ A;  1IHZ A;  5FLX E;  2YU9 B;  2SNS A;  4LF5 Q;  2R92 G;  5IYD H;  3E5S A;  4QB4 A;  1EEI D;  1S72 A;  2WAQ G;  4IAL A;  5K5P A;  1IBK L;  2B2T C;  4LFA Q;  4EGV A;  4F8M A;  1KDC A;  4OWX B;  3J80 E;  3Q24 A;  1SFO B;  2R7Z B;  1JB7 A;  2K32 A;  1N34 L;  1L0Y B;  4ZQ3 A;  1ENA A;  1EL0 A;  2RSO A;  1B3Q A;  4U68 A;  3GTK H;  1S5B D;  4CJ2 C;  2F0W A;  4FXK C;  5J22 A;  3FEW X;  3OIP A;  1VQO A;  2UUB Q;  3WDN A;  3CC7 A;  1JWM D;  2G9H D;  4OX9 L;  1SYB A;  4DU9 A;  4DR6 Q;  5IYB G;  5FJ8 G;  1B44 D;  3A8I E;  3CMA A;  4BBS H;  4K0K L;  1LTS D;  4IZ8 A;  1VQA A;  4DUZ Q;  2DY7 A;  2B8F A;  2F0T A;  4LMQ D;  4XTC S;  3KYH C;  4CHT B;  2ZJQ A;  2D5D A;  3GTG B;  1F2Z A;  1E1O A;  1WTX A;  1Y1V H;  5CV4 A;  4N9P A;  5C3W A;  1QOH A;  1KDA A;  2B63 H;  2NB0 A;  2NTT A;  4HN7 A;  4RFB A;  2DUD A;  1S5C D;  3HOZ H;  5IIF A;  1K83 B;  2L12 A;  2NVX B;  4LFC Q;  1SAP A;  2BH2 A;  1NCV A;  4C2M H;  1VQH A;  1WOC A;  2UU9 L;  3H3V C;  2JQO A;  2NBF A;  1X9N A;  4FF3 A;  1U5K A;  2SOB A;  4E6I A;  2V1C C;  3O13 A;  1UEA B;  4A3J H;  1FJG L;  4A3K H;  2Z9H A;  1HUN A;  1YHA A;  3CCL A;  4L5T A;  4RWS C;  1N33 Q;  2OQ0 A;  2VS1 A;  4U67 3;  3K5M A;  3SHL A;  2AMC B;  1V1P B;  2PQA B;  4GKK L;  2JA9 A;  3SR1 A;  5LMU Q;  1FGU A;  1VS0 A;  2Q2I A;  3C1E A;  3PUV A;  1K73 C;  4KN7 C;  4IJH A;  2A68 C;  1VDZ A;  3IRB A;  4C3J H;  4LUZ A;  2JA6 H;  1GJX A;  2NVT B;  2H1E A;  5DM6 3;  2F3I A;  4K8J A;  3E9H A;  1Y8N B;  1SSO A;  2QIL A;  1QG7 A;  4ULL A;  3M4O B;  1LAB A;  1WTH A;  1ZYR D;  3AFQ A;  5IT9 c;  2VUM G;  3GD7 A;  2CQA A;  1X3G A;  4BA1 I;  1BOS A;  1I4X A;  1E3P A;  1R9T H;  1L0X B;  1JE5 A;  1EZ8 A;  1HZ9 A;  3BS1 A;  1IBK Q;  5CC4 A;  3N6R A;  4C1N K;  2IL8 A;  1N34 Q;  2E2J B;  3PGZ A;  5C5L A;  3GTP H;  5C6A A;  2EYH A;  1XWE A;  3S15 H;  3NEN A;  1XMO Q;  1TS2 A;  4K6D A;  3M7G A;  2WIN B;  1SNP A;  2E5L L;  3CRL C;  4OX9 Q;  3S14 H;  2ICE C;  3R2T A;  4HMJ A;  4BBR G;  4DK1 A;  2Z6B A;  2SNM A;  1AZP A;  4A3I H;  3HOW H;  3FKI B;  3A7A B;  1EY4 A;  2VZA A;  3GV3 A;  1FGB D;  4A4I A;  1PHJ A;  3PV0 A;  4WRD A;  3HOU H;  3EJI A;  2JSO A;  1W3S A;  5M3F B;  2OTJ A;  2G9D A;  3S16 B;  3TP5 A;  4OO1 H;  2UXB L;  5EQ0 A;  5BN3 A;  1F77 A;  2NVY H;  2UXD Q;  5C3X A;  2F4V L;  2E2I B;  3D0F A;  5J39 A;  2UU9 Q;  2NVQ B;  5FLM G;  5I6Y A;  3HS0 C;  3I8Z A;  3FPP A;  2KJX A;  2LXJ A;  2AQ1 B;  4RGT A;  3KK7 A;  4LAA A;  1FJG Q;  1QCB D;  1Q86 C;  1PH7 A;  3UDG A;  2IJ0 A;  4AH6 A;  2DNC A;  1CZG A;  1QWY A;  4OEL B;  1C9O A;  4GKK Q;  1STH A;  3JAM c;  5IGG A;  3G6E A;  4K14 A;  5KEE A;  5JJK A;  3PIP A;  1O78 A;  1EYA A;  2PI2 E;  4IO9 A;  3M85 A;  4XXE A;  1UE5 A;  2F03 A;  2KHS A;  3T56 B;  2I5H A;  3DEO A;  5NUC A;  3DXJ C;  2MPM A;  1XTD A;  5M3M G;  2JP1 A;  1PYW D;  4XQN A;  1K0R A;  1WJJ A;  1B70 B;  2A73 B;  4P71 A;  3GTQ B;  2JJQ A;  2JA8 H;  3AB9 A;  4JI2 Q;  3ER0 A;  3CCV A;  3S24 A;  4P75 A;  4B3S Q;  4GN3 B;  3S17 B;  2Y0S B;  4NXN L;  3F2B A;  5GAE C;  1YHB A;  3KLR A;  1GD7 A;  1V1O A;  4ABN A;  2MGS A;  4R8N A;  4EVO A;  1SYE A;  3MVV A;  4WJ4 A;  1BO0 A;  4K5V A;  2E5L Q;  3E0E A;  3ULL A;  3W1B A;  2CHB D;  2CH4 W;  4JVZ A;  5E4W C;  4PZ6 A;  3JC6 6;  4F7X A;  3DUZ A;  2F0U A;  4UP8 A;  5EGT A;  2G5D A;  3CXC A;  2PW5 A;  2ZT9 C;  2WB1 B;  4DV7 L;  1AH9 A;  1SND A;  4LW1 A;  4WOR A;  1MD2 D;  3VR3 A;  3E6Z X;  1XTC D;  5D3I B;  3CCQ A;  1CHQ D;  3U4V A;  3PO3 B;  5BR8 L;  3PUY A;  2UXB Q;  1PTO F;  1ML0 D;  1I3Q B;  2YYZ A;  3KUP A;  3I4M G;  1SDF A;  4JV5 Q;  2AQ2 B;  4UAI A;  1CTM A;  1TWH H;  5M9O A;  2CVR A;  3L7Z C;  3RLO A;  3PIO 3;  1WVL A;  1PLF A;  2F0P A;  2L15 A;  1EY5 A;  1XNQ L;  3CP0 A;  3CQZ H;  1EZ6 A;  3R3O A;  3EVQ A;  4GNX A;  4HSP A;  1X54 A;  2OCE A;  1AW7 A;  1PTO H;  1JE4 A;  2K01 A;  3J80 L;  4C56 C;  3TRE A;  3HOY H;  2J4X A;  2ZTC A;  1N36 Q;  2K52 A;  3D4D A;  5IYC G;  4HED A;  3HRZ C;  2K5W A;  3MFY A;  1BNZ A;  3MZ5 A;  2CQO A;  5HY6 A;  1VQB A;  4BY1 G;  2IW3 A;  1XPR A;  5J3B A;  3K0X A;  3BYY B;  2WAQ B;  5M5W H;  1SRU A;  3S1N H;  2YTV A;  5I6W A;  4R4O A;  3W2D A;  4AQY Q;  4CJ1 B;  3GTL B;  3PMF A;  2ID0 A;  1JQY D;  3BVM A;  4FDB A;  1RTN A;  3OW7 A;  4A3E G;  1AE2 A;  3L0O A;  3S1M H;  4IPC A;  5CV5 A;  4PG3 A;  4DV0 L;  1UAP A;  3F2U A;  2PMZ B;  3MXN A;  1IKL A;  4NXN Q;  4KKS A;  1S5E D;  2GN5 A;  4JI4 Q;  3EQL C;  1OXU A;  2EYJ A;  4RAU C;  1TWG B;  2ASB A;  3NP8 A;  3K5N A;  4KKT A;  1LT4 D;  4IFD G;  1EQR A;  4NB3 A;  1U0L A;  1EQT A;  1EIY B;  1D5Z C;  2PNH A;  5FKA C;  1LTL A;  3AU7 A;  1ESR A;  3K0Y A;  3CU7 A;  4ZUJ A;  2K5Q A;  2BE5 D;  3KF6 A;  5IP9 G;  3KJO A;  3GQB A;  1BBX C;  4ZK9 B;  5JEA G;  5BR8 Q;  4G57 A;  1I4P A;  1K8M A;  3BG3 A;  1ET6 A;  2JA5 G;  3EN2 A;  3Q6S A;  2JE6 I;  1SE4 A;  4QF4 A;  1TT2 A;  1UE1 A;  3HFZ B;  4CJ0 B;  1Y1W G;  1F2M A;  1U4L A;  1B8A A;  1XNQ Q;  1KHI A;  1SNC A;  4ZKB B;  5EBC A;  4PMB A;  4DV6 Q;  1PFS A;  3HGB A;  3MWY W;  2N8N A;  1EFI D;  4A3B G;  1JB3 A;  2RDF A;  3VDY A;  1HFN A;  1FNU A;  2X69 A;  1K0S A;  4A3C H;  2EOT A;  1QB5 D;  4FYD A;  1IYJ B;  1WTP A;  2H4O A;  1HNZ L;  1XNR Q;  3SE0 A;  3UDI A;  4OEM B;  4CDF C;  2HCI A;  1B9M A;  3M9B A;  2DJG C;  4JOI C;  4GNX C;  3DEP A;  4TVA B;  4NXM L;  3D3R A;  4YY3 Q;  4JI0 Q;  1TWA B;  2A6E C;  1GUW A;  4L5S A;  4K2K A;  3ULP A;  1W6K A;  2Z4I A;  1ENF A;  2FHT A;  4Y7N B;  3PUW A;  2MUY A;  1K9M C;  3PUX A;  2ENB A;  1S4Z A;  4ZLT F;  1SMX A;  2PO4 A;  1KTK A;  4ZAI A;  1PXU A;  2R93 H;  1HZC A;  3BDC A;  4KMU C;  3M3Y B;  4IN3 A;  1B9N A;  5A35 A;  2F0D A;  3DLL A;  2K5H A;  5C4X H;  4GKJ L;  1A3V A;  4DR7 L;  1N9W A;  1P8L A;  4O0A A;  1Q8I A;  2D0P A;  4C3I G;  4DAY A;  4C1N I;  1MSH A;  2EDG A;  3NEM A;  2HQL A;  2QDB A;  4R1J A;  4DR5 L;  5KGU A;  1J8I A;  4XIG S;  3CKI B;  5CBA E;  1DON A;  5C4J B;  2VQE L;  5I9P A;  1EY9 A;  3HOX G;  1CFM A;  4DR3 L;  4YCW A;  2Q8T A;  4HJ9 A;  1KD1 C;  3TBI B;  3NSW A;  2RSN A;  3D31 A;  4IUN A;  1YJ9 A;  3OHX C;  3P20 A;  1U4P A;  1BCP F;  3I55 A;  1OXS C;  4RHR A;  1ILQ A;  1X3Q A;  3E0J A;  2BH8 A;  1CI3 M;  3EA6 A;  3J7A 5;  4G7Z C;  1NUC A;  5JJL A;  4XQJ A;  5GAH C;  3V2T A;  2EPB A;  1ICW A;  1CZW A;  4A3D G;  4QIW E;  4GN5 A;  4F88 A;  1V1Q A;  5JVH 3;  3W3A A;  5CGK A;  1JOR A;  3SK6 A;  2EYO A;  4JBM A;  1PVO A;  2PI2 A;  5C44 G;  4DV2 Q;  2CW0 C;  2HIX A;  1PH5 A;  3VR2 A;  1BBW A;  1NR2 A;  1KC8 C;  4GOP B;  3C3L A;  1D7Q A;  2TMP A;  3BDO A;  5M3M B;  2EYL A;  3HOV G;  1QIL A;  3H0G G;  4POG A;  1I50 B;  1GUS A;  1CA5 A;  4J15 A;  2F0V A;  2F3V A;  5KIX A;  3Q0A A;  3SVM A;  3TEH B;  1BR9 A;  1ILP A;  2ZTD A;  5FK9 C;  4DXG A;  1JWS D;  3CCE A;  3FHW A;  2DJF C;  5IGB A;  4DV3 L;  1CKN A;  4QY7 A;  3NBH A;  4RKL A;  4IJL A;  1Q3L A;  4FO2 A;  2A68 D;  1H9R A;  4YHH L;  4DKA C;  1G6Z A;  4CGY B;  2B2Y C;  2R7F A;  4YIJ A;  1TY0 A;  2CKZ B;  2KUM A;  3C2P A;  1EU3 A;  3PF4 A;  1IZ6 A;  4JW0 A;  1TS5 A;  5IYD G;  3IKJ A;  3ND9 A;  3SK8 A;  5KYL A;  4TKO B;  3CCM A;  4QGU A;  3R93 A;  4DK3 C;  2K1B A;  1YNJ C;  3KBG A;  3T1Y L;  1VQM A;  1KLU D;  2UUA Q;  2NUC A;  4DR7 Q;  5EBD A;  3Q22 A;  1JWU D;  3UI2 A;  3KLS X;  4P2C B;  5E4X A;  2RKS A;  4AYB E;  1XMQ L;  4XYO A;  4UP9 A;  4HTH A;  2VQE Q;  3WWV A;  4DR3 Q;  3U4Z A;  3I4M B;  4WJW A;  3QB3 A;  1DGS A;  3FKI H;  5COR A;  2L55 A;  4BBS G;  4K5X A;  1X3E A;  3TRZ A;  1TXY A;  2NN6 H;  3Q23 A;  3D4R A;  1CSQ A;  3P1H A;  1S3O A;  2LS0 1;  1A0I A;  2I07 B;  2WV6 D;  1VQI A;  2HHH Q;  1Y1V G;  5M5X B;  3F1Z A;  1MJE A;  4R4Q A;  5BN4 A;  2B63 G;  4JYA Q;  4V0B A;  3I72 A;  3HOZ G;  3FPU B;  4M1U B;  1A2T A;  1BBU A;  4BY1 B;  1STY A;  3MC0 B;  3NQI A;  1CK1 A;  4R4C A;  5G3L D;  4NPS A;  2E2D C;  4A3J G;  2OF1 A;  4A3K G;  2I46 A;  1M1K C;  2TSS A;  4A75 A;  4XT1 B;  3ND8 A;  2HDM A;  2ZJP A;  5C5M A;  3GTJ B;  2KCC A;  2L0C A;  1Q7Y C;  1J9O A;  3S2D B;  4HIK A;  3Q8D A;  1KRS A;  4MNO A;  1WTQ A;  5FLX c;  5CV7 A;  3AFP A;  3EIV A;  2N88 A;  2AKW B;  3TQY A;  4C3J G;  2JA6 G;  3U9O A;  3K5O A;  2NN6 I;  4KY5 A;  1EIG A;  4OXP A;  3J80 c;  3KDF B;  3GTQ H;  2P5Z X;  1L0W A;  1E24 A;  1R4P B;  4RHS A;  3S1R B;  1CSP A;  3A56 A;  5EJW A;  2QDL A;  1DM0 B;  3T1Y Q;  3CHB D;  5DAU A;  2RQX A;  4JI8 L;  3MHB A;  3GTM B;  5IE8 A;  1QE6 A;  3KLS A;  5I2Y A;  4L5Q A;  1HTL D;  1E1T A;  4LF4 Q;  1SYF A;  3OYY A;  3TS2 A;  2OEO A;  4JCV E;  5ELO A;  2JA5 B;  4IQZ A;  4Y52 H;  1JOO A;  4FVM A;  4OL7 A;  4AYB G;  3HKZ G;  1Y1W B;  3HKS A;  1YHQ A;  3UDX A;  4A3I G;  1YIT A;  4DV4 Q;  3HOW G;  1PYS B;  3G7L A;  4X64 Q;  3PO3 H;  4ILW A;  2F0I A;  1AE3 A;  3D4W A;  3JAM i;  1PFN A;  4A3B B;  1QUQ A;  1STN A;  1K3B C;  3HOU G;  4IUU A;  1TY2 A;  2IY5 B;  1TR5 A;  4HID A;  5C0X I;  2RA4 A;  4OO1 G;  4EQP A;  2OXP A;  2ZM6 L;  3GTO B;  1Q82 C;  1VQC A;  4K6L A;  4B3T L;  3J81 E;  2L4N A;  1WCM H;  4HIO A;  1N32 Q;  4LF8 L;  3PO2 H;  2K50 A;  2D2C C;  2MO0 A;  5JPM C;  3K7U C;  3DHQ A;  4OHJ A;  1EY6 A;  4JI5 L;  1K8O A;  2ZXO A;  2EY2 A;  5C3E H;  4Q5V A;  1QZG A;  2DY8 A;  1TS4 A;  5IGC A;  1M4V A;  4B3R L;  5CV6 A;  1TII D;  3URY A;  2B2V A;  3TSS A;  1OTC A;  2Z4H A;  1OO9 B;  4N9T A;  5ELC A;  1UUP A;  5C0X J;  4A3G H;  3T1H L;  1KXL A;  5AJ3 L;  1BCP C;  5KNB A;  4PV1 C;  4BA2 I;  4C3I B;  2KHJ A;  2NZ1 D;  2F0H A;  5D14 A;  1A2U A;  3R8B A;  3LWE A;  1B2T A;  3UDF A;  2JA8 G;  2NZH A;  3TME A;  4K0K Q;  4JI8 Q;  1EIH A;  2K5N A;  1X32 A;  3PIO A;  1STA A;  3HOX B;  5EKL A;  2AQ3 B;  3NPP A;  4H13 C;  3S1Q B;  2L1B A;  3RUZ A;  2DN8 A;  2MNA A;  3D8G A;  3HZX A;  3G71 A;  1HZA A;  2MQH A;  1YNN C;  3NBI A;  5A2Q E;  5CV8 A;  3K58 A;  1AZQ A;  1ET9 A;  2FIN B;  4RCN A;  4A3F H;  1HRJ A;  3RD4 A;  3L9A X;  3KFU A;  3RZD H;  1LTI D;  2A69 D;  1J5E L;  4A3D B;  1WYD A;  3QOJ A;  4A3L H;  3A7L A;  4IUP A;  1I6H B;  2ZM6 Q;  4DAM A;  2AUJ D;  4LUV A;  4B3T Q;  2I0Q A;  3I56 A;  1PZJ D;  2IHF A;  3QJY A;  4LF8 Q;  2ZTE A;  3H0G B;  1NTG A;  3HOV B;  2A6H C;  2A74 C;  1VQF A;  4WJ3 M;  4LF7 L;  2HT1 A;  1JR0 D;  1SNM A;  1FNV A;  1EUJ A;  1GUN A;  1ESF A;  3GO5 A;  3X3M A;  3RMH A;  1N8R C;  3JAM E;  5M5Y B;  2RCN A;  4JK1 C;  3MA2 B;  1Q81 C;  4DV5 L;  4NMZ A;  1XJV A;  5COY A;  4MTK A;  2WFW A;  3STB C;  2KEC A;  2EYP A;  3HOY G;  4J8Q A;  2KCT A;  3V96 A;  4DNI A;  1LTB D;  2CWP A;  3ZJY C;  1D2B A;  4KHP L;  2F4I A;  4LNQ A;  2EYM A;  1BF4 A;  3RLF A;  1A62 A;  2Q8R E;  1A6X A;  3K7A B;  1CT1 D;  4ODG A;  3AQQ A;  3OWE B;  1PA6 A;  3CC2 A;  1Y8O B;  1G2S A;  4JI3 L;  1GXD C;  5EKI A;  1RCV D;  4KV6 A;  3GTK B;  4RMF A;  1DOL A;  1KNA A;  1HCZ A;  2B2V C;  5IWA L;  2QF7 A;  2A6E D;  3H15 A;  5F2D A;  1S40 A;  2M9V A;  3J7Z C;  1IBM L;  1CM9 A;  2K75 A;  4BBS B;  2ZJR A;  2FMC A;  4APV A;  2AWN A;  4KD4 A;  1LT6 D;  5I2X A;  4A3M H;  3IFD A;  2AHO B;  4BY7 B;  3I4N H;  4ME3 A;  1Y1V B;  4C3H B;  3OOC A;  4H0L C;  2F4V Q;  2B63 B;  3I4O A;  5C4J H;  5C4Z A;  3CCS A;  4KK7 A;  3PQI A;  1VQL A;  2PQE A;  2VW9 A;  2KQ3 A;  1CHP D;  4NKL A;  3I70 A;  4C2M B;  5FLX L;  4ALP A;  2F0Q A;  3NK9 A;  2N49 A;  4P72 A;  4B9X A;  2CFM A;  1RKN A;  4JI7 L;  4GLV B;  4A3J B;  4LF9 L;  1LTA D;  1QNU A;  1FVI A;  2BCO A;  2XWJ B;  1PV4 A;  3ZYY X;  4P73 A;  1IBL L;  4LF7 Q;  2R92 B;  4HR7 B;  1CQV A;  1T5X D;  2QCP X;  2OT2 A;  5CMD A;  5I4D A;  2PCF B;  4K2L A;  1Y8P B;  1NE3 A;  4N8X 1;  2MO1 A;  3H09 A;  1PYB A;  4R4T A;  2K28 A;  2EYF A;  4C3J B;  2JA6 B;  2B39 A;  4NW2 A;  2C9O A;  3S2H H;  4A3C G;  1H95 A;  5CV9 A;  2JA7 H;  2E2H H;  1C8C A;  1I50 H;  3SK5 A;  4KHP Q;  2CW0 D;  1GHK A;  3CPF A;  1HH2 P;  3CF5 A;  1R9T B;  4FF2 A;  3A0J A;  4UP7 A;  2QW7 A;  4KJO A;  3NE5 B;  1B4O A;  4ZKC B;  4TRD A;  4JI3 Q;  5D3D A;  4X66 L;  3OTO L;  3HEJ A;  3RZO H;  1HQM C;  2FXQ A;  3GTP B;  3BZK A;  3G4S A;  3UE1 A;  5LMN L;  2ZXR A;  4DV7 Q;  1B3A A;  1PTO D;  4KI0 A;  1IL8 A;  2XNA C;  4KJN A;  4LJZ C;  4A93 H;  2A69 C;  1IBM Q;  1HPC A;  3HKZ B;  1U4R A;  4LFB L;  3NWS A;  2EY5 A;  1TWF H;  1PZI D;  3J81 L;  3HOW B;  2R93 G;  1I4H A;  1YNJ D;  5ISR A;  3NTH A;  2FMM A;  2Z1C A;  1HJP A;  1FYC A;  1PH4 A;  1EWC A;  4HJA A;  5C4X G;  4YCU A;  4ZYS A;  3HOU B;  4L63 B;  1SMY C;  4DN4 M;  5E1F A;  1O7Z A;  4X3S A;  1PH2 A;  3F8T A;  2C35 B;  3UE0 A;  2NVY B;  4FF1 A;  4I7Z C;  3F2C A;  2EXD A;  1T5E A;  4YWK A;  3QG1 A;  1JT8 A;  3H91 A;  1P16 A;  4GNX B;  4X3U A;  1IW7 C;  1SE2 A;  4FXG C;  5JAV A;  1AFP A;  5M5X H;  3I90 A;  1O7Y A;  2F0L A;  4LF9 Q;  2B2U A;  1VMP A;  5EAY A;  4X6A H;  4KKU A;  1CA6 A;  3BZD B;  2F0J A;  4O1N A;  4OON A;  4HCE A;  5IGE A;  3SGI A;  2ZXP A;  3LX0 A;  2VUM B;  1OXT A;  3V05 A;  5LMN W;  2EJM A;  2MFI A;  3BU2 A;  5GQO A;  5IY0 A;  3RR5 A;  2LSS A;  5LHY 1;  2RHS B;  3I3C A;  1QJO A;  3LGJ A;  1VQ9 A;  4DV0 Q;  2JXM B;  3T16 A;  2YU9 H;  4GS3 A;  3ERS X;  1HHV A;  2V4D A;  3MXN B;  3S2D H;  2WKC A;  2XRQ D;  4BBR B;  3DM3 A;  1VQP A;  4QUF A;  4CDD C;  1SFO H;  5A2Q L;  2R7Z H;  4Z9C B;  4HMI A;  1KAA A;  2EE1 A;  1Z6H A;  1M90 C;  5LMN Q;  2EZV A;  2JEB I;  1II3 A;  3NTI A;  1Y69 U;  3S1R H;  1MKH A;  2L9H A;  4GZY C;  3KLW A;  2K33 A;  3J7Y W;  2XTI A;  3H3V H;  2Y0S E;  4LFB Q;  4R8I A;  3K80 C;  3CCU A;  1LTR D;  3KBX A;  3KF6 B;  3GP7 A;  4IUV A;  1MHW C;  1K28 A;  4HSV A;  3AMU A;  2F52 A;  1K8G A;  3A74 A;  3G48 A;  3GTG H;  2UUC L;  1EWH A;  3MAQ A;  1PZK D;  1X6O A;  3EBE A;  2K04 A;  3ERO A;  3ONA B;  2KA7 A;  2WB1 E;  1IXR A;  1K83 H;  1I4R A;  2I5M X;  2NVX H;  3OPO A;  4X65 L;  2B8G A;  2DGY A;  1SE3 A;  2SDF A;  4NDX A;  2Z0S A;  3FKI G;  2QKI C;  1PDQ A;  1J6Q A;  2NN6 G;  3CQZ B;  2BA0 A;  4RGM A;  4DFA A;  3MEH A;  3BVG A;  1Q12 A;  3CME A;  5DM7 3;  4JBW A;  1PTO B;  1C7Y A;  2EY1 A;  1I94 L;  1X3P A;  2PW7 A;  3GTO H;  1UEB A;  1HNZ Q;  4LF6 L;  3HOY B;  1Q8K A;  1VCI A;  2XGT A;  3A54 A;  3NQT A;  3SEB A;  4O42 A;  4AIM A;  1LO5 D;  2XSC A;  3H3V I;  4OWT B;  1Q1E A;  3J80 i;  1CKM A;  2B2T A;  4RCO A;  1QZH A;  4HAE A;  5M5W B;  2NVT H;  1VQE A;  4NXM Q;  3S1N B;  2XN9 C;  2EQS A;  4DNT B;  2Q2U A;  3VR4 A;  3M4O H;  1PRT F;  1QVG A;  1PTO C;  2B3G A;  2ICI A;  5HGQ A;  3K81 C;  3S1M B;  3FDT A;  4HJ7 A;  3VA7 A;  1ZKO A;  4QMG A;  5CYU A;  2WAQ E;  3NUC A;  1YIJ A;  4LF5 L;  5G3L F;  2YTX A;  4RKB A;  1NJI C;  2E2J H;  3W5O A;  3TDQ A;  1G6P A;  1R4Q B;  3QR8 A;  2FJ2 A;  1D1I A;  1EYC A;  3C1F A;  4B9W A;  4JBK A;  4LFA L;  4GKJ Q;  4DAY B;  1H9S A;  3ERQ A;  4TQU S;  1F9S A;  1RD9 D;  4C3I H;  2KHI A;  4KD3 A;  4DR5 Q;  1BCP D;  2PMZ E;  3AYH B;  5E3F A;  1QVC A;  1PFM A;  1LUZ A;  1VQN A;  5D65 A;  1A63 A;  5HGT A;  4B08 A;  3C46 A;  1DD2 A;  1SNO A;  5JEA J;  1LAC A;  2D9U A;  4DR6 L;  2UUC Q;  1MSG A;  2EVB A;  5ELE A;  4DUZ L;  2QEJ C;  5M3F H;  3S16 H;  3TP8 A;  1TWC B;  1G29 1;  2EIF A;  1Q1B A;  1KLG D;  2WB1 G;  3LNN A;  1V43 A;  1SEB D;  5C4H A;  2E2I H;  1SYC A;  2NVQ H;  1QVF A;  1YNN D;  3X3N A;  4A76 A;  2JEA I;  2O5I C;  1AEX A;  1IYV A;  1JCK B;  4DV1 L;  3PO3 G;  4K8I A;  1I6H H;  1NY4 A;  1X55 A;  1JJG A;  1X56 A;  5EPL A;  3T53 B;  1IKM A;  4L6T B;  1F2L A;  4UPA A;  1KAW A;  2MP1 A;  4KHZ A;  2MJ8 A;  4A3E B;  1N33 L;  1SNQ A;  4QCL A;  1GVP A;  4G7H C;  3CD6 A;  1GO3 E;  1WCM G;  1BDO A;  1V1P A;  2PQA A;  4DV3 Q;  1CKN B;  1O7I A;  4M8A A;  3PO2 G;  2YTY A;  4IUQ A;  1I6V C;  1F2Y A;  2NWG A;  3NBH B;  2A6H D;  1UE6 A;  1EYG A;  2VL6 A;  1JJC B;  4YHH Q;  5C3E G;  5C0X H;  4YWL A;  3L2P A;  4DR2 L;  4QL5 A;  2F0E A;  4UDU C;  3QOL A;  5DNF A;  2DNE A;  4FP5 D;  3STB D;  3S17 H;  4BXX H;  2L5T A;  1C4Q A;  1TVX A;  3FP9 A;  3K7A H;  3TZU A;  1W2B A;  1CUK A;  4CKB A;  2K7V A;  3H6M A;  3PF5 A;  4R4I A;  1G51 A;  1H9S B;  4A3G G;  1TQO A;  2VNU D;  5J1Z A;  5JPN C;  4KLK A;  1STB A;  2F0S A;  2BOS A;  2R93 B;  1MIU A;  5C4X B;  2NTS A;  4G4K A;  2H5X A;  4CKE A;  1XMQ Q;  1XMO L;  1CQF A;  3FVQ A;  2R7D A;  3VA5 A;  5FO9 B;  1S5D D;  2ATW A;  2IT1 A;  3KOJ A;  4G7O C;  2LKV A;  3BZC A;  4S3S A;  1WD0 A;  2K6A A;  2LFN A;  4KN4 C;  1VQ8 A;  1LLR D;  1FD7 D;  4DR4 L;  1YBY A;  4HJ8 A;  4BY7 H;  4Q0F A;  1I3Q H;  3M4P A;  1KNE A;  1BQQ T;  1WTW A;  1G8Z D;  4C3H H;  4MTN A;  1IYU A;  2SEB D;  3BJU A;  3ITP A;  3KJP A;  1B53 A;  4A3F G;  2UXD L;  4X62 L;  5IP7 H;  1BXT A;  4I7A A;  4DV1 Q;  2IWH A;  1GM5 A;  1L1O A;  2AUK A;  4DPG A;  1JJ2 A;  1Q90 A;  1PH8 A;  4L8J A;  4A3L G;  3J81 c;  4DK6 C;  1H9J A;  3P7J A;  1BCP B;  2KED A;  1PMR A;  2B29 A;  2VQF L;  5K36 H;  1WTR A;  1OXX K;  5LL6 S;  4QJF A;  4DAP A;  5JJI A;  3I91 A;  2R92 H;  3PUZ A;  4UY8 C;  3MXU A;  1B7Y B;  1YNX A;  3IAY A;  1Z47 A;  3SK4 A;  4ME5 A;  3GTL H;  3ULJ A;  4MZ9 A;  4DR2 Q;  5IT9 E;  3MTS A;  5H1S E;  5IOD A;  1SN8 A;  1NNX A;  2BDN A;  5ELF A;  2N78 A;  5IYB H;  1DOK A;  5FJ8 H;  1K8A C;  2JYO A;  2OWO A;  4JI2 L;  3CC4 A;  1TWG H;  4B3S L;  4FF4 A;  2HIV A;  3N52 A;  2HDL A;  3MEF A;  3DMU A;  5EPK A;  4DXF A;  5LL6 X;  1PRT B;  3M7N A;  2O2L D;  2N55 A;  2PZW A;  2UXC L;  1AN8 A;  5GAD C;  1SLJ A;  5DLQ E;  1RJT A;  1C48 A;  4FXD A;  2R6G A;  2MHV A;  3IL8 A;  1O7L A;  1EFW A;  5I9O A;  3VYU A;  3M4Q A;  4DR4 Q;  2A8V A;  1VQ6 A;  4V19 0;  1FNW A;  3TP6 A;  1U9R A;  2EJG C;  1GHJ A;  1QUQ B;  3OMC A;  2RF4 A;  1CKO A;  3QO2 A;  4A3M G;  1PRT C;  4DF7 A;  3I4N G;  2KCN A;  5C44 B;  1Z9F A;  3VR5 A;  4RGO S;  4X62 Q;  1SMY D;  1VMC A;  5DEH A;  1JIC A;  3RNU A;  2PZT A;  4JV5 L;  2OTL A;  1L1O B;  1VQG A;  4FNF A;  1MJC A;  1C0A A;  4JI5 Q;  4H02 A;  2VQF Q;  2D0O A;  4B3M L;  2NYZ D;  4IOA A;  4H7B A;  3K6O A;  3NWT A;  2LXK A;  2E74 C;  2Q2H A;  1HUM A;  4LWC A;  3R2I A;  1IW7 D;  2XWB B;  3F2D A;  1G2T A;  1YJW A;  4B3R Q;  4IUT A;  3OW2 A;  4ZUI A;  2OQK A;  1H9M A;  1M8A A;  4OGQ C;  2VUM H;  4GLA C;  1N36 L;  1LM0 A;  1X65 A;  1HA6 A;  2N3S A;  1KAB A;  3J7A F;  2A1A A;  2CH4 A;  1L1O C;  3TS0 A;  3DWQ A;  3T1H Q;  1PH1 A;  5AJ3 Q;  1U4M A;  3BVZ A;  3OIQ A;  2Z6K A;  3A55 A;  2K5D A;  1KDB A;  3DM1 A;  1TWA H;  4AQY L;  2D62 A;  5FOB B;  2A5H A;  2JA7 G;  2K14 A;  2K5V A;  4OO1 I;  2CWA A;  4UHV A;  4Y7N H;  3WOE A;  4IPH A;  4BBR H;  3SDZ A;  3I4L A;  3GDE A;  3QWN A;  1HZB A;  4JI1 L;  1TU2 B;  5EKK A;  3HP3 A;  1D8L A;  1D6E C;  3M3Y H;  2KEE A;  4JI4 L;  1EU4 A;  2VB2 X;  1LT5 D;  1KRT A;  1SRO A;  2UXC Q;  1RDP D;  1NR4 A;  3U50 C;  4KHV A;  1SYG A;  5KNC A;  2F0K A;  4F87 A;  3RLN A;  1HA5 A;  4MN3 A;  5ELB A;  2I5L X;  1SBB B;  1DZ1 A;  4CDC C;  3HOZ B;  4A93 G;  1OXV A;  5FLM H;  1J5E Q;  4QIW B;  4N8F A;  5CR3 A;  1XPO A;  3D6C A;  3P75 A;  2WP8 J;  3VYT A;  3OWF A;  2K4K A;  1X3F A;  1HXY D;  2IPK D;  2HCC A;  4DA2 A;  4A3K B;  1XYI A;  3HG9 A;  1D5X C;  3CCR A;  2C5C A;  5BN5 A;  1NAP A;  1VQJ A;  1MGS A;  1HNW L;  3B6Y A;  3W1G A;  2KOL A;  1JOK A;  4OIJ A;  1WFQ A;  1WCM B;  4B3M Q;  1UWV A;  3PO2 B;  1V8Q A;  5JJZ A;  5JVG 3;  4DV6 L;  5FO8 B;  2EXZ A;  4JOI A;  4BS9 A;  1SYD A;  2PZU A;  4DV5 Q;  1ONL A;  2GA4 B;  1MI2 A;  3KF8 A;  1HR0 L;  1ZYR C;  5C3E B;  1SJH D;  2KVM A;  5M3M H;  1PH6 A;  3VYR A;  4EQO A;  1TKW B;  2RCF A;  2R3Z A;  3BDL A;  4MHE A;  1UE7 A;  4QQB X;  5L37 A;  4RH6 A;  2YV5 A;  1ASY A;  1XNR L;  5FO7 B;  1F9P A;  4LUO A;  2PPB C;  2F0M A;  3E9I A;  1ZEQ X;  2L11 A;  1ASZ A;  2VXW A;  3RN5 A;  1YVC A;  1NSN S;  4POF A;  4A3G B;  2HUG A;  3NTK A;  2XRS D;  4GN4 B;  1HNX L;  2J7Z A;  5IGD A;  2E75 C;  4YY3 L;  2RDG A;  4DNR B;  4JI0 L;  3E3X A;  3S15 B;  2XVS A;  5IWA Q;  4XT3 B;  2F3W A;  1B50 A;  4EX5 A;  3S14 B;  2F0O A;  4X3T A;  1HQR D;  4JI1 Q;  4AYB B;  3PIP 3;  1Z7T A;  1ENC A;  3RN2 A;  1RTO A;  2R7Z G;  3ICE A;  5IOC A;  1VQ7 A;  2IX1 A;  4A3I B;  2Z6K C;  2Q8I B;  4LK1 C;  4J1M A;  2ALY B;  2O5J C;  2JK8 A;  3K5L A;  1EOV A;  3T13 A;  4IPD A;  1YJN A;  3I4M H;  4YWM A;  1HR0 W;  2M2L A;  4MIU A;  1O80 A;  2J0T D;  4A3F B;  3DWA A;  4PMW A;  2R61 A;  4R9W A;  2RDH A;  3RZD B;  3AEV A;  1TWC H;  1GUT A;  4PZ7 A;  4JI7 Q;  1ZXT A;  3OMG A;  1JC7 A;  3EFX D;  5AFW A;  1HTP A;  4JG2 A;  3IFT A;  5IGF A;  1LV9 A;  1HNW Q;  4JC0 A;  1H9K A;  2JN4 A;  5ELN A;  5IT9 L;  4X3K A;  5IYC H;  1F9R A;  1IBL Q;  2CCZ A;  4BY1 H;  1E0B A;  3L3O C;  4DGZ A;  3CAM A;  1STG A;  4BWG B;  2LY7 A;  4P74 A;  3CCJ A;  1VQD A;  3KF8 B;  5E7N A;  1HR0 Q;  1W6J A;  1NMF A;  3WOF A;  1G91 A;  1VF7 A;  3QIA A;  5T1G A;  2Z8L A;  3GTJ H;  1RHP A;  2B2Y A;  4A3E H;  4DV2 L;  4DR1 L;  1PFB A;  1KL9 A;  3CRK C;  2QA4 A;  4GOP A;  2QEX A;  3K8A A;  1JOQ A;  2X6G A;  3CW2 C;  4KY7 A;  4K5W A;  2JA8 B;  1E22 A;  5GRO A;  3FRP B;  2XIW A;  1S5F D;  2VB3 X;  4RA8 A;  2B2W A;  4HJ5 A;  4X66 Q;  3OTO Q;  1YI2 A;  1HNX Q;  1YZ6 A;  1EQQ A;  4KY6 A;  3NXW A;  4IFD H;  1TS3 A;  2WII B;  5EPJ A;  2F0F A;  1PH3 A;  3G6J B;  3D6W A; 
#chains in the Genus database with same CATH homology
 3J81 j;  2F0N A;  1EY0 A;  3J7A V;  4DUY L;  1UNS A;  1B1Z A;  1SXT A;  3A8J E;  3GTM H;  5IP9 H;  3TZD A;  1DJR D;  2VY3 A;  4HCS A;  5JEA H;  1I4Q A;  4KTA A;  1DCZ A;  3S9W A;  4JI6 L;  1STE A;  2UUA L;  4XYQ A;  1I5F A;  2JA5 H;  4QUC A;  1L2F A;  2K03 A;  4A3M B;  5T1I A;  4RG1 A;  4OWW B;  4IPG A;  3NHH A;  1HFG A;  2KEN A;  4IUR A;  4NP5 A;  3I4N B;  2K05 A;  1Y1W H;  1RF2 D;  3JAM L;  2AWO A;  2RHQ B;  2BA1 A;  1K3R A;  3A5Z B;  4XDX A;  1D5M C;  1PH9 A;  2O4X A;  4ID6 A;  1TWH B;  3SXH A;  1A3U A;  5KYI A;  4A3B H;  2EJF C;  5M3F G;  3DWP A;  2KCM A;  4HIM A;  1FL0 A;  2HHH L;  4IFD I;  1KIX A;  1WTO A;  5GAG C;  4JYA L;  1WI5 A;  1WTV A;  4O2D A;  1WD1 A;  1EWI A;  1A3T A;  2E76 C;  2FFK B;  4PNY A;  2F0G A;  1KQS A;  1FR3 A;  2WAC A;  1BKB A;  1NMG A;  1SR3 A;  3U58 A;  1E2Z A;  3OSO A;  1IL2 A;  2B2U C;  4WFN 3;  1EYD A;  1GUO A;  3A5U A;  1E2V A;  4DR1 Q;  1EY8 A;  3LWU A;  3S2H B;  2PYK A;  2RBM A;  2X6L A;  2JA7 B;  2E2H B;  1LTT D;  5JOB A;  4DAV A;  3TP7 A;  3MXG A;  3K59 A;  1XPU A;  1Q46 A;  3U9S A;  1V9P A;  1T9H A;  4CKC A;  4EQN A;  4IFD J;  5CBE E;  3A8K E;  4ZRZ A;  1XXG A;  3I73 A;  2QGQ A;  5C0X G;  3M4Y A;  2NZO A;  1MBY A;  2GVA A;  4H44 C;  1LYL A;  3VR6 A;  3RZO B;  4OIK A;  3GV6 A;  1D1K A;  4GOP C;  1AP0 A;  3KDF A;  4DUY Q;  4XQQ A;  2ES2 A;  2BE5 C;  4BXX G;  2UUB L;  2Y0S G;  2IX0 A;  3HOX H;  1QNK A;  1DOM A;  2RVL A;  3T4A C;  4A93 B;  4YCV A;  4PZ8 A;  1EOT A;  1VQ4 A;  4JI6 Q;  3PCO B;  2B2W C;  3S1Q H;  4EQ5 A;  4L5R C;  1EQV A;  1TWF B;  1GUG A;  4TSS A;  3I7F A;  1RL2 A;  4I65 A;  3MFG A;  4IOC A;  1YEZ A;  2M00 A;  1EY7 A;  1A15 A;  4LF4 L;  2PNR C;  2IHE A;  4GLX A;  4CBV A;  4X65 Q;  1I4G A;  1A8V A;  2EY6 A;  3VYS A;  3BYT B;  3J81 i;  3HKZ E;  1LTG D;  3PSI A;  1BVS A;  1JMC A;  3TN2 A;  5KRU A;  1VQK A;  1EEF D;  4PQX A;  1DXM A;  1LT3 D;  4LFC L;  4A3D H;  5TSS A;  5ELD A;  1ROD A;  3K57 A;  2A19 A;  4DV4 L;  3MXP A;  3I2Z A;  4X64 L;  1E2W A;  2E8G A;  1DYQ A;  4BY7 G;  1I94 Q;  2GVB A;  1XX8 A;  2BDO A;  4J6H A;  4PMC A;  1F9Q A;  4DK0 A;  4C3H G;  5C44 H;  1Y14 B;  1GKH A;  4LF6 Q;  1RIP A;  5HUR A;  2Q2T A;  2KBN A;  3HOV H;  3H0G H;  1BUV T;  1PRT D;  1NBW A;  2F1M A;  3H94 A;  3CPW A;  3FMC A;  1EIF A;  5IP7 G;  5KND A;  2HQE A;  1E7Z A;  1N32 L;  4JBJ A;  1SE8 A;  5LMU L;  1SJE D;  1VQ5 A;  5M5Y H;  3T51 B;  2LMC B;  4RGN A;  3NEL A;  2IX3 A;  5K36 G;  1VF5 C;  2WKD A;  1GOZ A;  1IHZ A;  5FLX E;  2YU9 B;  2SNS A;  4LF5 Q;  2R92 G;  5IYD H;  3E5S A;  4QB4 A;  1EEI D;  1S72 A;  2WAQ G;  4IAL A;  5K5P A;  1IBK L;  2B2T C;  4LFA Q;  4EGV A;  4F8M A;  1KDC A;  4OWX B;  3J80 E;  3Q24 A;  1SFO B;  2R7Z B;  1JB7 A;  2K32 A;  1N34 L;  1L0Y B;  4ZQ3 A;  1ENA A;  1EL0 A;  2RSO A;  4U68 A;  3GTK H;  1S5B D;  4CJ2 C;  2F0W A;  4FXK C;  5J22 A;  3FEW X;  1VQO A;  3OIP A;  2UUB Q;  3WDN A;  3CC7 A;  1JWM D;  4OX9 L;  2G9H D;  1SYB A;  4DU9 A;  4DR6 Q;  5IYB G;  5FJ8 G;  1B44 D;  3CMA A;  3A8I E;  4BBS H;  4K0K L;  4DUZ Q;  1LTS D;  1VQA A;  4IZ8 A;  2DY7 A;  2B8F A;  2F0T A;  4LMQ D;  4XTC S;  3KYH C;  4CHT B;  2ZJQ A;  2D5D A;  3GTG B;  1F2Z A;  1E1O A;  1WTX A;  1Y1V H;  5CV4 A;  4N9P A;  5C3W A;  2B63 H;  1KDA A;  1QOH A;  2NB0 A;  2NTT A;  4HN7 A;  4RFB A;  2DUD A;  1S5C D;  3HOZ H;  5IIF A;  1K83 B;  2L12 A;  2NVX B;  4LFC Q;  1SAP A;  2BH2 A;  1NCV A;  4C2M H;  1VQH A;  1WOC A;  2UU9 L;  3H3V C;  2JQO A;  2NBF A;  1X9N A;  4FF3 A;  1U5K A;  2SOB A;  4E6I A;  2V1C C;  3O13 A;  1UEA B;  4A3J H;  1FJG L;  4A3K H;  1HUN A;  1YHA A;  3CCL A;  4L5T A;  1N33 Q;  4RWS C;  2OQ0 A;  2VS1 A;  4U67 3;  3K5M A;  3SHL A;  2AMC B;  1V1P B;  2PQA B;  4GKK L;  2JA9 A;  3SR1 A;  5LMU Q;  1FGU A;  1VS0 A;  2Q2I A;  3PUV A;  3C1E A;  1K73 C;  4KN7 C;  4IJH A;  2A68 C;  1VDZ A;  3IRB A;  4C3J H;  4LUZ A;  2JA6 H;  1GJX A;  2NVT B;  2H1E A;  5DM6 3;  2F3I A;  4K8J A;  3E9H A;  1Y8N B;  1SSO A;  2QIL A;  1QG7 A;  4ULL A;  3M4O B;  1LAB A;  3AFQ A;  1ZYR D;  5IT9 c;  2VUM G;  3GD7 A;  4BA1 I;  1X3G A;  2CQA A;  1BOS A;  1I4X A;  1E3P A;  1R9T H;  1L0X B;  1JE5 A;  1EZ8 A;  1HZ9 A;  1IBK Q;  3BS1 A;  5CC4 A;  3N6R A;  4C1N K;  2IL8 A;  1N34 Q;  2E2J B;  3PGZ A;  5C5L A;  3GTP H;  5C6A A;  2EYH A;  1XWE A;  3S15 H;  3NEN A;  1XMO Q;  1TS2 A;  4K6D A;  3M7G A;  2WIN B;  1SNP A;  2E5L L;  4OX9 Q;  3S14 H;  3CRL C;  2ICE C;  3R2T A;  4HMJ A;  4BBR G;  4DK1 A;  2SNM A;  1AZP A;  4A3I H;  3HOW H;  3FKI B;  3A7A B;  2VZA A;  1EY4 A;  3GV3 A;  1FGB D;  4A4I A;  1PHJ A;  3PV0 A;  4WRD A;  3HOU H;  3EJI A;  2JSO A;  1W3S A;  2OTJ A;  5M3F B;  2G9D A;  3S16 B;  3TP5 A;  4OO1 H;  2UXB L;  5EQ0 A;  5BN3 A;  1F77 A;  2NVY H;  2UXD Q;  5C3X A;  2F4V L;  2E2I B;  3D0F A;  2UU9 Q;  5J39 A;  2NVQ B;  5FLM G;  5I6Y A;  3HS0 C;  3I8Z A;  3FPP A;  2KJX A;  2LXJ A;  2AQ1 B;  4RGT A;  3KK7 A;  4LAA A;  1FJG Q;  1Q86 C;  1QCB D;  1PH7 A;  3UDG A;  4AH6 A;  2IJ0 A;  2DNC A;  1CZG A;  1QWY A;  1C9O A;  4GKK Q;  1STH A;  3JAM c;  5IGG A;  3G6E A;  4K14 A;  5KEE A;  5JJK A;  3PIP A;  1O78 A;  1EYA A;  2PI2 E;  4IO9 A;  3M85 A;  4XXE A;  1UE5 A;  2F03 A;  2KHS A;  3T56 B;  2I5H A;  3DEO A;  5NUC A;  3DXJ C;  2MPM A;  1XTD A;  5M3M G;  2JP1 A;  1PYW D;  4XQN A;  1K0R A;  1WJJ A;  1B70 B;  2A73 B;  4P71 A;  3GTQ B;  2JJQ A;  2JA8 H;  3AB9 A;  4JI2 Q;  3ER0 A;  3CCV A;  3S24 A;  4P75 A;  4B3S Q;  4GN3 B;  3S17 B;  2Y0S B;  4NXN L;  3F2B A;  5GAE C;  1YHB A;  3KLR A;  1GD7 A;  1V1O A;  4ABN A;  2MGS A;  4R8N A;  4EVO A;  4WJ4 A;  1SYE A;  3MVV A;  1BO0 A;  4K5V A;  2E5L Q;  3E0E A;  3ULL A;  3W1B A;  2CHB D;  5E4W C;  4PZ6 A;  3JC6 6;  4F7X A;  4UP8 A;  2F0U A;  3DUZ A;  5EGT A;  3CXC A;  2PW5 A;  4DV7 L;  2WB1 B;  2ZT9 C;  1AH9 A;  4LW1 A;  1SND A;  4WOR A;  1MD2 D;  3VR3 A;  3E6Z X;  1XTC D;  5D3I B;  3CCQ A;  1CHQ D;  3U4V A;  3PO3 B;  5BR8 L;  3PUY A;  2UXB Q;  1PTO F;  1ML0 D;  1I3Q B;  2YYZ A;  3KUP A;  3I4M G;  1SDF A;  4JV5 Q;  2AQ2 B;  4UAI A;  1CTM A;  1TWH H;  5M9O A;  2CVR A;  3L7Z C;  3RLO A;  3PIO 3;  1WVL A;  1PLF A;  2L15 A;  2F0P A;  1EY5 A;  1XNQ L;  3CP0 A;  3CQZ H;  1EZ6 A;  3R3O A;  3EVQ A;  4GNX A;  4HSP A;  1X54 A;  2OCE A;  1AW7 A;  1PTO H;  1JE4 A;  2K01 A;  3J80 L;  3HOY H;  3TRE A;  4C56 C;  2J4X A;  2ZTC A;  1N36 Q;  2K52 A;  3D4D A;  5IYC G;  4HED A;  3HRZ C;  2K5W A;  3MFY A;  1BNZ A;  3MZ5 A;  2CQO A;  5HY6 A;  1VQB A;  4BY1 G;  2IW3 A;  1XPR A;  5J3B A;  3K0X A;  3BYY B;  2WAQ B;  5M5W H;  1SRU A;  3S1N H;  2YTV A;  5I6W A;  4R4O A;  3W2D A;  4AQY Q;  4CJ1 B;  3GTL B;  3PMF A;  2ID0 A;  1JQY D;  3BVM A;  4FDB A;  1RTN A;  3OW7 A;  4A3E G;  1AE2 A;  3L0O A;  3S1M H;  4IPC A;  5CV5 A;  4PG3 A;  4DV0 L;  1UAP A;  3F2U A;  2PMZ B;  3MXN A;  1IKL A;  4NXN Q;  4KKS A;  1S5E D;  2GN5 A;  4JI4 Q;  3EQL C;  1OXU A;  2EYJ A;  4RAU C;  2ASB A;  1TWG B;  3NP8 A;  3K5N A;  4KKT A;  4IFD G;  1LT4 D;  1EQR A;  4NB3 A;  1U0L A;  1EQT A;  1EIY B;  1D5Z C;  2PNH A;  5FKA C;  1LTL A;  3AU7 A;  1ESR A;  3K0Y A;  3CU7 A;  4ZUJ A;  2K5Q A;  3KF6 A;  2BE5 D;  5IP9 G;  3KJO A;  3GQB A;  1BBX C;  4ZK9 B;  5JEA G;  5BR8 Q;  4G57 A;  1I4P A;  1K8M A;  3BG3 A;  1ET6 A;  2JA5 G;  3EN2 A;  3Q6S A;  2JE6 I;  1SE4 A;  4QF4 A;  1TT2 A;  1UE1 A;  3HFZ B;  4CJ0 B;  1Y1W G;  1F2M A;  1U4L A;  1B8A A;  1XNQ Q;  1KHI A;  1SNC A;  4ZKB B;  5EBC A;  4DV6 Q;  4PMB A;  1PFS A;  3HGB A;  3MWY W;  2N8N A;  1EFI D;  4A3B G;  1JB3 A;  2RDF A;  3VDY A;  1HFN A;  1FNU A;  2X69 A;  4A3C H;  2EOT A;  1QB5 D;  4FYD A;  1IYJ B;  1WTP A;  1HNZ L;  1XNR Q;  2H4O A;  3SE0 A;  3UDI A;  2HCI A;  1B9M A;  3M9B A;  4JOI C;  4GNX C;  3DEP A;  4TVA B;  4NXM L;  3D3R A;  4YY3 Q;  4JI0 Q;  1TWA B;  2A6E C;  1GUW A;  4L5S A;  4K2K A;  3ULP A;  1W6K A;  2Z4I A;  1ENF A;  2FHT A;  4Y7N B;  3PUW A;  2MUY A;  1K9M C;  3PUX A;  2ENB A;  1S4Z A;  4ZLT F;  1SMX A;  2PO4 A;  1KTK A;  4ZAI A;  1PXU A;  2R93 H;  1HZC A;  3BDC A;  4KMU C;  3M3Y B;  4IN3 A;  1B9N A;  5A35 A;  2F0D A;  3DLL A;  2K5H A;  5C4X H;  4GKJ L;  4DR7 L;  1A3V A;  1N9W A;  1P8L A;  4O0A A;  1Q8I A;  2D0P A;  4C3I G;  4DAY A;  4C1N I;  1MSH A;  2EDG A;  3NEM A;  2HQL A;  2QDB A;  4R1J A;  4DR5 L;  5KGU A;  1J8I A;  4XIG S;  3CKI B;  5CBA E;  1DON A;  5C4J B;  2VQE L;  3HOX G;  1EY9 A;  5I9P A;  1CFM A;  4DR3 L;  4YCW A;  2Q8T A;  4HJ9 A;  1KD1 C;  3TBI B;  3NSW A;  3D31 A;  1YJ9 A;  2RSN A;  4IUN A;  3OHX C;  3P20 A;  1U4P A;  3I55 A;  1BCP F;  1OXS C;  4RHR A;  1ILQ A;  1X3Q A;  3E0J A;  2BH8 A;  1CI3 M;  3EA6 A;  3J7A 5;  4G7Z C;  1NUC A;  5JJL A;  4XQJ A;  5GAH C;  3V2T A;  2EPB A;  1ICW A;  1CZW A;  4A3D G;  4QIW E;  4GN5 A;  4F88 A;  1V1Q A;  5JVH 3;  3W3A A;  5CGK A;  1JOR A;  3SK6 A;  2EYO A;  4JBM A;  1PVO A;  2PI2 A;  5C44 G;  4DV2 Q;  2HIX A;  2CW0 C;  1PH5 A;  3VR2 A;  1BBW A;  1KC8 C;  1NR2 A;  4GOP B;  3C3L A;  1D7Q A;  2TMP A;  3BDO A;  5M3M B;  2EYL A;  3HOV G;  3H0G G;  1QIL A;  4POG A;  1I50 B;  1GUS A;  1CA5 A;  4J15 A;  2F0V A;  2F3V A;  5KIX A;  3Q0A A;  3SVM A;  3TEH B;  1BR9 A;  1ILP A;  2ZTD A;  3CCE A;  5FK9 C;  1JWS D;  4DXG A;  3FHW A;  5IGB A;  4DV3 L;  1CKN A;  4QY7 A;  3NBH A;  4RKL A;  4IJL A;  1Q3L A;  4FO2 A;  2A68 D;  1H9R A;  4YHH L;  4DKA C;  1G6Z A;  4CGY B;  2R7F A;  2B2Y C;  4YIJ A;  1TY0 A;  2CKZ B;  2KUM A;  3C2P A;  3PF4 A;  1EU3 A;  1IZ6 A;  5IYD G;  1TS5 A;  3CCM A;  3IKJ A;  3ND9 A;  3SK8 A;  4TKO B;  5KYL A;  4QGU A;  3R93 A;  4DK3 C;  2K1B A;  1YNJ C;  3KBG A;  3T1Y L;  1VQM A;  1KLU D;  2UUA Q;  4DR7 Q;  2NUC A;  5EBD A;  3Q22 A;  1JWU D;  3UI2 A;  3KLS X;  4P2C B;  5E4X A;  2RKS A;  4AYB E;  1XMQ L;  2VQE Q;  4UP9 A;  4HTH A;  4XYO A;  3WWV A;  4DR3 Q;  3U4Z A;  3I4M B;  4WJW A;  3QB3 A;  1DGS A;  3FKI H;  5COR A;  2L55 A;  4BBS G;  3TRZ A;  1X3E A;  4K5X A;  1TXY A;  2NN6 H;  3Q23 A;  3D4R A;  1CSQ A;  3P1H A;  1S3O A;  2LS0 1;  1A0I A;  2I07 B;  2WV6 D;  1VQI A;  2HHH Q;  1Y1V G;  1MJE A;  3F1Z A;  5M5X B;  4R4Q A;  5BN4 A;  2B63 G;  4JYA Q;  4V0B A;  3I72 A;  3HOZ G;  3FPU B;  4M1U B;  1A2T A;  1BBU A;  4BY1 B;  1STY A;  3MC0 B;  3NQI A;  1CK1 A;  4R4C A;  5G3L D;  4NPS A;  2E2D C;  4A3J G;  4A3K G;  1M1K C;  2I46 A;  2OF1 A;  4A75 A;  2TSS A;  4XT1 B;  3ND8 A;  2HDM A;  2ZJP A;  5C5M A;  3GTJ B;  2KCC A;  2L0C A;  1Q7Y C;  1J9O A;  3S2D B;  4HIK A;  3Q8D A;  1KRS A;  4MNO A;  1WTQ A;  5FLX c;  5CV7 A;  3AFP A;  3EIV A;  2N88 A;  2AKW B;  3TQY A;  2JA6 G;  4C3J G;  3U9O A;  3K5O A;  2NN6 I;  4KY5 A;  1EIG A;  4OXP A;  3J80 c;  3KDF B;  3GTQ H;  1L0W A;  1E24 A;  1R4P B;  4RHS A;  3S1R B;  1CSP A;  3A56 A;  5EJW A;  1DM0 B;  3T1Y Q;  3CHB D;  5DAU A;  4JI8 L;  2RQX A;  3MHB A;  3GTM B;  5IE8 A;  1QE6 A;  3KLS A;  5I2Y A;  4L5Q A;  1HTL D;  1E1T A;  4LF4 Q;  3OYY A;  3TS2 A;  1SYF A;  2OEO A;  4JCV E;  5ELO A;  2JA5 B;  4IQZ A;  4Y52 H;  1JOO A;  4FVM A;  4OL7 A;  4AYB G;  3HKZ G;  1Y1W B;  3HKS A;  1YHQ A;  3UDX A;  4A3I G;  1YIT A;  4DV4 Q;  3HOW G;  1PYS B;  4X64 Q;  3G7L A;  3PO3 H;  4ILW A;  2F0I A;  1AE3 A;  3JAM i;  3D4W A;  1PFN A;  4A3B B;  1QUQ A;  1STN A;  3HOU G;  2IY5 B;  1TY2 A;  4IUU A;  1TR5 A;  4HID A;  5C0X I;  4OO1 G;  2RA4 A;  4EQP A;  2OXP A;  2ZM6 L;  3GTO B;  1Q82 C;  1VQC A;  4B3T L;  4K6L A;  3J81 E;  2L4N A;  1WCM H;  4HIO A;  1N32 Q;  4LF8 L;  3PO2 H;  2K50 A;  2D2C C;  2MO0 A;  5JPM C;  3K7U C;  3DHQ A;  4JI5 L;  1EY6 A;  4OHJ A;  1K8O A;  2ZXO A;  2EY2 A;  5C3E H;  4Q5V A;  1QZG A;  2DY8 A;  1TS4 A;  5IGC A;  1M4V A;  4B3R L;  5CV6 A;  1TII D;  3URY A;  2B2V A;  3TSS A;  1OTC A;  2Z4H A;  1OO9 B;  4N9T A;  5ELC A;  1UUP A;  5C0X J;  4A3G H;  3T1H L;  1KXL A;  5AJ3 L;  1BCP C;  5KNB A;  4PV1 C;  4BA2 I;  4C3I B;  2KHJ A;  2F0H A;  2NZ1 D;  5D14 A;  1A2U A;  3R8B A;  3LWE A;  1B2T A;  3UDF A;  2JA8 G;  2NZH A;  3TME A;  4K0K Q;  4JI8 Q;  1EIH A;  2K5N A;  1X32 A;  3PIO A;  1STA A;  3HOX B;  5EKL A;  2AQ3 B;  3NPP A;  4H13 C;  3S1Q B;  2L1B A;  3RUZ A;  2DN8 A;  2MNA A;  3D8G A;  3G71 A;  3HZX A;  1HZA A;  2MQH A;  1YNN C;  3NBI A;  5A2Q E;  5CV8 A;  3K58 A;  1AZQ A;  4A3F H;  1ET9 A;  2FIN B;  4RCN A;  1HRJ A;  3RD4 A;  3L9A X;  3KFU A;  3RZD H;  1LTI D;  1J5E L;  2A69 D;  4A3D B;  1WYD A;  4A3L H;  3QOJ A;  3A7L A;  4IUP A;  1I6H B;  2ZM6 Q;  4DAM A;  2AUJ D;  4LUV A;  4B3T Q;  2I0Q A;  3I56 A;  2IHF A;  4LF8 Q;  1PZJ D;  3QJY A;  2ZTE A;  3H0G B;  1NTG A;  3HOV B;  2A6H C;  2A74 C;  1VQF A;  4WJ3 M;  4LF7 L;  2HT1 A;  1JR0 D;  1SNM A;  1FNV A;  1EUJ A;  1GUN A;  1ESF A;  3GO5 A;  3X3M A;  3RMH A;  1N8R C;  3JAM E;  5M5Y B;  2RCN A;  4JK1 C;  3MA2 B;  1Q81 C;  4DV5 L;  1XJV A;  4NMZ A;  5COY A;  2WFW A;  3STB C;  2KEC A;  3HOY G;  2EYP A;  4J8Q A;  2KCT A;  3V96 A;  4DNI A;  2CWP A;  1LTB D;  3ZJY C;  1D2B A;  4KHP L;  2F4I A;  4LNQ A;  2EYM A;  1BF4 A;  3RLF A;  1A62 A;  2Q8R E;  1A6X A;  3K7A B;  1CT1 D;  4ODG A;  3AQQ A;  3OWE B;  1PA6 A;  3CC2 A;  1Y8O B;  1G2S A;  4JI3 L;  1GXD C;  5EKI A;  1RCV D;  4KV6 A;  3GTK B;  4RMF A;  1DOL A;  1KNA A;  1HCZ A;  2B2V C;  5IWA L;  2QF7 A;  2A6E D;  3H15 A;  1S40 A;  5F2D A;  2M9V A;  3J7Z C;  1IBM L;  2K75 A;  1CM9 A;  4BBS B;  2ZJR A;  2FMC A;  4APV A;  2AWN A;  4KD4 A;  1LT6 D;  5I2X A;  4A3M H;  3IFD A;  2AHO B;  4BY7 B;  3I4N H;  4ME3 A;  1Y1V B;  4C3H B;  3OOC A;  4H0L C;  2F4V Q;  2B63 B;  3I4O A;  5C4J H;  5C4Z A;  3CCS A;  4KK7 A;  1VQL A;  2PQE A;  2VW9 A;  2KQ3 A