5C0XI

Structure of a 12-subunit nuclear exosome complex bound to structured rna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
284
structure length
222
Chain Sequence
PEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTDTVKNILVSVLPGTNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title RNA degradation paths in a 12-subunit nuclear exosome complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 42
structure length 222
sequence length 284
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF10447 EXOSC1 Exosome component EXOSC1/CSL4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c0xI02
2.40.50.880 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c0xI01
3CCVA 3I2ZA 3K0XA 2R6GA 3H3VI 3RLOA 1K0RA 1Q82C 1E3PA 2HQLA 1VQLA 3W1GA 1AE3A 3F8TA 3IRBA 4O0AA 3K7AH 4DR6Q 1FVIA 4QJFA 1KC8C 2NVYH 1Y1VH 4AQYL 5AJ3L 3LGJA 4LUVA 2JEBI 1PH7A 1YHAA 4GKJQ 3GTJH 1IYJB 4DR3Q 1M90C 1L0WA 4GNXB 1IBML 4YWLA 1X54A 4GN4B 5LMNW 1N9WA 4A3CG 2VUMH 1Z47A 2WP8J 4GS3A 3GTPH 4IPCA 5M3MG 4JI5L 5IYCH 4HIKA 2Y0SG 1FJGQ 1J5EQ 1WFQA 4JI6Q 1NE3A 1EQRA 3KYHC 4WJ4A 2NN6I 1PH1A 3RZDH 3I56A 2JA9A 4YHHL 5FJ8H 1N34L 3S24A 4BBSG 4GLAC 2OQ0A 3T1HQ 1TWGH 1K8GA 4HIMA 1MJEA 2YTVA 4GN3B 3MEFA 2LSSA 4JI1L 2F3IA 3KLWA 1EYGA 1WYDA 2K50A 1HZ9A 4ALPA 4JI0L 2PNHA 1I5FA 3BZKA 3L7ZC 5JEAJ 3RR5A 4B3SL 2B3GA 1PYSB 1FL0A 3M85A 1QVFA 3GTKH 3HOVG 4GKKQ 3NELA 1TWAH 2R7ZG 4DR5Q 4BXXG 1OXXK 1PFSA 4MZ9A 1L1OC 4BA1I 2K75A 2WB1G 4QQBX 1HZAA 4OX9L 3CMAA 4UY8C 3HOYG 3GTGH 2NZHA 5C3EH 3KF8B 1KL9A 4TQUS 1XNRL 4BY7H 1YVCA 4K0KL 4HIOA 4A3FG 1OXUA 5LMUQ 1HNXL 3MXNB 3F2BA 4UP9A 4P75A 1VQ5A 1QVCA 4YY3L 3EIVA 4IPGA 1Y14B 1EIFA 1I6HH 1HR0W 1QUQA 2VY3A 4JV5L 5LMUL 3NENA 1KXLA 1Z9FA 3STBC 3CCMA 3TQYA 1N8RC 2HT1A 1I94Q 2C35B 5IP9G 3CCEA 3T1YQ 1R9TH 4LF6L 2KHIA 4JBWA 1CSPA 3HKZG 1PH8A 2ZJRA 1X55A 4IPHA 1MKHA 5C0XI 4IFDG 1XMOL 1CKNB 2UXCQ 2JQOA 1L2FA 1IBLQ 1A0IA 4HJAA 1PV4A 5M3FH 4R4IA 1WI5A 4DAYB 2R7FA 1SR3A 4H02A 4IJLA 2JJQA 4TVAB 1I3QH 4DV4L 3J7ZC 3CCLA 3UE1A 1TWCH 1A62A 2WFWA 2YYZA 3K80C 3KF6B 5GQOA 4A4IA 4POFA 4GLXA 3S14H 1Q46A 3CPWA 2E2HH 1VQ6A 3GTQH 5ELOA 1HNZQ 5JJIA 1Y1VG 1EFWA 4DR7Q 1HNWL 1C0AA 1IBKQ 1L1OB 1SMXA 1PH6A 4A3LG 4DUZQ 4B3MQ 1VQDA 4C3JH 2NVTH 1IZ6A 2YTYA 1N33Q 1E22A 3S2DH 4DV6Q 3CQZH 3ER0A 3S1NH 2NZOA 2Z0SA 1EWIA 4NXMQ 4JI7Q 3HOWG 4RG1A 1N32Q 2UU9L 1Y1WG 2UXDQ 1HJPA 2GVAA 2JK8A 4A3EH 4NXML 3PUVA 2N3SA 1WOCA 2CWAA 4L5TA 4J15A 4ME3A 4APVA 4DK6C 3I4NH 3PUXA 2IX1A 3JAMi 2XGTA 3BZCA 3CC2A 2HIVA 4LF5Q 1YJ9A 2JA7G 1K8AC 3HOXG 4B3TL 4LF8L 2ZM6Q 1Q81C 3J7A5 2NN6G 1ASYA 4LF7L 2ZJPA 4HJ7A 4YCVA 3G71A 2VNUD 1XMQL 2MNAA 1M1KC 1OXTA 4OWWB 3PF4A 3G6EA 1D8LA 4JYAQ 1SRUA 4KI0A 2E2JH 1NY4A 2ZTCA 2FXQA 4IFDI 2RF4A 1CSQA 3TEHB 4X66L 3CD6A 3B6YA 4JBJA 4JI2Q 1Q1EA 1YHQA 4A3BG 3GO5A 1LTLA 5IYDG 2VQEQ 3KDFA 1E24A 2JA5G 2QGQA 1G291 4X62L 2ZTDA 1LYLA 2YTXA 1S3OA 3S1QH 3CAMA 4AQYQ 2DGYA 5AJ3Q 1SN8A 1AH9A 1S40A 4DV1L 1Q86C 1IBMQ 2IT1A 3TS0A 2OWOA 2BH2A 4DR4Q 2ID0A 3CCJA 3AEVA 4DNIA 1KIXA 2PMZE 3NEMA 3PUZA 5FLMG 4A3MG 5IYBG 2HIXA 1UE6A 3HOZH 1EOVA 3GTMH 3UDFA 4JI5Q 1MIUA 1TWHH 4DR4L 5M5YH 1SLJA 1V9PA 4A3JG 5C0XG 5M3FG 4HJ5A 4YHHQ 1PA6A 1N34Q 4X65L 1E7ZA 3HKSA 4A76A 3PO3G 5GAEC 1Q1BA 3RLNA 4LUZA 4QGUA 4KHPL 2Y0SE 3TS2A 2PI2A 3FP9A 5BR8L 2JEAI 4JI1Q 2JA6H 4LUOA 4X64Q 4GOPA 4JI0Q 3S15H 1VCIA 4P71A 2E8GA 4B3SQ 1SROA 5M5XH 1VQMA 3J81c 1UE5A 4A3DG 5C4XG 3E0EA 3I7FA 4X64L 1H95A 3CF5A 1V43A 4OX9Q 1X56A 3PCOB 3J81j 1VQEA 3J80i 2LXJA 5IE8A 4DV0L 1YEZA 1XNRQ 2OTLA 4JI8L 4K0KQ 4IJHA 3HOUG 1IXRA 2WB1E 4POGA 4GLVB 3I55A 3AYHB 1JB7A 1HNXQ 4C3IH 1XPUA 1VQJA 4DV7L 4O2DA 1T9HA 1WCMH 4YY3Q 5C44H 1QZGA 2NVXH 2KBNA 2Z6KA 3U4VA 4JV5Q 1KRSA 2R7DA 4JCVE 3G48A 1PH5A 4BY1G 2VQFL 5E7NA 2K5HA 3GTLH 5EAYA 1VQIA 1OXSC 4R4CA 1VQHA 3U50C 1TWFH 4MNOA 4A3KH 2UUCQ 2MO1A 4LF6Q 1JJ2A 2WAQG 2N78A 2JA8G 2UXBL 5IP7H 3CXCA 1JJGA 1NTGA 4IPDA 1B7YB 4KLKA 3SGIA 2N49A 3CP0A 1XMOQ 5JJKA 4C3HH 3FKIG 4BBRH 4A3GH 1BVSA 2UUCL 2AWOA 4P73A 2CFMA 3HKZE 4DV3L 3BU2A 3UDXA 3E9IA 4LFBQ 1NMGA 1U5KA 1VQCA 4DV4Q 4DUYL 3S1MH 2CQOA 1VQNA 1KAWA 1KD1C 2MFIA 5FLXc 4GOPC 4LF9Q 3H0GH 3UDGA 4JI4L 4LNQA 1BKBA 3KJPA 2K5NA 3KFUA 1HNWQ 4DV5L 2UUAL 2V1CC 2HHHL 1YBYA 2Q2UA 1YITA 4LFAL 1EIYB 3G4SA 1VQAA 3F2DA 3W1BA 1XPRA 4LF9L 2F4VL 1PH3A 3M4PA 1XJVA 4NXNQ 2L15A 3DM3A 2UU9Q 3I4MH 1QZHA 1MJCA 2UUBL 3KDFB 3HOZG 3AQQA 1UE1A 3RLFA 1YI2A 3KOJA 4A3CH 1UWVA 4OONA 4NXNL 2VUMG 1GM5A 4PMWA 4PZ7A 1J6QA 3PV0A 5M3MH 4DPGA 4LWCA 2Z6KC 4NB3A 5IYCG 1VQPA 2IX0A 4B3TQ 1SE8A 1Q12A 1KRTA 3CCRA 1IL2A 1XNQL 4LF8Q 4A3LH 4EQ5A 3GTOH 4UPAA 4LF7Q 1S72A 3ULLA 2YU9H 1UEBA 4EX5A 5FJ8G 1XMQQ 4BBSH 2A19A 5IWAL 3S16H 1LUZA 3S17H 4DR2L 3L2PA 4DV2L 2BA0A 4UP8A 2EXDA 3M7NA 3F2CA 3GD7A 3EBEA 4X66Q 1VQKA 4C2MH 1OTCA 1XPOA 1VQ9A 3HOVH 1CKMA 2F52A 3ERSX 5GROA 2R7ZH 4BXXH 1JE5A 4DK3C 2H5XA 1RIPA 4X62Q 4LFCL 5GAHC 5JJLA 3CW2C 4NPSA 2E5LL 4QY7A 4AYBG 4AYBE 2IY5B 1X65A 5C3EG 1WCMG 4GOPB 3HOYH 4BY7G 1B8AA 1VS0A 4IOCA 1K9MC 2AHOB 4JBKA 3CPFA 4OWXB 1YNXA 2QA4A 3M3YH 1PVOA 4DV1Q 4R4TA 4A93H 1EUJA 4A3KG 2ZJQA 4B3RL 4PZ6A 2AMCB 2BA1A 1K3RA 1LM0A 3Q8DA 1VQOA 1VQ7A 5C0XJ 3KJOA 3OW2A 3A5UA 2ES2A 2K5VA 4A3GG 2CWPA 3D0FA 3HFZB 4R4OA 3CCUA 2DUDA 1GO3E 4YWMA 2D0OA 3PO2H 1PHJA 3L0OA 4X65Q 3PSIA 3CMEA 2GN5A 1RL2A 4KHPQ 4LF4Q 3OTOL 3NBHB 2K4KA 1A63A 5BR8Q 1OXVA 1YIJA 3RN2A 3M4OH 1GKHA 4JI3L 3H0GG 1QUQB 4HJ8A 1N36L 4LF4L 2KCMA 1JJCB 3S2HH 4AIMA 2ATWA 2VZAA 2B29A 2LXKA 3K7UC 4YCUA 4P72A 1PH4A 2ASBA 2E2IH 1E1OA 2AWNA 4PZ8A 1X3EA 4XIGS 1XTDA 5LMNQ 3H3VH 3TREA 1PH9A 2PQAA 4YWKA 4DV0Q 3I4MG 1X3FA 1B70B 4QL5A 4RMFA 1GVPA 1Q8KA 2OCEA 3E9HA 4JI8Q 3DLLA 3S1RH 4DR6L 2VL6A 2QEXA 4DV7Q 3PIPA 1C9OA 5LMNL 4X6AH 5K36G 2BH8A 3HOWH 1G6PA 1Y1WH 4A3IH 4GKJL 1BBUA 4DR3L 3AFPA 1U0LA 5GAGC 4A3EG 2VQFQ 3PGZA 4HJ9A 3PIOA 3I4NG 1FGUA 4OXPA 2UXBQ 1V1QA 1VQGA 3WWVA 2KHJA 2JA7H 1YJWA 3HOXH 1CUKA 3A74A 1J5EL 1W3SA 1K73C 4JI6L 1FJGL 1X6OA 4IFDJ 1P16A 1Q7YC 3U58A 1VQFA 2WAQE 3ZJYC 2A1AA 4R1JA 3W5OA 2B63H 4IOAA 1YHBA 4DV3Q 5H1SE 1PH2A 1SFOH 3T1HL 2N8NA 1EQQA 3AFQA 2MQHA 3STBD 3H15A 4DUYQ 2CKZB 3GDEA 1JT8A 2R93H 4OO1I 3VDYA 4PG3A 4A3BH 2JE6I 4GKKL 2PI2E 1C7YA 5IYDH 3OYYA 4DR5L 1JMCA 1HZCA 2JA5H 3TRZA 4GNXA 1X9NA 5C4JH 1HR0Q 4JI4Q 4AH6A 4JOIA 1GD7A 1ASZA 4DV5Q 2UUAQ 1PYBA 2HHHQ 5JEAG 2A8VA 2ZTEA 4LW1A 4A93G 4LFAQ 3CC4A 3PO3H 4Y52H 2F4VQ 2NVQH 1HR0L 2I5HA 5DLQE 4R4QA 1E1TA 1WJJA 3U4ZA 2UUBQ 2Q2TA 1QVGA 4HIDA 2VW9A 1KQSA 2IHEA 2R92G 1KHIA 1D7QA 4GN5A 3D31A 3J80c 4DR1Q 3PO2G 2ALYB 3F1ZA 4A3MH 5FLMH 5IYBH 2K14A 3UDIA 1YZ6A 3A0JA 1I94L 3T1YL 1XNQQ 4WJ3M 1K83H 1VQBA 2OTJA 3A5ZB 3I4OA 2EIFA 4XTCS 4DR1L 4OWTB 1HZBA 2KCTA 2RHQB 4A3JH 4P74A 1TXYA 3CCQA 1G51A 4JG2A 5IWAQ 1BBWA 2YV5A 4IO9A 4A75A 3RN5A 2GVBA 2UXCL 1IBLL 4DR2Q 3ULJA 4DV2Q 2K52A 2MO0A 2JA6G 4BA2I 3PUYA 3EN2A 5HY6A 2I5MX 2OQKA 1X3GA 4LFBL 5HGQA 1O7IA 4A3DH 2I5LX 5C4XH 1A8VA 5M5WH 4LFCQ 1W2BA 2E5LQ 4L5RC 5IY0A 2VS1A 3BJUA 1HNZL 4DR7L 3K81C 1IBKL 3PUWA 3K8AA 3RNUA 4A3IG 4DUZL 4B3ML 3HOUH 2IHFA 4DKAC 1N33L 4GNXC 4DV6L 4JOIC 4JI7L 1NBWA 4L5QA 5C44G 1N32L 2Q2IA 3M9BA 4B3RQ 1VQ4A 3CC7A 2UXDL 4A3FH 2RCNA 2XTIA 1CKNA 4L5SA 2PQAB 4BY1H 3ULPA 3JC66 1CKOA 4Y7NH 2R93G 4KHZA 2D0PA 1NJIC 2JA8H 4YCWA 3PF5A 5IP7G 4LF5L 3FHWA 2B63G 3KF6A 2AKWB 2I0QA 5J3BA 4QIWE 3J81i 1HH2P 2ZM6L 1VQ8A 2R92H 5ELNA 4BBRG 3FKIH 2EQSA 5IP9H 1NMFA 1YJNA 3RZOH 3OTOQ 2KENA 3UE0A 1DGSA 4JC0A 2CCZA 3ICEA 4JYAL 1UE7A 1L1OA 4JBMA 4DAMA 4JI3Q 1N36Q 5GADC 3M4QA 1AE2A 1P8LA 4FDBA 3CCSA 2D62A 5IT9c 4OO1G 4UP7A 4JI2L 2RHSB 3JAMc 1I50H 2Q2HA 4MTNA 2VQEL
chains in the Genus database with same CATH superfamily
3QWNA 1AFPA 2NTSA 1B4OA 3FEWX 4CKBA 4ZCKA 1Y69U 1RODA 1E3PA 2LFNA 1MBYA 3IRBA 1H9MA 2ENBA 1F2MA 2HDMA 1Y1VH 3J7YW 1E2WA 3AMUA 2L12A 2KVMA 1PLFA 4DR3Q 2B8FA 4GN4B 1STNA 3MVVA 5LMNW 4QCLA 2HQEA 5EQ0A 4IPCA 3DWAA 4UDUC 1LTAD 5C44B 1X32A 4JI6Q 5KIXA 3I90A 2NN6I 2JA9A 4BBSG 1N34L 2JA7B 3KBGA 4GLAC 3IL8A 1K8GA 2O4XA 5IGEA 4GN3B 1NAPA 2LSSA 4JI1L 4N8FA 2NZ1D 4ALPA 4FVMA 1I5FA 3K5OA 4B3SL 3RR5A 1WTPA 3R93A 3M85A 1FL0A 3HOVG 1ENCA 4BXXG 1OXXK 1PFSA 1HUMA 2WB1G 4KKUA 3PIP3 2Q8TA 5C3EH 4TQUS 1GUGA 4FF3A 1XNRL 2K33A 4HIOA 3D8GA 3KLRA 1FR3A 2QKIC 4P75A 1UEAB 1VQ5A 2HDLA 3C2PA 1SYCA 2KA7A 4UHVA 1QUQA 1ICFB 3NENA 1KXLA 5EPKA 3X3MA 2HT1A 4ZUIA 3T1YQ 4IUTA 3CCEA 4PNYA 3X3NA 4IFDG 1XMOL 1QILA 2A6HC 1MGSA 2NTTA 5CV5A 4H02A 2ATWA 2EPBA 4TVAB 3J7ZC 4MHEA 2WFWA 4A4IA 3MZ5A 4K5VA 3MAQA 3MXPA 1BCPC 2MP1A 3CPWA 5ELOA 1HNZQ 2I46A 4KY6A 5C4XB 1HNWL 5M5WB 1C0AA 1IBKQ 1L1OB 1SMXA 2X6GA 2EY2A 4C3JH 1N33Q 2F0WA 4Q0FA 3ER0A 3V96A 2AQ2B 1XTCD 4M1UB 5K36H 2A68C 1N32Q 2AUKA 2UU9L 3NXWA 4NXML 1WOCA 3I4NH 5C3WA 2XVSA 3CC2A 5CV4A 4LF5Q 3PQIA 3HOXG 4Y7NB 2RCFA 4LF8L 5ISRA 2NN6G 1ASYA 4HJ7A 4YCVA 3G71A 1XMQL 2E75C 1B53A 1ONLA 3G6EA 4JYAQ 1SRUA 1NY4A 2ZTCA 3SHLA 3RZOB 1JB3A 5J1ZA 1SEBD 5CV8A 4X66L 4JBJA 4JI2Q 3K5MA 1C4QA 4BWGB 3KDFA 1E24A 2ZTDA 1LYLA 1Y8PB 2YTXA 1S3OA 3DXJC 3CAMA 4J6HA 1TS3A 3Q24A 1Y1VB 4H0LC 4CDDC 2BH2A 3S9WA 4DNIA 1KIXA 3W2DA 3HOWB 4NDXA 4XXEA 4HJ5A 5M3FG 1N34Q 4NW2A 1TIID 3TS2A 5JOBA 5BR8L 5EPJA 4JI1Q 4CDFC 4X64Q 4KN4C 1MI2A 1VCIA 4P71A 4B3SQ 2L0CA 1DYQA 3J81c 3TP5A 2E2DC 1BNZA 3ZYYX 3MXUA 1EY4A 1KABA 2B8GA 3E3XA 1R4QB 1XNRQ 1Y8OB 1KNEA 4HAEA 3HOUG 2WB1E 1BQQT 4C3IH 5C3EB 1VQJA 4CGYB 1XPUA 1KDCA 2JA5B 2KBNA 2Z6KA 3U4VA 2R7DA 4JCVE 3G48A 2PCFB 3E5SA 2F1MA 5EAYA 1VQHA 2MO1A 3IAYA 2LMCB 1JWUD 1NSNS 1JJGA 1KLGD 1B3QA 3NK9A 3SGIA 3DMUA 2N49A 3CP0A 1XMOQ 4C3HH 4A3GH 1BVSA 4G7HC 4WJWA 2FMMA 3IFTA 1EEID 1U5KA 2EE1A 3NHHA 4DUYL 4A3JB 2CQOA 3A7AB 5BN3A 1CTMA 2MFIA 2J4XA 3G6JB 4JI4L 3KFUA 1HNWQ 4ZKBB 3KJPA 4KY5A 4DV5L 2JSOA 2L1BA 2EVBA 1ESRA 4UAIA 5AFWA 3W1BA 1XJVA 4C3JB 4N9PA 3AB9A 3I72A 2UU9Q 1QZHA 1IW7D 3KOJA 4A3CH 1UWVA 4NXNL 2A5HA 1GM5A 2I07B 4PMWA 4PZ7A 3PV0A 5M3MH 4N8X1 1MSGA 2Z6KC 1XNQL 3I4NB 1KRTA 2BDOA 1BDOA 5FO7B 4LF8Q 1II3A 1UEBA 1XMQQ 4BY1B 3S16H 4DR2L 2B2WA 2BA0A 2HCCA 1GUNA 1SNDA 4ZK9B 3EA6A 3EBEA 4X66Q 1K8MA 1AEXA 1LTTD 2K5QA 3ERSX 1BOSA 1Y8NB 4DK3C 2H5XA 5JJLA 4QY7A 4AYBG 2XN9C 4PMCA 1PZID 1WCMG 2IPKD 4GOPB 4BY7G 1B2TA 4H7BA 1TR5A 1HTPA 2QA4A 5KYIA 2RSNA 1HXYD 2ZJQA 3Q8DA 1KDBA 3P1HA 5FLXE 1D5MC 1S5ED 2F0LA 5NUCA 2TSSA 5IGGA 2D0OA 1SE4A 3A54A 1EYCA 2PO4A 1H9KA 3PSIA 3OW7A 3WDNA 4NMZA 1B9NA 4DFAA 1V1PB 3OTOL 5BR8Q 1YIJA 1EZ6A 3H0GG 1GUOA 1QUQB 3NP8A 4JI3L 1T5EA 2B2WC 3BVMA 3K7UC 3NUCA 3NE5B 4YCUA 2ASBA 4K2KA 2E2IH 1CHQD 2AWNA 4XIGS 1XTDA 4G7OC 1NNXA 2KECA 1GVPA 1O80A 3M4YA 3S1RH 2F0IA 2O2LD 4XDXA 4S3SA 4A3IH 4GKJL 1BBUA 4C3IB 4RGOS 1U0LA 1A3TA 4A3EG 4X3KA 1XWEA 5CR3A 3T56B 5FOBB 1J5EL 5BN5A 1LT6D 2F0DA 2DY8A 4K6DA 1PFNA 1YHBA 1PH2A 5DEHA 4C3HB 3HGBA 4A3GB 2N8NA 3AFQA 3H15A 1S5DD 3I8ZA 4DUYQ 3GDEA 3K5LA 1JT8A 4MTKA 2JE6I 3FMCA 2WACA 3FPPA 1SSOA 1C7YA 3OYYA 1HZCA 3TRZA 2V4DA 1X9NA 5C4JH 4JI4Q 1SYDA 4DV5Q 4CKEA 1DCZA 1TVXA 4A93G 1I3QB 2WKDA 4G7ZC 4Y52H 5EPLA 4H13C 1WJJA 3V2TA 1PFMA 3U4ZA 3GTQB 4HIDA 2NWGA 4DXGA 1D7QA 1BCPD 1ILQA 3J80c 4X3UA 4DR1Q 2OXPA 2ALYB 4OELB 3F1ZA 4A3MH 5FLMH 3CQZB 2AQ3B 3HP3A 1G2TA 1XNQQ 3J81E 1K83H 1HZBA 2RHQB 3LNNA 5M3MB 2A68D 2F0UA 4KHVA 1O7LA 3EVQA 2UXCL 4BA2I 1EYDA 4DR2Q 2MO0A 4ZAIA 5A35A 1EY8A 1H9SB 5HY6A 3S16B 3OIQA 2OQKA 4LFBL 3QG1A 5IT9L 5KNCA 5JVH3 3H3VC 3BJUA 2D2CC 4KTAA 1C8CA 3PUWA 4DUZL 1L0XB 2IHFA 4DKAC 4DV6L 5D3IB 5I9PA 1S5BD 5C44G 3BVGA 2UXDL 4A3FH 2RCNA 2PQAB 5I6WA 1NJIC 2JA8H 3J7AV 2RBMA 4YCWA 1GHKA 2O5IC 3Q6SA 4DNTB 3J81i 4X6AH 1HH2P 2ZM6L 3FKIH 1NMFA 1YJNA 2QCPX 3URYA 3OTOQ 3UE0A 1DGSA 2QDLA 2RSOA 4JC0A 2K04A 1L1OA 1TKWB 3KLSA 1WTRA 4JBMA 4JI3Q 1V1OA 3M4QA 1P8LA 1HA6A 3CCSA 1QCBD 2RHSB 3Q23A 1WTOA 2Q2HA 2VQEL 3CCVA 2R6GA 2HUGA 1QB5D 3RLOA 1NCVA 1DOKA 2HQLA 1JE4A 2MUYA 1AE3A 2E2IB 3F8TA 3K7AH 1KC8C 2NVYH 5J39A 2BDNA 4DU9A 3VR3A 4K5XA 1EY0A 1YHAA 4GKJQ 1IYJB 2WKCA 1IBML 1L0WA 4GNXB 2IX3A 4YWLA 1X54A 3SK6A 1Z6HA 4A3IB 2VUMH 1Z47A 4GS3A 4HCSA 3OMGA 2K5DA 1LABA 1J5EQ 4WJ4A 1NE3A 3KYHC 5FJ8H 3S24A 2OQ0A 5CORA 4HIMA 3MEFA 1CK1A 1WYDA 2F0EA 4I65A 2PNHA 3MEHA 1PYSB 3GTKH 1QVFA 4BBRB 2NYZD 4JPBW 3NELA 2VXWA 3SK4A 4MZ9A 1L1OC 1SJHD 4BA1I 2PPBC 4DGZA 1HZAA 4OX9L 1GHJA 5CYUA 3GTGH 2NZHA 3S1MB 1ET9A 1KL9A 5C4JB 4K0KL 3ONAB 5ELDA 1GXDC 1OXUA 3VA5A 5HGTA 1QVCA 1GUWA 3EIVA 4QUCA 1EIFA 1BCPF 4BS9A 1F2ZA 3JAME 2XRQD 3SEBA 4JBWA 1CSPA 1X55A 2ZXOA 1K83B 2ZXRA 3DM1A 2UXCQ 2IWHA 2Y0SB 1EQTA 1LACA 1SR3A 4LFBQ 4POFA 1A62A 3KF6B 5GQOA 2F0VA 3H6MA 1VQ6A 1Y1VG 4IALA 1SNOA 3D4WA 3DEOA 4DUZQ 2YTYA 2F0JA 4DV6Q 3S1NH 2R7ZB 3HOWG 4RG1A 3H09A 4J8QA 2UXDQ 4KKTA 2JK8A 3D6CA 3QO2A 2CWAA 4ME3A 4L5TA 4DA2A 2IL8A 4A3FB 2IX1A 3JAMi 3BZCA 3EROA 3M3YB 2HIVA 1YJ9A 1RD9D 3BZDB 4F88A 2JA8B 2ZM6Q 1Q81C 3NPPA 2VNUD 3PF4A 1BXTA 1SYFA 2E2JH 4IFDI 2RF4A 3HKZB 1G8ZD 3P7JA 3CD6A 2PW5A 4TKOB 2F0KA 1YHQA 4C1NI 5IYDG 2VQEQ 1PMRA 2JA5G 1G291 2EY1A 2LKVA 2EYFA 3S2HB 3GP7A 1SN8A 3K7AB 1GOZA 5KYLA 3TP8A 2NVYB 4DV1L 1Q86C 1IBMQ 3Q22A 1IYUA 2NBFA 4X3TA 4DR4Q 3AEVA 3PUZA 1UE6A 3HOZH 3GTMH 1U4PA 3UDFA 2VUMB 1TWHH 5M5YH 5E4WC 1SLJA 1Y1WB 1V9PA 2VB2X 4A3JG 1S5CD 1PA6A 4X65L 1E7ZA 1Q1BA 1JOQA 4LUZA 1SAPA 4GOPA 3S15H 4O42A 2E8GA 1SROA 2F3VA 1EEFD 1VQMA 4A3DG 1UE5A 1HFNA 2IW3A 1QJOA 3E0EA 4X64L 5JAVA 3GTKB 1V43A 3ND8A 4OX9Q 4XQQA 4DXFA 3J80i 1EIHA 5IE8A 4DV0L 1RCVD 2OTLA 4K0KQ 3L9AX 3TP6A 4F7XA 4POGA 4A3BB 3GTGB 1PTOH 3BYTB 4O2DA 5EGTA 1KRSA 1U4RA 1V1PA 4BY1G 2FFKB 2K5HA 1VQIA 3OSOA 1OXSC 3HRZC 4R4CA 3T13A 1TWFH 3U50C 2R93H 5IGBA 2UUCQ 1JJ2A 3HZXA 4G57A 1H9JA 4Z9CB 4CHTB 1NTGA 1NR4A 4RGTA 2PZUA 3A8IE 4NP5A 2A6ED 3CKIB 4DV3L 3BU2A 3UDXA 2K28A 2RDGA 3NTHA 3KBXA 2WV6D 4OO1H 1KAWA 5FLXc 1V8QA 2FMCA 4GOPC 4LF9Q 2K5NA 2D9UA 2XRSD 5LL6X 2F4IA 5G3LF 1YBYA 1XX8A 3FVQA 1WVLA 1EIYB 1PH3A 1VF5C 2L15A 2F0MA 1MJCA 3M7GA 2UUBL 3S1NB 1SNPA 1SYGA 3DWPA 4LWCA 1AW7A 1T5XD 2XSCA 5IYCG 2IX0A 1VQPA 1IL2A 3CCRA 2F0SA 1IKMA 2E74C 3GTOH 3ULLA 2QW7A 4EX5A 4BBSH 4K8IA 5IWAL 3VR5A 3L2PA 5CV6A 2WAQB 2EXDA 4ID6A 3GD7A 3F2CA 4LK1C 1PFBA 2E2JB 1OTCA 4KN7C 1XPOA 4CJ1B 3HOVH 1LLRD 1X3PA 1PRTB 1CKMA 2F52A 1VMPA 4BXXH 1JE5A 1RIPA 4X3SA 5EKLA 2F0FA 4C3IG 2IY5B 1CQVA 4I7ZC 3MFYA 2G9DA 4IOCA 4DN4M 1EQVA 4OWXB 1YNXA 1WD1A 4DV1Q 2B2YA 1EUJA 4EQPA 2WINB 1TQOA 2RDHA 4PZ6A 1O78A 4B3RL 3MTSA 1K3RA 1VQ7A 3KJOA 4HEDA 3A5UA 2D5DA 2EYHA 1J8IA 4C3HG 4O1NA 4A3GG 1H9SA 3HFZB 3D3RA 2PZTA 2DUDA 1D6EC 1GO3E 4YWMA 3PO2H 3HOZB 2EYLA 4KJOA 3L0OA 1VF7A 4X65Q 1TWHB 5M5YB 4LF4Q 5CV7A 1EWCA 4ILWA 3RN2A 3A55A 1EZ8A 4AIMA 1ICWA 3S15B 2PQAA 4DV0Q 4RMFA 3DLLA 2OCEA 4KD3A 5C6AA 2EYOA 3NSWA 1WTQA 1G6PA 3VA7A 1PTOB 3AFPA 2MGSA 3VR6A 2Q8IB 3E6ZX 3J80L 1FGUA 2B2YC 5A2QE 2EJMA 2KHJA 2N88A 3HOXH 1CUKA 1W3SA 2NN6H 2F0QA 1A2UA 1VQFA 4R1JA 2B63H 4DV3Q 5FO8B 1SFOH 3QB3A 3T51B 2CKZB 1F9RA 2F03A 3OHXC 5I4DA 5KNBA 4DR5L 1CFMA 1PRTD 3QJYA 4GNXA 4U673 1HR0Q 4AH6A 1GD7A 1PYBA 5JEAG 2SOBA 4QB4A 2NVQH 5DLQE 1E1TA 1SNMA 3RMHA 2UUBQ 2RQXA 1RKNA 4HR7B 4GN5A 1U4MA 3SK8A 2CVRA 2VB3X 4IQZA 4EVOA 1S4ZA 1YZ6A 1SYEA 4WJ3M 2OTJA 3I4OA 4DR1L 4OWTB 2KCTA 2LY7A 1TXYA 1MD2D 1SNCA 1G51A 1QWYA 4HTHA 1BBWA 5IWAQ 3CCQA 4IO9A 1BF4A 2JA6G 1STGA 1JQYD 3EN2A 1JORA 5FO9B 4ZYSA 5E4XA 5IY0A 4DR7L 3K81C 2WB1B 4A3IG 1GUTA 3HOUH 2N55A 4GNXC 1EY9A 5DAUA 2J7ZA 1NBWA 2Q2IA 1IYVA 4B3RQ 1VQ4A 1PTOD 2LS01 3ULPA 5K5PA 2EYPA 1DD2A 1CKOA 2DNCA 3I91A 2D0PA 3CRKC 4RAUC 5IP7G 3PF5A 3FHWA 3KF6A 3A7LA 2I0QA 5J3BA 1VQ8A 2R92H 5ELNA 4BBRG 5IP9H 3PO2B 3PMFA 2KENA 3DHQA 2SEBD 1QE6A 1ML0D 4U68A 1B1ZA 1FNWA 2E76C 4FDBA 4QMGA 4UP7A 3JAMc 3LWUA 3TN2A 3I2ZA 3VR4A 3H3VI 2G5DA 2K05A 2EOTA 1Q82C 2XWBB 3W1GA 4O0AA 1F2YA 1FVIA 4QJFA 2BCOA 1PH7A 1PZJD 2M9VA 3EJIA 1CI3M 2F0OA 2BE5C 2KCNA 2CQAA 3V05A 1DOLA 1CZWA 4JI5L 4HIKA 2Y0SG 1WFQA 3I70A 4R9WA 2Q8RE 3RZDH 1PH1A 3HOXB 3ITPA 2YTVA 2XIWA 3TMEA 1EYGA 2K50A 1HZ9A 2B63B 2X6LA 4WRDA 4C1NK 1LV9A 3UI2A 2B3GA 2KUMA 2R7ZG 4DR5Q 1H9RA 3HS0C 1K0SA 3K57A 1PRTF 1HRJA 4K6LA 3R2TA 4UY8C 3HOYG 1HTLD 3KF8B 4BY7H 4A3FG 5LMUQ 1SYBA 3C1FA 3MXNB 3F2BA 2NVQB 3I3CA 4XYOA 1U9RA 1I6HH 1Z9FA 3STBC 1EY6A 3TQYA 1N8RC 2C35B 2F0PA 1R9TH 4LF6L 2PMZB 2A6EC 5KGUA 3HKZG 2ZJRA 4IPHA 5C0XI 2ZXPA 4K14A 2JQOA 5J22A 1L2FA 5CGKA 4FXDA 2J0TD 4WORA 4MN3A 5D3DA 1JOOA 4IJLA 1G6ZA 3CCLA 2JJQA 1VMCA 4V0BA 3S14H 1Q46A 1FGBD 2E2HH 4ME5A 3RUZA 4DR7Q 1RJTA 1LO5D 1LT4D 1PH6A 4A3LG 2MHVA 1VQDA 2TMPA 3S2DH 4OHJA 3NBIA 1EWIA 4OIKA 3HOUB 1Y1WG 5I9OA 1RTNA 5D65A 4A3EH 3PUVA 2N3SA 2ICEC 4APVA 1FNVA 4FP5D 4DK6C 3PUXA 2GA4B 2JA7G 4B3TL 2K03A 1OO9B 4LF7L 3F2UA 2ZJPA 1AP0A 4PQXA 2MNAA 1OXTA 1M4VA 3EQLC 1M1KC 4OWWB 2R92B 1D8LA 4KI0A 2FXQA 1PZKD 3A56A 1I6VC 1JR0D 4FO2A 1TU2B 1Q1EA 5ELFA 5EKKA 3GO5A 4A3BG 4OIJA 1X3QA 2QGQA 5DM63 5ELCA 3D6WA 2F0HA 4DF7A 3G7LA 1WTWA 1YNJC 1AH9A 1S40A 3SE0A 3P75A 2IT1A 2PW7A 2OWOA 1CQFA 5TSSA 1UNSA 3S1RB 5IYBG 2HIXA 1EOVA 4I7AA 2DJGC 2H4OA 4JI5Q 3MFGA 2OT2A 4DR4L 5HURA 4M8AA 1I4RA 5C0XG 1F9PA 4A76A 3CU7A 4KHPL 2Y0SE 3RZDB 5IGDA 2JEAI 4LUOA 5FKAC 4RCOA 1ILPA 5C4XG 3I7FA 1CA6A 1H95A 4XT1B 3CF5A 3GQBA 4HMJA 1IHZA 4RCNA 1X56A 5FLXL 3J81j 1VQEA 2LXJA 1I4QA 1YEZA 3AU7A 3QOJA 4JI8L 1IXRA 3BYYB 4AYBB 3VYRA 3AYHB 4BY7B 5C44H 1QZGA 4RWSC 4CBVA 2HCIA 1PH5A 3A8KE 2VQFL 1QNUA 3GTLH 1HQMC 1QOHA 4LF6Q 3OPOA 5JJIA 4A3KH 5DM73 2WAQG 4FXKC 3D4RA 3CXCA 1R9TB 1B7YB 4KLKA 5JJKA 3OIPA 1NR2A 2UUCL 4A3MB 3HKZE 1AZPA 1JWSD 3SK5A 1NMGA 1PRTC 1U4LA 1LTID 1BR9A 1KD1C 2KEDA 5IGFA 3BDLA 4DAVA 1L0YB 3S14B 2E2HB 2V1CC 4LMQD 3J7AF 2Q2UA 1YITA 1ZKOA 1EL0A 3G4SA 1VQAA 1XPRA 4LF9L 3H94A 2IJ0A 3I4MH 1ZYRD 3S2DB 3HOZG 2DY7A 1CA5A 3AQQA 1W6KA 3BG3A 1YI2A 3R3OA 3OMCA 2OF1A 5DNFA 1ZXTA 2KOLA 1J6QA 4RHSA 4B3TQ 1SE8A 3RD4A 5EJWA 4YIJA 4UPAA 4LF7Q 1S72A 1XYIA 1LUZA 4CDEC 3S17H 2XWJB 4DV2L 3MA2B 3OWFA 1VQKA 4C2MH 3FKIB 4FF2A 5GAHC 3CW2C 4NPSA 2E5LL 4FYDA 5C3EG 1ESFA 4ABNA 1VS0A 3J81L 3NWSA 2DJFC 1K9MC 1PTOC 2AHOB 4JBKA 1PVOA 2CW0D 4J1MA 4EGVA 2AQ1B 2BA1A 5F2DA 1VQOA 1LM0A 5ELBA 1ZEQX 5C5MA 3OWEB 2KCCA 2CWPA 1XXGA 1STEA 1B9MA 2CHBD 1PHJA 1CHPD 1DOMA 1TS4A 4KHPQ 1RL2A 2EXZA 4KD4A 3HG9A 2BE5D 2A74C 3M4OH 1GKHA 4LF4L 2KCMA 2F0NA 5JJZA 3K59A 2LXKA 4QF4A 4PZ8A 1MHWC 1X3EA 3T16A 2EY6A 5M9OA 5LMNQ 4YWKA 1B70B 1M8AA 4JI8Q 3E9HA 4C3JG 4DR6L 3PIPA 5K36G 2PYKA 3TZDA 3HOWH 1LTRD 3VYSA 5IOCA 1D1KA 3Q0AA 2VQFQ 5CBEE 3PGZA 1STHA 3PIOA 4HJ9A 4ZQ3A 3IKJA 4DAPA 3I4NG 1SE2A 1V1QA 3R8BA 3GTLB 1YJWA 1FJGL 4IFDJ 1K73C 4A3KB 3ND9A 3WOFA 4DK1A 1Q7YC 2WAQE 3ZJYC 2A1AA 4QIWB 1I4GA 5H1SE 3T1HL 1EQQA 3STBD 5JPNC 4IZ8A 5CC4A 4GKKL 2KQ3A 5D14A 5IYDH 1JMCA 4HSPA 4B08A 2JA5H 2RDFA 4JOIA 4XYQA 4DK0A 3PIO3 4OL7A 4LW1A 4F8MA 1YNND 3CC4A 3PO3H 5IGCA 4KV6A 2Z6BA 1CZGA 4QUFA 1HR0L 2Z4HA 1E2VA 2Q2TA 1QVGA 2VW9A 2OEOA 1RDPD 3I4MB 4CKCA 1GUSA 3PO2G 4IUQA 1WTXA 2K14A 2DN8A 1I4XA 1TY2A 3UDIA 1I94L 4RFBA 4RH6A 2O5JC 3A5ZB 2EIFA 5ELEA 1EYAA 5IIFA 4A3JH 4OEMB 3A8JE 4JG2A 2YV5A 1DXMA 1IBLL 4DV2Q 1DZ1A 3N52A 1Q3LA 2L4NA 3KF8A 1D2BA 2K32A 2I5MX 3TP7A 3S17B 1SMYD 5HGQA 4A3DH 2KHSA 3MXNA 5JPMC 1A8VA 4C2MB 1W2BA 4F87A 1BBXC 3JAML 2E5LQ 2VS1A 2EYMA 2MJ8A 3K8AA 3RNUA 2ZT9C 4C56C 4B3ML 2K01A 4IUUA 4DNRB 4JOIC 1FNUA 4IUVA 1F2LA 3D4DA 4JI7L 4L5QA 4P2CB 1BUVT 4FF4A 3M9BA 1JC7A 2XTIA 4L5SA 1PDQA 3QOLA 2R3ZA 4BY1H 1D5ZC 4KHZA 4ZUJA 3NWTA 2B63G 1SE3A 1RHPA 2SDFA 2C9OA 1YNJD 2AKWB 4EQOA 5C5LA 3E0JA 3GTMB 3ICEA 3FRPB 4IFDH 4DAMA 4XQNA 1AE2A 1TS5A 3M4OB 1I50H 1E0BA 4MTNA 1WD0A 3K0XA 4RGMA 1K0RA 4L63B 1JCKB 1VQLA 1BO0A 4DR6Q 4L6TB 4AQYL 5AJ3L 3LGJA 4LUVA 1B3AA 2JEBI 1EOTA 4E6IA 5T1IA 3GTJH 1M90C 5EKIA 1N9WA 4A3CG 2X69A 1O7YA 2WP8J 3KLSX 3GTPH 4TRDA 1Z7TA 5C4ZA 5M3MG 3L3OC 5IYCH 1FJGQ 1EQRA 4RGNA 4NKLA 3I56A 3DWQA 4YHHL 2RVLA 3T1HQ 1TWGH 2R93B 1TWFB 1MJEA 4WFN3 4V190 2EJGC 2F3IA 3ERQA 3KLWA 3MHBA 4JI0L 3BZKA 3L7ZC 5JEAJ 1JOKA 4GKKQ 1JICA 1TWAH 2Z9HA 2K75A 4QQBX 3FDTA 3CMAA 1EY5A 1DONA 4KJNA 2K6AA 5CMDA 5IODA 2Z8LA 1YVCA 2L55A 2SNMA 1HNXL 3NBHA 3PO3B 4UP9A 4B9XA 1LTSD 2QILA 2Z1CA 4YY3L 4IPGA 1Y14B 5IT9E 2VY3A 1HR0W 4JV5L 3GV6A 5LMUL 1QNKA 5CV9A 5T1GA 2R92G 3CCMA 2H1EA 5IP9G 3T53B 2KJXA 5E1FA 1I94Q 2KHIA 1PH8A 4ODGA 1MKHA 3SVMA 1EWHA 1CKNB 1IBLQ 1A0IA 4HJAA 1TS2A 5C3XA 3CHBD 1PV4A 5M3FH 4R4IA 1WI5A 4DAYB 5JVG3 2R7FA 4DV4L 1I3QH 3GTOB 2L5TA 1TWCH 2YYZA 3I4LA 3UE1A 3K80C 4GLXA 4BBSB 1C48A 3FPUB 3GTQH 2CH4W 4A3DB 1EFWA 1ZYRC 4JVZA 4B3MQ 4KMUC 5KNDA 2NVTH 1IZ6A 3HOVB 1E22A 1EU3A 3CQZH 2NZOA 2Z0SA 4NXMQ 2WIIB 4JI7Q 1TT2A 1HA5A 1HJPA 2GVAA 1FYCA 1A2TA 5CBAE 1RTOA 1UUPA 4CJ0B 4J15A 5I2YA 1HFGA 2XGTA 1QG7A 4ZRZA 3QIAA 3SDZA 1K28A 3VR2A 1K8AC 5I2XA 5L37A 3HEJA 3J7A5 2M2LA 3K58A 1ENFA 1E2ZA 2A73B 3K0YA 4L8JA 1Q90A 3MC0B 3KK7A 2A69C 1CSQA 4LAAA 1JWMD 4K2LA 3B6YA 3TEHB 1WTVA 4FF1A 4ZLTF 1LTLA 4MIUA 3NQIA 5COYA 4X62L 2CW0C 3C1EA 1A3UA 1I50B 4ZKCB 3OOCA 1BCPB 5JEAH 3S1QH 4AQYQ 2DGYA 5AJ3Q 4Q5VA 5KRUA 1MSHA 1S5FD 3TS0A 2ID0A 3CCJA 2PMZE 3GTJB 3NEMA 4A3MG 5FLMG 3K6OA 2JYOA 1MIUA 3GTPB 1K3BC 3K5NA 4YHHQ 3HKSA 5GAEC 4HSVA 4FXGC 3RLNA 3U9OA 4QGUA 2PI2A 3FP9A 3IFDA 2JA6H 1KDAA 1LTBD 3LX0A 1IKLA 2DNEA 3WOEA 2KEEA 4JI0Q 2CH4A 1TWGB 5M5XH 3TZUA 3C3LA 1WTHA 4PMBA 1HHVA 1SFOB 2JN4A 3U9SA 1TWAB 3PCOB 5I6YA 2P5ZX 4IJHA 4JW0A 4GLVB 3I55A 1JB7A 1HNXQ 4ULLA 4DV7L 1SBBB 2K1BA 1T9HA 1WCMH 4YY3Q 2NVXH 4JV5Q 2C5CA 2MPMA 2PNRC 5E7NA 1O7ZA 2ICIA 1LT5D 1D5XC 4MNOA 2JA8G 4R8NA 1KAAA 2UXBL 1GJXA 2N78A 5C4HA 5IP7H 3C46A 4IPDA 3DUZA 3QR8A 3TDQA 3SXHA 3FKIG 3VYTA 4BBRH 3TSSA 2XNAC 2AWOA 4K8JA 4P73A 2CFMA 1KLUD 3E9IA 5FK9C 1VQCA 4XT3B 4DV4Q 3S1MH 4HMIA 1TY0A 1DJRD 3SR1A 5M3FB 1AZQA 1VQNA 1YNNC 2A6HD 2M00A 2F3WA 2L11A 1TWCB 3H0GH 3I73A 3UDGA 4LNQA 2SNSA 1BKBA 2UUAL 5A2QL 2HHHL 1ET6A 4LFAL 2F4VL 4EQNA 3F2DA 3M4PA 4NXNQ 3DM3A 1B50A 2NVTB 2F0GA 1LTGD 3KDFB 1UE1A 3RLFA 4OONA 2VUMG 2BOSA 1A15A 4FNFA 4DPGA 4NB3A 1Q12A 3W3AA 1PTOF 4EQ5A 2NUCA 1KTKA 4KY7A 2QF7A 2YU9H 5FJ8G 1EY7A 1SMYC 2A19A 4IURA 3NQTA 5BN4A 4UP8A 1SJED 3M7NA 1STBA 3CRLC 1VQ9A 5LHY1 2R7ZH 5GROA 4TSSA 1STYA 1IL8A 4X62Q 4LFCL 2QEJC 4AYBE 3BVZA 1X65A 3HOYH 1B8AA 1RF2D 1HQRD 1B44D 2B2UA 2EJFC 2PZWA 5LL6S 1AN8A 3S1QB 4IN3A 3CPFA 2EYJA 3M3YH 4OGQC 3BDCA 2L9HA 4R4TA 4A93H 1EFID 4A3KG 3H91A 2FINB 3GV3A 2AMCB 1SDFA 1D1IA 5C0XJ 3EFXD 4HCEA 3OW2A 2ES2A 2K5VA 1UAPA 3D0FA 1KNAA 4R4OA 2K7VA 3CCUA 1NUCA 1G2SA 3CMEA 2GN5A 4HN7A 5EBCA 3NBHB 2K4KA 1A63A 1OXVA 2B2TA 2Z4IA 4HJ8A 1N36L 2JA6B 3S2HH 1JJCB 1I4PA 3NTKA 4GZYC 2HD3A 2VZAA 2B29A 4P72A 1PH4A 5M5XB 1E1OA 3N6RA 3H3VH 2K5WA 3VYUA 3TREA 1PH9A 5KEEA 3I4MG 1X3FA 2RA4A 4QL5A 4A3LH 1Q8KA 3TBIB 4G4KA 1I4HA 1W6JA 2VL6A 2QEXA 2JXMB 4DV7Q 5LMNL 1C9OA 2BH8A 2B2VA 1Y1WH 1LT3D 4DR3L 2B2UC 5GAGC 4H44C 1Q8IA 1WCMB 2NVXB 1F77A 3P20A 1A3VA 2NB0A 5E3FA 3DEPA 4OXPA 2UXBQ 1VQGA 3WWVA 1DM0B 1HCZA 2JA7H 1G91A 3A74A 4JI6L 3NTIA 1X6OA 1I6HB 1P16A 3U58A 3W5OA 4IOAA 2MQHA 3KUPA 4JK1C 4XQJA 4OO1I 3VDYA 4PG3A 4A3BH 2PI2E 2B2TC 1ASZA 4CDCC 2UUAQ 2HHHQ 2A8VA 2EY5A 2ZTEA 3H0GB 4LJZC 4LFAQ 2JP1A 2F4VQ 3BS1A 2I5HA 4R4QA 1CT1D 4K5WA 1ENAA 4N9TA 1KQSA 2IHEA 3T4AC 1KHIA 2F0TA 4RA8A 3MXGA 3D31A 4R8IA 5IYBH 3MWYW 2B2VC 1R4PB 3A0JA 3T1YL 1VQBA 2B39A 4XTCS 5C0XH 4P74A 4A3EB 1EIGA 4A75A 3RN5A 2GVBA 4CJ2C 3ULJA 2K52A 2YU9B 3PUYA 3LWEA 4RHRA 4KKSA 1HUNA 1X3GA 2AUJD 2QDBA 1O7IA 1PYWD 5G3LD 4IUPA 2I5LX 5C4XH 4B9WA 2G9HD 1STAA 1F9QA 5M5WH 4LFCQ 1IW7C 4L5RC 1HNZL 1IBKL 2RKSA 3BDOA 1N33L 2A69D 3HOYB 1N32L 1K8OA 3CC7A 3O13A 1CKNA 2FHTA 1PXUA 4A93B 2PQEA 3JC66 1VDZA 4KK7A 1A6XA 4Y7NH 2EZVA 1SXTA 2R93G 4DAYA 1F9SA 2EDGA 1FD7D 4LF5L 1EU4A 4QIWE 2EQSA 3R2IA 1CM9A 5EBDA 1SNQA 3RZOH 1J9OA 2FJ2A 4PV1C 2R61A 2CCZA 4JYAL 1UE7A 1N36Q 5GADC 3J80E 4RKBA 4RKLA 2D62A 5IT9c 4OO1G 4JI2L 4IUNA 1HPCA 3PO3G
chains in the Genus database with same CATH topology
3QWNA 1AFPA 2NTSA 1B4OA 3FEWX 4CKBA 1Y69U 1RODA 1E3PA 2LFNA 3IRBA 1MBYA 1H9MA 2ENBA 1F2MA 2HDMA 1Y1VH 3J7YW 1E2WA 3AMUA 2L12A 2KVMA 4DR3Q 1PLFA 2B8FA 4GN4B 1STNA 3MVVA 5LMNW 4QCLA 2HQEA 5EQ0A 4IPCA 3DWAA 4UDUC 1LTAD 5C44B 1X32A 4JI6Q 5KIXA 3I90A 2NN6I 2JA9A 4BBSG 1N34L 2JA7B 3KBGA 4GLAC 3IL8A 1K8GA 2O4XA 5IGEA 4GN3B 2LSSA 4JI1L 1NAPA 2NZ1D 4ALPA 4FVMA 1I5FA 3K5OA 4B3SL 3RR5A 1WTPA 3M85A 3R93A 1FL0A 3HOVG 1ENCA 4BXXG 1OXXK 1PFSA 1HUMA 2WB1G 4KKUA 3PIP3 5C3EH 2Q8TA 4TQUS 1XNRL 1GUGA 4FF3A 2K33A 4HIOA 3D8GA 3KLRA 1FR3A 2QKIC 4P75A 1UEAB 1VQ5A 2HDLA 3C2PA 1SYCA 2KA7A 1QUQA 3NENA 1KXLA 5EPKA 3X3MA 2HT1A 4ZUIA 3T1YQ 3CCEA 4IUTA 4PNYA 3X3NA 4IFDG 1XMOL 1QILA 2A6HC 1MGSA 2NTTA 5CV5A 4H02A 2ATWA 4TVAB 2EPBA 3J7ZC 4MHEA 2WFWA 4A4IA 3MZ5A 4K5VA 3MAQA 3MXPA 1BCPC 3CPWA 2MP1A 5ELOA 1HNZQ 2I46A 4KY6A 5C4XB 1HNWL 5M5WB 1C0AA 1IBKQ 1L1OB 1SMXA 2X6GA 2EY2A 4C3JH 1N33Q 2F0WA 4Q0FA 3ER0A 3V96A 2AQ2B 1XTCD 4M1UB 5K36H 1N32Q 2A68C 2UU9L 2AUKA 3NXWA 4NXML 1WOCA 3I4NH 5C3WA 2XVSA 3CC2A 5CV4A 4LF5Q 3HOXG 4Y7NB 4LF8L 5ISRA 2NN6G 1ASYA 4HJ7A 4YCVA 3G71A 1XMQL 2E75C 1B53A 1ONLA 3G6EA 4JYAQ 1SRUA 1NY4A 2ZTCA 3SHLA 3RZOB 1JB3A 5J1ZA 1SEBD 5CV8A 4X66L 4JBJA 4JI2Q 3K5MA 1C4QA 4BWGB 3KDFA 1E24A 2ZTDA 1LYLA 2YTXA 1Y8PB 1S3OA 3DXJC 3CAMA 4J6HA 1TS3A 3Q24A 1Y1VB 4H0LC 2BH2A 3S9WA 4DNIA 1KIXA 3W2DA 3HOWB 4NDXA 4XXEA 4HJ5A 5M3FG 1N34Q 4NW2A 1TIID 3TS2A 5JOBA 5BR8L 5EPJA 4JI1Q 4X64Q 4KN4C 1MI2A 1VCIA 4P71A 4B3SQ 2L0CA 1DYQA 3J81c 3TP5A 2E2DC 1BNZA 3ZYYX 3MXUA 1EY4A 1KABA 2B8GA 1XNRQ 1R4QB 1Y8OB 1KNEA 4HAEA 3HOUG 2WB1E 1BQQT 4C3IH 1XPUA 1VQJA 4CGYB 5C3EB 1KDCA 2JA5B 2KBNA 2Z6KA 3U4VA 2R7DA 4JCVE 3G48A 2PCFB 3E5SA 2F1MA 5EAYA 1VQHA 2MO1A 3IAYA 2LMCB 1JWUD 1NSNS 1JJGA 1KLGD 3NK9A 3SGIA 3DMUA 2N49A 3CP0A 1XMOQ 4C3HH 4A3GH 1BVSA 4G7HC 4WJWA 2FMMA 3IFTA 1U5KA 1EEID 2EE1A 4DUYL 3NHHA 4A3JB 2CQOA 3A7AB 5BN3A 1CTMA 2MFIA 2J4XA 3G6JB 4JI4L 3KFUA 1HNWQ 4ZKBB 3KJPA 4DV5L 4KY5A 2JSOA 2L1BA 2EVBA 1ESRA 4UAIA 5AFWA 3W1BA 1XJVA 4C3JB 2UU9Q 3AB9A 3I72A 4N9PA 1QZHA 1IW7D 3KOJA 4A3CH 1UWVA 4NXNL 2A5HA 1GM5A 4PMWA 2I07B 4PZ7A 3PV0A 5M3MH 2Z6KC 1MSGA 1XNQL 3I4NB 1KRTA 2BDOA 1BDOA 5FO7B 4LF8Q 1II3A 1UEBA 1XMQQ 4BY1B 3S16H 4DR2L 2B2WA 2BA0A 2HCCA 1GUNA 1SNDA 4ZK9B 3EBEA 4X66Q 3EA6A 1K8MA 1AEXA 1LTTD 2K5QA 3ERSX 1BOSA 1Y8NB 4DK3C 2H5XA 5JJLA 4QY7A 4AYBG 2XN9C 4PMCA 1PZID 1WCMG 4GOPB 2IPKD 4BY7G 1B2TA 4H7BA 1TR5A 1HTPA 2QA4A 5KYIA 2RSNA 1HXYD 2ZJQA 3Q8DA 1KDBA 3P1HA 5FLXE 1D5MC 1S5ED 2F0LA 5NUCA 2TSSA 5IGGA 2D0OA 1SE4A 3A54A 1EYCA 2PO4A 1H9KA 3PSIA 3OW7A 3WDNA 4NMZA 1B9NA 3OTOL 1V1PB 4DFAA 5BR8Q 1YIJA 4JI3L 3H0GG 1QUQB 1EZ6A 1GUOA 3NP8A 1T5EA 2B2WC 3BVMA 3K7UC 4YCUA 3NE5B 3NUCA 2ASBA 4K2KA 2E2IH 1CHQD 2AWNA 4XIGS 1XTDA 4G7OC 2KECA 1GVPA 1O80A 3M4YA 3S1RH 2F0IA 2O2LD 4XDXA 4S3SA 4A3IH 4GKJL 1BBUA 4C3IB 4RGOS 1U0LA 1A3TA 4A3EG 4X3KA 1XWEA 5CR3A 3T56B 5FOBB 1J5EL 5BN5A 1LT6D 2F0DA 2DY8A 4K6DA 1PFNA 1YHBA 1PH2A 5DEHA 4C3HB 3HGBA 4A3GB 2N8NA 3AFQA 3H15A 1S5DD 4DUYQ 3I8ZA 3GDEA 3K5LA 1JT8A 2JE6I 3FMCA 2WACA 3FPPA 1SSOA 1C7YA 3OYYA 1HZCA 3TRZA 1X9NA 4JI4Q 5C4JH 2V4DA 1SYDA 4DV5Q 4CKEA 1DCZA 1TVXA 4A93G 1I3QB 4Y52H 2WKDA 4G7ZC 5EPLA 4H13C 1WJJA 3V2TA 1PFMA 3U4ZA 3GTQB 4HIDA 2NWGA 1D7QA 4DXGA 1BCPD 1ILQA 3J80c 4DR1Q 4X3UA 2OXPA 2ALYB 3F1ZA 4A3MH 5FLMH 3CQZB 2AQ3B 3HP3A 1G2TA 1XNQQ 3J81E 1K83H 1HZBA 2RHQB 3LNNA 5M3MB 2A68D 2F0UA 4KHVA 1O7LA 2UXCL 3EVQA 4BA2I 4DR2Q 1EYDA 2MO0A 4ZAIA 5A35A 1EY8A 1H9SB 5HY6A 3S16B 3OIQA 2OQKA 4LFBL 3QG1A 5IT9L 5KNCA 5JVH3 3H3VC 3BJUA 2D2CC 4KTAA 1C8CA 3PUWA 4DUZL 1L0XB 2IHFA 4DKAC 4DV6L 5D3IB 5I9PA 1S5BD 5C44G 3BVGA 2UXDL 4A3FH 2RCNA 2PQAB 5I6WA 1NJIC 2JA8H 3J7AV 2RBMA 4YCWA 1GHKA 2O5IC 3Q6SA 4DNTB 3J81i 4X6AH 1HH2P 2ZM6L 3FKIH 1NMFA 1YJNA 2QCPX 3OTOQ 3URYA 3UE0A 1DGSA 4JC0A 2RSOA 2K04A 1L1OA 1TKWB 4JBMA 3KLSA 1WTRA 4JI3Q 1V1OA 3M4QA 1P8LA 1HA6A 3CCSA 1QCBD 2RHSB 3Q23A 1WTOA 2Q2HA 2VQEL 3CCVA 2R6GA 2HUGA 1QB5D 3RLOA 1NCVA 2HQLA 1DOKA 1JE4A 2MUYA 1AE3A 2E2IB 3F8TA 3K7AH 1KC8C 2NVYH 5J39A 2BDNA 4DU9A 3VR3A 4K5XA 1EY0A 1YHAA 4GKJQ 1IYJB 1IBML 2WKCA 1L0WA 4GNXB 2IX3A 4YWLA 1X54A 3SK6A 1Z6HA 4A3IB 2VUMH 1Z47A 4GS3A 4HCSA 3OMGA 2K5DA 1J5EQ 1LABA 4WJ4A 1NE3A 3KYHC 5FJ8H 3S24A 2OQ0A 5CORA 4HIMA 3MEFA 1CK1A 1WYDA 2F0EA 4I65A 2PNHA 3MEHA 1PYSB 3GTKH 1QVFA 4BBRB 2NYZD 3NELA 2VXWA 3SK4A 4MZ9A 1L1OC 1SJHD 4BA1I 2PPBC 4DGZA 1HZAA 4OX9L 1GHJA 5CYUA 3GTGH 2NZHA 3S1MB 1KL9A 1ET9A 5C4JB 4K0KL 3ONAB 5ELDA 1GXDC 1OXUA 3VA5A 5HGTA 1QVCA 1GUWA 3EIVA 4QUCA 1EIFA 1BCPF 4BS9A 1F2ZA 3JAME 2XRQD 3SEBA 4JBWA 1CSPA 1X55A 2ZXOA 1K83B 2ZXRA 3DM1A 2UXCQ 2IWHA 2Y0SB 1EQTA 1LACA 1SR3A 4LFBQ 4POFA 1A62A 3KF6B 5GQOA 2F0VA 3H6MA 1VQ6A 1Y1VG 4IALA 1SNOA 3D4WA 3DEOA 4DUZQ 2YTYA 4DV6Q 3S1NH 2F0JA 2R7ZB 3HOWG 4RG1A 3H09A 4J8QA 2UXDQ 4KKTA 2JK8A 3D6CA 3QO2A 2CWAA 4ME3A 4L5TA 4DA2A 2IL8A 4A3FB 2IX1A 3JAMi 3BZCA 3EROA 3M3YB 2HIVA 1YJ9A 1RD9D 3BZDB 4F88A 2JA8B 2ZM6Q 1Q81C 3NPPA 2VNUD 3PF4A 1BXTA 1SYFA 2E2JH 4IFDI 2RF4A 3HKZB 1G8ZD 3P7JA 3CD6A 2PW5A 4TKOB 1YHQA 2F0KA 5IYDG 2VQEQ 4C1NI 1PMRA 2JA5G 1G291 2EY1A 2LKVA 2EYFA 3S2HB 3GP7A 1SN8A 3K7AB 1GOZA 5KYLA 3TP8A 4DV1L 1Q86C 2NVYB 1IBMQ 3Q22A 1IYUA 2NBFA 4X3TA 4DR4Q 3AEVA 3PUZA 1UE6A 3HOZH 3GTMH 1U4PA 3UDFA 2VUMB 1TWHH 5M5YH 5E4WC 1SLJA 1Y1WB 1V9PA 2VB2X 4A3JG 1PA6A 1S5CD 4X65L 1E7ZA 1Q1BA 1JOQA 4LUZA 1SAPA 4GOPA 3S15H 4O42A 2E8GA 1SROA 2F3VA 1VQMA 1EEFD 4A3DG 1UE5A 1HFNA 2IW3A 1QJOA 3E0EA 4X64L 5JAVA 3GTKB 1V43A 4OX9Q 3ND8A 4XQQA 4DXFA 3J80i 1EIHA 5IE8A 4DV0L 1RCVD 2OTLA 4K0KQ 3L9AX 3TP6A 4F7XA 4POGA 4A3BB 3GTGB 1PTOH 3BYTB 4O2DA 5EGTA 1KRSA 1U4RA 1V1PA 4BY1G 2FFKB 2K5HA 1VQIA 3OSOA 1OXSC 4R4CA 3U50C 2R93H 1TWFH 3HRZC 3T13A 2UUCQ 5IGBA 1JJ2A 3HZXA 4G57A 1H9JA 4Z9CB 4CHTB 1NTGA 1NR4A 4RGTA 2PZUA 3A8IE 4NP5A 2A6ED 3CKIB 4DV3L 3BU2A 3UDXA 2K28A 2RDGA 3NTHA 3KBXA 2WV6D 4OO1H 1KAWA 5FLXc 1V8QA 2FMCA 4GOPC 4LF9Q 2K5NA 2D9UA 2XRSD 5LL6X 2F4IA 5G3LF 1YBYA 1XX8A 3FVQA 1EIYB 1WVLA 1PH3A 2L15A 1VF5C 2UUBL 1MJCA 2F0MA 3M7GA 3S1NB 1SNPA 1SYGA 3DWPA 4LWCA 1AW7A 1IL2A 5IYCG 1VQPA 2IX0A 1T5XD 2XSCA 3CCRA 2F0SA 1IKMA 2E74C 3GTOH 3ULLA 4EX5A 4BBSH 4K8IA 5IWAL 3VR5A 3L2PA 5CV6A 2WAQB 2EXDA 3F2CA 3GD7A 4ID6A 4LK1C 1PFBA 2E2JB 1OTCA 4KN7C 1XPOA 4CJ1B 3HOVH 1LLRD 1X3PA 1PRTB 1CKMA 2F52A 1VMPA 4BXXH 1JE5A 1RIPA 4X3SA 5EKLA 2F0FA 4C3IG 2IY5B 1CQVA 4I7ZC 3MFYA 4IOCA 2G9DA 4DN4M 1EQVA 4OWXB 1YNXA 1WD1A 4DV1Q 2B2YA 1EUJA 4EQPA 4B3RL 1TQOA 4PZ6A 2RDHA 1O78A 2WINB 3MTSA 1K3RA 1VQ7A 3KJOA 4HEDA 3A5UA 2D5DA 2EYHA 1J8IA 4C3HG 4A3GG 4O1NA 1H9SA 3HFZB 2PZTA 3D3RA 2DUDA 1GO3E 4YWMA 3PO2H 1D6EC 3HOZB 2EYLA 4KJOA 3L0OA 4X65Q 1VF7A 1TWHB 5M5YB 4LF4Q 5CV7A 1EWCA 4ILWA 3RN2A 3A55A 4AIMA 1EZ8A 1ICWA 3S15B 2PQAA 4DV0Q 4RMFA 3DLLA 2OCEA 4KD3A 5C6AA 2EYOA 3NSWA 1WTQA 1G6PA 3VA7A 1PTOB 3AFPA 2MGSA 3VR6A 2Q8IB 3E6ZX 3J80L 1FGUA 2B2YC 5A2QE 2EJMA 2KHJA 2N88A 3HOXH 1CUKA 1W3SA 2NN6H 2F0QA 1A2UA 1VQFA 4R1JA 2B63H 4DV3Q 5FO8B 1SFOH 3QB3A 3T51B 2CKZB 1F9RA 2F03A 3OHXC 4DR5L 5I4DA 5KNBA 1CFMA 1PRTD 4GNXA 1HR0Q 3QJYA 4U673 4AH6A 1GD7A 1PYBA 5JEAG 2SOBA 4QB4A 2NVQH 5DLQE 1E1TA 1SNMA 2UUBQ 3RMHA 2RQXA 1RKNA 4HR7B 4GN5A 1U4MA 3SK8A 2CVRA 2VB3X 4IQZA 4EVOA 1S4ZA 1YZ6A 4WJ3M 1SYEA 2OTJA 3I4OA 4DR1L 4OWTB 2KCTA 2LY7A 1TXYA 1MD2D 3CCQA 1G51A 5IWAQ 4IO9A 1BBWA 1QWYA 1SNCA 4HTHA 2JA6G 1BF4A 1STGA 3EN2A 1JQYD 1JORA 5FO9B 4ZYSA 5E4XA 5IY0A 4DR7L 3K81C 2WB1B 4A3IG 1GUTA 3HOUH 2N55A 4GNXC 1EY9A 5DAUA 2J7ZA 1NBWA 2Q2IA 1IYVA 4B3RQ 1VQ4A 1PTOD 3ULPA 2LS01 5K5PA 2EYPA 1DD2A 1CKOA 2DNCA 3I91A 2D0PA 3PF5A 3CRKC 5IP7G 4RAUC 3FHWA 3KF6A 3A7LA 2I0QA 5J3BA 1VQ8A 2R92H 5ELNA 4BBRG 5IP9H 3PO2B 3PMFA 2KENA 3DHQA 2SEBD 1QE6A 1ML0D 4U68A 1B1ZA 1FNWA 2E76C 4FDBA 4QMGA 4UP7A 3JAMc 3LWUA 3TN2A 3I2ZA 3VR4A 3H3VI 2K05A 2EOTA 1Q82C 2XWBB 3W1GA 4O0AA 1F2YA 1FVIA 4QJFA 2BCOA 1PH7A 1PZJD 2M9VA 3EJIA 1CI3M 2F0OA 2BE5C 2KCNA 2CQAA 3V05A 1DOLA 1CZWA 4JI5L 4HIKA 2Y0SG 1WFQA 3I70A 1PH1A 2Q8RE 3RZDH 4R9WA 3HOXB 3ITPA 2YTVA 2XIWA 3TMEA 1EYGA 2K50A 1HZ9A 2B63B 2X6LA 4WRDA 4C1NK 1LV9A 3UI2A 2B3GA 2KUMA 2R7ZG 4DR5Q 1H9RA 3HS0C 3K57A 1PRTF 1HRJA 4K6LA 3R2TA 4UY8C 3HOYG 1HTLD 3KF8B 4BY7H 4A3FG 5LMUQ 1SYBA 3MXNB 3F2BA 3C1FA 2NVQB 3I3CA 4XYOA 1U9RA 1I6HH 1Z9FA 3STBC 1N8RC 3TQYA 1EY6A 2C35B 1R9TH 4LF6L 2F0PA 2PMZB 2A6EC 5KGUA 3HKZG 2ZJRA 4IPHA 5C0XI 2ZXPA 4K14A 2JQOA 5J22A 1L2FA 5CGKA 4FXDA 2J0TD 4WORA 4MN3A 5D3DA 1JOOA 4IJLA 1G6ZA 3CCLA 2JJQA 1VMCA 4V0BA 3S14H 1Q46A 1FGBD 2E2HH 4ME5A 3RUZA 4DR7Q 1RJTA 1LO5D 4A3LG 1PH6A 1LT4D 2MHVA 1VQDA 2TMPA 3S2DH 4OHJA 3NBIA 1EWIA 4OIKA 3HOUB 1Y1WG 5I9OA 1RTNA 5D65A 4A3EH 3PUVA 2N3SA 4APVA 2ICEC 4DK6C 1FNVA 4FP5D 3PUXA 2GA4B 2JA7G 4B3TL 2K03A 1OO9B 4LF7L 3F2UA 2ZJPA 1AP0A 2MNAA 1M1KC 1OXTA 4OWWB 1M4VA 3EQLC 4PQXA 2R92B 1D8LA 4KI0A 2FXQA 1PZKD 3A56A 1I6VC 1JR0D 4FO2A 1TU2B 1Q1EA 4A3BG 5ELFA 3GO5A 5EKKA 4OIJA 1X3QA 2QGQA 5DM63 5ELCA 3D6WA 2F0HA 4DF7A 3G7LA 1WTWA 1YNJC 1AH9A 1S40A 3SE0A 3P75A 2IT1A 2PW7A 2OWOA 1CQFA 5TSSA 1UNSA 3S1RB 5IYBG 2HIXA 1EOVA 4JI5Q 2H4OA 3MFGA 2OT2A 4DR4L 5HURA 4M8AA 1I4RA 5C0XG 1F9PA 4A76A 3CU7A 4KHPL 2Y0SE 3RZDB 2JEAI 5IGDA 4LUOA 5FKAC 4RCOA 1ILPA 5C4XG 3I7FA 1H95A 1CA6A 3CF5A 4XT1B 3GQBA 4HMJA 1IHZA 4RCNA 1X56A 5FLXL 3J81j 1VQEA 2LXJA 1I4QA 1YEZA 3AU7A 3QOJA 4JI8L 1IXRA 3BYYB 4AYBB 3VYRA 3AYHB 4BY7B 5C44H 1QZGA 4RWSC 4CBVA 2HCIA 1PH5A 3A8KE 2VQFL 3GTLH 1QNUA 1HQMC 1QOHA 4LF6Q 3OPOA 5JJIA 4A3KH 5DM73 2WAQG 4FXKC 3D4RA 3CXCA 1R9TB 1B7YB 4KLKA 5JJKA 3OIPA 1NR2A 2UUCL 4A3MB 3HKZE 1AZPA 1JWSD 3SK5A 1NMGA 1PRTC 1U4LA 1LTID 1BR9A 1KD1C 2KEDA 5IGFA 3BDLA 4DAVA 1L0YB 3S14B 2E2HB 2V1CC 4LMQD 3J7AF 2Q2UA 1YITA 1ZKOA 1EL0A 3G4SA 1VQAA 1XPRA 4LF9L 3H94A 2IJ0A 3I4MH 1ZYRD 3S2DB 3HOZG 2DY7A 1CA5A 3AQQA 1W6KA 3BG3A 1YI2A 3R3OA 3OMCA 2OF1A 5DNFA 1ZXTA 2KOLA 1J6QA 4RHSA 4B3TQ 1SE8A 3RD4A 5EJWA 4YIJA 4UPAA 4LF7Q 1S72A 1XYIA 1LUZA 3S17H 2XWJB 4DV2L 3MA2B 3OWFA 1VQKA 4C2MH 3FKIB 4FF2A 5GAHC 3CW2C 4NPSA 2E5LL 4FYDA 5C3EG 1ESFA 4ABNA 1VS0A 3J81L 3NWSA 1K9MC 2AHOB 1PTOC 4JBKA 1PVOA 2CW0D 4J1MA 4EGVA 2AQ1B 2BA1A 5F2DA 1VQOA 1LM0A 5ELBA 1ZEQX 5C5MA 3OWEB 2KCCA 2CWPA 1XXGA 1STEA 1B9MA 2CHBD 1PHJA 1CHPD 1DOMA 1TS4A 4KHPQ 1RL2A 2EXZA 4KD4A 3HG9A 2BE5D 3M4OH 2A74C 1GKHA 4LF4L 2KCMA 2F0NA 5JJZA 3K59A 2LXKA 4QF4A 4PZ8A 3T16A 1X3EA 5LMNQ 2EY6A 5M9OA 4YWKA 1B70B 1M8AA 4JI8Q 3E9HA 4C3JG 4DR6L 3PIPA 5K36G 2PYKA 3TZDA 3HOWH 1LTRD 3VYSA 5IOCA 1D1KA 3Q0AA 2VQFQ 5CBEE 3PGZA 4HJ9A 3PIOA 1STHA 3I4NG 3IKJA 4ZQ3A 4DAPA 1SE2A 1V1QA 3R8BA 3GTLB 1YJWA 1FJGL 4IFDJ 1K73C 4A3KB 3ND9A 3WOFA 4DK1A 1Q7YC 2WAQE 3ZJYC 2A1AA 4QIWB 5H1SE 1I4GA 3T1HL 1EQQA 3STBD 5JPNC 4IZ8A 5CC4A 4GKKL 5IYDH 2KQ3A 5D14A 1JMCA 4HSPA 2JA5H 4B08A 2RDFA 4JOIA 4XYQA 4DK0A 3PIO3 4OL7A 4LW1A 4F8MA 3PO3H 3CC4A 1YNND 5IGCA 4KV6A 1CZGA 4QUFA 1HR0L 2Z4HA 1E2VA 2Q2TA 1QVGA 2VW9A 2OEOA 1RDPD 3I4MB 4CKCA 1GUSA 3PO2G 4IUQA 1WTXA 2K14A 3UDIA 1I4XA 1TY2A 2DN8A 1I94L 4RFBA 4RH6A 2O5JC 3A5ZB 2EIFA 5ELEA 1EYAA 4A3JH 5IIFA 4JG2A 3A8JE 2YV5A 1DXMA 1IBLL 4DV2Q 1DZ1A 3N52A 1Q3LA 2L4NA 3KF8A 1D2BA 2K32A 2I5MX 3TP7A 3S17B 1SMYD 5HGQA 4A3DH 2KHSA 3MXNA 5JPMC 1A8VA 4C2MB 1W2BA 4F87A 1BBXC 2E5LQ 3JAML 2VS1A 2EYMA 2MJ8A 3K8AA 3RNUA 2ZT9C 4C56C 4B3ML 2K01A 4IUUA 4DNRB 4JOIC 1FNUA 4IUVA 1F2LA 3D4DA 4JI7L 4L5QA 4P2CB 1BUVT 4FF4A 3M9BA 1JC7A 2XTIA 4L5SA 1PDQA 3QOLA 4BY1H 2R3ZA 1D5ZC 4KHZA 4ZUJA 3NWTA 2B63G 1SE3A 1RHPA 2SDFA 2C9OA 1YNJD 2AKWB 4EQOA 5C5LA 3E0JA 3GTMB 3ICEA 3FRPB 4IFDH 4DAMA 4XQNA 1AE2A 1TS5A 3M4OB 1I50H 1E0BA 4MTNA 1WD0A 3K0XA 4RGMA 1K0RA 4L63B 1JCKB 1VQLA 4DR6Q 1BO0A 4L6TB 4AQYL 5AJ3L 3LGJA 4LUVA 1B3AA 2JEBI 1EOTA 4E6IA 5T1IA 3GTJH 1M90C 5EKIA 1N9WA 4A3CG 2X69A 1O7YA 2WP8J 3GTPH 3KLSX 4TRDA 5M3MG 1Z7TA 5C4ZA 3L3OC 5IYCH 1FJGQ 1EQRA 4RGNA 4NKLA 3I56A 3DWQA 4YHHL 2RVLA 3T1HQ 1TWGH 2R93B 1MJEA 1TWFB 4WFN3 4V190 2F3IA 3KLWA 2EJGC 3ERQA 3MHBA 4JI0L 3BZKA 3L7ZC 5JEAJ 1JOKA 4GKKQ 1JICA 1TWAH 2K75A 4QQBX 3FDTA 3CMAA 1EY5A 1DONA 4KJNA 2K6AA 5CMDA 5IODA 2Z8LA 1YVCA 2L55A 2SNMA 1HNXL 3NBHA 3PO3B 4UP9A 4B9XA 1LTSD 2QILA 2Z1CA 4YY3L 4IPGA 1Y14B 1HR0W 2VY3A 4JV5L 5IT9E 5LMUL 3GV6A 1QNKA 5CV9A 5T1GA 2R92G 3CCMA 1I94Q 5IP9G 2H1EA 2KJXA 5E1FA 3T53B 2KHIA 1PH8A 4ODGA 1MKHA 3SVMA 1EWHA 1CKNB 1IBLQ 1A0IA 4HJAA 1TS2A 5C3XA 3CHBD 1PV4A 5M3FH 4R4IA 1WI5A 4DAYB 5JVG3 2R7FA 4DV4L 1I3QH 3GTOB 3UE1A 1TWCH 2YYZA 4GLXA 2L5TA 3K80C 3I4LA 4BBSB 1C48A 3FPUB 3GTQH 4A3DB 1EFWA 1ZYRC 4B3MQ 4KMUC 5KNDA 2NVTH 1IZ6A 3HOVB 1E22A 1EU3A 3CQZH 2NZOA 2Z0SA 4NXMQ 2WIIB 4JI7Q 1TT2A 1HA5A 1HJPA 2GVAA 1FYCA 1A2TA 5CBAE 1RTOA 1UUPA 4CJ0B 4J15A 5I2YA 1HFGA 2XGTA 1QG7A 4ZRZA 3QIAA 3SDZA 1K8AC 3VR2A 5I2XA 3HEJA 3J7A5 2M2LA 3K58A 1ENFA 1E2ZA 2A73B 3K0YA 4L8JA 1Q90A 3MC0B 3KK7A 2A69C 1CSQA 3TEHB 1JWMD 4K2LA 3B6YA 4LAAA 1WTVA 4FF1A 4ZLTF 1LTLA 4MIUA 3NQIA 5COYA 4X62L 2CW0C 3C1EA 1A3UA 1I50B 4ZKCB 3OOCA 1BCPB 5JEAH 3S1QH 4AQYQ 2DGYA 5AJ3Q 4Q5VA 5KRUA 1MSHA 1S5FD 3TS0A 2ID0A 3CCJA 2PMZE 3GTJB 3NEMA 4A3MG 5FLMG 3K6OA 2JYOA 1MIUA 3GTPB 3K5NA 4YHHQ 3HKSA 5GAEC 3RLNA 4QGUA 4FXGC 4HSVA 3U9OA 2PI2A 3FP9A 2JA6H 3IFDA 1KDAA 1LTBD 3LX0A 1IKLA 2DNEA 4JI0Q 2KEEA 3WOEA 1TWGB 5M5XH 3TZUA 3C3LA 4PMBA 1HHVA 1SFOB 3U9SA 3PCOB 1TWAB 5I6YA 4IJHA 4GLVB 3I55A 1JB7A 1HNXQ 4ULLA 4DV7L 1SBBB 2K1BA 1T9HA 1WCMH 4YY3Q 2NVXH 4JV5Q 2C5CA 2MPMA 2PNRC 5E7NA 1O7ZA 2ICIA 1LT5D 1D5XC 4MNOA 2JA8G 4R8NA 1KAAA 2UXBL 1GJXA 2N78A 5C4HA 5IP7H 3C46A 4IPDA 3DUZA 3TDQA 3SXHA 3FKIG 4BBRH 3VYTA 3TSSA 2XNAC 2AWOA 4K8JA 4P73A 2CFMA 1KLUD 3E9IA 5FK9C 1VQCA 4DV4Q 4XT3B 3S1MH 4HMIA 1TY0A 1DJRD 1VQNA 3SR1A 5M3FB 1AZQA 1YNNC 2A6HD 2M00A 2F3WA 2L11A 1TWCB 3H0GH 3I73A 3UDGA 4LNQA 2SNSA 1BKBA 2UUAL 5A2QL 2HHHL 1ET6A 4LFAL 2F4VL 3F2DA 4EQNA 3M4PA 4NXNQ 3DM3A 1B50A 2NVTB 2F0GA 1LTGD 3KDFB 1UE1A 3RLFA 4OONA 2VUMG 2BOSA 1A15A 4DPGA 4FNFA 4NB3A 1Q12A 3W3AA 1PTOF 4EQ5A 2NUCA 1KTKA 4KY7A 2YU9H 2QF7A 5FJ8G 2A19A 1EY7A 1SMYC 4IURA 3NQTA 5BN4A 4UP8A 1SJED 3M7NA 1STBA 3CRLC 1VQ9A 5LHY1 2R7ZH 5GROA 4TSSA 1STYA 1IL8A 4X62Q 4LFCL 2QEJC 4AYBE 3BVZA 1X65A 3HOYH 1B8AA 1RF2D 1HQRD 1B44D 2B2UA 2EJFC 2PZWA 5LL6S 1AN8A 3S1QB 4IN3A 3CPFA 2EYJA 3M3YH 4OGQC 4R4TA 4A93H 2L9HA 3BDCA 1EFID 4A3KG 3H91A 2FINB 3GV3A 2AMCB 1SDFA 1D1IA 5C0XJ 3EFXD 4HCEA 3OW2A 2ES2A 2K5VA 1UAPA 3D0FA 1KNAA 4R4OA 3CCUA 2K7VA 1NUCA 1G2SA 3CMEA 2GN5A 4HN7A 5EBCA 3NBHB 2K4KA 1A63A 1OXVA 2B2TA 2Z4IA 4HJ8A 1N36L 2JA6B 3S2HH 1JJCB 1I4PA 3NTKA 4GZYC 2VZAA 2B29A 4P72A 1PH4A 5M5XB 1E1OA 3H3VH 3N6RA 2K5WA 3VYUA 3TREA 1PH9A 5KEEA 3I4MG 1X3FA 2RA4A 4A3LH 4QL5A 1Q8KA 3TBIB 4G4KA 1I4HA 1W6JA 2VL6A 2QEXA 2JXMB 4DV7Q 5LMNL 1C9OA 2BH8A 2B2VA 1Y1WH 1LT3D 4DR3L 2B2UC 5GAGC 4H44C 1Q8IA 1WCMB 2NVXB 1F77A 3P20A 1A3VA 2NB0A 5E3FA 3DEPA 4OXPA 2UXBQ 1VQGA 3WWVA 2JA7H 1DM0B 1HCZA 1G91A 3A74A 4JI6L 3NTIA 1X6OA 1I6HB 1P16A 3U58A 3W5OA 4IOAA 2MQHA 3KUPA 4JK1C 4XQJA 4OO1I 3VDYA 4PG3A 4A3BH 2PI2E 2B2TC 1ASZA 2UUAQ 2HHHQ 2A8VA 2EY5A 2ZTEA 3H0GB 4LJZC 4LFAQ 2JP1A 2F4VQ 3BS1A 2I5HA 4R4QA 1CT1D 4K5WA 1ENAA 4N9TA 1KQSA 2IHEA 3T4AC 1KHIA 2F0TA 4RA8A 3MXGA 3D31A 4R8IA 5IYBH 3MWYW 2B2VC 1R4PB 3A0JA 3T1YL 1VQBA 2B39A 4XTCS 5C0XH 4P74A 4A3EB 1EIGA 4A75A 3RN5A 2GVBA 4CJ2C 3ULJA 2K52A 2YU9B 3PUYA 3LWEA 4RHRA 4KKSA 1HUNA 1X3GA 2AUJD 2QDBA 1O7IA 1PYWD 5G3LD 4IUPA 2I5LX 5C4XH 4B9WA 2G9HD 1STAA 5M5WH 1F9QA 4LFCQ 4L5RC 1IW7C 1HNZL 1IBKL 2RKSA 3BDOA 1N33L 2A69D 3HOYB 1N32L 1K8OA 3CC7A 3O13A 1CKNA 2FHTA 1PXUA 4A93B 2PQEA 3JC66 1VDZA 4KK7A 1A6XA 4Y7NH 2R93G 1SXTA 2EZVA 4DAYA 1F9SA 2EDGA 1FD7D 4LF5L 1EU4A 4QIWE 2EQSA 3RZOH 1CM9A 3R2IA 1SNQA 5EBDA 1J9OA 2FJ2A 4PV1C 2CCZA 4JYAL 2R61A 1UE7A 1N36Q 5GADC 3J80E 4RKBA 4RKLA 2D62A 5IT9c 4OO1G 4JI2L 4IUNA 1HPCA 3PO3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV A;  3I2Z A;  3K0X A;  2R6G A;  3H3V I;  3RLO A;  1K0R A;  1Q82 C;  1E3P A;  2HQL A;  1VQL A;  3W1G A;  1AE3 A;  3F8T A;  3IRB A;  4O0A A;  3K7A H;  4DR6 Q;  1FVI A;  4QJF A;  1KC8 C;  2NVY H;  1Y1V H;  4AQY L;  5AJ3 L;  3LGJ A;  4LUV A;  2JEB I;  1PH7 A;  1YHA A;  4GKJ Q;  3GTJ H;  1IYJ B;  4DR3 Q;  1M90 C;  1L0W A;  4GNX B;  1IBM L;  4YWL A;  1X54 A;  4GN4 B;  5LMN W;  1N9W A;  4A3C G;  2VUM H;  1Z47 A;  2WP8 J;  4GS3 A;  3GTP H;  4IPC A;  5M3M G;  4JI5 L;  5IYC H;  4HIK A;  2Y0S G;  1FJG Q;  1J5E Q;  1WFQ A;  4JI6 Q;  1NE3 A;  1EQR A;  3KYH C;  4WJ4 A;  2NN6 I;  1PH1 A;  3RZD H;  3I56 A;  2JA9 A;  4YHH L;  5FJ8 H;  1N34 L;  3S24 A;  4BBS G;  4GLA C;  2OQ0 A;  3T1H Q;  1TWG H;  1K8G A;  4HIM A;  1MJE A;  2YTV A;  4GN3 B;  3MEF A;  2LSS A;  4JI1 L;  2F3I A;  3KLW A;  1EYG A;  1WYD A;  2K50 A;  1HZ9 A;  4ALP A;  4JI0 L;  2PNH A;  1I5F A;  3BZK A;  3L7Z C;  5JEA J;  3RR5 A;  4B3S L;  2B3G A;  1PYS B;  1FL0 A;  3M85 A;  1QVF A;  3GTK H;  3HOV G;  4GKK Q;  3NEL A;  1TWA H;  2R7Z G;  4DR5 Q;  4BXX G;  1OXX K;  1PFS A;  4MZ9 A;  1L1O C;  4BA1 I;  2K75 A;  2WB1 G;  4QQB X;  1HZA A;  4OX9 L;  3CMA A;  4UY8 C;  3HOY G;  3GTG H;  2NZH A;  5C3E H;  3KF8 B;  1KL9 A;  4TQU S;  1XNR L;  4BY7 H;  1YVC A;  4K0K L;  4HIO A;  4A3F G;  1OXU A;  5LMU Q;  1HNX L;  3MXN B;  3F2B A;  4UP9 A;  4P75 A;  1VQ5 A;  1QVC A;  4YY3 L;  3EIV A;  4IPG A;  1Y14 B;  1EIF A;  1I6H H;  1HR0 W;  1QUQ A;  2VY3 A;  4JV5 L;  5LMU L;  3NEN A;  1KXL A;  1Z9F A;  3STB C;  3CCM A;  3TQY A;  1N8R C;  2HT1 A;  1I94 Q;  2C35 B;  5IP9 G;  3CCE A;  3T1Y Q;  1R9T H;  4LF6 L;  2KHI A;  4JBW A;  1CSP A;  3HKZ G;  1PH8 A;  2ZJR A;  1X55 A;  4IPH A;  1MKH A;  5C0X I;  4IFD G;  1XMO L;  1CKN B;  2UXC Q;  2JQO A;  1L2F A;  1IBL Q;  1A0I A;  4HJA A;  1PV4 A;  5M3F H;  4R4I A;  1WI5 A;  4DAY B;  2R7F A;  1SR3 A;  4H02 A;  4IJL A;  2JJQ A;  4TVA B;  1I3Q H;  4DV4 L;  3J7Z C;  3CCL A;  3UE1 A;  1TWC H;  1A62 A;  2WFW A;  2YYZ A;  3K80 C;  3KF6 B;  5GQO A;  4A4I A;  4POF A;  4GLX A;  3S14 H;  1Q46 A;  3CPW A;  2E2H H;  1VQ6 A;  3GTQ H;  5ELO A;  1HNZ Q;  5JJI A;  1Y1V G;  1EFW A;  4DR7 Q;  1HNW L;  1C0A A;  1IBK Q;  1L1O B;  1SMX A;  1PH6 A;  4A3L G;  4DUZ Q;  4B3M Q;  1VQD A;  4C3J H;  2NVT H;  1IZ6 A;  2YTY A;  1N33 Q;  1E22 A;  3S2D H;  4DV6 Q;  3CQZ H;  3ER0 A;  3S1N H;  2NZO A;  2Z0S A;  1EWI A;  4NXM Q;  4JI7 Q;  3HOW G;  4RG1 A;  1N32 Q;  2UU9 L;  1Y1W G;  2UXD Q;  1HJP A;  2GVA A;  2JK8 A;  4A3E H;  4NXM L;  3PUV A;  2N3S A;  1WOC A;  2CWA A;  4L5T A;  4J15 A;  4ME3 A;  4APV A;  4DK6 C;  3I4N H;  3PUX A;  2IX1 A;  3JAM i;  2XGT A;  3BZC A;  3CC2 A;  2HIV A;  4LF5 Q;  1YJ9 A;  2JA7 G;  1K8A C;  3HOX G;  4B3T L;  4LF8 L;  2ZM6 Q;  1Q81 C;  3J7A 5;  2NN6 G;  1ASY A;  4LF7 L;  2ZJP A;  4HJ7 A;  4YCV A;  3G71 A;  2VNU D;  1XMQ L;  2MNA A;  1M1K C;  1OXT A;  4OWW B;  3PF4 A;  3G6E A;  1D8L A;  4JYA Q;  1SRU A;  4KI0 A;  2E2J H;  1NY4 A;  2ZTC A;  2FXQ A;  4IFD I;  2RF4 A;  1CSQ A;  3TEH B;  4X66 L;  3CD6 A;  3B6Y A;  4JBJ A;  4JI2 Q;  1Q1E A;  1YHQ A;  4A3B G;  3GO5 A;  1LTL A;  5IYD G;  2VQE Q;  3KDF A;  1E24 A;  2JA5 G;  2QGQ A;  1G29 1;  4X62 L;  2ZTD A;  1LYL A;  2YTX A;  1S3O A;  3S1Q H;  3CAM A;  4AQY Q;  2DGY A;  5AJ3 Q;  1SN8 A;  1AH9 A;  1S40 A;  4DV1 L;  1Q86 C;  1IBM Q;  2IT1 A;  3TS0 A;  2OWO A;  2BH2 A;  4DR4 Q;  2ID0 A;  3CCJ A;  3AEV A;  4DNI A;  1KIX A;  2PMZ E;  3NEM A;  3PUZ A;  5FLM G;  4A3M G;  5IYB G;  2HIX A;  1UE6 A;  3HOZ H;  1EOV A;  3GTM H;  3UDF A;  4JI5 Q;  1MIU A;  1TWH H;  4DR4 L;  5M5Y H;  1SLJ A;  1V9P A;  4A3J G;  5C0X G;  5M3F G;  4HJ5 A;  4YHH Q;  1PA6 A;  1N34 Q;  4X65 L;  1E7Z A;  3HKS A;  4A76 A;  3PO3 G;  5GAE C;  1Q1B A;  3RLN A;  4LUZ A;  4QGU A;  4KHP L;  2Y0S E;  3TS2 A;  2PI2 A;  3FP9 A;  5BR8 L;  2JEA I;  4JI1 Q;  2JA6 H;  4LUO A;  4X64 Q;  4GOP A;  4JI0 Q;  3S15 H;  1VCI A;  4P71 A;  2E8G A;  4B3S Q;  1SRO A;  5M5X H;  1VQM A;  3J81 c;  1UE5 A;  4A3D G;  5C4X G;  3E0E A;  3I7F A;  4X64 L;  1H95 A;  3CF5 A;  1V43 A;  4OX9 Q;  1X56 A;  3PCO B;  3J81 j;  1VQE A;  3J80 i;  2LXJ A;  5IE8 A;  4DV0 L;  1YEZ A;  1XNR Q;  2OTL A;  4JI8 L;  4K0K Q;  4IJH A;  3HOU G;  1IXR A;  2WB1 E;  4POG A;  4GLV B;  3I55 A;  3AYH B;  1JB7 A;  1HNX Q;  4C3I H;  1XPU A;  1VQJ A;  4DV7 L;  4O2D A;  1T9H A;  1WCM H;  4YY3 Q;  5C44 H;  1QZG A;  2NVX H;  2KBN A;  2Z6K A;  3U4V A;  4JV5 Q;  1KRS A;  2R7D A;  4JCV E;  3G48 A;  1PH5 A;  4BY1 G;  2VQF L;  5E7N A;  2K5H A;  3GTL H;  5EAY A;  1VQI A;  1OXS C;  4R4C A;  1VQH A;  3U50 C;  1TWF H;  4MNO A;  4A3K H;  2UUC Q;  2MO1 A;  4LF6 Q;  1JJ2 A;  2WAQ G;  2N78 A;  2JA8 G;  2UXB L;  5IP7 H;  3CXC A;  1JJG A;  1NTG A;  4IPD A;  1B7Y B;  4KLK A;  3SGI A;  2N49 A;  3CP0 A;  1XMO Q;  5JJK A;  4C3H H;  3FKI G;  4BBR H;  4A3G H;  1BVS A;  2UUC L;  2AWO A;  4P73 A;  2CFM A;  3HKZ E;  4DV3 L;  3BU2 A;  3UDX A;  3E9I A;  4LFB Q;  1NMG A;  1U5K A;  1VQC A;  4DV4 Q;  4DUY L;  3S1M H;  2CQO A;  1VQN A;  1KAW A;  1KD1 C;  2MFI A;  5FLX c;  4GOP C;  4LF9 Q;  3H0G H;  3UDG A;  4JI4 L;  4LNQ A;  1BKB A;  3KJP A;  2K5N A;  3KFU A;  1HNW Q;  4DV5 L;  2UUA L;  2V1C C;  2HHH L;  1YBY A;  2Q2U A;  1YIT A;  4LFA L;  1EIY B;  3G4S A;  1VQA A;  3F2D A;  3W1B A;  1XPR A;  4LF9 L;  2F4V L;  1PH3 A;  3M4P A;  1XJV A;  4NXN Q;  2L15 A;  3DM3 A;  2UU9 Q;  3I4M H;  1QZH A;  1MJC A;  2UUB L;  3KDF B;  3HOZ G;  3AQQ A;  1UE1 A;  3RLF A;  1YI2 A;  3KOJ A;  4A3C H;  1UWV A;  4OON A;  4NXN L;  2VUM G;  1GM5 A;  4PMW A;  4PZ7 A;  1J6Q A;  3PV0 A;  5M3M H;  4DPG A;  4LWC A;  2Z6K C;  4NB3 A;  5IYC G;  1VQP A;  2IX0 A;  4B3T Q;  1SE8 A;  1Q12 A;  1KRT A;  3CCR A;  1IL2 A;  1XNQ L;  4LF8 Q;  4A3L H;  4EQ5 A;  3GTO H;  4UPA A;  4LF7 Q;  1S72 A;  3ULL A;  2YU9 H;  1UEB A;  4EX5 A;  5FJ8 G;  1XMQ Q;  4BBS H;  2A19 A;  5IWA L;  3S16 H;  1LUZ A;  3S17 H;  4DR2 L;  3L2P A;  4DV2 L;  2BA0 A;  4UP8 A;  2EXD A;  3M7N A;  3F2C A;  3GD7 A;  3EBE A;  4X66 Q;  1VQK A;  4C2M H;  1OTC A;  1XPO A;  1VQ9 A;  3HOV H;  1CKM A;  2F52 A;  3ERS X;  5GRO A;  2R7Z H;  4BXX H;  1JE5 A;  4DK3 C;  2H5X A;  1RIP A;  4X62 Q;  4LFC L;  5GAH C;  5JJL A;  3CW2 C;  4NPS A;  2E5L L;  4QY7 A;  4AYB G;  4AYB E;  2IY5 B;  1X65 A;  5C3E G;  1WCM G;  4GOP B;  3HOY H;  4BY7 G;  1B8A A;  1VS0 A;  4IOC A;  1K9M C;  2AHO B;  4JBK A;  3CPF A;  4OWX B;  1YNX A;  2QA4 A;  3M3Y H;  1PVO A;  4DV1 Q;  4R4T A;  4A93 H;  1EUJ A;  4A3K G;  2ZJQ A;  4B3R L;  4PZ6 A;  2AMC B;  2BA1 A;  1K3R A;  1LM0 A;  3Q8D A;  1VQO A;  1VQ7 A;  5C0X J;  3KJO A;  3OW2 A;  3A5U A;  2ES2 A;  2K5V A;  4A3G G;  2CWP A;  3D0F A;  3HFZ B;  4R4O A;  3CCU A;  2DUD A;  1GO3 E;  4YWM A;  2D0O A;  3PO2 H;  1PHJ A;  3L0O A;  4X65 Q;  3PSI A;  3CME A;  2GN5 A;  1RL2 A;  4KHP Q;  4LF4 Q;  3OTO L;  3NBH B;  2K4K A;  1A63 A;  5BR8 Q;  1OXV A;  1YIJ A;  3RN2 A;  3M4O H;  1GKH A;  4JI3 L;  3H0G G;  1QUQ B;  4HJ8 A;  1N36 L;  4LF4 L;  2KCM A;  1JJC B;  3S2H H;  4AIM A;  2ATW A;  2VZA A;  2B29 A;  2LXK A;  3K7U C;  4YCU A;  4P72 A;  1PH4 A;  2ASB A;  2E2I H;  1E1O A;  2AWN A;  4PZ8 A;  1X3E A;  4XIG S;  1XTD A;  5LMN Q;  3H3V H;  3TRE A;  1PH9 A;  2PQA A;  4YWK A;  4DV0 Q;  3I4M G;  1X3F A;  1B70 B;  4QL5 A;  4RMF A;  1GVP A;  1Q8K A;  2OCE A;  3E9H A;  4JI8 Q;  3DLL A;  3S1R H;  4DR6 L;  2VL6 A;  2QEX A;  4DV7 Q;  3PIP A;  1C9O A;  5LMN L;  4X6A H;  5K36 G;  2BH8 A;  3HOW H;  1G6P A;  1Y1W H;  4A3I H;  4GKJ L;  1BBU A;  4DR3 L;  3AFP A;  1U0L A;  5GAG C;  4A3E G;  2VQF Q;  3PGZ A;  4HJ9 A;  3PIO A;  3I4N G;  1FGU A;  4OXP A;  2UXB Q;  1V1Q A;  1VQG A;  3WWV A;  2KHJ A;  2JA7 H;  1YJW A;  3HOX H;  1CUK A;  3A74 A;  1J5E L;  1W3S A;  1K73 C;  4JI6 L;  1FJG L;  1X6O A;  4IFD J;  1P16 A;  1Q7Y C;  3U58 A;  1VQF A;  2WAQ E;  3ZJY C;  2A1A A;  4R1J A;  3W5O A;  2B63 H;  4IOA A;  1YHB A;  4DV3 Q;  5H1S E;  1PH2 A;  1SFO H;  3T1H L;  2N8N A;  1EQQ A;  3AFQ A;  2MQH A;  3STB D;  3H15 A;  4DUY Q;  2CKZ B;  3GDE A;  1JT8 A;  2R93 H;  4OO1 I;  3VDY A;  4PG3 A;  4A3B H;  2JE6 I;  4GKK L;  2PI2 E;  1C7Y A;  5IYD H;  3OYY A;  4DR5 L;  1JMC A;  1HZC A;  2JA5 H;  3TRZ A;  4GNX A;  1X9N A;  5C4J H;  1HR0 Q;  4JI4 Q;  4AH6 A;  4JOI A;  1GD7 A;  1ASZ A;  4DV5 Q;  2UUA Q;  1PYB A;  2HHH Q;  5JEA G;  2A8V A;  2ZTE A;  4LW1 A;  4A93 G;  4LFA Q;  3CC4 A;  3PO3 H;  4Y52 H;  2F4V Q;  2NVQ H;  1HR0 L;  2I5H A;  5DLQ E;  4R4Q A;  1E1T A;  1WJJ A;  3U4Z A;  2UUB Q;  2Q2T A;  1QVG A;  4HID A;  2VW9 A;  1KQS A;  2IHE A;  2R92 G;  1KHI A;  1D7Q A;  4GN5 A;  3D31 A;  3J80 c;  4DR1 Q;  3PO2 G;  2ALY B;  3F1Z A;  4A3M H;  5FLM H;  5IYB H;  2K14 A;  3UDI A;  1YZ6 A;  3A0J A;  1I94 L;  3T1Y L;  1XNQ Q;  4WJ3 M;  1K83 H;  1VQB A;  2OTJ A;  3A5Z B;  3I4O A;  2EIF A;  4XTC S;  4DR1 L;  4OWT B;  1HZB A;  2KCT A;  2RHQ B;  4A3J H;  4P74 A;  1TXY A;  3CCQ A;  1G51 A;  4JG2 A;  5IWA Q;  1BBW A;  2YV5 A;  4IO9 A;  4A75 A;  3RN5 A;  2GVB A;  2UXC L;  1IBL L;  4DR2 Q;  3ULJ A;  4DV2 Q;  2K52 A;  2MO0 A;  2JA6 G;  4BA2 I;  3PUY A;  3EN2 A;  5HY6 A;  2I5M X;  2OQK A;  1X3G A;  4LFB L;  5HGQ A;  1O7I A;  4A3D H;  2I5L X;  5C4X H;  1A8V A;  5M5W H;  4LFC Q;  1W2B A;  2E5L Q;  4L5R C;  5IY0 A;  2VS1 A;  3BJU A;  1HNZ L;  4DR7 L;  3K81 C;  1IBK L;  3PUW A;  3K8A A;  3RNU A;  4A3I G;  4DUZ L;  4B3M L;  3HOU H;  2IHF A;  4DKA C;  1N33 L;  4GNX C;  4DV6 L;  4JOI C;  4JI7 L;  1NBW A;  4L5Q A;  5C44 G;  1N32 L;  2Q2I A;  3M9B A;  4B3R Q;  1VQ4 A;  3CC7 A;  2UXD L;  4A3F H;  2RCN A;  2XTI A;  1CKN A;  4L5S A;  2PQA B;  4BY1 H;  3ULP A;  3JC6 6;  1CKO A;  4Y7N H;  2R93 G;  4KHZ A;  2D0P A;  1NJI C;  2JA8 H;  4YCW A;  3PF5 A;  5IP7 G;  4LF5 L;  3FHW A;  2B63 G;  3KF6 A;  2AKW B;  2I0Q A;  5J3B A;  4QIW E;  3J81 i;  1HH2 P;  2ZM6 L;  1VQ8 A;  2R92 H;  5ELN A;  4BBR G;  3FKI H;  2EQS A;  5IP9 H;  1NMF A;  1YJN A;  3RZO H;  3OTO Q;  2KEN A;  3UE0 A;  1DGS A;  4JC0 A;  2CCZ A;  3ICE A;  4JYA L;  1UE7 A;  1L1O A;  4JBM A;  4DAM A;  4JI3 Q;  1N36 Q;  5GAD C;  3M4Q A;  1AE2 A;  1P8L A;  4FDB A;  3CCS A;  2D62 A;  5IT9 c;  4OO1 G;  4UP7 A;  4JI2 L;  2RHS B;  3JAM c;  1I50 H;  2Q2H A;  4MTN A;  2VQE L; 
#chains in the Genus database with same CATH topology
 3QWN A;  1AFP A;  2NTS A;  1B4O A;  3FEW X;  4CKB A;  4ZCK A;  1Y69 U;  1ROD A;  1E3P A;  2LFN A;  1MBY A;  3IRB A;  1H9M A;  2ENB A;  1F2M A;  2HDM A;  1Y1V H;  3J7Y W;  1E2W A;  3AMU A;  2L12 A;  2KVM A;  1PLF A;  4DR3 Q;  2B8F A;  4GN4 B;  1STN A;  3MVV A;  5LMN W;  4QCL A;  2HQE A;  5EQ0 A;  4IPC A;  3DWA A;  4UDU C;  1LTA D;  5C44 B;  1X32 A;  4JI6 Q;  5KIX A;  3I90 A;  2NN6 I;  2JA9 A;  4BBS G;  1N34 L;  2JA7 B;  3KBG A;  4GLA C;  3IL8 A;  1K8G A;  2O4X A;  5IGE A;  4GN3 B;  1NAP A;  2LSS A;  4JI1 L;  4N8F A;  2NZ1 D;  4ALP A;  4FVM A;  1I5F A;  3K5O A;  4B3S L;  3RR5 A;  1WTP A;  3R93 A;  3M85 A;  1FL0 A;  3HOV G;  1ENC A;  4BXX G;  1OXX K;  1PFS A;  1HUM A;  2WB1 G;  4KKU A;  3PIP 3;  2Q8T A;  5C3E H;  4TQU S;  1GUG A;  4FF3 A;  1XNR L;  2K33 A;  4HIO A;  3D8G A;  3KLR A;  1FR3 A;  2QKI C;  4P75 A;  1UEA B;  1VQ5 A;  2HDL A;  3C2P A;  1SYC A;  2KA7 A;  4UHV A;  1QUQ A;  1ICF B;  3NEN A;  1KXL A;  5EPK A;  3X3M A;  2HT1 A;  4ZUI A;  3T1Y Q;  4IUT A;  3CCE A;  4PNY A;  3X3N A;  4IFD G;  1XMO L;  1QIL A;  2A6H C;  1MGS A;  2NTT A;  5CV5 A;  4H02 A;  2ATW A;  2EPB A;  4TVA B;  3J7Z C;  4MHE A;  2WFW A;  4A4I A;  3MZ5 A;  4K5V A;  3MAQ A;  3MXP A;  1BCP C;  2MP1 A;  3CPW A;  5ELO A;  1HNZ Q;  2I46 A;  4KY6 A;  5C4X B;  1HNW L;  5M5W B;  1C0A A;  1IBK Q;  1L1O B;  1SMX A;  2X6G A;  2EY2 A;  4C3J H;  1N33 Q;  2F0W A;  4Q0F A;  3ER0 A;  3V96 A;  2AQ2 B;  1XTC D;  4M1U B;  5K36 H;  2A68 C;  1N32 Q;  2AUK A;  2UU9 L;  3NXW A;  4NXM L;  1WOC A;  3I4N H;  5C3W A;  2XVS A;  3CC2 A;  5CV4 A;  4LF5 Q;  3PQI A;  3HOX G;  4Y7N B;  2RCF A;  4LF8 L;  5ISR A;  2NN6 G;  1ASY A;  4HJ7 A;  4YCV A;  3G71 A;  1XMQ L;  2E75 C;  1B53 A;  1ONL A;  3G6E A;  4JYA Q;  1SRU A;  1NY4 A;  2ZTC A;  3SHL A;  3RZO B;  1JB3 A;  5J1Z A;  1SEB D;  5CV8 A;  4X66 L;  4JBJ A;  4JI2 Q;  3K5M A;  1C4Q A;  4BWG B;  3KDF A;  1E24 A;  2ZTD A;  1LYL A;  1Y8P B;  2YTX A;  1S3O A;  3DXJ C;  3CAM A;  4J6H A;  1TS3 A;  3Q24 A;  1Y1V B;  4H0L C;  4CDD C;  2BH2 A;  3S9W A;  4DNI A;  1KIX A;  3W2D A;  3HOW B;  4NDX A;  4XXE A;  4HJ5 A;  5M3F G;  1N34 Q;  4NW2 A;  1TII D;  3TS2 A;  5JOB A;  5BR8 L;  5EPJ A;  4JI1 Q;  4CDF C;  4X64 Q;  4KN4 C;  1MI2 A;  1VCI A;  4P71 A;  4B3S Q;  2L0C A;  1DYQ A;  3J81 c;  3TP5 A;  2E2D C;  1BNZ A;  3ZYY X;  3MXU A;  1EY4 A;  1KAB A;  2B8G A;  3E3X A;  1R4Q B;  1XNR Q;  1Y8O B;  1KNE A;  4HAE A;  3HOU G;  2WB1 E;  1BQQ T;  4C3I H;  5C3E B;  1VQJ A;  4CGY B;  1XPU A;  1KDC A;  2JA5 B;  2KBN A;  2Z6K A;  3U4V A;  2R7D A;  4JCV E;  3G48 A;  2PCF B;  3E5S A;  2F1M A;  5EAY A;  1VQH A;  2MO1 A;  3IAY A;  2LMC B;  1JWU D;  1NSN S;  1JJG A;  1KLG D;  1B3Q A;  3NK9 A;  3SGI A;  3DMU A;  2N49 A;  3CP0 A;  1XMO Q;  4C3H H;  4A3G H;  1BVS A;  4G7H C;  4WJW A;  2FMM A;  3IFT A;  1EEI D;  1U5K A;  2EE1 A;  3NHH A;  4DUY L;  4A3J B;  2CQO A;  3A7A B;  5BN3 A;  1CTM A;  2MFI A;  2J4X A;  3G6J B;  4JI4 L;  3KFU A;  1HNW Q;  4ZKB B;  3KJP A;  4KY5 A;  4DV5 L;  2JSO A;  2L1B A;  2EVB A;  1ESR A;  4UAI A;  5AFW A;  3W1B A;  1XJV A;  4C3J B;  4N9P A;  3AB9 A;  3I72 A;  2UU9 Q;  1QZH A;  1IW7 D;  3KOJ A;  4A3C H;  1UWV A;  4NXN L;  2A5H A;  1GM5 A;  2I07 B;  4PMW A;  4PZ7 A;  3PV0 A;  5M3M H;  4N8X 1;  1MSG A;  2Z6K C;  1XNQ L;  3I4N B;  1KRT A;  2BDO A;  1BDO A;  5FO7 B;  4LF8 Q;  1II3 A;  1UEB A;  1XMQ Q;  4BY1 B;  3S16 H;  4DR2 L;  2B2W A;  2BA0 A;  2HCC A;  1GUN A;  1SND A;  4ZK9 B;  3EA6 A;  3EBE A;  4X66 Q;  1K8M A;  1AEX A;  1LTT D;  2K5Q A;  3ERS X;  1BOS A;  1Y8N B;  4DK3 C;  2H5X A;  5JJL A;  4QY7 A;  4AYB G;  2XN9 C;  4PMC A;  1PZI D;  1WCM G;  2IPK D;  4GOP B;  4BY7 G;  1B2T A;  4H7B A;  1TR5 A;  1HTP A;  2QA4 A;  5KYI A;  2RSN A;  1HXY D;  2ZJQ A;  3Q8D A;  1KDB A;  3P1H A;  5FLX E;  1D5M C;  1S5E D;  2F0L A;  5NUC A;  2TSS A;  5IGG A;  2D0O A;  1SE4 A;  3A54 A;  1EYC A;  2PO4 A;  1H9K A;  3PSI A;  3OW7 A;  3WDN A;  4NMZ A;  1B9N A;  4DFA A;  1V1P B;  3OTO L;  5BR8 Q;  1YIJ A;  1EZ6 A;  3H0G G;  1GUO A;  1QUQ B;  3NP8 A;  4JI3 L;  1T5E A;  2B2W C;  3BVM A;  3K7U C;  3NUC A;  3NE5 B;  4YCU A;  2ASB A;  4K2K A;  2E2I H;  1CHQ D;  2AWN A;  4XIG S;  1XTD A;  4G7O C;  1NNX A;  2KEC A;  1GVP A;  1O80 A;  3M4Y A;  3S1R H;  2F0I A;  2O2L D;  4XDX A;  4S3S A;  4A3I H;  4GKJ L;  1BBU A;  4C3I B;  4RGO S;  1U0L A;  1A3T A;  4A3E G;  4X3K A;  1XWE A;  5CR3 A;  3T56 B;  5FOB B;  1J5E L;  5BN5 A;  1LT6 D;  2F0D A;  2DY8 A;  4K6D A;  1PFN A;  1YHB A;  1PH2 A;  5DEH A;  4C3H B;  3HGB A;  4A3G B;  2N8N A;  3AFQ A;  3H15 A;  1S5D D;  3I8Z A;  4DUY Q;  3GDE A;  3K5L A;  1JT8 A;  4MTK A;  2JE6 I;  3FMC A;  2WAC A;  3FPP A;  1SSO A;  1C7Y A;  3OYY A;  1HZC A;  3TRZ A;  2V4D A;  1X9N A;  5C4J H;  4JI4 Q;  1SYD A;  4DV5 Q;  4CKE A;  1DCZ A;  1TVX A;  4A93 G;  1I3Q B;  2WKD A;  4G7Z C;  4Y52 H;  5EPL A;  4H13 C;  1WJJ A;  3V2T A;  1PFM A;  3U4Z A;  3GTQ B;  4HID A;  2NWG A;  4DXG A;  1D7Q A;  1BCP D;  1ILQ A;  3J80 c;  4X3U A;  4DR1 Q;  2OXP A;  2ALY B;  4OEL B;  3F1Z A;  4A3M H;  5FLM H;  3CQZ B;  2AQ3 B;  3HP3 A;  1G2T A;  1XNQ Q;  3J81 E;  1K83 H;  1HZB A;  2RHQ B;  3LNN A;  5M3M B;  2A68 D;  2F0U A;  4KHV A;  1O7L A;  3EVQ A;  2UXC L;  4BA2 I;  1EYD A;  4DR2 Q;  2MO0 A;  4ZAI A;  5A35 A;  1EY8 A;  1H9S B;  5HY6 A;  3S16 B;  3OIQ A;  2OQK A;  4LFB L;  3QG1 A;  5IT9 L;  5KNC A;  5JVH 3;  3H3V C;  3BJU A;  2D2C C;  4KTA A;  1C8C A;  3PUW A;  4DUZ L;  1L0X B;  2IHF A;  4DKA C;  4DV6 L;  5D3I B;  5I9P A;  1S5B D;  5C44 G;  3BVG A;  2UXD L;  4A3F H;  2RCN A;  2PQA B;  5I6W A;  1NJI C;  2JA8 H;  3J7A V;  2RBM A;  4YCW A;  1GHK A;  2O5I C;  3Q6S A;  4DNT B;  3J81 i;  4X6A H;  1HH2 P;  2ZM6 L;  3FKI H;  1NMF A;  1YJN A;  2QCP X;  3URY A;  3OTO Q;  3UE0 A;  1DGS A;  2QDL A;  2RSO A;  4JC0 A;  2K04 A;  1L1O A;  1TKW B;  3KLS A;  1WTR A;  4JBM A;  4JI3 Q;  1V1O A;  3M4Q A;  1P8L A;  1HA6 A;  3CCS A;  1QCB D;  2RHS B;  3Q23 A;  1WTO A;  2Q2H A;  2VQE L;  3CCV A;  2R6G A;  2HUG A;  1QB5 D;  3RLO A;  1NCV A;  1DOK A;  2HQL A;  1JE4 A;  2MUY A;  1AE3 A;  2E2I B;  3F8T A;  3K7A H;  1KC8 C;  2NVY H;  5J39 A;  2BDN A;  4DU9 A;  3VR3 A;  4K5X A;  1EY0 A;  1YHA A;  4GKJ Q;  1IYJ B;  2WKC A;  1IBM L;  1L0W A;  4GNX B;  2IX3 A;  4YWL A;  1X54 A;  3SK6 A;  1Z6H A;  4A3I B;  2VUM H;  1Z47 A;  4GS3 A;  4HCS A;  3OMG A;  2K5D A;  1LAB A;  1J5E Q;  4WJ4 A;  1NE3 A;  3KYH C;  5FJ8 H;  3S24 A;  2OQ0 A;  5COR A;  4HIM A;  3MEF A;  1CK1 A;  1WYD A;  2F0E A;  4I65 A;  2PNH A;  3MEH A;  1PYS B;  3GTK H;  1QVF A;  4BBR B;  2NYZ D;  4JPB W;  3NEL A;  2VXW A;  3SK4 A;  4MZ9 A;  1L1O C;  1SJH D;  4BA1 I;  2PPB C;  4DGZ A;  1HZA A;  4OX9 L;  1GHJ A;  5CYU A;  3GTG H;  2NZH A;  3S1M B;  1ET9 A;  1KL9 A;  5C4J B;  4K0K L;  3ONA B;  5ELD A;  1GXD C;  1OXU A;  3VA5 A;  5HGT A;  1QVC A;  1GUW A;  3EIV A;  4QUC A;  1EIF A;  1BCP F;  4BS9 A;  1F2Z A;  3JAM E;  2XRQ D;  3SEB A;  4JBW A;  1CSP A;  1X55 A;  2ZXO A;  1K83 B;  2ZXR A;  3DM1 A;  2UXC Q;  2IWH A;  2Y0S B;  1EQT A;  1LAC A;  1SR3 A;  4LFB Q;  4POF A;  1A62 A;  3KF6 B;  5GQO A;  2F0V A;  3H6M A;  1VQ6 A;  1Y1V G;  4IAL A;  1SNO A;  3D4W A;  3DEO A;  4DUZ Q;  2YTY A;  2F0J A;  4DV6 Q;  3S1N H;  2R7Z B;  3HOW G;  4RG1 A;  3H09 A;  4J8Q A;  2UXD Q;  4KKT A;  2JK8 A;  3D6C A;  3QO2 A;  2CWA A;  4ME3 A;  4L5T A;  4DA2 A;  2IL8 A;  4A3F B;  2IX1 A;  3JAM i;  3BZC A;  3ERO A;  3M3Y B;  2HIV A;  1YJ9 A;  1RD9 D;  3BZD B;  4F88 A;  2JA8 B;  2ZM6 Q;  1Q81 C;  3NPP A;  2VNU D;  3PF4 A;  1BXT A;  1SYF A;  2E2J H;  4IFD I;  2RF4 A;  3HKZ B;  1G8Z D;  3P7J A;  3CD6 A;  2PW5 A;  4TKO B;  2F0K A;  1YHQ A;  4C1N I;  5IYD G;  2VQE Q;  1PMR A;  2JA5 G;  1G29 1;  2EY1 A;  2LKV A;  2EYF A;  3S2H B;  3GP7 A;  1SN8 A;  3K7A B;  1GOZ A;  5KYL A;  3TP8 A;  2NVY B;  4DV1 L;  1Q86 C;  1IBM Q;  3Q22 A;  1IYU A;  2NBF A;  4X3T A;  4DR4 Q;  3AEV A;  3PUZ A;  1UE6 A;  3HOZ H;  3GTM H;  1U4P A;  3UDF A;  2VUM B;  1TWH H;  5M5Y H;  5E4W C;  1SLJ A;  1Y1W B;  1V9P A;  2VB2 X;  4A3J G;  1S5C D;  1PA6 A;  4X65 L;  1E7Z A;  1Q1B A;  1JOQ A;  4LUZ A;  1SAP A;  4GOP A;  3S15 H;  4O42 A;  2E8G A;  1SRO A;  2F3V A;  1EEF D;  1VQM A;  4A3D G;  1UE5 A;  1HFN A;  2IW3 A;  1QJO A;  3E0E A;  4X64 L;  5JAV A;  3GTK B;  1V43 A;  3ND8 A;  4OX9 Q;  4XQQ A;  4DXF A;  3J80 i;  1EIH A;  5IE8 A;  4DV0 L;  1RCV D;  2OTL A;  4K0K Q;  3L9A X;  3TP6 A;  4F7X A;  4POG A;  4A3B B;  3GTG B;  1PTO H;  3BYT B;  4O2D A;  5EGT A;  1KRS A;  1U4R A;  1V1P A;  4BY1 G;  2FFK B;  2K5H A;  1VQI A;  3OSO A;  1OXS C;  3HRZ C;  4R4C A;  3T13 A;  1TWF H;  3U50 C;  2R93 H;  5IGB A;  2UUC Q;  1JJ2 A;  3HZX A;  4G57 A;  1H9J A;  4Z9C B;  4CHT B;  1NTG A;  1NR4 A;  4RGT A;  2PZU A;  3A8I E;  4NP5 A;  2A6E D;  3CKI B;  4DV3 L;  3BU2 A;  3UDX A;  2K28 A;  2RDG A;  3NTH A;  3KBX A;  2WV6 D;  4OO1 H;  1KAW A;  5FLX c;  1V8Q A;  2FMC A;  4GOP C;  4LF9 Q;  2K5N A;  2D9U A;  2XRS D;  5LL6 X;  2F4I A;  5G3L F;  1YBY A;  1XX8 A;  3FVQ A;  1WVL A;  1EIY B;  1PH3 A;  1VF5 C;  2L15 A;  2F0M A;  1MJC A;  3M7G A;  2UUB L;  3S1N B;  1SNP A;  1SYG A;  3DWP A;  4LWC A;  1AW7 A;  1T5X D;  2XSC A;  5IYC G;  2IX0 A;  1VQP A;  1IL2 A;  3CCR A;  2F0S A;  1IKM A;  2E74 C;  3GTO H;  3ULL A;  2QW7 A;  4EX5 A;  4BBS H;  4K8I A;  5IWA L;  3VR5 A;  3L2P A;  5CV6 A;  2WAQ B;  2EXD A;  4ID6 A;  3GD7 A;  3F2C A;  4LK1 C;  1PFB A;  2E2J B;  1OTC A;  4KN7 C;  1XPO A;  4CJ1 B;  3HOV H;  1LLR D;  1X3P A;  1PRT B;  1CKM A;  2F52 A;  1VMP A;  4BXX H;  1JE5 A;  1RIP A;  4X3S A;  5EKL A;  2F0F A;  4C3I G;  2IY5 B;  1CQV A;  4I7Z C;  3MFY A;  2G9D A;  4IOC A;  4DN4 M;  1EQV A;  4OWX B;  1YNX A;  1WD1 A;  4DV1 Q;  2B2Y A;  1EUJ A;  4EQP A;  2WIN B;  1TQO A;  2RDH A;  4PZ6 A;  1O78 A;  4B3R L;  3MTS A;  1K3R A;  1VQ7 A;  3KJO A;  4HED A;  3A5U A;  2D5D A;  2EYH A;  1J8I A;  4C3H G;  4O1N A;  4A3G G;  1H9S A;  3HFZ B;  3D3R A;  2PZT A;  2DUD A;  1D6E C;  1GO3 E;  4YWM A;  3PO2 H;  3HOZ B;  2EYL A;  4KJO A;  3L0O A;  1VF7 A;  4X65 Q;  1TWH B;  5M5Y B;  4LF4 Q;  5CV7 A;  1EWC A;  4ILW A;  3RN2 A;  3A55 A;  1EZ8 A;  4AIM A;  1ICW A;  3S15 B;  2PQA A;  4DV0 Q;  4RMF A;  3DLL A;  2OCE A;  4KD3 A;  5C6A A;  2EYO A;  3NSW A;  1WTQ A;  1G6P A;  3VA7 A;  1PTO B;  3AFP A;  2MGS A;  3VR6 A;  2Q8I B;  3E6Z X;  3J80 L;  1FGU A;  2B2Y C;  5A2Q E;  2EJM A;  2KHJ A;  2N88 A;  3HOX H;  1CUK A;  1W3S A;  2NN6 H;  2F0Q A;  1A2U A;  1VQF A;  4R1J A;  2B63 H;  4DV3 Q;  5FO8 B;  1SFO H;  3QB3 A;  3T51 B;  2CKZ B;  1F9R A;  2F03 A;  3OHX C;  5I4D A;  5KNB A;  4DR5 L;  1CFM A;  1PRT D;  3QJY A;  4GNX A;  4U67 3;  1HR0 Q;  4AH6 A;  1GD7 A;  1PYB A;  5JEA G;  2SOB A;  4QB4 A;  2NVQ H;  5DLQ E;  1E1T A;  1SNM A;  3RMH A;  2UUB Q;  2RQX A;  1RKN A;  4HR7 B;  4GN5 A;  1U4M A;  3SK8 A;  2CVR A;  2VB3 X;  4IQZ A;  4EVO A;  1S4Z A;  1YZ6 A;  1SYE A;  4WJ3 M;  2OTJ A;  3I4O A;  4DR1 L;  4OWT B;  2KCT A;  2LY7 A;  1TXY A;  1MD2 D;  1SNC A;  1G51 A;  1QWY A;  4HTH A;  1BBW A;  5IWA Q;  3CCQ A;  4IO9 A;  1BF4 A;  2JA6 G;  1STG A;  1JQY D;  3EN2 A;  1JOR A;  5FO9 B;  4ZYS A;  5E4X A;  5IY0 A;  4DR7 L;  3K81 C;  2WB1 B;  4A3I G;  1GUT A;  3HOU H;  2N55 A;  4GNX C;  1EY9 A;  5DAU A;  2J7Z A;  1NBW A;  2Q2I A;  1IYV A;  4B3R Q;  1VQ4 A;  1PTO D;  2LS0 1;  3ULP A;  5K5P A;  2EYP A;  1DD2 A;  1CKO A;  2DNC A;  3I91 A;  2D0P A;  3CRK C;  4RAU C;  5IP7 G;  3PF5 A;  3FHW A;  3KF6 A;  3A7L A;  2I0Q A;  5J3B A;  1VQ8 A;  2R92 H;  5ELN A;  4BBR G;  5IP9 H;  3PO2 B;  3PMF A;  2KEN A;  3DHQ A;  2SEB D;  1QE6 A;  1ML0 D;  4U68 A;  1B1Z A;  1FNW A;  2E76 C;  4FDB A;  4QMG A;  4UP7 A;  3JAM c;  3LWU A;  3TN2 A;  3I2Z A;  3VR4 A;  3H3V I;  2G5D A;  2K05 A;  2EOT A;  1Q82 C;  2XWB B;  3W1G A;  4O0A A;  1F2Y A;  1FVI A;  4QJF A;  2BCO A;  1PH7 A;  1PZJ D;  2M9V A;  3EJI A;  1CI3 M;  2F0O A;  2BE5 C;  2KCN A;  2CQA A;  3V05 A;  1DOL A;  1CZW A;  4JI5 L;  4HIK A;  2Y0S G;  1WFQ A;  3I70 A;  4R9W A;  2Q8R E;  3RZD H;  1PH1 A;  3HOX B;  3ITP A;  2YTV A;  2XIW A;  3TME A;  1EYG A;  2K50 A;  1HZ9 A;  2B63 B;  2X6L A;  4WRD A;  4C1N K;  1LV9 A;  3UI2 A;  2B3G A;  2KUM A;  2R7Z G;  4DR5 Q;  1H9R A;  3HS0 C;  1K0S A;  3K57 A;  1PRT F;  1HRJ A;  4K6L A;  3R2T A;  4UY8 C;  3HOY G;  1HTL D;  3KF8 B;  4BY7 H;  4A3F G;  5LMU Q;  1SYB A;  3C1F A;  3MXN B;  3F2B A;  2NVQ B;  3I3C A;  4XYO A;  1U9R A;  1I6H H;  1Z9F A;  3STB C;  1EY6 A;  3TQY A;  1N8R C;  2C35 B;  2F0P A;  1R9T H;  4LF6 L;  2PMZ B;  2A6E C;  5KGU A;  3HKZ G;  2ZJR A;  4IPH A;  5C0X I;  2ZXP A;  4K14 A;  2JQO A;  5J22 A;  1L2F A;  5CGK A;  4FXD A;  2J0T D;  4WOR A;  4MN3 A;  5D3D A;  1JOO A;  4IJL A;  1G6Z A;  3CCL A;  2JJQ A;  1VMC A;  4V0B A;  3S14 H;  1Q46 A;  1FGB D;  2E2H H;  4ME5 A;  3RUZ A;  4DR7 Q;  1RJT A;  1LO5 D;  1LT4 D;  1PH6 A;  4A3L G;  2MHV A;  1VQD A;  2TMP A;  3S2D H;  4OHJ A;  3NBI A;  1EWI A;  4OIK A;  3HOU B;  1Y1W G;  5I9O A;  1RTN A;  5D65 A;  4A3E H;  3PUV A;  2N3S A;  2ICE C;  4APV A;  1FNV A;  4FP5 D;  4DK6 C;  3PUX A;  2GA4 B;  2JA7 G;  4B3T L;  2K03 A;  1OO9 B;  4LF7 L;  3F2U A;  2ZJP A;  1AP0 A;  4PQX A;  2MNA A;  1OXT A;  1M4V A;  3EQL C;  1M1K C;  4OWW B;  2R92 B;  1D8L A;  4KI0 A;  2FXQ A;  1PZK D;  3A56 A;  1I6V C;  1JR0 D;  4FO2 A;  1TU2 B;  1Q1E A;  5ELF A;  5EKK A;  3GO5 A;  4A3B G;  4OIJ A;  1X3Q A;  2QGQ A;  5DM6 3;  5ELC A;  3D6W A;  2F0H A;  4DF7 A;  3G7L A;  1WTW A;  1YNJ C;  1AH9 A;  1S40 A;  3SE0 A;  3P75 A;  2IT1 A;  2PW7 A;  2OWO A;  1CQF A;  5TSS A;  1UNS A;  3S1R B;  5IYB G;  2HIX A;  1EOV A;  4I7A A;  2DJG C;  2H4O A;  4JI5 Q;  3MFG A;  2OT2 A;  4DR4 L;  5HUR A;  4M8A A;  1I4R A;  5C0X G;  1F9P A;  4A76 A;  3CU7 A;  4KHP L;  2Y0S E;  3RZD B;  5IGD A;  2JEA I;  4LUO A;  5FKA C;  4RCO A;  1ILP A;  5C4X G;  3I7F A;  1CA6 A;  1H95 A;  4XT1 B;  3CF5 A;  3GQB A;  4HMJ A;  1IHZ A;  4RCN A;  1X56 A;  5FLX L;  3J81 j;  1VQE A;  2LXJ A;  1I4Q A;  1YEZ A;  3AU7 A;  3QOJ A;  4JI8 L;  1IXR A;  3BYY B;  4AYB B;  3VYR A;  3AYH B;  4BY7 B;  5C44 H;  1QZG A;  4RWS C;  4CBV A;  2HCI A;  1PH5 A;  3A8K E;  2VQF L;  1QNU A;  3GTL H;  1HQM C;  1QOH A;  4LF6 Q;  3OPO A;  5JJI A;  4A3K H;  5DM7 3;  2WAQ G;  4FXK C;  3D4R A;  3CXC A;  1R9T B;  1B7Y B;  4KLK A;  5JJK A;  3OIP A;  1NR2 A;  2UUC L;  4A3M B;  3HKZ E;  1AZP A;  1JWS D;  3SK5 A;  1NMG A;  1PRT C;  1U4L A;  1LTI D;  1BR9 A;  1KD1 C;  2KED A;  5IGF A;  3BDL A;  4DAV A;  1L0Y B;  3S14 B;  2E2H B;  2V1C C;  4LMQ D;  3J7A F;  2Q2U A;  1YIT A;  1ZKO A;  1EL0 A;  3G4S A;  1VQA A;  1XPR A;  4LF9 L;  3H94 A;  2IJ0 A;  3I4M H;  1ZYR D;  3S2D B;  3HOZ G;  2DY7 A;  1CA5 A;  3AQQ A;  1W6K A;  3BG3 A;  1YI2 A;  3R3O A;  3OMC A;  2OF1 A;  5DNF A;  1ZXT A;  2KOL A;  1J6Q A;  4RHS A;  4B3T Q;  1SE8 A;  3RD4 A;  5EJW A;  4YIJ A;  4UPA A;  4LF7 Q;  1S72 A;  1XYI A;  1LUZ A;  4CDE C;  3S17 H;  2XWJ B;  4DV2 L;  3MA2 B;  3OWF A;  1VQK A;  4C2M H;  3FKI B;  4FF2 A;  5GAH C;  3CW2 C;  4NPS A;  2E5L L;  4FYD A;  5C3E G;  1ESF A;  4ABN A;  1VS0 A;  3J81 L;  3NWS A;  2DJF C;  1K9M C;  1PTO C;  2AHO B;  4JBK A;  1PVO A;  2CW0 D;  4J1M A;  4EGV A;  2AQ1 B;  2BA1 A;  5F2D A;  1VQO A;  1LM0 A;  5ELB A;  1ZEQ X;  5C5M A;  3OWE B;  2KCC A;  2CWP A;  1XXG A;  1STE A;  1B9M A;  2CHB D;  1PHJ A;  1CHP D;  1DOM A;  1TS4 A;  4KHP Q;  1RL2 A;  2EXZ A;  4KD4 A;  3HG9 A;  2BE5 D;  2A74 C;  3M4O H;  1GKH A;  4LF4 L;  2KCM A;  2F0N A;  5JJZ A;  3K59 A;  2LXK A;  4QF4 A;  4PZ8 A;  1MHW C;  1X3E A;  3T16 A;  2EY6 A;  5M9O A;  5LMN Q;  4YWK A;  1B70 B;  1M8A A;  4JI8 Q;  3E9H A;  4C3J G;  4DR6 L;  3PIP A;  5K36 G;  2PYK A;  3TZD A;  3HOW H;  1LTR D;  3VYS A;  5IOC A;  1D1K A;  3Q0A A;  2VQF Q;  5CBE E;  3PGZ A;  1STH A;  3PIO A;  4HJ9 A;  4ZQ3 A;  3IKJ A;  4DAP A;  3I4N G;  1SE2 A;  1V1Q A;  3R8B A;  3GTL B;  1YJW A;  1FJG L;  4IFD J;  1K73 C;  4A3K B;  3ND9 A;  3WOF A;  4DK1 A;  1Q7Y C;  2WAQ E;  3ZJY C;  2A1A A;  4QIW B;  1I4G A;  5H1S E;  3T1H L;  1EQQ A;  3STB D;  5JPN C;  4IZ8 A;  5CC4 A;  4GKK L;  2KQ3 A;  5D14 A;  5IYD H;  1JMC A;  4HSP A;  4B08 A;  2JA5 H;  2RDF A;  4JOI A;  4XYQ A;  4DK0 A;  3PIO 3;  4OL7 A;  4LW1 A;  4F8M A;  1YNN D;  3CC4 A;  3PO3 H;  5IGC A;  4KV6 A;  2Z6B A;  1CZG A;  4QUF A;  1HR0 L;  2Z4H A;  1E2V A;  2Q2T A;  1QVG A;  2VW9 A;  2OEO A;  1RDP D;  3I4M B;  4CKC A;  1GUS A;  3PO2 G;  4IUQ A;  1WTX A;  2K14 A;  2DN8 A;  1I4X A;  1TY2 A;  3UDI A;  1I94 L;  4RFB A;  4RH6 A;  2O5J C;  3A5Z B;  2EIF A;  5ELE A;  1EYA A;  5IIF A;  4A3J H;  4OEM B;  3A8J E;  4JG2 A;  2YV5 A;  1DXM A;  1IBL L;  4DV2 Q;  1DZ1 A;  3N52 A;  1Q3L A;  2L4N A;  3KF8 A;  1D2B A;  2K32 A;  2I5M X;  3TP7 A;  3S17 B;  1SMY D;  5HGQ A;  4A3D H;  2KHS A;  3MXN A;  5JPM C;  1A8V A;  4C2M B;  1W2B A;  4F87 A;  1BBX C;  3JAM L;  2E5L Q;  2VS1 A;  2EYM A;  2MJ8 A;  3K8A A;  3RNU A;  2ZT9 C;  4C56 C;  4B3M L;  2K01 A;  4IUU A;  4DNR B;  4JOI C;  1FNU A;  4IUV A;  1F2L A;  3D4D A;  4JI7 L;  4L5Q A;  4P2C B;  1BUV T;  4FF4 A;  3M9B A;  1JC7 A;  2XTI A;  4L5S A;  1PDQ A;  3QOL A;  2R3Z A;  4BY1 H;  1D5Z C;  4KHZ A;  4ZUJ A;  3NWT A;  2B63 G;  1SE3 A;  1RHP A;  2SDF A;  2C9O A;  1YNJ D;  2AKW B;  4EQO A;  5C5L A;  3E0J A;  3GTM B;  3ICE A;  3FRP B;  4IFD H;  4DAM A;  4XQN A;  1AE2 A;  1TS5 A;  3M4O B;  1I50 H;  1E0B A;  4MTN A;  1WD0 A;  3K0X A;  4RGM A;  1K0R A;  4L63 B;  1JCK B;  1VQL A;  1BO0 A;  4DR6 Q;  4L6T B;  4AQY L;  5AJ3 L;  3LGJ A;  4LUV A;  1B3A A;  2JEB I;  1EOT A;  4E6I A;  5T1I A;  3GTJ H;  1M90 C;  5EKI A;  1N9W A;  4A3C G;  2X69 A;  1O7Y A;  2WP8 J;  3KLS X;  3GTP H;  4TRD A;  1Z7T A;  5C4Z A;  5M3M G;  3L3O C;  5IYC H;  1FJG Q;  1EQR A;  4RGN A;  4NKL A;  3I56 A;  3DWQ A;  4YHH L;  2RVL A;  3T1H Q;  1TWG H;  2R93 B;  1TWF B;  1MJE A;  4WFN 3;  4V19 0;  2EJG C;  2F3I A;  3ERQ A;  3KLW A;  3MHB A;  4JI0 L;  3BZK A;  3L7Z C;  5JEA J;  1JOK A;  4GKK Q;  1JIC A;  1TWA H;  2Z9H A;  2K75 A;  4QQB X;  3FDT A;  3CMA A;  1EY5 A;  1DON A;  4KJN A;  2K6A A;  5CMD A;  5IOD A;  2Z8L A;  1YVC A;  2L55 A;  2SNM A;  1HNX L;  3NBH A;  3PO3 B;  4UP9 A;  4B9X A;  1LTS D;  2QIL A;  2Z1C A;  4YY3 L;  4IPG A;  1Y14 B;  5IT9 E;  2VY3 A;  1HR0 W;  4JV5 L;  3GV6 A;  5LMU L;  1QNK A;  5CV9 A;  5T1G A;  2R92 G;  3CCM A;  2H1E A;  5IP9 G;  3T53 B;  2KJX A;  5E1F A;  1I94 Q;  2KHI A;  1PH8 A;  4ODG A;  1MKH A;  3SVM A;  1EWH A;  1CKN B;  1IBL Q;  1A0I A;  4HJA A;  1TS2 A;  5C3X A;  3CHB D;  1PV4 A;  5M3F H;  4R4I A;  1WI5 A;  4DAY B;  5JVG 3;  2R7F A;  4DV4 L;  1I3Q H;  3GTO B;  2L5T A;  1TWC H;  2YYZ A;  3I4L A;  3UE1 A;  3K80 C;  4GLX A;  4BBS B;  1C48 A;  3FPU B;  3GTQ H;  2CH4 W;  4A3D B;  1EFW A;  1ZYR C;  4JVZ A;  4B3M Q;  4KMU C;  5KND A;  2NVT H;  1IZ6 A;  3HOV B;  1E22 A;  1EU3 A;  3CQZ H;  2NZO A;  2Z0S A;  4NXM Q;  2WII B;  4JI7 Q;  1TT2 A;  1HA5 A;  1HJP A;  2GVA A;  1FYC A;  1A2T A;  5CBA E;  1RTO A;  1UUP A;  4CJ0 B;  4J15 A;  5I2Y A;  1HFG A;  2XGT A;  1QG7 A;  4ZRZ A;  3QIA A;  3SDZ A;  1K28 A;  3VR2 A;  1K8A C;  5I2X A;  5L37 A;  3HEJ A;  3J7A 5;  2M2L A;  3K58 A;  1ENF A;  1E2Z A;  2A73 B;  3K0Y A;  4L8J A;  1Q90 A;  3MC0 B;  3KK7 A;  2A69 C;  1CSQ A;  4LAA A;  1JWM D;  4K2L A;  3B6Y A;  3TEH B;  1WTV A;  4FF1 A;  4ZLT F;  1LTL A;  4MIU A;  3NQI A;  5COY A;  4X62 L;  2CW0 C;  3C1E A;  1A3U A;  1I50 B;  4ZKC B;  3OOC A;  1BCP B;  5JEA H;  3S1Q H;  4AQY Q;  2DGY A;  5AJ3 Q;  4Q5V A;  5KRU A;  1MSH A;  1S5F D;  3TS0 A;  2ID0 A;  3CCJ A;  2PMZ E;  3GTJ B;  3NEM A;  4A3M G;  5FLM G;  3K6O A;  2JYO A;  1MIU A;  3GTP B;  1K3B C;  3K5N A;  4YHH Q;  3HKS A;  5GAE C;  4HSV A;  4FXG C;  3RLN A;  3U9O A;  4QGU A;  2PI2 A;  3FP9 A;  3IFD A;  2JA6 H;  1KDA A;  1LTB D;  3LX0 A;  1IKL A;  2DNE A;  3WOE A;  2KEE A;  4JI0 Q;  2CH4 A;  1TWG B;  5M5X H;  3TZU A;  3C3L A;  1WTH A;  4PMB A;  1HHV A;  1SFO B;  2JN4 A;  3U9S A;  1TWA B;  3PCO B;  5I6Y A;  2P5Z X;  4IJH A;  4JW0 A;  4GLV B;  3I55 A;  1JB7 A;  1HNX Q;  4ULL A;  4DV7 L;  1SBB B;  2K1B A;  1T9H A;  1WCM H;  4YY3 Q;  2NVX H;  4JV5 Q;  2C5C A;  2MPM A;  2PNR C;  5E7N A;  1O7Z A;  2ICI A;  1LT5 D;  1D5X C;  4MNO A;  2JA8 G;  4R8N A;  1KAA A;  2UXB L;  1GJX A;  2N78 A;  5C4H A;  5IP7 H;  3C46 A;  4IPD A;  3DUZ A;  3QR8 A;  3TDQ A;  3SXH A;  3FKI G;  3VYT A;  4BBR H;  3TSS A;  2XNA C;  2AWO A;  4K8J A;  4P73 A;  2CFM A;  1KLU D;  3E9I A;  5FK9 C;  1VQC A;  4XT3 B;  4DV4 Q;  3S1M H;  4HMI A;  1TY0 A;  1DJR D;  3SR1 A;  5M3F B;  1AZQ A;  1VQN A;  1YNN C;  2A6H D;  2M00 A;  2F3W A;  2L11 A;  1TWC B;  3H0G H;  3I73 A;  3UDG A;  4LNQ A;  2SNS A;  1BKB A;  2UUA L;  5A2Q L;  2HHH L;  1ET6 A;  4LFA L;  2F4V L;  4EQN A;  3F2D A;  3M4P A;  4NXN Q;  3DM3 A;  1B50 A;  2NVT B;  2F0G A;  1LTG D;  3KDF B;  1UE1 A;  3RLF A;  4OON A;  2VUM G;  2BOS A;  1A15 A;  4FNF A;  4DPG A;  4NB3 A;  1Q12 A;  3W3A A;  1PTO F;  4EQ5 A;  2NUC A;  1KTK A;  4KY7 A;  2QF7 A;  2YU9 H;  5FJ8 G;  1EY7 A;  1SMY C;  2A19 A;  4IUR A;  3NQT A;  5BN4 A;  4UP8 A;  1SJE D;  3M7N A;  1STB A;  3CRL C;  1VQ9 A;  5LHY 1;  2R7Z H;  5GRO A;  4TSS A;  1STY A;  1IL8 A;  4X62 Q;  4LFC L;  2QEJ C;  4AYB E;  3BVZ A;  1X65 A;  3HOY H;  1B8A A;  1RF2 D;  1HQR D;  1B44 D;  2B2U A;  2EJF C;  2PZW A;  5LL6 S;  1AN8 A;  3S1Q B;  4IN3 A;  3CPF A;  2EYJ A;  3M3Y H;  4OGQ C;  3BDC A;  2L9H A;  4R4T A;  4A93 H;  1EFI D;  4A3K G;  3H91 A;  2FIN B;  3GV3 A;  2AMC B;  1SDF A;  1D1I A;  5C0X J;  3EFX D;  4HCE A;  3OW2 A;  2ES2 A;  2K5V A;  1UAP A;  3D0F A;  1KNA A;  4R4O A;  2K7V A;  3CCU A;  1NUC A;  1G2S A;  3CME A;  2GN5 A;  4HN7 A;  5EBC A;  3NBH B;  2K4K A;  1A63 A;  1OXV A;  2B2T A;  2Z4I A;  4HJ8 A;  1N36 L;  2JA6 B;  3S2H H;  1JJC B;  1I4P A;  3NTK A;  4GZY C;  2HD3 A;  2VZA A;  2B29 A;  4P72 A;  1PH4 A;  5M5X B;  1E1O A;  3N6R A;  3H3V H;  2K5W A;  3VYU A;  3TRE A;  1PH9 A;  5KEE A;  3I4M G;  1X3F A;  2RA4 A;  4QL5 A;  4A3L H;  1Q8K A;  3TBI B;  4G4K A;  1I4H A;  1W6J A;  2VL6 A;  2QEX A;  2JXM B;  4DV7 Q;  5LMN L;  1C9O A;  2BH8 A;  2B2V A;  1Y1W H;  1LT3 D;  4DR3 L;  2B2U C;  5GAG C;  4H44 C;  1Q8I A;  1WCM B;  2NVX B;  1F77 A;  3P20 A;  1A3V A;  2NB0 A;  5E3F A;  3DEP A;  4OXP A;  2UXB Q;  1VQG A;  3WWV A;  1DM0 B;  1HCZ A;  2JA7 H;  1G91 A;  3A74 A;  4JI6 L;  3NTI A;  1X6O A;  1I6H B;  1P16 A;  3U58 A;  3W5O A;  4IOA A;  2MQH A;  3KUP A;  4JK1 C;  4XQJ A;  4OO1 I;  3VDY A;  4PG3 A;  4A3B H;  2PI2 E;  2B2T C;  1ASZ A;  4CDC C;  2UUA Q;  2HHH Q;  2A8V A;  2EY5 A;  2ZTE A;  3H0G B;  4LJZ C;  4LFA Q;  2JP1 A;  2F4V Q;  3BS1 A;  2I5H A;  4R4Q A;  1CT1 D;  4K5W A;  1ENA A;  4N9T A;  1KQS A;  2IHE A;  3T4A C;  1KHI A;  2F0T A;  4RA8 A;  3MXG A;  3D31 A;  4R8I A;  5IYB H;  3MWY W;  2B2V C;  1R4P B;  3A0J A;  3T1Y L;  1VQB A;  2B39 A;  4XTC S;  5C0X H;  4P74 A;  4A3E B;  1EIG A;  4A75 A;  3RN5 A;  2GVB A;  4CJ2 C;  3ULJ A;  2K52 A;  2YU9 B;  3PUY A;  3LWE A;  4RHR A;  4KKS A;  1HUN A;  1X3G A;  2AUJ D;  2QDB A;  1O7I A;  1PYW D;  5G3L D;  4IUP A;  2I5L X;  5C4X H;  4B9W A;  2G9H D;  1STA A;  1F9Q A;  5M5W H;  4LFC Q;  1IW7 C;  4L5R C;  1HNZ L;  1IBK L;  2RKS A;  3BDO A;  1N33 L;  2A69 D;  3HOY B;  1N32 L;  1K8O A;  3CC7 A;  3O13 A;  1CKN A;  2FHT A;  1PXU A;  4A93 B;  2PQE A;  3JC6 6;  1VDZ A;  4KK7 A;  1A6X A;  4Y7N H;  2EZV A;  1SXT A;  2R93 G;  4DAY A;  1F9S A;  2EDG A;  1FD7 D;  4LF5 L;  1EU4 A;  4QIW E;  2EQS A;  3R2I A;  1CM9 A;  5EBD A;  1SNQ A;  3RZO H;  1J9O A;  2FJ2 A;  4PV1 C;  2R61 A;  2CCZ A;  4JYA L;  1UE7 A;  1N36 Q;  5GAD C;  3J80 E;  4RKB A;  4RKL A;  2D62 A;  5IT9 c;  4OO1 G;  4JI2 L;  4IUN A;  1HPC A;  3PO3 G; 
#chains in the Genus database with same CATH homology
 3QWN A;  1AFP A;  2NTS A;  1B4O A;  3FEW X;  4CKB A;  1Y69 U;  1ROD A;  1E3P A;  2LFN A;  3IRB A;  1MBY A;  1H9M A;  2ENB A;  1F2M A;  2HDM A;  1Y1V H;  3J7Y W;  1E2W A;  3AMU A;  2L12 A;  2KVM A;  4DR3 Q;  1PLF A;  2B8F A;  4GN4 B;  1STN A;  3MVV A;  5LMN W;  4QCL A;  2HQE A;  5EQ0 A;  4IPC A;  3DWA A;  4UDU C;  1LTA D;  5C44 B;  1X32 A;  4JI6 Q;  5KIX A;  3I90 A;  2NN6 I;  2JA9 A;  4BBS G;  1N34 L;  2JA7 B;  3KBG A;  4GLA C;  3IL8 A;  1K8G A;  2O4X A;  5IGE A;  4GN3 B;  2LSS A;  4JI1 L;  1NAP A;  2NZ1 D;  4ALP A;  4FVM A;  1I5F A;  3K5O A;  4B3S L;  3RR5 A;  1WTP A;  3M85 A;  3R93 A;  1FL0 A;  3HOV G;  1ENC A;  4BXX G;  1OXX K;  1PFS A;  1HUM A;  2WB1 G;  4KKU A;  3PIP 3;  5C3E H;  2Q8T A;  4TQU S;  1XNR L;  1GUG A;  4FF3 A;  2K33 A;  4HIO A;  3D8G A;  3KLR A;  1FR3 A;  2QKI C;  4P75 A;  1UEA B;  1VQ5 A;  2HDL A;  3C2P A;  1SYC A;  2KA7 A;  1QUQ A;  3NEN A;  1KXL A;  5EPK A;  3X3M A;  2HT1 A;  4ZUI A;  3T1Y Q;  3CCE A;  4IUT A;  4PNY A;  3X3N A;  4IFD G;  1XMO L;  1QIL A;  2A6H C;  1MGS A;  2NTT A;  5CV5 A;  4H02 A;  2ATW A;  4TVA B;  2EPB A;  3J7Z C;  4MHE A;  2WFW A;  4A4I A;  3MZ5 A;  4K5V A;  3MAQ A;  3MXP A;  1BCP C;  3CPW A;  2MP1 A;  5ELO A;  1HNZ Q;  2I46 A;  4KY6 A;  5C4X B;  1HNW L;  5M5W B;  1C0A A;  1IBK Q;  1L1O B;  1SMX A;  2X6G A;  2EY2 A;  4C3J H;  1N33 Q;  2F0W A;  4Q0F A;  3ER0 A;  3V96 A;  2AQ2 B;  1XTC D;  4M1U B;  5K36 H;  1N32 Q;  2A68 C;  2UU9 L;  2AUK A;  3NXW A;  4NXM L;  1WOC A;  3I4N H;  5C3W A;  2XVS A;  3CC2 A;  5CV4 A;  4LF5 Q;  3HOX G;  4Y7N B;  4LF8 L;  5ISR A;  2NN6 G;  1ASY A;  4HJ7 A;  4YCV A;  3G71 A;  1XMQ L;  2E75 C;  1B53 A;  1ONL A;  3G6E A;  4JYA Q;  1SRU A;  1NY4 A;  2ZTC A;  3SHL A;  3RZO B;  1JB3 A;  5J1Z A;  1SEB D;  5CV8 A;  4X66 L;  4JBJ A;  4JI2 Q;  3K5M A;  1C4Q A;  4BWG B;  3KDF A;  1E24 A;  2ZTD A;  1LYL A;  2YTX A;  1Y8P B;  1S3O A;  3DXJ C;  3CAM A;  4J6H A;  1TS3 A;  3Q24 A;  1Y1V B;  4H0L C;  2BH2 A;  3S9W A;  4DNI A;  1KIX A;  3W2D A;  3HOW B;  4NDX A;  4XXE A;  4HJ5 A;  5M3F G;  1N34 Q;  4NW2 A;  1TII D;  3TS2 A;  5JOB A;  5BR8 L;  5EPJ A;  4JI1 Q;  4X64 Q;  4KN4 C;  1MI2 A;  1VCI A;  4P71 A;  4B3S Q;  2L0C A;  1DYQ A;  3J81 c;  3TP5 A;  2E2D C;  1BNZ A;  3ZYY X;  3MXU A;  1EY4 A;  1KAB A;  2B8G A;  1XNR Q;  1R4Q B;  1Y8O B;  1KNE A;  4HAE A;  3HOU G;  2WB1 E;  1BQQ T;  4C3I H;  1XPU A;  1VQJ A;  4CGY B;  5C3E B;  1KDC A;  2JA5 B;  2KBN A;  2Z6K A;  3U4V A;  2R7D A;  4JCV E;  3G48 A;  2PCF B;  3E5S A;  2F1M A;  5EAY A;  1VQH A;  2MO1 A;  3IAY A;  2LMC B;  1JWU D;  1NSN S;  1JJG A;  1KLG D;  3NK9 A;  3SGI A;  3DMU A;  2N49 A;  3CP0 A;  1XMO Q;  4C3H H;  4A3G H;  1BVS A;  4G7H C;  4WJW A;  2FMM A;  3IFT A;  1U5K A;  1EEI D;  2EE1 A;  4DUY L;  3NHH A;  4A3J B;  2CQO A;  3A7A B;  5BN3 A;  1CTM A;  2MFI A;  2J4X A;  3G6J B;  4JI4 L;  3KFU A;  1HNW Q;  4ZKB B;  3KJP A;  4DV5 L;  4KY5 A;  2JSO A;  2L1B A;  2EVB A;  1ESR A;  4UAI A;  5AFW A;  3W1B A;  1XJV A;  4C3J B;  2UU9 Q;  3AB9 A;  3I72 A;  4N9P A;  1QZH A;  1IW7 D;  3KOJ A;  4A3C H;  1UWV A;  4NXN L;  2A5H A;  1GM5 A;  4PMW A;  2I07 B;  4PZ7 A;  3PV0 A;  5M3M H;  2Z6K C;  1MSG A;  1XNQ L;  3I4N B;  1KRT A;  2BDO A;  1BDO A;  5FO7 B;  4LF8 Q;  1II3 A;  1UEB A;  1XMQ Q;  4BY1 B;  3S16 H;  4DR2 L;  2B2W A;  2BA0 A;  2HCC A;  1GUN A;  1SND A;  4ZK9 B;  3EBE A;  4X66 Q;  3EA6 A;  1K8M A;  1AEX A;  1LTT D;  2K5Q A;  3ERS X;  1BOS A;  1Y8N B;  4DK3 C;  2H5X A;  5JJL A;  4QY7 A;  4AYB G;  2XN9 C;  4PMC A;  1PZI D;  1WCM G;  4GOP B;  2IPK D;  4BY7 G;  1B2T A;  4H7B A;  1TR5 A;  1HTP A;  2QA4 A;  5KYI A;  2RSN A;  1HXY D;  2ZJQ A;  3Q8D A;  1KDB A;  3P1H A;  5FLX E;  1D5M C;  1S5E D;  2F0L A;  5NUC A;  2TSS A;  5IGG A;  2D0O A;  1SE4 A;  3A54 A;  1EYC A;  2PO4 A;  1H9K A;  3PSI A;  3OW7 A;  3WDN A;  4NMZ A;  1B9N A;  3OTO L;  1V1P B;  4DFA A;  5BR8 Q;  1YIJ A;  4JI3 L;  3H0G G;  1QUQ B;  1EZ6 A;  1GUO A;  3NP8 A;  1T5E A;  2B2W C;  3BVM A;  3K7U C;  4YCU A;  3NE5 B;  3NUC A;  2ASB A;  4K2K A;  2E2I H;  1CHQ D;  2AWN A;  4XIG S;  1XTD A;  4G7O C;  2KEC A;  1GVP A;  1O80 A;  3M4Y A;  3S1R H;  2F0I A;  2O2L D;  4XDX A;  4S3S A;  4A3I H;  4GKJ L;  1BBU A;  4C3I B;  4RGO S;  1U0L A;  1A3T A;  4A3E G;  4X3K A;  1XWE A;  5CR3 A;  3T56 B;  5FOB B;  1J5E L;  5BN5 A;  1LT6 D;  2F0D A;  2DY8 A;  4K6D A;  1PFN A;  1YHB A;  1PH2 A;  5DEH A;  4C3H B;  3HGB A;  4A3G B;  2N8N A;  3AFQ A;  3H15 A;  1S5D D;  4DUY Q;  3I8Z A;  3GDE A;  3K5L A;  1JT8 A;  2JE6 I;  3FMC A;  2WAC A;  3FPP A;  1SSO A;  1C7Y A;  3OYY A;  1HZC A;  3TRZ A;  1X9N A;  4JI4 Q;  5C4J H;  2V4D A;  1SYD A;  4DV5 Q;  4CKE A;  1DCZ A;  1TVX A;  4A93 G;  1I3Q B;  4Y52 H;  2WKD A;  4G7Z C;  5EPL A;  4H13 C;  1WJJ A;  3V2T A;  1PFM A;  3U4Z A;  3GTQ B;  4HID A;  2NWG A;  1D7Q A;  4DXG A;  1BCP D;  1ILQ A;  3J80 c;  4DR1 Q;  4X3U A;  2OXP A;  2ALY B;  3F1Z A;  4A3M H;  5FLM H;  3CQZ B;  2AQ3 B;  3HP3 A;  1G2T A;  1XNQ Q;  3J81 E;  1K83 H;  1HZB A;  2RHQ B;  3LNN A;  5M3M B;  2A68 D;  2F0U A;  4KHV A;  1O7L A;  2UXC L;  3EVQ A;  4BA2 I;  4DR2 Q;  1EYD A;  2MO0 A;  4ZAI A;  5A35 A;  1EY8 A;  1H9S B;  5HY6 A;  3S16 B;  3OIQ A;  2OQK A;  4LFB L;  3QG1 A;  5IT9 L;  5KNC A;  5JVH 3;  3H3V C;  3BJU A;  2D2C C;  4KTA A;  1C8C A;  3PUW A;  4DUZ L;  1L0X B;  2IHF A;  4DKA C;  4DV6 L;  5D3I B;  5I9P A;  1S5B D;  5C44 G;  3BVG A;  2UXD L;  4A3F H;  2RCN A;  2PQA B;  5I6W A;  1NJI C;  2JA8 H;  3J7A V;  2RBM A;  4YCW A;  1GHK A;  2O5I C;  3Q6S A;  4DNT B;  3J81 i;  4X6A H;  1HH2 P;  2ZM6 L;  3FKI H;  1NMF A;  1YJN A;  2QCP X;  3OTO Q;  3URY A;  3UE0 A;  1DGS A;  4JC0 A;  2RSO A;  2K04 A;  1L1O A;  1TKW B;  4JBM A;  3KLS A;  1WTR A;  4JI3 Q;  1V1O A;  3M4Q A;  1P8L A;  1HA6 A;  3CCS A;  1QCB D;  2RHS B;  3Q23 A;  1WTO A;  2Q2H A;  2VQE L;  3CCV A;  2R6G A;  2HUG A;  1QB5 D;  3RLO A;  1NCV A;  2HQL A;  1DOK A;  1JE4 A;  2MUY A;  1AE3 A;  2E2I B;  3F8T A;  3K7A H;  1KC8 C;  2NVY H;  5J39 A;  2BDN A;  4DU9 A;  3VR3 A;  4K5X A;  1EY0 A;  1YHA A;  4GKJ Q;  1IYJ B;  1IBM L;  2WKC A;  1L0W A;  4GNX B;  2IX3 A;  4YWL A;  1X54 A;  3SK6 A;  1Z6H A;  4A3I B;  2VUM H;  1Z47 A;  4GS3 A;  4HCS A;  3OMG A;  2K5D A;  1J5E Q;  1LAB A;  4WJ4 A;  1NE3 A;  3KYH C;  5FJ8 H;  3S24 A;  2OQ0 A;  5COR A;  4HIM A;  3MEF A;  1CK1 A;  1WYD A;  2F0E A;  4I65 A;  2PNH A;  3MEH A;  1PYS B;  3GTK H;  1QVF A;  4BBR B;  2NYZ D;  3NEL A;  2VXW A;  3SK4 A;  4MZ9 A;  1L1O C;  1SJH D;  4BA1 I;  2PPB C;  4DGZ A;  1HZA A;  4OX9 L;  1GHJ A;  5CYU A;  3GTG H;  2NZH A;  3S1M B;  1KL9 A;  1ET9 A;  5C4J B;  4K0K L;  3ONA B;  5ELD A;  1GXD C;  1OXU A;  3VA5 A;  5HGT A;  1QVC A;  1GUW A;  3EIV A;  4QUC A;  1EIF A;  1BCP F;  4BS9 A;  1F2Z A;  3JAM E;  2XRQ D;  3SEB A;  4JBW A;  1CSP A;  1X55 A;  2ZXO A;  1K83 B;  2ZXR A;  3DM1 A;  2UXC Q;  2IWH A;  2Y0S B;  1EQT A;  1LAC A;  1SR3 A;  4LFB Q;  4POF A;  1A62 A;  3KF6 B;  5GQO A;  2F0V A;  3H6M A;  1VQ6 A;  1Y1V G;  4IAL A;  1SNO A;  3D4W A;  3DEO A;  4DUZ Q;  2YTY A;  4DV6 Q;  3S1N H;  2F0J A;  2R7Z B;  3HOW G;  4RG1 A;  3H09 A;  4J8Q A;  2UXD Q;  4KKT A;  2JK8 A;  3D6C A;  3QO2 A;  2CWA A;  4ME3 A;  4L5T A;  4DA2 A;  2IL8 A;  4A3F B;  2IX1 A;  3JAM i;  3BZC A;  3ERO A;  3M3Y B;  2HIV A;  1YJ9 A;  1RD9 D;  3BZD B;  4F88 A;  2JA8 B;  2ZM6 Q;  1Q81 C;  3NPP A;  2VNU D;  3PF4 A;  1BXT A;  1SYF A;  2E2J H;  4IFD I;  2RF4 A;  3HKZ B;  1G8Z D;  3P7J A;  3CD6 A;  2PW5 A;  4TKO B;  1YHQ A;  2F0K A;  5IYD G;  2VQE Q;  4C1N I;  1PMR A;  2JA5 G;  1G29 1;  2EY1 A;  2LKV A;  2EYF A;  3S2H B;  3GP7 A;  1SN8 A;  3K7A B;  1GOZ A;  5KYL A;  3TP8 A;  4DV1 L;  1Q86 C;  2NVY B;  1IBM Q;  3Q22 A;  1IYU A;  2NBF A;  4X3T A;  4DR4 Q;  3AEV A;  3PUZ A;  1UE6 A;  3HOZ H;  3GTM H;  1U4P A;  3UDF A;  2VUM B;  1TWH H;  5M5Y H;  5E4W C;  1SLJ A;  1Y1W B;  1V9P A;  2VB2 X;  4A3J G;  1PA6 A;  1S5C D;  4X65 L;  1E7Z A;  1Q1B A;  1JOQ A;  4LUZ A;  1SAP A;  4GOP A;  3S15 H;  4O42 A;  2E8G A;  1SRO A;  2F3V A;  1VQM A;  1EEF D;  4A3D G;  1UE5 A;  1HFN A;  2IW3 A;  1QJO A;  3E0E A;  4X64 L;  5JAV A;  3GTK B;  1V43 A;  4OX9 Q;  3ND8 A;  4XQQ A;  4DXF A;  3J80 i;  1EIH A;  5IE8 A;  4DV0 L;  1RCV D;  2OTL A;  4K0K Q;  3L9A X;  3TP6 A;  4F7X A;  4POG A;  4A3B B;  3GTG B;  1PTO H;  3BYT B;  4O2D A;  5EGT A;  1KRS A;  1U4R A;  1V1P A;  4BY1 G;  2FFK B;  2K5H A;  1VQI A;  3OSO A;  1OXS C;  4R4C A;  3U50 C;  2R93 H;  1TWF H;  3HRZ C;  3T13 A;  2UUC Q;  5IGB A;  1JJ2 A;  3HZX A;  4G57 A;  1H9J A;  4Z9C B;  4CHT B;  1NTG A;  1NR4 A;  4RGT A;  2PZU A;  3A8I E;  4NP5 A;  2A6E D;  3CKI B;  4DV3 L;  3BU2 A;  3UDX A;  2K28 A;  2RDG A;  3NTH A;  3KBX A;  2WV6 D;  4OO1 H;  1KAW A;  5FLX c;  1V8Q A;  2FMC A;  4GOP C;  4LF9 Q;  2K5N A;  2D9U A;  2XRS D;  5LL6 X;  2F4I A;  5G3L F;  1YBY A;  1XX8 A;  3FVQ A;  1EIY B;  1WVL A;  1PH3 A;  2L15 A;  1VF5 C;  2UUB L;  1MJC A;  2F0M A;  3M7G A;  3S1N B;  1SNP A;  1SYG A;  3DWP A;  4LWC A;  1AW7 A;  1IL2 A;  5IYC G;  1VQP A;  2IX0 A;  1T5X D;  2XSC A;  3CCR A;  2F0S A;  1IKM A;  2E74 C;  3GTO H;  3ULL A;  4EX5 A;  4BBS H;  4K8I A;  5IWA L;  3VR5 A;  3L2P A;  5CV6 A;  2WAQ B;  2EXD A;  3F2C A;  3GD7 A;  4ID6 A;  4LK1 C;  1PFB A;  2E2J B;  1OTC A;  4KN7 C;  1XPO A;  4CJ1 B;  3HOV H;  1LLR D;  1X3P A;  1PRT B;  1CKM A;  2F52 A;  1VMP A;  4BXX H;  1JE5 A;  1RIP A;  4X3S A;  5EKL A;  2F0F A;  4C3I G;  2IY5 B;  1CQV A;  4I7Z C;  3MFY A;  4IOC A;  2G9D A;  4DN4 M;  1EQV A;  4OWX B;  1YNX A;  1WD1 A;  4DV1 Q;  2B2Y A;  1EUJ A;  4EQP A;  4B3R L;  1TQO A;  4PZ6 A;  2RDH A;  1O78 A;  2WIN B;  3MTS A;  1K3R A;  1VQ7 A;  3KJO A;  4HED A;  3A5U A;  2D5D A;  2EYH A;  1J8I A;  4C3H G;  4A3G G;  4O1N A;  1H9S A;  3HFZ B;  2PZT A;  3D3R A;  2DUD A;  1GO3 E;  4YWM A;  3PO2 H;  1D6E C;  3HOZ B;  2EYL A;  4KJO A;  3L0O A;  4X65 Q;  1VF7 A;  1TWH B;  5M5Y B;  4LF4 Q;  5CV7 A;  1EWC A;  4ILW A;  3RN2 A;  3A55 A;  4AIM A;  1EZ8 A;  1ICW A;  3S15 B;  2PQA A;  4DV0 Q;  4RMF A;  3DLL A;  2OCE A;  4KD3 A;  5C6A A;  2EYO A;  3NSW A;  1WTQ A;  1G6P A;  3VA7 A;  1PTO B;  3AFP A;  2MGS A;  3VR6 A;  2Q8I B;  3E6Z X;  3J80 L;  1FGU A;  2B2Y C;  5A2Q E;  2EJM A;  2KHJ A;  2N88 A;  3HOX H;  1CUK A;  1W3S A;  2NN6 H;  2F0Q A;  1A2U A;  1VQF A;  4R1J A;  2B63 H;  4DV3 Q;  5FO8 B;  1SFO H;  3QB3 A;  3T51 B;  2CKZ B;  1F9R A;  2F03 A;  3OHX C;  4DR5 L;  5I4D A;  5KNB A;  1CFM A;  1PRT D;  4GNX A;  1HR0 Q;  3QJY A;  4U67 3;  4AH6 A;  1GD7 A;  1PYB A;  5JEA G;  2SOB A;  4QB4 A;  2NVQ H;  5DLQ E;  1E1T A;  1SNM A;  2UUB Q;  3RMH A;  2RQX A;  1RKN A;  4HR7 B;  4GN5 A;  1U4M A;  3SK8 A;  2CVR A;  2VB3 X;  4IQZ A;  4EVO A;  1S4Z A;  1YZ6 A;  4WJ3 M;  1SYE A;  2OTJ A;  3I4O A;  4DR1 L;  4OWT B;  2KCT A;  2LY7 A;  1TXY A;  1MD2 D;  3CCQ A;  1G51 A;  5IWA Q;  4IO9 A;  1BBW A;  1QWY A;  1SNC A;  4HTH A;  2JA6 G;  1BF4 A;  1STG A;  3EN2 A;  1JQY D;  1JOR A;  5FO9 B;  4ZYS A;  5E4X A;  5IY0 A;  4DR7 L;  3K81 C;  2WB1 B;  4A3I G;  1GUT A;  3HOU H;  2N55 A;  4GNX C;  1EY9 A;  5DAU A;  2J7Z A;  1NBW A;  2Q2I A;  1IYV A;  4B3R Q;  1VQ4 A;  1PTO D;  3ULP A;  2LS0 1;  5K5P A;  2EYP A;  1DD2 A;  1CKO A;  2DNC A;  3I91 A;  2D0P A;  3PF5 A;  3CRK C;  5IP7 G;  4RAU C;  3FHW A;  3KF6 A;  3A7L A;  2I0Q A;  5J3B A;  1VQ8 A;  2R92 H;  5ELN A;  4BBR G;  5IP9 H;  3PO2 B;  3PMF A;  2KEN A;  3DHQ A;  2SEB D;  1QE6 A;  1ML0 D;  4U68 A;  1B1Z A;  1FNW A;  2E76 C;  4FDB A;  4QMG A;  4UP7 A;  3JAM c;  3LWU A;  3TN2 A;  3I2Z A;  3VR4 A;  3H3V I;  2K05 A;  2EOT A;  1Q82 C;  2XWB B;  3W1G A;  4O0A A;  1F2Y A;  1FVI A;  4QJF A;  2BCO A;  1PH7 A;  1PZJ D;  2M9V A;  3EJI A;  1CI3 M;  2F0O A;  2BE5 C;  2KCN A;  2CQA A;  3V05 A;  1DOL A;  1CZW A;  4JI5 L;  4HIK A;  2Y0S G;  1WFQ A;  3I70 A;  1PH1 A;  2Q8R E;  3RZD H;  4R9W A;  3HOX B;  3ITP A;  2YTV A;  2XIW A;  3TME A;  1EYG A;  2K50 A;  1HZ9 A;  2B63 B;  2X6L A;  4WRD A;  4C1N K;  1LV9 A;  3UI2 A;  2B3G A;  2KUM A;  2R7Z G;  4DR5 Q;  1H9R A;  3HS0 C;  3K57 A;  1PRT F;  1HRJ A;  4K6L A;  3R2T A;  4UY8 C;  3HOY G;  1HTL D;  3KF8 B;  4BY7 H;  4A3F G;  5LMU Q;  1SYB A;  3MXN B;  3F2B A;  3C1F A;  2NVQ B;  3I3C A;  4XYO A;  1U9R A;  1I6H H;  1Z9F A;  3STB C;  1N8R C;  3TQY A;  1EY6 A;  2C35 B;  1R9T H;  4LF6 L;  2F0P A;  2PMZ B;  2A6E C;  5KGU A;  3HKZ G;  2ZJR A;  4IPH A;  5C0X I;  2ZXP A;  4K14 A;  2JQO A;  5J22 A;  1L2F A;  5CGK A;  4FXD A;  2J0T D;  4WOR A;  4MN3 A;  5D3D A;  1JOO A;  4IJL A;  1G6Z A;  3CCL A;  2JJQ A;  1VMC A;  4V0B A;  3S14 H;  1Q46 A;  1FGB D;  2E2H H;  4ME5 A;  3RUZ A;  4DR7 Q;  1RJT A;  1LO5 D;  4A3L G;  1PH6 A;  1LT4 D;  2MHV A;  1VQD A;  2TMP A;  3S2D H;  4OHJ A;  3NBI A;  1EWI A;  4OIK A;  3HOU B;  1Y1W G;  5I9O A;  1RTN A;  5D65 A;  4A3E H;  3PUV A;  2N3S A;  4APV A;  2ICE C;  4DK6 C;  1FNV A;  4FP5 D;  3PUX A;  2GA4 B;  2JA7 G;  4B3T L;  2K03 A;  1OO9 B;  4LF7 L;  3F2U A;  2ZJP A;  1AP0 A;  2MNA A;  1M1K C;  1OXT A;  4OWW B;  1M4V A;  3EQL C;  4PQX A;  2R92 B;  1D8L A;  4KI0 A;  2FXQ A;  1PZK D;  3A56 A;  1I6V C;  1JR0 D;  4FO2 A;  1TU2 B;  1Q1E A;  4A3B G;  5ELF A;  3GO5 A;  5EKK A;  4OIJ A;  1X3Q A;  2QGQ A;  5DM6 3;  5ELC A;  3D6W A;  2F0H A;  4DF7 A;  3G7L A;  1WTW A;  1YNJ C;  1AH9 A;  1S40 A;  3SE0 A;  3P75 A;  2IT1 A;  2PW7 A;  2OWO A;  1CQF A;  5TSS A;  1UNS A;  3S1R B;  5IYB G;  2HIX A;  1EOV A;  4JI5 Q;  2H4O A;  3MFG A;  2OT2 A;  4DR4 L;  5HUR A;  4M8A A;  1I4R A;  5C0X G