2OXPA

Crystal structure of staphylococcal nuclease mutant v66d/p117g/h124l/s128a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High apparent dielectric constant inside a protein reflects structural reorganization coupled to the ionization of an internal asp
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oxpA00
2F0WA 1SYEA 2F0VA 2SNSA 4RKBA 2SOBA 1EZ8A 4KY6A 2HQEA 5C4ZA 1TR5A 1II3A 3MZ5A 1EYCA 2PZTA 4ID6A 2EYJA 4KD4A 5KGUA 1STYA 5IIFA 5CR3A 3E5SA 4NDXA 5CGKA 2F3WA 4N9TA 2EXZA 2PZUA 2O4XA 1EY9A 5HGTA 5CV5A 1EY0A 1EY7A 2EY5A 1RKNA 3U9OA 1KAAA 2EY1A 2OXPA 4NMZA 3TP6A 2F0NA 2EYMA 2PYKA 5C4HA 2F0OA 3R3OA 4HTHA 3TP8A 5JOBA 4E6IA 5KEEA 1ENCA 1STGA 1SYCA 5KIXA 2KHSA 3MEHA 4QF4A 4QB4A 5E1FA 1SNCA 1TQOA 3TP7A 5HURA 5IGCA 5IODA 4KTAA 5KYIA 5DEHA 2F0DA 3TMEA 4IALA 4IUNA 4KY7A 4EQOA 3OMCA 3NXWA 3QOJA 3V2TA 2F0LA 3LX0A 3DMUA 3SR1A 1EY4A 5C6AA 3NQTA 5CV8A 4EQNA 2OF1A 4B9XA 4K5WA 3P75A 4LAAA 4RKLA 1F2YA 2M00A 4ME5A 5KRUA 5JAVA 2F0MA 3SK6A 5C3XA 2KQ3A 4G57A 4WORA 2EYOA 4EQPA 4KJOA 1KDCA 2ENBA 5K5PA 4PNYA 3SXHA 4K6DA 2OEOA 2EY2A 2F0TA 3VA5A 3HZXA 1JOQA 3D4DA 5CV7A 3H6MA 1ENAA 4S3SA 4DGZA 1EZ6A 4DFAA 5I6WA 3C1EA 4NP5A 4DF7A 4F8MA 1U9RA 3EROA 4QMGA 4H7BA 4KV6A 5CV6A 4PMCA 1STBA 3MXPA 4HMIA 4J1MA 4ZUJA 5IGBA 3S9WA 2SNMA 1KABA 3D4WA 3HEJA 2EYLA 4NKLA 1EY8A 4OL7A 1EQVA 5EGTA 2RKSA 3DHQA 1EY6A 1JOOA 2EYFA 5IGDA 5IGEA 1A3UA 1TT2A 2F0PA 2NUCA 4WRDA 2EY6A 2F0QA 3MHBA 3P1HA 1EYDA 4IZ8A 3ERQA 3NP8A 3OMGA 4HMJA 1KDAA 5C5MA 1STNA 2F0UA 2F3VA 5J39A 1A3TA 2RDFA 5J22A 3ITPA 3RUZA 4TRDA 3T16A 5EKKA 4ZQ3A 3TP5A 4I65A 4ZUIA 1STAA 2LKVA 2F0SA 2PW7A 4K8JA 1AEXA 3OWFA 5ISRA 4N9PA 3EVQA 5IOCA 3NHHA 2F0FA 5IGGA 1A3VA 2F0KA 5IGFA 2QDBA 5NUCA 3BDCA 4YIJA 2WACA 1JOKA 1A2UA 5E3FA 5I9PA 5I6YA 1SNPA 4J6HA 3QOLA 4K5XA 3T13A 5KYLA 4B9WA 4EVOA 1JORA 3BDLA 1STHA 3PMFA 1KDBA 1SYDA 2PZWA 1A2TA 4K8IA 5CV4A 4F7XA 3MVVA 2PW5A 1SNMA 2EYPA 4K2KA 1EYAA 2PQEA 1SNQA 5C5LA 3SK4A 1SNDA 4K5VA 3NK9A 1SYGA 3NUCA 3D6CA 4MIUA 4R8NA 5F2DA 3SK5A 5C3WA 4PMBA 1SYBA 5I9OA 5J1ZA 1SNOA 4DU9A 4K2LA 5CC4A 3C1FA 5M9OA 4KHVA 4K14A 5CV9A 1F2MA 3EJIA 3D8GA 3SHLA 5EKLA 4KJNA 2F0GA 1EY5A 1F2ZA 1NUCA 2EYHA 4ODGA 2F0EA 2F0JA 2F0HA 1NSNS 2F0IA 4KD3A 1SYFA 1IHZA 2RBMA 3OSOA 5DAUA 3SK8A 4KY5A 3QB3A
chains in the Genus database with same CATH superfamily
2Q8RE 2R92B 3K7UC 4BWGB 3X3NA 2CQAA 2EYJA 4L5TA 4GNXC 1CSPA 1ICWA 3A8JE 5A2QL 1WTVA 5LMNL 4N9TA 3L9AX 3S15H 4OIJA 1I4GA 1PFSA 1V9PA 4WJ3M 2HDMA 3CCUA 1C0AA 2YYZA 3R3OA 3IL8A 4ZYSA 4HJ7A 4LNQA 1QZGA 3BU2A 4H13C 1BQQT 1RTOA 3TMEA 4BXXH 2JQOA 3FPUB 4A3CH 2VNUD 4WJWA 4IQZA 2CH4A 1XNRQ 3NQTA 1ZEQX 3NTHA 5IP9G 1P16A 4DK0A 3PF5A 4WORA 1UE6A 5GROA 5DNFA 4A3FG 4PNYA 2Q2IA 4LF9Q 4FF2A 3VA5A 1D5MC 2VL6A 4HCSA 1HH2P 3H6MA 2LXKA 4OO1G 1ICFB 2EJMA 3VA7A 3HP3A 1SMYD 4QGUA 2QEJC 3S1RB 4DV4Q 1DYQA 2K50A 4A3EB 1TKWB 2KCCA 1PH8A 1HJPA 3KLWA 2IWHA 4WRDA 1HUMA 3OMGA 1FNWA 5C5MA 3N6RA 4X65Q 2CW0C 3TBIB 2A6HD 2JEBI 2R7FA 1QUQA 4JV5L 1ET9A 1FNVA 1QCBD 3E9HA 4X3UA 2IX3A 4I65A 4K8JA 2EVBA 2CCZA 1K3BC 3J7AF 1CKOA 1WTXA 1OO9B 3I4LA 1KTKA 2K7VA 2Z1CA 4JYAQ 4NB3A 4B3TQ 3GTGH 2WACA 1HZBA 1JE5A 5KGUA 1SYDA 3CHBD 1NNXA 3R8BA 2M2LA 2Y0SE 1W2BA 2K1BA 3I90A 1GUOA 5C3WA 5I9OA 2VB3X 1X3PA 3BVZA 1A62A 1WI5A 1H9RA 2MO0A 2JA8H 1R4QB 2F0HA 1SYFA 4G4KA 1X56A 2K75A 4OEMB 1LT5D 3RD4A 1NMGA 1OTCA 1HQRD 2PZTA 3NTIA 3ZJYC 1IBML 3HOVH 2F3WA 3BZCA 1UNSA 4A3MB 4C56C 4U673 2B2YC 4LWCA 1YI2A 2R93H 3TP6A 2VQFQ 1Y14B 3RLFA 4AYBE 2E2IB 2NZHA 3VR5A 1ENCA 4POGA 2NVXB 2HD3A 3ND9A 2M9VA 2VQFL 4HSPA 5IODA 2BDNA 1JICA 1Y8NB 3HOXH 4YCUA 3V2TA 5LMUQ 1TWGB 5JEAG 4B9XA 4XDXA 2PNHA 3P75A 2CHBD 3PUYA 1HQMC 4FF4A 4LFBQ 2EYOA 2R92H 1PTOF 2K01A 1EQQA 1VF7A 1WTWA 3CKIB 1WJJA 1GUTA 3PO2H 5FK9C 1O7YA 2AQ2B 5T1IA 4H7BA 2UXBQ 4YY3L 2UUAL 2KCMA 1GOZA 1B9MA 3GP7A 3NPPA 2UXBL 2L55A 5ELNA 2KUMA 2CH4W 4FDBA 5C4XG 1A3UA 2A6ED 4HJ8A 5M5YH 3HOZB 1EWIA 3NQIA 2MNAA 3E0EA 2F0UA 3EQLC 4IUUA 3G4SA 4CDDC 1PTOC 4A3BH 4TRDA 5AFWA 1E2WA 5IYCH 1PZKD 1BKBA 2F0SA 4IUTA 4LFAQ 1LV9A 3OWFA 4KN7C 5IYDH 1CQFA 3KK7A 3L3OC 1K83H 4J6HA 1UE1A 3HOUH 1PDQA 4EVOA 1JORA 4K8IA 2JA5G 1HNXQ 3QIAA 2EYPA 4LF8L 2CWPA 5C5LA 3HGBA 2F4IA 3HOYH 1IYJB 5EPLA 1CKMA 3PCOB 1TVXA 2QILA 2K03A 1MJEA 2UU9Q 1U4PA 3TS0A 4AH6A 2HHHL 1B53A 3A56A 2KECA 4KJNA 1IBMQ 4LF9L 2NB0A 3Q6SA 3DWQA 1U5KA 1IHZA 3AMUA 3QB3A 4DR7Q 3J81i 3L2PA 2A74C 1EZ8A 4YWMA 1I4QA 1K0SA 3K80C 4IURA 1OXUA 2PZUA 3M7GA 4UPAA 1K28A 2EXDA 2QCPX 1I6HH 4RAUC 4PMWA 3MEFA 2WIIB 3CU7A 4ME3A 1K83B 1WFQA 5EBCA 1HXYD 2EPBA 4TSSA 1QWYA 1V1PB 2K5DA 3HFZB 4G7OC 1LABA 2GVBA 2L0CA 3STBC 3CCSA 2F0LA 1QUQB 1I5FA 1EY4A 1UWVA 2PQAA 2MUYA 3I56A 5KNBA 4LAAA 4RKLA 4ME5A 3JAML 3MXUA 1U4MA 1B44D 2FINB 1NE3A 4KJOA 2K5NA 4XIGS 2WV6D 1L1OB 3HZXA 1XMOQ 1QNUA 4OHJA 4LF6Q 3OOCA 1X6OA 1ENAA 1N32Q 5GAEC 1LTID 4BY1H 1QE6A 3K7AH 4R8IA 2FMMA 2X69A 3AEVA 3EN2A 4UP9A 3S9WA 1MSHA 1C4QA 4TVAB 4A3FB 4A93G 3GV3A 4NKLA 4MTNA 5EGTA 3QG1A 1SJHD 4DF7A 4P73A 4KKTA 1Q1BA 2R93G 4LUVA 1ILQA 1B1ZA 1Y1VH 3FKIB 1SSOA 3RUZA 2E74C 4IJHA 4DNIA 3IFTA 3JC66 4MZ9A 4BY1G 2B39A 4NXNL 2B2WC 1IBKL 2ZXRA 3K5LA 1BNZA 3MXGA 1BUVT 1SNPA 1NR2A 3HKZG 1I4RA 1MGSA 2BH2A 3S16B 4KHZA 2IPKD 4DK3C 1JE4A 1SE2A 1E1OA 1W3SA 1SN8A 3I72A 4A3MH 4L8JA 3SK5A 5K36H 3H3VH 1SYBA 2LY7A 1PH6A 3HOVB 5LMNQ 5EAYA 5CV9A 3QR8A 3RLNA 4FYDA 1NUCA 3M3YB 3UI2A 1NSNS 1Y1WB 1Q8KA 1HA6A 2JA8B 1SEBD 4OWWB 2HDLA 5J3BA 2I5LX 4KD4A 1SXTA 1VQJA 1K73C 5C0XJ 1LTAD 1KD1C 3F1ZA 4Q5VA 3F2DA 4BY7G 4DK6C 4XYOA 3FEWX 4A3BG 2R7DA 3HG9A 4X3SA 2DN8A 3EFXD 2HIXA 4LF7L 3GTOB 4QB4A 1E1TA 2F0DA 4LW1A 4IPDA 3Q0AA 3OMCA 3BVGA 4GS3A 1AW7A 3FPPA 2OF1A 1SDFA 5C3EG 5COYA 4GOPB 5KRUA 2A69D 3D6WA 3LWUA 3VR2A 1VQBA 2WINB 2RA4A 4BY7H 2B2WA 4X62Q 1SROA 1JOQA 4X66Q 2WB1B 4RFBA 2CQOA 4F8MA 2WAQB 1DM0B 2EE1A 4KV6A 1EFWA 2I07B 3GDEA 4FNFA 4HMIA 1Q1EA 2AWOA 3D4WA 4HIKA 2I5MX 2XTIA 2BOSA 2E2HB 1F9QA 1PRTB 1NTGA 5EBDA 5AJ3Q 4DNRB 3NP8A 5IP7G 2B8GA 1J9OA 1I50B 4NW2A 3F8TA 4BA2I 4A3GG 2EQSA 4ZUIA 5KNCA 4DR6L 3IRBA 5C4JB 3GTMH 1LLRD 3OPOA 2AUKA 3G71A 4QL5A 3J80c 2VQEL 4DK1A 1A2TA 3TRZA 1FVIA 4OGQC 5C3EB 2EJFC 4K2KA 5A35A 2Z4HA 4X64Q 1I6VC 3GTMB 4LF4Q 4B3MQ 2KCTA 1CKNB 4CGYB 4JI0L 3CCEA 1RIPA 3PO2G 3EJIA 1N36L 4DV5Q 3GTQB 2IJ0A 3W2DA 3ND8A 5I2YA 2XVSA 1V43A 3SK8A 4KLKA 3S17B 4MN3A 2MO1A 1YHAA 2E2HH 1O7IA 2A68C 1EEFD 5M5WB 1YNJD 3PO3G 1Q8IA 3MA2B 3AB9A 1W6KA 5IE8A 1EY0A 4PG3A 4FXDA 5JVG3 1KAAA 1JQYD 1UE5A 3T51B 1L1OA 3AU7A 4X65L 1HFGA 1TQOA 2BA1A 1EU3A 4KTAA 1HNZQ 5D14A 5DEHA 4P71A 4IALA 2JK8A 1X32A 2FJ2A 2UUBL 2ATWA 1IBLQ 1M8AA 2QGQA 2CW0D 4OX9L 3ERSX 3KUPA 1X54A 2C5CA 5BR8Q 5CBAE 3SK6A 1F77A 1A8VA 2A68D 3A7AB 1PHJA 3TZUA 5ELBA 4A76A 1MBYA 3GTOH 4DAYA 2F03A 5CV7A 1EZ6A 3IFDA 3M4OB 1KL9A 1U9RA 3KF8A 1XTDA 4C3HG 4PMCA 1STBA 2L5TA 1KQSA 4F87A 5IGBA 1EQTA 4CJ1B 3HOWH 2JA7B 2A5HA 3A0JA 2Z4IA 4GLXA 1Y1WH 2OCEA 5IT9c 1LTLA 3ITPA 3VR6A 5M3FG 5IWAL 4B3ML 1PRTD 5I4DA 2NVYB 2XRSD 1HA5A 4UY8C 1EEID 4JK1C 1O7LA 4OO1H 1TY2A 2VY3A 3O13A 4PQXA 5LL6X 1YZ6A 2FXQA 4B9WA 1KLUD 2R7ZG 1NY4A 3TREA 2UXCL 4JI5L 1SBBB 4IFDG 4Q0FA 4IN3A 4K5VA 2FFKB 1CTMA 4HEDA 3D6CA 3S24A 1I3QB 5J39A 2IX0A 2MPMA 1TWHH 3S2HB 4LJZC 3OTOQ 3P20A 4K14A 4ZAIA 3FKIH 2X6GA 3SHLA 1Y1VB 1EY5A 2N78A 3H94A 3PGZA 3TQYA 2F0EA 1Q86C 4DA2A 2F0IA 2XRQD 4IJLA 3S1NB 2JE6I 1LO5D 1JC7A 1FNUA 1STYA 1E0BA 1PTOH 3K0XA 1TWCB 2R3ZA 5IYBH 4A3JH 2E5LQ 4X66L 4BY1B 1HNWQ 2O2LD 4RA8A 1J5EL 3IAYA 1B70B 2KVMA 1SNCA 1XMQL 3D31A 4JI4Q 3NXWA 1V1OA 1FL0A 1DZ1A 2L15A 3VYSA 3P7JA 2PQAB 4WFN3 1FJGQ 3H91A 2ENBA 1BBUA 4M8AA 2EY2A 4DUZQ 4TKOB 1TU2B 1I6HB 3M7NA 4JI6L 4UAIA 1EUJA 3PUZA 5EPJA 2SDFA 4A93B 1GHKA 1LACA 4ZUJA 2B2VC 4BBSG 1Z47A 4JBKA 1VQFA 1YNND 4IPCA 1GUNA 2EY6A 5FLXc 1EYDA 3ERQA 5E7NA 1KDAA 3B6YA 1J8IA 1WTPA 2BE5D 1PH3A 2D9UA 2IW3A 1SJED 1VQGA 1WD0A 2KHIA 1STAA 2LKVA 4B08A 1N8RC 4XTCS 2B63H 3UDFA 2YU9B 1D6EC 1DGSA 3CMAA 3FMCA 2E2JB 1MSGA 1ZYRD 1CI3M 3HOUB 4K5XA 4HIMA 2K5QA 3MFYA 4NPSA 2ZJRA 5C4XH 2PZWA 1IBKQ 2A6HC 3PIP3 3HRZC 1ASZA 1L0XB 3PO3H 1CSQA 1SNQA 4A3IB 4O0AA 3FVQA 1G51A 3M4YA 2WAQG 4EQ5A 4IPGA 5J1ZA 1IXRA 3GTPH 1SNOA 1VQIA 5IYCG 3VDYA 1ESRA 2ICIA 2RBMA 3J7ZC 1G291 4DV3Q 1GUGA 3RR5A 1JMCA 3G6JB 4A3CG 3KDFB 2YTXA 3G7LA 4GZYC 3CCLA 3PQIA 2BCOA 1WVLA 1TWAB 1RTNA 4N8X1 1H9MA 1YHQA 2ZM6L 4LF6L 1N32L 3DEOA 3U50C 1XMOL 2OXPA 4JI5Q 4NXML 3K6OA 4BBRG 5EPKA 2NTSA 3UDGA 5KEEA 3TN2A 2RSOA 4FVMA 1Q82C 2K6AA 3JAME 1DONA 2WP8J 5D3IB 3RMHA 4R4QA 4FXKC 2ZJQA 1I94Q 3GTJH 1VCIA 4Y52H 1C9OA 5JPMC 3GO5A 4PZ8A 3NBIA 3BZDB 4DKAC 4K6DA 2F52A 1LTBD 2OTLA 2A19A 4JI8Q 2ALYB 3D3RA 4GNXA 1PH5A 1JJGA 3F2UA 2DNCA 1RF2D 3J81E 3I4MH 5FO8B 3A54A 2SNMA 3DUZA 5E4WC 2EYLA 1TWFH 1ILPA 4ILWA 1SE4A 2EYFA 5FOBB 3KLRA 1KNEA 1T5EA 3KBGA 4HMJA 1CA6A 2UU9L 1A3TA 4DR6Q 5BR8L 1S5CD 1B2TA 2F4VL 2JA7G 4B3RL 1PXUA 3NHHA 2F0FA 1FGBD 2QDBA 3I4MG 3H0GG 5E3FA 1VQ6A 1RODA 1EU4A 3HOWG 3I4NG 3S2DH 1T5XD 1KDBA 1X9NA 4JBMA 1GM5A 4I7AA 3D0FA 2V1CC 1O7ZA 1Z7TA 1KHIA 1BBWA 3Q8DA 1EFID 2HT1A 5CC4A 1SMXA 4DV0Q 1HZ9A 2G9DA 5JJLA 3PIOA 5C44B 3CF5A 4UP8A 2NWGA 4JBWA 1B3AA 4ZQ3A 1KNAA 1QILA 5LMNW 1BF4A 4ZKBB 1YEZA 3S1RH 3IKJA 3NWTA 1VQKA 3KF6A 2E76C 1KAWA 2JXMB 1S3OA 3PF4A 3CCRA 4A4IA 2KA7A 5GAGC 2JA6G 4LFBL 2VQEQ 4ALPA 4QF4A 1T9HA 4GN4B 4GOPA 1TWFB 3DM3A 3KBXA 2JYOA 3I4MB 3GTLB 5DLQE 4C3IB 4WJ4A 5ELOA 2MP1A 1Y69U 4K5WA 3A8KE 3RLOA 4RHSA 5JAVA 2JP1A 1PFBA 1VQ8A 4XYQA 4QY7A 2RF4A 1KIXA 3BS1A 5D65A 3W5OA 1L0YB 4C3HB 5I6WA 2RDGA 2DNEA 3CPWA 1PZID 3V05A 3TZDA 5C0XI 1UE7A 3E9IA 5M3MG 4CKBA 1TS4A 3HEJA 1VQOA 3K5NA 3FHWA 3PUVA 2NUCA 4IZ8A 2F0QA 3W1BA 4X62L 4DAPA 2UXDQ 3J80i 4DV2Q 4GOPC 4AQYL 4NXNQ 1YVCA 3S1QB 1EOVA 2PNRC 2EZVA 2WKCA 5IOCA 1LTSD 1TY0A 2JA9A 1ESFA 4RHRA 1PVOA 2E75C 4YHHQ 3G48A 5I9PA 3CCMA 1CKNA 4R9WA 3H0GH 4GN3B 4O1NA 2JN4A 3RZOH 3CCVA 1LTGD 2B3GA 3T56B 4JI7Q 2D0OA 2YTVA 1WTOA 4A3DH 3PSIA 1O80A 3NK9A 1SYGA 3CMEA 2DUDA 2K5WA 2R92G 2RHQB 4BS9A 1N33Q 4A3IH 1HFNA 3C1FA 2K05A 3D8GA 4OXPA 3TEHB 2FMCA 1F2ZA 2EYHA 1D2BA 1BVSA 3OSOA 1DOLA 3WOFA 2DGYA 4DV7Q 2VUMG 1QVCA 2PO4A 2E2JH 4JI2L 4BBSH 3HOVG 3SE0A 2YU9H 5IIFA 1NMFA 1SFOH 2ES2A 4CBVA 3K8AA 1H9JA 2RCNA 4QCLA 2O4XA 1GKHA 2WB1E 1ZXTA 4DR2L 1GJXA 1GO3E 2K33A 4YWKA 2IY5B 1K3RA 4FF1A 2Q2TA 1GUWA 2JA6H 1YJ9A 1RHPA 1BR9A 4DV1L 4F88A 1Q12A 2N55A 2XIWA 4DR1Q 1XNRL 2UUCQ 3OIQA 4A93H 3DMUA 3I4NH 2ASBA 2BDOA 1HZAA 2PMZE 3STBD 3OYYA 5GADC 2R7ZB 2NYZD 2RDHA 3K5OA 4EQPA 2HIVA 4OONA 3GV6A 2F0TA 4DR2Q 1HHVA 1S5DD 1Q3LA 4DGZA 4DFAA 3PUXA 4JI3L 1EIFA 4OX9Q 5M3MH 2HCCA 4LF8Q 1X3GA 2VXWA 3DWAA 3FDTA 3AFPA 1LYLA 4DV7L 2RSNA 3S1MB 3OW7A 1W6JA 1HNZL 2AWNA 2X6LA 3P1HA 4IFDH 1HPCA 1BBXC 1KLGD 2SEBD 4DAVA 4LFAL 5CYUA 1TS5A 2J4XA 1JWUD 1FD7D 1D1IA 2AQ1B 1Z9FA 3MXNB 4A3JB 1TWCH 3J80E 3MTSA 4A3GH 1PTOB 2B63G 3W3AA 5BN3A 5GQOA 4A3KH 3RZDH 1N34Q 3A5UA 2F0KA 2HUGA 1XXGA 2ICEC 5ELCA 5NUCA 4YIJA 4XQQA 5FLXL 2F3IA 1Q81C 2L1BA 4XQNA 4KMUC 1SNMA 3CAMA 3HKSA 1F9SA 1TWHB 4DV5L 4LUZA 1QVFA 4PMBA 2QDLA 3A7LA 4YCWA 4DU9A 4LF5Q 2BA0A 4LF4L 3DXJC 1DD2A 5EKLA 4QUFA 4C2MB 4JOIC 1YNXA 1EWCA 2VS1A 2EJGC 2K14A 3BYYB 4DR4L 3HOXG 2VUMH 1SYEA 2K32A 2SNSA 4EGVA 4XQJA 4LMQD 3KFUA 1II3A 1EYCA 1JR0D 4DUYL 3J7YW 1PLFA 2R7ZH 1F2LA 1WCMB 3K5MA 4V190 3ULJA 1UEAB 4PZ7A 1EY9A 3UDXA 3WWVA 1WCMG 2EY5A 5TSSA 2AHOB 3C2PA 2EY1A 3R2IA 4JOIA 5C0XG 5HGQA 1IZ6A 1HNXL 2N49A 4DXFA 4E6IA 3NTKA 4C3JB 2JA7H 2KHSA 5HURA 3HOWB 1HR0W 4RG1A 1YNNC 1CFMA 3TDQA 3C3LA 1A15A 4KY7A 4PV1C 4Z9CB 3QOJA 2B2UC 2N88A 3LX0A 3SR1A 4JI1L 4ZK9B 2N8NA 1K8GA 3M4OH 5CBEE 3S14H 1ZYRC 3L7ZC 5IP9H 1RL2A 2B2YA 5FLMH 5IP7H 3SXHA 4QIWE 4OO1I 2OT2A 2XWJB 3LGJA 2YTYA 5ELEA 2EOTA 3MXPA 4A3EG 4YY3Q 1AZQA 5M3FB 1VS0A 1AN8A 3A8IE 3I70A 3JAMc 2Z6BA 4A3DB 3FRPB 4EX5A 1WYDA 2K04A 4JYAL 2YV5A 4CDEC 2NVTH 1G8ZD 1WOCA 2VB2X 3J80L 1KC8C 1EOTA 3M85A 1VQ9A 1MD2D 4OWTB 4H02A 4CJ2C 5ELFA 1NAPA 4BBRB 2L4NA 3KLSX 2KHJA 3CRLC 4JV5Q 2A1AA 3WOEA 5LMUL 1QZHA 2K4KA 1GUSA 5IGFA 3S1QH 4U68A 3S17H 4O2DA 4RCNA 3J81j 1K8AC 3AYHB 3M9BA 1YIJA 3GTQH 5JJIA 1L2FA 3NBHA 3I8ZA 2C35B 1SNDA 2IL8A 4ZRZA 1PRTC 3NUCA 4R4OA 1HR0L 1MIUA 1IKMA 4P72A 1B50A 1AP0A 4RCOA 4KI0A 5M9OA 1Q46A 1KRTA 1CA5A 1LM0A 4DUYQ 3LWEA 1K8MA 1P8LA 3KF8B 4C3HH 2F0JA 2AMCB 1S5BD 4Y7NB 4XXEA 3CC7A 4HIDA 4CHTB 4KY6A 5A2QE 2KJXA 3MZ5A 1R4PB 1QJOA 5C4JH 1XNQL 4DV6L 4A3DG 4LF5L 1PYSB 2UUCL 4C3IH 2NVQB 5CV5A 1I50H 3ZYYX 2XNAC 3VYTA 3PIO3 4DV1Q 2EYMA 1V1QA 4HTHA 1H95A 1I94L 1EWHA 1SYCA 3TSSA 2DJGC 4LUOA 2F1MA 5KYIA 3I2ZA 3MXNA 1G6PA 1RD9D 3BYTB 2Z9HA 5FLXE 2L11A 4YWLA 3NELA 4EQNA 5EQ0A 2C9OA 2A73B 2EDGA 1VQMA 2NVTB 5C3XA 2Q2HA 1LT6D 1Y1VG 3J81c 1XJVA 1IL8A 1CZGA 2CVRA 3SDZA 1M90C 1D5ZC 5M3FH 3HS0C 2I46A 5LL6S 5C44H 3I7FA 4A3IG 1E2ZA 3A74A 4P74A 4QMGA 4DV4L 2QW7A 1MKHA 4QJFA 2IT1A 4JI3Q 1CQVA 4IPHA 4JI7L 1YJWA 2H5XA 4DV3L 1EY6A 1JOOA 2WAQE 4R4IA 2ID0A 1OXTA 1JB3A 2B2TA 5FKAC 3QO2A 3S2DB 2TSSA 4YHHL 4H0LC 2F3VA 2IX1A 1JT8A 4ULLA 1G91A 3I73A 1OXVA 3HKZB 5M5XB 1C48A 1S5FD 2BH8A 3GD7A 1ML0D 1SR3A 3E0JA 1VQAA 4MNOA 3VYRA 2MGSA 5ISRA 2UXDL 5IYDG 2D0PA 4DV6Q 1XNQQ 3Q24A 5I6YA 3NSWA 1SE3A 4AYBB 1IYVA 3M3YH 4DR7L 5CORA 3MVVA 4MIUA 1LTRD 2RQXA 5F2DA 1WCMH 3BVMA 1H9SB 1PRTF 1SRUA 3CCQA 2HHHQ 2K5HA 2N3SA 4JW0A 1HR0Q 2DJFC 2VUMB 3S16H 5DAUA 4C2MH 5BN5A 2I0QA 3I3CA 3F2BA 2SOBA 2HQEA 3GTJB 1EYGA 1K8OA 4DR3Q 4NDXA 1V8QA 1C7YA 1N33L 4GKJL 2XSCA 3U58A 3KJPA 3UDIA 2LXJA 3HKZE 4A3MG 3RNUA 3NE5B 2B2TC 2JJQA 5D3DA 1AH9A 1U0LA 3MEHA 1M4VA 2WFWA 3LNNA 4JVZA 1PH9A 3DLLA 4A3KB 1CZWA 4A3GB 4IFDI 3PIPA 4L5RC 4IOAA 3I55A 1XMQQ 1TWAH 2UUAQ 1F2YA 1ZKOA 1LT3D 3V96A 4AQYQ 2KQ3A 4G57A 4IUVA 4DV2L 1S72A 2KENA 1L0WA 1J5EQ 2KOLA 3DM1A 2CWAA 3ICEA 3S1MH 2OEOA 1HNWL 1X3EA 3D4DA 4G7ZC 1JCKB 2CKZB 1XWEA 4NP5A 4KKSA 5CV6A 5DM73 2TMPA 2RHSB 1H9KA 1FR3A 4GLAC 1VQNA 5JJZA 5JEAH 1EY8A 1B3QA 2RCFA 3DHQA 1EL0A 3T4AC 1PTOD 5C4XB 5G3LF 1VQHA 3OTOL 1BDOA 3KDFA 3WDNA 5J22A 2ZTEA 2KEEA 1BO0A 4X3TA 4A3LH 3I4NB 2B63B 3UE0A 2VW9A 2QF7A 1XTCD 1ENFA 4I7ZC 2H1EA 3VR4A 2PPBC 3BDCA 1CT1D 2JA6B 1V1PA 4RGTA 3W1GA 1STHA 4DR4Q 3DWPA 2JSOA 2PQEA 2QEXA 4C3IG 1S4ZA 4HR7B 3ULPA 1DOKA 1STEA 2LMCB 1F9PA 3HOYB 4K0KQ 4ZKCB 1O78A 4GKKQ 1VQEA 1YITA 1I4PA 1LUZA 1E22A 4RWSC 4DXGA 2NN6G 2QA4A 4V0BA 1CK1A 5JVH3 1YBYA 1N34L 3PV0A 2Q8TA 2D2CC 3E5SA 2J7ZA 2EXZA 2OWOA 1WD1A 5HGTA 1PH1A 4A3BB 2RVLA 3U9OA 1HZCA 4NMZA 3T53B 2F0NA 3CCJA 1OXXK 1VDZA 4C3JG 4DAYB 2PYKA 4JBJA 4XT3B 3RZOB 2DY7A 2F0OA 3CD6A 3TP8A 1SE8A 3CW2C 3H0GB 3HOZH 2I5HA 1PH2A 1SLJA 5IGCA 3TP7A 4UP7A 1C8CA 2Q8IB 1J6QA 5IT9E 4JC0A 1IBLL 3PUWA 4B3RQ 1LT4D 5EJWA 4ZCKA 5C6AA 1E24A 2NN6H 3HOUG 1JJCB 4HJAA 2MQHA 1IL2A 4UDUC 5JEAJ 3PO2B 1BCPD 2EIFA 3T1YL 2D62A 2WB1G 2Z0SA 1NJIC 3S1NH 1G2TA 2R61A 1PYBA 4J15A 1D7QA 1G6ZA 1H9SA 1Y8PB 4R1JA 1ASYA 1XX8A 1TWGH 3CP0A 4GNXB 1MHWC 4GN5A 3HOXB 2G9HD 1XPUA 3SGIA 2PCFB 2Y0SB 3K81C 3ONAB 5JPNC 4JCVE 3A55A 2NVXH 4DR1L 3GQBA 2Y0SG 1N36Q 1TXYA 3C46A 3K59A 2XN9C 2E2IH 4H44C 2RDFA 2R93B 1N9WA 4APVA 3UE1A 1NR4A 4X3KA 3FKIG 4A3LG 3GTLH 5KNDA 2HCIA 1DJRD 2NVYH 1EIGA 4LK1C 4CKCA 3KYHC 4DR5L 4HN7A 3EVQA 1VQ4A 2K52A 5IGGA 1X3QA 1JOKA 1VMPA 5L37A 3VR3A 5E4XA 4JI2Q 5BN4A 4ABNA 2BE5C 2Z6KC 4NXMQ 3TS2A 2B29A 4HSVA 1YNJC 3CC4A 5M5XH 4JI6Q 3OW2A 2NBFA 3KF6B 3U9SA 3J81L 3EA6A 3EBEA 1E7ZA 4L63B 4ODGA 1EIYB 4KD3A 3G6EA 1RDPD 3KLSA 1B7YB 3GTGB 1M1KC 2HQLA 5C4ZA 1VQLA 1GD7A 4FXGC 3L0OA 4HCEA 1PYWD 5CGKA 3NBHB 2O5JC 1EY7A 5K36G 1RKNA 4XT1B 4LFCL 4KHPL 5DM63 3RN2A 2QKIC 1STGA 3T1HQ 1BOSA 5KIXA 1L1OC 2B2UA 5E1FA 1HUNA 4KHPQ 4LFCQ 4A3EH 1CHPD 3A5ZB 4EQOA 2E5LL 5EKIA 3BG3A 2A69C 1WTRA 3OHXC 1TS3A 4RGNA 1DOMA 1NBWA 4POFA 5M5WH 4B3SL 4LF7Q 4DPGA 4L5QA 3K58A 2A8VA 1GXDC 1XYIA 2PI2A 3RN5A 2KEDA 1PH7A 4S3SA 3C1EA 1PV4A 2PMZB 2NVQH 1AE2A 4J1MA 1HTLD 2D5DA 3F2CA 2KBNA 3ER0A 2K5VA 4X6AH 1QG7A 1BCPC 5IGEA 5IGDA 5C3EH 2L12A 5FO7B 3FP9A 3U4ZA 1PFMA 3AFQA 3MHBA 4Y7NH 1VQ7A 3I91A 4PZ6A 4CDCC 1OXSC 1PFNA 2P5ZX 3H15A 4B3SQ 4L6TB 2IHFA 4IOCA 3S15B 1K9MC 4JPBW 5IWAQ 1A0IA 4GLVB 3NENA 3QJYA 3CXCA 2B2VA 3SVMA 4BXXG 1D8LA 1A2UA 2ZTCA 1GHJA 1IYUA 2ZXPA 3T13A 1A63A 4DN4M 5CV4A 3PMFA 4RH6A 4F7XA 3MAQA 1XPRA 4KKUA 4DV0L 5I2XA 1I4HA 4BBRH 4QIWB 4C1NI 2V4DA 1VQPA 3SEBA 2VZAA 2KCNA 1D5XC 3E6ZX 3T1YQ 1QOHA 4P2CB 3Q23A 4BY7B 1B4OA 1BCPB 2F0VA 4RKBA 2Z6KA 1TR5A 3GTPB 1X3FA 4IO9A 1E2VA 1IW7C 1GVPA 3BDOA 5CR3A 2JA5H 1X55A 1Y1WG 1B8AA 5IYBG 4A3JG 3OWEB 1QVGA 3PO3B 1IKLA 2F4VQ 3GTKB 2GN5A 2UXCQ 1CHQD 5C4HA 5JOBA 1MI2A 4A3KG 1E3PA 3MFGA 4QUCA 4IUNA 3S14B 3URYA 1PZJD 2IHEA 4DR5Q 4KK7A 3R93A 4IUPA 2R6GA 1I4XA 3NEMA 4M1UB 3JAMi 4K6LA 2M00A 4ZLTF 2F0MA 4L5SA 4DNTB 1NCVA 3MC0B 4JI8L 1S5ED 1KDCA 2XWBB 3CPFA 4C3JH 2G5DA 2E8GA 1R9TB 4GKKL 2Q2UA 1UEBA 1YJNA 4JI0Q 1QB5D 3EROA 4HJ9A 1DCZA 1EIHA 3D4RA 1HCZA 2ZTDA 2LFNA 1KABA 1JWSD 4HJ5A 1VF5C 4OL7A 3ULLA 3J7AV 1AZPA 4IFDJ 4AIMA 5GAHC 3DEPA 1BCPF 4CJ0B 2FHTA 1B9NA 1TT2A 2NTTA 4N8FA 3H3VI 1WTHA 1STNA 1VQDA 3CQZH 4OELB 1F9RA 5C0XH 3J7A5 1A6XA 3KJOA 1JJ2A 1Z6HA 3T16A 5EKKA 2DY8A 4FO2A 1AFPA 1Q90A 2ZM6Q 4G7HC 2PW7A 2OQKA 1S40A 1UAPA 4N9PA 2UUBQ 1PMRA 4IUQA 3N52A 1RJTA 2K28A 3AQQA 3QOLA 2NZOA 2NN6I 5HY6A 3BDLA 1XPOA 1ET6A 3I4OA 4TQUS 2GA4B 1EQRA 2PW5A 1VQ5A 4UHVA 2B8FA 2MHVA 3SK4A 3RZDB 4R8NA 3HOYG 1CUKA 4A3FH 3MWYW 3H3VC 1F2MA 3K7AB 4DAMA 5FO9B 3NWSA 5FJ8H 2F0GA 1PH4A 1JB7A 5KYLA 3OIPA 5IY0A 4RGMA 2AUJD 4MTKA 1VQCA 4KY5A 2F0WA 4FF3A 4HAEA 3S2HH 1U4LA 4ID6A 2GVAA 1ONLA 4C1NK 2AQ3B 5M3MB 3R2TA 1I3QH 3H09A 4K0KL 3X3MA 2E2DC 5LHY1 4MHEA 3CC2A 2A6EC 5T1GA 2PI2E 2LS01 4X64L 3CQZB 1HTPA 1PA6A 3HOZG 1HRJA 1U4RA 1KXLA 1FGUA 4HIOA 1G2SA 1YHBA 2CFMA 4JI1Q 1WTQA 1IW7D 1DXMA 1UUPA 4J8QA 5IT9L 4GKJQ 3VYUA 1SMYC 1LTTD 5CV8A 2WKDA 3M4PA 2Z8LA 2MFIA 4R4CA 3K0YA 4RMFA 2O5IC 4QQBX 1R9TH 4DUZL 4A75A 3QWNA 2J0TD 5G3LD 5K5PA 1X65A 5AJ3L 1BXTA 2AKWB 1Q7YC 3BZKA 2MJ8A 3CRKC 1FJGL 4KN4C 4JG2A 4CDFC 2JA8G 1MJCA 1TIID 4O42A 3EIVA 1CM9A 1SFOB 5CMDA 1EQVA 2RKSA 4BBSB 3K57A 4JI4L 2F0PA 1RCVD 1FYCA 2NZ1D 3T1HL 3Q22A 3BJUA 2H4OA 3GTKH 1KRSA 2ZXOA 3E3XA 4AYBG 5H1SE 3TP5A 2JA5B 2OQ0A 1JWMD 5JJKA 1AEXA 4RGOS 1Y8OB 5ELDA 1A3VA 4FP5D 4BA1I 2ZJPA 4B3TL 1QNKA 4OIKA 5M5YB 3U4VA 2JEAI 2ZT9C 1EYAA 2LSSA 4YCVA 4R4TA 1AE3A 3KOJA 1SAPA 5FLMG 2OTJA 1K0RA 1TS2A 1VMCA 3M4QA 4K2LA 4P75A 4DR3L 5C44G 4KHVA 1D1KA 4OWXB 2L9HA 5FJ8G 4CKEA 2XGTA
chains in the Genus database with same CATH topology
2Q8RE 2R92B 4BWGB 3X3NA 2CQAA 2EYJA 1ICWA 3A8JE 5A2QL 1WTVA 4N9TA 3L9AX 4OIJA 1I4GA 2HDMA 2YYZA 3R3OA 3IL8A 4ZYSA 4H13C 1BQQT 1RTOA 3TMEA 2VNUD 3FPUB 4WJWA 4IQZA 3NQTA 1ZEQX 3NTHA 4DK0A 4WORA 5DNFA 4PNYA 4FF2A 3VA5A 1D5MC 4HCSA 3H6MA 4OO1G 2EJMA 3VA7A 3HP3A 1SMYD 2QEJC 3S1RB 1DYQA 4A3EB 1TKWB 2KCCA 2IWHA 4WRDA 1HUMA 3OMGA 1FNWA 5C5MA 3N6RA 2CW0C 3TBIB 2A6HD 2JEBI 1ET9A 1FNVA 1QCBD 4X3UA 2IX3A 4I65A 4K8JA 3J7AF 2EVBA 1WTXA 1OO9B 3I4LA 1KTKA 2K7VA 2Z1CA 2WACA 5KGUA 1SYDA 3CHBD 3R8BA 2M2LA 2K1BA 3I90A 1GUOA 5C3WA 5I9OA 2VB3X 1X3PA 3BVZA 1H9RA 1R4QB 2F0HA 1SYFA 4G4KA 1LT5D 3RD4A 1HQRD 2PZTA 3NTIA 2F3WA 1UNSA 4A3MB 4C56C 4U673 2B2YC 3TP6A 3RLFA 2E2IB 3VR5A 1ENCA 2NVXB 3ND9A 2M9VA 4HSPA 5IODA 2BDNA 1JICA 1Y8NB 3V2TA 1TWGB 5JEAG 4B9XA 4XDXA 3P75A 2CHBD 3PUYA 1HQMC 4FF4A 2EYOA 1PTOF 2K01A 1VF7A 1WTWA 3CKIB 1GUTA 5FK9C 1O7YA 2AQ2B 5T1IA 4H7BA 1GOZA 1B9MA 3GP7A 3NPPA 2L55A 2KUMA 1A3UA 2A6ED 3HOZB 3NQIA 2F0UA 3EQLC 4IUUA 1PTOC 4TRDA 5AFWA 1E2WA 1PZKD 2F0SA 4IUTA 1LV9A 3OWFA 4KN7C 1CQFA 3KK7A 3L3OC 4J6HA 1PDQA 4EVOA 1JORA 4K8IA 3QIAA 2EYPA 5C5LA 3HGBA 2F4IA 5EPLA 1TVXA 2QILA 2K03A 1U4PA 1B53A 3A56A 2KECA 4KJNA 2NB0A 3Q6SA 3DWQA 3AMUA 1IHZA 3QB3A 2A74C 1EZ8A 1I4QA 4IURA 1OXUA 2PZUA 3M7GA 2QCPX 4RAUC 4PMWA 2WIIB 3CU7A 1K83B 5EBCA 1HXYD 2EPBA 4TSSA 1QWYA 1V1PB 2K5DA 4G7OC 1LABA 2L0CA 2F0LA 1EY4A 2MUYA 5KNBA 4LAAA 4RKLA 4ME5A 3JAML 3MXUA 1U4MA 1B44D 2FINB 4KJOA 4XIGS 2WV6D 3HZXA 1QNUA 4OHJA 3OOCA 1ENAA 1LTID 1QE6A 4R8IA 2FMMA 2X69A 3S9WA 1MSHA 1C4QA 4A3FB 3GV3A 4NKLA 5EGTA 3QG1A 1SJHD 4DF7A 4KKTA 1Q1BA 1ILQA 1B1ZA 3FKIB 1SSOA 3RUZA 2E74C 3IFTA 2B39A 2B2WC 2ZXRA 3K5LA 1BNZA 3MXGA 1BUVT 1SNPA 1NR2A 1I4RA 1MGSA 3S16B 4KHZA 2IPKD 1JE4A 1SE2A 3I72A 4L8JA 3SK5A 5K36H 1SYBA 2LY7A 3HOVB 5CV9A 4FYDA 1NUCA 3M3YB 3UI2A 1NSNS 1Y1WB 1HA6A 2JA8B 1SEBD 2HDLA 4KD4A 1SXTA 5C0XJ 1LTAD 4Q5VA 4XYOA 3FEWX 3HG9A 4X3SA 2DN8A 3EFXD 3GTOB 4QB4A 2F0DA 3Q0AA 3OMCA 3BVGA 1AW7A 3FPPA 2OF1A 1SDFA 5COYA 5KRUA 2A69D 3D6WA 3LWUA 3VR2A 2WINB 2RA4A 2B2WA 1JOQA 2WB1B 4RFBA 4F8MA 2WAQB 1DM0B 2EE1A 4KV6A 2I07B 4FNFA 4HMIA 1Q1EA 2AWOA 3D4WA 2BOSA 2E2HB 1F9QA 1PRTB 5EBDA 4DNRB 3NP8A 2B8GA 1J9OA 1I50B 4NW2A 4BA2I 4ZUIA 5KNCA 5C4JB 1LLRD 3OPOA 2AUKA 4DK1A 1A2TA 4OGQC 5C3EB 2EJFC 4K2KA 5A35A 2Z4HA 1I6VC 3GTMB 4CGYB 3EJIA 3GTQB 2IJ0A 3W2DA 3ND8A 5I2YA 2XVSA 1V43A 3SK8A 3S17B 4MN3A 2A68C 1EEFD 5M5WB 1YNJD 1Q8IA 3MA2B 3AB9A 1W6KA 1EY0A 4FXDA 5JVG3 1KAAA 1JQYD 3T51B 3AU7A 1HFGA 1TQOA 2BA1A 1EU3A 4KTAA 5D14A 5DEHA 4IALA 1X32A 2FJ2A 1M8AA 2CW0D 3KUPA 2C5CA 5CBAE 3SK6A 1F77A 2A68D 3A7AB 3TZUA 5ELBA 1MBYA 4DAYA 2F03A 5CV7A 1EZ6A 3IFDA 3M4OB 1U9RA 3KF8A 4C3HG 4PMCA 1STBA 2L5TA 4F87A 5IGBA 1EQTA 4CJ1B 2JA7B 2A5HA 2Z4IA 3ITPA 3VR6A 1PRTD 5I4DA 2NVYB 2XRSD 1HA5A 1EEID 4JK1C 1O7LA 4OO1H 1TY2A 3O13A 4PQXA 5LL6X 4B9WA 1KLUD 1SBBB 4IFDG 4Q0FA 4IN3A 4K5VA 2FFKB 1CTMA 4HEDA 3D6CA 5J39A 1I3QB 2IX0A 2MPMA 3S2HB 4LJZC 3P20A 4K14A 4ZAIA 2X6GA 3SHLA 1Y1VB 1EY5A 3H94A 2F0EA 4DA2A 2F0IA 2XRQD 3S1NB 2JE6I 1LO5D 1JC7A 1FNUA 1STYA 1E0BA 1PTOH 1TWCB 2R3ZA 4BY1B 2O2LD 4RA8A 3IAYA 2KVMA 1SNCA 3D31A 3NXWA 1V1OA 1DZ1A 3VYSA 3P7JA 4WFN3 3H91A 2ENBA 4M8AA 2EY2A 4TKOB 1TU2B 1I6HB 3M7NA 4UAIA 3PUZA 5EPJA 2SDFA 4A93B 1GHKA 1LACA 4ZUJA 2B2VC 1Z47A 1YNND 1GUNA 2EY6A 1EYDA 3ERQA 1KDAA 1J8IA 1WTPA 2BE5D 2D9UA 2IW3A 1SJED 1WD0A 1STAA 2LKVA 4B08A 4XTCS 2YU9B 1D6EC 3FMCA 2E2JB 1MSGA 1ZYRD 1CI3M 3HOUB 4K5XA 2K5QA 3MFYA 2PZWA 2A6HC 3PIP3 3HRZC 1L0XB 1SNQA 4A3IB 3FVQA 3M4YA 5J1ZA 1SNOA 1ESRA 2ICIA 2RBMA 1G291 1GUGA 3G6JB 3G7LA 4GZYC 2BCOA 1WVLA 1TWAB 1RTNA 1H9MA 3DEOA 2OXPA 3K6OA 5EPKA 2NTSA 5KEEA 3TN2A 2RSOA 4FVMA 2K6AA 3JAME 1DONA 2WP8J 5D3IB 3RMHA 4FXKC 1VCIA 5JPMC 3GO5A 3NBIA 3BZDB 4K6DA 1LTBD 3D3RA 3F2UA 2DNCA 1RF2D 3J81E 5FO8B 3A54A 2SNMA 3DUZA 5E4WC 2EYLA 1ILPA 4ILWA 1SE4A 2EYFA 5FOBB 3KLRA 1KNEA 1T5EA 3KBGA 4HMJA 1CA6A 1A3TA 1S5CD 1B2TA 1PXUA 3NHHA 2F0FA 1FGBD 2QDBA 5E3FA 1RODA 1EU4A 1T5XD 1KDBA 1O7ZA 1Z7TA 1EFID 5CC4A 2G9DA 5C44B 2NWGA 4JBWA 1B3AA 4ZQ3A 1KNAA 1QILA 1BF4A 4ZKBB 3IKJA 3NWTA 2E76C 2JXMB 2KA7A 4QF4A 1TWFB 3KBXA 2JYOA 3I4MB 3GTLB 4C3IB 2MP1A 1Y69U 4K5WA 3A8KE 4RHSA 5JAVA 2JP1A 1PFBA 4XYQA 3BS1A 5D65A 1L0YB 4C3HB 5I6WA 2RDGA 2DNEA 1PZID 3V05A 3TZDA 5C0XI 4CKBA 1TS4A 3HEJA 3K5NA 3PUVA 2NUCA 4IZ8A 2F0QA 4DAPA 3S1QB 2PNRC 2EZVA 2WKCA 5IOCA 1LTSD 1TY0A 4RHRA 1ESFA 2E75C 5I9PA 4R9WA 4O1NA 1LTGD 3T56B 1WTOA 1O80A 3NK9A 1SYGA 2K5WA 4BS9A 1HFNA 3C1FA 2K05A 3D8GA 2FMCA 1F2ZA 2EYHA 1D2BA 3OSOA 1DOLA 3WOFA 2PO4A 3SE0A 5IIFA 4CBVA 1H9JA 4QCLA 2O4XA 1ZXTA 1GJXA 2K33A 4FF1A 1GUWA 1RHPA 1BR9A 4F88A 1Q12A 2N55A 2XIWA 3OIQA 3DMUA 2BDOA 2R7ZB 2NYZD 2RDHA 3K5OA 4EQPA 3GV6A 2F0TA 1HHVA 1S5DD 1Q3LA 4DGZA 4DFAA 3PUXA 2HCCA 2VXWA 3DWAA 3FDTA 2RSNA 3S1MB 3OW7A 1W6JA 2AWNA 2X6LA 3P1HA 4IFDH 1HPCA 1BBXC 1KLGD 2SEBD 4DAVA 5CYUA 1TS5A 2J4XA 1JWUD 1FD7D 1D1IA 2AQ1B 4A3JB 3J80E 3MTSA 1PTOB 3W3AA 5BN3A 2F0KA 2HUGA 1XXGA 2ICEC 5ELCA 5NUCA 4YIJA 4XQQA 5FLXL 2L1BA 4XQNA 4KMUC 1SNMA 1F9SA 1TWHB 4PMBA 3A7LA 4DU9A 2BA0A 3DXJC 1DD2A 5EKLA 4QUFA 4C2MB 1EWCA 2EJGC 3BYYB 1SYEA 2K32A 2SNSA 4EGVA 4XQJA 4LMQD 1II3A 1EYCA 1JR0D 3J7YW 1PLFA 1F2LA 1WCMB 3K5MA 4V190 1UEAB 1EY9A 2EY5A 5TSSA 3C2PA 2EY1A 3R2IA 5C0XG 4DXFA 4E6IA 3NTKA 4C3JB 2KHSA 5HURA 3HOWB 1YNNC 1CFMA 3TDQA 3C3LA 1A15A 4KY7A 4PV1C 4Z9CB 3QOJA 2B2UC 2N88A 3LX0A 3SR1A 4ZK9B 5CBEE 1ZYRC 3L7ZC 2B2YA 3SXHA 4OO1I 2OT2A 2XWJB 5ELEA 2EOTA 3MXPA 1AZQA 5M3FB 1AN8A 3A8IE 3I70A 4A3DB 3FRPB 2K04A 1G8ZD 2VB2X 3J80L 1EOTA 3M85A 1MD2D 4CJ2C 5ELFA 1NAPA 4BBRB 2L4NA 3KLSX 3CRLC 3WOEA 1GUSA 5IGFA 4U68A 4RCNA 3NBHA 3I8ZA 1SNDA 2IL8A 4ZRZA 1PRTC 3NUCA 1IKMA 1B50A 1AP0A 4RCOA 4KI0A 5M9OA 1CA5A 3LWEA 1K8MA 2F0JA 1S5BD 4Y7NB 4XXEA 4CHTB 4KY6A 5A2QE 2KJXA 3MZ5A 1R4PB 1QJOA 2NVQB 5CV5A 3ZYYX 2XNAC 3VYTA 3PIO3 2EYMA 4HTHA 1EWHA 1SYCA 3TSSA 2F1MA 5KYIA 3MXNA 1RD9D 3BYTB 5FLXE 2L11A 4EQNA 5EQ0A 2C9OA 2A73B 2EDGA 2NVTB 5C3XA 1LT6D 1IL8A 1CZGA 2CVRA 3SDZA 1D5ZC 3HS0C 2I46A 5LL6S 1E2ZA 4QMGA 2IT1A 1CQVA 1EY6A 1JOOA 2ID0A 1OXTA 1JB3A 2B2TA 5FKAC 3QO2A 3S2DB 2TSSA 4H0LC 2F3VA 2IX1A 4ULLA 1G91A 3I73A 1OXVA 3HKZB 5M5XB 1C48A 1S5FD 3GD7A 1ML0D 3E0JA 3VYRA 2MGSA 5ISRA 3Q24A 5I6YA 3NSWA 1SE3A 4AYBB 1IYVA 5CORA 3MVVA 4MIUA 1LTRD 2RQXA 5F2DA 3BVMA 1H9SB 1PRTF 2VUMB 5DAUA 5BN5A 3I3CA 2SOBA 2HQEA 3GTJB 1K8OA 4NDXA 1V8QA 2XSCA 3NE5B 2B2TC 5D3DA 3MEHA 1M4VA 3LNNA 4A3KB 1CZWA 4A3GB 4IFDI 1F2YA 1ZKOA 1LT3D 3V96A 2KQ3A 4G57A 4IUVA 2KOLA 3DM1A 2OEOA 3D4DA 4G7ZC 1JCKB 1XWEA 4NP5A 4KKSA 5CV6A 5DM73 2TMPA 1H9KA 1FR3A 5JJZA 5JEAH 1EY8A 3DHQA 1EL0A 3T4AC 1PTOD 5C4XB 5G3LF 1BDOA 3WDNA 5J22A 2KEEA 1BO0A 4X3TA 3I4NB 2B63B 2QF7A 1XTCD 1ENFA 4I7ZC 2H1EA 3VR4A 2PPBC 3BDCA 1CT1D 2JA6B 1V1PA 4RGTA 1STHA 3DWPA 2JSOA 2PQEA 4C3IG 1S4ZA 4HR7B 1DOKA 1STEA 2LMCB 1F9PA 3HOYB 4ZKCB 1O78A 1I4PA 4RWSC 4DXGA 2NN6G 4V0BA 1CK1A 5JVH3 3PV0A 2Q8TA 2D2CC 3E5SA 2J7ZA 2EXZA 1WD1A 5HGTA 4A3BB 2RVLA 3U9OA 4NMZA 3T53B 2F0NA 1OXXK 1VDZA 4C3JG 2PYKA 4XT3B 3RZOB 2DY7A 2F0OA 3TP8A 3H0GB 5IGCA 3TP7A 1C8CA 2Q8IB 5IT9E 3PUWA 1LT4D 5EJWA 5C6AA 2NN6H 4UDUC 5JEAJ 3PO2B 1BCPD 2D62A 1G2TA 2R61A 1G6ZA 1H9SA 1Y8PB 1XX8A 3HOXB 2G9HD 2PCFB 2Y0SB 3ONAB 5JPNC 3A55A 3GQBA 3C46A 3K59A 2XN9C 4H44C 2RDFA 2R93B 1NR4A 4X3KA 5KNDA 2HCIA 1DJRD 4LK1C 1EIGA 4CKCA 4HN7A 3EVQA 5IGGA 1X3QA 1JOKA 1VMPA 3VR3A 5E4XA 5BN4A 4ABNA 2BE5C 4HSVA 1YNJC 2NBFA 3U9SA 3J81L 3EA6A 4L63B 4ODGA 4KD3A 1RDPD 3KLSA 3GTGB 5C4ZA 4FXGC 4HCEA 1PYWD 5CGKA 2O5JC 1EY7A 5K36G 1RKNA 4XT1B 5DM63 2QKIC 1STGA 1BOSA 5KIXA 2B2UA 5E1FA 1HUNA 1CHPD 4EQOA 5EKIA 3BG3A 2A69C 1WTRA 3OHXC 1TS3A 4RGNA 1DOMA 3K58A 1GXDC 1XYIA 2KEDA 4S3SA 3C1EA 2PMZB 4J1MA 1HTLD 2D5DA 1QG7A 1BCPC 5IGEA 5IGDA 2L12A 5FO7B 1PFMA 3MHBA 3I91A 1OXSC 1PFNA 4L6TB 3S15B 3QJYA 2B2VA 3SVMA 1A2UA 1GHJA 1IYUA 2ZXPA 3T13A 4DN4M 5CV4A 3PMFA 4RH6A 4F7XA 3MAQA 4KKUA 5I2XA 1I4HA 4QIWB 4C1NI 2V4DA 3SEBA 2KCNA 1D5XC 3E6ZX 1QOHA 4P2CB 3Q23A 4BY7B 1B4OA 1BCPB 2F0VA 4RKBA 1TR5A 3GTPB 1E2VA 1IW7C 3BDOA 5CR3A 3OWEB 3PO3B 1IKLA 3GTKB 1CHQD 5C4HA 5JOBA 1MI2A 3MFGA 4QUCA 4IUNA 3S14B 3URYA 1PZJD 4KK7A 3R93A 4IUPA 2R6GA 1I4XA 4M1UB 4K6LA 2M00A 4ZLTF 2F0MA 4DNTB 1NCVA 3MC0B 1S5ED 1KDCA 2XWBB 1R9TB 1QB5D 3EROA 1DCZA 1EIHA 3D4RA 1HCZA 2LFNA 1KABA 1JWSD 1VF5C 4OL7A 3J7AV 4IFDJ 1AZPA 3DEPA 1BCPF 4CJ0B 2FHTA 1B9NA 1TT2A 2NTTA 1STNA 1F9RA 5C0XH 1A6XA 3T16A 1Z6HA 5EKKA 2DY8A 4FO2A 1AFPA 1Q90A 4G7HC 2PW7A 1UAPA 4N9PA 1PMRA 4IUQA 3N52A 1RJTA 2K28A 3QOLA 2NN6I 3BDLA 1ET6A 4TQUS 2GA4B 2PW5A 2B8FA 2MHVA 3SK4A 3RZDB 4R8NA 3MWYW 3H3VC 1F2MA 3K7AB 5FO9B 3NWSA 2F0GA 5KYLA 3OIPA 4RGMA 2AUJD 4KY5A 2F0WA 4FF3A 4HAEA 1U4LA 4ID6A 1ONLA 4C1NK 2AQ3B 5M3MB 3R2TA 3H09A 3X3MA 2E2DC 5LHY1 4MHEA 2A6EC 5T1GA 2LS01 3CQZB 1HTPA 1HRJA 1U4RA 1G2SA 1WTQA 1IW7D 1DXMA 1UUPA 4J8QA 5IT9L 3VYUA 1SMYC 1LTTD 5CV8A 2WKDA 2Z8LA 3K0YA 2O5IC 3QWNA 2J0TD 5G3LD 5K5PA 1BXTA 3CRKC 4KN4C 1TIID 4O42A 1SFOB 1CM9A 5CMDA 1EQVA 2RKSA 4BBSB 3K57A 2F0PA 1RCVD 1FYCA 2NZ1D 3Q22A 2H4OA 2ZXOA 3TP5A 2JA5B 1JWMD 1AEXA 4RGOS 1Y8OB 5ELDA 1A3VA 4FP5D 4BA1I 1QNKA 4OIKA 5M5YB 2JEAI 2ZT9C 1EYAA 1SAPA 1TS2A 1VMCA 4K2LA 4KHVA 1D1KA 2L9HA 4CKEA 2MJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0W A;  1SYE A;  2F0V A;  2SNS A;  4RKB A;  2SOB A;  1EZ8 A;  4KY6 A;  2HQE A;  5C4Z A;  1TR5 A;  1II3 A;  3MZ5 A;  1EYC A;  2PZT A;  4ID6 A;  2EYJ A;  4KD4 A;  5KGU A;  1STY A;  5IIF A;  5CR3 A;  3E5S A;  4NDX A;  5CGK A;  2F3W A;  4N9T A;  2EXZ A;  2PZU A;  2O4X A;  1EY9 A;  5HGT A;  5CV5 A;  1EY0 A;  1EY7 A;  2EY5 A;  1RKN A;  3U9O A;  1KAA A;  2EY1 A;  2OXP A;  4NMZ A;  3TP6 A;  2F0N A;  2EYM A;  2PYK A;  5C4H A;  2F0O A;  3R3O A;  4HTH A;  3TP8 A;  5JOB A;  4E6I A;  5KEE A;  1ENC A;  1STG A;  1SYC A;  5KIX A;  2KHS A;  3MEH A;  4QF4 A;  4QB4 A;  5E1F A;  1SNC A;  1TQO A;  3TP7 A;  5HUR A;  5IGC A;  5IOD A;  4KTA A;  5KYI A;  5DEH A;  2F0D A;  3TME A;  4IAL A;  4IUN A;  4KY7 A;  4EQO A;  3OMC A;  3NXW A;  3QOJ A;  3V2T A;  2F0L A;  3LX0 A;  3DMU A;  3SR1 A;  1EY4 A;  5C6A A;  3NQT A;  5CV8 A;  4EQN A;  2OF1 A;  4B9X A;  4K5W A;  3P75 A;  4LAA A;  4RKL A;  1F2Y A;  2M00 A;  4ME5 A;  5KRU A;  5JAV A;  2F0M A;  3SK6 A;  5C3X A;  2KQ3 A;  4G57 A;  4WOR A;  2EYO A;  4EQP A;  4KJO A;  1KDC A;  2ENB A;  5K5P A;  4PNY A;  3SXH A;  4K6D A;  2OEO A;  2EY2 A;  2F0T A;  3VA5 A;  3HZX A;  1JOQ A;  3D4D A;  5CV7 A;  3H6M A;  1ENA A;  4S3S A;  4DGZ A;  1EZ6 A;  4DFA A;  5I6W A;  3C1E A;  4NP5 A;  4DF7 A;  4F8M A;  1U9R A;  3ERO A;  4QMG A;  4H7B A;  4KV6 A;  5CV6 A;  4PMC A;  1STB A;  3MXP A;  4HMI A;  4J1M A;  4ZUJ A;  5IGB A;  3S9W A;  2SNM A;  1KAB A;  3D4W A;  3HEJ A;  2EYL A;  4NKL A;  1EY8 A;  4OL7 A;  1EQV A;  5EGT A;  2RKS A;  3DHQ A;  1EY6 A;  1JOO A;  2EYF A;  5IGD A;  5IGE A;  1A3U A;  1TT2 A;  2F0P A;  2NUC A;  4WRD A;  2EY6 A;  2F0Q A;  3MHB A;  3P1H A;  1EYD A;  4IZ8 A;  3ERQ A;  3NP8 A;  3OMG A;  4HMJ A;  1KDA A;  5C5M A;  1STN A;  2F0U A;  2F3V A;  5J39 A;  1A3T A;  2RDF A;  5J22 A;  3ITP A;  3RUZ A;  4TRD A;  3T16 A;  5EKK A;  4ZQ3 A;  3TP5 A;  4I65 A;  4ZUI A;  1STA A;  2LKV A;  2F0S A;  2PW7 A;  4K8J A;  1AEX A;  3OWF A;  5ISR A;  4N9P A;  3EVQ A;  5IOC A;  3NHH A;  2F0F A;  5IGG A;  1A3V A;  2F0K A;  5IGF A;  2QDB A;  5NUC A;  3BDC A;  4YIJ A;  2WAC A;  1JOK A;  1A2U A;  5E3F A;  5I9P A;  5I6Y A;  1SNP A;  4J6H A;  3QOL A;  4K5X A;  3T13 A;  5KYL A;  4B9W A;  4EVO A;  1JOR A;  3BDL A;  1STH A;  3PMF A;  1KDB A;  1SYD A;  2PZW A;  1A2T A;  4K8I A;  5CV4 A;  4F7X A;  3MVV A;  2PW5 A;  1SNM A;  2EYP A;  4K2K A;  1EYA A;  2PQE A;  1SNQ A;  5C5L A;  3SK4 A;  1SND A;  4K5V A;  3NK9 A;  1SYG A;  3NUC A;  3D6C A;  4MIU A;  4R8N A;  5F2D A;  3SK5 A;  5C3W A;  4PMB A;  1SYB A;  5I9O A;  5J1Z A;  1SNO A;  4DU9 A;  4K2L A;  5CC4 A;  3C1F A;  5M9O A;  4KHV A;  4K14 A;  5CV9 A;  1F2M A;  3EJI A;  3D8G A;  3SHL A;  5EKL A;  4KJN A;  2F0G A;  1EY5 A;  1F2Z A;  1NUC A;  2EYH A;  4ODG A;  2F0E A;  2F0J A;  2F0H A;  1NSN S;  2F0I A;  4KD3 A;  1SYF A;  1IHZ A;  2RBM A;  3OSO A;  5DAU A;  3SK8 A;  4KY5 A;  3QB3 A; 
#chains in the Genus database with same CATH topology
 2Q8R E;  2R92 B;  3K7U C;  4BWG B;  3X3N A;  2CQA A;  2EYJ A;  4L5T A;  4GNX C;  1CSP A;  1ICW A;  3A8J E;  5A2Q L;  1WTV A;  5LMN L;  4N9T A;  3L9A X;  3S15 H;  4OIJ A;  1I4G A;  1PFS A;  1V9P A;  4WJ3 M;  2HDM A;  3CCU A;  1C0A A;  2YYZ A;  3R3O A;  3IL8 A;  4ZYS A;  4HJ7 A;  4LNQ A;  1QZG A;  3BU2 A;  4H13 C;  1BQQ T;  1RTO A;  3TME A;  4BXX H;  2JQO A;  3FPU B;  4A3C H;  2VNU D;  4WJW A;  4IQZ A;  2CH4 A;  1XNR Q;  3NQT A;  1ZEQ X;  3NTH A;  5IP9 G;  1P16 A;  4DK0 A;  3PF5 A;  4WOR A;  1UE6 A;  5GRO A;  5DNF A;  4A3F G;  4PNY A;  2Q2I A;  4LF9 Q;  4FF2 A;  3VA5 A;  1D5M C;  2VL6 A;  4HCS A;  1HH2 P;  3H6M A;  2LXK A;  4OO1 G;  1ICF B;  2EJM A;  3VA7 A;  3HP3 A;  1SMY D;  4QGU A;  2QEJ C;  3S1R B;  4DV4 Q;  1DYQ A;  2K50 A;  4A3E B;  1TKW B;  2KCC A;  1PH8 A;  1HJP A;  3KLW A;  2IWH A;  4WRD A;  1HUM A;  3OMG A;  1FNW A;  5C5M A;  3N6R A;  4X65 Q;  2CW0 C;  3TBI B;  2A6H D;  2JEB I;  2R7F A;  1QUQ A;  4JV5 L;  1ET9 A;  1FNV A;  1QCB D;  3E9H A;  4X3U A;  2IX3 A;  4I65 A;  4K8J A;  2EVB A;  2CCZ A;  1K3B C;  3J7A F;  1CKO A;  1WTX A;  1OO9 B;  3I4L A;  1KTK A;  2K7V A;  2Z1C A;  4JYA Q;  4NB3 A;  4B3T Q;  3GTG H;  2WAC A;  1HZB A;  1JE5 A;  5KGU A;  1SYD A;  3CHB D;  1NNX A;  3R8B A;  2M2L A;  2Y0S E;  1W2B A;  2K1B A;  3I90 A;  1GUO A;  5C3W A;  5I9O A;  2VB3 X;  1X3P A;  3BVZ A;  1A62 A;  1WI5 A;  1H9R A;  2MO0 A;  2JA8 H;  1R4Q B;  2F0H A;  1SYF A;  4G4K A;  1X56 A;  2K75 A;  4OEM B;  1LT5 D;  3RD4 A;  1NMG A;  1OTC A;  1HQR D;  2PZT A;  3NTI A;  3ZJY C;  1IBM L;  3HOV H;  2F3W A;  3BZC A;  1UNS A;  4A3M B;  4C56 C;  4U67 3;  2B2Y C;  4LWC A;  1YI2 A;  2R93 H;  3TP6 A;  2VQF Q;  1Y14 B;  3RLF A;  4AYB E;  2E2I B;  2NZH A;  3VR5 A;  1ENC A;  4POG A;  2NVX B;  2HD3 A;  3ND9 A;  2M9V A;  2VQF L;  4HSP A;  5IOD A;  2BDN A;  1JIC A;  1Y8N B;  3HOX H;  4YCU A;  3V2T A;  5LMU Q;  1TWG B;  5JEA G;  4B9X A;  4XDX A;  2PNH A;  3P75 A;  2CHB D;  3PUY A;  1HQM C;  4FF4 A;  4LFB Q;  2EYO A;  2R92 H;  1PTO F;  2K01 A;  1EQQ A;  1VF7 A;  1WTW A;  3CKI B;  1WJJ A;  1GUT A;  3PO2 H;  5FK9 C;  1O7Y A;  2AQ2 B;  5T1I A;  4H7B A;  2UXB Q;  4YY3 L;  2UUA L;  2KCM A;  1GOZ A;  1B9M A;  3GP7 A;  3NPP A;  2UXB L;  2L55 A;  5ELN A;  2KUM A;  2CH4 W;  4FDB A;  5C4X G;  1A3U A;  2A6E D;  4HJ8 A;  5M5Y H;  3HOZ B;  1EWI A;  3NQI A;  2MNA A;  3E0E A;  2F0U A;  3EQL C;  4IUU A;  3G4S A;  4CDD C;  1PTO C;  4A3B H;  4TRD A;  5AFW A;  1E2W A;  5IYC H;  1PZK D;  1BKB A;  2F0S A;  4IUT A;  4LFA Q;  1LV9 A;  3OWF A;  4KN7 C;  5IYD H;  1CQF A;  3KK7 A;  3L3O C;  1K83 H;  4J6H A;  1UE1 A;  3HOU H;  1PDQ A;  4EVO A;  1JOR A;  4K8I A;  2JA5 G;  1HNX Q;  3QIA A;  2EYP A;  4LF8 L;  2CWP A;  5C5L A;  3HGB A;  2F4I A;  3HOY H;  1IYJ B;  5EPL A;  1CKM A;  3PCO B;  1TVX A;  2QIL A;  2K03 A;  1MJE A;  2UU9 Q;  1U4P A;  3TS0 A;  4AH6 A;  2HHH L;  1B53 A;  3A56 A;  2KEC A;  4KJN A;  1IBM Q;  4LF9 L;  2NB0 A;  3Q6S A;  3DWQ A;  1U5K A;  1IHZ A;  3AMU A;  3QB3 A;  4DR7 Q;  3J81 i;  3L2P A;  2A74 C;  1EZ8 A;  4YWM A;  1I4Q A;  1K0S A;  3K80 C;  4IUR A;  1OXU A;  2PZU A;  3M7G A;  4UPA A;  1K28 A;  2EXD A;  2QCP X;  1I6H H;  4RAU C;  4PMW A;  3MEF A;  2WII B;  3CU7 A;  4ME3 A;  1K83 B;  1WFQ A;  5EBC A;  1HXY D;  2EPB A;  4TSS A;  1QWY A;  1V1P B;  2K5D A;  3HFZ B;  4G7O C;  1LAB A;  2GVB A;  2L0C A;  3STB C;  3CCS A;  2F0L A;  1QUQ B;  1I5F A;  1EY4 A;  1UWV A;  2PQA A;  2MUY A;  3I56 A;  5KNB A;  4LAA A;  4RKL A;  4ME5 A;  3JAM L;  3MXU A;  1U4M A;  1B44 D;  2FIN B;  1NE3 A;  4KJO A;  2K5N A;  4XIG S;  2WV6 D;  1L1O B;  3HZX A;  1XMO Q;  1QNU A;  4OHJ A;  4LF6 Q;  3OOC A;  1X6O A;  1ENA A;  1N32 Q;  5GAE C;  1LTI D;  4BY1 H;  1QE6 A;  3K7A H;  4R8I A;  2FMM A;  2X69 A;  3AEV A;  3EN2 A;  4UP9 A;  3S9W A;  1MSH A;  1C4Q A;  4TVA B;  4A3F B;  4A93 G;  3GV3 A;  4NKL A;  4MTN A;  5EGT A;  3QG1 A;  1SJH D;  4DF7 A;  4P73 A;  4KKT A;  1Q1B A;  2R93 G;  4LUV A;  1ILQ A;  1B1Z A;  1Y1V H;  3FKI B;  1SSO A;  3RUZ A;  2E74 C;  4IJH A;  4DNI A;  3IFT A;  3JC6 6;  4MZ9 A;  4BY1 G;  2B39 A;  4NXN L;  2B2W C;  1IBK L;  2ZXR A;  3K5L A;  1BNZ A;  3MXG A;  1BUV T;  1SNP A;  1NR2 A;  3HKZ G;  1I4R A;  1MGS A;  2BH2 A;  3S16 B;  4KHZ A;  2IPK D;  4DK3 C;  1JE4 A;  1SE2 A;  1E1O A;  1W3S A;  1SN8 A;  3I72 A;  4A3M H;  4L8J A;  3SK5 A;  5K36 H;  3H3V H;  1SYB A;  2LY7 A;  1PH6 A;  3HOV B;  5LMN Q;  5EAY A;  5CV9 A;  3QR8 A;  3RLN A;  4FYD A;  1NUC A;  3M3Y B;  3UI2 A;  1NSN S;  1Y1W B;  1Q8K A;  1HA6 A;  2JA8 B;  1SEB D;  4OWW B;  2HDL A;  5J3B A;  2I5L X;  4KD4 A;  1SXT A;  1VQJ A;  1K73 C;  5C0X J;  1LTA D;  1KD1 C;  3F1Z A;  4Q5V A;  3F2D A;  4BY7 G;  4DK6 C;  4XYO A;  3FEW X;  4A3B G;  2R7D A;  3HG9 A;  4X3S A;  2DN8 A;  3EFX D;  2HIX A;  4LF7 L;  3GTO B;  4QB4 A;  1E1T A;  2F0D A;  4LW1 A;  4IPD A;  3Q0A A;  3OMC A;  3BVG A;  4GS3 A;  1AW7 A;  3FPP A;  2OF1 A;  1SDF A;  5C3E G;  5COY A;  4GOP B;  5KRU A;  2A69 D;  3D6W A;  3LWU A;  3VR2 A;  1VQB A;  2WIN B;  2RA4 A;  4BY7 H;  2B2W A;  4X62 Q;  1SRO A;  1JOQ A;  4X66 Q;  2WB1 B;  4RFB A;  2CQO A;  4F8M A;  2WAQ B;  1DM0 B;  2EE1 A;  4KV6 A;  1EFW A;  2I07 B;  3GDE A;  4FNF A;  4HMI A;  1Q1E A;  2AWO A;  3D4W A;  4HIK A;  2I5M X;  2XTI A;  2BOS A;  2E2H B;  1F9Q A;  1PRT B;  1NTG A;  5EBD A;  5AJ3 Q;  4DNR B;  3NP8 A;  5IP7 G;  2B8G A;  1J9O A;  1I50 B;  4NW2 A;  3F8T A;  4BA2 I;  4A3G G;  2EQS A;  4ZUI A;  5KNC A;  4DR6 L;  3IRB A;  5C4J B;  3GTM H;  1LLR D;  3OPO A;  2AUK A;  3G71 A;  4QL5 A;  3J80 c;  2VQE L;  4DK1 A;  1A2T A;  3TRZ A;  1FVI A;  4OGQ C;  5C3E B;  2EJF C;  4K2K A;  5A35 A;  2Z4H A;  4X64 Q;  1I6V C;  3GTM B;  4LF4 Q;  4B3M Q;  2KCT A;  1CKN B;  4CGY B;  4JI0 L;  3CCE A;  1RIP A;  3PO2 G;  3EJI A;  1N36 L;  4DV5 Q;  3GTQ B;  2IJ0 A;  3W2D A;  3ND8 A;  5I2Y A;  2XVS A;  1V43 A;  3SK8 A;  4KLK A;  3S17 B;  4MN3 A;  2MO1 A;  1YHA A;  2E2H H;  1O7I A;  2A68 C;  1EEF D;  5M5W B;  1YNJ D;  3PO3 G;  1Q8I A;  3MA2 B;  3AB9 A;  1W6K A;  5IE8 A;  1EY0 A;  4PG3 A;  4FXD A;  5JVG 3;  1KAA A;  1JQY D;  1UE5 A;  3T51 B;  1L1O A;  3AU7 A;  4X65 L;  1HFG A;  1TQO A;  2BA1 A;  1EU3 A;  4KTA A;  1HNZ Q;  5D14 A;  5DEH A;  4P71 A;  4IAL A;  2JK8 A;  1X32 A;  2FJ2 A;  2UUB L;  2ATW A;  1IBL Q;  1M8A A;  2QGQ A;  2CW0 D;  4OX9 L;  3ERS X;  3KUP A;  1X54 A;  2C5C A;  5BR8 Q;  5CBA E;  3SK6 A;  1F77 A;  1A8V A;  2A68 D;  3A7A B;  1PHJ A;  3TZU A;  5ELB A;  4A76 A;  1MBY A;  3GTO H;  4DAY A;  2F03 A;  5CV7 A;  1EZ6 A;  3IFD A;  3M4O B;  1KL9 A;  1U9R A;  3KF8 A;  1XTD A;  4C3H G;  4PMC A;  1STB A;  2L5T A;  1KQS A;  4F87 A;  5IGB A;  1EQT A;  4CJ1 B;  3HOW H;  2JA7 B;  2A5H A;  3A0J A;  2Z4I A;  4GLX A;  1Y1W H;  2OCE A;  5IT9 c;  1LTL A;  3ITP A;  3VR6 A;  5M3F G;  5IWA L;  4B3M L;  1PRT D;  5I4D A;  2NVY B;  2XRS D;  1HA5 A;  4UY8 C;  1EEI D;  4JK1 C;  1O7L A;  4OO1 H;  1TY2 A;  2VY3 A;  3O13 A;  4PQX A;  5LL6 X;  1YZ6 A;  2FXQ A;  4B9W A;  1KLU D;  2R7Z G;  1NY4 A;  3TRE A;  2UXC L;  4JI5 L;  1SBB B;  4IFD G;  4Q0F A;  4IN3 A;  4K5V A;  2FFK B;  1CTM A;  4HED A;  3D6C A;  3S24 A;  1I3Q B;  5J39 A;  2IX0 A;  2MPM A;  1TWH H;  3S2H B;  4LJZ C;  3OTO Q;  3P20 A;  4K14 A;  4ZAI A;  3FKI H;  2X6G A;  3SHL A;  1Y1V B;  1EY5 A;  2N78 A;  3H94 A;  3PGZ A;  3TQY A;  2F0E A;  1Q86 C;  4DA2 A;  2F0I A;  2XRQ D;  4IJL A;  3S1N B;  2JE6 I;  1LO5 D;  1JC7 A;  1FNU A;  1STY A;  1E0B A;  1PTO H;  3K0X A;  1TWC B;  2R3Z A;  5IYB H;  4A3J H;  2E5L Q;  4X66 L;  4BY1 B;  1HNW Q;  2O2L D;  4RA8 A;  1J5E L;  3IAY A;  1B70 B;  2KVM A;  1SNC A;  1XMQ L;  3D31 A;  4JI4 Q;  3NXW A;  1V1O A;  1FL0 A;  1DZ1 A;  2L15 A;  3VYS A;  3P7J A;  2PQA B;  4WFN 3;  1FJG Q;  3H91 A;  2ENB A;  1BBU A;  4M8A A;  2EY2 A;  4DUZ Q;  4TKO B;  1TU2 B;  1I6H B;  3M7N A;  4JI6 L;  4UAI A;  1EUJ A;  3PUZ A;  5EPJ A;  2SDF A;  4A93 B;  1GHK A;  1LAC A;  4ZUJ A;  2B2V C;  4BBS G;  1Z47 A;  4JBK A;  1VQF A;  1YNN D;  4IPC A;  1GUN A;  2EY6 A;  5FLX c;  1EYD A;  3ERQ A;  5E7N A;  1KDA A;  3B6Y A;  1J8I A;  1WTP A;  2BE5 D;  1PH3 A;  2D9U A;  2IW3 A;  1SJE D;  1VQG A;  1WD0 A;  2KHI A;  1STA A;  2LKV A;  4B08 A;  1N8R C;  4XTC S;  2B63 H;  3UDF A;  2YU9 B;  1D6E C;  1DGS A;  3CMA A;  3FMC A;  2E2J B;  1MSG A;  1ZYR D;  1CI3 M;  3HOU B;  4K5X A;  4HIM A;  2K5Q A;  3MFY A;  4NPS A;  2ZJR A;  5C4X H;  2PZW A;  1IBK Q;  2A6H C;  3PIP 3;  3HRZ C;  1ASZ A;  1L0X B;  3PO3 H;  1CSQ A;  1SNQ A;  4A3I B;  4O0A A;  3FVQ A;  1G51 A;  3M4Y A;  2WAQ G;  4EQ5 A;  4IPG A;  5J1Z A;  1IXR A;  3GTP H;  1SNO A;  1VQI A;  5IYC G;  3VDY A;  1ESR A;  2ICI A;  2RBM A;  3J7Z C;  1G29 1;  4DV3 Q;  1GUG A;  3RR5 A;  1JMC A;  3G6J B;  4A3C G;  3KDF B;  2YTX A;  3G7L A;  4GZY C;  3CCL A;  3PQI A;  2BCO A;  1WVL A;  1TWA B;  1RTN A;  4N8X 1;  1H9M A;  1YHQ A;  2ZM6 L;  4LF6 L;  1N32 L;  3DEO A;  3U50 C;  1XMO L;  2OXP A;  4JI5 Q;  4NXM L;  3K6O A;  4BBR G;  5EPK A;  2NTS A;  3UDG A;  5KEE A;  3TN2 A;  2RSO A;  4FVM A;  1Q82 C;  2K6A A;  3JAM E;  1DON A;  2WP8 J;  5D3I B;  3RMH A;  4R4Q A;  4FXK C;  2ZJQ A;  1I94 Q;  3GTJ H;  1VCI A;  4Y52 H;  1C9O A;  5JPM C;  3GO5 A;  4PZ8 A;  3NBI A;  3BZD B;  4DKA C;  4K6D A;  2F52 A;  1LTB D;  2OTL A;  2A19 A;  4JI8 Q;  2ALY B;  3D3R A;  4GNX A;  1PH5 A;  1JJG A;  3F2U A;  2DNC A;  1RF2 D;  3J81 E;  3I4M H;  5FO8 B;  3A54 A;  2SNM A;  3DUZ A;  5E4W C;  2EYL A;  1TWF H;  1ILP A;  4ILW A;  1SE4 A;  2EYF A;  5FOB B;  3KLR A;  1KNE A;  1T5E A;  3KBG A;  4HMJ A;  1CA6 A;  2UU9 L;  1A3T A;  4DR6 Q;  5BR8 L;  1S5C D;  1B2T A;  2F4V L;  2JA7 G;  4B3R L;  1PXU A;  3NHH A;  2F0F A;  1FGB D;  2QDB A;  3I4M G;  3H0G G;  5E3F A;  1VQ6 A;  1ROD A;  1EU4 A;  3HOW G;  3I4N G;  3S2D H;  1T5X D;  1KDB A;  1X9N A;  4JBM A;  1GM5 A;  4I7A A;  3D0F A;  2V1C C;  1O7Z A;  1Z7T A;  1KHI A;  1BBW A;  3Q8D A;  1EFI D;  2HT1 A;  5CC4 A;  1SMX A;  4DV0 Q;  1HZ9 A;  2G9D A;  5JJL A;  3PIO A;  5C44 B;  3CF5 A;  4UP8 A;  2NWG A;  4JBW A;  1B3A A;  4ZQ3 A;  1KNA A;  1QIL A;  5LMN W;  1BF4 A;  4ZKB B;  1YEZ A;  3S1R H;  3IKJ A;  3NWT A;  1VQK A;  3KF6 A;  2E76 C;  1KAW A;  2JXM B;  1S3O A;  3PF4 A;  3CCR A;  4A4I A;  2KA7 A;  5GAG C;  2JA6 G;  4LFB L;  2VQE Q;  4ALP A;  4QF4 A;  1T9H A;  4GN4 B;  4GOP A;  1TWF B;  3DM3 A;  3KBX A;  2JYO A;  3I4M B;  3GTL B;  5DLQ E;  4C3I B;  4WJ4 A;  5ELO A;  2MP1 A;  1Y69 U;  4K5W A;  3A8K E;  3RLO A;  4RHS A;  5JAV A;  2JP1 A;  1PFB A;  1VQ8 A;  4XYQ A;  4QY7 A;  2RF4 A;  1KIX A;  3BS1 A;  5D65 A;  3W5O A;  1L0Y B;  4C3H B;  5I6W A;  2RDG A;  2DNE A;  3CPW A;  1PZI D;  3V05 A;  3TZD A;  5C0X I;  1UE7 A;  3E9I A;  5M3M G;  4CKB A;  1TS4 A;  3HEJ A;  1VQO A;  3K5N A;  3FHW A;  3PUV A;  2NUC A;  4IZ8 A;  2F0Q A;  3W1B A;  4X62 L;  4DAP A;  2UXD Q;  3J80 i;  4DV2 Q;  4GOP C;  4AQY L;  4NXN Q;  1YVC A;  3S1Q B;  1EOV A;  2PNR C;  2EZV A;  2WKC A;  5IOC A;  1LTS D;  1TY0 A;  2JA9 A;  1ESF A;  4RHR A;  1PVO A;  2E75 C;  4YHH Q;  3G48 A;  5I9P A;  3CCM A;  1CKN A;  4R9W A;  3H0G H;  4GN3 B;  4O1N A;  2JN4 A;  3RZO H;  3CCV A;  1LTG D;  2B3G A;  3T56 B;  4JI7 Q;  2D0O A;  2YTV A;  1WTO A;  4A3D H;  3PSI A;  1O80 A;  3NK9 A;  1SYG A;  3CME A;  2DUD A;  2K5W A;  2R92 G;  2RHQ B;  4BS9 A;  1N33 Q;  4A3I H;  1HFN A;  3C1F A;  2K05 A;  3D8G A;  4OXP A;  3TEH B;  2FMC A;  1F2Z A;  2EYH A;  1D2B A;  1BVS A;  3OSO A;  1DOL A;  3WOF A;  2DGY A;  4DV7 Q;  2VUM G;  1QVC A;  2PO4 A;  2E2J H;  4JI2 L;  4BBS H;  3HOV G;  3SE0 A;  2YU9 H;  5IIF A;  1NMF A;  1SFO H;  2ES2 A;  4CBV A;  3K8A A;  1H9J A;  2RCN A;  4QCL A;  2O4X A;  1GKH A;  2WB1 E;  1ZXT A;  4DR2 L;  1GJX A;  1GO3 E;  2K33 A;  4YWK A;  2IY5 B;  1K3R A;  4FF1 A;  2Q2T A;  1GUW A;  2JA6 H;  1YJ9 A;  1RHP A;  1BR9 A;  4DV1 L;  4F88 A;  1Q12 A;  2N55 A;  2XIW A;  4DR1 Q;  1XNR L;  2UUC Q;  3OIQ A;  4A93 H;  3DMU A;  3I4N H;  2ASB A;  2BDO A;  1HZA A;  2PMZ E;  3STB D;  3OYY A;  5GAD C;  2R7Z B;  2NYZ D;  2RDH A;  3K5O A;  4EQP A;  2HIV A;  4OON A;  3GV6 A;  2F0T A;  4DR2 Q;  1HHV A;  1S5D D;  1Q3L A;  4DGZ A;  4DFA A;  3PUX A;  4JI3 L;  1EIF A;  4OX9 Q;  5M3M H;  2HCC A;  4LF8 Q;  1X3G A;  2VXW A;  3DWA A;  3FDT A;  3AFP A;  1LYL A;  4DV7 L;  2RSN A;  3S1M B;  3OW7 A;  1W6J A;  1HNZ L;  2AWN A;  2X6L A;  3P1H A;  4IFD H;  1HPC A;  1BBX C;  1KLG D;  2SEB D;  4DAV A;  4LFA L;  5CYU A;  1TS5 A;  2J4X A;  1JWU D;  1FD7 D;  1D1I A;  2AQ1 B;  1Z9F A;  3MXN B;  4A3J B;  1TWC H;  3J80 E;  3MTS A;  4A3G H;  1PTO B;  2B63 G;  3W3A A;  5BN3 A;  5GQO A;  4A3K H;  3RZD H;  1N34 Q;  3A5U A;  2F0K A;  2HUG A;  1XXG A;  2ICE C;  5ELC A;  5NUC A;  4YIJ A;  4XQQ A;  5FLX L;  2F3I A;  1Q81 C;  2L1B A;  4XQN A;  4KMU C;  1SNM A;  3CAM A;  3HKS A;  1F9S A;  1TWH B;  4DV5 L;  4LUZ A;  1QVF A;  4PMB A;  2QDL A;  3A7L A;  4YCW A;  4DU9 A;  4LF5 Q;  2BA0 A;  4LF4 L;  3DXJ C;  1DD2 A;  5EKL A;  4QUF A;  4C2M B;  4JOI C;  1YNX A;  1EWC A;  2VS1 A;  2EJG C;  2K14 A;  3BYY B;  4DR4 L;  3HOX G;  2VUM H;  1SYE A;  2K32 A;  2SNS A;  4EGV A;  4XQJ A;  4LMQ D;  3KFU A;  1II3 A;  1EYC A;  1JR0 D;  4DUY L;  3J7Y W;  1PLF A;  2R7Z H;  1F2L A;  1WCM B;  3K5M A;  4V19 0;  3ULJ A;  1UEA B;  4PZ7 A;  1EY9 A;  3UDX A;  3WWV A;  1WCM G;  2EY5 A;  5TSS A;  2AHO B;  3C2P A;  2EY1 A;  3R2I A;  4JOI A;  5C0X G;  5HGQ A;  1IZ6 A;  1HNX L;  2N49 A;  4DXF A;  4E6I A;  3NTK A;  4C3J B;  2JA7 H;  2KHS A;  5HUR A;  3HOW B;  1HR0 W;  4RG1 A;  1YNN C;  1CFM A;  3TDQ A;  3C3L A;  1A15 A;  4KY7 A;  4PV1 C;  4Z9C B;  3QOJ A;  2B2U C;  2N88 A;  3LX0 A;  3SR1 A;  4JI1 L;  4ZK9 B;  2N8N A;  1K8G A;  3M4O H;  5CBE E;  3S14 H;  1ZYR C;  3L7Z C;  5IP9 H;  1RL2 A;  2B2Y A;  5FLM H;  5IP7 H;  3SXH A;  4QIW E;  4OO1 I;  2OT2 A;  2XWJ B;  3LGJ A;  2YTY A;  5ELE A;  2EOT A;  3MXP A;  4A3E G;  4YY3 Q;  1AZQ A;  5M3F B;  1VS0 A;  1AN8 A;  3A8I E;  3I70 A;  3JAM c;  2Z6B A;  4A3D B;  3FRP B;  4EX5 A;  1WYD A;  2K04 A;  4JYA L;  2YV5 A;  4CDE C;  2NVT H;  1G8Z D;  1WOC A;  2VB2 X;  3J80 L;  1KC8 C;  1EOT A;  3M85 A;  1VQ9 A;  1MD2 D;  4OWT B;  4H02 A;  4CJ2 C;  5ELF A;  1NAP A;  4BBR B;  2L4N A;  3KLS X;  2KHJ A;  3CRL C;  4JV5 Q;  2A1A A;  3WOE A;  5LMU L;  1QZH A;  2K4K A;  1GUS A;  5IGF A;  3S1Q H;  4U68 A;  3S17 H;  4O2D A;  4RCN A;  3J81 j;  1K8A C;  3AYH B;  3M9B A;  1YIJ A;  3GTQ H;  5JJI A;  1L2F A;  3NBH A;  3I8Z A;  2C35 B;  1SND A;  2IL8 A;  4ZRZ A;  1PRT C;  3NUC A;  4R4O A;  1HR0 L;  1MIU A;  1IKM A;  4P72 A;  1B50 A;  1AP0 A;  4RCO A;  4KI0 A;  5M9O A;  1Q46 A;  1KRT A;  1CA5 A;  1LM0 A;  4DUY Q;  3LWE A;  1K8M A;  1P8L A;  3KF8 B;  4C3H H;  2F0J A;  2AMC B;  1S5B D;  4Y7N B;  4XXE A;  3CC7 A;  4HID A;  4CHT B;  4KY6 A;  5A2Q E;  2KJX A;  3MZ5 A;  1R4P B;  1QJO A;  5C4J H;  1XNQ L;  4DV6 L;  4A3D G;  4LF5 L;  1PYS B;  2UUC L;  4C3I H;  2NVQ B;  5CV5 A;  1I50 H;  3ZYY X;  2XNA C;  3VYT A;  3PIO 3;  4DV1 Q;  2EYM A;  1V1Q A;  4HTH A;  1H95 A;  1I94 L;  1EWH A;  1SYC A;  3TSS A;  2DJG C;  4LUO A;  2F1M A;  5KYI A;  3I2Z A;  3MXN A;  1G6P A;  1RD9 D;  3BYT B;  2Z9H A;  5FLX E;  2L11 A;  4YWL A;  3NEL A;  4EQN A;  5EQ0 A;  2C9O A;  2A73 B;  2EDG A;  1VQM A;  2NVT B;  5C3X A;  2Q2H A;  1LT6 D;  1Y1V G;  3J81 c;  1XJV A;  1IL8 A;  1CZG A;  2CVR A;  3SDZ A;  1M90 C;  1D5Z C;  5M3F H;  3HS0 C;  2I46 A;  5LL6 S;  5C44 H;  3I7F A;  4A3I G;  1E2Z A;  3A74 A;  4P74 A;  4QMG A;  4DV4 L;  2QW7 A;  1MKH A;  4QJF A;  2IT1 A;  4JI3 Q;  1CQV A;  4IPH A;  4JI7 L;  1YJW A;  2H5X A;  4DV3 L;  1EY6 A;  1JOO A;  2WAQ E;  4R4I A;  2ID0 A;  1OXT A;  1JB3 A;  2B2T A;  5FKA C;  3QO2 A;  3S2D B;  2TSS A;  4YHH L;  4H0L C;  2F3V A;  2IX1 A;  1JT8 A;  4ULL A;  1G91 A;  3I73 A;  1OXV A;  3HKZ B;  5M5X B;  1C48 A;  1S5F D;  2BH8 A;  3GD7 A;  1ML0 D;  1SR3 A;  3E0J A;  1VQA A;  4MNO A;  3VYR A;  2MGS A;  5ISR A;  2UXD L;  5IYD G;  2D0P A;  4DV6 Q;  1XNQ Q;  3Q24 A;  5I6Y A;  3NSW A;  1SE3 A;  4AYB B;  1IYV A;  3M3Y H;  4DR7 L;  5COR A;  3MVV A;  4MIU A;  1LTR D;  2RQX A;  5F2D A;  1WCM H;  3BVM A;  1H9S B;  1PRT F;  1SRU A;  3CCQ A;  2HHH Q;  2K5H A;  2N3S A;  4JW0 A;  1HR0 Q;  2DJF C;  2VUM B;  3S16 H;  5DAU A;  4C2M H;  5BN5 A;  2I0Q A;  3I3C A;  3F2B A;  2SOB A;  2HQE A;  3GTJ B;  1EYG A;  1K8O A;  4DR3 Q;  4NDX A;  1V8Q A;  1C7Y A;  1N33 L;  4GKJ L;  2XSC A;  3U58 A;  3KJP A;  3UDI A;  2LXJ A;  3HKZ E;  4A3M G;  3RNU A;  3NE5 B;  2B2T C;  2JJQ A;  5D3D A;  1AH9 A;  1U0L A;  3MEH A;  1M4V A;  2WFW A;  3LNN A;  4JVZ A;  1PH9 A;  3DLL A;  4A3K B;  1CZW A;  4A3G B;  4IFD I;  3PIP A;  4L5R C;  4IOA A;  3I55 A;  1XMQ Q;  1TWA H;  2UUA Q;  1F2Y A;  1ZKO A;  1LT3 D;  3V96 A;  4AQY Q;  2KQ3 A;  4G57 A;  4IUV A;  4DV2 L;  1S72 A;  2KEN A;  1L0W A;  1J5E Q;  2KOL A;  3DM1 A;  2CWA A;  3ICE A;  3S1M H;  2OEO A;  1HNW L;  1X3E A;  3D4D A;  4G7Z C;  1JCK B;  2CKZ B;  1XWE A;  4NP5 A;  4KKS A;  5CV6 A;  5DM7 3;  2TMP A;  2RHS B;  1H9K A;  1FR3 A;  4GLA C;  1VQN A;  5JJZ A;  5JEA H;  1EY8 A;  1B3Q A;  2RCF A;  3DHQ A;  1EL0 A;  3T4A C;  1PTO D;  5C4X B;  5G3L F;  1VQH A;  3OTO L;  1BDO A;  3KDF A;  3WDN A;  5J22 A;  2ZTE A;  2KEE A;  1BO0 A;  4X3T A;  4A3L H;  3I4N B;  2B63 B;  3UE0 A;  2VW9 A;  2QF7 A;  1XTC D;  1ENF A;  4I7Z C;  2H1E A;  3VR4 A;  2PPB C;  3BDC A;  1CT1 D;  2JA6 B;  1V1P A;  4RGT A;  3W1G A;  1STH A;  4DR4 Q;  3DWP A;  2JSO A;  2PQE A;  2QEX A;  4C3I G;  1S4Z A;  4HR7 B;  3ULP A;  1DOK A;  1STE A;  2LMC B;  1F9P A;  3HOY B;  4K0K Q;  4ZKC B;  1O78 A;  4GKK Q;  1VQE A;  1YIT A;  1I4P A;  1LUZ A;  1E22 A;  4RWS C;  4DXG A;  2NN6 G;  2QA4 A;  4V0B A;  1CK1 A;  5JVH 3;  1YBY A;  1N34 L;  3PV0 A;  2Q8T A;  2D2C C;  3E5S A;  2J7Z A;  2EXZ A;  2OWO A;  1WD1 A;  5HGT A;  1PH1 A;  4A3B B;  2RVL A;  3U9O A;  1HZC A;  4NMZ A;  3T53 B;  2F0N A;  3CCJ A;  1OXX K;  1VDZ A;  4C3J G;  4DAY B;  2PYK A;  4JBJ A;  4XT3 B;  3RZO B;  2DY7 A;  2F0O A;  3CD6 A;  3TP8 A;  1SE8 A;  3CW2 C;  3H0G B;  3HOZ H;  2I5H A;  1PH2 A;  1SLJ A;  5IGC A;  3TP7 A;  4UP7 A;  1C8C A;  2Q8I B;  1J6Q A;  5IT9 E;  4JC0 A;  1IBL L;  3PUW A;  4B3R Q;  1LT4 D;  5EJW A;  4ZCK A;  5C6A A;  1E24 A;  2NN6 H;  3HOU G;  1JJC B;  4HJA A;  2MQH A;  1IL2 A;  4UDU C;  5JEA J;  3PO2 B;  1BCP D;  2EIF A;  3T1Y L;  2D62 A;  2WB1 G;  2Z0S A;  1NJI C;  3S1N H;  1G2T A;  2R61 A;  1PYB A;  4J15 A;  1D7Q A;  1G6Z A;  1H9S A;  1Y8P B;  4R1J A;  1ASY A;  1XX8 A;  1TWG H;  3CP0 A;  4GNX B;  1MHW C;  4GN5 A;  3HOX B;  2G9H D;  1XPU A;  3SGI A;  2PCF B;  2Y0S B;  3K81 C;  3ONA B;  5JPN C;  4JCV E;  3A55 A;  2NVX H;  4DR1 L;  3GQB A;  2Y0S G;  1N36 Q;  1TXY A;  3C46 A;  3K59 A;  2XN9 C;  2E2I H;  4H44 C;  2RDF A;  2R93 B;  1N9W A;  4APV A;  3UE1 A;  1NR4 A;  4X3K A;  3FKI G;  4A3L G;  3GTL H;  5KND A;  2HCI A;  1DJR D;  2NVY H;  1EIG A;  4LK1 C;  4CKC A;  3KYH C;  4DR5 L;  4HN7 A;  3EVQ A;  1VQ4 A;  2K52 A;  5IGG A;  1X3Q A;  1JOK A;  1VMP A;  5L37 A;  3VR3 A;  5E4X A;  4JI2 Q;  5BN4 A;  4ABN A;  2BE5 C;  2Z6K C;  4NXM Q;  3TS2 A;  2B29 A;  4HSV A;  1YNJ C;  3CC4 A;  5M5X H;  4JI6 Q;  3OW2 A;  2NBF A;  3KF6 B;  3U9S A;  3J81 L;  3EA6 A;  3EBE A;  1E7Z A;  4L63 B;  4ODG A;  1EIY B;  4KD3 A;  3G6E A;  1RDP D;  3KLS A;  1B7Y B;  3GTG B;  1M1K C;  2HQL A;  5C4Z A;  1VQL A;  1GD7 A;  4FXG C;  3L0O A;  4HCE A;  1PYW D;  5CGK A;  3NBH B;  2O5J C;  1EY7 A;  5K36 G;  1RKN A;  4XT1 B;  4LFC L;  4KHP L;  5DM6 3;  3RN2 A;  2QKI C;  1STG A;  3T1H Q;  1BOS A;  5KIX A;  1L1O C;  2B2U A;  5E1F A;  1HUN A;  4KHP Q;  4LFC Q;  4A3E H;  1CHP D;  3A5Z B;  4EQO A;  2E5L L;  5EKI A;  3BG3 A;  2A69 C;  1WTR A;  3OHX C;  1TS3 A;  4RGN A;  1DOM A;  1NBW A;  4POF A;  5M5W H;  4B3S L;  4LF7 Q;  4DPG A;  4L5Q A;  3K58 A;  2A8V A;  1GXD C;  1XYI A;  2PI2 A;  3RN5 A;  2KED A;  1PH7 A;  4S3S A;  3C1E A;  1PV4 A;  2PMZ B;  2NVQ H;  1AE2 A;  4J1M A;  1HTL D;  2D5D A;  3F2C A;  2KBN A;  3ER0 A;  2K5V A;  4X6A H;  1QG7 A;  1BCP C;  5IGE A;  5IGD A;  5C3E H;  2L12 A;  5FO7 B;  3FP9 A;  3U4Z A;  1PFM A;  3AFQ A;  3MHB A;  4Y7N H;  1VQ7 A;  3I91 A;  4PZ6 A;  4CDC C;  1OXS C;  1PFN A;  2P5Z X;  3H15 A;  4B3S Q;  4L6T B;  2IHF A;  4IOC A;  3S15 B;  1K9M C;  4JPB W;  5IWA Q;  1A0I A;  4GLV B;  3NEN A;  3QJY A;  3CXC A;  2B2V A;  3SVM A;  4BXX G;  1D8L A;  1A2U A;  2ZTC A;  1GHJ A;  1IYU A;  2ZXP A;  3T13 A;  1A63 A;  4DN4 M;  5CV4 A;  3PMF A;  4RH6 A;  4F7X A;  3MAQ A;  1XPR A;  4KKU A;  4DV0 L;  5I2X A;  1I4H A;  4BBR H;  4QIW B;  4C1N I;  2V4D A;  1VQP A;  3SEB A;  2VZA A;  2KCN A;  1D5X C;  3E6Z X;  3T1Y Q;  1QOH A;  4P2C B;  3Q23 A;  4BY7 B;  1B4O A;  1BCP B;  2F0V A;  4RKB A;  2Z6K A;  1TR5 A;  3GTP B;  1X3F A;  4IO9 A;  1E2V A;  1IW7 C;  1GVP A;  3BDO A;  5CR3 A;  2JA5 H;  1X55 A;  1Y1W G;  1B8A A;  5IYB G;  4A3J G;  3OWE B;  1QVG A;  3PO3 B;  1IKL A;  2F4V Q;  3GTK B;  2GN5 A;  2UXC Q;  1CHQ D;  5C4H A;  5JOB A;  1MI2 A;  4A3K G;  1E3P A;  3MFG A;  4QUC A;  4IUN A;  3S14 B;  3URY A;  1PZJ D;  2IHE A;  4DR5 Q;  4KK7 A;  3R93 A;  4IUP A;  2R6G A;  1I4X A;  3NEM A;  4M1U B;  3JAM i;  4K6L A;  2M00 A;  4ZLT F;  2F0M A;  4L5S A;  4DNT B;  1NCV A;  3MC0 B;  4JI8 L;  1S5E D;  1KDC A;  2XWB B;  3CPF A;  4C3J H;  2G5D A;  2E8G A;  1R9T B;  4GKK L;  2Q2U A;  1UEB A;  1YJN A;  4JI0 Q;  1QB5 D;  3ERO A;  4HJ9 A;  1DCZ A;  1EIH A;  3D4R A;  1HCZ A;  2ZTD A;  2LFN A;  1KAB A;  1JWS D;  4HJ5 A;  1VF5 C;  4OL7 A;  3ULL A;  3J7A V;  1AZP A;  4IFD J;  4AIM A;  5GAH C;  3DEP A;  1BCP F;  4CJ0 B;  2FHT A;  1B9N A;  1TT2 A;  2NTT A;  4N8F A;  3H3V I;  1WTH A;  1STN A;  1VQD A;  3CQZ H;  4OEL B;  1F9R A;  5C0X H;  3J7A 5;  1A6X A;  3KJO A;  1JJ2 A;  1Z6H A;  3T16 A;  5EKK A;  2DY8 A;  4FO2 A;  1AFP A;  1Q90 A;  2ZM6 Q;  4G7H C;  2PW7 A;  2OQK A;  1S40 A;  1UAP A;  4N9P A;  2UUB Q;  1PMR A;  4IUQ A;  3N52 A;  1RJT A;  2K28 A;  3AQQ A;  3QOL A;  2NZO A;  2NN6 I;  5HY6 A;  3BDL A;  1XPO A;  1ET6 A;  3I4O A;  4TQU S;  2GA4 B;  1EQR A;  2PW5 A;  1VQ5 A;  4UHV A;  2B8F A;  2MHV A;  3SK4 A;  3RZD B;  4R8N A;  3HOY G;  1CUK A;  4A3F H;  3MWY W;  3H3V C;  1F2M A;  3K7A B;  4DAM A;  5FO9 B;  3NWS A;  5FJ8 H;  2F0G A;  1PH4 A;  1JB7 A;  5KYL A;  3OIP A;  5IY0 A;  4RGM A;  2AUJ D;  4MTK A;  1VQC A;  4KY5 A;  2F0W A;  4FF3 A;  4HAE A;  3S2H H;  1U4L A;  4ID6 A;  2GVA A;  1ONL A;  4C1N K;  2AQ3 B;  5M3M B;  3R2T A;  1I3Q H;  3H09 A;  4K0K L;  3X3M A;  2E2D C;  5LHY 1;  4MHE A;  3CC2 A;  2A6E C;  5T1G A;  2PI2 E;  2LS0 1;  4X64 L;  3CQZ B;  1HTP A;  1PA6 A;  3HOZ G;  1HRJ A;  1U4R A;  1KXL A;  1FGU A;  4HIO A;  1G2S A;  1YHB A;  2CFM A;  4JI1 Q;  1WTQ A;  1IW7 D;  1DXM A;  1UUP A;  4J8Q A;  5IT9 L;  4GKJ Q;  3VYU A;  1SMY C;  1LTT D;  5CV8 A;  2WKD A;  3M4P A;  2Z8L A;  2MFI A;  4R4C A;  3K0Y A;  4RMF A;  2O5I C;  4QQB X;  1R9T H;  4DUZ L;  4A75 A;  3QWN A;  2J0T D;  5G3L D;  5K5P A;  1X65 A;  5AJ3 L;  1BXT A;  2AKW B;  1Q7Y C;  3BZK A;  2MJ8 A;  3CRK C;  1FJG L;  4KN4 C;  4JG2 A;  4CDF C;  2JA8 G;  1MJC A;  1TII D;  4O42 A;  3EIV A;  1CM9 A;  1SFO B;  5CMD A;  1EQV A;  2RKS A;  4BBS B;  3K57 A;  4JI4 L;  2F0P A;  1RCV D;  1FYC A;  2NZ1 D;  3T1H L;  3Q22 A;  3BJU A;  2H4O A;  3GTK H;  1KRS A;  2ZXO A;  3E3X A;  4AYB G;  5H1S E;  3TP5 A;  2JA5 B;  2OQ0 A;  1JWM D;  5JJK A;  1AEX A;  4RGO S;  1Y8O B;  5ELD A;  1A3V A;  4FP5 D;  4BA1 I;  2ZJP A;  4B3T L;  1QNK A;  4OIK A;  5M5Y B;  3U4V A;  2JEA I;  2ZT9 C;  1EYA A;  2LSS A;  4YCV A;  4R4T A;  1AE3 A;  3KOJ A;  1SAP A;  5FLM G;  2OTJ A;  1K0R A;  1TS2 A;  1VMC A;  3M4Q A;  4K2L A;  4P75 A;  4DR3 L;  5C44 G;  4KHV A;  1D1K A;  4OWX B;  2L9H A;  5FJ8 G;  4CKE A;  2XGT A; 
#chains in the Genus database with same CATH homology
 2Q8R E;  2R92 B;  4BWG B;  3X3N A;  2CQA A;  2EYJ A;  1ICW A;  3A8J E;  5A2Q L;  1WTV A;  4N9T A;  3L9A X;  4OIJ A;  1I4G A;  2HDM A;  2YYZ A;  3R3O A;  3IL8 A;  4ZYS A;  4H13 C;  1BQQ T;  1RTO A;  3TME A;  2VNU D;  3FPU B;  4WJW A;  4IQZ A;  3NQT A;  1ZEQ X;  3NTH A;  4DK0 A;  4WOR A;  5DNF A;  4PNY A;  4FF2 A;  3VA5 A;  1D5M C;  4HCS A;  3H6M A;  4OO1 G;  2EJM A;  3VA7 A;  3HP3 A;  1SMY D;  2QEJ C;  3S1R B;  1DYQ A;  4A3E B;  1TKW B;  2KCC A;  2IWH A;  4WRD A;  1HUM A;  3OMG A;  1FNW A;  5C5M A;  3N6R A;  2CW0 C;  3TBI B;  2A6H D;  2JEB I;  1ET9 A;  1FNV A;  1QCB D;  4X3U A;  2IX3 A;  4I65 A;  4K8J A;  3J7A F;  2EVB A;  1WTX A;  1OO9 B;  3I4L A;  1KTK A;  2K7V A;  2Z1C A;  2WAC A;  5KGU A;  1SYD A;  3CHB D;  3R8B A;  2M2L A;  2K1B A;  3I90 A;  1GUO A;  5C3W A;  5I9O A;  2VB3 X;  1X3P A;  3BVZ A;  1H9R A;  1R4Q B;  2F0H A;  1SYF A;  4G4K A;  1LT5 D;  3RD4 A;  1HQR D;  2PZT A;  3NTI A;  2F3W A;  1UNS A;  4A3M B;  4C56 C;  4U67 3;  2B2Y C;  3TP6 A;  3RLF A;  2E2I B;  3VR5 A;  1ENC A;  2NVX B;  3ND9 A;  2M9V A;  4HSP A;  5IOD A;  2BDN A;  1JIC A;  1Y8N B;  3V2T A;  1TWG B;  5JEA G;  4B9X A;  4XDX A;  3P75 A;  2CHB D;  3PUY A;  1HQM C;  4FF4 A;  2EYO A;  1PTO F;  2K01 A;  1VF7 A;  1WTW A;  3CKI B;  1GUT A;  5FK9 C;  1O7Y A;  2AQ2 B;  5T1I A;  4H7B A;  1GOZ A;  1B9M A;  3GP7 A;  3NPP A;  2L55 A;  2KUM A;  1A3U A;  2A6E D;  3HOZ B;  3NQI A;  2F0U A;  3EQL C;  4IUU A;  1PTO C;  4TRD A;  5AFW A;  1E2W A;  1PZK D;  2F0S A;  4IUT A;  1LV9 A;  3OWF A;  4KN7 C;  1CQF A;  3KK7 A;  3L3O C;  4J6H A;  1PDQ A;  4EVO A;  1JOR A;  4K8I A;  3QIA A;  2EYP A;  5C5L A;  3HGB A;  2F4I A;  5EPL A;  1TVX A;  2QIL A;  2K03 A;  1U4P A;  1B53 A;  3A56 A;  2KEC A;  4KJN A;  2NB0 A;  3Q6S A;  3DWQ A;  3AMU A;  1IHZ A;  3QB3 A;  2A74 C;  1EZ8 A;  1I4Q A;  4IUR A;  1OXU A;  2PZU A;  3M7G A;  2QCP X;  4RAU C;  4PMW A;  2WII B;  3CU7 A;  1K83 B;  5EBC A;  1HXY D;  2EPB A;  4TSS A;  1QWY A;  1V1P B;  2K5D A;  4G7O C;  1LAB A;  2L0C A;  2F0L A;  1EY4 A;  2MUY A;  5KNB A;  4LAA A;  4RKL A;  4ME5 A;  3JAM L;  3MXU A;  1U4M A;  1B44 D;  2FIN B;  4KJO A;  4XIG S;  2WV6 D;  3HZX A;  1QNU A;  4OHJ A;  3OOC A;  1ENA A;  1LTI D;  1QE6 A;  4R8I A;  2FMM A;  2X69 A;  3S9W A;  1MSH A;  1C4Q A;  4A3F B;  3GV3 A;  4NKL A;  5EGT A;  3QG1 A;  1SJH D;  4DF7 A;  4KKT A;  1Q1B A;  1ILQ A;  1B1Z A;  3FKI B;  1SSO A;  3RUZ A;  2E74 C;  3IFT A;  2B39 A;  2B2W C;  2ZXR A;  3K5L A;  1BNZ A;  3MXG A;  1BUV T;  1SNP A;  1NR2 A;  1I4R A;  1MGS A;  3S16 B;  4KHZ A;  2IPK D;  1JE4 A;  1SE2 A;  3I72 A;  4L8J A;  3SK5 A;  5K36 H;  1SYB A;  2LY7 A;  3HOV B;  5CV9 A;  4FYD A;  1NUC A;  3M3Y B;  3UI2 A;  1NSN S;  1Y1W B;  1HA6 A;  2JA8 B;  1SEB D;  2HDL A;  4KD4 A;  1SXT A;  5C0X J;  1LTA D;  4Q5V A;  4XYO A;  3FEW X;  3HG9 A;  4X3S A;  2DN8 A;  3EFX D;  3GTO B;  4QB4 A;  2F0D A;  3Q0A A;  3OMC A;  3BVG A;  1AW7 A;  3FPP A;  2OF1 A;  1SDF A;  5COY A;  5KRU A;  2A69 D;  3D6W A;  3LWU A;  3VR2 A;  2WIN B;  2RA4 A;  2B2W A;  1JOQ A;  2WB1 B;  4RFB A;  4F8M A;  2WAQ B;  1DM0 B;  2EE1 A;  4KV6 A;  2I07 B;  4FNF A;  4HMI A;  1Q1E A;  2AWO A;  3D4W A;  2BOS A;  2E2H B;  1F9Q A;  1PRT B;  5EBD A;  4DNR B;  3NP8 A;  2B8G A;  1J9O A;  1I50 B;  4NW2 A;  4BA2 I;  4ZUI A;  5KNC A;  5C4J B;  1LLR D;  3OPO A;  2AUK A;  4DK1 A;  1A2T A;  4OGQ C;  5C3E B;  2EJF C;  4K2K A;  5A35 A;  2Z4H A;  1I6V C;  3GTM B;  4CGY B;  3EJI A;  3GTQ B;  2IJ0 A;  3W2D A;  3ND8 A;  5I2Y A;  2XVS A;  1V43 A;  3SK8 A;  3S17 B;  4MN3 A;  2A68 C;  1EEF D;  5M5W B;  1YNJ D;  1Q8I A;  3MA2 B;  3AB9 A;  1W6K A;  1EY0 A;  4FXD A;  5JVG 3;  1KAA A;  1JQY D;  3T51 B;  3AU7 A;  1HFG A;  1TQO A;  2BA1 A;  1EU3 A;  4KTA A;  5D14 A;  5DEH A;  4IAL A;  1X32 A;  2FJ2 A;  1M8A A;  2CW0 D;  3KUP A;  2C5C A;  5CBA E;  3SK6 A;  1F77 A;  2A68 D;  3A7A B;  3TZU A;  5ELB A;  1MBY A;  4DAY A;  2F03 A;  5CV7 A;  1EZ6 A;  3IFD A;  3M4O B;  1U9R A;  3KF8 A;  4C3H G;  4PMC A;  1STB A;  2L5T A;  4F87 A;  5IGB A;  1EQT A;  4CJ1 B;  2JA7 B;  2A5H A;  2Z4I A;  3ITP A;  3VR6 A;  1PRT D;  5I4D A;  2NVY B;  2XRS D;  1HA5 A;  1EEI D;  4JK1 C;  1O7L A;  4OO1 H;  1TY2 A;  3O13 A;  4PQX A;  5LL6 X;  4B9W A;  1KLU D;  1SBB B;  4IFD G;  4Q0F A;  4IN3 A;  4K5V A;  2FFK B;  1CTM A;  4HED A;  3D6C A;  5J39 A;  1I3Q B;  2IX0 A;  2MPM A;  3S2H B;  4LJZ C;  3P20 A;  4K14 A;  4ZAI A;  2X6G A;  3SHL A;  1Y1V B;  1EY5 A;  3H94 A;  2F0E A;  4DA2 A;  2F0I A;  2XRQ D;  3S1N B;  2JE6 I;  1LO5 D;  1JC7 A;  1FNU A;  1STY A;  1E0B A;  1PTO H;  1TWC B;  2R3Z A;  4BY1 B;  2O2L D;  4RA8 A;  3IAY A;  2KVM A;  1SNC A;  3D31 A;  3NXW A;  1V1O A;  1DZ1 A;  3VYS A;  3P7J A;  4WFN 3;  3H91 A;  2ENB A;  4M8A A;  2EY2 A;  4TKO B;  1TU2 B;  1I6H B;  3M7N A;  4UAI A;  3PUZ A;  5EPJ A;  2SDF A;  4A93 B;  1GHK A;  1LAC A;  4ZUJ A;  2B2V C;  1Z47 A;  1YNN D;  1GUN A;  2EY6 A;  1EYD A;  3ERQ A;  1KDA A;  1J8I A;  1WTP A;  2BE5 D;  2D9U A;  2IW3 A;  1SJE D;  1WD0 A;  1STA A;  2LKV A;  4B08 A;  4XTC S;  2YU9 B;  1D6E C;  3FMC A;  2E2J B;  1MSG A;  1ZYR D;  1CI3 M;  3HOU B;  4K5X A;  2K5Q A;  3MFY A;  2PZW A;  2A6H C;  3PIP 3;  3HRZ C;  1L0X B;  1SNQ A;  4A3I B;  3FVQ A;  3M4Y A;  5J1Z A;  1SNO A;  1ESR A;  2ICI A;  2RBM A;  1G29 1;  1GUG A;  3G6J B;  3G7L A;  4GZY C;  2BCO A;  1WVL A;  1TWA B;  1RTN A;  1H9M A;  3DEO A;  2OXP A;  3K6O A;  5EPK A;  2NTS A;  5KEE A;  3TN2 A;  2RSO A;  4FVM A;  2K6A A;  3JAM E;  1DON A;  2WP8 J;  5D3I B;  3RMH A;  4FXK C;  1VCI A;  5JPM C;  3GO5 A;  3NBI A;  3BZD B;  4K6D A;  1LTB D;  3D3R A;  3F2U A;  2DNC A;  1RF2 D;  3J81 E;  5FO8 B;  3A54 A;  2SNM A;  3DUZ A;  5E4W C;  2EYL A;  1ILP A;  4ILW A;  1SE4 A;  2EYF A;  5FOB B;  3KLR A;  1KNE A;  1T5E A;  3KBG A;  4HMJ A;  1CA6 A;  1A3T A;  1S5C D;  1B2T A;  1PXU A;  3NHH A;  2F0F A;  1FGB D;  2QDB A;  5E3F A;  1ROD A;  1EU4 A;  1T5X D;  1KDB A;  1O7Z A;  1Z7T A;  1EFI D;  5CC4 A;  2G9D A;  5C44 B;  2NWG A;  4JBW A;  1B3A A;  4ZQ3 A;  1KNA A;  1QIL A;  1BF4 A;  4ZKB B;  3IKJ A;  3NWT A;  2E76 C;  2JXM B;  2KA7 A;  4QF4 A;  1TWF B;  3KBX A;  2JYO A;  3I4M B;  3GTL B;  4C3I B;  2MP1 A;  1Y69 U;  4K5W A;  3A8K E;  4RHS A;  5JAV A;  2JP1 A;  1PFB A;  4XYQ A;  3BS1 A;  5D65 A;  1L0Y B;  4C3H B;  5I6W A;  2RDG A;  2DNE A;  1PZI D;  3V05 A;  3TZD A;  5C0X I;  4CKB A;  1TS4 A;  3HEJ A;  3K5N A;  3PUV A;  2NUC A;  4IZ8 A;  2F0Q A;  4DAP A;  3S1Q B;  2PNR C;  2EZV A;  2WKC A;  5IOC A;  1LTS D;  1TY0 A;  4RHR A;  1ESF A;  2E75 C;  5I9P A;  4R9W A;  4O1N A;  1LTG D;  3T56 B;  1WTO A;  1O80 A;  3NK9 A;  1SYG A;  2K5W A;  4BS9 A;  1HFN A;  3C1F A;  2K05 A;  3D8G A;  2FMC A;  1F2Z A;  2EYH A;  1D2B A;  3OSO A;  1DOL A;  3WOF A;  2PO4 A;  3SE0 A;  5IIF A;  4CBV A;  1H9J A;  4QCL A;  2O4X A;  1ZXT A;  1GJX A;  2K33 A;  4FF1 A;  1GUW A;  1RHP A;  1BR9 A;  4F88 A;  1Q12 A;  2N55 A;  2XIW A;  3OIQ A;  3DMU A;  2BDO A;  2R7Z B;  2NYZ D;  2RDH A;  3K5O A;  4EQP A;  3GV6 A;  2F0T A;  1HHV A;  1S5D D;  1Q3L A;  4DGZ A;  4DFA A;  3PUX A;  2HCC A;  2VXW A;  3DWA A;  3FDT A;  2RSN A;  3S1M B;  3OW7 A;  1W6J A;  2AWN A;  2X6L A;  3P1H A;  4IFD H;  1HPC A;  1BBX C;  1KLG D;  2SEB D;  4DAV A;  5CYU A;  1TS5 A;  2J4X A;  1JWU D;  1FD7 D;  1D1I A;  2AQ1 B;  4A3J B;  3J80 E;  3MTS A;  1PTO B;  3W3A A;  5BN3 A;  2F0K A;  2HUG A;  1XXG A;  2ICE C;  5ELC A;  5NUC A;  4YIJ A;  4XQQ A;  5FLX L;  2L1B A;  4XQN A;  4KMU C;  1SNM A;  1F9S A;  1TWH B;  4PMB A;  3A7L A;  4DU9 A;  2BA0 A;  3DXJ C;  1DD2 A;  5EKL A;  4QUF A;  4C2M B;  1EWC A;  2EJG C;  3BYY B;  1SYE A;  2K32 A;  2SNS A;  4EGV A;  4XQJ A;  4LMQ D;  1II3 A;  1EYC A;  1JR0 D;  3J7Y W;  1PLF A;  1F2L A;  1WCM B;  3K5M A;  4V19 0;  1UEA B;  1EY9 A;  2EY5 A;  5TSS A;  3C2P A;  2EY1 A;  3R2I A;  5C0X G;  4DXF A;  4E6I A;  3NTK A;  4C3J B;  2KHS A;  5HUR A;  3HOW B;  1YNN C;  1CFM A;  3TDQ A;  3C3L A;  1A15 A;  4KY7 A;  4PV1 C;  4Z9C B;  3QOJ A;  2B2U C;  2N88 A;  3LX0 A;  3SR1 A;  4ZK9 B;  5CBE E;  1ZYR C;  3L7Z C;  2B2Y A;  3SXH A;  4OO1 I;  2OT2 A;  2XWJ B;  5ELE A;  2EOT A;  3MXP A;  1AZQ A;  5M3F B;  1AN8 A;  3A8I E;  3I70 A;  4A3D B;  3FRP B;  2K04 A;  1G8Z D;  2VB2 X;  3J80 L;  1EOT A;  3M85 A;  1MD2 D;  4CJ2 C;  5ELF A;  1NAP A;  4BBR B;  2L4N A;  3KLS X;  3CRL C;  3WOE A;  1GUS A;  5IGF A;  4U68 A;  4RCN A;  3NBH A;  3I8Z A;  1SND A;  2IL8 A;  4ZRZ A;  1PRT C;  3NUC A;  1IKM A;  1B50 A;  1AP0 A;  4RCO A;  4KI0 A;  5M9O A;  1CA5 A;  3LWE A;  1K8M A;  2F0J A;  1S5B D;  4Y7N B;  4XXE A;  4CHT B;  4KY6 A;  5A2Q E;  2KJX A;  3MZ5 A;  1R4P B;  1QJO A;  2NVQ B;  5CV5 A;  3ZYY X;  2XNA C;  3VYT A;  3PIO 3;  2EYM A;  4HTH A;  1EWH A;  1SYC A;  3TSS A;  2F1M A;  5KYI A;  3MXN A;  1RD9 D;  3BYT B;  5FLX E;  2L11 A;  4EQN A;  5EQ0 A;  2C9O A;  2A73 B;  2EDG A;  2NVT B;  5C3X A;  1LT6 D;  1IL8 A;  1CZG A;  2CVR A;  3SDZ A;  1D5Z C;  3HS0 C;  2I46 A;  5LL6 S;  1E2Z A;  4QMG A;  2IT1 A;  1CQV A;  1EY6 A;  1JOO A;  2ID0 A;  1OXT A;  1JB3 A;  2B2T A;  5FKA C;  3QO2 A;  3S2D B;  2TSS A;  4H0L C;  2F3V A;  2IX1 A;  4ULL A;  1G91 A;  3I73 A;  1OXV A;  3HKZ B;  5M5X B;  1C48 A;  1S5F D;  3GD7 A;  1ML0 D;  3E0J A;  3VYR A;  2MGS A;  5ISR A;  3Q24 A;  5I6Y A;  3NSW A;  1SE3 A;  4AYB B;  1IYV A;  5COR A;  3MVV A;  4MIU A;  1LTR D;  2RQX A;  5F2D A;  3BVM A;  1H9S B;  1PRT F;  2VUM B;  5DAU A;  5BN5 A;  3I3C A;  2SOB A;  2HQE A;  3GTJ B;  1K8O A;  4NDX A;  1V8Q A;  2XSC A;  3NE5 B;  2B2T C;  5D3D A;  3MEH A;  1M4V A;  3LNN A;  4A3K B;  1CZW A;  4A3G B;  4IFD I;  1F2Y A;  1ZKO A;  1LT3 D;  3V96 A;  2KQ3 A;  4G57 A;  4IUV A;  2KOL A;  3DM1 A;  2OEO A;  3D4D A;  4G7Z C;  1JCK B;  1XWE A;  4NP5 A;  4KKS A;  5CV6 A;  5DM7 3;  2TMP A;  1H9K A;  1FR3 A;  5JJZ A;  5JEA H;  1EY8 A;  3DHQ A;  1EL0 A;  3T4A C;  1PTO D;  5C4X B;  5G3L F;  1BDO A;  3WDN A;  5J22 A;  2KEE A;  1BO0 A;  4X3T A;  3I4N B;  2B63 B;  2QF7 A;  1XTC D;  1ENF A;  4I7Z C;  2H1E A;  3VR4 A;  2PPB C;  3BDC A;  1CT1 D;  2JA6 B;  1V1P A;  4RGT A;  1STH A;  3DWP A;  2JSO A;  2PQE A;  4C3I G;  1S4Z A;  4HR7 B;  1DOK A;  1STE A;  2LMC B;  1F9P A;  3HOY B;  4ZKC B;  1O78 A;  1I4P A;  4RWS C;  4DXG A;  2NN6 G;  4V0B A;  1CK1 A;  5JVH 3;  3PV0 A;  2Q8T A;  2D2C C;  3E5S A;  2J7Z A;  2EXZ A;  1WD1 A;  5HGT A;  4A3B B;  2RVL A;  3U9O A;  4NMZ A;  3T53 B;  2F0N A;  1OXX K;  1VDZ A;  4C3J G;  2PYK A;  4XT3 B;  3RZO B;  2DY7 A;  2F0O A;  3TP8 A;  3H0G B;  5IGC A;  3TP7 A;  1C8C A;  2Q8I B;  5IT9 E;  3PUW A;  1LT4 D;  5EJW A;  5C6A A;  2NN6 H;  4UDU C;  5JEA J;  3PO2 B;  1BCP D;  2D62 A;  1G2T A;  2R61 A;  1G6Z A;  1H9S A;  1Y8P B;  1XX8 A;  3HOX B;  2G9H D;  2PCF B;  2Y0S B;  3ONA B;  5JPN C;  3A55 A;  3GQB A;  3C46 A;  3K59 A;  2XN9 C;  4H44 C;  2RDF A;  2R93 B;  1NR4 A;  4X3K A;  5KND A;  2HCI A;  1DJR D;  4LK1 C;  1EIG A;  4CKC A;  4HN7 A;  3EVQ A;  5IGG A;  1X3Q A;  1JOK A;  1VMP A;  3VR3 A;  5E4X A;  5BN4 A;  4ABN A;  2BE5 C;  4HSV A;  1YNJ C;  2NBF A;  3U9S A;  3J81 L;  3EA6 A;  4L63 B;  4ODG A;  4KD3 A;  1RDP D;  3KLS A;  3GTG B;  5C4Z A;  4FXG C;  4HCE A;  1PYW D;  5CGK A;  2O5J C;  1EY7 A;  5K36 G;  1RKN A;  4XT1 B;  5DM6 3;  2QKI C;  1STG A;  1BOS A;  5KIX A;  2B2U A;  5E1F A;  1HUN A;  1CHP D;  4EQO A;  5EKI A;  3BG3 A;  2A69 C;  1WTR A;  3OHX C;  1TS3 A;  4RGN A;  1DOM A;  3K58 A;  1GXD C;  1XYI A;  2KED A;  4S3S A;  3C1E A;  2PMZ B;  4J1M A;  1HTL D;  2D5D A;  1QG7 A;  1BCP C;  5IGE A;  5IGD A;  2L12 A;  5FO7 B;  1PFM A;  3MHB A;  3I91 A;  1OXS C;  1PFN A;  4L6T B;  3S15 B;  3QJY A;  2B2V A;  3SVM A;  1A2U A;  1GHJ A;  1IYU A;  2ZXP A;  3T13 A;  4DN4 M;  5CV4 A;  3PMF A;  4RH6 A;  4F7X A;  3MAQ A;  4KKU A;  5I2X A;  1I4H A;  4QIW B;  4C1N I;  2V4D A;  3SEB A;  2KCN A;  1D5X C;  3E6Z X;  1QOH A;  4P2C B;  3Q23 A;  4BY7 B;  1B4O A;  1BCP B;  2F0V A;  4RKB A;  1TR5 A;  3GTP B;  1E2V A;  1IW7 C;  3BDO A;  5CR3 A;  3OWE B;  3PO3 B;  1IKL A;  3GTK B;  1CHQ D;  5C4H A;  5JOB A;  1MI2 A;  3MFG A;  4QUC A;  4IUN A;  3S14 B;  3URY A;  1PZJ D;  4KK7 A;  3R93 A;  4IUP A;  2R6G A;  1I4X A;  4M1U B;  4K6L A;  2M00 A;  4ZLT F;  2F0M A;  4DNT B;  1NCV A;  3MC0 B;  1S5E D;  1KDC A;  2XWB B;  1R9T B;  1QB5 D;  3ERO A;  1DCZ A;  1EIH A;  3D4R A;  1HCZ A;  2LFN A;  1KAB A;  1JWS D;  1VF5 C;  4OL7 A;  3J7A V;  4IFD J;  1AZP A;  3DEP A;  1BCP F;  4CJ0 B;  2FHT A;  1B9N A;  1TT2 A;  2NTT A;  1STN A;  1F9R A;  5C0X H;  1A6X A;  3T16 A;  1Z6H A;  5EKK A;  2DY8 A;  4FO2 A;  1AFP A;  1Q90 A;  4G7H C;  2PW7 A;  1UAP A;  4N9P A;  1PMR A;  4IUQ A;  3N52 A;  1RJT A;  2K28 A;  3QOL A;  2NN6 I;  3BDL A;  1ET6 A;  4TQU S;  2GA4 B;  2PW5 A;  2B8F A;  2MHV A;  3SK4 A;  3RZD B;  4R8N A;  3MWY W;  3H3V C;  1F2M A;  3K7A B;  5FO9 B;  3NWS A;  2F0G A;  5KYL A;  3OIP A;  4RGM A;  2AUJ D;  4KY5 A;  2F0W A;  4FF3 A;  4HAE A;  1U4L A;  4ID6 A;  1ONL A;  4C1N K;  2AQ3 B;  5M3M B;  3R2T A;  3H09 A;  3X3M A;  2E2D C;  5LHY 1;  4MHE A;  2A6E C;  5T1G A;  2LS0 1;  3CQZ B;  1HTP A;  1HRJ A;  1U4R A;  1G2S A;  1WTQ A;  1IW7 D;  1DXM A;  1UUP A;  4J8Q A;  5IT9 L;  3VYU A;  1SMY C;  1LTT D;  5CV8 A;  2WKD A;  2Z8L A;  3K0Y A;  2O5I C;  3QWN A;  2J0T D;  5G3L D;  5K5P A;  1BXT A;  3CRK C;  4KN4 C;  1TII D;  4O42 A;  1SFO B;  1CM9 A;  5CMD A;  1EQV A;  2RKS A;  4BBS B;  3K57 A;  2F0P A;  1RCV D;  1FYC A;  2NZ1 D;  3Q22 A;  2H4O A;  2ZXO A;  3TP5 A;  2JA5 B;  1JWM D;  1AEX A;  4RGO S;  1Y8O B;  5ELD A;  1A3V A;  4FP5 D;  4BA1 I;  1QNK A;  4OIK A;  5M5Y B;  2JEA I;  2ZT9 C;  1EYA A;  1SAP A;  1TS2 A;  1VMC A;  4K2L A;  4KHV A;  1D1K A;  2L9H A;  4CKE A;  2MJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...