2OXPA

Crystal structure of staphylococcal nuclease mutant v66d/p117g/h124l/s128a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title High apparent dielectric constant inside a protein reflects structural reorganization coupled to the ionization of an internal asp
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oxpA00
4KD4A 2EYPA 2F0JA 3PMFA 3DMUA 5CC4A 1SNPA 3NQTA 4HMIA 3E5SA 1F2YA 4QMGA 1F2MA 4DFAA 3NK9A 3OWFA 4KY7A 1SYFA 4K5VA 1JOQA 5CV4A 2F0FA 1SNOA 1SNDA 2F0LA 4HTHA 4KTAA 4RKLA 3TP5A 4B9WA 1SYEA 1JOOA 3QOJA 4IUNA 2OXPA 5E3FA 1NUCA 4J6HA 2SOBA 3QOLA 5C5MA 1AEXA 3RUZA 3NXWA 3C1FA 5KYLA 1JOKA 2NUCA 2F0MA 2F3WA 5HGTA 2OEOA 5DAUA 5KRUA 4N9TA 1KDAA 3D4WA 4RKBA 1IHZA 2F0KA 5CGKA 4IALA 5KYIA 1U9RA 2F3VA 3NP8A 4K5XA 3NUCA 1F2ZA 1II3A 1ENAA 1SYDA 1TT2A 2O4XA 3T16A 5KEEA 2EYLA 4DU9A 2QDBA 5KGUA 4DGZA 1SYGA 1KAAA 1A3VA 3SK6A 3SR1A 2EYHA 4K2KA 3SK8A 1A2UA 1A3UA 4E6IA 3BDLA 4DF7A 4G57A 2F0EA 2EY1A 3TP7A 3TP6A 1EZ6A 3EVQA 1EYAA 2F0SA 5JOBA 5I6WA 5I9OA 2F0DA 4PNYA 5IGGA 3C1EA 2SNSA 5IGDA 4K5WA 1A2TA 2F0WA 4EVOA 2F0NA 4KV6A 2F0TA 3HZXA 4R8NA 5J1ZA 4KJOA 1STAA 5CV9A 4IZ8A 4OL7A 4ZQ3A 4ZUJA 4HMJA 3SHLA 3SK4A 4N9PA 3VA5A 5J22A 2EY6A 3DHQA 3MEHA 1EY0A 3MXPA 4KHVA 4KY6A 4EQNA 2EYFA 3V2TA 4EQOA 5C3WA 4ME5A 2EYMA 5E1FA 4H7BA 2F0IA 4ZUIA 1STGA 3ITPA 4WRDA 5C4ZA 5IOCA 1EY5A 2PW7A 1TQOA 4NMZA 1KDCA 1STYA 3ERQA 5C3XA 5CV7A 1SNMA 2F0GA 2KQ3A 4YIJA 5K5PA 2F0VA 4LAAA 1KABA 2F0UA 4KD3A 1EYCA 1JORA 1EZ8A 1ENCA 2EXZA 3H6MA 4MIUA 3EJIA 5C6AA 2EY5A 1STNA 2RDFA 2LKVA 3SXHA 2EYOA 5I9PA 2HQEA 4QB4A 5IGFA 5EKKA 5DEHA 4K8JA 4EQPA 5EGTA 3R3OA 3TP8A 2WACA 4F7XA 5IGBA 5F2DA 5ISRA 4QF4A 4K2LA 2F0HA 4PMCA 3P1HA 5HURA 5CV6A 3LX0A 2EYJA 5M9OA 1EY9A 3MZ5A 5IODA 5IIFA 1EY4A 2RBMA 2KHSA 2PZWA 2ENBA 1NSNS 4S3SA 1SNQA 3P75A 5EKLA 4NKLA 4NP5A 5NUCA 3MVVA 5J39A 4K14A 4J1MA 4NDXA 3S9WA 1KDBA 1SNCA 5C4HA 2PZUA 3D6CA 5CV5A 1STHA 4I65A 2RKSA 2PYKA 4KJNA 4B9XA 2M00A 1STBA 3D4DA 2OF1A 3SK5A 1TR5A 3NHHA 2F0QA 3OMCA 1EY7A 3OSOA 3U9OA 2EY2A 4K8IA 2PW5A 5CR3A 3HEJA 5JAVA 2PQEA 4PMBA 1A3TA 4TRDA 5KIXA 3EROA 4ID6A 5IGCA 4KY5A 3T13A 4F8MA 3BDCA 1RKNA 2PZTA 3QB3A 2F0PA 5CV8A 5IGEA 1SYCA 1SYBA 5I6YA 3D8GA 1EYDA 3MHBA 4K6DA 2SNMA 1EY6A 1EQVA 2F0OA 5C5LA 1EY8A 3OMGA 3TMEA 4WORA 4ODGA
chains in the Genus database with same CATH superfamily
2B2YC 5E4WC 2VQEL 1ZEQX 2A19A 5A2QL 1X65A 1YNJD 2AKWB 4QMGA 2UUCQ 3GTMB 4HTHA 1LV9A 1PA6A 4BBRB 4HIKA 1VDZA 3ZJYC 2PNHA 4KLKA 2VQEQ 2Z6KA 1PH5A 1IL2A 5M5WB 1PYSB 3QO2A 4OO1I 3HP3A 4LMQD 1Y14B 2KHIA 5IYDH 1F2ZA 5ELEA 1TVXA 3OTOL 1YHAA 3CPWA 3CF5A 1YVCA 3D6WA 1LTSD 3D31A 1V43A 3KBXA 4DR4L 1A2UA 4DR3L 1SBBB 1EQTA 2I07B 5C4XH 2ZTCA 4WFN3 1TY0A 4DR2L 3DUZA 5FLXE 1KLGD 4JI7L 3OTOQ 2N8NA 3KLRA 3U4VA 5I4DA 1PTOB 4A75A 4KV6A 1HNXL 4QQBX 1GUSA 2ALYB 2JA5B 4DR4Q 3VA5A 4DR3Q 3NENA 2B63B 2JA6B 4DR2Q 2HCIA 4JBMA 4JI7Q 2G9HD 4NMZA 1HNXQ 2WKDA 4GN4B 3H3VI 2F4IA 2VUMG 1E1OA 1VS0A 5LL6S 2R7DA 1B50A 1I3QB 1EZ8A 4MIUA 3OW7A 3SXHA 3S2HH 1NJIC 2KVMA 2EYOA 2L11A 3V05A 2K4KA 2K7VA 1RTNA 3P1HA 1GVPA 3QIAA 1TWGB 2KHSA 3P75A 3MAQA 2EOTA 1WTQA 4DN4M 4ZYSA 1TWFH 2B2UC 3KJOA 5CV5A 3J7AF 4A93H 1GO3E 1YJWA 3CU7A 4GOPC 1FJGL 1HHVA 1VF5C 1PRTD 2F0QA 1AFPA 1VQGA 4N8X1 4X3SA 5CR3A 5IT9L 3CCJA 1RKNA 4OWXB 3EBEA 2WIIB 1FJGQ 2I5LX 1WTVA 3KF8B 1RIPA 3LWUA 3N6RA 2VUMB 1O7YA 2BA1A 2R7ZG 1BR9A 3DMUA 3E5SA 1F2MA 1BNZA 4ZK9B 1U5KA 4K5VA 5IYDG 4L5RC 2R93G 2BDNA 1XJVA 2SOBA 4IURA 4XQJA 2E76C 4IJHA 2F3WA 2OEOA 1SSOA 3CMEA 3D4WA 1QILA 4IALA 3GTJB 5C4XG 3CCSA 1E1TA 1HQMC 1ENAA 1HH2P 5FLXL 1CI3M 1R4PB 1L1OB 2ZT9C 1S5ED 4FDBA 2EY1A 1UUPA 2NN6I 5D14A 1S5BD 3Q23A 2FFKB 4HAEA 4Y52H 3W5OA 1BUVT 4DAYB 2HHHL 4OWWB 5ELFA 3MXGA 4R4OA 2A1AA 1Q12A 1IYUA 1VQ9A 3R93A 3A5ZB 3DM1A 2E2JH 4ME5A 5EJWA 3PO3H 3ULJA 3ITPA 4OONA 2HHHQ 1NBWA 3ERQA 2O2LD 2Y0SG 2N55A 5CV7A 1AZPA 3GTQB 3E0EA 5EBDA 5IY0A 1HA6A 1YNND 1EYGA 2V4DA 1CZGA 5C4XB 3C3LA 3GTLB 5M5YH 2F0HA 2XIWA 3MEFA 3GQBA 2IPKD 4LF8L 3BZDB 1ASZA 4DV7L 1E22A 2VB3X 3KF8A 3M9BA 2KEEA 2AHOB 2FHTA 3IKJA 1TWAH 1Q3LA 1O7IA 4IPHA 1V1OA 4MNOA 3I73A 4DV7Q 1U4RA 5FO8B 1AH9A 3TS2A 3A8JE 1YITA 2KEDA 4LF5L 4L6TB 2X6GA 2RCNA 3BU2A 4A3LG 3S2HB 2KBNA 1Q86C 2LSSA 2N88A 1PFBA 1VMPA 4L5SA 1OXXK 4A3CH 4RMFA 1CKNB 3A5UA 4APVA 3AYHB 3NELA 4LF5Q 1L1OA 3PF4A 3L0OA 5BN3A 3J7A5 4WJ4A 5I2XA 1B44D 2UXBL 1TWFB 1G51A 3N52A 1VQCA 1PYWD 3NQIA 1SR3A 1SYEA 4A93B 2OXPA 3J81c 2JA8H 5CBEE 1BVSA 1I94L 1FR3A 4UAIA 2WV6D 4DAYA 1C9OA 3PIPA 1VQOA 1UE6A 4WJ3M 1JB7A 1K0SA 1JQYD 2UXBQ 4LUOA 2EYLA 3C46A 2BA0A 1JC7A 1KAWA 1CTMA 1I94Q 3MC0B 2VQFL 1W6KA 1VQ6A 1OXSC 1JICA 1X56A 4GOPB 2CH4W 5AFWA 3PF5A 3OOCA 5I6WA 5JOBA 3H0GH 2AQ1B 5EPJA 3M7GA 2OWOA 4R8NA 1MKHA 5CV9A 4IZ8A 2VQFQ 4KY6A 3MEHA 1I50H 4AH6A 3EFXD 2TMPA 3D3RA 4MHEA 1LYLA 3CC2A 1F9RA 2IJ0A 4A3IH 5FJ8G 1CSPA 2PW7A 4PZ7A 3TN2A 1NMFA 3FKIH 1VQEA 4B3RL 1EU4A 1D5ZC 1S72A 3BYTB 3H6MA 3T56B 4IN3A 3AFQA 1UAPA 1SN8A 1GHKA 3R2TA 2F3IA 5GQOA 4B3RQ 1E3PA 1PH8A 2B2TA 1H95A 1F9QA 1L2FA 1W3SA 3RMHA 4DV5L 4LF7L 3GDEA 1PFSA 4BY7G 1IXRA 5M5XH 3HOWH 2RSOA 2E2JB 1Y8OB 2GA4B 1X3FA 2RDGA 3CQZH 3PO3B 1O80A 3NBHB 3J81j 3SK5A 1TR5A 3NHHA 4DV5Q 2B2WA 4R8IA 4LF7Q 1YI2A 4A3CG 2UU9L 2A73B 1T5XD 2PW5A 3JAMi 1Z6HA 1MJCA 2DUDA 1QB5D 5IGEA 1LACA 1SYBA 1D6EC 1PZID 3CCEA 1WTWA 4Q5VA 1I4PA 2EJMA 2UU9Q 5M5YB 1EY8A 2H1EA 3L3OC 3MFYA 1B70B 4XTCS 2JA8G 5CBAE 1RCVD 3K0YA 5BN5A 2JXMB 4RCOA 3TRZA 4KN7C 1I4RA 1WI5A 4BBSH 1H9RA 1D5MC 4JI4L 1DZ1A 1RODA 4UP9A 1TWAB 2HDLA 4OIKA 1CZWA 2Z6KC 3HFZB 3WWVA 4CBVA 3I4MH 3TQYA 5HGTA 4JI4Q 1LABA 4YWKA 1TT2A 2WP8J 3UDIA 2QDBA 3H0GG 2OCEA 4YCUA 1SYGA 3BVZA 4U68A 1B53A 4K2KA 1BQQT 2EIFA 3MA2B 4LF6L 4XYQA 4R4IA 3OW2A 4RHSA 4DV4L 4AIMA 4LUVA 4A3IG 5EAYA 1G8ZD 1BO0A 4YCWA 2KECA 1DOMA 2FINB 4X62L 1HTPA 3CC7A 4OL7A 3FKIG 4LF6Q 4H13C 2JA8B 4QL5A 4DV4Q 4QJFA 3X3MA 1ESFA 4A4IA 1ET6A 4X62Q 1VQKA 4IFDJ 3ND8A 3K81C 1JJGA 3Q22A 2Z8LA 1IKLA 5ELOA 3NBHA 3EJIA 2F52A 2N49A 2O5JC 2NVYH 3TBIB 4A3DH 1TIID 1SJED 4K8JA 2ATWA 1EWHA 4F7XA 3HOWG 3LX0A 2D5DA 3H0GB 2JEBI 4A3EH 1TS5A 3FPPA 1J5EL 5GAEC 5TSSA 4PQXA 4FF2A 3S9WA 1KDBA 1SNCA 1I50B 3H94A 3DLLA 2RKSA 3HGBA 4JOIA 4A3IB 3D4DA 2JEAI 3S1QH 1J5EQ 3FKIB 2NTSA 3U50C 3HOVH 2E5LQ 3BVGA 4QUFA 2PMZE 2HD3A 3NEMA 1A63A 4KY5A 3WDNA 4BBSG 2XN9C 2PZTA 3QB3A 1PFNA 5CV8A 1SYCA 3MHBA 5J3BA 1FL0A 5DEHA 2BE5D 2F0JA 1KD1C 4NXML 3I4MG 1DGSA 4RGTA 4GLXA 1B9MA 2VS1A 1SYFA 5M5XB 3HOWB 2KA7A 2E2IH 3CQZB 3PV0A 3I3CA 3VR5A 4NXMQ 1VQ8A 3U4ZA 2E8GA 4GN5A 5KRUA 1KDAA 4QIWE 3I4OA 3S16B 1BCPF 1X6OA 2WB1E 3IFDA 4XQQA 3KUPA 2FXQA 1N9WA 4KKSA 4DGZA 2L9HA 2UUAL 2KCCA 4OEMB 3SR1A 2EYHA 2K5WA 1QNUA 4G57A 1DCZA 3TP7A 3T53B 3CCVA 1EYAA 2EJFC 1K8AC 2DY8A 3CCUA 2VXWA 3KFUA 4BBSB 2UUAQ 2G9DA 4FVMA 2AWNA 4PZ6A 3WOEA 2K01A 1XXGA 4EQNA 3I55A 2ID0A 1YBYA 2MGSA 3I4MB 5C4ZA 2DY7A 4A3DG 4JBJA 2H5XA 1N33L 4KD3A 1VQLA 1GJXA 2A6EC 1BKBA 2EY5A 3UI2A 4P73A 4A3EG 5EKKA 2RDHA 1QUQA 1N33Q 4PMCA 3S1RH 3F2DA 5CV6A 1XMQL 5CYUA 2A69C 5EBCA 1EIFA 3TDQA 3CHBD 1KIXA 5EKLA 2ZTDA 3KLWA 4J1MA 3TS0A 5FK9C 3S2DH 4C3JH 2R92H 1BCPC 5IT9c 1TU2B 1TY2A 1XMQQ 4JBKA 1OXVA 2PCFB 3OMCA 1GUTA 2NZHA 4RAUC 1CFMA 4IFDG 5ELBA 2I46A 2TSSA 3EROA 2PPBC 2ZM6Q 3IFTA 3CCRA 2GVAA 5FO9B 2NVYB 4A3DB 5E4XA 1JT8A 3CPFA 1L1OC 2AQ2B 1TKWB 5ELCA 4A3EB 1LTLA 2KCTA 3NK9A 1E2WA 3LGJA 3A8KE 3DM3A 3T1YL 1F2LA 3W2DA 3J80L 1LTBD 4KKTA 2JP1A 2PI2A 4I7AA 3V96A 4YY3L 5EPKA 3HOVB 4A76A 1GUNA 3T1YQ 2B29A 5JVG3 1CKOA 3ONAB 1IYJB 1B3AA 3TZDA 4YY3Q 5JJLA 4B3SL 2RHSB 4IUQA 3PIO3 1HNWL 3I4LA 2ZJPA 3TSSA 1EWIA 2F0EA 3EVQA 5I9OA 3J7ZC 2Y0SE 1AE2A 4BA1I 1ZXTA 2R7ZH 4POFA 4B3SQ 2AUJD 1Y1WH 4LFBL 3DEPA 4DR7L 1HNWQ 2E2IB 3UDGA 2KUMA 4C56C 5M3MH 2MFIA 2R93H 3GTQH 1DJRD 3G6JB 1I5FA 1PRTB 2VL6A 5JJKA 1Q1EA 5FLMH 1YHBA 1HPCA 4LFBQ 3BYYB 4DR7Q 1KABA 3VR3A 1SMYD 1PH2A 2BOSA 3GTLH 2UXDL 1S40A 2MQHA 1ML0D 2N78A 2E75C 2WB1G 5IGBA 1LTRD 4C3JG 2R92G 4FF4A 2B2TC 4LJZC 5IODA 5A35A 2UXDQ 1EY4A 1H9KA 4DUYL 5NUCA 1PH3A 5IWAL 3GTGH 2HIVA 5C4HA 2EE1A 2LMCB 2PZUA 1EL0A 4LFAL 1B3QA 2PMZB 2YYZA 3G4SA 3CKIB 2A6HD 1Q8IA 2OF1A 5JVH3 1XTDA 2B2WC 4DUYQ 1NAPA 4HN7A 3GD7A 1OXTA 3RLNA 5IWAQ 3M4YA 4LFAQ 3RNUA 3E0JA 4EQ5A 4LWCA 1V1PB 4F8MA 1D7QA 1M8AA 4CKBA 3E9HA 3MXNB 2OTLA 1WTXA 1PZJD 3S1RB 1EUJA 1QE6A 3KYHC 2NVXH 1HZ9A 3EIVA 1SNPA 3NQTA 4KI0A 4QIWB 4EGVA 1VQJA 3GTPB 2WB1B 4MTNA 1SNOA 1SNDA 1K0RA 4C3JB 1R9TH 3S2DB 4LF4L 2R92B 1B2TA 2D0PA 5J39A 5KYLA 4ZKBB 5FOBB 4XIGS 1PYBA 3WOFA 2QA4A 4N9TA 1KXLA 4GLVB 4JI0L 1CT1D 1J8IA 5GROA 1SYDA 4LF4Q 2DGYA 4X66L 1HZCA 4RGMA 3URYA 1IBKL 2QGQA 1TS2A 4JC0A 2CFMA 1Y1WG 1MSHA 1LT5D 1BCPB 4NPSA 4DF7A 4A3LH 1A6XA 4JI0Q 4O2DA 5M3MG 2SEBD 4X66Q 2A8VA 3C1EA 3HZXA 1G291 1UWVA 5FLMG 1IBKQ 1L0YB 5J22A 2VW9A 4HMJA 1M1KC 4OXPA 2IHFA 1SE2A 1PTOD 3ULPA 2Q2IA 1A0IA 2XNAC 4DV3L 3CCLA 1FD7D 1EQQA 5DLQE 3TREA 4IQZA 2GVBA 3FVQA 1Y1VH 2F0VA 2OTJA 3S17H 4JPBW 1YZ6A 3QWNA 5C3EH 2DJGC 4DV3Q 5G3LD 4G7HC 2EQSA 1STEA 2KENA 4HSVA 5EGTA 2UUBL 1B8AA 5HURA 4R4QA 1EY9A 1V1PA 1VQ7A 1QJOA 2ZJQA 3L9AX 3MXNA 1NSNS 2CW0D 3S15H 2R7ZB 1Y1WB 3J81i 2UUBQ 1Q82C 5M3MB 4GKKQ 3VA7A 4JOIC 5JJIA 2R93B 2F03A 2CWAA 2J7ZA 4DV6L 1JR0D 1LT6D 4DV1L 3G71A 3FPUB 4IUTA 5LMNL 5FJ8H 3STBD 4TRDA 2K04A 1C0AA 4XT3B 4YWLA 2E2HB 3T13A 2JA6G 1D8LA 4DV6Q 5C44H 2F0PA 4DV1Q 1UE1A 3ZYYX 5LMNQ 5C0XJ 3KLSA 1V1QA 4WORA 4QCLA 2B8GA 2VY3A 2MNAA 1EOVA 3K58A 1GM5A 3GTGB 2F0LA 3ER0A 1JMCA 1JOOA 1Q81C 1NUCA 1RDPD 1C8CA 4BY7H 1GXDC 3PUZA 3J7YW 2NUCA 3AU7A 3PUVA 3T1HL 3RN5A 3GV3A 1K3RA 4X64L 1E2ZA 3Q6SA 1Q7YC 2C5CA 2Y0SB 3S14H 2LXJA 4HIOA 5LMNW 4LNQA 1PFMA 3SK6A 3K5NA 3SK8A 3T1HQ 1CM9A 4JI5L 1ZYRC 4XYOA 4X64Q 1ILQA 1ET9A 1QVCA 2NVXB 1CQVA 4EVOA 3PUXA 2K5VA 4L63B 1R9TB 1Y1VG 4JI5Q 5C3EG 4H7BA 1KHIA 3VYTA 5C0XH 2Z9HA 3RLFA 1G91A 2XWJB 1XPRA 1KNEA 2F0UA 2WAQE 4TKOB 1CK1A 1CQFA 2RCFA 4EX5A 1R4QB 1PV4A 3M7NA 3K5OA 2J4XA 1FYCA 1LUZA 2ASBA 3TP8A 1G2TA 4QF4A 1U4LA 3LNNA 1P8LA 5IIFA 2PZWA 4POGA 1SNQA 2L12A 4NP5A 4O0AA 1BF4A 1WD1A 3HS0C 4DXFA 2PI2E 2NVQH 2I5MX 3ERSX 4GNXA 2YTVA 4DK3C 3Q8DA 5C44G 2WFWA 1JB3A 4KN4C 1Y1VB 3PIOA 5EQ0A 4TVAB 3S17B 2A68C 5C3EB 4O1NA 4A3MH 1IZ6A 1XWEA 3DXJC 4JVZA 3F2UA 2XTIA 1H9JA 3CXCA 1Y69U 3OMGA 2ZXRA 5BN4A 1EIYB 3GV6A 2M2LA 3IL8A 5H1SE 2VB2X 2L55A 3FEWX 1FNWA 1Q1BA 3J81E 3S15B 3ICEA 5JEAJ 4BY1H 4KY7A 2EXDA 5T1GA 5M3FH 4B3ML 1SEBD 4IUNA 4J6HA 4QUCA 3CCMA 3S16H 4XDXA 1UNSA 1KC8C 3C1FA 4IOAA 2HT1A 4GZYC 3MXUA 3CW2C 1PDQA 2FJ2A 1AZQA 1H9SB 2HUGA 1XMOL 3LWEA 3NUCA 4B3MQ 1HRJA 4CJ2C 1C48A 2EPBA 4ZRZA 5C44B 1IW7C 1N36L 4RG1A 4M1UB 4I7ZC 1WD0A 1ASYA 4A3KH 1KQSA 3OHXC 3GP7A 1EIGA 3M4OH 1XMOQ 1EZ6A 2MPMA 2AQ3B 2FMMA 1KLUD 2F0WA 5C0XG 3UDFA 2JN4A 1Y8NB 4M8AA 4WJWA 1N36Q 1RF2D 4KHVA 4KK7A 1EFWA 2EYFA 1YNJC 1K83H 4BY7B 4HCEA 4X3KA 1WTRA 4DK1A 4IPCA 4PMWA 2BH2A 1KDCA 5GAGC 1UE7A 2NYZD 1IYVA 3QJYA 4KKUA 2KQ3A 5T1IA 3Q0AA 3S14B 1EYCA 4HSPA 3UDXA 1XNQQ 4G4KA 4IJLA 5I9PA 2L4NA 5IGFA 2Q2UA 1HFGA 1PRTF 2MO1A 2WACA 3BG3A 3NTIA 4N8FA 1K3BC 1HR0L 3BS1A 3D0FA 3ND9A 4H02A 4U673 1AN8A 1X54A 1Y8PB 3NWTA 4C2MH 1Q90A 1MJEA 4A3FH 1N34L 1MHWC 1GHJA 3NBIA 4A3MG 1HR0Q 4PZ8A 2Q8RE 4B9XA 1WTOA 4C3IH 1XPUA 1NR2A 3K6OA 4K8IA 3R8BA 5IP9H 1F77A 2L1BA 3KJPA 1N34Q 3AFPA 3FMCA 4RGNA 5LMUL 4YHHL 1K8MA 4BY1G 1SE4A 3J81L 3SEBA 4AYBG 1H9SA 5M3FG 3D8GA 4K6DA 5COYA 2WAQG 2CQAA 3H15A 4DA2A 3J80c 3AB9A 3DWQA 2E5LL 4FXGC 3PMFA 3R2IA 2JQOA 2P5ZX 2MHVA 3SDZA 5LMUQ 3OWFA 1SRUA 4YHHQ 1HR0W 1PLFA 2NB0A 1GUOA 2NVQB 3A56A 1EWCA 5G3LF 5K36H 1QUQB 2QILA 4FF3A 3I2ZA 2ICIA 2F0KA 1O7LA 1K9MC 3I56A 4A3KG 2I5HA 3NP8A 1B4OA 1II3A 1M4VA 3T16A 4L5QA 3K5MA 2LS01 2GN5A 1PRTC 4A3MB 4IUVA 2IWHA 3L7ZC 1CSQA 4HIMA 4IFDH 4B3TL 3BDLA 4CHTB 2R61A 4PNYA 3PO2H 5DM63 5IGDA 1S5DD 1PMRA 4B3TQ 4BY1B 4AYBB 4ZQ3A 3SHLA 4QY7A 5M3FB 1I4HA 4OGQC 3K59A 2WAQB 4EQOA 3VYUA 1QVGA 3PQIA 3JAME 5E1FA 1MSGA 4X65L 1K8GA 1RD9D 2QW7A 1TQOA 1QZHA 3DEOA 3E9IA 3SGIA 1O78A 2E74C 1SNMA 1I4XA 2K5HA 1YIJA 2EXZA 4JI2L 2K5DA 1BOSA 1STNA 4A3GH 4X65Q 3VDYA 4IUPA 1A15A 1RL2A 4JK1C 4A3KB 3M4OB 2HQLA 1VQBA 2PNRC 3NWSA 4K2LA 3SE0A 1L0WA 4A3FG 2JK8A 3DWAA 4J15A 4JI2Q 4AQYQ 1N32L 2ENBA 3PSIA 4LF9L 3BZCA 4C3IG 1C4QA 5IP9G 2CKZB 1GD7A 2QEJC 1GUWA 1K83B 3H91A 4ZLTF 1G6PA 4KJNA 1LTGD 1STBA 4YCVA 2K5NA 2YU9H 1N32Q 4IOCA 4LF9Q 1LT3D 4RWSC 1GUGA 3AQQA 2EY2A 4F88A 5JAVA 4PMBA 5KIXA 1XTCD 1HTLD 4V190 4P75A 1K28A 3NTHA 1B1ZA 3BVMA 2JA9A 1QNKA 3HOUH 1XX8A 5I6YA 1DYQA 4HEDA 1SMXA 4DAMA 3CMAA 2D2CC 3K7UC 3GTPH 1PXUA 1YNNC 5K36G 1NTGA 2ZM6L 1QZGA 2JSOA 4C2MB 1ILPA 1IL8A 3J7AV 3G7LA 3A8IE 3TP5A 2JA7G 4B9WA 4A3FB 5E3FA 2XRQD 4HJAA 3I91A 4H44C 4Q0FA 2ZJRA 1T9HA 1W6JA 1J6QA 4RKBA 2HDMA 4C3IB 3RZDH 4ALPA 5D65A 3MFGA 3JC66 4C3HH 3PO2G 4UHVA 2MJ8A 3KK7A 1A3VA 2JE6I 1PVOA 1KTKA 3MTSA 3NPPA 3ULLA 1CA5A 3FDTA 2G5DA 2RSNA 2X6LA 4IUUA 4Z9CB 4B08A 2H4OA 1D1KA 3KBGA 4CJ1B 1EIHA 3JAML 5IYCG 4G7OC 5J1ZA 4CDFC 5FLXc 3F2BA 4JI6L 4HR7B 3MXPA 2EY6A 5C4JH 1QVFA 4RGOS 1L0XB 4DV2L 2F0IA 4A3GG 2CWPA 1KRTA 1T5EA 4FXKC 4JI6Q 1WYDA 2JA7B 4P71A 2VZAA 4DV2Q 1PH7A 1G2SA 2OT2A 3CD6A 4R4CA 4H0LC 3W1BA 5JPMC 3HKZE 4NW2A 4DNIA 4NXNL 1SROA 3KDFB 3PO2B 3MZ5A 4RFBA 3HOZH 2RBMA 5CORA 2F1MA 3U58A 5IT9E 3CAMA 1B9NA 4OO1H 2DJFC 2L0CA 4GN3B 4ILWA 3I70A 3K7AH 4GNXC 4NXNQ 2K75A 5EPLA 1LLRD 1BXTA 4J8QA 3HOUG 4L8JA 4RHRA 4HIDA 2E2HH 3D4RA 4HJ7A 4JV5L 4RCNA 1TWCH 3H3VC 5IGCA 4ZAIA 4A3GB 2MUYA 2D0OA 1FNUA 5AJ3L 3OPOA 1SXTA 1IBLL 2A5HA 3TMEA 4KD4A 4JV5Q 1EFID 1VQPA 4HMIA 4DFAA 2QKIC 5AJ3Q 1VQAA 1E2VA 2K14A 2I0QA 2JYOA 1OTCA 1OXUA 4IPDA 1YEZA 4ME3A 3H3VH 3HG9A 1IBLQ 5C5MA 4C3HG 1BBUA 2BDOA 3KF6B 1WOCA 2IX3A 1PH6A 1NY4A 2YU9B 3TEHB 1XYIA 1SDFA 2M9VA 3GO5A 2FMCA 4HJ9A 1U9RA 4DU9A 5LL6X 4OELB 1KAAA 3A74A 2WKCA 4Y7NH 2Q2HA 1NMGA 3HOUB 1WJJA 4ULLA 3I7FA 4XT1B 3TP6A 1X3QA 3I4NH 4XXEA 4X3UA 3KLSX 1LTID 1PH1A 1V9PA 2SNSA 1STAA 4JCVE 3SK4A 2XGTA 4N9PA 3S24A 2ES2A 4P2CB 3E6ZX 3KDFA 2A74C 4JI8L 4JI1L 3RR5A 1V8QA 1EY5A 4KMUC 2F4VL 3RZDB 4BXXH 1Q46A 2KJXA 2D62A 1NE3A 2KHJA 4MZ9A 3BDOA 1JORA 4C3HB 2IX1A 4DUZL 1D2BA 1ENCA 1X55A 4JI8Q 3CCQA 3HOZG 4JI1Q 4KHZA 3IRBA 4LFCL 1HFNA 2NZ1D 2B3GA 4OO1G 3GTKH 2KCMA 2NBFA 4EQPA 2F4VQ 3R3OA 1GOZA 1S5CD 3UE1A 4DXGA 1JWUD 4DUZQ 2Q2TA 1O7ZA 4F87A 2YTYA 4DAVA 1SE3A 4LFCQ 2X69A 1H9MA 1HJPA 2QDLA 1I4QA 2CHBD 5C4JB 3D6CA 3M3YH 1STHA 1W2BA 1VQDA 5D3DA 1HNZL 1X3GA 3I8ZA 4DNRB 3K80C 4BA2I 5LHY1 4IPGA 3OSOA 1QWYA 4JBWA 1K73C 3HEJA 4LK1C 1A3TA 2NN6H 3KF6A 4DK6C 1HNZQ 1ONLA 2CCZA 4GKKL 1HCZA 1TS3A 4K6LA 2R6GA 5E7NA 4NB3A 1RJTA 3NE5B 1KL9A 1LM0A 1MIUA 2K5QA 3SVMA 2UXCL 3CP0A 1HZAA 3HOZB 4OHJA 3HKZG 3FP9A 1EU3A 1JJCB 1JOQA 5CV4A 3A54A 3K7AB 2CVRA 5FO7B 2E2DC 2UXCQ 4TQUS 3I90A 2A6ED 1VMCA 5GAHC 1X3EA 2F3VA 1AP0A 2IHEA 1DXMA 4CDCC 3I4NG 3VYSA 2O4XA 1NR4A 1PH9A 1TWCB 1VQMA 3W1GA 2DN8A 3K57A 2AMCB 1CKMA 5DM73 2A69D 4GNXB 1Z7TA 4C1NI 2JJQA 4K5WA 4O42A 4UDUC 1VQIA 4JI3L 1BCPD 2XSCA 4BXXG 1U4PA 4HCSA 1BDOA 5KNCA 4A93G 4G7ZC 1JJ2A 2BE5C 1P16A 1EY0A 1WTHA 2Z4HA 3IAYA 2Z6BA 1F9PA 2EYMA 1STGA 4WRDA 1U0LA 3HKZB 4JI3Q 2YTXA 5K5PA 4LUZA 3A7LA 3U9SA 4LF8Q 3VR2A 2RF4A 2PO4A 5C6AA 4Y7NB 1WFQA 2RDFA 1B7YB 2HQEA 4RH6A 3A0JA 3UE0A 5F2DA 1Z47A 3I4NB 2K6AA 5JPNC 4FYDA 3A7AB 5M9OA 1DD2A 2K50A 5ELDA 3G48A 1J9OA 1JE5A 5HY6A 3K5LA 4DR6L 2PQAB 4NKLA 2DNEA 1CUKA 5HGQA 2NN6G 4AYBE 1QCBD 2QEXA 4FXDA 1VQHA 3O13A 1VQ5A 1BBWA 4DR6Q 4DPGA 5JJZA 3G6EA 3P20A 1ENFA 2D9UA 3OWEB 2B2VA 2NZOA 4L5TA 1S5FD 5C0XI 3PGZA 2Q8TA 3GTKB 3E3XA 1YNXA 1SLJA 1CHQD 1ICWA 3OYYA 2EYPA 4DR5L 1ESRA 2B2YA 1XNRL 1EOTA 3B6YA 1HA5A 1HZBA 1KRSA 2XRSD 4CDEC 3PO3G 1UEAB 2L15A 3M3YB 3S1NH 3RN2A 3CRLC 2QCPX 3RUZA 5IYBH 2R7FA 4DR5Q 2F0MA 1XNRQ 3NSWA 1E24A 1F9SA 1EEFD 1IHZA 1A8VA 3PCOB 2MO0A 5KEEA 1DM0B 1WCMH 5KGUA 3F1ZA 1M90C 4R9WA 1SAPA 1N8RC 5EKIA 4XQNA 1X9NA 4E6IA 3C2PA 1ICFB 2RQXA 2AWOA 4FP5D 4DR1L 1PH4A 1QG7A 3OIQA 3PUWA 3OIPA 4UY8C 1KNAA 4GLAC 1HUNA 3DHQA 1RHPA 5C3WA 4DR1Q 2IT1A 3NTKA 1CA6A 3FHWA 1Q8KA 1MBYA 5IOCA 2PQAA 1CKNA 5FKAC 2Z4IA 1FGUA 5C3XA 1I6VC 4R1JA 1YJ9A 2IX0A 1I6HH 4YWMA 3TZUA 2OQ0A 4DNTB 2LXKA 1DONA 1D1IA 1PZKD 1VQ4A 3HOYH 4QB4A 2EZVA 4UP7A 4CKEA 5GADC 3J80i 2KCNA 1MGSA 3DWPA 2LY7A 2K1BA 1VCIA 1MD2D 4DKAC 1EQRA 1XNQL 3X3NA 2K28A 1SFOH 1CHPD 2NTTA 1E7ZA 2B2UA 4I65A 3HKSA 1VQFA 3RZOH 5CMDA 4RA8A 4CKCA 4GOPA 5JEAH 1JWSD 2ZTEA 3S1MH 2EDGA 3HOXH 3PUYA 3BDCA 2K52A 1SMYC 4OWTB 2OQKA 1EQVA 2K03A 4X6AH 1K8OA 2B8FA 5IYBG 3T51B 1S3OA 2XVSA 1F2YA 2IY5B 1LO5D 2EJGC 2F0FA 2K05A 2IL8A 3M4QA 4MTKA 3L2PA 1WCMG 4UPAA 1AEXA 3NXWA 5IP7H 1JOKA 2HCCA 1VQNA 2Z0SA 5CGKA 3M4PA 3EN2A 4K5XA 2A6HC 2C9OA 1C7YA 4X3TA 2NVTH 1PTOF 1QOHA 3CRKC 1WTPA 1HUMA 3RLOA 3JAMc 5ELNA 1A3UA 3K0XA 1TWHH 1YHQA 2V1CC 2XWBB 3RD4A 3EQLC 5IGGA 4FF1A 2F0DA 3QR8A 3VR4A 1A2TA 2F0TA 1U4MA 3T4AC 4GKJL 4K0KL 4ZUJA 2CH4A 4LW1A 1TS4A 1X32A 1UE5A 3GTOH 3S1NB 1IKMA 4OIJA 3BZKA 1NCVA 4ZUIA 2JA7H 4BWGB 3HOYG 3EA6A 1STYA 4ABNA 4GKJQ 4K0KQ 5KNBA 4A3BH 1XPOA 4CDDC 5KNDA 1WCMB 2N3SA 4HJ5A 2K32A 2LKVA 1JWMD 4A3JH 1IBML 1SJHD 4BS9A 5ISRA 1AE3A 4V0BA 2EYJA 3HRZC 2KOLA 2WINB 5JEAG 4IFDI 1HXYD 2BH8A 1FNVA 4S3SA 3W3AA 3MVVA 4K14A 4NDXA 1IBMQ 3GTMH 1ZKOA 2L5TA 2MP1A 2NWGA 3K8AA 3MWYW 5IYCH 4BBRH 4P72A 3HOXG 2CQOA 4CGYB 1EEID 5M5WH 4DV0L 1BBXC 2IW3A 1PTOC 4AQYL 1I6HB 3U9OA 4ZKCB 1RTOA 2SDFA 1DOKA 1ZYRD 2DNCA 1GKHA 3J80E 3HOYB 3CC4A 4DV0Q 5C5LA 2F0OA 1A62A 1WVLA 3AEVA 4PV1C 5IP7G 5CC4A 1PTOH 2JA5H 2J0TD 4JW0A 1SFOB 2B63H 4KTAA 4RKLA 4TSSA 3M85A 3QOJA 2JA6H 3KOJA 3RZOB 1JE4A 2CW0C 5A2QE 3QOLA 1FGBD 2RHQB 4OX9L 5DAUA 2B39A 3VR6A 2BCOA 4MN3A 3S1MB 5KYIA 2EVBA 1E0BA 1PHJA 4KHPL 2ICEC 1LTAD 2Q8IB 1I3QH 3HOXB 4OX9Q 1MI2A 3FRPB 4P74A 4GS3A 3STBC 4ZCKA 5D3IB 1HQRD 4KHPQ 1S4ZA 3F8TA 2F0SA 1AW7A 1YJNA 2F0NA 1TWGH 5IE8A 4KJOA 4A3BG 1VF7A 4CJ0B 2RA4A 1G6ZA 3V2TA 2YV5A 5I2YA 4FO2A 4DAPA 5BR8L 2QF7A 2ZXOA 4JG2A 3HOVG 1UEBA 4A3JG 2HIXA 2A68D 4QGUA 1NNXA 2F0GA 4YIJA 1X3PA 4LAAA 2NVTB 1D5XC 5DNFA 5L37A 3QG1A 5BR8Q 1JCKB 2LFNA 3VYRA 3PIP3 2RVLA 4JYAL 1TWHB 4BBRG 3I72A 2VUMH 4FNFA 1DOLA 4IO9A 1OO9B 2O5IC 1TXYA 4R4TA 4JYAQ 2ZXPA 3GTOB 3H09A 1Z9FA 2Z1CA 3P7JA 1LT4D 1SE8A 2PYKA 1I4GA 2M00A 1FVIA 4A3BB 4C1NK 1EY7A 4HJ8A 3GTJH 1IW7D 2PQEA 4UP8A 3S1QB 2B2VC 4ID6A 3AMUA 4DK0A 3BJUA 2AUKA 3A55A 2K33A 4A3JB 2JA5G 2UUCL 4PG3A 3Q24A 2R3ZA 2B63G 1EYDA 1LTTD 3F2CA 2SNMA 1EY6A 2C35B 2VNUD 4ODGA
chains in the Genus database with same CATH topology
2B2YC 5E4WC 1ZEQX 5A2QL 1YNJD 4QMGA 3GTMB 4HTHA 1LV9A 4BBRB 1VDZA 5M5WB 3QO2A 4OO1I 3HP3A 4LMQD 1F2ZA 5ELEA 1TVXA 3D6WA 1LTSD 3D31A 1V43A 3KBXA 1A2UA 1SBBB 1EQTA 2I07B 4WFN3 1TY0A 3DUZA 5FLXE 1KLGD 3KLRA 5I4DA 1PTOB 4KV6A 1GUSA 2JA5B 3VA5A 2B63B 2JA6B 2HCIA 2G9HD 4NMZA 2WKDA 2F4IA 5LL6S 1B50A 1I3QB 1EZ8A 4MIUA 3OW7A 3SXHA 2KVMA 2EYOA 2L11A 3V05A 2K7VA 1RTNA 3P1HA 3QIAA 1TWGB 2KHSA 3P75A 3MAQA 2EOTA 1WTQA 4DN4M 4ZYSA 2B2UC 5CV5A 3J7AF 3CU7A 1HHVA 1VF5C 1PRTD 2F0QA 1AFPA 4X3SA 5CR3A 5IT9L 1RKNA 2WIIB 1WTVA 3LWUA 3N6RA 2VUMB 1O7YA 2BA1A 1BR9A 3DMUA 3E5SA 1F2MA 1BNZA 4ZK9B 4K5VA 2BDNA 2SOBA 4IURA 4XQJA 2E76C 2F3WA 2OEOA 1SSOA 3D4WA 1QILA 4IALA 3GTJB 1HQMC 1ENAA 5FLXL 1CI3M 1R4PB 2ZT9C 1S5ED 2EY1A 1UUPA 2NN6I 5D14A 1S5BD 3Q23A 2FFKB 4HAEA 1BUVT 5ELFA 3MXGA 1Q12A 1IYUA 3R93A 3DM1A 4ME5A 5EJWA 3ITPA 3ERQA 2O2LD 2N55A 5CV7A 1AZPA 3GTQB 5EBDA 1HA6A 1YNND 2V4DA 1CZGA 5C4XB 3C3LA 3GTLB 2F0HA 2XIWA 3GQBA 2IPKD 3BZDB 2VB3X 3KF8A 2KEEA 2FHTA 3IKJA 1Q3LA 1V1OA 3I73A 1U4RA 5FO8B 3A8JE 2KEDA 4L6TB 2X6GA 3S2HB 2N88A 1PFBA 1VMPA 1OXXK 5BN3A 5I2XA 1B44D 1TWFB 3N52A 1PYWD 3NQIA 1SYEA 4A93B 2OXPA 5CBEE 1FR3A 4UAIA 2WV6D 4DAYA 1JQYD 2EYLA 3C46A 2BA0A 1JC7A 1CTMA 3MC0B 1W6KA 1OXSC 1JICA 5AFWA 3OOCA 5I6WA 5JOBA 2AQ1B 5EPJA 3M7GA 4R8NA 5CV9A 4IZ8A 4KY6A 3MEHA 3EFXD 2TMPA 3D3RA 4MHEA 1F9RA 2IJ0A 2PW7A 3TN2A 1EU4A 1D5ZC 3BYTB 3H6MA 3T56B 4IN3A 1UAPA 1GHKA 3R2TA 2B2TA 1F9QA 3RMHA 2RSOA 2E2JB 1Y8OB 2GA4B 2RDGA 3PO3B 1O80A 3SK5A 1TR5A 3NHHA 2B2WA 4R8IA 2A73B 1T5XD 2PW5A 1Z6HA 1QB5D 5IGEA 1LACA 1SYBA 1D6EC 1PZID 1WTWA 4Q5VA 1I4PA 2EJMA 5M5YB 1EY8A 2H1EA 3L3OC 3MFYA 4XTCS 5CBAE 1RCVD 3K0YA 5BN5A 2JXMB 4RCOA 4KN7C 1I4RA 1H9RA 1D5MC 1DZ1A 1RODA 1TWAB 2HDLA 4OIKA 1CZWA 4CBVA 5HGTA 1LABA 1TT2A 2WP8J 2QDBA 1SYGA 3BVZA 4U68A 1B53A 4K2KA 1BQQT 3MA2B 4XYQA 4RHSA 1G8ZD 1BO0A 2KECA 1DOMA 2FINB 1HTPA 4OL7A 4H13C 2JA8B 3X3MA 1ESFA 1ET6A 4IFDJ 3ND8A 3Q22A 2Z8LA 1IKLA 3NBHA 3EJIA 2O5JC 3TBIB 1TIID 1SJED 4K8JA 1EWHA 4F7XA 3LX0A 2D5DA 3H0GB 2JEBI 1TS5A 3FPPA 5TSSA 4PQXA 4FF2A 3S9WA 1KDBA 1SNCA 1I50B 3H94A 2RKSA 3HGBA 4A3IB 3D4DA 2JEAI 3FKIB 2NTSA 3BVGA 4QUFA 4KY5A 3WDNA 2XN9C 2PZTA 3QB3A 1PFNA 5CV8A 1SYCA 3MHBA 5DEHA 2BE5D 2F0JA 4RGTA 1B9MA 1SYFA 5M5XB 3HOWB 2KA7A 3CQZB 3PV0A 3I3CA 3VR5A 5KRUA 1KDAA 3S16B 1BCPF 3IFDA 4XQQA 3KUPA 4KKSA 4DGZA 2L9HA 2KCCA 3SR1A 2EYHA 2K5WA 1QNUA 4G57A 1DCZA 3TP7A 3T53B 1EYAA 2EJFC 2DY8A 2VXWA 4BBSB 2G9DA 4FVMA 2AWNA 3WOEA 2K01A 1XXGA 4EQNA 2ID0A 2MGSA 3I4MB 5C4ZA 2DY7A 4KD3A 1GJXA 2A6EC 2EY5A 3UI2A 5EKKA 2RDHA 4PMCA 5CV6A 5CYUA 2A69C 5EBCA 3TDQA 3CHBD 5EKLA 4J1MA 5FK9C 1BCPC 1TU2B 1TY2A 1OXVA 2PCFB 3OMCA 1GUTA 4RAUC 1CFMA 4IFDG 5ELBA 2I46A 2TSSA 3EROA 2PPBC 3IFTA 5FO9B 2NVYB 4A3DB 5E4XA 2AQ2B 1TKWB 5ELCA 4A3EB 3NK9A 1E2WA 3A8KE 1F2LA 3W2DA 3J80L 1LTBD 4KKTA 2JP1A 3V96A 5EPKA 3HOVB 1GUNA 5JVG3 3ONAB 1B3AA 3TZDA 4IUQA 3PIO3 3I4LA 3TSSA 2F0EA 3EVQA 5I9OA 4BA1I 1ZXTA 2AUJD 3DEPA 2E2IB 2KUMA 4C56C 1DJRD 3G6JB 1PRTB 1Q1EA 1HPCA 3BYYB 1KABA 3VR3A 1SMYD 2BOSA 1ML0D 2E75C 5IGBA 1LTRD 4C3JG 4FF4A 2B2TC 4LJZC 5IODA 5A35A 1EY4A 1H9KA 5NUCA 5C4HA 2EE1A 2LMCB 2PZUA 1EL0A 2PMZB 2YYZA 3CKIB 2A6HD 1Q8IA 2OF1A 5JVH3 2B2WC 1NAPA 4HN7A 3GD7A 1OXTA 3M4YA 3E0JA 1V1PB 4F8MA 1M8AA 4CKBA 1WTXA 1PZJD 3S1RB 1QE6A 1SNPA 3NQTA 4KI0A 4QIWB 4EGVA 3GTPB 2WB1B 3S2DB 1SNOA 1SNDA 4C3JB 1B2TA 2R92B 5J39A 5KYLA 4ZKBB 5FOBB 4XIGS 3WOFA 4N9TA 1CT1D 1J8IA 1SYDA 4RGMA 3URYA 1TS2A 1MSHA 1LT5D 1BCPB 4DF7A 1A6XA 2SEBD 3C1EA 3HZXA 1G291 1L0YB 5J22A 4HMJA 1SE2A 1PTOD 2XNAC 1FD7D 4IQZA 3FVQA 2F0VA 3QWNA 4G7HC 5G3LD 1STEA 4HSVA 5EGTA 5HURA 1EY9A 1V1PA 1QJOA 3L9AX 3MXNA 1NSNS 2CW0D 2R7ZB 1Y1WB 5M3MB 3VA7A 2R93B 2F03A 2J7ZA 1JR0D 1LT6D 3FPUB 4IUTA 4TRDA 2K04A 4XT3B 2E2HB 3T13A 2F0PA 3ZYYX 5C0XJ 3KLSA 4WORA 4QCLA 2B8GA 3K58A 3GTGB 2F0LA 1JOOA 1NUCA 1RDPD 1C8CA 1GXDC 3PUZA 3J7YW 2NUCA 3AU7A 3PUVA 3GV3A 1E2ZA 3Q6SA 2C5CA 2Y0SB 1PFMA 3SK6A 3K5NA 3SK8A 1CM9A 1ZYRC 4XYOA 1ILQA 1ET9A 2NVXB 1CQVA 4EVOA 3PUXA 4L63B 1R9TB 4H7BA 3VYTA 5C0XH 3RLFA 1G91A 2XWJB 1KNEA 2F0UA 4TKOB 1CK1A 1CQFA 1R4QB 3M7NA 3K5OA 2J4XA 1FYCA 3TP8A 1G2TA 4QF4A 1U4LA 3LNNA 5IIFA 2PZWA 1SNQA 2L12A 4NP5A 1BF4A 1WD1A 3HS0C 4DXFA 1JB3A 4KN4C 1Y1VB 5EQ0A 3S17B 2A68C 5C3EB 4O1NA 1XWEA 3DXJC 3F2UA 1H9JA 1Y69U 5BN4A 3OMGA 2ZXRA 3GV6A 2M2LA 3IL8A 2VB2X 2L55A 3FEWX 1FNWA 1Q1BA 3J81E 3S15B 5JEAJ 4KY7A 5T1GA 1SEBD 4IUNA 4J6HA 4QUCA 4XDXA 1UNSA 3C1FA 4GZYC 3MXUA 1PDQA 2FJ2A 1AZQA 1H9SB 2HUGA 3LWEA 3NUCA 1HRJA 4CJ2C 1C48A 2EPBA 4ZRZA 5C44B 1IW7C 4M1UB 4I7ZC 1WD0A 3OHXC 3GP7A 1EIGA 1EZ6A 2MPMA 2AQ3B 2FMMA 1KLUD 2F0WA 5C0XG 1Y8NB 4M8AA 4WJWA 1RF2D 4KHVA 4KK7A 2EYFA 1YNJC 4BY7B 4HCEA 4X3KA 1WTRA 4DK1A 4PMWA 1KDCA 2NYZD 1IYVA 3QJYA 4KKUA 2KQ3A 5T1IA 3Q0AA 3S14B 1EYCA 4HSPA 4G4KA 5I9PA 2L4NA 5IGFA 1HFGA 1PRTF 2WACA 3BG3A 3NTIA 3BS1A 3ND9A 4U673 1AN8A 1Y8PB 3NWTA 1Q90A 1GHJA 3NBIA 4B9XA 2Q8RE 1WTOA 1NR2A 3K6OA 4K8IA 3R8BA 1F77A 2L1BA 3FMCA 4RGNA 1K8MA 1SE4A 3J81L 3SEBA 1H9SA 3D8GA 4K6DA 5COYA 2CQAA 4DA2A 3AB9A 3DWQA 4FXGC 3PMFA 3R2IA 2MHVA 3SDZA 3OWFA 1PLFA 2NB0A 1GUOA 2NVQB 3A56A 1EWCA 5G3LF 5K36H 2QILA 4FF3A 2ICIA 2F0KA 1O7LA 3NP8A 1B4OA 1II3A 1M4VA 3T16A 3K5MA 2LS01 1PRTC 4A3MB 4IUVA 2IWHA 3L7ZC 4IFDH 3BDLA 4CHTB 2R61A 4PNYA 5DM63 5IGDA 1S5DD 1PMRA 4BY1B 4AYBB 4ZQ3A 3SHLA 5M3FB 1I4HA 4OGQC 3K59A 2WAQB 4EQOA 3VYUA 3JAME 5E1FA 1MSGA 1RD9D 1TQOA 3DEOA 1O78A 2E74C 1SNMA 1I4XA 2EXZA 2K5DA 1BOSA 1STNA 4IUPA 1A15A 4JK1C 4A3KB 3M4OB 2PNRC 3NWSA 4K2LA 3SE0A 3DWAA 2ENBA 4C3IG 1C4QA 2QEJC 1GUWA 1K83B 3H91A 4ZLTF 4KJNA 1LTGD 1STBA 1LT3D 4RWSC 1GUGA 2EY2A 4F88A 5JAVA 4PMBA 5KIXA 1XTCD 1HTLD 4V190 3NTHA 1B1ZA 3BVMA 1QNKA 1XX8A 5I6YA 1DYQA 4HEDA 2D2CC 1PXUA 1YNNC 5K36G 2JSOA 4C2MB 1ILPA 1IL8A 3J7AV 3G7LA 3A8IE 3TP5A 4B9WA 4A3FB 5E3FA 2XRQD 3I91A 4H44C 4Q0FA 1W6JA 4RKBA 2HDMA 4C3IB 5D65A 3MFGA 2MJ8A 1A3VA 2JE6I 3KK7A 1KTKA 3MTSA 3NPPA 1CA5A 3FDTA 2RSNA 2X6LA 4IUUA 4Z9CB 4B08A 2H4OA 1D1KA 3KBGA 4CJ1B 1EIHA 3JAML 4G7OC 5J1ZA 4HR7B 2EY6A 3MXPA 4RGOS 1L0XB 2F0IA 1T5EA 4FXKC 2JA7B 1G2SA 2OT2A 4H0LC 5JPMC 4NW2A 3PO2B 3MZ5A 4RFBA 2RBMA 5CORA 2F1MA 5IT9E 1B9NA 4OO1H 2L0CA 4ILWA 3I70A 5EPLA 1LLRD 1BXTA 4J8QA 4L8JA 4RHRA 3D4RA 4RCNA 3H3VC 5IGCA 4ZAIA 4A3GB 2MUYA 1FNUA 3OPOA 1SXTA 2A5HA 3TMEA 4KD4A 1EFID 4HMIA 4DFAA 2QKIC 1E2VA 2JYOA 1OXUA 3HG9A 5C5MA 4C3HG 2BDOA 2IX3A 2YU9B 1XYIA 1SDFA 2M9VA 3GO5A 2FMCA 1U9RA 4DU9A 5LL6X 1KAAA 2WKCA 3HOUB 4ULLA 4XT1B 3TP6A 1X3QA 4XXEA 4X3UA 3KLSX 1LTID 2SNSA 1STAA 3SK4A 4N9PA 4P2CB 3E6ZX 2A74C 1V8QA 1EY5A 4KMUC 3RZDB 2KJXA 2D62A 3BDOA 1JORA 4C3HB 2IX1A 1D2BA 1ENCA 4KHZA 1HFNA 2NZ1D 4OO1G 2NBFA 4EQPA 3R3OA 1GOZA 1S5CD 4DXGA 1JWUD 1O7ZA 4F87A 4DAVA 1SE3A 2X69A 1H9MA 1I4QA 2CHBD 5C4JB 3D6CA 1STHA 5D3DA 3I8ZA 4DNRB 4BA2I 5LHY1 3OSOA 1QWYA 4JBWA 3HEJA 4LK1C 1A3TA 2NN6H 1ONLA 1HCZA 1TS3A 4K6LA 2R6GA 1RJTA 3NE5B 2K5QA 3SVMA 3HOZB 4OHJA 1EU3A 1JOQA 5CV4A 3A54A 3K7AB 2CVRA 5FO7B 2E2DC 4TQUS 3I90A 2A6ED 1VMCA 2F3VA 1AP0A 1DXMA 3VYSA 2O4XA 1NR4A 1TWCB 2DN8A 3K57A 5DM73 2A69D 1Z7TA 4C1NI 4K5WA 4O42A 4UDUC 1BCPD 2XSCA 1U4PA 4HCSA 1BDOA 5KNCA 4G7ZC 2BE5C 1EY0A 2Z4HA 3IAYA 1F9PA 2EYMA 1STGA 4WRDA 3HKZB 5K5PA 3A7LA 3U9SA 3VR2A 2PO4A 5C6AA 4Y7NB 2RDFA 2HQEA 4RH6A 5F2DA 1Z47A 3I4NB 2K6AA 5JPNC 4FYDA 3A7AB 5M9OA 1DD2A 5ELDA 1J9OA 3K5LA 4NKLA 2DNEA 2NN6G 1QCBD 4FXDA 3O13A 5JJZA 3P20A 1ENFA 2D9UA 3OWEB 2B2VA 1S5FD 5C0XI 2Q8TA 3GTKB 1CHQD 1ICWA 2EYPA 1ESRA 2B2YA 1EOTA 1HA5A 2XRSD 1UEAB 3M3YB 3CRLC 2QCPX 3RUZA 2F0MA 3NSWA 1F9SA 1EEFD 1IHZA 5KEEA 1DM0B 5KGUA 4R9WA 1SAPA 5EKIA 4XQNA 4E6IA 3C2PA 2RQXA 2AWOA 4FP5D 1QG7A 3OIQA 3PUWA 3OIPA 1KNAA 1HUNA 3DHQA 1RHPA 5C3WA 2IT1A 3NTKA 1CA6A 1MBYA 5IOCA 5FKAC 2Z4IA 5C3XA 1I6VC 2IX0A 3TZUA 4DNTB 1DONA 1D1IA 1PZKD 4QB4A 2EZVA 4CKEA 2KCNA 1MGSA 3DWPA 2LY7A 2K1BA 1VCIA 1MD2D 3X3NA 2K28A 1CHPD 2NTTA 2B2UA 4I65A 5CMDA 4RA8A 4CKCA 5JEAH 1JWSD 2EDGA 3PUYA 3BDCA 1SMYC 1EQVA 2K03A 1K8OA 2B8FA 3T51B 2XVSA 1F2YA 1LO5D 2EJGC 2F0FA 2K05A 2IL8A 1AEXA 3NXWA 1JOKA 2HCCA 5CGKA 4K5XA 2A6HC 2C9OA 4X3TA 1PTOF 1QOHA 3CRKC 1WTPA 1HUMA 1A3UA 2XWBB 3RD4A 3EQLC 5IGGA 4FF1A 2F0DA 3VR4A 1A2TA 2F0TA 1U4MA 3T4AC 4ZUJA 1TS4A 1X32A 3S1NB 1IKMA 4OIJA 1NCVA 4ZUIA 4BWGB 3EA6A 1STYA 4ABNA 5KNBA 5KNDA 1WCMB 2K32A 2LKVA 1JWMD 1SJHD 4BS9A 5ISRA 4V0BA 2EYJA 3HRZC 2KOLA 2WINB 5JEAG 4IFDI 1HXYD 4S3SA 1FNVA 3W3AA 3MVVA 4K14A 4NDXA 1ZKOA 2L5TA 2MP1A 2NWGA 3MWYW 4CGYB 1EEID 1BBXC 2IW3A 1PTOC 1I6HB 3U9OA 4ZKCB 1RTOA 2SDFA 1DOKA 1ZYRD 2DNCA 3J80E 3HOYB 5C5LA 2F0OA 1WVLA 4PV1C 5CC4A 1PTOH 2J0TD 1SFOB 4KTAA 4RKLA 4TSSA 3M85A 3QOJA 3RZOB 1JE4A 2CW0C 5A2QE 3QOLA 1FGBD 5DAUA 2B39A 3VR6A 2BCOA 4MN3A 3S1MB 5KYIA 2EVBA 1E0BA 2ICEC 1LTAD 2Q8IB 3HOXB 1MI2A 3FRPB 5D3IB 1HQRD 1S4ZA 2F0SA 1AW7A 2F0NA 4KJOA 1VF7A 4CJ0B 2RA4A 1G6ZA 3V2TA 5I2YA 4FO2A 4DAPA 2QF7A 2ZXOA 2A68D 2F0GA 4YIJA 1X3PA 4LAAA 2NVTB 1D5XC 5DNFA 3QG1A 1JCKB 2LFNA 3VYRA 3PIP3 2RVLA 1TWHB 3I72A 4FNFA 1DOLA 1OO9B 2O5IC 2ZXPA 3GTOB 3H09A 2Z1CA 3P7JA 1LT4D 2PYKA 1I4GA 2M00A 4A3BB 4C1NK 1EY7A 1IW7D 2PQEA 3S1QB 2B2VC 4ID6A 3AMUA 4DK0A 2AUKA 3A55A 2K33A 4A3JB 3Q24A 2R3ZA 1EYDA 1LTTD 2SNMA 1EY6A 2VNUD 4ODGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD4 A;  2EYP A;  2F0J A;  3PMF A;  3DMU A;  5CC4 A;  1SNP A;  3NQT A;  4HMI A;  3E5S A;  1F2Y A;  4QMG A;  1F2M A;  4DFA A;  3NK9 A;  3OWF A;  4KY7 A;  1SYF A;  4K5V A;  1JOQ A;  5CV4 A;  2F0F A;  1SNO A;  1SND A;  2F0L A;  4HTH A;  4KTA A;  4RKL A;  3TP5 A;  4B9W A;  1SYE A;  1JOO A;  3QOJ A;  4IUN A;  2OXP A;  5E3F A;  1NUC A;  4J6H A;  2SOB A;  3QOL A;  5C5M A;  1AEX A;  3RUZ A;  3NXW A;  3C1F A;  5KYL A;  1JOK A;  2NUC A;  2F0M A;  2F3W A;  5HGT A;  2OEO A;  5DAU A;  5KRU A;  4N9T A;  1KDA A;  3D4W A;  4RKB A;  1IHZ A;  2F0K A;  5CGK A;  4IAL A;  5KYI A;  1U9R A;  2F3V A;  3NP8 A;  4K5X A;  3NUC A;  1F2Z A;  1II3 A;  1ENA A;  1SYD A;  1TT2 A;  2O4X A;  3T16 A;  5KEE A;  2EYL A;  4DU9 A;  2QDB A;  5KGU A;  4DGZ A;  1SYG A;  1KAA A;  1A3V A;  3SK6 A;  3SR1 A;  2EYH A;  4K2K A;  3SK8 A;  1A2U A;  1A3U A;  4E6I A;  3BDL A;  4DF7 A;  4G57 A;  2F0E A;  2EY1 A;  3TP7 A;  3TP6 A;  1EZ6 A;  3EVQ A;  1EYA A;  2F0S A;  5JOB A;  5I6W A;  5I9O A;  2F0D A;  4PNY A;  5IGG A;  3C1E A;  2SNS A;  5IGD A;  4K5W A;  1A2T A;  2F0W A;  4EVO A;  2F0N A;  4KV6 A;  2F0T A;  3HZX A;  4R8N A;  5J1Z A;  4KJO A;  1STA A;  5CV9 A;  4IZ8 A;  4OL7 A;  4ZQ3 A;  4ZUJ A;  4HMJ A;  3SHL A;  3SK4 A;  4N9P A;  3VA5 A;  5J22 A;  2EY6 A;  3DHQ A;  3MEH A;  1EY0 A;  3MXP A;  4KHV A;  4KY6 A;  4EQN A;  2EYF A;  3V2T A;  4EQO A;  5C3W A;  4ME5 A;  2EYM A;  5E1F A;  4H7B A;  2F0I A;  4ZUI A;  1STG A;  3ITP A;  4WRD A;  5C4Z A;  5IOC A;  1EY5 A;  2PW7 A;  1TQO A;  4NMZ A;  1KDC A;  1STY A;  3ERQ A;  5C3X A;  5CV7 A;  1SNM A;  2F0G A;  2KQ3 A;  4YIJ A;  5K5P A;  2F0V A;  4LAA A;  1KAB A;  2F0U A;  4KD3 A;  1EYC A;  1JOR A;  1EZ8 A;  1ENC A;  2EXZ A;  3H6M A;  4MIU A;  3EJI A;  5C6A A;  2EY5 A;  1STN A;  2RDF A;  2LKV A;  3SXH A;  2EYO A;  5I9P A;  2HQE A;  4QB4 A;  5IGF A;  5EKK A;  5DEH A;  4K8J A;  4EQP A;  5EGT A;  3R3O A;  3TP8 A;  2WAC A;  4F7X A;  5IGB A;  5F2D A;  5ISR A;  4QF4 A;  4K2L A;  2F0H A;  4PMC A;  3P1H A;  5HUR A;  5CV6 A;  3LX0 A;  2EYJ A;  5M9O A;  1EY9 A;  3MZ5 A;  5IOD A;  5IIF A;  1EY4 A;  2RBM A;  2KHS A;  2PZW A;  2ENB A;  1NSN S;  4S3S A;  1SNQ A;  3P75 A;  5EKL A;  4NKL A;  4NP5 A;  5NUC A;  3MVV A;  5J39 A;  4K14 A;  4J1M A;  4NDX A;  3S9W A;  1KDB A;  1SNC A;  5C4H A;  2PZU A;  3D6C A;  5CV5 A;  1STH A;  4I65 A;  2RKS A;  2PYK A;  4KJN A;  4B9X A;  2M00 A;  1STB A;  3D4D A;  2OF1 A;  3SK5 A;  1TR5 A;  3NHH A;  2F0Q A;  3OMC A;  1EY7 A;  3OSO A;  3U9O A;  2EY2 A;  4K8I A;  2PW5 A;  5CR3 A;  3HEJ A;  5JAV A;  2PQE A;  4PMB A;  1A3T A;  4TRD A;  5KIX A;  3ERO A;  4ID6 A;  5IGC A;  4KY5 A;  3T13 A;  4F8M A;  3BDC A;  1RKN A;  2PZT A;  3QB3 A;  2F0P A;  5CV8 A;  5IGE A;  1SYC A;  1SYB A;  5I6Y A;  3D8G A;  1EYD A;  3MHB A;  4K6D A;  2SNM A;  1EY6 A;  1EQV A;  2F0O A;  5C5L A;  1EY8 A;  3OMG A;  3TME A;  4WOR A;  4ODG A; 
#chains in the Genus database with same CATH topology
 2B2Y C;  5E4W C;  2VQE L;  1ZEQ X;  2A19 A;  5A2Q L;  1X65 A;  1YNJ D;  2AKW B;  4QMG A;  2UUC Q;  3GTM B;  4HTH A;  1LV9 A;  1PA6 A;  4BBR B;  4HIK A;  1VDZ A;  3ZJY C;  2PNH A;  4KLK A;  2VQE Q;  2Z6K A;  1PH5 A;  1IL2 A;  5M5W B;  1PYS B;  3QO2 A;  4OO1 I;  3HP3 A;  4LMQ D;  1Y14 B;  2KHI A;  5IYD H;  1F2Z A;  5ELE A;  1TVX A;  3OTO L;  1YHA A;  3CPW A;  3CF5 A;  1YVC A;  3D6W A;  1LTS D;  3D31 A;  1V43 A;  3KBX A;  4DR4 L;  1A2U A;  4DR3 L;  1SBB B;  1EQT A;  2I07 B;  5C4X H;  2ZTC A;  4WFN 3;  1TY0 A;  4DR2 L;  3DUZ A;  5FLX E;  1KLG D;  4JI7 L;  3OTO Q;  2N8N A;  3KLR A;  3U4V A;  5I4D A;  1PTO B;  4A75 A;  4KV6 A;  1HNX L;  4QQB X;  1GUS A;  2ALY B;  2JA5 B;  4DR4 Q;  3VA5 A;  4DR3 Q;  3NEN A;  2B63 B;  2JA6 B;  4DR2 Q;  2HCI A;  4JBM A;  4JI7 Q;  2G9H D;  4NMZ A;  1HNX Q;  2WKD A;  4GN4 B;  3H3V I;  2F4I A;  2VUM G;  1E1O A;  1VS0 A;  5LL6 S;  2R7D A;  1B50 A;  1I3Q B;  1EZ8 A;  4MIU A;  3OW7 A;  3SXH A;  3S2H H;  1NJI C;  2KVM A;  2EYO A;  2L11 A;  3V05 A;  2K4K A;  2K7V A;  1RTN A;  3P1H A;  1GVP A;  3QIA A;  1TWG B;  2KHS A;  3P75 A;  3MAQ A;  2EOT A;  1WTQ A;  4DN4 M;  4ZYS A;  1TWF H;  2B2U C;  3KJO A;  5CV5 A;  3J7A F;  4A93 H;  1GO3 E;  1YJW A;  3CU7 A;  4GOP C;  1FJG L;  1HHV A;  1VF5 C;  1PRT D;  2F0Q A;  1AFP A;  1VQG A;  4N8X 1;  4X3S A;  5CR3 A;  5IT9 L;  3CCJ A;  1RKN A;  4OWX B;  3EBE A;  2WII B;  1FJG Q;  2I5L X;  1WTV A;  3KF8 B;  1RIP A;  3LWU A;  3N6R A;  2VUM B;  1O7Y A;  2BA1 A;  2R7Z G;  1BR9 A;  3DMU A;  3E5S A;  1F2M A;  1BNZ A;  4ZK9 B;  1U5K A;  4K5V A;  5IYD G;  4L5R C;  2R93 G;  2BDN A;  1XJV A;  2SOB A;  4IUR A;  4XQJ A;  2E76 C;  4IJH A;  2F3W A;  2OEO A;  1SSO A;  3CME A;  3D4W A;  1QIL A;  4IAL A;  3GTJ B;  5C4X G;  3CCS A;  1E1T A;  1HQM C;  1ENA A;  1HH2 P;  5FLX L;  1CI3 M;  1R4P B;  1L1O B;  2ZT9 C;  1S5E D;  4FDB A;  2EY1 A;  1UUP A;  2NN6 I;  5D14 A;  1S5B D;  3Q23 A;  2FFK B;  4HAE A;  4Y52 H;  3W5O A;  1BUV T;  4DAY B;  2HHH L;  4OWW B;  5ELF A;  3MXG A;  4R4O A;  2A1A A;  1Q12 A;  1IYU A;  1VQ9 A;  3R93 A;  3A5Z B;  3DM1 A;  2E2J H;  4ME5 A;  5EJW A;  3PO3 H;  3ULJ A;  3ITP A;  4OON A;  2HHH Q;  1NBW A;  3ERQ A;  2O2L D;  2Y0S G;  2N55 A;  5CV7 A;  1AZP A;  3GTQ B;  3E0E A;  5EBD A;  5IY0 A;  1HA6 A;  1YNN D;  1EYG A;  2V4D A;  1CZG A;  5C4X B;  3C3L A;  3GTL B;  5M5Y H;  2F0H A;  2XIW A;  3MEF A;  3GQB A;  2IPK D;  4LF8 L;  3BZD B;  1ASZ A;  4DV7 L;  1E22 A;  2VB3 X;  3KF8 A;  3M9B A;  2KEE A;  2AHO B;  2FHT A;  3IKJ A;  1TWA H;  1Q3L A;  1O7I A;  4IPH A;  1V1O A;  4MNO A;  3I73 A;  4DV7 Q;  1U4R A;  5FO8 B;  1AH9 A;  3TS2 A;  3A8J E;  1YIT A;  2KED A;  4LF5 L;  4L6T B;  2X6G A;  2RCN A;  3BU2 A;  4A3L G;  3S2H B;  2KBN A;  1Q86 C;  2LSS A;  2N88 A;  1PFB A;  1VMP A;  4L5S A;  1OXX K;  4A3C H;  4RMF A;  1CKN B;  3A5U A;  4APV A;  3AYH B;  3NEL A;  4LF5 Q;  1L1O A;  3PF4 A;  3L0O A;  5BN3 A;  3J7A 5;  4WJ4 A;  5I2X A;  1B44 D;  2UXB L;  1TWF B;  1G51 A;  3N52 A;  1VQC A;  1PYW D;  3NQI A;  1SR3 A;  1SYE A;  4A93 B;  2OXP A;  3J81 c;  2JA8 H;  5CBE E;  1BVS A;  1I94 L;  1FR3 A;  4UAI A;  2WV6 D;  4DAY A;  1C9O A;  3PIP A;  1VQO A;  1UE6 A;  4WJ3 M;  1JB7 A;  1K0S A;  1JQY D;  2UXB Q;  4LUO A;  2EYL A;  3C46 A;  2BA0 A;  1JC7 A;  1KAW A;  1CTM A;  1I94 Q;  3MC0 B;  2VQF L;  1W6K A;  1VQ6 A;  1OXS C;  1JIC A;  1X56 A;  4GOP B;  2CH4 W;  5AFW A;  3PF5 A;  3OOC A;  5I6W A;  5JOB A;  3H0G H;  2AQ1 B;  5EPJ A;  3M7G A;  2OWO A;  4R8N A;  1MKH A;  5CV9 A;  4IZ8 A;  2VQF Q;  4KY6 A;  3MEH A;  1I50 H;  4AH6 A;  3EFX D;  2TMP A;  3D3R A;  4MHE A;  1LYL A;  3CC2 A;  1F9R A;  2IJ0 A;  4A3I H;  5FJ8 G;  1CSP A;  2PW7 A;  4PZ7 A;  3TN2 A;  1NMF A;  3FKI H;  1VQE A;  4B3R L;  1EU4 A;  1D5Z C;  1S72 A;  3BYT B;  3H6M A;  3T56 B;  4IN3 A;  3AFQ A;  1UAP A;  1SN8 A;  1GHK A;  3R2T A;  2F3I A;  5GQO A;  4B3R Q;  1E3P A;  1PH8 A;  2B2T A;  1H95 A;  1F9Q A;  1L2F A;  1W3S A;  3RMH A;  4DV5 L;  4LF7 L;  3GDE A;  1PFS A;  4BY7 G;  1IXR A;  5M5X H;  3HOW H;  2RSO A;  2E2J B;  1Y8O B;  2GA4 B;  1X3F A;  2RDG A;  3CQZ H;  3PO3 B;  1O80 A;  3NBH B;  3J81 j;  3SK5 A;  1TR5 A;  3NHH A;  4DV5 Q;  2B2W A;  4R8I A;  4LF7 Q;  1YI2 A;  4A3C G;  2UU9 L;  2A73 B;  1T5X D;  2PW5 A;  3JAM i;  1Z6H A;  1MJC A;  2DUD A;  1QB5 D;  5IGE A;  1LAC A;  1SYB A;  1D6E C;  1PZI D;  3CCE A;  1WTW A;  4Q5V A;  1I4P A;  2EJM A;  2UU9 Q;  5M5Y B;  1EY8 A;  2H1E A;  3L3O C;  3MFY A;  1B70 B;  4XTC S;  2JA8 G;  5CBA E;  1RCV D;  3K0Y A;  5BN5 A;  2JXM B;  4RCO A;  3TRZ A;  4KN7 C;  1I4R A;  1WI5 A;  4BBS H;  1H9R A;  1D5M C;  4JI4 L;  1DZ1 A;  1ROD A;  4UP9 A;  1TWA B;  2HDL A;  4OIK A;  1CZW A;  2Z6K C;  3HFZ B;  3WWV A;  4CBV A;  3I4M H;  3TQY A;  5HGT A;  4JI4 Q;  1LAB A;  4YWK A;  1TT2 A;  2WP8 J;  3UDI A;  2QDB A;  3H0G G;  2OCE A;  4YCU A;  1SYG A;  3BVZ A;  4U68 A;  1B53 A;  4K2K A;  1BQQ T;  2EIF A;  3MA2 B;  4LF6 L;  4XYQ A;  4R4I A;  3OW2 A;  4RHS A;  4DV4 L;  4AIM A;  4LUV A;  4A3I G;  5EAY A;  1G8Z D;  1BO0 A;  4YCW A;  2KEC A;  1DOM A;  2FIN B;  4X62 L;  1HTP A;  3CC7 A;  4OL7 A;  3FKI G;  4LF6 Q;  4H13 C;  2JA8 B;  4QL5 A;  4DV4 Q;  4QJF A;  3X3M A;  1ESF A;  4A4I A;  1ET6 A;  4X62 Q;  1VQK A;  4IFD J;  3ND8 A;  3K81 C;  1JJG A;  3Q22 A;  2Z8L A;  1IKL A;  5ELO A;  3NBH A;  3EJI A;  2F52 A;  2N49 A;  2O5J C;  2NVY H;  3TBI B;  4A3D H;  1TII D;  1SJE D;  4K8J A;  2ATW A;  1EWH A;  4F7X A;  3HOW G;  3LX0 A;  2D5D A;  3H0G B;  2JEB I;  4A3E H;  1TS5 A;  3FPP A;  1J5E L;  5GAE C;  5TSS A;  4PQX A;  4FF2 A;  3S9W A;  1KDB A;  1SNC A;  1I50 B;  3H94 A;  3DLL A;  2RKS A;  3HGB A;  4JOI A;  4A3I B;  3D4D A;  2JEA I;  3S1Q H;  1J5E Q;  3FKI B;  2NTS A;  3U50 C;  3HOV H;  2E5L Q;  3BVG A;  4QUF A;  2PMZ E;  2HD3 A;  3NEM A;  1A63 A;  4KY5 A;  3WDN A;  4BBS G;  2XN9 C;  2PZT A;  3QB3 A;  1PFN A;  5CV8 A;  1SYC A;  3MHB A;  5J3B A;  1FL0 A;  5DEH A;  2BE5 D;  2F0J A;  1KD1 C;  4NXM L;  3I4M G;  1DGS A;  4RGT A;  4GLX A;  1B9M A;  2VS1 A;  1SYF A;  5M5X B;  3HOW B;  2KA7 A;  2E2I H;  3CQZ B;  3PV0 A;  3I3C A;  3VR5 A;  4NXM Q;  1VQ8 A;  3U4Z A;  2E8G A;  4GN5 A;  5KRU A;  1KDA A;  4QIW E;  3I4O A;  3S16 B;  1BCP F;  1X6O A;  2WB1 E;  3IFD A;  4XQQ A;  3KUP A;  2FXQ A;  1N9W A;  4KKS A;  4DGZ A;  2L9H A;  2UUA L;  2KCC A;  4OEM B;  3SR1 A;  2EYH A;  2K5W A;  1QNU A;  4G57 A;  1DCZ A;  3TP7 A;  3T53 B;  3CCV A;  1EYA A;  2EJF C;  1K8A C;  2DY8 A;  3CCU A;  2VXW A;  3KFU A;  4BBS B;  2UUA Q;  2G9D A;  4FVM A;  2AWN A;  4PZ6 A;  3WOE A;  2K01 A;  1XXG A;  4EQN A;  3I55 A;  2ID0 A;  1YBY A;  2MGS A;  3I4M B;  5C4Z A;  2DY7 A;  4A3D G;  4JBJ A;  2H5X A;  1N33 L;  4KD3 A;  1VQL A;  1GJX A;  2A6E C;  1BKB A;  2EY5 A;  3UI2 A;  4P73 A;  4A3E G;  5EKK A;  2RDH A;  1QUQ A;  1N33 Q;  4PMC A;  3S1R H;  3F2D A;  5CV6 A;  1XMQ L;  5CYU A;  2A69 C;  5EBC A;  1EIF A;  3TDQ A;  3CHB D;  1KIX A;  5EKL A;  2ZTD A;  3KLW A;  4J1M A;  3TS0 A;  5FK9 C;  3S2D H;  4C3J H;  2R92 H;  1BCP C;  5IT9 c;  1TU2 B;  1TY2 A;  1XMQ Q;  4JBK A;  1OXV A;  2PCF B;  3OMC A;  1GUT A;  2NZH A;  4RAU C;  1CFM A;  4IFD G;  5ELB A;  2I46 A;  2TSS A;  3ERO A;  2PPB C;  2ZM6 Q;  3IFT A;  3CCR A;  2GVA A;  5FO9 B;  2NVY B;  4A3D B;  5E4X A;  1JT8 A;  3CPF A;  1L1O C;  2AQ2 B;  1TKW B;  5ELC A;  4A3E B;  1LTL A;  2KCT A;  3NK9 A;  1E2W A;  3LGJ A;  3A8K E;  3DM3 A;  3T1Y L;  1F2L A;  3W2D A;  3J80 L;  1LTB D;  4KKT A;  2JP1 A;  2PI2 A;  4I7A A;  3V96 A;  4YY3 L;  5EPK A;  3HOV B;  4A76 A;  1GUN A;  3T1Y Q;  2B29 A;  5JVG 3;  1CKO A;  3ONA B;  1IYJ B;  1B3A A;  3TZD A;  4YY3 Q;  5JJL A;  4B3S L;  2RHS B;  4IUQ A;  3PIO 3;  1HNW L;  3I4L A;  2ZJP A;  3TSS A;  1EWI A;  2F0E A;  3EVQ A;  5I9O A;  3J7Z C;  2Y0S E;  1AE2 A;  4BA1 I;  1ZXT A;  2R7Z H;  4POF A;  4B3S Q;  2AUJ D;  1Y1W H;  4LFB L;  3DEP A;  4DR7 L;  1HNW Q;  2E2I B;  3UDG A;  2KUM A;  4C56 C;  5M3M H;  2MFI A;  2R93 H;  3GTQ H;  1DJR D;  3G6J B;  1I5F A;  1PRT B;  2VL6 A;  5JJK A;  1Q1E A;  5FLM H;  1YHB A;  1HPC A;  4LFB Q;  3BYY B;  4DR7 Q;  1KAB A;  3VR3 A;  1SMY D;  1PH2 A;  2BOS A;  3GTL H;  2UXD L;  1S40 A;  2MQH A;  1ML0 D;  2N78 A;  2E75 C;  2WB1 G;  5IGB A;  1LTR D;  4C3J G;  2R92 G;  4FF4 A;  2B2T C;  4LJZ C;  5IOD A;  5A35 A;  2UXD Q;  1EY4 A;  1H9K A;  4DUY L;  5NUC A;  1PH3 A;  5IWA L;  3GTG H;  2HIV A;  5C4H A;  2EE1 A;  2LMC B;  2PZU A;  1EL0 A;  4LFA L;  1B3Q A;  2PMZ B;  2YYZ A;  3G4S A;  3CKI B;  2A6H D;  1Q8I A;  2OF1 A;  5JVH 3;  1XTD A;  2B2W C;  4DUY Q;  1NAP A;  4HN7 A;  3GD7 A;  1OXT A;  3RLN A;  5IWA Q;  3M4Y A;  4LFA Q;  3RNU A;  3E0J A;  4EQ5 A;  4LWC A;  1V1P B;  4F8M A;  1D7Q A;  1M8A A;  4CKB A;  3E9H A;  3MXN B;  2OTL A;  1WTX A;  1PZJ D;  3S1R B;  1EUJ A;  1QE6 A;  3KYH C;  2NVX H;  1HZ9 A;  3EIV A;  1SNP A;  3NQT A;  4KI0 A;  4QIW B;  4EGV A;  1VQJ A;  3GTP B;  2WB1 B;  4MTN A;  1SNO A;  1SND A;  1K0R A;  4C3J B;  1R9T H;  3S2D B;  4LF4 L;  2R92 B;  1B2T A;  2D0P A;  5J39 A;  5KYL A;  4ZKB B;  5FOB B;  4XIG S;  1PYB A;  3WOF A;  2QA4 A;  4N9T A;  1KXL A;  4GLV B;  4JI0 L;  1CT1 D;  1J8I A;  5GRO A;  1SYD A;  4LF4 Q;  2DGY A;  4X66 L;  1HZC A;  4RGM A;  3URY A;  1IBK L;  2QGQ A;  1TS2 A;  4JC0 A;  2CFM A;  1Y1W G;  1MSH A;  1LT5 D;  1BCP B;  4NPS A;  4DF7 A;  4A3L H;  1A6X A;  4JI0 Q;  4O2D A;  5M3M G;  2SEB D;  4X66 Q;  2A8V A;  3C1E A;  3HZX A;  1G29 1;  1UWV A;  5FLM G;  1IBK Q;  1L0Y B;  5J22 A;  2VW9 A;  4HMJ A;  1M1K C;  4OXP A;  2IHF A;  1SE2 A;  1PTO D;  3ULP A;  2Q2I A;  1A0I A;  2XNA C;  4DV3 L;  3CCL A;  1FD7 D;  1EQQ A;  5DLQ E;  3TRE A;  4IQZ A;  2GVB A;  3FVQ A;  1Y1V H;  2F0V A;  2OTJ A;  3S17 H;  4JPB W;  1YZ6 A;  3QWN A;  5C3E H;  2DJG C;  4DV3 Q;  5G3L D;  4G7H C;  2EQS A;  1STE A;  2KEN A;  4HSV A;  5EGT A;  2UUB L;  1B8A A;  5HUR A;  4R4Q A;  1EY9 A;  1V1P A;  1VQ7 A;  1QJO A;  2ZJQ A;  3L9A X;  3MXN A;  1NSN S;  2CW0 D;  3S15 H;  2R7Z B;  1Y1W B;  3J81 i;  2UUB Q;  1Q82 C;  5M3M B;  4GKK Q;  3VA7 A;  4JOI C;  5JJI A;  2R93 B;  2F03 A;  2CWA A;  2J7Z A;  4DV6 L;  1JR0 D;  1LT6 D;  4DV1 L;  3G71 A;  3FPU B;  4IUT A;  5LMN L;  5FJ8 H;  3STB D;  4TRD A;  2K04 A;  1C0A A;  4XT3 B;  4YWL A;  2E2H B;  3T13 A;  2JA6 G;  1D8L A;  4DV6 Q;  5C44 H;  2F0P A;  4DV1 Q;  1UE1 A;  3ZYY X;  5LMN Q;  5C0X J;  3KLS A;  1V1Q A;  4WOR A;  4QCL A;  2B8G A;  2VY3 A;  2MNA A;  1EOV A;  3K58 A;  1GM5 A;  3GTG B;  2F0L A;  3ER0 A;  1JMC A;  1JOO A;  1Q81 C;  1NUC A;  1RDP D;  1C8C A;  4BY7 H;  1GXD C;  3PUZ A;  3J7Y W;  2NUC A;  3AU7 A;  3PUV A;  3T1H L;  3RN5 A;  3GV3 A;  1K3R A;  4X64 L;  1E2Z A;  3Q6S A;  1Q7Y C;  2C5C A;  2Y0S B;  3S14 H;  2LXJ A;  4HIO A;  5LMN W;  4LNQ A;  1PFM A;  3SK6 A;  3K5N A;  3SK8 A;  3T1H Q;  1CM9 A;  4JI5 L;  1ZYR C;  4XYO A;  4X64 Q;  1ILQ A;  1ET9 A;  1QVC A;  2NVX B;  1CQV A;  4EVO A;  3PUX A;  2K5V A;  4L63 B;  1R9T B;  1Y1V G;  4JI5 Q;  5C3E G;  4H7B A;  1KHI A;  3VYT A;  5C0X H;  2Z9H A;  3RLF A;  1G91 A;  2XWJ B;  1XPR A;  1KNE A;  2F0U A;  2WAQ E;  4TKO B;  1CK1 A;  1CQF A;  2RCF A;  4EX5 A;  1R4Q B;  1PV4 A;  3M7N A;  3K5O A;  2J4X A;  1FYC A;  1LUZ A;  2ASB A;  3TP8 A;  1G2T A;  4QF4 A;  1U4L A;  3LNN A;  1P8L A;  5IIF A;  2PZW A;  4POG A;  1SNQ A;  2L12 A;  4NP5 A;  4O0A A;  1BF4 A;  1WD1 A;  3HS0 C;  4DXF A;  2PI2 E;  2NVQ H;  2I5M X;  3ERS X;  4GNX A;  2YTV A;  4DK3 C;  3Q8D A;  5C44 G;  2WFW A;  1JB3 A;  4KN4 C;  1Y1V B;  3PIO A;  5EQ0 A;  4TVA B;  3S17 B;  2A68 C;  5C3E B;  4O1N A;  4A3M H;  1IZ6 A;  1XWE A;  3DXJ C;  4JVZ A;  3F2U A;  2XTI A;  1H9J A;  3CXC A;  1Y69 U;  3OMG A;  2ZXR A;  5BN4 A;  1EIY B;  3GV6 A;  2M2L A;  3IL8 A;  5H1S E;  2VB2 X;  2L55 A;  3FEW X;  1FNW A;  1Q1B A;  3J81 E;  3S15 B;  3ICE A;  5JEA J;  4BY1 H;  4KY7 A;  2EXD A;  5T1G A;  5M3F H;  4B3M L;  1SEB D;  4IUN A;  4J6H A;  4QUC A;  3CCM A;  3S16 H;  4XDX A;  1UNS A;  1KC8 C;  3C1F A;  4IOA A;  2HT1 A;  4GZY C;  3MXU A;  3CW2 C;  1PDQ A;  2FJ2 A;  1AZQ A;  1H9S B;  2HUG A;  1XMO L;  3LWE A;  3NUC A;  4B3M Q;  1HRJ A;  4CJ2 C;  1C48 A;  2EPB A;  4ZRZ A;  5C44 B;  1IW7 C;  1N36 L;  4RG1 A;  4M1U B;  4I7Z C;  1WD0 A;  1ASY A;  4A3K H;  1KQS A;  3OHX C;  3GP7 A;  1EIG A;  3M4O H;  1XMO Q;  1EZ6 A;  2MPM A;  2AQ3 B;  2FMM A;  1KLU D;  2F0W A;  5C0X G;  3UDF A;  2JN4 A;  1Y8N B;  4M8A A;  4WJW A;  1N36 Q;  1RF2 D;  4KHV A;  4KK7 A;  1EFW A;  2EYF A;  1YNJ C;  1K83 H;  4BY7 B;  4HCE A;  4X3K A;  1WTR A;  4DK1 A;  4IPC A;  4PMW A;  2BH2 A;  1KDC A;  5GAG C;  1UE7 A;  2NYZ D;  1IYV A;  3QJY A;  4KKU A;  2KQ3 A;  5T1I A;  3Q0A A;  3S14 B;  1EYC A;  4HSP A;  3UDX A;  1XNQ Q;  4G4K A;  4IJL A;  5I9P A;  2L4N A;  5IGF A;  2Q2U A;  1HFG A;  1PRT F;  2MO1 A;  2WAC A;  3BG3 A;  3NTI A;  4N8F A;  1K3B C;  1HR0 L;  3BS1 A;  3D0F A;  3ND9 A;  4H02 A;  4U67 3;  1AN8 A;  1X54 A;  1Y8P B;  3NWT A;  4C2M H;  1Q90 A;  1MJE A;  4A3F H;  1N34 L;  1MHW C;  1GHJ A;  3NBI A;  4A3M G;  1HR0 Q;  4PZ8 A;  2Q8R E;  4B9X A;  1WTO A;  4C3I H;  1XPU A;  1NR2 A;  3K6O A;  4K8I A;  3R8B A;  5IP9 H;  1F77 A;  2L1B A;  3KJP A;  1N34 Q;  3AFP A;  3FMC A;  4RGN A;  5LMU L;  4YHH L;  1K8M A;  4BY1 G;  1SE4 A;  3J81 L;  3SEB A;  4AYB G;  1H9S A;  5M3F G;  3D8G A;  4K6D A;  5COY A;  2WAQ G;  2CQA A;  3H15 A;  4DA2 A;  3J80 c;  3AB9 A;  3DWQ A;  2E5L L;  4FXG C;  3PMF A;  3R2I A;  2JQO A;  2P5Z X;  2MHV A;  3SDZ A;  5LMU Q;  3OWF A;  1SRU A;  4YHH Q;  1HR0 W;  1PLF A;  2NB0 A;  1GUO A;  2NVQ B;  3A56 A;  1EWC A;  5G3L F;  5K36 H;  1QUQ B;  2QIL A;  4FF3 A;  3I2Z A;  2ICI A;  2F0K A;  1O7L A;  1K9M C;  3I56 A;  4A3K G;  2I5H A;  3NP8 A;  1B4O A;  1II3 A;  1M4V A;  3T16 A;  4L5Q A;  3K5M A;  2LS0 1;  2GN5 A;  1PRT C;  4A3M B;  4IUV A;  2IWH A;  3L7Z C;  1CSQ A;  4HIM A;  4IFD H;  4B3T L;  3BDL A;  4CHT B;  2R61 A;  4PNY A;  3PO2 H;  5DM6 3;  5IGD A;  1S5D D;  1PMR A;  4B3T Q;  4BY1 B;  4AYB B;  4ZQ3 A;  3SHL A;  4QY7 A;  5M3F B;  1I4H A;  4OGQ C;  3K59 A;  2WAQ B;  4EQO A;  3VYU A;  1QVG A;  3PQI A;  3JAM E;  5E1F A;  1MSG A;  4X65 L;  1K8G A;  1RD9 D;  2QW7 A;  1TQO A;  1QZH A;  3DEO A;  3E9I A;  3SGI A;  1O78 A;  2E74 C;  1SNM A;  1I4X A;  2K5H A;  1YIJ A;  2EXZ A;  4JI2 L;  2K5D A;  1BOS A;  1STN A;  4A3G H;  4X65 Q;  3VDY A;  4IUP A;  1A15 A;  1RL2 A;  4JK1 C;  4A3K B;  3M4O B;  2HQL A;  1VQB A;  2PNR C;  3NWS A;  4K2L A;  3SE0 A;  1L0W A;  4A3F G;  2JK8 A;  3DWA A;  4J15 A;  4JI2 Q;  4AQY Q;  1N32 L;  2ENB A;  3PSI A;  4LF9 L;  3BZC A;  4C3I G;  1C4Q A;  5IP9 G;  2CKZ B;  1GD7 A;  2QEJ C;  1GUW A;  1K83 B;  3H91 A;  4ZLT F;  1G6P A;  4KJN A;  1LTG D;  1STB A;  4YCV A;  2K5N A;  2YU9 H;  1N32 Q;  4IOC A;  4LF9 Q;  1LT3 D;  4RWS C;  1GUG A;  3AQQ A;  2EY2 A;  4F88 A;  5JAV A;  4PMB A;  5KIX A;  1XTC D;  1HTL D;  4V19 0;  4P75 A;  1K28 A;  3NTH A;  1B1Z A;  3BVM A;  2JA9 A;  1QNK A;  3HOU H;  1XX8 A;  5I6Y A;  1DYQ A;  4HED A;  1SMX A;  4DAM A;  3CMA A;  2D2C C;  3K7U C;  3GTP H;  1PXU A;  1YNN C;  5K36 G;  1NTG A;  2ZM6 L;  1QZG A;  2JSO A;  4C2M B;  1ILP A;  1IL8 A;  3J7A V;  3G7L A;  3A8I E;  3TP5 A;  2JA7 G;  4B9W A;  4A3F B;  5E3F A;  2XRQ D;  4HJA A;  3I91 A;  4H44 C;  4Q0F A;  2ZJR A;  1T9H A;  1W6J A;  1J6Q A;  4RKB A;  2HDM A;  4C3I B;  3RZD H;  4ALP A;  5D65 A;  3MFG A;  3JC6 6;  4C3H H;  3PO2 G;  4UHV A;  2MJ8 A;  3KK7 A;  1A3V A;  2JE6 I;  1PVO A;  1KTK A;  3MTS A;  3NPP A;  3ULL A;  1CA5 A;  3FDT A;  2G5D A;  2RSN A;  2X6L A;  4IUU A;  4Z9C B;  4B08 A;  2H4O A;  1D1K A;  3KBG A;  4CJ1 B;  1EIH A;  3JAM L;  5IYC G;  4G7O C;  5J1Z A;  4CDF C;  5FLX c;  3F2B A;  4JI6 L;  4HR7 B;  3MXP A;  2EY6 A;  5C4J H;  1QVF A;  4RGO S;  1L0X B;  4DV2 L;  2F0I A;  4A3G G;  2CWP A;  1KRT A;  1T5E A;  4FXK C;  4JI6 Q;  1WYD A;  2JA7 B;  4P71 A;  2VZA A;  4DV2 Q;  1PH7 A;  1G2S A;  2OT2 A;  3CD6 A;  4R4C A;  4H0L C;  3W1B A;  5JPM C;  3HKZ E;  4NW2 A;  4DNI A;  4NXN L;  1SRO A;  3KDF B;  3PO2 B;  3MZ5 A;  4RFB A;  3HOZ H;  2RBM A;  5COR A;  2F1M A;  3U58 A;  5IT9 E;  3CAM A;  1B9N A;  4OO1 H;  2DJF C;  2L0C A;  4GN3 B;  4ILW A;  3I70 A;  3K7A H;  4GNX C;  4NXN Q;  2K75 A;  5EPL A;  1LLR D;  1BXT A;  4J8Q A;  3HOU G;  4L8J A;  4RHR A;  4HID A;  2E2H H;  3D4R A;  4HJ7 A;  4JV5 L;  4RCN A;  1TWC H;  3H3V C;  5IGC A;  4ZAI A;  4A3G B;  2MUY A;  2D0O A;  1FNU A;  5AJ3 L;  3OPO A;  1SXT A;  1IBL L;  2A5H A;  3TME A;  4KD4 A;  4JV5 Q;  1EFI D;  1VQP A;  4HMI A;  4DFA A;  2QKI C;  5AJ3 Q;  1VQA A;  1E2V A;  2K14 A;  2I0Q A;  2JYO A;  1OTC A;  1OXU A;  4IPD A;  1YEZ A;  4ME3 A;  3H3V H;  3HG9 A;  1IBL Q;  5C5M A;  4C3H G;  1BBU A;  2BDO A;  3KF6 B;  1WOC A;  2IX3 A;  1PH6 A;  1NY4 A;  2YU9 B;  3TEH B;  1XYI A;  1SDF A;  2M9V A;  3GO5 A;  2FMC A;  4HJ9 A;  1U9R A;  4DU9 A;  5LL6 X;  4OEL B;  1KAA A;  3A74 A;  2WKC A;  4Y7N H;  2Q2H A;  1NMG A;  3HOU B;  1WJJ A;  4ULL A;  3I7F A;  4XT1 B;  3TP6 A;  1X3Q A;  3I4N H;  4XXE A;  4X3U A;  3KLS X;  1LTI D;  1PH1 A;  1V9P A;  2SNS A;  1STA A;  4JCV E;  3SK4 A;  2XGT A;  4N9P A;  3S24 A;  2ES2 A;  4P2C B;  3E6Z X;  3KDF A;  2A74 C;  4JI8 L;  4JI1 L;  3RR5 A;  1V8Q A;  1EY5 A;  4KMU C;  2F4V L;  3RZD B;  4BXX H;  1Q46 A;  2KJX A;  2D62 A;  1NE3 A;  2KHJ A;  4MZ9 A;  3BDO A;  1JOR A;  4C3H B;  2IX1 A;  4DUZ L;  1D2B A;  1ENC A;  1X55 A;  4JI8 Q;  3CCQ A;  3HOZ G;  4JI1 Q;  4KHZ A;  3IRB A;  4LFC L;  1HFN A;  2NZ1 D;  2B3G A;  4OO1 G;  3GTK H;  2KCM A;  2NBF A;  4EQP A;  2F4V Q;  3R3O A;  1GOZ A;  1S5C D;  3UE1 A;  4DXG A;  1JWU D;  4DUZ Q;  2Q2T A;  1O7Z A;  4F87 A;  2YTY A;  4DAV A;  1SE3 A;  4LFC Q;  2X69 A;  1H9M A;  1HJP A;  2QDL A;  1I4Q A;  2CHB D;  5C4J B;  3D6C A;  3M3Y H;  1STH A;  1W2B A;  1VQD A;  5D3D A;  1HNZ L;  1X3G A;  3I8Z A;  4DNR B;  3K80 C;  4BA2 I;  5LHY 1;  4IPG A;  3OSO A;  1QWY A;  4JBW A;  1K73 C;  3HEJ A;  4LK1 C;  1A3T A;  2NN6 H;  3KF6 A;  4DK6 C;  1HNZ Q;  1ONL A;  2CCZ A;  4GKK L;  1HCZ A;  1TS3 A;  4K6L A;  2R6G A;  5E7N A;  4NB3 A;  1RJT A;  3NE5 B;  1KL9 A;  1LM0 A;  1MIU A;  2K5Q A;  3SVM A;  2UXC L;  3CP0 A;  1HZA A;  3HOZ B;  4OHJ A;  3HKZ G;  3FP9 A;  1EU3 A;  1JJC B;  1JOQ A;  5CV4 A;  3A54 A;  3K7A B;  2CVR A;  5FO7 B;  2E2D C;  2UXC Q;  4TQU S;  3I90 A;  2A6E D;  1VMC A;  5GAH C;  1X3E A;  2F3V A;  1AP0 A;  2IHE A;  1DXM A;  4CDC C;  3I4N G;  3VYS A;  2O4X A;  1NR4 A;  1PH9 A;  1TWC B;  1VQM A;  3W1G A;  2DN8 A;  3K57 A;  2AMC B;  1CKM A;  5DM7 3;  2A69 D;  4GNX B;  1Z7T A;  4C1N I;  2JJQ A;  4K5W A;  4O42 A;  4UDU C;  1VQI A;  4JI3 L;  1BCP D;  2XSC A;  4BXX G;  1U4P A;  4HCS A;  1BDO A;  5KNC A;  4A93 G;  4G7Z C;  1JJ2 A;  2BE5 C;  1P16 A;  1EY0 A;  1WTH A;  2Z4H A;  3IAY A;  2Z6B A;  1F9P A;  2EYM A;  1STG A;  4WRD A;  1U0L A;  3HKZ B;  4JI3 Q;  2YTX A;  5K5P A;  4LUZ A;  3A7L A;  3U9S A;  4LF8 Q;  3VR2 A;  2RF4 A;  2PO4 A;  5C6A A;  4Y7N B;  1WFQ A;  2RDF A;  1B7Y B;  2HQE A;  4RH6 A;  3A0J A;  3UE0 A;  5F2D A;  1Z47 A;  3I4N B;  2K6A A;  5JPN C;  4FYD A;  3A7A B;  5M9O A;  1DD2 A;  2K50 A;  5ELD A;  3G48 A;  1J9O A;  1JE5 A;  5HY6 A;  3K5L A;  4DR6 L;  2PQA B;  4NKL A;  2DNE A;  1CUK A;  5HGQ A;  2NN6 G;  4AYB E;  1QCB D;  2QEX A;  4FXD A;  1VQH A;  3O13 A;  1VQ5 A;  1BBW A;  4DR6 Q;  4DPG A;  5JJZ A;  3G6E A;  3P20 A;  1ENF A;  2D9U A;  3OWE B;  2B2V A;  2NZO A;  4L5T A;  1S5F D;  5C0X I;  3PGZ A;  2Q8T A;  3GTK B;  3E3X A;  1YNX A;  1SLJ A;  1CHQ D;  1ICW A;  3OYY A;  2EYP A;  4DR5 L;  1ESR A;  2B2Y A;  1XNR L;  1EOT A;  3B6Y A;  1HA5 A;  1HZB A;  1KRS A;  2XRS D;  4CDE C;  3PO3 G;  1UEA B;  2L15 A;  3M3Y B;  3S1N H;  3RN2 A;  3CRL C;  2QCP X;  3RUZ A;  5IYB H;  2R7F A;  4DR5 Q;  2F0M A;  1XNR Q;  3NSW A;  1E24 A;  1F9S A;  1EEF D;  1IHZ A;  1A8V A;  3PCO B;  2MO0 A;  5KEE A;  1DM0 B;  1WCM H;  5KGU A;  3F1Z A;  1M90 C;  4R9W A;  1SAP A;  1N8R C;  5EKI A;  4XQN A;  1X9N A;  4E6I A;  3C2P A;  1ICF B;  2RQX A;  2AWO A;  4FP5 D;  4DR1 L;  1PH4 A;  1QG7 A;  3OIQ A;  3PUW A;  3OIP A;  4UY8 C;  1KNA A;  4GLA C;  1HUN A;  3DHQ A;  1RHP A;  5C3W A;  4DR1 Q;  2IT1 A;  3NTK A;  1CA6 A;  3FHW A;  1Q8K A;  1MBY A;  5IOC A;  2PQA A;  1CKN A;  5FKA C;  2Z4I A;  1FGU A;  5C3X A;  1I6V C;  4R1J A;  1YJ9 A;  2IX0 A;  1I6H H;  4YWM A;  3TZU A;  2OQ0 A;  4DNT B;  2LXK A;  1DON A;  1D1I A;  1PZK D;  1VQ4 A;  3HOY H;  4QB4 A;  2EZV A;  4UP7 A;  4CKE A;  5GAD C;  3J80 i;  2KCN A;  1MGS A;  3DWP A;  2LY7 A;  2K1B A;  1VCI A;  1MD2 D;  4DKA C;  1EQR A;  1XNQ L;  3X3N A;  2K28 A;  1SFO H;  1CHP D;  2NTT A;  1E7Z A;  2B2U A;  4I65 A;  3HKS A;  1VQF A;  3RZO H;  5CMD A;  4RA8 A;  4CKC A;  4GOP A;  5JEA H;  1JWS D;  2ZTE A;  3S1M H;  2EDG A;  3HOX H;  3PUY A;  3BDC A;  2K52 A;  1SMY C;  4OWT B;  2OQK A;  1EQV A;  2K03 A;  4X6A H;  1K8O A;  2B8F A;  5IYB G;  3T51 B;  1S3O A;  2XVS A;  1F2Y A;  2IY5 B;  1LO5 D;  2EJG C;  2F0F A;  2K05 A;  2IL8 A;  3M4Q A;  4MTK A;  3L2P A;  1WCM G;  4UPA A;  1AEX A;  3NXW A;  5IP7 H;  1JOK A;  2HCC A;  1VQN A;  2Z0S A;  5CGK A;  3M4P A;  3EN2 A;  4K5X A;  2A6H C;  2C9O A;  1C7Y A;  4X3T A;  2NVT H;  1PTO F;  1QOH A;  3CRK C;  1WTP A;  1HUM A;  3RLO A;  3JAM c;  5ELN A;  1A3U A;  3K0X A;  1TWH H;  1YHQ A;  2V1C C;  2XWB B;  3RD4 A;  3EQL C;  5IGG A;  4FF1 A;  2F0D A;  3QR8 A;  3VR4 A;  1A2T A;  2F0T A;  1U4M A;  3T4A C;  4GKJ L;  4K0K L;  4ZUJ A;  2CH4 A;  4LW1 A;  1TS4 A;  1X32 A;  1UE5 A;  3GTO H;  3S1N B;  1IKM A;  4OIJ A;  3BZK A;  1NCV A;  4ZUI A;  2JA7 H;  4BWG B;  3HOY G;  3EA6 A;  1STY A;  4ABN A;  4GKJ Q;  4K0K Q;  5KNB A;  4A3B H;  1XPO A;  4CDD C;  5KND A;  1WCM B;  2N3S A;  4HJ5 A;  2K32 A;  2LKV A;  1JWM D;  4A3J H;  1IBM L;  1SJH D;  4BS9 A;  5ISR A;  1AE3 A;  4V0B A;  2EYJ A;  3HRZ C;  2KOL A;  2WIN B;  5JEA G;  4IFD I;  1HXY D;  2BH8 A;  1FNV A;  4S3S A;  3W3A A;  3MVV A;  4K14 A;  4NDX A;  1IBM Q;  3GTM H;  1ZKO A;  2L5T A;  2MP1 A;  2NWG A;  3K8A A;  3MWY W;  5IYC H;  4BBR H;  4P72 A;  3HOX G;  2CQO A;  4CGY B;  1EEI D;  5M5W H;  4DV0 L;  1BBX C;  2IW3 A;  1PTO C;  4AQY L;  1I6H B;  3U9O A;  4ZKC B;  1RTO A;  2SDF A;  1DOK A;  1ZYR D;  2DNC A;  1GKH A;  3J80 E;  3HOY B;  3CC4 A;  4DV0 Q;  5C5L A;  2F0O A;  1A62 A;  1WVL A;  3AEV A;  4PV1 C;  5IP7 G;  5CC4 A;  1PTO H;  2JA5 H;  2J0T D;  4JW0 A;  1SFO B;  2B63 H;  4KTA A;  4RKL A;  4TSS A;  3M85 A;  3QOJ A;  2JA6 H;  3KOJ A;  3RZO B;  1JE4 A;  2CW0 C;  5A2Q E;  3QOL A;  1FGB D;  2RHQ B;  4OX9 L;  5DAU A;  2B39 A;  3VR6 A;  2BCO A;  4MN3 A;  3S1M B;  5KYI A;  2EVB A;  1E0B A;  1PHJ A;  4KHP L;  2ICE C;  1LTA D;  2Q8I B;  1I3Q H;  3HOX B;  4OX9 Q;  1MI2 A;  3FRP B;  4P74 A;  4GS3 A;  3STB C;  4ZCK A;  5D3I B;  1HQR D;  4KHP Q;  1S4Z A;  3F8T A;  2F0S A;  1AW7 A;  1YJN A;  2F0N A;  1TWG H;  5IE8 A;  4KJO A;  4A3B G;  1VF7 A;  4CJ0 B;  2RA4 A;  1G6Z A;  3V2T A;  2YV5 A;  5I2Y A;  4FO2 A;  4DAP A;  5BR8 L;  2QF7 A;  2ZXO A;  4JG2 A;  3HOV G;  1UEB A;  4A3J G;  2HIX A;  2A68 D;  4QGU A;  1NNX A;  2F0G A;  4YIJ A;  1X3P A;  4LAA A;  2NVT B;  1D5X C;  5DNF A;  5L37 A;  3QG1 A;  5BR8 Q;  1JCK B;  2LFN A;  3VYR A;  3PIP 3;  2RVL A;  4JYA L;  1TWH B;  4BBR G;  3I72 A;  2VUM H;  4FNF A;  1DOL A;  4IO9 A;  1OO9 B;  2O5I C;  1TXY A;  4R4T A;  4JYA Q;  2ZXP A;  3GTO B;  3H09 A;  1Z9F A;  2Z1C A;  3P7J A;  1LT4 D;  1SE8 A;  2PYK A;  1I4G A;  2M00 A;  1FVI A;  4A3B B;  4C1N K;  1EY7 A;  4HJ8 A;  3GTJ H;  1IW7 D;  2PQE A;  4UP8 A;  3S1Q B;  2B2V C;  4ID6 A;  3AMU A;  4DK0 A;  3BJU A;  2AUK A;  3A55 A;  2K33 A;  4A3J B;  2JA5 G;  2UUC L;  4PG3 A;  3Q24 A;  2R3Z A;  2B63 G;  1EYD A;  1LTT D;  3F2C A;  2SNM A;  1EY6 A;  2C35 B;  2VNU D;  4ODG A; 
#chains in the Genus database with same CATH homology
 2B2Y C;  5E4W C;  1ZEQ X;  5A2Q L;  1YNJ D;  4QMG A;  3GTM B;  4HTH A;  1LV9 A;  4BBR B;  1VDZ A;  5M5W B;  3QO2 A;  4OO1 I;  3HP3 A;  4LMQ D;  1F2Z A;  5ELE A;  1TVX A;  3D6W A;  1LTS D;  3D31 A;  1V43 A;  3KBX A;  1A2U A;  1SBB B;  1EQT A;  2I07 B;  4WFN 3;  1TY0 A;  3DUZ A;  5FLX E;  1KLG D;  3KLR A;  5I4D A;  1PTO B;  4KV6 A;  1GUS A;  2JA5 B;  3VA5 A;  2B63 B;  2JA6 B;  2HCI A;  2G9H D;  4NMZ A;  2WKD A;  2F4I A;  5LL6 S;  1B50 A;  1I3Q B;  1EZ8 A;  4MIU A;  3OW7 A;  3SXH A;  2KVM A;  2EYO A;  2L11 A;  3V05 A;  2K7V A;  1RTN A;  3P1H A;  3QIA A;  1TWG B;  2KHS A;  3P75 A;  3MAQ A;  2EOT A;  1WTQ A;  4DN4 M;  4ZYS A;  2B2U C;  5CV5 A;  3J7A F;  3CU7 A;  1HHV A;  1VF5 C;  1PRT D;  2F0Q A;  1AFP A;  4X3S A;  5CR3 A;  5IT9 L;  1RKN A;  2WII B;  1WTV A;  3LWU A;  3N6R A;  2VUM B;  1O7Y A;  2BA1 A;  1BR9 A;  3DMU A;  3E5S A;  1F2M A;  1BNZ A;  4ZK9 B;  4K5V A;  2BDN A;  2SOB A;  4IUR A;  4XQJ A;  2E76 C;  2F3W A;  2OEO A;  1SSO A;  3D4W A;  1QIL A;  4IAL A;  3GTJ B;  1HQM C;  1ENA A;  5FLX L;  1CI3 M;  1R4P B;  2ZT9 C;  1S5E D;  2EY1 A;  1UUP A;  2NN6 I;  5D14 A;  1S5B D;  3Q23 A;  2FFK B;  4HAE A;  1BUV T;  5ELF A;  3MXG A;  1Q12 A;  1IYU A;  3R93 A;  3DM1 A;  4ME5 A;  5EJW A;  3ITP A;  3ERQ A;  2O2L D;  2N55 A;  5CV7 A;  1AZP A;  3GTQ B;  5EBD A;  1HA6 A;  1YNN D;  2V4D A;  1CZG A;  5C4X B;  3C3L A;  3GTL B;  2F0H A;  2XIW A;  3GQB A;  2IPK D;  3BZD B;  2VB3 X;  3KF8 A;  2KEE A;  2FHT A;  3IKJ A;  1Q3L A;  1V1O A;  3I73 A;  1U4R A;  5FO8 B;  3A8J E;  2KED A;  4L6T B;  2X6G A;  3S2H B;  2N88 A;  1PFB A;  1VMP A;  1OXX K;  5BN3 A;  5I2X A;  1B44 D;  1TWF B;  3N52 A;  1PYW D;  3NQI A;  1SYE A;  4A93 B;  2OXP A;  5CBE E;  1FR3 A;  4UAI A;  2WV6 D;  4DAY A;  1JQY D;  2EYL A;  3C46 A;  2BA0 A;  1JC7 A;  1CTM A;  3MC0 B;  1W6K A;  1OXS C;  1JIC A;  5AFW A;  3OOC A;  5I6W A;  5JOB A;  2AQ1 B;  5EPJ A;  3M7G A;  4R8N A;  5CV9 A;  4IZ8 A;  4KY6 A;  3MEH A;  3EFX D;  2TMP A;  3D3R A;  4MHE A;  1F9R A;  2IJ0 A;  2PW7 A;  3TN2 A;  1EU4 A;  1D5Z C;  3BYT B;  3H6M A;  3T56 B;  4IN3 A;  1UAP A;  1GHK A;  3R2T A;  2B2T A;  1F9Q A;  3RMH A;  2RSO A;  2E2J B;  1Y8O B;  2GA4 B;  2RDG A;  3PO3 B;  1O80 A;  3SK5 A;  1TR5 A;  3NHH A;  2B2W A;  4R8I A;  2A73 B;  1T5X D;  2PW5 A;  1Z6H A;  1QB5 D;  5IGE A;  1LAC A;  1SYB A;  1D6E C;  1PZI D;  1WTW A;  4Q5V A;  1I4P A;  2EJM A;  5M5Y B;  1EY8 A;  2H1E A;  3L3O C;  3MFY A;  4XTC S;  5CBA E;  1RCV D;  3K0Y A;  5BN5 A;  2JXM B;  4RCO A;  4KN7 C;  1I4R A;  1H9R A;  1D5M C;  1DZ1 A;  1ROD A;  1TWA B;  2HDL A;  4OIK A;  1CZW A;  4CBV A;  5HGT A;  1LAB A;  1TT2 A;  2WP8 J;  2QDB A;  1SYG A;  3BVZ A;  4U68 A;  1B53 A;  4K2K A;  1BQQ T;  3MA2 B;  4XYQ A;  4RHS A;  1G8Z D;  1BO0 A;  2KEC A;  1DOM A;  2FIN B;  1HTP A;  4OL7 A;  4H13 C;  2JA8 B;  3X3M A;  1ESF A;  1ET6 A;  4IFD J;  3ND8 A;  3Q22 A;  2Z8L A;  1IKL A;  3NBH A;  3EJI A;  2O5J C;  3TBI B;  1TII D;  1SJE D;  4K8J A;  1EWH A;  4F7X A;  3LX0 A;  2D5D A;  3H0G B;  2JEB I;  1TS5 A;  3FPP A;  5TSS A;  4PQX A;  4FF2 A;  3S9W A;  1KDB A;  1SNC A;  1I50 B;  3H94 A;  2RKS A;  3HGB A;  4A3I B;  3D4D A;  2JEA I;  3FKI B;  2NTS A;  3BVG A;  4QUF A;  4KY5 A;  3WDN A;  2XN9 C;  2PZT A;  3QB3 A;  1PFN A;  5CV8 A;  1SYC A;  3MHB A;  5DEH A;  2BE5 D;  2F0J A;  4RGT A;  1B9M A;  1SYF A;  5M5X B;  3HOW B;  2KA7 A;  3CQZ B;  3PV0 A;  3I3C A;  3VR5 A;  5KRU A;  1KDA A;  3S16 B;  1BCP F;  3IFD A;  4XQQ A;  3KUP A;  4KKS A;  4DGZ A;  2L9H A;  2KCC A;  3SR1 A;  2EYH A;  2K5W A;  1QNU A;  4G57 A;  1DCZ A;  3TP7 A;  3T53 B;  1EYA A;  2EJF C;  2DY8 A;  2VXW A;  4BBS B;  2G9D A;  4FVM A;  2AWN A;  3WOE A;  2K01 A;  1XXG A;  4EQN A;  2ID0 A;  2MGS A;  3I4M B;  5C4Z A;  2DY7 A;  4KD3 A;  1GJX A;  2A6E C;  2EY5 A;  3UI2 A;  5EKK A;  2RDH A;  4PMC A;  5CV6 A;  5CYU A;  2A69 C;  5EBC A;  3TDQ A;  3CHB D;  5EKL A;  4J1M A;  5FK9 C;  1BCP C;  1TU2 B;  1TY2 A;  1OXV A;  2PCF B;  3OMC A;  1GUT A;  4RAU C;  1CFM A;  4IFD G;  5ELB A;  2I46 A;  2TSS A;  3ERO A;  2PPB C;  3IFT A;  5FO9 B;  2NVY B;  4A3D B;  5E4X A;  2AQ2 B;  1TKW B;  5ELC A;  4A3E B;  3NK9 A;  1E2W A;  3A8K E;  1F2L A;  3W2D A;  3J80 L;  1LTB D;  4KKT A;  2JP1 A;  3V96 A;  5EPK A;  3HOV B;  1GUN A;  5JVG 3;  3ONA B;  1B3A A;  3TZD A;  4IUQ A;  3PIO 3;  3I4L A;  3TSS A;  2F0E A;  3EVQ A;  5I9O A;  4BA1 I;  1ZXT A;  2AUJ D;  3DEP A;  2E2I B;  2KUM A;  4C56 C;  1DJR D;  3G6J B;  1PRT B;  1Q1E A;  1HPC A;  3BYY B;  1KAB A;  3VR3 A;  1SMY D;  2BOS A;  1ML0 D;  2E75 C;  5IGB A;  1LTR D;  4C3J G;  4FF4 A;  2B2T C;  4LJZ C;  5IOD A;  5A35 A;  1EY4 A;  1H9K A;  5NUC A;  5C4H A;  2EE1 A;  2LMC B;  2PZU A;  1EL0 A;  2PMZ B;  2YYZ A;  3CKI B;  2A6H D;  1Q8I A;  2OF1 A;  5JVH 3;  2B2W C;  1NAP A;  4HN7 A;  3GD7 A;  1OXT A;  3M4Y A;  3E0J A;  1V1P B;  4F8M A;  1M8A A;  4CKB A;  1WTX A;  1PZJ D;  3S1R B;  1QE6 A;  1SNP A;  3NQT A;  4KI0 A;  4QIW B;  4EGV A;  3GTP B;  2WB1 B;  3S2D B;  1SNO A;  1SND A;  4C3J B;  1B2T A;  2R92 B;  5J39 A;  5KYL A;  4ZKB B;  5FOB B;  4XIG S;  3WOF A;  4N9T A;  1CT1 D;  1J8I A;  1SYD A;  4RGM A;  3URY A;  1TS2 A;  1MSH A;  1LT5 D;  1BCP B;  4DF7 A;  1A6X A;  2SEB D;  3C1E A;  3HZX A;  1G29 1;  1L0Y B;  5J22 A;  4HMJ A;  1SE2 A;  1PTO D;  2XNA C;  1FD7 D;  4IQZ A;  3FVQ A;  2F0V A;  3QWN A;  4G7H C;  5G3L D;  1STE A;  4HSV A;  5EGT A;  5HUR A;  1EY9 A;  1V1P A;  1QJO A;  3L9A X;  3MXN A;  1NSN S;  2CW0 D;  2R7Z B;  1Y1W B;  5M3M B;  3VA7 A;  2R93 B;  2F03 A;  2J7Z A;  1JR0 D;  1LT6 D;  3FPU B;  4IUT A;  4TRD A;  2K04 A;  4XT3 B;  2E2H B;  3T13 A;  2F0P A;  3ZYY X;  5C0X J;  3KLS A;  4WOR A;  4QCL A;  2B8G A;  3K58 A;  3GTG B;  2F0L A;  1JOO A;  1NUC A;  1RDP D;  1C8C A;  1GXD C;  3PUZ A;  3J7Y W;  2NUC A;  3AU7 A;  3PUV A;  3GV3 A;  1E2Z A;  3Q6S A;  2C5C A;  2Y0S B;  1PFM A;  3SK6 A;  3K5N A;  3SK8 A;  1CM9 A;  1ZYR C;  4XYO A;  1ILQ A;  1ET9 A;  2NVX B;  1CQV A;  4EVO A;  3PUX A;  4L63 B;  1R9T B;  4H7B A;  3VYT A;  5C0X H;  3RLF A;  1G91 A;  2XWJ B;  1KNE A;  2F0U A;  4TKO B;  1CK1 A;  1CQF A;  1R4Q B;  3M7N A;  3K5O A;  2J4X A;  1FYC A;  3TP8 A;  1G2T A;  4QF4 A;  1U4L A;  3LNN A;  5IIF A;  2PZW A;  1SNQ A;  2L12 A;  4NP5 A;  1BF4 A;  1WD1 A;  3HS0 C;  4DXF A;  1JB3 A;  4KN4 C;  1Y1V B;  5EQ0 A;  3S17 B;  2A68 C;  5C3E B;  4O1N A;  1XWE A;  3DXJ C;  3F2U A;  1H9J A;  1Y69 U;  5BN4 A;  3OMG A;  2ZXR A;  3GV6 A;  2M2L A;  3IL8 A;  2VB2 X;  2L55 A;  3FEW X;  1FNW A;  1Q1B A;  3J81 E;  3S15 B;  5JEA J;  4KY7 A;  5T1G A;  1SEB D;  4IUN A;  4J6H A;  4QUC A;  4XDX A;  1UNS A;  3C1F A;  4GZY C;  3MXU A;  1PDQ A;  2FJ2 A;  1AZQ A;  1H9S B;  2HUG A;  3LWE A;  3NUC A;  1HRJ A;  4CJ2 C;  1C48 A;  2EPB A;  4ZRZ A;  5C44 B;  1IW7 C;  4M1U B;  4I7Z C;  1WD0 A;  3OHX C;  3GP7 A;  1EIG A;  1EZ6 A;  2MPM A;  2AQ3 B;  2FMM A;  1KLU D;  2F0W A;  5C0X G;  1Y8N B;  4M8A A;  4WJW A;  1RF2 D;  4KHV A;  4KK7 A;  2EYF A;  1YNJ C;  4BY7 B;  4HCE A;  4X3K A;  1WTR A;  4DK1 A;  4PMW A;  1KDC A;  2NYZ D;  1IYV A;  3QJY A;  4KKU A;  2KQ3 A;  5T1I A;  3Q0A A;  3S14 B;  1EYC A;  4HSP A;  4G4K A;  5I9P A;  2L4N A;  5IGF A;  1HFG A;  1PRT F;  2WAC A;  3BG3 A;  3NTI A;  3BS1 A;  3ND9 A;  4U67 3;  1AN8 A;  1Y8P B;  3NWT A;  1Q90 A;  1GHJ A;  3NBI A;  4B9X A;  2Q8R E;  1WTO A;  1NR2 A;  3K6O A;  4K8I A;  3R8B A;  1F77 A;  2L1B A;  3FMC A;  4RGN A;  1K8M A;  1SE4 A;  3J81 L;  3SEB A;  1H9S A;  3D8G A;  4K6D A;  5COY A;  2CQA A;  4DA2 A;  3AB9 A;  3DWQ A;  4FXG C;  3PMF A;  3R2I A;  2MHV A;  3SDZ A;  3OWF A;  1PLF A;  2NB0 A;  1GUO A;  2NVQ B;  3A56 A;  1EWC A;  5G3L F;  5K36 H;  2QIL A;  4FF3 A;  2ICI A;  2F0K A;  1O7L A;  3NP8 A;  1B4O A;  1II3 A;  1M4V A;  3T16 A;  3K5M A;  2LS0 1;  1PRT C;  4A3M B;  4IUV A;  2IWH A;  3L7Z C;  4IFD H;  3BDL A;  4CHT B;  2R61 A;  4PNY A;  5DM6 3;  5IGD A;  1S5D D;  1PMR A;  4BY1 B;  4AYB B;  4ZQ3 A;  3SHL A;  5M3F B;  1I4H A;  4OGQ C;  3K59 A;  2WAQ B;  4EQO A;  3VYU A;  3JAM E;  5E1F A;  1MSG A;  1RD9 D;  1TQO A;  3DEO A;  1O78 A;  2E74 C;  1SNM A;  1I4X A;  2EXZ A;  2K5D A;  1BOS A;  1STN A;  4IUP A;  1A15 A;  4JK1 C;  4A3K B;  3M4O B;  2PNR C;  3NWS A;  4K2L A;  3SE0 A;  3DWA A;  2ENB A;  4C3I G;  1C4Q A;  2QEJ C;  1GUW A;  1K83 B;  3H91 A;  4ZLT F;  4KJN A;  1LTG D;  1STB A;  1LT3 D;  4RWS C;  1GUG A;  2EY2 A;  4F88 A;  5JAV A;  4PMB A;  5KIX A;  1XTC D;  1HTL D;  4V19 0;  3NTH A;  1B1Z A;  3BVM A;  1QNK A;  1XX8 A;  5I6Y A;  1DYQ A;  4HED A;  2D2C C;  1PXU A;  1YNN C;  5K36 G;  2JSO A;  4C2M B;  1ILP A;  1IL8 A;  3J7A V;  3G7L A;  3A8I E;  3TP5 A;  4B9W A;  4A3F B;  5E3F A;  2XRQ D;  3I91 A;  4H44 C;  4Q0F A;  1W6J A;  4RKB A;  2HDM A;  4C3I B;  5D65 A;  3MFG A;  2MJ8 A;  1A3V A;  2JE6 I;  3KK7 A;  1KTK A;  3MTS A;  3NPP A;  1CA5 A;  3FDT A;  2RSN A;  2X6L A;  4IUU A;  4Z9C B;  4B08 A;  2H4O A;  1D1K A;  3KBG A;  4CJ1 B;  1EIH A;  3JAM L;  4G7O C;  5J1Z A;  4HR7 B;  2EY6 A;  3MXP A;  4RGO S;  1L0X B;  2F0I A;  1T5E A;  4FXK C;  2JA7 B;  1G2S A;  2OT2 A;  4H0L C;  5JPM C;  4NW2 A;  3PO2 B;  3MZ5 A;  4RFB A;  2RBM A;  5COR A;  2F1M A;  5IT9 E;  1B9N A;  4OO1 H;  2L0C A;  4ILW A;  3I70 A;  5EPL A;  1LLR D;  1BXT A;  4J8Q A;  4L8J A;  4RHR A;  3D4R A;  4RCN A;  3H3V C;  5IGC A;  4ZAI A;  4A3G B;  2MUY A;  1FNU A;  3OPO A;  1SXT A;  2A5H A;  3TME A;  4KD4 A;  1EFI D;  4HMI A;  4DFA A;  2QKI C;  1E2V A;  2JYO A;  1OXU A;  3HG9 A;  5C5M A;  4C3H G;  2BDO A;  2IX3 A;  2YU9 B;  1XYI A;  1SDF A;  2M9V A;  3GO5 A;  2FMC A;  1U9R A;  4DU9 A;  5LL6 X;  1KAA A;  2WKC A;  3HOU B;  4ULL A;  4XT1 B;  3TP6 A;  1X3Q A;  4XXE A;  4X3U A;  3KLS X;  1LTI D;  2SNS A;  1STA A;  3SK4 A;  4N9P A;  4P2C B;  3E6Z X;  2A74 C;  1V8Q A;  1EY5 A;  4KMU C;  3RZD B;  2KJX A;  2D62 A;  3BDO A;  1JOR A;  4C3H B;  2IX1 A;  1D2B A;  1ENC A;  4KHZ A;  1HFN A;  2NZ1 D;  4OO1 G;  2NBF A;  4EQP A;  3R3O A;  1GOZ A;  1S5C D;  4DXG A;  1JWU D;  1O7Z A;  4F87 A;  4DAV A;  1SE3 A;  2X69 A;  1H9M A;  1I4Q A;  2CHB D;  5C4J B;  3D6C A;  1STH A;  5D3D A;  3I8Z A;  4DNR B;  4BA2 I;  5LHY 1;  3OSO A;  1QWY A;  4JBW A;  3HEJ A;  4LK1 C;  1A3T A;  2NN6 H;  1ONL A;  1HCZ A;  1TS3 A;  4K6L A;  2R6G A;  1RJT A;  3NE5 B;  2K5Q A;  3SVM A;  3HOZ B;  4OHJ A;  1EU3 A;  1JOQ A;  5CV4 A;  3A54 A;  3K7A B;  2CVR A;  5FO7 B;  2E2D C;  4TQU S;  3I90 A;  2A6E D;  1VMC A;  2F3V A;  1AP0 A;  1DXM A;  3VYS A;  2O4X A;  1NR4 A;  1TWC B;  2DN8 A;  3K57 A;  5DM7 3;  2A69 D;  1Z7T A;  4C1N I;  4K5W A;  4O42 A;  4UDU C;  1BCP D;  2XSC A;  1U4P A;  4HCS A;  1BDO A;  5KNC A;  4G7Z C;  2BE5 C;  1EY0 A;  2Z4H A;  3IAY A;  1F9P A;  2EYM A;  1STG A;  4WRD A;  3HKZ B;  5K5P A;  3A7L A;  3U9S A;  3VR2 A;  2PO4 A;  5C6A A;  4Y7N B;  2RDF A;  2HQE A;  4RH6 A;  5F2D A;  1Z47 A;  3I4N B;  2K6A A;  5JPN C;  4FYD A;  3A7A B;  5M9O A;  1DD2 A;  5ELD A;  1J9O A;  3K5L A;  4NKL A;  2DNE A;  2NN6 G;  1QCB D;  4FXD A;  3O13 A;  5JJZ A;  3P20 A;  1ENF A;  2D9U A;  3OWE B;  2B2V A;  1S5F D;  5C0X I;  2Q8T A;  3GTK B;  1CHQ D;  1ICW A;  2EYP A;  1ESR A;  2B2Y A;  1EOT A;  1HA5 A;  2XRS D;  1UEA B;  3M3Y B;  3CRL C;  2QCP X;  3RUZ A;  2F0M A;  3NSW A;  1F9S A;  1EEF D;  1IHZ A;  5KEE A;  1DM0 B;  5KGU A;  4R9W A;  1SAP A;  5EKI A;  4XQN A;  4E6I A;  3C2P A;  2RQX A;  2AWO A;  4FP5 D;  1QG7 A;  3OIQ A;  3PUW A;  3OIP A;  1KNA A;  1HUN A;  3DHQ A;  1RHP A;  5C3W A;  2IT1 A;  3NTK A;  1CA6 A;  1MBY A;  5IOC A;  5FKA C;  2Z4I A;  5C3X A;  1I6V C;  2IX0 A;  3TZU A;  4DNT B;  1DON A;  1D1I A;  1PZK D;  4QB4 A;  2EZV A;  4CKE A;  2KCN A;  1MGS A;  3DWP A;  2LY7 A;  2K1B A;  1VCI A;  1MD2 D;  3X3N A;  2K28 A;  1CHP D;  2NTT A;  2B2U A;  4I65 A;  5CMD A;  4RA8 A;  4CKC A;  5JEA H;  1JWS D;  2EDG A;  3PUY A;  3BDC A;  1SMY C;  1EQV A;  2K03 A;  1K8O A;  2B8F A;  3T51 B;  2XVS A;  1F2Y A;  1LO5 D;  2EJG C;  2F0F A;  2K05 A;  2IL8 A;  1AEX A;  3NXW A;  1JOK A;  2HCC A;  5CGK A;  4K5X A;  2A6H C;  2C9O A;  4X3T A;  1PTO F;  1QOH A;  3CRK C;  1WTP A;  1HUM A;  1A3U A;  2XWB B;  3RD4 A;  3EQL C;  5IGG A;  4FF1 A;  2F0D A;  3VR4 A;  1A2T A;  2F0T A;  1U4M A;  3T4A C;  4ZUJ A;  1TS4 A;  1X32 A;  3S1N B;  1IKM A;  4OIJ A;  1NCV A;  4ZUI A;  4BWG B;  3EA6 A;  1STY A;  4ABN A;  5KNB A;  5KND A;  1WCM B;  2K32 A;  2LKV A;  1JWM D;  1SJH D;  4BS9 A;  5ISR A;  4V0B A;  2EYJ A;  3HRZ C;  2KOL A;  2WIN B;  5JEA G;  4IFD I;  1HXY D;  4S3S A;  1FNV A;  3W3A A;  3MVV A;  4K14 A;  4NDX A;  1ZKO A;  2L5T A;  2MP1 A;  2NWG A;  3MWY W;  4CGY B;  1EEI D;  1BBX C;  2IW3 A;  1PTO C;  1I6H B;  3U9O A;  4ZKC B;  1RTO A;  2SDF A;  1DOK A;  1ZYR D;  2DNC A;  3J80 E;  3HOY B;  5C5L A;  2F0O A;  1WVL A;  4PV1 C;  5CC4 A;  1PTO H;  2J0T D;  1SFO B;  4KTA A;  4RKL A;  4TSS A;  3M85 A;  3QOJ A;  3RZO B;  1JE4 A;  2CW0 C;  5A2Q E;  3QOL A;  1FGB D;  5DAU A;  2B39 A;  3VR6 A;  2BCO A;  4MN3 A;  3S1M B;  5KYI A;  2EVB A;  1E0B A;  2ICE C;  1LTA D;  2Q8I B;  3HOX B;  1MI2 A;  3FRP B;  5D3I B;  1HQR D;  1S4Z A;  2F0S A;  1AW7 A;  2F0N A;  4KJO A;  1VF7 A;  4CJ0 B;  2RA4 A;  1G6Z A;  3V2T A;  5I2Y A;  4FO2 A;  4DAP A;  2QF7 A;  2ZXO A;  2A68 D;  2F0G A;  4YIJ A;  1X3P A;  4LAA A;  2NVT B;  1D5X C;  5DNF A;  3QG1 A;  1JCK B;  2LFN A;  3VYR A;  3PIP 3;  2RVL A;  1TWH B;  3I72 A;  4FNF A;  1DOL A;  1OO9 B;  2O5I C;  2ZXP A;  3GTO B;  3H09 A;  2Z1C A;  3P7J A;  1LT4 D;  2PYK A;  1I4G A;  2M00 A;  4A3B B;  4C1N K;  1EY7 A;  1IW7 D;  2PQE A;  3S1Q B;  2B2V C;  4ID6 A;  3AMU A;  4DK0 A;  2AUK A;  3A55 A;  2K33 A;  4A3J B;  3Q24 A;  2R3Z A;  1EYD A;  1LTT D;  2SNM A;  1EY6 A;  2VNU D;  4ODG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...