2OXPA

Crystal structure of staphylococcal nuclease mutant v66d/p117g/h124l/s128a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title High apparent dielectric constant inside a protein reflects structural reorganization coupled to the ionization of an internal asp
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oxpA00
2F0DA 5EKLA 5EGTA 1SYGA 1EY9A 1TQOA 2EYFA 2F0OA 2F0TA 3ERQA 4J6HA 5CV4A 4YIJA 3RUZA 4F8MA 5I9PA 2OEOA 5C5MA 1AEXA 2PZWA 3MZ5A 1EY6A 2EY5A 3NQTA 4ID6A 4K2LA 1RKNA 5KEEA 3SK8A 3C1FA 3DMUA 2F0KA 2SOBA 3MEHA 2RKSA 4HMJA 4KHVA 4EQOA 3OWFA 4K5XA 5E1FA 4QF4A 2PW5A 5K5PA 4ZUIA 4NP5A 1JOOA 2F0NA 5C3WA 3H6MA 3TMEA 2WACA 4KTAA 5IGEA 4KY6A 2NUCA 3MXPA 5I9OA 2EY2A 5JAVA 2F0WA 2PQEA 4KY7A 5C6AA 3DHQA 5IIFA 2ENBA 5EKKA 1STNA 3LX0A 4PMCA 2F0SA 5C3XA 4K8JA 1EY7A 1F2ZA 2EYLA 1KABA 4PMBA 5CGKA 5IGDA 5CV6A 1F2YA 2F0EA 5F2DA 5J1ZA 2F3VA 1EZ6A 2F0GA 4WORA 5IGBA 4B9WA 1KDCA 4MIUA 5C4HA 1STYA 4EVOA 1ENAA 2OXPA 5IGFA 4K6DA 1A2UA 2KHSA 5DAUA 2F0JA 3BDLA 4NMZA 1NUCA 3E5SA 2EYPA 2SNMA 2OF1A 4HTHA 2F0QA 2F0PA 4IALA 4KJOA 3U9OA 4S3SA 4H7BA 2F0IA 4N9PA 4K2KA 2EXZA 3OSOA 4KV6A 3SK4A 1SYFA 4QMGA 4PNYA 4B9XA 3BDCA 5J39A 3EVQA 5KRUA 4IZ8A 2F0MA 4RKBA 3QOLA 5KYLA 2PZUA 2EY6A 1NSNS 5KGUA 4TRDA 4KD3A 4ME5A 3QOJA 4KY5A 4QB4A 1STHA 1A2TA 4DGZA 3HEJA 1STGA 3D6CA 4DF7A 4K5WA 3EROA 5DEHA 4ZUJA 4RKLA 5M9OA 1EYDA 2F0UA 1F2MA 2O4XA 3OMCA 5CV8A 5E3FA 1EYAA 3EJIA 5I6WA 1U9RA 1A3TA 1SNCA 4NKLA 5IGGA 5CV5A 4LAAA 5ISRA 1SYCA 1KDAA 1SNDA 3T16A 5KIXA 1STBA 4DFAA 1JORA 2LKVA 3NP8A 3NHHA 3SR1A 3D4WA 4I65A 1KAAA 5C5LA 2F0HA 2PYKA 5CR3A 1STAA 2QDBA 3P75A 2EYHA 5JOBA 1KDBA 4EQNA 2EYMA 3SHLA 2F3WA 1TR5A 2F0VA 1SYEA 5CV9A 3ITPA 1A3UA 5HURA 5IGCA 4ODGA 1II3A 5IODA 2SNSA 2EYJA 3TP8A 3NXWA 4KJNA 3NK9A 5I6YA 4K14A 1EYCA 4K5VA 2RDFA 4DU9A 1EY8A 3PMFA 4G57A 5KYIA 2KQ3A 1EY5A 3T13A 1EY4A 3TP7A 3C1EA 1A3VA 3V2TA 3D4DA 3SK5A 4N9TA 3HZXA 1EQVA 3TP5A 1SYBA 4KD4A 5C4ZA 2PW7A 3D8GA 1SNMA 3SXHA 1SNOA 3NUCA 5NUCA 5HGTA 4J1MA 4HMIA 4R8NA 1SNPA 3VA5A 4EQPA 3R3OA 1IHZA 2PZTA 2HQEA 1TT2A 3MHBA 4OL7A 3MVVA 1JOKA 3OMGA 1EZ8A 4WRDA 5CV7A 5J22A 3SK6A 4E6IA 1EY0A 4IUNA 3P1HA 4K8IA 3S9WA 2EYOA 1SNQA 3TP6A 4F7XA 5CC4A 4NDXA 1ENCA 1JOQA 4ZQ3A 2EY1A 2F0LA 5IOCA 3QB3A 2F0FA 1SYDA 2RBMA 2M00A
chains in the Genus database with same CATH superfamily
2YTVA 1SYGA 2VS1A 1EY9A 1YJWA 3HKZB 3UI2A 2SOBA 3OTOL 2NTSA 1CZWA 1V1PB 4K5XA 4GKKL 1KTKA 1AZPA 4JI0L 1O7YA 4GN4B 5AFWA 2WAQG 4YY3Q 2OWOA 2PMZE 2PI2A 1CKMA 2K32A 4PMBA 4IUPA 1EWHA 3S1QH 2AWOA 1ML0D 4HIOA 2OXPA 1EEID 4B3TL 4A4IA 1NUCA 1MIUA 4P73A 2N8NA 4GN5A 2R61A 2N88A 5CMDA 1I4RA 4G4KA 4DAMA 1ET9A 3E9IA 1HA6A 2IJ0A 3GDEA 4G7HC 5M5XB 1Y69U 4KV6A 4LF4L 5LL6S 1GJXA 1EWCA 3GTGH 2K1BA 2A68C 2DY7A 5ELOA 3DWQA 1VQLA 3HOXG 4OIKA 1EIYB 4DR7L 2F4VL 4CDFC 1DONA 4LFAQ 1SYCA 3BYYB 3P20A 2CKZB 4N8X1 1TY2A 3JAML 4XTCS 5C5LA 3I90A 4JI8Q 1KRTA 2QA4A 3MFGA 3S2HH 3NEMA 5CR3A 3HOUH 3KDFB 3IRBA 2F3WA 1TR5A 4MTKA 2SNSA 2EYJA 5LMNQ 4JI0Q 3A5ZB 3I4MG 5M3FB 2AUKA 1R4PB 3T56B 2OQKA 5IP7H 3OW7A 3LWEA 3K7AB 3SXHA 4RA8A 2EOTA 3TSSA 2DUDA 3R3OA 2PMZB 1HUMA 5DM73 2R7ZG 4CKEA 5IYDG 3NTIA 4BS9A 4A3DB 4K8IA 2MQHA 2R93B 3RR5A 4B3ML 1TWGB 3D6WA 1ILPA 4FDBA 3DLLA 1Y1VH 1VQ6A 4C3IB 3EQLC 1PXUA 1ONLA 3CCQA 1AEXA 4KN7C 2EY5A 4K2LA 3MEFA 1QJOA 1B3QA 3NQIA 3I72A 3HG9A 3QR8A 3M3YB 2ICIA 5K5PA 1XNRL 2WFWA 4BY7H 2LMCB 2YV5A 3MXPA 5EJWA 4A93G 4DR3Q 2JA5G 1TS4A 1E24A 4WJ4A 5DAUA 2H1EA 2LSSA 3PUXA 4PZ7A 5M3MG 4CDEC 1N8RC 1C0AA 3GO5A 1TVXA 4POFA 2QF7A 1XPRA 1H9SA 3M7NA 1H9KA 4A3KG 4KMUC 4A3IH 2KENA 2H4OA 4FXGC 1B50A 1AW7A 3SK4A 4DAPA 1YJ9A 4IO9A 5KYLA 4FNFA 1QVFA 1WJJA 4UPAA 4ZUJA 2NBFA 4X3SA 2F0UA 2O4XA 1IKMA 2HD3A 5IGGA 3A0JA 5IP9G 3N52A 4BBSH 1SNDA 3A54A 1CUKA 3KYHC 3RMHA 1LO5D 1NMGA 1XMQL 4AYBG 3OHXC 3CRKC 4C2MB 4B3SL 1EU4A 2IHEA 4QIWE 1PH9A 3P75A 1YHAA 5JOBA 4TQUS 4IPHA 1W6KA 3I4NH 3AU7A 2JJQA 4ODGA 4JI4Q 3NK9A 5HY6A 2MNAA 1DZ1A 4DU9A 3L3OC 5KYIA 1LT4D 1XMOL 1SNMA 2OCEA 2MO0A 1BBXC 5HGTA 5BN3A 3WWVA 3VA5A 3GTMB 1HFGA 1RDPD 1OO9B 1L0WA 4DV4Q 1LTTD 4AQYQ 3MHBA 3ONAB 1MD2D 2QCPX 2K01A 1CZGA 3J7YW 2UUAL 4H0LC 1JOQA 3SE0A 1N34Q 1M4VA 2PI2E 3CD6A 3S14H 3MFYA 2F0TA 4LF6L 1HXYD 4G7OC 4JI6Q 1GUNA 3GV6A 1WD1A 1TS5A 1PDQA 2EY2A 4C3JG 2JYOA 4R4CA 3LX0A 4K8JA 1PH8A 2GN5A 5F2DA 5JPMC 5J1ZA 3VA7A 1HZCA 1VS0A 3WOFA 1X3EA 4JYAQ 1Z47A 3EN2A 1LTRD 2MGSA 1XJVA 4L63B 2E2HH 3L9AX 4A3EB 1RODA 3G6JB 4DR6L 3GTPB 4QIWB 1SJHD 2ES2A 4PNYA 1FNUA 2MJ8A 3EVQA 2I5MX 1XMOQ 2RSNA 3CXCA 1X3GA 1QUQA 4X62Q 2D5DA 4IFDH 3HOUG 2JA8H 2B2UC 1WCMB 4JI3L 3CHBD 2AQ1B 4BXXH 3OMCA 3VR6A 1SBBB 2KECA 2UUAQ 1GM5A 1TWAB 4MTNA 1H95A 2R93H 4MNOA 2JXMB 2HIXA 2KA7A 3V96A 3CPWA 5IP7G 5G3LF 4DN4M 1B9MA 2KBNA 4OWTB 3U58A 4YWLA 4KN4C 3FMCA 3ULPA 3S17H 2KEEA 2K4KA 1JMCA 1KDBA 4EQNA 3QIAA 1SJED 2NN6G 5IGCA 3GQBA 1KLGD 2ZTEA 1PZJD 4YHHQ 3M3YH 1D6EC 4P2CB 4X65L 3Q0AA 1EYCA 5JEAH 4OWWB 1CKNA 2XSCA 3BU2A 1IBML 4LFCQ 4HAEA 1EY4A 4BY1H 4UDUC 4M1UB 3HOWB 1PFBA 4HR7B 2K03A 3ND9A 3QWNA 4NW2A 2NVXB 1BCPD 2B2VC 1IW7C 1YITA 1QE6A 2PNHA 1BO0A 1AE2A 1NR2A 3GP7A 2UXBL 4F7XA 2NWGA 2K28A 2B63B 3GTKB 4ULLA 2F0FA 4H13C 1K8OA 1MBYA 3DEPA 4QJFA 3DMUA 3A56A 1ZYRD 4DR1Q 1PH4A 4FVMA 4U68A 1CFMA 3ZYYX 2VNUD 2CH4W 5IGEA 3K0XA 4KY6A 3J81i 2K5WA 3MXGA 2JE6I 2L4NA 1N36Q 5FJ8H 1QOHA 1GXDC 2RF4A 1VQOA 1I6HB 5C0XH 3K81C 4C2MH 4H44C 1VQNA 3AEVA 1BCPF 3PO2B 4JI1Q 1TKWB 1VQ9A 4PV1C 1T5EA 3GTQH 4LK1C 1RIPA 2K50A 2R92G 2EXZA 1IBLL 3BDCA 3QO2A 1MI2A 4BWGB 1HR0W 3QOLA 5JJKA 1SE2A 4GLVB 3KDFA 3Q22A 5IYCH 3HKZG 5K36G 2VB2X 2Q2IA 2Z8LA 3VYUA 3J7ZC 1ILQA 2Y0SE 1XPUA 3LGJA 1ICWA 1SN8A 5LMUL 4DV3Q 3GD7A 1OTCA 4KI0A 2BDOA 2D2CC 3TN2A 1KAAA 2ZM6Q 1WYDA 1BNZA 4LF7Q 2O5JC 4PMWA 4ALPA 3K8AA 1J6QA 1VCIA 2C9OA 3G6EA 4FXDA 1JICA 2RSOA 1MHWC 1SRUA 1SYEA 5HURA 1E7ZA 1YVCA 3DWAA 3CC2A 3VR2A 2B2WA 3J80c 1VQCA 1I4HA 1QZGA 3V2TA 2VQFL 1G6ZA 2X6LA 1H9SB 1CA6A 2UUCQ 1D7QA 2BH8A 3I2ZA 4ZAIA 2HQEA 1TT2A 4A3MH 1UE1A 4QL5A 1BOSA 4UY8C 4GZYC 2D62A 4IUNA 1L1OC 3S9WA 4OONA 4GNXB 1C4QA 3K57A 3S1RB 2RBMA 4DV7L 4XYOA 3W2DA 2KOLA 1PTOD 1PRTB 2JA7B 3MC0B 4YCWA 3NQTA 2OTLA 4P72A 3I91A 3MEHA 2RKSA 3K7UC 1WCMH 3AB9A 5E1FA 4DAYB 1SMYD 3BVZA 4NP5A 3OW2A 4TSSA 2AWNA 5IWAL 2Q2TA 1WOCA 5JJZA 4RG1A 2LXKA 5I9OA 5M3FG 4JI2L 5IT9L 1TWAH 2F52A 1N32L 3HP3A 4PMCA 4IPDA 2Y0SB 1LT3D 2EQSA 5IGBA 4EX5A 4NMZA 3S2HB 1Y14B 3CQZH 4R4IA 2PCFB 2Z4HA 3H0GB 1R9TH 1RF2D 4A3DG 2R93G 4FF4A 3AQQA 4K2KA 2HHHQ 1V1QA 3L7ZC 3HS0C 4OGQC 3M9BA 2E5LQ 4ZK9B 1WI5A 1X3QA 4RKBA 5EBDA 3M85A 4C3IG 2WB1B 2Z0SA 3HOWH 5IT9E 1A2TA 2Z6KC 1Q8KA 4RCNA 4JBJA 2NVXH 5I2YA 1S5DD 4ZLTF 1N33Q 4R9WA 3GTOH 1SLJA 5JEAG 1IL2A 5CBEE 4LUZA 3T16A 3FEWX 5KIXA 3HOVB 1YNNC 2DJGC 4DV7Q 4LFBL 1JB3A 2ZTDA 3GTKH 4NXMQ 5FLXL 3OPOA 2QEJC 1Y1VB 5ELEA 4DV2Q 4GLXA 2IT1A 3TDQA 2GVBA 4FF3A 1A8VA 1HZBA 1VQ5A 4JOIA 1OXSC 3J81L 3ITPA 1DOKA 1SR3A 1X54A 3BZCA 2TMPA 3BZKA 2L9HA 1PFNA 1Y8NB 2ZXPA 1EY8A 4BY7B 1XWEA 5CBAE 2KJXA 2A73B 1YNJD 4X66Q 2KUMA 2PW7A 4X64L 5CORA 1U4MA 3TQYA 5AJ3Q 4YY3L 1CHPD 1SDFA 1IHZA 2HCIA 1G291 1TWFB 1PTOC 2QEXA 1KLUD 5FLXE 1C48A 2CWAA 3A8IE 3EBEA 1QUQB 1H9RA 5TSSA 1SE8A 1R4QB 2ZJPA 1STEA 3J81E 1Q81C 1SMYC 3FHWA 4L6TB 5FJ8G 3KJOA 2EYFA 2NN6I 2K04A 4LW1A 5FO7B 2QGQA 3EFXD 4H02A 1P8LA 2G9DA 2IWHA 2B2TC 2K5DA 3F2DA 1HJPA 5T1IA 3IAYA 4LFBQ 3R2IA 5CGKA 4BBSB 1NAPA 4LFAL 1EIFA 1HNZQ 3G4SA 5IYCG 4Q5VA 1CKNB 3CF5A 1F9PA 3PQIA 4JI8L 1VQ7A 1DD2A 3I4NB 3U9OA 3FP9A 5I2XA 1WTOA 2I0QA 3A5UA 4M8AA 3HOYH 5LMNL 2F0MA 4X64Q 4JW0A 1PZKD 3EA6A 2PZUA 4Q0FA 2CVRA 4LMQD 2ZJQA 3QOJA 3H15A 1GUGA 3AYHB 5M9OA 4ILWA 4JBWA 5CV8A 4NKLA 4LAAA 1EIHA 3CP0A 1E3PA 1STBA 2EPBA 1WD0A 3RLOA 2XIWA 3NP8A 1YBYA 3K5LA 3S1NH 3S1RH 3K59A 1CKOA 3D4WA 4I65A 4V0BA 2F0HA 1BF4A 3K58A 3S14B 3IFDA 5FLMH 2JA7H 3A8JE 1HTPA 1A0IA 1NJIC 3KJPA 2BA1A 2YU9H 1EU3A 4A3EG 2GVAA 3NXWA 3CRLC 4K5VA 4R4QA 1C7YA 1HNWQ 2OT2A 1A3VA 1JC7A 3CMAA 3D8GA 4RGOS 1HQRD 3NUCA 3CCUA 3H94A 3GV3A 2HDMA 3KOJA 1RTOA 4DAVA 4DR3L 2F3IA 4RGNA 1JOKA 2L1BA 1I6VC 1SSOA 4KHZA 2E2HB 4JVZA 4FYDA 4L5TA 2EYOA 5CC4A 3BDOA 3H0GH 5ELFA 4DK1A 2JEBI 1KAWA 4ABNA 1YIJA 4A76A 1HFNA 3RD4A 5ELDA 4POGA 1M1KC 2JEAI 2M9VA 4CKBA 3MZ5A 3JC66 3NWSA 2MUYA 1Q82C 4X3UA 1WTPA 1RKNA 1J8IA 1LT5D 4ME3A 2YTXA 2JA8B 4KHVA 1U0LA 1X65A 1LTAD 4JI5Q 1IKLA 4J8QA 4KTAA 4HJ5A 3HOVH 1O80A 1AE3A 2RQXA 3VYSA 5GADC 3DXJC 1STYA 1V8QA 1VQJA 4R4OA 2N3SA 3S17B 1QG7A 2K5QA 5KNDA 4HTHA 1KC8C 3H3VH 1I4GA 1QNUA 2Q8RE 1S5BD 3U50C 4ZCKA 2B63G 1RD9D 2Z1CA 4JI4L 3PV0A 4XQNA 4HIDA 4GOPC 3S16H 4ZYSA 2EY6A 4BY1B 2AUJD 3VR3A 4DK3C 2F1MA 4X3TA 1F2LA 5E3FA 3LNNA 1TWFH 3X3MA 2XWBB 5D65A 5ISRA 1X9NA 1G6PA 4DV4L 1E2VA 1LYLA 4AQYL 3L2PA 1X56A 3CCLA 4OX9Q 2OTJA 4BBRG 5D14A 2D9UA 1OXTA 2Z9HA 1W6JA 5FO8B 1N34L 2EZVA 1KL9A 3STBD 1VQMA 1A3UA 2L12A 4GNXA 3PO2G 1FL0A 4A3GH 1K3RA 2B8GA 4K14A 1FNWA 1I4XA 1LACA 4JPBW 4OHJA 3T13A 2WAQE 4JI6L 1E22A 3KBGA 1Q86C 1SYBA 4KD4A 4RGMA 1VQIA 2K52A 1UUPA 2CWPA 2CQAA 5FKAC 1LLRD 5C44B 4DR5L 4XXEA 1BUVT 4DAYA 4IUVA 4DR2Q 4GKJQ 5LL6X 4E6IA 2D0PA 3J7AV 3KLWA 2ZTCA 4JYAL 5JEAJ 4GLAC 3K0YA 2PQAB 3GTQB 4LF9Q 4XT3B 4CDDC 3CC7A 2M00A 2F0OA 3MA2B 2DY8A 1L1OA 1HNXQ 1PH7A 2E2IB 1UE7A 2K5VA 2HQLA 4X62L 3MXUA 3H91A 4QF4A 5GQOA 4PQXA 2XNAC 4NPSA 1DGSA 4RHRA 3R8BA 4DK0A 2VZAA 2E75C 5IIFA 4UHVA 1Q12A 2XGTA 1QZHA 3M7GA 1F2YA 3F2CA 4A3BB 4WORA 5GROA 4CGYB 5IYBH 1HR0Q 4N8FA 2KHSA 3VR4A 1CTMA 2SNMA 4HEDA 2MHVA 1J9OA 2BA0A 1NMFA 4IALA 4OO1H 1D1KA 1PVOA 4N9PA 4RAUC 4DUYQ 1GUWA 4YHHL 1MSHA 5G3LD 5C4XH 4LFCL 3FKIH 4AIMA 1MJEA 2JA7G 2IY5B 4DR5Q 3I8ZA 1TS3A 4LWCA 5CYUA 5EPKA 3T53B 4ZKCB 4A3MB 3HKSA 1E1TA 1T9HA 3EIVA 3I56A 1TIID 5H1SE 2RCFA 2JSOA 4DV6Q 3Q8DA 1SE3A 5LHY1 5JVG3 2EVBA 2UU9Q 4DXFA 1WTQA 3C3LA 4P71A 2PYKA 2Y0SG 3VYTA 2QDBA 2EYHA 3UE0A 4B3RQ 3MTSA 1VQHA 4LUVA 1DYQA 2K05A 2FMMA 3H0GG 1HZ9A 3LWUA 1IYVA 4RWSC 1EY5A 2ALYB 4DR1L 1H9JA 3E0JA 1XX8A 1EQVA 2QDLA 2R6GA 1PMRA 1SFOB 1JCKB 1ASYA 1B53A 2WB1G 1C8CA 2CHBD 1N36L 2IX1A 2B2YC 1CI3M 4MHEA 1SROA 3W5OA 4JV5Q 4OL7A 3MVVA 1EZ8A 4BA2I 1PYWD 3A74A 4DV5Q 3CQZB 1D5MC 4JI1L 3W1GA 3JAMc 1R9TB 3HOVG 3S1MB 5EKLA 3V05A 3ERQA 4P75A 1F77A 2WV6D 3O13A 2A5HA 1HUNA 2CQOA 2XRSD 1Y1VG 4QY7A 4IPGA 4HMJA 3PIO3 2K75A 3CPFA 2IW3A 4IUUA 4A3LH 1VQBA 1FGBD 4Z9CB 1E2ZA 1U4RA 2DNEA 1GUTA 3GTOB 3KLSX 5C6AA 4R4TA 4BY7G 2ID0A 1ZEQX 2EE1A 1QCBD 1FVIA 2B2TA 3PUVA 4A3FH 1P16A 2IL8A 1LTSD 2JQOA 3KUPA 2VUMH 1KDCA 5BN4A 4DV3L 2J4XA 4AYBE 4K0KQ 1PRTD 2R7DA 1NCVA 2CW0D 1I4PA 2ZM6L 4LF7L 4XDXA 3ERSX 2L11A 3SGIA 3OIPA 3HGBA 1S40A 4A3CH 1BKBA 1W2BA 4A3IG 1RL2A 1ICFB 4CJ2C 2FHTA 2OQ0A 1MKHA 4QQBX 1STGA 5C44H 5DEHA 1VMCA 2VQEQ 3TZDA 4A93B 2UUCL 3U4VA 2RCNA 1BQQT 3BVMA 1K28A 1LTID 1QWYA 4LF8L 1E1OA 4XT1B 1I50B 1Q46A 3NHHA 3SR1A 4BBSG 5L37A 5JPNC 1FGUA 1XTCD 5C3EH 2KCCA 3P7JA 3T1YQ 1JR0D 2WP8J 1KD1C 3SHLA 2E2IH 3KF8A 3IKJA 1PRTF 4RHSA 1K83H 1II3A 4DNIA 4KJNA 4LUOA 1FD7D 3I4NG 5C4JB 2VB3X 1UWVA 3T1HQ 4R8IA 4CDCC 2B29A 4Y52H 2CFMA 4CKCA 1HA5A 1K9MC 4A3BH 1TS2A 1X32A 2MP1A 1F9RA 1EUJA 4R8NA 1NY4A 4L8JA 1Z6HA 1SMXA 3DM1A 1VQ4A 1Q1EA 1Q1BA 3NBHA 1WVLA 5J22A 1TWHB 3KF6B 2IHFA 2NVTH 5M5WB 1B1ZA 1FJGL 2MFIA 1ENCA 4ZQ3A 3QB3A 5E4XA 2RDGA 1MSGA 1BCPC 1TQOA 4EQPA 4J6HA 2I07B 1KQSA 3HOYB 2HHHL 3GTJB 2PZWA 1Y8PB 1EY6A 4JC0A 5IYBG 2YYZA 3CCSA 1AZQA 2E5LL 4JI7Q 2ZXRA 3QG1A 1UAPA 4OXPA 4XQQA 4EQOA 2PW5A 2ASBA 4LF5Q 3UE1A 2EJGC 1JE4A 2WACA 4LF8Q 5BR8Q 1EY7A 1F2ZA 2EYLA 1KABA 3PIP3 1N33L 1E2WA 2F0EA 1ZYRC 1ESFA 3S1NB 2LY7A 1LUZA 4K6DA 2HCCA 2F0JA 4NXML 3UDIA 3NBIA 4KKTA 1U4LA 3CAMA 4DV2L 2F0PA 1B2TA 4KJOA 2YU9B 4U673 2F0IA 3TBIB 4QMGA 1X6OA 2YTYA 2J0TD 3W1BA 1ET6A 2E2DC 4ME5A 1SFOH 1MGSA 4I7AA 5DM63 4DF7A 4X66L 4IFDG 4RKLA 2JA8G 1O7ZA 1OXUA 1U5KA 1SXTA 5AJ3L 4GOPA 3OIQA 1L1OB 1J5EQ 4BXXG 1FJGQ 3FDTA 1AP0A 1QVCA 1LABA 1X55A 3DM3A 3S15B 3E9HA 3S1MH 3PUZA 2XN9C 2Q2UA 1S4ZA 4KHPQ 2F0VA 3CCEA 2PQAA 3TP8A 1VF7A 2P5ZX 2RDFA 1CSQA 2EIFA 3Q6SA 3I3CA 4N9TA 4CHTB 1IYJB 1SNOA 1GVPA 4BY1G 1YHQA 4HJ7A 2R7ZH 5JJIA 4OEMB 1EFID 1BR9A 4OWXB 1HNZL 2FXQA 1TWCH 2FJ2A 5CV7A 2E74C 1EYGA 3R2TA 1Q90A 2F03A 2JA6B 1D1IA 1JT8A 1BBWA 1ASZA 2DN8A 3NE5B 1A63A 2F0DA 4UP8A 1GHKA 2B3GA 5KNCA 3J7A5 1KNEA 5C5MA 5KEEA 3RZDB 3I73A 4L5QA 3S16B 4HJ8A 3HKZE 4X3KA 3U4ZA 1IZ6A 1YHBA 2C5CA 2F0NA 1PFSA 3I4OA 3GTLH 4A93H 2KHJA 4HJ9A 2CH4A 3S2DH 1BDOA 1SAPA 3CCVA 3TREA 1DJRD 1I50H 3M4PA 5C3XA 5EPLA 3TZUA 1NNXA 4GN3B 4DR4Q 1ZKOA 1B44D 4HCSA 4DA2A 5KNBA 1Q8IA 4RGTA 5C44G 1Y1WB 1JB7A 2JN4A 3BDLA 2HUGA 1CA5A 2EYPA 1I94Q 2I5LX 2OF1A 5C0XG 4G7ZC 2A68D 3B6YA 3PO3B 2L15A 3M4YA 1F9QA 4A3GB 5J39A 4IZ8A 1IXRA 5C4JH 2EJMA 3BYTB 1U4PA 4QGUA 1HNWL 3H3VI 1WTVA 4KY5A 2L5TA 3HEJA 1JJ2A 4K5WA 3E3XA 4TKOB 1EYDA 1F2MA 1PLFA 2A6ED 1TY0A 1SE4A 3DEOA 3CCRA 4P74A 1SEBD 1TWHH 2DJFC 4KK7A 1EL0A 1RHPA 3KK7A 5M5WH 2LKVA 2MO1A 4A3BG 1KXLA 3PF4A 2EXDA 1IBKQ 1STAA 1YEZA 3GTJH 3KLSA 1K73C 4BA1I 3NENA 4YWKA 1AH9A 1GD7A 3AFPA 1VQGA 2ZT9C 3PMFA 1JJCB 3M4OB 3F2UA 1G8ZD 1B8AA 2NB0A 2XWJB 4JI5L 1CHQD 4MZ9A 2J7ZA 3TP5A 5E7NA 1JE5A 1KRSA 2B2UA 4LJZC 3J80i 4DUZQ 1LTBD 1DOLA 1JQYD 2ZJRA 4FF2A 1YNJC 4A3MG 1GUOA 4YWMA 4C56C 2ZXOA 2EY1A 2B2YA 1X3PA 3OYYA 3OWEB 2NTTA 3RUZA 5CV4A 4APVA 2M2LA 3G7LA 4F8MA 2A1AA 1VF5C 5D3IB 4ID6A 4HIKA 2E76C 5C4XB 2FINB 3E6ZX 2F0KA 3FKIB 1HRJA 2Q8IB 5JJLA 1S72A 1JOOA 5D3DA 4C3JH 3VYRA 4HCEA 1WCMG 4EGVA 1W3SA 3FVQA 4NB3A 2F0WA 4KY7A 2VL6A 3KF8B 4DV0Q 1PYBA 5IGDA 3U9SA 1QILA 2F0GA 3S15H 2B2VA 4O1NA 4OX9L 2LFNA 5IGFA 1C9OA 1IL8A 3E5SA 3BS1A 5EPJA 3I4LA 1EQRA 1VQDA 4B9XA 4C1NK 2Z4IA 1QNKA 2B2WC 2A6EC 5M5YH 3OTOQ 3NBHB 2R7FA 3RN5A 4GKKQ 1D8LA 3D3RA 2DGYA 4KD3A 2H5XA 3W3AA 4OO1I 2Z6BA 4DGZA 2R3ZA 3EROA 3HOWG 3K5NA 2IPKD 4JK1C 1EYAA 5CV5A 3MXNA 5HGQA 3ZJYC 2LS01 5IT9c 4A75A 1O7LA 2PO4A 1CSPA 3Q24A 4DR2L 4GKJL 4IUQA 5GAGC 1E0BA 1K8AC 2JA6H 3KBXA 1JORA 4B3TQ 1K0SA 3G71A 1UNSA 2FFKB 1S3OA 3BZDB 3JAME 1K8MA 2NN6H 1FR3A 2NVQB 3UDXA 4LF9L 3KF6A 3RZDH 4C3HB 5CV9A 4QCLA 3HOZB 1EOTA 5EAYA 3K5MA 1HNXL 4LF4Q 2WINB 5FK9C 5J3BA 1Z7TA 3PCOB 5GAHC 2KHIA 1QVGA 1GHJA 3C2PA 5C4ZA 3SK5A 1L0YB 2NVYB 4IPCA 4A3JB 4IFDI 4DR7Q 2F4VQ 2RVLA 4A3FB 2XVSA 3C46A 2VUMB 2WIIB 2E8GA 1Y1WH 1B4OA 5EBCA 1T5XD 4IFDJ 1DXMA 4WRDA 4IUTA 1KNAA 1L2FA 1VQFA 3PO3H 1HR0L 4FXKC 1S5CD 2RDHA 3TP6A 3AMUA 2X69A 2A69D 1YJNA 5GAEC 5FLXc 1VQPA 1NR4A 5DNFA 5EGTA 4DK6C 4GOPB 1A62A 3VDYA 4IQZA 4DUYL 2B39A 2AHOB 3SK8A 2JP1A 1A15A 3C1FA 3J81c 4QUFA 3RNUA 1HCZA 1PTOH 2I46A 3IL8A 1YZ6A 2PQEA 2F0SA 2HIVA 3MWYW 1EOVA 3AFQA 3D0FA 2F3VA 3K5OA 1G91A 4B9WA 4DV6L 1OXVA 2A74C 5C3EB 3K80C 2UU9L 4B3MQ 2R92H 3OOCA 4JOIC 4RH6A 4Y7NH 4H7BA 1K83B 3A55A 3QJYA 4B3RL 2K33A 5IODA 1BBUA 1SYFA 2K6AA 3J80L 5EKIA 3M4OH 3URYA 5K36H 1EEFD 1XNRQ 3RN2A 4XQJA 1V9PA 3HOYG 1JJGA 4X6AH 1I4QA 1HQMC 3D6CA 5DLQE 1VMPA 3BJUA 1PA6A 1HHVA 2JK8A 3EJIA 4JCVE 2K5HA 1A3TA 1SNCA 1TXYA 3F8TA 3RLFA 3RZOB 1HZAA 4JV5L 3CKIB 2KEDA 2NVTB 1B9NA 2RA4A 1RCVD 4DV5L 1B70B 5C0XI 3I7FA 4FF1A 4CJ0B 4DXGA 1A6XA 3J80E 4TVAB 5M5XH 1FNVA 5FLMG 2NZHA 1I3QB 5C0XJ 1IW7D 2WAQB 3DUZA 2KQ3A 3PF5A 3J7AF 1GO3E 3CCMA 2XRQD 3D4DA 3PGZA 2AQ3B 3STBC 2Z6KA 2A69C 1PV4A 5LMNW 1SNPA 2BH2A 3T4AC 5ELNA 2F4IA 4RMFA 3TS2A 2K14A 2MPMA 4MN3A 3TEHB 4K0KL 4OIJA 1XMQQ 2AKWB 4B3SQ 2DNCA 2VW9A 2VY3A 1CT1D 1PH2A 4YIJA 5I9PA 4J15A 1LTLA 5BN5A 1V43A 3T51B 3HOXB 2O2LD 4RCOA 4DNTB 3VR5A 4DV1L 1XNQL 3OWFA 4IJLA 5M3FH 1WTRA 1UEAB 2E2JB 1ENFA 3TMEA 2IX3A 4HSPA 1K3BC 2VQEL 4HSVA 2ENBA 2BDNA 1STNA 3K7AH 1NTGA 5EQ0A 5CV6A 3ULJA 1M8AA 4GS3A 1CQFA 2BOSA 3SEBA 1EZ6A 1D5XC 1WTXA 4MIUA 4FO2A 3WDNA 1ENAA 1A2UA 1JWUD 2NVQH 1S5FD 1CM9A 3KLRA 3N6RA 4A3DH 4KKUA 1WTHA 2EDGA 4C3HH 2N78A 3G48A 3ER0A 1PYSB 3T1YL 1VQ8A 4V190 3I4MB 1TWGH 2A8VA 3HOZH 4S3SA 5IE8A 1K0RA 4LF6Q 1DM0B 4AH6A 4C3IH 2L55A 2JA6G 1ESRA 2B8FA 2O5IC 2Q8TA 3BG3A 1AN8A 1D2BA 1DCZA 2KVMA 2NVYH 3K6OA 4A3JH 1NSNS 1PZID 4QB4A 3T1HL 1STHA 4ZRZA 1NE3A 2NYZD 2PPBC 2R7ZB 5I6WA 1BVSA 1TWCB 1L0XB 2V4DA 1F9SA 4IURA 2K7VA 3Q23A 4WJ3M 4QUCA 1V1PA 2NZOA 4O0AA 1O78A 4DR6Q 4C1NI 1CQVA 3ICEA 3DWPA 4DV1Q 1XNQQ 1KIXA 2BCOA 1GOZA 1Y1WG 3D4RA 4ZKBB 1RTNA 3PIOA 3NWTA 1D5ZC 3A7AB 3PO3G 5I6YA 4JI7L 3CU7A 2NZ1D 5JVH3 3I55A 3GTLB 4A3GG 1UE5A 4JI3Q 2TSSA 4LF5L 3S2DB 1V1OA 2QW7A 2A19A 2JA5B 3A7LA 5FOBB 5BR8L 5M3MB 3NPPA 5FO9B 4L5RC 4BBRB 4K6LA 1LV9A 1EY0A 4IJHA 4UP9A 4A3KB 1HTLD 4R1JA 1SNQA 3RLNA 3UDFA 4NDXA 2F0LA 2KCTA 3NTHA 3ND8A 4KKSA 5KRUA 5IY0A 2EJFC 1X3FA 2L0CA 3D31A 3MXNB 2UUBL 2SEBD 4X65Q 1XXGA 2RHQB 1N9WA 1XTDA 3PUYA 1IBMQ 3A8KE 1FYCA 1WTWA 4CJ1B 1KHIA 2QKIC 2UXDL 1EQTA 3H6MA 1JWSD 2XTIA 2NUCA 3L0OA 5JAVA 2ICEC 3IFTA 3RZOH 5EKKA 4HIMA 3X3NA 5ELCA 2KCMA 1J5EL 4AYBB 3GTMH 2G5DA 4XYQA 2LXJA 4EVOA 2UXBQ 1HPCA 2F0QA 1HH2P 1I3QH 4GNXC 1VQEA 4KHPL 3WOEA 1JWMD 1K8GA 5ELBA 4OO1G 2V1CC 3CW2C 2WKCA 3KFUA 1PRTC 2A6HD 2I5HA 1YNND 2CW0C 2GA4B 4TRDA 3S24A 3SVMA 2WB1E 2AQ2B 5C4XG 3FKIG 1WFQA 4YCUA 1U9RA 3CC4A 1KDAA 4UP7A 2WKDA 4DFAA 1EWIA 2UXCL 3J81j 1PH3A 3S1QB 4O2DA 3NELA 1BCPB 4JG2A 1GUSA 2UUBQ 4PG3A 2K5NA 4A3EH 2EYMA 1TU2B 3HOXH 1IBLQ 5COYA 3GTPH 4DKAC 2UXDQ 1S5ED 1G51A 2E2JH 1AFPA 3R93A 4C3JB 1BXTA 3TP7A 1PH6A 4I7ZC 4F88A 3GTGB 3HZXA 3M4QA 3CMEA 3PIPA 5NUCA 2KCNA 2Q2HA 4J1MA 4HMIA 3UDGA 2PZTA 1QB5D 1Z9FA 5LMUQ 4DR4L 3SK6A 3P1HA 2ATWA 1VQAA 1UEBA 1XYIA 1UE6A 4B08A 4PZ6A 3CCJA 3I4MH 3PUWA 1I94L 5IOCA 3NTKA 4DNRB 1LTGD 5A2QL 2QILA 4LNQA 2IX0A 3HOUB 4WJWA 2OEOA 1Y8OB 1PFMA 4NXNL 5M5YB 2VXWA 2AMCB 1Q3LA 3JAMi 3HRZC 3H3VC 4IN3A 2BE5D 4C3HG 2HT1A 4ZUIA 1LM0A 3HOZG 5C3WA 3I70A 2VQFQ 5IYDH 3FRPB 4A3LG 2UXCQ 1PTOF 3DHQA 4O42A 4FP5D 1B7YB 1CK1A 3HFZB 4WFN3 4A3JG 3F2BA 1GKHA 5C4HA 5E4WC 4UAIA 4A3FG 2D0OA 2VUMG 2A6HC 5A2QE 1M90C 1IBKL 2N55A 2B63H 1VDZA 4KLKA 2N49A 3OSOA 3ULLA 3E0EA 4L5SA 1DOMA 2RHSB 2HDLA 4A3CG 2JA5H 5KGUA 3MAQA 1B3AA 5IWAQ 1EIGA 4JBKA 1O7IA 5M3MH 4JI2Q 1N32Q 4DUZL 3F1ZA 4PZ8A 4BBRH 1H9MA 4A3KH 4HN7A 5T1GA 4HJAA 4CBVA 4RFBA 4JBMA 2FMCA 1I6HH 2X6GA 4NXNQ 4IOCA 1EFWA 4EQ5A 3FPPA 3PO2H 1OXXK 3NSWA 5C3EG 1G2TA 3H09A 3TS0A 5A35A 3SDZA 2JA9A 3BVGA 4A3IB 5IP9H 2C35B 1XPOA 2G9HD 1PH1A 4G57A 1PTOB 1YI2A 1I5FA 3C1EA 1G2SA 1VQKA 2CCZA 1LT6D 1MJCA 1IYUA 2SDFA 4YCVA 4DV0L 2PNRC 1PHJA 3FPUB 4OELB 3OMGA 4F87A 4DPGA 4IOAA 1ZXTA 1YNXA 1Q7YC 3PSIA 1EQQA 4XIGS 1RJTA 1PH5A 2R92B 4Y7NB 2BE5C 1SYDA 3TRZA 1NBWA 5I4DA
chains in the Genus database with same CATH topology
1SYGA 1EY9A 3HKZB 3UI2A 2SOBA 2NTSA 1CZWA 1V1PB 4K5XA 1KTKA 1AZPA 1O7YA 5AFWA 2K32A 4PMBA 4IUPA 1EWHA 2AWOA 1ML0D 2OXPA 1EEID 1NUCA 2R61A 2N88A 5CMDA 1I4RA 4G4KA 1ET9A 1HA6A 2IJ0A 4G7HC 5M5XB 1Y69U 4KV6A 5LL6S 1GJXA 1EWCA 2K1BA 2A68C 2DY7A 3DWQA 4OIKA 1DONA 1SYCA 3BYYB 3P20A 1TY2A 3JAML 4XTCS 5C5LA 3I90A 3MFGA 5CR3A 2F3WA 1TR5A 2SNSA 2EYJA 5M3FB 2AUKA 1R4PB 3T56B 3OW7A 3LWEA 3K7AB 3SXHA 4RA8A 2EOTA 3TSSA 3R3OA 2PMZB 1HUMA 5DM73 4CKEA 3NTIA 4BS9A 4A3DB 4K8IA 2R93B 1TWGB 3D6WA 1ILPA 4C3IB 3EQLC 1PXUA 1ONLA 1AEXA 4KN7C 2EY5A 4K2LA 1QJOA 3NQIA 3I72A 3HG9A 3M3YB 2ICIA 5K5PA 2LMCB 3MXPA 5EJWA 1TS4A 5DAUA 2H1EA 3PUXA 3GO5A 1TVXA 2QF7A 1H9SA 3M7NA 1H9KA 4KMUC 4FXGC 2H4OA 1B50A 1AW7A 3SK4A 4DAPA 5KYLA 4FNFA 4ZUJA 2NBFA 4X3SA 2F0UA 2O4XA 1IKMA 5IGGA 3N52A 1SNDA 3A54A 3RMHA 1LO5D 4C2MB 3OHXC 3CRKC 1EU4A 3P75A 5JOBA 4TQUS 1W6KA 3AU7A 4ODGA 3NK9A 1DZ1A 4DU9A 3L3OC 5KYIA 1LT4D 1SNMA 1BBXC 5HGTA 5BN3A 3VA5A 3GTMB 1HFGA 1RDPD 1OO9B 1LTTD 3MHBA 3ONAB 1MD2D 2QCPX 2K01A 1CZGA 3J7YW 4H0LC 1JOQA 3SE0A 1M4VA 3MFYA 2F0TA 1HXYD 4G7OC 1GUNA 3GV6A 1WD1A 1TS5A 1PDQA 2EY2A 4C3JG 2JYOA 3LX0A 4K8JA 5F2DA 5JPMC 5J1ZA 3VA7A 3WOFA 1Z47A 1LTRD 2MGSA 4L63B 3L9AX 4A3EB 1RODA 3G6JB 3GTPB 4QIWB 1SJHD 4PNYA 1FNUA 2MJ8A 3EVQA 2RSNA 2D5DA 4IFDH 2B2UC 1WCMB 3CHBD 2AQ1B 3OMCA 3VR6A 1SBBB 2KECA 1TWAB 2JXMB 2KA7A 3V96A 5G3LF 4DN4M 1B9MA 4KN4C 3FMCA 2KEEA 1KDBA 4EQNA 3QIAA 1SJED 2NN6G 5IGCA 3GQBA 1KLGD 1PZJD 1D6EC 4P2CB 3Q0AA 1EYCA 5JEAH 2XSCA 4HAEA 1EY4A 4UDUC 4M1UB 3HOWB 1PFBA 4HR7B 2K03A 3ND9A 3QWNA 4NW2A 2NVXB 1BCPD 2B2VC 1IW7C 1QE6A 1BO0A 1NR2A 3GP7A 4F7XA 2NWGA 2K28A 2B63B 3GTKB 4ULLA 2F0FA 4H13C 1K8OA 1MBYA 3DEPA 3DMUA 3A56A 1ZYRD 4FVMA 4U68A 3ZYYX 1CFMA 2VNUD 5IGEA 4KY6A 2K5WA 3MXGA 2JE6I 2L4NA 1QOHA 1GXDC 1I6HB 5C0XH 4H44C 1BCPF 3PO2B 1TKWB 4PV1C 1T5EA 4LK1C 2EXZA 3BDCA 3QO2A 1MI2A 4BWGB 3QOLA 1SE2A 3Q22A 5K36G 2VB2X 2Z8LA 3VYUA 1ILQA 1ICWA 3GD7A 4KI0A 2BDOA 2D2CC 3TN2A 1KAAA 1BNZA 2O5JC 4PMWA 1VCIA 2C9OA 4FXDA 1JICA 2RSOA 1SYEA 5HURA 3DWAA 3VR2A 2B2WA 1I4HA 3V2TA 1G6ZA 2X6LA 1H9SB 1CA6A 4ZAIA 2HQEA 1TT2A 1BOSA 4GZYC 2D62A 4IUNA 3S9WA 1C4QA 3K57A 3S1RB 2RBMA 4XYOA 3W2DA 2KOLA 1PTOD 1PRTB 2JA7B 3MC0B 3NQTA 3I91A 3MEHA 2RKSA 3AB9A 5E1FA 1SMYD 3BVZA 4NP5A 4TSSA 2AWNA 5JJZA 5I9OA 5IT9L 3HP3A 4PMCA 2Y0SB 1LT3D 5IGBA 4NMZA 3S2HB 2PCFB 2Z4HA 3H0GB 1RF2D 4FF4A 4K2KA 3L7ZC 3HS0C 4OGQC 4ZK9B 1X3QA 4RKBA 5EBDA 3M85A 4C3IG 2WB1B 5IT9E 1A2TA 4RCNA 5I2YA 1S5DD 4ZLTF 4R9WA 5JEAG 5CBEE 3T16A 3FEWX 5KIXA 3HOVB 1YNNC 1JB3A 5FLXL 3OPOA 2QEJC 1Y1VB 5ELEA 2IT1A 3TDQA 4FF3A 1OXSC 3J81L 3ITPA 1DOKA 2TMPA 2L9HA 1PFNA 1Y8NB 2ZXPA 1EY8A 4BY7B 1XWEA 5CBAE 2KJXA 2A73B 1YNJD 2KUMA 2PW7A 5CORA 1U4MA 1CHPD 1SDFA 1IHZA 2HCIA 1G291 1TWFB 1PTOC 1KLUD 5FLXE 1C48A 3A8IE 1H9RA 5TSSA 1R4QB 1STEA 3J81E 1SMYC 4L6TB 2EYFA 2NN6I 2K04A 5FO7B 3EFXD 2G9DA 2IWHA 2B2TC 2K5DA 5T1IA 3IAYA 3R2IA 5CGKA 4BBSB 1NAPA 4Q5VA 1F9PA 1DD2A 3I4NB 3U9OA 1WTOA 5I2XA 4M8AA 2F0MA 1PZKD 3EA6A 2PZUA 4Q0FA 2CVRA 4LMQD 3QOJA 1GUGA 5M9OA 4ILWA 4JBWA 5CV8A 4NKLA 4LAAA 1EIHA 1STBA 2EPBA 1WD0A 2XIWA 3NP8A 3K5LA 3K59A 3D4WA 4I65A 4V0BA 2F0HA 1BF4A 3K58A 3S14B 3IFDA 3A8JE 1HTPA 2BA1A 1EU3A 3NXWA 3CRLC 4K5VA 2OT2A 1A3VA 1JC7A 3D8GA 4RGOS 1HQRD 3NUCA 3H94A 3GV3A 2HDMA 1RTOA 4DAVA 4RGNA 1JOKA 2L1BA 1I6VC 1SSOA 4KHZA 2E2HB 4FYDA 2EYOA 5CC4A 3BDOA 5ELFA 4DK1A 2JEBI 1HFNA 4ABNA 3RD4A 5ELDA 2JEAI 2M9VA 4CKBA 3MZ5A 3NWSA 2MUYA 4X3UA 1WTPA 1RKNA 1J8IA 1LT5D 2JA8B 4KHVA 1LTAD 1IKLA 4J8QA 4KTAA 1O80A 2RQXA 3VYSA 3DXJC 1STYA 1V8QA 3S17B 1QG7A 2K5QA 5KNDA 4HTHA 1I4GA 1QNUA 2Q8RE 1S5BD 1RD9D 2Z1CA 3PV0A 4XQNA 4ZYSA 2EY6A 4BY1B 2AUJD 3VR3A 2F1MA 4X3TA 1F2LA 5E3FA 3LNNA 3X3MA 2XWBB 5D65A 5ISRA 1E2VA 5D14A 2D9UA 1OXTA 1W6JA 5FO8B 2EZVA 1A3UA 2L12A 4K14A 2B8GA 1FNWA 1I4XA 1LACA 4OHJA 3T13A 3KBGA 1SYBA 4KD4A 4RGMA 1UUPA 2CQAA 5FKAC 1LLRD 5C44B 4XXEA 1BUVT 4DAYA 4IUVA 5LL6X 4E6IA 3J7AV 5JEAJ 3K0YA 3GTQB 4XT3B 2M00A 2F0OA 3MA2B 2DY8A 2E2IB 3MXUA 3H91A 4QF4A 4PQXA 2XNAC 4RHRA 3R8BA 4DK0A 2E75C 5IIFA 1Q12A 3M7GA 1F2YA 4A3BB 4WORA 4CGYB 2KHSA 3VR4A 1CTMA 2SNMA 4HEDA 2MHVA 1J9OA 2BA0A 4IALA 4OO1H 1D1KA 4N9PA 4RAUC 1GUWA 1MSHA 5G3LD 3I8ZA 1TS3A 5CYUA 5EPKA 3T53B 4ZKCB 4A3MB 1TIID 2JSOA 1SE3A 5LHY1 5JVG3 2EVBA 4DXFA 1WTQA 3C3LA 2PYKA 3VYTA 2QDBA 2EYHA 3MTSA 1DYQA 2K05A 2FMMA 3LWUA 1IYVA 4RWSC 1EY5A 1H9JA 3E0JA 1XX8A 1EQVA 2R6GA 1PMRA 1SFOB 1JCKB 1B53A 1C8CA 2CHBD 2IX1A 2B2YC 1CI3M 4MHEA 4OL7A 3MVVA 1EZ8A 4BA2I 1PYWD 3CQZB 1D5MC 1R9TB 3S1MB 5EKLA 3V05A 3ERQA 1F77A 2WV6D 3O13A 2A5HA 1HUNA 2XRSD 4HMJA 3PIO3 2IW3A 4IUUA 1FGBD 4Z9CB 1E2ZA 1U4RA 2DNEA 1GUTA 3GTOB 3KLSX 5C6AA 2ID0A 1ZEQX 2EE1A 1QCBD 2B2TA 3PUVA 2IL8A 1LTSD 3KUPA 1KDCA 5BN4A 2J4XA 1PRTD 1NCVA 2CW0D 1I4PA 4XDXA 2L11A 3OIPA 3HGBA 4CJ2C 2FHTA 1STGA 5DEHA 1VMCA 3TZDA 4A93B 1BQQT 3BVMA 1LTID 1QWYA 4XT1B 1I50B 3NHHA 3SR1A 5JPNC 1XTCD 2KCCA 3P7JA 1JR0D 2WP8J 3SHLA 3KF8A 3IKJA 1PRTF 4RHSA 1II3A 4KJNA 1FD7D 5C4JB 2VB3X 4R8IA 4CKCA 1HA5A 1TS2A 1X32A 2MP1A 1F9RA 4R8NA 4L8JA 1Z6HA 3DM1A 1Q1EA 1Q1BA 3NBHA 1WVLA 5J22A 1TWHB 5M5WB 1B1ZA 1ENCA 4ZQ3A 3QB3A 5E4XA 2RDGA 1MSGA 1BCPC 1TQOA 4EQPA 4J6HA 2I07B 3HOYB 3GTJB 2PZWA 1Y8PB 1EY6A 1AZQA 2YYZA 2ZXRA 3QG1A 1UAPA 4XQQA 4EQOA 2PW5A 2EJGC 1JE4A 2WACA 1EY7A 1F2ZA 2EYLA 1KABA 3PIP3 1E2WA 2F0EA 1ZYRC 1ESFA 3S1NB 2LY7A 4K6DA 2HCCA 2F0JA 3NBIA 4KKTA 1U4LA 2F0PA 1B2TA 4KJOA 2YU9B 4U673 2F0IA 3TBIB 4QMGA 2J0TD 1ET6A 2E2DC 4ME5A 1MGSA 4DF7A 4IFDG 4RKLA 1O7ZA 1OXUA 1SXTA 3OIQA 3FDTA 1AP0A 1LABA 3S15B 3PUZA 2XN9C 1S4ZA 2F0VA 3TP8A 1VF7A 2RDFA 3Q6SA 3I3CA 4N9TA 4CHTB 1SNOA 1EFID 1BR9A 2FJ2A 5CV7A 2E74C 3R2TA 1Q90A 2F03A 2JA6B 1D1IA 2DN8A 3NE5B 2F0DA 1GHKA 5KNCA 1KNEA 5C5MA 5KEEA 3RZDB 3I73A 3S16B 4X3KA 2C5CA 2F0NA 1BDOA 1SAPA 1DJRD 5C3XA 5EPLA 3TZUA 1ZKOA 1B44D 4HCSA 4DA2A 5KNBA 1Q8IA 4RGTA 1Y1WB 3BDLA 2HUGA 1CA5A 2EYPA 2OF1A 5C0XG 4G7ZC 2A68D 3PO3B 3M4YA 1F9QA 4A3GB 5J39A 4IZ8A 2EJMA 3BYTB 1U4PA 1WTVA 4KY5A 2L5TA 3HEJA 4K5WA 4TKOB 1EYDA 1F2MA 1PLFA 2A6ED 1TY0A 1SE4A 3DEOA 1SEBD 4KK7A 1EL0A 1RHPA 3KK7A 2LKVA 1STAA 3KLSA 4BA1I 2ZT9C 3PMFA 3M4OB 3F2UA 1G8ZD 2NB0A 2XWJB 1CHQD 2J7ZA 3TP5A 2B2UA 4LJZC 1LTBD 1DOLA 1JQYD 4FF2A 1YNJC 1GUOA 4C56C 2ZXOA 2EY1A 2B2YA 1X3PA 3OWEB 2NTTA 3RUZA 5CV4A 2M2LA 3G7LA 4F8MA 1VF5C 5D3IB 4ID6A 2E76C 5C4XB 2FINB 3E6ZX 2F0KA 3FKIB 1HRJA 2Q8IB 1JOOA 5D3DA 3VYRA 4HCEA 4EGVA 3FVQA 2F0WA 4KY7A 5IGDA 3U9SA 1QILA 2F0GA 2B2VA 4O1NA 2LFNA 5IGFA 1IL8A 3E5SA 3BS1A 5EPJA 3I4LA 4B9XA 4C1NK 2Z4IA 1QNKA 2B2WC 2A6EC 3D3RA 4KD3A 3W3AA 4OO1I 4DGZA 2R3ZA 3EROA 3K5NA 2IPKD 4JK1C 1EYAA 5CV5A 3MXNA 2LS01 1O7LA 2PO4A 3Q24A 4IUQA 1E0BA 1JORA 3KBXA 1UNSA 2FFKB 3BZDB 3JAME 1K8MA 2NN6H 1FR3A 2NVQB 4C3HB 5CV9A 4QCLA 3HOZB 1EOTA 3K5MA 2WINB 5FK9C 1Z7TA 1GHJA 3C2PA 5C4ZA 3SK5A 1L0YB 2NVYB 4A3JB 4IFDI 2RVLA 4A3FB 2XVSA 3C46A 2VUMB 2WIIB 4IFDJ 1B4OA 5EBCA 1T5XD 1DXMA 4WRDA 4IUTA 1KNAA 4FXKC 1S5CD 2RDHA 3TP6A 3AMUA 2X69A 2A69D 1NR4A 5DNFA 5EGTA 4IQZA 2B39A 3SK8A 2JP1A 1A15A 3C1FA 4QUFA 1HCZA 1PTOH 2I46A 3IL8A 2PQEA 2F0SA 3MWYW 2F3VA 3K5OA 1G91A 4B9WA 1OXVA 2A74C 5C3EB 3OOCA 4RH6A 4H7BA 1K83B 3A55A 3QJYA 2K33A 5IODA 1SYFA 2K6AA 3J80L 5EKIA 3URYA 5K36H 1EEFD 4XQJA 1I4QA 1HQMC 3D6CA 1VMPA 1HHVA 3EJIA 1A3TA 1SNCA 3RLFA 3RZOB 3CKIB 2KEDA 2NVTB 1B9NA 2RA4A 1RCVD 5C0XI 4FF1A 4CJ0B 4DXGA 1A6XA 3J80E 1FNVA 1I3QB 5C0XJ 1IW7D 2WAQB 3DUZA 2KQ3A 3J7AF 2XRQD 3D4DA 2AQ3B 2A69C 1SNPA 3T4AC 2F4IA 2MPMA 4MN3A 4OIJA 2DNCA 1CT1D 4YIJA 5I9PA 5BN5A 1V43A 3T51B 3HOXB 2O2LD 4RCOA 4DNTB 3VR5A 3OWFA 1WTRA 1UEAB 2E2JB 1ENFA 3TMEA 2IX3A 4HSPA 4HSVA 2ENBA 2BDNA 1STNA 5EQ0A 5CV6A 1M8AA 1CQFA 2BOSA 3SEBA 1EZ6A 1D5XC 1WTXA 4MIUA 4FO2A 3WDNA 1ENAA 1A2UA 1JWUD 1S5FD 1CM9A 3KLRA 3N6RA 4KKUA 2EDGA 4V190 3I4MB 4S3SA 1DM0B 2L55A 1ESRA 2B8FA 2O5IC 2Q8TA 3BG3A 1AN8A 1D2BA 1DCZA 2KVMA 3K6OA 1NSNS 1PZID 4QB4A 1STHA 4ZRZA 2NYZD 2PPBC 2R7ZB 5I6WA 1TWCB 1L0XB 2V4DA 1F9SA 4IURA 2K7VA 3Q23A 4QUCA 1V1PA 1O78A 4C1NI 1CQVA 3DWPA 2BCOA 1GOZA 3D4RA 4ZKBB 1RTNA 3NWTA 1D5ZC 3A7AB 5I6YA 3CU7A 2NZ1D 5JVH3 3GTLB 2TSSA 3S2DB 1V1OA 2JA5B 3A7LA 5FOBB 5M3MB 3NPPA 5FO9B 4BBRB 4K6LA 1LV9A 1EY0A 4A3KB 1HTLD 1SNQA 4NDXA 2F0LA 3NTHA 3ND8A 4KKSA 5KRUA 2EJFC 2L0CA 3D31A 2SEBD 1XXGA 3PUYA 3A8KE 1FYCA 1WTWA 4CJ1B 2QKIC 1EQTA 3H6MA 1JWSD 2NUCA 5JAVA 2ICEC 3IFTA 5EKKA 3X3NA 5ELCA 4AYBB 4XYQA 4EVOA 1HPCA 2F0QA 3WOEA 1JWMD 5ELBA 4OO1G 2WKCA 1PRTC 2A6HD 1YNND 2CW0C 2GA4B 4TRDA 3SVMA 2AQ2B 1U9RA 1KDAA 2WKDA 4DFAA 3S1QB 1BCPB 1GUSA 2EYMA 1TU2B 5COYA 1S5ED 1AFPA 3R93A 4C3JB 1BXTA 3TP7A 4I7ZC 4F88A 3GTGB 3HZXA 5NUCA 2KCNA 4J1MA 4HMIA 2PZTA 1QB5D 3SK6A 3P1HA 1XYIA 4B08A 3PUWA 5IOCA 3NTKA 4DNRB 1LTGD 5A2QL 2QILA 2IX0A 3HOUB 4WJWA 2OEOA 1Y8OB 1PFMA 5M5YB 2VXWA 1Q3LA 3HRZC 3H3VC 4IN3A 2BE5D 4C3HG 4ZUIA 5C3WA 3I70A 3FRPB 1PTOF 3DHQA 4O42A 4FP5D 1CK1A 4WFN3 5C4HA 5E4WC 4UAIA 2A6HC 5A2QE 2N55A 1VDZA 3OSOA 1DOMA 2HDLA 5KGUA 3MAQA 1B3AA 1EIGA 1H9MA 4HN7A 5T1GA 4CBVA 4RFBA 2FMCA 2X6GA 3FPPA 1OXXK 3NSWA 1G2TA 3H09A 5A35A 3SDZA 3BVGA 4A3IB 2G9HD 4G57A 1PTOB 3C1EA 1G2SA 1LT6D 1IYUA 2SDFA 2PNRC 3FPUB 3OMGA 4F87A 1ZXTA 2R92B 4XIGS 1RJTA 4Y7NB 2BE5C 1SYDA 5DM63 5I4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0D A;  5EKL A;  5EGT A;  1SYG A;  1EY9 A;  1TQO A;  2EYF A;  2F0O A;  2F0T A;  3ERQ A;  4J6H A;  5CV4 A;  4YIJ A;  3RUZ A;  4F8M A;  5I9P A;  2OEO A;  5C5M A;  1AEX A;  2PZW A;  3MZ5 A;  1EY6 A;  2EY5 A;  3NQT A;  4ID6 A;  4K2L A;  1RKN A;  5KEE A;  3SK8 A;  3C1F A;  3DMU A;  2F0K A;  2SOB A;  3MEH A;  2RKS A;  4HMJ A;  4KHV A;  4EQO A;  3OWF A;  4K5X A;  5E1F A;  4QF4 A;  2PW5 A;  5K5P A;  4ZUI A;  4NP5 A;  1JOO A;  2F0N A;  5C3W A;  3H6M A;  3TME A;  2WAC A;  4KTA A;  5IGE A;  4KY6 A;  2NUC A;  3MXP A;  5I9O A;  2EY2 A;  5JAV A;  2F0W A;  2PQE A;  4KY7 A;  5C6A A;  3DHQ A;  5IIF A;  2ENB A;  5EKK A;  1STN A;  3LX0 A;  4PMC A;  2F0S A;  5C3X A;  4K8J A;  1EY7 A;  1F2Z A;  2EYL A;  1KAB A;  4PMB A;  5CGK A;  5IGD A;  5CV6 A;  1F2Y A;  2F0E A;  5F2D A;  5J1Z A;  2F3V A;  1EZ6 A;  2F0G A;  4WOR A;  5IGB A;  4B9W A;  1KDC A;  4MIU A;  5C4H A;  1STY A;  4EVO A;  1ENA A;  2OXP A;  5IGF A;  4K6D A;  1A2U A;  2KHS A;  5DAU A;  2F0J A;  3BDL A;  4NMZ A;  1NUC A;  3E5S A;  2EYP A;  2SNM A;  2OF1 A;  4HTH A;  2F0Q A;  2F0P A;  4IAL A;  4KJO A;  3U9O A;  4S3S A;  4H7B A;  2F0I A;  4N9P A;  4K2K A;  2EXZ A;  3OSO A;  4KV6 A;  3SK4 A;  1SYF A;  4QMG A;  4PNY A;  4B9X A;  3BDC A;  5J39 A;  3EVQ A;  5KRU A;  4IZ8 A;  2F0M A;  4RKB A;  3QOL A;  5KYL A;  2PZU A;  2EY6 A;  1NSN S;  5KGU A;  4TRD A;  4KD3 A;  4ME5 A;  3QOJ A;  4KY5 A;  4QB4 A;  1STH A;  1A2T A;  4DGZ A;  3HEJ A;  1STG A;  3D6C A;  4DF7 A;  4K5W A;  3ERO A;  5DEH A;  4ZUJ A;  4RKL A;  5M9O A;  1EYD A;  2F0U A;  1F2M A;  2O4X A;  3OMC A;  5CV8 A;  5E3F A;  1EYA A;  3EJI A;  5I6W A;  1U9R A;  1A3T A;  1SNC A;  4NKL A;  5IGG A;  5CV5 A;  4LAA A;  5ISR A;  1SYC A;  1KDA A;  1SND A;  3T16 A;  5KIX A;  1STB A;  4DFA A;  1JOR A;  2LKV A;  3NP8 A;  3NHH A;  3SR1 A;  3D4W A;  4I65 A;  1KAA A;  5C5L A;  2F0H A;  2PYK A;  5CR3 A;  1STA A;  2QDB A;  3P75 A;  2EYH A;  5JOB A;  1KDB A;  4EQN A;  2EYM A;  3SHL A;  2F3W A;  1TR5 A;  2F0V A;  1SYE A;  5CV9 A;  3ITP A;  1A3U A;  5HUR A;  5IGC A;  4ODG A;  1II3 A;  5IOD A;  2SNS A;  2EYJ A;  3TP8 A;  3NXW A;  4KJN A;  3NK9 A;  5I6Y A;  4K14 A;  1EYC A;  4K5V A;  2RDF A;  4DU9 A;  1EY8 A;  3PMF A;  4G57 A;  5KYI A;  2KQ3 A;  1EY5 A;  3T13 A;  1EY4 A;  3TP7 A;  3C1E A;  1A3V A;  3V2T A;  3D4D A;  3SK5 A;  4N9T A;  3HZX A;  1EQV A;  3TP5 A;  1SYB A;  4KD4 A;  5C4Z A;  2PW7 A;  3D8G A;  1SNM A;  3SXH A;  1SNO A;  3NUC A;  5NUC A;  5HGT A;  4J1M A;  4HMI A;  4R8N A;  1SNP A;  3VA5 A;  4EQP A;  3R3O A;  1IHZ A;  2PZT A;  2HQE A;  1TT2 A;  3MHB A;  4OL7 A;  3MVV A;  1JOK A;  3OMG A;  1EZ8 A;  4WRD A;  5CV7 A;  5J22 A;  3SK6 A;  4E6I A;  1EY0 A;  4IUN A;  3P1H A;  4K8I A;  3S9W A;  2EYO A;  1SNQ A;  3TP6 A;  4F7X A;  5CC4 A;  4NDX A;  1ENC A;  1JOQ A;  4ZQ3 A;  2EY1 A;  2F0L A;  5IOC A;  3QB3 A;  2F0F A;  1SYD A;  2RBM A;  2M00 A; 
#chains in the Genus database with same CATH topology
 2YTV A;  1SYG A;  2VS1 A;  1EY9 A;  1YJW A;  3HKZ B;  3UI2 A;  2SOB A;  3OTO L;  2NTS A;  1CZW A;  1V1P B;  4K5X A;  4GKK L;  1KTK A;  1AZP A;  4JI0 L;  1O7Y A;  4GN4 B;  5AFW A;  2WAQ G;  4YY3 Q;  2OWO A;  2PMZ E;  2PI2 A;  1CKM A;  2K32 A;  4PMB A;  4IUP A;  1EWH A;  3S1Q H;  2AWO A;  1ML0 D;  4HIO A;  2OXP A;  1EEI D;  4B3T L;  4A4I A;  1NUC A;  1MIU A;  4P73 A;  2N8N A;  4GN5 A;  2R61 A;  2N88 A;  5CMD A;  1I4R A;  4G4K A;  4DAM A;  1ET9 A;  3E9I A;  1HA6 A;  2IJ0 A;  3GDE A;  4G7H C;  5M5X B;  1Y69 U;  4KV6 A;  4LF4 L;  5LL6 S;  1GJX A;  1EWC A;  3GTG H;  2K1B A;  2A68 C;  2DY7 A;  5ELO A;  3DWQ A;  1VQL A;  3HOX G;  4OIK A;  1EIY B;  4DR7 L;  2F4V L;  4CDF C;  1DON A;  4LFA Q;  1SYC A;  3BYY B;  3P20 A;  2CKZ B;  4N8X 1;  1TY2 A;  3JAM L;  4XTC S;  5C5L A;  3I90 A;  4JI8 Q;  1KRT A;  2QA4 A;  3MFG A;  3S2H H;  3NEM A;  5CR3 A;  3HOU H;  3KDF B;  3IRB A;  2F3W A;  1TR5 A;  4MTK A;  2SNS A;  2EYJ A;  5LMN Q;  4JI0 Q;  3A5Z B;  3I4M G;  5M3F B;  2AUK A;  1R4P B;  3T56 B;  2OQK A;  5IP7 H;  3OW7 A;  3LWE A;  3K7A B;  3SXH A;  4RA8 A;  2EOT A;  3TSS A;  2DUD A;  3R3O A;  2PMZ B;  1HUM A;  5DM7 3;  2R7Z G;  4CKE A;  5IYD G;  3NTI A;  4BS9 A;  4A3D B;  4K8I A;  2MQH A;  2R93 B;  3RR5 A;  4B3M L;  1TWG B;  3D6W A;  1ILP A;  4FDB A;  3DLL A;  1Y1V H;  1VQ6 A;  4C3I B;  3EQL C;  1PXU A;  1ONL A;  3CCQ A;  1AEX A;  4KN7 C;  2EY5 A;  4K2L A;  3MEF A;  1QJO A;  1B3Q A;  3NQI A;  3I72 A;  3HG9 A;  3QR8 A;  3M3Y B;  2ICI A;  5K5P A;  1XNR L;  2WFW A;  4BY7 H;  2LMC B;  2YV5 A;  3MXP A;  5EJW A;  4A93 G;  4DR3 Q;  2JA5 G;  1TS4 A;  1E24 A;  4WJ4 A;  5DAU A;  2H1E A;  2LSS A;  3PUX A;  4PZ7 A;  5M3M G;  4CDE C;  1N8R C;  1C0A A;  3GO5 A;  1TVX A;  4POF A;  2QF7 A;  1XPR A;  1H9S A;  3M7N A;  1H9K A;  4A3K G;  4KMU C;  4A3I H;  2KEN A;  2H4O A;  4FXG C;  1B50 A;  1AW7 A;  3SK4 A;  4DAP A;  1YJ9 A;  4IO9 A;  5KYL A;  4FNF A;  1QVF A;  1WJJ A;  4UPA A;  4ZUJ A;  2NBF A;  4X3S A;  2F0U A;  2O4X A;  1IKM A;  2HD3 A;  5IGG A;  3A0J A;  5IP9 G;  3N52 A;  4BBS H;  1SND A;  3A54 A;  1CUK A;  3KYH C;  3RMH A;  1LO5 D;  1NMG A;  1XMQ L;  4AYB G;  3OHX C;  3CRK C;  4C2M B;  4B3S L;  1EU4 A;  2IHE A;  4QIW E;  1PH9 A;  3P75 A;  1YHA A;  5JOB A;  4TQU S;  4IPH A;  1W6K A;  3I4N H;  3AU7 A;  2JJQ A;  4ODG A;  4JI4 Q;  3NK9 A;  5HY6 A;  2MNA A;  1DZ1 A;  4DU9 A;  3L3O C;  5KYI A;  1LT4 D;  1XMO L;  1SNM A;  2OCE A;  2MO0 A;  1BBX C;  5HGT A;  5BN3 A;  3WWV A;  3VA5 A;  3GTM B;  1HFG A;  1RDP D;  1OO9 B;  1L0W A;  4DV4 Q;  1LTT D;  4AQY Q;  3MHB A;  3ONA B;  1MD2 D;  2QCP X;  2K01 A;  1CZG A;  3J7Y W;  2UUA L;  4H0L C;  1JOQ A;  3SE0 A;  1N34 Q;  1M4V A;  2PI2 E;  3CD6 A;  3S14 H;  3MFY A;  2F0T A;  4LF6 L;  1HXY D;  4G7O C;  4JI6 Q;  1GUN A;  3GV6 A;  1WD1 A;  1TS5 A;  1PDQ A;  2EY2 A;  4C3J G;  2JYO A;  4R4C A;  3LX0 A;  4K8J A;  1PH8 A;  2GN5 A;  5F2D A;  5JPM C;  5J1Z A;  3VA7 A;  1HZC A;  1VS0 A;  3WOF A;  1X3E A;  4JYA Q;  1Z47 A;  3EN2 A;  1LTR D;  2MGS A;  1XJV A;  4L63 B;  2E2H H;  3L9A X;  4A3E B;  1ROD A;  3G6J B;  4DR6 L;  3GTP B;  4QIW B;  1SJH D;  2ES2 A;  4PNY A;  1FNU A;  2MJ8 A;  3EVQ A;  2I5M X;  1XMO Q;  2RSN A;  3CXC A;  1X3G A;  1QUQ A;  4X62 Q;  2D5D A;  4IFD H;  3HOU G;  2JA8 H;  2B2U C;  1WCM B;  4JI3 L;  3CHB D;  2AQ1 B;  4BXX H;  3OMC A;  3VR6 A;  1SBB B;  2KEC A;  2UUA Q;  1GM5 A;  1TWA B;  4MTN A;  1H95 A;  2R93 H;  4MNO A;  2JXM B;  2HIX A;  2KA7 A;  3V96 A;  3CPW A;  5IP7 G;  5G3L F;  4DN4 M;  1B9M A;  2KBN A;  4OWT B;  3U58 A;  4YWL A;  4KN4 C;  3FMC A;  3ULP A;  3S17 H;  2KEE A;  2K4K A;  1JMC A;  1KDB A;  4EQN A;  3QIA A;  1SJE D;  2NN6 G;  5IGC A;  3GQB A;  1KLG D;  2ZTE A;  1PZJ D;  4YHH Q;  3M3Y H;  1D6E C;  4P2C B;  4X65 L;  3Q0A A;  1EYC A;  5JEA H;  4OWW B;  1CKN A;  2XSC A;  3BU2 A;  1IBM L;  4LFC Q;  4HAE A;  1EY4 A;  4BY1 H;  4UDU C;  4M1U B;  3HOW B;  1PFB A;  4HR7 B;  2K03 A;  3ND9 A;  3QWN A;  4NW2 A;  2NVX B;  1BCP D;  2B2V C;  1IW7 C;  1YIT A;  1QE6 A;  2PNH A;  1BO0 A;  1AE2 A;  1NR2 A;  3GP7 A;  2UXB L;  4F7X A;  2NWG A;  2K28 A;  2B63 B;  3GTK B;  4ULL A;  2F0F A;  4H13 C;  1K8O A;  1MBY A;  3DEP A;  4QJF A;  3DMU A;  3A56 A;  1ZYR D;  4DR1 Q;  1PH4 A;  4FVM A;  4U68 A;  1CFM A;  3ZYY X;  2VNU D;  2CH4 W;  5IGE A;  3K0X A;  4KY6 A;  3J81 i;  2K5W A;  3MXG A;  2JE6 I;  2L4N A;  1N36 Q;  5FJ8 H;  1QOH A;  1GXD C;  2RF4 A;  1VQO A;  1I6H B;  5C0X H;  3K81 C;  4C2M H;  4H44 C;  1VQN A;  3AEV A;  1BCP F;  3PO2 B;  4JI1 Q;  1TKW B;  1VQ9 A;  4PV1 C;  1T5E A;  3GTQ H;  4LK1 C;  1RIP A;  2K50 A;  2R92 G;  2EXZ A;  1IBL L;  3BDC A;  3QO2 A;  1MI2 A;  4BWG B;  1HR0 W;  3QOL A;  5JJK A;  1SE2 A;  4GLV B;  3KDF A;  3Q22 A;  5IYC H;  3HKZ G;  5K36 G;  2VB2 X;  2Q2I A;  2Z8L A;  3VYU A;  3J7Z C;  1ILQ A;  2Y0S E;  1XPU A;  3LGJ A;  1ICW A;  1SN8 A;  5LMU L;  4DV3 Q;  3GD7 A;  1OTC A;  4KI0 A;  2BDO A;  2D2C C;  3TN2 A;  1KAA A;  2ZM6 Q;  1WYD A;  1BNZ A;  4LF7 Q;  2O5J C;  4PMW A;  4ALP A;  3K8A A;  1J6Q A;  1VCI A;  2C9O A;  3G6E A;  4FXD A;  1JIC A;  2RSO A;  1MHW C;  1SRU A;  1SYE A;  5HUR A;  1E7Z A;  1YVC A;  3DWA A;  3CC2 A;  3VR2 A;  2B2W A;  3J80 c;  1VQC A;  1I4H A;  1QZG A;  3V2T A;  2VQF L;  1G6Z A;  2X6L A;  1H9S B;  1CA6 A;  2UUC Q;  1D7Q A;  2BH8 A;  3I2Z A;  4ZAI A;  2HQE A;  1TT2 A;  4A3M H;  1UE1 A;  4QL5 A;  1BOS A;  4UY8 C;  4GZY C;  2D62 A;  4IUN A;  1L1O C;  3S9W A;  4OON A;  4GNX B;  1C4Q A;  3K57 A;  3S1R B;  2RBM A;  4DV7 L;  4XYO A;  3W2D A;  2KOL A;  1PTO D;  1PRT B;  2JA7 B;  3MC0 B;  4YCW A;  3NQT A;  2OTL A;  4P72 A;  3I91 A;  3MEH A;  2RKS A;  3K7U C;  1WCM H;  3AB9 A;  5E1F A;  4DAY B;  1SMY D;  3BVZ A;  4NP5 A;  3OW2 A;  4TSS A;  2AWN A;  5IWA L;  2Q2T A;  1WOC A;  5JJZ A;  4RG1 A;  2LXK A;  5I9O A;  5M3F G;  4JI2 L;  5IT9 L;  1TWA H;  2F52 A;  1N32 L;  3HP3 A;  4PMC A;  4IPD A;  2Y0S B;  1LT3 D;  2EQS A;  5IGB A;  4EX5 A;  4NMZ A;  3S2H B;  1Y14 B;  3CQZ H;  4R4I A;  2PCF B;  2Z4H A;  3H0G B;  1R9T H;  1RF2 D;  4A3D G;  2R93 G;  4FF4 A;  3AQQ A;  4K2K A;  2HHH Q;  1V1Q A;  3L7Z C;  3HS0 C;  4OGQ C;  3M9B A;  2E5L Q;  4ZK9 B;  1WI5 A;  1X3Q A;  4RKB A;  5EBD A;  3M85 A;  4C3I G;  2WB1 B;  2Z0S A;  3HOW H;  5IT9 E;  1A2T A;  2Z6K C;  1Q8K A;  4RCN A;  4JBJ A;  2NVX H;  5I2Y A;  1S5D D;  4ZLT F;  1N33 Q;  4R9W A;  3GTO H;  1SLJ A;  5JEA G;  1IL2 A;  5CBE E;  4LUZ A;  3T16 A;  3FEW X;  5KIX A;  3HOV B;  1YNN C;  2DJG C;  4DV7 Q;  4LFB L;  1JB3 A;  2ZTD A;  3GTK H;  4NXM Q;  5FLX L;  3OPO A;  2QEJ C;  1Y1V B;  5ELE A;  4DV2 Q;  4GLX A;  2IT1 A;  3TDQ A;  2GVB A;  4FF3 A;  1A8V A;  1HZB A;  1VQ5 A;  4JOI A;  1OXS C;  3J81 L;  3ITP A;  1DOK A;  1SR3 A;  1X54 A;  3BZC A;  2TMP A;  3BZK A;  2L9H A;  1PFN A;  1Y8N B;  2ZXP A;  1EY8 A;  4BY7 B;  1XWE A;  5CBA E;  2KJX A;  2A73 B;  1YNJ D;  4X66 Q;  2KUM A;  2PW7 A;  4X64 L;  5COR A;  1U4M A;  3TQY A;  5AJ3 Q;  4YY3 L;  1CHP D;  1SDF A;  1IHZ A;  2HCI A;  1G29 1;  1TWF B;  1PTO C;  2QEX A;  1KLU D;  5FLX E;  1C48 A;  2CWA A;  3A8I E;  3EBE A;  1QUQ B;  1H9R A;  5TSS A;  1SE8 A;  1R4Q B;  2ZJP A;  1STE A;  3J81 E;  1Q81 C;  1SMY C;  3FHW A;  4L6T B;  5FJ8 G;  3KJO A;  2EYF A;  2NN6 I;  2K04 A;  4LW1 A;  5FO7 B;  2QGQ A;  3EFX D;  4H02 A;  1P8L A;  2G9D A;  2IWH A;  2B2T C;  2K5D A;  3F2D A;  1HJP A;  5T1I A;  3IAY A;  4LFB Q;  3R2I A;  5CGK A;  4BBS B;  1NAP A;  4LFA L;  1EIF A;  1HNZ Q;  3G4S A;  5IYC G;  4Q5V A;  1CKN B;  3CF5 A;  1F9P A;  3PQI A;  4JI8 L;  1VQ7 A;  1DD2 A;  3I4N B;  3U9O A;  3FP9 A;  5I2X A;  1WTO A;  2I0Q A;  3A5U A;  4M8A A;  3HOY H;  5LMN L;  2F0M A;  4X64 Q;  4JW0 A;  1PZK D;  3EA6 A;  2PZU A;  4Q0F A;  2CVR A;  4LMQ D;  2ZJQ A;  3QOJ A;  3H15 A;  1GUG A;  3AYH B;  5M9O A;  4ILW A;  4JBW A;  5CV8 A;  4NKL A;  4LAA A;  1EIH A;  3CP0 A;  1E3P A;  1STB A;  2EPB A;  1WD0 A;  3RLO A;  2XIW A;  3NP8 A;  1YBY A;  3K5L A;  3S1N H;  3S1R H;  3K59 A;  1CKO A;  3D4W A;  4I65 A;  4V0B A;  2F0H A;  1BF4 A;  3K58 A;  3S14 B;  3IFD A;  5FLM H;  2JA7 H;  3A8J E;  1HTP A;  1A0I A;  1NJI C;  3KJP A;  2BA1 A;  2YU9 H;  1EU3 A;  4A3E G;  2GVA A;  3NXW A;  3CRL C;  4K5V A;  4R4Q A;  1C7Y A;  1HNW Q;  2OT2 A;  1A3V A;  1JC7 A;  3CMA A;  3D8G A;  4RGO S;  1HQR D;  3NUC A;  3CCU A;  3H94 A;  3GV3 A;  2HDM A;  3KOJ A;  1RTO A;  4DAV A;  4DR3 L;  2F3I A;  4RGN A;  1JOK A;  2L1B A;  1I6V C;  1SSO A;  4KHZ A;  2E2H B;  4JVZ A;  4FYD A;  4L5T A;  2EYO A;  5CC4 A;  3BDO A;  3H0G H;  5ELF A;  4DK1 A;  2JEB I;  1KAW A;  4ABN A;  1YIJ A;  4A76 A;  1HFN A;  3RD4 A;  5ELD A;  4POG A;  1M1K C;  2JEA I;  2M9V A;  4CKB A;  3MZ5 A;  3JC6 6;  3NWS A;  2MUY A;  1Q82 C;  4X3U A;  1WTP A;  1RKN A;  1J8I A;  1LT5 D;  4ME3 A;  2YTX A;  2JA8 B;  4KHV A;  1U0L A;  1X65 A;  1LTA D;  4JI5 Q;  1IKL A;  4J8Q A;  4KTA A;  4HJ5 A;  3HOV H;  1O80 A;  1AE3 A;  2RQX A;  3VYS A;  5GAD C;  3DXJ C;  1STY A;  1V8Q A;  1VQJ A;  4R4O A;  2N3S A;  3S17 B;  1QG7 A;  2K5Q A;  5KND A;  4HTH A;  1KC8 C;  3H3V H;  1I4G A;  1QNU A;  2Q8R E;  1S5B D;  3U50 C;  4ZCK A;  2B63 G;  1RD9 D;  2Z1C A;  4JI4 L;  3PV0 A;  4XQN A;  4HID A;  4GOP C;  3S16 H;  4ZYS A;  2EY6 A;  4BY1 B;  2AUJ D;  3VR3 A;  4DK3 C;  2F1M A;  4X3T A;  1F2L A;  5E3F A;  3LNN A;  1TWF H;  3X3M A;  2XWB B;  5D65 A;  5ISR A;  1X9N A;  1G6P A;  4DV4 L;  1E2V A;  1LYL A;  4AQY L;  3L2P A;  1X56 A;  3CCL A;  4OX9 Q;  2OTJ A;  4BBR G;  5D14 A;  2D9U A;  1OXT A;  2Z9H A;  1W6J A;  5FO8 B;  1N34 L;  2EZV A;  1KL9 A;  3STB D;  1VQM A;  1A3U A;  2L12 A;  4GNX A;  3PO2 G;  1FL0 A;  4A3G H;  1K3R A;  2B8G A;  4K14 A;  1FNW A;  1I4X A;  1LAC A;  4JPB W;  4OHJ A;  3T13 A;  2WAQ E;  4JI6 L;  1E22 A;  3KBG A;  1Q86 C;  1SYB A;  4KD4 A;  4RGM A;  1VQI A;  2K52 A;  1UUP A;  2CWP A;  2CQA A;  5FKA C;  1LLR D;  5C44 B;  4DR5 L;  4XXE A;  1BUV T;  4DAY A;  4IUV A;  4DR2 Q;  4GKJ Q;  5LL6 X;  4E6I A;  2D0P A;  3J7A V;  3KLW A;  2ZTC A;  4JYA L;  5JEA J;  4GLA C;  3K0Y A;  2PQA B;  3GTQ B;  4LF9 Q;  4XT3 B;  4CDD C;  3CC7 A;  2M00 A;  2F0O A;  3MA2 B;  2DY8 A;  1L1O A;  1HNX Q;  1PH7 A;  2E2I B;  1UE7 A;  2K5V A;  2HQL A;  4X62 L;  3MXU A;  3H91 A;  4QF4 A;  5GQO A;  4PQX A;  2XNA C;  4NPS A;  1DGS A;  4RHR A;  3R8B A;  4DK0 A;  2VZA A;  2E75 C;  5IIF A;  4UHV A;  1Q12 A;  2XGT A;  1QZH A;  3M7G A;  1F2Y A;  3F2C A;  4A3B B;  4WOR A;  5GRO A;  4CGY B;  5IYB H;  1HR0 Q;  4N8F A;  2KHS A;  3VR4 A;  1CTM A;  2SNM A;  4HED A;  2MHV A;  1J9O A;  2BA0 A;  1NMF A;  4IAL A;  4OO1 H;  1D1K A;  1PVO A;  4N9P A;  4RAU C;  4DUY Q;  1GUW A;  4YHH L;  1MSH A;  5G3L D;  5C4X H;  4LFC L;  3FKI H;  4AIM A;  1MJE A;  2JA7 G;  2IY5 B;  4DR5 Q;  3I8Z A;  1TS3 A;  4LWC A;  5CYU A;  5EPK A;  3T53 B;  4ZKC B;  4A3M B;  3HKS A;  1E1T A;  1T9H A;  3EIV A;  3I56 A;  1TII D;  5H1S E;  2RCF A;  2JSO A;  4DV6 Q;  3Q8D A;  1SE3 A;  5LHY 1;  5JVG 3;  2EVB A;  2UU9 Q;  4DXF A;  1WTQ A;  3C3L A;  4P71 A;  2PYK A;  2Y0S G;  3VYT A;  2QDB A;  2EYH A;  3UE0 A;  4B3R Q;  3MTS A;  1VQH A;  4LUV A;  1DYQ A;  2K05 A;  2FMM A;  3H0G G;  1HZ9 A;  3LWU A;  1IYV A;  4RWS C;  1EY5 A;  2ALY B;  4DR1 L;  1H9J A;  3E0J A;  1XX8 A;  1EQV A;  2QDL A;  2R6G A;  1PMR A;  1SFO B;  1JCK B;  1ASY A;  1B53 A;  2WB1 G;  1C8C A;  2CHB D;  1N36 L;  2IX1 A;  2B2Y C;  1CI3 M;  4MHE A;  1SRO A;  3W5O A;  4JV5 Q;  4OL7 A;  3MVV A;  1EZ8 A;  4BA2 I;  1PYW D;  3A74 A;  4DV5 Q;  3CQZ B;  1D5M C;  4JI1 L;  3W1G A;  3JAM c;  1R9T B;  3HOV G;  3S1M B;  5EKL A;  3V05 A;  3ERQ A;  4P75 A;  1F77 A;  2WV6 D;  3O13 A;  2A5H A;  1HUN A;  2CQO A;  2XRS D;  1Y1V G;  4QY7 A;  4IPG A;  4HMJ A;  3PIO 3;  2K75 A;  3CPF A;  2IW3 A;  4IUU A;  4A3L H;  1VQB A;  1FGB D;  4Z9C B;  1E2Z A;  1U4R A;  2DNE A;  1GUT A;  3GTO B;  3KLS X;  5C6A A;  4R4T A;  4BY7 G;  2ID0 A;  1ZEQ X;  2EE1 A;  1QCB D;  1FVI A;  2B2T A;  3PUV A;  4A3F H;  1P16 A;  2IL8 A;  1LTS D;  2JQO A;  3KUP A;  2VUM H;  1KDC A;  5BN4 A;  4DV3 L;  2J4X A;  4AYB E;  4K0K Q;  1PRT D;  2R7D A;  1NCV A;  2CW0 D;  1I4P A;  2ZM6 L;  4LF7 L;  4XDX A;  3ERS X;  2L11 A;  3SGI A;  3OIP A;  3HGB A;  1S40 A;  4A3C H;  1BKB A;  1W2B A;  4A3I G;  1RL2 A;  1ICF B;  4CJ2 C;  2FHT A;  2OQ0 A;  1MKH A;  4QQB X;  1STG A;  5C44 H;  5DEH A;  1VMC A;  2VQE Q;  3TZD A;  4A93 B;  2UUC L;  3U4V A;  2RCN A;  1BQQ T;  3BVM A;  1K28 A;  1LTI D;  1QWY A;  4LF8 L;  1E1O A;  4XT1 B;  1I50 B;  1Q46 A;  3NHH A;  3SR1 A;  4BBS G;  5L37 A;  5JPN C;  1FGU A;  1XTC D;  5C3E H;  2KCC A;  3P7J A;  3T1Y Q;  1JR0 D;  2WP8 J;  1KD1 C;  3SHL A;  2E2I H;  3KF8 A;  3IKJ A;  1PRT F;  4RHS A;  1K83 H;  1II3 A;  4DNI A;  4KJN A;  4LUO A;  1FD7 D;  3I4N G;  5C4J B;  2VB3 X;  1UWV A;  3T1H Q;  4R8I A;  4CDC C;  2B29 A;  4Y52 H;  2CFM A;  4CKC A;  1HA5 A;  1K9M C;  4A3B H;  1TS2 A;  1X32 A;  2MP1 A;  1F9R A;  1EUJ A;  4R8N A;  1NY4 A;  4L8J A;  1Z6H A;  1SMX A;  3DM1 A;  1VQ4 A;  1Q1E A;  1Q1B A;  3NBH A;  1WVL A;  5J22 A;  1TWH B;  3KF6 B;  2IHF A;  2NVT H;  5M5W B;  1B1Z A;  1FJG L;  2MFI A;  1ENC A;  4ZQ3 A;  3QB3 A;  5E4X A;  2RDG A;  1MSG A;  1BCP C;  1TQO A;  4EQP A;  4J6H A;  2I07 B;  1KQS A;  3HOY B;  2HHH L;  3GTJ B;  2PZW A;  1Y8P B;  1EY6 A;  4JC0 A;  5IYB G;  2YYZ A;  3CCS A;  1AZQ A;  2E5L L;  4JI7 Q;  2ZXR A;  3QG1 A;  1UAP A;  4OXP A;  4XQQ A;  4EQO A;  2PW5 A;  2ASB A;  4LF5 Q;  3UE1 A;  2EJG C;  1JE4 A;  2WAC A;  4LF8 Q;  5BR8 Q;  1EY7 A;  1F2Z A;  2EYL A;  1KAB A;  3PIP 3;  1N33 L;  1E2W A;  2F0E A;  1ZYR C;  1ESF A;  3S1N B;  2LY7 A;  1LUZ A;  4K6D A;  2HCC A;  2F0J A;  4NXM L;  3UDI A;  3NBI A;  4KKT A;  1U4L A;  3CAM A;  4DV2 L;  2F0P A;  1B2T A;  4KJO A;  2YU9 B;  4U67 3;  2F0I A;  3TBI B;  4QMG A;  1X6O A;  2YTY A;  2J0T D;  3W1B A;  1ET6 A;  2E2D C;  4ME5 A;  1SFO H;  1MGS A;  4I7A A;  5DM6 3;  4DF7 A;  4X66 L;  4IFD G;  4RKL A;  2JA8 G;  1O7Z A;  1OXU A;  1U5K A;  1SXT A;  5AJ3 L;  4GOP A;  3OIQ A;  1L1O B;  1J5E Q;  4BXX G;  1FJG Q;  3FDT A;  1AP0 A;  1QVC A;  1LAB A;  1X55 A;  3DM3 A;  3S15 B;  3E9H A;  3S1M H;  3PUZ A;  2XN9 C;  2Q2U A;  1S4Z A;  4KHP Q;  2F0V A;  3CCE A;  2PQA A;  3TP8 A;  1VF7 A;  2P5Z X;  2RDF A;  1CSQ A;  2EIF A;  3Q6S A;  3I3C A;  4N9T A;  4CHT B;  1IYJ B;  1SNO A;  1GVP A;  4BY1 G;  1YHQ A;  4HJ7 A;  2R7Z H;  5JJI A;  4OEM B;  1EFI D;  1BR9 A;  4OWX B;  1HNZ L;  2FXQ A;  1TWC H;  2FJ2 A;  5CV7 A;  2E74 C;  1EYG A;  3R2T A;  1Q90 A;  2F03 A;  2JA6 B;  1D1I A;  1JT8 A;  1BBW A;  1ASZ A;  2DN8 A;  3NE5 B;  1A63 A;  2F0D A;  4UP8 A;  1GHK A;  2B3G A;  5KNC A;  3J7A 5;  1KNE A;  5C5M A;  5KEE A;  3RZD B;  3I73 A;  4L5Q A;  3S16 B;  4HJ8 A;  3HKZ E;  4X3K A;  3U4Z A;  1IZ6 A;  1YHB A;  2C5C A;  2F0N A;  1PFS A;  3I4O A;  3GTL H;  4A93 H;  2KHJ A;  4HJ9 A;  2CH4 A;  3S2D H;  1BDO A;  1SAP A;  3CCV A;  3TRE A;  1DJR D;  1I50 H;  3M4P A;  5C3X A;  5EPL A;  3TZU A;  1NNX A;  4GN3 B;  4DR4 Q;  1ZKO A;  1B44 D;  4HCS A;  4DA2 A;  5KNB A;  1Q8I A;  4RGT A;  5C44 G;  1Y1W B;  1JB7 A;  2JN4 A;  3BDL A;  2HUG A;  1CA5 A;  2EYP A;  1I94 Q;  2I5L X;  2OF1 A;  5C0X G;  4G7Z C;  2A68 D;  3B6Y A;  3PO3 B;  2L15 A;  3M4Y A;  1F9Q A;  4A3G B;  5J39 A;  4IZ8 A;  1IXR A;  5C4J H;  2EJM A;  3BYT B;  1U4P A;  4QGU A;  1HNW L;  3H3V I;  1WTV A;  4KY5 A;  2L5T A;  3HEJ A;  1JJ2 A;  4K5W A;  3E3X A;  4TKO B;  1EYD A;  1F2M A;  1PLF A;  2A6E D;  1TY0 A;  1SE4 A;  3DEO A;  3CCR A;  4P74 A;  1SEB D;  1TWH H;  2DJF C;  4KK7 A;  1EL0 A;  1RHP A;  3KK7 A;  5M5W H;  2LKV A;  2MO1 A;  4A3B G;  1KXL A;  3PF4 A;  2EXD A;  1IBK Q;  1STA A;  1YEZ A;  3GTJ H;  3KLS A;  1K73 C;  4BA1 I;  3NEN A;  4YWK A;  1AH9 A;  1GD7 A;  3AFP A;  1VQG A;  2ZT9 C;  3PMF A;  1JJC B;  3M4O B;  3F2U A;  1G8Z D;  1B8A A;  2NB0 A;  2XWJ B;  4JI5 L;  1CHQ D;  4MZ9 A;  2J7Z A;  3TP5 A;  5E7N A;  1JE5 A;  1KRS A;  2B2U A;  4LJZ C;  3J80 i;  4DUZ Q;  1LTB D;  1DOL A;  1JQY D;  2ZJR A;  4FF2 A;  1YNJ C;  4A3M G;  1GUO A;  4YWM A;  4C56 C;  2ZXO A;  2EY1 A;  2B2Y A;  1X3P A;  3OYY A;  3OWE B;  2NTT A;  3RUZ A;  5CV4 A;  4APV A;  2M2L A;  3G7L A;  4F8M A;  2A1A A;  1VF5 C;  5D3I B;  4ID6 A;  4HIK A;  2E76 C;  5C4X B;  2FIN B;  3E6Z X;  2F0K A;  3FKI B;  1HRJ A;  2Q8I B;  5JJL A;  1S72 A;  1JOO A;  5D3D A;  4C3J H;  3VYR A;  4HCE A;  1WCM G;  4EGV A;  1W3S A;  3FVQ A;  4NB3 A;  2F0W A;  4KY7 A;  2VL6 A;  3KF8 B;  4DV0 Q;  1PYB A;  5IGD A;  3U9S A;  1QIL A;  2F0G A;  3S15 H;  2B2V A;  4O1N A;  4OX9 L;  2LFN A;  5IGF A;  1C9O A;  1IL8 A;  3E5S A;  3BS1 A;  5EPJ A;  3I4L A;  1EQR A;  1VQD A;  4B9X A;  4C1N K;  2Z4I A;  1QNK A;  2B2W C;  2A6E C;  5M5Y H;  3OTO Q;  3NBH B;  2R7F A;  3RN5 A;  4GKK Q;  1D8L A;  3D3R A;  2DGY A;  4KD3 A;  2H5X A;  3W3A A;  4OO1 I;  2Z6B A;  4DGZ A;  2R3Z A;  3ERO A;  3HOW G;  3K5N A;  2IPK D;  4JK1 C;  1EYA A;  5CV5 A;  3MXN A;  5HGQ A;  3ZJY C;  2LS0 1;  5IT9 c;  4A75 A;  1O7L A;  2PO4 A;  1CSP A;  3Q24 A;  4DR2 L;  4GKJ L;  4IUQ A;  5GAG C;  1E0B A;  1K8A C;  2JA6 H;  3KBX A;  1JOR A;  4B3T Q;  1K0S A;  3G71 A;  1UNS A;  2FFK B;  1S3O A;  3BZD B;  3JAM E;  1K8M A;  2NN6 H;  1FR3 A;  2NVQ B;  3UDX A;  4LF9 L;  3KF6 A;  3RZD H;  4C3H B;  5CV9 A;  4QCL A;  3HOZ B;  1EOT A;  5EAY A;  3K5M A;  1HNX L;  4LF4 Q;  2WIN B;  5FK9 C;  5J3B A;  1Z7T A;  3PCO B;  5GAH C;  2KHI A;  1QVG A;  1GHJ A;  3C2P A;  5C4Z A;  3SK5 A;  1L0Y B;  2NVY B;  4IPC A;  4A3J B;  4IFD I;  4DR7 Q;  2F4V Q;  2RVL A;  4A3F B;  2XVS A;  3C46 A;  2VUM B;  2WII B;  2E8G A;  1Y1W H;  1B4O A;  5EBC A;  1T5X D;  4IFD J;  1DXM A;  4WRD A;  4IUT A;  1KNA A;  1L2F A;  1VQF A;  3PO3 H;  1HR0 L;  4FXK C;  1S5C D;  2RDH A;  3TP6 A;  3AMU A;  2X69 A;  2A69 D;  1YJN A;  5GAE C;  5FLX c;  1VQP A;  1NR4 A;  5DNF A;  5EGT A;  4DK6 C;  4GOP B;  1A62 A;  3VDY A;  4IQZ A;  4DUY L;  2B39 A;  2AHO B;  3SK8 A;  2JP1 A;  1A15 A;  3C1F A;  3J81 c;  4QUF A;  3RNU A;  1HCZ A;  1PTO H;  2I46 A;  3IL8 A;  1YZ6 A;  2PQE A;  2F0S A;  2HIV A;  3MWY W;  1EOV A;  3AFQ A;  3D0F A;  2F3V A;  3K5O A;  1G91 A;  4B9W A;  4DV6 L;  1OXV A;  2A74 C;  5C3E B;  3K80 C;  2UU9 L;  4B3M Q;  2R92 H;  3OOC A;  4JOI C;  4RH6 A;  4Y7N H;  4H7B A;  1K83 B;  3A55 A;  3QJY A;  4B3R L;  2K33 A;  5IOD A;  1BBU A;  1SYF A;  2K6A A;  3J80 L;  5EKI A;  3M4O H;  3URY A;  5K36 H;  1EEF D;  1XNR Q;  3RN2 A;  4XQJ A;  1V9P A;  3HOY G;  1JJG A;  4X6A H;  1I4Q A;  1HQM C;  3D6C A;  5DLQ E;  1VMP A;  3BJU A;  1PA6 A;  1HHV A;  2JK8 A;  3EJI A;  4JCV E;  2K5H A;  1A3T A;  1SNC A;  1TXY A;  3F8T A;  3RLF A;  3RZO B;  1HZA A;  4JV5 L;  3CKI B;  2KED A;  2NVT B;  1B9N A;  2RA4 A;  1RCV D;  4DV5 L;  1B70 B;  5C0X I;  3I7F A;  4FF1 A;  4CJ0 B;  4DXG A;  1A6X A;  3J80 E;  4TVA B;  5M5X H;  1FNV A;  5FLM G;  2NZH A;  1I3Q B;  5C0X J;  1IW7 D;  2WAQ B;  3DUZ A;  2KQ3 A;  3PF5 A;  3J7A F;  1GO3 E;  3CCM A;  2XRQ D;  3D4D A;  3PGZ A;  2AQ3 B;  3STB C;  2Z6K A;  2A69 C;  1PV4 A;  5LMN W;  1SNP A;  2BH2 A;  3T4A C;  5ELN A;  2F4I A;  4RMF A;  3TS2 A;  2K14 A;  2MPM A;  4MN3 A;  3TEH B;  4K0K L;  4OIJ A;  1XMQ Q;  2AKW B;  4B3S Q;  2DNC A;  2VW9 A;  2VY3 A;  1CT1 D;  1PH2 A;  4YIJ A;  5I9P A;  4J15 A;  1LTL A;  5BN5 A;  1V43 A;  3T51 B;  3HOX B;  2O2L D;  4RCO A;  4DNT B;  3VR5 A;  4DV1 L;  1XNQ L;  3OWF A;  4IJL A;  5M3F H;  1WTR A;  1UEA B;  2E2J B;  1ENF A;  3TME A;  2IX3 A;  4HSP A;  1K3B C;  2VQE L;  4HSV A;  2ENB A;  2BDN A;  1STN A;  3K7A H;  1NTG A;  5EQ0 A;  5CV6 A;  3ULJ A;  1M8A A;  4GS3 A;  1CQF A;  2BOS A;  3SEB A;  1EZ6 A;  1D5X C;  1WTX A;  4MIU A;  4FO2 A;  3WDN A;  1ENA A;  1A2U A;  1JWU D;  2NVQ H;  1S5F D;  1CM9 A;  3KLR A;  3N6R A;  4A3D H;  4KKU A;  1WTH A;  2EDG A;  4C3H H;  2N78 A;  3G48 A;  3ER0 A;  1PYS B;  3T1Y L;  1VQ8 A;  4V19 0;  3I4M B;  1TWG H;  2A8V A;  3HOZ H;  4S3S A;  5IE8 A;  1K0R A;  4LF6 Q;  1DM0 B;  4AH6 A;  4C3I H;  2L55 A;  2JA6 G;  1ESR A;  2B8F A;  2O5I C;  2Q8T A;  3BG3 A;  1AN8 A;  1D2B A;  1DCZ A;  2KVM A;  2NVY H;  3K6O A;  4A3J H;  1NSN S;  1PZI D;  4QB4 A;  3T1H L;  1STH A;  4ZRZ A;  1NE3 A;  2NYZ D;  2PPB C;  2R7Z B;  5I6W A;  1BVS A;  1TWC B;  1L0X B;  2V4D A;  1F9S A;  4IUR A;  2K7V A;  3Q23 A;  4WJ3 M;  4QUC A;  1V1P A;  2NZO A;  4O0A A;  1O78 A;  4DR6 Q;  4C1N I;  1CQV A;  3ICE A;  3DWP A;  4DV1 Q;  1XNQ Q;  1KIX A;  2BCO A;  1GOZ A;  1Y1W G;  3D4R A;  4ZKB B;  1RTN A;  3PIO A;  3NWT A;  1D5Z C;  3A7A B;  3PO3 G;  5I6Y A;  4JI7 L;  3CU7 A;  2NZ1 D;  5JVH 3;  3I55 A;  3GTL B;  4A3G G;  1UE5 A;  4JI3 Q;  2TSS A;  4LF5 L;  3S2D B;  1V1O A;  2QW7 A;  2A19 A;  2JA5 B;  3A7L A;  5FOB B;  5BR8 L;  5M3M B;  3NPP A;  5FO9 B;  4L5R C;  4BBR B;  4K6L A;  1LV9 A;  1EY0 A;  4IJH A;  4UP9 A;  4A3K B;  1HTL D;  4R1J A;  1SNQ A;  3RLN A;  3UDF A;  4NDX A;  2F0L A;  2KCT A;  3NTH A;  3ND8 A;  4KKS A;  5KRU A;  5IY0 A;  2EJF C;  1X3F A;  2L0C A;  3D31 A;  3MXN B;  2UUB L;  2SEB D;  4X65 Q;  1XXG A;  2RHQ B;  1N9W A;  1XTD A;  3PUY A;  1IBM Q;  3A8K E;  1FYC A;  1WTW A;  4CJ1 B;  1KHI A;  2QKI C;  2UXD L;  1EQT A;  3H6M A;  1JWS D;  2XTI A;  2NUC A;  3L0O A;  5JAV A;  2ICE C;  3IFT A;  3RZO H;  5EKK A;  4HIM A;  3X3N A;  5ELC A;  2KCM A;  1J5E L;  4AYB B;  3GTM H;  2G5D A;  4XYQ A;  2LXJ A;  4EVO A;  2UXB Q;  1HPC A;  2F0Q A;  1HH2 P;  1I3Q H;  4GNX C;  1VQE A;  4KHP L;  3WOE A;  1JWM D;  1K8G A;  5ELB A;  4OO1 G;  2V1C C;  3CW2 C;  2WKC A;  3KFU A;  1PRT C;  2A6H D;  2I5H A;  1YNN D;  2CW0 C;  2GA4 B;  4TRD A;  3S24 A;  3SVM A;  2WB1 E;  2AQ2 B;  5C4X G;  3FKI G;  1WFQ A;  4YCU A;  1U9R A;  3CC4 A;  1KDA A;  4UP7 A;  2WKD A;  4DFA A;  1EWI A;  2UXC L;  3J81 j;  1PH3 A;  3S1Q B;  4O2D A;  3NEL A;  1BCP B;  4JG2 A;  1GUS A;  2UUB Q;  4PG3 A;  2K5N A;  4A3E H;  2EYM A;  1TU2 B;  3HOX H;  1IBL Q;  5COY A;  3GTP H;  4DKA C;  2UXD Q;  1S5E D;  1G51 A;  2E2J H;  1AFP A;  3R93 A;  4C3J B;  1BXT A;  3TP7 A;  1PH6 A;  4I7Z C;  4F88 A;  3GTG B;  3HZX A;  3M4Q A;  3CME A;  3PIP A;  5NUC A;  2KCN A;  2Q2H A;  4J1M A;  4HMI A;  3UDG A;  2PZT A;  1QB5 D;  1Z9F A;  5LMU Q;  4DR4 L;  3SK6 A;  3P1H A;  2ATW A;  1VQA A;  1UEB A;  1XYI A;  1UE6 A;  4B08 A;  4PZ6 A;  3CCJ A;  3I4M H;  3PUW A;  1I94 L;  5IOC A;  3NTK A;  4DNR B;  1LTG D;  5A2Q L;  2QIL A;  4LNQ A;  2IX0 A;  3HOU B;  4WJW A;  2OEO A;  1Y8O B;  1PFM A;  4NXN L;  5M5Y B;  2VXW A;  2AMC B;  1Q3L A;  3JAM i;  3HRZ C;  3H3V C;  4IN3 A;  2BE5 D;  4C3H G;  2HT1 A;  4ZUI A;  1LM0 A;  3HOZ G;  5C3W A;  3I70 A;  2VQF Q;  5IYD H;  3FRP B;  4A3L G;  2UXC Q;  1PTO F;  3DHQ A;  4O42 A;  4FP5 D;  1B7Y B;  1CK1 A;  3HFZ B;  4WFN 3;  4A3J G;  3F2B A;  1GKH A;  5C4H A;  5E4W C;  4UAI A;  4A3F G;  2D0O A;  2VUM G;  2A6H C;  5A2Q E;  1M90 C;  1IBK L;  2N55 A;  2B63 H;  1VDZ A;  4KLK A;  2N49 A;  3OSO A;  3ULL A;  3E0E A;  4L5S A;  1DOM A;  2RHS B;  2HDL A;  4A3C G;  2JA5 H;  5KGU A;  3MAQ A;  1B3A A;  5IWA Q;  1EIG A;  4JBK A;  1O7I A;  5M3M H;  4JI2 Q;  1N32 Q;  4DUZ L;  3F1Z A;  4PZ8 A;  4BBR H;  1H9M A;  4A3K H;  4HN7 A;  5T1G A;  4HJA A;  4CBV A;  4RFB A;  4JBM A;  2FMC A;  1I6H H;  2X6G A;  4NXN Q;  4IOC A;  1EFW A;  4EQ5 A;  3FPP A;  3PO2 H;  1OXX K;  3NSW A;  5C3E G;  1G2T A;  3H09 A;  3TS0 A;  5A35 A;  3SDZ A;  2JA9 A;  3BVG A;  4A3I B;  5IP9 H;  2C35 B;  1XPO A;  2G9H D;  1PH1 A;  4G57 A;  1PTO B;  1YI2 A;  1I5F A;  3C1E A;  1G2S A;  1VQK A;  2CCZ A;  1LT6 D;  1MJC A;  1IYU A;  2SDF A;  4YCV A;  4DV0 L;  2PNR C;  1PHJ A;  3FPU B;  4OEL B;  3OMG A;  4F87 A;  4DPG A;  4IOA A;  1ZXT A;  1YNX A;  1Q7Y C;  3PSI A;  1EQQ A;  4XIG S;  1RJT A;  1PH5 A;  2R92 B;  4Y7N B;  2BE5 C;  1SYD A;  3TRZ A;  1NBW A;  5I4D A; 
#chains in the Genus database with same CATH homology
 1SYG A;  1EY9 A;  3HKZ B;  3UI2 A;  2SOB A;  2NTS A;  1CZW A;  1V1P B;  4K5X A;  1KTK A;  1AZP A;  1O7Y A;  5AFW A;  2K32 A;  4PMB A;  4IUP A;  1EWH A;  2AWO A;  1ML0 D;  2OXP A;  1EEI D;  1NUC A;  2R61 A;  2N88 A;  5CMD A;  1I4R A;  4G4K A;  1ET9 A;  1HA6 A;  2IJ0 A;  4G7H C;  5M5X B;  1Y69 U;  4KV6 A;  5LL6 S;  1GJX A;  1EWC A;  2K1B A;  2A68 C;  2DY7 A;  3DWQ A;  4OIK A;  1DON A;  1SYC A;  3BYY B;  3P20 A;  1TY2 A;  3JAM L;  4XTC S;  5C5L A;  3I90 A;  3MFG A;  5CR3 A;  2F3W A;  1TR5 A;  2SNS A;  2EYJ A;  5M3F B;  2AUK A;  1R4P B;  3T56 B;  3OW7 A;  3LWE A;  3K7A B;  3SXH A;  4RA8 A;  2EOT A;  3TSS A;  3R3O A;  2PMZ B;  1HUM A;  5DM7 3;  4CKE A;  3NTI A;  4BS9 A;  4A3D B;  4K8I A;  2R93 B;  1TWG B;  3D6W A;  1ILP A;  4C3I B;  3EQL C;  1PXU A;  1ONL A;  1AEX A;  4KN7 C;  2EY5 A;  4K2L A;  1QJO A;  3NQI A;  3I72 A;  3HG9 A;  3M3Y B;  2ICI A;  5K5P A;  2LMC B;  3MXP A;  5EJW A;  1TS4 A;  5DAU A;  2H1E A;  3PUX A;  3GO5 A;  1TVX A;  2QF7 A;  1H9S A;  3M7N A;  1H9K A;  4KMU C;  4FXG C;  2H4O A;  1B50 A;  1AW7 A;  3SK4 A;  4DAP A;  5KYL A;  4FNF A;  4ZUJ A;  2NBF A;  4X3S A;  2F0U A;  2O4X A;  1IKM A;  5IGG A;  3N52 A;  1SND A;  3A54 A;  3RMH A;  1LO5 D;  4C2M B;  3OHX C;  3CRK C;  1EU4 A;  3P75 A;  5JOB A;  4TQU S;  1W6K A;  3AU7 A;  4ODG A;  3NK9 A;  1DZ1 A;  4DU9 A;  3L3O C;  5KYI A;  1LT4 D;  1SNM A;  1BBX C;  5HGT A;  5BN3 A;  3VA5 A;  3GTM B;  1HFG A;  1RDP D;  1OO9 B;  1LTT D;  3MHB A;  3ONA B;  1MD2 D;  2QCP X;  2K01 A;  1CZG A;  3J7Y W;  4H0L C;  1JOQ A;  3SE0 A;  1M4V A;  3MFY A;  2F0T A;  1HXY D;  4G7O C;  1GUN A;  3GV6 A;  1WD1 A;  1TS5 A;  1PDQ A;  2EY2 A;  4C3J G;  2JYO A;  3LX0 A;  4K8J A;  5F2D A;  5JPM C;  5J1Z A;  3VA7 A;  3WOF A;  1Z47 A;  1LTR D;  2MGS A;  4L63 B;  3L9A X;  4A3E B;  1ROD A;  3G6J B;  3GTP B;  4QIW B;  1SJH D;  4PNY A;  1FNU A;  2MJ8 A;  3EVQ A;  2RSN A;  2D5D A;  4IFD H;  2B2U C;  1WCM B;  3CHB D;  2AQ1 B;  3OMC A;  3VR6 A;  1SBB B;  2KEC A;  1TWA B;  2JXM B;  2KA7 A;  3V96 A;  5G3L F;  4DN4 M;  1B9M A;  4KN4 C;  3FMC A;  2KEE A;  1KDB A;  4EQN A;  3QIA A;  1SJE D;  2NN6 G;  5IGC A;  3GQB A;  1KLG D;  1PZJ D;  1D6E C;  4P2C B;  3Q0A A;  1EYC A;  5JEA H;  2XSC A;  4HAE A;  1EY4 A;  4UDU C;  4M1U B;  3HOW B;  1PFB A;  4HR7 B;  2K03 A;  3ND9 A;  3QWN A;  4NW2 A;  2NVX B;  1BCP D;  2B2V C;  1IW7 C;  1QE6 A;  1BO0 A;  1NR2 A;  3GP7 A;  4F7X A;  2NWG A;  2K28 A;  2B63 B;  3GTK B;  4ULL A;  2F0F A;  4H13 C;  1K8O A;  1MBY A;  3DEP A;  3DMU A;  3A56 A;  1ZYR D;  4FVM A;  4U68 A;  3ZYY X;  1CFM A;  2VNU D;  5IGE A;  4KY6 A;  2K5W A;  3MXG A;  2JE6 I;  2L4N A;  1QOH A;  1GXD C;  1I6H B;  5C0X H;  4H44 C;  1BCP F;  3PO2 B;  1TKW B;  4PV1 C;  1T5E A;  4LK1 C;  2EXZ A;  3BDC A;  3QO2 A;  1MI2 A;  4BWG B;  3QOL A;  1SE2 A;  3Q22 A;  5K36 G;  2VB2 X;  2Z8L A;  3VYU A;  1ILQ A;  1ICW A;  3GD7 A;  4KI0 A;  2BDO A;  2D2C C;  3TN2 A;  1KAA A;  1BNZ A;  2O5J C;  4PMW A;  1VCI A;  2C9O A;  4FXD A;  1JIC A;  2RSO A;  1SYE A;  5HUR A;  3DWA A;  3VR2 A;  2B2W A;  1I4H A;  3V2T A;  1G6Z A;  2X6L A;  1H9S B;  1CA6 A;  4ZAI A;  2HQE A;  1TT2 A;  1BOS A;  4GZY C;  2D62 A;  4IUN A;  3S9W A;  1C4Q A;  3K57 A;  3S1R B;  2RBM A;  4XYO A;  3W2D A;  2KOL A;  1PTO D;  1PRT B;  2JA7 B;  3MC0 B;  3NQT A;  3I91 A;  3MEH A;  2RKS A;  3AB9 A;  5E1F A;  1SMY D;  3BVZ A;  4NP5 A;  4TSS A;  2AWN A;  5JJZ A;  5I9O A;  5IT9 L;  3HP3 A;  4PMC A;  2Y0S B;  1LT3 D;  5IGB A;  4NMZ A;  3S2H B;  2PCF B;  2Z4H A;  3H0G B;  1RF2 D;  4FF4 A;  4K2K A;  3L7Z C;  3HS0 C;  4OGQ C;  4ZK9 B;  1X3Q A;  4RKB A;  5EBD A;  3M85 A;  4C3I G;  2WB1 B;  5IT9 E;  1A2T A;  4RCN A;  5I2Y A;  1S5D D;  4ZLT F;  4R9W A;  5JEA G;  5CBE E;  3T16 A;  3FEW X;  5KIX A;  3HOV B;  1YNN C;  1JB3 A;  5FLX L;  3OPO A;  2QEJ C;  1Y1V B;  5ELE A;  2IT1 A;  3TDQ A;  4FF3 A;  1OXS C;  3J81 L;  3ITP A;  1DOK A;  2TMP A;  2L9H A;  1PFN A;  1Y8N B;  2ZXP A;  1EY8 A;  4BY7 B;  1XWE A;  5CBA E;  2KJX A;  2A73 B;  1YNJ D;  2KUM A;  2PW7 A;  5COR A;  1U4M A;  1CHP D;  1SDF A;  1IHZ A;  2HCI A;  1G29 1;  1TWF B;  1PTO C;  1KLU D;  5FLX E;  1C48 A;  3A8I E;  1H9R A;  5TSS A;  1R4Q B;  1STE A;  3J81 E;  1SMY C;  4L6T B;  2EYF A;  2NN6 I;  2K04 A;  5FO7 B;  3EFX D;  2G9D A;  2IWH A;  2B2T C;  2K5D A;  5T1I A;  3IAY A;  3R2I A;  5CGK A;  4BBS B;  1NAP A;  4Q5V A;  1F9P A;  1DD2 A;  3I4N B;  3U9O A;  1WTO A;  5I2X A;  4M8A A;  2F0M A;  1PZK D;  3EA6 A;  2PZU A;  4Q0F A;  2CVR A;  4LMQ D;  3QOJ A;  1GUG A;  5M9O A;  4ILW A;  4JBW A;  5CV8 A;  4NKL A;  4LAA A;  1EIH A;  1STB A;  2EPB A;  1WD0 A;  2XIW A;  3NP8 A;  3K5L A;  3K59 A;  3D4W A;  4I65 A;  4V0B A;  2F0H A;  1BF4 A;  3K58 A;  3S14 B;  3IFD A;  3A8J E;  1HTP A;  2BA1 A;  1EU3 A;  3NXW A;  3CRL C;  4K5V A;  2OT2 A;  1A3V A;  1JC7 A;  3D8G A;  4RGO S;  1HQR D;  3NUC A;  3H94 A;  3GV3 A;  2HDM A;  1RTO A;  4DAV A;  4RGN A;  1JOK A;  2L1B A;  1I6V C;  1SSO A;  4KHZ A;  2E2H B;  4FYD A;  2EYO A;  5CC4 A;  3BDO A;  5ELF A;  4DK1 A;  2JEB I;  1HFN A;  4ABN A;  3RD4 A;  5ELD A;  2JEA I;  2M9V A;  4CKB A;  3MZ5 A;  3NWS A;  2MUY A;  4X3U A;  1WTP A;  1RKN A;  1J8I A;  1LT5 D;  2JA8 B;  4KHV A;  1LTA D;  1IKL A;  4J8Q A;  4KTA A;  1O80 A;  2RQX A;  3VYS A;  3DXJ C;  1STY A;  1V8Q A;  3S17 B;  1QG7 A;  2K5Q A;  5KND A;  4HTH A;  1I4G A;  1QNU A;  2Q8R E;  1S5B D;  1RD9 D;  2Z1C A;  3PV0 A;  4XQN A;  4ZYS A;  2EY6 A;  4BY1 B;  2AUJ D;  3VR3 A;  2F1M A;  4X3T A;  1F2L A;  5E3F A;  3LNN A;  3X3M A;  2XWB B;  5D65 A;  5ISR A;  1E2V A;  5D14 A;  2D9U A;  1OXT A;  1W6J A;  5FO8 B;  2EZV A;  1A3U A;  2L12 A;  4K14 A;  2B8G A;  1FNW A;  1I4X A;  1LAC A;  4OHJ A;  3T13 A;  3KBG A;  1SYB A;  4KD4 A;  4RGM A;  1UUP A;  2CQA A;  5FKA C;  1LLR D;  5C44 B;  4XXE A;  1BUV T;  4DAY A;  4IUV A;  5LL6 X;  4E6I A;  3J7A V;  5JEA J;  3K0Y A;  3GTQ B;  4XT3 B;  2M00 A;  2F0O A;  3MA2 B;  2DY8 A;  2E2I B;  3MXU A;  3H91 A;  4QF4 A;  4PQX A;  2XNA C;  4RHR A;  3R8B A;  4DK0 A;  2E75 C;  5IIF A;  1Q12 A;  3M7G A;  1F2Y A;  4A3B B;  4WOR A;  4CGY B;  2KHS A;  3VR4 A;  1CTM A;  2SNM A;  4HED A;  2MHV A;  1J9O A;  2BA0 A;  4IAL A;  4OO1 H;  1D1K A;  4N9P A;  4RAU C;  1GUW A;  1MSH A;  5G3L D;  3I8Z A;  1TS3 A;  5CYU A;  5EPK A;  3T53 B;  4ZKC B;  4A3M B;  1TII D;  2JSO A;  1SE3 A;  5LHY 1;  5JVG 3;  2EVB A;  4DXF A;  1WTQ A;  3C3L A;  2PYK A;  3VYT A;  2QDB A;  2EYH A;  3MTS A;  1DYQ A;  2K05 A;  2FMM A;  3LWU A;  1IYV A;  4RWS C;  1EY5 A;  1H9J A;  3E0J A;  1XX8 A;  1EQV A;  2R6G A;  1PMR A;  1SFO B;  1JCK B;  1B53 A;  1C8C A;  2CHB D;  2IX1 A;  2B2Y C;  1CI3 M;  4MHE A;  4OL7 A;  3MVV A;  1EZ8 A;  4BA2 I;  1PYW D;  3CQZ B;  1D5M C;  1R9T B;  3S1M B;  5EKL A;  3V05 A;  3ERQ A;  1F77 A;  2WV6 D;  3O13 A;  2A5H A;  1HUN A;  2XRS D;  4HMJ A;  3PIO 3;  2IW3 A;  4IUU A;  1FGB D;  4Z9C B;  1E2Z A;  1U4R A;  2DNE A;  1GUT A;  3GTO B;  3KLS X;  5C6A A;  2ID0 A;  1ZEQ X;  2EE1 A;  1QCB D;  2B2T A;  3PUV A;  2IL8 A;  1LTS D;  3KUP A;  1KDC A;  5BN4 A;  2J4X A;  1PRT D;  1NCV A;  2CW0 D;  1I4P A;  4XDX A;  2L11 A;  3OIP A;  3HGB A;  4CJ2 C;  2FHT A;  1STG A;  5DEH A;  1VMC A;  3TZD A;  4A93 B;  1BQQ T;  3BVM A;  1LTI D;  1QWY A;  4XT1 B;  1I50 B;  3NHH A;  3SR1 A;  5JPN C;  1XTC D;  2KCC A;  3P7J A;  1JR0 D;  2WP8 J;  3SHL A;  3KF8 A;  3IKJ A;  1PRT F;  4RHS A;  1II3 A;  4KJN A;  1FD7 D;  5C4J B;  2VB3 X;  4R8I A;  4CKC A;  1HA5 A;  1TS2 A;  1X32 A;  2MP1 A;  1F9R A;  4R8N A;  4L8J A;  1Z6H A;  3DM1 A;  1Q1E A;  1Q1B A;  3NBH A;  1WVL A;  5J22 A;  1TWH B;  5M5W B;  1B1Z A;  1ENC A;  4ZQ3 A;  3QB3 A;  5E4X A;  2RDG A;  1MSG A;  1BCP C;  1TQO A;  4EQP A;  4J6H A;  2I07 B;  3HOY B;  3GTJ B;  2PZW A;  1Y8P B;  1EY6 A;  1AZQ A;  2YYZ A;  2ZXR A;  3QG1 A;  1UAP A;  4XQQ A;  4EQO A;  2PW5 A;  2EJG C;  1JE4 A;  2WAC A;  1EY7 A;  1F2Z A;  2EYL A;  1KAB A;  3PIP 3;  1E2W A;  2F0E A;  1ZYR C;  1ESF A;  3S1N B;  2LY7 A;  4K6D A;  2HCC A;  2F0J A;  3NBI A;  4KKT A;  1U4L A;  2F0P A;  1B2T A;  4KJO A;  2YU9 B;  4U67 3;  2F0I A;  3TBI B;  4QMG A;  2J0T D;  1ET6 A;  2E2D C;  4ME5 A;  1MGS A;  4DF7 A;  4IFD G;  4RKL A;  1O7Z A;  1OXU A;  1SXT A;  3OIQ A;  3FDT A;  1AP0 A;  1LAB A;  3S15 B;  3PUZ A;  2XN9 C;  1S4Z A;  2F0V A;  3TP8 A;  1VF7 A;  2RDF A;  3Q6S A;  3I3C A;  4N9T A;  4CHT B;  1SNO A;  1EFI D;  1BR9 A;  2FJ2 A;  5CV7 A;  2E74 C;  3R2T A;  1Q90 A;  2F03 A;  2JA6 B;  1D1I A;  2DN8 A;  3NE5 B;  2F0D A;  1GHK A;  5KNC A;  1KNE A;  5C5M A;  5KEE A;  3RZD B;  3I73 A;  3S16 B;  4X3K A;  2C5C A;  2F0N A;  1BDO A;  1SAP A;  1DJR D;  5C3X A;  5EPL A;  3TZU A;  1ZKO A;  1B44 D;  4HCS A;  4DA2 A;  5KNB A;  1Q8I A;  4RGT A;  1Y1W B;  3BDL A;  2HUG A;  1CA5 A;  2EYP A;  2OF1 A;  5C0X G;  4G7Z C;  2A68 D;  3PO3 B;  3M4Y A;  1F9Q A;  4A3G B;  5J39 A;  4IZ8 A;  2EJM A;  3BYT B;  1U4P A;  1WTV A;  4KY5 A;  2L5T A;  3HEJ A;  4K5W A;  4TKO B;  1EYD A;  1F2M A;  1PLF A;  2A6E D;  1TY0 A;  1SE4 A;  3DEO A;  1SEB D;  4KK7 A;  1EL0 A;  1RHP A;  3KK7 A;  2LKV A;  1STA A;  3KLS A;  4BA1 I;  2ZT9 C;  3PMF A;  3M4O B;  3F2U A;  1G8Z D;  2NB0 A;  2XWJ B;  1CHQ D;  2J7Z A;  3TP5 A;  2B2U A;  4LJZ C;  1LTB D;  1DOL A;  1JQY D;  4FF2 A;  1YNJ C;  1GUO A;  4C56 C;  2ZXO A;  2EY1 A;  2B2Y A;  1X3P A;  3OWE B;  2NTT A;  3RUZ A;  5CV4 A;  2M2L A;  3G7L A;  4F8M A;  1VF5 C;  5D3I B;  4ID6 A;  2E76 C;  5C4X B;  2FIN B;  3E6Z X;  2F0K A;  3FKI B;  1HRJ A;  2Q8I B;  1JOO A;  5D3D A;  3VYR A;  4HCE A;  4EGV A;  3FVQ A;  2F0W A;  4KY7 A;  5IGD A;  3U9S A;  1QIL A;  2F0G A;  2B2V A;  4O1N A;  2LFN A;  5IGF A;  1IL8 A;  3E5S A;  3BS1 A;  5EPJ A;  3I4L A;  4B9X A;  4C1N K;  2Z4I A;  1QNK A;  2B2W C;  2A6E C;  3D3R A;  4KD3 A;  3W3A A;  4OO1 I;  4DGZ A;  2R3Z A;  3ERO A;  3K5N A;  2IPK D;  4JK1 C;  1EYA A;  5CV5 A;  3MXN A;  2LS0 1;  1O7L A;  2PO4 A;  3Q24 A;  4IUQ A;  1E0B A;  1JOR A;  3KBX A;  1UNS A;  2FFK B;  3BZD B;  3JAM E;  1K8M A;  2NN6 H;  1FR3 A;  2NVQ B;  4C3H B;  5CV9 A;  4QCL A;  3HOZ B;  1EOT A;  3K5M A;  2WIN B;  5FK9 C;  1Z7T A;  1GHJ A;  3C2P A;  5C4Z A;  3SK5 A;  1L0Y B;  2NVY B;  4A3J B;  4IFD I;  2RVL A;  4A3F B;  2XVS A;  3C46 A;  2VUM B;  2WII B;  4IFD J;  1B4O A;  5EBC A;  1T5X D;  1DXM A;  4WRD A;  4IUT A;  1KNA A;  4FXK C;  1S5C D;  2RDH A;  3TP6 A;  3AMU A;  2X69 A;  2A69 D;  1NR4 A;  5DNF A;  5EGT A;  4IQZ A;  2B39 A;  3SK8 A;  2JP1 A;  1A15 A;  3C1F A;  4QUF A;  1HCZ A;  1PTO H;  2I46 A;  3IL8 A;  2PQE A;  2F0S A;  3MWY W;  2F3V A;  3K5O A;  1G91 A;  4B9W A;  1OXV A;  2A74 C;  5C3E B;  3OOC A;  4RH6 A;  4H7B A;  1K83 B;  3A55 A;  3QJY A;  2K33 A;  5IOD A;  1SYF A;  2K6A A;  3J80 L;  5EKI A;  3URY A;  5K36 H;  1EEF D;  4XQJ A;  1I4Q A;  1HQM C;  3D6C A;  1VMP A;  1HHV A;  3EJI A;  1A3T A;  1SNC A;  3RLF A;  3RZO B;  3CKI B;  2KED A;  2NVT B;  1B9N A;  2RA4 A;  1RCV D;  5C0X I;  4FF1 A;  4CJ0 B;  4DXG A;  1A6X A;  3J80 E;  1FNV A;  1I3Q B;  5C0X J;  1IW7 D;  2WAQ B;  3DUZ A;  2KQ3 A;  3J7A F;  2XRQ D;  3D4D A;  2AQ3 B;  2A69 C;  1SNP A;  3T4A C;  2F4I A;  2MPM A;  4MN3 A;  4OIJ A;  2DNC A;  1CT1 D;  4YIJ A;  5I9P A;  5BN5 A;  1V43 A;  3T51 B;  3HOX B;  2O2L D;  4RCO A;  4DNT B;  3VR5 A;  3OWF A;  1WTR A;  1UEA B;  2E2J B;  1ENF A;  3TME A;  2IX3 A;  4HSP A;  4HSV A;  2ENB A;  2BDN A;  1STN A;  5EQ0 A;  5CV6 A;  1M8A A;  1CQF A;  2BOS A;  3SEB A;  1EZ6 A;  1D5X C;  1WTX A;  4MIU A;  4FO2 A;  3WDN A;  1ENA A;  1A2U A;  1JWU D;  1S5F D;  1CM9 A;  3KLR A;  3N6R A;  4KKU A;  2EDG A;  4V19 0;  3I4M B;  4S3S A;  1DM0 B;  2L55 A;  1ESR A;  2B8F A;  2O5I C;  2Q8T A;  3BG3 A;  1AN8 A;  1D2B A;  1DCZ A;  2KVM A;  3K6O A;  1NSN S;  1PZI D;  4QB4 A;  1STH A;  4ZRZ A;  2NYZ D;  2PPB C;  2R7Z B;  5I6W A;  1TWC B;  1L0X B;  2V4D A;  1F9S A;  4IUR A;  2K7V A;  3Q23 A;  4QUC A;  1V1P A;  1O78 A;  4C1N I;  1CQV A;  3DWP A;  2BCO A;  1GOZ A;  3D4R A;  4ZKB B;  1RTN A;  3NWT A;  1D5Z C;  3A7A B;  5I6Y A;  3CU7 A;  2NZ1 D;  5JVH 3;  3GTL B;  2TSS A;  3S2D B;  1V1O A;  2JA5 B;  3A7L A;  5FOB B;  5M3M B;  3NPP A;  5FO9 B;  4BBR B;  4K6L A;  1LV9 A;  1EY0 A;  4A3K B;  1HTL D;  1SNQ A;  4NDX A;  2F0L A;  3NTH A;  3ND8 A;  4KKS A;  5KRU A;  2EJF C;  2L0C A;  3D31 A;  2SEB D;  1XXG A;  3PUY A;  3A8K E;  1FYC A;  1WTW A;  4CJ1 B;  2QKI C;  1EQT A;  3H6M A;  1JWS D;  2NUC A;  5JAV A;  2ICE C;  3IFT A;  5EKK A;  3X3N A;  5ELC A;  4AYB B;  4XYQ A;  4EVO A;  1HPC A;  2F0Q A;  3WOE A;  1JWM D;  5ELB A;  4OO1 G;  2WKC A;  1PRT C;  2A6H D;  1YNN D;  2CW0 C;  2GA4 B;  4TRD A;  3SVM A;  2AQ2 B;  1U9R A;  1KDA A;  2WKD A;  4DFA A;  3S1Q B;  1BCP B;  1GUS A;  2EYM A;  1TU2 B;  5COY A;  1S5E D;  1AFP A;  3R93 A;  4C3J B;  1BXT A;  3TP7 A;  4I7Z C;  4F88 A;  3GTG B;  3HZX A;  5NUC A;  2KCN A;  4J1M A;  4HMI A;  2PZT A;  1QB5 D;  3SK6 A;  3P1H A;  1XYI A;  4B08 A;  3PUW A;  5IOC A;  3NTK A;  4DNR B;  1LTG D;  5A2Q L;  2QIL A;  2IX0 A;  3HOU B;  4WJW A;  2OEO A;  1Y8O B;  1PFM A;  5M5Y B;  2VXW A;  1Q3L A;  3HRZ C;  3H3V C;  4IN3 A;  2BE5 D;  4C3H G;  4ZUI A;  5C3W A;  3I70 A;  3FRP B;  1PTO F;  3DHQ A;  4O42 A;  4FP5 D;  1CK1 A;  4WFN 3;  5C4H A;  5E4W C;  4UAI A;  2A6H C;  5A2Q E;  2N55 A;  1VDZ A;  3OSO A;  1DOM A;  2HDL A;  5KGU A;  3MAQ A;  1B3A A;  1EIG A;  1H9M A;  4HN7 A;  5T1G A;  4CBV A;  4RFB A;  2FMC A;  2X6G A;  3FPP A;  1OXX K;  3NSW A;  1G2T A;  3H09 A;  5A35 A;  3SDZ A;  3BVG A;  4A3I B;  2G9H D;  4G57 A;  1PTO B;  3C1E A;  1G2S A;  1LT6 D;  1IYU A;  2SDF A;  2PNR C;  3FPU B;  3OMG A;  4F87 A;  1ZXT A;  2R92 B;  4XIG S;  1RJT A;  4Y7N B;  2BE5 C;  1SYD A;  5DM6 3;  5I4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...