2OXPA

Crystal structure of staphylococcal nuclease mutant v66d/p117g/h124l/s128a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High apparent dielectric constant inside a protein reflects structural reorganization coupled to the ionization of an internal asp
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2oxpA00
5ISRA 4IUNA 4K5WA 1NSNS 5EKKA 4ODGA 2F0JA 3VA5A 3BDLA 3PMFA 1KDBA 3ITPA 3MZ5A 4YIJA 4KHVA 4QMGA 3SK4A 2EYMA 1STHA 5CR3A 1EY4A 1F2ZA 5CV5A 4G57A 5HGTA 1A3VA 2QDBA 5CV7A 2EXZA 2PZTA 2EYFA 3MHBA 3TP8A 3U9OA 2F0TA 4ZUJA 4B9WA 2RKSA 3HZXA 5CGKA 2M00A 3MXPA 5K5PA 2ENBA 4K2LA 2EY5A 2F0MA 3H6MA 5IGGA 3OMGA 3TP6A 3T13A 1EY5A 2F0KA 4KY7A 3QB3A 1F2YA 3NXWA 1EY9A 2EYLA 5C4HA 3OSOA 5I6YA 4WORA 5I9OA 4IALA 4QB4A 1SNPA 4ZQ3A 3BDCA 2F0UA 1EZ6A 1SYFA 4KD3A 3SHLA 3C1EA 1NUCA 1SNMA 3C1FA 1SYEA 2SNSA 4F7XA 2SOBA 1STNA 4KJOA 2OXPA 4KTAA 1SNDA 4N9TA 2F0QA 3NK9A 4NP5A 4PMCA 3TP7A 2F0VA 3QOLA 4EQPA 5C5MA 1ENAA 1KABA 1AEXA 3RUZA 1TR5A 5J22A 2HQEA 4RKLA 4WRDA 5IGEA 3V2TA 5KIXA 5DAUA 5I6WA 5KYLA 4K8IA 2PZWA 2F0IA 3NHHA 2F0EA 5C6AA 3OWFA 1EYAA 1SNQA 1JORA 2KHSA 1KAAA 4R8NA 5F2DA 3DHQA 1SYBA 4MIUA 2F3VA 2LKVA 5J1ZA 1STAA 4K8JA 2RBMA 3EJIA 5CV9A 5E1FA 2OF1A 4IZ8A 1A2TA 5IGCA 4EVOA 2EY2A 2F0FA 1STBA 4NDXA 5M9OA 5CV8A 5KRUA 1EZ8A 3D8GA 3MEHA 4HTHA 4EQOA 1U9RA 2F0NA 2F0LA 1EQVA 2F3WA 5JAVA 4DU9A 4EQNA 1EY8A 4OL7A 2SNMA 2F0OA 2OEOA 1KDCA 2EYJA 3D4DA 4ID6A 4RKBA 2PW7A 5EGTA 3SXHA 4I65A 5CV6A 3LX0A 2EY1A 4F8MA 4QF4A 1II3A 3ERQA 2EYOA 2PYKA 2RDFA 4S3SA 5CV4A 1RKNA 4KJNA 5DEHA 3SK5A 4HMJA 1JOQA 1EYCA 4J1MA 5NUCA 2WACA 5IOCA 1STGA 4KY6A 4N9PA 5IODA 4E6IA 2F0SA 1STYA 5C5LA 4H7BA 1SNCA 4J6HA 4LAAA 1SYDA 1EY6A 2EYPA 1TQOA 2F0PA 4K5VA 5KEEA 3SK6A 4HMIA 4NMZA 5KGUA 2F0DA 4TRDA 5C4ZA 4DF7A 2NUCA 4ME5A 4PMBA 1F2MA 5E3FA 5J39A 3OMCA 4DGZA 2KQ3A 1JOKA 3D6CA 1EY0A 5IGBA 1ENCA 5CC4A 3P1HA 3SK8A 5HURA 3MVVA 2F0WA 1IHZA 1TT2A 2O4XA 4K2KA 3NP8A 4K6DA 4PNYA 4B9XA 5I9PA 2EY6A 4KV6A 1SNOA 3E5SA 3EROA 3S9WA 5C3XA 5IGFA 1EY7A 3HEJA 4KY5A 5IIFA 1EYDA 1KDAA 2PZUA 4K5XA 2EYHA 4ZUIA 4KD4A 5IGDA 3NUCA 1A3UA 4DFAA 1JOOA 3P75A 2PW5A 3QOJA 3DMUA 1A2UA 2PQEA 3EVQA 3R3OA 4K14A 3TP5A 5C3WA 2F0GA 4NKLA 5JOBA 1A3TA 5EKLA 5KYIA 1SYGA 3T16A 3D4WA 3SR1A 1SYCA 3TMEA 3NQTA 2F0HA
chains in the Genus database with same CATH superfamily
5ISRA 5EAYA 5CMDA 1S5CD 3J81L 1D1KA 2VUMB 1VQ9A 4PQXA 4R8IA 1CKMA 4LF5Q 2WAQG 3IRBA 4KHVA 3HOXH 1LV9A 5LMNL 1VQ8A 2OWOA 3M3YH 3CC2A 4A3GH 3HKZB 1HA6A 4DV4L 2JA6H 1A62A 4PMWA 5A35A 3GTKB 3T56B 4JI0Q 2H4OA 3KUPA 1VQIA 3NXWA 5GAEC 2QEJC 3D3RA 5FLMH 4RHSA 5T1GA 1YHBA 2RCFA 1Z7TA 3IL8A 1QE6A 1WCMH 5JVH3 5COYA 1ET6A 2HHHL 5FO8B 3Q24A 3W5OA 2JA7H 1IYJB 5IGEA 4DK3C 2HUGA 1C4QA 3K7UC 4H02A 2F0EA 3DWPA 5C6AA 4MTNA 1IBLL 3RZOB 4LF6L 1ZXTA 1EEFD 4QJFA 2RF4A 3TS2A 2F3VA 1Y69U 1ZKOA 2A6HD 4YWKA 5M3MH 1CQVA 4P71A 4EQOA 1OXVA 2L15A 1RL2A 1ML0D 2OQ0A 3VDYA 1SJHD 1D6EC 4OEMB 1J9OA 4ABNA 3VYUA 1XNRQ 1M1KC 4POFA 3A74A 4DUYQ 4JI5Q 5IP7G 1B44D 4DV1L 5C4XH 1CM9A 4APVA 5M3MB 1K28A 2NN6H 2EPBA 1Q1BA 1K0RA 2F0DA 5G3LD 1QJOA 2HCIA 2JJQA 5J39A 3H3VH 1L1OC 5CORA 1HZCA 1VQ7A 4UPAA 4DV7Q 3MVVA 1K8GA 4B9XA 4PV1C 1SEBD 2E2IB 4YHHL 1HNXQ 4KY5A 4V190 1CFMA 3KOJA 4XTCS 2HHHQ 4G4KA 1Z47A 1X3PA 1LM0A 1A2UA 2K1BA 3U50C 5C3WA 2AQ2B 2BA1A 1AE3A 3T16A 1SE2A 3F2CA 4R4CA 1PH3A 3W1GA 1NSNS 4LFAL 1ICWA 2CQOA 4JBKA 4JI2Q 1BCPD 4DA2A 1F2ZA 2K5DA 1BOSA 4MNOA 4LWCA 2JA8G 1BR9A 4JI0L 4IJLA 2I5LX 1U4PA 2K33A 1UNSA 4FXKC 4R4OA 2VUMH 2K6AA 3KDFA 3E0JA 3K81C 3JAMc 3S1RB 2R92H 4ZQ3A 3I2ZA 4BY7G 5EBDA 1AN8A 1SYFA 2F0UA 5T1IA 3M4PA 4NW2A 3QOLA 4C1NK 2PNRC 5E7NA 4HJ9A 3V2TA 5DAUA 4FXGC 1YJ9A 3ER0A 2OQKA 1RHPA 3CCUA 4PZ7A 1RCVD 1I94Q 4JYAL 4OX9Q 4C3HG 1X9NA 1KLGD 2QF7A 4A3EH 2Z4IA 1KQSA 1EIYB 1HNWQ 1PTOF 1C0AA 5BN5A 1KDCA 4JBJA 2Q8RE 2ZXOA 3K80C 4A93H 1K0SA 1II3A 4P74A 3E0EA 1H9RA 1U0LA 2N55A 3CCLA 3U9SA 4X62Q 3R8BA 1JR0D 4NDXA 4LAAA 2JK8A 3S17H 4B3SQ 3CD6A 1PDQA 1SMYC 4DF7A 1PH7A 1B2TA 2Q8TA 1YNND 2NVYB 2RCNA 4KN4C 2NYZD 2QEXA 5IGBA 1GHKA 2B2YC 3SK8A 1PH5A 1YHQA 1LT5D 3EROA 4RWSC 4XQNA 1D2BA 2R3ZA 4TSSA 4QUCA 1D1IA 3UDXA 3CPWA 3PQIA 4A3KB 1QVFA 2NVQB 3CCSA 3QOJA 4WJ4A 4JI7Q 1BKBA 1A3TA 3HP3A 3N52A 1ICFB 1X3QA 1BO0A 3NBHB 4QIWB 4BY1B 3UE1A 3TMEA 3OHXC 4OHJA 2Q2TA 4WFN3 3FKIG 4ILWA 3ZYYX 1WTHA 4KLKA 1TKWB 4G57A 3D4RA 3EN2A 4RGTA 2KHJA 2WP8J 2K7VA 3ULPA 1FNUA 3MXPA 5FLMG 1K73C 1PH4A 4FF2A 4HAEA 4JVZA 5LMNQ 4R4IA 4DK6C 4YCWA 1BBUA 3NELA 4BY1H 4FDBA 4LMQD 1H9JA 2EYLA 3I91A 2VQFL 2KEDA 5EBCA 1DONA 2SOBA 3MXGA 2YU9H 4FF1A 5C4XG 1KABA 1HTPA 5ELBA 1TR5A 3AYHB 1AFPA 4RKLA 5D65A 1IKMA 1WTXA 1YVCA 1VF7A 5IYDH 2PZWA 2VXWA 3BVGA 2B8GA 5KNCA 1M4VA 3NPPA 4HJ5A 4A3MG 2DN8A 4MIUA 3J7ZC 2B2WC 2RBMA 2NTSA 3WOFA 1SE3A 3NBIA 3HKZG 1Y1WH 3MEHA 1OXTA 1I4RA 2HDLA 3STBD 3OOCA 4MTKA 4IOCA 3I3CA 3K59A 3EIVA 2D2CC 2N78A 3RMHA 2H1EA 3G6EA 3S17B 4QGUA 3FPPA 4QUFA 1TS3A 4IPGA 5KNBA 2ICEC 5M5YH 2GVBA 2K5WA 5TSSA 3SK6A 3X3NA 5M3FB 4KHPL 1BUVT 2SEBD 4ME5A 4A93B 3DWAA 4L5RC 2L55A 3UI2A 3PF5A 1JOKA 2NZ1D 2AMCB 2AUKA 4LW1A 3RLFA 1O78A 1VQLA 2K01A 1VS0A 1W6JA 3PO2G 4K6DA 2D62A 2ATWA 2UUCL 4A3DH 4X66L 4DR5Q 1LABA 5JJKA 1IW7C 1Q86C 2R93B 1FGUA 3P75A 1EU3A 2RDHA 4K14A 4YHHQ 3K6OA 3UDIA 1CT1D 1N32L 4P73A 4TKOB 1I6HH 1YZ6A 4LNQA 1ESFA 3A5ZB 3CMAA 4DR1Q 2A69D 4LFCQ 3MEFA 1B9NA 5EKIA 4YIJA 1SMYD 4HJAA 4UY8C 1YNJC 2PQAA 3C46A 1PXUA 2M2LA 3BZCA 5EJWA 4DV5Q 3M4OB 1Y1VG 1HXYD 3RN5A 1E3PA 1SROA 1SLJA 4JBMA 1I4QA 2WB1B 4A3EG 1DGSA 2R93G 1SYEA 1STNA 2KUMA 4A3KG 2KCMA 1NJIC 1KHIA 4POGA 4DR7Q 5C4JB 2AQ3B 2F0VA 1Y8NB 1TWCB 5IP7H 2N49A 3P20A 3QR8A 1IL2A 1N34Q 1SXTA 2A6EC 3KFUA 3DEOA 5KYLA 2E2HB 2FHTA 2KJXA 2B63G 3AFPA 2A73B 3HKSA 1SNQA 1QOHA 4G7HC 5CBAE 1K83H 4EGVA 3H91A 2VY3A 4GOPB 2BH2A 3OTOL 2E2IH 4OO1G 5D14A 4X65L 1KNEA 1Z9FA 3A56A 1V1PA 3KF8A 1MGSA 3J80L 4IFDG 2RSOA 3BZDB 2UXBL 4JI8Q 3G7LA 2Z1CA 4H44C 2E2DC 1PV4A 1LACA 4B3MQ 1I50B 1I5FA 1KTKA 4E6IA 3CCMA 1VQAA 4H7BA 1UUPA 3W2DA 5M5WB 1TWGH 5IYCG 4UP9A 2NUCA 3PIP3 3DEPA 3CCQA 2Q8IB 4RFBA 5C0XJ 3A5UA 3T1HL 2NVTB 1DD2A 2QILA 1IZ6A 1LTAD 3JAML 3HOWB 4X3UA 5JJLA 2O4XA 5IY0A 1B8AA 3E5SA 1QVCA 2WB1E 3I4NH 4DR7L 1GO3E 1HUMA 2CW0C 2JA8B 1K9MC 1PFSA 4OIJA 4IUQA 1TIID 5EKLA 2MQHA 1WI5A 1RF2D 3NQTA 5BN4A 1VQDA 3HRZC 4JI7L 2I46A 3GTKH 5IYDG 2B63B 3PO3G 4HCSA 3ITPA 4BA1I 2Y0SG 1TWGB 3MAQA 2A8VA 1E24A 2EQSA 3C3LA 2I5HA 4JBWA 4B9WA 1OO9B 2ASBA 3I4NG 3D0FA 1ZYRC 1VCIA 1WTPA 1R9TB 5FKAC 2R92G 2VNUD 3CHBD 4BY1G 3KLSX 5E4XA 1PH1A 2R7ZG 1ZEQX 1F2YA 1LT3D 2IPKD 4IALA 3BDCA 3C1EA 1KRTA 5FO7B 3NTKA 1XTCD 1JT8A 1QCBD 4GOPA 4EQPA 1KXLA 4BBSB 3A0JA 1RD9D 1S5BD 5IP9H 3GTOB 4DV3Q 1VMCA 1S3OA 1UWVA 3MXNA 3LWUA 2C35B 4RCNA 2HIVA 2RA4A 3S14B 3OIPA 1ASYA 2KECA 3DM1A 2CWPA 3KF6A 5I2XA 5IT9c 4JOIA 1SSOA 1TWCH 3K0XA 4K8JA 1TS2A 1XYIA 1WJJA 2K4KA 2EVBA 5CV8A 4JI8L 1K83B 1U9RA 4DU9A 1LTRD 1QG7A 3ZJYC 1PYBA 2PW7A 3S2HH 2BE5D 2RHSB 4QF4A 3K7AH 4I7ZC 3PF4A 3I4LA 1PH9A 5JPMC 5C4JH 2NBFA 4N9PA 4HSPA 2A74C 4GKKQ 1N9WA 1KC8C 2EYPA 5M3FG 3KLWA 3HKZE 1QZHA 1RODA 2UU9L 1MI2A 3QIAA 4FF4A 3PO3H 3EQLC 1KAWA 3KJPA 1K3RA 1W6KA 2DJGC 3AFQA 3KF6B 2F0WA 1PTOH 4A3CG 4LUOA 4IPDA 4LF7Q 2KCTA 3BYTB 4FO2A 1GXDC 3P7JA 4DR5L 1E22A 3PUWA 3Q8DA 3SR1A 1X3GA 4CKCA 1YNNC 1E2VA 3MZ5A 1YNXA 1HQMC 2BOSA 3SK4A 2VQEL 1STHA 2DUDA 1EWHA 3ULLA 1IYUA 2EXZA 2PZTA 4MHEA 2VB3X 2F0TA 1X55A 4X64L 4DPGA 4IO9A 4Y7NH 4C3IB 3GTJH 4HJ7A 4H13C 3H0GG 4AQYL 1L1OA 3OSOA 3DLLA 1TU2B 1UE6A 2F4VQ 2LMCB 4NPSA 1I4PA 3WWVA 4PMCA 4Y52H 1ENAA 4DR2L 3S15B 3IFDA 2JA5G 4GKJQ 2L4NA 3I55A 4O42A 4HJ8A 5I6WA 3CF5A 1STEA 1CTMA 3HOUG 1H95A 4A3FH 4R8NA 3BZKA 3TS0A 1SYBA 3CC4A 2LKVA 2RHQB 3J80i 2XRSD 3GTGH 3I4MG 4A3KH 1A2TA 1TWHB 2EOTA 2B39A 1XX8A 1Y14B 4RHRA 5JJIA 1EWCA 2NVXB 1FYCA 4EQNA 3D4DA 4ID6A 4UP7A 4A3BB 1PHJA 2KBNA 5C0XG 3AMUA 3VYSA 4O2DA 4JI3L 1IBKQ 2BDNA 1QILA 2JQOA 2SDFA 3LWEA 4GN3B 2VS1A 4F88A 2D5DA 2IHEA 1FNVA 4ZLTF 4DR4L 2YU9B 3RZDH 4J6HA 1EY6A 1F2LA 4TVAB 3CCRA 2R7DA 3K7AB 1TWAB 3I8ZA 2HIXA 1JJ2A 1F2MA 5M5XH 3NSWA 2EXDA 3SGIA 4JI6L 2ZJRA 3UDGA 1K8OA 3KJOA 2CFMA 2MO0A 3AU7A 3E9IA 2AWNA 2C5CA 2KOLA 4DV0L 2B2VC 2JEBI 3DXJC 1EYDA 1IBMQ 4HEDA 4ZUIA 5IGDA 2QW7A 4P75A 4OGQC 4DNTB 4CJ1B 2DNEA 1S40A 1TY0A 3DMUA 1YNJD 5BR8L 4A3DG 4DN4M 1VQHA 3OYYA 1UE7A 3KLRA 3OPOA 2PCFB 3D4WA 1SYCA 4C1NI 4BXXG 2UXBQ 3CAMA 3VA5A 5I4DA 3PMFA 4CDFC 2R6GA 3WOEA 1S4ZA 1K8MA 3DUZA 2MP1A 1I3QB 3HFZB 3H94A 3MHBA 2A1AA 2EYFA 3U4ZA 4FF3A 2A19A 3TDQA 4JOIC 4BBRH 4JW0A 4GLVB 4KI0A 1PTOB 2F4VL 1E7ZA 2F0MA 3PUXA 1Y1VH 3PO2B 4FP5D 4XT3B 5C4HA 5I9OA 4PZ8A 1EZ6A 1V8QA 1SNMA 2LXKA 2SNSA 1OXXK 4JYAQ 1XNQL 1PVOA 2K28A 4A3MH 2CH4W 1C7YA 5IWAL 4JI6Q 3ONAB 3RLOA 3TBIB 2Q2UA 1NCVA 5FK9C 3F1ZA 1QUQA 1NBWA 4FNFA 4RG1A 1JORA 2FMMA 4RGNA 3VYTA 4DV4Q 1EOVA 1IBML 2UUAQ 1HH2P 1PLFA 2JA8H 3RN2A 1DM0B 1KLUD 3IFTA 1D5ZC 1HA5A 4IFDI 3QWNA 3WDNA 4RKBA 1JOQA 4V0BA 2XIWA 4DR1L 3SXHA 1YI2A 4HMJA 2NB0A 1STGA 1CSPA 5IODA 3BDOA 2JYOA 4QL5A 3R93A 4N8X1 2G5DA 1D8LA 5C4ZA 1X54A 4LF5L 3HOZH 1NTGA 4PMBA 5LHY1 3PUVA 3STBC 3JC66 3TRZA 3M7NA 2LY7A 5FOBB 1EUJA 3FMCA 2AUJD 4ZYSA 4NXMQ 4I7AA 1WD0A 4UP8A 2KCCA 5HY6A 5C44H 4C3JB 2PZUA 1R9TH 5K36H 2L9HA 4OO1H 1XJVA 1VQEA 2ZTCA 1DCZA 2YYZA 2IY5B 2F0GA 1EOTA 2MUYA 3KBXA 3W1BA 1XNQQ 1BF4A 1IBLQ 2HT1A 1D7QA 3FRPB 4RCOA 3FKIB 5EKKA 3S16B 1QVGA 5D3IB 2FINB 3CCJA 2ICIA 1PZID 2J7ZA 3U9OA 1JE5A 1UAPA 1G91A 2VW9A 3HZXA 2EZVA 4JK1C 5K5PA 2R61A 3GTQB 4A3IB 2WAQE 4JI5L 4DUYL 3OMGA 3X3MA 1EY5A 5JEAJ 4X3SA 1N36L 1EY9A 2Z6BA 5I6YA 1FL0A 1O7LA 4RAUC 2EDGA 1LT4D 1Q7YC 2VQEQ 2NZOA 3ND9A 3C1FA 4KTAA 1B4OA 1WCMG 5C44B 2P5ZX 4EX5A 1BBXC 5GROA 5M5WH 1G291 4RGMA 4DAVA 1ENFA 3T1HQ 3RZOH 3BS1A 4A3JH 3FDTA 5LL6X 5KIXA 3M4QA 3K5NA 4IURA 3I7FA 4IFDH 2LSSA 1EYAA 2OCEA 3H3VI 1O80A 5F2DA 3DHQA 2JA6G 4HSVA 3C2PA 2FXQA 2K50A 1BBWA 3FVQA 1H9SB 2I5MX 1PRTF 1E2WA 5GQOA 1TS4A 4DR6L 4BY7H 1A6XA 1EY8A 3NBHA 3HOYB 1MIUA 4RH6A 1EWIA 3CW2C 1F77A 5CV6A 4OIKA 1Q46A 2XWJB 5DEHA 5M5XB 1EYCA 4J1MA 1T9HA 4R1JA 3D6WA 4JI3Q 2A68D 3LNNA 3J7YW 3RZDB 1X65A 2ZJQA 4NMZA 4K6LA 1GUOA 3VR5A 3T1YQ 1VQOA 3S1QB 4OO1I 1SAPA 2KQ3A 4P2CB 3D6CA 2JA9A 3EFXD 1I94L 1R4PB 2O5IC 4LF8Q 2YV5A 1A0IA 3Q23A 2HDMA 5JEAG 1TWAH 2BA0A 2ZTEA 3MA2B 1X3FA 4DR4Q 1TXYA 3O13A 1Y8OB 4KMUC 5FJ8G 2PW5A 2K05A 4A75A 4LK1C 2IHFA 1P8LA 1SYGA 4XXEA 4ZCKA 1PYSB 5FJ8H 3KDFB 4DR3Q 4XIGS 1IXRA 3ERSX 2RKSA 1C48A 2LFNA 3GV6A 3IAYA 1N32Q 1EL0A 2C9OA 2ZXRA 2ENBA 4K2LA 5HGQA 1V1QA 3H0GH 5EPKA 2F0KA 3QB3A 2LXJA 3F2BA 2RSNA 4JPBW 4QB4A 3K57A 1MD2D 4DV5L 4LF6Q 3I70A 3PCOB 2OXPA 4DV3L 5J3BA 1BVSA 1KNAA 3T1YL 3J81j 1AEXA 4OWTB 1Q90A 1HFGA 3I73A 3U4VA 1MBYA 1LTTD 5LMUQ 1JMCA 2R7ZH 2Z4HA 1Q1EA 2E2JB 4IQZA 3A8JE 1Q8KA 3CCEA 3NWTA 3TEHB 1UE5A 4BA2I 1STAA 3OW7A 1LUZA 2NN6I 1VQ6A 1GUSA 2LS01 2CVRA 4KN7C 5M9OA 1SMXA 5L37A 1JB3A 2A6ED 3OTOQ 1FJGL 2ZM6L 1D5MC 4ZK9B 2EYJA 1PH6A 2OTJA 3CKIB 4CDDC 3CPFA 2DJFC 3SK5A 2RDFA 3KBGA 4KJNA 4Q0FA 2TSSA 1EIHA 1NR4A 2MGSA 3CQZB 3AEVA 1CI3M 1X56A 2NN6G 5C5LA 1HNXL 1HNZQ 4U68A 4J15A 3GTLB 4RMFA 5E3FA 5A2QE 1XXGA 2L1BA 4DGZA 5IWAQ 5H1SE 1WVLA 1XPOA 4LF4Q 3GTMB 5CC4A 1WTRA 4FVMA 1L1OB 1BDOA 1TWFH 5HURA 5IE8A 4PNYA 4OWWB 3S15H 5I9PA 4B3TL 2EY6A 2H5XA 5IYCH 2CHBD 1HQRD 4NXML 4OWXB 2V4DA 4L5QA 4C3HH 4DFAA 1A3UA 1YJNA 5ELOA 1CHPD 4NKLA 1R4QB 5KYIA 5C0XI 5C3EB 1TWFB 2B2YA 1VQMA 3S2HB 4IUUA 4JV5L 1M8AA 3GTMH 5D3DA 4ME3A 3J7AF 2JA7G 4HIKA 2WV6D 4EQ5A 2QCPX 3GV3A 3HOVG 2CH4A 2ZM6Q 1YJWA 3PGZA 1Q82C 4B3RQ 5AJ3L 4A3BG 4NXNL 3VR4A 4KY7A 3S2DH 1SNPA 4QQBX 3S1QH 1CKOA 1XMOQ 2V1CC 4QCLA 4NP5A 2UXDQ 5LMUL 3M7GA 4OELB 4JC0A 3B6YA 1PTOD 5FLXL 1XWEA 3VYRA 1BQQT 4YWMA 1HNWL 1RTNA 4KKSA 5C0XH 4R4TA 2L12A 1SFOB 4KHPQ 3L7ZC 2DY7A 4CJ2C 4XQJA 3HOYH 2J4XA 2ZT9C 2FMCA 1WTOA 1DJRD 3M9BA 4RGOS 2OF1A 1V43A 1STBA 3K5MA 2UUCQ 3QJYA 1ASZA 1GKHA 4O0AA 1WOCA 1JWMD 1MJCA 3H0GB 4LF9Q 2K52A 2WKDA 2WINB 2DGYA 4A3JB 1E1TA 2F0SA 4LF7L 4LF4L 1MHWC 3I4NB 4HMIA 1LTSD 1UEBA 5LMNW 1VQJA 2JSOA 1AZQA 3PIO3 3HOWH 2L5TA 4N8FA 3S1RH 2R92B 1SDFA 3CC7A 1ENCA 1GM5A 3HOUB 1XMOL 2B2TA 2K04A 4B08A 2UXDL 1EY7A 4A3LH 4CGYB 1KDAA 3K8AA 3MFYA 1PH2A 4YWLA 1CZWA 3NUCA 3M85A 1XNRL 1UE1A 2BH8A 4JI1L 3L3OC 1PH8A 4MN3A 1TY2A 1CZGA 4YCVA 3FEWX 1N33L 3SE0A 3SDZA 3GTQH 2F0JA 2N88A 4A3JG 2UXCL 1LT6D 2IL8A 3L0OA 4QMGA 2VQFQ 5CV5A 1PFBA 2QDBA 1TS5A 3TP8A 4CBVA 5G3LF 4C3JH 1LTGD 1G2SA 5E4WC 4KK7A 1SJED 3HS0C 2EY5A 2E2HH 4J8QA 3J81E 1DYQA 3MFGA 1XPRA 2JA6B 4DUZQ 1T5EA 3AQQA 2EJGC 4WORA 3KK7A 3M3YB 3MWYW 4BY7B 3SHLA 3TZDA 1IYVA 1NUCA 4A3GG 3Q6SA 1BCPB 2YTXA 4DV6Q 1KIXA 1L0YB 1SE4A 4LFBQ 4GLXA 3BVMA 3S2DB 4DKAC 4WJWA 1B53A 3L2PA 1FR3A 4R9WA 4JI2L 5BN3A 2NVTH 4K0KL 1HPCA 4R4QA 4GKJL 1QNUA 3NE5B 3NHHA 3ND8A 3EA6A 3FPUB 4NB3A 4LFAQ 3QG1A 1PMRA 3A7LA 4M1UB 4CHTB 3HOVH 2NWGA 2XN9C 4LUVA 4DR3L 2A68C 1EEID 3A7AB 2F0NA 4BBSG 1FNWA 3DM3A 1L0WA 1PZJD 4F87A 4BWGB 5DLQE 1FJGQ 3GTPB 2YTVA 3H09A 1PRTC 1RTOA 4Q5VA 1PTOC 4H0LC 2JA7B 4MZ9A 1CA5A 4JG2A 3HG9A 1LTLA 4RA8A 5KEEA 2AHOB 4TRDA 1J6QA 1VQKA 1M90C 3W3AA 2XNAC 3MTSA 4PZ6A 3FKIH 2OTLA 1JJCB 2E5LQ 1IL8A 2IX1A 2Z8LA 1OXUA 1NR2A 1QWYA 5ELFA 2F03A 2Y0SB 5KNDA 1LLRD 5IGCA 1EFWA 3GTLH 1QB5D 1SRUA 5IIFA 1Y1WB 1ILPA 4BBRB 2EE1A 3NQIA 1A63A 1V1OA 4KD4A 4X6AH 1FD7D 4AH6A 4A3GB 1JOOA 4OX9L 2K5VA 3HOXB 2JA5B 3I4OA 2AWOA 2L0CA 1G51A 4A93G 1U5KA 1CSQA 1UEAB 4GKKL 4K5WA 5IT9L 4ODGA 3S1MH 3BDLA 1F9PA 1KDBA 3S1NB 2J0TD 3AB9A 3TZUA 1LTBD 3RNUA 3VR2A 4XT1B 2NZHA 5BR8Q 1E2ZA 4OXPA 1PRTB 3BG3A 2I07B 3M4YA 4GNXC 4DV2Q 4L5SA 1N34L 2MHVA 1SR3A 5GADC 2WFWA 1AE2A 1Q3LA 2A6HC 1F9QA 2FFKB 1MSHA 1NE3A 4PG3A 4QY7A 3OIQA 5M3FH 4BBRG 3I90A 1Y1WG 2MFIA 4KJOA 1S5ED 4B3TQ 2CQAA 1WD1A 1SNDA 3GO5A 3I4MH 2B29A 4FXDA 4A3DB 1VQ4A 1PA6A 5A2QL 3G71A 4YY3Q 4X62L 2GN5A 3IKJA 4GOPC 4LF8L 1C8CA 1TVXA 4K8IA 2EIFA 5CBEE 4IJHA 4O1NA 1G6ZA 1H9MA 4CDEC 2NVXH 1F9SA 1VQFA 3LGJA 4ZAIA 4DV1Q 3G6JB 3KF8B 4YCUA 2ID0A 1WYDA 4L8JA 2F0FA 4TQUS 4AYBE 4AQYQ 4A3LG 5DM63 3D8GA 1X3EA 3A8IE 5ELNA 1CHQD 1PZKD 3RLNA 1EQVA 2B2UA 2F3WA 2HCCA 5JAVA 2JXMB 3GD7A 4A3FB 2M9VA 1Y1VB 2X69A 4F8MA 4GNXA 2EY1A 1S5DD 3ERQA 2E75C 4S3SA 2I0QA 1RKNA 4IUVA 2NVYH 2WB1G 3S24A 4DR2Q 1WTQA 4LF9L 4GLAC 1VQBA 3N6RA 1GD7A 1GHJA 1I6VC 1U4RA 3BVZA 4G7ZC 1AP0A 2XTIA 1HZ9A 3T4AC 2Q2IA 4BXXH 4HIMA 3RD4A 4C2MB 2KVMA 4B3ML 1YITA 2Q2HA 3GQBA 4ZRZA 2Z6KC 1IHZA 1L0XB 1TT2A 3S9WA 1YIJA 4KV6A 2XGTA 2QGQA 4Y7NB 3GTJB 5EPLA 1DZ1A 4JI4L 3PUYA 3TSSA 2PNHA 2D0PA 2D9UA 2PQEA 3TN2A 2GVAA 4A3FG 4GS3A 2R7ZB 2K75A 2IW3A 2O2LD 2K14A 2B2TC 2PPBC 1JB7A 3F2DA 4C3IH 1PFNA 3PUZA 2EYMA 1B50A 1MKHA 1I4GA 4GN5A 5HGTA 1S72A 5CGKA 1DOKA 1KRSA 1NMFA 3Q0AA 4XYQA 3K0YA 3S1MB 4IFDJ 4C2MH 1N33Q 5IGGA 2YTYA 3TP6A 4A3BH 1O7ZA 2NTTA 2KEEA 2UXCQ 1X6OA 1U4MA 2PI2E 4CKEA 4KD3A 3PO3B 4F7XA 2CWAA 1GVPA 2K32A 3ICEA 4N9TA 3TP7A 4X66Q 1T5XD 1W2BA 4C56C 5C5MA 4KKTA 1XPUA 3RUZA 1QZGA 1J5EQ 4WRDA 1PFMA 3V96A 2F0IA 1EQRA 5FO9B 2KHSA 1K8AC 2JA5H 4JI4Q 4K0KQ 3TQYA 1KL9A 1L2FA 1Z6HA 2X6GA 3L9AX 4L5TA 4DV6L 2VB2X 4IZ8A 1HRJA 4XDXA 1W3SA 4EVOA 4ZKBB 1I4XA 1Q81C 1CUKA 2QDLA 2UU9Q 3CRLC 1DOLA 3GTPH 4XYOA 5FLXE 3S14H 3BJUA 1GUWA 3CU7A 4CKBA 2N8NA 1IW7D 1RDPD 2WACA 1HZAA 2E8GA 1SYDA 3HOXG 2N3SA 4ULLA 3E9HA 5KGUA 3R2TA 1A15A 2GA4B 3PSIA 3OWEB 3U58A 3A55A 3MXNB 3OMCA 4LFBL 1AW7A 1RJTA 4HR7B 1O7YA 1LTID 1ZYRD 1VF5C 3NTHA 1D5XC 2B2UC 4K5XA 1SN8A 3CRKC 2E76C 2QKIC 1VQGA 3NWSA 1VQNA 2JEAI 3VR6A 5C4XB 4IUTA 3V05A 3S1NH 1DOMA 3OW2A 1IKLA 1CK1A 4WJ3M 2HQLA 1AZPA 1B3QA 4LJZC 1NAPA 1J5EL 2UUAL 2ES2A 2G9DA 1GUTA 1H9KA 3EBEA 5ELDA 1WFQA 4AIMA 1NMGA 3E3XA 4B3RL 1OTCA 1GOZA 1DXMA 1HHVA 3I56A 4DV7L 2VZAA 1JQYD 1NY4A 1Q8IA 1V9PA 4A3IH 1LYLA 4HN7A 2X6LA 3H6MA 3T53B 2B63H 4CDCC 3T13A 1ILQA 3CCVA 2E5LL 1CKNB 1EYGA 1VQCA 2RDGA 2E74C 3HGBA 2MJ8A 1H9SA 1JC7A 1JE4A 3A54A 3S16H 3NK9A 3H15A 4DXFA 4DK1A 1YHAA 5J22A 1G2TA 1S5FD 2WKCA 4FYDA 2B2VA 3NENA 4IPCA 3K58A 3OWFA 1HZBA 1BCPF 3HOZB 1KAAA 3GTOH 3K5OA 5J1ZA 3JAME 3PV0A 2KCNA 3EJIA 1I3QH 3VR3A 1HR0W 3HOVB 2EY2A 5FLXc 4XQQA 2F0LA 1I50H 1RIPA 4UHVA 5JEAH 2SNMA 1XTDA 1A8VA 4I65A 3LX0A 1V1PB 2EYOA 2XVSA 1U4LA 2WIIB 1EQTA 1X32A 4DV0Q 3Q22A 1VDZA 2WAQB 5IOCA 3G48A 5AFWA 1WCMB 4GNXB 1STYA 1SNCA 2F0PA 4K5VA 1TQOA 4DK0A 1E1OA 4KHZA 2A69C 1XMQQ 2B8FA 2Z9HA 3CMEA 1EY0A 1EU4A 4DUZL 2VUMG 1IBKL 3FP9A 4P72A 3M4OH 1F9RA 4A3MB 1B1ZA 3TREA 1G8ZD 3MXUA 3HEJA 1HNZL 1NNXA 1ONLA 4G7OC 3JAMi 2R7FA 2AQ1B 5C44G 4AYBG 3TP5A 2BE5C 4LFCL 3PO2H 4QIWE 2EJMA 1SNOA 1SFOH 1HTLD 2RQXA 4IUNA 3VA7A 1J8IA 2PMZE 4U673 5IP9G 3HOZG 1LO5D 3SEBA 3KYHC 1WTWA 1EY4A 1B9MA 5CV7A 3KLSA 3J81i 3MC0B 1SE8A 2R93H 5IYBG 1GJXA 1JCKB 1MSGA 2HD3A 2M00A 3NEMA 4HCEA 2IX3A 3HOUH 2QA4A 4JV5Q 2KHIA 1CA6A 2JN4A 1Q12A 1K3BC 1CKNA 1HCZA 1P16A 5LL6S 2UUBL 4DXGA 2B2WA 1KD1C 3URYA 2O5JC 3ULJA 1AH9A 5ELCA 5GAHC 4GZYC 4HIOA 2IJ0A 3CXCA 5JPNC 4DAYA 5I2YA 2XSCA 2Y0SE 2EJFC 2PO4A 2IT1A 2MPMA 2Z0SA 3T51B 5CV9A 5E1FA 2IWHA 4ALPA 1HR0L 5M5YB 4AYBB 2ZJPA 2L11A 4X64Q 4IUPA 3H3VC 2F0OA 2OEOA 5EGTA 2CW0D 2F1MA 1EIFA 1WTVA 1GUGA 2CKZB 5CV4A 2ALYB 2F4IA 2K03A 2PMZB 2Z6KA 1TWHH 1OXSC 4ZKCB 4KY6A 3GTGB 4X65Q 5ELEA 2PI2A 3CQZH 3K5LA 1B7YB 1JICA 1QNKA 4IN3A 1Y8PB 2BCOA 2IX0A 2KA7A 3UDFA 1I6HB 4A76A 3P1HA 3HOWG 2D0OA 5EQ0A 1E0BA 4UAIA 5IGFA 4C3HB 4GN4B 5GAGC 4YY3L 2ZXPA 5JOBA 4A4IA 3A8KE 3F8TA 3RR5A 5JVG3 2UUBQ 2F52A 3UE0A 2DY8A 2E2JH 5C3EH 1G6PA 4JI1Q 1B3AA 1N36Q 3FHWA 2DNCA 4DNIA 2MO1A 5CR3A 2XRQD 4DV2L 1A3VA 3PIPA 4HIDA 2NVQH 4A3CH 1HFNA 3DWQA 4ZUJA 1EFID 1B70B 2VL6A 1C9OA 3GP7A 3E6ZX 5IT9E 4DAPA 1YBYA 4LUZA 4BS9A 2FJ2A 5EPJA 1QUQB 1VMPA 4C3JG 1HUNA 4B3SL 1BCPC 3R2IA 2K5NA 2F0QA 3I72A 2B3GA 4OONA 3G4SA 4L63B 5JJZA 3D31A 4DAMA 2HQEA 2AKWB 3BYYB 1GUNA 1PRTD 2G9HD 4DR6Q 4JCVE 3J7AV 2XWBB 2A5HA 1N8RC 2K5QA 4A3IG 3F2UA 1HR0Q 2ZTDA 4UDUC 3J81c 1O7IA 2MNAA 1EIGA 5M3MG 3J7A5 1BXTA 4A3EB 5AJ3Q 2RVLA 4Z9CB 1HJPA 5K36G 2CCZA 4KKUA 2PQAB 4X3TA 4HTHA 1EZ8A 3CP0A 5KRUA 1EQQA 1VQPA 1FGBD 4OL7A 4IOAA 1BNZA 5DNFA 1JJGA 3BU2A 2PYKA 2K5HA 5IYBH 2BDOA 2JP1A 1MJEA 2OT2A 5NUCA 4X3KA 4IPHA 2KENA 4CJ0B 3I4MB 3J80c 4NXNQ 4L6TB 2JE6I 1SBBB 2F3IA 5DM73 1ET9A 4BBSH 4K2KA 3NP8A 1FVIA 1JWUD 5CYUA 1PYWD 5C3XA 3QO2A 1YEZA 1CQFA 1VQ5A 3J80E 2EYHA 1ESRA 1JWSD 1I4HA 3PIOA 2TMPA 3EVQA 4C3IG 1XMQL 3R3OA 3SVMA 3GDEA 3HOYG 5C3EG 3NTIA 4DNRB 4M8AA 4DAYB 2F0HA
chains in the Genus database with same CATH topology
5ISRA 5CMDA 1S5CD 3J81L 1D1KA 2VUMB 4PQXA 4R8IA 4KHVA 1LV9A 3HKZB 1HA6A 4PMWA 5A35A 3GTKB 3T56B 2H4OA 3KUPA 3NXWA 2QEJC 3D3RA 4RHSA 5T1GA 1Z7TA 3IL8A 1QE6A 5JVH3 5COYA 1ET6A 5FO8B 3Q24A 5IGEA 2HUGA 1C4QA 2F0EA 3DWPA 5C6AA 3RZOB 1ZXTA 1EEFD 2F3VA 1Y69U 1ZKOA 2A6HD 1CQVA 4EQOA 1OXVA 1ML0D 1SJHD 1D6EC 1J9OA 4ABNA 3VYUA 1B44D 1CM9A 5M3MB 2NN6H 2EPBA 1Q1BA 2F0DA 5G3LD 1QJOA 2HCIA 5J39A 5CORA 3MVVA 4B9XA 4PV1C 1SEBD 2E2IB 4KY5A 4V190 1CFMA 4XTCS 4G4KA 1Z47A 1X3PA 1A2UA 2K1BA 5C3WA 2AQ2B 2BA1A 3T16A 1SE2A 1NSNS 1ICWA 1BCPD 4DA2A 1F2ZA 2K5DA 1BOSA 1BR9A 1U4PA 2K33A 1UNSA 4FXKC 2K6AA 3E0JA 3S1RB 4ZQ3A 5EBDA 1AN8A 1SYFA 2F0UA 5T1IA 4NW2A 3QOLA 4C1NK 2PNRC 3V2TA 5DAUA 4FXGC 1RHPA 1RCVD 4C3HG 1KLGD 2QF7A 2Z4IA 1PTOF 5BN5A 1KDCA 2Q8RE 2ZXOA 1II3A 1H9RA 2N55A 3U9SA 3R8BA 1JR0D 4NDXA 4LAAA 1PDQA 1SMYC 4DF7A 1B2TA 2Q8TA 1YNND 2NVYB 4KN4C 2NYZD 5IGBA 1GHKA 2B2YC 3SK8A 1LT5D 3EROA 4RWSC 4XQNA 1D2BA 2R3ZA 4TSSA 4QUCA 1D1IA 4A3KB 2NVQB 3QOJA 3HP3A 1A3TA 3N52A 1X3QA 4BY1B 1BO0A 4QIWB 3TMEA 3OHXC 4OHJA 4WFN3 4ILWA 3ZYYX 1TKWB 4G57A 3D4RA 4RGTA 2WP8J 2K7VA 1FNUA 3MXPA 4FF2A 4HAEA 4LMQD 1H9JA 2EYLA 3I91A 2KEDA 5EBCA 1DONA 2SOBA 3MXGA 4FF1A 1KABA 1HTPA 5ELBA 1TR5A 1AFPA 4RKLA 5D65A 1IKMA 1WTXA 1VF7A 2PZWA 2VXWA 3BVGA 2B8GA 5KNCA 1M4VA 3NPPA 2DN8A 4MIUA 2B2WC 2RBMA 3WOFA 2NTSA 1SE3A 3NBIA 3MEHA 1OXTA 1I4RA 2HDLA 3OOCA 3I3CA 3K59A 2D2CC 3RMHA 2H1EA 3S17B 3FPPA 4QUFA 1TS3A 5KNBA 2ICEC 2K5WA 3SK6A 5TSSA 3X3NA 5M3FB 1BUVT 2SEBD 4ME5A 4A93B 3DWAA 2L55A 3UI2A 1JOKA 2NZ1D 2AUKA 3RLFA 1O78A 2K01A 1W6JA 4K6DA 2D62A 1LABA 1IW7C 2R93B 3P75A 1EU3A 2RDHA 4K14A 3K6OA 1CT1D 4TKOB 1ESFA 2A69D 5EKIA 1B9NA 4YIJA 1SMYD 1YNJC 3C46A 1PXUA 2M2LA 5EJWA 3M4OB 1HXYD 1I4QA 2WB1B 1SYEA 1STNA 2KUMA 5C4JB 2AQ3B 2F0VA 1Y8NB 1TWCB 3P20A 1SXTA 2A6EC 3DEOA 5KYLA 2E2HB 2FHTA 2KJXA 2A73B 1SNQA 1QOHA 4G7HC 5CBAE 4EGVA 3H91A 4OO1G 5D14A 1KNEA 3A56A 1V1PA 3KF8A 1MGSA 3J80L 4IFDG 2RSOA 3BZDB 3G7LA 2Z1CA 4H44C 2E2DC 1LACA 1I50B 1KTKA 4E6IA 4H7BA 1UUPA 3W2DA 5M5WB 2NUCA 3PIP3 3DEPA 2Q8IB 4RFBA 5C0XJ 2NVTB 1DD2A 2QILA 1LTAD 3JAML 3HOWB 4X3UA 2O4XA 3E5SA 1HUMA 2CW0C 2JA8B 4OIJA 4IUQA 1TIID 5EKLA 1RF2D 5BN4A 3NQTA 3HRZC 2I46A 2B63B 4HCSA 3ITPA 4BA1I 1TWGB 3MAQA 3C3LA 4JBWA 4B9WA 1OO9B 1ZYRC 1VCIA 1WTPA 1R9TB 5FKAC 2VNUD 3CHBD 3KLSX 5E4XA 1ZEQX 1F2YA 1LT3D 2IPKD 4IALA 3BDCA 3C1EA 5FO7B 3NTKA 1XTCD 1QCBD 4EQPA 4BBSB 1RD9D 1S5BD 3GTOB 1VMCA 3MXNA 3LWUA 4RCNA 2RA4A 3S14B 3OIPA 2KECA 3DM1A 5I2XA 1SSOA 4K8JA 1TS2A 1XYIA 2EVBA 5CV8A 1K83B 1U9RA 4DU9A 1LTRD 1QG7A 2PW7A 2BE5D 4QF4A 4I7ZC 3I4LA 5JPMC 2NBFA 4N9PA 4HSPA 2A74C 2EYPA 1RODA 1MI2A 3QIAA 4FF4A 3EQLC 1W6KA 2F0WA 1PTOH 3BYTB 4FO2A 1GXDC 3P7JA 3PUWA 3SR1A 4CKCA 1YNNC 1E2VA 3MZ5A 1HQMC 2BOSA 3SK4A 1STHA 1EWHA 1IYUA 2EXZA 2PZTA 4MHEA 2VB3X 2F0TA 4C3IB 4H13C 3OSOA 1TU2B 2LMCB 1I4PA 4PMCA 1ENAA 3S15B 3IFDA 2L4NA 4O42A 5I6WA 1STEA 1CTMA 4R8NA 1SYBA 2LKVA 2XRSD 1A2TA 1TWHB 2EOTA 2B39A 1XX8A 4RHRA 1EWCA 2NVXB 1FYCA 4EQNA 3D4DA 4ID6A 4A3BB 5C0XG 3AMUA 3VYSA 2BDNA 1QILA 2SDFA 3LWEA 4F88A 2D5DA 4ZLTF 1FNVA 2YU9B 4J6HA 1EY6A 1F2LA 3K7AB 1TWAB 3I8ZA 1F2MA 3NSWA 1K8OA 3AU7A 2AWNA 2C5CA 2KOLA 2B2VC 2JEBI 3DXJC 1EYDA 5IGDA 4HEDA 4ZUIA 4DNTB 4OGQC 4CJ1B 2DNEA 1TY0A 3DMUA 1YNJD 4DN4M 3KLRA 3OPOA 2PCFB 3D4WA 1SYCA 4C1NI 3VA5A 5I4DA 3PMFA 2R6GA 3WOEA 1S4ZA 1K8MA 3DUZA 2MP1A 1I3QB 3H94A 3MHBA 2EYFA 4FF3A 3TDQA 4KI0A 1PTOB 2F0MA 3PUXA 3PO2B 4FP5D 4XT3B 5C4HA 5I9OA 1EZ6A 1V8QA 1SNMA 2SNSA 1OXXK 2K28A 3ONAB 3TBIB 1NCVA 5FK9C 4FNFA 1JORA 2FMMA 4RGNA 3VYTA 1PLFA 1DM0B 1KLUD 3IFTA 1D5ZC 1HA5A 4IFDI 3QWNA 3WDNA 4RKBA 1JOQA 4V0BA 2XIWA 3SXHA 4HMJA 2NB0A 1STGA 5IODA 3BDOA 2JYOA 3R93A 5C4ZA 4PMBA 5LHY1 3PUVA 3M7NA 2LY7A 5FOBB 3FMCA 2AUJD 4ZYSA 1WD0A 2KCCA 4C3JB 2PZUA 5K36H 2L9HA 4OO1H 1DCZA 2YYZA 2F0GA 1EOTA 2MUYA 3KBXA 1BF4A 3FRPB 4RCOA 3FKIB 5EKKA 3S16B 5D3IB 2FINB 2ICIA 1PZID 2J7ZA 3U9OA 1UAPA 1G91A 3HZXA 2EZVA 4JK1C 5K5PA 2R61A 3GTQB 4A3IB 3OMGA 3X3MA 1EY5A 5JEAJ 4X3SA 1EY9A 5I6YA 1O7LA 4RAUC 2EDGA 1LT4D 3ND9A 3C1FA 4KTAA 1B4OA 5C44B 1BBXC 1G291 4RGMA 4DAVA 1ENFA 3BS1A 3FDTA 5LL6X 5KIXA 3K5NA 4IURA 4IFDH 1EYAA 1O80A 5F2DA 3DHQA 4HSVA 3C2PA 3FVQA 1H9SB 1PRTF 1E2WA 1TS4A 1A6XA 1EY8A 3NBHA 3HOYB 4RH6A 1F77A 5CV6A 4OIKA 2XWJB 5DEHA 5M5XB 1EYCA 4J1MA 3D6WA 2A68D 3RZDB 3LNNA 3J7YW 4NMZA 4K6LA 1GUOA 3VR5A 3S1QB 4OO1I 1SAPA 2KQ3A 4P2CB 3D6CA 3EFXD 1R4PB 2O5IC 3Q23A 2HDMA 5JEAG 2BA0A 3MA2B 3O13A 1Y8OB 4KMUC 2PW5A 2K05A 4LK1C 1SYGA 4XXEA 4XIGS 2RKSA 1C48A 2LFNA 3GV6A 3IAYA 1EL0A 2C9OA 2ZXRA 2ENBA 4K2LA 5EPKA 2F0KA 3QB3A 2RSNA 4QB4A 3K57A 1MD2D 3I70A 2OXPA 1KNAA 1AEXA 1Q90A 1HFGA 3I73A 1MBYA 1LTTD 2Z4HA 1Q1EA 2E2JB 4IQZA 3A8JE 3NWTA 4BA2I 1STAA 3OW7A 2NN6I 1GUSA 2LS01 2CVRA 4KN7C 5M9OA 1JB3A 2A6ED 1D5MC 4ZK9B 2EYJA 3CKIB 3SK5A 2RDFA 3KBGA 4KJNA 4Q0FA 2TSSA 1EIHA 1NR4A 2MGSA 3CQZB 1CI3M 2NN6G 5C5LA 4U68A 3GTLB 5E3FA 5A2QE 1XXGA 2L1BA 4DGZA 1WVLA 3GTMB 5CC4A 1WTRA 4FVMA 1BDOA 5HURA 4PNYA 5I9PA 2EY6A 2CHBD 1HQRD 2V4DA 4DFAA 1A3UA 1CHPD 4NKLA 1R4QB 5KYIA 5C0XI 5C3EB 1TWFB 2B2YA 3S2HB 4IUUA 1M8AA 5D3DA 3J7AF 2WV6D 2QCPX 3GV3A 3VR4A 4KY7A 1SNPA 4QCLA 4NP5A 3M7GA 1PTOD 5FLXL 1XWEA 3VYRA 1BQQT 1RTNA 4KKSA 5C0XH 2L12A 1SFOB 3L7ZC 2DY7A 4CJ2C 4XQJA 2J4XA 2ZT9C 2FMCA 1WTOA 1DJRD 4RGOS 2OF1A 1V43A 1STBA 3K5MA 3QJYA 1JWMD 3H0GB 2WKDA 2WINB 4A3JB 2F0SA 3I4NB 4HMIA 1LTSD 2JSOA 1AZQA 3PIO3 2L5TA 2R92B 1SDFA 1ENCA 3HOUB 2B2TA 2K04A 4B08A 1EY7A 4CGYB 1KDAA 3MFYA 1CZWA 3NUCA 3M85A 3L3OC 4MN3A 1TY2A 1CZGA 3FEWX 3SE0A 3SDZA 2F0JA 2N88A 1LT6D 2IL8A 4QMGA 5CV5A 1PFBA 2QDBA 1TS5A 3TP8A 4CBVA 5G3LF 1LTGD 1G2SA 5E4WC 4KK7A 1SJED 3HS0C 2EY5A 4J8QA 3J81E 1DYQA 3MFGA 2JA6B 1T5EA 2EJGC 4WORA 3KK7A 3M3YB 3MWYW 4BY7B 3SHLA 3TZDA 1IYVA 1NUCA 3Q6SA 1BCPB 1L0YB 1SE4A 3BVMA 3S2DB 4WJWA 1B53A 1FR3A 4R9WA 5BN3A 1HPCA 1QNUA 3NE5B 3NHHA 3ND8A 3EA6A 3FPUB 3QG1A 1PMRA 3A7LA 4M1UB 4CHTB 2NWGA 2XN9C 2A68C 1EEID 3A7AB 2F0NA 1FNWA 1PZJD 4F87A 4BWGB 3GTPB 3H09A 1PRTC 1RTOA 4Q5VA 1PTOC 4H0LC 2JA7B 1CA5A 3HG9A 4RA8A 5KEEA 4TRDA 3W3AA 2XNAC 3MTSA 2IX1A 1IL8A 2Z8LA 1OXUA 1NR2A 1QWYA 5ELFA 2F03A 2Y0SB 5KNDA 1LLRD 5IGCA 1QB5D 5IIFA 1Y1WB 1ILPA 4BBRB 2EE1A 3NQIA 1V1OA 4KD4A 1FD7D 4A3GB 1JOOA 3HOXB 2JA5B 2AWOA 2L0CA 1UEAB 4K5WA 5IT9L 4ODGA 3BDLA 1F9PA 1KDBA 3S1NB 2J0TD 3AB9A 3TZUA 1LTBD 3VR2A 4XT1B 1E2ZA 1PRTB 3BG3A 2I07B 3M4YA 2MHVA 1Q3LA 2A6HC 1F9QA 2FFKB 1MSHA 3OIQA 3I90A 1S5ED 4KJOA 2CQAA 1WD1A 1SNDA 3GO5A 4FXDA 4A3DB 5A2QL 3IKJA 1C8CA 1TVXA 4K8IA 5CBEE 4O1NA 1G6ZA 1H9MA 1F9SA 4ZAIA 3G6JB 2ID0A 4L8JA 2F0FA 4TQUS 5DM63 3D8GA 3A8IE 1CHQD 1PZKD 1EQVA 2B2UA 2F3WA 2HCCA 5JAVA 2JXMB 3GD7A 4A3FB 2M9VA 1Y1VB 2X69A 4F8MA 2EY1A 1S5DD 3ERQA 2E75C 4S3SA 1RKNA 4IUVA 1WTQA 3N6RA 1GHJA 1I6VC 1U4RA 3BVZA 4G7ZC 1AP0A 3T4AC 3RD4A 4C2MB 2KVMA 3GQBA 4ZRZA 1IHZA 1L0XB 1TT2A 3S9WA 4KV6A 4Y7NB 3GTJB 5EPLA 1DZ1A 3PUYA 3TSSA 2D9UA 2PQEA 3TN2A 2R7ZB 2IW3A 2O2LD 2B2TC 2PPBC 1PFNA 3PUZA 2EYMA 1B50A 1I4GA 5HGTA 5CGKA 1DOKA 3Q0AA 4XYQA 3K0YA 3S1MB 4IFDJ 5IGGA 3TP6A 1O7ZA 2NTTA 2KEEA 1U4MA 4CKEA 4KD3A 3PO3B 4F7XA 2K32A 4N9TA 3TP7A 1T5XD 4C56C 5C5MA 4KKTA 3RUZA 4WRDA 1PFMA 3V96A 2F0IA 5FO9B 2KHSA 2X6GA 1Z6HA 3L9AX 2VB2X 4IZ8A 1HRJA 4XDXA 4EVOA 4ZKBB 1I4XA 3CRLC 1DOLA 4XYOA 5FLXE 1GUWA 3CU7A 4CKBA 1IW7D 1RDPD 2WACA 1SYDA 4ULLA 5KGUA 3R2TA 1A15A 2GA4B 3OWEB 3A55A 3OMCA 1AW7A 1RJTA 4HR7B 1O7YA 1LTID 1ZYRD 1VF5C 3NTHA 1D5XC 2B2UC 4K5XA 3CRKC 3NWSA 2E76C 2QKIC 2JEAI 3VR6A 5C4XB 4IUTA 3V05A 1DOMA 1IKLA 1CK1A 1AZPA 4LJZC 1NAPA 2G9DA 1GUTA 1H9KA 5ELDA 1GOZA 1DXMA 1HHVA 1JQYD 1Q8IA 4HN7A 3T53B 2X6LA 3H6MA 3T13A 1ILQA 2RDGA 2E74C 3HGBA 2MJ8A 1H9SA 1JC7A 1JE4A 3A54A 3NK9A 4DXFA 4DK1A 5J22A 1G2TA 1S5FD 2WKCA 4FYDA 2B2VA 3K58A 3OWFA 1BCPF 3HOZB 1KAAA 3K5OA 5J1ZA 3JAME 3PV0A 2KCNA 3EJIA 3VR3A 3HOVB 2EY2A 4XQQA 2F0LA 5JEAH 2SNMA 4I65A 3LX0A 1V1PB 2EYOA 2XVSA 1U4LA 2WIIB 1EQTA 1X32A 3Q22A 1VDZA 2WAQB 5IOCA 5AFWA 1WCMB 1STYA 1SNCA 2F0PA 4K5VA 1TQOA 4DK0A 4KHZA 2A69C 2B8FA 1EY0A 1EU4A 1F9RA 4A3MB 1B1ZA 1G8ZD 3MXUA 3HEJA 4G7OC 1ONLA 2AQ1B 3TP5A 2BE5C 2EJMA 1SNOA 1HTLD 2RQXA 4IUNA 3VA7A 1J8IA 4U673 1LO5D 3SEBA 1WTWA 1EY4A 1B9MA 5CV7A 3KLSA 3MC0B 1GJXA 1JCKB 1MSGA 2M00A 4HCEA 2IX3A 1CA6A 1Q12A 1HCZA 5LL6S 4DXGA 2B2WA 3URYA 2O5JC 5ELCA 4GZYC 2IJ0A 5JPNC 4DAYA 5I2YA 2XSCA 2EJFC 2PO4A 2IT1A 2MPMA 3T51B 5CV9A 5E1FA 2IWHA 5M5YB 4AYBB 2L11A 4IUPA 3H3VC 2F0OA 2OEOA 5EGTA 2CW0D 2F1MA 1WTVA 1GUGA 5CV4A 2F4IA 2K03A 2PMZB 1OXSC 4ZKCB 4KY6A 3GTGB 5ELEA 3K5LA 1JICA 1QNKA 4IN3A 1Y8PB 2BCOA 2IX0A 2KA7A 1I6HB 3P1HA 5EQ0A 1E0BA 4UAIA 5IGFA 4C3HB 2ZXPA 5JOBA 3A8KE 5JVG3 2DY8A 1B3AA 2DNCA 5CR3A 2XRQD 1A3VA 1HFNA 3DWQA 4ZUJA 1EFID 3GP7A 5IT9E 3E6ZX 4DAPA 4BS9A 2FJ2A 5EPJA 1VMPA 4C3JG 1HUNA 1BCPC 3R2IA 2F0QA 3I72A 4L63B 5JJZA 3D31A 2HQEA 3BYYB 1GUNA 1PRTD 2G9HD 3J7AV 2XWBB 2A5HA 2K5QA 3F2UA 4UDUC 1EIGA 1BXTA 4A3EB 2RVLA 4Z9CB 5K36G 4KKUA 5KRUA 4X3TA 1EZ8A 4HTHA 1FGBD 4OL7A 1BNZA 5DNFA 2PYKA 2BDOA 2JP1A 2OT2A 5NUCA 4X3KA 4CJ0B 3I4MB 4L6TB 2JE6I 1SBBB 5DM73 1ET9A 4K2KA 3NP8A 1JWUD 5CYUA 1PYWD 5C3XA 3QO2A 1CQFA 3J80E 2EYHA 1ESRA 1JWSD 1I4HA 2TMPA 3EVQA 4C3IG 3R3OA 3SVMA 3NTIA 4DNRB 4M8AA 2F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISR A;  4IUN A;  4K5W A;  1NSN S;  5EKK A;  4ODG A;  2F0J A;  3VA5 A;  3BDL A;  3PMF A;  1KDB A;  3ITP A;  3MZ5 A;  4YIJ A;  4KHV A;  4QMG A;  3SK4 A;  2EYM A;  1STH A;  5CR3 A;  1EY4 A;  1F2Z A;  5CV5 A;  4G57 A;  5HGT A;  1A3V A;  2QDB A;  5CV7 A;  2EXZ A;  2PZT A;  2EYF A;  3MHB A;  3TP8 A;  3U9O A;  2F0T A;  4ZUJ A;  4B9W A;  2RKS A;  3HZX A;  5CGK A;  2M00 A;  3MXP A;  5K5P A;  2ENB A;  4K2L A;  2EY5 A;  2F0M A;  3H6M A;  5IGG A;  3OMG A;  3TP6 A;  3T13 A;  1EY5 A;  2F0K A;  4KY7 A;  3QB3 A;  1F2Y A;  3NXW A;  1EY9 A;  2EYL A;  5C4H A;  3OSO A;  5I6Y A;  4WOR A;  5I9O A;  4IAL A;  4QB4 A;  1SNP A;  4ZQ3 A;  3BDC A;  2F0U A;  1EZ6 A;  1SYF A;  4KD3 A;  3SHL A;  3C1E A;  1NUC A;  1SNM A;  3C1F A;  1SYE A;  2SNS A;  4F7X A;  2SOB A;  1STN A;  4KJO A;  2OXP A;  4KTA A;  1SND A;  4N9T A;  2F0Q A;  3NK9 A;  4NP5 A;  4PMC A;  3TP7 A;  2F0V A;  3QOL A;  4EQP A;  5C5M A;  1ENA A;  1KAB A;  1AEX A;  3RUZ A;  1TR5 A;  5J22 A;  2HQE A;  4RKL A;  4WRD A;  5IGE A;  3V2T A;  5KIX A;  5DAU A;  5I6W A;  5KYL A;  4K8I A;  2PZW A;  2F0I A;  3NHH A;  2F0E A;  5C6A A;  3OWF A;  1EYA A;  1SNQ A;  1JOR A;  2KHS A;  1KAA A;  4R8N A;  5F2D A;  3DHQ A;  1SYB A;  4MIU A;  2F3V A;  2LKV A;  5J1Z A;  1STA A;  4K8J A;  2RBM A;  3EJI A;  5CV9 A;  5E1F A;  2OF1 A;  4IZ8 A;  1A2T A;  5IGC A;  4EVO A;  2EY2 A;  2F0F A;  1STB A;  4NDX A;  5M9O A;  5CV8 A;  5KRU A;  1EZ8 A;  3D8G A;  3MEH A;  4HTH A;  4EQO A;  1U9R A;  2F0N A;  2F0L A;  1EQV A;  2F3W A;  5JAV A;  4DU9 A;  4EQN A;  1EY8 A;  4OL7 A;  2SNM A;  2F0O A;  2OEO A;  1KDC A;  2EYJ A;  3D4D A;  4ID6 A;  4RKB A;  2PW7 A;  5EGT A;  3SXH A;  4I65 A;  5CV6 A;  3LX0 A;  2EY1 A;  4F8M A;  4QF4 A;  1II3 A;  3ERQ A;  2EYO A;  2PYK A;  2RDF A;  4S3S A;  5CV4 A;  1RKN A;  4KJN A;  5DEH A;  3SK5 A;  4HMJ A;  1JOQ A;  1EYC A;  4J1M A;  5NUC A;  2WAC A;  5IOC A;  1STG A;  4KY6 A;  4N9P A;  5IOD A;  4E6I A;  2F0S A;  1STY A;  5C5L A;  4H7B A;  1SNC A;  4J6H A;  4LAA A;  1SYD A;  1EY6 A;  2EYP A;  1TQO A;  2F0P A;  4K5V A;  5KEE A;  3SK6 A;  4HMI A;  4NMZ A;  5KGU A;  2F0D A;  4TRD A;  5C4Z A;  4DF7 A;  2NUC A;  4ME5 A;  4PMB A;  1F2M A;  5E3F A;  5J39 A;  3OMC A;  4DGZ A;  2KQ3 A;  1JOK A;  3D6C A;  1EY0 A;  5IGB A;  1ENC A;  5CC4 A;  3P1H A;  3SK8 A;  5HUR A;  3MVV A;  2F0W A;  1IHZ A;  1TT2 A;  2O4X A;  4K2K A;  3NP8 A;  4K6D A;  4PNY A;  4B9X A;  5I9P A;  2EY6 A;  4KV6 A;  1SNO A;  3E5S A;  3ERO A;  3S9W A;  5C3X A;  5IGF A;  1EY7 A;  3HEJ A;  4KY5 A;  5IIF A;  1EYD A;  1KDA A;  2PZU A;  4K5X A;  2EYH A;  4ZUI A;  4KD4 A;  5IGD A;  3NUC A;  1A3U A;  4DFA A;  1JOO A;  3P75 A;  2PW5 A;  3QOJ A;  3DMU A;  1A2U A;  2PQE A;  3EVQ A;  3R3O A;  4K14 A;  3TP5 A;  5C3W A;  2F0G A;  4NKL A;  5JOB A;  1A3T A;  5EKL A;  5KYI A;  1SYG A;  3T16 A;  3D4W A;  3SR1 A;  1SYC A;  3TME A;  3NQT A;  2F0H A; 
#chains in the Genus database with same CATH topology
 5ISR A;  5EAY A;  5CMD A;  1S5C D;  3J81 L;  1D1K A;  2VUM B;  1VQ9 A;  4PQX A;  4R8I A;  1CKM A;  4LF5 Q;  2WAQ G;  3IRB A;  4KHV A;  3HOX H;  1LV9 A;  5LMN L;  1VQ8 A;  2OWO A;  3M3Y H;  3CC2 A;  4A3G H;  3HKZ B;  1HA6 A;  4DV4 L;  2JA6 H;  1A62 A;  4PMW A;  5A35 A;  3GTK B;  3T56 B;  4JI0 Q;  2H4O A;  3KUP A;  1VQI A;  3NXW A;  5GAE C;  2QEJ C;  3D3R A;  5FLM H;  4RHS A;  5T1G A;  1YHB A;  2RCF A;  1Z7T A;  3IL8 A;  1QE6 A;  1WCM H;  5JVH 3;  5COY A;  1ET6 A;  2HHH L;  5FO8 B;  3Q24 A;  3W5O A;  2JA7 H;  1IYJ B;  5IGE A;  4DK3 C;  2HUG A;  1C4Q A;  3K7U C;  4H02 A;  2F0E A;  3DWP A;  5C6A A;  4MTN A;  1IBL L;  3RZO B;  4LF6 L;  1ZXT A;  1EEF D;  4QJF A;  2RF4 A;  3TS2 A;  2F3V A;  1Y69 U;  1ZKO A;  2A6H D;  4YWK A;  5M3M H;  1CQV A;  4P71 A;  4EQO A;  1OXV A;  2L15 A;  1RL2 A;  1ML0 D;  2OQ0 A;  3VDY A;  1SJH D;  1D6E C;  4OEM B;  1J9O A;  4ABN A;  3VYU A;  1XNR Q;  1M1K C;  4POF A;  3A74 A;  4DUY Q;  4JI5 Q;  5IP7 G;  1B44 D;  4DV1 L;  5C4X H;  1CM9 A;  4APV A;  5M3M B;  1K28 A;  2NN6 H;  2EPB A;  1Q1B A;  1K0R A;  2F0D A;  5G3L D;  1QJO A;  2HCI A;  2JJQ A;  5J39 A;  3H3V H;  1L1O C;  5COR A;  1HZC A;  1VQ7 A;  4UPA A;  4DV7 Q;  3MVV A;  1K8G A;  4B9X A;  4PV1 C;  1SEB D;  2E2I B;  4YHH L;  1HNX Q;  4KY5 A;  4V19 0;  1CFM A;  3KOJ A;  4XTC S;  2HHH Q;  4G4K A;  1Z47 A;  1X3P A;  1LM0 A;  1A2U A;  2K1B A;  3U50 C;  5C3W A;  2AQ2 B;  2BA1 A;  1AE3 A;  3T16 A;  1SE2 A;  3F2C A;  4R4C A;  1PH3 A;  3W1G A;  1NSN S;  4LFA L;  1ICW A;  2CQO A;  4JBK A;  4JI2 Q;  1BCP D;  4DA2 A;  1F2Z A;  2K5D A;  1BOS A;  4MNO A;  4LWC A;  2JA8 G;  1BR9 A;  4JI0 L;  4IJL A;  2I5L X;  1U4P A;  2K33 A;  1UNS A;  4FXK C;  4R4O A;  2VUM H;  2K6A A;  3KDF A;  3E0J A;  3K81 C;  3JAM c;  3S1R B;  2R92 H;  4ZQ3 A;  3I2Z A;  4BY7 G;  5EBD A;  1AN8 A;  1SYF A;  2F0U A;  5T1I A;  3M4P A;  4NW2 A;  3QOL A;  4C1N K;  2PNR C;  5E7N A;  4HJ9 A;  3V2T A;  5DAU A;  4FXG C;  1YJ9 A;  3ER0 A;  2OQK A;  1RHP A;  3CCU A;  4PZ7 A;  1RCV D;  1I94 Q;  4JYA L;  4OX9 Q;  4C3H G;  1X9N A;  1KLG D;  2QF7 A;  4A3E H;  2Z4I A;  1KQS A;  1EIY B;  1HNW Q;  1PTO F;  1C0A A;  5BN5 A;  1KDC A;  4JBJ A;  2Q8R E;  2ZXO A;  3K80 C;  4A93 H;  1K0S A;  1II3 A;  4P74 A;  3E0E A;  1H9R A;  1U0L A;  2N55 A;  3CCL A;  3U9S A;  4X62 Q;  3R8B A;  1JR0 D;  4NDX A;  4LAA A;  2JK8 A;  3S17 H;  4B3S Q;  3CD6 A;  1PDQ A;  1SMY C;  4DF7 A;  1PH7 A;  1B2T A;  2Q8T A;  1YNN D;  2NVY B;  2RCN A;  4KN4 C;  2NYZ D;  2QEX A;  5IGB A;  1GHK A;  2B2Y C;  3SK8 A;  1PH5 A;  1YHQ A;  1LT5 D;  3ERO A;  4RWS C;  4XQN A;  1D2B A;  2R3Z A;  4TSS A;  4QUC A;  1D1I A;  3UDX A;  3CPW A;  3PQI A;  4A3K B;  1QVF A;  2NVQ B;  3CCS A;  3QOJ A;  4WJ4 A;  4JI7 Q;  1BKB A;  1A3T A;  3HP3 A;  3N52 A;  1ICF B;  1X3Q A;  1BO0 A;  3NBH B;  4QIW B;  4BY1 B;  3UE1 A;  3TME A;  3OHX C;  4OHJ A;  2Q2T A;  4WFN 3;  3FKI G;  4ILW A;  3ZYY X;  1WTH A;  4KLK A;  1TKW B;  4G57 A;  3D4R A;  3EN2 A;  4RGT A;  2KHJ A;  2WP8 J;  2K7V A;  3ULP A;  1FNU A;  3MXP A;  5FLM G;  1K73 C;  1PH4 A;  4FF2 A;  4HAE A;  4JVZ A;  5LMN Q;  4R4I A;  4DK6 C;  4YCW A;  1BBU A;  3NEL A;  4BY1 H;  4FDB A;  4LMQ D;  1H9J A;  2EYL A;  3I91 A;  2VQF L;  2KED A;  5EBC A;  1DON A;  2SOB A;  3MXG A;  2YU9 H;  4FF1 A;  5C4X G;  1KAB A;  1HTP A;  5ELB A;  1TR5 A;  3AYH B;  1AFP A;  4RKL A;  5D65 A;  1IKM A;  1WTX A;  1YVC A;  1VF7 A;  5IYD H;  2PZW A;  2VXW A;  3BVG A;  2B8G A;  5KNC A;  1M4V A;  3NPP A;  4HJ5 A;  4A3M G;  2DN8 A;  4MIU A;  3J7Z C;  2B2W C;  2RBM A;  2NTS A;  3WOF A;  1SE3 A;  3NBI A;  3HKZ G;  1Y1W H;  3MEH A;  1OXT A;  1I4R A;  2HDL A;  3STB D;  3OOC A;  4MTK A;  4IOC A;  3I3C A;  3K59 A;  3EIV A;  2D2C C;  2N78 A;  3RMH A;  2H1E A;  3G6E A;  3S17 B;  4QGU A;  3FPP A;  4QUF A;  1TS3 A;  4IPG A;  5KNB A;  2ICE C;  5M5Y H;  2GVB A;  2K5W A;  5TSS A;  3SK6 A;  3X3N A;  5M3F B;  4KHP L;  1BUV T;  2SEB D;  4ME5 A;  4A93 B;  3DWA A;  4L5R C;  2L55 A;  3UI2 A;  3PF5 A;  1JOK A;  2NZ1 D;  2AMC B;  2AUK A;  4LW1 A;  3RLF A;  1O78 A;  1VQL A;  2K01 A;  1VS0 A;  1W6J A;  3PO2 G;  4K6D A;  2D62 A;  2ATW A;  2UUC L;  4A3D H;  4X66 L;  4DR5 Q;  1LAB A;  5JJK A;  1IW7 C;  1Q86 C;  2R93 B;  1FGU A;  3P75 A;  1EU3 A;  2RDH A;  4K14 A;  4YHH Q;  3K6O A;  3UDI A;  1CT1 D;  1N32 L;  4P73 A;  4TKO B;  1I6H H;  1YZ6 A;  4LNQ A;  1ESF A;  3A5Z B;  3CMA A;  4DR1 Q;  2A69 D;  4LFC Q;  3MEF A;  1B9N A;  5EKI A;  4YIJ A;  1SMY D;  4HJA A;  4UY8 C;  1YNJ C;  2PQA A;  3C46 A;  1PXU A;  2M2L A;  3BZC A;  5EJW A;  4DV5 Q;  3M4O B;  1Y1V G;  1HXY D;  3RN5 A;  1E3P A;  1SRO A;  1SLJ A;  4JBM A;  1I4Q A;  2WB1 B;  4A3E G;  1DGS A;  2R93 G;  1SYE A;  1STN A;  2KUM A;  4A3K G;  2KCM A;  1NJI C;  1KHI A;  4POG A;  4DR7 Q;  5C4J B;  2AQ3 B;  2F0V A;  1Y8N B;  1TWC B;  5IP7 H;  2N49 A;  3P20 A;  3QR8 A;  1IL2 A;  1N34 Q;  1SXT A;  2A6E C;  3KFU A;  3DEO A;  5KYL A;  2E2H B;  2FHT A;  2KJX A;  2B63 G;  3AFP A;  2A73 B;  3HKS A;  1SNQ A;  1QOH A;  4G7H C;  5CBA E;  1K83 H;  4EGV A;  3H91 A;  2VY3 A;  4GOP B;  2BH2 A;  3OTO L;  2E2I H;  4OO1 G;  5D14 A;  4X65 L;  1KNE A;  1Z9F A;  3A56 A;  1V1P A;  3KF8 A;  1MGS A;  3J80 L;  4IFD G;  2RSO A;  3BZD B;  2UXB L;  4JI8 Q;  3G7L A;  2Z1C A;  4H44 C;  2E2D C;  1PV4 A;  1LAC A;  4B3M Q;  1I50 B;  1I5F A;  1KTK A;  4E6I A;  3CCM A;  1VQA A;  4H7B A;  1UUP A;  3W2D A;  5M5W B;  1TWG H;  5IYC G;  4UP9 A;  2NUC A;  3PIP 3;  3DEP A;  3CCQ A;  2Q8I B;  4RFB A;  5C0X J;  3A5U A;  3T1H L;  2NVT B;  1DD2 A;  2QIL A;  1IZ6 A;  1LTA D;  3JAM L;  3HOW B;  4X3U A;  5JJL A;  2O4X A;  5IY0 A;  1B8A A;  3E5S A;  1QVC A;  2WB1 E;  3I4N H;  4DR7 L;  1GO3 E;  1HUM A;  2CW0 C;  2JA8 B;  1K9M C;  1PFS A;  4OIJ A;  4IUQ A;  1TII D;  5EKL A;  2MQH A;  1WI5 A;  1RF2 D;  3NQT A;  5BN4 A;  1VQD A;  3HRZ C;  4JI7 L;  2I46 A;  3GTK H;  5IYD G;  2B63 B;  3PO3 G;  4HCS A;  3ITP A;  4BA1 I;  2Y0S G;  1TWG B;  3MAQ A;  2A8V A;  1E24 A;  2EQS A;  3C3L A;  2I5H A;  4JBW A;  4B9W A;  1OO9 B;  2ASB A;  3I4N G;  3D0F A;  1ZYR C;  1VCI A;  1WTP A;  1R9T B;  5FKA C;  2R92 G;  2VNU D;  3CHB D;  4BY1 G;  3KLS X;  5E4X A;  1PH1 A;  2R7Z G;  1ZEQ X;  1F2Y A;  1LT3 D;  2IPK D;  4IAL A;  3BDC A;  3C1E A;  1KRT A;  5FO7 B;  3NTK A;  1XTC D;  1JT8 A;  1QCB D;  4GOP A;  4EQP A;  1KXL A;  4BBS B;  3A0J A;  1RD9 D;  1S5B D;  5IP9 H;  3GTO B;  4DV3 Q;  1VMC A;  1S3O A;  1UWV A;  3MXN A;  3LWU A;  2C35 B;  4RCN A;  2HIV A;  2RA4 A;  3S14 B;  3OIP A;  1ASY A;  2KEC A;  3DM1 A;  2CWP A;  3KF6 A;  5I2X A;  5IT9 c;  4JOI A;  1SSO A;  1TWC H;  3K0X A;  4K8J A;  1TS2 A;  1XYI A;  1WJJ A;  2K4K A;  2EVB A;  5CV8 A;  4JI8 L;  1K83 B;  1U9R A;  4DU9 A;  1LTR D;  1QG7 A;  3ZJY C;  1PYB A;  2PW7 A;  3S2H H;  2BE5 D;  2RHS B;  4QF4 A;  3K7A H;  4I7Z C;  3PF4 A;  3I4L A;  1PH9 A;  5JPM C;  5C4J H;  2NBF A;  4N9P A;  4HSP A;  2A74 C;  4GKK Q;  1N9W A;  1KC8 C;  2EYP A;  5M3F G;  3KLW A;  3HKZ E;  1QZH A;  1ROD A;  2UU9 L;  1MI2 A;  3QIA A;  4FF4 A;  3PO3 H;  3EQL C;  1KAW A;  3KJP A;  1K3R A;  1W6K A;  2DJG C;  3AFQ A;  3KF6 B;  2F0W A;  1PTO H;  4A3C G;  4LUO A;  4IPD A;  4LF7 Q;  2KCT A;  3BYT B;  4FO2 A;  1GXD C;  3P7J A;  4DR5 L;  1E22 A;  3PUW A;  3Q8D A;  3SR1 A;  1X3G A;  4CKC A;  1YNN C;  1E2V A;  3MZ5 A;  1YNX A;  1HQM C;  2BOS A;  3SK4 A;  2VQE L;  1STH A;  2DUD A;  1EWH A;  3ULL A;  1IYU A;  2EXZ A;  2PZT A;  4MHE A;  2VB3 X;  2F0T A;  1X55 A;  4X64 L;  4DPG A;  4IO9 A;  4Y7N H;  4C3I B;  3GTJ H;  4HJ7 A;  4H13 C;  3H0G G;  4AQY L;  1L1O A;  3OSO A;  3DLL A;  1TU2 B;  1UE6 A;  2F4V Q;  2LMC B;  4NPS A;  1I4P A;  3WWV A;  4PMC A;  4Y52 H;  1ENA A;  4DR2 L;  3S15 B;  3IFD A;  2JA5 G;  4GKJ Q;  2L4N A;  3I55 A;  4O42 A;  4HJ8 A;  5I6W A;  3CF5 A;  1STE A;  1CTM A;  3HOU G;  1H95 A;  4A3F H;  4R8N A;  3BZK A;  3TS0 A;  1SYB A;  3CC4 A;  2LKV A;  2RHQ B;  3J80 i;  2XRS D;  3GTG H;  3I4M G;  4A3K H;  1A2T A;  1TWH B;  2EOT A;  2B39 A;  1XX8 A;  1Y14 B;  4RHR A;  5JJI A;  1EWC A;  2NVX B;  1FYC A;  4EQN A;  3D4D A;  4ID6 A;  4UP7 A;  4A3B B;  1PHJ A;  2KBN A;  5C0X G;  3AMU A;  3VYS A;  4O2D A;  4JI3 L;  1IBK Q;  2BDN A;  1QIL A;  2JQO A;  2SDF A;  3LWE A;  4GN3 B;  2VS1 A;  4F88 A;  2D5D A;  2IHE A;  1FNV A;  4ZLT F;  4DR4 L;  2YU9 B;  3RZD H;  4J6H A;  1EY6 A;  1F2L A;  4TVA B;  3CCR A;  2R7D A;  3K7A B;  1TWA B;  3I8Z A;  2HIX A;  1JJ2 A;  1F2M A;  5M5X H;  3NSW A;  2EXD A;  3SGI A;  4JI6 L;  2ZJR A;  3UDG A;  1K8O A;  3KJO A;  2CFM A;  2MO0 A;  3AU7 A;  3E9I A;  2AWN A;  2C5C A;  2KOL A;  4DV0 L;  2B2V C;  2JEB I;  3DXJ C;  1EYD A;  1IBM Q;  4HED A;  4ZUI A;  5IGD A;  2QW7 A;  4P75 A;  4OGQ C;  4DNT B;  4CJ1 B;  2DNE A;  1S40 A;  1TY0 A;  3DMU A;  1YNJ D;  5BR8 L;  4A3D G;  4DN4 M;  1VQH A;  3OYY A;  1UE7 A;  3KLR A;  3OPO A;  2PCF B;  3D4W A;  1SYC A;  4C1N I;  4BXX G;  2UXB Q;  3CAM A;  3VA5 A;  5I4D A;  3PMF A;  4CDF C;  2R6G A;  3WOE A;  1S4Z A;  1K8M A;  3DUZ A;  2MP1 A;  1I3Q B;  3HFZ B;  3H94 A;  3MHB A;  2A1A A;  2EYF A;  3U4Z A;  4FF3 A;  2A19 A;  3TDQ A;  4JOI C;  4BBR H;  4JW0 A;  4GLV B;  4KI0 A;  1PTO B;  2F4V L;  1E7Z A;  2F0M A;  3PUX A;  1Y1V H;  3PO2 B;  4FP5 D;  4XT3 B;  5C4H A;  5I9O A;  4PZ8 A;  1EZ6 A;  1V8Q A;  1SNM A;  2LXK A;  2SNS A;  1OXX K;  4JYA Q;  1XNQ L;  1PVO A;  2K28 A;  4A3M H;  2CH4 W;  1C7Y A;  5IWA L;  4JI6 Q;  3ONA B;  3RLO A;  3TBI B;  2Q2U A;  1NCV A;  5FK9 C;  3F1Z A;  1QUQ A;  1NBW A;  4FNF A;  4RG1 A;  1JOR A;  2FMM A;  4RGN A;  3VYT A;  4DV4 Q;  1EOV A;  1IBM L;  2UUA Q;  1HH2 P;  1PLF A;  2JA8 H;  3RN2 A;  1DM0 B;  1KLU D;  3IFT A;  1D5Z C;  1HA5 A;  4IFD I;  3QWN A;  3WDN A;  4RKB A;  1JOQ A;  4V0B A;  2XIW A;  4DR1 L;  3SXH A;  1YI2 A;  4HMJ A;  2NB0 A;  1STG A;  1CSP A;  5IOD A;  3BDO A;  2JYO A;  4QL5 A;  3R93 A;  4N8X 1;  2G5D A;  1D8L A;  5C4Z A;  1X54 A;  4LF5 L;  3HOZ H;  1NTG A;  4PMB A;  5LHY 1;  3PUV A;  3STB C;  3JC6 6;  3TRZ A;  3M7N A;  2LY7 A;  5FOB B;  1EUJ A;  3FMC A;  2AUJ D;  4ZYS A;  4NXM Q;  4I7A A;  1WD0 A;  4UP8 A;  2KCC A;  5HY6 A;  5C44 H;  4C3J B;  2PZU A;  1R9T H;  5K36 H;  2L9H A;  4OO1 H;  1XJV A;  1VQE A;  2ZTC A;  1DCZ A;  2YYZ A;  2IY5 B;  2F0G A;  1EOT A;  2MUY A;  3KBX A;  3W1B A;  1XNQ Q;  1BF4 A;  1IBL Q;  2HT1 A;  1D7Q A;  3FRP B;  4RCO A;  3FKI B;  5EKK A;  3S16 B;  1QVG A;  5D3I B;  2FIN B;  3CCJ A;  2ICI A;  1PZI D;  2J7Z A;  3U9O A;  1JE5 A;  1UAP A;  1G91 A;  2VW9 A;  3HZX A;  2EZV A;  4JK1 C;  5K5P A;  2R61 A;  3GTQ B;  4A3I B;  2WAQ E;  4JI5 L;  4DUY L;  3OMG A;  3X3M A;  1EY5 A;  5JEA J;  4X3S A;  1N36 L;  1EY9 A;  2Z6B A;  5I6Y A;  1FL0 A;  1O7L A;  4RAU C;  2EDG A;  1LT4 D;  1Q7Y C;  2VQE Q;  2NZO A;  3ND9 A;  3C1F A;  4KTA A;  1B4O A;  1WCM G;  5C44 B;  2P5Z X;  4EX5 A;  1BBX C;  5GRO A;  5M5W H;  1G29 1;  4RGM A;  4DAV A;  1ENF A;  3T1H Q;  3RZO H;  3BS1 A;  4A3J H;  3FDT A;  5LL6 X;  5KIX A;  3M4Q A;  3K5N A;  4IUR A;  3I7F A;  4IFD H;  2LSS A;  1EYA A;  2OCE A;  3H3V I;  1O80 A;  5F2D A;  3DHQ A;  2JA6 G;  4HSV A;  3C2P A;  2FXQ A;  2K50 A;  1BBW A;  3FVQ A;  1H9S B;  2I5M X;  1PRT F;  1E2W A;  5GQO A;  1TS4 A;  4DR6 L;  4BY7 H;  1A6X A;  1EY8 A;  3NBH A;  3HOY B;  1MIU A;  4RH6 A;  1EWI A;  3CW2 C;  1F77 A;  5CV6 A;  4OIK A;  1Q46 A;  2XWJ B;  5DEH A;  5M5X B;  1EYC A;  4J1M A;  1T9H A;  4R1J A;  3D6W A;  4JI3 Q;  2A68 D;  3LNN A;  3J7Y W;  3RZD B;  1X65 A;  2ZJQ A;  4NMZ A;  4K6L A;  1GUO A;  3VR5 A;  3T1Y Q;  1VQO A;  3S1Q B;  4OO1 I;  1SAP A;  2KQ3 A;  4P2C B;  3D6C A;  2JA9 A;  3EFX D;  1I94 L;  1R4P B;  2O5I C;  4LF8 Q;  2YV5 A;  1A0I A;  3Q23 A;  2HDM A;  5JEA G;  1TWA H;  2BA0 A;  2ZTE A;  3MA2 B;  1X3F A;  4DR4 Q;  1TXY A;  3O13 A;  1Y8O B;  4KMU C;  5FJ8 G;  2PW5 A;  2K05 A;  4A75 A;  4LK1 C;  2IHF A;  1P8L A;  1SYG A;  4XXE A;  4ZCK A;  1PYS B;  5FJ8 H;  3KDF B;  4DR3 Q;  4XIG S;  1IXR A;  3ERS X;  2RKS A;  1C48 A;  2LFN A;  3GV6 A;  3IAY A;  1N32 Q;  1EL0 A;  2C9O A;  2ZXR A;  2ENB A;  4K2L A;  5HGQ A;  1V1Q A;  3H0G H;  5EPK A;  2F0K A;  3QB3 A;  2LXJ A;  3F2B A;  2RSN A;  4JPB W;  4QB4 A;  3K57 A;  1MD2 D;  4DV5 L;  4LF6 Q;  3I70 A;  3PCO B;  2OXP A;  4DV3 L;  5J3B A;  1BVS A;  1KNA A;  3T1Y L;  3J81 j;  1AEX A;  4OWT B;  1Q90 A;  1HFG A;  3I73 A;  3U4V A;  1MBY A;  1LTT D;  5LMU Q;  1JMC A;  2R7Z H;  2Z4H A;  1Q1E A;  2E2J B;  4IQZ A;  3A8J E;  1Q8K A;  3CCE A;  3NWT A;  3TEH B;  1UE5 A;  4BA2 I;  1STA A;  3OW7 A;  1LUZ A;  2NN6 I;  1VQ6 A;  1GUS A;  2LS0 1;  2CVR A;  4KN7 C;  5M9O A;  1SMX A;  5L37 A;  1JB3 A;  2A6E D;  3OTO Q;  1FJG L;  2ZM6 L;  1D5M C;  4ZK9 B;  2EYJ A;  1PH6 A;  2OTJ A;  3CKI B;  4CDD C;  3CPF A;  2DJF C;  3SK5 A;  2RDF A;  3KBG A;  4KJN A;  4Q0F A;  2TSS A;  1EIH A;  1NR4 A;  2MGS A;  3CQZ B;  3AEV A;  1CI3 M;  1X56 A;  2NN6 G;  5C5L A;  1HNX L;  1HNZ Q;  4U68 A;  4J15 A;  3GTL B;  4RMF A;  5E3F A;  5A2Q E;  1XXG A;  2L1B A;  4DGZ A;  5IWA Q;  5H1S E;  1WVL A;  1XPO A;  4LF4 Q;  3GTM B;  5CC4 A;  1WTR A;  4FVM A;  1L1O B;  1BDO A;  1TWF H;  5HUR A;  5IE8 A;  4PNY A;  4OWW B;  3S15 H;  5I9P A;  4B3T L;  2EY6 A;  2H5X A;  5IYC H;  2CHB D;  1HQR D;  4NXM L;  4OWX B;  2V4D A;  4L5Q A;  4C3H H;  4DFA A;  1A3U A;  1YJN A;  5ELO A;  1CHP D;  4NKL A;  1R4Q B;  5KYI A;  5C0X I;  5C3E B;  1TWF B;  2B2Y A;  1VQM A;  3S2H B;  4IUU A;  4JV5 L;  1M8A A;  3GTM H;  5D3D A;  4ME3 A;  3J7A F;  2JA7 G;  4HIK A;  2WV6 D;  4EQ5 A;  2QCP X;  3GV3 A;  3HOV G;  2CH4 A;  2ZM6 Q;  1YJW A;  3PGZ A;  1Q82 C;  4B3R Q;  5AJ3 L;  4A3B G;  4NXN L;  3VR4 A;  4KY7 A;  3S2D H;  1SNP A;  4QQB X;  3S1Q H;  1CKO A;  1XMO Q;  2V1C C;  4QCL A;  4NP5 A;  2UXD Q;  5LMU L;  3M7G A;  4OEL B;  4JC0 A;  3B6Y A;  1PTO D;  5FLX L;  1XWE A;  3VYR A;  1BQQ T;  4YWM A;  1HNW L;  1RTN A;  4KKS A;  5C0X H;  4R4T A;  2L12 A;  1SFO B;  4KHP Q;  3L7Z C;  2DY7 A;  4CJ2 C;  4XQJ A;  3HOY H;  2J4X A;  2ZT9 C;  2FMC A;  1WTO A;  1DJR D;  3M9B A;  4RGO S;  2OF1 A;  1V43 A;  1STB A;  3K5M A;  2UUC Q;  3QJY A;  1ASZ A;  1GKH A;  4O0A A;  1WOC A;  1JWM D;  1MJC A;  3H0G B;  4LF9 Q;  2K52 A;  2WKD A;  2WIN B;  2DGY A;  4A3J B;  1E1T A;  2F0S A;  4LF7 L;  4LF4 L;  1MHW C;  3I4N B;  4HMI A;  1LTS D;  1UEB A;  5LMN W;  1VQJ A;  2JSO A;  1AZQ A;  3PIO 3;  3HOW H;  2L5T A;  4N8F A;  3S1R H;  2R92 B;  1SDF A;  3CC7 A;  1ENC A;  1GM5 A;  3HOU B;  1XMO L;  2B2T A;  2K04 A;  4B08 A;  2UXD L;  1EY7 A;  4A3L H;  4CGY B;  1KDA A;  3K8A A;  3MFY A;  1PH2 A;  4YWL A;  1CZW A;  3NUC A;  3M85 A;  1XNR L;  1UE1 A;  2BH8 A;  4JI1 L;  3L3O C;  1PH8 A;  4MN3 A;  1TY2 A;  1CZG A;  4YCV A;  3FEW X;  1N33 L;  3SE0 A;  3SDZ A;  3GTQ H;  2F0J A;  2N88 A;  4A3J G;  2UXC L;  1LT6 D;  2IL8 A;  3L0O A;  4QMG A;  2VQF Q;  5CV5 A;  1PFB A;  2QDB A;  1TS5 A;  3TP8 A;  4CBV A;  5G3L F;  4C3J H;  1LTG D;  1G2S A;  5E4W C;  4KK7 A;  1SJE D;  3HS0 C;  2EY5 A;  2E2H H;  4J8Q A;  3J81 E;  1DYQ A;  3MFG A;  1XPR A;  2JA6 B;  4DUZ Q;  1T5E A;  3AQQ A;  2EJG C;  4WOR A;  3KK7 A;  3M3Y B;  3MWY W;  4BY7 B;  3SHL A;  3TZD A;  1IYV A;  1NUC A;  4A3G G;  3Q6S A;  1BCP B;  2YTX A;  4DV6 Q;  1KIX A;  1L0Y B;  1SE4 A;  4LFB Q;  4GLX A;  3BVM A;  3S2D B;  4DKA C;  4WJW A;  1B53 A;  3L2P A;  1FR3 A;  4R9W A;  4JI2 L;  5BN3 A;  2NVT H;  4K0K L;  1HPC A;  4R4Q A;  4GKJ L;  1QNU A;  3NE5 B;  3NHH A;  3ND8 A;  3EA6 A;  3FPU B;  4NB3 A;  4LFA Q;  3QG1 A;  1PMR A;  3A7L A;  4M1U B;  4CHT B;  3HOV H;  2NWG A;  2XN9 C;  4LUV A;  4DR3 L;  2A68 C;  1EEI D;  3A7A B;  2F0N A;  4BBS G;  1FNW A;  3DM3 A;  1L0W A;  1PZJ D;  4F87 A;  4BWG B;  5DLQ E;  1FJG Q;  3GTP B;  2YTV A;  3H09 A;  1PRT C;  1RTO A;  4Q5V A;  1PTO C;  4H0L C;  2JA7 B;  4MZ9 A;  1CA5 A;  4JG2 A;  3HG9 A;  1LTL A;  4RA8 A;  5KEE A;  2AHO B;  4TRD A;  1J6Q A;  1VQK A;  1M90 C;  3W3A A;  2XNA C;  3MTS A;  4PZ6 A;  3FKI H;  2OTL A;  1JJC B;  2E5L Q;  1IL8 A;  2IX1 A;  2Z8L A;  1OXU A;  1NR2 A;  1QWY A;  5ELF A;  2F03 A;  2Y0S B;  5KND A;  1LLR D;  5IGC A;  1EFW A;  3GTL H;  1QB5 D;  1SRU A;  5IIF A;  1Y1W B;  1ILP A;  4BBR B;  2EE1 A;  3NQI A;  1A63 A;  1V1O A;  4KD4 A;  4X6A H;  1FD7 D;  4AH6 A;  4A3G B;  1JOO A;  4OX9 L;  2K5V A;  3HOX B;  2JA5 B;  3I4O A;  2AWO A;  2L0C A;  1G51 A;  4A93 G;  1U5K A;  1CSQ A;  1UEA B;  4GKK L;  4K5W A;  5IT9 L;  4ODG A;  3S1M H;  3BDL A;  1F9P A;  1KDB A;  3S1N B;  2J0T D;  3AB9 A;  3TZU A;  1LTB D;  3RNU A;  3VR2 A;  4XT1 B;  2NZH A;  5BR8 Q;  1E2Z A;  4OXP A;  1PRT B;  3BG3 A;  2I07 B;  3M4Y A;  4GNX C;  4DV2 Q;  4L5S A;  1N34 L;  2MHV A;  1SR3 A;  5GAD C;  2WFW A;  1AE2 A;  1Q3L A;  2A6H C;  1F9Q A;  2FFK B;  1MSH A;  1NE3 A;  4PG3 A;  4QY7 A;  3OIQ A;  5M3F H;  4BBR G;  3I90 A;  1Y1W G;  2MFI A;  4KJO A;  1S5E D;  4B3T Q;  2CQA A;  1WD1 A;  1SND A;  3GO5 A;  3I4M H;  2B29 A;  4FXD A;  4A3D B;  1VQ4 A;  1PA6 A;  5A2Q L;  3G71 A;  4YY3 Q;  4X62 L;  2GN5 A;  3IKJ A;  4GOP C;  4LF8 L;  1C8C A;  1TVX A;  4K8I A;  2EIF A;  5CBE E;  4IJH A;  4O1N A;  1G6Z A;  1H9M A;  4CDE C;  2NVX H;  1F9S A;  1VQF A;  3LGJ A;  4ZAI A;  4DV1 Q;  3G6J B;  3KF8 B;  4YCU A;  2ID0 A;  1WYD A;  4L8J A;  2F0F A;  4TQU S;  4AYB E;  4AQY Q;  4A3L G;  5DM6 3;  3D8G A;  1X3E A;  3A8I E;  5ELN A;  1CHQ D;  1PZK D;  3RLN A;  1EQV A;  2B2U A;  2F3W A;  2HCC A;  5JAV A;  2JXM B;  3GD7 A;  4A3F B;  2M9V A;  1Y1V B;  2X69 A;  4F8M A;  4GNX A;  2EY1 A;  1S5D D;  3ERQ A;  2E75 C;  4S3S A;  2I0Q A;  1RKN A;  4IUV A;  2NVY H;  2WB1 G;  3S24 A;  4DR2 Q;  1WTQ A;  4LF9 L;  4GLA C;  1VQB A;  3N6R A;  1GD7 A;  1GHJ A;  1I6V C;  1U4R A;  3BVZ A;  4G7Z C;  1AP0 A;  2XTI A;  1HZ9 A;  3T4A C;  2Q2I A;  4BXX H;  4HIM A;  3RD4 A;  4C2M B;  2KVM A;  4B3M L;  1YIT A;  2Q2H A;  3GQB A;  4ZRZ A;  2Z6K C;  1IHZ A;  1L0X B;  1TT2 A;  3S9W A;  1YIJ A;  4KV6 A;  2XGT A;  2QGQ A;  4Y7N B;  3GTJ B;  5EPL A;  1DZ1 A;  4JI4 L;  3PUY A;  3TSS A;  2PNH A;  2D0P A;  2D9U A;  2PQE A;  3TN2 A;  2GVA A;  4A3F G;  4GS3 A;  2R7Z B;  2K75 A;  2IW3 A;  2O2L D;  2K14 A;  2B2T C;  2PPB C;  1JB7 A;  3F2D A;  4C3I H;  1PFN A;  3PUZ A;  2EYM A;  1B50 A;  1MKH A;  1I4G A;  4GN5 A;  5HGT A;  1S72 A;  5CGK A;  1DOK A;  1KRS A;  1NMF A;  3Q0A A;  4XYQ A;  3K0Y A;  3S1M B;  4IFD J;  4C2M H;  1N33 Q;  5IGG A;  2YTY A;  3TP6 A;  4A3B H;  1O7Z A;  2NTT A;  2KEE A;  2UXC Q;  1X6O A;  1U4M A;  2PI2 E;  4CKE A;  4KD3 A;  3PO3 B;  4F7X A;  2CWA A;  1GVP A;  2K32 A;  3ICE A;  4N9T A;  3TP7 A;  4X66 Q;  1T5X D;  1W2B A;  4C56 C;  5C5M A;  4KKT A;  1XPU A;  3RUZ A;  1QZG A;  1J5E Q;  4WRD A;  1PFM A;  3V96 A;  2F0I A;  1EQR A;  5FO9 B;  2KHS A;  1K8A C;  2JA5 H;  4JI4 Q;  4K0K Q;  3TQY A;  1KL9 A;  1L2F A;  1Z6H A;  2X6G A;  3L9A X;  4L5T A;  4DV6 L;  2VB2 X;  4IZ8 A;  1HRJ A;  4XDX A;  1W3S A;  4EVO A;  4ZKB B;  1I4X A;  1Q81 C;  1CUK A;  2QDL A;  2UU9 Q;  3CRL C;  1DOL A;  3GTP H;  4XYO A;  5FLX E;  3S14 H;  3BJU A;  1GUW A;  3CU7 A;  4CKB A;  2N8N A;  1IW7 D;  1RDP D;  2WAC A;  1HZA A;  2E8G A;  1SYD A;  3HOX G;  2N3S A;  4ULL A;  3E9H A;  5KGU A;  3R2T A;  1A15 A;  2GA4 B;  3PSI A;  3OWE B;  3U58 A;  3A55 A;  3MXN B;  3OMC A;  4LFB L;  1AW7 A;  1RJT A;  4HR7 B;  1O7Y A;  1LTI D;  1ZYR D;  1VF5 C;  3NTH A;  1D5X C;  2B2U C;  4K5X A;  1SN8 A;  3CRK C;  2E76 C;  2QKI C;  1VQG A;  3NWS A;  1VQN A;  2JEA I;  3VR6 A;  5C4X B;  4IUT A;  3V05 A;  3S1N H;  1DOM A;  3OW2 A;  1IKL A;  1CK1 A;  4WJ3 M;  2HQL A;  1AZP A;  1B3Q A;  4LJZ C;  1NAP A;  1J5E L;  2UUA L;  2ES2 A;  2G9D A;  1GUT A;  1H9K A;  3EBE A;  5ELD A;  1WFQ A;  4AIM A;  1NMG A;  3E3X A;  4B3R L;  1OTC A;  1GOZ A;  1DXM A;  1HHV A;  3I56 A;  4DV7 L;  2VZA A;  1JQY D;  1NY4 A;  1Q8I A;  1V9P A;  4A3I H;  1LYL A;  4HN7 A;  2X6L A;  3H6M A;  3T53 B;  2B63 H;  4CDC C;  3T13 A;  1ILQ A;  3CCV A;  2E5L L;  1CKN B;  1EYG A;  1VQC A;  2RDG A;  2E74 C;  3HGB A;  2MJ8 A;  1H9S A;  1JC7 A;  1JE4 A;  3A54 A;  3S16 H;  3NK9 A;  3H15 A;  4DXF A;  4DK1 A;  1YHA A;  5J22 A;  1G2T A;  1S5F D;  2WKC A;  4FYD A;  2B2V A;  3NEN A;  4IPC A;  3K58 A;  3OWF A;  1HZB A;  1BCP F;  3HOZ B;  1KAA A;  3GTO H;  3K5O A;  5J1Z A;  3JAM E;  3PV0 A;  2KCN A;  3EJI A;  1I3Q H;  3VR3 A;  1HR0 W;  3HOV B;  2EY2 A;  5FLX c;  4XQQ A;  2F0L A;  1I50 H;  1RIP A;  4UHV A;  5JEA H;  2SNM A;  1XTD A;  1A8V A;  4I65 A;  3LX0 A;  1V1P B;  2EYO A;  2XVS A;  1U4L A;  2WII B;  1EQT A;  1X32 A;  4DV0 Q;  3Q22 A;  1VDZ A;  2WAQ B;  5IOC A;  3G48 A;  5AFW A;  1WCM B;  4GNX B;  1STY A;  1SNC A;  2F0P A;  4K5V A;  1TQO A;  4DK0 A;  1E1O A;  4KHZ A;  2A69 C;  1XMQ Q;  2B8F A;  2Z9H A;  3CME A;  1EY0 A;  1EU4 A;  4DUZ L;  2VUM G;  1IBK L;  3FP9 A;  4P72 A;  3M4O H;  1F9R A;  4A3M B;  1B1Z A;  3TRE A;  1G8Z D;  3MXU A;  3HEJ A;  1HNZ L;  1NNX A;  1ONL A;  4G7O C;  3JAM i;  2R7F A;  2AQ1 B;  5C44 G;  4AYB G;  3TP5 A;  2BE5 C;  4LFC L;  3PO2 H;  4QIW E;  2EJM A;  1SNO A;  1SFO H;  1HTL D;  2RQX A;  4IUN A;  3VA7 A;  1J8I A;  2PMZ E;  4U67 3;  5IP9 G;  3HOZ G;  1LO5 D;  3SEB A;  3KYH C;  1WTW A;  1EY4 A;  1B9M A;  5CV7 A;  3KLS A;  3J81 i;  3MC0 B;  1SE8 A;  2R93 H;  5IYB G;  1GJX A;  1JCK B;  1MSG A;  2HD3 A;  2M00 A;  3NEM A;  4HCE A;  2IX3 A;  3HOU H;  2QA4 A;  4JV5 Q;  2KHI A;  1CA6 A;  2JN4 A;  1Q12 A;  1K3B C;  1CKN A;  1HCZ A;  1P16 A;  5LL6 S;  2UUB L;  4DXG A;  2B2W A;  1KD1 C;  3URY A;  2O5J C;  3ULJ A;  1AH9 A;  5ELC A;  5GAH C;  4GZY C;  4HIO A;  2IJ0 A;  3CXC A;  5JPN C;  4DAY A;  5I2Y A;  2XSC A;  2Y0S E;  2EJF C;  2PO4 A;  2IT1 A;  2MPM A;  2Z0S A;  3T51 B;  5CV9 A;  5E1F A;  2IWH A;  4ALP A;  1HR0 L;  5M5Y B;  4AYB B;  2ZJP A;  2L11 A;  4X64 Q;  4IUP A;  3H3V C;  2F0O A;  2OEO A;  5EGT A;  2CW0 D;  2F1M A;  1EIF A;  1WTV A;  1GUG A;  2CKZ B;  5CV4 A;  2ALY B;  2F4I A;  2K03 A;  2PMZ B;  2Z6K A;  1TWH H;  1OXS C;  4ZKC B;  4KY6 A;  3GTG B;  4X65 Q;  5ELE A;  2PI2 A;  3CQZ H;  3K5L A;  1B7Y B;  1JIC A;  1QNK A;  4IN3 A;  1Y8P B;  2BCO A;  2IX0 A;  2KA7 A;  3UDF A;  1I6H B;  4A76 A;  3P1H A;  3HOW G;  2D0O A;  5EQ0 A;  1E0B A;  4UAI A;  5IGF A;  4C3H B;  4GN4 B;  5GAG C;  4YY3 L;  2ZXP A;  5JOB A;  4A4I A;  3A8K E;  3F8T A;  3RR5 A;  5JVG 3;  2UUB Q;  2F52 A;  3UE0 A;  2DY8 A;  2E2J H;  5C3E H;  1G6P A;  4JI1 Q;  1B3A A;  1N36 Q;  3FHW A;  2DNC A;  4DNI A;  2MO1 A;  5CR3 A;  2XRQ D;  4DV2 L;  1A3V A;  3PIP A;  4HID A;  2NVQ H;  4A3C H;  1HFN A;  3DWQ A;  4ZUJ A;  1EFI D;  1B70 B;  2VL6 A;  1C9O A;  3GP7 A;  3E6Z X;  5IT9 E;  4DAP A;  1YBY A;  4LUZ A;  4BS9 A;  2FJ2 A;  5EPJ A;  1QUQ B;  1VMP A;  4C3J G;  1HUN A;  4B3S L;  1BCP C;  3R2I A;  2K5N A;  2F0Q A;  3I72 A;  2B3G A;  4OON A;  3G4S A;  4L63 B;  5JJZ A;  3D31 A;  4DAM A;  2HQE A;  2AKW B;  3BYY B;  1GUN A;  1PRT D;  2G9H D;  4DR6 Q;  4JCV E;  3J7A V;  2XWB B;  2A5H A;  1N8R C;  2K5Q A;  4A3I G;  3F2U A;  1HR0 Q;  2ZTD A;  4UDU C;  3J81 c;  1O7I A;  2MNA A;  1EIG A;  5M3M G;  3J7A 5;  1BXT A;  4A3E B;  5AJ3 Q;  2RVL A;  4Z9C B;  1HJP A;  5K36 G;  2CCZ A;  4KKU A;  2PQA B;  4X3T A;  4HTH A;  1EZ8 A;  3CP0 A;  5KRU A;  1EQQ A;  1VQP A;  1FGB D;  4OL7 A;  4IOA A;  1BNZ A;  5DNF A;  1JJG A;  3BU2 A;  2PYK A;  2K5H A;  5IYB H;  2BDO A;  2JP1 A;  1MJE A;  2OT2 A;  5NUC A;  4X3K A;  4IPH A;  2KEN A;  4CJ0 B;  3I4M B;  3J80 c;  4NXN Q;  4L6T B;  2JE6 I;  1SBB B;  2F3I A;  5DM7 3;  1ET9 A;  4BBS H;  4K2K A;  3NP8 A;  1FVI A;  1JWU D;  5CYU A;  1PYW D;  5C3X A;  3QO2 A;  1YEZ A;  1CQF A;  1VQ5 A;  3J80 E;  2EYH A;  1ESR A;  1JWS D;  1I4H A;  3PIO A;  2TMP A;  3EVQ A;  4C3I G;  1XMQ L;  3R3O A;  3SVM A;  3GDE A;  3HOY G;  5C3E G;  3NTI A;  4DNR B;  4M8A A;  4DAY B;  2F0H A; 
#chains in the Genus database with same CATH homology
 5ISR A;  5CMD A;  1S5C D;  3J81 L;  1D1K A;  2VUM B;  4PQX A;  4R8I A;  4KHV A;  1LV9 A;  3HKZ B;  1HA6 A;  4PMW A;  5A35 A;  3GTK B;  3T56 B;  2H4O A;  3KUP A;  3NXW A;  2QEJ C;  3D3R A;  4RHS A;  5T1G A;  1Z7T A;  3IL8 A;  1QE6 A;  5JVH 3;  5COY A;  1ET6 A;  5FO8 B;  3Q24 A;  5IGE A;  2HUG A;  1C4Q A;  2F0E A;  3DWP A;  5C6A A;  3RZO B;  1ZXT A;  1EEF D;  2F3V A;  1Y69 U;  1ZKO A;  2A6H D;  1CQV A;  4EQO A;  1OXV A;  1ML0 D;  1SJH D;  1D6E C;  1J9O A;  4ABN A;  3VYU A;  1B44 D;  1CM9 A;  5M3M B;  2NN6 H;  2EPB A;  1Q1B A;  2F0D A;  5G3L D;  1QJO A;  2HCI A;  5J39 A;  5COR A;  3MVV A;  4B9X A;  4PV1 C;  1SEB D;  2E2I B;  4KY5 A;  4V19 0;  1CFM A;  4XTC S;  4G4K A;  1Z47 A;  1X3P A;  1A2U A;  2K1B A;  5C3W A;  2AQ2 B;  2BA1 A;  3T16 A;  1SE2 A;  1NSN S;  1ICW A;  1BCP D;  4DA2 A;  1F2Z A;  2K5D A;  1BOS A;  1BR9 A;  1U4P A;  2K33 A;  1UNS A;  4FXK C;  2K6A A;  3E0J A;  3S1R B;  4ZQ3 A;  5EBD A;  1AN8 A;  1SYF A;  2F0U A;  5T1I A;  4NW2 A;  3QOL A;  4C1N K;  2PNR C;  3V2T A;  5DAU A;  4FXG C;  1RHP A;  1RCV D;  4C3H G;  1KLG D;  2QF7 A;  2Z4I A;  1PTO F;  5BN5 A;  1KDC A;  2Q8R E;  2ZXO A;  1II3 A;  1H9R A;  2N55 A;  3U9S A;  3R8B A;  1JR0 D;  4NDX A;  4LAA A;  1PDQ A;  1SMY C;  4DF7 A;  1B2T A;  2Q8T A;  1YNN D;  2NVY B;  4KN4 C;  2NYZ D;  5IGB A;  1GHK A;  2B2Y C;  3SK8 A;  1LT5 D;  3ERO A;  4RWS C;  4XQN A;  1D2B A;  2R3Z A;  4TSS A;  4QUC A;  1D1I A;  4A3K B;  2NVQ B;  3QOJ A;  3HP3 A;  1A3T A;  3N52 A;  1X3Q A;  4BY1 B;  1BO0 A;  4QIW B;  3TME A;  3OHX C;  4OHJ A;  4WFN 3;  4ILW A;  3ZYY X;  1TKW B;  4G57 A;  3D4R A;  4RGT A;  2WP8 J;  2K7V A;  1FNU A;  3MXP A;  4FF2 A;  4HAE A;  4LMQ D;  1H9J A;  2EYL A;  3I91 A;  2KED A;  5EBC A;  1DON A;  2SOB A;  3MXG A;  4FF1 A;  1KAB A;  1HTP A;  5ELB A;  1TR5 A;  1AFP A;  4RKL A;  5D65 A;  1IKM A;  1WTX A;  1VF7 A;  2PZW A;  2VXW A;  3BVG A;  2B8G A;  5KNC A;  1M4V A;  3NPP A;  2DN8 A;  4MIU A;  2B2W C;  2RBM A;  3WOF A;  2NTS A;  1SE3 A;  3NBI A;  3MEH A;  1OXT A;  1I4R A;  2HDL A;  3OOC A;  3I3C A;  3K59 A;  2D2C C;  3RMH A;  2H1E A;  3S17 B;  3FPP A;  4QUF A;  1TS3 A;  5KNB A;  2ICE C;  2K5W A;  3SK6 A;  5TSS A;  3X3N A;  5M3F B;  1BUV T;  2SEB D;  4ME5 A;  4A93 B;  3DWA A;  2L55 A;  3UI2 A;  1JOK A;  2NZ1 D;  2AUK A;  3RLF A;  1O78 A;  2K01 A;  1W6J A;  4K6D A;  2D62 A;  1LAB A;  1IW7 C;  2R93 B;  3P75 A;  1EU3 A;  2RDH A;  4K14 A;  3K6O A;  1CT1 D;  4TKO B;  1ESF A;  2A69 D;  5EKI A;  1B9N A;  4YIJ A;  1SMY D;  1YNJ C;  3C46 A;  1PXU A;  2M2L A;  5EJW A;  3M4O B;  1HXY D;  1I4Q A;  2WB1 B;  1SYE A;  1STN A;  2KUM A;  5C4J B;  2AQ3 B;  2F0V A;  1Y8N B;  1TWC B;  3P20 A;  1SXT A;  2A6E C;  3DEO A;  5KYL A;  2E2H B;  2FHT A;  2KJX A;  2A73 B;  1SNQ A;  1QOH A;  4G7H C;  5CBA E;  4EGV A;  3H91 A;  4OO1 G;  5D14 A;  1KNE A;  3A56 A;  1V1P A;  3KF8 A;  1MGS A;  3J80 L;  4IFD G;  2RSO A;  3BZD B;  3G7L A;  2Z1C A;  4H44 C;  2E2D C;  1LAC A;  1I50 B;  1KTK A;  4E6I A;  4H7B A;  1UUP A;  3W2D A;  5M5W B;  2NUC A;  3PIP 3;  3DEP A;  2Q8I B;  4RFB A;  5C0X J;  2NVT B;  1DD2 A;  2QIL A;  1LTA D;  3JAM L;  3HOW B;  4X3U A;  2O4X A;  3E5S A;  1HUM A;  2CW0 C;  2JA8 B;  4OIJ A;  4IUQ A;  1TII D;  5EKL A;  1RF2 D;  5BN4 A;  3NQT A;  3HRZ C;  2I46 A;  2B63 B;  4HCS A;  3ITP A;  4BA1 I;  1TWG B;  3MAQ A;  3C3L A;  4JBW A;  4B9W A;  1OO9 B;  1ZYR C;  1VCI A;  1WTP A;  1R9T B;  5FKA C;  2VNU D;  3CHB D;  3KLS X;  5E4X A;  1ZEQ X;  1F2Y A;  1LT3 D;  2IPK D;  4IAL A;  3BDC A;  3C1E A;  5FO7 B;  3NTK A;  1XTC D;  1QCB D;  4EQP A;  4BBS B;  1RD9 D;  1S5B D;  3GTO B;  1VMC A;  3MXN A;  3LWU A;  4RCN A;  2RA4 A;  3S14 B;  3OIP A;  2KEC A;  3DM1 A;  5I2X A;  1SSO A;  4K8J A;  1TS2 A;  1XYI A;  2EVB A;  5CV8 A;  1K83 B;  1U9R A;  4DU9 A;  1LTR D;  1QG7 A;  2PW7 A;  2BE5 D;  4QF4 A;  4I7Z C;  3I4L A;  5JPM C;  2NBF A;  4N9P A;  4HSP A;  2A74 C;  2EYP A;  1ROD A;  1MI2 A;  3QIA A;  4FF4 A;  3EQL C;  1W6K A;  2F0W A;  1PTO H;  3BYT B;  4FO2 A;  1GXD C;  3P7J A;  3PUW A;  3SR1 A;  4CKC A;  1YNN C;  1E2V A;  3MZ5 A;  1HQM C;  2BOS A;  3SK4 A;  1STH A;  1EWH A;  1IYU A;  2EXZ A;  2PZT A;  4MHE A;  2VB3 X;  2F0T A;  4C3I B;  4H13 C;  3OSO A;  1TU2 B;  2LMC B;  1I4P A;  4PMC A;  1ENA A;  3S15 B;  3IFD A;  2L4N A;  4O42 A;  5I6W A;  1STE A;  1CTM A;  4R8N A;  1SYB A;  2LKV A;  2XRS D;  1A2T A;  1TWH B;  2EOT A;  2B39 A;  1XX8 A;  4RHR A;  1EWC A;  2NVX B;  1FYC A;  4EQN A;  3D4D A;  4ID6 A;  4A3B B;  5C0X G;  3AMU A;  3VYS A;  2BDN A;  1QIL A;  2SDF A;  3LWE A;  4F88 A;  2D5D A;  4ZLT F;  1FNV A;  2YU9 B;  4J6H A;  1EY6 A;  1F2L A;  3K7A B;  1TWA B;  3I8Z A;  1F2M A;  3NSW A;  1K8O A;  3AU7 A;  2AWN A;  2C5C A;  2KOL A;  2B2V C;  2JEB I;  3DXJ C;  1EYD A;  5IGD A;  4HED A;  4ZUI A;  4DNT B;  4OGQ C;  4CJ1 B;  2DNE A;  1TY0 A;  3DMU A;  1YNJ D;  4DN4 M;  3KLR A;  3OPO A;  2PCF B;  3D4W A;  1SYC A;  4C1N I;  3VA5 A;  5I4D A;  3PMF A;  2R6G A;  3WOE A;  1S4Z A;  1K8M A;  3DUZ A;  2MP1 A;  1I3Q B;  3H94 A;  3MHB A;  2EYF A;  4FF3 A;  3TDQ A;  4KI0 A;  1PTO B;  2F0M A;  3PUX A;  3PO2 B;  4FP5 D;  4XT3 B;  5C4H A;  5I9O A;  1EZ6 A;  1V8Q A;  1SNM A;  2SNS A;  1OXX K;  2K28 A;  3ONA B;  3TBI B;  1NCV A;  5FK9 C;  4FNF A;  1JOR A;  2FMM A;  4RGN A;  3VYT A;  1PLF A;  1DM0 B;  1KLU D;  3IFT A;  1D5Z C;  1HA5 A;  4IFD I;  3QWN A;  3WDN A;  4RKB A;  1JOQ A;  4V0B A;  2XIW A;  3SXH A;  4HMJ A;  2NB0 A;  1STG A;  5IOD A;  3BDO A;  2JYO A;  3R93 A;  5C4Z A;  4PMB A;  5LHY 1;  3PUV A;  3M7N A;  2LY7 A;  5FOB B;  3FMC A;  2AUJ D;  4ZYS A;  1WD0 A;  2KCC A;  4C3J B;  2PZU A;  5K36 H;  2L9H A;  4OO1 H;  1DCZ A;  2YYZ A;  2F0G A;  1EOT A;  2MUY A;  3KBX A;  1BF4 A;  3FRP B;  4RCO A;  3FKI B;  5EKK A;  3S16 B;  5D3I B;  2FIN B;  2ICI A;  1PZI D;  2J7Z A;  3U9O A;  1UAP A;  1G91 A;  3HZX A;  2EZV A;  4JK1 C;  5K5P A;  2R61 A;  3GTQ B;  4A3I B;  3OMG A;  3X3M A;  1EY5 A;  5JEA J;  4X3S A;  1EY9 A;  5I6Y A;  1O7L A;  4RAU C;  2EDG A;  1LT4 D;  3ND9 A;  3C1F A;  4KTA A;  1B4O A;  5C44 B;  1BBX C;  1G29 1;  4RGM A;  4DAV A;  1ENF A;  3BS1 A;  3FDT A;  5LL6 X;  5KIX A;  3K5N A;  4IUR A;  4IFD H;  1EYA A;  1O80 A;  5F2D A;  3DHQ A;  4HSV A;  3C2P A;  3FVQ A;  1H9S B;  1PRT F;  1E2W A;  1TS4 A;  1A6X A;  1EY8 A;  3NBH A;  3HOY B;  4RH6 A;  1F77 A;  5CV6 A;  4OIK A;  2XWJ B;  5DEH A;  5M5X B;  1EYC A;  4J1M A;  3D6W A;  2A68 D;  3RZD B;  3LNN A;  3J7Y W;  4NMZ A;  4K6L A;  1GUO A;  3VR5 A;  3S1Q B;  4OO1 I;  1SAP A;  2KQ3 A;  4P2C B;  3D6C A;  3EFX D;  1R4P B;  2O5I C;  3Q23 A;  2HDM A;  5JEA G;  2BA0 A;  3MA2 B;  3O13 A;  1Y8O B;  4KMU C;  2PW5 A;  2K05 A;  4LK1 C;  1SYG A;  4XXE A;  4XIG S;  2RKS A;  1C48 A;  2LFN A;  3GV6 A;  3IAY A;  1EL0 A;  2C9O A;  2ZXR A;  2ENB A;  4K2L A;  5EPK A;  2F0K A;  3QB3 A;  2RSN A;  4QB4 A;  3K57 A;  1MD2 D;  3I70 A;  2OXP A;  1KNA A;  1AEX A;  1Q90 A;  1HFG A;  3I73 A;  1MBY A;  1LTT D;  2Z4H A;  1Q1E A;  2E2J B;  4IQZ A;  3A8J E;  3NWT A;  4BA2 I;  1STA A;  3OW7 A;  2NN6 I;  1GUS A;  2LS0 1;  2CVR A;  4KN7 C;  5M9O A;  1JB3 A;  2A6E D;  1D5M C;  4ZK9 B;  2EYJ A;  3CKI B;  3SK5 A;  2RDF A;  3KBG A;  4KJN A;  4Q0F A;  2TSS A;  1EIH A;  1NR4 A;  2MGS A;  3CQZ B;  1CI3 M;  2NN6 G;  5C5L A;  4U68 A;  3GTL B;  5E3F A;  5A2Q E;  1XXG A;  2L1B A;  4DGZ A;  1WVL A;  3GTM B;  5CC4 A;  1WTR A;  4FVM A;  1BDO A;  5HUR A;  4PNY A;  5I9P A;  2EY6 A;  2CHB D;  1HQR D;  2V4D A;  4DFA A;  1A3U A;  1CHP D;  4NKL A;  1R4Q B;  5KYI A;  5C0X I;  5C3E B;  1TWF B;  2B2Y A;  3S2H B;  4IUU A;  1M8A A;  5D3D A;  3J7A F;  2WV6 D;  2QCP X;  3GV3 A;  3VR4 A;  4KY7 A;  1SNP A;  4QCL A;  4NP5 A;  3M7G A;  1PTO D;  5FLX L;  1XWE A;  3VYR A;  1BQQ T;  1RTN A;  4KKS A;  5C0X H;  2L12 A;  1SFO B;  3L7Z C;  2DY7 A;  4CJ2 C;  4XQJ A;  2J4X A;  2ZT9 C;  2FMC A;  1WTO A;  1DJR D;  4RGO S;  2OF1 A;  1V43 A;  1STB A;  3K5M A;  3QJY A;  1JWM D;  3H0G B;  2WKD A;  2WIN B;  4A3J B;  2F0S A;  3I4N B;  4HMI A;  1LTS D;  2JSO A;  1AZQ A;  3PIO 3;  2L5T A;  2R92 B;  1SDF A;  1ENC A;  3HOU B;  2B2T A;  2K04 A;  4B08 A;  1EY7 A;  4CGY B;  1KDA A;  3MFY A;  1CZW A;  3NUC A;  3M85 A;  3L3O C;  4MN3 A;  1TY2 A;  1CZG A;  3FEW X;  3SE0 A;  3SDZ A;  2F0J A;  2N88 A;  1LT6 D;  2IL8 A;  4QMG A;  5CV5 A;  1PFB A;  2QDB A;  1TS5 A;  3TP8 A;  4CBV A;  5G3L F;  1LTG D;  1G2S A;  5E4W C;  4KK7 A;  1SJE D;  3HS0 C;  2EY5 A;  4J8Q A;  3J81 E;  1DYQ A;  3MFG A;  2JA6 B;  1T5E A;  2EJG C;  4WOR A;  3KK7 A;  3M3Y B;  3MWY W;  4BY7 B;  3SHL A;  3TZD A;  1IYV A;  1NUC A;  3Q6S A;  1BCP B;  1L0Y B;  1SE4 A;  3BVM A;  3S2D B;  4WJW A;  1B53 A;  1FR3 A;  4R9W A;  5BN3 A;  1HPC A;  1QNU A;  3NE5 B;  3NHH A;  3ND8 A;  3EA6 A;  3FPU B;  3QG1 A;  1PMR A;  3A7L A;  4M1U B;  4CHT B;  2NWG A;  2XN9 C;  2A68 C;  1EEI D;  3A7A B;  2F0N A;  1FNW A;  1PZJ D;  4F87 A;  4BWG B;  3GTP B;  3H09 A;  1PRT C;  1RTO A;  4Q5V A;  1PTO C;  4H0L C;  2JA7 B;  1CA5 A;  3HG9 A;  4RA8 A;  5KEE A;  4TRD A;  3W3A A;  2XNA C;  3MTS A;  2IX1 A;  1IL8 A;  2Z8L A;  1OXU A;  1NR2 A;  1QWY A;  5ELF A;  2F03 A;  2Y0S B;  5KND A;  1LLR D;  5IGC A;  1QB5 D;  5IIF A;  1Y1W B;  1ILP A;  4BBR B;  2EE1 A;  3NQI A;  1V1O A;  4KD4 A;  1FD7 D;  4A3G B;  1JOO A;  3HOX B;  2JA5 B;  2AWO A;  2L0C A;  1UEA B;  4K5W A;  5IT9 L;  4ODG A;  3BDL A;  1F9P A;  1KDB A;  3S1N B;  2J0T D;  3AB9 A;  3TZU A;  1LTB D;  3VR2 A;  4XT1 B;  1E2Z A;  1PRT B;  3BG3 A;  2I07 B;  3M4Y A;  2MHV A;  1Q3L A;  2A6H C;  1F9Q A;  2FFK B;  1MSH A;  3OIQ A;  3I90 A;  1S5E D;  4KJO A;  2CQA A;  1WD1 A;  1SND A;  3GO5 A;  4FXD A;  4A3D B;  5A2Q L;  3IKJ A;  1C8C A;  1TVX A;  4K8I A;  5CBE E;  4O1N A;  1G6Z A;  1H9M A;  1F9S A;  4ZAI A;  3G6J B;  2ID0 A;  4L8J A;  2F0F A;  4TQU S;  5DM6 3;  3D8G A;  3A8I E;  1CHQ D;  1PZK D;  1EQV A;  2B2U A;  2F3W A;  2HCC A;  5JAV A;  2JXM B;  3GD7 A;  4A3F B;  2M9V A;  1Y1V B;  2X69 A;  4F8M A;  2EY1 A;  1S5D D;  3ERQ A;  2E75 C;  4S3S A;  1RKN A;  4IUV A;  1WTQ A;  3N6R A;  1GHJ A;  1I6V C;  1U4R A;  3BVZ A;  4G7Z C;  1AP0 A;  3T4A C;  3RD4 A;  4C2M B;  2KVM A;  3GQB A;  4ZRZ A;  1IHZ A;  1L0X B;  1TT2 A;  3S9W A;  4KV6 A;  4Y7N B;  3GTJ B;  5EPL A;  1DZ1 A;  3PUY A;  3TSS A;  2D9U A;  2PQE A;  3TN2 A;  2R7Z B;  2IW3 A;  2O2L D;  2B2T C;  2PPB C;  1PFN A;  3PUZ A;  2EYM A;  1B50 A;  1I4G A;  5HGT A;  5CGK A;  1DOK A;  3Q0A A;  4XYQ A;  3K0Y A;  3S1M B;  4IFD J;  5IGG A;  3TP6 A;  1O7Z A;  2NTT A;  2KEE A;  1U4M A;  4CKE A;  4KD3 A;  3PO3 B;  4F7X A;  2K32 A;  4N9T A;  3TP7 A;  1T5X D;  4C56 C;  5C5M A;  4KKT A;  3RUZ A;  4WRD A;  1PFM A;  3V96 A;  2F0I A;  5FO9 B;  2KHS A;  2X6G A;  1Z6H A;  3L9A X;  2VB2 X;  4IZ8 A;  1HRJ A;  4XDX A;  4EVO A;  4ZKB B;  1I4X A;  3CRL C;  1DOL A;  4XYO A;  5FLX E;  1GUW A;  3CU7 A;  4CKB A;  1IW7 D;  1RDP D;  2WAC A;  1SYD A;  4ULL A;  5KGU A;  3R2T A;  1A15 A;  2GA4 B;  3OWE B;  3A55 A;  3OMC A;  1AW7 A;  1RJT A;  4HR7 B;  1O7Y A;  1LTI D;  1ZYR D;  1VF5 C;  3NTH A;  1D5X C;  2B2U C;  4K5X A;  3CRK C;  3NWS A;  2E76 C;  2QKI C;  2JEA I;  3VR6 A;  5C4X B;  4IUT A;  3V05 A;  1DOM A;  1IKL A;  1CK1 A;  1AZP A;  4LJZ C;  1NAP A;  2G9D A;  1GUT A;  1H9K A;  5ELD A;  1GOZ A;  1DXM A;  1HHV A;  1JQY D;  1Q8I A;  4HN7 A;  3T53 B;  2X6L A;  3H6M A;  3T13 A;  1ILQ A;  2RDG A;  2E74 C;  3HGB A;  2MJ8 A;  1H9S A;  1JC7 A;  1JE4 A;  3A54 A;  3NK9 A;  4DXF A;  4DK1 A;  5J22 A;  1G2T A;  1S5F D;  2WKC A;  4FYD A;  2B2V A;  3K58 A;  3OWF A;  1BCP F;  3HOZ B;  1KAA A;  3K5O A;  5J1Z A;  3JAM E;  3PV0 A;  2KCN A;  3EJI A;  3VR3 A;  3HOV B;  2EY2 A;  4XQQ A;  2F0L A;  5JEA H;  2SNM A;  4I65 A;  3LX0 A;  1V1P B;  2EYO A;  2XVS A;  1U4L A;  2WII B;  1EQT A;  1X32 A;  3Q22 A;  1VDZ A;  2WAQ B;  5IOC A;  5AFW A;  1WCM B;  1STY A;  1SNC A;  2F0P A;  4K5V A;  1TQO A;  4DK0 A;  4KHZ A;  2A69 C;  2B8F A;  1EY0 A;  1EU4 A;  1F9R A;  4A3M B;  1B1Z A;  1G8Z D;  3MXU A;  3HEJ A;  4G7O C;  1ONL A;  2AQ1 B;  3TP5 A;  2BE5 C;  2EJM A;  1SNO A;  1HTL D;  2RQX A;  4IUN A;  3VA7 A;  1J8I A;  4U67 3;  1LO5 D;  3SEB A;  1WTW A;  1EY4 A;  1B9M A;  5CV7 A;  3KLS A;  3MC0 B;  1GJX A;  1JCK B;  1MSG A;  2M00 A;  4HCE A;  2IX3 A;  1CA6 A;  1Q12 A;  1HCZ A;  5LL6 S;  4DXG A;  2B2W A;  3URY A;  2O5J C;  5ELC A;  4GZY C;  2IJ0 A;  5JPN C;  4DAY A;  5I2Y A;  2XSC A;  2EJF C;  2PO4 A;  2IT1 A;  2MPM A;  3T51 B;  5CV9 A;  5E1F A;  2IWH A;  5M5Y B;  4AYB B;  2L11 A;  4IUP A;  3H3V C;  2F0O A;  2OEO A;  5EGT A;  2CW0 D;  2F1M A;  1WTV A;  1GUG A;  5CV4 A;  2F4I A;  2K03 A;  2PMZ B;  1OXS C;  4ZKC B;  4KY6 A;  3GTG B;  5ELE A;  3K5L A;  1JIC A;  1QNK A;  4IN3 A;  1Y8P B;  2BCO A;  2IX0 A;  2KA7 A;  1I6H B;  3P1H A;  5EQ0 A;  1E0B A;  4UAI A;  5IGF A;  4C3H B;  2ZXP A;  5JOB A;  3A8K E;  5JVG 3;  2DY8 A;  1B3A A;  2DNC A;  5CR3 A;  2XRQ D;  1A3V A;  1HFN A;  3DWQ A;  4ZUJ A;  1EFI D;  3GP7 A;  5IT9 E;  3E6Z X;  4DAP A;  4BS9 A;  2FJ2 A;  5EPJ A;  1VMP A;  4C3J G;  1HUN A;  1BCP C;  3R2I A;  2F0Q A;  3I72 A;  4L63 B;  5JJZ A;  3D31 A;  2HQE A;  3BYY B;  1GUN A;  1PRT D;  2G9H D;  3J7A V;  2XWB B;  2A5H A;  2K5Q A;  3F2U A;  4UDU C;  1EIG A;  1BXT A;  4A3E B;  2RVL A;  4Z9C B;  5K36 G;  4KKU A;  5KRU A;  4X3T A;  1EZ8 A;  4HTH A;  1FGB D;  4OL7 A;  1BNZ A;  5DNF A;  2PYK A;  2BDO A;  2JP1 A;  2OT2 A;  5NUC A;  4X3K A;  4CJ0 B;  3I4M B;  4L6T B;  2JE6 I;  1SBB B;  5DM7 3;  1ET9 A;  4K2K A;  3NP8 A;  1JWU D;  5CYU A;  1PYW D;  5C3X A;  3QO2 A;  1CQF A;  3J80 E;  2EYH A;  1ESR A;  1JWS D;  1I4H A;  2TMP A;  3EVQ A;  4C3I G;  3R3O A;  3SVM A;  3NTI A;  4DNR B;  4M8A A;  2F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...