2K50A

Solution nmr structure of the replication factor a related protein from methanobacterium thermoautotrophicum. northeast structural genomics target tr91a.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
MKPEHRMDTISKLEEGAETPVTGRVMKISSPRTFTTRKGREGKLANVIIADDTGELRAVFWTENIKLLKKFREGDVIRIKDVNIRGGFGGRKEAHLMPRSTVEVLDPLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Replication factor A related protein
publication title Solution NMR Structure of the replication Factor A Related Protein from Methanobacterium thermoautotrophicum. Northeast Structural Genomics Target TR91A.
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k50A01
3S14H 1SN8A 4A3EH 4GOPB 4B3RQ 1GD7A 4O0AA 1PH5A 4JYAQ 1CKMA 5LMUQ 5IYBH 3WWVA 4A75A 3JC66 4FDBA 5M3MH 5GQOA 1M90C 4JI6L 2OCEA 4DR5L 1L2FA 2CCZA 5IY0A 1IBLL 4JOIA 1HJPA 4A3IG 3I4NG 4DR7L 2UUCQ 3KDFA 2K5HA 5IP7H 4B3TQ 4WJ4A 1SE8A 2Z6KA 1L0WA 1PH8A 5C0XG 1JJGA 4A3DG 4LF6Q 1Q82C 2LSSA 5J3BA 3TQYA 2E5LQ 4JI8Q 4A76A 4LF8Q 4IPHA 1ASYA 5GROA 1HNWQ 4IPGA 4APVA 2K5NA 4KHZA 5GAEC 2E8GA 1N8RC 3ULPA 4NB3A 4UY8C 2VS1A 1YITA 3HKZG 3UE0A 2JA8H 4DK6C 1S3OA 2JA7G 1YHAA 2JQOA 2ES2A 3AYHB 4IPDA 2JEBI 1IBML 4BY1H 3CCRA 1U5KA 3CCSA 1UWVA 4HIOA 2XGTA 4JI6Q 4UP9A 2QEXA 4YCUA 4DR5Q 4B3SL 4JBWA 1NMFA 1WYDA 1NY4A 1IBLQ 2ZJRA 3Q8DA 2I0QA 3M7NA 4YCWA 4P75A 4JBKA 2N8NA 3NELA 1PH4A 4DR7Q 2R7FA 3S1NH 5JEAG 3U4VA 2D62A 3GTJH 2CQOA 5GAGC 3STBD 3HOVG 4X62L 3TEHB 2AWOA 3J81j 1G291 1TWAH 3GTOH 2GN5A 4DAMA 4LF9L 1SROA 2NN6I 1FJGL 4UP8A 1NE3A 1KAWA 4LF4L 3E0EA 4P72A 1MKHA 3AQQA 1OXTA 1CKNB 3RLNA 4LF5L 2F4VL 1FVIA 5JJKA 4DAYB 1VQ7A 1NTGA 4QJFA 1EOVA 1X54A 4A3LH 1VS0A 1IBMQ 4JBMA 2HHHL 1JB7A 5M3FG 2K75A 3S1RH 3H0GG 1CSQA 3CP0A 2KENA 2NN6G 1I50H 3CCQA 2DGYA 2LXKA 4B3SQ 4POGA 4YHHL 1BBUA 2WAQG 4OWWB 1AE3A 1Y1WG 4YY3L 4TQUS 1YEZA 4PMWA 3UDXA 4A3JG 2OTJA 1Y1VG 2MNAA 1Q86C 2NZHA 4JC0A 3HOUH 3PSIA 5IP9H 1KXLA 2F3IA 2K14A 4X62Q 4BA2I 2WB1G 3B6YA 5IYDG 3PO3G 3GTLH 1FL0A 4JV5L 4LF9Q 2PQAB 1Q1EA 2N49A 1FJGQ 1X9NA 4EX5A 2ZJPA 4LF4Q 1AE2A 2AMCB 4UP7A 4POFA 5C3EG 1GKHA 4H02A 4YCVA 4LF5Q 1LTLA 4GLAC 2I5LX 2F4VQ 1OXUA 2ASBA 3PO2H 3OTOL 3F2CA 2A19A 3STBC 1XPUA 4A93G 4A3CH 1X65A 4A3BG 1S40A 2HHHQ 4IO9A 1PFSA 4A3MG 4DUZL 4ME3A 4XTCS 1K8GA 4DV7L 1BKBA 4GLVB 4LFCL 3E9IA 4YHHQ 2YYZA 4L5TA 4A3DH 4JOIC 2E2JH 4OX9L 3S1MH 4GNXB 2PI2E 4YWKA 4AH6A 4YY3Q 1OTCA 2IT1A 3JAMc 3S2HH 2Z6KC 1YJNA 1Q46A 3CAMA 1N36L 1OXVA 3AFQA 5BR8L 4DR6L 1L1OB 1R9TH 1QUQB 4DUYL 1X3GA 3U4ZA 1IBKL 4Y52H 4JV5Q 4QY7A 5LMNW 2HIVA 3K0XA 4C3IH 1VQHA 4JBJA 1PH3A 4A3IH 3SGIA 3I4NH 2Y0SE 4A3KG 1VQFA 1PH1A 3J80i 2ZTEA 4DKAC 5FLMG 4X66L 3OTOQ 3W1BA 3D0FA 1VQBA 4IFDG 1VQPA 3CCMA 3GD7A 1VQ6A 3PF4A 4R4CA 3I4MG 1E3PA 1UE5A 4DUZQ 1LM0A 4KLKA 1G6PA 4DV7Q 1BBWA 4LFCQ 2KCMA 1EYGA 3CMEA 3E9HA 4X64L 4DV3L 4OX9Q 1WCMG 2HQLA 3UDFA 5IYCG 1UE7A 5C0XJ 3PV0A 5C0XI 4BBSG 1VQCA 2JA7H 3S17H 1T9HA 3G4SA 1N36Q 4BXXG 1XNRL 4R1JA 1YJ9A 5BR8Q 4DR6Q 4GN3B 4MTNA 3L2PA 4DUYQ 1SFOH 2R7ZG 1IBKQ 4PG3A 2HIXA 3PUWA 1YIJA 1Q1BA 4JI2L 1PH9A 1KHIA 1JJ2A 3OYYA 1VQNA 3CF5A 2R6GA 1WFQA 1Z47A 2N78A 5FJ8G 4B3ML 4X66Q 3HOVH 1XPRA 5IT9c 2PMZE 1JT8A 3M9BA 1YHBA 4O2DA 2EQSA 5JJLA 1Y14B 4DNIA 1OXSC 1W3SA 2Q2IA 1B7YB 5JEAJ 3FKIG 2E2IH 4DV3Q 3AFPA 4X64Q 1RL2A 1CUKA 3KYHC 4Y7NH 4IPCA 3A0JA 4PZ6A 1HR0L 1KD1C 4NXML 1TWHH 5HGQA 1XNRQ 3U58A 2H5XA 2K4KA 1I3QH 3HKSA 3KJOA 5M3FH 3H0GH 3TS0A 3DM3A 2VY3A 4AYBE 2YTXA 1HZAA 2DUDA 4JCVE 4R4QA 4EQ5A 4L5RC 3K80C 3J81c 1VQ4A 4JI2Q 4GKKL 4HIMA 1Y1WH 5C4XG 1TXYA 1UEBA 3FHWA 4UPAA 1MIUA 4DV5L 4GOPC 1Y1VH 4A3JH 4DR4L 4JI3L 4L5QA 4B3MQ 1K0RA 1RIPA 1VQIA 2PI2A 1B8AA 4DK3C 1YBYA 3CMAA 1NBWA 4A4IA 1KL9A 1SRUA 2FXQA 3I55A 4DPGA 3HOXG 3PO3H 1PA6A 1I94L 1E24A 5IYDH 2JJQA 4R4OA 3S15H 3EIVA 4AQYL 1CKOA 1VQOA 2IHFA 3CCJA 1QVGA 5C3EH 2PNHA 4OXPA 3T1HL 2JA6G 3W1GA 3PIPA 1KRTA 3CC7A 4NPSA 2EXDA 3ER0A 1XTDA 4DV1L 4LUZA 3PUXA 2MFIA 4A93H 1P8LA 2K50A 2MO0A 4OWTB 3KOJA 4HIDA 1HR0Q 4LNQA 1L1OA 3CW2C 3HFZB 4NXMQ 4A3BH 3RZDH 3K7AH 3NENA 2NVYH 4A3MH 3RZOH 1HR0W 3PGZA 4C2MH 3OW2A 2Q2TA 2N3SA 2QA4A 3HKZE 4KHPL 4GKKQ 1N9WA 3I2ZA 4LFBL 2OWOA 3ULLA 4DV5Q 4BA1I 2I5MX 4HIKA 1VQLA 4JI3Q 1VQ5A 4JI0L 4XIGS 4DR1L 4DR4Q 4K0KL 3L7ZC 1E22A 3BZCA 3CXCA 1IXRA 1YZ6A 5M5YH 5FLXc 1I94Q 4JI7Q 2ZTCA 1VQEA 2YTVA 5M5XH 3NBHB 3PCOB 3PIOA 4DV2L 4GOPA 2NZOA 4AQYQ 1EIYB 1SMXA 1EQRA 4A3KH 1SLJA 3T1HQ 3F8TA 1A62A 3J7ZC 1VQ9A 3EN2A 4WJ3M 2QGQA 4YWMA 4DV1Q 1MJCA 5FLMH 2R93G 4R4TA 4YWLA 3HOWG 4OO1G 1KIXA 2YU9H 1VCIA 1Z9FA 2VUMG 1WI5A 2CFMA 3I4MH 4IOAA 1PH2A 2IX0A 2MQHA 4IJHA 2BA0A 4KHPQ 3G48A 1V9PA 1WCMH 5IYCH 2JA5G 4LFBQ 2WFWA 4BBSH 3KF8B 1O7IA 1B70B 5IWAL 2IX1A 4IFDJ 4JI0Q 4GN5A 4DR1Q 1S72A 3KLWA 4BXXH 4IFDI 4K0KQ 1EQQA 2E2HH 1TWFH 1E7ZA 3PUYA 1WJJA 1HZBA 3I7FA 2R7ZH 3GTQH 4IJLA 4QQBX 2WAQE 3UDIA 5H1SE 2CWAA 3A5ZB 3F2BA 3BU2A 2OQKA 4DV2Q 3J7A5 1OXXK 2R92G 1N34L 3TS2A 2D0PA 1P16A 3CQZH 4C3HH 3JAMi 2ZM6L 2UUAL 2RF4A 4GN4B 5DLQE 3K81C 3CD6A 2R7DA 5FJ8H 4GLXA 3CC4A 2WB1E 3M3YH 3U50C 1VQ8A 3RLOA 4HJAA 1A63A 5C44G 3S1QH 2NVQH 4PZ8A 1V43A 2L15A 1LYLA 2F52A 3S24A 4LUOA 3W5OA 2B63G 1D8LA 2JE6I 3UDGA 1VQMA 1K9MC 3FKIH 3GTGH 2VZAA 1X3EA 2GVBA 3M4OH 3CCEA 3PF5A 5IWAQ 1VQDA 3LGJA 4DV0L 1X6OA 4J15A 3MEFA 2OQ0A 3EBEA 3BJUA 3T1YL 2UU9L 5IE8A 1GM5A 1PYBA 4A3GG 2UXDL 1FGUA 3M4PA 1QZHA 2I5HA 4QGUA 4DR2L 1JMCA 3GO5A 1V1QA 1DGSA 2HT1A 2RHQB 1CKNA 4A3FG 3GTMH 1N34Q 2UUAQ 2ZM6Q 2ZJQA 1Q7YC 1I5FA 5C4XH 4BY7G 1I6HH 4AIMA 4NXNL 1Q8KA 2Z0SA 1YJWA 1D7QA 1YI2A 3GTKH 4HJ7A 2YV5A 3ZJYC 2MO1A 2AHOB 2ZTDA 3RR5A 1C9OA 4BBRG 4DV6L 1XMQL 1HNXL 1L1OC 1IZ6A 3HOXH 4HJ5A 2Q2UA 3S2DH 3M4QA 3KF6B 5EAYA 4JI1L 2A1AA 1XMOL 4LF7L 1JE5A 4OONA 2VW9A 2RHSB 3ICEA 2VQFL 2JA6H 3UE1A 4X65L 1EUJA 1K73C 3RNUA 1YHQA 4DV0Q 1J6QA 3T1YQ 2UU9Q 3HOZG 2UXDQ 2PQAA 4P71A 4DV4L 3F2DA 1NJIC 3KFUA 1IYJB 4DR2Q 4GS3A 4HJ9A 4R4IA 2OTLA 4OWXB 4P74A 1XPOA 1Q81C 1GO3E 4LW1A 1M1KC 4A3EG 1IL2A 1VQKA 4NXNQ 1PH7A 2CWPA 2UUBL 3CCLA 5IYBG 3NEMA 3G6EA 5M3MG 4P73A 4DV6Q 1XMQQ 1HNXQ 1KRSA 1G51A 4JI7L 1X55A 1N33L 1PH6A 2NVTH 2BA1A 4JI5L 4IOCA 2BH8A 4JI1Q 4RMFA 2VL6A 3J81i 4GNXA 1PVOA 1XMOQ 4LF7Q 3I4OA 4DR3L 2EIFA 2AKWB 1QVCA 2KBNA 5IP7G 2VQFQ 2JEAI 1GVPA 1LUZA 3GTPH 4X65Q 1TWGH 4MZ9A 2R93H 1J5EL 3HOWH 1C0AA 1QUQA 3TRZA 2V1CC 1H95A 3A74A 3ERSX 1QZGA 1ASZA 2YTYA 3I56A 2B3GA 4TVAB 4DV4Q 2VUMH 3H3VH 2WP8J 2RCNA 3K7UC 2B29A 2CKZB 3MXNB 1SR3A 2ALYB 4RG1A 1K8AC 5K36G 3KDFB 2JA5H 3ULJA 2JA8G 4LWCA 1MJEA 3IRBA 3S16H 4LFAL 4JG2A 1Q12A 2UUBQ 4OO1I 2KHJA 4BY1G 2VNUD 1PHJA 2VQEL 2Q2HA 3RN2A 3H3VI 1N33Q 1UE6A 1BVSA 4JI5Q 4LUVA 1EFWA 3RN5A 3A5UA 2R92H 1A8VA 5E7NA 3TREA 4DR3Q 1TWCH 2K52A 1KC8C 2UXCL 2JK8A 2Y0SG 2KHIA 1WOCA 2A8VA 3FP9A 4QIWE 1J5EQ 5GAHC 1KQSA 5LMNL 4GKJL 5HY6A 3CC2A 5C44H 5GADC 3G71A 1W2BA 1X3FA 2KCTA 3M85A 2NVXH 1VQGA 1YVCA 2AWNA 2B63H 1C7YA 2D0OA 4JI4L 1YNXA 1N32L 2IHEA 2K5VA 1QVFA 4LFAQ 2UXBL 3PUVA 4A3LG 3PUZA 1CSPA 3CCUA 1HH2P 1HNZL 2VQEQ 4A3GH 4ALPA 3RLFA 1HZCA 3CPFA 1PYSB 3KF6A 3K8AA 5ELNA 3F1ZA 5M5WH 5AJ3L 3CCVA 3HOYH 3VDYA 1XNQL 4L5SA 4A3FH 5ELOA 1E1TA 3KJPA 1K83H 3GDEA 1XJVA 2ATWA 4BY7H 4B3RL 1PV4A 4QL5A 3CPWA 2UXCQ 3J80c 1AH9A 4MNOA 4JYAL 5LMUL 1K3RA 2XTIA 5IP9G 3HOUG 4BBRH 2JA9A 5LMNQ 4GKJQ 1NMGA 4PZ7A 1A0IA 1VQAA 1E1OA 2ID0A 3L0OA 2GVAA 3AEVA 3D31A 1HZ9A 2UUCL 4B3TL 4JI4Q 3H15A 2LXJA 4LF6L 3PO2G 2BH2A 1N32Q 4KI0A 4HJ8A 2C35B 1U0LA 3BZKA 1UE1A 1VQJA 1EIFA 4A3CG 2UXBQ 3HOZH 2E5LL 3HOYG 1X56A 4JI8L 4C3JH 1HNZQ 5JJIA 4LF8L 1HNWL 5AJ3Q 5C4JH 1EWIA 1XNQQ 4AYBG 1JJCB 4GNXC 2IY5B 4X6AH 3DLLA
chains in the Genus database with same CATH superfamily
4NP5A 3VR6A 3TP5A 1PH5A 4JYAQ 5IYBH 4KHVA 1JE4A 3DXJC 1U9RA 5CORA 5GQOA 3QR8A 2OCEA 5M3MH 1PRTC 3HOUB 1L2FA 1IBLL 2SOBA 2PMZB 1HJPA 3TZDA 1PH8A 2F0VA 5C0XG 1Q82C 2LSSA 1STNA 4HCSA 4JI8Q 3SXHA 5J1ZA 1HNWQ 5GROA 4IPGA 2F0MA 2Z4HA 3HOYB 2PNRC 4CHTB 3ULPA 1BOSA 2B2UC 3WOEA 4QCLA 5E1FA 1K83B 2QILA 4AYBB 1YITA 3S1MB 2JQOA 2I46A 1JQYD 3NBIA 2ES2A 5C4HA 2JEBI 5IGEA 3CCRA 3A8JE 2XGTA 4YCUA 4K8IA 1EY6A 1NMFA 5IODA 2ZJRA 4ULLA 4P75A 3U4VA 4DNRB 3GQBA 3GTJH 4A3IB 2CQOA 1STEA 1O80A 1VMCA 5KEEA 1LT6D 3SVMA 2FMCA 2AWOA 1TWAH 4DAMA 1BUVT 2NN6I 1CQFA 5I6WA 1KAWA 3ONAB 3TMEA 4P72A 4TRDA 1ILQA 3AQQA 3TN2A 4C1NK 1FVIA 1NTGA 1EOVA 4A3LH 1VS0A 2HHHL 4J1MA 3S1RH 3H0GG 3CP0A 4MIUA 1I50H 4N8X1 2LXKA 3CCQA 1EY9A 3T4AC 4YHHL 1STGA 5FO9B 4DAPA 1Y1WG 3HEJA 4TQUS 1YEZA 4BS9A 5I2XA 1KTKA 3PSIA 5IP9H 4LAAA 3HOUH 2F0EA 4KJNA 4LF9Q 1Q1EA 3LWUA 4EGVA 4POFA 1IW7D 4GLAC 1IL8A 3OWFA 1LTID 3VA7A 4BY1B 2I07B 1PTOC 1S5BD 2EYPA 3H91A 4GLVB 2LS01 2FHTA 4JOIC 4OX9L 2C5CA 3S1MH 4ZKBB 4GNXB 4YY3Q 1GUTA 3JAMc 1Q46A 3CAMA 4IUQA 1OXVA 1H9SB 1Y1VB 5BR8L 2LKVA 3I90A 4QY7A 5LMNW 4JV5Q 1PRTB 1VQHA 4JBJA 2Z4IA 4A3IH 4J6HA 3S15B 3QJYA 1BDOA 1FYCA 4DKAC 3J7AF 3MVVA 1VF7A 1O78A 1XWEA 4A93B 3FRPB 4R4CA 4DUZQ 4LFCQ 1WTQA 2KCMA 3CMEA 4A3MB 4BWGB 3DM1A 5C0XI 4BBSG 4V190 3PQIA 3SEBA 3G4SA 4BXXG 5EKIA 1FR3A 4DR6Q 4G7OC 5L37A 1SFOH 2ICIA 1UUPA 4PG3A 4XT1B 2HIXA 1J9OA 1Q1BA 1U4RA 3SK6A 3VA5A 5JEAH 3OYYA 3LNNA 3R2TA 2R6GA 1PFBA 1Z47A 1A3VA 1NUCA 4A3KB 4B3ML 1XPRA 5IT9c 3M9BA 3PO2B 3P1HA 1YHBA 4O2DA 1Y14B 1TKWB 1W3SA 1B7YB 5KYIA 5JEAJ 2E2IH 4DV3Q 3AFPA 2B8FA 4FNFA 3KYHC 2F0SA 1PFMA 1TY0A 1SBBB 1B9MA 1XNRQ 2H5XA 2K4KA 3TS0A 2A6EC 3DM3A 1A3TA 2NN6H 1YNJD 1BO0A 3FDTA 1HZAA 3MXPA 4JCVE 1UEBA 3FHWA 1WTHA 1MIUA 4UPAA 4OL7A 1Y1VH 3D6WA 3RMHA 2EVBA 4JI3L 3JAME 2NBFA 1K0RA 5EPLA 2PI2A 4PV1C 4DK3C 1NBWA 4A4IA 1Z7TA 4X3SA 3PO3H 1RTOA 4KY6A 1E24A 2F3WA 3U9OA 4R4OA 3S15H 3EIVA 3EQLC 2IHFA 4KMUC 4OXPA 3TDQA 3K59A 4K5VA 4NPSA 1XTDA 4A93H 3KOJA 1F9SA 3CW2C 1HFGA 2L1BA 3K7AH 5EBDA 4A3MH 4XYOA 2TMPA 1PTOB 1TS5A 3PGZA 4S3SA 2FFKB 3OW2A 1HRJA 2N3SA 4LFBL 1ENCA 3MA2B 1EIGA 4JI0L 3BS1A 3L7ZC 3BZCA 2XN9C 1YZ6A 5FLXc 1O7ZA 4QIWB 1VQEA 3PCOB 3S2DB 4A3KH 1VQ9A 3T1HQ 3F8TA 3T53B 1DXMA 3MEHA 4DV1Q 1CA5A 4R4TA 5NUCA 2GA4B 2F0WA 5CV5A 4XXEA 1DOKA 3VYUA 2EY6A 4ZCKA 4FXKC 1Z9FA 2VUMG 2CFMA 1PH2A 4MHEA 2BA0A 1BNZA 3G48A 5EQ0A 3WDNA 3KF8B 3D4RA 2D5DA 4K0KQ 4Q0FA 1SMYD 1E7ZA 3Q23A 5M9OA 5C4ZA 4IJLA 5H1SE 3K5LA 2EJMA 3BU2A 3AB9A 4EQOA 4L63B 3J7A5 2R92G 2D0PA 5K5PA 5IGDA 4GN4B 1WTOA 2RBMA 2R7DA 3F2UA 3GTPB 3CC4A 1B4OA 3U50C 1SE4A 4P2CB 4DXFA 1KNEA 3W5OA 2IX3A 3RZOB 5DM73 3TBIB 1X3EA 3M4OH 1IKLA 1EWCA 4IQZA 1LTRD 3CCEA 5IWAQ 4OELB 2OQ0A 3T1YL 5IE8A 1PTOH 4A3GG 1SJED 1VMPA 1V1QA 2MHVA 4A3FG 1N34Q 4CBVA 2UUAQ 4BY7G 1RTNA 1D7QA 3ZJYC 1V1OA 2YU9B 3UI2A 1L1OC 2Q2UA 3S2DH 1D6EC 2RKSA 1F2MA 4FF4A 5FLXE 5CMDA 1WTWA 4KK7A 1XMOL 1TS2A 4OONA 2VQFL 2KCCA 1ET9A 4X65L 2B63B 1IKMA 4BBSB 3E6ZX 3A7LA 5E3FA 1C8CA 2UXDQ 2RDHA 1V1PA 5JAVA 3F2DA 1RCVD 3ERQA 4R4IA 2OF1A 5AFWA 4P74A 5KNCA 1GO3E 2EYJA 4LW1A 3J80L 1M1KC 2O2LD 2KUMA 1I6VC 1LTBD 4FXGC 5IYBG 1CHPD 2KEEA 5M3MG 1HNXQ 1N33L 3VYRA 1PH6A 3EROA 5COYA 4JI5L 4BBRB 2NVTH 4CGYB 4GNXA 4K6DA 4DR3L 3GTPH 1QVCA 2JEAI 1GVPA 1TWGH 1H9SA 4MZ9A 3QB3A 1J5EL 4KN7C 3TRZA 2V1CC 3ERSX 3E3XA 1QOHA 3E5SA 2WP8J 4C3JB 2CKZB 1SR3A 1GUWA 2ALYB 1LT4D 1A2UA 4G7ZC 2JA5H 3EJIA 1M8AA 4LWCA 4ODGA 3S14B 4LFAL 4JG2A 1Q12A 4A3EB 2VNUD 2VQEL 2Q2HA 2DNCA 3Q24A 2CW0D 2B2UA 1DZ1A 5E7NA 1TWCH 3GV3A 2K52A 5EJWA 1KQSA 4C1NI 3CC2A 2Z6BA 3NPPA 4HMIA 2FJ2A 1W2BA 1X3FA 2KCTA 3OMGA 4TSSA 2B63H 1YVCA 2SNMA 2X69A 1Q8IA 1N32L 3C2PA 2KCNA 4A3LG 2BDNA 3FPPA 1AN8A 3CCUA 1TT2A 3PMFA 5AJ3L 4HSVA 4L5SA 2MGSA 5ELFA 4M1UB 1UAPA 2OXPA 1XJVA 2KJXA 2ATWA 4B3RL 3NWSA 2TSSA 1SJHD 3V05A 3S1NB 3OPOA 4MNOA 4J8QA 5LMUL 5IP9G 3HOUG 4BBRH 5LMNQ 3ND8A 4GKJQ 1NMGA 4PZ7A 3W3AA 1E1OA 3X3NA 2VUMB 1FNVA 1SYGA 3EVQA 3D31A 2UUCL 4JI4Q 4OIKA 1FNWA 2PZWA 4LF6L 3K6OA 1U4PA 4KI0A 4HJ8A 3HOZH 2E5LL 3HOYG 1X56A 4C3JH 3BDLA 1NR2A 1B1ZA 3VR2A 2QDLA 3IKJA 1B3QA 4AYBG 4X6AH 1G2TA 3S14H 1XX8A 2R92B 2K1BA 4A3EH 4GOPB 2EJGC 1PZID 5A2QL 4KD3A 4A75A 4FDBA 1M90C 3K5MA 4N8FA 2CH4W 2IPKD 5C6AA 1D5MC 2CCZA 4JOIA 3A55A 4A3IG 4DR7L 4DU9A 3KDFA 4B3TQ 1SE8A 1L0WA 1JJGA 4DK1A 1QG7A 3TQYA 1ESRA 1B53A 3MHBA 4CJ1B 2OEOA 2PZTA 3TP8A 4IPHA 1ASYA 2K5NA 4KHZA 5TSSA 5GAEC 2E8GA 3JAML 4NB3A 2K28A 4A3FB 1NAPA 2L9HA 3TSSA 4A3DB 4DK6C 1YHAA 4DK0A 2RCFA 4CDFC 4JI6Q 4UP9A 2QEXA 5CV9A 4DR5Q 4B3SL 1MSGA 4KJOA 1SEBD 5E4WC 4RHRA 2N8NA 3KF8A 3S1NH 4C3IB 5JEAG 5HURA 1EZ8A 4QMGA 1F2LA 1B44D 4ILWA 2NUCA 2B2VA 4X62L 3PIO3 2GN5A 3EFXD 5C4JB 1STYA 3E0EA 3RLNA 3FEWX 3RUZA 4DAYB 1VQ7A 1EQTA 1X54A 1IBMQ 3NXWA 4JBMA 1JB7A 2F3VA 3U9SA 2NN6G 4POGA 4KY7A 4ZRZA 2DY7A 5IT9L 1E2WA 1MGSA 1Y1VG 4PQXA 2D9UA 2PZUA 5EPJA 5EKKA 3NP8A 4ZQ3A 3PO3G 3HOVB 1LTAD 1TR5A 1FJGQ 5CGKA 1X9NA 4LF4Q 4UAIA 1ET6A 1Y8PB 2MPMA 4LF5Q 2F4VQ 1R4PB 2ASBA 4A93G 4A3CH 4H7BA 3BDOA 3KUPA 1PFSA 3I70A 4A3MG 4G4KA 4F87A 1I4GA 2F0KA 3E9IA 1WTXA 4L5TA 4A3DH 5FO8B 2MUYA 2N55A 5DNFA 3MTSA 2PI2E 4AH6A 4CKEA 1OTCA 1HTPA 1YJNA 3J7YW 3GTJB 2PPBC 1KDCA 2E75C 3OIQA 3U4ZA 4Y52H 4C3IH 5IGFA 1EY0A 1GHJA 3I4NH 4A3KG 1Z6HA 1RDPD 4IUUA 2EJFC 3OTOQ 3A8IE 3W1BA 1SXTA 1VQBA 1EEFD 4OEMB 1LM0A 1TS4A 4A3BB 2NYZD 4DV7Q 1G6PA 1BBWA 3E9HA 2HQLA 4RGMA 1IW7C 2MP1A 1N36Q 2PQEA 5FLXL 1CZGA 1X3PA 3CRLC 3H94A 4MTNA 3L2PA 4DUYQ 1IBKQ 2F03A 4JVZA 4HN7A 1VQNA 1K3BC 5M5XB 2O5IC 3CF5A 1ML0D 2N78A 4FF2A 4X66Q 3HOVH 2PMZE 1OXSC 2Q2IA 3H3VC 1DONA 3NSWA 4X64Q 1IYVA 1CUKA 2ENBA 3A0JA 1HR0L 4KKSA 1KD1C 4NXML 4G57A 3QOLA 1GXDC 5HGQA 3U58A 2EYMA 3HKSA 5M3FH 4AYBE 3V2TA 2YTXA 3HRZC 4EQ5A 1EIHA 2XSCA 3K80C 2R7ZB 4JI2Q 4GKKL 5G3LF 3CQZB 3LX0A 3K5OA 3CMAA 1KL9A 5IYDH 4DPGA 3M3YB 4B9XA 1PA6A 2JJQA 4AQYL 4NMZA 1UNSA 1X32A 2AUJD 1VQOA 1CTMA 3PIPA 3CC7A 1I4RA 3ER0A 3KBXA 4LUZA 3GTGB 3J7AV 4HIDA 1E0BA 1L1OA 4A3BH 1EU3A 3NENA 4RGOS 1SYEA 1HR0W 1SFOB 3Q0AA 2JYOA 1AFPA 4MTKA 1I4QA 1CFMA 4DV5Q 4BA1I 4HIKA 4DR4Q 5KNBA 1FNUA 4XIGS 1E22A 1JORA 1K28A 1V1PB 2RA4A 4RGTA 1YNJC 1I94Q 1SSOA 5ELEA 2YTVA 3BVZA 5M5XH 3HOXB 2ICEC 4GOPA 4IUNA 2ZXRA 1EQRA 5IGCA 2E2IB 2IL8A 1H9MA 4YWLA 4I7AA 1XYIA 4IFDH 1S5DD 2L55A 1WI5A 2CQAA 3L9AX 2WKCA 3V96A 4KHPQ 1WCMH 2RSNA 2JA5G 1CM9A 1HUMA 1K8MA 2EY2A 2PCFB 1O7IA 2WFWA 2IJ0A 1B70B 2IX1A 4IFDJ 3QOJA 4DR1Q 1SNMA 3SK4A 3I8ZA 2E2HH 1HZBA 2R7ZH 3GTQH 3PO3B 4QQBX 3A5ZB 4RH6A 4X3TA 4DV2Q 3TS2A 3CQZH 1CK1A 2B2WC 3MC0B 1B9NA 5CV8A 5DAUA 3CD6A 3KBGA 2QKIC 3HG9A 3M3YH 4U673 1LTTD 1VQ8A 4HJAA 3S1QH 1NNXA 2WACA 2R93B 3AMUA 2L15A 3K7AB 1EYAA 1BCPF 3NHHA 2B63G 3UDGA 3GTGH 1ENAA 2VZAA 2A73B 1TY2A 1VQDA 3LGJA 1X6OA 2EY5A 2DJFC 2VB2X 3MEFA 4J15A 3EBEA 3BJUA 2WINB 1SNOA 3M4PA 3M7GA 4QGUA 3SK8A 2HT1A 3CRKC 5ISRA 2ZM6Q 1Q7YC 4DAYA 5T1IA 2Z0SA 1NR4A 5EBCA 1YI2A 2RDGA 4BBRG 2MO1A 4CKCA 1XMQL 2F0TA 1C9OA 1SMYC 1LACA 1X3QA 3GV6A 1IZ6A 3HOXH 4HJ5A 4FF3A 1LTGD 2EXZA 1LT5D 2M2LA 3CKIB 3SDZA 5C44B 4F8MA 2VW9A 1BCPC 5CR3A 2RHSB 1ILPA 2M9VA 2F0UA 2NVXB 1K73C 1QB5D 1LABA 1YHQA 5G3LD 3AU7A 3D6CA 4DV0Q 3HOZG 4EQPA 2UU9Q 1G6ZA 4C3JG 1XXGA 4RCOA 1WTPA 1NJIC 3KFUA 2OTLA 4DR2Q 1BR9A 4A3EG 4NXNQ 2B2TA 2KHSA 2Z1CA 4QUCA 3NEMA 5IGGA 3G6EA 4DV6Q 1KRSA 1G51A 4JI7L 1X55A 1QE6A 2ZT9C 4JI1Q 5EKLA 3J81i 1PVOA 4LF7Q 2KBNA 4HTHA 1LUZA 4CKBA 3L3OC 3M4OB 3MXGA 2R93H 4OO1H 3A74A 1QZGA 3I56A 3NTKA 4TVAB 4DV4Q 3H3VH 1JC7A 1LO5D 4FP5D 3QG1A 4RG1A 3KDFB 2BCOA 3ULJA 1B3AA 2UUBQ 2KHJA 4HAEA 3RN2A 1BVSA 3RN5A 3IAYA 4FF1A 2UXCL 4QIWE 1L0XB 4X3KA 2K03A 5C44H 3A7AB 2L12A 4RCNA 3A8KE 3G71A 3M85A 2NVXH 2AWNA 1WTRA 3BZDB 1YNXA 2IHEA 1O7YA 3PUVA 2CVRA 3PUZA 1CSPA 3GP7A 3R3OA 4ALPA 3KF6A 3CPFA 4WFN3 5M5WH 1ZKOA 1I4XA 2NVTB 1BCPD 3DWAA 1RKNA 5ELOA 1OO9B 1JB3A 1QCBD 1PV4A 3CPWA 1TWGB 4JYAL 1G2SA 4H13C 3W2DA 2K32A 3L0OA 1ENFA 2J4XA 3SK5A 3DHQA 1F2ZA 2GVAA 3AEVA 1KLGD 2CW0C 3GTOB 1U4MA 1EY8A 2J7ZA 3H15A 4K6LA 2JA5B 4A3CG 2UXBQ 1VQJA 2HCCA 4JI8L 1HNZQ 1HNWL 4KV6A 1XNQQ 1JJCB 4A3DG 2AQ1B 4HR7B 3D8GA 2JP1A 3G7LA 5FK9C 4R8IA 3R8BA 1TWCB 1K0SA 3FPUB 4O0AA 3JC66 4WRDA 4CDCC 3MAQA 4C3IG 5IY0A 2F0OA 1EY5A 1NSNS 3I4NG 2Q8TA 2K5HA 1FD7D 4C56C 2O4XA 2QW7A 4LF8Q 2XRSD 3OW7A 4JK1C 1WD0A 1MSHA 2OT2A 3D3RA 5K36H 1K8OA 2A5HA 2IW3A 1B50A 2VS1A 3HKZG 3UE0A 1HXYD 2E2JB 1S3OA 4ME5A 2XVSA 4IPDA 4RKBA 1U5KA 3CCSA 3QO2A 3I3CA 4JBWA 1NY4A 3VYSA 1IBLQ 5I2YA 1R9TB 2I0QA 3M7NA 2VXWA 3NELA 2R7FA 4XQQA 3P75A 2D62A 2G9DA 1ICFB 3HOVG 3STBD 2Z9HA 1A3UA 5C5LA 5T1GA 3TZUA 1G91A 3TEHB 1AZQA 3NTHA 1G291 3J81j 3HOZB 5DEHA 3GTOH 4LF9L 1SROA 3IL8A 4UP8A 3C1FA 1NE3A 1MKHA 5JVH3 1OXTA 1CKNB 1QJOA 5JJKA 5KGUA 4N9PA 5M3FG 3P20A 3C3LA 1J8IA 1KDAA 4K14A 1D2BA 4TKOB 1BBUA 2CH4A 1AE3A 4YY3L 2MJ8A 2OTJA 1Q86C 4JC0A 2PO4A 2F3IA 2KVMA 1NCVA 5IYDG 1FL0A 4DN4M 4JV5L 5LHY1 2PQAB 2N49A 4EX5A 5J39A 1WVLA 2ZJPA 1AE2A 4UP7A 1EWHA 4YCVA 1LTLA 5KIXA 2A19A 1XPUA 4A3BG 2A68D 1S40A 2HHHQ 4Y7NB 4DUZL 4ME3A 1K8GA 3BYYB 3SE0A 1BKBA 1I3QB 4LFCL 4YHHQ 2YYZA 3T51B 2E2JH 1STHA 4IN3A 2EYFA 3LWEA 4YWKA 2IT1A 2K7VA 2WAQB 2Z6KC 3AFQA 4A3JB 4DR6L 1L1OB 1R9TH 2HD3A 1QUQB 5CBAE 1X3GA 5I6YA 1HTLD 2NTSA 3QWNA 1GJXA 2SEBD 2WB1B 3BYTB 1Y8OB 4EVOA 3ITPA 1PH1A 4KKTA 2KA7A 2ZTEA 1Y69U 2K5WA 2A6HD 5C3EB 3D0FA 2O5JC 4IFDG 3CCMA 1BBXC 3KLSA 2RQXA 3A54A 3GD7A 1VQ6A 1UE5A 3OHXC 2A69D 4KLKA 1YNND 1EYGA 4DV3L 4OX9Q 1WCMG 3D4DA 1PDQA 3X3MA 2AQ2B 2JA7H 3S17H 1XNRL 4R1JA 5BR8Q 1DD2A 2RVLA 2R7ZG 3T56B 2J0TD 3PUWA 2QF7A 3HP3A 1WTVA 1F77A 4IURA 5IOCA 3OOCA 2B2WA 1EQVA 3I4MB 4B08A 4I7ZC 1H9KA 1RL2A 4DNTB 3DUZA 1E2VA 4IPCA 4Y7NH 3OMCA 4K5XA 1I3QH 1PFNA 3KJOA 2SDFA 1TWFB 2DUDA 5D3DA 4R4QA 1DOLA 4L5RC 2B2YC 3J81c 1VQ4A 2ZXOA 3I4NB 1TXYA 2L4NA 4A3JH 4QUFA 5CBEE 4B3MQ 2L0CA 1RIPA 1VQIA 1B8AA 4QF4A 1HQRD 1YBYA 3HOXG 1L0YB 3I55A 3R2IA 2D2CC 1JICA 3DWQA 2NVQB 1G8ZD 1H9JA 1CKOA 5BN3A 5C3EH 3T1HL 3DEPA 1KRTA 3O13A 4DV1L 2EXDA 2HQEA 2MFIA 3FMCA 1ZXTA 3HKZB 1P8LA 2K50A 2MO0A 4OWTB 5CV4A 2NVYH 2F0LA 5CV7A 1TVXA 3HKZE 4KN4C 1STAA 1N9WA 3I2ZA 3ULLA 3GTMB 1VQLA 4JI3Q 1VQ5A 4K0KL 5C4XB 4HMJA 4JW0A 4I65A 4N9TA 1KLUD 4JI7Q 1LLRD 2ZTCA 3IFDA 3NBHB 1EIYB 5BN4A 2NZOA 1SLJA 1A62A 3J7ZC 1ESFA 2BE5D 4KY5A 2QGQA 1MJCA 5FLMH 2R93G 4OO1G 2JA6B 2K5QA 4NKLA 3NUCA 4RAUC 4XT3B 1KIXA 1VCIA 2NB0A 5I9PA 1SDFA 1I4HA 3CHBD 5M3FB 3I4MH 1GUOA 2MQHA 4ZUIA 3N6RA 2K04A 4IJHA 5KNDA 5IYCH 2XWBB 4LFBQ 4YIJA 5IWAL 3NQTA 1GUNA 4GN5A 1S72A 4JI0Q 3KLWA 4IFDI 1IYUA 1TWFH 1WJJA 3E0JA 2E74C 1N34L 4C3HH 1P16A 2UUAL 1I4PA 1PZKD 3J81E 2RF4A 2RDFA 4U68A 5DLQE 4XYQA 3ZYYX 2DY8A 5FKAC 5BN5A 5FJ8H 1BXTA 4GLXA 2G9HD 3BG3A 1A63A 4ABNA 3MWYW 5C44G 1JOQA 1PRTF 2NVQH 3HOWB 4PZ8A 1V43A 1LYLA 1RHPA 4LUOA 3DMUA 4LK1C 1VQMA 2X6LA 3FKIH 4RFBA 3H09A 2GVBA 4UDUC 1LV9A 1ZYRD 1JT8A 2UXDL 1SAPA 1PYBA 1MHWC 1FGUA 2JSOA 1CKNA 3GTMH 2ZJQA 4ZUJA 5C4XH 3HS0C 1QNKA 4HJ7A 2YV5A 1HNXL 1HFNA 2ZTDA 4M8AA 3RR5A 1EYCA 1SNDA 4F7XA 1WD1A 2KEDA 3M4QA 3KF6B 2A1AA 1JE5A 2JA6H 1EUJA 1WCMB 3RNUA 1D5XC 1HQMC 1J6QA 3T1YQ 1F9PA 2PQAA 2E2HB 3I73A 1CZWA 2B39A 2L11A 4HJ9A 3GTQB 4FO2A 3CU7A 1VQKA 4K2LA 4CJ0B 2CWPA 1PH7A 3I4LA 3VR3A 2K5DA 1PXUA 4OIJA 5EGTA 3S1QB 4RA8A 4IOCA 2BH8A 1DJRD 2VL6A 1XMOQ 3I4OA 2AKWB 2VQFQ 4HCEA 4X65Q 3HOWH 4UHVA 1QUQA 2F4IA 1C0AA 1H95A 5KRUA 4KTAA 3J80E 1ASZA 2YTYA 4Q5VA 2RCNA 3K7UC 4K2KA 3MXNB 2EYLA 5K36G 1K8AC 5F2DA 2NWGA 1AW7A 4KD4A 4OO1I 2NTTA 2QEJC 3H3VI 1N33Q 1PTOF 1UE6A 4EQNA 4JI5Q 4LUVA 4R9WA 2XWJB 1A8VA 4DR3Q 1R4QB 5D3IB 4X3UA 1JCKB 1KC8C 2Y0SG 3S9WA 2KHIA 2FMMA 1SE2A 2A8VA 3FP9A 1J5EQ 5GAHC 5LMNL 4GKJL 5HY6A 5GADC 1PZJD 4ID6A 4ZYSA 1JR0D 2F0HA 2CHBD 1AP0A 2D0OA 4JI4L 2F0FA 4O1NA 2K5VA 1QVFA 4LFAQ 1XTCD 4XQNA 4QB4A 2JA8B 2VQEQ 1PRTD 3HOYH 1EZ6A 1H9RA 3K8AA 1HA6A 2RSOA 3VR4A 1E1TA 1K83H 1QWYA 3GDEA 4QL5A 1KDBA 1AH9A 5C5MA 1ICWA 1EY4A 2JA9A 1C4QA 5IGBA 1ZEQX 3I91A 4B3TL 1PYWD 2LXJA 2ZXPA 5C3XA 1GHKA 1N32Q 1B2TA 5A35A 3BZKA 2C9OA 5KYLA 5D65A 2Q8IB 3NQIA 5AJ3Q 5LL6X 3R93A 1EWIA 1VDZA 4UY8C 2IY5B 5JVG3 1SN8A 2E76C 4B3RQ 1GD7A 1S5FD 1CKMA 5LMUQ 4IZ8A 4RHSA 3WWVA 4JI6L 1JOOA 1Y8NB 2F0JA 4DR5L 2B2VC 2LFNA 1A2TA 2V4DA 1TU2B 3GTLB 2UUCQ 5IP7H 4WJ4A 2Z6KA 4LF6Q 1HPCA 5J3BA 2E5LQ 1HCZA 4A76A 3NBHA 3PIP3 1KAAA 4APVA 5M5WB 5A2QE 1N8RC 4DGZA 2PW5A 1SNQA 2E2DC 3OSOA 2JA8H 2JA7G 5LL6S 5ELDA 1DOMA 3AYHB 3MZ5A 1IBML 4BY1H 3S2HB 1SYCA 1UWVA 4HIOA 4V0BA 1WYDA 3Q8DA 4YCWA 4JBKA 4CDEC 1PH4A 4DR7Q 2WV6D 2EE1A 2PYKA 1SNCA 5GAGC 3NK9A 4RKLA 1GUSA 4ZLTF 1PTOD 1FJGL 1M4VA 4FXDA 4LF4L 1SYDA 2JXMB 1PLFA 4LF5L 2F4VL 4ZAIA 3I72A 4QJFA 2Q8RE 1CT1D 2K75A 1EU4A 1CSQA 3WOFA 2KENA 3BVMA 2DGYA 4B3SQ 1FGBD 2WKDA 2WAQG 1CI3M 4OWWB 4PMWA 4RWSC 3UDXA 1EFID 4A3JG 2MNAA 1CQVA 2NZHA 3P7JA 1RF2D 1KXLA 2K14A 2KOLA 4X62Q 4BA2I 2WB1G 2VB3X 3B6YA 5HGTA 3GTLH 4NDXA 1W6JA 4IUTA 1EOTA 2EOTA 2B2YA 3K58A 2AMCB 5C3EG 1GKHA 4H02A 1TQOA 1IHZA 2I5LX 1OXUA 3PO2H 3OTOL 3F2CA 3STBC 5CV6A 5J22A 1SE3A 1X65A 3N52A 4IO9A 5IT9E 1TWHB 1MBYA 4XTCS 3J81L 4DV7L 1F9RA 5IIFA 3H0GB 1RODA 1STBA 1EL0A 3S2HH 1O7LA 1GUGA 3K0YA 4RGNA 4MN3A 2Y0SB 4DFAA 1N36L 1Y1WB 4WJWA 2K05A 4DUYL 1IBKL 1Q90A 2HIVA 3K0XA 4L6TB 4DF7A 4GZYC 1PH3A 5EPKA 3SGIA 2G5DA 1BCPB 2Y0SE 1VQFA 5ELCA 1EEID 3J80i 1PMRA 3KK7A 1SYBA 5C0XH 5FLMG 4X66L 3VR5A 2BOSA 1KNAA 1VQPA 2M00A 1BQQT 2A6ED 3PF4A 3I4MG 1E3PA 2A74C 3RZDB 2B8GA 1S5ED 5I4DA 4X64L 3UDFA 5IYCG 4C2MB 1UE7A 5C0XJ 2H4OA 1HA5A 3PV0A 1VQCA 1T9HA 1SNPA 1YJ9A 1RJTA 2A68C 3DWPA 4KKUA 4GN3B 1JWUD 4WORA 3TP7A 3MXNA 3A56A 5JOBA 4CDDC 1YIJA 4C3HG 5M5YB 4JI2L 4OHJA 1PH9A 1KHIA 1JJ2A 1WFQA 5FJ8G 2HDMA 2F0NA 2PW7A 2EQSA 5JJLA 4DNIA 4FVMA 3FKIG 1QILA 3ND9A 1DYQA 4HEDA 4JPBW 4ZKCB 2A6HC 4PZ6A 1D1IA 1TWHH 4H44C 1AZPA 1DM0B 1F9QA 3Q6SA 3URYA 3H0GH 2DJGC 2EPBA 4PNYA 2VY3A 2A69C 1JOKA 1YNNC 1TIID 3MFYA 3KLSX 2QDBA 4HIMA 1Y1WH 5C4XG 2K01A 4DV5L 4GOPC 4DR4L 1QNUA 4L5QA 1Q3LA 5E4XA 4CJ2C 1CHQD 1SRUA 2FXQA 2AQ3B 1I94L 3RD4A 3NWTA 2LY7A 3CCJA 2Z8LA 1QVGA 2PNHA 2JA6G 3W1GA 3SR1A 3PUXA 5JJZA 1HR0Q 4LNQA 4NXMQ 3S17B 2JA7B 2H1EA 2EYHA 2EZVA 3HFZB 3RZDH 4DXGA 5FO7B 2EY1A 3RZOH 4C2MH 2Q2TA 4LJZC 2QA4A 4K5WA 4KHPL 2AUKA 4GKKQ 4FYDA 2OWOA 2I5MX 1BF4A 4DR1L 1I6HB 2BDOA 4L8JA 2L5TA 3CXCA 1IXRA 5M5YH 3GTKB 1DCZA 4F88A 4DV2L 3PIOA 4AQYQ 1S5CD 3KLRA 1SMXA 3Q22A 4WJ3M 3EN2A 4LMQD 4YWMA 3HOWG 4XDXA 2YU9H 2F0PA 3NE5B 4IUPA 4IOAA 2IX0A 1V9PA 1E2ZA 5I9OA 4BBSH 4BXXH 1EQQA 3PUYA 2NZ1D 3I7FA 2P5ZX 2EDGA 2K6AA 2WAQE 3DEOA 2CWAA 3UDIA 5JPNC 3F2BA 2OQKA 4PMCA 1OXXK 2ZM6L 3JAMi 3K81C 1JWSD 1VF5C 2WB1E 3BVGA 4NW2A 3RLOA 1V8QA 2NVYB 2F52A 3S24A 4DAVA 1D8LA 2JE6I 1EYDA 3D4WA 1II3A 1K9MC 4ZK9B 3HGBA 2EYOA 2BE5C 4O42A 2HDLA 2KECA 3PF5A 4DV0L 1A15A 4R8NA 2UU9L 3EA6A 2B2TC 1GM5A 3S16B 3K57A 1QZHA 2I5HA 4K8JA 4DR2L 4E6IA 1JMCA 3GO5A 1DGSA 5D14A 2RHQB 1I6HH 1I5FA 5C3WA 4AIMA 4NXNL 1Q8KA 1YJWA 2R61A 3G6JB 3C46A 2DN8A 3GTKH 4DV6L 2AHOB 3OIPA 1TS3A 4HSPA 1U4LA 3HZXA 5EAYA 4JI1L 5CC4A 2WIIB 2FINB 4LF7L 1AEXA 1D1KA 4PMBA 3ICEA 3UE1A 2F0IA 2X6GA 3MFGA 4DA2A 2QCPX 4P71A 4DV4L 1IYJB 4GS3A 4A3GB 1SYFA 4OWXB 2F0GA 2XNAC 2HUGA 2HCIA 1XPOA 1Q81C 4C3HB 1IL2A 3C1EA 3IFTA 1T5XD 2UUBL 1F2YA 3CCLA 1ONLA 1ZYRC 4BY7B 1S4ZA 1XMQQ 4P73A 5DM63 1LT3D 3VYTA 2BA1A 1C48A 3MXUA 4RMFA 5ELBA 3T13A 2KQ3A 3M4YA 3NTIA 1LTSD 2EIFA 5IP7G 3QIAA 3FKIB 1UEAB 1EY7A 2LMCB 2B3GA 2VUMH 3FVQA 2B29A 4B9WA 2XIWA 4H0LC 2JA8G 1MJEA 3IRBA 3S16H 4BY1G 2SNSA 1HUNA 1PHJA 3H6MA 4OGQC 2F0DA 3BDCA 3T16A 3TP6A 5M3MB 1EFWA 3A5UA 2K33A 2R92H 2N88A 4Z9CB 3TREA 2F0QA 1JWMD 2JK8A 2JN4A 1WOCA 4IUVA 1T5EA 5CYUA 1VQGA 1D5ZC 1MI2A 1KABA 1C7YA 1MD2D 2UXBL 5JPMC 2R3ZA 1HH2P 1HNZL 4A3GH 3RLFA 1W6KA 1HZCA 1PYSB 5ELNA 3F1ZA 3CCVA 1A6XA 1HHVA 3VDYA 4IALA 1XNQL 3SHLA 2DNEA 4A3FH 3KJPA 4BY7H 4XQJA 2UXCQ 3J80c 1CA6A 1K3RA 2XRQD 2XTIA 1A0IA 1VQAA 3K5NA 2ID0A 1GOZA 5FOBB 4G7HC 3OWEB 1TWAB 1HZ9A 2IWHA 3PO2G 2BH2A 2C35B 1U0LA 1UE1A 1EIFA 5JJIA 4LF8L 5C4JH 3S1RB 4GNXC 1I50B 1RD9D 2F1MA 3DLLA
chains in the Genus database with same CATH topology
3S14H 1SN8A 4A3EH 4GOPB 4B3RQ 1GD7A 4O0AA 1PH5A 4JYAQ 1CKMA 5LMUQ 5IYBH 3WWVA 4A75A 3JC66 4FDBA 5M3MH 5GQOA 1M90C 4JI6L 2OCEA 4DR5L 1L2FA 2CCZA 5IY0A 1IBLL 4JOIA 1HJPA 4A3IG 3I4NG 4DR7L 2UUCQ 3KDFA 2K5HA 5IP7H 4B3TQ 4WJ4A 1SE8A 2Z6KA 1L0WA 1PH8A 5C0XG 1JJGA 4A3DG 4LF6Q 1Q82C 2LSSA 5J3BA 3TQYA 2E5LQ 4JI8Q 4A76A 4LF8Q 4IPHA 1ASYA 5GROA 1HNWQ 4IPGA 4APVA 2K5NA 4KHZA 5GAEC 2E8GA 1N8RC 3ULPA 4NB3A 4UY8C 2VS1A 1YITA 3HKZG 3UE0A 2JA8H 4DK6C 1S3OA 2JA7G 1YHAA 2JQOA 2ES2A 3AYHB 4IPDA 2JEBI 1IBML 4BY1H 3CCRA 1U5KA 3CCSA 1UWVA 4HIOA 2XGTA 4JI6Q 4UP9A 2QEXA 4YCUA 4DR5Q 4B3SL 4JBWA 1NMFA 1WYDA 1NY4A 1IBLQ 2ZJRA 3Q8DA 2I0QA 3M7NA 4YCWA 4P75A 4JBKA 2N8NA 3NELA 1PH4A 4DR7Q 2R7FA 3S1NH 5JEAG 3U4VA 2D62A 3GTJH 2CQOA 5GAGC 3STBD 3HOVG 4X62L 3TEHB 2AWOA 3J81j 1G291 1TWAH 3GTOH 2GN5A 4DAMA 4LF9L 1SROA 2NN6I 1FJGL 4UP8A 1NE3A 1KAWA 4LF4L 3E0EA 4P72A 1MKHA 3AQQA 1OXTA 1CKNB 3RLNA 4LF5L 2F4VL 1FVIA 5JJKA 4DAYB 1VQ7A 1NTGA 4QJFA 1EOVA 1X54A 4A3LH 1VS0A 1IBMQ 4JBMA 2HHHL 1JB7A 5M3FG 2K75A 3S1RH 3H0GG 1CSQA 3CP0A 2KENA 2NN6G 1I50H 3CCQA 2DGYA 2LXKA 4B3SQ 4POGA 4YHHL 1BBUA 2WAQG 4OWWB 1AE3A 1Y1WG 4YY3L 4TQUS 1YEZA 4PMWA 3UDXA 4A3JG 2OTJA 1Y1VG 2MNAA 1Q86C 2NZHA 4JC0A 3HOUH 3PSIA 5IP9H 1KXLA 2F3IA 2K14A 4X62Q 4BA2I 2WB1G 3B6YA 5IYDG 3PO3G 3GTLH 1FL0A 4JV5L 4LF9Q 2PQAB 1Q1EA 2N49A 1FJGQ 1X9NA 4EX5A 2ZJPA 4LF4Q 1AE2A 2AMCB 4UP7A 4POFA 5C3EG 1GKHA 4H02A 4YCVA 4LF5Q 1LTLA 4GLAC 2I5LX 2F4VQ 1OXUA 2ASBA 3PO2H 3OTOL 3F2CA 2A19A 3STBC 1XPUA 4A93G 4A3CH 1X65A 4A3BG 1S40A 2HHHQ 4IO9A 1PFSA 4A3MG 4DUZL 4ME3A 4XTCS 1K8GA 4DV7L 1BKBA 4GLVB 4LFCL 3E9IA 4YHHQ 2YYZA 4L5TA 4A3DH 4JOIC 2E2JH 4OX9L 3S1MH 4GNXB 2PI2E 4YWKA 4AH6A 4YY3Q 1OTCA 2IT1A 3JAMc 3S2HH 2Z6KC 1YJNA 1Q46A 3CAMA 1N36L 1OXVA 3AFQA 5BR8L 4DR6L 1L1OB 1R9TH 1QUQB 4DUYL 1X3GA 3U4ZA 1IBKL 4Y52H 4JV5Q 4QY7A 5LMNW 2HIVA 3K0XA 4C3IH 1VQHA 4JBJA 1PH3A 4A3IH 3SGIA 3I4NH 2Y0SE 4A3KG 1VQFA 1PH1A 3J80i 2ZTEA 4DKAC 5FLMG 4X66L 3OTOQ 3W1BA 3D0FA 1VQBA 4IFDG 1VQPA 3CCMA 3GD7A 1VQ6A 3PF4A 4R4CA 3I4MG 1E3PA 1UE5A 4DUZQ 1LM0A 4KLKA 1G6PA 4DV7Q 1BBWA 4LFCQ 2KCMA 1EYGA 3CMEA 3E9HA 4X64L 4DV3L 4OX9Q 1WCMG 2HQLA 3UDFA 5IYCG 1UE7A 5C0XJ 3PV0A 5C0XI 4BBSG 1VQCA 2JA7H 3S17H 1T9HA 3G4SA 1N36Q 4BXXG 1XNRL 4R1JA 1YJ9A 5BR8Q 4DR6Q 4GN3B 4MTNA 3L2PA 4DUYQ 1SFOH 2R7ZG 1IBKQ 4PG3A 2HIXA 3PUWA 1YIJA 1Q1BA 4JI2L 1PH9A 1KHIA 1JJ2A 3OYYA 1VQNA 3CF5A 2R6GA 1WFQA 1Z47A 2N78A 5FJ8G 4B3ML 4X66Q 3HOVH 1XPRA 5IT9c 2PMZE 1JT8A 3M9BA 1YHBA 4O2DA 2EQSA 5JJLA 1Y14B 4DNIA 1OXSC 1W3SA 2Q2IA 1B7YB 5JEAJ 3FKIG 2E2IH 4DV3Q 3AFPA 4X64Q 1RL2A 1CUKA 3KYHC 4Y7NH 4IPCA 3A0JA 4PZ6A 1HR0L 1KD1C 4NXML 1TWHH 5HGQA 1XNRQ 3U58A 2H5XA 2K4KA 1I3QH 3HKSA 3KJOA 5M3FH 3H0GH 3TS0A 3DM3A 2VY3A 4AYBE 2YTXA 1HZAA 2DUDA 4JCVE 4R4QA 4EQ5A 4L5RC 3K80C 3J81c 1VQ4A 4JI2Q 4GKKL 4HIMA 1Y1WH 5C4XG 1TXYA 1UEBA 3FHWA 4UPAA 1MIUA 4DV5L 4GOPC 1Y1VH 4A3JH 4DR4L 4JI3L 4L5QA 4B3MQ 1K0RA 1RIPA 1VQIA 2PI2A 1B8AA 4DK3C 1YBYA 3CMAA 1NBWA 4A4IA 1KL9A 1SRUA 2FXQA 3I55A 4DPGA 3HOXG 3PO3H 1PA6A 1I94L 1E24A 5IYDH 2JJQA 4R4OA 3S15H 3EIVA 4AQYL 1CKOA 1VQOA 2IHFA 3CCJA 1QVGA 5C3EH 2PNHA 4OXPA 3T1HL 2JA6G 3W1GA 3PIPA 1KRTA 3CC7A 4NPSA 2EXDA 3ER0A 1XTDA 4DV1L 4LUZA 3PUXA 2MFIA 4A93H 1P8LA 2K50A 2MO0A 4OWTB 3KOJA 4HIDA 1HR0Q 4LNQA 1L1OA 3CW2C 3HFZB 4NXMQ 4A3BH 3RZDH 3K7AH 3NENA 2NVYH 4A3MH 3RZOH 1HR0W 3PGZA 4C2MH 3OW2A 2Q2TA 2N3SA 2QA4A 3HKZE 4KHPL 4GKKQ 1N9WA 3I2ZA 4LFBL 2OWOA 3ULLA 4DV5Q 4BA1I 2I5MX 4HIKA 1VQLA 4JI3Q 1VQ5A 4JI0L 4XIGS 4DR1L 4DR4Q 4K0KL 3L7ZC 1E22A 3BZCA 3CXCA 1IXRA 1YZ6A 5M5YH 5FLXc 1I94Q 4JI7Q 2ZTCA 1VQEA 2YTVA 5M5XH 3NBHB 3PCOB 3PIOA 4DV2L 4GOPA 2NZOA 4AQYQ 1EIYB 1SMXA 1EQRA 4A3KH 1SLJA 3T1HQ 3F8TA 1A62A 3J7ZC 1VQ9A 3EN2A 4WJ3M 2QGQA 4YWMA 4DV1Q 1MJCA 5FLMH 2R93G 4R4TA 4YWLA 3HOWG 4OO1G 1KIXA 2YU9H 1VCIA 1Z9FA 2VUMG 1WI5A 2CFMA 3I4MH 4IOAA 1PH2A 2IX0A 2MQHA 4IJHA 2BA0A 4KHPQ 3G48A 1V9PA 1WCMH 5IYCH 2JA5G 4LFBQ 2WFWA 4BBSH 3KF8B 1O7IA 1B70B 5IWAL 2IX1A 4IFDJ 4JI0Q 4GN5A 4DR1Q 1S72A 3KLWA 4BXXH 4IFDI 4K0KQ 1EQQA 2E2HH 1TWFH 1E7ZA 3PUYA 1WJJA 1HZBA 3I7FA 2R7ZH 3GTQH 4IJLA 4QQBX 2WAQE 3UDIA 5H1SE 2CWAA 3A5ZB 3F2BA 3BU2A 2OQKA 4DV2Q 3J7A5 1OXXK 2R92G 1N34L 3TS2A 2D0PA 1P16A 3CQZH 4C3HH 3JAMi 2ZM6L 2UUAL 2RF4A 4GN4B 5DLQE 3K81C 3CD6A 2R7DA 5FJ8H 4GLXA 3CC4A 2WB1E 3M3YH 3U50C 1VQ8A 3RLOA 4HJAA 1A63A 5C44G 3S1QH 2NVQH 4PZ8A 1V43A 2L15A 1LYLA 2F52A 3S24A 4LUOA 3W5OA 2B63G 1D8LA 2JE6I 3UDGA 1VQMA 1K9MC 3FKIH 3GTGH 2VZAA 1X3EA 2GVBA 3M4OH 3CCEA 3PF5A 5IWAQ 1VQDA 3LGJA 4DV0L 1X6OA 4J15A 3MEFA 2OQ0A 3EBEA 3BJUA 3T1YL 2UU9L 5IE8A 1GM5A 1PYBA 4A3GG 2UXDL 1FGUA 3M4PA 1QZHA 2I5HA 4QGUA 4DR2L 1JMCA 3GO5A 1V1QA 1DGSA 2HT1A 2RHQB 1CKNA 4A3FG 3GTMH 1N34Q 2UUAQ 2ZM6Q 2ZJQA 1Q7YC 1I5FA 5C4XH 4BY7G 1I6HH 4AIMA 4NXNL 1Q8KA 2Z0SA 1YJWA 1D7QA 1YI2A 3GTKH 4HJ7A 2YV5A 3ZJYC 2MO1A 2AHOB 2ZTDA 3RR5A 1C9OA 4BBRG 4DV6L 1XMQL 1HNXL 1L1OC 1IZ6A 3HOXH 4HJ5A 2Q2UA 3S2DH 3M4QA 3KF6B 5EAYA 4JI1L 2A1AA 1XMOL 4LF7L 1JE5A 4OONA 2VW9A 2RHSB 3ICEA 2VQFL 2JA6H 3UE1A 4X65L 1EUJA 1K73C 3RNUA 1YHQA 4DV0Q 1J6QA 3T1YQ 2UU9Q 3HOZG 2UXDQ 2PQAA 4P71A 4DV4L 3F2DA 1NJIC 3KFUA 1IYJB 4DR2Q 4GS3A 4HJ9A 4R4IA 2OTLA 4OWXB 4P74A 1XPOA 1Q81C 1GO3E 4LW1A 1M1KC 4A3EG 1IL2A 1VQKA 4NXNQ 1PH7A 2CWPA 2UUBL 3CCLA 5IYBG 3NEMA 3G6EA 5M3MG 4P73A 4DV6Q 1XMQQ 1HNXQ 1KRSA 1G51A 4JI7L 1X55A 1N33L 1PH6A 2NVTH 2BA1A 4JI5L 4IOCA 2BH8A 4JI1Q 4RMFA 2VL6A 3J81i 4GNXA 1PVOA 1XMOQ 4LF7Q 3I4OA 4DR3L 2EIFA 2AKWB 1QVCA 2KBNA 5IP7G 2VQFQ 2JEAI 1GVPA 1LUZA 3GTPH 4X65Q 1TWGH 4MZ9A 2R93H 1J5EL 3HOWH 1C0AA 1QUQA 3TRZA 2V1CC 1H95A 3A74A 3ERSX 1QZGA 1ASZA 2YTYA 3I56A 2B3GA 4TVAB 4DV4Q 2VUMH 3H3VH 2WP8J 2RCNA 3K7UC 2B29A 2CKZB 3MXNB 1SR3A 2ALYB 4RG1A 1K8AC 5K36G 3KDFB 2JA5H 3ULJA 2JA8G 4LWCA 1MJEA 3IRBA 3S16H 4LFAL 4JG2A 1Q12A 2UUBQ 4OO1I 2KHJA 4BY1G 2VNUD 1PHJA 2VQEL 2Q2HA 3RN2A 3H3VI 1N33Q 1UE6A 1BVSA 4JI5Q 4LUVA 1EFWA 3RN5A 3A5UA 2R92H 1A8VA 5E7NA 3TREA 4DR3Q 1TWCH 2K52A 1KC8C 2UXCL 2JK8A 2Y0SG 2KHIA 1WOCA 2A8VA 3FP9A 4QIWE 1J5EQ 5GAHC 1KQSA 5LMNL 4GKJL 5HY6A 3CC2A 5C44H 5GADC 3G71A 1W2BA 1X3FA 2KCTA 3M85A 2NVXH 1VQGA 1YVCA 2AWNA 2B63H 1C7YA 2D0OA 4JI4L 1YNXA 1N32L 2IHEA 2K5VA 1QVFA 4LFAQ 2UXBL 3PUVA 4A3LG 3PUZA 1CSPA 3CCUA 1HH2P 1HNZL 2VQEQ 4A3GH 4ALPA 3RLFA 1HZCA 3CPFA 1PYSB 3KF6A 3K8AA 5ELNA 3F1ZA 5M5WH 5AJ3L 3CCVA 3HOYH 3VDYA 1XNQL 4L5SA 4A3FH 5ELOA 1E1TA 3KJPA 1K83H 3GDEA 1XJVA 2ATWA 4BY7H 4B3RL 1PV4A 4QL5A 3CPWA 2UXCQ 3J80c 1AH9A 4MNOA 4JYAL 5LMUL 1K3RA 2XTIA 5IP9G 3HOUG 4BBRH 2JA9A 5LMNQ 4GKJQ 1NMGA 4PZ7A 1A0IA 1VQAA 1E1OA 2ID0A 3L0OA 2GVAA 3AEVA 3D31A 1HZ9A 2UUCL 4B3TL 4JI4Q 3H15A 2LXJA 4LF6L 3PO2G 2BH2A 1N32Q 4KI0A 4HJ8A 2C35B 1U0LA 3BZKA 1UE1A 1VQJA 1EIFA 4A3CG 2UXBQ 3HOZH 2E5LL 3HOYG 1X56A 4JI8L 4C3JH 1HNZQ 5JJIA 4LF8L 1HNWL 5AJ3Q 5C4JH 1EWIA 1XNQQ 4AYBG 1JJCB 4GNXC 2IY5B 4X6AH 3DLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 H;  1SN8 A;  4A3E H;  4GOP B;  4B3R Q;  1GD7 A;  4O0A A;  1PH5 A;  4JYA Q;  1CKM A;  5LMU Q;  5IYB H;  3WWV A;  4A75 A;  3JC6 6;  4FDB A;  5M3M H;  5GQO A;  1M90 C;  4JI6 L;  2OCE A;  4DR5 L;  1L2F A;  2CCZ A;  5IY0 A;  1IBL L;  4JOI A;  1HJP A;  4A3I G;  3I4N G;  4DR7 L;  2UUC Q;  3KDF A;  2K5H A;  5IP7 H;  4B3T Q;  4WJ4 A;  1SE8 A;  2Z6K A;  1L0W A;  1PH8 A;  5C0X G;  1JJG A;  4A3D G;  4LF6 Q;  1Q82 C;  2LSS A;  5J3B A;  3TQY A;  2E5L Q;  4JI8 Q;  4A76 A;  4LF8 Q;  4IPH A;  1ASY A;  5GRO A;  1HNW Q;  4IPG A;  4APV A;  2K5N A;  4KHZ A;  5GAE C;  2E8G A;  1N8R C;  3ULP A;  4NB3 A;  4UY8 C;  2VS1 A;  1YIT A;  3HKZ G;  3UE0 A;  2JA8 H;  4DK6 C;  1S3O A;  2JA7 G;  1YHA A;  2JQO A;  2ES2 A;  3AYH B;  4IPD A;  2JEB I;  1IBM L;  4BY1 H;  3CCR A;  1U5K A;  3CCS A;  1UWV A;  4HIO A;  2XGT A;  4JI6 Q;  4UP9 A;  2QEX A;  4YCU A;  4DR5 Q;  4B3S L;  4JBW A;  1NMF A;  1WYD A;  1NY4 A;  1IBL Q;  2ZJR A;  3Q8D A;  2I0Q A;  3M7N A;  4YCW A;  4P75 A;  4JBK A;  2N8N A;  3NEL A;  1PH4 A;  4DR7 Q;  2R7F A;  3S1N H;  5JEA G;  3U4V A;  2D62 A;  3GTJ H;  2CQO A;  5GAG C;  3STB D;  3HOV G;  4X62 L;  3TEH B;  2AWO A;  3J81 j;  1G29 1;  1TWA H;  3GTO H;  2GN5 A;  4DAM A;  4LF9 L;  1SRO A;  2NN6 I;  1FJG L;  4UP8 A;  1NE3 A;  1KAW A;  4LF4 L;  3E0E A;  4P72 A;  1MKH A;  3AQQ A;  1OXT A;  1CKN B;  3RLN A;  4LF5 L;  2F4V L;  1FVI A;  5JJK A;  4DAY B;  1VQ7 A;  1NTG A;  4QJF A;  1EOV A;  1X54 A;  4A3L H;  1VS0 A;  1IBM Q;  4JBM A;  2HHH L;  1JB7 A;  5M3F G;  2K75 A;  3S1R H;  3H0G G;  1CSQ A;  3CP0 A;  2KEN A;  2NN6 G;  1I50 H;  3CCQ A;  2DGY A;  2LXK A;  4B3S Q;  4POG A;  4YHH L;  1BBU A;  2WAQ G;  4OWW B;  1AE3 A;  1Y1W G;  4YY3 L;  4TQU S;  1YEZ A;  4PMW A;  3UDX A;  4A3J G;  2OTJ A;  1Y1V G;  2MNA A;  1Q86 C;  2NZH A;  4JC0 A;  3HOU H;  3PSI A;  5IP9 H;  1KXL A;  2F3I A;  2K14 A;  4X62 Q;  4BA2 I;  2WB1 G;  3B6Y A;  5IYD G;  3PO3 G;  3GTL H;  1FL0 A;  4JV5 L;  4LF9 Q;  2PQA B;  1Q1E A;  2N49 A;  1FJG Q;  1X9N A;  4EX5 A;  2ZJP A;  4LF4 Q;  1AE2 A;  2AMC B;  4UP7 A;  4POF A;  5C3E G;  1GKH A;  4H02 A;  4YCV A;  4LF5 Q;  1LTL A;  4GLA C;  2I5L X;  2F4V Q;  1OXU A;  2ASB A;  3PO2 H;  3OTO L;  3F2C A;  2A19 A;  3STB C;  1XPU A;  4A93 G;  4A3C H;  1X65 A;  4A3B G;  1S40 A;  2HHH Q;  4IO9 A;  1PFS A;  4A3M G;  4DUZ L;  4ME3 A;  4XTC S;  1K8G A;  4DV7 L;  1BKB A;  4GLV B;  4LFC L;  3E9I A;  4YHH Q;  2YYZ A;  4L5T A;  4A3D H;  4JOI C;  2E2J H;  4OX9 L;  3S1M H;  4GNX B;  2PI2 E;  4YWK A;  4AH6 A;  4YY3 Q;  1OTC A;  2IT1 A;  3JAM c;  3S2H H;  2Z6K C;  1YJN A;  1Q46 A;  3CAM A;  1N36 L;  1OXV A;  3AFQ A;  5BR8 L;  4DR6 L;  1L1O B;  1R9T H;  1QUQ B;  4DUY L;  1X3G A;  3U4Z A;  1IBK L;  4Y52 H;  4JV5 Q;  4QY7 A;  5LMN W;  2HIV A;  3K0X A;  4C3I H;  1VQH A;  4JBJ A;  1PH3 A;  4A3I H;  3SGI A;  3I4N H;  2Y0S E;  4A3K G;  1VQF A;  1PH1 A;  3J80 i;  2ZTE A;  4DKA C;  5FLM G;  4X66 L;  3OTO Q;  3W1B A;  3D0F A;  1VQB A;  4IFD G;  1VQP A;  3CCM A;  3GD7 A;  1VQ6 A;  3PF4 A;  4R4C A;  3I4M G;  1E3P A;  1UE5 A;  4DUZ Q;  1LM0 A;  4KLK A;  1G6P A;  4DV7 Q;  1BBW A;  4LFC Q;  2KCM A;  1EYG A;  3CME A;  3E9H A;  4X64 L;  4DV3 L;  4OX9 Q;  1WCM G;  2HQL A;  3UDF A;  5IYC G;  1UE7 A;  5C0X J;  3PV0 A;  5C0X I;  4BBS G;  1VQC A;  2JA7 H;  3S17 H;  1T9H A;  3G4S A;  1N36 Q;  4BXX G;  1XNR L;  4R1J A;  1YJ9 A;  5BR8 Q;  4DR6 Q;  4GN3 B;  4MTN A;  3L2P A;  4DUY Q;  1SFO H;  2R7Z G;  1IBK Q;  4PG3 A;  2HIX A;  3PUW A;  1YIJ A;  1Q1B A;  4JI2 L;  1PH9 A;  1KHI A;  1JJ2 A;  3OYY A;  1VQN A;  3CF5 A;  2R6G A;  1WFQ A;  1Z47 A;  2N78 A;  5FJ8 G;  4B3M L;  4X66 Q;  3HOV H;  1XPR A;  5IT9 c;  2PMZ E;  1JT8 A;  3M9B A;  1YHB A;  4O2D A;  2EQS A;  5JJL A;  1Y14 B;  4DNI A;  1OXS C;  1W3S A;  2Q2I A;  1B7Y B;  5JEA J;  3FKI G;  2E2I H;  4DV3 Q;  3AFP A;  4X64 Q;  1RL2 A;  1CUK A;  3KYH C;  4Y7N H;  4IPC A;  3A0J A;  4PZ6 A;  1HR0 L;  1KD1 C;  4NXM L;  1TWH H;  5HGQ A;  1XNR Q;  3U58 A;  2H5X A;  2K4K A;  1I3Q H;  3HKS A;  3KJO A;  5M3F H;  3H0G H;  3TS0 A;  3DM3 A;  2VY3 A;  4AYB E;  2YTX A;  1HZA A;  2DUD A;  4JCV E;  4R4Q A;  4EQ5 A;  4L5R C;  3K80 C;  3J81 c;  1VQ4 A;  4JI2 Q;  4GKK L;  4HIM A;  1Y1W H;  5C4X G;  1TXY A;  1UEB A;  3FHW A;  4UPA A;  1MIU A;  4DV5 L;  4GOP C;  1Y1V H;  4A3J H;  4DR4 L;  4JI3 L;  4L5Q A;  4B3M Q;  1K0R A;  1RIP A;  1VQI A;  2PI2 A;  1B8A A;  4DK3 C;  1YBY A;  3CMA A;  1NBW A;  4A4I A;  1KL9 A;  1SRU A;  2FXQ A;  3I55 A;  4DPG A;  3HOX G;  3PO3 H;  1PA6 A;  1I94 L;  1E24 A;  5IYD H;  2JJQ A;  4R4O A;  3S15 H;  3EIV A;  4AQY L;  1CKO A;  1VQO A;  2IHF A;  3CCJ A;  1QVG A;  5C3E H;  2PNH A;  4OXP A;  3T1H L;  2JA6 G;  3W1G A;  3PIP A;  1KRT A;  3CC7 A;  4NPS A;  2EXD A;  3ER0 A;  1XTD A;  4DV1 L;  4LUZ A;  3PUX A;  2MFI A;  4A93 H;  1P8L A;  2K50 A;  2MO0 A;  4OWT B;  3KOJ A;  4HID A;  1HR0 Q;  4LNQ A;  1L1O A;  3CW2 C;  3HFZ B;  4NXM Q;  4A3B H;  3RZD H;  3K7A H;  3NEN A;  2NVY H;  4A3M H;  3RZO H;  1HR0 W;  3PGZ A;  4C2M H;  3OW2 A;  2Q2T A;  2N3S A;  2QA4 A;  3HKZ E;  4KHP L;  4GKK Q;  1N9W A;  3I2Z A;  4LFB L;  2OWO A;  3ULL A;  4DV5 Q;  4BA1 I;  2I5M X;  4HIK A;  1VQL A;  4JI3 Q;  1VQ5 A;  4JI0 L;  4XIG S;  4DR1 L;  4DR4 Q;  4K0K L;  3L7Z C;  1E22 A;  3BZC A;  3CXC A;  1IXR A;  1YZ6 A;  5M5Y H;  5FLX c;  1I94 Q;  4JI7 Q;  2ZTC A;  1VQE A;  2YTV A;  5M5X H;  3NBH B;  3PCO B;  3PIO A;  4DV2 L;  4GOP A;  2NZO A;  4AQY Q;  1EIY B;  1SMX A;  1EQR A;  4A3K H;  1SLJ A;  3T1H Q;  3F8T A;  1A62 A;  3J7Z C;  1VQ9 A;  3EN2 A;  4WJ3 M;  2QGQ A;  4YWM A;  4DV1 Q;  1MJC A;  5FLM H;  2R93 G;  4R4T A;  4YWL A;  3HOW G;  4OO1 G;  1KIX A;  2YU9 H;  1VCI A;  1Z9F A;  2VUM G;  1WI5 A;  2CFM A;  3I4M H;  4IOA A;  1PH2 A;  2IX0 A;  2MQH A;  4IJH A;  2BA0 A;  4KHP Q;  3G48 A;  1V9P A;  1WCM H;  5IYC H;  2JA5 G;  4LFB Q;  2WFW A;  4BBS H;  3KF8 B;  1O7I A;  1B70 B;  5IWA L;  2IX1 A;  4IFD J;  4JI0 Q;  4GN5 A;  4DR1 Q;  1S72 A;  3KLW A;  4BXX H;  4IFD I;  4K0K Q;  1EQQ A;  2E2H H;  1TWF H;  1E7Z A;  3PUY A;  1WJJ A;  1HZB A;  3I7F A;  2R7Z H;  3GTQ H;  4IJL A;  4QQB X;  2WAQ E;  3UDI A;  5H1S E;  2CWA A;  3A5Z B;  3F2B A;  3BU2 A;  2OQK A;  4DV2 Q;  3J7A 5;  1OXX K;  2R92 G;  1N34 L;  3TS2 A;  2D0P A;  1P16 A;  3CQZ H;  4C3H H;  3JAM i;  2ZM6 L;  2UUA L;  2RF4 A;  4GN4 B;  5DLQ E;  3K81 C;  3CD6 A;  2R7D A;  5FJ8 H;  4GLX A;  3CC4 A;  2WB1 E;  3M3Y H;  3U50 C;  1VQ8 A;  3RLO A;  4HJA A;  1A63 A;  5C44 G;  3S1Q H;  2NVQ H;  4PZ8 A;  1V43 A;  2L15 A;  1LYL A;  2F52 A;  3S24 A;  4LUO A;  3W5O A;  2B63 G;  1D8L A;  2JE6 I;  3UDG A;  1VQM A;  1K9M C;  3FKI H;  3GTG H;  2VZA A;  1X3E A;  2GVB A;  3M4O H;  3CCE A;  3PF5 A;  5IWA Q;  1VQD A;  3LGJ A;  4DV0 L;  1X6O A;  4J15 A;  3MEF A;  2OQ0 A;  3EBE A;  3BJU A;  3T1Y L;  2UU9 L;  5IE8 A;  1GM5 A;  1PYB A;  4A3G G;  2UXD L;  1FGU A;  3M4P A;  1QZH A;  2I5H A;  4QGU A;  4DR2 L;  1JMC A;  3GO5 A;  1V1Q A;  1DGS A;  2HT1 A;  2RHQ B;  1CKN A;  4A3F G;  3GTM H;  1N34 Q;  2UUA Q;  2ZM6 Q;  2ZJQ A;  1Q7Y C;  1I5F A;  5C4X H;  4BY7 G;  1I6H H;  4AIM A;  4NXN L;  1Q8K A;  2Z0S A;  1YJW A;  1D7Q A;  1YI2 A;  3GTK H;  4HJ7 A;  2YV5 A;  3ZJY C;  2MO1 A;  2AHO B;  2ZTD A;  3RR5 A;  1C9O A;  4BBR G;  4DV6 L;  1XMQ L;  1HNX L;  1L1O C;  1IZ6 A;  3HOX H;  4HJ5 A;  2Q2U A;  3S2D H;  3M4Q A;  3KF6 B;  5EAY A;  4JI1 L;  2A1A A;  1XMO L;  4LF7 L;  1JE5 A;  4OON A;  2VW9 A;  2RHS B;  3ICE A;  2VQF L;  2JA6 H;  3UE1 A;  4X65 L;  1EUJ A;  1K73 C;  3RNU A;  1YHQ A;  4DV0 Q;  1J6Q A;  3T1Y Q;  2UU9 Q;  3HOZ G;  2UXD Q;  2PQA A;  4P71 A;  4DV4 L;  3F2D A;  1NJI C;  3KFU A;  1IYJ B;  4DR2 Q;  4GS3 A;  4HJ9 A;  4R4I A;  2OTL A;  4OWX B;  4P74 A;  1XPO A;  1Q81 C;  1GO3 E;  4LW1 A;  1M1K C;  4A3E G;  1IL2 A;  1VQK A;  4NXN Q;  1PH7 A;  2CWP A;  2UUB L;  3CCL A;  5IYB G;  3NEM A;  3G6E A;  5M3M G;  4P73 A;  4DV6 Q;  1XMQ Q;  1HNX Q;  1KRS A;  1G51 A;  4JI7 L;  1X55 A;  1N33 L;  1PH6 A;  2NVT H;  2BA1 A;  4JI5 L;  4IOC A;  2BH8 A;  4JI1 Q;  4RMF A;  2VL6 A;  3J81 i;  4GNX A;  1PVO A;  1XMO Q;  4LF7 Q;  3I4O A;  4DR3 L;  2EIF A;  2AKW B;  1QVC A;  2KBN A;  5IP7 G;  2VQF Q;  2JEA I;  1GVP A;  1LUZ A;  3GTP H;  4X65 Q;  1TWG H;  4MZ9 A;  2R93 H;  1J5E L;  3HOW H;  1C0A A;  1QUQ A;  3TRZ A;  2V1C C;  1H95 A;  3A74 A;  3ERS X;  1QZG A;  1ASZ A;  2YTY A;  3I56 A;  2B3G A;  4TVA B;  4DV4 Q;  2VUM H;  3H3V H;  2WP8 J;  2RCN A;  3K7U C;  2B29 A;  2CKZ B;  3MXN B;  1SR3 A;  2ALY B;  4RG1 A;  1K8A C;  5K36 G;  3KDF B;  2JA5 H;  3ULJ A;  2JA8 G;  4LWC A;  1MJE A;  3IRB A;  3S16 H;  4LFA L;  4JG2 A;  1Q12 A;  2UUB Q;  4OO1 I;  2KHJ A;  4BY1 G;  2VNU D;  1PHJ A;  2VQE L;  2Q2H A;  3RN2 A;  3H3V I;  1N33 Q;  1UE6 A;  1BVS A;  4JI5 Q;  4LUV A;  1EFW A;  3RN5 A;  3A5U A;  2R92 H;  1A8V A;  5E7N A;  3TRE A;  4DR3 Q;  1TWC H;  2K52 A;  1KC8 C;  2UXC L;  2JK8 A;  2Y0S G;  2KHI A;  1WOC A;  2A8V A;  3FP9 A;  4QIW E;  1J5E Q;  5GAH C;  1KQS A;  5LMN L;  4GKJ L;  5HY6 A;  3CC2 A;  5C44 H;  5GAD C;  3G71 A;  1W2B A;  1X3F A;  2KCT A;  3M85 A;  2NVX H;  1VQG A;  1YVC A;  2AWN A;  2B63 H;  1C7Y A;  2D0O A;  4JI4 L;  1YNX A;  1N32 L;  2IHE A;  2K5V A;  1QVF A;  4LFA Q;  2UXB L;  3PUV A;  4A3L G;  3PUZ A;  1CSP A;  3CCU A;  1HH2 P;  1HNZ L;  2VQE Q;  4A3G H;  4ALP A;  3RLF A;  1HZC A;  3CPF A;  1PYS B;  3KF6 A;  3K8A A;  5ELN A;  3F1Z A;  5M5W H;  5AJ3 L;  3CCV A;  3HOY H;  3VDY A;  1XNQ L;  4L5S A;  4A3F H;  5ELO A;  1E1T A;  3KJP A;  1K83 H;  3GDE A;  1XJV A;  2ATW A;  4BY7 H;  4B3R L;  1PV4 A;  4QL5 A;  3CPW A;  2UXC Q;  3J80 c;  1AH9 A;  4MNO A;  4JYA L;  5LMU L;  1K3R A;  2XTI A;  5IP9 G;  3HOU G;  4BBR H;  2JA9 A;  5LMN Q;  4GKJ Q;  1NMG A;  4PZ7 A;  1A0I A;  1VQA A;  1E1O A;  2ID0 A;  3L0O A;  2GVA A;  3AEV A;  3D31 A;  1HZ9 A;  2UUC L;  4B3T L;  4JI4 Q;  3H15 A;  2LXJ A;  4LF6 L;  3PO2 G;  2BH2 A;  1N32 Q;  4KI0 A;  4HJ8 A;  2C35 B;  1U0L A;  3BZK A;  1UE1 A;  1VQJ A;  1EIF A;  4A3C G;  2UXB Q;  3HOZ H;  2E5L L;  3HOY G;  1X56 A;  4JI8 L;  4C3J H;  1HNZ Q;  5JJI A;  4LF8 L;  1HNW L;  5AJ3 Q;  5C4J H;  1EWI A;  1XNQ Q;  4AYB G;  1JJC B;  4GNX C;  2IY5 B;  4X6A H;  3DLL A; 
#chains in the Genus database with same CATH topology
 4NP5 A;  3VR6 A;  3TP5 A;  1PH5 A;  4JYA Q;  5IYB H;  4KHV A;  1JE4 A;  3DXJ C;  1U9R A;  5COR A;  5GQO A;  3QR8 A;  2OCE A;  5M3M H;  1PRT C;  3HOU B;  1L2F A;  1IBL L;  2SOB A;  2PMZ B;  1HJP A;  3TZD A;  1PH8 A;  2F0V A;  5C0X G;  1Q82 C;  2LSS A;  1STN A;  4HCS A;  4JI8 Q;  3SXH A;  5J1Z A;  1HNW Q;  5GRO A;  4IPG A;  2F0M A;  2Z4H A;  3HOY B;  2PNR C;  4CHT B;  3ULP A;  1BOS A;  2B2U C;  3WOE A;  4QCL A;  5E1F A;  1K83 B;  2QIL A;  4AYB B;  1YIT A;  3S1M B;  2JQO A;  2I46 A;  1JQY D;  3NBI A;  2ES2 A;  5C4H A;  2JEB I;  5IGE A;  3CCR A;  3A8J E;  2XGT A;  4YCU A;  4K8I A;  1EY6 A;  1NMF A;  5IOD A;  2ZJR A;  4ULL A;  4P75 A;  3U4V A;  4DNR B;  3GQB A;  3GTJ H;  4A3I B;  2CQO A;  1STE A;  1O80 A;  1VMC A;  5KEE A;  1LT6 D;  3SVM A;  2FMC A;  2AWO A;  1TWA H;  4DAM A;  1BUV T;  2NN6 I;  1CQF A;  5I6W A;  1KAW A;  3ONA B;  3TME A;  4P72 A;  4TRD A;  1ILQ A;  3AQQ A;  3TN2 A;  4C1N K;  1FVI A;  1NTG A;  1EOV A;  4A3L H;  1VS0 A;  2HHH L;  4J1M A;  3S1R H;  3H0G G;  3CP0 A;  4MIU A;  1I50 H;  4N8X 1;  2LXK A;  3CCQ A;  1EY9 A;  3T4A C;  4YHH L;  1STG A;  5FO9 B;  4DAP A;  1Y1W G;  3HEJ A;  4TQU S;  1YEZ A;  4BS9 A;  5I2X A;  1KTK A;  3PSI A;  5IP9 H;  4LAA A;  3HOU H;  2F0E A;  4KJN A;  4LF9 Q;  1Q1E A;  3LWU A;  4EGV A;  4POF A;  1IW7 D;  4GLA C;  1IL8 A;  3OWF A;  1LTI D;  3VA7 A;  4BY1 B;  2I07 B;  1PTO C;  1S5B D;  2EYP A;  3H91 A;  4GLV B;  2LS0 1;  2FHT A;  4JOI C;  4OX9 L;  2C5C A;  3S1M H;  4ZKB B;  4GNX B;  4YY3 Q;  1GUT A;  3JAM c;  1Q46 A;  3CAM A;  4IUQ A;  1OXV A;  1H9S B;  1Y1V B;  5BR8 L;  2LKV A;  3I90 A;  4QY7 A;  5LMN W;  4JV5 Q;  1PRT B;  1VQH A;  4JBJ A;  2Z4I A;  4A3I H;  4J6H A;  3S15 B;  3QJY A;  1BDO A;  1FYC A;  4DKA C;  3J7A F;  3MVV A;  1VF7 A;  1O78 A;  1XWE A;  4A93 B;  3FRP B;  4R4C A;  4DUZ Q;  4LFC Q;  1WTQ A;  2KCM A;  3CME A;  4A3M B;  4BWG B;  3DM1 A;  5C0X I;  4BBS G;  4V19 0;  3PQI A;  3SEB A;  3G4S A;  4BXX G;  5EKI A;  1FR3 A;  4DR6 Q;  4G7O C;  5L37 A;  1SFO H;  2ICI A;  1UUP A;  4PG3 A;  4XT1 B;  2HIX A;  1J9O A;  1Q1B A;  1U4R A;  3SK6 A;  3VA5 A;  5JEA H;  3OYY A;  3LNN A;  3R2T A;  2R6G A;  1PFB A;  1Z47 A;  1A3V A;  1NUC A;  4A3K B;  4B3M L;  1XPR A;  5IT9 c;  3M9B A;  3PO2 B;  3P1H A;  1YHB A;  4O2D A;  1Y14 B;  1TKW B;  1W3S A;  1B7Y B;  5KYI A;  5JEA J;  2E2I H;  4DV3 Q;  3AFP A;  2B8F A;  4FNF A;  3KYH C;  2F0S A;  1PFM A;  1TY0 A;  1SBB B;  1B9M A;  1XNR Q;  2H5X A;  2K4K A;  3TS0 A;  2A6E C;  3DM3 A;  1A3T A;  2NN6 H;  1YNJ D;  1BO0 A;  3FDT A;  1HZA A;  3MXP A;  4JCV E;  1UEB A;  3FHW A;  1WTH A;  1MIU A;  4UPA A;  4OL7 A;  1Y1V H;  3D6W A;  3RMH A;  2EVB A;  4JI3 L;  3JAM E;  2NBF A;  1K0R A;  5EPL A;  2PI2 A;  4PV1 C;  4DK3 C;  1NBW A;  4A4I A;  1Z7T A;  4X3S A;  3PO3 H;  1RTO A;  4KY6 A;  1E24 A;  2F3W A;  3U9O A;  4R4O A;  3S15 H;  3EIV A;  3EQL C;  2IHF A;  4KMU C;  4OXP A;  3TDQ A;  3K59 A;  4K5V A;  4NPS A;  1XTD A;  4A93 H;  3KOJ A;  1F9S A;  3CW2 C;  1HFG A;  2L1B A;  3K7A H;  5EBD A;  4A3M H;  4XYO A;  2TMP A;  1PTO B;  1TS5 A;  3PGZ A;  4S3S A;  2FFK B;  3OW2 A;  1HRJ A;  2N3S A;  4LFB L;  1ENC A;  3MA2 B;  1EIG A;  4JI0 L;  3BS1 A;  3L7Z C;  3BZC A;  2XN9 C;  1YZ6 A;  5FLX c;  1O7Z A;  4QIW B;  1VQE A;  3PCO B;  3S2D B;  4A3K H;  1VQ9 A;  3T1H Q;  3F8T A;  3T53 B;  1DXM A;  3MEH A;  4DV1 Q;  1CA5 A;  4R4T A;  5NUC A;  2GA4 B;  2F0W A;  5CV5 A;  4XXE A;  1DOK A;  3VYU A;  2EY6 A;  4ZCK A;  4FXK C;  1Z9F A;  2VUM G;  2CFM A;  1PH2 A;  4MHE A;  2BA0 A;  1BNZ A;  3G48 A;  5EQ0 A;  3WDN A;  3KF8 B;  3D4R A;  2D5D A;  4K0K Q;  4Q0F A;  1SMY D;  1E7Z A;  3Q23 A;  5M9O A;  5C4Z A;  4IJL A;  5H1S E;  3K5L A;  2EJM A;  3BU2 A;  3AB9 A;  4EQO A;  4L63 B;  3J7A 5;  2R92 G;  2D0P A;  5K5P A;  5IGD A;  4GN4 B;  1WTO A;  2RBM A;  2R7D A;  3F2U A;  3GTP B;  3CC4 A;  1B4O A;  3U50 C;  1SE4 A;  4P2C B;  4DXF A;  1KNE A;  3W5O A;  2IX3 A;  3RZO B;  5DM7 3;  3TBI B;  1X3E A;  3M4O H;  1IKL A;  1EWC A;  4IQZ A;  1LTR D;  3CCE A;  5IWA Q;  4OEL B;  2OQ0 A;  3T1Y L;  5IE8 A;  1PTO H;  4A3G G;  1SJE D;  1VMP A;  1V1Q A;  2MHV A;  4A3F G;  1N34 Q;  4CBV A;  2UUA Q;  4BY7 G;  1RTN A;  1D7Q A;  3ZJY C;  1V1O A;  2YU9 B;  3UI2 A;  1L1O C;  2Q2U A;  3S2D H;  1D6E C;  2RKS A;  1F2M A;  4FF4 A;  5FLX E;  5CMD A;  1WTW A;  4KK7 A;  1XMO L;  1TS2 A;  4OON A;  2VQF L;  2KCC A;  1ET9 A;  4X65 L;  2B63 B;  1IKM A;  4BBS B;  3E6Z X;  3A7L A;  5E3F A;  1C8C A;  2UXD Q;  2RDH A;  1V1P A;  5JAV A;  3F2D A;  1RCV D;  3ERQ A;  4R4I A;  2OF1 A;  5AFW A;  4P74 A;  5KNC A;  1GO3 E;  2EYJ A;  4LW1 A;  3J80 L;  1M1K C;  2O2L D;  2KUM A;  1I6V C;  1LTB D;  4FXG C;  5IYB G;  1CHP D;  2KEE A;  5M3M G;  1HNX Q;  1N33 L;  3VYR A;  1PH6 A;  3ERO A;  5COY A;  4JI5 L;  4BBR B;  2NVT H;  4CGY B;  4GNX A;  4K6D A;  4DR3 L;  3GTP H;  1QVC A;  2JEA I;  1GVP A;  1TWG H;  1H9S A;  4MZ9 A;  3QB3 A;  1J5E L;  4KN7 C;  3TRZ A;  2V1C C;  3ERS X;  3E3X A;  1QOH A;  3E5S A;  2WP8 J;  4C3J B;  2CKZ B;  1SR3 A;  1GUW A;  2ALY B;  1LT4 D;  1A2U A;  4G7Z C;  2JA5 H;  3EJI A;  1M8A A;  4LWC A;  4ODG A;  3S14 B;  4LFA L;  4JG2 A;  1Q12 A;  4A3E B;  2VNU D;  2VQE L;  2Q2H A;  2DNC A;  3Q24 A;  2CW0 D;  2B2U A;  1DZ1 A;  5E7N A;  1TWC H;  3GV3 A;  2K52 A;  5EJW A;  1KQS A;  4C1N I;  3CC2 A;  2Z6B A;  3NPP A;  4HMI A;  2FJ2 A;  1W2B A;  1X3F A;  2KCT A;  3OMG A;  4TSS A;  2B63 H;  1YVC A;  2SNM A;  2X69 A;  1Q8I A;  1N32 L;  3C2P A;  2KCN A;  4A3L G;  2BDN A;  3FPP A;  1AN8 A;  3CCU A;  1TT2 A;  3PMF A;  5AJ3 L;  4HSV A;  4L5S A;  2MGS A;  5ELF A;  4M1U B;  1UAP A;  2OXP A;  1XJV A;  2KJX A;  2ATW A;  4B3R L;  3NWS A;  2TSS A;  1SJH D;  3V05 A;  3S1N B;  3OPO A;  4MNO A;  4J8Q A;  5LMU L;  5IP9 G;  3HOU G;  4BBR H;  5LMN Q;  3ND8 A;  4GKJ Q;  1NMG A;  4PZ7 A;  3W3A A;  1E1O A;  3X3N A;  2VUM B;  1FNV A;  1SYG A;  3EVQ A;  3D31 A;  2UUC L;  4JI4 Q;  4OIK A;  1FNW A;  2PZW A;  4LF6 L;  3K6O A;  1U4P A;  4KI0 A;  4HJ8 A;  3HOZ H;  2E5L L;  3HOY G;  1X56 A;  4C3J H;  3BDL A;  1NR2 A;  1B1Z A;  3VR2 A;  2QDL A;  3IKJ A;  1B3Q A;  4AYB G;  4X6A H;  1G2T A;  3S14 H;  1XX8 A;  2R92 B;  2K1B A;  4A3E H;  4GOP B;  2EJG C;  1PZI D;  5A2Q L;  4KD3 A;  4A75 A;  4FDB A;  1M90 C;  3K5M A;  4N8F A;  2CH4 W;  2IPK D;  5C6A A;  1D5M C;  2CCZ A;  4JOI A;  3A55 A;  4A3I G;  4DR7 L;  4DU9 A;  3KDF A;  4B3T Q;  1SE8 A;  1L0W A;  1JJG A;  4DK1 A;  1QG7 A;  3TQY A;  1ESR A;  1B53 A;  3MHB A;  4CJ1 B;  2OEO A;  2PZT A;  3TP8 A;  4IPH A;  1ASY A;  2K5N A;  4KHZ A;  5TSS A;  5GAE C;  2E8G A;  3JAM L;  4NB3 A;  2K28 A;  4A3F B;  1NAP A;  2L9H A;  3TSS A;  4A3D B;  4DK6 C;  1YHA A;  4DK0 A;  2RCF A;  4CDF C;  4JI6 Q;  4UP9 A;  2QEX A;  5CV9 A;  4DR5 Q;  4B3S L;  1MSG A;  4KJO A;  1SEB D;  5E4W C;  4RHR A;  2N8N A;  3KF8 A;  3S1N H;  4C3I B;  5JEA G;  5HUR A;  1EZ8 A;  4QMG A;  1F2L A;  1B44 D;  4ILW A;  2NUC A;  2B2V A;  4X62 L;  3PIO 3;  2GN5 A;  3EFX D;  5C4J B;  1STY A;  3E0E A;  3RLN A;  3FEW X;  3RUZ A;  4DAY B;  1VQ7 A;  1EQT A;  1X54 A;  1IBM Q;  3NXW A;  4JBM A;  1JB7 A;  2F3V A;  3U9S A;  2NN6 G;  4POG A;  4KY7 A;  4ZRZ A;  2DY7 A;  5IT9 L;  1E2W A;  1MGS A;  1Y1V G;  4PQX A;  2D9U A;  2PZU A;  5EPJ A;  5EKK A;  3NP8 A;  4ZQ3 A;  3PO3 G;  3HOV B;  1LTA D;  1TR5 A;  1FJG Q;  5CGK A;  1X9N A;  4LF4 Q;  4UAI A;  1ET6 A;  1Y8P B;  2MPM A;  4LF5 Q;  2F4V Q;  1R4P B;  2ASB A;  4A93 G;  4A3C H;  4H7B A;  3BDO A;  3KUP A;  1PFS A;  3I70 A;  4A3M G;  4G4K A;  4F87 A;  1I4G A;  2F0K A;  3E9I A;  1WTX A;  4L5T A;  4A3D H;  5FO8 B;  2MUY A;  2N55 A;  5DNF A;  3MTS A;  2PI2 E;  4AH6 A;  4CKE A;  1OTC A;  1HTP A;  1YJN A;  3J7Y W;  3GTJ B;  2PPB C;  1KDC A;  2E75 C;  3OIQ A;  3U4Z A;  4Y52 H;  4C3I H;  5IGF A;  1EY0 A;  1GHJ A;  3I4N H;  4A3K G;  1Z6H A;  1RDP D;  4IUU A;  2EJF C;  3OTO Q;  3A8I E;  3W1B A;  1SXT A;  1VQB A;  1EEF D;  4OEM B;  1LM0 A;  1TS4 A;  4A3B B;  2NYZ D;  4DV7 Q;  1G6P A;  1BBW A;  3E9H A;  2HQL A;  4RGM A;  1IW7 C;  2MP1 A;  1N36 Q;  2PQE A;  5FLX L;  1CZG A;  1X3P A;  3CRL C;  3H94 A;  4MTN A;  3L2P A;  4DUY Q;  1IBK Q;  2F03 A;  4JVZ A;  4HN7 A;  1VQN A;  1K3B C;  5M5X B;  2O5I C;  3CF5 A;  1ML0 D;  2N78 A;  4FF2 A;  4X66 Q;  3HOV H;  2PMZ E;  1OXS C;  2Q2I A;  3H3V C;  1DON A;  3NSW A;  4X64 Q;  1IYV A;  1CUK A;  2ENB A;  3A0J A;  1HR0 L;  4KKS A;  1KD1 C;  4NXM L;  4G57 A;  3QOL A;  1GXD C;  5HGQ A;  3U58 A;  2EYM A;  3HKS A;  5M3F H;  4AYB E;  3V2T A;  2YTX A;  3HRZ C;  4EQ5 A;  1EIH A;  2XSC A;  3K80 C;  2R7Z B;  4JI2 Q;  4GKK L;  5G3L F;  3CQZ B;  3LX0 A;  3K5O A;  3CMA A;  1KL9 A;  5IYD H;  4DPG A;  3M3Y B;  4B9X A;  1PA6 A;  2JJQ A;  4AQY L;  4NMZ A;  1UNS A;  1X32 A;  2AUJ D;  1VQO A;  1CTM A;  3PIP A;  3CC7 A;  1I4R A;  3ER0 A;  3KBX A;  4LUZ A;  3GTG B;  3J7A V;  4HID A;  1E0B A;  1L1O A;  4A3B H;  1EU3 A;  3NEN A;  4RGO S;  1SYE A;  1HR0 W;  1SFO B;  3Q0A A;  2JYO A;  1AFP A;  4MTK A;  1I4Q A;  1CFM A;  4DV5 Q;  4BA1 I;  4HIK A;  4DR4 Q;  5KNB A;  1FNU A;  4XIG S;  1E22 A;  1JOR A;  1K28 A;  1V1P B;  2RA4 A;  4RGT A;  1YNJ C;  1I94 Q;  1SSO A;  5ELE A;  2YTV A;  3BVZ A;  5M5X H;  3HOX B;  2ICE C;  4GOP A;  4IUN A;  2ZXR A;  1EQR A;  5IGC A;  2E2I B;  2IL8 A;  1H9M A;  4YWL A;  4I7A A;  1XYI A;  4IFD H;  1S5D D;  2L55 A;  1WI5 A;  2CQA A;  3L9A X;  2WKC A;  3V96 A;  4KHP Q;  1WCM H;  2RSN A;  2JA5 G;  1CM9 A;  1HUM A;  1K8M A;  2EY2 A;  2PCF B;  1O7I A;  2WFW A;  2IJ0 A;  1B70 B;  2IX1 A;  4IFD J;  3QOJ A;  4DR1 Q;  1SNM A;  3SK4 A;  3I8Z A;  2E2H H;  1HZB A;  2R7Z H;  3GTQ H;  3PO3 B;  4QQB X;  3A5Z B;  4RH6 A;  4X3T A;  4DV2 Q;  3TS2 A;  3CQZ H;  1CK1 A;  2B2W C;  3MC0 B;  1B9N A;  5CV8 A;  5DAU A;  3CD6 A;  3KBG A;  2QKI C;  3HG9 A;  3M3Y H;  4U67 3;  1LTT D;  1VQ8 A;  4HJA A;  3S1Q H;  1NNX A;  2WAC A;  2R93 B;  3AMU A;  2L15 A;  3K7A B;  1EYA A;  1BCP F;  3NHH A;  2B63 G;  3UDG A;  3GTG H;  1ENA A;  2VZA A;  2A73 B;  1TY2 A;  1VQD A;  3LGJ A;  1X6O A;  2EY5 A;  2DJF C;  2VB2 X;  3MEF A;  4J15 A;  3EBE A;  3BJU A;  2WIN B;  1SNO A;  3M4P A;  3M7G A;  4QGU A;  3SK8 A;  2HT1 A;  3CRK C;  5ISR A;  2ZM6 Q;  1Q7Y C;  4DAY A;  5T1I A;  2Z0S A;  1NR4 A;  5EBC A;  1YI2 A;  2RDG A;  4BBR G;  2MO1 A;  4CKC A;  1XMQ L;  2F0T A;  1C9O A;  1SMY C;  1LAC A;  1X3Q A;  3GV6 A;  1IZ6 A;  3HOX H;  4HJ5 A;  4FF3 A;  1LTG D;  2EXZ A;  1LT5 D;  2M2L A;  3CKI B;  3SDZ A;  5C44 B;  4F8M A;  2VW9 A;  1BCP C;  5CR3 A;  2RHS B;  1ILP A;  2M9V A;  2F0U A;  2NVX B;  1K73 C;  1QB5 D;  1LAB A;  1YHQ A;  5G3L D;  3AU7 A;  3D6C A;  4DV0 Q;  3HOZ G;  4EQP A;  2UU9 Q;  1G6Z A;  4C3J G;  1XXG A;  4RCO A;  1WTP A;  1NJI C;  3KFU A;  2OTL A;  4DR2 Q;  1BR9 A;  4A3E G;  4NXN Q;  2B2T A;  2KHS A;  2Z1C A;  4QUC A;  3NEM A;  5IGG A;  3G6E A;  4DV6 Q;  1KRS A;  1G51 A;  4JI7 L;  1X55 A;  1QE6 A;  2ZT9 C;  4JI1 Q;  5EKL A;  3J81 i;  1PVO A;  4LF7 Q;  2KBN A;  4HTH A;  1LUZ A;  4CKB A;  3L3O C;  3M4O B;  3MXG A;  2R93 H;  4OO1 H;  3A74 A;  1QZG A;  3I56 A;  3NTK A;  4TVA B;  4DV4 Q;  3H3V H;  1JC7 A;  1LO5 D;  4FP5 D;  3QG1 A;  4RG1 A;  3KDF B;  2BCO A;  3ULJ A;  1B3A A;  2UUB Q;  2KHJ A;  4HAE A;  3RN2 A;  1BVS A;  3RN5 A;  3IAY A;  4FF1 A;  2UXC L;  4QIW E;  1L0X B;  4X3K A;  2K03 A;  5C44 H;  3A7A B;  2L12 A;  4RCN A;  3A8K E;  3G71 A;  3M85 A;  2NVX H;  2AWN A;  1WTR A;  3BZD B;  1YNX A;  2IHE A;  1O7Y A;  3PUV A;  2CVR A;  3PUZ A;  1CSP A;  3GP7 A;  3R3O A;  4ALP A;  3KF6 A;  3CPF A;  4WFN 3;  5M5W H;  1ZKO A;  1I4X A;  2NVT B;  1BCP D;  3DWA A;  1RKN A;  5ELO A;  1OO9 B;  1JB3 A;  1QCB D;  1PV4 A;  3CPW A;  1TWG B;  4JYA L;  1G2S A;  4H13 C;  3W2D A;  2K32 A;  3L0O A;  1ENF A;  2J4X A;  3SK5 A;  3DHQ A;  1F2Z A;  2GVA A;  3AEV A;  1KLG D;  2CW0 C;  3GTO B;  1U4M A;  1EY8 A;  2J7Z A;  3H15 A;  4K6L A;  2JA5 B;  4A3C G;  2UXB Q;  1VQJ A;  2HCC A;  4JI8 L;  1HNZ Q;  1HNW L;  4KV6 A;  1XNQ Q;  1JJC B;  4A3D G;  2AQ1 B;  4HR7 B;  3D8G A;  2JP1 A;  3G7L A;  5FK9 C;  4R8I A;  3R8B A;  1TWC B;  1K0S A;  3FPU B;  4O0A A;  3JC6 6;  4WRD A;  4CDC C;  3MAQ A;  4C3I G;  5IY0 A;  2F0O A;  1EY5 A;  1NSN S;  3I4N G;  2Q8T A;  2K5H A;  1FD7 D;  4C56 C;  2O4X A;  2QW7 A;  4LF8 Q;  2XRS D;  3OW7 A;  4JK1 C;  1WD0 A;  1MSH A;  2OT2 A;  3D3R A;  5K36 H;  1K8O A;  2A5H A;  2IW3 A;  1B50 A;  2VS1 A;  3HKZ G;  3UE0 A;  1HXY D;  2E2J B;  1S3O A;  4ME5 A;  2XVS A;  4IPD A;  4RKB A;  1U5K A;  3CCS A;  3QO2 A;  3I3C A;  4JBW A;  1NY4 A;  3VYS A;  1IBL Q;  5I2Y A;  1R9T B;  2I0Q A;  3M7N A;  2VXW A;  3NEL A;  2R7F A;  4XQQ A;  3P75 A;  2D62 A;  2G9D A;  1ICF B;  3HOV G;  3STB D;  2Z9H A;  1A3U A;  5C5L A;  5T1G A;  3TZU A;  1G91 A;  3TEH B;  1AZQ A;  3NTH A;  1G29 1;  3J81 j;  3HOZ B;  5DEH A;  3GTO H;  4LF9 L;  1SRO A;  3IL8 A;  4UP8 A;  3C1F A;  1NE3 A;  1MKH A;  5JVH 3;  1OXT A;  1CKN B;  1QJO A;  5JJK A;  5KGU A;  4N9P A;  5M3F G;  3P20 A;  3C3L A;  1J8I A;  1KDA A;  4K14 A;  1D2B A;  4TKO B;  1BBU A;  2CH4 A;  1AE3 A;  4YY3 L;  2MJ8 A;  2OTJ A;  1Q86 C;  4JC0 A;  2PO4 A;  2F3I A;  2KVM A;  1NCV A;  5IYD G;  1FL0 A;  4DN4 M;  4JV5 L;  5LHY 1;  2PQA B;  2N49 A;  4EX5 A;  5J39 A;  1WVL A;  2ZJP A;  1AE2 A;  4UP7 A;  1EWH A;  4YCV A;  1LTL A;  5KIX A;  2A19 A;  1XPU A;  4A3B G;  2A68 D;  1S40 A;  2HHH Q;  4Y7N B;  4DUZ L;  4ME3 A;  1K8G A;  3BYY B;  3SE0 A;  1BKB A;  1I3Q B;  4LFC L;  4YHH Q;  2YYZ A;  3T51 B;  2E2J H;  1STH A;  4IN3 A;  2EYF A;  3LWE A;  4YWK A;  2IT1 A;  2K7V A;  2WAQ B;  2Z6K C;  3AFQ A;  4A3J B;  4DR6 L;  1L1O B;  1R9T H;  2HD3 A;  1QUQ B;  5CBA E;  1X3G A;  5I6Y A;  1HTL D;  2NTS A;  3QWN A;  1GJX A;  2SEB D;  2WB1 B;  3BYT B;  1Y8O B;  4EVO A;  3ITP A;  1PH1 A;  4KKT A;  2KA7 A;  2ZTE A;  1Y69 U;  2K5W A;  2A6H D;  5C3E B;  3D0F A;  2O5J C;  4IFD G;  3CCM A;  1BBX C;  3KLS A;  2RQX A;  3A54 A;  3GD7 A;  1VQ6 A;  1UE5 A;  3OHX C;  2A69 D;  4KLK A;  1YNN D;  1EYG A;  4DV3 L;  4OX9 Q;  1WCM G;  3D4D A;  1PDQ A;  3X3M A;  2AQ2 B;  2JA7 H;  3S17 H;  1XNR L;  4R1J A;  5BR8 Q;  1DD2 A;  2RVL A;  2R7Z G;  3T56 B;  2J0T D;  3PUW A;  2QF7 A;  3HP3 A;  1WTV A;  1F77 A;  4IUR A;  5IOC A;  3OOC A;  2B2W A;  1EQV A;  3I4M B;  4B08 A;  4I7Z C;  1H9K A;  1RL2 A;  4DNT B;  3DUZ A;  1E2V A;  4IPC A;  4Y7N H;  3OMC A;  4K5X A;  1I3Q H;  1PFN A;  3KJO A;  2SDF A;  1TWF B;  2DUD A;  5D3D A;  4R4Q A;  1DOL A;  4L5R C;  2B2Y C;  3J81 c;  1VQ4 A;  2ZXO A;  3I4N B;  1TXY A;  2L4N A;  4A3J H;  4QUF A;  5CBE E;  4B3M Q;  2L0C A;  1RIP A;  1VQI A;  1B8A A;  4QF4 A;  1HQR D;  1YBY A;  3HOX G;  1L0Y B;  3I55 A;  3R2I A;  2D2C C;  1JIC A;  3DWQ A;  2NVQ B;  1G8Z D;  1H9J A;  1CKO A;  5BN3 A;  5C3E H;  3T1H L;  3DEP A;  1KRT A;  3O13 A;  4DV1 L;  2EXD A;  2HQE A;  2MFI A;  3FMC A;  1ZXT A;  3HKZ B;  1P8L A;  2K50 A;  2MO0 A;  4OWT B;  5CV4 A;  2NVY H;  2F0L A;  5CV7 A;  1TVX A;  3HKZ E;  4KN4 C;  1STA A;  1N9W A;  3I2Z A;  3ULL A;  3GTM B;  1VQL A;  4JI3 Q;  1VQ5 A;  4K0K L;  5C4X B;  4HMJ A;  4JW0 A;  4I65 A;  4N9T A;  1KLU D;  4JI7 Q;  1LLR D;  2ZTC A;  3IFD A;  3NBH B;  1EIY B;  5BN4 A;  2NZO A;  1SLJ A;  1A62 A;  3J7Z C;  1ESF A;  2BE5 D;  4KY5 A;  2QGQ A;  1MJC A;  5FLM H;  2R93 G;  4OO1 G;  2JA6 B;  2K5Q A;  4NKL A;  3NUC A;  4RAU C;  4XT3 B;  1KIX A;  1VCI A;  2NB0 A;  5I9P A;  1SDF A;  1I4H A;  3CHB D;  5M3F B;  3I4M H;  1GUO A;  2MQH A;  4ZUI A;  3N6R A;  2K04 A;  4IJH A;  5KND A;  5IYC H;  2XWB B;  4LFB Q;  4YIJ A;  5IWA L;  3NQT A;  1GUN A;  4GN5 A;  1S72 A;  4JI0 Q;  3KLW A;  4IFD I;  1IYU A;  1TWF H;  1WJJ A;  3E0J A;  2E74 C;  1N34 L;  4C3H H;  1P16 A;  2UUA L;  1I4P A;  1PZK D;  3J81 E;  2RF4 A;  2RDF A;  4U68 A;  5DLQ E;  4XYQ A;  3ZYY X;  2DY8 A;  5FKA C;  5BN5 A;  5FJ8 H;  1BXT A;  4GLX A;  2G9H D;  3BG3 A;  1A63 A;  4ABN A;  3MWY W;  5C44 G;  1JOQ A;  1PRT F;  2NVQ H;  3HOW B;  4PZ8 A;  1V43 A;  1LYL A;  1RHP A;  4LUO A;  3DMU A;  4LK1 C;  1VQM A;  2X6L A;  3FKI H;  4RFB A;  3H09 A;  2GVB A;  4UDU C;  1LV9 A;  1ZYR D;  1JT8 A;  2UXD L;  1SAP A;  1PYB A;  1MHW C;  1FGU A;  2JSO A;  1CKN A;  3GTM H;  2ZJQ A;  4ZUJ A;  5C4X H;  3HS0 C;  1QNK A;  4HJ7 A;  2YV5 A;  1HNX L;  1HFN A;  2ZTD A;  4M8A A;  3RR5 A;  1EYC A;  1SND A;  4F7X A;  1WD1 A;  2KED A;  3M4Q A;  3KF6 B;  2A1A A;  1JE5 A;  2JA6 H;  1EUJ A;  1WCM B;  3RNU A;  1D5X C;  1HQM C;  1J6Q A;  3T1Y Q;  1F9P A;  2PQA A;  2E2H B;  3I73 A;  1CZW A;  2B39 A;  2L11 A;  4HJ9 A;  3GTQ B;  4FO2 A;  3CU7 A;  1VQK A;  4K2L A;  4CJ0 B;  2CWP A;  1PH7 A;  3I4L A;  3VR3 A;  2K5D A;  1PXU A;  4OIJ A;  5EGT A;  3S1Q B;  4RA8 A;  4IOC A;  2BH8 A;  1DJR D;  2VL6 A;  1XMO Q;  3I4O A;  2AKW B;  2VQF Q;  4HCE A;  4X65 Q;  3HOW H;  4UHV A;  1QUQ A;  2F4I A;  1C0A A;  1H95 A;  5KRU A;  4KTA A;  3J80 E;  1ASZ A;  2YTY A;  4Q5V A;  2RCN A;  3K7U C;  4K2K A;  3MXN B;  2EYL A;  5K36 G;  1K8A C;  5F2D A;  2NWG A;  1AW7 A;  4KD4 A;  4OO1 I;  2NTT A;  2QEJ C;  3H3V I;  1N33 Q;  1PTO F;  1UE6 A;  4EQN A;  4JI5 Q;  4LUV A;  4R9W A;  2XWJ B;  1A8V A;  4DR3 Q;  1R4Q B;  5D3I B;  4X3U A;  1JCK B;  1KC8 C;  2Y0S G;  3S9W A;  2KHI A;  2FMM A;  1SE2 A;  2A8V A;  3FP9 A;  1J5E Q;  5GAH C;  5LMN L;  4GKJ L;  5HY6 A;  5GAD C;  1PZJ D;  4ID6 A;  4ZYS A;  1JR0 D;  2F0H A;  2CHB D;  1AP0 A;  2D0O A;  4JI4 L;  2F0F A;  4O1N A;  2K5V A;  1QVF A;  4LFA Q;  1XTC D;  4XQN A;  4QB4 A;  2JA8 B;  2VQE Q;  1PRT D;  3HOY H;  1EZ6 A;  1H9R A;  3K8A A;  1HA6 A;  2RSO A;  3VR4 A;  1E1T A;  1K83 H;  1QWY A;  3GDE A;  4QL5 A;  1KDB A;  1AH9 A;  5C5M A;  1ICW A;  1EY4 A;  2JA9 A;  1C4Q A;  5IGB A;  1ZEQ X;  3I91 A;  4B3T L;  1PYW D;  2LXJ A;  2ZXP A;  5C3X A;  1GHK A;  1N32 Q;  1B2T A;  5A35 A;  3BZK A;  2C9O A;  5KYL A;  5D65 A;  2Q8I B;  3NQI A;  5AJ3 Q;  5LL6 X;  3R93 A;  1EWI A;  1VDZ A;  4UY8 C;  2IY5 B;  5JVG 3;  1SN8 A;  2E76 C;  4B3R Q;  1GD7 A;  1S5F D;  1CKM A;  5LMU Q;  4IZ8 A;  4RHS A;  3WWV A;  4JI6 L;  1JOO A;  1Y8N B;  2F0J A;  4DR5 L;  2B2V C;  2LFN A;  1A2T A;  2V4D A;  1TU2 B;  3GTL B;  2UUC Q;  5IP7 H;  4WJ4 A;  2Z6K A;  4LF6 Q;  1HPC A;  5J3B A;  2E5L Q;  1HCZ A;  4A76 A;  3NBH A;  3PIP 3;  1KAA A;  4APV A;  5M5W B;  5A2Q E;  1N8R C;  4DGZ A;  2PW5 A;  1SNQ A;  2E2D C;  3OSO A;  2JA8 H;  2JA7 G;  5LL6 S;  5ELD A;  1DOM A;  3AYH B;  3MZ5 A;  1IBM L;  4BY1 H;  3S2H B;  1SYC A;  1UWV A;  4HIO A;  4V0B A;  1WYD A;  3Q8D A;  4YCW A;  4JBK A;  4CDE C;  1PH4 A;  4DR7 Q;  2WV6 D;  2EE1 A;  2PYK A;  1SNC A;  5GAG C;  3NK9 A;  4RKL A;  1GUS A;  4ZLT F;  1PTO D;  1FJG L;  1M4V A;  4FXD A;  4LF4 L;  1SYD A;  2JXM B;  1PLF A;  4LF5 L;  2F4V L;  4ZAI A;  3I72 A;  4QJF A;  2Q8R E;  1CT1 D;  2K75 A;  1EU4 A;  1CSQ A;  3WOF A;  2KEN A;  3BVM A;  2DGY A;  4B3S Q;  1FGB D;  2WKD A;  2WAQ G;  1CI3 M;  4OWW B;  4PMW A;  4RWS C;  3UDX A;  1EFI D;  4A3J G;  2MNA A;  1CQV A;  2NZH A;  3P7J A;  1RF2 D;  1KXL A;  2K14 A;  2KOL A;  4X62 Q;  4BA2 I;  2WB1 G;  2VB3 X;  3B6Y A;  5HGT A;  3GTL H;  4NDX A;  1W6J A;  4IUT A;  1EOT A;  2EOT A;  2B2Y A;  3K58 A;  2AMC B;  5C3E G;  1GKH A;  4H02 A;  1TQO A;  1IHZ A;  2I5L X;  1OXU A;  3PO2 H;  3OTO L;  3F2C A;  3STB C;  5CV6 A;  5J22 A;  1SE3 A;  1X65 A;  3N52 A;  4IO9 A;  5IT9 E;  1TWH B;  1MBY A;  4XTC S;  3J81 L;  4DV7 L;  1F9R A;  5IIF A;  3H0G B;  1ROD A;  1STB A;  1EL0 A;  3S2H H;  1O7L A;  1GUG A;  3K0Y A;  4RGN A;  4MN3 A;  2Y0S B;  4DFA A;  1N36 L;  1Y1W B;  4WJW A;  2K05 A;  4DUY L;  1IBK L;  1Q90 A;  2HIV A;  3K0X A;  4L6T B;  4DF7 A;  4GZY C;  1PH3 A;  5EPK A;  3SGI A;  2G5D A;  1BCP B;  2Y0S E;  1VQF A;  5ELC A;  1EEI D;  3J80 i;  1PMR A;  3KK7 A;  1SYB A;  5C0X H;  5FLM G;  4X66 L;  3VR5 A;  2BOS A;  1KNA A;  1VQP A;  2M00 A;  1BQQ T;  2A6E D;  3PF4 A;  3I4M G;  1E3P A;  2A74 C;  3RZD B;  2B8G A;  1S5E D;  5I4D A;  4X64 L;  3UDF A;  5IYC G;  4C2M B;  1UE7 A;  5C0X J;  2H4O A;  1HA5 A;  3PV0 A;  1VQC A;  1T9H A;  1SNP A;  1YJ9 A;  1RJT A;  2A68 C;  3DWP A;  4KKU A;  4GN3 B;  1JWU D;  4WOR A;  3TP7 A;  3MXN A;  3A56 A;  5JOB A;  4CDD C;  1YIJ A;  4C3H G;  5M5Y B;  4JI2 L;  4OHJ A;  1PH9 A;  1KHI A;  1JJ2 A;  1WFQ A;  5FJ8 G;  2HDM A;  2F0N A;  2PW7 A;  2EQS A;  5JJL A;  4DNI A;  4FVM A;  3FKI G;  1QIL A;  3ND9 A;  1DYQ A;  4HED A;  4JPB W;  4ZKC B;  2A6H C;  4PZ6 A;  1D1I A;  1TWH H;  4H44 C;  1AZP A;  1DM0 B;  1F9Q A;  3Q6S A;  3URY A;  3H0G H;  2DJG C;  2EPB A;  4PNY A;  2VY3 A;  2A69 C;  1JOK A;  1YNN C;  1TII D;  3MFY A;  3KLS X;  2QDB A;  4HIM A;  1Y1W H;  5C4X G;  2K01 A;  4DV5 L;  4GOP C;  4DR4 L;  1QNU A;  4L5Q A;  1Q3L A;  5E4X A;  4CJ2 C;  1CHQ D;  1SRU A;  2FXQ A;  2AQ3 B;  1I94 L;  3RD4 A;  3NWT A;  2LY7 A;  3CCJ A;  2Z8L A;  1QVG A;  2PNH A;  2JA6 G;  3W1G A;  3SR1 A;  3PUX A;  5JJZ A;  1HR0 Q;  4LNQ A;  4NXM Q;  3S17 B;  2JA7 B;  2H1E A;  2EYH A;  2EZV A;  3HFZ B;  3RZD H;  4DXG A;  5FO7 B;  2EY1 A;  3RZO H;  4C2M H;  2Q2T A;  4LJZ C;  2QA4 A;  4K5W A;  4KHP L;  2AUK A;  4GKK Q;  4FYD A;  2OWO A;  2I5M X;  1BF4 A;  4DR1 L;  1I6H B;  2BDO A;  4L8J A;  2L5T A;  3CXC A;  1IXR A;  5M5Y H;  3GTK B;  1DCZ A;  4F88 A;  4DV2 L;  3PIO A;  4AQY Q;  1S5C D;  3KLR A;  1SMX A;  3Q22 A;  4WJ3 M;  3EN2 A;  4LMQ D;  4YWM A;  3HOW G;  4XDX A;  2YU9 H;  2F0P A;  3NE5 B;  4IUP A;  4IOA A;  2IX0 A;  1V9P A;  1E2Z A;  5I9O A;  4BBS H;  4BXX H;  1EQQ A;  3PUY A;  2NZ1 D;  3I7F A;  2P5Z X;  2EDG A;  2K6A A;  2WAQ E;  3DEO A;  2CWA A;  3UDI A;  5JPN C;  3F2B A;  2OQK A;  4PMC A;  1OXX K;  2ZM6 L;  3JAM i;  3K81 C;  1JWS D;  1VF5 C;  2WB1 E;  3BVG A;  4NW2 A;  3RLO A;  1V8Q A;  2NVY B;  2F52 A;  3S24 A;  4DAV A;  1D8L A;  2JE6 I;  1EYD A;  3D4W A;  1II3 A;  1K9M C;  4ZK9 B;  3HGB A;  2EYO A;  2BE5 C;  4O42 A;  2HDL A;  2KEC A;  3PF5 A;  4DV0 L;  1A15 A;  4R8N A;  2UU9 L;  3EA6 A;  2B2T C;  1GM5 A;  3S16 B;  3K57 A;  1QZH A;  2I5H A;  4K8J A;  4DR2 L;  4E6I A;  1JMC A;  3GO5 A;  1DGS A;  5D14 A;  2RHQ B;  1I6H H;  1I5F A;  5C3W A;  4AIM A;  4NXN L;  1Q8K A;  1YJW A;  2R61 A;  3G6J B;  3C46 A;  2DN8 A;  3GTK H;  4DV6 L;  2AHO B;  3OIP A;  1TS3 A;  4HSP A;  1U4L A;  3HZX A;  5EAY A;  4JI1 L;  5CC4 A;  2WII B;  2FIN B;  4LF7 L;  1AEX A;  1D1K A;  4PMB A;  3ICE A;  3UE1 A;  2F0I A;  2X6G A;  3MFG A;  4DA2 A;  2QCP X;  4P71 A;  4DV4 L;  1IYJ B;  4GS3 A;  4A3G B;  1SYF A;  4OWX B;  2F0G A;  2XNA C;  2HUG A;  2HCI A;  1XPO A;  1Q81 C;  4C3H B;  1IL2 A;  3C1E A;  3IFT A;  1T5X D;  2UUB L;  1F2Y A;  3CCL A;  1ONL A;  1ZYR C;  4BY7 B;  1S4Z A;  1XMQ Q;  4P73 A;  5DM6 3;  1LT3 D;  3VYT A;  2BA1 A;  1C48 A;  3MXU A;  4RMF A;  5ELB A;  3T13 A;  2KQ3 A;  3M4Y A;  3NTI A;  1LTS D;  2EIF A;  5IP7 G;  3QIA A;  3FKI B;  1UEA B;  1EY7 A;  2LMC B;  2B3G A;  2VUM H;  3FVQ A;  2B29 A;  4B9W A;  2XIW A;  4H0L C;  2JA8 G;  1MJE A;  3IRB A;  3S16 H;  4BY1 G;  2SNS A;  1HUN A;  1PHJ A;  3H6M A;  4OGQ C;  2F0D A;  3BDC A;  3T16 A;  3TP6 A;  5M3M B;  1EFW A;  3A5U A;  2K33 A;  2R92 H;  2N88 A;  4Z9C B;  3TRE A;  2F0Q A;  1JWM D;  2JK8 A;  2JN4 A;  1WOC A;  4IUV A;  1T5E A;  5CYU A;  1VQG A;  1D5Z C;  1MI2 A;  1KAB A;  1C7Y A;  1MD2 D;  2UXB L;  5JPM C;  2R3Z A;  1HH2 P;  1HNZ L;  4A3G H;  3RLF A;  1W6K A;  1HZC A;  1PYS B;  5ELN A;  3F1Z A;  3CCV A;  1A6X A;  1HHV A;  3VDY A;  4IAL A;  1XNQ L;  3SHL A;  2DNE A;  4A3F H;  3KJP A;  4BY7 H;  4XQJ A;  2UXC Q;  3J80 c;  1CA6 A;  1K3R A;  2XRQ D;  2XTI A;  1A0I A;  1VQA A;  3K5N A;  2ID0 A;  1GOZ A;  5FOB B;  4G7H C;  3OWE B;  1TWA B;  1HZ9 A;  2IWH A;  3PO2 G;  2BH2 A;  2C35 B;  1U0L A;  1UE1 A;  1EIF A;  5JJI A;  4LF8 L;  5C4J H;  3S1R B;  4GNX C;  1I50 B;  1RD9 D;  2F1M A;  3DLL A; 
#chains in the Genus database with same CATH homology
 3S14 H;  1SN8 A;  4A3E H;  4GOP B;  4B3R Q;  1GD7 A;  4O0A A;  1PH5 A;  4JYA Q;  1CKM A;  5LMU Q;  5IYB H;  3WWV A;  4A75 A;  3JC6 6;  4FDB A;  5M3M H;  5GQO A;  1M90 C;  4JI6 L;  2OCE A;  4DR5 L;  1L2F A;  2CCZ A;  5IY0 A;  1IBL L;  4JOI A;  1HJP A;  4A3I G;  3I4N G;  4DR7 L;  2UUC Q;  3KDF A;  2K5H A;  5IP7 H;  4B3T Q;  4WJ4 A;  1SE8 A;  2Z6K A;  1L0W A;  1PH8 A;  5C0X G;  1JJG A;  4A3D G;  4LF6 Q;  1Q82 C;  2LSS A;  5J3B A;  3TQY A;  2E5L Q;  4JI8 Q;  4A76 A;  4LF8 Q;  4IPH A;  1ASY A;  5GRO A;  1HNW Q;  4IPG A;  4APV A;  2K5N A;  4KHZ A;  5GAE C;  2E8G A;  1N8R C;  3ULP A;  4NB3 A;  4UY8 C;  2VS1 A;  1YIT A;  3HKZ G;  3UE0 A;  2JA8 H;  4DK6 C;  1S3O A;  2JA7 G;  1YHA A;  2JQO A;  2ES2 A;  3AYH B;  4IPD A;  2JEB I;  1IBM L;  4BY1 H;  3CCR A;  1U5K A;  3CCS A;  1UWV A;  4HIO A;  2XGT A;  4JI6 Q;  4UP9 A;  2QEX A;  4YCU A;  4DR5 Q;  4B3S L;  4JBW A;  1NMF A;  1WYD A;  1NY4 A;  1IBL Q;  2ZJR A;  3Q8D A;  2I0Q A;  3M7N A;  4YCW A;  4P75 A;  4JBK A;  2N8N A;  3NEL A;  1PH4 A;  4DR7 Q;  2R7F A;  3S1N H;  5JEA G;  3U4V A;  2D62 A;  3GTJ H;  2CQO A;  5GAG C;  3STB D;  3HOV G;  4X62 L;  3TEH B;  2AWO A;  3J81 j;  1G29 1;  1TWA H;  3GTO H;  2GN5 A;  4DAM A;  4LF9 L;  1SRO A;  2NN6 I;  1FJG L;  4UP8 A;  1NE3 A;  1KAW A;  4LF4 L;  3E0E A;  4P72 A;  1MKH A;  3AQQ A;  1OXT A;  1CKN B;  3RLN A;  4LF5 L;  2F4V L;  1FVI A;  5JJK A;  4DAY B;  1VQ7 A;  1NTG A;  4QJF A;  1EOV A;  1X54 A;  4A3L H;  1VS0 A;  1IBM Q;  4JBM A;  2HHH L;  1JB7 A;  5M3F G;  2K75 A;  3S1R H;  3H0G G;  1CSQ A;  3CP0 A;  2KEN A;  2NN6 G;  1I50 H;  3CCQ A;  2DGY A;  2LXK A;  4B3S Q;  4POG A;  4YHH L;  1BBU A;  2WAQ G;  4OWW B;  1AE3 A;  1Y1W G;  4YY3 L;  4TQU S;  1YEZ A;  4PMW A;  3UDX A;  4A3J G;  2OTJ A;  1Y1V G;  2MNA A;  1Q86 C;  2NZH A;  4JC0 A;  3HOU H;  3PSI A;  5IP9 H;  1KXL A;  2F3I A;  2K14 A;  4X62 Q;  4BA2 I;  2WB1 G;  3B6Y A;  5IYD G;  3PO3 G;  3GTL H;  1FL0 A;  4JV5 L;  4LF9 Q;  2PQA B;  1Q1E A;  2N49 A;  1FJG Q;  1X9N A;  4EX5 A;  2ZJP A;  4LF4 Q;  1AE2 A;  2AMC B;  4UP7 A;  4POF A;  5C3E G;  1GKH A;  4H02 A;  4YCV A;  4LF5 Q;  1LTL A;  4GLA C;  2I5L X;  2F4V Q;  1OXU A;  2ASB A;  3PO2 H;  3OTO L;  3F2C A;  2A19 A;  3STB C;  1XPU A;  4A93 G;  4A3C H;  1X65 A;  4A3B G;  1S40 A;  2HHH Q;  4IO9 A;  1PFS A;  4A3M G;  4DUZ L;  4ME3 A;  4XTC S;  1K8G A;  4DV7 L;  1BKB A;  4GLV B;  4LFC L;  3E9I A;  4YHH Q;  2YYZ A;  4L5T A;  4A3D H;  4JOI C;  2E2J H;  4OX9 L;  3S1M H;  4GNX B;  2PI2 E;  4YWK A;  4AH6 A;  4YY3 Q;  1OTC A;  2IT1 A;  3JAM c;  3S2H H;  2Z6K C;  1YJN A;  1Q46 A;  3CAM A;  1N36 L;  1OXV A;  3AFQ A;  5BR8 L;  4DR6 L;  1L1O B;  1R9T H;  1QUQ B;  4DUY L;  1X3G A;  3U4Z A;  1IBK L;  4Y52 H;  4JV5 Q;  4QY7 A;  5LMN W;  2HIV A;  3K0X A;  4C3I H;  1VQH A;  4JBJ A;  1PH3 A;  4A3I H;  3SGI A;  3I4N H;  2Y0S E;  4A3K G;  1VQF A;  1PH1 A;  3J80 i;  2ZTE A;  4DKA C;  5FLM G;  4X66 L;  3OTO Q;  3W1B A;  3D0F A;  1VQB A;  4IFD G;  1VQP A;  3CCM A;  3GD7 A;  1VQ6 A;  3PF4 A;  4R4C A;  3I4M G;  1E3P A;  1UE5 A;  4DUZ Q;  1LM0 A;  4KLK A;  1G6P A;  4DV7 Q;  1BBW A;  4LFC Q;  2KCM A;  1EYG A;  3CME A;  3E9H A;  4X64 L;  4DV3 L;  4OX9 Q;  1WCM G;  2HQL A;  3UDF A;  5IYC G;  1UE7 A;  5C0X J;  3PV0 A;  5C0X I;  4BBS G;  1VQC A;  2JA7 H;  3S17 H;  1T9H A;  3G4S A;  1N36 Q;  4BXX G;  1XNR L;  4R1J A;  1YJ9 A;  5BR8 Q;  4DR6 Q;  4GN3 B;  4MTN A;  3L2P A;  4DUY Q;  1SFO H;  2R7Z G;  1IBK Q;  4PG3 A;  2HIX A;  3PUW A;  1YIJ A;  1Q1B A;  4JI2 L;  1PH9 A;  1KHI A;  1JJ2 A;  3OYY A;  1VQN A;  3CF5 A;  2R6G A;  1WFQ A;  1Z47 A;  2N78 A;  5FJ8 G;  4B3M L;  4X66 Q;  3HOV H;  1XPR A;  5IT9 c;  2PMZ E;  1JT8 A;  3M9B A;  1YHB A;  4O2D A;  2EQS A;  5JJL A;  1Y14 B;  4DNI A;  1OXS C;  1W3S A;  2Q2I A;  1B7Y B;  5JEA J;  3FKI G;  2E2I H;  4DV3 Q;  3AFP A;  4X64 Q;  1RL2 A;  1CUK A;  3KYH C;  4Y7N H;  4IPC A;  3A0J A;  4PZ6 A;  1HR0 L;  1KD1 C;  4NXM L;  1TWH H;  5HGQ A;  1XNR Q;  3U58 A;  2H5X A;  2K4K A;  1I3Q H;  3HKS A;  3KJO A;  5M3F H;  3H0G H;  3TS0 A;  3DM3 A;  2VY3 A;  4AYB E;  2YTX A;  1HZA A;  2DUD A;  4JCV E;  4R4Q A;  4EQ5 A;  4L5R C;  3K80 C;  3J81 c;  1VQ4 A;  4JI2 Q;  4GKK L;  4HIM A;  1Y1W H;  5C4X G;  1TXY A;  1UEB A;  3FHW A;  4UPA A;  1MIU A;  4DV5 L;  4GOP C;  1Y1V H;  4A3J H;  4DR4 L;  4JI3 L;  4L5Q A;  4B3M Q;  1K0R A;  1RIP A;  1VQI A;  2PI2 A;  1B8A A;  4DK3 C;  1YBY A;  3CMA A;  1NBW A;  4A4I A;  1KL9 A;  1SRU A;  2FXQ A;  3I55 A;  4DPG A;  3HOX G;  3PO3 H;  1PA6 A;  1I94 L;  1E24 A;  5IYD H;  2JJQ A;  4R4O A;  3S15 H;  3EIV A;  4AQY L;  1CKO A;  1VQO A;  2IHF A;  3CCJ A;  1QVG A;  5C3E H;  2PNH A;  4OXP A;  3T1H L;  2JA6 G;  3W1G A;  3PIP A;  1KRT A;  3CC7 A;  4NPS A;  2EXD A;  3ER0 A;  1XTD A;  4DV1 L;  4LUZ A;  3PUX A;  2MFI A;  4A93 H;  1P8L A;  2K50 A;  2MO0 A;  4OWT B;  3KOJ A;  4HID A;  1HR0 Q;  4LNQ A;  1L1O A;  3CW2 C;  3HFZ B;  4NXM Q;  4A3B H;  3RZD H;  3K7A H;  3NEN A;  2NVY H;  4A3M H;  3RZO H;  1HR0 W;  3PGZ A;  4C2M H;  3OW2 A;  2Q2T A;  2N3S A;  2QA4 A;  3HKZ E;  4KHP L;  4GKK Q;  1N9W A;  3I2Z A;  4LFB L;  2OWO A;  3ULL A;  4DV5 Q;  4BA1 I;  2I5M X;  4HIK A;  1VQL A;  4JI3 Q;  1VQ5 A;  4JI0 L;  4XIG S;  4DR1 L;  4DR4 Q;  4K0K L;  3L7Z C;  1E22 A;  3BZC A;  3CXC A;  1IXR A;  1YZ6 A;  5M5Y H;  5FLX c;  1I94 Q;  4JI7 Q;  2ZTC A;  1VQE A;  2YTV A;  5M5X H;  3NBH B;  3PCO B;  3PIO A;  4DV2 L;  4GOP A;  2NZO A;  4AQY Q;  1EIY B;  1SMX A;  1EQR A;  4A3K H;  1SLJ A;  3T1H Q;  3F8T A;  1A62 A;  3J7Z C;  1VQ9 A;  3EN2 A;  4WJ3 M;  2QGQ A;  4YWM A;  4DV1 Q;  1MJC A;  5FLM H;  2R93 G;  4R4T A;  4YWL A;  3HOW G;  4OO1 G;  1KIX A;  2YU9 H;  1VCI A;  1Z9F A;  2VUM G;  1WI5 A;  2CFM A;  3I4M H;  4IOA A;  1PH2 A;  2IX0 A;  2MQH A;  4IJH A;  2BA0 A;  4KHP Q;  3G48 A;  1V9P A;  1WCM H;  5IYC H;  2JA5 G;  4LFB Q;  2WFW A;  4BBS H;  3KF8 B;  1O7I A;  1B70 B;  5IWA L;  2IX1 A;  4IFD J;  4JI0 Q;  4GN5 A;  4DR1 Q;  1S72 A;  3KLW A;  4BXX H;  4IFD I;  4K0K Q;  1EQQ A;  2E2H H;  1TWF H;  1E7Z A;  3PUY A;  1WJJ A;  1HZB A;  3I7F A;  2R7Z H;  3GTQ H;  4IJL A;  4QQB X;  2WAQ E;  3UDI A;  5H1S E;  2CWA A;  3A5Z B;  3F2B A;  3BU2 A;  2OQK A;  4DV2 Q;  3J7A 5;  1OXX K;  2R92 G;  1N34 L;  3TS2 A;  2D0P A;  1P16 A;  3CQZ H;  4C3H H;  3JAM i;  2ZM6 L;  2UUA L;  2RF4 A;  4GN4 B;  5DLQ E;  3K81 C;  3CD6 A;  2R7D A;  5FJ8 H;  4GLX A;  3CC4 A;  2WB1 E;  3M3Y H;  3U50 C;  1VQ8 A;  3RLO A;  4HJA A;  1A63 A;  5C44 G;  3S1Q H;  2NVQ H;  4PZ8 A;  1V43 A;  2L15 A;  1LYL A;  2F52 A;  3S24 A;  4LUO A;  3W5O A;  2B63 G;  1D8L A;  2JE6 I;  3UDG A;  1VQM A;  1K9M C;  3FKI H;  3GTG H;  2VZA A;  1X3E A;  2GVB A;  3M4O H;  3CCE A;  3PF5 A;  5IWA Q;  1VQD A;  3LGJ A;  4DV0 L;  1X6O A;  4J15 A;  3MEF A;  2OQ0 A;  3EBE A;  3BJU A;  3T1Y L;  2UU9 L;  5IE8 A;  1GM5 A;  1PYB A;  4A3G G;  2UXD L;  1FGU A;  3M4P A;  1QZH A;  2I5H A;  4QGU A;  4DR2 L;  1JMC A;  3GO5 A;  1V1Q A;  1DGS A;  2HT1 A;  2RHQ B;  1CKN A;  4A3F G;  3GTM H;  1N34 Q;  2UUA Q;  2ZM6 Q;  2ZJQ A;  1Q7Y C;  1I5F A;  5C4X H;  4BY7 G;  1I6H H;  4AIM A;  4NXN L;  1Q8K A;  2Z0S A;  1YJW A;  1D7Q A;  1YI2 A;  3GTK H;  4HJ7 A;  2YV5 A;  3ZJY C;  2MO1 A;  2AHO B;  2ZTD A;  3RR5 A;  1C9O A;  4BBR G;  4DV6 L;  1XMQ L;  1HNX L;  1L1O C;  1IZ6 A;  3HOX H;  4HJ5 A;  2Q2U A;  3S2D H;  3M4Q A;  3KF6 B;  5EAY A;  4JI1 L;  2A1A A;  1XMO L;  4LF7 L;  1JE5 A;  4OON A;  2VW9 A;  2RHS B;  3ICE A;  2VQF L;  2JA6 H;  3UE1 A;  4X65 L;  1EUJ A;  1K73 C;  3RNU A;  1YHQ A;  4DV0 Q;  1J6Q A;  3T1Y Q;  2UU9 Q;  3HOZ G;  2UXD Q;  2PQA A;  4P71 A;  4DV4 L;  3F2D A;  1NJI C;  3KFU A;  1IYJ B;  4DR2 Q;  4GS3 A;  4HJ9 A;  4R4I A;  2OTL A;  4OWX B;  4P74 A;  1XPO A;  1Q81 C;  1GO3 E;  4LW1 A;  1M1K C;  4A3E G;  1IL2 A;  1VQK A;  4NXN Q;  1PH7 A;  2CWP A;  2UUB L;  3CCL A;  5IYB G;  3NEM A;  3G6E A;  5M3M G;  4P73 A;  4DV6 Q;  1XMQ Q;  1HNX Q;  1KRS A;  1G51 A;  4JI7 L;  1X55 A;  1N33 L;  1PH6 A;  2NVT H;  2BA1 A;  4JI5 L;  4IOC A;  2BH8 A;  4JI1 Q;  4RMF A;  2VL6 A;  3J81 i;  4GNX A;  1PVO A;  1XMO Q;  4LF7 Q;  3I4O A;  4DR3 L;  2EIF A;  2AKW B;  1QVC A;  2KBN A;  5IP7 G;  2VQF Q;  2JEA I;  1GVP A;  1LUZ A;  3GTP H;  4X65 Q;  1TWG H;  4MZ9 A;  2R93 H;  1J5E L;  3HOW H;  1C0A A;  1QUQ A;  3TRZ A;  2V1C C;  1H95 A;  3A74 A;  3ERS X;  1QZG A;  1ASZ A;  2YTY A;  3I56 A;  2B3G A;  4TVA B;  4DV4 Q;  2VUM H;  3H3V H;  2WP8 J;  2RCN A;  3K7U C;  2B29 A;  2CKZ B;  3MXN B;  1SR3 A;  2ALY B;  4RG1 A;  1K8A C;  5K36 G;  3KDF B;  2JA5 H;  3ULJ A;  2JA8 G;  4LWC A;  1MJE A;  3IRB A;  3S16 H;  4LFA L;  4JG2 A;  1Q12 A;  2UUB Q;  4OO1 I;  2KHJ A;  4BY1 G;  2VNU D;  1PHJ A;  2VQE L;  2Q2H A;  3RN2 A;  3H3V I;  1N33 Q;  1UE6 A;  1BVS A;  4JI5 Q;  4LUV A;  1EFW A;  3RN5 A;  3A5U A;  2R92 H;  1A8V A;  5E7N A;  3TRE A;  4DR3 Q;  1TWC H;  2K52 A;  1KC8 C;  2UXC L;  2JK8 A;  2Y0S G;  2KHI A;  1WOC A;  2A8V A;  3FP9 A;  4QIW E;  1J5E Q;  5GAH C;  1KQS A;  5LMN L;  4GKJ L;  5HY6 A;  3CC2 A;  5C44 H;  5GAD C;  3G71 A;  1W2B A;  1X3F A;  2KCT A;  3M85 A;  2NVX H;  1VQG A;  1YVC A;  2AWN A;  2B63 H;  1C7Y A;  2D0O A;  4JI4 L;  1YNX A;  1N32 L;  2IHE A;  2K5V A;  1QVF A;  4LFA Q;  2UXB L;  3PUV A;  4A3L G;  3PUZ A;  1CSP A;  3CCU A;  1HH2 P;  1HNZ L;  2VQE Q;  4A3G H;  4ALP A;  3RLF A;  1HZC A;  3CPF A;  1PYS B;  3KF6 A;  3K8A A;  5ELN A;  3F1Z A;  5M5W H;  5AJ3 L;  3CCV A;  3HOY H;  3VDY A;  1XNQ L;  4L5S A;  4A3F H;  5ELO A;  1E1T A;  3KJP A;  1K83 H;  3GDE A;  1XJV A;  2ATW A;  4BY7 H;  4B3R L;  1PV4 A;  4QL5 A;  3CPW A;  2UXC Q;  3J80 c;  1AH9 A;  4MNO A;  4JYA L;  5LMU L;  1K3R A;  2XTI A;  5IP9 G;  3HOU G;  4BBR H;  2JA9 A;  5LMN Q;  4GKJ Q;  1NMG A;  4PZ7 A;  1A0I A;  1VQA A;  1E1O A;  2ID0 A;  3L0O A;  2GVA A;  3AEV A;  3D31 A;  1HZ9 A;  2UUC L;  4B3T L;  4JI4 Q;  3H15 A;  2LXJ A;  4LF6 L;  3PO2 G;  2BH2 A;  1N32 Q;  4KI0 A;  4HJ8 A;  2C35 B;  1U0L A;  3BZK A;  1UE1 A;  1VQJ A;  1EIF A;  4A3C G;  2UXB Q;  3HOZ H;  2E5L L;  3HOY G;  1X56 A;  4JI8 L;  4C3J H;  1HNZ Q;  5JJI A;  4LF8 L;  1HNW L;  5AJ3 Q;  5C4J H;  1EWI A;  1XNQ Q;  4AYB G;  1JJC B;  4GNX C;  2IY5 B;  4X6A H;  3DLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...