4DV3L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv3L00
2PI2A 2MO1A 5M3FH 1HNXL 4WJ4A 2A19A 2JQOA 1S40A 3F2DA 2Q2UA 1XPOA 3K7AH 1XJVA 2IX1A 3BJUA 4JBJA 5JJKA 4POFA 3HOYH 4GLVB 4JI2Q 1ASYA 4X65L 2N78A 2YV5A 1JJCB 2A8VA 3KDFB 5IYCG 1G6PA 1A63A 4KI0A 1N36L 2VZAA 4J15A 4NXML 4DK3C 3FP9A 2VQFQ 5C3EH 1VQOA 1IBKL 3OTOL 4JI8Q 2FXQA 1A8VA 1Q1EA 4K0KQ 1XMOQ 3PUZA 1IBMQ 4AQYQ 4A3LG 2ASBA 1YEZA 4DV0L 2IX0A 2HHHL 1JB7A 1Y14B 3HKSA 3BZKA 2PMZE 1BBUA 1YJ9A 1XNRQ 3AYHB 4IJHA 4JI5Q 3S14H 1I50H 2MQHA 3VDYA 3PIOA 2VQEL 4TVAB 5C44H 5LMNQ 3KJPA 4LF4L 4KLKA 3RLNA 2JJQA 3H0GH 4BA2I 2GVBA 1YZ6A 4IPGA 2JA9A 4JOIC 1WFQA 3B6YA 1YJNA 1KRTA 3DM3A 2F52A 3HOZH 5K36G 1OXTA 4O2DA 1VQCA 2VQFL 1IL2A 4X6AH 1D8LA 1GVPA 1SR3A 3L7ZC 4JI8L 4JI7Q 3I7FA 3GTMH 2KBNA 2CQOA 5IY0A 4A75A 1SMXA 1N34Q 1IBLQ 4NXNQ 2NZOA 1IBML 4O0AA 4HIMA 1EWIA 4X64L 1WI5A 4P74A 3KDFA 2GN5A 4HIKA 4JV5Q 3MXNB 1XMQL 2JA5H 1J5EQ 4P71A 1XNRL 4ME3A 4JI1L 4IOAA 1MJEA 2B29A 2WB1G 5LMNL 4A3CH 4B3RQ 3FHWA 3PCOB 4P73A 2R6GA 3KJOA 1AE3A 1HNZQ 3T1YQ 2HQLA 1N32Q 3H0GG 4OX9Q 4YWKA 3UDGA 5BR8Q 1C7YA 2LSSA 1KQSA 1JE5A 4UP9A 1KL9A 5E7NA 2VY3A 1PYBA 4JYAQ 2UXBQ 3L2PA 3J81i 4BXXH 4YHHL 1VQFA 3JAMi 4DAYB 4HIDA 4A3IH 1N34L 1EYGA 1HNWQ 3TEHB 2LXJA 4P75A 1X55A 3CW2C 5GAEC 4DR7Q 1E22A 3E0EA 2E2HH 2C35B 4GKKL 4DR3Q 2I5MX 2UUAQ 4JI3Q 5HGQA 2KCTA 4JV5L 2N8NA 1TWAH 4LFCQ 4RG1A 1HZAA 2JA5G 4OXPA 4DUZQ 1IXRA 1UE6A 4NPSA 3D31A 1PV4A 1VQ9A 1X56A 4B3RL 1E24A 1YI2A 1HNZL 4GN4B 1S3OA 1V43A 3PUWA 3PO2H 4A3CG 2ID0A 4DPGA 4R4TA 2E5LL 1N32L 4OX9L 5IYBH 4OWWB 4FDBA 5IWAQ 3CCMA 1RL2A 4YCVA 4LF7L 1C0AA 2R7DA 1XPRA 4DV4L 1IZ6A 1WCMG 2RCNA 5ELOA 5FJ8H 4JYAL 1HR0Q 4DR1L 3M85A 3LGJA 3A0JA 1SE8A 4LFBQ 1HNWL 3KYHC 4LF6Q 4B3SL 3TREA 4A3IG 2NVXH 1VQLA 3CCLA 1FJGQ 3CC4A 1B8AA 4DR3L 2UUAL 4P72A 1K73C 5M3MG 4LFCL 3STBD 1HNXQ 5JEAJ 5C0XG 4DR6L 1MIUA 4DUZL 2QEXA 3M4QA 3MEFA 2CWAA 3CXCA 4A3EH 2ZM6Q 3PF5A 3F2CA 2OCEA 4LUVA 1TWHH 2AHOB 2PQAB 1JJGA 5IWAL 2NN6G 1G291 1C9OA 1SFOH 5IYBG 1N36Q 5M5WH 2B3GA 2L15A 4PG3A 3ULJA 1NMFA 1IBKQ 3OTOQ 2YTYA 5FJ8G 4DR2L 2OQKA 3I4OA 2KENA 3I55A 3RLOA 2JEAI 3IRBA 2R93H 1Q86C 4WJ3M 3I4MG 4DV0Q 5C0XI 2HHHQ 3K0XA 3W1BA 5IYDH 1HJPA 4QIWE 3CCEA 5C4XG 1V9PA 3F2BA 4OWXB 2VQEQ 2WAQG 4LF4Q 1P8LA 2WAQE 1LUZA 3HOXH 2ZM6L 3S2DH 3GTGH 2NN6I 5IP9G 4QGUA 3TRZA 4A3MG 3PIPA 4LUZA 1VQMA 1NY4A 3NBHB 1X3GA 3A5UA 4A3FH 1VQNA 2WFWA 1TWFH 1K8GA 1E3PA 1OXXK 2MNAA 3DLLA 3KF8B 3A74A 4GN5A 4YY3L 1Y1WG 1VQEA 4JI0Q 1CKMA 1VCIA 2PQAA 1QVGA 4X64Q 4R4IA 2AKWB 4B3TL 3M9BA 5EAYA 3ERSX 3J80i 4BY1H 1B70B 2VL6A 1VS0A 1XMQQ 2R93G 3S16H 2NVQH 4R4QA 1VQKA 4JI1Q 5J3BA 3UDFA 5M3FG 1K9MC 1VQ6A 4DKAC 3I4NH 2VUMH 5JJIA 3A5ZB 1UE7A 2K5VA 1PHJA 3U4ZA 3HOXG 3CPFA 4KHPQ 4DR5L 1UE1A 1I94L 3HOYG 2IY5B 3CF5A 2KCMA 4GN3B 1OXVA 4GNXC 3T1HL 4A3FG 1HZ9A 3J7ZC 2BH2A 1K3RA 1KC8C 3UE1A 2V1CC 4YHHQ 5C3EG 1WOCA 4HJ8A 2E8GA 4JI0L 3I2ZA 1NMGA 1Q1BA 4OWTB 2GVAA 5DLQE 3RLFA 2EIFA 1W2BA 1X9NA 3ZJYC 1D7QA 2ZTDA 4GKKQ 1A0IA 1Q8KA 2Q2TA 2JA6H 1VQDA 3E9IA 3M3YH 4LW1A 5IP7H 4BY1G 1IYJB 2N3SA 2K14A 4DR4L 4UPAA 4BBSH 2WB1E 2IT1A 1V1QA 2Q2IA 4JBWA 4GNXB 1L1OB 4JI6L 2R92G 5H1SE 5C44G 4OONA 4BA1I 2E5LQ 2UXDQ 4IFDJ 4KHPL 3JC66 5AJ3Q 1LM0A 2UUCL 4LF7Q 4AYBG 1YBYA 3ULPA 4L5RC 4DV4Q 1L2FA 3HOZG 4H02A 4DAMA 4MNOA 3RZOH 1VQGA 4DR1Q 1VQ7A 1I5FA 1EIFA 3K80C 3CC7A 4EQ5A 1Q7YC 4PZ8A 4BBRH 4B3SQ 3PO3H 3L0OA 2HIXA 2Y0SG 3W5OA 4A4IA 5GROA 1RIPA 2BH8A 1UEBA 2E2JH 3J7A5 1XTDA 3ER0A 2WP8J 1PH5A 2JA8H 1N9WA 4YWLA 1O7IA 2D0PA 1YJWA 1HR0W 4DR6Q 3D0FA 1XPUA 1K0RA 3Q8DA 5IP7G 3RNUA 1A62A 3S1RH 1TWGH 2YTXA 3HOUH 3F8TA 5FLMH 4DV7L 1R9TH 1XNQL 4BBSG 1KAWA 2UXDL 5M5YH 4HJ9A 3GTOH 3UDIA 3HOVH 3M7NA 1CKOA 1FGUA 3FKIH 5AJ3L 2K5NA 3HOWH 3S2HH 4A3BH 1OXUA 3G71A 1VQAA 1WYDA 3OW2A 2NVYH 4LFAL 4DV2Q 1B7YB 3CAMA 4A3JH 4DR2Q 4GNXA 1L1OA 4BXXG 3CMAA 2K52A 2Z6KA 2B63H 3GTPH 1TXYA 1BVSA 2BA1A 4JI4L 3HFZB 3U50C 5GADC 3GTLH 1AH9A 1PH1A 4LF5Q 3U58A 1I3QH 3K8AA 4LWCA 1X6OA 1SLJA 4QL5A 4DV5L 2D0OA 2ALYB 4DV1L 1VQ4A 1EFWA 1CSPA 1YIJA 4A3GH 4MZ9A 3CCVA 2NVTH 4QY7A 1M90C 4ALPA 4GOPB 4YCWA 2IHEA 4X62L 3SGIA 4A3DH 2VS1A 3HOUG 1QZHA 5FLMG 3BU2A 4A93H 3PO2G 2JA7H 3S1MH 2K5HA 4IPCA 3GD7A 3FKIG 1K8AC 1PFSA 4X66Q 5M5XH 1GM5A 4A3BG 4DV2L 1QVCA 4YY3Q 4LNQA 1FL0A 2RF4A 4GS3A 4QQBX 3ULLA 1JJ2A 2XGTA 4A3JG 3S1QH 4Y52H 3RZDH 2AWOA 4B3TQ 2B63G 2DUDA 5GAGC 5LMUL 4LF5L 2XTIA 4LUOA 3UDXA 4AIMA 1KIXA 4JG2A 3BZCA 1I6HH 1VQBA 2K50A 3NELA 2R7ZH 2JK8A 2JEBI 1M1KC 3GO5A 4A3GG 3NENA 1X3EA 1EUJA 4A3EG 4DNIA 3GTJH 2CKZB 4XIGS 4HJAA 4A3DG 4DR5Q 1I94Q 4LF8Q 3CCJA 1DGSA 3EN2A 4UP7A 1NJIC 1SROA 5GQOA 5IE8A 2JA7G 3T1HQ 2R7FA 4X66L 4A3LH 1HH2P 5LMNW 1VQIA 4IOCA 4GOPA 4PZ6A 4GLAC 3M4OH 1EIYB 2RHQB 4BY7H 3PUVA 4YCUA 4PZ7A 3KLWA 4DV3L 3PGZA 1MKHA 4JCVE 4GLXA 1Y1VH 1K83H 1Q46A 3UE0A 3I56A 1H95A 4HJ7A 1PA6A 3KF6B 4L5SA 4DR4Q 1T9HA 4DUYQ 4AH6A 1N8RC 1EOVA 1ASZA 2CCZA 3CQZH 2HIVA 5ELNA 3GTKH 4JI6Q 3J81c 1X54A 1Q81C 2ATWA 2N49A 1NTGA 2R7ZG 1SN8A 2PI2E 3JAMc 2RHSB 4C3HH 1NE3A 2OTJA 2UUCQ 3OYYA 3CMEA 4LF8L 2A1AA 1G51A 5IT9c 1L1OC 3ICEA 3RN2A 1J6QA 2Z6KC 1MJCA 4PMWA 1PH7A 1E1OA 3U4VA 3PF4A 2DGYA 3GDEA 4OO1G 1AE2A 2IHFA 4JBKA 2UUBQ 3CC2A 2R92H 3GTQH 4HIOA 4BY7G 4R1JA 2MO0A 1SRUA 2EXDA 1YHBA 1Y1VG 4DV6Q 3TQYA 3KFUA 1YITA 4DUYL 4IPHA 4JI2L 2UU9Q 3H3VH 3H15A 4KHZA 1EQQA 4DV7Q 1XNQQ 3RR5A 3G6EA 1KXLA 5IYDG 3I4NG 3PSIA 3S17H 2VUMG 1JT8A 5C4JH 1OXSC 4AYBE 3HKZG 3HKZE 2YTVA 3WWVA 3CCSA 2F4VQ 1PH4A 3KF6A 2QA4A 1HZCA 1L0WA 4LFAQ 4K0KL 1XMOL 4TQUS 4AQYL 3RN5A 3TS2A 1TWCH 1LYLA 4OO1I 4L5TA 1YVCA 2I5HA 3G48A 4IJLA 4YWMA 1S72A 4JI4Q 2Y0SE 3PUXA 2UUBL 2F3IA 3AFPA 1W3SA 2ZJQA 4JI5L 3M4PA 4UY8C 1VQJA 1FVIA 2OWOA 4DV5Q 2JA6G 4IFDG 4DV1Q 1GO3E 3G4SA 4DV6L 4MTNA 2UU9L 4A3KH 5HY6A 3K81C 2ZTCA 4X62Q 2MFIA 3CPWA 1WCMH 2OTLA 1BKBA 4R4CA 2EQSA 2CFMA 2PNHA 1PH2A 1VQHA 3CD6A 4GOPC 1N33Q 4C3IH 1YNXA 4JI7L 2F4VL 1U0LA 1QUQB 4GKJQ 3AQQA 1IBLL 1OTCA 4NXNL 1E7ZA 3AFQA 2E2IH 2UXCQ 4C3JH 1PH9A 1NBWA 3F1ZA 4B3MQ 5M3MH 1KHIA 2BA0A 1QZGA 1CKNB 4XTCS 1YHQA 3KOJA 3AEVA 1JMCA 1J5EL 1YHAA 4BBRG 2OQ0A 2ZTEA 3STBC 5LMUQ 3PO3G 1VQPA 3W1GA 3CCRA 2Z0SA 2QGQA 4IFDI 3PV0A 1PH6A 2VNUD 1UE5A 1PH8A 1VQ5A 4A76A 2LXKA 3T1YL 2HT1A 2JA8G 5C0XJ 3S1NH 4EX5A 5BR8L 3H3VI 1Z47A 2Q2HA 1E1TA 4A3KG 4JOIA 2K75A 4NB3A 1LTLA 2UXBL 2JE6I 2K4KA 2CWPA 1X65A 1KD1C 4JBMA 1N33L 3HOVG 4GKJL 1PYSB 3J80c 1Z9FA 2KHIA 3TS0A 2ES2A 3CP0A 3HOWG 2UXCL 2ZJRA 4JC0A 4LF9Q 4POGA 3I4MH 4Y7NH 4B3ML 4DR7L 1HZBA 5JEAG 2AWNA 1BBWA 2H5XA 4JI3L 5C4XH 1WJJA 3S15H 3S24A 1GKHA 4DV3Q 4APVA 3EBEA 3PUYA 2D62A 4QJFA 2YU9H 1QUQA 3E9HA 5IP9H 1QVFA 1Q12A 3EIVA 2AMCB 4A3MH 1U5KA 2KHJA 1KRSA 5IYCH 4C2MH 1X3FA 2NZHA 1CKNA 4X65Q 3NEMA 1CSQA 3J81j 1VQ8A 2I5LX 5GAHC 1PH3A 1UWVA 2I0QA 3K7UC 1GD7A 4L5QA 3CCQA 5FLXc 1Y1WH 4NXMQ 4R4OA 1HR0L 4A93G 1PVOA 2YYZA 4IPDA 1Q82C 4HJ5A 4LFBL 4UP8A 4DK6C 4LF6L 1EQRA 2ZJPA 4LF9L 1CUKA 1FJGL 3CCUA 4RMFA 1P16A 5JJLA 4IO9A 2VW9A
chains in the Genus database with same CATH superfamily
5M3FH 1VMCA 2A19A 3MZ5A 3GTMB 3F2DA 2L11A 3BJUA 4G57A 3VA7A 1SEBD 2SDFA 1ASYA 2RA4A 3FDTA 4X65L 2N78A 2A8VA 1G6PA 1A63A 4KHVA 1RDPD 2CH4W 2VZAA 4DK3C 5C3EH 1U4MA 3K58A 1VQOA 3OTOL 4IQZA 1GUSA 1Q1EA 2EY2A 4AQYQ 4CKBA 5LHY1 2QEJC 2HHHL 2DN8A 2F0GA 1XNRQ 5G3LD 5JOBA 3AYHB 1I50H 2VQEL 2R92H 3KJPA 3I73A 4KY6A 3KLSA 3HOZH 3URYA 2VQFL 2KEDA 1ESFA 5I6YA 1AFPA 3BVGA 4NXNQ 5NUCA 4X64L 4P74A 3KDFA 4KJOA 4JV5Q 2JA5H 4QUCA 4A3JB 1J5EQ 4P71A 2EYOA 2BE5C 1B9MA 1E0BA 5COYA 1MJEA 2B29A 4A3CH 5LMNL 1S4ZA 3PCOB 4N8X1 2EE1A 3SK4A 2Q8IB 3T1YQ 2HQLA 4IUQA 4YWKA 5HURA 5BR8Q 1JE5A 5EKLA 2K7VA 1B4OA 5EQ0A 2ZXRA 5D3DA 3P20A 1VQFA 3JAMi 1Z7TA 2XN9C 4A3IH 4HIDA 4P2CB 2LXJA 1SFOB 1MSGA 1DD2A 1LTBD 1E22A 5M5WB 2C35B 2K03A 3VR5A 2EY5A 2I5MX 4GKKL 4K8JA 5FO9B 4DUZQ 4B9WA 1QILA 4ZLTF 3Q0AA 5KNCA 1WTWA 1C48A 1HNZL 1FNWA 3PUWA 3PO2H 1H9JA 1LTTD 2PQEA 4OX9L 5IWAQ 3MXNA 1OO9B 1XPRA 3E0JA 3G6JB 4DV4L 2RCNA 5FJ8H 3PQIA 1GUTA 1HNWL 4CHTB 3C3LA 2NWGA 1TS4A 4B3SL 3TREA 2G9DA 2EXZA 3ITPA 4DAVA 4DR3L 4P72A 3NQIA 4XT1B 4J8QA 2QEXA 3M4QA 3MEFA 2CWAA 4A3EH 2MGSA 1S5CD 3PF5A 3F2CA 1TWHH 2F3VA 2PQAB 2HCCA 1S5BD 5IYBG 4X3TA 3A7LA 2YTYA 4C3HB 4G4KA 3U9SA 1EYCA 3I4OA 3MXGA 2JEAI 3T13A 1TS3A 3MHBA 1Q86C 3W1BA 2A69D 1PRTB 2AQ3B 3DXJC 4OWXB 2PZUA 2WAQG 4LF4Q 1ICWA 2A6EC 5IP9G 3TRZA 1R4PB 4TSSA 4LUZA 5G3LF 2RVLA 5DM73 2WFWA 1II3A 1K8GA 3CRLC 4B9XA 3A74A 5T1IA 1BXTA 1DYQA 1DM0B 1CKMA 3NP8A 4R4IA 4QB4A 5EAYA 3I90A 5JJZA 3J80i 4BY1H 2NVQH 4KD3A 4R4QA 4WORA 1BCPB 4HMIA 5J3BA 4JI1Q 3UDFA 1GOZA 1NR2A 2K5QA 2KJXA 2JA8B 3D4RA 1I94L 2DJFC 1HUNA 3OHXC 4A3FG 4C1NI 1HZ9A 2Z6BA 1STEA 1R9TB 1I4HA 1DOMA 2D9UA 2I46A 4WJWA 4YHHQ 2F0LA 4V190 4FO2A 3GTOB 1WOCA 4HJ8A 3FKIB 3I2ZA 1NMGA 3IFTA 4WFN3 1SMYD 5DLQE 2J4XA 3I72A 4ME5A 1Q8KA 2JA6H 3M3YH 3CRKC 3KF8A 1IYJB 1EFID 1DOLA 2N3SA 1JC7A 4BBSH 1V1QA 4BA1I 4HR7B 1WVLA 2E5LQ 2UXDQ 4KHPL 3JC66 2QKIC 1L2FA 1LTRD 4H02A 4DAMA 4MNOA 3RZOH 1VQGA 4J6HA 3CC7A 3V2TA 3TZDA 1SJHD 3PO3H 3J7A5 1PH5A 3MTSA 3A8IE 2TMPA 3S1RH 4N9TA 5J39A 1U4PA 2YTXA 2MJ8A 5FLMH 1CHQD 5JVG3 4DV7L 4DXFA 1KAWA 2NTTA 5M5YH 4HJ9A 3HOVH 3M7NA 1FGUA 4MTKA 3HOWH 5ELFA 3S2HH 3OW2A 4HMJA 1O7ZA 2KCNA 4LFAL 4DV2Q 3CAMA 3PIO3 1L1OA 2K52A 1BVSA 3GTLH 4JI4L 1PH1A 1Q3LA 1BUVT 1H9KA 3K8AA 4LWCA 4DV5L 4DV1L 1VQ4A 3C1FA 4MZ9A 3CCVA 4QY7A 1M90C 4ALPA 2B2WA 4YCWA 4X62L 2LFNA 1K83B 4QF4A 2K5HA 3FKIG 3K59A 2K5DA 5M5XH 4EGVA 3DHQA 1JCKB 3S1QH 3NTKA 4PMCA 2H1EA 3H3VC 3RZDH 2AWOA 3HG9A 5LMUL 2XTIA 4LUOA 3UDXA 4ZYSA 4AIMA 4JG2A 3OIPA 5IIFA 2R7ZH 4IZ8A 3AB9A 4A3GG 1I50B 3GTJH 2CKZB 1TVXA 4RKLA 5EBDA 4CGYB 3P7JA 2F0EA 4LF8Q 2XIWA 1RJTA 5GQOA 5IE8A 2KCCA 4X66L 1F9SA 1IW7D 3OW7A 4XQJA 1G2SA 1SBBB 3EVQA 3SE0A 3PGZA 2ZT9C 1Y1VH 3KF6B 1HFGA 1B53A 4DUYQ 5LL6S 4AH6A 2A6ED 3GTKH 2CCZA 5IYDH 2EYFA 1Q81C 3HEJA 2PI2E 1NE3A 3CMEA 1L1OC 3V96A 3E6ZX 4A3KB 2HCIA 3DWPA 1PH7A 1E1OA 1STBA 2JYOA 3TMEA 3U4VA 4OO1G 1FYCA 2O4XA 2UUBQ 4H44C 2B2WC 2F0OA 1DJRD 1YHBA 4DV6Q 2F0VA 2UU9Q 4KHZA 2L12A 2KUMA 3E5SA 3SEBA 3I4NG 4CJ2C 2VUMG 1F9QA 1JT8A 3NXWA 4ZUJA 5D14A 1OXSC 4HSVA 3HKZE 3CCSA 4I65A 2QA4A 2R61A 4AQYL 3TS2A 4OO1I 1TWCH 3AMUA 1YVCA 1KTKA 2PCFB 1QE6A 2BDNA 3G48A 1CHPD 1F2ZA 1PFMA 2LMCB 4Y7NB 2ZXOA 2RCFA 5DEHA 3I70A 3IAYA 1LABA 5FOBB 2SOBA 5HY6A 1EQTA 2OTLA 4R4CA 1PH2A 2FJ2A 4GKJQ 1U0LA 1QUQB 4NXNL 1E7ZA 2UXCQ 2FMMA 3A7AB 4C3JH 1PH9A 2K33A 1QZGA 1CKNB 4KY5A 1PRTF 5IGDA 1WD1A 1JMCA 1J5EL 2EJFC 1O78A 3STBC 2VNUD 2L1BA 4HSPA 3CCRA 3PV0A 1PH6A 4A76A 2LXKA 3NQTA 3T1YL 2HT1A 3S1NH 3T56B 4N9PA 5JAVA 5BR8L 3H3VI 1PTOC 3C1EA 2Q2HA 3K7AB 4A3KG 2JE6I 1QJOA 2CWPA 3OOCA 1N33L 3HOYB 3QR8A 1ML0D 4I7ZC 5CGKA 4OL7A 4C3IG 4JC0A 1SE4A 1IHZA 5KNDA 1HZBA 2RDGA 5JEAG 2AWNA 1UUPA 2CVRA 1YNJC 1WJJA 4L8JA 4APVA 1SYBA 4DV3Q 2JP1A 3D8GA 5IP9H 1RKNA 2AMCB 1D5MC 4BY1B 4L63B 4C2MH 1X3FA 2NVQB 3K0YA 2I07B 2XWJB 1UWVA 1LACA 3A54A 1QOHA 1STHA 5C44B 5F2DA 1PVOA 2YYZA 4IPDA 4RA8A 1HXYD 1F2MA 4UP8A 4LF9L 5I9PA 3CCUA 1KDBA 1P16A 5JJLA 4IO9A 2MO1A 2JQOA 3OMGA 2L9HA 2X6GA 5TSSA 3ND9A 2YV5A 5IYCG 4KI0A 4FXKC 4J15A 4KY7A 1CZWA 2O5JC 3FVQA 3NHHA 4Q5VA 1YEZA 1S5DD 1GUNA 1STAA 3HKSA 3BZKA 2PMZE 3FMCA 4JI5Q 5D3IB 2MQHA 3VDYA 2KEEA 1QNUA 4LF4L 4KLKA 3RLNA 3A56A 3N52A 4IPGA 1TWAB 2CW0D 3DM3A 2F52A 5K36G 4O2DA 3R93A 5CV9A 4KKTA 1D8LA 4JI8L 5IY0A 1N34Q 1EL0A 4FNFA 1IBML 1JE4A 1HA6A 1WI5A 1L0YB 2GN5A 1TT2A 1D1IA 4TKOB 4ME3A 4JI1L 1ENFA 2A6HD 2NVXB 3KJOA 1ILQA 3H0GG 3K5NA 5D65A 1C7YA 1I6VC 4M1UB 2VY3A 1PYBA 2WKDA 3TBIB 4JYAQ 3L2PA 4YHHL 1SYEA 3LNNA 4DAYB 2PZWA 3OMCA 1EYGA 3P1HA 3TEHB 4P75A 4IUVA 2QDBA 4DF7A 4CBVA 3E0EA 2E2HH 3ONAB 4JI3Q 4RG1A 2F03A 1HZAA 1GUOA 1AW7A 1IXRA 1PV4A 1VQ9A 3RZDB 4B3RL 3BDOA 1TQOA 1V43A 3MXUA 2E5LL 1N32L 2XRSD 1EIGA 3CCMA 1RL2A 2R7DA 3WOFA 2R7ZB 5C4HA 3HOXB 5KIXA 3S2DB 1HR0Q 5KEEA 3AU7A 1TWFB 1VQLA 1FJGQ 1LV9A 1B8AA 1KABA 2UUAL 1K73C 3P75A 4LFCL 1JB3A 3STBD 5JEAJ 5C0XG 1HNXQ 4OEMB 1MIUA 1G6ZA 5E1FA 4RGTA 2Z4HA 5BN3A 4H7BA 4LUVA 2AHOB 1PTOD 1F9PA 1Y1VB 1JJGA 2B3GA 1EEFD 3ND8A 3OSOA 4F87A 4XT3B 4XDXA 2VXWA 3RLOA 3IRBA 2R93H 1K28A 5C0XI 2EJMA 1ICFB 4LMQD 4QIWE 3J7AV 5C4XG 3F2BA 2WAQE 1LUZA 2B2UA 2ZM6L 1XYIA 3GTGH 2AUKA 1RD9D 3NE5B 3GQBA 4A3MG 4UHVA 1SNPA 3C2PA 3A5UA 1VQNA 2ENBA 2MNAA 1LO5D 4R8IA 2F0PA 1Y1WG 4KN4C 1VQEA 2OT2A 2PQAA 1GHKA 2AKWB 1L0XB 3NUCA 1JWUD 1XMQQ 3S16H 2A68C 1GUGA 4BBRB 1I4GA 4XYOA 1ZEQX 3I4NH 2VUMH 5AFWA 3A5ZB 2K5VA 2E2JB 4IUTA 3HOXG 1AP0A 4DFAA 5I2XA 2IY5B 3CF5A 5CV6A 1XXGA 1K8OA 3HOUB 3J7ZC 2BH2A 1KC8C 3UE1A 2V1CC 4JI0L 2E8GA 1T5EA 1Q1BA 1D7QA 1W2BA 1X9NA 2ZTDA 2B8GA 1O80A 4PMBA 2Q2TA 3E9IA 3SK6A 4C3JB 2F0WA 4MIUA 2V4DA 2K14A 2B63B 3GTPB 4UPAA 2WB1E 1MI2A 4JBWA 5H1SE 4OONA 1I3QB 3VYUA 1G91A 5AJ3Q 3D6CA 1YBYA 3ULPA 2NVTB 1D2BA 1KDCA 3CKIB 4A3DB 5BN4A 1I5FA 2F3WA 3X3NA 4A93B 5IGCA 5IGBA 2HIXA 1RTNA 4H0LC 2BH8A 4NP5A 1V1PB 3ER0A 4YWLA 4DR6Q 2B2UC 1HR0W 3D0FA 3J81L 1K0RA 3RNUA 5IP7G 1TWGH 3F8TA 3RMHA 1BQQT 1W6KA 4OGQC 2K5NA 4A3BH 1VQAA 1WYDA 5I2YA 2NVYH 3MFYA 5JEAH 2NZ1D 1C4QA 5ELDA 4BXXG 5KNBA 2F0SA 1TXYA 2K6AA 4RFBA 5FKAC 2WIIB 2BA1A 3HFZB 1JQYD 4LF5Q 1EFWA 2F0NA 4IUNA 1YIJA 1A3TA 4BY7B 1KNEA 2HUGA 2VS1A 4K5XA 3HOUG 1PRTC 3NPPA 2JA7H 3S1MH 3NBIA 2L55A 1PFSA 3MXPA 3CQZB 1GM5A 1QVCA 4YY3Q 2RF4A 4GS3A 4A3JG 2B2TA 1E2WA 4B3TQ 2B63G 4ZRZA 5GAGC 2M9VA 4GZYC 2EYMA 1KIXA 1AEXA 1I6HH 3KUPA 2FMCA 3GO5A 4E6IA 2WB1B 3GTQB 2PW7A 3SK5A 3VA5A 1A3UA 2D5DA 4ODGA 3BYYB 1BCPC 4A3DG 4DR5Q 3CCJA 1DGSA 3EN2A 3V05A 1D5XC 4K8IA 3T1HQ 2R7FA 4ZKBB 1HH2P 3MAQA 5C4JB 1CM9A 2EYHA 2CQAA 1WTVA 5KYLA 4N8FA 4DV3L 4JCVE 3JAME 4GLXA 1Q46A 4CJ0B 3HRZC 1T9HA 1N8RC 5IT9E 4IUPA 5ELNA 4JI6Q 3J81c 1NTGA 2K28A 1NUCA 2UUCQ 1G51A 1NNXA 3EFXD 4ZAIA 3QWNA 1VF5C 1WCMB 4HEDA 1PTOH 1SXTA 3PF4A 1CI3M 5BN5A 1AE2A 3CC2A 4HIOA 4BY7G 1SRUA 1RCVD 5M3MB 2E2HB 4OHJA 4G7ZC 1YITA 2LY7A 3H15A 1Q90A 1XNQQ 1HCZA 4RCOA 3BS1A 1ENAA 1LTAD 4C3HG 1EY7A 4AYBE 2F4VQ 3D3RA 4PQXA 3KF6A 1TY0A 2BCOA 1WTXA 1S5ED 4U68A 3RN5A 2B2TC 5J22A 2WINB 2QW7A 4YWMA 1HPCA 2Y0SE 2F3IA 1Z6HA 1W3SA 2ZJQA 4JI5L 3G7LA 1VQJA 3I4MB 2BE5D 2PYKA 4J1MA 1EQVA 2VB3X 4IFDG 2PPBC 4KKUA 5CC4A 2MFIA 4UDUC 2OXPA 5FK9C 4Z9CB 2EQSA 2CFMA 2PNHA 3UI2A 3CD6A 1V8QA 1YNXA 3OPOA 3PMFA 3AQQA 2E2IH 4FXDA 4B3MQ 3F1ZA 2PNRC 4G7HC 2RBMA 1VQPA 3W1GA 1WTRA 4IFDI 1PH8A 2R93B 2JA8G 5M3FB 3A8JE 3J80E 1Z47A 1PFNA 3VR2A 4JOIA 4G7OC 2BOSA 3MWYW 3OWEB 4NB3A 4MHEA 1IYVA 5L37A 1KD1C 4JBMA 4ABNA 2ZJRA 1ET9A 1PZKD 5C3EB 1TU2B 2F0IA 4EVOA 4JI3L 5ISRA 5C4XH 4HAEA 1RTOA 5C3XA 3S15H 4CDEC 3PUYA 2YU9H 1KNAA 1QUQA 3QO2A 1DOKA 5FLXE 3EIVA 2P5ZX 4A3MH 4FF3A 1U5KA 1KRSA 3J7YW 4ZKCB 4X65Q 1B3QA 1CKNA 1CSQA 4M8AA 1VQ8A 2I5LX 1PH3A 1IL8A 2R92B 1Y1WH 2IW3A 2L5TA 4RHSA 1HR0L 1JORA 3SXHA 1RODA 4NW2A 4HJ5A 2ZJPA 3HOZB 1CUKA 1FJGL 2B8FA 1CK1A 3F2UA 2M00A 2VW9A 2PI2A 1BNZA 1HNXL 4WJ4A 4RKBA 2FHTA 2Q2UA 4DNTB 1XPOA 1JOQA 2IX1A 1HQRD 1IYUA 4BWGB 4POFA 4KD4A 3KLSX 3QB3A 2JA5B 4CKCA 5CV7A 4DNRB 1HRJA 2OEOA 1JJCB 3OWFA 1BCPD 4K5WA 4NXML 2VQFQ 3FP9A 4ULLA 2FXQA 1SYCA 1XMOQ 3PUZA 1EU3A 2K01A 1BO0A 3DUZA 2HQEA 4H13C 3RD4A 4A3IB 1YJ9A 4C1NK 3EA6A 1EZ6A 3PIOA 1B9NA 3BDCA 5LMNQ 2GVBA 4DA2A 1PZJD 4JOIC 1WFQA 1KRTA 1HHVA 4RHRA 2EYPA 1OXTA 2RKSA 1VQCA 1IL2A 4F7XA 3PO2B 3L7ZC 1GVPA 1SR3A 4X6AH 1B2TA 3GTMH 1U4RA 1IBLQ 2N55A 2NZOA 1CTMA 4HIMA 1FD7D 4HIKA 2NVYB 1FNVA 1YNNC 1XMQL 3D6WA 1EIHA 1XNRL 3T4AC 4IOAA 4P73A 1HNZQ 1AE3A 1H9SB 1B1ZA 4IUUA 4OX9Q 3GV6A 3UDGA 1QCBD 2LSSA 1G2TA 4UP9A 5E7NA 1V1OA 1EY9A 4A3EB 1VDZA 1Y8OB 3J81i 4BXXH 1ENCA 1TWHB 2MP1A 4CDCC 1HNWQ 1X55A 4DN4M 1NR4A 4DR3Q 4JV5L 2B39A 2JA5G 5EPJA 3A8KE 1UE6A 3D31A 2N88A 2GA4B 3NK9A 2FFKB 3NTIA 3JAML 1YI2A 2NBFA 4A3CG 2ID0A 5IYBH 4OWWB 3BZDB 4FDBA 4YCVA 2IX3A 1CA5A 4FF4A 5ELOA 5A2QE 3FRPB 3M85A 4LFBQ 1SE8A 3QG1A 1B50A 3KYHC 1PZID 4A3IG 1CA6A 3CCLA 3SDZA 3CC4A 1B3AA 4DK0A 4DR6L 1JICA 4DUZL 3CXCA 4DAYA 1UAPA 1SSOA 1S5FD 2OCEA 1A3VA 3K57A 4LK1C 5IWAL 1G291 1SFOH 1ZKOA 3KBGA 1N36Q 5M5WH 3KLRA 2L15A 1SYGA 5CBAE 1NMFA 1IBKQ 5FJ8G 1EYAA 3HKZB 4S3SA 5JVH3 2JSOA 4DV0Q 2XVSA 2F0FA 4NMZA 3K0XA 1I4PA 1HJPA 4KJNA 3Q23A 5I6WA 2F0HA 2QILA 1P8LA 1DONA 2JA6B 3M3YB 4QGUA 3W3AA 2K04A 4LAAA 3PIPA 3NBHB 1X3GA 4A3FH 5EGTA 1K3BC 4BBSB 2F0TA 3DLLA 5C4ZA 1J8IA 4YY3L 2EY1A 4ZUIA 3SR1A 1K8MA 4I7AA 3NWTA 3M9BA 4B3TL 2VL6A 1JWMD 3RZOB 1BF4A 1VQKA 1K9MC 3PO3B 2DY7A 1EY4A 3BVZA 1PHJA 4KHPQ 4DR5L 1UE1A 3J80L 3HOYG 3H09A 2KCMA 3S1RB 1AZQA 1OXVA 2JXMB 4GNXC 3T1HL 1K3RA 3CHBD 4L6TB 5M5YB 3HOVB 3HOWB 3S2HB 3ZJYC 2E74C 5ELEA 4KK7A 1EY6A 1JOOA 1E2VA 4BY1G 2O2LD 3GTLB 2IT1A 2Q2IA 5FLXL 4JI6L 4GNXB 4CDDC 5C44G 3MVVA 5EKKA 3L3OC 2UUCL 4LF7Q 4L5RC 2A73B 4JK1C 4DR1Q 3BDLA 3K80C 3H94A 1Q7YC 3W5OA 4A4IA 1YNND 5M5XB 1XTDA 2WP8J 2JA8H 1N9WA 1YJWA 1MHWC 2D0PA 2M2LA 4DK1A 1XPUA 1SDFA 1A62A 5EPKA 3S1QB 4BS9A 1SNCA 3Q22A 4K2LA 1XNQL 1R9TH 4BBSG 2YU9B 2UXDL 1CQFA 3GTOH 3UDIA 3FKIH 1VMPA 1PDQA 3ZYYX 1EWCA 4UAIA 3GTJB 3BYTB 4DR2Q 3L9AX 4K2KA 2Z6KA 3NWSA 3LWEA 1EY8A 1M8AA 4QCLA 2ICEC 1LT3D 1X6OA 1SLJA 4QL5A 3VYSA 2PMZB 2F0UA 1CSPA 4A3GH 2MPMA 4KMUC 4K6LA 1HUMA 4GOPB 2IHEA 3SGIA 5EJWA 5EPLA 5FLMG 1V1PA 2A74C 1J9OA 2CH4A 2KECA 3DM1A 4IPCA 3GD7A 1K8AC 3TDQA 3GTKB 1HTPA 4X66Q 4DV2L 3TP6A 4LNQA 1FL0A 5ELCA 1STNA 3ULLA 4Y52H 5FO7B 1GHJA 1LT4D 5E3FA 2AQ2B 2DUDA 1YNJD 2EY6A 2L4NA 3DMUA 1WD0A 3BZCA 3FPPA 2DNEA 1JR0D 3TP5A 3R2IA 2JEBI 1EUJA 4DNIA 1D6EC 3I8ZA 4XIGS 1TKWB 3IFDA 1NJIC 2C9OA 2Q8TA 4RAUC 2WACA 3A55A 5KRUA 4OO1H 4IOCA 4GLAC 3M4OH 2AQ1B 4FVMA 1F77A 2LS01 2RHQB 1AN8A 4YCUA 2NTSA 1O7LA 1K83H 1TWCB 3UE0A 3I56A 4OELB 5CYUA 4HJ7A 4L5SA 1W6JA 4DR4Q 3VR3A 1U9RA 1KLGD 1STYA 2HIVA 3EQLC 3HGBA 1ASZA 3QOJA 2ATWA 2R7ZG 2N49A 3KK7A 1IKLA 1KLUD 1WTHA 1PXUA 1T5XD 4LF8L 2XRQD 1FNUA 2Z6KC 1MJCA 2WKCA 4PMWA 5A2QL 1SMYC 2DGYA 1MD2D 4V0BA 1K0SA 1QG7A 2IHFA 2IPKD 2HD3A 4C56C 2F0QA 1MSHA 2IJ0A 2IWHA 4R1JA 2MO0A 2RQXA 1JWSD 1Y1VG 3TQYA 1FR3A 4DUYL 5E4WC 3H3VH 5I4DA 3E3XA 4KKSA 1KXLA 4X3SA 5IYDG 3PSIA 3S17H 1PH4A 3S1NB 1HZCA 1L0WA 1XMOL 1LYLA 2HDMA 4L5TA 1DXMA 4IJLA 1S72A 3U9OA 2UUBL 3PUXA 3C46A 4QIWB 5C6AA 4DV6L 4MTNA 5FO8B 2UU9L 4A3KH 5IOCA 3CPWA 3K81C 2WAQB 3CU7A 1BKBA 3BG3A 3Q6SA 1BDOA 1SNOA 3TSSA 1N33Q 4C3IH 5JPMC 4C2MB 1IBLL 2WV6D 1OTCA 2G5DA 3AFQA 1NBWA 1PTOF 2Z8LA 2BA0A 4KV6A 4RH6A 4RCNA 4XTCS 3MFGA 1YHAA 4BBRG 1STGA 2ZTEA 4O42A 4RGOS 1VQ5A 1I4QA 3I3CA 5C0XJ 1U4LA 4EX5A 1E1TA 1PLFA 2EZVA 2K75A 3HS0C 1SJED 4PV1C 2K4KA 1G8ZD 1X65A 4GKJL 2H4OA 1Z9FA 2KHIA 2UXCL 3S9WA 4A3FB 4POGA 4LF9Q 4Y7NH 1X3QA 3DEOA 3W2DA 2KVMA 4C3JG 4RGMA 1PFBA 3WDNA 3X3MA 1X3PA 2Z9HA 1HA5A 1EEID 3DEPA 2NYZD 1QVFA 2KHJA 4XQNA 4HCEA 5IYCH 3NEMA 5GAHC 2QF7A 1A2TA 2EVBA 1XWEA 3K7UC 1GD7A 4L5QA 2NB0A 4A93G 2PZTA 4XYQA 5C5MA 1IW7C 1BOSA 4LFBL 4DK6C 1SE2A 3EJIA 1Q8IA 1GJXA 2EJGC 2K1BA 5M9OA 1S40A 1B44D 1SE3A 2XSCA 3K7AH 1XJVA 2J0TD 4JBJA 5JJKA 1DCZA 1SNDA 2K32A 3HOYH 4GLVB 1H9RA 4JI2Q 3R8BA 4FF1A 5K36H 3KDFB 3OIQA 1N36L 1QNKA 3FPUB 4JVZA 1F2LA 1XTCD 4JI8Q 1CZGA 1IBKL 1A8VA 4K0KQ 4CJ1B 1IBMQ 4A3LG 4IURA 2EOTA 2ASBA 5IGFA 4DV0L 2IX0A 1JB7A 1Y14B 3TZUA 1BBUA 4LJZC 4IJHA 3S14H 2A68D 4TVAB 3MC0B 5C44H 4BA2I 2JJQA 3H0GH 5C3WA 1YZ6A 3I91A 2JA9A 3B6YA 1YJNA 1EOTA 4JI7Q 3I7FA 2KBNA 2CQOA 5KGUA 1NAPA 1SMXA 4A75A 2KA7A 4O0AA 1EWIA 4WRDA 5JPNC 1A15A 1XX8A 3MXNB 3HP3A 2KHSA 1KAAA 3FEWX 1IKMA 2F0JA 2WB1G 1ET6A 1TS5A 3FHWA 3R2TA 4B3RQ 2R6GA 4IALA 3RUZA 3QIAA 4FF2A 1N32Q 1KQSA 2G9HD 2SNSA 4A3GB 1KL9A 4DAPA 1R4QB 2UXBQ 5J1ZA 1KDAA 1N34L 5LL6X 1Y69U 3CW2C 2IL8A 5GAEC 4DR7Q 5C0XH 2UUAQ 5HGQA 2KCTA 4FP5D 2N8NA 1TWAH 5EBCA 3GP7A 5CMDA 4LFCQ 2X69A 3DWAA 4OXPA 4NPSA 4R9WA 1X56A 1E24A 4GN4B 2OF1A 1S3OA 1SYDA 1HFNA 4DPGA 4R4TA 3SHLA 3M7GA 4LF7L 1C0AA 1H9MA 1SNMA 1TY2A 1IZ6A 1WCMG 2ZXPA 1HQMC 4JYAL 3GTGB 4DR1L 1H9SA 3LGJA 3A0JA 4LF6Q 5EKIA 2LKVA 2NVXH 5M3MG 2MHVA 3K5LA 5T1GA 3M4OB 3K5MA 1LT6D 2ZM6Q 1EY5A 3S16B 3KBXA 2NN6G 1C9OA 1LLRD 1PRTD 4RGNA 2XWBB 3I4NB 4PG3A 3NTHA 3ULJA 1Y8PB 2VUMB 3OTOQ 4AYBB 2EYJA 1D5ZC 4MN3A 4DR2L 4XXEA 3TP7A 3LWUA 2OQKA 2KENA 3I55A 1LTGD 4WJ3M 2JN4A 3I4MG 2HHHQ 1BR9A 3T53B 3CCEA 2Y0SB 1V9PA 2VQEQ 5CV4A 4KN7C 3HOXH 4ID6A 3S2DH 4ZCKA 2NN6I 4HTHA 2E2DC 1VQMA 1NY4A 5HGTA 3ERQA 2SNMA 1TWFH 1E3PA 1OXXK 1Y8NB 1DZ1A 3KF8B 4GN5A 4HN7A 3S17B 2PO4A 4JI0Q 2EYLA 4IN3A 1VCIA 1VF7A 1QVGA 4K6DA 4X64Q 3ERSX 4FYDA 1B70B 1VS0A 1LTID 2R93G 2RSNA 5M3FG 1VQ6A 4FXGC 1A2UA 2CHBD 4DKAC 4F8MA 5JJIA 1UE7A 2C5CA 2CW0C 3U4ZA 2RDHA 1UEAB 3CPFA 2HDLA 2VB2X 3H91A 5CORA 2AUJD 4GN3B 1TWGB 2F1MA 1BBXC 3H6MA 5ELBA 4B08A 5C3EG 1TR5A 2Q8RE 2TSSA 1D1KA 3D4DA 4OWTB 2GVAA 3RLFA 3SVMA 2EIFA 4C3IB 4A3BB 3NBHA 4GKKQ 1A0IA 2MUYA 1VQDA 4LW1A 4F88A 1WTQA 5IP7H 2A6HC 4U673 5K5PA 4DR4L 3M4YA 1L1OB 3EROA 2R92G 1ZYRC 3QJYA 4IFDJ 3DWQA 2J7ZA 1LM0A 4AYBG 5CV5A 1SNQA 2B2VA 1PMRA 2FINB 4DV4Q 5I9OA 3HOZG 5CV8A 3K6OA 5CR3A 4HCSA 2QCPX 1VQ7A 1EIFA 3SK8A 3S1MB 2JA7B 4EQ5A 4PZ8A 4BBRH 4B3SQ 3L0OA 4ILWA 2Y0SG 2RDFA 2XNAC 5CBEE 3PIP3 5GROA 1EU4A 1RIPA 4X3UA 4DGZA 2SEBD 1UEBA 3T51B 2E2JH 1MGSA 4QUFA 1O7IA 2L0CA 3LX0A 3Q8DA 4DXGA 3HOUH 3D4WA 1LTSD 5IT9L 1CKOA 5AJ3L 1I6HB 1OXUA 3G71A 1AZPA 1B7YB 4A3JH 1PYWD 4GNXA 4QMGA 1TIID 3CMAA 2B63H 3GTPH 1AH9A 3U50C 5GADC 3U58A 1I3QH 2E75C 2R3ZA 2D0OA 2ALYB 3BVMA 2NVTH 2KOLA 2RSOA 1O7YA 1WTPA 4A3DH 3QOLA 2DNCA 3IKJA 4ZK9B 1CQVA 1QZHA 3BU2A 4A93H 3PO2G 3VR6A 4A3BG 2E76C 1M4VA 3TP8A 1CT1D 4QQBX 1JJ2A 2XGTA 1BCPF 1F9RA 3MA2B 3N6RA 3J7AF 4LF5L 4ZQ3A 1PTOB 4EQOA 1ZXTA 1UNSA 1VQBA 2K50A 3NELA 2JK8A 1M1KC 1RHPA 3NENA 1X3EA 4A3EG 3S14B 2B2VC 1E2ZA 1SYFA 1CFMA 1EZ8A 4HJAA 1I94Q 3H0GB 2F0MA 4UP7A 3Q24A 1SROA 2JA7G 4A3LH 5LMNW 1SAPA 4K14A 1VQIA 2F0KA 4GOPA 4PZ6A 4Q0FA 2F4IA 4EQPA 1EIYB 3O13A 4R8NA 4BY7H 3PUVA 4PZ7A 3KLWA 3J81E 2O5IC 1MKHA 2BDOA 3VR4A 5IGGA 1H95A 1PA6A 1EWHA 2A5HA 2EDGA 1EOVA 1TS2A 3CQZH 1X54A 1SN8A 3JAMc 2RHSB 4C3HH 2DY8A 2OTJA 1C8CA 3OYYA 3VYTA 2QDLA 2A1AA 2B2YA 5IT9c 5E4XA 3ICEA 3RN2A 1J6QA 4XQQA 4DU9A 1QB5D 3GDEA 1A6XA 2X6LA 4NKLA 4JBKA 4PNYA 3T16A 3K5OA 5DM63 3GTQH 2E2IB 4IFDH 4KTAA 1EY0A 2EXDA 3KFUA 4IPHA 4JI2L 1EQQA 4DV7Q 3RR5A 3IL8A 3G6EA 5C4JH 3NSWA 1GUWA 3HKZG 2YTVA 3WWVA 2KQ3A 4LFAQ 4K0KL 4TQUS 4RWSC 3MEHA 4JW0A 2I5HA 1I4XA 4X3KA 4JI4Q 1ESRA 3AFPA 4CKEA 3M4PA 4UY8C 1FVIA 2OWOA 3I4LA 4DV5Q 4EQNA 2JA6G 4DV1Q 1GO3E 3G4SA 1X32A 5C4XB 1ZYRD 1JOKA 3S15B 2ZTCA 4X62Q 1MBYA 1WCMH 4K5VA 2Z4IA 4A3MB 1VQHA 3R3OA 4GOPC 2F4VL 4JI7L 1GXDC 4O1NA 1Y1WB 5M3MH 1KHIA 5IGEA 1YHQA 1EYDA 3KOJA 3AEVA 2OQ0A 3PO3G 5LMUQ 2PW5A 1HTLD 2D2CC 2QGQA 2Z0SA 1UE5A 4TRDA 2NN6H 5DAUA 4NDXA 2B2YC 1ONLA 4CDFC 1FGBD 1LTLA 1I4RA 4OIKA 2UXBL 5DNFA 4YIJA 3HOVG 1PYSB 1NSNS 3J80c 2ES2A 3TS0A 2ICIA 3CP0A 5KYIA 3HOWG 3I4MH 2Z1CA 4B3ML 4DR7L 1RF2D 2K5WA 1BBWA 2H5XA 3WOEA 1LT5D 3GV3A 1QWYA 5C5LA 3S24A 1GKHA 3EBEA 2A69C 2D62A 4QJFA 5IODA 3E9HA 4OIJA 1Q12A 2F0DA 3TN2A 1NCVA 1WTOA 5A35A 2NZHA 4JPBW 3J81j 2EPBA 2NUCA 2I0QA 1F2YA 4NXMQ 3CCQA 5FLXc 4R4OA 3VYRA 1Q82C 2K05A 2DJGC 1ILPA 4LF6L 1EQRA 3HZXA 4RMFA
chains in the Genus database with same CATH topology
2PI2A 2MO1A 5M3FH 1HNXL 4WJ4A 2A19A 2JQOA 1S40A 3F2DA 2Q2UA 1XPOA 3K7AH 1XJVA 2IX1A 3BJUA 4JBJA 5JJKA 4POFA 3HOYH 4GLVB 4JI2Q 1ASYA 4X65L 2N78A 2YV5A 1JJCB 2A8VA 3KDFB 5IYCG 1G6PA 1A63A 4KI0A 1N36L 2VZAA 4J15A 4NXML 4DK3C 3FP9A 2VQFQ 5C3EH 1VQOA 1IBKL 3OTOL 4JI8Q 2FXQA 1A8VA 1Q1EA 4K0KQ 1XMOQ 3PUZA 1IBMQ 4AQYQ 4A3LG 2ASBA 1YEZA 4DV0L 2IX0A 2HHHL 1JB7A 1Y14B 3HKSA 3BZKA 2PMZE 1BBUA 1YJ9A 1XNRQ 3AYHB 4IJHA 4JI5Q 3S14H 1I50H 2MQHA 3VDYA 3PIOA 2VQEL 4TVAB 5C44H 5LMNQ 3KJPA 4LF4L 4KLKA 3RLNA 2JJQA 3H0GH 4BA2I 2GVBA 1YZ6A 4IPGA 2JA9A 4JOIC 1WFQA 3B6YA 1YJNA 1KRTA 3DM3A 2F52A 3HOZH 5K36G 1OXTA 4O2DA 1VQCA 2VQFL 1IL2A 4X6AH 1D8LA 1GVPA 1SR3A 3L7ZC 4JI8L 4JI7Q 3I7FA 3GTMH 2KBNA 2CQOA 5IY0A 4A75A 1SMXA 1N34Q 1IBLQ 4NXNQ 2NZOA 1IBML 4O0AA 4HIMA 1EWIA 4X64L 1WI5A 4P74A 3KDFA 2GN5A 4HIKA 4JV5Q 3MXNB 1XMQL 2JA5H 1J5EQ 4P71A 1XNRL 4ME3A 4JI1L 4IOAA 1MJEA 2B29A 2WB1G 5LMNL 4A3CH 4B3RQ 3FHWA 3PCOB 4P73A 2R6GA 3KJOA 1AE3A 1HNZQ 3T1YQ 2HQLA 1N32Q 3H0GG 4OX9Q 4YWKA 3UDGA 5BR8Q 1C7YA 2LSSA 1KQSA 1JE5A 4UP9A 1KL9A 5E7NA 2VY3A 1PYBA 4JYAQ 2UXBQ 3L2PA 3J81i 4BXXH 4YHHL 1VQFA 3JAMi 4DAYB 4HIDA 4A3IH 1N34L 1EYGA 1HNWQ 3TEHB 2LXJA 4P75A 1X55A 3CW2C 5GAEC 4DR7Q 1E22A 3E0EA 2E2HH 2C35B 4GKKL 4DR3Q 2I5MX 2UUAQ 4JI3Q 5HGQA 2KCTA 4JV5L 2N8NA 1TWAH 4LFCQ 4RG1A 1HZAA 2JA5G 4OXPA 4DUZQ 1IXRA 1UE6A 4NPSA 3D31A 1PV4A 1VQ9A 1X56A 4B3RL 1E24A 1YI2A 1HNZL 4GN4B 1S3OA 1V43A 3PUWA 3PO2H 4A3CG 2ID0A 4DPGA 4R4TA 2E5LL 1N32L 4OX9L 5IYBH 4OWWB 4FDBA 5IWAQ 3CCMA 1RL2A 4YCVA 4LF7L 1C0AA 2R7DA 1XPRA 4DV4L 1IZ6A 1WCMG 2RCNA 5ELOA 5FJ8H 4JYAL 1HR0Q 4DR1L 3M85A 3LGJA 3A0JA 1SE8A 4LFBQ 1HNWL 3KYHC 4LF6Q 4B3SL 3TREA 4A3IG 2NVXH 1VQLA 3CCLA 1FJGQ 3CC4A 1B8AA 4DR3L 2UUAL 4P72A 1K73C 5M3MG 4LFCL 3STBD 1HNXQ 5JEAJ 5C0XG 4DR6L 1MIUA 4DUZL 2QEXA 3M4QA 3MEFA 2CWAA 3CXCA 4A3EH 2ZM6Q 3PF5A 3F2CA 2OCEA 4LUVA 1TWHH 2AHOB 2PQAB 1JJGA 5IWAL 2NN6G 1G291 1C9OA 1SFOH 5IYBG 1N36Q 5M5WH 2B3GA 2L15A 4PG3A 3ULJA 1NMFA 1IBKQ 3OTOQ 2YTYA 5FJ8G 4DR2L 2OQKA 3I4OA 2KENA 3I55A 3RLOA 2JEAI 3IRBA 2R93H 1Q86C 4WJ3M 3I4MG 4DV0Q 5C0XI 2HHHQ 3K0XA 3W1BA 5IYDH 1HJPA 4QIWE 3CCEA 5C4XG 1V9PA 3F2BA 4OWXB 2VQEQ 2WAQG 4LF4Q 1P8LA 2WAQE 1LUZA 3HOXH 2ZM6L 3S2DH 3GTGH 2NN6I 5IP9G 4QGUA 3TRZA 4A3MG 3PIPA 4LUZA 1VQMA 1NY4A 3NBHB 1X3GA 3A5UA 4A3FH 1VQNA 2WFWA 1TWFH 1K8GA 1E3PA 1OXXK 2MNAA 3DLLA 3KF8B 3A74A 4GN5A 4YY3L 1Y1WG 1VQEA 4JI0Q 1CKMA 1VCIA 2PQAA 1QVGA 4X64Q 4R4IA 2AKWB 4B3TL 3M9BA 5EAYA 3ERSX 3J80i 4BY1H 1B70B 2VL6A 1VS0A 1XMQQ 2R93G 3S16H 2NVQH 4R4QA 1VQKA 4JI1Q 5J3BA 3UDFA 5M3FG 1K9MC 1VQ6A 4DKAC 3I4NH 2VUMH 5JJIA 3A5ZB 1UE7A 2K5VA 1PHJA 3U4ZA 3HOXG 3CPFA 4KHPQ 4DR5L 1UE1A 1I94L 3HOYG 2IY5B 3CF5A 2KCMA 4GN3B 1OXVA 4GNXC 3T1HL 4A3FG 1HZ9A 3J7ZC 2BH2A 1K3RA 1KC8C 3UE1A 2V1CC 4YHHQ 5C3EG 1WOCA 4HJ8A 2E8GA 4JI0L 3I2ZA 1NMGA 1Q1BA 4OWTB 2GVAA 5DLQE 3RLFA 2EIFA 1W2BA 1X9NA 3ZJYC 1D7QA 2ZTDA 4GKKQ 1A0IA 1Q8KA 2Q2TA 2JA6H 1VQDA 3E9IA 3M3YH 4LW1A 5IP7H 4BY1G 1IYJB 2N3SA 2K14A 4DR4L 4UPAA 4BBSH 2WB1E 2IT1A 1V1QA 2Q2IA 4JBWA 4GNXB 1L1OB 4JI6L 2R92G 5H1SE 5C44G 4OONA 4BA1I 2E5LQ 2UXDQ 4IFDJ 4KHPL 3JC66 5AJ3Q 1LM0A 2UUCL 4LF7Q 4AYBG 1YBYA 3ULPA 4L5RC 4DV4Q 1L2FA 3HOZG 4H02A 4DAMA 4MNOA 3RZOH 1VQGA 4DR1Q 1VQ7A 1I5FA 1EIFA 3K80C 3CC7A 4EQ5A 1Q7YC 4PZ8A 4BBRH 4B3SQ 3PO3H 3L0OA 2HIXA 2Y0SG 3W5OA 4A4IA 5GROA 1RIPA 2BH8A 1UEBA 2E2JH 3J7A5 1XTDA 3ER0A 2WP8J 1PH5A 2JA8H 1N9WA 4YWLA 1O7IA 2D0PA 1YJWA 1HR0W 4DR6Q 3D0FA 1XPUA 1K0RA 3Q8DA 5IP7G 3RNUA 1A62A 3S1RH 1TWGH 2YTXA 3HOUH 3F8TA 5FLMH 4DV7L 1R9TH 1XNQL 4BBSG 1KAWA 2UXDL 5M5YH 4HJ9A 3GTOH 3UDIA 3HOVH 3M7NA 1CKOA 1FGUA 3FKIH 5AJ3L 2K5NA 3HOWH 3S2HH 4A3BH 1OXUA 3G71A 1VQAA 1WYDA 3OW2A 2NVYH 4LFAL 4DV2Q 1B7YB 3CAMA 4A3JH 4DR2Q 4GNXA 1L1OA 4BXXG 3CMAA 2K52A 2Z6KA 2B63H 3GTPH 1TXYA 1BVSA 2BA1A 4JI4L 3HFZB 3U50C 5GADC 3GTLH 1AH9A 1PH1A 4LF5Q 3U58A 1I3QH 3K8AA 4LWCA 1X6OA 1SLJA 4QL5A 4DV5L 2D0OA 2ALYB 4DV1L 1VQ4A 1EFWA 1CSPA 1YIJA 4A3GH 4MZ9A 3CCVA 2NVTH 4QY7A 1M90C 4ALPA 4GOPB 4YCWA 2IHEA 4X62L 3SGIA 4A3DH 2VS1A 3HOUG 1QZHA 5FLMG 3BU2A 4A93H 3PO2G 2JA7H 3S1MH 2K5HA 4IPCA 3GD7A 3FKIG 1K8AC 1PFSA 4X66Q 5M5XH 1GM5A 4A3BG 4DV2L 1QVCA 4YY3Q 4LNQA 1FL0A 2RF4A 4GS3A 4QQBX 3ULLA 1JJ2A 2XGTA 4A3JG 3S1QH 4Y52H 3RZDH 2AWOA 4B3TQ 2B63G 2DUDA 5GAGC 5LMUL 4LF5L 2XTIA 4LUOA 3UDXA 4AIMA 1KIXA 4JG2A 3BZCA 1I6HH 1VQBA 2K50A 3NELA 2R7ZH 2JK8A 2JEBI 1M1KC 3GO5A 4A3GG 3NENA 1X3EA 1EUJA 4A3EG 4DNIA 3GTJH 2CKZB 4XIGS 4HJAA 4A3DG 4DR5Q 1I94Q 4LF8Q 3CCJA 1DGSA 3EN2A 4UP7A 1NJIC 1SROA 5GQOA 5IE8A 2JA7G 3T1HQ 2R7FA 4X66L 4A3LH 1HH2P 5LMNW 1VQIA 4IOCA 4GOPA 4PZ6A 4GLAC 3M4OH 1EIYB 2RHQB 4BY7H 3PUVA 4YCUA 4PZ7A 3KLWA 4DV3L 3PGZA 1MKHA 4JCVE 4GLXA 1Y1VH 1K83H 1Q46A 3UE0A 3I56A 1H95A 4HJ7A 1PA6A 3KF6B 4L5SA 4DR4Q 1T9HA 4DUYQ 4AH6A 1N8RC 1EOVA 1ASZA 2CCZA 3CQZH 2HIVA 5ELNA 3GTKH 4JI6Q 3J81c 1X54A 1Q81C 2ATWA 2N49A 1NTGA 2R7ZG 1SN8A 2PI2E 3JAMc 2RHSB 4C3HH 1NE3A 2OTJA 2UUCQ 3OYYA 3CMEA 4LF8L 2A1AA 1G51A 5IT9c 1L1OC 3ICEA 3RN2A 1J6QA 2Z6KC 1MJCA 4PMWA 1PH7A 1E1OA 3U4VA 3PF4A 2DGYA 3GDEA 4OO1G 1AE2A 2IHFA 4JBKA 2UUBQ 3CC2A 2R92H 3GTQH 4HIOA 4BY7G 4R1JA 2MO0A 1SRUA 2EXDA 1YHBA 1Y1VG 4DV6Q 3TQYA 3KFUA 1YITA 4DUYL 4IPHA 4JI2L 2UU9Q 3H3VH 3H15A 4KHZA 1EQQA 4DV7Q 1XNQQ 3RR5A 3G6EA 1KXLA 5IYDG 3I4NG 3PSIA 3S17H 2VUMG 1JT8A 5C4JH 1OXSC 4AYBE 3HKZG 3HKZE 2YTVA 3WWVA 3CCSA 2F4VQ 1PH4A 3KF6A 2QA4A 1HZCA 1L0WA 4LFAQ 4K0KL 1XMOL 4TQUS 4AQYL 3RN5A 3TS2A 1TWCH 1LYLA 4OO1I 4L5TA 1YVCA 2I5HA 3G48A 4IJLA 4YWMA 1S72A 4JI4Q 2Y0SE 3PUXA 2UUBL 2F3IA 3AFPA 1W3SA 2ZJQA 4JI5L 3M4PA 4UY8C 1VQJA 1FVIA 2OWOA 4DV5Q 2JA6G 4IFDG 4DV1Q 1GO3E 3G4SA 4DV6L 4MTNA 2UU9L 4A3KH 5HY6A 3K81C 2ZTCA 4X62Q 2MFIA 3CPWA 1WCMH 2OTLA 1BKBA 4R4CA 2EQSA 2CFMA 2PNHA 1PH2A 1VQHA 3CD6A 4GOPC 1N33Q 4C3IH 1YNXA 4JI7L 2F4VL 1U0LA 1QUQB 4GKJQ 3AQQA 1IBLL 1OTCA 4NXNL 1E7ZA 3AFQA 2E2IH 2UXCQ 4C3JH 1PH9A 1NBWA 3F1ZA 4B3MQ 5M3MH 1KHIA 2BA0A 1QZGA 1CKNB 4XTCS 1YHQA 3KOJA 3AEVA 1JMCA 1J5EL 1YHAA 4BBRG 2OQ0A 2ZTEA 3STBC 5LMUQ 3PO3G 1VQPA 3W1GA 3CCRA 2Z0SA 2QGQA 4IFDI 3PV0A 1PH6A 2VNUD 1UE5A 1PH8A 1VQ5A 4A76A 2LXKA 3T1YL 2HT1A 2JA8G 5C0XJ 3S1NH 4EX5A 5BR8L 3H3VI 1Z47A 2Q2HA 1E1TA 4A3KG 4JOIA 2K75A 4NB3A 1LTLA 2UXBL 2JE6I 2K4KA 2CWPA 1X65A 1KD1C 4JBMA 1N33L 3HOVG 4GKJL 1PYSB 3J80c 1Z9FA 2KHIA 3TS0A 2ES2A 3CP0A 3HOWG 2UXCL 2ZJRA 4JC0A 4LF9Q 4POGA 3I4MH 4Y7NH 4B3ML 4DR7L 1HZBA 5JEAG 2AWNA 1BBWA 2H5XA 4JI3L 5C4XH 1WJJA 3S15H 3S24A 1GKHA 4DV3Q 4APVA 3EBEA 3PUYA 2D62A 4QJFA 2YU9H 1QUQA 3E9HA 5IP9H 1QVFA 1Q12A 3EIVA 2AMCB 4A3MH 1U5KA 2KHJA 1KRSA 5IYCH 4C2MH 1X3FA 2NZHA 1CKNA 4X65Q 3NEMA 1CSQA 3J81j 1VQ8A 2I5LX 5GAHC 1PH3A 1UWVA 2I0QA 3K7UC 1GD7A 4L5QA 3CCQA 5FLXc 1Y1WH 4NXMQ 4R4OA 1HR0L 4A93G 1PVOA 2YYZA 4IPDA 1Q82C 4HJ5A 4LFBL 4UP8A 4DK6C 4LF6L 1EQRA 2ZJPA 4LF9L 1CUKA 1FJGL 3CCUA 4RMFA 1P16A 5JJLA 4IO9A 2VW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  2MO1 A;  5M3F H;  1HNX L;  4WJ4 A;  2A19 A;  2JQO A;  1S40 A;  3F2D A;  2Q2U A;  1XPO A;  3K7A H;  1XJV A;  2IX1 A;  3BJU A;  4JBJ A;  5JJK A;  4POF A;  3HOY H;  4GLV B;  4JI2 Q;  1ASY A;  4X65 L;  2N78 A;  2YV5 A;  1JJC B;  2A8V A;  3KDF B;  5IYC G;  1G6P A;  1A63 A;  4KI0 A;  1N36 L;  2VZA A;  4J15 A;  4NXM L;  4DK3 C;  3FP9 A;  2VQF Q;  5C3E H;  1VQO A;  1IBK L;  3OTO L;  4JI8 Q;  2FXQ A;  1A8V A;  1Q1E A;  4K0K Q;  1XMO Q;  3PUZ A;  1IBM Q;  4AQY Q;  4A3L G;  2ASB A;  1YEZ A;  4DV0 L;  2IX0 A;  2HHH L;  1JB7 A;  1Y14 B;  3HKS A;  3BZK A;  2PMZ E;  1BBU A;  1YJ9 A;  1XNR Q;  3AYH B;  4IJH A;  4JI5 Q;  3S14 H;  1I50 H;  2MQH A;  3VDY A;  3PIO A;  2VQE L;  4TVA B;  5C44 H;  5LMN Q;  3KJP A;  4LF4 L;  4KLK A;  3RLN A;  2JJQ A;  3H0G H;  4BA2 I;  2GVB A;  1YZ6 A;  4IPG A;  2JA9 A;  4JOI C;  1WFQ A;  3B6Y A;  1YJN A;  1KRT A;  3DM3 A;  2F52 A;  3HOZ H;  5K36 G;  1OXT A;  4O2D A;  1VQC A;  2VQF L;  1IL2 A;  4X6A H;  1D8L A;  1GVP A;  1SR3 A;  3L7Z C;  4JI8 L;  4JI7 Q;  3I7F A;  3GTM H;  2KBN A;  2CQO A;  5IY0 A;  4A75 A;  1SMX A;  1N34 Q;  1IBL Q;  4NXN Q;  2NZO A;  1IBM L;  4O0A A;  4HIM A;  1EWI A;  4X64 L;  1WI5 A;  4P74 A;  3KDF A;  2GN5 A;  4HIK A;  4JV5 Q;  3MXN B;  1XMQ L;  2JA5 H;  1J5E Q;  4P71 A;  1XNR L;  4ME3 A;  4JI1 L;  4IOA A;  1MJE A;  2B29 A;  2WB1 G;  5LMN L;  4A3C H;  4B3R Q;  3FHW A;  3PCO B;  4P73 A;  2R6G A;  3KJO A;  1AE3 A;  1HNZ Q;  3T1Y Q;  2HQL A;  1N32 Q;  3H0G G;  4OX9 Q;  4YWK A;  3UDG A;  5BR8 Q;  1C7Y A;  2LSS A;  1KQS A;  1JE5 A;  4UP9 A;  1KL9 A;  5E7N A;  2VY3 A;  1PYB A;  4JYA Q;  2UXB Q;  3L2P A;  3J81 i;  4BXX H;  4YHH L;  1VQF A;  3JAM i;  4DAY B;  4HID A;  4A3I H;  1N34 L;  1EYG A;  1HNW Q;  3TEH B;  2LXJ A;  4P75 A;  1X55 A;  3CW2 C;  5GAE C;  4DR7 Q;  1E22 A;  3E0E A;  2E2H H;  2C35 B;  4GKK L;  4DR3 Q;  2I5M X;  2UUA Q;  4JI3 Q;  5HGQ A;  2KCT A;  4JV5 L;  2N8N A;  1TWA H;  4LFC Q;  4RG1 A;  1HZA A;  2JA5 G;  4OXP A;  4DUZ Q;  1IXR A;  1UE6 A;  4NPS A;  3D31 A;  1PV4 A;  1VQ9 A;  1X56 A;  4B3R L;  1E24 A;  1YI2 A;  1HNZ L;  4GN4 B;  1S3O A;  1V43 A;  3PUW A;  3PO2 H;  4A3C G;  2ID0 A;  4DPG A;  4R4T A;  2E5L L;  1N32 L;  4OX9 L;  5IYB H;  4OWW B;  4FDB A;  5IWA Q;  3CCM A;  1RL2 A;  4YCV A;  4LF7 L;  1C0A A;  2R7D A;  1XPR A;  4DV4 L;  1IZ6 A;  1WCM G;  2RCN A;  5ELO A;  5FJ8 H;  4JYA L;  1HR0 Q;  4DR1 L;  3M85 A;  3LGJ A;  3A0J A;  1SE8 A;  4LFB Q;  1HNW L;  3KYH C;  4LF6 Q;  4B3S L;  3TRE A;  4A3I G;  2NVX H;  1VQL A;  3CCL A;  1FJG Q;  3CC4 A;  1B8A A;  4DR3 L;  2UUA L;  4P72 A;  1K73 C;  5M3M G;  4LFC L;  3STB D;  1HNX Q;  5JEA J;  5C0X G;  4DR6 L;  1MIU A;  4DUZ L;  2QEX A;  3M4Q A;  3MEF A;  2CWA A;  3CXC A;  4A3E H;  2ZM6 Q;  3PF5 A;  3F2C A;  2OCE A;  4LUV A;  1TWH H;  2AHO B;  2PQA B;  1JJG A;  5IWA L;  2NN6 G;  1G29 1;  1C9O A;  1SFO H;  5IYB G;  1N36 Q;  5M5W H;  2B3G A;  2L15 A;  4PG3 A;  3ULJ A;  1NMF A;  1IBK Q;  3OTO Q;  2YTY A;  5FJ8 G;  4DR2 L;  2OQK A;  3I4O A;  2KEN A;  3I55 A;  3RLO A;  2JEA I;  3IRB A;  2R93 H;  1Q86 C;  4WJ3 M;  3I4M G;  4DV0 Q;  5C0X I;  2HHH Q;  3K0X A;  3W1B A;  5IYD H;  1HJP A;  4QIW E;  3CCE A;  5C4X G;  1V9P A;  3F2B A;  4OWX B;  2VQE Q;  2WAQ G;  4LF4 Q;  1P8L A;  2WAQ E;  1LUZ A;  3HOX H;  2ZM6 L;  3S2D H;  3GTG H;  2NN6 I;  5IP9 G;  4QGU A;  3TRZ A;  4A3M G;  3PIP A;  4LUZ A;  1VQM A;  1NY4 A;  3NBH B;  1X3G A;  3A5U A;  4A3F H;  1VQN A;  2WFW A;  1TWF H;  1K8G A;  1E3P A;  1OXX K;  2MNA A;  3DLL A;  3KF8 B;  3A74 A;  4GN5 A;  4YY3 L;  1Y1W G;  1VQE A;  4JI0 Q;  1CKM A;  1VCI A;  2PQA A;  1QVG A;  4X64 Q;  4R4I A;  2AKW B;  4B3T L;  3M9B A;  5EAY A;  3ERS X;  3J80 i;  4BY1 H;  1B70 B;  2VL6 A;  1VS0 A;  1XMQ Q;  2R93 G;  3S16 H;  2NVQ H;  4R4Q A;  1VQK A;  4JI1 Q;  5J3B A;  3UDF A;  5M3F G;  1K9M C;  1VQ6 A;  4DKA C;  3I4N H;  2VUM H;  5JJI A;  3A5Z B;  1UE7 A;  2K5V A;  1PHJ A;  3U4Z A;  3HOX G;  3CPF A;  4KHP Q;  4DR5 L;  1UE1 A;  1I94 L;  3HOY G;  2IY5 B;  3CF5 A;  2KCM A;  4GN3 B;  1OXV A;  4GNX C;  3T1H L;  4A3F G;  1HZ9 A;  3J7Z C;  2BH2 A;  1K3R A;  1KC8 C;  3UE1 A;  2V1C C;  4YHH Q;  5C3E G;  1WOC A;  4HJ8 A;  2E8G A;  4JI0 L;  3I2Z A;  1NMG A;  1Q1B A;  4OWT B;  2GVA A;  5DLQ E;  3RLF A;  2EIF A;  1W2B A;  1X9N A;  3ZJY C;  1D7Q A;  2ZTD A;  4GKK Q;  1A0I A;  1Q8K A;  2Q2T A;  2JA6 H;  1VQD A;  3E9I A;  3M3Y H;  4LW1 A;  5IP7 H;  4BY1 G;  1IYJ B;  2N3S A;  2K14 A;  4DR4 L;  4UPA A;  4BBS H;  2WB1 E;  2IT1 A;  1V1Q A;  2Q2I A;  4JBW A;  4GNX B;  1L1O B;  4JI6 L;  2R92 G;  5H1S E;  5C44 G;  4OON A;  4BA1 I;  2E5L Q;  2UXD Q;  4IFD J;  4KHP L;  3JC6 6;  5AJ3 Q;  1LM0 A;  2UUC L;  4LF7 Q;  4AYB G;  1YBY A;  3ULP A;  4L5R C;  4DV4 Q;  1L2F A;  3HOZ G;  4H02 A;  4DAM A;  4MNO A;  3RZO H;  1VQG A;  4DR1 Q;  1VQ7 A;  1I5F A;  1EIF A;  3K80 C;  3CC7 A;  4EQ5 A;  1Q7Y C;  4PZ8 A;  4BBR H;  4B3S Q;  3PO3 H;  3L0O A;  2HIX A;  2Y0S G;  3W5O A;  4A4I A;  5GRO A;  1RIP A;  2BH8 A;  1UEB A;  2E2J H;  3J7A 5;  1XTD A;  3ER0 A;  2WP8 J;  1PH5 A;  2JA8 H;  1N9W A;  4YWL A;  1O7I A;  2D0P A;  1YJW A;  1HR0 W;  4DR6 Q;  3D0F A;  1XPU A;  1K0R A;  3Q8D A;  5IP7 G;  3RNU A;  1A62 A;  3S1R H;  1TWG H;  2YTX A;  3HOU H;  3F8T A;  5FLM H;  4DV7 L;  1R9T H;  1XNQ L;  4BBS G;  1KAW A;  2UXD L;  5M5Y H;  4HJ9 A;  3GTO H;  3UDI A;  3HOV H;  3M7N A;  1CKO A;  1FGU A;  3FKI H;  5AJ3 L;  2K5N A;  3HOW H;  3S2H H;  4A3B H;  1OXU A;  3G71 A;  1VQA A;  1WYD A;  3OW2 A;  2NVY H;  4LFA L;  4DV2 Q;  1B7Y B;  3CAM A;  4A3J H;  4DR2 Q;  4GNX A;  1L1O A;  4BXX G;  3CMA A;  2K52 A;  2Z6K A;  2B63 H;  3GTP H;  1TXY A;  1BVS A;  2BA1 A;  4JI4 L;  3HFZ B;  3U50 C;  5GAD C;  3GTL H;  1AH9 A;  1PH1 A;  4LF5 Q;  3U58 A;  1I3Q H;  3K8A A;  4LWC A;  1X6O A;  1SLJ A;  4QL5 A;  4DV5 L;  2D0O A;  2ALY B;  4DV1 L;  1VQ4 A;  1EFW A;  1CSP A;  1YIJ A;  4A3G H;  4MZ9 A;  3CCV A;  2NVT H;  4QY7 A;  1M90 C;  4ALP A;  4GOP B;  4YCW A;  2IHE A;  4X62 L;  3SGI A;  4A3D H;  2VS1 A;  3HOU G;  1QZH A;  5FLM G;  3BU2 A;  4A93 H;  3PO2 G;  2JA7 H;  3S1M H;  2K5H A;  4IPC A;  3GD7 A;  3FKI G;  1K8A C;  1PFS A;  4X66 Q;  5M5X H;  1GM5 A;  4A3B G;  4DV2 L;  1QVC A;  4YY3 Q;  4LNQ A;  1FL0 A;  2RF4 A;  4GS3 A;  4QQB X;  3ULL A;  1JJ2 A;  2XGT A;  4A3J G;  3S1Q H;  4Y52 H;  3RZD H;  2AWO A;  4B3T Q;  2B63 G;  2DUD A;  5GAG C;  5LMU L;  4LF5 L;  2XTI A;  4LUO A;  3UDX A;  4AIM A;  1KIX A;  4JG2 A;  3BZC A;  1I6H H;  1VQB A;  2K50 A;  3NEL A;  2R7Z H;  2JK8 A;  2JEB I;  1M1K C;  3GO5 A;  4A3G G;  3NEN A;  1X3E A;  1EUJ A;  4A3E G;  4DNI A;  3GTJ H;  2CKZ B;  4XIG S;  4HJA A;  4A3D G;  4DR5 Q;  1I94 Q;  4LF8 Q;  3CCJ A;  1DGS A;  3EN2 A;  4UP7 A;  1NJI C;  1SRO A;  5GQO A;  5IE8 A;  2JA7 G;  3T1H Q;  2R7F A;  4X66 L;  4A3L H;  1HH2 P;  5LMN W;  1VQI A;  4IOC A;  4GOP A;  4PZ6 A;  4GLA C;  3M4O H;  1EIY B;  2RHQ B;  4BY7 H;  3PUV A;  4YCU A;  4PZ7 A;  3KLW A;  4DV3 L;  3PGZ A;  1MKH A;  4JCV E;  4GLX A;  1Y1V H;  1K83 H;  1Q46 A;  3UE0 A;  3I56 A;  1H95 A;  4HJ7 A;  1PA6 A;  3KF6 B;  4L5S A;  4DR4 Q;  1T9H A;  4DUY Q;  4AH6 A;  1N8R C;  1EOV A;  1ASZ A;  2CCZ A;  3CQZ H;  2HIV A;  5ELN A;  3GTK H;  4JI6 Q;  3J81 c;  1X54 A;  1Q81 C;  2ATW A;  2N49 A;  1NTG A;  2R7Z G;  1SN8 A;  2PI2 E;  3JAM c;  2RHS B;  4C3H H;  1NE3 A;  2OTJ A;  2UUC Q;  3OYY A;  3CME A;  4LF8 L;  2A1A A;  1G51 A;  5IT9 c;  1L1O C;  3ICE A;  3RN2 A;  1J6Q A;  2Z6K C;  1MJC A;  4PMW A;  1PH7 A;  1E1O A;  3U4V A;  3PF4 A;  2DGY A;  3GDE A;  4OO1 G;  1AE2 A;  2IHF A;  4JBK A;  2UUB Q;  3CC2 A;  2R92 H;  3GTQ H;  4HIO A;  4BY7 G;  4R1J A;  2MO0 A;  1SRU A;  2EXD A;  1YHB A;  1Y1V G;  4DV6 Q;  3TQY A;  3KFU A;  1YIT A;  4DUY L;  4IPH A;  4JI2 L;  2UU9 Q;  3H3V H;  3H15 A;  4KHZ A;  1EQQ A;  4DV7 Q;  1XNQ Q;  3RR5 A;  3G6E A;  1KXL A;  5IYD G;  3I4N G;  3PSI A;  3S17 H;  2VUM G;  1JT8 A;  5C4J H;  1OXS C;  4AYB E;  3HKZ G;  3HKZ E;  2YTV A;  3WWV A;  3CCS A;  2F4V Q;  1PH4 A;  3KF6 A;  2QA4 A;  1HZC A;  1L0W A;  4LFA Q;  4K0K L;  1XMO L;  4TQU S;  4AQY L;  3RN5 A;  3TS2 A;  1TWC H;  1LYL A;  4OO1 I;  4L5T A;  1YVC A;  2I5H A;  3G48 A;  4IJL A;  4YWM A;  1S72 A;  4JI4 Q;  2Y0S E;  3PUX A;  2UUB L;  2F3I A;  3AFP A;  1W3S A;  2ZJQ A;  4JI5 L;  3M4P A;  4UY8 C;  1VQJ A;  1FVI A;  2OWO A;  4DV5 Q;  2JA6 G;  4IFD G;  4DV1 Q;  1GO3 E;  3G4S A;  4DV6 L;  4MTN A;  2UU9 L;  4A3K H;  5HY6 A;  3K81 C;  2ZTC A;  4X62 Q;  2MFI A;  3CPW A;  1WCM H;  2OTL A;  1BKB A;  4R4C A;  2EQS A;  2CFM A;  2PNH A;  1PH2 A;  1VQH A;  3CD6 A;  4GOP C;  1N33 Q;  4C3I H;  1YNX A;  4JI7 L;  2F4V L;  1U0L A;  1QUQ B;  4GKJ Q;  3AQQ A;  1IBL L;  1OTC A;  4NXN L;  1E7Z A;  3AFQ A;  2E2I H;  2UXC Q;  4C3J H;  1PH9 A;  1NBW A;  3F1Z A;  4B3M Q;  5M3M H;  1KHI A;  2BA0 A;  1QZG A;  1CKN B;  4XTC S;  1YHQ A;  3KOJ A;  3AEV A;  1JMC A;  1J5E L;  1YHA A;  4BBR G;  2OQ0 A;  2ZTE A;  3STB C;  5LMU Q;  3PO3 G;  1VQP A;  3W1G A;  3CCR A;  2Z0S A;  2QGQ A;  4IFD I;  3PV0 A;  1PH6 A;  2VNU D;  1UE5 A;  1PH8 A;  1VQ5 A;  4A76 A;  2LXK A;  3T1Y L;  2HT1 A;  2JA8 G;  5C0X J;  3S1N H;  4EX5 A;  5BR8 L;  3H3V I;  1Z47 A;  2Q2H A;  1E1T A;  4A3K G;  4JOI A;  2K75 A;  4NB3 A;  1LTL A;  2UXB L;  2JE6 I;  2K4K A;  2CWP A;  1X65 A;  1KD1 C;  4JBM A;  1N33 L;  3HOV G;  4GKJ L;  1PYS B;  3J80 c;  1Z9F A;  2KHI A;  3TS0 A;  2ES2 A;  3CP0 A;  3HOW G;  2UXC L;  2ZJR A;  4JC0 A;  4LF9 Q;  4POG A;  3I4M H;  4Y7N H;  4B3M L;  4DR7 L;  1HZB A;  5JEA G;  2AWN A;  1BBW A;  2H5X A;  4JI3 L;  5C4X H;  1WJJ A;  3S15 H;  3S24 A;  1GKH A;  4DV3 Q;  4APV A;  3EBE A;  3PUY A;  2D62 A;  4QJF A;  2YU9 H;  1QUQ A;  3E9H A;  5IP9 H;  1QVF A;  1Q12 A;  3EIV A;  2AMC B;  4A3M H;  1U5K A;  2KHJ A;  1KRS A;  5IYC H;  4C2M H;  1X3F A;  2NZH A;  1CKN A;  4X65 Q;  3NEM A;  1CSQ A;  3J81 j;  1VQ8 A;  2I5L X;  5GAH C;  1PH3 A;  1UWV A;  2I0Q A;  3K7U C;  1GD7 A;  4L5Q A;  3CCQ A;  5FLX c;  1Y1W H;  4NXM Q;  4R4O A;  1HR0 L;  4A93 G;  1PVO A;  2YYZ A;  4IPD A;  1Q82 C;  4HJ5 A;  4LFB L;  4UP8 A;  4DK6 C;  4LF6 L;  1EQR A;  2ZJP A;  4LF9 L;  1CUK A;  1FJG L;  3CCU A;  4RMF A;  1P16 A;  5JJL A;  4IO9 A;  2VW9 A; 
#chains in the Genus database with same CATH topology
 5M3F H;  1VMC A;  2A19 A;  3MZ5 A;  3GTM B;  3F2D A;  2L11 A;  3BJU A;  4G57 A;  3VA7 A;  1SEB D;  2SDF A;  1ASY A;  2RA4 A;  3FDT A;  4X65 L;  2N78 A;  2A8V A;  1G6P A;  1A63 A;  4KHV A;  1RDP D;  2CH4 W;  2VZA A;  4DK3 C;  5C3E H;  1U4M A;  3K58 A;  1VQO A;  3OTO L;  4IQZ A;  1GUS A;  1Q1E A;  2EY2 A;  4AQY Q;  4CKB A;  5LHY 1;  2QEJ C;  2HHH L;  2DN8 A;  2F0G A;  1XNR Q;  5G3L D;  5JOB A;  3AYH B;  1I50 H;  2VQE L;  2R92 H;  3KJP A;  3I73 A;  4KY6 A;  3KLS A;  3HOZ H;  3URY A;  2VQF L;  2KED A;  1ESF A;  5I6Y A;  1AFP A;  3BVG A;  4NXN Q;  5NUC A;  4X64 L;  4P74 A;  3KDF A;  4KJO A;  4JV5 Q;  2JA5 H;  4QUC A;  4A3J B;  1J5E Q;  4P71 A;  2EYO A;  2BE5 C;  1B9M A;  1E0B A;  5COY A;  1MJE A;  2B29 A;  4A3C H;  5LMN L;  1S4Z A;  3PCO B;  4N8X 1;  2EE1 A;  3SK4 A;  2Q8I B;  3T1Y Q;  2HQL A;  4IUQ A;  4YWK A;  5HUR A;  5BR8 Q;  1JE5 A;  5EKL A;  2K7V A;  1B4O A;  5EQ0 A;  2ZXR A;  5D3D A;  3P20 A;  1VQF A;  3JAM i;  1Z7T A;  2XN9 C;  4A3I H;  4HID A;  4P2C B;  2LXJ A;  1SFO B;  1MSG A;  1DD2 A;  1LTB D;  1E22 A;  5M5W B;  2C35 B;  2K03 A;  3VR5 A;  2EY5 A;  2I5M X;  4GKK L;  4K8J A;  5FO9 B;  4DUZ Q;  4B9W A;  1QIL A;  4ZLT F;  3Q0A A;  5KNC A;  1WTW A;  1C48 A;  1HNZ L;  1FNW A;  3PUW A;  3PO2 H;  1H9J A;  1LTT D;  2PQE A;  4OX9 L;  5IWA Q;  3MXN A;  1OO9 B;  1XPR A;  3E0J A;  3G6J B;  4DV4 L;  2RCN A;  5FJ8 H;  3PQI A;  1GUT A;  1HNW L;  4CHT B;  3C3L A;  2NWG A;  1TS4 A;  4B3S L;  3TRE A;  2G9D A;  2EXZ A;  3ITP A;  4DAV A;  4DR3 L;  4P72 A;  3NQI A;  4XT1 B;  4J8Q A;  2QEX A;  3M4Q A;  3MEF A;  2CWA A;  4A3E H;  2MGS A;  1S5C D;  3PF5 A;  3F2C A;  1TWH H;  2F3V A;  2PQA B;  2HCC A;  1S5B D;  5IYB G;  4X3T A;  3A7L A;  2YTY A;  4C3H B;  4G4K A;  3U9S A;  1EYC A;  3I4O A;  3MXG A;  2JEA I;  3T13 A;  1TS3 A;  3MHB A;  1Q86 C;  3W1B A;  2A69 D;  1PRT B;  2AQ3 B;  3DXJ C;  4OWX B;  2PZU A;  2WAQ G;  4LF4 Q;  1ICW A;  2A6E C;  5IP9 G;  3TRZ A;  1R4P B;  4TSS A;  4LUZ A;  5G3L F;  2RVL A;  5DM7 3;  2WFW A;  1II3 A;  1K8G A;  3CRL C;  4B9X A;  3A74 A;  5T1I A;  1BXT A;  1DYQ A;  1DM0 B;  1CKM A;  3NP8 A;  4R4I A;  4QB4 A;  5EAY A;  3I90 A;  5JJZ A;  3J80 i;  4BY1 H;  2NVQ H;  4KD3 A;  4R4Q A;  4WOR A;  1BCP B;  4HMI A;  5J3B A;  4JI1 Q;  3UDF A;  1GOZ A;  1NR2 A;  2K5Q A;  2KJX A;  2JA8 B;  3D4R A;  1I94 L;  2DJF C;  1HUN A;  3OHX C;  4A3F G;  4C1N I;  1HZ9 A;  2Z6B A;  1STE A;  1R9T B;  1I4H A;  1DOM A;  2D9U A;  2I46 A;  4WJW A;  4YHH Q;  2F0L A;  4V19 0;  4FO2 A;  3GTO B;  1WOC A;  4HJ8 A;  3FKI B;  3I2Z A;  1NMG A;  3IFT A;  4WFN 3;  1SMY D;  5DLQ E;  2J4X A;  3I72 A;  4ME5 A;  1Q8K A;  2JA6 H;  3M3Y H;  3CRK C;  3KF8 A;  1IYJ B;  1EFI D;  1DOL A;  2N3S A;  1JC7 A;  4BBS H;  1V1Q A;  4BA1 I;  4HR7 B;  1WVL A;  2E5L Q;  2UXD Q;  4KHP L;  3JC6 6;  2QKI C;  1L2F A;  1LTR D;  4H02 A;  4DAM A;  4MNO A;  3RZO H;  1VQG A;  4J6H A;  3CC7 A;  3V2T A;  3TZD A;  1SJH D;  3PO3 H;  3J7A 5;  1PH5 A;  3MTS A;  3A8I E;  2TMP A;  3S1R H;  4N9T A;  5J39 A;  1U4P A;  2YTX A;  2MJ8 A;  5FLM H;  1CHQ D;  5JVG 3;  4DV7 L;  4DXF A;  1KAW A;  2NTT A;  5M5Y H;  4HJ9 A;  3HOV H;  3M7N A;  1FGU A;  4MTK A;  3HOW H;  5ELF A;  3S2H H;  3OW2 A;  4HMJ A;  1O7Z A;  2KCN A;  4LFA L;  4DV2 Q;  3CAM A;  3PIO 3;  1L1O A;  2K52 A;  1BVS A;  3GTL H;  4JI4 L;  1PH1 A;  1Q3L A;  1BUV T;  1H9K A;  3K8A A;  4LWC A;  4DV5 L;  4DV1 L;  1VQ4 A;  3C1F A;  4MZ9 A;  3CCV A;  4QY7 A;  1M90 C;  4ALP A;  2B2W A;  4YCW A;  4X62 L;  2LFN A;  1K83 B;  4QF4 A;  2K5H A;  3FKI G;  3K59 A;  2K5D A;  5M5X H;  4EGV A;  3DHQ A;  1JCK B;  3S1Q H;  3NTK A;  4PMC A;  2H1E A;  3H3V C;  3RZD H;  2AWO A;  3HG9 A;  5LMU L;  2XTI A;  4LUO A;  3UDX A;  4ZYS A;  4AIM A;  4JG2 A;  3OIP A;  5IIF A;  2R7Z H;  4IZ8 A;  3AB9 A;  4A3G G;  1I50 B;  3GTJ H;  2CKZ B;  1TVX A;  4RKL A;  5EBD A;  4CGY B;  3P7J A;  2F0E A;  4LF8 Q;  2XIW A;  1RJT A;  5GQO A;  5IE8 A;  2KCC A;  4X66 L;  1F9S A;  1IW7 D;  3OW7 A;  4XQJ A;  1G2S A;  1SBB B;  3EVQ A;  3SE0 A;  3PGZ A;  2ZT9 C;  1Y1V H;  3KF6 B;  1HFG A;  1B53 A;  4DUY Q;  5LL6 S;  4AH6 A;  2A6E D;  3GTK H;  2CCZ A;  5IYD H;  2EYF A;  1Q81 C;  3HEJ A;  2PI2 E;  1NE3 A;  3CME A;  1L1O C;  3V96 A;  3E6Z X;  4A3K B;  2HCI A;  3DWP A;  1PH7 A;  1E1O A;  1STB A;  2JYO A;  3TME A;  3U4V A;  4OO1 G;  1FYC A;  2O4X A;  2UUB Q;  4H44 C;  2B2W C;  2F0O A;  1DJR D;  1YHB A;  4DV6 Q;  2F0V A;  2UU9 Q;  4KHZ A;  2L12 A;  2KUM A;  3E5S A;  3SEB A;  3I4N G;  4CJ2 C;  2VUM G;  1F9Q A;  1JT8 A;  3NXW A;  4ZUJ A;  5D14 A;  1OXS C;  4HSV A;  3HKZ E;  3CCS A;  4I65 A;  2QA4 A;  2R61 A;  4AQY L;  3TS2 A;  4OO1 I;  1TWC H;  3AMU A;  1YVC A;  1KTK A;  2PCF B;  1QE6 A;  2BDN A;  3G48 A;  1CHP D;  1F2Z A;  1PFM A;  2LMC B;  4Y7N B;  2ZXO A;  2RCF A;  5DEH A;  3I70 A;  3IAY A;  1LAB A;  5FOB B;  2SOB A;  5HY6 A;  1EQT A;  2OTL A;  4R4C A;  1PH2 A;  2FJ2 A;  4GKJ Q;  1U0L A;  1QUQ B;  4NXN L;  1E7Z A;  2UXC Q;  2FMM A;  3A7A B;  4C3J H;  1PH9 A;  2K33 A;  1QZG A;  1CKN B;  4KY5 A;  1PRT F;  5IGD A;  1WD1 A;  1JMC A;  1J5E L;  2EJF C;  1O78 A;  3STB C;  2VNU D;  2L1B A;  4HSP A;  3CCR A;  3PV0 A;  1PH6 A;  4A76 A;  2LXK A;  3NQT A;  3T1Y L;  2HT1 A;  3S1N H;  3T56 B;  4N9P A;  5JAV A;  5BR8 L;  3H3V I;  1PTO C;  3C1E A;  2Q2H A;  3K7A B;  4A3K G;  2JE6 I;  1QJO A;  2CWP A;  3OOC A;  1N33 L;  3HOY B;  3QR8 A;  1ML0 D;  4I7Z C;  5CGK A;  4OL7 A;  4C3I G;  4JC0 A;  1SE4 A;  1IHZ A;  5KND A;  1HZB A;  2RDG A;  5JEA G;  2AWN A;  1UUP A;  2CVR A;  1YNJ C;  1WJJ A;  4L8J A;  4APV A;  1SYB A;  4DV3 Q;  2JP1 A;  3D8G A;  5IP9 H;  1RKN A;  2AMC B;  1D5M C;  4BY1 B;  4L63 B;  4C2M H;  1X3F A;  2NVQ B;  3K0Y A;  2I07 B;  2XWJ B;  1UWV A;  1LAC A;  3A54 A;  1QOH A;  1STH A;  5C44 B;  5F2D A;  1PVO A;  2YYZ A;  4IPD A;  4RA8 A;  1HXY D;  1F2M A;  4UP8 A;  4LF9 L;  5I9P A;  3CCU A;  1KDB A;  1P16 A;  5JJL A;  4IO9 A;  2MO1 A;  2JQO A;  3OMG A;  2L9H A;  2X6G A;  5TSS A;  3ND9 A;  2YV5 A;  5IYC G;  4KI0 A;  4FXK C;  4J15 A;  4KY7 A;  1CZW A;  2O5J C;  3FVQ A;  3NHH A;  4Q5V A;  1YEZ A;  1S5D D;  1GUN A;  1STA A;  3HKS A;  3BZK A;  2PMZ E;  3FMC A;  4JI5 Q;  5D3I B;  2MQH A;  3VDY A;  2KEE A;  1QNU A;  4LF4 L;  4KLK A;  3RLN A;  3A56 A;  3N52 A;  4IPG A;  1TWA B;  2CW0 D;  3DM3 A;  2F52 A;  5K36 G;  4O2D A;  3R93 A;  5CV9 A;  4KKT A;  1D8L A;  4JI8 L;  5IY0 A;  1N34 Q;  1EL0 A;  4FNF A;  1IBM L;  1JE4 A;  1HA6 A;  1WI5 A;  1L0Y B;  2GN5 A;  1TT2 A;  1D1I A;  4TKO B;  4ME3 A;  4JI1 L;  1ENF A;  2A6H D;  2NVX B;  3KJO A;  1ILQ A;  3H0G G;  3K5N A;  5D65 A;  1C7Y A;  1I6V C;  4M1U B;  2VY3 A;  1PYB A;  2WKD A;  3TBI B;  4JYA Q;  3L2P A;  4YHH L;  1SYE A;  3LNN A;  4DAY B;  2PZW A;  3OMC A;  1EYG A;  3P1H A;  3TEH B;  4P75 A;  4IUV A;  2QDB A;  4DF7 A;  4CBV A;  3E0E A;  2E2H H;  3ONA B;  4JI3 Q;  4RG1 A;  2F03 A;  1HZA A;  1GUO A;  1AW7 A;  1IXR A;  1PV4 A;  1VQ9 A;  3RZD B;  4B3R L;  3BDO A;  1TQO A;  1V43 A;  3MXU A;  2E5L L;  1N32 L;  2XRS D;  1EIG A;  3CCM A;  1RL2 A;  2R7D A;  3WOF A;  2R7Z B;  5C4H A;  3HOX B;  5KIX A;  3S2D B;  1HR0 Q;  5KEE A;  3AU7 A;  1TWF B;  1VQL A;  1FJG Q;  1LV9 A;  1B8A A;  1KAB A;  2UUA L;  1K73 C;  3P75 A;  4LFC L;  1JB3 A;  3STB D;  5JEA J;  5C0X G;  1HNX Q;  4OEM B;  1MIU A;  1G6Z A;  5E1F A;  4RGT A;  2Z4H A;  5BN3 A;  4H7B A;  4LUV A;  2AHO B;  1PTO D;  1F9P A;  1Y1V B;  1JJG A;  2B3G A;  1EEF D;  3ND8 A;  3OSO A;  4F87 A;  4XT3 B;  4XDX A;  2VXW A;  3RLO A;  3IRB A;  2R93 H;  1K28 A;  5C0X I;  2EJM A;  1ICF B;  4LMQ D;  4QIW E;  3J7A V;  5C4X G;  3F2B A;  2WAQ E;  1LUZ A;  2B2U A;  2ZM6 L;  1XYI A;  3GTG H;  2AUK A;  1RD9 D;  3NE5 B;  3GQB A;  4A3M G;  4UHV A;  1SNP A;  3C2P A;  3A5U A;  1VQN A;  2ENB A;  2MNA A;  1LO5 D;  4R8I A;  2F0P A;  1Y1W G;  4KN4 C;  1VQE A;  2OT2 A;  2PQA A;  1GHK A;  2AKW B;  1L0X B;  3NUC A;  1JWU D;  1XMQ Q;  3S16 H;  2A68 C;  1GUG A;  4BBR B;  1I4G A;  4XYO A;  1ZEQ X;  3I4N H;  2VUM H;  5AFW A;  3A5Z B;  2K5V A;  2E2J B;  4IUT A;  3HOX G;  1AP0 A;  4DFA A;  5I2X A;  2IY5 B;  3CF5 A;  5CV6 A;  1XXG A;  1K8O A;  3HOU B;  3J7Z C;  2BH2 A;  1KC8 C;  3UE1 A;  2V1C C;  4JI0 L;  2E8G A;  1T5E A;  1Q1B A;  1D7Q A;  1W2B A;  1X9N A;  2ZTD A;  2B8G A;  1O80 A;  4PMB A;  2Q2T A;  3E9I A;  3SK6 A;  4C3J B;  2F0W A;  4MIU A;  2V4D A;  2K14 A;  2B63 B;  3GTP B;  4UPA A;  2WB1 E;  1MI2 A;  4JBW A;  5H1S E;  4OON A;  1I3Q B;  3VYU A;  1G91 A;  5AJ3 Q;  3D6C A;  1YBY A;  3ULP A;  2NVT B;  1D2B A;  1KDC A;  3CKI B;  4A3D B;  5BN4 A;  1I5F A;  2F3W A;  3X3N A;  4A93 B;  5IGC A;  5IGB A;  2HIX A;  1RTN A;  4H0L C;  2BH8 A;  4NP5 A;  1V1P B;  3ER0 A;  4YWL A;  4DR6 Q;  2B2U C;  1HR0 W;  3D0F A;  3J81 L;  1K0R A;  3RNU A;  5IP7 G;  1TWG H;  3F8T A;  3RMH A;  1BQQ T;  1W6K A;  4OGQ C;  2K5N A;  4A3B H;  1VQA A;  1WYD A;  5I2Y A;  2NVY H;  3MFY A;  5JEA H;  2NZ1 D;  1C4Q A;  5ELD A;  4BXX G;  5KNB A;  2F0S A;  1TXY A;  2K6A A;  4RFB A;  5FKA C;  2WII B;  2BA1 A;  3HFZ B;  1JQY D;  4LF5 Q;  1EFW A;  2F0N A;  4IUN A;  1YIJ A;  1A3T A;  4BY7 B;  1KNE A;  2HUG A;  2VS1 A;  4K5X A;  3HOU G;  1PRT C;  3NPP A;  2JA7 H;  3S1M H;  3NBI A;  2L55 A;  1PFS A;  3MXP A;  3CQZ B;  1GM5 A;  1QVC A;  4YY3 Q;  2RF4 A;  4GS3 A;  4A3J G;  2B2T A;  1E2W A;  4B3T Q;  2B63 G;  4ZRZ A;  5GAG C;  2M9V A;  4GZY C;  2EYM A;  1KIX A;  1AEX A;  1I6H H;  3KUP A;  2FMC A;  3GO5 A;  4E6I A;  2WB1 B;  3GTQ B;  2PW7 A;  3SK5 A;  3VA5 A;  1A3U A;  2D5D A;  4ODG A;  3BYY B;  1BCP C;  4A3D G;  4DR5 Q;  3CCJ A;  1DGS A;  3EN2 A;  3V05 A;  1D5X C;  4K8I A;  3T1H Q;  2R7F A;  4ZKB B;  1HH2 P;  3MAQ A;  5C4J B;  1CM9 A;  2EYH A;  2CQA A;  1WTV A;  5KYL A;  4N8F A;  4DV3 L;  4JCV E;  3JAM E;  4GLX A;  1Q46 A;  4CJ0 B;  3HRZ C;  1T9H A;  1N8R C;  5IT9 E;  4IUP A;  5ELN A;  4JI6 Q;  3J81 c;  1NTG A;  2K28 A;  1NUC A;  2UUC Q;  1G51 A;  1NNX A;  3EFX D;  4ZAI A;  3QWN A;  1VF5 C;  1WCM B;  4HED A;  1PTO H;  1SXT A;  3PF4 A;  1CI3 M;  5BN5 A;  1AE2 A;  3CC2 A;  4HIO A;  4BY7 G;  1SRU A;  1RCV D;  5M3M B;  2E2H B;  4OHJ A;  4G7Z C;  1YIT A;  2LY7 A;  3H15 A;  1Q90 A;  1XNQ Q;  1HCZ A;  4RCO A;  3BS1 A;  1ENA A;  1LTA D;  4C3H G;  1EY7 A;  4AYB E;  2F4V Q;  3D3R A;  4PQX A;  3KF6 A;  1TY0 A;  2BCO A;  1WTX A;  1S5E D;  4U68 A;  3RN5 A;  2B2T C;  5J22 A;  2WIN B;  2QW7 A;  4YWM A;  1HPC A;  2Y0S E;  2F3I A;  1Z6H A;  1W3S A;  2ZJQ A;  4JI5 L;  3G7L A;  1VQJ A;  3I4M B;  2BE5 D;  2PYK A;  4J1M A;  1EQV A;  2VB3 X;  4IFD G;  2PPB C;  4KKU A;  5CC4 A;  2MFI A;  4UDU C;  2OXP A;  5FK9 C;  4Z9C B;  2EQS A;  2CFM A;  2PNH A;  3UI2 A;  3CD6 A;  1V8Q A;  1YNX A;  3OPO A;  3PMF A;  3AQQ A;  2E2I H;  4FXD A;  4B3M Q;  3F1Z A;  2PNR C;  4G7H C;  2RBM A;  1VQP A;  3W1G A;  1WTR A;  4IFD I;  1PH8 A;  2R93 B;  2JA8 G;  5M3F B;  3A8J E;  3J80 E;  1Z47 A;  1PFN A;  3VR2 A;  4JOI A;  4G7O C;  2BOS A;  3MWY W;  3OWE B;  4NB3 A;  4MHE A;  1IYV A;  5L37 A;  1KD1 C;  4JBM A;  4ABN A;  2ZJR A;  1ET9 A;  1PZK D;  5C3E B;  1TU2 B;  2F0I A;  4EVO A;  4JI3 L;  5ISR A;  5C4X H;  4HAE A;  1RTO A;  5C3X A;  3S15 H;  4CDE C;  3PUY A;  2YU9 H;  1KNA A;  1QUQ A;  3QO2 A;  1DOK A;  5FLX E;  3EIV A;  2P5Z X;  4A3M H;  4FF3 A;  1U5K A;  1KRS A;  3J7Y W;  4ZKC B;  4X65 Q;  1B3Q A;  1CKN A;  1CSQ A;  4M8A A;  1VQ8 A;  2I5L X;  1PH3 A;  1IL8 A;  2R92 B;  1Y1W H;  2IW3 A;  2L5T A;  4RHS A;  1HR0 L;  1JOR A;  3SXH A;  1ROD A;  4NW2 A;  4HJ5 A;  2ZJP A;  3HOZ B;  1CUK A;  1FJG L;  2B8F A;  1CK1 A;  3F2U A;  2M00 A;  2VW9 A;  2PI2 A;  1BNZ A;  1HNX L;  4WJ4 A;  4RKB A;  2FHT A;  2Q2U A;  4DNT B;  1XPO A;  1JOQ A;  2IX1 A;  1HQR D;  1IYU A;  4BWG B;  4POF A;  4KD4 A;  3KLS X;  3QB3 A;  2JA5 B;  4CKC A;  5CV7 A;  4DNR B;  1HRJ A;  2OEO A;  1JJC B;  3OWF A;  1BCP D;  4K5W A;  4NXM L;  2VQF Q;  3FP9 A;  4ULL A;  2FXQ A;  1SYC A;  1XMO Q;  3PUZ A;  1EU3 A;  2K01 A;  1BO0 A;  3DUZ A;  2HQE A;  4H13 C;  3RD4 A;  4A3I B;  1YJ9 A;  4C1N K;  3EA6 A;  1EZ6 A;  3PIO A;  1B9N A;  3BDC A;  5LMN Q;  2GVB A;  4DA2 A;  1PZJ D;  4JOI C;  1WFQ A;  1KRT A;  1HHV A;  4RHR A;  2EYP A;  1OXT A;  2RKS A;  1VQC A;  1IL2 A;  4F7X A;  3PO2 B;  3L7Z C;  1GVP A;  1SR3 A;  4X6A H;  1B2T A;  3GTM H;  1U4R A;  1IBL Q;  2N55 A;  2NZO A;  1CTM A;  4HIM A;  1FD7 D;  4HIK A;  2NVY B;  1FNV A;  1YNN C;  1XMQ L;  3D6W A;  1EIH A;  1XNR L;  3T4A C;  4IOA A;  4P73 A;  1HNZ Q;  1AE3 A;  1H9S B;  1B1Z A;  4IUU A;  4OX9 Q;  3GV6 A;  3UDG A;  1QCB D;  2LSS A;  1G2T A;  4UP9 A;  5E7N A;  1V1O A;  1EY9 A;  4A3E B;  1VDZ A;  1Y8O B;  3J81 i;  4BXX H;  1ENC A;  1TWH B;  2MP1 A;  4CDC C;  1HNW Q;  1X55 A;  4DN4 M;  1NR4 A;  4DR3 Q;  4JV5 L;  2B39 A;  2JA5 G;  5EPJ A;  3A8K E;  1UE6 A;  3D31 A;  2N88 A;  2GA4 B;  3NK9 A;  2FFK B;  3NTI A;  3JAM L;  1YI2 A;  2NBF A;  4A3C G;  2ID0 A;  5IYB H;  4OWW B;  3BZD B;  4FDB A;  4YCV A;  2IX3 A;  1CA5 A;  4FF4 A;  5ELO A;  5A2Q E;  3FRP B;  3M85 A;  4LFB Q;  1SE8 A;  3QG1 A;  1B50 A;  3KYH C;  1PZI D;  4A3I G;  1CA6 A;  3CCL A;  3SDZ A;  3CC4 A;  1B3A A;  4DK0 A;  4DR6 L;  1JIC A;  4DUZ L;  3CXC A;  4DAY A;  1UAP A;  1SSO A;  1S5F D;  2OCE A;  1A3V A;  3K57 A;  4LK1 C;  5IWA L;  1G29 1;  1SFO H;  1ZKO A;  3KBG A;  1N36 Q;  5M5W H;  3KLR A;  2L15 A;  1SYG A;  5CBA E;  1NMF A;  1IBK Q;  5FJ8 G;  1EYA A;  3HKZ B;  4S3S A;  5JVH 3;  2JSO A;  4DV0 Q;  2XVS A;  2F0F A;  4NMZ A;  3K0X A;  1I4P A;  1HJP A;  4KJN A;  3Q23 A;  5I6W A;  2F0H A;  2QIL A;  1P8L A;  1DON A;  2JA6 B;  3M3Y B;  4QGU A;  3W3A A;  2K04 A;  4LAA A;  3PIP A;  3NBH B;  1X3G A;  4A3F H;  5EGT A;  1K3B C;  4BBS B;  2F0T A;  3DLL A;  5C4Z A;  1J8I A;  4YY3 L;  2EY1 A;  4ZUI A;  3SR1 A;  1K8M A;  4I7A A;  3NWT A;  3M9B A;  4B3T L;  2VL6 A;  1JWM D;  3RZO B;  1BF4 A;  1VQK A;  1K9M C;  3PO3 B;  2DY7 A;  1EY4 A;  3BVZ A;  1PHJ A;  4KHP Q;  4DR5 L;  1UE1 A;  3J80 L;  3HOY G;  3H09 A;  2KCM A;  3S1R B;  1AZQ A;  1OXV A;  2JXM B;  4GNX C;  3T1H L;  1K3R A;  3CHB D;  4L6T B;  5M5Y B;  3HOV B;  3HOW B;  3S2H B;  3ZJY C;  2E74 C;  5ELE A;  4KK7 A;  1EY6 A;  1JOO A;  1E2V A;  4BY1 G;  2O2L D;  3GTL B;  2IT1 A;  2Q2I A;  5FLX L;  4JI6 L;  4GNX B;  4CDD C;  5C44 G;  3MVV A;  5EKK A;  3L3O C;  2UUC L;  4LF7 Q;  4L5R C;  2A73 B;  4JK1 C;  4DR1 Q;  3BDL A;  3K80 C;  3H94 A;  1Q7Y C;  3W5O A;  4A4I A;  1YNN D;  5M5X B;  1XTD A;  2WP8 J;  2JA8 H;  1N9W A;  1YJW A;  1MHW C;  2D0P A;  2M2L A;  4DK1 A;  1XPU A;  1SDF A;  1A62 A;  5EPK A;  3S1Q B;  4BS9 A;  1SNC A;  3Q22 A;  4K2L A;  1XNQ L;  1R9T H;  4BBS G;  2YU9 B;  2UXD L;  1CQF A;  3GTO H;  3UDI A;  3FKI H;  1VMP A;  1PDQ A;  3ZYY X;  1EWC A;  4UAI A;  3GTJ B;  3BYT B;  4DR2 Q;  3L9A X;  4K2K A;  2Z6K A;  3NWS A;  3LWE A;  1EY8 A;  1M8A A;  4QCL A;  2ICE C;  1LT3 D;  1X6O A;  1SLJ A;  4QL5 A;  3VYS A;  2PMZ B;  2F0U A;  1CSP A;  4A3G H;  2MPM A;  4KMU C;  4K6L A;  1HUM A;  4GOP B;  2IHE A;  3SGI A;  5EJW A;  5EPL A;  5FLM G;  1V1P A;  2A74 C;  1J9O A;  2CH4 A;  2KEC A;  3DM1 A;  4IPC A;  3GD7 A;  1K8A C;  3TDQ A;  3GTK B;  1HTP A;  4X66 Q;  4DV2 L;  3TP6 A;  4LNQ A;  1FL0 A;  5ELC A;  1STN A;  3ULL A;  4Y52 H;  5FO7 B;  1GHJ A;  1LT4 D;  5E3F A;  2AQ2 B;  2DUD A;  1YNJ D;  2EY6 A;  2L4N A;  3DMU A;  1WD0 A;  3BZC A;  3FPP A;  2DNE A;  1JR0 D;  3TP5 A;  3R2I A;  2JEB I;  1EUJ A;  4DNI A;  1D6E C;  3I8Z A;  4XIG S;  1TKW B;  3IFD A;  1NJI C;  2C9O A;  2Q8T A;  4RAU C;  2WAC A;  3A55 A;  5KRU A;  4OO1 H;  4IOC A;  4GLA C;  3M4O H;  2AQ1 B;  4FVM A;  1F77 A;  2LS0 1;  2RHQ B;  1AN8 A;  4YCU A;  2NTS A;  1O7L A;  1K83 H;  1TWC B;  3UE0 A;  3I56 A;  4OEL B;  5CYU A;  4HJ7 A;  4L5S A;  1W6J A;  4DR4 Q;  3VR3 A;  1U9R A;  1KLG D;  1STY A;  2HIV A;  3EQL C;  3HGB A;  1ASZ A;  3QOJ A;  2ATW A;  2R7Z G;  2N49 A;  3KK7 A;  1IKL A;  1KLU D;  1WTH A;  1PXU A;  1T5X D;  4LF8 L;  2XRQ D;  1FNU A;  2Z6K C;  1MJC A;  2WKC A;  4PMW A;  5A2Q L;  1SMY C;  2DGY A;  1MD2 D;  4V0B A;  1K0S A;  1QG7 A;  2IHF A;  2IPK D;  2HD3 A;  4C56 C;  2F0Q A;  1MSH A;  2IJ0 A;  2IWH A;  4R1J A;  2MO0 A;  2RQX A;  1JWS D;  1Y1V G;  3TQY A;  1FR3 A;  4DUY L;  5E4W C;  3H3V H;  5I4D A;  3E3X A;  4KKS A;  1KXL A;  4X3S A;  5IYD G;  3PSI A;  3S17 H;  1PH4 A;  3S1N B;  1HZC A;  1L0W A;  1XMO L;  1LYL A;  2HDM A;  4L5T A;  1DXM A;  4IJL A;  1S72 A;  3U9O A;  2UUB L;  3PUX A;  3C46 A;  4QIW B;  5C6A A;  4DV6 L;  4MTN A;  5FO8 B;  2UU9 L;  4A3K H;  5IOC A;  3CPW A;  3K81 C;  2WAQ B;  3CU7 A;  1BKB A;  3BG3 A;  3Q6S A;  1BDO A;  1SNO A;  3TSS A;  1N33 Q;  4C3I H;  5JPM C;  4C2M B;  1IBL L;  2WV6 D;  1OTC A;  2G5D A;  3AFQ A;  1NBW A;  1PTO F;  2Z8L A;  2BA0 A;  4KV6 A;  4RH6 A;  4RCN A;  4XTC S;  3MFG A;  1YHA A;  4BBR G;  1STG A;  2ZTE A;  4O42 A;  4RGO S;  1VQ5 A;  1I4Q A;  3I3C A;  5C0X J;  1U4L A;  4EX5 A;  1E1T A;  1PLF A;  2EZV A;  2K75 A;  3HS0 C;  1SJE D;  4PV1 C;  2K4K A;  1G8Z D;  1X65 A;  4GKJ L;  2H4O A;  1Z9F A;  2KHI A;  2UXC L;  3S9W A;  4A3F B;  4POG A;  4LF9 Q;  4Y7N H;  1X3Q A;  3DEO A;  3W2D A;  2KVM A;  4C3J G;  4RGM A;  1PFB A;  3WDN A;  3X3M A;  1X3P A;  2Z9H A;  1HA5 A;  1EEI D;  3DEP A;  2NYZ D;  1QVF A;  2KHJ A;  4XQN A;  4HCE A;  5IYC H;  3NEM A;  5GAH C;  2QF7 A;  1A2T A;  2EVB A;  1XWE A;  3K7U C;  1GD7 A;  4L5Q A;  2NB0 A;  4A93 G;  2PZT A;  4XYQ A;  5C5M A;  1IW7 C;  1BOS A;  4LFB L;  4DK6 C;  1SE2 A;  3EJI A;  1Q8I A;  1GJX A;  2EJG C;  2K1B A;  5M9O A;  1S40 A;  1B44 D;  1SE3 A;  2XSC A;  3K7A H;  1XJV A;  2J0T D;  4JBJ A;  5JJK A;  1DCZ A;  1SND A;  2K32 A;  3HOY H;  4GLV B;  1H9R A;  4JI2 Q;  3R8B A;  4FF1 A;  5K36 H;  3KDF B;  3OIQ A;  1N36 L;  1QNK A;  3FPU B;  4JVZ A;  1F2L A;  1XTC D;  4JI8 Q;  1CZG A;  1IBK L;  1A8V A;  4K0K Q;  4CJ1 B;  1IBM Q;  4A3L G;  4IUR A;  2EOT A;  2ASB A;  5IGF A;  4DV0 L;  2IX0 A;  1JB7 A;  1Y14 B;  3TZU A;  1BBU A;  4LJZ C;  4IJH A;  3S14 H;  2A68 D;  4TVA B;  3MC0 B;  5C44 H;  4BA2 I;  2JJQ A;  3H0G H;  5C3W A;  1YZ6 A;  3I91 A;  2JA9 A;  3B6Y A;  1YJN A;  1EOT A;  4JI7 Q;  3I7F A;  2KBN A;  2CQO A;  5KGU A;  1NAP A;  1SMX A;  4A75 A;  2KA7 A;  4O0A A;  1EWI A;  4WRD A;  5JPN C;  1A15 A;  1XX8 A;  3MXN B;  3HP3 A;  2KHS A;  1KAA A;  3FEW X;  1IKM A;  2F0J A;  2WB1 G;  1ET6 A;  1TS5 A;  3FHW A;  3R2T A;  4B3R Q;  2R6G A;  4IAL A;  3RUZ A;  3QIA A;  4FF2 A;  1N32 Q;  1KQS A;  2G9H D;  2SNS A;  4A3G B;  1KL9 A;  4DAP A;  1R4Q B;  2UXB Q;  5J1Z A;  1KDA A;  1N34 L;  5LL6 X;  1Y69 U;  3CW2 C;  2IL8 A;  5GAE C;  4DR7 Q;  5C0X H;  2UUA Q;  5HGQ A;  2KCT A;  4FP5 D;  2N8N A;  1TWA H;  5EBC A;  3GP7 A;  5CMD A;  4LFC Q;  2X69 A;  3DWA A;  4OXP A;  4NPS A;  4R9W A;  1X56 A;  1E24 A;  4GN4 B;  2OF1 A;  1S3O A;  1SYD A;  1HFN A;  4DPG A;  4R4T A;  3SHL A;  3M7G A;  4LF7 L;  1C0A A;  1H9M A;  1SNM A;  1TY2 A;  1IZ6 A;  1WCM G;  2ZXP A;  1HQM C;  4JYA L;  3GTG B;  4DR1 L;  1H9S A;  3LGJ A;  3A0J A;  4LF6 Q;  5EKI A;  2LKV A;  2NVX H;  5M3M G;  2MHV A;  3K5L A;  5T1G A;  3M4O B;  3K5M A;  1LT6 D;  2ZM6 Q;  1EY5 A;  3S16 B;  3KBX A;  2NN6 G;  1C9O A;  1LLR D;  1PRT D;  4RGN A;  2XWB B;  3I4N B;  4PG3 A;  3NTH A;  3ULJ A;  1Y8P B;  2VUM B;  3OTO Q;  4AYB B;  2EYJ A;  1D5Z C;  4MN3 A;  4DR2 L;  4XXE A;  3TP7 A;  3LWU A;  2OQK A;  2KEN A;  3I55 A;  1LTG D;  4WJ3 M;  2JN4 A;  3I4M G;  2HHH Q;  1BR9 A;  3T53 B;  3CCE A;  2Y0S B;  1V9P A;  2VQE Q;  5CV4 A;  4KN7 C;  3HOX H;  4ID6 A;  3S2D H;  4ZCK A;  2NN6 I;  4HTH A;  2E2D C;  1VQM A;  1NY4 A;  5HGT A;  3ERQ A;  2SNM A;  1TWF H;  1E3P A;  1OXX K;  1Y8N B;  1DZ1 A;  3KF8 B;  4GN5 A;  4HN7 A;  3S17 B;  2PO4 A;  4JI0 Q;  2EYL A;  4IN3 A;  1VCI A;  1VF7 A;  1QVG A;  4K6D A;  4X64 Q;  3ERS X;  4FYD A;  1B70 B;  1VS0 A;  1LTI D;  2R93 G;  2RSN A;  5M3F G;  1VQ6 A;  4FXG C;  1A2U A;  2CHB D;  4DKA C;  4F8M A;  5JJI A;  1UE7 A;  2C5C A;  2CW0 C;  3U4Z A;  2RDH A;  1UEA B;  3CPF A;  2HDL A;  2VB2 X;  3H91 A;  5COR A;  2AUJ D;  4GN3 B;  1TWG B;  2F1M A;  1BBX C;  3H6M A;  5ELB A;  4B08 A;  5C3E G;  1TR5 A;  2Q8R E;  2TSS A;  1D1K A;  3D4D A;  4OWT B;  2GVA A;  3RLF A;  3SVM A;  2EIF A;  4C3I B;  4A3B B;  3NBH A;  4GKK Q;  1A0I A;  2MUY A;  1VQD A;  4LW1 A;  4F88 A;  1WTQ A;  5IP7 H;  2A6H C;  4U67 3;  5K5P A;  4DR4 L;  3M4Y A;  1L1O B;  3ERO A;  2R92 G;  1ZYR C;  3QJY A;  4IFD J;  3DWQ A;  2J7Z A;  1LM0 A;  4AYB G;  5CV5 A;  1SNQ A;  2B2V A;  1PMR A;  2FIN B;  4DV4 Q;  5I9O A;  3HOZ G;  5CV8 A;  3K6O A;  5CR3 A;  4HCS A;  2QCP X;  1VQ7 A;  1EIF A;  3SK8 A;  3S1M B;  2JA7 B;  4EQ5 A;  4PZ8 A;  4BBR H;  4B3S Q;  3L0O A;  4ILW A;  2Y0S G;  2RDF A;  2XNA C;  5CBE E;  3PIP 3;  5GRO A;  1EU4 A;  1RIP A;  4X3U A;  4DGZ A;  2SEB D;  1UEB A;  3T51 B;  2E2J H;  1MGS A;  4QUF A;  1O7I A;  2L0C A;  3LX0 A;  3Q8D A;  4DXG A;  3HOU H;  3D4W A;  1LTS D;  5IT9 L;  1CKO A;  5AJ3 L;  1I6H B;  1OXU A;  3G71 A;  1AZP A;  1B7Y B;  4A3J H;  1PYW D;  4GNX A;  4QMG A;  1TII D;  3CMA A;  2B63 H;  3GTP H;  1AH9 A;  3U50 C;  5GAD C;  3U58 A;  1I3Q H;  2E75 C;  2R3Z A;  2D0O A;  2ALY B;  3BVM A;  2NVT H;  2KOL A;  2RSO A;  1O7Y A;  1WTP A;  4A3D H;  3QOL A;  2DNC A;  3IKJ A;  4ZK9 B;  1CQV A;  1QZH A;  3BU2 A;  4A93 H;  3PO2 G;  3VR6 A;  4A3B G;  2E76 C;  1M4V A;  3TP8 A;  1CT1 D;  4QQB X;  1JJ2 A;  2XGT A;  1BCP F;  1F9R A;  3MA2 B;  3N6R A;  3J7A F;  4LF5 L;  4ZQ3 A;  1PTO B;  4EQO A;  1ZXT A;  1UNS A;  1VQB A;  2K50 A;  3NEL A;  2JK8 A;  1M1K C;  1RHP A;  3NEN A;  1X3E A;  4A3E G;  3S14 B;  2B2V C;  1E2Z A;  1SYF A;  1CFM A;  1EZ8 A;  4HJA A;  1I94 Q;  3H0G B;  2F0M A;  4UP7 A;  3Q24 A;  1SRO A;  2JA7 G;  4A3L H;  5LMN W;  1SAP A;  4K14 A;  1VQI A;  2F0K A;  4GOP A;  4PZ6 A;  4Q0F A;  2F4I A;  4EQP A;  1EIY B;  3O13 A;  4R8N A;  4BY7 H;  3PUV A;  4PZ7 A;  3KLW A;  3J81 E;  2O5I C;  1MKH A;  2BDO A;  3VR4 A;  5IGG A;  1H95 A;  1PA6 A;  1EWH A;  2A5H A;  2EDG A;  1EOV A;  1TS2 A;  3CQZ H;  1X54 A;  1SN8 A;  3JAM c;  2RHS B;  4C3H H;  2DY8 A;  2OTJ A;  1C8C A;  3OYY A;  3VYT A;  2QDL A;  2A1A A;  2B2Y A;  5IT9 c;  5E4X A;  3ICE A;  3RN2 A;  1J6Q A;  4XQQ A;  4DU9 A;  1QB5 D;  3GDE A;  1A6X A;  2X6L A;  4NKL A;  4JBK A;  4PNY A;  3T16 A;  3K5O A;  5DM6 3;  3GTQ H;  2E2I B;  4IFD H;  4KTA A;  1EY0 A;  2EXD A;  3KFU A;  4IPH A;  4JI2 L;  1EQQ A;  4DV7 Q;  3RR5 A;  3IL8 A;  3G6E A;  5C4J H;  3NSW A;  1GUW A;  3HKZ G;  2YTV A;  3WWV A;  2KQ3 A;  4LFA Q;  4K0K L;  4TQU S;  4RWS C;  3MEH A;  4JW0 A;  2I5H A;  1I4X A;  4X3K A;  4JI4 Q;  1ESR A;  3AFP A;  4CKE A;  3M4P A;  4UY8 C;  1FVI A;  2OWO A;  3I4L A;  4DV5 Q;  4EQN A;  2JA6 G;  4DV1 Q;  1GO3 E;  3G4S A;  1X32 A;  5C4X B;  1ZYR D;  1JOK A;  3S15 B;  2ZTC A;  4X62 Q;  1MBY A;  1WCM H;  4K5V A;  2Z4I A;  4A3M B;  1VQH A;  3R3O A;  4GOP C;  2F4V L;  4JI7 L;  1GXD C;  4O1N A;  1Y1W B;  5M3M H;  1KHI A;  5IGE A;  1YHQ A;  1EYD A;  3KOJ A;  3AEV A;  2OQ0 A;  3PO3 G;  5LMU Q;  2PW5 A;  1HTL D;  2D2C C;  2QGQ A;  2Z0S A;  1UE5 A;  4TRD A;  2NN6 H;  5DAU A;  4NDX A;  2B2Y C;  1ONL A;  4CDF C;  1FGB D;  1LTL A;  1I4R A;  4OIK A;  2UXB L;  5DNF A;  4YIJ A;  3HOV G;  1PYS B;  1NSN S;  3J80 c;  2ES2 A;  3TS0 A;  2ICI A;  3CP0 A;  5KYI A;  3HOW G;  3I4M H;  2Z1C A;  4B3M L;  4DR7 L;  1RF2 D;  2K5W A;  1BBW A;  2H5X A;  3WOE A;  1LT5 D;  3GV3 A;  1QWY A;  5C5L A;  3S24 A;  1GKH A;  3EBE A;  2A69 C;  2D62 A;  4QJF A;  5IOD A;  3E9H A;  4OIJ A;  1Q12 A;  2F0D A;  3TN2 A;  1NCV A;  1WTO A;  5A35 A;  2NZH A;  4JPB W;  3J81 j;  2EPB A;  2NUC A;  2I0Q A;  1F2Y A;  4NXM Q;  3CCQ A;  5FLX c;  4R4O A;  3VYR A;  1Q82 C;  2K05 A;  2DJG C;  1ILP A;  4LF6 L;  1EQR A;  3HZX A;  4RMF A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  2MO1 A;  5M3F H;  1HNX L;  4WJ4 A;  2A19 A;  2JQO A;  1S40 A;  3F2D A;  2Q2U A;  1XPO A;  3K7A H;  1XJV A;  2IX1 A;  3BJU A;  4JBJ A;  5JJK A;  4POF A;  3HOY H;  4GLV B;  4JI2 Q;  1ASY A;  4X65 L;  2N78 A;  2YV5 A;  1JJC B;  2A8V A;  3KDF B;  5IYC G;  1G6P A;  1A63 A;  4KI0 A;  1N36 L;  2VZA A;  4J15 A;  4NXM L;  4DK3 C;  3FP9 A;  2VQF Q;  5C3E H;  1VQO A;  1IBK L;  3OTO L;  4JI8 Q;  2FXQ A;  1A8V A;  1Q1E A;  4K0K Q;  1XMO Q;  3PUZ A;  1IBM Q;  4AQY Q;  4A3L G;  2ASB A;  1YEZ A;  4DV0 L;  2IX0 A;  2HHH L;  1JB7 A;  1Y14 B;  3HKS A;  3BZK A;  2PMZ E;  1BBU A;  1YJ9 A;  1XNR Q;  3AYH B;  4IJH A;  4JI5 Q;  3S14 H;  1I50 H;  2MQH A;  3VDY A;  3PIO A;  2VQE L;  4TVA B;  5C44 H;  5LMN Q;  3KJP A;  4LF4 L;  4KLK A;  3RLN A;  2JJQ A;  3H0G H;  4BA2 I;  2GVB A;  1YZ6 A;  4IPG A;  2JA9 A;  4JOI C;  1WFQ A;  3B6Y A;  1YJN A;  1KRT A;  3DM3 A;  2F52 A;  3HOZ H;  5K36 G;  1OXT A;  4O2D A;  1VQC A;  2VQF L;  1IL2 A;  4X6A H;  1D8L A;  1GVP A;  1SR3 A;  3L7Z C;  4JI8 L;  4JI7 Q;  3I7F A;  3GTM H;  2KBN A;  2CQO A;  5IY0 A;  4A75 A;  1SMX A;  1N34 Q;  1IBL Q;  4NXN Q;  2NZO A;  1IBM L;  4O0A A;  4HIM A;  1EWI A;  4X64 L;  1WI5 A;  4P74 A;  3KDF A;  2GN5 A;  4HIK A;  4JV5 Q;  3MXN B;  1XMQ L;  2JA5 H;  1J5E Q;  4P71 A;  1XNR L;  4ME3 A;  4JI1 L;  4IOA A;  1MJE A;  2B29 A;  2WB1 G;  5LMN L;  4A3C H;  4B3R Q;  3FHW A;  3PCO B;  4P73 A;  2R6G A;  3KJO A;  1AE3 A;  1HNZ Q;  3T1Y Q;  2HQL A;  1N32 Q;  3H0G G;  4OX9 Q;  4YWK A;  3UDG A;  5BR8 Q;  1C7Y A;  2LSS A;  1KQS A;  1JE5 A;  4UP9 A;  1KL9 A;  5E7N A;  2VY3 A;  1PYB A;  4JYA Q;  2UXB Q;  3L2P A;  3J81 i;  4BXX H;  4YHH L;  1VQF A;  3JAM i;  4DAY B;  4HID A;  4A3I H;  1N34 L;  1EYG A;  1HNW Q;  3TEH B;  2LXJ A;  4P75 A;  1X55 A;  3CW2 C;  5GAE C;  4DR7 Q;  1E22 A;  3E0E A;  2E2H H;  2C35 B;  4GKK L;  4DR3 Q;  2I5M X;  2UUA Q;  4JI3 Q;  5HGQ A;  2KCT A;  4JV5 L;  2N8N A;  1TWA H;  4LFC Q;  4RG1 A;  1HZA A;  2JA5 G;  4OXP A;  4DUZ Q;  1IXR A;  1UE6 A;  4NPS A;  3D31 A;  1PV4 A;  1VQ9 A;  1X56 A;  4B3R L;  1E24 A;  1YI2 A;  1HNZ L;  4GN4 B;  1S3O A;  1V43 A;  3PUW A;  3PO2 H;  4A3C G;  2ID0 A;  4DPG A;  4R4T A;  2E5L L;  1N32 L;  4OX9 L;  5IYB H;  4OWW B;  4FDB A;  5IWA Q;  3CCM A;  1RL2 A;  4YCV A;  4LF7 L;  1C0A A;  2R7D A;  1XPR A;  4DV4 L;  1IZ6 A;  1WCM G;  2RCN A;  5ELO A;  5FJ8 H;  4JYA L;  1HR0 Q;  4DR1 L;  3M85 A;  3LGJ A;  3A0J A;  1SE8 A;  4LFB Q;  1HNW L;  3KYH C;  4LF6 Q;  4B3S L;  3TRE A;  4A3I G;  2NVX H;  1VQL A;  3CCL A;  1FJG Q;  3CC4 A;  1B8A A;  4DR3 L;  2UUA L;  4P72 A;  1K73 C;  5M3M G;  4LFC L;  3STB D;  1HNX Q;  5JEA J;  5C0X G;  4DR6 L;  1MIU A;  4DUZ L;  2QEX A;  3M4Q A;  3MEF A;  2CWA A;  3CXC A;  4A3E H;  2ZM6 Q;  3PF5 A;  3F2C A;  2OCE A;  4LUV A;  1TWH H;  2AHO B;  2PQA B;  1JJG A;  5IWA L;  2NN6 G;  1G29 1;  1C9O A;  1SFO H;  5IYB G;  1N36 Q;  5M5W H;  2B3G A;  2L15 A;  4PG3 A;  3ULJ A;  1NMF A;  1IBK Q;  3OTO Q;  2YTY A;  5FJ8 G;  4DR2 L;  2OQK A;  3I4O A;  2KEN A;  3I55 A;  3RLO A;  2JEA I;  3IRB A;  2R93 H;  1Q86 C;  4WJ3 M;  3I4M G;  4DV0 Q;  5C0X I;  2HHH Q;  3K0X A;  3W1B A;  5IYD H;  1HJP A;  4QIW E;  3CCE A;  5C4X G;  1V9P A;  3F2B A;  4OWX B;  2VQE Q;  2WAQ G;  4LF4 Q;  1P8L A;  2WAQ E;  1LUZ A;  3HOX H;  2ZM6 L;  3S2D H;  3GTG H;  2NN6 I;  5IP9 G;  4QGU A;  3TRZ A;  4A3M G;  3PIP A;  4LUZ A;  1VQM A;  1NY4 A;  3NBH B;  1X3G A;  3A5U A;  4A3F H;  1VQN A;  2WFW A;  1TWF H;  1K8G A;  1E3P A;  1OXX K;  2MNA A;  3DLL A;  3KF8 B;  3A74 A;  4GN5 A;  4YY3 L;  1Y1W G;  1VQE A;  4JI0 Q;  1CKM A;  1VCI A;  2PQA A;  1QVG A;  4X64 Q;  4R4I A;  2AKW B;  4B3T L;  3M9B A;  5EAY A;  3ERS X;  3J80 i;  4BY1 H;  1B70 B;  2VL6 A;  1VS0 A;  1XMQ Q;  2R93 G;  3S16 H;  2NVQ H;  4R4Q A;  1VQK A;  4JI1 Q;  5J3B A;  3UDF A;  5M3F G;  1K9M C;  1VQ6 A;  4DKA C;  3I4N H;  2VUM H;  5JJI A;  3A5Z B;  1UE7 A;  2K5V A;  1PHJ A;  3U4Z A;  3HOX G;  3CPF A;  4KHP Q;  4DR5 L;  1UE1 A;  1I94 L;  3HOY G;  2IY5 B;  3CF5 A;  2KCM A;  4GN3 B;  1OXV A;  4GNX C;  3T1H L;  4A3F G;  1HZ9 A;  3J7Z C;  2BH2 A;  1K3R A;  1KC8 C;  3UE1 A;  2V1C C;  4YHH Q;  5C3E G;  1WOC A;  4HJ8 A;  2E8G A;  4JI0 L;  3I2Z A;  1NMG A;  1Q1B A;  4OWT B;  2GVA A;  5DLQ E;  3RLF A;  2EIF A;  1W2B A;  1X9N A;  3ZJY C;  1D7Q A;  2ZTD A;  4GKK Q;  1A0I A;  1Q8K A;  2Q2T A;  2JA6 H;  1VQD A;  3E9I A;  3M3Y H;  4LW1 A;  5IP7 H;  4BY1 G;  1IYJ B;  2N3S A;  2K14 A;  4DR4 L;  4UPA A;  4BBS H;  2WB1 E;  2IT1 A;  1V1Q A;  2Q2I A;  4JBW A;  4GNX B;  1L1O B;  4JI6 L;  2R92 G;  5H1S E;  5C44 G;  4OON A;  4BA1 I;  2E5L Q;  2UXD Q;  4IFD J;  4KHP L;  3JC6 6;  5AJ3 Q;  1LM0 A;  2UUC L;  4LF7 Q;  4AYB G;  1YBY A;  3ULP A;  4L5R C;  4DV4 Q;  1L2F A;  3HOZ G;  4H02 A;  4DAM A;  4MNO A;  3RZO H;  1VQG A;  4DR1 Q;  1VQ7 A;  1I5F A;  1EIF A;  3K80 C;  3CC7 A;  4EQ5 A;  1Q7Y C;  4PZ8 A;  4BBR H;  4B3S Q;  3PO3 H;  3L0O A;  2HIX A;  2Y0S G;  3W5O A;  4A4I A;  5GRO A;  1RIP A;  2BH8 A;  1UEB A;  2E2J H;  3J7A 5;  1XTD A;  3ER0 A;  2WP8 J;  1PH5 A;  2JA8 H;  1N9W A;  4YWL A;  1O7I A;  2D0P A;  1YJW A;  1HR0 W;  4DR6 Q;  3D0F A;  1XPU A;  1K0R A;  3Q8D A;  5IP7 G;  3RNU A;  1A62 A;  3S1R H;  1TWG H;  2YTX A;  3HOU H;  3F8T A;  5FLM H;  4DV7 L;  1R9T H;  1XNQ L;  4BBS G;  1KAW A;  2UXD L;  5M5Y H;  4HJ9 A;  3GTO H;  3UDI A;  3HOV H;  3M7N A;  1CKO A;  1FGU A;  3FKI H;  5AJ3 L;  2K5N A;  3HOW H;  3S2H H;  4A3B H;  1OXU A;  3G71 A;  1VQA A;  1WYD A;  3OW2 A;  2NVY H;  4LFA L;  4DV2 Q;  1B7Y B;  3CAM A;  4A3J H;  4DR2 Q;  4GNX A;  1L1O A;  4BXX G;  3CMA A;  2K52 A;  2Z6K A;  2B63 H;  3GTP H;  1TXY A;  1BVS A;  2BA1 A;  4JI4 L;  3HFZ B;  3U50 C;  5GAD C;  3GTL H;  1AH9 A;  1PH1 A;  4LF5 Q;  3U58 A;  1I3Q H;  3K8A A;  4LWC A;  1X6O A;  1SLJ A;  4QL5 A;  4DV5 L;  2D0O A;  2ALY B;  4DV1 L;  1VQ4 A;  1EFW A;  1CSP A;  1YIJ A;  4A3G H;  4MZ9 A;  3CCV A;  2NVT H;  4QY7 A;  1M90 C;  4ALP A;  4GOP B;  4YCW A;  2IHE A;  4X62 L;  3SGI A;  4A3D H;  2VS1 A;  3HOU G;  1QZH A;  5FLM G;  3BU2 A;  4A93 H;  3PO2 G;  2JA7 H;  3S1M H;  2K5H A;  4IPC A;  3GD7 A;  3FKI G;  1K8A C;  1PFS A;  4X66 Q;  5M5X H;  1GM5 A;  4A3B G;  4DV2 L;  1QVC A;  4YY3 Q;  4LNQ A;  1FL0 A;  2RF4 A;  4GS3 A;  4QQB X;  3ULL A;  1JJ2 A;  2XGT A;  4A3J G;  3S1Q H;  4Y52 H;  3RZD H;  2AWO A;  4B3T Q;  2B63 G;  2DUD A;  5GAG C;  5LMU L;  4LF5 L;  2XTI A;  4LUO A;  3UDX A;  4AIM A;  1KIX A;  4JG2 A;  3BZC A;  1I6H H;  1VQB A;  2K50 A;  3NEL A;  2R7Z H;  2JK8 A;  2JEB I;  1M1K C;  3GO5 A;  4A3G G;  3NEN A;  1X3E A;  1EUJ A;  4A3E G;  4DNI A;  3GTJ H;  2CKZ B;  4XIG S;  4HJA A;  4A3D G;  4DR5 Q;  1I94 Q;  4LF8 Q;  3CCJ A;  1DGS A;  3EN2 A;  4UP7 A;  1NJI C;  1SRO A;  5GQO A;  5IE8 A;  2JA7 G;  3T1H Q;  2R7F A;  4X66 L;  4A3L H;  1HH2 P;  5LMN W;  1VQI A;  4IOC A;  4GOP A;  4PZ6 A;  4GLA C;  3M4O H;  1EIY B;  2RHQ B;  4BY7 H;  3PUV A;  4YCU A;  4PZ7 A;  3KLW A;  4DV3 L;  3PGZ A;  1MKH A;  4JCV E;  4GLX A;  1Y1V H;  1K83 H;  1Q46 A;  3UE0 A;  3I56 A;  1H95 A;  4HJ7 A;  1PA6 A;  3KF6 B;  4L5S A;  4DR4 Q;  1T9H A;  4DUY Q;  4AH6 A;  1N8R C;  1EOV A;  1ASZ A;  2CCZ A;  3CQZ H;  2HIV A;  5ELN A;  3GTK H;  4JI6 Q;  3J81 c;  1X54 A;  1Q81 C;  2ATW A;  2N49 A;  1NTG A;  2R7Z G;  1SN8 A;  2PI2 E;  3JAM c;  2RHS B;  4C3H H;  1NE3 A;  2OTJ A;  2UUC Q;  3OYY A;  3CME A;  4LF8 L;  2A1A A;  1G51 A;  5IT9 c;  1L1O C;  3ICE A;  3RN2 A;  1J6Q A;  2Z6K C;  1MJC A;  4PMW A;  1PH7 A;  1E1O A;  3U4V A;  3PF4 A;  2DGY A;  3GDE A;  4OO1 G;  1AE2 A;  2IHF A;  4JBK A;  2UUB Q;  3CC2 A;  2R92 H;  3GTQ H;  4HIO A;  4BY7 G;  4R1J A;  2MO0 A;  1SRU A;  2EXD A;  1YHB A;  1Y1V G;  4DV6 Q;  3TQY A;  3KFU A;  1YIT A;  4DUY L;  4IPH A;  4JI2 L;  2UU9 Q;  3H3V H;  3H15 A;  4KHZ A;  1EQQ A;  4DV7 Q;  1XNQ Q;  3RR5 A;  3G6E A;  1KXL A;  5IYD G;  3I4N G;  3PSI A;  3S17 H;  2VUM G;  1JT8 A;  5C4J H;  1OXS C;  4AYB E;  3HKZ G;  3HKZ E;  2YTV A;  3WWV A;  3CCS A;  2F4V Q;  1PH4 A;  3KF6 A;  2QA4 A;  1HZC A;  1L0W A;  4LFA Q;  4K0K L;  1XMO L;  4TQU S;  4AQY L;  3RN5 A;  3TS2 A;  1TWC H;  1LYL A;  4OO1 I;  4L5T A;  1YVC A;  2I5H A;  3G48 A;  4IJL A;  4YWM A;  1S72 A;  4JI4 Q;  2Y0S E;  3PUX A;  2UUB L;  2F3I A;  3AFP A;  1W3S A;  2ZJQ A;  4JI5 L;  3M4P A;  4UY8 C;  1VQJ A;  1FVI A;  2OWO A;  4DV5 Q;  2JA6 G;  4IFD G;  4DV1 Q;  1GO3 E;  3G4S A;  4DV6 L;  4MTN A;  2UU9 L;  4A3K H;  5HY6 A;  3K81 C;  2ZTC A;  4X62 Q;  2MFI A;  3CPW A;  1WCM H;  2OTL A;  1BKB A;  4R4C A;  2EQS A;  2CFM A;  2PNH A;  1PH2 A;  1VQH A;  3CD6 A;  4GOP C;  1N33 Q;  4C3I H;  1YNX A;  4JI7 L;  2F4V L;  1U0L A;  1QUQ B;  4GKJ Q;  3AQQ A;  1IBL L;  1OTC A;  4NXN L;  1E7Z A;  3AFQ A;  2E2I H;  2UXC Q;  4C3J H;  1PH9 A;  1NBW A;  3F1Z A;  4B3M Q;  5M3M H;  1KHI A;  2BA0 A;  1QZG A;  1CKN B;  4XTC S;  1YHQ A;  3KOJ A;  3AEV A;  1JMC A;  1J5E L;  1YHA A;  4BBR G;  2OQ0 A;  2ZTE A;  3STB C;  5LMU Q;  3PO3 G;  1VQP A;  3W1G A;  3CCR A;  2Z0S A;  2QGQ A;  4IFD I;  3PV0 A;  1PH6 A;  2VNU D;  1UE5 A;  1PH8 A;  1VQ5 A;  4A76 A;  2LXK A;  3T1Y L;  2HT1 A;  2JA8 G;  5C0X J;  3S1N H;  4EX5 A;  5BR8 L;  3H3V I;  1Z47 A;  2Q2H A;  1E1T A;  4A3K G;  4JOI A;  2K75 A;  4NB3 A;  1LTL A;  2UXB L;  2JE6 I;  2K4K A;  2CWP A;  1X65 A;  1KD1 C;  4JBM A;  1N33 L;  3HOV G;  4GKJ L;  1PYS B;  3J80 c;  1Z9F A;  2KHI A;  3TS0 A;  2ES2 A;  3CP0 A;  3HOW G;  2UXC L;  2ZJR A;  4JC0 A;  4LF9 Q;  4POG A;  3I4M H;  4Y7N H;  4B3M L;  4DR7 L;  1HZB A;  5JEA G;  2AWN A;  1BBW A;  2H5X A;  4JI3 L;  5C4X H;  1WJJ A;  3S15 H;  3S24 A;  1GKH A;  4DV3 Q;  4APV A;  3EBE A;  3PUY A;  2D62 A;  4QJF A;  2YU9 H;  1QUQ A;  3E9H A;  5IP9 H;  1QVF A;  1Q12 A;  3EIV A;  2AMC B;  4A3M H;  1U5K A;  2KHJ A;  1KRS A;  5IYC H;  4C2M H;  1X3F A;  2NZH A;  1CKN A;  4X65 Q;  3NEM A;  1CSQ A;  3J81 j;  1VQ8 A;  2I5L X;  5GAH C;  1PH3 A;  1UWV A;  2I0Q A;  3K7U C;  1GD7 A;  4L5Q A;  3CCQ A;  5FLX c;  1Y1W H;  4NXM Q;  4R4O A;  1HR0 L;  4A93 G;  1PVO A;  2YYZ A;  4IPD A;  1Q82 C;  4HJ5 A;  4LFB L;  4UP8 A;  4DK6 C;  4LF6 L;  1EQR A;  2ZJP A;  4LF9 L;  1CUK A;  1FJG L;  3CCU A;  4RMF A;  1P16 A;  5JJL A;  4IO9 A;  2VW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...