4DV3L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv3L00
1P8LA 4RMFA 1YHQA 1J5EL 1KL9A 2JA9A 3EIVA 4LF7Q 3PF4A 2C35B 5LMNL 1TWAH 1FL0A 2ZJQA 4BA2I 3CC2A 4IFDG 1VQOA 4DV1L 2KHIA 2A8VA 4JI3L 1JE5A 5LMNW 3CCSA 3DM3A 1PH2A 2UXCQ 3UDXA 1Q12A 4A3LH 4DR2Q 1HNWQ 4KHPL 3T1HL 4X66L 3CCVA 4X6AH 4BY1G 4OONA 4YWMA 5C0XI 3GDEA 1E22A 3PUWA 5IWAL 1XPRA 4BBSG 1YHBA 3M4PA 4L5QA 3E9HA 4R4CA 4LFAQ 3ULLA 2VQFQ 1HR0W 1D8LA 4GN3B 4GOPB 4B3TL 2ATWA 4R4OA 4UP8A 4YWKA 4DNIA 4OO1I 4DK6C 2B3GA 2UU9Q 3J81i 4B3SL 1YVCA 3PUZA 4X64L 3J80c 1GO3E 1U5KA 4DV5L 1PH4A 4LF9L 1XJVA 2NN6I 1QUQB 2PMZE 3BZKA 2AHOB 4JI8Q 4POFA 1N33L 2D62A 1X56A 1XMOL 4C3JH 4IJHA 2CCZA 1CKNB 1I6HH 2I5LX 4DUYL 1PYSB 1G291 2K5VA 2E5LL 1S3OA 4GOPC 1E3PA 4JI6L 2EXDA 4JI0Q 3RLFA 3G4SA 4GNXB 1VQDA 4MNOA 3S16H 3TS2A 4YY3Q 1IBKQ 3CCUA 4PZ7A 4BXXG 1WJJA 3KYHC 4P74A 4LUOA 5J3BA 4HJ7A 3UE1A 2RF4A 4LF7L 4GN4B 3OYYA 3F2DA 1EOVA 4R4IA 4GKJQ 3J80i 4IPCA 1VQLA 3TREA 2UXCL 1Y14B 3HOZH 2B29A 3BZCA 3K7AH 3S1RH 1Q46A 4DR2L 4B3MQ 1HNWL 3W5OA 4GNXC 5JEAJ 5FLMG 3PUYA 2YTXA 5M5YH 3F2CA 1EUJA 3CCJA 2YTVA 4FDBA 1EYGA 5C4XH 3HOVH 1S72A 1E1TA 2VQFL 1KQSA 1FVIA 4LFAL 1E24A 3PV0A 1Y1WG 1MKHA 2BA0A 2JEBI 3AQQA 2UU9L 2R92G 3HOWG 1XPUA 3PUVA 1I50H 4IJLA 3UDFA 3UE0A 2NVTH 4BY7G 1EQRA 1VQPA 4A4IA 4EQ5A 4DAYB 1JB7A 1EIYB 2KCTA 1QZGA 4LF6Q 3CMAA 1IXRA 4A3BG 1N9WA 1NMGA 1Z9FA 4PZ8A 3RLNA 3HOXG 1XMQQ 2I5HA 4DV2Q 4QY7A 3KDFA 1IBLL 4IFDI 2R6GA 1L1OB 2UUBL 1VQIA 4JI0L 4JCVE 5H1SE 3H15A 4JV5Q 4YY3L 1UWVA 1IBKL 2K50A 3I7FA 1A62A 1G6PA 1OXUA 2WB1E 3A74A 1J5EQ 3GTJH 2IX1A 1HZAA 5IP9G 1LUZA 3HKZE 5LMNQ 2VZAA 3K7UC 2JA6G 3GO5A 5GAEC 1QVCA 1L1OC 1LM0A 2PQAA 2WFWA 2VQEQ 4P73A 4B3ML 1B7YB 2N8NA 4RG1A 1I94Q 1Z47A 4DUZQ 1PV4A 1HR0Q 3CCLA 1WOCA 4JI2Q 4A3IG 2ES2A 4R1JA 5BR8Q 5IWAQ 3OTOQ 2KENA 1PH6A 4QQBX 5GAHC 1Q8KA 3ZJYC 1S40A 4IOCA 2UUCQ 2XTIA 4DR5Q 4NPSA 1E7ZA 4KLKA 3ULPA 2R93H 4A3DG 2A19A 4DV5Q 1CSQA 5GAGC 3BJUA 5EAYA 5C0XJ 1VQ8A 1N32Q 3M4QA 4DPGA 4HJ9A 2F52A 1HNXQ 1VQHA 2OWOA 4HIKA 5M5XH 2JEAI 1BBWA 5GADC 2UXBQ 3PGZA 2VS1A 3D0FA 1XMQL 1OXTA 4IO9A 4JBKA 1C0AA 4JV5L 1KC8C 2JK8A 3I56A 3PSIA 2B63G 5HY6A 4YCVA 1HJPA 1WCMH 4LW1A 4TVAB 2PI2A 4L5TA 2MNAA 4NB3A 1NJIC 2JA7G 2UXDQ 1W2BA 4GN5A 3U58A 3STBD 3CC7A 4KI0A 2ZJRA 2VQEL 1MJCA 2JQOA 1OXVA 1Y1VG 2EIFA 5IY0A 4BBSH 1IL2A 1D7QA 2K4KA 1I94L 3E0EA 3AEVA 4DUZL 4R4QA 3PCOB 1HR0L 4JBMA 4JI2L 3KDFB 5BR8L 3OTOL 3K0XA 5AJ3Q 4DR3L 1AH9A 4A3MH 3PF5A 2IHFA 2VUMH 3RR5A 5IYDG 2YV5A 2I0QA 2KCMA 2UUCL 4DR5L 1X3EA 4DR4Q 3HOYG 1H95A 3KOJA 5C4JH 4MZ9A 4OWXB 1MIUA 1IBMQ 3S24A 4OX9Q 1PH1A 1KRSA 4A3JH 1N32L 4P71A 3RN2A 3GTMH 1HNXL 3OW2A 4JI7Q 1JJCB 4ALPA 2GVBA 5IYCG 1CKOA 2PQAB 4L5SA 4UP9A 3IRBA 1IBLQ 2MQHA 1TWHH 2UUAQ 2CKZB 2Z6KA 2UUBQ 1C7YA 1VQ7A 4A3LG 2H5XA 1R9TH 1HH2P 2JA5G 4APVA 3FKIH 3STBC 4IPGA 2CWPA 4PZ6A 2AWNA 2R7DA 4DV3Q 4MTNA 2UXDL 2RCNA 4GS3A 1EFWA 2VY3A 2WB1G 2NVQH 3F8TA 5DLQE 3L2PA 4WJ3M 3HKZG 4A3CG 2L15A 1G51A 4JI4Q 4DV7Q 3L0OA 3ULJA 1VQ9A 3WWVA 5IT9c 4JOIA 2DGYA 5AJ3L 1A63A 2R92H 3HOWH 3HOUH 1GVPA 5M3FH 4UP7A 4UY8C 4AQYQ 2MO1A 3M9BA 4DR4L 5IP7G 1VQAA 1HZ9A 2QEXA 1KIXA 1AE2A 1BKBA 3UDIA 3PIOA 1K8AC 1VQKA 1IBML 1NE3A 2LSSA 4JBJA 4R4TA 3K81C 4OX9L 4K0KQ 1PVOA 2JE6I 4A3BH 4A3GG 4B3RQ 1NMFA 3I4NH 2ZTDA 3HOXH 4JI7L 1Q1EA 3AFQA 4UPAA 2F3IA 1RIPA 1LTLA 1ASZA 1XNQQ 1V9PA 4IPDA 1JJ2A 1SR3A 2JA8G 4HIMA 1VQEA 4DAMA 5FJ8G 3GTOH 2UUAL 3RZDH 1UE1A 1K83H 1I5FA 2N78A 3KJPA 1YI2A 2E2HH 2YU9H 4DKAC 3TS0A 3TQYA 2HQLA 3KF6A 3S14H 3L7ZC 5IP9H 4AIMA 1SE8A 1YITA 1X3GA 3CF5A 1JT8A 4Y52H 2JA6H 3HOVG 1YBYA 1V1QA 2QGQA 3HKSA 4DV3L 4A76A 4A3EG 3GTLH 2PI2E 1GKHA 2OCEA 2ZJPA 4BA1I 3M4OH 3SGIA 3S1NH 2V1CC 2VL6A 1PH9A 1M90C 1PFSA 5M5WH 2VW9A 4POGA 4DR1Q 1YZ6A 1Q82C 1PH3A 4A3IH 3PO3G 2NZOA 4JI4L 4DV7L 1X55A 5IYBH 4DV4Q 4BBRH 2DUDA 4YCWA 1SROA 3H0GG 1YIJA 2R7FA 2KBNA 4A3FG 3GD7A 1VQJA 4DR3Q 1BBUA 1X6OA 1TWFH 4C2MH 1B8AA 4GOPA 4AQYL 5IE8A 4LF5Q 2R7ZH 4A3DH 1VQFA 5ELNA 4LUZA 1Q86C 4K0KL 4DR6Q 1LYLA 3K80C 3RZOH 4HIOA 1UE7A 4A93G 4ME3A 4B3RL 3G6EA 4AYBG 4AH6A 2IX0A 2Y0SE 1TWCH 3NELA 1KRTA 3JC66 2D0PA 1CKMA 2ZM6Q 1XNQL 4P72A 3M7NA 4X65Q 3PO2H 3J81j 1NBWA 2AWOA 4TQUS 5M3MH 1AE3A 1CSPA 2HT1A 2WP8J 1K73C 1EIFA 1PH7A 1A8VA 4X62Q 3CAMA 3CCRA 4GNXA 1PHJA 2OQKA 4NXNQ 3S15H 1OXSC 3DLLA 2CFMA 1PH5A 4LF4Q 2Q2IA 5GQOA 4PG3A 5JJLA 2F4VQ 1TXYA 2RHQB 4LFBQ 4QJFA 1Y1VH 4OWWB 1O7IA 1FJGQ 3S1MH 4WJ4A 1VQGA 2R93G 4P75A 4BY1H 3I4MG 1CUKA 4DR1L 1KAWA 1SRUA 2E2JH 3M85A 3F1ZA 4A3KG 4DV4L 5C3EG 3GTGH 1DGSA 3A5UA 1HZBA 3RN5A 1MJEA 4OXPA 3E9IA 4GLVB 3PUXA 4EX5A 1UE6A 3CXCA 1YJNA 3CC4A 4LF5L 3CPFA 3T1YQ 2BH2A 2PNHA 1YHAA 4JBWA 1EWIA 4AYBE 2NZHA 5C44G 1E1OA 3BU2A 4DR6L 1N36Q 3JAMc 4NXMQ 1WFQA 5IYCH 3NEMA 1WCMG 3GTQH 2UXBL 3LGJA 3MEFA 2ZM6L 4GKKQ 1X3FA 1Q7YC 4X65L 2QA4A 1C9OA 4QGUA 2IY5B 4DR7Q 2JA5H 3CP0A 4DV6Q 5GROA 1L1OA 1TWGH 1VQBA 3W1BA 3W1GA 5JEAG 2HHHQ 4BXXH 1YEZA 3UDGA 4X62L 3A5ZB 2WAQG 1W3SA 4NXNL 1L0WA 1RL2A 4IPHA 1VQ4A 4XTCS 4YHHQ 1X65A 3I4OA 3G71A 1VQNA 3NENA 4LF4L 3A0JA 3CD6A 4A3MG 4LFCQ 2F4VL 2VUMG 1GD7A 3H3VI 4LFBL 4IFDJ 4A3CH 3D31A 1FJGL 1WYDA 2BA1A 5FLMH 4GLAC 3JAMi 4JI5Q 3J7ZC 2Q2HA 4C3HH 4A3JG 2MFIA 4JC0A 4O2DA 1XNRQ 2KHJA 2OTLA 1YJ9A 3Q8DA 3AYHB 3MXNB 1Y1WH 4KHZA 4A75A 2XGTA 1B70B 1N8RC 5IP7H 1OTCA 3ER0A 1VCIA 2NVXH 5FLXc 3RNUA 3T1YL 3PIPA 3U4ZA 3CCEA 3G48A 2ASBA 1YJWA 4BY7H 2ZTCA 4A3GH 2HIXA 1K0RA 1K9MC 4DV0Q 2YTYA 1N36L 3CCQA 2K5HA 2HIVA 1XTDA 4NXML 1X9NA 3FKIG 1QVGA 1IZ6A 2JA8H 3EBEA 1PA6A 2K75A 2BH8A 4J15A 1J6QA 3CPWA 5FJ8H 4HJAA 4JI1Q 4GKKL 1OXXK 3KF8B 1SMXA 3K8AA 2WAQE 4IOAA 2CWAA 5LMUQ 3HFZB 1Q81C 4YWLA 1IYJB 3U4VA 4DV6L 1GM5A 4DR7L 4JYAQ 2HHHL 2LXJA 2ZTEA 3HOZG 2Y0SG 3CQZH 2K5NA 4LF8Q 2E8GA 4OWTB 1Q1BA 1HNZQ 1A0IA 4A3EH 4YHHL 2YYZA 3I55A 2EQSA 4YCUA 4L5RC 1KHIA 5C4XG 1BVSA 3TRZA 4LFCL 1SLJA 3HOUG 1KD1C 2VNUD 5M3FG 3M3YH 3S1QH 2IHEA 4HIDA 1N34Q 3J7A5 1K3RA 3PO3H 2CQOA 2K14A 5C0XG 2IT1A 1K8GA 4JI8L 1V43A 1SN8A 4JI5L 3H0GH 2GN5A 3H3VH 3KFUA 4JG2A 3KLWA 4A3FH 1XNRL 3CMEA 4OO1G 3I4NG 2OTJA 1U0LA 4H02A 2E2IH 1WI5A 4O0AA 1FGUA 2A1AA 2Z0SA 3F2BA 3S17H 1M1KC 5E7NA 4HJ5A 3AFPA 2ALYB 1I3QH 1NY4A 2NN6G 1VQ5A 3CCMA 2N3SA 4PMWA 3ICEA 4A93H 1T9HA 2RHSB 1L2FA 4DV0L 1JMCA 1KXLA 2I5MX 3GTPH 1YNXA 3ERSX 4GKJL 2GVAA 4HJ8A 4DV1Q 1QUQA 4JI1L 4GLXA 3RLOA 1HZCA 1X54A 2D0OA 3CW2C 4JI3Q 3VDYA 4XIGS 1CKNA 3NBHB 1VQMA 3FHWA 4QL5A 5LMUL 1SFOH 2Z6KC 5K36G 4KHPQ 4JYAL 3T1HQ 4X66Q 1XPOA 2LXKA 2B63H 1UEBA 5JJIA 3S2DH 4QIWE 4LF8L 5IYBG 1HNZL 2MO0A 3EN2A 4BBRG 4LUVA 2JA7H 1VQ6A 1QZHA 4B3TQ 1UE5A 4B3SQ 1ASYA 3S2HH 1QVFA 2AKWB 2JJQA 4X64Q 3I4MH 2NVYH 2K52A 1NTGA 3TEHB 1EQQA 2R7ZG 4Y7NH 1PH8A 1N34L 4LF9Q 3GTKH 4LWCA 3U50C 3KJOA 5JJKA 4A3KH 1JJGA 5C3EH 4DK3C 5HGQA 4LF6L 1N33Q 1XMOQ 2Q2TA 5ELOA 1PYBA 2N49A 1P16A 4JOIC 5IYDH 4DV2L 4DUYQ 2E5LQ 3FP9A 1VS0A 2Q2UA 3I2ZA 4JI6Q 3HOYH 3PO2G 5C44H 3J81c 1VQCA 2OQ0A 3KF6B 4C3IH 2FXQA 5M3MG 4LNQA 2ID0A 2AMCB 3B6YA
chains in the Genus database with same CATH superfamily
2A6ED 4RMFA 3PIO3 1KL9A 3PF4A 1FL0A 3DEOA 4BA2I 3CC2A 2KHIA 3C46A 5M5XB 2A8VA 1JWSD 1D5ZC 4B9WA 1Q12A 1KABA 4KHPL 1BNZA 4BY1G 5IOCA 5C0XI 1XPRA 3M4PA 3E9HA 4R4CA 3ULLA 2HCCA 1D8LA 4GN3B 4OGQC 4YWKA 1JOKA 1FGBD 3J81i 3VR6A 1JE4A 5I6WA 3PUZA 3R8BA 1HUMA 1U5KA 4DV5L 2F0FA 1V1PB 3MXPA 2EDGA 2NN6I 1MSGA 2MP1A 4ZK9B 1QUQB 4JI8Q 4BBSB 3P20A 4HAEA 4POFA 2D62A 1X56A 1XMOL 2CCZA 3MFGA 3OMGA 1FNWA 4DUYL 1PYSB 4A3MB 3RLFA 4ZQ3A 4IURA 4HJ7A 4JVZA 1MD2D 3OYYA 5DM73 5JOBA 1RTNA 3D4RA 3HOZH 2B29A 4GNXC 1LLRD 3P7JA 2J4XA 1LO5D 1MSHA 2YTXA 3F2CA 1EUJA 2N88A 5A2QL 2YTVA 3CCJA 1EYGA 5C4XH 1ZXTA 5HURA 4P2CB 1KQSA 1FVIA 1IKLA 2JEBI 2R92G 1A3TA 2NVTH 1JOQA 2NVQB 4EQ5A 3S1RB 3Q24A 2KJXA 1QZGA 3BZDB 1IXRA 1JQYD 4PZ8A 1SYDA 1I6HH 4DV2Q 4QY7A 1L1OB 3H15A 3Q6SA 1EYAA 1PTOB 4K2KA 2RDGA 1OXUA 1PYWD 3NSWA 3SDZA 2KQ3A 4E6IA 1WVLA 1J5EQ 1HZAA 3I4NB 5HGTA 5LMNQ 2L1BA 2JA6G 5KNDA 5GAEC 2VQEQ 2PQAA 2WFWA 3M4OB 4P73A 2E2HB 1K83B 4RG1A 3E6ZX 1PXUA 3HGBA 5K5PA 1HR0Q 1WOCA 1NSNS 2ES2A 3S14B 4R1JA 1PH6A 1SNOA 1G2SA 2KENA 2CVRA 3VYSA 3TZUA 2F0EA 1D1IA 2L4NA 1S40A 4IOCA 4G7OC 2WKDA 1SE2A 3D8GA 1E7ZA 1SYFA 4KLKA 3GTLB 2R93H 4KMUC 3S1NB 1F9QA 1HXYD 3M4QA 3AMUA 1HNXQ 4HIKA 3DHQA 5M5XH 1BBWA 2F0LA 3VA5A 2SNMA 4JBKA 5CV5A 5F2DA 1Q90A 1U4RA 1IYUA 1ILQA 3J81L 2AUJD 1J8IA 4YCVA 5A2QE 1HJPA 4XQNA 4LW1A 4TVAB 2PCFB 4L5TA 1NJIC 1W2BA 5EPJA 1CHPD 2EJMA 1DYQA 1K3BC 2VQEL 2Q8IB 2JQOA 4BBSH 5IY0A 1SEBD 3E0EA 1YNNC 1HR0L 1LTAD 5AJ3Q 3X3MA 1D1KA 4A3MH 2IHFA 2KCMA 1TY2A 4KV6A 1X3EA 3S24A 4OX9Q 1KRSA 3HG9A 1HNXL 2B2VA 2GVBA 2A6HD 5IYCG 1AZQA 1HRJA 4ID6A 1QE6A 2A5HA 2I07B 2Z6KA 1C7YA 5CV4A 1UUPA 2JA5G 4O1NA 4X3UA 4IPGA 5EKIA 2R7DA 2H1EA 1F9PA 4MTNA 3VYTA 4GS3A 2NVQH 5DLQE 1STHA 3QWNA 3HKZG 1G51A 1VMCA 4I7AA 3MVVA 1VQ9A 5AJ3L 1H9KA 3HOWH 4UY8C 4UP7A 1LT3D 4WORA 3M9BA 1KIXA 1PTOH 4I7ZC 4K0KQ 4JBJA 4R4TA 4OX9L 4CKCA 1CZGA 4A3GG 2CQAA 1A6XA 3I4NH 2ZTDA 1Q1EA 2R3ZA 1TT2A 4JW0A 1JJ2A 1Y1WB 4HIMA 1B3AA 4DAMA 5COYA 3PQIA 2E2HH 1UE1A 1K83H 3OIPA 5D3DA 4IQZA 4BY7B 3KF6A 3S14H 4AIMA 1SE8A 1X3GA 1QG7A 3HKSA 4A3BB 2PW7A 3MWYW 3HOXB 2O5IC 3GTLH 2PI2E 3SK5A 5FO8B 5I2YA 2EZVA 3S1NH 1M90C 2M9VA 4DXFA 3EJIA 1X55A 1XTCD 3DM1A 3SHLA 1BBXC 1ONLA 2KBNA 1AZPA 1S5CD 4DR3Q 1EY0A 4NMZA 1B8AA 3BDCA 1GUNA 2K04A 4HEDA 3M3YB 4KTAA 3S1QB 4K0KL 3PO3B 4EQNA 1GUGA 3H94A 3RZOH 4ME3A 3G6EA 4AH6A 3NELA 1TWCH 2D0PA 1CKMA 1T5EA 2NUCA 3S17B 3J81j 3MXNA 4XQQA 1EIFA 4GNXA 3CCRA 4A93B 2F03A 3EROA 4HMJA 4KJOA 1H9SA 2QDBA 5JJLA 2D9UA 1JC7A 2Z9HA 1HA6A 1FJGQ 4GZYC 3LX0A 2IJ0A 2R93G 1SFOB 2PZTA 4KKTA 1DOMA 3PUXA 3CXCA 5LL6X 2JA7B 3VYUA 3CPFA 3CHBD 3T1YQ 2PNHA 1QCBD 1ZYRD 4KY5A 4HSVA 1EQVA 1WFQA 4HTHA 2KVMA 4MN3A 3HEJA 5FO7B 4GKKQ 2CH4A 3W3AA 1I4HA 3BYYB 2QA4A 5D3IB 1DD2A 2RQXA 2O2LD 4DR7Q 4OIJA 2F0HA 4BXXH 1W3SA 2Z6BA 2F4IA 1RL2A 1VQNA 1VQ4A 4XTCS 3G71A 4IOAA 3I4OA 3CD6A 4IUVA 5FOBB 4A3MG 3R2TA 1GD7A 3H3VI 4CDDC 4A3CH 1FJGL 4J8QA 5FLMH 3J7ZC 2Q2HA 4ILWA 1XNRQ 2AQ2B 2KHJA 2OTLA 3AYHB 1Y1WH 4ZLTF 5IP7H 3D4WA 2F0JA 5FLXc 3T1YL 3PIPA 1CHQD 4OIKA 4PMCA 4BY7H 2ASBA 2ZTCA 4B08A 3VYRA 3I72A 2HIXA 4N9TA 2YTYA 2K5HA 2XN9C 1XTDA 4MIUA 1QVGA 4L8JA 2BH8A 3CPWA 1J6QA 3BDLA 5FJ8H 3Q0AA 4C3HB 4GKKL 3K8AA 1J9OA 4DR7L 1IYJB 3WOFA 2QKIC 1GHKA 3A55A 4LF8Q 4OWTB 1H9JA 1Q1BA 4CDEC 4A3EH 2YYZA 2VB2X 4YCUA 4IUTA 1SLJA 2JN4A 2JA8B 5BN5A 3M3YH 3S1QH 2IHEA 4HIDA 3PO3H 3H0GH 4JG2A 1KDBA 3JAME 1XNRL 3I4NG 1U0LA 4H02A 1WI5A 3S17H 4Q0FA 3MA2B 1M1KC 4U68A 4YIJA 3M4YA 2GA4B 1LT5D 3CCMA 3SVMA 4A93H 4FP5D 1T9HA 2EJFC 1I4RA 2RHSB 4L6TB 4F7XA 2BDOA 2X6GA 3GTPH 3ERSX 4GKJL 1GXDC 1UNSA 3CW2C 4A3FB 4WRDA 3QO2A 1SFOH 5K36G 1PFBA 2X69A 2LS01 1XPOA 1UEBA 1R4QB 4LF8L 4XT1B 2MO0A 2JA7H 1QZHA 5BN3A 4B3TQ 1UE5A 4IN3A 5LHY1 3MEHA 1QVFA 2AKWB 2JJQA 1EQQA 4Y7NH 2A68C 4LF9Q 2RBMA 4DK3C 2PQEA 1N33Q 1LTBD 4LMQD 2Z1CA 2XWBB 2N49A 1P16A 1DM0B 3RD4A 5E1FA 1ENCA 1BXTA 2XIWA 3I4MB 3QG1A 2L12A 1B50A 4PMBA 1YHQA 3DWQA 3EIVA 4A3KB 2PO4A 5C3EB 5LL6S 4DAVA 1BCPF 3CCSA 3DM3A 5JEAH 3UDXA 1CT1D 1EU3A 1FR3A 4DR2Q 2G5DA 4A3LH 1HQRD 4O42A 4CJ1B 1EZ6A 4HMIA 1O78A 3U9OA 1WTXA 3PUWA 5IWAL 5J1ZA 1AP0A 1YHBA 2XSCA 1SNQA 1WCMB 4B3TL 3R2IA 4GOPB 4OO1I 4DNIA 1GO3E 4LF9L 5CBAE 5CR3A 5EKKA 2PMZE 2WAQB 2AHOB 5ELBA 1VDZA 1N33L 1WTRA 1S5BD 2ZXPA 1G291 1F2ZA 1E3PA 1HTLD 1D2BA 3E5SA 2LMCB 3PMFA 1VQDA 5FLXL 3GQBA 3TS2A 4YY3Q 2K5QA 2NTSA 5M9OA 4BXXG 4PZ7A 3KYHC 3UE1A 3I91A 2RF4A 4XYOA 3GTMB 1SNPA 2VXWA 1VQLA 3TREA 1A3VA 3FEWX 3K7AH 4DR2L 5ELEA 5FLMG 5M5YH 4Z9CB 1RCVD 3FKIB 2F0TA 1Y1WG 2BA0A 1SYBA 5C0XH 3PUVA 4BY7G 2K28A 4A4IA 1G8ZD 3T53B 2B39A 1JB7A 2J7ZA 2KCTA 1CM9A 1U4LA 3CMAA 4FYDA 4A3BG 1NMGA 3HOXG 3TP7A 4CJ0B 5I9PA 1XMQQ 4QIWB 2EYMA 4JCVE 1K28A 2IL8A 3ONAB 2J0TD 5H1SE 5M3FB 3IFTA 4YY3L 3I7FA 1EY9A 1G6PA 2NVTB 3A74A 1ESFA 5IP9G 3KBGA 1LUZA 3HKZE 3H09A 3O13A 2O5JC 2RKSA 1QVCA 1L1OC 3J80E 1I6HB 2N8NA 3OSOA 3RZDB 1STEA 2CW0C 1Z47A 1BCPD 1SNDA 3ZJYC 1EOTA 4N8X1 3OWEB 3ULPA 3V96A 4DV5Q 1CSQA 4UDUC 1VQ8A 1N32Q 2CHBD 2F0SA 4DPGA 4HJ9A 1YNJC 4A3IB 2OWOA 1NAPA 1STGA 4KHVA 4S3SA 3PGZA 3D0FA 1XMQL 4IO9A 5EQ0A 3MC0B 2BE5D 3I56A 1D5MC 3EVQA 1H9RA 1F9RA 1WCMH 1L0YB 2IW3A 5I9OA 4IUQA 2JA7G 2UXDQ 3A8JE 4GN5A 3U58A 1V8QA 1CQFA 3FPUB 4XXEA 3KF8A 2RSOA 1MJCA 1OXVA 2EIFA 1IL2A 2ZT9C 4BS9A 1EU4A 1KDAA 1OO9B 3S15B 2PPBC 3T56B 3KLSA 1H95A 5C4JH 1WTOA 1Y1VB 4R8NA 1W6KA 1LABA 2F0PA 1N32L 3GTMH 1EIGA 1EYCA 1SYEA 3OW2A 2M00A 2PQAB 4L5SA 1SDFA 3ZYYX 3IRBA 3FPPA 2EY2A 2CKZB 4A3LG 1F9SA 2H5XA 4APVA 4PV1C 3FKIH 5CV8A 2Q8RE 4JK1C 3BDOA 3S9WA 4DV3Q 2UXDL 2RCNA 1FNVA 2F0KA 1NCVA 3SK6A 2WB1G 3F8TA 2K7VA 3NXWA 1TS3A 4WJ3M 1TWGB 3A56A 2BDNA 3L0OA 5FK9C 1IYVA 3SR1A 4H13C 3NWSA 1KAAA 2DGYA 4C3HG 3DUZA 3QB3A 5M3FH 1AE2A 2B2YC 3PIOA 1VQKA 2LSSA 3K81C 3ND9A 4MHEA 2JE6I 4B3RQ 2K32A 2F3IA 1ASZA 1XNQQ 1V9PA 2HD3A 4IPDA 1SR3A 3C3LA 2JA8G 1AFPA 2FINB 2NVXB 3RZDH 3HOWB 1I5FA 2WINB 3KJPA 4K5VA 2KUMA 1E2ZA 1JT8A 2QW7A 4N9PA 1F2YA 2QGQA 1HCZA 4QUFA 4DV3L 4QUCA 5EPKA 1LTTD 1GKHA 2OCEA 2ZJPA 4BA1I 3D3RA 2G9DA 3SGIA 3V2TA 1PH9A 1PFSA 5M5WH 2VW9A 1XYIA 4POGA 1Q82C 1PH3A 4A3IH 3P1HA 4TSSA 3GV6A 4DV4Q 2ICEC 3A8IE 2DUDA 4YCWA 4DK0A 2SEBD 5KYIA 4A3FG 3GD7A 1VQJA 4C2MH 3MFYA 1QB5D 4A3DH 2X6LA 3NWTA 1VQFA 1G2TA 5ELNA 4LUZA 1Q86C 4DR6Q 1PFNA 2F0NA 4NKLA 2M2LA 1V1PA 4B3RL 1PFMA 2UXBQ 1XNQL 4P72A 3KUPA 3U9SA 3T51B 4G7ZC 1NBWA 1AE3A 2WP8J 1U4MA 5C5LA 5BN4A 1BO0A 3CAMA 4RKLA 3S15H 1OXSC 2QDLA 4IFDH 2Q2IA 3RZOB 5IT9E 1SMYD 4HCSA 4LFBQ 4FNFA 4CHTB 4QJFA 1TWCB 1Y1VH 4OWWB 1ICFB 3I4MG 1IW7D 3M7GA 1JR0D 4A3KG 4DV4L 5C3EG 1HHVA 1HZBA 3MTSA 4OXPA 3NBIA 3T4AC 4EX5A 1YJNA 1UE6A 1FNUA 2EY6A 1EWIA 2K1BA 4AYBE 1DJRD 2NVYB 4DR6L 3JAMc 4NXMQ 1G91A 3D6CA 1WCMG 1C8CA 2UXBL 3MEFA 3L9AX 3QOLA 1C9OA 1L1OA 1M8AA 1TWGH 5C44B 4LK1C 1C48A 1YEZA 2WAQG 2F0DA 4YHHQ 1X65A 2PYKA 3J7AF 1LV9A 1TWAB 2EE1A 4LFBL 4DXGA 1KDCA 2BA1A 3NBHA 3JAMi 1TIID 2L9HA 2XRSD 4RHRA 2MFIA 2B2UC 1MBYA 1B1ZA 1ENAA 3MXNB 1GJXA 4A75A 1N8RC 2A6EC 1JOOA 1VCIA 2NVXH 3RNUA 3CCEA 3G48A 2O4XA 3CCQA 4DA2A 5E4XA 4NXML 3EA6A 4IALA 3FKIG 5T1GA 3EBEA 1SAPA 5G3LD 4C3JB 1OXXK 1BOSA 5LMUQ 1PRTF 3HFZB 3U4VA 2A69D 2LXJA 2OEOA 2Y0SG 5DM63 3HOZG 5CMDA 4JPBW 2E8GA 2QILA 1A0IA 4YHHL 1SE3A 2EQSA 5C4XG 1BVSA 1RD9D 5KIXA 1KD1C 4K5WA 2KECA 2WACA 4WFN3 5M3FG 1JORA 1HUNA 1N34Q 1D5XC 2CQOA 1K8GA 1EFID 4H0LC 1SN8A 1B53A 3H3VH 3KFUA 2MGSA 1ENFA 4KKSA 4ZYSA 3CMEA 2RVLA 1HTPA 5DNFA 2L0CA 4O0AA 1FGUA 2Z0SA 3F2BA 5E7NA 4A3EB 3NE5B 4HJ5A 3AFPA 2ALYB 1NY4A 3G7LA 4X3TA 1LTSD 2E74C 4PMWA 4K6DA 1L2FA 2JP1A 1IL8A 4CDFC 5A35A 5IGBA 3Q22A 3MXUA 5JJZA 3H0GB 4DV1Q 4R9WA 4JI3Q 2SOBA 1HZCA 1X54A 5T1IA 3RLOA 3VDYA 1CKNA 5LMUL 1SBBB 3EQLC 4OEMB 3T1HQ 3A8KE 1O7YA 1EY5A 3IFDA 3NTKA 2L5TA 4OHJA 4B3SQ 3GTPB 1ZKOA 2NVYH 3TEHB 1N34L 2JXMB 3GTKH 1EEFD 4LWCA 3U50C 1JJGA 2B2YA 2FMMA 5HGQA 1SYCA 4LF6L 1I6VC 1PYBA 4JOIC 4RGTA 2E5LQ 3DXJC 1BCPB 3I2ZA 3TP5A 5C44H 1CA5A 1VQCA 2EOTA 2JSOA 1CFMA 2AMCB 1TR5A 3B6YA 1P8LA 4DFAA 4Y7NB 4LF7Q 1K8OA 2C35B 1TWAH 4IFDG 3JAML 4DV1L 4JI3L 1JE5A 5LMNW 4RCOA 3URYA 4K6LA 4V0BA 1O7ZA 3DWAA 2XWJB 2I46A 3CCVA 2HDMA 3T1HL 1WD1A 4OONA 4YWMA 4DNTB 2WV6D 4HSPA 4BBSG 4L5QA 4LFAQ 2VQFQ 1HR0W 1JB3A 3P75A 2ATWA 4R4OA 4UP8A 1PRTD 4DK6C 2B3GA 4B3SL 1YVCA 3J80c 5TSSA 1PH4A 1I4XA 1XJVA 5KYLA 3MXGA 3BZKA 4C3JH 4G4KA 2K33A 2E5LL 2K5VA 4GOPC 3QOJA 3NTHA 4JI0Q 4DAPA 5KEEA 4KK7A 4MTKA 3CCUA 3K59A 1WJJA 4P74A 4HCEA 5J3BA 5I4DA 4LF7L 3MZ5A 4GN4B 4BWGB 4GKJQ 1MGSA 3J80i 1AN8A 4WJWA 3CRLC 3BZCA 1Q46A 2G9HD 3OHXC 3W5OA 4FXDA 5JEAJ 3PUYA 4FDBA 1E1TA 2VQFL 4LFAL 3PV0A 1G6ZA 4V190 3HOWG 1I50H 3UE0A 1EQRA 4HN7A 1S5FD 4OO1H 1PDQA 3SXHA 4DAYB 3K7AB 3LWEA 2IX3A 1RODA 1RKNA 1N9WA 5M5YB 3RLNA 3TMEA 1IBLL 1YNJD 2I5HA 2D2CC 3KDFA 4C1NI 2R6GA 2UUBL 3HOUB 1VQIA 1U9RA 4JI0L 1WD0A 4JV5Q 1Z7TA 2WB1E 3GTJH 2V4DA 4RKBA 3SK8A 3K7UC 4KY7A 2EYJA 1O80A 3GO5A 5FKAC 3GTOB 2MUYA 5EPLA 1I94Q 2YU9B 1E0BA 4DUZQ 2RA4A 4JI2Q 2B2UA 5BR8Q 5IWAQ 5GAHC 1Q8KA 1GOZA 2Z4HA 2PZWA 2UUCQ 3OMCA 1DXMA 2A19A 4RHSA 3I70A 5GAGC 3BJUA 5C0XJ 1NNXA 2F52A 1E2WA 3VR4A 5GADC 5CYUA 1OXTA 5ISRA 1TWFB 4JV5L 1TY0A 1KC8C 2LKVA 2P5ZX 4K2LA 3PSIA 5HY6A 5C4ZA 4LAAA 4KN7C 1EL0A 4QCLA 1JWUD 4NB3A 5JVG3 5C4HA 3KLSX 2PMZB 3FDTA 3OW7A 3PO2B 4X3KA 4Q5VA 5M3MB 1I94L 4J6HA 5E3FA 3VR3A 4DUZL 4R4QA 4JI2L 5BR8L 1EWHA 2YV5A 2UUCL 3I8ZA 4DR4Q 3CU7A 4OWXB 1IBMQ 3J80L 3S1MB 4RGOS 4P71A 2XRQD 1PZKD 2L11A 4JI7Q 1EY4A 1JJCB 3GTGB 4ZCKA 1BDOA 1LTRD 3W2DA 5JVH3 1CKOA 5FO9B 4UP9A 2B8FA 2MQHA 3AU7A 2UUAQ 3K5MA 1QJOA 1U4PA 5C4JB 3STBC 1A3UA 2EY5A 2CWPA 1QWYA 4FXKC 2BOSA 2Z8LA 1QNKA 3FMCA 3GTQB 1GUSA 2HCIA 4PQXA 2HQEA 2ZXRA 4A3CG 2L15A 4JI4Q 1SXTA 3ULJA 1ZYRC 3WWVA 5IT9c 4JOIA 1I4PA 1A63A 1RTOA 2R92H 3HOUH 1GVPA 4AQYQ 2MO1A 4DR4L 5IP7G 1HZ9A 1B44D 1RF2D 3UDIA 2EJGC 2TSSA 3HKZB 1NE3A 3D4DA 1IBML 1PVOA 1S5ED 4JI7L 3QR8A 1IKMA 4UPAA 1RIPA 3A7LA 1EWCA 5FJ8G 2NN6H 3GTOH 5KGUA 2UUAL 3NHHA 2N78A 2YU9H 3TQYA 2HQLA 4A3GB 3L7ZC 4ME5A 1YITA 3CF5A 3QJYA 2JA6H 1YBYA 4A3EG 2DY8A 4FO2A 3NP8A 2K03A 4KY6A 3V05A 2VB3X 1S5DD 2VL6A 1CZWA 4DR1Q 3PO3G 2NZOA 4JI4L 3FRPB 3SK4A 5IYBH 1PTOC 1SROA 3H0GG 5CV6A 1B9NA 1BBUA 4LF5Q 1QILA 1TWFH 4GOPA 4AQYL 4NW2A 5IE8A 2A74C 1QNUA 1YNND 2EYFA 3BYTB 1LYLA 2XVSA 3K80C 2JYOA 4A93G 1ZEQX 4UAIA 5M5WB 1RDPD 4H7BA 2IX0A 2Y0SE 1SE4A 2AQ3B 2NWGA 3FVQA 4NDXA 3PO2H 2E2IB 2IWHA 2AWOA 5M3MH 1CSPA 2PNRC 1KLGD 4C2MB 1PH7A 4A3DB 3E0JA 1E2VA 1A8VA 4NXNQ 1MI2A 2TMPA 1PH5A 1FD7D 5GQOA 4LF4Q 4PG3A 1LTID 2RHQB 4DNRB 2EY1A 3S1MH 4WJ4A 1VQGA 2R61A 1CUKA 4DR1L 1KAWA 4HR7B 3F1ZA 1O7LA 2B63B 3GTGH 1DGSA 3RN5A 5D65A 3E9IA 4IUPA 4ZUJA 4LF5L 1HFNA 4JBWA 4FF4A 1ESRA 3NUCA 4U673 4IUNA 5C3XA 5EBCA 2E76C 1N36Q 1TS4A 1EY6A 5JPMC 1EY7A 5IYCH 2B8GA 1HPCA 3CRKC 3NEMA 1AEXA 1FYCA 3GTQH 2F0UA 1X3FA 4C56C 1Q7YC 2XNAC 4QGUA 2JA5H 3HOYB 2HHHQ 5JEAG 3G6JB 3UDGA 4C3IB 1BQQT 3K5OA 1XX8A 4OELB 4NXNL 1L0WA 4G57A 4LF4L 3A0JA 4LFCQ 4EQPA 4IFDJ 2K05A 3D31A 1WYDA 2HDLA 2Q8TA 4JI5Q 3ERQA 4O2DA 1VF7A 4DK1A 1II3A 4KHZA 1B70B 3VA7A 3ER0A 5IT9L 3U4ZA 1LTGD 1PRTB 3KK7A 5CV9A 4A3GH 1K0RA 1K9MC 3NQTA 1N36L 3DEPA 1QOHA 1IZ6A 4B9XA 4J15A 4IZ8A 1HQMC 2ENBA 1STAA 4YWLA 2MPMA 4JYAQ 2HHHL 1SJED 3N52A 3DMUA 5IGFA 3J7YW 3S16B 1EYDA 3UI2A 1HNZQ 2D5DA 3I55A 4L5RC 1Y8OB 1KHIA 3TZDA 4LFCL 3HOUG 1B4OA 1K3RA 5C0XG 1S4ZA 4JI8L 4JI5L 4RAUC 2GN5A 3GP7A 3KLWA 5AFWA 2OTJA 1R4PB 2E2IH 1M4VA 3HOVB 1PMRA 3TP6A 4CJ2C 3R3OA 2NN6G 2KCCA 5G3LF 1T5XD 1KXLA 2I5MX 1JICA 2GVAA 4ZUIA 1QUQA 1SSOA 2IPKD 4GLXA 1KLUD 3NBHB 5CORA 1VQMA 1BF4A 1C4QA 4QL5A 3IAYA 5EBDA 1F77A 4JYAL 4X66Q 4FF3A 1STYA 2LXKA 2B63H 1STBA 1H9MA 5IYBG 1HNZL 3EN2A 4J1MA 1VQ6A 4AYBB 2KEDA 4X64Q 2C5CA 1TVXA 1WTWA 1PH8A 3KJOA 5JJKA 5JPNC 5KNBA 1DOKA 3OIQA 3QIAA 5CGKA 2Q2TA 4H44C 1NR2A 4CBVA 3I4LA 5IYDH 4DV2L 1L0XB 1B3QA 3A54A 2K5WA 4JI6Q 3HOYH 3PO2G 2EYHA 2LFNA 4FF1A 1SYGA 2OQ0A 3KF6B 2FXQA 3DWPA 4C3IH 5M3MG 4LNQA 3LWUA 5C3WA 1J5EL 3GTKB 2JA9A 1GUOA 5LMNL 2ZJQA 1VQOA 1Y8NB 2F0MA 5IGGA 2DNEA 3HP3A 2UXCQ 1PH2A 1BCPC 1HNWQ 4X66L 4X6AH 2FJ2A 2L55A 1KNAA 2ICIA 3GDEA 1E22A 2F0IA 2MJ8A 5IGDA 1B2TA 4DGZA 2UU9Q 1SNCA 1AW7A 4X64L 2EXZA 2RDHA 4IJHA 1CKNB 2BE5C 1WTPA 2I5LX 3BVGA 1GUWA 5L37A 2FFKB 1MHWC 1S3OA 5C5MA 2VUMB 4JI6L 2EVBA 2EXDA 2KCNA 3Q23A 3TN2A 3G4SA 4GNXB 4MNOA 3S16H 1RJTA 1IBKQ 1BUVT 2KOLA 4LUOA 1WTHA 1H9SB 3BVMA 4A3JB 4R8IA 3F2DA 1EOVA 2WKCA 4R4IA 1EQTA 4IPCA 2UXCL 1Y14B 2LY7A 2BCOA 3S1RH 5JAVA 1PZID 1V1OA 1TWHB 4B3MQ 4XDXA 1HNWL 2DNCA 4K8IA 1R9TB 5CV7A 2F0OA 3TBIB 3OWFA 3HOVH 1S72A 1F2LA 1E24A 2B2TC 1A2UA 1PLFA 1MKHA 3AQQA 2UU9L 1XPUA 3OOCA 4IJLA 3UDFA 3J81E 2NZ1D 1VQPA 1EIYB 4LF6Q 4M1UB 2A68D 3M4OH 1Z9FA 2ZXOA 1X3PA 3E3XA 4IFDI 2F3VA 5I2XA 3K5LA 1EY8A 4QB4A 1UAPA 2QF7A 1Y8PB 1UWVA 1IBKL 2K50A 4X3SA 1A62A 3N6RA 1I50B 5D14A 1HA5A 2RDFA 2IX1A 3EFXD 2VZAA 5K36H 5IIFA 5EGTA 1GUTA 3T13A 1LM0A 5CC4A 4B3ML 1PTOF 1B7YB 4L63B 1GHJA 4UHVA 4F8MA 1PV4A 3CCLA 2PW5A 4DU9A 4A3IG 3OTOQ 4QQBX 1LT4D 3LNNA 3TDQA 3GTJB 2XTIA 4DR5Q 4NPSA 4RH6A 4A3DG 5ELFA 3T16A 5EAYA 3F2UA 1VQHA 3C2PA 1ET6A 1UEAB 3CKIB 2JEAI 4BBRB 2VS1A 2PZUA 4CKBA 1C0AA 2R7ZB 1CA6A 1I4GA 4QF4A 3RMHA 3PIP3 2JK8A 2B63G 1VF5C 2PI2A 4KN4C 4DF7A 2MNAA 4K14A 4ODGA 3STBD 3CC7A 4KI0A 2ZJRA 2E75C 1W6JA 4ULLA 2B2WC 5KNCA 5I6YA 1Y1VG 1D7QA 2K4KA 2KA7A 4TRDA 3AEVA 5IGEA 3PCOB 4JBMA 3KDFB 3OTOL 3K0XA 1AH9A 4DR3L 3PF5A 3I3CA 2VUMH 3RR5A 5IYDG 2I0QA 2F1MA 4DR5L 3HOYG 3KOJA 4MZ9A 1MIUA 4C3IG 4F88A 1PH1A 4A3JH 4BY1B 1Q8IA 3RN2A 5ELCA 2E2JB 4ALPA 2A73B 2NBFA 3MHBA 1TS5A 1IBLQ 1ILPA 1TWHH 4FXGC 2UUBQ 2EYOA 1VQ7A 1SMYC 3C1EA 1DOLA 1R9TH 1HH2P 3WOEA 3R93A 4LJZC 5EJWA 4ABNA 4N8FA 4PZ6A 2AWNA 1IW7C 1IHZA 4RGMA 1BR9A 2NB0A 1EFWA 1CK1A 2VY3A 4XYQA 1NR4A 5KRUA 2CH4W 2F0WA 3L2PA 2OXPA 3I90A 1TQOA 4DV7Q 2OF1A 3I73A 1SJHD 1WTVA 2C9OA 1DZ1A 5IGCA 1WTQA 2WB1B 2CW0D 1PTOD 2QEXA 1VQAA 1BKBA 1K8AC 5ELDA 2A6HC 4RA8A 3GV3A 4A3BH 1NMFA 4NP5A 1KNEA 5J39A 3HOXH 2K5DA 3AFQA 3L3OC 5CBEE 1LTLA 1Y69U 1XXGA 1VQEA 3TSSA 2EYPA 4FVMA 5EKLA 2F0VA 2R92B 1YI2A 3H91A 4DKAC 3TS0A 3AB9A 1K8MA 1JWMD 5IP9H 1K0SA 1F2MA 4Y52H 3HOVG 4ZRZA 4CGYB 1V1QA 4A76A 4EQOA 4KD4A 1SNMA 1Q3LA 3HZXA 2V1CC 1CTMA 1YZ6A 5DAUA 3CQZB 4DV7L 5J22A 4BBRH 2K6AA 1YIJA 2R7FA 3NQIA 1X6OA 2R7ZH 4K5XA 1KTKA 2JA6B 1PZJD 1RHPA 3KBXA 2NYZD 3BG3A 4HIOA 1UE7A 1TS2A 2DJFC 2KHSA 4AYBG 2KEEA 2A69C 1KRTA 3WDNA 3X3NA 3JC66 2E2DC 2ZM6Q 3M7NA 4X65Q 2H4OA 4G7HC 4TQUS 4RFBA 2HT1A 3SEBA 1I3QB 1K73C 1ET9A 4X62Q 3NTIA 1PHJA 2OQKA 3DLLA 2CFMA 1TKWB 1XWEA 2B2TA 5E4WC 2F4VQ 1TXYA 1O7IA 4P75A 4BY1H 3IKJA 1SRUA 2E2JH 3M85A 3VR5A 3A5UA 1MJEA 5IODA 3S2DB 4K8JA 4GLVB 3CC4A 1A15A 2AUKA 2BH2A 2OT2A 2WIIB 4EGVA 1YHAA 3OPOA 3S2HB 2NZHA 5C44G 1E1OA 3BU2A 4ZKCB 4DAYA 3VR2A 2F0QA 3LGJA 2ZM6L 2SNSA 4X65L 4XT3B 2IY5B 4M8AA 4KKUA 3CP0A 1EEID 5GROA 4DV6Q 1VQBA 2DJGC 3W1BA 2F3WA 3W1GA 4F87A 4X62L 3A5ZB 3KLRA 4IPHA 2NTTA 4C1NK 3H6MA 3NENA 2F4VL 4OL7A 2VUMG 1ML0D 2F0GA 2RSNA 4EVOA 1X3QA 3BS1A 4GLAC 5C6AA 2JA5B 4C3HH 1EZ8A 3NK9A 4A3JG 4JC0A 4FF2A 1VMPA 4IUUA 1YJ9A 2DN8A 3Q8DA 1OTCA 2XGTA 1CQVA 4RGNA 4C3JG 1Z6HA 2FHTA 1I4QA 1YJWA 1X32A 4DV0Q 1LT6D 2HUGA 2HIVA 3HS0C 1X9NA 3C1FA 2JA8H 1PA6A 2K75A 2N55A 3ND8A 3SE0A 1LACA 4HJAA 4JI1Q 2QEJC 3KF8B 1SMXA 2WAQE 1EIHA 3MAQA 2CWAA 1Q81C 2DY7A 4XQJA 4DV6L 1GM5A 2B2WA 2ZTEA 3CQZH 1PRTC 2K5NA 4QMGA 1CI3M 4KJNA 3BVZA 4DN4M 3HRZC 3TRZA 2AQ1B 2VNUD 2Z4IA 3J7A5 3HOZB 2K14A 2RCFA 2Y0SB 2IT1A 1V43A 2EYLA 4A3FH 4OO1G 5NUCA 4RCNA 4ZKBB 5C4XB 3K5NA 2A1AA 4CDCC 1HFGA 4PNYA 1I3QH 2SDFA 1VQ5A 2N3SA 4I65A 4KD3A 3ICEA 2QCPX 1DCZA 4DV0L 2EPBA 1JMCA 3J7AV 1ICWA 2B2VC 3K6OA 3K57A 1YNXA 4HJ8A 1NUCA 4JI1L 3NPPA 2D0OA 4XIGS 2FMCA 3FHWA 4RWSC 2Z6KC 4KHPQ 1D6EC 4CKEA 5JJIA 3S2DH 4QIWE 3IL8A 3K58A 1JCKB 4TKOB 4LUVA 4BBRG 3K0YA 5DEHA 3H3VC 3TP8A 1ASYA 3S2HH 2R7ZG 2K01A 3I4MH 2K52A 1NTGA 5FLXE 4A3KH 1A2TA 5C3EH 1TU2B 1B9MA 1XMOQ 5ELOA 1STNA 2MHVA 4ZAIA 4DUYQ 3FP9A 1VS0A 3ITPA 2Q2UA 3J81c 3A7AB 3RUZA 3D6WA 1DONA 2ID0A 2R93B
chains in the Genus database with same CATH topology
1P8LA 4RMFA 1YHQA 1J5EL 1KL9A 2JA9A 3EIVA 4LF7Q 3PF4A 2C35B 5LMNL 1TWAH 1FL0A 2ZJQA 4BA2I 3CC2A 4IFDG 1VQOA 4DV1L 2KHIA 2A8VA 4JI3L 1JE5A 5LMNW 3CCSA 3DM3A 1PH2A 2UXCQ 3UDXA 1Q12A 4A3LH 4DR2Q 1HNWQ 4KHPL 3T1HL 4X66L 3CCVA 4X6AH 4BY1G 4OONA 4YWMA 5C0XI 3GDEA 1E22A 3PUWA 5IWAL 1XPRA 4BBSG 1YHBA 3M4PA 4L5QA 3E9HA 4R4CA 4LFAQ 3ULLA 2VQFQ 1HR0W 1D8LA 4GN3B 4GOPB 4B3TL 2ATWA 4R4OA 4UP8A 4YWKA 4DNIA 4OO1I 4DK6C 2B3GA 2UU9Q 3J81i 4B3SL 1YVCA 3PUZA 4X64L 3J80c 1GO3E 1U5KA 4DV5L 1PH4A 4LF9L 1XJVA 2NN6I 1QUQB 2PMZE 3BZKA 2AHOB 4JI8Q 4POFA 1N33L 2D62A 1X56A 1XMOL 4C3JH 4IJHA 2CCZA 1CKNB 1I6HH 2I5LX 4DUYL 1PYSB 1G291 2K5VA 2E5LL 1S3OA 4GOPC 1E3PA 4JI6L 2EXDA 4JI0Q 3RLFA 3G4SA 4GNXB 1VQDA 4MNOA 3S16H 3TS2A 4YY3Q 1IBKQ 3CCUA 4PZ7A 4BXXG 1WJJA 3KYHC 4P74A 4LUOA 5J3BA 4HJ7A 3UE1A 2RF4A 4LF7L 4GN4B 3OYYA 3F2DA 1EOVA 4R4IA 4GKJQ 3J80i 4IPCA 1VQLA 3TREA 2UXCL 1Y14B 3HOZH 2B29A 3BZCA 3K7AH 3S1RH 1Q46A 4DR2L 4B3MQ 1HNWL 3W5OA 4GNXC 5JEAJ 5FLMG 3PUYA 2YTXA 5M5YH 3F2CA 1EUJA 3CCJA 2YTVA 4FDBA 1EYGA 5C4XH 3HOVH 1S72A 1E1TA 2VQFL 1KQSA 1FVIA 4LFAL 1E24A 3PV0A 1Y1WG 1MKHA 2BA0A 2JEBI 3AQQA 2UU9L 2R92G 3HOWG 1XPUA 3PUVA 1I50H 4IJLA 3UDFA 3UE0A 2NVTH 4BY7G 1EQRA 1VQPA 4A4IA 4EQ5A 4DAYB 1JB7A 1EIYB 2KCTA 1QZGA 4LF6Q 3CMAA 1IXRA 4A3BG 1N9WA 1NMGA 1Z9FA 4PZ8A 3RLNA 3HOXG 1XMQQ 2I5HA 4DV2Q 4QY7A 3KDFA 1IBLL 4IFDI 2R6GA 1L1OB 2UUBL 1VQIA 4JI0L 4JCVE 5H1SE 3H15A 4JV5Q 4YY3L 1UWVA 1IBKL 2K50A 3I7FA 1A62A 1G6PA 1OXUA 2WB1E 3A74A 1J5EQ 3GTJH 2IX1A 1HZAA 5IP9G 1LUZA 3HKZE 5LMNQ 2VZAA 3K7UC 2JA6G 3GO5A 5GAEC 1QVCA 1L1OC 1LM0A 2PQAA 2WFWA 2VQEQ 4P73A 4B3ML 1B7YB 2N8NA 4RG1A 1I94Q 1Z47A 4DUZQ 1PV4A 1HR0Q 3CCLA 1WOCA 4JI2Q 4A3IG 2ES2A 4R1JA 5BR8Q 5IWAQ 3OTOQ 2KENA 1PH6A 4QQBX 5GAHC 1Q8KA 3ZJYC 1S40A 4IOCA 2UUCQ 2XTIA 4DR5Q 4NPSA 1E7ZA 4KLKA 3ULPA 2R93H 4A3DG 2A19A 4DV5Q 1CSQA 5GAGC 3BJUA 5EAYA 5C0XJ 1VQ8A 1N32Q 3M4QA 4DPGA 4HJ9A 2F52A 1HNXQ 1VQHA 2OWOA 4HIKA 5M5XH 2JEAI 1BBWA 5GADC 2UXBQ 3PGZA 2VS1A 3D0FA 1XMQL 1OXTA 4IO9A 4JBKA 1C0AA 4JV5L 1KC8C 2JK8A 3I56A 3PSIA 2B63G 5HY6A 4YCVA 1HJPA 1WCMH 4LW1A 4TVAB 2PI2A 4L5TA 2MNAA 4NB3A 1NJIC 2JA7G 2UXDQ 1W2BA 4GN5A 3U58A 3STBD 3CC7A 4KI0A 2ZJRA 2VQEL 1MJCA 2JQOA 1OXVA 1Y1VG 2EIFA 5IY0A 4BBSH 1IL2A 1D7QA 2K4KA 1I94L 3E0EA 3AEVA 4DUZL 4R4QA 3PCOB 1HR0L 4JBMA 4JI2L 3KDFB 5BR8L 3OTOL 3K0XA 5AJ3Q 4DR3L 1AH9A 4A3MH 3PF5A 2IHFA 2VUMH 3RR5A 5IYDG 2YV5A 2I0QA 2KCMA 2UUCL 4DR5L 1X3EA 4DR4Q 3HOYG 1H95A 3KOJA 5C4JH 4MZ9A 4OWXB 1MIUA 1IBMQ 3S24A 4OX9Q 1PH1A 1KRSA 4A3JH 1N32L 4P71A 3RN2A 3GTMH 1HNXL 3OW2A 4JI7Q 1JJCB 4ALPA 2GVBA 5IYCG 1CKOA 2PQAB 4L5SA 4UP9A 3IRBA 1IBLQ 2MQHA 1TWHH 2UUAQ 2CKZB 2Z6KA 2UUBQ 1C7YA 1VQ7A 4A3LG 2H5XA 1R9TH 1HH2P 2JA5G 4APVA 3FKIH 3STBC 4IPGA 2CWPA 4PZ6A 2AWNA 2R7DA 4DV3Q 4MTNA 2UXDL 2RCNA 4GS3A 1EFWA 2VY3A 2WB1G 2NVQH 3F8TA 5DLQE 3L2PA 4WJ3M 3HKZG 4A3CG 2L15A 1G51A 4JI4Q 4DV7Q 3L0OA 3ULJA 1VQ9A 3WWVA 5IT9c 4JOIA 2DGYA 5AJ3L 1A63A 2R92H 3HOWH 3HOUH 1GVPA 5M3FH 4UP7A 4UY8C 4AQYQ 2MO1A 3M9BA 4DR4L 5IP7G 1VQAA 1HZ9A 2QEXA 1KIXA 1AE2A 1BKBA 3UDIA 3PIOA 1K8AC 1VQKA 1IBML 1NE3A 2LSSA 4JBJA 4R4TA 3K81C 4OX9L 4K0KQ 1PVOA 2JE6I 4A3BH 4A3GG 4B3RQ 1NMFA 3I4NH 2ZTDA 3HOXH 4JI7L 1Q1EA 3AFQA 4UPAA 2F3IA 1RIPA 1LTLA 1ASZA 1XNQQ 1V9PA 4IPDA 1JJ2A 1SR3A 2JA8G 4HIMA 1VQEA 4DAMA 5FJ8G 3GTOH 2UUAL 3RZDH 1UE1A 1K83H 1I5FA 2N78A 3KJPA 1YI2A 2E2HH 2YU9H 4DKAC 3TS0A 3TQYA 2HQLA 3KF6A 3S14H 3L7ZC 5IP9H 4AIMA 1SE8A 1YITA 1X3GA 3CF5A 1JT8A 4Y52H 2JA6H 3HOVG 1YBYA 1V1QA 2QGQA 3HKSA 4DV3L 4A76A 4A3EG 3GTLH 2PI2E 1GKHA 2OCEA 2ZJPA 4BA1I 3M4OH 3SGIA 3S1NH 2V1CC 2VL6A 1PH9A 1M90C 1PFSA 5M5WH 2VW9A 4POGA 4DR1Q 1YZ6A 1Q82C 1PH3A 4A3IH 3PO3G 2NZOA 4JI4L 4DV7L 1X55A 5IYBH 4DV4Q 4BBRH 2DUDA 4YCWA 1SROA 3H0GG 1YIJA 2R7FA 2KBNA 4A3FG 3GD7A 1VQJA 4DR3Q 1BBUA 1X6OA 1TWFH 4C2MH 1B8AA 4GOPA 4AQYL 5IE8A 4LF5Q 2R7ZH 4A3DH 1VQFA 5ELNA 4LUZA 1Q86C 4K0KL 4DR6Q 1LYLA 3K80C 3RZOH 4HIOA 1UE7A 4A93G 4ME3A 4B3RL 3G6EA 4AYBG 4AH6A 2IX0A 2Y0SE 1TWCH 3NELA 1KRTA 3JC66 2D0PA 1CKMA 2ZM6Q 1XNQL 4P72A 3M7NA 4X65Q 3PO2H 3J81j 1NBWA 2AWOA 4TQUS 5M3MH 1AE3A 1CSPA 2HT1A 2WP8J 1K73C 1EIFA 1PH7A 1A8VA 4X62Q 3CAMA 3CCRA 4GNXA 1PHJA 2OQKA 4NXNQ 3S15H 1OXSC 3DLLA 2CFMA 1PH5A 4LF4Q 2Q2IA 5GQOA 4PG3A 5JJLA 2F4VQ 1TXYA 2RHQB 4LFBQ 4QJFA 1Y1VH 4OWWB 1O7IA 1FJGQ 3S1MH 4WJ4A 1VQGA 2R93G 4P75A 4BY1H 3I4MG 1CUKA 4DR1L 1KAWA 1SRUA 2E2JH 3M85A 3F1ZA 4A3KG 4DV4L 5C3EG 3GTGH 1DGSA 3A5UA 1HZBA 3RN5A 1MJEA 4OXPA 3E9IA 4GLVB 3PUXA 4EX5A 1UE6A 3CXCA 1YJNA 3CC4A 4LF5L 3CPFA 3T1YQ 2BH2A 2PNHA 1YHAA 4JBWA 1EWIA 4AYBE 2NZHA 5C44G 1E1OA 3BU2A 4DR6L 1N36Q 3JAMc 4NXMQ 1WFQA 5IYCH 3NEMA 1WCMG 3GTQH 2UXBL 3LGJA 3MEFA 2ZM6L 4GKKQ 1X3FA 1Q7YC 4X65L 2QA4A 1C9OA 4QGUA 2IY5B 4DR7Q 2JA5H 3CP0A 4DV6Q 5GROA 1L1OA 1TWGH 1VQBA 3W1BA 3W1GA 5JEAG 2HHHQ 4BXXH 1YEZA 3UDGA 4X62L 3A5ZB 2WAQG 1W3SA 4NXNL 1L0WA 1RL2A 4IPHA 1VQ4A 4XTCS 4YHHQ 1X65A 3I4OA 3G71A 1VQNA 3NENA 4LF4L 3A0JA 3CD6A 4A3MG 4LFCQ 2F4VL 2VUMG 1GD7A 3H3VI 4LFBL 4IFDJ 4A3CH 3D31A 1FJGL 1WYDA 2BA1A 5FLMH 4GLAC 3JAMi 4JI5Q 3J7ZC 2Q2HA 4C3HH 4A3JG 2MFIA 4JC0A 4O2DA 1XNRQ 2KHJA 2OTLA 1YJ9A 3Q8DA 3AYHB 3MXNB 1Y1WH 4KHZA 4A75A 2XGTA 1B70B 1N8RC 5IP7H 1OTCA 3ER0A 1VCIA 2NVXH 5FLXc 3RNUA 3T1YL 3PIPA 3U4ZA 3CCEA 3G48A 2ASBA 1YJWA 4BY7H 2ZTCA 4A3GH 2HIXA 1K0RA 1K9MC 4DV0Q 2YTYA 1N36L 3CCQA 2K5HA 2HIVA 1XTDA 4NXML 1X9NA 3FKIG 1QVGA 1IZ6A 2JA8H 3EBEA 1PA6A 2K75A 2BH8A 4J15A 1J6QA 3CPWA 5FJ8H 4HJAA 4JI1Q 4GKKL 1OXXK 3KF8B 1SMXA 3K8AA 2WAQE 4IOAA 2CWAA 5LMUQ 3HFZB 1Q81C 4YWLA 1IYJB 3U4VA 4DV6L 1GM5A 4DR7L 4JYAQ 2HHHL 2LXJA 2ZTEA 3HOZG 2Y0SG 3CQZH 2K5NA 4LF8Q 2E8GA 4OWTB 1Q1BA 1HNZQ 1A0IA 4A3EH 4YHHL 2YYZA 3I55A 2EQSA 4YCUA 4L5RC 1KHIA 5C4XG 1BVSA 3TRZA 4LFCL 1SLJA 3HOUG 1KD1C 2VNUD 5M3FG 3M3YH 3S1QH 2IHEA 4HIDA 1N34Q 3J7A5 1K3RA 3PO3H 2CQOA 2K14A 5C0XG 2IT1A 1K8GA 4JI8L 1V43A 1SN8A 4JI5L 3H0GH 2GN5A 3H3VH 3KFUA 4JG2A 3KLWA 4A3FH 1XNRL 3CMEA 4OO1G 3I4NG 2OTJA 1U0LA 4H02A 2E2IH 1WI5A 4O0AA 1FGUA 2A1AA 2Z0SA 3F2BA 3S17H 1M1KC 5E7NA 4HJ5A 3AFPA 2ALYB 1I3QH 1NY4A 2NN6G 1VQ5A 3CCMA 2N3SA 4PMWA 3ICEA 4A93H 1T9HA 2RHSB 1L2FA 4DV0L 1JMCA 1KXLA 2I5MX 3GTPH 1YNXA 3ERSX 4GKJL 2GVAA 4HJ8A 4DV1Q 1QUQA 4JI1L 4GLXA 3RLOA 1HZCA 1X54A 2D0OA 3CW2C 4JI3Q 3VDYA 4XIGS 1CKNA 3NBHB 1VQMA 3FHWA 4QL5A 5LMUL 1SFOH 2Z6KC 5K36G 4KHPQ 4JYAL 3T1HQ 4X66Q 1XPOA 2LXKA 2B63H 1UEBA 5JJIA 3S2DH 4QIWE 4LF8L 5IYBG 1HNZL 2MO0A 3EN2A 4BBRG 4LUVA 2JA7H 1VQ6A 1QZHA 4B3TQ 1UE5A 4B3SQ 1ASYA 3S2HH 1QVFA 2AKWB 2JJQA 4X64Q 3I4MH 2NVYH 2K52A 1NTGA 3TEHB 1EQQA 2R7ZG 4Y7NH 1PH8A 1N34L 4LF9Q 3GTKH 4LWCA 3U50C 3KJOA 5JJKA 4A3KH 1JJGA 5C3EH 4DK3C 5HGQA 4LF6L 1N33Q 1XMOQ 2Q2TA 5ELOA 1PYBA 2N49A 1P16A 4JOIC 5IYDH 4DV2L 4DUYQ 2E5LQ 3FP9A 1VS0A 2Q2UA 3I2ZA 4JI6Q 3HOYH 3PO2G 5C44H 3J81c 1VQCA 2OQ0A 3KF6B 4C3IH 2FXQA 5M3MG 4LNQA 2ID0A 2AMCB 3B6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8L A;  4RMF A;  1YHQ A;  1J5E L;  1KL9 A;  2JA9 A;  3EIV A;  4LF7 Q;  3PF4 A;  2C35 B;  5LMN L;  1TWA H;  1FL0 A;  2ZJQ A;  4BA2 I;  3CC2 A;  4IFD G;  1VQO A;  4DV1 L;  2KHI A;  2A8V A;  4JI3 L;  1JE5 A;  5LMN W;  3CCS A;  3DM3 A;  1PH2 A;  2UXC Q;  3UDX A;  1Q12 A;  4A3L H;  4DR2 Q;  1HNW Q;  4KHP L;  3T1H L;  4X66 L;  3CCV A;  4X6A H;  4BY1 G;  4OON A;  4YWM A;  5C0X I;  3GDE A;  1E22 A;  3PUW A;  5IWA L;  1XPR A;  4BBS G;  1YHB A;  3M4P A;  4L5Q A;  3E9H A;  4R4C A;  4LFA Q;  3ULL A;  2VQF Q;  1HR0 W;  1D8L A;  4GN3 B;  4GOP B;  4B3T L;  2ATW A;  4R4O A;  4UP8 A;  4YWK A;  4DNI A;  4OO1 I;  4DK6 C;  2B3G A;  2UU9 Q;  3J81 i;  4B3S L;  1YVC A;  3PUZ A;  4X64 L;  3J80 c;  1GO3 E;  1U5K A;  4DV5 L;  1PH4 A;  4LF9 L;  1XJV A;  2NN6 I;  1QUQ B;  2PMZ E;  3BZK A;  2AHO B;  4JI8 Q;  4POF A;  1N33 L;  2D62 A;  1X56 A;  1XMO L;  4C3J H;  4IJH A;  2CCZ A;  1CKN B;  1I6H H;  2I5L X;  4DUY L;  1PYS B;  1G29 1;  2K5V A;  2E5L L;  1S3O A;  4GOP C;  1E3P A;  4JI6 L;  2EXD A;  4JI0 Q;  3RLF A;  3G4S A;  4GNX B;  1VQD A;  4MNO A;  3S16 H;  3TS2 A;  4YY3 Q;  1IBK Q;  3CCU A;  4PZ7 A;  4BXX G;  1WJJ A;  3KYH C;  4P74 A;  4LUO A;  5J3B A;  4HJ7 A;  3UE1 A;  2RF4 A;  4LF7 L;  4GN4 B;  3OYY A;  3F2D A;  1EOV A;  4R4I A;  4GKJ Q;  3J80 i;  4IPC A;  1VQL A;  3TRE A;  2UXC L;  1Y14 B;  3HOZ H;  2B29 A;  3BZC A;  3K7A H;  3S1R H;  1Q46 A;  4DR2 L;  4B3M Q;  1HNW L;  3W5O A;  4GNX C;  5JEA J;  5FLM G;  3PUY A;  2YTX A;  5M5Y H;  3F2C A;  1EUJ A;  3CCJ A;  2YTV A;  4FDB A;  1EYG A;  5C4X H;  3HOV H;  1S72 A;  1E1T A;  2VQF L;  1KQS A;  1FVI A;  4LFA L;  1E24 A;  3PV0 A;  1Y1W G;  1MKH A;  2BA0 A;  2JEB I;  3AQQ A;  2UU9 L;  2R92 G;  3HOW G;  1XPU A;  3PUV A;  1I50 H;  4IJL A;  3UDF A;  3UE0 A;  2NVT H;  4BY7 G;  1EQR A;  1VQP A;  4A4I A;  4EQ5 A;  4DAY B;  1JB7 A;  1EIY B;  2KCT A;  1QZG A;  4LF6 Q;  3CMA A;  1IXR A;  4A3B G;  1N9W A;  1NMG A;  1Z9F A;  4PZ8 A;  3RLN A;  3HOX G;  1XMQ Q;  2I5H A;  4DV2 Q;  4QY7 A;  3KDF A;  1IBL L;  4IFD I;  2R6G A;  1L1O B;  2UUB L;  1VQI A;  4JI0 L;  4JCV E;  5H1S E;  3H15 A;  4JV5 Q;  4YY3 L;  1UWV A;  1IBK L;  2K50 A;  3I7F A;  1A62 A;  1G6P A;  1OXU A;  2WB1 E;  3A74 A;  1J5E Q;  3GTJ H;  2IX1 A;  1HZA A;  5IP9 G;  1LUZ A;  3HKZ E;  5LMN Q;  2VZA A;  3K7U C;  2JA6 G;  3GO5 A;  5GAE C;  1QVC A;  1L1O C;  1LM0 A;  2PQA A;  2WFW A;  2VQE Q;  4P73 A;  4B3M L;  1B7Y B;  2N8N A;  4RG1 A;  1I94 Q;  1Z47 A;  4DUZ Q;  1PV4 A;  1HR0 Q;  3CCL A;  1WOC A;  4JI2 Q;  4A3I G;  2ES2 A;  4R1J A;  5BR8 Q;  5IWA Q;  3OTO Q;  2KEN A;  1PH6 A;  4QQB X;  5GAH C;  1Q8K A;  3ZJY C;  1S40 A;  4IOC A;  2UUC Q;  2XTI A;  4DR5 Q;  4NPS A;  1E7Z A;  4KLK A;  3ULP A;  2R93 H;  4A3D G;  2A19 A;  4DV5 Q;  1CSQ A;  5GAG C;  3BJU A;  5EAY A;  5C0X J;  1VQ8 A;  1N32 Q;  3M4Q A;  4DPG A;  4HJ9 A;  2F52 A;  1HNX Q;  1VQH A;  2OWO A;  4HIK A;  5M5X H;  2JEA I;  1BBW A;  5GAD C;  2UXB Q;  3PGZ A;  2VS1 A;  3D0F A;  1XMQ L;  1OXT A;  4IO9 A;  4JBK A;  1C0A A;  4JV5 L;  1KC8 C;  2JK8 A;  3I56 A;  3PSI A;  2B63 G;  5HY6 A;  4YCV A;  1HJP A;  1WCM H;  4LW1 A;  4TVA B;  2PI2 A;  4L5T A;  2MNA A;  4NB3 A;  1NJI C;  2JA7 G;  2UXD Q;  1W2B A;  4GN5 A;  3U58 A;  3STB D;  3CC7 A;  4KI0 A;  2ZJR A;  2VQE L;  1MJC A;  2JQO A;  1OXV A;  1Y1V G;  2EIF A;  5IY0 A;  4BBS H;  1IL2 A;  1D7Q A;  2K4K A;  1I94 L;  3E0E A;  3AEV A;  4DUZ L;  4R4Q A;  3PCO B;  1HR0 L;  4JBM A;  4JI2 L;  3KDF B;  5BR8 L;  3OTO L;  3K0X A;  5AJ3 Q;  4DR3 L;  1AH9 A;  4A3M H;  3PF5 A;  2IHF A;  2VUM H;  3RR5 A;  5IYD G;  2YV5 A;  2I0Q A;  2KCM A;  2UUC L;  4DR5 L;  1X3E A;  4DR4 Q;  3HOY G;  1H95 A;  3KOJ A;  5C4J H;  4MZ9 A;  4OWX B;  1MIU A;  1IBM Q;  3S24 A;  4OX9 Q;  1PH1 A;  1KRS A;  4A3J H;  1N32 L;  4P71 A;  3RN2 A;  3GTM H;  1HNX L;  3OW2 A;  4JI7 Q;  1JJC B;  4ALP A;  2GVB A;  5IYC G;  1CKO A;  2PQA B;  4L5S A;  4UP9 A;  3IRB A;  1IBL Q;  2MQH A;  1TWH H;  2UUA Q;  2CKZ B;  2Z6K A;  2UUB Q;  1C7Y A;  1VQ7 A;  4A3L G;  2H5X A;  1R9T H;  1HH2 P;  2JA5 G;  4APV A;  3FKI H;  3STB C;  4IPG A;  2CWP A;  4PZ6 A;  2AWN A;  2R7D A;  4DV3 Q;  4MTN A;  2UXD L;  2RCN A;  4GS3 A;  1EFW A;  2VY3 A;  2WB1 G;  2NVQ H;  3F8T A;  5DLQ E;  3L2P A;  4WJ3 M;  3HKZ G;  4A3C G;  2L15 A;  1G51 A;  4JI4 Q;  4DV7 Q;  3L0O A;  3ULJ A;  1VQ9 A;  3WWV A;  5IT9 c;  4JOI A;  2DGY A;  5AJ3 L;  1A63 A;  2R92 H;  3HOW H;  3HOU H;  1GVP A;  5M3F H;  4UP7 A;  4UY8 C;  4AQY Q;  2MO1 A;  3M9B A;  4DR4 L;  5IP7 G;  1VQA A;  1HZ9 A;  2QEX A;  1KIX A;  1AE2 A;  1BKB A;  3UDI A;  3PIO A;  1K8A C;  1VQK A;  1IBM L;  1NE3 A;  2LSS A;  4JBJ A;  4R4T A;  3K81 C;  4OX9 L;  4K0K Q;  1PVO A;  2JE6 I;  4A3B H;  4A3G G;  4B3R Q;  1NMF A;  3I4N H;  2ZTD A;  3HOX H;  4JI7 L;  1Q1E A;  3AFQ A;  4UPA A;  2F3I A;  1RIP A;  1LTL A;  1ASZ A;  1XNQ Q;  1V9P A;  4IPD A;  1JJ2 A;  1SR3 A;  2JA8 G;  4HIM A;  1VQE A;  4DAM A;  5FJ8 G;  3GTO H;  2UUA L;  3RZD H;  1UE1 A;  1K83 H;  1I5F A;  2N78 A;  3KJP A;  1YI2 A;  2E2H H;  2YU9 H;  4DKA C;  3TS0 A;  3TQY A;  2HQL A;  3KF6 A;  3S14 H;  3L7Z C;  5IP9 H;  4AIM A;  1SE8 A;  1YIT A;  1X3G A;  3CF5 A;  1JT8 A;  4Y52 H;  2JA6 H;  3HOV G;  1YBY A;  1V1Q A;  2QGQ A;  3HKS A;  4DV3 L;  4A76 A;  4A3E G;  3GTL H;  2PI2 E;  1GKH A;  2OCE A;  2ZJP A;  4BA1 I;  3M4O H;  3SGI A;  3S1N H;  2V1C C;  2VL6 A;  1PH9 A;  1M90 C;  1PFS A;  5M5W H;  2VW9 A;  4POG A;  4DR1 Q;  1YZ6 A;  1Q82 C;  1PH3 A;  4A3I H;  3PO3 G;  2NZO A;  4JI4 L;  4DV7 L;  1X55 A;  5IYB H;  4DV4 Q;  4BBR H;  2DUD A;  4YCW A;  1SRO A;  3H0G G;  1YIJ A;  2R7F A;  2KBN A;  4A3F G;  3GD7 A;  1VQJ A;  4DR3 Q;  1BBU A;  1X6O A;  1TWF H;  4C2M H;  1B8A A;  4GOP A;  4AQY L;  5IE8 A;  4LF5 Q;  2R7Z H;  4A3D H;  1VQF A;  5ELN A;  4LUZ A;  1Q86 C;  4K0K L;  4DR6 Q;  1LYL A;  3K80 C;  3RZO H;  4HIO A;  1UE7 A;  4A93 G;  4ME3 A;  4B3R L;  3G6E A;  4AYB G;  4AH6 A;  2IX0 A;  2Y0S E;  1TWC H;  3NEL A;  1KRT A;  3JC6 6;  2D0P A;  1CKM A;  2ZM6 Q;  1XNQ L;  4P72 A;  3M7N A;  4X65 Q;  3PO2 H;  3J81 j;  1NBW A;  2AWO A;  4TQU S;  5M3M H;  1AE3 A;  1CSP A;  2HT1 A;  2WP8 J;  1K73 C;  1EIF A;  1PH7 A;  1A8V A;  4X62 Q;  3CAM A;  3CCR A;  4GNX A;  1PHJ A;  2OQK A;  4NXN Q;  3S15 H;  1OXS C;  3DLL A;  2CFM A;  1PH5 A;  4LF4 Q;  2Q2I A;  5GQO A;  4PG3 A;  5JJL A;  2F4V Q;  1TXY A;  2RHQ B;  4LFB Q;  4QJF A;  1Y1V H;  4OWW B;  1O7I A;  1FJG Q;  3S1M H;  4WJ4 A;  1VQG A;  2R93 G;  4P75 A;  4BY1 H;  3I4M G;  1CUK A;  4DR1 L;  1KAW A;  1SRU A;  2E2J H;  3M85 A;  3F1Z A;  4A3K G;  4DV4 L;  5C3E G;  3GTG H;  1DGS A;  3A5U A;  1HZB A;  3RN5 A;  1MJE A;  4OXP A;  3E9I A;  4GLV B;  3PUX A;  4EX5 A;  1UE6 A;  3CXC A;  1YJN A;  3CC4 A;  4LF5 L;  3CPF A;  3T1Y Q;  2BH2 A;  2PNH A;  1YHA A;  4JBW A;  1EWI A;  4AYB E;  2NZH A;  5C44 G;  1E1O A;  3BU2 A;  4DR6 L;  1N36 Q;  3JAM c;  4NXM Q;  1WFQ A;  5IYC H;  3NEM A;  1WCM G;  3GTQ H;  2UXB L;  3LGJ A;  3MEF A;  2ZM6 L;  4GKK Q;  1X3F A;  1Q7Y C;  4X65 L;  2QA4 A;  1C9O A;  4QGU A;  2IY5 B;  4DR7 Q;  2JA5 H;  3CP0 A;  4DV6 Q;  5GRO A;  1L1O A;  1TWG H;  1VQB A;  3W1B A;  3W1G A;  5JEA G;  2HHH Q;  4BXX H;  1YEZ A;  3UDG A;  4X62 L;  3A5Z B;  2WAQ G;  1W3S A;  4NXN L;  1L0W A;  1RL2 A;  4IPH A;  1VQ4 A;  4XTC S;  4YHH Q;  1X65 A;  3I4O A;  3G71 A;  1VQN A;  3NEN A;  4LF4 L;  3A0J A;  3CD6 A;  4A3M G;  4LFC Q;  2F4V L;  2VUM G;  1GD7 A;  3H3V I;  4LFB L;  4IFD J;  4A3C H;  3D31 A;  1FJG L;  1WYD A;  2BA1 A;  5FLM H;  4GLA C;  3JAM i;  4JI5 Q;  3J7Z C;  2Q2H A;  4C3H H;  4A3J G;  2MFI A;  4JC0 A;  4O2D A;  1XNR Q;  2KHJ A;  2OTL A;  1YJ9 A;  3Q8D A;  3AYH B;  3MXN B;  1Y1W H;  4KHZ A;  4A75 A;  2XGT A;  1B70 B;  1N8R C;  5IP7 H;  1OTC A;  3ER0 A;  1VCI A;  2NVX H;  5FLX c;  3RNU A;  3T1Y L;  3PIP A;  3U4Z A;  3CCE A;  3G48 A;  2ASB A;  1YJW A;  4BY7 H;  2ZTC A;  4A3G H;  2HIX A;  1K0R A;  1K9M C;  4DV0 Q;  2YTY A;  1N36 L;  3CCQ A;  2K5H A;  2HIV A;  1XTD A;  4NXM L;  1X9N A;  3FKI G;  1QVG A;  1IZ6 A;  2JA8 H;  3EBE A;  1PA6 A;  2K75 A;  2BH8 A;  4J15 A;  1J6Q A;  3CPW A;  5FJ8 H;  4HJA A;  4JI1 Q;  4GKK L;  1OXX K;  3KF8 B;  1SMX A;  3K8A A;  2WAQ E;  4IOA A;  2CWA A;  5LMU Q;  3HFZ B;  1Q81 C;  4YWL A;  1IYJ B;  3U4V A;  4DV6 L;  1GM5 A;  4DR7 L;  4JYA Q;  2HHH L;  2LXJ A;  2ZTE A;  3HOZ G;  2Y0S G;  3CQZ H;  2K5N A;  4LF8 Q;  2E8G A;  4OWT B;  1Q1B A;  1HNZ Q;  1A0I A;  4A3E H;  4YHH L;  2YYZ A;  3I55 A;  2EQS A;  4YCU A;  4L5R C;  1KHI A;  5C4X G;  1BVS A;  3TRZ A;  4LFC L;  1SLJ A;  3HOU G;  1KD1 C;  2VNU D;  5M3F G;  3M3Y H;  3S1Q H;  2IHE A;  4HID A;  1N34 Q;  3J7A 5;  1K3R A;  3PO3 H;  2CQO A;  2K14 A;  5C0X G;  2IT1 A;  1K8G A;  4JI8 L;  1V43 A;  1SN8 A;  4JI5 L;  3H0G H;  2GN5 A;  3H3V H;  3KFU A;  4JG2 A;  3KLW A;  4A3F H;  1XNR L;  3CME A;  4OO1 G;  3I4N G;  2OTJ A;  1U0L A;  4H02 A;  2E2I H;  1WI5 A;  4O0A A;  1FGU A;  2A1A A;  2Z0S A;  3F2B A;  3S17 H;  1M1K C;  5E7N A;  4HJ5 A;  3AFP A;  2ALY B;  1I3Q H;  1NY4 A;  2NN6 G;  1VQ5 A;  3CCM A;  2N3S A;  4PMW A;  3ICE A;  4A93 H;  1T9H A;  2RHS B;  1L2F A;  4DV0 L;  1JMC A;  1KXL A;  2I5M X;  3GTP H;  1YNX A;  3ERS X;  4GKJ L;  2GVA A;  4HJ8 A;  4DV1 Q;  1QUQ A;  4JI1 L;  4GLX A;  3RLO A;  1HZC A;  1X54 A;  2D0O A;  3CW2 C;  4JI3 Q;  3VDY A;  4XIG S;  1CKN A;  3NBH B;  1VQM A;  3FHW A;  4QL5 A;  5LMU L;  1SFO H;  2Z6K C;  5K36 G;  4KHP Q;  4JYA L;  3T1H Q;  4X66 Q;  1XPO A;  2LXK A;  2B63 H;  1UEB A;  5JJI A;  3S2D H;  4QIW E;  4LF8 L;  5IYB G;  1HNZ L;  2MO0 A;  3EN2 A;  4BBR G;  4LUV A;  2JA7 H;  1VQ6 A;  1QZH A;  4B3T Q;  1UE5 A;  4B3S Q;  1ASY A;  3S2H H;  1QVF A;  2AKW B;  2JJQ A;  4X64 Q;  3I4M H;  2NVY H;  2K52 A;  1NTG A;  3TEH B;  1EQQ A;  2R7Z G;  4Y7N H;  1PH8 A;  1N34 L;  4LF9 Q;  3GTK H;  4LWC A;  3U50 C;  3KJO A;  5JJK A;  4A3K H;  1JJG A;  5C3E H;  4DK3 C;  5HGQ A;  4LF6 L;  1N33 Q;  1XMO Q;  2Q2T A;  5ELO A;  1PYB A;  2N49 A;  1P16 A;  4JOI C;  5IYD H;  4DV2 L;  4DUY Q;  2E5L Q;  3FP9 A;  1VS0 A;  2Q2U A;  3I2Z A;  4JI6 Q;  3HOY H;  3PO2 G;  5C44 H;  3J81 c;  1VQC A;  2OQ0 A;  3KF6 B;  4C3I H;  2FXQ A;  5M3M G;  4LNQ A;  2ID0 A;  2AMC B;  3B6Y A; 
#chains in the Genus database with same CATH topology
 2A6E D;  4RMF A;  3PIO 3;  1KL9 A;  3PF4 A;  1FL0 A;  3DEO A;  4BA2 I;  3CC2 A;  2KHI A;  3C46 A;  5M5X B;  2A8V A;  1JWS D;  1D5Z C;  4B9W A;  1Q12 A;  1KAB A;  4KHP L;  1BNZ A;  4BY1 G;  5IOC A;  5C0X I;  1XPR A;  3M4P A;  3E9H A;  4R4C A;  3ULL A;  2HCC A;  1D8L A;  4GN3 B;  4OGQ C;  4YWK A;  1JOK A;  1FGB D;  3J81 i;  3VR6 A;  1JE4 A;  5I6W A;  3PUZ A;  3R8B A;  1HUM A;  1U5K A;  4DV5 L;  2F0F A;  1V1P B;  3MXP A;  2EDG A;  2NN6 I;  1MSG A;  2MP1 A;  4ZK9 B;  1QUQ B;  4JI8 Q;  4BBS B;  3P20 A;  4HAE A;  4POF A;  2D62 A;  1X56 A;  1XMO L;  2CCZ A;  3MFG A;  3OMG A;  1FNW A;  4DUY L;  1PYS B;  4A3M B;  3RLF A;  4ZQ3 A;  4IUR A;  4HJ7 A;  4JVZ A;  1MD2 D;  3OYY A;  5DM7 3;  5JOB A;  1RTN A;  3D4R A;  3HOZ H;  2B29 A;  4GNX C;  1LLR D;  3P7J A;  2J4X A;  1LO5 D;  1MSH A;  2YTX A;  3F2C A;  1EUJ A;  2N88 A;  5A2Q L;  2YTV A;  3CCJ A;  1EYG A;  5C4X H;  1ZXT A;  5HUR A;  4P2C B;  1KQS A;  1FVI A;  1IKL A;  2JEB I;  2R92 G;  1A3T A;  2NVT H;  1JOQ A;  2NVQ B;  4EQ5 A;  3S1R B;  3Q24 A;  2KJX A;  1QZG A;  3BZD B;  1IXR A;  1JQY D;  4PZ8 A;  1SYD A;  1I6H H;  4DV2 Q;  4QY7 A;  1L1O B;  3H15 A;  3Q6S A;  1EYA A;  1PTO B;  4K2K A;  2RDG A;  1OXU A;  1PYW D;  3NSW A;  3SDZ A;  2KQ3 A;  4E6I A;  1WVL A;  1J5E Q;  1HZA A;  3I4N B;  5HGT A;  5LMN Q;  2L1B A;  2JA6 G;  5KND A;  5GAE C;  2VQE Q;  2PQA A;  2WFW A;  3M4O B;  4P73 A;  2E2H B;  1K83 B;  4RG1 A;  3E6Z X;  1PXU A;  3HGB A;  5K5P A;  1HR0 Q;  1WOC A;  1NSN S;  2ES2 A;  3S14 B;  4R1J A;  1PH6 A;  1SNO A;  1G2S A;  2KEN A;  2CVR A;  3VYS A;  3TZU A;  2F0E A;  1D1I A;  2L4N A;  1S40 A;  4IOC A;  4G7O C;  2WKD A;  1SE2 A;  3D8G A;  1E7Z A;  1SYF A;  4KLK A;  3GTL B;  2R93 H;  4KMU C;  3S1N B;  1F9Q A;  1HXY D;  3M4Q A;  3AMU A;  1HNX Q;  4HIK A;  3DHQ A;  5M5X H;  1BBW A;  2F0L A;  3VA5 A;  2SNM A;  4JBK A;  5CV5 A;  5F2D A;  1Q90 A;  1U4R A;  1IYU A;  1ILQ A;  3J81 L;  2AUJ D;  1J8I A;  4YCV A;  5A2Q E;  1HJP A;  4XQN A;  4LW1 A;  4TVA B;  2PCF B;  4L5T A;  1NJI C;  1W2B A;  5EPJ A;  1CHP D;  2EJM A;  1DYQ A;  1K3B C;  2VQE L;  2Q8I B;  2JQO A;  4BBS H;  5IY0 A;  1SEB D;  3E0E A;  1YNN C;  1HR0 L;  1LTA D;  5AJ3 Q;  3X3M A;  1D1K A;  4A3M H;  2IHF A;  2KCM A;  1TY2 A;  4KV6 A;  1X3E A;  3S24 A;  4OX9 Q;  1KRS A;  3HG9 A;  1HNX L;  2B2V A;  2GVB A;  2A6H D;  5IYC G;  1AZQ A;  1HRJ A;  4ID6 A;  1QE6 A;  2A5H A;  2I07 B;  2Z6K A;  1C7Y A;  5CV4 A;  1UUP A;  2JA5 G;  4O1N A;  4X3U A;  4IPG A;  5EKI A;  2R7D A;  2H1E A;  1F9P A;  4MTN A;  3VYT A;  4GS3 A;  2NVQ H;  5DLQ E;  1STH A;  3QWN A;  3HKZ G;  1G51 A;  1VMC A;  4I7A A;  3MVV A;  1VQ9 A;  5AJ3 L;  1H9K A;  3HOW H;  4UY8 C;  4UP7 A;  1LT3 D;  4WOR A;  3M9B A;  1KIX A;  1PTO H;  4I7Z C;  4K0K Q;  4JBJ A;  4R4T A;  4OX9 L;  4CKC A;  1CZG A;  4A3G G;  2CQA A;  1A6X A;  3I4N H;  2ZTD A;  1Q1E A;  2R3Z A;  1TT2 A;  4JW0 A;  1JJ2 A;  1Y1W B;  4HIM A;  1B3A A;  4DAM A;  5COY A;  3PQI A;  2E2H H;  1UE1 A;  1K83 H;  3OIP A;  5D3D A;  4IQZ A;  4BY7 B;  3KF6 A;  3S14 H;  4AIM A;  1SE8 A;  1X3G A;  1QG7 A;  3HKS A;  4A3B B;  2PW7 A;  3MWY W;  3HOX B;  2O5I C;  3GTL H;  2PI2 E;  3SK5 A;  5FO8 B;  5I2Y A;  2EZV A;  3S1N H;  1M90 C;  2M9V A;  4DXF A;  3EJI A;  1X55 A;  1XTC D;  3DM1 A;  3SHL A;  1BBX C;  1ONL A;  2KBN A;  1AZP A;  1S5C D;  4DR3 Q;  1EY0 A;  4NMZ A;  1B8A A;  3BDC A;  1GUN A;  2K04 A;  4HED A;  3M3Y B;  4KTA A;  3S1Q B;  4K0K L;  3PO3 B;  4EQN A;  1GUG A;  3H94 A;  3RZO H;  4ME3 A;  3G6E A;  4AH6 A;  3NEL A;  1TWC H;  2D0P A;  1CKM A;  1T5E A;  2NUC A;  3S17 B;  3J81 j;  3MXN A;  4XQQ A;  1EIF A;  4GNX A;  3CCR A;  4A93 B;  2F03 A;  3ERO A;  4HMJ A;  4KJO A;  1H9S A;  2QDB A;  5JJL A;  2D9U A;  1JC7 A;  2Z9H A;  1HA6 A;  1FJG Q;  4GZY C;  3LX0 A;  2IJ0 A;  2R93 G;  1SFO B;  2PZT A;  4KKT A;  1DOM A;  3PUX A;  3CXC A;  5LL6 X;  2JA7 B;  3VYU A;  3CPF A;  3CHB D;  3T1Y Q;  2PNH A;  1QCB D;  1ZYR D;  4KY5 A;  4HSV A;  1EQV A;  1WFQ A;  4HTH A;  2KVM A;  4MN3 A;  3HEJ A;  5FO7 B;  4GKK Q;  2CH4 A;  3W3A A;  1I4H A;  3BYY B;  2QA4 A;  5D3I B;  1DD2 A;  2RQX A;  2O2L D;  4DR7 Q;  4OIJ A;  2F0H A;  4BXX H;  1W3S A;  2Z6B A;  2F4I A;  1RL2 A;  1VQN A;  1VQ4 A;  4XTC S;  3G71 A;  4IOA A;  3I4O A;  3CD6 A;  4IUV A;  5FOB B;  4A3M G;  3R2T A;  1GD7 A;  3H3V I;  4CDD C;  4A3C H;  1FJG L;  4J8Q A;  5FLM H;  3J7Z C;  2Q2H A;  4ILW A;  1XNR Q;  2AQ2 B;  2KHJ A;  2OTL A;  3AYH B;  1Y1W H;  4ZLT F;  5IP7 H;  3D4W A;  2F0J A;  5FLX c;  3T1Y L;  3PIP A;  1CHQ D;  4OIK A;  4PMC A;  4BY7 H;  2ASB A;  2ZTC A;  4B08 A;  3VYR A;  3I72 A;  2HIX A;  4N9T A;  2YTY A;  2K5H A;  2XN9 C;  1XTD A;  4MIU A;  1QVG A;  4L8J A;  2BH8 A;  3CPW A;  1J6Q A;  3BDL A;  5FJ8 H;  3Q0A A;  4C3H B;  4GKK L;  3K8A A;  1J9O A;  4DR7 L;  1IYJ B;  3WOF A;  2QKI C;  1GHK A;  3A55 A;  4LF8 Q;  4OWT B;  1H9J A;  1Q1B A;  4CDE C;  4A3E H;  2YYZ A;  2VB2 X;  4YCU A;  4IUT A;  1SLJ A;  2JN4 A;  2JA8 B;  5BN5 A;  3M3Y H;  3S1Q H;  2IHE A;  4HID A;  3PO3 H;  3H0G H;  4JG2 A;  1KDB A;  3JAM E;  1XNR L;  3I4N G;  1U0L A;  4H02 A;  1WI5 A;  3S17 H;  4Q0F A;  3MA2 B;  1M1K C;  4U68 A;  4YIJ A;  3M4Y A;  2GA4 B;  1LT5 D;  3CCM A;  3SVM A;  4A93 H;  4FP5 D;  1T9H A;  2EJF C;  1I4R A;  2RHS B;  4L6T B;  4F7X A;  2BDO A;  2X6G A;  3GTP H;  3ERS X;  4GKJ L;  1GXD C;  1UNS A;  3CW2 C;  4A3F B;  4WRD A;  3QO2 A;  1SFO H;  5K36 G;  1PFB A;  2X69 A;  2LS0 1;  1XPO A;  1UEB A;  1R4Q B;  4LF8 L;  4XT1 B;  2MO0 A;  2JA7 H;  1QZH A;  5BN3 A;  4B3T Q;  1UE5 A;  4IN3 A;  5LHY 1;  3MEH A;  1QVF A;  2AKW B;  2JJQ A;  1EQQ A;  4Y7N H;  2A68 C;  4LF9 Q;  2RBM A;  4DK3 C;  2PQE A;  1N33 Q;  1LTB D;  4LMQ D;  2Z1C A;  2XWB B;  2N49 A;  1P16 A;  1DM0 B;  3RD4 A;  5E1F A;  1ENC A;  1BXT A;  2XIW A;  3I4M B;  3QG1 A;  2L12 A;  1B50 A;  4PMB A;  1YHQ A;  3DWQ A;  3EIV A;  4A3K B;  2PO4 A;  5C3E B;  5LL6 S;  4DAV A;  1BCP F;  3CCS A;  3DM3 A;  5JEA H;  3UDX A;  1CT1 D;  1EU3 A;  1FR3 A;  4DR2 Q;  2G5D A;  4A3L H;  1HQR D;  4O42 A;  4CJ1 B;  1EZ6 A;  4HMI A;  1O78 A;  3U9O A;  1WTX A;  3PUW A;  5IWA L;  5J1Z A;  1AP0 A;  1YHB A;  2XSC A;  1SNQ A;  1WCM B;  4B3T L;  3R2I A;  4GOP B;  4OO1 I;  4DNI A;  1GO3 E;  4LF9 L;  5CBA E;  5CR3 A;  5EKK A;  2PMZ E;  2WAQ B;  2AHO B;  5ELB A;  1VDZ A;  1N33 L;  1WTR A;  1S5B D;  2ZXP A;  1G29 1;  1F2Z A;  1E3P A;  1HTL D;  1D2B A;  3E5S A;  2LMC B;  3PMF A;  1VQD A;  5FLX L;  3GQB A;  3TS2 A;  4YY3 Q;  2K5Q A;  2NTS A;  5M9O A;  4BXX G;  4PZ7 A;  3KYH C;  3UE1 A;  3I91 A;  2RF4 A;  4XYO A;  3GTM B;  1SNP A;  2VXW A;  1VQL A;  3TRE A;  1A3V A;  3FEW X;  3K7A H;  4DR2 L;  5ELE A;  5FLM G;  5M5Y H;  4Z9C B;  1RCV D;  3FKI B;  2F0T A;  1Y1W G;  2BA0 A;  1SYB A;  5C0X H;  3PUV A;  4BY7 G;  2K28 A;  4A4I A;  1G8Z D;  3T53 B;  2B39 A;  1JB7 A;  2J7Z A;  2KCT A;  1CM9 A;  1U4L A;  3CMA A;  4FYD A;  4A3B G;  1NMG A;  3HOX G;  3TP7 A;  4CJ0 B;  5I9P A;  1XMQ Q;  4QIW B;  2EYM A;  4JCV E;  1K28 A;  2IL8 A;  3ONA B;  2J0T D;  5H1S E;  5M3F B;  3IFT A;  4YY3 L;  3I7F A;  1EY9 A;  1G6P A;  2NVT B;  3A74 A;  1ESF A;  5IP9 G;  3KBG A;  1LUZ A;  3HKZ E;  3H09 A;  3O13 A;  2O5J C;  2RKS A;  1QVC A;  1L1O C;  3J80 E;  1I6H B;  2N8N A;  3OSO A;  3RZD B;  1STE A;  2CW0 C;  1Z47 A;  1BCP D;  1SND A;  3ZJY C;  1EOT A;  4N8X 1;  3OWE B;  3ULP A;  3V96 A;  4DV5 Q;  1CSQ A;  4UDU C;  1VQ8 A;  1N32 Q;  2CHB D;  2F0S A;  4DPG A;  4HJ9 A;  1YNJ C;  4A3I B;  2OWO A;  1NAP A;  1STG A;  4KHV A;  4S3S A;  3PGZ A;  3D0F A;  1XMQ L;  4IO9 A;  5EQ0 A;  3MC0 B;  2BE5 D;  3I56 A;  1D5M C;  3EVQ A;  1H9R A;  1F9R A;  1WCM H;  1L0Y B;  2IW3 A;  5I9O A;  4IUQ A;  2JA7 G;  2UXD Q;  3A8J E;  4GN5 A;  3U58 A;  1V8Q A;  1CQF A;  3FPU B;  4XXE A;  3KF8 A;  2RSO A;  1MJC A;  1OXV A;  2EIF A;  1IL2 A;  2ZT9 C;  4BS9 A;  1EU4 A;  1KDA A;  1OO9 B;  3S15 B;  2PPB C;  3T56 B;  3KLS A;  1H95 A;  5C4J H;  1WTO A;  1Y1V B;  4R8N A;  1W6K A;  1LAB A;  2F0P A;  1N32 L;  3GTM H;  1EIG A;  1EYC A;  1SYE A;  3OW2 A;  2M00 A;  2PQA B;  4L5S A;  1SDF A;  3ZYY X;  3IRB A;  3FPP A;  2EY2 A;  2CKZ B;  4A3L G;  1F9S A;  2H5X A;  4APV A;  4PV1 C;  3FKI H;  5CV8 A;  2Q8R E;  4JK1 C;  3BDO A;  3S9W A;  4DV3 Q;  2UXD L;  2RCN A;  1FNV A;  2F0K A;  1NCV A;  3SK6 A;  2WB1 G;  3F8T A;  2K7V A;  3NXW A;  1TS3 A;  4WJ3 M;  1TWG B;  3A56 A;  2BDN A;  3L0O A;  5FK9 C;  1IYV A;  3SR1 A;  4H13 C;  3NWS A;  1KAA A;  2DGY A;  4C3H G;  3DUZ A;  3QB3 A;  5M3F H;  1AE2 A;  2B2Y C;  3PIO A;  1VQK A;  2LSS A;  3K81 C;  3ND9 A;  4MHE A;  2JE6 I;  4B3R Q;  2K32 A;  2F3I A;  1ASZ A;  1XNQ Q;  1V9P A;  2HD3 A;  4IPD A;  1SR3 A;  3C3L A;  2JA8 G;  1AFP A;  2FIN B;  2NVX B;  3RZD H;  3HOW B;  1I5F A;  2WIN B;  3KJP A;  4K5V A;  2KUM A;  1E2Z A;  1JT8 A;  2QW7 A;  4N9P A;  1F2Y A;  2QGQ A;  1HCZ A;  4QUF A;  4DV3 L;  4QUC A;  5EPK A;  1LTT D;  1GKH A;  2OCE A;  2ZJP A;  4BA1 I;  3D3R A;  2G9D A;  3SGI A;  3V2T A;  1PH9 A;  1PFS A;  5M5W H;  2VW9 A;  1XYI A;  4POG A;  1Q82 C;  1PH3 A;  4A3I H;  3P1H A;  4TSS A;  3GV6 A;  4DV4 Q;  2ICE C;  3A8I E;  2DUD A;  4YCW A;  4DK0 A;  2SEB D;  5KYI A;  4A3F G;  3GD7 A;  1VQJ A;  4C2M H;  3MFY A;  1QB5 D;  4A3D H;  2X6L A;  3NWT A;  1VQF A;  1G2T A;  5ELN A;  4LUZ A;  1Q86 C;  4DR6 Q;  1PFN A;  2F0N A;  4NKL A;  2M2L A;  1V1P A;  4B3R L;  1PFM A;  2UXB Q;  1XNQ L;  4P72 A;  3KUP A;  3U9S A;  3T51 B;  4G7Z C;  1NBW A;  1AE3 A;  2WP8 J;  1U4M A;  5C5L A;  5BN4 A;  1BO0 A;  3CAM A;  4RKL A;  3S15 H;  1OXS C;  2QDL A;  4IFD H;  2Q2I A;  3RZO B;  5IT9 E;  1SMY D;  4HCS A;  4LFB Q;  4FNF A;  4CHT B;  4QJF A;  1TWC B;  1Y1V H;  4OWW B;  1ICF B;  3I4M G;  1IW7 D;  3M7G A;  1JR0 D;  4A3K G;  4DV4 L;  5C3E G;  1HHV A;  1HZB A;  3MTS A;  4OXP A;  3NBI A;  3T4A C;  4EX5 A;  1YJN A;  1UE6 A;  1FNU A;  2EY6 A;  1EWI A;  2K1B A;  4AYB E;  1DJR D;  2NVY B;  4DR6 L;  3JAM c;  4NXM Q;  1G91 A;  3D6C A;  1WCM G;  1C8C A;  2UXB L;  3MEF A;  3L9A X;  3QOL A;  1C9O A;  1L1O A;  1M8A A;  1TWG H;  5C44 B;  4LK1 C;  1C48 A;  1YEZ A;  2WAQ G;  2F0D A;  4YHH Q;  1X65 A;  2PYK A;  3J7A F;  1LV9 A;  1TWA B;  2EE1 A;  4LFB L;  4DXG A;  1KDC A;  2BA1 A;  3NBH A;  3JAM i;  1TII D;  2L9H A;  2XRS D;  4RHR A;  2MFI A;  2B2U C;  1MBY A;  1B1Z A;  1ENA A;  3MXN B;  1GJX A;  4A75 A;  1N8R C;  2A6E C;  1JOO A;  1VCI A;  2NVX H;  3RNU A;  3CCE A;  3G48 A;  2O4X A;  3CCQ A;  4DA2 A;  5E4X A;  4NXM L;  3EA6 A;  4IAL A;  3FKI G;  5T1G A;  3EBE A;  1SAP A;  5G3L D;  4C3J B;  1OXX K;  1BOS A;  5LMU Q;  1PRT F;  3HFZ B;  3U4V A;  2A69 D;  2LXJ A;  2OEO A;  2Y0S G;  5DM6 3;  3HOZ G;  5CMD A;  4JPB W;  2E8G A;  2QIL A;  1A0I A;  4YHH L;  1SE3 A;  2EQS A;  5C4X G;  1BVS A;  1RD9 D;  5KIX A;  1KD1 C;  4K5W A;  2KEC A;  2WAC A;  4WFN 3;  5M3F G;  1JOR A;  1HUN A;  1N34 Q;  1D5X C;  2CQO A;  1K8G A;  1EFI D;  4H0L C;  1SN8 A;  1B53 A;  3H3V H;  3KFU A;  2MGS A;  1ENF A;  4KKS A;  4ZYS A;  3CME A;  2RVL A;  1HTP A;  5DNF A;  2L0C A;  4O0A A;  1FGU A;  2Z0S A;  3F2B A;  5E7N A;  4A3E B;  3NE5 B;  4HJ5 A;  3AFP A;  2ALY B;  1NY4 A;  3G7L A;  4X3T A;  1LTS D;  2E74 C;  4PMW A;  4K6D A;  1L2F A;  2JP1 A;  1IL8 A;  4CDF C;  5A35 A;  5IGB A;  3Q22 A;  3MXU A;  5JJZ A;  3H0G B;  4DV1 Q;  4R9W A;  4JI3 Q;  2SOB A;  1HZC A;  1X54 A;  5T1I A;  3RLO A;  3VDY A;  1CKN A;  5LMU L;  1SBB B;  3EQL C;  4OEM B;  3T1H Q;  3A8K E;  1O7Y A;  1EY5 A;  3IFD A;  3NTK A;  2L5T A;  4OHJ A;  4B3S Q;  3GTP B;  1ZKO A;  2NVY H;  3TEH B;  1N34 L;  2JXM B;  3GTK H;  1EEF D;  4LWC A;  3U50 C;  1JJG A;  2B2Y A;  2FMM A;  5HGQ A;  1SYC A;  4LF6 L;  1I6V C;  1PYB A;  4JOI C;  4RGT A;  2E5L Q;  3DXJ C;  1BCP B;  3I2Z A;  3TP5 A;  5C44 H;  1CA5 A;  1VQC A;  2EOT A;  2JSO A;  1CFM A;  2AMC B;  1TR5 A;  3B6Y A;  1P8L A;  4DFA A;  4Y7N B;  4LF7 Q;  1K8O A;  2C35 B;  1TWA H;  4IFD G;  3JAM L;  4DV1 L;  4JI3 L;  1JE5 A;  5LMN W;  4RCO A;  3URY A;  4K6L A;  4V0B A;  1O7Z A;  3DWA A;  2XWJ B;  2I46 A;  3CCV A;  2HDM A;  3T1H L;  1WD1 A;  4OON A;  4YWM A;  4DNT B;  2WV6 D;  4HSP A;  4BBS G;  4L5Q A;  4LFA Q;  2VQF Q;  1HR0 W;  1JB3 A;  3P75 A;  2ATW A;  4R4O A;  4UP8 A;  1PRT D;  4DK6 C;  2B3G A;  4B3S L;  1YVC A;  3J80 c;  5TSS A;  1PH4 A;  1I4X A;  1XJV A;  5KYL A;  3MXG A;  3BZK A;  4C3J H;  4G4K A;  2K33 A;  2E5L L;  2K5V A;  4GOP C;  3QOJ A;  3NTH A;  4JI0 Q;  4DAP A;  5KEE A;  4KK7 A;  4MTK A;  3CCU A;  3K59 A;  1WJJ A;  4P74 A;  4HCE A;  5J3B A;  5I4D A;  4LF7 L;  3MZ5 A;  4GN4 B;  4BWG B;  4GKJ Q;  1MGS A;  3J80 i;  1AN8 A;  4WJW A;  3CRL C;  3BZC A;  1Q46 A;  2G9H D;  3OHX C;  3W5O A;  4FXD A;  5JEA J;  3PUY A;  4FDB A;  1E1T A;  2VQF L;  4LFA L;  3PV0 A;  1G6Z A;  4V19 0;  3HOW G;  1I50 H;  3UE0 A;  1EQR A;  4HN7 A;  1S5F D;  4OO1 H;  1PDQ A;  3SXH A;  4DAY B;  3K7A B;  3LWE A;  2IX3 A;  1ROD A;  1RKN A;  1N9W A;  5M5Y B;  3RLN A;  3TME A;  1IBL L;  1YNJ D;  2I5H A;  2D2C C;  3KDF A;  4C1N I;  2R6G A;  2UUB L;  3HOU B;  1VQI A;  1U9R A;  4JI0 L;  1WD0 A;  4JV5 Q;  1Z7T A;  2WB1 E;  3GTJ H;  2V4D A;  4RKB A;  3SK8 A;  3K7U C;  4KY7 A;  2EYJ A;  1O80 A;  3GO5 A;  5FKA C;  3GTO B;  2MUY A;  5EPL A;  1I94 Q;  2YU9 B;  1E0B A;  4DUZ Q;  2RA4 A;  4JI2 Q;  2B2U A;  5BR8 Q;  5IWA Q;  5GAH C;  1Q8K A;  1GOZ A;  2Z4H A;  2PZW A;  2UUC Q;  3OMC A;  1DXM A;  2A19 A;  4RHS A;  3I70 A;  5GAG C;  3BJU A;  5C0X J;  1NNX A;  2F52 A;  1E2W A;  3VR4 A;  5GAD C;  5CYU A;  1OXT A;  5ISR A;  1TWF B;  4JV5 L;  1TY0 A;  1KC8 C;  2LKV A;  2P5Z X;  4K2L A;  3PSI A;  5HY6 A;  5C4Z A;  4LAA A;  4KN7 C;  1EL0 A;  4QCL A;  1JWU D;  4NB3 A;  5JVG 3;  5C4H A;  3KLS X;  2PMZ B;  3FDT A;  3OW7 A;  3PO2 B;  4X3K A;  4Q5V A;  5M3M B;  1I94 L;  4J6H A;  5E3F A;  3VR3 A;  4DUZ L;  4R4Q A;  4JI2 L;  5BR8 L;  1EWH A;  2YV5 A;  2UUC L;  3I8Z A;  4DR4 Q;  3CU7 A;  4OWX B;  1IBM Q;  3J80 L;  3S1M B;  4RGO S;  4P71 A;  2XRQ D;  1PZK D;  2L11 A;  4JI7 Q;  1EY4 A;  1JJC B;  3GTG B;  4ZCK A;  1BDO A;  1LTR D;  3W2D A;  5JVH 3;  1CKO A;  5FO9 B;  4UP9 A;  2B8F A;  2MQH A;  3AU7 A;  2UUA Q;  3K5M A;  1QJO A;  1U4P A;  5C4J B;  3STB C;  1A3U A;  2EY5 A;  2CWP A;  1QWY A;  4FXK C;  2BOS A;  2Z8L A;  1QNK A;  3FMC A;  3GTQ B;  1GUS A;  2HCI A;  4PQX A;  2HQE A;  2ZXR A;  4A3C G;  2L15 A;  4JI4 Q;  1SXT A;  3ULJ A;  1ZYR C;  3WWV A;  5IT9 c;  4JOI A;  1I4P A;  1A63 A;  1RTO A;  2R92 H;  3HOU H;  1GVP A;  4AQY Q;  2MO1 A;  4DR4 L;  5IP7 G;  1HZ9 A;  1B44 D;  1RF2 D;  3UDI A;  2EJG C;  2TSS A;  3HKZ B;  1NE3 A;  3D4D A;  1IBM L;  1PVO A;  1S5E D;  4JI7 L;  3QR8 A;  1IKM A;  4UPA A;  1RIP A;  3A7L A;  1EWC A;  5FJ8 G;  2NN6 H;  3GTO H;  5KGU A;  2UUA L;  3NHH A;  2N78 A;  2YU9 H;  3TQY A;  2HQL A;  4A3G B;  3L7Z C;  4ME5 A;  1YIT A;  3CF5 A;  3QJY A;  2JA6 H;  1YBY A;  4A3E G;  2DY8 A;  4FO2 A;  3NP8 A;  2K03 A;  4KY6 A;  3V05 A;  2VB3 X;  1S5D D;  2VL6 A;  1CZW A;  4DR1 Q;  3PO3 G;  2NZO A;  4JI4 L;  3FRP B;  3SK4 A;  5IYB H;  1PTO C;  1SRO A;  3H0G G;  5CV6 A;  1B9N A;  1BBU A;  4LF5 Q;  1QIL A;  1TWF H;  4GOP A;  4AQY L;  4NW2 A;  5IE8 A;  2A74 C;  1QNU A;  1YNN D;  2EYF A;  3BYT B;  1LYL A;  2XVS A;  3K80 C;  2JYO A;  4A93 G;  1ZEQ X;  4UAI A;  5M5W B;  1RDP D;  4H7B A;  2IX0 A;  2Y0S E;  1SE4 A;  2AQ3 B;  2NWG A;  3FVQ A;  4NDX A;  3PO2 H;  2E2I B;  2IWH A;  2AWO A;  5M3M H;  1CSP A;  2PNR C;  1KLG D;  4C2M B;  1PH7 A;  4A3D B;  3E0J A;  1E2V A;  1A8V A;  4NXN Q;  1MI2 A;  2TMP A;  1PH5 A;  1FD7 D;  5GQO A;  4LF4 Q;  4PG3 A;  1LTI D;  2RHQ B;  4DNR B;  2EY1 A;  3S1M H;  4WJ4 A;  1VQG A;  2R61 A;  1CUK A;  4DR1 L;  1KAW A;  4HR7 B;  3F1Z A;  1O7L A;  2B63 B;  3GTG H;  1DGS A;  3RN5 A;  5D65 A;  3E9I A;  4IUP A;  4ZUJ A;  4LF5 L;  1HFN A;  4JBW A;  4FF4 A;  1ESR A;  3NUC A;  4U67 3;  4IUN A;  5C3X A;  5EBC A;  2E76 C;  1N36 Q;  1TS4 A;  1EY6 A;  5JPM C;  1EY7 A;  5IYC H;  2B8G A;  1HPC A;  3CRK C;  3NEM A;  1AEX A;  1FYC A;  3GTQ H;  2F0U A;  1X3F A;  4C56 C;  1Q7Y C;  2XNA C;  4QGU A;  2JA5 H;  3HOY B;  2HHH Q;  5JEA G;  3G6J B;  3UDG A;  4C3I B;  1BQQ T;  3K5O A;  1XX8 A;  4OEL B;  4NXN L;  1L0W A;  4G57 A;  4LF4 L;  3A0J A;  4LFC Q;  4EQP A;  4IFD J;  2K05 A;  3D31 A;  1WYD A;  2HDL A;  2Q8T A;  4JI5 Q;  3ERQ A;  4O2D A;  1VF7 A;  4DK1 A;  1II3 A;  4KHZ A;  1B70 B;  3VA7 A;  3ER0 A;  5IT9 L;  3U4Z A;  1LTG D;  1PRT B;  3KK7 A;  5CV9 A;  4A3G H;  1K0R A;  1K9M C;  3NQT A;  1N36 L;  3DEP A;  1QOH A;  1IZ6 A;  4B9X A;  4J15 A;  4IZ8 A;  1HQM C;  2ENB A;  1STA A;  4YWL A;  2MPM A;  4JYA Q;  2HHH L;  1SJE D;  3N52 A;  3DMU A;  5IGF A;  3J7Y W;  3S16 B;  1EYD A;  3UI2 A;  1HNZ Q;  2D5D A;  3I55 A;  4L5R C;  1Y8O B;  1KHI A;  3TZD A;  4LFC L;  3HOU G;  1B4O A;  1K3R A;  5C0X G;  1S4Z A;  4JI8 L;  4JI5 L;  4RAU C;  2GN5 A;  3GP7 A;  3KLW A;  5AFW A;  2OTJ A;  1R4P B;  2E2I H;  1M4V A;  3HOV B;  1PMR A;  3TP6 A;  4CJ2 C;  3R3O A;  2NN6 G;  2KCC A;  5G3L F;  1T5X D;  1KXL A;  2I5M X;  1JIC A;  2GVA A;  4ZUI A;  1QUQ A;  1SSO A;  2IPK D;  4GLX A;  1KLU D;  3NBH B;  5COR A;  1VQM A;  1BF4 A;  1C4Q A;  4QL5 A;  3IAY A;  5EBD A;  1F77 A;  4JYA L;  4X66 Q;  4FF3 A;  1STY A;  2LXK A;  2B63 H;  1STB A;  1H9M A;  5IYB G;  1HNZ L;  3EN2 A;  4J1M A;  1VQ6 A;  4AYB B;  2KED A;  4X64 Q;  2C5C A;  1TVX A;  1WTW A;  1PH8 A;  3KJO A;  5JJK A;  5JPN C;  5KNB A;  1DOK A;  3OIQ A;  3QIA A;  5CGK A;  2Q2T A;  4H44 C;  1NR2 A;  4CBV A;  3I4L A;  5IYD H;  4DV2 L;  1L0X B;  1B3Q A;  3A54 A;  2K5W A;  4JI6 Q;  3HOY H;  3PO2 G;  2EYH A;  2LFN A;  4FF1 A;  1SYG A;  2OQ0 A;  3KF6 B;  2FXQ A;  3DWP A;  4C3I H;  5M3M G;  4LNQ A;  3LWU A;  5C3W A;  1J5E L;  3GTK B;  2JA9 A;  1GUO A;  5LMN L;  2ZJQ A;  1VQO A;  1Y8N B;  2F0M A;  5IGG A;  2DNE A;  3HP3 A;  2UXC Q;  1PH2 A;  1BCP C;  1HNW Q;  4X66 L;  4X6A H;  2FJ2 A;  2L55 A;  1KNA A;  2ICI A;  3GDE A;  1E22 A;  2F0I A;  2MJ8 A;  5IGD A;  1B2T A;  4DGZ A;  2UU9 Q;  1SNC A;  1AW7 A;  4X64 L;  2EXZ A;  2RDH A;  4IJH A;  1CKN B;  2BE5 C;  1WTP A;  2I5L X;  3BVG A;  1GUW A;  5L37 A;  2FFK B;  1MHW C;  1S3O A;  5C5M A;  2VUM B;  4JI6 L;  2EVB A;  2EXD A;  2KCN A;  3Q23 A;  3TN2 A;  3G4S A;  4GNX B;  4MNO A;  3S16 H;  1RJT A;  1IBK Q;  1BUV T;  2KOL A;  4LUO A;  1WTH A;  1H9S B;  3BVM A;  4A3J B;  4R8I A;  3F2D A;  1EOV A;  2WKC A;  4R4I A;  1EQT A;  4IPC A;  2UXC L;  1Y14 B;  2LY7 A;  2BCO A;  3S1R H;  5JAV A;  1PZI D;  1V1O A;  1TWH B;  4B3M Q;  4XDX A;  1HNW L;  2DNC A;  4K8I A;  1R9T B;  5CV7 A;  2F0O A;  3TBI B;  3OWF A;  3HOV H;  1S72 A;  1F2L A;  1E24 A;  2B2T C;  1A2U A;  1PLF A;  1MKH A;  3AQQ A;  2UU9 L;  1XPU A;  3OOC A;  4IJL A;  3UDF A;  3J81 E;  2NZ1 D;  1VQP A;  1EIY B;  4LF6 Q;  4M1U B;  2A68 D;  3M4O H;  1Z9F A;  2ZXO A;  1X3P A;  3E3X A;  4IFD I;  2F3V A;  5I2X A;  3K5L A;  1EY8 A;  4QB4 A;  1UAP A;  2QF7 A;  1Y8P B;  1UWV A;  1IBK L;  2K50 A;  4X3S A;  1A62 A;  3N6R A;  1I50 B;  5D14 A;  1HA5 A;  2RDF A;  2IX1 A;  3EFX D;  2VZA A;  5K36 H;  5IIF A;  5EGT A;  1GUT A;  3T13 A;  1LM0 A;  5CC4 A;  4B3M L;  1PTO F;  1B7Y B;  4L63 B;  1GHJ A;  4UHV A;  4F8M A;  1PV4 A;  3CCL A;  2PW5 A;  4DU9 A;  4A3I G;  3OTO Q;  4QQB X;  1LT4 D;  3LNN A;  3TDQ A;  3GTJ B;  2XTI A;  4DR5 Q;  4NPS A;  4RH6 A;  4A3D G;  5ELF A;  3T16 A;  5EAY A;  3F2U A;  1VQH A;  3C2P A;  1ET6 A;  1UEA B;  3CKI B;  2JEA I;  4BBR B;  2VS1 A;  2PZU A;  4CKB A;  1C0A A;  2R7Z B;  1CA6 A;  1I4G A;  4QF4 A;  3RMH A;  3PIP 3;  2JK8 A;  2B63 G;  1VF5 C;  2PI2 A;  4KN4 C;  4DF7 A;  2MNA A;  4K14 A;  4ODG A;  3STB D;  3CC7 A;  4KI0 A;  2ZJR A;  2E75 C;  1W6J A;  4ULL A;  2B2W C;  5KNC A;  5I6Y A;  1Y1V G;  1D7Q A;  2K4K A;  2KA7 A;  4TRD A;  3AEV A;  5IGE A;  3PCO B;  4JBM A;  3KDF B;  3OTO L;  3K0X A;  1AH9 A;  4DR3 L;  3PF5 A;  3I3C A;  2VUM H;  3RR5 A;  5IYD G;  2I0Q A;  2F1M A;  4DR5 L;  3HOY G;  3KOJ A;  4MZ9 A;  1MIU A;  4C3I G;  4F88 A;  1PH1 A;  4A3J H;  4BY1 B;  1Q8I A;  3RN2 A;  5ELC A;  2E2J B;  4ALP A;  2A73 B;  2NBF A;  3MHB A;  1TS5 A;  1IBL Q;  1ILP A;  1TWH H;  4FXG C;  2UUB Q;  2EYO A;  1VQ7 A;  1SMY C;  3C1E A;  1DOL A;  1R9T H;  1HH2 P;  3WOE A;  3R93 A;  4LJZ C;  5EJW A;  4ABN A;  4N8F A;  4PZ6 A;  2AWN A;  1IW7 C;  1IHZ A;  4RGM A;  1BR9 A;  2NB0 A;  1EFW A;  1CK1 A;  2VY3 A;  4XYQ A;  1NR4 A;  5KRU A;  2CH4 W;  2F0W A;  3L2P A;  2OXP A;  3I90 A;  1TQO A;  4DV7 Q;  2OF1 A;  3I73 A;  1SJH D;  1WTV A;  2C9O A;  1DZ1 A;  5IGC A;  1WTQ A;  2WB1 B;  2CW0 D;  1PTO D;  2QEX A;  1VQA A;  1BKB A;  1K8A C;  5ELD A;  2A6H C;  4RA8 A;  3GV3 A;  4A3B H;  1NMF A;  4NP5 A;  1KNE A;  5J39 A;  3HOX H;  2K5D A;  3AFQ A;  3L3O C;  5CBE E;  1LTL A;  1Y69 U;  1XXG A;  1VQE A;  3TSS A;  2EYP A;  4FVM A;  5EKL A;  2F0V A;  2R92 B;  1YI2 A;  3H91 A;  4DKA C;  3TS0 A;  3AB9 A;  1K8M A;  1JWM D;  5IP9 H;  1K0S A;  1F2M A;  4Y52 H;  3HOV G;  4ZRZ A;  4CGY B;  1V1Q A;  4A76 A;  4EQO A;  4KD4 A;  1SNM A;  1Q3L A;  3HZX A;  2V1C C;  1CTM A;  1YZ6 A;  5DAU A;  3CQZ B;  4DV7 L;  5J22 A;  4BBR H;  2K6A A;  1YIJ A;  2R7F A;  3NQI A;  1X6O A;  2R7Z H;  4K5X A;  1KTK A;  2JA6 B;  1PZJ D;  1RHP A;  3KBX A;  2NYZ D;  3BG3 A;  4HIO A;  1UE7 A;  1TS2 A;  2DJF C;  2KHS A;  4AYB G;  2KEE A;  2A69 C;  1KRT A;  3WDN A;  3X3N A;  3JC6 6;  2E2D C;  2ZM6 Q;  3M7N A;  4X65 Q;  2H4O A;  4G7H C;  4TQU S;  4RFB A;  2HT1 A;  3SEB A;  1I3Q B;  1K73 C;  1ET9 A;  4X62 Q;  3NTI A;  1PHJ A;  2OQK A;  3DLL A;  2CFM A;  1TKW B;  1XWE A;  2B2T A;  5E4W C;  2F4V Q;  1TXY A;  1O7I A;  4P75 A;  4BY1 H;  3IKJ A;  1SRU A;  2E2J H;  3M85 A;  3VR5 A;  3A5U A;  1MJE A;  5IOD A;  3S2D B;  4K8J A;  4GLV B;  3CC4 A;  1A15 A;  2AUK A;  2BH2 A;  2OT2 A;  2WII B;  4EGV A;  1YHA A;  3OPO A;  3S2H B;  2NZH A;  5C44 G;  1E1O A;  3BU2 A;  4ZKC B;  4DAY A;  3VR2 A;  2F0Q A;  3LGJ A;  2ZM6 L;  2SNS A;  4X65 L;  4XT3 B;  2IY5 B;  4M8A A;  4KKU A;  3CP0 A;  1EEI D;  5GRO A;  4DV6 Q;  1VQB A;  2DJG C;  3W1B A;  2F3W A;  3W1G A;  4F87 A;  4X62 L;  3A5Z B;  3KLR A;  4IPH A;  2NTT A;  4C1N K;  3H6M A;  3NEN A;  2F4V L;  4OL7 A;  2VUM G;  1ML0 D;  2F0G A;  2RSN A;  4EVO A;  1X3Q A;  3BS1 A;  4GLA C;  5C6A A;  2JA5 B;  4C3H H;  1EZ8 A;  3NK9 A;  4A3J G;  4JC0 A;  4FF2 A;  1VMP A;  4IUU A;  1YJ9 A;  2DN8 A;  3Q8D A;  1OTC A;  2XGT A;  1CQV A;  4RGN A;  4C3J G;  1Z6H A;  2FHT A;  1I4Q A;  1YJW A;  1X32 A;  4DV0 Q;  1LT6 D;  2HUG A;  2HIV A;  3HS0 C;  1X9N A;  3C1F A;  2JA8 H;  1PA6 A;  2K75 A;  2N55 A;  3ND8 A;  3SE0 A;  1LAC A;  4HJA A;  4JI1 Q;  2QEJ C;  3KF8 B;  1SMX A;  2WAQ E;  1EIH A;  3MAQ A;  2CWA A;  1Q81 C;  2DY7 A;  4XQJ A;  4DV6 L;  1GM5 A;  2B2W A;  2ZTE A;  3CQZ H;  1PRT C;  2K5N A;  4QMG A;  1CI3 M;  4KJN A;  3BVZ A;  4DN4 M;  3HRZ C;  3TRZ A;  2AQ1 B;  2VNU D;  2Z4I A;  3J7A 5;  3HOZ B;  2K14 A;  2RCF A;  2Y0S B;  2IT1 A;  1V43 A;  2EYL A;  4A3F H;  4OO1 G;  5NUC A;  4RCN A;  4ZKB B;  5C4X B;  3K5N A;  2A1A A;  4CDC C;  1HFG A;  4PNY A;  1I3Q H;  2SDF A;  1VQ5 A;  2N3S A;  4I65 A;  4KD3 A;  3ICE A;  2QCP X;  1DCZ A;  4DV0 L;  2EPB A;  1JMC A;  3J7A V;  1ICW A;  2B2V C;  3K6O A;  3K57 A;  1YNX A;  4HJ8 A;  1NUC A;  4JI1 L;  3NPP A;  2D0O A;  4XIG S;  2FMC A;  3FHW A;  4RWS C;  2Z6K C;  4KHP Q;  1D6E C;  4CKE A;  5JJI A;  3S2D H;  4QIW E;  3IL8 A;  3K58 A;  1JCK B;  4TKO B;  4LUV A;  4BBR G;  3K0Y A;  5DEH A;  3H3V C;  3TP8 A;  1ASY A;  3S2H H;  2R7Z G;  2K01 A;  3I4M H;  2K52 A;  1NTG A;  5FLX E;  4A3K H;  1A2T A;  5C3E H;  1TU2 B;  1B9M A;  1XMO Q;  5ELO A;  1STN A;  2MHV A;  4ZAI A;  4DUY Q;  3FP9 A;  1VS0 A;  3ITP A;  2Q2U A;  3J81 c;  3A7A B;  3RUZ A;  3D6W A;  1DON A;  2ID0 A;  2R93 B; 
#chains in the Genus database with same CATH homology
 1P8L A;  4RMF A;  1YHQ A;  1J5E L;  1KL9 A;  2JA9 A;  3EIV A;  4LF7 Q;  3PF4 A;  2C35 B;  5LMN L;  1TWA H;  1FL0 A;  2ZJQ A;  4BA2 I;  3CC2 A;  4IFD G;  1VQO A;  4DV1 L;  2KHI A;  2A8V A;  4JI3 L;  1JE5 A;  5LMN W;  3CCS A;  3DM3 A;  1PH2 A;  2UXC Q;  3UDX A;  1Q12 A;  4A3L H;  4DR2 Q;  1HNW Q;  4KHP L;  3T1H L;  4X66 L;  3CCV A;  4X6A H;  4BY1 G;  4OON A;  4YWM A;  5C0X I;  3GDE A;  1E22 A;  3PUW A;  5IWA L;  1XPR A;  4BBS G;  1YHB A;  3M4P A;  4L5Q A;  3E9H A;  4R4C A;  4LFA Q;  3ULL A;  2VQF Q;  1HR0 W;  1D8L A;  4GN3 B;  4GOP B;  4B3T L;  2ATW A;  4R4O A;  4UP8 A;  4YWK A;  4DNI A;  4OO1 I;  4DK6 C;  2B3G A;  2UU9 Q;  3J81 i;  4B3S L;  1YVC A;  3PUZ A;  4X64 L;  3J80 c;  1GO3 E;  1U5K A;  4DV5 L;  1PH4 A;  4LF9 L;  1XJV A;  2NN6 I;  1QUQ B;  2PMZ E;  3BZK A;  2AHO B;  4JI8 Q;  4POF A;  1N33 L;  2D62 A;  1X56 A;  1XMO L;  4C3J H;  4IJH A;  2CCZ A;  1CKN B;  1I6H H;  2I5L X;  4DUY L;  1PYS B;  1G29 1;  2K5V A;  2E5L L;  1S3O A;  4GOP C;  1E3P A;  4JI6 L;  2EXD A;  4JI0 Q;  3RLF A;  3G4S A;  4GNX B;  1VQD A;  4MNO A;  3S16 H;  3TS2 A;  4YY3 Q;  1IBK Q;  3CCU A;  4PZ7 A;  4BXX G;  1WJJ A;  3KYH C;  4P74 A;  4LUO A;  5J3B A;  4HJ7 A;  3UE1 A;  2RF4 A;  4LF7 L;  4GN4 B;  3OYY A;  3F2D A;  1EOV A;  4R4I A;  4GKJ Q;  3J80 i;  4IPC A;  1VQL A;  3TRE A;  2UXC L;  1Y14 B;  3HOZ H;  2B29 A;  3BZC A;  3K7A H;  3S1R H;  1Q46 A;  4DR2 L;  4B3M Q;  1HNW L;  3W5O A;  4GNX C;  5JEA J;  5FLM G;  3PUY A;  2YTX A;  5M5Y H;  3F2C A;  1EUJ A;  3CCJ A;  2YTV A;  4FDB A;  1EYG A;  5C4X H;  3HOV H;  1S72 A;  1E1T A;  2VQF L;  1KQS A;  1FVI A;  4LFA L;  1E24 A;  3PV0 A;  1Y1W G;  1MKH A;  2BA0 A;  2JEB I;  3AQQ A;  2UU9 L;  2R92 G;  3HOW G;  1XPU A;  3PUV A;  1I50 H;  4IJL A;  3UDF A;  3UE0 A;  2NVT H;  4BY7 G;  1EQR A;  1VQP A;  4A4I A;  4EQ5 A;  4DAY B;  1JB7 A;  1EIY B;  2KCT A;  1QZG A;  4LF6 Q;  3CMA A;  1IXR A;  4A3B G;  1N9W A;  1NMG A;  1Z9F A;  4PZ8 A;  3RLN A;  3HOX G;  1XMQ Q;  2I5H A;  4DV2 Q;  4QY7 A;  3KDF A;  1IBL L;  4IFD I;  2R6G A;  1L1O B;  2UUB L;  1VQI A;  4JI0 L;  4JCV E;  5H1S E;  3H15 A;  4JV5 Q;  4YY3 L;  1UWV A;  1IBK L;  2K50 A;  3I7F A;  1A62 A;  1G6P A;  1OXU A;  2WB1 E;  3A74 A;  1J5E Q;  3GTJ H;  2IX1 A;  1HZA A;  5IP9 G;  1LUZ A;  3HKZ E;  5LMN Q;  2VZA A;  3K7U C;  2JA6 G;  3GO5 A;  5GAE C;  1QVC A;  1L1O C;  1LM0 A;  2PQA A;  2WFW A;  2VQE Q;  4P73 A;  4B3M L;  1B7Y B;  2N8N A;  4RG1 A;  1I94 Q;  1Z47 A;  4DUZ Q;  1PV4 A;  1HR0 Q;  3CCL A;  1WOC A;  4JI2 Q;  4A3I G;  2ES2 A;  4R1J A;  5BR8 Q;  5IWA Q;  3OTO Q;  2KEN A;  1PH6 A;  4QQB X;  5GAH C;  1Q8K A;  3ZJY C;  1S40 A;  4IOC A;  2UUC Q;  2XTI A;  4DR5 Q;  4NPS A;  1E7Z A;  4KLK A;  3ULP A;  2R93 H;  4A3D G;  2A19 A;  4DV5 Q;  1CSQ A;  5GAG C;  3BJU A;  5EAY A;  5C0X J;  1VQ8 A;  1N32 Q;  3M4Q A;  4DPG A;  4HJ9 A;  2F52 A;  1HNX Q;  1VQH A;  2OWO A;  4HIK A;  5M5X H;  2JEA I;  1BBW A;  5GAD C;  2UXB Q;  3PGZ A;  2VS1 A;  3D0F A;  1XMQ L;  1OXT A;  4IO9 A;  4JBK A;  1C0A A;  4JV5 L;  1KC8 C;  2JK8 A;  3I56 A;  3PSI A;  2B63 G;  5HY6 A;  4YCV A;  1HJP A;  1WCM H;  4LW1 A;  4TVA B;  2PI2 A;  4L5T A;  2MNA A;  4NB3 A;  1NJI C;  2JA7 G;  2UXD Q;  1W2B A;  4GN5 A;  3U58 A;  3STB D;  3CC7 A;  4KI0 A;  2ZJR A;  2VQE L;  1MJC A;  2JQO A;  1OXV A;  1Y1V G;  2EIF A;  5IY0 A;  4BBS H;  1IL2 A;  1D7Q A;  2K4K A;  1I94 L;  3E0E A;  3AEV A;  4DUZ L;  4R4Q A;  3PCO B;  1HR0 L;  4JBM A;  4JI2 L;  3KDF B;  5BR8 L;  3OTO L;  3K0X A;  5AJ3 Q;  4DR3 L;  1AH9 A;  4A3M H;  3PF5 A;  2IHF A;  2VUM H;  3RR5 A;  5IYD G;  2YV5 A;  2I0Q A;  2KCM A;  2UUC L;  4DR5 L;  1X3E A;  4DR4 Q;  3HOY G;  1H95 A;  3KOJ A;  5C4J H;  4MZ9 A;  4OWX B;  1MIU A;  1IBM Q;  3S24 A;  4OX9 Q;  1PH1 A;  1KRS A;  4A3J H;  1N32 L;  4P71 A;  3RN2 A;  3GTM H;  1HNX L;  3OW2 A;  4JI7 Q;  1JJC B;  4ALP A;  2GVB A;  5IYC G;  1CKO A;  2PQA B;  4L5S A;  4UP9 A;  3IRB A;  1IBL Q;  2MQH A;  1TWH H;  2UUA Q;  2CKZ B;  2Z6K A;  2UUB Q;  1C7Y A;  1VQ7 A;  4A3L G;  2H5X A;  1R9T H;  1HH2 P;  2JA5 G;  4APV A;  3FKI H;  3STB C;  4IPG A;  2CWP A;  4PZ6 A;  2AWN A;  2R7D A;  4DV3 Q;  4MTN A;  2UXD L;  2RCN A;  4GS3 A;  1EFW A;  2VY3 A;  2WB1 G;  2NVQ H;  3F8T A;  5DLQ E;  3L2P A;  4WJ3 M;  3HKZ G;  4A3C G;  2L15 A;  1G51 A;  4JI4 Q;  4DV7 Q;  3L0O A;  3ULJ A;  1VQ9 A;  3WWV A;  5IT9 c;  4JOI A;  2DGY A;  5AJ3 L;  1A63 A;  2R92 H;  3HOW H;  3HOU H;  1GVP A;  5M3F H;  4UP7 A;  4UY8 C;  4AQY Q;  2MO1 A;  3M9B A;  4DR4 L;  5IP7 G;  1VQA A;  1HZ9 A;  2QEX A;  1KIX A;  1AE2 A;  1BKB A;  3UDI A;  3PIO A;  1K8A C;  1VQK A;  1IBM L;  1NE3 A;  2LSS A;  4JBJ A;  4R4T A;  3K81 C;  4OX9 L;  4K0K Q;  1PVO A;  2JE6 I;  4A3B H;  4A3G G;  4B3R Q;  1NMF A;  3I4N H;  2ZTD A;  3HOX H;  4JI7 L;  1Q1E A;  3AFQ A;  4UPA A;  2F3I A;  1RIP A;  1LTL A;  1ASZ A;  1XNQ Q;  1V9P A;  4IPD A;  1JJ2 A;  1SR3 A;  2JA8 G;  4HIM A;  1VQE A;  4DAM A;  5FJ8 G;  3GTO H;  2UUA L;  3RZD H;  1UE1 A;  1K83 H;  1I5F A;  2N78 A;  3KJP A;  1YI2 A;  2E2H H;  2YU9 H;  4DKA C;  3TS0 A;  3TQY A;  2HQL A;  3KF6 A;  3S14 H;  3L7Z C;  5IP9 H;  4AIM A;  1SE8 A;  1YIT A;  1X3G A;  3CF5 A;  1JT8 A;  4Y52 H;  2JA6 H;  3HOV G;  1YBY A;  1V1Q A;  2QGQ A;  3HKS A;  4DV3 L;  4A76 A;  4A3E G;  3GTL H;  2PI2 E;  1GKH A;  2OCE A;  2ZJP A;  4BA1 I;  3M4O H;  3SGI A;  3S1N H;  2V1C C;  2VL6 A;  1PH9 A;  1M90 C;  1PFS A;  5M5W H;  2VW9 A;  4POG A;  4DR1 Q;  1YZ6 A;  1Q82 C;  1PH3 A;  4A3I H;  3PO3 G;  2NZO A;  4JI4 L;  4DV7 L;  1X55 A;  5IYB H;  4DV4 Q;  4BBR H;  2DUD A;  4YCW A;  1SRO A;  3H0G G;  1YIJ A;  2R7F A;  2KBN A;  4A3F G;  3GD7 A;  1VQJ A;  4DR3 Q;  1BBU A;  1X6O A;  1TWF H;  4C2M H;  1B8A A;  4GOP A;  4AQY L;  5IE8 A;  4LF5 Q;  2R7Z H;  4A3D H;  1VQF A;  5ELN A;  4LUZ A;  1Q86 C;  4K0K L;  4DR6 Q;  1LYL A;  3K80 C;  3RZO H;  4HIO A;  1UE7 A;  4A93 G;  4ME3 A;  4B3R L;  3G6E A;  4AYB G;  4AH6 A;  2IX0 A;  2Y0S E;  1TWC H;  3NEL A;  1KRT A;  3JC6 6;  2D0P A;  1CKM A;  2ZM6 Q;  1XNQ L;  4P72 A;  3M7N A;  4X65 Q;  3PO2 H;  3J81 j;  1NBW A;  2AWO A;  4TQU S;  5M3M H;  1AE3 A;  1CSP A;  2HT1 A;  2WP8 J;  1K73 C;  1EIF A;  1PH7 A;  1A8V A;  4X62 Q;  3CAM A;  3CCR A;  4GNX A;  1PHJ A;  2OQK A;  4NXN Q;  3S15 H;  1OXS C;  3DLL A;  2CFM A;  1PH5 A;  4LF4 Q;  2Q2I A;  5GQO A;  4PG3 A;  5JJL A;  2F4V Q;  1TXY A;  2RHQ B;  4LFB Q;  4QJF A;  1Y1V H;  4OWW B;  1O7I A;  1FJG Q;  3S1M H;  4WJ4 A;  1VQG A;  2R93 G;  4P75 A;  4BY1 H;  3I4M G;  1CUK A;  4DR1 L;  1KAW A;  1SRU A;  2E2J H;  3M85 A;  3F1Z A;  4A3K G;  4DV4 L;  5C3E G;  3GTG H;  1DGS A;  3A5U A;  1HZB A;  3RN5 A;  1MJE A;  4OXP A;  3E9I A;  4GLV B;  3PUX A;  4EX5 A;  1UE6 A;  3CXC A;  1YJN A;  3CC4 A;  4LF5 L;  3CPF A;  3T1Y Q;  2BH2 A;  2PNH A;  1YHA A;  4JBW A;  1EWI A;  4AYB E;  2NZH A;  5C44 G;  1E1O A;  3BU2 A;  4DR6 L;  1N36 Q;  3JAM c;  4NXM Q;  1WFQ A;  5IYC H;  3NEM A;  1WCM G;  3GTQ H;  2UXB L;  3LGJ A;  3MEF A;  2ZM6 L;  4GKK Q;  1X3F A;  1Q7Y C;  4X65 L;  2QA4 A;  1C9O A;  4QGU A;  2IY5 B;  4DR7 Q;  2JA5 H;  3CP0 A;  4DV6 Q;  5GRO A;  1L1O A;  1TWG H;  1VQB A;  3W1B A;  3W1G A;  5JEA G;  2HHH Q;  4BXX H;  1YEZ A;  3UDG A;  4X62 L;  3A5Z B;  2WAQ G;  1W3S A;  4NXN L;  1L0W A;  1RL2 A;  4IPH A;  1VQ4 A;  4XTC S;  4YHH Q;  1X65 A;  3I4O A;  3G71 A;  1VQN A;  3NEN A;  4LF4 L;  3A0J A;  3CD6 A;  4A3M G;  4LFC Q;  2F4V L;  2VUM G;  1GD7 A;  3H3V I;  4LFB L;  4IFD J;  4A3C H;  3D31 A;  1FJG L;  1WYD A;  2BA1 A;  5FLM H;  4GLA C;  3JAM i;  4JI5 Q;  3J7Z C;  2Q2H A;  4C3H H;  4A3J G;  2MFI A;  4JC0 A;  4O2D A;  1XNR Q;  2KHJ A;  2OTL A;  1YJ9 A;  3Q8D A;  3AYH B;  3MXN B;  1Y1W H;  4KHZ A;  4A75 A;  2XGT A;  1B70 B;  1N8R C;  5IP7 H;  1OTC A;  3ER0 A;  1VCI A;  2NVX H;  5FLX c;  3RNU A;  3T1Y L;  3PIP A;  3U4Z A;  3CCE A;  3G48 A;  2ASB A;  1YJW A;  4BY7 H;  2ZTC A;  4A3G H;  2HIX A;  1K0R A;  1K9M C;  4DV0 Q;  2YTY A;  1N36 L;  3CCQ A;  2K5H A;  2HIV A;  1XTD A;  4NXM L;  1X9N A;  3FKI G;  1QVG A;  1IZ6 A;  2JA8 H;  3EBE A;  1PA6 A;  2K75 A;  2BH8 A;  4J15 A;  1J6Q A;  3CPW A;  5FJ8 H;  4HJA A;  4JI1 Q;  4GKK L;  1OXX K;  3KF8 B;  1SMX A;  3K8A A;  2WAQ E;  4IOA A;  2CWA A;  5LMU Q;  3HFZ B;  1Q81 C;  4YWL A;  1IYJ B;  3U4V A;  4DV6 L;  1GM5 A;  4DR7 L;  4JYA Q;  2HHH L;  2LXJ A;  2ZTE A;  3HOZ G;  2Y0S G;  3CQZ H;  2K5N A;  4LF8 Q;  2E8G A;  4OWT B;  1Q1B A;  1HNZ Q;  1A0I A;  4A3E H;  4YHH L;  2YYZ A;  3I55 A;  2EQS A;  4YCU A;  4L5R C;  1KHI A;  5C4X G;  1BVS A;  3TRZ A;  4LFC L;  1SLJ A;  3HOU G;  1KD1 C;  2VNU D;  5M3F G;  3M3Y H;  3S1Q H;  2IHE A;  4HID A;  1N34 Q;  3J7A 5;  1K3R A;  3PO3 H;  2CQO A;  2K14 A;  5C0X G;  2IT1 A;  1K8G A;  4JI8 L;  1V43 A;  1SN8 A;  4JI5 L;  3H0G H;  2GN5 A;  3H3V H;  3KFU A;  4JG2 A;  3KLW A;  4A3F H;  1XNR L;  3CME A;  4OO1 G;  3I4N G;  2OTJ A;  1U0L A;  4H02 A;  2E2I H;  1WI5 A;  4O0A A;  1FGU A;  2A1A A;  2Z0S A;  3F2B A;  3S17 H;  1M1K C;  5E7N A;  4HJ5 A;  3AFP A;  2ALY B;  1I3Q H;  1NY4 A;  2NN6 G;  1VQ5 A;  3CCM A;  2N3S A;  4PMW A;  3ICE A;  4A93 H;  1T9H A;  2RHS B;  1L2F A;  4DV0 L;  1JMC A;  1KXL A;  2I5M X;  3GTP H;  1YNX A;  3ERS X;  4GKJ L;  2GVA A;  4HJ8 A;  4DV1 Q;  1QUQ A;  4JI1 L;  4GLX A;  3RLO A;  1HZC A;  1X54 A;  2D0O A;  3CW2 C;  4JI3 Q;  3VDY A;  4XIG S;  1CKN A;  3NBH B;  1VQM A;  3FHW A;  4QL5 A;  5LMU L;  1SFO H;  2Z6K C;  5K36 G;  4KHP Q;  4JYA L;  3T1H Q;  4X66 Q;  1XPO A;  2LXK A;  2B63 H;  1UEB A;  5JJI A;  3S2D H;  4QIW E;  4LF8 L;  5IYB G;  1HNZ L;  2MO0 A;  3EN2 A;  4BBR G;  4LUV A;  2JA7 H;  1VQ6 A;  1QZH A;  4B3T Q;  1UE5 A;  4B3S Q;  1ASY A;  3S2H H;  1QVF A;  2AKW B;  2JJQ A;  4X64 Q;  3I4M H;  2NVY H;  2K52 A;  1NTG A;  3TEH B;  1EQQ A;  2R7Z G;  4Y7N H;  1PH8 A;  1N34 L;  4LF9 Q;  3GTK H;  4LWC A;  3U50 C;  3KJO A;  5JJK A;  4A3K H;  1JJG A;  5C3E H;  4DK3 C;  5HGQ A;  4LF6 L;  1N33 Q;  1XMO Q;  2Q2T A;  5ELO A;  1PYB A;  2N49 A;  1P16 A;  4JOI C;  5IYD H;  4DV2 L;  4DUY Q;  2E5L Q;  3FP9 A;  1VS0 A;  2Q2U A;  3I2Z A;  4JI6 Q;  3HOY H;  3PO2 G;  5C44 H;  3J81 c;  1VQC A;  2OQ0 A;  3KF6 B;  4C3I H;  2FXQ A;  5M3M G;  4LNQ A;  2ID0 A;  2AMC B;  3B6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...