2KHSA

Solution structure of snase121:snase(111-143) complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title The native-like interactions between SNase121 and SNase(111-143) fragments induce the recovery of their native-like structures and the ability to degrade DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 26
structure length 121
sequence length 121
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2khsA00
3TMEA 4DFAA 1EY8A 1JOQA 3MVVA 5C5LA 3BDLA 2EY1A 5ISRA 5C3WA 1SYFA 3MHBA 5C4HA 2QDBA 5KRUA 5KYLA 2EYLA 2F0EA 2F0IA 4E6IA 1ENAA 1IHZA 2F0LA 2NUCA 4NDXA 1JOOA 1A3UA 4ZUJA 3D4DA 2EYMA 2HQEA 2PZUA 2WACA 4IZ8A 3D4WA 2O4XA 2EY6A 5IGCA 4MIUA 2F0GA 1F2MA 4G57A 3NXWA 3HEJA 1SYEA 3V2TA 1STGA 5HURA 3VA5A 4K5XA 4KD3A 2F0PA 5CR3A 5IOCA 4TRDA 4K14A 1II3A 4HTHA 2LKVA 4QF4A 3SR1A 4DGZA 5C4ZA 3QOJA 1STAA 1EYCA 4LAAA 5IGBA 1SYBA 1TT2A 2OF1A 2F0NA 5I6WA 3QOLA 4PMBA 1STHA 2EY2A 3NP8A 5IGEA 3R3OA 1KDCA 4PNYA 5IGFA 4EQOA 3SK4A 1AEXA 5KYIA 1STNA 4S3SA 5E3FA 5J1ZA 4F8MA 4IUNA 5HGTA 4DU9A 3EVQA 4YIJA 4HMJA 4KD4A 1SYDA 4ZQ3A 3NHHA 5I6YA 4DF7A 5IODA 3NK9A 5J39A 2F3WA 2SNSA 4RKLA 5CV6A 1EYDA 5C5MA 2EYFA 3OMCA 5J22A 3C1EA 3SHLA 1EY7A 3P75A 1A3VA 2F0HA 3HZXA 1EYAA 3E5SA 4H7BA 2F0SA 4NMZA 1A3TA 3D8GA 3OWFA 3SK6A 1EZ8A 4KTAA 1NSNS 5JOBA 3MZ5A 2EY5A 1SNCA 2EXZA 1KDAA 2SOBA 5I9OA 2F0VA 5EKKA 4K5WA 3ITPA 4KY6A 5JAVA 4F7XA 3ERQA 4KJOA 4PMCA 5IIFA 5M9OA 1STBA 2PW5A 1SNPA 3LX0A 4ZUIA 1SNMA 4NP5A 5I9PA 2F3VA 1TR5A 5C3XA 3TP8A 3RUZA 3BDCA 3P1HA 2F0FA 3TP5A 2OXPA 4N9TA 3T16A 5F2DA 1SNOA 4KJNA 3H6MA 4RKBA 2F0QA 2F0JA 2RKSA 3DHQA 4K8JA 4EQPA 2SNMA 4KV6A 2EYJA 1TQOA 4QMGA 1SNQA 1U9RA 2RBMA 3D6CA 4HMIA 4KHVA 4QB4A 5CV8A 4EVOA 3C1FA 2F0UA 5IGGA 5CV9A 5E1FA 2EYOA 5C6AA 3PMFA 3EJIA 2F0OA 3TP6A 5CC4A 2RDFA 1JOKA 3QB3A 1A2UA 1F2ZA 1SNDA 3DMUA 3SK5A 4B9XA 4WORA 4K2KA 1EZ6A 1KAAA 1EQVA 4ID6A 4K5VA 4KY5A 4ODGA 2PQEA 5CV5A 3OMGA 1A2TA 1F2YA 3U9OA 2F0DA 1EY6A 2KQ3A 4J6HA 5KGUA 2F0WA 5CV4A 2F0MA 5CV7A 5KIXA 1KDBA 4N9PA 4ME5A 4EQNA 5EKLA 3SK8A 1EY0A 2ENBA 1ENCA 3T13A 4J1MA 5DEHA 5KEEA 3SXHA 3NUCA 1RKNA 4KY7A 3TP7A 5DAUA 1SYGA 2EYHA 2PW7A 1EY9A 4K6DA 4K2LA 3EROA 1NUCA 1EY5A 2F0TA 1SYCA 2M00A 2PZWA 4I65A 3NQTA 5EGTA 1KABA 3MEHA 4B9WA 1EY4A 4IALA 2PYKA 3S9WA 4WRDA 2KHSA 4OL7A 2F0KA 3OSOA 2EYPA 4K8IA 4NKLA 5IGDA 2PZTA 5CGKA 4R8NA 1JORA 5K5PA 1STYA 3MXPA 5NUCA 2OEOA
chains in the Genus database with same CATH superfamily
5EJWA 1GXDC 4DV5L 2B2VA 3URYA 5JPMC 2WB1G 4P74A 3QR8A 2Z0SA 1GUSA 1MGSA 4MIUA 3CCLA 3D6WA 1SYEA 3LGJA 3A7AB 1AH9A 1H9RA 5IT9E 1GJXA 3UI2A 1TT2A 1DOKA 4YCUA 1CQFA 1EU3A 4OX9L 1PDQA 5KYIA 4MTKA 1XTDA 4KKTA 3K81C 4LFCL 1X32A 2K03A 4IUNA 1LTID 4YIJA 2D5DA 1PH6A 3UE1A 2F4VQ 3K0YA 3S1MH 4P72A 2J0TD 1K83H 3EBEA 2F52A 3JAME 4DUZQ 4H7BA 4XTCS 5JOBA 2FINB 1KNEA 1XXGA 2EY5A 2EXZA 3ITPA 4QL5A 3N6RA 5M5XH 4KJOA 3MTSA 4X64Q 1K8GA 3Q8DA 1XNRQ 1XPRA 1ENFA 1QJOA 2F3VA 3PIOA 1Q90A 3MXNA 3ULPA 4YHHL 1EIFA 4FXDA 2KOLA 1JB3A 1TY0A 5IP9G 4EQ5A 4Y52H 3GV6A 5CV8A 4EVOA 5C6AA 4B3RQ 4IPDA 2CCZA 2O5JC 2QF7A 1V9PA 2M2LA 1NMFA 2BDOA 2K5HA 3I56A 2H4OA 3Q6SA 1WTPA 5CORA 3HOXG 2JA8G 2HUGA 2KEDA 2H1EA 1QZGA 4O0AA 2CVRA 2NVTB 5KEEA 2LMCB 4RGNA 1WFQA 5GQOA 3HKSA 1VQ9A 3O13A 1G291 5AJ3L 1WTXA 2UXBQ 2L1BA 3F8TA 5D3DA 2IHFA 1SE3A 4QUFA 1Z9FA 2Z6KA 5D3IB 2SOBA 1J9OA 4GN5A 4JI4Q 2OQKA 1CZWA 5C4XB 2MPMA 3MA2B 1IHZA 4ZUJA 2GVBA 3D4DA 2WAQB 4DV7L 1DD2A 3PUVA 3CPWA 1XPOA 3NXWA 3M4OH 4ZKBB 1HZCA 5CR3A 4FF4A 3QWNA 1JE5A 2IX0A 4LAAA 4C3IG 3A8JE 2HD3A 4B3SL 2JEBI 2ZJRA 3KF8B 2N3SA 1PTOF 1XWEA 4UHVA 3OHXC 5J1ZA 1PH7A 5M5YB 1QVFA 2VL6A 2QCPX 1E0BA 4CKCA 4ZQ3A 2LSSA 4IURA 3GTLB 4DV3Q 2RQXA 5CV6A 3CC7A 2K5NA 1N36Q 3C1EA 3A56A 3P75A 2B63H 2F0HA 1L1OA 4NMZA 3OWFA 3MEFA 1Y1VG 4A93B 1D5MC 4PG3A 4X65Q 3H3VI 1GUGA 4BBSH 1NR2A 3PUZA 5IT9c 4L5RC 3BU2A 5T1GA 1U4LA 3I4MG 4FDBA 1B53A 1PRTB 1EEID 1CFMA 4GOPB 1I94L 4FF3A 3M4PA 1HRJA 1EIYB 2UXDQ 2RBMA 4QB4A 1Z47A 2F0UA 4ZK9B 3UDFA 4I7AA 1STEA 5FJ8G 3JAMc 4R4IA 4A3FB 3SK5A 1FGBD 3HOVH 1EQVA 2B2YC 5M5WH 2E2IB 2F0DA 1EY6A 2K5WA 2TSSA 1QB5D 2KVMA 5CV4A 1PVOA 2GA4B 1DJRD 1HFGA 4DV2L 4F88A 3CCEA 3R2TA 4A3MH 3K7AH 5DNFA 2RA4A 4DK1A 3ZYYX 3CQZH 5A2QL 1NUCA 5EGTA 3F2UA 3QG1A 3A5UA 4AYBE 1MD2D 5BN3A 4JYAL 1NAPA 2K5QA 4K8IA 4K0KL 4JV5Q 1D1KA 5CGKA 1WTQA 3S1RH 4NXNQ 2AUJD 3D0FA 2KENA 1TS3A 1LLRD 5G3LD 2QDBA 1X3PA 3ERSX 5BR8L 2ID0A 4B3TL 3HOWB 4AH6A 2F0LA 3BJUA 4KKUA 4KI0A 4DUYL 2HQEA 2IHEA 5IP7H 3MXNB 2DN8A 3A55A 4JCVE 4H44C 2NZOA 1JT8A 1LTTD 1SYBA 4JI3L 1PZJD 2EJMA 3GQBA 5IGFA 1AEXA 2XRSD 2YTYA 5FLMH 2MO0A 4DR7Q 1IBKQ 1JWUD 2OQ0A 4F8MA 4X3TA 2E2JH 3M85A 1FL0A 4HSVA 3K5LA 4BY1B 1TWFH 4B3MQ 4LF6L 1O7LA 4RCOA 3SVMA 3OMCA 3M9BA 4GN4B 2KCTA 2Q8RE 1KAWA 5EPJA 3IAYA 4JI2L 1IZ6A 1Q8IA 1NSNS 3F2BA 5EBDA 4DV5Q 2VQFL 3UDGA 3PF4A 1BXTA 1DZ1A 1PTOH 3HS0C 4DAYA 4N9TA 1HA6A 1LABA 3VR5A 2F0QA 3SE0A 1M1KC 2A6EC 4H0LC 4DXFA 4DXGA 4POGA 1RTOA 3EQLC 5FLXc 3L2PA 4JBJA 2JA5H 1S5CD 1JC7A 4OX9Q 2D0OA 4LFCQ 3CCVA 2NN6I 1H9MA 1HZBA 1PLFA 4NXMQ 4ODGA 4YCWA 3OMGA 2Y0SB 2RVLA 4IOAA 1EEFD 4OONA 2PQAA 5DEHA 2JYOA 4IN3A 2KA7A 2IX3A 2L11A 3RR5A 1WTWA 1YNNC 4JW0A 5E4WC 3RD4A 2LXKA 3PV0A 1OXVA 1EY4A 3S9WA 3HKZE 1GUTA 2Q8IB 1ASZA 3EFXD 1L1OB 1VQOA 4YHHQ 4XYOA 2XN9C 1WI5A 1QNUA 1YHAA 1CM9A 2Z4HA 4BWGB 5C3WA 4DR4Q 3BG3A 1ICFB 4L8JA 1JOOA 1JWSD 3CHBD 2B2UC 1VCIA 2KECA 4QUCA 1TVXA 4BY7H 1CA6A 5C4XG 1X9NA 2PMZB 3VA5A 3P7JA 3BYTB 5IOCA 4GNXC 1II3A 5ELBA 3TDQA 4QF4A 2WAQG 3E0JA 2Z1CA 4JOIC 1TWGB 2WKDA 3R3OA 1I4PA 4EQOA 4XYQA 5JEAG 1VQJA 3GTPB 3S2HH 4HJ9A 4DU9A 2Q2HA 1H9KA 2QDLA 4LF5Q 2FJ2A 1SE8A 4LWCA 5LL6X 2K05A 3K5NA 1EIGA 3EN2A 1U5KA 2DNEA 3TREA 5GAHC 5C0XH 1WYDA 3K57A 1EZ8A 4KTAA 3T4AC 2X6LA 1X3GA 1B8AA 3S16B 4A3DG 5I9OA 5ELOA 3S17B 4A3JG 4OWWB 1SNPA 4JI8L 1UNSA 4UDUC 1SNMA 5C3XA 1ILQA 1E2WA 2OCEA 2CH4A 4CDDC 3S1MB 3Q22A 2O5IC 1SNOA 1K83B 1ICWA 1Q46A 3X3NA 1IBMQ 3HRZC 1O7ZA 2QEJC 1Y8NB 4QMGA 2NVXH 2WB1E 4V190 1B9NA 1LM0A 5CV9A 5M5XB 2ZM6L 2DUDA 4ABNA 4KY5A 5CV5A 3STBD 3V96A 1TWAB 3I2ZA 2B2WC 4R8IA 4ALPA 5FLXL 1E2VA 2VY3A 2MP1A 3J81L 4WJ4A 4XT3B 4CBVA 2WP8J 1SROA 1IYJB 2PNRC 1HZAA 3BVMA 3CP0A 4K2LA 4QQBX 2PZWA 3BS1A 1BO0A 4YCVA 3MEHA 5HGQA 4B9WA 1WJJA 3I90A 4HJ5A 1KRSA 4OL7A 1CI3M 4IO9A 3MXUA 2JA8B 4IUVA 5C44B 1GVPA 2NVQH 4R4CA 5BN4A 3RZOH 1I94Q 2XNAC 1PTOD 1YVCA 3MVVA 4C1NK 2R7DA 3KJPA 3H3VC 1U4MA 2HQLA 2B39A 1F9PA 4OWXB 4RGTA 3PO2G 3VR4A 2XRQD 1OXUA 3NPPA 3CPFA 4LJZC 1LTSD 3HOWG 3ONAB 4TRDA 1E3PA 5FO7B 1PH9A 4L63B 1KD1C 1YZ6A 3BZCA 1XMQQ 4C56C 3SK4A 1HZ9A 4L6TB 2Q2TA 3AFPA 3A5ZB 1LTLA 3EVQA 2V1CC 3FKIB 4UPAA 1DONA 1HNWL 2RDHA 3M4OB 2CW0D 2CWPA 4A3GH 2VW9A 4U673 4JYAQ 4K0KQ 1CKNA 2E5LL 1EYAA 2NYZD 5TSSA 1C48A 4BY1G 1ZYRD 2KHIA 1Q8KA 2R61A 5JAVA 2JP1A 3X3MA 4B3TQ 1N32L 1UE6A 4EGVA 3RN2A 4DAVA 3T1YQ 4DUYQ 3WDNA 1VQ5A 4DR5Q 1C8CA 2V4DA 3EA6A 5G3LF 3DEOA 5F2DA 3H0GH 2QEXA 4N8FA 1Y1VB 4APVA 4IUTA 4RH6A 3FDTA 1GO3E 3P20A 2A69D 2K33A 4KV6A 2WKCA 4JI3Q 1EQQA 3J81i 2YU9H 4CKBA 1Y8PB 3TP6A 2JEAI 3KOJA 3I4MB 4P2CB 1H9JA 3TZUA 5IYCH 3A7LA 1H95A 5C3EG 1DGSA 1VQLA 1FYCA 4DNIA 5EKIA 5GAGC 4NW2A 2Z4IA 2KEEA 2HCCA 4POFA 4A3CH 1I6HH 1L0WA 1Q3LA 4JI2Q 3SXHA 4UP9A 1RKNA 1FJGL 3A0JA 1H9SA 4IOCA 1K28A 2M00A 3HOVB 4GZYC 1PRTC 1PH8A 5M5WB 1KABA 3GTQH 2D62A 3GD7A 1SJHD 3M4YA 2B2VC 3OW2A 2BH8A 2OTLA 1UE5A 1BBXC 2N49A 2PNHA 5ELEA 1HNXQ 4PZ6A 1ASYA 3K7AB 1JOQA 3DLLA 2DJGC 4KKSA 3FEWX 2GN5A 4C3JH 1A3UA 1WCMH 1Z7TA 4IZ8A 2QILA 3D4WA 2XWJB 2H5XA 2O4XA 2EDGA 1IXRA 1PH4A 2E8GA 4QIWE 3S1RB 1Y1WH 2DGYA 3NWSA 5C4JB 4HIOA 2UUAL 4LF9L 1B7YB 1STHA 2EY2A 3K58A 1NCVA 1VQKA 1YHBA 2CQOA 2ZXPA 2VB3X 3DM1A 3MXGA 5J3BA 2XVSA 2KCNA 2LXJA 1QE6A 1QOHA 3CCJA 3ULLA 3S1NH 1ML0D 4G7OC 5JVG3 1WTOA 3CC2A 2HDMA 4WFN3 3GTOB 5T1IA 1CSQA 4YY3L 4KY6A 2L12A 1X65A 1QILA 5LL6S 3GTGH 3TP8A 4A75A 3RUZA 5IYDH 4DR6L 2R7ZH 2ALYB 1XYIA 1TIID 1D2BA 3ICEA 1CHPD 4CDCC 1LTRD 2E2HB 4YWLA 2K50A 3OIQA 1PZKD 2ZT9C 4RHRA 4K6LA 1JOKA 3DMUA 1PTOB 1SBBB 3KK7A 3I73A 4DV0L 1YNJD 1V1PA 4DR1L 5JJIA 1LYLA 2CFMA 4ZKCB 1FNUA 3KLSX 1CK1A 3FHWA 2F3IA 3WOFA 1YIJA 1K3RA 2PI2A 2ENBA 2RCFA 1G2TA 2A5HA 2JA5B 3OWEB 1W6KA 4LFAL 2ZXRA 2F4IA 1EFID 3EROA 1ONLA 2D2CC 2Z6KC 2UUBL 4I65A 1F9QA 1L0YB 3AB9A 1YJ9A 3J80L 4IFDH 3PGZA 5JPNC 1ET9A 3VYTA 3I72A 4PV1C 3S1QB 4NKLA 3S15H 3NWTA 3G6JB 3EIVA 1LO5D 5M3MH 2N55A 3BVZA 2F03A 3BDLA 3U9SA 2EYLA 2F0EA 1R4QB 5I2XA 5C44G 1A8VA 4DV1L 4JI7L 2ZM6Q 1G51A 1VQ4A 3FRPB 3WOEA 1HA5A 4DPGA 2BE5D 4V0BA 2ZTCA 5C4ZA 4IPGA 3PO3H 3HOXH 1RJTA 4JI6L 1D1IA 2RCNA 5JJKA 3T1HL 5E3FA 4DR3L 4OO1H 2C5CA 1HJPA 4RG1A 1L1OC 1A15A 4UP8A 5J39A 3PIP3 1RDPD 3CRKC 2SNSA 2BH2A 1EFWA 4O2DA 4C2MH 1SJED 1TS4A 2B2TA 4UP7A 4GLXA 3HZXA 1IBLQ 3HGBA 3FKIG 3D8GA 1BBUA 3HOUH 5EKKA 3AEVA 4LFBL 5M9OA 3G4SA 1E1OA 2PW5A 4CHTB 1WD0A 1FNWA 1I50B 4TSSA 4JI0L 1HPCA 2VQEQ 2A68D 4A3EH 4DV4Q 1ZEQX 1XNQQ 1G91A 3I4NH 4A3DB 4K8JA 3TQYA 3OTOL 2KCCA 1VDZA 3OW7A 4A3JB 1X55A 1CUKA 5EAYA 2F0OA 3MFGA 3VYRA 4CDFC 2B63G 3QB3A 4A76A 3SEBA 4A3KH 3NSWA 1PZID 3J80i 2OTJA 2IWHA 2K75A 2PQEA 1F2YA 1C0AA 3LWEA 4RWSC 4BBSG 1I4XA 2NWGA 2KBNA 2AWOA 1EL0A 3RZDH 1SMXA 1SDFA 2WAQE 1Y69U 3RMHA 1MJCA 5JEAJ 2E5LQ 2NVXB 1DXMA 3F1ZA 1ENCA 3KDFA 4BBRH 1QZHA 4DA2A 3RNUA 3NQTA 1N32Q 2A6HD 1UEAB 4GN3B 2PYKA 4J8QA 2K5DA 1YEZA 5I2YA 1D6EC 2EYPA 1AZQA 1JJ2A 2UUCL 4IJLA 3DXJC 5K5PA 1VQ7A 3HOVG 4BXXH 4GLVB 2IX1A 3GTJH 4DFAA 1K8OA 1ET6A 2VXWA 1J6QA 2C35B 5C4HA 2F0IA 2DY7A 1HUMA 2NUCA 3KYHC 1IL8A 2WACA 3I4OA 5FJ8H 3K59A 4A3MG 2IW3A 1J5EL 4DR2L 4JI5L 1YBYA 3BZKA 2BA1A 2NVQB 1BBWA 1LT6D 2CQAA 3AMUA 3RZOB 1CZGA 4J15A 3GTMB 3S14H 4MNOA 2XSCA 3PO2B 1A63A 3ZJYC 1FJGQ 3I8ZA 5I4DA 5I6YA 2FMMA 1A62A 4IJHA 5C0XI 1EYDA 1OXXK 4DV6L 1TWCH 1PXUA 4ZLTF 1JICA 5A35A 1WD1A 4A3IH 2QKIC 4LF4L 3Q24A 3JC66 2EIFA 2F0VA 4K5WA 1CKMA 3M3YH 1STBA 3IL8A 4C3HH 4ZUIA 4QCLA 4HIMA 2RHSB 3NQIA 5FLMG 4A3GB 3A54A 3NBHA 5AFWA 5K36H 1XMOL 3DWQA 1K0SA 1LTAD 1SNQA 3E9IA 4LF9Q 2R7FA 1I5FA 4X62L 3HP3A 3W3AA 1R9TB 2KUMA 1JE4A 2JXMB 1QVCA 3K8AA 1VQCA 2BCOA 4ZCKA 3U9OA 1I4HA 1C7YA 1AW7A 4P73A 1EOVA 4WJWA 2F1MA 4XQQA 2NZ1D 2JN4A 2CKZB 3FVQA 3CCSA 4L5QA 5DM73 3IFDA 3VA7A 1EY9A 3GTKH 1SRUA 1N34L 5C3EB 5LMUL 1FGUA 4OELB 1NE3A 1C9OA 2MFIA 5D65A 2JA5G 5IT9L 4DAPA 2A8VA 4OWTB 4DR6Q 3A8IE 4X66L 1SE2A 5FK9C 4JC0A 3TEHB 4GKKL 1FR3A 1S5FD 4A4IA 1BCPD 1B1ZA 2VUMH 3Q23A 3GTQB 2QGQA 3CKIB 1BVSA 4FO2A 1A6XA 4R4QA 3V2TA 3JAML 4DV0Q 2EVBA 1PA6A 2JA7B 1EUJA 4GKJL 5I6WA 3QOLA 1KDCA 1CT1D 1E24A 2CWAA 5D14A 1JR0D 3H3VH 1QCBD 5EQ0A 2HHHL 2L9HA 4LFAQ 2LY7A 4M8AA 4LW1A 2B8GA 1GD7A 2F3WA 4RKLA 1IL2A 2L55A 3TZDA 2K5VA 5HY6A 4OIJA 3H94A 3E0EA 1VQ6A 4BY7G 2AQ3B 2Y0SE 3NTHA 3VYUA 2EJGC 1LT4D 2YTXA 4A3LH 2D0PA 2BA0A 3LX0A 4DV1Q 4JI7Q 4LK1C 3P1HA 2R93H 4G4KA 1BOSA 1K3BC 3H6MA 3S1NB 2F0JA 2RKSA 4EQPA 1YI2A 1AE2A 2SNMA 5AJ3Q 1HNZL 4XT1B 1EWIA 1XTCD 4KHVA 3PMFA 5CC4A 4JI6Q 3ER0A 4OIKA 5C0XG 3T1HQ 1SR3A 3OYYA 4BS9A 4O42A 4DR3Q 3GTGB 4DUZL 4GS3A 5CYUA 4KLKA 2R7ZB 4CDEC 2K04A 3CF5A 3HOZH 2KCMA 4DV7Q 5CV7A 4X64L 3STBC 4J1MA 1S4ZA 4NPSA 2PMZE 4HCSA 4KY7A 1FD7D 1P8LA 5CMDA 3GTLH 4UAIA 2NTSA 2EJFC 2F0TA 4JBMA 4A3BH 2B2UA 1VF7A 4B3SQ 3JAMi 4JI0Q 4HR7B 1B50A 1PYBA 2AMCB 4B08A 4PQXA 4B3RL 4A93H 3MXPA 3ND8A 4LUOA 5IYBH 3CCQA 1EY8A 2B8FA 3PCOB 1EYGA 5KRUA 1PTOC 4HJ7A 2GVAA 1HHVA 2CH4W 2B3GA 2WV6D 2EYMA 2SDFA 3J7A5 5FKAC 2EY6A 5IGCA 2JA6H 4DKAC 4HCEA 3NBHB 5HURA 3QIAA 4KD3A 2F0PA 2EZVA 1FNVA 1GHJA 3SR1A 5M3MB 2UXCL 2FMCA 1EYCA 1MSGA 4R4OA 1AZPA 3G7LA 5IGEA 4H13C 4CGYB 3NP8A 4A3FH 1IYUA 3J7AF 1S3OA 4I7ZC 2UXBL 3B6YA 5HGTA 5FO9B 4DN4M 3NTKA 1X54A 4G7ZC 1VQAA 1SLJA 2Z6BA 2TMPA 3K7UC 1ZKOA 4DAYB 2JQOA 4DAMA 2CW0C 3KUPA 2UUCQ 3TS0A 1MJEA 3PO3B 3OIPA 5GADC 1NMGA 4PMWA 1BDOA 1HR0L 3CMEA 3S24A 3U4ZA 1TXYA 2JSOA 4F7XA 3PIPA 4KHPL 4DV2Q 1ZYRC 4OGQC 1VQ8A 2NN6H 1V1QA 2NVYH 1SMYD 1X56A 4HAEA 1JMCA 4DR2Q 4JI5Q 1MHWC 1W3SA 1WTRA 1SE4A 3G48A 1GOZA 3I7FA 2M9VA 2RF4A 1DOLA 2EYJA 1AE3A 2QA4A 3HOUB 1U9RA 4HMIA 4KN4C 4A3GG 3KBXA 1KXLA 3TN2A 2A69C 2PQAB 3EJIA 1N36L 1HQRD 1A2UA 3VR2A 1L2FA 1TWHH 1NY4A 3R2IA 1JQYD 2VZAA 3L7ZC 5BR8Q 3RLOA 2AWNA 2XTIA 4A3EB 1TY2A 1BCPB 3G71A 4ZRZA 1CHQD 1HFNA 4N9PA 1K8AC 1MIUA 1NBWA 3DWAA 2X69A 2B63B 3NTIA 3PSIA 3TP7A 1IW7D 1SYGA 3H0GG 2PW7A 4IFDI 4K6DA 1O78A 4BA1I 1SYCA 3E3XA 4A3KB 3W1GA 2UXDL 1HTLD 3QO2A 4BBSB 1E2ZA 3HOYH 1VQGA 1Q1BA 1NR4A 2ZXOA 1W2BA 4IUUA 2MJ8A 5IYCG 2DY8A 1HH2P 4LF6Q 4IPHA 2Q8TA 1GM5A 2JK8A 2K7VA 2RSOA 2EXDA 2HDLA 4A3CG 3L3OC 1I6VC 4Z9CB 5A2QE 5M3FH 1UUPA 3HFZB 4G57A 3HEJA 5IWAL 2VQFQ 3HG9A 1S5DD 4HTHA 1PFBA 3T56B 2MQHA 2K28A 3GTJB 2IT1A 4OO1I 4A3MB 2JA7G 4JV5L 1VF5C 2K4KA 1X3QA 4KD4A 4NXNL 3NHHA 1PHJA 5LMUQ 3CQZB 4C3JG 1G8ZD 1Y8OB 5EPLA 1B70B 4BA2I 3J7AV 3BZDB 1HTPA 3KF8A 2F0SA 3C3LA 1QNKA 3SK6A 4X66Q 3S14B 2MO1A 4GKKQ 1RHPA 1MKHA 1PFSA 3FPPA 1Y14B 1PV4A 4NP5A 1IYVA 3D4RA 1PH2A 4AQYL 1KTKA 4RAUC 3T51B 1L0XB 3CAMA 1J8IA 1IBKL 4LMQD 1BCPF 4CKEA 2I5MX 1HCZA 4A3IB 4GKJQ 1V43A 2L15A 3NELA 3CXCA 1CA5A 3BVGA 2R92H 4B3ML 1VMPA 1HR0W 4QGUA 1UAPA 4P75A 3K5OA 2AUKA 4P71A 2HHHQ 3T53B 1B44D 1EIHA 2K1BA 1OO9B 4GOPA 1SSOA 2E2JB 2A19A 3GO5A 1TWGH 2HCIA 4LF8L 4JPBW 1YNJC 4H02A 1OTCA 1TWFB 4JVZA 1T5EA 3KFUA 3MC0B 4F87A 4X3UA 1EY0A 3GTPH 2ICIA 5IYDG 3MFYA 2R7ZG 3CCMA 1K9MC 2EYHA 1SFOH 3GDEA 3U4VA 1KLUD 5CBEE 1F9RA 4IALA 1W6JA 2BDNA 4DNRB 4Y7NH 3NE5B 3S16H 4KHZA 2OEOA 3IFTA 5JJLA 2Z9HA 3FP9A 1BF4A 3S17H 2I07B 4NXML 1HNZQ 4R9WA 5KYLA 4PZ7A 1ENAA 2IY5B 3GTKB 2I46A 2PZUA 3VDYA 3SGIA 1S5ED 3AQQA 1QUQA 3CU7A 1YITA 2F0GA 1X3EA 5ELDA 1SEBD 1SXTA 2A1AA 1B3AA 1I4RA 4JI8Q 4DGZA 3UE0A 3QOJA 2BE5C 4IFDG 4PMBA 3L9AX 5COYA 3SDZA 1CKNB 3DWPA 2SEBD 4QY7A 5FO8B 1STNA 3ULJA 1PFNA 2VUMB 1I4QA 4L5TA 4HMJA 5IP9H 2B2TC 5M3MG 2VB2X 1AP0A 2AKWB 1ZXTA 4DF7A 1TWAH 4IUPA 1G6ZA 4DR4L 2IL8A 2J7ZA 1A3VA 1LV9A 2G9DA 2Q2IA 1JWMD 4RMFA 1Q86C 2CHBD 1KRTA 2OWOA 1KDAA 1CSPA 3ERQA 4PMCA 2AHOB 1TS2A 1VQEA 1NTGA 2JA8H 1PYWD 2ASBA 5C44H 3PO3G 4FF1A 2F0FA 2OXPA 5L37A 4RGOS 4KJNA 4XQNA 4XXEA 4OO1G 1Q7YC 4BY7B 1A0IA 3CMAA 2A68C 2UXCQ 4XDXA 2NB0A 1JORA 3ND9A 3D6CA 4LF5L 1S5BD 1TS5A 2G5DA 4WJ3M 2RDFA 2Q2UA 1SAPA 4FF2A 1EZ6A 3TBIB 4K5VA 1EWCA 3S2HB 1DM0B 1H9SB 3WWVA 2UU9L 3HOUG 2R93B 4J6HA 2LFNA 2F0WA 2F0MA 1KNAA 1E1TA 4X3KA 4ULLA 5EKLA 3T13A 3KF6A 3GV3A 2DNCA 2PCFB 3FKIH 1K8MA 4A3EG 1HR0Q 1T9HA 4LF7L 4KHPQ 3I4NG 1B4OA 2I5HA 4C3IH 1IBML 2F0KA 2XGTA 3HOZB 2A6HC 1PFMA 1N9WA 5H1SE 3CD6A 4A3KG 1PMRA 1HNWQ 4LUZA 3MHBA 3QJYA 2PO4A 5FLXE 4Q0FA 3UDXA 2JE6I 3J81E 1F77A 4A3BB 1Z6HA 2L4NA 2ICEC 1EOTA 2AQ1B 2ES2A 4BBRG 1Y1VH 1U4RA 1XX8A 3M4QA 2LKVA 5EPKA 2C9OA 2MUYA 4TVAB 4O1NA 3I4MH 4KN7C 1GUNA 3W5OA 1YJNA 4AYBB 4JI1L 1BUVT 5C0XJ 1VQHA 1PH5A 4EX5A 4BXXG 1CKOA 1F9SA 1TU2B 3N52A 2JA6B 1KHIA 3NK9A 1GHKA 3L0OA 2K6AA 1WTHA 5J22A 3KJOA 1EY7A 4R4TA 2L0CA 4ZYSA 3CRLC 4ZAIA 1I3QH 1KQSA 3D3RA 1IKMA 5ELNA 4IUQA 5ELFA 4HN7A 5DLQE 2JA9A 3I91A 1JJCB 3AU7A 2I0QA 1EQRA 3S2DH 1XMQL 4JBWA 1EWHA 1QG7A 3R93A 1Q82C 1B9MA 3PF5A 1KIXA 5IWAQ 3D31A 1V1PB 4LNQA 4MN3A 1E22A 1MI2A 1YNXA 5IGGA 2EYOA 5IP7G 5ELCA 1DCZA 1SNDA 1F2ZA 1Q1EA 2NVYB 4A3IG 4B9XA 1QUQB 1VQFA 4M1UB 4K2KA 3IKJA 2PPBC 4OEMB 1WOCA 5C4JH 1OXTA 5KGUA 2KQ3A 3V05A 1N8RC 1X6OA 4GLAC 4X6AH 4C3HG 3TS2A 4JK1C 2B2YA 2LS01 3T1YL 1Q12A 3RLNA 2MNAA 2EPBA 4DR5L 3DM3A 1LT5D 2RHQB 3E9HA 5DAUA 1S72A 5K36G 4C1NI 3M7GA 2UUAQ 1TWHB 3TRZA 1DYQA 1LTBD 2BOSA 3KLRA 3KLWA 3UDIA 3W2DA 3NEMA 5IGDA 4AQYQ 2PZTA 3GTOH 4Q5VA 5NUCA 3TMEA 2R3ZA 2JJQA 5C5LA 3H0GB 3U50C 2YYZA 1LT3D 1O7YA 2E2DC 2VS1A 2PI2E 2AQ2B 4FXKC 4XQJA 2ATWA 4YWKA 2B29A 1IKLA 1PRTF 1LUZA 1BCPC 2YU9B 3HOYB 2VNUD 2EE1A 2EQSA 4YY3Q 1PH3A 5JVH3 1OXSC 2XIWA 3NENA 4LUVA 2E2HH 1VQBA 4XIGS 5IGBA 4LF8Q 1STAA 3FMCA 4TKOB 1VQMA 4HEDA 2N88A 4PNYA 1XPUA 3F2DA 4JBKA 1N33L 2A73B 3HKZB 1I6HB 5JJZA 2NBFA 4FXGC 1ESFA 3A8KE 5M3FB 1RODA 1HNXL 2Z8LA 1UWVA 1MSHA 4RHSA 5C5MA 2VUMG 5GAEC 3PIO3 3J81c 5FOBB 4HIDA 1A3TA 3KF6B 4DR1Q 4QJFA 1SNCA 5E7NA 2NZHA 3S1QH 4C3JB 1Q81C 1M4VA 3BDCA 1O7IA 1WCMB 2YTVA 3TP5A 5LMNL 4MTNA 3DEPA 2A6ED 4KMUC 2UUBQ 1V1OA 4FNFA 4OHJA 4UY8C 1TQOA 1Y1WB 1X3FA 2FXQA 2NVTH 1C4QA 3KDFB 4CJ1B 1G6PA 4DK3C 1KAAA 1WTVA 3C46A 1KL9A 1RF2D 2E75C 4N8X1 1P16A 3VR3A 4RGMA 2WIIB 4A3LG 1DOMA 1VQIA 1G2SA 1S40A 3FPUB 5KNCA 1D8LA 4ME5A 4TQUS 3SK8A 4AIMA 2R92B 2R93G 5C4XH 1YNND 2K14A 1QWYA 3K0XA 4NB3A 4JG2A 2G9HD 3GP7A 3AFQA 4L5SA 1KC8C 3NBIA 3E6ZX 2F4VL 5GROA 4WRDA 1AFPA 2WB1B 5JEAH 3OSOA 2KHJA 2RDGA 4R8NA 1STYA 2HIXA 2NTTA 1GUWA 5ISRA 1SYFA 5DM63 3HOZG 1SFOB 1I50H 1XNRL 2FHTA 4NDXA 5M5YH 1UE1A 3CC4A 5CBAE 4A3DH 2UU9Q 3J80E 5IY0A 4Y7NB 4LFBQ 4K14A 3K5MA 1PH1A 5LHY1 4A3JH 4A3BG 2KJXA 1EU4A 4GNXA 1YJWA 5BN5A 5IE8A 4A93G 4JOIA 5IYBG 3OTOQ 4LF7Q 1VMCA 1SYDA 1VQDA 4RFBA 1EQTA 4AYBG 3KLSA 3M7NA 2EYFA 4HJAA 3AYHB 2J4XA 4FYDA 3I70A 1VQPA 1B2TA 3SHLA 1CTMA 2E76C 3E5SA 1U4PA 3S15B 1LACA 2JA6G 3VYSA 3CCUA 4PZ8A 3VR6A 5IIFA 1PYSB 1TR5A 2MGSA 4A3FG 1F2LA 2E2IH 2RSNA 1SMYC 4HIKA 1QVGA 3OOCA 1D5ZC 4FVMA 4RKBA 3MAQA 3I55A 4JI4L 4IPCA 4DNTB 3K6OA 2ZJPA 1VQNA 1HXYD 4JI1Q 2R6GA 1K0RA 3H15A 2QW7A 3HOXB 2WFWA 4ILWA 2O2LD 4WORA 4ME3A 1IBLL 3RLFA 4HSPA 2I5LX 4KK7A 1K73C 5LMNW 3GTMH 1U0LA 4IFDJ 1RCVD 2NN6G 5KIXA 4CJ0B 3PO2H 3LWUA 4EQNA 1J5EQ 4C2MB 1E7ZA 3NUCA 5KNDA 3K80C 3HOWH 2VQEL 1RL2A 1M90C 2B2WA 1JCKB 4DV4L 1XNQL 4DV3L 1IW7C 2XWBB 1B3QA 1NNXA 3BYYB 2KHSA 1VS0A 3C2PA 1UE7A 4CJ2C 3DUZA 3W1BA 3G6EA 1YHQA 3KBGA 4X65L 1GUOA 2EY1A 1JJGA 3TSSA 3I4NB 4DV6Q 4E6IA 2K52A 3OPOA 2ZTDA 1RTNA 4C3IB 1SN8A 1TKWB 3I4LA 3J7YW 4LF4Q 3F2CA 1NJIC 1F2MA 4X3SA 4BY1H 2EOTA 1R4PB 1STGA 4K5XA 2N8NA 4R1JA 1JB7A 3CCRA 2OF1A 2F0NA 3PUWA 3HOYG 1BNZA 3RZDB 2OT2A 4S3SA 3U58A 1R9TH 1XMOQ 3BDOA 3MWYW 2YV5A 4BBRB 1BQQT 1ILPA 5IODA 2WINB 2FFKB 2ZJQA 2A74C 3HKZG 4X62Q 4DK0A 1XJVA 2IJ0A 3J81j 4RCNA 5M3FG 1RIPA 3MZ5A 5C3EH 3H09A 2DJFC 4IQZA 3R8BA 3J80c 1RD9D 2D9UA 4QIWB 1KLGD 2X6GA 1V8QA 4YWMA 3LNNA 2HIVA 5I9PA 1BR9A 2HT1A 3I3CA 5KNBA 1BKBA 3T16A 1GKHA 2MHVA 3PUYA 1N34Q 1D7QA 1T5XD 2E74C 2Y0SG 3DHQA 3H91A 1I3QB 1ESRA 1O80A 5E4XA 3Q0AA 1WCMG 3C1FA 4GOPC 1MBYA 3A74A 5E1FA 1N33Q 4G7HC 1AN8A 4DK6C 3S2DB 4ID6A 2JA7H 1Y1WG 1HUNA 1A2TA 2K01A 1CQVA 3IRBA 2K32A 4HJ8A 1KDBA 4MHEA 1M8AA 3RN5A 5EBCA 4OXPA 1TWCB 3CW2C 4GNXB 3J7ZC 4DR7L 1FVIA 1PRTD 2ZTEA 4FP5D 4MZ9A 1LTGD 3PUXA 1UEBA 3PQIA 1EY5A 2N78A 4RA8A 1HQMC 4U68A 3M3YB 2P5ZX 2R92G 4C3HB 1I4GA 5LMNQ 1D5XC 2L5TA 2IPKD 1WVLA
chains in the Genus database with same CATH topology
5EJWA 1GXDC 2B2VA 3URYA 5JPMC 1GUSA 1MGSA 4MIUA 3D6WA 1SYEA 3A7AB 1H9RA 5IT9E 1GJXA 3UI2A 1TT2A 1DOKA 1CQFA 1EU3A 1PDQA 5KYIA 4KKTA 1X32A 2K03A 4IUNA 1LTID 4YIJA 2D5DA 3K0YA 2J0TD 3JAME 4H7BA 4XTCS 5JOBA 2FINB 1KNEA 1XXGA 2EY5A 2EXZA 3ITPA 3N6RA 4KJOA 3MTSA 1ENFA 1QJOA 2F3VA 1Q90A 3MXNA 4FXDA 2KOLA 1JB3A 1TY0A 3GV6A 5CV8A 4EVOA 5C6AA 2O5JC 2QF7A 2M2LA 2BDOA 2H4OA 3Q6SA 1WTPA 5CORA 2HUGA 2KEDA 2H1EA 2CVRA 2NVTB 5KEEA 2LMCB 4RGNA 3O13A 1G291 1WTXA 2L1BA 5D3DA 1SE3A 4QUFA 5D3IB 2SOBA 1J9OA 1CZWA 5C4XB 2MPMA 3MA2B 1IHZA 4ZUJA 3D4DA 2WAQB 1DD2A 3PUVA 3NXWA 4ZKBB 5CR3A 4FF4A 3QWNA 2IX0A 4LAAA 4C3IG 3A8JE 2JEBI 1PTOF 1XWEA 5M5YB 3OHXC 5J1ZA 2QCPX 1E0BA 4CKCA 4ZQ3A 4IURA 3GTLB 2RQXA 5CV6A 3C1EA 3A56A 3P75A 2F0HA 4NMZA 3OWFA 4A93B 1D5MC 1GUGA 1NR2A 3PUZA 5T1GA 1U4LA 1B53A 1PRTB 1EEID 1CFMA 4FF3A 1HRJA 2RBMA 4QB4A 1Z47A 2F0UA 4ZK9B 1STEA 4A3FB 3SK5A 1FGBD 1EQVA 2B2YC 2E2IB 2F0DA 1EY6A 2K5WA 2TSSA 1QB5D 2KVMA 5CV4A 2GA4B 1DJRD 1HFGA 4F88A 3R2TA 5DNFA 2RA4A 4DK1A 3ZYYX 5A2QL 1NUCA 5EGTA 3F2UA 3QG1A 1MD2D 5BN3A 1NAPA 2K5QA 4K8IA 1D1KA 5CGKA 1WTQA 2AUJD 1TS3A 1LLRD 5G3LD 2QDBA 1X3PA 3HOWB 2ID0A 2F0LA 4KKUA 4KI0A 2HQEA 2DN8A 3A55A 4H44C 1LTTD 1SYBA 1PZJD 2EJMA 3GQBA 5IGFA 1AEXA 2XRSD 1JWUD 4F8MA 4X3TA 3M85A 4HSVA 3K5LA 4BY1B 1O7LA 4RCOA 3SVMA 3OMCA 2Q8RE 5EPJA 3IAYA 1Q8IA 1NSNS 5EBDA 1BXTA 1DZ1A 1PTOH 3HS0C 4DAYA 4N9TA 1HA6A 1LABA 3VR5A 2F0QA 3SE0A 2A6EC 4H0LC 4DXFA 4DXGA 1RTOA 3EQLC 1S5CD 1JC7A 2NN6I 1H9MA 1PLFA 4ODGA 3OMGA 2Y0SB 2RVLA 1EEFD 5DEHA 2JYOA 4IN3A 2KA7A 2IX3A 2L11A 1WTWA 1YNNC 5E4WC 3RD4A 3PV0A 1OXVA 1EY4A 3S9WA 1GUTA 2Q8IB 3EFXD 4XYOA 2XN9C 1QNUA 2Z4HA 1CM9A 4BWGB 5C3WA 3BG3A 4L8JA 1JOOA 1JWSD 3CHBD 2B2UC 1VCIA 2KECA 4QUCA 1TVXA 1CA6A 2PMZB 3VA5A 5IOCA 3P7JA 3BYTB 1II3A 5ELBA 3TDQA 4QF4A 3E0JA 2Z1CA 1TWGB 2WKDA 3R3OA 1I4PA 4EQOA 4XYQA 5JEAG 3GTPB 4DU9A 1H9KA 2FJ2A 5LL6X 2K05A 3K5NA 1EIGA 2DNEA 5C0XH 3K57A 1EZ8A 4KTAA 3T4AC 2X6LA 3S16B 5I9OA 3S17B 1SNPA 1UNSA 4UDUC 1SNMA 5C3XA 1ILQA 1E2WA 3S1MB 3Q22A 2O5IC 1SNOA 1K83B 1ICWA 3X3NA 3HRZC 1O7ZA 2QEJC 1Y8NB 4QMGA 4V190 1B9NA 5CV9A 5M5XB 4ABNA 4KY5A 5CV5A 3V96A 1TWAB 2B2WC 4R8IA 5FLXL 1E2VA 3J81L 2MP1A 4XT3B 4CBVA 2WP8J 2PNRC 3BVMA 4K2LA 2PZWA 3BS1A 1BO0A 3MEHA 4B9WA 3I90A 4OL7A 1CI3M 3MXUA 2JA8B 4IUVA 5C44B 5BN4A 2XNAC 1PTOD 3MVVA 4C1NK 3H3VC 1U4MA 2B39A 1F9PA 4RGTA 3VR4A 2XRQD 1OXUA 3NPPA 4LJZC 1LTSD 3ONAB 4TRDA 5FO7B 4L63B 4C56C 3SK4A 4L6TB 3EVQA 3FKIB 1DONA 2RDHA 3M4OB 2CW0D 4U673 1EYAA 2NYZD 5TSSA 1C48A 1ZYRD 2R61A 5JAVA 2JP1A 3X3MA 4EGVA 4DAVA 3WDNA 1C8CA 2V4DA 3EA6A 5G3LF 3DEOA 5F2DA 1Y1VB 4IUTA 4RH6A 3FDTA 3P20A 2A69D 2K33A 4KV6A 2WKCA 4CKBA 1Y8PB 3TP6A 2JEAI 3I4MB 4P2CB 1H9JA 3TZUA 3A7LA 1FYCA 5EKIA 4NW2A 2Z4IA 2KEEA 2HCCA 1Q3LA 3SXHA 1RKNA 1H9SA 2M00A 3HOVB 4GZYC 1PRTC 5M5WB 1KABA 2D62A 3GD7A 1SJHD 3M4YA 2B2VC 1BBXC 5ELEA 3K7AB 1JOQA 4KKSA 3FEWX 1A3UA 1Z7TA 4IZ8A 2QILA 3D4WA 2XWJB 2O4XA 2EDGA 3S1RB 3NWSA 5C4JB 1STHA 2EY2A 3K58A 1NCVA 2ZXPA 2VB3X 3DM1A 3MXGA 2XVSA 2KCNA 1QE6A 1QOHA 1ML0D 4G7OC 5JVG3 1WTOA 2HDMA 4WFN3 3GTOB 5T1IA 4KY6A 2L12A 1QILA 5LL6S 3TP8A 3RUZA 1XYIA 1TIID 1D2BA 1CHPD 1LTRD 2E2HB 3OIQA 1PZKD 2ZT9C 4RHRA 4K6LA 1JOKA 3DMUA 1PTOB 1SBBB 3KK7A 3I73A 1YNJD 1V1PA 4ZKCB 1FNUA 3KLSX 1CK1A 3WOFA 2ENBA 1G2TA 2A5HA 2JA5B 3OWEB 1W6KA 2ZXRA 2F4IA 1EFID 3EROA 1ONLA 2D2CC 4I65A 1F9QA 1L0YB 3AB9A 4IFDH 3J80L 5JPNC 1ET9A 3VYTA 3I72A 4PV1C 3S1QB 4NKLA 3NWTA 3G6JB 1LO5D 2N55A 3BVZA 2F03A 3BDLA 3U9SA 2EYLA 2F0EA 1R4QB 5I2XA 3FRPB 3WOEA 1HA5A 2BE5D 4V0BA 5C4ZA 1RJTA 1D1IA 5E3FA 4OO1H 2C5CA 1A15A 5J39A 3PIP3 1RDPD 3CRKC 2SNSA 1SJED 1TS4A 2B2TA 3HZXA 3HGBA 3D8GA 5EKKA 5M9OA 2PW5A 4CHTB 1WD0A 1FNWA 1I50B 4TSSA 1HPCA 2A68D 1ZEQX 1G91A 4A3DB 4K8JA 2KCCA 1VDZA 3OW7A 4A3JB 2F0OA 3MFGA 3VYRA 3QB3A 3SEBA 3NSWA 1PZID 2IWHA 2PQEA 1F2YA 3LWEA 4RWSC 1I4XA 2NWGA 2AWOA 1EL0A 1SDFA 1Y69U 3RMHA 5JEAJ 2NVXB 1DXMA 1ENCA 4DA2A 3NQTA 2A6HD 1UEAB 2PYKA 4J8QA 2K5DA 5I2YA 1D6EC 2EYPA 1AZQA 3DXJC 5K5PA 2IX1A 4DFAA 1K8OA 1ET6A 2VXWA 5C4HA 2F0IA 2DY7A 1HUMA 2NUCA 1IL8A 2WACA 3K59A 2IW3A 2BA1A 2NVQB 1LT6D 2CQAA 3AMUA 3RZOB 1CZGA 3GTMB 2XSCA 3PO2B 3I8ZA 5I4DA 5I6YA 2FMMA 5C0XI 1EYDA 1OXXK 1PXUA 4ZLTF 1JICA 5A35A 1WD1A 2QKIC 3Q24A 2F0VA 4K5WA 1STBA 3IL8A 4ZUIA 4QCLA 3NQIA 4A3GB 3A54A 3NBHA 5AFWA 5K36H 3DWQA 1LTAD 1SNQA 3HP3A 3W3AA 1R9TB 2KUMA 1JE4A 2JXMB 2BCOA 3U9OA 1I4HA 1AW7A 4WJWA 2F1MA 4XQQA 2NZ1D 3FVQA 5DM73 3IFDA 3VA7A 1EY9A 5C3EB 5D65A 5IT9L 4DAPA 3A8IE 1SE2A 5FK9C 1FR3A 1S5FD 1BCPD 1B1ZA 3Q23A 3GTQB 3CKIB 4FO2A 1A6XA 3V2TA 3JAML 2EVBA 2JA7B 5I6WA 3QOLA 1KDCA 1CT1D 5D14A 1JR0D 1QCBD 5EQ0A 2L9HA 2LY7A 4M8AA 2B8GA 2F3WA 4RKLA 2L55A 3TZDA 4OIJA 3H94A 2AQ3B 3NTHA 3VYUA 2EJGC 1LT4D 2BA0A 3LX0A 4LK1C 3P1HA 4G4KA 1BOSA 3H6MA 3S1NB 2F0JA 2RKSA 4EQPA 2SNMA 4XT1B 1XTCD 4KHVA 3PMFA 5CC4A 4OIKA 5C0XG 4BS9A 4O42A 3GTGB 5CYUA 2R7ZB 2K04A 5CV7A 4J1MA 1S4ZA 4HCSA 4KY7A 1FD7D 5CMDA 4UAIA 2NTSA 2EJFC 2F0TA 2B2UA 1VF7A 4HR7B 1B50A 4B08A 4PQXA 3MXPA 3ND8A 1EY8A 2B8FA 5KRUA 1PTOC 1HHVA 2WV6D 2EYMA 2SDFA 5FKAC 2EY6A 5IGCA 4HCEA 5HURA 3QIAA 4KD3A 2F0PA 2EZVA 1FNVA 1GHJA 3SR1A 5M3MB 2FMCA 1EYCA 1MSGA 1AZPA 3G7LA 5IGEA 4H13C 4CGYB 3NP8A 1IYUA 3J7AF 4I7ZC 5HGTA 5FO9B 4DN4M 3NTKA 4G7ZC 2TMPA 1ZKOA 2CW0C 3KUPA 3PO3B 3OIPA 4PMWA 1BDOA 2JSOA 4F7XA 1ZYRC 4OGQC 2NN6H 1SMYD 4HAEA 1WTRA 1SE4A 1GOZA 2M9VA 1DOLA 2EYJA 3HOUB 1U9RA 4HMIA 4KN4C 3KBXA 3TN2A 2A69C 3EJIA 1HQRD 1A2UA 3VR2A 3R2IA 1JQYD 3L7ZC 2AWNA 4A3EB 1TY2A 1BCPB 4ZRZA 1CHQD 1HFNA 4N9PA 3DWAA 2X69A 2B63B 3NTIA 3TP7A 1IW7D 1SYGA 2PW7A 4IFDI 4K6DA 1O78A 4BA1I 1SYCA 4A3KB 1HTLD 3QO2A 4BBSB 1E2ZA 1Q1BA 1NR4A 2ZXOA 4IUUA 2MJ8A 2DY8A 2Q8TA 2K7VA 2RSOA 2HDLA 3L3OC 1I6VC 4Z9CB 5A2QE 1UUPA 4G57A 3HEJA 3HG9A 1S5DD 4HTHA 1PFBA 3T56B 2K28A 3GTJB 2IT1A 4OO1I 4A3MB 1VF5C 1X3QA 4KD4A 3NHHA 3CQZB 4C3JG 1G8ZD 1Y8OB 5EPLA 4BA2I 3J7AV 3BZDB 1HTPA 2F0SA 3KF8A 3C3LA 1QNKA 3SK6A 3S14B 1RHPA 3FPPA 4NP5A 1IYVA 3D4RA 1KTKA 4RAUC 3T51B 1L0XB 1J8IA 4LMQD 1BCPF 4CKEA 1HCZA 4A3IB 1V43A 1CA5A 3BVGA 1VMPA 1UAPA 3K5OA 2AUKA 3T53B 1B44D 1EIHA 2K1BA 1OO9B 1SSOA 2E2JB 3GO5A 2HCIA 1YNJC 1TWFB 1T5EA 3MC0B 4F87A 4X3UA 1EY0A 2ICIA 3MFYA 2EYHA 5CBEE 1KLUD 1F9RA 4IALA 1W6JA 2BDNA 4DNRB 3NE5B 4KHZA 2OEOA 3IFTA 1BF4A 2I07B 4R9WA 5KYLA 1ENAA 3GTKB 2I46A 2PZUA 1S5ED 3CU7A 2F0GA 5ELDA 1SEBD 1SXTA 1B3AA 1I4RA 4DGZA 3QOJA 2BE5C 4IFDG 4PMBA 3L9AX 5COYA 3SDZA 3DWPA 2SEBD 5FO8B 1STNA 1PFNA 2VUMB 1I4QA 4HMJA 2B2TC 2VB2X 1AP0A 1ZXTA 4DF7A 4IUPA 1G6ZA 2IL8A 2J7ZA 1A3VA 1LV9A 2G9DA 1JWMD 2CHBD 1KDAA 3ERQA 4PMCA 1TS2A 1PYWD 4FF1A 2F0FA 2OXPA 4RGOS 4KJNA 4XQNA 4XXEA 4OO1G 4BY7B 2A68C 4XDXA 2NB0A 1JORA 3ND9A 3D6CA 1S5BD 1TS5A 2RDFA 1SAPA 4FF2A 1EZ6A 3TBIB 4K5VA 1EWCA 3S2HB 1DM0B 1H9SB 2R93B 4J6HA 2LFNA 2F0WA 2F0MA 1KNAA 4X3KA 4ULLA 5EKLA 3T13A 3GV3A 2DNCA 2PCFB 1K8MA 1B4OA 2F0KA 3HOZB 2A6HC 1PFMA 1PMRA 3MHBA 3QJYA 2PO4A 5FLXE 4Q0FA 2JE6I 3J81E 1F77A 4A3BB 1Z6HA 2L4NA 2ICEC 1EOTA 2AQ1B 1U4RA 1XX8A 2LKVA 5EPKA 2C9OA 2MUYA 4O1NA 4KN7C 1GUNA 4AYBB 1BUVT 5C0XJ 1F9SA 1TU2B 3N52A 2JA6B 3NK9A 1GHKA 2K6AA 5J22A 1EY7A 2L0CA 4ZYSA 3CRLC 4ZAIA 3D3RA 1IKMA 4IUQA 5ELFA 4HN7A 3I91A 3AU7A 4JBWA 1EWHA 1QG7A 3R93A 1B9MA 3D31A 1V1PB 4MN3A 1MI2A 5IGGA 2EYOA 5ELCA 1DCZA 1SNDA 1F2ZA 1Q1EA 2NVYB 4B9XA 4M1UB 4K2KA 3IKJA 2PPBC 1OXTA 5KGUA 2KQ3A 3V05A 4C3HG 4JK1C 2B2YA 2LS01 1Q12A 2EPBA 1LT5D 5DAUA 5K36G 4C1NI 3M7GA 1TWHB 1DYQA 1LTBD 2BOSA 3KLRA 3W2DA 5IGDA 2PZTA 4Q5VA 5NUCA 3TMEA 2R3ZA 5C5LA 3H0GB 2YYZA 1LT3D 1O7YA 2E2DC 2AQ2B 4FXKC 4XQJA 1IKLA 1PRTF 2YU9B 1BCPC 3HOYB 2VNUD 2EE1A 5JVH3 1OXSC 2XIWA 4XIGS 5IGBA 1STAA 3FMCA 4TKOB 4HEDA 2N88A 4PNYA 2A73B 3HKZB 1I6HB 5JJZA 2NBFA 4FXGC 1ESFA 3A8KE 5M3FB 1RODA 2Z8LA 1MSHA 4RHSA 5C5MA 3PIO3 5FOBB 1A3TA 1SNCA 4C3JB 1M4VA 3BDCA 1WCMB 3TP5A 3DEPA 2A6ED 4KMUC 1V1OA 4FNFA 4OHJA 1TQOA 1Y1WB 1C4QA 4CJ1B 1KAAA 1WTVA 3C46A 1RF2D 2E75C 3VR3A 4RGMA 2WIIB 1DOMA 1G2SA 3FPUB 5KNCA 4ME5A 4TQUS 3SK8A 2R92B 1YNND 1QWYA 2G9HD 3GP7A 3NBIA 3E6ZX 4WRDA 1AFPA 2WB1B 5JEAH 3OSOA 2RDGA 4R8NA 1STYA 2NTTA 1GUWA 5ISRA 1SYFA 5DM63 1SFOB 2FHTA 4NDXA 5CBAE 3J80E 4Y7NB 4K14A 3K5MA 5LHY1 2KJXA 1EU4A 5BN5A 1VMCA 1SYDA 4RFBA 1EQTA 3KLSA 3M7NA 2EYFA 2J4XA 4FYDA 3I70A 1B2TA 3SHLA 1CTMA 2E76C 3E5SA 1U4PA 3S15B 1LACA 3VYSA 3VR6A 5IIFA 1TR5A 2MGSA 1F2LA 2RSNA 1SMYC 3OOCA 1D5ZC 4FVMA 4RKBA 3MAQA 4DNTB 3K6OA 1HXYD 2R6GA 3HOXB 4ILWA 2O2LD 4WORA 3RLFA 4HSPA 4KK7A 4IFDJ 1RCVD 2NN6G 5KIXA 4CJ0B 3LWUA 4EQNA 4C2MB 3NUCA 5KNDA 2B2WA 1JCKB 1IW7C 2XWBB 3BYYB 2KHSA 3C2PA 4CJ2C 3DUZA 3KBGA 1GUOA 2EY1A 3TSSA 3I4NB 4E6IA 3OPOA 1RTNA 4C3IB 1TKWB 3I4LA 3J7YW 1F2MA 4X3SA 2EOTA 1R4PB 1STGA 4K5XA 2OF1A 2F0NA 3PUWA 1BNZA 3RZDB 2OT2A 4S3SA 3BDOA 3MWYW 4BBRB 1BQQT 1ILPA 5IODA 2WINB 2FFKB 2A74C 4DK0A 2IJ0A 4RCNA 3MZ5A 3H09A 3R8BA 4IQZA 1RD9D 2D9UA 4QIWB 1KLGD 2X6GA 1V8QA 3LNNA 5I9PA 1BR9A 3I3CA 5KNBA 3T16A 2MHVA 3PUYA 1T5XD 2E74C 3DHQA 3H91A 1I3QB 5E4XA 1ESRA 1O80A 3Q0AA 3C1FA 1MBYA 5E1FA 4G7HC 1AN8A 3S2DB 4ID6A 1HUNA 1A2TA 2K01A 1CQVA 2K32A 1KDBA 4MHEA 1M8AA 5EBCA 1TWCB 1PRTD 4FP5D 1LTGD 3PUXA 1EY5A 4RA8A 1HQMC 4U68A 3M3YB 4C3HB 1I4GA 1D5XC 2L5TA 2IPKD 1WVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TME A;  4DFA A;  1EY8 A;  1JOQ A;  3MVV A;  5C5L A;  3BDL A;  2EY1 A;  5ISR A;  5C3W A;  1SYF A;  3MHB A;  5C4H A;  2QDB A;  5KRU A;  5KYL A;  2EYL A;  2F0E A;  2F0I A;  4E6I A;  1ENA A;  1IHZ A;  2F0L A;  2NUC A;  4NDX A;  1JOO A;  1A3U A;  4ZUJ A;  3D4D A;  2EYM A;  2HQE A;  2PZU A;  2WAC A;  4IZ8 A;  3D4W A;  2O4X A;  2EY6 A;  5IGC A;  4MIU A;  2F0G A;  1F2M A;  4G57 A;  3NXW A;  3HEJ A;  1SYE A;  3V2T A;  1STG A;  5HUR A;  3VA5 A;  4K5X A;  4KD3 A;  2F0P A;  5CR3 A;  5IOC A;  4TRD A;  4K14 A;  1II3 A;  4HTH A;  2LKV A;  4QF4 A;  3SR1 A;  4DGZ A;  5C4Z A;  3QOJ A;  1STA A;  1EYC A;  4LAA A;  5IGB A;  1SYB A;  1TT2 A;  2OF1 A;  2F0N A;  5I6W A;  3QOL A;  4PMB A;  1STH A;  2EY2 A;  3NP8 A;  5IGE A;  3R3O A;  1KDC A;  4PNY A;  5IGF A;  4EQO A;  3SK4 A;  1AEX A;  5KYI A;  1STN A;  4S3S A;  5E3F A;  5J1Z A;  4F8M A;  4IUN A;  5HGT A;  4DU9 A;  3EVQ A;  4YIJ A;  4HMJ A;  4KD4 A;  1SYD A;  4ZQ3 A;  3NHH A;  5I6Y A;  4DF7 A;  5IOD A;  3NK9 A;  5J39 A;  2F3W A;  2SNS A;  4RKL A;  5CV6 A;  1EYD A;  5C5M A;  2EYF A;  3OMC A;  5J22 A;  3C1E A;  3SHL A;  1EY7 A;  3P75 A;  1A3V A;  2F0H A;  3HZX A;  1EYA A;  3E5S A;  4H7B A;  2F0S A;  4NMZ A;  1A3T A;  3D8G A;  3OWF A;  3SK6 A;  1EZ8 A;  4KTA A;  1NSN S;  5JOB A;  3MZ5 A;  2EY5 A;  1SNC A;  2EXZ A;  1KDA A;  2SOB A;  5I9O A;  2F0V A;  5EKK A;  4K5W A;  3ITP A;  4KY6 A;  5JAV A;  4F7X A;  3ERQ A;  4KJO A;  4PMC A;  5IIF A;  5M9O A;  1STB A;  2PW5 A;  1SNP A;  3LX0 A;  4ZUI A;  1SNM A;  4NP5 A;  5I9P A;  2F3V A;  1TR5 A;  5C3X A;  3TP8 A;  3RUZ A;  3BDC A;  3P1H A;  2F0F A;  3TP5 A;  2OXP A;  4N9T A;  3T16 A;  5F2D A;  1SNO A;  4KJN A;  3H6M A;  4RKB A;  2F0Q A;  2F0J A;  2RKS A;  3DHQ A;  4K8J A;  4EQP A;  2SNM A;  4KV6 A;  2EYJ A;  1TQO A;  4QMG A;  1SNQ A;  1U9R A;  2RBM A;  3D6C A;  4HMI A;  4KHV A;  4QB4 A;  5CV8 A;  4EVO A;  3C1F A;  2F0U A;  5IGG A;  5CV9 A;  5E1F A;  2EYO A;  5C6A A;  3PMF A;  3EJI A;  2F0O A;  3TP6 A;  5CC4 A;  2RDF A;  1JOK A;  3QB3 A;  1A2U A;  1F2Z A;  1SND A;  3DMU A;  3SK5 A;  4B9X A;  4WOR A;  4K2K A;  1EZ6 A;  1KAA A;  1EQV A;  4ID6 A;  4K5V A;  4KY5 A;  4ODG A;  2PQE A;  5CV5 A;  3OMG A;  1A2T A;  1F2Y A;  3U9O A;  2F0D A;  1EY6 A;  2KQ3 A;  4J6H A;  5KGU A;  2F0W A;  5CV4 A;  2F0M A;  5CV7 A;  5KIX A;  1KDB A;  4N9P A;  4ME5 A;  4EQN A;  5EKL A;  3SK8 A;  1EY0 A;  2ENB A;  1ENC A;  3T13 A;  4J1M A;  5DEH A;  5KEE A;  3SXH A;  3NUC A;  1RKN A;  4KY7 A;  3TP7 A;  5DAU A;  1SYG A;  2EYH A;  2PW7 A;  1EY9 A;  4K6D A;  4K2L A;  3ERO A;  1NUC A;  1EY5 A;  2F0T A;  1SYC A;  2M00 A;  2PZW A;  4I65 A;  3NQT A;  5EGT A;  1KAB A;  3MEH A;  4B9W A;  1EY4 A;  4IAL A;  2PYK A;  3S9W A;  4WRD A;  2KHS A;  4OL7 A;  2F0K A;  3OSO A;  2EYP A;  4K8I A;  4NKL A;  5IGD A;  2PZT A;  5CGK A;  4R8N A;  1JOR A;  5K5P A;  1STY A;  3MXP A;  5NUC A;  2OEO A; 
#chains in the Genus database with same CATH topology
 5EJW A;  1GXD C;  4DV5 L;  2B2V A;  3URY A;  5JPM C;  2WB1 G;  4P74 A;  3QR8 A;  2Z0S A;  1GUS A;  1MGS A;  4MIU A;  3CCL A;  3D6W A;  1SYE A;  3LGJ A;  3A7A B;  1AH9 A;  1H9R A;  5IT9 E;  1GJX A;  3UI2 A;  1TT2 A;  1DOK A;  4YCU A;  1CQF A;  1EU3 A;  4OX9 L;  1PDQ A;  5KYI A;  4MTK A;  1XTD A;  4KKT A;  3K81 C;  4LFC L;  1X32 A;  2K03 A;  4IUN A;  1LTI D;  4YIJ A;  2D5D A;  1PH6 A;  3UE1 A;  2F4V Q;  3K0Y A;  3S1M H;  4P72 A;  2J0T D;  1K83 H;  3EBE A;  2F52 A;  3JAM E;  4DUZ Q;  4H7B A;  4XTC S;  5JOB A;  2FIN B;  1KNE A;  1XXG A;  2EY5 A;  2EXZ A;  3ITP A;  4QL5 A;  3N6R A;  5M5X H;  4KJO A;  3MTS A;  4X64 Q;  1K8G A;  3Q8D A;  1XNR Q;  1XPR A;  1ENF A;  1QJO A;  2F3V A;  3PIO A;  1Q90 A;  3MXN A;  3ULP A;  4YHH L;  1EIF A;  4FXD A;  2KOL A;  1JB3 A;  1TY0 A;  5IP9 G;  4EQ5 A;  4Y52 H;  3GV6 A;  5CV8 A;  4EVO A;  5C6A A;  4B3R Q;  4IPD A;  2CCZ A;  2O5J C;  2QF7 A;  1V9P A;  2M2L A;  1NMF A;  2BDO A;  2K5H A;  3I56 A;  2H4O A;  3Q6S A;  1WTP A;  5COR A;  3HOX G;  2JA8 G;  2HUG A;  2KED A;  2H1E A;  1QZG A;  4O0A A;  2CVR A;  2NVT B;  5KEE A;  2LMC B;  4RGN A;  1WFQ A;  5GQO A;  3HKS A;  1VQ9 A;  3O13 A;  1G29 1;  5AJ3 L;  1WTX A;  2UXB Q;  2L1B A;  3F8T A;  5D3D A;  2IHF A;  1SE3 A;  4QUF A;  1Z9F A;  2Z6K A;  5D3I B;  2SOB A;  1J9O A;  4GN5 A;  4JI4 Q;  2OQK A;  1CZW A;  5C4X B;  2MPM A;  3MA2 B;  1IHZ A;  4ZUJ A;  2GVB A;  3D4D A;  2WAQ B;  4DV7 L;  1DD2 A;  3PUV A;  3CPW A;  1XPO A;  3NXW A;  3M4O H;  4ZKB B;  1HZC A;  5CR3 A;  4FF4 A;  3QWN A;  1JE5 A;  2IX0 A;  4LAA A;  4C3I G;  3A8J E;  2HD3 A;  4B3S L;  2JEB I;  2ZJR A;  3KF8 B;  2N3S A;  1PTO F;  1XWE A;  4UHV A;  3OHX C;  5J1Z A;  1PH7 A;  5M5Y B;  1QVF A;  2VL6 A;  2QCP X;  1E0B A;  4CKC A;  4ZQ3 A;  2LSS A;  4IUR A;  3GTL B;  4DV3 Q;  2RQX A;  5CV6 A;  3CC7 A;  2K5N A;  1N36 Q;  3C1E A;  3A56 A;  3P75 A;  2B63 H;  2F0H A;  1L1O A;  4NMZ A;  3OWF A;  3MEF A;  1Y1V G;  4A93 B;  1D5M C;  4PG3 A;  4X65 Q;  3H3V I;  1GUG A;  4BBS H;  1NR2 A;  3PUZ A;  5IT9 c;  4L5R C;  3BU2 A;  5T1G A;  1U4L A;  3I4M G;  4FDB A;  1B53 A;  1PRT B;  1EEI D;  1CFM A;  4GOP B;  1I94 L;  4FF3 A;  3M4P A;  1HRJ A;  1EIY B;  2UXD Q;  2RBM A;  4QB4 A;  1Z47 A;  2F0U A;  4ZK9 B;  3UDF A;  4I7A A;  1STE A;  5FJ8 G;  3JAM c;  4R4I A;  4A3F B;  3SK5 A;  1FGB D;  3HOV H;  1EQV A;  2B2Y C;  5M5W H;  2E2I B;  2F0D A;  1EY6 A;  2K5W A;  2TSS A;  1QB5 D;  2KVM A;  5CV4 A;  1PVO A;  2GA4 B;  1DJR D;  1HFG A;  4DV2 L;  4F88 A;  3CCE A;  3R2T A;  4A3M H;  3K7A H;  5DNF A;  2RA4 A;  4DK1 A;  3ZYY X;  3CQZ H;  5A2Q L;  1NUC A;  5EGT A;  3F2U A;  3QG1 A;  3A5U A;  4AYB E;  1MD2 D;  5BN3 A;  4JYA L;  1NAP A;  2K5Q A;  4K8I A;  4K0K L;  4JV5 Q;  1D1K A;  5CGK A;  1WTQ A;  3S1R H;  4NXN Q;  2AUJ D;  3D0F A;  2KEN A;  1TS3 A;  1LLR D;  5G3L D;  2QDB A;  1X3P A;  3ERS X;  5BR8 L;  2ID0 A;  4B3T L;  3HOW B;  4AH6 A;  2F0L A;  3BJU A;  4KKU A;  4KI0 A;  4DUY L;  2HQE A;  2IHE A;  5IP7 H;  3MXN B;  2DN8 A;  3A55 A;  4JCV E;  4H44 C;  2NZO A;  1JT8 A;  1LTT D;  1SYB A;  4JI3 L;  1PZJ D;  2EJM A;  3GQB A;  5IGF A;  1AEX A;  2XRS D;  2YTY A;  5FLM H;  2MO0 A;  4DR7 Q;  1IBK Q;  1JWU D;  2OQ0 A;  4F8M A;  4X3T A;  2E2J H;  3M85 A;  1FL0 A;  4HSV A;  3K5L A;  4BY1 B;  1TWF H;  4B3M Q;  4LF6 L;  1O7L A;  4RCO A;  3SVM A;  3OMC A;  3M9B A;  4GN4 B;  2KCT A;  2Q8R E;  1KAW A;  5EPJ A;  3IAY A;  4JI2 L;  1IZ6 A;  1Q8I A;  1NSN S;  3F2B A;  5EBD A;  4DV5 Q;  2VQF L;  3UDG A;  3PF4 A;  1BXT A;  1DZ1 A;  1PTO H;  3HS0 C;  4DAY A;  4N9T A;  1HA6 A;  1LAB A;  3VR5 A;  2F0Q A;  3SE0 A;  1M1K C;  2A6E C;  4H0L C;  4DXF A;  4DXG A;  4POG A;  1RTO A;  3EQL C;  5FLX c;  3L2P A;  4JBJ A;  2JA5 H;  1S5C D;  1JC7 A;  4OX9 Q;  2D0O A;  4LFC Q;  3CCV A;  2NN6 I;  1H9M A;  1HZB A;  1PLF A;  4NXM Q;  4ODG A;  4YCW A;  3OMG A;  2Y0S B;  2RVL A;  4IOA A;  1EEF D;  4OON A;  2PQA A;  5DEH A;  2JYO A;  4IN3 A;  2KA7 A;  2IX3 A;  2L11 A;  3RR5 A;  1WTW A;  1YNN C;  4JW0 A;  5E4W C;  3RD4 A;  2LXK A;  3PV0 A;  1OXV A;  1EY4 A;  3S9W A;  3HKZ E;  1GUT A;  2Q8I B;  1ASZ A;  3EFX D;  1L1O B;  1VQO A;  4YHH Q;  4XYO A;  2XN9 C;  1WI5 A;  1QNU A;  1YHA A;  1CM9 A;  2Z4H A;  4BWG B;  5C3W A;  4DR4 Q;  3BG3 A;  1ICF B;  4L8J A;  1JOO A;  1JWS D;  3CHB D;  2B2U C;  1VCI A;  2KEC A;  4QUC A;  1TVX A;  4BY7 H;  1CA6 A;  5C4X G;  1X9N A;  2PMZ B;  3VA5 A;  3P7J A;  3BYT B;  5IOC A;  4GNX C;  1II3 A;  5ELB A;  3TDQ A;  4QF4 A;  2WAQ G;  3E0J A;  2Z1C A;  4JOI C;  1TWG B;  2WKD A;  3R3O A;  1I4P A;  4EQO A;  4XYQ A;  5JEA G;  1VQJ A;  3GTP B;  3S2H H;  4HJ9 A;  4DU9 A;  2Q2H A;  1H9K A;  2QDL A;  4LF5 Q;  2FJ2 A;  1SE8 A;  4LWC A;  5LL6 X;  2K05 A;  3K5N A;  1EIG A;  3EN2 A;  1U5K A;  2DNE A;  3TRE A;  5GAH C;  5C0X H;  1WYD A;  3K57 A;  1EZ8 A;  4KTA A;  3T4A C;  2X6L A;  1X3G A;  1B8A A;  3S16 B;  4A3D G;  5I9O A;  5ELO A;  3S17 B;  4A3J G;  4OWW B;  1SNP A;  4JI8 L;  1UNS A;  4UDU C;  1SNM A;  5C3X A;  1ILQ A;  1E2W A;  2OCE A;  2CH4 A;  4CDD C;  3S1M B;  3Q22 A;  2O5I C;  1SNO A;  1K83 B;  1ICW A;  1Q46 A;  3X3N A;  1IBM Q;  3HRZ C;  1O7Z A;  2QEJ C;  1Y8N B;  4QMG A;  2NVX H;  2WB1 E;  4V19 0;  1B9N A;  1LM0 A;  5CV9 A;  5M5X B;  2ZM6 L;  2DUD A;  4ABN A;  4KY5 A;  5CV5 A;  3STB D;  3V96 A;  1TWA B;  3I2Z A;  2B2W C;  4R8I A;  4ALP A;  5FLX L;  1E2V A;  2VY3 A;  2MP1 A;  3J81 L;  4WJ4 A;  4XT3 B;  4CBV A;  2WP8 J;  1SRO A;  1IYJ B;  2PNR C;  1HZA A;  3BVM A;  3CP0 A;  4K2L A;  4QQB X;  2PZW A;  3BS1 A;  1BO0 A;  4YCV A;  3MEH A;  5HGQ A;  4B9W A;  1WJJ A;  3I90 A;  4HJ5 A;  1KRS A;  4OL7 A;  1CI3 M;  4IO9 A;  3MXU A;  2JA8 B;  4IUV A;  5C44 B;  1GVP A;  2NVQ H;  4R4C A;  5BN4 A;  3RZO H;  1I94 Q;  2XNA C;  1PTO D;  1YVC A;  3MVV A;  4C1N K;  2R7D A;  3KJP A;  3H3V C;  1U4M A;  2HQL A;  2B39 A;  1F9P A;  4OWX B;  4RGT A;  3PO2 G;  3VR4 A;  2XRQ D;  1OXU A;  3NPP A;  3CPF A;  4LJZ C;  1LTS D;  3HOW G;  3ONA B;  4TRD A;  1E3P A;  5FO7 B;  1PH9 A;  4L63 B;  1KD1 C;  1YZ6 A;  3BZC A;  1XMQ Q;  4C56 C;  3SK4 A;  1HZ9 A;  4L6T B;  2Q2T A;  3AFP A;  3A5Z B;  1LTL A;  3EVQ A;  2V1C C;  3FKI B;  4UPA A;  1DON A;  1HNW L;  2RDH A;  3M4O B;  2CW0 D;  2CWP A;  4A3G H;  2VW9 A;  4U67 3;  4JYA Q;  4K0K Q;  1CKN A;  2E5L L;  1EYA A;  2NYZ D;  5TSS A;  1C48 A;  4BY1 G;  1ZYR D;  2KHI A;  1Q8K A;  2R61 A;  5JAV A;  2JP1 A;  3X3M A;  4B3T Q;  1N32 L;  1UE6 A;  4EGV A;  3RN2 A;  4DAV A;  3T1Y Q;  4DUY Q;  3WDN A;  1VQ5 A;  4DR5 Q;  1C8C A;  2V4D A;  3EA6 A;  5G3L F;  3DEO A;  5F2D A;  3H0G H;  2QEX A;  4N8F A;  1Y1V B;  4APV A;  4IUT A;  4RH6 A;  3FDT A;  1GO3 E;  3P20 A;  2A69 D;  2K33 A;  4KV6 A;  2WKC A;  4JI3 Q;  1EQQ A;  3J81 i;  2YU9 H;  4CKB A;  1Y8P B;  3TP6 A;  2JEA I;  3KOJ A;  3I4M B;  4P2C B;  1H9J A;  3TZU A;  5IYC H;  3A7L A;  1H95 A;  5C3E G;  1DGS A;  1VQL A;  1FYC A;  4DNI A;  5EKI A;  5GAG C;  4NW2 A;  2Z4I A;  2KEE A;  2HCC A;  4POF A;  4A3C H;  1I6H H;  1L0W A;  1Q3L A;  4JI2 Q;  3SXH A;  4UP9 A;  1RKN A;  1FJG L;  3A0J A;  1H9S A;  4IOC A;  1K28 A;  2M00 A;  3HOV B;  4GZY C;  1PRT C;  1PH8 A;  5M5W B;  1KAB A;  3GTQ H;  2D62 A;  3GD7 A;  1SJH D;  3M4Y A;  2B2V C;  3OW2 A;  2BH8 A;  2OTL A;  1UE5 A;  1BBX C;  2N49 A;  2PNH A;  5ELE A;  1HNX Q;  4PZ6 A;  1ASY A;  3K7A B;  1JOQ A;  3DLL A;  2DJG C;  4KKS A;  3FEW X;  2GN5 A;  4C3J H;  1A3U A;  1WCM H;  1Z7T A;  4IZ8 A;  2QIL A;  3D4W A;  2XWJ B;  2H5X A;  2O4X A;  2EDG A;  1IXR A;  1PH4 A;  2E8G A;  4QIW E;  3S1R B;  1Y1W H;  2DGY A;  3NWS A;  5C4J B;  4HIO A;  2UUA L;  4LF9 L;  1B7Y B;  1STH A;  2EY2 A;  3K58 A;  1NCV A;  1VQK A;  1YHB A;  2CQO A;  2ZXP A;  2VB3 X;  3DM1 A;  3MXG A;  5J3B A;  2XVS A;  2KCN A;  2LXJ A;  1QE6 A;  1QOH A;  3CCJ A;  3ULL A;  3S1N H;  1ML0 D;  4G7O C;  5JVG 3;  1WTO A;  3CC2 A;  2HDM A;  4WFN 3;  3GTO B;  5T1I A;  1CSQ A;  4YY3 L;  4KY6 A;  2L12 A;  1X65 A;  1QIL A;  5LL6 S;  3GTG H;  3TP8 A;  4A75 A;  3RUZ A;  5IYD H;  4DR6 L;  2R7Z H;  2ALY B;  1XYI A;  1TII D;  1D2B A;  3ICE A;  1CHP D;  4CDC C;  1LTR D;  2E2H B;  4YWL A;  2K50 A;  3OIQ A;  1PZK D;  2ZT9 C;  4RHR A;  4K6L A;  1JOK A;  3DMU A;  1PTO B;  1SBB B;  3KK7 A;  3I73 A;  4DV0 L;  1YNJ D;  1V1P A;  4DR1 L;  5JJI A;  1LYL A;  2CFM A;  4ZKC B;  1FNU A;  3KLS X;  1CK1 A;  3FHW A;  2F3I A;  3WOF A;  1YIJ A;  1K3R A;  2PI2 A;  2ENB A;  2RCF A;  1G2T A;  2A5H A;  2JA5 B;  3OWE B;  1W6K A;  4LFA L;  2ZXR A;  2F4I A;  1EFI D;  3ERO A;  1ONL A;  2D2C C;  2Z6K C;  2UUB L;  4I65 A;  1F9Q A;  1L0Y B;  3AB9 A;  1YJ9 A;  3J80 L;  4IFD H;  3PGZ A;  5JPN C;  1ET9 A;  3VYT A;  3I72 A;  4PV1 C;  3S1Q B;  4NKL A;  3S15 H;  3NWT A;  3G6J B;  3EIV A;  1LO5 D;  5M3M H;  2N55 A;  3BVZ A;  2F03 A;  3BDL A;  3U9S A;  2EYL A;  2F0E A;  1R4Q B;  5I2X A;  5C44 G;  1A8V A;  4DV1 L;  4JI7 L;  2ZM6 Q;  1G51 A;  1VQ4 A;  3FRP B;  3WOE A;  1HA5 A;  4DPG A;  2BE5 D;  4V0B A;  2ZTC A;  5C4Z A;  4IPG A;  3PO3 H;  3HOX H;  1RJT A;  4JI6 L;  1D1I A;  2RCN A;  5JJK A;  3T1H L;  5E3F A;  4DR3 L;  4OO1 H;  2C5C A;  1HJP A;  4RG1 A;  1L1O C;  1A15 A;  4UP8 A;  5J39 A;  3PIP 3;  1RDP D;  3CRK C;  2SNS A;  2BH2 A;  1EFW A;  4O2D A;  4C2M H;  1SJE D;  1TS4 A;  2B2T A;  4UP7 A;  4GLX A;  3HZX A;  1IBL Q;  3HGB A;  3FKI G;  3D8G A;  1BBU A;  3HOU H;  5EKK A;  3AEV A;  4LFB L;  5M9O A;  3G4S A;  1E1O A;  2PW5 A;  4CHT B;  1WD0 A;  1FNW A;  1I50 B;  4TSS A;  4JI0 L;  1HPC A;  2VQE Q;  2A68 D;  4A3E H;  4DV4 Q;  1ZEQ X;  1XNQ Q;  1G91 A;  3I4N H;  4A3D B;  4K8J A;  3TQY A;  3OTO L;  2KCC A;  1VDZ A;  3OW7 A;  4A3J B;  1X55 A;  1CUK A;  5EAY A;  2F0O A;  3MFG A;  3VYR A;  4CDF C;  2B63 G;  3QB3 A;  4A76 A;  3SEB A;  4A3K H;  3NSW A;  1PZI D;  3J80 i;  2OTJ A;  2IWH A;  2K75 A;  2PQE A;  1F2Y A;  1C0A A;  3LWE A;  4RWS C;  4BBS G;  1I4X A;  2NWG A;  2KBN A;  2AWO A;  1EL0 A;  3RZD H;  1SMX A;  1SDF A;  2WAQ E;  1Y69 U;  3RMH A;  1MJC A;  5JEA J;  2E5L Q;  2NVX B;  1DXM A;  3F1Z A;  1ENC A;  3KDF A;  4BBR H;  1QZH A;  4DA2 A;  3RNU A;  3NQT A;  1N32 Q;  2A6H D;  1UEA B;  4GN3 B;  2PYK A;  4J8Q A;  2K5D A;  1YEZ A;  5I2Y A;  1D6E C;  2EYP A;  1AZQ A;  1JJ2 A;  2UUC L;  4IJL A;  3DXJ C;  5K5P A;  1VQ7 A;  3HOV G;  4BXX H;  4GLV B;  2IX1 A;  3GTJ H;  4DFA A;  1K8O A;  1ET6 A;  2VXW A;  1J6Q A;  2C35 B;  5C4H A;  2F0I A;  2DY7 A;  1HUM A;  2NUC A;  3KYH C;  1IL8 A;  2WAC A;  3I4O A;  5FJ8 H;  3K59 A;  4A3M G;  2IW3 A;  1J5E L;  4DR2 L;  4JI5 L;  1YBY A;  3BZK A;  2BA1 A;  2NVQ B;  1BBW A;  1LT6 D;  2CQA A;  3AMU A;  3RZO B;  1CZG A;  4J15 A;  3GTM B;  3S14 H;  4MNO A;  2XSC A;  3PO2 B;  1A63 A;  3ZJY C;  1FJG Q;  3I8Z A;  5I4D A;  5I6Y A;  2FMM A;  1A62 A;  4IJH A;  5C0X I;  1EYD A;  1OXX K;  4DV6 L;  1TWC H;  1PXU A;  4ZLT F;  1JIC A;  5A35 A;  1WD1 A;  4A3I H;  2QKI C;  4LF4 L;  3Q24 A;  3JC6 6;  2EIF A;  2F0V A;  4K5W A;  1CKM A;  3M3Y H;  1STB A;  3IL8 A;  4C3H H;  4ZUI A;  4QCL A;  4HIM A;  2RHS B;  3NQI A;  5FLM G;  4A3G B;  3A54 A;  3NBH A;  5AFW A;  5K36 H;  1XMO L;  3DWQ A;  1K0S A;  1LTA D;  1SNQ A;  3E9I A;  4LF9 Q;  2R7F A;  1I5F A;  4X62 L;  3HP3 A;  3W3A A;  1R9T B;  2KUM A;  1JE4 A;  2JXM B;  1QVC A;  3K8A A;  1VQC A;  2BCO A;  4ZCK A;  3U9O A;  1I4H A;  1C7Y A;  1AW7 A;  4P73 A;  1EOV A;  4WJW A;  2F1M A;  4XQQ A;  2NZ1 D;  2JN4 A;  2CKZ B;  3FVQ A;  3CCS A;  4L5Q A;  5DM7 3;  3IFD A;  3VA7 A;  1EY9 A;  3GTK H;  1SRU A;  1N34 L;  5C3E B;  5LMU L;  1FGU A;  4OEL B;  1NE3 A;  1C9O A;  2MFI A;  5D65 A;  2JA5 G;  5IT9 L;  4DAP A;  2A8V A;  4OWT B;  4DR6 Q;  3A8I E;  4X66 L;  1SE2 A;  5FK9 C;  4JC0 A;  3TEH B;  4GKK L;  1FR3 A;  1S5F D;  4A4I A;  1BCP D;  1B1Z A;  2VUM H;  3Q23 A;  3GTQ B;  2QGQ A;  3CKI B;  1BVS A;  4FO2 A;  1A6X A;  4R4Q A;  3V2T A;  3JAM L;  4DV0 Q;  2EVB A;  1PA6 A;  2JA7 B;  1EUJ A;  4GKJ L;  5I6W A;  3QOL A;  1KDC A;  1CT1 D;  1E24 A;  2CWA A;  5D14 A;  1JR0 D;  3H3V H;  1QCB D;  5EQ0 A;  2HHH L;  2L9H A;  4LFA Q;  2LY7 A;  4M8A A;  4LW1 A;  2B8G A;  1GD7 A;  2F3W A;  4RKL A;  1IL2 A;  2L55 A;  3TZD A;  2K5V A;  5HY6 A;  4OIJ A;  3H94 A;  3E0E A;  1VQ6 A;  4BY7 G;  2AQ3 B;  2Y0S E;  3NTH A;  3VYU A;  2EJG C;  1LT4 D;  2YTX A;  4A3L H;  2D0P A;  2BA0 A;  3LX0 A;  4DV1 Q;  4JI7 Q;  4LK1 C;  3P1H A;  2R93 H;  4G4K A;  1BOS A;  1K3B C;  3H6M A;  3S1N B;  2F0J A;  2RKS A;  4EQP A;  1YI2 A;  1AE2 A;  2SNM A;  5AJ3 Q;  1HNZ L;  4XT1 B;  1EWI A;  1XTC D;  4KHV A;  3PMF A;  5CC4 A;  4JI6 Q;  3ER0 A;  4OIK A;  5C0X G;  3T1H Q;  1SR3 A;  3OYY A;  4BS9 A;  4O42 A;  4DR3 Q;  3GTG B;  4DUZ L;  4GS3 A;  5CYU A;  4KLK A;  2R7Z B;  4CDE C;  2K04 A;  3CF5 A;  3HOZ H;  2KCM A;  4DV7 Q;  5CV7 A;  4X64 L;  3STB C;  4J1M A;  1S4Z A;  4NPS A;  2PMZ E;  4HCS A;  4KY7 A;  1FD7 D;  1P8L A;  5CMD A;  3GTL H;  4UAI A;  2NTS A;  2EJF C;  2F0T A;  4JBM A;  4A3B H;  2B2U A;  1VF7 A;  4B3S Q;  3JAM i;  4JI0 Q;  4HR7 B;  1B50 A;  1PYB A;  2AMC B;  4B08 A;  4PQX A;  4B3R L;  4A93 H;  3MXP A;  3ND8 A;  4LUO A;  5IYB H;  3CCQ A;  1EY8 A;  2B8F A;  3PCO B;  1EYG A;  5KRU A;  1PTO C;  4HJ7 A;  2GVA A;  1HHV A;  2CH4 W;  2B3G A;  2WV6 D;  2EYM A;  2SDF A;  3J7A 5;  5FKA C;  2EY6 A;  5IGC A;  2JA6 H;  4DKA C;  4HCE A;  3NBH B;  5HUR A;  3QIA A;  4KD3 A;  2F0P A;  2EZV A;  1FNV A;  1GHJ A;  3SR1 A;  5M3M B;  2UXC L;  2FMC A;  1EYC A;  1MSG A;  4R4O A;  1AZP A;  3G7L A;  5IGE A;  4H13 C;  4CGY B;  3NP8 A;  4A3F H;  1IYU A;  3J7A F;  1S3O A;  4I7Z C;  2UXB L;  3B6Y A;  5HGT A;  5FO9 B;  4DN4 M;  3NTK A;  1X54 A;  4G7Z C;  1VQA A;  1SLJ A;  2Z6B A;  2TMP A;  3K7U C;  1ZKO A;  4DAY B;  2JQO A;  4DAM A;  2CW0 C;  3KUP A;  2UUC Q;  3TS0 A;  1MJE A;  3PO3 B;  3OIP A;  5GAD C;  1NMG A;  4PMW A;  1BDO A;  1HR0 L;  3CME A;  3S24 A;  3U4Z A;  1TXY A;  2JSO A;  4F7X A;  3PIP A;  4KHP L;  4DV2 Q;  1ZYR C;  4OGQ C;  1VQ8 A;  2NN6 H;  1V1Q A;  2NVY H;  1SMY D;  1X56 A;  4HAE A;  1JMC A;  4DR2 Q;  4JI5 Q;  1MHW C;  1W3S A;  1WTR A;  1SE4 A;  3G48 A;  1GOZ A;  3I7F A;  2M9V A;  2RF4 A;  1DOL A;  2EYJ A;  1AE3 A;  2QA4 A;  3HOU B;  1U9R A;  4HMI A;  4KN4 C;  4A3G G;  3KBX A;  1KXL A;  3TN2 A;  2A69 C;  2PQA B;  3EJI A;  1N36 L;  1HQR D;  1A2U A;  3VR2 A;  1L2F A;  1TWH H;  1NY4 A;  3R2I A;  1JQY D;  2VZA A;  3L7Z C;  5BR8 Q;  3RLO A;  2AWN A;  2XTI A;  4A3E B;  1TY2 A;  1BCP B;  3G71 A;  4ZRZ A;  1CHQ D;  1HFN A;  4N9P A;  1K8A C;  1MIU A;  1NBW A;  3DWA A;  2X69 A;  2B63 B;  3NTI A;  3PSI A;  3TP7 A;  1IW7 D;  1SYG A;  3H0G G;  2PW7 A;  4IFD I;  4K6D A;  1O78 A;  4BA1 I;  1SYC A;  3E3X A;  4A3K B;  3W1G A;  2UXD L;  1HTL D;  3QO2 A;  4BBS B;  1E2Z A;  3HOY H;  1VQG A;  1Q1B A;  1NR4 A;  2ZXO A;  1W2B A;  4IUU A;  2MJ8 A;  5IYC G;  2DY8 A;  1HH2 P;  4LF6 Q;  4IPH A;  2Q8T A;  1GM5 A;  2JK8 A;  2K7V A;  2RSO A;  2EXD A;  2HDL A;  4A3C G;  3L3O C;  1I6V C;  4Z9C B;  5A2Q E;  5M3F H;  1UUP A;  3HFZ B;  4G57 A;  3HEJ A;  5IWA L;  2VQF Q;  3HG9 A;  1S5D D;  4HTH A;  1PFB A;  3T56 B;  2MQH A;  2K28 A;  3GTJ B;  2IT1 A;  4OO1 I;  4A3M B;  2JA7 G;  4JV5 L;  1VF5 C;  2K4K A;  1X3Q A;  4KD4 A;  4NXN L;  3NHH A;  1PHJ A;  5LMU Q;  3CQZ B;  4C3J G;  1G8Z D;  1Y8O B;  5EPL A;  1B70 B;  4BA2 I;  3J7A V;  3BZD B;  1HTP A;  3KF8 A;  2F0S A;  3C3L A;  1QNK A;  3SK6 A;  4X66 Q;  3S14 B;  2MO1 A;  4GKK Q;  1RHP A;  1MKH A;  1PFS A;  3FPP A;  1Y14 B;  1PV4 A;  4NP5 A;  1IYV A;  3D4R A;  1PH2 A;  4AQY L;  1KTK A;  4RAU C;  3T51 B;  1L0X B;  3CAM A;  1J8I A;  1IBK L;  4LMQ D;  1BCP F;  4CKE A;  2I5M X;  1HCZ A;  4A3I B;  4GKJ Q;  1V43 A;  2L15 A;  3NEL A;  3CXC A;  1CA5 A;  3BVG A;  2R92 H;  4B3M L;  1VMP A;  1HR0 W;  4QGU A;  1UAP A;  4P75 A;  3K5O A;  2AUK A;  4P71 A;  2HHH Q;  3T53 B;  1B44 D;  1EIH A;  2K1B A;  1OO9 B;  4GOP A;  1SSO A;  2E2J B;  2A19 A;  3GO5 A;  1TWG H;  2HCI A;  4LF8 L;  4JPB W;  1YNJ C;  4H02 A;  1OTC A;  1TWF B;  4JVZ A;  1T5E A;  3KFU A;  3MC0 B;  4F87 A;  4X3U A;  1EY0 A;  3GTP H;  2ICI A;  5IYD G;  3MFY A;  2R7Z G;  3CCM A;  1K9M C;  2EYH A;  1SFO H;  3GDE A;  3U4V A;  1KLU D;  5CBE E;  1F9R A;  4IAL A;  1W6J A;  2BDN A;  4DNR B;  4Y7N H;  3NE5 B;  3S16 H;  4KHZ A;  2OEO A;  3IFT A;  5JJL A;  2Z9H A;  3FP9 A;  1BF4 A;  3S17 H;  2I07 B;  4NXM L;  1HNZ Q;  4R9W A;  5KYL A;  4PZ7 A;  1ENA A;  2IY5 B;  3GTK B;  2I46 A;  2PZU A;  3VDY A;  3SGI A;  1S5E D;  3AQQ A;  1QUQ A;  3CU7 A;  1YIT A;  2F0G A;  1X3E A;  5ELD A;  1SEB D;  1SXT A;  2A1A A;  1B3A A;  1I4R A;  4JI8 Q;  4DGZ A;  3UE0 A;  3QOJ A;  2BE5 C;  4IFD G;  4PMB A;  3L9A X;  5COY A;  3SDZ A;  1CKN B;  3DWP A;  2SEB D;  4QY7 A;  5FO8 B;  1STN A;  3ULJ A;  1PFN A;  2VUM B;  1I4Q A;  4L5T A;  4HMJ A;  5IP9 H;  2B2T C;  5M3M G;  2VB2 X;  1AP0 A;  2AKW B;  1ZXT A;  4DF7 A;  1TWA H;  4IUP A;  1G6Z A;  4DR4 L;  2IL8 A;  2J7Z A;  1A3V A;  1LV9 A;  2G9D A;  2Q2I A;  1JWM D;  4RMF A;  1Q86 C;  2CHB D;  1KRT A;  2OWO A;  1KDA A;  1CSP A;  3ERQ A;  4PMC A;  2AHO B;  1TS2 A;  1VQE A;  1NTG A;  2JA8 H;  1PYW D;  2ASB A;  5C44 H;  3PO3 G;  4FF1 A;  2F0F A;  2OXP A;  5L37 A;  4RGO S;  4KJN A;  4XQN A;  4XXE A;  4OO1 G;  1Q7Y C;  4BY7 B;  1A0I A;  3CMA A;  2A68 C;  2UXC Q;  4XDX A;  2NB0 A;  1JOR A;  3ND9 A;  3D6C A;  4LF5 L;  1S5B D;  1TS5 A;  2G5D A;  4WJ3 M;  2RDF A;  2Q2U A;  1SAP A;  4FF2 A;  1EZ6 A;  3TBI B;  4K5V A;  1EWC A;  3S2H B;  1DM0 B;  1H9S B;  3WWV A;  2UU9 L;  3HOU G;  2R93 B;  4J6H A;  2LFN A;  2F0W A;  2F0M A;  1KNA A;  1E1T A;  4X3K A;  4ULL A;  5EKL A;  3T13 A;  3KF6 A;  3GV3 A;  2DNC A;  2PCF B;  3FKI H;  1K8M A;  4A3E G;  1HR0 Q;  1T9H A;  4LF7 L;  4KHP Q;  3I4N G;  1B4O A;  2I5H A;  4C3I H;  1IBM L;  2F0K A;  2XGT A;  3HOZ B;  2A6H C;  1PFM A;  1N9W A;  5H1S E;  3CD6 A;  4A3K G;  1PMR A;  1HNW Q;  4LUZ A;  3MHB A;  3QJY A;  2PO4 A;  5FLX E;  4Q0F A;  3UDX A;  2JE6 I;  3J81 E;  1F77 A;  4A3B B;  1Z6H A;  2L4N A;  2ICE C;  1EOT A;  2AQ1 B;  2ES2 A;  4BBR G;  1Y1V H;  1U4R A;  1XX8 A;  3M4Q A;  2LKV A;  5EPK A;  2C9O A;  2MUY A;  4TVA B;  4O1N A;  3I4M H;  4KN7 C;  1GUN A;  3W5O A;  1YJN A;  4AYB B;  4JI1 L;  1BUV T;  5C0X J;  1VQH A;  1PH5 A;  4EX5 A;  4BXX G;  1CKO A;  1F9S A;  1TU2 B;  3N52 A;  2JA6 B;  1KHI A;  3NK9 A;  1GHK A;  3L0O A;  2K6A A;  1WTH A;  5J22 A;  3KJO A;  1EY7 A;  4R4T A;  2L0C A;  4ZYS A;  3CRL C;  4ZAI A;  1I3Q H;  1KQS A;  3D3R A;  1IKM A;  5ELN A;  4IUQ A;  5ELF A;  4HN7 A;  5DLQ E;  2JA9 A;  3I91 A;  1JJC B;  3AU7 A;  2I0Q A;  1EQR A;  3S2D H;  1XMQ L;  4JBW A;  1EWH A;  1QG7 A;  3R93 A;  1Q82 C;  1B9M A;  3PF5 A;  1KIX A;  5IWA Q;  3D31 A;  1V1P B;  4LNQ A;  4MN3 A;  1E22 A;  1MI2 A;  1YNX A;  5IGG A;  2EYO A;  5IP7 G;  5ELC A;  1DCZ A;  1SND A;  1F2Z A;  1Q1E A;  2NVY B;  4A3I G;  4B9X A;  1QUQ B;  1VQF A;  4M1U B;  4K2K A;  3IKJ A;  2PPB C;  4OEM B;  1WOC A;  5C4J H;  1OXT A;  5KGU A;  2KQ3 A;  3V05 A;  1N8R C;  1X6O A;  4GLA C;  4X6A H;  4C3H G;  3TS2 A;  4JK1 C;  2B2Y A;  2LS0 1;  3T1Y L;  1Q12 A;  3RLN A;  2MNA A;  2EPB A;  4DR5 L;  3DM3 A;  1LT5 D;  2RHQ B;  3E9H A;  5DAU A;  1S72 A;  5K36 G;  4C1N I;  3M7G A;  2UUA Q;  1TWH B;  3TRZ A;  1DYQ A;  1LTB D;  2BOS A;  3KLR A;  3KLW A;  3UDI A;  3W2D A;  3NEM A;  5IGD A;  4AQY Q;  2PZT A;  3GTO H;  4Q5V A;  5NUC A;  3TME A;  2R3Z A;  2JJQ A;  5C5L A;  3H0G B;  3U50 C;  2YYZ A;  1LT3 D;  1O7Y A;  2E2D C;  2VS1 A;  2PI2 E;  2AQ2 B;  4FXK C;  4XQJ A;  2ATW A;  4YWK A;  2B29 A;  1IKL A;  1PRT F;  1LUZ A;  1BCP C;  2YU9 B;  3HOY B;  2VNU D;  2EE1 A;  2EQS A;  4YY3 Q;  1PH3 A;  5JVH 3;  1OXS C;  2XIW A;  3NEN A;  4LUV A;  2E2H H;  1VQB A;  4XIG S;  5IGB A;  4LF8 Q;  1STA A;  3FMC A;  4TKO B;  1VQM A;  4HED A;  2N88 A;  4PNY A;  1XPU A;  3F2D A;  4JBK A;  1N33 L;  2A73 B;  3HKZ B;  1I6H B;  5JJZ A;  2NBF A;  4FXG C;  1ESF A;  3A8K E;  5M3F B;  1ROD A;  1HNX L;  2Z8L A;  1UWV A;  1MSH A;  4RHS A;  5C5M A;  2VUM G;  5GAE C;  3PIO 3;  3J81 c;  5FOB B;  4HID A;  1A3T A;  3KF6 B;  4DR1 Q;  4QJF A;  1SNC A;  5E7N A;  2NZH A;  3S1Q H;  4C3J B;  1Q81 C;  1M4V A;  3BDC A;  1O7I A;  1WCM B;  2YTV A;  3TP5 A;  5LMN L;  4MTN A;  3DEP A;  2A6E D;  4KMU C;  2UUB Q;  1V1O A;  4FNF A;  4OHJ A;  4UY8 C;  1TQO A;  1Y1W B;  1X3F A;  2FXQ A;  2NVT H;  1C4Q A;  3KDF B;  4CJ1 B;  1G6P A;  4DK3 C;  1KAA A;  1WTV A;  3C46 A;  1KL9 A;  1RF2 D;  2E75 C;  4N8X 1;  1P16 A;  3VR3 A;  4RGM A;  2WII B;  4A3L G;  1DOM A;  1VQI A;  1G2S A;  1S40 A;  3FPU B;  5KNC A;  1D8L A;  4ME5 A;  4TQU S;  3SK8 A;  4AIM A;  2R92 B;  2R93 G;  5C4X H;  1YNN D;  2K14 A;  1QWY A;  3K0X A;  4NB3 A;  4JG2 A;  2G9H D;  3GP7 A;  3AFQ A;  4L5S A;  1KC8 C;  3NBI A;  3E6Z X;  2F4V L;  5GRO A;  4WRD A;  1AFP A;  2WB1 B;  5JEA H;  3OSO A;  2KHJ A;  2RDG A;  4R8N A;  1STY A;  2HIX A;  2NTT A;  1GUW A;  5ISR A;  1SYF A;  5DM6 3;  3HOZ G;  1SFO B;  1I50 H;  1XNR L;  2FHT A;  4NDX A;  5M5Y H;  1UE1 A;  3CC4 A;  5CBA E;  4A3D H;  2UU9 Q;  3J80 E;  5IY0 A;  4Y7N B;  4LFB Q;  4K14 A;  3K5M A;  1PH1 A;  5LHY 1;  4A3J H;  4A3B G;  2KJX A;  1EU4 A;  4GNX A;  1YJW A;  5BN5 A;  5IE8 A;  4A93 G;  4JOI A;  5IYB G;  3OTO Q;  4LF7 Q;  1VMC A;  1SYD A;  1VQD A;  4RFB A;  1EQT A;  4AYB G;  3KLS A;  3M7N A;  2EYF A;  4HJA A;  3AYH B;  2J4X A;  4FYD A;  3I70 A;  1VQP A;  1B2T A;  3SHL A;  1CTM A;  2E76 C;  3E5S A;  1U4P A;  3S15 B;  1LAC A;  2JA6 G;  3VYS A;  3CCU A;  4PZ8 A;  3VR6 A;  5IIF A;  1PYS B;  1TR5 A;  2MGS A;  4A3F G;  1F2L A;  2E2I H;  2RSN A;  1SMY C;  4HIK A;  1QVG A;  3OOC A;  1D5Z C;  4FVM A;  4RKB A;  3MAQ A;  3I55 A;  4JI4 L;  4IPC A;  4DNT B;  3K6O A;  2ZJP A;  1VQN A;  1HXY D;  4JI1 Q;  2R6G A;  1K0R A;  3H15 A;  2QW7 A;  3HOX B;  2WFW A;  4ILW A;  2O2L D;  4WOR A;  4ME3 A;  1IBL L;  3RLF A;  4HSP A;  2I5L X;  4KK7 A;  1K73 C;  5LMN W;  3GTM H;  1U0L A;  4IFD J;  1RCV D;  2NN6 G;  5KIX A;  4CJ0 B;  3PO2 H;  3LWU A;  4EQN A;  1J5E Q;  4C2M B;  1E7Z A;  3NUC A;  5KND A;  3K80 C;  3HOW H;  2VQE L;  1RL2 A;  1M90 C;  2B2W A;  1JCK B;  4DV4 L;  1XNQ L;  4DV3 L;  1IW7 C;  2XWB B;  1B3Q A;  1NNX A;  3BYY B;  2KHS A;  1VS0 A;  3C2P A;  1UE7 A;  4CJ2 C;  3DUZ A;  3W1B A;  3G6E A;  1YHQ A;  3KBG A;  4X65 L;  1GUO A;  2EY1 A;  1JJG A;  3TSS A;  3I4N B;  4DV6 Q;  4E6I A;  2K52 A;  3OPO A;  2ZTD A;  1RTN A;  4C3I B;  1SN8 A;  1TKW B;  3I4L A;  3J7Y W;  4LF4 Q;  3F2C A;  1NJI C;  1F2M A;  4X3S A;  4BY1 H;  2EOT A;  1R4P B;  1STG A;  4K5X A;  2N8N A;  4R1J A;  1JB7 A;  3CCR A;  2OF1 A;  2F0N A;  3PUW A;  3HOY G;  1BNZ A;  3RZD B;  2OT2 A;  4S3S A;  3U58 A;  1R9T H;  1XMO Q;  3BDO A;  3MWY W;  2YV5 A;  4BBR B;  1BQQ T;  1ILP A;  5IOD A;  2WIN B;  2FFK B;  2ZJQ A;  2A74 C;  3HKZ G;  4X62 Q;  4DK0 A;  1XJV A;  2IJ0 A;  3J81 j;  4RCN A;  5M3F G;  1RIP A;  3MZ5 A;  5C3E H;  3H09 A;  2DJF C;  4IQZ A;  3R8B A;  3J80 c;  1RD9 D;  2D9U A;  4QIW B;  1KLG D;  2X6G A;  1V8Q A;  4YWM A;  3LNN A;  2HIV A;  5I9P A;  1BR9 A;  2HT1 A;  3I3C A;  5KNB A;  1BKB A;  3T16 A;  1GKH A;  2MHV A;  3PUY A;  1N34 Q;  1D7Q A;  1T5X D;  2E74 C;  2Y0S G;  3DHQ A;  3H91 A;  1I3Q B;  1ESR A;  1O80 A;  5E4X A;  3Q0A A;  1WCM G;  3C1F A;  4GOP C;  1MBY A;  3A74 A;  5E1F A;  1N33 Q;  4G7H C;  1AN8 A;  4DK6 C;  3S2D B;  4ID6 A;  2JA7 H;  1Y1W G;  1HUN A;  1A2T A;  2K01 A;  1CQV A;  3IRB A;  2K32 A;  4HJ8 A;  1KDB A;  4MHE A;  1M8A A;  3RN5 A;  5EBC A;  4OXP A;  1TWC B;  3CW2 C;  4GNX B;  3J7Z C;  4DR7 L;  1FVI A;  1PRT D;  2ZTE A;  4FP5 D;  4MZ9 A;  1LTG D;  3PUX A;  1UEB A;  3PQI A;  1EY5 A;  2N78 A;  4RA8 A;  1HQM C;  4U68 A;  3M3Y B;  2P5Z X;  2R92 G;  4C3H B;  1I4G A;  5LMN Q;  1D5X C;  2L5T A;  2IPK D;  1WVL A; 
#chains in the Genus database with same CATH homology
 5EJW A;  1GXD C;  2B2V A;  3URY A;  5JPM C;  1GUS A;  1MGS A;  4MIU A;  3D6W A;  1SYE A;  3A7A B;  1H9R A;  5IT9 E;  1GJX A;  3UI2 A;  1TT2 A;  1DOK A;  1CQF A;  1EU3 A;  1PDQ A;  5KYI A;  4KKT A;  1X32 A;  2K03 A;  4IUN A;  1LTI D;  4YIJ A;  2D5D A;  3K0Y A;  2J0T D;  3JAM E;  4H7B A;  4XTC S;  5JOB A;  2FIN B;  1KNE A;  1XXG A;  2EY5 A;  2EXZ A;  3ITP A;  3N6R A;  4KJO A;  3MTS A;  1ENF A;  1QJO A;  2F3V A;  1Q90 A;  3MXN A;  4FXD A;  2KOL A;  1JB3 A;  1TY0 A;  3GV6 A;  5CV8 A;  4EVO A;  5C6A A;  2O5J C;  2QF7 A;  2M2L A;  2BDO A;  2H4O A;  3Q6S A;  1WTP A;  5COR A;  2HUG A;  2KED A;  2H1E A;  2CVR A;  2NVT B;  5KEE A;  2LMC B;  4RGN A;  3O13 A;  1G29 1;  1WTX A;  2L1B A;  5D3D A;  1SE3 A;  4QUF A;  5D3I B;  2SOB A;  1J9O A;  1CZW A;  5C4X B;  2MPM A;  3MA2 B;  1IHZ A;  4ZUJ A;  3D4D A;  2WAQ B;  1DD2 A;  3PUV A;  3NXW A;  4ZKB B;  5CR3 A;  4FF4 A;  3QWN A;  2IX0 A;  4LAA A;  4C3I G;  3A8J E;  2JEB I;  1PTO F;  1XWE A;  5M5Y B;  3OHX C;  5J1Z A;  2QCP X;  1E0B A;  4CKC A;  4ZQ3 A;  4IUR A;  3GTL B;  2RQX A;  5CV6 A;  3C1E A;  3A56 A;  3P75 A;  2F0H A;  4NMZ A;  3OWF A;  4A93 B;  1D5M C;  1GUG A;  1NR2 A;  3PUZ A;  5T1G A;  1U4L A;  1B53 A;  1PRT B;  1EEI D;  1CFM A;  4FF3 A;  1HRJ A;  2RBM A;  4QB4 A;  1Z47 A;  2F0U A;  4ZK9 B;  1STE A;  4A3F B;  3SK5 A;  1FGB D;  1EQV A;  2B2Y C;  2E2I B;  2F0D A;  1EY6 A;  2K5W A;  2TSS A;  1QB5 D;  2KVM A;  5CV4 A;  2GA4 B;  1DJR D;  1HFG A;  4F88 A;  3R2T A;  5DNF A;  2RA4 A;  4DK1 A;  3ZYY X;  5A2Q L;  1NUC A;  5EGT A;  3F2U A;  3QG1 A;  1MD2 D;  5BN3 A;  1NAP A;  2K5Q A;  4K8I A;  1D1K A;  5CGK A;  1WTQ A;  2AUJ D;  1TS3 A;  1LLR D;  5G3L D;  2QDB A;  1X3P A;  3HOW B;  2ID0 A;  2F0L A;  4KKU A;  4KI0 A;  2HQE A;  2DN8 A;  3A55 A;  4H44 C;  1LTT D;  1SYB A;  1PZJ D;  2EJM A;  3GQB A;  5IGF A;  1AEX A;  2XRS D;  1JWU D;  4F8M A;  4X3T A;  3M85 A;  4HSV A;  3K5L A;  4BY1 B;  1O7L A;  4RCO A;  3SVM A;  3OMC A;  2Q8R E;  5EPJ A;  3IAY A;  1Q8I A;  1NSN S;  5EBD A;  1BXT A;  1DZ1 A;  1PTO H;  3HS0 C;  4DAY A;  4N9T A;  1HA6 A;  1LAB A;  3VR5 A;  2F0Q A;  3SE0 A;  2A6E C;  4H0L C;  4DXF A;  4DXG A;  1RTO A;  3EQL C;  1S5C D;  1JC7 A;  2NN6 I;  1H9M A;  1PLF A;  4ODG A;  3OMG A;  2Y0S B;  2RVL A;  1EEF D;  5DEH A;  2JYO A;  4IN3 A;  2KA7 A;  2IX3 A;  2L11 A;  1WTW A;  1YNN C;  5E4W C;  3RD4 A;  3PV0 A;  1OXV A;  1EY4 A;  3S9W A;  1GUT A;  2Q8I B;  3EFX D;  4XYO A;  2XN9 C;  1QNU A;  2Z4H A;  1CM9 A;  4BWG B;  5C3W A;  3BG3 A;  4L8J A;  1JOO A;  1JWS D;  3CHB D;  2B2U C;  1VCI A;  2KEC A;  4QUC A;  1TVX A;  1CA6 A;  2PMZ B;  3VA5 A;  5IOC A;  3P7J A;  3BYT B;  1II3 A;  5ELB A;  3TDQ A;  4QF4 A;  3E0J A;  2Z1C A;  1TWG B;  2WKD A;  3R3O A;  1I4P A;  4EQO A;  4XYQ A;  5JEA G;  3GTP B;  4DU9 A;  1H9K A;  2FJ2 A;  5LL6 X;  2K05 A;  3K5N A;  1EIG A;  2DNE A;  5C0X H;  3K57 A;  1EZ8 A;  4KTA A;  3T4A C;  2X6L A;  3S16 B;  5I9O A;  3S17 B;  1SNP A;  1UNS A;  4UDU C;  1SNM A;  5C3X A;  1ILQ A;  1E2W A;  3S1M B;  3Q22 A;  2O5I C;  1SNO A;  1K83 B;  1ICW A;  3X3N A;  3HRZ C;  1O7Z A;  2QEJ C;  1Y8N B;  4QMG A;  4V19 0;  1B9N A;  5CV9 A;  5M5X B;  4ABN A;  4KY5 A;  5CV5 A;  3V96 A;  1TWA B;  2B2W C;  4R8I A;  5FLX L;  1E2V A;  3J81 L;  2MP1 A;  4XT3 B;  4CBV A;  2WP8 J;  2PNR C;  3BVM A;  4K2L A;  2PZW A;  3BS1 A;  1BO0 A;  3MEH A;  4B9W A;  3I90 A;  4OL7 A;  1CI3 M;  3MXU A;  2JA8 B;  4IUV A;  5C44 B;  5BN4 A;  2XNA C;  1PTO D;  3MVV A;  4C1N K;  3H3V C;  1U4M A;  2B39 A;  1F9P A;  4RGT A;  3VR4 A;  2XRQ D;  1OXU A;  3NPP A;  4LJZ C;  1LTS D;  3ONA B;  4TRD A;  5FO7 B;  4L63 B;  4C56 C;  3SK4 A;  4L6T B;  3EVQ A;  3FKI B;  1DON A;  2RDH A;  3M4O B;  2CW0 D;  4U67 3;  1EYA A;  2NYZ D;  5TSS A;  1C48 A;  1ZYR D;  2R61 A;  5JAV A;  2JP1 A;  3X3M A;  4EGV A;  4DAV A;  3WDN A;  1C8C A;  2V4D A;  3EA6 A;  5G3L F;  3DEO A;  5F2D A;  1Y1V B;  4IUT A;  4RH6 A;  3FDT A;  3P20 A;  2A69 D;  2K33 A;  4KV6 A;  2WKC A;  4CKB A;  1Y8P B;  3TP6 A;  2JEA I;  3I4M B;  4P2C B;  1H9J A;  3TZU A;  3A7L A;  1FYC A;  5EKI A;  4NW2 A;  2Z4I A;  2KEE A;  2HCC A;  1Q3L A;  3SXH A;  1RKN A;  1H9S A;  2M00 A;  3HOV B;  4GZY C;  1PRT C;  5M5W B;  1KAB A;  2D62 A;  3GD7 A;  1SJH D;  3M4Y A;  2B2V C;  1BBX C;  5ELE A;  3K7A B;  1JOQ A;  4KKS A;  3FEW X;  1A3U A;  1Z7T A;  4IZ8 A;  2QIL A;  3D4W A;  2XWJ B;  2O4X A;  2EDG A;  3S1R B;  3NWS A;  5C4J B;  1STH A;  2EY2 A;  3K58 A;  1NCV A;  2ZXP A;  2VB3 X;  3DM1 A;  3MXG A;  2XVS A;  2KCN A;  1QE6 A;  1QOH A;  1ML0 D;  4G7O C;  5JVG 3;  1WTO A;  2HDM A;  4WFN 3;  3GTO B;  5T1I A;  4KY6 A;  2L12 A;  1QIL A;  5LL6 S;  3TP8 A;  3RUZ A;  1XYI A;  1TII D;  1D2B A;  1CHP D;  1LTR D;  2E2H B;  3OIQ A;  1PZK D;  2ZT9 C;  4RHR A;  4K6L A;  1JOK A;  3DMU A;  1PTO B;  1SBB B;  3KK7 A;  3I73 A;  1YNJ D;  1V1P A;  4ZKC B;  1FNU A;  3KLS X;  1CK1 A;  3WOF A;  2ENB A;  1G2T A;  2A5H A;  2JA5 B;  3OWE B;  1W6K A;  2ZXR A;  2F4I A;  1EFI D;  3ERO A;  1ONL A;  2D2C C;  4I65 A;  1F9Q A;  1L0Y B;  3AB9 A;  4IFD H;  3J80 L;  5JPN C;  1ET9 A;  3VYT A;  3I72 A;  4PV1 C;  3S1Q B;  4NKL A;  3NWT A;  3G6J B;  1LO5 D;  2N55 A;  3BVZ A;  2F03 A;  3BDL A;  3U9S A;  2EYL A;  2F0E A;  1R4Q B;  5I2X A;  3FRP B;  3WOE A;  1HA5 A;  2BE5 D;  4V0B A;  5C4Z A;  1RJT A;  1D1I A;  5E3F A;  4OO1 H;  2C5C A;  1A15 A;  5J39 A;  3PIP 3;  1RDP D;  3CRK C;  2SNS A;  1SJE D;  1TS4 A;  2B2T A;  3HZX A;  3HGB A;  3D8G A;  5EKK A;  5M9O A;  2PW5 A;  4CHT B;  1WD0 A;  1FNW A;  1I50 B;  4TSS A;  1HPC A;  2A68 D;  1ZEQ X;  1G91 A;  4A3D B;  4K8J A;  2KCC A;  1VDZ A;  3OW7 A;  4A3J B;  2F0O A;  3MFG A;  3VYR A;  3QB3 A;  3SEB A;  3NSW A;  1PZI D;  2IWH A;  2PQE A;  1F2Y A;  3LWE A;  4RWS C;  1I4X A;  2NWG A;  2AWO A;  1EL0 A;  1SDF A;  1Y69 U;  3RMH A;  5JEA J;  2NVX B;  1DXM A;  1ENC A;  4DA2 A;  3NQT A;  2A6H D;  1UEA B;  2PYK A;  4J8Q A;  2K5D A;  5I2Y A;  1D6E C;  2EYP A;  1AZQ A;  3DXJ C;  5K5P A;  2IX1 A;  4DFA A;  1K8O A;  1ET6 A;  2VXW A;  5C4H A;  2F0I A;  2DY7 A;  1HUM A;  2NUC A;  1IL8 A;  2WAC A;  3K59 A;  2IW3 A;  2BA1 A;  2NVQ B;  1LT6 D;  2CQA A;  3AMU A;  3RZO B;  1CZG A;  3GTM B;  2XSC A;  3PO2 B;  3I8Z A;  5I4D A;  5I6Y A;  2FMM A;  5C0X I;  1EYD A;  1OXX K;  1PXU A;  4ZLT F;  1JIC A;  5A35 A;  1WD1 A;  2QKI C;  3Q24 A;  2F0V A;  4K5W A;  1STB A;  3IL8 A;  4ZUI A;  4QCL A;  3NQI A;  4A3G B;  3A54 A;  3NBH A;  5AFW A;  5K36 H;  3DWQ A;  1LTA D;  1SNQ A;  3HP3 A;  3W3A A;  1R9T B;  2KUM A;  1JE4 A;  2JXM B;  2BCO A;  3U9O A;  1I4H A;  1AW7 A;  4WJW A;  2F1M A;  4XQQ A;  2NZ1 D;  3FVQ A;  5DM7 3;  3IFD A;  3VA7 A;  1EY9 A;  5C3E B;  5D65 A;  5IT9 L;  4DAP A;  3A8I E;  1SE2 A;  5FK9 C;  1FR3 A;  1S5F D;  1BCP D;  1B1Z A;  3Q23 A;  3GTQ B;  3CKI B;  4FO2 A;  1A6X A;  3V2T A;  3JAM L;  2EVB A;  2JA7 B;  5I6W A;  3QOL A;  1KDC A;  1CT1 D;  5D14 A;  1JR0 D;  1QCB D;  5EQ0 A;  2L9H A;  2LY7 A;  4M8A A;  2B8G A;  2F3W A;  4RKL A;  2L55 A;  3TZD A;  4OIJ A;  3H94 A;  2AQ3 B;  3NTH A;  3VYU A;  2EJG C;  1LT4 D;  2BA0 A;  3LX0 A;  4LK1 C;  3P1H A;  4G4K A;  1BOS A;  3H6M A;  3S1N B;  2F0J A;  2RKS A;  4EQP A;  2SNM A;  4XT1 B;  1XTC D;  4KHV A;  3PMF A;  5CC4 A;  4OIK A;  5C0X G;  4BS9 A;  4O42 A;  3GTG B;  5CYU A;  2R7Z B;  2K04 A;  5CV7 A;  4J1M A;  1S4Z A;  4HCS A;  4KY7 A;  1FD7 D;  5CMD A;  4UAI A;  2NTS A;  2EJF C;  2F0T A;  2B2U A;  1VF7 A;  4HR7 B;  1B50 A;  4B08 A;  4PQX A;  3MXP A;  3ND8 A;  1EY8 A;  2B8F A;  5KRU A;  1PTO C;  1HHV A;  2WV6 D;  2EYM A;  2SDF A;  5FKA C;  2EY6 A;  5IGC A;  4HCE A;  5HUR A;  3QIA A;  4KD3 A;  2F0P A;  2EZV A;  1FNV A;  1GHJ A;  3SR1 A;  5M3M B;  2FMC A;  1EYC A;  1MSG A;  1AZP A;  3G7L A;  5IGE A;  4H13 C;  4CGY B;  3NP8 A;  1IYU A;  3J7A F;  4I7Z C;  5HGT A;  5FO9 B;  4DN4 M;  3NTK A;  4G7Z C;  2TMP A;  1ZKO A;  2CW0 C;  3KUP A;  3PO3 B;  3OIP A;  4PMW A;  1BDO A;  2JSO A;  4F7X A;  1ZYR C;  4OGQ C;  2NN6 H;  1SMY D;  4HAE A;  1WTR A;  1SE4 A;  1GOZ A;  2M9V A;  1DOL A;  2EYJ A;  3HOU B;  1U9R A;  4HMI A;  4KN4 C;  3KBX A;  3TN2 A;  2A69 C;  3EJI A;  1HQR D;  1A2U A;  3VR2 A;  3R2I A;  1JQY D;  3L7Z C;  2AWN A;  4A3E B;  1TY2 A;  1BCP B;  4ZRZ A;  1CHQ D;  1HFN A;  4N9P A;  3DWA A;  2X69 A;  2B63 B;  3NTI A;  3TP7 A;  1IW7 D;  1SYG A;  2PW7 A;  4IFD I;  4K6D A;  1O78 A;  4BA1 I;  1SYC A;  4A3K B;  1HTL D;  3QO2 A;  4BBS B;  1E2Z A;  1Q1B A;  1NR4 A;  2ZXO A;  4IUU A;  2MJ8 A;  2DY8 A;  2Q8T A;  2K7V A;  2RSO A;  2HDL A;  3L3O C;  1I6V C;  4Z9C B;  5A2Q E;  1UUP A;  4G57 A;  3HEJ A;  3HG9 A;  1S5D D;  4HTH A;  1PFB A;  3T56 B;  2K28 A;  3GTJ B;  2IT1 A;  4OO1 I;  4A3M B;  1VF5 C;  1X3Q A;  4KD4 A;  3NHH A;  3CQZ B;  4C3J G;  1G8Z D;  1Y8O B;  5EPL A;  4BA2 I;  3J7A V;  3BZD B;  1HTP A;  2F0S A;  3KF8 A;  3C3L A;  1QNK A;  3SK6 A;  3S14 B;  1RHP A;  3FPP A;  4NP5 A;  1IYV A;  3D4R A;  1KTK A;  4RAU C;  3T51 B;  1L0X B;  1J8I A;  4LMQ D;  1BCP F;  4CKE A;  1HCZ A;  4A3I B;  1V43 A;  1CA5 A;  3BVG A;  1VMP A;  1UAP A;  3K5O A;  2AUK A;  3T53 B;  1B44 D;  1EIH A;  2K1B A;  1OO9 B;  1SSO A;  2E2J B;  3GO5 A;  2HCI A;  1YNJ C;  1TWF B;  1T5E A;  3MC0 B;  4F87 A;  4X3U A;  1EY0 A;  2ICI A;  3MFY A;  2EYH A;  5CBE E;  1KLU D;  1F9R A;  4IAL A;  1W6J A;  2BDN A;  4DNR B;  3NE5 B;  4KHZ A;  2OEO A;  3IFT A;  1BF4 A;  2I07 B;  4R9W A;  5KYL A;  1ENA A;  3GTK B;  2I46 A;  2PZU A;  1S5E D;  3CU7 A;  2F0G A;  5ELD A;  1SEB D;  1SXT A;  1B3A A;  1I4R A;  4DGZ A;  3QOJ A;  2BE5 C;  4IFD G;  4PMB A;  3L9A X;  5COY A;  3SDZ A;  3DWP A;  2SEB D;  5FO8 B;  1STN A;  1PFN A;  2VUM B;  1I4Q A;  4HMJ A;  2B2T C;  2VB2 X;  1AP0 A;  1ZXT A;  4DF7 A;  4IUP A;  1G6Z A;  2IL8 A;  2J7Z A;  1A3V A;  1LV9 A;  2G9D A;  1JWM D;  2CHB D;  1KDA A;  3ERQ A;  4PMC A;  1TS2 A;  1PYW D;  4FF1 A;  2F0F A;  2OXP A;  4RGO S;  4KJN A;  4XQN A;  4XXE A;  4OO1 G;  4BY7 B;  2A68 C;  4XDX A;  2NB0 A;  1JOR A;  3ND9 A;  3D6C A;  1S5B D;  1TS5 A;  2RDF A;  1SAP A;  4FF2 A;  1EZ6 A;  3TBI B;  4K5V A;  1EWC A;  3S2H B;  1DM0 B;  1H9S B;  2R93 B;  4J6H A;  2LFN A;  2F0W A;  2F0M A;  1KNA A;  4X3K A;  4ULL A;  5EKL A;  3T13 A;  3GV3 A;  2DNC A;  2PCF B;  1K8M A;  1B4O A;  2F0K A;  3HOZ B;  2A6H C;  1PFM A;  1PMR A;  3MHB A;  3QJY A;  2PO4 A;  5FLX E;  4Q0F A;  2JE6 I;  3J81 E;  1F77 A;  4A3B B;  1Z6H A;  2L4N A;  2ICE C;  1EOT A;  2AQ1 B;  1U4R A;  1XX8 A;  2LKV A;  5EPK A;  2C9O A;  2MUY A;  4O1N A;  4KN7 C;  1GUN A;  4AYB B;  1BUV T;  5C0X J;  1F9S A;  1TU2 B;  3N52 A;  2JA6 B;  3NK9 A;  1GHK A;  2K6A A;  5J22 A;  1EY7 A;  2L0C A;  4ZYS A;  3CRL C;  4ZAI A;  3D3R A;  1IKM A;  4IUQ A;  5ELF A;  4HN7 A;  3I91 A;  3AU7 A;  4JBW A;  1EWH A;  1QG7 A;  3R93 A;  1B9M A;  3D31 A;  1V1P B;  4MN3 A;  1MI2 A;  5IGG A;  2EYO A;  5ELC A;  1DCZ A;  1SND A;  1F2Z A;  1Q1E A;  2NVY B;  4B9X A;  4M1U B;  4K2K A;  3IKJ A;  2PPB C;  1OXT A;  5KGU A;  2KQ3 A;  3V05 A;  4C3H G;  4JK1 C;  2B2Y A;  2LS0 1;  1Q12 A;  2EPB A;  1LT5 D;  5DAU A;  5K36 G;  4C1N I;  3M7G A;  1TWH B;  1DYQ A;  1LTB D;  2BOS A;  3KLR A;  3W2D A;  5IGD A;  2PZT A;  4Q5V A;  5NUC A;  3TME A;  2R3Z A;  5C5L A;  3H0G B;  2YYZ A;  1LT3 D;  1O7Y A;  2E2D C;  2AQ2 B;  4FXK C;  4XQJ A;  1IKL A;  1PRT F;  2YU9 B;  1BCP C;  3HOY B;  2VNU D;  2EE1 A;  5JVH 3;  1OXS C;  2XIW A;  4XIG S;  5IGB A;  1STA A;  3FMC A;  4TKO B;  4HED A;  2N88 A;  4PNY A;  2A73 B;  3HKZ B;  1I6H B;  5JJZ A;  2NBF A;  4FXG C;  1ESF A;  3A8K E;  5M3F B;  1ROD A;  2Z8L A;  1MSH A;  4RHS A;  5C5M A;  3PIO 3;  5FOB B;  1A3T A;  1SNC A;  4C3J B;  1M4V A;  3BDC A;  1WCM B;  3TP5 A;  3DEP A;  2A6E D;  4KMU C;  1V1O A;  4FNF A;  4OHJ A;  1TQO A;  1Y1W B;  1C4Q A;  4CJ1 B;  1KAA A;  1WTV A;  3C46 A;  1RF2 D;  2E75 C;  3VR3 A;  4RGM A;  2WII B;  1DOM A;  1G2S A;  3FPU B;  5KNC A;  4ME5 A;  4TQU S;  3SK8 A;  2R92 B;  1YNN D;  1QWY A;  2G9H D;  3GP7 A;  3NBI A;  3E6Z X;  4WRD A;  1AFP A;  2WB1 B;  5JEA H;  3OSO A;  2RDG A;  4R8N A;  1STY A;  2NTT A;  1GUW A;  5ISR A;  1SYF A;  5DM6 3;  1SFO B;  2FHT A;  4NDX A;  5CBA E;  3J80 E;  4Y7N B;  4K14 A;  3K5M A;  5LHY 1;  2KJX A;  1EU4 A;  5BN5 A;  1VMC A;  1SYD A;  4RFB A;  1EQT A;  3KLS A;  3M7N A;  2EYF A;  2J4X A;  4FYD A;  3I70 A;  1B2T A;  3SHL A;  1CTM A;  2E76 C;  3E5S A;  1U4P A;  3S15 B;  1LAC A;  3VYS A;  3VR6 A;  5IIF A;  1TR5 A;  2MGS A;  1F2L A;  2RSN A;  1SMY C;  3OOC A;  1D5Z C;  4FVM A;  4RKB A;  3MAQ A;  4DNT B;  3K6O A;  1HXY D;  2R6G A;  3HOX B;  4ILW A;  2O2L D;  4WOR A;  3RLF A;  4HSP A;  4KK7 A;  4IFD J;  1RCV D;  2NN6 G;  5KIX A;  4CJ0 B;  3LWU A;  4EQN A;  4C2M B;  3NUC A;  5KND A;  2B2W A;  1JCK B;  1IW7 C;  2XWB B;  3BYY B;  2KHS A;  3C2P A;  4CJ2 C;  3DUZ A;  3KBG A;  1GUO A;  2EY1 A;  3TSS A;  3I4N B;  4E6I A;  3OPO A;  1RTN A;  4C3I B;  1TKW B;  3I4L A;  3J7Y W;  1F2M A;  4X3S A;  2EOT A;  1R4P B;  1STG A;  4K5X A;  2OF1 A;  2F0N A;  3PUW A;  1BNZ A;  3RZD B;  2OT2 A;  4S3S A;  3BDO A;  3MWY W;  4BBR B;  1BQQ T;  1ILP A;  5IOD A;  2WIN B;  2FFK B;  2A74 C;  4DK0 A;  2IJ0 A;  4RCN A;  3MZ5 A;  3H09 A;  3R8B A;  4IQZ A;  1RD9 D;  2D9U A;  4QIW B;  1KLG D;  2X6G A;  1V8Q A;  3LNN A;  5I9P A;  1BR9 A;  3I3C A;  5KNB A;  3T16 A;  2MHV A;  3PUY A;  1T5X D;  2E74 C;  3DHQ A;  3H91 A;  1I3Q B;  5E4X A;  1ESR A;  1O80 A;  3Q0A A;  3C1F A;  1MBY A;  5E1F A;  4G7H C;  1AN8 A;  3S2D B;  4ID6 A;  1HUN A;  1A2T A;  2K01 A;  1CQV A;  2K32 A;  1KDB A;  4MHE A;  1M8A A;  5EBC A;  1TWC B;  1PRT D;  4FP5 D;  1LTG D;  3PUX A;  1EY5 A;  4RA8 A;  1HQM C;  4U68 A;  3M3Y B;  4C3H B;  1I4G A;  1D5X C;  2L5T A;  2IPK D;  1WVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...