2KHSA

Solution structure of snase121:snase(111-143) complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title The native-like interactions between SNase121 and SNase(111-143) fragments induce the recovery of their native-like structures and the ability to degrade DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 26
structure length 121
sequence length 121
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2khsA00
1SYFA 1SYDA 1SNOA 2QDBA 1JOKA 3OMCA 3R3OA 2F0NA 5C6AA 5I9PA 3MZ5A 3D4DA 3V2TA 4EQOA 1EYDA 2F0DA 5KYIA 1EY7A 4KD4A 3SK4A 2SNMA 1EY6A 4KJOA 4YIJA 1KDAA 1SYCA 2OXPA 5DAUA 2EY1A 5J1ZA 1NUCA 4NDXA 5KGUA 1STHA 4DU9A 1EY0A 5KEEA 3MHBA 1EY9A 1STGA 3EVQA 4PMBA 1EZ6A 4K5WA 3QOJA 5HURA 2F3VA 5I6YA 5I9OA 3LX0A 5IIFA 5M9OA 4K2LA 2PYKA 4LAAA 1A2TA 3SXHA 3TP5A 2EYLA 3HEJA 5I6WA 4TRDA 2PZWA 1EY4A 4KTAA 5CR3A 3SK5A 3TMEA 5J39A 4DGZA 3NP8A 1TR5A 2F0QA 2EY5A 3OWFA 3P75A 4PMCA 5CV7A 5IOCA 4KV6A 3TP7A 5CGKA 1EZ8A 3HZXA 4HMIA 4KY7A 4OL7A 1JORA 4ZUIA 4NP5A 3EJIA 5CV8A 3C1FA 5IGDA 5EGTA 5IGFA 5KIXA 4S3SA 2EYOA 1II3A 3MEHA 3PMFA 2F0EA 1STYA 2KHSA 2PW5A 3QOLA 2EXZA 4B9XA 4QF4A 4K5VA 4F8MA 4R8NA 4EVOA 5CV6A 1KDBA 4F7XA 5C3XA 5IGGA 1F2YA 3TP6A 5CV9A 3SK6A 3SK8A 5J22A 3VA5A 2F0MA 2PQEA 4HMJA 4ODGA 1A3TA 3BDLA 1KAAA 1RKNA 2F0WA 3H6MA 1KDCA 4PNYA 5C5LA 1EYCA 1ENCA 1EYAA 2F0SA 2PZTA 3NQTA 2F0UA 2WACA 5C3WA 5KYLA 1TT2A 2OF1A 1IHZA 3C1EA 1SNPA 5JOBA 5IGCA 2RKSA 2ENBA 2NUCA 3ITPA 5C5MA 1JOQA 4EQNA 2F0JA 4J6HA 5CC4A 2F0KA 4K5XA 4DFAA 5IODA 3EROA 4H7BA 4K14A 1U9RA 2SOBA 4RKLA 3TP8A 4IUNA 5K5PA 2F0TA 4N9TA 4NMZA 2F0PA 1SYGA 1TQOA 3NXWA 4KY6A 2OEOA 4MIUA 1SNQA 4KY5A 5E1FA 1KABA 2EYMA 2EYHA 1SYEA 2KQ3A 2SNSA 2PW7A 3SHLA 5IGBA 3D4WA 3NUCA 5DEHA 1SYBA 4KHVA 1EY8A 3U9OA 4ZQ3A 5CV5A 4J1MA 3OSOA 4K8IA 2F0IA 2EYJA 1A3VA 2HQEA 2RBMA 3E5SA 3OMGA 3NK9A 3QB3A 1NSNS 4ID6A 4QMGA 3NHHA 4RKBA 5C4ZA 3S9WA 2F0VA 5F2DA 2F0LA 4NKLA 5HGTA 5C4HA 3D8GA 4KJNA 5E3FA 2EYPA 1STNA 4K6DA 2F0GA 2F0OA 4E6IA 2EYFA 5JAVA 4K8JA 5KRUA 4HTHA 3BDCA 4DF7A 1STAA 3RUZA 2F3WA 5ISRA 4I65A 3DHQA 3ERQA 2M00A 4EQPA 2LKVA 1JOOA 4WRDA 5EKKA 4ZUJA 4WORA 4G57A 2F0FA 1F2ZA 3SR1A 3MXPA 3MVVA 4IZ8A 5IGEA 2PZUA 2EY2A 2RDFA 1ENAA 5NUCA 4N9PA 3T16A 1SNDA 4IALA 4ME5A 1STBA 4QB4A 3P1HA 3DMUA 1EY5A 1EQVA 2F0HA 2O4XA 1SNMA 4K2KA 4B9WA 3T13A 1F2MA 1SNCA 1AEXA 1A2UA 2EY6A 4KD3A 5CV4A 1A3UA 5EKLA 3D6CA
chains in the Genus database with same CATH superfamily
3RN5A 1VQ8A 1EY7A 3OTOQ 1H9JA 1I50B 1I94L 2KBNA 3I4NH 4DUZQ 2EY1A 1NUCA 2XWJB 2Z6KC 1TWCH 2HUGA 2VS1A 1PYSB 3J80E 2DGYA 1BBWA 2PZWA 1YITA 1U4RA 1X3GA 4YHHL 2EQSA 2K14A 5JJLA 4HR7B 2UXCQ 3HOXB 3NTHA 1QG7A 2MJ8A 4X3UA 3CQZB 2F0EA 3S1QB 4HEDA 3TZUA 4POGA 2KCNA 1KDBA 4GZYC 2LMCB 2HD3A 4A76A 4N8FA 3VYRA 4JOIC 1VQ5A 1QUQB 3VR4A 2JA5B 2KEDA 2MUYA 3DWQA 4DAYB 4ZAIA 5CBAE 1AFPA 1LTGD 1QUQA 3HG9A 2K52A 1MD2D 4OGQC 4R4QA 2B2UC 2B3GA 3SE0A 4DAYA 3JAMc 3H3VI 5C4XG 1F77A 2Z0SA 1BQQT 2KCTA 1L1OC 3J81c 1S72A 1X3QA 3KLSA 5K5PA 4TQUS 2F0TA 1PYWD 1VDZA 2R92G 1ILPA 2G9HD 4KY6A 3H15A 5D14A 3PO2H 4JV5L 1OXUA 5IGBA 1CK1A 1JJGA 3M9BA 2CCZA 4JI5Q 5LMUL 1UE5A 2DNCA 1WJJA 1A8VA 3S17B 1SE4A 1JICA 1TS5A 1X32A 2MGSA 4GS3A 1STNA 2IPKD 3TREA 4J8QA 4DF7A 5BR8L 2QILA 1MJCA 1NR2A 4BY7B 2ZJQA 4I65A 1W3SA 2EJMA 2WKDA 3HFZB 3S2HB 4HJ8A 1VQOA 2GA4B 3CRLC 2QA4A 3GTMB 1SNDA 2HHHL 3ZJYC 3VR6A 1B1ZA 2RQXA 3CCUA 2OT2A 3ERSX 2Z6KA 3ND9A 3RR5A 2A68D 1YHQA 2XTIA 3HS0C 5EKLA 3MZ5A 4WJ4A 4A3JG 1V9PA 1QZHA 1Y1WG 3G4SA 3RZDH 4V190 3UDXA 1YHAA 5AJ3Q 3RD4A 1HRJA 3KBGA 1S5ED 5KNDA 5IE8A 4IOAA 4DV6Q 3NWTA 5I6WA 1HCZA 4JOIA 1CSPA 2ID0A 3FHWA 3SK5A 2E2IH 3H09A 1K9MC 1AW7A 3WOEA 2N49A 3PGZA 4HAEA 1G291 4M8AA 2KA7A 2RHQB 1UWVA 5L37A 2XIWA 1Q7YC 2O5IC 5CV8A 3C1FA 5IGFA 1L1OB 3CCEA 3W3AA 2Y0SE 2AUKA 4X62L 1VQNA 2EXZA 1HJPA 2VQFL 3L3OC 2K5QA 4DR5Q 4P73A 1JC7A 1L1OA 4LF5L 1XTCD 4C3HG 2IL8A 5GAGC 4LNQA 2F52A 2H1EA 3QJYA 3BDLA 1RKNA 2R93H 2CH4W 1KDCA 4BY1H 1H95A 1NAPA 2HIVA 2NVXH 2UUBL 2K28A 2RKSA 2ENBA 3IKJA 4XT1B 3ICEA 4IFDJ 2NVYB 5TSSA 2KUMA 5A2QL 4KLKA 3BVMA 5LL6S 4A3IH 4A93H 2N55A 2EYMA 2NZ1D 5K36H 4C1NI 2KHIA 2VNUD 3J81j 2AMCB 2R7DA 3OSOA 5FLXc 4DR6L 4UY8C 2K5DA 2XWBB 3T1YQ 1FGBD 3NK9A 4QMGA 1NSNS 1NNXA 3GTLB 4C1NK 4DUYQ 3KFUA 3D8GA 3GDEA 3TBIB 5CORA 1PH6A 2WAQG 3BDCA 1OXXK 1STAA 2PPBC 1KRSA 4JBMA 4APVA 2ZTCA 2JA6H 2LKVA 1JOOA 4A3GH 4G57A 4MN3A 4NB3A 4PZ8A 4B3TL 1NTGA 3GTOH 4CBVA 1XJVA 4C2MB 4B3RQ 1UUPA 1EOTA 4C3HB 3D4RA 1SNCA 2JA8H 2MP1A 2X69A 4DR4L 3OMCA 2UU9L 4B3SL 3M4OB 3VYUA 1IL2A 4JI0Q 4OELB 1BR9A 1FD7D 3QWNA 3NPPA 1KAWA 1SAPA 1D5XC 3NBHB 2XN9C 4C3JH 3CP0A 3S15B 4C3IG 3UDGA 2LXKA 2K5WA 4WJ3M 3NBHA 2MNAA 4LAAA 1PFNA 4TVAB 1E2ZA 1LT3D 4QJFA 1VQLA 2F4IA 4YY3Q 2A73B 3I70A 4KY7A 1E1OA 4OEMB 3GTKB 4A3FB 1ZYRD 4CJ1B 2RSOA 4A3BG 1N8RC 1EFID 2KECA 4F8MA 1HR0W 3I4NB 3JAME 1F2YA 3TDQA 3PO2G 4R9WA 1DOLA 1TWCB 3J81E 2K5NA 1GUTA 2E5LL 1CT1D 3M7GA 5T1IA 1I3QH 1Y8OB 2NZHA 3HRZC 2L12A 2B2TC 3CCSA 4H0LC 2HDLA 1C48A 3C1EA 4POFA 1CSQA 1TWHH 2B2YC 1YNNC 2EVBA 4A3KH 2SOBA 3J80i 3CCLA 3I55A 1NMFA 5M5WH 4DPGA 5E1FA 2A6ED 4A3CG 4JI1L 5C0XG 1I4HA 1VQAA 4P75A 5DEHA 4DV7Q 5M5YH 1VQFA 3TEHB 3NWSA 3RLNA 1XPUA 5C4ZA 2WINB 4X3KA 4N8X1 4H44C 1GXDC 1ENFA 2KOLA 2WFWA 1LTID 4DR1Q 2MPMA 1FJGQ 3IAYA 4RCNA 1RIPA 3T4AC 1PRTD 1K8MA 2PZUA 1RTOA 4ME5A 1STBA 2X6GA 4EX5A 5FLMG 1EQVA 1ET9A 2YU9H 2XVSA 4LFBL 1EQRA 5C0XI 2NN6I 1JWMD 2F0DA 2PCFB 4JW0A 5ELDA 1Z9FA 2I5MX 3KK7A 4MNOA 2J4XA 3DUZA 2IT1A 5IIFA 2K50A 1HNXL 1IBKQ 2R93G 2H5XA 4UDUC 5D3DA 3CD6A 4BY1G 1EZ8A 3HZXA 4X3SA 4ZCKA 2KCMA 2VY3A 3E6ZX 3HOXH 5IGDA 4Y7NH 5G3LD 3WOFA 1Q46A 1E3PA 1IW7D 3S1QH 3I72A 4QGUA 1N9WA 3S1MH 4DR2Q 4EVOA 5IGGA 3RZDB 3KF8B 4GOPC 4A3IG 1XYIA 3MC0B 3KJPA 1Z47A 3RZOH 3M7NA 4A3DH 2Q8TA 4JI3Q 1I6HB 5K36G 4HJ5A 2JA5H 3KF8A 1TU2B 2GN5A 4LWCA 2UUAL 2NTTA 1U4LA 1EYCA 2Q8RE 2E2IB 4DV4L 3AFQA 2R7FA 3IRBA 3AYHB 1IHZA 5JOBA 2A6HC 1K0RA 1SN8A 1LM0A 5FLXE 3MAQA 1JOQA 1KTKA 2YTVA 5IODA 1XWEA 3H0GH 4IPCA 1FNWA 3J80c 2OEOA 1JR0D 1JE4A 1IKMA 5EBCA 3SHLA 1EOVA 3TN2A 3L9AX 4ZYSA 1RF2D 5JVG3 1G8ZD 3QIAA 4OX9Q 2PO4A 4BXXH 4DR3L 4ID6A 3K5OA 3S9WA 1N34L 2BH8A 3S17H 2R93B 4X66L 2D5DA 3OYYA 2JQOA 2F0LA 1ZKOA 5HGTA 1VMCA 4LMQD 1E2VA 4LJZC 4BS9A 4G7ZC 2NVXB 2F0GA 4JBJA 5M3MH 4DNRB 2E2DC 4JBWA 4DV5Q 5ISRA 2CWAA 4MTNA 2M00A 5IWAL 1I4GA 3S2HH 2QKIC 4H13C 2CHBD 5IP7G 1PYBA 4A93B 4C3JG 5NUCA 5CMDA 2D62A 3BG3A 1SE8A 3DEPA 4K2KA 1X56A 1IKLA 4BBRG 3WWVA 2F3IA 4R4IA 2QGQA 3SGIA 5LMNL 1H9SB 5ELFA 1D5MC 4KKTA 1Y69U 3A8IE 3RMHA 1EY6A 1H9SA 5IP9H 2NWGA 4A3MG 3CC2A 1KDAA 1YNXA 5DAUA 4UP7A 2OQ0A 3VA7A 1L0XB 2SDFA 2K5VA 3BZDB 1EU3A 2VZAA 5AFWA 4GOPB 2JA6B 4LW1A 4A3GB 1S5DD 2CQAA 4PMBA 2F3VA 3GTOB 3LX0A 4GOPA 3VR5A 2ZJRA 3HOVH 3TP5A 1R4QB 1CTMA 1IBMQ 3MXUA 2JA8B 3P75A 4BA1I 3H91A 2PW5A 3HOYH 4A3KG 3EBEA 3UI2A 1BCPD 2E2JH 1PZKD 2FXQA 3I3CA 2BE5C 3UDFA 3K6OA 2PQEA 1UAPA 4C3JB 4DV1L 4DA2A 2DN8A 1CZGA 4NW2A 2V4DA 4ME3A 2RF4A 3KDFB 1I4RA 2Q2UA 4JI6L 4LUOA 1XNRQ 1W6JA 5C3WA 2K04A 2D2CC 1IBLQ 1SNPA 1TY2A 3KDFA 1FR3A 2HCCA 5C4JH 2RCNA 3A5ZB 1VQGA 1QCBD 5GQOA 3K57A 4BBSG 2H4OA 3VR3A 1BVSA 4N9TA 3FKIG 3BDOA 2TSSA 1KABA 3HOZG 1V1QA 3N52A 1JB3A 1IXRA 1KNAA 3M3YB 5CV5A 3CC4A 1BXTA 1HA6A 3LWUA 2BH2A 3HOWB 1SE3A 2ASBA 5DM63 3GTLH 3L7ZC 3CCJA 3R2IA 1I3QB 1LUZA 3EA6A 5ELCA 1QNKA 1G2TA 2K01A 2UUCQ 1K3BC 2UXBQ 1HNZQ 3J81i 1MHWC 4O1NA 1TWHB 4RGTA 1S5FD 1MBYA 2K6AA 3KUPA 1HQMC 3ERQA 3KJOA 3OTOL 3CPFA 5M5WB 4KN7C 3MXPA 4RH6A 1N32Q 1ENAA 4RAUC 4DUZL 3T16A 3K5LA 4IO9A 1A15A 4CDFC 1GUWA 1PFBA 2B63H 1GUSA 4HN7A 4IJLA 3KF6B 1AZQA 3GTGB 1SJED 2K32A 1S4ZA 2VXWA 3KF6A 3HOXG 4C56C 3CAMA 4DXFA 1KXLA 1SMXA 1VQ7A 1JB7A 4Q5VA 1SYCA 1QVFA 3L0OA 1TS3A 4NDXA 4FVMA 1RTNA 5EJWA 2I46A 2NTSA 3KLRA 3CCQA 5LL6X 5I6YA 4K2LA 2JA5G 5C0XJ 5J39A 1YIJA 4DGZA 2IWHA 1X3PA 4O0AA 4KHPQ 2K7VA 4IPDA 4ZUIA 3PIPA 1NBWA 3GTKH 2L11A 4A3FH 2K33A 2RCFA 5IYDH 4IOCA 2YYZA 1VQ9A 2C9OA 4DAVA 3IFDA 3H3VC 1L0WA 1RD9D 5J22A 1D2BA 1Q8IA 1DM0B 1UE1A 1L2FA 3HKSA 3N6RA 1KLUD 2B8GA 1EYGA 1A62A 3QO2A 1BNZA 1LT4D 4BXXG 1CKNB 1PH8A 4JI5L 1TT2A 1YNJD 1JMCA 2AHOB 1SSOA 1HNWQ 4UHVA 2DY7A 3K7UC 1BO0A 1CKNA 1HXYD 3U9SA 3K59A 4Y7NB 1U9RA 4LUVA 4BY7G 1Z7TA 2C35B 4JCVE 3S1MB 2BDNA 3S2DH 4JPBW 2ICEC 3RZOB 3SEBA 4A3DB 3MFGA 4AH6A 4PMWA 4K8IA 4J15A 1CA6A 1ASZA 2A69C 2F4VQ 2UXDL 4OO1H 1FL0A 4FF1A 1W6KA 1TWGH 4JI7Q 1RCVD 2EYFA 2VQEQ 3HOUH 2YTXA 3PIO3 1ICFB 3H0GB 1OXTA 2B29A 1FNVA 3J7A5 5EKKA 1B3AA 3BJUA 4O2DA 3A55A 3TQYA 1B44D 2LS01 4PV1C 1HZ9A 4RMFA 1PH5A 1EQQA 2TMPA 1NR4A 1F9QA 2PI2E 4DV6L 1SNOA 2F0NA 5I9PA 3E0EA 4EQOA 3TZDA 4YWKA 5M3MB 1D8LA 3VYTA 5EBDA 2V1CC 5J1ZA 1PFSA 5BN3A 4DU9A 1EY0A 3AQQA 2CQOA 4L5SA 3KOJA 3P20A 4YHHQ 2L5TA 2KVMA 1N36Q 2IY5B 4A3LH 1EY4A 3TMEA 2R61A 2EY5A 2GVAA 2AQ3B 3M85A 1VQDA 4CDEC 4DR7L 2ZXRA 4S3SA 3PMFA 4LF6Q 1YBYA 2AKWB 4QF4A 5C3EH 1DYQA 2J7ZA 1H9RA 1Q1BA 4YWLA 3S16B 1I6HH 4ODGA 1CI3M 2RHSB 4IJHA 2ZXPA 1KQSA 3M4PA 3MEFA 1F9PA 4LUZA 1PH4A 1OTCA 1O7ZA 3HOVB 3H6MA 1B4OA 3K80C 1EYAA 5JPMC 3MXGA 2M2LA 2RDGA 3DEOA 3T1YL 2P5ZX 4I7ZC 4EQNA 1BF4A 2BDOA 4JV5Q 4DUYL 4RKLA 5IT9L 2F0PA 1SYGA 5DM73 3HOYB 2FFKB 1AE3A 2E2JB 2EYHA 1DGSA 2SNSA 2AUJD 2JA7H 4RGMA 2VUMH 1SJHD 4GN4B 3KYHC 3S1NB 3ER0A 1WOCA 4DN4M 4ABNA 2B63G 4X65Q 2CFMA 4V0BA 4LF4Q 4NXNQ 5LMNW 2AQ1B 1VF7A 3EN2A 1BBUA 3MFYA 1NY4A 5C4JB 4JI0L 3PO3H 3DWPA 1K8AC 3C46A 2PMZB 4OWTB 1D7QA 3G6EA 1K73C 3IFTA 4IALA 3NTIA 3HP3A 2CVRA 3JC66 4IURA 1EL0A 1RDPD 2D9UA 4XYQA 1MI2A 1Q81C 1A3UA 1PH3A 3SXHA 1HUMA 2QDBA 1QJOA 2EE1A 4KD4A 4G7HC 1B70B 2NB0A 4A3FG 2QEJC 1X6OA 2Z6BA 5IYDG 1KL9A 2I07B 3TSSA 1I4QA 3I4NG 4QUFA 4JI4L 4YCUA 5H1SE 1Y8PB 3A7AB 3FMCA 3T1HQ 4MHEA 1LTRD 3ONAB 2MQHA 2B63B 3DLLA 1Q82C 5IOCA 3T51B 3F2CA 1F2LA 3J7YW 1R9TH 3BU2A 3J7AV 2XGTA 2RSNA 4RGOS 3F2UA 1WD0A 2KHSA 2JEBI 1SMYD 1M8AA 4AQYQ 1EIHA 1QNUA 2F0MA 3OW7A 1XMQQ 1NE3A 4GKKQ 4P2CB 4CKBA 2UUBQ 4DV3L 3I4MB 1HQRD 2R6GA 5I2XA 2A74C 4RCOA 1Y1VB 5GADC 3A0JA 1XNQQ 3Q6SA 5CC4A 4HIKA 2CW0C 1YVCA 4PQXA 5FO8B 3FEWX 4NMZA 2QCPX 3K7AH 1SNQA 1DCZA 1J9OA 4DR6Q 4DR1L 4LF8L 1TS2A 3M3YH 2B2WA 1QWYA 5A35A 1YJWA 2IX0A 5D3IB 2L0CA 2N88A 2Q2TA 3HOWH 1KRTA 4LFCQ 1HA5A 5M5XH 1GUNA 1DOKA 1O80A 2KENA 2A68C 1GKHA 4LF9Q 2XRQD 3FVQA 2JSOA 4HTHA 3VR2A 1U4MA 5LHY1 1XPRA 4EQPA 2K5HA 1VQIA 3URYA 1JQYD 1V1PB 1G2SA 3I91A 2OTJA 3S2DB 4QB4A 3P1HA 4B3SQ 1N33Q 4IFDH 2E8GA 1V1PA 1GD7A 4KD3A 1OXVA 3GTGH 4U68A 1S5BD 3TS2A 2LFNA 4EGVA 1JOKA 4RFBA 1IBKL 3TRZA 2ALYB 2ZT9C 3KLWA 5JEAH 1KHIA 1TWGB 3SK4A 2O5JC 3HOUB 2Z4HA 4FO2A 1HZAA 3OOCA 1WFQA 4HIMA 1XMOQ 1GHKA 4RA8A 1IYJB 3BVZA 5HURA 2A19A 4XTCS 1LTLA 3FDTA 2FJ2A 3U4ZA 4JI3L 4AIMA 3STBD 3OWFA 4PMCA 2ES2A 1EWHA 1AN8A 3TP7A 4X6AH 2K05A 3I73A 3D6WA 3H94A 1FGUA 4FF3A 4DV2Q 4DK0A 1CKMA 3NSWA 3UE1A 2E2HH 2I5LX 4K5VA 1QOHA 5CV6A 1O7LA 4GNXC 1P16A 5CV9A 1VQHA 3SK8A 4KKUA 1G6PA 1PV4A 4GKJL 3E3XA 4GN3B 1SDFA 1CM9A 1JT8A 3JAML 1RHPA 1E2WA 3TS0A 2QF7A 1KAAA 4O42A 4QQBX 4L6TB 3J81L 1TWAH 1X65A 3LNNA 5KYLA 1XXGA 3M4YA 4JK1C 1AH9A 3GTPB 2F0KA 4FXDA 4QUCA 1J5EQ 4NXMQ 1CHQD 4KY5A 1LV9A 1EIFA 3RN2A 5C3EB 1H9KA 4DV5L 4A93G 3HKZG 3A8JE 1UEBA 1TWFB 4XYOA 3U9OA 3I90A 1CUKA 4KHVA 4ZQ3A 1WTVA 2WB1B 4HCEA 3QB3A 4RKBA 3PUWA 1F9RA 1X55A 5I2YA 2YTYA 4NKLA 3S14H 3NE5B 4KJNA 3ULJA 1JJ2A 1PTOH 4JBKA 1JE5A 4OWXB 1KLGD 2JA6G 4IPHA 1F2ZA 5T1GA 4A3GG 4KMUC 2L4NA 2JA7B 2VUMB 4LFBQ 1B9MA 3S24A 1DD2A 2DJGC 2KJXA 2JA8G 1SYFA 1A6XA 4L63B 1GHJA 5GAHC 3CF5A 1M90C 3Q23A 1F9SA 4BWGB 1DJRD 2E75C 3PO3B 3P7JA 5DNFA 2B2VA 4GNXB 4DAPA 1ZYRC 3H3VH 2Y0SB 3DWAA 3HKZB 4GNXA 3EFXD 1VF5C 2ZM6L 1SE2A 3CKIB 2EYLA 1XX8A 2WP8J 4TRDA 2F0QA 5FO7B 5CGKA 1MKHA 3GTQB 4IN3A 1BOSA 1TVXA 1Q90A 2PQAA 3EJIA 1AZPA 5EGTA 1XNRL 2EYOA 1UE7A 3MEHA 1WI5A 3QOLA 1BDOA 2HIXA 5C44B 4K0KQ 1QZGA 3AB9A 2PNHA 1OO9B 4R1JA 2UUAQ 3S16H 1GVPA 2ZTDA 1VQPA 1PMRA 5FOBB 1HH2P 1A3TA 2A6EC 1P8LA 4G4KA 3HOWG 4ULLA 2FMCA 1K3RA 4HCSA 5C4XH 4P72A 2PNRC 1R9TB 5IGCA 1DXMA 2I0QA 1PTOF 4J6HA 3GD7A 4K5XA 1QB5D 1RJTA 4XQNA 1S3OA 1ZXTA 2XSCA 2UXBL 1TQOA 1HNZL 5FLXL 3VYSA 2JK8A 2D0OA 4LFAQ 3S1NH 4JYAL 1B9NA 1N34Q 1SXTA 1SLJA 2DY8A 2GVBA 3BZCA 1T9HA 1K8GA 4X66Q 1PH2A 1VMPA 1EEID 1PRTC 2EYJA 1N32L 2RBMA 4HIOA 1C4QA 2FMMA 2RVLA 4CKCA 2ICIA 1R4PB 2AWOA 1VS0A 3I8ZA 3Q22A 4LF7Q 1VQKA 4JI2Q 4K6DA 4R4TA 2PMZE 2AQ2B 4JC0A 5JEAG 3K0YA 2Z8LA 4IUVA 3KLSX 4IPGA 1PA6A 2JYOA 1YEZA 4WORA 3K7AB 1VQCA 3W2DA 1Q3LA 1WTHA 3T56B 5IGEA 1O78A 2RDFA 3W5OA 4ZLTF 4CKEA 4DV0Q 3C3LA 3PSIA 3R2TA 1SNMA 1F2MA 1I4PA 1AEXA 4QIWB 3Q8DA 4B3MQ 1CQFA 1ML0D 1XTDA 4OXPA 2EPBA 5M3FB 2WKCA 5M5XB 4PZ6A 3R3OA 4A3JH 3V2TA 3ULLA 2FINB 2SNMA 1Y1WH 4KHPL 2L15A 5E4XA 4P71A 3UE0A 5KGUA 1V8QA 2JJQA 1IW7C 1EZ6A 5JJZA 2LY7A 2Z4IA 1S5CD 4QL5A 1WVLA 3PUVA 2Q2HA 5COYA 1STEA 1FNUA 3FPPA 3CCMA 1DOMA 2B39A 3QG1A 2N8NA 1CKOA 4KV6A 1GJXA 5FO9B 4HIDA 1K8OA 1J8IA 1WCMB 5KIXA 1SFOH 1B2TA 5KNCA 1WTPA 5BN4A 1GUGA 2UXCL 1HNWL 1EQTA 1PTOC 3DXJC 3RLOA 3VA5A 1U5KA 2O2LD 3DM1A 4A3DG 1PRTB 4PG3A 3FRPB 3I4MH 2E74C 1ENCA 2F0SA 4AYBB 2F0UA 2WACA 1Y1VH 4KKSA 4FXKC 4TSSA 4WFN3 1MGSA 4IQZA 1E7ZA 2RDHA 3R93A 3CMAA 4H7BA 3OWEB 2MHVA 4IUNA 1SRUA 3E0JA 3H0GG 4JI7L 3CHBD 3X3MA 3X3NA 2E2HB 3CXCA 1B7YB 4JVZA 2MFIA 2VW9A 1G51A 1VQMA 4Q0FA 4X64Q 2G5DA 1JCKB 1RODA 3OIPA 1C7YA 2F0IA 1MSHA 3NHHA 4PZ7A 1NCVA 4XT3B 3NQIA 4XQJA 1TWAB 4FF2A 5JVH3 3PF4A 3F2BA 2EYPA 2N3SA 1W2BA 4OWWB 3NELA 5JAVA 1HR0Q 5M3MG 1HTPA 4KK7A 1EU4A 2IHEA 1RL2A 3K58A 1ICWA 1MJEA 2C5CA 5HY6A 1U0LA 1VCIA 3DMUA 4ILWA 3VDYA 1X54A 1EWIA 4YCVA 3T13A 5ELNA 1QVCA 2A1AA 1N36L 5C6AA 1I4XA 3S14B 1E1TA 1Q8KA 2R7ZB 2BA0A 3NBIA 5IP9G 1G6ZA 1YI2A 2A8VA 1PTOB 2A5HA 4RHRA 1U4PA 4QY7A 3CMEA 4LF6L 1C9OA 3EVQA 5EPJA 4C3IH 1LT6D 1BCPC 4JI8Q 2X6LA 5I9OA 2NYZD 5AJ3L 4CJ2C 1C0AA 3HEJA 1HUNA 3HOVG 4X3TA 2L9HA 4MZ9A 1QE6A 3A5UA 3S1RH 1I94Q 1NMGA 4LK1C 5IT9E 2CH4A 4FYDA 3AU7A 2ZTEA 4A3BH 3BS1A 1UNSA 3HOYG 1EWCA 4R8NA 1ZEQX 2IHFA 4DR5L 3D3RA 2K4KA 1I6VC 2IJ0A 1B53A 4ZKBB 2CW0D 3T53B 1Q1EA 4X65L 3J80L 5A2QE 4LF4L 4NXNL 3GTPH 2MO1A 2LXJA 3EROA 4OIKA 4BA2I 3NTKA 5EAYA 4A3CH 2WB1E 4B08A 5C0XH 1D6EC 2NN6H 2KQ3A 2L1BA 1TWFH 3NUCA 2UXDQ 1LO5D 4J1MA 3G6JB 4GLAC 1LYLA 4HJ7A 1VQ4A 4M1UB 1V1OA 2CKZB 2F0VA 1YNND 3NEMA 3J7AF 5C4XB 2F0OA 3OPOA 3J7ZC 3GTJH 4A4IA 4ZKCB 1EFWA 1DONA 2R92B 3DHQA 4IUTA 2BOSA 2DJFC 5LMUQ 1NJIC 3B6YA 3SDZA 5FLMH 1BCPB 1PXUA 3D31A 3U58A 2QEXA 1ONLA 3T1HL 1HFGA 4B3RL 3K8AA 2NVTH 1B50A 5BR8Q 3GP7A 4YCWA 3CC7A 3I7FA 4CJ0B 1EIYB 2B2UA 1JWUD 4KJOA 3HKZE 5ELOA 3F2DA 1A63A 4JG2A 2OXPA 2HHHQ 3BYYB 1IL8A 1STHA 3LWEA 3WDNA 2B2WC 3MHBA 1XPOA 2WIIB 1B3QA 1CA5A 4K5WA 1YJ9A 3QOJA 1ESFA 1EUJA 4DNTB 3Q0AA 1E24A 4AQYL 4RGNA 1AE2A 1A2TA 1L0YB 1T5XD 4CDDC 3CRKC 4KTAA 5CR3A 3CCVA 1XMQL 1K83H 4DR7Q 3BZKA 4GKKL 5CV7A 3M4QA 3I4MG 3PIP3 1GOZA 3GTQH 4OL7A 1JORA 1ILQA 1Y1VG 4A3JB 2NVQH 1Q86C 3OW2A 1B8AA 4YY3L 1YNJC 1Y1WB 1I5FA 1XNQL 2VB2X 5C44H 3FP9A 5JEAJ 1G91A 5CBEE 2JXMB 4A75A 3BVGA 3G48A 2F0WA 2PZTA 3U4VA 3AFPA 4X62Q 4LFCL 1ESRA 2VQFQ 1YJNA 2Z9HA 1LLRD 4DFAA 3G71A 2EZVA 1SFOB 3U50C 1TY0A 4LF5Q 4LF9L 2Q2IA 1PZJD 4KI0A 3NXWA 5EQ0A 3PF5A 3QR8A 2EIFA 1HPCA 3CU7A 1SYEA 5KNBA 1YZ6A 2R3ZA 1SYBA 4XDXA 2M9VA 2YV5A 3SVMA 2A6HD 3OMGA 4Z9CB 1N33L 4DNIA 4DV7L 1JJCB 2HDMA 4RG1A 5F2DA 5C4HA 5I4DA 4OO1G 4E6IA 1QVGA 5KRUA 3MWYW 4HJ9A 3HOUG 4GLVB 1LABA 5IP7H 4WRDA 1PH9A 2F0FA 2HQLA 1HFNA 1HZCA 4QIWE 1FJGL 3V05A 3GO5A 2WV6D 3K5MA 3UDIA 5JJKA 4BBRH 1UEAB 4A3EH 1XMOL 1D5ZC 3W1BA 1WTXA 5IYCH 1VQBA 5E4WC 5M3FH 3PQIA 1CQVA 1EYDA 5EPLA 4JI4Q 2WAQB 4A3MH 4B3TQ 3HGBA 3AMUA 1HTLD 4OHJA 4DV2L 5KEEA 1EY9A 3I56A 3V96A 1BUVT 4OO1I 2K1BA 1PHJA 4UPAA 1D1IA 2G9DA 4DKAC 4ZK9B 2UU9Q 1TXYA 4DR4Q 1A0IA 2Q8IB 1VQ6A 4A3LG 1LTAD 2OQKA 3NP8A 4MTKA 1LTSD 4HMIA 4TKOB 2JN4A 1IYUA 1WCMH 4FP5D 4R8IA 4K6LA 2OCEA 4DK1A 2EDGA 2I5HA 1LACA 3A54A 3ZYYX 2EJGC 2QDLA 1PDQA 4UP8A 2NN6G 2Z1CA 5C3EG 1IYVA 4HMJA 4DV3Q 1J5EL 4C3IB 4NXML 2EJFC 3E9HA 4AYBE 4DR2L 1IZ6A 1SEBD 2KEEA 2WB1G 2NBFA 5C5LA 1FYCA 1J6QA 3NQTA 5JPNC 1PLFA 2B8FA 4Y52H 3Q24A 3S1RB 4OIJA 1AP0A 1HZBA 4GLXA 4BBSH 2BE5D 2B2VC 4A3BB 4L5RC 4K14A 3FKIH 4LF8Q 1OXSC 5CYUA 3HOZH 4YWMA 2XRSD 2E5LQ 1T5EA 3PO2B 2N78A 4EQ5A 4CGYB 3D4WA 1D1KA 1WD1A 2JA7G 2VUMG 4HSVA 1A3VA 3E5SA 4QCLA 2F03A 5GAEC 1MIUA 4CDCC 5E3FA 1GM5A 4OX9L 1I50H 3ULPA 5D65A 1GO3E 4IUPA 4R4CA 4JI1Q 1TIID 3RUZA 3K81C 3PO3G 1Y14B 3IL8A 2PI2A 3SR1A 4IZ8A 3MVVA 2Y0SG 2IX1A 4DAMA 3PUYA 2O4XA 1X3EA 5JJIA 3GV6A 2VB3X 3EQLC 2K03A 3CPWA 2EY6A 5CV4A 1SYDA 3PUXA 3D4DA 3RNUA 2B2TA 3CQZH 2HT1A 2D0PA 2R7ZH 4FDBA 4YIJA 3GTJB 5J3BA 4KN4C 5FJ8H 4HJAA 2B2YA 4DK6C 5C44G 4U673 5FKAC 1PRTF 4RWSC 5GROA 4OONA 1WYDA 1LTTD 4DXGA 5M9OA 5IYBH 4K0KL 1SMYC 5FK9C 1LTBD 4UP9A 3RLFA 1SR3A 1DZ1A 1EIGA 2ZJPA 2NVTB 3K5NA 1PTOD 3PUZA 1JWSD 4ALPA 1O7IA 1X9NA 1IBML 3W1GA 4WJWA 2LSSA 1II3A 4GKJQ 4R4OA 2XNAC 1YHBA 1SROA 2DNEA 4RHSA 4F7XA 5C3XA 4NPSA 3PV0A 2AWNA 4UAIA 1ET6A 1HNXQ 3GQBA 2JP1A 3MTSA 4FF4A 1O7YA 4LFAL 2JEAI 4L5QA 4PNYA 3I2ZA 2PQAB 1CFMA 1K83B 4BY1B 2ZXOA 3KBXA 1KD1C 2ATWA 4GN5A 5C5MA 2NUCA 1X3FA 2SEBD 3F8TA 4FNFA 4BY7H 2NVQB 5G3LF 4LF7L 1IBLL 4JI2L 4MIUA 4A3IB 3A56A 3GTMH 2PW7A 5ELBA 1BKBA 1M1KC 1UE6A 2VL6A 1PFMA 1GUOA 3A8KE 1EY8A 5IT9c 3O13A 4DV4Q 1FVIA 2NZOA 4A3EG 2HQEA 4DV0L 5IYCG 4F87A 1H9MA 3EIVA 5M3FG 5E7NA 4B3ML 2HCIA 2KCCA 2R92H 2EOTA 1M4VA 2UUCL 3PCOB 4ZUJA 3PIOA 4DK3C 2A69D 3CCRA 3I4OA 4N9PA 4DR3Q 1Q12A 4KHZA 3DM3A 4L8JA 1EY5A 1KC8C 4B9WA 2IX3A 3LGJA 1A2UA 3BYTB 4IFDG 3D6CA 5EKIA 3STBC 1WCMG 5IWAQ 3I4LA 5DLQE 4XXEA 1HHVA 3R8BA 1PZID 1KIXA 1Y8NB 2ZM6Q 3AEVA 4XQQA 1STGA 4ZRZA 1V43A 3E9IA 2PYKA 5LMNQ 3D0FA 4BBRB 5IY0A 5HGQA 4A3EB 3G7LA 4IUUA 1TR5A 2J0TD 1K0SA 4AYBG 4F88A 1S40A 4NP5A 2JA9A 2NVYH 1KNEA 1WTRA 1STYA 4A3MB 3GV3A 4B9XA 4IFDI 1TS4A 3TP6A 2CWPA 3SK6A 1PH7A 3MA2B 3L2PA 1WTOA 1PH1A 2BCOA 1CZWA 3C2PA 2IW3A 2MO0A 1QILA 4X64L 3JAMi 5EPKA 1TKWB 4L5TA 2F1MA 2OF1A 3ITPA 1VQEA 2F0JA 1EEFD 4HSPA 1WTQA 3FPUB 1E0BA 3OIQA 4A3KB 3OHXC 3TP8A 4JYAQ 4P74A 3A74A 2OWOA 4H02A 4DV1Q 1BCPF 1HR0L 2OTLA 2JE6I 3K0XA 3F1ZA 3NENA 4C2MH 1PVOA 2FHTA 5ELEA 4C3HH 1WTWA 5M5YB 1LT5D 4JI6Q 1Z6HA 5KYIA 2E76C 1ASYA 3M4OH 2EXDA 4FXGC 4IUQA 4K8JA 2F4VL 2R7ZG 3CW2C 2BA1A 1BBXC 2F3WA 2KHJA 4BBSB 3FKIB 3ND8A 2K75A 1C8CA 5FJ8G 1K28A 2RA4A 2VQEL 3HOZB 1CHPD 1E22A 3S15H 2EY2A 4G7OC 3MXNB 4CHTB 2QW7A 2DUDA 2L55A 2F0HA 5IYBG 3A7LA 1SBBB 2YU9B 4I7AA 4XIGS 4JI8L 2WAQE 3MXNA 5BN5A 1MSGA 1VQJA
chains in the Genus database with same CATH topology
1EY7A 1H9JA 1I50B 2EY1A 1NUCA 2XWJB 2HUGA 3J80E 2PZWA 1U4RA 4HR7B 3HOXB 3NTHA 1QG7A 2MJ8A 4X3UA 3CQZB 2F0EA 3S1QB 4HEDA 3TZUA 2KCNA 1KDBA 4GZYC 2LMCB 3VYRA 3VR4A 2JA5B 2KEDA 2MUYA 3DWQA 4ZAIA 5CBAE 1AFPA 1LTGD 3HG9A 1MD2D 4OGQC 4DAYA 2B2UC 3SE0A 1F77A 1BQQT 1X3QA 3KLSA 5K5PA 4TQUS 2F0TA 1PYWD 1VDZA 1ILPA 2G9HD 4KY6A 5D14A 1OXUA 5IGBA 1CK1A 2DNCA 3S17B 1SE4A 1JICA 1TS5A 1X32A 2MGSA 1STNA 2IPKD 4J8QA 4DF7A 2QILA 1NR2A 4BY7B 4I65A 2EJMA 2WKDA 3S2HB 2GA4B 3CRLC 3GTMB 1SNDA 3VR6A 1B1ZA 2RQXA 2OT2A 3ND9A 2A68D 3HS0C 5EKLA 3MZ5A 4V190 3RD4A 1HRJA 3KBGA 1S5ED 5KNDA 3NWTA 5I6WA 1HCZA 3SK5A 2ID0A 3H09A 1AW7A 3WOEA 4HAEA 1G291 4M8AA 2KA7A 2XIWA 2O5IC 5CV8A 3C1FA 5IGFA 3W3AA 2AUKA 2EXZA 3L3OC 2K5QA 1JC7A 1XTCD 4C3HG 2IL8A 2H1EA 3QJYA 3BDLA 1RKNA 1KDCA 1NAPA 2K28A 2RKSA 2ENBA 3IKJA 4XT1B 4IFDJ 2NVYB 5TSSA 2KUMA 5A2QL 3BVMA 5LL6S 2N55A 2EYMA 2NZ1D 5K36H 4C1NI 2VNUD 3OSOA 2K5DA 2XWBB 1FGBD 3NK9A 4QMGA 1NSNS 3GTLB 4C1NK 3D8GA 3TBIB 5CORA 3BDCA 1OXXK 1STAA 2PPBC 2LKVA 1JOOA 4G57A 4MN3A 4CBVA 4C2MB 1UUPA 1EOTA 4C3HB 3D4RA 1SNCA 2MP1A 2X69A 3M4OB 3OMCA 3VYUA 1BR9A 1FD7D 3QWNA 3NPPA 1SAPA 1D5XC 2XN9C 3S15B 4C3IG 2K5WA 3NBHA 4LAAA 1PFNA 1E2ZA 1LT3D 2F4IA 2A73B 3I70A 4KY7A 3GTKB 4A3FB 1ZYRD 4CJ1B 2RSOA 1EFID 2KECA 4F8MA 3I4NB 3JAME 1F2YA 3TDQA 4R9WA 1DOLA 1TWCB 3J81E 1GUTA 1CT1D 3M7GA 5T1IA 1Y8OB 3HRZC 2L12A 2B2TC 4H0LC 2HDLA 1C48A 3C1EA 2B2YC 1YNNC 2EVBA 2SOBA 5E1FA 2A6ED 5C0XG 1I4HA 5DEHA 3NWSA 5C4ZA 2WINB 4X3KA 4H44C 1GXDC 1ENFA 2KOLA 1LTID 2MPMA 3IAYA 4RCNA 3T4AC 1PRTD 1K8MA 2PZUA 1RTOA 4ME5A 1STBA 2X6GA 1EQVA 1ET9A 2XVSA 5C0XI 2NN6I 1JWMD 2F0DA 2PCFB 5ELDA 3KK7A 2J4XA 3DUZA 2IT1A 5IIFA 4UDUC 5D3DA 1EZ8A 3HZXA 4X3SA 3E6ZX 5IGDA 5G3LD 3WOFA 1IW7D 3I72A 4EVOA 5IGGA 3RZDB 1XYIA 3MC0B 1Z47A 3M7NA 2Q8TA 5K36G 1I6HB 3KF8A 1TU2B 2NTTA 1U4LA 1EYCA 2Q8RE 2E2IB 1IHZA 5JOBA 2A6HC 5FLXE 3MAQA 1JOQA 1KTKA 5IODA 1XWEA 1FNWA 2OEOA 1JR0D 1JE4A 1IKMA 5EBCA 3SHLA 3TN2A 3L9AX 4ZYSA 1RF2D 5JVG3 1G8ZD 3QIAA 2PO4A 4ID6A 3K5OA 3S9WA 2R93B 2D5DA 2F0LA 1ZKOA 5HGTA 1VMCA 4LMQD 1E2VA 4LJZC 4BS9A 4G7ZC 2NVXB 2F0GA 4DNRB 2E2DC 4JBWA 5ISRA 2M00A 1I4GA 2QKIC 4H13C 2CHBD 4A93B 4C3JG 5NUCA 5CMDA 2D62A 3BG3A 3DEPA 4K2KA 1IKLA 1H9SB 5ELFA 1D5MC 4KKTA 1Y69U 3A8IE 3RMHA 1EY6A 1H9SA 2NWGA 1KDAA 5DAUA 3VA7A 1L0XB 2SDFA 3BZDB 5AFWA 1EU3A 2JA6B 4A3GB 1S5DD 2CQAA 4PMBA 2F3VA 3GTOB 3LX0A 3VR5A 3TP5A 1R4QB 1CTMA 3MXUA 2JA8B 3P75A 4BA1I 3H91A 2PW5A 3UI2A 1BCPD 1PZKD 3I3CA 2BE5C 3K6OA 2PQEA 1UAPA 4C3JB 4DA2A 2DN8A 1CZGA 4NW2A 2V4DA 1I4RA 1W6JA 5C3WA 2K04A 2D2CC 1SNPA 1TY2A 1FR3A 2HCCA 1QCBD 3K57A 2H4OA 3VR3A 4N9TA 3BDOA 2TSSA 1KABA 3N52A 1JB3A 1KNAA 3M3YB 5CV5A 1BXTA 1HA6A 3LWUA 3HOWB 1SE3A 5DM63 3L7ZC 3R2IA 1I3QB 3EA6A 5ELCA 1QNKA 1G2TA 2K01A 4O1NA 1TWHB 4RGTA 1S5FD 1MBYA 2K6AA 3KUPA 1HQMC 3ERQA 5M5WB 4KN7C 3MXPA 4RH6A 1ENAA 4RAUC 3T16A 3K5LA 1A15A 1GUWA 1PFBA 1GUSA 4HN7A 1AZQA 3GTGB 1SJED 2K32A 1S4ZA 2VXWA 4C56C 4DXFA 4Q5VA 1SYCA 1TS3A 4NDXA 4FVMA 1RTNA 5EJWA 2I46A 2NTSA 3KLRA 5LL6X 5I6YA 4K2LA 5C0XJ 5J39A 4DGZA 2IWHA 1X3PA 2K7VA 4ZUIA 2L11A 2K33A 2YYZA 2C9OA 4DAVA 3IFDA 3H3VC 1RD9D 5J22A 1D2BA 1Q8IA 1DM0B 1KLUD 3N6RA 2B8GA 3QO2A 1BNZA 1LT4D 1TT2A 1YNJD 1SSOA 2DY7A 1BO0A 1HXYD 3U9SA 3K59A 4Y7NB 1U9RA 1Z7TA 3S1MB 2BDNA 2ICEC 3RZOB 3SEBA 4A3DB 3MFGA 4PMWA 4K8IA 1CA6A 2A69C 4OO1H 4FF1A 1W6KA 1RCVD 2EYFA 3PIO3 3H0GB 1OXTA 1FNVA 5EKKA 1B3AA 3A55A 1B44D 2LS01 4PV1C 2TMPA 1NR4A 1F9QA 1SNOA 2F0NA 5I9PA 4EQOA 3TZDA 5M3MB 3VYTA 5EBDA 5J1ZA 5BN3A 4DU9A 1EY0A 3P20A 2L5TA 2KVMA 1EY4A 3TMEA 2R61A 2EY5A 2AQ3B 3M85A 2ZXRA 4S3SA 3PMFA 4QF4A 1DYQA 2J7ZA 1H9RA 1Q1BA 3S16B 4ODGA 1CI3M 2ZXPA 1F9PA 1O7ZA 3HOVB 3H6MA 1B4OA 1EYAA 5JPMC 3MXGA 2M2LA 2RDGA 3DEOA 4I7ZC 4EQNA 1BF4A 2BDOA 4RKLA 5IT9L 2F0PA 1SYGA 5DM73 3HOYB 2FFKB 2E2JB 2EYHA 2SNSA 2AUJD 4RGMA 3S1NB 1SJHD 4DN4M 4ABNA 4V0BA 2AQ1B 1VF7A 3MFYA 5C4JB 3DWPA 3C46A 2PMZB 3IFTA 4IALA 3NTIA 3HP3A 2CVRA 4IURA 1EL0A 1RDPD 2D9UA 4XYQA 1MI2A 1A3UA 3SXHA 1HUMA 2QDBA 1QJOA 2EE1A 4KD4A 4G7HC 2NB0A 2QEJC 2I07B 3TSSA 1I4QA 4QUFA 1Y8PB 3A7AB 3FMCA 4MHEA 1LTRD 3ONAB 2B63B 5IOCA 3T51B 1F2LA 3J7YW 3J7AV 2RSNA 4RGOS 3F2UA 1WD0A 2KHSA 2JEBI 1SMYD 1M8AA 1EIHA 1QNUA 2F0MA 3OW7A 4P2CB 4CKBA 3I4MB 1HQRD 2R6GA 5I2XA 2A74C 4RCOA 1Y1VB 3Q6SA 5CC4A 2CW0C 4PQXA 5FO8B 3FEWX 4NMZA 2QCPX 1SNQA 1DCZA 1J9OA 1TS2A 2B2WA 1QWYA 5A35A 2IX0A 5D3IB 2L0CA 2N88A 1HA5A 1GUNA 1DOKA 1O80A 2A68C 2XRQD 3FVQA 2JSOA 4HTHA 3VR2A 1U4MA 5LHY1 4EQPA 3URYA 1JQYD 1V1PB 1G2SA 3I91A 3S2DB 4QB4A 3P1HA 4IFDH 1V1PA 4KD3A 1OXVA 4U68A 1S5BD 2LFNA 4EGVA 1JOKA 4RFBA 2ZT9C 5JEAH 1TWGB 3SK4A 2O5JC 3HOUB 2Z4HA 4FO2A 3OOCA 1GHKA 4RA8A 3BVZA 5HURA 4XTCS 3FDTA 2FJ2A 3OWFA 4PMCA 1EWHA 1AN8A 3TP7A 2K05A 3I73A 3D6WA 3H94A 4FF3A 4DK0A 3NSWA 4K5VA 1QOHA 5CV6A 1O7LA 5CV9A 3SK8A 4KKUA 1SDFA 1CM9A 3JAML 1RHPA 1E2WA 2QF7A 1KAAA 4O42A 4L6TB 3J81L 3LNNA 5KYLA 1XXGA 3M4YA 4JK1C 3GTPB 2F0KA 4FXDA 4QUCA 1CHQD 4KY5A 1LV9A 5C3EB 1H9KA 3A8JE 1TWFB 4XYOA 3U9OA 3I90A 4KHVA 4ZQ3A 1WTVA 2WB1B 4HCEA 3QB3A 4RKBA 3PUWA 1F9RA 5I2YA 4NKLA 3NE5B 4KJNA 1PTOH 1KLGD 1F2ZA 5T1GA 4KMUC 2L4NA 2JA7B 2VUMB 1B9MA 1DD2A 2KJXA 1SYFA 1A6XA 4L63B 1GHJA 3Q23A 1F9SA 4BWGB 1DJRD 2E75C 3PO3B 3P7JA 5DNFA 2B2VA 4DAPA 1ZYRC 2Y0SB 3DWAA 3HKZB 3EFXD 1VF5C 1SE2A 3CKIB 2EYLA 1XX8A 2WP8J 4TRDA 2F0QA 5FO7B 5CGKA 3GTQB 4IN3A 1BOSA 1TVXA 1Q90A 3EJIA 1AZPA 5EGTA 2EYOA 3MEHA 3QOLA 1BDOA 5C44B 3AB9A 1OO9B 1PMRA 5FOBB 1A3TA 2A6EC 4G4KA 4ULLA 2FMCA 4HCSA 2PNRC 1R9TB 5IGCA 1DXMA 1PTOF 4J6HA 3GD7A 4K5XA 1QB5D 1RJTA 4XQNA 1ZXTA 2XSCA 1TQOA 5FLXL 3VYSA 1B9NA 1SXTA 2DY8A 1VMPA 1EEID 1PRTC 2EYJA 2RBMA 1C4QA 2FMMA 2RVLA 4CKCA 2ICIA 1R4PB 2AWOA 3I8ZA 3Q22A 4K6DA 2AQ2B 5JEAG 3K0YA 2Z8LA 4IUVA 3KLSX 2JYOA 4WORA 3K7AB 3W2DA 1Q3LA 3T56B 5IGEA 1O78A 2RDFA 4ZLTF 4CKEA 3C3LA 3R2TA 1SNMA 1F2MA 1I4PA 1AEXA 4QIWB 1CQFA 1ML0D 2EPBA 5M3FB 2WKCA 5M5XB 3R3OA 3V2TA 2FINB 2SNMA 5E4XA 5KGUA 1V8QA 1IW7C 1EZ6A 5JJZA 2LY7A 2Z4IA 1S5CD 1WVLA 3PUVA 5COYA 1STEA 1FNUA 3FPPA 1DOMA 2B39A 3QG1A 4KV6A 1GJXA 5FO9B 1K8OA 1J8IA 1WCMB 5KIXA 1B2TA 5KNCA 1WTPA 5BN4A 1GUGA 1EQTA 1PTOC 3DXJC 3VA5A 2O2LD 3DM1A 1PRTB 3FRPB 2E74C 1ENCA 2F0SA 4AYBB 2F0UA 2WACA 4KKSA 4WFN3 4FXKC 4TSSA 1MGSA 4IQZA 2RDHA 3R93A 4H7BA 3OWEB 2MHVA 4IUNA 3E0JA 3CHBD 3X3MA 3X3NA 2E2HB 4Q0FA 1JCKB 1RODA 3OIPA 2F0IA 1MSHA 3NHHA 1NCVA 4XT3B 3NQIA 4XQJA 1TWAB 4FF2A 5JVH3 2EYPA 5JAVA 1HTPA 4KK7A 1EU4A 3K58A 1ICWA 2C5CA 1VCIA 3DMUA 4ILWA 3T13A 5C6AA 1I4XA 3S14B 2R7ZB 2BA0A 3NBIA 1G6ZA 1PTOB 2A5HA 4RHRA 1U4PA 3EVQA 5EPJA 1LT6D 1BCPC 5I9OA 2X6LA 2NYZD 4CJ2C 3HEJA 1HUNA 4X3TA 2L9HA 1QE6A 4LK1C 5IT9E 4FYDA 3AU7A 3BS1A 1UNSA 1EWCA 4R8NA 1ZEQX 3D3RA 1I6VC 2IJ0A 1B53A 4ZKBB 2CW0D 3T53B 1Q1EA 3J80L 5A2QE 3EROA 4OIKA 4BA2I 3NTKA 4B08A 5C0XH 1D6EC 2NN6H 2KQ3A 2L1BA 3NUCA 1LO5D 4J1MA 3G6JB 4M1UB 1V1OA 2F0VA 1YNND 3J7AF 5C4XB 2F0OA 3OPOA 4ZKCB 1DONA 2R92B 3DHQA 4IUTA 2BOSA 3SDZA 1BCPB 1PXUA 3D31A 1ONLA 1HFGA 1B50A 3GP7A 4CJ0B 2B2UA 1JWUD 4KJOA 2OXPA 3BYYB 1IL8A 1STHA 3LWEA 3WDNA 2B2WC 3MHBA 2WIIB 1CA5A 4K5WA 3QOJA 1ESFA 4DNTB 3Q0AA 4RGNA 1A2TA 1L0YB 1T5XD 3CRKC 4KTAA 5CR3A 5CV7A 3PIP3 1GOZA 4OL7A 1JORA 1ILQA 4A3JB 1YNJC 1Y1WB 2VB2X 5JEAJ 1G91A 5CBEE 2JXMB 3BVGA 2F0WA 2PZTA 1ESRA 1LLRD 4DFAA 2EZVA 1SFOB 1TY0A 4KI0A 1PZJD 5EQ0A 3NXWA 1HPCA 3CU7A 1SYEA 5KNBA 2R3ZA 1SYBA 4XDXA 2M9VA 3SVMA 2A6HD 3OMGA 4Z9CB 2HDMA 5F2DA 5C4HA 5I4DA 4OO1G 4E6IA 5KRUA 3MWYW 1LABA 4WRDA 2F0FA 1HFNA 3V05A 3GO5A 2WV6D 3K5MA 1UEAB 1D5ZC 1WTXA 5E4WC 1CQVA 1EYDA 5EPLA 2WAQB 3HGBA 3AMUA 1HTLD 4OHJA 5KEEA 1EY9A 3V96A 1BUVT 4OO1I 2K1BA 1D1IA 2G9DA 4ZK9B 2Q8IB 1LTAD 3NP8A 1LTSD 4HMIA 4TKOB 1IYUA 4R8IA 4FP5D 4K6LA 4DK1A 2EDGA 1LACA 3A54A 3ZYYX 2EJGC 1PDQA 2NN6G 2Z1CA 1IYVA 4HMJA 4C3IB 2EJFC 1SEBD 2KEEA 2NBFA 5C5LA 1FYCA 3NQTA 5JPNC 1PLFA 2B8FA 3Q24A 3S1RB 4OIJA 1AP0A 2BE5D 2B2VC 4A3BB 4K14A 1OXSC 5CYUA 2XRSD 1T5EA 3PO2B 4CGYB 1D1KA 3D4WA 1WD1A 4HSVA 1A3VA 3E5SA 4QCLA 2F03A 5E3FA 5D65A 4IUPA 3RUZA 1TIID 3IL8A 3SR1A 4IZ8A 3MVVA 2IX1A 3PUYA 2O4XA 3GV6A 2VB3X 3EQLC 2K03A 2EY6A 5CV4A 1SYDA 3PUXA 3D4DA 2B2TA 4YIJA 3GTJB 4KN4C 2B2YA 4U673 5FKAC 1PRTF 4RWSC 4DXGA 1LTTD 5M9OA 1SMYC 5FK9C 1LTBD 3RLFA 1DZ1A 1EIGA 2NVTB 3K5NA 1PTOD 3PUZA 1JWSD 4WJWA 1II3A 2XNAC 2DNEA 4RHSA 4F7XA 5C3XA 3PV0A 2AWNA 4UAIA 1ET6A 3GQBA 2JP1A 3MTSA 4FF4A 1O7YA 2JEAI 4PNYA 1CFMA 1K83B 4BY1B 2ZXOA 3KBXA 5C5MA 2NUCA 2SEBD 4FNFA 2NVQB 5G3LF 4MIUA 4A3IB 3A56A 2PW7A 5ELBA 1PFMA 1GUOA 3A8KE 1EY8A 3O13A 2HQEA 4F87A 1H9MA 2HCIA 2KCCA 2EOTA 1M4VA 4ZUJA 2A69D 4N9PA 1Q12A 4KHZA 4L8JA 1EY5A 4B9WA 2IX3A 1A2UA 3BYTB 4IFDG 3D6CA 5EKIA 3I4LA 4XXEA 1HHVA 3R8BA 1PZID 1Y8NB 4XQQA 1STGA 4ZRZA 1V43A 2PYKA 4BBRB 4A3EB 3G7LA 4IUUA 1TR5A 2J0TD 4F88A 4NP5A 1KNEA 1WTRA 1STYA 4A3MB 3GV3A 4B9XA 4IFDI 1TS4A 3TP6A 3SK6A 3MA2B 1WTOA 2BCOA 1CZWA 3C2PA 2IW3A 1QILA 5EPKA 1TKWB 2F1MA 2OF1A 3ITPA 2F0JA 1EEFD 4HSPA 1WTQA 3FPUB 1E0BA 3OIQA 4A3KB 3OHXC 3TP8A 1BCPF 2JE6I 2FHTA 5ELEA 1WTWA 5M5YB 1LT5D 1Z6HA 5KYIA 2E76C 4FXGC 4IUQA 4K8JA 4BBSB 2BA1A 1BBXC 2F3WA 3FKIB 3ND8A 1C8CA 2RA4A 3HOZB 1CHPD 2EY2A 4G7OC 4CHTB 2L55A 2F0HA 3A7LA 1SBBB 2YU9B 4XIGS 3MXNA 5BN5A 1MSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYF A;  1SYD A;  1SNO A;  2QDB A;  1JOK A;  3OMC A;  3R3O A;  2F0N A;  5C6A A;  5I9P A;  3MZ5 A;  3D4D A;  3V2T A;  4EQO A;  1EYD A;  2F0D A;  5KYI A;  1EY7 A;  4KD4 A;  3SK4 A;  2SNM A;  1EY6 A;  4KJO A;  4YIJ A;  1KDA A;  1SYC A;  2OXP A;  5DAU A;  2EY1 A;  5J1Z A;  1NUC A;  4NDX A;  5KGU A;  1STH A;  4DU9 A;  1EY0 A;  5KEE A;  3MHB A;  1EY9 A;  1STG A;  3EVQ A;  4PMB A;  1EZ6 A;  4K5W A;  3QOJ A;  5HUR A;  2F3V A;  5I6Y A;  5I9O A;  3LX0 A;  5IIF A;  5M9O A;  4K2L A;  2PYK A;  4LAA A;  1A2T A;  3SXH A;  3TP5 A;  2EYL A;  3HEJ A;  5I6W A;  4TRD A;  2PZW A;  1EY4 A;  4KTA A;  5CR3 A;  3SK5 A;  3TME A;  5J39 A;  4DGZ A;  3NP8 A;  1TR5 A;  2F0Q A;  2EY5 A;  3OWF A;  3P75 A;  4PMC A;  5CV7 A;  5IOC A;  4KV6 A;  3TP7 A;  5CGK A;  1EZ8 A;  3HZX A;  4HMI A;  4KY7 A;  4OL7 A;  1JOR A;  4ZUI A;  4NP5 A;  3EJI A;  5CV8 A;  3C1F A;  5IGD A;  5EGT A;  5IGF A;  5KIX A;  4S3S A;  2EYO A;  1II3 A;  3MEH A;  3PMF A;  2F0E A;  1STY A;  2KHS A;  2PW5 A;  3QOL A;  2EXZ A;  4B9X A;  4QF4 A;  4K5V A;  4F8M A;  4R8N A;  4EVO A;  5CV6 A;  1KDB A;  4F7X A;  5C3X A;  5IGG A;  1F2Y A;  3TP6 A;  5CV9 A;  3SK6 A;  3SK8 A;  5J22 A;  3VA5 A;  2F0M A;  2PQE A;  4HMJ A;  4ODG A;  1A3T A;  3BDL A;  1KAA A;  1RKN A;  2F0W A;  3H6M A;  1KDC A;  4PNY A;  5C5L A;  1EYC A;  1ENC A;  1EYA A;  2F0S A;  2PZT A;  3NQT A;  2F0U A;  2WAC A;  5C3W A;  5KYL A;  1TT2 A;  2OF1 A;  1IHZ A;  3C1E A;  1SNP A;  5JOB A;  5IGC A;  2RKS A;  2ENB A;  2NUC A;  3ITP A;  5C5M A;  1JOQ A;  4EQN A;  2F0J A;  4J6H A;  5CC4 A;  2F0K A;  4K5X A;  4DFA A;  5IOD A;  3ERO A;  4H7B A;  4K14 A;  1U9R A;  2SOB A;  4RKL A;  3TP8 A;  4IUN A;  5K5P A;  2F0T A;  4N9T A;  4NMZ A;  2F0P A;  1SYG A;  1TQO A;  3NXW A;  4KY6 A;  2OEO A;  4MIU A;  1SNQ A;  4KY5 A;  5E1F A;  1KAB A;  2EYM A;  2EYH A;  1SYE A;  2KQ3 A;  2SNS A;  2PW7 A;  3SHL A;  5IGB A;  3D4W A;  3NUC A;  5DEH A;  1SYB A;  4KHV A;  1EY8 A;  3U9O A;  4ZQ3 A;  5CV5 A;  4J1M A;  3OSO A;  4K8I A;  2F0I A;  2EYJ A;  1A3V A;  2HQE A;  2RBM A;  3E5S A;  3OMG A;  3NK9 A;  3QB3 A;  1NSN S;  4ID6 A;  4QMG A;  3NHH A;  4RKB A;  5C4Z A;  3S9W A;  2F0V A;  5F2D A;  2F0L A;  4NKL A;  5HGT A;  5C4H A;  3D8G A;  4KJN A;  5E3F A;  2EYP A;  1STN A;  4K6D A;  2F0G A;  2F0O A;  4E6I A;  2EYF A;  5JAV A;  4K8J A;  5KRU A;  4HTH A;  3BDC A;  4DF7 A;  1STA A;  3RUZ A;  2F3W A;  5ISR A;  4I65 A;  3DHQ A;  3ERQ A;  2M00 A;  4EQP A;  2LKV A;  1JOO A;  4WRD A;  5EKK A;  4ZUJ A;  4WOR A;  4G57 A;  2F0F A;  1F2Z A;  3SR1 A;  3MXP A;  3MVV A;  4IZ8 A;  5IGE A;  2PZU A;  2EY2 A;  2RDF A;  1ENA A;  5NUC A;  4N9P A;  3T16 A;  1SND A;  4IAL A;  4ME5 A;  1STB A;  4QB4 A;  3P1H A;  3DMU A;  1EY5 A;  1EQV A;  2F0H A;  2O4X A;  1SNM A;  4K2K A;  4B9W A;  3T13 A;  1F2M A;  1SNC A;  1AEX A;  1A2U A;  2EY6 A;  4KD3 A;  5CV4 A;  1A3U A;  5EKL A;  3D6C A; 
#chains in the Genus database with same CATH topology
 3RN5 A;  1VQ8 A;  1EY7 A;  3OTO Q;  1H9J A;  1I50 B;  1I94 L;  2KBN A;  3I4N H;  4DUZ Q;  2EY1 A;  1NUC A;  2XWJ B;  2Z6K C;  1TWC H;  2HUG A;  2VS1 A;  1PYS B;  3J80 E;  2DGY A;  1BBW A;  2PZW A;  1YIT A;  1U4R A;  1X3G A;  4YHH L;  2EQS A;  2K14 A;  5JJL A;  4HR7 B;  2UXC Q;  3HOX B;  3NTH A;  1QG7 A;  2MJ8 A;  4X3U A;  3CQZ B;  2F0E A;  3S1Q B;  4HED A;  3TZU A;  4POG A;  2KCN A;  1KDB A;  4GZY C;  2LMC B;  2HD3 A;  4A76 A;  4N8F A;  3VYR A;  4JOI C;  1VQ5 A;  1QUQ B;  3VR4 A;  2JA5 B;  2KED A;  2MUY A;  3DWQ A;  4DAY B;  4ZAI A;  5CBA E;  1AFP A;  1LTG D;  1QUQ A;  3HG9 A;  2K52 A;  1MD2 D;  4OGQ C;  4R4Q A;  2B2U C;  2B3G A;  3SE0 A;  4DAY A;  3JAM c;  3H3V I;  5C4X G;  1F77 A;  2Z0S A;  1BQQ T;  2KCT A;  1L1O C;  3J81 c;  1S72 A;  1X3Q A;  3KLS A;  5K5P A;  4TQU S;  2F0T A;  1PYW D;  1VDZ A;  2R92 G;  1ILP A;  2G9H D;  4KY6 A;  3H15 A;  5D14 A;  3PO2 H;  4JV5 L;  1OXU A;  5IGB A;  1CK1 A;  1JJG A;  3M9B A;  2CCZ A;  4JI5 Q;  5LMU L;  1UE5 A;  2DNC A;  1WJJ A;  1A8V A;  3S17 B;  1SE4 A;  1JIC A;  1TS5 A;  1X32 A;  2MGS A;  4GS3 A;  1STN A;  2IPK D;  3TRE A;  4J8Q A;  4DF7 A;  5BR8 L;  2QIL A;  1MJC A;  1NR2 A;  4BY7 B;  2ZJQ A;  4I65 A;  1W3S A;  2EJM A;  2WKD A;  3HFZ B;  3S2H B;  4HJ8 A;  1VQO A;  2GA4 B;  3CRL C;  2QA4 A;  3GTM B;  1SND A;  2HHH L;  3ZJY C;  3VR6 A;  1B1Z A;  2RQX A;  3CCU A;  2OT2 A;  3ERS X;  2Z6K A;  3ND9 A;  3RR5 A;  2A68 D;  1YHQ A;  2XTI A;  3HS0 C;  5EKL A;  3MZ5 A;  4WJ4 A;  4A3J G;  1V9P A;  1QZH A;  1Y1W G;  3G4S A;  3RZD H;  4V19 0;  3UDX A;  1YHA A;  5AJ3 Q;  3RD4 A;  1HRJ A;  3KBG A;  1S5E D;  5KND A;  5IE8 A;  4IOA A;  4DV6 Q;  3NWT A;  5I6W A;  1HCZ A;  4JOI A;  1CSP A;  2ID0 A;  3FHW A;  3SK5 A;  2E2I H;  3H09 A;  1K9M C;  1AW7 A;  3WOE A;  2N49 A;  3PGZ A;  4HAE A;  1G29 1;  4M8A A;  2KA7 A;  2RHQ B;  1UWV A;  5L37 A;  2XIW A;  1Q7Y C;  2O5I C;  5CV8 A;  3C1F A;  5IGF A;  1L1O B;  3CCE A;  3W3A A;  2Y0S E;  2AUK A;  4X62 L;  1VQN A;  2EXZ A;  1HJP A;  2VQF L;  3L3O C;  2K5Q A;  4DR5 Q;  4P73 A;  1JC7 A;  1L1O A;  4LF5 L;  1XTC D;  4C3H G;  2IL8 A;  5GAG C;  4LNQ A;  2F52 A;  2H1E A;  3QJY A;  3BDL A;  1RKN A;  2R93 H;  2CH4 W;  1KDC A;  4BY1 H;  1H95 A;  1NAP A;  2HIV A;  2NVX H;  2UUB L;  2K28 A;  2RKS A;  2ENB A;  3IKJ A;  4XT1 B;  3ICE A;  4IFD J;  2NVY B;  5TSS A;  2KUM A;  5A2Q L;  4KLK A;  3BVM A;  5LL6 S;  4A3I H;  4A93 H;  2N55 A;  2EYM A;  2NZ1 D;  5K36 H;  4C1N I;  2KHI A;  2VNU D;  3J81 j;  2AMC B;  2R7D A;  3OSO A;  5FLX c;  4DR6 L;  4UY8 C;  2K5D A;  2XWB B;  3T1Y Q;  1FGB D;  3NK9 A;  4QMG A;  1NSN S;  1NNX A;  3GTL B;  4C1N K;  4DUY Q;  3KFU A;  3D8G A;  3GDE A;  3TBI B;  5COR A;  1PH6 A;  2WAQ G;  3BDC A;  1OXX K;  1STA A;  2PPB C;  1KRS A;  4JBM A;  4APV A;  2ZTC A;  2JA6 H;  2LKV A;  1JOO A;  4A3G H;  4G57 A;  4MN3 A;  4NB3 A;  4PZ8 A;  4B3T L;  1NTG A;  3GTO H;  4CBV A;  1XJV A;  4C2M B;  4B3R Q;  1UUP A;  1EOT A;  4C3H B;  3D4R A;  1SNC A;  2JA8 H;  2MP1 A;  2X69 A;  4DR4 L;  3OMC A;  2UU9 L;  4B3S L;  3M4O B;  3VYU A;  1IL2 A;  4JI0 Q;  4OEL B;  1BR9 A;  1FD7 D;  3QWN A;  3NPP A;  1KAW A;  1SAP A;  1D5X C;  3NBH B;  2XN9 C;  4C3J H;  3CP0 A;  3S15 B;  4C3I G;  3UDG A;  2LXK A;  2K5W A;  4WJ3 M;  3NBH A;  2MNA A;  4LAA A;  1PFN A;  4TVA B;  1E2Z A;  1LT3 D;  4QJF A;  1VQL A;  2F4I A;  4YY3 Q;  2A73 B;  3I70 A;  4KY7 A;  1E1O A;  4OEM B;  3GTK B;  4A3F B;  1ZYR D;  4CJ1 B;  2RSO A;  4A3B G;  1N8R C;  1EFI D;  2KEC A;  4F8M A;  1HR0 W;  3I4N B;  3JAM E;  1F2Y A;  3TDQ A;  3PO2 G;  4R9W A;  1DOL A;  1TWC B;  3J81 E;  2K5N A;  1GUT A;  2E5L L;  1CT1 D;  3M7G A;  5T1I A;  1I3Q H;  1Y8O B;  2NZH A;  3HRZ C;  2L12 A;  2B2T C;  3CCS A;  4H0L C;  2HDL A;  1C48 A;  3C1E A;  4POF A;  1CSQ A;  1TWH H;  2B2Y C;  1YNN C;  2EVB A;  4A3K H;  2SOB A;  3J80 i;  3CCL A;  3I55 A;  1NMF A;  5M5W H;  4DPG A;  5E1F A;  2A6E D;  4A3C G;  4JI1 L;  5C0X G;  1I4H A;  1VQA A;  4P75 A;  5DEH A;  4DV7 Q;  5M5Y H;  1VQF A;  3TEH B;  3NWS A;  3RLN A;  1XPU A;  5C4Z A;  2WIN B;  4X3K A;  4N8X 1;  4H44 C;  1GXD C;  1ENF A;  2KOL A;  2WFW A;  1LTI D;  4DR1 Q;  2MPM A;  1FJG Q;  3IAY A;  4RCN A;  1RIP A;  3T4A C;  1PRT D;  1K8M A;  2PZU A;  1RTO A;  4ME5 A;  1STB A;  2X6G A;  4EX5 A;  5FLM G;  1EQV A;  1ET9 A;  2YU9 H;  2XVS A;  4LFB L;  1EQR A;  5C0X I;  2NN6 I;  1JWM D;  2F0D A;  2PCF B;  4JW0 A;  5ELD A;  1Z9F A;  2I5M X;  3KK7 A;  4MNO A;  2J4X A;  3DUZ A;  2IT1 A;  5IIF A;  2K50 A;  1HNX L;  1IBK Q;  2R93 G;  2H5X A;  4UDU C;  5D3D A;  3CD6 A;  4BY1 G;  1EZ8 A;  3HZX A;  4X3S A;  4ZCK A;  2KCM A;  2VY3 A;  3E6Z X;  3HOX H;  5IGD A;  4Y7N H;  5G3L D;  3WOF A;  1Q46 A;  1E3P A;  1IW7 D;  3S1Q H;  3I72 A;  4QGU A;  1N9W A;  3S1M H;  4DR2 Q;  4EVO A;  5IGG A;  3RZD B;  3KF8 B;  4GOP C;  4A3I G;  1XYI A;  3MC0 B;  3KJP A;  1Z47 A;  3RZO H;  3M7N A;  4A3D H;  2Q8T A;  4JI3 Q;  1I6H B;  5K36 G;  4HJ5 A;  2JA5 H;  3KF8 A;  1TU2 B;  2GN5 A;  4LWC A;  2UUA L;  2NTT A;  1U4L A;  1EYC A;  2Q8R E;  2E2I B;  4DV4 L;  3AFQ A;  2R7F A;  3IRB A;  3AYH B;  1IHZ A;  5JOB A;  2A6H C;  1K0R A;  1SN8 A;  1LM0 A;  5FLX E;  3MAQ A;  1JOQ A;  1KTK A;  2YTV A;  5IOD A;  1XWE A;  3H0G H;  4IPC A;  1FNW A;  3J80 c;  2OEO A;  1JR0 D;  1JE4 A;  1IKM A;  5EBC A;  3SHL A;  1EOV A;  3TN2 A;  3L9A X;  4ZYS A;  1RF2 D;  5JVG 3;  1G8Z D;  3QIA A;  4OX9 Q;  2PO4 A;  4BXX H;  4DR3 L;  4ID6 A;  3K5O A;  3S9W A;  1N34 L;  2BH8 A;  3S17 H;  2R93 B;  4X66 L;  2D5D A;  3OYY A;  2JQO A;  2F0L A;  1ZKO A;  5HGT A;  1VMC A;  4LMQ D;  1E2V A;  4LJZ C;  4BS9 A;  4G7Z C;  2NVX B;  2F0G A;  4JBJ A;  5M3M H;  4DNR B;  2E2D C;  4JBW A;  4DV5 Q;  5ISR A;  2CWA A;  4MTN A;  2M00 A;  5IWA L;  1I4G A;  3S2H H;  2QKI C;  4H13 C;  2CHB D;  5IP7 G;  1PYB A;  4A93 B;  4C3J G;  5NUC A;  5CMD A;  2D62 A;  3BG3 A;  1SE8 A;  3DEP A;  4K2K A;  1X56 A;  1IKL A;  4BBR G;  3WWV A;  2F3I A;  4R4I A;  2QGQ A;  3SGI A;  5LMN L;  1H9S B;  5ELF A;  1D5M C;  4KKT A;  1Y69 U;  3A8I E;  3RMH A;  1EY6 A;  1H9S A;  5IP9 H;  2NWG A;  4A3M G;  3CC2 A;  1KDA A;  1YNX A;  5DAU A;  4UP7 A;  2OQ0 A;  3VA7 A;  1L0X B;  2SDF A;  2K5V A;  3BZD B;  1EU3 A;  2VZA A;  5AFW A;  4GOP B;  2JA6 B;  4LW1 A;  4A3G B;  1S5D D;  2CQA A;  4PMB A;  2F3V A;  3GTO B;  3LX0 A;  4GOP A;  3VR5 A;  2ZJR A;  3HOV H;  3TP5 A;  1R4Q B;  1CTM A;  1IBM Q;  3MXU A;  2JA8 B;  3P75 A;  4BA1 I;  3H91 A;  2PW5 A;  3HOY H;  4A3K G;  3EBE A;  3UI2 A;  1BCP D;  2E2J H;  1PZK D;  2FXQ A;  3I3C A;  2BE5 C;  3UDF A;  3K6O A;  2PQE A;  1UAP A;  4C3J B;  4DV1 L;  4DA2 A;  2DN8 A;  1CZG A;  4NW2 A;  2V4D A;  4ME3 A;  2RF4 A;  3KDF B;  1I4R A;  2Q2U A;  4JI6 L;  4LUO A;  1XNR Q;  1W6J A;  5C3W A;  2K04 A;  2D2C C;  1IBL Q;  1SNP A;  1TY2 A;  3KDF A;  1FR3 A;  2HCC A;  5C4J H;  2RCN A;  3A5Z B;  1VQG A;  1QCB D;  5GQO A;  3K57 A;  4BBS G;  2H4O A;  3VR3 A;  1BVS A;  4N9T A;  3FKI G;  3BDO A;  2TSS A;  1KAB A;  3HOZ G;  1V1Q A;  3N52 A;  1JB3 A;  1IXR A;  1KNA A;  3M3Y B;  5CV5 A;  3CC4 A;  1BXT A;  1HA6 A;  3LWU A;  2BH2 A;  3HOW B;  1SE3 A;  2ASB A;  5DM6 3;  3GTL H;  3L7Z C;  3CCJ A;  3R2I A;  1I3Q B;  1LUZ A;  3EA6 A;  5ELC A;  1QNK A;  1G2T A;  2K01 A;  2UUC Q;  1K3B C;  2UXB Q;  1HNZ Q;  3J81 i;  1MHW C;  4O1N A;  1TWH B;  4RGT A;  1S5F D;  1MBY A;  2K6A A;  3KUP A;  1HQM C;  3ERQ A;  3KJO A;  3OTO L;  3CPF A;  5M5W B;  4KN7 C;  3MXP A;  4RH6 A;  1N32 Q;  1ENA A;  4RAU C;  4DUZ L;  3T16 A;  3K5L A;  4IO9 A;  1A15 A;  4CDF C;  1GUW A;  1PFB A;  2B63 H;  1GUS A;  4HN7 A;  4IJL A;  3KF6 B;  1AZQ A;  3GTG B;  1SJE D;  2K32 A;  1S4Z A;  2VXW A;  3KF6 A;  3HOX G;  4C56 C;  3CAM A;  4DXF A;  1KXL A;  1SMX A;  1VQ7 A;  1JB7 A;  4Q5V A;  1SYC A;  1QVF A;  3L0O A;  1TS3 A;  4NDX A;  4FVM A;  1RTN A;  5EJW A;  2I46 A;  2NTS A;  3KLR A;  3CCQ A;  5LL6 X;  5I6Y A;  4K2L A;  2JA5 G;  5C0X J;  5J39 A;  1YIJ A;  4DGZ A;  2IWH A;  1X3P A;  4O0A A;  4KHP Q;  2K7V A;  4IPD A;  4ZUI A;  3PIP A;  1NBW A;  3GTK H;  2L11 A;  4A3F H;  2K33 A;  2RCF A;  5IYD H;  4IOC A;  2YYZ A;  1VQ9 A;  2C9O A;  4DAV A;  3IFD A;  3H3V C;  1L0W A;  1RD9 D;  5J22 A;  1D2B A;  1Q8I A;  1DM0 B;  1UE1 A;  1L2F A;  3HKS A;  3N6R A;  1KLU D;  2B8G A;  1EYG A;  1A62 A;  3QO2 A;  1BNZ A;  1LT4 D;  4BXX G;  1CKN B;  1PH8 A;  4JI5 L;  1TT2 A;  1YNJ D;  1JMC A;  2AHO B;  1SSO A;  1HNW Q;  4UHV A;  2DY7 A;  3K7U C;  1BO0 A;  1CKN A;  1HXY D;  3U9S A;  3K59 A;  4Y7N B;  1U9R A;  4LUV A;  4BY7 G;  1Z7T A;  2C35 B;  4JCV E;  3S1M B;  2BDN A;  3S2D H;  4JPB W;  2ICE C;  3RZO B;  3SEB A;  4A3D B;  3MFG A;  4AH6 A;  4PMW A;  4K8I A;  4J15 A;  1CA6 A;  1ASZ A;  2A69 C;  2F4V Q;  2UXD L;  4OO1 H;  1FL0 A;  4FF1 A;  1W6K A;  1TWG H;  4JI7 Q;  1RCV D;  2EYF A;  2VQE Q;  3HOU H;  2YTX A;  3PIO 3;  1ICF B;  3H0G B;  1OXT A;  2B29 A;  1FNV A;  3J7A 5;  5EKK A;  1B3A A;  3BJU A;  4O2D A;  3A55 A;  3TQY A;  1B44 D;  2LS0 1;  4PV1 C;  1HZ9 A;  4RMF A;  1PH5 A;  1EQQ A;  2TMP A;  1NR4 A;  1F9Q A;  2PI2 E;  4DV6 L;  1SNO A;  2F0N A;  5I9P A;  3E0E A;  4EQO A;  3TZD A;  4YWK A;  5M3M B;  1D8L A;  3VYT A;  5EBD A;  2V1C C;  5J1Z A;  1PFS A;  5BN3 A;  4DU9 A;  1EY0 A;  3AQQ A;  2CQO A;  4L5S A;  3KOJ A;  3P20 A;  4YHH Q;  2L5T A;  2KVM A;  1N36 Q;  2IY5 B;  4A3L H;  1EY4 A;  3TME A;  2R61 A;  2EY5 A;  2GVA A;  2AQ3 B;  3M85 A;  1VQD A;  4CDE C;  4DR7 L;  2ZXR A;  4S3S A;  3PMF A;  4LF6 Q;  1YBY A;  2AKW B;  4QF4 A;  5C3E H;  1DYQ A;  2J7Z A;  1H9R A;  1Q1B A;  4YWL A;  3S16 B;  1I6H H;  4ODG A;  1CI3 M;  2RHS B;  4IJH A;  2ZXP A;  1KQS A;  3M4P A;  3MEF A;  1F9P A;  4LUZ A;  1PH4 A;  1OTC A;  1O7Z A;  3HOV B;  3H6M A;  1B4O A;  3K80 C;  1EYA A;  5JPM C;  3MXG A;  2M2L A;  2RDG A;  3DEO A;  3T1Y L;  2P5Z X;  4I7Z C;  4EQN A;  1BF4 A;  2BDO A;  4JV5 Q;  4DUY L;  4RKL A;  5IT9 L;  2F0P A;  1SYG A;  5DM7 3;  3HOY B;  2FFK B;  1AE3 A;  2E2J B;  2EYH A;  1DGS A;  2SNS A;  2AUJ D;  2JA7 H;  4RGM A;  2VUM H;  1SJH D;  4GN4 B;  3KYH C;  3S1N B;  3ER0 A;  1WOC A;  4DN4 M;  4ABN A;  2B63 G;  4X65 Q;  2CFM A;  4V0B A;  4LF4 Q;  4NXN Q;  5LMN W;  2AQ1 B;  1VF7 A;  3EN2 A;  1BBU A;  3MFY A;  1NY4 A;  5C4J B;  4JI0 L;  3PO3 H;  3DWP A;  1K8A C;  3C46 A;  2PMZ B;  4OWT B;  1D7Q A;  3G6E A;  1K73 C;  3IFT A;  4IAL A;  3NTI A;  3HP3 A;  2CVR A;  3JC6 6;  4IUR A;  1EL0 A;  1RDP D;  2D9U A;  4XYQ A;  1MI2 A;  1Q81 C;  1A3U A;  1PH3 A;  3SXH A;  1HUM A;  2QDB A;  1QJO A;  2EE1 A;  4KD4 A;  4G7H C;  1B70 B;  2NB0 A;  4A3F G;  2QEJ C;  1X6O A;  2Z6B A;  5IYD G;  1KL9 A;  2I07 B;  3TSS A;  1I4Q A;  3I4N G;  4QUF A;  4JI4 L;  4YCU A;  5H1S E;  1Y8P B;  3A7A B;  3FMC A;  3T1H Q;  4MHE A;  1LTR D;  3ONA B;  2MQH A;  2B63 B;  3DLL A;  1Q82 C;  5IOC A;  3T51 B;  3F2C A;  1F2L A;  3J7Y W;  1R9T H;  3BU2 A;  3J7A V;  2XGT A;  2RSN A;  4RGO S;  3F2U A;  1WD0 A;  2KHS A;  2JEB I;  1SMY D;  1M8A A;  4AQY Q;  1EIH A;  1QNU A;  2F0M A;  3OW7 A;  1XMQ Q;  1NE3 A;  4GKK Q;  4P2C B;  4CKB A;  2UUB Q;  4DV3 L;  3I4M B;  1HQR D;  2R6G A;  5I2X A;  2A74 C;  4RCO A;  1Y1V B;  5GAD C;  3A0J A;  1XNQ Q;  3Q6S A;  5CC4 A;  4HIK A;  2CW0 C;  1YVC A;  4PQX A;  5FO8 B;  3FEW X;  4NMZ A;  2QCP X;  3K7A H;  1SNQ A;  1DCZ A;  1J9O A;  4DR6 Q;  4DR1 L;  4LF8 L;  1TS2 A;  3M3Y H;  2B2W A;  1QWY A;  5A35 A;  1YJW A;  2IX0 A;  5D3I B;  2L0C A;  2N88 A;  2Q2T A;  3HOW H;  1KRT A;  4LFC Q;  1HA5 A;  5M5X H;  1GUN A;  1DOK A;  1O80 A;  2KEN A;  2A68 C;  1GKH A;  4LF9 Q;  2XRQ D;  3FVQ A;  2JSO A;  4HTH A;  3VR2 A;  1U4M A;  5LHY 1;  1XPR A;  4EQP A;  2K5H A;  1VQI A;  3URY A;  1JQY D;  1V1P B;  1G2S A;  3I91 A;  2OTJ A;  3S2D B;  4QB4 A;  3P1H A;  4B3S Q;  1N33 Q;  4IFD H;  2E8G A;  1V1P A;  1GD7 A;  4KD3 A;  1OXV A;  3GTG H;  4U68 A;  1S5B D;  3TS2 A;  2LFN A;  4EGV A;  1JOK A;  4RFB A;  1IBK L;  3TRZ A;  2ALY B;  2ZT9 C;  3KLW A;  5JEA H;  1KHI A;  1TWG B;  3SK4 A;  2O5J C;  3HOU B;  2Z4H A;  4FO2 A;  1HZA A;  3OOC A;  1WFQ A;  4HIM A;  1XMO Q;  1GHK A;  4RA8 A;  1IYJ B;  3BVZ A;  5HUR A;  2A19 A;  4XTC S;  1LTL A;  3FDT A;  2FJ2 A;  3U4Z A;  4JI3 L;  4AIM A;  3STB D;  3OWF A;  4PMC A;  2ES2 A;  1EWH A;  1AN8 A;  3TP7 A;  4X6A H;  2K05 A;  3I73 A;  3D6W A;  3H94 A;  1FGU A;  4FF3 A;  4DV2 Q;  4DK0 A;  1CKM A;  3NSW A;  3UE1 A;  2E2H H;  2I5L X;  4K5V A;  1QOH A;  5CV6 A;  1O7L A;  4GNX C;  1P16 A;  5CV9 A;  1VQH A;  3SK8 A;  4KKU A;  1G6P A;  1PV4 A;  4GKJ L;  3E3X A;  4GN3 B;  1SDF A;  1CM9 A;  1JT8 A;  3JAM L;  1RHP A;  1E2W A;  3TS0 A;  2QF7 A;  1KAA A;  4O42 A;  4QQB X;  4L6T B;  3J81 L;  1TWA H;  1X65 A;  3LNN A;  5KYL A;  1XXG A;  3M4Y A;  4JK1 C;  1AH9 A;  3GTP B;  2F0K A;  4FXD A;  4QUC A;  1J5E Q;  4NXM Q;  1CHQ D;  4KY5 A;  1LV9 A;  1EIF A;  3RN2 A;  5C3E B;  1H9K A;  4DV5 L;  4A93 G;  3HKZ G;  3A8J E;  1UEB A;  1TWF B;  4XYO A;  3U9O A;  3I90 A;  1CUK A;  4KHV A;  4ZQ3 A;  1WTV A;  2WB1 B;  4HCE A;  3QB3 A;  4RKB A;  3PUW A;  1F9R A;  1X55 A;  5I2Y A;  2YTY A;  4NKL A;  3S14 H;  3NE5 B;  4KJN A;  3ULJ A;  1JJ2 A;  1PTO H;  4JBK A;  1JE5 A;  4OWX B;  1KLG D;  2JA6 G;  4IPH A;  1F2Z A;  5T1G A;  4A3G G;  4KMU C;  2L4N A;  2JA7 B;  2VUM B;  4LFB Q;  1B9M A;  3S24 A;  1DD2 A;  2DJG C;  2KJX A;  2JA8 G;  1SYF A;  1A6X A;  4L63 B;  1GHJ A;  5GAH C;  3CF5 A;  1M90 C;  3Q23 A;  1F9S A;  4BWG B;  1DJR D;  2E75 C;  3PO3 B;  3P7J A;  5DNF A;  2B2V A;  4GNX B;  4DAP A;  1ZYR C;  3H3V H;  2Y0S B;  3DWA A;  3HKZ B;  4GNX A;  3EFX D;  1VF5 C;  2ZM6 L;  1SE2 A;  3CKI B;  2EYL A;  1XX8 A;  2WP8 J;  4TRD A;  2F0Q A;  5FO7 B;  5CGK A;  1MKH A;  3GTQ B;  4IN3 A;  1BOS A;  1TVX A;  1Q90 A;  2PQA A;  3EJI A;  1AZP A;  5EGT A;  1XNR L;  2EYO A;  1UE7 A;  3MEH A;  1WI5 A;  3QOL A;  1BDO A;  2HIX A;  5C44 B;  4K0K Q;  1QZG A;  3AB9 A;  2PNH A;  1OO9 B;  4R1J A;  2UUA Q;  3S16 H;  1GVP A;  2ZTD A;  1VQP A;  1PMR A;  5FOB B;  1HH2 P;  1A3T A;  2A6E C;  1P8L A;  4G4K A;  3HOW G;  4ULL A;  2FMC A;  1K3R A;  4HCS A;  5C4X H;  4P72 A;  2PNR C;  1R9T B;  5IGC A;  1DXM A;  2I0Q A;  1PTO F;  4J6H A;  3GD7 A;  4K5X A;  1QB5 D;  1RJT A;  4XQN A;  1S3O A;  1ZXT A;  2XSC A;  2UXB L;  1TQO A;  1HNZ L;  5FLX L;  3VYS A;  2JK8 A;  2D0O A;  4LFA Q;  3S1N H;  4JYA L;  1B9N A;  1N34 Q;  1SXT A;  1SLJ A;  2DY8 A;  2GVB A;  3BZC A;  1T9H A;  1K8G A;  4X66 Q;  1PH2 A;  1VMP A;  1EEI D;  1PRT C;  2EYJ A;  1N32 L;  2RBM A;  4HIO A;  1C4Q A;  2FMM A;  2RVL A;  4CKC A;  2ICI A;  1R4P B;  2AWO A;  1VS0 A;  3I8Z A;  3Q22 A;  4LF7 Q;  1VQK A;  4JI2 Q;  4K6D A;  4R4T A;  2PMZ E;  2AQ2 B;  4JC0 A;  5JEA G;  3K0Y A;  2Z8L A;  4IUV A;  3KLS X;  4IPG A;  1PA6 A;  2JYO A;  1YEZ A;  4WOR A;  3K7A B;  1VQC A;  3W2D A;  1Q3L A;  1WTH A;  3T56 B;  5IGE A;  1O78 A;  2RDF A;  3W5O A;  4ZLT F;  4CKE A;  4DV0 Q;  3C3L A;  3PSI A;  3R2T A;  1SNM A;  1F2M A;  1I4P A;  1AEX A;  4QIW B;  3Q8D A;  4B3M Q;  1CQF A;  1ML0 D;  1XTD A;  4OXP A;  2EPB A;  5M3F B;  2WKC A;  5M5X B;  4PZ6 A;  3R3O A;  4A3J H;  3V2T A;  3ULL A;  2FIN B;  2SNM A;  1Y1W H;  4KHP L;  2L15 A;  5E4X A;  4P71 A;  3UE0 A;  5KGU A;  1V8Q A;  2JJQ A;  1IW7 C;  1EZ6 A;  5JJZ A;  2LY7 A;  2Z4I A;  1S5C D;  4QL5 A;  1WVL A;  3PUV A;  2Q2H A;  5COY A;  1STE A;  1FNU A;  3FPP A;  3CCM A;  1DOM A;  2B39 A;  3QG1 A;  2N8N A;  1CKO A;  4KV6 A;  1GJX A;  5FO9 B;  4HID A;  1K8O A;  1J8I A;  1WCM B;  5KIX A;  1SFO H;  1B2T A;  5KNC A;  1WTP A;  5BN4 A;  1GUG A;  2UXC L;  1HNW L;  1EQT A;  1PTO C;  3DXJ C;  3RLO A;  3VA5 A;  1U5K A;  2O2L D;  3DM1 A;  4A3D G;  1PRT B;  4PG3 A;  3FRP B;  3I4M H;  2E74 C;  1ENC A;  2F0S A;  4AYB B;  2F0U A;  2WAC A;  1Y1V H;  4KKS A;  4FXK C;  4TSS A;  4WFN 3;  1MGS A;  4IQZ A;  1E7Z A;  2RDH A;  3R93 A;  3CMA A;  4H7B A;  3OWE B;  2MHV A;  4IUN A;  1SRU A;  3E0J A;  3H0G G;  4JI7 L;  3CHB D;  3X3M A;  3X3N A;  2E2H B;  3CXC A;  1B7Y B;  4JVZ A;  2MFI A;  2VW9 A;  1G51 A;  1VQM A;  4Q0F A;  4X64 Q;  2G5D A;  1JCK B;  1ROD A;  3OIP A;  1C7Y A;  2F0I A;  1MSH A;  3NHH A;  4PZ7 A;  1NCV A;  4XT3 B;  3NQI A;  4XQJ A;  1TWA B;  4FF2 A;  5JVH 3;  3PF4 A;  3F2B A;  2EYP A;  2N3S A;  1W2B A;  4OWW B;  3NEL A;  5JAV A;  1HR0 Q;  5M3M G;  1HTP A;  4KK7 A;  1EU4 A;  2IHE A;  1RL2 A;  3K58 A;  1ICW A;  1MJE A;  2C5C A;  5HY6 A;  1U0L A;  1VCI A;  3DMU A;  4ILW A;  3VDY A;  1X54 A;  1EWI A;  4YCV A;  3T13 A;  5ELN A;  1QVC A;  2A1A A;  1N36 L;  5C6A A;  1I4X A;  3S14 B;  1E1T A;  1Q8K A;  2R7Z B;  2BA0 A;  3NBI A;  5IP9 G;  1G6Z A;  1YI2 A;  2A8V A;  1PTO B;  2A5H A;  4RHR A;  1U4P A;  4QY7 A;  3CME A;  4LF6 L;  1C9O A;  3EVQ A;  5EPJ A;  4C3I H;  1LT6 D;  1BCP C;  4JI8 Q;  2X6L A;  5I9O A;  2NYZ D;  5AJ3 L;  4CJ2 C;  1C0A A;  3HEJ A;  1HUN A;  3HOV G;  4X3T A;  2L9H A;  4MZ9 A;  1QE6 A;  3A5U A;  3S1R H;  1I94 Q;  1NMG A;  4LK1 C;  5IT9 E;  2CH4 A;  4FYD A;  3AU7 A;  2ZTE A;  4A3B H;  3BS1 A;  1UNS A;  3HOY G;  1EWC A;  4R8N A;  1ZEQ X;  2IHF A;  4DR5 L;  3D3R A;  2K4K A;  1I6V C;  2IJ0 A;  1B53 A;  4ZKB B;  2CW0 D;  3T53 B;  1Q1E A;  4X65 L;  3J80 L;  5A2Q E;  4LF4 L;  4NXN L;  3GTP H;  2MO1 A;  2LXJ A;  3ERO A;  4OIK A;  4BA2 I;  3NTK A;  5EAY A;  4A3C H;  2WB1 E;  4B08 A;  5C0X H;  1D6E C;  2NN6 H;  2KQ3 A;  2L1B A;  1TWF H;  3NUC A;  2UXD Q;  1LO5 D;  4J1M A;  3G6J B;  4GLA C;  1LYL A;  4HJ7 A;  1VQ4 A;  4M1U B;  1V1O A;  2CKZ B;  2F0V A;  1YNN D;  3NEM A;  3J7A F;  5C4X B;  2F0O A;  3OPO A;  3J7Z C;  3GTJ H;  4A4I A;  4ZKC B;  1EFW A;  1DON A;  2R92 B;  3DHQ A;  4IUT A;  2BOS A;  2DJF C;  5LMU Q;  1NJI C;  3B6Y A;  3SDZ A;  5FLM H;  1BCP B;  1PXU A;  3D31 A;  3U58 A;  2QEX A;  1ONL A;  3T1H L;  1HFG A;  4B3R L;  3K8A A;  2NVT H;  1B50 A;  5BR8 Q;  3GP7 A;  4YCW A;  3CC7 A;  3I7F A;  4CJ0 B;  1EIY B;  2B2U A;  1JWU D;  4KJO A;  3HKZ E;  5ELO A;  3F2D A;  1A63 A;  4JG2 A;  2OXP A;  2HHH Q;  3BYY B;  1IL8 A;  1STH A;  3LWE A;  3WDN A;  2B2W C;  3MHB A;  1XPO A;  2WII B;  1B3Q A;  1CA5 A;  4K5W A;  1YJ9 A;  3QOJ A;  1ESF A;  1EUJ A;  4DNT B;  3Q0A A;  1E24 A;  4AQY L;  4RGN A;  1AE2 A;  1A2T A;  1L0Y B;  1T5X D;  4CDD C;  3CRK C;  4KTA A;  5CR3 A;  3CCV A;  1XMQ L;  1K83 H;  4DR7 Q;  3BZK A;  4GKK L;  5CV7 A;  3M4Q A;  3I4M G;  3PIP 3;  1GOZ A;  3GTQ H;  4OL7 A;  1JOR A;  1ILQ A;  1Y1V G;  4A3J B;  2NVQ H;  1Q86 C;  3OW2 A;  1B8A A;  4YY3 L;  1YNJ C;  1Y1W B;  1I5F A;  1XNQ L;  2VB2 X;  5C44 H;  3FP9 A;  5JEA J;  1G91 A;  5CBE E;  2JXM B;  4A75 A;  3BVG A;  3G48 A;  2F0W A;  2PZT A;  3U4V A;  3AFP A;  4X62 Q;  4LFC L;  1ESR A;  2VQF Q;  1YJN A;  2Z9H A;  1LLR D;  4DFA A;  3G71 A;  2EZV A;  1SFO B;  3U50 C;  1TY0 A;  4LF5 Q;  4LF9 L;  2Q2I A;  1PZJ D;  4KI0 A;  3NXW A;  5EQ0 A;  3PF5 A;  3QR8 A;  2EIF A;  1HPC A;  3CU7 A;  1SYE A;  5KNB A;  1YZ6 A;  2R3Z A;  1SYB A;  4XDX A;  2M9V A;  2YV5 A;  3SVM A;  2A6H D;  3OMG A;  4Z9C B;  1N33 L;  4DNI A;  4DV7 L;  1JJC B;  2HDM A;  4RG1 A;  5F2D A;  5C4H A;  5I4D A;  4OO1 G;  4E6I A;  1QVG A;  5KRU A;  3MWY W;  4HJ9 A;  3HOU G;  4GLV B;  1LAB A;  5IP7 H;  4WRD A;  1PH9 A;  2F0F A;  2HQL A;  1HFN A;  1HZC A;  4QIW E;  1FJG L;  3V05 A;  3GO5 A;  2WV6 D;  3K5M A;  3UDI A;  5JJK A;  4BBR H;  1UEA B;  4A3E H;  1XMO L;  1D5Z C;  3W1B A;  1WTX A;  5IYC H;  1VQB A;  5E4W C;  5M3F H;  3PQI A;  1CQV A;  1EYD A;  5EPL A;  4JI4 Q;  2WAQ B;  4A3M H;  4B3T Q;  3HGB A;  3AMU A;  1HTL D;  4OHJ A;  4DV2 L;  5KEE A;  1EY9 A;  3I56 A;  3V96 A;  1BUV T;  4OO1 I;  2K1B A;  1PHJ A;  4UPA A;  1D1I A;  2G9D A;  4DKA C;  4ZK9 B;  2UU9 Q;  1TXY A;  4DR4 Q;  1A0I A;  2Q8I B;  1VQ6 A;  4A3L G;  1LTA D;  2OQK A;  3NP8 A;  4MTK A;  1LTS D;  4HMI A;  4TKO B;  2JN4 A;  1IYU A;  1WCM H;  4FP5 D;  4R8I A;  4K6L A;  2OCE A;  4DK1 A;  2EDG A;  2I5H A;  1LAC A;  3A54 A;  3ZYY X;  2EJG C;  2QDL A;  1PDQ A;  4UP8 A;  2NN6 G;  2Z1C A;  5C3E G;  1IYV A;  4HMJ A;  4DV3 Q;  1J5E L;  4C3I B;  4NXM L;  2EJF C;  3E9H A;  4AYB E;  4DR2 L;  1IZ6 A;  1SEB D;  2KEE A;  2WB1 G;  2NBF A;  5C5L A;  1FYC A;  1J6Q A;  3NQT A;  5JPN C;  1PLF A;  2B8F A;  4Y52 H;  3Q24 A;  3S1R B;  4OIJ A;  1AP0 A;  1HZB A;  4GLX A;  4BBS H;  2BE5 D;  2B2V C;  4A3B B;  4L5R C;  4K14 A;  3FKI H;  4LF8 Q;  1OXS C;  5CYU A;  3HOZ H;  4YWM A;  2XRS D;  2E5L Q;  1T5E A;  3PO2 B;  2N78 A;  4EQ5 A;  4CGY B;  3D4W A;  1D1K A;  1WD1 A;  2JA7 G;  2VUM G;  4HSV A;  1A3V A;  3E5S A;  4QCL A;  2F03 A;  5GAE C;  1MIU A;  4CDC C;  5E3F A;  1GM5 A;  4OX9 L;  1I50 H;  3ULP A;  5D65 A;  1GO3 E;  4IUP A;  4R4C A;  4JI1 Q;  1TII D;  3RUZ A;  3K81 C;  3PO3 G;  1Y14 B;  3IL8 A;  2PI2 A;  3SR1 A;  4IZ8 A;  3MVV A;  2Y0S G;  2IX1 A;  4DAM A;  3PUY A;  2O4X A;  1X3E A;  5JJI A;  3GV6 A;  2VB3 X;  3EQL C;  2K03 A;  3CPW A;  2EY6 A;  5CV4 A;  1SYD A;  3PUX A;  3D4D A;  3RNU A;  2B2T A;  3CQZ H;  2HT1 A;  2D0P A;  2R7Z H;  4FDB A;  4YIJ A;  3GTJ B;  5J3B A;  4KN4 C;  5FJ8 H;  4HJA A;  2B2Y A;  4DK6 C;  5C44 G;  4U67 3;  5FKA C;  1PRT F;  4RWS C;  5GRO A;  4OON A;  1WYD A;  1LTT D;  4DXG A;  5M9O A;  5IYB H;  4K0K L;  1SMY C;  5FK9 C;  1LTB D;  4UP9 A;  3RLF A;  1SR3 A;  1DZ1 A;  1EIG A;  2ZJP A;  2NVT B;  3K5N A;  1PTO D;  3PUZ A;  1JWS D;  4ALP A;  1O7I A;  1X9N A;  1IBM L;  3W1G A;  4WJW A;  2LSS A;  1II3 A;  4GKJ Q;  4R4O A;  2XNA C;  1YHB A;  1SRO A;  2DNE A;  4RHS A;  4F7X A;  5C3X A;  4NPS A;  3PV0 A;  2AWN A;  4UAI A;  1ET6 A;  1HNX Q;  3GQB A;  2JP1 A;  3MTS A;  4FF4 A;  1O7Y A;  4LFA L;  2JEA I;  4L5Q A;  4PNY A;  3I2Z A;  2PQA B;  1CFM A;  1K83 B;  4BY1 B;  2ZXO A;  3KBX A;  1KD1 C;  2ATW A;  4GN5 A;  5C5M A;  2NUC A;  1X3F A;  2SEB D;  3F8T A;  4FNF A;  4BY7 H;  2NVQ B;  5G3L F;  4LF7 L;  1IBL L;  4JI2 L;  4MIU A;  4A3I B;  3A56 A;  3GTM H;  2PW7 A;  5ELB A;  1BKB A;  1M1K C;  1UE6 A;  2VL6 A;  1PFM A;  1GUO A;  3A8K E;  1EY8 A;  5IT9 c;  3O13 A;  4DV4 Q;  1FVI A;  2NZO A;  4A3E G;  2HQE A;  4DV0 L;  5IYC G;  4F87 A;  1H9M A;  3EIV A;  5M3F G;  5E7N A;  4B3M L;  2HCI A;  2KCC A;  2R92 H;  2EOT A;  1M4V A;  2UUC L;  3PCO B;  4ZUJ A;  3PIO A;  4DK3 C;  2A69 D;  3CCR A;  3I4O A;  4N9P A;  4DR3 Q;  1Q12 A;  4KHZ A;  3DM3 A;  4L8J A;  1EY5 A;  1KC8 C;  4B9W A;  2IX3 A;  3LGJ A;  1A2U A;  3BYT B;  4IFD G;  3D6C A;  5EKI A;  3STB C;  1WCM G;  5IWA Q;  3I4L A;  5DLQ E;  4XXE A;  1HHV A;  3R8B A;  1PZI D;  1KIX A;  1Y8N B;  2ZM6 Q;  3AEV A;  4XQQ A;  1STG A;  4ZRZ A;  1V43 A;  3E9I A;  2PYK A;  5LMN Q;  3D0F A;  4BBR B;  5IY0 A;  5HGQ A;  4A3E B;  3G7L A;  4IUU A;  1TR5 A;  2J0T D;  1K0S A;  4AYB G;  4F88 A;  1S40 A;  4NP5 A;  2JA9 A;  2NVY H;  1KNE A;  1WTR A;  1STY A;  4A3M B;  3GV3 A;  4B9X A;  4IFD I;  1TS4 A;  3TP6 A;  2CWP A;  3SK6 A;  1PH7 A;  3MA2 B;  3L2P A;  1WTO A;  1PH1 A;  2BCO A;  1CZW A;  3C2P A;  2IW3 A;  2MO0 A;  1QIL A;  4X64 L;  3JAM i;  5EPK A;  1TKW B;  4L5T A;  2F1M A;  2OF1 A;  3ITP A;  1VQE A;  2F0J A;  1EEF D;  4HSP A;  1WTQ A;  3FPU B;  1E0B A;  3OIQ A;  4A3K B;  3OHX C;  3TP8 A;  4JYA Q;  4P74 A;  3A74 A;  2OWO A;  4H02 A;  4DV1 Q;  1BCP F;  1HR0 L;  2OTL A;  2JE6 I;  3K0X A;  3F1Z A;  3NEN A;  4C2M H;  1PVO A;  2FHT A;  5ELE A;  4C3H H;  1WTW A;  5M5Y B;  1LT5 D;  4JI6 Q;  1Z6H A;  5KYI A;  2E76 C;  1ASY A;  3M4O H;  2EXD A;  4FXG C;  4IUQ A;  4K8J A;  2F4V L;  2R7Z G;  3CW2 C;  2BA1 A;  1BBX C;  2F3W A;  2KHJ A;  4BBS B;  3FKI B;  3ND8 A;  2K75 A;  1C8C A;  5FJ8 G;  1K28 A;  2RA4 A;  2VQE L;  3HOZ B;  1CHP D;  1E22 A;  3S15 H;  2EY2 A;  4G7O C;  3MXN B;  4CHT B;  2QW7 A;  2DUD A;  2L55 A;  2F0H A;  5IYB G;  3A7L A;  1SBB B;  2YU9 B;  4I7A A;  4XIG S;  4JI8 L;  2WAQ E;  3MXN A;  5BN5 A;  1MSG A;  1VQJ A; 
#chains in the Genus database with same CATH homology
 1EY7 A;  1H9J A;  1I50 B;  2EY1 A;  1NUC A;  2XWJ B;  2HUG A;  3J80 E;  2PZW A;  1U4R A;  4HR7 B;  3HOX B;  3NTH A;  1QG7 A;  2MJ8 A;  4X3U A;  3CQZ B;  2F0E A;  3S1Q B;  4HED A;  3TZU A;  2KCN A;  1KDB A;  4GZY C;  2LMC B;  3VYR A;  3VR4 A;  2JA5 B;  2KED A;  2MUY A;  3DWQ A;  4ZAI A;  5CBA E;  1AFP A;  1LTG D;  3HG9 A;  1MD2 D;  4OGQ C;  4DAY A;  2B2U C;  3SE0 A;  1F77 A;  1BQQ T;  1X3Q A;  3KLS A;  5K5P A;  4TQU S;  2F0T A;  1PYW D;  1VDZ A;  1ILP A;  2G9H D;  4KY6 A;  5D14 A;  1OXU A;  5IGB A;  1CK1 A;  2DNC A;  3S17 B;  1SE4 A;  1JIC A;  1TS5 A;  1X32 A;  2MGS A;  1STN A;  2IPK D;  4J8Q A;  4DF7 A;  2QIL A;  1NR2 A;  4BY7 B;  4I65 A;  2EJM A;  2WKD A;  3S2H B;  2GA4 B;  3CRL C;  3GTM B;  1SND A;  3VR6 A;  1B1Z A;  2RQX A;  2OT2 A;  3ND9 A;  2A68 D;  3HS0 C;  5EKL A;  3MZ5 A;  4V19 0;  3RD4 A;  1HRJ A;  3KBG A;  1S5E D;  5KND A;  3NWT A;  5I6W A;  1HCZ A;  3SK5 A;  2ID0 A;  3H09 A;  1AW7 A;  3WOE A;  4HAE A;  1G29 1;  4M8A A;  2KA7 A;  2XIW A;  2O5I C;  5CV8 A;  3C1F A;  5IGF A;  3W3A A;  2AUK A;  2EXZ A;  3L3O C;  2K5Q A;  1JC7 A;  1XTC D;  4C3H G;  2IL8 A;  2H1E A;  3QJY A;  3BDL A;  1RKN A;  1KDC A;  1NAP A;  2K28 A;  2RKS A;  2ENB A;  3IKJ A;  4XT1 B;  4IFD J;  2NVY B;  5TSS A;  2KUM A;  5A2Q L;  3BVM A;  5LL6 S;  2N55 A;  2EYM A;  2NZ1 D;  5K36 H;  4C1N I;  2VNU D;  3OSO A;  2K5D A;  2XWB B;  1FGB D;  3NK9 A;  4QMG A;  1NSN S;  3GTL B;  4C1N K;  3D8G A;  3TBI B;  5COR A;  3BDC A;  1OXX K;  1STA A;  2PPB C;  2LKV A;  1JOO A;  4G57 A;  4MN3 A;  4CBV A;  4C2M B;  1UUP A;  1EOT A;  4C3H B;  3D4R A;  1SNC A;  2MP1 A;  2X69 A;  3M4O B;  3OMC A;  3VYU A;  1BR9 A;  1FD7 D;  3QWN A;  3NPP A;  1SAP A;  1D5X C;  2XN9 C;  3S15 B;  4C3I G;  2K5W A;  3NBH A;  4LAA A;  1PFN A;  1E2Z A;  1LT3 D;  2F4I A;  2A73 B;  3I70 A;  4KY7 A;  3GTK B;  4A3F B;  1ZYR D;  4CJ1 B;  2RSO A;  1EFI D;  2KEC A;  4F8M A;  3I4N B;  3JAM E;  1F2Y A;  3TDQ A;  4R9W A;  1DOL A;  1TWC B;  3J81 E;  1GUT A;  1CT1 D;  3M7G A;  5T1I A;  1Y8O B;  3HRZ C;  2L12 A;  2B2T C;  4H0L C;  2HDL A;  1C48 A;  3C1E A;  2B2Y C;  1YNN C;  2EVB A;  2SOB A;  5E1F A;  2A6E D;  5C0X G;  1I4H A;  5DEH A;  3NWS A;  5C4Z A;  2WIN B;  4X3K A;  4H44 C;  1GXD C;  1ENF A;  2KOL A;  1LTI D;  2MPM A;  3IAY A;  4RCN A;  3T4A C;  1PRT D;  1K8M A;  2PZU A;  1RTO A;  4ME5 A;  1STB A;  2X6G A;  1EQV A;  1ET9 A;  2XVS A;  5C0X I;  2NN6 I;  1JWM D;  2F0D A;  2PCF B;  5ELD A;  3KK7 A;  2J4X A;  3DUZ A;  2IT1 A;  5IIF A;  4UDU C;  5D3D A;  1EZ8 A;  3HZX A;  4X3S A;  3E6Z X;  5IGD A;  5G3L D;  3WOF A;  1IW7 D;  3I72 A;  4EVO A;  5IGG A;  3RZD B;  1XYI A;  3MC0 B;  1Z47 A;  3M7N A;  2Q8T A;  5K36 G;  1I6H B;  3KF8 A;  1TU2 B;  2NTT A;  1U4L A;  1EYC A;  2Q8R E;  2E2I B;  1IHZ A;  5JOB A;  2A6H C;  5FLX E;  3MAQ A;  1JOQ A;  1KTK A;  5IOD A;  1XWE A;  1FNW A;  2OEO A;  1JR0 D;  1JE4 A;  1IKM A;  5EBC A;  3SHL A;  3TN2 A;  3L9A X;  4ZYS A;  1RF2 D;  5JVG 3;  1G8Z D;  3QIA A;  2PO4 A;  4ID6 A;  3K5O A;  3S9W A;  2R93 B;  2D5D A;  2F0L A;  1ZKO A;  5HGT A;  1VMC A;  4LMQ D;  1E2V A;  4LJZ C;  4BS9 A;  4G7Z C;  2NVX B;  2F0G A;  4DNR B;  2E2D C;  4JBW A;  5ISR A;  2M00 A;  1I4G A;  2QKI C;  4H13 C;  2CHB D;  4A93 B;  4C3J G;  5NUC A;  5CMD A;  2D62 A;  3BG3 A;  3DEP A;  4K2K A;  1IKL A;  1H9S B;  5ELF A;  1D5M C;  4KKT A;  1Y69 U;  3A8I E;  3RMH A;  1EY6 A;  1H9S A;  2NWG A;  1KDA A;  5DAU A;  3VA7 A;  1L0X B;  2SDF A;  3BZD B;  5AFW A;  1EU3 A;  2JA6 B;  4A3G B;  1S5D D;  2CQA A;  4PMB A;  2F3V A;  3GTO B;  3LX0 A;  3VR5 A;  3TP5 A;  1R4Q B;  1CTM A;  3MXU A;  2JA8 B;  3P75 A;  4BA1 I;  3H91 A;  2PW5 A;  3UI2 A;  1BCP D;  1PZK D;  3I3C A;  2BE5 C;  3K6O A;  2PQE A;  1UAP A;  4C3J B;  4DA2 A;  2DN8 A;  1CZG A;  4NW2 A;  2V4D A;  1I4R A;  1W6J A;  5C3W A;  2K04 A;  2D2C C;  1SNP A;  1TY2 A;  1FR3 A;  2HCC A;  1QCB D;  3K57 A;  2H4O A;  3VR3 A;  4N9T A;  3BDO A;  2TSS A;  1KAB A;  3N52 A;  1JB3 A;  1KNA A;  3M3Y B;  5CV5 A;  1BXT A;  1HA6 A;  3LWU A;  3HOW B;  1SE3 A;  5DM6 3;  3L7Z C;  3R2I A;  1I3Q B;  3EA6 A;  5ELC A;  1QNK A;  1G2T A;  2K01 A;  4O1N A;  1TWH B;  4RGT A;  1S5F D;  1MBY A;  2K6A A;  3KUP A;  1HQM C;  3ERQ A;  5M5W B;  4KN7 C;  3MXP A;  4RH6 A;  1ENA A;  4RAU C;  3T16 A;  3K5L A;  1A15 A;  1GUW A;  1PFB A;  1GUS A;  4HN7 A;  1AZQ A;  3GTG B;  1SJE D;  2K32 A;  1S4Z A;  2VXW A;  4C56 C;  4DXF A;  4Q5V A;  1SYC A;  1TS3 A;  4NDX A;  4FVM A;  1RTN A;  5EJW A;  2I46 A;  2NTS A;  3KLR A;  5LL6 X;  5I6Y A;  4K2L A;  5C0X J;  5J39 A;  4DGZ A;  2IWH A;  1X3P A;  2K7V A;  4ZUI A;  2L11 A;  2K33 A;  2YYZ A;  2C9O A;  4DAV A;  3IFD A;  3H3V C;  1RD9 D;  5J22 A;  1D2B A;  1Q8I A;  1DM0 B;  1KLU D;  3N6R A;  2B8G A;  3QO2 A;  1BNZ A;  1LT4 D;  1TT2 A;  1YNJ D;  1SSO A;  2DY7 A;  1BO0 A;  1HXY D;  3U9S A;  3K59 A;  4Y7N B;  1U9R A;  1Z7T A;  3S1M B;  2BDN A;  2ICE C;  3RZO B;  3SEB A;  4A3D B;  3MFG A;  4PMW A;  4K8I A;  1CA6 A;  2A69 C;  4OO1 H;  4FF1 A;  1W6K A;  1RCV D;  2EYF A;  3PIO 3;  3H0G B;  1OXT A;  1FNV A;  5EKK A;  1B3A A;  3A55 A;  1B44 D;  2LS0 1;  4PV1 C;  2TMP A;  1NR4 A;  1F9Q A;  1SNO A;  2F0N A;  5I9P A;  4EQO A;  3TZD A;  5M3M B;  3VYT A;  5EBD A;  5J1Z A;  5BN3 A;  4DU9 A;  1EY0 A;  3P20 A;  2L5T A;  2KVM A;  1EY4 A;  3TME A;  2R61 A;  2EY5 A;  2AQ3 B;  3M85 A;  2ZXR A;  4S3S A;  3PMF A;  4QF4 A;  1DYQ A;  2J7Z A;  1H9R A;  1Q1B A;  3S16 B;  4ODG A;  1CI3 M;  2ZXP A;  1F9P A;  1O7Z A;  3HOV B;  3H6M A;  1B4O A;  1EYA A;  5JPM C;  3MXG A;  2M2L A;  2RDG A;  3DEO A;  4I7Z C;  4EQN A;  1BF4 A;  2BDO A;  4RKL A;  5IT9 L;  2F0P A;  1SYG A;  5DM7 3;  3HOY B;  2FFK B;  2E2J B;  2EYH A;  2SNS A;  2AUJ D;  4RGM A;  3S1N B;  1SJH D;  4DN4 M;  4ABN A;  4V0B A;  2AQ1 B;  1VF7 A;  3MFY A;  5C4J B;  3DWP A;  3C46 A;  2PMZ B;  3IFT A;  4IAL A;  3NTI A;  3HP3 A;  2CVR A;  4IUR A;  1EL0 A;  1RDP D;  2D9U A;  4XYQ A;  1MI2 A;  1A3U A;  3SXH A;  1HUM A;  2QDB A;  1QJO A;  2EE1 A;  4KD4 A;  4G7H C;  2NB0 A;  2QEJ C;  2I07 B;  3TSS A;  1I4Q A;  4QUF A;  1Y8P B;  3A7A B;  3FMC A;  4MHE A;  1LTR D;  3ONA B;  2B63 B;  5IOC A;  3T51 B;  1F2L A;  3J7Y W;  3J7A V;  2RSN A;  4RGO S;  3F2U A;  1WD0 A;  2KHS A;  2JEB I;  1SMY D;  1M8A A;  1EIH A;  1QNU A;  2F0M A;  3OW7 A;  4P2C B;  4CKB A;  3I4M B;  1HQR D;  2R6G A;  5I2X A;  2A74 C;  4RCO A;  1Y1V B;  3Q6S A;  5CC4 A;  2CW0 C;  4PQX A;  5FO8 B;  3FEW X;  4NMZ A;  2QCP X;  1SNQ A;  1DCZ A;  1J9O A;  1TS2 A;  2B2W A;  1QWY A;  5A35 A;  2IX0 A;  5D3I B;  2L0C A;  2N88 A;  1HA5 A;  1GUN A;  1DOK A;  1O80 A;  2A68 C;  2XRQ D;  3FVQ A;  2JSO A;  4HTH A;  3VR2 A;  1U4M A;  5LHY 1;  4EQP A;  3URY A;  1JQY D;  1V1P B;  1G2S A;  3I91 A;  3S2D B;  4QB4 A;  3P1H A;  4IFD H;  1V1P A;  4KD3 A;  1OXV A;  4U68 A;  1S5B D;  2LFN A;  4EGV A;  1JOK A;  4RFB A;  2ZT9 C;  5JEA H;  1TWG B;  3SK4 A;  2O5J C;  3HOU B;  2Z4H A;  4FO2 A;  3OOC A;  1GHK A;  4RA8 A;  3BVZ A;  5HUR A;  4XTC S;  3FDT A;  2FJ2 A;  3OWF A;  4PMC A;  1EWH A;  1AN8 A;  3TP7 A;  2K05 A;  3I73 A;  3D6W A;  3H94 A;  4FF3 A;  4DK0 A;  3NSW A;  4K5V A;  1QOH A;  5CV6 A;  1O7L A;  5CV9 A;  3SK8 A;  4KKU A;  1SDF A;  1CM9 A;  3JAM L;  1RHP A;  1E2W A;  2QF7 A;  1KAA A;  4O42 A;  4L6T B;  3J81 L;  3LNN A;  5KYL A;  1XXG A;  3M4Y A;  4JK1 C;  3GTP B;  2F0K A;  4FXD A;  4QUC A;  1CHQ D;  4KY5 A;  1LV9 A;  5C3E B;  1H9K A;  3A8J E;  1TWF B;  4XYO A;  3U9O A;  3I90 A;  4KHV A;  4ZQ3 A;  1WTV A;  2WB1 B;  4HCE A;  3QB3 A;  4RKB A;  3PUW A;  1F9R A;  5I2Y A;  4NKL A;  3NE5 B;  4KJN A;  1PTO H;  1KLG D;  1F2Z A;  5T1G A;  4KMU C;  2L4N A;  2JA7 B;  2VUM B;  1B9M A;  1DD2 A;  2KJX A;  1SYF A;  1A6X A;  4L63 B;  1GHJ A;  3Q23 A;  1F9S A;  4BWG B;  1DJR D;  2E75 C;  3PO3 B;  3P7J A;  5DNF A;  2B2V A;  4DAP A;  1ZYR C;  2Y0S B;  3DWA A;  3HKZ B;  3EFX D;  1VF5 C;  1SE2 A;  3CKI B;  2EYL A;  1XX8 A;  2WP8 J;  4TRD A;  2F0Q A;  5FO7 B;  5CGK A;  3GTQ B;  4IN3 A;  1BOS A;  1TVX A;  1Q90 A;  3EJI A;  1AZP A;  5EGT A;  2EYO A;  3MEH A;  3QOL A;  1BDO A;  5C44 B;  3AB9 A;  1OO9 B;  1PMR A;  5FOB B;  1A3T A;  2A6E C;  4G4K A;  4ULL A;  2FMC A;  4HCS A;  2PNR C;  1R9T B;  5IGC A;  1DXM A;  1PTO F;  4J6H A;  3GD7 A;  4K5X A;  1QB5 D;  1RJT A;  4XQN A;  1ZXT A;  2XSC A;  1TQO A;  5FLX L;  3VYS A;  1B9N A;  1SXT A;  2DY8 A;  1VMP A;  1EEI D;  1PRT C;  2EYJ A;  2RBM A;  1C4Q A;  2FMM A;  2RVL A;  4CKC A;  2ICI A;  1R4P B;  2AWO A;  3I8Z A;  3Q22 A;  4K6D A;  2AQ2 B;  5JEA G;  3K0Y A;  2Z8L A;  4IUV A;  3KLS X;  2JYO A;  4WOR A;  3K7A B;  3W2D A;  1Q3L A;  3T56 B;  5IGE A;  1O78 A;  2RDF A;  4ZLT F;  4CKE A;  3C3L A;  3R2T A;  1SNM A;  1F2M A;  1I4P A;  1AEX A;  4QIW B;  1CQF A;  1ML0 D;  2EPB A;  5M3F B;  2WKC A;  5M5X B;  3R3O A;  3V2T A;  2FIN B;  2SNM A;  5E4X A;  5KGU A;  1V8Q A;  1IW7 C;  1EZ6 A;  5JJZ A;  2LY7 A;  2Z4I A;  1S5C D;  1WVL A;  3PUV A;  5COY A;  1STE A;  1FNU A;  3FPP A;  1DOM A;  2B39 A;  3QG1 A;  4KV6 A;  1GJX A;  5FO9 B;  1K8O A;  1J8I A;  1WCM B;  5KIX A;  1B2T A;  5KNC A;  1WTP A;  5BN4 A;  1GUG A;  1EQT A;  1PTO C;  3DXJ C;  3VA5 A;  2O2L D;  3DM1 A;  1PRT B;  3FRP B;  2E74 C;  1ENC A;  2F0S A;  4AYB B;  2F0U A;  2WAC A;  4KKS A;  4WFN 3;  4FXK C;  4TSS A;  1MGS A;  4IQZ A;  2RDH A;  3R93 A;  4H7B A;  3OWE B;  2MHV A;  4IUN A;  3E0J A;  3CHB D;  3X3M A;  3X3N A;  2E2H B;  4Q0F A;  1JCK B;  1ROD A;  3OIP A;  2F0I A;  1MSH A;  3NHH A;  1NCV A;  4XT3 B;  3NQI A;  4XQJ A;  1TWA B;  4FF2 A;  5JVH 3;  2EYP A;  5JAV A;  1HTP A;  4KK7 A;  1EU4 A;  3K58 A;  1ICW A;  2C5C A;  1VCI A;  3DMU A;  4ILW A;  3T13 A;  5C6A A;  1I4X A;  3S14 B;  2R7Z B;  2BA0 A;  3NBI A;  1G6Z A;  1PTO B;  2A5H A;  4RHR A;  1U4P A;  3EVQ A;  5EPJ A;  1LT6 D;  1BCP C;  5I9O A;  2X6L A;  2NYZ D;  4CJ2 C;  3HEJ A;  1HUN A;  4X3T A;  2L9H A;  1QE6 A;  4LK1 C;  5IT9 E;  4FYD A;  3AU7 A;  3BS1 A;  1UNS A;  1EWC A;  4R8N A;  1ZEQ X;  3D3R A;  1I6V C;  2IJ0 A;  1B53 A;  4ZKB B;  2CW0 D;  3T53 B;  1Q1E A;  3J80 L;  5A2Q E;  3ERO A;  4OIK A;  4BA2 I;  3NTK A;  4B08 A;  5C0X H;  1D6E C;  2NN6 H;  2KQ3 A;  2L1B A;  3NUC A;  1LO5 D;  4J1M A;  3G6J B;  4M1U B;  1V1O A;  2F0V A;  1YNN D;  3J7A F;  5C4X B;  2F0O A;  3OPO A;  4ZKC B;  1DON A;  2R92 B;  3DHQ A;  4IUT A;  2BOS A;  3SDZ A;  1BCP B;  1PXU A;  3D31 A;  1ONL A;  1HFG A;  1B50 A;  3GP7 A;  4CJ0 B;  2B2U A;  1JWU D;  4KJO A;  2OXP A;  3BYY B;  1IL8 A;  1STH A;  3LWE A;  3WDN A;  2B2W C;  3MHB A;  2WII B;  1CA5 A;  4K5W A;  3QOJ A;  1ESF A;  4DNT B;  3Q0A A;  4RGN A;  1A2T A;  1L0Y B;  1T5X D;  3CRK C;  4KTA A;  5CR3 A;  5CV7 A;  3PIP 3;  1GOZ A;  4OL7 A;  1JOR A;  1ILQ A;  4A3J B;  1YNJ C;  1Y1W B;  2VB2 X;  5JEA J;  1G91 A;  5CBE E;  2JXM B;  3BVG A;  2F0W A;  2PZT A;  1ESR A;  1LLR D;  4DFA A;  2EZV A;  1SFO B;  1TY0 A;  4KI0 A;  1PZJ D;  5EQ0 A;  3NXW A;  1HPC A;  3CU7 A;  1SYE A;  5KNB A;  2R3Z A;  1SYB A;  4XDX A;  2M9V A;  3SVM A;  2A6H D;  3OMG A;  4Z9C B;  2HDM A;  5F2D A;  5C4H A;  5I4D A;  4OO1 G;  4E6I A;  5KRU A;  3MWY W;  1LAB A;  4WRD A;  2F0F A;  1HFN A;  3V05 A;  3GO5 A;  2WV6 D;  3K5M A;  1UEA B;  1D5Z C;  1WTX A;  5E4W C;  1CQV A;  1EYD A;  5EPL A;  2WAQ B;  3HGB A;  3AMU A;  1HTL D;  4OHJ A;  5KEE A;  1EY9 A;  3V96 A;  1BUV T;  4OO1 I;  2K1B A;  1D1I A;  2G9D A;  4ZK9 B;  2Q8I B;  1LTA D;  3NP8 A;  1LTS D;  4HMI A;  4TKO B;  1IYU A;  4R8I A;  4FP5 D;  4K6L A;  4DK1 A;  2EDG A;  1LAC A;  3A54 A;  3ZYY X;  2EJG C;  1PDQ A;  2NN6 G;  2Z1C A;  1IYV A;  4HMJ A;  4C3I B;  2EJF C;  1SEB D;  2KEE A;  2NBF A;  5C5L A;  1FYC A;  3NQT A;  5JPN C;  1PLF A;  2B8F A;  3Q24 A;  3S1R B;  4OIJ A;  1AP0 A;  2BE5 D;  2B2V C;  4A3B B;  4K14 A;  1OXS C;  5CYU A;  2XRS D;  1T5E A;  3PO2 B;  4CGY B;  1D1K A;  3D4W A;  1WD1 A;  4HSV A;  1A3V A;  3E5S A;  4QCL A;  2F03 A;  5E3F A;  5D65 A;  4IUP A;  3RUZ A;  1TII D;  3IL8 A;  3SR1 A;  4IZ8 A;  3MVV A;  2IX1 A;  3PUY A;  2O4X A;  3GV6 A;  2VB3 X;  3EQL C;  2K03 A;  2EY6 A;  5CV4 A;  1SYD A;  3PUX A;  3D4D A;  2B2T A;  4YIJ A;  3GTJ B;  4KN4 C;  2B2Y A;  4U67 3;  5FKA C;  1PRT F;  4RWS C;  4DXG A;  1LTT D;  5M9O A;  1SMY C;  5FK9 C;  1LTB D;  3RLF A;  1DZ1 A;  1EIG A;  2NVT B;  3K5N A;  1PTO D;  3PUZ A;  1JWS D;  4WJW A;  1II3 A;  2XNA C;  2DNE A;  4RHS A;  4F7X A;  5C3X A;  3PV0 A;  2AWN A;  4UAI A;  1ET6 A;  3GQB A;  2JP1 A;  3MTS A;  4FF4 A;  1O7Y A;  2JEA I;  4PNY A;  1CFM A;  1K83 B;  4BY1 B;  2ZXO A;  3KBX A;  5C5M A;  2NUC A;  2SEB D;  4FNF A;  2NVQ B;  5G3L F;  4MIU A;  4A3I B;  3A56 A;  2PW7 A;  5ELB A;  1PFM A;  1GUO A;  3A8K E;  1EY8 A;  3O13 A;  2HQE A;  4F87 A;  1H9M A;  2HCI A;  2KCC A;  2EOT A;  1M4V A;  4ZUJ A;  2A69 D;  4N9P A;  1Q12 A;  4KHZ A;  4L8J A;  1EY5 A;  4B9W A;  2IX3 A;  1A2U A;  3BYT B;  4IFD G;  3D6C A;  5EKI A;  3I4L A;  4XXE A;  1HHV A;  3R8B A;  1PZI D;  1Y8N B;  4XQQ A;  1STG A;  4ZRZ A;  1V43 A;  2PYK A;  4BBR B;  4A3E B;  3G7L A;  4IUU A;  1TR5 A;  2J0T D;  4F88 A;  4NP5 A;  1KNE A;  1WTR A;  1STY A;  4A3M B;  3GV3 A;  4B9X A;  4IFD I;  1TS4 A;  3TP6 A;  3SK6 A;  3MA2 B;  1WTO A;  2BCO A;  1CZW A;  3C2P A;  2IW3 A;  1QIL A;  5EPK A;  1TKW B;  2F1M A;  2OF1 A;  3ITP A;  2F0J A;  1EEF D;  4HSP A;  1WTQ A;  3FPU B;  1E0B A;  3OIQ A;  4A3K B;  3OHX C;  3TP8 A;  1BCP F;  2JE6 I;  2FHT A;  5ELE A;  1WTW A;  5M5Y B;  1LT5 D;  1Z6H A;  5KYI A;  2E76 C;  4FXG C;  4IUQ A;  4K8J A;  4BBS B;  2BA1 A;  1BBX C;  2F3W A;  3FKI B;  3ND8 A;  1C8C A;  2RA4 A;  3HOZ B;  1CHP D;  2EY2 A;  4G7O C;  4CHT B;  2L55 A;  2F0H A;  3A7L A;  1SBB B;  2YU9 B;  4XIG S;  3MXN A;  5BN5 A;  1MSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...