2KHSA

Solution structure of snase121:snase(111-143) complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title The native-like interactions between SNase121 and SNase(111-143) fragments induce the recovery of their native-like structures and the ability to degrade DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 26
structure length 121
sequence length 121
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2khsA00
3U9OA 2O4XA 5EKKA 5KEEA 1KABA 3D8GA 4KHVA 2F0JA 2EYOA 2SOBA 5C6AA 3D6CA 1SNDA 5HGTA 1ENAA 2F0WA 4QF4A 3R3OA 3TP7A 5IODA 5CV7A 3D4DA 3BDCA 1F2YA 5KGUA 2F0IA 2F0QA 2OF1A 5CV8A 2WACA 1SNOA 5C5MA 4HMJA 1SYBA 4HTHA 4RKLA 5I6YA 4PMBA 4E6IA 5KYLA 5IGGA 5IGDA 2EYFA 4R8NA 4F8MA 5IOCA 5M9OA 1SNCA 1II3A 2EYHA 3TP5A 5KYIA 3OMCA 4KJNA 3NQTA 4WRDA 4I65A 1NUCA 1EZ6A 5DEHA 3RUZA 2RBMA 1STAA 4NP5A 4PNYA 5CV9A 5E3FA 2F0VA 2F0SA 1SYEA 1U9RA 1SYCA 2F0UA 2RKSA 3SR1A 1JOKA 4RKBA 4OL7A 4G57A 5JOBA 1EYAA 1F2MA 4B9WA 5IGEA 2RDFA 4EQPA 5I9OA 5IGCA 5IIFA 2F0TA 3E5SA 3P75A 4KV6A 3NHHA 2EXZA 2EY1A 4KY6A 1STNA 2EY2A 3MXPA 4DGZA 1A3UA 2PZUA 3LX0A 3TP6A 5IGBA 1TT2A 2SNMA 2EYPA 3P1HA 1A2TA 5J1ZA 5I9PA 4KTAA 3EROA 3TP8A 2F0GA 5E1FA 4DFAA 3QOLA 1EYCA 1EYDA 1NSNS 2EY6A 2M00A 3QB3A 4ME5A 1EY8A 5F2DA 4DU9A 4K6DA 4KY5A 2F0FA 5KIXA 2KHSA 1AEXA 2PW7A 1STYA 3NUCA 1IHZA 3SHLA 4KY7A 5EKLA 2EY5A 3NP8A 1EY5A 3ERQA 3ITPA 2F0MA 3DHQA 4ID6A 4IALA 3HZXA 4DF7A 1EY0A 3C1FA 4F7XA 1SYGA 3OMGA 4J1MA 5CC4A 4K8JA 4J6HA 4KD3A 2LKVA 5C3XA 4NMZA 1EY6A 3MEHA 2F0LA 4TRDA 5JAVA 5J39A 3C1EA 2SNSA 4KD4A 1STGA 5CR3A 4EQOA 4PMCA 2OEOA 4IUNA 3MHBA 1A3VA 4K5XA 4MIUA 3SK6A 4K14A 3H6MA 4WORA 1EQVA 3PMFA 5C3WA 2F3VA 1EZ8A 4N9PA 4S3SA 1EY9A 1A3TA 1SNQA 4YIJA 1STHA 3D4WA 1TR5A 5I6WA 2F0HA 2EYMA 2OXPA 3NK9A 3OWFA 2F0KA 3QOJA 4QB4A 1KAAA 4NDXA 4K5WA 3T16A 5IGFA 3SK8A 5HURA 2EYJA 5CGKA 4KJOA 2PQEA 5K5PA 2PW5A 3BDLA 1JOOA 3MZ5A 4LAAA 4B9XA 4K2KA 3HEJA 1STBA 2F0NA 2NUCA 1KDCA 2HQEA 3NXWA 4K5VA 3SXHA 3VA5A 1A2UA 1ENCA 3EVQA 1SYFA 5C4ZA 5ISRA 1SNPA 3OSOA 2EYLA 4NKLA 3SK5A 4IZ8A 3S9WA 5J22A 5CV4A 4EQNA 3V2TA 2F0OA 2F0PA 4N9TA 5CV5A 5NUCA 2F3WA 2PZTA 4ODGA 3T13A 5CV6A 1KDBA 1SYDA 2ENBA 1F2ZA 3SK4A 4K2LA 2QDBA 3DMUA 4QMGA 3EJIA 1RKNA 5EGTA 1JORA 4ZUJA 4H7BA 4ZQ3A 4K8IA 1SNMA 2PYKA 1EY4A 3TMEA 4ZUIA 2KQ3A 1JOQA 3MVVA 2F0DA 4HMIA 5C5LA 5C4HA 4EVOA 2PZWA 1TQOA 5KRUA 2F0EA 5DAUA 1KDAA 1EY7A
chains in the Genus database with same CATH superfamily
3U9OA 4Q5VA 2JEBI 4H02A 3GQBA 2K7VA 2F0WA 2XRQD 2VQEL 1SYBA 2LS01 5IGGA 1E2VA 4R8NA 1IXRA 1II3A 2C35B 3IAYA 3TN2A 3I4NH 2IJ0A 4LF4L 1WD1A 5IE8A 1Y1VG 5JOBA 1S5DD 4JI6Q 5IIFA 1VQJA 4KV6A 2JQOA 2JJQA 1GUGA 4HIDA 4DA2A 1M1KC 2EYPA 4KKUA 3HFZB 3T1YL 4DFAA 1T9HA 4X3UA 1KRTA 1TS5A 1HZBA 1NMGA 4DR1L 4DNTB 3CHBD 3TS2A 1EY5A 5FLMG 4OO1H 1I4PA 3KLWA 4GNXA 3I4MH 4R4CA 1LYLA 3TRZA 1EQRA 1EYGA 3S16H 2QCPX 3OYYA 4AQYQ 5ELDA 1XNQQ 3QJYA 3PF4A 3S2DB 1X6OA 1K28A 1N34L 4A3BG 3J81j 3JAME 4PQXA 4BA1I 2P5ZX 1TWGB 1YIJA 4MTNA 2Y0SB 3T4AC 4PZ7A 4IFDI 1J8IA 4NXMQ 2R6GA 3CP0A 3D6WA 2EYLA 4NKLA 2WAQE 4IZ8A 1SXTA 1BO0A 4AIMA 3HOWB 1U0LA 3RLOA 3CCUA 1VQAA 3VYSA 2JK8A 4JYAQ 1AZPA 3S1NH 2GVAA 4L5TA 2WB1B 2JA6B 5L37A 3S2DH 1JOQA 2C5CA 2MO1A 4HIOA 3NTHA 3A7AB 5KRUA 1LLRD 4C2MH 2E2IB 5TSSA 5CV7A 4B3ML 1Q3LA 1STEA 4C3HG 3NTKA 1EQQA 4HMJA 4PZ6A 2K5VA 5C0XJ 2IWHA 1PFNA 3PUVA 1PMRA 4WRDA 3I8ZA 3G6EA 5DEHA 1FYCA 2NN6I 4DUYL 2VL6A 2TMPA 3HOWH 1L2FA 1SYEA 2BOSA 4X3KA 4NXNQ 2J0TD 4FF4A 1XMQL 1OXSC 5I4DA 1XJVA 2CFMA 1O7LA 2EY1A 2EY2A 4OWXB 4HIMA 1L0YB 4QCLA 4XYQA 1A2TA 2K33A 4C1NI 4IUUA 2F0GA 3P7JA 4DXGA 1SFOH 3FP9A 1FGBD 3GTOB 1ZEQX 1BCPF 2KECA 1AZQA 4L63B 1LTAD 3SHLA 2X6GA 4DK6C 1TY2A 3HZXA 1BR9A 3ND9A 4JOIA 3VA7A 3KJOA 4O0AA 3K58A 1C8CA 1F9RA 3F2DA 2D5DA 5CR3A 5IYDH 1TWCH 2VS1A 4C3IG 2A19A 1V1OA 5ELEA 4IPCA 4WORA 1BCPD 2PQAB 2WINB 1STHA 1AE3A 4IFDH 2VUMB 4FXKC 3QOJA 2Z1CA 2XN9C 2FJ2A 2F1MA 5HURA 1BCPB 2NUCA 2B2YC 1HNWL 3CCSA 1I4GA 1VMCA 5C4ZA 3GTOH 1I94L 3M4OB 4B3SQ 1L1OB 1QB5D 4X3TA 1CA5A 2PI2E 3V2TA 4DV5L 1J9OA 2F0PA 1G6ZA 5AJ3L 4DV7Q 2XVSA 1EEID 1X55A 1ESFA 4IO9A 1HUMA 4ZCKA 4QMGA 3MXNB 4GKJQ 3RD4A 4DV4L 4BXXH 1GHKA 2N8NA 2NYZD 5C5LA 2DGYA 5DM73 1HHVA 1XYIA 1D5MC 4J8QA 4X66L 4CDEC 2B2TC 1DOMA 4A3FB 1EY7A 1YNND 2FHTA 3GP7A 1QE6A 4XXEA 2F52A 4DV1L 3H0GH 3HOYH 2O5JC 4ALPA 2JA5G 1PH4A 3RMHA 4P73A 1EFWA 3EFXD 2F0QA 3C2PA 5KEEA 2B2UA 2NN6H 1V1PA 1PH2A 1PZID 4QGUA 3M3YB 3CPWA 5DNFA 4FP5D 2A73B 1STAA 4IUPA 1U9RA 4HJ9A 4G7ZC 4KLKA 1VQ4A 4LFAL 1E1TA 1KAWA 1D7QA 5I9OA 1HZCA 1PTOC 2B2YA 3I4OA 1TKWB 2V4DA 2B63B 5FO7B 3P1HA 3A55A 5J1ZA 4A3FH 1IBLL 2FINB 1PFSA 1CQFA 2NB0A 2AUKA 4K6DA 4OGQC 2VW9A 3R8BA 2AMCB 3GTMB 1XNRL 1CK1A 4HCEA 4FNFA 1P16A 3ULPA 1M90C 1SYGA 1YJNA 3CCQA 5KNBA 2JE6I 2C9OA 4LK1C 1RCVD 5JVG3 2LXKA 3FPPA 2CH4W 4JBKA 1QVFA 3GTPB 4JBWA 2KUMA 1OXUA 3Q6SA 4C3JG 3W1GA 1ML0D 2NVQH 4A3GH 5C3WA 2KEEA 3PMFA 2DJFC 2F3VA 2B2WC 2KVMA 4JI8Q 3EA6A 4C56C 4DR2L 2B63H 3K5NA 5IGFA 1JJ2A 1HQRD 4L5QA 2XSCA 1B8AA 1FVIA 4LF6L 2KBNA 5IYBH 3VYRA 1IL2A 4YCVA 2CWPA 1WTXA 2BA0A 3N6RA 2ZM6Q 3GTMH 1EIGA 3T53B 4BS9A 5CORA 4HIKA 3D0FA 2QA4A 2XIWA 5IP9H 3NBHB 1PYBA 1PRTC 5EGTA 1B44D 1BNZA 4LF7Q 3GTPH 1IW7C 2M2LA 2UU9L 5BN3A 3AFQA 1Q86C 4HCSA 3CCLA 3EN2A 1FD7D 1OTCA 1RD9D 4GKKL 1SNDA 2KCMA 1ENAA 3TZUA 1I6HH 2VZAA 1HPCA 1BQQT 1WCMB 4GOPC 1KRSA 4XIGS 1YHAA 2EYFA 2NBFA 2YYZA 4KKSA 1SNCA 5EBCA 1FNVA 1UUPA 2DY8A 1NY4A 3WOEA 4DR4Q 1XPOA 3UDIA 1VS0A 2RBMA 4NP5A 1TVXA 4O2DA 2HHHL 2E2DC 4BBRG 5CBAE 5C4JB 2R7ZB 2RKSA 4GN3B 1KNAA 2JA8H 2IT1A 4DV2L 4QJFA 3ND8A 1N33Q 3S2HH 5C44B 4ILWA 4JI4Q 3MXPA 4IQZA 3T56B 2JA7G 3DEOA 1PH5A 3J7AV 1K3BC 4L5RC 4KTAA 4A3LG 3A5ZB 2F4VL 1Y1WG 2A69D 2UXBQ 4R4IA 3R2TA 3U4ZA 3DLLA 4FXDA 4LFCL 1ONLA 2RDGA 1CKNA 4DAPA 1QOHA 1IBKQ 2ZT9C 4J15A 4OONA 3MWYW 2CVRA 2HCCA 1AN8A 4YCWA 4C1NK 1O80A 2RA4A 1SSOA 4A3JB 4BY7G 4KHPL 4KD4A 1STGA 1GUSA 1SROA 2MJ8A 3HKZB 1S5BD 3SK6A 3CRLC 1ENFA 4N9PA 1GM5A 1KC8C 2I5HA 1B2TA 5C44H 3TDQA 1JR0D 4GOPA 1J5EQ 1LTID 4LF9Q 3MA2B 1ET6A 3RZDH 3JAML 4A3DG 1QVGA 2UXCL 1JOOA 2AQ1B 1BOSA 2VQEQ 2OTLA 1AP0A 3NXWA 4OELB 3HKSA 2IHEA 4G7HC 1LM0A 2Z6BA 4LF5L 2HCIA 4KN7C 3TEHB 3PO3B 3SK5A 2BCOA 4DV6L 1XX8A 4LF4Q 3H3VC 3PQIA 4A3CG 2A1AA 3FVQA 1SJHD 5FKAC 4GLXA 4UY8C 1LACA 1VQGA 1SYDA 4TQUS 4DUZL 1RDPD 4K2LA 2QDBA 1EQTA 2F3IA 3W1BA 1ICWA 1Y1VB 4F87A 1G2SA 5JVH3 1EY4A 2F4IA 3T1YQ 5GQOA 1PZJD 2DY7A 2QEXA 4EVOA 4A3KB 3KF8A 3BYYB 1CZGA 4NW2A 1DD2A 5COYA 4HN7A 1CTMA 1JT8A 4R9WA 3UE0A 3G48A 4CBVA 3A0JA 1IL8A 2F0IA 1S5CD 3F2UA 1SJED 3CCEA 1OO9B 2ID0A 1A0IA 5M9OA 2Z4HA 2GA4B 4XT3B 2LY7A 1N34Q 2F0SA 1CSPA 3K57A 2I07B 4KY6A 1Y1VH 4A3BB 1U4MA 5T1GA 1YHBA 3MFYA 1TWAB 2MNAA 4R4TA 3A54A 4L6TB 3M7GA 2Y0SE 3HOVB 2XWJB 1SLJA 3BU2A 3OTOL 1H9SB 2HDLA 2Z6KA 2PW7A 4UP7A 3K6OA 4KY7A 4RAUC 2EVBA 4JW0A 4KHZA 3K80C 1DONA 1Y14B 3L7ZC 5FLMH 3T1HQ 1BVSA 3H09A 1PZKD 1I5FA 4XTCS 3C1EA 4TKOB 3MHBA 2RSNA 5A35A 2ASBA 4FO2A 2SDFA 5LL6X 4P71A 5FO8B 4A3BH 4TVAB 1BBWA 4NDXA 3T16A 5JJIA 4WJWA 1TWAH 5K5PA 4B3MQ 2R92B 4ZYSA 3MZ5A 2B8GA 4QIWB 5M5XB 4X6AH 1MGSA 3VA5A 4K5VA 3RZOH 3KBXA 3N52A 3CU7A 1BDOA 2AQ3B 1D8LA 5EPJA 2L12A 1A63A 4DUYQ 3KFUA 2NTTA 1PH1A 4P74A 5CV5A 5D14A 1ZKOA 3PIO3 1XMQQ 4DR3L 3NELA 3E0JA 5JEAJ 2E5LL 4A75A 3STBD 1TXYA 1JORA 4ZUJA 5IWAL 2R7FA 4DAYB 5EQ0A 2F0EA 3I73A 3PSIA 3DEPA 2IL8A 5K36G 4HAEA 2K5HA 4FF1A 1G2TA 4RHSA 3I4NB 1HTPA 1NJIC 2KJXA 1PFMA 1X3QA 1SNOA 5C5MA 1MKHA 2B2VC 3J81E 5IOCA 3GO5A 4C3HH 3MAQA 5IT9E 1PH7A 3NQTA 1YBYA 3L9AX 2Z0SA 1QWYA 2F0VA 4GN5A 1SRUA 1CSQA 1EYAA 2BA1A 5IGCA 4ZLTF 4ULLA 4HSVA 3J80E 2SNMA 4O1NA 3PUZA 3KF6B 1YJWA 3OOCA 1HNWQ 2BE5D 4ME5A 1I94Q 3NSWA 4XQNA 3K7UC 3E0EA 4DU9A 4AYBE 3I4MB 2K01A 4DV5Q 2IY5B 2ZJPA 1STYA 1Z9FA 5AJ3Q 2KA7A 3S16B 1PH8A 3DHQA 4ID6A 1W6KA 1Z47A 4F7XA 5M3MG 2D9UA 1RHPA 2K75A 1HNZL 3NWTA 5JAVA 5D3DA 4DV4Q 5BN4A 5C3EG 4KMUC 4G7OC 4X66Q 2FMCA 2K50A 4RGOS 4MIUA 1TY0A 3H6MA 4I7AA 4HJ7A 4DV1Q 2AUJD 1WFQA 1KIXA 1L0XB 4C3IH 1TR5A 1T5XD 5EPLA 5JPMC 2B2VA 4QB4A 1K0RA 2EYJA 4JI2L 3NENA 3L0OA 1GVPA 1YZ6A 1H9RA 1ZYRC 2B3GA 4L8JA 1CHQD 2ZTCA 1SR3A 4P72A 1BCPC 3NQIA 1E2WA 1SE2A 4PZ8A 5D65A 1YNJD 2F0OA 3S1NB 1VF7A 3T13A 2UUCL 1L1OC 1KDBA 5FO9B 3SK4A 1MD2D 4Z9CB 1S5ED 1KNEA 3DMUA 5JJLA 1K9MC 2QGQA 4C2MB 4ZQ3A 3TMEA 4A3MG 2R3ZA 2MHVA 5C4HA 1IBLQ 1O7IA 2D2CC 1X3PA 3EBEA 4HEDA 1UE1A 1HNXL 4DNRB 5LMUL 4QL5A 2E2HH 1XNRQ 1PXUA 1OXVA 4GLVB 5GAEC 3ZYYX 1WTPA 4JI1L 2IHFA 2ZXOA 3X3NA 4F88A 3X3MA 2JA5H 3HGBA 4H13C 5GAHC 2XGTA 5T1IA 1GO3E 4AH6A 1NUCA 1V43A 3K5LA 2JEAI 5A2QE 2H4OA 2JSOA 3CC7A 4G57A 1Q82C 3R93A 2EPBA 3PIPA 1VQDA 4C3JB 3MXUA 4DR2Q 2PNRC 1SFOB 4FYDA 5C4XG 1Q8IA 1HR0L 3DWQA 3MEFA 1TT2A 4LW1A 1C7YA 3HOZG 4LF6Q 3ERSX 4PG3A 1XMOL 1X3EA 3URYA 1VQ8A 2KHJA 4DK0A 4JI5L 3RN5A 3UI2A 4OX9L 2K5QA 1IHZA 1MJCA 1Z7TA 1G91A 1C9OA 3NP8A 4IALA 1EY0A 4DR7L 2X6LA 1TWCB 3J7A5 2EJMA 1KLUD 1NR4A 4KD3A 4NMZA 1EY6A 2UUAL 2SNSA 2ZJRA 1H9KA 2EXDA 3TBIB 3QO2A 2K04A 4K14A 2ZTDA 3PGZA 5FOBB 4GNXB 1NBWA 1EZ8A 4A76A 4C3JH 3GTGH 1CUKA 4YIJA 3D4WA 4GKKQ 2F0KA 2Q8TA 1QZHA 4KJOA 1WJJA 4YY3L 2K14A 4LAAA 2OT2A 1EWIA 1SMYC 3A8IE 4A93G 5HGQA 1EU3A 1Y8NB 1JWUD 4EQNA 2HHHQ 5FJ8G 3QWNA 1SBBB 2PZTA 4ODGA 4JI0L 1O7ZA 2J7ZA 1IBMQ 1EL0A 4DV2Q 1VQKA 3HOUG 3SDZA 1LV9A 4BBRB 2AQ2B 1Q1EA 3IFDA 4JCVE 1SNMA 3H0GB 3PV0A 3JC66 5CYUA 3HOYB 1H9MA 4IOAA 2F4VQ 1P8LA 3E9HA 4AYBB 3K5MA 3KK7A 2A68D 2VXWA 4LWCA 4RGNA 2AWNA 5G3LF 4LFCQ 4FXGC 4ZKBB 3I91A 3QG1A 1VQHA 3PO2G 4QF4A 3T51B 1H95A 5IGDA 1ILPA 4OHJA 2OQKA 4KHPQ 3VR6A 3TZDA 1GUWA 3CW2C 1G291 4DAVA 2A6HC 5G3LD 5IGEA 4MHEA 4RG1A 4IFDJ 1TWFH 4BBRH 2O5IC 4K6LA 3HKZE 3FRPB 3GTKH 4EX5A 1A3UA 2LMCB 2JXMB 2PZUA 3J80c 3PCOB 1JB3A 4A3EG 1NE3A 1CFMA 5I9PA 2JA7H 4X65L 4LF5Q 4QQBX 2EY6A 5BR8L 2EE1A 4DV6Q 4A3LH 1WTHA 3NBIA 4GZYC 1Y1WH 3CPFA 4HJ8A 1HA5A 5AFWA 3GDEA 2NVXH 2MUYA 4DUZQ 5C0XG 1PHJA 4JI7L 5EKIA 1K73C 4A3GB 2NVQB 1AH9A 3BJUA 5ELCA 2TSSA 4UPAA 1YITA 2D0PA 3I2ZA 3HOXG 4BY7H 3S14H 1KD1C 2A6ED 1QNUA 1GXDC 1KAAA 4CJ1B 4AQYL 3J7AF 1O7YA 2R93G 1UE7A 4X62L 1SEBD 3M4YA 2B39A 3I7FA 2F0NA 4I7ZC 5EJWA 4A3DH 3EVQA 3HP3A 4HR7B 3FHWA 3F1ZA 1RJTA 3V96A 2UUBL 2JP1A 1S4ZA 1X56A 4A3IG 2B2TA 1U4LA 1UE5A 2PO4A 1WD0A 1Y8PB 3VR3A 4A3CH 3JAMc 4WFN3 1HUNA 4JBMA 2OTJA 4LF8L 2G9HD 4ZUIA 2BH2A 2GN5A 2WB1G 2JA6G 2PZWA 5J3BA 1TQOA 1I6HB 3OTOQ 4XYOA 1F2LA 4FF2A 2PI2A 1E22A 2O4XA 2N49A 3NWSA 4KHVA 1UEBA 4DV0L 3CKIB 3CMAA 1XXGA 2CH4A 1HZAA 4P75A 4F8MA 2JA8B 3TREA 3SGIA 3VYUA 3S2HB 3KJPA 4RGMA 4P2CB 2FXQA 3OWEB 1VQPA 1I3QH 2Q2IA 2E76C 1V1PB 1WTOA 2PNHA 5GROA 5E4WC 3EQLC 2XTIA 2EXZA 2O2LD 3AB9A 5IGBA 3LX0A 2QKIC 1VDZA 1EWHA 4RA8A 3J80L 1OXXK 2DNCA 2KCNA 3WWVA 4QIWE 2F0FA 4LMQD 5ELNA 4X64L 1A8VA 2B2WA 1HXYD 4DR3Q 2YTVA 4B3TL 1OXTA 2E5LQ 5CC4A 3LWUA 1NNXA 2NTSA 5IWAQ 3CC4A 3TSSA 2BH8A 1D5ZC 3J7YW 1QNKA 1M8AA 2Q2HA 1UAPA 3RZDB 2OEOA 2UXDL 1N36L 4IPGA 2RF4A 4NPSA 1J6QA 1EOTA 2K4KA 2ICIA 2AKWB 3KDFA 2L0CA 1KHIA 2EYMA 3I56A 3OHXC 2VUMG 2AHOB 3QIAA 4K2KA 1B3QA 2HQEA 3S15B 3W3AA 3I90A 2E75C 3RNUA 1W2BA 2Q8RE 3CQZB 2CW0D 1X32A 4WJ4A 5JPNC 1A6XA 1DGSA 1V9PA 2XNAC 3L2PA 1F2ZA 1IZ6A 1S40A 4DNIA 4HJ5A 3HG9A 1CZWA 5JJKA 1MI2A 2KCTA 2PYKA 1KL9A 2JA9A 1CHPD 2L55A 1PH6A 3UDFA 3KLSA 1G6PA 1KABA 1PLFA 2EYOA 2SOBA 3STBC 5K36H 2OCEA 1M4VA 3S15H 1HR0W 2A74C 4E6IA 1BXTA 1B50A 1X3FA 5KNDA 4CDDC 3SVMA 5M3MB 1VQNA 3CQZH 1ILQA 4Y7NH 2EIFA 4CKCA 1B70B 1FL0A 3VR5A 2YTYA 2E8GA 2CQOA 1IYJB 1JC7A 3FKIG 4OL7A 1B3AA 2NVTH 3CAMA 5C3EB 3AQQA 3S1RB 3E5SA 5A2QL 2CQAA 4DR1Q 3J7ZC 4JI2Q 1PTOH 1JJGA 2HDMA 3G6JB 4GN4B 3TP8A 2RHQB 3TS0A 1VQLA 1EU4A 4KY5A 2WAQG 5EKLA 3E3XA 1LT5D 1B1ZA 2Z9HA 2UUCQ 1N32L 3RR5A 3I4LA 2AWOA 1PA6A 4XT1B 1VQBA 2NZ1D 3UE1A 4CJ2C 3CMEA 2IX1A 5M3MH 1L0WA 1QUQA 2F0LA 1VQOA 1CKNB 1E1OA 1WYDA 3D31A 5BN5A 3CC2A 2Q2TA 1HNXQ 5C3EH 2RVLA 4U673 3S1RH 4A3MB 3RZOB 1X9NA 5I6WA 5FK9C 4RGTA 2L4NA 3SK8A 2CWAA 5CGKA 4JI1Q 2Z4IA 2MP1A 2MPMA 3SXHA 5KNCA 4OWWB 1A2UA 2EJGC 3OSOA 1D1IA 2MO0A 3BVMA 1WI5A 4N9TA 4YHHL 2RSOA 1LTBD 3BZDB 3G71A 2I46A 4JBJA 5H1SE 5ELFA 1JMCA 5ELBA 4PMWA 1EEFD 3NTIA 3H3VI 1VMPA 2MGSA 2KQ3A 3K8AA 3BVZA 1YNJC 5C4XB 2H1EA 4ZK9B 1JE4A 4A3MH 4OXPA 3CXCA 4DR6L 3CCRA 3HOZB 4OX9Q 3F8TA 1VQ5A 1I4HA 1S72A 4C3HB 2FFKB 3MC0B 2VNUD 1JWMD 3D4DA 1F77A 2XRSD 4UDUC 5KGUA 4DR7Q 1LO5D 2OF1A 1X3GA 1QVCA 2G5DA 1HTLD 5CV8A 4HTHA 4TSSA 3KF8B 1NCVA 3NEMA 1F9SA 1S5FD 3NPPA 1WCMG 2UUAQ 2EYHA 3J80i 1KTKA 4KJNA 4Y52H 3DWAA 1TS3A 3GTJB 2F0UA 2L5TA 1I50H 3OPOA 4JI3L 3DUZA 1UEAB 5LL6S 1W3SA 2N55A 2WFWA 3AU7A 3RN2A 2R7ZG 1C4QA 3P75A 1MJEA 3ONAB 3HS0C 1Q8KA 4CJ0B 3TP6A 4YY3Q 3A74A 2DUDA 4BBSG 2NWGA 5C4XH 3A5UA 2K03A 3H94A 3QOLA 2HIXA 5EPKA 1DOKA 3HOZH 4RCNA 1F9PA 3IKJA 5IYCG 2IW3A 3F2BA 1I4QA 4UHVA 4JI0Q 3LWEA 2ES2A 3GV6A 3ITPA 4V190 1ICFB 1SE3A 2MFIA 4B3RL 2LKVA 1PYSB 3MEHA 4TRDA 1TWHB 4C3IB 3ULLA 3GTJH 3RLFA 4A3JG 4JPBW 1DOLA 5C0XI 1SNQA 3BYTB 2F0HA 2PCFB 4MTKA 4DK3C 4GNXC 1Z6HA 1ASZA 3PUXA 1STBA 3BDOA 1B9NA 4IPDA 4ZRZA 3JAMi 1ENCA 3PO2B 4DR5L 4KN4C 4PV1C 4GS3A 1J5EL 2WKCA 4JK1C 4LF9L 1CA6A 4IJLA 2K5DA 3PO3G 2XWBB 3H3VH 2DNEA 4A93H 1EOVA 1B7YB 2ENBA 4RWSC 5FLXE 5FJ8H 1MSGA 1LT4D 4Q0FA 2KEDA 1CI3M 1TWHH 1PDQA 3KBGA 1BBUA 2E2HB 3HOUH 4BY1G 1PYWD 4X65Q 4N8X1 2QEJC 3CD6A 5LMNL 5BR8Q 3K7AH 4A3EB 4A3KG 1YI2A 1K83H 2JA5B 3C3LA 3PUWA 2BDNA 5CBEE 3D6CA 1K8AC 5HGTA 3CCMA 3BDCA 4RH6A 1HRJA 5E7NA 4LFAQ 4JI7Q 4K0KL 2IPKD 1K8OA 3PO2H 1EWCA 1CM9A 1ET9A 2K28A 2A68C 1ESRA 3KLSX 5CV9A 1PV4A 3M7NA 3AFPA 5JEAG 1F2MA 1Y8OB 1CT1D 3I55A 1K8MA 3S1MB 3NHHA 1XPRA 4DPGA 3QR8A 3HOXB 4X62Q 3A7LA 3KUPA 4IPHA 1VQFA 5M3FG 5JJZA 3Q0AA 2VQFL 3U50C 1NMFA 2UUBQ 1JJCB 2OWOA 4A3EH 3S24A 4APVA 4YWMA 5DM63 2R93B 1LABA 4LNQA 3HOVG 1AEXA 2E2JB 5IP7G 4WJ3M 1HZ9A 1YNNC 2EY5A 1JWSD 4YWLA 3OMGA 4J1MA 4A3IB 1ASYA 1CKMA 2PQAA 1N8RC 4LF8Q 4J6HA 4UAIA 2VB3X 5C3XA 1FGUA 4LFBL 3GTGB 1RODA 5C0XH 5EBDA 1GKHA 1Q1BA 1I4XA 3MXGA 4PMCA 1FJGL 3S1MH 1DYQA 3T1HL 1C0AA 1ZXTA 3TQYA 3I70A 2PMZB 2K6AA 2OXPA 3HOXH 4G4KA 1L1OA 4DV0Q 3DM1A 4JOIC 4HSPA 4K5WA 1B53A 1LTRD 3HEJA 2KCCA 4NB3A 2R92G 2R93H 1E0BA 2K32A 2ZXPA 4H0LC 1TWGH 4U68A 2QW7A 4DV3L 3U58A 2E2JH 3MXNA 3OIQA 2K5NA 2UU9Q 5NUCA 2F3WA 2A6EC 2Q8IB 2CHBD 4A3IH 1IYUA 1DJRD 1HCZA 4XQQA 3FPUB 1JB7A 3ICEA 1RIPA 1RKNA 4CGYB 4FF3A 4EQ5A 4KI0A 2F0DA 1RL2A 4HMIA 4DKAC 2YU9B 3ER0A 3GV3A 2WIIB 2LSSA 1KDAA 4JC0A 2JA6H 3LGJA 1PH9A 2A8VA 4X64Q 4IJHA 3TP7A 4DK1A 3R3OA 4M8AA 2F03A 4B3TQ 1LT6D 3I4NG 2K1BA 4PMBA 1TS4A 4CKBA 5KYLA 4V0BA 2E2IH 4N8FA 3BS1A 5KYIA 1TWFB 3I3CA 2NZHA 2UXDQ 1E2ZA 2ICEC 5E3FA 3GTKB 1B9MA 4OIKA 1N36Q 4JV5L 1CKOA 1QJOA 1MIUA 2JA7B 4EQPA 2I5MX 3OIPA 3R2IA 1HJPA 2B2UC 3PUYA 1ZYRD 3BG3A 1VQ6A 2YU9H 1Y1WB 4CDFC 3EROA 5E1FA 3VR4A 2NVXB 1PFBA 4RCOA 4GLAC 1EYDA 1NSNS 1VF5C 3MFGA 1EY8A 1XTDA 3J81c 4OO1G 4UP8A 1U4PA 5IT9c 2ATWA 4IOCA 1YNXA 5I2YA 1Y69U 3I4MG 3OW2A 3C1FA 3SEBA 4POFA 2KHIA 3LNNA 1Q81C 4K8JA 4BY7B 1X54A 4RMFA 3S14B 2H5XA 1TU2B 2JN4A 1AFPA 1EIHA 2UXCQ 2HUGA 3DM3A 2N3SA 1D1KA 1VQEA 4IUQA 1G51A 4A3DB 4JI6L 5GADC 3M85A 3K5OA 1RTNA 5DLQE 2ZXRA 2E74C 1KDCA 3W5OA 3NBHA 5M5WB 2VUMH 4LJZC 3KOJA 2ALYB 4H44C 2I0QA 2ZJQA 2A69C 3PIOA 3SE0A 4IUVA 1C48A 5D3IB 4ZKCB 1GUNA 1H9JA 1NR2A 5FLXc 3M4OH 3Q8DA 4QY7A 1B4OA 2YV5A 3EJIA 3IRBA 3C46A 4IUTA 2K52A 3FKIB 3NE5B 4QUCA 1XNQL 1KLGD 1U4RA 1AE2A 3MTSA 2Y0SG 2CW0C 2I5LX 2FMMA 3K59A 3E6ZX 3D8GA 1QILA 4LUVA 4XQJA 1IKMA 5C6AA 4LUZA 1N32Q 2WACA 4RKLA 5M5WH 2WAQB 1I3QB 1D6EC 1YJ9A 4NXML 3Q23A 3HOWG 3D4RA 2NZOA 1A15A 4CHTB 2IX0A 3RUZA 1UNSA 1VQMA 1GUOA 1SYCA 4B9WA 3M3YH 1NTGA 1U5KA 1DM0B 4MN3A 3EIVA 4L5SA 1SE8A 2RHSB 1LTGD 1STNA 4DGZA 3FKIH 1FR3A 4JYAL 2SEBD 1SMYD 1YVCA 1AW7A 5LHY1 3QB3A 1MBYA 5F2DA 4MNOA 2D0OA 1VQ9A 3CCJA 3CCVA 1O78A 2KHSA 1X65A 3RLNA 3K0XA 3S9WA 1GJXA 1Q12A 2F0MA 4YHHQ 3J81L 1VQCA 2CKZB 4R1JA 1K8GA 5M5YB 5IT9L 5CMDA 3FDTA 5IYDG 2ZTEA 2L11A 5J39A 3M4PA 4EQOA 4XDXA 2EDGA 1WTVA 1Q46A 1G8ZD 2L1BA 2KOLA 4IN3A 4IFDG 1D2BA 4CKEA 4NXNL 4DR6Q 1SN8A 1JCKB 1QG7A 4R8IA 4HJAA 3GTQB 1EY9A 1SMXA 3G7LA 3NK9A 1SAPA 1UWVA 2PQEA 3DWPA 1XTCD 2PW5A 3BDLA 3VDYA 1WOCA 1NAPA 1SDFA 2YTXA 3AMUA 3D3RA 1EIYB 2IX3A 1SNPA 1K0SA 4O42A 1VQIA 2DN8A 5J22A 2A6HD 5LMNW 3FEWX 1HQMC 1EUJA 3VYTA 5M5YH 3CRKC 4JI3Q 1YHQA 1UE6A 1E3PA 4ME3A 3S17B 4BXXG 1PTOF 2L9HA 1DXMA 2L15A 5FLXL 1JE5A 4KK7A 1I4RA 3H0GG 1IBML 3GTQH 3P20A 2EJFC 5DAUA 3HOYG 1IKLA 2HT1A 3W2DA 4OEMB 4BBSB 4AYBG 4FVMA 2NN6G 2F0JA 2Z8LA 4B3RQ 3K0YA 3UDXA 3IL8A 4Y7NB 1PTOD 4IURA 2NVTB 1BKBA 5HY6A 1T5EA 2VB2X 4B3SL 3K81C 4I65A 1QCBD 1EZ6A 3HRZC 3G4SA 4PNYA 1WCMH 1LTTD 1PTOB 2RDHA 4LUOA 4DV7L 1JOKA 4RKBA 3U4VA 3S17H 1XWEA 4JG2A 4BA2I 2RDFA 3V05A 4JVZA 1H9SA 1Q90A 2J4XA 3PIP3 1QZGA 4KKTA 4CDCC 5C4JH 4A3FG 2R7ZH 4GKJL 2QF7A 1DCZA 4POGA 3AEVA 4DR5Q 1F9QA 1HNZQ 1JQYD 4BBSH 1SE4A 3B6YA 5KIXA 1MHWC 2B8FA 5IYCH 3M4QA 4UP9A 4YWKA 3M9BA 4M1UB 1MSHA 3H15A 1YEZA 1PRTF 1GUTA 3E9IA 4A3GG 1E7ZA 3DXJC 2K05A 5LMNQ 1W6JA 2HQLA 1A3VA 2Z6KC 4K5XA 2B63G 3CF5A 2M9VA 1K3RA 1EQVA 1LTSD 4S3SA 4A3JH 4BY1B 2NVYB 2HIVA 1WTRA 5IYBG 3I72A 1Q7YC 3S1QB 1WVLA 1IYVA 1RF2D 1WTWA 4B9XA 4K0KQ 1FNUA 4BWGB 4ABNA 1PRTD 5ISRA 1IW7D 5GAGC 3KDFB 2V1CC 5ELOA 1DZ1A 3AYHB 3A8JE 5IP9G 2BE5C 5CV4A 3Q24A 2B29A 1GD7A 4DAMA 4DAYA 1R4PB 1PRTB 4DXFA 2PPBC 4OWTB 1V8QA 4YCUA 3PO3H 4X3SA 1N9WA 3IFTA 5LMUQ 3WDNA 4RHRA 2G9DA 1BF4A 3GTLB 2X69A 4K8IA 3L3OC 3F2CA 3FMCA 3MVVA 2VQFQ 3BZKA 1RTOA 1BUVT 5IY0A 2EOTA 4R4OA 2D62A 2RCNA 4B08A 4BY1H 2NVYH 5EKKA 5M3FB 1HH2P 1V1QA 4DN4M 4GOPB 1R9TB 4JI8L 3S1QH 4FDBA 3OW7A 5IODA 4A3KH 4EGVA 1F2YA 5I6YA 1LT3D 3ZJYC 1I50B 1JICA 4LFBQ 2K5WA 1KQSA 3TP5A 3OMCA 4MZ9A 2ZM6L 1HR0Q 1FJGQ 2JA8G 1A62A 2EZVA 3KLRA 3KF6A 3SR1A 4ZAIA 1XMOQ 2MQHA 3WOFA 1D5XC 3J81i 1E24A 3A56A 1PH3A 2F0TA 4JI5Q 1I6VC 3GTLH 5JEAH 4LF7L 2GVBA 2RCFA 2LXJA 1TS2A 2PMZE 2WB1E 3ULJA 3KYHC 3Q22A 2HD3A 1EYCA 2M00A 2WV6D 2LFNA 4DV3Q 5M3FH 1R9TH 2N88A 3PF5A 4A4IA 3NUCA 3U9SA 3ERQA 4DF7A 2WP8J 2Q2UA 1PVOA 5E4XA 3HOVH 3O13A 2RQXA 3BVGA 5IP7H 1EFID 1S3OA 2OQ0A 5I2XA 1XPUA 4QUFA 1GHJA 2JYOA 4OO1I 4DR4L 1HFGA 4IUNA 5C44G 1FNWA 2QILA 1BBXC 2DJGC 2N78A 1KXLA 1A3TA 1LTLA 2R7DA 1EIFA 1N33L 3H91A 3OWFA 1QUQB 1CQVA 2EQSA 2KENA 4JI4L 3BZCA 3GD7A 2BDOA 1WTQA 1HA6A 1R4QB 1VQ7A 4A93B 1SYFA 2UXBL 1VCIA 4RFBA 3VR2A 2A5HA 2R92H 1LUZA 2R61A 3UDGA 5M5XH 2CCZA 4JV5Q 1HFNA 1IBKL 2QDLA 3A8KE 4OIJA 3HOUB 2VY3A 5CV6A 4R4QA 5EAYA 3HKZG 3K7AB 1TIID 1GOZA 4H7BA 1K83B 2WKDA
chains in the Genus database with same CATH topology
3U9OA 4Q5VA 2JEBI 3GQBA 2K7VA 2F0WA 2XRQD 1SYBA 2LS01 5IGGA 1E2VA 4R8NA 1II3A 3IAYA 3TN2A 2IJ0A 1WD1A 5JOBA 1S5DD 5IIFA 4KV6A 1GUGA 4DA2A 2EYPA 4KKUA 4DFAA 4X3UA 1TS5A 4DNTB 3CHBD 1EY5A 4OO1H 1I4PA 2QCPX 5ELDA 3QJYA 3S2DB 3JAME 4PQXA 4BA1I 1TWGB 2Y0SB 3T4AC 4IFDI 1J8IA 2R6GA 3D6WA 2EYLA 4NKLA 4IZ8A 1SXTA 1BO0A 3HOWB 3VYSA 1AZPA 2WB1B 2JA6B 1JOQA 2C5CA 3NTHA 3A7AB 5KRUA 1LLRD 2E2IB 5TSSA 5CV7A 1Q3LA 1STEA 4C3HG 3NTKA 4HMJA 5C0XJ 2IWHA 1PFNA 3PUVA 1PMRA 4WRDA 3I8ZA 5DEHA 1FYCA 2NN6I 2TMPA 1SYEA 2BOSA 4FF4A 4X3KA 2J0TD 1OXSC 5I4DA 2EY1A 1O7LA 2EY2A 1L0YB 4QCLA 4XYQA 1A2TA 2K33A 4C1NI 4IUUA 2F0GA 3P7JA 4DXGA 1FGBD 3GTOB 1ZEQX 1BCPF 2KECA 1AZQA 4L63B 1LTAD 3SHLA 2X6GA 1TY2A 3HZXA 1BR9A 3ND9A 3VA7A 3K58A 1C8CA 1F9RA 2D5DA 5CR3A 4C3IG 1V1OA 5ELEA 4WORA 1BCPD 2WINB 1STHA 4IFDH 2VUMB 4FXKC 3QOJA 2Z1CA 2XN9C 2FJ2A 2F1MA 5HURA 1BCPB 2NUCA 2B2YC 1I4GA 1VMCA 5C4ZA 3M4OB 1QB5D 4X3TA 1CA5A 3V2TA 1J9OA 2F0PA 1G6ZA 2XVSA 1EEID 1ESFA 1HUMA 4QMGA 1GHKA 3RD4A 2NYZD 5C5LA 1HHVA 5DM73 1XYIA 1D5MC 4J8QA 2B2TC 1DOMA 4A3FB 1EY7A 1YNND 2FHTA 3GP7A 1QE6A 4XXEA 2O5JC 3RMHA 2F0QA 3EFXD 3C2PA 5KEEA 2B2UA 2NN6H 1V1PA 1PZID 3M3YB 5DNFA 4FP5D 2A73B 1STAA 4IUPA 1U9RA 4G7ZC 5I9OA 1PTOC 2B2YA 1TKWB 2V4DA 2B63B 5FO7B 3P1HA 3A55A 5J1ZA 2FINB 1CQFA 2NB0A 2AUKA 4K6DA 4OGQC 3R8BA 3GTMB 1CK1A 4HCEA 4FNFA 1SYGA 5KNBA 2JE6I 2C9OA 4LK1C 1RCVD 5JVG3 3FPPA 3GTPB 4JBWA 2KUMA 1OXUA 3Q6SA 4C3JG 1ML0D 5C3WA 2KEEA 3PMFA 2F3VA 2B2WC 2KVMA 4C56C 3EA6A 3K5NA 5IGFA 1HQRD 2XSCA 3VYRA 1WTXA 2BA0A 3N6RA 1EIGA 3T53B 4BS9A 5CORA 2XIWA 1PRTC 5EGTA 1B44D 1BNZA 1IW7C 2M2LA 5BN3A 4HCSA 1FD7D 1RD9D 1SNDA 1ENAA 3TZUA 1HPCA 1BQQT 1WCMB 4XIGS 2EYFA 2NBFA 2YYZA 4KKSA 1SNCA 5EBCA 1FNVA 1UUPA 2DY8A 3WOEA 2RBMA 4NP5A 1TVXA 2E2DC 5CBAE 5C4JB 2R7ZB 2RKSA 1KNAA 2IT1A 3ND8A 5C44B 4ILWA 3MXPA 4IQZA 3T56B 3DEOA 3J7AV 4KTAA 2A69D 3R2TA 4FXDA 1ONLA 2RDGA 4DAPA 1QOHA 2ZT9C 3MWYW 2CVRA 2HCCA 1AN8A 4C1NK 1O80A 2RA4A 1SSOA 4A3JB 4KD4A 1STGA 1GUSA 2MJ8A 3HKZB 1S5BD 3SK6A 3CRLC 1ENFA 4N9PA 1B2TA 3TDQA 1JR0D 1LTID 3MA2B 1ET6A 3JAML 1JOOA 2AQ1B 1BOSA 1AP0A 3NXWA 4G7HC 2HCIA 4KN7C 3PO3B 3SK5A 2BCOA 1XX8A 3H3VC 3FVQA 1SJHD 5FKAC 1LACA 4TQUS 1SYDA 1RDPD 4K2LA 2QDBA 1EQTA 1ICWA 1Y1VB 4F87A 1G2SA 5JVH3 1EY4A 2F4IA 1PZJD 2DY7A 4EVOA 4A3KB 3KF8A 3BYYB 1CZGA 4NW2A 1DD2A 5COYA 4HN7A 1CTMA 4R9WA 4CBVA 1IL8A 2F0IA 1S5CD 3F2UA 1SJED 1OO9B 2ID0A 5M9OA 2Z4HA 2GA4B 4XT3B 2LY7A 2F0SA 3K57A 2I07B 4KY6A 4A3BB 1U4MA 5T1GA 3MFYA 1TWAB 3A54A 4L6TB 3M7GA 3HOVB 2XWJB 1H9SB 2HDLA 2PW7A 3K6OA 4KY7A 4RAUC 2EVBA 4KHZA 1DONA 3L7ZC 3H09A 1PZKD 4XTCS 3C1EA 4TKOB 3MHBA 2RSNA 5A35A 4FO2A 2SDFA 5LL6X 5FO8B 4NDXA 3T16A 4WJWA 5K5PA 2R92B 4ZYSA 3MZ5A 2B8GA 4QIWB 5M5XB 1MGSA 3VA5A 4K5VA 3KBXA 3N52A 3CU7A 1BDOA 2AQ3B 5EPJA 2L12A 2NTTA 5CV5A 5D14A 1ZKOA 3PIO3 3E0JA 5JEAJ 1JORA 4ZUJA 5EQ0A 2F0EA 3I73A 3DEPA 2IL8A 5K36G 4HAEA 4FF1A 1G2TA 4RHSA 3I4NB 1HTPA 2KJXA 1PFMA 1X3QA 1SNOA 5C5MA 2B2VC 3J81E 5IOCA 3GO5A 3MAQA 5IT9E 3NQTA 3L9AX 1QWYA 2F0VA 1EYAA 2BA1A 5IGCA 4ZLTF 4ULLA 4HSVA 3J80E 2SNMA 4O1NA 3PUZA 3OOCA 2BE5D 4ME5A 3NSWA 4XQNA 4DU9A 3I4MB 2K01A 1STYA 2KA7A 3S16B 3DHQA 4ID6A 1W6KA 1Z47A 4F7XA 2D9UA 1RHPA 3NWTA 5JAVA 5D3DA 5BN4A 4KMUC 4G7OC 2FMCA 4RGOS 4MIUA 1TY0A 3H6MA 2AUJD 1L0XB 1TR5A 1T5XD 5EPLA 5JPMC 2B2VA 4QB4A 2EYJA 1ZYRC 1H9RA 4L8JA 1CHQD 1BCPC 1E2WA 3NQIA 1SE2A 5D65A 1YNJD 2F0OA 3S1NB 1VF7A 3T13A 1KDBA 5FO9B 3SK4A 1MD2D 4Z9CB 1S5ED 1KNEA 3DMUA 4C2MB 4ZQ3A 3TMEA 2R3ZA 2MHVA 5C4HA 2D2CC 1X3PA 4HEDA 4DNRB 1PXUA 1OXVA 3ZYYX 1WTPA 2ZXOA 3X3NA 4F88A 3X3MA 3HGBA 4H13C 5T1IA 1NUCA 1V43A 3K5LA 2JEAI 5A2QE 2H4OA 2JSOA 4G57A 3R93A 2EPBA 4C3JB 1SFOB 3MXUA 2PNRC 4FYDA 1Q8IA 3DWQA 1TT2A 3URYA 4DK0A 3UI2A 2K5QA 1IHZA 1Z7TA 1G91A 3NP8A 4IALA 1EY0A 2X6LA 1TWCB 2EJMA 1KLUD 1NR4A 4KD3A 4NMZA 1EY6A 2SNSA 1H9KA 3TBIB 3QO2A 2K04A 4K14A 5FOBB 1EZ8A 4YIJA 3D4WA 2F0KA 2Q8TA 4KJOA 4LAAA 2OT2A 1SMYC 3A8IE 1EU3A 1Y8NB 1JWUD 4EQNA 3QWNA 1SBBB 2PZTA 4ODGA 1O7ZA 2J7ZA 1EL0A 3SDZA 1LV9A 4BBRB 2AQ2B 1Q1EA 3IFDA 1SNMA 3H0GB 3PV0A 5CYUA 3HOYB 1H9MA 4AYBB 3K5MA 3KK7A 2A68D 2VXWA 4RGNA 2AWNA 5G3LF 4FXGC 4ZKBB 3I91A 3QG1A 4QF4A 3T51B 5IGDA 1ILPA 4OHJA 3VR6A 3TZDA 1GUWA 1G291 4DAVA 2A6HC 5G3LD 5IGEA 4MHEA 4IFDJ 2O5IC 4K6LA 3FRPB 1A3UA 2LMCB 2JXMB 2PZUA 1JB3A 1CFMA 5I9PA 2EY6A 2EE1A 3NBIA 4GZYC 1HA5A 5AFWA 2MUYA 5C0XG 2NVQB 5EKIA 4A3GB 5ELCA 2TSSA 2A6ED 1QNUA 1GXDC 1KAAA 4CJ1B 3J7AF 1O7YA 1SEBD 3M4YA 2B39A 5EJWA 2F0NA 4I7ZC 3EVQA 3HP3A 4HR7B 1RJTA 3V96A 2JP1A 1S4ZA 2B2TA 1U4LA 2PO4A 1WD0A 1Y8PB 3VR3A 4WFN3 1HUNA 2G9HD 4ZUIA 2PZWA 1I6HB 1TQOA 4XYOA 1F2LA 4FF2A 2O4XA 3NWSA 4KHVA 3CKIB 1XXGA 4F8MA 2JA8B 3VYUA 3S2HB 4RGMA 4P2CB 3OWEB 2E76C 1V1PB 1WTOA 5E4WC 3EQLC 2EXZA 2O2LD 3AB9A 5IGBA 3LX0A 2QKIC 1VDZA 1EWHA 4RA8A 3J80L 1OXXK 2DNCA 2KCNA 2F0FA 4LMQD 2B2WA 1HXYD 1OXTA 5CC4A 3LWUA 2NTSA 3TSSA 3J7YW 1D5ZC 1QNKA 1M8AA 3RZDB 1UAPA 2OEOA 1EOTA 2ICIA 2L0CA 2EYMA 3OHXC 3QIAA 4K2KA 2HQEA 3S15B 3W3AA 3I90A 2E75C 2Q8RE 3CQZB 2CW0D 1X32A 5JPNC 1A6XA 2XNAC 1F2ZA 3HG9A 1CZWA 1MI2A 2PYKA 1CHPD 2L55A 3KLSA 1KABA 1PLFA 2EYOA 2SOBA 5K36H 1M4VA 2A74C 4E6IA 1BXTA 1B50A 5KNDA 3SVMA 5M3MB 1ILQA 4CKCA 3VR5A 4OL7A 1JC7A 1B3AA 5C3EB 3S1RB 3E5SA 5A2QL 2CQAA 1PTOH 2HDMA 3G6JB 3TP8A 1EU4A 4KY5A 5EKLA 1LT5D 1B1ZA 3I4LA 2AWOA 4XT1B 2NZ1D 4CJ2C 2IX1A 2F0LA 3D31A 5BN5A 2RVLA 4U673 4A3MB 3RZOB 5I6WA 5FK9C 4RGTA 2L4NA 3SK8A 5CGKA 2Z4IA 2MP1A 2MPMA 3SXHA 5KNCA 1A2UA 2EJGC 3OSOA 1D1IA 3BVMA 4N9TA 2RSOA 1LTBD 3BZDB 2I46A 5ELFA 5ELBA 4PMWA 1EEFD 3NTIA 1VMPA 2MGSA 2KQ3A 3BVZA 1YNJC 5C4XB 2H1EA 4ZK9B 1JE4A 3HOZB 1I4HA 4C3HB 2FFKB 3MC0B 2VNUD 1JWMD 3D4DA 1F77A 2XRSD 4UDUC 5KGUA 1LO5D 2OF1A 5CV8A 1HTLD 4HTHA 4TSSA 1NCVA 1F9SA 1S5FD 3NPPA 2EYHA 1KTKA 4KJNA 3DWAA 1TS3A 3GTJB 2F0UA 2L5TA 3OPOA 3DUZA 1UEAB 5LL6S 2N55A 3AU7A 1C4QA 3P75A 3ONAB 3HS0C 4CJ0B 3TP6A 2NWGA 2K03A 3H94A 3QOLA 5EPKA 1DOKA 4RCNA 1F9PA 3IKJA 2IW3A 1I4QA 3LWEA 3GV6A 3ITPA 4V190 1SE3A 2LKVA 3MEHA 4TRDA 1TWHB 4C3IB 3RLFA 1DOLA 5C0XI 1SNQA 3BYTB 2F0HA 2PCFB 1Z6HA 3PUXA 1STBA 3BDOA 1B9NA 4ZRZA 1ENCA 3PO2B 4KN4C 4PV1C 2WKCA 4JK1C 1CA6A 2K5DA 2XWBB 2DNEA 2ENBA 4RWSC 5FLXE 1MSGA 1LT4D 4Q0FA 2KEDA 1CI3M 1PDQA 3KBGA 2E2HB 1PYWD 2QEJC 4A3EB 2JA5B 3C3LA 3PUWA 2BDNA 5CBEE 3D6CA 5HGTA 3BDCA 4RH6A 1HRJA 1K8OA 2IPKD 1EWCA 1CM9A 1ET9A 2K28A 2A68C 1ESRA 3KLSX 5CV9A 3M7NA 5JEAG 1F2MA 1Y8OB 1CT1D 1K8MA 3S1MB 3NHHA 3HOXB 3A7LA 3KUPA 5JJZA 3Q0AA 2R93B 5DM63 1LABA 1AEXA 2E2JB 1YNNC 2EY5A 1JWSD 3OMGA 4J1MA 4A3IB 4J6HA 4UAIA 2VB3X 5C3XA 3GTGB 1RODA 5C0XH 5EBDA 1Q1BA 1I4XA 3MXGA 4PMCA 1DYQA 1ZXTA 3I70A 2PMZB 2K6AA 2OXPA 4G4KA 3DM1A 4HSPA 4K5WA 1B53A 1LTRD 3HEJA 2KCCA 1E0BA 2K32A 2ZXPA 4H0LC 4U68A 3MXNA 3OIQA 5NUCA 2F3WA 2A6EC 2Q8IB 2CHBD 1IYUA 1DJRD 1HCZA 4XQQA 3FPUB 1RKNA 4CGYB 4FF3A 4KI0A 2F0DA 4HMIA 2YU9B 3GV3A 2WIIB 1KDAA 3TP7A 4DK1A 3R3OA 4M8AA 2F03A 1LT6D 2K1BA 4PMBA 1TS4A 4CKBA 5KYLA 4V0BA 3BS1A 5KYIA 1TWFB 3I3CA 1E2ZA 2ICEC 5E3FA 3GTKB 1B9MA 4OIKA 1QJOA 2JA7B 4EQPA 3OIPA 3R2IA 2B2UC 3PUYA 1ZYRD 3BG3A 1Y1WB 3EROA 5E1FA 3VR4A 2NVXB 1PFBA 4RCOA 1EYDA 1NSNS 1VF5C 3MFGA 1EY8A 4OO1G 1U4PA 5I2YA 1Y69U 3C1FA 3SEBA 3LNNA 4K8JA 4BY7B 3S14B 1TU2B 1AFPA 1EIHA 2HUGA 1D1KA 4IUQA 4A3DB 3M85A 3K5OA 1RTNA 2ZXRA 2E74C 1KDCA 3NBHA 5M5WB 4LJZC 4H44C 2A69C 3SE0A 4IUVA 1C48A 5D3IB 4ZKCB 1GUNA 1H9JA 1NR2A 1B4OA 3EJIA 3C46A 4IUTA 3FKIB 3NE5B 4QUCA 1KLGD 1U4RA 3MTSA 2CW0C 2FMMA 3K59A 3E6ZX 3D8GA 1QILA 4XQJA 1IKMA 5C6AA 2WACA 4RKLA 2WAQB 1I3QB 1D6EC 3Q23A 3D4RA 1A15A 4CHTB 2IX0A 3RUZA 1UNSA 1GUOA 1SYCA 4B9WA 1DM0B 4MN3A 1LTGD 1STNA 4DGZA 1FR3A 2SEBD 1SMYD 1AW7A 5LHY1 3QB3A 1MBYA 5F2DA 1O78A 2KHSA 3S9WA 1GJXA 1Q12A 2F0MA 3J81L 5M5YB 5IT9L 5CMDA 3FDTA 2L11A 5J39A 4EQOA 4XDXA 2EDGA 1WTVA 1G8ZD 2L1BA 2KOLA 4IN3A 4IFDG 1D2BA 4CKEA 1JCKB 1QG7A 4R8IA 3GTQB 1EY9A 3G7LA 3NK9A 1SAPA 2PQEA 3DWPA 1XTCD 2PW5A 3BDLA 1NAPA 1SDFA 3AMUA 3D3RA 2IX3A 1SNPA 4O42A 2DN8A 5J22A 2A6HD 3FEWX 1HQMC 3VYTA 3CRKC 3S17B 1PTOF 2L9HA 1DXMA 5FLXL 4KK7A 1I4RA 3P20A 2EJFC 5DAUA 1IKLA 3W2DA 4BBSB 4FVMA 2NN6G 2F0JA 2Z8LA 3K0YA 4Y7NB 3IL8A 1PTOD 4IURA 2NVTB 1T5EA 2VB2X 4I65A 1QCBD 1EZ6A 3HRZC 4PNYA 1LTTD 1PTOB 2RDHA 1JOKA 4RKBA 1XWEA 4BA2I 2RDFA 3V05A 1H9SA 1Q90A 2J4XA 3PIP3 4KKTA 2QF7A 1DCZA 1F9QA 1JQYD 1SE4A 5KIXA 2B8FA 4M1UB 1MSHA 1PRTF 1GUTA 3DXJC 2K05A 1W6JA 1A3VA 4K5XA 2M9VA 1EQVA 1LTSD 4S3SA 4BY1B 2NVYB 1WTRA 3I72A 3S1QB 1WVLA 1IYVA 1RF2D 1WTWA 4B9XA 1FNUA 4BWGB 4ABNA 1PRTD 5ISRA 1IW7D 1DZ1A 3A8JE 2BE5C 5CV4A 3Q24A 4DAYA 1R4PB 1PRTB 4DXFA 2PPBC 1V8QA 4X3SA 3IFTA 3WDNA 4RHRA 2G9DA 1BF4A 3GTLB 2X69A 4K8IA 3L3OC 3FMCA 3MVVA 1RTOA 1BUVT 2EOTA 2D62A 4B08A 5EKKA 5M3FB 4DN4M 1R9TB 3OW7A 5IODA 4EGVA 1F2YA 5I6YA 1LT3D 1I50B 1JICA 2K5WA 3TP5A 3OMCA 2EZVA 3KLRA 3SR1A 4ZAIA 3WOFA 1D5XC 3A56A 2F0TA 1I6VC 5JEAH 1TS2A 3Q22A 1EYCA 2M00A 2WV6D 2LFNA 2N88A 3NUCA 3U9SA 3ERQA 4DF7A 2WP8J 5E4XA 3O13A 2RQXA 3BVGA 1EFID 5I2XA 4QUFA 1GHJA 2JYOA 4OO1I 1HFGA 4IUNA 1FNWA 2QILA 1BBXC 1A3TA 3H91A 1CQVA 3OWFA 3GD7A 2BDOA 1WTQA 1HA6A 1R4QB 4A93B 1SYFA 1VCIA 4RFBA 3VR2A 2A5HA 2R61A 1HFNA 3A8KE 4OIJA 3HOUB 5CV6A 3K7AB 1TIID 1GOZA 4H7BA 1K83B 2WKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9O A;  2O4X A;  5EKK A;  5KEE A;  1KAB A;  3D8G A;  4KHV A;  2F0J A;  2EYO A;  2SOB A;  5C6A A;  3D6C A;  1SND A;  5HGT A;  1ENA A;  2F0W A;  4QF4 A;  3R3O A;  3TP7 A;  5IOD A;  5CV7 A;  3D4D A;  3BDC A;  1F2Y A;  5KGU A;  2F0I A;  2F0Q A;  2OF1 A;  5CV8 A;  2WAC A;  1SNO A;  5C5M A;  4HMJ A;  1SYB A;  4HTH A;  4RKL A;  5I6Y A;  4PMB A;  4E6I A;  5KYL A;  5IGG A;  5IGD A;  2EYF A;  4R8N A;  4F8M A;  5IOC A;  5M9O A;  1SNC A;  1II3 A;  2EYH A;  3TP5 A;  5KYI A;  3OMC A;  4KJN A;  3NQT A;  4WRD A;  4I65 A;  1NUC A;  1EZ6 A;  5DEH A;  3RUZ A;  2RBM A;  1STA A;  4NP5 A;  4PNY A;  5CV9 A;  5E3F A;  2F0V A;  2F0S A;  1SYE A;  1U9R A;  1SYC A;  2F0U A;  2RKS A;  3SR1 A;  1JOK A;  4RKB A;  4OL7 A;  4G57 A;  5JOB A;  1EYA A;  1F2M A;  4B9W A;  5IGE A;  2RDF A;  4EQP A;  5I9O A;  5IGC A;  5IIF A;  2F0T A;  3E5S A;  3P75 A;  4KV6 A;  3NHH A;  2EXZ A;  2EY1 A;  4KY6 A;  1STN A;  2EY2 A;  3MXP A;  4DGZ A;  1A3U A;  2PZU A;  3LX0 A;  3TP6 A;  5IGB A;  1TT2 A;  2SNM A;  2EYP A;  3P1H A;  1A2T A;  5J1Z A;  5I9P A;  4KTA A;  3ERO A;  3TP8 A;  2F0G A;  5E1F A;  4DFA A;  3QOL A;  1EYC A;  1EYD A;  1NSN S;  2EY6 A;  2M00 A;  3QB3 A;  4ME5 A;  1EY8 A;  5F2D A;  4DU9 A;  4K6D A;  4KY5 A;  2F0F A;  5KIX A;  2KHS A;  1AEX A;  2PW7 A;  1STY A;  3NUC A;  1IHZ A;  3SHL A;  4KY7 A;  5EKL A;  2EY5 A;  3NP8 A;  1EY5 A;  3ERQ A;  3ITP A;  2F0M A;  3DHQ A;  4ID6 A;  4IAL A;  3HZX A;  4DF7 A;  1EY0 A;  3C1F A;  4F7X A;  1SYG A;  3OMG A;  4J1M A;  5CC4 A;  4K8J A;  4J6H A;  4KD3 A;  2LKV A;  5C3X A;  4NMZ A;  1EY6 A;  3MEH A;  2F0L A;  4TRD A;  5JAV A;  5J39 A;  3C1E A;  2SNS A;  4KD4 A;  1STG A;  5CR3 A;  4EQO A;  4PMC A;  2OEO A;  4IUN A;  3MHB A;  1A3V A;  4K5X A;  4MIU A;  3SK6 A;  4K14 A;  3H6M A;  4WOR A;  1EQV A;  3PMF A;  5C3W A;  2F3V A;  1EZ8 A;  4N9P A;  4S3S A;  1EY9 A;  1A3T A;  1SNQ A;  4YIJ A;  1STH A;  3D4W A;  1TR5 A;  5I6W A;  2F0H A;  2EYM A;  2OXP A;  3NK9 A;  3OWF A;  2F0K A;  3QOJ A;  4QB4 A;  1KAA A;  4NDX A;  4K5W A;  3T16 A;  5IGF A;  3SK8 A;  5HUR A;  2EYJ A;  5CGK A;  4KJO A;  2PQE A;  5K5P A;  2PW5 A;  3BDL A;  1JOO A;  3MZ5 A;  4LAA A;  4B9X A;  4K2K A;  3HEJ A;  1STB A;  2F0N A;  2NUC A;  1KDC A;  2HQE A;  3NXW A;  4K5V A;  3SXH A;  3VA5 A;  1A2U A;  1ENC A;  3EVQ A;  1SYF A;  5C4Z A;  5ISR A;  1SNP A;  3OSO A;  2EYL A;  4NKL A;  3SK5 A;  4IZ8 A;  3S9W A;  5J22 A;  5CV4 A;  4EQN A;  3V2T A;  2F0O A;  2F0P A;  4N9T A;  5CV5 A;  5NUC A;  2F3W A;  2PZT A;  4ODG A;  3T13 A;  5CV6 A;  1KDB A;  1SYD A;  2ENB A;  1F2Z A;  3SK4 A;  4K2L A;  2QDB A;  3DMU A;  4QMG A;  3EJI A;  1RKN A;  5EGT A;  1JOR A;  4ZUJ A;  4H7B A;  4ZQ3 A;  4K8I A;  1SNM A;  2PYK A;  1EY4 A;  3TME A;  4ZUI A;  2KQ3 A;  1JOQ A;  3MVV A;  2F0D A;  4HMI A;  5C5L A;  5C4H A;  4EVO A;  2PZW A;  1TQO A;  5KRU A;  2F0E A;  5DAU A;  1KDA A;  1EY7 A; 
#chains in the Genus database with same CATH topology
 3U9O A;  4Q5V A;  2JEB I;  4H02 A;  3GQB A;  2K7V A;  2F0W A;  2XRQ D;  2VQE L;  1SYB A;  2LS0 1;  5IGG A;  1E2V A;  4R8N A;  1IXR A;  1II3 A;  2C35 B;  3IAY A;  3TN2 A;  3I4N H;  2IJ0 A;  4LF4 L;  1WD1 A;  5IE8 A;  1Y1V G;  5JOB A;  1S5D D;  4JI6 Q;  5IIF A;  1VQJ A;  4KV6 A;  2JQO A;  2JJQ A;  1GUG A;  4HID A;  4DA2 A;  1M1K C;  2EYP A;  4KKU A;  3HFZ B;  3T1Y L;  4DFA A;  1T9H A;  4X3U A;  1KRT A;  1TS5 A;  1HZB A;  1NMG A;  4DR1 L;  4DNT B;  3CHB D;  3TS2 A;  1EY5 A;  5FLM G;  4OO1 H;  1I4P A;  3KLW A;  4GNX A;  3I4M H;  4R4C A;  1LYL A;  3TRZ A;  1EQR A;  1EYG A;  3S16 H;  2QCP X;  3OYY A;  4AQY Q;  5ELD A;  1XNQ Q;  3QJY A;  3PF4 A;  3S2D B;  1X6O A;  1K28 A;  1N34 L;  4A3B G;  3J81 j;  3JAM E;  4PQX A;  4BA1 I;  2P5Z X;  1TWG B;  1YIJ A;  4MTN A;  2Y0S B;  3T4A C;  4PZ7 A;  4IFD I;  1J8I A;  4NXM Q;  2R6G A;  3CP0 A;  3D6W A;  2EYL A;  4NKL A;  2WAQ E;  4IZ8 A;  1SXT A;  1BO0 A;  4AIM A;  3HOW B;  1U0L A;  3RLO A;  3CCU A;  1VQA A;  3VYS A;  2JK8 A;  4JYA Q;  1AZP A;  3S1N H;  2GVA A;  4L5T A;  2WB1 B;  2JA6 B;  5L37 A;  3S2D H;  1JOQ A;  2C5C A;  2MO1 A;  4HIO A;  3NTH A;  3A7A B;  5KRU A;  1LLR D;  4C2M H;  2E2I B;  5TSS A;  5CV7 A;  4B3M L;  1Q3L A;  1STE A;  4C3H G;  3NTK A;  1EQQ A;  4HMJ A;  4PZ6 A;  2K5V A;  5C0X J;  2IWH A;  1PFN A;  3PUV A;  1PMR A;  4WRD A;  3I8Z A;  3G6E A;  5DEH A;  1FYC A;  2NN6 I;  4DUY L;  2VL6 A;  2TMP A;  3HOW H;  1L2F A;  1SYE A;  2BOS A;  4X3K A;  4NXN Q;  2J0T D;  4FF4 A;  1XMQ L;  1OXS C;  5I4D A;  1XJV A;  2CFM A;  1O7L A;  2EY1 A;  2EY2 A;  4OWX B;  4HIM A;  1L0Y B;  4QCL A;  4XYQ A;  1A2T A;  2K33 A;  4C1N I;  4IUU A;  2F0G A;  3P7J A;  4DXG A;  1SFO H;  3FP9 A;  1FGB D;  3GTO B;  1ZEQ X;  1BCP F;  2KEC A;  1AZQ A;  4L63 B;  1LTA D;  3SHL A;  2X6G A;  4DK6 C;  1TY2 A;  3HZX A;  1BR9 A;  3ND9 A;  4JOI A;  3VA7 A;  3KJO A;  4O0A A;  3K58 A;  1C8C A;  1F9R A;  3F2D A;  2D5D A;  5CR3 A;  5IYD H;  1TWC H;  2VS1 A;  4C3I G;  2A19 A;  1V1O A;  5ELE A;  4IPC A;  4WOR A;  1BCP D;  2PQA B;  2WIN B;  1STH A;  1AE3 A;  4IFD H;  2VUM B;  4FXK C;  3QOJ A;  2Z1C A;  2XN9 C;  2FJ2 A;  2F1M A;  5HUR A;  1BCP B;  2NUC A;  2B2Y C;  1HNW L;  3CCS A;  1I4G A;  1VMC A;  5C4Z A;  3GTO H;  1I94 L;  3M4O B;  4B3S Q;  1L1O B;  1QB5 D;  4X3T A;  1CA5 A;  2PI2 E;  3V2T A;  4DV5 L;  1J9O A;  2F0P A;  1G6Z A;  5AJ3 L;  4DV7 Q;  2XVS A;  1EEI D;  1X55 A;  1ESF A;  4IO9 A;  1HUM A;  4ZCK A;  4QMG A;  3MXN B;  4GKJ Q;  3RD4 A;  4DV4 L;  4BXX H;  1GHK A;  2N8N A;  2NYZ D;  5C5L A;  2DGY A;  5DM7 3;  1HHV A;  1XYI A;  1D5M C;  4J8Q A;  4X66 L;  4CDE C;  2B2T C;  1DOM A;  4A3F B;  1EY7 A;  1YNN D;  2FHT A;  3GP7 A;  1QE6 A;  4XXE A;  2F52 A;  4DV1 L;  3H0G H;  3HOY H;  2O5J C;  4ALP A;  2JA5 G;  1PH4 A;  3RMH A;  4P73 A;  1EFW A;  3EFX D;  2F0Q A;  3C2P A;  5KEE A;  2B2U A;  2NN6 H;  1V1P A;  1PH2 A;  1PZI D;  4QGU A;  3M3Y B;  3CPW A;  5DNF A;  4FP5 D;  2A73 B;  1STA A;  4IUP A;  1U9R A;  4HJ9 A;  4G7Z C;  4KLK A;  1VQ4 A;  4LFA L;  1E1T A;  1KAW A;  1D7Q A;  5I9O A;  1HZC A;  1PTO C;  2B2Y A;  3I4O A;  1TKW B;  2V4D A;  2B63 B;  5FO7 B;  3P1H A;  3A55 A;  5J1Z A;  4A3F H;  1IBL L;  2FIN B;  1PFS A;  1CQF A;  2NB0 A;  2AUK A;  4K6D A;  4OGQ C;  2VW9 A;  3R8B A;  2AMC B;  3GTM B;  1XNR L;  1CK1 A;  4HCE A;  4FNF A;  1P16 A;  3ULP A;  1M90 C;  1SYG A;  1YJN A;  3CCQ A;  5KNB A;  2JE6 I;  2C9O A;  4LK1 C;  1RCV D;  5JVG 3;  2LXK A;  3FPP A;  2CH4 W;  4JBK A;  1QVF A;  3GTP B;  4JBW A;  2KUM A;  1OXU A;  3Q6S A;  4C3J G;  3W1G A;  1ML0 D;  2NVQ H;  4A3G H;  5C3W A;  2KEE A;  3PMF A;  2DJF C;  2F3V A;  2B2W C;  2KVM A;  4JI8 Q;  3EA6 A;  4C56 C;  4DR2 L;  2B63 H;  3K5N A;  5IGF A;  1JJ2 A;  1HQR D;  4L5Q A;  2XSC A;  1B8A A;  1FVI A;  4LF6 L;  2KBN A;  5IYB H;  3VYR A;  1IL2 A;  4YCV A;  2CWP A;  1WTX A;  2BA0 A;  3N6R A;  2ZM6 Q;  3GTM H;  1EIG A;  3T53 B;  4BS9 A;  5COR A;  4HIK A;  3D0F A;  2QA4 A;  2XIW A;  5IP9 H;  3NBH B;  1PYB A;  1PRT C;  5EGT A;  1B44 D;  1BNZ A;  4LF7 Q;  3GTP H;  1IW7 C;  2M2L A;  2UU9 L;  5BN3 A;  3AFQ A;  1Q86 C;  4HCS A;  3CCL A;  3EN2 A;  1FD7 D;  1OTC A;  1RD9 D;  4GKK L;  1SND A;  2KCM A;  1ENA A;  3TZU A;  1I6H H;  2VZA A;  1HPC A;  1BQQ T;  1WCM B;  4GOP C;  1KRS A;  4XIG S;  1YHA A;  2EYF A;  2NBF A;  2YYZ A;  4KKS A;  1SNC A;  5EBC A;  1FNV A;  1UUP A;  2DY8 A;  1NY4 A;  3WOE A;  4DR4 Q;  1XPO A;  3UDI A;  1VS0 A;  2RBM A;  4NP5 A;  1TVX A;  4O2D A;  2HHH L;  2E2D C;  4BBR G;  5CBA E;  5C4J B;  2R7Z B;  2RKS A;  4GN3 B;  1KNA A;  2JA8 H;  2IT1 A;  4DV2 L;  4QJF A;  3ND8 A;  1N33 Q;  3S2H H;  5C44 B;  4ILW A;  4JI4 Q;  3MXP A;  4IQZ A;  3T56 B;  2JA7 G;  3DEO A;  1PH5 A;  3J7A V;  1K3B C;  4L5R C;  4KTA A;  4A3L G;  3A5Z B;  2F4V L;  1Y1W G;  2A69 D;  2UXB Q;  4R4I A;  3R2T A;  3U4Z A;  3DLL A;  4FXD A;  4LFC L;  1ONL A;  2RDG A;  1CKN A;  4DAP A;  1QOH A;  1IBK Q;  2ZT9 C;  4J15 A;  4OON A;  3MWY W;  2CVR A;  2HCC A;  1AN8 A;  4YCW A;  4C1N K;  1O80 A;  2RA4 A;  1SSO A;  4A3J B;  4BY7 G;  4KHP L;  4KD4 A;  1STG A;  1GUS A;  1SRO A;  2MJ8 A;  3HKZ B;  1S5B D;  3SK6 A;  3CRL C;  1ENF A;  4N9P A;  1GM5 A;  1KC8 C;  2I5H A;  1B2T A;  5C44 H;  3TDQ A;  1JR0 D;  4GOP A;  1J5E Q;  1LTI D;  4LF9 Q;  3MA2 B;  1ET6 A;  3RZD H;  3JAM L;  4A3D G;  1QVG A;  2UXC L;  1JOO A;  2AQ1 B;  1BOS A;  2VQE Q;  2OTL A;  1AP0 A;  3NXW A;  4OEL B;  3HKS A;  2IHE A;  4G7H C;  1LM0 A;  2Z6B A;  4LF5 L;  2HCI A;  4KN7 C;  3TEH B;  3PO3 B;  3SK5 A;  2BCO A;  4DV6 L;  1XX8 A;  4LF4 Q;  3H3V C;  3PQI A;  4A3C G;  2A1A A;  3FVQ A;  1SJH D;  5FKA C;  4GLX A;  4UY8 C;  1LAC A;  1VQG A;  1SYD A;  4TQU S;  4DUZ L;  1RDP D;  4K2L A;  2QDB A;  1EQT A;  2F3I A;  3W1B A;  1ICW A;  1Y1V B;  4F87 A;  1G2S A;  5JVH 3;  1EY4 A;  2F4I A;  3T1Y Q;  5GQO A;  1PZJ D;  2DY7 A;  2QEX A;  4EVO A;  4A3K B;  3KF8 A;  3BYY B;  1CZG A;  4NW2 A;  1DD2 A;  5COY A;  4HN7 A;  1CTM A;  1JT8 A;  4R9W A;  3UE0 A;  3G48 A;  4CBV A;  3A0J A;  1IL8 A;  2F0I A;  1S5C D;  3F2U A;  1SJE D;  3CCE A;  1OO9 B;  2ID0 A;  1A0I A;  5M9O A;  2Z4H A;  2GA4 B;  4XT3 B;  2LY7 A;  1N34 Q;  2F0S A;  1CSP A;  3K57 A;  2I07 B;  4KY6 A;  1Y1V H;  4A3B B;  1U4M A;  5T1G A;  1YHB A;  3MFY A;  1TWA B;  2MNA A;  4R4T A;  3A54 A;  4L6T B;  3M7G A;  2Y0S E;  3HOV B;  2XWJ B;  1SLJ A;  3BU2 A;  3OTO L;  1H9S B;  2HDL A;  2Z6K A;  2PW7 A;  4UP7 A;  3K6O A;  4KY7 A;  4RAU C;  2EVB A;  4JW0 A;  4KHZ A;  3K80 C;  1DON A;  1Y14 B;  3L7Z C;  5FLM H;  3T1H Q;  1BVS A;  3H09 A;  1PZK D;  1I5F A;  4XTC S;  3C1E A;  4TKO B;  3MHB A;  2RSN A;  5A35 A;  2ASB A;  4FO2 A;  2SDF A;  5LL6 X;  4P71 A;  5FO8 B;  4A3B H;  4TVA B;  1BBW A;  4NDX A;  3T16 A;  5JJI A;  4WJW A;  1TWA H;  5K5P A;  4B3M Q;  2R92 B;  4ZYS A;  3MZ5 A;  2B8G A;  4QIW B;  5M5X B;  4X6A H;  1MGS A;  3VA5 A;  4K5V A;  3RZO H;  3KBX A;  3N52 A;  3CU7 A;  1BDO A;  2AQ3 B;  1D8L A;  5EPJ A;  2L12 A;  1A63 A;  4DUY Q;  3KFU A;  2NTT A;  1PH1 A;  4P74 A;  5CV5 A;  5D14 A;  1ZKO A;  3PIO 3;  1XMQ Q;  4DR3 L;  3NEL A;  3E0J A;  5JEA J;  2E5L L;  4A75 A;  3STB D;  1TXY A;  1JOR A;  4ZUJ A;  5IWA L;  2R7F A;  4DAY B;  5EQ0 A;  2F0E A;  3I73 A;  3PSI A;  3DEP A;  2IL8 A;  5K36 G;  4HAE A;  2K5H A;  4FF1 A;  1G2T A;  4RHS A;  3I4N B;  1HTP A;  1NJI C;  2KJX A;  1PFM A;  1X3Q A;  1SNO A;  5C5M A;  1MKH A;  2B2V C;  3J81 E;  5IOC A;  3GO5 A;  4C3H H;  3MAQ A;  5IT9 E;  1PH7 A;  3NQT A;  1YBY A;  3L9A X;  2Z0S A;  1QWY A;  2F0V A;  4GN5 A;  1SRU A;  1CSQ A;  1EYA A;  2BA1 A;  5IGC A;  4ZLT F;  4ULL A;  4HSV A;  3J80 E;  2SNM A;  4O1N A;  3PUZ A;  3KF6 B;  1YJW A;  3OOC A;  1HNW Q;  2BE5 D;  4ME5 A;  1I94 Q;  3NSW A;  4XQN A;  3K7U C;  3E0E A;  4DU9 A;  4AYB E;  3I4M B;  2K01 A;  4DV5 Q;  2IY5 B;  2ZJP A;  1STY A;  1Z9F A;  5AJ3 Q;  2KA7 A;  3S16 B;  1PH8 A;  3DHQ A;  4ID6 A;  1W6K A;  1Z47 A;  4F7X A;  5M3M G;  2D9U A;  1RHP A;  2K75 A;  1HNZ L;  3NWT A;  5JAV A;  5D3D A;  4DV4 Q;  5BN4 A;  5C3E G;  4KMU C;  4G7O C;  4X66 Q;  2FMC A;  2K50 A;  4RGO S;  4MIU A;  1TY0 A;  3H6M A;  4I7A A;  4HJ7 A;  4DV1 Q;  2AUJ D;  1WFQ A;  1KIX A;  1L0X B;  4C3I H;  1TR5 A;  1T5X D;  5EPL A;  5JPM C;  2B2V A;  4QB4 A;  1K0R A;  2EYJ A;  4JI2 L;  3NEN A;  3L0O A;  1GVP A;  1YZ6 A;  1H9R A;  1ZYR C;  2B3G A;  4L8J A;  1CHQ D;  2ZTC A;  1SR3 A;  4P72 A;  1BCP C;  3NQI A;  1E2W A;  1SE2 A;  4PZ8 A;  5D65 A;  1YNJ D;  2F0O A;  3S1N B;  1VF7 A;  3T13 A;  2UUC L;  1L1O C;  1KDB A;  5FO9 B;  3SK4 A;  1MD2 D;  4Z9C B;  1S5E D;  1KNE A;  3DMU A;  5JJL A;  1K9M C;  2QGQ A;  4C2M B;  4ZQ3 A;  3TME A;  4A3M G;  2R3Z A;  2MHV A;  5C4H A;  1IBL Q;  1O7I A;  2D2C C;  1X3P A;  3EBE A;  4HED A;  1UE1 A;  1HNX L;  4DNR B;  5LMU L;  4QL5 A;  2E2H H;  1XNR Q;  1PXU A;  1OXV A;  4GLV B;  5GAE C;  3ZYY X;  1WTP A;  4JI1 L;  2IHF A;  2ZXO A;  3X3N A;  4F88 A;  3X3M A;  2JA5 H;  3HGB A;  4H13 C;  5GAH C;  2XGT A;  5T1I A;  1GO3 E;  4AH6 A;  1NUC A;  1V43 A;  3K5L A;  2JEA I;  5A2Q E;  2H4O A;  2JSO A;  3CC7 A;  4G57 A;  1Q82 C;  3R93 A;  2EPB A;  3PIP A;  1VQD A;  4C3J B;  3MXU A;  4DR2 Q;  2PNR C;  1SFO B;  4FYD A;  5C4X G;  1Q8I A;  1HR0 L;  3DWQ A;  3MEF A;  1TT2 A;  4LW1 A;  1C7Y A;  3HOZ G;  4LF6 Q;  3ERS X;  4PG3 A;  1XMO L;  1X3E A;  3URY A;  1VQ8 A;  2KHJ A;  4DK0 A;  4JI5 L;  3RN5 A;  3UI2 A;  4OX9 L;  2K5Q A;  1IHZ A;  1MJC A;  1Z7T A;  1G91 A;  1C9O A;  3NP8 A;  4IAL A;  1EY0 A;  4DR7 L;  2X6L A;  1TWC B;  3J7A 5;  2EJM A;  1KLU D;  1NR4 A;  4KD3 A;  4NMZ A;  1EY6 A;  2UUA L;  2SNS A;  2ZJR A;  1H9K A;  2EXD A;  3TBI B;  3QO2 A;  2K04 A;  4K14 A;  2ZTD A;  3PGZ A;  5FOB B;  4GNX B;  1NBW A;  1EZ8 A;  4A76 A;  4C3J H;  3GTG H;  1CUK A;  4YIJ A;  3D4W A;  4GKK Q;  2F0K A;  2Q8T A;  1QZH A;  4KJO A;  1WJJ A;  4YY3 L;  2K14 A;  4LAA A;  2OT2 A;  1EWI A;  1SMY C;  3A8I E;  4A93 G;  5HGQ A;  1EU3 A;  1Y8N B;  1JWU D;  4EQN A;  2HHH Q;  5FJ8 G;  3QWN A;  1SBB B;  2PZT A;  4ODG A;  4JI0 L;  1O7Z A;  2J7Z A;  1IBM Q;  1EL0 A;  4DV2 Q;  1VQK A;  3HOU G;  3SDZ A;  1LV9 A;  4BBR B;  2AQ2 B;  1Q1E A;  3IFD A;  4JCV E;  1SNM A;  3H0G B;  3PV0 A;  3JC6 6;  5CYU A;  3HOY B;  1H9M A;  4IOA A;  2F4V Q;  1P8L A;  3E9H A;  4AYB B;  3K5M A;  3KK7 A;  2A68 D;  2VXW A;  4LWC A;  4RGN A;  2AWN A;  5G3L F;  4LFC Q;  4FXG C;  4ZKB B;  3I91 A;  3QG1 A;  1VQH A;  3PO2 G;  4QF4 A;  3T51 B;  1H95 A;  5IGD A;  1ILP A;  4OHJ A;  2OQK A;  4KHP Q;  3VR6 A;  3TZD A;  1GUW A;  3CW2 C;  1G29 1;  4DAV A;  2A6H C;  5G3L D;  5IGE A;  4MHE A;  4RG1 A;  4IFD J;  1TWF H;  4BBR H;  2O5I C;  4K6L A;  3HKZ E;  3FRP B;  3GTK H;  4EX5 A;  1A3U A;  2LMC B;  2JXM B;  2PZU A;  3J80 c;  3PCO B;  1JB3 A;  4A3E G;  1NE3 A;  1CFM A;  5I9P A;  2JA7 H;  4X65 L;  4LF5 Q;  4QQB X;  2EY6 A;  5BR8 L;  2EE1 A;  4DV6 Q;  4A3L H;  1WTH A;  3NBI A;  4GZY C;  1Y1W H;  3CPF A;  4HJ8 A;  1HA5 A;  5AFW A;  3GDE A;  2NVX H;  2MUY A;  4DUZ Q;  5C0X G;  1PHJ A;  4JI7 L;  5EKI A;  1K73 C;  4A3G B;  2NVQ B;  1AH9 A;  3BJU A;  5ELC A;  2TSS A;  4UPA A;  1YIT A;  2D0P A;  3I2Z A;  3HOX G;  4BY7 H;  3S14 H;  1KD1 C;  2A6E D;  1QNU A;  1GXD C;  1KAA A;  4CJ1 B;  4AQY L;  3J7A F;  1O7Y A;  2R93 G;  1UE7 A;  4X62 L;  1SEB D;  3M4Y A;  2B39 A;  3I7F A;  2F0N A;  4I7Z C;  5EJW A;  4A3D H;  3EVQ A;  3HP3 A;  4HR7 B;  3FHW A;  3F1Z A;  1RJT A;  3V96 A;  2UUB L;  2JP1 A;  1S4Z A;  1X56 A;  4A3I G;  2B2T A;  1U4L A;  1UE5 A;  2PO4 A;  1WD0 A;  1Y8P B;  3VR3 A;  4A3C H;  3JAM c;  4WFN 3;  1HUN A;  4JBM A;  2OTJ A;  4LF8 L;  2G9H D;  4ZUI A;  2BH2 A;  2GN5 A;  2WB1 G;  2JA6 G;  2PZW A;  5J3B A;  1TQO A;  1I6H B;  3OTO Q;  4XYO A;  1F2L A;  4FF2 A;  2PI2 A;  1E22 A;  2O4X A;  2N49 A;  3NWS A;  4KHV A;  1UEB A;  4DV0 L;  3CKI B;  3CMA A;  1XXG A;  2CH4 A;  1HZA A;  4P75 A;  4F8M A;  2JA8 B;  3TRE A;  3SGI A;  3VYU A;  3S2H B;  3KJP A;  4RGM A;  4P2C B;  2FXQ A;  3OWE B;  1VQP A;  1I3Q H;  2Q2I A;  2E76 C;  1V1P B;  1WTO A;  2PNH A;  5GRO A;  5E4W C;  3EQL C;  2XTI A;  2EXZ A;  2O2L D;  3AB9 A;  5IGB A;  3LX0 A;  2QKI C;  1VDZ A;  1EWH A;  4RA8 A;  3J80 L;  1OXX K;  2DNC A;  2KCN A;  3WWV A;  4QIW E;  2F0F A;  4LMQ D;  5ELN A;  4X64 L;  1A8V A;  2B2W A;  1HXY D;  4DR3 Q;  2YTV A;  4B3T L;  1OXT A;  2E5L Q;  5CC4 A;  3LWU A;  1NNX A;  2NTS A;  5IWA Q;  3CC4 A;  3TSS A;  2BH8 A;  1D5Z C;  3J7Y W;  1QNK A;  1M8A A;  2Q2H A;  1UAP A;  3RZD B;  2OEO A;  2UXD L;  1N36 L;  4IPG A;  2RF4 A;  4NPS A;  1J6Q A;  1EOT A;  2K4K A;  2ICI A;  2AKW B;  3KDF A;  2L0C A;  1KHI A;  2EYM A;  3I56 A;  3OHX C;  2VUM G;  2AHO B;  3QIA A;  4K2K A;  1B3Q A;  2HQE A;  3S15 B;  3W3A A;  3I90 A;  2E75 C;  3RNU A;  1W2B A;  2Q8R E;  3CQZ B;  2CW0 D;  1X32 A;  4WJ4 A;  5JPN C;  1A6X A;  1DGS A;  1V9P A;  2XNA C;  3L2P A;  1F2Z A;  1IZ6 A;  1S40 A;  4DNI A;  4HJ5 A;  3HG9 A;  1CZW A;  5JJK A;  1MI2 A;  2KCT A;  2PYK A;  1KL9 A;  2JA9 A;  1CHP D;  2L55 A;  1PH6 A;  3UDF A;  3KLS A;  1G6P A;  1KAB A;  1PLF A;  2EYO A;  2SOB A;  3STB C;  5K36 H;  2OCE A;  1M4V A;  3S15 H;  1HR0 W;  2A74 C;  4E6I A;  1BXT A;  1B50 A;  1X3F A;  5KND A;  4CDD C;  3SVM A;  5M3M B;  1VQN A;  3CQZ H;  1ILQ A;  4Y7N H;  2EIF A;  4CKC A;  1B70 B;  1FL0 A;  3VR5 A;  2YTY A;  2E8G A;  2CQO A;  1IYJ B;  1JC7 A;  3FKI G;  4OL7 A;  1B3A A;  2NVT H;  3CAM A;  5C3E B;  3AQQ A;  3S1R B;  3E5S A;  5A2Q L;  2CQA A;  4DR1 Q;  3J7Z C;  4JI2 Q;  1PTO H;  1JJG A;  2HDM A;  3G6J B;  4GN4 B;  3TP8 A;  2RHQ B;  3TS0 A;  1VQL A;  1EU4 A;  4KY5 A;  2WAQ G;  5EKL A;  3E3X A;  1LT5 D;  1B1Z A;  2Z9H A;  2UUC Q;  1N32 L;  3RR5 A;  3I4L A;  2AWO A;  1PA6 A;  4XT1 B;  1VQB A;  2NZ1 D;  3UE1 A;  4CJ2 C;  3CME A;  2IX1 A;  5M3M H;  1L0W A;  1QUQ A;  2F0L A;  1VQO A;  1CKN B;  1E1O A;  1WYD A;  3D31 A;  5BN5 A;  3CC2 A;  2Q2T A;  1HNX Q;  5C3E H;  2RVL A;  4U67 3;  3S1R H;  4A3M B;  3RZO B;  1X9N A;  5I6W A;  5FK9 C;  4RGT A;  2L4N A;  3SK8 A;  2CWA A;  5CGK A;  4JI1 Q;  2Z4I A;  2MP1 A;  2MPM A;  3SXH A;  5KNC A;  4OWW B;  1A2U A;  2EJG C;  3OSO A;  1D1I A;  2MO0 A;  3BVM A;  1WI5 A;  4N9T A;  4YHH L;  2RSO A;  1LTB D;  3BZD B;  3G71 A;  2I46 A;  4JBJ A;  5H1S E;  5ELF A;  1JMC A;  5ELB A;  4PMW A;  1EEF D;  3NTI A;  3H3V I;  1VMP A;  2MGS A;  2KQ3 A;  3K8A A;  3BVZ A;  1YNJ C;  5C4X B;  2H1E A;  4ZK9 B;  1JE4 A;  4A3M H;  4OXP A;  3CXC A;  4DR6 L;  3CCR A;  3HOZ B;  4OX9 Q;  3F8T A;  1VQ5 A;  1I4H A;  1S72 A;  4C3H B;  2FFK B;  3MC0 B;  2VNU D;  1JWM D;  3D4D A;  1F77 A;  2XRS D;  4UDU C;  5KGU A;  4DR7 Q;  1LO5 D;  2OF1 A;  1X3G A;  1QVC A;  2G5D A;  1HTL D;  5CV8 A;  4HTH A;  4TSS A;  3KF8 B;  1NCV A;  3NEM A;  1F9S A;  1S5F D;  3NPP A;  1WCM G;  2UUA Q;  2EYH A;  3J80 i;  1KTK A;  4KJN A;  4Y52 H;  3DWA A;  1TS3 A;  3GTJ B;  2F0U A;  2L5T A;  1I50 H;  3OPO A;  4JI3 L;  3DUZ A;  1UEA B;  5LL6 S;  1W3S A;  2N55 A;  2WFW A;  3AU7 A;  3RN2 A;  2R7Z G;  1C4Q A;  3P75 A;  1MJE A;  3ONA B;  3HS0 C;  1Q8K A;  4CJ0 B;  3TP6 A;  4YY3 Q;  3A74 A;  2DUD A;  4BBS G;  2NWG A;  5C4X H;  3A5U A;  2K03 A;  3H94 A;  3QOL A;  2HIX A;  5EPK A;  1DOK A;  3HOZ H;  4RCN A;  1F9P A;  3IKJ A;  5IYC G;  2IW3 A;  3F2B A;  1I4Q A;  4UHV A;  4JI0 Q;  3LWE A;  2ES2 A;  3GV6 A;  3ITP A;  4V19 0;  1ICF B;  1SE3 A;  2MFI A;  4B3R L;  2LKV A;  1PYS B;  3MEH A;  4TRD A;  1TWH B;  4C3I B;  3ULL A;  3GTJ H;  3RLF A;  4A3J G;  4JPB W;  1DOL A;  5C0X I;  1SNQ A;  3BYT B;  2F0H A;  2PCF B;  4MTK A;  4DK3 C;  4GNX C;  1Z6H A;  1ASZ A;  3PUX A;  1STB A;  3BDO A;  1B9N A;  4IPD A;  4ZRZ A;  3JAM i;  1ENC A;  3PO2 B;  4DR5 L;  4KN4 C;  4PV1 C;  4GS3 A;  1J5E L;  2WKC A;  4JK1 C;  4LF9 L;  1CA6 A;  4IJL A;  2K5D A;  3PO3 G;  2XWB B;  3H3V H;  2DNE A;  4A93 H;  1EOV A;  1B7Y B;  2ENB A;  4RWS C;  5FLX E;  5FJ8 H;  1MSG A;  1LT4 D;  4Q0F A;  2KED A;  1CI3 M;  1TWH H;  1PDQ A;  3KBG A;  1BBU A;  2E2H B;  3HOU H;  4BY1 G;  1PYW D;  4X65 Q;  4N8X 1;  2QEJ C;  3CD6 A;  5LMN L;  5BR8 Q;  3K7A H;  4A3E B;  4A3K G;  1YI2 A;  1K83 H;  2JA5 B;  3C3L A;  3PUW A;  2BDN A;  5CBE E;  3D6C A;  1K8A C;  5HGT A;  3CCM A;  3BDC A;  4RH6 A;  1HRJ A;  5E7N A;  4LFA Q;  4JI7 Q;  4K0K L;  2IPK D;  1K8O A;  3PO2 H;  1EWC A;  1CM9 A;  1ET9 A;  2K28 A;  2A68 C;  1ESR A;  3KLS X;  5CV9 A;  1PV4 A;  3M7N A;  3AFP A;  5JEA G;  1F2M A;  1Y8O B;  1CT1 D;  3I55 A;  1K8M A;  3S1M B;  3NHH A;  1XPR A;  4DPG A;  3QR8 A;  3HOX B;  4X62 Q;  3A7L A;  3KUP A;  4IPH A;  1VQF A;  5M3F G;  5JJZ A;  3Q0A A;  2VQF L;  3U50 C;  1NMF A;  2UUB Q;  1JJC B;  2OWO A;  4A3E H;  3S24 A;  4APV A;  4YWM A;  5DM6 3;  2R93 B;  1LAB A;  4LNQ A;  3HOV G;  1AEX A;  2E2J B;  5IP7 G;  4WJ3 M;  1HZ9 A;  1YNN C;  2EY5 A;  1JWS D;  4YWL A;  3OMG A;  4J1M A;  4A3I B;  1ASY A;  1CKM A;  2PQA A;  1N8R C;  4LF8 Q;  4J6H A;  4UAI A;  2VB3 X;  5C3X A;  1FGU A;  4LFB L;  3GTG B;  1ROD A;  5C0X H;  5EBD A;  1GKH A;  1Q1B A;  1I4X A;  3MXG A;  4PMC A;  1FJG L;  3S1M H;  1DYQ A;  3T1H L;  1C0A A;  1ZXT A;  3TQY A;  3I70 A;  2PMZ B;  2K6A A;  2OXP A;  3HOX H;  4G4K A;  1L1O A;  4DV0 Q;  3DM1 A;  4JOI C;  4HSP A;  4K5W A;  1B53 A;  1LTR D;  3HEJ A;  2KCC A;  4NB3 A;  2R92 G;  2R93 H;  1E0B A;  2K32 A;  2ZXP A;  4H0L C;  1TWG H;  4U68 A;  2QW7 A;  4DV3 L;  3U58 A;  2E2J H;  3MXN A;  3OIQ A;  2K5N A;  2UU9 Q;  5NUC A;  2F3W A;  2A6E C;  2Q8I B;  2CHB D;  4A3I H;  1IYU A;  1DJR D;  1HCZ A;  4XQQ A;  3FPU B;  1JB7 A;  3ICE A;  1RIP A;  1RKN A;  4CGY B;  4FF3 A;  4EQ5 A;  4KI0 A;  2F0D A;  1RL2 A;  4HMI A;  4DKA C;  2YU9 B;  3ER0 A;  3GV3 A;  2WII B;  2LSS A;  1KDA A;  4JC0 A;  2JA6 H;  3LGJ A;  1PH9 A;  2A8V A;  4X64 Q;  4IJH A;  3TP7 A;  4DK1 A;  3R3O A;  4M8A A;  2F03 A;  4B3T Q;  1LT6 D;  3I4N G;  2K1B A;  4PMB A;  1TS4 A;  4CKB A;  5KYL A;  4V0B A;  2E2I H;  4N8F A;  3BS1 A;  5KYI A;  1TWF B;  3I3C A;  2NZH A;  2UXD Q;  1E2Z A;  2ICE C;  5E3F A;  3GTK B;  1B9M A;  4OIK A;  1N36 Q;  4JV5 L;  1CKO A;  1QJO A;  1MIU A;  2JA7 B;  4EQP A;  2I5M X;  3OIP A;  3R2I A;  1HJP A;  2B2U C;  3PUY A;  1ZYR D;  3BG3 A;  1VQ6 A;  2YU9 H;  1Y1W B;  4CDF C;  3ERO A;  5E1F A;  3VR4 A;  2NVX B;  1PFB A;  4RCO A;  4GLA C;  1EYD A;  1NSN S;  1VF5 C;  3MFG A;  1EY8 A;  1XTD A;  3J81 c;  4OO1 G;  4UP8 A;  1U4P A;  5IT9 c;  2ATW A;  4IOC A;  1YNX A;  5I2Y A;  1Y69 U;  3I4M G;  3OW2 A;  3C1F A;  3SEB A;  4POF A;  2KHI A;  3LNN A;  1Q81 C;  4K8J A;  4BY7 B;  1X54 A;  4RMF A;  3S14 B;  2H5X A;  1TU2 B;  2JN4 A;  1AFP A;  1EIH A;  2UXC Q;  2HUG A;  3DM3 A;  2N3S A;  1D1K A;  1VQE A;  4IUQ A;  1G51 A;  4A3D B;  4JI6 L;  5GAD C;  3M85 A;  3K5O A;  1RTN A;  5DLQ E;  2ZXR A;  2E74 C;  1KDC A;  3W5O A;  3NBH A;  5M5W B;  2VUM H;  4LJZ C;  3KOJ A;  2ALY B;  4H44 C;  2I0Q A;  2ZJQ A;  2A69 C;  3PIO A;  3SE0 A;  4IUV A;  1C48 A;  5D3I B;  4ZKC B;  1GUN A;  1H9J A;  1NR2 A;  5FLX c;  3M4O H;  3Q8D A;  4QY7 A;  1B4O A;  2YV5 A;  3EJI A;  3IRB A;  3C46 A;  4IUT A;  2K52 A;  3FKI B;  3NE5 B;  4QUC A;  1XNQ L;  1KLG D;  1U4R A;  1AE2 A;  3MTS A;  2Y0S G;  2CW0 C;  2I5L X;  2FMM A;  3K59 A;  3E6Z X;  3D8G A;  1QIL A;  4LUV A;  4XQJ A;  1IKM A;  5C6A A;  4LUZ A;  1N32 Q;  2WAC A;  4RKL A;  5M5W H;  2WAQ B;  1I3Q B;  1D6E C;  1YJ9 A;  4NXM L;  3Q23 A;  3HOW G;  3D4R A;  2NZO A;  1A15 A;  4CHT B;  2IX0 A;  3RUZ A;  1UNS A;  1VQM A;  1GUO A;  1SYC A;  4B9W A;  3M3Y H;  1NTG A;  1U5K A;  1DM0 B;  4MN3 A;  3EIV A;  4L5S A;  1SE8 A;  2RHS B;  1LTG D;  1STN A;  4DGZ A;  3FKI H;  1FR3 A;  4JYA L;  2SEB D;  1SMY D;  1YVC A;  1AW7 A;  5LHY 1;  3QB3 A;  1MBY A;  5F2D A;  4MNO A;  2D0O A;  1VQ9 A;  3CCJ A;  3CCV A;  1O78 A;  2KHS A;  1X65 A;  3RLN A;  3K0X A;  3S9W A;  1GJX A;  1Q12 A;  2F0M A;  4YHH Q;  3J81 L;  1VQC A;  2CKZ B;  4R1J A;  1K8G A;  5M5Y B;  5IT9 L;  5CMD A;  3FDT A;  5IYD G;  2ZTE A;  2L11 A;  5J39 A;  3M4P A;  4EQO A;  4XDX A;  2EDG A;  1WTV A;  1Q46 A;  1G8Z D;  2L1B A;  2KOL A;  4IN3 A;  4IFD G;  1D2B A;  4CKE A;  4NXN L;  4DR6 Q;  1SN8 A;  1JCK B;  1QG7 A;  4R8I A;  4HJA A;  3GTQ B;  1EY9 A;  1SMX A;  3G7L A;  3NK9 A;  1SAP A;  1UWV A;  2PQE A;  3DWP A;  1XTC D;  2PW5 A;  3BDL A;  3VDY A;  1WOC A;  1NAP A;  1SDF A;  2YTX A;  3AMU A;  3D3R A;  1EIY B;  2IX3 A;  1SNP A;  1K0S A;  4O42 A;  1VQI A;  2DN8 A;  5J22 A;  2A6H D;  5LMN W;  3FEW X;  1HQM C;  1EUJ A;  3VYT A;  5M5Y H;  3CRK C;  4JI3 Q;  1YHQ A;  1UE6 A;  1E3P A;  4ME3 A;  3S17 B;  4BXX G;  1PTO F;  2L9H A;  1DXM A;  2L15 A;  5FLX L;  1JE5 A;  4KK7 A;  1I4R A;  3H0G G;  1IBM L;  3GTQ H;  3P20 A;  2EJF C;  5DAU A;  3HOY G;  1IKL A;  2HT1 A;  3W2D A;  4OEM B;  4BBS B;  4AYB G;  4FVM A;  2NN6 G;  2F0J A;  2Z8L A;  4B3R Q;  3K0Y A;  3UDX A;  3IL8 A;  4Y7N B;  1PTO D;  4IUR A;  2NVT B;  1BKB A;  5HY6 A;  1T5E A;  2VB2 X;  4B3S L;  3K81 C;  4I65 A;  1QCB D;  1EZ6 A;  3HRZ C;  3G4S A;  4PNY A;  1WCM H;  1LTT D;  1PTO B;  2RDH A;  4LUO A;  4DV7 L;  1JOK A;  4RKB A;  3U4V A;  3S17 H;  1XWE A;  4JG2 A;  4BA2 I;  2RDF A;  3V05 A;  4JVZ A;  1H9S A;  1Q90 A;  2J4X A;  3PIP 3;  1QZG A;  4KKT A;  4CDC C;  5C4J H;  4A3F G;  2R7Z H;  4GKJ L;  2QF7 A;  1DCZ A;  4POG A;  3AEV A;  4DR5 Q;  1F9Q A;  1HNZ Q;  1JQY D;  4BBS H;  1SE4 A;  3B6Y A;  5KIX A;  1MHW C;  2B8F A;  5IYC H;  3M4Q A;  4UP9 A;  4YWK A;  3M9B A;  4M1U B;  1MSH A;  3H15 A;  1YEZ A;  1PRT F;  1GUT A;  3E9I A;  4A3G G;  1E7Z A;  3DXJ C;  2K05 A;  5LMN Q;  1W6J A;  2HQL A;  1A3V A;  2Z6K C;  4K5X A;  2B63 G;  3CF5 A;  2M9V A;  1K3R A;  1EQV A;  1LTS D;  4S3S A;  4A3J H;  4BY1 B;  2NVY B;  2HIV A;  1WTR A;  5IYB G;  3I72 A;  1Q7Y C;  3S1Q B;  1WVL A;  1IYV A;  1RF2 D;  1WTW A;  4B9X A;  4K0K Q;  1FNU A;  4BWG B;  4ABN A;  1PRT D;  5ISR A;  1IW7 D;  5GAG C;  3KDF B;  2V1C C;  5ELO A;  1DZ1 A;  3AYH B;  3A8J E;  5IP9 G;  2BE5 C;  5CV4 A;  3Q24 A;  2B29 A;  1GD7 A;  4DAM A;  4DAY A;  1R4P B;  1PRT B;  4DXF A;  2PPB C;  4OWT B;  1V8Q A;  4YCU A;  3PO3 H;  4X3S A;  1N9W A;  3IFT A;  5LMU Q;  3WDN A;  4RHR A;  2G9D A;  1BF4 A;  3GTL B;  2X69 A;  4K8I A;  3L3O C;  3F2C A;  3FMC A;  3MVV A;  2VQF Q;  3BZK A;  1RTO A;  1BUV T;  5IY0 A;  2EOT A;  4R4O A;  2D62 A;  2RCN A;  4B08 A;  4BY1 H;  2NVY H;  5EKK A;  5M3F B;  1HH2 P;  1V1Q A;  4DN4 M;  4GOP B;  1R9T B;  4JI8 L;  3S1Q H;  4FDB A;  3OW7 A;  5IOD A;  4A3K H;  4EGV A;  1F2Y A;  5I6Y A;  1LT3 D;  3ZJY C;  1I50 B;  1JIC A;  4LFB Q;  2K5W A;  1KQS A;  3TP5 A;  3OMC A;  4MZ9 A;  2ZM6 L;  1HR0 Q;  1FJG Q;  2JA8 G;  1A62 A;  2EZV A;  3KLR A;  3KF6 A;  3SR1 A;  4ZAI A;  1XMO Q;  2MQH A;  3WOF A;  1D5X C;  3J81 i;  1E24 A;  3A56 A;  1PH3 A;  2F0T A;  4JI5 Q;  1I6V C;  3GTL H;  5JEA H;  4LF7 L;  2GVB A;  2RCF A;  2LXJ A;  1TS2 A;  2PMZ E;  2WB1 E;  3ULJ A;  3KYH C;  3Q22 A;  2HD3 A;  1EYC A;  2M00 A;  2WV6 D;  2LFN A;  4DV3 Q;  5M3F H;  1R9T H;  2N88 A;  3PF5 A;  4A4I A;  3NUC A;  3U9S A;  3ERQ A;  4DF7 A;  2WP8 J;  2Q2U A;  1PVO A;  5E4X A;  3HOV H;  3O13 A;  2RQX A;  3BVG A;  5IP7 H;  1EFI D;  1S3O A;  2OQ0 A;  5I2X A;  1XPU A;  4QUF A;  1GHJ A;  2JYO A;  4OO1 I;  4DR4 L;  1HFG A;  4IUN A;  5C44 G;  1FNW A;  2QIL A;  1BBX C;  2DJG C;  2N78 A;  1KXL A;  1A3T A;  1LTL A;  2R7D A;  1EIF A;  1N33 L;  3H91 A;  3OWF A;  1QUQ B;  1CQV A;  2EQS A;  2KEN A;  4JI4 L;  3BZC A;  3GD7 A;  2BDO A;  1WTQ A;  1HA6 A;  1R4Q B;  1VQ7 A;  4A93 B;  1SYF A;  2UXB L;  1VCI A;  4RFB A;  3VR2 A;  2A5H A;  2R92 H;  1LUZ A;  2R61 A;  3UDG A;  5M5X H;  2CCZ A;  4JV5 Q;  1HFN A;  1IBK L;  2QDL A;  3A8K E;  4OIJ A;  3HOU B;  2VY3 A;  5CV6 A;  4R4Q A;  5EAY A;  3HKZ G;  3K7A B;  1TII D;  1GOZ A;  4H7B A;  1K83 B;  2WKD A; 
#chains in the Genus database with same CATH homology
 3U9O A;  4Q5V A;  2JEB I;  3GQB A;  2K7V A;  2F0W A;  2XRQ D;  1SYB A;  2LS0 1;  5IGG A;  1E2V A;  4R8N A;  1II3 A;  3IAY A;  3TN2 A;  2IJ0 A;  1WD1 A;  5JOB A;  1S5D D;  5IIF A;  4KV6 A;  1GUG A;  4DA2 A;  2EYP A;  4KKU A;  4DFA A;  4X3U A;  1TS5 A;  4DNT B;  3CHB D;  1EY5 A;  4OO1 H;  1I4P A;  2QCP X;  5ELD A;  3QJY A;  3S2D B;  3JAM E;  4PQX A;  4BA1 I;  1TWG B;  2Y0S B;  3T4A C;  4IFD I;  1J8I A;  2R6G A;  3D6W A;  2EYL A;  4NKL A;  4IZ8 A;  1SXT A;  1BO0 A;  3HOW B;  3VYS A;  1AZP A;  2WB1 B;  2JA6 B;  1JOQ A;  2C5C A;  3NTH A;  3A7A B;  5KRU A;  1LLR D;  2E2I B;  5TSS A;  5CV7 A;  1Q3L A;  1STE A;  4C3H G;  3NTK A;  4HMJ A;  5C0X J;  2IWH A;  1PFN A;  3PUV A;  1PMR A;  4WRD A;  3I8Z A;  5DEH A;  1FYC A;  2NN6 I;  2TMP A;  1SYE A;  2BOS A;  4FF4 A;  4X3K A;  2J0T D;  1OXS C;  5I4D A;  2EY1 A;  1O7L A;  2EY2 A;  1L0Y B;  4QCL A;  4XYQ A;  1A2T A;  2K33 A;  4C1N I;  4IUU A;  2F0G A;  3P7J A;  4DXG A;  1FGB D;  3GTO B;  1ZEQ X;  1BCP F;  2KEC A;  1AZQ A;  4L63 B;  1LTA D;  3SHL A;  2X6G A;  1TY2 A;  3HZX A;  1BR9 A;  3ND9 A;  3VA7 A;  3K58 A;  1C8C A;  1F9R A;  2D5D A;  5CR3 A;  4C3I G;  1V1O A;  5ELE A;  4WOR A;  1BCP D;  2WIN B;  1STH A;  4IFD H;  2VUM B;  4FXK C;  3QOJ A;  2Z1C A;  2XN9 C;  2FJ2 A;  2F1M A;  5HUR A;  1BCP B;  2NUC A;  2B2Y C;  1I4G A;  1VMC A;  5C4Z A;  3M4O B;  1QB5 D;  4X3T A;  1CA5 A;  3V2T A;  1J9O A;  2F0P A;  1G6Z A;  2XVS A;  1EEI D;  1ESF A;  1HUM A;  4QMG A;  1GHK A;  3RD4 A;  2NYZ D;  5C5L A;  1HHV A;  5DM7 3;  1XYI A;  1D5M C;  4J8Q A;  2B2T C;  1DOM A;  4A3F B;  1EY7 A;  1YNN D;  2FHT A;  3GP7 A;  1QE6 A;  4XXE A;  2O5J C;  3RMH A;  2F0Q A;  3EFX D;  3C2P A;  5KEE A;  2B2U A;  2NN6 H;  1V1P A;  1PZI D;  3M3Y B;  5DNF A;  4FP5 D;  2A73 B;  1STA A;  4IUP A;  1U9R A;  4G7Z C;  5I9O A;  1PTO C;  2B2Y A;  1TKW B;  2V4D A;  2B63 B;  5FO7 B;  3P1H A;  3A55 A;  5J1Z A;  2FIN B;  1CQF A;  2NB0 A;  2AUK A;  4K6D A;  4OGQ C;  3R8B A;  3GTM B;  1CK1 A;  4HCE A;  4FNF A;  1SYG A;  5KNB A;  2JE6 I;  2C9O A;  4LK1 C;  1RCV D;  5JVG 3;  3FPP A;  3GTP B;  4JBW A;  2KUM A;  1OXU A;  3Q6S A;  4C3J G;  1ML0 D;  5C3W A;  2KEE A;  3PMF A;  2F3V A;  2B2W C;  2KVM A;  4C56 C;  3EA6 A;  3K5N A;  5IGF A;  1HQR D;  2XSC A;  3VYR A;  1WTX A;  2BA0 A;  3N6R A;  1EIG A;  3T53 B;  4BS9 A;  5COR A;  2XIW A;  1PRT C;  5EGT A;  1B44 D;  1BNZ A;  1IW7 C;  2M2L A;  5BN3 A;  4HCS A;  1FD7 D;  1RD9 D;  1SND A;  1ENA A;  3TZU A;  1HPC A;  1BQQ T;  1WCM B;  4XIG S;  2EYF A;  2NBF A;  2YYZ A;  4KKS A;  1SNC A;  5EBC A;  1FNV A;  1UUP A;  2DY8 A;  3WOE A;  2RBM A;  4NP5 A;  1TVX A;  2E2D C;  5CBA E;  5C4J B;  2R7Z B;  2RKS A;  1KNA A;  2IT1 A;  3ND8 A;  5C44 B;  4ILW A;  3MXP A;  4IQZ A;  3T56 B;  3DEO A;  3J7A V;  4KTA A;  2A69 D;  3R2T A;  4FXD A;  1ONL A;  2RDG A;  4DAP A;  1QOH A;  2ZT9 C;  3MWY W;  2CVR A;  2HCC A;  1AN8 A;  4C1N K;  1O80 A;  2RA4 A;  1SSO A;  4A3J B;  4KD4 A;  1STG A;  1GUS A;  2MJ8 A;  3HKZ B;  1S5B D;  3SK6 A;  3CRL C;  1ENF A;  4N9P A;  1B2T A;  3TDQ A;  1JR0 D;  1LTI D;  3MA2 B;  1ET6 A;  3JAM L;  1JOO A;  2AQ1 B;  1BOS A;  1AP0 A;  3NXW A;  4G7H C;  2HCI A;  4KN7 C;  3PO3 B;  3SK5 A;  2BCO A;  1XX8 A;  3H3V C;  3FVQ A;  1SJH D;  5FKA C;  1LAC A;  4TQU S;  1SYD A;  1RDP D;  4K2L A;  2QDB A;  1EQT A;  1ICW A;  1Y1V B;  4F87 A;  1G2S A;  5JVH 3;  1EY4 A;  2F4I A;  1PZJ D;  2DY7 A;  4EVO A;  4A3K B;  3KF8 A;  3BYY B;  1CZG A;  4NW2 A;  1DD2 A;  5COY A;  4HN7 A;  1CTM A;  4R9W A;  4CBV A;  1IL8 A;  2F0I A;  1S5C D;  3F2U A;  1SJE D;  1OO9 B;  2ID0 A;  5M9O A;  2Z4H A;  2GA4 B;  4XT3 B;  2LY7 A;  2F0S A;  3K57 A;  2I07 B;  4KY6 A;  4A3B B;  1U4M A;  5T1G A;  3MFY A;  1TWA B;  3A54 A;  4L6T B;  3M7G A;  3HOV B;  2XWJ B;  1H9S B;  2HDL A;  2PW7 A;  3K6O A;  4KY7 A;  4RAU C;  2EVB A;  4KHZ A;  1DON A;  3L7Z C;  3H09 A;  1PZK D;  4XTC S;  3C1E A;  4TKO B;  3MHB A;  2RSN A;  5A35 A;  4FO2 A;  2SDF A;  5LL6 X;  5FO8 B;  4NDX A;  3T16 A;  4WJW A;  5K5P A;  2R92 B;  4ZYS A;  3MZ5 A;  2B8G A;  4QIW B;  5M5X B;  1MGS A;  3VA5 A;  4K5V A;  3KBX A;  3N52 A;  3CU7 A;  1BDO A;  2AQ3 B;  5EPJ A;  2L12 A;  2NTT A;  5CV5 A;  5D14 A;  1ZKO A;  3PIO 3;  3E0J A;  5JEA J;  1JOR A;  4ZUJ A;  5EQ0 A;  2F0E A;  3I73 A;  3DEP A;  2IL8 A;  5K36 G;  4HAE A;  4FF1 A;  1G2T A;  4RHS A;  3I4N B;  1HTP A;  2KJX A;  1PFM A;  1X3Q A;  1SNO A;  5C5M A;  2B2V C;  3J81 E;  5IOC A;  3GO5 A;  3MAQ A;  5IT9 E;  3NQT A;  3L9A X;  1QWY A;  2F0V A;  1EYA A;  2BA1 A;  5IGC A;  4ZLT F;  4ULL A;  4HSV A;  3J80 E;  2SNM A;  4O1N A;  3PUZ A;  3OOC A;  2BE5 D;  4ME5 A;  3NSW A;  4XQN A;  4DU9 A;  3I4M B;  2K01 A;  1STY A;  2KA7 A;  3S16 B;  3DHQ A;  4ID6 A;  1W6K A;  1Z47 A;  4F7X A;  2D9U A;  1RHP A;  3NWT A;  5JAV A;  5D3D A;  5BN4 A;  4KMU C;  4G7O C;  2FMC A;  4RGO S;  4MIU A;  1TY0 A;  3H6M A;  2AUJ D;  1L0X B;  1TR5 A;  1T5X D;  5EPL A;  5JPM C;  2B2V A;  4QB4 A;  2EYJ A;  1ZYR C;  1H9R A;  4L8J A;  1CHQ D;  1BCP C;  1E2W A;  3NQI A;  1SE2 A;  5D65 A;  1YNJ D;  2F0O A;  3S1N B;  1VF7 A;  3T13 A;  1KDB A;  5FO9 B;  3SK4 A;  1MD2 D;  4Z9C B;  1S5E D;  1KNE A;  3DMU A;  4C2M B;  4ZQ3 A;  3TME A;  2R3Z A;  2MHV A;  5C4H A;  2D2C C;  1X3P A;  4HED A;  4DNR B;  1PXU A;  1OXV A;  3ZYY X;  1WTP A;  2ZXO A;  3X3N A;  4F88 A;  3X3M A;  3HGB A;  4H13 C;  5T1I A;  1NUC A;  1V43 A;  3K5L A;  2JEA I;  5A2Q E;  2H4O A;  2JSO A;  4G57 A;  3R93 A;  2EPB A;  4C3J B;  1SFO B;  3MXU A;  2PNR C;  4FYD A;  1Q8I A;  3DWQ A;  1TT2 A;  3URY A;  4DK0 A;  3UI2 A;  2K5Q A;  1IHZ A;  1Z7T A;  1G91 A;  3NP8 A;  4IAL A;  1EY0 A;  2X6L A;  1TWC B;  2EJM A;  1KLU D;  1NR4 A;  4KD3 A;  4NMZ A;  1EY6 A;  2SNS A;  1H9K A;  3TBI B;  3QO2 A;  2K04 A;  4K14 A;  5FOB B;  1EZ8 A;  4YIJ A;  3D4W A;  2F0K A;  2Q8T A;  4KJO A;  4LAA A;  2OT2 A;  1SMY C;  3A8I E;  1EU3 A;  1Y8N B;  1JWU D;  4EQN A;  3QWN A;  1SBB B;  2PZT A;  4ODG A;  1O7Z A;  2J7Z A;  1EL0 A;  3SDZ A;  1LV9 A;  4BBR B;  2AQ2 B;  1Q1E A;  3IFD A;  1SNM A;  3H0G B;  3PV0 A;  5CYU A;  3HOY B;  1H9M A;  4AYB B;  3K5M A;  3KK7 A;  2A68 D;  2VXW A;  4RGN A;  2AWN A;  5G3L F;  4FXG C;  4ZKB B;  3I91 A;  3QG1 A;  4QF4 A;  3T51 B;  5IGD A;  1ILP A;  4OHJ A;  3VR6 A;  3TZD A;  1GUW A;  1G29 1;  4DAV A;  2A6H C;  5G3L D;  5IGE A;  4MHE A;  4IFD J;  2O5I C;  4K6L A;  3FRP B;  1A3U A;  2LMC B;  2JXM B;  2PZU A;  1JB3 A;  1CFM A;  5I9P A;  2EY6 A;  2EE1 A;  3NBI A;  4GZY C;  1HA5 A;  5AFW A;  2MUY A;  5C0X G;  2NVQ B;  5EKI A;  4A3G B;  5ELC A;  2TSS A;  2A6E D;  1QNU A;  1GXD C;  1KAA A;  4CJ1 B;  3J7A F;  1O7Y A;  1SEB D;  3M4Y A;  2B39 A;  5EJW A;  2F0N A;  4I7Z C;  3EVQ A;  3HP3 A;  4HR7 B;  1RJT A;  3V96 A;  2JP1 A;  1S4Z A;  2B2T A;  1U4L A;  2PO4 A;  1WD0 A;  1Y8P B;  3VR3 A;  4WFN 3;  1HUN A;  2G9H D;  4ZUI A;  2PZW A;  1I6H B;  1TQO A;  4XYO A;  1F2L A;  4FF2 A;  2O4X A;  3NWS A;  4KHV A;  3CKI B;  1XXG A;  4F8M A;  2JA8 B;  3VYU A;  3S2H B;  4RGM A;  4P2C B;  3OWE B;  2E76 C;  1V1P B;  1WTO A;  5E4W C;  3EQL C;  2EXZ A;  2O2L D;  3AB9 A;  5IGB A;  3LX0 A;  2QKI C;  1VDZ A;  1EWH A;  4RA8 A;  3J80 L;  1OXX K;  2DNC A;  2KCN A;  2F0F A;  4LMQ D;  2B2W A;  1HXY D;  1OXT A;  5CC4 A;  3LWU A;  2NTS A;  3TSS A;  3J7Y W;  1D5Z C;  1QNK A;  1M8A A;  3RZD B;  1UAP A;  2OEO A;  1EOT A;  2ICI A;  2L0C A;  2EYM A;  3OHX C;  3QIA A;  4K2K A;  2HQE A;  3S15 B;  3W3A A;  3I90 A;  2E75 C;  2Q8R E;  3CQZ B;  2CW0 D;  1X32 A;  5JPN C;  1A6X A;  2XNA C;  1F2Z A;  3HG9 A;  1CZW A;  1MI2 A;  2PYK A;  1CHP D;  2L55 A;  3KLS A;  1KAB A;  1PLF A;  2EYO A;  2SOB A;  5K36 H;  1M4V A;  2A74 C;  4E6I A;  1BXT A;  1B50 A;  5KND A;  3SVM A;  5M3M B;  1ILQ A;  4CKC A;  3VR5 A;  4OL7 A;  1JC7 A;  1B3A A;  5C3E B;  3S1R B;  3E5S A;  5A2Q L;  2CQA A;  1PTO H;  2HDM A;  3G6J B;  3TP8 A;  1EU4 A;  4KY5 A;  5EKL A;  1LT5 D;  1B1Z A;  3I4L A;  2AWO A;  4XT1 B;  2NZ1 D;  4CJ2 C;  2IX1 A;  2F0L A;  3D31 A;  5BN5 A;  2RVL A;  4U67 3;  4A3M B;  3RZO B;  5I6W A;  5FK9 C;  4RGT A;  2L4N A;  3SK8 A;  5CGK A;  2Z4I A;  2MP1 A;  2MPM A;  3SXH A;  5KNC A;  1A2U A;  2EJG C;  3OSO A;  1D1I A;  3BVM A;  4N9T A;  2RSO A;  1LTB D;  3BZD B;  2I46 A;  5ELF A;  5ELB A;  4PMW A;  1EEF D;  3NTI A;  1VMP A;  2MGS A;  2KQ3 A;  3BVZ A;  1YNJ C;  5C4X B;  2H1E A;  4ZK9 B;  1JE4 A;  3HOZ B;  1I4H A;  4C3H B;  2FFK B;  3MC0 B;  2VNU D;  1JWM D;  3D4D A;  1F77 A;  2XRS D;  4UDU C;  5KGU A;  1LO5 D;  2OF1 A;  5CV8 A;  1HTL D;  4HTH A;  4TSS A;  1NCV A;  1F9S A;  1S5F D;  3NPP A;  2EYH A;  1KTK A;  4KJN A;  3DWA A;  1TS3 A;  3GTJ B;  2F0U A;  2L5T A;  3OPO A;  3DUZ A;  1UEA B;  5LL6 S;  2N55 A;  3AU7 A;  1C4Q A;  3P75 A;  3ONA B;  3HS0 C;  4CJ0 B;  3TP6 A;  2NWG A;  2K03 A;  3H94 A;  3QOL A;  5EPK A;  1DOK A;  4RCN A;  1F9P A;  3IKJ A;  2IW3 A;  1I4Q A;  3LWE A;  3GV6 A;  3ITP A;  4V19 0;  1SE3 A;  2LKV A;  3MEH A;  4TRD A;  1TWH B;  4C3I B;  3RLF A;  1DOL A;  5C0X I;  1SNQ A;  3BYT B;  2F0H A;  2PCF B;  1Z6H A;  3PUX A;  1STB A;  3BDO A;  1B9N A;  4ZRZ A;  1ENC A;  3PO2 B;  4KN4 C;  4PV1 C;  2WKC A;  4JK1 C;  1CA6 A;  2K5D A;  2XWB B;  2DNE A;  2ENB A;  4RWS C;  5FLX E;  1MSG A;  1LT4 D;  4Q0F A;  2KED A;  1CI3 M;  1PDQ A;  3KBG A;  2E2H B;  1PYW D;  2QEJ C;  4A3E B;  2JA5 B;  3C3L A;  3PUW A;  2BDN A;  5CBE E;  3D6C A;  5HGT A;  3BDC A;  4RH6 A;  1HRJ A;  1K8O A;  2IPK D;  1EWC A;  1CM9 A;  1ET9 A;  2K28 A;  2A68 C;  1ESR A;  3KLS X;  5CV9 A;  3M7N A;  5JEA G;  1F2M A;  1Y8O B;  1CT1 D;  1K8M A;  3S1M B;  3NHH A;  3HOX B;  3A7L A;  3KUP A;  5JJZ A;  3Q0A A;  2R93 B;  5DM6 3;  1LAB A;  1AEX A;  2E2J B;  1YNN C;  2EY5 A;  1JWS D;  3OMG A;  4J1M A;  4A3I B;  4J6H A;  4UAI A;  2VB3 X;  5C3X A;  3GTG B;  1ROD A;  5C0X H;  5EBD A;  1Q1B A;  1I4X A;  3MXG A;  4PMC A;  1DYQ A;  1ZXT A;  3I70 A;  2PMZ B;  2K6A A;  2OXP A;  4G4K A;  3DM1 A;  4HSP A;  4K5W A;  1B53 A;  1LTR D;  3HEJ A;  2KCC A;  1E0B A;  2K32 A;  2ZXP A;  4H0L C;  4U68 A;  3MXN A;  3OIQ A;  5NUC A;  2F3W A;  2A6E C;  2Q8I B;  2CHB D;  1IYU A;  1DJR D;  1HCZ A;  4XQQ A;  3FPU B;  1RKN A;  4CGY B;  4FF3 A;  4KI0 A;  2F0D A;  4HMI A;  2YU9 B;  3GV3 A;  2WII B;  1KDA A;  3TP7 A;  4DK1 A;  3R3O A;  4M8A A;  2F03 A;  1LT6 D;  2K1B A;  4PMB A;  1TS4 A;  4CKB A;  5KYL A;  4V0B A;  3BS1 A;  5KYI A;  1TWF B;  3I3C A;  1E2Z A;  2ICE C;  5E3F A;  3GTK B;  1B9M A;  4OIK A;  1QJO A;  2JA7 B;  4EQP A;  3OIP A;  3R2I A;  2B2U C;  3PUY A;  1ZYR D;  3BG3 A;  1Y1W B;  3ERO A;  5E1F A;  3VR4 A;  2NVX B;  1PFB A;  4RCO A;  1EYD A;  1NSN S;  1VF5 C;  3MFG A;  1EY8 A;  4OO1 G;  1U4P A;  5I2Y A;  1Y69 U;  3C1F A;  3SEB A;  3LNN A;  4K8J A;  4BY7 B;  3S14 B;  1TU2 B;  1AFP A;  1EIH A;  2HUG A;  1D1K A;  4IUQ A;  4A3D B;  3M85 A;  3K5O A;  1RTN A;  2ZXR A;  2E74 C;  1KDC A;  3NBH A;  5M5W B;  4LJZ C;  4H44 C;  2A69 C;  3SE0 A;  4IUV A;  1C48 A;  5D3I B;  4ZKC B;  1GUN A;  1H9J A;  1NR2 A;  1B4O A;  3EJI A;  3C46 A;  4IUT A;  3FKI B;  3NE5 B;  4QUC A;  1KLG D;  1U4R A;  3MTS A;  2CW0 C;  2FMM A;  3K59 A;  3E6Z X;  3D8G A;  1QIL A;  4XQJ A;  1IKM A;  5C6A A;  2WAC A;  4RKL A;  2WAQ B;  1I3Q B;  1D6E C;  3Q23 A;  3D4R A;  1A15 A;  4CHT B;  2IX0 A;  3RUZ A;  1UNS A;  1GUO A;  1SYC A;  4B9W A;  1DM0 B;  4MN3 A;  1LTG D;  1STN A;  4DGZ A;  1FR3 A;  2SEB D;  1SMY D;  1AW7 A;  5LHY 1;  3QB3 A;  1MBY A;  5F2D A;  1O78 A;  2KHS A;  3S9W A;  1GJX A;  1Q12 A;  2F0M A;  3J81 L;  5M5Y B;  5IT9 L;  5CMD A;  3FDT A;  2L11 A;  5J39 A;  4EQO A;  4XDX A;  2EDG A;  1WTV A;  1G8Z D;  2L1B A;  2KOL A;  4IN3 A;  4IFD G;  1D2B A;  4CKE A;  1JCK B;  1QG7 A;  4R8I A;  3GTQ B;  1EY9 A;  3G7L A;  3NK9 A;  1SAP A;  2PQE A;  3DWP A;  1XTC D;  2PW5 A;  3BDL A;  1NAP A;  1SDF A;  3AMU A;  3D3R A;  2IX3 A;  1SNP A;  4O42 A;  2DN8 A;  5J22 A;  2A6H D;  3FEW X;  1HQM C;  3VYT A;  3CRK C;  3S17 B;  1PTO F;  2L9H A;  1DXM A;  5FLX L;  4KK7 A;  1I4R A;  3P20 A;  2EJF C;  5DAU A;  1IKL A;  3W2D A;  4BBS B;  4FVM A;  2NN6 G;  2F0J A;  2Z8L A;  3K0Y A;  4Y7N B;  3IL8 A;  1PTO D;  4IUR A;  2NVT B;  1T5E A;  2VB2 X;  4I65 A;  1QCB D;  1EZ6 A;  3HRZ C;  4PNY A;  1LTT D;  1PTO B;  2RDH A;  1JOK A;  4RKB A;  1XWE A;  4BA2 I;  2RDF A;  3V05 A;  1H9S A;  1Q90 A;  2J4X A;  3PIP 3;  4KKT A;  2QF7 A;  1DCZ A;  1F9Q A;  1JQY D;  1SE4 A;  5KIX A;  2B8F A;  4M1U B;  1MSH A;  1PRT F;  1GUT A;  3DXJ C;  2K05 A;  1W6J A;  1A3V A;  4K5X A;  2M9V A;  1EQV A;  1LTS D;  4S3S A;  4BY1 B;  2NVY B;  1WTR A;  3I72 A;  3S1Q B;  1WVL A;  1IYV A;  1RF2 D;  1WTW A;  4B9X A;  1FNU A;  4BWG B;  4ABN A;  1PRT D;  5ISR A;  1IW7 D;  1DZ1 A;  3A8J E;  2BE5 C;  5CV4 A;  3Q24 A;  4DAY A;  1R4P B;  1PRT B;  4DXF A;  2PPB C;  1V8Q A;  4X3S A;  3IFT A;  3WDN A;  4RHR A;  2G9D A;  1BF4 A;  3GTL B;  2X69 A;  4K8I A;  3L3O C;  3FMC A;  3MVV A;  1RTO A;  1BUV T;  2EOT A;  2D62 A;  4B08 A;  5EKK A;  5M3F B;  4DN4 M;  1R9T B;  3OW7 A;  5IOD A;  4EGV A;  1F2Y A;  5I6Y A;  1LT3 D;  1I50 B;  1JIC A;  2K5W A;  3TP5 A;  3OMC A;  2EZV A;  3KLR A;  3SR1 A;  4ZAI A;  3WOF A;  1D5X C;  3A56 A;  2F0T A;  1I6V C;  5JEA H;  1TS2 A;  3Q22 A;  1EYC A;  2M00 A;  2WV6 D;  2LFN A;  2N88 A;  3NUC A;  3U9S A;  3ERQ A;  4DF7 A;  2WP8 J;  5E4X A;  3O13 A;  2RQX A;  3BVG A;  1EFI D;  5I2X A;  4QUF A;  1GHJ A;  2JYO A;  4OO1 I;  1HFG A;  4IUN A;  1FNW A;  2QIL A;  1BBX C;  1A3T A;  3H91 A;  1CQV A;  3OWF A;  3GD7 A;  2BDO A;  1WTQ A;  1HA6 A;  1R4Q B;  4A93 B;  1SYF A;  1VCI A;  4RFB A;  3VR2 A;  2A5H A;  2R61 A;  1HFN A;  3A8K E;  4OIJ A;  3HOU B;  5CV6 A;  3K7A B;  1TII D;  1GOZ A;  4H7B A;  1K83 B;  2WKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...