2KHSA

Solution structure of snase121:snase(111-143) complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title The native-like interactions between SNase121 and SNase(111-143) fragments induce the recovery of their native-like structures and the ability to degrade DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 26
structure length 121
sequence length 121
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2khsA00
5IGCA 3T16A 4R8NA 3OMCA 5IOCA 4ZQ3A 1SYDA 4E6IA 5IGGA 5CV9A 3OMGA 5IGBA 3T13A 2PQEA 1STHA 2EY6A 2F0SA 2EYLA 4NMZA 2EYMA 1EY7A 4NKLA 1SYGA 5EGTA 5CR3A 4ZUJA 1ENAA 4RKLA 1STYA 1U9RA 3MHBA 4WRDA 2F0EA 2OF1A 3E5SA 4ME5A 4N9PA 4KJOA 2F0OA 2QDBA 3SXHA 2EYJA 3D4WA 4B9XA 1STBA 5KGUA 5IODA 2F0IA 3P1HA 5E1FA 4K8JA 5I9PA 5JAVA 1KDBA 2PZUA 5EKLA 1ENCA 3TP5A 3D6CA 2EYHA 4PMBA 3MZ5A 5JOBA 3TP7A 5I6YA 5KRUA 4IUNA 1KAAA 2EY2A 4HMJA 1KABA 3C1FA 2F0LA 4H7BA 3BDCA 4KJNA 4KY6A 4QMGA 4B9WA 1JORA 5IGFA 2O4XA 2F3WA 4KD4A 4DFAA 4HTHA 4YIJA 5M9OA 4KV6A 2PZTA 4K2LA 4ODGA 3RUZA 1STGA 4DF7A 5I6WA 1STNA 5E3FA 5J22A 5CV4A 5CV5A 2LKVA 1AEXA 1NUCA 4HMIA 4NP5A 5DEHA 3SR1A 5I9OA 2F0NA 3EJIA 4IZ8A 2WACA 3NXWA 1EY9A 3D4DA 3P75A 5C5LA 4DGZA 4F7XA 5F2DA 1EY8A 1EQVA 5HGTA 3MEHA 2OEOA 1F2ZA 5IIFA 3NUCA 2EYOA 3DHQA 3R3OA 1A3UA 2F0GA 4KD3A 1A2TA 2F0VA 2HQEA 4TRDA 5CV7A 3TMEA 5KIXA 2SOBA 5CV8A 3TP6A 5C6AA 2OXPA 1EZ6A 1STAA 5C3WA 3HEJA 3OSOA 4OL7A 3EROA 3QB3A 5C4HA 4RKBA 1II3A 3SK8A 2EY1A 4KY7A 4J6HA 5J1ZA 1TT2A 4IALA 4K2KA 1EZ8A 5NUCA 3D8GA 4WORA 5IGEA 2F0KA 3S9WA 3QOJA 4I65A 1SYCA 4S3SA 2SNMA 5IGDA 2F0FA 2PZWA 3V2TA 5CGKA 2KHSA 2KQ3A 3PMFA 3SHLA 2NUCA 3NP8A 4QF4A 5CC4A 5K5PA 4ZUIA 4K5VA 5KYLA 2F0TA 2F0JA 1NSNS 3HZXA 3MVVA 4K5WA 2SNSA 1A3VA 1JOKA 1SYBA 1F2MA 4KY5A 4QB4A 4PNYA 4N9TA 2F0PA 2F0WA 1KDAA 3EVQA 5DAUA 1SNMA 4EQOA 5C3XA 1SNOA 2EYPA 4K5XA 4EQPA 1TR5A 3NHHA 3H6MA 1JOOA 3BDLA 3SK4A 3ITPA 2F0HA 3OWFA 5CV6A 5HURA 5C4ZA 2F3VA 1A2UA 4K14A 4K8IA 5KEEA 3NK9A 1EYAA 1EY5A 1A3TA 1SYEA 3LX0A 4G57A 2ENBA 3SK5A 3MXPA 2M00A 2F0UA 2F0DA 4J1MA 4KHVA 1SNPA 1JOQA 3QOLA 4ID6A 2EY5A 3NQTA 3TP8A 5KYIA 3VA5A 4K6DA 2EXZA 1SNDA 2F0MA 3U9OA 2EYFA 4DU9A 2RDFA 1EY6A 1EYCA 1SYFA 3C1EA 1SNQA 3DMUA 3SK6A 1EYDA 1IHZA 4NDXA 4EQNA 1TQOA 2PYKA 5ISRA 4LAAA 4F8MA 2RBMA 2RKSA 3ERQA 2PW7A 1SNCA 4KTAA 2F0QA 4MIUA 1EY4A 1KDCA 5J39A 1EY0A 4PMCA 2PW5A 5EKKA 5C5MA 1F2YA 1RKNA 4EVOA
chains in the Genus database with same CATH superfamily
1WOCA 1EQQA 3T16A 1HNWL 4JCVE 2CKZB 1MD2D 3CMAA 5IGGA 5CV9A 3OW2A 3K8AA 5G3LF 2F0SA 2DY8A 5E7NA 2A69C 4XYQA 5I2XA 3GTJH 2UU9L 5LMUL 5BN5A 4DAPA 2B39A 5FO7B 4QIWE 1Q81C 4GN5A 1HUMA 2HDLA 1AZQA 4KN7C 1JC7A 4CDFC 3C1FA 1MSGA 3HOYH 1GHKA 3KLSA 4DR2L 1ILPA 2O4XA 4XTCS 4HTHA 1XPOA 1Q86C 4A3FH 1Y1VG 1DCZA 3MXUA 4C3HB 4EGVA 4O42A 2PI2A 3M4PA 1DXMA 2B8GA 5M5XB 3S1RH 3H94A 4WJ3M 1PH4A 2WACA 1E2ZA 4ZKBB 2HCIA 2K1BA 1SROA 4LWCA 4LF9Q 4OONA 3PO2H 1V1PB 2H1EA 5FOBB 4LFAL 5C6AA 4A4IA 4DUYQ 4DV0Q 4DN4M 1L1OA 2K28A 3PUYA 1I4HA 3OTOQ 1FJGL 2VL6A 4RKBA 3L3OC 3SK8A 4H0LC 3M3YH 2R93B 1D5ZC 1VQKA 4K0KQ 4R4QA 2CW0D 3KF8B 4I65A 4RWSC 3TRZA 1Y1WG 1KL9A 4KKSA 3Q22A 4ULLA 4K5VA 1J6QA 3J80i 4A75A 4Q0FA 3E0EA 3CC4A 1TWHH 4GLXA 5IYDH 3FDTA 2JEBI 4DA2A 1CZWA 4P73A 2ASBA 3NWSA 3E0JA 1MKHA 3PIP3 2AUJD 2PMZE 1TWFB 2B2YA 2ENBA 3OYYA 4CHTB 3G7LA 3A55A 3S2HB 3TBIB 5CORA 5E4XA 2V1CC 3S1NB 2KECA 1C9OA 5A2QE 2TMPA 3BDOA 3NEMA 1NCVA 1SYFA 1K83H 2WV6D 4DR3Q 3G4SA 4P71A 1QVFA 2PNRC 3P20A 4CKBA 4A3BH 4KHPL 4A3DG 4HR7B 4OO1H 1BBUA 2MHVA 4IFDH 3UI2A 3PO3G 3MTSA 5C5MA 3NELA 1E1OA 2NBFA 1PXUA 5ELDA 4ZQ3A 1SYDA 5FJ8H 5IGBA 4LFCQ 3GP7A 2O5JC 1STHA 1QNKA 2EY6A 5EGTA 1EIYB 5C0XH 3MHBA 4YWKA 5HGTA 3K59A 1XJVA 2JA6B 3LGJA 1Q8KA 2F0IA 1C0AA 1XNQL 4OEMB 1Q82C 5EAYA 2QCPX 1O80A 3HRZC 3F2CA 1N32L 3KF6A 3PUVA 1S5BD 1C8CA 3JC66 5M9OA 4IPHA 4JI6Q 3PQIA 4DK3C 4BA2I 2K75A 1NUCA 3OWEB 2Z6KA 3P75A 2JE6I 4Y7NB 4TRDA 2CCZA 4KD3A 2F0VA 1VQHA 4JK1C 2F3IA 2AQ1B 1UAPA 1HH2P 2DY7A 2EQSA 3BZCA 4KI0A 1EFWA 3P7JA 1EEFD 1H9RA 5G3LD 3CP0A 2R61A 1II3A 2WAQB 3I72A 3MA2B 4DPGA 1J5EL 2XRSD 5IGEA 2DNEA 3GTPB 3S9WA 1SYCA 4DR7Q 4JI2Q 2HHHL 1XMQQ 2NUCA 5K5PA 1G6PA 3I4LA 1VQ5A 3FRPB 4JI7L 3W1BA 5GAHC 3DEPA 2N88A 1F2MA 1LTRD 3NTIA 3I73A 1HNWQ 1PTOF 1G8ZD 5M3MH 1IYJB 1KDAA 3K5MA 1SFOH 1IW7C 3T56B 4JBMA 3H6MA 3UE1A 3I4NG 2F3VA 3N6RA 1LTGD 4LJZC 4XT1B 4L5RC 2I5LX 5LMUQ 1SMYC 2UU9Q 1HA6A 3SK5A 1BBXC 1PVOA 2EDGA 3KLSX 4A3JB 1K3BC 3AFPA 4K6DA 4KMUC 5LHY1 4DR2Q 1H9KA 1YNJC 3HOWG 1G291 5LL6S 2K5NA 4B08A 3H91A 5C3EH 1TQOA 3K5NA 4GNXC 5KNCA 1OXTA 4HCSA 1HHVA 1ICWA 1X6OA 2R7ZH 3VR5A 4BBSB 1EQTA 2KCNA 2VZAA 2GN5A 4RCNA 4RKLA 4MHEA 3E5SA 4LFAQ 4N9PA 3LWEA 4C1NI 5KGUA 1UEBA 4R4CA 5M5WB 1FJGQ 4WFN3 5JPMC 2IPKD 4CKCA 3TS0A 1YJNA 4BBRB 5CYUA 3RLNA 2O2LD 2PZTA 3OPOA 3J81i 4BY7B 1STGA 2MUYA 3BVMA 2KEEA 3HKZG 1TS3A 4V0BA 4NP5A 4ZAIA 1DOLA 1I4QA 3M7GA 1SE3A 5KNDA 1PYBA 3FKIG 5ELNA 4I7ZC 5JEAG 1PFBA 5EQ0A 1TS2A 4XT3B 4XQNA 2GVAA 1B70B 1AZPA 3JAMc 2YYZA 4JG2A 5CV8A 4LF4L 3QWNA 4DR1L 3QJYA 1Q90A 5M3FB 3AYHB 1KHIA 1I4PA 3IAYA 3BU2A 4TSSA 1IBML 3EIVA 5CGKA 2PQAB 2E2IH 3TZUA 2Q8RE 3W3AA 1EU4A 2F0TA 1QVGA 4KHPQ 1CT1D 2JA8G 1IYVA 3CQZH 3LWUA 1CKNA 1RIPA 3I3CA 3S2DB 1ESRA 4BXXH 4PNYA 1VQCA 1Y1WH 1SNOA 3KLRA 4G7ZC 2RCNA 2JA5B 4DXGA 4A3KH 1HZCA 4JV5L 1G6ZA 2HCCA 4PZ7A 1BOSA 5CBAE 5C44G 1XNQQ 2E75C 1TWGH 1HZAA 1E22A 4O2DA 3S14H 1X54A 2Q2UA 1N32Q 3PF4A 1IBKL 1X65A 3GTLB 1PRTC 1VF5C 1SR3A 1BCPC 1ET9A 4IQZA 2F4VQ 3GTOH 1PYSB 3RZDH 4A93B 2PW7A 2XN9C 3CW2C 1EWIA 1V1QA 1HFNA 1KNEA 3CCJA 3DEOA 1YI2A 4LUOA 1CQFA 4QL5A 2BA1A 3STBD 1HCZA 3LNNA 1FNUA 1ZEQX 2ZXRA 1HR0W 1Y69U 1M1KC 1GUTA 2JYOA 1KTKA 4A3DH 4DV4L 1CK1A 4OWTB 2F0OA 2G9DA 3HOXB 4YWMA 5JAVA 1PTOD 1VDZA 2MJ8A 4GOPB 2M2LA 1LTLA 4PV1C 2FINB 1FYCA 4H7BA 1J5EQ 1X32A 5EJWA 2KENA 4AYBB 3PV0A 1BR9A 2YTXA 1HUNA 3GTJB 2E2JH 1CUKA 2HHHQ 1JT8A 4KHZA 4ALPA 2CFMA 4BS9A 5I6WA 1STNA 4UAIA 1PH7A 5IYBG 4U673 1I4GA 5CV4A 2LKVA 4O0AA 1FL0A 1QUQA 4ME3A 2FMMA 5I9OA 4IUTA 5EBDA 2VW9A 3CXCA 1PHJA 2EVBA 4A3FB 3J7AF 3S16B 3HOVH 1AFPA 2JXMB 1D8LA 1SBBB 3BVGA 2B2WA 2KCCA 1PH6A 4DUZL 2A8VA 3S1RB 3QB3A 1WCMG 2WKCA 3MXNB 1U4MA 1WTWA 1PZKD 2I5MX 4KY7A 4MNOA 1B3AA 5NUCA 4A3IH 3PO2B 4HCEA 4S3SA 4DAVA 1TWAH 4IN3A 2H4OA 3SHLA 4PQXA 2CW0C 3HZXA 3M3YB 5IP7G 1K0SA 1MJCA 5LL6X 1V1OA 4Z9CB 4NXML 1W6KA 1YNNC 1HA5A 1B9MA 2F0PA 2EYPA 1JWUD 3D4RA 5A35A 1IYUA 3ITPA 4RAUC 1PDQA 2FFKB 4G4KA 1HNZL 5HGQA 3T51B 1KD1C 3GTMB 2M00A 1A0IA 4HAEA 1K8OA 1QCBD 4DK6C 3U9OA 4JBJA 3NTHA 1D6EC 1UE1A 3ULJA 3H3VC 1HNXL 2YV5A 4EQNA 4MIUA 3BJUA 2ZJRA 2CWPA 1L1OB 4P75A 4GN4B 4C56C 3J7ZC 3S1MB 1K83B 3DM1A 3HOWH 5C4XG 3EN2A 1IKLA 4NKLA 3Q0AA 3U4ZA 1ENAA 4M8AA 1AE2A 4LF4Q 4YWLA 4DR1Q 4X64L 5JVG3 1L0YB 2CVRA 1PFMA 3D6CA 2EYHA 2K4KA 4OO1I 4YHHL 4IFDI 4CKEA 4HMJA 4L63B 4B9WA 4QY7A 3NSWA 2Q2IA 4KD4A 4JI5L 2E74C 1IBMQ 4LF7L 4ZK9B 5C0XI 1VQPA 3VYUA 5EBCA 3RD4A 3X3MA 4JI0L 1H9MA 2XIWA 4OIKA 3EJIA 4MTKA 4B3TL 1CHPD 2B63H 2RSOA 1IKMA 1CQVA 5T1IA 4CDDC 1A2TA 4JV5Q 2Y0SE 3VYSA 3F8TA 3ER0A 2KVMA 3L9AX 3FKIH 3VR2A 1NTGA 4OX9L 4J6HA 4YY3L 1EIHA 1IBKQ 3GDEA 2K32A 3QOJA 3K5LA 1VQAA 2AUKA 1K8MA 5KYLA 1NSNS 2HDMA 3FPUB 1OO9B 3KJPA 1SLJA 1LTTD 2K50A 1X3QA 1FGUA 4DR4L 4FP5D 3BYTB 4N8X1 4DNIA 5C3XA 2E2HH 3SGIA 2VB2X 5M5YH 1K73C 1W3SA 1YVCA 4HIKA 1TR5A 1EU3A 3KF6B 4DV4Q 2JA8H 4FF4A 1VQDA 4GKKL 4CDEC 1AE3A 1DOKA 2RF4A 3PIPA 3NK9A 1TVXA 1WI5A 1SFOB 4ZKCB 3CF5A 4ID6A 3L0OA 4BY1H 1GVPA 4XYOA 4LFBL 3I4MH 1E1TA 3Q23A 5C44H 2VXWA 1FNWA 1HZ9A 2JEAI 3DLLA 1QOHA 2F0QA 1Y8OB 1KDCA 1SXTA 2L12A 1TS5A 4JPBW 2J0TD 4ZYSA 2L55A 4RMFA 4IPDA 1ASZA 1JB7A 4DUZQ 2R7ZB 1ENFA 1M8AA 3L2PA 2VUMB 3TP5A 3S24A 1KLGD 4JI4L 1HRJA 5KRUA 1JCKB 1HZBA 2UXDL 4CGYB 4KJNA 1T5EA 3DUZA 2DUDA 2F3WA 4DFAA 3G6JB 2XNAC 1CKMA 3KDFA 4NXNL 4FF1A 2KCTA 2OTJA 4TKOB 4G7HC 4NXMQ 4HMIA 3SR1A 4DAMA 1KRTA 5FLXE 2B29A 2EIFA 4A3EG 1YHBA 4FYDA 3A74A 2NVYH 2K03A 3H0GB 4LUZA 1JB3A 3C3LA 1HNZQ 2OQKA 4FDBA 2D9UA 4OL7A 2E5LL 1B50A 3ULLA 3PUZA 3CPWA 4XXEA 4BWGB 1HNXQ 4QQBX 3PMFA 1WCMH 2NZOA 2NZHA 1M90C 3AU7A 2Y0SB 2VB3X 1Y8PB 3ND8A 2ZJQA 1JJGA 2A6HD 3KLWA 2C5CA 3WOFA 1LACA 1B8AA 2MQHA 3GD7A 3J7YW 4C3HG 1L0XB 4K14A 4LF8L 4X64Q 3GTQB 2WB1B 2IY5B 4IURA 3OIPA 2F0UA 4A3MB 4YHHQ 1ZYRD 2Q8IB 5KYIA 2A68D 4A3KB 1SNDA 4DAYA 5TSSA 1EWCA 2AMCB 4JI5Q 1O7ZA 2EJGC 3SK6A 4FO2A 1X56A 4GN3B 4X66L 1E2VA 4LF7Q 1FGBD 1I6HH 1CZGA 1XX8A 2K05A 1B4OA 4JI0Q 1QG7A 1EQRA 1YZ6A 3HOZB 3G48A 2M9VA 2PW5A 4DV2L 1F2YA 2R93G 1TY2A 2E2DC 4B3TQ 3VR4A 4A3LG 2Z1CA 1Z6HA 4APVA 1DONA 4M1UB 1PFSA 3STBC 1KIXA 5CC4A 4B9XA 3J80E 4ZLTF 3P1HA 4DV1L 2K5HA 1KDBA 1EUJA 1B7YB 5C4XH 4PMBA 4HSPA 3HOUB 4OX9Q 1LO5D 1CKNB 2CHBD 4YY3Q 2SDFA 1PTOC 1I50H 1CHQD 1O7IA 5IE8A 1WTQA 1F9RA 3K80C 5E3FA 2Z4HA 3A7LA 3RZOH 1N34L 2JJQA 3HKZE 4ZRZA 1I94L 1JWSD 4DR4Q 3RN2A 4C2MH 2E2JB 2DJFC 3GQBA 2KHJA 2IWHA 1NR2A 1EFID 4J15A 1F2ZA 1D2BA 3A56A 3CCUA 4RHRA 1VS0A 4GKKQ 4Y52H 2DGYA 5KIXA 2Q2HA 4UDUC 2OXPA 3MC0B 1DYQA 5D65A 5C4HA 1YJWA 3NE5B 3HOVB 2AWOA 1WJJA 3JAML 1OXVA 4BA1I 3D8GA 2MO0A 1Y14B 4WORA 4LFBQ 2PZWA 2UUAL 3ULPA 2LXKA 2UXCL 1LTAD 2JA6G 3ICEA 4FXGC 3MVVA 4QIWB 3KBXA 2FMCA 1B44D 3PUWA 1RHPA 2LFNA 4I7AA 4A3IB 3S1QB 1QILA 2A74C 3N52A 1W2BA 4FXKC 1TWAB 2VS1A 4A3CG 1SNMA 3IL8A 4IFDJ 1WD1A 1NAPA 2N55A 1PH8A 1XYIA 5CV6A 4X62L 1Q46A 1SE4A 1Z47A 1HQRD 2QF7A 2J4XA 1EY5A 1A3TA 1PTOB 5C0XJ 4KHVA 2G5DA 3GTKB 2UXDQ 3QOLA 3SEBA 1D5MC 2EZVA 1QUQB 2K6AA 1ML0D 2PPBC 1F2LA 1EY6A 1HR0L 1LT3D 1KAWA 1IHZA 1I6VC 4C3IB 2HUGA 1TWCH 3S15B 4NXNQ 3CMEA 2B8FA 5L37A 5EPLA 2OCEA 1U4RA 3PIO3 1VQ8A 2WAQG 3FVQA 2ICIA 1RKNA 5IWAL 4DNTB 4E6IA 1N33L 3OMGA 4L5TA 2NVQH 2XWBB 3TS2A 2EYMA 1BUVT 2KHIA 1Q3LA 1STYA 2FHTA 2OF1A 4ME5A 3SXHA 4A3GH 2SEBD 2EYJA 1JQYD 3DWQA 3T1HL 1LM0A 2E5LQ 1LT4D 4U68A 2JA7B 1SAPA 2H5XA 4YCUA 1PA6A 4IUNA 1KAAA 3UDGA 2F0LA 2NVXH 2NTSA 3DWPA 4R9WA 1E0BA 2PMZB 3VYTA 2K01A 2B2VC 1S5CD 3EA6A 3Q8DA 4XIGS 5HY6A 1MI2A 2JP1A 2HD3A 3FP9A 4OWWB 2KJXA 5J22A 2R92B 4R4OA 2ZXOA 4C3JH 2B2UA 3T4AC 5JJZA 4A3JG 3D4DA 4R4TA 4LNQA 1HXYD 1PH1A 3M9BA 3TREA 3R3OA 3OW7A 1SE2A 2I5HA 2QDLA 1STAA 4LF8Q 2L0CA 2HIVA 2B63B 1UE7A 3Q24A 3MFYA 2C35B 2A6EC 5A2QL 1GUOA 1DOMA 4BBSG 4JBKA 5GAEC 4GZYC 2TSSA 1QE6A 2IW3A 2XTIA 2A5HA 4MN3A 4NW2A 4X66Q 1D7QA 3H09A 1CA6A 1MHWC 3AFQA 1B2TA 1MIUA 3CD6A 1WTHA 2NZ1D 1XPUA 2D2CC 1NY4A 1Y1VH 2YTVA 4WJ4A 4DV2Q 1H9SA 1CA5A 3VDYA 1A63A 1UNSA 5GAGC 4BBRG 2DNCA 3NHHA 1X55A 3J81E 1R4PB 4HJ8A 4BY7G 1R9TB 2BDNA 2D5DA 4NB3A 2A69D 2WKDA 4DV1Q 2RQXA 1EYAA 4GOPC 1SYEA 3R2IA 3MXPA 2E2HB 5C4JB 5ELOA 1VCIA 3KOJA 4DU9A 5FLXc 1LT6D 3W2DA 3PSIA 4C3HH 1X3PA 2I46A 1GUWA 4RGNA 3M85A 1VMPA 4L8JA 4BY1B 5LMNW 1N34Q 5M3FG 1G51A 3I4MB 1I94Q 1C4QA 3FEWX 4EVOA 1WTXA 2MNAA 4B3RL 1AN8A 2PQEA 3VR6A 1AW7A 2L4NA 1YEZA 4ZUJA 1U9RA 5I9PA 3RN5A 4JI3L 1BVSA 5IT9c 4IOAA 4KJOA 2A1AA 2B2TC 4JI8L 1STBA 1MBYA 2ALYB 2R93H 2BCOA 5BN4A 1EWHA 4A3LH 2NN6G 1I3QB 4OGQC 3AQQA 2QEXA 2LMCB 4OHJA 1CSPA 2JA5G 2ES2A 3QO2A 4KV6A 2UUAQ 4A76A 1XMOL 3IFDA 4V190 1PH5A 3EQLC 1VQ9A 3KFUA 5GQOA 3M7NA 3CHBD 1GUGA 3PO3H 3L7ZC 3MEHA 4DR6L 1TY0A 4A93G 3RLFA 4X62Q 2SOBA 5KNBA 4HJAA 3DM3A 5K36G 1G2TA 4O1NA 1Y8NB 3S2HH 3OSOA 3TZDA 1VQBA 2A19A 3I7FA 4DV7L 1HR0Q 4JI7Q 4MTNA 3HOYB 2F52A 2EPBA 2KQ3A 3PGZA 4QF4A 3HOXG 2XWJB 2NVTH 4EX5A 1EOVA 1LUZA 1L1OC 4LF6L 3J80c 1HTLD 1SYBA 3GO5A 3PF5A 5BR8L 4N9TA 5IWAQ 5DAUA 2QILA 1M4VA 1N33Q 1ESFA 4AYBG 3M4YA 3URYA 2JA6H 2EJFC 1PLFA 3OWFA 5H1SE 3CCSA 4K8IA 4OIJA 3KDFB 3T1HQ 2K5WA 1LV9A 3E3XA 1EIFA 4GLVB 3K81C 1HPCA 4KK7A 2EY5A 3D31A 2X6LA 4A3FG 1RF2D 3VR3A 3IKJA 1GOZA 3CCVA 4YCVA 2QEJC 5ELEA 1LABA 1ILQA 3FMCA 5E4WC 4IOCA 2NWGA 3CCEA 2L1BA 2B2YC 3H15A 1BXTA 5IY0A 4Y7NH 2RCFA 1TWHB 3PO2G 1L0WA 2HT1A 4XQQA 4Q5VA 2EYLA 2QDBA 1QNUA 2CQAA 2R3ZA 2I0QA 1BCPF 3I4NH 2MGSA 1I5FA 3GTPH 1WVLA 3AB9A 2L5TA 3S17H 1S5FD 4KY6A 1WTVA 1BQQT 4JW0A 5IYDG 4X3KA 3TN2A 1AH9A 1LTBD 4QJFA 1KRSA 1I50B 4A3BB 4UPAA 2EXDA 4QGUA 1IW7D 4DAYB 2EYOA 1QZGA 1P8LA 3MXGA 4JBWA 2BE5D 1GKHA 3NENA 3J7A5 1PFNA 5ELBA 2P5ZX 4AIMA 1SMYD 2A73B 1LTSD 2IT1A 3EFXD 2N8NA 4IPCA 1TT2A 4IALA 4JOIA 5DNFA 2Z6KC 3HKSA 2VY3A 1YNJD 2YU9H 1TS4A 3C46A 4P74A 2DN8A 4YCWA 5FJ8G 4BBSH 1VQJA 4JC0A 4RGOS 3T1YL 2KBNA 2OT2A 2WINB 4B3RQ 2L9HA 1H95A 1T5XD 1CM9A 4GNXA 1VQLA 5M5WH 1T9HA 4JI3Q 3HGBA 1VQIA 5JEAH 2HIXA 3A8JE 4JI8Q 4G57A 1BO0A 4GKJL 1BDOA 4J1MA 4CJ2C 4X3SA 4OXPA 4BBRH 4X6AH 3TP8A 3PUXA 2K5VA 1A8VA 2GA4B 2KOLA 3BG3A 4DK1A 5FLMG 2PYKA 3I90A 4LAAA 1LYLA 1U4PA 4F8MA 1XMOQ 1QZHA 4R1JA 3UDIA 1V8QA 1NMFA 3A54A 1F9PA 4DR5L 1EYGA 3F1ZA 2IJ0A 4F87A 1TWCB 2LY7A 3R2TA 3H3VI 3A0JA 1VQ6A 1PH2A 3IRBA 5M3MB 4DR6Q 3ZJYC 4POFA 1X3EA 2RDHA 4KKUA 3B6YA 5M3FH 2I07B 2FXQA 1XPRA 3NBIA 3U9SA 3RR5A 2F03A 1KABA 3I2ZA 3BYYB 4DV7Q 4A3GB 3A8IE 2K33A 3IFTA 1LTID 1VQGA 1STEA 3I55A 3TEHB 1B1ZA 3RUZA 3K6OA 2D62A 2CH4W 4JI1L 3J81c 5DM73 3E6ZX 5C3EB 1RODA 2NVXB 4RGMA 4LF6Q 2JA5H 1BBWA 2UXBL 5BR8Q 1K3RA 5F2DA 3JAMi 4P72A 5IP9G 2F0GA 2CH4A 3QIAA 2ZT9C 5C3WA 3HEJA 4C3JB 2ZTDA 1RCVD 4H02A 4RH6A 4FNFA 4IUVA 2IX3A 5COYA 2OWOA 3RMHA 4A93H 4JYAL 3W1GA 5K36H 1D1KA 1BCPD 4B3SL 4UP9A 2R7ZG 3SDZA 2VUMG 3I56A 1DGSA 1UE6A 2SNSA 4HJ9A 1E24A 4HEDA 4PG3A 2K52A 1PH9A 5IYBH 4LF5L 3HOXH 1QWYA 3C2PA 1IL8A 1Y1VB 4PZ8A 5HURA 1A2UA 2D0PA 1JWMD 3HS0C 3CRLC 1EOTA 5IT9E 2F0DA 2AQ2B 4RFBA 1UUPA 1G91A 1RTNA 1VQ7A 1D5XC 3H0GG 2MP1A 3DMUA 1SNQA 3D3RA 3Q6SA 4NDXA 2K04A 2XGTA 2RKSA 5I4DA 4GS3A 3MAQA 1CTMA 2E2IB 2KEDA 1LLRD 2K14A 3S16H 4DV6L 5IP7H 3CQZB 3PIOA 2Z8LA 1GUSA 5AJ3L 5IOCA 2WAQE 1IZ6A 1NE3A 2N78A 1Y1WB 4K6LA 2BA0A 3V96A 2EE1A 2RSNA 3GV6A 2Y0SG 4CBVA 1P16A 1K8AC 1GJXA 5I6YA 4QCLA 1L2FA 3CCMA 4X65L 3AMUA 1YHAA 1H9SB 1K0RA 1TWGB 2KUMA 4QMGA 1N8RC 1QJOA 2ZJPA 1ZXTA 3S14B 1NR4A 1ET6A 4BXXG 5ELFA 1Q8IA 1CKOA 2WB1G 3GTOB 3RZDB 3UDFA 1XTCD 5DEHA 4A3MG 3T1YQ 1YNND 4IZ8A 4OWXB 1F9QA 3NXWA 4A3KG 3BZDB 4UHVA 3R8BA 1JE4A 1I4RA 1QVCA 4L6TB 5CV7A 1S72A 2BH8A 4IJLA 1NMGA 1G2SA 2EJMA 2IL8A 3GTMH 4HN7A 1J9OA 2X6GA 1EZ6A 4A3DB 5FK9C 3EROA 1NJIC 4GKJQ 3HOZG 4RA8A 4DXFA 3PO3B 2EOTA 1UEAB 4PMWA 1SE8A 1VF7A 1X9NA 1F77A 1YNXA 4UY8C 4H13C 1HQMC 5IGDA 3I70A 2F0FA 2ICEC 1VMCA 2KHSA 2B2WC 3NP8A 1TIID 3R93A 3S1MH 2GVBA 1UE5A 2C9OA 5EPKA 4N8FA 4RG1A 3HOUG 4LK1C 3NBHA 4KY5A 4DR5Q 3K58A 1YJ9A 3PCOB 3K0YA 3M4OH 2NVTB 2XSCA 1MSHA 5CBEE 3BDLA 3E9HA 3KK7A 2F0HA 1R4QB 3MWYW 3CKIB 3LX0A 4G7OC 3WOEA 1VQNA 5LMNL 1QB5D 2JQOA 2VQFL 2EXZA 1UWVA 3UE0A 1RDPD 1D1IA 4JI1Q 4B3ML 5FLXL 3G71A 2F4VL 3HOVG 1O7LA 2UXBQ 4R8NA 5FLMH 3X3NA 1WTOA 1OXUA 3GV3A 4JI4Q 1BKBA 5IYCG 2AQ3B 2BH2A 1H9JA 3H3VH 4KKTA 4A3IG 5JOBA 3TP7A 3K57A 1JJ2A 1S5ED 3WDNA 2EY2A 5IT9L 3DXJC 3K7AH 2E8GA 5EKIA 2ID0A 4JYAQ 4YIJA 4XQJA 1ASYA 2UUCL 1FD7D 4B3SQ 4P2CB 3I4NB 4ABNA 1PH3A 4NPSA 1V43A 4H44C 1IBLL 2VNUD 2LS01 3VYRA 5CV5A 3S17B 2B3GA 4FVMA 1GXDC 4PZ6A 1OXXK 1EY9A 4F7XA 5C5LA 4LF5Q 4TVAB 3GTGH 1SRUA 2OEOA 1KQSA 3TQYA 3HOWB 3RLOA 3U4VA 3DHQA 4QUCA 4C3IG 2D0OA 4LW1A 4JOIC 2HQLA 1GM5A 1FR3A 2BE5C 3KUPA 1KNAA 1SMXA 2EY1A 2RVLA 2IHEA 2LSSA 1ZKOA 3SE0A 3ZYYX 2RA4A 4K2KA 5IP9H 5DLQE 4L5QA 4R4IA 1XNRL 5JJKA 1PMRA 1XXGA 2ZXPA 2F0JA 4K5WA 4XDXA 2JA7G 4DV6Q 1B3QA 1JOKA 1ONLA 2Q2TA 1TXYA 2RHQB 2L11A 5AJ3Q 1WTPA 2YU9B 3EVQA 1YHQA 2QGQA 4A3EH 4EQPA 3CAMA 2VUMH 5FO8B 3J80L 4AYBE 1S3OA 5C4ZA 1SSOA 4HIMA 3HG9A 2R92G 2PCFB 1C48A 1IXRA 3I4OA 3HKZB 1VQFA 3U58A 3ONAB 2WP8J 1GO3E 3O13A 5GROA 1OTCA 3NWTA 1HJPA 5J3BA 4X65Q 1MGSA 2Z9HA 3VA5A 3FKIB 2QW7A 1Z9FA 2RDFA 2OTLA 3J7AV 1V1PA 3BS1A 1U5KA 2UUBL 3ERQA 4AQYL 4KTAA 2BDOA 1XWEA 3HP3A 1EY4A 1JMCA 2B63G 1EY0A 4PMCA 5JJIA 1N36L 3H0GH 1U4LA 5IGCA 2R7FA 3KF8A 3OMCA 4RHSA 1E2WA 2ZTEA 3T13A 1IL2A 5DM63 1B9NA 1K9MC 5M5YB 5E1FA 4RCOA 2JA8B 2QKIC 3TSSA 3OHXC 3MZ5A 3SVMA 1O7YA 1TU2B 5M5XH 3BDCA 5IGFA 1SEBD 3A5ZB 4GNXB 5D3DA 5FO9B 1W6JA 5C44B 2F0NA 1EIGA 3U50C 2PI2E 1EQVA 3NUCA 5IIFA 3GTQH 4DV3L 3CU7A 3TP6A 1PZID 4A3MH 1KLUD 4BY1G 4KN4C 2NN6I 3I4MG 5LMNQ 2VQFQ 4DKAC 2O5IC 2UXCQ 2E76C 1K28A 1X3GA 5GADC 2Z4IA 2G9HD 1JICA 3CC7A 1VQOA 5ELCA 4R8IA 3HOZH 2DJGC 1ICFB 4ZUIA 1BNZA 3KYHC 4B3MQ 1TWFH 2ZM6L 4J8QA 2BOSA 2JK8A 1KC8C 1MJEA 4MZ9A 2ZTCA 1Z7TA 4WJWA 3F2DA 4KLKA 4QUFA 4DV5L 4LUVA 2NVYB 4LMQD 3S1NH 2KCMA 5AFWA 3HOUH 1LT5D 1X3FA 2RHSB 2N3SA 4IO9A 2L15A 1DM0B 4OELB 3G6EA 2UUCQ 3A5UA 5ISRA 2RBMA 2JSOA 2NTTA 4HJ5A 1SNCA 1IBLQ 3MEFA 5I2YA 1WCMB 5J39A 2A6HC 5EKKA 3TMEA 1Q1EA 4X3UA 4NMZA 3A8KE 1CI3M 5CR3A 3HOYG 4A3CH 1BF4A 2WIIB 1Q7YC 4K8JA 5EKLA 1DZ1A 2V4DA 4UP7A 4POGA 1ZYRC 3A7AB 2N49A 1O78A 1SDFA 2A68C 3QR8A 1A6XA 5IYCH 3UDXA 1JORA 1GD7A 1I4XA 1PRTB 1VQEA 1BCPB 2Z0SA 5FKAC 1XNRQ 4C1NK 3NQIA 3S1QH 1WFQA 3AEVA 1I6HB 1JR0D 1EEID 2R7DA 1AEXA 1VQ4A 2VQEL 4FXDA 1WTRA 4DGZA 3K0XA 2K5DA 1EY8A 3VA7A 1PRTF 3J81L 4X3TA 4EQ5A 3FHWA 1A3UA 1PTOH 2HQEA 2IHFA 3CRKC 3F2BA 1E7ZA 2MPMA 1JJCB 1GHJA 3GTKH 2FJ2A 1XTDA 3NPPA 5J1ZA 5C4XB 4C3IH 3CCLA 3CC2A 2F0KA 3S15H 2SNMA 3NTKA 1C7YA 1A15A 1SJED 4F88A 2UUBQ 1N9WA 5EPJA 4AQYQ 5T1GA 1B53A 1N36Q 2R6GA 3CPFA 3RZOB 2F0WA 2XRQD 4EQOA 3K5OA 2NYZD 4K5XA 3K7UC 3M4QA 4LF9L 4C2MB 1JOOA 1YBYA 2YTYA 4A3JH 3SK4A 5JPNC 1PV4A 2AHOB 2JA7H 3E9IA 5KEEA 4DUYL 4DV0L 1EL0A 2Q8TA 3I91A 3OTOL 3KBGA 3F2UA 1VQMA 4A3BG 1SNPA 1SN8A 1U0LA 1JOQA 3M4OB 4OO1G 4IFDG 4HSVA 3CCQA 1RJTA 1E3PA 2QA4A 4DNRB 2RDGA 2F0MA 2EYFA 1F9SA 4K0KL 2NB0A 3D0FA 4GLAC 3C1EA 2R92H 3KJOA 1PYWD 4ZCKA 3OIQA 5C0XG 4CJ0B 2XVSA 1JE5A 2LXJA 4RGTA 2AKWB 1FVIA 3RNUA 2PQAA 4IUUA 1EY7A 2B2VA 1SYGA 4IUPA 4HIDA 4IPGA 4WRDA 2F0EA 4DV3Q 1S40A 3D4WA 5IODA 2X69A 2PZUA 1ENCA 1CSQA 3D6WA 4BY7H 2F4IA 1YITA 2JA9A 2MO1A 2A6ED 5JJLA 4IJHA 1CFMA 3NBHB 1RL2A 1DJRD 5BN3A 2IX1A 1NNXA 1Q1BA 4DR3L 2MFIA 4K2LA 4ODGA 2ATWA 4DF7A 1YIJA 3EBEA 3HFZB 3K7AB 4CDCC 4DK0A 2ZM6Q 4AH6A 1V9PA 2WB1E 1RTOA 4HIOA 2AWNA 4LFCL 1R9TH 1TKWB 4DV5Q 1HFGA 5JVH3 1WYDA 3DWAA 2NVQB 1OXSC 5C4JH 3ND9A 1A62A 3MFGA 3CCRA 3TDQA 3GTGB 1SJHD 5JEAJ 1EZ8A 1S5DD 2B2UC 3ERSX 3S2DH 2NN6H 3FPPA 2PO4A 4FF2A 3V2TA 5M3MG 3J81j 2JN4A 4JI6L 3WWVA 1J8IA 4GOPA 3BVZA 1WD0A 1A3VA 4TQUS 1S4ZA 4L5SA 2CQOA 4QB4A 3T53B 4A3GG 5CMDA 2PNHA 3QG1A 1FNVA 2IX0A 1GUNA 1RD9D 4UP8A 4FF3A 2K5QA 3GTLH 3OOCA 2CWAA 1Q12A 2OQ0A 5C3EG 1I3QH 2Z6BA 3BZKA 1PRTD 1PZJD 2K7VA 3V05A 4A3EB 3NQTA 2J7ZA 2WFWA 3W5OA 3JAME 4CJ1B 1EYCA 5D14A 4ILWA 1EYDA 4DR7L 1AP0A 4JI2L 2F1MA 2B2TA 1KXLA 1XMQL 5D3IB 1K8GA 1NBWA 4C3JG 4HJ7A 3MXNA 1HTPA 3I8ZA 1DD2A 2KA7A 2VQEQ 4JVZA 4IUQA
chains in the Genus database with same CATH topology
3T16A 1MD2D 5IGGA 5CV9A 5G3LF 2F0SA 2DY8A 2A69C 4XYQA 5I2XA 5BN5A 4DAPA 2B39A 5FO7B 1AZQA 1HUMA 2HDLA 4KN7C 1JC7A 3C1FA 1MSGA 1GHKA 3KLSA 1ILPA 2O4XA 4XTCS 4HTHA 1DCZA 3MXUA 4C3HB 4EGVA 4O42A 1DXMA 2B8GA 5M5XB 3H94A 2WACA 1E2ZA 4ZKBB 2HCIA 2K1BA 1V1PB 2H1EA 5FOBB 5C6AA 4DN4M 2K28A 3PUYA 1I4HA 4RKBA 3L3OC 3SK8A 4H0LC 2R93B 1D5ZC 2CW0D 4I65A 4RWSC 4KKSA 3Q22A 4ULLA 4K5VA 4Q0FA 3FDTA 2JEBI 4DA2A 1CZWA 3NWSA 3E0JA 3PIP3 2AUJD 1TWFB 2B2YA 2ENBA 4CHTB 3G7LA 3A55A 3S2HB 3TBIB 5CORA 5E4XA 3S1NB 2KECA 5A2QE 2TMPA 3BDOA 1SYFA 1NCVA 2WV6D 2PNRC 3P20A 4CKBA 4HR7B 4OO1H 4IFDH 2MHVA 3UI2A 3MTSA 5C5MA 2NBFA 1PXUA 5ELDA 4ZQ3A 1SYDA 5IGBA 3GP7A 2O5JC 1STHA 1QNKA 2EY6A 5EGTA 5C0XH 3MHBA 5HGTA 3K59A 2JA6B 2F0IA 2QCPX 1O80A 3HRZC 3PUVA 1S5BD 1C8CA 5M9OA 4BA2I 1NUCA 3OWEB 3P75A 2JE6I 4Y7NB 4TRDA 4KD3A 2F0VA 4JK1C 2AQ1B 1UAPA 2DY7A 4KI0A 3P7JA 1EEFD 1H9RA 5G3LD 2R61A 1II3A 2WAQB 3I72A 3MA2B 2XRSD 5IGEA 2DNEA 3GTPB 3S9WA 1SYCA 2NUCA 5K5PA 3I4LA 3FRPB 3DEPA 2N88A 1F2MA 1LTRD 3NTIA 3I73A 1PTOF 1G8ZD 3K5MA 1KDAA 1IW7C 3T56B 3H6MA 2F3VA 3N6RA 1LTGD 4LJZC 4XT1B 1SMYC 1HA6A 3SK5A 1BBXC 2EDGA 3KLSX 4A3JB 4KMUC 4K6DA 5LHY1 1H9KA 1YNJC 1G291 5LL6S 4B08A 3H91A 1TQOA 3K5NA 5KNCA 1OXTA 4HCSA 1HHVA 1ICWA 3VR5A 4BBSB 1EQTA 2KCNA 4RCNA 4RKLA 4MHEA 3E5SA 4N9PA 3LWEA 4C1NI 5KGUA 5M5WB 4WFN3 5JPMC 2IPKD 4CKCA 4BBRB 5CYUA 2O2LD 2PZTA 3OPOA 4BY7B 1STGA 2MUYA 3BVMA 2KEEA 1TS3A 4V0BA 4NP5A 4ZAIA 1DOLA 1I4QA 3M7GA 1SE3A 5KNDA 4I7ZC 5JEAG 1PFBA 5EQ0A 1TS2A 4XT3B 4XQNA 1AZPA 2YYZA 5CV8A 3QWNA 3QJYA 1Q90A 5M3FB 1I4PA 3IAYA 4TSSA 5CGKA 3TZUA 2Q8RE 3W3AA 1EU4A 2F0TA 1CT1D 1IYVA 3LWUA 3I3CA 3S2DB 1ESRA 4PNYA 1SNOA 3KLRA 4G7ZC 2JA5B 4DXGA 1G6ZA 2HCCA 1BOSA 5CBAE 2E75C 3GTLB 1PRTC 1VF5C 1BCPC 1ET9A 4IQZA 4A93B 2PW7A 2XN9C 1HFNA 1KNEA 3DEOA 1CQFA 2BA1A 1HCZA 3LNNA 1FNUA 1ZEQX 2ZXRA 1Y69U 1GUTA 2JYOA 1KTKA 1CK1A 2F0OA 2G9DA 3HOXB 5JAVA 1PTOD 1VDZA 2MJ8A 2M2LA 4PV1C 2FINB 1FYCA 4H7BA 1X32A 5EJWA 4AYBB 3PV0A 1BR9A 1HUNA 3GTJB 4KHZA 4BS9A 5I6WA 1STNA 4UAIA 4U673 1I4GA 5CV4A 2LKVA 5I9OA 2FMMA 4IUTA 5EBDA 2EVBA 4A3FB 3J7AF 3S16B 1AFPA 2JXMB 3BVGA 1SBBB 2B2WA 2KCCA 3S1RB 3QB3A 2WKCA 1U4MA 1WTWA 1PZKD 4KY7A 1B3AA 5NUCA 3PO2B 4HCEA 4S3SA 4DAVA 4IN3A 2H4OA 3SHLA 4PQXA 2CW0C 3HZXA 3M3YB 5LL6X 1V1OA 4Z9CB 1W6KA 1YNNC 1HA5A 1B9MA 2F0PA 2EYPA 1JWUD 3D4RA 5A35A 1IYUA 3ITPA 4RAUC 1PDQA 2FFKB 4G4KA 3T51B 3GTMB 2M00A 4HAEA 1K8OA 1QCBD 3U9OA 3NTHA 1D6EC 3H3VC 4EQNA 4MIUA 4C56C 3S1MB 1K83B 3DM1A 1IKLA 4NKLA 3Q0AA 1ENAA 4M8AA 5JVG3 1L0YB 2CVRA 1PFMA 3D6CA 2EYHA 4OO1I 4IFDI 4CKEA 4HMJA 4L63B 4B9WA 3NSWA 4KD4A 2E74C 4ZK9B 5C0XI 3VYUA 5EBCA 3RD4A 3X3MA 1H9MA 2XIWA 4OIKA 3EJIA 1CHPD 2RSOA 1IKMA 1CQVA 5T1IA 1A2TA 3VYSA 2KVMA 3L9AX 3VR2A 4J6HA 1EIHA 2K32A 3QOJA 3K5LA 2AUKA 1K8MA 5KYLA 1NSNS 2HDMA 3FPUB 1OO9B 1LTTD 1X3QA 4FP5D 3BYTB 5C3XA 2VB2X 1TR5A 1EU3A 4FF4A 1DOKA 3NK9A 1TVXA 1SFOB 4ZKCB 4ID6A 4XYOA 3Q23A 2VXWA 1FNWA 2JEAI 1QOHA 2F0QA 1Y8OB 1KDCA 1SXTA 2L12A 1TS5A 2J0TD 4ZYSA 2L55A 2R7ZB 1ENFA 1M8AA 2VUMB 3TP5A 1KLGD 1HRJA 5KRUA 1JCKB 4CGYB 4KJNA 1T5EA 3DUZA 2F3WA 4DFAA 3G6JB 2XNAC 4FF1A 4TKOB 4G7HC 4HMIA 3SR1A 5FLXE 4FYDA 2K03A 3H0GB 1JB3A 3C3LA 2D9UA 4OL7A 1B50A 3PUZA 4XXEA 4BWGB 3PMFA 3AU7A 2Y0SB 2VB3X 1Y8PB 3ND8A 2A6HD 2C5CA 3WOFA 1LACA 3GD7A 3J7YW 4C3HG 1L0XB 4K14A 3GTQB 2WB1B 4IURA 3OIPA 2F0UA 4A3MB 1ZYRD 2Q8IB 5KYIA 2A68D 4A3KB 1SNDA 4DAYA 5TSSA 1EWCA 1O7ZA 2EJGC 3SK6A 4FO2A 1E2VA 1FGBD 1CZGA 1XX8A 2K05A 1B4OA 1QG7A 3HOZB 2M9VA 2PW5A 1F2YA 1TY2A 2E2DC 3VR4A 2Z1CA 1Z6HA 1DONA 4M1UB 5CC4A 4B9XA 3J80E 4ZLTF 3P1HA 1KDBA 4PMBA 4HSPA 3HOUB 1LO5D 2CHBD 2SDFA 1PTOC 1CHQD 1WTQA 1F9RA 5E3FA 2Z4HA 3A7LA 4ZRZA 1JWSD 2E2JB 3GQBA 2IWHA 1NR2A 1EFID 1F2ZA 1D2BA 3A56A 4RHRA 5KIXA 4UDUC 2OXPA 3MC0B 1DYQA 5D65A 5C4HA 3NE5B 3HOVB 2AWOA 3JAML 1OXVA 4BA1I 3D8GA 4WORA 2PZWA 1LTAD 4FXGC 3MVVA 4QIWB 3KBXA 2FMCA 1B44D 3PUWA 1RHPA 2LFNA 4A3IB 3S1QB 1QILA 2A74C 3N52A 4FXKC 1TWAB 1SNMA 3IL8A 4IFDJ 1WD1A 1NAPA 2N55A 1XYIA 5CV6A 1SE4A 1Z47A 1HQRD 2QF7A 2J4XA 1EY5A 1A3TA 1PTOB 5C0XJ 4KHVA 3GTKB 3QOLA 3SEBA 1D5MC 2EZVA 2K6AA 1ML0D 2PPBC 1F2LA 1EY6A 1LT3D 1IHZA 1I6VC 4C3IB 2HUGA 3S15B 2B8FA 5EPLA 1U4RA 3PIO3 3FVQA 2ICIA 1RKNA 4DNTB 4E6IA 3OMGA 2XWBB 2EYMA 1BUVT 1Q3LA 1STYA 2FHTA 2OF1A 4ME5A 3SXHA 2SEBD 2EYJA 1JQYD 3DWQA 1LT4D 4U68A 2JA7B 1SAPA 4IUNA 1KAAA 2F0LA 2NTSA 3DWPA 4R9WA 1E0BA 2PMZB 3VYTA 2K01A 2B2VC 1S5CD 3EA6A 4XIGS 1MI2A 2JP1A 2R92B 2KJXA 5J22A 2ZXOA 2B2UA 3T4AC 5JJZA 3D4DA 1HXYD 3R3OA 3OW7A 1SE2A 1STAA 2L0CA 2B63B 3Q24A 3MFYA 2A6EC 5A2QL 1GUOA 1DOMA 4GZYC 2TSSA 1QE6A 2IW3A 2A5HA 4MN3A 4NW2A 3H09A 1CA6A 1B2TA 2NZ1D 2D2CC 1H9SA 1CA5A 1UNSA 2DNCA 3NHHA 3J81E 1R4PB 1R9TB 2BDNA 2D5DA 2A69D 2WKDA 2RQXA 1EYAA 1SYEA 3R2IA 3MXPA 2E2HB 5C4JB 1VCIA 4DU9A 1LT6D 3W2DA 1X3PA 2I46A 1GUWA 4RGNA 3M85A 1VMPA 4L8JA 4BY1B 3I4MB 1C4QA 4EVOA 3FEWX 1WTXA 1AN8A 2PQEA 3VR6A 1AW7A 2L4NA 4ZUJA 1U9RA 5I9PA 4KJOA 2B2TC 1STBA 1MBYA 2BCOA 5BN4A 1EWHA 2NN6G 1I3QB 4OGQC 2LMCB 4OHJA 3QO2A 4KV6A 3IFDA 4V190 3EQLC 3M7NA 3CHBD 1GUGA 3L7ZC 3MEHA 1TY0A 3RLFA 2SOBA 5KNBA 5K36G 1G2TA 4O1NA 1Y8NB 3OSOA 3TZDA 3HOYB 2KQ3A 2EPBA 4QF4A 2XWJB 1HTLD 1SYBA 3GO5A 4N9TA 5DAUA 2QILA 1M4VA 1ESFA 3M4YA 3URYA 2EJFC 1PLFA 3OWFA 4K8IA 4OIJA 2K5WA 1LV9A 1HPCA 4KK7A 2EY5A 3D31A 2X6LA 1RF2D 3VR3A 3IKJA 1GOZA 2QEJC 5ELEA 1LABA 1ILQA 3FMCA 5E4WC 2NWGA 2L1BA 2B2YC 1BXTA 1TWHB 4XQQA 4Q5VA 2EYLA 2QDBA 1QNUA 2CQAA 2R3ZA 1BCPF 2MGSA 1WVLA 3AB9A 2L5TA 1S5FD 4KY6A 1WTVA 1BQQT 4X3KA 3TN2A 1LTBD 1I50B 4A3BB 1IW7D 2EYOA 4JBWA 3MXGA 2BE5D 1PFNA 5ELBA 1SMYD 2A73B 1LTSD 2IT1A 3EFXD 1TT2A 4IALA 5DNFA 1YNJD 1TS4A 3C46A 2DN8A 4RGOS 2OT2A 2WINB 2L9HA 1T5XD 1CM9A 3HGBA 5JEAH 3A8JE 4G57A 1BO0A 1BDOA 4J1MA 4CJ2C 4X3SA 3TP8A 3PUXA 3BG3A 2GA4B 4DK1A 2KOLA 2PYKA 3I90A 4LAAA 1U4PA 4F8MA 1V8QA 3A54A 1F9PA 2IJ0A 4F87A 1TWCB 2LY7A 3R2TA 5M3MB 2RDHA 4KKUA 2I07B 3NBIA 3U9SA 2F03A 1KABA 3BYYB 4A3GB 3A8IE 2K33A 3IFTA 1LTID 1STEA 1B1ZA 3RUZA 3K6OA 2D62A 5C3EB 5DM73 3E6ZX 1RODA 2NVXB 4RGMA 5F2DA 2F0GA 3QIAA 2ZT9C 5C3WA 3HEJA 4C3JB 1RCVD 4RH6A 4FNFA 4IUVA 2IX3A 5COYA 3RMHA 5K36H 1D1KA 1BCPD 3SDZA 2SNSA 4HEDA 1QWYA 3C2PA 1IL8A 1Y1VB 5HURA 1A2UA 1JWMD 3HS0C 3CRLC 1EOTA 5IT9E 2F0DA 2AQ2B 4RFBA 1UUPA 1G91A 1RTNA 1D5XC 2MP1A 3DMUA 1SNQA 3D3RA 3Q6SA 4NDXA 2K04A 2RKSA 5I4DA 3MAQA 1CTMA 2E2IB 2KEDA 1LLRD 3CQZB 2Z8LA 1GUSA 5IOCA 1Y1WB 4K6LA 2BA0A 3V96A 2EE1A 2RSNA 3GV6A 4CBVA 1GJXA 5I6YA 4QCLA 3AMUA 1H9SB 1TWGB 2KUMA 4QMGA 1QJOA 1ZXTA 3S14B 1NR4A 1ET6A 5ELFA 1Q8IA 3GTOB 3RZDB 1XTCD 5DEHA 1YNND 4IZ8A 1F9QA 3NXWA 3BZDB 3R8BA 1JE4A 1I4RA 4L6TB 5CV7A 1G2SA 2EJMA 2IL8A 4HN7A 1J9OA 2X6GA 1EZ6A 4A3DB 5FK9C 3EROA 4RA8A 4DXFA 3PO3B 2EOTA 1UEAB 4PMWA 1VF7A 1F77A 4H13C 1HQMC 5IGDA 3I70A 2F0FA 2ICEC 1VMCA 2KHSA 2B2WC 3NP8A 1TIID 3R93A 2C9OA 5EPKA 4LK1C 3NBHA 4KY5A 3K58A 3K0YA 2NVTB 2XSCA 5CBEE 1MSHA 3BDLA 3KK7A 2F0HA 1R4QB 3MWYW 3CKIB 3LX0A 4G7OC 3WOEA 1QB5D 2EXZA 1RDPD 1D1IA 5FLXL 1O7LA 4R8NA 3X3NA 1WTOA 1OXUA 3GV3A 2AQ3B 1H9JA 4KKTA 5JOBA 3TP7A 3K57A 1S5ED 3WDNA 2EY2A 5IT9L 3DXJC 5EKIA 2ID0A 4YIJA 4XQJA 1FD7D 4P2CB 3I4NB 4ABNA 1V43A 4H44C 2VNUD 2LS01 3VYRA 5CV5A 3S17B 4FVMA 1GXDC 1OXXK 1EY9A 4F7XA 5C5LA 2OEOA 3HOWB 3DHQA 4QUCA 4C3IG 1FR3A 2BE5C 3KUPA 1KNAA 2EY1A 2RVLA 1ZKOA 3SE0A 3ZYYX 2RA4A 4K2KA 1PMRA 1XXGA 2ZXPA 2F0JA 4K5WA 4XDXA 1JOKA 1ONLA 2L11A 1WTPA 2YU9B 3EVQA 4EQPA 5FO8B 3J80L 5C4ZA 1SSOA 3HG9A 2PCFB 1C48A 3HKZB 3ONAB 2WP8J 3O13A 3NWTA 1MGSA 3VA5A 3FKIB 2RDFA 3J7AV 1V1PA 3BS1A 3ERQA 4KTAA 2BDOA 1XWEA 3HP3A 1EY4A 1EY0A 4PMCA 1U4LA 5IGCA 3KF8A 3OMCA 4RHSA 1E2WA 3T13A 5DM63 1B9NA 5M5YB 5E1FA 4RCOA 2JA8B 2QKIC 3TSSA 3OHXC 3MZ5A 3SVMA 1O7YA 1TU2B 3BDCA 5IGFA 1SEBD 5D3DA 5FO9B 1W6JA 5C44B 2F0NA 1EIGA 1EQVA 3NUCA 5IIFA 3CU7A 3TP6A 1PZID 1KLUD 4KN4C 2NN6I 2O5IC 2E76C 2Z4IA 2G9HD 1JICA 5ELCA 4R8IA 4ZUIA 1BNZA 4J8QA 2BOSA 1Z7TA 4WJWA 4QUFA 2NVYB 4LMQD 5AFWA 1LT5D 1DM0B 5ISRA 2RBMA 2JSOA 2NTTA 1SNCA 5I2YA 1WCMB 5J39A 2A6HC 5EKKA 3TMEA 1Q1EA 4X3UA 4NMZA 3A8KE 1CI3M 5CR3A 1BF4A 2WIIB 4K8JA 5EKLA 1DZ1A 2V4DA 1ZYRC 3A7AB 1O78A 1SDFA 2A68C 1A6XA 1JORA 1I4XA 1PRTB 1BCPB 5FKAC 4C1NK 3NQIA 1I6HB 1JR0D 1EEID 1AEXA 4FXDA 1WTRA 4DGZA 2K5DA 1EY8A 3VA7A 1PRTF 3J81L 4X3TA 1A3UA 1PTOH 2HQEA 3CRKC 2MPMA 1GHJA 2FJ2A 3NPPA 5J1ZA 5C4XB 2F0KA 2SNMA 3NTKA 1A15A 1SJED 4F88A 5EPJA 5T1GA 1B53A 2R6GA 3RZOB 2F0WA 2XRQD 4EQOA 3K5OA 2NYZD 4K5XA 4C2MB 1JOOA 3SK4A 5JPNC 5KEEA 1EL0A 2Q8TA 3I91A 3KBGA 3F2UA 1SNPA 1JOQA 3M4OB 4OO1G 4IFDG 4HSVA 1RJTA 4DNRB 2F0MA 2RDGA 2EYFA 1F9SA 2NB0A 3C1EA 1PYWD 3OIQA 5C0XG 4CJ0B 2XVSA 4RGTA 4IUUA 1EY7A 2B2VA 1SYGA 4IUPA 4WRDA 2F0EA 3D4WA 5IODA 2X69A 2PZUA 1ENCA 3D6WA 2F4IA 2A6ED 1CFMA 1DJRD 5BN3A 2IX1A 1Q1BA 4K2LA 4ODGA 4DF7A 4DK0A 3K7AB 1RTOA 2AWNA 1TKWB 1HFGA 5JVH3 3DWAA 2NVQB 1OXSC 3ND9A 3MFGA 3TDQA 3GTGB 1SJHD 5JEAJ 1EZ8A 1S5DD 2B2UC 2NN6H 3FPPA 2PO4A 4FF2A 3V2TA 1J8IA 3BVZA 1WD0A 1A3VA 4TQUS 1S4ZA 4QB4A 3T53B 5CMDA 3QG1A 1FNVA 2IX0A 1GUNA 1RD9D 4FF3A 2K5QA 3OOCA 1Q12A 1PRTD 1PZJD 2K7VA 3V05A 4A3EB 3NQTA 2J7ZA 3JAME 4CJ1B 1EYCA 5D14A 4ILWA 1EYDA 1AP0A 2F1MA 2B2TA 5D3IB 4C3JG 3MXNA 1HTPA 3I8ZA 1DD2A 2KA7A 4IUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  3T16 A;  4R8N A;  3OMC A;  5IOC A;  4ZQ3 A;  1SYD A;  4E6I A;  5IGG A;  5CV9 A;  3OMG A;  5IGB A;  3T13 A;  2PQE A;  1STH A;  2EY6 A;  2F0S A;  2EYL A;  4NMZ A;  2EYM A;  1EY7 A;  4NKL A;  1SYG A;  5EGT A;  5CR3 A;  4ZUJ A;  1ENA A;  4RKL A;  1STY A;  1U9R A;  3MHB A;  4WRD A;  2F0E A;  2OF1 A;  3E5S A;  4ME5 A;  4N9P A;  4KJO A;  2F0O A;  2QDB A;  3SXH A;  2EYJ A;  3D4W A;  4B9X A;  1STB A;  5KGU A;  5IOD A;  2F0I A;  3P1H A;  5E1F A;  4K8J A;  5I9P A;  5JAV A;  1KDB A;  2PZU A;  5EKL A;  1ENC A;  3TP5 A;  3D6C A;  2EYH A;  4PMB A;  3MZ5 A;  5JOB A;  3TP7 A;  5I6Y A;  5KRU A;  4IUN A;  1KAA A;  2EY2 A;  4HMJ A;  1KAB A;  3C1F A;  2F0L A;  4H7B A;  3BDC A;  4KJN A;  4KY6 A;  4QMG A;  4B9W A;  1JOR A;  5IGF A;  2O4X A;  2F3W A;  4KD4 A;  4DFA A;  4HTH A;  4YIJ A;  5M9O A;  4KV6 A;  2PZT A;  4K2L A;  4ODG A;  3RUZ A;  1STG A;  4DF7 A;  5I6W A;  1STN A;  5E3F A;  5J22 A;  5CV4 A;  5CV5 A;  2LKV A;  1AEX A;  1NUC A;  4HMI A;  4NP5 A;  5DEH A;  3SR1 A;  5I9O A;  2F0N A;  3EJI A;  4IZ8 A;  2WAC A;  3NXW A;  1EY9 A;  3D4D A;  3P75 A;  5C5L A;  4DGZ A;  4F7X A;  5F2D A;  1EY8 A;  1EQV A;  5HGT A;  3MEH A;  2OEO A;  1F2Z A;  5IIF A;  3NUC A;  2EYO A;  3DHQ A;  3R3O A;  1A3U A;  2F0G A;  4KD3 A;  1A2T A;  2F0V A;  2HQE A;  4TRD A;  5CV7 A;  3TME A;  5KIX A;  2SOB A;  5CV8 A;  3TP6 A;  5C6A A;  2OXP A;  1EZ6 A;  1STA A;  5C3W A;  3HEJ A;  3OSO A;  4OL7 A;  3ERO A;  3QB3 A;  5C4H A;  4RKB A;  1II3 A;  3SK8 A;  2EY1 A;  4KY7 A;  4J6H A;  5J1Z A;  1TT2 A;  4IAL A;  4K2K A;  1EZ8 A;  5NUC A;  3D8G A;  4WOR A;  5IGE A;  2F0K A;  3S9W A;  3QOJ A;  4I65 A;  1SYC A;  4S3S A;  2SNM A;  5IGD A;  2F0F A;  2PZW A;  3V2T A;  5CGK A;  2KHS A;  2KQ3 A;  3PMF A;  3SHL A;  2NUC A;  3NP8 A;  4QF4 A;  5CC4 A;  5K5P A;  4ZUI A;  4K5V A;  5KYL A;  2F0T A;  2F0J A;  1NSN S;  3HZX A;  3MVV A;  4K5W A;  2SNS A;  1A3V A;  1JOK A;  1SYB A;  1F2M A;  4KY5 A;  4QB4 A;  4PNY A;  4N9T A;  2F0P A;  2F0W A;  1KDA A;  3EVQ A;  5DAU A;  1SNM A;  4EQO A;  5C3X A;  1SNO A;  2EYP A;  4K5X A;  4EQP A;  1TR5 A;  3NHH A;  3H6M A;  1JOO A;  3BDL A;  3SK4 A;  3ITP A;  2F0H A;  3OWF A;  5CV6 A;  5HUR A;  5C4Z A;  2F3V A;  1A2U A;  4K14 A;  4K8I A;  5KEE A;  3NK9 A;  1EYA A;  1EY5 A;  1A3T A;  1SYE A;  3LX0 A;  4G57 A;  2ENB A;  3SK5 A;  3MXP A;  2M00 A;  2F0U A;  2F0D A;  4J1M A;  4KHV A;  1SNP A;  1JOQ A;  3QOL A;  4ID6 A;  2EY5 A;  3NQT A;  3TP8 A;  5KYI A;  3VA5 A;  4K6D A;  2EXZ A;  1SND A;  2F0M A;  3U9O A;  2EYF A;  4DU9 A;  2RDF A;  1EY6 A;  1EYC A;  1SYF A;  3C1E A;  1SNQ A;  3DMU A;  3SK6 A;  1EYD A;  1IHZ A;  4NDX A;  4EQN A;  1TQO A;  2PYK A;  5ISR A;  4LAA A;  4F8M A;  2RBM A;  2RKS A;  3ERQ A;  2PW7 A;  1SNC A;  4KTA A;  2F0Q A;  4MIU A;  1EY4 A;  1KDC A;  5J39 A;  1EY0 A;  4PMC A;  2PW5 A;  5EKK A;  5C5M A;  1F2Y A;  1RKN A;  4EVO A; 
#chains in the Genus database with same CATH topology
 1WOC A;  1EQQ A;  3T16 A;  1HNW L;  4JCV E;  2CKZ B;  1MD2 D;  3CMA A;  5IGG A;  5CV9 A;  3OW2 A;  3K8A A;  5G3L F;  2F0S A;  2DY8 A;  5E7N A;  2A69 C;  4XYQ A;  5I2X A;  3GTJ H;  2UU9 L;  5LMU L;  5BN5 A;  4DAP A;  2B39 A;  5FO7 B;  4QIW E;  1Q81 C;  4GN5 A;  1HUM A;  2HDL A;  1AZQ A;  4KN7 C;  1JC7 A;  4CDF C;  3C1F A;  1MSG A;  3HOY H;  1GHK A;  3KLS A;  4DR2 L;  1ILP A;  2O4X A;  4XTC S;  4HTH A;  1XPO A;  1Q86 C;  4A3F H;  1Y1V G;  1DCZ A;  3MXU A;  4C3H B;  4EGV A;  4O42 A;  2PI2 A;  3M4P A;  1DXM A;  2B8G A;  5M5X B;  3S1R H;  3H94 A;  4WJ3 M;  1PH4 A;  2WAC A;  1E2Z A;  4ZKB B;  2HCI A;  2K1B A;  1SRO A;  4LWC A;  4LF9 Q;  4OON A;  3PO2 H;  1V1P B;  2H1E A;  5FOB B;  4LFA L;  5C6A A;  4A4I A;  4DUY Q;  4DV0 Q;  4DN4 M;  1L1O A;  2K28 A;  3PUY A;  1I4H A;  3OTO Q;  1FJG L;  2VL6 A;  4RKB A;  3L3O C;  3SK8 A;  4H0L C;  3M3Y H;  2R93 B;  1D5Z C;  1VQK A;  4K0K Q;  4R4Q A;  2CW0 D;  3KF8 B;  4I65 A;  4RWS C;  3TRZ A;  1Y1W G;  1KL9 A;  4KKS A;  3Q22 A;  4ULL A;  4K5V A;  1J6Q A;  3J80 i;  4A75 A;  4Q0F A;  3E0E A;  3CC4 A;  1TWH H;  4GLX A;  5IYD H;  3FDT A;  2JEB I;  4DA2 A;  1CZW A;  4P73 A;  2ASB A;  3NWS A;  3E0J A;  1MKH A;  3PIP 3;  2AUJ D;  2PMZ E;  1TWF B;  2B2Y A;  2ENB A;  3OYY A;  4CHT B;  3G7L A;  3A55 A;  3S2H B;  3TBI B;  5COR A;  5E4X A;  2V1C C;  3S1N B;  2KEC A;  1C9O A;  5A2Q E;  2TMP A;  3BDO A;  3NEM A;  1NCV A;  1SYF A;  1K83 H;  2WV6 D;  4DR3 Q;  3G4S A;  4P71 A;  1QVF A;  2PNR C;  3P20 A;  4CKB A;  4A3B H;  4KHP L;  4A3D G;  4HR7 B;  4OO1 H;  1BBU A;  2MHV A;  4IFD H;  3UI2 A;  3PO3 G;  3MTS A;  5C5M A;  3NEL A;  1E1O A;  2NBF A;  1PXU A;  5ELD A;  4ZQ3 A;  1SYD A;  5FJ8 H;  5IGB A;  4LFC Q;  3GP7 A;  2O5J C;  1STH A;  1QNK A;  2EY6 A;  5EGT A;  1EIY B;  5C0X H;  3MHB A;  4YWK A;  5HGT A;  3K59 A;  1XJV A;  2JA6 B;  3LGJ A;  1Q8K A;  2F0I A;  1C0A A;  1XNQ L;  4OEM B;  1Q82 C;  5EAY A;  2QCP X;  1O80 A;  3HRZ C;  3F2C A;  1N32 L;  3KF6 A;  3PUV A;  1S5B D;  1C8C A;  3JC6 6;  5M9O A;  4IPH A;  4JI6 Q;  3PQI A;  4DK3 C;  4BA2 I;  2K75 A;  1NUC A;  3OWE B;  2Z6K A;  3P75 A;  2JE6 I;  4Y7N B;  4TRD A;  2CCZ A;  4KD3 A;  2F0V A;  1VQH A;  4JK1 C;  2F3I A;  2AQ1 B;  1UAP A;  1HH2 P;  2DY7 A;  2EQS A;  3BZC A;  4KI0 A;  1EFW A;  3P7J A;  1EEF D;  1H9R A;  5G3L D;  3CP0 A;  2R61 A;  1II3 A;  2WAQ B;  3I72 A;  3MA2 B;  4DPG A;  1J5E L;  2XRS D;  5IGE A;  2DNE A;  3GTP B;  3S9W A;  1SYC A;  4DR7 Q;  4JI2 Q;  2HHH L;  1XMQ Q;  2NUC A;  5K5P A;  1G6P A;  3I4L A;  1VQ5 A;  3FRP B;  4JI7 L;  3W1B A;  5GAH C;  3DEP A;  2N88 A;  1F2M A;  1LTR D;  3NTI A;  3I73 A;  1HNW Q;  1PTO F;  1G8Z D;  5M3M H;  1IYJ B;  1KDA A;  3K5M A;  1SFO H;  1IW7 C;  3T56 B;  4JBM A;  3H6M A;  3UE1 A;  3I4N G;  2F3V A;  3N6R A;  1LTG D;  4LJZ C;  4XT1 B;  4L5R C;  2I5L X;  5LMU Q;  1SMY C;  2UU9 Q;  1HA6 A;  3SK5 A;  1BBX C;  1PVO A;  2EDG A;  3KLS X;  4A3J B;  1K3B C;  3AFP A;  4K6D A;  4KMU C;  5LHY 1;  4DR2 Q;  1H9K A;  1YNJ C;  3HOW G;  1G29 1;  5LL6 S;  2K5N A;  4B08 A;  3H91 A;  5C3E H;  1TQO A;  3K5N A;  4GNX C;  5KNC A;  1OXT A;  4HCS A;  1HHV A;  1ICW A;  1X6O A;  2R7Z H;  3VR5 A;  4BBS B;  1EQT A;  2KCN A;  2VZA A;  2GN5 A;  4RCN A;  4RKL A;  4MHE A;  3E5S A;  4LFA Q;  4N9P A;  3LWE A;  4C1N I;  5KGU A;  1UEB A;  4R4C A;  5M5W B;  1FJG Q;  4WFN 3;  5JPM C;  2IPK D;  4CKC A;  3TS0 A;  1YJN A;  4BBR B;  5CYU A;  3RLN A;  2O2L D;  2PZT A;  3OPO A;  3J81 i;  4BY7 B;  1STG A;  2MUY A;  3BVM A;  2KEE A;  3HKZ G;  1TS3 A;  4V0B A;  4NP5 A;  4ZAI A;  1DOL A;  1I4Q A;  3M7G A;  1SE3 A;  5KND A;  1PYB A;  3FKI G;  5ELN A;  4I7Z C;  5JEA G;  1PFB A;  5EQ0 A;  1TS2 A;  4XT3 B;  4XQN A;  2GVA A;  1B70 B;  1AZP A;  3JAM c;  2YYZ A;  4JG2 A;  5CV8 A;  4LF4 L;  3QWN A;  4DR1 L;  3QJY A;  1Q90 A;  5M3F B;  3AYH B;  1KHI A;  1I4P A;  3IAY A;  3BU2 A;  4TSS A;  1IBM L;  3EIV A;  5CGK A;  2PQA B;  2E2I H;  3TZU A;  2Q8R E;  3W3A A;  1EU4 A;  2F0T A;  1QVG A;  4KHP Q;  1CT1 D;  2JA8 G;  1IYV A;  3CQZ H;  3LWU A;  1CKN A;  1RIP A;  3I3C A;  3S2D B;  1ESR A;  4BXX H;  4PNY A;  1VQC A;  1Y1W H;  1SNO A;  3KLR A;  4G7Z C;  2RCN A;  2JA5 B;  4DXG A;  4A3K H;  1HZC A;  4JV5 L;  1G6Z A;  2HCC A;  4PZ7 A;  1BOS A;  5CBA E;  5C44 G;  1XNQ Q;  2E75 C;  1TWG H;  1HZA A;  1E22 A;  4O2D A;  3S14 H;  1X54 A;  2Q2U A;  1N32 Q;  3PF4 A;  1IBK L;  1X65 A;  3GTL B;  1PRT C;  1VF5 C;  1SR3 A;  1BCP C;  1ET9 A;  4IQZ A;  2F4V Q;  3GTO H;  1PYS B;  3RZD H;  4A93 B;  2PW7 A;  2XN9 C;  3CW2 C;  1EWI A;  1V1Q A;  1HFN A;  1KNE A;  3CCJ A;  3DEO A;  1YI2 A;  4LUO A;  1CQF A;  4QL5 A;  2BA1 A;  3STB D;  1HCZ A;  3LNN A;  1FNU A;  1ZEQ X;  2ZXR A;  1HR0 W;  1Y69 U;  1M1K C;  1GUT A;  2JYO A;  1KTK A;  4A3D H;  4DV4 L;  1CK1 A;  4OWT B;  2F0O A;  2G9D A;  3HOX B;  4YWM A;  5JAV A;  1PTO D;  1VDZ A;  2MJ8 A;  4GOP B;  2M2L A;  1LTL A;  4PV1 C;  2FIN B;  1FYC A;  4H7B A;  1J5E Q;  1X32 A;  5EJW A;  2KEN A;  4AYB B;  3PV0 A;  1BR9 A;  2YTX A;  1HUN A;  3GTJ B;  2E2J H;  1CUK A;  2HHH Q;  1JT8 A;  4KHZ A;  4ALP A;  2CFM A;  4BS9 A;  5I6W A;  1STN A;  4UAI A;  1PH7 A;  5IYB G;  4U67 3;  1I4G A;  5CV4 A;  2LKV A;  4O0A A;  1FL0 A;  1QUQ A;  4ME3 A;  2FMM A;  5I9O A;  4IUT A;  5EBD A;  2VW9 A;  3CXC A;  1PHJ A;  2EVB A;  4A3F B;  3J7A F;  3S16 B;  3HOV H;  1AFP A;  2JXM B;  1D8L A;  1SBB B;  3BVG A;  2B2W A;  2KCC A;  1PH6 A;  4DUZ L;  2A8V A;  3S1R B;  3QB3 A;  1WCM G;  2WKC A;  3MXN B;  1U4M A;  1WTW A;  1PZK D;  2I5M X;  4KY7 A;  4MNO A;  1B3A A;  5NUC A;  4A3I H;  3PO2 B;  4HCE A;  4S3S A;  4DAV A;  1TWA H;  4IN3 A;  2H4O A;  3SHL A;  4PQX A;  2CW0 C;  3HZX A;  3M3Y B;  5IP7 G;  1K0S A;  1MJC A;  5LL6 X;  1V1O A;  4Z9C B;  4NXM L;  1W6K A;  1YNN C;  1HA5 A;  1B9M A;  2F0P A;  2EYP A;  1JWU D;  3D4R A;  5A35 A;  1IYU A;  3ITP A;  4RAU C;  1PDQ A;  2FFK B;  4G4K A;  1HNZ L;  5HGQ A;  3T51 B;  1KD1 C;  3GTM B;  2M00 A;  1A0I A;  4HAE A;  1K8O A;  1QCB D;  4DK6 C;  3U9O A;  4JBJ A;  3NTH A;  1D6E C;  1UE1 A;  3ULJ A;  3H3V C;  1HNX L;  2YV5 A;  4EQN A;  4MIU A;  3BJU A;  2ZJR A;  2CWP A;  1L1O B;  4P75 A;  4GN4 B;  4C56 C;  3J7Z C;  3S1M B;  1K83 B;  3DM1 A;  3HOW H;  5C4X G;  3EN2 A;  1IKL A;  4NKL A;  3Q0A A;  3U4Z A;  1ENA A;  4M8A A;  1AE2 A;  4LF4 Q;  4YWL A;  4DR1 Q;  4X64 L;  5JVG 3;  1L0Y B;  2CVR A;  1PFM A;  3D6C A;  2EYH A;  2K4K A;  4OO1 I;  4YHH L;  4IFD I;  4CKE A;  4HMJ A;  4L63 B;  4B9W A;  4QY7 A;  3NSW A;  2Q2I A;  4KD4 A;  4JI5 L;  2E74 C;  1IBM Q;  4LF7 L;  4ZK9 B;  5C0X I;  1VQP A;  3VYU A;  5EBC A;  3RD4 A;  3X3M A;  4JI0 L;  1H9M A;  2XIW A;  4OIK A;  3EJI A;  4MTK A;  4B3T L;  1CHP D;  2B63 H;  2RSO A;  1IKM A;  1CQV A;  5T1I A;  4CDD C;  1A2T A;  4JV5 Q;  2Y0S E;  3VYS A;  3F8T A;  3ER0 A;  2KVM A;  3L9A X;  3FKI H;  3VR2 A;  1NTG A;  4OX9 L;  4J6H A;  4YY3 L;  1EIH A;  1IBK Q;  3GDE A;  2K32 A;  3QOJ A;  3K5L A;  1VQA A;  2AUK A;  1K8M A;  5KYL A;  1NSN S;  2HDM A;  3FPU B;  1OO9 B;  3KJP A;  1SLJ A;  1LTT D;  2K50 A;  1X3Q A;  1FGU A;  4DR4 L;  4FP5 D;  3BYT B;  4N8X 1;  4DNI A;  5C3X A;  2E2H H;  3SGI A;  2VB2 X;  5M5Y H;  1K73 C;  1W3S A;  1YVC A;  4HIK A;  1TR5 A;  1EU3 A;  3KF6 B;  4DV4 Q;  2JA8 H;  4FF4 A;  1VQD A;  4GKK L;  4CDE C;  1AE3 A;  1DOK A;  2RF4 A;  3PIP A;  3NK9 A;  1TVX A;  1WI5 A;  1SFO B;  4ZKC B;  3CF5 A;  4ID6 A;  3L0O A;  4BY1 H;  1GVP A;  4XYO A;  4LFB L;  3I4M H;  1E1T A;  3Q23 A;  5C44 H;  2VXW A;  1FNW A;  1HZ9 A;  2JEA I;  3DLL A;  1QOH A;  2F0Q A;  1Y8O B;  1KDC A;  1SXT A;  2L12 A;  1TS5 A;  4JPB W;  2J0T D;  4ZYS A;  2L55 A;  4RMF A;  4IPD A;  1ASZ A;  1JB7 A;  4DUZ Q;  2R7Z B;  1ENF A;  1M8A A;  3L2P A;  2VUM B;  3TP5 A;  3S24 A;  1KLG D;  4JI4 L;  1HRJ A;  5KRU A;  1JCK B;  1HZB A;  2UXD L;  4CGY B;  4KJN A;  1T5E A;  3DUZ A;  2DUD A;  2F3W A;  4DFA A;  3G6J B;  2XNA C;  1CKM A;  3KDF A;  4NXN L;  4FF1 A;  2KCT A;  2OTJ A;  4TKO B;  4G7H C;  4NXM Q;  4HMI A;  3SR1 A;  4DAM A;  1KRT A;  5FLX E;  2B29 A;  2EIF A;  4A3E G;  1YHB A;  4FYD A;  3A74 A;  2NVY H;  2K03 A;  3H0G B;  4LUZ A;  1JB3 A;  3C3L A;  1HNZ Q;  2OQK A;  4FDB A;  2D9U A;  4OL7 A;  2E5L L;  1B50 A;  3ULL A;  3PUZ A;  3CPW A;  4XXE A;  4BWG B;  1HNX Q;  4QQB X;  3PMF A;  1WCM H;  2NZO A;  2NZH A;  1M90 C;  3AU7 A;  2Y0S B;  2VB3 X;  1Y8P B;  3ND8 A;  2ZJQ A;  1JJG A;  2A6H D;  3KLW A;  2C5C A;  3WOF A;  1LAC A;  1B8A A;  2MQH A;  3GD7 A;  3J7Y W;  4C3H G;  1L0X B;  4K14 A;  4LF8 L;  4X64 Q;  3GTQ B;  2WB1 B;  2IY5 B;  4IUR A;  3OIP A;  2F0U A;  4A3M B;  4YHH Q;  1ZYR D;  2Q8I B;  5KYI A;  2A68 D;  4A3K B;  1SND A;  4DAY A;  5TSS A;  1EWC A;  2AMC B;  4JI5 Q;  1O7Z A;  2EJG C;  3SK6 A;  4FO2 A;  1X56 A;  4GN3 B;  4X66 L;  1E2V A;  4LF7 Q;  1FGB D;  1I6H H;  1CZG A;  1XX8 A;  2K05 A;  1B4O A;  4JI0 Q;  1QG7 A;  1EQR A;  1YZ6 A;  3HOZ B;  3G48 A;  2M9V A;  2PW5 A;  4DV2 L;  1F2Y A;  2R93 G;  1TY2 A;  2E2D C;  4B3T Q;  3VR4 A;  4A3L G;  2Z1C A;  1Z6H A;  4APV A;  1DON A;  4M1U B;  1PFS A;  3STB C;  1KIX A;  5CC4 A;  4B9X A;  3J80 E;  4ZLT F;  3P1H A;  4DV1 L;  2K5H A;  1KDB A;  1EUJ A;  1B7Y B;  5C4X H;  4PMB A;  4HSP A;  3HOU B;  4OX9 Q;  1LO5 D;  1CKN B;  2CHB D;  4YY3 Q;  2SDF A;  1PTO C;  1I50 H;  1CHQ D;  1O7I A;  5IE8 A;  1WTQ A;  1F9R A;  3K80 C;  5E3F A;  2Z4H A;  3A7L A;  3RZO H;  1N34 L;  2JJQ A;  3HKZ E;  4ZRZ A;  1I94 L;  1JWS D;  4DR4 Q;  3RN2 A;  4C2M H;  2E2J B;  2DJF C;  3GQB A;  2KHJ A;  2IWH A;  1NR2 A;  1EFI D;  4J15 A;  1F2Z A;  1D2B A;  3A56 A;  3CCU A;  4RHR A;  1VS0 A;  4GKK Q;  4Y52 H;  2DGY A;  5KIX A;  2Q2H A;  4UDU C;  2OXP A;  3MC0 B;  1DYQ A;  5D65 A;  5C4H A;  1YJW A;  3NE5 B;  3HOV B;  2AWO A;  1WJJ A;  3JAM L;  1OXV A;  4BA1 I;  3D8G A;  2MO0 A;  1Y14 B;  4WOR A;  4LFB Q;  2PZW A;  2UUA L;  3ULP A;  2LXK A;  2UXC L;  1LTA D;  2JA6 G;  3ICE A;  4FXG C;  3MVV A;  4QIW B;  3KBX A;  2FMC A;  1B44 D;  3PUW A;  1RHP A;  2LFN A;  4I7A A;  4A3I B;  3S1Q B;  1QIL A;  2A74 C;  3N52 A;  1W2B A;  4FXK C;  1TWA B;  2VS1 A;  4A3C G;  1SNM A;  3IL8 A;  4IFD J;  1WD1 A;  1NAP A;  2N55 A;  1PH8 A;  1XYI A;  5CV6 A;  4X62 L;  1Q46 A;  1SE4 A;  1Z47 A;  1HQR D;  2QF7 A;  2J4X A;  1EY5 A;  1A3T A;  1PTO B;  5C0X J;  4KHV A;  2G5D A;  3GTK B;  2UXD Q;  3QOL A;  3SEB A;  1D5M C;  2EZV A;  1QUQ B;  2K6A A;  1ML0 D;  2PPB C;  1F2L A;  1EY6 A;  1HR0 L;  1LT3 D;  1KAW A;  1IHZ A;  1I6V C;  4C3I B;  2HUG A;  1TWC H;  3S15 B;  4NXN Q;  3CME A;  2B8F A;  5L37 A;  5EPL A;  2OCE A;  1U4R A;  3PIO 3;  1VQ8 A;  2WAQ G;  3FVQ A;  2ICI A;  1RKN A;  5IWA L;  4DNT B;  4E6I A;  1N33 L;  3OMG A;  4L5T A;  2NVQ H;  2XWB B;  3TS2 A;  2EYM A;  1BUV T;  2KHI A;  1Q3L A;  1STY A;  2FHT A;  2OF1 A;  4ME5 A;  3SXH A;  4A3G H;  2SEB D;  2EYJ A;  1JQY D;  3DWQ A;  3T1H L;  1LM0 A;  2E5L Q;  1LT4 D;  4U68 A;  2JA7 B;  1SAP A;  2H5X A;  4YCU A;  1PA6 A;  4IUN A;  1KAA A;  3UDG A;  2F0L A;  2NVX H;  2NTS A;  3DWP A;  4R9W A;  1E0B A;  2PMZ B;  3VYT A;  2K01 A;  2B2V C;  1S5C D;  3EA6 A;  3Q8D A;  4XIG S;  5HY6 A;  1MI2 A;  2JP1 A;  2HD3 A;  3FP9 A;  4OWW B;  2KJX A;  5J22 A;  2R92 B;  4R4O A;  2ZXO A;  4C3J H;  2B2U A;  3T4A C;  5JJZ A;  4A3J G;  3D4D A;  4R4T A;  4LNQ A;  1HXY D;  1PH1 A;  3M9B A;  3TRE A;  3R3O A;  3OW7 A;  1SE2 A;  2I5H A;  2QDL A;  1STA A;  4LF8 Q;  2L0C A;  2HIV A;  2B63 B;  1UE7 A;  3Q24 A;  3MFY A;  2C35 B;  2A6E C;  5A2Q L;  1GUO A;  1DOM A;  4BBS G;  4JBK A;  5GAE C;  4GZY C;  2TSS A;  1QE6 A;  2IW3 A;  2XTI A;  2A5H A;  4MN3 A;  4NW2 A;  4X66 Q;  1D7Q A;  3H09 A;  1CA6 A;  1MHW C;  3AFQ A;  1B2T A;  1MIU A;  3CD6 A;  1WTH A;  2NZ1 D;  1XPU A;  2D2C C;  1NY4 A;  1Y1V H;  2YTV A;  4WJ4 A;  4DV2 Q;  1H9S A;  1CA5 A;  3VDY A;  1A63 A;  1UNS A;  5GAG C;  4BBR G;  2DNC A;  3NHH A;  1X55 A;  3J81 E;  1R4P B;  4HJ8 A;  4BY7 G;  1R9T B;  2BDN A;  2D5D A;  4NB3 A;  2A69 D;  2WKD A;  4DV1 Q;  2RQX A;  1EYA A;  4GOP C;  1SYE A;  3R2I A;  3MXP A;  2E2H B;  5C4J B;  5ELO A;  1VCI A;  3KOJ A;  4DU9 A;  5FLX c;  1LT6 D;  3W2D A;  3PSI A;  4C3H H;  1X3P A;  2I46 A;  1GUW A;  4RGN A;  3M85 A;  1VMP A;  4L8J A;  4BY1 B;  5LMN W;  1N34 Q;  5M3F G;  1G51 A;  3I4M B;  1I94 Q;  1C4Q A;  3FEW X;  4EVO A;  1WTX A;  2MNA A;  4B3R L;  1AN8 A;  2PQE A;  3VR6 A;  1AW7 A;  2L4N A;  1YEZ A;  4ZUJ A;  1U9R A;  5I9P A;  3RN5 A;  4JI3 L;  1BVS A;  5IT9 c;  4IOA A;  4KJO A;  2A1A A;  2B2T C;  4JI8 L;  1STB A;  1MBY A;  2ALY B;  2R93 H;  2BCO A;  5BN4 A;  1EWH A;  4A3L H;  2NN6 G;  1I3Q B;  4OGQ C;  3AQQ A;  2QEX A;  2LMC B;  4OHJ A;  1CSP A;  2JA5 G;  2ES2 A;  3QO2 A;  4KV6 A;  2UUA Q;  4A76 A;  1XMO L;  3IFD A;  4V19 0;  1PH5 A;  3EQL C;  1VQ9 A;  3KFU A;  5GQO A;  3M7N A;  3CHB D;  1GUG A;  3PO3 H;  3L7Z C;  3MEH A;  4DR6 L;  1TY0 A;  4A93 G;  3RLF A;  4X62 Q;  2SOB A;  5KNB A;  4HJA A;  3DM3 A;  5K36 G;  1G2T A;  4O1N A;  1Y8N B;  3S2H H;  3OSO A;  3TZD A;  1VQB A;  2A19 A;  3I7F A;  4DV7 L;  1HR0 Q;  4JI7 Q;  4MTN A;  3HOY B;  2F52 A;  2EPB A;  2KQ3 A;  3PGZ A;  4QF4 A;  3HOX G;  2XWJ B;  2NVT H;  4EX5 A;  1EOV A;  1LUZ A;  1L1O C;  4LF6 L;  3J80 c;  1HTL D;  1SYB A;  3GO5 A;  3PF5 A;  5BR8 L;  4N9T A;  5IWA Q;  5DAU A;  2QIL A;  1M4V A;  1N33 Q;  1ESF A;  4AYB G;  3M4Y A;  3URY A;  2JA6 H;  2EJF C;  1PLF A;  3OWF A;  5H1S E;  3CCS A;  4K8I A;  4OIJ A;  3KDF B;  3T1H Q;  2K5W A;  1LV9 A;  3E3X A;  1EIF A;  4GLV B;  3K81 C;  1HPC A;  4KK7 A;  2EY5 A;  3D31 A;  2X6L A;  4A3F G;  1RF2 D;  3VR3 A;  3IKJ A;  1GOZ A;  3CCV A;  4YCV A;  2QEJ C;  5ELE A;  1LAB A;  1ILQ A;  3FMC A;  5E4W C;  4IOC A;  2NWG A;  3CCE A;  2L1B A;  2B2Y C;  3H15 A;  1BXT A;  5IY0 A;  4Y7N H;  2RCF A;  1TWH B;  3PO2 G;  1L0W A;  2HT1 A;  4XQQ A;  4Q5V A;  2EYL A;  2QDB A;  1QNU A;  2CQA A;  2R3Z A;  2I0Q A;  1BCP F;  3I4N H;  2MGS A;  1I5F A;  3GTP H;  1WVL A;  3AB9 A;  2L5T A;  3S17 H;  1S5F D;  4KY6 A;  1WTV A;  1BQQ T;  4JW0 A;  5IYD G;  4X3K A;  3TN2 A;  1AH9 A;  1LTB D;  4QJF A;  1KRS A;  1I50 B;  4A3B B;  4UPA A;  2EXD A;  4QGU A;  1IW7 D;  4DAY B;  2EYO A;  1QZG A;  1P8L A;  3MXG A;  4JBW A;  2BE5 D;  1GKH A;  3NEN A;  3J7A 5;  1PFN A;  5ELB A;  2P5Z X;  4AIM A;  1SMY D;  2A73 B;  1LTS D;  2IT1 A;  3EFX D;  2N8N A;  4IPC A;  1TT2 A;  4IAL A;  4JOI A;  5DNF A;  2Z6K C;  3HKS A;  2VY3 A;  1YNJ D;  2YU9 H;  1TS4 A;  3C46 A;  4P74 A;  2DN8 A;  4YCW A;  5FJ8 G;  4BBS H;  1VQJ A;  4JC0 A;  4RGO S;  3T1Y L;  2KBN A;  2OT2 A;  2WIN B;  4B3R Q;  2L9H A;  1H95 A;  1T5X D;  1CM9 A;  4GNX A;  1VQL A;  5M5W H;  1T9H A;  4JI3 Q;  3HGB A;  1VQI A;  5JEA H;  2HIX A;  3A8J E;  4JI8 Q;  4G57 A;  1BO0 A;  4GKJ L;  1BDO A;  4J1M A;  4CJ2 C;  4X3S A;  4OXP A;  4BBR H;  4X6A H;  3TP8 A;  3PUX A;  2K5V A;  1A8V A;  2GA4 B;  2KOL A;  3BG3 A;  4DK1 A;  5FLM G;  2PYK A;  3I90 A;  4LAA A;  1LYL A;  1U4P A;  4F8M A;  1XMO Q;  1QZH A;  4R1J A;  3UDI A;  1V8Q A;  1NMF A;  3A54 A;  1F9P A;  4DR5 L;  1EYG A;  3F1Z A;  2IJ0 A;  4F87 A;  1TWC B;  2LY7 A;  3R2T A;  3H3V I;  3A0J A;  1VQ6 A;  1PH2 A;  3IRB A;  5M3M B;  4DR6 Q;  3ZJY C;  4POF A;  1X3E A;  2RDH A;  4KKU A;  3B6Y A;  5M3F H;  2I07 B;  2FXQ A;  1XPR A;  3NBI A;  3U9S A;  3RR5 A;  2F03 A;  1KAB A;  3I2Z A;  3BYY B;  4DV7 Q;  4A3G B;  3A8I E;  2K33 A;  3IFT A;  1LTI D;  1VQG A;  1STE A;  3I55 A;  3TEH B;  1B1Z A;  3RUZ A;  3K6O A;  2D62 A;  2CH4 W;  4JI1 L;  3J81 c;  5DM7 3;  3E6Z X;  5C3E B;  1ROD A;  2NVX B;  4RGM A;  4LF6 Q;  2JA5 H;  1BBW A;  2UXB L;  5BR8 Q;  1K3R A;  5F2D A;  3JAM i;  4P72 A;  5IP9 G;  2F0G A;  2CH4 A;  3QIA A;  2ZT9 C;  5C3W A;  3HEJ A;  4C3J B;  2ZTD A;  1RCV D;  4H02 A;  4RH6 A;  4FNF A;  4IUV A;  2IX3 A;  5COY A;  2OWO A;  3RMH A;  4A93 H;  4JYA L;  3W1G A;  5K36 H;  1D1K A;  1BCP D;  4B3S L;  4UP9 A;  2R7Z G;  3SDZ A;  2VUM G;  3I56 A;  1DGS A;  1UE6 A;  2SNS A;  4HJ9 A;  1E24 A;  4HED A;  4PG3 A;  2K52 A;  1PH9 A;  5IYB H;  4LF5 L;  3HOX H;  1QWY A;  3C2P A;  1IL8 A;  1Y1V B;  4PZ8 A;  5HUR A;  1A2U A;  2D0P A;  1JWM D;  3HS0 C;  3CRL C;  1EOT A;  5IT9 E;  2F0D A;  2AQ2 B;  4RFB A;  1UUP A;  1G91 A;  1RTN A;  1VQ7 A;  1D5X C;  3H0G G;  2MP1 A;  3DMU A;  1SNQ A;  3D3R A;  3Q6S A;  4NDX A;  2K04 A;  2XGT A;  2RKS A;  5I4D A;  4GS3 A;  3MAQ A;  1CTM A;  2E2I B;  2KED A;  1LLR D;  2K14 A;  3S16 H;  4DV6 L;  5IP7 H;  3CQZ B;  3PIO A;  2Z8L A;  1GUS A;  5AJ3 L;  5IOC A;  2WAQ E;  1IZ6 A;  1NE3 A;  2N78 A;  1Y1W B;  4K6L A;  2BA0 A;  3V96 A;  2EE1 A;  2RSN A;  3GV6 A;  2Y0S G;  4CBV A;  1P16 A;  1K8A C;  1GJX A;  5I6Y A;  4QCL A;  1L2F A;  3CCM A;  4X65 L;  3AMU A;  1YHA A;  1H9S B;  1K0R A;  1TWG B;  2KUM A;  4QMG A;  1N8R C;  1QJO A;  2ZJP A;  1ZXT A;  3S14 B;  1NR4 A;  1ET6 A;  4BXX G;  5ELF A;  1Q8I A;  1CKO A;  2WB1 G;  3GTO B;  3RZD B;  3UDF A;  1XTC D;  5DEH A;  4A3M G;  3T1Y Q;  1YNN D;  4IZ8 A;  4OWX B;  1F9Q A;  3NXW A;  4A3K G;  3BZD B;  4UHV A;  3R8B A;  1JE4 A;  1I4R A;  1QVC A;  4L6T B;  5CV7 A;  1S72 A;  2BH8 A;  4IJL A;  1NMG A;  1G2S A;  2EJM A;  2IL8 A;  3GTM H;  4HN7 A;  1J9O A;  2X6G A;  1EZ6 A;  4A3D B;  5FK9 C;  3ERO A;  1NJI C;  4GKJ Q;  3HOZ G;  4RA8 A;  4DXF A;  3PO3 B;  2EOT A;  1UEA B;  4PMW A;  1SE8 A;  1VF7 A;  1X9N A;  1F77 A;  1YNX A;  4UY8 C;  4H13 C;  1HQM C;  5IGD A;  3I70 A;  2F0F A;  2ICE C;  1VMC A;  2KHS A;  2B2W C;  3NP8 A;  1TII D;  3R93 A;  3S1M H;  2GVB A;  1UE5 A;  2C9O A;  5EPK A;  4N8F A;  4RG1 A;  3HOU G;  4LK1 C;  3NBH A;  4KY5 A;  4DR5 Q;  3K58 A;  1YJ9 A;  3PCO B;  3K0Y A;  3M4O H;  2NVT B;  2XSC A;  1MSH A;  5CBE E;  3BDL A;  3E9H A;  3KK7 A;  2F0H A;  1R4Q B;  3MWY W;  3CKI B;  3LX0 A;  4G7O C;  3WOE A;  1VQN A;  5LMN L;  1QB5 D;  2JQO A;  2VQF L;  2EXZ A;  1UWV A;  3UE0 A;  1RDP D;  1D1I A;  4JI1 Q;  4B3M L;  5FLX L;  3G71 A;  2F4V L;  3HOV G;  1O7L A;  2UXB Q;  4R8N A;  5FLM H;  3X3N A;  1WTO A;  1OXU A;  3GV3 A;  4JI4 Q;  1BKB A;  5IYC G;  2AQ3 B;  2BH2 A;  1H9J A;  3H3V H;  4KKT A;  4A3I G;  5JOB A;  3TP7 A;  3K57 A;  1JJ2 A;  1S5E D;  3WDN A;  2EY2 A;  5IT9 L;  3DXJ C;  3K7A H;  2E8G A;  5EKI A;  2ID0 A;  4JYA Q;  4YIJ A;  4XQJ A;  1ASY A;  2UUC L;  1FD7 D;  4B3S Q;  4P2C B;  3I4N B;  4ABN A;  1PH3 A;  4NPS A;  1V43 A;  4H44 C;  1IBL L;  2VNU D;  2LS0 1;  3VYR A;  5CV5 A;  3S17 B;  2B3G A;  4FVM A;  1GXD C;  4PZ6 A;  1OXX K;  1EY9 A;  4F7X A;  5C5L A;  4LF5 Q;  4TVA B;  3GTG H;  1SRU A;  2OEO A;  1KQS A;  3TQY A;  3HOW B;  3RLO A;  3U4V A;  3DHQ A;  4QUC A;  4C3I G;  2D0O A;  4LW1 A;  4JOI C;  2HQL A;  1GM5 A;  1FR3 A;  2BE5 C;  3KUP A;  1KNA A;  1SMX A;  2EY1 A;  2RVL A;  2IHE A;  2LSS A;  1ZKO A;  3SE0 A;  3ZYY X;  2RA4 A;  4K2K A;  5IP9 H;  5DLQ E;  4L5Q A;  4R4I A;  1XNR L;  5JJK A;  1PMR A;  1XXG A;  2ZXP A;  2F0J A;  4K5W A;  4XDX A;  2JA7 G;  4DV6 Q;  1B3Q A;  1JOK A;  1ONL A;  2Q2T A;  1TXY A;  2RHQ B;  2L11 A;  5AJ3 Q;  1WTP A;  2YU9 B;  3EVQ A;  1YHQ A;  2QGQ A;  4A3E H;  4EQP A;  3CAM A;  2VUM H;  5FO8 B;  3J80 L;  4AYB E;  1S3O A;  5C4Z A;  1SSO A;  4HIM A;  3HG9 A;  2R92 G;  2PCF B;  1C48 A;  1IXR A;  3I4O A;  3HKZ B;  1VQF A;  3U58 A;  3ONA B;  2WP8 J;  1GO3 E;  3O13 A;  5GRO A;  1OTC A;  3NWT A;  1HJP A;  5J3B A;  4X65 Q;  1MGS A;  2Z9H A;  3VA5 A;  3FKI B;  2QW7 A;  1Z9F A;  2RDF A;  2OTL A;  3J7A V;  1V1P A;  3BS1 A;  1U5K A;  2UUB L;  3ERQ A;  4AQY L;  4KTA A;  2BDO A;  1XWE A;  3HP3 A;  1EY4 A;  1JMC A;  2B63 G;  1EY0 A;  4PMC A;  5JJI A;  1N36 L;  3H0G H;  1U4L A;  5IGC A;  2R7F A;  3KF8 A;  3OMC A;  4RHS A;  1E2W A;  2ZTE A;  3T13 A;  1IL2 A;  5DM6 3;  1B9N A;  1K9M C;  5M5Y B;  5E1F A;  4RCO A;  2JA8 B;  2QKI C;  3TSS A;  3OHX C;  3MZ5 A;  3SVM A;  1O7Y A;  1TU2 B;  5M5X H;  3BDC A;  5IGF A;  1SEB D;  3A5Z B;  4GNX B;  5D3D A;  5FO9 B;  1W6J A;  5C44 B;  2F0N A;  1EIG A;  3U50 C;  2PI2 E;  1EQV A;  3NUC A;  5IIF A;  3GTQ H;  4DV3 L;  3CU7 A;  3TP6 A;  1PZI D;  4A3M H;  1KLU D;  4BY1 G;  4KN4 C;  2NN6 I;  3I4M G;  5LMN Q;  2VQF Q;  4DKA C;  2O5I C;  2UXC Q;  2E76 C;  1K28 A;  1X3G A;  5GAD C;  2Z4I A;  2G9H D;  1JIC A;  3CC7 A;  1VQO A;  5ELC A;  4R8I A;  3HOZ H;  2DJG C;  1ICF B;  4ZUI A;  1BNZ A;  3KYH C;  4B3M Q;  1TWF H;  2ZM6 L;  4J8Q A;  2BOS A;  2JK8 A;  1KC8 C;  1MJE A;  4MZ9 A;  2ZTC A;  1Z7T A;  4WJW A;  3F2D A;  4KLK A;  4QUF A;  4DV5 L;  4LUV A;  2NVY B;  4LMQ D;  3S1N H;  2KCM A;  5AFW A;  3HOU H;  1LT5 D;  1X3F A;  2RHS B;  2N3S A;  4IO9 A;  2L15 A;  1DM0 B;  4OEL B;  3G6E A;  2UUC Q;  3A5U A;  5ISR A;  2RBM A;  2JSO A;  2NTT A;  4HJ5 A;  1SNC A;  1IBL Q;  3MEF A;  5I2Y A;  1WCM B;  5J39 A;  2A6H C;  5EKK A;  3TME A;  1Q1E A;  4X3U A;  4NMZ A;  3A8K E;  1CI3 M;  5CR3 A;  3HOY G;  4A3C H;  1BF4 A;  2WII B;  1Q7Y C;  4K8J A;  5EKL A;  1DZ1 A;  2V4D A;  4UP7 A;  4POG A;  1ZYR C;  3A7A B;  2N49 A;  1O78 A;  1SDF A;  2A68 C;  3QR8 A;  1A6X A;  5IYC H;  3UDX A;  1JOR A;  1GD7 A;  1I4X A;  1PRT B;  1VQE A;  1BCP B;  2Z0S A;  5FKA C;  1XNR Q;  4C1N K;  3NQI A;  3S1Q H;  1WFQ A;  3AEV A;  1I6H B;  1JR0 D;  1EEI D;  2R7D A;  1AEX A;  1VQ4 A;  2VQE L;  4FXD A;  1WTR A;  4DGZ A;  3K0X A;  2K5D A;  1EY8 A;  3VA7 A;  1PRT F;  3J81 L;  4X3T A;  4EQ5 A;  3FHW A;  1A3U A;  1PTO H;  2HQE A;  2IHF A;  3CRK C;  3F2B A;  1E7Z A;  2MPM A;  1JJC B;  1GHJ A;  3GTK H;  2FJ2 A;  1XTD A;  3NPP A;  5J1Z A;  5C4X B;  4C3I H;  3CCL A;  3CC2 A;  2F0K A;  3S15 H;  2SNM A;  3NTK A;  1C7Y A;  1A15 A;  1SJE D;  4F88 A;  2UUB Q;  1N9W A;  5EPJ A;  4AQY Q;  5T1G A;  1B53 A;  1N36 Q;  2R6G A;  3CPF A;  3RZO B;  2F0W A;  2XRQ D;  4EQO A;  3K5O A;  2NYZ D;  4K5X A;  3K7U C;  3M4Q A;  4LF9 L;  4C2M B;  1JOO A;  1YBY A;  2YTY A;  4A3J H;  3SK4 A;  5JPN C;  1PV4 A;  2AHO B;  2JA7 H;  3E9I A;  5KEE A;  4DUY L;  4DV0 L;  1EL0 A;  2Q8T A;  3I91 A;  3OTO L;  3KBG A;  3F2U A;  1VQM A;  4A3B G;  1SNP A;  1SN8 A;  1U0L A;  1JOQ A;  3M4O B;  4OO1 G;  4IFD G;  4HSV A;  3CCQ A;  1RJT A;  1E3P A;  2QA4 A;  4DNR B;  2RDG A;  2F0M A;  2EYF A;  1F9S A;  4K0K L;  2NB0 A;  3D0F A;  4GLA C;  3C1E A;  2R92 H;  3KJO A;  1PYW D;  4ZCK A;  3OIQ A;  5C0X G;  4CJ0 B;  2XVS A;  1JE5 A;  2LXJ A;  4RGT A;  2AKW B;  1FVI A;  3RNU A;  2PQA A;  4IUU A;  1EY7 A;  2B2V A;  1SYG A;  4IUP A;  4HID A;  4IPG A;  4WRD A;  2F0E A;  4DV3 Q;  1S40 A;  3D4W A;  5IOD A;  2X69 A;  2PZU A;  1ENC A;  1CSQ A;  3D6W A;  4BY7 H;  2F4I A;  1YIT A;  2JA9 A;  2MO1 A;  2A6E D;  5JJL A;  4IJH A;  1CFM A;  3NBH B;  1RL2 A;  1DJR D;  5BN3 A;  2IX1 A;  1NNX A;  1Q1B A;  4DR3 L;  2MFI A;  4K2L A;  4ODG A;  2ATW A;  4DF7 A;  1YIJ A;  3EBE A;  3HFZ B;  3K7A B;  4CDC C;  4DK0 A;  2ZM6 Q;  4AH6 A;  1V9P A;  2WB1 E;  1RTO A;  4HIO A;  2AWN A;  4LFC L;  1R9T H;  1TKW B;  4DV5 Q;  1HFG A;  5JVH 3;  1WYD A;  3DWA A;  2NVQ B;  1OXS C;  5C4J H;  3ND9 A;  1A62 A;  3MFG A;  3CCR A;  3TDQ A;  3GTG B;  1SJH D;  5JEA J;  1EZ8 A;  1S5D D;  2B2U C;  3ERS X;  3S2D H;  2NN6 H;  3FPP A;  2PO4 A;  4FF2 A;  3V2T A;  5M3M G;  3J81 j;  2JN4 A;  4JI6 L;  3WWV A;  1J8I A;  4GOP A;  3BVZ A;  1WD0 A;  1A3V A;  4TQU S;  1S4Z A;  4L5S A;  2CQO A;  4QB4 A;  3T53 B;  4A3G G;  5CMD A;  2PNH A;  3QG1 A;  1FNV A;  2IX0 A;  1GUN A;  1RD9 D;  4UP8 A;  4FF3 A;  2K5Q A;  3GTL H;  3OOC A;  2CWA A;  1Q12 A;  2OQ0 A;  5C3E G;  1I3Q H;  2Z6B A;  3BZK A;  1PRT D;  1PZJ D;  2K7V A;  3V05 A;  4A3E B;  3NQT A;  2J7Z A;  2WFW A;  3W5O A;  3JAM E;  4CJ1 B;  1EYC A;  5D14 A;  4ILW A;  1EYD A;  4DR7 L;  1AP0 A;  4JI2 L;  2F1M A;  2B2T A;  1KXL A;  1XMQ L;  5D3I B;  1K8G A;  1NBW A;  4C3J G;  4HJ7 A;  3MXN A;  1HTP A;  3I8Z A;  1DD2 A;  2KA7 A;  2VQE Q;  4JVZ A;  4IUQ A; 
#chains in the Genus database with same CATH homology
 3T16 A;  1MD2 D;  5IGG A;  5CV9 A;  5G3L F;  2F0S A;  2DY8 A;  2A69 C;  4XYQ A;  5I2X A;  5BN5 A;  4DAP A;  2B39 A;  5FO7 B;  1AZQ A;  1HUM A;  2HDL A;  4KN7 C;  1JC7 A;  3C1F A;  1MSG A;  1GHK A;  3KLS A;  1ILP A;  2O4X A;  4XTC S;  4HTH A;  1DCZ A;  3MXU A;  4C3H B;  4EGV A;  4O42 A;  1DXM A;  2B8G A;  5M5X B;  3H94 A;  2WAC A;  1E2Z A;  4ZKB B;  2HCI A;  2K1B A;  1V1P B;  2H1E A;  5FOB B;  5C6A A;  4DN4 M;  2K28 A;  3PUY A;  1I4H A;  4RKB A;  3L3O C;  3SK8 A;  4H0L C;  2R93 B;  1D5Z C;  2CW0 D;  4I65 A;  4RWS C;  4KKS A;  3Q22 A;  4ULL A;  4K5V A;  4Q0F A;  3FDT A;  2JEB I;  4DA2 A;  1CZW A;  3NWS A;  3E0J A;  3PIP 3;  2AUJ D;  1TWF B;  2B2Y A;  2ENB A;  4CHT B;  3G7L A;  3A55 A;  3S2H B;  3TBI B;  5COR A;  5E4X A;  3S1N B;  2KEC A;  5A2Q E;  2TMP A;  3BDO A;  1SYF A;  1NCV A;  2WV6 D;  2PNR C;  3P20 A;  4CKB A;  4HR7 B;  4OO1 H;  4IFD H;  2MHV A;  3UI2 A;  3MTS A;  5C5M A;  2NBF A;  1PXU A;  5ELD A;  4ZQ3 A;  1SYD A;  5IGB A;  3GP7 A;  2O5J C;  1STH A;  1QNK A;  2EY6 A;  5EGT A;  5C0X H;  3MHB A;  5HGT A;  3K59 A;  2JA6 B;  2F0I A;  2QCP X;  1O80 A;  3HRZ C;  3PUV A;  1S5B D;  1C8C A;  5M9O A;  4BA2 I;  1NUC A;  3OWE B;  3P75 A;  2JE6 I;  4Y7N B;  4TRD A;  4KD3 A;  2F0V A;  4JK1 C;  2AQ1 B;  1UAP A;  2DY7 A;  4KI0 A;  3P7J A;  1EEF D;  1H9R A;  5G3L D;  2R61 A;  1II3 A;  2WAQ B;  3I72 A;  3MA2 B;  2XRS D;  5IGE A;  2DNE A;  3GTP B;  3S9W A;  1SYC A;  2NUC A;  5K5P A;  3I4L A;  3FRP B;  3DEP A;  2N88 A;  1F2M A;  1LTR D;  3NTI A;  3I73 A;  1PTO F;  1G8Z D;  3K5M A;  1KDA A;  1IW7 C;  3T56 B;  3H6M A;  2F3V A;  3N6R A;  1LTG D;  4LJZ C;  4XT1 B;  1SMY C;  1HA6 A;  3SK5 A;  1BBX C;  2EDG A;  3KLS X;  4A3J B;  4KMU C;  4K6D A;  5LHY 1;  1H9K A;  1YNJ C;  1G29 1;  5LL6 S;  4B08 A;  3H91 A;  1TQO A;  3K5N A;  5KNC A;  1OXT A;  4HCS A;  1HHV A;  1ICW A;  3VR5 A;  4BBS B;  1EQT A;  2KCN A;  4RCN A;  4RKL A;  4MHE A;  3E5S A;  4N9P A;  3LWE A;  4C1N I;  5KGU A;  5M5W B;  4WFN 3;  5JPM C;  2IPK D;  4CKC A;  4BBR B;  5CYU A;  2O2L D;  2PZT A;  3OPO A;  4BY7 B;  1STG A;  2MUY A;  3BVM A;  2KEE A;  1TS3 A;  4V0B A;  4NP5 A;  4ZAI A;  1DOL A;  1I4Q A;  3M7G A;  1SE3 A;  5KND A;  4I7Z C;  5JEA G;  1PFB A;  5EQ0 A;  1TS2 A;  4XT3 B;  4XQN A;  1AZP A;  2YYZ A;  5CV8 A;  3QWN A;  3QJY A;  1Q90 A;  5M3F B;  1I4P A;  3IAY A;  4TSS A;  5CGK A;  3TZU A;  2Q8R E;  3W3A A;  1EU4 A;  2F0T A;  1CT1 D;  1IYV A;  3LWU A;  3I3C A;  3S2D B;  1ESR A;  4PNY A;  1SNO A;  3KLR A;  4G7Z C;  2JA5 B;  4DXG A;  1G6Z A;  2HCC A;  1BOS A;  5CBA E;  2E75 C;  3GTL B;  1PRT C;  1VF5 C;  1BCP C;  1ET9 A;  4IQZ A;  4A93 B;  2PW7 A;  2XN9 C;  1HFN A;  1KNE A;  3DEO A;  1CQF A;  2BA1 A;  1HCZ A;  3LNN A;  1FNU A;  1ZEQ X;  2ZXR A;  1Y69 U;  1GUT A;  2JYO A;  1KTK A;  1CK1 A;  2F0O A;  2G9D A;  3HOX B;  5JAV A;  1PTO D;  1VDZ A;  2MJ8 A;  2M2L A;  4PV1 C;  2FIN B;  1FYC A;  4H7B A;  1X32 A;  5EJW A;  4AYB B;  3PV0 A;  1BR9 A;  1HUN A;  3GTJ B;  4KHZ A;  4BS9 A;  5I6W A;  1STN A;  4UAI A;  4U67 3;  1I4G A;  5CV4 A;  2LKV A;  5I9O A;  2FMM A;  4IUT A;  5EBD A;  2EVB A;  4A3F B;  3J7A F;  3S16 B;  1AFP A;  2JXM B;  3BVG A;  1SBB B;  2B2W A;  2KCC A;  3S1R B;  3QB3 A;  2WKC A;  1U4M A;  1WTW A;  1PZK D;  4KY7 A;  1B3A A;  5NUC A;  3PO2 B;  4HCE A;  4S3S A;  4DAV A;  4IN3 A;  2H4O A;  3SHL A;  4PQX A;  2CW0 C;  3HZX A;  3M3Y B;  5LL6 X;  1V1O A;  4Z9C B;  1W6K A;  1YNN C;  1HA5 A;  1B9M A;  2F0P A;  2EYP A;  1JWU D;  3D4R A;  5A35 A;  1IYU A;  3ITP A;  4RAU C;  1PDQ A;  2FFK B;  4G4K A;  3T51 B;  3GTM B;  2M00 A;  4HAE A;  1K8O A;  1QCB D;  3U9O A;  3NTH A;  1D6E C;  3H3V C;  4EQN A;  4MIU A;  4C56 C;  3S1M B;  1K83 B;  3DM1 A;  1IKL A;  4NKL A;  3Q0A A;  1ENA A;  4M8A A;  5JVG 3;  1L0Y B;  2CVR A;  1PFM A;  3D6C A;  2EYH A;  4OO1 I;  4IFD I;  4CKE A;  4HMJ A;  4L63 B;  4B9W A;  3NSW A;  4KD4 A;  2E74 C;  4ZK9 B;  5C0X I;  3VYU A;  5EBC A;  3RD4 A;  3X3M A;  1H9M A;  2XIW A;  4OIK A;  3EJI A;  1CHP D;  2RSO A;  1IKM A;  1CQV A;  5T1I A;  1A2T A;  3VYS A;  2KVM A;  3L9A X;  3VR2 A;  4J6H A;  1EIH A;  2K32 A;  3QOJ A;  3K5L A;  2AUK A;  1K8M A;  5KYL A;  1NSN S;  2HDM A;  3FPU B;  1OO9 B;  1LTT D;  1X3Q A;  4FP5 D;  3BYT B;  5C3X A;  2VB2 X;  1TR5 A;  1EU3 A;  4FF4 A;  1DOK A;  3NK9 A;  1TVX A;  1SFO B;  4ZKC B;  4ID6 A;  4XYO A;  3Q23 A;  2VXW A;  1FNW A;  2JEA I;  1QOH A;  2F0Q A;  1Y8O B;  1KDC A;  1SXT A;  2L12 A;  1TS5 A;  2J0T D;  4ZYS A;  2L55 A;  2R7Z B;  1ENF A;  1M8A A;  2VUM B;  3TP5 A;  1KLG D;  1HRJ A;  5KRU A;  1JCK B;  4CGY B;  4KJN A;  1T5E A;  3DUZ A;  2F3W A;  4DFA A;  3G6J B;  2XNA C;  4FF1 A;  4TKO B;  4G7H C;  4HMI A;  3SR1 A;  5FLX E;  4FYD A;  2K03 A;  3H0G B;  1JB3 A;  3C3L A;  2D9U A;  4OL7 A;  1B50 A;  3PUZ A;  4XXE A;  4BWG B;  3PMF A;  3AU7 A;  2Y0S B;  2VB3 X;  1Y8P B;  3ND8 A;  2A6H D;  2C5C A;  3WOF A;  1LAC A;  3GD7 A;  3J7Y W;  4C3H G;  1L0X B;  4K14 A;  3GTQ B;  2WB1 B;  4IUR A;  3OIP A;  2F0U A;  4A3M B;  1ZYR D;  2Q8I B;  5KYI A;  2A68 D;  4A3K B;  1SND A;  4DAY A;  5TSS A;  1EWC A;  1O7Z A;  2EJG C;  3SK6 A;  4FO2 A;  1E2V A;  1FGB D;  1CZG A;  1XX8 A;  2K05 A;  1B4O A;  1QG7 A;  3HOZ B;  2M9V A;  2PW5 A;  1F2Y A;  1TY2 A;  2E2D C;  3VR4 A;  2Z1C A;  1Z6H A;  1DON A;  4M1U B;  5CC4 A;  4B9X A;  3J80 E;  4ZLT F;  3P1H A;  1KDB A;  4PMB A;  4HSP A;  3HOU B;  1LO5 D;  2CHB D;  2SDF A;  1PTO C;  1CHQ D;  1WTQ A;  1F9R A;  5E3F A;  2Z4H A;  3A7L A;  4ZRZ A;  1JWS D;  2E2J B;  3GQB A;  2IWH A;  1NR2 A;  1EFI D;  1F2Z A;  1D2B A;  3A56 A;  4RHR A;  5KIX A;  4UDU C;  2OXP A;  3MC0 B;  1DYQ A;  5D65 A;  5C4H A;  3NE5 B;  3HOV B;  2AWO A;  3JAM L;  1OXV A;  4BA1 I;  3D8G A;  4WOR A;  2PZW A;  1LTA D;  4FXG C;  3MVV A;  4QIW B;  3KBX A;  2FMC A;  1B44 D;  3PUW A;  1RHP A;  2LFN A;  4A3I B;  3S1Q B;  1QIL A;  2A74 C;  3N52 A;  4FXK C;  1TWA B;  1SNM A;  3IL8 A;  4IFD J;  1WD1 A;  1NAP A;  2N55 A;  1XYI A;  5CV6 A;  1SE4 A;  1Z47 A;  1HQR D;  2QF7 A;  2J4X A;  1EY5 A;  1A3T A;  1PTO B;  5C0X J;  4KHV A;  3GTK B;  3QOL A;  3SEB A;  1D5M C;  2EZV A;  2K6A A;  1ML0 D;  2PPB C;  1F2L A;  1EY6 A;  1LT3 D;  1IHZ A;  1I6V C;  4C3I B;  2HUG A;  3S15 B;  2B8F A;  5EPL A;  1U4R A;  3PIO 3;  3FVQ A;  2ICI A;  1RKN A;  4DNT B;  4E6I A;  3OMG A;  2XWB B;  2EYM A;  1BUV T;  1Q3L A;  1STY A;  2FHT A;  2OF1 A;  4ME5 A;  3SXH A;  2SEB D;  2EYJ A;  1JQY D;  3DWQ A;  1LT4 D;  4U68 A;  2JA7 B;  1SAP A;  4IUN A;  1KAA A;  2F0L A;  2NTS A;  3DWP A;  4R9W A;  1E0B A;  2PMZ B;  3VYT A;  2K01 A;  2B2V C;  1S5C D;  3EA6 A;  4XIG S;  1MI2 A;  2JP1 A;  2R92 B;  2KJX A;  5J22 A;  2ZXO A;  2B2U A;  3T4A C;  5JJZ A;  3D4D A;  1HXY D;  3R3O A;  3OW7 A;  1SE2 A;  1STA A;  2L0C A;  2B63 B;  3Q24 A;  3MFY A;  2A6E C;  5A2Q L;  1GUO A;  1DOM A;  4GZY C;  2TSS A;  1QE6 A;  2IW3 A;  2A5H A;  4MN3 A;  4NW2 A;  3H09 A;  1CA6 A;  1B2T A;  2NZ1 D;  2D2C C;  1H9S A;  1CA5 A;  1UNS A;  2DNC A;  3NHH A;  3J81 E;  1R4P B;  1R9T B;  2BDN A;  2D5D A;  2A69 D;  2WKD A;  2RQX A;  1EYA A;  1SYE A;  3R2I A;  3MXP A;  2E2H B;  5C4J B;  1VCI A;  4DU9 A;  1LT6 D;  3W2D A;  1X3P A;  2I46 A;  1GUW A;  4RGN A;  3M85 A;  1VMP A;  4L8J A;  4BY1 B;  3I4M B;  1C4Q A;  4EVO A;  3FEW X;  1WTX A;  1AN8 A;  2PQE A;  3VR6 A;  1AW7 A;  2L4N A;  4ZUJ A;  1U9R A;  5I9P A;  4KJO A;  2B2T C;  1STB A;  1MBY A;  2BCO A;  5BN4 A;  1EWH A;  2NN6 G;  1I3Q B;  4OGQ C;  2LMC B;  4OHJ A;  3QO2 A;  4KV6 A;  3IFD A;  4V19 0;  3EQL C;  3M7N A;  3CHB D;  1GUG A;  3L7Z C;  3MEH A;  1TY0 A;  3RLF A;  2SOB A;  5KNB A;  5K36 G;  1G2T A;  4O1N A;  1Y8N B;  3OSO A;  3TZD A;  3HOY B;  2KQ3 A;  2EPB A;  4QF4 A;  2XWJ B;  1HTL D;  1SYB A;  3GO5 A;  4N9T A;  5DAU A;  2QIL A;  1M4V A;  1ESF A;  3M4Y A;  3URY A;  2EJF C;  1PLF A;  3OWF A;  4K8I A;  4OIJ A;  2K5W A;  1LV9 A;  1HPC A;  4KK7 A;  2EY5 A;  3D31 A;  2X6L A;  1RF2 D;  3VR3 A;  3IKJ A;  1GOZ A;  2QEJ C;  5ELE A;  1LAB A;  1ILQ A;  3FMC A;  5E4W C;  2NWG A;  2L1B A;  2B2Y C;  1BXT A;  1TWH B;  4XQQ A;  4Q5V A;  2EYL A;  2QDB A;  1QNU A;  2CQA A;  2R3Z A;  1BCP F;  2MGS A;  1WVL A;  3AB9 A;  2L5T A;  1S5F D;  4KY6 A;  1WTV A;  1BQQ T;  4X3K A;  3TN2 A;  1LTB D;  1I50 B;  4A3B B;  1IW7 D;  2EYO A;  4JBW A;  3MXG A;  2BE5 D;  1PFN A;  5ELB A;  1SMY D;  2A73 B;  1LTS D;  2IT1 A;  3EFX D;  1TT2 A;  4IAL A;  5DNF A;  1YNJ D;  1TS4 A;  3C46 A;  2DN8 A;  4RGO S;  2OT2 A;  2WIN B;  2L9H A;  1T5X D;  1CM9 A;  3HGB A;  5JEA H;  3A8J E;  4G57 A;  1BO0 A;  1BDO A;  4J1M A;  4CJ2 C;  4X3S A;  3TP8 A;  3PUX A;  3BG3 A;  2GA4 B;  4DK1 A;  2KOL A;  2PYK A;  3I90 A;  4LAA A;  1U4P A;  4F8M A;  1V8Q A;  3A54 A;  1F9P A;  2IJ0 A;  4F87 A;  1TWC B;  2LY7 A;  3R2T A;  5M3M B;  2RDH A;  4KKU A;  2I07 B;  3NBI A;  3U9S A;  2F03 A;  1KAB A;  3BYY B;  4A3G B;  3A8I E;  2K33 A;  3IFT A;  1LTI D;  1STE A;  1B1Z A;  3RUZ A;  3K6O A;  2D62 A;  5C3E B;  5DM7 3;  3E6Z X;  1ROD A;  2NVX B;  4RGM A;  5F2D A;  2F0G A;  3QIA A;  2ZT9 C;  5C3W A;  3HEJ A;  4C3J B;  1RCV D;  4RH6 A;  4FNF A;  4IUV A;  2IX3 A;  5COY A;  3RMH A;  5K36 H;  1D1K A;  1BCP D;  3SDZ A;  2SNS A;  4HED A;  1QWY A;  3C2P A;  1IL8 A;  1Y1V B;  5HUR A;  1A2U A;  1JWM D;  3HS0 C;  3CRL C;  1EOT A;  5IT9 E;  2F0D A;  2AQ2 B;  4RFB A;  1UUP A;  1G91 A;  1RTN A;  1D5X C;  2MP1 A;  3DMU A;  1SNQ A;  3D3R A;  3Q6S A;  4NDX A;  2K04 A;  2RKS A;  5I4D A;  3MAQ A;  1CTM A;  2E2I B;  2KED A;  1LLR D;  3CQZ B;  2Z8L A;  1GUS A;  5IOC A;  1Y1W B;  4K6L A;  2BA0 A;  3V96 A;  2EE1 A;  2RSN A;  3GV6 A;  4CBV A;  1GJX A;  5I6Y A;  4QCL A;  3AMU A;  1H9S B;  1TWG B;  2KUM A;  4QMG A;  1QJO A;  1ZXT A;  3S14 B;  1NR4 A;  1ET6 A;  5ELF A;  1Q8I A;  3GTO B;  3RZD B;  1XTC D;  5DEH A;  1YNN D;  4IZ8 A;  1F9Q A;  3NXW A;  3BZD B;  3R8B A;  1JE4 A;  1I4R A;  4L6T B;  5CV7 A;  1G2S A;  2EJM A;  2IL8 A;  4HN7 A;  1J9O A;  2X6G A;  1EZ6 A;  4A3D B;  5FK9 C;  3ERO A;  4RA8 A;  4DXF A;  3PO3 B;  2EOT A;  1UEA B;  4PMW A;  1VF7 A;  1F77 A;  4H13 C;  1HQM C;  5IGD A;  3I70 A;  2F0F A;  2ICE C;  1VMC A;  2KHS A;  2B2W C;  3NP8 A;  1TII D;  3R93 A;  2C9O A;  5EPK A;  4LK1 C;  3NBH A;  4KY5 A;  3K58 A;  3K0Y A;  2NVT B;  2XSC A;  5CBE E;  1MSH A;  3BDL A;  3KK7 A;  2F0H A;  1R4Q B;  3MWY W;  3CKI B;  3LX0 A;  4G7O C;  3WOE A;  1QB5 D;  2EXZ A;  1RDP D;  1D1I A;  5FLX L;  1O7L A;  4R8N A;  3X3N A;  1WTO A;  1OXU A;  3GV3 A;  2AQ3 B;  1H9J A;  4KKT A;  5JOB A;  3TP7 A;  3K57 A;  1S5E D;  3WDN A;  2EY2 A;  5IT9 L;  3DXJ C;  5EKI A;  2ID0 A;  4YIJ A;  4XQJ A;  1FD7 D;  4P2C B;  3I4N B;  4ABN A;  1V43 A;  4H44 C;  2VNU D;  2LS0 1;  3VYR A;  5CV5 A;  3S17 B;  4FVM A;  1GXD C;  1OXX K;  1EY9 A;  4F7X A;  5C5L A;  2OEO A;  3HOW B;  3DHQ A;  4QUC A;  4C3I G;  1FR3 A;  2BE5 C;  3KUP A;  1KNA A;  2EY1 A;  2RVL A;  1ZKO A;  3SE0 A;  3ZYY X;  2RA4 A;  4K2K A;  1PMR A;  1XXG A;  2ZXP A;  2F0J A;  4K5W A;  4XDX A;  1JOK A;  1ONL A;  2L11 A;  1WTP A;  2YU9 B;  3EVQ A;  4EQP A;  5FO8 B;  3J80 L;  5C4Z A;  1SSO A;  3HG9 A;  2PCF B;  1C48 A;  3HKZ B;  3ONA B;  2WP8 J;  3O13 A;  3NWT A;  1MGS A;  3VA5 A;  3FKI B;  2RDF A;  3J7A V;  1V1P A;  3BS1 A;  3ERQ A;  4KTA A;  2BDO A;  1XWE A;  3HP3 A;  1EY4 A;  1EY0 A;  4PMC A;  1U4L A;  5IGC A;  3KF8 A;  3OMC A;  4RHS A;  1E2W A;  3T13 A;  5DM6 3;  1B9N A;  5M5Y B;  5E1F A;  4RCO A;  2JA8 B;  2QKI C;  3TSS A;  3OHX C;  3MZ5 A;  3SVM A;  1O7Y A;  1TU2 B;  3BDC A;  5IGF A;  1SEB D;  5D3D A;  5FO9 B;  1W6J A;  5C44 B;  2F0N A;  1EIG A;  1EQV A;  3NUC A;  5IIF A;  3CU7 A;  3TP6 A;  1PZI D;  1KLU D;  4KN4 C;  2NN6 I;  2O5I C;  2E76 C;  2Z4I A;  2G9H D;  1JIC A;  5ELC A;  4R8I A;  4ZUI A;  1BNZ A;  4J8Q A;  2BOS A;  1Z7T A;  4WJW A;  4QUF A;  2NVY B;  4LMQ D;  5AFW A;  1LT5 D;  1DM0 B;  5ISR A;  2RBM A;  2JSO A;  2NTT A;  1SNC A;  5I2Y A;  1WCM B;  5J39 A;  2A6H C;  5EKK A;  3TME A;  1Q1E A;  4X3U A;  4NMZ A;  3A8K E;  1CI3 M;  5CR3 A;  1BF4 A;  2WII B;  4K8J A;  5EKL A;  1DZ1 A;  2V4D A;  1ZYR C;  3A7A B;  1O78 A;  1SDF A;  2A68 C;  1A6X A;  1JOR A;  1I4X A;  1PRT B;  1BCP B;  5FKA C;  4C1N K;  3NQI A;  1I6H B;  1JR0 D;  1EEI D;  1AEX A;  4FXD A;  1WTR A;  4DGZ A;  2K5D A;  1EY8 A;  3VA7 A;  1PRT F;  3J81 L;  4X3T A;  1A3U A;  1PTO H;  2HQE A;  3CRK C;  2MPM A;  1GHJ A;  2FJ2 A;  3NPP A;  5J1Z A;  5C4X B;  2F0K A;  2SNM A;  3NTK A;  1A15 A;  1SJE D;  4F88 A;  5EPJ A;  5T1G A;  1B53 A;  2R6G A;  3RZO B;  2F0W A;  2XRQ D;  4EQO A;  3K5O A;  2NYZ D;  4K5X A;  4C2M B;  1JOO A;  3SK4 A;  5JPN C;  5KEE A;  1EL0 A;  2Q8T A;  3I91 A;  3KBG A;  3F2U A;  1SNP A;  1JOQ A;  3M4O B;  4OO1 G;  4IFD G;  4HSV A;  1RJT A;  4DNR B;  2F0M A;  2RDG A;  2EYF A;  1F9S A;  2NB0 A;  3C1E A;  1PYW D;  3OIQ A;  5C0X G;  4CJ0 B;  2XVS A;  4RGT A;  4IUU A;  1EY7 A;  2B2V A;  1SYG A;  4IUP A;  4WRD A;  2F0E A;  3D4W A;  5IOD A;  2X69 A;  2PZU A;  1ENC A;  3D6W A;  2F4I A;  2A6E D;  1CFM A;  1DJR D;  5BN3 A;  2IX1 A;  1Q1B A;  4K2L A;  4ODG A;  4DF7 A;  4DK0 A;  3K7A B;  1RTO A;  2AWN A;  1TKW B;  1HFG A;  5JVH 3;  3DWA A;  2NVQ B;  1OXS C;  3ND9 A;  3MFG A;  3TDQ A;  3GTG B;  1SJH D;  5JEA J;  1EZ8 A;  1S5D D;  2B2U C;  2NN6 H;  3FPP A;  2PO4 A;  4FF2 A;  3V2T A;  1J8I A;  3BVZ A;  1WD0 A;  1A3V A;  4TQU S;  1S4Z A;  4QB4 A;  3T53 B;  5CMD A;  3QG1 A;  1FNV A;  2IX0 A;  1GUN A;  1RD9 D;  4FF3 A;  2K5Q A;  3OOC A;  1Q12 A;  1PRT D;  1PZJ D;  2K7V A;  3V05 A;  4A3E B;  3NQT A;  2J7Z A;  3JAM E;  4CJ1 B;  1EYC A;  5D14 A;  4ILW A;  1EYD A;  1AP0 A;  2F1M A;  2B2T A;  5D3I B;  4C3J G;  3MXN A;  1HTP A;  3I8Z A;  1DD2 A;  2KA7 A;  4IUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...