2KHSA

Solution structure of snase121:snase(111-143) complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The native-like interactions between SNase121 and SNase(111-143) fragments induce the recovery of their native-like structures and the ability to degrade DNA.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 26
structure length 121
sequence length 121
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2khsA00
5I9PA 3P1HA 3QOJA 5CV4A 2NUCA 1KDCA 3SXHA 4KJNA 1II3A 3S9WA 2OF1A 3TP5A 4DU9A 4ID6A 5NUCA 3SK6A 5CV8A 4F8MA 5JAVA 3BDLA 5KGUA 1JOQA 2F0KA 5J1ZA 1F2MA 1TR5A 2F0DA 4HMIA 5HURA 3D8GA 1EY9A 3OWFA 3T16A 3D6CA 4PMBA 3C1FA 3BDCA 5EGTA 3T13A 3SK5A 5DEHA 1NUCA 3ITPA 4OL7A 2O4XA 3MHBA 4KHVA 4TRDA 1EY8A 1F2ZA 2F0JA 2OXPA 3QOLA 4K14A 1SYDA 4WORA 5C5LA 4KD3A 4N9TA 4KV6A 4EVOA 5CC4A 2EY6A 1EZ8A 3TMEA 3HZXA 4F7XA 2F0OA 2F0NA 3MXPA 1KABA 3H6MA 1STAA 1EY6A 1AEXA 3QB3A 5C5MA 1IHZA 3NUCA 5KYIA 5IGGA 2RBMA 1A3TA 1ENAA 2F3WA 2KHSA 4ME5A 5CV9A 5IGCA 4PMCA 2F0WA 4RKBA 1SNPA 1KDBA 4IUNA 1JOKA 1STHA 1EYAA 4EQNA 4EQPA 5J39A 2EYLA 4NKLA 5IGBA 1U9RA 5IGEA 4K8JA 1RKNA 2F0PA 2QDBA 3SK8A 5CGKA 2EYFA 2EYJA 1SYCA 3LX0A 3TP6A 5C4ZA 1TT2A 1KDAA 1A2UA 5CV5A 4KY5A 4KD4A 3PMFA 2WACA 3RUZA 4ZUJA 3V2TA 2F0SA 5K5PA 1SYFA 2F0FA 1F2YA 2EY2A 5J22A 1EY7A 4MIUA 4B9XA 3SHLA 3SK4A 5KIXA 4E6IA 4DFAA 5EKLA 2HQEA 3EVQA 3NQTA 4RKLA 1EZ6A 1SYBA 1JORA 3C1EA 2F0MA 2PZTA 4K6DA 2PYKA 2F0EA 3OMGA 4QF4A 4NMZA 2F0UA 5C6AA 4WRDA 5ISRA 5KRUA 4G57A 1SNMA 3NHHA 2RKSA 1A3VA 1NSNS 2EYOA 3NP8A 3NXWA 1A3UA 4K8IA 4NDXA 5F2DA 4QMGA 3TP8A 4EQOA 1EY0A 1STYA 1EYDA 2EYMA 4KJOA 3MVVA 5C3XA 2F0VA 4HMJA 2EYPA 3D4WA 4YIJA 4I65A 1SYGA 3DHQA 5CR3A 5IODA 4B9WA 2RDFA 1EYCA 3D4DA 5IGDA 4NP5A 5M9OA 3OMCA 3TP7A 4KY7A 3MEHA 2SNSA 4IALA 3VA5A 2PW7A 1EY5A 1SNOA 2F0LA 3HEJA 4ODGA 1JOOA 1SYEA 5C3WA 2PZUA 2F0IA 4HTHA 2F0GA 2PQEA 5I6WA 2EXZA 5IIFA 3OSOA 5KEEA 5HGTA 2KQ3A 1TQOA 4IZ8A 3SR1A 2EY5A 2F0TA 3DMUA 4R8NA 4N9PA 5E1FA 5C4HA 5IOCA 4K5VA 5I9OA 2PW5A 4K5XA 4KTAA 5JOBA 2F0HA 1STBA 4DGZA 1SNDA 2F3VA 1SNQA 3R3OA 1KAAA 4PNYA 4J1MA 4ZUIA 3P75A 4LAAA 5KYLA 2ENBA 5I6YA 4QB4A 2PZWA 5EKKA 2F0QA 3U9OA 2OEOA 3E5SA 3ERQA 2EY1A 4J6HA 2EYHA 4K5WA 2LKVA 5CV7A 4ZQ3A 4DF7A 5IGFA 1EQVA 1STGA 3EJIA 1A2TA 4KY6A 1SNCA 5E3FA 1ENCA 3NK9A 3MZ5A 1EY4A 4H7BA 1STNA 4K2LA 4S3SA 2M00A 3EROA 5CV6A 2SNMA 4K2KA 2SOBA 5DAUA
chains in the Genus database with same CATH superfamily
1IBKQ 4IUTA 5EPLA 1PZJD 2A8VA 4I7AA 1F2MA 3NWSA 5D3DA 4CBVA 4DV2Q 1KAWA 1EWHA 4LUVA 4CKEA 1VQ6A 2PQAB 5M3MH 3K7AH 4PQXA 4GNXB 3MXNB 3G4SA 1JMCA 5D14A 3HOVG 3PSIA 4NW2A 1J5EL 2VUMB 4PG3A 1QUQB 5IP7G 2NVQH 1TS3A 4LF4L 2NVTB 2JYOA 2JSOA 3CCRA 4R4CA 2R6GA 4GKKL 1PFNA 5BR8L 2NVTH 4DR2L 2NVQB 3K8AA 4PMWA 2RA4A 4KY5A 1SBBB 3PMFA 1K8AC 4JI5L 3WWVA 2H5XA 1DZ1A 4LF7L 3PO2G 2HHHL 2KVMA 4DFAA 2HQEA 1U0LA 5CMDA 3DLLA 4K6DA 2ZJPA 1K83B 4DNTB 1UUPA 1G2TA 3I72A 1QB5D 2L15A 1JJCB 5FLXL 2ZT9C 3J80E 1STEA 3J80c 1PRTB 4OXPA 4X65L 3G71A 4JI7L 5C0XJ 5JEAG 4IJHA 3DHQA 3GTPB 5I2YA 1EY5A 4AQYL 3T1YQ 1CM9A 2D2CC 3FPUB 3I73A 4PZ8A 4LFAL 2KOLA 2PQEA 4B3TQ 5HGTA 4A3KG 2HUGA 3DMUA 4OELB 2VQEL 3QWNA 1I4RA 5M3FG 3ERSX 1I94Q 3CMAA 4A3GB 1EU3A 3Q22A 2OT2A 1TWFB 1VS0A 5EKKA 3TRZA 4PZ7A 5GAHC 4AYBE 1SFOB 4G7HC 2F03A 1EIHA 1T5XD 2MNAA 1SDFA 1PLFA 2X69A 1KNAA 4A3DH 1S72A 4DR7L 4C2MB 4GLAC 4JPBW 2RF4A 4ID6A 2NVXB 2K28A 4DK1A 1CKNA 4FVMA 3OWFA 4X64Q 3BS1A 3AQQA 2B63G 1EZ8A 1EIFA 1Y8OB 1N36L 3H0GB 1XMOQ 2CW0D 2OTLA 3I70A 1VQGA 2LS01 1HTLD 4ME5A 1FVIA 3HOVH 1NNXA 1F9PA 2HDLA 2PCFB 1YBYA 3VYRA 5IP7H 2QDBA 2B8GA 3ND9A 5EPJA 5JPNC 1N33Q 1S4ZA 3W3AA 3PF4A 3KK7A 3EN2A 3CAMA 4A3JG 1XPOA 1SSOA 4DR5L 2JP1A 3VYTA 3EVQA 1WOCA 4QF4A 1YHAA 3OMGA 2PQAA 1XMQQ 1HQRD 2FMCA 2IY5B 4DV3Q 4HIOA 2XIWA 1GUOA 4HJ7A 2R7DA 4HMJA 4NXMQ 1H9SA 1X3PA 4NP5A 5K36H 2CCZA 4LF5Q 5JEAH 3MEHA 2SNSA 5LMNW 4KHPQ 2JA7B 4DXGA 5M5YH 3Q24A 4EQ5A 1U4LA 2F0GA 4A93H 2UUAQ 2K5DA 4RGNA 3P7JA 1O7YA 3GV3A 1RDPD 4OX9Q 4UY8C 4H44C 1DCZA 4CGYB 1SNDA 3A8JE 3NBIA 1R4PB 5ELBA 4JBMA 2OEOA 1W3SA 3A8KE 1Z47A 2LKVA 1EQQA 3OHXC 1QILA 2K14A 4DF7A 4QCLA 1XXGA 5FLMH 2NVYH 3UE0A 4H7BA 3DXJC 1F9RA 1IKMA 4R1JA 4OEMB 1VQ7A 1HUMA 4YY3L 1VCIA 5DAUA 3RZOB 3I7FA 5CV4A 3QOJA 4FF3A 1OXSC 2BCOA 1I4XA 1MD2D 3BDLA 1UE7A 3KLSA 4HIKA 4DV0Q 3J7A5 1I3QH 3RMHA 3BDCA 5EGTA 3LGJA 4JG2A 3RLOA 4DAVA 4KHVA 4WORA 4N9TA 1NY4A 2XGTA 2O5IC 2RSNA 4LW1A 4EX5A 1P16A 4DR1L 5H1SE 4CDDC 1C0AA 1TVXA 5IGCA 3UDGA 1LT5D 5ELDA 4MZ9A 4X62Q 2EYJA 3NTHA 1RODA 3T53B 1KXLA 1A2UA 5G3LD 3J81E 3UDFA 4UP9A 4GOPC 2WAQE 2F0FA 1DONA 2EDGA 1YI2A 5M5WH 3I4NG 4UAIA 1CSQA 3KBXA 2F1MA 3U58A 1LTAD 4LF9L 5IT9L 1WTXA 1RTNA 1A63A 5ISRA 1LTID 2K5QA 3NTKA 4ALPA 1SR3A 4JI3L 3DUZA 3J7YW 2V1CC 4QMGA 3VYSA 1V1OA 2DUDA 1K9MC 4YIJA 3J81c 3TSSA 2Z1CA 5FK9C 5FJ8H 2VS1A 4IQZA 3BVGA 5CORA 3HP3A 3PCOB 5ELOA 4FF1A 3H94A 2ALYB 5C3WA 3IAYA 3S2DH 1EFWA 1U4MA 2VL6A 3PO3B 4YHHL 1D1IA 2G5DA 2LSSA 2VZAA 3HOYG 1K8GA 5FLXc 3L7ZC 4WFN3 3GTQB 1EQTA 2CKZB 1X56A 1QUQA 5E1FA 3K58A 2ZJQA 4DUYL 2EJMA 1DJRD 2E2HB 3PUXA 1OXTA 3U9SA 4C1NI 1N34Q 4JYAL 1L0WA 1DXMA 2QILA 3AFQA 1EEID 1STGA 1ICWA 2ICEC 2R7ZH 1STNA 4OGQC 2Z6KC 1WD0A 1RHPA 2Z4HA 2HIXA 4X3SA 3K80C 3I56A 4HIDA 5COYA 3KOJA 1ASZA 5EJWA 1BVSA 4IFDJ 1EIYB 2BE5D 1KHIA 1JB7A 1HR0Q 2F0KA 2XRSD 4A3KH 4RHSA 1ET9A 3Q6SA 1L1OC 3C1FA 1R9TH 2JA9A 1HNZQ 1AE2A 4GN4B 2OXPA 2XWJB 3QOLA 3W1GA 4OO1I 5CC4A 1SXTA 2UXCL 1O7LA 4F7XA 2F0NA 4YWLA 2FINB 5LMNQ 4CDCC 2CHBD 3C2PA 1BBWA 1IHZA 2F4IA 1X54A 3HOWG 2VQFL 4PMCA 5KNDA 3RZDH 3FEWX 4LFBQ 1CSPA 2G9DA 1IXRA 2EJFC 2WAQG 1XX8A 1ONLA 5CGKA 3GTLH 1U4PA 5C4XB 1CKMA 1ZEQX 1E3PA 5C3EH 4KN7C 4LF8L 2PO4A 3FDTA 4HJAA 2OWOA 2B2WC 4KD4A 2AUKA 2Q8IB 3IRBA 2BDNA 3GP7A 2QCPX 2WKDA 1GJXA 1WTRA 4A3JH 4ABNA 2OTJA 2R61A 1O7ZA 4JV5L 5C0XI 1FNUA 1HZCA 1YVCA 2EIFA 5F2DA 1DOKA 4A3DG 1EYDA 3TBIB 4YY3Q 2YTXA 1VQPA 2B29A 4XXEA 2JK8A 2RDFA 1QVFA 1Q12A 5M9OA 3TP7A 2GA4B 3I2ZA 4R4QA 3VA5A 2JQOA 3Q23A 1BBXC 3WOEA 4FXDA 2WAQB 1JOOA 5EKIA 5FJ8G 4JI8Q 4JI7Q 4RFBA 5IYCG 2NN6H 3S14B 3J81j 5KEEA 3BG3A 4OONA 4B3TL 1IL8A 5GADC 4GOPB 5I9OA 2VNUD 2PW5A 2GVBA 4DUZQ 1IW7D 5AJ3L 4LUOA 2WB1B 3DEPA 3STBC 1XTDA 4PNYA 1TWHH 5LMNL 1EIGA 2A6HD 4LAAA 5C0XG 2M9VA 1AW7A 3MA2B 4BS9A 1IBML 4ZQ3A 1ML0D 1V1PA 1XPUA 1NCVA 3KJOA 2JN4A 3K0YA 4LF6Q 1OXXK 4DR2Q 2M00A 3F8TA 2SDFA 1SE3A 4A3GH 4LJZC 3KLWA 1M1KC 1J8IA 2UU9L 3A0JA 2N3SA 4DR3Q 1VQDA 5NUCA 1PH1A 3BU2A 4POFA 4V190 3S1QH 1I4HA 2Q2TA 2BE5C 1PRTC 2UUCL 1EY9A 4A93B 1X6OA 3D6CA 3S16H 4JCVE 2RHSB 2F0JA 3AEVA 4RHRA 1VQJA 1B70B 2FMMA 1CA5A 2I5MX 2YU9B 5IP9H 1O78A 1HRJA 3NUCA 3K7AB 1G6ZA 1S5BD 4QQBX 3DWAA 3I8ZA 3SK8A 1WD1A 1PTOF 1SLJA 4DA2A 3L3OC 4MN3A 4JI1L 1GO3E 5K5PA 2EY2A 2PPBC 4WJ3M 3HKZG 4PZ6A 1EU4A 1CHPD 2KJXA 4DNRB 1XMQL 2BDOA 4E6IA 2ZXOA 1LTSD 3PO3G 3A5ZB 2NZ1D 3T1HQ 1D7QA 1PH2A 2NYZD 1W6KA 2KCMA 1UE5A 2L12A 1A3VA 1JC7A 3EFXD 2IWHA 5KNCA 4KJOA 3S24A 3BZKA 3R93A 1OXVA 3FHWA 1EWCA 2PMZE 2A6HC 1JE4A 4OHJA 3CCJA 4KY7A 2QGQA 1Q1BA 2Z0SA 3NBHA 4UP8A 1SE4A 1K28A 3KDFA 4ULLA 3CF5A 4OWWB 1UE1A 1QOHA 2N55A 3CP0A 1A15A 3I4MG 1YNNC 2F0TA 3HKZB 2VQEQ 2H4OA 1JT8A 2X6GA 4N8X1 5GAEC 1XNQQ 3S15B 2L1BA 2K01A 3RNUA 3S2HH 4QB4A 4HAEA 1NJIC 3E5SA 4J15A 5HGQA 1HZ9A 3CKIB 3CW2C 2ASBA 4K2LA 2Z8LA 3S1NB 4LMQD 1AH9A 4WJWA 4BBSG 1Q81C 3KFUA 1KDCA 1RIPA 2VB3X 1II3A 4KI0A 4DN4M 3BJUA 3SK6A 4F8MA 3HOYH 3CC2A 5C44B 4FO2A 3SEBA 1GD7A 1KLGD 2VUMH 3T16A 3KF6A 1S3OA 1C8CA 3MWYW 5DM63 1VF7A 4TRDA 4ZLTF 4JBJA 1SYDA 3AU7A 5CYUA 4DR4Q 4X3TA 2R92B 3E9IA 1HZAA 1LT6D 2A6ED 5E4XA 4P72A 1N32L 1H95A 1ENAA 2F3WA 1W6JA 3SDZA 4ZYSA 4OIKA 3F2DA 2NTSA 2B2WA 4AQYQ 3T1YL 2E2JH 1I6HB 3HKZE 4JOIA 1EYAA 3KLRA 2EYLA 4NKLA 4R9WA 3TS0A 1D6EC 4C3JB 3RLFA 3CCVA 2K5NA 5C4ZA 3JAME 1C4QA 1K8OA 2GVAA 4IN3A 1WTQA 4MIUA 4A3EG 1PHJA 2PI2E 4EGVA 1PTOD 3KBGA 3BDOA 4KHZA 5JJIA 3MAQA 2MFIA 1IL2A 3QJYA 1VMPA 3AB9A 5EKLA 4DV2L 4GKKQ 3H09A 3OW7A 3J80L 4IOAA 1B9MA 4QJFA 2ATWA 3NWTA 4ZCKA 1SNMA 3NP8A 4RAUC 1A3UA 3FKIB 3W5OA 3GTMB 1EY0A 3K0XA 2EYPA 1EOVA 5M3MG 2HD3A 3CMEA 1TXYA 1R4QB 1EYCA 3FP9A 3T56B 5IGDA 4IALA 4BY1H 3DEOA 1L0YB 1TWAB 2RDHA 1HQMC 1IBLQ 2JA5B 2AQ1B 4C3HH 2NBFA 1I4QA 4R8NA 1YEZA 1FYCA 1KNEA 4K5XA 3ULPA 1IYVA 1HNWQ 4UP7A 3CCEA 1B44D 1ZYRC 4J8QA 2L4NA 2HIVA 4AYBG 1XMOL 3HOWH 3HG9A 5DLQE 3A55A 4OO1G 5CV7A 1J6QA 1RJTA 3STBD 4IUUA 3OOCA 4TSSA 3MZ5A 2ZTDA 3PV0A 4Y7NH 2DN8A 2EPBA 2VW9A 1HFNA 1ET6A 2SOBA 4LFCL 3P1HA 2X6LA 2ZM6Q 5CBAE 1L1OA 2A74C 4ILWA 3K5LA 4BY7G 3CRLC 4BA1I 4LFBL 4QGUA 1B4OA 3SK5A 1CA6A 1D5XC 2A73B 2AWNA 2E2HH 2K33A 5M3FB 2IJ0A 1PTOB 1LTGD 2JA8G 1PYSB 3PUWA 2BA1A 2GN5A 2RQXA 4A3FG 1AEXA 2B2UC 4A3KB 4X66Q 2XWBB 2RBMA 2NTTA 4GOPA 4RKBA 1DOMA 1JOKA 3M4OH 4A3IG 4A3GG 3CPFA 1B3AA 1Y69U 4G4KA 2EYFA 1O7IA 1ZYRD 3R8BA 4DKAC 4RH6A 5LL6X 4DXFA 3BVZA 3E9HA 5C0XH 1BCPC 1TWFH 1PH4A 5IYDG 1VQ5A 3NQTA 1MIUA 2F3IA 2F0MA 1XPRA 1N34L 3HOZH 4NMZA 5C6AA 4WRDA 3A5UA 2MHVA 4IJLA 3K7UC 1NSNS 2JXMB 4K8IA 5TSSA 4EQOA 4XT1B 3JAMi 5EBCA 3M3YB 2K7VA 2K6AA 2HHHQ 1QZGA 4LNQA 4ZKBB 3GO5A 3D4DA 1G91A 3SVMA 1Q1EA 1PH5A 4DAYA 4WJ4A 4A3IB 1Y1WB 4HTHA 3TREA 1SAPA 1WTVA 1N32Q 1EL0A 2OQKA 4GLXA 2HCIA 3PUZA 3QG1A 1QNKA 3TZUA 1Q86C 4XQQA 2KBNA 5EQ0A 2R93G 3PO3H 1I4PA 1F9QA 5KNBA 1SNQA 1KAAA 2RHQB 5DNFA 3CCQA 3WDNA 3GTGB 3S14H 4DNIA 1HR0W 1ILQA 1N9WA 5IE8A 1EQVA 4LF6L 4FXKC 1X3EA 5A2QL 1GXDC 2JEAI 3KJPA 4JI4Q 1JWSD 3KDFB 3A7LA 3ND8A 3BZCA 1HZBA 1U4RA 4KKSA 1E7ZA 2N78A 2BA0A 1TY2A 1E2WA 1K73C 2RVLA 2E2IH 1M8AA 2JJQA 5LMUL 2R93B 2TSSA 4APVA 4RCOA 4EVOA 4B3SL 1YHQA 4M8AA 2EY6A 4BXXG 3TMEA 1LUZA 1OXUA 4DV4Q 2PI2A 1BBUA 1KABA 2DY7A 5C3EB 1D1KA 1CI3M 1TWCH 1PXUA 1Y1WG 3HOYB 4CKCA 1MGSA 2MGSA 4BBSH 1H9JA 4O0AA 1Y8NB 4JOIC 2WIIB 1CQFA 4MNOA 1TWGH 3HGBA 1DGSA 5J22A 5JEAJ 3CPWA 3FKIG 5EAYA 1BR9A 2KCTA 3I55A 3BZDB 1BCPB 3PIO3 2K5HA 2Z6BA 1G51A 2F0EA 3NXWA 3D31A 4FF2A 3MVVA 3HKSA 1FJGL 4QUCA 2FFKB 5K36G 4NXNL 1PH9A 2HT1A 2D0OA 4JI0Q 3OMCA 1JB3A 3E6ZX 2XNAC 4ODGA 2K05A 1GKHA 2C5CA 1BQQT 2JA6G 2B2VA 4DV1L 4IZ8A 1VQ9A 2UXBL 5L37A 2R7ZB 4DAMA 1R9TB 1FJGQ 4TQUS 4P73A 5J3BA 1HR0L 5M5XH 2E75C 2WINB 1H9SB 2ENBA 2UUCQ 1HNXL 1HNXQ 1S5FD 2OCEA 3R2IA 4L63B 2JA5H 2P5ZX 1TS4A 4S3SA 1TWCB 3HOUB 1DOLA 2ZJRA 3EA6A 1WTOA 2KEDA 3FMCA 2D9UA 2QF7A 3D0FA 5JAVA 4G7ZC 4DK6C 1VQEA 2C9OA 4C3HG 1GM5A 5T1IA 3J7AF 2B2YA 2F0DA 4JW0A 5HURA 4IO9A 1XTCD 3CC4A 4CHTB 3T13A 3RZDB 4L5RC 1NUCA 3A74A 4OL7A 4HR7B 1IKLA 5LHY1 5C5LA 2K5VA 2XVSA 1ILPA 1GVPA 4OO1H 2A1AA 2PMZB 3A54A 5M5YB 2FJ2A 3KF8B 1TS5A 3HOXH 4DK0A 1AP0A 1B50A 1X3QA 4A3FH 4IPCA 1O80A 3IL8A 3MXGA 1U9RA 5IGEA 3ULJA 2WB1G 1CKNB 1Z9FA 2R7ZG 1HXYD 2QEXA 2ID0A 4FP5D 1NR4A 1VQHA 4IUQA 4YCVA 1EEFD 1I6HH 3MFGA 3J81L 1EZ6A 5ELFA 4A75A 3P20A 3CXCA 2K5WA 2MO0A 3H0GH 4G7OC 3B6YA 2JA8H 4X62L 3AYHB 4JI6Q 1LV9A 2K52A 4I65A 4XYOA 2MPMA 1WTWA 1AZQA 2E2JB 2CWAA 4DR1Q 1ESRA 1HA6A 1MSHA 4H02A 4A93G 3AMUA 2F0LA 1TWHB 1SYEA 3PIP3 1YIJA 2DJGC 3HOZB 1F2LA 5ELCA 2UUAL 2HQLA 3GTOB 2Q2UA 4IUVA 3SR1A 4R8IA 3S2HB 3IFDA 2CQOA 3HS0C 5IOCA 1SEBD 1PA6A 3S16B 4KTAA 4X65Q 4JI4L 3OWEB 5DM73 3PIPA 4J1MA 5KYLA 1WVLA 5I6YA 4A3MH 1IW7C 2Z4IA 5FLMG 3UE1A 4ZRZA 2IHEA 3GTMH 1A62A 1V1QA 3GD7A 2H1EA 2DJFC 3KF6B 2K75A 2I0QA 1EY4A 1YNXA 4C2MH 1JJ2A 1H9KA 1PTOC 3H3VI 1YNJD 1LACA 3J7AV 1BCPD 1RCVD 1PFSA 2UXDQ 1X65A 2NUCA 4CKBA 3OIQA 2OF1A 2IL8A 2JEBI 1JOQA 5KGUA 3HOZG 3M7NA 4NPSA 2R7FA 2YU9H 3TN2A 2NVXH 3U50C 5I2XA 2NZOA 3X3NA 3ITPA 1PDQA 1N8RC 3MHBA 5IYBH 1EY8A 3NTIA 1WTHA 4GS3A 4Y52H 1QG7A 2XRQD 1C9OA 3S1MB 2Z6KA 2WB1E 4YHHQ 2O5JC 2KHSA 1QE6A 4IUNA 1STHA 4RGMA 4BY7B 2IPKD 2MQHA 1SMXA 4JBKA 1G291 1PVOA 3QIAA 1MBYA 3D3RA 1IBKL 2OQ0A 3M4YA 2NN6G 2XN9C 1F2YA 4F87A 1X9NA 1LT3D 4B9XA 4JI0L 3SHLA 4HIMA 4ME3A 2AUJD 5E4WC 4HEDA 4C3IG 4DR7Q 2JA7G 1TY0A 2F0UA 4BXXH 2EYOA 1SMYC 1QJOA 2D5DA 4RCNA 5C3XA 2M2LA 1HNWL 2F0VA 3OYYA 4Q0FA 4B3RQ 1LTBD 1SYGA 3GV6A 3PUYA 2RCFA 2LFNA 1JE5A 2D62A 3L0OA 3M4OB 1FL0A 2Q2IA 4DV4L 5T1GA 1G8ZD 3HEJA 5JJKA 3OIPA 4O42A 1NE3A 4B3SQ 4L5SA 2CH4W 1VQLA 4IFDG 3M3YH 1JCKB 1BOSA 4KLKA 3HFZB 1KLUD 2E8GA 1VMCA 2MP1A 5JOBA 1TWGB 4YCWA 3K5OA 3IFTA 5E7NA 2KCNA 5JJZA 2Q2HA 2R92H 2O2LD 1UNSA 2F0QA 3U9OA 2EY1A 4J6HA 1GHJA 3VR2A 5A35A 4LWCA 1BXTA 3EJIA 5LMUQ 3R2TA 4A3EB 1PRTF 2PNHA 2A68D 3SXHA 4KJNA 4LF7Q 4P75A 4DU9A 2E76C 4B08A 1AN8A 2JA6H 1FGUA 4QIWE 3PIOA 4R4IA 1IBLL 1BCPF 4IOCA 2KHJA 1YJWA 3M85A 3TS2A 3VR4A 2XTIA 1V1PB 4OX9L 1L2FA 2F4VL 1TIID 4DV5L 2F0OA 3TDQA 5BN4A 2KCCA 5C4XG 4MTKA 1VQIA 2B39A 4UDUC 4DR3L 5KYIA 4DV7Q 3JAML 5CV9A 4IUPA 3LWEA 1B7YB 1WJJA 4K8JA 1CUKA 5BN5A 1A8VA 2CQAA 3VYUA 1KDAA 3RUZA 2AQ3B 3V2TA 4NXML 3ZYYX 1K3RA 3TQYA 3O13A 1SYFA 3MEFA 3M9BA 4DV3L 2KUMA 5JJLA 2RDGA 1JJGA 4A3DB 2J7ZA 1WCMH 3SK4A 2C35B 3VR3A 2L0CA 4IPDA 1RF2D 4BWGB 4RKLA 3MXUA 3F2UA 1NMGA 5KRUA 3PQIA 3M7GA 1PH7A 3TP8A 3H0GG 3ONAB 3URYA 4DR4L 1N33L 4IPGA 4UPAA 5AFWA 4KK7A 4A3LH 4DV6L 2UUBQ 1B9NA 4L6TB 4A76A 4H0LC 4CDEC 4JI2L 2ZTCA 3OSOA 4RGOS 3HOVB 4A3JB 2JA8B 2EY5A 1HCZA 1HUNA 4K5VA 4Y7NB 4XIGS 4P2CB 2ZM6L 1YZ6A 3OTOL 3F2BA 3Q0AA 1SJHD 2UUBL 4KN4C 2N8NA 4KY6A 4R4TA 4P74A 3PO2B 1PH8A 4K2KA 3H3VH 1T9HA 2I5LX 2DGYA 1NTGA 1A0IA 1T5EA 2SEBD 2CH4A 4O2DA 4MTNA 1PTOH 1X3GA 3CCSA 4CDFC 5J1ZA 3T1HL 4BBRH 4A3CH 2YTVA 4DV6Q 4UHVA 1U5KA 1XWEA 1K3BC 1HNZL 3HOUH 2O4XA 4JI1Q 2L11A 3GTJB 3A7AB 4KV6A 2FHTA 5IYBG 4A3MG 4A3BB 3H6MA 1VQKA 1EY6A 4GKJL 4OWXB 3G7LA 1LTTD 4N8FA 1SRUA 1LYLA 1Y1VH 3U4VA 5FO7B 5J39A 4DK3C 1QVCA 2Y0SB 3NE5B 1ASYA 4XQJA 1PYWD 2F0PA 1VQOA 1HA5A 5JVG3 3J80i 1PYBA 2B2YC 3S17H 3V96A 1BF4A 2F4VQ 3MFYA 2AHOB 3I4MB 5C4JB 4DR6Q 4TKOB 5KIXA 4BY1B 3AFPA 4R4OA 1ZXTA 2EVBA 1CTMA 1HPCA 2XSCA 1UEAB 4YCUA 2QKIC 4MHEA 3CCLA 2PZTA 3TEHB 3E0JA 1J9OA 3CCMA 2B2TA 4RMFA 2Y0SE 3BVMA 1E0BA 1MSGA 1EUJA 1E1OA 5AJ3Q 2A69C 1OO9B 3D4WA 4DV5Q 4JVZA 4AH6A 2AQ2B 1FNWA 1VQAA 1M4VA 1AFPA 5HY6A 3S1RH 5FLXE 2B2UA 1GUWA 1E2ZA 1SROA 3D4RA 3GQBA 3S1RB 4A3LG 4LF4Q 4IPHA 1HH2P 4BY7H 4JI6L 1XJVA 1B2TA 1GOZA 3I4NB 1ESFA 3SGIA 3JAMc 2UU9Q 1B53A 4IFDH 2B63B 1ICFB 3DM1A 1D2BA 2F0HA 3J81i 3W2DA 3W1BA 3M4PA 3R3OA 1GUSA 4ZUIA 4Q5VA 2RSOA 1S5DD 1QCBD 4C3JH 1SJED 4K5WA 1IBMQ 3CU7A 3L2PA 4A3BH 5IGFA 5M5XB 1FNVA 4XT3B 3CQZH 3RLNA 3C46A 5CV6A 1F77A 4BBSB 2EZVA 3T51B 1F9SA 2L55A 2EE1A 2QDLA 3S9WA 3UI2A 1XNQL 3EBEA 3N52A 3V05A 2JA7H 1PFBA 3I4OA 1RD9D 1XYIA 4PMBA 5IYDH 2I46A 5DEHA 2CFMA 4U673 4HCEA 4BBRG 1F2ZA 1VQMA 4L8JA 4KD3A 3HOUG 2R92G 2E5LQ 4B3RL 3F2CA 4M1UB 3RZOH 4LF8Q 1EQRA 1YNND 2VB2X 2WV6D 2NB0A 3GDEA 1KD1C 3S1NH 2CWPA 5IGGA 1Y14B 2JA6B 4JV5Q 1L1OB 4A3IH 4C3HB 3ICEA 3VA7A 4RGTA 2RCNA 1XNRQ 1LTRD 1UAPA 2BH8A 4JI2Q 4GLVB 3TP6A 3HOXB 5IY0A 2L9HA 4C56C 4A3EH 5IT9E 2F0SA 5IWAL 4AIMA 1EWIA 1EY7A 1K83H 2WKCA 1DYQA 2KEEA 3I4NH 1WYDA 3RD4A 3KYHC 1SYBA 4KMUC 5A2QE 2PYKA 2VQFQ 4AYBB 2UXBQ 2G9HD 3NHHA 3DM3A 4DV1Q 5BN3A 3H3VC 1DD2A 1FGBD 1EOTA 1UWVA 1VF5C 4YWKA 3GTKH 2UXCQ 3CRKC 1VQ8A 5CR3A 3K57A 1D5MC 2VXWA 2EQSA 4LF5L 1D5ZC 3K5NA 3T4AC 2K4KA 2E2DC 2PZUA 3NQIA 3QR8A 2IHFA 4C3IB 2IT1A 3F1ZA 5I6WA 5JVH3 3TZDA 1TQOA 1I6VC 2R93H 2BOSA 5IYCH 1Q82C 2UXDL 3N6RA 1QVGA 4OIJA 3E0EA 1RL2A 1VQCA 5C4XH 2EXDA 4A4IA 4POGA 3FKIH 3P75A 4JC0A 2A68C 2I07B 1LTLA 1PRTD 1BKBA 1AE3A 4JYAQ 1CKOA 1A2TA 1SNCA 4YWMA 4P71A 2SNMA 3DWPA 4A3MB 4A3BG 4GN5A 4FXGC 2Q8TA 4B3ML 1GUTA 1PH3A 1LT4D 1Y8PB 2DNCA 5CV8A 5D3IB 1XNRL 4K0KL 2K50A 2E74C 3G6JB 2NVYB 1TR5A 4LF9Q 4A3FB 1VDZA 4C1NK 5C44H 4FYDA 1LLRD 2B2TC 4X64L 1PZID 1Q3LA 4JI8L 4K14A 4L5QA 2E5LL 5IT9c 3BYYB 3HZXA 4ZKCB 3MXPA 3QB3A 1Y1WH 2DNEA 3I90A 4DUZL 1A3TA 1Q8KA 2IX3A 1CZGA 2K03A 3HRZC 3NSWA 5JPMC 3GTPH 4HN7A 1BDOA 4EQNA 1PV4A 1ZKOA 1RKNA 1VQBA 3K6OA 4LUZA 3LX0A 2AMCB 1TT2A 3QO2A 4XYQA 1SMYD 2WACA 1ENFA 2IW3A 1E1TA 1EFID 3E3XA 5ELEA 1I3QB 2DY8A 1CHQD 5I4DA 3K81C 3K59A 4K6LA 4V0BA 3H91A 1SE8A 1JICA 2D0PA 2QEJC 1I50B 3S15H 1WFQA 1STYA 3DWQA 1CK1A 1LM0A 1HFGA 4F88A 3CCUA 1UE6A 1TWAH 1QNUA 2WFWA 1VQ4A 2QA4A 2PW7A 2NN6I 4A3CG 4X3KA 1K0RA 5D65A 3VR5A 5FO9B 4DV0L 1W2BA 2KENA 5M3MB 2A6EC 3ZJYC 5GQOA 3S17B 1KTKA 1UEBA 3MC0B 2QW7A 3UDXA 4DGZA 1DM0B 1Y1VG 4IURA 4I7ZC 4B3MQ 2JA5G 4JI5Q 4GNXA 2EYHA 3HOWB 4KKTA 3MTSA 3S1MH 4KHPL 5C3EG 3PF5A 1Q7YC 5E3FA 3NK9A 4RWSC 1JWMD 4DR6L 2N49A 4RA8A 2IX0A 4X66L 3TP5A 2HDMA 1FD7D 3NENA 4DUYQ 3KUPA 1YJNA 2N88A 3Q8DA 3D8GA 3PO2H 3A56A 1K8MA 1TKWB 3KLSX 2CVRA 1YNJC 3EQLC 4GKJQ 3GTGH 2ZXRA 3H15A 1PMRA 3D6WA 1WI5A 2ZXPA 1QZHA 4HCSA 4QUFA 5FOBB 3HOXG 4IFDI 3NBHB 5M3FH 1LABA 4L5TA 1Z6HA 2F0WA 1KDBA 2K32A 3FRPB 5IGBA 2BH2A 4X6AH 5M5WB 3GTJH 2MUYA 4CJ1B 1Q8IA 3FPPA 5CV5A 3CC7A 4NB3A 4CJ2C 2CW0C 1JQYD 2J4XA 4XQNA 2NZHA 3VR6A 1X55A 3PGZA 4C3JG 1NR2A 4LFCQ 1K0SA 1GUGA 5IWAQ 1JORA 3C1EA 1H9MA 3OTOQ 4G57A 2MO1A 2RKSA 1EYGA 2FXQA 4JI3Q 1IYJB 1S5ED 2LMCB 3GTOH 1E24A 2EYMA 1V43A 2KA7A 2EOTA 3X3MA 1MJCA 1L0XB 2EJGC 3EIVA 3IKJA 5EBDA 1GUNA 1C7YA 2B3GA 3G6EA 1KIXA 4BA2I 3VDYA 3I91A 4XTCS 4JBWA 1B3QA 3I4LA 3GTQH 1SNOA 3GTLB 3RN5A 2F0IA 2IX1A 4BY1G 2ES2A 3LNNA 2EXZA 5IIFA 1KQSA 1D8LA 1RTOA 1BNZA 4N9PA 4FNFA 4XDXA 1G6PA 1MJEA 1CZWA 5IP9G 1STBA 4HSVA 2A19A 4U68A 3J7ZC 4LFAQ 3CD6A 2PZWA 4GZYC 1P8LA 3ERQA 1MHWC 1IYUA 3U4ZA 4K0KQ 1MKHA 1V9PA 2B8FA 2LY7A 3OPOA 4OWTB 1ENCA 2B2VC 1I94L 3NPPA 1TU2B 2MJ8A 3OW2A 1CT1D 5I9PA 1B8AA 1SE2A 1AZPA 1NAPA 1S40A 1KL9A 1MI2A 3NEMA 3C3LA 5GROA 1NMFA 1YITA 3MXNA 4HJ8A 2YTYA 1GHKA 4HMIA 1TS2A 1CFMA 2A69D 4DV7L 2KECA 4C3IH 2WP8J 2B63H 2K04A 4TVAB 1V8QA 1JWUD 1YJ9A 2L5TA 4BBRB 1SN8A 2PNRC 4QIWB 3I3CA 2Q8RE 1BUVT 4Z9CB 1STAA 5C5MA 1A6XA 5BR8Q 4DPGA 1LO5D 1PZKD 3G48A 4HJ5A 3BYTB 1NBWA 4LK1C 3CQZB 3LWUA 1WCMB 1J5EQ 1SNPA 3A8IE 4EQPA 4PV1C 1X3FA 3I4MH 2A5HA 2HCCA 1E22A 1WTPA 1SYCA 3S2DB 4H13C 5FO8B 4DAYB 4ZUJA 1QWYA 3CHBD 2R3ZA 2VY3A 2AKWB 2K1BA 3S1QB 1SFOH 4DR5Q 3SE0A 1G2SA 5LL6S 4NXNQ 2Z9HA 5G3LF 1KC8C 2ICIA 2YV5A 3RN2A 3FVQA 4O1NA 5C4JH 4HSPA 5FKAC 1OTCA 3JC66 5GAGC 4NDXA 5EPKA 1E2VA 4DAPA 1I5FA 4RG1A 4GNXC 1Q46A 1C48A 4JK1C 5IODA 2AWOA 1H9RA 4B9WA 1CQVA 1S5CD 1PH6A 4CJ0B 2YYZA 3NELA 1Q90A 1VQFA 4KKUA 3KF8A 3WOFA 1Z7TA 1HTPA 3ER0A 3ULLA 1BO0A 2VUMG 4ZK9B 5C44G 1B1ZA 4GN3B 1KRTA 2F52A 1PFMA 2ZTEA 2JE6I 2KQ3A 2I5HA 1I50H 3GTKB 1HJPA 1VQNA 2TMPA 5CBEE 1X32A 5C4HA 1FR3A 2NWGA 2J0TD 3UDIA 2E2IB 3PUVA 4X3UA 1KRSA 2F3VA 3K5MA 4ZAIA 1YHBA 2Y0SG 1N36Q 2LXJA 2V4DA 1WCMG 1M90C 4QY7A 5ELNA 4FF4A 2LXKA 3RR5A 2KHIA 4HJ9A 1Y1VB 3M4QA 4QL5A 3L9AX 3EROA 1HHVA 1JR0D 1I4GA 4FDBA 1IZ6A
chains in the Genus database with same CATH topology
4IUTA 5EPLA 1PZJD 1F2MA 3NWSA 5D3DA 4CBVA 1EWHA 4CKEA 4PQXA 5D14A 4NW2A 2VUMB 2NVTB 1TS3A 2JYOA 2JSOA 2R6GA 1PFNA 2NVQB 4PMWA 2RA4A 4KY5A 1SBBB 3PMFA 1DZ1A 2KVMA 4DFAA 2HQEA 5CMDA 4K6DA 1K83B 4DNTB 1UUPA 1G2TA 3I72A 1QB5D 5FLXL 2ZT9C 3J80E 1STEA 1PRTB 5C0XJ 5JEAG 3DHQA 3GTPB 5I2YA 1EY5A 1CM9A 2D2CC 3FPUB 3I73A 2KOLA 2PQEA 5HGTA 2HUGA 3DMUA 3QWNA 1I4RA 4A3GB 1EU3A 3Q22A 2OT2A 1TWFB 5EKKA 1SFOB 4G7HC 2F03A 1EIHA 1T5XD 1SDFA 1PLFA 2X69A 1KNAA 4C2MB 4ID6A 2NVXB 2K28A 4DK1A 4FVMA 3OWFA 3BS1A 1EZ8A 1Y8OB 3H0GB 2CW0D 3I70A 2LS01 1HTLD 4ME5A 1F9PA 2HDLA 2PCFB 3VYRA 2QDBA 2B8GA 3ND9A 5EPJA 5JPNC 1S4ZA 3W3AA 3KK7A 1SSOA 2JP1A 3VYTA 3EVQA 4QF4A 3OMGA 1HQRD 2FMCA 2XIWA 1GUOA 4HMJA 1H9SA 1X3PA 4NP5A 5K36H 5JEAH 3MEHA 2SNSA 2JA7B 4DXGA 3Q24A 1U4LA 2F0GA 2K5DA 4RGNA 3P7JA 1O7YA 3GV3A 1RDPD 4H44C 1DCZA 4CGYB 1SNDA 3A8JE 3NBIA 1R4PB 5ELBA 2OEOA 3A8KE 1Z47A 2LKVA 3OHXC 1QILA 4QCLA 4DF7A 1XXGA 4H7BA 3DXJC 1F9RA 1IKMA 1HUMA 1VCIA 5DAUA 3RZOB 5CV4A 3QOJA 4FF3A 1OXSC 2BCOA 1I4XA 1MD2D 3BDLA 3KLSA 3RMHA 3BDCA 5EGTA 4DAVA 4KHVA 4WORA 4N9TA 2O5IC 2RSNA 1TVXA 5IGCA 1LT5D 5ELDA 2EYJA 3NTHA 1RODA 3T53B 1A2UA 5G3LD 3J81E 2F0FA 1DONA 2EDGA 4UAIA 3KBXA 2F1MA 1LTAD 5IT9L 1WTXA 1RTNA 5ISRA 1LTID 2K5QA 3NTKA 3DUZA 3J7YW 4QMGA 3VYSA 1V1OA 4YIJA 3TSSA 2Z1CA 5FK9C 4IQZA 3BVGA 5CORA 3HP3A 4FF1A 3H94A 5C3WA 3IAYA 1U4MA 3PO3B 1D1IA 3L7ZC 4WFN3 3GTQB 1EQTA 5E1FA 3K58A 2EJMA 1DJRD 2E2HB 3PUXA 1OXTA 3U9SA 4C1NI 1DXMA 2QILA 1EEID 1STGA 1ICWA 2ICEC 1STNA 4OGQC 1WD0A 1RHPA 2Z4HA 4X3SA 5COYA 5EJWA 4IFDJ 2BE5D 2F0KA 2XRSD 4RHSA 1ET9A 3Q6SA 3C1FA 2OXPA 2XWJB 3QOLA 4OO1I 5CC4A 1SXTA 1O7LA 4F7XA 2F0NA 2FINB 2CHBD 3C2PA 1IHZA 2F4IA 4PMCA 5KNDA 3FEWX 2G9DA 2EJFC 1XX8A 1ONLA 5CGKA 1U4PA 5C4XB 1ZEQX 4KN7C 2PO4A 3FDTA 2B2WC 4KD4A 2AUKA 2Q8IB 2BDNA 3GP7A 2QCPX 2WKDA 1GJXA 1WTRA 4ABNA 2R61A 1O7ZA 5C0XI 1FNUA 5F2DA 1DOKA 1EYDA 3TBIB 4XXEA 2RDFA 1Q12A 5M9OA 3TP7A 2GA4B 3VA5A 3Q23A 1BBXC 3WOEA 4FXDA 2WAQB 1JOOA 5EKIA 4RFBA 2NN6H 3S14B 5KEEA 3BG3A 1IL8A 5I9OA 2VNUD 2PW5A 1IW7D 2WB1B 3DEPA 4PNYA 1EIGA 2A6HD 4LAAA 5C0XG 2M9VA 1AW7A 3MA2B 4BS9A 4ZQ3A 1ML0D 1V1PA 1NCVA 3K0YA 1OXXK 2M00A 2SDFA 1SE3A 4LJZC 1J8IA 5NUCA 4V190 1I4HA 2BE5C 1PRTC 1EY9A 4A93B 3D6CA 2F0JA 4RHRA 2FMMA 1CA5A 2YU9B 1O78A 1HRJA 3NUCA 3K7AB 1G6ZA 1S5BD 3DWAA 3I8ZA 3SK8A 1WD1A 1PTOF 4DA2A 3L3OC 4MN3A 5K5PA 2EY2A 2PPBC 1EU4A 1CHPD 2KJXA 4DNRB 2BDOA 4E6IA 2ZXOA 1LTSD 2NZ1D 2NYZD 1W6KA 2L12A 1A3VA 1JC7A 3EFXD 2IWHA 5KNCA 4KJOA 3R93A 1OXVA 1EWCA 2A6HC 1JE4A 4OHJA 4KY7A 1Q1BA 3NBHA 1SE4A 4ULLA 1QOHA 2N55A 1A15A 1YNNC 2F0TA 3HKZB 2H4OA 2X6GA 3S15B 2L1BA 2K01A 4QB4A 4HAEA 3E5SA 3CKIB 4K2LA 2Z8LA 3S1NB 4LMQD 4WJWA 1KDCA 2VB3X 1II3A 4KI0A 4DN4M 3SK6A 4F8MA 5C44B 4FO2A 3SEBA 1KLGD 3T16A 1C8CA 3MWYW 5DM63 1VF7A 4TRDA 4ZLTF 1SYDA 3AU7A 5CYUA 4X3TA 2R92B 1LT6D 2A6ED 5E4XA 1ENAA 2F3WA 1W6JA 4ZYSA 3SDZA 4OIKA 2NTSA 2B2WA 1I6HB 1EYAA 3KLRA 2EYLA 4NKLA 4R9WA 1D6EC 4C3JB 3RLFA 5C4ZA 3JAME 1C4QA 1K8OA 4IN3A 1WTQA 4MIUA 4EGVA 1PTOD 3KBGA 3BDOA 4KHZA 3MAQA 3QJYA 1VMPA 3AB9A 5EKLA 3H09A 3OW7A 3J80L 1B9MA 3NWTA 1SNMA 3NP8A 3GTMB 4RAUC 1A3UA 3FKIB 1EY0A 2EYPA 1R4QB 1EYCA 5IGDA 3T56B 4IALA 3DEOA 1L0YB 1TWAB 2RDHA 1HQMC 2JA5B 2AQ1B 2NBFA 1I4QA 4R8NA 1FYCA 1KNEA 4K5XA 1IYVA 1B44D 1ZYRC 4J8QA 2L4NA 3HG9A 3A55A 4OO1G 5CV7A 1RJTA 4IUUA 3OOCA 4TSSA 3MZ5A 3PV0A 2DN8A 2EPBA 1HFNA 1ET6A 2SOBA 3P1HA 2X6LA 5CBAE 2A74C 4ILWA 3K5LA 3CRLC 4BA1I 1B4OA 3SK5A 1CA6A 1D5XC 2A73B 2AWNA 2K33A 5M3FB 2IJ0A 1PTOB 1LTGD 3PUWA 2BA1A 2RQXA 1AEXA 2B2UC 4A3KB 2XWBB 2RBMA 2NTTA 4RKBA 1DOMA 1JOKA 1B3AA 1Y69U 4G4KA 2EYFA 1ZYRD 3R8BA 4RH6A 5LL6X 4DXFA 3BVZA 5C0XH 1BCPC 3NQTA 2F0MA 4NMZA 5C6AA 4WRDA 2MHVA 1NSNS 2JXMB 4K8IA 5TSSA 4EQOA 4XT1B 5EBCA 3M3YB 2K7VA 2K6AA 4ZKBB 3GO5A 3D4DA 1G91A 3SVMA 1Q1EA 4DAYA 4A3IB 1Y1WB 4HTHA 1SAPA 1WTVA 1EL0A 2HCIA 3PUZA 3QG1A 1QNKA 3TZUA 4XQQA 5EQ0A 1I4PA 1F9QA 5KNBA 1SNQA 1KAAA 5DNFA 3WDNA 3GTGB 1ILQA 1EQVA 4FXKC 5A2QL 1GXDC 2JEAI 1JWSD 3A7LA 3ND8A 1U4RA 4KKSA 2BA0A 1TY2A 1E2WA 2RVLA 1M8AA 2R93B 2TSSA 4RCOA 4EVOA 4M8AA 2EY6A 3TMEA 1OXUA 2DY7A 1KABA 5C3EB 1D1KA 1CI3M 3HOYB 1PXUA 4CKCA 1MGSA 2MGSA 1H9JA 1Y8NB 2WIIB 1CQFA 3HGBA 5J22A 5JEAJ 1BR9A 3BZDB 1BCPB 3PIO3 2F0EA 3NXWA 3D31A 4FF2A 3MVVA 4QUCA 2FFKB 5K36G 3OMCA 1JB3A 3E6ZX 2XNAC 4ODGA 2K05A 2C5CA 1BQQT 2B2VA 4IZ8A 2R7ZB 1R9TB 4TQUS 2E75C 2WINB 1H9SB 2ENBA 1S5FD 3R2IA 4L63B 1TS4A 4S3SA 1TWCB 3HOUB 1DOLA 3EA6A 1WTOA 2KEDA 3FMCA 2D9UA 2QF7A 4G7ZC 5JAVA 2C9OA 4C3HG 5T1IA 3J7AF 2B2YA 2F0DA 5HURA 1XTCD 4CHTB 3T13A 3RZDB 1NUCA 4OL7A 4HR7B 1IKLA 5LHY1 5C5LA 2XVSA 1ILPA 4OO1H 2PMZB 3A54A 5M5YB 2FJ2A 1TS5A 1AP0A 4DK0A 1B50A 1X3QA 1O80A 3IL8A 3MXGA 1U9RA 5IGEA 1HXYD 2ID0A 4FP5D 1NR4A 4IUQA 1EEFD 3MFGA 3J81L 1EZ6A 5ELFA 3P20A 2K5WA 4G7OC 1LV9A 4I65A 4XYOA 2MPMA 1WTWA 1AZQA 2E2JB 1ESRA 1HA6A 1MSHA 3AMUA 2F0LA 1TWHB 1SYEA 3PIP3 3HOZB 1F2LA 5ELCA 3GTOB 4IUVA 3SR1A 4R8IA 3S2HB 3IFDA 3HS0C 5IOCA 1SEBD 3S16B 4KTAA 3OWEB 5DM73 4J1MA 5KYLA 1WVLA 5I6YA 1IW7C 2Z4IA 4ZRZA 3GD7A 2H1EA 1EY4A 1H9KA 1PTOC 1YNJD 1LACA 3J7AV 1BCPD 1RCVD 2NUCA 4CKBA 3OIQA 2OF1A 2IL8A 2JEBI 1JOQA 5KGUA 3M7NA 3TN2A 5I2XA 3X3NA 3ITPA 1PDQA 3MHBA 1EY8A 3NTIA 1QG7A 2XRQD 3S1MB 2O5JC 2KHSA 1QE6A 4IUNA 1STHA 4RGMA 4BY7B 2IPKD 1G291 3QIAA 1MBYA 3D3RA 3M4YA 2NN6G 2XN9C 1F2YA 4F87A 1LT3D 4B9XA 3SHLA 2AUJD 5E4WC 4HEDA 4C3IG 1TY0A 2F0UA 2EYOA 1SMYC 1QJOA 2D5DA 4RCNA 5C3XA 2M2LA 2F0VA 4Q0FA 1LTBD 1SYGA 3GV6A 3PUYA 2LFNA 2D62A 3M4OB 5T1GA 1G8ZD 3HEJA 3OIPA 4O42A 4IFDG 1JCKB 1BOSA 1KLUD 1VMCA 2MP1A 5JOBA 1TWGB 3K5OA 3IFTA 2KCNA 5JJZA 2O2LD 1UNSA 2F0QA 3U9OA 2EY1A 4J6HA 1GHJA 5A35A 3VR2A 1BXTA 3EJIA 3R2TA 4A3EB 1PRTF 2A68D 3SXHA 4KJNA 4DU9A 2E76C 4B08A 1AN8A 1BCPF 3M85A 3VR4A 1V1PB 1TIID 2F0OA 3TDQA 5BN4A 2KCCA 4UDUC 2B39A 5KYIA 3JAML 5CV9A 4IUPA 3LWEA 4K8JA 5BN5A 3VYUA 2CQAA 1KDAA 3RUZA 2AQ3B 3V2TA 3ZYYX 3O13A 1SYFA 2KUMA 2RDGA 4A3DB 2J7ZA 3SK4A 3VR3A 2L0CA 1RF2D 4BWGB 4RKLA 3MXUA 3F2UA 5KRUA 3M7GA 3TP8A 3ONAB 3URYA 5AFWA 4KK7A 1B9NA 4L6TB 4H0LC 3OSOA 4RGOS 3HOVB 4A3JB 2JA8B 2EY5A 1HCZA 1HUNA 4K5VA 4Y7NB 4XIGS 4P2CB 3Q0AA 1SJHD 4KN4C 4KY6A 3PO2B 4K2KA 1T5EA 2SEBD 1PTOH 5J1ZA 1XWEA 2O4XA 2L11A 3GTJB 3A7AB 4KV6A 2FHTA 4A3BB 3H6MA 1EY6A 3G7LA 1LTTD 5FO7B 5J39A 2Y0SB 3NE5B 4XQJA 1PYWD 2F0PA 1HA5A 5JVG3 2B2YC 3V96A 1BF4A 3MFYA 3I4MB 5C4JB 4TKOB 5KIXA 4BY1B 1ZXTA 2EVBA 1CTMA 1HPCA 2XSCA 1UEAB 2QKIC 4MHEA 2PZTA 3E0JA 1J9OA 2B2TA 3BVMA 1E0BA 1MSGA 2A69C 1OO9B 3D4WA 2AQ2B 1FNWA 1M4VA 1AFPA 5FLXE 2B2UA 1GUWA 1E2ZA 3D4RA 3GQBA 3S1RB 1B2TA 1GOZA 3I4NB 1ESFA 1B53A 4IFDH 2B63B 3DM1A 1D2BA 2F0HA 3W2DA 1GUSA 3R3OA 4ZUIA 4Q5VA 2RSOA 1S5DD 1QCBD 1SJED 4K5WA 3CU7A 5IGFA 5M5XB 1FNVA 4XT3B 3C46A 5CV6A 1F77A 4BBSB 2EZVA 3T51B 1F9SA 2L55A 2EE1A 3S9WA 3UI2A 3N52A 3V05A 1PFBA 1XYIA 1RD9D 4PMBA 2I46A 5DEHA 4U673 4HCEA 1F2ZA 4L8JA 4KD3A 4M1UB 1YNND 2VB2X 2WV6D 2NB0A 5IGGA 2JA6B 4C3HB 3VA7A 4RGTA 1LTRD 1UAPA 3TP6A 3HOXB 2L9HA 4C56C 5IT9E 2F0SA 1EY7A 2WKCA 1DYQA 2KEEA 3RD4A 1SYBA 4KMUC 5A2QE 2PYKA 4AYBB 2G9HD 3NHHA 5BN3A 3H3VC 1DD2A 1FGBD 1EOTA 1VF5C 3CRKC 5CR3A 3K57A 1D5MC 2VXWA 1D5ZC 3K5NA 3T4AC 2E2DC 2PZUA 3NQIA 4C3IB 2IT1A 5I6WA 5JVH3 3TZDA 1TQOA 1I6VC 2BOSA 3N6RA 4OIJA 3P75A 2A68C 2I07B 1PRTD 1A2TA 1SNCA 4A3MB 2SNMA 3DWPA 4FXGC 2Q8TA 1GUTA 1LT4D 1Y8PB 2DNCA 5CV8A 5D3IB 2E74C 3G6JB 2NVYB 1TR5A 4A3FB 1VDZA 4C1NK 4FYDA 1LLRD 2B2TC 1PZID 1Q3LA 4K14A 3BYYB 3HZXA 4ZKCB 3MXPA 3QB3A 2DNEA 3I90A 1A3TA 2IX3A 1CZGA 5JPMC 2K03A 3HRZC 3NSWA 4HN7A 4EQNA 1BDOA 1ZKOA 1RKNA 3K6OA 3LX0A 1TT2A 3QO2A 4XYQA 1SMYD 2WACA 1ENFA 2IW3A 1EFID 5ELEA 1I3QB 2DY8A 1CHQD 5I4DA 3K59A 4K6LA 4V0BA 3H91A 1JICA 2QEJC 1I50B 1STYA 3DWQA 1CK1A 1HFGA 4F88A 1QNUA 2PW7A 2NN6I 4X3KA 5D65A 3VR5A 5FO9B 5M3MB 2A6EC 3S17B 1KTKA 3MC0B 4DGZA 1DM0B 4IURA 4I7ZC 2EYHA 3HOWB 4KKTA 3MTSA 5E3FA 3NK9A 4RWSC 1JWMD 4RA8A 2IX0A 3TP5A 2HDMA 1FD7D 3KUPA 2N88A 3D8GA 3A56A 1K8MA 1TKWB 3KLSX 2CVRA 1YNJC 3EQLC 2ZXRA 1PMRA 3D6WA 2ZXPA 4HCSA 4QUFA 5FOBB 4IFDI 1LABA 1Z6HA 2F0WA 1KDBA 2K32A 3FRPB 5IGBA 5M5WB 2MUYA 4CJ1B 1Q8IA 3FPPA 5CV5A 4CJ2C 2CW0C 1JQYD 2J4XA 4XQNA 3VR6A 4C3JG 1NR2A 1GUGA 1JORA 3C1EA 1H9MA 4G57A 2RKSA 1S5ED 2LMCB 2EYMA 1V43A 2KA7A 2EOTA 3X3MA 1L0XB 2EJGC 3IKJA 5EBDA 1GUNA 4BA2I 3I91A 4XTCS 4JBWA 3I4LA 1SNOA 3GTLB 2F0IA 2IX1A 3LNNA 2EXZA 5IIFA 1RTOA 1BNZA 4N9PA 4FNFA 4XDXA 1CZWA 1STBA 4HSVA 4U68A 2PZWA 4GZYC 3ERQA 1IYUA 2LY7A 2B8FA 3OPOA 1ENCA 2B2VC 3NPPA 1TU2B 2MJ8A 1CT1D 5I9PA 1SE2A 1AZPA 1NAPA 1MI2A 3C3LA 3MXNA 1GHKA 4HMIA 1TS2A 1CFMA 2A69D 2KECA 2WP8J 2K04A 1V8QA 1JWUD 2L5TA 4BBRB 2PNRC 4QIWB 3I3CA 2Q8RE 1BUVT 4Z9CB 1STAA 5C5MA 1A6XA 1LO5D 1PZKD 3BYTB 4LK1C 3CQZB 3LWUA 1WCMB 1SNPA 3A8IE 4EQPA 4PV1C 2A5HA 2HCCA 1WTPA 1SYCA 3S2DB 4H13C 5FO8B 4ZUJA 1QWYA 3CHBD 2R3ZA 2K1BA 3S1QB 3SE0A 1G2SA 5LL6S 5G3LF 2ICIA 3FVQA 4O1NA 4HSPA 5FKAC 4NDXA 5EPKA 1E2VA 4DAPA 1C48A 4JK1C 5IODA 2AWOA 1H9RA 4B9WA 1CQVA 1S5CD 4CJ0B 2YYZA 1Q90A 3WOFA 4KKUA 3KF8A 1Z7TA 1HTPA 1BO0A 4ZK9B 1B1ZA 1PFMA 2JE6I 2KQ3A 3GTKB 2TMPA 5CBEE 1X32A 5C4HA 1FR3A 2NWGA 2J0TD 2E2IB 3PUVA 4X3UA 2F3VA 3K5MA 4ZAIA 2V4DA 4FF4A 1Y1VB 3L9AX 3EROA 1HHVA 1JR0D 1I4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9P A;  3P1H A;  3QOJ A;  5CV4 A;  2NUC A;  1KDC A;  3SXH A;  4KJN A;  1II3 A;  3S9W A;  2OF1 A;  3TP5 A;  4DU9 A;  4ID6 A;  5NUC A;  3SK6 A;  5CV8 A;  4F8M A;  5JAV A;  3BDL A;  5KGU A;  1JOQ A;  2F0K A;  5J1Z A;  1F2M A;  1TR5 A;  2F0D A;  4HMI A;  5HUR A;  3D8G A;  1EY9 A;  3OWF A;  3T16 A;  3D6C A;  4PMB A;  3C1F A;  3BDC A;  5EGT A;  3T13 A;  3SK5 A;  5DEH A;  1NUC A;  3ITP A;  4OL7 A;  2O4X A;  3MHB A;  4KHV A;  4TRD A;  1EY8 A;  1F2Z A;  2F0J A;  2OXP A;  3QOL A;  4K14 A;  1SYD A;  4WOR A;  5C5L A;  4KD3 A;  4N9T A;  4KV6 A;  4EVO A;  5CC4 A;  2EY6 A;  1EZ8 A;  3TME A;  3HZX A;  4F7X A;  2F0O A;  2F0N A;  3MXP A;  1KAB A;  3H6M A;  1STA A;  1EY6 A;  1AEX A;  3QB3 A;  5C5M A;  1IHZ A;  3NUC A;  5KYI A;  5IGG A;  2RBM A;  1A3T A;  1ENA A;  2F3W A;  2KHS A;  4ME5 A;  5CV9 A;  5IGC A;  4PMC A;  2F0W A;  4RKB A;  1SNP A;  1KDB A;  4IUN A;  1JOK A;  1STH A;  1EYA A;  4EQN A;  4EQP A;  5J39 A;  2EYL A;  4NKL A;  5IGB A;  1U9R A;  5IGE A;  4K8J A;  1RKN A;  2F0P A;  2QDB A;  3SK8 A;  5CGK A;  2EYF A;  2EYJ A;  1SYC A;  3LX0 A;  3TP6 A;  5C4Z A;  1TT2 A;  1KDA A;  1A2U A;  5CV5 A;  4KY5 A;  4KD4 A;  3PMF A;  2WAC A;  3RUZ A;  4ZUJ A;  3V2T A;  2F0S A;  5K5P A;  1SYF A;  2F0F A;  1F2Y A;  2EY2 A;  5J22 A;  1EY7 A;  4MIU A;  4B9X A;  3SHL A;  3SK4 A;  5KIX A;  4E6I A;  4DFA A;  5EKL A;  2HQE A;  3EVQ A;  3NQT A;  4RKL A;  1EZ6 A;  1SYB A;  1JOR A;  3C1E A;  2F0M A;  2PZT A;  4K6D A;  2PYK A;  2F0E A;  3OMG A;  4QF4 A;  4NMZ A;  2F0U A;  5C6A A;  4WRD A;  5ISR A;  5KRU A;  4G57 A;  1SNM A;  3NHH A;  2RKS A;  1A3V A;  1NSN S;  2EYO A;  3NP8 A;  3NXW A;  1A3U A;  4K8I A;  4NDX A;  5F2D A;  4QMG A;  3TP8 A;  4EQO A;  1EY0 A;  1STY A;  1EYD A;  2EYM A;  4KJO A;  3MVV A;  5C3X A;  2F0V A;  4HMJ A;  2EYP A;  3D4W A;  4YIJ A;  4I65 A;  1SYG A;  3DHQ A;  5CR3 A;  5IOD A;  4B9W A;  2RDF A;  1EYC A;  3D4D A;  5IGD A;  4NP5 A;  5M9O A;  3OMC A;  3TP7 A;  4KY7 A;  3MEH A;  2SNS A;  4IAL A;  3VA5 A;  2PW7 A;  1EY5 A;  1SNO A;  2F0L A;  3HEJ A;  4ODG A;  1JOO A;  1SYE A;  5C3W A;  2PZU A;  2F0I A;  4HTH A;  2F0G A;  2PQE A;  5I6W A;  2EXZ A;  5IIF A;  3OSO A;  5KEE A;  5HGT A;  2KQ3 A;  1TQO A;  4IZ8 A;  3SR1 A;  2EY5 A;  2F0T A;  3DMU A;  4R8N A;  4N9P A;  5E1F A;  5C4H A;  5IOC A;  4K5V A;  5I9O A;  2PW5 A;  4K5X A;  4KTA A;  5JOB A;  2F0H A;  1STB A;  4DGZ A;  1SND A;  2F3V A;  1SNQ A;  3R3O A;  1KAA A;  4PNY A;  4J1M A;  4ZUI A;  3P75 A;  4LAA A;  5KYL A;  2ENB A;  5I6Y A;  4QB4 A;  2PZW A;  5EKK A;  2F0Q A;  3U9O A;  2OEO A;  3E5S A;  3ERQ A;  2EY1 A;  4J6H A;  2EYH A;  4K5W A;  2LKV A;  5CV7 A;  4ZQ3 A;  4DF7 A;  5IGF A;  1EQV A;  1STG A;  3EJI A;  1A2T A;  4KY6 A;  1SNC A;  5E3F A;  1ENC A;  3NK9 A;  3MZ5 A;  1EY4 A;  4H7B A;  1STN A;  4K2L A;  4S3S A;  2M00 A;  3ERO A;  5CV6 A;  2SNM A;  4K2K A;  2SOB A;  5DAU A; 
#chains in the Genus database with same CATH topology
 1IBK Q;  4IUT A;  5EPL A;  1PZJ D;  2A8V A;  4I7A A;  1F2M A;  3NWS A;  5D3D A;  4CBV A;  4DV2 Q;  1KAW A;  1EWH A;  4LUV A;  4CKE A;  1VQ6 A;  2PQA B;  5M3M H;  3K7A H;  4PQX A;  4GNX B;  3MXN B;  3G4S A;  1JMC A;  5D14 A;  3HOV G;  3PSI A;  4NW2 A;  1J5E L;  2VUM B;  4PG3 A;  1QUQ B;  5IP7 G;  2NVQ H;  1TS3 A;  4LF4 L;  2NVT B;  2JYO A;  2JSO A;  3CCR A;  4R4C A;  2R6G A;  4GKK L;  1PFN A;  5BR8 L;  2NVT H;  4DR2 L;  2NVQ B;  3K8A A;  4PMW A;  2RA4 A;  4KY5 A;  1SBB B;  3PMF A;  1K8A C;  4JI5 L;  3WWV A;  2H5X A;  1DZ1 A;  4LF7 L;  3PO2 G;  2HHH L;  2KVM A;  4DFA A;  2HQE A;  1U0L A;  5CMD A;  3DLL A;  4K6D A;  2ZJP A;  1K83 B;  4DNT B;  1UUP A;  1G2T A;  3I72 A;  1QB5 D;  2L15 A;  1JJC B;  5FLX L;  2ZT9 C;  3J80 E;  1STE A;  3J80 c;  1PRT B;  4OXP A;  4X65 L;  3G71 A;  4JI7 L;  5C0X J;  5JEA G;  4IJH A;  3DHQ A;  3GTP B;  5I2Y A;  1EY5 A;  4AQY L;  3T1Y Q;  1CM9 A;  2D2C C;  3FPU B;  3I73 A;  4PZ8 A;  4LFA L;  2KOL A;  2PQE A;  4B3T Q;  5HGT A;  4A3K G;  2HUG A;  3DMU A;  4OEL B;  2VQE L;  3QWN A;  1I4R A;  5M3F G;  3ERS X;  1I94 Q;  3CMA A;  4A3G B;  1EU3 A;  3Q22 A;  2OT2 A;  1TWF B;  1VS0 A;  5EKK A;  3TRZ A;  4PZ7 A;  5GAH C;  4AYB E;  1SFO B;  4G7H C;  2F03 A;  1EIH A;  1T5X D;  2MNA A;  1SDF A;  1PLF A;  2X69 A;  1KNA A;  4A3D H;  1S72 A;  4DR7 L;  4C2M B;  4GLA C;  4JPB W;  2RF4 A;  4ID6 A;  2NVX B;  2K28 A;  4DK1 A;  1CKN A;  4FVM A;  3OWF A;  4X64 Q;  3BS1 A;  3AQQ A;  2B63 G;  1EZ8 A;  1EIF A;  1Y8O B;  1N36 L;  3H0G B;  1XMO Q;  2CW0 D;  2OTL A;  3I70 A;  1VQG A;  2LS0 1;  1HTL D;  4ME5 A;  1FVI A;  3HOV H;  1NNX A;  1F9P A;  2HDL A;  2PCF B;  1YBY A;  3VYR A;  5IP7 H;  2QDB A;  2B8G A;  3ND9 A;  5EPJ A;  5JPN C;  1N33 Q;  1S4Z A;  3W3A A;  3PF4 A;  3KK7 A;  3EN2 A;  3CAM A;  4A3J G;  1XPO A;  1SSO A;  4DR5 L;  2JP1 A;  3VYT A;  3EVQ A;  1WOC A;  4QF4 A;  1YHA A;  3OMG A;  2PQA A;  1XMQ Q;  1HQR D;  2FMC A;  2IY5 B;  4DV3 Q;  4HIO A;  2XIW A;  1GUO A;  4HJ7 A;  2R7D A;  4HMJ A;  4NXM Q;  1H9S A;  1X3P A;  4NP5 A;  5K36 H;  2CCZ A;  4LF5 Q;  5JEA H;  3MEH A;  2SNS A;  5LMN W;  4KHP Q;  2JA7 B;  4DXG A;  5M5Y H;  3Q24 A;  4EQ5 A;  1U4L A;  2F0G A;  4A93 H;  2UUA Q;  2K5D A;  4RGN A;  3P7J A;  1O7Y A;  3GV3 A;  1RDP D;  4OX9 Q;  4UY8 C;  4H44 C;  1DCZ A;  4CGY B;  1SND A;  3A8J E;  3NBI A;  1R4P B;  5ELB A;  4JBM A;  2OEO A;  1W3S A;  3A8K E;  1Z47 A;  2LKV A;  1EQQ A;  3OHX C;  1QIL A;  2K14 A;  4DF7 A;  4QCL A;  1XXG A;  5FLM H;  2NVY H;  3UE0 A;  4H7B A;  3DXJ C;  1F9R A;  1IKM A;  4R1J A;  4OEM B;  1VQ7 A;  1HUM A;  4YY3 L;  1VCI A;  5DAU A;  3RZO B;  3I7F A;  5CV4 A;  3QOJ A;  4FF3 A;  1OXS C;  2BCO A;  1I4X A;  1MD2 D;  3BDL A;  1UE7 A;  3KLS A;  4HIK A;  4DV0 Q;  3J7A 5;  1I3Q H;  3RMH A;  3BDC A;  5EGT A;  3LGJ A;  4JG2 A;  3RLO A;  4DAV A;  4KHV A;  4WOR A;  4N9T A;  1NY4 A;  2XGT A;  2O5I C;  2RSN A;  4LW1 A;  4EX5 A;  1P16 A;  4DR1 L;  5H1S E;  4CDD C;  1C0A A;  1TVX A;  5IGC A;  3UDG A;  1LT5 D;  5ELD A;  4MZ9 A;  4X62 Q;  2EYJ A;  3NTH A;  1ROD A;  3T53 B;  1KXL A;  1A2U A;  5G3L D;  3J81 E;  3UDF A;  4UP9 A;  4GOP C;  2WAQ E;  2F0F A;  1DON A;  2EDG A;  1YI2 A;  5M5W H;  3I4N G;  4UAI A;  1CSQ A;  3KBX A;  2F1M A;  3U58 A;  1LTA D;  4LF9 L;  5IT9 L;  1WTX A;  1RTN A;  1A63 A;  5ISR A;  1LTI D;  2K5Q A;  3NTK A;  4ALP A;  1SR3 A;  4JI3 L;  3DUZ A;  3J7Y W;  2V1C C;  4QMG A;  3VYS A;  1V1O A;  2DUD A;  1K9M C;  4YIJ A;  3J81 c;  3TSS A;  2Z1C A;  5FK9 C;  5FJ8 H;  2VS1 A;  4IQZ A;  3BVG A;  5COR A;  3HP3 A;  3PCO B;  5ELO A;  4FF1 A;  3H94 A;  2ALY B;  5C3W A;  3IAY A;  3S2D H;  1EFW A;  1U4M A;  2VL6 A;  3PO3 B;  4YHH L;  1D1I A;  2G5D A;  2LSS A;  2VZA A;  3HOY G;  1K8G A;  5FLX c;  3L7Z C;  4WFN 3;  3GTQ B;  1EQT A;  2CKZ B;  1X56 A;  1QUQ A;  5E1F A;  3K58 A;  2ZJQ A;  4DUY L;  2EJM A;  1DJR D;  2E2H B;  3PUX A;  1OXT A;  3U9S A;  4C1N I;  1N34 Q;  4JYA L;  1L0W A;  1DXM A;  2QIL A;  3AFQ A;  1EEI D;  1STG A;  1ICW A;  2ICE C;  2R7Z H;  1STN A;  4OGQ C;  2Z6K C;  1WD0 A;  1RHP A;  2Z4H A;  2HIX A;  4X3S A;  3K80 C;  3I56 A;  4HID A;  5COY A;  3KOJ A;  1ASZ A;  5EJW A;  1BVS A;  4IFD J;  1EIY B;  2BE5 D;  1KHI A;  1JB7 A;  1HR0 Q;  2F0K A;  2XRS D;  4A3K H;  4RHS A;  1ET9 A;  3Q6S A;  1L1O C;  3C1F A;  1R9T H;  2JA9 A;  1HNZ Q;  1AE2 A;  4GN4 B;  2OXP A;  2XWJ B;  3QOL A;  3W1G A;  4OO1 I;  5CC4 A;  1SXT A;  2UXC L;  1O7L A;  4F7X A;  2F0N A;  4YWL A;  2FIN B;  5LMN Q;  4CDC C;  2CHB D;  3C2P A;  1BBW A;  1IHZ A;  2F4I A;  1X54 A;  3HOW G;  2VQF L;  4PMC A;  5KND A;  3RZD H;  3FEW X;  4LFB Q;  1CSP A;  2G9D A;  1IXR A;  2EJF C;  2WAQ G;  1XX8 A;  1ONL A;  5CGK A;  3GTL H;  1U4P A;  5C4X B;  1CKM A;  1ZEQ X;  1E3P A;  5C3E H;  4KN7 C;  4LF8 L;  2PO4 A;  3FDT A;  4HJA A;  2OWO A;  2B2W C;  4KD4 A;  2AUK A;  2Q8I B;  3IRB A;  2BDN A;  3GP7 A;  2QCP X;  2WKD A;  1GJX A;  1WTR A;  4A3J H;  4ABN A;  2OTJ A;  2R61 A;  1O7Z A;  4JV5 L;  5C0X I;  1FNU A;  1HZC A;  1YVC A;  2EIF A;  5F2D A;  1DOK A;  4A3D G;  1EYD A;  3TBI B;  4YY3 Q;  2YTX A;  1VQP A;  2B29 A;  4XXE A;  2JK8 A;  2RDF A;  1QVF A;  1Q12 A;  5M9O A;  3TP7 A;  2GA4 B;  3I2Z A;  4R4Q A;  3VA5 A;  2JQO A;  3Q23 A;  1BBX C;  3WOE A;  4FXD A;  2WAQ B;  1JOO A;  5EKI A;  5FJ8 G;  4JI8 Q;  4JI7 Q;  4RFB A;  5IYC G;  2NN6 H;  3S14 B;  3J81 j;  5KEE A;  3BG3 A;  4OON A;  4B3T L;  1IL8 A;  5GAD C;  4GOP B;  5I9O A;  2VNU D;  2PW5 A;  2GVB A;  4DUZ Q;  1IW7 D;  5AJ3 L;  4LUO A;  2WB1 B;  3DEP A;  3STB C;  1XTD A;  4PNY A;  1TWH H;  5LMN L;  1EIG A;  2A6H D;  4LAA A;  5C0X G;  2M9V A;  1AW7 A;  3MA2 B;  4BS9 A;  1IBM L;  4ZQ3 A;  1ML0 D;  1V1P A;  1XPU A;  1NCV A;  3KJO A;  2JN4 A;  3K0Y A;  4LF6 Q;  1OXX K;  4DR2 Q;  2M00 A;  3F8T A;  2SDF A;  1SE3 A;  4A3G H;  4LJZ C;  3KLW A;  1M1K C;  1J8I A;  2UU9 L;  3A0J A;  2N3S A;  4DR3 Q;  1VQD A;  5NUC A;  1PH1 A;  3BU2 A;  4POF A;  4V19 0;  3S1Q H;  1I4H A;  2Q2T A;  2BE5 C;  1PRT C;  2UUC L;  1EY9 A;  4A93 B;  1X6O A;  3D6C A;  3S16 H;  4JCV E;  2RHS B;  2F0J A;  3AEV A;  4RHR A;  1VQJ A;  1B70 B;  2FMM A;  1CA5 A;  2I5M X;  2YU9 B;  5IP9 H;  1O78 A;  1HRJ A;  3NUC A;  3K7A B;  1G6Z A;  1S5B D;  4QQB X;  3DWA A;  3I8Z A;  3SK8 A;  1WD1 A;  1PTO F;  1SLJ A;  4DA2 A;  3L3O C;  4MN3 A;  4JI1 L;  1GO3 E;  5K5P A;  2EY2 A;  2PPB C;  4WJ3 M;  3HKZ G;  4PZ6 A;  1EU4 A;  1CHP D;  2KJX A;  4DNR B;  1XMQ L;  2BDO A;  4E6I A;  2ZXO A;  1LTS D;  3PO3 G;  3A5Z B;  2NZ1 D;  3T1H Q;  1D7Q A;  1PH2 A;  2NYZ D;  1W6K A;  2KCM A;  1UE5 A;  2L12 A;  1A3V A;  1JC7 A;  3EFX D;  2IWH A;  5KNC A;  4KJO A;  3S24 A;  3BZK A;  3R93 A;  1OXV A;  3FHW A;  1EWC A;  2PMZ E;  2A6H C;  1JE4 A;  4OHJ A;  3CCJ A;  4KY7 A;  2QGQ A;  1Q1B A;  2Z0S A;  3NBH A;  4UP8 A;  1SE4 A;  1K28 A;  3KDF A;  4ULL A;  3CF5 A;  4OWW B;  1UE1 A;  1QOH A;  2N55 A;  3CP0 A;  1A15 A;  3I4M G;  1YNN C;  2F0T A;  3HKZ B;  2VQE Q;  2H4O A;  1JT8 A;  2X6G A;  4N8X 1;  5GAE C;  1XNQ Q;  3S15 B;  2L1B A;  2K01 A;  3RNU A;  3S2H H;  4QB4 A;  4HAE A;  1NJI C;  3E5S A;  4J15 A;  5HGQ A;  1HZ9 A;  3CKI B;  3CW2 C;  2ASB A;  4K2L A;  2Z8L A;  3S1N B;  4LMQ D;  1AH9 A;  4WJW A;  4BBS G;  1Q81 C;  3KFU A;  1KDC A;  1RIP A;  2VB3 X;  1II3 A;  4KI0 A;  4DN4 M;  3BJU A;  3SK6 A;  4F8M A;  3HOY H;  3CC2 A;  5C44 B;  4FO2 A;  3SEB A;  1GD7 A;  1KLG D;  2VUM H;  3T16 A;  3KF6 A;  1S3O A;  1C8C A;  3MWY W;  5DM6 3;  1VF7 A;  4TRD A;  4ZLT F;  4JBJ A;  1SYD A;  3AU7 A;  5CYU A;  4DR4 Q;  4X3T A;  2R92 B;  3E9I A;  1HZA A;  1LT6 D;  2A6E D;  5E4X A;  4P72 A;  1N32 L;  1H95 A;  1ENA A;  2F3W A;  1W6J A;  3SDZ A;  4ZYS A;  4OIK A;  3F2D A;  2NTS A;  2B2W A;  4AQY Q;  3T1Y L;  2E2J H;  1I6H B;  3HKZ E;  4JOI A;  1EYA A;  3KLR A;  2EYL A;  4NKL A;  4R9W A;  3TS0 A;  1D6E C;  4C3J B;  3RLF A;  3CCV A;  2K5N A;  5C4Z A;  3JAM E;  1C4Q A;  1K8O A;  2GVA A;  4IN3 A;  1WTQ A;  4MIU A;  4A3E G;  1PHJ A;  2PI2 E;  4EGV A;  1PTO D;  3KBG A;  3BDO A;  4KHZ A;  5JJI A;  3MAQ A;  2MFI A;  1IL2 A;  3QJY A;  1VMP A;  3AB9 A;  5EKL A;  4DV2 L;  4GKK Q;  3H09 A;  3OW7 A;  3J80 L;  4IOA A;  1B9M A;  4QJF A;  2ATW A;  3NWT A;  4ZCK A;  1SNM A;  3NP8 A;  4RAU C;  1A3U A;  3FKI B;  3W5O A;  3GTM B;  1EY0 A;  3K0X A;  2EYP A;  1EOV A;  5M3M G;  2HD3 A;  3CME A;  1TXY A;  1R4Q B;  1EYC A;  3FP9 A;  3T56 B;  5IGD A;  4IAL A;  4BY1 H;  3DEO A;  1L0Y B;  1TWA B;  2RDH A;  1HQM C;  1IBL Q;  2JA5 B;  2AQ1 B;  4C3H H;  2NBF A;  1I4Q A;  4R8N A;  1YEZ A;  1FYC A;  1KNE A;  4K5X A;  3ULP A;  1IYV A;  1HNW Q;  4UP7 A;  3CCE A;  1B44 D;  1ZYR C;  4J8Q A;  2L4N A;  2HIV A;  4AYB G;  1XMO L;  3HOW H;  3HG9 A;  5DLQ E;  3A55 A;  4OO1 G;  5CV7 A;  1J6Q A;  1RJT A;  3STB D;  4IUU A;  3OOC A;  4TSS A;  3MZ5 A;  2ZTD A;  3PV0 A;  4Y7N H;  2DN8 A;  2EPB A;  2VW9 A;  1HFN A;  1ET6 A;  2SOB A;  4LFC L;  3P1H A;  2X6L A;  2ZM6 Q;  5CBA E;  1L1O A;  2A74 C;  4ILW A;  3K5L A;  4BY7 G;  3CRL C;  4BA1 I;  4LFB L;  4QGU A;  1B4O A;  3SK5 A;  1CA6 A;  1D5X C;  2A73 B;  2AWN A;  2E2H H;  2K33 A;  5M3F B;  2IJ0 A;  1PTO B;  1LTG D;  2JA8 G;  1PYS B;  3PUW A;  2BA1 A;  2GN5 A;  2RQX A;  4A3F G;  1AEX A;  2B2U C;  4A3K B;  4X66 Q;  2XWB B;  2RBM A;  2NTT A;  4GOP A;  4RKB A;  1DOM A;  1JOK A;  3M4O H;  4A3I G;  4A3G G;  3CPF A;  1B3A A;  1Y69 U;  4G4K A;  2EYF A;  1O7I A;  1ZYR D;  3R8B A;  4DKA C;  4RH6 A;  5LL6 X;  4DXF A;  3BVZ A;  3E9H A;  5C0X H;  1BCP C;  1TWF H;  1PH4 A;  5IYD G;  1VQ5 A;  3NQT A;  1MIU A;  2F3I A;  2F0M A;  1XPR A;  1N34 L;  3HOZ H;  4NMZ A;  5C6A A;  4WRD A;  3A5U A;  2MHV A;  4IJL A;  3K7U C;  1NSN S;  2JXM B;  4K8I A;  5TSS A;  4EQO A;  4XT1 B;  3JAM i;  5EBC A;  3M3Y B;  2K7V A;  2K6A A;  2HHH Q;  1QZG A;  4LNQ A;  4ZKB B;  3GO5 A;  3D4D A;  1G91 A;  3SVM A;  1Q1E A;  1PH5 A;  4DAY A;  4WJ4 A;  4A3I B;  1Y1W B;  4HTH A;  3TRE A;  1SAP A;  1WTV A;  1N32 Q;  1EL0 A;  2OQK A;  4GLX A;  2HCI A;  3PUZ A;  3QG1 A;  1QNK A;  3TZU A;  1Q86 C;  4XQQ A;  2KBN A;  5EQ0 A;  2R93 G;  3PO3 H;  1I4P A;  1F9Q A;  5KNB A;  1SNQ A;  1KAA A;  2RHQ B;  5DNF A;  3CCQ A;  3WDN A;  3GTG B;  3S14 H;  4DNI A;  1HR0 W;  1ILQ A;  1N9W A;  5IE8 A;  1EQV A;  4LF6 L;  4FXK C;  1X3E A;  5A2Q L;  1GXD C;  2JEA I;  3KJP A;  4JI4 Q;  1JWS D;  3KDF B;  3A7L A;  3ND8 A;  3BZC A;  1HZB A;  1U4R A;  4KKS A;  1E7Z A;  2N78 A;  2BA0 A;  1TY2 A;  1E2W A;  1K73 C;  2RVL A;  2E2I H;  1M8A A;  2JJQ A;  5LMU L;  2R93 B;  2TSS A;  4APV A;  4RCO A;  4EVO A;  4B3S L;  1YHQ A;  4M8A A;  2EY6 A;  4BXX G;  3TME A;  1LUZ A;  1OXU A;  4DV4 Q;  2PI2 A;  1BBU A;  1KAB A;  2DY7 A;  5C3E B;  1D1K A;  1CI3 M;  1TWC H;  1PXU A;  1Y1W G;  3HOY B;  4CKC A;  1MGS A;  2MGS A;  4BBS H;  1H9J A;  4O0A A;  1Y8N B;  4JOI C;  2WII B;  1CQF A;  4MNO A;  1TWG H;  3HGB A;  1DGS A;  5J22 A;  5JEA J;  3CPW A;  3FKI G;  5EAY A;  1BR9 A;  2KCT A;  3I55 A;  3BZD B;  1BCP B;  3PIO 3;  2K5H A;  2Z6B A;  1G51 A;  2F0E A;  3NXW A;  3D31 A;  4FF2 A;  3MVV A;  3HKS A;  1FJG L;  4QUC A;  2FFK B;  5K36 G;  4NXN L;  1PH9 A;  2HT1 A;  2D0O A;  4JI0 Q;  3OMC A;  1JB3 A;  3E6Z X;  2XNA C;  4ODG A;  2K05 A;  1GKH A;  2C5C A;  1BQQ T;  2JA6 G;  2B2V A;  4DV1 L;  4IZ8 A;  1VQ9 A;  2UXB L;  5L37 A;  2R7Z B;  4DAM A;  1R9T B;  1FJG Q;  4TQU S;  4P73 A;  5J3B A;  1HR0 L;  5M5X H;  2E75 C;  2WIN B;  1H9S B;  2ENB A;  2UUC Q;  1HNX L;  1HNX Q;  1S5F D;  2OCE A;  3R2I A;  4L63 B;  2JA5 H;  2P5Z X;  1TS4 A;  4S3S A;  1TWC B;  3HOU B;  1DOL A;  2ZJR A;  3EA6 A;  1WTO A;  2KED A;  3FMC A;  2D9U A;  2QF7 A;  3D0F A;  5JAV A;  4G7Z C;  4DK6 C;  1VQE A;  2C9O A;  4C3H G;  1GM5 A;  5T1I A;  3J7A F;  2B2Y A;  2F0D A;  4JW0 A;  5HUR A;  4IO9 A;  1XTC D;  3CC4 A;  4CHT B;  3T13 A;  3RZD B;  4L5R C;  1NUC A;  3A74 A;  4OL7 A;  4HR7 B;  1IKL A;  5LHY 1;  5C5L A;  2K5V A;  2XVS A;  1ILP A;  1GVP A;  4OO1 H;  2A1A A;  2PMZ B;  3A54 A;  5M5Y B;  2FJ2 A;  3KF8 B;  1TS5 A;  3HOX H;  4DK0 A;  1AP0 A;  1B50 A;  1X3Q A;  4A3F H;  4IPC A;  1O80 A;  3IL8 A;  3MXG A;  1U9R A;  5IGE A;  3ULJ A;  2WB1 G;  1CKN B;  1Z9F A;  2R7Z G;  1HXY D;  2QEX A;  2ID0 A;  4FP5 D;  1NR4 A;  1VQH A;  4IUQ A;  4YCV A;  1EEF D;  1I6H H;  3MFG A;  3J81 L;  1EZ6 A;  5ELF A;  4A75 A;  3P20 A;  3CXC A;  2K5W A;  2MO0 A;  3H0G H;  4G7O C;  3B6Y A;  2JA8 H;  4X62 L;  3AYH B;  4JI6 Q;  1LV9 A;  2K52 A;  4I65 A;  4XYO A;  2MPM A;  1WTW A;  1AZQ A;  2E2J B;  2CWA A;  4DR1 Q;  1ESR A;  1HA6 A;  1MSH A;  4H02 A;  4A93 G;  3AMU A;  2F0L A;  1TWH B;  1SYE A;  3PIP 3;  1YIJ A;  2DJG C;  3HOZ B;  1F2L A;  5ELC A;  2UUA L;  2HQL A;  3GTO B;  2Q2U A;  4IUV A;  3SR1 A;  4R8I A;  3S2H B;  3IFD A;  2CQO A;  3HS0 C;  5IOC A;  1SEB D;  1PA6 A;  3S16 B;  4KTA A;  4X65 Q;  4JI4 L;  3OWE B;  5DM7 3;  3PIP A;  4J1M A;  5KYL A;  1WVL A;  5I6Y A;  4A3M H;  1IW7 C;  2Z4I A;  5FLM G;  3UE1 A;  4ZRZ A;  2IHE A;  3GTM H;  1A62 A;  1V1Q A;  3GD7 A;  2H1E A;  2DJF C;  3KF6 B;  2K75 A;  2I0Q A;  1EY4 A;  1YNX A;  4C2M H;  1JJ2 A;  1H9K A;  1PTO C;  3H3V I;  1YNJ D;  1LAC A;  3J7A V;  1BCP D;  1RCV D;  1PFS A;  2UXD Q;  1X65 A;  2NUC A;  4CKB A;  3OIQ A;  2OF1 A;  2IL8 A;  2JEB I;  1JOQ A;  5KGU A;  3HOZ G;  3M7N A;  4NPS A;  2R7F A;  2YU9 H;  3TN2 A;  2NVX H;  3U50 C;  5I2X A;  2NZO A;  3X3N A;  3ITP A;  1PDQ A;  1N8R C;  3MHB A;  5IYB H;  1EY8 A;  3NTI A;  1WTH A;  4GS3 A;  4Y52 H;  1QG7 A;  2XRQ D;  1C9O A;  3S1M B;  2Z6K A;  2WB1 E;  4YHH Q;  2O5J C;  2KHS A;  1QE6 A;  4IUN A;  1STH A;  4RGM A;  4BY7 B;  2IPK D;  2MQH A;  1SMX A;  4JBK A;  1G29 1;  1PVO A;  3QIA A;  1MBY A;  3D3R A;  1IBK L;  2OQ0 A;  3M4Y A;  2NN6 G;  2XN9 C;  1F2Y A;  4F87 A;  1X9N A;  1LT3 D;  4B9X A;  4JI0 L;  3SHL A;  4HIM A;  4ME3 A;  2AUJ D;  5E4W C;  4HED A;  4C3I G;  4DR7 Q;  2JA7 G;  1TY0 A;  2F0U A;  4BXX H;  2EYO A;  1SMY C;  1QJO A;  2D5D A;  4RCN A;  5C3X A;  2M2L A;  1HNW L;  2F0V A;  3OYY A;  4Q0F A;  4B3R Q;  1LTB D;  1SYG A;  3GV6 A;  3PUY A;  2RCF A;  2LFN A;  1JE5 A;  2D62 A;  3L0O A;  3M4O B;  1FL0 A;  2Q2I A;  4DV4 L;  5T1G A;  1G8Z D;  3HEJ A;  5JJK A;  3OIP A;  4O42 A;  1NE3 A;  4B3S Q;  4L5S A;  2CH4 W;  1VQL A;  4IFD G;  3M3Y H;  1JCK B;  1BOS A;  4KLK A;  3HFZ B;  1KLU D;  2E8G A;  1VMC A;  2MP1 A;  5JOB A;  1TWG B;  4YCW A;  3K5O A;  3IFT A;  5E7N A;  2KCN A;  5JJZ A;  2Q2H A;  2R92 H;  2O2L D;  1UNS A;  2F0Q A;  3U9O A;  2EY1 A;  4J6H A;  1GHJ A;  3VR2 A;  5A35 A;  4LWC A;  1BXT A;  3EJI A;  5LMU Q;  3R2T A;  4A3E B;  1PRT F;  2PNH A;  2A68 D;  3SXH A;  4KJN A;  4LF7 Q;  4P75 A;  4DU9 A;  2E76 C;  4B08 A;  1AN8 A;  2JA6 H;  1FGU A;  4QIW E;  3PIO A;  4R4I A;  1IBL L;  1BCP F;  4IOC A;  2KHJ A;  1YJW A;  3M85 A;  3TS2 A;  3VR4 A;  2XTI A;  1V1P B;  4OX9 L;  1L2F A;  2F4V L;  1TII D;  4DV5 L;  2F0O A;  3TDQ A;  5BN4 A;  2KCC A;  5C4X G;  4MTK A;  1VQI A;  2B39 A;  4UDU C;  4DR3 L;  5KYI A;  4DV7 Q;  3JAM L;  5CV9 A;  4IUP A;  3LWE A;  1B7Y B;  1WJJ A;  4K8J A;  1CUK A;  5BN5 A;  1A8V A;  2CQA A;  3VYU A;  1KDA A;  3RUZ A;  2AQ3 B;  3V2T A;  4NXM L;  3ZYY X;  1K3R A;  3TQY A;  3O13 A;  1SYF A;  3MEF A;  3M9B A;  4DV3 L;  2KUM A;  5JJL A;  2RDG A;  1JJG A;  4A3D B;  2J7Z A;  1WCM H;  3SK4 A;  2C35 B;  3VR3 A;  2L0C A;  4IPD A;  1RF2 D;  4BWG B;  4RKL A;  3MXU A;  3F2U A;  1NMG A;  5KRU A;  3PQI A;  3M7G A;  1PH7 A;  3TP8 A;  3H0G G;  3ONA B;  3URY A;  4DR4 L;  1N33 L;  4IPG A;  4UPA A;  5AFW A;  4KK7 A;  4A3L H;  4DV6 L;  2UUB Q;  1B9N A;  4L6T B;  4A76 A;  4H0L C;  4CDE C;  4JI2 L;  2ZTC A;  3OSO A;  4RGO S;  3HOV B;  4A3J B;  2JA8 B;  2EY5 A;  1HCZ A;  1HUN A;  4K5V A;  4Y7N B;  4XIG S;  4P2C B;  2ZM6 L;  1YZ6 A;  3OTO L;  3F2B A;  3Q0A A;  1SJH D;  2UUB L;  4KN4 C;  2N8N A;  4KY6 A;  4R4T A;  4P74 A;  3PO2 B;  1PH8 A;  4K2K A;  3H3V H;  1T9H A;  2I5L X;  2DGY A;  1NTG A;  1A0I A;  1T5E A;  2SEB D;  2CH4 A;  4O2D A;  4MTN A;  1PTO H;  1X3G A;  3CCS A;  4CDF C;  5J1Z A;  3T1H L;  4BBR H;  4A3C H;  2YTV A;  4DV6 Q;  4UHV A;  1U5K A;  1XWE A;  1K3B C;  1HNZ L;  3HOU H;  2O4X A;  4JI1 Q;  2L11 A;  3GTJ B;  3A7A B;  4KV6 A;  2FHT A;  5IYB G;  4A3M G;  4A3B B;  3H6M A;  1VQK A;  1EY6 A;  4GKJ L;  4OWX B;  3G7L A;  1LTT D;  4N8F A;  1SRU A;  1LYL A;  1Y1V H;  3U4V A;  5FO7 B;  5J39 A;  4DK3 C;  1QVC A;  2Y0S B;  3NE5 B;  1ASY A;  4XQJ A;  1PYW D;  2F0P A;  1VQO A;  1HA5 A;  5JVG 3;  3J80 i;  1PYB A;  2B2Y C;  3S17 H;  3V96 A;  1BF4 A;  2F4V Q;  3MFY A;  2AHO B;  3I4M B;  5C4J B;  4DR6 Q;  4TKO B;  5KIX A;  4BY1 B;  3AFP A;  4R4O A;  1ZXT A;  2EVB A;  1CTM A;  1HPC A;  2XSC A;  1UEA B;  4YCU A;  2QKI C;  4MHE A;  3CCL A;  2PZT A;  3TEH B;  3E0J A;  1J9O A;  3CCM A;  2B2T A;  4RMF A;  2Y0S E;  3BVM A;  1E0B A;  1MSG A;  1EUJ A;  1E1O A;  5AJ3 Q;  2A69 C;  1OO9 B;  3D4W A;  4DV5 Q;  4JVZ A;  4AH6 A;  2AQ2 B;  1FNW A;  1VQA A;  1M4V A;  1AFP A;  5HY6 A;  3S1R H;  5FLX E;  2B2U A;  1GUW A;  1E2Z A;  1SRO A;  3D4R A;  3GQB A;  3S1R B;  4A3L G;  4LF4 Q;  4IPH A;  1HH2 P;  4BY7 H;  4JI6 L;  1XJV A;  1B2T A;  1GOZ A;  3I4N B;  1ESF A;  3SGI A;  3JAM c;  2UU9 Q;  1B53 A;  4IFD H;  2B63 B;  1ICF B;  3DM1 A;  1D2B A;  2F0H A;  3J81 i;  3W2D A;  3W1B A;  3M4P A;  3R3O A;  1GUS A;  4ZUI A;  4Q5V A;  2RSO A;  1S5D D;  1QCB D;  4C3J H;  1SJE D;  4K5W A;  1IBM Q;  3CU7 A;  3L2P A;  4A3B H;  5IGF A;  5M5X B;  1FNV A;  4XT3 B;  3CQZ H;  3RLN A;  3C46 A;  5CV6 A;  1F77 A;  4BBS B;  2EZV A;  3T51 B;  1F9S A;  2L55 A;  2EE1 A;  2QDL A;  3S9W A;  3UI2 A;  1XNQ L;  3EBE A;  3N52 A;  3V05 A;  2JA7 H;  1PFB A;  3I4O A;  1RD9 D;  1XYI A;  4PMB A;  5IYD H;  2I46 A;  5DEH A;  2CFM A;  4U67 3;  4HCE A;  4BBR G;  1F2Z A;  1VQM A;  4L8J A;  4KD3 A;  3HOU G;  2R92 G;  2E5L Q;  4B3R L;  3F2C A;  4M1U B;  3RZO H;  4LF8 Q;  1EQR A;  1YNN D;  2VB2 X;  2WV6 D;  2NB0 A;  3GDE A;  1KD1 C;  3S1N H;  2CWP A;  5IGG A;  1Y14 B;  2JA6 B;  4JV5 Q;  1L1O B;  4A3I H;  4C3H B;  3ICE A;  3VA7 A;  4RGT A;  2RCN A;  1XNR Q;  1LTR D;  1UAP A;  2BH8 A;  4JI2 Q;  4GLV B;  3TP6 A;  3HOX B;  5IY0 A;  2L9H A;  4C56 C;  4A3E H;  5IT9 E;  2F0S A;  5IWA L;  4AIM A;  1EWI A;  1EY7 A;  1K83 H;  2WKC A;  1DYQ A;  2KEE A;  3I4N H;  1WYD A;  3RD4 A;  3KYH C;  1SYB A;  4KMU C;  5A2Q E;  2PYK A;  2VQF Q;  4AYB B;  2UXB Q;  2G9H D;  3NHH A;  3DM3 A;  4DV1 Q;  5BN3 A;  3H3V C;  1DD2 A;  1FGB D;  1EOT A;  1UWV A;  1VF5 C;  4YWK A;  3GTK H;  2UXC Q;  3CRK C;  1VQ8 A;  5CR3 A;  3K57 A;  1D5M C;  2VXW A;  2EQS A;  4LF5 L;  1D5Z C;  3K5N A;  3T4A C;  2K4K A;  2E2D C;  2PZU A;  3NQI A;  3QR8 A;  2IHF A;  4C3I B;  2IT1 A;  3F1Z A;  5I6W A;  5JVH 3;  3TZD A;  1TQO A;  1I6V C;  2R93 H;  2BOS A;  5IYC H;  1Q82 C;  2UXD L;  3N6R A;  1QVG A;  4OIJ A;  3E0E A;  1RL2 A;  1VQC A;  5C4X H;  2EXD A;  4A4I A;  4POG A;  3FKI H;  3P75 A;  4JC0 A;  2A68 C;  2I07 B;  1LTL A;  1PRT D;  1BKB A;  1AE3 A;  4JYA Q;  1CKO A;  1A2T A;  1SNC A;  4YWM A;  4P71 A;  2SNM A;  3DWP A;  4A3M B;  4A3B G;  4GN5 A;  4FXG C;  2Q8T A;  4B3M L;  1GUT A;  1PH3 A;  1LT4 D;  1Y8P B;  2DNC A;  5CV8 A;  5D3I B;  1XNR L;  4K0K L;  2K50 A;  2E74 C;  3G6J B;  2NVY B;  1TR5 A;  4LF9 Q;  4A3F B;  1VDZ A;  4C1N K;  5C44 H;  4FYD A;  1LLR D;  2B2T C;  4X64 L;  1PZI D;  1Q3L A;  4JI8 L;  4K14 A;  4L5Q A;  2E5L L;  5IT9 c;  3BYY B;  3HZX A;  4ZKC B;  3MXP A;  3QB3 A;  1Y1W H;  2DNE A;  3I90 A;  4DUZ L;  1A3T A;  1Q8K A;  2IX3 A;  1CZG A;  2K03 A;  3HRZ C;  3NSW A;  5JPM C;  3GTP H;  4HN7 A;  1BDO A;  4EQN A;  1PV4 A;  1ZKO A;  1RKN A;  1VQB A;  3K6O A;  4LUZ A;  3LX0 A;  2AMC B;  1TT2 A;  3QO2 A;  4XYQ A;  1SMY D;  2WAC A;  1ENF A;  2IW3 A;  1E1T A;  1EFI D;  3E3X A;  5ELE A;  1I3Q B;  2DY8 A;  1CHQ D;  5I4D A;  3K81 C;  3K59 A;  4K6L A;  4V0B A;  3H91 A;  1SE8 A;  1JIC A;  2D0P A;  2QEJ C;  1I50 B;  3S15 H;  1WFQ A;  1STY A;  3DWQ A;  1CK1 A;  1LM0 A;  1HFG A;  4F88 A;  3CCU A;  1UE6 A;  1TWA H;  1QNU A;  2WFW A;  1VQ4 A;  2QA4 A;  2PW7 A;  2NN6 I;  4A3C G;  4X3K A;  1K0R A;  5D65 A;  3VR5 A;  5FO9 B;  4DV0 L;  1W2B A;  2KEN A;  5M3M B;  2A6E C;  3ZJY C;  5GQO A;  3S17 B;  1KTK A;  1UEB A;  3MC0 B;  2QW7 A;  3UDX A;  4DGZ A;  1DM0 B;  1Y1V G;  4IUR A;  4I7Z C;  4B3M Q;  2JA5 G;  4JI5 Q;  4GNX A;  2EYH A;  3HOW B;  4KKT A;  3MTS A;  3S1M H;  4KHP L;  5C3E G;  3PF5 A;  1Q7Y C;  5E3F A;  3NK9 A;  4RWS C;  1JWM D;  4DR6 L;  2N49 A;  4RA8 A;  2IX0 A;  4X66 L;  3TP5 A;  2HDM A;  1FD7 D;  3NEN A;  4DUY Q;  3KUP A;  1YJN A;  2N88 A;  3Q8D A;  3D8G A;  3PO2 H;  3A56 A;  1K8M A;  1TKW B;  3KLS X;  2CVR A;  1YNJ C;  3EQL C;  4GKJ Q;  3GTG H;  2ZXR A;  3H15 A;  1PMR A;  3D6W A;  1WI5 A;  2ZXP A;  1QZH A;  4HCS A;  4QUF A;  5FOB B;  3HOX G;  4IFD I;  3NBH B;  5M3F H;  1LAB A;  4L5T A;  1Z6H A;  2F0W A;  1KDB A;  2K32 A;  3FRP B;  5IGB A;  2BH2 A;  4X6A H;  5M5W B;  3GTJ H;  2MUY A;  4CJ1 B;  1Q8I A;  3FPP A;  5CV5 A;  3CC7 A;  4NB3 A;  4CJ2 C;  2CW0 C;  1JQY D;  2J4X A;  4XQN A;  2NZH A;  3VR6 A;  1X55 A;  3PGZ A;  4C3J G;  1NR2 A;  4LFC Q;  1K0S A;  1GUG A;  5IWA Q;  1JOR A;  3C1E A;  1H9M A;  3OTO Q;  4G57 A;  2MO1 A;  2RKS A;  1EYG A;  2FXQ A;  4JI3 Q;  1IYJ B;  1S5E D;  2LMC B;  3GTO H;  1E24 A;  2EYM A;  1V43 A;  2KA7 A;  2EOT A;  3X3M A;  1MJC A;  1L0X B;  2EJG C;  3EIV A;  3IKJ A;  5EBD A;  1GUN A;  1C7Y A;  2B3G A;  3G6E A;  1KIX A;  4BA2 I;  3VDY A;  3I91 A;  4XTC S;  4JBW A;  1B3Q A;  3I4L A;  3GTQ H;  1SNO A;  3GTL B;  3RN5 A;  2F0I A;  2IX1 A;  4BY1 G;  2ES2 A;  3LNN A;  2EXZ A;  5IIF A;  1KQS A;  1D8L A;  1RTO A;  1BNZ A;  4N9P A;  4FNF A;  4XDX A;  1G6P A;  1MJE A;  1CZW A;  5IP9 G;  1STB A;  4HSV A;  2A19 A;  4U68 A;  3J7Z C;  4LFA Q;  3CD6 A;  2PZW A;  4GZY C;  1P8L A;  3ERQ A;  1MHW C;  1IYU A;  3U4Z A;  4K0K Q;  1MKH A;  1V9P A;  2B8F A;  2LY7 A;  3OPO A;  4OWT B;  1ENC A;  2B2V C;  1I94 L;  3NPP A;  1TU2 B;  2MJ8 A;  3OW2 A;  1CT1 D;  5I9P A;  1B8A A;  1SE2 A;  1AZP A;  1NAP A;  1S40 A;  1KL9 A;  1MI2 A;  3NEM A;  3C3L A;  5GRO A;  1NMF A;  1YIT A;  3MXN A;  4HJ8 A;  2YTY A;  1GHK A;  4HMI A;  1TS2 A;  1CFM A;  2A69 D;  4DV7 L;  2KEC A;  4C3I H;  2WP8 J;  2B63 H;  2K04 A;  4TVA B;  1V8Q A;  1JWU D;  1YJ9 A;  2L5T A;  4BBR B;  1SN8 A;  2PNR C;  4QIW B;  3I3C A;  2Q8R E;  1BUV T;  4Z9C B;  1STA A;  5C5M A;  1A6X A;  5BR8 Q;  4DPG A;  1LO5 D;  1PZK D;  3G48 A;  4HJ5 A;  3BYT B;  1NBW A;  4LK1 C;  3CQZ B;  3LWU A;  1WCM B;  1J5E Q;  1SNP A;  3A8I E;  4EQP A;  4PV1 C;  1X3F A;  3I4M H;  2A5H A;  2HCC A;  1E22 A;  1WTP A;  1SYC A;  3S2D B;  4H13 C;  5FO8 B;  4DAY B;  4ZUJ A;  1QWY A;  3CHB D;  2R3Z A;  2VY3 A;  2AKW B;  2K1B A;  3S1Q B;  1SFO H;  4DR5 Q;  3SE0 A;  1G2S A;  5LL6 S;  4NXN Q;  2Z9H A;  5G3L F;  1KC8 C;  2ICI A;  2YV5 A;  3RN2 A;  3FVQ A;  4O1N A;  5C4J H;  4HSP A;  5FKA C;  1OTC A;  3JC6 6;  5GAG C;  4NDX A;  5EPK A;  1E2V A;  4DAP A;  1I5F A;  4RG1 A;  4GNX C;  1Q46 A;  1C48 A;  4JK1 C;  5IOD A;  2AWO A;  1H9R A;  4B9W A;  1CQV A;  1S5C D;  1PH6 A;  4CJ0 B;  2YYZ A;  3NEL A;  1Q90 A;  1VQF A;  4KKU A;  3KF8 A;  3WOF A;  1Z7T A;  1HTP A;  3ER0 A;  3ULL A;  1BO0 A;  2VUM G;  4ZK9 B;  5C44 G;  1B1Z A;  4GN3 B;  1KRT A;  2F52 A;  1PFM A;  2ZTE A;  2JE6 I;  2KQ3 A;  2I5H A;  1I50 H;  3GTK B;  1HJP A;  1VQN A;  2TMP A;  5CBE E;  1X32 A;  5C4H A;  1FR3 A;  2NWG A;  2J0T D;  3UDI A;  2E2I B;  3PUV A;  4X3U A;  1KRS A;  2F3V A;  3K5M A;  4ZAI A;  1YHB A;  2Y0S G;  1N36 Q;  2LXJ A;  2V4D A;  1WCM G;  1M90 C;  4QY7 A;  5ELN A;  4FF4 A;  2LXK A;  3RR5 A;  2KHI A;  4HJ9 A;  1Y1V B;  3M4Q A;  4QL5 A;  3L9A X;  3ERO A;  1HHV A;  1JR0 D;  1I4G A;  4FDB A;  1IZ6 A; 
#chains in the Genus database with same CATH homology
 4IUT A;  5EPL A;  1PZJ D;  1F2M A;  3NWS A;  5D3D A;  4CBV A;  1EWH A;  4CKE A;  4PQX A;  5D14 A;  4NW2 A;  2VUM B;  2NVT B;  1TS3 A;  2JYO A;  2JSO A;  2R6G A;  1PFN A;  2NVQ B;  4PMW A;  2RA4 A;  4KY5 A;  1SBB B;  3PMF A;  1DZ1 A;  2KVM A;  4DFA A;  2HQE A;  5CMD A;  4K6D A;  1K83 B;  4DNT B;  1UUP A;  1G2T A;  3I72 A;  1QB5 D;  5FLX L;  2ZT9 C;  3J80 E;  1STE A;  1PRT B;  5C0X J;  5JEA G;  3DHQ A;  3GTP B;  5I2Y A;  1EY5 A;  1CM9 A;  2D2C C;  3FPU B;  3I73 A;  2KOL A;  2PQE A;  5HGT A;  2HUG A;  3DMU A;  3QWN A;  1I4R A;  4A3G B;  1EU3 A;  3Q22 A;  2OT2 A;  1TWF B;  5EKK A;  1SFO B;  4G7H C;  2F03 A;  1EIH A;  1T5X D;  1SDF A;  1PLF A;  2X69 A;  1KNA A;  4C2M B;  4ID6 A;  2NVX B;  2K28 A;  4DK1 A;  4FVM A;  3OWF A;  3BS1 A;  1EZ8 A;  1Y8O B;  3H0G B;  2CW0 D;  3I70 A;  2LS0 1;  1HTL D;  4ME5 A;  1F9P A;  2HDL A;  2PCF B;  3VYR A;  2QDB A;  2B8G A;  3ND9 A;  5EPJ A;  5JPN C;  1S4Z A;  3W3A A;  3KK7 A;  1SSO A;  2JP1 A;  3VYT A;  3EVQ A;  4QF4 A;  3OMG A;  1HQR D;  2FMC A;  2XIW A;  1GUO A;  4HMJ A;  1H9S A;  1X3P A;  4NP5 A;  5K36 H;  5JEA H;  3MEH A;  2SNS A;  2JA7 B;  4DXG A;  3Q24 A;  1U4L A;  2F0G A;  2K5D A;  4RGN A;  3P7J A;  1O7Y A;  3GV3 A;  1RDP D;  4H44 C;  1DCZ A;  4CGY B;  1SND A;  3A8J E;  3NBI A;  1R4P B;  5ELB A;  2OEO A;  3A8K E;  1Z47 A;  2LKV A;  3OHX C;  1QIL A;  4QCL A;  4DF7 A;  1XXG A;  4H7B A;  3DXJ C;  1F9R A;  1IKM A;  1HUM A;  1VCI A;  5DAU A;  3RZO B;  5CV4 A;  3QOJ A;  4FF3 A;  1OXS C;  2BCO A;  1I4X A;  1MD2 D;  3BDL A;  3KLS A;  3RMH A;  3BDC A;  5EGT A;  4DAV A;  4KHV A;  4WOR A;  4N9T A;  2O5I C;  2RSN A;  1TVX A;  5IGC A;  1LT5 D;  5ELD A;  2EYJ A;  3NTH A;  1ROD A;  3T53 B;  1A2U A;  5G3L D;  3J81 E;  2F0F A;  1DON A;  2EDG A;  4UAI A;  3KBX A;  2F1M A;  1LTA D;  5IT9 L;  1WTX A;  1RTN A;  5ISR A;  1LTI D;  2K5Q A;  3NTK A;  3DUZ A;  3J7Y W;  4QMG A;  3VYS A;  1V1O A;  4YIJ A;  3TSS A;  2Z1C A;  5FK9 C;  4IQZ A;  3BVG A;  5COR A;  3HP3 A;  4FF1 A;  3H94 A;  5C3W A;  3IAY A;  1U4M A;  3PO3 B;  1D1I A;  3L7Z C;  4WFN 3;  3GTQ B;  1EQT A;  5E1F A;  3K58 A;  2EJM A;  1DJR D;  2E2H B;  3PUX A;  1OXT A;  3U9S A;  4C1N I;  1DXM A;  2QIL A;  1EEI D;  1STG A;  1ICW A;  2ICE C;  1STN A;  4OGQ C;  1WD0 A;  1RHP A;  2Z4H A;  4X3S A;  5COY A;  5EJW A;  4IFD J;  2BE5 D;  2F0K A;  2XRS D;  4RHS A;  1ET9 A;  3Q6S A;  3C1F A;  2OXP A;  2XWJ B;  3QOL A;  4OO1 I;  5CC4 A;  1SXT A;  1O7L A;  4F7X A;  2F0N A;  2FIN B;  2CHB D;  3C2P A;  1IHZ A;  2F4I A;  4PMC A;  5KND A;  3FEW X;  2G9D A;  2EJF C;  1XX8 A;  1ONL A;  5CGK A;  1U4P A;  5C4X B;  1ZEQ X;  4KN7 C;  2PO4 A;  3FDT A;  2B2W C;  4KD4 A;  2AUK A;  2Q8I B;  2BDN A;  3GP7 A;  2QCP X;  2WKD A;  1GJX A;  1WTR A;  4ABN A;  2R61 A;  1O7Z A;  5C0X I;  1FNU A;  5F2D A;  1DOK A;  1EYD A;  3TBI B;  4XXE A;  2RDF A;  1Q12 A;  5M9O A;  3TP7 A;  2GA4 B;  3VA5 A;  3Q23 A;  1BBX C;  3WOE A;  4FXD A;  2WAQ B;  1JOO A;  5EKI A;  4RFB A;  2NN6 H;  3S14 B;  5KEE A;  3BG3 A;  1IL8 A;  5I9O A;  2VNU D;  2PW5 A;  1IW7 D;  2WB1 B;  3DEP A;  4PNY A;  1EIG A;  2A6H D;  4LAA A;  5C0X G;  2M9V A;  1AW7 A;  3MA2 B;  4BS9 A;  4ZQ3 A;  1ML0 D;  1V1P A;  1NCV A;  3K0Y A;  1OXX K;  2M00 A;  2SDF A;  1SE3 A;  4LJZ C;  1J8I A;  5NUC A;  4V19 0;  1I4H A;  2BE5 C;  1PRT C;  1EY9 A;  4A93 B;  3D6C A;  2F0J A;  4RHR A;  2FMM A;  1CA5 A;  2YU9 B;  1O78 A;  1HRJ A;  3NUC A;  3K7A B;  1G6Z A;  1S5B D;  3DWA A;  3I8Z A;  3SK8 A;  1WD1 A;  1PTO F;  4DA2 A;  3L3O C;  4MN3 A;  5K5P A;  2EY2 A;  2PPB C;  1EU4 A;  1CHP D;  2KJX A;  4DNR B;  2BDO A;  4E6I A;  2ZXO A;  1LTS D;  2NZ1 D;  2NYZ D;  1W6K A;  2L12 A;  1A3V A;  1JC7 A;  3EFX D;  2IWH A;  5KNC A;  4KJO A;  3R93 A;  1OXV A;  1EWC A;  2A6H C;  1JE4 A;  4OHJ A;  4KY7 A;  1Q1B A;  3NBH A;  1SE4 A;  4ULL A;  1QOH A;  2N55 A;  1A15 A;  1YNN C;  2F0T A;  3HKZ B;  2H4O A;  2X6G A;  3S15 B;  2L1B A;  2K01 A;  4QB4 A;  4HAE A;  3E5S A;  3CKI B;  4K2L A;  2Z8L A;  3S1N B;  4LMQ D;  4WJW A;  1KDC A;  2VB3 X;  1II3 A;  4KI0 A;  4DN4 M;  3SK6 A;  4F8M A;  5C44 B;  4FO2 A;  3SEB A;  1KLG D;  3T16 A;  1C8C A;  3MWY W;  5DM6 3;  1VF7 A;  4TRD A;  4ZLT F;  1SYD A;  3AU7 A;  5CYU A;  4X3T A;  2R92 B;  1LT6 D;  2A6E D;  5E4X A;  1ENA A;  2F3W A;  1W6J A;  4ZYS A;  3SDZ A;  4OIK A;  2NTS A;  2B2W A;  1I6H B;  1EYA A;  3KLR A;  2EYL A;  4NKL A;  4R9W A;  1D6E C;  4C3J B;  3RLF A;  5C4Z A;  3JAM E;  1C4Q A;  1K8O A;  4IN3 A;  1WTQ A;  4MIU A;  4EGV A;  1PTO D;  3KBG A;  3BDO A;  4KHZ A;  3MAQ A;  3QJY A;  1VMP A;  3AB9 A;  5EKL A;  3H09 A;  3OW7 A;  3J80 L;  1B9M A;  3NWT A;  1SNM A;  3NP8 A;  3GTM B;  4RAU C;  1A3U A;  3FKI B;  1EY0 A;  2EYP A;  1R4Q B;  1EYC A;  5IGD A;  3T56 B;  4IAL A;  3DEO A;  1L0Y B;  1TWA B;  2RDH A;  1HQM C;  2JA5 B;  2AQ1 B;  2NBF A;  1I4Q A;  4R8N A;  1FYC A;  1KNE A;  4K5X A;  1IYV A;  1B44 D;  1ZYR C;  4J8Q A;  2L4N A;  3HG9 A;  3A55 A;  4OO1 G;  5CV7 A;  1RJT A;  4IUU A;  3OOC A;  4TSS A;  3MZ5 A;  3PV0 A;  2DN8 A;  2EPB A;  1HFN A;  1ET6 A;  2SOB A;  3P1H A;  2X6L A;  5CBA E;  2A74 C;  4ILW A;  3K5L A;  3CRL C;  4BA1 I;  1B4O A;  3SK5 A;  1CA6 A;  1D5X C;  2A73 B;  2AWN A;  2K33 A;  5M3F B;  2IJ0 A;  1PTO B;  1LTG D;  3PUW A;  2BA1 A;  2RQX A;  1AEX A;  2B2U C;  4A3K B;  2XWB B;  2RBM A;  2NTT A;  4RKB A;  1DOM A;  1JOK A;  1B3A A;  1Y69 U;  4G4K A;  2EYF A;  1ZYR D;  3R8B A;  4RH6 A;  5LL6 X;  4DXF A;  3BVZ A;  5C0X H;  1BCP C;  3NQT A;  2F0M A;  4NMZ A;  5C6A A;  4WRD A;  2MHV A;  1NSN S;  2JXM B;  4K8I A;  5TSS A;  4EQO A;  4XT1 B;  5EBC A;  3M3Y B;  2K7V A;  2K6A A;  4ZKB B;  3GO5 A;  3D4D A;  1G91 A;  3SVM A;  1Q1E A;  4DAY A;  4A3I B;  1Y1W B;  4HTH A;  1SAP A;  1WTV A;  1EL0 A;  2HCI A;  3PUZ A;  3QG1 A;  1QNK A;  3TZU A;  4XQQ A;  5EQ0 A;  1I4P A;  1F9Q A;  5KNB A;  1SNQ A;  1KAA A;  5DNF A;  3WDN A;  3GTG B;  1ILQ A;  1EQV A;  4FXK C;  5A2Q L;  1GXD C;  2JEA I;  1JWS D;  3A7L A;  3ND8 A;  1U4R A;  4KKS A;  2BA0 A;  1TY2 A;  1E2W A;  2RVL A;  1M8A A;  2R93 B;  2TSS A;  4RCO A;  4EVO A;  4M8A A;  2EY6 A;  3TME A;  1OXU A;  2DY7 A;  1KAB A;  5C3E B;  1D1K A;  1CI3 M;  3HOY B;  1PXU A;  4CKC A;  1MGS A;  2MGS A;  1H9J A;  1Y8N B;  2WII B;  1CQF A;  3HGB A;  5J22 A;  5JEA J;  1BR9 A;  3BZD B;  1BCP B;  3PIO 3;  2F0E A;  3NXW A;  3D31 A;  4FF2 A;  3MVV A;  4QUC A;  2FFK B;  5K36 G;  3OMC A;  1JB3 A;  3E6Z X;  2XNA C;  4ODG A;  2K05 A;  2C5C A;  1BQQ T;  2B2V A;  4IZ8 A;  2R7Z B;  1R9T B;  4TQU S;  2E75 C;  2WIN B;  1H9S B;  2ENB A;  1S5F D;  3R2I A;  4L63 B;  1TS4 A;  4S3S A;  1TWC B;  3HOU B;  1DOL A;  3EA6 A;  1WTO A;  2KED A;  3FMC A;  2D9U A;  2QF7 A;  4G7Z C;  5JAV A;  2C9O A;  4C3H G;  5T1I A;  3J7A F;  2B2Y A;  2F0D A;  5HUR A;  1XTC D;  4CHT B;  3T13 A;  3RZD B;  1NUC A;  4OL7 A;  4HR7 B;  1IKL A;  5LHY 1;  5C5L A;  2XVS A;  1ILP A;  4OO1 H;  2PMZ B;  3A54 A;  5M5Y B;  2FJ2 A;  1TS5 A;  1AP0 A;  4DK0 A;  1B50 A;  1X3Q A;  1O80 A;  3IL8 A;  3MXG A;  1U9R A;  5IGE A;  1HXY D;  2ID0 A;  4FP5 D;  1NR4 A;  4IUQ A;  1EEF D;  3MFG A;  3J81 L;  1EZ6 A;  5ELF A;  3P20 A;  2K5W A;  4G7O C;  1LV9 A;  4I65 A;  4XYO A;  2MPM A;  1WTW A;  1AZQ A;  2E2J B;  1ESR A;  1HA6 A;  1MSH A;  3AMU A;  2F0L A;  1TWH B;  1SYE A;  3PIP 3;  3HOZ B;  1F2L A;  5ELC A;  3GTO B;  4IUV A;  3SR1 A;  4R8I A;  3S2H B;  3IFD A;  3HS0 C;  5IOC A;  1SEB D;  3S16 B;  4KTA A;  3OWE B;  5DM7 3;  4J1M A;  5KYL A;  1WVL A;  5I6Y A;  1IW7 C;  2Z4I A;  4ZRZ A;  3GD7 A;  2H1E A;  1EY4 A;  1H9K A;  1PTO C;  1YNJ D;  1LAC A;  3J7A V;  1BCP D;  1RCV D;  2NUC A;  4CKB A;  3OIQ A;  2OF1 A;  2IL8 A;  2JEB I;  1JOQ A;  5KGU A;  3M7N A;  3TN2 A;  5I2X A;  3X3N A;  3ITP A;  1PDQ A;  3MHB A;  1EY8 A;  3NTI A;  1QG7 A;  2XRQ D;  3S1M B;  2O5J C;  2KHS A;  1QE6 A;  4IUN A;  1STH A;  4RGM A;  4BY7 B;  2IPK D;  1G29 1;  3QIA A;  1MBY A;  3D3R A;  3M4Y A;  2NN6 G;  2XN9 C;  1F2Y A;  4F87 A;  1LT3 D;  4B9X A;  3SHL A;  2AUJ D;  5E4W C;  4HED A;  4C3I G;  1TY0 A;  2F0U A;  2EYO A;  1SMY C;  1QJO A;  2D5D A;  4RCN A;  5C3X A;  2M2L A;  2F0V A;  4Q0F A;  1LTB D;  1SYG A;  3GV6 A;  3PUY A;  2LFN A;  2D62 A;  3M4O B;  5T1G A;  1G8Z D;  3HEJ A;  3OIP A;  4O42 A;  4IFD G;  1JCK B;  1BOS A;  1KLU D;  1VMC A;  2MP1 A;  5JOB A;  1TWG B;  3K5O A;  3IFT A;  2KCN A;  5JJZ A;  2O2L D;  1UNS A;  2F0Q A;  3U9O A;  2EY1 A;  4J6H A;  1GHJ A;  5A35 A;  3VR2 A;  1BXT A;  3EJI A;  3R2T A;  4A3E B;  1PRT F;  2A68 D;  3SXH A;  4KJN A;  4DU9 A;  2E76 C;  4B08 A;  1AN8 A;  1BCP F;  3M85 A;  3VR4 A;  1V1P B;  1TII D;  2F0O A;  3TDQ A;  5BN4 A;  2KCC A;  4UDU C;  2B39 A;  5KYI A;  3JAM L;  5CV9 A;  4IUP A;  3LWE A;  4K8J A;  5BN5 A;  3VYU A;  2CQA A;  1KDA A;  3RUZ A;  2AQ3 B;  3V2T A;  3ZYY X;  3O13 A;  1SYF A;  2KUM A;  2RDG A;  4A3D B;  2J7Z A;  3SK4 A;  3VR3 A;  2L0C A;  1RF2 D;  4BWG B;  4RKL A;  3MXU A;  3F2U A;  5KRU A;  3M7G A;  3TP8 A;  3ONA B;  3URY A;  5AFW A;  4KK7 A;  1B9N A;  4L6T B;  4H0L C;  3OSO A;  4RGO S;  3HOV B;  4A3J B;  2JA8 B;  2EY5 A;  1HCZ A;  1HUN A;  4K5V A;  4Y7N B;  4XIG S;  4P2C B;  3Q0A A;  1SJH D;  4KN4 C;  4KY6 A;  3PO2 B;  4K2K A;  1T5E A;  2SEB D;  1PTO H;  5J1Z A;  1XWE A;  2O4X A;  2L11 A;  3GTJ B;  3A7A B;  4KV6 A;  2FHT A;  4A3B B;  3H6M A;  1EY6 A;  3G7L A;  1LTT D;  5FO7 B;  5J39 A;  2Y0S B;  3NE5 B;  4XQJ A;  1PYW D;  2F0P A;  1HA5 A;  5JVG 3;  2B2Y C;  3V96 A;  1BF4 A;  3MFY A;  3I4M B;  5C4J B;  4TKO B;  5KIX A;  4BY1 B;  1ZXT A;  2EVB A;  1CTM A;  1HPC A;  2XSC A;  1UEA B;  2QKI C;  4MHE A;  2PZT A;  3E0J A;  1J9O A;  2B2T A;  3BVM A;  1E0B A;  1MSG A;  2A69 C;  1OO9 B;  3D4W A;  2AQ2 B;  1FNW A;  1M4V A;  1AFP A;  5FLX E;  2B2U A;  1GUW A;  1E2Z A;  3D4R A;  3GQB A;  3S1R B;  1B2T A;  1GOZ A;  3I4N B;  1ESF A;  1B53 A;  4IFD H;  2B63 B;  3DM1 A;  1D2B A;  2F0H A;  3W2D A;  1GUS A;  3R3O A;  4ZUI A;  4Q5V A;  2RSO A;  1S5D D;  1QCB D;  1SJE D;  4K5W A;  3CU7 A;  5IGF A;  5M5X B;  1FNV A;  4XT3 B;  3C46 A;  5CV6 A;  1F77 A;  4BBS B;  2EZV A;  3T51 B;  1F9S A;  2L55 A;  2EE1 A;  3S9W A;  3UI2 A;  3N52 A;  3V05 A;  1PFB A;  1XYI A;  1RD9 D;  4PMB A;  2I46 A;  5DEH A;  4U67 3;  4HCE A;  1F2Z A;  4L8J A;  4KD3 A;  4M1U B;  1YNN D;  2VB2 X;  2WV6 D;  2NB0 A;  5IGG A;  2JA6 B;  4C3H B;  3VA7 A;  4RGT A;  1LTR D;  1UAP A;  3TP6 A;  3HOX B;  2L9H A;  4C56 C;  5IT9 E;  2F0S A;  1EY7 A;  2WKC A;  1DYQ A;  2KEE A;  3RD4 A;  1SYB A;  4KMU C;  5A2Q E;  2PYK A;  4AYB B;  2G9H D;  3NHH A;  5BN3 A;  3H3V C;  1DD2 A;  1FGB D;  1EOT A;  1VF5 C;  3CRK C;  5CR3 A;  3K57 A;  1D5M C;  2VXW A;  1D5Z C;  3K5N A;  3T4A C;  2E2D C;  2PZU A;  3NQI A;  4C3I B;  2IT1 A;  5I6W A;  5JVH 3;  3TZD A;  1TQO A;  1I6V C;  2BOS A;  3N6R A;  4OIJ A;  3P75 A;  2A68 C;  2I07 B;  1PRT D;  1A2T A;  1SNC A;  4A3M B;  2SNM A;  3DWP A;  4FXG C;  2Q8T A;  1GUT A;  1LT4 D;  1Y8P B;  2DNC A;  5CV8 A;  5D3I B;  2E74 C;  3G6J B;  2NVY B;  1TR5 A;  4A3F B;  1VDZ A;  4C1N K;  4FYD A;  1LLR D;  2B2T C;  1PZI D;  1Q3L A;  4K14 A;  3BYY B;  3HZX A;  4ZKC B;  3MXP A;  3QB3 A;  2DNE A;  3I90 A;  1A3T A;  2IX3 A;  1CZG A;  5JPM C;  2K03 A;  3HRZ C;  3NSW A;  4HN7 A;  4EQN A;  1BDO A;  1ZKO A;  1RKN A;  3K6O A;  3LX0 A;  1TT2 A;  3QO2 A;  4XYQ A;  1SMY D;  2WAC A;  1ENF A;  2IW3 A;  1EFI D;  5ELE A;  1I3Q B;  2DY8 A;  1CHQ D;  5I4D A;  3K59 A;  4K6L A;  4V0B A;  3H91 A;  1JIC A;  2QEJ C;  1I50 B;  1STY A;  3DWQ A;  1CK1 A;  1HFG A;  4F88 A;  1QNU A;  2PW7 A;  2NN6 I;  4X3K A;  5D65 A;  3VR5 A;  5FO9 B;  5M3M B;  2A6E C;  3S17 B;  1KTK A;  3MC0 B;  4DGZ A;  1DM0 B;  4IUR A;  4I7Z C;  2EYH A;  3HOW B;  4KKT A;  3MTS A;  5E3F A;  3NK9 A;  4RWS C;  1JWM D;  4RA8 A;  2IX0 A;  3TP5 A;  2HDM A;  1FD7 D;  3KUP A;  2N88 A;  3D8G A;  3A56 A;  1K8M A;  1TKW B;  3KLS X;  2CVR A;  1YNJ C;  3EQL C;  2ZXR A;  1PMR A;  3D6W A;  2ZXP A;  4HCS A;  4QUF A;  5FOB B;  4IFD I;  1LAB A;  1Z6H A;  2F0W A;  1KDB A;  2K32 A;  3FRP B;  5IGB A;  5M5W B;  2MUY A;  4CJ1 B;  1Q8I A;  3FPP A;  5CV5 A;  4CJ2 C;  2CW0 C;  1JQY D;  2J4X A;  4XQN A;  3VR6 A;  4C3J G;  1NR2 A;  1GUG A;  1JOR A;  3C1E A;  1H9M A;  4G57 A;  2RKS A;  1S5E D;  2LMC B;  2EYM A;  1V43 A;  2KA7 A;  2EOT A;  3X3M A;  1L0X B;  2EJG C;  3IKJ A;  5EBD A;  1GUN A;  4BA2 I;  3I91 A;  4XTC S;  4JBW A;  3I4L A;  1SNO A;  3GTL B;  2F0I A;  2IX1 A;  3LNN A;  2EXZ A;  5IIF A;  1RTO A;  1BNZ A;  4N9P A;  4FNF A;  4XDX A;  1CZW A;  1STB A;  4HSV A;  4U68 A;  2PZW A;  4GZY C;  3ERQ A;  1IYU A;  2LY7 A;  2B8F A;  3OPO A;  1ENC A;  2B2V C;  3NPP A;  1TU2 B;  2MJ8 A;  1CT1 D;  5I9P A;  1SE2 A;  1AZP A;  1NAP A;  1MI2 A;  3C3L A;  3MXN A;  1GHK A;  4HMI A;  1TS2 A;  1CFM A;  2A69 D;  2KEC A;  2WP8 J;  2K04 A;  1V8Q A;  1JWU D;  2L5T A;  4BBR B;  2PNR C;  4QIW B;  3I3C A;  2Q8R E;  1BUV T;  4Z9C B;  1STA A;  5C5M A;  1A6X A;  1LO5 D;  1PZK D;  3BYT B;  4LK1 C;  3CQZ B;  3LWU A;  1WCM B;  1SNP A;  3A8I E;  4EQP A;  4PV1 C;  2A5H A;  2HCC A;  1WTP A;  1SYC A;  3S2D B;  4H13 C;  5FO8 B;  4ZUJ A;  1QWY A;  3CHB D;  2R3Z A;  2K1B A;  3S1Q B;  3SE0 A;  1G2S A;  5LL6 S;  5G3L F;  2ICI A;  3FVQ A;  4O1N A;  4HSP A;  5FKA C;  4NDX A;  5EPK A;  1E2V A;  4DAP A;  1C48 A;  4JK1 C;  5IOD A;  2AWO A;  1H9R A;  4B9W A;  1CQV A;  1S5C D;  4CJ0 B;  2YYZ A;  1Q90 A;  3WOF A;  4KKU A;  3KF8 A;  1Z7T A;  1HTP A;  1BO0 A;  4ZK9 B;  1B1Z A;  1PFM A;  2JE6 I;  2KQ3 A;  3GTK B;  2TMP A;  5CBE E;  1X32 A;  5C4H A;  1FR3 A;  2NWG A;  2J0T D;  2E2I B;  3PUV A;  4X3U A;  2F3V A;  3K5M A;  4ZAI A;  2V4D A;  4FF4 A;  1Y1V B;  3L9A X;  3ERO A;  1HHV A;  1JR0 D;  1I4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...