3FDTA

Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Chromobox protein homolog 5
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fdtA00
3DEOA 1O7ZA 4U68A 3R93A 4OIJA 1EOTA 2CVRA 2N88A 2N55A 3GV6A 2KEDA 4X3TA 2VXWA 4HCSA 3IL8A 1DOLA 1G2TA 4ZAIA 2KUMA 2KECA 4HSVA 4XT3B 1MSHA 2Q8TA 4CJ2C 1LV9A 4X3SA 2FINB 2RA4A 1TVXA 5D65A 2NZ1D 5COYA 2X6GA 4IUTA 1ML0D 1RHPA 4HAEA 4LMQD 1M8AA 1DONA 1RJTA 1EIHA 1PLFA 1RTNA 3P7JA 2D9UA 1DZ1A 1KNEA 5T1GA 2B2TA 4OIKA 3GV3A 1EQTA 1RTOA 2L12A 1J8IA 2K03A 1BF4A 2B2YA 2K04A 2NYZD 1G6ZA 4CJ1B 2X69A 2B2UA 4RA8A 1PFNA 1SAPA 1O7YA 1NCVA 3DM1A 1NR2A 2JYOA 2MGSA 2NWGA 5DNFA 3TN2A 1B2TA 1ILQA 4R9WA 4ZKBB 4ZKCB 3QO2A 2MPMA 2L11A 3G7LA 1IKMA 1X3PA 2X6LA 1U4LA 1NAPA 1CA5A 5EQ0A 3UI2A 1ESRA 2KOLA 5CMDA 2DY7A 1JE4A 4CJ0B 1WTWA 5CBEE 4UAIA 1BBXC 1O80A 1PFMA 1XX8A 3Q6SA 1WD1A 2FMMA 5AFWA 1HUNA 4NW2A 4X3KA 2EPBA 2B2YC 3I3CA 1QNKA 2RSNA 3D6WA 5EPLA 1WTXA 1JICA 1RODA 2L4NA 2RVLA 3ONAB 4IUVA 1SSOA 1ICWA 2B2TC 2EOTA 2J7ZA 4O42A 2RSOA 1S4ZA 1WTVA 3I91A 2FFKB 2H1EA 2HDMA 1F9QA 4RWSC 5EPKA 5EPJA 1HFNA 1CA6A 5EKIA 1NR4A 1ZXTA 1EIGA 1F9RA 2JP1A 1BNZA 1HRJA 1U4MA 1QE6A 2FHTA 3I8ZA 3N52A 1IL8A 4IUPA 4MN3A 4XT1B 3MWYW 4IUQA 1C8CA 3KBXA 3SVMA 1F9PA 1Q3LA 1MSGA 1HA6A 1U4PA 2HCCA 2B2WA 4DN4M 1DOKA 3MTSA 1MGSA 2K01A 2B2WC 2XIWA 1B50A 4IURA 1B4OA 2MJ8A 1WTRA 1PDQA 1QG7A 2KVMA 1HFGA 4QUFA 1X32A 1WTQA 2HDLA 1B3AA 3FDTA 1GUWA 3KUPA 2R3ZA 1WTOA 1WVLA 2K1BA 5CORA 1DOMA 1X3QA 4X3UA 5E4WC 1J9OA 1EL0A 1AZQA 3I90A 1WD0A 4MHEA 3TZDA 4R8IA 2MP1A 1AZPA 1A15A 1G91A 2M2LA 5D14A 2HUGA 1B53A 2SDFA 5E4XA 2K05A 3IFDA 3LWEA 2BDNA 2L9HA 3DEPA 3FPUB 2HCIA 3F2UA 1SDFA 2B2VC 1G2SA 3HP3A 1F2LA 1PFBA 1BO0A 1KNAA 2B2VA 2EE1A 4XDXA 1CM9A 2B2UC 1E0BA 1AP0A 1F9SA 1U4RA 2L1BA 4RAUC 4QUCA 1WTPA 1XYIA 3H91A 1HHVA 2Q8RE 5CBAE 1VMCA 2K28A 4HEDA 1ILPA 5EJWA 2FJ2A 1IKLA 2KEEA 2IL8A 1HUMA 4ZLTF 1MI2A 4IUUA 4ZK9B 1VMPA 2DY8A 5JJZA 5T1IA
chains in the Genus database with same CATH superfamily
1VQHA 1EOTA 2CVRA 4A4IA 1X3EA 1TWGH 1WCMH 4DK0A 1FJGQ 1KDAA 1QCBD 3IFTA 3CQZH 1LV9A 2WKDA 5D65A 1TWFB 3BG3A 4B9XA 2E2JH 4C3JB 4JOIC 5COYA 3W5OA 2AQ2B 3T1YL 2PW7A 3GTMH 2D62A 1RDPD 1FNWA 2R92G 2LMCB 4K5XA 3BZCA 3DLLA 3CRLC 1PH4A 3S16H 4A3FB 4X62L 2EY2A 2VY3A 1AE2A 1BF4A 1OTCA 2O2LD 5E3FA 4B3RL 4M8AA 2H5XA 2Z0SA 4YWLA 3J7AV 1Y8PB 1U4LA 2EZVA 1N33Q 2RHSB 2OCEA 2KA7A 1NNXA 2B29A 1WTWA 4OX9Q 5GQOA 1STNA 1WD1A 1EEID 3M4OH 3L3OC 1HR0W 4R1JA 4A3JH 4JBWA 2UXCL 4C3HB 3WDNA 3PO2H 1CHQD 2Q2TA 1EYAA 4ULLA 3NQTA 1M90C 3T51B 4G4KA 1S72A 3BDOA 1G51A 1EIGA 4UP9A 2A68D 3MVVA 4I7AA 1QE6A 1RIPA 3J81E 2OQ0A 5LMUQ 1CKNA 2IX0A 4L8JA 1NMGA 4BY1H 3S1NB 3MXNB 2B2WA 1DOKA 3PIP3 2K5NA 1JOQA 1PDQA 1JQYD 4B08A 1HFGA 4QUFA 1WTQA 4JI4Q 2GN5A 1I94Q 4DAYA 2B8GA 3PIOA 2QDBA 2GVAA 3Q23A 2MP1A 3R8BA 2PZWA 5D14A 4FF3A 1EY5A 3GTJB 2OEOA 3KDFA 2UXBQ 3C3LA 4FXGC 1YBYA 4CDCC 3A8KE 3SK8A 3S1RH 1Q90A 1GJXA 3JC66 1W3SA 5JEAJ 3S1QB 4XDXA 2R7ZB 1VQ5A 1AP0A 2F0VA 4OONA 1AH9A 1SROA 4LF4Q 1XWEA 2FMCA 3Q0AA 4ZLTF 4IUUA 4IUVA 1VMPA 4GN4B 1JT8A 5FO9B 1G2TA 2JA9A 2VB3X 3IL8A 3RZDH 1AN8A 2EXZA 4A3JB 4K8IA 1L2FA 4IUTA 1LACA 3PO3G 3HOUG 2HIVA 1CTMA 4K5WA 4HR7B 2ZXOA 3RLFA 3GV3A 2RCFA 2P5ZX 4K2KA 2RHQB 3K8AA 2F0WA 1SE8A 3GDEA 4H0LC 1SFOH 4JI7L 2SEBD 4NPSA 2MGSA 3K7AB 3A74A 5DM63 1KRTA 1JE5A 4IUNA 4R9WA 1AE3A 3I55A 4A3EH 1T5EA 5CGKA 1G8ZD 4BWGB 1NAPA 1VCIA 2XRSD 1G6ZA 1XJVA 3M4QA 2E2JB 5AFWA 3HOXG 2R93G 1QB5D 3CQZB 4DR6Q 4IPDA 2V4DA 2KQ3A 4K0KQ 2B2TC 5J3BA 3DUZA 3S17B 3CCMA 4RCNA 4UHVA 1ZXTA 2F0MA 2UU9Q 2EJFC 1H9SB 3U58A 1YVCA 3CC2A 3UE1A 2DN8A 3ER0A 1D6EC 4LK1C 5IP9H 4N8X1 5JAVA 1DM0B 2ZJRA 1QG7A 2HDLA 1E24A 1JORA 1HXYD 2R3ZA 4GLXA 4LFCQ 4IJLA 5I2YA 3TZDA 4FF2A 5CV5A 5I4DA 1EY4A 4ZCKA 4H7BA 3FKIG 2K05A 4O2DA 3SK5A 3QIAA 3UDXA 5FKAC 3DEPA 3FPUB 1RD9D 4MIUA 2F0OA 1QWYA 1VQAA 3J80i 1BR9A 3P20A 3CCEA 2F0LA 3H0GH 4FXKC 1CQFA 2A6EC 3AYHB 4DR3L 3D4RA 4J15A 5AJ3Q 1ILPA 1F2YA 4BBRH 3PUXA 1TWHH 4X6AH 4HMIA 1RCVD 1SYDA 1BBWA 1MSHA 3T1YQ 2NUCA 3BVMA 4YHHQ 4KTAA 4X3SA 3Q24A 1B1ZA 2SOBA 3K5NA 3HOVB 3FVQA 5DEHA 1ML0D 1EIHA 2NTSA 4JI4L 5I2XA 2EQSA 3M85A 5T1GA 1JJ2A 1K0RA 4H13C 5CV4A 4HIDA 3PMFA 3STBC 1OXSC 3I4OA 5DNFA 1N36Q 1WYDA 1VQIA 4NMZA 2IX1A 1JCKB 3NXWA 3HZXA 4A3IB 2X6LA 5CV9A 1TWCB 1ICFB 3K57A 2XN9C 3Q6SA 2I07B 4LF8L 3HOZB 1VQDA 4A93H 5KEEA 1E1OA 2BCOA 2XNAC 2CW0D 3S15B 4FP5D 2MO1A 2L4NA 2WP8J 1STHA 4IFDI 4IJHA 5IYBH 1FGBD 1VQLA 3PCOB 5LMNQ 4JI8L 1XMOQ 2KCMA 2EY1A 1STGA 3EFXD 4A3EB 2Q2HA 3GTQH 1UEBA 1PH6A 3A55A 3J80E 3MFGA 3VDYA 1XNRL 5M3MB 2VZAA 2Z6BA 5C3EG 5FO8B 1VQ9A 5CC4A 4LNQA 3SGIA 4LFCL 1QVCA 4DAPA 4ALPA 3TS0A 1KDCA 3A56A 1ONLA 3L9AX 3B6YA 4X3UA 3MAQA 4C1NI 4A3MG 2F03A 4R8IA 5IWAL 1SNPA 1EYCA 1MHWC 4B9WA 5EAYA 2HUGA 2EYFA 2WAQB 4DV5Q 3P1HA 3IFDA 2NZHA 2BDNA 2BDOA 1C9OA 1QNUA 1EY9A 4OO1I 1L1OB 2HCIA 2HHHQ 1E2ZA 4K14A 1Q1EA 3MZ5A 3G4SA 3D6CA 1N36L 3I2ZA 1DYQA 3CCQA 1JWSD 2B2VA 4A3GB 1NUCA 3NK9A 1A0IA 5BR8L 3FRPB 3AFPA 3TS2A 3EN2A 3PUZA 3FHWA 4GOPB 1VMCA 5IT9E 4K0KL 1V1PB 3UDGA 2IL8A 4DNIA 4J6HA 2F0EA 2JEBI 5EGTA 1K9MC 2NVQB 1CFMA 1HTPA 2N88A 5JVG3 4M1UB 2I46A 3BZKA 1PMRA 2LXJA 3X3NA 1WFQA 4JI1Q 1MBYA 2RQXA 4P73A 4WJ4A 3S2DH 1Q8KA 2E8GA 4A3KB 4A3CG 3M4PA 3RUZA 4DUZL 1VDZA 3QJYA 4JI2L 2BH8A 1DONA 1RJTA 2Y0SG 1KQSA 3SHLA 4JPBW 5IP7H 3CC7A 3ULPA 1A8VA 4WJWA 1CSPA 2B2YA 2IPKD 2AWOA 4C1NK 1NCVA 4DV3L 1VQ8A 3D4WA 1YJWA 1EUJA 2EYLA 2MPMA 2R61A 4KMUC 3SK6A 4H44C 5EKLA 1CA5A 1VF7A 2K50A 1PVOA 1HTLD 4CJ0B 4UAIA 1XX8A 2FMMA 1IYVA 1EU4A 1R9TH 1YEZA 4RGMA 5AJ3L 3I3CA 3BJUA 4C3HH 2QA4A 4LJZC 3MXNA 3ONAB 5FOBB 3QB3A 4Y52H 5GROA 5C44H 1CKNB 1TS2A 5IT9c 1IBKQ 1EY8A 2O5JC 4QL5A 1T9HA 4DR1Q 3BYYB 4ZUIA 4KKUA 3QG1A 4DA2A 1F9RA 1DGSA 1M4VA 3CCRA 3I4MH 1BCPF 1IL8A 3A0JA 5LMUL 2L5TA 2JA6B 4L5QA 2UU9L 3C46A 1DD2A 1LT5D 1HPCA 1SNMA 4OELB 1MGSA 1IBLL 1WTRA 1B4OA 2EY6A 2VUMB 3S16B 1TQOA 5L37A 2R93B 5KIXA 1QZGA 5FO7B 2I0QA 3P75A 3K0YA 1H9JA 4MZ9A 1D7QA 1J9OA 1JJCB 4B3RQ 4MHEA 4JI0Q 2PPBC 4A93G 1ENFA 3HOWG 2YTVA 1H9SA 1GXDC 4QIWB 5I6WA 3MXUA 2L9HA 3HRZC 4N8FA 4IPCA 1A3TA 1S5CD 1A6XA 5ELFA 3J81i 4GKJQ 3OIPA 2OXPA 2Q8RE 1HZCA 4JYAL 4A3IG 4JBMA 3I4MB 3TP7A 2QDLA 1TR5A 1V8QA 1CQVA 1Q12A 1VQ4A 3J81j 5M5YH 3CW2C 2KCTA 1SE4A 4OIJA 5C44B 4ZAIA 2QW7A 1SEBD 3NP8A 3JAMi 4RGNA 3VR6A 1PXUA 1I6HH 1G6PA 1TKWB 3BVGA 4A3BB 1SMYD 4QJFA 2WAQG 3K5LA 4HTHA 4X62Q 1DJRD 5EBCA 1UWVA 1XMQL 3CMEA 1T5XD 2ZT9C 1EQTA 2L12A 4A75A 4NDXA 1SAPA 2CW0C 2KJXA 4JI0L 1B2TA 4DF7A 2D0PA 4DK6C 3G7LA 1UE6A 3V05A 3H09A 3E5SA 1I4GA 3PGZA 3I4NG 2CCZA 4C2MH 3TMEA 4X65Q 3U4VA 2K14A 4OWTB 1S5FD 3MEHA 3NWSA 1LTAD 5C4XB 1LTSD 3J80L 1PTOC 4DV4Q 3PF5A 2RSNA 1WTXA 1NY4A 1SSOA 4O42A 2RSOA 1V1PA 4RKBA 4HJ7A 1PH7A 3W1GA 4DR5L 4A3GG 2DJGC 5IIFA 3DWAA 4NXML 1H9MA 3UDIA 4CDFC 1XNRQ 5ELEA 1WOCA 4IUQA 5JOBA 5D3IB 2VQFL 1GOZA 1UE5A 1SYCA 1MKHA 2KCCA 2M00A 1U4PA 2PO4A 4A3GH 3RNUA 2LSSA 4Y7NB 3LGJA 5JJKA 2MQHA 3A7AB 4RKLA 4V190 1X32A 2CHBD 2I5LX 4JI7Q 4OWXB 1RF2D 1JB3A 4P72A 1XPRA 2E76C 4S3SA 4QMGA 4I7ZC 1BVSA 1G291 5C5MA 2ZXPA 1GM5A 5EBDA 2E2IB 1SR3A 1LT6D 2QCPX 3JAME 4POFA 3R3OA 4QB4A 2F4VL 4HSPA 2DUDA 3NTHA 2NZOA 4GKJL 3OW7A 4IFDG 4HJ8A 1SNCA 2VQEL 4DV7Q 5HGQA 5ELDA 2OTLA 3AEVA 4G7OC 3GTOH 1IBML 4HEDA 1L1OA 2PQAB 1SYBA 2BA0A 3NBHA 2DY8A 3BU2A 4JW0A 3ZJYC 1O7ZA 2XVSA 1AZPA 4G57A 3I73A 3J7A5 5HGTA 2KUMA 4QGUA 3S15H 5IYDH 1PYWD 2M9VA 3S1MB 1I4QA 4YWKA 3TDQA 1K83B 2XWBB 4JOIA 4DFAA 1HQMC 1UE1A 1JB7A 1RTNA 3P7JA 1CZWA 4A3IH 2F0GA 1CT1D 3C1EA 5M5WH 2ZM6Q 2DJFC 2NYZD 1X3FA 4DKAC 4G7ZC 4KHPQ 1V43A 2NTTA 4RA8A 3PIPA 1U0LA 4C3IB 2RCNA 3QO2A 3TSSA 3KF6A 1N8RC 3E0EA 4N9PA 2WAQE 2XRQD 2ICEC 3UI2A 3AMUA 4DR6L 1BDOA 2E5LL 1QZHA 4PZ6A 2E2HH 2R92B 1S40A 2EYOA 4B3TL 1XNQL 1N32L 1LUZA 3I72A 1YZ6A 4GN5A 5EPKA 4IFDJ 3HOYB 1PA6A 3OIQA 1JOOA 2MUYA 3HKZB 2A1AA 2FHTA 3KLSA 2YV5A 1KABA 3CKIB 4IZ8A 1V1QA 3H0GB 4UY8C 2K01A 2B63H 5C44G 4BY7H 3AFQA 1GVPA 1B3AA 1LM0A 4JI5Q 2NVXB 4C3HG 1EL0A 2YTXA 1IBLQ 3A5ZB 2K75A 2K7VA 2PI2A 3H0GG 1UAPA 1YJNA 2ZM6L 3G6EA 4ZRZA 4KN7C 1PRTF 1L0YB 4OX9L 3CAMA 4IFDH 1CI3M 1J5EL 1CHPD 1FVIA 3QOLA 2ASBA 2O4XA 1HNXL 4LF5Q 4HIOA 1E0BA 3FEWX 1PZID 3WWVA 3ULJA 2N78A 5H1SE 2O5IC 4BBSG 2LS01 1DCZA 4U673 1PYBA 2PYKA 4IQZA 4G7HC 1WJJA 1P8LA 2NN6I 3S17H 5BN5A 4PV1C 5J1ZA 1JWMD 1XTDA 1HNZQ 5HURA 2KCNA 2EYHA 4DUZQ 2WFWA 1I94L 3H3VC 5C6AA 3MC0B 4DR7L 1PRTD 3VR5A 2D9UA 1DZ1A 2GVBA 5TSSA 1U5KA 4PMWA 1GUSA 2K04A 1XXGA 1SE3A 3E6ZX 1NBWA 3PIO3 4HIMA 2L11A 4K6LA 4OWWB 1VQOA 1OXUA 2D2CC 4C3JG 1LTTD 4WORA 1Q46A 2PMZB 3JAMc 3PO3B 2RDGA 3M4YA 1PRTB 2WACA 2RBMA 5I9OA 5EPLA 1HCZA 1YJ9A 1KHIA 1WI5A 2PQAA 5C3EH 3I91A 4DV0L 2AMCB 2R7FA 2JA5B 4IO9A 2OQKA 5EKIA 4AH6A 3K5MA 2UUBQ 4WJ3M 3NENA 4FVMA 3ND8A 5DM73 1EIFA 1AEXA 2K5HA 4GOPC 1C48A 3ZYYX 3CF5A 1A3VA 2R7ZH 4A3DB 4UPAA 3LNNA 4L63B 2AHOB 4YY3Q 5C4XG 1ASYA 2KVMA 2LKVA 3MEFA 4JI5L 5A2QL 4AIMA 3OWFA 1GUWA 2F52A 5CORA 3PV0A 2TMPA 5E4WC 1D1KA 2K32A 1FGUA 3K0XA 3GTJH 1UNSA 3KLSX 5CV7A 3SE0A 2R7DA 1YNJC 4PZ7A 5A35A 1YNXA 4B3ML 2WKCA 2B2VC 1LT3D 3BYTB 1JC7A 5C4ZA 2HIXA 4ZUJA 2QEJC 2A19A 2B2UC 2N8NA 1VQMA 4RMFA 2J0TD 1QUQA 4RAUC 3S1NH 1TWAB 1FD7D 5KNCA 4NXNQ 3DMUA 1E7ZA 3HOWH 1JOKA 4P2CB 3KJOA 4X3TA 1F2MA 4CDEC 3PUWA 4UDUC 2N49A 4DAVA 4XQQA 4JI2Q 4DNRB 3M4OB 1HJPA 3HKSA 3EJIA 4XQNA 3NBHB 4JBJA 2R7ZG 1RHPA 2LY7A 4DR2L 2IY5B 3T56B 5IYDG 1I50H 3NWTA 1TY0A 3S14B 3TQYA 2F3WA 4Q5VA 1VF5C 3DWQA 4A3FH 3CU7A 4DK1A 1HQRD 3BDLA 4YCVA 2A68C 4KHPL 2JJQA 3GTMB 5CMDA 4X66L 4DR4Q 1SBBB 4C3JH 4B3MQ 3M7GA 2NN6H 1B3QA 3D6WA 4I65A 4EQ5A 2HT1A 1Q82C 2F0FA 1TWGB 4V0BA 2AQ1B 1S4ZA 4Z9CB 2YU9H 2Z6KC 1A62A 1SMYC 3PUVA 1S5BD 1BCPD 1EY0A 5IP7G 1IZ6A 3CPWA 4A3CH 3KOJA 5M3FB 4DV1L 1BBUA 3H3VI 3D8GA 2EVBA 3JAML 4BXXG 1ET6A 3CPFA 1XMQQ 2K5VA 4APVA 1NTGA 2MJ8A 4BXXH 5JEAG 3FDTA 1HNWL 2JN4A 4PQXA 3M3YB 2WB1B 2F0QA 2K5WA 2UUCL 4K8JA 2E74C 4CDDC 4QQBX 3BZDB 4LFBQ 2I5MX 1D8LA 2F0IA 2MHVA 2NN6G 1X56A 2VL6A 3NSWA 1EFID 1TU2B 1CSQA 4P75A 5CR3A 4BA1I 2OF1A 4O1NA 3KBGA 1KNAA 2L15A 3I4NH 1C7YA 3FKIB 1IBMQ 1K8AC 1XYIA 3H91A 2UUAQ 1EQVA 2Y0SB 2AUKA 1CUKA 2K28A 4JI3L 4DV6Q 4LF5L 2SNSA 3GD7A 4DNTB 5FLMG 4R4IA 3HOUH 4JK1C 5ELOA 4U68A 3A7LA 1XMOL 3GTGH 3GTKB 3GV6A 4AQYL 5M5XB 4A3MH 4DR1L 2LFNA 3KYHC 1C4QA 2Q8TA 1KAWA 4CJ2C 4F7XA 2FINB 1Y1WH 1QILA 1R4PB 1HNZL 4AYBG 1ZYRD 2Z4IA 3K6OA 2Q2IA 3NBIA 2PZTA 2NVXH 4HMJA 3G71A 4PNYA 1SXTA 1I3QB 3RLOA 2PQEA 2B63B 1E1TA 5KNBA 3HOXB 3AB9A 1IYJB 5FK9C 1PFSA 4DAYB 4KI0A 1LYLA 3RN2A 1X3PA 1GUNA 2E2DC 3RN5A 1ESRA 5CYUA 1TXYA 1B44D 5NUCA 3GTLH 4LAAA 4AYBE 1EQRA 1PH3A 1L0XB 5LMNW 3KLRA 1D2BA 4X3KA 4EQNA 3OTOQ 4DUYQ 2ZJQA 1KDBA 3RZOH 3J7ZC 1Y1VB 1IHZA 2ES2A 4NXMQ 4ZQ3A 1GUTA 2E2HB 1QOHA 1YITA 3LX0A 1F9QA 4LUVA 2BE5C 3HOZG 3ITPA 2IHEA 1BUVT 2A6HD 3U50C 2F0KA 4BY1G 3L7ZC 1BNZA 4CHTB 2EIFA 5C4HA 3DXJC 1RL2A 4MN3A 4JI6L 1C8CA 2G9HD 3SVMA 1Q3LA 2UUBL 4DN4M 2K5QA 1TY2A 2EYMA 3S2HB 1II3A 4N9TA 4KKSA 4EQOA 3O13A 2Q2UA 3I70A 3D4DA 1DOMA 3STBD 5C5LA 1UEAB 4J8QA 5K36G 2AKWB 2SDFA 5CV6A 5E4XA 4TVAB 4OHJA 1NE3A 4UP7A 1LO5D 2VQEQ 4DV7L 3NQIA 2R6GA 1F2LA 3MA2B 4NXNL 1BO0A 3NUCA 4FXDA 2L0CA 3BVZA 1CM9A 1J6QA 1EOVA 5CBAE 1SYGA 2Z4HA 4CGYB 1EWCA 4GNXB 1TS5A 1FL0A 4FF4A 2KEDA 2PW5A 1LTRD 4HSVA 3M9BA 3VR4A 1PZKD 1EY7A 1A3UA 4E6IA 3RZOB 2NZ1D 1K28A 1SNDA 5IP9G 4HAEA 3GTLB 5LHY1 1F77A 3OWEB 4HCEA 4ABNA 4GZYC 5GADC 2MNAA 4ILWA 1A63A 3OW2A 2ALYB 3HOXH 1Y69U 3ICEA 1VQGA 1SN8A 2F0JA 2B2UA 1I3QH 3QWNA 4O0AA 2KHIA 3HGBA 4BBSH 4ZKCB 1BQQT 3AQQA 1Y14B 3NPPA 1IXRA 2IW3A 2XSCA 1IYUA 1HR0L 4JC0A 5CBEE 2VNUD 2E75C 3OTOL 3BS1A 1UUPA 5IE8A 2Z1CA 1NJIC 4L5SA 3SDZA 1QNKA 3J81L 5BN4A 4RH6A 2EOTA 3GTKH 2FFKB 4XYQA 4RHRA 1VQJA 3U4ZA 1PH8A 5G3LF 4HJ9A 4HJ5A 4ODGA 2CQOA 1SLJA 1Y8OB 2JE6I 3VYRA 4ZYSA 4KJOA 1VQFA 4BY7G 2B63G 2A69D 1HA6A 2A6ED 1PTOD 2F0PA 2WINB 2QILA 3TP6A 2JA7B 3L0OA 1IW7C 1K8MA 2K6AA 1K3BC 1C0AA 2M2LA 4A3BH 2Z9HA 5IYBG 4X64Q 3OYYA 3LWEA 2RDHA 4C56C 4P74A 3EA6A 3I4LA 4Q0FA 1X55A 4GNXA 4X65L 3HP3A 2UUAL 4DV6L 2EE1A 4RCOA 4FF1A 4JVZA 4F87A 2JA8H 3J7AF 3TZUA 5JPNC 5F2DA 1Z47A 2K4KA 3C1FA 2PCFB 2YU9B 1HZAA 1FR3A 4HCSA 1DOLA 5FJ8G 2WB1E 4R8NA 1STBA 1YNND 3IRBA 3K80C 1FNUA 1PH2A 1HA5A 1PHJA 4LMQD 3RMHA 3PUYA 1EWHA 3T53B 3I4MG 3QOJA 2VUMH 4OIKA 2PNRC 4LWCA 2JK8A 1Q8IA 3DHQA 1B9NA 3NEMA 4CJ1B 2X69A 3EBEA 1PFNA 4DV3Q 3PO2G 1MIUA 1NR2A 4KV6A 1SYEA 4UP8A 4DV2L 1ENAA 1S3OA 4R4OA 4GLVB 1I50B 4KHVA 4OEMB 4KN4C 1KLGD 1VQNA 2DY7A 3U9SA 1PH9A 2YTYA 1K8OA 4X66Q 4DR4L 2EPBA 2QKIC 4GNXC 3TREA 2EJGC 3UE0A 2IJ0A 1ICWA 3OHXC 1IBKL 3SXHA 5G3LD 1Q7YC 1AW7A 4RWSC 1SMXA 2TSSA 2A8VA 5EPJA 2FXQA 3VYSA 3HOWB 4JYAQ 1HFNA 3A54A 2A6HC 1PH5A 2NVTH 1TWAH 3S24A 4BA2I 4A76A 2XGTA 1TS3A 1ASZA 3J81c 4F8MA 3WOEA 5C4JB 1RKNA 4EQPA 3MFYA 3IAYA 1O78A 2PZUA 2K1BA 1EU3A 5E7NA 1KL9A 1LTID 4HJAA 1X54A 1AFPA 2Q8IB 5LL6X 2HD3A 4A3KH 4LFBL 1GO3E 2EYPA 5C0XH 1EEFD 2CH4A 2NVQH 1PFBA 1P16A 3NTKA 1QVFA 2HHHL 1VQ7A 4TKOB 4L5RC 2RF4A 1ZEQX 3UDFA 4RGOS 4A3EG 1KD1C 4LF7Q 4OXPA 2FJ2A 1GHKA 5C0XI 1MI2A 5BN3A 2JA5H 3MHBA 5T1IA 2IX3A 4CKEA 3DEOA 1OXTA 4MNOA 5C3XA 5C3EB 1CK1A 2KECA 2DNCA 4YIJA 1R4QB 4KD3A 3PO3H 1HNWQ 4CKCA 3X3MA 5E1FA 2YYZA 4XIGS 1M8AA 4JI1L 4EVOA 3GTPH 1PLFA 4KHZA 3OMGA 4POGA 1B70B 4WRDA 5IT9L 5GAGC 3OSOA 2I5HA 2UXDL 4AYBB 1PTOF 5KNDA 1K73C 3GTQB 1HR0Q 1H95A 3ERSX 2JYOA 4KLKA 3TN2A 2NWGA 2VS1A 4ZKBB 4JV5Q 2JA7G 3F2CA 3HEJA 2KOLA 2G5DA 2DNEA 5KRUA 1BBXC 5IOCA 4K6DA 1MJCA 3EVQA 2JSOA 4DAMA 2AQ3B 2B2YC 4TQUS 2KENA 4DXFA 1Y1VH 3CD6A 5JJIA 2GA4B 5D3DA 1L0WA 2EXDA 1KXLA 2JXMB 1K8GA 4A93B 2H1EA 2B3GA 1TWCH 3F2BA 1U9RA 5IGBA 3EIVA 4WFN3 1KLUD 1U4MA 3ERQA 4R4QA 3T1HL 1N34Q 4QIWE 4XT1B 2NBFA 2IWHA 2L55A 2F0TA 3F1ZA 2Z8LA 3KFUA 4DR7Q 2C5CA 1I4XA 1PTOH 2XIWA 3H15A 2Z6KA 2ZTCA 1WTOA 1X3QA 2PMZE 2PI2E 3NE5B 1I4PA 4EGVA 1STAA 5FLXE 3HOVH 4JBKA 2EY5A 1Y1WB 5ELBA 5KYIA 2BOSA 5JJLA 3IKJA 2RDFA 3M7NA 1BOSA 1N33L 3RLNA 5M5XH 4H02A 1M1KC 2CWPA 3K58A 1D5MC 1TT2A 1V1OA 1TWHB 1PTOB 4IOCA 4A3DG 2A69C 3HOVG 5C3WA 3R2IA 3HOUB 3DWPA 1F9SA 1GUOA 1LT4D 2F1MA 4LF9Q 2UXCQ 3U9OA 4ZK9B 2BA1A 2SNMA 1YHBA 1XTCD 1IKLA 3FKIH 1HUMA 3I4NB 3T4AC 3HOYH 4BS9A 4B3TQ 1XNQQ 3A5UA 3K5OA 5ELCA 1PV4A 5FLXL 2R92H 2A73B 3FP9A 2BH2A 5ELNA 4XQJA 4YY3L 4DK3C 4PG3A 3W2DA 3M3YH 3K59A 1EYDA 4C3IH 2B2TA 1B9MA 1JWUD 4ID6A 3SEBA 2KHSA 3KDFB 1EQQA 5M9OA 3D3RA 1X3GA 3E9IA 3EQLC 1W6KA 5IY0A 1ILQA 2MO0A 5EKKA 1A2TA 4KY7A 1FYCA 4QF4A 4RG1A 5M3FH 3VYUA 3HS0C 1IW7D 2B39A 3GTPB 1QJOA 1JE4A 1K83H 4XTCS 1O7LA 1O80A 2A5HA 1D5ZC 2ICIA 3E3XA 4LUOA 4NW2A 1K0SA 1LTBD 1KTKA 3TRZA 4GKKL 1JICA 2RVLA 3MXPA 4NP5A 1A2UA 3AU7A 2G9DA 2HDMA 3D0FA 4DR3Q 3FPPA 4DPGA 1BKBA 4KJNA 4AQYQ 2QGQA 2C35B 3K7AH 2AWNA 3MWYW 1QVGA 3S9WA 4K5VA 1GD7A 1FNVA 1MSGA 3L2PA 1SFOB 1CKMA 4LFAQ 1Z7TA 1STYA 3CCSA 5KGUA 3H6MA 2E2IH 3S14H 1EIYB 4KKTA 3EROA 3URYA 4DU9A 1JR0D 4FYDA 1EFWA 1PRTC 5ISRA 5M3FG 3GQBA 5C0XG 3GP7A 1SRUA 3RZDB 2JA6G 4KD4A 5C4JH 1HH2P 4K2LA 3MXGA 4IN3A 4KY5A 1V9PA 5DAUA 2L1BA 4QUCA 1VQ6A 1D5XC 3H3VH 3ULLA 2RKSA 2NVTB 2F4VQ 1X6OA 2WV6D 5EJWA 4FDBA 5IODA 2KHJA 2XWJB 1EYGA 5KYLA 3S1QH 3R93A 4LF7L 3TP5A 1N34L 1S5DD 4DV0Q 1W6JA 3DM3A 3S1RB 2VW9A 1B7YB 3NELA 4B3SL 2X6GA 1LABA 1VQEA 4JCVE 4LFAL 2CQAA 4GOPA 1YNNC 3CMAA 1RTOA 3OMCA 3KF6B 1PYSB 2F0UA 5IWAQ 4BBRG 4A3DH 5IGFA 1I4HA 3E0JA 4BY1B 4LF6L 4DGZA 3Q8DA 5FLXc 1KIXA 4PMCA 4DV2Q 3KLWA 1YHAA 5CV8A 5EQ0A 5J39A 4HN7A 1VS0A 4RHSA 5M3MG 1B8AA 3VR2A 1HUNA 3OPOA 1I6HB 2ZTEA 2D5DA 4JI3Q 3PO2B 2OTJA 3GO5A 4YWMA 2J7ZA 1Y8NB 3PSIA 3CXCA 3CCUA 1KC8C 1SE2A 3OOCA 1NSNS 1NR4A 5M5YB 1K3RA 4EX5A 2QEXA 1E3PA 2H4OA 4LUZA 1STEA 3N52A 1E2WA 4IUPA 3T13A 2F3IA 2JA8B 5C0XJ 1E2VA 2K52A 2VQFQ 4FO2A 3CP0A 3MTSA 3I7FA 2B2WC 4GS3A 4B3SQ 4ME3A 4QY7A 4YCUA 1Y1VG 1WCMG 4DR2Q 4R4CA 3R2TA 4OGQC 1A15A 4FNFA 1TWFH 3V2TA 1BXTA 2ATWA 1KRSA 2JA7H 1Q1BA 3FMCA 4XYOA 1TIID 1W2BA 3J7YW 2R93H 1O7IA 1WCMB 2NB0A 1CKOA 2WB1G 4LF9L 4A3BG 1MJEA 2JA6H 1U4RA 3H94A 1EZ6A 4DXGA 1PH1A 1XPUA 1J5EQ 1UE7A 4OL7A 4R4TA 1YI2A 3CCJA 4HIKA 1X65A 5J22A 3CRKC 1ZYRC 1WTPA 1I6VC 4JI6Q 1EWIA 2WIIB 1SNQA 2F0SA 4OO1H 1I4RA 1Y1WG 1X9NA 1BCPB 1EZ8A 2DGYA 4XT3B 5IGDA 2A74C 5IGCA 2RA4A 1TVXA 1R9TB 1N9WA 1F2ZA 5LL6S 1ZKOA 5JPMC 4YHHL 2B8FA 1HZBA 4JG2A 1D1IA 3CCLA 5K5PA 4BBSB 3TEHB 3TBIB 3W1BA 4BY7B 1YIJA 1Z9FA 3K7UC 3RR5A 2K03A 3SR1A 4DV5L 4L6TB 3TP8A 2XTIA 3W3AA 4LF6Q 3DM1A 2CKZB 4JV5L 2EDGA 3G48A 1DXMA 1LTLA 4GKKQ 1OO9B 4QCLA 3S2DB 5IYCG 2ID0A 1RODA 2F0DA 3HG9A 1VQPA 4IPHA 5JEAH 1WTVA 1I5FA 3KF8A 2NVYB 2VB2X 3CHBD 1CA6A 1Z6HA 5I9PA 2ENBA 2JP1A 4C3IG 3I8ZA 3VA7A 3KBXA 4RGTA 3VA5A 1NMFA 1ET9A 5M5WB 3HOYG 3F8TA 3RD4A 1WTHA 1VQKA 1YNJD 3KJPA 3KUPA 3LWUA 3CCVA 3I90A 3F2DA 1WD0A 5GAEC 1G91A 3WOFA 1CZGA 4IPGA 4GLAC 1B53A 2KBNA 4P71A 3S1MH 1Q86C 3PF4A 3HKZG 1ENCA 2E5LQ 1SJHD 4A3JG 4IALA 4CKBA 4NB3A 3F2UA 1SJED 4A3FG 3S2HH 3NHHA 5M3MH 2N3SA 5K36H 2F0NA 4TRDA 1HNXQ 1N32Q 1H9KA 1VQBA 1HHVA 2VUMG 3HKZE 3GTOB 2K33A 5A2QE 2KEEA 3KK7A 2F3VA 2F0HA 4KY6A 4DUYL 3T1HQ 4DV4L 5JJZA 2N55A 5I6YA 2VXWA 1XPOA 3HFZB 1GKHA 4DR5Q 3K81C 4JI8Q 5FJ8H 1SYFA 4ME5A 1MD2D 1Q81C 3E9HA 5IGEA 3HOZH 3A8IE 1L1OC 1IL2A 1KNEA 5IGGA 2JA8G 4X64L 3Q22A 4CBVA 4KK7A 1J8IA 1ESFA 1KAAA 4Y7NH 2CFMA 4PZ8A 2OT2A 1OXXK 1IKMA 1O7YA 2V1CC 2QF7A 5IYCH 3BDCA 1JJGA 2D0OA 4RFBA 2NVYH 2J4XA 3KF8B 1PFMA 2BE5D 2EYJA 4LF8Q 2LXKA 3VYTA 4GN3B 2CH4W 3N6RA 3PQIA 1YHQA 4A3MB 4LF4L 2IT1A 5LMNL 3ND9A 5C4XH 3G6JB 3GTGB 1JMCA 4BBRB 3QR8A 4C2MB 1FJGL 2K5DA 1SNOA 2CWAA 5GAHC 1E22A 2EJMA 2ZTDA 1H9RA 1HRJA 2PNHA 2C9OA 2AUJD 3D31A 1PZJD 1F9PA 5JVH3 1LLRD 4A3LG 2HCCA 4DV1Q 4NKLA 4A3LH 3CC4A 1B50A 4IURA 5FLMH 4MTNA 3VR3A 1GUGA 3J80c 2ZXRA 1HZ9A 5HY6A 1WVLA 1OXVA 4YCWA 3A8JE 2IHFA 4OO1G 2Y0SE 1AZQA 2HQLA 3T16A 2ZJPA 3I56A 2JA5G 4F88A 4TSSA 2UXDQ 3SK4A 4L5TA 5DLQE 2UXBL 4LW1A 1BCPC 2UUCQ 4J1MA 2HQEA 1GHJA 1SDFA 1G2SA 2MFIA 4MTKA 4XXEA 1LTGD 5BR8Q 2JQOA 2JEAI 3NTIA 4PMBA 4IOAA 1QUQB 1TS4A 2F4IA 1VQCA 2OWOA 3V96A 3C2PA 4A3KG 1S5ED 1EY6A
chains in the Genus database with same CATH topology
1EOTA 2CVRA 4DK0A 1KDAA 1QCBD 3IFTA 1LV9A 2WKDA 5D65A 1TWFB 3BG3A 4B9XA 4C3JB 5COYA 2AQ2B 2PW7A 2D62A 1RDPD 1FNWA 2LMCB 4K5XA 3CRLC 4A3FB 2EY2A 1BF4A 2O2LD 5E3FA 4M8AA 3J7AV 1Y8PB 1U4LA 2EZVA 2KA7A 1WTWA 1STNA 1WD1A 1EEID 3L3OC 4JBWA 4C3HB 3WDNA 1CHQD 1EYAA 4ULLA 3NQTA 3T51B 4G4KA 3BDOA 1EIGA 2A68D 3MVVA 1QE6A 3J81E 2IX0A 4L8JA 3S1NB 2B2WA 1DOKA 3PIP3 1JOQA 1PDQA 1JQYD 4QUFA 1HFGA 4B08A 1WTQA 4DAYA 2B8GA 2QDBA 3Q23A 2MP1A 3R8BA 2PZWA 5D14A 4FF3A 1EY5A 3GTJB 2OEOA 3C3LA 4FXGC 3A8KE 3SK8A 1GJXA 1Q90A 5JEAJ 3S1QB 4XDXA 2R7ZB 1AP0A 2F0VA 1XWEA 2FMCA 3Q0AA 4ZLTF 4IUUA 4IUVA 1VMPA 5FO9B 1G2TA 2VB3X 3IL8A 1AN8A 2EXZA 4A3JB 4K8IA 4IUTA 1LACA 1CTMA 4K5WA 4HR7B 2ZXOA 3RLFA 3GV3A 4K2KA 2F0WA 4H0LC 2SEBD 2MGSA 3K7AB 5DM63 4R9WA 4IUNA 1T5EA 5CGKA 1G8ZD 4BWGB 1NAPA 1VCIA 2XRSD 1G6ZA 2E2JB 5AFWA 1QB5D 3CQZB 2V4DA 2KQ3A 2B2TC 3DUZA 3S17B 4RCNA 1ZXTA 2F0MA 2EJFC 1H9SB 2DN8A 1D6EC 4LK1C 5JAVA 1DM0B 1QG7A 2HDLA 1JORA 1HXYD 2R3ZA 5I2YA 3TZDA 4FF2A 5CV5A 5I4DA 1EY4A 4H7BA 2K05A 3SK5A 3QIAA 5FKAC 3DEPA 3FPUB 1RD9D 4MIUA 2F0OA 1QWYA 1BR9A 3P20A 2F0LA 4FXKC 1CQFA 2A6EC 3D4RA 1ILPA 1F2YA 3PUXA 4HMIA 1RCVD 1SYDA 1MSHA 2NUCA 3BVMA 4KTAA 4X3SA 3Q24A 1B1ZA 2SOBA 3HOVB 3K5NA 3FVQA 5DEHA 1ML0D 1EIHA 2NTSA 5I2XA 3M85A 5T1GA 4H13C 5CV4A 3PMFA 1OXSC 5DNFA 4NMZA 2IX1A 1JCKB 3NXWA 3HZXA 4A3IB 2X6LA 5CV9A 1TWCB 3K57A 2XN9C 3Q6SA 2I07B 3HOZB 5KEEA 2BCOA 2XNAC 2CW0D 3S15B 4FP5D 2WP8J 2L4NA 1STHA 4IFDI 1FGBD 3EFXD 2EY1A 1STGA 4A3EB 3A55A 3J80E 3MFGA 5M3MB 5FO8B 5CC4A 4DAPA 1KDCA 3A56A 1ONLA 3L9AX 3MAQA 4X3UA 4C1NI 2F03A 4R8IA 1SNPA 1EYCA 4B9WA 2HUGA 2EYFA 2WAQB 3P1HA 3IFDA 2BDNA 2BDOA 1QNUA 1EY9A 4OO1I 2HCIA 1E2ZA 4K14A 1Q1EA 3MZ5A 3D6CA 1DYQA 1JWSD 2B2VA 4A3GB 1NUCA 3NK9A 3FRPB 3PUZA 1VMCA 5IT9E 1V1PB 2IL8A 4J6HA 2F0EA 2JEBI 5EGTA 2NVQB 1CFMA 1HTPA 2N88A 5JVG3 4M1UB 2I46A 1PMRA 3X3NA 1MBYA 2RQXA 4A3KB 3RUZA 1VDZA 3QJYA 1DONA 1RJTA 3SHLA 4WJWA 2B2YA 2IPKD 2AWOA 4C1NK 1NCVA 3D4WA 2EYLA 2MPMA 2R61A 3SK6A 4KMUC 4H44C 5EKLA 1CA5A 1VF7A 1HTLD 4CJ0B 4UAIA 1XX8A 2FMMA 1IYVA 1EU4A 4RGMA 3I3CA 4LJZC 3MXNA 3ONAB 5FOBB 3QB3A 1TS2A 1EY8A 2O5JC 3BYYB 4ZUIA 4KKUA 3QG1A 4DA2A 1F9RA 1M4VA 1BCPF 1IL8A 2L5TA 2JA6B 3C46A 1DD2A 1LT5D 1HPCA 1SNMA 1MGSA 1WTRA 1B4OA 2EY6A 2VUMB 3S16B 1TQOA 2R93B 5KIXA 5FO7B 3P75A 3K0YA 1H9JA 1J9OA 4MHEA 2PPBC 1ENFA 1H9SA 1GXDC 4QIWB 5I6WA 3MXUA 2L9HA 3HRZC 1A3TA 1S5CD 1A6XA 5ELFA 3OIPA 2OXPA 2Q8RE 3I4MB 3TP7A 1TR5A 1V8QA 1CQVA 1Q12A 1SE4A 4OIJA 5C44B 4ZAIA 1SEBD 3NP8A 4RGNA 3VR6A 1PXUA 1TKWB 3BVGA 4A3BB 1SMYD 3K5LA 4HTHA 1DJRD 5EBCA 1T5XD 2ZT9C 1EQTA 2L12A 4NDXA 1SAPA 2CW0C 2KJXA 1B2TA 4DF7A 3G7LA 3V05A 3H09A 3E5SA 1I4GA 3TMEA 1S5FD 3MEHA 3NWSA 1LTAD 5C4XB 1LTSD 3J80L 1PTOC 2RSNA 1WTXA 1SSOA 4O42A 2RSOA 1V1PA 4RKBA 5IIFA 3DWAA 1H9MA 5ELEA 4IUQA 5JOBA 5D3IB 1GOZA 1SYCA 2KCCA 2M00A 1U4PA 2PO4A 4Y7NB 3A7AB 4RKLA 4V190 1X32A 2CHBD 1RF2D 1JB3A 2E76C 4S3SA 4QMGA 4I7ZC 1G291 5C5MA 2ZXPA 5EBDA 2E2IB 1LT6D 2QCPX 3JAME 3R3OA 4QB4A 4HSPA 3NTHA 3OW7A 4IFDG 1SNCA 5ELDA 4G7OC 4HEDA 1SYBA 2BA0A 3NBHA 2DY8A 1O7ZA 2XVSA 1AZPA 4G57A 3I73A 5HGTA 2KUMA 1PYWD 2M9VA 3S1MB 1I4QA 3TDQA 1K83B 2XWBB 4DFAA 1HQMC 1RTNA 3P7JA 1CZWA 2F0GA 1CT1D 3C1EA 2NYZD 4G7ZC 1V43A 2NTTA 4RA8A 4C3IB 3QO2A 3TSSA 4N9PA 2XRQD 2ICEC 3UI2A 3AMUA 1BDOA 2R92B 2EYOA 3I72A 5EPKA 4IFDJ 3HOYB 3OIQA 1JOOA 2MUYA 3HKZB 2FHTA 3KLSA 1KABA 3CKIB 4IZ8A 3H0GB 2K01A 1B3AA 2NVXB 4C3HG 1EL0A 2K7VA 1UAPA 4ZRZA 4KN7C 1PRTF 1L0YB 4IFDH 1CI3M 1CHPD 3QOLA 2O4XA 1E0BA 3FEWX 1PZID 2O5IC 2LS01 1DCZA 4U673 2PYKA 4IQZA 4G7HC 2NN6I 5BN5A 5J1ZA 4PV1C 1JWMD 5HURA 2KCNA 2EYHA 3H3VC 5C6AA 3MC0B 1PRTD 3VR5A 2D9UA 1DZ1A 5TSSA 4PMWA 1GUSA 2K04A 1XXGA 1SE3A 3E6ZX 3PIO3 2L11A 4K6LA 1OXUA 2D2CC 4C3JG 1LTTD 4WORA 2PMZB 3PO3B 2RDGA 3M4YA 1PRTB 2WACA 2RBMA 5I9OA 5EPLA 1HCZA 3I91A 2JA5B 5EKIA 3K5MA 4FVMA 3ND8A 5DM73 1AEXA 1C48A 3ZYYX 4A3DB 1A3VA 3LNNA 4L63B 2KVMA 2LKVA 5A2QL 3OWFA 1GUWA 5CORA 3PV0A 2TMPA 5E4WC 1D1KA 2K32A 1UNSA 3KLSX 5CV7A 3SE0A 1YNJC 5A35A 2WKCA 2B2VC 1LT3D 3BYTB 1JC7A 5C4ZA 4ZUJA 2QEJC 2B2UC 2J0TD 4RAUC 1TWAB 1FD7D 5KNCA 3DMUA 1JOKA 4P2CB 4X3TA 1F2MA 3PUWA 4UDUC 4DAVA 4XQQA 4DNRB 3M4OB 3EJIA 4XQNA 1RHPA 2LY7A 3T56B 3NWTA 1TY0A 3S14B 2F3WA 4Q5VA 1VF5C 3DWQA 3CU7A 4DK1A 1HQRD 3BDLA 2A68C 3GTMB 5CMDA 1SBBB 3M7GA 2NN6H 3D6WA 4I65A 2F0FA 1TWGB 4V0BA 2AQ1B 1S4ZA 4Z9CB 1SMYC 3PUVA 1S5BD 1BCPD 1EY0A 5M3FB 3D8GA 2EVBA 3JAML 1ET6A 2MJ8A 5JEAG 3FDTA 4PQXA 3M3YB 2WB1B 2F0QA 2K5WA 4K8JA 2E74C 3BZDB 2F0IA 2MHVA 2NN6G 3NSWA 1EFID 1TU2B 5CR3A 4BA1I 2OF1A 4O1NA 3KBGA 1KNAA 3FKIB 1XYIA 3H91A 1EQVA 2Y0SB 2AUKA 2K28A 2SNSA 3GD7A 4DNTB 4JK1C 4U68A 3A7LA 3GTKB 3GV6A 5M5XB 2LFNA 1C4QA 2Q8TA 4CJ2C 4F7XA 2FINB 1QILA 1R4PB 1ZYRD 2Z4IA 3K6OA 3NBIA 2PZTA 4HMJA 4PNYA 1SXTA 1I3QB 2PQEA 2B63B 5KNBA 3HOXB 3AB9A 5FK9C 4KI0A 1X3PA 1GUNA 2E2DC 1ESRA 5CYUA 1B44D 5NUCA 4LAAA 1L0XB 3KLRA 1D2BA 4X3KA 4EQNA 1KDBA 1Y1VB 1IHZA 4ZQ3A 1GUTA 2E2HB 1QOHA 3LX0A 1F9QA 2BE5C 3ITPA 1BUVT 2A6HD 2F0KA 3L7ZC 1BNZA 4CHTB 5C4HA 3DXJC 4MN3A 1C8CA 2G9HD 3SVMA 1Q3LA 4DN4M 2K5QA 1TY2A 2EYMA 3S2HB 1II3A 4N9TA 4KKSA 4EQOA 3O13A 3I70A 3D4DA 1DOMA 5C5LA 1UEAB 4J8QA 5K36G 2SDFA 5CV6A 5E4XA 4OHJA 1LO5D 3NQIA 2R6GA 1F2LA 3MA2B 1BO0A 3NUCA 4FXDA 2L0CA 3BVZA 1CM9A 5CBAE 1SYGA 2Z4HA 4CGYB 1EWCA 1TS5A 4FF4A 2KEDA 2PW5A 1LTRD 4HSVA 3VR4A 1PZKD 1EY7A 1A3UA 4E6IA 3RZOB 2NZ1D 1SNDA 4HAEA 3GTLB 5LHY1 1F77A 3OWEB 4HCEA 4ABNA 4GZYC 4ILWA 1Y69U 2F0JA 2B2UA 3QWNA 3HGBA 4ZKCB 1BQQT 3NPPA 2IW3A 2XSCA 1IYUA 5CBEE 2VNUD 2E75C 3BS1A 1UUPA 2Z1CA 3SDZA 1QNKA 3J81L 5BN4A 4RH6A 2EOTA 2FFKB 4XYQA 4RHRA 5G3LF 4ODGA 1Y8OB 2JE6I 3VYRA 4ZYSA 4KJOA 2A69D 1HA6A 2A6ED 1PTOD 2F0PA 2WINB 2QILA 3TP6A 2JA7B 1IW7C 1K8MA 2K6AA 2M2LA 3LWEA 2RDHA 4C56C 3EA6A 3I4LA 4Q0FA 3HP3A 2EE1A 4RCOA 4FF1A 4F87A 3J7AF 3TZUA 5JPNC 5F2DA 1Z47A 3C1FA 2PCFB 2YU9B 1FR3A 4HCSA 1DOLA 4R8NA 1STBA 1YNND 1FNUA 1HA5A 4LMQD 3RMHA 3PUYA 1EWHA 3T53B 3QOJA 4OIKA 2PNRC 1Q8IA 3DHQA 1B9NA 4CJ1B 2X69A 1PFNA 1NR2A 4KV6A 1SYEA 1ENAA 1I50B 4KHVA 4KN4C 1KLGD 2DY7A 3U9SA 1K8OA 2EPBA 2QKIC 2EJGC 2IJ0A 1ICWA 3OHXC 3SXHA 5G3LD 1AW7A 4RWSC 2TSSA 5EPJA 3HOWB 3VYSA 1HFNA 3A54A 2A6HC 4BA2I 1TS3A 4F8MA 3WOEA 5C4JB 1RKNA 4EQPA 3MFYA 3IAYA 1O78A 2PZUA 2K1BA 1EU3A 1LTID 1AFPA 2Q8IB 5LL6X 2EYPA 5C0XH 1EEFD 1PFBA 3NTKA 4TKOB 1ZEQX 4RGOS 2FJ2A 1GHKA 5C0XI 1MI2A 5BN3A 3MHBA 5T1IA 2IX3A 4CKEA 3DEOA 1OXTA 5C3XA 5C3EB 1CK1A 2KECA 2DNCA 4YIJA 1R4QB 4KD3A 4CKCA 3X3MA 5E1FA 2YYZA 4XIGS 1M8AA 4EVOA 1PLFA 4KHZA 3OMGA 4WRDA 5IT9L 3OSOA 4AYBB 1PTOF 5KNDA 3GTQB 3TN2A 2JYOA 2NWGA 4ZKBB 3HEJA 2KOLA 2DNEA 5KRUA 1BBXC 5IOCA 4K6DA 3EVQA 2JSOA 2AQ3B 2B2YC 4TQUS 4DXFA 2GA4B 5D3DA 2JXMB 4A93B 2H1EA 1U9RA 5IGBA 4WFN3 1KLUD 1U4MA 3ERQA 4XT1B 2NBFA 2IWHA 2L55A 2F0TA 2Z8LA 2C5CA 1I4XA 1PTOH 2XIWA 1WTOA 1X3QA 3NE5B 1I4PA 4EGVA 1STAA 5FLXE 2EY5A 1Y1WB 5ELBA 5KYIA 2BOSA 3IKJA 2RDFA 3M7NA 1BOSA 3K58A 1D5MC 1TWHB 1TT2A 1V1OA 1PTOB 2A69C 5C3WA 3R2IA 3HOUB 3DWPA 1F9SA 1GUOA 1LT4D 2F1MA 3U9OA 2BA1A 2SNMA 1XTCD 1IKLA 1HUMA 3I4NB 3T4AC 4BS9A 3K5OA 5ELCA 5FLXL 2A73B 4XQJA 3W2DA 3K59A 1EYDA 2B2TA 1B9MA 1JWUD 4ID6A 3SEBA 2KHSA 5M9OA 3D3RA 3EQLC 1W6KA 1ILQA 5EKKA 1A2TA 4KY7A 1FYCA 4QF4A 3VYUA 3HS0C 1IW7D 2B39A 3GTPB 1QJOA 1JE4A 4XTCS 1O7LA 1O80A 2A5HA 1D5ZC 2ICIA 4NW2A 1LTBD 1KTKA 1JICA 2RVLA 3MXPA 4NP5A 1A2UA 3AU7A 2G9DA 2HDMA 3FPPA 4KJNA 3MWYW 2AWNA 3S9WA 4K5VA 1FNVA 1MSGA 1SFOB 1Z7TA 1STYA 5KGUA 3H6MA 4KKTA 3EROA 3URYA 4DU9A 1JR0D 4FYDA 1PRTC 5ISRA 3GQBA 5C0XG 3GP7A 3RZDB 4KD4A 4K2LA 3MXGA 4IN3A 4KY5A 5DAUA 2L1BA 4QUCA 1D5XC 2RKSA 2NVTB 2WV6D 5EJWA 5IODA 2XWJB 5KYLA 3R93A 3TP5A 1S5DD 1W6JA 3S1RB 2X6GA 1LABA 2CQAA 1YNNC 1RTOA 3OMCA 2F0UA 5IGFA 1I4HA 3E0JA 4BY1B 4DGZA 4PMCA 5CV8A 5EQ0A 5J39A 4HN7A 4RHSA 3VR2A 1HUNA 3OPOA 1I6HB 2D5DA 3PO2B 3GO5A 2J7ZA 1Y8NB 1SE2A 3OOCA 1NSNS 1NR4A 5M5YB 2H4OA 1STEA 3N52A 1E2WA 4IUPA 3T13A 2JA8B 5C0XJ 1E2VA 4FO2A 3MTSA 2B2WC 3R2TA 4OGQC 1A15A 4FNFA 3V2TA 1BXTA 1Q1BA 3FMCA 4XYOA 1TIID 3J7YW 1WCMB 2NB0A 1U4RA 3H94A 1EZ6A 4DXGA 4OL7A 5J22A 3CRKC 1ZYRC 1WTPA 1I6VC 2WIIB 1SNQA 2F0SA 4OO1H 1I4RA 1BCPB 1EZ8A 4XT3B 5IGDA 2A74C 5IGCA 2RA4A 1TVXA 1R9TB 1F2ZA 5LL6S 1ZKOA 5JPMC 2B8FA 1D1IA 5K5PA 4BBSB 3TBIB 4BY7B 2K03A 3SR1A 4L6TB 3TP8A 3W3AA 3DM1A 2EDGA 1DXMA 1OO9B 4QCLA 3S2DB 2ID0A 1RODA 2F0DA 3HG9A 5JEAH 1WTVA 3KF8A 2NVYB 2VB2X 3CHBD 1CA6A 1Z6HA 5I9PA 2ENBA 2JP1A 4C3IG 3I8ZA 3VA7A 3KBXA 4RGTA 3VA5A 1ET9A 5M5WB 3RD4A 1YNJD 3KUPA 3LWUA 3I90A 1WD0A 1G91A 3WOFA 1CZGA 1B53A 1ENCA 1SJHD 4IALA 4CKBA 3F2UA 1SJED 3NHHA 5K36H 2F0NA 4TRDA 1H9KA 1HHVA 3GTOB 2K33A 5A2QE 2KEEA 3KK7A 2F3VA 2F0HA 4KY6A 5JJZA 2N55A 5I6YA 2VXWA 1SYFA 4ME5A 1MD2D 5IGEA 3A8IE 1KNEA 5IGGA 3Q22A 4CBVA 4KK7A 1J8IA 1ESFA 1KAAA 2OT2A 1OXXK 1IKMA 1O7YA 2QF7A 3BDCA 4RFBA 2J4XA 1PFMA 2BE5D 2EYJA 3VYTA 1EY6A 3N6RA 4A3MB 2IT1A 3ND9A 3G6JB 3GTGB 4BBRB 4C2MB 2K5DA 1SNOA 2EJMA 1HRJA 1H9RA 2C9OA 2AUJD 3D31A 1PZJD 1F9PA 5JVH3 1LLRD 2HCCA 4NKLA 1B50A 4IURA 3VR3A 1GUGA 2ZXRA 1WVLA 1OXVA 3A8JE 4OO1G 1AZQA 3T16A 4F88A 4TSSA 3SK4A 1BCPC 4J1MA 2HQEA 1GHJA 1SDFA 1G2SA 4XXEA 1LTGD 2JEAI 4PMBA 3NTIA 1TS4A 2F4IA 3V96A 3C2PA 1S5ED 4ZK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEO A;  1O7Z A;  4U68 A;  3R93 A;  4OIJ A;  1EOT A;  2CVR A;  2N88 A;  2N55 A;  3GV6 A;  2KED A;  4X3T A;  2VXW A;  4HCS A;  3IL8 A;  1DOL A;  1G2T A;  4ZAI A;  2KUM A;  2KEC A;  4HSV A;  4XT3 B;  1MSH A;  2Q8T A;  4CJ2 C;  1LV9 A;  4X3S A;  2FIN B;  2RA4 A;  1TVX A;  5D65 A;  2NZ1 D;  5COY A;  2X6G A;  4IUT A;  1ML0 D;  1RHP A;  4HAE A;  4LMQ D;  1M8A A;  1DON A;  1RJT A;  1EIH A;  1PLF A;  1RTN A;  3P7J A;  2D9U A;  1DZ1 A;  1KNE A;  5T1G A;  2B2T A;  4OIK A;  3GV3 A;  1EQT A;  1RTO A;  2L12 A;  1J8I A;  2K03 A;  1BF4 A;  2B2Y A;  2K04 A;  2NYZ D;  1G6Z A;  4CJ1 B;  2X69 A;  2B2U A;  4RA8 A;  1PFN A;  1SAP A;  1O7Y A;  1NCV A;  3DM1 A;  1NR2 A;  2JYO A;  2MGS A;  2NWG A;  5DNF A;  3TN2 A;  1B2T A;  1ILQ A;  4R9W A;  4ZKB B;  4ZKC B;  3QO2 A;  2MPM A;  2L11 A;  3G7L A;  1IKM A;  1X3P A;  2X6L A;  1U4L A;  1NAP A;  1CA5 A;  5EQ0 A;  3UI2 A;  1ESR A;  2KOL A;  5CMD A;  2DY7 A;  1JE4 A;  4CJ0 B;  1WTW A;  5CBE E;  4UAI A;  1BBX C;  1O80 A;  1PFM A;  1XX8 A;  3Q6S A;  1WD1 A;  2FMM A;  5AFW A;  1HUN A;  4NW2 A;  4X3K A;  2EPB A;  2B2Y C;  3I3C A;  1QNK A;  2RSN A;  3D6W A;  5EPL A;  1WTX A;  1JIC A;  1ROD A;  2L4N A;  2RVL A;  3ONA B;  4IUV A;  1SSO A;  1ICW A;  2B2T C;  2EOT A;  2J7Z A;  4O42 A;  2RSO A;  1S4Z A;  1WTV A;  3I91 A;  2FFK B;  2H1E A;  2HDM A;  1F9Q A;  4RWS C;  5EPK A;  5EPJ A;  1HFN A;  1CA6 A;  5EKI A;  1NR4 A;  1ZXT A;  1EIG A;  1F9R A;  2JP1 A;  1BNZ A;  1HRJ A;  1U4M A;  1QE6 A;  2FHT A;  3I8Z A;  3N52 A;  1IL8 A;  4IUP A;  4MN3 A;  4XT1 B;  3MWY W;  4IUQ A;  1C8C A;  3KBX A;  3SVM A;  1F9P A;  1Q3L A;  1MSG A;  1HA6 A;  1U4P A;  2HCC A;  2B2W A;  4DN4 M;  1DOK A;  3MTS A;  1MGS A;  2K01 A;  2B2W C;  2XIW A;  1B50 A;  4IUR A;  1B4O A;  2MJ8 A;  1WTR A;  1PDQ A;  1QG7 A;  2KVM A;  1HFG A;  4QUF A;  1X32 A;  1WTQ A;  2HDL A;  1B3A A;  3FDT A;  1GUW A;  3KUP A;  2R3Z A;  1WTO A;  1WVL A;  2K1B A;  5COR A;  1DOM A;  1X3Q A;  4X3U A;  5E4W C;  1J9O A;  1EL0 A;  1AZQ A;  3I90 A;  1WD0 A;  4MHE A;  3TZD A;  4R8I A;  2MP1 A;  1AZP A;  1A15 A;  1G91 A;  2M2L A;  5D14 A;  2HUG A;  1B53 A;  2SDF A;  5E4X A;  2K05 A;  3IFD A;  3LWE A;  2BDN A;  2L9H A;  3DEP A;  3FPU B;  2HCI A;  3F2U A;  1SDF A;  2B2V C;  1G2S A;  3HP3 A;  1F2L A;  1PFB A;  1BO0 A;  1KNA A;  2B2V A;  2EE1 A;  4XDX A;  1CM9 A;  2B2U C;  1E0B A;  1AP0 A;  1F9S A;  1U4R A;  2L1B A;  4RAU C;  4QUC A;  1WTP A;  1XYI A;  3H91 A;  1HHV A;  2Q8R E;  5CBA E;  1VMC A;  2K28 A;  4HED A;  1ILP A;  5EJW A;  2FJ2 A;  1IKL A;  2KEE A;  2IL8 A;  1HUM A;  4ZLT F;  1MI2 A;  4IUU A;  4ZK9 B;  1VMP A;  2DY8 A;  5JJZ A;  5T1I A; 
#chains in the Genus database with same CATH topology
 1VQH A;  1EOT A;  2CVR A;  4A4I A;  1X3E A;  1TWG H;  1WCM H;  4DK0 A;  1FJG Q;  1KDA A;  1QCB D;  3IFT A;  3CQZ H;  1LV9 A;  2WKD A;  5D65 A;  1TWF B;  3BG3 A;  4B9X A;  2E2J H;  4C3J B;  4JOI C;  5COY A;  3W5O A;  2AQ2 B;  3T1Y L;  2PW7 A;  3GTM H;  2D62 A;  1RDP D;  1FNW A;  2R92 G;  2LMC B;  4K5X A;  3BZC A;  3DLL A;  3CRL C;  1PH4 A;  3S16 H;  4A3F B;  4X62 L;  2EY2 A;  2VY3 A;  1AE2 A;  1BF4 A;  1OTC A;  2O2L D;  5E3F A;  4B3R L;  4M8A A;  2H5X A;  2Z0S A;  4YWL A;  3J7A V;  1Y8P B;  1U4L A;  2EZV A;  1N33 Q;  2RHS B;  2OCE A;  2KA7 A;  1NNX A;  2B29 A;  1WTW A;  4OX9 Q;  5GQO A;  1STN A;  1WD1 A;  1EEI D;  3M4O H;  3L3O C;  1HR0 W;  4R1J A;  4A3J H;  4JBW A;  2UXC L;  4C3H B;  3WDN A;  3PO2 H;  1CHQ D;  2Q2T A;  1EYA A;  4ULL A;  3NQT A;  1M90 C;  3T51 B;  4G4K A;  1S72 A;  3BDO A;  1G51 A;  1EIG A;  4UP9 A;  2A68 D;  3MVV A;  4I7A A;  1QE6 A;  1RIP A;  3J81 E;  2OQ0 A;  5LMU Q;  1CKN A;  2IX0 A;  4L8J A;  1NMG A;  4BY1 H;  3S1N B;  3MXN B;  2B2W A;  1DOK A;  3PIP 3;  2K5N A;  1JOQ A;  1PDQ A;  1JQY D;  4B08 A;  1HFG A;  4QUF A;  1WTQ A;  4JI4 Q;  2GN5 A;  1I94 Q;  4DAY A;  2B8G A;  3PIO A;  2QDB A;  2GVA A;  3Q23 A;  2MP1 A;  3R8B A;  2PZW A;  5D14 A;  4FF3 A;  1EY5 A;  3GTJ B;  2OEO A;  3KDF A;  2UXB Q;  3C3L A;  4FXG C;  1YBY A;  4CDC C;  3A8K E;  3SK8 A;  3S1R H;  1Q90 A;  1GJX A;  3JC6 6;  1W3S A;  5JEA J;  3S1Q B;  4XDX A;  2R7Z B;  1VQ5 A;  1AP0 A;  2F0V A;  4OON A;  1AH9 A;  1SRO A;  4LF4 Q;  1XWE A;  2FMC A;  3Q0A A;  4ZLT F;  4IUU A;  4IUV A;  1VMP A;  4GN4 B;  1JT8 A;  5FO9 B;  1G2T A;  2JA9 A;  2VB3 X;  3IL8 A;  3RZD H;  1AN8 A;  2EXZ A;  4A3J B;  4K8I A;  1L2F A;  4IUT A;  1LAC A;  3PO3 G;  3HOU G;  2HIV A;  1CTM A;  4K5W A;  4HR7 B;  2ZXO A;  3RLF A;  3GV3 A;  2RCF A;  2P5Z X;  4K2K A;  2RHQ B;  3K8A A;  2F0W A;  1SE8 A;  3GDE A;  4H0L C;  1SFO H;  4JI7 L;  2SEB D;  4NPS A;  2MGS A;  3K7A B;  3A74 A;  5DM6 3;  1KRT A;  1JE5 A;  4IUN A;  4R9W A;  1AE3 A;  3I55 A;  4A3E H;  1T5E A;  5CGK A;  1G8Z D;  4BWG B;  1NAP A;  1VCI A;  2XRS D;  1G6Z A;  1XJV A;  3M4Q A;  2E2J B;  5AFW A;  3HOX G;  2R93 G;  1QB5 D;  3CQZ B;  4DR6 Q;  4IPD A;  2V4D A;  2KQ3 A;  4K0K Q;  2B2T C;  5J3B A;  3DUZ A;  3S17 B;  3CCM A;  4RCN A;  4UHV A;  1ZXT A;  2F0M A;  2UU9 Q;  2EJF C;  1H9S B;  3U58 A;  1YVC A;  3CC2 A;  3UE1 A;  2DN8 A;  3ER0 A;  1D6E C;  4LK1 C;  5IP9 H;  4N8X 1;  5JAV A;  1DM0 B;  2ZJR A;  1QG7 A;  2HDL A;  1E24 A;  1JOR A;  1HXY D;  2R3Z A;  4GLX A;  4LFC Q;  4IJL A;  5I2Y A;  3TZD A;  4FF2 A;  5CV5 A;  5I4D A;  1EY4 A;  4ZCK A;  4H7B A;  3FKI G;  2K05 A;  4O2D A;  3SK5 A;  3QIA A;  3UDX A;  5FKA C;  3DEP A;  3FPU B;  1RD9 D;  4MIU A;  2F0O A;  1QWY A;  1VQA A;  3J80 i;  1BR9 A;  3P20 A;  3CCE A;  2F0L A;  3H0G H;  4FXK C;  1CQF A;  2A6E C;  3AYH B;  4DR3 L;  3D4R A;  4J15 A;  5AJ3 Q;  1ILP A;  1F2Y A;  4BBR H;  3PUX A;  1TWH H;  4X6A H;  4HMI A;  1RCV D;  1SYD A;  1BBW A;  1MSH A;  3T1Y Q;  2NUC A;  3BVM A;  4YHH Q;  4KTA A;  4X3S A;  3Q24 A;  1B1Z A;  2SOB A;  3K5N A;  3HOV B;  3FVQ A;  5DEH A;  1ML0 D;  1EIH A;  2NTS A;  4JI4 L;  5I2X A;  2EQS A;  3M85 A;  5T1G A;  1JJ2 A;  1K0R A;  4H13 C;  5CV4 A;  4HID A;  3PMF A;  3STB C;  1OXS C;  3I4O A;  5DNF A;  1N36 Q;  1WYD A;  1VQI A;  4NMZ A;  2IX1 A;  1JCK B;  3NXW A;  3HZX A;  4A3I B;  2X6L A;  5CV9 A;  1TWC B;  1ICF B;  3K57 A;  2XN9 C;  3Q6S A;  2I07 B;  4LF8 L;  3HOZ B;  1VQD A;  4A93 H;  5KEE A;  1E1O A;  2BCO A;  2XNA C;  2CW0 D;  3S15 B;  4FP5 D;  2MO1 A;  2L4N A;  2WP8 J;  1STH A;  4IFD I;  4IJH A;  5IYB H;  1FGB D;  1VQL A;  3PCO B;  5LMN Q;  4JI8 L;  1XMO Q;  2KCM A;  2EY1 A;  1STG A;  3EFX D;  4A3E B;  2Q2H A;  3GTQ H;  1UEB A;  1PH6 A;  3A55 A;  3J80 E;  3MFG A;  3VDY A;  1XNR L;  5M3M B;  2VZA A;  2Z6B A;  5C3E G;  5FO8 B;  1VQ9 A;  5CC4 A;  4LNQ A;  3SGI A;  4LFC L;  1QVC A;  4DAP A;  4ALP A;  3TS0 A;  1KDC A;  3A56 A;  1ONL A;  3L9A X;  3B6Y A;  4X3U A;  3MAQ A;  4C1N I;  4A3M G;  2F03 A;  4R8I A;  5IWA L;  1SNP A;  1EYC A;  1MHW C;  4B9W A;  5EAY A;  2HUG A;  2EYF A;  2WAQ B;  4DV5 Q;  3P1H A;  3IFD A;  2NZH A;  2BDN A;  2BDO A;  1C9O A;  1QNU A;  1EY9 A;  4OO1 I;  1L1O B;  2HCI A;  2HHH Q;  1E2Z A;  4K14 A;  1Q1E A;  3MZ5 A;  3G4S A;  3D6C A;  1N36 L;  3I2Z A;  1DYQ A;  3CCQ A;  1JWS D;  2B2V A;  4A3G B;  1NUC A;  3NK9 A;  1A0I A;  5BR8 L;  3FRP B;  3AFP A;  3TS2 A;  3EN2 A;  3PUZ A;  3FHW A;  4GOP B;  1VMC A;  5IT9 E;  4K0K L;  1V1P B;  3UDG A;  2IL8 A;  4DNI A;  4J6H A;  2F0E A;  2JEB I;  5EGT A;  1K9M C;  2NVQ B;  1CFM A;  1HTP A;  2N88 A;  5JVG 3;  4M1U B;  2I46 A;  3BZK A;  1PMR A;  2LXJ A;  3X3N A;  1WFQ A;  4JI1 Q;  1MBY A;  2RQX A;  4P73 A;  4WJ4 A;  3S2D H;  1Q8K A;  2E8G A;  4A3K B;  4A3C G;  3M4P A;  3RUZ A;  4DUZ L;  1VDZ A;  3QJY A;  4JI2 L;  2BH8 A;  1DON A;  1RJT A;  2Y0S G;  1KQS A;  3SHL A;  4JPB W;  5IP7 H;  3CC7 A;  3ULP A;  1A8V A;  4WJW A;  1CSP A;  2B2Y A;  2IPK D;  2AWO A;  4C1N K;  1NCV A;  4DV3 L;  1VQ8 A;  3D4W A;  1YJW A;  1EUJ A;  2EYL A;  2MPM A;  2R61 A;  4KMU C;  3SK6 A;  4H44 C;  5EKL A;  1CA5 A;  1VF7 A;  2K50 A;  1PVO A;  1HTL D;  4CJ0 B;  4UAI A;  1XX8 A;  2FMM A;  1IYV A;  1EU4 A;  1R9T H;  1YEZ A;  4RGM A;  5AJ3 L;  3I3C A;  3BJU A;  4C3H H;  2QA4 A;  4LJZ C;  3MXN A;  3ONA B;  5FOB B;  3QB3 A;  4Y52 H;  5GRO A;  5C44 H;  1CKN B;  1TS2 A;  5IT9 c;  1IBK Q;  1EY8 A;  2O5J C;  4QL5 A;  1T9H A;  4DR1 Q;  3BYY B;  4ZUI A;  4KKU A;  3QG1 A;  4DA2 A;  1F9R A;  1DGS A;  1M4V A;  3CCR A;  3I4M H;  1BCP F;  1IL8 A;  3A0J A;  5LMU L;  2L5T A;  2JA6 B;  4L5Q A;  2UU9 L;  3C46 A;  1DD2 A;  1LT5 D;  1HPC A;  1SNM A;  4OEL B;  1MGS A;  1IBL L;  1WTR A;  1B4O A;  2EY6 A;  2VUM B;  3S16 B;  1TQO A;  5L37 A;  2R93 B;  5KIX A;  1QZG A;  5FO7 B;  2I0Q A;  3P75 A;  3K0Y A;  1H9J A;  4MZ9 A;  1D7Q A;  1J9O A;  1JJC B;  4B3R Q;  4MHE A;  4JI0 Q;  2PPB C;  4A93 G;  1ENF A;  3HOW G;  2YTV A;  1H9S A;  1GXD C;  4QIW B;  5I6W A;  3MXU A;  2L9H A;  3HRZ C;  4N8F A;  4IPC A;  1A3T A;  1S5C D;  1A6X A;  5ELF A;  3J81 i;  4GKJ Q;  3OIP A;  2OXP A;  2Q8R E;  1HZC A;  4JYA L;  4A3I G;  4JBM A;  3I4M B;  3TP7 A;  2QDL A;  1TR5 A;  1V8Q A;  1CQV A;  1Q12 A;  1VQ4 A;  3J81 j;  5M5Y H;  3CW2 C;  2KCT A;  1SE4 A;  4OIJ A;  5C44 B;  4ZAI A;  2QW7 A;  1SEB D;  3NP8 A;  3JAM i;  4RGN A;  3VR6 A;  1PXU A;  1I6H H;  1G6P A;  1TKW B;  3BVG A;  4A3B B;  1SMY D;  4QJF A;  2WAQ G;  3K5L A;  4HTH A;  4X62 Q;  1DJR D;  5EBC A;  1UWV A;  1XMQ L;  3CME A;  1T5X D;  2ZT9 C;  1EQT A;  2L12 A;  4A75 A;  4NDX A;  1SAP A;  2CW0 C;  2KJX A;  4JI0 L;  1B2T A;  4DF7 A;  2D0P A;  4DK6 C;  3G7L A;  1UE6 A;  3V05 A;  3H09 A;  3E5S A;  1I4G A;  3PGZ A;  3I4N G;  2CCZ A;  4C2M H;  3TME A;  4X65 Q;  3U4V A;  2K14 A;  4OWT B;  1S5F D;  3MEH A;  3NWS A;  1LTA D;  5C4X B;  1LTS D;  3J80 L;  1PTO C;  4DV4 Q;  3PF5 A;  2RSN A;  1WTX A;  1NY4 A;  1SSO A;  4O42 A;  2RSO A;  1V1P A;  4RKB A;  4HJ7 A;  1PH7 A;  3W1G A;  4DR5 L;  4A3G G;  2DJG C;  5IIF A;  3DWA A;  4NXM L;  1H9M A;  3UDI A;  4CDF C;  1XNR Q;  5ELE A;  1WOC A;  4IUQ A;  5JOB A;  5D3I B;  2VQF L;  1GOZ A;  1UE5 A;  1SYC A;  1MKH A;  2KCC A;  2M00 A;  1U4P A;  2PO4 A;  4A3G H;  3RNU A;  2LSS A;  4Y7N B;  3LGJ A;  5JJK A;  2MQH A;  3A7A B;  4RKL A;  4V19 0;  1X32 A;  2CHB D;  2I5L X;  4JI7 Q;  4OWX B;  1RF2 D;  1JB3 A;  4P72 A;  1XPR A;  2E76 C;  4S3S A;  4QMG A;  4I7Z C;  1BVS A;  1G29 1;  5C5M A;  2ZXP A;  1GM5 A;  5EBD A;  2E2I B;  1SR3 A;  1LT6 D;  2QCP X;  3JAM E;  4POF A;  3R3O A;  4QB4 A;  2F4V L;  4HSP A;  2DUD A;  3NTH A;  2NZO A;  4GKJ L;  3OW7 A;  4IFD G;  4HJ8 A;  1SNC A;  2VQE L;  4DV7 Q;  5HGQ A;  5ELD A;  2OTL A;  3AEV A;  4G7O C;  3GTO H;  1IBM L;  4HED A;  1L1O A;  2PQA B;  1SYB A;  2BA0 A;  3NBH A;  2DY8 A;  3BU2 A;  4JW0 A;  3ZJY C;  1O7Z A;  2XVS A;  1AZP A;  4G57 A;  3I73 A;  3J7A 5;  5HGT A;  2KUM A;  4QGU A;  3S15 H;  5IYD H;  1PYW D;  2M9V A;  3S1M B;  1I4Q A;  4YWK A;  3TDQ A;  1K83 B;  2XWB B;  4JOI A;  4DFA A;  1HQM C;  1UE1 A;  1JB7 A;  1RTN A;  3P7J A;  1CZW A;  4A3I H;  2F0G A;  1CT1 D;  3C1E A;  5M5W H;  2ZM6 Q;  2DJF C;  2NYZ D;  1X3F A;  4DKA C;  4G7Z C;  4KHP Q;  1V43 A;  2NTT A;  4RA8 A;  3PIP A;  1U0L A;  4C3I B;  2RCN A;  3QO2 A;  3TSS A;  3KF6 A;  1N8R C;  3E0E A;  4N9P A;  2WAQ E;  2XRQ D;  2ICE C;  3UI2 A;  3AMU A;  4DR6 L;  1BDO A;  2E5L L;  1QZH A;  4PZ6 A;  2E2H H;  2R92 B;  1S40 A;  2EYO A;  4B3T L;  1XNQ L;  1N32 L;  1LUZ A;  3I72 A;  1YZ6 A;  4GN5 A;  5EPK A;  4IFD J;  3HOY B;  1PA6 A;  3OIQ A;  1JOO A;  2MUY A;  3HKZ B;  2A1A A;  2FHT A;  3KLS A;  2YV5 A;  1KAB A;  3CKI B;  4IZ8 A;  1V1Q A;  3H0G B;  4UY8 C;  2K01 A;  2B63 H;  5C44 G;  4BY7 H;  3AFQ A;  1GVP A;  1B3A A;  1LM0 A;  4JI5 Q;  2NVX B;  4C3H G;  1EL0 A;  2YTX A;  1IBL Q;  3A5Z B;  2K75 A;  2K7V A;  2PI2 A;  3H0G G;  1UAP A;  1YJN A;  2ZM6 L;  3G6E A;  4ZRZ A;  4KN7 C;  1PRT F;  1L0Y B;  4OX9 L;  3CAM A;  4IFD H;  1CI3 M;  1J5E L;  1CHP D;  1FVI A;  3QOL A;  2ASB A;  2O4X A;  1HNX L;  4LF5 Q;  4HIO A;  1E0B A;  3FEW X;  1PZI D;  3WWV A;  3ULJ A;  2N78 A;  5H1S E;  2O5I C;  4BBS G;  2LS0 1;  1DCZ A;  4U67 3;  1PYB A;  2PYK A;  4IQZ A;  4G7H C;  1WJJ A;  1P8L A;  2NN6 I;  3S17 H;  5BN5 A;  4PV1 C;  5J1Z A;  1JWM D;  1XTD A;  1HNZ Q;  5HUR A;  2KCN A;  2EYH A;  4DUZ Q;  2WFW A;  1I94 L;  3H3V C;  5C6A A;  3MC0 B;  4DR7 L;  1PRT D;  3VR5 A;  2D9U A;  1DZ1 A;  2GVB A;  5TSS A;  1U5K A;  4PMW A;  1GUS A;  2K04 A;  1XXG A;  1SE3 A;  3E6Z X;  1NBW A;  3PIO 3;  4HIM A;  2L11 A;  4K6L A;  4OWW B;  1VQO A;  1OXU A;  2D2C C;  4C3J G;  1LTT D;  4WOR A;  1Q46 A;  2PMZ B;  3JAM c;  3PO3 B;  2RDG A;  3M4Y A;  1PRT B;  2WAC A;  2RBM A;  5I9O A;  5EPL A;  1HCZ A;  1YJ9 A;  1KHI A;  1WI5 A;  2PQA A;  5C3E H;  3I91 A;  4DV0 L;  2AMC B;  2R7F A;  2JA5 B;  4IO9 A;  2OQK A;  5EKI A;  4AH6 A;  3K5M A;  2UUB Q;  4WJ3 M;  3NEN A;  4FVM A;  3ND8 A;  5DM7 3;  1EIF A;  1AEX A;  2K5H A;  4GOP C;  1C48 A;  3ZYY X;  3CF5 A;  1A3V A;  2R7Z H;  4A3D B;  4UPA A;  3LNN A;  4L63 B;  2AHO B;  4YY3 Q;  5C4X G;  1ASY A;  2KVM A;  2LKV A;  3MEF A;  4JI5 L;  5A2Q L;  4AIM A;  3OWF A;  1GUW A;  2F52 A;  5COR A;  3PV0 A;  2TMP A;  5E4W C;  1D1K A;  2K32 A;  1FGU A;  3K0X A;  3GTJ H;  1UNS A;  3KLS X;  5CV7 A;  3SE0 A;  2R7D A;  1YNJ C;  4PZ7 A;  5A35 A;  1YNX A;  4B3M L;  2WKC A;  2B2V C;  1LT3 D;  3BYT B;  1JC7 A;  5C4Z A;  2HIX A;  4ZUJ A;  2QEJ C;  2A19 A;  2B2U C;  2N8N A;  1VQM A;  4RMF A;  2J0T D;  1QUQ A;  4RAU C;  3S1N H;  1TWA B;  1FD7 D;  5KNC A;  4NXN Q;  3DMU A;  1E7Z A;  3HOW H;  1JOK A;  4P2C B;  3KJO A;  4X3T A;  1F2M A;  4CDE C;  3PUW A;  4UDU C;  2N49 A;  4DAV A;  4XQQ A;  4JI2 Q;  4DNR B;  3M4O B;  1HJP A;  3HKS A;  3EJI A;  4XQN A;  3NBH B;  4JBJ A;  2R7Z G;  1RHP A;  2LY7 A;  4DR2 L;  2IY5 B;  3T56 B;  5IYD G;  1I50 H;  3NWT A;  1TY0 A;  3S14 B;  3TQY A;  2F3W A;  4Q5V A;  1VF5 C;  3DWQ A;  4A3F H;  3CU7 A;  4DK1 A;  1HQR D;  3BDL A;  4YCV A;  2A68 C;  4KHP L;  2JJQ A;  3GTM B;  5CMD A;  4X66 L;  4DR4 Q;  1SBB B;  4C3J H;  4B3M Q;  3M7G A;  2NN6 H;  1B3Q A;  3D6W A;  4I65 A;  4EQ5 A;  2HT1 A;  1Q82 C;  2F0F A;  1TWG B;  4V0B A;  2AQ1 B;  1S4Z A;  4Z9C B;  2YU9 H;  2Z6K C;  1A62 A;  1SMY C;  3PUV A;  1S5B D;  1BCP D;  1EY0 A;  5IP7 G;  1IZ6 A;  3CPW A;  4A3C H;  3KOJ A;  5M3F B;  4DV1 L;  1BBU A;  3H3V I;  3D8G A;  2EVB A;  3JAM L;  4BXX G;  1ET6 A;  3CPF A;  1XMQ Q;  2K5V A;  4APV A;  1NTG A;  2MJ8 A;  4BXX H;  5JEA G;  3FDT A;  1HNW L;  2JN4 A;  4PQX A;  3M3Y B;  2WB1 B;  2F0Q A;  2K5W A;  2UUC L;  4K8J A;  2E74 C;  4CDD C;  4QQB X;  3BZD B;  4LFB Q;  2I5M X;  1D8L A;  2F0I A;  2MHV A;  2NN6 G;  1X56 A;  2VL6 A;  3NSW A;  1EFI D;  1TU2 B;  1CSQ A;  4P75 A;  5CR3 A;  4BA1 I;  2OF1 A;  4O1N A;  3KBG A;  1KNA A;  2L15 A;  3I4N H;  1C7Y A;  3FKI B;  1IBM Q;  1K8A C;  1XYI A;  3H91 A;  2UUA Q;  1EQV A;  2Y0S B;  2AUK A;  1CUK A;  2K28 A;  4JI3 L;  4DV6 Q;  4LF5 L;  2SNS A;  3GD7 A;  4DNT B;  5FLM G;  4R4I A;  3HOU H;  4JK1 C;  5ELO A;  4U68 A;  3A7L A;  1XMO L;  3GTG H;  3GTK B;  3GV6 A;  4AQY L;  5M5X B;  4A3M H;  4DR1 L;  2LFN A;  3KYH C;  1C4Q A;  2Q8T A;  1KAW A;  4CJ2 C;  4F7X A;  2FIN B;  1Y1W H;  1QIL A;  1R4P B;  1HNZ L;  4AYB G;  1ZYR D;  2Z4I A;  3K6O A;  2Q2I A;  3NBI A;  2PZT A;  2NVX H;  4HMJ A;  3G71 A;  4PNY A;  1SXT A;  1I3Q B;  3RLO A;  2PQE A;  2B63 B;  1E1T A;  5KNB A;  3HOX B;  3AB9 A;  1IYJ B;  5FK9 C;  1PFS A;  4DAY B;  4KI0 A;  1LYL A;  3RN2 A;  1X3P A;  1GUN A;  2E2D C;  3RN5 A;  1ESR A;  5CYU A;  1TXY A;  1B44 D;  5NUC A;  3GTL H;  4LAA A;  4AYB E;  1EQR A;  1PH3 A;  1L0X B;  5LMN W;  3KLR A;  1D2B A;  4X3K A;  4EQN A;  3OTO Q;  4DUY Q;  2ZJQ A;  1KDB A;  3RZO H;  3J7Z C;  1Y1V B;  1IHZ A;  2ES2 A;  4NXM Q;  4ZQ3 A;  1GUT A;  2E2H B;  1QOH A;  1YIT A;  3LX0 A;  1F9Q A;  4LUV A;  2BE5 C;  3HOZ G;  3ITP A;  2IHE A;  1BUV T;  2A6H D;  3U50 C;  2F0K A;  4BY1 G;  3L7Z C;  1BNZ A;  4CHT B;  2EIF A;  5C4H A;  3DXJ C;  1RL2 A;  4MN3 A;  4JI6 L;  1C8C A;  2G9H D;  3SVM A;  1Q3L A;  2UUB L;  4DN4 M;  2K5Q A;  1TY2 A;  2EYM A;  3S2H B;  1II3 A;  4N9T A;  4KKS A;  4EQO A;  3O13 A;  2Q2U A;  3I70 A;  3D4D A;  1DOM A;  3STB D;  5C5L A;  1UEA B;  4J8Q A;  5K36 G;  2AKW B;  2SDF A;  5CV6 A;  5E4X A;  4TVA B;  4OHJ A;  1NE3 A;  4UP7 A;  1LO5 D;  2VQE Q;  4DV7 L;  3NQI A;  2R6G A;  1F2L A;  3MA2 B;  4NXN L;  1BO0 A;  3NUC A;  4FXD A;  2L0C A;  3BVZ A;  1CM9 A;  1J6Q A;  1EOV A;  5CBA E;  1SYG A;  2Z4H A;  4CGY B;  1EWC A;  4GNX B;  1TS5 A;  1FL0 A;  4FF4 A;  2KED A;  2PW5 A;  1LTR D;  4HSV A;  3M9B A;  3VR4 A;  1PZK D;  1EY7 A;  1A3U A;  4E6I A;  3RZO B;  2NZ1 D;  1K28 A;  1SND A;  5IP9 G;  4HAE A;  3GTL B;  5LHY 1;  1F77 A;  3OWE B;  4HCE A;  4ABN A;  4GZY C;  5GAD C;  2MNA A;  4ILW A;  1A63 A;  3OW2 A;  2ALY B;  3HOX H;  1Y69 U;  3ICE A;  1VQG A;  1SN8 A;  2F0J A;  2B2U A;  1I3Q H;  3QWN A;  4O0A A;  2KHI A;  3HGB A;  4BBS H;  4ZKC B;  1BQQ T;  3AQQ A;  1Y14 B;  3NPP A;  1IXR A;  2IW3 A;  2XSC A;  1IYU A;  1HR0 L;  4JC0 A;  5CBE E;  2VNU D;  2E75 C;  3OTO L;  3BS1 A;  1UUP A;  5IE8 A;  2Z1C A;  1NJI C;  4L5S A;  3SDZ A;  1QNK A;  3J81 L;  5BN4 A;  4RH6 A;  2EOT A;  3GTK H;  2FFK B;  4XYQ A;  4RHR A;  1VQJ A;  3U4Z A;  1PH8 A;  5G3L F;  4HJ9 A;  4HJ5 A;  4ODG A;  2CQO A;  1SLJ A;  1Y8O B;  2JE6 I;  3VYR A;  4ZYS A;  4KJO A;  1VQF A;  4BY7 G;  2B63 G;  2A69 D;  1HA6 A;  2A6E D;  1PTO D;  2F0P A;  2WIN B;  2QIL A;  3TP6 A;  2JA7 B;  3L0O A;  1IW7 C;  1K8M A;  2K6A A;  1K3B C;  1C0A A;  2M2L A;  4A3B H;  2Z9H A;  5IYB G;  4X64 Q;  3OYY A;  3LWE A;  2RDH A;  4C56 C;  4P74 A;  3EA6 A;  3I4L A;  4Q0F A;  1X55 A;  4GNX A;  4X65 L;  3HP3 A;  2UUA L;  4DV6 L;  2EE1 A;  4RCO A;  4FF1 A;  4JVZ A;  4F87 A;  2JA8 H;  3J7A F;  3TZU A;  5JPN C;  5F2D A;  1Z47 A;  2K4K A;  3C1F A;  2PCF B;  2YU9 B;  1HZA A;  1FR3 A;  4HCS A;  1DOL A;  5FJ8 G;  2WB1 E;  4R8N A;  1STB A;  1YNN D;  3IRB A;  3K80 C;  1FNU A;  1PH2 A;  1HA5 A;  1PHJ A;  4LMQ D;  3RMH A;  3PUY A;  1EWH A;  3T53 B;  3I4M G;  3QOJ A;  2VUM H;  4OIK A;  2PNR C;  4LWC A;  2JK8 A;  1Q8I A;  3DHQ A;  1B9N A;  3NEM A;  4CJ1 B;  2X69 A;  3EBE A;  1PFN A;  4DV3 Q;  3PO2 G;  1MIU A;  1NR2 A;  4KV6 A;  1SYE A;  4UP8 A;  4DV2 L;  1ENA A;  1S3O A;  4R4O A;  4GLV B;  1I50 B;  4KHV A;  4OEM B;  4KN4 C;  1KLG D;  1VQN A;  2DY7 A;  3U9S A;  1PH9 A;  2YTY A;  1K8O A;  4X66 Q;  4DR4 L;  2EPB A;  2QKI C;  4GNX C;  3TRE A;  2EJG C;  3UE0 A;  2IJ0 A;  1ICW A;  3OHX C;  1IBK L;  3SXH A;  5G3L D;  1Q7Y C;  1AW7 A;  4RWS C;  1SMX A;  2TSS A;  2A8V A;  5EPJ A;  2FXQ A;  3VYS A;  3HOW B;  4JYA Q;  1HFN A;  3A54 A;  2A6H C;  1PH5 A;  2NVT H;  1TWA H;  3S24 A;  4BA2 I;  4A76 A;  2XGT A;  1TS3 A;  1ASZ A;  3J81 c;  4F8M A;  3WOE A;  5C4J B;  1RKN A;  4EQP A;  3MFY A;  3IAY A;  1O78 A;  2PZU A;  2K1B A;  1EU3 A;  5E7N A;  1KL9 A;  1LTI D;  4HJA A;  1X54 A;  1AFP A;  2Q8I B;  5LL6 X;  2HD3 A;  4A3K H;  4LFB L;  1GO3 E;  2EYP A;  5C0X H;  1EEF D;  2CH4 A;  2NVQ H;  1PFB A;  1P16 A;  3NTK A;  1QVF A;  2HHH L;  1VQ7 A;  4TKO B;  4L5R C;  2RF4 A;  1ZEQ X;  3UDF A;  4RGO S;  4A3E G;  1KD1 C;  4LF7 Q;  4OXP A;  2FJ2 A;  1GHK A;  5C0X I;  1MI2 A;  5BN3 A;  2JA5 H;  3MHB A;  5T1I A;  2IX3 A;  4CKE A;  3DEO A;  1OXT A;  4MNO A;  5C3X A;  5C3E B;  1CK1 A;  2KEC A;  2DNC A;  4YIJ A;  1R4Q B;  4KD3 A;  3PO3 H;  1HNW Q;  4CKC A;  3X3M A;  5E1F A;  2YYZ A;  4XIG S;  1M8A A;  4JI1 L;  4EVO A;  3GTP H;  1PLF A;  4KHZ A;  3OMG A;  4POG A;  1B70 B;  4WRD A;  5IT9 L;  5GAG C;  3OSO A;  2I5H A;  2UXD L;  4AYB B;  1PTO F;  5KND A;  1K73 C;  3GTQ B;  1HR0 Q;  1H95 A;  3ERS X;  2JYO A;  4KLK A;  3TN2 A;  2NWG A;  2VS1 A;  4ZKB B;  4JV5 Q;  2JA7 G;  3F2C A;  3HEJ A;  2KOL A;  2G5D A;  2DNE A;  5KRU A;  1BBX C;  5IOC A;  4K6D A;  1MJC A;  3EVQ A;  2JSO A;  4DAM A;  2AQ3 B;  2B2Y C;  4TQU S;  2KEN A;  4DXF A;  1Y1V H;  3CD6 A;  5JJI A;  2GA4 B;  5D3D A;  1L0W A;  2EXD A;  1KXL A;  2JXM B;  1K8G A;  4A93 B;  2H1E A;  2B3G A;  1TWC H;  3F2B A;  1U9R A;  5IGB A;  3EIV A;  4WFN 3;  1KLU D;  1U4M A;  3ERQ A;  4R4Q A;  3T1H L;  1N34 Q;  4QIW E;  4XT1 B;  2NBF A;  2IWH A;  2L55 A;  2F0T A;  3F1Z A;  2Z8L A;  3KFU A;  4DR7 Q;  2C5C A;  1I4X A;  1PTO H;  2XIW A;  3H15 A;  2Z6K A;  2ZTC A;  1WTO A;  1X3Q A;  2PMZ E;  2PI2 E;  3NE5 B;  1I4P A;  4EGV A;  1STA A;  5FLX E;  3HOV H;  4JBK A;  2EY5 A;  1Y1W B;  5ELB A;  5KYI A;  2BOS A;  5JJL A;  3IKJ A;  2RDF A;  3M7N A;  1BOS A;  1N33 L;  3RLN A;  5M5X H;  4H02 A;  1M1K C;  2CWP A;  3K58 A;  1D5M C;  1TT2 A;  1V1O A;  1TWH B;  1PTO B;  4IOC A;  4A3D G;  2A69 C;  3HOV G;  5C3W A;  3R2I A;  3HOU B;  3DWP A;  1F9S A;  1GUO A;  1LT4 D;  2F1M A;  4LF9 Q;  2UXC Q;  3U9O A;  4ZK9 B;  2BA1 A;  2SNM A;  1YHB A;  1XTC D;  1IKL A;  3FKI H;  1HUM A;  3I4N B;  3T4A C;  3HOY H;  4BS9 A;  4B3T Q;  1XNQ Q;  3A5U A;  3K5O A;  5ELC A;  1PV4 A;  5FLX L;  2R92 H;  2A73 B;  3FP9 A;  2BH2 A;  5ELN A;  4XQJ A;  4YY3 L;  4DK3 C;  4PG3 A;  3W2D A;  3M3Y H;  3K59 A;  1EYD A;  4C3I H;  2B2T A;  1B9M A;  1JWU D;  4ID6 A;  3SEB A;  2KHS A;  3KDF B;  1EQQ A;  5M9O A;  3D3R A;  1X3G A;  3E9I A;  3EQL C;  1W6K A;  5IY0 A;  1ILQ A;  2MO0 A;  5EKK A;  1A2T A;  4KY7 A;  1FYC A;  4QF4 A;  4RG1 A;  5M3F H;  3VYU A;  3HS0 C;  1IW7 D;  2B39 A;  3GTP B;  1QJO A;  1JE4 A;  1K83 H;  4XTC S;  1O7L A;  1O80 A;  2A5H A;  1D5Z C;  2ICI A;  3E3X A;  4LUO A;  4NW2 A;  1K0S A;  1LTB D;  1KTK A;  3TRZ A;  4GKK L;  1JIC A;  2RVL A;  3MXP A;  4NP5 A;  1A2U A;  3AU7 A;  2G9D A;  2HDM A;  3D0F A;  4DR3 Q;  3FPP A;  4DPG A;  1BKB A;  4KJN A;  4AQY Q;  2QGQ A;  2C35 B;  3K7A H;  2AWN A;  3MWY W;  1QVG A;  3S9W A;  4K5V A;  1GD7 A;  1FNV A;  1MSG A;  3L2P A;  1SFO B;  1CKM A;  4LFA Q;  1Z7T A;  1STY A;  3CCS A;  5KGU A;  3H6M A;  2E2I H;  3S14 H;  1EIY B;  4KKT A;  3ERO A;  3URY A;  4DU9 A;  1JR0 D;  4FYD A;  1EFW A;  1PRT C;  5ISR A;  5M3F G;  3GQB A;  5C0X G;  3GP7 A;  1SRU A;  3RZD B;  2JA6 G;  4KD4 A;  5C4J H;  1HH2 P;  4K2L A;  3MXG A;  4IN3 A;  4KY5 A;  1V9P A;  5DAU A;  2L1B A;  4QUC A;  1VQ6 A;  1D5X C;  3H3V H;  3ULL A;  2RKS A;  2NVT B;  2F4V Q;  1X6O A;  2WV6 D;  5EJW A;  4FDB A;  5IOD A;  2KHJ A;  2XWJ B;  1EYG A;  5KYL A;  3S1Q H;  3R93 A;  4LF7 L;  3TP5 A;  1N34 L;  1S5D D;  4DV0 Q;  1W6J A;  3DM3 A;  3S1R B;  2VW9 A;  1B7Y B;  3NEL A;  4B3S L;  2X6G A;  1LAB A;  1VQE A;  4JCV E;  4LFA L;  2CQA A;  4GOP A;  1YNN C;  3CMA A;  1RTO A;  3OMC A;  3KF6 B;  1PYS B;  2F0U A;  5IWA Q;  4BBR G;  4A3D H;  5IGF A;  1I4H A;  3E0J A;  4BY1 B;  4LF6 L;  4DGZ A;  3Q8D A;  5FLX c;  1KIX A;  4PMC A;  4DV2 Q;  3KLW A;  1YHA A;  5CV8 A;  5EQ0 A;  5J39 A;  4HN7 A;  1VS0 A;  4RHS A;  5M3M G;  1B8A A;  3VR2 A;  1HUN A;  3OPO A;  1I6H B;  2ZTE A;  2D5D A;  4JI3 Q;  3PO2 B;  2OTJ A;  3GO5 A;  4YWM A;  2J7Z A;  1Y8N B;  3PSI A;  3CXC A;  3CCU A;  1KC8 C;  1SE2 A;  3OOC A;  1NSN S;  1NR4 A;  5M5Y B;  1K3R A;  4EX5 A;  2QEX A;  1E3P A;  2H4O A;  4LUZ A;  1STE A;  3N52 A;  1E2W A;  4IUP A;  3T13 A;  2F3I A;  2JA8 B;  5C0X J;  1E2V A;  2K52 A;  2VQF Q;  4FO2 A;  3CP0 A;  3MTS A;  3I7F A;  2B2W C;  4GS3 A;  4B3S Q;  4ME3 A;  4QY7 A;  4YCU A;  1Y1V G;  1WCM G;  4DR2 Q;  4R4C A;  3R2T A;  4OGQ C;  1A15 A;  4FNF A;  1TWF H;  3V2T A;  1BXT A;  2ATW A;  1KRS A;  2JA7 H;  1Q1B A;  3FMC A;  4XYO A;  1TII D;  1W2B A;  3J7Y W;  2R93 H;  1O7I A;  1WCM B;  2NB0 A;  1CKO A;  2WB1 G;  4LF9 L;  4A3B G;  1MJE A;  2JA6 H;  1U4R A;  3H94 A;  1EZ6 A;  4DXG A;  1PH1 A;  1XPU A;  1J5E Q;  1UE7 A;  4OL7 A;  4R4T A;  1YI2 A;  3CCJ A;  4HIK A;  1X65 A;  5J22 A;  3CRK C;  1ZYR C;  1WTP A;  1I6V C;  4JI6 Q;  1EWI A;  2WII B;  1SNQ A;  2F0S A;  4OO1 H;  1I4R A;  1Y1W G;  1X9N A;  1BCP B;  1EZ8 A;  2DGY A;  4XT3 B;  5IGD A;  2A74 C;  5IGC A;  2RA4 A;  1TVX A;  1R9T B;  1N9W A;  1F2Z A;  5LL6 S;  1ZKO A;  5JPM C;  4YHH L;  2B8F A;  1HZB A;  4JG2 A;  1D1I A;  3CCL A;  5K5P A;  4BBS B;  3TEH B;  3TBI B;  3W1B A;  4BY7 B;  1YIJ A;  1Z9F A;  3K7U C;  3RR5 A;  2K03 A;  3SR1 A;  4DV5 L;  4L6T B;  3TP8 A;  2XTI A;  3W3A A;  4LF6 Q;  3DM1 A;  2CKZ B;  4JV5 L;  2EDG A;  3G48 A;  1DXM A;  1LTL A;  4GKK Q;  1OO9 B;  4QCL A;  3S2D B;  5IYC G;  2ID0 A;  1ROD A;  2F0D A;  3HG9 A;  1VQP A;  4IPH A;  5JEA H;  1WTV A;  1I5F A;  3KF8 A;  2NVY B;  2VB2 X;  3CHB D;  1CA6 A;  1Z6H A;  5I9P A;  2ENB A;  2JP1 A;  4C3I G;  3I8Z A;  3VA7 A;  3KBX A;  4RGT A;  3VA5 A;  1NMF A;  1ET9 A;  5M5W B;  3HOY G;  3F8T A;  3RD4 A;  1WTH A;  1VQK A;  1YNJ D;  3KJP A;  3KUP A;  3LWU A;  3CCV A;  3I90 A;  3F2D A;  1WD0 A;  5GAE C;  1G91 A;  3WOF A;  1CZG A;  4IPG A;  4GLA C;  1B53 A;  2KBN A;  4P71 A;  3S1M H;  1Q86 C;  3PF4 A;  3HKZ G;  1ENC A;  2E5L Q;  1SJH D;  4A3J G;  4IAL A;  4CKB A;  4NB3 A;  3F2U A;  1SJE D;  4A3F G;  3S2H H;  3NHH A;  5M3M H;  2N3S A;  5K36 H;  2F0N A;  4TRD A;  1HNX Q;  1N32 Q;  1H9K A;  1VQB A;  1HHV A;  2VUM G;  3HKZ E;  3GTO B;  2K33 A;  5A2Q E;  2KEE A;  3KK7 A;  2F3V A;  2F0H A;  4KY6 A;  4DUY L;  3T1H Q;  4DV4 L;  5JJZ A;  2N55 A;  5I6Y A;  2VXW A;  1XPO A;  3HFZ B;  1GKH A;  4DR5 Q;  3K81 C;  4JI8 Q;  5FJ8 H;  1SYF A;  4ME5 A;  1MD2 D;  1Q81 C;  3E9H A;  5IGE A;  3HOZ H;  3A8I E;  1L1O C;  1IL2 A;  1KNE A;  5IGG A;  2JA8 G;  4X64 L;  3Q22 A;  4CBV A;  4KK7 A;  1J8I A;  1ESF A;  1KAA A;  4Y7N H;  2CFM A;  4PZ8 A;  2OT2 A;  1OXX K;  1IKM A;  1O7Y A;  2V1C C;  2QF7 A;  5IYC H;  3BDC A;  1JJG A;  2D0O A;  4RFB A;  2NVY H;  2J4X A;  3KF8 B;  1PFM A;  2BE5 D;  2EYJ A;  4LF8 Q;  2LXK A;  3VYT A;  4GN3 B;  2CH4 W;  3N6R A;  3PQI A;  1YHQ A;  4A3M B;  4LF4 L;  2IT1 A;  5LMN L;  3ND9 A;  5C4X H;  3G6J B;  3GTG B;  1JMC A;  4BBR B;  3QR8 A;  4C2M B;  1FJG L;  2K5D A;  1SNO A;  2CWA A;  5GAH C;  1E22 A;  2EJM A;  2ZTD A;  1H9R A;  1HRJ A;  2PNH A;  2C9O A;  2AUJ D;  3D31 A;  1PZJ D;  1F9P A;  5JVH 3;  1LLR D;  4A3L G;  2HCC A;  4DV1 Q;  4NKL A;  4A3L H;  3CC4 A;  1B50 A;  4IUR A;  5FLM H;  4MTN A;  3VR3 A;  1GUG A;  3J80 c;  2ZXR A;  1HZ9 A;  5HY6 A;  1WVL A;  1OXV A;  4YCW A;  3A8J E;  2IHF A;  4OO1 G;  2Y0S E;  1AZQ A;  2HQL A;  3T16 A;  2ZJP A;  3I56 A;  2JA5 G;  4F88 A;  4TSS A;  2UXD Q;  3SK4 A;  4L5T A;  5DLQ E;  2UXB L;  4LW1 A;  1BCP C;  2UUC Q;  4J1M A;  2HQE A;  1GHJ A;  1SDF A;  1G2S A;  2MFI A;  4MTK A;  4XXE A;  1LTG D;  5BR8 Q;  2JQO A;  2JEA I;  3NTI A;  4PMB A;  4IOA A;  1QUQ B;  1TS4 A;  2F4I A;  1VQC A;  2OWO A;  3V96 A;  3C2P A;  4A3K G;  1S5E D;  1EY6 A; 
#chains in the Genus database with same CATH homology
 1EOT A;  2CVR A;  4DK0 A;  1KDA A;  1QCB D;  3IFT A;  1LV9 A;  2WKD A;  5D65 A;  1TWF B;  3BG3 A;  4B9X A;  4C3J B;  5COY A;  2AQ2 B;  2PW7 A;  2D62 A;  1RDP D;  1FNW A;  2LMC B;  4K5X A;  3CRL C;  4A3F B;  2EY2 A;  1BF4 A;  2O2L D;  5E3F A;  4M8A A;  3J7A V;  1Y8P B;  1U4L A;  2EZV A;  2KA7 A;  1WTW A;  1STN A;  1WD1 A;  1EEI D;  3L3O C;  4JBW A;  4C3H B;  3WDN A;  1CHQ D;  1EYA A;  4ULL A;  3NQT A;  3T51 B;  4G4K A;  3BDO A;  1EIG A;  2A68 D;  3MVV A;  1QE6 A;  3J81 E;  2IX0 A;  4L8J A;  3S1N B;  2B2W A;  1DOK A;  3PIP 3;  1JOQ A;  1PDQ A;  1JQY D;  4QUF A;  1HFG A;  4B08 A;  1WTQ A;  4DAY A;  2B8G A;  2QDB A;  3Q23 A;  2MP1 A;  3R8B A;  2PZW A;  5D14 A;  4FF3 A;  1EY5 A;  3GTJ B;  2OEO A;  3C3L A;  4FXG C;  3A8K E;  3SK8 A;  1GJX A;  1Q90 A;  5JEA J;  3S1Q B;  4XDX A;  2R7Z B;  1AP0 A;  2F0V A;  1XWE A;  2FMC A;  3Q0A A;  4ZLT F;  4IUU A;  4IUV A;  1VMP A;  5FO9 B;  1G2T A;  2VB3 X;  3IL8 A;  1AN8 A;  2EXZ A;  4A3J B;  4K8I A;  4IUT A;  1LAC A;  1CTM A;  4K5W A;  4HR7 B;  2ZXO A;  3RLF A;  3GV3 A;  4K2K A;  2F0W A;  4H0L C;  2SEB D;  2MGS A;  3K7A B;  5DM6 3;  4R9W A;  4IUN A;  1T5E A;  5CGK A;  1G8Z D;  4BWG B;  1NAP A;  1VCI A;  2XRS D;  1G6Z A;  2E2J B;  5AFW A;  1QB5 D;  3CQZ B;  2V4D A;  2KQ3 A;  2B2T C;  3DUZ A;  3S17 B;  4RCN A;  1ZXT A;  2F0M A;  2EJF C;  1H9S B;  2DN8 A;  1D6E C;  4LK1 C;  5JAV A;  1DM0 B;  1QG7 A;  2HDL A;  1JOR A;  1HXY D;  2R3Z A;  5I2Y A;  3TZD A;  4FF2 A;  5CV5 A;  5I4D A;  1EY4 A;  4H7B A;  2K05 A;  3SK5 A;  3QIA A;  5FKA C;  3DEP A;  3FPU B;  1RD9 D;  4MIU A;  2F0O A;  1QWY A;  1BR9 A;  3P20 A;  2F0L A;  4FXK C;  1CQF A;  2A6E C;  3D4R A;  1ILP A;  1F2Y A;  3PUX A;  4HMI A;  1RCV D;  1SYD A;  1MSH A;  2NUC A;  3BVM A;  4KTA A;  4X3S A;  3Q24 A;  1B1Z A;  2SOB A;  3HOV B;  3K5N A;  3FVQ A;  5DEH A;  1ML0 D;  1EIH A;  2NTS A;  5I2X A;  3M85 A;  5T1G A;  4H13 C;  5CV4 A;  3PMF A;  1OXS C;  5DNF A;  4NMZ A;  2IX1 A;  1JCK B;  3NXW A;  3HZX A;  4A3I B;  2X6L A;  5CV9 A;  1TWC B;  3K57 A;  2XN9 C;  3Q6S A;  2I07 B;  3HOZ B;  5KEE A;  2BCO A;  2XNA C;  2CW0 D;  3S15 B;  4FP5 D;  2WP8 J;  2L4N A;  1STH A;  4IFD I;  1FGB D;  3EFX D;  2EY1 A;  1STG A;  4A3E B;  3A55 A;  3J80 E;  3MFG A;  5M3M B;  5FO8 B;  5CC4 A;  4DAP A;  1KDC A;  3A56 A;  1ONL A;  3L9A X;  3MAQ A;  4X3U A;  4C1N I;  2F03 A;  4R8I A;  1SNP A;  1EYC A;  4B9W A;  2HUG A;  2EYF A;  2WAQ B;  3P1H A;  3IFD A;  2BDN A;  2BDO A;  1QNU A;  1EY9 A;  4OO1 I;  2HCI A;  1E2Z A;  4K14 A;  1Q1E A;  3MZ5 A;  3D6C A;  1DYQ A;  1JWS D;  2B2V A;  4A3G B;  1NUC A;  3NK9 A;  3FRP B;  3PUZ A;  1VMC A;  5IT9 E;  1V1P B;  2IL8 A;  4J6H A;  2F0E A;  2JEB I;  5EGT A;  2NVQ B;  1CFM A;  1HTP A;  2N88 A;  5JVG 3;  4M1U B;  2I46 A;  1PMR A;  3X3N A;  1MBY A;  2RQX A;  4A3K B;  3RUZ A;  1VDZ A;  3QJY A;  1DON A;  1RJT A;  3SHL A;  4WJW A;  2B2Y A;  2IPK D;  2AWO A;  4C1N K;  1NCV A;  3D4W A;  2EYL A;  2MPM A;  2R61 A;  3SK6 A;  4KMU C;  4H44 C;  5EKL A;  1CA5 A;  1VF7 A;  1HTL D;  4CJ0 B;  4UAI A;  1XX8 A;  2FMM A;  1IYV A;  1EU4 A;  4RGM A;  3I3C A;  4LJZ C;  3MXN A;  3ONA B;  5FOB B;  3QB3 A;  1TS2 A;  1EY8 A;  2O5J C;  3BYY B;  4ZUI A;  4KKU A;  3QG1 A;  4DA2 A;  1F9R A;  1M4V A;  1BCP F;  1IL8 A;  2L5T A;  2JA6 B;  3C46 A;  1DD2 A;  1LT5 D;  1HPC A;  1SNM A;  1MGS A;  1WTR A;  1B4O A;  2EY6 A;  2VUM B;  3S16 B;  1TQO A;  2R93 B;  5KIX A;  5FO7 B;  3P75 A;  3K0Y A;  1H9J A;  1J9O A;  4MHE A;  2PPB C;  1ENF A;  1H9S A;  1GXD C;  4QIW B;  5I6W A;  3MXU A;  2L9H A;  3HRZ C;  1A3T A;  1S5C D;  1A6X A;  5ELF A;  3OIP A;  2OXP A;  2Q8R E;  3I4M B;  3TP7 A;  1TR5 A;  1V8Q A;  1CQV A;  1Q12 A;  1SE4 A;  4OIJ A;  5C44 B;  4ZAI A;  1SEB D;  3NP8 A;  4RGN A;  3VR6 A;  1PXU A;  1TKW B;  3BVG A;  4A3B B;  1SMY D;  3K5L A;  4HTH A;  1DJR D;  5EBC A;  1T5X D;  2ZT9 C;  1EQT A;  2L12 A;  4NDX A;  1SAP A;  2CW0 C;  2KJX A;  1B2T A;  4DF7 A;  3G7L A;  3V05 A;  3H09 A;  3E5S A;  1I4G A;  3TME A;  1S5F D;  3MEH A;  3NWS A;  1LTA D;  5C4X B;  1LTS D;  3J80 L;  1PTO C;  2RSN A;  1WTX A;  1SSO A;  4O42 A;  2RSO A;  1V1P A;  4RKB A;  5IIF A;  3DWA A;  1H9M A;  5ELE A;  4IUQ A;  5JOB A;  5D3I B;  1GOZ A;  1SYC A;  2KCC A;  2M00 A;  1U4P A;  2PO4 A;  4Y7N B;  3A7A B;  4RKL A;  4V19 0;  1X32 A;  2CHB D;  1RF2 D;  1JB3 A;  2E76 C;  4S3S A;  4QMG A;  4I7Z C;  1G29 1;  5C5M A;  2ZXP A;  5EBD A;  2E2I B;  1LT6 D;  2QCP X;  3JAM E;  3R3O A;  4QB4 A;  4HSP A;  3NTH A;  3OW7 A;  4IFD G;  1SNC A;  5ELD A;  4G7O C;  4HED A;  1SYB A;  2BA0 A;  3NBH A;  2DY8 A;  1O7Z A;  2XVS A;  1AZP A;  4G57 A;  3I73 A;  5HGT A;  2KUM A;  1PYW D;  2M9V A;  3S1M B;  1I4Q A;  3TDQ A;  1K83 B;  2XWB B;  4DFA A;  1HQM C;  1RTN A;  3P7J A;  1CZW A;  2F0G A;  1CT1 D;  3C1E A;  2NYZ D;  4G7Z C;  1V43 A;  2NTT A;  4RA8 A;  4C3I B;  3QO2 A;  3TSS A;  4N9P A;  2XRQ D;  2ICE C;  3UI2 A;  3AMU A;  1BDO A;  2R92 B;  2EYO A;  3I72 A;  5EPK A;  4IFD J;  3HOY B;  3OIQ A;  1JOO A;  2MUY A;  3HKZ B;  2FHT A;  3KLS A;  1KAB A;  3CKI B;  4IZ8 A;  3H0G B;  2K01 A;  1B3A A;  2NVX B;  4C3H G;  1EL0 A;  2K7V A;  1UAP A;  4ZRZ A;  4KN7 C;  1PRT F;  1L0Y B;  4IFD H;  1CI3 M;  1CHP D;  3QOL A;  2O4X A;  1E0B A;  3FEW X;  1PZI D;  2O5I C;  2LS0 1;  1DCZ A;  4U67 3;  2PYK A;  4IQZ A;  4G7H C;  2NN6 I;  5BN5 A;  5J1Z A;  4PV1 C;  1JWM D;  5HUR A;  2KCN A;  2EYH A;  3H3V C;  5C6A A;  3MC0 B;  1PRT D;  3VR5 A;  2D9U A;  1DZ1 A;  5TSS A;  4PMW A;  1GUS A;  2K04 A;  1XXG A;  1SE3 A;  3E6Z X;  3PIO 3;  2L11 A;  4K6L A;  1OXU A;  2D2C C;  4C3J G;  1LTT D;  4WOR A;  2PMZ B;  3PO3 B;  2RDG A;  3M4Y A;  1PRT B;  2WAC A;  2RBM A;  5I9O A;  5EPL A;  1HCZ A;  3I91 A;  2JA5 B;  5EKI A;  3K5M A;  4FVM A;  3ND8 A;  5DM7 3;  1AEX A;  1C48 A;  3ZYY X;  4A3D B;  1A3V A;  3LNN A;  4L63 B;  2KVM A;  2LKV A;  5A2Q L;  3OWF A;  1GUW A;  5COR A;  3PV0 A;  2TMP A;  5E4W C;  1D1K A;  2K32 A;  1UNS A;  3KLS X;  5CV7 A;  3SE0 A;  1YNJ C;  5A35 A;  2WKC A;  2B2V C;  1LT3 D;  3BYT B;  1JC7 A;  5C4Z A;  4ZUJ A;  2QEJ C;  2B2U C;  2J0T D;  4RAU C;  1TWA B;  1FD7 D;  5KNC A;  3DMU A;  1JOK A;  4P2C B;  4X3T A;  1F2M A;  3PUW A;  4UDU C;  4DAV A;  4XQQ A;  4DNR B;  3M4O B;  3EJI A;  4XQN A;  1RHP A;  2LY7 A;  3T56 B;  3NWT A;  1TY0 A;  3S14 B;  2F3W A;  4Q5V A;  1VF5 C;  3DWQ A;  3CU7 A;  4DK1 A;  1HQR D;  3BDL A;  2A68 C;  3GTM B;  5CMD A;  1SBB B;  3M7G A;  2NN6 H;  3D6W A;  4I65 A;  2F0F A;  1TWG B;  4V0B A;  2AQ1 B;  1S4Z A;  4Z9C B;  1SMY C;  3PUV A;  1S5B D;  1BCP D;  1EY0 A;  5M3F B;  3D8G A;  2EVB A;  3JAM L;  1ET6 A;  2MJ8 A;  5JEA G;  3FDT A;  4PQX A;  3M3Y B;  2WB1 B;  2F0Q A;  2K5W A;  4K8J A;  2E74 C;  3BZD B;  2F0I A;  2MHV A;  2NN6 G;  3NSW A;  1EFI D;  1TU2 B;  5CR3 A;  4BA1 I;  2OF1 A;  4O1N A;  3KBG A;  1KNA A;  3FKI B;  1XYI A;  3H91 A;  1EQV A;  2Y0S B;  2AUK A;  2K28 A;  2SNS A;  3GD7 A;  4DNT B;  4JK1 C;  4U68 A;  3A7L A;  3GTK B;  3GV6 A;  5M5X B;  2LFN A;  1C4Q A;  2Q8T A;  4CJ2 C;  4F7X A;  2FIN B;  1QIL A;  1R4P B;  1ZYR D;  2Z4I A;  3K6O A;  3NBI A;  2PZT A;  4HMJ A;  4PNY A;  1SXT A;  1I3Q B;  2PQE A;  2B63 B;  5KNB A;  3HOX B;  3AB9 A;  5FK9 C;  4KI0 A;  1X3P A;  1GUN A;  2E2D C;  1ESR A;  5CYU A;  1B44 D;  5NUC A;  4LAA A;  1L0X B;  3KLR A;  1D2B A;  4X3K A;  4EQN A;  1KDB A;  1Y1V B;  1IHZ A;  4ZQ3 A;  1GUT A;  2E2H B;  1QOH A;  3LX0 A;  1F9Q A;  2BE5 C;  3ITP A;  1BUV T;  2A6H D;  2F0K A;  3L7Z C;  1BNZ A;  4CHT B;  5C4H A;  3DXJ C;  4MN3 A;  1C8C A;  2G9H D;  3SVM A;  1Q3L A;  4DN4 M;  2K5Q A;  1TY2 A;  2EYM A;  3S2H B;  1II3 A;  4N9T A;  4KKS A;  4EQO A;  3O13 A;  3I70 A;  3D4D A;  1DOM A;  5C5L A;  1UEA B;  4J8Q A;  5K36 G;  2SDF A;  5CV6 A;  5E4X A;  4OHJ A;  1LO5 D;  3NQI A;  2R6G A;  1F2L A;  3MA2 B;  1BO0 A;  3NUC A;  4FXD A;  2L0C A;  3BVZ A;  1CM9 A;  5CBA E;  1SYG A;  2Z4H A;  4CGY B;  1EWC A;  1TS5 A;  4FF4 A;  2KED A;  2PW5 A;  1LTR D;  4HSV A;  3VR4 A;  1PZK D;  1EY7 A;  1A3U A;  4E6I A;  3RZO B;  2NZ1 D;  1SND A;  4HAE A;  3GTL B;  5LHY 1;  1F77 A;  3OWE B;  4HCE A;  4ABN A;  4GZY C;  4ILW A;  1Y69 U;  2F0J A;  2B2U A;  3QWN A;  3HGB A;  4ZKC B;  1BQQ T;  3NPP A;  2IW3 A;  2XSC A;  1IYU A;  5CBE E;  2VNU D;  2E75 C;  3BS1 A;  1UUP A;  2Z1C A;  3SDZ A;  1QNK A;  3J81 L;  5BN4 A;  4RH6 A;  2EOT A;  2FFK B;  4XYQ A;  4RHR A;  5G3L F;  4ODG A;  1Y8O B;  2JE6 I;  3VYR A;  4ZYS A;  4KJO A;  2A69 D;  1HA6 A;  2A6E D;  1PTO D;  2F0P A;  2WIN B;  2QIL A;  3TP6 A;  2JA7 B;  1IW7 C;  1K8M A;  2K6A A;  2M2L A;  3LWE A;  2RDH A;  4C56 C;  3EA6 A;  3I4L A;  4Q0F A;  3HP3 A;  2EE1 A;  4RCO A;  4FF1 A;  4F87 A;  3J7A F;  3TZU A;  5JPN C;  5F2D A;  1Z47 A;  3C1F A;  2PCF B;  2YU9 B;  1FR3 A;  4HCS A;  1DOL A;  4R8N A;  1STB A;  1YNN D;  1FNU A;  1HA5 A;  4LMQ D;  3RMH A;  3PUY A;  1EWH A;  3T53 B;  3QOJ A;  4OIK A;  2PNR C;  1Q8I A;  3DHQ A;  1B9N A;  4CJ1 B;  2X69 A;  1PFN A;  1NR2 A;  4KV6 A;  1SYE A;  1ENA A;  1I50 B;  4KHV A;  4KN4 C;  1KLG D;  2DY7 A;  3U9S A;  1K8O A;  2EPB A;  2QKI C;  2EJG C;  2IJ0 A;  1ICW A;  3OHX C;  3SXH A;  5G3L D;  1AW7 A;  4RWS C;  2TSS A;  5EPJ A;  3HOW B;  3VYS A;  1HFN A;  3A54 A;  2A6H C;  4BA2 I;  1TS3 A;  4F8M A;  3WOE A;  5C4J B;  1RKN A;  4EQP A;  3MFY A;  3IAY A;  1O78 A;  2PZU A;  2K1B A;  1EU3 A;  1LTI D;  1AFP A;  2Q8I B;  5LL6 X;  2EYP A;  5C0X H;  1EEF D;  1PFB A;  3NTK A;  4TKO B;  1ZEQ X;  4RGO S;  2FJ2 A;  1GHK A;  5C0X I;  1MI2 A;  5BN3 A;  3MHB A;  5T1I A;  2IX3 A;  4CKE A;  3DEO A;  1OXT A;  5C3X A;  5C3E B;  1CK1 A;  2KEC A;  2DNC A;  4YIJ A;  1R4Q B;  4KD3 A;  4CKC A;  3X3M A;  5E1F A;  2YYZ A;  4XIG S;  1M8A A;  4EVO A;  1PLF A;  4KHZ A;  3OMG A;  4WRD A;  5IT9 L;  3OSO A;  4AYB B;  1PTO F;  5KND A;  3GTQ B;  3TN2 A;  2JYO A;  2NWG A;  4ZKB B;  3HEJ A;  2KOL A;  2DNE A;  5KRU A;  1BBX C;  5IOC A;  4K6D A;  3EVQ A;  2JSO A;  2AQ3 B;  2B2Y C;  4TQU S;  4DXF A;  2GA4 B;  5D3D A;  2JXM B;  4A93 B;  2H1E A;  1U9R A;  5IGB A;  4WFN 3;  1KLU D;  1U4M A;  3ERQ A;  4XT1 B;  2NBF A;  2IWH A;  2L55 A;  2F0T A;  2Z8L A;  2C5C A;  1I4X A;  1PTO H;  2XIW A;  1WTO A;  1X3Q A;  3NE5 B;  1I4P A;  4EGV A;  1STA A;  5FLX E;  2EY5 A;  1Y1W B;  5ELB A;  5KYI A;  2BOS A;  3IKJ A;  2RDF A;  3M7N A;  1BOS A;  3K58 A;  1D5M C;  1TWH B;  1TT2 A;  1V1O A;  1PTO B;  2A69 C;  5C3W A;  3R2I A;  3HOU B;  3DWP A;  1F9S A;  1GUO A;  1LT4 D;  2F1M A;  3U9O A;  2BA1 A;  2SNM A;  1XTC D;  1IKL A;  1HUM A;  3I4N B;  3T4A C;  4BS9 A;  3K5O A;  5ELC A;  5FLX L;  2A73 B;  4XQJ A;  3W2D A;  3K59 A;  1EYD A;  2B2T A;  1B9M A;  1JWU D;  4ID6 A;  3SEB A;  2KHS A;  5M9O A;  3D3R A;  3EQL C;  1W6K A;  1ILQ A;  5EKK A;  1A2T A;  4KY7 A;  1FYC A;  4QF4 A;  3VYU A;  3HS0 C;  1IW7 D;  2B39 A;  3GTP B;  1QJO A;  1JE4 A;  4XTC S;  1O7L A;  1O80 A;  2A5H A;  1D5Z C;  2ICI A;  4NW2 A;  1LTB D;  1KTK A;  1JIC A;  2RVL A;  3MXP A;  4NP5 A;  1A2U A;  3AU7 A;  2G9D A;  2HDM A;  3FPP A;  4KJN A;  3MWY W;  2AWN A;  3S9W A;  4K5V A;  1FNV A;  1MSG A;  1SFO B;  1Z7T A;  1STY A;  5KGU A;  3H6M A;  4KKT A;  3ERO A;  3URY A;  4DU9 A;  1JR0 D;  4FYD A;  1PRT C;  5ISR A;  3GQB A;  5C0X G;  3GP7 A;  3RZD B;  4KD4 A;  4K2L A;  3MXG A;  4IN3 A;  4KY5 A;  5DAU A;  2L1B A;  4QUC A;  1D5X C;  2RKS A;  2NVT B;  2WV6 D;  5EJW A;  5IOD A;  2XWJ B;  5KYL A;  3R93 A;  3TP5 A;  1S5D D;  1W6J A;  3S1R B;  2X6G A;  1LAB A;  2CQA A;  1YNN C;  1RTO A;  3OMC A;  2F0U A;  5IGF A;  1I4H A;  3E0J A;  4BY1 B;  4DGZ A;  4PMC A;  5CV8 A;  5EQ0 A;  5J39 A;  4HN7 A;  4RHS A;  3VR2 A;  1HUN A;  3OPO A;  1I6H B;  2D5D A;  3PO2 B;  3GO5 A;  2J7Z A;  1Y8N B;  1SE2 A;  3OOC A;  1NSN S;  1NR4 A;  5M5Y B;  2H4O A;  1STE A;  3N52 A;  1E2W A;  4IUP A;  3T13 A;  2JA8 B;  5C0X J;  1E2V A;  4FO2 A;  3MTS A;  2B2W C;  3R2T A;  4OGQ C;  1A15 A;  4FNF A;  3V2T A;  1BXT A;  1Q1B A;  3FMC A;  4XYO A;  1TII D;  3J7Y W;  1WCM B;  2NB0 A;  1U4R A;  3H94 A;  1EZ6 A;  4DXG A;  4OL7 A;  5J22 A;  3CRK C;  1ZYR C;  1WTP A;  1I6V C;  2WII B;  1SNQ A;  2F0S A;  4OO1 H;  1I4R A;  1BCP B;  1EZ8 A;  4XT3 B;  5IGD A;  2A74 C;  5IGC A;  2RA4 A;  1TVX A;  1R9T B;  1F2Z A;  5LL6 S;  1ZKO A;  5JPM C;  2B8F A;  1D1I A;  5K5P A;  4BBS B;  3TBI B;  4BY7 B;  2K03 A;  3SR1 A;  4L6T B;  3TP8 A;  3W3A A;  3DM1 A;  2EDG A;  1DXM A;  1OO9 B;  4QCL A;  3S2D B;  2ID0 A;  1ROD A;  2F0D A;  3HG9 A;  5JEA H;  1WTV A;  3KF8 A;  2NVY B;  2VB2 X;  3CHB D;  1CA6 A;  1Z6H A;  5I9P A;  2ENB A;  2JP1 A;  4C3I G;  3I8Z A;  3VA7 A;  3KBX A;  4RGT A;  3VA5 A;  1ET9 A;  5M5W B;  3RD4 A;  1YNJ D;  3KUP A;  3LWU A;  3I90 A;  1WD0 A;  1G91 A;  3WOF A;  1CZG A;  1B53 A;  1ENC A;  1SJH D;  4IAL A;  4CKB A;  3F2U A;  1SJE D;  3NHH A;  5K36 H;  2F0N A;  4TRD A;  1H9K A;  1HHV A;  3GTO B;  2K33 A;  5A2Q E;  2KEE A;  3KK7 A;  2F3V A;  2F0H A;  4KY6 A;  5JJZ A;  2N55 A;  5I6Y A;  2VXW A;  1SYF A;  4ME5 A;  1MD2 D;  5IGE A;  3A8I E;  1KNE A;  5IGG A;  3Q22 A;  4CBV A;  4KK7 A;  1J8I A;  1ESF A;  1KAA A;  2OT2 A;  1OXX K;  1IKM A;  1O7Y A;  2QF7 A;  3BDC A;  4RFB A;  2J4X A;  1PFM A;  2BE5 D;  2EYJ A;  3VYT A;  1EY6 A;  3N6R A;  4A3M B;  2IT1 A;  3ND9 A;  3G6J B;  3GTG B;  4BBR B;  4C2M B;  2K5D A;  1SNO A;  2EJM A;  1HRJ A;  1H9R A;  2C9O A;  2AUJ D;  3D31 A;  1PZJ D;  1F9P A;  5JVH 3;  1LLR D;  2HCC A;  4NKL A;  1B50 A;  4IUR A;  3VR3 A;  1GUG A;  2ZXR A;  1WVL A;  1OXV A;  3A8J E;  4OO1 G;  1AZQ A;  3T16 A;  4F88 A;  4TSS A;  3SK4 A;  1BCP C;  4J1M A;  2HQE A;  1GHJ A;  1SDF A;  1G2S A;  4XXE A;  1LTG D;  2JEA I;  4PMB A;  3NTI A;  1TS4 A;  2F4I A;  3V96 A;  3C2P A;  1S5E D;  4ZK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...