3FDTA

Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
b'EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fdtA00
1DZ1A 5CBAE 1IL8A 1B53A 3KUPA 4ZKBB 1QG7A 4ZKCB 1DONA 1F9RA 2MP1A 1HUMA 5CORA 3G7LA 3FDTA 3HP3A 2XIWA 2L4NA 2SDFA 3GV3A 3SVMA 1HRJA 4X3TA 1Q3LA 2FJ2A 3H91A 5CMDA 5JJZA 1RHPA 5EQ0A 1B4OA 1VMPA 2CVRA 1KNAA 1EIGA 1F9SA 2FHTA 1WTXA 3D6WA 5EJWA 3I91A 1PDQA 2KVMA 2HUGA 1HUNA 2KEDA 1WTVA 1RTOA 3IL8A 1MI2A 1S4ZA 2B2WA 2RA4A 4RAUC 4HAEA 5E4WC 1WVLA 1BNZA 1JICA 2Q8RE 3I3CA 2JYOA 4ZK9B 1ESRA 2B2VA 5CBEE 1WTOA 2X69A 2HCCA 3DM1A 2B2VC 4OIJA 1B50A 2EOTA 4IUVA 4LMQD 2JP1A 2KOLA 2K04A 4X3SA 5T1IA 1MGSA 2B2TC 3ONAB 1G2TA 1XX8A 1RODA 3TZDA 1B2TA 1HHVA 3R93A 1M8AA 1J9OA 3GV6A 5EPLA 2RVLA 4X3KA 5EPJA 2L12A 1O7ZA 1CA5A 2FMMA 1U4MA 2M2LA 5DNFA 4RA8A 1BBXC 1AP0A 2K1BA 4IUQA 1AZQA 1ZXTA 4R9WA 2J7ZA 4CJ0B 1ILQA 2R3ZA 3MTSA 1DOMA 4HCSA 5T1GA 1U4PA 2BDNA 1O7YA 1WTQA 2NYZD 3FPUB 3TN2A 1PFBA 1SSOA 2DY7A 2HCIA 4IURA 4MHEA 2EPBA 2X6GA 1GUWA 1WTPA 3IFDA 1HFGA 2B2UC 3I8ZA 1J8IA 1G91A 1PLFA 2HDLA 2B2TA 2K28A 3MWYW 1G2SA 2B2YC 4U68A 1AZPA 4RWSC 2K03A 2FFKB 2H1EA 4HEDA 1ICWA 2K05A 3UI2A 1LV9A 1EIHA 1HFNA 1TVXA 3I90A 1WTWA 1WD1A 1G6ZA 2FINB 1NR2A 2N88A 3LWEA 3Q6SA 1KNEA 2X6LA 1CM9A 2NWGA 4XT1B 1JE4A 5E4XA 2MPMA 1B3AA 1NR4A 1ML0D 2K01A 4MN3A 1PFMA 5AFWA 1MSHA 1EQTA 2D9UA 3KBXA 4HSVA 1NCVA 1F9QA 2HDMA 2MGSA 1X32A 4IUUA 2VXWA 4ZAIA 1WD0A 2MJ8A 4X3UA 4IUPA 1SDFA 5EPKA 1VMCA 2EE1A 1IKMA 1EL0A 2B2UA 4XT3B 4OIKA 2RSNA 2KUMA 4ZLTF 1RTNA 2B2YA 4R8IA 4CJ1B 1ILPA 3N52A 4O42A 1XYIA 5D65A 4QUFA 1DOLA 2KECA 2NZ1D 1BO0A 2KEEA 3DEPA 5D14A 4CJ2C 4DN4M 3DEOA 2N55A 2L1BA 1C8CA 1RJTA 1X3PA 4QUCA 2RSOA 1DOKA 1F9PA 5COYA 2L9HA 1NAPA 2L11A 1BF4A 5EKIA 1CA6A 1MSGA 1QNKA 1QE6A 1WTRA 3P7JA 1U4RA 1F2LA 2IL8A 4IUTA 4XDXA 2DY8A 3F2UA 1A15A 3QO2A 4NW2A 2B2WC 1E0BA 4UAIA 1PFNA 1IKLA 1U4LA 1X3QA 2Q8TA 1HA6A 1EOTA 1O80A 1SAPA
chains in the Genus database with same CATH superfamily
2F52A 1O78A 1S5DD 1Q8IA 4JI7L 2JEAI 4LF6L 4HMJA 2VQFQ 2QCPX 2VUMH 1GHJA 4IJLA 4PZ7A 1Q3LA 2FJ2A 5IP9G 1UNSA 3A8KE 3MFYA 5CMDA 1EYGA 1B4OA 1HNXL 4P74A 4OX9Q 1HUNA 1CUKA 2K5NA 4TKOB 5A2QE 2KCTA 1F2ZA 1ONLA 1YIJA 3KF8A 1PTOF 1AE3A 4DV2L 3K8AA 1RF2D 1TT2A 3CC7A 3LGJA 4ULLA 1BCPD 3OOCA 2M00A 3KDFB 3IRBA 4IUVA 4LMQD 2A5HA 4EX5A 2NVYH 1IBLL 3HEJA 1BR9A 4A3MB 1Y1WB 3A5UA 1I4QA 3CU7A 4A3GH 1LUZA 2JEBI 5M5WH 2B39A 1HJPA 5I2YA 1BCPB 1CKOA 2FMMA 3KK7A 4LAAA 4RG1A 2K1BA 1K8OA 1FD7D 4IPHA 2G9HD 2KQ3A 2PMZB 4C3JG 3DM3A 4GOPC 2R61A 1B70B 2O5JC 5M3MB 5G3LD 1SSOA 3S2HH 1H9KA 2X6GA 1JJ2A 1ENFA 3DLLA 3IFDA 1G91A 4U68A 2K28A 1G2SA 4JI1L 1LT5D 1LV9A 4I7ZC 4FVMA 2F0OA 1WOCA 4LF6Q 3ND9A 4KHZA 3OWEB 3CC2A 4DR5Q 1K28A 1K83H 3G6JB 3OHXC 1EY7A 2K01A 3HGBA 2XNAC 1HNXQ 3HOXG 3GTJH 2UXBQ 2CQAA 3PMFA 1VMCA 1CTMA 4N9TA 4UY8C 3DWQA 1XJVA 4O42A 1HPCA 1H9SB 2A69D 4DV2Q 2YV5A 1L0WA 1EY0A 3RUZA 1RJTA 1YJNA 4K2LA 2EY5A 4L5SA 3HOZH 1PRTC 1IBLQ 2XVSA 2LFNA 5EBDA 5C4ZA 3WOFA 2IL8A 1JB3A 3MXPA 5C44B 4UAIA 1U4LA 4C3IB 3D3RA 1L1OC 1T5XD 3G4SA 3NTKA 1LACA 1IL8A 1K9MC 2PNRC 2QDLA 2PZUA 4IUNA 1Z47A 4DV5L 2ID0A 1XNRL 1TWCH 2OCEA 2BE5D 4XXEA 2XRQD 5JJLA 2I5MX 4NMZA 3T53B 4KMUC 1CKNB 4DF7A 2VY3A 3OPOA 2A19A 4PNYA 4NXNL 4MTNA 1MBYA 2MFIA 3BZCA 4L5TA 5EKLA 2BCOA 4ZK9B 5KGUA 1CK1A 2B2VA 3SK5A 4LF9L 1C9OA 1SNDA 2O4XA 1LT4D 3DM1A 2AQ2B 4AYBB 1I94L 2EOTA 2B63G 2VB2X 2JP1A 4JYAQ 3R2IA 3H3VI 1LYLA 3V96A 2QILA 3R93A 3VYTA 2JA8B 4BY7B 4NXMQ 2F3VA 4B3RL 5BR8Q 3EVQA 3JAMi 2I07B 4GS3A 1VQAA 1WFQA 3HKZG 4KN4C 4R4TA 1K0SA 2MO1A 2KCCA 1SYDA 2JXMB 4X65Q 1SNOA 1O7LA 5GAEC 4A3BB 4ME5A 3CXCA 4S3SA 4HJ5A 5M5XB 1PH6A 2RCNA 2ENBA 4LF8Q 1YZ6A 1JWSD 1TVXA 1V43A 3RLNA 1IBKQ 4K6DA 4DV5Q 2N88A 2D5DA 2ZJQA 3E0JA 1XNRQ 3HOYG 2X6LA 5GAGC 5J3BA 4XT1B 1KRSA 2CQOA 3ULJA 4APVA 1IW7C 2DNCA 2E2JH 2EE1A 4NXNQ 5LMNW 5DLQE 4BS9A 5IE8A 1NY4A 4A3KG 3K5OA 5JVH3 4WJWA 1D8LA 1UE5A 1CSQA 3EN2A 4CDFC 2PW5A 4G4KA 2NVXH 3QG1A 4PMWA 1WI5A 1U5KA 1V8QA 4MZ9A 5IOCA 4DR2Q 1EYDA 1QVCA 1WTRA 3J80E 1R9TB 4PZ8A 2DNEA 1VQFA 3HFZB 1CI3M 1E0BA 1HXYD 3CW2C 4Y7NH 3EJIA 3NTHA 4OXPA 2XN9C 1D5MC 4IQZA 2EDGA 4ZKBB 3QOJA 3FRPB 2N78A 4N8X1 1S72A 4A3LG 2AWOA 2VW9A 2Y0SB 1PH8A 4J1MA 3U50C 1X54A 1HQMC 4LFAQ 5IYCH 1WTVA 4N8FA 3KYHC 3I4MB 4DAMA 2X69A 4JV5Q 1WCMH 4WORA 5JJKA 1VQ6A 3I72A 3LNNA 3I4NH 4DV6L 3TP6A 5FLMG 4JI4L 3S15B 2EY1A 5IYBH 3TZDA 3J7AF 1J9OA 3HOUH 3M4YA 2IT1A 2K5WA 4R4OA 4RA8A 1LM0A 2AUKA 3JAML 2PCFB 4A3EH 5LHY1 1DOMA 4KJOA 4DUYL 1PMRA 2SEBD 3FVQA 2HCIA 1K8GA 2E2IB 5LMUQ 1DXMA 3M4OH 3S17B 4A3FG 1P16A 2B2TA 3RZDB 2JA9A 3RMHA 2A73B 2K03A 2D0PA 1L0YB 4K2KA 1A6XA 2RQXA 4J8QA 2CW0C 4CKCA 3I90A 3TS0A 1NR2A 1XWEA 2EY2A 2F0GA 4IN3A 5IT9c 1KNEA 3OYYA 4UPAA 2F0DA 4DV1L 1SLJA 3VR3A 2JA6H 2NN6H 2PZWA 3Q24A 3NBIA 1STBA 1EEID 2EVBA 2R92G 1LTSD 2KHIA 3MXNB 3BDLA 3JC66 2EJFC 1PH2A 3N52A 3CP0A 1N33L 1F77A 4JI5L 2XWBB 1T5EA 4QGUA 5D14A 1FJGL 3DWPA 4DN4M 1GVPA 4LFCQ 1G8ZD 3PO2B 1EFWA 3S1QB 4A3JG 4DXFA 1C4QA 1SFOB 1ET9A 5KYLA 1XMOL 4JI4Q 5EKIA 1FGBD 1JT8A 1B9MA 2HHHL 4IFDH 1QNUA 4RGTA 4K5WA 1EWIA 2Q8TA 1Y69U 5C4XG 3NPPA 4K14A 3NWTA 1EFID 1B53A 5CC4A 3BJUA 1PZKD 4DV7L 1E24A 3HP3A 3GTPH 4DK1A 3SVMA 4L5QA 4GKJL 1RDPD 2K7VA 4X64Q 1CSPA 1PH3A 5JJZA 1RHPA 1EUJA 4X62L 2CVRA 3S14B 3GTGB 1A62A 2R7ZH 4HCEA 3E9HA 3AB9A 5C3WA 1EQRA 2NTSA 1WVLA 2I46A 2H5XA 4IPCA 2VB3X 5LMNL 5IP7G 3GTLB 4JI6L 1XMQL 3E3XA 1ZEQX 2B2VC 2J4XA 4EQNA 2LY7A 2PMZE 3DWAA 3EFXD 4JI0L 3R2TA 3GTMB 1GUTA 2LSSA 3CF5A 3H94A 4YCWA 2RVLA 1QZGA 1N33Q 3QWNA 4R9WA 4BBSG 4DA2A 1IYUA 3VYSA 1UAPA 4A75A 2LMCB 1IBML 3K0YA 1JWUD 1ZYRC 4R4QA 4MHEA 1B3QA 2C9OA 2HHHQ 4FNFA 5GAHC 2KA7A 2PQAA 5KNBA 1FVIA 1QOHA 2JA5G 3TS2A 2PQEA 1PTOD 2QEJC 4JVZA 4KKSA 3MZ5A 2NVQB 5JPMC 4A3BG 3BYYB 4GNXC 1WTWA 1G6ZA 4DR6Q 2JA7G 4C3JB 1VQDA 2F1MA 2WACA 1A3UA 1IHZA 1PTOB 4XYQA 3SDZA 2EZVA 3KF6A 5EPKA 3PF4A 1VQGA 3T51B 2MNAA 1TS5A 3S16H 1RTNA 2N49A 4DR4L 1SYGA 2KECA 1XMQQ 1WYDA 2TMPA 3STBC 4CKBA 3F1ZA 4GN3B 1Y1VG 4OHJA 5CV7A 1CQFA 4A3MH 1Y1WH 4JI0Q 5HGTA 3HOXB 3ERSX 5JEAJ 2UU9Q 1E2WA 1U0LA 3ND8A 2AHOB 3Q0AA 3EIVA 3UE0A 2O5IC 4ABNA 1M90C 1E1OA 1PA6A 3T1HQ 1VQJA 1WJJA 3TDQA 4IOCA 1KLUD 5C0XH 1N8RC 3O13A 4OO1G 2KCMA 3SXHA 3NTIA 1JJCB 3T1YQ 1SNQA 1VS0A 3K81C 4AYBE 1AH9A 3CCQA 3CQZB 3A7AB 2I5HA 4CBVA 5IYDG 3K5LA 3SEBA 1BOSA 1L1OA 1BCPC 2RDFA 4YWMA 5TSSA 1V1PA 1B50A 2F0FA 5IGDA 1I50B 4G7HC 2K04A 2VQEQ 4L5RC 2OWOA 2NB0A 2EYOA 1HHVA 1LTBD 1M8AA 4AIMA 4DR4Q 1AW7A 4Q0FA 5C4JB 3OWFA 3TSSA 1FNUA 4HCSA 1HR0W 2B63B 3TN2A 4L8JA 4FDBA 5AJ3L 1LTTD 4LF5L 2K32A 5E1FA 5C4HA 1E2ZA 5GADC 4O2DA 5ELEA 2Q2IA 4C3IH 3PIPA 3BVMA 3E5SA 4HEDA 1K73C 3PO3G 5DEHA 5ELNA 1SJED 1S3OA 2K33A 2WFWA 3CHBD 2VNUD 3HKZB 4RKBA 1JWMD 1W2BA 1YBYA 3OMGA 2EYLA 4NDXA 3U9SA 1BKBA 4Z9CB 3KBGA 3MC0B 2F03A 3D4RA 3KLWA 4CJ1B 1XYIA 3Q23A 5KEEA 4KHPL 1Y8OB 3HOYB 2K14A 2SNSA 2N55A 3RLFA 2RSOA 5IWAL 1LT3D 1MSGA 2RF4A 2Y0SE 1QZHA 4BY7H 4IUTA 5FO8B 2JA8H 3TRZA 3F2UA 4A3KB 4DR1L 4CHTB 3E0EA 4HR7B 4MNOA 1E22A 2R93G 4CDDC 5C3EH 3UDFA 1STAA 5CBAE 2YTVA 1W6KA 5HGQA 3W1GA 5AJ3Q 2SDFA 4RGOS 4DAPA 2F0HA 4LF4L 3K7AB 1SE8A 5FLXc 4YWLA 4HN7A 4RKLA 4OEMB 5EJWA 1UEBA 3IFTA 1PYSB 2D2CC 3K59A 3STBD 3OTOQ 4F7XA 1PVOA 1SN8A 2RHQB 5KRUA 1HNZL 4G7ZC 2B8FA 4LF7Q 3VR6A 1Q1EA 4K5VA 1GHKA 4NB3A 2Z6BA 4QQBX 1HZ9A 4KK7A 1ICFB 3DMUA 1A3TA 4BBRH 3KLSX 3U58A 3BYTB 3PUVA 1VQIA 1B8AA 1TWFB 5DNFA 5H1SE 1YEZA 1OXTA 1T9HA 3HKSA 2IW3A 5IIFA 4GKKL 3PF5A 3HG9A 5T1GA 3TBIB 2BDNA 1SJHD 4KY7A 1NMFA 1EYCA 1R9TH 4X6AH 1X3EA 1WTPA 3OW7A 5M9OA 1GJXA 3A55A 1J8IA 4HJ7A 1M4VA 1QUQA 1VF5C 2WV6D 4R4IA 1NUCA 2FFKB 4QB4A 5HURA 3K57A 2GN5A 4LFBL 4DNTB 1HFNA 2F0LA 3GO5A 2WP8J 3P1HA 1YNJD 1MIUA 3JAME 4AH6A 1P8LA 2MPMA 5AFWA 4LF4Q 2MGSA 1YNND 1TWHB 5I9OA 4A3FB 5M5YB 1GKHA 3KLRA 4KJNA 5C5LA 1ILPA 3I73A 3I4MH 5KIXA 5D65A 2LXJA 1TS4A 1BO0A 3GTKB 1PYWD 2F0JA 1SEBD 4H7BA 2PI2E 1HCZA 3S15H 4TSSA 2CWPA 4V0BA 1EZ6A 2L11A 4JI7Q 1UUPA 4KV6A 1HR0L 2H4OA 5JEAG 2R92B 1PH7A 3W1BA 3M7NA 3BU2A 3K0XA 1KC8C 5FJ8H 3CCJA 2HD3A 1PHJA 3FHWA 3C46A 4WJ4A 1IYJB 1HUMA 4GKKQ 1TIID 4FP5D 3OIQA 4A3JB 3EBEA 2E2IH 1VQLA 3S17H 1NTGA 2K5HA 4BY1G 3SGIA 3RZDH 2FHTA 4UHVA 4A3CG 1F2MA 2F3WA 5E7NA 5C4XB 2A68D 5E4WC 1GUNA 4X66L 3S1MB 4LW1A 1KABA 1LTGD 2Q8RE 4J15A 5CBEE 1GXDC 3W2DA 1CZWA 4FXGC 1VQCA 3MEHA 3S1RB 1NBWA 4KKUA 3F8TA 3A74A 5IYBG 1LABA 2Z1CA 1A3VA 5I2XA 5CV9A 4NPSA 2V1CC 1U4MA 3TP5A 4JI1Q 1YJWA 1KDCA 1ZXTA 3PO2H 3D4DA 4RHRA 4A4IA 2I5LX 4DKAC 1GD7A 3X3MA 5JPNC 2DY7A 4GZYC 1STNA 1YHQA 3K5MA 5D3DA 1S5ED 4ILWA 4JG2A 4IPDA 1VF7A 4YWKA 3ERQA 3I7FA 2VS1A 3DHQA 4BBSB 3Q6SA 2ZTDA 2K50A 2WINB 1XTCD 4H13C 1XPRA 1EIYB 4MN3A 5CV5A 3S14H 1M1KC 3GTGH 1F9QA 2EJGC 4PG3A 2L55A 2MJ8A 2JA5B 3VA7A 4X66Q 2QDBA 1GM5A 4B3SL 3GP7A 1CFMA 3GTLH 2JA7B 3S1NB 2A6ED 4GNXA 3DEPA 4FF3A 1KRTA 4BXXG 2ZT9C 5IP9H 1X3GA 3NSWA 2F0KA 3GTMH 3M9BA 4XQNA 4XDXA 1SNMA 2ZJRA 4KKTA 2XWJB 1JORA 4DUZL 4IPGA 2ZXOA 2ZM6L 1A2UA 1JCKB 1HZCA 2IPKD 1V1QA 4H02A 4QCLA 1F9RA 4LUVA 2ZTEA 4LF9Q 4UP9A 4JBKA 1Y1VB 3I55A 3H3VH 1I94Q 5K36G 1VQMA 2KCNA 1XNQL 2KVMA 2NVQH 2BA1A 1E1TA 2K75A 1BNZA 4NKLA 1K3BC 2EXZA 4G57A 2JYOA 4C3JH 4LK1C 4BWGB 4B3RQ 3U9OA 1MD2D 3M7GA 1PTOH 3BG3A 3RLOA 4A93H 1XTDA 1SYBA 4X3SA 1X9NA 2EY6A 1QVFA 3KDFA 4LUZA 5HY6A 3GQBA 3J7AV 4GOPB 3H3VC 4P72A 4B3SQ 3F2DA 4QF4A 5IGCA 2JK8A 1O7ZA 1PZID 2FMCA 3ZJYC 1CA5A 1N32L 3TEHB 2R3ZA 1NE3A 3I4OA 1KL9A 3HKZE 3HOXH 3EQLC 4FF1A 4QMGA 2EPBA 1Q81C 3HOVH 1PTOC 1CHPD 4DGZA 5M5WB 1TWGB 2B2YC 4DUZQ 1X65A 2JJQA 4KLKA 4YCUA 3M3YB 2ICEC 4C3HG 2K05A 3C1FA 4RCOA 2K5QA 1Q7YC 3GD7A 3HOWG 4B3ML 1VQ4A 2HIXA 4HTHA 4ZUJA 1LO5D 3CCLA 4DV0L 2A74C 2NN6I 3NUCA 1EQTA 2F3IA 1SROA 3FKIG 3CQZH 2VXWA 3J80c 1SDFA 1PH4A 5FKAC 2F0IA 3NXWA 3E9IA 3PO3B 1EOVA 3RN5A 3WOEA 4QUFA 3VA5A 2VL6A 3SK6A 1LLRD 3BDCA 1H9SA 3DEOA 1VQKA 1I50H 1KHIA 4MTKA 1F9PA 3IKJA 3WWVA 4V190 4IFDI 1YJ9A 3GTJB 1NAPA 1BF4A 1FR3A 1QNKA 1KIXA 3G6EA 3L0OA 1H9MA 3G48A 2B2WC 4JI2L 3GTQH 3NEMA 1OXSC 5C4JH 1EOTA 1SAPA 3CCVA 3CKIB 2B63H 1I6HB 3FDTA 2IJ0A 2XIWA 4F8MA 3F2CA 2YTXA 5IGGA 2F0QA 1Q86C 5FO9B 2ES2A 3CRKC 4ZRZA 3J81c 3P20A 3D0FA 4DV6Q 1EQVA 1HNWL 2R93B 1CKNA 1W6JA 1S4ZA 4A76A 2RA4A 4HAEA 2IY5B 3NBHB 1VDZA 2ZXPA 3FEWX 2WAQG 4DV0Q 4DU9A 3WDNA 5M3FG 2KOLA 4R1JA 4DUYQ 1V9PA 4RH6A 1RODA 4E6IA 2YTYA 1GUSA 5EKKA 3I56A 2JN4A 3Q8DA 4PMBA 1BBXC 1AZQA 4RGMA 3CCMA 4DR7L 3MTSA 1WTQA 2RCFA 2R7FA 4QJFA 1AFPA 3VDYA 3K5NA 4XQQA 3PUXA 1BVSA 4DV1Q 3R8BA 4A3KH 4ZQ3A 1VQ7A 2E2DC 1FNWA 4GN5A 1K3RA 1PFSA 4JK1C 2UUBL 1EIHA 1S5CD 4HJAA 4OWXB 3BVGA 1RCVD 4OONA 1CM9A 5LL6X 4JI5Q 4B9WA 1FJGQ 4IOAA 3L2PA 3KBXA 2GVAA 2ZTCA 1VQEA 4X3UA 4HIOA 1SYFA 1XMOQ 1TS2A 1HNWQ 1AEXA 1H9JA 1SMYD 3J81j 4DV4L 4ZLTF 4R8IA 3PIO3 3J81i 3MA2B 1KAWA 3NENA 1JOOA 1SXTA 4JBJA 4A3LH 5CR3A 3CCSA 1ENAA 2F0UA 4B3TL 1C8CA 4XIGS 4K0KL 3A7LA 1SYEA 2WB1G 4DV7Q 4M8AA 2RKSA 4TRDA 4YHHL 4GKJQ 5IODA 4A3DG 2DY8A 3CPWA 1MHWC 1VQHA 5C3EG 4HJ8A 4X62Q 1TWFH 1Z7TA 5C0XI 2NVXB 1SNPA 4UP8A 2CHBD 1B1ZA 3G7LA 1II3A 1D6EC 3F2BA 2EYFA 5FLMH 2L4NA 5LMNQ 2PZTA 4H44C 4JI6Q 3B6YA 3BZDB 1EIGA 1F9SA 3H0GG 4KTAA 3UDIA 4Y7NB 3QR8A 2HUGA 3KF8B 2UUBQ 3NQIA 1FL0A 4PMCA 5C6AA 3I3CA 1ESRA 5I6WA 2ZJPA 4A3IG 1MJEA 1HA5A 1HZBA 1K8MA 1VQBA 1KLGD 2DN8A 3S9WA 2MQHA 3BZKA 3D8GA 1KTKA 2SNMA 1TWHH 4A3FH 4BY1B 4K5XA 5M5YH 5E3FA 5M3MH 2VUMG 2UXDL 4BBRG 1IBMQ 2RHSB 4DV4Q 4X3KA 3GTKH 5C5MA 3MEFA 1G291 3KJOA 4B3TQ 2Z9HA 1HTPA 2R92H 2ATWA 3HOUB 1J5EL 3I8ZA 4F87A 2UUCL 3EA6A 1PRTF 5KNCA 4A3GG 5IT9L 4EQ5A 3UI2A 1YNJC 3AU7A 1BBUA 5NUCA 1E2VA 1OO9B 4A3JH 2EXDA 2EIFA 1YNNC 1JE4A 2RDHA 4POGA 3M4OB 1S5FD 5JAVA 1OTCA 4M1UB 1OXXK 3SR1A 1JC7A 3L9AX 2DJGC 4GLVB 4DAYA 2QW7A 4F88A 2RSNA 1EIFA 2R7DA 5FO7B 1FNVA 4FXKC 1DOLA 5C44H 3MXNA 3S1RH 1PH9A 2UUAL 3LWUA 2OTJA 1X55A 3NELA 2K6AA 3NHHA 3ICEA 1QWYA 4I65A 2E74C 4CGYB 1LTLA 4DV3L 3A8IE 1B7YB 1K0RA 2BA0A 4OWWB 2MHVA 4JPBW 1JOKA 1I4RA 5J1ZA 5IP7H 1O80A 3NK9A 4KY5A 1B9NA 1QVGA 1GO3E 2N3SA 1A2TA 2PI2A 4JOIA 1F2YA 1KXLA 1V1OA 2DUDA 2K5VA 3HOZG 1PXUA 4PQXA 1O7IA 2A68C 2F0NA 4C2MB 4IFDJ 3BDOA 3MXGA 5CV4A 3AMUA 5IGBA 4BBSH 2VQFL 2PW7A 2CWAA 1Q8KA 1TR5A 3S2DB 4DPGA 4DNRB 4DXGA 3ITPA 4OX9L 2E2HB 2KBNA 2YU9B 2RDGA 2JA5H 4ODGA 4EGVA 4LF5Q 2QF7A 3TQYA 4A3BH 5EPLA 3K58A 2JA7H 3S1NH 3CCRA 3OMCA 2L12A 3FP9A 5M5XH 4IUQA 4ID6A 3URYA 3T13A 4CJ0B 1L0XB 3PUWA 2NUCA 1TY0A 1VQ5A 1PFBA 1PZJD 2CCZA 3VYUA 2B2UC 1UE1A 3R3OA 2A1AA 1A63A 2H1EA 2D0OA 1TXYA 5EBCA 1CHQD 1JR0D 3W5OA 1Y1VH 4KHPQ 5KYIA 1GOZA 4C1NI 1ML0D 1STHA 1MSHA 3PIOA 3FMCA 3VR5A 3VR4A 1WD0A 3CCEA 4ZAIA 2MUYA 1KDBA 4POFA 1ENCA 5IWAQ 1EL0A 1E7ZA 2GA4B 2A6EC 2E75C 2FXQA 2KUMA 2QGQA 2B2YA 3BVZA 3U4VA 4C3HB 3ZYYX 4K6LA 3NE5B 3PUYA 4LWCA 3UE1A 5BN3A 4DR5L 2PPBC 1TU2B 3HOWB 4DR1Q 4Y52H 4PZ6A 1ASYA 4OO1H 2UXBL 5BN5A 2AUJD 3FKIB 4TVAB 1ET6A 1QE6A 4XQJA 1SMXA 3S24A 1TQOA 4H0LC 3TMEA 4ZUIA 1F2LA 5CGKA 1JMCA 3S16B 1Q46A 2LXKA 1XXGA 5IYDH 1PFNA 4FXDA 2A6HD 4GLXA 2BH2A 4IO9A 1RD9D 4L6TB 1TS3A 1E3PA 1EU3A 2NVTB 1HNZQ 2M9VA 1I4XA 4N9PA 1KAAA 2OQ0A 4JI8L 4HMIA 4X3TA 4OGQC 1TWGH 4UP7A 3DUZA 5EQ0A 3RR5A 1NMGA 5ELDA 1LTAD 3M3YH 1RTOA 2B2WA 4OL7A 4RAUC 1KQSA 4MIUA 1FYCA 1VQPA 4PV1C 1JE5A 5K5PA 1Q82C 1UWVA 1LT6D 5DM73 2TSSA 1S40A 3PCOB 4YCVA 2HCCA 4A93G 1QILA 2UXCL 1DD2A 3AYHB 3MFGA 2Z4HA 3ER0A 2OQKA 5C0XJ 2B8GA 3J7A5 4GN4B 1HTLD 4J6HA 3ONAB 1XX8A 2N8NA 4KD4A 3PO3H 1B2TA 2ICIA 3GV6A 5CV8A 5IYCG 5L37A 1N34L 1AP0A 2EYJA 1Y8PB 4LFBQ 2HIVA 2IHFA 2WAQB 2Q2HA 1DCZA 3QJYA 5M3FB 4JYAL 4OWTB 2NYZD 1WCMG 3JAMc 3NQTA 3HOVG 5J22A 2OF1A 4NXML 5BR8L 3I4NG 1BQQT 2HDLA 2F0EA 3MWYW 1AZPA 2PO4A 3M4PA 4KN7C 3V2TA 4CDCC 1ICWA 3C1EA 3HOUG 3CRLC 2FINB 1I6HH 4JCVE 4DK6C 5ISRA 4X65L 1YITA 3C3LA 4JI8Q 1B3AA 2BOSA 4A3EG 4TQUS 4HSVA 2EYMA 3S1QH 1SFOH 2L15A 3M4QA 1B44D 5IGFA 1JOQA 4IUPA 4LF8L 2I0QA 1I6VC 2R93H 1IKMA 1Q1BA 3A54A 1STYA 1IBKL 1HR0Q 3RZOB 3A5ZB 4LNQA 3J7ZC 3RNUA 5LL6S 2KEEA 4XYOA 2PNHA 3SHLA 4FF2A 2JQOA 4P2CB 4CJ2C 3H6MA 2UXCQ 1EWHA 3ULLA 1EY9A 1PH1A 2F4IA 1L2FA 5GQOA 2JA6G 1A15A 2OXPA 3CC4A 1UE7A 2NN6G 1N34Q 4B9XA 3GTOB 4DAVA 1I4PA 5ELFA 1RL2A 5GROA 1EY6A 1QG7A 4DR2L 5FLXL 1TWAB 2WB1B 1DYQA 4XTCS 5F2DA 2KHSA 4EQPA 1D5XC 3T56B 4JOIC 3MAQA 2E76C 2Z6KC 4A3DB 3AFQA 1WTXA 3A56A 1D7QA 1QCBD 5C3EB 4IFDG 1I3QB 3IL8A 1A0IA 1JICA 3AFPA 1G51A 4RMFA 1VQ9A 1WTOA 2G9DA 4R4CA 2SOBA 4IALA 4LFAL 1Z6HA 1MGSA 3H0GB 1QB5D 4U673 2K52A 2R7ZG 4JV5L 4HIKA 2M2LA 2EJMA 2EYHA 3PQIA 4A3IB 4ME3A 3HZXA 5FK9C 1DGSA 2QKIC 5EAYA 1EU4A 1JQYD 2BDOA 1U4PA 2PQAB 4EVOA 4WFN3 2VUMB 4OELB 2Q8IB 4HIDA 2GVBA 1X3FA 2HQLA 4BBRB 1PV4A 3OW2A 2C5CA 1SE3A 1YVCA 3I70A 4QY7A 1D2BA 2CH4A 1R4PB 3VR2A 1X6OA 2XSCA 5LMUL 1IZ6A 2NWGA 5E4XA 1NR4A 2IHEA 3KF6B 1PFMA 1RIPA 5JEAH 1HH2P 1NCVA 1SMYC 3N6RA 4IUUA 2NVYB 1BUVT 1LTRD 2F0SA 4QIWB 3T16A 4A3GB 3EROA 1PH5A 1XPOA 3A8JE 2YYZA 5IT9E 1BBWA 1PYBA 2F0MA 3PUZA 4C1NK 2ZM6Q 1FGUA 1X3PA 3HRZC 4BY1H 5COYA 3TZUA 3KOJA 1XPUA 1BCPF 1EWCA 2WIIB 4O0AA 2B29A 3MXUA 2BH8A 1U4RA 4A3CH 3S2HB 4O1NA 5A2QL 1PRTD 1BXTA 3E6ZX 2AWNA 4NW2A 4RCNA 3OIPA 1NJIC 1DJRD 1HZAA 2F4VL 4LFCL 1XNQQ 5EGTA 3NP8A 3X3NA 1D1IA 4BA2I 1DONA 2MP1A 1PRTB 1I4GA 3J81E 3MVVA 4HSPA 2DGYA 3QOLA 3H91A 2NZOA 1K83B 1HQRD 3CCUA 2HT1A 1VMPA 4JW0A 5G3LF 4GLAC 4JI3L 4A3MG 3D6WA 1Y1WG 3I91A 1I4HA 2QEXA 2KEDA 1L1OB 1SE2A 3G71A 1MI2A 1V1PB 1K8AC 1MJCA 3TREA 2Q2UA 4FO2A 4X64L 1C0AA 1N32Q 1RKNA 4OIJA 2Z8LA 1Q12A 1QJOA 4IZ8A 1GUGA 1C7YA 4YY3L 2AKWB 5M3MG 3QB3A 5C0XG 3HOZB 3C2PA 1YHAA 4DK3C 1D5ZC 4RHSA 4WJ3M 3PIP3 3L3OC 4LJZC 1D1KA 1KD1C 2J7ZA 4DAYB 3NWSA 1X56A 3GDEA 3CD6A 1EEFD 1ILQA 2NTTA 3DXJC 3MHBA 1TWCB 4B3MQ 4FYDA 2QA4A 1TY2A 2IWHA 4RWSC 2F4VQ 2KENA 4R8NA 4BXXH 1U9RA 3J80i 2P5ZX 2WKDA 3HOYH 5I6YA 1VQ8A 2D9UA 2HDMA 4C2MH 1AE2A 4JI3Q 4KD3A 1LTID 2B2UA 4XT3B 5D3IB 1IW7D 4DR6L 5C44G 1VQNA 3K7UC 1NNXA 5CYUA 4C3IG 4QL5A 3S2DH 5CV6A 4JI2Q 2L1BA 4YY3Q 1IYVA 2J0TD 3FPPA 4JC0A 2ZXRA 1OXUA 2E2HH 2YU9H 5K36H 2XGTA 3KJPA 3L7ZC 1CQVA 4BA1I 3P7JA 3AQQA 4RFBA 3K7AH 2IX3A 4KY6A 1STGA 1X3QA 1HA6A 2OEOA 1DZ1A 1ZKOA 4AQYL 1SBBB 3KUPA 4ZKCB 3U4ZA 1H9RA 5CORA 3VYRA 4AYBG 1Y14B 2UU9L 4CDEC 3RD4A 3P75A 1PDQA 3K6OA 4C56C 2E2JB 4BY7G 2MO0A 3TP8A 2JA8G 2CFMA 1EY4A 3T1HL 3D6CA 3OSOA 3TP7A 5J39A 1JB7A 1DM0B 3T1YL 1SR3A 4DR7Q 2AQ3B 2WAQE 1Q90A 4B08A 1G2TA 4C3HH 3Q22A 1GUOA 3H15A 4HJ9A 3HOWH 4GOPA 2CH4W 2OT2A 3IAYA 2E5LL 4A93B 1S5BD 4RGNA 2LS01 2VQEL 3FKIH 1O7YA 3SK4A 3FPUB 4IURA 1NSNS 1QUQB 1GUWA 3LX0A 1HFGA 4DR3L 1PLFA 1YHBA 1VQOA 3ULPA 3W3AA 2AQ1B 5IY0A 4AQYQ 3PGZA 2XRSD 2NVTH 3LWEA 3V05A 2CW0D 4KHVA 2IX0A 1Z9FA 1SRUA 1WCMB 3J80L 3D31A 5JOBA 3HOVB 2R6GA 2Z0SA 5A35A 5EPJA 1TKWB 1OXVA 1X32A 3I4NB 3KFUA 4K0KQ 1I5FA 2RBMA 4YHHQ 5ELCA 3HS0C 4NP5A 1IXRA 2NZ1D 4ZYSA 3A0JA 1JJGA 2L0CA 1UEAB 4JBWA 4QUCA 4A3EB 1SNCA 1DOKA 1N9WA 4DNIA 2Y0SG 3UDGA 2G5DA 2L5TA 2WB1E 1J6QA 3CMEA 3QO2A 2A6HC 4IJHA 2F0WA 1IKLA 4Q5VA 3RN2A 5C4XH 1W3SA 2E5LQ 3S1MH 3I4MG 5M3FH 1CKMA 5C3XA 1CT1D 2E8GA 3GV3A 3J81L 1HRJA 3UDXA 3CMAA 2DJFC 2KHJA 2PYKA 4DR3Q 1KNAA 1G6PA 2JA6B 3GTQB 1IL2A 1UE6A 2B3GA 3PSIA 2UXDQ 3D4WA 4L63B 1BDOA 2OTLA 2K4KA 5BN4A 3BS1A 5I4DA 5FJ8G 2VZAA 3CPFA 3NBHA 5KNDA 2NZHA 1SYCA 3M85A 2K5DA 4WRDA 5FLXE 2ASBA 3K80C 4JBMA 2NBFA 4P71A 5T1IA 5ELOA 3OTOL 2IX1A 2B2TC 4K8IA 2Z6KA 3RZOH 3KLSA 4ZCKA 1EY5A 4ALPA 4LF7L 2KJXA 4K8JA 1J5EQ 1YNXA 4DFAA 3CAMA 1N36L 4HIMA 2UUCQ 1YI2A 4UDUC 1VCIA 2A69C 2V4DA 3GTPB 2Z4IA 4CKEA 2C35B 2JSOA 2AMCB 4FF4A 2O2LD 1SE4A 1ZYRD 2HQEA 1ESFA 2R7ZB 5DAUA 4P73A 2EYPA 5I9PA 3GTOH 5DM63 4LUOA 4QIWE 4DK0A 1EY8A 1WD1A 3T4AC 3J7YW 1TWAH 5ELBA 5JJIA 3I4LA 3PO2G 1WTHA 2XTIA 1H95A 4EQOA 2UUAQ 4A3DH 5IGEA 2A8VA 4G7OC 1I3QH 2F0TA 2BE5C 3PV0A 4OIKA 1Y8NB 4GNXB 1EZ8A 3QIAA 4KI0A 2D62A 4DV3Q 3I2ZA 2EQSA 4OO1I 2LKVA 5JVG3 1STEA 2CKZB 4P75A 3SE0A 3SK8A 5FOBB 1ASZA 1KDAA 4YIJA 2F0VA 2F0PA 1MKHA 3H09A 1EYAA 1C48A 2L9HA 1A8VA 3H0GH 1CA6A 3AEVA 2ALYB 1EQQA 1CZGA 2JE6I 1AN8A 2Q2TA 4I7AA 4A3IH 1R4QB 1N36Q 2WKCA
chains in the Genus database with same CATH topology
1O78A 1S5DD 1Q8IA 2JEAI 4HMJA 2QCPX 1GHJA 1Q3LA 2FJ2A 1UNSA 3A8KE 3MFYA 5CMDA 1B4OA 1HUNA 4TKOB 5A2QE 1F2ZA 1ONLA 3KF8A 1PTOF 1RF2D 1TT2A 4ULLA 1BCPD 3OOCA 2M00A 4IUVA 4LMQD 2A5HA 3HEJA 1BR9A 4A3MB 1Y1WB 1I4QA 3CU7A 2JEBI 2B39A 5I2YA 1BCPB 3KK7A 2FMMA 4LAAA 1K8OA 2K1BA 1FD7D 2G9HD 2KQ3A 2PMZB 4C3JG 2R61A 2O5JC 5M3MB 5G3LD 1SSOA 1H9KA 2X6GA 1ENFA 3IFDA 1G91A 4U68A 2K28A 1G2SA 1LT5D 1LV9A 4I7ZC 4FVMA 2F0OA 3ND9A 4KHZA 3OWEB 3G6JB 3OHXC 1EY7A 2K01A 3HGBA 2XNAC 2CQAA 3PMFA 1VMCA 1CTMA 4N9TA 3DWQA 4O42A 1HPCA 1H9SB 2A69D 1EY0A 3RUZA 1RJTA 4K2LA 2EY5A 1PRTC 2XVSA 2LFNA 5EBDA 5C4ZA 3WOFA 2IL8A 1JB3A 3MXPA 5C44B 4UAIA 1U4LA 4C3IB 3D3RA 1T5XD 3NTKA 1LACA 1IL8A 2PNRC 2PZUA 4IUNA 1Z47A 2ID0A 2BE5D 4XXEA 2XRQD 4NMZA 3T53B 4KMUC 4DF7A 3OPOA 4PNYA 1MBYA 5EKLA 4ZK9B 5KGUA 2BCOA 1CK1A 2B2VA 3SK5A 1SNDA 2O4XA 1LT4D 3DM1A 2AQ2B 4AYBB 2EOTA 2VB2X 2JP1A 3R2IA 3V96A 2QILA 3R93A 3VYTA 2JA8B 4BY7B 2F3VA 3EVQA 2I07B 4KN4C 2KCCA 1SYDA 2JXMB 1SNOA 1O7LA 4A3BB 4ME5A 4S3SA 5M5XB 2ENBA 1JWSD 1TVXA 1V43A 4K6DA 2N88A 2D5DA 3E0JA 2X6LA 4XT1B 1IW7C 2DNCA 2EE1A 4BS9A 3K5OA 5JVH3 4WJWA 2PW5A 4G4KA 3QG1A 4PMWA 1V8QA 5IOCA 1EYDA 1WTRA 3J80E 1R9TB 2DNEA 1CI3M 1E0BA 1HXYD 3EJIA 3NTHA 2XN9C 1D5MC 4IQZA 2EDGA 4ZKBB 3QOJA 3FRPB 2AWOA 2Y0SB 4J1MA 1HQMC 1WTVA 3I4MB 2X69A 4WORA 3I72A 3LNNA 3TP6A 3S15B 2EY1A 3TZDA 3J7AF 1J9OA 3M4YA 2IT1A 2K5WA 4RA8A 2AUKA 3JAML 2PCFB 5LHY1 1DOMA 4KJOA 1PMRA 2SEBD 3FVQA 2HCIA 2E2IB 1DXMA 3S17B 2B2TA 3RZDB 3RMHA 2A73B 2K03A 1L0YB 4K2KA 1A6XA 2RQXA 4J8QA 2CW0C 4CKCA 3I90A 1NR2A 1XWEA 2EY2A 2F0GA 4IN3A 1KNEA 2F0DA 3VR3A 2NN6H 2PZWA 3Q24A 3NBIA 1STBA 1EEID 2EVBA 1LTSD 3BDLA 2EJFC 3N52A 1F77A 2XWBB 1T5EA 5D14A 3DWPA 4DN4M 3PO2B 1G8ZD 3S1QB 1SFOB 4DXFA 1C4QA 1ET9A 5KYLA 5EKIA 1FGBD 1B9MA 4IFDH 1QNUA 4RGTA 4K5WA 2Q8TA 1Y69U 3NPPA 4K14A 3NWTA 1EFID 1B53A 5CC4A 1PZKD 3HP3A 4DK1A 3SVMA 1RDPD 2K7VA 5JJZA 1RHPA 3S14B 2CVRA 3GTGB 4HCEA 3AB9A 5C3WA 2NTSA 1WVLA 2I46A 2VB3X 3GTLB 1ZEQX 2B2VC 2J4XA 4EQNA 2LY7A 3DWAA 3EFXD 3R2TA 3GTMB 1GUTA 3H94A 2RVLA 3QWNA 4R9WA 4DA2A 1IYUA 3VYSA 1UAPA 2LMCB 3K0YA 1JWUD 1ZYRC 4MHEA 2C9OA 4FNFA 2KA7A 5KNBA 1QOHA 2PQEA 1PTOD 2QEJC 4KKSA 3MZ5A 2NVQB 5JPMC 3BYYB 1WTWA 1G6ZA 4C3JB 2F1MA 2WACA 1A3UA 1IHZA 1PTOB 4XYQA 3SDZA 2EZVA 5EPKA 3T51B 1TS5A 1RTNA 1SYGA 2KECA 2TMPA 4CKBA 4OHJA 5CV7A 1CQFA 5HGTA 3HOXB 5JEAJ 1E2WA 3ND8A 3Q0AA 2O5IC 4ABNA 3TDQA 1KLUD 5C0XH 3O13A 4OO1G 3SXHA 3NTIA 1SNQA 3CQZB 3A7AB 4CBVA 3K5LA 3SEBA 1BOSA 1BCPC 2RDFA 5TSSA 1V1PA 1B50A 2F0FA 5IGDA 1I50B 4G7HC 2K04A 2NB0A 2EYOA 1HHVA 1LTBD 1M8AA 1AW7A 4Q0FA 5C4JB 3OWFA 3TSSA 1FNUA 4HCSA 2B63B 3TN2A 4L8JA 1LTTD 2K32A 5E1FA 5C4HA 1E2ZA 5ELEA 3BVMA 3E5SA 4HEDA 5DEHA 1SJED 2K33A 2VNUD 3CHBD 3HKZB 4RKBA 1JWMD 3OMGA 2EYLA 4NDXA 3U9SA 4Z9CB 3KBGA 3MC0B 2F03A 3D4RA 4CJ1B 1XYIA 3Q23A 5KEEA 1Y8OB 3HOYB 2SNSA 2N55A 3RLFA 2RSOA 1LT3D 1MSGA 4IUTA 5FO8B 3F2UA 4A3KB 4CHTB 4HR7B 1STAA 5CBAE 1W6KA 2SDFA 4RGOS 4DAPA 2F0HA 3K7AB 4HN7A 4RKLA 5EJWA 3IFTA 2D2CC 3K59A 4F7XA 5KRUA 4G7ZC 2B8FA 3VR6A 1Q1EA 4K5VA 1GHKA 4KK7A 3DMUA 1A3TA 3KLSX 3BYTB 3PUVA 1TWFB 5DNFA 1OXTA 2IW3A 5IIFA 3HG9A 5T1GA 3TBIB 2BDNA 1SJHD 4KY7A 1EYCA 1WTPA 3OW7A 5M9OA 1GJXA 3A55A 1J8IA 1M4VA 1VF5C 2WV6D 1NUCA 2FFKB 4QB4A 5HURA 3K57A 4DNTB 1HFNA 2F0LA 3GO5A 2WP8J 3P1HA 1YNJD 3JAME 2MPMA 5AFWA 2MGSA 1YNND 1TWHB 5I9OA 4A3FB 5M5YB 3KLRA 4KJNA 5C5LA 1ILPA 3I73A 5KIXA 5D65A 1TS4A 1BO0A 3GTKB 1PYWD 2F0JA 1SEBD 4H7BA 1HCZA 4TSSA 4V0BA 1EZ6A 2L11A 1UUPA 4KV6A 2H4OA 5JEAG 2R92B 3M7NA 3C46A 1HUMA 1TIID 4FP5D 3OIQA 4A3JB 2FHTA 1F2MA 2F3WA 5C4XB 2A68D 5E4WC 1GUNA 3S1MB 1KABA 1LTGD 2Q8RE 5CBEE 1GXDC 3W2DA 1CZWA 4FXGC 3MEHA 3S1RB 4KKUA 1LABA 2Z1CA 1A3VA 5I2XA 5CV9A 1U4MA 3TP5A 1KDCA 1ZXTA 3D4DA 4RHRA 3X3MA 5JPNC 2DY7A 4GZYC 1STNA 3K5MA 5D3DA 1S5ED 4ILWA 1VF7A 3ERQA 3DHQA 4BBSB 3Q6SA 2WINB 1XTCD 4H13C 4MN3A 5CV5A 1F9QA 2EJGC 2L55A 2MJ8A 2JA5B 3VA7A 2QDBA 3GP7A 1CFMA 2JA7B 3S1NB 2A6ED 3DEPA 4FF3A 2ZT9C 3NSWA 2F0KA 4XQNA 4XDXA 1SNMA 4KKTA 2XWJB 1JORA 2ZXOA 1A2UA 1JCKB 2IPKD 4QCLA 1F9RA 1Y1VB 5K36G 2KCNA 2KVMA 2BA1A 1BNZA 4NKLA 2EXZA 4G57A 2JYOA 4LK1C 4BWGB 3U9OA 1MD2D 3M7GA 1PTOH 3BG3A 4X3SA 1SYBA 2EY6A 3GQBA 3J7AV 3H3VC 4QF4A 5IGCA 1CA5A 1O7ZA 1PZID 2FMCA 2R3ZA 3EQLC 4FF1A 4QMGA 2EPBA 1PTOC 1CHPD 4DGZA 5M5WB 1TWGB 2B2YC 3M3YB 2ICEC 4C3HG 2K05A 3C1FA 4RCOA 2K5QA 3GD7A 4HTHA 4ZUJA 1LO5D 2A74C 2NN6I 3NUCA 1EQTA 2VXWA 1SDFA 5FKAC 2F0IA 3NXWA 3PO3B 3WOEA 4QUFA 3VA5A 3SK6A 1LLRD 3BDCA 1H9SA 3DEOA 1F9PA 3IKJA 4V190 4IFDI 3GTJB 1NAPA 1BF4A 1FR3A 1QNKA 1H9MA 2B2WC 1OXSC 1EOTA 1SAPA 3CKIB 1I6HB 3FDTA 2IJ0A 2XIWA 4F8MA 5IGGA 2F0QA 5FO9B 3CRKC 4ZRZA 3P20A 1EQVA 2R93B 1W6JA 1S4ZA 2RA4A 4HAEA 1VDZA 2ZXPA 3FEWX 4DU9A 3WDNA 2KOLA 4RH6A 1RODA 4E6IA 1GUSA 5EKKA 4PMBA 1BBXC 1AZQA 4RGMA 3MTSA 1WTQA 1AFPA 3K5NA 4XQQA 3PUXA 3R8BA 4ZQ3A 2E2DC 1FNWA 4JK1C 1EIHA 1S5CD 3BVGA 1RCVD 1CM9A 5LL6X 4B9WA 3KBXA 4X3UA 1SYFA 1TS2A 1AEXA 1H9JA 1SMYD 4ZLTF 4R8IA 3PIO3 3MA2B 1JOOA 1SXTA 5CR3A 1ENAA 2F0UA 1C8CA 4XIGS 3A7LA 1SYEA 4M8AA 2RKSA 4TRDA 5IODA 2DY8A 1Z7TA 5C0XI 2NVXB 1SNPA 2CHBD 1B1ZA 3G7LA 1II3A 1D6EC 2EYFA 2L4NA 2PZTA 4H44C 3BZDB 1EIGA 1F9SA 4KTAA 4Y7NB 2HUGA 3NQIA 4PMCA 5C6AA 3I3CA 1ESRA 5I6WA 1HA5A 1K8MA 2DN8A 1KLGD 3S9WA 3D8GA 1KTKA 2SNMA 4BY1B 4K5XA 5E3FA 4X3KA 5C5MA 1G291 1HTPA 3HOUB 3I8ZA 4F87A 3EA6A 1PRTF 5KNCA 5IT9L 3UI2A 1YNJC 3AU7A 5NUCA 1E2VA 1OO9B 1YNNC 1JE4A 2RDHA 3M4OB 1S5FD 5JAVA 4M1UB 1OXXK 3SR1A 1JC7A 3L9AX 4DAYA 4F88A 2RSNA 5FO7B 1FNVA 4FXKC 1DOLA 3MXNA 3LWUA 2K6AA 3NHHA 1QWYA 4I65A 2E74C 4CGYB 3A8IE 2BA0A 2MHVA 1JOKA 1I4RA 5J1ZA 1O80A 3NK9A 4KY5A 1B9NA 1A2TA 1F2YA 1V1OA 1PXUA 4PQXA 2A68C 2F0NA 4C2MB 4IFDJ 3BDOA 3MXGA 5CV4A 3AMUA 5IGBA 2PW7A 1TR5A 3S2DB 4DNRB 4DXGA 3ITPA 2E2HB 2YU9B 2RDGA 4ODGA 4EGVA 2QF7A 5EPLA 3K58A 3OMCA 2L12A 4IUQA 4ID6A 3URYA 3T13A 4CJ0B 1L0XB 3PUWA 2NUCA 1TY0A 1PFBA 1PZJD 3VYUA 2B2UC 3R3OA 2H1EA 5EBCA 1CHQD 1JR0D 5KYIA 1GOZA 4C1NI 1ML0D 1STHA 1MSHA 3FMCA 3VR5A 3VR4A 1WD0A 4ZAIA 2MUYA 1KDBA 1ENCA 1EL0A 2GA4B 2A6EC 2E75C 3BVZA 2KUMA 4C3HB 2B2YA 3ZYYX 4K6LA 3NE5B 3PUYA 5BN3A 2PPBC 3HOWB 1TU2B 4OO1H 5BN5A 2AUJD 3FKIB 1ET6A 1QE6A 4XQJA 1TQOA 4H0LC 3TMEA 4ZUIA 1F2LA 5CGKA 3S16B 1XXGA 1PFNA 4FXDA 2A6HD 1RD9D 4L6TB 1TS3A 1EU3A 2NVTB 2M9VA 1I4XA 4N9PA 1KAAA 4HMIA 4X3TA 4OGQC 5EQ0A 3DUZA 5ELDA 1LTAD 1RTOA 2B2WA 4OL7A 4RAUC 4MIUA 1FYCA 4PV1C 5K5PA 1LT6D 5DM73 2TSSA 2HCCA 1QILA 1DD2A 3MFGA 2Z4HA 5C0XJ 2B8GA 1HTLD 4J6HA 3ONAB 1XX8A 4KD4A 1B2TA 2ICIA 3GV6A 5CV8A 1AP0A 2EYJA 1Y8PB 2WAQB 1DCZA 3QJYA 5M3FB 2NYZD 3NQTA 5J22A 2OF1A 1BQQT 2HDLA 2F0EA 3MWYW 1AZPA 2PO4A 4KN7C 3V2TA 1ICWA 3C1EA 3CRLC 2FINB 5ISRA 3C3LA 1B3AA 2BOSA 4TQUS 4HSVA 2EYMA 5IGFA 1B44D 1JOQA 4IUPA 1I6VC 1IKMA 1Q1BA 3A54A 1STYA 3RZOB 5LL6S 2KEEA 4XYOA 3SHLA 4FF2A 4CJ2C 4P2CB 3H6MA 1EWHA 1EY9A 2F4IA 1A15A 2OXPA 2NN6G 4B9XA 3GTOB 4DAVA 1I4PA 5ELFA 1EY6A 1QG7A 5FLXL 1TWAB 2WB1B 1DYQA 4XTCS 5F2DA 2KHSA 4EQPA 1D5XC 3T56B 3MAQA 2E76C 4A3DB 1WTXA 3A56A 1QCBD 5C3EB 4IFDG 1I3QB 3IL8A 1JICA 1WTOA 2G9DA 2SOBA 4IALA 1Z6HA 1MGSA 3H0GB 1QB5D 4U673 2M2LA 2EJMA 2EYHA 4A3IB 3HZXA 5FK9C 2QKIC 1EU4A 1JQYD 2BDOA 1U4PA 4EVOA 4WFN3 2VUMB 2Q8IB 4BBRB 2C5CA 1SE3A 3I70A 1D2BA 1R4PB 3VR2A 2XSCA 2NWGA 5E4XA 1NR4A 1PFMA 5JEAH 1NCVA 1SMYC 3N6RA 4IUUA 2NVYB 1BUVT 1LTRD 2F0SA 4QIWB 3T16A 4A3GB 3EROA 3A8JE 2YYZA 5IT9E 2F0MA 3PUZA 4C1NK 1X3PA 3HRZC 5COYA 3TZUA 1BCPF 1EWCA 2WIIB 3MXUA 1U4RA 3S2HB 4O1NA 5A2QL 1PRTD 1BXTA 3E6ZX 2AWNA 4NW2A 4RCNA 3OIPA 1DJRD 5EGTA 3NP8A 3X3NA 1D1IA 4BA2I 1DONA 2MP1A 1PRTB 1I4GA 3J81E 3MVVA 4HSPA 3QOLA 3H91A 1K83B 1HQRD 1VMPA 5G3LF 3D6WA 3I91A 1I4HA 2KEDA 1SE2A 1MI2A 1V1PB 4FO2A 1RKNA 4OIJA 2Z8LA 1Q12A 1QJOA 4IZ8A 1GUGA 3QB3A 5C0XG 3HOZB 3C2PA 1D5ZC 4RHSA 3PIP3 3L3OC 4LJZC 1D1KA 2J7ZA 3NWSA 1EEFD 1ILQA 2NTTA 3DXJC 3MHBA 1TWCB 4FYDA 1TY2A 2IWHA 4RWSC 4R8NA 1U9RA 2WKDA 5I6YA 2D9UA 2HDMA 4KD3A 1LTID 2B2UA 4XT3B 5D3IB 1IW7D 5CYUA 4C3IG 5CV6A 2L1BA 1IYVA 2J0TD 3FPPA 2ZXRA 1OXUA 5K36H 3L7ZC 1CQVA 4BA1I 3P7JA 4RFBA 2IX3A 4KY6A 1STGA 1X3QA 1HA6A 2OEOA 1DZ1A 1ZKOA 1SBBB 3KUPA 4ZKCB 1H9RA 5CORA 3VYRA 3RD4A 3P75A 1PDQA 3K6OA 4C56C 2E2JB 3TP8A 1EY4A 3D6CA 3OSOA 3TP7A 5J39A 1DM0B 2AQ3B 1Q90A 4B08A 1G2TA 3Q22A 1GUOA 2OT2A 3IAYA 4A93B 1S5BD 4RGNA 2LS01 1O7YA 3SK4A 3FPUB 4IURA 1NSNS 1GUWA 3LX0A 1HFGA 1PLFA 3W3AA 2AQ1B 2XRSD 3LWEA 3V05A 2CW0D 4KHVA 2IX0A 1WCMB 3J80L 3D31A 5JOBA 3HOVB 2R6GA 5A35A 5EPJA 1TKWB 1OXVA 1X32A 3I4NB 2RBMA 5ELCA 3HS0C 4NP5A 2NZ1D 4ZYSA 2L0CA 1UEAB 4JBWA 4QUCA 4A3EB 1SNCA 1DOKA 2L5TA 3QO2A 2A6HC 2F0WA 1IKLA 4Q5VA 5C3XA 1CT1D 3GV3A 3J81L 1HRJA 2PYKA 1KNAA 2JA6B 3GTQB 3D4WA 4L63B 1BDOA 5BN4A 3BS1A 5I4DA 3NBHA 5KNDA 1SYCA 3M85A 2K5DA 4WRDA 5FLXE 2NBFA 5T1IA 2IX1A 2B2TC 4K8IA 3KLSA 1EY5A 2KJXA 4K8JA 4DFAA 4UDUC 1VCIA 2A69C 2V4DA 3GTPB 2Z4IA 4CKEA 2JSOA 4FF4A 2O2LD 1SE4A 1ZYRD 2HQEA 1ESFA 2R7ZB 5DAUA 2EYPA 5I9PA 5DM63 4DK0A 1EY8A 1WD1A 3T4AC 3J7YW 5ELBA 3I4LA 4EQOA 5IGEA 4G7OC 2F0TA 2BE5C 3PV0A 4OIKA 1Y8NB 1EZ8A 3QIAA 4KI0A 2D62A 4OO1I 2LKVA 5JVG3 1STEA 3SE0A 3SK8A 5FOBB 1KDAA 4YIJA 2F0VA 2F0PA 3H09A 1EYAA 1C48A 2L9HA 1CA6A 1CZGA 2JE6I 1AN8A 1R4QB 2WKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZ1 A;  5CBA E;  1IL8 A;  1B53 A;  3KUP A;  4ZKB B;  1QG7 A;  4ZKC B;  1DON A;  1F9R A;  2MP1 A;  1HUM A;  5COR A;  3G7L A;  3FDT A;  3HP3 A;  2XIW A;  2L4N A;  2SDF A;  3GV3 A;  3SVM A;  1HRJ A;  4X3T A;  1Q3L A;  2FJ2 A;  3H91 A;  5CMD A;  5JJZ A;  1RHP A;  5EQ0 A;  1B4O A;  1VMP A;  2CVR A;  1KNA A;  1EIG A;  1F9S A;  2FHT A;  1WTX A;  3D6W A;  5EJW A;  3I91 A;  1PDQ A;  2KVM A;  2HUG A;  1HUN A;  2KED A;  1WTV A;  1RTO A;  3IL8 A;  1MI2 A;  1S4Z A;  2B2W A;  2RA4 A;  4RAU C;  4HAE A;  5E4W C;  1WVL A;  1BNZ A;  1JIC A;  2Q8R E;  3I3C A;  2JYO A;  4ZK9 B;  1ESR A;  2B2V A;  5CBE E;  1WTO A;  2X69 A;  2HCC A;  3DM1 A;  2B2V C;  4OIJ A;  1B50 A;  2EOT A;  4IUV A;  4LMQ D;  2JP1 A;  2KOL A;  2K04 A;  4X3S A;  5T1I A;  1MGS A;  2B2T C;  3ONA B;  1G2T A;  1XX8 A;  1ROD A;  3TZD A;  1B2T A;  1HHV A;  3R93 A;  1M8A A;  1J9O A;  3GV6 A;  5EPL A;  2RVL A;  4X3K A;  5EPJ A;  2L12 A;  1O7Z A;  1CA5 A;  2FMM A;  1U4M A;  2M2L A;  5DNF A;  4RA8 A;  1BBX C;  1AP0 A;  2K1B A;  4IUQ A;  1AZQ A;  1ZXT A;  4R9W A;  2J7Z A;  4CJ0 B;  1ILQ A;  2R3Z A;  3MTS A;  1DOM A;  4HCS A;  5T1G A;  1U4P A;  2BDN A;  1O7Y A;  1WTQ A;  2NYZ D;  3FPU B;  3TN2 A;  1PFB A;  1SSO A;  2DY7 A;  2HCI A;  4IUR A;  4MHE A;  2EPB A;  2X6G A;  1GUW A;  1WTP A;  3IFD A;  1HFG A;  2B2U C;  3I8Z A;  1J8I A;  1G91 A;  1PLF A;  2HDL A;  2B2T A;  2K28 A;  3MWY W;  1G2S A;  2B2Y C;  4U68 A;  1AZP A;  4RWS C;  2K03 A;  2FFK B;  2H1E A;  4HED A;  1ICW A;  2K05 A;  3UI2 A;  1LV9 A;  1EIH A;  1HFN A;  1TVX A;  3I90 A;  1WTW A;  1WD1 A;  1G6Z A;  2FIN B;  1NR2 A;  2N88 A;  3LWE A;  3Q6S A;  1KNE A;  2X6L A;  1CM9 A;  2NWG A;  4XT1 B;  1JE4 A;  5E4X A;  2MPM A;  1B3A A;  1NR4 A;  1ML0 D;  2K01 A;  4MN3 A;  1PFM A;  5AFW A;  1MSH A;  1EQT A;  2D9U A;  3KBX A;  4HSV A;  1NCV A;  1F9Q A;  2HDM A;  2MGS A;  1X32 A;  4IUU A;  2VXW A;  4ZAI A;  1WD0 A;  2MJ8 A;  4X3U A;  4IUP A;  1SDF A;  5EPK A;  1VMC A;  2EE1 A;  1IKM A;  1EL0 A;  2B2U A;  4XT3 B;  4OIK A;  2RSN A;  2KUM A;  4ZLT F;  1RTN A;  2B2Y A;  4R8I A;  4CJ1 B;  1ILP A;  3N52 A;  4O42 A;  1XYI A;  5D65 A;  4QUF A;  1DOL A;  2KEC A;  2NZ1 D;  1BO0 A;  2KEE A;  3DEP A;  5D14 A;  4CJ2 C;  4DN4 M;  3DEO A;  2N55 A;  2L1B A;  1C8C A;  1RJT A;  1X3P A;  4QUC A;  2RSO A;  1DOK A;  1F9P A;  5COY A;  2L9H A;  1NAP A;  2L11 A;  1BF4 A;  5EKI A;  1CA6 A;  1MSG A;  1QNK A;  1QE6 A;  1WTR A;  3P7J A;  1U4R A;  1F2L A;  2IL8 A;  4IUT A;  4XDX A;  2DY8 A;  3F2U A;  1A15 A;  3QO2 A;  4NW2 A;  2B2W C;  1E0B A;  4UAI A;  1PFN A;  1IKL A;  1U4L A;  1X3Q A;  2Q8T A;  1HA6 A;  1EOT A;  1O80 A;  1SAP A; 
#chains in the Genus database with same CATH topology
 2F52 A;  1O78 A;  1S5D D;  1Q8I A;  4JI7 L;  2JEA I;  4LF6 L;  4HMJ A;  2VQF Q;  2QCP X;  2VUM H;  1GHJ A;  4IJL A;  4PZ7 A;  1Q3L A;  2FJ2 A;  5IP9 G;  1UNS A;  3A8K E;  3MFY A;  5CMD A;  1EYG A;  1B4O A;  1HNX L;  4P74 A;  4OX9 Q;  1HUN A;  1CUK A;  2K5N A;  4TKO B;  5A2Q E;  2KCT A;  1F2Z A;  1ONL A;  1YIJ A;  3KF8 A;  1PTO F;  1AE3 A;  4DV2 L;  3K8A A;  1RF2 D;  1TT2 A;  3CC7 A;  3LGJ A;  4ULL A;  1BCP D;  3OOC A;  2M00 A;  3KDF B;  3IRB A;  4IUV A;  4LMQ D;  2A5H A;  4EX5 A;  2NVY H;  1IBL L;  3HEJ A;  1BR9 A;  4A3M B;  1Y1W B;  3A5U A;  1I4Q A;  3CU7 A;  4A3G H;  1LUZ A;  2JEB I;  5M5W H;  2B39 A;  1HJP A;  5I2Y A;  1BCP B;  1CKO A;  2FMM A;  3KK7 A;  4LAA A;  4RG1 A;  2K1B A;  1K8O A;  1FD7 D;  4IPH A;  2G9H D;  2KQ3 A;  2PMZ B;  4C3J G;  3DM3 A;  4GOP C;  2R61 A;  1B70 B;  2O5J C;  5M3M B;  5G3L D;  1SSO A;  3S2H H;  1H9K A;  2X6G A;  1JJ2 A;  1ENF A;  3DLL A;  3IFD A;  1G91 A;  4U68 A;  2K28 A;  1G2S A;  4JI1 L;  1LT5 D;  1LV9 A;  4I7Z C;  4FVM A;  2F0O A;  1WOC A;  4LF6 Q;  3ND9 A;  4KHZ A;  3OWE B;  3CC2 A;  4DR5 Q;  1K28 A;  1K83 H;  3G6J B;  3OHX C;  1EY7 A;  2K01 A;  3HGB A;  2XNA C;  1HNX Q;  3HOX G;  3GTJ H;  2UXB Q;  2CQA A;  3PMF A;  1VMC A;  1CTM A;  4N9T A;  4UY8 C;  3DWQ A;  1XJV A;  4O42 A;  1HPC A;  1H9S B;  2A69 D;  4DV2 Q;  2YV5 A;  1L0W A;  1EY0 A;  3RUZ A;  1RJT A;  1YJN A;  4K2L A;  2EY5 A;  4L5S A;  3HOZ H;  1PRT C;  1IBL Q;  2XVS A;  2LFN A;  5EBD A;  5C4Z A;  3WOF A;  2IL8 A;  1JB3 A;  3MXP A;  5C44 B;  4UAI A;  1U4L A;  4C3I B;  3D3R A;  1L1O C;  1T5X D;  3G4S A;  3NTK A;  1LAC A;  1IL8 A;  1K9M C;  2PNR C;  2QDL A;  2PZU A;  4IUN A;  1Z47 A;  4DV5 L;  2ID0 A;  1XNR L;  1TWC H;  2OCE A;  2BE5 D;  4XXE A;  2XRQ D;  5JJL A;  2I5M X;  4NMZ A;  3T53 B;  4KMU C;  1CKN B;  4DF7 A;  2VY3 A;  3OPO A;  2A19 A;  4PNY A;  4NXN L;  4MTN A;  1MBY A;  2MFI A;  3BZC A;  4L5T A;  5EKL A;  2BCO A;  4ZK9 B;  5KGU A;  1CK1 A;  2B2V A;  3SK5 A;  4LF9 L;  1C9O A;  1SND A;  2O4X A;  1LT4 D;  3DM1 A;  2AQ2 B;  4AYB B;  1I94 L;  2EOT A;  2B63 G;  2VB2 X;  2JP1 A;  4JYA Q;  3R2I A;  3H3V I;  1LYL A;  3V96 A;  2QIL A;  3R93 A;  3VYT A;  2JA8 B;  4BY7 B;  4NXM Q;  2F3V A;  4B3R L;  5BR8 Q;  3EVQ A;  3JAM i;  2I07 B;  4GS3 A;  1VQA A;  1WFQ A;  3HKZ G;  4KN4 C;  4R4T A;  1K0S A;  2MO1 A;  2KCC A;  1SYD A;  2JXM B;  4X65 Q;  1SNO A;  1O7L A;  5GAE C;  4A3B B;  4ME5 A;  3CXC A;  4S3S A;  4HJ5 A;  5M5X B;  1PH6 A;  2RCN A;  2ENB A;  4LF8 Q;  1YZ6 A;  1JWS D;  1TVX A;  1V43 A;  3RLN A;  1IBK Q;  4K6D A;  4DV5 Q;  2N88 A;  2D5D A;  2ZJQ A;  3E0J A;  1XNR Q;  3HOY G;  2X6L A;  5GAG C;  5J3B A;  4XT1 B;  1KRS A;  2CQO A;  3ULJ A;  4APV A;  1IW7 C;  2DNC A;  2E2J H;  2EE1 A;  4NXN Q;  5LMN W;  5DLQ E;  4BS9 A;  5IE8 A;  1NY4 A;  4A3K G;  3K5O A;  5JVH 3;  4WJW A;  1D8L A;  1UE5 A;  1CSQ A;  3EN2 A;  4CDF C;  2PW5 A;  4G4K A;  2NVX H;  3QG1 A;  4PMW A;  1WI5 A;  1U5K A;  1V8Q A;  4MZ9 A;  5IOC A;  4DR2 Q;  1EYD A;  1QVC A;  1WTR A;  3J80 E;  1R9T B;  4PZ8 A;  2DNE A;  1VQF A;  3HFZ B;  1CI3 M;  1E0B A;  1HXY D;  3CW2 C;  4Y7N H;  3EJI A;  3NTH A;  4OXP A;  2XN9 C;  1D5M C;  4IQZ A;  2EDG A;  4ZKB B;  3QOJ A;  3FRP B;  2N78 A;  4N8X 1;  1S72 A;  4A3L G;  2AWO A;  2VW9 A;  2Y0S B;  1PH8 A;  4J1M A;  3U50 C;  1X54 A;  1HQM C;  4LFA Q;  5IYC H;  1WTV A;  4N8F A;  3KYH C;  3I4M B;  4DAM A;  2X69 A;  4JV5 Q;  1WCM H;  4WOR A;  5JJK A;  1VQ6 A;  3I72 A;  3LNN A;  3I4N H;  4DV6 L;  3TP6 A;  5FLM G;  4JI4 L;  3S15 B;  2EY1 A;  5IYB H;  3TZD A;  3J7A F;  1J9O A;  3HOU H;  3M4Y A;  2IT1 A;  2K5W A;  4R4O A;  4RA8 A;  1LM0 A;  2AUK A;  3JAM L;  2PCF B;  4A3E H;  5LHY 1;  1DOM A;  4KJO A;  4DUY L;  1PMR A;  2SEB D;  3FVQ A;  2HCI A;  1K8G A;  2E2I B;  5LMU Q;  1DXM A;  3M4O H;  3S17 B;  4A3F G;  1P16 A;  2B2T A;  3RZD B;  2JA9 A;  3RMH A;  2A73 B;  2K03 A;  2D0P A;  1L0Y B;  4K2K A;  1A6X A;  2RQX A;  4J8Q A;  2CW0 C;  4CKC A;  3I90 A;  3TS0 A;  1NR2 A;  1XWE A;  2EY2 A;  2F0G A;  4IN3 A;  5IT9 c;  1KNE A;  3OYY A;  4UPA A;  2F0D A;  4DV1 L;  1SLJ A;  3VR3 A;  2JA6 H;  2NN6 H;  2PZW A;  3Q24 A;  3NBI A;  1STB A;  1EEI D;  2EVB A;  2R92 G;  1LTS D;  2KHI A;  3MXN B;  3BDL A;  3JC6 6;  2EJF C;  1PH2 A;  3N52 A;  3CP0 A;  1N33 L;  1F77 A;  4JI5 L;  2XWB B;  1T5E A;  4QGU A;  5D14 A;  1FJG L;  3DWP A;  4DN4 M;  1GVP A;  4LFC Q;  1G8Z D;  3PO2 B;  1EFW A;  3S1Q B;  4A3J G;  4DXF A;  1C4Q A;  1SFO B;  1ET9 A;  5KYL A;  1XMO L;  4JI4 Q;  5EKI A;  1FGB D;  1JT8 A;  1B9M A;  2HHH L;  4IFD H;  1QNU A;  4RGT A;  4K5W A;  1EWI A;  2Q8T A;  1Y69 U;  5C4X G;  3NPP A;  4K14 A;  3NWT A;  1EFI D;  1B53 A;  5CC4 A;  3BJU A;  1PZK D;  4DV7 L;  1E24 A;  3HP3 A;  3GTP H;  4DK1 A;  3SVM A;  4L5Q A;  4GKJ L;  1RDP D;  2K7V A;  4X64 Q;  1CSP A;  1PH3 A;  5JJZ A;  1RHP A;  1EUJ A;  4X62 L;  2CVR A;  3S14 B;  3GTG B;  1A62 A;  2R7Z H;  4HCE A;  3E9H A;  3AB9 A;  5C3W A;  1EQR A;  2NTS A;  1WVL A;  2I46 A;  2H5X A;  4IPC A;  2VB3 X;  5LMN L;  5IP7 G;  3GTL B;  4JI6 L;  1XMQ L;  3E3X A;  1ZEQ X;  2B2V C;  2J4X A;  4EQN A;  2LY7 A;  2PMZ E;  3DWA A;  3EFX D;  4JI0 L;  3R2T A;  3GTM B;  1GUT A;  2LSS A;  3CF5 A;  3H94 A;  4YCW A;  2RVL A;  1QZG A;  1N33 Q;  3QWN A;  4R9W A;  4BBS G;  4DA2 A;  1IYU A;  3VYS A;  1UAP A;  4A75 A;  2LMC B;  1IBM L;  3K0Y A;  1JWU D;  1ZYR C;  4R4Q A;  4MHE A;  1B3Q A;  2C9O A;  2HHH Q;  4FNF A;  5GAH C;  2KA7 A;  2PQA A;  5KNB A;  1FVI A;  1QOH A;  2JA5 G;  3TS2 A;  2PQE A;  1PTO D;  2QEJ C;  4JVZ A;  4KKS A;  3MZ5 A;  2NVQ B;  5JPM C;  4A3B G;  3BYY B;  4GNX C;  1WTW A;  1G6Z A;  4DR6 Q;  2JA7 G;  4C3J B;  1VQD A;  2F1M A;  2WAC A;  1A3U A;  1IHZ A;  1PTO B;  4XYQ A;  3SDZ A;  2EZV A;  3KF6 A;  5EPK A;  3PF4 A;  1VQG A;  3T51 B;  2MNA A;  1TS5 A;  3S16 H;  1RTN A;  2N49 A;  4DR4 L;  1SYG A;  2KEC A;  1XMQ Q;  1WYD A;  2TMP A;  3STB C;  4CKB A;  3F1Z A;  4GN3 B;  1Y1V G;  4OHJ A;  5CV7 A;  1CQF A;  4A3M H;  1Y1W H;  4JI0 Q;  5HGT A;  3HOX B;  3ERS X;  5JEA J;  2UU9 Q;  1E2W A;  1U0L A;  3ND8 A;  2AHO B;  3Q0A A;  3EIV A;  3UE0 A;  2O5I C;  4ABN A;  1M90 C;  1E1O A;  1PA6 A;  3T1H Q;  1VQJ A;  1WJJ A;  3TDQ A;  4IOC A;  1KLU D;  5C0X H;  1N8R C;  3O13 A;  4OO1 G;  2KCM A;  3SXH A;  3NTI A;  1JJC B;  3T1Y Q;  1SNQ A;  1VS0 A;  3K81 C;  4AYB E;  1AH9 A;  3CCQ A;  3CQZ B;  3A7A B;  2I5H A;  4CBV A;  5IYD G;  3K5L A;  3SEB A;  1BOS A;  1L1O A;  1BCP C;  2RDF A;  4YWM A;  5TSS A;  1V1P A;  1B50 A;  2F0F A;  5IGD A;  1I50 B;  4G7H C;  2K04 A;  2VQE Q;  4L5R C;  2OWO A;  2NB0 A;  2EYO A;  1HHV A;  1LTB D;  1M8A A;  4AIM A;  4DR4 Q;  1AW7 A;  4Q0F A;  5C4J B;  3OWF A;  3TSS A;  1FNU A;  4HCS A;  1HR0 W;  2B63 B;  3TN2 A;  4L8J A;  4FDB A;  5AJ3 L;  1LTT D;  4LF5 L;  2K32 A;  5E1F A;  5C4H A;  1E2Z A;  5GAD C;  4O2D A;  5ELE A;  2Q2I A;  4C3I H;  3PIP A;  3BVM A;  3E5S A;  4HED A;  1K73 C;  3PO3 G;  5DEH A;  5ELN A;  1SJE D;  1S3O A;  2K33 A;  2WFW A;  3CHB D;  2VNU D;  3HKZ B;  4RKB A;  1JWM D;  1W2B A;  1YBY A;  3OMG A;  2EYL A;  4NDX A;  3U9S A;  1BKB A;  4Z9C B;  3KBG A;  3MC0 B;  2F03 A;  3D4R A;  3KLW A;  4CJ1 B;  1XYI A;  3Q23 A;  5KEE A;  4KHP L;  1Y8O B;  3HOY B;  2K14 A;  2SNS A;  2N55 A;  3RLF A;  2RSO A;  5IWA L;  1LT3 D;  1MSG A;  2RF4 A;  2Y0S E;  1QZH A;  4BY7 H;  4IUT A;  5FO8 B;  2JA8 H;  3TRZ A;  3F2U A;  4A3K B;  4DR1 L;  4CHT B;  3E0E A;  4HR7 B;  4MNO A;  1E22 A;  2R93 G;  4CDD C;  5C3E H;  3UDF A;  1STA A;  5CBA E;  2YTV A;  1W6K A;  5HGQ A;  3W1G A;  5AJ3 Q;  2SDF A;  4RGO S;  4DAP A;  2F0H A;  4LF4 L;  3K7A B;  1SE8 A;  5FLX c;  4YWL A;  4HN7 A;  4RKL A;  4OEM B;  5EJW A;  1UEB A;  3IFT A;  1PYS B;  2D2C C;  3K59 A;  3STB D;  3OTO Q;  4F7X A;  1PVO A;  1SN8 A;  2RHQ B;  5KRU A;  1HNZ L;  4G7Z C;  2B8F A;  4LF7 Q;  3VR6 A;  1Q1E A;  4K5V A;  1GHK A;  4NB3 A;  2Z6B A;  4QQB X;  1HZ9 A;  4KK7 A;  1ICF B;  3DMU A;  1A3T A;  4BBR H;  3KLS X;  3U58 A;  3BYT B;  3PUV A;  1VQI A;  1B8A A;  1TWF B;  5DNF A;  5H1S E;  1YEZ A;  1OXT A;  1T9H A;  3HKS A;  2IW3 A;  5IIF A;  4GKK L;  3PF5 A;  3HG9 A;  5T1G A;  3TBI B;  2BDN A;  1SJH D;  4KY7 A;  1NMF A;  1EYC A;  1R9T H;  4X6A H;  1X3E A;  1WTP A;  3OW7 A;  5M9O A;  1GJX A;  3A55 A;  1J8I A;  4HJ7 A;  1M4V A;  1QUQ A;  1VF5 C;  2WV6 D;  4R4I A;  1NUC A;  2FFK B;  4QB4 A;  5HUR A;  3K57 A;  2GN5 A;  4LFB L;  4DNT B;  1HFN A;  2F0L A;  3GO5 A;  2WP8 J;  3P1H A;  1YNJ D;  1MIU A;  3JAM E;  4AH6 A;  1P8L A;  2MPM A;  5AFW A;  4LF4 Q;  2MGS A;  1YNN D;  1TWH B;  5I9O A;  4A3F B;  5M5Y B;  1GKH A;  3KLR A;  4KJN A;  5C5L A;  1ILP A;  3I73 A;  3I4M H;  5KIX A;  5D65 A;  2LXJ A;  1TS4 A;  1BO0 A;  3GTK B;  1PYW D;  2F0J A;  1SEB D;  4H7B A;  2PI2 E;  1HCZ A;  3S15 H;  4TSS A;  2CWP A;  4V0B A;  1EZ6 A;  2L11 A;  4JI7 Q;  1UUP A;  4KV6 A;  1HR0 L;  2H4O A;  5JEA G;  2R92 B;  1PH7 A;  3W1B A;  3M7N A;  3BU2 A;  3K0X A;  1KC8 C;  5FJ8 H;  3CCJ A;  2HD3 A;  1PHJ A;  3FHW A;  3C46 A;  4WJ4 A;  1IYJ B;  1HUM A;  4GKK Q;  1TII D;  4FP5 D;  3OIQ A;  4A3J B;  3EBE A;  2E2I H;  1VQL A;  3S17 H;  1NTG A;  2K5H A;  4BY1 G;  3SGI A;  3RZD H;  2FHT A;  4UHV A;  4A3C G;  1F2M A;  2F3W A;  5E7N A;  5C4X B;  2A68 D;  5E4W C;  1GUN A;  4X66 L;  3S1M B;  4LW1 A;  1KAB A;  1LTG D;  2Q8R E;  4J15 A;  5CBE E;  1GXD C;  3W2D A;  1CZW A;  4FXG C;  1VQC A;  3MEH A;  3S1R B;  1NBW A;  4KKU A;  3F8T A;  3A74 A;  5IYB G;  1LAB A;  2Z1C A;  1A3V A;  5I2X A;  5CV9 A;  4NPS A;  2V1C C;  1U4M A;  3TP5 A;  4JI1 Q;  1YJW A;  1KDC A;  1ZXT A;  3PO2 H;  3D4D A;  4RHR A;  4A4I A;  2I5L X;  4DKA C;  1GD7 A;  3X3M A;  5JPN C;  2DY7 A;  4GZY C;  1STN A;  1YHQ A;  3K5M A;  5D3D A;  1S5E D;  4ILW A;  4JG2 A;  4IPD A;  1VF7 A;  4YWK A;  3ERQ A;  3I7F A;  2VS1 A;  3DHQ A;  4BBS B;  3Q6S A;  2ZTD A;  2K50 A;  2WIN B;  1XTC D;  4H13 C;  1XPR A;  1EIY B;  4MN3 A;  5CV5 A;  3S14 H;  1M1K C;  3GTG H;  1F9Q A;  2EJG C;  4PG3 A;  2L55 A;  2MJ8 A;  2JA5 B;  3VA7 A;  4X66 Q;  2QDB A;  1GM5 A;  4B3S L;  3GP7 A;  1CFM A;  3GTL H;  2JA7 B;  3S1N B;  2A6E D;  4GNX A;  3DEP A;  4FF3 A;  1KRT A;  4BXX G;  2ZT9 C;  5IP9 H;  1X3G A;  3NSW A;  2F0K A;  3GTM H;  3M9B A;  4XQN A;  4XDX A;  1SNM A;  2ZJR A;  4KKT A;  2XWJ B;  1JOR A;  4DUZ L;  4IPG A;  2ZXO A;  2ZM6 L;  1A2U A;  1JCK B;  1HZC A;  2IPK D;  1V1Q A;  4H02 A;  4QCL A;  1F9R A;  4LUV A;  2ZTE A;  4LF9 Q;  4UP9 A;  4JBK A;  1Y1V B;  3I55 A;  3H3V H;  1I94 Q;  5K36 G;  1VQM A;  2KCN A;  1XNQ L;  2KVM A;  2NVQ H;  2BA1 A;  1E1T A;  2K75 A;  1BNZ A;  4NKL A;  1K3B C;  2EXZ A;  4G57 A;  2JYO A;  4C3J H;  4LK1 C;  4BWG B;  4B3R Q;  3U9O A;  1MD2 D;  3M7G A;  1PTO H;  3BG3 A;  3RLO A;  4A93 H;  1XTD A;  1SYB A;  4X3S A;  1X9N A;  2EY6 A;  1QVF A;  3KDF A;  4LUZ A;  5HY6 A;  3GQB A;  3J7A V;  4GOP B;  3H3V C;  4P72 A;  4B3S Q;  3F2D A;  4QF4 A;  5IGC A;  2JK8 A;  1O7Z A;  1PZI D;  2FMC A;  3ZJY C;  1CA5 A;  1N32 L;  3TEH B;  2R3Z A;  1NE3 A;  3I4O A;  1KL9 A;  3HKZ E;  3HOX H;  3EQL C;  4FF1 A;  4QMG A;  2EPB A;  1Q81 C;  3HOV H;  1PTO C;  1CHP D;  4DGZ A;  5M5W B;  1TWG B;  2B2Y C;  4DUZ Q;  1X65 A;  2JJQ A;  4KLK A;  4YCU A;  3M3Y B;  2ICE C;  4C3H G;  2K05 A;  3C1F A;  4RCO A;  2K5Q A;  1Q7Y C;  3GD7 A;  3HOW G;  4B3M L;  1VQ4 A;  2HIX A;  4HTH A;  4ZUJ A;  1LO5 D;  3CCL A;  4DV0 L;  2A74 C;  2NN6 I;  3NUC A;  1EQT A;  2F3I A;  1SRO A;  3FKI G;  3CQZ H;  2VXW A;  3J80 c;  1SDF A;  1PH4 A;  5FKA C;  2F0I A;  3NXW A;  3E9I A;  3PO3 B;  1EOV A;  3RN5 A;  3WOE A;  4QUF A;  3VA5 A;  2VL6 A;  3SK6 A;  1LLR D;  3BDC A;  1H9S A;  3DEO A;  1VQK A;  1I50 H;  1KHI A;  4MTK A;  1F9P A;  3IKJ A;  3WWV A;  4V19 0;  4IFD I;  1YJ9 A;  3GTJ B;  1NAP A;  1BF4 A;  1FR3 A;  1QNK A;  1KIX A;  3G6E A;  3L0O A;  1H9M A;  3G48 A;  2B2W C;  4JI2 L;  3GTQ H;  3NEM A;  1OXS C;  5C4J H;  1EOT A;  1SAP A;  3CCV A;  3CKI B;  2B63 H;  1I6H B;  3FDT A;  2IJ0 A;  2XIW A;  4F8M A;  3F2C A;  2YTX A;  5IGG A;  2F0Q A;  1Q86 C;  5FO9 B;  2ES2 A;  3CRK C;  4ZRZ A;  3J81 c;  3P20 A;  3D0F A;  4DV6 Q;  1EQV A;  1HNW L;  2R93 B;  1CKN A;  1W6J A;  1S4Z A;  4A76 A;  2RA4 A;  4HAE A;  2IY5 B;  3NBH B;  1VDZ A;  2ZXP A;  3FEW X;  2WAQ G;  4DV0 Q;  4DU9 A;  3WDN A;  5M3F G;  2KOL A;  4R1J A;  4DUY Q;  1V9P A;  4RH6 A;  1ROD A;  4E6I A;  2YTY A;  1GUS A;  5EKK A;  3I56 A;  2JN4 A;  3Q8D A;  4PMB A;  1BBX C;  1AZQ A;  4RGM A;  3CCM A;  4DR7 L;  3MTS A;  1WTQ A;  2RCF A;  2R7F A;  4QJF A;  1AFP A;  3VDY A;  3K5N A;  4XQQ A;  3PUX A;  1BVS A;  4DV1 Q;  3R8B A;  4A3K H;  4ZQ3 A;  1VQ7 A;  2E2D C;  1FNW A;  4GN5 A;  1K3R A;  1PFS A;  4JK1 C;  2UUB L;  1EIH A;  1S5C D;  4HJA A;  4OWX B;  3BVG A;  1RCV D;  4OON A;  1CM9 A;  5LL6 X;  4JI5 Q;  4B9W A;  1FJG Q;  4IOA A;  3L2P A;  3KBX A;  2GVA A;  2ZTC A;  1VQE A;  4X3U A;  4HIO A;  1SYF A;  1XMO Q;  1TS2 A;  1HNW Q;  1AEX A;  1H9J A;  1SMY D;  3J81 j;  4DV4 L;  4ZLT F;  4R8I A;  3PIO 3;  3J81 i;  3MA2 B;  1KAW A;  3NEN A;  1JOO A;  1SXT A;  4JBJ A;  4A3L H;  5CR3 A;  3CCS A;  1ENA A;  2F0U A;  4B3T L;  1C8C A;  4XIG S;  4K0K L;  3A7L A;  1SYE A;  2WB1 G;  4DV7 Q;  4M8A A;  2RKS A;  4TRD A;  4YHH L;  4GKJ Q;  5IOD A;  4A3D G;  2DY8 A;  3CPW A;  1MHW C;  1VQH A;  5C3E G;  4HJ8 A;  4X62 Q;  1TWF H;  1Z7T A;  5C0X I;  2NVX B;  1SNP A;  4UP8 A;  2CHB D;  1B1Z A;  3G7L A;  1II3 A;  1D6E C;  3F2B A;  2EYF A;  5FLM H;  2L4N A;  5LMN Q;  2PZT A;  4H44 C;  4JI6 Q;  3B6Y A;  3BZD B;  1EIG A;  1F9S A;  3H0G G;  4KTA A;  3UDI A;  4Y7N B;  3QR8 A;  2HUG A;  3KF8 B;  2UUB Q;  3NQI A;  1FL0 A;  4PMC A;  5C6A A;  3I3C A;  1ESR A;  5I6W A;  2ZJP A;  4A3I G;  1MJE A;  1HA5 A;  1HZB A;  1K8M A;  1VQB A;  1KLG D;  2DN8 A;  3S9W A;  2MQH A;  3BZK A;  3D8G A;  1KTK A;  2SNM A;  1TWH H;  4A3F H;  4BY1 B;  4K5X A;  5M5Y H;  5E3F A;  5M3M H;  2VUM G;  2UXD L;  4BBR G;  1IBM Q;  2RHS B;  4DV4 Q;  4X3K A;  3GTK H;  5C5M A;  3MEF A;  1G29 1;  3KJO A;  4B3T Q;  2Z9H A;  1HTP A;  2R92 H;  2ATW A;  3HOU B;  1J5E L;  3I8Z A;  4F87 A;  2UUC L;  3EA6 A;  1PRT F;  5KNC A;  4A3G G;  5IT9 L;  4EQ5 A;  3UI2 A;  1YNJ C;  3AU7 A;  1BBU A;  5NUC A;  1E2V A;  1OO9 B;  4A3J H;  2EXD A;  2EIF A;  1YNN C;  1JE4 A;  2RDH A;  4POG A;  3M4O B;  1S5F D;  5JAV A;  1OTC A;  4M1U B;  1OXX K;  3SR1 A;  1JC7 A;  3L9A X;  2DJG C;  4GLV B;  4DAY A;  2QW7 A;  4F88 A;  2RSN A;  1EIF A;  2R7D A;  5FO7 B;  1FNV A;  4FXK C;  1DOL A;  5C44 H;  3MXN A;  3S1R H;  1PH9 A;  2UUA L;  3LWU A;  2OTJ A;  1X55 A;  3NEL A;  2K6A A;  3NHH A;  3ICE A;  1QWY A;  4I65 A;  2E74 C;  4CGY B;  1LTL A;  4DV3 L;  3A8I E;  1B7Y B;  1K0R A;  2BA0 A;  4OWW B;  2MHV A;  4JPB W;  1JOK A;  1I4R A;  5J1Z A;  5IP7 H;  1O80 A;  3NK9 A;  4KY5 A;  1B9N A;  1QVG A;  1GO3 E;  2N3S A;  1A2T A;  2PI2 A;  4JOI A;  1F2Y A;  1KXL A;  1V1O A;  2DUD A;  2K5V A;  3HOZ G;  1PXU A;  4PQX A;  1O7I A;  2A68 C;  2F0N A;  4C2M B;  4IFD J;  3BDO A;  3MXG A;  5CV4 A;  3AMU A;  5IGB A;  4BBS H;  2VQF L;  2PW7 A;  2CWA A;  1Q8K A;  1TR5 A;  3S2D B;  4DPG A;  4DNR B;  4DXG A;  3ITP A;  4OX9 L;  2E2H B;  2KBN A;  2YU9 B;  2RDG A;  2JA5 H;  4ODG A;  4EGV A;  4LF5 Q;  2QF7 A;  3TQY A;  4A3B H;  5EPL A;  3K58 A;  2JA7 H;  3S1N H;  3CCR A;  3OMC A;  2L12 A;  3FP9 A;  5M5X H;  4IUQ A;  4ID6 A;  3URY A;  3T13 A;  4CJ0 B;  1L0X B;  3PUW A;  2NUC A;  1TY0 A;  1VQ5 A;  1PFB A;  1PZJ D;  2CCZ A;  3VYU A;  2B2U C;  1UE1 A;  3R3O A;  2A1A A;  1A63 A;  2H1E A;  2D0O A;  1TXY A;  5EBC A;  1CHQ D;  1JR0 D;  3W5O A;  1Y1V H;  4KHP Q;  5KYI A;  1GOZ A;  4C1N I;  1ML0 D;  1STH A;  1MSH A;  3PIO A;  3FMC A;  3VR5 A;  3VR4 A;  1WD0 A;  3CCE A;  4ZAI A;  2MUY A;  1KDB A;  4POF A;  1ENC A;  5IWA Q;  1EL0 A;  1E7Z A;  2GA4 B;  2A6E C;  2E75 C;  2FXQ A;  2KUM A;  2QGQ A;  2B2Y A;  3BVZ A;  3U4V A;  4C3H B;  3ZYY X;  4K6L A;  3NE5 B;  3PUY A;  4LWC A;  3UE1 A;  5BN3 A;  4DR5 L;  2PPB C;  1TU2 B;  3HOW B;  4DR1 Q;  4Y52 H;  4PZ6 A;  1ASY A;  4OO1 H;  2UXB L;  5BN5 A;  2AUJ D;  3FKI B;  4TVA B;  1ET6 A;  1QE6 A;  4XQJ A;  1SMX A;  3S24 A;  1TQO A;  4H0L C;  3TME A;  4ZUI A;  1F2L A;  5CGK A;  1JMC A;  3S16 B;  1Q46 A;  2LXK A;  1XXG A;  5IYD H;  1PFN A;  4FXD A;  2A6H D;  4GLX A;  2BH2 A;  4IO9 A;  1RD9 D;  4L6T B;  1TS3 A;  1E3P A;  1EU3 A;  2NVT B;  1HNZ Q;  2M9V A;  1I4X A;  4N9P A;  1KAA A;  2OQ0 A;  4JI8 L;  4HMI A;  4X3T A;  4OGQ C;  1TWG H;  4UP7 A;  3DUZ A;  5EQ0 A;  3RR5 A;  1NMG A;  5ELD A;  1LTA D;  3M3Y H;  1RTO A;  2B2W A;  4OL7 A;  4RAU C;  1KQS A;  4MIU A;  1FYC A;  1VQP A;  4PV1 C;  1JE5 A;  5K5P A;  1Q82 C;  1UWV A;  1LT6 D;  5DM7 3;  2TSS A;  1S40 A;  3PCO B;  4YCV A;  2HCC A;  4A93 G;  1QIL A;  2UXC L;  1DD2 A;  3AYH B;  3MFG A;  2Z4H A;  3ER0 A;  2OQK A;  5C0X J;  2B8G A;  3J7A 5;  4GN4 B;  1HTL D;  4J6H A;  3ONA B;  1XX8 A;  2N8N A;  4KD4 A;  3PO3 H;  1B2T A;  2ICI A;  3GV6 A;  5CV8 A;  5IYC G;  5L37 A;  1N34 L;  1AP0 A;  2EYJ A;  1Y8P B;  4LFB Q;  2HIV A;  2IHF A;  2WAQ B;  2Q2H A;  1DCZ A;  3QJY A;  5M3F B;  4JYA L;  4OWT B;  2NYZ D;  1WCM G;  3JAM c;  3NQT A;  3HOV G;  5J22 A;  2OF1 A;  4NXM L;  5BR8 L;  3I4N G;  1BQQ T;  2HDL A;  2F0E A;  3MWY W;  1AZP A;  2PO4 A;  3M4P A;  4KN7 C;  3V2T A;  4CDC C;  1ICW A;  3C1E A;  3HOU G;  3CRL C;  2FIN B;  1I6H H;  4JCV E;  4DK6 C;  5ISR A;  4X65 L;  1YIT A;  3C3L A;  4JI8 Q;  1B3A A;  2BOS A;  4A3E G;  4TQU S;  4HSV A;  2EYM A;  3S1Q H;  1SFO H;  2L15 A;  3M4Q A;  1B44 D;  5IGF A;  1JOQ A;  4IUP A;  4LF8 L;  2I0Q A;  1I6V C;  2R93 H;  1IKM A;  1Q1B A;  3A54 A;  1STY A;  1IBK L;  1HR0 Q;  3RZO B;  3A5Z B;  4LNQ A;  3J7Z C;  3RNU A;  5LL6 S;  2KEE A;  4XYO A;  2PNH A;  3SHL A;  4FF2 A;  2JQO A;  4P2C B;  4CJ2 C;  3H6M A;  2UXC Q;  1EWH A;  3ULL A;  1EY9 A;  1PH1 A;  2F4I A;  1L2F A;  5GQO A;  2JA6 G;  1A15 A;  2OXP A;  3CC4 A;  1UE7 A;  2NN6 G;  1N34 Q;  4B9X A;  3GTO B;  4DAV A;  1I4P A;  5ELF A;  1RL2 A;  5GRO A;  1EY6 A;  1QG7 A;  4DR2 L;  5FLX L;  1TWA B;  2WB1 B;  1DYQ A;  4XTC S;  5F2D A;  2KHS A;  4EQP A;  1D5X C;  3T56 B;  4JOI C;  3MAQ A;  2E76 C;  2Z6K C;  4A3D B;  3AFQ A;  1WTX A;  3A56 A;  1D7Q A;  1QCB D;  5C3E B;  4IFD G;  1I3Q B;  3IL8 A;  1A0I A;  1JIC A;  3AFP A;  1G51 A;  4RMF A;  1VQ9 A;  1WTO A;  2G9D A;  4R4C A;  2SOB A;  4IAL A;  4LFA L;  1Z6H A;  1MGS A;  3H0G B;  1QB5 D;  4U67 3;  2K52 A;  2R7Z G;  4JV5 L;  4HIK A;  2M2L A;  2EJM A;  2EYH A;  3PQI A;  4A3I B;  4ME3 A;  3HZX A;  5FK9 C;  1DGS A;  2QKI C;  5EAY A;  1EU4 A;  1JQY D;  2BDO A;  1U4P A;  2PQA B;  4EVO A;  4WFN 3;  2VUM B;  4OEL B;  2Q8I B;  4HID A;  2GVB A;  1X3F A;  2HQL A;  4BBR B;  1PV4 A;  3OW2 A;  2C5C A;  1SE3 A;  1YVC A;  3I70 A;  4QY7 A;  1D2B A;  2CH4 A;  1R4P B;  3VR2 A;  1X6O A;  2XSC A;  5LMU L;  1IZ6 A;  2NWG A;  5E4X A;  1NR4 A;  2IHE A;  3KF6 B;  1PFM A;  1RIP A;  5JEA H;  1HH2 P;  1NCV A;  1SMY C;  3N6R A;  4IUU A;  2NVY B;  1BUV T;  1LTR D;  2F0S A;  4QIW B;  3T16 A;  4A3G B;  3ERO A;  1PH5 A;  1XPO A;  3A8J E;  2YYZ A;  5IT9 E;  1BBW A;  1PYB A;  2F0M A;  3PUZ A;  4C1N K;  2ZM6 Q;  1FGU A;  1X3P A;  3HRZ C;  4BY1 H;  5COY A;  3TZU A;  3KOJ A;  1XPU A;  1BCP F;  1EWC A;  2WII B;  4O0A A;  2B29 A;  3MXU A;  2BH8 A;  1U4R A;  4A3C H;  3S2H B;  4O1N A;  5A2Q L;  1PRT D;  1BXT A;  3E6Z X;  2AWN A;  4NW2 A;  4RCN A;  3OIP A;  1NJI C;  1DJR D;  1HZA A;  2F4V L;  4LFC L;  1XNQ Q;  5EGT A;  3NP8 A;  3X3N A;  1D1I A;  4BA2 I;  1DON A;  2MP1 A;  1PRT B;  1I4G A;  3J81 E;  3MVV A;  4HSP A;  2DGY A;  3QOL A;  3H91 A;  2NZO A;  1K83 B;  1HQR D;  3CCU A;  2HT1 A;  1VMP A;  4JW0 A;  5G3L F;  4GLA C;  4JI3 L;  4A3M G;  3D6W A;  1Y1W G;  3I91 A;  1I4H A;  2QEX A;  2KED A;  1L1O B;  1SE2 A;  3G71 A;  1MI2 A;  1V1P B;  1K8A C;  1MJC A;  3TRE A;  2Q2U A;  4FO2 A;  4X64 L;  1C0A A;  1N32 Q;  1RKN A;  4OIJ A;  2Z8L A;  1Q12 A;  1QJO A;  4IZ8 A;  1GUG A;  1C7Y A;  4YY3 L;  2AKW B;  5M3M G;  3QB3 A;  5C0X G;  3HOZ B;  3C2P A;  1YHA A;  4DK3 C;  1D5Z C;  4RHS A;  4WJ3 M;  3PIP 3;  3L3O C;  4LJZ C;  1D1K A;  1KD1 C;  2J7Z A;  4DAY B;  3NWS A;  1X56 A;  3GDE A;  3CD6 A;  1EEF D;  1ILQ A;  2NTT A;  3DXJ C;  3MHB A;  1TWC B;  4B3M Q;  4FYD A;  2QA4 A;  1TY2 A;  2IWH A;  4RWS C;  2F4V Q;  2KEN A;  4R8N A;  4BXX H;  1U9R A;  3J80 i;  2P5Z X;  2WKD A;  3HOY H;  5I6Y A;  1VQ8 A;  2D9U A;  2HDM A;  4C2M H;  1AE2 A;  4JI3 Q;  4KD3 A;  1LTI D;  2B2U A;  4XT3 B;  5D3I B;  1IW7 D;  4DR6 L;  5C44 G;  1VQN A;  3K7U C;  1NNX A;  5CYU A;  4C3I G;  4QL5 A;  3S2D H;  5CV6 A;  4JI2 Q;  2L1B A;  4YY3 Q;  1IYV A;  2J0T D;  3FPP A;  4JC0 A;  2ZXR A;  1OXU A;  2E2H H;  2YU9 H;  5K36 H;  2XGT A;  3KJP A;  3L7Z C;  1CQV A;  4BA1 I;  3P7J A;  3AQQ A;  4RFB A;  3K7A H;  2IX3 A;  4KY6 A;  1STG A;  1X3Q A;  1HA6 A;  2OEO A;  1DZ1 A;  1ZKO A;  4AQY L;  1SBB B;  3KUP A;  4ZKC B;  3U4Z A;  1H9R A;  5COR A;  3VYR A;  4AYB G;  1Y14 B;  2UU9 L;  4CDE C;  3RD4 A;  3P75 A;  1PDQ A;  3K6O A;  4C56 C;  2E2J B;  4BY7 G;  2MO0 A;  3TP8 A;  2JA8 G;  2CFM A;  1EY4 A;  3T1H L;  3D6C A;  3OSO A;  3TP7 A;  5J39 A;  1JB7 A;  1DM0 B;  3T1Y L;  1SR3 A;  4DR7 Q;  2AQ3 B;  2WAQ E;  1Q90 A;  4B08 A;  1G2T A;  4C3H H;  3Q22 A;  1GUO A;  3H15 A;  4HJ9 A;  3HOW H;  4GOP A;  2CH4 W;  2OT2 A;  3IAY A;  2E5L L;  4A93 B;  1S5B D;  4RGN A;  2LS0 1;  2VQE L;  3FKI H;  1O7Y A;  3SK4 A;  3FPU B;  4IUR A;  1NSN S;  1QUQ B;  1GUW A;  3LX0 A;  1HFG A;  4DR3 L;  1PLF A;  1YHB A;  1VQO A;  3ULP A;  3W3A A;  2AQ1 B;  5IY0 A;  4AQY Q;  3PGZ A;  2XRS D;  2NVT H;  3LWE A;  3V05 A;  2CW0 D;  4KHV A;  2IX0 A;  1Z9F A;  1SRU A;  1WCM B;  3J80 L;  3D31 A;  5JOB A;  3HOV B;  2R6G A;  2Z0S A;  5A35 A;  5EPJ A;  1TKW B;  1OXV A;  1X32 A;  3I4N B;  3KFU A;  4K0K Q;  1I5F A;  2RBM A;  4YHH Q;  5ELC A;  3HS0 C;  4NP5 A;  1IXR A;  2NZ1 D;  4ZYS A;  3A0J A;  1JJG A;  2L0C A;  1UEA B;  4JBW A;  4QUC A;  4A3E B;  1SNC A;  1DOK A;  1N9W A;  4DNI A;  2Y0S G;  3UDG A;  2G5D A;  2L5T A;  2WB1 E;  1J6Q A;  3CME A;  3QO2 A;  2A6H C;  4IJH A;  2F0W A;  1IKL A;  4Q5V A;  3RN2 A;  5C4X H;  1W3S A;  2E5L Q;  3S1M H;  3I4M G;  5M3F H;  1CKM A;  5C3X A;  1CT1 D;  2E8G A;  3GV3 A;  3J81 L;  1HRJ A;  3UDX A;  3CMA A;  2DJF C;  2KHJ A;  2PYK A;  4DR3 Q;  1KNA A;  1G6P A;  2JA6 B;  3GTQ B;  1IL2 A;  1UE6 A;  2B3G A;  3PSI A;  2UXD Q;  3D4W A;  4L63 B;  1BDO A;  2OTL A;  2K4K A;  5BN4 A;  3BS1 A;  5I4D A;  5FJ8 G;  2VZA A;  3CPF A;  3NBH A;  5KND A;  2NZH A;  1SYC A;  3M85 A;  2K5D A;  4WRD A;  5FLX E;  2ASB A;  3K80 C;  4JBM A;  2NBF A;  4P71 A;  5T1I A;  5ELO A;  3OTO L;  2IX1 A;  2B2T C;  4K8I A;  2Z6K A;  3RZO H;  3KLS A;  4ZCK A;  1EY5 A;  4ALP A;  4LF7 L;  2KJX A;  4K8J A;  1J5E Q;  1YNX A;  4DFA A;  3CAM A;  1N36 L;  4HIM A;  2UUC Q;  1YI2 A;  4UDU C;  1VCI A;  2A69 C;  2V4D A;  3GTP B;  2Z4I A;  4CKE A;  2C35 B;  2JSO A;  2AMC B;  4FF4 A;  2O2L D;  1SE4 A;  1ZYR D;  2HQE A;  1ESF A;  2R7Z B;  5DAU A;  4P73 A;  2EYP A;  5I9P A;  3GTO H;  5DM6 3;  4LUO A;  4QIW E;  4DK0 A;  1EY8 A;  1WD1 A;  3T4A C;  3J7Y W;  1TWA H;  5ELB A;  5JJI A;  3I4L A;  3PO2 G;  1WTH A;  2XTI A;  1H95 A;  4EQO A;  2UUA Q;  4A3D H;  5IGE A;  2A8V A;  4G7O C;  1I3Q H;  2F0T A;  2BE5 C;  3PV0 A;  4OIK A;  1Y8N B;  4GNX B;  1EZ8 A;  3QIA A;  4KI0 A;  2D62 A;  4DV3 Q;  3I2Z A;  2EQS A;  4OO1 I;  2LKV A;  5JVG 3;  1STE A;  2CKZ B;  4P75 A;  3SE0 A;  3SK8 A;  5FOB B;  1ASZ A;  1KDA A;  4YIJ A;  2F0V A;  2F0P A;  1MKH A;  3H09 A;  1EYA A;  1C48 A;  2L9H A;  1A8V A;  3H0G H;  1CA6 A;  3AEV A;  2ALY B;  1EQQ A;  1CZG A;  2JE6 I;  1AN8 A;  2Q2T A;  4I7A A;  4A3I H;  1R4Q B;  1N36 Q;  2WKC A; 
#chains in the Genus database with same CATH homology
 1O78 A;  1S5D D;  1Q8I A;  2JEA I;  4HMJ A;  2QCP X;  1GHJ A;  1Q3L A;  2FJ2 A;  1UNS A;  3A8K E;  3MFY A;  5CMD A;  1B4O A;  1HUN A;  4TKO B;  5A2Q E;  1F2Z A;  1ONL A;  3KF8 A;  1PTO F;  1RF2 D;  1TT2 A;  4ULL A;  1BCP D;  3OOC A;  2M00 A;  4IUV A;  4LMQ D;  2A5H A;  3HEJ A;  1BR9 A;  4A3M B;  1Y1W B;  1I4Q A;  3CU7 A;  2JEB I;  2B39 A;  5I2Y A;  1BCP B;  3KK7 A;  2FMM A;  4LAA A;  1K8O A;  2K1B A;  1FD7 D;  2G9H D;  2KQ3 A;  2PMZ B;  4C3J G;  2R61 A;  2O5J C;  5M3M B;  5G3L D;  1SSO A;  1H9K A;  2X6G A;  1ENF A;  3IFD A;  1G91 A;  4U68 A;  2K28 A;  1G2S A;  1LT5 D;  1LV9 A;  4I7Z C;  4FVM A;  2F0O A;  3ND9 A;  4KHZ A;  3OWE B;  3G6J B;  3OHX C;  1EY7 A;  2K01 A;  3HGB A;  2XNA C;  2CQA A;  3PMF A;  1VMC A;  1CTM A;  4N9T A;  3DWQ A;  4O42 A;  1HPC A;  1H9S B;  2A69 D;  1EY0 A;  3RUZ A;  1RJT A;  4K2L A;  2EY5 A;  1PRT C;  2XVS A;  2LFN A;  5EBD A;  5C4Z A;  3WOF A;  2IL8 A;  1JB3 A;  3MXP A;  5C44 B;  4UAI A;  1U4L A;  4C3I B;  3D3R A;  1T5X D;  3NTK A;  1LAC A;  1IL8 A;  2PNR C;  2PZU A;  4IUN A;  1Z47 A;  2ID0 A;  2BE5 D;  4XXE A;  2XRQ D;  4NMZ A;  3T53 B;  4KMU C;  4DF7 A;  3OPO A;  4PNY A;  1MBY A;  5EKL A;  4ZK9 B;  5KGU A;  2BCO A;  1CK1 A;  2B2V A;  3SK5 A;  1SND A;  2O4X A;  1LT4 D;  3DM1 A;  2AQ2 B;  4AYB B;  2EOT A;  2VB2 X;  2JP1 A;  3R2I A;  3V96 A;  2QIL A;  3R93 A;  3VYT A;  2JA8 B;  4BY7 B;  2F3V A;  3EVQ A;  2I07 B;  4KN4 C;  2KCC A;  1SYD A;  2JXM B;  1SNO A;  1O7L A;  4A3B B;  4ME5 A;  4S3S A;  5M5X B;  2ENB A;  1JWS D;  1TVX A;  1V43 A;  4K6D A;  2N88 A;  2D5D A;  3E0J A;  2X6L A;  4XT1 B;  1IW7 C;  2DNC A;  2EE1 A;  4BS9 A;  3K5O A;  5JVH 3;  4WJW A;  2PW5 A;  4G4K A;  3QG1 A;  4PMW A;  1V8Q A;  5IOC A;  1EYD A;  1WTR A;  3J80 E;  1R9T B;  2DNE A;  1CI3 M;  1E0B A;  1HXY D;  3EJI A;  3NTH A;  2XN9 C;  1D5M C;  4IQZ A;  2EDG A;  4ZKB B;  3QOJ A;  3FRP B;  2AWO A;  2Y0S B;  4J1M A;  1HQM C;  1WTV A;  3I4M B;  2X69 A;  4WOR A;  3I72 A;  3LNN A;  3TP6 A;  3S15 B;  2EY1 A;  3TZD A;  3J7A F;  1J9O A;  3M4Y A;  2IT1 A;  2K5W A;  4RA8 A;  2AUK A;  3JAM L;  2PCF B;  5LHY 1;  1DOM A;  4KJO A;  1PMR A;  2SEB D;  3FVQ A;  2HCI A;  2E2I B;  1DXM A;  3S17 B;  2B2T A;  3RZD B;  3RMH A;  2A73 B;  2K03 A;  1L0Y B;  4K2K A;  1A6X A;  2RQX A;  4J8Q A;  2CW0 C;  4CKC A;  3I90 A;  1NR2 A;  1XWE A;  2EY2 A;  2F0G A;  4IN3 A;  1KNE A;  2F0D A;  3VR3 A;  2NN6 H;  2PZW A;  3Q24 A;  3NBI A;  1STB A;  1EEI D;  2EVB A;  1LTS D;  3BDL A;  2EJF C;  3N52 A;  1F77 A;  2XWB B;  1T5E A;  5D14 A;  3DWP A;  4DN4 M;  3PO2 B;  1G8Z D;  3S1Q B;  1SFO B;  4DXF A;  1C4Q A;  1ET9 A;  5KYL A;  5EKI A;  1FGB D;  1B9M A;  4IFD H;  1QNU A;  4RGT A;  4K5W A;  2Q8T A;  1Y69 U;  3NPP A;  4K14 A;  3NWT A;  1EFI D;  1B53 A;  5CC4 A;  1PZK D;  3HP3 A;  4DK1 A;  3SVM A;  1RDP D;  2K7V A;  5JJZ A;  1RHP A;  3S14 B;  2CVR A;  3GTG B;  4HCE A;  3AB9 A;  5C3W A;  2NTS A;  1WVL A;  2I46 A;  2VB3 X;  3GTL B;  1ZEQ X;  2B2V C;  2J4X A;  4EQN A;  2LY7 A;  3DWA A;  3EFX D;  3R2T A;  3GTM B;  1GUT A;  3H94 A;  2RVL A;  3QWN A;  4R9W A;  4DA2 A;  1IYU A;  3VYS A;  1UAP A;  2LMC B;  3K0Y A;  1JWU D;  1ZYR C;  4MHE A;  2C9O A;  4FNF A;  2KA7 A;  5KNB A;  1QOH A;  2PQE A;  1PTO D;  2QEJ C;  4KKS A;  3MZ5 A;  2NVQ B;  5JPM C;  3BYY B;  1WTW A;  1G6Z A;  4C3J B;  2F1M A;  2WAC A;  1A3U A;  1IHZ A;  1PTO B;  4XYQ A;  3SDZ A;  2EZV A;  5EPK A;  3T51 B;  1TS5 A;  1RTN A;  1SYG A;  2KEC A;  2TMP A;  4CKB A;  4OHJ A;  5CV7 A;  1CQF A;  5HGT A;  3HOX B;  5JEA J;  1E2W A;  3ND8 A;  3Q0A A;  2O5I C;  4ABN A;  3TDQ A;  1KLU D;  5C0X H;  3O13 A;  4OO1 G;  3SXH A;  3NTI A;  1SNQ A;  3CQZ B;  3A7A B;  4CBV A;  3K5L A;  3SEB A;  1BOS A;  1BCP C;  2RDF A;  5TSS A;  1V1P A;  1B50 A;  2F0F A;  5IGD A;  1I50 B;  4G7H C;  2K04 A;  2NB0 A;  2EYO A;  1HHV A;  1LTB D;  1M8A A;  1AW7 A;  4Q0F A;  5C4J B;  3OWF A;  3TSS A;  1FNU A;  4HCS A;  2B63 B;  3TN2 A;  4L8J A;  1LTT D;  2K32 A;  5E1F A;  5C4H A;  1E2Z A;  5ELE A;  3BVM A;  3E5S A;  4HED A;  5DEH A;  1SJE D;  2K33 A;  2VNU D;  3CHB D;  3HKZ B;  4RKB A;  1JWM D;  3OMG A;  2EYL A;  4NDX A;  3U9S A;  4Z9C B;  3KBG A;  3MC0 B;  2F03 A;  3D4R A;  4CJ1 B;  1XYI A;  3Q23 A;  5KEE A;  1Y8O B;  3HOY B;  2SNS A;  2N55 A;  3RLF A;  2RSO A;  1LT3 D;  1MSG A;  4IUT A;  5FO8 B;  3F2U A;  4A3K B;  4CHT B;  4HR7 B;  1STA A;  5CBA E;  1W6K A;  2SDF A;  4RGO S;  4DAP A;  2F0H A;  3K7A B;  4HN7 A;  4RKL A;  5EJW A;  3IFT A;  2D2C C;  3K59 A;  4F7X A;  5KRU A;  4G7Z C;  2B8F A;  3VR6 A;  1Q1E A;  4K5V A;  1GHK A;  4KK7 A;  3DMU A;  1A3T A;  3KLS X;  3BYT B;  3PUV A;  1TWF B;  5DNF A;  1OXT A;  2IW3 A;  5IIF A;  3HG9 A;  5T1G A;  3TBI B;  2BDN A;  1SJH D;  4KY7 A;  1EYC A;  1WTP A;  3OW7 A;  5M9O A;  1GJX A;  3A55 A;  1J8I A;  1M4V A;  1VF5 C;  2WV6 D;  1NUC A;  2FFK B;  4QB4 A;  5HUR A;  3K57 A;  4DNT B;  1HFN A;  2F0L A;  3GO5 A;  2WP8 J;  3P1H A;  1YNJ D;  3JAM E;  2MPM A;  5AFW A;  2MGS A;  1YNN D;  1TWH B;  5I9O A;  4A3F B;  5M5Y B;  3KLR A;  4KJN A;  5C5L A;  1ILP A;  3I73 A;  5KIX A;  5D65 A;  1TS4 A;  1BO0 A;  3GTK B;  1PYW D;  2F0J A;  1SEB D;  4H7B A;  1HCZ A;  4TSS A;  4V0B A;  1EZ6 A;  2L11 A;  1UUP A;  4KV6 A;  2H4O A;  5JEA G;  2R92 B;  3M7N A;  3C46 A;  1HUM A;  1TII D;  4FP5 D;  3OIQ A;  4A3J B;  2FHT A;  1F2M A;  2F3W A;  5C4X B;  2A68 D;  5E4W C;  1GUN A;  3S1M B;  1KAB A;  1LTG D;  2Q8R E;  5CBE E;  1GXD C;  3W2D A;  1CZW A;  4FXG C;  3MEH A;  3S1R B;  4KKU A;  1LAB A;  2Z1C A;  1A3V A;  5I2X A;  5CV9 A;  1U4M A;  3TP5 A;  1KDC A;  1ZXT A;  3D4D A;  4RHR A;  3X3M A;  5JPN C;  2DY7 A;  4GZY C;  1STN A;  3K5M A;  5D3D A;  1S5E D;  4ILW A;  1VF7 A;  3ERQ A;  3DHQ A;  4BBS B;  3Q6S A;  2WIN B;  1XTC D;  4H13 C;  4MN3 A;  5CV5 A;  1F9Q A;  2EJG C;  2L55 A;  2MJ8 A;  2JA5 B;  3VA7 A;  2QDB A;  3GP7 A;  1CFM A;  2JA7 B;  3S1N B;  2A6E D;  3DEP A;  4FF3 A;  2ZT9 C;  3NSW A;  2F0K A;  4XQN A;  4XDX A;  1SNM A;  4KKT A;  2XWJ B;  1JOR A;  2ZXO A;  1A2U A;  1JCK B;  2IPK D;  4QCL A;  1F9R A;  1Y1V B;  5K36 G;  2KCN A;  2KVM A;  2BA1 A;  1BNZ A;  4NKL A;  2EXZ A;  4G57 A;  2JYO A;  4LK1 C;  4BWG B;  3U9O A;  1MD2 D;  3M7G A;  1PTO H;  3BG3 A;  4X3S A;  1SYB A;  2EY6 A;  3GQB A;  3J7A V;  3H3V C;  4QF4 A;  5IGC A;  1CA5 A;  1O7Z A;  1PZI D;  2FMC A;  2R3Z A;  3EQL C;  4FF1 A;  4QMG A;  2EPB A;  1PTO C;  1CHP D;  4DGZ A;  5M5W B;  1TWG B;  2B2Y C;  3M3Y B;  2ICE C;  4C3H G;  2K05 A;  3C1F A;  4RCO A;  2K5Q A;  3GD7 A;  4HTH A;  4ZUJ A;  1LO5 D;  2A74 C;  2NN6 I;  3NUC A;  1EQT A;  2VXW A;  1SDF A;  5FKA C;  2F0I A;  3NXW A;  3PO3 B;  3WOE A;  4QUF A;  3VA5 A;  3SK6 A;  1LLR D;  3BDC A;  1H9S A;  3DEO A;  1F9P A;  3IKJ A;  4V19 0;  4IFD I;  3GTJ B;  1NAP A;  1BF4 A;  1FR3 A;  1QNK A;  1H9M A;  2B2W C;  1OXS C;  1EOT A;  1SAP A;  3CKI B;  1I6H B;  3FDT A;  2IJ0 A;  2XIW A;  4F8M A;  5IGG A;  2F0Q A;  5FO9 B;  3CRK C;  4ZRZ A;  3P20 A;  1EQV A;  2R93 B;  1W6J A;  1S4Z A;  2RA4 A;  4HAE A;  1VDZ A;  2ZXP A;  3FEW X;  4DU9 A;  3WDN A;  2KOL A;  4RH6 A;  1ROD A;  4E6I A;  1GUS A;  5EKK A;  4PMB A;  1BBX C;  1AZQ A;  4RGM A;  3MTS A;  1WTQ A;  1AFP A;  3K5N A;  4XQQ A;  3PUX A;  3R8B A;  4ZQ3 A;  2E2D C;  1FNW A;  4JK1 C;  1EIH A;  1S5C D;  3BVG A;  1RCV D;  1CM9 A;  5LL6 X;  4B9W A;  3KBX A;  4X3U A;  1SYF A;  1TS2 A;  1AEX A;  1H9J A;  1SMY D;  4ZLT F;  4R8I A;  3PIO 3;  3MA2 B;  1JOO A;  1SXT A;  5CR3 A;  1ENA A;  2F0U A;  1C8C A;  4XIG S;  3A7L A;  1SYE A;  4M8A A;  2RKS A;  4TRD A;  5IOD A;  2DY8 A;  1Z7T A;  5C0X I;  2NVX B;  1SNP A;  2CHB D;  1B1Z A;  3G7L A;  1II3 A;  1D6E C;  2EYF A;  2L4N A;  2PZT A;  4H44 C;  3BZD B;  1EIG A;  1F9S A;  4KTA A;  4Y7N B;  2HUG A;  3NQI A;  4PMC A;  5C6A A;  3I3C A;  1ESR A;  5I6W A;  1HA5 A;  1K8M A;  2DN8 A;  1KLG D;  3S9W A;  3D8G A;  1KTK A;  2SNM A;  4BY1 B;  4K5X A;  5E3F A;  4X3K A;  5C5M A;  1G29 1;  1HTP A;  3HOU B;  3I8Z A;  4F87 A;  3EA6 A;  1PRT F;  5KNC A;  5IT9 L;  3UI2 A;  1YNJ C;  3AU7 A;  5NUC A;  1E2V A;  1OO9 B;  1YNN C;  1JE4 A;  2RDH A;  3M4O B;  1S5F D;  5JAV A;  4M1U B;  1OXX K;  3SR1 A;  1JC7 A;  3L9A X;  4DAY A;  4F88 A;  2RSN A;  5FO7 B;  1FNV A;  4FXK C;  1DOL A;  3MXN A;  3LWU A;  2K6A A;  3NHH A;  1QWY A;  4I65 A;  2E74 C;  4CGY B;  3A8I E;  2BA0 A;  2MHV A;  1JOK A;  1I4R A;  5J1Z A;  1O80 A;  3NK9 A;  4KY5 A;  1B9N A;  1A2T A;  1F2Y A;  1V1O A;  1PXU A;  4PQX A;  2A68 C;  2F0N A;  4C2M B;  4IFD J;  3BDO A;  3MXG A;  5CV4 A;  3AMU A;  5IGB A;  2PW7 A;  1TR5 A;  3S2D B;  4DNR B;  4DXG A;  3ITP A;  2E2H B;  2YU9 B;  2RDG A;  4ODG A;  4EGV A;  2QF7 A;  5EPL A;  3K58 A;  3OMC A;  2L12 A;  4IUQ A;  4ID6 A;  3URY A;  3T13 A;  4CJ0 B;  1L0X B;  3PUW A;  2NUC A;  1TY0 A;  1PFB A;  1PZJ D;  3VYU A;  2B2U C;  3R3O A;  2H1E A;  5EBC A;  1CHQ D;  1JR0 D;  5KYI A;  1GOZ A;  4C1N I;  1ML0 D;  1STH A;  1MSH A;  3FMC A;  3VR5 A;  3VR4 A;  1WD0 A;  4ZAI A;  2MUY A;  1KDB A;  1ENC A;  1EL0 A;  2GA4 B;  2A6E C;  2E75 C;  3BVZ A;  2KUM A;  4C3H B;  2B2Y A;  3ZYY X;  4K6L A;  3NE5 B;  3PUY A;  5BN3 A;  2PPB C;  3HOW B;  1TU2 B;  4OO1 H;  5BN5 A;  2AUJ D;  3FKI B;  1ET6 A;  1QE6 A;  4XQJ A;  1TQO A;  4H0L C;  3TME A;  4ZUI A;  1F2L A;  5CGK A;  3S16 B;  1XXG A;  1PFN A;  4FXD A;  2A6H D;  1RD9 D;  4L6T B;  1TS3 A;  1EU3 A;  2NVT B;  2M9V A;  1I4X A;  4N9P A;  1KAA A;  4HMI A;  4X3T A;  4OGQ C;  5EQ0 A;  3DUZ A;  5ELD A;  1LTA D;  1RTO A;  2B2W A;  4OL7 A;  4RAU C;  4MIU A;  1FYC A;  4PV1 C;  5K5P A;  1LT6 D;  5DM7 3;  2TSS A;  2HCC A;  1QIL A;  1DD2 A;  3MFG A;  2Z4H A;  5C0X J;  2B8G A;  1HTL D;  4J6H A;  3ONA B;  1XX8 A;  4KD4 A;  1B2T A;  2ICI A;  3GV6 A;  5CV8 A;  1AP0 A;  2EYJ A;  1Y8P B;  2WAQ B;  1DCZ A;  3QJY A;  5M3F B;  2NYZ D;  3NQT A;  5J22 A;  2OF1 A;  1BQQ T;  2HDL A;  2F0E A;  3MWY W;  1AZP A;  2PO4 A;  4KN7 C;  3V2T A;  1ICW A;  3C1E A;  3CRL C;  2FIN B;  5ISR A;  3C3L A;  1B3A A;  2BOS A;  4TQU S;  4HSV A;  2EYM A;  5IGF A;  1B44 D;  1JOQ A;  4IUP A;  1I6V C;  1IKM A;  1Q1B A;  3A54 A;  1STY A;  3RZO B;  5LL6 S;  2KEE A;  4XYO A;  3SHL A;  4FF2 A;  4CJ2 C;  4P2C B;  3H6M A;  1EWH A;  1EY9 A;  2F4I A;  1A15 A;  2OXP A;  2NN6 G;  4B9X A;  3GTO B;  4DAV A;  1I4P A;  5ELF A;  1EY6 A;  1QG7 A;  5FLX L;  1TWA B;  2WB1 B;  1DYQ A;  4XTC S;  5F2D A;  2KHS A;  4EQP A;  1D5X C;  3T56 B;  3MAQ A;  2E76 C;  4A3D B;  1WTX A;  3A56 A;  1QCB D;  5C3E B;  4IFD G;  1I3Q B;  3IL8 A;  1JIC A;  1WTO A;  2G9D A;  2SOB A;  4IAL A;  1Z6H A;  1MGS A;  3H0G B;  1QB5 D;  4U67 3;  2M2L A;  2EJM A;  2EYH A;  4A3I B;  3HZX A;  5FK9 C;  2QKI C;  1EU4 A;  1JQY D;  2BDO A;  1U4P A;  4EVO A;  4WFN 3;  2VUM B;  2Q8I B;  4BBR B;  2C5C A;  1SE3 A;  3I70 A;  1D2B A;  1R4P B;  3VR2 A;  2XSC A;  2NWG A;  5E4X A;  1NR4 A;  1PFM A;  5JEA H;  1NCV A;  1SMY C;  3N6R A;  4IUU A;  2NVY B;  1BUV T;  1LTR D;  2F0S A;  4QIW B;  3T16 A;  4A3G B;  3ERO A;  3A8J E;  2YYZ A;  5IT9 E;  2F0M A;  3PUZ A;  4C1N K;  1X3P A;  3HRZ C;  5COY A;  3TZU A;  1BCP F;  1EWC A;  2WII B;  3MXU A;  1U4R A;  3S2H B;  4O1N A;  5A2Q L;  1PRT D;  1BXT A;  3E6Z X;  2AWN A;  4NW2 A;  4RCN A;  3OIP A;  1DJR D;  5EGT A;  3NP8 A;  3X3N A;  1D1I A;  4BA2 I;  1DON A;  2MP1 A;  1PRT B;  1I4G A;  3J81 E;  3MVV A;  4HSP A;  3QOL A;  3H91 A;  1K83 B;  1HQR D;  1VMP A;  5G3L F;  3D6W A;  3I91 A;  1I4H A;  2KED A;  1SE2 A;  1MI2 A;  1V1P B;  4FO2 A;  1RKN A;  4OIJ A;  2Z8L A;  1Q12 A;  1QJO A;  4IZ8 A;  1GUG A;  3QB3 A;  5C0X G;  3HOZ B;  3C2P A;  1D5Z C;  4RHS A;  3PIP 3;  3L3O C;  4LJZ C;  1D1K A;  2J7Z A;  3NWS A;  1EEF D;  1ILQ A;  2NTT A;  3DXJ C;  3MHB A;  1TWC B;  4FYD A;  1TY2 A;  2IWH A;  4RWS C;  4R8N A;  1U9R A;  2WKD A;  5I6Y A;  2D9U A;  2HDM A;  4KD3 A;  1LTI D;  2B2U A;  4XT3 B;  5D3I B;  1IW7 D;  5CYU A;  4C3I G;  5CV6 A;  2L1B A;  1IYV A;  2J0T D;  3FPP A;  2ZXR A;  1OXU A;  5K36 H;  3L7Z C;  1CQV A;  4BA1 I;  3P7J A;  4RFB A;  2IX3 A;  4KY6 A;  1STG A;  1X3Q A;  1HA6 A;  2OEO A;  1DZ1 A;  1ZKO A;  1SBB B;  3KUP A;  4ZKC B;  1H9R A;  5COR A;  3VYR A;  3RD4 A;  3P75 A;  1PDQ A;  3K6O A;  4C56 C;  2E2J B;  3TP8 A;  1EY4 A;  3D6C A;  3OSO A;  3TP7 A;  5J39 A;  1DM0 B;  2AQ3 B;  1Q90 A;  4B08 A;  1G2T A;  3Q22 A;  1GUO A;  2OT2 A;  3IAY A;  4A93 B;  1S5B D;  4RGN A;  2LS0 1;  1O7Y A;  3SK4 A;  3FPU B;  4IUR A;  1NSN S;  1GUW A;  3LX0 A;  1HFG A;  1PLF A;  3W3A A;  2AQ1 B;  2XRS D;  3LWE A;  3V05 A;  2CW0 D;  4KHV A;  2IX0 A;  1WCM B;  3J80 L;  3D31 A;  5JOB A;  3HOV B;  2R6G A;  5A35 A;  5EPJ A;  1TKW B;  1OXV A;  1X32 A;  3I4N B;  2RBM A;  5ELC A;  3HS0 C;  4NP5 A;  2NZ1 D;  4ZYS A;  2L0C A;  1UEA B;  4JBW A;  4QUC A;  4A3E B;  1SNC A;  1DOK A;  2L5T A;  3QO2 A;  2A6H C;  2F0W A;  1IKL A;  4Q5V A;  5C3X A;  1CT1 D;  3GV3 A;  3J81 L;  1HRJ A;  2PYK A;  1KNA A;  2JA6 B;  3GTQ B;  3D4W A;  4L63 B;  1BDO A;  5BN4 A;  3BS1 A;  5I4D A;  3NBH A;  5KND A;  1SYC A;  3M85 A;  2K5D A;  4WRD A;  5FLX E;  2NBF A;  5T1I A;  2IX1 A;  2B2T C;  4K8I A;  3KLS A;  1EY5 A;  2KJX A;  4K8J A;  4DFA A;  4UDU C;  1VCI A;  2A69 C;  2V4D A;  3GTP B;  2Z4I A;  4CKE A;  2JSO A;  4FF4 A;  2O2L D;  1SE4 A;  1ZYR D;  2HQE A;  1ESF A;  2R7Z B;  5DAU A;  2EYP A;  5I9P A;  5DM6 3;  4DK0 A;  1EY8 A;  1WD1 A;  3T4A C;  3J7Y W;  5ELB A;  3I4L A;  4EQO A;  5IGE A;  4G7O C;  2F0T A;  2BE5 C;  3PV0 A;  4OIK A;  1Y8N B;  1EZ8 A;  3QIA A;  4KI0 A;  2D62 A;  4OO1 I;  2LKV A;  5JVG 3;  1STE A;  3SE0 A;  3SK8 A;  5FOB B;  1KDA A;  4YIJ A;  2F0V A;  2F0P A;  3H09 A;  1EYA A;  1C48 A;  2L9H A;  1CA6 A;  1CZG A;  2JE6 I;  1AN8 A;  1R4Q B;  2WKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...