3FDTA

Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fdtA00
3GV6A 1Q3LA 1WTPA 2JYOA 1IKLA 1SDFA 1F9RA 2FJ2A 1ZXTA 3IFDA 2CVRA 3N52A 5DNFA 1AZQA 5D65A 2HUGA 2MP1A 3SVMA 4HSVA 4R8IA 1F9PA 2SDFA 3QO2A 2L1BA 1B53A 4IUUA 1CA5A 5T1IA 1QG7A 3DEOA 4ZK9B 2L12A 3HP3A 4RA8A 4CJ2C 4DN4M 1EQTA 3FDTA 1HUNA 4UAIA 5CBAE 4ZKBB 1JICA 3MTSA 4QUCA 1EIGA 1U4MA 2X69A 2IL8A 1TVXA 3TZDA 2KECA 2B2TC 1ILPA 5EQ0A 4NW2A 3F2UA 2Q8TA 2B2UC 2J7ZA 2KVMA 2L4NA 4RAUC 2X6LA 4X3TA 1WVLA 1WTRA 4IURA 4X3KA 5E4XA 2B2YA 2B2YC 3TN2A 3KUPA 2K03A 1PLFA 1XX8A 2HDLA 2L9HA 1X32A 1DOKA 1ESRA 2KEEA 3G7LA 1WD1A 1IL8A 1ICWA 1C8CA 1WD0A 1SAPA 2RSOA 3GV3A 3UI2A 1NR2A 2EOTA 1O7YA 2B2WA 3R93A 1J9OA 1EIHA 3Q6SA 5EPKA 1GUWA 1S4ZA 1RTOA 1DOLA 2MJ8A 3I91A 4O42A 2FMMA 3P7JA 1QE6A 4ZLTF 1DONA 1HFGA 1LV9A 1NAPA 1F9QA 1F2LA 1NR4A 2M2LA 2VXWA 5D14A 2JP1A 1X3QA 1G6ZA 4XT1B 1WTWA 1BO0A 2K05A 2K01A 1ILQA 5AFWA 4R9WA 1J8IA 2X6GA 2HCIA 5EKIA 4MN3A 3KBXA 2EE1A 5E4WC 2R3ZA 3I8ZA 1ML0D 1KNAA 1RODA 1A15A 2EPBA 2NWGA 2RA4A 4ZKCB 5JJZA 1RHPA 5CMDA 2RSNA 1MSHA 1U4RA 2FHTA 2HCCA 1HA6A 4CJ1B 1NCVA 1IKMA 3H91A 4HAEA 5CORA 1B2TA 4QUFA 2MGSA 2B2WC 1AP0A 3LWEA 4HEDA 4U68A 1G2SA 2KUMA 2K04A 1HFNA 4MHEA 1PFMA 2KEDA 3I3CA 4XDXA 1O80A 1XYIA 1B50A 1HHVA 1HUMA 1M8AA 3IL8A 2HDMA 1O7ZA 1KNEA 2FFKB 2NZ1D 1E0BA 3ONAB 2RVLA 3DEPA 4IUVA 1PFNA 1MGSA 2D9UA 5T1GA 1CA6A 1HRJA 1MI2A 1MSGA 2N88A 4RWSC 5EPLA 1AZPA 4IUQA 1B4OA 1VMPA 1VMCA 4IUTA 1WTXA 1DZ1A 2K1BA 3I90A 4LMQD 1EOTA 1U4LA 1JE4A 3DM1A 1B3AA 1SSOA 4IUPA 4OIJA 1BNZA 4OIKA 2N55A 4CJ0B 4XT3B 3D6WA 4ZAIA 5CBEE 4X3UA 1WTVA 2K28A 4X3SA 3FPUB 1BF4A 4HCSA 1WTOA 2KOLA 1G2TA 2DY8A 2NYZD 1U4PA 1EL0A 2XIWA 1QNKA 1X3PA 1RTNA 2DY7A 2BDNA 1WTQA 5EPJA 1DOMA 1CM9A 1PDQA 2B2TA 2MPMA 1F9SA 2B2UA 3MWYW 1PFBA 2Q8RE 2L11A 5EJWA 1BBXC 2B2VA 2B2VC 2FINB 2H1EA 1G91A 1RJTA 5COYA
chains in the Genus database with same CATH superfamily
3Q0AA 1IYVA 4DKAC 2B63H 2CWPA 1JMCA 5KRUA 3GTQB 2F0OA 2UUAQ 1ZXTA 3MC0B 4ALPA 3S2HH 4NKLA 1H9JA 4A3IB 4ZK9B 4IFDG 4P71A 1HNZL 4XQJA 1I4HA 3MXNB 3EA6A 3GTJH 4B3TQ 4OO1G 4ZKBB 1VF7A 3KF6A 1VDZA 3RUZA 1UNSA 4WJ3M 1I50H 2EXDA 4R4IA 4A3FG 2PZWA 3S14B 4A3GG 4NW2A 1NMGA 3VA7A 3B6YA 4KKTA 2B2YC 1TWHB 4RCNA 5C6AA 5FJ8H 2YU9B 3M4PA 4DAYB 1JWMD 5C0XI 1EY5A 1IL8A 2F0HA 2J0TD 2RKSA 3UI2A 1JC7A 2EOTA 3T4AC 1J9OA 2A5HA 1EQRA 2K52A 2WB1G 5IT9c 3WWVA 2F0GA 1T9HA 3S17B 3HOVH 3G6EA 2R61A 1PA6A 4DK6C 4M8AA 2CW0D 1FNUA 4IFDJ 1R4QB 1BUVT 1C9OA 3HOXG 3A8IE 3J81j 3K57A 2A6HD 3WDNA 3CC4A 2Z6KC 1YHBA 5TSSA 4UPAA 4KTAA 4GKJL 2CH4W 1QUQB 3AFPA 4LF5Q 5JJKA 3A56A 4G4KA 5K36H 1A2UA 1TY2A 3CCLA 4KHVA 5KIXA 1CTMA 2ZTEA 4TVAB 4GNXC 3OPOA 4R4OA 3WOFA 2WB1B 1K8GA 5H1SE 5BR8L 4DV7L 4HTHA 4BXXH 4A3JB 2EY5A 3HS0C 4OIJA 4IUPA 2K50A 3CHBD 1ZKOA 2F3WA 1V1PB 3ND8A 4A3EG 4PZ6A 3H0GH 3AEVA 1G6PA 5GROA 1X3PA 1O78A 5EPJA 5CV8A 5CV6A 4DR1L 3A74A 1NBWA 4ZUJA 2F0EA 2QDLA 1BBXC 4N9TA 1HA5A 4BA2I 5C44H 5ELNA 1PH2A 1HNXQ 2E2HB 1STHA 1CQFA 1H9SB 2R7ZH 4K8JA 2LS01 2R93B 1YNNC 2F0VA 1XMQQ 1UE5A 2A68D 1ESFA 4JI8L 5C0XH 3CU7A 1B8AA 1A3TA 3HOUB 2X69A 3R8BA 2B8FA 3VDYA 4GZYC 5FO8B 4LF7L 4OO1I 1SE8A 2DJGC 5E4XA 3T13A 1IZ6A 3CRKC 3ERSX 3A0JA 1QILA 1WCMB 1TY0A 2UUBQ 1RD9D 4F7XA 4A4IA 3J80E 4J8QA 4DR5L 3QJYA 1KDCA 2L0CA 1TWAH 3I91A 1EY8A 4O42A 5KYLA 4ZLTF 1N33Q 2M2LA 1F2LA 1WI5A 4DV1L 4XT1B 4A75A 4EVOA 2A69D 1XNRQ 5C5MA 5C5LA 1JR0D 2X6GA 1Q12A 4JW0A 5M3MG 2R3ZA 5E7NA 1YJNA 2IJ0A 1FGBD 4HIOA 2B39A 3S1NB 1HA6A 1J6QA 1TIID 1TWCH 1X3FA 4HIKA 3GTQH 1AEXA 1AP0A 3BG3A 3LWEA 1STYA 1HNZQ 4JK1C 4A3IH 5IYDG 5M5YB 4OGQC 4MHEA 4K5WA 4A3KG 1H95A 2VY3A 4EQ5A 3HEJA 3J81i 1JE5A 2NB0A 4UHVA 4MZ9A 3KLWA 2K5WA 1EU4A 1MGSA 2PNRC 3EIVA 2JA5G 4APVA 1SNOA 3Q22A 3TEHB 2A6ED 1TWHH 4L5RC 2YU9H 1D8LA 3M4OH 1D1KA 5M3MB 1ASZA 1SR3A 2PZUA 4DF7A 4DV3L 1E1OA 1S5BD 3MWYW 1PFBA 3URYA 1VQHA 1ENFA 3S17H 2MO0A 2IHEA 4A3KB 1D6EC 4YY3L 2NVTB 1K8OA 2GA4B 2EYLA 1SDFA 4OO1H 3FMCA 4ZUIA 4CDFC 1K0RA 1I4PA 4C2MB 2N78A 5IP7G 4GKKQ 2R6GA 1D2BA 4NP5A 3HOYB 5M5XB 3U58A 2B29A 1UE1A 4DXFA 4JI4Q 1GUSA 3RMHA 3ND9A 1YEZA 2IT1A 1X65A 1STBA 5ELBA 1XNQL 2N8NA 4LUOA 2EYOA 3SE0A 2RBMA 2EQSA 2ZM6L 1HH2P 1A3UA 3A8KE 1W3SA 4UP9A 2UUCL 3CAMA 4B08A 1XX8A 2HDLA 1NY4A 2AUKA 3Q24A 4A3MG 1LLRD 1GM5A 1SMYD 1TWGB 4A3JH 2RCNA 3BDOA 4N8FA 1NR2A 4OELB 1QVFA 1SN8A 2F03A 1DOLA 2MUYA 1YJWA 1CKNA 3IFTA 4QB4A 4KD3A 4LFCQ 4NXML 2QILA 1X54A 3H6MA 5C4ZA 3ITPA 3RLFA 4MN3A 3TBIB 4AQYL 2R92B 2EPBA 2NWGA 3K80C 4DV6L 3S1MB 2QW7A 1I4RA 1VQFA 1PV4A 3HZXA 2E2HH 4QGUA 3KDFA 1HR0Q 2BA1A 2G9HD 1A0IA 2R7DA 4KMUC 4U68A 1X55A 1AH9A 2R93H 3E9HA 1BBUA 3I3CA 1J5EQ 4LF9L 4DK0A 2YV5A 3IL8A 1TXYA 3FKIB 3HOUH 2Q2TA 5KNDA 5GAHC 2RDGA 5D3IB 4RWSC 5I6WA 4A3EH 4X65Q 2CQOA 4X66L 2HHHQ 4BY7G 2L15A 1B1ZA 1WCMH 1L1OB 1YNJD 3OOCA 2XSCA 4ME3A 2UU9L 1LUZA 1Y1VG 3A7AB 2WFWA 5CV9A 1BCPF 1QNKA 4K6DA 4CDCC 2EY6A 2BE5C 2VQEL 1Y69U 2IX3A 2F0WA 5DLQE 3MXGA 1OXUA 3Q23A 4OL7A 4TQUS 3NELA 4RHRA 2JYOA 2K14A 3HOZG 1BCPC 3DMUA 3AB9A 4JI1L 3IFDA 4L5SA 1F9PA 2SDFA 2E8GA 2YTVA 4JBMA 5G3LF 3S1NH 5I2YA 1K0SA 4R4CA 2F0JA 1U4MA 1QWYA 4BY7B 1JWUD 3SGIA 1QZHA 1L2FA 1TVXA 4I7ZC 5J1ZA 1EZ6A 5M5YH 1EWCA 5EQ0A 5EAYA 2VQFL 3SXHA 4UP7A 3KF8A 4YCWA 5CC4A 2L9HA 1KDAA 3SEBA 4LK1C 3BZCA 2AKWB 3E0EA 1KAWA 5JVH3 1EWIA 3JAME 3ICEA 4DR6Q 4NXNQ 1C48A 3IKJA 1ENCA 4B3MQ 2Z1CA 3HOZB 2B63G 4X64L 3HKZE 1DONA 5D14A 5M3MH 1JQYD 1KLUD 3NBHB 1G6ZA 2JA8G 2ALYB 5ELCA 1W6KA 1HZCA 5AFWA 3M9BA 4HMJA 5AJ3L 1PH3A 3NQTA 3I8ZA 3G48A 3CCMA 4HJAA 1OXVA 4JOIC 5FLXc 4A3KH 2NVTH 4JYAQ 1KAAA 5A2QL 4GLAC 3TQYA 1TS2A 5CORA 3SK6A 4C2MH 3D6CA 3HOYH 1II3A 1R9TB 1HHVA 1O80A 5ELDA 3K5NA 2WIIB 2CFMA 1O7ZA 1KNEA 2Z4HA 1I6HB 1YJ9A 1HRJA 1YNXA 5JJIA 5EPLA 4A3LG 5I4DA 4KY7A 3RZDB 1EOTA 2UUAL 3HOVG 3KJOA 4KK7A 3KYHC 4POGA 1Q8IA 3FPUB 2Y0SE 1I6VC 1RIPA 1WTHA 4B3TL 2NZHA 1CHQD 1TWGH 4GOPB 1U4PA 2KA7A 1DYQA 3GP7A 3PQIA 4JI7Q 2SEBD 4DV5L 4A3DB 2JA7B 4LF6Q 2I5HA 2JXMB 1GHJA 2EXZA 1LTRD 1Q1BA 1RJTA 4FF2A 2WAQE 1IKLA 3TP6A 1KC8C 1KRSA 1HNWL 2FJ2A 2PI2A 3KF6B 4GN5A 3AMUA 2R92H 1H9KA 3S1MH 1LTBD 2RHSB 4RA8A 1KABA 4BXXG 1CZWA 3FDTA 1GO3E 2EDGA 1EY4A 1NTGA 1GUOA 3NTIA 4OEMB 4RCOA 4LF9Q 5ELEA 3F2UA 2L4NA 4H0LC 3SDZA 2XWJB 3D4DA 1HQRD 1LACA 2I07B 3FKIH 4KLKA 5IT9E 3TSSA 1SEBD 1B9MA 1ESRA 3GTPB 4IQZA 1SMYC 2Z6KA 4X66Q 2AQ1B 1ZEQX 3TP7A 3A7LA 1L0WA 3GTMB 1PZID 4DR7Q 1YNND 2QGQA 4HIDA 3FHWA 4LF5L 4ZRZA 2ZJPA 2UU9Q 3K58A 1NAPA 2ICEC 3N6RA 4TSSA 4GNXA 1HZBA 4KKUA 2CWAA 3BDCA 4O0AA 4UY8C 3PIP3 4ZKCB 1RODA 2F0PA 1RKNA 1GKHA 4A93B 2GN5A 1FVIA 3CCRA 5IYCG 3F2CA 5CR3A 1YHQA 1EFWA 1X9NA 1PYBA 2LY7A 1M8AA 3S16B 4BY7H 4Y7NH 3L0OA 3CC7A 1MI2A 1Y1WB 4RGMA 1HNXL 2ZXPA 4IUQA 2K1BA 1B3AA 1Y1VH 4YCUA 2OQ0A 2PO4A 5KYIA 2UXBQ 4DAMA 1XMQL 1EEFD 4X3SA 1DXMA 4QMGA 5IOCA 3GTLH 1E22A 2DY8A 2NYZD 4PQXA 2O4XA 2EJGC 2DY7A 5C0XJ 1EOVA 4DAPA 3HOZH 1S5DD 1SYGA 2AUJD 1G91A 4A3BB 5M3FG 4JI6Q 2OCEA 4V190 2YYZA 2OTLA 2QA4A 1U9RA 5CV4A 3VR4A 4HSVA 1OXSC 2JK8A 3DEOA 4BBSB 4ZQ3A 2CKZB 3F2DA 1NE3A 1N33L 4QY7A 3KBGA 3L9AX 2KECA 4EQOA 1XNRL 1CFMA 4H02A 2B2UC 1LTTD 2PQEA 1R9TH 1K3RA 2Z6BA 2C9OA 1I6HH 4QL5A 1IW7C 1PFSA 1K83B 4RGNA 5IP9H 1HR0W 3G7LA 4Q0FA 2ZJQA 1WD1A 3AU7A 1A3VA 1SAPA 3RD4A 4FF4A 1E2VA 5M3FB 1QVGA 2JA8H 1XJVA 3J7AF 3UDGA 1T5XD 1EIFA 1RTOA 2UXCQ 4FXGC 1EU3A 1UAPA 4PZ8A 1X3QA 1MKHA 4DV5Q 1L0YB 3A55A 2ICIA 4A3DH 1LTLA 2JA7H 4ILWA 3DUZA 3K5LA 4DUYL 3H15A 2F0SA 3OMCA 2OT2A 1Q82C 1STEA 1YI2A 1B44D 1HNWQ 2E2IB 1Q86C 1OXXK 3K0YA 1EY6A 4FYDA 1VQCA 2KBNA 4DPGA 4A3LH 3S2DH 1EQQA 2Z0SA 2FMCA 2I5LX 4A3JG 2HT1A 2ZJRA 3I4LA 2LXKA 1SE2A 4C56C 4UP8A 2K5QA 5C3EB 4IALA 3J80L 1KD1C 3BYYB 2XWBB 4GKKL 1GOZA 4B9XA 3D6WA 1YBYA 4YIJA 1IBKQ 2P5ZX 2QEJC 4JI4L 3CXCA 3G6JB 2EYFA 5LHY1 1RTNA 5HY6A 5JOBA 3TS2A 3U9OA 1L1OC 3MXPA 5IE8A 2Q8RE 1TKWB 5FO7B 2B2VA 2FINB 1LTGD 4RGOS 2F0KA 5COYA 3J7AV 2CQAA 2R93G 5JAVA 3A5UA 2EYJA 2IX1A 1QCBD 4QCLA 4LF4Q 5DNFA 3N52A 3HOUG 2HUGA 4R8IA 3W3AA 4R1JA 1CK1A 3W5OA 1S72A 4YCVA 1SNPA 2L5TA 4BA1I 1UWVA 5CBAE 3EQLC 3NSWA 3W1GA 3MTSA 3PGZA 2IL8A 4LFCL 1PRTB 5EGTA 3GDEA 1WCMG 2BE5D 3LGJA 2Q8TA 4FXDA 2PW5A 4OWTB 3BYTB 3HGBA 2K03A 3S16H 1PLFA 4AYBE 1S5CD 1Y1WH 1RF2D 1BCPD 4YHHQ 1CKNB 1SYCA 1HR0L 4ULLA 3NQIA 5ELFA 2NVYB 1UE6A 2XGTA 3K81C 2ASBA 1M90C 3CMAA 4MIUA 1J5EL 2EIFA 2M9VA 1HFGA 2XTIA 4PV1C 4LNQA 1KXLA 4KD4A 1JOQA 1LT4D 1J8IA 1ILQA 4ZCKA 3BZKA 4X65L 3KDFB 1Y8NB 2HCIA 4XYQA 5C4JB 5IYCH 5G3LD 1ML0D 1YITA 2HHHL 3I7FA 4IZ8A 5A35A 5KNCA 4A3BH 2LMCB 4OX9Q 1VQAA 2PQAA 5M5WH 4LWCA 4B3SQ 4FF1A 1DGSA 1B2TA 3KLSX 3PUWA 4BBSH 4L6TB 1CHPD 1YVCA 5JEAG 1Z7TA 4K6LA 2ENBA 2HDMA 2FFKB 5IY0A 1GJXA 1SNQA 2F3IA 3VR2A 2EY2A 4L8JA 3STBC 2VW9A 3K59A 1MSGA 1DM0B 1B4OA 1SNDA 1EYGA 4BS9A 1R4PB 2EVBA 1K8AC 1EQVA 2N55A 5CBEE 1G8ZD 1K83H 1WTVA 1AFPA 4H44C 2O2LD 1CT1D 4CHTB 3PCOB 4IJHA 1HTPA 5M3FH 3KOJA 1X6OA 3MXNA 4GOPC 4LAAA 2IPKD 3HOYG 3S14H 4KN7C 1FYCA 1WTPA 3QR8A 4DUYQ 1I4GA 1HPCA 3HOWB 1VQLA 1G291 4KHPQ 2MHVA 4C3HB 3GQBA 4DR6L 4NXNL 4Y52H 3R3OA 4B3ML 2OTJA 2E2IH 1CUKA 4JI3Q 3T1HQ 3RNUA 3NEMA 1SNMA 3TP8A 1I3QB 1HQMC 3HKZB 1TU2B 4IURA 1S40A 3CQZB 4JOIA 1DOKA 2HIVA 4JYAL 3PUZA 5C3EH 4OONA 4C3IB 2K6AA 1NUCA 1NSNS 4OHJA 1CKOA 3GD7A 2Z9HA 3GTKB 3PMFA 2KHSA 3P7JA 3X3MA 4H13C 2RF4A 4JI2Q 3OWFA 5BN4A 3PIPA 1K8MA 3C2PA 4LF8L 3J81c 2R92G 5FLXE 1I4QA 1A6XA 5IGCA 5FLMG 2EE1A 2GVAA 3U50C 2DN8A 5JJZA 2PYKA 2E2JB 1RHPA 4JVZA 3C1EA 1PMRA 4CDEC 1VQ4A 2MGSA 2B2WC 3FKIG 3OHXC 2OQKA 3K0XA 3F1ZA 5C3WA 3P75A 1EUJA 1HFNA 3I72A 1D5XC 4JI7L 2Y0SB 1GXDC 1WFQA 4Z9CB 4LF6L 1JCKB 1HUMA 3J80i 5IGDA 3MAQA 1CSQA 1PTOB 3BVMA 4C3JB 3MEHA 1VMPA 1WTXA 3CKIB 3MEFA 1JE4A 3JAML 3SHLA 1JOOA 4XIGS 3FVQA 1F2YA 3LX0A 3S15B 2WAQB 1B3QA 2CH4A 2YTYA 3DHQA 2V4DA 1SLJA 4DR2Q 1RCVD 4JBWA 3G4SA 1WTQA 2NVYH 2MPMA 3W2DA 5JPMC 4KJNA 4DV2L 2ID0A 2H1EA 4DR3Q 4G57A 1SRUA 5EBDA 2B8GA 4LFAQ 1N36L 2RQXA 4KHZA 2CVRA 3HFZB 5C4JH 1D5MC 2WV6D 3SVMA 2LXJA 1PHJA 2L1BA 4DR7L 4BBRB 4DV4Q 4UDUC 4CJ2C 1LTAD 4DN4M 1TS4A 3OW2A 4QUCA 2OWOA 3S1QB 5CV5A 3ZYYX 1PH7A 1VQKA 3PIO3 4JPBW 3TS0A 1XPUA 2M00A 1TQOA 2RDFA 5IIFA 3I55A 3E9IA 4GS3A 4DAVA 4X3KA 2ZTCA 3TN2A 1SXTA 3L3OC 2WKCA 2VUMB 1U0LA 1KQSA 3SR1A 3JC66 1SYEA 3T1YL 1M1KC 2RSOA 1ASYA 1C7YA 1GUWA 2ZXRA 1Y8OB 1VCIA 4J6HA 2D62A 4HJ7A 1F9QA 5FK9C 3LNNA 4M1UB 2Q2UA 3AYHB 2F0NA 4NB3A 3D31A 1C0AA 1H9MA 4TRDA 1PH6A 2HD3A 1IW7D 4X6AH 2XN9C 1E3PA 2E76C 2UXBL 4S3SA 1X3EA 4GLVB 4KKSA 5KEEA 2DUDA 3DWPA 5EKLA 5JEAH 1EIYB 1EZ8A 2KUMA 3ULJA 4C3HH 5IP9G 4RG1A 3J7YW 2O5JC 5C4XB 2KCTA 4XDXA 1F77A 3HKSA 5IYBG 4YWMA 5IT9L 2DGYA 4KJOA 2CHBD 1Z6HA 4RGTA 3I4NB 3J7A5 1SMXA 4JI6L 1KIXA 1AZPA 5F2DA 4L5TA 3ULLA 4JBJA 4RHSA 2KCMA 2IWHA 3A54A 3CQZH 4OIKA 4XT3B 5EKKA 1D5ZC 4A76A 2XRQD 3MZ5A 2JA7G 4A3DG 2OXPA 1HCZA 2JSOA 5IGFA 4A3CH 1EL0A 1YZ6A 2N3SA 5M5XH 3RLOA 1CM9A 4G7ZC 1SE3A 3GTKH 3UDXA 1F9SA 2B2UA 4LF8Q 1QB5D 3DM3A 1HXYD 3R2IA 4LFBQ 5J3BA 3MFGA 1JB7A 4HN7A 5D65A 4IPHA 1HZAA 2E2JH 3BU2A 3I4OA 1CZGA 3F2BA 1E1TA 1EQTA 2BOSA 2UXCL 1PRTF 2FXQA 1EIGA 1MD2D 1LO5D 1O7LA 3F8TA 3CCQA 4F88A 3NK9A 1AE3A 3OTOL 3PO3B 2B2YA 2A1AA 1PRTC 1SYBA 1PTOH 4EQPA 3K6OA 4C3JH 4PNYA 3GTJB 4KI0A 3CPFA 1Z9FA 2F4VQ 3D0FA 1GUNA 2JA6B 3RZOB 2NVXB 5FLMH 2PI2E 1OXTA 4L5QA 1LV9A 3PO2B 2JN4A 1EFID 4CBVA 2WP8J 1JORA 2K05A 1FNWA 4A93G 2K5DA 3T51B 4DV2Q 1KDBA 2QF7A 4R4TA 4LJZC 1LT5D 1Y8PB 1XPOA 2Q8IB 3PUXA 3OW7A 2AQ2B 5DM73 1WYDA 1U4RA 1S5ED 3S24A 1PH8A 3M7GA 1N36Q 1MBYA 1IBKL 1N9WA 5LMNW 1IKMA 4HAEA 1ONLA 5ISRA 1Y1WG 4BBRH 2QKIC 3U4VA 2NTTA 1PFMA 3D4RA 1RDPD 3AFQA 1FGUA 4NDXA 2NZ1D 3CRLC 3S1QH 3E0JA 3ONAB 4IUVA 3DEPA 4PG3A 5T1GA 3JAMi 3RN5A 1SFOB 2NVQB 4QQBX 2F3VA 2RDHA 1U4LA 4LF4L 1SSOA 3C1FA 1V8QA 3T1YQ 3K7AB 2I5MX 1N8RC 3L2PA 1V43A 3OMGA 1YIJA 4LUZA 4K0KQ 4O2DA 4A3BG 3HG9A 1PH5A 5J39A 2MNAA 1A8VA 4PMCA 3LWUA 3VYUA 1UUPA 1JB3A 3NPPA 2IHFA 3STBD 3S1RB 4BBSG 1E24A 5IWAQ 3MA2B 2NN6I 1L0XB 4YHHL 1PH9A 1B7YB 1V1OA 2G5DA 2MP1A 2EJMA 1B53A 4AYBB 2ATWA 1PVOA 1JJCB 3CW2C 1KTKA 1JICA 2I0QA 4IO9A 5DM63 5C44B 5I2XA 3TZDA 1EY7A 2B2TC 5IGBA 2EZVA 5C4XH 1WVLA 1VQGA 3GTGB 4FO2A 4FVMA 3RLNA 3T56B 3W1BA 4DK1A 3EJIA 3I4NH 4OX9L 2KEEA 1X56A 4KV6A 5IGGA 3I73A 4B3SL 1KRTA 2GVBA 2BA0A 2K4KA 5LL6X 1VQJA 4JI0Q 1UEBA 2MJ8A 3QOJA 3TP5A 2FMMA 2QCPX 4F8MA 1KL9A 3TZUA 1NR4A 2ZXOA 2E2DC 2XNAC 1VQ6A 2RCFA 3KJPA 2K5NA 3A8JE 4LUVA 3KBXA 1EYDA 1QNUA 4I65A 1A62A 2BDOA 3QOLA 1K9MC 2A19A 4C1NI 1B70B 3RZDH 4BY1B 1TS3A 4H7BA 5IYBH 2JEBI 4XXEA 1SJED 4DV0Q 1ENAA 3VR3A 2SNSA 1IL2A 2Z8LA 4YWLA 5HGTA 4NMZA 3EFXD 5C3EG 5LMUQ 4GOPA 4HJ8A 3I4MG 2J4XA 1PFNA 1ZYRC 2G9DA 3FPPA 1SE4A 3OTOQ 1TWCB 3K7UC 1BVSA 4U673 4KHPL 1S3OA 1BOSA 3PO3H 1PTOC 1LTSD 4P2CB 3KFUA 4FF3A 3OIPA 2NN6H 1VQPA 4QIWE 4JI3L 4G7HC 3T1HL 3CCVA 4ME5A 3BS1A 1JJGA 1FJGQ 1BR9A 1DOMA 1W6JA 4P72A 3ERQA 4IOCA 2JA6H 1A63A 3VYRA 3RZOH 1JOKA 2NVXH 4K2KA 4KY6A 3TMEA 4PMWA 1DCZA 3K8AA 3PO2H 1HZ9A 3D8GA 1OO9B 2UXDL 1PYSB 2NTSA 1CI3M 3GO5A 3C3LA 3M4OB 1F9RA 1IYUA 3CF5A 2C35B 1N34Q 1GHKA 3I4MB 1XMOQ 3DLLA 1QVCA 5FKAC 3SK4A 3PIOA 1KLGD 1QG7A 3HP3A 1FNVA 1E7ZA 4ODGA 3GTPH 3M85A 4JI2L 4EGVA 3GTMH 3NWTA 1AW7A 2IX0A 1ILPA 2JA9A 5DAUA 1Q81C 2AWNA 2D0OA 2KVMA 1LM0A 1SYDA 4X3TA 4JI5Q 4A3FB 4A3GB 1PH1A 2BH2A 3R2TA 4DUZL 1KHIA 3J81E 1SFOH 2NVQH 2KQ3A 2K5VA 4RH6A 1WD0A 3IAYA 4J1MA 2LKVA 1XPRA 2D0PA 2B2WA 3KK7A 3K7AH 5L37A 4A93H 4GN4B 5I9PA 2ZTDA 3I2ZA 3NHHA 2MQHA 4JG2A 3V2TA 5EKIA 4HCEA 3E6ZX 3EVQA 3S1RH 4DR4L 2WKDA 1EY0A 1NCVA 4B3RQ 4ZYSA 4DR2L 1NNXA 4RFBA 2E75C 2PZTA 1W2BA 3HOXB 3U4ZA 5C4HA 1XWEA 1XYIA 3VA5A 1A2TA 1IBLQ 3PV0A 4DR3L 1PYWD 3AQQA 4FDBA 5FO9B 4IUTA 4LFAL 3DM1A 2K75A 3NUCA 3GTGH 3RN2A 3RR5A 2PMZE 4X3UA 2CCZA 2K28A 4R8NA 4DV4L 2MO1A 1SROA 1SBBB 2KOLA 1VQOA 3TDQA 4MTKA 5FLXL 2DNEA 2QDBA 1STGA 1GUTA 2EY1A 4CKBA 5JVG3 2BDNA 4RKBA 4IFDI 4A3EB 4E6IA 1PH4A 3D4WA 1PXUA 3EBEA 4WJ4A 4JV5L 3HOWG 4OXPA 2OF1A 5D3DA 4C3HG 5FOBB 4DXGA 1Q3LA 3VR5A 4QJFA 4CDDC 3M3YB 1O7IA 5IGEA 3CCJA 5E1FA 3DWQA 4IJLA 3QO2A 3SK8A 5K5PA 3DWAA 2H5XA 3CCEA 4BY1H 3HKZG 5LMNQ 1WOCA 2VB2X 3C46A 4DNRB 3TREA 2EYPA 4OWXB 4I7AA 1I94L 1WTRA 2X6LA 4C3IG 5HGQA 4A3CG 3KUPA 1T5EA 5CYUA 1F2ZA 4DFAA 1X32A 3SK5A 1IHZA 1VQIA 1VF5C 5JEAJ 3GTOB 4EX5A 1XTCD 1STNA 4FNFA 4DAYA 2PPBC 4NPSA 3KF8B 2VL6A 4HJ5A 3HRZC 4X62L 4R4QA 2JP1A 3E5SA 2BCOA 2AWOA 3H3VI 5E4WC 2UXDQ 2JEAI 1A15A 1PRTD 2NBFA 2RSNA 4CJ1B 2Y0SG 3VYTA 4GLXA 3TRZA 1RL2A 3FEWX 4J15A 3I4MH 3CP0A 3PF4A 1G2SA 1VQDA 2NZOA 4C3JG 1EWHA 1N32L 3QG1A 4K14A 1HTLD 1VQ8A 1I4XA 1QUQA 2N88A 4LFBL 4IFDH 2WAQG 5I6YA 1VMCA 1DZ1A 3WOEA 3I90A 1Z47A 3H09A 1BQQT 1BNZA 4DUZQ 4A3FH 2YTXA 1G51A 4A3GH 3T16A 1BF4A 2JA5B 5GQOA 4GKJQ 1Q90A 4IOAA 1EEID 2WB1E 2OEOA 5C3XA 1V1PA 2F4IA 4V0BA 3NP8A 4HIMA 2L11A 5EJWA 3D3RA 3QIAA 2B2VC 3CCUA 2LSSA 4QF4A 4CKCA 4CGYB 1MHWC 5BR8Q 4F87A 4BBRG 3K5MA 4DV7Q 1FD7D 2E5LL 4IN3A 3A5ZB 2VB3X 4EQNA 4IUUA 2A73B 4JCVE 3VR6A 1CA5A 2F4VL 1LTID 4DR4Q 2L12A 1TR5A 1I5FA 2F1MA 3QWNA 1HUNA 5KNBA 1H9SA 1TWFB 4AH6A 1FR3A 2ES2A 2VUMG 3HOXH 1LT3D 4DR1Q 1SNCA 4ID6A 2CW0C 1DD2A 3BVZA 4K2LA 3CPWA 2AHOB 3O13A 2EYHA 4XTCS 3L7ZC 4XQQA 1CQVA 2A6HC 2LFNA 1Q1EA 3H3VH 2KCNA 4XYOA 1YHAA 1C8CA 2Q2IA 4WORA 1JJ2A 3NTKA 1SJHD 4AIMA 1EIHA 3UE0A 5E3FA 1S4ZA 3CC2A 5JPNC 4A3MB 3I70A 4JI8Q 3E3XA 1VQEA 1ET9A 2VXWA 3MVVA 3NXWA 4YWKA 1WTWA 3J80c 1P16A 5GAGC 2NUCA 1BKBA 3QB3A 4LF7Q 4JV5Q 4XQNA 1QJOA 3MXUA 3BDLA 2D5DA 2VS1A 2JJQA 3ZJYC 2F0UA 3CD6A 2HQLA 4O1NA 5M9OA 5C4XG 3M3YH 3H91A 2QEXA 1TS5A 4DR5Q 2KCCA 4GNXB 4TKOB 2IY5B 3M4QA 2H4OA 3I4NG 4K0KL 2R7FA 2E74C 3NBIA 2KHIA 3PUYA 1BDOA 3UDIA 4CKEA 1VQ5A 3MFYA 4LW1A 4DV1Q 2RVLA 1CA6A 5IWAL 1I94Q 5HURA 1P8LA 2VNUD 4ZAIA 2WINB 1K73C 4FP5D 2A68C 4OWWB 3HOWH 4K5VA 1NMFA 4IPCA 4Y7NB 3GTOH 1LT6D 3NTHA 1VQMA 1V1QA 2B2TA 1JT8A 4X62Q 1M4VA 1VS0A 2PCFB 4JBKA 1Y1VB 1ZYRD 2Q2HA 1I3QH 1MIUA 2BH8A 3GTLB 1Q7YC 5I9OA 1IXRA 1MJCA 5KGUA 2JQOA 3VYSA 1E2ZA 1EYCA 1PTOD 4JI0L 3H94A 4BWGB 1MJEA 2DNCA 4C3IH 2SOBA 3PO3G 1C4QA 3V96A 1N32Q 2A69C 4DV3Q 2JE6I 4DGZA 1IBML 2NN6G 1S5FD 1DJRD 2J7ZA 1JWSD 5DEHA 4KY5A 3PF5A 2F0QA 3EROA 5LL6S 2C5CA 4PMBA 3PUVA 4YY3Q 1EYAA 5IYDH 2JA6G 2MFIA 4P73A 2F0DA 1ICWA 3PO2G 1O7YA 1B9NA 1E2WA 4DV0L 5FJ8G 1WJJA 2XVSA 4WRDA 2JA5H 3FRPB 3S9WA 1ICFB 1D7QA 4IPDA 3OYYA 5EBCA 5LMUL 1XNQQ 1BO0A 2EJFC 2HIXA 3Q8DA 3UE1A 4MTNA 4HMIA 2B63B 2ZM6Q 2I46A 3S2HB 4GN3B 2UUCQ 1H9RA 3BJUA 2RA4A 1VQ9A 2A6EC 2E5LQ 2JA8B 4DNTB 4FXKC 5CMDA 1MSHA 2FHTA 2HCCA 3P20A 3ULPA 2K32A 2WACA 4IPGA 4HEDA 1I50B 2K04A 4C1NK 3MHBA 1FJGL 2F0IA 3S15H 3V05A 2KEDA 1B50A 3OIQA 4QIWB 1TWFH 3NENA 5IP7H 1E0BA 5BN3A 4B9WA 4NXMQ 2D9UA 4N8X1 5K36G 1ET6A 2L55A 1Y14B 4LMQD 3IRBA 3KLSA 4AQYQ 4RMFA 1N34L 1XMOL 1UE7A 4DV6Q 3OSOA 4CJ0B 1GVPA 3H3VC 3S2DB 1WTOA 4P74A 3HOVB 2XIWA 3P1HA 2DJFC 1PDQA 3PSIA 1L1OA 2K5HA 1SYFA 3H0GG 1GD7A 3J7ZC 3CCSA 1VQBA 4WFN3 3BVGA 4DU9A 4A3MH 5NUCA 3DXJC 3FP9A 3K5OA 3M7NA 1V9PA 5GAEC 4JI5L 4AYBG 1QZGA 4PZ7A 1QOHA 3GV6A 1D1IA 1GUGA 1NJIC 1AZQA 4K5XA 2KHJA 4L63B 2EYMA 5C44G 2F0FA 2PNHA 5T1IA 2VUMH 1Q8KA 5J22A 1TT2A 2N49A 1OTCA 3U9SA 4UAIA 5A2QE 2A8VA 2R7ZG 1EY9A 2IW3A 2VQEQ 2VZAA 2HQEA 1PZKD 2K33A 2F0LA 4RAUC 5C0XG 1PZJD 3G71A 4DNIA 3UDFA 3H0GB 1LYLA 4JI1Q 5GADC 4B3RL 3GV3A 1X3GA 1STAA 2RHQB 4G7OC 4POFA 3R93A 2AQ3B 1VQ7A 3CMEA 4DK3C 3Q6SA 4RKLA 5EPKA 5ELOA 3EN2A 2ZT9C 4JC0A 4WJWA 1QE6A 5JJLA 1IBLL 2Z4IA 1U5KA 3JAMc 1AN8A 2K01A 4Q5VA 2VQFQ 4R9WA 2TMPA 4BY1G 4N9PA 2R7ZB 2TSSA 1BBWA 3NBHA 5CV7A 1KNAA 3BZDB 4HSPA 4P75A 3I56A 5IODA 2D2CC 4MNOA 4DA2A 1YNJC 4HR7B 3T53B 1Q46A 4QUFA 1VQNA 1XXGA 2B3GA 2PMZB 1XTDA 1CKMA 4X64Q 2O5IC 3KLRA 1LABA 1FL0A 4HJ9A 2PW7A 5CGKA 2AMCB 3OWEB 2F0TA 4A3IG 1IBMQ 3J81L 5AJ3Q 1UEAB 2A74C 2PQAB 5M5WB 2K7VA 1HJPA 2KENA 2UUBL 1AE2A 1BXTA 3NE5B 1TWAB 3X3NA 3NWSA 2F52A 1G2TA 4HCSA 4IUNA 1F2MA 2F0MA 3M4YA 4KN4C 1CSPA 3ER0A 5LMNL 5BN5A 2KJXA 2XRSD 2V1CC 1IYJB 1K3BC 4ABNA 1BCPB 1PTOF 1K28A 4K8IA 2SNMA
chains in the Genus database with same CATH topology
3Q0AA 1IYVA 5KRUA 3GTQB 2F0OA 1ZXTA 3MC0B 4NKLA 1H9JA 4A3IB 4ZK9B 4IFDG 4XQJA 1I4HA 3EA6A 4OO1G 4ZKBB 1VF7A 1VDZA 3RUZA 1UNSA 2PZWA 3S14B 4NW2A 3VA7A 4KKTA 2B2YC 1TWHB 4RCNA 5C6AA 2YU9B 1JWMD 5C0XI 1EY5A 1IL8A 2F0HA 2J0TD 2RKSA 3UI2A 1JC7A 2EOTA 3T4AC 1J9OA 2A5HA 2F0GA 3S17B 2R61A 4M8AA 2CW0D 1FNUA 4IFDJ 1R4QB 1BUVT 3A8IE 3K57A 2A6HD 3WDNA 5TSSA 4KTAA 3A56A 4G4KA 5K36H 1A2UA 1TY2A 4KHVA 5KIXA 1CTMA 3OPOA 3WOFA 2WB1B 4HTHA 4A3JB 2EY5A 3HS0C 4OIJA 4IUPA 3CHBD 1ZKOA 2F3WA 1V1PB 3ND8A 1X3PA 1O78A 5EPJA 5CV8A 5CV6A 4ZUJA 2F0EA 1BBXC 4N9TA 1HA5A 4BA2I 2E2HB 1STHA 1CQFA 1H9SB 4K8JA 2LS01 2R93B 1YNNC 2F0VA 2A68D 1ESFA 5C0XH 3CU7A 1A3TA 3HOUB 2X69A 3R8BA 2B8FA 4GZYC 5FO8B 4OO1I 5E4XA 3T13A 3CRKC 1QILA 1WCMB 1TY0A 1RD9D 4F7XA 3J80E 4J8QA 3QJYA 1KDCA 2L0CA 3I91A 1EY8A 4O42A 5KYLA 4ZLTF 2M2LA 1F2LA 4XT1B 4EVOA 2A69D 5C5MA 5C5LA 1JR0D 2X6GA 1Q12A 2R3ZA 2IJ0A 1FGBD 2B39A 3S1NB 1HA6A 1TIID 1AEXA 1AP0A 3BG3A 3LWEA 1STYA 4JK1C 5M5YB 4OGQC 4MHEA 4K5WA 3HEJA 2NB0A 2K5WA 1EU4A 1MGSA 2PNRC 1SNOA 3Q22A 2A6ED 1D1KA 5M3MB 2PZUA 4DF7A 1S5BD 3MWYW 1PFBA 3URYA 1ENFA 4A3KB 1D6EC 2NVTB 1K8OA 2GA4B 2EYLA 1SDFA 4OO1H 3FMCA 4ZUIA 1I4PA 4C2MB 2R6GA 1D2BA 4NP5A 3HOYB 5M5XB 4DXFA 1GUSA 3RMHA 3ND9A 2IT1A 1STBA 5ELBA 2EYOA 3SE0A 2RBMA 1A3UA 3A8KE 4B08A 1XX8A 2HDLA 2AUKA 3Q24A 1LLRD 1SMYD 1TWGB 3BDOA 1NR2A 2F03A 1DOLA 2MUYA 3IFTA 4QB4A 4KD3A 2QILA 3H6MA 5C4ZA 3ITPA 3RLFA 4MN3A 3TBIB 2R92B 2EPBA 2NWGA 3S1MB 1I4RA 3HZXA 2BA1A 2G9HD 4KMUC 4U68A 3I3CA 4DK0A 3IL8A 3FKIB 5KNDA 2RDGA 5D3IB 4RWSC 5I6WA 1B1ZA 1YNJD 3OOCA 2XSCA 3A7AB 5CV9A 1BCPF 1QNKA 4K6DA 2EY6A 2BE5C 1Y69U 2IX3A 2F0WA 3MXGA 1OXUA 3Q23A 4TQUS 4OL7A 4RHRA 2JYOA 1BCPC 3DMUA 3AB9A 3IFDA 1F9PA 2SDFA 5G3LF 5I2YA 2F0JA 1U4MA 1QWYA 4BY7B 1JWUD 1TVXA 5J1ZA 4I7ZC 1EZ6A 1EWCA 5EQ0A 3SXHA 3KF8A 5CC4A 2L9HA 1KDAA 3SEBA 4LK1C 5JVH3 3JAME 1C48A 3IKJA 1ENCA 2Z1CA 3HOZB 1DONA 5D14A 1JQYD 1KLUD 1G6ZA 5ELCA 1W6KA 5AFWA 4HMJA 3NQTA 3I8ZA 1OXVA 1KAAA 5A2QL 1TS2A 5CORA 3SK6A 3D6CA 1II3A 1R9TB 1HHVA 1O80A 5ELDA 3K5NA 2WIIB 1O7ZA 1KNEA 2Z4HA 1I6HB 1HRJA 5EPLA 5I4DA 4KY7A 3RZDB 1EOTA 4KK7A 1Q8IA 3FPUB 1I6VC 1CHQD 1U4PA 2KA7A 1DYQA 3GP7A 2SEBD 4A3DB 2JA7B 2JXMB 1GHJA 2EXZA 1LTRD 1Q1BA 1RJTA 4FF2A 1IKLA 3TP6A 2FJ2A 3AMUA 1H9KA 1LTBD 4RA8A 1KABA 1CZWA 3FDTA 2EDGA 1EY4A 1GUOA 3NTIA 4RCOA 5ELEA 3F2UA 2L4NA 4H0LC 3SDZA 2XWJB 3D4DA 1HQRD 1LACA 2I07B 5IT9E 3TSSA 1SEBD 1B9MA 1ESRA 3GTPB 4IQZA 1SMYC 2AQ1B 1ZEQX 3TP7A 3A7LA 3GTMB 1PZID 1YNND 4ZRZA 3K58A 1NAPA 2ICEC 3N6RA 4TSSA 4KKUA 3BDCA 3PIP3 4ZKCB 1RODA 2F0PA 1RKNA 4A93B 5CR3A 2LY7A 1M8AA 3S16B 1MI2A 1Y1WB 4RGMA 2ZXPA 4IUQA 2K1BA 1B3AA 2PO4A 5KYIA 1EEFD 4X3SA 1DXMA 4QMGA 5IOCA 2DY8A 2NYZD 4PQXA 2O4XA 2EJGC 2DY7A 5C0XJ 4DAPA 1S5DD 1SYGA 2AUJD 1G91A 4A3BB 4V190 2YYZA 1U9RA 5CV4A 3VR4A 4HSVA 1OXSC 3DEOA 4BBSB 4ZQ3A 3KBGA 3L9AX 2KECA 4EQOA 1CFMA 2B2UC 1LTTD 2PQEA 2C9OA 1IW7C 1K83B 4RGNA 3G7LA 4Q0FA 1WD1A 3AU7A 1A3VA 1SAPA 3RD4A 4FF4A 1E2VA 5M3FB 3J7AF 1T5XD 1RTOA 4FXGC 1EU3A 1UAPA 1X3QA 1L0YB 3A55A 2ICIA 4ILWA 3DUZA 3K5LA 2F0SA 3OMCA 2OT2A 1STEA 1B44D 2E2IB 1OXXK 3K0YA 1EY6A 4FYDA 2FMCA 3I4LA 1SE2A 4C56C 2K5QA 5C3EB 4IALA 3J80L 3BYYB 2XWBB 1GOZA 4B9XA 3D6WA 4YIJA 2QEJC 3G6JB 2EYFA 5LHY1 1RTNA 5JOBA 3U9OA 3MXPA 2Q8RE 1TKWB 5FO7B 2B2VA 2FINB 1LTGD 4RGOS 2F0KA 5COYA 3J7AV 2CQAA 5JAVA 2EYJA 2IX1A 1QCBD 4QCLA 5DNFA 3N52A 2HUGA 4R8IA 3W3AA 1CK1A 1SNPA 2L5TA 4BA1I 5CBAE 3EQLC 3NSWA 3MTSA 2IL8A 1PRTB 5EGTA 2BE5D 4FXDA 2Q8TA 2PW5A 3BYTB 3HGBA 2K03A 1PLFA 1S5CD 1RF2D 1BCPD 1SYCA 4ULLA 3NQIA 5ELFA 2NVYB 4MIUA 2M9VA 1HFGA 4PV1C 4KD4A 1JOQA 1LT4D 1J8IA 1ILQA 1Y8NB 2HCIA 4XYQA 5C4JB 5G3LD 1ML0D 5KNCA 4IZ8A 5A35A 2LMCB 4FF1A 1B2TA 3KLSX 3PUWA 4L6TB 1CHPD 5JEAG 1Z7TA 4K6LA 2ENBA 2HDMA 2FFKB 1GJXA 1SNQA 3VR2A 2EY2A 4L8JA 3K59A 1MSGA 1DM0B 1B4OA 1SNDA 4BS9A 1R4PB 2EVBA 1EQVA 2N55A 5CBEE 1G8ZD 1WTVA 1AFPA 4H44C 2O2LD 1CT1D 4CHTB 1HTPA 3MXNA 4LAAA 2IPKD 4KN7C 1FYCA 1WTPA 1I4GA 1HPCA 3HOWB 1G291 2MHVA 4C3HB 3GQBA 3R3OA 1SNMA 3TP8A 1I3QB 1HQMC 3HKZB 1TU2B 4IURA 3CQZB 1DOKA 3PUZA 4C3IB 2K6AA 1NUCA 1NSNS 4OHJA 3GD7A 3GTKB 3PMFA 2KHSA 3P7JA 3X3MA 4H13C 3C2PA 3OWFA 5BN4A 1K8MA 5FLXE 1I4QA 1A6XA 5IGCA 2EE1A 2DN8A 5JJZA 2PYKA 2E2JB 1RHPA 3C1EA 1PMRA 2MGSA 2B2WC 3OHXC 5C3WA 3P75A 1HFNA 3I72A 1D5XC 2Y0SB 1GXDC 4Z9CB 1JCKB 1HUMA 5IGDA 3MAQA 1PTOB 3BVMA 4C3JB 3MEHA 1VMPA 1WTXA 3CKIB 1JE4A 3JAML 3SHLA 1JOOA 4XIGS 3FVQA 1F2YA 3LX0A 3S15B 2WAQB 3DHQA 2V4DA 1RCVD 4JBWA 1WTQA 2MPMA 3W2DA 5JPMC 4KJNA 2ID0A 2H1EA 4G57A 5EBDA 2B8GA 2RQXA 4KHZA 2CVRA 1D5MC 2WV6D 3SVMA 2L1BA 4BBRB 4UDUC 4CJ2C 1LTAD 4DN4M 1TS4A 3S1QB 4QUCA 5CV5A 3ZYYX 3PIO3 2M00A 1TQOA 2RDFA 5IIFA 4DAVA 4X3KA 3TN2A 1SXTA 3L3OC 2WKCA 2VUMB 3SR1A 1SYEA 2RSOA 1GUWA 2ZXRA 1Y8OB 1VCIA 4J6HA 2D62A 1F9QA 5FK9C 3LNNA 4M1UB 2F0NA 3D31A 1H9MA 4TRDA 1IW7D 2XN9C 2E76C 4S3SA 4KKSA 5KEEA 3DWPA 5EKLA 5JEAH 1EZ8A 2KUMA 3J7YW 2O5JC 5C4XB 4XDXA 1F77A 5IT9L 4KJOA 2CHBD 1Z6HA 4RGTA 3I4NB 1AZPA 5F2DA 4RHSA 2IWHA 3A54A 4OIKA 4XT3B 5EKKA 1D5ZC 2XRQD 3MZ5A 2OXPA 1HCZA 2JSOA 5IGFA 1EL0A 1CM9A 4G7ZC 1SE3A 1F9SA 2B2UA 1QB5D 1HXYD 3R2IA 3MFGA 4HN7A 5D65A 1CZGA 1EQTA 2BOSA 1PRTF 1EIGA 1MD2D 1LO5D 1O7LA 4F88A 3NK9A 3PO3B 2B2YA 1PRTC 1SYBA 1PTOH 4EQPA 3K6OA 4PNYA 3GTJB 4KI0A 1GUNA 2JA6B 3RZOB 2NVXB 1OXTA 1LV9A 3PO2B 1EFID 4CBVA 2WP8J 1JORA 2K05A 1FNWA 2K5DA 3T51B 1KDBA 2QF7A 4LJZC 1LT5D 1Y8PB 2Q8IB 3PUXA 3OW7A 2AQ2B 5DM73 1U4RA 1S5ED 3M7GA 1MBYA 1IKMA 4HAEA 1ONLA 5ISRA 2QKIC 2NTTA 1PFMA 3D4RA 1RDPD 4NDXA 2NZ1D 3CRLC 3E0JA 3ONAB 4IUVA 3DEPA 5T1GA 1SFOB 2NVQB 2F3VA 2RDHA 1U4LA 1SSOA 3C1FA 1V8QA 3K7AB 1V43A 3OMGA 3HG9A 5J39A 4PMCA 3LWUA 3VYUA 1UUPA 1JB3A 3NPPA 3S1RB 3MA2B 2NN6I 1L0XB 1V1OA 2MP1A 2EJMA 1B53A 4AYBB 1KTKA 1JICA 5DM63 5C44B 5I2XA 3TZDA 1EY7A 2B2TC 5IGBA 2EZVA 1WVLA 3GTGB 4FO2A 4FVMA 3T56B 4DK1A 3EJIA 2KEEA 4KV6A 5IGGA 3I73A 2BA0A 5LL6X 2MJ8A 3QOJA 3TP5A 2FMMA 2QCPX 4F8MA 3TZUA 1NR4A 2ZXOA 2E2DC 2XNAC 3A8JE 3KBXA 1EYDA 1QNUA 4I65A 2BDOA 3QOLA 4C1NI 4BY1B 1TS3A 4H7BA 2JEBI 4XXEA 1SJED 1ENAA 3VR3A 2SNSA 2Z8LA 5HGTA 4NMZA 3EFXD 2J4XA 1PFNA 1ZYRC 2G9DA 3FPPA 1SE4A 1TWCB 4U673 1BOSA 1PTOC 1LTSD 4P2CB 4FF3A 3OIPA 2NN6H 4G7HC 4ME5A 3BS1A 1BR9A 1DOMA 1W6JA 3ERQA 3VYRA 1JOKA 4K2KA 4KY6A 3TMEA 4PMWA 1DCZA 3D8GA 1OO9B 2NTSA 1CI3M 3GO5A 3C3LA 3M4OB 1F9RA 1IYUA 1GHKA 3I4MB 5FKAC 3SK4A 1KLGD 1QG7A 3HP3A 1FNVA 4ODGA 3M85A 4EGVA 3NWTA 1AW7A 2IX0A 1ILPA 5DAUA 2AWNA 2KVMA 1SYDA 4X3TA 4A3FB 4A3GB 3R2TA 3J81E 2KQ3A 4RH6A 3IAYA 1WD0A 4J1MA 2LKVA 2B2WA 3KK7A 5I9PA 3NHHA 3V2TA 5EKIA 4HCEA 3E6ZX 3EVQA 2WKDA 1EY0A 1NCVA 4ZYSA 4RFBA 2E75C 2PZTA 3HOXB 5C4HA 1XWEA 1XYIA 3VA5A 1A2TA 3PV0A 1PYWD 5FO9B 4IUTA 3DM1A 3NUCA 4X3UA 2K28A 4R8NA 2KOLA 1SBBB 3TDQA 5FLXL 2DNEA 2QDBA 1STGA 1GUTA 2EY1A 4CKBA 5JVG3 2BDNA 4RKBA 4IFDI 4A3EB 4E6IA 3D4WA 1PXUA 2OF1A 5D3DA 4C3HG 5FOBB 4DXGA 1Q3LA 3VR5A 3M3YB 5IGEA 5E1FA 3DWQA 3QO2A 3SK8A 5K5PA 3DWAA 2VB2X 3C46A 4DNRB 2EYPA 1WTRA 2X6LA 4C3IG 3KUPA 1T5EA 5CYUA 1F2ZA 4DFAA 1X32A 3SK5A 1IHZA 1VF5C 5JEAJ 3GTOB 1XTCD 1STNA 4FNFA 4DAYA 2PPBC 3HRZC 2JP1A 3E5SA 2BCOA 2AWOA 5E4WC 2JEAI 1A15A 1PRTD 2NBFA 2RSNA 4CJ1B 3VYTA 3FEWX 1G2SA 4C3JG 1EWHA 3QG1A 4K14A 1HTLD 1I4XA 2N88A 4IFDH 5I6YA 1VMCA 1DZ1A 3WOEA 3I90A 1Z47A 3H09A 1BQQT 1BNZA 3T16A 1BF4A 2JA5B 1Q90A 1EEID 2OEOA 5C3XA 1V1PA 2F4IA 4V0BA 3NP8A 2L11A 5EJWA 3D3RA 3QIAA 2B2VC 4QF4A 4CKCA 4CGYB 4F87A 3K5MA 1FD7D 4IN3A 2VB3X 4EQNA 4IUUA 2A73B 3VR6A 1CA5A 1LTID 2L12A 1TR5A 2F1MA 3QWNA 1HUNA 5KNBA 1H9SA 1TWFB 1FR3A 1LT3D 1SNCA 4ID6A 2CW0C 1DD2A 3BVZA 4K2LA 3O13A 2EYHA 4XTCS 3L7ZC 4XQQA 1CQVA 2A6HC 2LFNA 1Q1EA 2KCNA 4XYOA 1C8CA 4WORA 3NTKA 1SJHD 1EIHA 5E3FA 1S4ZA 5JPNC 4A3MB 3I70A 1ET9A 2VXWA 3MVVA 3NXWA 1WTWA 2NUCA 3QB3A 4XQNA 1QJOA 3MXUA 3BDLA 2D5DA 2F0UA 4O1NA 5M9OA 3H91A 1TS5A 2KCCA 4TKOB 2H4OA 2E74C 3NBIA 3PUYA 1BDOA 4CKEA 3MFYA 2RVLA 1CA6A 5HURA 2VNUD 4ZAIA 2WINB 4FP5D 2A68C 4K5VA 4Y7NB 1LT6D 3NTHA 2B2TA 1M4VA 2PCFB 1Y1VB 1ZYRD 3GTLB 5I9OA 5KGUA 3VYSA 1E2ZA 1EYCA 1PTOD 3H94A 4BWGB 2DNCA 2SOBA 1C4QA 3V96A 2A69C 2JE6I 4DGZA 2NN6G 1S5FD 1DJRD 2J7ZA 1JWSD 5DEHA 4KY5A 2F0QA 3EROA 5LL6S 2C5CA 4PMBA 3PUVA 1EYAA 2F0DA 1ICWA 1O7YA 1B9NA 1E2WA 2XVSA 4WRDA 3FRPB 3S9WA 5EBCA 1BO0A 2EJFC 4HMIA 2B63B 2I46A 3S2HB 1H9RA 2RA4A 2A6EC 2JA8B 4DNTB 4FXKC 5CMDA 1MSHA 2FHTA 2HCCA 3P20A 2K32A 2WACA 4HEDA 1I50B 2K04A 4C1NK 3MHBA 2F0IA 3V05A 2KEDA 1B50A 3OIQA 4QIWB 1E0BA 5BN3A 4B9WA 2D9UA 5K36G 1ET6A 2L55A 4LMQD 3KLSA 3OSOA 4CJ0B 3H3VC 3S2DB 1WTOA 3HOVB 2XIWA 3P1HA 1PDQA 1SYFA 4WFN3 3BVGA 4DU9A 5NUCA 3DXJC 3K5OA 3M7NA 1QOHA 3GV6A 1D1IA 1GUGA 1AZQA 4K5XA 4L63B 2EYMA 2F0FA 5T1IA 5J22A 1TT2A 3U9SA 4UAIA 5A2QE 1EY9A 2IW3A 2HQEA 1PZKD 2K33A 2F0LA 4RAUC 5C0XG 1PZJD 3H0GB 3GV3A 1STAA 4G7OC 3R93A 2AQ3B 3Q6SA 4RKLA 5EPKA 2ZT9C 4WJWA 1QE6A 2Z4IA 1AN8A 2K01A 4Q5VA 4R9WA 2TMPA 4N9PA 2R7ZB 2TSSA 3NBHA 5CV7A 1KNAA 3BZDB 4HSPA 5IODA 2D2CC 4DA2A 1YNJC 4HR7B 3T53B 4QUFA 1XXGA 2PMZB 2O5IC 3KLRA 1LABA 2PW7A 5CGKA 3OWEB 2F0TA 3J81L 1UEAB 2A74C 5M5WB 2K7VA 1BXTA 3NE5B 1TWAB 3X3NA 3NWSA 1G2TA 4HCSA 4IUNA 1F2MA 2F0MA 3M4YA 4KN4C 5BN5A 2KJXA 2XRSD 4ABNA 1BCPB 1PTOF 4K8IA 2SNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV6 A;  1Q3L A;  1WTP A;  2JYO A;  1IKL A;  1SDF A;  1F9R A;  2FJ2 A;  1ZXT A;  3IFD A;  2CVR A;  3N52 A;  5DNF A;  1AZQ A;  5D65 A;  2HUG A;  2MP1 A;  3SVM A;  4HSV A;  4R8I A;  1F9P A;  2SDF A;  3QO2 A;  2L1B A;  1B53 A;  4IUU A;  1CA5 A;  5T1I A;  1QG7 A;  3DEO A;  4ZK9 B;  2L12 A;  3HP3 A;  4RA8 A;  4CJ2 C;  4DN4 M;  1EQT A;  3FDT A;  1HUN A;  4UAI A;  5CBA E;  4ZKB B;  1JIC A;  3MTS A;  4QUC A;  1EIG A;  1U4M A;  2X69 A;  2IL8 A;  1TVX A;  3TZD A;  2KEC A;  2B2T C;  1ILP A;  5EQ0 A;  4NW2 A;  3F2U A;  2Q8T A;  2B2U C;  2J7Z A;  2KVM A;  2L4N A;  4RAU C;  2X6L A;  4X3T A;  1WVL A;  1WTR A;  4IUR A;  4X3K A;  5E4X A;  2B2Y A;  2B2Y C;  3TN2 A;  3KUP A;  2K03 A;  1PLF A;  1XX8 A;  2HDL A;  2L9H A;  1X32 A;  1DOK A;  1ESR A;  2KEE A;  3G7L A;  1WD1 A;  1IL8 A;  1ICW A;  1C8C A;  1WD0 A;  1SAP A;  2RSO A;  3GV3 A;  3UI2 A;  1NR2 A;  2EOT A;  1O7Y A;  2B2W A;  3R93 A;  1J9O A;  1EIH A;  3Q6S A;  5EPK A;  1GUW A;  1S4Z A;  1RTO A;  1DOL A;  2MJ8 A;  3I91 A;  4O42 A;  2FMM A;  3P7J A;  1QE6 A;  4ZLT F;  1DON A;  1HFG A;  1LV9 A;  1NAP A;  1F9Q A;  1F2L A;  1NR4 A;  2M2L A;  2VXW A;  5D14 A;  2JP1 A;  1X3Q A;  1G6Z A;  4XT1 B;  1WTW A;  1BO0 A;  2K05 A;  2K01 A;  1ILQ A;  5AFW A;  4R9W A;  1J8I A;  2X6G A;  2HCI A;  5EKI A;  4MN3 A;  3KBX A;  2EE1 A;  5E4W C;  2R3Z A;  3I8Z A;  1ML0 D;  1KNA A;  1ROD A;  1A15 A;  2EPB A;  2NWG A;  2RA4 A;  4ZKC B;  5JJZ A;  1RHP A;  5CMD A;  2RSN A;  1MSH A;  1U4R A;  2FHT A;  2HCC A;  1HA6 A;  4CJ1 B;  1NCV A;  1IKM A;  3H91 A;  4HAE A;  5COR A;  1B2T A;  4QUF A;  2MGS A;  2B2W C;  1AP0 A;  3LWE A;  4HED A;  4U68 A;  1G2S A;  2KUM A;  2K04 A;  1HFN A;  4MHE A;  1PFM A;  2KED A;  3I3C A;  4XDX A;  1O80 A;  1XYI A;  1B50 A;  1HHV A;  1HUM A;  1M8A A;  3IL8 A;  2HDM A;  1O7Z A;  1KNE A;  2FFK B;  2NZ1 D;  1E0B A;  3ONA B;  2RVL A;  3DEP A;  4IUV A;  1PFN A;  1MGS A;  2D9U A;  5T1G A;  1CA6 A;  1HRJ A;  1MI2 A;  1MSG A;  2N88 A;  4RWS C;  5EPL A;  1AZP A;  4IUQ A;  1B4O A;  1VMP A;  1VMC A;  4IUT A;  1WTX A;  1DZ1 A;  2K1B A;  3I90 A;  4LMQ D;  1EOT A;  1U4L A;  1JE4 A;  3DM1 A;  1B3A A;  1SSO A;  4IUP A;  4OIJ A;  1BNZ A;  4OIK A;  2N55 A;  4CJ0 B;  4XT3 B;  3D6W A;  4ZAI A;  5CBE E;  4X3U A;  1WTV A;  2K28 A;  4X3S A;  3FPU B;  1BF4 A;  4HCS A;  1WTO A;  2KOL A;  1G2T A;  2DY8 A;  2NYZ D;  1U4P A;  1EL0 A;  2XIW A;  1QNK A;  1X3P A;  1RTN A;  2DY7 A;  2BDN A;  1WTQ A;  5EPJ A;  1DOM A;  1CM9 A;  1PDQ A;  2B2T A;  2MPM A;  1F9S A;  2B2U A;  3MWY W;  1PFB A;  2Q8R E;  2L11 A;  5EJW A;  1BBX C;  2B2V A;  2B2V C;  2FIN B;  2H1E A;  1G91 A;  1RJT A;  5COY A; 
#chains in the Genus database with same CATH topology
 3Q0A A;  1IYV A;  4DKA C;  2B63 H;  2CWP A;  1JMC A;  5KRU A;  3GTQ B;  2F0O A;  2UUA Q;  1ZXT A;  3MC0 B;  4ALP A;  3S2H H;  4NKL A;  1H9J A;  4A3I B;  4ZK9 B;  4IFD G;  4P71 A;  1HNZ L;  4XQJ A;  1I4H A;  3MXN B;  3EA6 A;  3GTJ H;  4B3T Q;  4OO1 G;  4ZKB B;  1VF7 A;  3KF6 A;  1VDZ A;  3RUZ A;  1UNS A;  4WJ3 M;  1I50 H;  2EXD A;  4R4I A;  4A3F G;  2PZW A;  3S14 B;  4A3G G;  4NW2 A;  1NMG A;  3VA7 A;  3B6Y A;  4KKT A;  2B2Y C;  1TWH B;  4RCN A;  5C6A A;  5FJ8 H;  2YU9 B;  3M4P A;  4DAY B;  1JWM D;  5C0X I;  1EY5 A;  1IL8 A;  2F0H A;  2J0T D;  2RKS A;  3UI2 A;  1JC7 A;  2EOT A;  3T4A C;  1J9O A;  2A5H A;  1EQR A;  2K52 A;  2WB1 G;  5IT9 c;  3WWV A;  2F0G A;  1T9H A;  3S17 B;  3HOV H;  3G6E A;  2R61 A;  1PA6 A;  4DK6 C;  4M8A A;  2CW0 D;  1FNU A;  4IFD J;  1R4Q B;  1BUV T;  1C9O A;  3HOX G;  3A8I E;  3J81 j;  3K57 A;  2A6H D;  3WDN A;  3CC4 A;  2Z6K C;  1YHB A;  5TSS A;  4UPA A;  4KTA A;  4GKJ L;  2CH4 W;  1QUQ B;  3AFP A;  4LF5 Q;  5JJK A;  3A56 A;  4G4K A;  5K36 H;  1A2U A;  1TY2 A;  3CCL A;  4KHV A;  5KIX A;  1CTM A;  2ZTE A;  4TVA B;  4GNX C;  3OPO A;  4R4O A;  3WOF A;  2WB1 B;  1K8G A;  5H1S E;  5BR8 L;  4DV7 L;  4HTH A;  4BXX H;  4A3J B;  2EY5 A;  3HS0 C;  4OIJ A;  4IUP A;  2K50 A;  3CHB D;  1ZKO A;  2F3W A;  1V1P B;  3ND8 A;  4A3E G;  4PZ6 A;  3H0G H;  3AEV A;  1G6P A;  5GRO A;  1X3P A;  1O78 A;  5EPJ A;  5CV8 A;  5CV6 A;  4DR1 L;  3A74 A;  1NBW A;  4ZUJ A;  2F0E A;  2QDL A;  1BBX C;  4N9T A;  1HA5 A;  4BA2 I;  5C44 H;  5ELN A;  1PH2 A;  1HNX Q;  2E2H B;  1STH A;  1CQF A;  1H9S B;  2R7Z H;  4K8J A;  2LS0 1;  2R93 B;  1YNN C;  2F0V A;  1XMQ Q;  1UE5 A;  2A68 D;  1ESF A;  4JI8 L;  5C0X H;  3CU7 A;  1B8A A;  1A3T A;  3HOU B;  2X69 A;  3R8B A;  2B8F A;  3VDY A;  4GZY C;  5FO8 B;  4LF7 L;  4OO1 I;  1SE8 A;  2DJG C;  5E4X A;  3T13 A;  1IZ6 A;  3CRK C;  3ERS X;  3A0J A;  1QIL A;  1WCM B;  1TY0 A;  2UUB Q;  1RD9 D;  4F7X A;  4A4I A;  3J80 E;  4J8Q A;  4DR5 L;  3QJY A;  1KDC A;  2L0C A;  1TWA H;  3I91 A;  1EY8 A;  4O42 A;  5KYL A;  4ZLT F;  1N33 Q;  2M2L A;  1F2L A;  1WI5 A;  4DV1 L;  4XT1 B;  4A75 A;  4EVO A;  2A69 D;  1XNR Q;  5C5M A;  5C5L A;  1JR0 D;  2X6G A;  1Q12 A;  4JW0 A;  5M3M G;  2R3Z A;  5E7N A;  1YJN A;  2IJ0 A;  1FGB D;  4HIO A;  2B39 A;  3S1N B;  1HA6 A;  1J6Q A;  1TII D;  1TWC H;  1X3F A;  4HIK A;  3GTQ H;  1AEX A;  1AP0 A;  3BG3 A;  3LWE A;  1STY A;  1HNZ Q;  4JK1 C;  4A3I H;  5IYD G;  5M5Y B;  4OGQ C;  4MHE A;  4K5W A;  4A3K G;  1H95 A;  2VY3 A;  4EQ5 A;  3HEJ A;  3J81 i;  1JE5 A;  2NB0 A;  4UHV A;  4MZ9 A;  3KLW A;  2K5W A;  1EU4 A;  1MGS A;  2PNR C;  3EIV A;  2JA5 G;  4APV A;  1SNO A;  3Q22 A;  3TEH B;  2A6E D;  1TWH H;  4L5R C;  2YU9 H;  1D8L A;  3M4O H;  1D1K A;  5M3M B;  1ASZ A;  1SR3 A;  2PZU A;  4DF7 A;  4DV3 L;  1E1O A;  1S5B D;  3MWY W;  1PFB A;  3URY A;  1VQH A;  1ENF A;  3S17 H;  2MO0 A;  2IHE A;  4A3K B;  1D6E C;  4YY3 L;  2NVT B;  1K8O A;  2GA4 B;  2EYL A;  1SDF A;  4OO1 H;  3FMC A;  4ZUI A;  4CDF C;  1K0R A;  1I4P A;  4C2M B;  2N78 A;  5IP7 G;  4GKK Q;  2R6G A;  1D2B A;  4NP5 A;  3HOY B;  5M5X B;  3U58 A;  2B29 A;  1UE1 A;  4DXF A;  4JI4 Q;  1GUS A;  3RMH A;  3ND9 A;  1YEZ A;  2IT1 A;  1X65 A;  1STB A;  5ELB A;  1XNQ L;  2N8N A;  4LUO A;  2EYO A;  3SE0 A;  2RBM A;  2EQS A;  2ZM6 L;  1HH2 P;  1A3U A;  3A8K E;  1W3S A;  4UP9 A;  2UUC L;  3CAM A;  4B08 A;  1XX8 A;  2HDL A;  1NY4 A;  2AUK A;  3Q24 A;  4A3M G;  1LLR D;  1GM5 A;  1SMY D;  1TWG B;  4A3J H;  2RCN A;  3BDO A;  4N8F A;  1NR2 A;  4OEL B;  1QVF A;  1SN8 A;  2F03 A;  1DOL A;  2MUY A;  1YJW A;  1CKN A;  3IFT A;  4QB4 A;  4KD3 A;  4LFC Q;  4NXM L;  2QIL A;  1X54 A;  3H6M A;  5C4Z A;  3ITP A;  3RLF A;  4MN3 A;  3TBI B;  4AQY L;  2R92 B;  2EPB A;  2NWG A;  3K80 C;  4DV6 L;  3S1M B;  2QW7 A;  1I4R A;  1VQF A;  1PV4 A;  3HZX A;  2E2H H;  4QGU A;  3KDF A;  1HR0 Q;  2BA1 A;  2G9H D;  1A0I A;  2R7D A;  4KMU C;  4U68 A;  1X55 A;  1AH9 A;  2R93 H;  3E9H A;  1BBU A;  3I3C A;  1J5E Q;  4LF9 L;  4DK0 A;  2YV5 A;  3IL8 A;  1TXY A;  3FKI B;  3HOU H;  2Q2T A;  5KND A;  5GAH C;  2RDG A;  5D3I B;  4RWS C;  5I6W A;  4A3E H;  4X65 Q;  2CQO A;  4X66 L;  2HHH Q;  4BY7 G;  2L15 A;  1B1Z A;  1WCM H;  1L1O B;  1YNJ D;  3OOC A;  2XSC A;  4ME3 A;  2UU9 L;  1LUZ A;  1Y1V G;  3A7A B;  2WFW A;  5CV9 A;  1BCP F;  1QNK A;  4K6D A;  4CDC C;  2EY6 A;  2BE5 C;  2VQE L;  1Y69 U;  2IX3 A;  2F0W A;  5DLQ E;  3MXG A;  1OXU A;  3Q23 A;  4OL7 A;  4TQU S;  3NEL A;  4RHR A;  2JYO A;  2K14 A;  3HOZ G;  1BCP C;  3DMU A;  3AB9 A;  4JI1 L;  3IFD A;  4L5S A;  1F9P A;  2SDF A;  2E8G A;  2YTV A;  4JBM A;  5G3L F;  3S1N H;  5I2Y A;  1K0S A;  4R4C A;  2F0J A;  1U4M A;  1QWY A;  4BY7 B;  1JWU D;  3SGI A;  1QZH A;  1L2F A;  1TVX A;  4I7Z C;  5J1Z A;  1EZ6 A;  5M5Y H;  1EWC A;  5EQ0 A;  5EAY A;  2VQF L;  3SXH A;  4UP7 A;  3KF8 A;  4YCW A;  5CC4 A;  2L9H A;  1KDA A;  3SEB A;  4LK1 C;  3BZC A;  2AKW B;  3E0E A;  1KAW A;  5JVH 3;  1EWI A;  3JAM E;  3ICE A;  4DR6 Q;  4NXN Q;  1C48 A;  3IKJ A;  1ENC A;  4B3M Q;  2Z1C A;  3HOZ B;  2B63 G;  4X64 L;  3HKZ E;  1DON A;  5D14 A;  5M3M H;  1JQY D;  1KLU D;  3NBH B;  1G6Z A;  2JA8 G;  2ALY B;  5ELC A;  1W6K A;  1HZC A;  5AFW A;  3M9B A;  4HMJ A;  5AJ3 L;  1PH3 A;  3NQT A;  3I8Z A;  3G48 A;  3CCM A;  4HJA A;  1OXV A;  4JOI C;  5FLX c;  4A3K H;  2NVT H;  4JYA Q;  1KAA A;  5A2Q L;  4GLA C;  3TQY A;  1TS2 A;  5COR A;  3SK6 A;  4C2M H;  3D6C A;  3HOY H;  1II3 A;  1R9T B;  1HHV A;  1O80 A;  5ELD A;  3K5N A;  2WII B;  2CFM A;  1O7Z A;  1KNE A;  2Z4H A;  1I6H B;  1YJ9 A;  1HRJ A;  1YNX A;  5JJI A;  5EPL A;  4A3L G;  5I4D A;  4KY7 A;  3RZD B;  1EOT A;  2UUA L;  3HOV G;  3KJO A;  4KK7 A;  3KYH C;  4POG A;  1Q8I A;  3FPU B;  2Y0S E;  1I6V C;  1RIP A;  1WTH A;  4B3T L;  2NZH A;  1CHQ D;  1TWG H;  4GOP B;  1U4P A;  2KA7 A;  1DYQ A;  3GP7 A;  3PQI A;  4JI7 Q;  2SEB D;  4DV5 L;  4A3D B;  2JA7 B;  4LF6 Q;  2I5H A;  2JXM B;  1GHJ A;  2EXZ A;  1LTR D;  1Q1B A;  1RJT A;  4FF2 A;  2WAQ E;  1IKL A;  3TP6 A;  1KC8 C;  1KRS A;  1HNW L;  2FJ2 A;  2PI2 A;  3KF6 B;  4GN5 A;  3AMU A;  2R92 H;  1H9K A;  3S1M H;  1LTB D;  2RHS B;  4RA8 A;  1KAB A;  4BXX G;  1CZW A;  3FDT A;  1GO3 E;  2EDG A;  1EY4 A;  1NTG A;  1GUO A;  3NTI A;  4OEM B;  4RCO A;  4LF9 Q;  5ELE A;  3F2U A;  2L4N A;  4H0L C;  3SDZ A;  2XWJ B;  3D4D A;  1HQR D;  1LAC A;  2I07 B;  3FKI H;  4KLK A;  5IT9 E;  3TSS A;  1SEB D;  1B9M A;  1ESR A;  3GTP B;  4IQZ A;  1SMY C;  2Z6K A;  4X66 Q;  2AQ1 B;  1ZEQ X;  3TP7 A;  3A7L A;  1L0W A;  3GTM B;  1PZI D;  4DR7 Q;  1YNN D;  2QGQ A;  4HID A;  3FHW A;  4LF5 L;  4ZRZ A;  2ZJP A;  2UU9 Q;  3K58 A;  1NAP A;  2ICE C;  3N6R A;  4TSS A;  4GNX A;  1HZB A;  4KKU A;  2CWA A;  3BDC A;  4O0A A;  4UY8 C;  3PIP 3;  4ZKC B;  1ROD A;  2F0P A;  1RKN A;  1GKH A;  4A93 B;  2GN5 A;  1FVI A;  3CCR A;  5IYC G;  3F2C A;  5CR3 A;  1YHQ A;  1EFW A;  1X9N A;  1PYB A;  2LY7 A;  1M8A A;  3S16 B;  4BY7 H;  4Y7N H;  3L0O A;  3CC7 A;  1MI2 A;  1Y1W B;  4RGM A;  1HNX L;  2ZXP A;  4IUQ A;  2K1B A;  1B3A A;  1Y1V H;  4YCU A;  2OQ0 A;  2PO4 A;  5KYI A;  2UXB Q;  4DAM A;  1XMQ L;  1EEF D;  4X3S A;  1DXM A;  4QMG A;  5IOC A;  3GTL H;  1E22 A;  2DY8 A;  2NYZ D;  4PQX A;  2O4X A;  2EJG C;  2DY7 A;  5C0X J;  1EOV A;  4DAP A;  3HOZ H;  1S5D D;  1SYG A;  2AUJ D;  1G91 A;  4A3B B;  5M3F G;  4JI6 Q;  2OCE A;  4V19 0;  2YYZ A;  2OTL A;  2QA4 A;  1U9R A;  5CV4 A;  3VR4 A;  4HSV A;  1OXS C;  2JK8 A;  3DEO A;  4BBS B;  4ZQ3 A;  2CKZ B;  3F2D A;  1NE3 A;  1N33 L;  4QY7 A;  3KBG A;  3L9A X;  2KEC A;  4EQO A;  1XNR L;  1CFM A;  4H02 A;  2B2U C;  1LTT D;  2PQE A;  1R9T H;  1K3R A;  2Z6B A;  2C9O A;  1I6H H;  4QL5 A;  1IW7 C;  1PFS A;  1K83 B;  4RGN A;  5IP9 H;  1HR0 W;  3G7L A;  4Q0F A;  2ZJQ A;  1WD1 A;  3AU7 A;  1A3V A;  1SAP A;  3RD4 A;  4FF4 A;  1E2V A;  5M3F B;  1QVG A;  2JA8 H;  1XJV A;  3J7A F;  3UDG A;  1T5X D;  1EIF A;  1RTO A;  2UXC Q;  4FXG C;  1EU3 A;  1UAP A;  4PZ8 A;  1X3Q A;  1MKH A;  4DV5 Q;  1L0Y B;  3A55 A;  2ICI A;  4A3D H;  1LTL A;  2JA7 H;  4ILW A;  3DUZ A;  3K5L A;  4DUY L;  3H15 A;  2F0S A;  3OMC A;  2OT2 A;  1Q82 C;  1STE A;  1YI2 A;  1B44 D;  1HNW Q;  2E2I B;  1Q86 C;  1OXX K;  3K0Y A;  1EY6 A;  4FYD A;  1VQC A;  2KBN A;  4DPG A;  4A3L H;  3S2D H;  1EQQ A;  2Z0S A;  2FMC A;  2I5L X;  4A3J G;  2HT1 A;  2ZJR A;  3I4L A;  2LXK A;  1SE2 A;  4C56 C;  4UP8 A;  2K5Q A;  5C3E B;  4IAL A;  3J80 L;  1KD1 C;  3BYY B;  2XWB B;  4GKK L;  1GOZ A;  4B9X A;  3D6W A;  1YBY A;  4YIJ A;  1IBK Q;  2P5Z X;  2QEJ C;  4JI4 L;  3CXC A;  3G6J B;  2EYF A;  5LHY 1;  1RTN A;  5HY6 A;  5JOB A;  3TS2 A;  3U9O A;  1L1O C;  3MXP A;  5IE8 A;  2Q8R E;  1TKW B;  5FO7 B;  2B2V A;  2FIN B;  1LTG D;  4RGO S;  2F0K A;  5COY A;  3J7A V;  2CQA A;  2R93 G;  5JAV A;  3A5U A;  2EYJ A;  2IX1 A;  1QCB D;  4QCL A;  4LF4 Q;  5DNF A;  3N52 A;  3HOU G;  2HUG A;  4R8I A;  3W3A A;  4R1J A;  1CK1 A;  3W5O A;  1S72 A;  4YCV A;  1SNP A;  2L5T A;  4BA1 I;  1UWV A;  5CBA E;  3EQL C;  3NSW A;  3W1G A;  3MTS A;  3PGZ A;  2IL8 A;  4LFC L;  1PRT B;  5EGT A;  3GDE A;  1WCM G;  2BE5 D;  3LGJ A;  2Q8T A;  4FXD A;  2PW5 A;  4OWT B;  3BYT B;  3HGB A;  2K03 A;  3S16 H;  1PLF A;  4AYB E;  1S5C D;  1Y1W H;  1RF2 D;  1BCP D;  4YHH Q;  1CKN B;  1SYC A;  1HR0 L;  4ULL A;  3NQI A;  5ELF A;  2NVY B;  1UE6 A;  2XGT A;  3K81 C;  2ASB A;  1M90 C;  3CMA A;  4MIU A;  1J5E L;  2EIF A;  2M9V A;  1HFG A;  2XTI A;  4PV1 C;  4LNQ A;  1KXL A;  4KD4 A;  1JOQ A;  1LT4 D;  1J8I A;  1ILQ A;  4ZCK A;  3BZK A;  4X65 L;  3KDF B;  1Y8N B;  2HCI A;  4XYQ A;  5C4J B;  5IYC H;  5G3L D;  1ML0 D;  1YIT A;  2HHH L;  3I7F A;  4IZ8 A;  5A35 A;  5KNC A;  4A3B H;  2LMC B;  4OX9 Q;  1VQA A;  2PQA A;  5M5W H;  4LWC A;  4B3S Q;  4FF1 A;  1DGS A;  1B2T A;  3KLS X;  3PUW A;  4BBS H;  4L6T B;  1CHP D;  1YVC A;  5JEA G;  1Z7T A;  4K6L A;  2ENB A;  2HDM A;  2FFK B;  5IY0 A;  1GJX A;  1SNQ A;  2F3I A;  3VR2 A;  2EY2 A;  4L8J A;  3STB C;  2VW9 A;  3K59 A;  1MSG A;  1DM0 B;  1B4O A;  1SND A;  1EYG A;  4BS9 A;  1R4P B;  2EVB A;  1K8A C;  1EQV A;  2N55 A;  5CBE E;  1G8Z D;  1K83 H;  1WTV A;  1AFP A;  4H44 C;  2O2L D;  1CT1 D;  4CHT B;  3PCO B;  4IJH A;  1HTP A;  5M3F H;  3KOJ A;  1X6O A;  3MXN A;  4GOP C;  4LAA A;  2IPK D;  3HOY G;  3S14 H;  4KN7 C;  1FYC A;  1WTP A;  3QR8 A;  4DUY Q;  1I4G A;  1HPC A;  3HOW B;  1VQL A;  1G29 1;  4KHP Q;  2MHV A;  4C3H B;  3GQB A;  4DR6 L;  4NXN L;  4Y52 H;  3R3O A;  4B3M L;  2OTJ A;  2E2I H;  1CUK A;  4JI3 Q;  3T1H Q;  3RNU A;  3NEM A;  1SNM A;  3TP8 A;  1I3Q B;  1HQM C;  3HKZ B;  1TU2 B;  4IUR A;  1S40 A;  3CQZ B;  4JOI A;  1DOK A;  2HIV A;  4JYA L;  3PUZ A;  5C3E H;  4OON A;  4C3I B;  2K6A A;  1NUC A;  1NSN S;  4OHJ A;  1CKO A;  3GD7 A;  2Z9H A;  3GTK B;  3PMF A;  2KHS A;  3P7J A;  3X3M A;  4H13 C;  2RF4 A;  4JI2 Q;  3OWF A;  5BN4 A;  3PIP A;  1K8M A;  3C2P A;  4LF8 L;  3J81 c;  2R92 G;  5FLX E;  1I4Q A;  1A6X A;  5IGC A;  5FLM G;  2EE1 A;  2GVA A;  3U50 C;  2DN8 A;  5JJZ A;  2PYK A;  2E2J B;  1RHP A;  4JVZ A;  3C1E A;  1PMR A;  4CDE C;  1VQ4 A;  2MGS A;  2B2W C;  3FKI G;  3OHX C;  2OQK A;  3K0X A;  3F1Z A;  5C3W A;  3P75 A;  1EUJ A;  1HFN A;  3I72 A;  1D5X C;  4JI7 L;  2Y0S B;  1GXD C;  1WFQ A;  4Z9C B;  4LF6 L;  1JCK B;  1HUM A;  3J80 i;  5IGD A;  3MAQ A;  1CSQ A;  1PTO B;  3BVM A;  4C3J B;  3MEH A;  1VMP A;  1WTX A;  3CKI B;  3MEF A;  1JE4 A;  3JAM L;  3SHL A;  1JOO A;  4XIG S;  3FVQ A;  1F2Y A;  3LX0 A;  3S15 B;  2WAQ B;  1B3Q A;  2CH4 A;  2YTY A;  3DHQ A;  2V4D A;  1SLJ A;  4DR2 Q;  1RCV D;  4JBW A;  3G4S A;  1WTQ A;  2NVY H;  2MPM A;  3W2D A;  5JPM C;  4KJN A;  4DV2 L;  2ID0 A;  2H1E A;  4DR3 Q;  4G57 A;  1SRU A;  5EBD A;  2B8G A;  4LFA Q;  1N36 L;  2RQX A;  4KHZ A;  2CVR A;  3HFZ B;  5C4J H;  1D5M C;  2WV6 D;  3SVM A;  2LXJ A;  1PHJ A;  2L1B A;  4DR7 L;  4BBR B;  4DV4 Q;  4UDU C;  4CJ2 C;  1LTA D;  4DN4 M;  1TS4 A;  3OW2 A;  4QUC A;  2OWO A;  3S1Q B;  5CV5 A;  3ZYY X;  1PH7 A;  1VQK A;  3PIO 3;  4JPB W;  3TS0 A;  1XPU A;  2M00 A;  1TQO A;  2RDF A;  5IIF A;  3I55 A;  3E9I A;  4GS3 A;  4DAV A;  4X3K A;  2ZTC A;  3TN2 A;  1SXT A;  3L3O C;  2WKC A;  2VUM B;  1U0L A;  1KQS A;  3SR1 A;  3JC6 6;  1SYE A;  3T1Y L;  1M1K C;  2RSO A;  1ASY A;  1C7Y A;  1GUW A;  2ZXR A;  1Y8O B;  1VCI A;  4J6H A;  2D62 A;  4HJ7 A;  1F9Q A;  5FK9 C;  3LNN A;  4M1U B;  2Q2U A;  3AYH B;  2F0N A;  4NB3 A;  3D31 A;  1C0A A;  1H9M A;  4TRD A;  1PH6 A;  2HD3 A;  1IW7 D;  4X6A H;  2XN9 C;  1E3P A;  2E76 C;  2UXB L;  4S3S A;  1X3E A;  4GLV B;  4KKS A;  5KEE A;  2DUD A;  3DWP A;  5EKL A;  5JEA H;  1EIY B;  1EZ8 A;  2KUM A;  3ULJ A;  4C3H H;  5IP9 G;  4RG1 A;  3J7Y W;  2O5J C;  5C4X B;  2KCT A;  4XDX A;  1F77 A;  3HKS A;  5IYB G;  4YWM A;  5IT9 L;  2DGY A;  4KJO A;  2CHB D;  1Z6H A;  4RGT A;  3I4N B;  3J7A 5;  1SMX A;  4JI6 L;  1KIX A;  1AZP A;  5F2D A;  4L5T A;  3ULL A;  4JBJ A;  4RHS A;  2KCM A;  2IWH A;  3A54 A;  3CQZ H;  4OIK A;  4XT3 B;  5EKK A;  1D5Z C;  4A76 A;  2XRQ D;  3MZ5 A;  2JA7 G;  4A3D G;  2OXP A;  1HCZ A;  2JSO A;  5IGF A;  4A3C H;  1EL0 A;  1YZ6 A;  2N3S A;  5M5X H;  3RLO A;  1CM9 A;  4G7Z C;  1SE3 A;  3GTK H;  3UDX A;  1F9S A;  2B2U A;  4LF8 Q;  1QB5 D;  3DM3 A;  1HXY D;  3R2I A;  4LFB Q;  5J3B A;  3MFG A;  1JB7 A;  4HN7 A;  5D65 A;  4IPH A;  1HZA A;  2E2J H;  3BU2 A;  3I4O A;  1CZG A;  3F2B A;  1E1T A;  1EQT A;  2BOS A;  2UXC L;  1PRT F;  2FXQ A;  1EIG A;  1MD2 D;  1LO5 D;  1O7L A;  3F8T A;  3CCQ A;  4F88 A;  3NK9 A;  1AE3 A;  3OTO L;  3PO3 B;  2B2Y A;  2A1A A;  1PRT C;  1SYB A;  1PTO H;  4EQP A;  3K6O A;  4C3J H;  4PNY A;  3GTJ B;  4KI0 A;  3CPF A;  1Z9F A;  2F4V Q;  3D0F A;  1GUN A;  2JA6 B;  3RZO B;  2NVX B;  5FLM H;  2PI2 E;  1OXT A;  4L5Q A;  1LV9 A;  3PO2 B;  2JN4 A;  1EFI D;  4CBV A;  2WP8 J;  1JOR A;  2K05 A;  1FNW A;  4A93 G;  2K5D A;  3T51 B;  4DV2 Q;  1KDB A;  2QF7 A;  4R4T A;  4LJZ C;  1LT5 D;  1Y8P B;  1XPO A;  2Q8I B;  3PUX A;  3OW7 A;  2AQ2 B;  5DM7 3;  1WYD A;  1U4R A;  1S5E D;  3S24 A;  1PH8 A;  3M7G A;  1N36 Q;  1MBY A;  1IBK L;  1N9W A;  5LMN W;  1IKM A;  4HAE A;  1ONL A;  5ISR A;  1Y1W G;  4BBR H;  2QKI C;  3U4V A;  2NTT A;  1PFM A;  3D4R A;  1RDP D;  3AFQ A;  1FGU A;  4NDX A;  2NZ1 D;  3CRL C;  3S1Q H;  3E0J A;  3ONA B;  4IUV A;  3DEP A;  4PG3 A;  5T1G A;  3JAM i;  3RN5 A;  1SFO B;  2NVQ B;  4QQB X;  2F3V A;  2RDH A;  1U4L A;  4LF4 L;  1SSO A;  3C1F A;  1V8Q A;  3T1Y Q;  3K7A B;  2I5M X;  1N8R C;  3L2P A;  1V43 A;  3OMG A;  1YIJ A;  4LUZ A;  4K0K Q;  4O2D A;  4A3B G;  3HG9 A;  1PH5 A;  5J39 A;  2MNA A;  1A8V A;  4PMC A;  3LWU A;  3VYU A;  1UUP A;  1JB3 A;  3NPP A;  2IHF A;  3STB D;  3S1R B;  4BBS G;  1E24 A;  5IWA Q;  3MA2 B;  2NN6 I;  1L0X B;  4YHH L;  1PH9 A;  1B7Y B;  1V1O A;  2G5D A;  2MP1 A;  2EJM A;  1B53 A;  4AYB B;  2ATW A;  1PVO A;  1JJC B;  3CW2 C;  1KTK A;  1JIC A;  2I0Q A;  4IO9 A;  5DM6 3;  5C44 B;  5I2X A;  3TZD A;  1EY7 A;  2B2T C;  5IGB A;  2EZV A;  5C4X H;  1WVL A;  1VQG A;  3GTG B;  4FO2 A;  4FVM A;  3RLN A;  3T56 B;  3W1B A;  4DK1 A;  3EJI A;  3I4N H;  4OX9 L;  2KEE A;  1X56 A;  4KV6 A;  5IGG A;  3I73 A;  4B3S L;  1KRT A;  2GVB A;  2BA0 A;  2K4K A;  5LL6 X;  1VQJ A;  4JI0 Q;  1UEB A;  2MJ8 A;  3QOJ A;  3TP5 A;  2FMM A;  2QCP X;  4F8M A;  1KL9 A;  3TZU A;  1NR4 A;  2ZXO A;  2E2D C;  2XNA C;  1VQ6 A;  2RCF A;  3KJP A;  2K5N A;  3A8J E;  4LUV A;  3KBX A;  1EYD A;  1QNU A;  4I65 A;  1A62 A;  2BDO A;  3QOL A;  1K9M C;  2A19 A;  4C1N I;  1B70 B;  3RZD H;  4BY1 B;  1TS3 A;  4H7B A;  5IYB H;  2JEB I;  4XXE A;  1SJE D;  4DV0 Q;  1ENA A;  3VR3 A;  2SNS A;  1IL2 A;  2Z8L A;  4YWL A;  5HGT A;  4NMZ A;  3EFX D;  5C3E G;  5LMU Q;  4GOP A;  4HJ8 A;  3I4M G;  2J4X A;  1PFN A;  1ZYR C;  2G9D A;  3FPP A;  1SE4 A;  3OTO Q;  1TWC B;  3K7U C;  1BVS A;  4U67 3;  4KHP L;  1S3O A;  1BOS A;  3PO3 H;  1PTO C;  1LTS D;  4P2C B;  3KFU A;  4FF3 A;  3OIP A;  2NN6 H;  1VQP A;  4QIW E;  4JI3 L;  4G7H C;  3T1H L;  3CCV A;  4ME5 A;  3BS1 A;  1JJG A;  1FJG Q;  1BR9 A;  1DOM A;  1W6J A;  4P72 A;  3ERQ A;  4IOC A;  2JA6 H;  1A63 A;  3VYR A;  3RZO H;  1JOK A;  2NVX H;  4K2K A;  4KY6 A;  3TME A;  4PMW A;  1DCZ A;  3K8A A;  3PO2 H;  1HZ9 A;  3D8G A;  1OO9 B;  2UXD L;  1PYS B;  2NTS A;  1CI3 M;  3GO5 A;  3C3L A;  3M4O B;  1F9R A;  1IYU A;  3CF5 A;  2C35 B;  1N34 Q;  1GHK A;  3I4M B;  1XMO Q;  3DLL A;  1QVC A;  5FKA C;  3SK4 A;  3PIO A;  1KLG D;  1QG7 A;  3HP3 A;  1FNV A;  1E7Z A;  4ODG A;  3GTP H;  3M85 A;  4JI2 L;  4EGV A;  3GTM H;  3NWT A;  1AW7 A;  2IX0 A;  1ILP A;  2JA9 A;  5DAU A;  1Q81 C;  2AWN A;  2D0O A;  2KVM A;  1LM0 A;  1SYD A;  4X3T A;  4JI5 Q;  4A3F B;  4A3G B;  1PH1 A;  2BH2 A;  3R2T A;  4DUZ L;  1KHI A;  3J81 E;  1SFO H;  2NVQ H;  2KQ3 A;  2K5V A;  4RH6 A;  1WD0 A;  3IAY A;  4J1M A;  2LKV A;  1XPR A;  2D0P A;  2B2W A;  3KK7 A;  3K7A H;  5L37 A;  4A93 H;  4GN4 B;  5I9P A;  2ZTD A;  3I2Z A;  3NHH A;  2MQH A;  4JG2 A;  3V2T A;  5EKI A;  4HCE A;  3E6Z X;  3EVQ A;  3S1R H;  4DR4 L;  2WKD A;  1EY0 A;  1NCV A;  4B3R Q;  4ZYS A;  4DR2 L;  1NNX A;  4RFB A;  2E75 C;  2PZT A;  1W2B A;  3HOX B;  3U4Z A;  5C4H A;  1XWE A;  1XYI A;  3VA5 A;  1A2T A;  1IBL Q;  3PV0 A;  4DR3 L;  1PYW D;  3AQQ A;  4FDB A;  5FO9 B;  4IUT A;  4LFA L;  3DM1 A;  2K75 A;  3NUC A;  3GTG H;  3RN2 A;  3RR5 A;  2PMZ E;  4X3U A;  2CCZ A;  2K28 A;  4R8N A;  4DV4 L;  2MO1 A;  1SRO A;  1SBB B;  2KOL A;  1VQO A;  3TDQ A;  4MTK A;  5FLX L;  2DNE A;  2QDB A;  1STG A;  1GUT A;  2EY1 A;  4CKB A;  5JVG 3;  2BDN A;  4RKB A;  4IFD I;  4A3E B;  4E6I A;  1PH4 A;  3D4W A;  1PXU A;  3EBE A;  4WJ4 A;  4JV5 L;  3HOW G;  4OXP A;  2OF1 A;  5D3D A;  4C3H G;  5FOB B;  4DXG A;  1Q3L A;  3VR5 A;  4QJF A;  4CDD C;  3M3Y B;  1O7I A;  5IGE A;  3CCJ A;  5E1F A;  3DWQ A;  4IJL A;  3QO2 A;  3SK8 A;  5K5P A;  3DWA A;  2H5X A;  3CCE A;  4BY1 H;  3HKZ G;  5LMN Q;  1WOC A;  2VB2 X;  3C46 A;  4DNR B;  3TRE A;  2EYP A;  4OWX B;  4I7A A;  1I94 L;  1WTR A;  2X6L A;  4C3I G;  5HGQ A;  4A3C G;  3KUP A;  1T5E A;  5CYU A;  1F2Z A;  4DFA A;  1X32 A;  3SK5 A;  1IHZ A;  1VQI A;  1VF5 C;  5JEA J;  3GTO B;  4EX5 A;  1XTC D;  1STN A;  4FNF A;  4DAY A;  2PPB C;  4NPS A;  3KF8 B;  2VL6 A;  4HJ5 A;  3HRZ C;  4X62 L;  4R4Q A;  2JP1 A;  3E5S A;  2BCO A;  2AWO A;  3H3V I;  5E4W C;  2UXD Q;  2JEA I;  1A15 A;  1PRT D;  2NBF A;  2RSN A;  4CJ1 B;  2Y0S G;  3VYT A;  4GLX A;  3TRZ A;  1RL2 A;  3FEW X;  4J15 A;  3I4M H;  3CP0 A;  3PF4 A;  1G2S A;  1VQD A;  2NZO A;  4C3J G;  1EWH A;  1N32 L;  3QG1 A;  4K14 A;  1HTL D;  1VQ8 A;  1I4X A;  1QUQ A;  2N88 A;  4LFB L;  4IFD H;  2WAQ G;  5I6Y A;  1VMC A;  1DZ1 A;  3WOE A;  3I90 A;  1Z47 A;  3H09 A;  1BQQ T;  1BNZ A;  4DUZ Q;  4A3F H;  2YTX A;  1G51 A;  4A3G H;  3T16 A;  1BF4 A;  2JA5 B;  5GQO A;  4GKJ Q;  1Q90 A;  4IOA A;  1EEI D;  2WB1 E;  2OEO A;  5C3X A;  1V1P A;  2F4I A;  4V0B A;  3NP8 A;  4HIM A;  2L11 A;  5EJW A;  3D3R A;  3QIA A;  2B2V C;  3CCU A;  2LSS A;  4QF4 A;  4CKC A;  4CGY B;  1MHW C;  5BR8 Q;  4F87 A;  4BBR G;  3K5M A;  4DV7 Q;  1FD7 D;  2E5L L;  4IN3 A;  3A5Z B;  2VB3 X;  4EQN A;  4IUU A;  2A73 B;  4JCV E;  3VR6 A;  1CA5 A;  2F4V L;  1LTI D;  4DR4 Q;  2L12 A;  1TR5 A;  1I5F A;  2F1M A;  3QWN A;  1HUN A;  5KNB A;  1H9S A;  1TWF B;  4AH6 A;  1FR3 A;  2ES2 A;  2VUM G;  3HOX H;  1LT3 D;  4DR1 Q;  1SNC A;  4ID6 A;  2CW0 C;  1DD2 A;  3BVZ A;  4K2L A;  3CPW A;  2AHO B;  3O13 A;  2EYH A;  4XTC S;  3L7Z C;  4XQQ A;  1CQV A;  2A6H C;  2LFN A;  1Q1E A;  3H3V H;  2KCN A;  4XYO A;  1YHA A;  1C8C A;  2Q2I A;  4WOR A;  1JJ2 A;  3NTK A;  1SJH D;  4AIM A;  1EIH A;  3UE0 A;  5E3F A;  1S4Z A;  3CC2 A;  5JPN C;  4A3M B;  3I70 A;  4JI8 Q;  3E3X A;  1VQE A;  1ET9 A;  2VXW A;  3MVV A;  3NXW A;  4YWK A;  1WTW A;  3J80 c;  1P16 A;  5GAG C;  2NUC A;  1BKB A;  3QB3 A;  4LF7 Q;  4JV5 Q;  4XQN A;  1QJO A;  3MXU A;  3BDL A;  2D5D A;  2VS1 A;  2JJQ A;  3ZJY C;  2F0U A;  3CD6 A;  2HQL A;  4O1N A;  5M9O A;  5C4X G;  3M3Y H;  3H91 A;  2QEX A;  1TS5 A;  4DR5 Q;  2KCC A;  4GNX B;  4TKO B;  2IY5 B;  3M4Q A;  2H4O A;  3I4N G;  4K0K L;  2R7F A;  2E74 C;  3NBI A;  2KHI A;  3PUY A;  1BDO A;  3UDI A;  4CKE A;  1VQ5 A;  3MFY A;  4LW1 A;  4DV1 Q;  2RVL A;  1CA6 A;  5IWA L;  1I94 Q;  5HUR A;  1P8L A;  2VNU D;  4ZAI A;  2WIN B;  1K73 C;  4FP5 D;  2A68 C;  4OWW B;  3HOW H;  4K5V A;  1NMF A;  4IPC A;  4Y7N B;  3GTO H;  1LT6 D;  3NTH A;  1VQM A;  1V1Q A;  2B2T A;  1JT8 A;  4X62 Q;  1M4V A;  1VS0 A;  2PCF B;  4JBK A;  1Y1V B;  1ZYR D;  2Q2H A;  1I3Q H;  1MIU A;  2BH8 A;  3GTL B;  1Q7Y C;  5I9O A;  1IXR A;  1MJC A;  5KGU A;  2JQO A;  3VYS A;  1E2Z A;  1EYC A;  1PTO D;  4JI0 L;  3H94 A;  4BWG B;  1MJE A;  2DNC A;  4C3I H;  2SOB A;  3PO3 G;  1C4Q A;  3V96 A;  1N32 Q;  2A69 C;  4DV3 Q;  2JE6 I;  4DGZ A;  1IBM L;  2NN6 G;  1S5F D;  1DJR D;  2J7Z A;  1JWS D;  5DEH A;  4KY5 A;  3PF5 A;  2F0Q A;  3ERO A;  5LL6 S;  2C5C A;  4PMB A;  3PUV A;  4YY3 Q;  1EYA A;  5IYD H;  2JA6 G;  2MFI A;  4P73 A;  2F0D A;  1ICW A;  3PO2 G;  1O7Y A;  1B9N A;  1E2W A;  4DV0 L;  5FJ8 G;  1WJJ A;  2XVS A;  4WRD A;  2JA5 H;  3FRP B;  3S9W A;  1ICF B;  1D7Q A;  4IPD A;  3OYY A;  5EBC A;  5LMU L;  1XNQ Q;  1BO0 A;  2EJF C;  2HIX A;  3Q8D A;  3UE1 A;  4MTN A;  4HMI A;  2B63 B;  2ZM6 Q;  2I46 A;  3S2H B;  4GN3 B;  2UUC Q;  1H9R A;  3BJU A;  2RA4 A;  1VQ9 A;  2A6E C;  2E5L Q;  2JA8 B;  4DNT B;  4FXK C;  5CMD A;  1MSH A;  2FHT A;  2HCC A;  3P20 A;  3ULP A;  2K32 A;  2WAC A;  4IPG A;  4HED A;  1I50 B;  2K04 A;  4C1N K;  3MHB A;  1FJG L;  2F0I A;  3S15 H;  3V05 A;  2KED A;  1B50 A;  3OIQ A;  4QIW B;  1TWF H;  3NEN A;  5IP7 H;  1E0B A;  5BN3 A;  4B9W A;  4NXM Q;  2D9U A;  4N8X 1;  5K36 G;  1ET6 A;  2L55 A;  1Y14 B;  4LMQ D;  3IRB A;  3KLS A;  4AQY Q;  4RMF A;  1N34 L;  1XMO L;  1UE7 A;  4DV6 Q;  3OSO A;  4CJ0 B;  1GVP A;  3H3V C;  3S2D B;  1WTO A;  4P74 A;  3HOV B;  2XIW A;  3P1H A;  2DJF C;  1PDQ A;  3PSI A;  1L1O A;  2K5H A;  1SYF A;  3H0G G;  1GD7 A;  3J7Z C;  3CCS A;  1VQB A;  4WFN 3;  3BVG A;  4DU9 A;  4A3M H;  5NUC A;  3DXJ C;  3FP9 A;  3K5O A;  3M7N A;  1V9P A;  5GAE C;  4JI5 L;  4AYB G;  1QZG A;  4PZ7 A;  1QOH A;  3GV6 A;  1D1I A;  1GUG A;  1NJI C;  1AZQ A;  4K5X A;  2KHJ A;  4L63 B;  2EYM A;  5C44 G;  2F0F A;  2PNH A;  5T1I A;  2VUM H;  1Q8K A;  5J22 A;  1TT2 A;  2N49 A;  1OTC A;  3U9S A;  4UAI A;  5A2Q E;  2A8V A;  2R7Z G;  1EY9 A;  2IW3 A;  2VQE Q;  2VZA A;  2HQE A;  1PZK D;  2K33 A;  2F0L A;  4RAU C;  5C0X G;  1PZJ D;  3G71 A;  4DNI A;  3UDF A;  3H0G B;  1LYL A;  4JI1 Q;  5GAD C;  4B3R L;  3GV3 A;  1X3G A;  1STA A;  2RHQ B;  4G7O C;  4POF A;  3R93 A;  2AQ3 B;  1VQ7 A;  3CME A;  4DK3 C;  3Q6S A;  4RKL A;  5EPK A;  5ELO A;  3EN2 A;  2ZT9 C;  4JC0 A;  4WJW A;  1QE6 A;  5JJL A;  1IBL L;  2Z4I A;  1U5K A;  3JAM c;  1AN8 A;  2K01 A;  4Q5V A;  2VQF Q;  4R9W A;  2TMP A;  4BY1 G;  4N9P A;  2R7Z B;  2TSS A;  1BBW A;  3NBH A;  5CV7 A;  1KNA A;  3BZD B;  4HSP A;  4P75 A;  3I56 A;  5IOD A;  2D2C C;  4MNO A;  4DA2 A;  1YNJ C;  4HR7 B;  3T53 B;  1Q46 A;  4QUF A;  1VQN A;  1XXG A;  2B3G A;  2PMZ B;  1XTD A;  1CKM A;  4X64 Q;  2O5I C;  3KLR A;  1LAB A;  1FL0 A;  4HJ9 A;  2PW7 A;  5CGK A;  2AMC B;  3OWE B;  2F0T A;  4A3I G;  1IBM Q;  3J81 L;  5AJ3 Q;  1UEA B;  2A74 C;  2PQA B;  5M5W B;  2K7V A;  1HJP A;  2KEN A;  2UUB L;  1AE2 A;  1BXT A;  3NE5 B;  1TWA B;  3X3N A;  3NWS A;  2F52 A;  1G2T A;  4HCS A;  4IUN A;  1F2M A;  2F0M A;  3M4Y A;  4KN4 C;  1CSP A;  3ER0 A;  5LMN L;  5BN5 A;  2KJX A;  2XRS D;  2V1C C;  1IYJ B;  1K3B C;  4ABN A;  1BCP B;  1PTO F;  1K28 A;  4K8I A;  2SNM A; 
#chains in the Genus database with same CATH homology
 3Q0A A;  1IYV A;  5KRU A;  3GTQ B;  2F0O A;  1ZXT A;  3MC0 B;  4NKL A;  1H9J A;  4A3I B;  4ZK9 B;  4IFD G;  4XQJ A;  1I4H A;  3EA6 A;  4OO1 G;  4ZKB B;  1VF7 A;  1VDZ A;  3RUZ A;  1UNS A;  2PZW A;  3S14 B;  4NW2 A;  3VA7 A;  4KKT A;  2B2Y C;  1TWH B;  4RCN A;  5C6A A;  2YU9 B;  1JWM D;  5C0X I;  1EY5 A;  1IL8 A;  2F0H A;  2J0T D;  2RKS A;  3UI2 A;  1JC7 A;  2EOT A;  3T4A C;  1J9O A;  2A5H A;  2F0G A;  3S17 B;  2R61 A;  4M8A A;  2CW0 D;  1FNU A;  4IFD J;  1R4Q B;  1BUV T;  3A8I E;  3K57 A;  2A6H D;  3WDN A;  5TSS A;  4KTA A;  3A56 A;  4G4K A;  5K36 H;  1A2U A;  1TY2 A;  4KHV A;  5KIX A;  1CTM A;  3OPO A;  3WOF A;  2WB1 B;  4HTH A;  4A3J B;  2EY5 A;  3HS0 C;  4OIJ A;  4IUP A;  3CHB D;  1ZKO A;  2F3W A;  1V1P B;  3ND8 A;  1X3P A;  1O78 A;  5EPJ A;  5CV8 A;  5CV6 A;  4ZUJ A;  2F0E A;  1BBX C;  4N9T A;  1HA5 A;  4BA2 I;  2E2H B;  1STH A;  1CQF A;  1H9S B;  4K8J A;  2LS0 1;  2R93 B;  1YNN C;  2F0V A;  2A68 D;  1ESF A;  5C0X H;  3CU7 A;  1A3T A;  3HOU B;  2X69 A;  3R8B A;  2B8F A;  4GZY C;  5FO8 B;  4OO1 I;  5E4X A;  3T13 A;  3CRK C;  1QIL A;  1WCM B;  1TY0 A;  1RD9 D;  4F7X A;  3J80 E;  4J8Q A;  3QJY A;  1KDC A;  2L0C A;  3I91 A;  1EY8 A;  4O42 A;  5KYL A;  4ZLT F;  2M2L A;  1F2L A;  4XT1 B;  4EVO A;  2A69 D;  5C5M A;  5C5L A;  1JR0 D;  2X6G A;  1Q12 A;  2R3Z A;  2IJ0 A;  1FGB D;  2B39 A;  3S1N B;  1HA6 A;  1TII D;  1AEX A;  1AP0 A;  3BG3 A;  3LWE A;  1STY A;  4JK1 C;  5M5Y B;  4OGQ C;  4MHE A;  4K5W A;  3HEJ A;  2NB0 A;  2K5W A;  1EU4 A;  1MGS A;  2PNR C;  1SNO A;  3Q22 A;  2A6E D;  1D1K A;  5M3M B;  2PZU A;  4DF7 A;  1S5B D;  3MWY W;  1PFB A;  3URY A;  1ENF A;  4A3K B;  1D6E C;  2NVT B;  1K8O A;  2GA4 B;  2EYL A;  1SDF A;  4OO1 H;  3FMC A;  4ZUI A;  1I4P A;  4C2M B;  2R6G A;  1D2B A;  4NP5 A;  3HOY B;  5M5X B;  4DXF A;  1GUS A;  3RMH A;  3ND9 A;  2IT1 A;  1STB A;  5ELB A;  2EYO A;  3SE0 A;  2RBM A;  1A3U A;  3A8K E;  4B08 A;  1XX8 A;  2HDL A;  2AUK A;  3Q24 A;  1LLR D;  1SMY D;  1TWG B;  3BDO A;  1NR2 A;  2F03 A;  1DOL A;  2MUY A;  3IFT A;  4QB4 A;  4KD3 A;  2QIL A;  3H6M A;  5C4Z A;  3ITP A;  3RLF A;  4MN3 A;  3TBI B;  2R92 B;  2EPB A;  2NWG A;  3S1M B;  1I4R A;  3HZX A;  2BA1 A;  2G9H D;  4KMU C;  4U68 A;  3I3C A;  4DK0 A;  3IL8 A;  3FKI B;  5KND A;  2RDG A;  5D3I B;  4RWS C;  5I6W A;  1B1Z A;  1YNJ D;  3OOC A;  2XSC A;  3A7A B;  5CV9 A;  1BCP F;  1QNK A;  4K6D A;  2EY6 A;  2BE5 C;  1Y69 U;  2IX3 A;  2F0W A;  3MXG A;  1OXU A;  3Q23 A;  4TQU S;  4OL7 A;  4RHR A;  2JYO A;  1BCP C;  3DMU A;  3AB9 A;  3IFD A;  1F9P A;  2SDF A;  5G3L F;  5I2Y A;  2F0J A;  1U4M A;  1QWY A;  4BY7 B;  1JWU D;  1TVX A;  5J1Z A;  4I7Z C;  1EZ6 A;  1EWC A;  5EQ0 A;  3SXH A;  3KF8 A;  5CC4 A;  2L9H A;  1KDA A;  3SEB A;  4LK1 C;  5JVH 3;  3JAM E;  1C48 A;  3IKJ A;  1ENC A;  2Z1C A;  3HOZ B;  1DON A;  5D14 A;  1JQY D;  1KLU D;  1G6Z A;  5ELC A;  1W6K A;  5AFW A;  4HMJ A;  3NQT A;  3I8Z A;  1OXV A;  1KAA A;  5A2Q L;  1TS2 A;  5COR A;  3SK6 A;  3D6C A;  1II3 A;  1R9T B;  1HHV A;  1O80 A;  5ELD A;  3K5N A;  2WII B;  1O7Z A;  1KNE A;  2Z4H A;  1I6H B;  1HRJ A;  5EPL A;  5I4D A;  4KY7 A;  3RZD B;  1EOT A;  4KK7 A;  1Q8I A;  3FPU B;  1I6V C;  1CHQ D;  1U4P A;  2KA7 A;  1DYQ A;  3GP7 A;  2SEB D;  4A3D B;  2JA7 B;  2JXM B;  1GHJ A;  2EXZ A;  1LTR D;  1Q1B A;  1RJT A;  4FF2 A;  1IKL A;  3TP6 A;  2FJ2 A;  3AMU A;  1H9K A;  1LTB D;  4RA8 A;  1KAB A;  1CZW A;  3FDT A;  2EDG A;  1EY4 A;  1GUO A;  3NTI A;  4RCO A;  5ELE A;  3F2U A;  2L4N A;  4H0L C;  3SDZ A;  2XWJ B;  3D4D A;  1HQR D;  1LAC A;  2I07 B;  5IT9 E;  3TSS A;  1SEB D;  1B9M A;  1ESR A;  3GTP B;  4IQZ A;  1SMY C;  2AQ1 B;  1ZEQ X;  3TP7 A;  3A7L A;  3GTM B;  1PZI D;  1YNN D;  4ZRZ A;  3K58 A;  1NAP A;  2ICE C;  3N6R A;  4TSS A;  4KKU A;  3BDC A;  3PIP 3;  4ZKC B;  1ROD A;  2F0P A;  1RKN A;  4A93 B;  5CR3 A;  2LY7 A;  1M8A A;  3S16 B;  1MI2 A;  1Y1W B;  4RGM A;  2ZXP A;  4IUQ A;  2K1B A;  1B3A A;  2PO4 A;  5KYI A;  1EEF D;  4X3S A;  1DXM A;  4QMG A;  5IOC A;  2DY8 A;  2NYZ D;  4PQX A;  2O4X A;  2EJG C;  2DY7 A;  5C0X J;  4DAP A;  1S5D D;  1SYG A;  2AUJ D;  1G91 A;  4A3B B;  4V19 0;  2YYZ A;  1U9R A;  5CV4 A;  3VR4 A;  4HSV A;  1OXS C;  3DEO A;  4BBS B;  4ZQ3 A;  3KBG A;  3L9A X;  2KEC A;  4EQO A;  1CFM A;  2B2U C;  1LTT D;  2PQE A;  2C9O A;  1IW7 C;  1K83 B;  4RGN A;  3G7L A;  4Q0F A;  1WD1 A;  3AU7 A;  1A3V A;  1SAP A;  3RD4 A;  4FF4 A;  1E2V A;  5M3F B;  3J7A F;  1T5X D;  1RTO A;  4FXG C;  1EU3 A;  1UAP A;  1X3Q A;  1L0Y B;  3A55 A;  2ICI A;  4ILW A;  3DUZ A;  3K5L A;  2F0S A;  3OMC A;  2OT2 A;  1STE A;  1B44 D;  2E2I B;  1OXX K;  3K0Y A;  1EY6 A;  4FYD A;  2FMC A;  3I4L A;  1SE2 A;  4C56 C;  2K5Q A;  5C3E B;  4IAL A;  3J80 L;  3BYY B;  2XWB B;  1GOZ A;  4B9X A;  3D6W A;  4YIJ A;  2QEJ C;  3G6J B;  2EYF A;  5LHY 1;  1RTN A;  5JOB A;  3U9O A;  3MXP A;  2Q8R E;  1TKW B;  5FO7 B;  2B2V A;  2FIN B;  1LTG D;  4RGO S;  2F0K A;  5COY A;  3J7A V;  2CQA A;  5JAV A;  2EYJ A;  2IX1 A;  1QCB D;  4QCL A;  5DNF A;  3N52 A;  2HUG A;  4R8I A;  3W3A A;  1CK1 A;  1SNP A;  2L5T A;  4BA1 I;  5CBA E;  3EQL C;  3NSW A;  3MTS A;  2IL8 A;  1PRT B;  5EGT A;  2BE5 D;  4FXD A;  2Q8T A;  2PW5 A;  3BYT B;  3HGB A;  2K03 A;  1PLF A;  1S5C D;  1RF2 D;  1BCP D;  1SYC A;  4ULL A;  3NQI A;  5ELF A;  2NVY B;  4MIU A;  2M9V A;  1HFG A;  4PV1 C;  4KD4 A;  1JOQ A;  1LT4 D;  1J8I A;  1ILQ A;  1Y8N B;  2HCI A;  4XYQ A;  5C4J B;  5G3L D;  1ML0 D;  5KNC A;  4IZ8 A;  5A35 A;  2LMC B;  4FF1 A;  1B2T A;  3KLS X;  3PUW A;  4L6T B;  1CHP D;  5JEA G;  1Z7T A;  4K6L A;  2ENB A;  2HDM A;  2FFK B;  1GJX A;  1SNQ A;  3VR2 A;  2EY2 A;  4L8J A;  3K59 A;  1MSG A;  1DM0 B;  1B4O A;  1SND A;  4BS9 A;  1R4P B;  2EVB A;  1EQV A;  2N55 A;  5CBE E;  1G8Z D;  1WTV A;  1AFP A;  4H44 C;  2O2L D;  1CT1 D;  4CHT B;  1HTP A;  3MXN A;  4LAA A;  2IPK D;  4KN7 C;  1FYC A;  1WTP A;  1I4G A;  1HPC A;  3HOW B;  1G29 1;  2MHV A;  4C3H B;  3GQB A;  3R3O A;  1SNM A;  3TP8 A;  1I3Q B;  1HQM C;  3HKZ B;  1TU2 B;  4IUR A;  3CQZ B;  1DOK A;  3PUZ A;  4C3I B;  2K6A A;  1NUC A;  1NSN S;  4OHJ A;  3GD7 A;  3GTK B;  3PMF A;  2KHS A;  3P7J A;  3X3M A;  4H13 C;  3C2P A;  3OWF A;  5BN4 A;  1K8M A;  5FLX E;  1I4Q A;  1A6X A;  5IGC A;  2EE1 A;  2DN8 A;  5JJZ A;  2PYK A;  2E2J B;  1RHP A;  3C1E A;  1PMR A;  2MGS A;  2B2W C;  3OHX C;  5C3W A;  3P75 A;  1HFN A;  3I72 A;  1D5X C;  2Y0S B;  1GXD C;  4Z9C B;  1JCK B;  1HUM A;  5IGD A;  3MAQ A;  1PTO B;  3BVM A;  4C3J B;  3MEH A;  1VMP A;  1WTX A;  3CKI B;  1JE4 A;  3JAM L;  3SHL A;  1JOO A;  4XIG S;  3FVQ A;  1F2Y A;  3LX0 A;  3S15 B;  2WAQ B;  3DHQ A;  2V4D A;  1RCV D;  4JBW A;  1WTQ A;  2MPM A;  3W2D A;  5JPM C;  4KJN A;  2ID0 A;  2H1E A;  4G57 A;  5EBD A;  2B8G A;  2RQX A;  4KHZ A;  2CVR A;  1D5M C;  2WV6 D;  3SVM A;  2L1B A;  4BBR B;  4UDU C;  4CJ2 C;  1LTA D;  4DN4 M;  1TS4 A;  3S1Q B;  4QUC A;  5CV5 A;  3ZYY X;  3PIO 3;  2M00 A;  1TQO A;  2RDF A;  5IIF A;  4DAV A;  4X3K A;  3TN2 A;  1SXT A;  3L3O C;  2WKC A;  2VUM B;  3SR1 A;  1SYE A;  2RSO A;  1GUW A;  2ZXR A;  1Y8O B;  1VCI A;  4J6H A;  2D62 A;  1F9Q A;  5FK9 C;  3LNN A;  4M1U B;  2F0N A;  3D31 A;  1H9M A;  4TRD A;  1IW7 D;  2XN9 C;  2E76 C;  4S3S A;  4KKS A;  5KEE A;  3DWP A;  5EKL A;  5JEA H;  1EZ8 A;  2KUM A;  3J7Y W;  2O5J C;  5C4X B;  4XDX A;  1F77 A;  5IT9 L;  4KJO A;  2CHB D;  1Z6H A;  4RGT A;  3I4N B;  1AZP A;  5F2D A;  4RHS A;  2IWH A;  3A54 A;  4OIK A;  4XT3 B;  5EKK A;  1D5Z C;  2XRQ D;  3MZ5 A;  2OXP A;  1HCZ A;  2JSO A;  5IGF A;  1EL0 A;  1CM9 A;  4G7Z C;  1SE3 A;  1F9S A;  2B2U A;  1QB5 D;  1HXY D;  3R2I A;  3MFG A;  4HN7 A;  5D65 A;  1CZG A;  1EQT A;  2BOS A;  1PRT F;  1EIG A;  1MD2 D;  1LO5 D;  1O7L A;  4F88 A;  3NK9 A;  3PO3 B;  2B2Y A;  1PRT C;  1SYB A;  1PTO H;  4EQP A;  3K6O A;  4PNY A;  3GTJ B;  4KI0 A;  1GUN A;  2JA6 B;  3RZO B;  2NVX B;  1OXT A;  1LV9 A;  3PO2 B;  1EFI D;  4CBV A;  2WP8 J;  1JOR A;  2K05 A;  1FNW A;  2K5D A;  3T51 B;  1KDB A;  2QF7 A;  4LJZ C;  1LT5 D;  1Y8P B;  2Q8I B;  3PUX A;  3OW7 A;  2AQ2 B;  5DM7 3;  1U4R A;  1S5E D;  3M7G A;  1MBY A;  1IKM A;  4HAE A;  1ONL A;  5ISR A;  2QKI C;  2NTT A;  1PFM A;  3D4R A;  1RDP D;  4NDX A;  2NZ1 D;  3CRL C;  3E0J A;  3ONA B;  4IUV A;  3DEP A;  5T1G A;  1SFO B;  2NVQ B;  2F3V A;  2RDH A;  1U4L A;  1SSO A;  3C1F A;  1V8Q A;  3K7A B;  1V43 A;  3OMG A;  3HG9 A;  5J39 A;  4PMC A;  3LWU A;  3VYU A;  1UUP A;  1JB3 A;  3NPP A;  3S1R B;  3MA2 B;  2NN6 I;  1L0X B;  1V1O A;  2MP1 A;  2EJM A;  1B53 A;  4AYB B;  1KTK A;  1JIC A;  5DM6 3;  5C44 B;  5I2X A;  3TZD A;  1EY7 A;  2B2T C;  5IGB A;  2EZV A;  1WVL A;  3GTG B;  4FO2 A;  4FVM A;  3T56 B;  4DK1 A;  3EJI A;  2KEE A;  4KV6 A;  5IGG A;  3I73 A;  2BA0 A;  5LL6 X;  2MJ8 A;  3QOJ A;  3TP5 A;  2FMM A;  2QCP X;  4F8M A;  3TZU A;  1NR4 A;  2ZXO A;  2E2D C;  2XNA C;  3A8J E;  3KBX A;  1EYD A;  1QNU A;  4I65 A;  2BDO A;  3QOL A;  4C1N I;  4BY1 B;  1TS3 A;  4H7B A;  2JEB I;  4XXE A;  1SJE D;  1ENA A;  3VR3 A;  2SNS A;  2Z8L A;  5HGT A;  4NMZ A;  3EFX D;  2J4X A;  1PFN A;  1ZYR C;  2G9D A;  3FPP A;  1SE4 A;  1TWC B;  4U67 3;  1BOS A;  1PTO C;  1LTS D;  4P2C B;  4FF3 A;  3OIP A;  2NN6 H;  4G7H C;  4ME5 A;  3BS1 A;  1BR9 A;  1DOM A;  1W6J A;  3ERQ A;  3VYR A;  1JOK A;  4K2K A;  4KY6 A;  3TME A;  4PMW A;  1DCZ A;  3D8G A;  1OO9 B;  2NTS A;  1CI3 M;  3GO5 A;  3C3L A;  3M4O B;  1F9R A;  1IYU A;  1GHK A;  3I4M B;  5FKA C;  3SK4 A;  1KLG D;  1QG7 A;  3HP3 A;  1FNV A;  4ODG A;  3M85 A;  4EGV A;  3NWT A;  1AW7 A;  2IX0 A;  1ILP A;  5DAU A;  2AWN A;  2KVM A;  1SYD A;  4X3T A;  4A3F B;  4A3G B;  3R2T A;  3J81 E;  2KQ3 A;  4RH6 A;  3IAY A;  1WD0 A;  4J1M A;  2LKV A;  2B2W A;  3KK7 A;  5I9P A;  3NHH A;  3V2T A;  5EKI A;  4HCE A;  3E6Z X;  3EVQ A;  2WKD A;  1EY0 A;  1NCV A;  4ZYS A;  4RFB A;  2E75 C;  2PZT A;  3HOX B;  5C4H A;  1XWE A;  1XYI A;  3VA5 A;  1A2T A;  3PV0 A;  1PYW D;  5FO9 B;  4IUT A;  3DM1 A;  3NUC A;  4X3U A;  2K28 A;  4R8N A;  2KOL A;  1SBB B;  3TDQ A;  5FLX L;  2DNE A;  2QDB A;  1STG A;  1GUT A;  2EY1 A;  4CKB A;  5JVG 3;  2BDN A;  4RKB A;  4IFD I;  4A3E B;  4E6I A;  3D4W A;  1PXU A;  2OF1 A;  5D3D A;  4C3H G;  5FOB B;  4DXG A;  1Q3L A;  3VR5 A;  3M3Y B;  5IGE A;  5E1F A;  3DWQ A;  3QO2 A;  3SK8 A;  5K5P A;  3DWA A;  2VB2 X;  3C46 A;  4DNR B;  2EYP A;  1WTR A;  2X6L A;  4C3I G;  3KUP A;  1T5E A;  5CYU A;  1F2Z A;  4DFA A;  1X32 A;  3SK5 A;  1IHZ A;  1VF5 C;  5JEA J;  3GTO B;  1XTC D;  1STN A;  4FNF A;  4DAY A;  2PPB C;  3HRZ C;  2JP1 A;  3E5S A;  2BCO A;  2AWO A;  5E4W C;  2JEA I;  1A15 A;  1PRT D;  2NBF A;  2RSN A;  4CJ1 B;  3VYT A;  3FEW X;  1G2S A;  4C3J G;  1EWH A;  3QG1 A;  4K14 A;  1HTL D;  1I4X A;  2N88 A;  4IFD H;  5I6Y A;  1VMC A;  1DZ1 A;  3WOE A;  3I90 A;  1Z47 A;  3H09 A;  1BQQ T;  1BNZ A;  3T16 A;  1BF4 A;  2JA5 B;  1Q90 A;  1EEI D;  2OEO A;  5C3X A;  1V1P A;  2F4I A;  4V0B A;  3NP8 A;  2L11 A;  5EJW A;  3D3R A;  3QIA A;  2B2V C;  4QF4 A;  4CKC A;  4CGY B;  4F87 A;  3K5M A;  1FD7 D;  4IN3 A;  2VB3 X;  4EQN A;  4IUU A;  2A73 B;  3VR6 A;  1CA5 A;  1LTI D;  2L12 A;  1TR5 A;  2F1M A;  3QWN A;  1HUN A;  5KNB A;  1H9S A;  1TWF B;  1FR3 A;  1LT3 D;  1SNC A;  4ID6 A;  2CW0 C;  1DD2 A;  3BVZ A;  4K2L A;  3O13 A;  2EYH A;  4XTC S;  3L7Z C;  4XQQ A;  1CQV A;  2A6H C;  2LFN A;  1Q1E A;  2KCN A;  4XYO A;  1C8C A;  4WOR A;  3NTK A;  1SJH D;  1EIH A;  5E3F A;  1S4Z A;  5JPN C;  4A3M B;  3I70 A;  1ET9 A;  2VXW A;  3MVV A;  3NXW A;  1WTW A;  2NUC A;  3QB3 A;  4XQN A;  1QJO A;  3MXU A;  3BDL A;  2D5D A;  2F0U A;  4O1N A;  5M9O A;  3H91 A;  1TS5 A;  2KCC A;  4TKO B;  2H4O A;  2E74 C;  3NBI A;  3PUY A;  1BDO A;  4CKE A;  3MFY A;  2RVL A;  1CA6 A;  5HUR A;  2VNU D;  4ZAI A;  2WIN B;  4FP5 D;  2A68 C;  4K5V A;  4Y7N B;  1LT6 D;  3NTH A;  2B2T A;  1M4V A;  2PCF B;  1Y1V B;  1ZYR D;  3GTL B;  5I9O A;  5KGU A;  3VYS A;  1E2Z A;  1EYC A;  1PTO D;  3H94 A;  4BWG B;  2DNC A;  2SOB A;  1C4Q A;  3V96 A;  2A69 C;  2JE6 I;  4DGZ A;  2NN6 G;  1S5F D;  1DJR D;  2J7Z A;  1JWS D;  5DEH A;  4KY5 A;  2F0Q A;  3ERO A;  5LL6 S;  2C5C A;  4PMB A;  3PUV A;  1EYA A;  2F0D A;  1ICW A;  1O7Y A;  1B9N A;  1E2W A;  2XVS A;  4WRD A;  3FRP B;  3S9W A;  5EBC A;  1BO0 A;  2EJF C;  4HMI A;  2B63 B;  2I46 A;  3S2H B;  1H9R A;  2RA4 A;  2A6E C;  2JA8 B;  4DNT B;  4FXK C;  5CMD A;  1MSH A;  2FHT A;  2HCC A;  3P20 A;  2K32 A;  2WAC A;  4HED A;  1I50 B;  2K04 A;  4C1N K;  3MHB A;  2F0I A;  3V05 A;  2KED A;  1B50 A;  3OIQ A;  4QIW B;  1E0B A;  5BN3 A;  4B9W A;  2D9U A;  5K36 G;  1ET6 A;  2L55 A;  4LMQ D;  3KLS A;  3OSO A;  4CJ0 B;  3H3V C;  3S2D B;  1WTO A;  3HOV B;  2XIW A;  3P1H A;  1PDQ A;  1SYF A;  4WFN 3;  3BVG A;  4DU9 A;  5NUC A;  3DXJ C;  3K5O A;  3M7N A;  1QOH A;  3GV6 A;  1D1I A;  1GUG A;  1AZQ A;  4K5X A;  4L63 B;  2EYM A;  2F0F A;  5T1I A;  5J22 A;  1TT2 A;  3U9S A;  4UAI A;  5A2Q E;  1EY9 A;  2IW3 A;  2HQE A;  1PZK D;  2K33 A;  2F0L A;  4RAU C;  5C0X G;  1PZJ D;  3H0G B;  3GV3 A;  1STA A;  4G7O C;  3R93 A;  2AQ3 B;  3Q6S A;  4RKL A;  5EPK A;  2ZT9 C;  4WJW A;  1QE6 A;  2Z4I A;  1AN8 A;  2K01 A;  4Q5V A;  4R9W A;  2TMP A;  4N9P A;  2R7Z B;  2TSS A;  3NBH A;  5CV7 A;  1KNA A;  3BZD B;  4HSP A;  5IOD A;  2D2C C;  4DA2 A;  1YNJ C;  4HR7 B;  3T53 B;  4QUF A;  1XXG A;  2PMZ B;  2O5I C;  3KLR A;  1LAB A;  2PW7 A;  5CGK A;  3OWE B;  2F0T A;  3J81 L;  1UEA B;  2A74 C;  5M5W B;  2K7V A;  1BXT A;  3NE5 B;  1TWA B;  3X3N A;  3NWS A;  1G2T A;  4HCS A;  4IUN A;  1F2M A;  2F0M A;  3M4Y A;  4KN4 C;  5BN5 A;  2KJX A;  2XRS D;  4ABN A;  1BCP B;  1PTO F;  4K8I A;  2SNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...