3FDTA

Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Chromobox protein homolog 5
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fdtA00
1F9SA 2KEEA 2K1BA 3N52A 4HEDA 4ZK9B 1PFBA 4U68A 1G91A 1IL8A 1AZPA 3KUPA 1KNEA 1PDQA 2KOLA 4IUTA 3I90A 3KBXA 1A15A 1CA5A 2FINB 3SVMA 5CBEE 1QG7A 4HSVA 4X3SA 2DY7A 2FJ2A 4NW2A 4X3UA 1M8AA 2DY8A 1QNKA 1J8IA 2M2LA 1GUWA 1O7ZA 3HP3A 5JJZA 3R93A 1BO0A 2FFKB 2L9HA 2B2WA 5CORA 1EL0A 5EPKA 1HUMA 1TVXA 2EE1A 2MPMA 1WTVA 1KNAA 2N88A 4R9WA 1RTNA 5EKIA 1J9OA 4MHEA 1ILQA 1U4RA 4ZKBB 1XYIA 1WTOA 2B2YC 1RHPA 1F9PA 1ML0D 1JICA 2FHTA 5DNFA 1MSHA 1MI2A 4IUQA 1B4OA 4ZAIA 2HCIA 4O42A 1B53A 3F2UA 4RAUC 1WTWA 2KECA 3GV6A 3I8ZA 2Q8TA 4XT3B 1ESRA 5EQ0A 4XDXA 4R8IA 1WTXA 1O80A 1B50A 2K01A 4X3TA 1BBXC 2L4NA 1DOMA 1SDFA 2J7ZA 2MGSA 4CJ0B 2NZ1D 3QO2A 1O7YA 3P7JA 1X3QA 5E4WC 1BF4A 1HUNA 1X3PA 1S4ZA 1WVLA 4ZKCB 3DEPA 1Q3LA 1WD1A 1U4PA 1NR4A 2X6GA 3IL8A 4CJ1B 2KVMA 2B2YA 4MN3A 1EIGA 2L1BA 4HAEA 4DN4M 1B2TA 1HFNA 1G2SA 3G7LA 1C8CA 5D14A 1EQTA 5CBAE 1WTQA 1E0BA 4QUCA 3DM1A 1SSOA 2L11A 2X6LA 1QE6A 1MGSA 1U4MA 3UI2A 1ILPA 1DONA 1ICWA 2H1EA 2B2TA 4XT1B 2MP1A 1WTPA 3FDTA 1CA6A 1AZQA 4IURA 2X69A 1DZ1A 2JYOA 3MWYW 4QUFA 1EIHA 1ZXTA 5T1IA 2BDNA 1RODA 2KEDA 2RSOA 3TZDA 2B2UC 2L12A 3GV3A 4IUPA 1WD0A 5AFWA 2B2TC 1F9QA 2JP1A 3DEOA 4UAIA 5CMDA 2RVLA 2HCCA 4OIJA 1NR2A 1PFNA 2EPBA 1IKLA 3Q6SA 5EPJA 1BNZA 1VMPA 1XX8A 1EOTA 2HUGA 5EPLA 3FPUB 1HHVA 1DOKA 1RJTA 4RA8A 4OIKA 1G6ZA 3D6WA 1HRJA 2B2VC 3IFDA 1HFGA 1DOLA 3I3CA 3TN2A 2KUMA 2RSNA 5E4XA 1AP0A 1JE4A 1X32A 1F9RA 2NWGA 4LMQD 2RA4A 2B2UA 2IL8A 3ONAB 1LV9A 2SDFA 4IUUA 1HA6A 2XIWA 2K28A 2NYZD 3LWEA 2VXWA 2N55A 5COYA 1VMCA 2R3ZA 2CVRA 5D65A 4X3KA 2HDMA 1SAPA 2Q8RE 2EOTA 3MTSA 2K03A 1IKMA 1CM9A 1RTOA 1U4LA 2K04A 2MJ8A 2HDLA 1F2LA 1NAPA 1NCVA 2K05A 4HCSA 4IUVA 4RWSC 4CJ2C 4ZLTF 2B2VA 5EJWA 1PFMA 1G2TA 5T1GA 1B3AA 1PLFA 1MSGA 2B2WC 1WTRA 3H91A 2FMMA 3I91A 2D9UA
chains in the Genus database with same CATH superfamily
3LGJA 2D62A 4C1NI 1SMXA 4WJ3M 2AHOB 2E8GA 2Z1CA 2ZT9C 5ISRA 4EQNA 2VNUD 2ENBA 3TRZA 1U5KA 3RN2A 2LMCB 5C44B 4HJ8A 2M2LA 1OXSC 1STYA 1BBWA 1TU2B 1VCIA 5IYBG 3VR4A 5FLXc 1NNXA 2VB3X 1I50H 4FXDA 1A3UA 2D0PA 1LT5D 1BXTA 3F2UA 4RAUC 5F2DA 3ZYYX 1XPUA 1FNVA 1OO9B 2R6GA 5EQ0A 1NY4A 4XDXA 1LACA 4JI1L 4F87A 4GN5A 3VYTA 5A2QL 3J7ZC 1BF4A 3DWQA 2QCPX 3L7ZC 1AEXA 2VB2X 4RKBA 1A3VA 1HUNA 2EY5A 1WVLA 2CCZA 4CJ1B 1XNQL 1SEBD 4A3MB 2NTSA 4MTKA 4YY3L 5M3MB 4P72A 3P75A 4HR7B 4C2MB 2PI2A 4G7HC 3CHBD 2D0OA 3HOVH 1HZBA 1U4MA 4TRDA 1QUQA 2IHEA 1GUOA 3PIP3 1SYDA 2X69A 4JI7Q 1EEID 3MFYA 1STHA 1WD0A 1CHPD 5AFWA 1NBWA 3SK8A 2EYMA 2DGYA 1I6HB 3MAQA 1H9KA 1BNZA 3A55A 4X65L 1A8VA 1RJTA 4IUNA 3S1NH 1EYDA 4B3TL 1O7IA 2HD3A 2SNSA 1JJGA 3CCEA 2SEBD 4C3JB 1VQHA 5IYCG 2WINB 4G7ZC 4JI0Q 4LFBQ 4K6DA 2DJGC 3A7AB 1K9MC 4NXMQ 1QVFA 4LF7Q 4LF4Q 1EFID 2JA8H 5I6WA 2R7ZB 2WFWA 2R7DA 4GLVB 1B3AA 4JI5L 4IPGA 5IP7G 4QMGA 4R4CA 1SNQA 4HEDA 3K8AA 4KMUC 2NTTA 1PH8A 1SE2A 1TR5A 3GTQB 2PZTA 5CBEE 2ASBA 2K14A 1Q86C 2CH4W 1I6VC 2F4VQ 4APVA 1QNKA 3RNUA 3CPFA 1CTMA 3HKSA 3VDYA 1TVXA 3E5SA 5BR8Q 5EKIA 1EOVA 1V1PB 1XYIA 3NELA 3K5LA 4C3HB 1PH3A 5LHY1 3FKIB 3U4ZA 3KOJA 1UNSA 1IW7D 3K5NA 2KECA 1EZ6A 3NBHB 3CCUA 2K01A 4X3TA 3P7JA 2R7ZH 5EKKA 2WAQG 1MHWC 1K8GA 1AN8A 1EIGA 1PFSA 4P71A 3H3VI 4HJ7A 3QOJA 4KHVA 4RGNA 1UE1A 1M1KC 4KD4A 4JI7L 1PRTC 3HOUB 1EY7A 4XIGS 1QJOA 1VQJA 1JWSD 5C44G 1AZQA 4IURA 2JYOA 1VQCA 1CKMA 4YWKA 5CMDA 4QB4A 3GTPB 1XXGA 1DM0B 2D2CC 2RVLA 4HIOA 4L5SA 2XRSD 3BJUA 1PRTD 3A8IE 2WB1B 1UE5A 3BVZA 2K32A 3A0JA 1LTBD 4HIKA 1HFGA 1HNZQ 4JI0L 2JA7H 4LFBL 4K8IA 1PH4A 2NWGA 4NXML 4LF7L 4LF4L 4IFDH 2KCTA 2R61A 3D4WA 4JBMA 3LWEA 1IBMQ 5C0XI 2ES2A 2Q8RE 4KY5A 4OXPA 4A3MG 2QEXA 1CM9A 1W6KA 5M3MG 2JA8G 2F1MA 4KK7A 4IUVA 2F0WA 3CCVA 2NB0A 2SOBA 1X3FA 1TS3A 2NZHA 2WIIB 1SN8A 3I91A 3HOUH 2ZTEA 2E2JB 2QW7A 1SYFA 2ID0A 3N52A 4OWXB 1G91A 3OMCA 2F4VL 3KF8A 1IL8A 1AZPA 1KXLA 5IP9H 1KNEA 4GOPA 4R4IA 3KF6A 3C1EA 2PCFB 3BDOA 4NW2A 5C5LA 3GTPH 1PTOB 5BR8L 3E0JA 2KA7A 1XNRQ 1EL0A 4EGVA 2LS01 3UDFA 1AE2A 1E3PA 1LLRD 1LM0A 3N6RA 4DR6Q 1C48A 1LT3D 4R4TA 5A2QE 1OTCA 4C3JG 2PW5A 3J81j 4A3GB 3KLRA 3T16A 5CC4A 1PVOA 4IZ8A 1Y1WB 1ZYRD 4DV1Q 1TWFB 1SFOB 4LUOA 4EQPA 1O7YA 3K0YA 2R7ZG 4GKJQ 1AFPA 5FO9B 1Q1EA 1Q3LA 1TWGH 1PH6A 4ILWA 1X3GA 2JA6H 3VYUA 4IOAA 5KYLA 1B2TA 1N34Q 4C1NK 4B9XA 2Z6BA 1EQTA 4J15A 5CBAE 4KN7C 3D8GA 2IY5B 1FD7D 1EU3A 4YIJA 4A93H 4C56C 1SYCA 1HZAA 3QOLA 1XTDA 2Z4IA 4PV1C 4N9TA 4CDCC 3M4YA 1HNZL 2Q2HA 4C3HG 2JSOA 1PA6A 1PYBA 3FKIG 2DJFC 4X66Q 3FPUB 3G48A 3GTJH 5FJ8G 2K5QA 1GUNA 1IBML 2JEBI 1TWFH 1X32A 3EA6A 5D3IB 4DR3Q 4HTHA 4IFDG 2KCCA 5ELEA 3Q24A 5BN3A 1X9NA 1VS0A 2CWPA 2R3ZA 3ICEA 3M85A 3RLFA 1B70B 5JEAJ 4O1NA 2KHJA 2K04A 4V190 5IGBA 3PIPA 1QNUA 5KRUA 2OTLA 3HOUG 3F1ZA 4DXFA 2KEEA 4ZK9B 5HY6A 2NVQB 4PZ6A 1Q12A 2JQOA 2IT1A 2PMZB 3MXNB 5LMUQ 1VQ6A 2A5HA 1XNRL 3M4QA 4DKAC 1TWAB 4RCOA 1GHJA 1VQLA 1J8IA 2K7VA 4DR6L 5K5PA 2WB1G 3HOZB 4BBSB 3T56B 4KKSA 1TWCB 1ILQA 2GVBA 4DV1L 1I3QH 3HRZC 1EZ8A 4EVOA 4IUQA 3EROA 1NSNS 4ZAIA 3I2ZA 3MEFA 4KI0A 4O42A 3JC66 3HOXB 2XVSA 1BBXC 1HR0W 3OYYA 1N34L 5E4WC 1S5BD 3V96A 2F0TA 2NN6I 3HOYH 2IPKD 3TREA 3WOFA 4OWTB 4BA1I 5C4JH 2MO1A 3DWAA 4FP5D 1HFNA 4JI4Q 5NUCA 2XGTA 1IZ6A 2WAQE 1T9HA 1WJJA 3NWSA 5D14A 1YHQA 1QCBD 1D5ZC 1WTQA 4OEMB 3CCQA 1WFQA 3L0OA 4DGZA 4GOPB 1MGSA 4DAMA 3OW7A 1EWHA 4A93G 1IBLQ 4MNOA 3FRPB 1RODA 1STGA 4TQUS 3HOZH 4BBSH 4BY7B 4X66L 2B2TC 4KY7A 4PMWA 1SBBB 1TWCH 4A3LH 3TP5A 3NEMA 3PO2B 2JJQA 5HGQA 4BXXH 3VR5A 4HJ9A 4DR3L 1LTTD 5CV4A 1EY0A 4A3GG 2IX1A 2E2IB 1TKWB 1Y1WG 4HIMA 2YTYA 1ASYA 3DM3A 1JE4A 1EY5A 2H5XA 4WFN3 1HJPA 4FVMA 2IL8A 3KFUA 2O5JC 2N55A 1YJNA 3TP7A 3ND8A 2F0KA 3HKZE 4FDBA 5C3EH 4Z9CB 4J1MA 2A69C 2K03A 4Y7NB 2C5CA 1NAPA 4ID6A 3Q0AA 3P1HA 4Q0FA 4BWGB 2NUCA 4EQOA 5LMUL 3K58A 3D0FA 4O0AA 3OOCA 3I4NH 4X6AH 4AQYQ 3RN5A 4JYAQ 2IHFA 1CUKA 1Z6HA 5KGUA 4A3JH 4PZ7A 4BY7H 3SEBA 2A6ED 2EXZA 2V1CC 4YCVA 1YNJC 3AFPA 3KDFB 3Q8DA 1Y1VB 2FFKB 2L9HA 1KAAA 1ONLA 3E6ZX 4JC0A 4MHEA 1RD9D 3H3VH 3GTKH 2A6HC 2R92H 5KIXA 2L55A 2D5DA 5J39A 2EIFA 1YNJD 2F0PA 1A0IA 1ESRA 2OF1A 2R93B 4JV5Q 3O13A 1LYLA 1SDFA 3W1GA 4JI4L 1O78A 1S4ZA 1SE4A 3S16B 3HOYG 2WKCA 3IL8A 3OMGA 4A3CG 4K5VA 2A6HD 4MN3A 2K33A 2XN9C 4DR2Q 1JJCB 2QGQA 3T13A 3Q22A 4TVAB 1DYQA 1IBLL 1E2VA 3LNNA 1QWYA 1DONA 5IWAL 1Y8NB 1DJRD 1R9TH 3FDTA 1LT4D 3MWYW 3J7AV 3PF4A 1NMGA 1D5MC 3HOZG 4BBSG 4OO1G 5EGTA 2E2HB 1BUVT 5C0XH 1IYJB 1FR3A 4A3LG 2MUYA 4X62L 4BXXG 1VQPA 1EFWA 1PTOC 2Q2TA 1CQFA 4JI1Q 3Q6SA 3T4AC 4DNTB 1ENFA 1Z9FA 1DOKA 4DU9A 4OHJA 2B2VC 2L5TA 4OELB 5M5WB 1I4HA 3HOXG 5CV9A 1P8LA 4RKLA 4HMIA 5C4ZA 2R93H 3W3AA 2IJ0A 1BCPB 3J80L 3G71A 4LF5Q 1Z7TA 5TSSA 5FO8B 3VA5A 2ZTDA 2CVRA 3IFTA 5C3EG 2EYHA 3HFZB 2FMCA 4RMFA 1FNUA 3I73A 1KABA 3GO5A 4AQYL 1SNOA 4X64Q 2BH2A 4JYAL 2FXQA 3BVMA 3K80C 2F0QA 1B9MA 1MSGA 1TWHH 2B2WC 4JBWA 1CI3M 1V1PA 1KDAA 4RG1A 4A75A 2YTXA 2IX3A 2RCNA 1PDQA 1DXMA 4IUTA 4BY7G 1CA5A 2AMCB 2E2HH 4B3SQ 3NBHA 4DAVA 2FJ2A 4K5WA 2DN8A 3T53B 2CHBD 3K59A 4B3TQ 3PO2G 1X6OA 4B3RQ 3UE1A 5E1FA 1O7ZA 3GTLH 1EY4A 5DAUA 3DWPA 5ELOA 3NTKA 2ICEC 3TP6A 5FKAC 4HIDA 1HTLD 3ZJYC 5M5WH 2WB1E 4JV5L 1Y8OB 3J80i 3JAML 2ZXPA 3S2HH 4IPHA 4KLKA 1B53A 4NP5A 1STAA 4O2DA 1G6PA 3EJIA 4A3DH 4JI5Q 2JK8A 4XQJA 3HOVB 4DR2L 2AWOA 2J7ZA 2NZ1D 1VDZA 2HT1A 3R8BA 2RHQB 4LK1C 4KY6A 2VQFQ 4ALPA 4JBKA 3AEVA 2L15A 2CWAA 1PRTF 3MXGA 3CCMA 3G7LA 5CV6A 1NJIC 4DV0L 1PV4A 2Z8LA 1JWMD 3KLSX 4F88A 3S1NB 1LT6D 2QA4A 1TS2A 4P73A 1ICWA 4LF6Q 2N3SA 2OT2A 1KD1C 1EIHA 1Y1VG 3HKZB 3PF5A 1DGSA 1IHZA 2Q8IB 4HCEA 1PYSB 2F03A 5LL6S 2I0QA 1S5ED 4A3EH 3EIVA 1IKLA 1C9OA 2I5MX 3BYYB 3OWFA 5DM63 4DV5Q 1HHVA 2JA8B 4LF5L 3EVQA 5M3FB 4QGUA 2RF4A 1KTKA 4HJAA 3CCLA 2GVAA 4QF4A 2QILA 5KNCA 2R93G 3VYRA 1KAWA 1GHKA 4ZUIA 4GN3B 3PQIA 1LV9A 3K5MA 3FMCA 1K83B 5IOCA 4X64L 4LUZA 4AIMA 1C7YA 4CBVA 4CDEC 3E9HA 4DR1Q 1QVCA 1F2LA 1WI5A 2K05A 2PYKA 4KJNA 2B2VA 1E7ZA 2LSSA 5T1GA 1PLFA 4ZUJA 4Y52H 1V1OA 4B3SL 4R4OA 5E3FA 4B3RL 1IXRA 2NZOA 4YCUA 2KOLA 4PZ8A 3KBXA 1F2YA 3I70A 1L0WA 2QDLA 1M8AA 4BY1H 1I94L 4GOPC 2YTVA 3GQBA 4DV2L 1GUWA 5JJZA 4V0BA 4L6TB 5FK9C 2B2WA 2MNAA 2NN6H 2MPMA 1LTGD 1CZGA 2HIVA 4DUZL 5M3FH 1A2UA 1G291 1BOSA 2CQAA 3QJYA 2O5IC 2B2YC 5HGTA 3WWVA 3BZCA 3QB3A 3FPPA 5DM73 1B4OA 1CZWA 2ALYB 4ME5A 4DV6Q 3TQYA 3U58A 3GV6A 1K83H 5IYDH 1FJGL 3KLWA 4EQ5A 2VQFL 1T5EA 5JVH3 1H9RA 3HS0C 1IW7C 4NXNQ 4QL5A 3DEPA 1NR4A 3MHBA 2F52A 4DV4Q 3HZXA 1I4XA 4LF6L 2BA1A 3NTHA 3J81L 1M90C 2XNAC 3A74A 3QIAA 4IFDJ 3RZDH 4LW1A 1KLUD 2K5WA 2JA7B 1G8ZD 3UDGA 2XWJB 4A3KB 2PMZE 5IGDA 1YBYA 2YYZA 1LTID 3C46A 5T1IA 1GOZA 4KKTA 3A5ZB 2B2UC 4DV5L 5FOBB 1F9QA 3H09A 1T5XD 1YNNC 1EQRA 2ZXRA 4OIJA 5JPNC 3CCJA 1S72A 5GAHC 1CFMA 5I9OA 4HJ5A 2J4XA 3J80E 2HUGA 1W3SA 1VQ5A 1XJVA 4RA8A 4A3IH 4OGQC 3D6WA 2OWOA 5M5XH 1K28A 1D5XC 1PYWD 3SR1A 2RSNA 2M00A 3GTMH 1F9RA 3M7GA 3HOVG 2F3IA 3SXHA 2EJGC 4DR1L 3RD4A 3SDZA 3MXNA 1JB7A 1YNND 2NYZD 4B3MQ 2VXWA 5LMNQ 5I4DA 1EEFD 3SK6A 3D6CA 2TMPA 2AQ2B 1PXUA 2I5HA 1AH9A 1CQVA 4ZYSA 2Q2IA 4L5RC 2EY2A 3K7AH 2PO4A 4A76A 2F0NA 4JBJA 4JI6L 1N32L 4A3KH 1JORA 4J8QA 1IYVA 4FXKC 3HKZG 3P20A 4IO9A 3UE0A 1GM5A 2DY7A 3RUZA 4OWWB 3PIOA 3F8TA 1BO0A 1PZJD 2VS1A 1RDPD 3JAME 2NN6G 4JK1C 2GA4B 1HUMA 2UXBQ 4DV6L 1FGUA 1HTPA 5M3FG 3KK7A 1TWGB 3I72A 2RQXA 1HNXL 1L1OB 4DF7A 1WTOA 3FP9A 2JA6B 1ML0D 3ERQA 1Q1BA 2F0UA 3SGIA 1B1ZA 1Y69U 1QOHA 3STBD 4NXNL 1H9SB 1MKHA 1UAPA 3H0GH 2K75A 4L63B 1WTXA 2RKSA 4DV4L 1Q81C 2KQ3A 1H9JA 4K8JA 3NSWA 3H15A 1EU4A 3KLSA 1IL2A 1BCPC 1S5DD 4A93B 1ZYRC 3GTGH 4DR4Q 5ELCA 2B2YA 4K2LA 4AYBB 1FGBD 2EJMA 3S1MH 3CKIB 3U9SA 3M9BA 4RGMA 3K7UC 1E0BA 1JC7A 2Y0SB 1SSOA 1W6JA 3GTJB 4POGA 5C6AA 2EZVA 4JI3Q 4XT1B 1BCPD 1QB5D 5IGCA 1CA6A 3EN2A 1ASZA 1DZ1A 3TBIB 2BDNA 3S1QH 4IUPA 3PUZA 3CC2A 1KRSA 2HCCA 1PFNA 1R4QB 1LTRD 2K4KA 4A3IG 4ZRZA 5BN5A 3F2CA 2QKIC 3PUWA 2B8GA 1GJXA 2AKWB 4B3ML 3NP8A 5LMNL 2RCFA 1HQMC 2LXKA 2UU9Q 2B63H 2B2UA 5GROA 2SDFA 2F3WA 4UP7A 2L0CA 2WKDA 3MA2B 1E22A 2N8NA 3KDFA 1IKMA 1AW7A 3TP8A 2HDLA 1Q7YC 4DPGA 4KD3A 1JOOA 4ZLTF 1PH1A 4DR5Q 3RZOH 3H91A 5GAGC 2NVYH 3IAYA 3E0EA 5A35A 2JA7G 4CDFC 4A3KG 1STEA 3KUPA 5CV7A 1I3QB 1TS5A 4UHVA 4R8NA 3U4VA 2UXBL 1JB3A 4IALA 3BZKA 5IT9L 1YZ6A 1D8LA 5H1SE 1MIUA 3OPOA 1HZ9A 1V8QA 1H95A 5JJIA 3OW2A 5EPKA 2A68D 5KNBA 1J9OA 3NQIA 1GVPA 1D1IA 3HOYB 1JOQA 4JI2Q 5C4JB 2EYFA 1YI2A 5IP9G 4DV7Q 1C0AA 2KJXA 4DR4L 1JQYD 5JVG3 1BR9A 2MFIA 1IBKQ 1U9RA 3CC7A 1MJEA 1C4QA 3QO2A 1H9MA 3CRKC 4PG3A 3J81E 2R7FA 3NBIA 4BBRH 5J22A 2ATWA 4M8AA 3CU7A 4HAEA 4DNRB 1B7YB 4JI3L 3D3RA 5ELFA 2F0LA 4QUCA 2NVXH 3G4SA 2BDOA 2E74C 2HIXA 2F0MA 1GUGA 3S17H 1HXYD 3CRLC 4N8X1 1PH5A 1ZXTA 5CGKA 3GTOB 1JR0D 1N9WA 5AJ3Q 1PTOF 3DEOA 1UWVA 1G51A 4P2CB 1SMYC 4WJWA 2VZAA 5C3EB 2JA6G 2UU9L 4JI8L 1K8MA 1OXVA 4NDXA 5K36H 1YHBA 1HRJA 3HEJA 5FO7B 2UXDL 1DOLA 3VYSA 1VF7A 1VQNA 4RH6A 3J7A5 2K50A 3DMUA 5EAYA 3I4NB 2RDGA 2B29A 2NBFA 4PMBA 1E24A 2SNMA 4DR5L 1SMYD 2ZJPA 4A3JB 5D65A 2BH8A 2HDMA 4AYBG 3F2BA 1J5EQ 5IWAQ 3MFGA 3CCSA 3TS2A 1NCVA 3PO3H 3DUZA 3R2IA 2Y0SG 5DLQE 1EY6A 1F9SA 4IPCA 4U68A 4X62Q 1NE3A 4IQZA 2VUMH 1KDBA 3GTKB 2HHHL 1TQOA 1WTHA 5CR3A 5C4XB 3GTOH 3VA7A 2A19A 3TZUA 4RHRA 3SVMA 2R92B 4I7ZC 1N36Q 3FEWX 1HNWQ 2KHSA 2K6AA 3UDXA 1SRUA 4JI2L 3BDCA 1UE6A 1STNA 1X55A 2OCEA 1D7QA 2A6EC 1JCKB 3KBGA 4R9WA 1YEZA 4DV7L 1YJWA 1U4RA 4RFBA 1F9PA 1FVIA 1HPCA 1XWEA 3HOWH 1IBKL 1D6EC 3EFXD 4RHSA 4LUVA 1JT8A 2DNEA 4XT3B 3BS1A 1DOMA 1R9TB 4MZ9A 1X56A 1Q8IA 4BBRG 2JA5H 1ET9A 1U4PA 1QZHA 1FL0A 1HCZA 3BDLA 4RGOS 2KENA 1VQIA 5ELNA 2F0FA 1VQOA 2IW3A 1G2SA 2Z9HA 5C4XH 1ESFA 2VY3A 5AJ3L 2A1AA 4PNYA 2A74C 4OX9L 2H1EA 1WTPA 1V9PA 2A8VA 1BQQT 4QUFA 3J80c 5ELBA 2RSOA 2C35B 3TZDA 2L12A 4RGTA 5I6YA 1JMCA 3X3NA 3S2DB 4ULLA 1OXXK 1CK1A 2JXMB 1SE8A 1F2MA 2PQAB 2AQ1B 3A56A 5EPLA 1TY2A 1R4PB 5K36G 4A4IA 1SYEA 1VQMA 2K5VA 1PH7A 5IE8A 3TN2A 1K3BC 1TWHB 1L1OC 1GO3E 1J5EL 4IUUA 2K52A 4POFA 4GS3A 4DV0Q 1PZKD 4JW0A 1A62A 1E1OA 3G6EA 2M9VA 3J7AF 2EOTA 2I5LX 5IYBH 2EYPA 5FLMH 2UXCQ 4QIWB 3NWTA 2NVTH 4CKEA 5IGFA 5GADC 3PO3G 1G2TA 1PHJA 2LFNA 2DNCA 4DXGA 3GTLB 1MD2D 1CSPA 1N36L 1HNWL 4YCWA 5IT9E 1EQQA 3A7LA 3S15H 2BE5D 5J1ZA 3JAMc 4CKBA 2ICIA 2XWBB 4U673 1GUTA 1TIID 4X3SA 3S2HB 3S2DH 2PQEA 2XRQD 3A5UA 4KKUA 1UEBA 4F7XA 3DHQA 4A3DB 1Q82C 1TS4A 1SNDA 3TDQA 3W2DA 2EE1A 2Z6KC 2I07B 1MJCA 1VQDA 1DD2A 3I55A 4WORA 3R3OA 3NK9A 4KV6A 2E5LQ 2FHTA 4OL7A 1V1QA 4K2KA 2XSCA 3FVQA 3I4NG 1AE3A 2H4OA 1SJHD 3IKJA 4KHPQ 1Y8PB 4CGYB 1EQVA 4A3JG 2I46A 3I8ZA 3K6OA 1TY0A 4ODGA 1U0LA 3I4MH 2YV5A 3K0XA 1VQ9A 1O80A 2CKZB 4XYQA 2JA5G 3BVGA 1JOKA 4I7AA 3W1BA 4K14A 4YHHQ 3DLLA 3I7FA 2L1BA 3BZDB 1N33Q 1XMOQ 1JJ2A 5JAVA 1I94Q 1VQBA 4CKCA 4DV2Q 4A3EB 2G5DA 5C4XG 3CPWA 2R92G 1E2ZA 4G4KA 2F0IA 1RCVD 3VR6A 1ILPA 2K5NA 4DUZQ 1EYCA 3M4PA 5IYCH 1KHIA 3S1RH 3S14H 2JN4A 3MEHA 5I2YA 2EY1A 2EQSA 2CW0D 4DK0A 2ZXOA 1FJGQ 5EPJA 3PMFA 4P74A 2C9OA 1K8AC 5HURA 4GN4B 3M4OH 3IFDA 1YITA 4FF2A 4JG2A 1XPRA 1NUCA 4LMQD 2K5HA 2IWHA 2UXCL 4GNXA 1V43A 2WP8J 4KTAA 5COYA 2N49A 1SNMA 5C0XG 4GKKQ 1X65A 2F0VA 3MTSA 5FLMG 1XMQL 2YU9B 4BY1B 2MJ8A 4EX5A 1JWUD 1PFMA 3URYA 2F0GA 1LTLA 5EBCA 4AYBE 3JAMi 1L1OA 1QILA 4DAYA 2AQ3B 2PI2E 4JCVE 4H7BA 4DUYQ 1LABA 1VQ4A 2Y0SE 3I90A 4DV3Q 2FINB 1H9SA 4XQQA 3AMUA 2BOSA 3D4RA 1B3QA 1RF2D 1ZKOA 4MTNA 4P75A 3EBEA 4NB3A 2E5LL 2E75C 3AFQA 5IY0A 4FNFA 4KHPL 1CT1D 5IIFA 3QR8A 4FXGC 1LUZA 1IYUA 1ZEQX 3MZ5A 3OWEB 5KEEA 1JICA 1SE3A 4DFAA 1MSHA 1MI2A 3J81c 1I4QA 4WJ4A 2F0OA 2B8FA 3L3OC 4IPDA 4UDUC 5G3LD 3I56A 5C44H 3K57A 3I4MG 1BCPF 4YHHL 1ENAA 3NE5B 3RZDB 2L4NA 3RMHA 2YU9H 1N33L 4CJ0B 1XMOL 4JI6Q 3H94A 4KJOA 1N32Q 2Z6KA 4LF9Q 3F2DA 1WD1A 1ET6A 3GP7A 2F0DA 5FLXL 3SK4A 1I4PA 4PMCA 5I2XA 4C3IB 4J6HA 1O7LA 1B44D 1OXTA 2OEOA 2QDBA 3KJPA 3CD6A 2QF7A 3IRBA 1RIPA 1QE6A 4A3IB 3UI2A 1SJED 2KBNA 5M5XB 1HNXQ 5CV5A 4A3DG 4DR7Q 4OO1I 3GTMB 1A2TA 2WV6D 3OIQA 5JJLA 3H3VC 3TS0A 5I9PA 5M9OA 4A3MH 2JP1A 3KYHC 5M3MH 1SYGA 3PCOB 2AUKA 1Z47A 4C2MH 4QJFA 4QQBX 3SE0A 4L5TA 1ICFB 1HQRD 4L5QA 4OIKA 3NQTA 1SR3A 4L8JA 2UUCQ 5DEHA 3S9WA 1UEAB 2KUMA 3MVVA 5E4XA 1AP0A 1K3RA 2EYLA 4GKKL 3MXPA 1K8OA 3K7AB 3ONAB 4B9WA 1UUPA 3LX0A 2K28A 4K0KQ 1VQFA 1VMCA 1I6HH 3CF5A 1A63A 4ZQ3A 1NMFA 2UUAQ 3CXCA 4QCLA 4C3IH 4RWSC 4IN3A 3T1YQ 3R2TA 1KL9A 4DUYL 4A3EG 4F8MA 2G9DA 2LY7A 3NXWA 2FMMA 4DV3L 3ULPA 1S40A 4TSSA 4C3JH 1L0YB 1Q46A 2B39A 2AUJD 2PZUA 4CDDC 2EVBA 1BVSA 3LWUA 2F0HA 4LNQA 4N8FA 2ZM6Q 1B8AA 2EY6A 3D4DA 1E2WA 5CYUA 4UPAA 3H0GB 4IJHA 3ULLA 1ENCA 4H13C 2V4DA 3G6JB 2EYOA 4B08A 1RTNA 3GTGB 3H6MA 3J81i 3PUXA 3T51B 3OTOQ 1RHPA 5CV8A 1EYGA 3CQZB 4DK6C 1WOCA 3GTQH 4I65A 2XTIA 1XPOA 3GD7A 1WTWA 3S1MB 4GNXB 2RDHA 4LF9L 3KJOA 4GLXA 1LO5D 1EIYB 1UE7A 2GN5A 4BY1G 2PNRC 4PQXA 3DXJC 2MGSA 3STBC 5IODA 1SNPA 1CHQD 1EUJA 1X3PA 4ZKCB 1N8RC 4UY8C 1FYCA 3S1QB 4C3HH 3A8JE 3FKIH 4E6IA 4GLAC 4FYDA 2K5DA 5FJ8H 3NUCA 1BKBA 4DR7L 4DAYB 2QEJC 3DM1A 1PZID 2L11A 2BCOA 1WYDA 2E2DC 1SLJA 2KCMA 3J7YW 1HR0Q 1VQGA 5IYDG 4NPSA 2B63B 2LXJA 5GAEC 1CKNA 2TSSA 4MIUA 3NENA 5IGGA 2UUCL 1KC8C 3CCRA 1EY8A 2O2LD 3CQZH 1VMPA 1XX8A 3CW2C 4K5XA 4WRDA 2OQKA 3CC4A 4K0KL 5D3DA 1MBYA 3RZOB 1QUQB 2NVYB 3AU7A 2UUAL 2ZJQA 5ELDA 2P5ZX 2PNHA 3T1YL 2Q2UA 4BA2I 1YHAA 5C5MA 4HSPA 4LFCQ 1SXTA 3BU2A 4C3IG 1RTOA 5IT9c 4NMZA 5LL6X 1GKHA 2EDGA 3CAMA 3ITPA 2ZM6L 1PH2A 1PH9A 3PGZA 2XIWA 4DK1A 2J0TD 3I4LA 3E9IA 1KQSA 1TXYA 3U9OA 4JI8Q 3BYTB 3OHXC 2N78A 3EQLC 2HQLA 1LTAD 2UXDQ 1WCMB 1X54A 3OTOL 3HP3A 3L9AX 2EXDA 2E2JH 1KNAA 5BN4A 1PMRA 3M3YB 4BBRB 3TMEA 4YWLA 3A54A 1YJ9A 2A68C 2EYJA 2ZTCA 1PTOH 4A3FB 1EYAA 5C3WA 5FLXE 2Q8TA 4XXEA 4R8IA 2NVXB 3K81C 2CH4A 1X3QA 3S17B 2HHHQ 4JVZA 4Q5VA 2Z4HA 4LFAQ 1D2BA 1I4GA 4QIWE 2PQAA 4A3GH 1VQ7A 2OTJA 1HR0L 4HMJA 1LTSD 4H0LC 4YWMA 1HA5A 1Y1WH 1SFOH 2X6LA 1VF5C 3HG9A 1S3OA 4QY7A 1WCMH 3H0GG 3QWNA 4KN4C 3ULJA 1K0SA 5KNDA 4DAPA 2VQEQ 4UAIA 5LMNW 3M3YH 3Q23A 4G7OC 4CHTB 2EPBA 2OXPA 3RLOA 2CQOA 1S5FD 2G9HD 3OIPA 3PO3B 3MC0B 4UP8A 3I3CA 3K5OA 4A3FH 3BG3A 4LF8Q 1BDOA 4NKLA 4LFCL 3L2PA 4IJLA 5M5YB 3ERSX 4DA2A 1HA6A 3B6YA 2PZWA 1XTCD 2VUMB 4LJZC 1A6XA 2BA0A 2AWNA 1I4RA 4H44C 2UUBQ 4XYOA 1SAPA 4OX9Q 2VW9A 2DUDA 5EKLA 2IX0A 4A3BB 4N9PA 2D9UA 2K1BA 3PSIA 1PFBA 3C3LA 3C1FA 5JPMC 4GKJL 4JOIC 2B63G 1JE5A 1W2BA 4FF4A 3HOWB 2RDFA 1M4VA 1QG7A 4HSVA 1EWCA 4X3UA 1OXUA 3AB9A 4BS9A 1CKNB 2HQEA 2WACA 3V2TA 3NHHA 4LAAA 3T1HQ 4A3CH 3NTIA 2O4XA 3E3XA 3GDEA 5JEAH 1WTVA 2JA5B 4ZKBB 2NVQH 1YVCA 2EJFC 1K0RA 3I4OA 3KF8B 3FHWA 5M5YH 3A8KE 3KF6B 1TWAH 2JE6I 3CP0A 4IOCA 1QZGA 4LFAL 1B50A 4OO1H 3RLNA 4R1JA 4M1UB 1EIFA 4G57A 4H02A 3OSOA 2X6GA 2E76C 4A3BH 3CMAA 2KVMA 3CMEA 4GZYC 1X3EA 4DN4M 1Q8KA 1E1TA 2PPBC 1C8CA 2JEAI 3HOXH 1DCZA 1KRTA 3WDNA 1STBA 2VQEL 1VQ8A 4JPBW 3TEHB 1WCMG 1Q90A 5C0XJ 4DK3C 2KEDA 3D31A 3GV3A 1L2FA 3TSSA 2F4IA 1NR2A 4LF8L 3C2PA 3WOEA 2NVTB 2F3VA 2KHIA 5C3XA 1G6ZA 4A3FG 2RHSB 2UUBL 1B9NA 2A69D 4XQNA 4OONA 1GXDC 3S15B 3PV0A 4AH6A 3PO2H 1HZCA 4ABNA 1SNCA 2A73B 2KCNA 4R4QA 4FF3A 4X3KA 4GNXC 1U4LA 4ME3A 1VQKA 4CJ2C 1Y14B 2JA9A 3ER0A 1KLGD 2E2IH 1J6QA 1PRTB 4RCNA 1GUSA 4DNIA 1WTRA 1VQAA 2MQHA 2MO0A 1GD7A 5G3LF 1A15A 4IFDI 3T1HL 3S24A 1TT2A 1YNXA 4Y7NH 3PUYA 1EY9A 2BE5C 2DY8A 3UDIA 1SYBA 3I4MB 4UP9A 3R93A 1SROA 1VQEA 5CORA 2PW7A 5JEAG 2MHVA 2N88A 2Z0SA 4JOIA 1XMQQ 5DNFA 3V05A 2F0EA 2HCIA 2VUMG 1A3TA 3MXUA 2ZJRA 3W5OA 5E7NA 1KIXA 1Y1VH 1BBUA 1RL2A 5IGEA 1YIJA 1L0XB 1K73C 4A3BG 3S1RB 1KDCA 3S14B 1F77A 2F0SA 1EWIA 3RR5A 2RBMA 5JJKA 3PIO3 4S3SA 3HOWG 3SHLA 1XNQQ 1S5CD 3X3MA 4YY3Q 3M4OB 2B2TA 2MP1A 3VR3A 1P16A 2LKVA 3S16H 4TKOB 1QVGA 1II3A 3U50C 1PTOD 1I5FA 3ND9A 4ZCKA 1FNWA 1D1KA 3NPPA 3M7NA 3AQQA 3SK5A 4HN7A 1EOTA 5GQOA 2VL6A 3QG1A 2CW0C 3AYHB 2CFMA 5L37A 3HGBA 1I50B 1NTGA 1CSQA 2B3GA 4KHZA 4LWCA 4X65Q 1HH2P 2RA4A 1RKNA 5JOBA 5C4HA 3PUVA 4XTCS 4FF1A 2F0JA 1F2ZA 4FO2A 4HCSA 5KYIA 5EJWA 2WAQB 5EBDA 3VR2A 4K6LA 1CKOA 2OQ0A 5J3BA 5IP7H
chains in the Genus database with same CATH topology
2D62A 4C1NI 2Z1CA 2ZT9C 5ISRA 4EQNA 2VNUD 2ENBA 2LMCB 5C44B 2M2LA 1OXSC 1STYA 1TU2B 1VCIA 3VR4A 2VB3X 4FXDA 1A3UA 1LT5D 1BXTA 3F2UA 4RAUC 5F2DA 3ZYYX 1FNVA 1OO9B 2R6GA 5EQ0A 4XDXA 1LACA 4F87A 3VYTA 5A2QL 1BF4A 3DWQA 2QCPX 3L7ZC 1AEXA 2VB2X 4RKBA 1A3VA 1HUNA 2EY5A 1WVLA 4CJ1B 1SEBD 4A3MB 2NTSA 5M3MB 3P75A 4HR7B 4C2MB 4G7HC 3CHBD 1U4MA 4TRDA 1GUOA 3PIP3 1SYDA 2X69A 1EEID 3MFYA 1STHA 1WD0A 1CHPD 5AFWA 3SK8A 2EYMA 1I6HB 3MAQA 1H9KA 1BNZA 3A55A 1RJTA 4IUNA 1EYDA 2SNSA 2SEBD 4C3JB 2WINB 4G7ZC 4K6DA 3A7AB 1EFID 5I6WA 2R7ZB 1B3AA 4QMGA 1SNQA 4HEDA 4KMUC 2NTTA 1SE2A 1TR5A 3GTQB 2PZTA 5CBEE 1I6VC 1QNKA 1CTMA 1TVXA 3E5SA 5EKIA 1V1PB 1XYIA 3K5LA 4C3HB 5LHY1 3FKIB 1UNSA 1IW7D 3K5NA 2KECA 1EZ6A 2K01A 4X3TA 3P7JA 5EKKA 1AN8A 1EIGA 3QOJA 4KHVA 4RGNA 4KD4A 1PRTC 3HOUB 1EY7A 4XIGS 1QJOA 1JWSD 1AZQA 4IURA 2JYOA 5CMDA 4QB4A 3GTPB 1XXGA 1DM0B 2D2CC 2RVLA 2XRSD 1PRTD 3A8IE 2WB1B 3BVZA 2K32A 1LTBD 1HFGA 4K8IA 2NWGA 4IFDH 2R61A 3D4WA 3LWEA 5C0XI 2Q8RE 4KY5A 1CM9A 1W6KA 2F1MA 4KK7A 4IUVA 2F0WA 2NB0A 2SOBA 1TS3A 2WIIB 3I91A 2E2JB 1SYFA 2ID0A 3N52A 1G91A 3OMCA 3KF8A 1IL8A 1AZPA 1KNEA 3C1EA 2PCFB 3BDOA 4NW2A 5C5LA 1PTOB 3E0JA 2KA7A 1EL0A 4EGVA 2LS01 1LLRD 3N6RA 1C48A 1LT3D 5A2QE 4C3JG 2PW5A 4A3GB 3KLRA 3T16A 5CC4A 4IZ8A 1Y1WB 1ZYRD 1TWFB 1SFOB 4EQPA 1O7YA 3K0YA 1AFPA 5FO9B 1Q1EA 1Q3LA 4ILWA 3VYUA 5KYLA 1B2TA 4C1NK 4B9XA 1EQTA 5CBAE 4KN7C 3D8GA 1FD7D 1EU3A 4YIJA 4C56C 1SYCA 3QOLA 2Z4IA 4PV1C 4N9TA 3M4YA 4C3HG 2JSOA 3FPUB 2K5QA 1GUNA 2JEBI 1X32A 3EA6A 5D3IB 4HTHA 4IFDG 2KCCA 5ELEA 3Q24A 5BN3A 2R3ZA 3M85A 3RLFA 5JEAJ 4O1NA 2K04A 4V190 5IGBA 1QNUA 5KRUA 4DXFA 2KEEA 4ZK9B 2NVQB 1Q12A 2IT1A 2PMZB 2A5HA 1TWAB 4RCOA 1GHJA 1J8IA 2K7VA 5K5PA 3HOZB 4BBSB 3T56B 4KKSA 1TWCB 1ILQA 3HRZC 1EZ8A 4EVOA 4IUQA 3EROA 1NSNS 4ZAIA 4KI0A 4O42A 3HOXB 2XVSA 1BBXC 5E4WC 1S5BD 3V96A 2F0TA 2NN6I 2IPKD 3WOFA 4BA1I 3DWAA 4FP5D 1HFNA 5NUCA 3NWSA 5D14A 1QCBD 1D5ZC 1WTQA 4DGZA 1MGSA 3OW7A 1EWHA 3FRPB 1RODA 1STGA 4TQUS 4BY7B 2B2TC 4KY7A 4PMWA 1SBBB 3TP5A 3PO2B 3VR5A 1LTTD 5CV4A 1EY0A 2IX1A 2E2IB 1TKWB 1JE4A 1EY5A 4WFN3 4FVMA 2IL8A 2O5JC 2N55A 3TP7A 3ND8A 2F0KA 4Z9CB 4J1MA 2A69C 2K03A 4Y7NB 2C5CA 1NAPA 4ID6A 3Q0AA 3P1HA 4Q0FA 4BWGB 2NUCA 4EQOA 3K58A 3OOCA 1Z6HA 5KGUA 3SEBA 2A6ED 2EXZA 1YNJC 1Y1VB 2FFKB 2L9HA 1KAAA 1ONLA 3E6ZX 4MHEA 1RD9D 2A6HC 5KIXA 2L55A 2D5DA 5J39A 1YNJD 2F0PA 1ESRA 2OF1A 2R93B 3O13A 1SDFA 1O78A 1S4ZA 1SE4A 3S16B 2WKCA 3IL8A 3OMGA 4K5VA 2A6HD 4MN3A 2K33A 2XN9C 3T13A 3Q22A 1DYQA 1E2VA 3LNNA 1QWYA 1DONA 1Y8NB 1DJRD 3FDTA 1LT4D 3MWYW 3J7AV 4OO1G 1D5MC 5EGTA 2E2HB 1BUVT 5C0XH 1FR3A 2MUYA 1PTOC 1CQFA 4DNTB 3Q6SA 3T4AC 1ENFA 1DOKA 4DU9A 4OHJA 2B2VC 2L5TA 5M5WB 1I4HA 5CV9A 4RKLA 4HMIA 5C4ZA 3W3AA 2IJ0A 1BCPB 3J80L 1Z7TA 5TSSA 5FO8B 3VA5A 2CVRA 3IFTA 2EYHA 2FMCA 1FNUA 3I73A 1KABA 3GO5A 1SNOA 3BVMA 2F0QA 1B9MA 1MSGA 2B2WC 4JBWA 1CI3M 1V1PA 1KDAA 2IX3A 1PDQA 1DXMA 4IUTA 1CA5A 3NBHA 4DAVA 2FJ2A 4K5WA 2DN8A 3T53B 2CHBD 3K59A 5E1FA 1O7ZA 1EY4A 5DAUA 3DWPA 3NTKA 2ICEC 3TP6A 5FKAC 1HTLD 1Y8OB 3JAML 2ZXPA 1B53A 4NP5A 1STAA 3EJIA 4XQJA 3HOVB 2AWOA 2J7ZA 2NZ1D 1VDZA 3R8BA 4LK1C 4KY6A 1PRTF 3MXGA 3G7LA 5CV6A 2Z8LA 1JWMD 3KLSX 4F88A 3S1NB 1LT6D 1TS2A 1ICWA 2OT2A 1EIHA 3HKZB 1IHZA 2Q8IB 4HCEA 2F03A 5LL6S 1S5ED 1IKLA 3BYYB 3OWFA 5DM63 1HHVA 2JA8B 3EVQA 5M3FB 1KTKA 4QF4A 2QILA 5KNCA 3VYRA 1GHKA 4ZUIA 1LV9A 3K5MA 3FMCA 1K83B 5IOCA 4CBVA 1F2LA 2PYKA 2K05A 4KJNA 2B2VA 5T1GA 1PLFA 4ZUJA 1V1OA 5E3FA 2KOLA 3KBXA 1F2YA 3I70A 1M8AA 3GQBA 1GUWA 5JJZA 4V0BA 4L6TB 5FK9C 2B2WA 2NN6H 2MPMA 1LTGD 1CZGA 1A2UA 1G291 1BOSA 2CQAA 3QJYA 2O5IC 2B2YC 5HGTA 3QB3A 3FPPA 5DM73 1B4OA 1CZWA 4ME5A 3GV6A 5JVH3 1T5EA 1H9RA 3HS0C 1IW7C 3DEPA 1NR4A 3MHBA 3HZXA 1I4XA 2BA1A 3NTHA 3J81L 2XNAC 3QIAA 4IFDJ 1KLUD 2K5WA 2JA7B 1G8ZD 2XWJB 4A3KB 5IGDA 2YYZA 1LTID 3C46A 5T1IA 1GOZA 4KKTA 2B2UC 5FOBB 1F9QA 3H09A 1T5XD 1YNNC 2ZXRA 4OIJA 5JPNC 1CFMA 5I9OA 2J4XA 3J80E 2HUGA 4RA8A 4OGQC 3D6WA 1D5XC 1PYWD 3SR1A 2RSNA 2M00A 1F9RA 3M7GA 3SXHA 2EJGC 3RD4A 3SDZA 3MXNA 1YNND 2NYZD 2VXWA 5I4DA 1EEFD 3SK6A 3D6CA 2TMPA 2AQ2B 1PXUA 1CQVA 4ZYSA 2EY2A 2PO4A 2F0NA 1JORA 4J8QA 1IYVA 4FXKC 3P20A 2DY7A 3RUZA 1BO0A 1PZJD 1RDPD 3JAME 2NN6G 4JK1C 2GA4B 1HUMA 1HTPA 3KK7A 1TWGB 3I72A 2RQXA 4DF7A 1WTOA 2JA6B 1ML0D 3ERQA 1Q1BA 2F0UA 1B1ZA 1Y69U 1QOHA 1H9SB 1UAPA 4L63B 1WTXA 2RKSA 2KQ3A 1H9JA 4K8JA 3NSWA 1EU4A 3KLSA 1BCPC 1S5DD 4A93B 1ZYRC 5ELCA 2B2YA 4K2LA 4AYBB 1FGBD 2EJMA 3CKIB 3U9SA 4RGMA 1E0BA 1JC7A 2Y0SB 1SSOA 1W6JA 3GTJB 5C6AA 2EZVA 4XT1B 1BCPD 1QB5D 5IGCA 1CA6A 1DZ1A 3TBIB 2BDNA 4IUPA 3PUZA 2HCCA 1PFNA 1R4QB 1LTRD 4ZRZA 5BN5A 2QKIC 3PUWA 2B8GA 1GJXA 3NP8A 1HQMC 2B2UA 2SDFA 2F3WA 2L0CA 2WKDA 3MA2B 1IKMA 3TP8A 1AW7A 2HDLA 4ZLTF 4KD3A 1JOOA 3H91A 3IAYA 5A35A 1STEA 3KUPA 5CV7A 1I3QB 1TS5A 4R8NA 1JB3A 4IALA 5IT9L 3OPOA 1V8QA 5EPKA 2A68D 5KNBA 1J9OA 3NQIA 1D1IA 3HOYB 1JOQA 5C4JB 2EYFA 2KJXA 1JQYD 5JVG3 1BR9A 1U9RA 1C4QA 3QO2A 1H9MA 3CRKC 3J81E 3NBIA 5J22A 4M8AA 3CU7A 4HAEA 4DNRB 3D3RA 5ELFA 2F0LA 4QUCA 2BDOA 2E74C 2F0MA 1GUGA 1HXYD 3CRLC 1ZXTA 5CGKA 3GTOB 1JR0D 1PTOF 3DEOA 4P2CB 1SMYC 4WJWA 5C3EB 1K8MA 1OXVA 4NDXA 5K36H 1HRJA 3HEJA 5FO7B 1DOLA 3VYSA 1VF7A 4RH6A 3DMUA 3I4NB 2RDGA 2NBFA 4PMBA 2SNMA 1SMYD 4A3JB 5D65A 2HDMA 3MFGA 1NCVA 3DUZA 3R2IA 1EY6A 1F9SA 4U68A 4IQZA 1KDBA 3GTKB 1TQOA 5CR3A 5C4XB 3VA7A 3TZUA 2R92B 4RHRA 3SVMA 4I7ZC 3FEWX 2KHSA 2K6AA 3BDCA 1STNA 2A6EC 1JCKB 3KBGA 4R9WA 1U4RA 4RFBA 1F9PA 1HPCA 1XWEA 1D6EC 3EFXD 4RHSA 2DNEA 4XT3B 3BS1A 1DOMA 1R9TB 1Q8IA 1ET9A 1U4PA 1HCZA 3BDLA 4RGOS 2F0FA 2IW3A 1G2SA 1ESFA 4PNYA 2A74C 2H1EA 1WTPA 1BQQT 4QUFA 5ELBA 2RSOA 3TZDA 2L12A 4RGTA 5I6YA 3S2DB 3X3NA 4ULLA 1OXXK 1CK1A 2JXMB 1F2MA 2AQ1B 3A56A 5EPLA 1TY2A 1R4PB 5K36G 1SYEA 3TN2A 1TWHB 4IUUA 1PZKD 2M9VA 3J7AF 2EOTA 2EYPA 4QIWB 3NWTA 4CKEA 5IGFA 1G2TA 2LFNA 2DNCA 4DXGA 3GTLB 1MD2D 5IT9E 3A7LA 2BE5D 5J1ZA 4CKBA 2ICIA 2XWBB 4U673 1GUTA 1TIID 4X3SA 3S2HB 2PQEA 2XRQD 4KKUA 4F7XA 3DHQA 4A3DB 1TS4A 1SNDA 3TDQA 3W2DA 2EE1A 2I07B 1DD2A 4WORA 3R3OA 3NK9A 4KV6A 2FHTA 4OL7A 4K2KA 2XSCA 3FVQA 2H4OA 1SJHD 3IKJA 1Y8PB 4CGYB 1EQVA 2I46A 3I8ZA 3K6OA 1TY0A 4ODGA 1O80A 4XYQA 3BVGA 1JOKA 4K14A 2L1BA 3BZDB 5JAVA 4CKCA 4A3EB 1E2ZA 4G4KA 2F0IA 1RCVD 3VR6A 1ILPA 1EYCA 3MEHA 5I2YA 2EY1A 2CW0D 4DK0A 2ZXOA 5EPJA 3PMFA 2C9OA 5HURA 3IFDA 4FF2A 1NUCA 4LMQD 2IWHA 1V43A 2WP8J 4KTAA 5COYA 1SNMA 5C0XG 2F0VA 3MTSA 2YU9B 4BY1B 2MJ8A 1JWUD 1PFMA 3URYA 2F0GA 5EBCA 1QILA 4DAYA 2AQ3B 4H7BA 1LABA 3I90A 2FINB 1H9SA 4XQQA 3AMUA 2BOSA 3D4RA 1RF2D 1ZKOA 2E75C 4FNFA 1CT1D 5IIFA 4FXGC 1IYUA 1ZEQX 3MZ5A 3OWEB 5KEEA 1JICA 1SE3A 4DFAA 1MSHA 1MI2A 1I4QA 2F0OA 2B8FA 3L3OC 4UDUC 5G3LD 3K57A 1BCPF 1ENAA 3NE5B 3RZDB 2L4NA 3RMHA 4CJ0B 3H94A 4KJOA 1WD1A 1ET6A 3GP7A 2F0DA 5FLXL 3SK4A 1I4PA 4PMCA 5I2XA 4C3IB 4J6HA 1O7LA 1B44D 1OXTA 2OEOA 2QDBA 2QF7A 1QE6A 4A3IB 3UI2A 1SJED 5M5XB 5CV5A 4OO1I 3GTMB 1A2TA 2WV6D 3OIQA 3H3VC 5I9PA 5M9OA 2JP1A 1SYGA 2AUKA 1Z47A 3SE0A 1HQRD 4OIKA 3NQTA 4L8JA 5DEHA 3S9WA 1UEAB 2KUMA 3MVVA 5E4XA 1AP0A 2EYLA 3MXPA 1K8OA 3K7AB 3ONAB 4B9WA 1UUPA 3LX0A 2K28A 1VMCA 4ZQ3A 4QCLA 4RWSC 4IN3A 3R2TA 4F8MA 2G9DA 2LY7A 3NXWA 2FMMA 4TSSA 1L0YB 2B39A 2AUJD 2PZUA 2EVBA 3LWUA 2F0HA 2EY6A 3D4DA 1E2WA 5CYUA 3H0GB 1ENCA 4H13C 2V4DA 3G6JB 2EYOA 4B08A 1RTNA 3GTGB 3H6MA 3PUXA 3T51B 1RHPA 5CV8A 3CQZB 4I65A 3GD7A 1WTWA 3S1MB 2RDHA 1LO5D 2PNRC 4PQXA 3DXJC 2MGSA 5IODA 1SNPA 1CHQD 1X3PA 4ZKCB 1FYCA 3S1QB 3A8JE 4E6IA 4FYDA 2K5DA 3NUCA 2QEJC 3DM1A 1PZID 2L11A 2BCOA 2E2DC 3J7YW 2B63B 2TSSA 4MIUA 5IGGA 1EY8A 2O2LD 4K5XA 1VMPA 1XX8A 4WRDA 5D3DA 1MBYA 3RZOB 2NVYB 3AU7A 5ELDA 4BA2I 5C5MA 4HSPA 1SXTA 4C3IG 1RTOA 4NMZA 5LL6X 2EDGA 3ITPA 2XIWA 4DK1A 2J0TD 3I4LA 3U9OA 3BYTB 3OHXC 3EQLC 1LTAD 1WCMB 3HP3A 3L9AX 1KNAA 5BN4A 1PMRA 3M3YB 4BBRB 3TMEA 3A54A 2A68C 2EYJA 1PTOH 4A3FB 1EYAA 5C3WA 5FLXE 2Q8TA 4XXEA 4R8IA 2NVXB 1X3QA 3S17B 4Q5VA 2Z4HA 1D2BA 1I4GA 4HMJA 1LTSD 4H0LC 1HA5A 2X6LA 1VF5C 3HG9A 3QWNA 4KN4C 5KNDA 4DAPA 4UAIA 3Q23A 4G7OC 4CHTB 2EPBA 2OXPA 1S5FD 2G9HD 3OIPA 3PO3B 3MC0B 3I3CA 3K5OA 3BG3A 1BDOA 4NKLA 5M5YB 4DA2A 1HA6A 2PZWA 1XTCD 2VUMB 4LJZC 1A6XA 2BA0A 2AWNA 1I4RA 4H44C 4XYOA 1SAPA 5EKLA 2IX0A 4A3BB 4N9PA 2D9UA 2K1BA 1PFBA 3C3LA 3C1FA 5JPMC 4FF4A 3HOWB 2RDFA 1M4VA 1QG7A 4HSVA 1EWCA 4X3UA 1OXUA 3AB9A 4BS9A 2HQEA 2WACA 3V2TA 3NHHA 4LAAA 3NTIA 2O4XA 1WTVA 5JEAH 2JA5B 4ZKBB 2EJFC 3A8KE 2JE6I 1B50A 4OO1H 4M1UB 4G57A 3OSOA 2X6GA 2E76C 2KVMA 4GZYC 4DN4M 2PPBC 1C8CA 2JEAI 1DCZA 3WDNA 1STBA 1Q90A 5C0XJ 2KEDA 3D31A 3GV3A 3TSSA 2F4IA 1NR2A 3C2PA 3WOEA 2NVTB 2F3VA 5C3XA 1G6ZA 1B9NA 2A69D 4XQNA 1GXDC 3S15B 3PV0A 4ABNA 1SNCA 2A73B 2KCNA 4FF3A 4X3KA 1U4LA 4CJ2C 1KLGD 1PRTB 4RCNA 1GUSA 1WTRA 5G3LF 1A15A 4IFDI 1TT2A 3PUYA 1EY9A 2BE5C 2DY8A 1SYBA 3I4MB 3R93A 5CORA 2PW7A 5JEAG 2MHVA 2N88A 5DNFA 3V05A 2F0EA 2HCIA 1A3TA 3MXUA 5IGEA 1L0XB 3S1RB 1KDCA 3S14B 1F77A 2F0SA 2RBMA 3PIO3 4S3SA 3SHLA 1S5CD 3X3MA 3M4OB 2B2TA 2MP1A 3VR3A 2LKVA 4TKOB 1II3A 1PTOD 3ND9A 1FNWA 1D1KA 3NPPA 3M7NA 3SK5A 4HN7A 1EOTA 3QG1A 2CW0C 3HGBA 1I50B 4KHZA 2RA4A 1RKNA 5JOBA 5C4HA 3PUVA 4XTCS 4FF1A 2F0JA 1F2ZA 4FO2A 4HCSA 5KYIA 5EJWA 2WAQB 5EBDA 3VR2A 4K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9S A;  2KEE A;  2K1B A;  3N52 A;  4HED A;  4ZK9 B;  1PFB A;  4U68 A;  1G91 A;  1IL8 A;  1AZP A;  3KUP A;  1KNE A;  1PDQ A;  2KOL A;  4IUT A;  3I90 A;  3KBX A;  1A15 A;  1CA5 A;  2FIN B;  3SVM A;  5CBE E;  1QG7 A;  4HSV A;  4X3S A;  2DY7 A;  2FJ2 A;  4NW2 A;  4X3U A;  1M8A A;  2DY8 A;  1QNK A;  1J8I A;  2M2L A;  1GUW A;  1O7Z A;  3HP3 A;  5JJZ A;  3R93 A;  1BO0 A;  2FFK B;  2L9H A;  2B2W A;  5COR A;  1EL0 A;  5EPK A;  1HUM A;  1TVX A;  2EE1 A;  2MPM A;  1WTV A;  1KNA A;  2N88 A;  4R9W A;  1RTN A;  5EKI A;  1J9O A;  4MHE A;  1ILQ A;  1U4R A;  4ZKB B;  1XYI A;  1WTO A;  2B2Y C;  1RHP A;  1F9P A;  1ML0 D;  1JIC A;  2FHT A;  5DNF A;  1MSH A;  1MI2 A;  4IUQ A;  1B4O A;  4ZAI A;  2HCI A;  4O42 A;  1B53 A;  3F2U A;  4RAU C;  1WTW A;  2KEC A;  3GV6 A;  3I8Z A;  2Q8T A;  4XT3 B;  1ESR A;  5EQ0 A;  4XDX A;  4R8I A;  1WTX A;  1O80 A;  1B50 A;  2K01 A;  4X3T A;  1BBX C;  2L4N A;  1DOM A;  1SDF A;  2J7Z A;  2MGS A;  4CJ0 B;  2NZ1 D;  3QO2 A;  1O7Y A;  3P7J A;  1X3Q A;  5E4W C;  1BF4 A;  1HUN A;  1X3P A;  1S4Z A;  1WVL A;  4ZKC B;  3DEP A;  1Q3L A;  1WD1 A;  1U4P A;  1NR4 A;  2X6G A;  3IL8 A;  4CJ1 B;  2KVM A;  2B2Y A;  4MN3 A;  1EIG A;  2L1B A;  4HAE A;  4DN4 M;  1B2T A;  1HFN A;  1G2S A;  3G7L A;  1C8C A;  5D14 A;  1EQT A;  5CBA E;  1WTQ A;  1E0B A;  4QUC A;  3DM1 A;  1SSO A;  2L11 A;  2X6L A;  1QE6 A;  1MGS A;  1U4M A;  3UI2 A;  1ILP A;  1DON A;  1ICW A;  2H1E A;  2B2T A;  4XT1 B;  2MP1 A;  1WTP A;  3FDT A;  1CA6 A;  1AZQ A;  4IUR A;  2X69 A;  1DZ1 A;  2JYO A;  3MWY W;  4QUF A;  1EIH A;  1ZXT A;  5T1I A;  2BDN A;  1ROD A;  2KED A;  2RSO A;  3TZD A;  2B2U C;  2L12 A;  3GV3 A;  4IUP A;  1WD0 A;  5AFW A;  2B2T C;  1F9Q A;  2JP1 A;  3DEO A;  4UAI A;  5CMD A;  2RVL A;  2HCC A;  4OIJ A;  1NR2 A;  1PFN A;  2EPB A;  1IKL A;  3Q6S A;  5EPJ A;  1BNZ A;  1VMP A;  1XX8 A;  1EOT A;  2HUG A;  5EPL A;  3FPU B;  1HHV A;  1DOK A;  1RJT A;  4RA8 A;  4OIK A;  1G6Z A;  3D6W A;  1HRJ A;  2B2V C;  3IFD A;  1HFG A;  1DOL A;  3I3C A;  3TN2 A;  2KUM A;  2RSN A;  5E4X A;  1AP0 A;  1JE4 A;  1X32 A;  1F9R A;  2NWG A;  4LMQ D;  2RA4 A;  2B2U A;  2IL8 A;  3ONA B;  1LV9 A;  2SDF A;  4IUU A;  1HA6 A;  2XIW A;  2K28 A;  2NYZ D;  3LWE A;  2VXW A;  2N55 A;  5COY A;  1VMC A;  2R3Z A;  2CVR A;  5D65 A;  4X3K A;  2HDM A;  1SAP A;  2Q8R E;  2EOT A;  3MTS A;  2K03 A;  1IKM A;  1CM9 A;  1RTO A;  1U4L A;  2K04 A;  2MJ8 A;  2HDL A;  1F2L A;  1NAP A;  1NCV A;  2K05 A;  4HCS A;  4IUV A;  4RWS C;  4CJ2 C;  4ZLT F;  2B2V A;  5EJW A;  1PFM A;  1G2T A;  5T1G A;  1B3A A;  1PLF A;  1MSG A;  2B2W C;  1WTR A;  3H91 A;  2FMM A;  3I91 A;  2D9U A; 
#chains in the Genus database with same CATH topology
 3LGJ A;  2D62 A;  4C1N I;  1SMX A;  4WJ3 M;  2AHO B;  2E8G A;  2Z1C A;  2ZT9 C;  5ISR A;  4EQN A;  2VNU D;  2ENB A;  3TRZ A;  1U5K A;  3RN2 A;  2LMC B;  5C44 B;  4HJ8 A;  2M2L A;  1OXS C;  1STY A;  1BBW A;  1TU2 B;  1VCI A;  5IYB G;  3VR4 A;  5FLX c;  1NNX A;  2VB3 X;  1I50 H;  4FXD A;  1A3U A;  2D0P A;  1LT5 D;  1BXT A;  3F2U A;  4RAU C;  5F2D A;  3ZYY X;  1XPU A;  1FNV A;  1OO9 B;  2R6G A;  5EQ0 A;  1NY4 A;  4XDX A;  1LAC A;  4JI1 L;  4F87 A;  4GN5 A;  3VYT A;  5A2Q L;  3J7Z C;  1BF4 A;  3DWQ A;  2QCP X;  3L7Z C;  1AEX A;  2VB2 X;  4RKB A;  1A3V A;  1HUN A;  2EY5 A;  1WVL A;  2CCZ A;  4CJ1 B;  1XNQ L;  1SEB D;  4A3M B;  2NTS A;  4MTK A;  4YY3 L;  5M3M B;  4P72 A;  3P75 A;  4HR7 B;  4C2M B;  2PI2 A;  4G7H C;  3CHB D;  2D0O A;  3HOV H;  1HZB A;  1U4M A;  4TRD A;  1QUQ A;  2IHE A;  1GUO A;  3PIP 3;  1SYD A;  2X69 A;  4JI7 Q;  1EEI D;  3MFY A;  1STH A;  1WD0 A;  1CHP D;  5AFW A;  1NBW A;  3SK8 A;  2EYM A;  2DGY A;  1I6H B;  3MAQ A;  1H9K A;  1BNZ A;  3A55 A;  4X65 L;  1A8V A;  1RJT A;  4IUN A;  3S1N H;  1EYD A;  4B3T L;  1O7I A;  2HD3 A;  2SNS A;  1JJG A;  3CCE A;  2SEB D;  4C3J B;  1VQH A;  5IYC G;  2WIN B;  4G7Z C;  4JI0 Q;  4LFB Q;  4K6D A;  2DJG C;  3A7A B;  1K9M C;  4NXM Q;  1QVF A;  4LF7 Q;  4LF4 Q;  1EFI D;  2JA8 H;  5I6W A;  2R7Z B;  2WFW A;  2R7D A;  4GLV B;  1B3A A;  4JI5 L;  4IPG A;  5IP7 G;  4QMG A;  4R4C A;  1SNQ A;  4HED A;  3K8A A;  4KMU C;  2NTT A;  1PH8 A;  1SE2 A;  1TR5 A;  3GTQ B;  2PZT A;  5CBE E;  2ASB A;  2K14 A;  1Q86 C;  2CH4 W;  1I6V C;  2F4V Q;  4APV A;  1QNK A;  3RNU A;  3CPF A;  1CTM A;  3HKS A;  3VDY A;  1TVX A;  3E5S A;  5BR8 Q;  5EKI A;  1EOV A;  1V1P B;  1XYI A;  3NEL A;  3K5L A;  4C3H B;  1PH3 A;  5LHY 1;  3FKI B;  3U4Z A;  3KOJ A;  1UNS A;  1IW7 D;  3K5N A;  2KEC A;  1EZ6 A;  3NBH B;  3CCU A;  2K01 A;  4X3T A;  3P7J A;  2R7Z H;  5EKK A;  2WAQ G;  1MHW C;  1K8G A;  1AN8 A;  1EIG A;  1PFS A;  4P71 A;  3H3V I;  4HJ7 A;  3QOJ A;  4KHV A;  4RGN A;  1UE1 A;  1M1K C;  4KD4 A;  4JI7 L;  1PRT C;  3HOU B;  1EY7 A;  4XIG S;  1QJO A;  1VQJ A;  1JWS D;  5C44 G;  1AZQ A;  4IUR A;  2JYO A;  1VQC A;  1CKM A;  4YWK A;  5CMD A;  4QB4 A;  3GTP B;  1XXG A;  1DM0 B;  2D2C C;  2RVL A;  4HIO A;  4L5S A;  2XRS D;  3BJU A;  1PRT D;  3A8I E;  2WB1 B;  1UE5 A;  3BVZ A;  2K32 A;  3A0J A;  1LTB D;  4HIK A;  1HFG A;  1HNZ Q;  4JI0 L;  2JA7 H;  4LFB L;  4K8I A;  1PH4 A;  2NWG A;  4NXM L;  4LF7 L;  4LF4 L;  4IFD H;  2KCT A;  2R61 A;  3D4W A;  4JBM A;  3LWE A;  1IBM Q;  5C0X I;  2ES2 A;  2Q8R E;  4KY5 A;  4OXP A;  4A3M G;  2QEX A;  1CM9 A;  1W6K A;  5M3M G;  2JA8 G;  2F1M A;  4KK7 A;  4IUV A;  2F0W A;  3CCV A;  2NB0 A;  2SOB A;  1X3F A;  1TS3 A;  2NZH A;  2WII B;  1SN8 A;  3I91 A;  3HOU H;  2ZTE A;  2E2J B;  2QW7 A;  1SYF A;  2ID0 A;  3N52 A;  4OWX B;  1G91 A;  3OMC A;  2F4V L;  3KF8 A;  1IL8 A;  1AZP A;  1KXL A;  5IP9 H;  1KNE A;  4GOP A;  4R4I A;  3KF6 A;  3C1E A;  2PCF B;  3BDO A;  4NW2 A;  5C5L A;  3GTP H;  1PTO B;  5BR8 L;  3E0J A;  2KA7 A;  1XNR Q;  1EL0 A;  4EGV A;  2LS0 1;  3UDF A;  1AE2 A;  1E3P A;  1LLR D;  1LM0 A;  3N6R A;  4DR6 Q;  1C48 A;  1LT3 D;  4R4T A;  5A2Q E;  1OTC A;  4C3J G;  2PW5 A;  3J81 j;  4A3G B;  3KLR A;  3T16 A;  5CC4 A;  1PVO A;  4IZ8 A;  1Y1W B;  1ZYR D;  4DV1 Q;  1TWF B;  1SFO B;  4LUO A;  4EQP A;  1O7Y A;  3K0Y A;  2R7Z G;  4GKJ Q;  1AFP A;  5FO9 B;  1Q1E A;  1Q3L A;  1TWG H;  1PH6 A;  4ILW A;  1X3G A;  2JA6 H;  3VYU A;  4IOA A;  5KYL A;  1B2T A;  1N34 Q;  4C1N K;  4B9X A;  2Z6B A;  1EQT A;  4J15 A;  5CBA E;  4KN7 C;  3D8G A;  2IY5 B;  1FD7 D;  1EU3 A;  4YIJ A;  4A93 H;  4C56 C;  1SYC A;  1HZA A;  3QOL A;  1XTD A;  2Z4I A;  4PV1 C;  4N9T A;  4CDC C;  3M4Y A;  1HNZ L;  2Q2H A;  4C3H G;  2JSO A;  1PA6 A;  1PYB A;  3FKI G;  2DJF C;  4X66 Q;  3FPU B;  3G48 A;  3GTJ H;  5FJ8 G;  2K5Q A;  1GUN A;  1IBM L;  2JEB I;  1TWF H;  1X32 A;  3EA6 A;  5D3I B;  4DR3 Q;  4HTH A;  4IFD G;  2KCC A;  5ELE A;  3Q24 A;  5BN3 A;  1X9N A;  1VS0 A;  2CWP A;  2R3Z A;  3ICE A;  3M85 A;  3RLF A;  1B70 B;  5JEA J;  4O1N A;  2KHJ A;  2K04 A;  4V19 0;  5IGB A;  3PIP A;  1QNU A;  5KRU A;  2OTL A;  3HOU G;  3F1Z A;  4DXF A;  2KEE A;  4ZK9 B;  5HY6 A;  2NVQ B;  4PZ6 A;  1Q12 A;  2JQO A;  2IT1 A;  2PMZ B;  3MXN B;  5LMU Q;  1VQ6 A;  2A5H A;  1XNR L;  3M4Q A;  4DKA C;  1TWA B;  4RCO A;  1GHJ A;  1VQL A;  1J8I A;  2K7V A;  4DR6 L;  5K5P A;  2WB1 G;  3HOZ B;  4BBS B;  3T56 B;  4KKS A;  1TWC B;  1ILQ A;  2GVB A;  4DV1 L;  1I3Q H;  3HRZ C;  1EZ8 A;  4EVO A;  4IUQ A;  3ERO A;  1NSN S;  4ZAI A;  3I2Z A;  3MEF A;  4KI0 A;  4O42 A;  3JC6 6;  3HOX B;  2XVS A;  1BBX C;  1HR0 W;  3OYY A;  1N34 L;  5E4W C;  1S5B D;  3V96 A;  2F0T A;  2NN6 I;  3HOY H;  2IPK D;  3TRE A;  3WOF A;  4OWT B;  4BA1 I;  5C4J H;  2MO1 A;  3DWA A;  4FP5 D;  1HFN A;  4JI4 Q;  5NUC A;  2XGT A;  1IZ6 A;  2WAQ E;  1T9H A;  1WJJ A;  3NWS A;  5D14 A;  1YHQ A;  1QCB D;  1D5Z C;  1WTQ A;  4OEM B;  3CCQ A;  1WFQ A;  3L0O A;  4DGZ A;  4GOP B;  1MGS A;  4DAM A;  3OW7 A;  1EWH A;  4A93 G;  1IBL Q;  4MNO A;  3FRP B;  1ROD A;  1STG A;  4TQU S;  3HOZ H;  4BBS H;  4BY7 B;  4X66 L;  2B2T C;  4KY7 A;  4PMW A;  1SBB B;  1TWC H;  4A3L H;  3TP5 A;  3NEM A;  3PO2 B;  2JJQ A;  5HGQ A;  4BXX H;  3VR5 A;  4HJ9 A;  4DR3 L;  1LTT D;  5CV4 A;  1EY0 A;  4A3G G;  2IX1 A;  2E2I B;  1TKW B;  1Y1W G;  4HIM A;  2YTY A;  1ASY A;  3DM3 A;  1JE4 A;  1EY5 A;  2H5X A;  4WFN 3;  1HJP A;  4FVM A;  2IL8 A;  3KFU A;  2O5J C;  2N55 A;  1YJN A;  3TP7 A;  3ND8 A;  2F0K A;  3HKZ E;  4FDB A;  5C3E H;  4Z9C B;  4J1M A;  2A69 C;  2K03 A;  4Y7N B;  2C5C A;  1NAP A;  4ID6 A;  3Q0A A;  3P1H A;  4Q0F A;  4BWG B;  2NUC A;  4EQO A;  5LMU L;  3K58 A;  3D0F A;  4O0A A;  3OOC A;  3I4N H;  4X6A H;  4AQY Q;  3RN5 A;  4JYA Q;  2IHF A;  1CUK A;  1Z6H A;  5KGU A;  4A3J H;  4PZ7 A;  4BY7 H;  3SEB A;  2A6E D;  2EXZ A;  2V1C C;  4YCV A;  1YNJ C;  3AFP A;  3KDF B;  3Q8D A;  1Y1V B;  2FFK B;  2L9H A;  1KAA A;  1ONL A;  3E6Z X;  4JC0 A;  4MHE A;  1RD9 D;  3H3V H;  3GTK H;  2A6H C;  2R92 H;  5KIX A;  2L55 A;  2D5D A;  5J39 A;  2EIF A;  1YNJ D;  2F0P A;  1A0I A;  1ESR A;  2OF1 A;  2R93 B;  4JV5 Q;  3O13 A;  1LYL A;  1SDF A;  3W1G A;  4JI4 L;  1O78 A;  1S4Z A;  1SE4 A;  3S16 B;  3HOY G;  2WKC A;  3IL8 A;  3OMG A;  4A3C G;  4K5V A;  2A6H D;  4MN3 A;  2K33 A;  2XN9 C;  4DR2 Q;  1JJC B;  2QGQ A;  3T13 A;  3Q22 A;  4TVA B;  1DYQ A;  1IBL L;  1E2V A;  3LNN A;  1QWY A;  1DON A;  5IWA L;  1Y8N B;  1DJR D;  1R9T H;  3FDT A;  1LT4 D;  3MWY W;  3J7A V;  3PF4 A;  1NMG A;  1D5M C;  3HOZ G;  4BBS G;  4OO1 G;  5EGT A;  2E2H B;  1BUV T;  5C0X H;  1IYJ B;  1FR3 A;  4A3L G;  2MUY A;  4X62 L;  4BXX G;  1VQP A;  1EFW A;  1PTO C;  2Q2T A;  1CQF A;  4JI1 Q;  3Q6S A;  3T4A C;  4DNT B;  1ENF A;  1Z9F A;  1DOK A;  4DU9 A;  4OHJ A;  2B2V C;  2L5T A;  4OEL B;  5M5W B;  1I4H A;  3HOX G;  5CV9 A;  1P8L A;  4RKL A;  4HMI A;  5C4Z A;  2R93 H;  3W3A A;  2IJ0 A;  1BCP B;  3J80 L;  3G71 A;  4LF5 Q;  1Z7T A;  5TSS A;  5FO8 B;  3VA5 A;  2ZTD A;  2CVR A;  3IFT A;  5C3E G;  2EYH A;  3HFZ B;  2FMC A;  4RMF A;  1FNU A;  3I73 A;  1KAB A;  3GO5 A;  4AQY L;  1SNO A;  4X64 Q;  2BH2 A;  4JYA L;  2FXQ A;  3BVM A;  3K80 C;  2F0Q A;  1B9M A;  1MSG A;  1TWH H;  2B2W C;  4JBW A;  1CI3 M;  1V1P A;  1KDA A;  4RG1 A;  4A75 A;  2YTX A;  2IX3 A;  2RCN A;  1PDQ A;  1DXM A;  4IUT A;  4BY7 G;  1CA5 A;  2AMC B;  2E2H H;  4B3S Q;  3NBH A;  4DAV A;  2FJ2 A;  4K5W A;  2DN8 A;  3T53 B;  2CHB D;  3K59 A;  4B3T Q;  3PO2 G;  1X6O A;  4B3R Q;  3UE1 A;  5E1F A;  1O7Z A;  3GTL H;  1EY4 A;  5DAU A;  3DWP A;  5ELO A;  3NTK A;  2ICE C;  3TP6 A;  5FKA C;  4HID A;  1HTL D;  3ZJY C;  5M5W H;  2WB1 E;  4JV5 L;  1Y8O B;  3J80 i;  3JAM L;  2ZXP A;  3S2H H;  4IPH A;  4KLK A;  1B53 A;  4NP5 A;  1STA A;  4O2D A;  1G6P A;  3EJI A;  4A3D H;  4JI5 Q;  2JK8 A;  4XQJ A;  3HOV B;  4DR2 L;  2AWO A;  2J7Z A;  2NZ1 D;  1VDZ A;  2HT1 A;  3R8B A;  2RHQ B;  4LK1 C;  4KY6 A;  2VQF Q;  4ALP A;  4JBK A;  3AEV A;  2L15 A;  2CWA A;  1PRT F;  3MXG A;  3CCM A;  3G7L A;  5CV6 A;  1NJI C;  4DV0 L;  1PV4 A;  2Z8L A;  1JWM D;  3KLS X;  4F88 A;  3S1N B;  1LT6 D;  2QA4 A;  1TS2 A;  4P73 A;  1ICW A;  4LF6 Q;  2N3S A;  2OT2 A;  1KD1 C;  1EIH A;  1Y1V G;  3HKZ B;  3PF5 A;  1DGS A;  1IHZ A;  2Q8I B;  4HCE A;  1PYS B;  2F03 A;  5LL6 S;  2I0Q A;  1S5E D;  4A3E H;  3EIV A;  1IKL A;  1C9O A;  2I5M X;  3BYY B;  3OWF A;  5DM6 3;  4DV5 Q;  1HHV A;  2JA8 B;  4LF5 L;  3EVQ A;  5M3F B;  4QGU A;  2RF4 A;  1KTK A;  4HJA A;  3CCL A;  2GVA A;  4QF4 A;  2QIL A;  5KNC A;  2R93 G;  3VYR A;  1KAW A;  1GHK A;  4ZUI A;  4GN3 B;  3PQI A;  1LV9 A;  3K5M A;  3FMC A;  1K83 B;  5IOC A;  4X64 L;  4LUZ A;  4AIM A;  1C7Y A;  4CBV A;  4CDE C;  3E9H A;  4DR1 Q;  1QVC A;  1F2L A;  1WI5 A;  2K05 A;  2PYK A;  4KJN A;  2B2V A;  1E7Z A;  2LSS A;  5T1G A;  1PLF A;  4ZUJ A;  4Y52 H;  1V1O A;  4B3S L;  4R4O A;  5E3F A;  4B3R L;  1IXR A;  2NZO A;  4YCU A;  2KOL A;  4PZ8 A;  3KBX A;  1F2Y A;  3I70 A;  1L0W A;  2QDL A;  1M8A A;  4BY1 H;  1I94 L;  4GOP C;  2YTV A;  3GQB A;  4DV2 L;  1GUW A;  5JJZ A;  4V0B A;  4L6T B;  5FK9 C;  2B2W A;  2MNA A;  2NN6 H;  2MPM A;  1LTG D;  1CZG A;  2HIV A;  4DUZ L;  5M3F H;  1A2U A;  1G29 1;  1BOS A;  2CQA A;  3QJY A;  2O5I C;  2B2Y C;  5HGT A;  3WWV A;  3BZC A;  3QB3 A;  3FPP A;  5DM7 3;  1B4O A;  1CZW A;  2ALY B;  4ME5 A;  4DV6 Q;  3TQY A;  3U58 A;  3GV6 A;  1K83 H;  5IYD H;  1FJG L;  3KLW A;  4EQ5 A;  2VQF L;  1T5E A;  5JVH 3;  1H9R A;  3HS0 C;  1IW7 C;  4NXN Q;  4QL5 A;  3DEP A;  1NR4 A;  3MHB A;  2F52 A;  4DV4 Q;  3HZX A;  1I4X A;  4LF6 L;  2BA1 A;  3NTH A;  3J81 L;  1M90 C;  2XNA C;  3A74 A;  3QIA A;  4IFD J;  3RZD H;  4LW1 A;  1KLU D;  2K5W A;  2JA7 B;  1G8Z D;  3UDG A;  2XWJ B;  4A3K B;  2PMZ E;  5IGD A;  1YBY A;  2YYZ A;  1LTI D;  3C46 A;  5T1I A;  1GOZ A;  4KKT A;  3A5Z B;  2B2U C;  4DV5 L;  5FOB B;  1F9Q A;  3H09 A;  1T5X D;  1YNN C;  1EQR A;  2ZXR A;  4OIJ A;  5JPN C;  3CCJ A;  1S72 A;  5GAH C;  1CFM A;  5I9O A;  4HJ5 A;  2J4X A;  3J80 E;  2HUG A;  1W3S A;  1VQ5 A;  1XJV A;  4RA8 A;  4A3I H;  4OGQ C;  3D6W A;  2OWO A;  5M5X H;  1K28 A;  1D5X C;  1PYW D;  3SR1 A;  2RSN A;  2M00 A;  3GTM H;  1F9R A;  3M7G A;  3HOV G;  2F3I A;  3SXH A;  2EJG C;  4DR1 L;  3RD4 A;  3SDZ A;  3MXN A;  1JB7 A;  1YNN D;  2NYZ D;  4B3M Q;  2VXW A;  5LMN Q;  5I4D A;  1EEF D;  3SK6 A;  3D6C A;  2TMP A;  2AQ2 B;  1PXU A;  2I5H A;  1AH9 A;  1CQV A;  4ZYS A;  2Q2I A;  4L5R C;  2EY2 A;  3K7A H;  2PO4 A;  4A76 A;  2F0N A;  4JBJ A;  4JI6 L;  1N32 L;  4A3K H;  1JOR A;  4J8Q A;  1IYV A;  4FXK C;  3HKZ G;  3P20 A;  4IO9 A;  3UE0 A;  1GM5 A;  2DY7 A;  3RUZ A;  4OWW B;  3PIO A;  3F8T A;  1BO0 A;  1PZJ D;  2VS1 A;  1RDP D;  3JAM E;  2NN6 G;  4JK1 C;  2GA4 B;  1HUM A;  2UXB Q;  4DV6 L;  1FGU A;  1HTP A;  5M3F G;  3KK7 A;  1TWG B;  3I72 A;  2RQX A;  1HNX L;  1L1O B;  4DF7 A;  1WTO A;  3FP9 A;  2JA6 B;  1ML0 D;  3ERQ A;  1Q1B A;  2F0U A;  3SGI A;  1B1Z A;  1Y69 U;  1QOH A;  3STB D;  4NXN L;  1H9S B;  1MKH A;  1UAP A;  3H0G H;  2K75 A;  4L63 B;  1WTX A;  2RKS A;  4DV4 L;  1Q81 C;  2KQ3 A;  1H9J A;  4K8J A;  3NSW A;  3H15 A;  1EU4 A;  3KLS A;  1IL2 A;  1BCP C;  1S5D D;  4A93 B;  1ZYR C;  3GTG H;  4DR4 Q;  5ELC A;  2B2Y A;  4K2L A;  4AYB B;  1FGB D;  2EJM A;  3S1M H;  3CKI B;  3U9S A;  3M9B A;  4RGM A;  3K7U C;  1E0B A;  1JC7 A;  2Y0S B;  1SSO A;  1W6J A;  3GTJ B;  4POG A;  5C6A A;  2EZV A;  4JI3 Q;  4XT1 B;  1BCP D;  1QB5 D;  5IGC A;  1CA6 A;  3EN2 A;  1ASZ A;  1DZ1 A;  3TBI B;  2BDN A;  3S1Q H;  4IUP A;  3PUZ A;  3CC2 A;  1KRS A;  2HCC A;  1PFN A;  1R4Q B;  1LTR D;  2K4K A;  4A3I G;  4ZRZ A;  5BN5 A;  3F2C A;  2QKI C;  3PUW A;  2B8G A;  1GJX A;  2AKW B;  4B3M L;  3NP8 A;  5LMN L;  2RCF A;  1HQM C;  2LXK A;  2UU9 Q;  2B63 H;  2B2U A;  5GRO A;  2SDF A;  2F3W A;  4UP7 A;  2L0C A;  2WKD A;  3MA2 B;  1E22 A;  2N8N A;  3KDF A;  1IKM A;  1AW7 A;  3TP8 A;  2HDL A;  1Q7Y C;  4DPG A;  4KD3 A;  1JOO A;  4ZLT F;  1PH1 A;  4DR5 Q;  3RZO H;  3H91 A;  5GAG C;  2NVY H;  3IAY A;  3E0E A;  5A35 A;  2JA7 G;  4CDF C;  4A3K G;  1STE A;  3KUP A;  5CV7 A;  1I3Q B;  1TS5 A;  4UHV A;  4R8N A;  3U4V A;  2UXB L;  1JB3 A;  4IAL A;  3BZK A;  5IT9 L;  1YZ6 A;  1D8L A;  5H1S E;  1MIU A;  3OPO A;  1HZ9 A;  1V8Q A;  1H95 A;  5JJI A;  3OW2 A;  5EPK A;  2A68 D;  5KNB A;  1J9O A;  3NQI A;  1GVP A;  1D1I A;  3HOY B;  1JOQ A;  4JI2 Q;  5C4J B;  2EYF A;  1YI2 A;  5IP9 G;  4DV7 Q;  1C0A A;  2KJX A;  4DR4 L;  1JQY D;  5JVG 3;  1BR9 A;  2MFI A;  1IBK Q;  1U9R A;  3CC7 A;  1MJE A;  1C4Q A;  3QO2 A;  1H9M A;  3CRK C;  4PG3 A;  3J81 E;  2R7F A;  3NBI A;  4BBR H;  5J22 A;  2ATW A;  4M8A A;  3CU7 A;  4HAE A;  4DNR B;  1B7Y B;  4JI3 L;  3D3R A;  5ELF A;  2F0L A;  4QUC A;  2NVX H;  3G4S A;  2BDO A;  2E74 C;  2HIX A;  2F0M A;  1GUG A;  3S17 H;  1HXY D;  3CRL C;  4N8X 1;  1PH5 A;  1ZXT A;  5CGK A;  3GTO B;  1JR0 D;  1N9W A;  5AJ3 Q;  1PTO F;  3DEO A;  1UWV A;  1G51 A;  4P2C B;  1SMY C;  4WJW A;  2VZA A;  5C3E B;  2JA6 G;  2UU9 L;  4JI8 L;  1K8M A;  1OXV A;  4NDX A;  5K36 H;  1YHB A;  1HRJ A;  3HEJ A;  5FO7 B;  2UXD L;  1DOL A;  3VYS A;  1VF7 A;  1VQN A;  4RH6 A;  3J7A 5;  2K50 A;  3DMU A;  5EAY A;  3I4N B;  2RDG A;  2B29 A;  2NBF A;  4PMB A;  1E24 A;  2SNM A;  4DR5 L;  1SMY D;  2ZJP A;  4A3J B;  5D65 A;  2BH8 A;  2HDM A;  4AYB G;  3F2B A;  1J5E Q;  5IWA Q;  3MFG A;  3CCS A;  3TS2 A;  1NCV A;  3PO3 H;  3DUZ A;  3R2I A;  2Y0S G;  5DLQ E;  1EY6 A;  1F9S A;  4IPC A;  4U68 A;  4X62 Q;  1NE3 A;  4IQZ A;  2VUM H;  1KDB A;  3GTK B;  2HHH L;  1TQO A;  1WTH A;  5CR3 A;  5C4X B;  3GTO H;  3VA7 A;  2A19 A;  3TZU A;  4RHR A;  3SVM A;  2R92 B;  4I7Z C;  1N36 Q;  3FEW X;  1HNW Q;  2KHS A;  2K6A A;  3UDX A;  1SRU A;  4JI2 L;  3BDC A;  1UE6 A;  1STN A;  1X55 A;  2OCE A;  1D7Q A;  2A6E C;  1JCK B;  3KBG A;  4R9W A;  1YEZ A;  4DV7 L;  1YJW A;  1U4R A;  4RFB A;  1F9P A;  1FVI A;  1HPC A;  1XWE A;  3HOW H;  1IBK L;  1D6E C;  3EFX D;  4RHS A;  4LUV A;  1JT8 A;  2DNE A;  4XT3 B;  3BS1 A;  1DOM A;  1R9T B;  4MZ9 A;  1X56 A;  1Q8I A;  4BBR G;  2JA5 H;  1ET9 A;  1U4P A;  1QZH A;  1FL0 A;  1HCZ A;  3BDL A;  4RGO S;  2KEN A;  1VQI A;  5ELN A;  2F0F A;  1VQO A;  2IW3 A;  1G2S A;  2Z9H A;  5C4X H;  1ESF A;  2VY3 A;  5AJ3 L;  2A1A A;  4PNY A;  2A74 C;  4OX9 L;  2H1E A;  1WTP A;  1V9P A;  2A8V A;  1BQQ T;  4QUF A;  3J80 c;  5ELB A;  2RSO A;  2C35 B;  3TZD A;  2L12 A;  4RGT A;  5I6Y A;  1JMC A;  3X3N A;  3S2D B;  4ULL A;  1OXX K;  1CK1 A;  2JXM B;  1SE8 A;  1F2M A;  2PQA B;  2AQ1 B;  3A56 A;  5EPL A;  1TY2 A;  1R4P B;  5K36 G;  4A4I A;  1SYE A;  1VQM A;  2K5V A;  1PH7 A;  5IE8 A;  3TN2 A;  1K3B C;  1TWH B;  1L1O C;  1GO3 E;  1J5E L;  4IUU A;  2K52 A;  4POF A;  4GS3 A;  4DV0 Q;  1PZK D;  4JW0 A;  1A62 A;  1E1O A;  3G6E A;  2M9V A;  3J7A F;  2EOT A;  2I5L X;  5IYB H;  2EYP A;  5FLM H;  2UXC Q;  4QIW B;  3NWT A;  2NVT H;  4CKE A;  5IGF A;  5GAD C;  3PO3 G;  1G2T A;  1PHJ A;  2LFN A;  2DNC A;  4DXG A;  3GTL B;  1MD2 D;  1CSP A;  1N36 L;  1HNW L;  4YCW A;  5IT9 E;  1EQQ A;  3A7L A;  3S15 H;  2BE5 D;  5J1Z A;  3JAM c;  4CKB A;  2ICI A;  2XWB B;  4U67 3;  1GUT A;  1TII D;  4X3S A;  3S2H B;  3S2D H;  2PQE A;  2XRQ D;  3A5U A;  4KKU A;  1UEB A;  4F7X A;  3DHQ A;  4A3D B;  1Q82 C;  1TS4 A;  1SND A;  3TDQ A;  3W2D A;  2EE1 A;  2Z6K C;  2I07 B;  1MJC A;  1VQD A;  1DD2 A;  3I55 A;  4WOR A;  3R3O A;  3NK9 A;  4KV6 A;  2E5L Q;  2FHT A;  4OL7 A;  1V1Q A;  4K2K A;  2XSC A;  3FVQ A;  3I4N G;  1AE3 A;  2H4O A;  1SJH D;  3IKJ A;  4KHP Q;  1Y8P B;  4CGY B;  1EQV A;  4A3J G;  2I46 A;  3I8Z A;  3K6O A;  1TY0 A;  4ODG A;  1U0L A;  3I4M H;  2YV5 A;  3K0X A;  1VQ9 A;  1O80 A;  2CKZ B;  4XYQ A;  2JA5 G;  3BVG A;  1JOK A;  4I7A A;  3W1B A;  4K14 A;  4YHH Q;  3DLL A;  3I7F A;  2L1B A;  3BZD B;  1N33 Q;  1XMO Q;  1JJ2 A;  5JAV A;  1I94 Q;  1VQB A;  4CKC A;  4DV2 Q;  4A3E B;  2G5D A;  5C4X G;  3CPW A;  2R92 G;  1E2Z A;  4G4K A;  2F0I A;  1RCV D;  3VR6 A;  1ILP A;  2K5N A;  4DUZ Q;  1EYC A;  3M4P A;  5IYC H;  1KHI A;  3S1R H;  3S14 H;  2JN4 A;  3MEH A;  5I2Y A;  2EY1 A;  2EQS A;  2CW0 D;  4DK0 A;  2ZXO A;  1FJG Q;  5EPJ A;  3PMF A;  4P74 A;  2C9O A;  1K8A C;  5HUR A;  4GN4 B;  3M4O H;  3IFD A;  1YIT A;  4FF2 A;  4JG2 A;  1XPR A;  1NUC A;  4LMQ D;  2K5H A;  2IWH A;  2UXC L;  4GNX A;  1V43 A;  2WP8 J;  4KTA A;  5COY A;  2N49 A;  1SNM A;  5C0X G;  4GKK Q;  1X65 A;  2F0V A;  3MTS A;  5FLM G;  1XMQ L;  2YU9 B;  4BY1 B;  2MJ8 A;  4EX5 A;  1JWU D;  1PFM A;  3URY A;  2F0G A;  1LTL A;  5EBC A;  4AYB E;  3JAM i;  1L1O A;  1QIL A;  4DAY A;  2AQ3 B;  2PI2 E;  4JCV E;  4H7B A;  4DUY Q;  1LAB A;  1VQ4 A;  2Y0S E;  3I90 A;  4DV3 Q;  2FIN B;  1H9S A;  4XQQ A;  3AMU A;  2BOS A;  3D4R A;  1B3Q A;  1RF2 D;  1ZKO A;  4MTN A;  4P75 A;  3EBE A;  4NB3 A;  2E5L L;  2E75 C;  3AFQ A;  5IY0 A;  4FNF A;  4KHP L;  1CT1 D;  5IIF A;  3QR8 A;  4FXG C;  1LUZ A;  1IYU A;  1ZEQ X;  3MZ5 A;  3OWE B;  5KEE A;  1JIC A;  1SE3 A;  4DFA A;  1MSH A;  1MI2 A;  3J81 c;  1I4Q A;  4WJ4 A;  2F0O A;  2B8F A;  3L3O C;  4IPD A;  4UDU C;  5G3L D;  3I56 A;  5C44 H;  3K57 A;  3I4M G;  1BCP F;  4YHH L;  1ENA A;  3NE5 B;  3RZD B;  2L4N A;  3RMH A;  2YU9 H;  1N33 L;  4CJ0 B;  1XMO L;  4JI6 Q;  3H94 A;  4KJO A;  1N32 Q;  2Z6K A;  4LF9 Q;  3F2D A;  1WD1 A;  1ET6 A;  3GP7 A;  2F0D A;  5FLX L;  3SK4 A;  1I4P A;  4PMC A;  5I2X A;  4C3I B;  4J6H A;  1O7L A;  1B44 D;  1OXT A;  2OEO A;  2QDB A;  3KJP A;  3CD6 A;  2QF7 A;  3IRB A;  1RIP A;  1QE6 A;  4A3I B;  3UI2 A;  1SJE D;  2KBN A;  5M5X B;  1HNX Q;  5CV5 A;  4A3D G;  4DR7 Q;  4OO1 I;  3GTM B;  1A2T A;  2WV6 D;  3OIQ A;  5JJL A;  3H3V C;  3TS0 A;  5I9P A;  5M9O A;  4A3M H;  2JP1 A;  3KYH C;  5M3M H;  1SYG A;  3PCO B;  2AUK A;  1Z47 A;  4C2M H;  4QJF A;  4QQB X;  3SE0 A;  4L5T A;  1ICF B;  1HQR D;  4L5Q A;  4OIK A;  3NQT A;  1SR3 A;  4L8J A;  2UUC Q;  5DEH A;  3S9W A;  1UEA B;  2KUM A;  3MVV A;  5E4X A;  1AP0 A;  1K3R A;  2EYL A;  4GKK L;  3MXP A;  1K8O A;  3K7A B;  3ONA B;  4B9W A;  1UUP A;  3LX0 A;  2K28 A;  4K0K Q;  1VQF A;  1VMC A;  1I6H H;  3CF5 A;  1A63 A;  4ZQ3 A;  1NMF A;  2UUA Q;  3CXC A;  4QCL A;  4C3I H;  4RWS C;  4IN3 A;  3T1Y Q;  3R2T A;  1KL9 A;  4DUY L;  4A3E G;  4F8M A;  2G9D A;  2LY7 A;  3NXW A;  2FMM A;  4DV3 L;  3ULP A;  1S40 A;  4TSS A;  4C3J H;  1L0Y B;  1Q46 A;  2B39 A;  2AUJ D;  2PZU A;  4CDD C;  2EVB A;  1BVS A;  3LWU A;  2F0H A;  4LNQ A;  4N8F A;  2ZM6 Q;  1B8A A;  2EY6 A;  3D4D A;  1E2W A;  5CYU A;  4UPA A;  3H0G B;  4IJH A;  3ULL A;  1ENC A;  4H13 C;  2V4D A;  3G6J B;  2EYO A;  4B08 A;  1RTN A;  3GTG B;  3H6M A;  3J81 i;  3PUX A;  3T51 B;  3OTO Q;  1RHP A;  5CV8 A;  1EYG A;  3CQZ B;  4DK6 C;  1WOC A;  3GTQ H;  4I65 A;  2XTI A;  1XPO A;  3GD7 A;  1WTW A;  3S1M B;  4GNX B;  2RDH A;  4LF9 L;  3KJO A;  4GLX A;  1LO5 D;  1EIY B;  1UE7 A;  2GN5 A;  4BY1 G;  2PNR C;  4PQX A;  3DXJ C;  2MGS A;  3STB C;  5IOD A;  1SNP A;  1CHQ D;  1EUJ A;  1X3P A;  4ZKC B;  1N8R C;  4UY8 C;  1FYC A;  3S1Q B;  4C3H H;  3A8J E;  3FKI H;  4E6I A;  4GLA C;  4FYD A;  2K5D A;  5FJ8 H;  3NUC A;  1BKB A;  4DR7 L;  4DAY B;  2QEJ C;  3DM1 A;  1PZI D;  2L11 A;  2BCO A;  1WYD A;  2E2D C;  1SLJ A;  2KCM A;  3J7Y W;  1HR0 Q;  1VQG A;  5IYD G;  4NPS A;  2B63 B;  2LXJ A;  5GAE C;  1CKN A;  2TSS A;  4MIU A;  3NEN A;  5IGG A;  2UUC L;  1KC8 C;  3CCR A;  1EY8 A;  2O2L D;  3CQZ H;  1VMP A;  1XX8 A;  3CW2 C;  4K5X A;  4WRD A;  2OQK A;  3CC4 A;  4K0K L;  5D3D A;  1MBY A;  3RZO B;  1QUQ B;  2NVY B;  3AU7 A;  2UUA L;  2ZJQ A;  5ELD A;  2P5Z X;  2PNH A;  3T1Y L;  2Q2U A;  4BA2 I;  1YHA A;  5C5M A;  4HSP A;  4LFC Q;  1SXT A;  3BU2 A;  4C3I G;  1RTO A;  5IT9 c;  4NMZ A;  5LL6 X;  1GKH A;  2EDG A;  3CAM A;  3ITP A;  2ZM6 L;  1PH2 A;  1PH9 A;  3PGZ A;  2XIW A;  4DK1 A;  2J0T D;  3I4L A;  3E9I A;  1KQS A;  1TXY A;  3U9O A;  4JI8 Q;  3BYT B;  3OHX C;  2N78 A;  3EQL C;  2HQL A;  1LTA D;  2UXD Q;  1WCM B;  1X54 A;  3OTO L;  3HP3 A;  3L9A X;  2EXD A;  2E2J H;  1KNA A;  5BN4 A;  1PMR A;  3M3Y B;  4BBR B;  3TME A;  4YWL A;  3A54 A;  1YJ9 A;  2A68 C;  2EYJ A;  2ZTC A;  1PTO H;  4A3F B;  1EYA A;  5C3W A;  5FLX E;  2Q8T A;  4XXE A;  4R8I A;  2NVX B;  3K81 C;  2CH4 A;  1X3Q A;  3S17 B;  2HHH Q;  4JVZ A;  4Q5V A;  2Z4H A;  4LFA Q;  1D2B A;  1I4G A;  4QIW E;  2PQA A;  4A3G H;  1VQ7 A;  2OTJ A;  1HR0 L;  4HMJ A;  1LTS D;  4H0L C;  4YWM A;  1HA5 A;  1Y1W H;  1SFO H;  2X6L A;  1VF5 C;  3HG9 A;  1S3O A;  4QY7 A;  1WCM H;  3H0G G;  3QWN A;  4KN4 C;  3ULJ A;  1K0S A;  5KND A;  4DAP A;  2VQE Q;  4UAI A;  5LMN W;  3M3Y H;  3Q23 A;  4G7O C;  4CHT B;  2EPB A;  2OXP A;  3RLO A;  2CQO A;  1S5F D;  2G9H D;  3OIP A;  3PO3 B;  3MC0 B;  4UP8 A;  3I3C A;  3K5O A;  4A3F H;  3BG3 A;  4LF8 Q;  1BDO A;  4NKL A;  4LFC L;  3L2P A;  4IJL A;  5M5Y B;  3ERS X;  4DA2 A;  1HA6 A;  3B6Y A;  2PZW A;  1XTC D;  2VUM B;  4LJZ C;  1A6X A;  2BA0 A;  2AWN A;  1I4R A;  4H44 C;  2UUB Q;  4XYO A;  1SAP A;  4OX9 Q;  2VW9 A;  2DUD A;  5EKL A;  2IX0 A;  4A3B B;  4N9P A;  2D9U A;  2K1B A;  3PSI A;  1PFB A;  3C3L A;  3C1F A;  5JPM C;  4GKJ L;  4JOI C;  2B63 G;  1JE5 A;  1W2B A;  4FF4 A;  3HOW B;  2RDF A;  1M4V A;  1QG7 A;  4HSV A;  1EWC A;  4X3U A;  1OXU A;  3AB9 A;  4BS9 A;  1CKN B;  2HQE A;  2WAC A;  3V2T A;  3NHH A;  4LAA A;  3T1H Q;  4A3C H;  3NTI A;  2O4X A;  3E3X A;  3GDE A;  5JEA H;  1WTV A;  2JA5 B;  4ZKB B;  2NVQ H;  1YVC A;  2EJF C;  1K0R A;  3I4O A;  3KF8 B;  3FHW A;  5M5Y H;  3A8K E;  3KF6 B;  1TWA H;  2JE6 I;  3CP0 A;  4IOC A;  1QZG A;  4LFA L;  1B50 A;  4OO1 H;  3RLN A;  4R1J A;  4M1U B;  1EIF A;  4G57 A;  4H02 A;  3OSO A;  2X6G A;  2E76 C;  4A3B H;  3CMA A;  2KVM A;  3CME A;  4GZY C;  1X3E A;  4DN4 M;  1Q8K A;  1E1T A;  2PPB C;  1C8C A;  2JEA I;  3HOX H;  1DCZ A;  1KRT A;  3WDN A;  1STB A;  2VQE L;  1VQ8 A;  4JPB W;  3TEH B;  1WCM G;  1Q90 A;  5C0X J;  4DK3 C;  2KED A;  3D31 A;  3GV3 A;  1L2F A;  3TSS A;  2F4I A;  1NR2 A;  4LF8 L;  3C2P A;  3WOE A;  2NVT B;  2F3V A;  2KHI A;  5C3X A;  1G6Z A;  4A3F G;  2RHS B;  2UUB L;  1B9N A;  2A69 D;  4XQN A;  4OON A;  1GXD C;  3S15 B;  3PV0 A;  4AH6 A;  3PO2 H;  1HZC A;  4ABN A;  1SNC A;  2A73 B;  2KCN A;  4R4Q A;  4FF3 A;  4X3K A;  4GNX C;  1U4L A;  4ME3 A;  1VQK A;  4CJ2 C;  1Y14 B;  2JA9 A;  3ER0 A;  1KLG D;  2E2I H;  1J6Q A;  1PRT B;  4RCN A;  1GUS A;  4DNI A;  1WTR A;  1VQA A;  2MQH A;  2MO0 A;  1GD7 A;  5G3L F;  1A15 A;  4IFD I;  3T1H L;  3S24 A;  1TT2 A;  1YNX A;  4Y7N H;  3PUY A;  1EY9 A;  2BE5 C;  2DY8 A;  3UDI A;  1SYB A;  3I4M B;  4UP9 A;  3R93 A;  1SRO A;  1VQE A;  5COR A;  2PW7 A;  5JEA G;  2MHV A;  2N88 A;  2Z0S A;  4JOI A;  1XMQ Q;  5DNF A;  3V05 A;  2F0E A;  2HCI A;  2VUM G;  1A3T A;  3MXU A;  2ZJR A;  3W5O A;  5E7N A;  1KIX A;  1Y1V H;  1BBU A;  1RL2 A;  5IGE A;  1YIJ A;  1L0X B;  1K73 C;  4A3B G;  3S1R B;  1KDC A;  3S14 B;  1F77 A;  2F0S A;  1EWI A;  3RR5 A;  2RBM A;  5JJK A;  3PIO 3;  4S3S A;  3HOW G;  3SHL A;  1XNQ Q;  1S5C D;  3X3M A;  4YY3 Q;  3M4O B;  2B2T A;  2MP1 A;  3VR3 A;  1P16 A;  2LKV A;  3S16 H;  4TKO B;  1QVG A;  1II3 A;  3U50 C;  1PTO D;  1I5F A;  3ND9 A;  4ZCK A;  1FNW A;  1D1K A;  3NPP A;  3M7N A;  3AQQ A;  3SK5 A;  4HN7 A;  1EOT A;  5GQO A;  2VL6 A;  3QG1 A;  2CW0 C;  3AYH B;  2CFM A;  5L37 A;  3HGB A;  1I50 B;  1NTG A;  1CSQ A;  2B3G A;  4KHZ A;  4LWC A;  4X65 Q;  1HH2 P;  2RA4 A;  1RKN A;  5JOB A;  5C4H A;  3PUV A;  4XTC S;  4FF1 A;  2F0J A;  1F2Z A;  4FO2 A;  4HCS A;  5KYI A;  5EJW A;  2WAQ B;  5EBD A;  3VR2 A;  4K6L A;  1CKO A;  2OQ0 A;  5J3B A;  5IP7 H; 
#chains in the Genus database with same CATH homology
 2D62 A;  4C1N I;  2Z1C A;  2ZT9 C;  5ISR A;  4EQN A;  2VNU D;  2ENB A;  2LMC B;  5C44 B;  2M2L A;  1OXS C;  1STY A;  1TU2 B;  1VCI A;  3VR4 A;  2VB3 X;  4FXD A;  1A3U A;  1LT5 D;  1BXT A;  3F2U A;  4RAU C;  5F2D A;  3ZYY X;  1FNV A;  1OO9 B;  2R6G A;  5EQ0 A;  4XDX A;  1LAC A;  4F87 A;  3VYT A;  5A2Q L;  1BF4 A;  3DWQ A;  2QCP X;  3L7Z C;  1AEX A;  2VB2 X;  4RKB A;  1A3V A;  1HUN A;  2EY5 A;  1WVL A;  4CJ1 B;  1SEB D;  4A3M B;  2NTS A;  5M3M B;  3P75 A;  4HR7 B;  4C2M B;  4G7H C;  3CHB D;  1U4M A;  4TRD A;  1GUO A;  3PIP 3;  1SYD A;  2X69 A;  1EEI D;  3MFY A;  1STH A;  1WD0 A;  1CHP D;  5AFW A;  3SK8 A;  2EYM A;  1I6H B;  3MAQ A;  1H9K A;  1BNZ A;  3A55 A;  1RJT A;  4IUN A;  1EYD A;  2SNS A;  2SEB D;  4C3J B;  2WIN B;  4G7Z C;  4K6D A;  3A7A B;  1EFI D;  5I6W A;  2R7Z B;  1B3A A;  4QMG A;  1SNQ A;  4HED A;  4KMU C;  2NTT A;  1SE2 A;  1TR5 A;  3GTQ B;  2PZT A;  5CBE E;  1I6V C;  1QNK A;  1CTM A;  1TVX A;  3E5S A;  5EKI A;  1V1P B;  1XYI A;  3K5L A;  4C3H B;  5LHY 1;  3FKI B;  1UNS A;  1IW7 D;  3K5N A;  2KEC A;  1EZ6 A;  2K01 A;  4X3T A;  3P7J A;  5EKK A;  1AN8 A;  1EIG A;  3QOJ A;  4KHV A;  4RGN A;  4KD4 A;  1PRT C;  3HOU B;  1EY7 A;  4XIG S;  1QJO A;  1JWS D;  1AZQ A;  4IUR A;  2JYO A;  5CMD A;  4QB4 A;  3GTP B;  1XXG A;  1DM0 B;  2D2C C;  2RVL A;  2XRS D;  1PRT D;  3A8I E;  2WB1 B;  3BVZ A;  2K32 A;  1LTB D;  1HFG A;  4K8I A;  2NWG A;  4IFD H;  2R61 A;  3D4W A;  3LWE A;  5C0X I;  2Q8R E;  4KY5 A;  1CM9 A;  1W6K A;  2F1M A;  4KK7 A;  4IUV A;  2F0W A;  2NB0 A;  2SOB A;  1TS3 A;  2WII B;  3I91 A;  2E2J B;  1SYF A;  2ID0 A;  3N52 A;  1G91 A;  3OMC A;  3KF8 A;  1IL8 A;  1AZP A;  1KNE A;  3C1E A;  2PCF B;  3BDO A;  4NW2 A;  5C5L A;  1PTO B;  3E0J A;  2KA7 A;  1EL0 A;  4EGV A;  2LS0 1;  1LLR D;  3N6R A;  1C48 A;  1LT3 D;  5A2Q E;  4C3J G;  2PW5 A;  4A3G B;  3KLR A;  3T16 A;  5CC4 A;  4IZ8 A;  1Y1W B;  1ZYR D;  1TWF B;  1SFO B;  4EQP A;  1O7Y A;  3K0Y A;  1AFP A;  5FO9 B;  1Q1E A;  1Q3L A;  4ILW A;  3VYU A;  5KYL A;  1B2T A;  4C1N K;  4B9X A;  1EQT A;  5CBA E;  4KN7 C;  3D8G A;  1FD7 D;  1EU3 A;  4YIJ A;  4C56 C;  1SYC A;  3QOL A;  2Z4I A;  4PV1 C;  4N9T A;  3M4Y A;  4C3H G;  2JSO A;  3FPU B;  2K5Q A;  1GUN A;  2JEB I;  1X32 A;  3EA6 A;  5D3I B;  4HTH A;  4IFD G;  2KCC A;  5ELE A;  3Q24 A;  5BN3 A;  2R3Z A;  3M85 A;  3RLF A;  5JEA J;  4O1N A;  2K04 A;  4V19 0;  5IGB A;  1QNU A;  5KRU A;  4DXF A;  2KEE A;  4ZK9 B;  2NVQ B;  1Q12 A;  2IT1 A;  2PMZ B;  2A5H A;  1TWA B;  4RCO A;  1GHJ A;  1J8I A;  2K7V A;  5K5P A;  3HOZ B;  4BBS B;  3T56 B;  4KKS A;  1TWC B;  1ILQ A;  3HRZ C;  1EZ8 A;  4EVO A;  4IUQ A;  3ERO A;  1NSN S;  4ZAI A;  4KI0 A;  4O42 A;  3HOX B;  2XVS A;  1BBX C;  5E4W C;  1S5B D;  3V96 A;  2F0T A;  2NN6 I;  2IPK D;  3WOF A;  4BA1 I;  3DWA A;  4FP5 D;  1HFN A;  5NUC A;  3NWS A;  5D14 A;  1QCB D;  1D5Z C;  1WTQ A;  4DGZ A;  1MGS A;  3OW7 A;  1EWH A;  3FRP B;  1ROD A;  1STG A;  4TQU S;  4BY7 B;  2B2T C;  4KY7 A;  4PMW A;  1SBB B;  3TP5 A;  3PO2 B;  3VR5 A;  1LTT D;  5CV4 A;  1EY0 A;  2IX1 A;  2E2I B;  1TKW B;  1JE4 A;  1EY5 A;  4WFN 3;  4FVM A;  2IL8 A;  2O5J C;  2N55 A;  3TP7 A;  3ND8 A;  2F0K A;  4Z9C B;  4J1M A;  2A69 C;  2K03 A;  4Y7N B;  2C5C A;  1NAP A;  4ID6 A;  3Q0A A;  3P1H A;  4Q0F A;  4BWG B;  2NUC A;  4EQO A;  3K58 A;  3OOC A;  1Z6H A;  5KGU A;  3SEB A;  2A6E D;  2EXZ A;  1YNJ C;  1Y1V B;  2FFK B;  2L9H A;  1KAA A;  1ONL A;  3E6Z X;  4MHE A;  1RD9 D;  2A6H C;  5KIX A;  2L55 A;  2D5D A;  5J39 A;  1YNJ D;  2F0P A;  1ESR A;  2OF1 A;  2R93 B;  3O13 A;  1SDF A;  1O78 A;  1S4Z A;  1SE4 A;  3S16 B;  2WKC A;  3IL8 A;  3OMG A;  4K5V A;  2A6H D;  4MN3 A;  2K33 A;  2XN9 C;  3T13 A;  3Q22 A;  1DYQ A;  1E2V A;  3LNN A;  1QWY A;  1DON A;  1Y8N B;  1DJR D;  3FDT A;  1LT4 D;  3MWY W;  3J7A V;  4OO1 G;  1D5M C;  5EGT A;  2E2H B;  1BUV T;  5C0X H;  1FR3 A;  2MUY A;  1PTO C;  1CQF A;  4DNT B;  3Q6S A;  3T4A C;  1ENF A;  1DOK A;  4DU9 A;  4OHJ A;  2B2V C;  2L5T A;  5M5W B;  1I4H A;  5CV9 A;  4RKL A;  4HMI A;  5C4Z A;  3W3A A;  2IJ0 A;  1BCP B;  3J80 L;  1Z7T A;  5TSS A;  5FO8 B;  3VA5 A;  2CVR A;  3IFT A;  2EYH A;  2FMC A;  1FNU A;  3I73 A;  1KAB A;  3GO5 A;  1SNO A;  3BVM A;  2F0Q A;  1B9M A;  1MSG A;  2B2W C;  4JBW A;  1CI3 M;  1V1P A;  1KDA A;  2IX3 A;  1PDQ A;  1DXM A;  4IUT A;  1CA5 A;  3NBH A;  4DAV A;  2FJ2 A;  4K5W A;  2DN8 A;  3T53 B;  2CHB D;  3K59 A;  5E1F A;  1O7Z A;  1EY4 A;  5DAU A;  3DWP A;  3NTK A;  2ICE C;  3TP6 A;  5FKA C;  1HTL D;  1Y8O B;  3JAM L;  2ZXP A;  1B53 A;  4NP5 A;  1STA A;  3EJI A;  4XQJ A;  3HOV B;  2AWO A;  2J7Z A;  2NZ1 D;  1VDZ A;  3R8B A;  4LK1 C;  4KY6 A;  1PRT F;  3MXG A;  3G7L A;  5CV6 A;  2Z8L A;  1JWM D;  3KLS X;  4F88 A;  3S1N B;  1LT6 D;  1TS2 A;  1ICW A;  2OT2 A;  1EIH A;  3HKZ B;  1IHZ A;  2Q8I B;  4HCE A;  2F03 A;  5LL6 S;  1S5E D;  1IKL A;  3BYY B;  3OWF A;  5DM6 3;  1HHV A;  2JA8 B;  3EVQ A;  5M3F B;  1KTK A;  4QF4 A;  2QIL A;  5KNC A;  3VYR A;  1GHK A;  4ZUI A;  1LV9 A;  3K5M A;  3FMC A;  1K83 B;  5IOC A;  4CBV A;  1F2L A;  2PYK A;  2K05 A;  4KJN A;  2B2V A;  5T1G A;  1PLF A;  4ZUJ A;  1V1O A;  5E3F A;  2KOL A;  3KBX A;  1F2Y A;  3I70 A;  1M8A A;  3GQB A;  1GUW A;  5JJZ A;  4V0B A;  4L6T B;  5FK9 C;  2B2W A;  2NN6 H;  2MPM A;  1LTG D;  1CZG A;  1A2U A;  1G29 1;  1BOS A;  2CQA A;  3QJY A;  2O5I C;  2B2Y C;  5HGT A;  3QB3 A;  3FPP A;  5DM7 3;  1B4O A;  1CZW A;  4ME5 A;  3GV6 A;  5JVH 3;  1T5E A;  1H9R A;  3HS0 C;  1IW7 C;  3DEP A;  1NR4 A;  3MHB A;  3HZX A;  1I4X A;  2BA1 A;  3NTH A;  3J81 L;  2XNA C;  3QIA A;  4IFD J;  1KLU D;  2K5W A;  2JA7 B;  1G8Z D;  2XWJ B;  4A3K B;  5IGD A;  2YYZ A;  1LTI D;  3C46 A;  5T1I A;  1GOZ A;  4KKT A;  2B2U C;  5FOB B;  1F9Q A;  3H09 A;  1T5X D;  1YNN C;  2ZXR A;  4OIJ A;  5JPN C;  1CFM A;  5I9O A;  2J4X A;  3J80 E;  2HUG A;  4RA8 A;  4OGQ C;  3D6W A;  1D5X C;  1PYW D;  3SR1 A;  2RSN A;  2M00 A;  1F9R A;  3M7G A;  3SXH A;  2EJG C;  3RD4 A;  3SDZ A;  3MXN A;  1YNN D;  2NYZ D;  2VXW A;  5I4D A;  1EEF D;  3SK6 A;  3D6C A;  2TMP A;  2AQ2 B;  1PXU A;  1CQV A;  4ZYS A;  2EY2 A;  2PO4 A;  2F0N A;  1JOR A;  4J8Q A;  1IYV A;  4FXK C;  3P20 A;  2DY7 A;  3RUZ A;  1BO0 A;  1PZJ D;  1RDP D;  3JAM E;  2NN6 G;  4JK1 C;  2GA4 B;  1HUM A;  1HTP A;  3KK7 A;  1TWG B;  3I72 A;  2RQX A;  4DF7 A;  1WTO A;  2JA6 B;  1ML0 D;  3ERQ A;  1Q1B A;  2F0U A;  1B1Z A;  1Y69 U;  1QOH A;  1H9S B;  1UAP A;  4L63 B;  1WTX A;  2RKS A;  2KQ3 A;  1H9J A;  4K8J A;  3NSW A;  1EU4 A;  3KLS A;  1BCP C;  1S5D D;  4A93 B;  1ZYR C;  5ELC A;  2B2Y A;  4K2L A;  4AYB B;  1FGB D;  2EJM A;  3CKI B;  3U9S A;  4RGM A;  1E0B A;  1JC7 A;  2Y0S B;  1SSO A;  1W6J A;  3GTJ B;  5C6A A;  2EZV A;  4XT1 B;  1BCP D;  1QB5 D;  5IGC A;  1CA6 A;  1DZ1 A;  3TBI B;  2BDN A;  4IUP A;  3PUZ A;  2HCC A;  1PFN A;  1R4Q B;  1LTR D;  4ZRZ A;  5BN5 A;  2QKI C;  3PUW A;  2B8G A;  1GJX A;  3NP8 A;  1HQM C;  2B2U A;  2SDF A;  2F3W A;  2L0C A;  2WKD A;  3MA2 B;  1IKM A;  3TP8 A;  1AW7 A;  2HDL A;  4ZLT F;  4KD3 A;  1JOO A;  3H91 A;  3IAY A;  5A35 A;  1STE A;  3KUP A;  5CV7 A;  1I3Q B;  1TS5 A;  4R8N A;  1JB3 A;  4IAL A;  5IT9 L;  3OPO A;  1V8Q A;  5EPK A;  2A68 D;  5KNB A;  1J9O A;  3NQI A;  1D1I A;  3HOY B;  1JOQ A;  5C4J B;  2EYF A;  2KJX A;  1JQY D;  5JVG 3;  1BR9 A;  1U9R A;  1C4Q A;  3QO2 A;  1H9M A;  3CRK C;  3J81 E;  3NBI A;  5J22 A;  4M8A A;  3CU7 A;  4HAE A;  4DNR B;  3D3R A;  5ELF A;  2F0L A;  4QUC A;  2BDO A;  2E74 C;  2F0M A;  1GUG A;  1HXY D;  3CRL C;  1ZXT A;  5CGK A;  3GTO B;  1JR0 D;  1PTO F;  3DEO A;  4P2C B;  1SMY C;  4WJW A;  5C3E B;  1K8M A;  1OXV A;  4NDX A;  5K36 H;  1HRJ A;  3HEJ A;  5FO7 B;  1DOL A;  3VYS A;  1VF7 A;  4RH6 A;  3DMU A;  3I4N B;  2RDG A;  2NBF A;  4PMB A;  2SNM A;  1SMY D;  4A3J B;  5D65 A;  2HDM A;  3MFG A;  1NCV A;  3DUZ A;  3R2I A;  1EY6 A;  1F9S A;  4U68 A;  4IQZ A;  1KDB A;  3GTK B;  1TQO A;  5CR3 A;  5C4X B;  3VA7 A;  3TZU A;  2R92 B;  4RHR A;  3SVM A;  4I7Z C;  3FEW X;  2KHS A;  2K6A A;  3BDC A;  1STN A;  2A6E C;  1JCK B;  3KBG A;  4R9W A;  1U4R A;  4RFB A;  1F9P A;  1HPC A;  1XWE A;  1D6E C;  3EFX D;  4RHS A;  2DNE A;  4XT3 B;  3BS1 A;  1DOM A;  1R9T B;  1Q8I A;  1ET9 A;  1U4P A;  1HCZ A;  3BDL A;  4RGO S;  2F0F A;  2IW3 A;  1G2S A;  1ESF A;  4PNY A;  2A74 C;  2H1E A;  1WTP A;  1BQQ T;  4QUF A;  5ELB A;  2RSO A;  3TZD A;  2L12 A;  4RGT A;  5I6Y A;  3S2D B;  3X3N A;  4ULL A;  1OXX K;  1CK1 A;  2JXM B;  1F2M A;  2AQ1 B;  3A56 A;  5EPL A;  1TY2 A;  1R4P B;  5K36 G;  1SYE A;  3TN2 A;  1TWH B;  4IUU A;  1PZK D;  2M9V A;  3J7A F;  2EOT A;  2EYP A;  4QIW B;  3NWT A;  4CKE A;  5IGF A;  1G2T A;  2LFN A;  2DNC A;  4DXG A;  3GTL B;  1MD2 D;  5IT9 E;  3A7L A;  2BE5 D;  5J1Z A;  4CKB A;  2ICI A;  2XWB B;  4U67 3;  1GUT A;  1TII D;  4X3S A;  3S2H B;  2PQE A;  2XRQ D;  4KKU A;  4F7X A;  3DHQ A;  4A3D B;  1TS4 A;  1SND A;  3TDQ A;  3W2D A;  2EE1 A;  2I07 B;  1DD2 A;  4WOR A;  3R3O A;  3NK9 A;  4KV6 A;  2FHT A;  4OL7 A;  4K2K A;  2XSC A;  3FVQ A;  2H4O A;  1SJH D;  3IKJ A;  1Y8P B;  4CGY B;  1EQV A;  2I46 A;  3I8Z A;  3K6O A;  1TY0 A;  4ODG A;  1O80 A;  4XYQ A;  3BVG A;  1JOK A;  4K14 A;  2L1B A;  3BZD B;  5JAV A;  4CKC A;  4A3E B;  1E2Z A;  4G4K A;  2F0I A;  1RCV D;  3VR6 A;  1ILP A;  1EYC A;  3MEH A;  5I2Y A;  2EY1 A;  2CW0 D;  4DK0 A;  2ZXO A;  5EPJ A;  3PMF A;  2C9O A;  5HUR A;  3IFD A;  4FF2 A;  1NUC A;  4LMQ D;  2IWH A;  1V43 A;  2WP8 J;  4KTA A;  5COY A;  1SNM A;  5C0X G;  2F0V A;  3MTS A;  2YU9 B;  4BY1 B;  2MJ8 A;  1JWU D;  1PFM A;  3URY A;  2F0G A;  5EBC A;  1QIL A;  4DAY A;  2AQ3 B;  4H7B A;  1LAB A;  3I90 A;  2FIN B;  1H9S A;  4XQQ A;  3AMU A;  2BOS A;  3D4R A;  1RF2 D;  1ZKO A;  2E75 C;  4FNF A;  1CT1 D;  5IIF A;  4FXG C;  1IYU A;  1ZEQ X;  3MZ5 A;  3OWE B;  5KEE A;  1JIC A;  1SE3 A;  4DFA A;  1MSH A;  1MI2 A;  1I4Q A;  2F0O A;  2B8F A;  3L3O C;  4UDU C;  5G3L D;  3K57 A;  1BCP F;  1ENA A;  3NE5 B;  3RZD B;  2L4N A;  3RMH A;  4CJ0 B;  3H94 A;  4KJO A;  1WD1 A;  1ET6 A;  3GP7 A;  2F0D A;  5FLX L;  3SK4 A;  1I4P A;  4PMC A;  5I2X A;  4C3I B;  4J6H A;  1O7L A;  1B44 D;  1OXT A;  2OEO A;  2QDB A;  2QF7 A;  1QE6 A;  4A3I B;  3UI2 A;  1SJE D;  5M5X B;  5CV5 A;  4OO1 I;  3GTM B;  1A2T A;  2WV6 D;  3OIQ A;  3H3V C;  5I9P A;  5M9O A;  2JP1 A;  1SYG A;  2AUK A;  1Z47 A;  3SE0 A;  1HQR D;  4OIK A;  3NQT A;  4L8J A;  5DEH A;  3S9W A;  1UEA B;  2KUM A;  3MVV A;  5E4X A;  1AP0 A;  2EYL A;  3MXP A;  1K8O A;  3K7A B;  3ONA B;  4B9W A;  1UUP A;  3LX0 A;  2K28 A;  1VMC A;  4ZQ3 A;  4QCL A;  4RWS C;  4IN3 A;  3R2T A;  4F8M A;  2G9D A;  2LY7 A;  3NXW A;  2FMM A;  4TSS A;  1L0Y B;  2B39 A;  2AUJ D;  2PZU A;  2EVB A;  3LWU A;  2F0H A;  2EY6 A;  3D4D A;  1E2W A;  5CYU A;  3H0G B;  1ENC A;  4H13 C;  2V4D A;  3G6J B;  2EYO A;  4B08 A;  1RTN A;  3GTG B;  3H6M A;  3PUX A;  3T51 B;  1RHP A;  5CV8 A;  3CQZ B;  4I65 A;  3GD7 A;  1WTW A;  3S1M B;  2RDH A;  1LO5 D;  2PNR C;  4PQX A;  3DXJ C;  2MGS A;  5IOD A;  1SNP A;  1CHQ D;  1X3P A;  4ZKC B;  1FYC A;  3S1Q B;  3A8J E;  4E6I A;  4FYD A;  2K5D A;  3NUC A;  2QEJ C;  3DM1 A;  1PZI D;  2L11 A;  2BCO A;  2E2D C;  3J7Y W;  2B63 B;  2TSS A;  4MIU A;  5IGG A;  1EY8 A;  2O2L D;  4K5X A;  1VMP A;  1XX8 A;  4WRD A;  5D3D A;  1MBY A;  3RZO B;  2NVY B;  3AU7 A;  5ELD A;  4BA2 I;  5C5M A;  4HSP A;  1SXT A;  4C3I G;  1RTO A;  4NMZ A;  5LL6 X;  2EDG A;  3ITP A;  2XIW A;  4DK1 A;  2J0T D;  3I4L A;  3U9O A;  3BYT B;  3OHX C;  3EQL C;  1LTA D;  1WCM B;  3HP3 A;  3L9A X;  1KNA A;  5BN4 A;  1PMR A;  3M3Y B;  4BBR B;  3TME A;  3A54 A;  2A68 C;  2EYJ A;  1PTO H;  4A3F B;  1EYA A;  5C3W A;  5FLX E;  2Q8T A;  4XXE A;  4R8I A;  2NVX B;  1X3Q A;  3S17 B;  4Q5V A;  2Z4H A;  1D2B A;  1I4G A;  4HMJ A;  1LTS D;  4H0L C;  1HA5 A;  2X6L A;  1VF5 C;  3HG9 A;  3QWN A;  4KN4 C;  5KND A;  4DAP A;  4UAI A;  3Q23 A;  4G7O C;  4CHT B;  2EPB A;  2OXP A;  1S5F D;  2G9H D;  3OIP A;  3PO3 B;  3MC0 B;  3I3C A;  3K5O A;  3BG3 A;  1BDO A;  4NKL A;  5M5Y B;  4DA2 A;  1HA6 A;  2PZW A;  1XTC D;  2VUM B;  4LJZ C;  1A6X A;  2BA0 A;  2AWN A;  1I4R A;  4H44 C;  4XYO A;  1SAP A;  5EKL A;  2IX0 A;  4A3B B;  4N9P A;  2D9U A;  2K1B A;  1PFB A;  3C3L A;  3C1F A;  5JPM C;  4FF4 A;  3HOW B;  2RDF A;  1M4V A;  1QG7 A;  4HSV A;  1EWC A;  4X3U A;  1OXU A;  3AB9 A;  4BS9 A;  2HQE A;  2WAC A;  3V2T A;  3NHH A;  4LAA A;  3NTI A;  2O4X A;  1WTV A;  5JEA H;  2JA5 B;  4ZKB B;  2EJF C;  3A8K E;  2JE6 I;  1B50 A;  4OO1 H;  4M1U B;  4G57 A;  3OSO A;  2X6G A;  2E76 C;  2KVM A;  4GZY C;  4DN4 M;  2PPB C;  1C8C A;  2JEA I;  1DCZ A;  3WDN A;  1STB A;  1Q90 A;  5C0X J;  2KED A;  3D31 A;  3GV3 A;  3TSS A;  2F4I A;  1NR2 A;  3C2P A;  3WOE A;  2NVT B;  2F3V A;  5C3X A;  1G6Z A;  1B9N A;  2A69 D;  4XQN A;  1GXD C;  3S15 B;  3PV0 A;  4ABN A;  1SNC A;  2A73 B;  2KCN A;  4FF3 A;  4X3K A;  1U4L A;  4CJ2 C;  1KLG D;  1PRT B;  4RCN A;  1GUS A;  1WTR A;  5G3L F;  1A15 A;  4IFD I;  1TT2 A;  3PUY A;  1EY9 A;  2BE5 C;  2DY8 A;  1SYB A;  3I4M B;  3R93 A;  5COR A;  2PW7 A;  5JEA G;  2MHV A;  2N88 A;  5DNF A;  3V05 A;  2F0E A;  2HCI A;  1A3T A;  3MXU A;  5IGE A;  1L0X B;  3S1R B;  1KDC A;  3S14 B;  1F77 A;  2F0S A;  2RBM A;  3PIO 3;  4S3S A;  3SHL A;  1S5C D;  3X3M A;  3M4O B;  2B2T A;  2MP1 A;  3VR3 A;  2LKV A;  4TKO B;  1II3 A;  1PTO D;  3ND9 A;  1FNW A;  1D1K A;  3NPP A;  3M7N A;  3SK5 A;  4HN7 A;  1EOT A;  3QG1 A;  2CW0 C;  3HGB A;  1I50 B;  4KHZ A;  2RA4 A;  1RKN A;  5JOB A;  5C4H A;  3PUV A;  4XTC S;  4FF1 A;  2F0J A;  1F2Z A;  4FO2 A;  4HCS A;  5KYI A;  5EJW A;  2WAQ B;  5EBD A;  3VR2 A;  4K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...