3FDTA

Crystal structure of the complex of human chromobox homolog 5 (cbx5) with h3k9(me)3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
b'EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Recognition and specificity determinants of the human cbx chromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fdtA00
1DOMA 1SAPA 1U4RA 2B2UC 3DM1A 1PFMA 5COYA 3FPUB 4CJ0B 3H91A 5CBAE 2K1BA 2KUMA 1G2SA 1F9QA 3ONAB 1CM9A 4OIKA 1U4PA 3MTSA 1HRJA 1B50A 1QE6A 1B3AA 2EPBA 1QNKA 3I3CA 5EPLA 1CA6A 1RODA 1RTNA 2L4NA 4O42A 2MP1A 3SVMA 2DY7A 4IUUA 1KNEA 2NYZD 5EKIA 4ZKCB 1EL0A 1KNAA 2NZ1D 2B2YA 3MWYW 4HAEA 4X3TA 2HCCA 3DEPA 1J9OA 1U4MA 3FDTA 3KUPA 2MJ8A 2N88A 1NR2A 1U4LA 3N52A 1HUNA 1O7ZA 2R3ZA 1G6ZA 4UAIA 1O7YA 5EQ0A 1NAPA 4IUPA 1F2LA 5D14A 1E0BA 2FHTA 2RSNA 4QUFA 1WTOA 1F9PA 4MN3A 2K03A 3GV3A 4ZK9B 1WTQA 1JE4A 5D65A 4HCSA 1G91A 1ICWA 2KEEA 1F9RA 1AZQA 1DOLA 1NR4A 3UI2A 1PDQA 2HCIA 1MI2A 5T1GA 1DONA 3LWEA 1A15A 2H1EA 2X6LA 4ZLTF 3QO2A 5E4WC 2JP1A 2L12A 4XT3B 1HA6A 3I8ZA 1RJTA 3I90A 2FJ2A 1XX8A 1BNZA 1VMPA 3I91A 4XDXA 1ILPA 2HDMA 1ML0D 2B2WA 1EOTA 2B2VC 2B2UA 2K01A 1J8IA 1RTOA 1X3PA 2L11A 5CBEE 4ZAIA 4ZKBB 4RAUC 1ESRA 3IL8A 2K05A 2IL8A 2RSOA 2DY8A 4NW2A 1SDFA 2Q8TA 2MGSA 1C8CA 5JJZA 3KBXA 1ZXTA 4RWSC 4CJ1B 1DZ1A 1TVXA 2KECA 4LMQD 1PLFA 3DEOA 1WTRA 1QG7A 5AFWA 1EIGA 1X3QA 1B4OA 2CVRA 1WVLA 1WTPA 1AZPA 4HEDA 1BF4A 5EPJA 2MPMA 4RA8A 1MSHA 2JYOA 2X69A 1MGSA 1MSGA 2B2VA 2NWGA 2FMMA 5CORA 1IKMA 1BBXC 1IL8A 2KOLA 1EQTA 3G7LA 5T1IA 1HFGA 1CA5A 5DNFA 1O80A 1X32A 1Q3LA 2M2LA 2BDNA 2HDLA 2X6GA 4X3SA 4IUVA 3P7JA 4OIJA 2K28A 3F2UA 5CMDA 1HUMA 4R9WA 3IFDA 4IURA 3TZDA 1M8AA 2XIWA 2RA4A 4U68A 4X3UA 1GUWA 2EOTA 2L1BA 4HSVA 5EPKA 1B2TA 1G2TA 4MHEA 1EIHA 1RHPA 1B53A 1WTXA 2B2TC 3HP3A 1ILQA 1BO0A 4IUQA 1WTVA 1WD1A 1WD0A 1JICA 4CJ2C 1XYIA 2KVMA 4R8IA 1S4ZA 5EJWA 3R93A 1F9SA 1DOKA 1PFBA 4XT1B 1AP0A 1WTWA 3D6WA 3TN2A 2N55A 2VXWA 1SSOA 2EE1A 1NCVA 2D9UA 1IKLA 2SDFA 2Q8RE 2RVLA 4QUCA 5E4XA 4DN4M 4IUTA 2J7ZA 2L9HA 1VMCA 1PFNA 2FINB 2B2YC 1HHVA 2K04A 3Q6SA 3GV6A 1LV9A 2FFKB 1HFNA 2B2TA 2KEDA 4X3KA 2HUGA 2B2WC
chains in the Genus database with same CATH superfamily
1CQVA 3VYRA 2B2UC 1HR0W 1V1PB 3RR5A 3UDFA 2JA8G 1JOKA 4XQQA 1HRJA 1U4PA 1LTLA 1PH4A 4GLAC 1VQLA 1K83H 2OF1A 3HZXA 1EIYB 2E2IB 1D5XC 2Z0SA 1J5EL 4BY1H 4ZKCB 1SROA 2CQAA 4YWKA 4X3TA 3RLNA 1OTCA 2E2JB 4MZ9A 2SNSA 4FDBA 4DV7L 5CYUA 1M1KC 5CV5A 2L15A 3HOXG 1XNQL 3ZJYC 2F3WA 2I5LX 3HOZG 1HZCA 4QUFA 1LACA 1LT6D 1RIPA 3FEWX 1S3OA 3NEMA 4PNYA 4XQNA 1VQGA 3TP5A 2BA0A 3FKIB 1N33Q 1CSQA 4POGA 2PNRC 3OWFA 1MI2A 5LHY1 2Z6KA 2JP1A 4JI8Q 2UUBL 1RJTA 1PZJD 1N34Q 1HQMC 4QGUA 4JI0L 1TWGB 1WJJA 2QILA 1GO3E 3GDEA 2LFNA 2B2VC 4HJAA 1X3PA 3QB3A 4EGVA 3NTKA 1N32Q 4EX5A 1LUZA 1WI5A 3GTJH 3J7A5 4RWSC 1SNPA 1PRTF 1AW7A 3J80L 4DR2Q 2KENA 2JQOA 1KHIA 1E2WA 1UE7A 1NMFA 1CKMA 3C3LA 2NWGA 4GZYC 2RHSB 5JEAJ 3EJIA 1JJ2A 2L5TA 3KLSA 3J81j 4QIWE 1KLGD 3A74A 5FLMH 4DAYA 1F77A 3NWTA 4UHVA 2VUMB 1QNUA 1GUWA 4HIMA 5EPKA 4POFA 1HR0Q 1ESFA 4GN4B 4BY7B 1JCKB 1WTVA 1BO0A 1HZBA 1L1OA 3ULPA 4LF4L 4DR4L 1BBWA 1IBML 2F03A 1SSOA 5C3WA 1I4RA 1Q1BA 2CKZB 3CCJA 1VDZA 1TWCB 5C5LA 4A3LG 2KEDA 3Q6SA 4FF4A 1NMGA 3A8KE 4MTKA 2QDBA 4RGOS 2I07B 1VQAA 4RH6A 4X62Q 4A3JG 2K33A 2QEJC 4EQOA 5ELOA 1IZ6A 2Z4IA 5E1FA 3MTSA 3CPWA 5H1SE 1VQPA 1V43A 3GTQB 1WCMH 1HNXQ 2A1AA 1LYLA 1ENFA 4AQYL 3HOYH 1UE1A 4NMZA 5LL6S 3R8BA 1Y8NB 4DUYL 2DY7A 3HOUG 3PO2B 3RMHA 4IALA 2NZ1D 3MWYW 2N78A 2B63H 2JSOA 2Z6KC 5GAGC 5ELDA 2BDOA 3I55A 2EY5A 3BVZA 3J81c 4A3DH 1E0BA 1XMOQ 5I2XA 4MN3A 1ZKOA 1SEBD 3QWNA 3UI2A 3ERQA 1PDQA 3DMUA 4JV5Q 5ELCA 2WIIB 1IXRA 3T53B 3MHBA 1Y69U 3B6YA 5M3MH 2EY2A 3Q0AA 1F2MA 5CGKA 2FJ2A 3GTPH 1XPUA 1EWIA 3IL8A 4NW2A 4MNOA 2M9VA 5AFWA 4IOAA 4IUNA 3LNNA 1QOHA 3S1QB 1GUGA 4TVAB 1I94L 2DNEA 4L5RC 4DNTB 5C0XG 4JG2A 1EY7A 1I50H 1QZGA 1UEAB 2M2LA 2WB1E 1XTCD 2K14A 4C3IG 2GA4B 4R9WA 2JA6H 2V4DA 2RA4A 1H9RA 2NVYB 3V05A 1O7IA 1C4QA 4O0AA 3DUZA 3HFZB 2F4VL 4B08A 1B53A 1QB5D 5K5PA 1D5ZC 4DUZQ 1WD0A 5KGUA 4P2CB 1FYCA 3EQLC 2YTYA 4P74A 5IT9E 1I4GA 3HEJA 4R8IA 3SEBA 3GTMB 4FF1A 4XT1B 3LGJA 1GUSA 2HHHQ 1AN8A 4PQXA 1SMYC 1XXGA 4OX9L 1NCVA 5KYIA 2JA5B 4DV1L 1B9MA 4IUTA 4C3JG 4LFCL 5HGQA 1RD9D 1I4HA 4E6IA 2HUGA 5A2QE 2PI2A 4IPHA 2CW0C 3C46A 4CDDC 4UY8C 3H0GG 1JJCB 1PYSB 1XWEA 4A3MH 4UPAA 1HTPA 1SYGA 3NENA 1YI2A 4PMCA 2JEAI 1R9TB 2HCCA 3URYA 2CQOA 1W6KA 4P71A 2A6EC 4HTHA 5FJ8H 3WOFA 3F8TA 3M4OB 1HUNA 1AEXA 4A3BH 4WRDA 2KCCA 3GV3A 2PYKA 4F87A 4OO1H 1TWGH 4HCSA 1FNWA 2PMZB 1DOLA 4HJ7A 1JR0D 2PO4A 3CPFA 2H5XA 2G5DA 2V1CC 5IGDA 3AU7A 4Q0FA 2F0SA 4FNFA 4IN3A 3T13A 5C6AA 3I8ZA 2MFIA 3BJUA 2RCNA 1VMPA 3UDGA 2OQKA 4K0KQ 2IY5B 1EOTA 1TKWB 1YJWA 2QW7A 3OSOA 2I5MX 4HMIA 1BDOA 4K5WA 2JA9A 4BY1G 4C3HB 1MJEA 2E8GA 4PZ6A 3FRPB 1JWUD 5EBCA 5I9PA 3NHHA 5ISRA 4M8AA 1VQCA 1RCVD 2VUMH 5J3BA 1CFMA 2UXCL 4DAVA 4DR7L 3H15A 4OEMB 1KRSA 1H9MA 5T1IA 4BY7H 2AQ2B 1XTDA 3BZDB 4X3SA 4ODGA 4MTNA 4JI5Q 1M8AA 5I4DA 5KIXA 1A8VA 3GTLB 3CQZB 3DWPA 5IGGA 1X65A 1ZYRC 3MEFA 2EY6A 5GAEC 2LKVA 3DLLA 2A6HC 3CCMA 1TWCH 2VQFL 4KKTA 4QMGA 3AMUA 1SYDA 4HIDA 2PZWA 1FGUA 4DR6L 2RVLA 2NBFA 1VQOA 5C4XB 3GTQH 2A69D 4C3JB 1SJHD 1SNQA 1JQYD 1PYBA 2R92B 1U4RA 5COYA 1K0RA 3EROA 4YY3L 3K5LA 2OQ0A 3LWUA 4K5VA 1I4PA 3EVQA 3HOXH 4V0BA 5FO9B 3SE0A 1C9OA 1CZGA 1EQRA 2B8GA 2NYZD 3S9WA 5C4ZA 4DAMA 1J9OA 3FDTA 1I6VC 2K7VA 4TQUS 1U4LA 1LT4D 1EOVA 2F1MA 2ATWA 1VQ9A 4UAIA 4IUPA 1F2LA 5F2DA 1PH6A 2VQEQ 1VQFA 3MXUA 3PIO3 3KBGA 4B3TL 5IYDH 2K03A 3ITPA 3S17B 1JE4A 5C0XJ 3CXCA 4IFDI 2YTVA 5AJ3L 4IFDH 3HRZC 4HR7B 1UUPA 3FVQA 3S16B 2PW5A 3M4PA 1PH3A 4HN7A 3PF4A 3NSWA 4YCUA 1ILPA 2B2WA 2HD3A 2K01A 1HH2P 1YNJD 2PNHA 5J39A 2KCNA 5C3XA 2EYJA 1EYGA 4NKLA 1U5KA 2K05A 2RSOA 3LX0A 4QB4A 2ZM6L 1SYFA 2EQSA 2UUCQ 4XXEA 4X65L 2B63G 3KOJA 1B4OA 2NTTA 1K8GA 4RA8A 2UU9Q 2ASBA 4DK6C 4BBRG 5JPNC 3CMAA 4CHTB 1N36L 5DNFA 1O80A 1RKNA 2ZTEA 1NSNS 2EYFA 1JOQA 5JPMC 1KIXA 1STNA 1II3A 1KXLA 4MIUA 4NXMQ 4DV0L 3IFDA 3GTMH 4LFBQ 2WFWA 1KABA 4OXPA 3K0YA 4MHEA 1TU2B 1GHKA 1HNZL 2FXQA 1GOZA 1EY4A 1VQKA 1VQNA 3S2DB 4A3LH 1IW7D 2KJXA 1GHJA 2TMPA 4A3JH 1ASZA 2YU9H 2VXWA 1GUTA 2NVXH 2EIFA 3SGIA 1IKLA 1TWHH 3S1NB 2KQ3A 2WB1G 1SYEA 1HJPA 2BE5D 2F4IA 2ICEC 3C2PA 3HOUH 2F0LA 4GKKL 2K6AA 1NUCA 1R9TH 1Q1EA 4A93B 3S2HH 2R7DA 2RDFA 3I4MG 3E5SA 4M1UB 3KJOA 3VYSA 4DU9A 1JMCA 4B3ML 1EZ8A 1TWFB 3OHXC 1QNKA 3I3CA 2EYLA 3CCRA 2AMCB 4F88A 1J5EQ 4LF9L 1E24A 4CKEA 3KDFA 1KNAA 3J80E 4JI7L 1E3PA 4DR3Q 5JJIA 1DCZA 2F0NA 4DV7Q 2R7ZG 1PVOA 4JBWA 2PCFB 1XNQQ 5FKAC 3T56B 5IGBA 4HJ5A 3I4LA 1KAAA 1ET6A 1SJED 3RZDB 3MC0B 2O2LD 3MFYA 2I46A 1SE3A 2EXDA 3U58A 3HKSA 5KNBA 1N9WA 3SK8A 3BG3A 1GUNA 1BBUA 3K57A 1DONA 1JWSD 1MIUA 4FVMA 2UUBQ 5M5XH 4C3HH 1B70B 4JI4L 4JI0Q 3NPPA 2K5WA 4Y7NB 1QZHA 5FLXc 4JI3L 3T51B 4NPSA 5EKLA 2B2UA 3FMCA 4C1NK 4DGZA 2IL8A 3A55A 1E1TA 4Y52H 5JJZA 1ZXTA 3D31A 4YCWA 3D6CA 2XNAC 1QWYA 4X64Q 1EYCA 5IGFA 3FKIG 3CP0A 5EPJA 2N8NA 1MSHA 3C1EA 1YHBA 1HPCA 5IP9G 5IIFA 3GTLH 3X3MA 1LTTD 1FJGL 2PI2E 2K28A 2Z4HA 2M00A 3NXWA 1HUMA 4UP9A 4IPGA 4K8IA 4L8JA 3HG9A 3CD6A 1Q82C 3GTOH 4G7OC 3HP3A 4FF3A 4IUQA 1PH8A 2NTSA 2ZJQA 4C3JH 4JI2L 4LF4Q 1BUVT 2QGQA 4DR4Q 2Z9HA 3MZ5A 4ME3A 2HQEA 2D5DA 3WDNA 3TN2A 2EE1A 2F3VA 3H6MA 3H0GH 1CTMA 1LV9A 4LW1A 3L2PA 4UP7A 2DJGC 1GVPA 3PUXA 2VUMG 1S5BD 2D2CC 3SR1A 2K1BA 1UNSA 4J1MA 4BY7G 4AQYQ 4KK7A 1KC8C 2IW3A 2RCFA 4DUYQ 1GD7A 2K5HA 3I7FA 1SR3A 4DFAA 1S5ED 4CDCC 4X6AH 4FXKC 3F1ZA 3KUPA 2RDHA 3S17H 1XNRL 4QL5A 5C44B 3CC4A 1SE2A 2K4KA 1D1KA 3J81E 1O7YA 2XRQD 4ZUIA 3EIVA 2K75A 1F9PA 2CFMA 1GKHA 3M7NA 1Q46A 1VQEA 1NR4A 5KNDA 2JK8A 1PH7A 3HOVB 1O7LA 1D7QA 2X6LA 3R3OA 2WP8J 3PO2G 3N6RA 4JPBW 1YNNC 1CSPA 4NDXA 5D3DA 2F0UA 2OWOA 2E5LL 3KK7A 4CDFC 3ER0A 1S5DD 4HIOA 1STEA 4OWXB 4YHHL 5KEEA 4R4IA 1PH9A 2EYOA 1YHAA 3FHWA 2DY8A 4QF4A 3MA2B 4QJFA 2ZJRA 4P73A 4ZUJA 4A3EB 1A0IA 3BZCA 1WYDA 1W3SA 2MPMA 3VR5A 5CV4A 1MSGA 1SXTA 2IHFA 5IYDG 4K6LA 3CRLC 2KOLA 2SOBA 5J22A 3J7AV 2KHSA 2Q2IA 3Q24A 3E6ZX 2X6GA 4IFDG 3ULLA 1JE5A 1EY0A 4ZRZA 3S2DH 1VQMA 3RNUA 1AE2A 1FGBD 4U68A 5C3EB 2F4VQ 1B2TA 3M85A 3BVMA 2VL6A 4F7XA 3MXNB 4H13C 4PG3A 4JI1L 4N8FA 3L3OC 5M5YB 4FYDA 4PMWA 3NBHA 2A68D 5GADC 4OX9Q 2PZUA 5IP7G 4A93H 1WFQA 1LM0A 1QCBD 4LFCQ 2UXBL 1YZ6A 3MFGA 4FP5D 3IKJA 4DV2Q 3OMCA 4KLKA 3PIP3 2BOSA 4LNQA 4YWMA 5ELNA 1YVCA 3E9IA 1I3QH 1F2ZA 3C1FA 2EJFC 4LF8L 5A35A 1B3AA 3NWSA 3VA5A 2BA1A 5EPLA 1RODA 1UEBA 2KHIA 1VQ6A 5I6WA 3BVGA 4IUUA 5EKIA 1D1IA 2Q2TA 1H9SA 3DEPA 4TSSA 3EN2A 1TIID 2JA5G 1STAA 2K32A 1IYVA 1BCPD 4LWCA 1G6ZA 1OO9B 4GN5A 1LT3D 2H4OA 1VQ8A 1DXMA 3S1RB 3CCLA 3PMFA 3OIQA 3I4NB 1DJRD 1ICFB 4APVA 1Y1WB 1Q8IA 1TWAB 1VQ7A 4JK1C 3IFTA 3BU2A 4LFAL 4P75A 3TRZA 1S72A 4CBVA 2F0OA 1HZAA 4RKLA 1KDBA 1QJOA 4TRDA 2Q8TA 4BBRH 4CJ1B 3CRKC 3NBHB 2YTXA 1X3QA 1PTOD 5BN4A 1EWHA 4DR1L 3A8IE 2UXCQ 1I5FA 4DR7Q 1EU4A 4IPDA 1OXVA 2BDNA 2HDLA 1YEZA 5CV8A 3GQBA 3TBIB 5CMDA 1SE4A 4IURA 1LTID 4HSPA 4X3UA 4C3HG 4C2MB 1LLRD 3U9OA 2O5JC 1H9SB 3TMEA 2VQFQ 2LMCB 1CKNA 2KVMA 2MO1A 2UXDL 3D4RA 3K80C 1MD2D 1WTWA 4G57A 4YIJA 3J81L 4DR6Q 2IWHA 3I4MH 1PZID 3E9HA 2ALYB 4BBSB 1I4QA 1B1ZA 1D2BA 2LXJA 3HKZB 4AYBB 1DOMA 1SAPA 3NE5B 4EQPA 1PFSA 5IOCA 4YY3Q 4LF5L 5GAHC 4JYAL 5CBAE 2B3GA 4DPGA 5BR8L 2YYZA 2R7ZH 4LK1C 1LABA 2Y0SB 1AFPA 5JVG3 1TY2A 3SVMA 1KL9A 1CHPD 5HGTA 3RUZA 2O5IC 2AWNA 1KRTA 3NUCA 2GVBA 2F0DA 4GNXB 4L5QA 3MXGA 4RHSA 3CCUA 3T1HL 5C4XG 4L63B 2F0HA 2A8VA 2E2IH 4B3TQ 2R92G 1NNXA 4XTCS 3H3VC 2WAQB 2XN9C 4GNXC 1X56A 1B3QA 1SRUA 3OWEB 5AJ3Q 2E2JH 5IODA 4H02A 1XPOA 2EZVA 4K8JA 3W2DA 2XGTA 5TSSA 3DM3A 1KAWA 4IFDJ 3OYYA 3Q22A 5ELEA 2AHOB 1IYUA 1JB3A 1QVFA 1BNZA 1U0LA 1RL2A 2WACA 3FKIH 1RTOA 1Y8OB 5CBEE 2G9DA 2ZM6Q 1SDFA 1CKNB 5IP9H 4X65Q 1X3FA 1WVLA 1WTPA 2TSSA 1X3EA 1EY5A 2XSCA 2RDGA 3M3YB 1MGSA 2DJFC 5IYCH 2RQXA 1N36Q 1DM0B 3A56A 3AQQA 1QILA 2K5DA 5DEHA 1EYDA 4KY7A 1A3VA 1Q3LA 1OXSC 1K0SA 1ZEQX 3EA6A 2ZTCA 4DV0Q 4BA2I 3F2UA 5M5YH 3T1YL 4G7HC 1L2FA 4A3IB 1SBBB 2NVTB 1HNZQ 1WD1A 1H95A 1MKHA 1HNXL 4IZ8A 1B7YB 4A3FB 3PO3B 3DWAA 1H9JA 3WOEA 2I0QA 1G8ZD 1X54A 1DGSA 3D3RA 1T5EA 4UDUC 1HXYD 4NXNL 5FO8B 5J1ZA 1VQ5A 3CAMA 2L9HA 2K04A 4I65A 3J80i 1K3BC 2B2TA 4GKKQ 3M4YA 3ND9A 5G3LD 1Q90A 2NVQB 5M5WB 1JB7A 4B3MQ 1CM9A 2IX1A 2R93B 1B50A 4HMJA 4JOIA 1V8QA 2A69C 2IT1A 4CDEC 1PXUA 3H09A 3KFUA 1UE5A 1SFOB 3A7LA 4LJZC 3KF8A 1Z9FA 3DWQA 1VQJA 2MJ8A 3I4NH 4DR5L 4JI6L 2F0MA 2K50A 3AFQA 3VR4A 1TWAH 2VY3A 5D14A 1BR9A 3T4AC 2CHBD 2UUAQ 3VYTA 3PO2H 1Y8PB 1G6PA 2JA7B 4A93G 4HJ9A 5BN5A 2VB2X 3VA7A 2ENBA 3QOLA 4J8QA 1SMXA 1LTSD 3VR3A 4JI4Q 3KYHC 4A4IA 1H9KA 3KLWA 2CH4A 3PQIA 3JAME 3A8JE 3PUWA 4DK1A 3OTOL 4JI3Q 1JT8A 5FLXE 2RHQB 3CC2A 4KV6A 2C5CA 4DK3C 5EBDA 1Z6HA 1L0XB 4R4OA 3K8AA 3RZOB 2JEBI 3GTGB 4L5SA 2PQAA 3KBXA 2E74C 1SNCA 1DZ1A 4RGMA 1QG7A 4BXXH 1AZPA 2CVRA 1LTAD 3F2BA 2HT1A 4LF6L 5IT9c 1YNJC 1E2ZA 4RMFA 1K28A 3PF5A 1Y1VB 5FO7B 4A3GB 1FJGQ 3CCEA 4DV6L 2BH8A 1FNUA 3A5ZB 5ELFA 4WJ4A 1TS5A 3S1QH 3TZDA 2XIWA 1PV4A 1ONLA 3PGZA 5K36H 5IP7H 3VDYA 2B2TC 1S40A 4JI2Q 2D62A 4QCLA 3KF8B 5IGEA 2EJMA 2C35B 4JOIC 2B29A 2WKDA 5GROA 3CF5A 2NVYH 2SDFA 4DN4M 1HHVA 1UAPA 3H3VI 2QDLA 1IW7C 2F0FA 2N3SA 1LO5D 1TXYA 3RN2A 3L0OA 3J81i 1ASYA 1TT2A 2JA5H 2R6GA 1XMQL 4YCVA 1RTNA 2L4NA 3NP8A 2BE5C 4JBKA 3S14B 1CQFA 3I4OA 4DNRB 4KHZA 1NE3A 4JVZA 1XNRQ 5IYBG 3ICEA 1PH1A 4O1NA 1JOOA 2O4XA 1R4QB 2PQAB 3N52A 2R3ZA 2F52A 1X3GA 1G291 3A54A 1WTOA 4V190 3DXJC 4J15A 3HOWB 1V1OA 3K5NA 3FPPA 4O2DA 2WAQE 4KTAA 2AUJD 2VB3X 4LUZA 3GTKB 3M4OH 1A15A 4R4QA 1T9HA 4ZLTF 3Q8DA 4KMUC 3GD7A 3U50C 2E5LQ 2JJQA 3CU7A 3STBD 5DAUA 3OW7A 1D6EC 1ML0D 1S5CD 5C44G 4ZKBB 4AH6A 1X9NA 3M3YH 2DGYA 2MGSA 1C8CA 1JORA 1NBWA 4OL7A 4WJWA 4X66L 4DV5L 1AE3A 5LL6X 2PMZE 1TR5A 3HOVG 1A3UA 1GXDC 2RBMA 3QIAA 2MUYA 1A3TA 3D8GA 4OIJA 3W1GA 4A3FH 1FNVA 2F0IA 1M4VA 1FD7D 4ID6A 1PHJA 3G4SA 1LTBD 4XIGS 2JE6I 1EEFD 4U673 4A3EG 4JI1Q 4A3KB 1PRTD 1HNWL 4RCOA 1VF7A 1DOKA 2ZXOA 3D6WA 4AIMA 3J7YW 1S5FD 4RCNA 1LTGD 2UXBQ 1WCMB 5E4XA 3CQZH 1VQ4A 3HOYB 3I73A 1BQQT 2NN6I 2LSSA 3A0JA 1SFOH 3AEVA 3E0JA 1PYWD 2XWBB 5IYCG 1YNXA 3BS1A 5C3EG 3ONAB 3ULJA 2QKIC 4LF8Q 1YHQA 1QE6A 4PMBA 5C4XH 3JAML 1CA6A 2BH2A 4A3DB 3S1MB 4BWGB 5FLXL 5M3FB 2R92H 2PW7A 3QG1A 2B2YA 1IBMQ 4WJ3M 4LF7L 1U4MA 4XYQA 3PIOA 5EGTA 2KHJA 2L0CA 3OOCA 1ET9A 5ELBA 1TS2A 5M3MB 3WWVA 3PCOB 3K7UC 2MNAA 3OW2A 1Q7YC 4H7BA 1F9RA 1IBKL 2QEXA 2QCPX 3L9AX 1E7ZA 3SK6A 1Y14B 3UDIA 4ZYSA 4FO2A 4Q5VA 5E4WC 4LFAQ 4JBJA 2MQHA 2L12A 5IE8A 3K7AB 4OELB 3MXNA 4DK0A 3D0FA 4B3RL 2F0WA 3NTHA 2L11A 3P1HA 4NXML 3S16H 2Q2HA 1ENAA 3PV0A 3RN5A 4JC0A 4K5XA 2F0KA 1L0YB 2AWOA 1FVIA 2ZTDA 2MO0A 1MHWC 3I70A 4IO9A 3I4NG 2JA6B 3TDQA 5JVH3 4DR1Q 1Y1WG 2SNMA 3EFXD 1JJGA 4QQBX 4Z9CB 2X69A 4ABNA 1IBLL 2B8FA 2FMMA 4GKJL 2C9OA 4KKUA 4G4KA 1X55A 1CA5A 3GP7A 1QVCA 2AKWB 3ERSX 4IUVA 1VQBA 4GLXA 1EFID 3IAYA 4RGTA 4DV3L 1KTKA 1PA6A 2WINB 5LMUL 5IGCA 2F0QA 3ZYYX 2UXDQ 1JICA 1S4ZA 1E2VA 3AB9A 1F9SA 2L55A 3X3NA 3I72A 1PFBA 1YIJA 3G6EA 1I94Q 3J80c 4DR3L 5HURA 4OWWB 2Q8IB 4BXXG 1C0AA 4A3MB 2B2YC 3TREA 2D0PA 2E2DC 2FFKB 2ZJPA 4KHPL 3RLOA 1PZKD 1YNND 4X3KA 4XQJA 4LF5Q 4JYAQ 3S14H 1PFMA 2A68C 4CJ0B 5BR8Q 1PMRA 3H91A 3TQYA 4IJHA 1A63A 2VNUD 3M9BA 3OPOA 1EFWA 1KD1C 4NP5A 1SYCA 3S1NH 2PPBC 1BVSA 4A3BB 1BXTA 1L0WA 1QUQA 1CT1D 1K73C 4PV1C 3S24A 2ICIA 3BYTB 3HOWH 5K36G 1SYBA 1B8AA 3K58A 4DV1Q 3T1HQ 1BCPB 5FK9C 1EQVA 1TWFH 4BBSG 4DV4L 4RHRA 3GTKH 3NQIA 2FHTA 3HKZG 4AYBG 2ES2A 4I7ZC 3VR2A 4PZ8A 1F2YA 4ALPA 1ICWA 4X64L 1AZQA 1BCPC 1VF5C 2Y0SG 2HCIA 1HZ9A 3U4ZA 3MEHA 1V9PA 5T1GA 2R61A 5L37A 3UE0A 2R7FA 4GOPB 3RZDH 3P75A 5NUCA 5BN3A 4CKCA 3PUVA 2DNCA 5LMNL 1CZWA 2HQLA 4UP8A 1NJIC 1OXTA 4DF7A 4GOPC 1SNMA 4LMQD 2WAQG 1BKBA 4Y7NH 1U9RA 2Z1CA 4B3SL 1PTOB 1CK1A 3KLSX 3TEHB 3M7GA 1EQTA 5EAYA 4G7ZC 2CCZA 4GLVB 5CC4A 2CWPA 3L7ZC 4A3KH 4A3CG 2NB0A 3M4QA 5IWAL 3T1YQ 4GNXA 1PTOC 3UDXA 2JA8B 2VS1A 2ZXPA 3FP9A 2EY1A 1QUQB 1PH5A 3CC7A 2JN4A 1JWMD 4CKBA 3RLFA 5EJWA 3JC66 1AP0A 4N9TA 4NXNQ 3W1BA 2QA4A 4NB3A 2D9UA 1YBYA 1PFNA 4HIKA 3SK4A 3HOXB 3S1MH 3HOZB 5M3FH 1D8LA 4EQNA 3DM1A 3FPUB 2EYHA 1K3RA 2E76C 4A3IG 5IYBH 1GJXA 4P72A 1VCIA 2OCEA 1EWCA 2WV6D 1G51A 4O42A 4A3FG 3PO3G 5CR3A 3QR8A 2N49A 1EIFA 4DAYB 1Q81C 3E0EA 2F0PA 1LTRD 4KD3A 4DXGA 4DR5Q 4JI6Q 3G6JB 1NR2A 1O7ZA 4WORA 1TS3A 4KD4A 5EQ0A 3JAMi 3A5UA 3KJPA 1GM5A 1L1OB 1TS4A 5I9OA 4YWLA 3K7AH 1KDAA 3SHLA 2GVAA 1IL2A 5IY0A 1W2BA 1EY9A 2KCMA 2GN5A 2R93G 2KEEA 3KLRA 2F3IA 1N33L 2F0JA 3O13A 3BZKA 5C44H 3TS0A 3J7ZC 2NN6G 2ZT9C 2EYMA 2J4XA 5CV9A 1L1OC 1WOCA 4XT3B 4JI8L 3SXHA 4RG1A 4KY5A 3I90A 3OTOQ 2F0EA 1XX8A 1N8RC 1N34L 3K5OA 2F0VA 4J6HA 1GUOA 4KN4C 2AQ3B 3CMEA 1Q8KA 4R8NA 3HOVH 1N32L 3D4DA 1CUKA 3G48A 4KHVA 4HJ8A 3R2TA 3DEOA 2OTLA 2OXPA 2JA7G 1YJ9A 4LF6Q 1DD2A 4DR2L 3PUYA 3D4WA 2A5HA 4H44C 3NBIA 3U9SA 3VYUA 1VS0A 5JEAH 3ND8A 5E7NA 1IKMA 1I6HB 1XPRA 2NZHA 5C4HA 4DV6Q 2EDGA 5JOBA 4A3EH 3P7JA 2LY7A 1C48A 4DV2L 4DA2A 4A3JB 2RKSA 2YU9B 1X6OA 2NVXB 2E2HB 1SMYD 1HQRD 1K8MA 1EIHA 1I4XA 1TWHB 1HR0L 1WTHA 1STYA 1V1QA 1Z7TA 1VQHA 3HOUB 3R93A 1IYJB 4GS3A 4R4TA 2CW0D 5CV6A 3S2HB 1Y1VG 2N55A 3PIPA 1STHA 1BCPF 5C3EH 2DUDA 4A3GG 1LT5D 2K5QA 2OEOA 4ILWA 5KNCA 1A2TA 2F0GA 4ZCKA 3S15B 2OT2A 4OO1I 4KN7C 4X62L 2KUMA 2Q2UA 5EKKA 4C56C 2EXZA 2I5HA 1ENCA 1XMQQ 2A6ED 3A7AB 1A2UA 4ULLA 1J6QA 1OXXK 3J7AF 5DM73 1R4PB 2N88A 1EYAA 1NAPA 3TSSA 5M5XB 3QOJA 1SLJA 2WKCA 1XMOL 1EZ6A 5C5MA 3U4VA 2HIVA 4FXGC 1PTOF 3CKIB 3EBEA 4JW0A 4LF9Q 2AQ1B 1K9MC 1FR3A 4JV5L 1HCZA 2D0OA 2EJGC 3LWEA 4CGYB 5C4JB 1KQSA 2Z6BA 4JI7Q 2J0TD 3S1RH 4C1NI 4QY7A 4B9WA 4PZ7A 3I91A 4C3IB 1KLUD 1Y1WH 1PTOH 1VQDA 1ESRA 5GQOA 5JJKA 1CI3M 1TVXA 3HOWG 3MVVA 1PLFA 4KI0A 4X66Q 4JBMA 1YJNA 4DV5Q 1EIGA 2KA7A 1BF4A 5KRUA 1RDPD 2JYOA 2IJ0A 3PUZA 3V2TA 5CORA 2JA8H 4DXFA 2A74C 1BBXC 1IL8A 3GTOB 1ZYRD 2XRSD 4F8MA 4L6TB 2KBNA 2A6HD 2B39A 2FMCA 1E22A 4KJNA 3P20A 1IHZA 4A76A 1P16A 2L1BA 1P8LA 1RHPA 3H0GB 1WTXA 3DHQA 1HNWQ 1EY8A 4DUZL 2ZXRA 5E3FA 5FLMG 4CJ2C 2NUCA 1XYIA 3NQTA 3HOZH 2P5ZX 5I6YA 3W3AA 4OGQC 2HHHL 1STBA 1UWVA 4C2MH 1EEID 5FOBB 2DN8A 4IQZA 4K14A 2A19A 4JCVE 5JAVA 1G2SA 1F9QA 4S3SA 3Q23A 2EPBA 1AH9A 4A3KG 4LUVA 2MP1A 1Q86C 4BBSH 3BDCA 3NK9A 1KNEA 4LF7Q 4HAEA 4FXDA 3E3XA 2RF4A 3AFPA 1TQOA 1WCMG 4KJOA 1K83B 3HOYG 4B9XA 3F2CA 3K6OA 4IJLA 2K5NA 4K2KA 2RSNA 2SEBD 4I7AA 2IPKD 3VR6A 1C7YA 4BY1B 2MHVA 5IT9L 3HKZE 4ZK9B 3H3VH 4AYBE 4OWTB 2IX0A 1IBKQ 1G91A 3HGBA 3BDOA 4XYOA 3SK5A 2Y0SE 4A3DG 3QO2A 5M3FG 1HA6A 5A2QL 4LAAA 1K8AC 4ZQ3A 4B3RQ 1BOSA 2HDMA 4K0KL 1J8IA 3OMGA 5M3MG 1HTLD 2VZAA 1W6JA 3K81C 1I6HH 1UE6A 4BA1I 3STBC 2OTJA 1XJVA 2IX3A 4A3CH 3TP6A 3CW2C 1SNDA 1IBLQ 3I2ZA 3K0XA 1D5MC 4GKJQ 3GTJB 5CV7A 2E2HH 3T16A 2AUKA 1VQIA 5LMNW 4QIWB 4YHHQ 4KKSA 3F2DA 5G3LF 3R2IA 4DV3Q 1NY4A 4IOCA 4JI5L 2EOTA 1SE8A 1MBYA 5LMUQ 1G2TA 5JJLA 2KCTA 3TP7A 3G71A 1PH2A 1CHQD 1PRTB 5DLQE 3UE1A 2YV5A 2JA6G 3CCQA 2LXKA 1I3QB 3S15H 4ME5A 4KY6A 5I2YA 3K5MA 4A3IH 3BYYB 2NVTH 2PZTA 1YITA 2QF7A 4BS9A 2J7ZA 1MJCA 1O78A 2FINB 1OXUA 1VMCA 4EVOA 1PRTC 3GV6A 2PQEA 4KHPQ 1HFNA 2EVBA 4EQ5A 3PO3H 2B2WC 2UUAL 2G9HD 3KF6A 3NELA 5JEAG 1TY0A 1B44D 2VW9A 4OIKA 1SNOA 3W5OA 1A62A 3H94A 4OONA 4DAPA 1DYQA 3GO5A 1T5XD 3SDZA 1NTGA 3V96A 3BDLA 3PSIA 3IRBA 4R1JA 1EL0A 1STGA 4H0LC 5DM63 3JAMc 4R4CA 1FL0A 5M5WH 2BCOA 2NVQH 2R93H 3RD4A 4DV4Q 1EY6A 4A3MG 3CHBD 5C0XI 2NN6H 2F0TA 5C4JH 4GN3B 5C0XH 4HCEA 2VQEL 2B63B 1WTQA 5D65A 1B9NA 2IHEA 4RKBA 4C3IH 1JC7A 5FJ8G 2A73B 1V1PA 5KYLA 3QJYA 4OHJA 4A3BG 2H1EA 4BBRB 4IPCA 3TP8A 4OO1G 2K52A 1EU3A 4XDXA 2JA7H 1A6XA 1K8OA 4RGNA 5LMNQ 4K2LA 4ZAIA 2XTIA 1Q12A 1EUJA 2UUCL 2KECA 2K5VA 3AYHB 3KDFB 1WTRA 2E75C 2JXMB 3GTPB 4DNIA 3MXPA 4K6DA 4HEDA 5HY6A 4B3SQ 2Z8LA 4FF2A 2HIXA 2UU9L 2B2VA 3RZOH 1QVGA 3G7LA 3GTGH 3CCVA 1HFGA 1SN8A 2WB1B 1E1OA 3KF6B 1X32A 3CCSA 5IWAQ 4L5TA 2EYPA 4RFBA 5M9OA 1M90C 2ID0A 1EQQA 1Z47A 1CKOA 4LFBL 4HSVA 3HS0C 1I50B 1Y1VH 4A75A 3I4MB 1RF2D 4DKAC 2XVSA 1ILQA 4A3GH 4TKOB 4N9PA 1KDCA 3NTIA 1HA5A 3K59A 2LS01 2R7ZB 3I56A 2CWAA 2Q8RE 4QUCA 2XWJB 3MAQA 4N8X1 5D3IB 2NZOA 4LUOA 3OIPA 3TZUA 4GOPA 3TS2A 4WFN3 2CH4W 4RAUC
chains in the Genus database with same CATH topology
1CQVA 3VYRA 2B2UC 1V1PB 1JOKA 4XQQA 1HRJA 1U4PA 2OF1A 3HZXA 2E2IB 1D5XC 4ZKCB 2CQAA 4X3TA 2E2JB 2SNSA 5CYUA 5CV5A 2F3WA 4QUFA 1LACA 1LT6D 3FEWX 4PNYA 4XQNA 3TP5A 2BA0A 3FKIB 2PNRC 3OWFA 1MI2A 5LHY1 2JP1A 1RJTA 1PZJD 1HQMC 1TWGB 2QILA 2LFNA 2B2VC 1X3PA 3QB3A 4EGVA 3NTKA 4RWSC 1SNPA 1PRTF 1AW7A 3J80L 1E2WA 3C3LA 2NWGA 4GZYC 5JEAJ 3EJIA 2L5TA 3KLSA 1KLGD 4DAYA 1F77A 3NWTA 2VUMB 1QNUA 1GUWA 5EPKA 1ESFA 4BY7B 1JCKB 1WTVA 1BO0A 2F03A 1SSOA 5C3WA 1I4RA 1Q1BA 1VDZA 1TWCB 5C5LA 2KEDA 3Q6SA 4FF4A 3A8KE 2QDBA 4RGOS 2I07B 4RH6A 2K33A 2QEJC 4EQOA 2Z4IA 5E1FA 3MTSA 3GTQB 1V43A 1ENFA 4NMZA 5LL6S 3R8BA 1Y8NB 3PO2B 2DY7A 3RMHA 4IALA 2NZ1D 3MWYW 2JSOA 5ELDA 2BDOA 2EY5A 3BVZA 1E0BA 5I2XA 4MN3A 1ZKOA 1SEBD 3QWNA 3UI2A 3ERQA 1PDQA 3DMUA 5ELCA 2WIIB 3T53B 3MHBA 1Y69U 2EY2A 3Q0AA 1F2MA 5CGKA 2FJ2A 3IL8A 4NW2A 2M9VA 5AFWA 4IUNA 3LNNA 1QOHA 3S1QB 1GUGA 2DNEA 4DNTB 5C0XG 1EY7A 1UEAB 2M2LA 1XTCD 4C3IG 2GA4B 4R9WA 2V4DA 2RA4A 1H9RA 2NVYB 3V05A 1C4QA 3DUZA 4B08A 1B53A 1QB5D 5K5PA 1D5ZC 1WD0A 5KGUA 4P2CB 1FYCA 3EQLC 5IT9E 1I4GA 3HEJA 4R8IA 3SEBA 3GTMB 4FF1A 4XT1B 1GUSA 1AN8A 4PQXA 1SMYC 1XXGA 1NCVA 5KYIA 2JA5B 1B9MA 4IUTA 4C3JG 1RD9D 1I4HA 4E6IA 2HUGA 5A2QE 2CW0C 3C46A 1XWEA 1HTPA 1SYGA 2JEAI 4PMCA 1R9TB 2HCCA 3URYA 1W6KA 2A6EC 4HTHA 1HUNA 3WOFA 3M4OB 1AEXA 4WRDA 2KCCA 3GV3A 2PYKA 4F87A 4OO1H 4HCSA 1FNWA 2PMZB 1DOLA 1JR0D 2PO4A 5IGDA 3AU7A 4Q0FA 2F0SA 4FNFA 4IN3A 3T13A 5C6AA 3I8ZA 1VMPA 1EOTA 1TKWB 3OSOA 4HMIA 4K5WA 1BDOA 4C3HB 3FRPB 1JWUD 5EBCA 5I9PA 3NHHA 5ISRA 4M8AA 1RCVD 1CFMA 4DAVA 1H9MA 5T1IA 2AQ2B 3BZDB 4X3SA 4ODGA 1M8AA 5I4DA 5KIXA 3GTLB 3CQZB 3DWPA 5IGGA 1ZYRC 2EY6A 2LKVA 2A6HC 4KKTA 4QMGA 3AMUA 1SYDA 2PZWA 2RVLA 2NBFA 5C4XB 2A69D 4C3JB 1SJHD 1SNQA 1JQYD 2R92B 1U4RA 5COYA 3K5LA 3EROA 3LWUA 4K5VA 1I4PA 3EVQA 4V0BA 5FO9B 3SE0A 1CZGA 2NYZD 2B8GA 3S9WA 5C4ZA 1J9OA 3FDTA 1I6VC 2K7VA 4TQUS 1U4LA 1LT4D 2F1MA 4UAIA 4IUPA 1F2LA 5F2DA 3MXUA 3PIO3 3KBGA 2K03A 3ITPA 3S17B 1JE4A 5C0XJ 4IFDI 4IFDH 3HRZC 4HR7B 1UUPA 3FVQA 3S16B 2PW5A 4HN7A 3NSWA 1ILPA 2B2WA 2K01A 1YNJD 5J39A 2KCNA 5C3XA 2EYJA 4NKLA 2K05A 2RSOA 3LX0A 4QB4A 1SYFA 4XXEA 1B4OA 2NTTA 4RA8A 5JPNC 4CHTB 5DNFA 1O80A 1RKNA 1NSNS 2EYFA 1JOQA 5JPMC 1STNA 1II3A 4MIUA 3IFDA 1KABA 3K0YA 4MHEA 1TU2B 1GHKA 1GOZA 1EY4A 3S2DB 1IW7D 2KJXA 1GHJA 2TMPA 2VXWA 1GUTA 1IKLA 3S1NB 2KQ3A 1SYEA 2BE5D 2F4IA 2ICEC 3C2PA 2F0LA 2K6AA 1NUCA 1Q1EA 4A93B 2RDFA 3E5SA 4M1UB 3VYSA 4DU9A 1EZ8A 1TWFB 3OHXC 1QNKA 3I3CA 2EYLA 4F88A 4CKEA 1KNAA 3J80E 1DCZA 2F0NA 4JBWA 2PCFB 5FKAC 3T56B 5IGBA 3I4LA 1KAAA 1ET6A 1SJED 3RZDB 3MC0B 2O2LD 3MFYA 2I46A 1SE3A 5KNBA 3SK8A 3BG3A 1GUNA 3K57A 1DONA 1JWSD 4FVMA 3NPPA 2K5WA 4Y7NB 3T51B 5EKLA 2B2UA 3FMCA 4C1NK 4DGZA 2IL8A 3A55A 5JJZA 1ZXTA 3D31A 3D6CA 2XNAC 1QWYA 1EYCA 5IGFA 5EPJA 1MSHA 3C1EA 1HPCA 5IIFA 3X3MA 1LTTD 2K28A 2Z4HA 2M00A 3NXWA 1HUMA 4K8IA 4L8JA 3HG9A 4G7OC 3HP3A 4FF3A 4IUQA 2NTSA 1BUVT 3MZ5A 2HQEA 2D5DA 3WDNA 3TN2A 2EE1A 2F3VA 3H6MA 1CTMA 1LV9A 3PUXA 1S5BD 2D2CC 3SR1A 2K1BA 1UNSA 4J1MA 4KK7A 2IW3A 4DFAA 1S5ED 4FXKC 3KUPA 2RDHA 5C44B 1SE2A 1D1KA 3J81E 1O7YA 2XRQD 4ZUIA 1F9PA 3M7NA 1NR4A 5KNDA 3HOVB 1O7LA 2X6LA 3R3OA 2WP8J 3N6RA 1YNNC 4NDXA 5D3DA 2F0UA 3KK7A 1S5DD 1STEA 5KEEA 2EYOA 2DY8A 4QF4A 3MA2B 4ZUJA 4A3EB 2MPMA 3VR5A 5CV4A 1MSGA 1SXTA 4K6LA 3CRLC 2KOLA 2SOBA 5J22A 3J7AV 2KHSA 3Q24A 3E6ZX 2X6GA 4IFDG 1EY0A 4ZRZA 1FGBD 4U68A 5C3EB 1B2TA 3M85A 3BVMA 4F7XA 4H13C 3L3OC 5M5YB 4FYDA 4PMWA 3NBHA 2A68D 2PZUA 1QCBD 3MFGA 4FP5D 3IKJA 3OMCA 3PIP3 2BOSA 1F2ZA 3C1FA 2EJFC 5A35A 1B3AA 3NWSA 3VA5A 2BA1A 5EPLA 1RODA 5I6WA 3BVGA 4IUUA 5EKIA 1D1IA 1H9SA 3DEPA 4TSSA 1TIID 1STAA 2K32A 1IYVA 1BCPD 1G6ZA 1OO9B 1LT3D 2H4OA 1DXMA 3S1RB 3PMFA 3OIQA 3I4NB 1DJRD 1Y1WB 1Q8IA 1TWAB 4JK1C 3IFTA 4CBVA 2F0OA 4RKLA 1KDBA 1QJOA 4TRDA 2Q8TA 4CJ1B 3CRKC 1X3QA 1PTOD 5BN4A 1EWHA 3A8IE 1EU4A 1OXVA 2BDNA 2HDLA 5CV8A 3GQBA 3TBIB 5CMDA 1SE4A 4IURA 1LTID 4HSPA 4X3UA 4C3HG 4C2MB 1LLRD 3U9OA 2O5JC 1H9SB 3TMEA 2LMCB 2KVMA 3D4RA 1MD2D 1WTWA 4G57A 4YIJA 3J81L 2IWHA 1PZID 4BBSB 1I4QA 1B1ZA 1D2BA 3HKZB 4AYBB 1DOMA 1SAPA 3NE5B 4EQPA 5IOCA 5CBAE 2YYZA 4LK1C 1LABA 2Y0SB 1AFPA 5JVG3 1TY2A 3SVMA 1CHPD 5HGTA 3RUZA 2O5IC 2AWNA 3NUCA 2F0DA 3MXGA 4RHSA 4L63B 2F0HA 4XTCS 3H3VC 2WAQB 2XN9C 3OWEB 5IODA 2EZVA 4K8JA 3W2DA 5TSSA 4IFDJ 3Q22A 5ELEA 1IYUA 1JB3A 1BNZA 2WACA 1RTOA 1Y8OB 5CBEE 2G9DA 1SDFA 1WVLA 1WTPA 2TSSA 1EY5A 2XSCA 2RDGA 3M3YB 1MGSA 2RQXA 1DM0B 3A56A 1QILA 2K5DA 5DEHA 1EYDA 4KY7A 1A3VA 1Q3LA 1OXSC 1ZEQX 3EA6A 4BA2I 3F2UA 4G7HC 4A3IB 1SBBB 2NVTB 1WD1A 4IZ8A 4A3FB 3PO3B 3DWAA 1H9JA 3WOEA 1G8ZD 3D3RA 1T5EA 4UDUC 1HXYD 5FO8B 5J1ZA 2L9HA 2K04A 4I65A 2B2TA 3M4YA 3ND9A 5G3LD 1Q90A 2NVQB 5M5WB 2IX1A 1CM9A 2R93B 1B50A 4HMJA 1V8QA 2A69C 2IT1A 1PXUA 3H09A 1SFOB 3A7LA 4LJZC 3KF8A 3DWQA 2MJ8A 2F0MA 3VR4A 5D14A 1BR9A 3T4AC 2CHBD 3VYTA 1Y8PB 2JA7B 5BN5A 2VB2X 3VA7A 2ENBA 3QOLA 4J8QA 1LTSD 3VR3A 1H9KA 3JAME 3A8JE 3PUWA 4DK1A 5FLXE 4KV6A 2C5CA 5EBDA 1Z6HA 1L0XB 3RZOB 2JEBI 3GTGB 3KBXA 2E74C 1SNCA 1DZ1A 4RGMA 1QG7A 1AZPA 2CVRA 1LTAD 1YNJC 1E2ZA 1Y1VB 5FO7B 4A3GB 1FNUA 5ELFA 1TS5A 3TZDA 2XIWA 1ONLA 5K36H 2B2TC 4QCLA 2D62A 5IGEA 2EJMA 2WKDA 2SDFA 4DN4M 1HHVA 1UAPA 1IW7C 2F0FA 1LO5D 1TT2A 2R6GA 1RTNA 2L4NA 3NP8A 2BE5C 3S14B 1CQFA 4DNRB 4KHZA 4O1NA 1JOOA 2O4XA 1R4QB 3N52A 2R3ZA 3A54A 1G291 4V190 1WTOA 3DXJC 3HOWB 1V1OA 3K5NA 3FPPA 4KTAA 2AUJD 2VB3X 3GTKB 1A15A 4ZLTF 4KMUC 3GD7A 3CU7A 5DAUA 3OW7A 1D6EC 1ML0D 1S5CD 4ZKBB 2MGSA 1C8CA 1JORA 4OL7A 4WJWA 5LL6X 1TR5A 1A3UA 1GXDC 2RBMA 2MUYA 1A3TA 3D8GA 3QIAA 4OIJA 1FNVA 2F0IA 1M4VA 1FD7D 4ID6A 1LTBD 4XIGS 2JE6I 1EEFD 4U673 4A3KB 1PRTD 4RCOA 1VF7A 1DOKA 2ZXOA 3D6WA 3J7YW 1S5FD 4RCNA 1LTGD 1WCMB 5E4XA 3HOYB 3I73A 1BQQT 2NN6I 3E0JA 1PYWD 2XWBB 3BS1A 3ONAB 2QKIC 1QE6A 4PMBA 3JAML 1CA6A 4A3DB 3S1MB 4BWGB 5FLXL 5M3FB 2PW7A 3QG1A 2B2YA 1U4MA 4XYQA 5EGTA 2L0CA 3OOCA 1ET9A 5ELBA 1TS2A 5M3MB 4H7BA 1F9RA 2QCPX 3L9AX 3SK6A 4ZYSA 4FO2A 4Q5VA 5E4WC 2L12A 3K7AB 3MXNA 4DK0A 2F0WA 3NTHA 2L11A 3P1HA 1ENAA 3PV0A 4K5XA 2F0KA 1L0YB 2AWOA 3I70A 2JA6B 3TDQA 5JVH3 2SNMA 3EFXD 4Z9CB 2X69A 4ABNA 2B8FA 2FMMA 2C9OA 4KKUA 4G4KA 1CA5A 3GP7A 4IUVA 1EFID 3IAYA 4RGTA 1KTKA 2WINB 5IGCA 2F0QA 3ZYYX 1JICA 1S4ZA 1E2VA 3AB9A 1F9SA 2L55A 3X3NA 3I72A 1PFBA 5HURA 2Q8IB 4A3MB 2B2YC 2E2DC 2FFKB 1PZKD 1YNND 4X3KA 4XQJA 1PFMA 2A68C 4CJ0B 1PMRA 3H91A 2VNUD 3OPOA 4NP5A 1SYCA 2PPBC 4A3BB 1BXTA 1CT1D 4PV1C 2ICIA 3BYTB 5K36G 1SYBA 3K58A 1BCPB 5FK9C 1EQVA 4RHRA 3NQIA 2FHTA 4I7ZC 3VR2A 1F2YA 1ICWA 1AZQA 1BCPC 1VF5C 2HCIA 3MEHA 5T1GA 2R61A 3P75A 5NUCA 5BN3A 4CKCA 3PUVA 2DNCA 1CZWA 1OXTA 4DF7A 1SNMA 4LMQD 1U9RA 2Z1CA 1PTOB 1CK1A 3KLSX 3M7GA 1EQTA 4G7ZC 5CC4A 3L7ZC 2NB0A 1PTOC 2JA8B 2ZXPA 2EY1A 1JWMD 4CKBA 3RLFA 5EJWA 1AP0A 4N9TA 2D9UA 1PFNA 3HOXB 3SK4A 3HOZB 4EQNA 3DM1A 3FPUB 2EYHA 2E76C 1GJXA 1VCIA 1EWCA 2WV6D 4O42A 5CR3A 2F0PA 1LTRD 4KD3A 4DXGA 3G6JB 1NR2A 1O7ZA 4WORA 1TS3A 4KD4A 5EQ0A 1TS4A 5I9OA 1KDAA 3SHLA 1EY9A 2KEEA 3KLRA 2F0JA 3O13A 2NN6G 2ZT9C 2EYMA 2J4XA 5CV9A 4XT3B 3SXHA 4KY5A 3I90A 2F0EA 1XX8A 3K5OA 2F0VA 4J6HA 1GUOA 4KN4C 2AQ3B 4R8NA 3D4DA 4KHVA 3R2TA 3DEOA 2OXPA 1DD2A 3PUYA 3D4WA 2A5HA 4H44C 3NBIA 3U9SA 3VYUA 5JEAH 3ND8A 1IKMA 1I6HB 5C4HA 2EDGA 5JOBA 3P7JA 2LY7A 1C48A 4DA2A 4A3JB 2RKSA 2YU9B 2NVXB 2E2HB 1SMYD 1HQRD 1K8MA 1EIHA 1I4XA 1TWHB 1STYA 1Z7TA 3HOUB 3R93A 2CW0D 5CV6A 3S2HB 2N55A 1STHA 1BCPF 1LT5D 2K5QA 2OEOA 4ILWA 5KNCA 1A2TA 2F0GA 3S15B 2OT2A 4OO1I 4KN7C 2KUMA 5EKKA 4C56C 2EXZA 1ENCA 2A6ED 3A7AB 1A2UA 4ULLA 1OXXK 3J7AF 5DM73 1R4PB 2N88A 1EYAA 1NAPA 3TSSA 5M5XB 3QOJA 2WKCA 1EZ6A 5C5MA 4FXGC 1PTOF 3CKIB 2AQ1B 1FR3A 1HCZA 2EJGC 3LWEA 4CGYB 5C4JB 2J0TD 4C1NI 4B9WA 3I91A 4C3IB 1KLUD 1PTOH 1ESRA 1CI3M 1TVXA 3MVVA 1PLFA 4KI0A 1EIGA 2KA7A 1BF4A 5KRUA 1RDPD 2JYOA 2IJ0A 3PUZA 3V2TA 5CORA 4DXFA 2A74C 1BBXC 1IL8A 3GTOB 1ZYRD 2XRSD 4F8MA 4L6TB 2A6HD 2B39A 2FMCA 4KJNA 3P20A 1IHZA 2L1BA 1RHPA 3H0GB 1WTXA 3DHQA 1EY8A 2ZXRA 5E3FA 4CJ2C 2NUCA 1XYIA 3NQTA 5I6YA 3W3AA 4OGQC 1STBA 1EEID 5FOBB 2DN8A 4IQZA 4K14A 5JAVA 1G2SA 1F9QA 4S3SA 3Q23A 2EPBA 2MP1A 3BDCA 3NK9A 1KNEA 4HAEA 4FXDA 1TQOA 4KJOA 1K83B 4B9XA 3K6OA 4K2KA 4BY1B 2RSNA 2SEBD 3VR6A 2IPKD 2MHVA 5IT9L 4ZK9B 2IX0A 1G91A 3HGBA 3BDOA 4XYOA 3SK5A 3QO2A 1HA6A 5A2QL 4LAAA 4ZQ3A 1BOSA 2HDMA 1J8IA 3OMGA 1HTLD 1W6JA 4BA1I 2IX3A 3TP6A 1SNDA 1D5MC 3GTJB 5CV7A 3T16A 2AUKA 4QIWB 4KKSA 5G3LF 3R2IA 2EOTA 1MBYA 1G2TA 3TP7A 1CHQD 1PRTB 1I3QB 4ME5A 4KY6A 5I2YA 3K5MA 3BYYB 2PZTA 2QF7A 4BS9A 2J7ZA 1O78A 1VMCA 2FINB 1OXUA 4EVOA 1PRTC 3GV6A 2PQEA 1HFNA 2EVBA 2B2WC 2G9HD 5JEAG 1TY0A 1B44D 4OIKA 1SNOA 3H94A 4DAPA 1DYQA 3GO5A 1T5XD 3SDZA 3V96A 3BDLA 1EL0A 1STGA 4H0LC 5DM63 2BCOA 3RD4A 1EY6A 3CHBD 5C0XI 2NN6H 2F0TA 5C0XH 4HCEA 2B63B 1WTQA 5D65A 1B9NA 4RKBA 1JC7A 2A73B 1V1PA 5KYLA 3QJYA 4OHJA 2H1EA 4BBRB 3TP8A 4OO1G 1EU3A 4XDXA 1A6XA 1K8OA 4RGNA 4K2LA 4ZAIA 1Q12A 2KECA 1WTRA 2E75C 2JXMB 3GTPB 3MXPA 4K6DA 4HEDA 2Z8LA 4FF2A 2B2VA 3G7LA 1HFGA 2WB1B 1X32A 2EYPA 4RFBA 5M9OA 2ID0A 1Z47A 4HSVA 3HS0C 1I50B 3I4MB 1RF2D 2XVSA 1ILQA 4TKOB 4N9PA 1KDCA 3NTIA 1HA5A 3K59A 2LS01 2R7ZB 2Q8RE 4QUCA 2XWJB 3MAQA 5D3IB 3OIPA 3TZUA 4WFN3 4RAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOM A;  1SAP A;  1U4R A;  2B2U C;  3DM1 A;  1PFM A;  5COY A;  3FPU B;  4CJ0 B;  3H91 A;  5CBA E;  2K1B A;  2KUM A;  1G2S A;  1F9Q A;  3ONA B;  1CM9 A;  4OIK A;  1U4P A;  3MTS A;  1HRJ A;  1B50 A;  1QE6 A;  1B3A A;  2EPB A;  1QNK A;  3I3C A;  5EPL A;  1CA6 A;  1ROD A;  1RTN A;  2L4N A;  4O42 A;  2MP1 A;  3SVM A;  2DY7 A;  4IUU A;  1KNE A;  2NYZ D;  5EKI A;  4ZKC B;  1EL0 A;  1KNA A;  2NZ1 D;  2B2Y A;  3MWY W;  4HAE A;  4X3T A;  2HCC A;  3DEP A;  1J9O A;  1U4M A;  3FDT A;  3KUP A;  2MJ8 A;  2N88 A;  1NR2 A;  1U4L A;  3N52 A;  1HUN A;  1O7Z A;  2R3Z A;  1G6Z A;  4UAI A;  1O7Y A;  5EQ0 A;  1NAP A;  4IUP A;  1F2L A;  5D14 A;  1E0B A;  2FHT A;  2RSN A;  4QUF A;  1WTO A;  1F9P A;  4MN3 A;  2K03 A;  3GV3 A;  4ZK9 B;  1WTQ A;  1JE4 A;  5D65 A;  4HCS A;  1G91 A;  1ICW A;  2KEE A;  1F9R A;  1AZQ A;  1DOL A;  1NR4 A;  3UI2 A;  1PDQ A;  2HCI A;  1MI2 A;  5T1G A;  1DON A;  3LWE A;  1A15 A;  2H1E A;  2X6L A;  4ZLT F;  3QO2 A;  5E4W C;  2JP1 A;  2L12 A;  4XT3 B;  1HA6 A;  3I8Z A;  1RJT A;  3I90 A;  2FJ2 A;  1XX8 A;  1BNZ A;  1VMP A;  3I91 A;  4XDX A;  1ILP A;  2HDM A;  1ML0 D;  2B2W A;  1EOT A;  2B2V C;  2B2U A;  2K01 A;  1J8I A;  1RTO A;  1X3P A;  2L11 A;  5CBE E;  4ZAI A;  4ZKB B;  4RAU C;  1ESR A;  3IL8 A;  2K05 A;  2IL8 A;  2RSO A;  2DY8 A;  4NW2 A;  1SDF A;  2Q8T A;  2MGS A;  1C8C A;  5JJZ A;  3KBX A;  1ZXT A;  4RWS C;  4CJ1 B;  1DZ1 A;  1TVX A;  2KEC A;  4LMQ D;  1PLF A;  3DEO A;  1WTR A;  1QG7 A;  5AFW A;  1EIG A;  1X3Q A;  1B4O A;  2CVR A;  1WVL A;  1WTP A;  1AZP A;  4HED A;  1BF4 A;  5EPJ A;  2MPM A;  4RA8 A;  1MSH A;  2JYO A;  2X69 A;  1MGS A;  1MSG A;  2B2V A;  2NWG A;  2FMM A;  5COR A;  1IKM A;  1BBX C;  1IL8 A;  2KOL A;  1EQT A;  3G7L A;  5T1I A;  1HFG A;  1CA5 A;  5DNF A;  1O80 A;  1X32 A;  1Q3L A;  2M2L A;  2BDN A;  2HDL A;  2X6G A;  4X3S A;  4IUV A;  3P7J A;  4OIJ A;  2K28 A;  3F2U A;  5CMD A;  1HUM A;  4R9W A;  3IFD A;  4IUR A;  3TZD A;  1M8A A;  2XIW A;  2RA4 A;  4U68 A;  4X3U A;  1GUW A;  2EOT A;  2L1B A;  4HSV A;  5EPK A;  1B2T A;  1G2T A;  4MHE A;  1EIH A;  1RHP A;  1B53 A;  1WTX A;  2B2T C;  3HP3 A;  1ILQ A;  1BO0 A;  4IUQ A;  1WTV A;  1WD1 A;  1WD0 A;  1JIC A;  4CJ2 C;  1XYI A;  2KVM A;  4R8I A;  1S4Z A;  5EJW A;  3R93 A;  1F9S A;  1DOK A;  1PFB A;  4XT1 B;  1AP0 A;  1WTW A;  3D6W A;  3TN2 A;  2N55 A;  2VXW A;  1SSO A;  2EE1 A;  1NCV A;  2D9U A;  1IKL A;  2SDF A;  2Q8R E;  2RVL A;  4QUC A;  5E4X A;  4DN4 M;  4IUT A;  2J7Z A;  2L9H A;  1VMC A;  1PFN A;  2FIN B;  2B2Y C;  1HHV A;  2K04 A;  3Q6S A;  3GV6 A;  1LV9 A;  2FFK B;  1HFN A;  2B2T A;  2KED A;  4X3K A;  2HUG A;  2B2W C; 
#chains in the Genus database with same CATH topology
 1CQV A;  3VYR A;  2B2U C;  1HR0 W;  1V1P B;  3RR5 A;  3UDF A;  2JA8 G;  1JOK A;  4XQQ A;  1HRJ A;  1U4P A;  1LTL A;  1PH4 A;  4GLA C;  1VQL A;  1K83 H;  2OF1 A;  3HZX A;  1EIY B;  2E2I B;  1D5X C;  2Z0S A;  1J5E L;  4BY1 H;  4ZKC B;  1SRO A;  2CQA A;  4YWK A;  4X3T A;  3RLN A;  1OTC A;  2E2J B;  4MZ9 A;  2SNS A;  4FDB A;  4DV7 L;  5CYU A;  1M1K C;  5CV5 A;  2L15 A;  3HOX G;  1XNQ L;  3ZJY C;  2F3W A;  2I5L X;  3HOZ G;  1HZC A;  4QUF A;  1LAC A;  1LT6 D;  1RIP A;  3FEW X;  1S3O A;  3NEM A;  4PNY A;  4XQN A;  1VQG A;  3TP5 A;  2BA0 A;  3FKI B;  1N33 Q;  1CSQ A;  4POG A;  2PNR C;  3OWF A;  1MI2 A;  5LHY 1;  2Z6K A;  2JP1 A;  4JI8 Q;  2UUB L;  1RJT A;  1PZJ D;  1N34 Q;  1HQM C;  4QGU A;  4JI0 L;  1TWG B;  1WJJ A;  2QIL A;  1GO3 E;  3GDE A;  2LFN A;  2B2V C;  4HJA A;  1X3P A;  3QB3 A;  4EGV A;  3NTK A;  1N32 Q;  4EX5 A;  1LUZ A;  1WI5 A;  3GTJ H;  3J7A 5;  4RWS C;  1SNP A;  1PRT F;  1AW7 A;  3J80 L;  4DR2 Q;  2KEN A;  2JQO A;  1KHI A;  1E2W A;  1UE7 A;  1NMF A;  1CKM A;  3C3L A;  2NWG A;  4GZY C;  2RHS B;  5JEA J;  3EJI A;  1JJ2 A;  2L5T A;  3KLS A;  3J81 j;  4QIW E;  1KLG D;  3A74 A;  5FLM H;  4DAY A;  1F77 A;  3NWT A;  4UHV A;  2VUM B;  1QNU A;  1GUW A;  4HIM A;  5EPK A;  4POF A;  1HR0 Q;  1ESF A;  4GN4 B;  4BY7 B;  1JCK B;  1WTV A;  1BO0 A;  1HZB A;  1L1O A;  3ULP A;  4LF4 L;  4DR4 L;  1BBW A;  1IBM L;  2F03 A;  1SSO A;  5C3W A;  1I4R A;  1Q1B A;  2CKZ B;  3CCJ A;  1VDZ A;  1TWC B;  5C5L A;  4A3L G;  2KED A;  3Q6S A;  4FF4 A;  1NMG A;  3A8K E;  4MTK A;  2QDB A;  4RGO S;  2I07 B;  1VQA A;  4RH6 A;  4X62 Q;  4A3J G;  2K33 A;  2QEJ C;  4EQO A;  5ELO A;  1IZ6 A;  2Z4I A;  5E1F A;  3MTS A;  3CPW A;  5H1S E;  1VQP A;  1V43 A;  3GTQ B;  1WCM H;  1HNX Q;  2A1A A;  1LYL A;  1ENF A;  4AQY L;  3HOY H;  1UE1 A;  4NMZ A;  5LL6 S;  3R8B A;  1Y8N B;  4DUY L;  2DY7 A;  3HOU G;  3PO2 B;  3RMH A;  4IAL A;  2NZ1 D;  3MWY W;  2N78 A;  2B63 H;  2JSO A;  2Z6K C;  5GAG C;  5ELD A;  2BDO A;  3I55 A;  2EY5 A;  3BVZ A;  3J81 c;  4A3D H;  1E0B A;  1XMO Q;  5I2X A;  4MN3 A;  1ZKO A;  1SEB D;  3QWN A;  3UI2 A;  3ERQ A;  1PDQ A;  3DMU A;  4JV5 Q;  5ELC A;  2WII B;  1IXR A;  3T53 B;  3MHB A;  1Y69 U;  3B6Y A;  5M3M H;  2EY2 A;  3Q0A A;  1F2M A;  5CGK A;  2FJ2 A;  3GTP H;  1XPU A;  1EWI A;  3IL8 A;  4NW2 A;  4MNO A;  2M9V A;  5AFW A;  4IOA A;  4IUN A;  3LNN A;  1QOH A;  3S1Q B;  1GUG A;  4TVA B;  1I94 L;  2DNE A;  4L5R C;  4DNT B;  5C0X G;  4JG2 A;  1EY7 A;  1I50 H;  1QZG A;  1UEA B;  2M2L A;  2WB1 E;  1XTC D;  2K14 A;  4C3I G;  2GA4 B;  4R9W A;  2JA6 H;  2V4D A;  2RA4 A;  1H9R A;  2NVY B;  3V05 A;  1O7I A;  1C4Q A;  4O0A A;  3DUZ A;  3HFZ B;  2F4V L;  4B08 A;  1B53 A;  1QB5 D;  5K5P A;  1D5Z C;  4DUZ Q;  1WD0 A;  5KGU A;  4P2C B;  1FYC A;  3EQL C;  2YTY A;  4P74 A;  5IT9 E;  1I4G A;  3HEJ A;  4R8I A;  3SEB A;  3GTM B;  4FF1 A;  4XT1 B;  3LGJ A;  1GUS A;  2HHH Q;  1AN8 A;  4PQX A;  1SMY C;  1XXG A;  4OX9 L;  1NCV A;  5KYI A;  2JA5 B;  4DV1 L;  1B9M A;  4IUT A;  4C3J G;  4LFC L;  5HGQ A;  1RD9 D;  1I4H A;  4E6I A;  2HUG A;  5A2Q E;  2PI2 A;  4IPH A;  2CW0 C;  3C46 A;  4CDD C;  4UY8 C;  3H0G G;  1JJC B;  1PYS B;  1XWE A;  4A3M H;  4UPA A;  1HTP A;  1SYG A;  3NEN A;  1YI2 A;  4PMC A;  2JEA I;  1R9T B;  2HCC A;  3URY A;  2CQO A;  1W6K A;  4P71 A;  2A6E C;  4HTH A;  5FJ8 H;  3WOF A;  3F8T A;  3M4O B;  1HUN A;  1AEX A;  4A3B H;  4WRD A;  2KCC A;  3GV3 A;  2PYK A;  4F87 A;  4OO1 H;  1TWG H;  4HCS A;  1FNW A;  2PMZ B;  1DOL A;  4HJ7 A;  1JR0 D;  2PO4 A;  3CPF A;  2H5X A;  2G5D A;  2V1C C;  5IGD A;  3AU7 A;  4Q0F A;  2F0S A;  4FNF A;  4IN3 A;  3T13 A;  5C6A A;  3I8Z A;  2MFI A;  3BJU A;  2RCN A;  1VMP A;  3UDG A;  2OQK A;  4K0K Q;  2IY5 B;  1EOT A;  1TKW B;  1YJW A;  2QW7 A;  3OSO A;  2I5M X;  4HMI A;  1BDO A;  4K5W A;  2JA9 A;  4BY1 G;  4C3H B;  1MJE A;  2E8G A;  4PZ6 A;  3FRP B;  1JWU D;  5EBC A;  5I9P A;  3NHH A;  5ISR A;  4M8A A;  1VQC A;  1RCV D;  2VUM H;  5J3B A;  1CFM A;  2UXC L;  4DAV A;  4DR7 L;  3H15 A;  4OEM B;  1KRS A;  1H9M A;  5T1I A;  4BY7 H;  2AQ2 B;  1XTD A;  3BZD B;  4X3S A;  4ODG A;  4MTN A;  4JI5 Q;  1M8A A;  5I4D A;  5KIX A;  1A8V A;  3GTL B;  3CQZ B;  3DWP A;  5IGG A;  1X65 A;  1ZYR C;  3MEF A;  2EY6 A;  5GAE C;  2LKV A;  3DLL A;  2A6H C;  3CCM A;  1TWC H;  2VQF L;  4KKT A;  4QMG A;  3AMU A;  1SYD A;  4HID A;  2PZW A;  1FGU A;  4DR6 L;  2RVL A;  2NBF A;  1VQO A;  5C4X B;  3GTQ H;  2A69 D;  4C3J B;  1SJH D;  1SNQ A;  1JQY D;  1PYB A;  2R92 B;  1U4R A;  5COY A;  1K0R A;  3ERO A;  4YY3 L;  3K5L A;  2OQ0 A;  3LWU A;  4K5V A;  1I4P A;  3EVQ A;  3HOX H;  4V0B A;  5FO9 B;  3SE0 A;  1C9O A;  1CZG A;  1EQR A;  2B8G A;  2NYZ D;  3S9W A;  5C4Z A;  4DAM A;  1J9O A;  3FDT A;  1I6V C;  2K7V A;  4TQU S;  1U4L A;  1LT4 D;  1EOV A;  2F1M A;  2ATW A;  1VQ9 A;  4UAI A;  4IUP A;  1F2L A;  5F2D A;  1PH6 A;  2VQE Q;  1VQF A;  3MXU A;  3PIO 3;  3KBG A;  4B3T L;  5IYD H;  2K03 A;  3ITP A;  3S17 B;  1JE4 A;  5C0X J;  3CXC A;  4IFD I;  2YTV A;  5AJ3 L;  4IFD H;  3HRZ C;  4HR7 B;  1UUP A;  3FVQ A;  3S16 B;  2PW5 A;  3M4P A;  1PH3 A;  4HN7 A;  3PF4 A;  3NSW A;  4YCU A;  1ILP A;  2B2W A;  2HD3 A;  2K01 A;  1HH2 P;  1YNJ D;  2PNH A;  5J39 A;  2KCN A;  5C3X A;  2EYJ A;  1EYG A;  4NKL A;  1U5K A;  2K05 A;  2RSO A;  3LX0 A;  4QB4 A;  2ZM6 L;  1SYF A;  2EQS A;  2UUC Q;  4XXE A;  4X65 L;  2B63 G;  3KOJ A;  1B4O A;  2NTT A;  1K8G A;  4RA8 A;  2UU9 Q;  2ASB A;  4DK6 C;  4BBR G;  5JPN C;  3CMA A;  4CHT B;  1N36 L;  5DNF A;  1O80 A;  1RKN A;  2ZTE A;  1NSN S;  2EYF A;  1JOQ A;  5JPM C;  1KIX A;  1STN A;  1II3 A;  1KXL A;  4MIU A;  4NXM Q;  4DV0 L;  3IFD A;  3GTM H;  4LFB Q;  2WFW A;  1KAB A;  4OXP A;  3K0Y A;  4MHE A;  1TU2 B;  1GHK A;  1HNZ L;  2FXQ A;  1GOZ A;  1EY4 A;  1VQK A;  1VQN A;  3S2D B;  4A3L H;  1IW7 D;  2KJX A;  1GHJ A;  2TMP A;  4A3J H;  1ASZ A;  2YU9 H;  2VXW A;  1GUT A;  2NVX H;  2EIF A;  3SGI A;  1IKL A;  1TWH H;  3S1N B;  2KQ3 A;  2WB1 G;  1SYE A;  1HJP A;  2BE5 D;  2F4I A;  2ICE C;  3C2P A;  3HOU H;  2F0L A;  4GKK L;  2K6A A;  1NUC A;  1R9T H;  1Q1E A;  4A93 B;  3S2H H;  2R7D A;  2RDF A;  3I4M G;  3E5S A;  4M1U B;  3KJO A;  3VYS A;  4DU9 A;  1JMC A;  4B3M L;  1EZ8 A;  1TWF B;  3OHX C;  1QNK A;  3I3C A;  2EYL A;  3CCR A;  2AMC B;  4F88 A;  1J5E Q;  4LF9 L;  1E24 A;  4CKE A;  3KDF A;  1KNA A;  3J80 E;  4JI7 L;  1E3P A;  4DR3 Q;  5JJI A;  1DCZ A;  2F0N A;  4DV7 Q;  2R7Z G;  1PVO A;  4JBW A;  2PCF B;  1XNQ Q;  5FKA C;  3T56 B;  5IGB A;  4HJ5 A;  3I4L A;  1KAA A;  1ET6 A;  1SJE D;  3RZD B;  3MC0 B;  2O2L D;  3MFY A;  2I46 A;  1SE3 A;  2EXD A;  3U58 A;  3HKS A;  5KNB A;  1N9W A;  3SK8 A;  3BG3 A;  1GUN A;  1BBU A;  3K57 A;  1DON A;  1JWS D;  1MIU A;  4FVM A;  2UUB Q;  5M5X H;  4C3H H;  1B70 B;  4JI4 L;  4JI0 Q;  3NPP A;  2K5W A;  4Y7N B;  1QZH A;  5FLX c;  4JI3 L;  3T51 B;  4NPS A;  5EKL A;  2B2U A;  3FMC A;  4C1N K;  4DGZ A;  2IL8 A;  3A55 A;  1E1T A;  4Y52 H;  5JJZ A;  1ZXT A;  3D31 A;  4YCW A;  3D6C A;  2XNA C;  1QWY A;  4X64 Q;  1EYC A;  5IGF A;  3FKI G;  3CP0 A;  5EPJ A;  2N8N A;  1MSH A;  3C1E A;  1YHB A;  1HPC A;  5IP9 G;  5IIF A;  3GTL H;  3X3M A;  1LTT D;  1FJG L;  2PI2 E;  2K28 A;  2Z4H A;  2M00 A;  3NXW A;  1HUM A;  4UP9 A;  4IPG A;  4K8I A;  4L8J A;  3HG9 A;  3CD6 A;  1Q82 C;  3GTO H;  4G7O C;  3HP3 A;  4FF3 A;  4IUQ A;  1PH8 A;  2NTS A;  2ZJQ A;  4C3J H;  4JI2 L;  4LF4 Q;  1BUV T;  2QGQ A;  4DR4 Q;  2Z9H A;  3MZ5 A;  4ME3 A;  2HQE A;  2D5D A;  3WDN A;  3TN2 A;  2EE1 A;  2F3V A;  3H6M A;  3H0G H;  1CTM A;  1LV9 A;  4LW1 A;  3L2P A;  4UP7 A;  2DJG C;  1GVP A;  3PUX A;  2VUM G;  1S5B D;  2D2C C;  3SR1 A;  2K1B A;  1UNS A;  4J1M A;  4BY7 G;  4AQY Q;  4KK7 A;  1KC8 C;  2IW3 A;  2RCF A;  4DUY Q;  1GD7 A;  2K5H A;  3I7F A;  1SR3 A;  4DFA A;  1S5E D;  4CDC C;  4X6A H;  4FXK C;  3F1Z A;  3KUP A;  2RDH A;  3S17 H;  1XNR L;  4QL5 A;  5C44 B;  3CC4 A;  1SE2 A;  2K4K A;  1D1K A;  3J81 E;  1O7Y A;  2XRQ D;  4ZUI A;  3EIV A;  2K75 A;  1F9P A;  2CFM A;  1GKH A;  3M7N A;  1Q46 A;  1VQE A;  1NR4 A;  5KND A;  2JK8 A;  1PH7 A;  3HOV B;  1O7L A;  1D7Q A;  2X6L A;  3R3O A;  2WP8 J;  3PO2 G;  3N6R A;  4JPB W;  1YNN C;  1CSP A;  4NDX A;  5D3D A;  2F0U A;  2OWO A;  2E5L L;  3KK7 A;  4CDF C;  3ER0 A;  1S5D D;  4HIO A;  1STE A;  4OWX B;  4YHH L;  5KEE A;  4R4I A;  1PH9 A;  2EYO A;  1YHA A;  3FHW A;  2DY8 A;  4QF4 A;  3MA2 B;  4QJF A;  2ZJR A;  4P73 A;  4ZUJ A;  4A3E B;  1A0I A;  3BZC A;  1WYD A;  1W3S A;  2MPM A;  3VR5 A;  5CV4 A;  1MSG A;  1SXT A;  2IHF A;  5IYD G;  4K6L A;  3CRL C;  2KOL A;  2SOB A;  5J22 A;  3J7A V;  2KHS A;  2Q2I A;  3Q24 A;  3E6Z X;  2X6G A;  4IFD G;  3ULL A;  1JE5 A;  1EY0 A;  4ZRZ A;  3S2D H;  1VQM A;  3RNU A;  1AE2 A;  1FGB D;  4U68 A;  5C3E B;  2F4V Q;  1B2T A;  3M85 A;  3BVM A;  2VL6 A;  4F7X A;  3MXN B;  4H13 C;  4PG3 A;  4JI1 L;  4N8F A;  3L3O C;  5M5Y B;  4FYD A;  4PMW A;  3NBH A;  2A68 D;  5GAD C;  4OX9 Q;  2PZU A;  5IP7 G;  4A93 H;  1WFQ A;  1LM0 A;  1QCB D;  4LFC Q;  2UXB L;  1YZ6 A;  3MFG A;  4FP5 D;  3IKJ A;  4DV2 Q;  3OMC A;  4KLK A;  3PIP 3;  2BOS A;  4LNQ A;  4YWM A;  5ELN A;  1YVC A;  3E9I A;  1I3Q H;  1F2Z A;  3C1F A;  2EJF C;  4LF8 L;  5A35 A;  1B3A A;  3NWS A;  3VA5 A;  2BA1 A;  5EPL A;  1ROD A;  1UEB A;  2KHI A;  1VQ6 A;  5I6W A;  3BVG A;  4IUU A;  5EKI A;  1D1I A;  2Q2T A;  1H9S A;  3DEP A;  4TSS A;  3EN2 A;  1TII D;  2JA5 G;  1STA A;  2K32 A;  1IYV A;  1BCP D;  4LWC A;  1G6Z A;  1OO9 B;  4GN5 A;  1LT3 D;  2H4O A;  1VQ8 A;  1DXM A;  3S1R B;  3CCL A;  3PMF A;  3OIQ A;  3I4N B;  1DJR D;  1ICF B;  4APV A;  1Y1W B;  1Q8I A;  1TWA B;  1VQ7 A;  4JK1 C;  3IFT A;  3BU2 A;  4LFA L;  4P75 A;  3TRZ A;  1S72 A;  4CBV A;  2F0O A;  1HZA A;  4RKL A;  1KDB A;  1QJO A;  4TRD A;  2Q8T A;  4BBR H;  4CJ1 B;  3CRK C;  3NBH B;  2YTX A;  1X3Q A;  1PTO D;  5BN4 A;  1EWH A;  4DR1 L;  3A8I E;  2UXC Q;  1I5F A;  4DR7 Q;  1EU4 A;  4IPD A;  1OXV A;  2BDN A;  2HDL A;  1YEZ A;  5CV8 A;  3GQB A;  3TBI B;  5CMD A;  1SE4 A;  4IUR A;  1LTI D;  4HSP A;  4X3U A;  4C3H G;  4C2M B;  1LLR D;  3U9O A;  2O5J C;  1H9S B;  3TME A;  2VQF Q;  2LMC B;  1CKN A;  2KVM A;  2MO1 A;  2UXD L;  3D4R A;  3K80 C;  1MD2 D;  1WTW A;  4G57 A;  4YIJ A;  3J81 L;  4DR6 Q;  2IWH A;  3I4M H;  1PZI D;  3E9H A;  2ALY B;  4BBS B;  1I4Q A;  1B1Z A;  1D2B A;  2LXJ A;  3HKZ B;  4AYB B;  1DOM A;  1SAP A;  3NE5 B;  4EQP A;  1PFS A;  5IOC A;  4YY3 Q;  4LF5 L;  5GAH C;  4JYA L;  5CBA E;  2B3G A;  4DPG A;  5BR8 L;  2YYZ A;  2R7Z H;  4LK1 C;  1LAB A;  2Y0S B;  1AFP A;  5JVG 3;  1TY2 A;  3SVM A;  1KL9 A;  1CHP D;  5HGT A;  3RUZ A;  2O5I C;  2AWN A;  1KRT A;  3NUC A;  2GVB A;  2F0D A;  4GNX B;  4L5Q A;  3MXG A;  4RHS A;  3CCU A;  3T1H L;  5C4X G;  4L63 B;  2F0H A;  2A8V A;  2E2I H;  4B3T Q;  2R92 G;  1NNX A;  4XTC S;  3H3V C;  2WAQ B;  2XN9 C;  4GNX C;  1X56 A;  1B3Q A;  1SRU A;  3OWE B;  5AJ3 Q;  2E2J H;  5IOD A;  4H02 A;  1XPO A;  2EZV A;  4K8J A;  3W2D A;  2XGT A;  5TSS A;  3DM3 A;  1KAW A;  4IFD J;  3OYY A;  3Q22 A;  5ELE A;  2AHO B;  1IYU A;  1JB3 A;  1QVF A;  1BNZ A;  1U0L A;  1RL2 A;  2WAC A;  3FKI H;  1RTO A;  1Y8O B;  5CBE E;  2G9D A;  2ZM6 Q;  1SDF A;  1CKN B;  5IP9 H;  4X65 Q;  1X3F A;  1WVL A;  1WTP A;  2TSS A;  1X3E A;  1EY5 A;  2XSC A;  2RDG A;  3M3Y B;  1MGS A;  2DJF C;  5IYC H;  2RQX A;  1N36 Q;  1DM0 B;  3A56 A;  3AQQ A;  1QIL A;  2K5D A;  5DEH A;  1EYD A;  4KY7 A;  1A3V A;  1Q3L A;  1OXS C;  1K0S A;  1ZEQ X;  3EA6 A;  2ZTC A;  4DV0 Q;  4BA2 I;  3F2U A;  5M5Y H;  3T1Y L;  4G7H C;  1L2F A;  4A3I B;  1SBB B;  2NVT B;  1HNZ Q;  1WD1 A;  1H95 A;  1MKH A;  1HNX L;  4IZ8 A;  1B7Y B;  4A3F B;  3PO3 B;  3DWA A;  1H9J A;  3WOE A;  2I0Q A;  1G8Z D;  1X54 A;  1DGS A;  3D3R A;  1T5E A;  4UDU C;  1HXY D;  4NXN L;  5FO8 B;  5J1Z A;  1VQ5 A;  3CAM A;  2L9H A;  2K04 A;  4I65 A;  3J80 i;  1K3B C;  2B2T A;  4GKK Q;  3M4Y A;  3ND9 A;  5G3L D;  1Q90 A;  2NVQ B;  5M5W B;  1JB7 A;  4B3M Q;  1CM9 A;  2IX1 A;  2R93 B;  1B50 A;  4HMJ A;  4JOI A;  1V8Q A;  2A69 C;  2IT1 A;  4CDE C;  1PXU A;  3H09 A;  3KFU A;  1UE5 A;  1SFO B;  3A7L A;  4LJZ C;  3KF8 A;  1Z9F A;  3DWQ A;  1VQJ A;  2MJ8 A;  3I4N H;  4DR5 L;  4JI6 L;  2F0M A;  2K50 A;  3AFQ A;  3VR4 A;  1TWA H;  2VY3 A;  5D14 A;  1BR9 A;  3T4A C;  2CHB D;  2UUA Q;  3VYT A;  3PO2 H;  1Y8P B;  1G6P A;  2JA7 B;  4A93 G;  4HJ9 A;  5BN5 A;  2VB2 X;  3VA7 A;  2ENB A;  3QOL A;  4J8Q A;  1SMX A;  1LTS D;  3VR3 A;  4JI4 Q;  3KYH C;  4A4I A;  1H9K A;  3KLW A;  2CH4 A;  3PQI A;  3JAM E;  3A8J E;  3PUW A;  4DK1 A;  3OTO L;  4JI3 Q;  1JT8 A;  5FLX E;  2RHQ B;  3CC2 A;  4KV6 A;  2C5C A;  4DK3 C;  5EBD A;  1Z6H A;  1L0X B;  4R4O A;  3K8A A;  3RZO B;  2JEB I;  3GTG B;  4L5S A;  2PQA A;  3KBX A;  2E74 C;  1SNC A;  1DZ1 A;  4RGM A;  1QG7 A;  4BXX H;  1AZP A;  2CVR A;  1LTA D;  3F2B A;  2HT1 A;  4LF6 L;  5IT9 c;  1YNJ C;  1E2Z A;  4RMF A;  1K28 A;  3PF5 A;  1Y1V B;  5FO7 B;  4A3G B;  1FJG Q;  3CCE A;  4DV6 L;  2BH8 A;  1FNU A;  3A5Z B;  5ELF A;  4WJ4 A;  1TS5 A;  3S1Q H;  3TZD A;  2XIW A;  1PV4 A;  1ONL A;  3PGZ A;  5K36 H;  5IP7 H;  3VDY A;  2B2T C;  1S40 A;  4JI2 Q;  2D62 A;  4QCL A;  3KF8 B;  5IGE A;  2EJM A;  2C35 B;  4JOI C;  2B29 A;  2WKD A;  5GRO A;  3CF5 A;  2NVY H;  2SDF A;  4DN4 M;  1HHV A;  1UAP A;  3H3V I;  2QDL A;  1IW7 C;  2F0F A;  2N3S A;  1LO5 D;  1TXY A;  3RN2 A;  3L0O A;  3J81 i;  1ASY A;  1TT2 A;  2JA5 H;  2R6G A;  1XMQ L;  4YCV A;  1RTN A;  2L4N A;  3NP8 A;  2BE5 C;  4JBK A;  3S14 B;  1CQF A;  3I4O A;  4DNR B;  4KHZ A;  1NE3 A;  4JVZ A;  1XNR Q;  5IYB G;  3ICE A;  1PH1 A;  4O1N A;  1JOO A;  2O4X A;  1R4Q B;  2PQA B;  3N52 A;  2R3Z A;  2F52 A;  1X3G A;  1G29 1;  3A54 A;  1WTO A;  4V19 0;  3DXJ C;  4J15 A;  3HOW B;  1V1O A;  3K5N A;  3FPP A;  4O2D A;  2WAQ E;  4KTA A;  2AUJ D;  2VB3 X;  4LUZ A;  3GTK B;  3M4O H;  1A15 A;  4R4Q A;  1T9H A;  4ZLT F;  3Q8D A;  4KMU C;  3GD7 A;  3U50 C;  2E5L Q;  2JJQ A;  3CU7 A;  3STB D;  5DAU A;  3OW7 A;  1D6E C;  1ML0 D;  1S5C D;  5C44 G;  4ZKB B;  4AH6 A;  1X9N A;  3M3Y H;  2DGY A;  2MGS A;  1C8C A;  1JOR A;  1NBW A;  4OL7 A;  4WJW A;  4X66 L;  4DV5 L;  1AE3 A;  5LL6 X;  2PMZ E;  1TR5 A;  3HOV G;  1A3U A;  1GXD C;  2RBM A;  3QIA A;  2MUY A;  1A3T A;  3D8G A;  4OIJ A;  3W1G A;  4A3F H;  1FNV A;  2F0I A;  1M4V A;  1FD7 D;  4ID6 A;  1PHJ A;  3G4S A;  1LTB D;  4XIG S;  2JE6 I;  1EEF D;  4U67 3;  4A3E G;  4JI1 Q;  4A3K B;  1PRT D;  1HNW L;  4RCO A;  1VF7 A;  1DOK A;  2ZXO A;  3D6W A;  4AIM A;  3J7Y W;  1S5F D;  4RCN A;  1LTG D;  2UXB Q;  1WCM B;  5E4X A;  3CQZ H;  1VQ4 A;  3HOY B;  3I73 A;  1BQQ T;  2NN6 I;  2LSS A;  3A0J A;  1SFO H;  3AEV A;  3E0J A;  1PYW D;  2XWB B;  5IYC G;  1YNX A;  3BS1 A;  5C3E G;  3ONA B;  3ULJ A;  2QKI C;  4LF8 Q;  1YHQ A;  1QE6 A;  4PMB A;  5C4X H;  3JAM L;  1CA6 A;  2BH2 A;  4A3D B;  3S1M B;  4BWG B;  5FLX L;  5M3F B;  2R92 H;  2PW7 A;  3QG1 A;  2B2Y A;  1IBM Q;  4WJ3 M;  4LF7 L;  1U4M A;  4XYQ A;  3PIO A;  5EGT A;  2KHJ A;  2L0C A;  3OOC A;  1ET9 A;  5ELB A;  1TS2 A;  5M3M B;  3WWV A;  3PCO B;  3K7U C;  2MNA A;  3OW2 A;  1Q7Y C;  4H7B A;  1F9R A;  1IBK L;  2QEX A;  2QCP X;  3L9A X;  1E7Z A;  3SK6 A;  1Y14 B;  3UDI A;  4ZYS A;  4FO2 A;  4Q5V A;  5E4W C;  4LFA Q;  4JBJ A;  2MQH A;  2L12 A;  5IE8 A;  3K7A B;  4OEL B;  3MXN A;  4DK0 A;  3D0F A;  4B3R L;  2F0W A;  3NTH A;  2L11 A;  3P1H A;  4NXM L;  3S16 H;  2Q2H A;  1ENA A;  3PV0 A;  3RN5 A;  4JC0 A;  4K5X A;  2F0K A;  1L0Y B;  2AWO A;  1FVI A;  2ZTD A;  2MO0 A;  1MHW C;  3I70 A;  4IO9 A;  3I4N G;  2JA6 B;  3TDQ A;  5JVH 3;  4DR1 Q;  1Y1W G;  2SNM A;  3EFX D;  1JJG A;  4QQB X;  4Z9C B;  2X69 A;  4ABN A;  1IBL L;  2B8F A;  2FMM A;  4GKJ L;  2C9O A;  4KKU A;  4G4K A;  1X55 A;  1CA5 A;  3GP7 A;  1QVC A;  2AKW B;  3ERS X;  4IUV A;  1VQB A;  4GLX A;  1EFI D;  3IAY A;  4RGT A;  4DV3 L;  1KTK A;  1PA6 A;  2WIN B;  5LMU L;  5IGC A;  2F0Q A;  3ZYY X;  2UXD Q;  1JIC A;  1S4Z A;  1E2V A;  3AB9 A;  1F9S A;  2L55 A;  3X3N A;  3I72 A;  1PFB A;  1YIJ A;  3G6E A;  1I94 Q;  3J80 c;  4DR3 L;  5HUR A;  4OWW B;  2Q8I B;  4BXX G;  1C0A A;  4A3M B;  2B2Y C;  3TRE A;  2D0P A;  2E2D C;  2FFK B;  2ZJP A;  4KHP L;  3RLO A;  1PZK D;  1YNN D;  4X3K A;  4XQJ A;  4LF5 Q;  4JYA Q;  3S14 H;  1PFM A;  2A68 C;  4CJ0 B;  5BR8 Q;  1PMR A;  3H91 A;  3TQY A;  4IJH A;  1A63 A;  2VNU D;  3M9B A;  3OPO A;  1EFW A;  1KD1 C;  4NP5 A;  1SYC A;  3S1N H;  2PPB C;  1BVS A;  4A3B B;  1BXT A;  1L0W A;  1QUQ A;  1CT1 D;  1K73 C;  4PV1 C;  3S24 A;  2ICI A;  3BYT B;  3HOW H;  5K36 G;  1SYB A;  1B8A A;  3K58 A;  4DV1 Q;  3T1H Q;  1BCP B;  5FK9 C;  1EQV A;  1TWF H;  4BBS G;  4DV4 L;  4RHR A;  3GTK H;  3NQI A;  2FHT A;  3HKZ G;  4AYB G;  2ES2 A;  4I7Z C;  3VR2 A;  4PZ8 A;  1F2Y A;  4ALP A;  1ICW A;  4X64 L;  1AZQ A;  1BCP C;  1VF5 C;  2Y0S G;  2HCI A;  1HZ9 A;  3U4Z A;  3MEH A;  1V9P A;  5T1G A;  2R61 A;  5L37 A;  3UE0 A;  2R7F A;  4GOP B;  3RZD H;  3P75 A;  5NUC A;  5BN3 A;  4CKC A;  3PUV A;  2DNC A;  5LMN L;  1CZW A;  2HQL A;  4UP8 A;  1NJI C;  1OXT A;  4DF7 A;  4GOP C;  1SNM A;  4LMQ D;  2WAQ G;  1BKB A;  4Y7N H;  1U9R A;  2Z1C A;  4B3S L;  1PTO B;  1CK1 A;  3KLS X;  3TEH B;  3M7G A;  1EQT A;  5EAY A;  4G7Z C;  2CCZ A;  4GLV B;  5CC4 A;  2CWP A;  3L7Z C;  4A3K H;  4A3C G;  2NB0 A;  3M4Q A;  5IWA L;  3T1Y Q;  4GNX A;  1PTO C;  3UDX A;  2JA8 B;  2VS1 A;  2ZXP A;  3FP9 A;  2EY1 A;  1QUQ B;  1PH5 A;  3CC7 A;  2JN4 A;  1JWM D;  4CKB A;  3RLF A;  5EJW A;  3JC6 6;  1AP0 A;  4N9T A;  4NXN Q;  3W1B A;  2QA4 A;  4NB3 A;  2D9U A;  1YBY A;  1PFN A;  4HIK A;  3SK4 A;  3HOX B;  3S1M H;  3HOZ B;  5M3F H;  1D8L A;  4EQN A;  3DM1 A;  3FPU B;  2EYH A;  1K3R A;  2E76 C;  4A3I G;  5IYB H;  1GJX A;  4P72 A;  1VCI A;  2OCE A;  1EWC A;  2WV6 D;  1G51 A;  4O42 A;  4A3F G;  3PO3 G;  5CR3 A;  3QR8 A;  2N49 A;  1EIF A;  4DAY B;  1Q81 C;  3E0E A;  2F0P A;  1LTR D;  4KD3 A;  4DXG A;  4DR5 Q;  4JI6 Q;  3G6J B;  1NR2 A;  1O7Z A;  4WOR A;  1TS3 A;  4KD4 A;  5EQ0 A;  3JAM i;  3A5U A;  3KJP A;  1GM5 A;  1L1O B;  1TS4 A;  5I9O A;  4YWL A;  3K7A H;  1KDA A;  3SHL A;  2GVA A;  1IL2 A;  5IY0 A;  1W2B A;  1EY9 A;  2KCM A;  2GN5 A;  2R93 G;  2KEE A;  3KLR A;  2F3I A;  1N33 L;  2F0J A;  3O13 A;  3BZK A;  5C44 H;  3TS0 A;  3J7Z C;  2NN6 G;  2ZT9 C;  2EYM A;  2J4X A;  5CV9 A;  1L1O C;  1WOC A;  4XT3 B;  4JI8 L;  3SXH A;  4RG1 A;  4KY5 A;  3I90 A;  3OTO Q;  2F0E A;  1XX8 A;  1N8R C;  1N34 L;  3K5O A;  2F0V A;  4J6H A;  1GUO A;  4KN4 C;  2AQ3 B;  3CME A;  1Q8K A;  4R8N A;  3HOV H;  1N32 L;  3D4D A;  1CUK A;  3G48 A;  4KHV A;  4HJ8 A;  3R2T A;  3DEO A;  2OTL A;  2OXP A;  2JA7 G;  1YJ9 A;  4LF6 Q;  1DD2 A;  4DR2 L;  3PUY A;  3D4W A;  2A5H A;  4H44 C;  3NBI A;  3U9S A;  3VYU A;  1VS0 A;  5JEA H;  3ND8 A;  5E7N A;  1IKM A;  1I6H B;  1XPR A;  2NZH A;  5C4H A;  4DV6 Q;  2EDG A;  5JOB A;  4A3E H;  3P7J A;  2LY7 A;  1C48 A;  4DV2 L;  4DA2 A;  4A3J B;  2RKS A;  2YU9 B;  1X6O A;  2NVX B;  2E2H B;  1SMY D;  1HQR D;  1K8M A;  1EIH A;  1I4X A;  1TWH B;  1HR0 L;  1WTH A;  1STY A;  1V1Q A;  1Z7T A;  1VQH A;  3HOU B;  3R93 A;  1IYJ B;  4GS3 A;  4R4T A;  2CW0 D;  5CV6 A;  3S2H B;  1Y1V G;  2N55 A;  3PIP A;  1STH A;  1BCP F;  5C3E H;  2DUD A;  4A3G G;  1LT5 D;  2K5Q A;  2OEO A;  4ILW A;  5KNC A;  1A2T A;  2F0G A;  4ZCK A;  3S15 B;  2OT2 A;  4OO1 I;  4KN7 C;  4X62 L;  2KUM A;  2Q2U A;  5EKK A;  4C56 C;  2EXZ A;  2I5H A;  1ENC A;  1XMQ Q;  2A6E D;  3A7A B;  1A2U A;  4ULL A;  1J6Q A;  1OXX K;  3J7A F;  5DM7 3;  1R4P B;  2N88 A;  1EYA A;  1NAP A;  3TSS A;  5M5X B;  3QOJ A;  1SLJ A;  2WKC A;  1XMO L;  1EZ6 A;  5C5M A;  3U4V A;  2HIV A;  4FXG C;  1PTO F;  3CKI B;  3EBE A;  4JW0 A;  4LF9 Q;  2AQ1 B;  1K9M C;  1FR3 A;  4JV5 L;  1HCZ A;  2D0O A;  2EJG C;  3LWE A;  4CGY B;  5C4J B;  1KQS A;  2Z6B A;  4JI7 Q;  2J0T D;  3S1R H;  4C1N I;  4QY7 A;  4B9W A;  4PZ7 A;  3I91 A;  4C3I B;  1KLU D;  1Y1W H;  1PTO H;  1VQD A;  1ESR A;  5GQO A;  5JJK A;  1CI3 M;  1TVX A;  3HOW G;  3MVV A;  1PLF A;  4KI0 A;  4X66 Q;  4JBM A;  1YJN A;  4DV5 Q;  1EIG A;  2KA7 A;  1BF4 A;  5KRU A;  1RDP D;  2JYO A;  2IJ0 A;  3PUZ A;  3V2T A;  5COR A;  2JA8 H;  4DXF A;  2A74 C;  1BBX C;  1IL8 A;  3GTO B;  1ZYR D;  2XRS D;  4F8M A;  4L6T B;  2KBN A;  2A6H D;  2B39 A;  2FMC A;  1E22 A;  4KJN A;  3P20 A;  1IHZ A;  4A76 A;  1P16 A;  2L1B A;  1P8L A;  1RHP A;  3H0G B;  1WTX A;  3DHQ A;  1HNW Q;  1EY8 A;  4DUZ L;  2ZXR A;  5E3F A;  5FLM G;  4CJ2 C;  2NUC A;  1XYI A;  3NQT A;  3HOZ H;  2P5Z X;  5I6Y A;  3W3A A;  4OGQ C;  2HHH L;  1STB A;  1UWV A;  4C2M H;  1EEI D;  5FOB B;  2DN8 A;  4IQZ A;  4K14 A;  2A19 A;  4JCV E;  5JAV A;  1G2S A;  1F9Q A;  4S3S A;  3Q23 A;  2EPB A;  1AH9 A;  4A3K G;  4LUV A;  2MP1 A;  1Q86 C;  4BBS H;  3BDC A;  3NK9 A;  1KNE A;  4LF7 Q;  4HAE A;  4FXD A;  3E3X A;  2RF4 A;  3AFP A;  1TQO A;  1WCM G;  4KJO A;  1K83 B;  3HOY G;  4B9X A;  3F2C A;  3K6O A;  4IJL A;  2K5N A;  4K2K A;  2RSN A;  2SEB D;  4I7A A;  2IPK D;  3VR6 A;  1C7Y A;  4BY1 B;  2MHV A;  5IT9 L;  3HKZ E;  4ZK9 B;  3H3V H;  4AYB E;  4OWT B;  2IX0 A;  1IBK Q;  1G91 A;  3HGB A;  3BDO A;  4XYO A;  3SK5 A;  2Y0S E;  4A3D G;  3QO2 A;  5M3F G;  1HA6 A;  5A2Q L;  4LAA A;  1K8A C;  4ZQ3 A;  4B3R Q;  1BOS A;  2HDM A;  4K0K L;  1J8I A;  3OMG A;  5M3M G;  1HTL D;  2VZA A;  1W6J A;  3K81 C;  1I6H H;  1UE6 A;  4BA1 I;  3STB C;  2OTJ A;  1XJV A;  2IX3 A;  4A3C H;  3TP6 A;  3CW2 C;  1SND A;  1IBL Q;  3I2Z A;  3K0X A;  1D5M C;  4GKJ Q;  3GTJ B;  5CV7 A;  2E2H H;  3T16 A;  2AUK A;  1VQI A;  5LMN W;  4QIW B;  4YHH Q;  4KKS A;  3F2D A;  5G3L F;  3R2I A;  4DV3 Q;  1NY4 A;  4IOC A;  4JI5 L;  2EOT A;  1SE8 A;  1MBY A;  5LMU Q;  1G2T A;  5JJL A;  2KCT A;  3TP7 A;  3G71 A;  1PH2 A;  1CHQ D;  1PRT B;  5DLQ E;  3UE1 A;  2YV5 A;  2JA6 G;  3CCQ A;  2LXK A;  1I3Q B;  3S15 H;  4ME5 A;  4KY6 A;  5I2Y A;  3K5M A;  4A3I H;  3BYY B;  2NVT H;  2PZT A;  1YIT A;  2QF7 A;  4BS9 A;  2J7Z A;  1MJC A;  1O78 A;  2FIN B;  1OXU A;  1VMC A;  4EVO A;  1PRT C;  3GV6 A;  2PQE A;  4KHP Q;  1HFN A;  2EVB A;  4EQ5 A;  3PO3 H;  2B2W C;  2UUA L;  2G9H D;  3KF6 A;  3NEL A;  5JEA G;  1TY0 A;  1B44 D;  2VW9 A;  4OIK A;  1SNO A;  3W5O A;  1A62 A;  3H94 A;  4OON A;  4DAP A;  1DYQ A;  3GO5 A;  1T5X D;  3SDZ A;  1NTG A;  3V96 A;  3BDL A;  3PSI A;  3IRB A;  4R1J A;  1EL0 A;  1STG A;  4H0L C;  5DM6 3;  3JAM c;  4R4C A;  1FL0 A;  5M5W H;  2BCO A;  2NVQ H;  2R93 H;  3RD4 A;  4DV4 Q;  1EY6 A;  4A3M G;  3CHB D;  5C0X I;  2NN6 H;  2F0T A;  5C4J H;  4GN3 B;  5C0X H;  4HCE A;  2VQE L;  2B63 B;  1WTQ A;  5D65 A;  1B9N A;  2IHE A;  4RKB A;  4C3I H;  1JC7 A;  5FJ8 G;  2A73 B;  1V1P A;  5KYL A;  3QJY A;  4OHJ A;  4A3B G;  2H1E A;  4BBR B;  4IPC A;  3TP8 A;  4OO1 G;  2K52 A;  1EU3 A;  4XDX A;  2JA7 H;  1A6X A;  1K8O A;  4RGN A;  5LMN Q;  4K2L A;  4ZAI A;  2XTI A;  1Q12 A;  1EUJ A;  2UUC L;  2KEC A;  2K5V A;  3AYH B;  3KDF B;  1WTR A;  2E75 C;  2JXM B;  3GTP B;  4DNI A;  3MXP A;  4K6D A;  4HED A;  5HY6 A;  4B3S Q;  2Z8L A;  4FF2 A;  2HIX A;  2UU9 L;  2B2V A;  3RZO H;  1QVG A;  3G7L A;  3GTG H;  3CCV A;  1HFG A;  1SN8 A;  2WB1 B;  1E1O A;  3KF6 B;  1X32 A;  3CCS A;  5IWA Q;  4L5T A;  2EYP A;  4RFB A;  5M9O A;  1M90 C;  2ID0 A;  1EQQ A;  1Z47 A;  1CKO A;  4LFB L;  4HSV A;  3HS0 C;  1I50 B;  1Y1V H;  4A75 A;  3I4M B;  1RF2 D;  4DKA C;  2XVS A;  1ILQ A;  4A3G H;  4TKO B;  4N9P A;  1KDC A;  3NTI A;  1HA5 A;  3K59 A;  2LS0 1;  2R7Z B;  3I56 A;  2CWA A;  2Q8R E;  4QUC A;  2XWJ B;  3MAQ A;  4N8X 1;  5D3I B;  2NZO A;  4LUO A;  3OIP A;  3TZU A;  4GOP A;  3TS2 A;  4WFN 3;  2CH4 W;  4RAU C; 
#chains in the Genus database with same CATH homology
 1CQV A;  3VYR A;  2B2U C;  1V1P B;  1JOK A;  4XQQ A;  1HRJ A;  1U4P A;  2OF1 A;  3HZX A;  2E2I B;  1D5X C;  4ZKC B;  2CQA A;  4X3T A;  2E2J B;  2SNS A;  5CYU A;  5CV5 A;  2F3W A;  4QUF A;  1LAC A;  1LT6 D;  3FEW X;  4PNY A;  4XQN A;  3TP5 A;  2BA0 A;  3FKI B;  2PNR C;  3OWF A;  1MI2 A;  5LHY 1;  2JP1 A;  1RJT A;  1PZJ D;  1HQM C;  1TWG B;  2QIL A;  2LFN A;  2B2V C;  1X3P A;  3QB3 A;  4EGV A;  3NTK A;  4RWS C;  1SNP A;  1PRT F;  1AW7 A;  3J80 L;  1E2W A;  3C3L A;  2NWG A;  4GZY C;  5JEA J;  3EJI A;  2L5T A;  3KLS A;  1KLG D;  4DAY A;  1F77 A;  3NWT A;  2VUM B;  1QNU A;  1GUW A;  5EPK A;  1ESF A;  4BY7 B;  1JCK B;  1WTV A;  1BO0 A;  2F03 A;  1SSO A;  5C3W A;  1I4R A;  1Q1B A;  1VDZ A;  1TWC B;  5C5L A;  2KED A;  3Q6S A;  4FF4 A;  3A8K E;  2QDB A;  4RGO S;  2I07 B;  4RH6 A;  2K33 A;  2QEJ C;  4EQO A;  2Z4I A;  5E1F A;  3MTS A;  3GTQ B;  1V43 A;  1ENF A;  4NMZ A;  5LL6 S;  3R8B A;  1Y8N B;  3PO2 B;  2DY7 A;  3RMH A;  4IAL A;  2NZ1 D;  3MWY W;  2JSO A;  5ELD A;  2BDO A;  2EY5 A;  3BVZ A;  1E0B A;  5I2X A;  4MN3 A;  1ZKO A;  1SEB D;  3QWN A;  3UI2 A;  3ERQ A;  1PDQ A;  3DMU A;  5ELC A;  2WII B;  3T53 B;  3MHB A;  1Y69 U;  2EY2 A;  3Q0A A;  1F2M A;  5CGK A;  2FJ2 A;  3IL8 A;  4NW2 A;  2M9V A;  5AFW A;  4IUN A;  3LNN A;  1QOH A;  3S1Q B;  1GUG A;  2DNE A;  4DNT B;  5C0X G;  1EY7 A;  1UEA B;  2M2L A;  1XTC D;  4C3I G;  2GA4 B;  4R9W A;  2V4D A;  2RA4 A;  1H9R A;  2NVY B;  3V05 A;  1C4Q A;  3DUZ A;  4B08 A;  1B53 A;  1QB5 D;  5K5P A;  1D5Z C;  1WD0 A;  5KGU A;  4P2C B;  1FYC A;  3EQL C;  5IT9 E;  1I4G A;  3HEJ A;  4R8I A;  3SEB A;  3GTM B;  4FF1 A;  4XT1 B;  1GUS A;  1AN8 A;  4PQX A;  1SMY C;  1XXG A;  1NCV A;  5KYI A;  2JA5 B;  1B9M A;  4IUT A;  4C3J G;  1RD9 D;  1I4H A;  4E6I A;  2HUG A;  5A2Q E;  2CW0 C;  3C46 A;  1XWE A;  1HTP A;  1SYG A;  2JEA I;  4PMC A;  1R9T B;  2HCC A;  3URY A;  1W6K A;  2A6E C;  4HTH A;  1HUN A;  3WOF A;  3M4O B;  1AEX A;  4WRD A;  2KCC A;  3GV3 A;  2PYK A;  4F87 A;  4OO1 H;  4HCS A;  1FNW A;  2PMZ B;  1DOL A;  1JR0 D;  2PO4 A;  5IGD A;  3AU7 A;  4Q0F A;  2F0S A;  4FNF A;  4IN3 A;  3T13 A;  5C6A A;  3I8Z A;  1VMP A;  1EOT A;  1TKW B;  3OSO A;  4HMI A;  4K5W A;  1BDO A;  4C3H B;  3FRP B;  1JWU D;  5EBC A;  5I9P A;  3NHH A;  5ISR A;  4M8A A;  1RCV D;  1CFM A;  4DAV A;  1H9M A;  5T1I A;  2AQ2 B;  3BZD B;  4X3S A;  4ODG A;  1M8A A;  5I4D A;  5KIX A;  3GTL B;  3CQZ B;  3DWP A;  5IGG A;  1ZYR C;  2EY6 A;  2LKV A;  2A6H C;  4KKT A;  4QMG A;  3AMU A;  1SYD A;  2PZW A;  2RVL A;  2NBF A;  5C4X B;  2A69 D;  4C3J B;  1SJH D;  1SNQ A;  1JQY D;  2R92 B;  1U4R A;  5COY A;  3K5L A;  3ERO A;  3LWU A;  4K5V A;  1I4P A;  3EVQ A;  4V0B A;  5FO9 B;  3SE0 A;  1CZG A;  2NYZ D;  2B8G A;  3S9W A;  5C4Z A;  1J9O A;  3FDT A;  1I6V C;  2K7V A;  4TQU S;  1U4L A;  1LT4 D;  2F1M A;  4UAI A;  4IUP A;  1F2L A;  5F2D A;  3MXU A;  3PIO 3;  3KBG A;  2K03 A;  3ITP A;  3S17 B;  1JE4 A;  5C0X J;  4IFD I;  4IFD H;  3HRZ C;  4HR7 B;  1UUP A;  3FVQ A;  3S16 B;  2PW5 A;  4HN7 A;  3NSW A;  1ILP A;  2B2W A;  2K01 A;  1YNJ D;  5J39 A;  2KCN A;  5C3X A;  2EYJ A;  4NKL A;  2K05 A;  2RSO A;  3LX0 A;  4QB4 A;  1SYF A;  4XXE A;  1B4O A;  2NTT A;  4RA8 A;  5JPN C;  4CHT B;  5DNF A;  1O80 A;  1RKN A;  1NSN S;  2EYF A;  1JOQ A;  5JPM C;  1STN A;  1II3 A;  4MIU A;  3IFD A;  1KAB A;  3K0Y A;  4MHE A;  1TU2 B;  1GHK A;  1GOZ A;  1EY4 A;  3S2D B;  1IW7 D;  2KJX A;  1GHJ A;  2TMP A;  2VXW A;  1GUT A;  1IKL A;  3S1N B;  2KQ3 A;  1SYE A;  2BE5 D;  2F4I A;  2ICE C;  3C2P A;  2F0L A;  2K6A A;  1NUC A;  1Q1E A;  4A93 B;  2RDF A;  3E5S A;  4M1U B;  3VYS A;  4DU9 A;  1EZ8 A;  1TWF B;  3OHX C;  1QNK A;  3I3C A;  2EYL A;  4F88 A;  4CKE A;  1KNA A;  3J80 E;  1DCZ A;  2F0N A;  4JBW A;  2PCF B;  5FKA C;  3T56 B;  5IGB A;  3I4L A;  1KAA A;  1ET6 A;  1SJE D;  3RZD B;  3MC0 B;  2O2L D;  3MFY A;  2I46 A;  1SE3 A;  5KNB A;  3SK8 A;  3BG3 A;  1GUN A;  3K57 A;  1DON A;  1JWS D;  4FVM A;  3NPP A;  2K5W A;  4Y7N B;  3T51 B;  5EKL A;  2B2U A;  3FMC A;  4C1N K;  4DGZ A;  2IL8 A;  3A55 A;  5JJZ A;  1ZXT A;  3D31 A;  3D6C A;  2XNA C;  1QWY A;  1EYC A;  5IGF A;  5EPJ A;  1MSH A;  3C1E A;  1HPC A;  5IIF A;  3X3M A;  1LTT D;  2K28 A;  2Z4H A;  2M00 A;  3NXW A;  1HUM A;  4K8I A;  4L8J A;  3HG9 A;  4G7O C;  3HP3 A;  4FF3 A;  4IUQ A;  2NTS A;  1BUV T;  3MZ5 A;  2HQE A;  2D5D A;  3WDN A;  3TN2 A;  2EE1 A;  2F3V A;  3H6M A;  1CTM A;  1LV9 A;  3PUX A;  1S5B D;  2D2C C;  3SR1 A;  2K1B A;  1UNS A;  4J1M A;  4KK7 A;  2IW3 A;  4DFA A;  1S5E D;  4FXK C;  3KUP A;  2RDH A;  5C44 B;  1SE2 A;  1D1K A;  3J81 E;  1O7Y A;  2XRQ D;  4ZUI A;  1F9P A;  3M7N A;  1NR4 A;  5KND A;  3HOV B;  1O7L A;  2X6L A;  3R3O A;  2WP8 J;  3N6R A;  1YNN C;  4NDX A;  5D3D A;  2F0U A;  3KK7 A;  1S5D D;  1STE A;  5KEE A;  2EYO A;  2DY8 A;  4QF4 A;  3MA2 B;  4ZUJ A;  4A3E B;  2MPM A;  3VR5 A;  5CV4 A;  1MSG A;  1SXT A;  4K6L A;  3CRL C;  2KOL A;  2SOB A;  5J22 A;  3J7A V;  2KHS A;  3Q24 A;  3E6Z X;  2X6G A;  4IFD G;  1EY0 A;  4ZRZ A;  1FGB D;  4U68 A;  5C3E B;  1B2T A;  3M85 A;  3BVM A;  4F7X A;  4H13 C;  3L3O C;  5M5Y B;  4FYD A;  4PMW A;  3NBH A;  2A68 D;  2PZU A;  1QCB D;  3MFG A;  4FP5 D;  3IKJ A;  3OMC A;  3PIP 3;  2BOS A;  1F2Z A;  3C1F A;  2EJF C;  5A35 A;  1B3A A;  3NWS A;  3VA5 A;  2BA1 A;  5EPL A;  1ROD A;  5I6W A;  3BVG A;  4IUU A;  5EKI A;  1D1I A;  1H9S A;  3DEP A;  4TSS A;  1TII D;  1STA A;  2K32 A;  1IYV A;  1BCP D;  1G6Z A;  1OO9 B;  1LT3 D;  2H4O A;  1DXM A;  3S1R B;  3PMF A;  3OIQ A;  3I4N B;  1DJR D;  1Y1W B;  1Q8I A;  1TWA B;  4JK1 C;  3IFT A;  4CBV A;  2F0O A;  4RKL A;  1KDB A;  1QJO A;  4TRD A;  2Q8T A;  4CJ1 B;  3CRK C;  1X3Q A;  1PTO D;  5BN4 A;  1EWH A;  3A8I E;  1EU4 A;  1OXV A;  2BDN A;  2HDL A;  5CV8 A;  3GQB A;  3TBI B;  5CMD A;  1SE4 A;  4IUR A;  1LTI D;  4HSP A;  4X3U A;  4C3H G;  4C2M B;  1LLR D;  3U9O A;  2O5J C;  1H9S B;  3TME A;  2LMC B;  2KVM A;  3D4R A;  1MD2 D;  1WTW A;  4G57 A;  4YIJ A;  3J81 L;  2IWH A;  1PZI D;  4BBS B;  1I4Q A;  1B1Z A;  1D2B A;  3HKZ B;  4AYB B;  1DOM A;  1SAP A;  3NE5 B;  4EQP A;  5IOC A;  5CBA E;  2YYZ A;  4LK1 C;  1LAB A;  2Y0S B;  1AFP A;  5JVG 3;  1TY2 A;  3SVM A;  1CHP D;  5HGT A;  3RUZ A;  2O5I C;  2AWN A;  3NUC A;  2F0D A;  3MXG A;  4RHS A;  4L63 B;  2F0H A;  4XTC S;  3H3V C;  2WAQ B;  2XN9 C;  3OWE B;  5IOD A;  2EZV A;  4K8J A;  3W2D A;  5TSS A;  4IFD J;  3Q22 A;  5ELE A;  1IYU A;  1JB3 A;  1BNZ A;  2WAC A;  1RTO A;  1Y8O B;  5CBE E;  2G9D A;  1SDF A;  1WVL A;  1WTP A;  2TSS A;  1EY5 A;  2XSC A;  2RDG A;  3M3Y B;  1MGS A;  2RQX A;  1DM0 B;  3A56 A;  1QIL A;  2K5D A;  5DEH A;  1EYD A;  4KY7 A;  1A3V A;  1Q3L A;  1OXS C;  1ZEQ X;  3EA6 A;  4BA2 I;  3F2U A;  4G7H C;  4A3I B;  1SBB B;  2NVT B;  1WD1 A;  4IZ8 A;  4A3F B;  3PO3 B;  3DWA A;  1H9J A;  3WOE A;  1G8Z D;  3D3R A;  1T5E A;  4UDU C;  1HXY D;  5FO8 B;  5J1Z A;  2L9H A;  2K04 A;  4I65 A;  2B2T A;  3M4Y A;  3ND9 A;  5G3L D;  1Q90 A;  2NVQ B;  5M5W B;  2IX1 A;  1CM9 A;  2R93 B;  1B50 A;  4HMJ A;  1V8Q A;  2A69 C;  2IT1 A;  1PXU A;  3H09 A;  1SFO B;  3A7L A;  4LJZ C;  3KF8 A;  3DWQ A;  2MJ8 A;  2F0M A;  3VR4 A;  5D14 A;  1BR9 A;  3T4A C;  2CHB D;  3VYT A;  1Y8P B;  2JA7 B;  5BN5 A;  2VB2 X;  3VA7 A;  2ENB A;  3QOL A;  4J8Q A;  1LTS D;  3VR3 A;  1H9K A;  3JAM E;  3A8J E;  3PUW A;  4DK1 A;  5FLX E;  4KV6 A;  2C5C A;  5EBD A;  1Z6H A;  1L0X B;  3RZO B;  2JEB I;  3GTG B;  3KBX A;  2E74 C;  1SNC A;  1DZ1 A;  4RGM A;  1QG7 A;  1AZP A;  2CVR A;  1LTA D;  1YNJ C;  1E2Z A;  1Y1V B;  5FO7 B;  4A3G B;  1FNU A;  5ELF A;  1TS5 A;  3TZD A;  2XIW A;  1ONL A;  5K36 H;  2B2T C;  4QCL A;  2D62 A;  5IGE A;  2EJM A;  2WKD A;  2SDF A;  4DN4 M;  1HHV A;  1UAP A;  1IW7 C;  2F0F A;  1LO5 D;  1TT2 A;  2R6G A;  1RTN A;  2L4N A;  3NP8 A;  2BE5 C;  3S14 B;  1CQF A;  4DNR B;  4KHZ A;  4O1N A;  1JOO A;  2O4X A;  1R4Q B;  3N52 A;  2R3Z A;  3A54 A;  1G29 1;  4V19 0;  1WTO A;  3DXJ C;  3HOW B;  1V1O A;  3K5N A;  3FPP A;  4KTA A;  2AUJ D;  2VB3 X;  3GTK B;  1A15 A;  4ZLT F;  4KMU C;  3GD7 A;  3CU7 A;  5DAU A;  3OW7 A;  1D6E C;  1ML0 D;  1S5C D;  4ZKB B;  2MGS A;  1C8C A;  1JOR A;  4OL7 A;  4WJW A;  5LL6 X;  1TR5 A;  1A3U A;  1GXD C;  2RBM A;  2MUY A;  1A3T A;  3D8G A;  3QIA A;  4OIJ A;  1FNV A;  2F0I A;  1M4V A;  1FD7 D;  4ID6 A;  1LTB D;  4XIG S;  2JE6 I;  1EEF D;  4U67 3;  4A3K B;  1PRT D;  4RCO A;  1VF7 A;  1DOK A;  2ZXO A;  3D6W A;  3J7Y W;  1S5F D;  4RCN A;  1LTG D;  1WCM B;  5E4X A;  3HOY B;  3I73 A;  1BQQ T;  2NN6 I;  3E0J A;  1PYW D;  2XWB B;  3BS1 A;  3ONA B;  2QKI C;  1QE6 A;  4PMB A;  3JAM L;  1CA6 A;  4A3D B;  3S1M B;  4BWG B;  5FLX L;  5M3F B;  2PW7 A;  3QG1 A;  2B2Y A;  1U4M A;  4XYQ A;  5EGT A;  2L0C A;  3OOC A;  1ET9 A;  5ELB A;  1TS2 A;  5M3M B;  4H7B A;  1F9R A;  2QCP X;  3L9A X;  3SK6 A;  4ZYS A;  4FO2 A;  4Q5V A;  5E4W C;  2L12 A;  3K7A B;  3MXN A;  4DK0 A;  2F0W A;  3NTH A;  2L11 A;  3P1H A;  1ENA A;  3PV0 A;  4K5X A;  2F0K A;  1L0Y B;  2AWO A;  3I70 A;  2JA6 B;  3TDQ A;  5JVH 3;  2SNM A;  3EFX D;  4Z9C B;  2X69 A;  4ABN A;  2B8F A;  2FMM A;  2C9O A;  4KKU A;  4G4K A;  1CA5 A;  3GP7 A;  4IUV A;  1EFI D;  3IAY A;  4RGT A;  1KTK A;  2WIN B;  5IGC A;  2F0Q A;  3ZYY X;  1JIC A;  1S4Z A;  1E2V A;  3AB9 A;  1F9S A;  2L55 A;  3X3N A;  3I72 A;  1PFB A;  5HUR A;  2Q8I B;  4A3M B;  2B2Y C;  2E2D C;  2FFK B;  1PZK D;  1YNN D;  4X3K A;  4XQJ A;  1PFM A;  2A68 C;  4CJ0 B;  1PMR A;  3H91 A;  2VNU D;  3OPO A;  4NP5 A;  1SYC A;  2PPB C;  4A3B B;  1BXT A;  1CT1 D;  4PV1 C;  2ICI A;  3BYT B;  5K36 G;  1SYB A;  3K58 A;  1BCP B;  5FK9 C;  1EQV A;  4RHR A;  3NQI A;  2FHT A;  4I7Z C;  3VR2 A;  1F2Y A;  1ICW A;  1AZQ A;  1BCP C;  1VF5 C;  2HCI A;  3MEH A;  5T1G A;  2R61 A;  3P75 A;  5NUC A;  5BN3 A;  4CKC A;  3PUV A;  2DNC A;  1CZW A;  1OXT A;  4DF7 A;  1SNM A;  4LMQ D;  1U9R A;  2Z1C A;  1PTO B;  1CK1 A;  3KLS X;  3M7G A;  1EQT A;  4G7Z C;  5CC4 A;  3L7Z C;  2NB0 A;  1PTO C;  2JA8 B;  2ZXP A;  2EY1 A;  1JWM D;  4CKB A;  3RLF A;  5EJW A;  1AP0 A;  4N9T A;  2D9U A;  1PFN A;  3HOX B;  3SK4 A;  3HOZ B;  4EQN A;  3DM1 A;  3FPU B;  2EYH A;  2E76 C;  1GJX A;  1VCI A;  1EWC A;  2WV6 D;  4O42 A;  5CR3 A;  2F0P A;  1LTR D;  4KD3 A;  4DXG A;  3G6J B;  1NR2 A;  1O7Z A;  4WOR A;  1TS3 A;  4KD4 A;  5EQ0 A;  1TS4 A;  5I9O A;  1KDA A;  3SHL A;  1EY9 A;  2KEE A;  3KLR A;  2F0J A;  3O13 A;  2NN6 G;  2ZT9 C;  2EYM A;  2J4X A;  5CV9 A;  4XT3 B;  3SXH A;  4KY5 A;  3I90 A;  2F0E A;  1XX8 A;  3K5O A;  2F0V A;  4J6H A;  1GUO A;  4KN4 C;  2AQ3 B;  4R8N A;  3D4D A;  4KHV A;  3R2T A;  3DEO A;  2OXP A;  1DD2 A;  3PUY A;  3D4W A;  2A5H A;  4H44 C;  3NBI A;  3U9S A;  3VYU A;  5JEA H;  3ND8 A;  1IKM A;  1I6H B;  5C4H A;  2EDG A;  5JOB A;  3P7J A;  2LY7 A;  1C48 A;  4DA2 A;  4A3J B;  2RKS A;  2YU9 B;  2NVX B;  2E2H B;  1SMY D;  1HQR D;  1K8M A;  1EIH A;  1I4X A;  1TWH B;  1STY A;  1Z7T A;  3HOU B;  3R93 A;  2CW0 D;  5CV6 A;  3S2H B;  2N55 A;  1STH A;  1BCP F;  1LT5 D;  2K5Q A;  2OEO A;  4ILW A;  5KNC A;  1A2T A;  2F0G A;  3S15 B;  2OT2 A;  4OO1 I;  4KN7 C;  2KUM A;  5EKK A;  4C56 C;  2EXZ A;  1ENC A;  2A6E D;  3A7A B;  1A2U A;  4ULL A;  1OXX K;  3J7A F;  5DM7 3;  1R4P B;  2N88 A;  1EYA A;  1NAP A;  3TSS A;  5M5X B;  3QOJ A;  2WKC A;  1EZ6 A;  5C5M A;  4FXG C;  1PTO F;  3CKI B;  2AQ1 B;  1FR3 A;  1HCZ A;  2EJG C;  3LWE A;  4CGY B;  5C4J B;  2J0T D;  4C1N I;  4B9W A;  3I91 A;  4C3I B;  1KLU D;  1PTO H;  1ESR A;  1CI3 M;  1TVX A;  3MVV A;  1PLF A;  4KI0 A;  1EIG A;  2KA7 A;  1BF4 A;  5KRU A;  1RDP D;  2JYO A;  2IJ0 A;  3PUZ A;  3V2T A;  5COR A;  4DXF A;  2A74 C;  1BBX C;  1IL8 A;  3GTO B;  1ZYR D;  2XRS D;  4F8M A;  4L6T B;  2A6H D;  2B39 A;  2FMC A;  4KJN A;  3P20 A;  1IHZ A;  2L1B A;  1RHP A;  3H0G B;  1WTX A;  3DHQ A;  1EY8 A;  2ZXR A;  5E3F A;  4CJ2 C;  2NUC A;  1XYI A;  3NQT A;  5I6Y A;  3W3A A;  4OGQ C;  1STB A;  1EEI D;  5FOB B;  2DN8 A;  4IQZ A;  4K14 A;  5JAV A;  1G2S A;  1F9Q A;  4S3S A;  3Q23 A;  2EPB A;  2MP1 A;  3BDC A;  3NK9 A;  1KNE A;  4HAE A;  4FXD A;  1TQO A;  4KJO A;  1K83 B;  4B9X A;  3K6O A;  4K2K A;  4BY1 B;  2RSN A;  2SEB D;  3VR6 A;  2IPK D;  2MHV A;  5IT9 L;  4ZK9 B;  2IX0 A;  1G91 A;  3HGB A;  3BDO A;  4XYO A;  3SK5 A;  3QO2 A;  1HA6 A;  5A2Q L;  4LAA A;  4ZQ3 A;  1BOS A;  2HDM A;  1J8I A;  3OMG A;  1HTL D;  1W6J A;  4BA1 I;  2IX3 A;  3TP6 A;  1SND A;  1D5M C;  3GTJ B;  5CV7 A;  3T16 A;  2AUK A;  4QIW B;  4KKS A;  5G3L F;  3R2I A;  2EOT A;  1MBY A;  1G2T A;  3TP7 A;  1CHQ D;  1PRT B;  1I3Q B;  4ME5 A;  4KY6 A;  5I2Y A;  3K5M A;  3BYY B;  2PZT A;  2QF7 A;  4BS9 A;  2J7Z A;  1O78 A;  1VMC A;  2FIN B;  1OXU A;  4EVO A;  1PRT C;  3GV6 A;  2PQE A;  1HFN A;  2EVB A;  2B2W C;  2G9H D;  5JEA G;  1TY0 A;  1B44 D;  4OIK A;  1SNO A;  3H94 A;  4DAP A;  1DYQ A;  3GO5 A;  1T5X D;  3SDZ A;  3V96 A;  3BDL A;  1EL0 A;  1STG A;  4H0L C;  5DM6 3;  2BCO A;  3RD4 A;  1EY6 A;  3CHB D;  5C0X I;  2NN6 H;  2F0T A;  5C0X H;  4HCE A;  2B63 B;  1WTQ A;  5D65 A;  1B9N A;  4RKB A;  1JC7 A;  2A73 B;  1V1P A;  5KYL A;  3QJY A;  4OHJ A;  2H1E A;  4BBR B;  3TP8 A;  4OO1 G;  1EU3 A;  4XDX A;  1A6X A;  1K8O A;  4RGN A;  4K2L A;  4ZAI A;  1Q12 A;  2KEC A;  1WTR A;  2E75 C;  2JXM B;  3GTP B;  3MXP A;  4K6D A;  4HED A;  2Z8L A;  4FF2 A;  2B2V A;  3G7L A;  1HFG A;  2WB1 B;  1X32 A;  2EYP A;  4RFB A;  5M9O A;  2ID0 A;  1Z47 A;  4HSV A;  3HS0 C;  1I50 B;  3I4M B;  1RF2 D;  2XVS A;  1ILQ A;  4TKO B;  4N9P A;  1KDC A;  3NTI A;  1HA5 A;  3K59 A;  2LS0 1;  2R7Z B;  2Q8R E;  4QUC A;  2XWJ B;  3MAQ A;  5D3I B;  3OIP A;  3TZU A;  4WFN 3;  4RAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...