2F0SA

Crystal structure of staphylococcal nuclease mutant v66l/i92v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0sA00
4K2LA 4MIUA 5KEEA 4K14A 1SNOA 4ID6A 1TR5A 4J6HA 4QB4A 5CV7A 1SYBA 3MHBA 3D4WA 2F0QA 3QOJA 4ZUIA 3U9OA 2EY6A 3OMGA 4QF4A 4EVOA 5HURA 5CV6A 3LX0A 3TP5A 5HGTA 4B9XA 2PW5A 3VA5A 3SXHA 3R3OA 2F0WA 4S3SA 5KIXA 2F0PA 5J1ZA 3EVQA 3SK6A 2EY1A 5IIFA 2F0NA 1SNPA 4K8IA 4OL7A 2PYKA 2F0MA 2KHSA 5JOBA 4DF7A 5ISRA 5EKLA 1EY7A 3D4DA 5C6AA 3HZXA 1KABA 1F2ZA 5CV8A 3T16A 1SYFA 5I9PA 2EYJA 1SYGA 1EY4A 1U9RA 1A2UA 4LAAA 4F8MA 1JOQA 3D6CA 2F0OA 1EY8A 3NK9A 5E1FA 2SNMA 4RKBA 1RKNA 2SOBA 2NUCA 4KY6A 4H7BA 5IGFA 1TT2A 4K2KA 1EY0A 1SNQA 2F3VA 3QB3A 2F0UA 1EZ6A 1JOOA 2F3WA 2F0IA 4PMBA 4NDXA 2F0FA 5C5LA 2EYPA 2OF1A 4PMCA 1SYEA 1A3VA 2EYOA 2KQ3A 2SNSA 4KJNA 5KYIA 5M9OA 3DHQA 4KD4A 5IODA 4E6IA 1II3A 3PMFA 4NP5A 4QMGA 4TRDA 1NSNS 5IGCA 1A3TA 2O4XA 2RDFA 2EYHA 5I6WA 5CV5A 3SK4A 3SK5A 1EYCA 2QDBA 4NMZA 4KJOA 1STGA 2F0TA 4ODGA 3TMEA 2M00A 4K8JA 2F0EA 4KD3A 5IGGA 4WRDA 5NUCA 4KV6A 2PZUA 4R8NA 1F2MA 4EQOA 1A2TA 2F0GA 5K5PA 1IHZA 2PZWA 1F2YA 4G57A 2EYLA 5C5MA 5C3WA 5KGUA 1KDAA 2EY2A 5DEHA 5EGTA 3QOLA 2F0KA 4J1MA 3DMUA 3MEHA 2WACA 4HMIA 5C4ZA 3HEJA 2EYFA 3OWFA 3MVVA 1EY9A 4IALA 4WORA 4HTHA 3NUCA 4N9TA 5E3FA 4ZUJA 3S9WA 5IOCA 4IZ8A 4K5VA 4ZQ3A 2RBMA 5I6YA 5IGBA 5JAVA 4EQNA 3H6MA 4NKLA 5CV4A 3D8GA 3MXPA 4PNYA 3BDCA 1ENAA 1EYAA 1NUCA 4K5WA 3ERQA 4EQPA 4YIJA 1EY5A 5CR3A 5CGKA 2OEOA 3SHLA 1AEXA 2HQEA 4RKLA 4KTAA 2F0SA 5C4HA 2LKVA 4IUNA 1A3UA 1EQVA 3MZ5A 4KY7A 2F0LA 3TP8A 3NP8A 5KYLA 1SYDA 1STNA 2EY5A 3P75A 4KHVA 3TP6A 4DU9A 3OSOA 2F0DA 2RKSA 5IGEA 1EYDA 3EJIA 5CV9A 1SYCA 3EROA 3SR1A 2PW7A 1STAA 2PZTA 2ENBA 1ENCA 1STYA 4I65A 1JORA 1KDCA 1SNDA 5KRUA 5I9OA 3C1FA 3P1HA 2OXPA 1SNMA 2PQEA 1STBA 5DAUA 1JOKA 5F2DA 1KDBA 2F0JA 3BDLA 1TQOA 3RUZA 3TP7A 1EZ8A 3T13A 5EKKA 1EY6A 3C1EA 4DFAA 4DGZA 4F7XA 4B9WA 4K6DA 5IGDA 4KY5A 1STHA 3SK8A 2F0VA 5C3XA 4HMJA 3OMCA 1SNCA 4ME5A 5J22A 2EYMA 4K5XA 3ITPA 3E5SA 5J39A 3NXWA 3V2TA 1KAAA 2EXZA 2F0HA 4N9PA 3NQTA 5CC4A 3NHHA
chains in the Genus database with same CATH superfamily
4UHVA 4K14A 1X6OA 3KK7A 2DY7A 3RZOH 1XJVA 2A1AA 4EVOA 1LM0A 2PW5A 4A3EH 2F4VL 1SN8A 2Y0SE 3R3OA 1GJXA 3CF5A 2QCPX 4FVMA 4DV1Q 1LYLA 4LNQA 2L55A 2BDOA 3T16A 1P16A 2EYJA 3R2IA 1VQFA 3T53B 3J81L 4WJ3M 4FXGC 1YNJD 4A3MG 2SNMA 3DWPA 5BN5A 3UE1A 2B3GA 3H0GH 3F2BA 3IAYA 5EPKA 5C5LA 2NVYB 5FLMG 3L2PA 3DLLA 5IGCA 1UE5A 2MPMA 2J4XA 2R92G 2DY8A 1PTOD 5IE8A 5IYDH 4L5TA 2I5HA 4DV5L 4TQUS 1D1KA 1E24A 4MTNA 2HT1A 3AQQA 3M7NA 2O2LD 1Y1WG 1O80A 4CJ2C 1D5ZC 4R4OA 1PRTF 1HA6A 3V05A 2KA7A 2B29A 2G9DA 2L11A 1IZ6A 4ILWA 3TSSA 1SSOA 1TWAH 3TREA 3KFUA 1UUPA 2NWGA 4IZ8A 2KCTA 3S1MB 1N33Q 1X9NA 4QIWB 4PNYA 3SDZA 1ASZA 4R9WA 3SHLA 4CJ0B 5KYLA 1SYDA 2HIVA 2XRSD 4ULLA 4IPCA 2UXCQ 2Q2IA 4C3JG 1Y8NB 1IYVA 1YBYA 5IYCG 5L37A 3SR1A 4DR5L 3M3YH 3MC0B 5BN4A 4Y7NH 4BBRG 2PQEA 1PLFA 3H94A 3BU2A 1PV4A 3PO3B 1DJRD 1M4VA 2BA0A 2ZTCA 3M4YA 3G6EA 3M4OH 3KLSX 1LTLA 1Z7TA 1DGSA 5C3XA 3C46A 4A3BH 4LF6L 3J81c 5J39A 2DJGC 4HIDA 1GUWA 3MXUA 4JI0L 5CC4A 2NZ1D 4MIUA 1GHKA 1X3FA 4XDXA 4R4CA 2R7ZB 5CV7A 3L0OA 2UXDL 2Y0SG 1Q3LA 2B2WC 3U4ZA 4DV0Q 3NBIA 3W1GA 4LF9Q 5AJ3Q 1AE3A 1HH2P 1N34L 4R4QA 2WKCA 3I56A 3D4DA 5CV8A 1S40A 4J8QA 1Q7YC 2N8NA 4DR4Q 3QIAA 2F0OA 1Q90A 1VQJA 2GA4B 1Z9FA 2R6GA 1SE4A 2C35B 3TN2A 1RHPA 2B39A 1G291 4DPGA 2F3VA 4YY3Q 1B4OA 1E0BA 1F9SA 2HDLA 3CD6A 2KJXA 4C1NI 1VQ7A 1Z47A 1D5MC 5C4JH 5ELEA 4IFDG 3T56B 1TWHB 3VYUA 4C56C 5GAHC 1YHAA 1PRTD 4NMZA 4QGUA 3J7ZC 2F0EA 4DR1L 1I4HA 1I6HH 3DEOA 3ZJYC 4A3IH 1XPUA 2HHHQ 4J15A 1IYUA 1F2YA 1B8AA 2BA1A 2ALYB 2CVRA 3HOZH 1X32A 4L5SA 1CTMA 1LLRD 2EYFA 3S17H 1HR0Q 2L1BA 4HCEA 1U4RA 1Q1EA 3CHBD 3DWQA 4OWWB 3FEWX 1QG7A 4OELB 2K5DA 3H6MA 4PQXA 2JA6G 3MXPA 1BCPF 3QR8A 4DR7Q 1FNVA 3HOYB 2MUYA 4YIJA 3LGJA 4CBVA 3W2DA 4Q5VA 5CGKA 2A6ED 3T1HQ 3DEPA 1A3UA 2RCFA 2F0LA 1CQFA 1I6VC 2O5IC 4RGTA 2Q2HA 2K5QA 3RLFA 3EROA 1S3OA 1J9OA 1DONA 5C44H 3T1YL 2LXJA 2D0OA 2F4VQ 3RUZA 1LUZA 3S24A 1VQ9A 1F9PA 1H9SA 1TS4A 3M4PA 1S4ZA 4X65Q 4O1NA 4HJ5A 4X3KA 4K0KL 4ME5A 1EEFD 1PTOH 1Y8PB 2K5HA 2D2CC 3HG9A 1V8QA 1Q46A 2KECA 1TR5A 1AN8A 2JP1A 2LMCB 4X62L 2XTIA 1H9SB 1H9RA 1XPOA 2IWHA 5JEAH 2XGTA 4AYBB 1X3GA 2B8GA 2A68D 3K5OA 3CU7A 2PO4A 4ABNA 1DZ1A 5C6AA 4JI5L 2P5ZX 2MO0A 3ONAB 4IO9A 4XQJA 3D6CA 4LFBL 3PO2H 5D65A 5M5XH 2VS1A 1LTGD 4EGVA 4H7BA 3VDYA 4RHSA 1BBUA 1GO3E 1VCIA 3FDTA 1O7IA 2MQHA 2OF1A 1SYEA 1XPRA 3MFGA 1J6QA 5KYIA 1OTCA 1JWSD 1NSNS 1A3TA 1CT1D 1LTAD 2MFIA 2Z8LA 1VQOA 2UU9Q 1B1ZA 4LJZC 2BE5D 1IYJB 4YWKA 1DYQA 4A3KB 1EU4A 1JE5A 1E22A 3R2TA 1A2TA 1Q8IA 2HIXA 1XYIA 1E2WA 3U58A 4HSPA 4Y52H 1B9NA 3DMUA 1VQCA 1G6ZA 5FLMH 3O13A 4DN4M 3BZDB 4K5VA 4A3JH 3GTLB 4NKLA 1A62A 1H95A 4EQPA 3CQZB 2HD3A 4LF7Q 2CW0C 2LY7A 2KHJA 4X64Q 4GOPA 4LF6Q 2UUAL 5JPMC 4LF5L 1HUNA 1STNA 3E3XA 4R8IA 1Y1WH 1ZEQX 1I4PA 2KCMA 4ZK9B 1PZJD 3VR2A 2RKSA 1PYWD 1ET9A 1VDZA 2YU9B 3GTKB 1PYBA 3S2HB 4LF4L 1KDBA 1TWFB 1IXRA 1K3BC 4LF8Q 1JWUD 4R4TA 4GOPB 2E2HB 3H15A 1N34Q 3KOJA 1MHWC 2XIWA 1KNAA 1MGSA 2A5HA 2OQ0A 2F0VA 4G7OC 1BO0A 3ITPA 4K5XA 3V96A 2B63B 1R4PB 3CC7A 2K05A 2TSSA 4C3IB 1QCBD 4XQQA 1EU3A 3OMGA 1G8ZD 5HURA 5CV6A 1QUQA 2PQAA 5J1ZA 1CM9A 2NVTB 3SK6A 2K75A 1YJWA 4ZKCB 2F0MA 4EX5A 3CP0A 3HZXA 4WJWA 3JAMi 4A3LG 1PH5A 1B3AA 5GAGC 4FF4A 3S1RB 3HKSA 3KJOA 2SOBA 4DUZQ 1ILPA 4A3CH 4JI6Q 1QUQB 2PQAB 4IUTA 5LL6S 3HFZB 2OWOA 3HKZE 4KJNA 2F4IA 3PF4A 1MIUA 4B3TL 3U9SA 4DK6C 1MBYA 2O4XA 3PO3G 5I6WA 1FVIA 5D14A 4C2MB 4KHZA 2SDFA 3TS0A 4FF1A 2QDBA 3FRPB 1CFMA 3J80i 5M5WB 4MNOA 4GN4B 5DLQE 2H5XA 2N49A 1FJGL 1IW7C 1WCMH 2KEDA 4O42A 4F88A 2KBNA 4DNRB 5JJKA 5C5MA 2EYLA 3K58A 1KNEA 3CMAA 1JJ2A 5IYBG 2R7ZG 2RDGA 2F0KA 5C3EB 4XT3B 3AFPA 5LMUQ 3NUCA 4ZRZA 2A6HD 3L3OC 5ELNA 4PV1C 2LS01 4DV1L 4DV2L 2AMCB 4CKBA 3G6JB 1LV9A 3GTOB 5CR3A 2IW3A 3GQBA 2DNEA 3TZUA 4KTAA 5IGBA 2LKVA 3ND9A 1FGBD 2WV6D 3P75A 2RDHA 3OW2A 4X3SA 1G91A 5CV9A 1WTHA 4L5RC 4GOPC 1YNXA 1MSGA 3FP9A 3T4AC 2QILA 3E6ZX 1SNMA 3TS2A 1BF4A 1EZ8A 2G5DA 4A3GH 3K80C 2Z4IA 4B9WA 1HZ9A 3HOVH 3KLWA 4UP9A 3CW2C 4C1NK 3A5UA 1PFMA 1KRSA 1VS0A 1UWVA 2F0HA 5EPJA 2B2UA 3D6WA 4A3FH 1WTWA 4K2LA 1I94Q 4NB3A 2L9HA 3A5ZB 1SFOH 1EFID 3VA7A 1CKNA 1IKMA 1EIFA 1LABA 1Y1VB 3NE5B 2B8FA 4PZ8A 1RIPA 2EJMA 2F0PA 3EVQA 1N33L 2F0NA 2ICEC 3EA6A 4JK1C 3IFTA 5EKLA 2JJQA 2K4KA 4FNFA 1CA6A 1S5ED 3HOYG 1LO5D 3I73A 3VR4A 1U9RA 4F8MA 3LNNA 5IT9c 3J7YW 1PH8A 2UXCL 4HIOA 1BR9A 3HKZG 3M7GA 5I4DA 1CKNB 3J81i 4B3RQ 2VXWA 4I7AA 4K2KA 4DNIA 1K8OA 1PH7A 1R9TB 4HR7B 3BVMA 1B2TA 4G4KA 4QUFA 5JEAJ 3NEMA 5FO9B 4XYQA 3MAQA 2WFWA 1JC7A 2EYHA 1K83H 3D31A 2JA9A 2K5WA 1QJOA 1O7ZA 2PZUA 2YYZA 2F0GA 1BQQT 2EY2A 4HSVA 4DV0L 3LWEA 3OPOA 3U50C 4LF9L 4LFCQ 1UEBA 2WACA 2Q2TA 5AJ3L 4LFAQ 4A75A 4BY1B 4ZQ3A 1HQRD 4CDDC 1HZBA 5C0XG 3PQIA 4AYBG 3S1QB 1G6PA 5C4XB 1TWCB 4P73A 1CA5A 3E9HA 1JQYD 5FLXE 3J81j 4DR4L 3MZ5A 1ZKOA 4N8X1 3CPWA 2A8VA 2R93B 2VUMG 2A69C 3RMHA 3GTMH 2Q8RE 2F0DA 4JV5Q 1PTOF 3W5OA 4YY3L 1STAA 1BCPB 4NXNQ 3PUWA 1EWHA 4JI4Q 4B3MQ 2K01A 2JA7B 2F0JA 3WWVA 2UUBL 3H3VI 5M5YB 3SVMA 3C1EA 2AHOB 2E5LL 4ZLTF 3HP3A 3NTKA 3G48A 2D62A 1VF7A 1SRUA 3V2TA 3GTJH 3HOWH 1ICWA 4JI3L 1CZWA 1O7LA 4ME3A 1S5BD 2HHHL 1SNOA 3IRBA 5TSSA 1K8AC 1Q82C 3MHBA 1B50A 3TEHB 3HOXB 1EQRA 2AWNA 2B2UC 2QF7A 4BXXH 1XMQL 1G51A 4L5QA 3OW7A 4AQYQ 1V1OA 2PYKA 2KHSA 4DR7L 1EY7A 1N32L 5FLXL 1RCVD 1V1QA 3PCOB 1PH2A 1N9WA 1HZCA 1GD7A 1FJGQ 4CHTB 4ALPA 1YEZA 3F1ZA 3H91A 1SMYD 5GQOA 3I4NB 4LUZA 3M4QA 4PMBA 3FKIB 1IL8A 1WD0A 3RNUA 2PI2A 4X65L 3J80c 2IX1A 4JI1L 4RGOS 4GZYC 3BJUA 5G3LD 4DV2Q 2EPBA 2XRQD 3UI2A 1RF2D 3DUZA 4IPDA 3A7LA 2B63G 5K5PA 3HOUB 2XNAC 4C3IG 2EOTA 1QVFA 3OWFA 3PGZA 1SDFA 1YI2A 2A74C 4H13C 2QEXA 5E3FA 1QILA 3S1NB 5JAVA 5I6YA 3PIO3 3PO3H 2EE1A 3ERQA 2Q8IB 2NVQB 1E7ZA 3MXGA 1F2LA 4QCLA 1WOCA 1ESRA 5JVG3 4PZ6A 1K0RA 1D5XC 2E2IH 1DOKA 1LTTD 1I50B 3K0YA 1EOVA 3KF6A 1YHQA 2N3SA 4C3HH 1YIJA 2E75C 4H44C 2R3ZA 4R1JA 1NMFA 2WINB 2UU9L 4IFDJ 2CH4A 2NTTA 2VZAA 4MTKA 1VMCA 2Z9HA 4DAMA 2ATWA 4GKKQ 4BY7B 3NWSA 1S5FD 3KF6B 3CCJA 3AEVA 3PUVA 1NCVA 5JPNC 4CGYB 1OXXK 3FPUB 1TS5A 3K7AH 4XXEA 4Z9CB 4DAYA 2WP8J 5M3MH 1U4LA 4RGMA 2JA8B 1X56A 1HFNA 4JI8Q 5C3EG 2F0WA 4S3SA 2K14A 4P71A 5D3IB 1VQEA 1MKHA 2Z6BA 4HJ7A 3KYHC 4LF7L 1TWHH 4X64L 1A2UA 1L1OA 1VQ8A 3GTGH 4DAYB 1VQIA 3NPPA 4HJ9A 2NUCA 2FMMA 1VQGA 2DGYA 1SNQA 3NWTA 2IX3A 5IP9G 2PNRC 3DWAA 3S15H 3U4VA 3Q24A 4AH6A 1DM0B 4LF8L 3N6RA 3I4MB 4RFBA 3EIVA 4WFN3 4P2CB 5DM73 4JBJA 1XTCD 4P75A 5DNFA 1PH4A 1JJGA 3HOYH 2X6LA 4WRDA 4P72A 3SE0A 4G57A 5KGUA 3A55A 1BVSA 1TWAB 3GTQH 2PNHA 2IHEA 1O78A 3HEJA 3RZDH 3W3AA 1H9KA 3WOEA 2RA4A 3BZCA 2EDGA 1W3SA 2NZHA 5JJLA 1Y1VG 2UUBQ 3MTSA 3X3MA 3KLSA 1D2BA 1EIHA 1W2BA 5EBDA 2JEAI 2E5LQ 4DV3Q 3BVGA 3K59A 4IUNA 1EQVA 3CRKC 1DOMA 3URYA 4DV6Q 4DUZL 4PZ7A 4A93B 4JI3Q 4JI6L 3S14H 2H1EA 3EJIA 1CK1A 4Y7NB 2IX0A 4JPBW 2NTSA 2QW7A 3HGBA 5KRUA 1SBBB 1WTOA 2MO1A 1IBLL 1HTLD 3TQYA 1XMQQ 3T13A 4A3BB 2A73B 3S2DH 4YCWA 4F7XA 5IGDA 3TDQA 1N32Q 2VB2X 3TRZA 4O2DA 2EYMA 1Z6HA 1GUSA 2VUMH 2GVAA 3I4OA 3BG3A 1JE4A 4JVZA 4JYAL 1VF5C 1QVCA 1QB5D 2A69D 4BBSH 4WJ4A 2MHVA 3P7JA 2EZVA 3VYRA 4KKSA 4GLXA 3LX0A 5LMUL 4IPHA 1S5CD 1W6KA 2EY1A 4KHPQ 5D3DA 4JI1Q 1B9MA 1SYFA 2D9UA 2AQ1B 1H9JA 1V1PA 5GAEC 1A6XA 1DCZA 3EBEA 2EXDA 4RKBA 5M3FH 3AYHB 1NR2A 5IP7H 1EY0A 3QB3A 1JOOA 3GP7A 2F0FA 2K5VA 5C4JB 1NAPA 2BH8A 5KNDA 2X6GA 1KIXA 4POGA 1VQMA 3IL8A 2RDFA 3E0JA 3ULPA 2JA5H 3GTLH 2QDLA 1AE2A 3SK4A 1EYCA 1I4GA 1XX8A 2WB1B 5JJZA 1I6HB 1ONLA 4A3IB 1U5KA 1PA6A 3MA2B 2L0CA 4DKAC 3NTIA 3BVZA 5EKIA 3HOZB 1I94L 4QIWE 3CXCA 2H4OA 1FGUA 5C3WA 3S17B 1PDQA 3QOLA 5ELOA 1HUMA 4WORA 3HOXG 5T1GA 5CBEE 2E2DC 3D4RA 1SLJA 2OCEA 1H9MA 4EQNA 1TWFH 2YTYA 1QNUA 1C0AA 5HY6A 1NTGA 3KJPA 1TY2A 5CORA 4OXPA 1IKLA 3I4LA 1VQNA 4CDCC 3H3VH 4B3RL 4A3DG 4DK0A 2LSSA 1XNRQ 3OSOA 5C44B 2OT2A 3K57A 4A3MH 1L0WA 1EYDA 3D3RA 1R4QB 2E2JH 3PIPA 1RTNA 4GNXA 5FJ8G 1VMPA 4C3IH 2O5JC 3Q8DA 3I4NG 1MJEA 3R8BA 5IWAQ 3FKIG 1KAWA 4L8JA 5FOBB 3G71A 3Q22A 2R92H 1X3QA 4K6DA 2K04A 2PPBC 1PTOB 1C9OA 2EVBA 5K36G 5J22A 1PMRA 2ZJPA 4XTCS 1N8RC 1MD2D 4GNXB 4OO1G 3RLOA 1NJIC 1S5DD 1JOQA 5GADC 3NHHA 5E1FA 1TS2A 4G7HC 1SE3A 5COYA 3EFXD 2KCNA 1QZGA 3D4WA 3QOJA 3U9OA 3HOUG 4TVAB 4LFCL 4IUPA 3BZKA 3NSWA 2CWAA 4LUVA 4KN4C 2AQ3B 4LFAL 4ZCKA 1O7YA 3PF5A 3GTPB 3K7UC 1CUKA 1F2ZA 2Z4HA 3PO2B 5M5XB 2CFMA 2AKWB 4DR2Q 5CBAE 2ES2A 1E1TA 5M5WH 4TKOB 4DUYL 3L9AX 5LL6X 2K33A 3ULLA 4M8AA 4JV5L 3QG1A 4C3JH 1FYCA 1J8IA 2XWBB 4NXNL 5IYCH 1HNXL 3QO2A 2RHQB 1GM5A 4B3ML 4JI4L 4GLVB 2MGSA 2X69A 4BBRH 4JCVE 3STBC 5C3EH 1HCZA 1WD1A 2HCIA 4FF2A 2C9OA 2OTJA 3CCEA 1JCKB 1OXSC 1YNNC 4OX9Q 4BY7G 2VQEL 3GDEA 1F2MA 5IT9E 2DNCA 4KK7A 2VL6A 2E74C 3M85A 4MZ9A 1TY0A 1MSHA 3VYTA 4A3JB 1B70B 1SE2A 2K03A 4MHEA 2WIIB 2JA8G 5IOCA 4AQYL 2XWJB 1IBLQ 1WJJA 4I7ZC 4U68A 1HPCA 2VNUD 1Q81C 1PZID 1KLGD 3PUYA 5C4HA 1ILQA 3TP8A 5EJWA 1LT4D 2F03A 3C2PA 3BDOA 2WAQB 4RMFA 3MEFA 2RSOA 4JYAQ 4GN3B 4BA2I 2UXBQ 2ZM6Q 3HS0C 1PH3A 1I4QA 1I4RA 4LMQD 1VQBA 1GXDC 5DAUA 4DK3C 4FXKC 4NW2A 3T51B 2BDNA 3KDFA 1TVXA 4DV7Q 2OQKA 1K73C 5IYDG 2AQ2B 4GNXC 1E2ZA 3I4MG 4IFDH 1STHA 2K50A 3KBGA 4LWCA 1PRTB 1PH6A 1FL0A 4AYBE 4IQZA 1SROA 4J6HA 1SYBA 3KDFB 4ZUIA 4OEMB 2YTVA 3TP5A 4U673 1JJCB 2NVXH 4JOIA 3VA5A 3SXHA 3OTOQ 3IFDA 1SNPA 5ISRA 5C0XJ 5CMDA 4TSSA 4HJAA 2UUCQ 2JA6H 4EQ5A 5I9PA 1JR0D 2FXQA 2MJ8A 2AUKA 2VQFQ 1WVLA 2R61A 3CPFA 1UNSA 1RKNA 1BNZA 1LTRD 4A93G 1ASYA 4X3TA 2LFNA 1EZ6A 1M1KC 1D6EC 1AP0A 1EYGA 4RA8A 2GN5A 1SJHD 1Y69U 4E6IA 2HQLA 2JE6I 5JVH3 1EQQA 1HNWQ 2QEJC 1TWGH 3JAME 1B53A 4A3BG 4GKKL 3S1QH 1EFWA 1WCMB 3I8ZA 4ODGA 1JMCA 4KV6A 1UE6A 1DXMA 5GROA 4J1MA 1L0XB 2Z1CA 1V43A 4JI8L 2J7ZA 1KQSA 2NBFA 4P74A 5CV4A 3GV3A 2HUGA 1ENAA 1NUCA 4QUCA 1NNXA 3MXNA 2PCFB 2HQEA 4ZAIA 4K6LA 3KLRA 4GKJQ 4DA2A 3RN5A 1I3QH 4IJLA 5LMNL 1U4MA 4OWTB 4KLKA 1BOSA 2KUMA 4M1UB 5G3LF 1XNQQ 4RWSC 1STYA 3I2ZA 1EOTA 5LMNW 1JORA 1KHIA 3P1HA 4A3GB 2A19A 1IBKQ 2ZTEA 1YHBA 2TMPA 1TQOA 1PRTC 3HOVB 3S16H 3JAML 3ND8A 1YVCA 3F2UA 5EKKA 1Q8KA 4B3SQ 1D7QA 2K28A 4A3FB 1VQKA 3K81C 2M9VA 4HIMA 1SE8A 4JC0A 4A3DH 2FINB 5KEEA 1SFOB 4DUYQ 4DR3Q 1EIGA 1T5XD 5FJ8H 4QF4A 3QJYA 5HGTA 4B9XA 1HNXQ 1CI3M 3A0JA 1MJCA 1EEID 1G2SA 5IIFA 4BWGB 2A6EC 4GLAC 4H02A 4DF7A 4ZKBB 2Q2UA 1L2FA 2EJGC 1SEBD 4QY7A 2D0PA 4DV3L 1Y8OB 3NELA 4HCSA 2FHTA 4O0AA 5K36H 1EWCA 1K9MC 1Q12A 5JJIA 4DV6L 1EY8A 1ICFB 4KN7C 1DOLA 5E7NA 2CW0D 2VQEQ 4A3KG 1OO9B 1EL0A 2XSCA 1CKOA 4YWMA 3CCMA 2YV5A 3HOUH 1U4PA 2ID0A 4YCVA 1KLUD 1A3VA 2K6AA 2ZXRA 1YJNA 4FDBA 1QZHA 2NVYH 4TRDA 4XT1B 2NN6G 1C4QA 1BBWA 3TMEA 2QKIC 4IUQA 1X54A 1OXVA 4F87A 3J81E 4EQOA 1PYSB 1RJTA 1TIID 4HMIA 5JEAG 2ZJRA 1VQPA 1EY9A 4CKCA 2G9HD 1HQMC 4HTHA 4N9TA 3I55A 4KHPL 1HR0W 3D8GA 3BDCA 3STBD 3S1MH 3F8TA 1Q1BA 4X66Q 5ELDA 2OEOA 2B2WA 3GTMB 4HIKA 3GD7A 4A3LH 3PO2G 2J0TD 1PFSA 2I5MX 1JB7A 1J5EQ 5EPLA 3TP6A 4DU9A 1ENFA 1YNND 1SAPA 1KL9A 2YTXA 3OHXC 1HTPA 1HHVA 1T9HA 1STBA 5BR8Q 2KCCA 2JA8H 2BE5C 2F3IA 1UE1A 4YHHQ 1TKWB 5EAYA 3GTJB 3HOWB 2XVSA 1F9QA 2QA4A 1F9RA 2MP1A 1BCPC 3OIQA 2K5NA 1CHQD 1WI5A 4LK1C 4FYDA 2JEBI 2F52A 3CC2A 1IW7D 3I72A 5IYBH 2R7ZH 3RLNA 1EIYB 4JI7Q 2R7DA 4RG1A 4A3JG 4IOAA 3VR6A 5HGQA 1NR4A 2E76C 5FO8B 2ZXOA 5FLXc 3I4MH 5LHY1 1EY4A 4LAAA 2B2TA 4CDFC 2Z0SA 3NK9A 2L12A 1XNRL 4KY6A 3F2DA 1LTID 3VYSA 3RZOB 2Z6KA 1UAPA 2KVMA 2F0UA 2I0QA 1CSQA 2F0IA 1C48A 2WAQG 4A3EB 3CCUA 2NB0A 4IFDI 1HJPA 5IWAL 1ET6A 1C7YA 5I2YA 1PFNA 2D5DA 2E8GA 2KOLA 4H0LC 5IODA 3UDFA 1STEA 3KUPA 3EQLC 4NPSA 1ZYRC 4IOCA 4BY7H 4KD3A 1K8GA 3Q6SA 3VR5A 1HNZQ 1FR3A 2QGQA 2BCOA 5DM63 3H0GB 5LMNQ 1D8LA 1IHZA 4A93H 5EGTA 3ER0A 2IT1A 4GS3A 2L5TA 3MEHA 2ICIA 1VQHA 1RODA 1K3RA 1Y14B 2XN9C 1WTVA 3A56A 1HRJA 1TU2B 3RR5A 3K5MA 4PG3A 1L1OB 1PFBA 5KNCA 3CCSA 1LTBD 2LXKA 4DR2L 2E2IB 2F0SA 5A35A 4DR6Q 3N52A 4A3CG 4JI2L 1BUVT 4C3HB 3UDGA 2JK8A 2PMZB 3X3NA 1PVOA 2NZOA 4I65A 4DNTB 1N36Q 5I9OA 3C1FA 1I5FA 4L6TB 4BA1I 3OOCA 3NBHA 1HA5A 3Q0AA 1EY6A 1IBMQ 2JXMB 2CCZA 5ELBA 4DAPA 3KF8A 4R4IA 1AFPA 1NMGA 4OX9L 1AW7A 3K7AB 3J7A5 1WCMG 3BYYB 2EXZA 3K0XA 4A76A 3NQTA 2L4NA 4JW0A 3M3YB 3A8IE 2RSNA 1LT5D 5M3MB 1S72A 1F77A 3NBHB 4XYOA 4HEDA 1K0SA 2A6HC 3FMCA 3M4OB 2IJ0A 3KF8B 4UDUC 1M8AA 1RDPD 5C0XH 3RN2A 2DJFC 3UDIA 3AB9A 1KABA 3GTGB 5CYUA 1UEAB 1C8CA 4FO2A 3CMEA 1KTKA 3M9BA 3RD4A 3B6YA 3CC4A 1PXUA 3VR3A 1D1IA 3S15B 4BS9A 1TT2A 2VY3A 3A8JE 4OWXB 1HXYD 1FNWA 4JBWA 5KNBA 3CKIB 2UXBL 2ZM6L 3KBXA 2B2TC 4LW1A 4PMCA 2Z6KC 3BYTB 4KD4A 3F2CA 4DV7L 2SEBD 4A3GG 1A0IA 3PMFA 4QMGA 4CKEA 3HOVG 4BY1G 5AFWA 5CV5A 3SK5A 2PI2E 4OIJA 3D0FA 2F0TA 3HKZB 5FKAC 5IGGA 5C4XG 5NUCA 4A3FG 1GUOA 4KI0A 3GTQB 4A3KH 2R93G 3RZDB 3G4SA 1L1OC 1UE7A 2FFKB 4IALA 3OTOL 1BBXC 2B2YA 3A7AB 5BN3A 2JA7G 4OO1I 1V1PB 2UUCL 3NTHA 1EWIA 2I5LX 2NN6H 4PMWA 2VQFL 3CAMA 1AEXA 2IHFA 1SMXA 3S14B 4YCUA 3CQZH 3NP8A 2ZJQA 3K8AA 2ZTDA 3I3CA 3A74A 3GO5A 1QE6A 3MWYW 3ULJA 2CKZB 2PZTA 1EQTA 5F2DA 1JOKA 2YU9H 4FP5D 3PV0A 3GTKH 3S2DB 2F1MA 3S2HH 1HNWL 1TXYA 3J7AF 1U0LA 4DFAA 4DGZA 4KY5A 4DAVA 4DV5Q 3GTPH 1FNUA 2E2HH 2VUMB 1SNCA 1K28A 2VW9A 1CQVA 4BBSB 4RCOA 4N9PA 1E2VA 4CDEC 2B63H 3HRZC 1M90C 1VQ4A 2RHSB 1VQLA 2K7VA 5I2XA 3I90A 3E9IA 4A4IA 1WFQA 1AZPA 1FD7D 1YZ6A 4IJHA 1ZXTA 4HN7A 1RL2A 2NVTH 4IUUA 2K52A 4GKJL 2MNAA 5M3FB 2N88A 3H09A 1A8VA 4JG2A 3CCRA 2Q8TA 3NENA 3I91A 1BCPD 4NXML 3S1RH 3J7AV 1XNQL 1MI2A 4DR5Q 3JC66 4OONA 5IY0A 4B08A 2KQ3A 3A54A 1KC8C 1IBKL 3PSIA 2JA5B 2RQXA 3DHQA 2KHIA 2PMZE 1YJ9A 1CZGA 4DV4L 2VB3X 4B3SL 3SGIA 4IURA 4AIMA 1B7YB 2BOSA 1WTPA 4K8JA 4C2MH 3HOWG 4QJFA 3TZDA 4JI0Q 2JSOA 2CH4W 4APVA 4JI2Q 2I07B 1XTDA 4DR3L 1KDAA 5DEHA 2UXDQ 4N8FA 2BH2A 4BXXG 2V1CC 1DD2A 1X3PA 1JT8A 4RHRA 3S9WA 3PUZA 3PUXA 1EYAA 1K8MA 1EY5A 4XQNA 2L15A 2WKDA 4A3MB 3I70A 2B2YC 1CHPD 1V9PA 1SMYC 1ZYRD 3SEBA 1LT6D 3NQIA 1XMOL 1E3PA 3GTOH 2E2JB 4RH6A 5E4XA 1AZQA 3W1BA 3UE0A 1SYCA 1LACA 1KXLA 2JN4A 5IP9H 1KDCA 4A3EG 3BS1A 3BDLA 2R92B 3L7ZC 2B2VA 1BXTA 5FK9C 1VQ6A 1VQ5A 4MN3A 3UDXA 2ZT9C 3OWEB 3ERSX 2RF4A 4IPGA 4X6AH 1YNJC 4HJ8A 1QVGA 4DR1Q 1Y1WB 1X55A 4KKUA 3FPPA 3A8KE 2K1BA 3FVQA 1CSPA 3I7FA 3H0GG 2F0QA 3DM1A 1X3EA 1PH1A 2EJFC 4UAIA 1PTOC 4UY8C 5KIXA 1QWYA 5JOBA 1Y1VH 4V190 2OTLA 1BDOA 4X66L 1SYGA 4RAUC 5IT9L 4C3JB 5T1IA 1J5EL 1E1OA 1OXUA 1SXTA 3PIP3 5IGFA 3Q23A 2JYOA 2WB1E 2IY5B 4C3HG 3K5NA 2F3WA 1CKMA 4FF3A 2EQSA 4BBRB 1NY4A 4NDXA 3T1YQ 2EYPA 2I46A 1RTOA 1JB3A 5BR8L 1VQDA 1IL2A 4Q0FA 5M9OA 4QL5A 5FO7B 1R9TH 4YHHL 4FXDA 3E0EA 4OHJA 4K0KQ 4KJOA 3WDNA 2M00A 2KENA 2Y0SB 1A63A 4JBMA 2C5CA 2DUDA 2R7FA 4X62Q 5M3MG 5C0XI 5C4ZA 4CJ1B 5EQ0A 4JI7L 1LT3D 1G2TA 4ZUJA 3DM3A 2FJ2A 4KKTA 3H3VC 2RBMA 3P20A 1GOZA 1AH9A 2KEEA 4BY1H 1GKHA 1NE3A 2FMCA 4K5WA 4JI5Q 5H1SE 4DXGA 5C4XH 1TWCH 4LFBQ 4DXFA 4YWLA 2EY5A 2AUJD 1LTSD 3DXJC 1Q86C 2R93H 5IGEA 2CQOA 1WTRA 1HZAA 3EN2A 3IKJA 1SNDA 2OXPA 1XXGA 1ML0D 1KD1C 5A2QE 1GUTA 2JA7H 1A15A 5M5YH 3J80E 2HDMA 2JQOA 3OYYA 2B2VC 3E5SA 3NXWA 1KAAA 4V0BA 1HNZL 4UP8A 1QOHA 1RD9D 3AU7A 1JWMD 4ID6A 3ZYYX 4QB4A 2NVXB 3OIPA 4UP7A 4NXMQ 2EY6A 2NN6I 3LWUA 1GHJA 2JA6B 3HOXH 2CHBD 3MXNB 4UPAA 4K8IA 1WTQA 4OL7A 1X65A 1PH9A 2ASBA 4XIGS 3PIOA 4DV4Q 4LUOA 2DN8A 3GV6A 2WB1G 2UUAQ 3C3LA 4LF5Q 4DR6L 4A3IG 1HFGA 2V4DA 2GVBA 1ESFA 1P8LA 2IL8A 1PZKD 2K32A 2ZXPA 4IN3A 1SR3A 3R93A 3HOZG 1TS3A 1N36L 2HCCA 2SNSA 4KMUC 2EYOA 3CCLA 3I4NH 5A2QL 4LF4Q 1TWGB 3G7LA 3FKIH 1II3A 1OXTA 4NP5A 1IBML 3J80L 3AFQA 2CWPA 2EIFA 1STGA 4JOIC 1GUNA 2CQAA 3QWNA 3FHWA 1T5EA 1WYDA 5ELFA 4R8NA 1XWEA 1WTXA 1XMOQ 4OO1H 4POFA 3K6OA 2PZWA 3TBIB 4JBKA 4BBSG 1B44D 3CCVA 1GUGA 2RCNA 5C44G 2N55A 1KRTA 1PHJA 3MVVA 1EUJA 1YITA 1BKBA 4HAEA 5E4WC 1I4XA 3K5LA 4RCNA 4DK1A 1K83B 2WAQE 1VQAA 4X3UA 5ELCA 3S1NH 1SJED 1I3QB 5J3BA 4RKLA 4KY7A 4RGNA 2IPKD 3CRLC 2NVQH 5M3FG 4KHVA 1L0YB 3AMUA 5IP7G 4GN5A 4IUVA 2PW7A 3MFYA 2ENBA 1ENCA 1HR0L 1I50H 2NYZD 3S16B 2A68C 3WOFA 1W6JA 4QQBX 4G7ZC 4B3TQ 3TP7A 5EBCA 3JAMc 2JA5G 1B3QA 2M2LA 4ZYSA 3SK8A 3T1HL 4HMJA 3OMCA 1NBWA 4OIKA 3ICEA 4A3DB 2AWOA 4L63B 3CCQA 1GVPA 2RVLA 1QNKA 2N78A 4OGQC 1JICA
chains in the Genus database with same CATH topology
4K14A 3KK7A 2DY7A 4EVOA 2PW5A 1GJXA 3R3OA 2QCPX 4FVMA 2L55A 2BDOA 3T16A 2EYJA 3R2IA 3T53B 3J81L 4FXGC 1YNJD 2SNMA 3DWPA 5BN5A 3IAYA 5EPKA 5C5LA 2NVYB 5IGCA 2MPMA 2J4XA 2DY8A 1PTOD 4TQUS 1D1KA 3M7NA 2O2LD 1O80A 4CJ2C 1D5ZC 1PRTF 1HA6A 3V05A 2KA7A 2G9DA 2L11A 4ILWA 3TSSA 1SSOA 1UUPA 2NWGA 4IZ8A 3S1MB 4QIWB 4PNYA 3SDZA 4R9WA 3SHLA 4CJ0B 5KYLA 1SYDA 2XRSD 4ULLA 4C3JG 1Y8NB 1IYVA 3SR1A 3MC0B 5BN4A 2PQEA 1PLFA 3H94A 3PO3B 1DJRD 1M4VA 2BA0A 3M4YA 3KLSX 1Z7TA 5C3XA 3C46A 5J39A 1GUWA 3MXUA 5CC4A 2NZ1D 4MIUA 1GHKA 4XDXA 2R7ZB 5CV7A 1Q3LA 2B2WC 3NBIA 2WKCA 3D4DA 5CV8A 4J8QA 3QIAA 2F0OA 1Q90A 2GA4B 2R6GA 1SE4A 3TN2A 1RHPA 2B39A 1G291 2F3VA 1B4OA 1E0BA 1F9SA 2HDLA 2KJXA 4C1NI 1Z47A 1D5MC 5ELEA 4IFDG 3T56B 1TWHB 3VYUA 4C56C 1PRTD 4NMZA 2F0EA 1I4HA 3DEOA 1IYUA 1F2YA 2BA1A 2CVRA 1X32A 1CTMA 1LLRD 2EYFA 2L1BA 4HCEA 1U4RA 1Q1EA 3CHBD 3DWQA 3FEWX 1QG7A 2K5DA 3H6MA 4PQXA 3MXPA 1BCPF 1FNVA 3HOYB 2MUYA 4YIJA 4CBVA 4Q5VA 3W2DA 5CGKA 2A6ED 3DEPA 1A3UA 2F0LA 1CQFA 1I6VC 2O5IC 4RGTA 2K5QA 3RLFA 3EROA 1J9OA 1DONA 3RUZA 1F9PA 1H9SA 1TS4A 1S4ZA 4O1NA 4X3KA 4ME5A 1EEFD 1PTOH 1Y8PB 2D2CC 3HG9A 1V8QA 2KECA 1TR5A 1AN8A 2JP1A 2LMCB 1H9SB 1H9RA 2IWHA 5JEAH 4AYBB 2B8GA 2A68D 3K5OA 3CU7A 2PO4A 4ABNA 1DZ1A 5C6AA 3ONAB 4XQJA 3D6CA 5D65A 1LTGD 4EGVA 4H7BA 4RHSA 1VCIA 3FDTA 2OF1A 1SYEA 3MFGA 5KYIA 1JWSD 1NSNS 1A3TA 1CT1D 1LTAD 2Z8LA 1B1ZA 4LJZC 2BE5D 1DYQA 4A3KB 1EU4A 3R2TA 1A2TA 1Q8IA 1XYIA 1E2WA 4HSPA 1B9NA 3DMUA 1G6ZA 4DN4M 3O13A 3BZDB 4K5VA 3GTLB 4NKLA 4EQPA 3CQZB 2CW0C 2LY7A 5JPMC 1HUNA 1STNA 4R8IA 1ZEQX 1I4PA 4ZK9B 1PZJD 3VR2A 2RKSA 1PYWD 1ET9A 1VDZA 2YU9B 3GTKB 3S2HB 1KDBA 1TWFB 1JWUD 2E2HB 2XIWA 1KNAA 1MGSA 2A5HA 2F0VA 4G7OC 1BO0A 3ITPA 4K5XA 3V96A 2B63B 1R4PB 2K05A 2TSSA 4C3IB 1QCBD 4XQQA 1EU3A 3OMGA 1G8ZD 5HURA 5CV6A 5J1ZA 1CM9A 2NVTB 3SK6A 4ZKCB 2F0MA 3HZXA 4WJWA 1B3AA 4FF4A 3S1RB 1ILPA 2SOBA 4IUTA 5LL6S 4KJNA 2F4IA 3U9SA 1MBYA 2O4XA 5I6WA 5D14A 4C2MB 4KHZA 2SDFA 4FF1A 2QDBA 3FRPB 1CFMA 5M5WB 1IW7C 2KEDA 4O42A 4F88A 4DNRB 5C5MA 2EYLA 3K58A 1KNEA 2RDGA 2F0KA 5C3EB 4XT3B 3NUCA 4ZRZA 2A6HD 3L3OC 4PV1C 2LS01 4CKBA 3G6JB 1LV9A 3GTOB 5CR3A 2IW3A 3GQBA 2DNEA 3TZUA 4KTAA 5IGBA 2LKVA 3ND9A 1FGBD 2WV6D 3P75A 2RDHA 4X3SA 1G91A 5CV9A 1MSGA 3T4AC 2QILA 3E6ZX 1SNMA 1BF4A 1EZ8A 2Z4IA 4B9WA 4C1NK 1PFMA 2F0HA 5EPJA 2B2UA 3D6WA 1WTWA 4K2LA 2L9HA 1EFID 3VA7A 1IKMA 1LABA 1Y1VB 3NE5B 2B8FA 2EJMA 2F0PA 3EVQA 2F0NA 2ICEC 3EA6A 4JK1C 3IFTA 5EKLA 4FNFA 1CA6A 1S5ED 1LO5D 3I73A 3VR4A 1U9RA 4F8MA 3LNNA 3J7YW 1BR9A 3M7GA 5I4DA 2VXWA 4K2KA 1K8OA 1R9TB 4HR7B 3BVMA 1B2TA 4G4KA 4QUFA 5JEAJ 5FO9B 4XYQA 3MAQA 1JC7A 2EYHA 3D31A 2K5WA 1QJOA 1O7ZA 2PZUA 2YYZA 2F0GA 1BQQT 2EY2A 4HSVA 3LWEA 3OPOA 2WACA 4BY1B 4ZQ3A 1HQRD 5C0XG 3S1QB 5C4XB 1TWCB 1CA5A 1JQYD 5FLXE 3MZ5A 1ZKOA 2R93B 2A69C 3RMHA 2Q8RE 2F0DA 1PTOF 1STAA 1BCPB 3PUWA 1EWHA 2K01A 2JA7B 2F0JA 5M5YB 3SVMA 3C1EA 4ZLTF 3HP3A 3NTKA 2D62A 1VF7A 3V2TA 1ICWA 1CZWA 1O7LA 1S5BD 1SNOA 5TSSA 3MHBA 1B50A 3HOXB 2AWNA 2B2UC 2QF7A 3OW7A 1V1OA 2PYKA 2KHSA 1EY7A 5FLXL 1RCVD 4CHTB 3H91A 1SMYD 3I4NB 4PMBA 3FKIB 1IL8A 1WD0A 2IX1A 4RGOS 4GZYC 5G3LD 2EPBA 2XRQD 3UI2A 1RF2D 3DUZA 3A7LA 5K5PA 3HOUB 2XNAC 4C3IG 2EOTA 3OWFA 1SDFA 2A74C 4H13C 5E3FA 1QILA 3S1NB 5JAVA 5I6YA 3PIO3 2EE1A 3ERQA 2Q8IB 2NVQB 3MXGA 1F2LA 4QCLA 1ESRA 5JVG3 1D5XC 1DOKA 1LTTD 1I50B 3K0YA 2E75C 4H44C 2R3ZA 2WINB 4IFDJ 2NTTA 1VMCA 4BY7B 3NWSA 1S5FD 3PUVA 1NCVA 5JPNC 4CGYB 1OXXK 3FPUB 1TS5A 4XXEA 4Z9CB 4DAYA 2WP8J 1U4LA 4RGMA 2JA8B 1HFNA 2F0WA 4S3SA 5D3IB 1A2UA 3NPPA 2NUCA 2FMMA 1SNQA 3NWTA 2IX3A 2PNRC 3DWAA 3Q24A 1DM0B 3N6RA 3I4MB 4RFBA 4WFN3 4P2CB 5DM73 1XTCD 5DNFA 2X6LA 4WRDA 3SE0A 4G57A 5KGUA 3A55A 1TWAB 3HEJA 1O78A 3W3AA 1H9KA 3WOEA 2RA4A 2EDGA 3MTSA 3X3MA 3KLSA 1D2BA 1EIHA 5EBDA 2JEAI 3BVGA 3K59A 4IUNA 1EQVA 3CRKC 1DOMA 3URYA 4A93B 2H1EA 3EJIA 1CK1A 4Y7NB 2IX0A 2NTSA 3HGBA 5KRUA 1SBBB 1WTOA 1HTLD 3T13A 4A3BB 2A73B 4F7XA 5IGDA 3TDQA 2VB2X 2EYMA 1Z6HA 1GUSA 3BG3A 1JE4A 1VF5C 1QB5D 2A69D 2MHVA 3P7JA 2EZVA 3VYRA 4KKSA 3LX0A 1S5CD 1W6KA 2EY1A 5D3DA 1B9MA 1SYFA 2D9UA 2AQ1B 1H9JA 1V1PA 1A6XA 1DCZA 4RKBA 1NR2A 1EY0A 3QB3A 1JOOA 3GP7A 2F0FA 5C4JB 1NAPA 5KNDA 2X6GA 3IL8A 2RDFA 3E0JA 3SK4A 1EYCA 1I4GA 1XX8A 2WB1B 5JJZA 1I6HB 1ONLA 4A3IB 3MA2B 2L0CA 3NTIA 3BVZA 5EKIA 3HOZB 2H4OA 5C3WA 3S17B 1PDQA 3QOLA 1HUMA 4WORA 5T1GA 5CBEE 2E2DC 3D4RA 1H9MA 4EQNA 1QNUA 1TY2A 5CORA 1IKLA 3I4LA 4DK0A 3OSOA 5C44B 2OT2A 3K57A 1EYDA 3D3RA 1R4QB 1RTNA 1VMPA 2O5JC 3R8BA 4L8JA 5FOBB 3Q22A 1X3QA 4K6DA 2K04A 2PPBC 1PTOB 5K36G 2EVBA 5J22A 1PMRA 4XTCS 1MD2D 4OO1G 1S5DD 1JOQA 5E1FA 3NHHA 1TS2A 4G7HC 1SE3A 5COYA 3EFXD 2KCNA 3D4WA 3QOJA 3U9OA 4IUPA 3NSWA 4KN4C 2AQ3B 1O7YA 3GTPB 1F2ZA 2Z4HA 3PO2B 5M5XB 5CBAE 4TKOB 3L9AX 5LL6X 2K33A 4M8AA 3QG1A 1FYCA 1J8IA 2XWBB 3QO2A 2MGSA 2X69A 1HCZA 1WD1A 2HCIA 4FF2A 2C9OA 1JCKB 1OXSC 1YNNC 1F2MA 5IT9E 2DNCA 4KK7A 2E74C 3M85A 1TY0A 1MSHA 3VYTA 4A3JB 1SE2A 2K03A 4MHEA 2WIIB 5IOCA 2XWJB 4I7ZC 4U68A 1HPCA 2VNUD 1PZID 1KLGD 3PUYA 5C4HA 1ILQA 3TP8A 5EJWA 1LT4D 2F03A 3C2PA 3BDOA 2WAQB 2RSOA 4BA2I 3HS0C 1I4QA 1I4RA 4LMQD 1GXDC 5DAUA 4FXKC 4NW2A 3T51B 2BDNA 1TVXA 2AQ2B 1E2ZA 4IFDH 1STHA 3KBGA 1PRTB 4IQZA 4J6HA 1SYBA 4ZUIA 3TP5A 4U673 3VA5A 3SXHA 3IFDA 1SNPA 5ISRA 5C0XJ 5CMDA 4TSSA 5I9PA 1JR0D 2MJ8A 1WVLA 2AUKA 2R61A 1UNSA 1RKNA 1BNZA 1LTRD 4X3TA 2LFNA 1EZ6A 1D6EC 1AP0A 4RA8A 1SJHD 1Y69U 4E6IA 2JE6I 5JVH3 2QEJC 3JAME 1B53A 1WCMB 3I8ZA 4ODGA 4KV6A 1DXMA 4J1MA 1L0XB 2Z1CA 1V43A 2J7ZA 2NBFA 5CV4A 3GV3A 2HUGA 1ENAA 1NUCA 4QUCA 3MXNA 2PCFB 2HQEA 4ZAIA 4K6LA 3KLRA 4DA2A 1U4MA 1BOSA 2KUMA 4M1UB 5G3LF 4RWSC 1STYA 1JORA 1EOTA 3P1HA 4A3GB 2TMPA 1TQOA 1PRTC 3HOVB 3JAML 3ND8A 3F2UA 5EKKA 2K28A 4A3FB 2M9VA 2FINB 5KEEA 1SFOB 1EIGA 1T5XD 4QF4A 3QJYA 5HGTA 4B9XA 1CI3M 1EEID 1G2SA 5IIFA 4BWGB 2A6EC 4DF7A 4ZKBB 2EJGC 1SEBD 1Y8OB 4HCSA 2FHTA 5K36H 1EWCA 1Q12A 1EY8A 4KN7C 1DOLA 2CW0D 1OO9B 1EL0A 2XSCA 1U4PA 2ID0A 1KLUD 1A3VA 2K6AA 2ZXRA 4TRDA 4XT1B 2NN6G 1C4QA 3TMEA 2QKIC 4IUQA 4F87A 1OXVA 3J81E 4EQOA 1RJTA 1TIID 4HMIA 5JEAG 1EY9A 4CKCA 2G9HD 1HQMC 4HTHA 4N9TA 3D8GA 3BDCA 1Q1BA 5ELDA 2OEOA 2B2WA 3GTMB 3GD7A 2J0TD 5EPLA 3TP6A 4DU9A 1ENFA 1YNND 1SAPA 3OHXC 1HTPA 1HHVA 1STBA 2KCCA 2BE5C 1TKWB 3GTJB 3HOWB 2XVSA 1F9QA 1F9RA 2MP1A 1BCPC 3OIQA 1CHQD 4LK1C 4FYDA 2JEBI 1IW7D 3I72A 3VR6A 1NR4A 2E76C 5FO8B 2ZXOA 5LHY1 1EY4A 4LAAA 2B2TA 3NK9A 2L12A 4KY6A 1LTID 3VYSA 3RZOB 1UAPA 2KVMA 2F0UA 2F0IA 1C48A 4A3EB 2NB0A 4IFDI 1ET6A 5I2YA 1PFNA 2D5DA 2KOLA 4H0LC 5IODA 1STEA 3KUPA 3EQLC 1ZYRC 4KD3A 3Q6SA 3VR5A 1FR3A 2BCOA 5DM63 3H0GB 1IHZA 5EGTA 2IT1A 2L5TA 3MEHA 2ICIA 1RODA 2XN9C 1WTVA 3A56A 1HRJA 1TU2B 3K5MA 1PFBA 5KNCA 1LTBD 2E2IB 2F0SA 5A35A 3N52A 1BUVT 4C3HB 2PMZB 3X3NA 4I65A 4DNTB 5I9OA 3C1FA 4L6TB 4BA1I 3OOCA 3NBHA 1HA5A 3Q0AA 1EY6A 2JXMB 5ELBA 4DAPA 3KF8A 1AFPA 1AW7A 3K7AB 3BYYB 2EXZA 3NQTA 2L4NA 3M3YB 3A8IE 2RSNA 1LT5D 5M3MB 1F77A 4XYOA 4HEDA 2A6HC 3FMCA 3M4OB 2IJ0A 4UDUC 1M8AA 1RDPD 5C0XH 3AB9A 1KABA 3GTGB 5CYUA 1UEAB 1C8CA 4FO2A 1KTKA 3RD4A 1PXUA 3VR3A 1D1IA 3S15B 4BS9A 1TT2A 3A8JE 5KNBA 1HXYD 1FNWA 4JBWA 3CKIB 3KBXA 2B2TC 4PMCA 3BYTB 4KD4A 2SEBD 3PMFA 4QMGA 4CKEA 5AFWA 5CV5A 3SK5A 4OIJA 2F0TA 3HKZB 5FKAC 5IGGA 5NUCA 1GUOA 4KI0A 3GTQB 3RZDB 2FFKB 4IALA 1BBXC 2B2YA 3A7AB 5BN3A 4OO1I 1V1PB 3NTHA 2NN6H 4PMWA 1AEXA 3S14B 3NP8A 3I3CA 3GO5A 1QE6A 3MWYW 2PZTA 1EQTA 5F2DA 1JOKA 4FP5D 3PV0A 3S2DB 2F1MA 3J7AF 4DFAA 4DGZA 4KY5A 4DAVA 1FNUA 2VUMB 1SNCA 1CQVA 4BBSB 4RCOA 4N9PA 1E2VA 3HRZC 2K7VA 5I2XA 3I90A 1AZPA 1FD7D 1ZXTA 4HN7A 4IUUA 5M3FB 2N88A 3H09A 2Q8TA 3I91A 1BCPD 3J7AV 1MI2A 4B08A 2KQ3A 3A54A 2JA5B 2RQXA 3DHQA 1CZGA 2VB3X 4IURA 2BOSA 1WTPA 4K8JA 3TZDA 2JSOA 2I07B 1KDAA 5DEHA 1DD2A 1X3PA 4RHRA 3S9WA 3PUZA 3PUXA 1EYAA 1K8MA 1EY5A 4XQNA 2WKDA 4A3MB 2B2YC 1CHPD 1ZYRD 1SMYC 3I70A 3SEBA 1LT6D 3NQIA 2E2JB 4RH6A 5E4XA 1AZQA 1SYCA 1LACA 1KDCA 3BS1A 3BDLA 2R92B 3L7ZC 2B2VA 1BXTA 5FK9C 4MN3A 2ZT9C 3OWEB 1YNJC 1Y1WB 4KKUA 3FPPA 3A8KE 2K1BA 3FVQA 2F0QA 3DM1A 2EJFC 4UAIA 1PTOC 5KIXA 1QWYA 5JOBA 4V190 1BDOA 1SYGA 4RAUC 5IT9L 4C3JB 5T1IA 1OXUA 1SXTA 3PIP3 5IGFA 3Q23A 2JYOA 4C3HG 3K5NA 2F3WA 4FF3A 4BBRB 4NDXA 2EYPA 2I46A 1RTOA 1JB3A 4Q0FA 5M9OA 5FO7B 4FXDA 4OHJA 4KJOA 3WDNA 2M00A 2Y0SB 2C5CA 5C0XI 5C4ZA 4CJ1B 5EQ0A 1LT3D 1G2TA 4ZUJA 4KKTA 2FJ2A 3H3VC 2RBMA 3P20A 1GOZA 2KEEA 4K5WA 2FMCA 4DXGA 4DXFA 2EY5A 2AUJD 1LTSD 3DXJC 5IGEA 1WTRA 3IKJA 1SNDA 2OXPA 1XXGA 1ML0D 5A2QE 1GUTA 1A15A 3J80E 2HDMA 2B2VC 3E5SA 3NXWA 1KAAA 4V0BA 1QOHA 1RD9D 3AU7A 1JWMD 4ID6A 3ZYYX 4QB4A 2NVXB 3OIPA 2EY6A 2NN6I 3LWUA 1GHJA 2JA6B 2CHBD 1WTQA 4K8IA 4OL7A 4XIGS 2DN8A 3GV6A 3C3LA 1HFGA 2V4DA 1ESFA 2IL8A 1PZKD 2K32A 2ZXPA 4IN3A 3R93A 1TS3A 2HCCA 2SNSA 4KMUC 2EYOA 5A2QL 1TWGB 3G7LA 1II3A 1OXTA 4NP5A 3J80L 1STGA 1GUNA 2CQAA 3QWNA 1T5EA 5ELFA 4R8NA 1XWEA 1WTXA 4OO1H 3K6OA 2PZWA 3TBIB 1B44D 1GUGA 2N55A 3MVVA 4HAEA 5E4WC 1I4XA 3K5LA 4RCNA 4DK1A 1K83B 4X3UA 5ELCA 1SJED 1I3QB 4RKLA 4KY7A 4RGNA 2IPKD 3CRLC 4KHVA 1L0YB 3AMUA 4IUVA 2PW7A 3MFYA 2ENBA 1ENCA 2NYZD 3S16B 2A68C 3WOFA 1W6JA 4G7ZC 3TP7A 5EBCA 2M2LA 4ZYSA 3SK8A 4HMJA 3OMCA 4OIKA 4A3DB 2AWOA 4L63B 2RVLA 1QNKA 4OGQC 1JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  4MIU A;  5KEE A;  4K14 A;  1SNO A;  4ID6 A;  1TR5 A;  4J6H A;  4QB4 A;  5CV7 A;  1SYB A;  3MHB A;  3D4W A;  2F0Q A;  3QOJ A;  4ZUI A;  3U9O A;  2EY6 A;  3OMG A;  4QF4 A;  4EVO A;  5HUR A;  5CV6 A;  3LX0 A;  3TP5 A;  5HGT A;  4B9X A;  2PW5 A;  3VA5 A;  3SXH A;  3R3O A;  2F0W A;  4S3S A;  5KIX A;  2F0P A;  5J1Z A;  3EVQ A;  3SK6 A;  2EY1 A;  5IIF A;  2F0N A;  1SNP A;  4K8I A;  4OL7 A;  2PYK A;  2F0M A;  2KHS A;  5JOB A;  4DF7 A;  5ISR A;  5EKL A;  1EY7 A;  3D4D A;  5C6A A;  3HZX A;  1KAB A;  1F2Z A;  5CV8 A;  3T16 A;  1SYF A;  5I9P A;  2EYJ A;  1SYG A;  1EY4 A;  1U9R A;  1A2U A;  4LAA A;  4F8M A;  1JOQ A;  3D6C A;  2F0O A;  1EY8 A;  3NK9 A;  5E1F A;  2SNM A;  4RKB A;  1RKN A;  2SOB A;  2NUC A;  4KY6 A;  4H7B A;  5IGF A;  1TT2 A;  4K2K A;  1EY0 A;  1SNQ A;  2F3V A;  3QB3 A;  2F0U A;  1EZ6 A;  1JOO A;  2F3W A;  2F0I A;  4PMB A;  4NDX A;  2F0F A;  5C5L A;  2EYP A;  2OF1 A;  4PMC A;  1SYE A;  1A3V A;  2EYO A;  2KQ3 A;  2SNS A;  4KJN A;  5KYI A;  5M9O A;  3DHQ A;  4KD4 A;  5IOD A;  4E6I A;  1II3 A;  3PMF A;  4NP5 A;  4QMG A;  4TRD A;  1NSN S;  5IGC A;  1A3T A;  2O4X A;  2RDF A;  2EYH A;  5I6W A;  5CV5 A;  3SK4 A;  3SK5 A;  1EYC A;  2QDB A;  4NMZ A;  4KJO A;  1STG A;  2F0T A;  4ODG A;  3TME A;  2M00 A;  4K8J A;  2F0E A;  4KD3 A;  5IGG A;  4WRD A;  5NUC A;  4KV6 A;  2PZU A;  4R8N A;  1F2M A;  4EQO A;  1A2T A;  2F0G A;  5K5P A;  1IHZ A;  2PZW A;  1F2Y A;  4G57 A;  2EYL A;  5C5M A;  5C3W A;  5KGU A;  1KDA A;  2EY2 A;  5DEH A;  5EGT A;  3QOL A;  2F0K A;  4J1M A;  3DMU A;  3MEH A;  2WAC A;  4HMI A;  5C4Z A;  3HEJ A;  2EYF A;  3OWF A;  3MVV A;  1EY9 A;  4IAL A;  4WOR A;  4HTH A;  3NUC A;  4N9T A;  5E3F A;  4ZUJ A;  3S9W A;  5IOC A;  4IZ8 A;  4K5V A;  4ZQ3 A;  2RBM A;  5I6Y A;  5IGB A;  5JAV A;  4EQN A;  3H6M A;  4NKL A;  5CV4 A;  3D8G A;  3MXP A;  4PNY A;  3BDC A;  1ENA A;  1EYA A;  1NUC A;  4K5W A;  3ERQ A;  4EQP A;  4YIJ A;  1EY5 A;  5CR3 A;  5CGK A;  2OEO A;  3SHL A;  1AEX A;  2HQE A;  4RKL A;  4KTA A;  2F0S A;  5C4H A;  2LKV A;  4IUN A;  1A3U A;  1EQV A;  3MZ5 A;  4KY7 A;  2F0L A;  3TP8 A;  3NP8 A;  5KYL A;  1SYD A;  1STN A;  2EY5 A;  3P75 A;  4KHV A;  3TP6 A;  4DU9 A;  3OSO A;  2F0D A;  2RKS A;  5IGE A;  1EYD A;  3EJI A;  5CV9 A;  1SYC A;  3ERO A;  3SR1 A;  2PW7 A;  1STA A;  2PZT A;  2ENB A;  1ENC A;  1STY A;  4I65 A;  1JOR A;  1KDC A;  1SND A;  5KRU A;  5I9O A;  3C1F A;  3P1H A;  2OXP A;  1SNM A;  2PQE A;  1STB A;  5DAU A;  1JOK A;  5F2D A;  1KDB A;  2F0J A;  3BDL A;  1TQO A;  3RUZ A;  3TP7 A;  1EZ8 A;  3T13 A;  5EKK A;  1EY6 A;  3C1E A;  4DFA A;  4DGZ A;  4F7X A;  4B9W A;  4K6D A;  5IGD A;  4KY5 A;  1STH A;  3SK8 A;  2F0V A;  5C3X A;  4HMJ A;  3OMC A;  1SNC A;  4ME5 A;  5J22 A;  2EYM A;  4K5X A;  3ITP A;  3E5S A;  5J39 A;  3NXW A;  3V2T A;  1KAA A;  2EXZ A;  2F0H A;  4N9P A;  3NQT A;  5CC4 A;  3NHH A; 
#chains in the Genus database with same CATH topology
 4UHV A;  4K14 A;  1X6O A;  3KK7 A;  2DY7 A;  3RZO H;  1XJV A;  2A1A A;  4EVO A;  1LM0 A;  2PW5 A;  4A3E H;  2F4V L;  1SN8 A;  2Y0S E;  3R3O A;  1GJX A;  3CF5 A;  2QCP X;  4FVM A;  4DV1 Q;  1LYL A;  4LNQ A;  2L55 A;  2BDO A;  3T16 A;  1P16 A;  2EYJ A;  3R2I A;  1VQF A;  3T53 B;  3J81 L;  4WJ3 M;  4FXG C;  1YNJ D;  4A3M G;  2SNM A;  3DWP A;  5BN5 A;  3UE1 A;  2B3G A;  3H0G H;  3F2B A;  3IAY A;  5EPK A;  5C5L A;  2NVY B;  5FLM G;  3L2P A;  3DLL A;  5IGC A;  1UE5 A;  2MPM A;  2J4X A;  2R92 G;  2DY8 A;  1PTO D;  5IE8 A;  5IYD H;  4L5T A;  2I5H A;  4DV5 L;  4TQU S;  1D1K A;  1E24 A;  4MTN A;  2HT1 A;  3AQQ A;  3M7N A;  2O2L D;  1Y1W G;  1O80 A;  4CJ2 C;  1D5Z C;  4R4O A;  1PRT F;  1HA6 A;  3V05 A;  2KA7 A;  2B29 A;  2G9D A;  2L11 A;  1IZ6 A;  4ILW A;  3TSS A;  1SSO A;  1TWA H;  3TRE A;  3KFU A;  1UUP A;  2NWG A;  4IZ8 A;  2KCT A;  3S1M B;  1N33 Q;  1X9N A;  4QIW B;  4PNY A;  3SDZ A;  1ASZ A;  4R9W A;  3SHL A;  4CJ0 B;  5KYL A;  1SYD A;  2HIV A;  2XRS D;  4ULL A;  4IPC A;  2UXC Q;  2Q2I A;  4C3J G;  1Y8N B;  1IYV A;  1YBY A;  5IYC G;  5L37 A;  3SR1 A;  4DR5 L;  3M3Y H;  3MC0 B;  5BN4 A;  4Y7N H;  4BBR G;  2PQE A;  1PLF A;  3H94 A;  3BU2 A;  1PV4 A;  3PO3 B;  1DJR D;  1M4V A;  2BA0 A;  2ZTC A;  3M4Y A;  3G6E A;  3M4O H;  3KLS X;  1LTL A;  1Z7T A;  1DGS A;  5C3X A;  3C46 A;  4A3B H;  4LF6 L;  3J81 c;  5J39 A;  2DJG C;  4HID A;  1GUW A;  3MXU A;  4JI0 L;  5CC4 A;  2NZ1 D;  4MIU A;  1GHK A;  1X3F A;  4XDX A;  4R4C A;  2R7Z B;  5CV7 A;  3L0O A;  2UXD L;  2Y0S G;  1Q3L A;  2B2W C;  3U4Z A;  4DV0 Q;  3NBI A;  3W1G A;  4LF9 Q;  5AJ3 Q;  1AE3 A;  1HH2 P;  1N34 L;  4R4Q A;  2WKC A;  3I56 A;  3D4D A;  5CV8 A;  1S40 A;  4J8Q A;  1Q7Y C;  2N8N A;  4DR4 Q;  3QIA A;  2F0O A;  1Q90 A;  1VQJ A;  2GA4 B;  1Z9F A;  2R6G A;  1SE4 A;  2C35 B;  3TN2 A;  1RHP A;  2B39 A;  1G29 1;  4DPG A;  2F3V A;  4YY3 Q;  1B4O A;  1E0B A;  1F9S A;  2HDL A;  3CD6 A;  2KJX A;  4C1N I;  1VQ7 A;  1Z47 A;  1D5M C;  5C4J H;  5ELE A;  4IFD G;  3T56 B;  1TWH B;  3VYU A;  4C56 C;  5GAH C;  1YHA A;  1PRT D;  4NMZ A;  4QGU A;  3J7Z C;  2F0E A;  4DR1 L;  1I4H A;  1I6H H;  3DEO A;  3ZJY C;  4A3I H;  1XPU A;  2HHH Q;  4J15 A;  1IYU A;  1F2Y A;  1B8A A;  2BA1 A;  2ALY B;  2CVR A;  3HOZ H;  1X32 A;  4L5S A;  1CTM A;  1LLR D;  2EYF A;  3S17 H;  1HR0 Q;  2L1B A;  4HCE A;  1U4R A;  1Q1E A;  3CHB D;  3DWQ A;  4OWW B;  3FEW X;  1QG7 A;  4OEL B;  2K5D A;  3H6M A;  4PQX A;  2JA6 G;  3MXP A;  1BCP F;  3QR8 A;  4DR7 Q;  1FNV A;  3HOY B;  2MUY A;  4YIJ A;  3LGJ A;  4CBV A;  3W2D A;  4Q5V A;  5CGK A;  2A6E D;  3T1H Q;  3DEP A;  1A3U A;  2RCF A;  2F0L A;  1CQF A;  1I6V C;  2O5I C;  4RGT A;  2Q2H A;  2K5Q A;  3RLF A;  3ERO A;  1S3O A;  1J9O A;  1DON A;  5C44 H;  3T1Y L;  2LXJ A;  2D0O A;  2F4V Q;  3RUZ A;  1LUZ A;  3S24 A;  1VQ9 A;  1F9P A;  1H9S A;  1TS4 A;  3M4P A;  1S4Z A;  4X65 Q;  4O1N A;  4HJ5 A;  4X3K A;  4K0K L;  4ME5 A;  1EEF D;  1PTO H;  1Y8P B;  2K5H A;  2D2C C;  3HG9 A;  1V8Q A;  1Q46 A;  2KEC A;  1TR5 A;  1AN8 A;  2JP1 A;  2LMC B;  4X62 L;  2XTI A;  1H9S B;  1H9R A;  1XPO A;  2IWH A;  5JEA H;  2XGT A;  4AYB B;  1X3G A;  2B8G A;  2A68 D;  3K5O A;  3CU7 A;  2PO4 A;  4ABN A;  1DZ1 A;  5C6A A;  4JI5 L;  2P5Z X;  2MO0 A;  3ONA B;  4IO9 A;  4XQJ A;  3D6C A;  4LFB L;  3PO2 H;  5D65 A;  5M5X H;  2VS1 A;  1LTG D;  4EGV A;  4H7B A;  3VDY A;  4RHS A;  1BBU A;  1GO3 E;  1VCI A;  3FDT A;  1O7I A;  2MQH A;  2OF1 A;  1SYE A;  1XPR A;  3MFG A;  1J6Q A;  5KYI A;  1OTC A;  1JWS D;  1NSN S;  1A3T A;  1CT1 D;  1LTA D;  2MFI A;  2Z8L A;  1VQO A;  2UU9 Q;  1B1Z A;  4LJZ C;  2BE5 D;  1IYJ B;  4YWK A;  1DYQ A;  4A3K B;  1EU4 A;  1JE5 A;  1E22 A;  3R2T A;  1A2T A;  1Q8I A;  2HIX A;  1XYI A;  1E2W A;  3U58 A;  4HSP A;  4Y52 H;  1B9N A;  3DMU A;  1VQC A;  1G6Z A;  5FLM H;  3O13 A;  4DN4 M;  3BZD B;  4K5V A;  4A3J H;  3GTL B;  4NKL A;  1A62 A;  1H95 A;  4EQP A;  3CQZ B;  2HD3 A;  4LF7 Q;  2CW0 C;  2LY7 A;  2KHJ A;  4X64 Q;  4GOP A;  4LF6 Q;  2UUA L;  5JPM C;  4LF5 L;  1HUN A;  1STN A;  3E3X A;  4R8I A;  1Y1W H;  1ZEQ X;  1I4P A;  2KCM A;  4ZK9 B;  1PZJ D;  3VR2 A;  2RKS A;  1PYW D;  1ET9 A;  1VDZ A;  2YU9 B;  3GTK B;  1PYB A;  3S2H B;  4LF4 L;  1KDB A;  1TWF B;  1IXR A;  1K3B C;  4LF8 Q;  1JWU D;  4R4T A;  4GOP B;  2E2H B;  3H15 A;  1N34 Q;  3KOJ A;  1MHW C;  2XIW A;  1KNA A;  1MGS A;  2A5H A;  2OQ0 A;  2F0V A;  4G7O C;  1BO0 A;  3ITP A;  4K5X A;  3V96 A;  2B63 B;  1R4P B;  3CC7 A;  2K05 A;  2TSS A;  4C3I B;  1QCB D;  4XQQ A;  1EU3 A;  3OMG A;  1G8Z D;  5HUR A;  5CV6 A;  1QUQ A;  2PQA A;  5J1Z A;  1CM9 A;  2NVT B;  3SK6 A;  2K75 A;  1YJW A;  4ZKC B;  2F0M A;  4EX5 A;  3CP0 A;  3HZX A;  4WJW A;  3JAM i;  4A3L G;  1PH5 A;  1B3A A;  5GAG C;  4FF4 A;  3S1R B;  3HKS A;  3KJO A;  2SOB A;  4DUZ Q;  1ILP A;  4A3C H;  4JI6 Q;  1QUQ B;  2PQA B;  4IUT A;  5LL6 S;  3HFZ B;  2OWO A;  3HKZ E;  4KJN A;  2F4I A;  3PF4 A;  1MIU A;  4B3T L;  3U9S A;  4DK6 C;  1MBY A;  2O4X A;  3PO3 G;  5I6W A;  1FVI A;  5D14 A;  4C2M B;  4KHZ A;  2SDF A;  3TS0 A;  4FF1 A;  2QDB A;  3FRP B;  1CFM A;  3J80 i;  5M5W B;  4MNO A;  4GN4 B;  5DLQ E;  2H5X A;  2N49 A;  1FJG L;  1IW7 C;  1WCM H;  2KED A;  4O42 A;  4F88 A;  2KBN A;  4DNR B;  5JJK A;  5C5M A;  2EYL A;  3K58 A;  1KNE A;  3CMA A;  1JJ2 A;  5IYB G;  2R7Z G;  2RDG A;  2F0K A;  5C3E B;  4XT3 B;  3AFP A;  5LMU Q;  3NUC A;  4ZRZ A;  2A6H D;  3L3O C;  5ELN A;  4PV1 C;  2LS0 1;  4DV1 L;  4DV2 L;  2AMC B;  4CKB A;  3G6J B;  1LV9 A;  3GTO B;  5CR3 A;  2IW3 A;  3GQB A;  2DNE A;  3TZU A;  4KTA A;  5IGB A;  2LKV A;  3ND9 A;  1FGB D;  2WV6 D;  3P75 A;  2RDH A;  3OW2 A;  4X3S A;  1G91 A;  5CV9 A;  1WTH A;  4L5R C;  4GOP C;  1YNX A;  1MSG A;  3FP9 A;  3T4A C;  2QIL A;  3E6Z X;  1SNM A;  3TS2 A;  1BF4 A;  1EZ8 A;  2G5D A;  4A3G H;  3K80 C;  2Z4I A;  4B9W A;  1HZ9 A;  3HOV H;  3KLW A;  4UP9 A;  3CW2 C;  4C1N K;  3A5U A;  1PFM A;  1KRS A;  1VS0 A;  1UWV A;  2F0H A;  5EPJ A;  2B2U A;  3D6W A;  4A3F H;  1WTW A;  4K2L A;  1I94 Q;  4NB3 A;  2L9H A;  3A5Z B;  1SFO H;  1EFI D;  3VA7 A;  1CKN A;  1IKM A;  1EIF A;  1LAB A;  1Y1V B;  3NE5 B;  2B8F A;  4PZ8 A;  1RIP A;  2EJM A;  2F0P A;  3EVQ A;  1N33 L;  2F0N A;  2ICE C;  3EA6 A;  4JK1 C;  3IFT A;  5EKL A;  2JJQ A;  2K4K A;  4FNF A;  1CA6 A;  1S5E D;  3HOY G;  1LO5 D;  3I73 A;  3VR4 A;  1U9R A;  4F8M A;  3LNN A;  5IT9 c;  3J7Y W;  1PH8 A;  2UXC L;  4HIO A;  1BR9 A;  3HKZ G;  3M7G A;  5I4D A;  1CKN B;  3J81 i;  4B3R Q;  2VXW A;  4I7A A;  4K2K A;  4DNI A;  1K8O A;  1PH7 A;  1R9T B;  4HR7 B;  3BVM A;  1B2T A;  4G4K A;  4QUF A;  5JEA J;  3NEM A;  5FO9 B;  4XYQ A;  3MAQ A;  2WFW A;  1JC7 A;  2EYH A;  1K83 H;  3D31 A;  2JA9 A;  2K5W A;  1QJO A;  1O7Z A;  2PZU A;  2YYZ A;  2F0G A;  1BQQ T;  2EY2 A;  4HSV A;  4DV0 L;  3LWE A;  3OPO A;  3U50 C;  4LF9 L;  4LFC Q;  1UEB A;  2WAC A;  2Q2T A;  5AJ3 L;  4LFA Q;  4A75 A;  4BY1 B;  4ZQ3 A;  1HQR D;  4CDD C;  1HZB A;  5C0X G;  3PQI A;  4AYB G;  3S1Q B;  1G6P A;  5C4X B;  1TWC B;  4P73 A;  1CA5 A;  3E9H A;  1JQY D;  5FLX E;  3J81 j;  4DR4 L;  3MZ5 A;  1ZKO A;  4N8X 1;  3CPW A;  2A8V A;  2R93 B;  2VUM G;  2A69 C;  3RMH A;  3GTM H;  2Q8R E;  2F0D A;  4JV5 Q;  1PTO F;  3W5O A;  4YY3 L;  1STA A;  1BCP B;  4NXN Q;  3PUW A;  1EWH A;  4JI4 Q;  4B3M Q;  2K01 A;  2JA7 B;  2F0J A;  3WWV A;  2UUB L;  3H3V I;  5M5Y B;  3SVM A;  3C1E A;  2AHO B;  2E5L L;  4ZLT F;  3HP3 A;  3NTK A;  3G48 A;  2D62 A;  1VF7 A;  1SRU A;  3V2T A;  3GTJ H;  3HOW H;  1ICW A;  4JI3 L;  1CZW A;  1O7L A;  4ME3 A;  1S5B D;  2HHH L;  1SNO A;  3IRB A;  5TSS A;  1K8A C;  1Q82 C;  3MHB A;  1B50 A;  3TEH B;  3HOX B;  1EQR A;  2AWN A;  2B2U C;  2QF7 A;  4BXX H;  1XMQ L;  1G51 A;  4L5Q A;  3OW7 A;  4AQY Q;  1V1O A;  2PYK A;  2KHS A;  4DR7 L;  1EY7 A;  1N32 L;  5FLX L;  1RCV D;  1V1Q A;  3PCO B;  1PH2 A;  1N9W A;  1HZC A;  1GD7 A;  1FJG Q;  4CHT B;  4ALP A;  1YEZ A;  3F1Z A;  3H91 A;  1SMY D;  5GQO A;  3I4N B;  4LUZ A;  3M4Q A;  4PMB A;  3FKI B;  1IL8 A;  1WD0 A;  3RNU A;  2PI2 A;  4X65 L;  3J80 c;  2IX1 A;  4JI1 L;  4RGO S;  4GZY C;  3BJU A;  5G3L D;  4DV2 Q;  2EPB A;  2XRQ D;  3UI2 A;  1RF2 D;  3DUZ A;  4IPD A;  3A7L A;  2B63 G;  5K5P A;  3HOU B;  2XNA C;  4C3I G;  2EOT A;  1QVF A;  3OWF A;  3PGZ A;  1SDF A;  1YI2 A;  2A74 C;  4H13 C;  2QEX A;  5E3F A;  1QIL A;  3S1N B;  5JAV A;  5I6Y A;  3PIO 3;  3PO3 H;  2EE1 A;  3ERQ A;  2Q8I B;  2NVQ B;  1E7Z A;  3MXG A;  1F2L A;  4QCL A;  1WOC A;  1ESR A;  5JVG 3;  4PZ6 A;  1K0R A;  1D5X C;  2E2I H;  1DOK A;  1LTT D;  1I50 B;  3K0Y A;  1EOV A;  3KF6 A;  1YHQ A;  2N3S A;  4C3H H;  1YIJ A;  2E75 C;  4H44 C;  2R3Z A;  4R1J A;  1NMF A;  2WIN B;  2UU9 L;  4IFD J;  2CH4 A;  2NTT A;  2VZA A;  4MTK A;  1VMC A;  2Z9H A;  4DAM A;  2ATW A;  4GKK Q;  4BY7 B;  3NWS A;  1S5F D;  3KF6 B;  3CCJ A;  3AEV A;  3PUV A;  1NCV A;  5JPN C;  4CGY B;  1OXX K;  3FPU B;  1TS5 A;  3K7A H;  4XXE A;  4Z9C B;  4DAY A;  2WP8 J;  5M3M H;  1U4L A;  4RGM A;  2JA8 B;  1X56 A;  1HFN A;  4JI8 Q;  5C3E G;  2F0W A;  4S3S A;  2K14 A;  4P71 A;  5D3I B;  1VQE A;  1MKH A;  2Z6B A;  4HJ7 A;  3KYH C;  4LF7 L;  1TWH H;  4X64 L;  1A2U A;  1L1O A;  1VQ8 A;  3GTG H;  4DAY B;  1VQI A;  3NPP A;  4HJ9 A;  2NUC A;  2FMM A;  1VQG A;  2DGY A;  1SNQ A;  3NWT A;  2IX3 A;  5IP9 G;  2PNR C;  3DWA A;  3S15 H;  3U4V A;  3Q24 A;  4AH6 A;  1DM0 B;  4LF8 L;  3N6R A;  3I4M B;  4RFB A;  3EIV A;  4WFN 3;  4P2C B;  5DM7 3;  4JBJ A;  1XTC D;  4P75 A;  5DNF A;  1PH4 A;  1JJG A;  3HOY H;  2X6L A;  4WRD A;  4P72 A;  3SE0 A;  4G57 A;  5KGU A;  3A55 A;  1BVS A;  1TWA B;  3GTQ H;  2PNH A;  2IHE A;  1O78 A;  3HEJ A;  3RZD H;  3W3A A;  1H9K A;  3WOE A;  2RA4 A;  3BZC A;  2EDG A;  1W3S A;  2NZH A;  5JJL A;  1Y1V G;  2UUB Q;  3MTS A;  3X3M A;  3KLS A;  1D2B A;  1EIH A;  1W2B A;  5EBD A;  2JEA I;  2E5L Q;  4DV3 Q;  3BVG A;  3K59 A;  4IUN A;  1EQV A;  3CRK C;  1DOM A;  3URY A;  4DV6 Q;  4DUZ L;  4PZ7 A;  4A93 B;  4JI3 Q;  4JI6 L;  3S14 H;  2H1E A;  3EJI A;  1CK1 A;  4Y7N B;  2IX0 A;  4JPB W;  2NTS A;  2QW7 A;  3HGB A;  5KRU A;  1SBB B;  1WTO A;  2MO1 A;  1IBL L;  1HTL D;  3TQY A;  1XMQ Q;  3T13 A;  4A3B B;  2A73 B;  3S2D H;  4YCW A;  4F7X A;  5IGD A;  3TDQ A;  1N32 Q;  2VB2 X;  3TRZ A;  4O2D A;  2EYM A;  1Z6H A;  1GUS A;  2VUM H;  2GVA A;  3I4O A;  3BG3 A;  1JE4 A;  4JVZ A;  4JYA L;  1VF5 C;  1QVC A;  1QB5 D;  2A69 D;  4BBS H;  4WJ4 A;  2MHV A;  3P7J A;  2EZV A;  3VYR A;  4KKS A;  4GLX A;  3LX0 A;  5LMU L;  4IPH A;  1S5C D;  1W6K A;  2EY1 A;  4KHP Q;  5D3D A;  4JI1 Q;  1B9M A;  1SYF A;  2D9U A;  2AQ1 B;  1H9J A;  1V1P A;  5GAE C;  1A6X A;  1DCZ A;  3EBE A;  2EXD A;  4RKB A;  5M3F H;  3AYH B;  1NR2 A;  5IP7 H;  1EY0 A;  3QB3 A;  1JOO A;  3GP7 A;  2F0F A;  2K5V A;  5C4J B;  1NAP A;  2BH8 A;  5KND A;  2X6G A;  1KIX A;  4POG A;  1VQM A;  3IL8 A;  2RDF A;  3E0J A;  3ULP A;  2JA5 H;  3GTL H;  2QDL A;  1AE2 A;  3SK4 A;  1EYC A;  1I4G A;  1XX8 A;  2WB1 B;  5JJZ A;  1I6H B;  1ONL A;  4A3I B;  1U5K A;  1PA6 A;  3MA2 B;  2L0C A;  4DKA C;  3NTI A;  3BVZ A;  5EKI A;  3HOZ B;  1I94 L;  4QIW E;  3CXC A;  2H4O A;  1FGU A;  5C3W A;  3S17 B;  1PDQ A;  3QOL A;  5ELO A;  1HUM A;  4WOR A;  3HOX G;  5T1G A;  5CBE E;  2E2D C;  3D4R A;  1SLJ A;  2OCE A;  1H9M A;  4EQN A;  1TWF H;  2YTY A;  1QNU A;  1C0A A;  5HY6 A;  1NTG A;  3KJP A;  1TY2 A;  5COR A;  4OXP A;  1IKL A;  3I4L A;  1VQN A;  4CDC C;  3H3V H;  4B3R L;  4A3D G;  4DK0 A;  2LSS A;  1XNR Q;  3OSO A;  5C44 B;  2OT2 A;  3K57 A;  4A3M H;  1L0W A;  1EYD A;  3D3R A;  1R4Q B;  2E2J H;  3PIP A;  1RTN A;  4GNX A;  5FJ8 G;  1VMP A;  4C3I H;  2O5J C;  3Q8D A;  3I4N G;  1MJE A;  3R8B A;  5IWA Q;  3FKI G;  1KAW A;  4L8J A;  5FOB B;  3G71 A;  3Q22 A;  2R92 H;  1X3Q A;  4K6D A;  2K04 A;  2PPB C;  1PTO B;  1C9O A;  2EVB A;  5K36 G;  5J22 A;  1PMR A;  2ZJP A;  4XTC S;  1N8R C;  1MD2 D;  4GNX B;  4OO1 G;  3RLO A;  1NJI C;  1S5D D;  1JOQ A;  5GAD C;  3NHH A;  5E1F A;  1TS2 A;  4G7H C;  1SE3 A;  5COY A;  3EFX D;  2KCN A;  1QZG A;  3D4W A;  3QOJ A;  3U9O A;  3HOU G;  4TVA B;  4LFC L;  4IUP A;  3BZK A;  3NSW A;  2CWA A;  4LUV A;  4KN4 C;  2AQ3 B;  4LFA L;  4ZCK A;  1O7Y A;  3PF5 A;  3GTP B;  3K7U C;  1CUK A;  1F2Z A;  2Z4H A;  3PO2 B;  5M5X B;  2CFM A;  2AKW B;  4DR2 Q;  5CBA E;  2ES2 A;  1E1T A;  5M5W H;  4TKO B;  4DUY L;  3L9A X;  5LL6 X;  2K33 A;  3ULL A;  4M8A A;  4JV5 L;  3QG1 A;  4C3J H;  1FYC A;  1J8I A;  2XWB B;  4NXN L;  5IYC H;  1HNX L;  3QO2 A;  2RHQ B;  1GM5 A;  4B3M L;  4JI4 L;  4GLV B;  2MGS A;  2X69 A;  4BBR H;  4JCV E;  3STB C;  5C3E H;  1HCZ A;  1WD1 A;  2HCI A;  4FF2 A;  2C9O A;  2OTJ A;  3CCE A;  1JCK B;  1OXS C;  1YNN C;  4OX9 Q;  4BY7 G;  2VQE L;  3GDE A;  1F2M A;  5IT9 E;  2DNC A;  4KK7 A;  2VL6 A;  2E74 C;  3M85 A;  4MZ9 A;  1TY0 A;  1MSH A;  3VYT A;  4A3J B;  1B70 B;  1SE2 A;  2K03 A;  4MHE A;  2WII B;  2JA8 G;  5IOC A;  4AQY L;  2XWJ B;  1IBL Q;  1WJJ A;  4I7Z C;  4U68 A;  1HPC A;  2VNU D;  1Q81 C;  1PZI D;  1KLG D;  3PUY A;  5C4H A;  1ILQ A;  3TP8 A;  5EJW A;  1LT4 D;  2F03 A;  3C2P A;  3BDO A;  2WAQ B;  4RMF A;  3MEF A;  2RSO A;  4JYA Q;  4GN3 B;  4BA2 I;  2UXB Q;  2ZM6 Q;  3HS0 C;  1PH3 A;  1I4Q A;  1I4R A;  4LMQ D;  1VQB A;  1GXD C;  5DAU A;  4DK3 C;  4FXK C;  4NW2 A;  3T51 B;  2BDN A;  3KDF A;  1TVX A;  4DV7 Q;  2OQK A;  1K73 C;  5IYD G;  2AQ2 B;  4GNX C;  1E2Z A;  3I4M G;  4IFD H;  1STH A;  2K50 A;  3KBG A;  4LWC A;  1PRT B;  1PH6 A;  1FL0 A;  4AYB E;  4IQZ A;  1SRO A;  4J6H A;  1SYB A;  3KDF B;  4ZUI A;  4OEM B;  2YTV A;  3TP5 A;  4U67 3;  1JJC B;  2NVX H;  4JOI A;  3VA5 A;  3SXH A;  3OTO Q;  3IFD A;  1SNP A;  5ISR A;  5C0X J;  5CMD A;  4TSS A;  4HJA A;  2UUC Q;  2JA6 H;  4EQ5 A;  5I9P A;  1JR0 D;  2FXQ A;  2MJ8 A;  2AUK A;  2VQF Q;  1WVL A;  2R61 A;  3CPF A;  1UNS A;  1RKN A;  1BNZ A;  1LTR D;  4A93 G;  1ASY A;  4X3T A;  2LFN A;  1EZ6 A;  1M1K C;  1D6E C;  1AP0 A;  1EYG A;  4RA8 A;  2GN5 A;  1SJH D;  1Y69 U;  4E6I A;  2HQL A;  2JE6 I;  5JVH 3;  1EQQ A;  1HNW Q;  2QEJ C;  1TWG H;  3JAM E;  1B53 A;  4A3B G;  4GKK L;  3S1Q H;  1EFW A;  1WCM B;  3I8Z A;  4ODG A;  1JMC A;  4KV6 A;  1UE6 A;  1DXM A;  5GRO A;  4J1M A;  1L0X B;  2Z1C A;  1V43 A;  4JI8 L;  2J7Z A;  1KQS A;  2NBF A;  4P74 A;  5CV4 A;  3GV3 A;  2HUG A;  1ENA A;  1NUC A;  4QUC A;  1NNX A;  3MXN A;  2PCF B;  2HQE A;  4ZAI A;  4K6L A;  3KLR A;  4GKJ Q;  4DA2 A;  3RN5 A;  1I3Q H;  4IJL A;  5LMN L;  1U4M A;  4OWT B;  4KLK A;  1BOS A;  2KUM A;  4M1U B;  5G3L F;  1XNQ Q;  4RWS C;  1STY A;  3I2Z A;  1EOT A;  5LMN W;  1JOR A;  1KHI A;  3P1H A;  4A3G B;  2A19 A;  1IBK Q;  2ZTE A;  1YHB A;  2TMP A;  1TQO A;  1PRT C;  3HOV B;  3S16 H;  3JAM L;  3ND8 A;  1YVC A;  3F2U A;  5EKK A;  1Q8K A;  4B3S Q;  1D7Q A;  2K28 A;  4A3F B;  1VQK A;  3K81 C;  2M9V A;  4HIM A;  1SE8 A;  4JC0 A;  4A3D H;  2FIN B;  5KEE A;  1SFO B;  4DUY Q;  4DR3 Q;  1EIG A;  1T5X D;  5FJ8 H;  4QF4 A;  3QJY A;  5HGT A;  4B9X A;  1HNX Q;  1CI3 M;  3A0J A;  1MJC A;  1EEI D;  1G2S A;  5IIF A;  4BWG B;  2A6E C;  4GLA C;  4H02 A;  4DF7 A;  4ZKB B;  2Q2U A;  1L2F A;  2EJG C;  1SEB D;  4QY7 A;  2D0P A;  4DV3 L;  1Y8O B;  3NEL A;  4HCS A;  2FHT A;  4O0A A;  5K36 H;  1EWC A;  1K9M C;  1Q12 A;  5JJI A;  4DV6 L;  1EY8 A;  1ICF B;  4KN7 C;  1DOL A;  5E7N A;  2CW0 D;  2VQE Q;  4A3K G;  1OO9 B;  1EL0 A;  2XSC A;  1CKO A;  4YWM A;  3CCM A;  2YV5 A;  3HOU H;  1U4P A;  2ID0 A;  4YCV A;  1KLU D;  1A3V A;  2K6A A;  2ZXR A;  1YJN A;  4FDB A;  1QZH A;  2NVY H;  4TRD A;  4XT1 B;  2NN6 G;  1C4Q A;  1BBW A;  3TME A;  2QKI C;  4IUQ A;  1X54 A;  1OXV A;  4F87 A;  3J81 E;  4EQO A;  1PYS B;  1RJT A;  1TII D;  4HMI A;  5JEA G;  2ZJR A;  1VQP A;  1EY9 A;  4CKC A;  2G9H D;  1HQM C;  4HTH A;  4N9T A;  3I55 A;  4KHP L;  1HR0 W;  3D8G A;  3BDC A;  3STB D;  3S1M H;  3F8T A;  1Q1B A;  4X66 Q;  5ELD A;  2OEO A;  2B2W A;  3GTM B;  4HIK A;  3GD7 A;  4A3L H;  3PO2 G;  2J0T D;  1PFS A;  2I5M X;  1JB7 A;  1J5E Q;  5EPL A;  3TP6 A;  4DU9 A;  1ENF A;  1YNN D;  1SAP A;  1KL9 A;  2YTX A;  3OHX C;  1HTP A;  1HHV A;  1T9H A;  1STB A;  5BR8 Q;  2KCC A;  2JA8 H;  2BE5 C;  2F3I A;  1UE1 A;  4YHH Q;  1TKW B;  5EAY A;  3GTJ B;  3HOW B;  2XVS A;  1F9Q A;  2QA4 A;  1F9R A;  2MP1 A;  1BCP C;  3OIQ A;  2K5N A;  1CHQ D;  1WI5 A;  4LK1 C;  4FYD A;  2JEB I;  2F52 A;  3CC2 A;  1IW7 D;  3I72 A;  5IYB H;  2R7Z H;  3RLN A;  1EIY B;  4JI7 Q;  2R7D A;  4RG1 A;  4A3J G;  4IOA A;  3VR6 A;  5HGQ A;  1NR4 A;  2E76 C;  5FO8 B;  2ZXO A;  5FLX c;  3I4M H;  5LHY 1;  1EY4 A;  4LAA A;  2B2T A;  4CDF C;  2Z0S A;  3NK9 A;  2L12 A;  1XNR L;  4KY6 A;  3F2D A;  1LTI D;  3VYS A;  3RZO B;  2Z6K A;  1UAP A;  2KVM A;  2F0U A;  2I0Q A;  1CSQ A;  2F0I A;  1C48 A;  2WAQ G;  4A3E B;  3CCU A;  2NB0 A;  4IFD I;  1HJP A;  5IWA L;  1ET6 A;  1C7Y A;  5I2Y A;  1PFN A;  2D5D A;  2E8G A;  2KOL A;  4H0L C;  5IOD A;  3UDF A;  1STE A;  3KUP A;  3EQL C;  4NPS A;  1ZYR C;  4IOC A;  4BY7 H;  4KD3 A;  1K8G A;  3Q6S A;  3VR5 A;  1HNZ Q;  1FR3 A;  2QGQ A;  2BCO A;  5DM6 3;  3H0G B;  5LMN Q;  1D8L A;  1IHZ A;  4A93 H;  5EGT A;  3ER0 A;  2IT1 A;  4GS3 A;  2L5T A;  3MEH A;  2ICI A;  1VQH A;  1ROD A;  1K3R A;  1Y14 B;  2XN9 C;  1WTV A;  3A56 A;  1HRJ A;  1TU2 B;  3RR5 A;  3K5M A;  4PG3 A;  1L1O B;  1PFB A;  5KNC A;  3CCS A;  1LTB D;  2LXK A;  4DR2 L;  2E2I B;  2F0S A;  5A35 A;  4DR6 Q;  3N52 A;  4A3C G;  4JI2 L;  1BUV T;  4C3H B;  3UDG A;  2JK8 A;  2PMZ B;  3X3N A;  1PVO A;  2NZO A;  4I65 A;  4DNT B;  1N36 Q;  5I9O A;  3C1F A;  1I5F A;  4L6T B;  4BA1 I;  3OOC A;  3NBH A;  1HA5 A;  3Q0A A;  1EY6 A;  1IBM Q;  2JXM B;  2CCZ A;  5ELB A;  4DAP A;  3KF8 A;  4R4I A;  1AFP A;  1NMG A;  4OX9 L;  1AW7 A;  3K7A B;  3J7A 5;  1WCM G;  3BYY B;  2EXZ A;  3K0X A;  4A76 A;  3NQT A;  2L4N A;  4JW0 A;  3M3Y B;  3A8I E;  2RSN A;  1LT5 D;  5M3M B;  1S72 A;  1F77 A;  3NBH B;  4XYO A;  4HED A;  1K0S A;  2A6H C;  3FMC A;  3M4O B;  2IJ0 A;  3KF8 B;  4UDU C;  1M8A A;  1RDP D;  5C0X H;  3RN2 A;  2DJF C;  3UDI A;  3AB9 A;  1KAB A;  3GTG B;  5CYU A;  1UEA B;  1C8C A;  4FO2 A;  3CME A;  1KTK A;  3M9B A;  3RD4 A;  3B6Y A;  3CC4 A;  1PXU A;  3VR3 A;  1D1I A;  3S15 B;  4BS9 A;  1TT2 A;  2VY3 A;  3A8J E;  4OWX B;  1HXY D;  1FNW A;  4JBW A;  5KNB A;  3CKI B;  2UXB L;  2ZM6 L;  3KBX A;  2B2T C;  4LW1 A;  4PMC A;  2Z6K C;  3BYT B;  4KD4 A;  3F2C A;  4DV7 L;  2SEB D;  4A3G G;  1A0I A;  3PMF A;  4QMG A;  4CKE A;  3HOV G;  4BY1 G;  5AFW A;  5CV5 A;  3SK5 A;  2PI2 E;  4OIJ A;  3D0F A;  2F0T A;  3HKZ B;  5FKA C;  5IGG A;  5C4X G;  5NUC A;  4A3F G;  1GUO A;  4KI0 A;  3GTQ B;  4A3K H;  2R93 G;  3RZD B;  3G4S A;  1L1O C;  1UE7 A;  2FFK B;  4IAL A;  3OTO L;  1BBX C;  2B2Y A;  3A7A B;  5BN3 A;  2JA7 G;  4OO1 I;  1V1P B;  2UUC L;  3NTH A;  1EWI A;  2I5L X;  2NN6 H;  4PMW A;  2VQF L;  3CAM A;  1AEX A;  2IHF A;  1SMX A;  3S14 B;  4YCU A;  3CQZ H;  3NP8 A;  2ZJQ A;  3K8A A;  2ZTD A;  3I3C A;  3A74 A;  3GO5 A;  1QE6 A;  3MWY W;  3ULJ A;  2CKZ B;  2PZT A;  1EQT A;  5F2D A;  1JOK A;  2YU9 H;  4FP5 D;  3PV0 A;  3GTK H;  3S2D B;  2F1M A;  3S2H H;  1HNW L;  1TXY A;  3J7A F;  1U0L A;  4DFA A;  4DGZ A;  4KY5 A;  4DAV A;  4DV5 Q;  3GTP H;  1FNU A;  2E2H H;  2VUM B;  1SNC A;  1K28 A;  2VW9 A;  1CQV A;  4BBS B;  4RCO A;  4N9P A;  1E2V A;  4CDE C;  2B63 H;  3HRZ C;  1M90 C;  1VQ4 A;  2RHS B;  1VQL A;  2K7V A;  5I2X A;  3I90 A;  3E9I A;  4A4I A;  1WFQ A;  1AZP A;  1FD7 D;  1YZ6 A;  4IJH A;  1ZXT A;  4HN7 A;  1RL2 A;  2NVT H;  4IUU A;  2K52 A;  4GKJ L;  2MNA A;  5M3F B;  2N88 A;  3H09 A;  1A8V A;  4JG2 A;  3CCR A;  2Q8T A;  3NEN A;  3I91 A;  1BCP D;  4NXM L;  3S1R H;  3J7A V;  1XNQ L;  1MI2 A;  4DR5 Q;  3JC6 6;  4OON A;  5IY0 A;  4B08 A;  2KQ3 A;  3A54 A;  1KC8 C;  1IBK L;  3PSI A;  2JA5 B;  2RQX A;  3DHQ A;  2KHI A;  2PMZ E;  1YJ9 A;  1CZG A;  4DV4 L;  2VB3 X;  4B3S L;  3SGI A;  4IUR A;  4AIM A;  1B7Y B;  2BOS A;  1WTP A;  4K8J A;  4C2M H;  3HOW G;  4QJF A;  3TZD A;  4JI0 Q;  2JSO A;  2CH4 W;  4APV A;  4JI2 Q;  2I07 B;  1XTD A;  4DR3 L;  1KDA A;  5DEH A;  2UXD Q;  4N8F A;  2BH2 A;  4BXX G;  2V1C C;  1DD2 A;  1X3P A;  1JT8 A;  4RHR A;  3S9W A;  3PUZ A;  3PUX A;  1EYA A;  1K8M A;  1EY5 A;  4XQN A;  2L15 A;  2WKD A;  4A3M B;  3I70 A;  2B2Y C;  1CHP D;  1V9P A;  1SMY C;  1ZYR D;  3SEB A;  1LT6 D;  3NQI A;  1XMO L;  1E3P A;  3GTO H;  2E2J B;  4RH6 A;  5E4X A;  1AZQ A;  3W1B A;  3UE0 A;  1SYC A;  1LAC A;  1KXL A;  2JN4 A;  5IP9 H;  1KDC A;  4A3E G;  3BS1 A;  3BDL A;  2R92 B;  3L7Z C;  2B2V A;  1BXT A;  5FK9 C;  1VQ6 A;  1VQ5 A;  4MN3 A;  3UDX A;  2ZT9 C;  3OWE B;  3ERS X;  2RF4 A;  4IPG A;  4X6A H;  1YNJ C;  4HJ8 A;  1QVG A;  4DR1 Q;  1Y1W B;  1X55 A;  4KKU A;  3FPP A;  3A8K E;  2K1B A;  3FVQ A;  1CSP A;  3I7F A;  3H0G G;  2F0Q A;  3DM1 A;  1X3E A;  1PH1 A;  2EJF C;  4UAI A;  1PTO C;  4UY8 C;  5KIX A;  1QWY A;  5JOB A;  1Y1V H;  4V19 0;  2OTL A;  1BDO A;  4X66 L;  1SYG A;  4RAU C;  5IT9 L;  4C3J B;  5T1I A;  1J5E L;  1E1O A;  1OXU A;  1SXT A;  3PIP 3;  5IGF A;  3Q23 A;  2JYO A;  2WB1 E;  2IY5 B;  4C3H G;  3K5N A;  2F3W A;  1CKM A;  4FF3 A;  2EQS A;  4BBR B;  1NY4 A;  4NDX A;  3T1Y Q;  2EYP A;  2I46 A;  1RTO A;  1JB3 A;  5BR8 L;  1VQD A;  1IL2 A;  4Q0F A;  5M9O A;  4QL5 A;  5FO7 B;  1R9T H;  4YHH L;  4FXD A;  3E0E A;  4OHJ A;  4K0K Q;  4KJO A;  3WDN A;  2M00 A;  2KEN A;  2Y0S B;  1A63 A;  4JBM A;  2C5C A;  2DUD A;  2R7F A;  4X62 Q;  5M3M G;  5C0X I;  5C4Z A;  4CJ1 B;  5EQ0 A;  4JI7 L;  1LT3 D;  1G2T A;  4ZUJ A;  3DM3 A;  2FJ2 A;  4KKT A;  3H3V C;  2RBM A;  3P20 A;  1GOZ A;  1AH9 A;  2KEE A;  4BY1 H;  1GKH A;  1NE3 A;  2FMC A;  4K5W A;  4JI5 Q;  5H1S E;  4DXG A;  5C4X H;  1TWC H;  4LFB Q;  4DXF A;  4YWL A;  2EY5 A;  2AUJ D;  1LTS D;  3DXJ C;  1Q86 C;  2R93 H;  5IGE A;  2CQO A;  1WTR A;  1HZA A;  3EN2 A;  3IKJ A;  1SND A;  2OXP A;  1XXG A;  1ML0 D;  1KD1 C;  5A2Q E;  1GUT A;  2JA7 H;  1A15 A;  5M5Y H;  3J80 E;  2HDM A;  2JQO A;  3OYY A;  2B2V C;  3E5S A;  3NXW A;  1KAA A;  4V0B A;  1HNZ L;  4UP8 A;  1QOH A;  1RD9 D;  3AU7 A;  1JWM D;  4ID6 A;  3ZYY X;  4QB4 A;  2NVX B;  3OIP A;  4UP7 A;  4NXM Q;  2EY6 A;  2NN6 I;  3LWU A;  1GHJ A;  2JA6 B;  3HOX H;  2CHB D;  3MXN B;  4UPA A;  4K8I A;  1WTQ A;  4OL7 A;  1X65 A;  1PH9 A;  2ASB A;  4XIG S;  3PIO A;  4DV4 Q;  4LUO A;  2DN8 A;  3GV6 A;  2WB1 G;  2UUA Q;  3C3L A;  4LF5 Q;  4DR6 L;  4A3I G;  1HFG A;  2V4D A;  2GVB A;  1ESF A;  1P8L A;  2IL8 A;  1PZK D;  2K32 A;  2ZXP A;  4IN3 A;  1SR3 A;  3R93 A;  3HOZ G;  1TS3 A;  1N36 L;  2HCC A;  2SNS A;  4KMU C;  2EYO A;  3CCL A;  3I4N H;  5A2Q L;  4LF4 Q;  1TWG B;  3G7L A;  3FKI H;  1II3 A;  1OXT A;  4NP5 A;  1IBM L;  3J80 L;  3AFQ A;  2CWP A;  2EIF A;  1STG A;  4JOI C;  1GUN A;  2CQA A;  3QWN A;  3FHW A;  1T5E A;  1WYD A;  5ELF A;  4R8N A;  1XWE A;  1WTX A;  1XMO Q;  4OO1 H;  4POF A;  3K6O A;  2PZW A;  3TBI B;  4JBK A;  4BBS G;  1B44 D;  3CCV A;  1GUG A;  2RCN A;  5C44 G;  2N55 A;  1KRT A;  1PHJ A;  3MVV A;  1EUJ A;  1YIT A;  1BKB A;  4HAE A;  5E4W C;  1I4X A;  3K5L A;  4RCN A;  4DK1 A;  1K83 B;  2WAQ E;  1VQA A;  4X3U A;  5ELC A;  3S1N H;  1SJE D;  1I3Q B;  5J3B A;  4RKL A;  4KY7 A;  4RGN A;  2IPK D;  3CRL C;  2NVQ H;  5M3F G;  4KHV A;  1L0Y B;  3AMU A;  5IP7 G;  4GN5 A;  4IUV A;  2PW7 A;  3MFY A;  2ENB A;  1ENC A;  1HR0 L;  1I50 H;  2NYZ D;  3S16 B;  2A68 C;  3WOF A;  1W6J A;  4QQB X;  4G7Z C;  4B3T Q;  3TP7 A;  5EBC A;  3JAM c;  2JA5 G;  1B3Q A;  2M2L A;  4ZYS A;  3SK8 A;  3T1H L;  4HMJ A;  3OMC A;  1NBW A;  4OIK A;  3ICE A;  4A3D B;  2AWO A;  4L63 B;  3CCQ A;  1GVP A;  2RVL A;  1QNK A;  2N78 A;  4OGQ C;  1JIC A; 
#chains in the Genus database with same CATH homology
 4K14 A;  3KK7 A;  2DY7 A;  4EVO A;  2PW5 A;  1GJX A;  3R3O A;  2QCP X;  4FVM A;  2L55 A;  2BDO A;  3T16 A;  2EYJ A;  3R2I A;  3T53 B;  3J81 L;  4FXG C;  1YNJ D;  2SNM A;  3DWP A;  5BN5 A;  3IAY A;  5EPK A;  5C5L A;  2NVY B;  5IGC A;  2MPM A;  2J4X A;  2DY8 A;  1PTO D;  4TQU S;  1D1K A;  3M7N A;  2O2L D;  1O80 A;  4CJ2 C;  1D5Z C;  1PRT F;  1HA6 A;  3V05 A;  2KA7 A;  2G9D A;  2L11 A;  4ILW A;  3TSS A;  1SSO A;  1UUP A;  2NWG A;  4IZ8 A;  3S1M B;  4QIW B;  4PNY A;  3SDZ A;  4R9W A;  3SHL A;  4CJ0 B;  5KYL A;  1SYD A;  2XRS D;  4ULL A;  4C3J G;  1Y8N B;  1IYV A;  3SR1 A;  3MC0 B;  5BN4 A;  2PQE A;  1PLF A;  3H94 A;  3PO3 B;  1DJR D;  1M4V A;  2BA0 A;  3M4Y A;  3KLS X;  1Z7T A;  5C3X A;  3C46 A;  5J39 A;  1GUW A;  3MXU A;  5CC4 A;  2NZ1 D;  4MIU A;  1GHK A;  4XDX A;  2R7Z B;  5CV7 A;  1Q3L A;  2B2W C;  3NBI A;  2WKC A;  3D4D A;  5CV8 A;  4J8Q A;  3QIA A;  2F0O A;  1Q90 A;  2GA4 B;  2R6G A;  1SE4 A;  3TN2 A;  1RHP A;  2B39 A;  1G29 1;  2F3V A;  1B4O A;  1E0B A;  1F9S A;  2HDL A;  2KJX A;  4C1N I;  1Z47 A;  1D5M C;  5ELE A;  4IFD G;  3T56 B;  1TWH B;  3VYU A;  4C56 C;  1PRT D;  4NMZ A;  2F0E A;  1I4H A;  3DEO A;  1IYU A;  1F2Y A;  2BA1 A;  2CVR A;  1X32 A;  1CTM A;  1LLR D;  2EYF A;  2L1B A;  4HCE A;  1U4R A;  1Q1E A;  3CHB D;  3DWQ A;  3FEW X;  1QG7 A;  2K5D A;  3H6M A;  4PQX A;  3MXP A;  1BCP F;  1FNV A;  3HOY B;  2MUY A;  4YIJ A;  4CBV A;  4Q5V A;  3W2D A;  5CGK A;  2A6E D;  3DEP A;  1A3U A;  2F0L A;  1CQF A;  1I6V C;  2O5I C;  4RGT A;  2K5Q A;  3RLF A;  3ERO A;  1J9O A;  1DON A;  3RUZ A;  1F9P A;  1H9S A;  1TS4 A;  1S4Z A;  4O1N A;  4X3K A;  4ME5 A;  1EEF D;  1PTO H;  1Y8P B;  2D2C C;  3HG9 A;  1V8Q A;  2KEC A;  1TR5 A;  1AN8 A;  2JP1 A;  2LMC B;  1H9S B;  1H9R A;  2IWH A;  5JEA H;  4AYB B;  2B8G A;  2A68 D;  3K5O A;  3CU7 A;  2PO4 A;  4ABN A;  1DZ1 A;  5C6A A;  3ONA B;  4XQJ A;  3D6C A;  5D65 A;  1LTG D;  4EGV A;  4H7B A;  4RHS A;  1VCI A;  3FDT A;  2OF1 A;  1SYE A;  3MFG A;  5KYI A;  1JWS D;  1NSN S;  1A3T A;  1CT1 D;  1LTA D;  2Z8L A;  1B1Z A;  4LJZ C;  2BE5 D;  1DYQ A;  4A3K B;  1EU4 A;  3R2T A;  1A2T A;  1Q8I A;  1XYI A;  1E2W A;  4HSP A;  1B9N A;  3DMU A;  1G6Z A;  4DN4 M;  3O13 A;  3BZD B;  4K5V A;  3GTL B;  4NKL A;  4EQP A;  3CQZ B;  2CW0 C;  2LY7 A;  5JPM C;  1HUN A;  1STN A;  4R8I A;  1ZEQ X;  1I4P A;  4ZK9 B;  1PZJ D;  3VR2 A;  2RKS A;  1PYW D;  1ET9 A;  1VDZ A;  2YU9 B;  3GTK B;  3S2H B;  1KDB A;  1TWF B;  1JWU D;  2E2H B;  2XIW A;  1KNA A;  1MGS A;  2A5H A;  2F0V A;  4G7O C;  1BO0 A;  3ITP A;  4K5X A;  3V96 A;  2B63 B;  1R4P B;  2K05 A;  2TSS A;  4C3I B;  1QCB D;  4XQQ A;  1EU3 A;  3OMG A;  1G8Z D;  5HUR A;  5CV6 A;  5J1Z A;  1CM9 A;  2NVT B;  3SK6 A;  4ZKC B;  2F0M A;  3HZX A;  4WJW A;  1B3A A;  4FF4 A;  3S1R B;  1ILP A;  2SOB A;  4IUT A;  5LL6 S;  4KJN A;  2F4I A;  3U9S A;  1MBY A;  2O4X A;  5I6W A;  5D14 A;  4C2M B;  4KHZ A;  2SDF A;  4FF1 A;  2QDB A;  3FRP B;  1CFM A;  5M5W B;  1IW7 C;  2KED A;  4O42 A;  4F88 A;  4DNR B;  5C5M A;  2EYL A;  3K58 A;  1KNE A;  2RDG A;  2F0K A;  5C3E B;  4XT3 B;  3NUC A;  4ZRZ A;  2A6H D;  3L3O C;  4PV1 C;  2LS0 1;  4CKB A;  3G6J B;  1LV9 A;  3GTO B;  5CR3 A;  2IW3 A;  3GQB A;  2DNE A;  3TZU A;  4KTA A;  5IGB A;  2LKV A;  3ND9 A;  1FGB D;  2WV6 D;  3P75 A;  2RDH A;  4X3S A;  1G91 A;  5CV9 A;  1MSG A;  3T4A C;  2QIL A;  3E6Z X;  1SNM A;  1BF4 A;  1EZ8 A;  2Z4I A;  4B9W A;  4C1N K;  1PFM A;  2F0H A;  5EPJ A;  2B2U A;  3D6W A;  1WTW A;  4K2L A;  2L9H A;  1EFI D;  3VA7 A;  1IKM A;  1LAB A;  1Y1V B;  3NE5 B;  2B8F A;  2EJM A;  2F0P A;  3EVQ A;  2F0N A;  2ICE C;  3EA6 A;  4JK1 C;  3IFT A;  5EKL A;  4FNF A;  1CA6 A;  1S5E D;  1LO5 D;  3I73 A;  3VR4 A;  1U9R A;  4F8M A;  3LNN A;  3J7Y W;  1BR9 A;  3M7G A;  5I4D A;  2VXW A;  4K2K A;  1K8O A;  1R9T B;  4HR7 B;  3BVM A;  1B2T A;  4G4K A;  4QUF A;  5JEA J;  5FO9 B;  4XYQ A;  3MAQ A;  1JC7 A;  2EYH A;  3D31 A;  2K5W A;  1QJO A;  1O7Z A;  2PZU A;  2YYZ A;  2F0G A;  1BQQ T;  2EY2 A;  4HSV A;  3LWE A;  3OPO A;  2WAC A;  4BY1 B;  4ZQ3 A;  1HQR D;  5C0X G;  3S1Q B;  5C4X B;  1TWC B;  1CA5 A;  1JQY D;  5FLX E;  3MZ5 A;  1ZKO A;  2R93 B;  2A69 C;  3RMH A;  2Q8R E;  2F0D A;  1PTO F;  1STA A;  1BCP B;  3PUW A;  1EWH A;  2K01 A;  2JA7 B;  2F0J A;  5M5Y B;  3SVM A;  3C1E A;  4ZLT F;  3HP3 A;  3NTK A;  2D62 A;  1VF7 A;  3V2T A;  1ICW A;  1CZW A;  1O7L A;  1S5B D;  1SNO A;  5TSS A;  3MHB A;  1B50 A;  3HOX B;  2AWN A;  2B2U C;  2QF7 A;  3OW7 A;  1V1O A;  2PYK A;  2KHS A;  1EY7 A;  5FLX L;  1RCV D;  4CHT B;  3H91 A;  1SMY D;  3I4N B;  4PMB A;  3FKI B;  1IL8 A;  1WD0 A;  2IX1 A;  4RGO S;  4GZY C;  5G3L D;  2EPB A;  2XRQ D;  3UI2 A;  1RF2 D;  3DUZ A;  3A7L A;  5K5P A;  3HOU B;  2XNA C;  4C3I G;  2EOT A;  3OWF A;  1SDF A;  2A74 C;  4H13 C;  5E3F A;  1QIL A;  3S1N B;  5JAV A;  5I6Y A;  3PIO 3;  2EE1 A;  3ERQ A;  2Q8I B;  2NVQ B;  3MXG A;  1F2L A;  4QCL A;  1ESR A;  5JVG 3;  1D5X C;  1DOK A;  1LTT D;  1I50 B;  3K0Y A;  2E75 C;  4H44 C;  2R3Z A;  2WIN B;  4IFD J;  2NTT A;  1VMC A;  4BY7 B;  3NWS A;  1S5F D;  3PUV A;  1NCV A;  5JPN C;  4CGY B;  1OXX K;  3FPU B;  1TS5 A;  4XXE A;  4Z9C B;  4DAY A;  2WP8 J;  1U4L A;  4RGM A;  2JA8 B;  1HFN A;  2F0W A;  4S3S A;  5D3I B;  1A2U A;  3NPP A;  2NUC A;  2FMM A;  1SNQ A;  3NWT A;  2IX3 A;  2PNR C;  3DWA A;  3Q24 A;  1DM0 B;  3N6R A;  3I4M B;  4RFB A;  4WFN 3;  4P2C B;  5DM7 3;  1XTC D;  5DNF A;  2X6L A;  4WRD A;  3SE0 A;  4G57 A;  5KGU A;  3A55 A;  1TWA B;  3HEJ A;  1O78 A;  3W3A A;  1H9K A;  3WOE A;  2RA4 A;  2EDG A;  3MTS A;  3X3M A;  3KLS A;  1D2B A;  1EIH A;  5EBD A;  2JEA I;  3BVG A;  3K59 A;  4IUN A;  1EQV A;  3CRK C;  1DOM A;  3URY A;  4A93 B;  2H1E A;  3EJI A;  1CK1 A;  4Y7N B;  2IX0 A;  2NTS A;  3HGB A;  5KRU A;  1SBB B;  1WTO A;  1HTL D;  3T13 A;  4A3B B;  2A73 B;  4F7X A;  5IGD A;  3TDQ A;  2VB2 X;  2EYM A;  1Z6H A;  1GUS A;  3BG3 A;  1JE4 A;  1VF5 C;  1QB5 D;  2A69 D;  2MHV A;  3P7J A;  2EZV A;  3VYR A;  4KKS A;  3LX0 A;  1S5C D;  1W6K A;  2EY1 A;  5D3D A;  1B9M A;  1SYF A;  2D9U A;  2AQ1 B;  1H9J A;  1V1P A;  1A6X A;  1DCZ A;  4RKB A;  1NR2 A;  1EY0 A;  3QB3 A;  1JOO A;  3GP7 A;  2F0F A;  5C4J B;  1NAP A;  5KND A;  2X6G A;  3IL8 A;  2RDF A;  3E0J A;  3SK4 A;  1EYC A;  1I4G A;  1XX8 A;  2WB1 B;  5JJZ A;  1I6H B;  1ONL A;  4A3I B;  3MA2 B;  2L0C A;  3NTI A;  3BVZ A;  5EKI A;  3HOZ B;  2H4O A;  5C3W A;  3S17 B;  1PDQ A;  3QOL A;  1HUM A;  4WOR A;  5T1G A;  5CBE E;  2E2D C;  3D4R A;  1H9M A;  4EQN A;  1QNU A;  1TY2 A;  5COR A;  1IKL A;  3I4L A;  4DK0 A;  3OSO A;  5C44 B;  2OT2 A;  3K57 A;  1EYD A;  3D3R A;  1R4Q B;  1RTN A;  1VMP A;  2O5J C;  3R8B A;  4L8J A;  5FOB B;  3Q22 A;  1X3Q A;  4K6D A;  2K04 A;  2PPB C;  1PTO B;  5K36 G;  2EVB A;  5J22 A;  1PMR A;  4XTC S;  1MD2 D;  4OO1 G;  1S5D D;  1JOQ A;  5E1F A;  3NHH A;  1TS2 A;  4G7H C;  1SE3 A;  5COY A;  3EFX D;  2KCN A;  3D4W A;  3QOJ A;  3U9O A;  4IUP A;  3NSW A;  4KN4 C;  2AQ3 B;  1O7Y A;  3GTP B;  1F2Z A;  2Z4H A;  3PO2 B;  5M5X B;  5CBA E;  4TKO B;  3L9A X;  5LL6 X;  2K33 A;  4M8A A;  3QG1 A;  1FYC A;  1J8I A;  2XWB B;  3QO2 A;  2MGS A;  2X69 A;  1HCZ A;  1WD1 A;  2HCI A;  4FF2 A;  2C9O A;  1JCK B;  1OXS C;  1YNN C;  1F2M A;  5IT9 E;  2DNC A;  4KK7 A;  2E74 C;  3M85 A;  1TY0 A;  1MSH A;  3VYT A;  4A3J B;  1SE2 A;  2K03 A;  4MHE A;  2WII B;  5IOC A;  2XWJ B;  4I7Z C;  4U68 A;  1HPC A;  2VNU D;  1PZI D;  1KLG D;  3PUY A;  5C4H A;  1ILQ A;  3TP8 A;  5EJW A;  1LT4 D;  2F03 A;  3C2P A;  3BDO A;  2WAQ B;  2RSO A;  4BA2 I;  3HS0 C;  1I4Q A;  1I4R A;  4LMQ D;  1GXD C;  5DAU A;  4FXK C;  4NW2 A;  3T51 B;  2BDN A;  1TVX A;  2AQ2 B;  1E2Z A;  4IFD H;  1STH A;  3KBG A;  1PRT B;  4IQZ A;  4J6H A;  1SYB A;  4ZUI A;  3TP5 A;  4U67 3;  3VA5 A;  3SXH A;  3IFD A;  1SNP A;  5ISR A;  5C0X J;  5CMD A;  4TSS A;  5I9P A;  1JR0 D;  2MJ8 A;  1WVL A;  2AUK A;  2R61 A;  1UNS A;  1RKN A;  1BNZ A;  1LTR D;  4X3T A;  2LFN A;  1EZ6 A;  1D6E C;  1AP0 A;  4RA8 A;  1SJH D;  1Y69 U;  4E6I A;  2JE6 I;  5JVH 3;  2QEJ C;  3JAM E;  1B53 A;  1WCM B;  3I8Z A;  4ODG A;  4KV6 A;  1DXM A;  4J1M A;  1L0X B;  2Z1C A;  1V43 A;  2J7Z A;  2NBF A;  5CV4 A;  3GV3 A;  2HUG A;  1ENA A;  1NUC A;  4QUC A;  3MXN A;  2PCF B;  2HQE A;  4ZAI A;  4K6L A;  3KLR A;  4DA2 A;  1U4M A;  1BOS A;  2KUM A;  4M1U B;  5G3L F;  4RWS C;  1STY A;  1JOR A;  1EOT A;  3P1H A;  4A3G B;  2TMP A;  1TQO A;  1PRT C;  3HOV B;  3JAM L;  3ND8 A;  3F2U A;  5EKK A;  2K28 A;  4A3F B;  2M9V A;  2FIN B;  5KEE A;  1SFO B;  1EIG A;  1T5X D;  4QF4 A;  3QJY A;  5HGT A;  4B9X A;  1CI3 M;  1EEI D;  1G2S A;  5IIF A;  4BWG B;  2A6E C;  4DF7 A;  4ZKB B;  2EJG C;  1SEB D;  1Y8O B;  4HCS A;  2FHT A;  5K36 H;  1EWC A;  1Q12 A;  1EY8 A;  4KN7 C;  1DOL A;  2CW0 D;  1OO9 B;  1EL0 A;  2XSC A;  1U4P A;  2ID0 A;  1KLU D;  1A3V A;  2K6A A;  2ZXR A;  4TRD A;  4XT1 B;  2NN6 G;  1C4Q A;  3TME A;  2QKI C;  4IUQ A;  4F87 A;  1OXV A;  3J81 E;  4EQO A;  1RJT A;  1TII D;  4HMI A;  5JEA G;  1EY9 A;  4CKC A;  2G9H D;  1HQM C;  4HTH A;  4N9T A;  3D8G A;  3BDC A;  1Q1B A;  5ELD A;  2OEO A;  2B2W A;  3GTM B;  3GD7 A;  2J0T D;  5EPL A;  3TP6 A;  4DU9 A;  1ENF A;  1YNN D;  1SAP A;  3OHX C;  1HTP A;  1HHV A;  1STB A;  2KCC A;  2BE5 C;  1TKW B;  3GTJ B;  3HOW B;  2XVS A;  1F9Q A;  1F9R A;  2MP1 A;  1BCP C;  3OIQ A;  1CHQ D;  4LK1 C;  4FYD A;  2JEB I;  1IW7 D;  3I72 A;  3VR6 A;  1NR4 A;  2E76 C;  5FO8 B;  2ZXO A;  5LHY 1;  1EY4 A;  4LAA A;  2B2T A;  3NK9 A;  2L12 A;  4KY6 A;  1LTI D;  3VYS A;  3RZO B;  1UAP A;  2KVM A;  2F0U A;  2F0I A;  1C48 A;  4A3E B;  2NB0 A;  4IFD I;  1ET6 A;  5I2Y A;  1PFN A;  2D5D A;  2KOL A;  4H0L C;  5IOD A;  1STE A;  3KUP A;  3EQL C;  1ZYR C;  4KD3 A;  3Q6S A;  3VR5 A;  1FR3 A;  2BCO A;  5DM6 3;  3H0G B;  1IHZ A;  5EGT A;  2IT1 A;  2L5T A;  3MEH A;  2ICI A;  1ROD A;  2XN9 C;  1WTV A;  3A56 A;  1HRJ A;  1TU2 B;  3K5M A;  1PFB A;  5KNC A;  1LTB D;  2E2I B;  2F0S A;  5A35 A;  3N52 A;  1BUV T;  4C3H B;  2PMZ B;  3X3N A;  4I65 A;  4DNT B;  5I9O A;  3C1F A;  4L6T B;  4BA1 I;  3OOC A;  3NBH A;  1HA5 A;  3Q0A A;  1EY6 A;  2JXM B;  5ELB A;  4DAP A;  3KF8 A;  1AFP A;  1AW7 A;  3K7A B;  3BYY B;  2EXZ A;  3NQT A;  2L4N A;  3M3Y B;  3A8I E;  2RSN A;  1LT5 D;  5M3M B;  1F77 A;  4XYO A;  4HED A;  2A6H C;  3FMC A;  3M4O B;  2IJ0 A;  4UDU C;  1M8A A;  1RDP D;  5C0X H;  3AB9 A;  1KAB A;  3GTG B;  5CYU A;  1UEA B;  1C8C A;  4FO2 A;  1KTK A;  3RD4 A;  1PXU A;  3VR3 A;  1D1I A;  3S15 B;  4BS9 A;  1TT2 A;  3A8J E;  5KNB A;  1HXY D;  1FNW A;  4JBW A;  3CKI B;  3KBX A;  2B2T C;  4PMC A;  3BYT B;  4KD4 A;  2SEB D;  3PMF A;  4QMG A;  4CKE A;  5AFW A;  5CV5 A;  3SK5 A;  4OIJ A;  2F0T A;  3HKZ B;  5FKA C;  5IGG A;  5NUC A;  1GUO A;  4KI0 A;  3GTQ B;  3RZD B;  2FFK B;  4IAL A;  1BBX C;  2B2Y A;  3A7A B;  5BN3 A;  4OO1 I;  1V1P B;  3NTH A;  2NN6 H;  4PMW A;  1AEX A;  3S14 B;  3NP8 A;  3I3C A;  3GO5 A;  1QE6 A;  3MWY W;  2PZT A;  1EQT A;  5F2D A;  1JOK A;  4FP5 D;  3PV0 A;  3S2D B;  2F1M A;  3J7A F;  4DFA A;  4DGZ A;  4KY5 A;  4DAV A;  1FNU A;  2VUM B;  1SNC A;  1CQV A;  4BBS B;  4RCO A;  4N9P A;  1E2V A;  3HRZ C;  2K7V A;  5I2X A;  3I90 A;  1AZP A;  1FD7 D;  1ZXT A;  4HN7 A;  4IUU A;  5M3F B;  2N88 A;  3H09 A;  2Q8T A;  3I91 A;  1BCP D;  3J7A V;  1MI2 A;  4B08 A;  2KQ3 A;  3A54 A;  2JA5 B;  2RQX A;  3DHQ A;  1CZG A;  2VB3 X;  4IUR A;  2BOS A;  1WTP A;  4K8J A;  3TZD A;  2JSO A;  2I07 B;  1KDA A;  5DEH A;  1DD2 A;  1X3P A;  4RHR A;  3S9W A;  3PUZ A;  3PUX A;  1EYA A;  1K8M A;  1EY5 A;  4XQN A;  2WKD A;  4A3M B;  2B2Y C;  1CHP D;  1ZYR D;  1SMY C;  3I70 A;  3SEB A;  1LT6 D;  3NQI A;  2E2J B;  4RH6 A;  5E4X A;  1AZQ A;  1SYC A;  1LAC A;  1KDC A;  3BS1 A;  3BDL A;  2R92 B;  3L7Z C;  2B2V A;  1BXT A;  5FK9 C;  4MN3 A;  2ZT9 C;  3OWE B;  1YNJ C;  1Y1W B;  4KKU A;  3FPP A;  3A8K E;  2K1B A;  3FVQ A;  2F0Q A;  3DM1 A;  2EJF C;  4UAI A;  1PTO C;  5KIX A;  1QWY A;  5JOB A;  4V19 0;  1BDO A;  1SYG A;  4RAU C;  5IT9 L;  4C3J B;  5T1I A;  1OXU A;  1SXT A;  3PIP 3;  5IGF A;  3Q23 A;  2JYO A;  4C3H G;  3K5N A;  2F3W A;  4FF3 A;  4BBR B;  4NDX A;  2EYP A;  2I46 A;  1RTO A;  1JB3 A;  4Q0F A;  5M9O A;  5FO7 B;  4FXD A;  4OHJ A;  4KJO A;  3WDN A;  2M00 A;  2Y0S B;  2C5C A;  5C0X I;  5C4Z A;  4CJ1 B;  5EQ0 A;  1LT3 D;  1G2T A;  4ZUJ A;  4KKT A;  2FJ2 A;  3H3V C;  2RBM A;  3P20 A;  1GOZ A;  2KEE A;  4K5W A;  2FMC A;  4DXG A;  4DXF A;  2EY5 A;  2AUJ D;  1LTS D;  3DXJ C;  5IGE A;  1WTR A;  3IKJ A;  1SND A;  2OXP A;  1XXG A;  1ML0 D;  5A2Q E;  1GUT A;  1A15 A;  3J80 E;  2HDM A;  2B2V C;  3E5S A;  3NXW A;  1KAA A;  4V0B A;  1QOH A;  1RD9 D;  3AU7 A;  1JWM D;  4ID6 A;  3ZYY X;  4QB4 A;  2NVX B;  3OIP A;  2EY6 A;  2NN6 I;  3LWU A;  1GHJ A;  2JA6 B;  2CHB D;  1WTQ A;  4K8I A;  4OL7 A;  4XIG S;  2DN8 A;  3GV6 A;  3C3L A;  1HFG A;  2V4D A;  1ESF A;  2IL8 A;  1PZK D;  2K32 A;  2ZXP A;  4IN3 A;  3R93 A;  1TS3 A;  2HCC A;  2SNS A;  4KMU C;  2EYO A;  5A2Q L;  1TWG B;  3G7L A;  1II3 A;  1OXT A;  4NP5 A;  3J80 L;  1STG A;  1GUN A;  2CQA A;  3QWN A;  1T5E A;  5ELF A;  4R8N A;  1XWE A;  1WTX A;  4OO1 H;  3K6O A;  2PZW A;  3TBI B;  1B44 D;  1GUG A;  2N55 A;  3MVV A;  4HAE A;  5E4W C;  1I4X A;  3K5L A;  4RCN A;  4DK1 A;  1K83 B;  4X3U A;  5ELC A;  1SJE D;  1I3Q B;  4RKL A;  4KY7 A;  4RGN A;  2IPK D;  3CRL C;  4KHV A;  1L0Y B;  3AMU A;  4IUV A;  2PW7 A;  3MFY A;  2ENB A;  1ENC A;  2NYZ D;  3S16 B;  2A68 C;  3WOF A;  1W6J A;  4G7Z C;  3TP7 A;  5EBC A;  2M2L A;  4ZYS A;  3SK8 A;  4HMJ A;  3OMC A;  4OIK A;  4A3D B;  2AWO A;  4L63 B;  2RVL A;  1QNK A;  4OGQ C;  1JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...