2F0SA

Crystal structure of staphylococcal nuclease mutant v66l/i92v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0sA00
1A3VA 3E5SA 5IGFA 4K2KA 1EZ6A 2F0WA 5I9OA 1EYAA 2PZUA 1EY6A 1STNA 2F3WA 5C4HA 2OXPA 5I6YA 1SNDA 4RKBA 2LKVA 4J1MA 5CGKA 4KV6A 2F0FA 2OF1A 3NXWA 1EY8A 4PMCA 2EYJA 1STBA 1JOOA 4WORA 3OMCA 2F0MA 5HGTA 2F0QA 5E3FA 2QDBA 3ITPA 2PYKA 1KDCA 2EY5A 4IUNA 5HURA 4DU9A 2EY1A 3MXPA 2EY6A 3DHQA 1KDBA 3EVQA 5IODA 5EKKA 1EY9A 2F0OA 2OEOA 4ODGA 4DGZA 4HTHA 3SR1A 5EGTA 2F0EA 2F3VA 3MZ5A 4K2LA 3NHHA 5CR3A 3EJIA 3NQTA 4F7XA 2HQEA 3OWFA 2EYPA 3NP8A 4HMIA 4K5XA 3TP8A 4DFAA 1EYCA 2KHSA 4IZ8A 4K8JA 1SYBA 5DEHA 3H6MA 2EXZA 4K5WA 1SYEA 2F0DA 4K6DA 4K8IA 1TR5A 5CC4A 4H7BA 1U9RA 4DF7A 3TP5A 4PMBA 1SYCA 4J6HA 4KD4A 4OL7A 1STHA 4IALA 4K5VA 5C4ZA 5J39A 1NUCA 3D4WA 4RKLA 5IGBA 5J1ZA 3SK4A 5C3XA 4F8MA 5IIFA 5IOCA 3OMGA 2EYOA 4R8NA 1STGA 3P75A 3BDLA 4LAAA 5NUCA 4KY6A 1SYDA 3QOJA 3D6CA 2PZTA 4K14A 4ZQ3A 4ME5A 5IGDA 4QF4A 5J22A 2M00A 5E1FA 2EYFA 3LX0A 3TP7A 5I9PA 2F0HA 4EQPA 1A3TA 5EKLA 5KYIA 1SNQA 1EY0A 3C1FA 5CV5A 3QOLA 5JAVA 5KIXA 1ENCA 4KD3A 5I6WA 4EQOA 3BDCA 4YIJA 1NSNS 2O4XA 2F0LA 2RKSA 4EVOA 2ENBA 3QB3A 4N9PA 3D4DA 5CV6A 5F2DA 2EYHA 2F0GA 1EQVA 2KQ3A 4KY5A 4HMJA 5CV9A 5C5LA 3ERQA 1A3UA 1KABA 2F0NA 3EROA 5M9OA 2EY2A 4NMZA 4B9WA 1SYFA 2F0SA 3RUZA 5K5PA 2F0PA 4KTAA 3T16A 1EY5A 2RDFA 4S3SA 4KHVA 4NKLA 5IGCA 1EYDA 2SNMA 5DAUA 1SNPA 3SXHA 1IHZA 2F0UA 5CV7A 5C3WA 2F0JA 3PMFA 4QB4A 3SK5A 5IGGA 1AEXA 5KGUA 1STYA 2EYMA 2F0KA 2PQEA 4KJNA 5KRUA 5ISRA 3HZXA 5KYLA 3NK9A 4I65A 5CV8A 3P1HA 1EZ8A 5IGEA 1TQOA 4B9XA 5C6AA 2F0IA 4QMGA 5JOBA 2SOBA 2RBMA 1SNCA 3HEJA 3D8GA 1SYGA 2SNSA 3NUCA 4TRDA 5CV4A 1JOQA 4PNYA 1KAAA 3TMEA 3MEHA 3R3OA 1JORA 1SNMA 3SHLA 2NUCA 1SNOA 3S9WA 2EYLA 4ID6A 4KY7A 4NDXA 1EY7A 1TT2A 2PW7A 1KDAA 4KJOA 3MHBA 3SK8A 1ENAA 4N9TA 3V2TA 5KEEA 1EY4A 3SK6A 5C5MA 4WRDA 2WACA 3T13A 3DMUA 1JOKA 3VA5A 1RKNA 3TP6A 4NP5A 3U9OA 3MVVA 4ZUJA 1F2MA 2PZWA 4E6IA 4EQNA 3OSOA 1A2UA 3C1EA 2F0VA 1STAA 1A2TA 4MIUA 2F0TA 1F2ZA 1II3A 4ZUIA 2PW5A 1F2YA 4G57A
chains in the Genus database with same CATH superfamily
1OXVA 3I8ZA 4R4OA 3RN2A 1I94Q 4JYAQ 1VQ6A 5I6YA 4RKBA 2E2IH 4NXNQ 4KV6A 1L1OC 3STBD 2A8VA 1HNWL 1TS5A 4QIWB 5COYA 1JJ2A 3DEOA 1OXTA 5BN3A 3DM1A 2UXDL 1SSOA 1I4PA 1VDZA 2RCFA 4YWKA 3ND9A 5FLMH 1KDBA 1NR4A 4JPBW 4XTCS 3MZ5A 2NVYB 2VUMH 2VB3X 1U4LA 3M7NA 3OWFA 4BBSH 2XRSD 2RHSB 1QUQB 5CC4A 2WB1E 3B6YA 4JI0L 3R93A 2VY3A 5J3BA 3NTIA 2JYOA 1W6JA 2BCOA 4APVA 1BCPB 1I94L 1X3GA 4ABNA 3TZDA 1VQOA 3PV0A 1SAPA 4KHZA 1VQDA 2ZM6Q 1B9MA 2L5TA 1RCVD 2JA7B 1HXYD 1PFNA 2DGYA 1PZJD 2MUYA 3HOYH 1EIFA 1C48A 1MSGA 3DWPA 1Q46A 1CHQD 2UU9L 2EYHA 2WAQB 1SFOB 4A3DG 1SJHD 1A3UA 3ERQA 4DV5L 4H44C 2E5LQ 5EPJA 2PI2E 3C3LA 2EXDA 5IGCA 2K05A 4OO1H 3Q6SA 1JR0D 3PMFA 4LUZA 4DAVA 4Y52H 1Q81C 1TQOA 4CDEC 2Y0SB 2AHOB 1KNAA 2B29A 3ULPA 1GXDC 4QIWE 4AYBG 2MJ8A 3R3OA 1ZYRC 4OELB 4C3JH 4BY7B 4N9TA 3EN2A 4LW1A 2GVBA 4C56C 1XMOL 5JVH3 4QY7A 2Y0SG 2B2TC 1A2UA 5JPNC 1NCVA 4RWSC 3GTOH 4P71A 4G57A 4IFDG 2EDGA 2PZUA 5LL6S 2NVXH 1BDOA 2B2YC 4PV1C 1VQPA 4BBRG 1EY8A 1ET9A 1LUZA 3CW2C 3PCOB 4ZCKA 1HH2P 1EQRA 3NE5B 2VNUD 3DHQA 3BDOA 4JI6L 1SE4A 2F1MA 5EGTA 2F3VA 4K2LA 1IBLQ 3HOYB 1I3QH 1IXRA 1MJEA 2P5ZX 2PQAA 4HR7B 4KN7C 3W1GA 3KLSA 4HMIA 5DEHA 2JEBI 4IUUA 3OWEB 4FO2A 4PMBA 1SYCA 2K7VA 4OL7A 5ELDA 4AH6A 3OMGA 1MGSA 3D6WA 4QF4A 1Q8IA 5E1FA 3VR4A 1A3TA 1PH6A 1GOZA 2OWOA 5C3EH 4KKSA 5DLQE 3U9SA 2RSOA 2E2JH 1VQHA 4JI4L 3GV3A 1BKBA 1V1PB 3H94A 3RZDH 4NMZA 4B9WA 4R8IA 4RHSA 2RDFA 1NMFA 1XMOQ 2UXCL 3CCUA 3NBHA 3KBGA 1X3QA 5C3WA 2MNAA 2D9UA 4CBVA 1X9NA 1NMGA 4A3EG 5KYLA 3S16B 4A3JG 1VMCA 4A3JB 4IFDH 2YU9H 3CPFA 1K0SA 2RBMA 4IUTA 1I4XA 2PPBC 1XMQL 2FJ2A 1JOQA 2WIIB 3TMEA 3FHWA 2Q2HA 1UE7A 2Z0SA 2B63G 1EQQA 4KKTA 1TT2A 1WYDA 4C2MH 2NB0A 3N6RA 2QCPX 4WRDA 3X3MA 1Y1VB 3MWYW 4HSVA 1WVLA 2IX1A 1E0BA 1MD2D 1VQAA 3KBXA 1FYCA 4R4QA 1CHPD 3L9AX 2R7ZB 3EIVA 1XXGA 4L5RC 3EA6A 5M3MH 2PI2A 2VB2X 1X56A 1PH8A 1HUNA 2ZXOA 1ENFA 3BYTB 4DV2Q 2I5MX 3P7JA 3DEPA 1MHWC 2NWGA 4FXGC 1SMXA 2BH2A 3X3NA 4R4IA 2WP8J 4RFBA 3EVQA 1WCMB 1TVXA 1GJXA 1D2BA 3PO3G 3SR1A 1LYLA 2NZOA 2RSNA 2SDFA 2XNAC 3QG1A 3SDZA 4LF9L 3TS0A 5CMDA 4DR5L 4XT3B 1VMPA 3F2DA 4DNRB 1D5XC 4A93B 2KUMA 4A3IB 1BR9A 1BXTA 1F9QA 4LF5L 4ZKCB 4FF2A 3P75A 1IW7C 1NAPA 5NUCA 3URYA 3IKJA 4DV0L 4GLXA 4ZQ3A 2LXKA 4XIGS 2M00A 1YEZA 4O2DA 3HOXG 3TP7A 3HOXB 1XNRQ 5KYIA 3M4OB 1SRUA 3TS2A 4EQOA 2EOTA 2EZVA 2LFNA 2Q2TA 3BJUA 1ZXTA 5C0XG 1I50H 5CV9A 4DR2Q 1ESRA 2B2WC 2F0NA 1Z9FA 4L8JA 4S3SA 1R4QB 5C4XB 4B3TL 3GP7A 2WINB 2MO1A 4KJNA 3W1BA 4LFBL 1N9WA 1Z6HA 5EAYA 4NXNL 2F0IA 2D0OA 1PH9A 4GN4B 1E2VA 3PGZA 4LF6Q 5I2XA 3GTOB 1QCBD 4RA8A 4DAMA 4KHPL 1EU3A 4L5TA 3J81E 1SNOA 2B2UA 2B2YA 1D5ZC 1PDQA 3MHBA 3K5LA 3HKZE 3NBHB 4B3MQ 1H9JA 4KLKA 1TWCH 2WACA 4BXXG 4OIKA 1PFSA 3J7A5 3NPPA 3H15A 2WB1G 3G7LA 1EIGA 5LHY1 5JJIA 3NELA 1X3FA 3FEWX 3KLSX 1X3EA 4FXDA 5I9OA 4GKKQ 1EWHA 3ZJYC 2YU9B 2BOSA 2KEDA 1SNDA 2JA8H 4JW0A 2BE5D 4RMFA 1LO5D 2NZHA 4GN5A 4BBSG 4WORA 2KOLA 1M90C 1VQBA 1RTOA 1KDCA 3HOXH 1BVSA 5AJ3L 1WTHA 4DV2L 5HY6A 1L1OB 3K57A 3HOUH 3GTPB 2B63B 4PMWA 4IQZA 1H9MA 1Q12A 3KUPA 1O78A 1FD7D 2MP1A 3Q24A 3K8AA 3PUWA 2NTSA 1SYBA 1XTCD 1FJGL 2ZT9C 4K5VA 1JWMD 4IALA 3GV6A 5LMUQ 2AKWB 2E8GA 2MPMA 4Z9CB 4A4IA 1DJRD 3K7AB 4IPCA 4K14A 1YNND 3S1RH 3S1NB 4IOCA 2I5LX 5FO8B 2EJMA 2FFKB 2VQEQ 1M4VA 1V1QA 3G71A 4DR6Q 1WTPA 3A8IE 4IURA 2HIVA 1GM5A 1CSQA 4JI7Q 3S16H 2ZJQA 4AQYQ 4ZKBB 1A8VA 2F0GA 3HFZB 4KY5A 1VF5C 3S2DB 3S14H 3PQIA 1LT5D 1TWFH 1VQ5A 1SE2A 1VQKA 1UAPA 2PCFB 1OO9B 4MN3A 3MEFA 2F0JA 3SK5A 1AEXA 3TRZA 5JJLA 1IZ6A 1AFPA 1N36Q 4UP9A 3RLFA 5GAEC 4U68A 2SOBA 2GN5A 4JK1C 4QJFA 3J7AV 1H95A 1R4PB 5FLXL 3Q8DA 4DV6L 5EBDA 4A3GG 4IFDI 1O7YA 4RH6A 3F1ZA 2R7ZH 2JN4A 1BNZA 4UY8C 3CKIB 2L4NA 4A3LH 3L3OC 5IT9L 1DOKA 1AZQA 1JWUD 1QWYA 2RA4A 4AQYL 3OPOA 4RHRA 2AMCB 2K52A 3AFPA 3KJOA 4LFCL 3V96A 1RDPD 1ML0D 3CD6A 3F8TA 5DNFA 3MXNB 1HTPA 1F2YA 4K2KA 3BU2A 2UUBL 4XYQA 4C1NK 1IYUA 3T1YQ 1L0XB 1G91A 1NBWA 2OXPA 4X3KA 3L0OA 3M4QA 3T53B 3TQYA 1E2ZA 1JE5A 4DAPA 1N34L 1YNNC 1JOOA 2QEJC 2A73B 2F0QA 1A15A 2QDBA 2A74C 4MHEA 4CDFC 1TWGH 4P72A 1EY9A 3H0GG 2F0OA 4RGOS 1PH5A 4FF1A 5D3DA 2ES2A 4Y7NB 3NQTA 4X62Q 1DOLA 2N78A 1LACA 1UE6A 1SE3A 2JA7H 1LTAD 4DUYL 1LTTD 3M3YB 1SYEA 5A2QL 1F9PA 2YTVA 2DJFC 1D8LA 4V0BA 3JC66 4RKLA 2ASBA 4FDBA 4ME5A 2IWHA 4OEMB 3BS1A 1O7LA 3KK7A 4X65L 2E2HB 4GNXA 1CQVA 1TY0A 1HZBA 3Q22A 3KF6A 2KCTA 3SEBA 5ELFA 3TBIB 1ILPA 2F4VQ 1T5XD 5I4DA 3D31A 3VYTA 4HIMA 1XPOA 4LF8L 4JI3Q 3I2ZA 5H1SE 3AB9A 3NTKA 2EY2A 2Q8IB 3I4MB 2HHHL 4BY1G 5HGQA 4NXMQ 5DAUA 1JQYD 5BR8Q 1SNPA 3SXHA 4CKEA 4NPSA 2VL6A 5M5XB 3HGBA 5KGUA 5JEAJ 5ISRA 4LF4Q 2D62A 4JI2Q 4B9XA 2KBNA 3W3AA 1FR3A 3WWVA 4DXGA 4A3IG 1LTRD 3T1YL 3H0GH 4MTKA 2L9HA 1S5ED 3J81j 1QOHA 2R7DA 1SBBB 2PW7A 4P2CB 1P16A 3GDEA 1AP0A 1HR0Q 1LLRD 3S15B 1TWAB 1BBWA 4YHHQ 1W3SA 3OW2A 3HOVG 4AYBE 1Q82C 1HNZQ 1F2MA 2YTXA 2F4IA 1A63A 3BVZA 1G6PA 1EIYB 4B08A 4J1MA 2VXWA 4IN3A 1JWSD 1J6QA 2K6AA 4XDXA 2F0WA 1ZKOA 1X6OA 4GOPA 1CKNB 2K14A 1QVCA 2Y0SE 3CAMA 4BBRB 2JA7G 1AW7A 3MA2B 1RF2D 1N33Q 2K01A 3NBIA 5IP9G 2K75A 5GROA 4ODGA 3A74A 4HTHA 4FF4A 2G9HD 4V190 3GTKH 1EOTA 4RGNA 1V1PA 2HQEA 4OONA 2CW0C 4OGQC 3UDIA 3S1QH 2NVXB 1VS0A 4F87A 3HKSA 1WTVA 3HS0C 5C4XH 1HA5A 2JXMB 1NUCA 3K59A 3ND8A 1MKHA 4H02A 1HQMC 4DXFA 2WKCA 2PMZB 2UUCL 3AMUA 3DM3A 1HA6A 3PIP3 4ME3A 4HN7A 4EQ5A 3KF8A 4HSPA 5CBEE 1Z7TA 2QKIC 3C1FA 4F88A 1LV9A 3U50C 3KLRA 2R93G 3UDXA 1B70B 1NSNS 3KFUA 2F0LA 4HJ5A 1QVFA 1EFID 4X6AH 4BBSB 2PNRC 1HR0W 1TWCB 4LMQD 1SE8A 2K5WA 1OTCA 4X64L 2F3IA 2QDLA 4PZ7A 4H0LC 5KNBA 2GVAA 1TWHB 5CV7A 5LMNQ 4JBKA 5KRUA 4GNXB 2C5CA 2HHHQ 2H5XA 2MGSA 2DN8A 2A5HA 5C6AA 2UXBL 1QVGA 2RF4A 2X69A 3CCQA 3VR5A 1KAAA 5G3LF 5K36G 1KRTA 5D3IB 3A0JA 1D5MC 2Z6KC 1H9SB 1VQ7A 2K32A 3T13A 4U673 4DV3L 1E24A 1B53A 1K73C 5M3MG 4R9WA 4X3TA 5D14A 1F9SA 5M5YH 1NTGA 5FOBB 1II3A 2QGQA 1DCZA 3D4RA 1JJCB 1EYAA 3DXJC 2K04A 2MO0A 2F3WA 2J7ZA 5C4HA 1PRTF 4XQNA 4MNOA 1LT3D 2M9VA 4BXXH 2AQ1B 2RVLA 1XNQQ 4A3FG 5IYDH 3NTHA 1F9RA 2A6EC 1AN8A 4WJ4A 2O2LD 2NN6H 4IUNA 1HTLD 1MI2A 4DR4Q 2OEOA 2R3ZA 2AUKA 2VZAA 4B3TQ 5CR3A 3J80E 3KJPA 3RMHA 4DFAA 4HIOA 1EYCA 1GUSA 2Z6KA 4A3MB 3O13A 1HQRD 2PNHA 4P75A 3GTMH 1T9HA 2QEXA 1E7ZA 1STHA 1KLUD 4TSSA 5J1ZA 5C3XA 1HR0L 1LTID 1XPUA 1VQ8A 1E1OA 2IHEA 2Q8TA 2VUMB 2QF7A 1SROA 1UEBA 2HCIA 5CV5A 1YNJD 1PH4A 5FLXE 1JC7A 2D0PA 4A93H 4JCVE 3G6EA 2L0CA 3K6OA 2KCNA 2X6LA 4TVAB 3KOJA 5K36H 5EJWA 1CZGA 5IWAL 1N32Q 5C44G 4HMJA 4KMUC 1ASZA 3GTGH 4OXPA 3CRKC 2K5DA 2N49A 1SDFA 1D6EC 4K6LA 1IHZA 1RL2A 4QB4A 2F0KA 2EJFC 5JJZA 5TSSA 3J7YW 5L37A 2DJGC 5JVG3 2ZTEA 1HRJA 4FYDA 1WTQA 1BCPD 4JG2A 3I90A 3MXGA 4ID6A 3UDFA 3DWQA 1EWIA 4DR2L 4GLVB 5JPMC 4A3KG 1EU4A 2E2JB 1ENAA 5ELBA 4DV7Q 2I46A 4BBRH 1EY4A 3HOWH 2KCMA 3KDFB 1RKNA 4DK6C 3H09A 3N52A 4E6IA 4IPGA 2JE6I 2ZM6L 2F0VA 3IRBA 3KYHC 3TZUA 4YWLA 2L11A 4ZUIA 2VQEL 1SEBD 2LSSA 1PRTB 1L2FA 3E5SA 4A3BB 3J7ZC 4C1NI 1I3QB 4A3JH 5IE8A 1J9OA 1HPCA 3RZOH 1BF4A 2EPBA 5CGKA 1TY2A 1CA5A 1TWAH 1ASYA 1RODA 1CT1D 5FLXc 2R92H 3ITPA 2EY5A 1BO0A 2JA9A 2JEAI 2EY6A 1YITA 3IL8A 3FP9A 4DUZQ 3FPPA 4RG1A 3NWTA 3ULJA 3F2UA 3I7FA 3M85A 2R93H 1L0WA 1YJ9A 1Y8NB 2B2TA 2XGTA 1I6HH 3FDTA 4K5WA 1CZWA 4GKKL 4K8IA 1KNEA 3RLNA 1OXXK 2JA5G 4YY3L 1GVPA 1Y8PB 4NW2A 5M3FB 3K7UC 2RCNA 1AE2A 3A5ZB 3RZDB 3BDLA 4QL5A 2B2VA 4JI1Q 2JA5H 2EJGC 2MHVA 2WKDA 3STBC 3PF4A 1W6KA 2CHBD 3HOVH 5I9PA 1CKMA 1H9KA 1DYQA 3T1HQ 3SVMA 4YIJA 1F77A 3M7GA 2UUAQ 3S2HB 3Q23A 1Q3LA 1EIHA 1HNXL 1TS2A 1YHQA 1YNXA 2KQ3A 3IFDA 1PFBA 3PO3B 3TSSA 4MTNA 3PO2G 4A3IH 1WFQA 4EX5A 3GTMB 3EBEA 1D7QA 2XVSA 1EYDA 2A6HC 2JP1A 1GUOA 4NB3A 2EYMA 3PUVA 1BBUA 3VA7A 4R4CA 1B9NA 1EZ8A 2JQOA 3RNUA 2MFIA 3GTJH 5GQOA 4JOIC 5JEAH 2HDMA 1I4GA 3AYHB 1J5EQ 3BVGA 2UXDQ 3MEHA 3J81c 1HFGA 4RCNA 5JEAG 1N34Q 4YCWA 1G2SA 5T1IA 1TWHH 3CMEA 1XMQQ 2B2VC 4G4KA 4NP5A 4FVMA 3OIQA 3LWEA 1JE4A 1K9MC 1EL0A 4MIUA 2TMPA 2F52A 4X65Q 4JI0Q 2J0TD 3P1HA 1A3VA 3CF5A 1EZ6A 2NVYH 3T4AC 3QWNA 2H1EA 2B2WA 4JI4Q 5A35A 2YTYA 3R2IA 3CC4A 4CGYB 3C2PA 5HGTA 3KDFA 3BYYB 4KHPQ 1PVOA 4DU9A 3MXPA 4IOAA 5EQ0A 2NN6I 5BR8L 4KKUA 3I55A 4C3HH 1I4QA 4IPHA 2F03A 2Q8RE 5EBCA 4ZLTF 3MFGA 5C4JH 2E5LL 3GTQH 4GN3B 4HAEA 1DGSA 3H91A 3OOCA 1Q1BA 1WD0A 4DV7L 5IGBA 2B8FA 1I6VC 3TDQA 1A6XA 3ONAB 3H3VH 2A19A 1G291 3TN2A 1BQQT 1K3BC 3K5MA 4WJWA 4DNTB 1HNZL 3HOYG 3U4VA 2RHQB 5JAVA 4ZK9B 1TIID 4DV0Q 2I0QA 3IFTA 3BDCA 4UPAA 1Q86C 4A3CH 1R9TB 1MBYA 2Z4IA 3L7ZC 2CW0D 1MIUA 4DUYQ 1Q90A 4C2MB 1U4PA 4WFN3 4DK3C 2R7FA 5K5PA 3RUZA 3T16A 1KTKA 1N8RC 2OQKA 2SNMA 3CCRA 2JA6B 5CORA 4CDCC 1UE1A 2JA5B 4OO1G 3LGJA 4A3FB 1IKMA 4RAUC 3W2DA 1O7ZA 2Z1CA 3E0JA 1HZAA 1SNCA 1SFOH 1KAWA 4LF9Q 3FKIH 1CK1A 5IP7G 3HOUG 2FMMA 1C0AA 4LJZC 2EYLA 4LF8Q 1JJGA 1EY7A 2WAQE 3MAQA 2K33A 1SR3A 1UEAB 3NQIA 1GUNA 3PO2B 2A69C 3JAME 4JOIA 5IGFA 1GO3E 4DNIA 5FK9C 1KL9A 1GUTA 4BY7H 1S5FD 1JT8A 3VYSA 1GHKA 1W2BA 3HOWB 1STBA 1KC8C 2M2LA 3FRPB 2XRQD 3FMCA 1Y14B 2XTIA 3WOFA 1LABA 3I73A 1GKHA 1C7YA 1HNWQ 1G2TA 1DM0B 5C44B 4JI2L 5A2QE 1IYVA 1VQEA 3PUXA 5E4WC 4HJ8A 1Y1VG 3H6MA 2KHIA 5C3EB 2JA8G 4BY7G 4A3DB 5C0XI 1TU2B 1WD1A 1NY4A 2RDHA 3D4WA 5BN4A 1NR2A 2R61A 4HJ7A 1B7YB 3PSIA 1JMCA 3PO3H 1SYDA 1JCKB 1N33L 4LFAQ 1U4MA 2UUAL 3E9HA 2KJXA 5E4XA 4A3BG 1YHAA 4LNQA 1BCPC 3HP3A 4DKAC 2OTJA 2LXJA 1QZGA 1DD2A 2FMCA 1CI3M 2NVQH 3D4DA 2ATWA 1IBLL 1WI5A 1XX8A 1GUGA 1HJPA 4A3GH 2Z9HA 2F0SA 1XNQL 4KTAA 5D65A 1CM9A 3NWSA 2N8NA 1HZ9A 3CC7A 4LF6L 1STYA 4DA2A 4DR7Q 4HIDA 4DAYB 4C3IG 3MC0B 1KIXA 2NVQB 1E22A 3HEJA 3VR6A 1XTDA 3S2DH 1V1OA 4A3GB 1YNJC 3R8BA 2B8GA 4PQXA 4HCSA 1N36L 2PQAB 1X54A 1E2WA 5JJKA 4KY7A 1SMYC 2R92B 2CWAA 1CQFA 4KJOA 3SK8A 2VW9A 1HHVA 2Q2UA 1Y1WH 3CPWA 1BBXC 3SK6A 4LK1C 4A76A 4DV1L 2B63H 1JOKA 2HT1A 3HOZG 4IO9A 4JI8L 3U9OA 3E6ZX 1I4HA 3C1EA 3OW7A 3GTJB 4FXKC 1A2TA 1ET6A 3K58A 2CKZB 2NYZD 4YY3Q 1S40A 1WOCA 4DR1L 1X32A 4G7OC 3UE1A 4UP7A 1EY6A 3KLWA 1S5BD 1K0RA 1STNA 3PIOA 1K28A 1PTOF 1VQLA 4LF7Q 5C3EG 4C3JB 2IX0A 3G6JB 3A5UA 5E3FA 2O5IC 1QUQA 1FGUA 3AU7A 3MXUA 5IODA 2A6ED 1CSPA 2WV6D 3GQBA 1IL8A 1K3RA 2F0EA 4CDDC 5FJ8G 3C46A 3NHHA 1VQNA 3E9IA 5LMUL 3NP8A 4O1NA 3GTLB 2J4XA 2JK8A 4K6DA 4LWCA 3S17B 1TWFB 3DWAA 4CHTB 3AEVA 3SK4A 4DR1Q 2JA8B 4F8MA 4OX9Q 1XPRA 1B44D 3GTGB 4QUCA 3D6CA 3I4MH 1PHJA 4LUOA 2N88A 5AJ3Q 3WOEA 3J80L 4JV5Q 3TREA 4KD3A 4JI5L 5I6WA 2Z4HA 3S1MB 1PH1A 2UUBQ 5DM73 1Q7YC 1U5KA 4L6TB 1S5DD 5M5WH 1L1OA 1VQ9A 1VQMA 4TQUS 3CCEA 3OIPA 4JI8Q 4JI3L 2AUJD 2BA0A 3CP0A 3S15H 4CJ0B 1G51A 4NXML 1U4RA 1EUJA 3ERSX 5IGEA 2TSSA 3BVMA 4QMGA 1FNWA 3PO2H 1B2TA 3PUYA 1EQTA 3RD4A 4H13C 3U4ZA 4GNXC 1K83B 3GD7A 1XWEA 1SNMA 3OHXC 2WFWA 2IY5B 2NUCA 5ELCA 2IL8A 3P20A 5IYBH 3VR3A 1ICFB 4YCVA 4GLAC 4C3JG 4C3HB 4GKJQ 1YVCA 1KQSA 4DAYA 1XJVA 1KLGD 2F0TA 2N55A 4BY1H 3HOZB 3ICEA 3MFYA 2IX3A 1K8GA 1NNXA 3J81i 4DN4M 3T1HL 2DNCA 4FP5D 3S17H 2A68C 2E2DC 3A7LA 3CCSA 1C4QA 3F2CA 1AH9A 1VQCA 1FVIA 5IYBG 2NTTA 3OMCA 4A75A 2CVRA 3ZYYX 2EVBA 4ULLA 1FGBD 1Q8KA 1PRTD 3T51B 5FO7B 4I7AA 4JV5L 4DK0A 1WJJA 3A54A 1SMYD 2V1CC 1PYSB 1QILA 3MTSA 3ULLA 4IJLA 5EPKA 2F0DA 3M9BA 3T56B 1S5CD 5M3MB 2DUDA 5ELOA 5C4ZA 4HJ9A 1HFNA 2VUMG 4DV1Q 1PLFA 3S14B 2C35B 4B3SQ 5C44H 2QILA 2EYFA 3LX0A 4PZ6A 4G7ZC 2F0HA 1CUKA 1I6HB 3UE0A 1ENCA 2QA4A 2HIXA 4DK1A 1VQIA 4EVOA 3HG9A 3LWUA 4XQQA 1KD1C 1PTOD 4I7ZC 2L1BA 2R7ZG 1O7IA 2PO4A 2NVTB 3F2BA 2DY7A 2WB1B 1LTGD 4RGTA 3TEHB 3NENA 4R4TA 1EY5A 2OT2A 4DR7L 2KEEA 2VS1A 2YV5A 1DONA 4BY1B 3HOZH 1GUWA 1QNKA 3PIPA 3VYUA 1RHPA 2OTLA 5ELNA 2SNSA 5GAHC 1SN8A 2Z6BA 1PFMA 1QZHA 4JI6Q 4NDXA 3HOWG 4OO1I 4X66Q 1I50B 1IBKL 4UHVA 4B3RQ 5KNCA 3VYRA 3KF6B 1SXTA 2IW3A 2JA6H 3I4NG 1RD9D 5IT9E 3I4MG 1PTOC 1F2ZA 1CA6A 3I3CA 1WCMG 2G5DA 4CKBA 2IJ0A 3I4LA 2XWJB 2XIWA 4DV3Q 2JA6G 3I4NH 4GKJL 4A3DH 1BCPF 1FJGQ 1PYBA 3J7AF 2LKVA 2ALYB 4DR3Q 2BH8A 4G7HC 2A69D 3GTLH 1IL2A 2I5HA 3S1RB 3QJYA 4QCLA 4X3SA 2D2CC 1KXLA 4RCOA 1P8LA 4LFBQ 5C0XH 1JB3A 4DGZA 4XQJA 2EQSA 3E0EA 5G3LD 4K0KQ 2DY8A 3EJIA 1PMRA 4LFCQ 2E2HH 5C0XJ 1EEFD 1HUMA 5HURA 2Z8LA 3QO2A 4FF3A 4A3BH 3H3VC 2NZ1D 2UXCQ 1UNSA 3TP5A 3L2PA 1YJWA 3VDYA 1BUVT 1PRTC 1FNUA 1S3OA 3K0YA 1EFWA 5IIFA 1X55A 3JAML 1D1IA 3G4SA 4GZYC 1J8IA 4IPDA 3M4YA 3QOJA 5IGDA 5J22A 2FINB 4P74A 1TXYA 3AFQA 5LL6X 1ESFA 2L15A 1QB5D 1I5FA 2A68D 3QOLA 5C4JB 1NE3A 1VQGA 4OHJA 4AIMA 4M1UB 1E1TA 2K50A 5IYDG 4A3FH 2RKSA 1RJTA 3E3XA 2E76C 2ENBA 4N9PA 4A3LG 2B3GA 3A8JE 2OCEA 1IBKQ 1K83H 4YCUA 1O80A 1QG7A 2HUGA 1HZCA 5FKAC 4O42A 1PA6A 3M4OH 1PZKD 5T1GA 1VQJA 1LTSD 3RN5A 2PQEA 4DR4L 2KECA 3HZXA 4KI0A 3S1NH 5CV8A 4LF7L 4X3UA 1D1KA 4PZ8A 5IT9c 1RIPA 1IKLA 2E2IB 4B3ML 5M5WB 1LM0A 1G6ZA 4J15A 4UDUC 3S9WA 4A3KB 2Q2IA 4CJ2C 1CFMA 2LS01 3CU7A 3RLOA 2DNEA 4BWGB 2BDNA 2YYZA 4C3IH 3IAYA 1LTBD 1MSHA 4L5QA 1PV4A 4X64Q 4ZYSA 2IT1A 2PZWA 3D3RA 4DR6L 3OSOA 1A62A 1C9OA 5ELEA 2CFMA 1EOVA 4XYOA 4A3MH 1ZYRD 4LF5Q 3D0FA 2WAQG 4BA1I 1UUPA 1UWVA 4OX9L 4A3EH 1YJNA 4M8AA 2IPKD 2UUCQ 2BA1A 5IWAQ 4WJ3M 2OF1A 3NXWA 2AWOA 1AZPA 1IBML 2XSCA 5DM63 1S72A 2PYKA 1WTRA 2ICIA 4JC0A 2BE5C 5EKKA 4N8X1 5IP9H 2ICEC 2K03A 2D5DA 1V43A 1R9TH 2IHFA 2F4VL 2AQ2B 2RDGA 1H9RA 2QW7A 2KHSA 1H9SA 1X3PA 1PZID 1M1KC 1T5EA 3I4NB 5J39A 4OWXB 2ZJRA 1UE5A 5GAGC 4JYAL 4C3HG 2EYOA 1B3QA 1STGA 3DLLA 3GTPH 2ZXRA 3HOUB 1CKOA 3I70A 4LF4L 2H4OA 3JAMi 3H3VI 4ALPA 1L0YB 3A7AB 4L5SA 1V8QA 5KIXA 5EKIA 3OTOQ 1A0IA 1B1ZA 3EQLC 4QQBX 3S24A 5CBAE 4JVZA 3GO5A 5FO9B 2O5JC 4QGUA 5LMNW 1EQVA 3FVQA 5M9OA 2FHTA 3CQZH 1Y69U 3J80c 2GA4B 3K80C 1CKNA 2KA7A 1FNVA 1ICWA 2V4DA 4NKLA 1CTMA 3CXCA 1OXUA 5IGGA 3K81C 2E74C 4X62L 4DUZL 3NK9A 4DV4L 4LUVA 1LT4D 4QUFA 2RQXA 5CYUA 4X66L 1G8ZD 4IUPA 3D8GA 1WTWA 2ZTDA 1NJIC 5CV4A 4PNYA 4DR5Q 1PXUA 4BA2I 1EWCA 1TKWB 3MXNA 1B4OA 1QJOA 4A3CG 1N32L 3S1MH 3CCJA 4UAIA 1DZ1A 1J5EL 2ZTCA 1IW7D 4RGMA 3J81L 3LNNA 4HIKA 3GTKB 2OQ0A 1JB7A 1TS4A 4DV5Q 4ZUJA 3HKZB 2R93B 2AQ3B 2HCCA 2K28A 4JBWA 2CCZA 1AE3A 2PW5A 1VQ4A 1M8AA 4POGA 1HCZA 3A56A 1DOMA 5C4XG 5E7NA 2F0FA 4UP8A 2KHJA 4PMCA 2EYJA 4K0KL 3G48A 1ILQA 2K5HA 2X6GA 4Q5VA 1YZ6A 3BZKA 3Q0AA 5M5YB 5IY0A 4ZAIA 2ZJPA 3NSWA 3JAMc 2K5VA 1S4ZA 2EYPA 4DF7A 3TP8A 4YWMA 3QR8A 2EXZA 1KRSA 1TR5A 4Q0FA 3VR2A 1U9RA 4GS3A 4J6HA 4A3EB 3M4PA 2EIFA 3I4OA 5IOCA 1Z47A 4R8NA 1K8OA 4YHHL 2AWNA 4LAAA 3UI2A 2PZTA 3W5OA 3R2TA 1SJED 3J80i 2R6GA 2R92G 5KNDA 4EQPA 2I07B 5M5XH 1RTNA 3GTQB 4CJ1B 4IUVA 1ZEQX 2PMZE 4O0AA 2O4XA 1E3PA 2LY7A 1U0LA 3QB3A 2VQFL 3ER0A 1F2LA 1FL0A 4B3RL 5F2DA 2MQHA 1GHJA 3FKIB 4JBJA 5AFWA 2CQAA 2CWPA 1I4RA 1SYFA 2B2UC 2K5NA 3I72A 4N8FA 3A55A 2CH4W 4KHVA 4C3IB 3AQQA 2F0UA 2XWBB 3K7AH 3WDNA 1PH2A 4POFA 4I65A 1XNRL 3BZCA 3I91A 3HKZG 3HOVB 4A3MG 3PF5A 5FJ8H 3SE0A 3FPUB 4JI5Q 1SYGA 4EGVA 1X65A 4TRDA 3K5OA 1ONLA 1VCIA 1TS3A 1JORA 4DV4Q 3SHLA 2KCCA 3S2HH 4R1JA 3I56A 4FNFA 1DXMA 1KDAA 1TWGB 3RR5A 2VQFQ 1VQFA 4P73A 4ZRZA 4GOPB 3U58A 3DMUA 3VA5A 1PTOH 4OIJA 5EPLA 3EFXD 3OTOL 2KENA 3H0GB 3TP6A 2L12A 1C8CA 3M3YH 3K0XA 1XYIA 3NEMA 2NBFA 2BDOA 4CKCA 2XN9C 1B50A 1JICA 4JI1L 2K5QA 3DUZA 3PIO3 2EE1A 3CCMA 1QE6A 1IYJB 1LT6D 2KVMA 2F0MA 3QIAA 2EY1A 5IYCH 2ID0A 1Y8OB 3HRZC 2UXBQ 3SGIA 1HNXQ 4IUQA 3CC2A 1MJCA 4F7XA 4MZ9A 3RZOB 2HD3A 4K5XA 4KN4C 1Q1EA 4TKOB 1EEID 1GD7A 4IZ8A 4K8JA 3CHBD 3BG3A 2A1AA 4H7BA 4DPGA 4HEDA 4KD4A 3KF8B 1PYWD 4IFDJ 2SEBD 2NVTH 3CQZB 4L63B 1YI2A 1YHBA 4KY6A 2L55A 4PG3A 1OXSC 1PH7A 4OWTB 3CCLA 2ZXPA 5EKLA 1WTXA 1SNQA 1EY0A 1BOSA 1STEA 2G9DA 1Y1WG 4LFAL 4DV6Q 4Y7NH 2E75C 2HDLA 4A3KH 5BN5A 4GOPC 1KHIA 5CV6A 5M3FH 1SLJA 5C5LA 5FLMG 3EROA 1KABA 2FXQA 1PH3A 4OWWB 5LMNL 2LMCB 4BS9A 4AYBB 2NN6G 4DR3L 2F0PA 1PTOB 4J8QA 1B8AA 4JBMA 3OYYA 2CH4A 5I2YA 3CCVA 1Y1WB 2JSOA 1Y1VH 2K4KA 3UDGA 1LTLA 4HCEA 3PUZA 3CRLC 1V9PA 5JOBA 3A8KE 2K1BA 1K8MA 4KK7A 3K5NA 1IBMQ 5IYCG 2JJQA 3NUCA 4JI7L 1K8AC 4XT1B 5M3FG 4XXEA 1EYGA 1B3AA 2UU9Q 4A93G 1YBYA 5GADC 3V2TA 5KEEA 2A6HD 3V05A 4HJAA 1YIJA 4B3SL 2B39A 5C5MA 1VF7A 2HQLA 3MVVA 2C9OA 4EQNA 4IJHA 2CQOA 3FKIG 1STAA 3BZDB 5IP7H 3S1QB 1WTOA 1WCMH 1QNUA 3CMAA 4ILWA 2N3SA
chains in the Genus database with same CATH topology
1OXVA 3I8ZA 5I6YA 4RKBA 4KV6A 1TS5A 4QIWB 5COYA 3DEOA 1OXTA 5BN3A 3DM1A 1SSOA 1I4PA 1VDZA 3ND9A 1KDBA 1NR4A 4XTCS 3MZ5A 2NVYB 2VB3X 1U4LA 3M7NA 3OWFA 2XRSD 5CC4A 3R93A 3NTIA 2JYOA 1W6JA 2BCOA 1BCPB 4ABNA 3TZDA 3PV0A 1SAPA 4KHZA 1B9MA 2L5TA 1RCVD 2JA7B 1HXYD 1PFNA 1PZJD 2MUYA 1C48A 1MSGA 3DWPA 1CHQD 2EYHA 2WAQB 1SFOB 1SJHD 1A3UA 3ERQA 4H44C 5EPJA 3C3LA 5IGCA 2K05A 4OO1H 3Q6SA 1JR0D 3PMFA 4DAVA 1TQOA 2Y0SB 1KNAA 1GXDC 2MJ8A 3R3OA 1ZYRC 4BY7B 4N9TA 4C56C 5JVH3 2B2TC 1A2UA 5JPNC 1NCVA 4RWSC 4G57A 4IFDG 2EDGA 2PZUA 5LL6S 1BDOA 2B2YC 4PV1C 1EY8A 1ET9A 3NE5B 2VNUD 3DHQA 3BDOA 1SE4A 2F1MA 5EGTA 2F3VA 4K2LA 3HOYB 4HR7B 4KN7C 3KLSA 4HMIA 5DEHA 2JEBI 4IUUA 3OWEB 4FO2A 4PMBA 1SYCA 2K7VA 4OL7A 5ELDA 3OMGA 1MGSA 3D6WA 4QF4A 1Q8IA 5E1FA 3VR4A 1A3TA 1GOZA 4KKSA 3U9SA 2RSOA 3GV3A 1V1PB 3H94A 4NMZA 4B9WA 4R8IA 4RHSA 2RDFA 3NBHA 3KBGA 1X3QA 5C3WA 2D9UA 4CBVA 5KYLA 3S16B 1VMCA 4A3JB 4IFDH 2RBMA 4IUTA 1I4XA 2PPBC 2FJ2A 1JOQA 2WIIB 3TMEA 4KKTA 1TT2A 2NB0A 3N6RA 2QCPX 4WRDA 3X3MA 1Y1VB 3MWYW 4HSVA 1WVLA 2IX1A 1E0BA 1MD2D 3KBXA 1FYCA 1CHPD 3L9AX 2R7ZB 1XXGA 3EA6A 2VB2X 1HUNA 2ZXOA 1ENFA 3BYTB 3P7JA 3DEPA 2NWGA 4FXGC 3X3NA 2WP8J 4RFBA 3EVQA 1WCMB 1TVXA 1GJXA 1D2BA 3SR1A 2RSNA 2XNAC 2SDFA 3QG1A 3SDZA 5CMDA 4XT3B 1VMPA 4DNRB 1D5XC 4A93B 2KUMA 4A3IB 1BR9A 1BXTA 1F9QA 4ZKCB 4FF2A 3P75A 1IW7C 1NAPA 5NUCA 3URYA 3IKJA 4ZQ3A 4XIGS 2M00A 3HOXB 3TP7A 5KYIA 3M4OB 4EQOA 2EOTA 2EZVA 2LFNA 1ZXTA 5C0XG 5CV9A 1ESRA 2B2WC 2F0NA 4L8JA 4S3SA 1R4QB 5C4XB 3GP7A 2WINB 4KJNA 1Z6HA 2F0IA 1E2VA 5I2XA 3GTOB 1QCBD 4RA8A 1EU3A 3J81E 1SNOA 2B2UA 2B2YA 1D5ZC 1PDQA 3MHBA 3K5LA 1H9JA 2WACA 4OIKA 3NPPA 3G7LA 1EIGA 5LHY1 3FEWX 3KLSX 4FXDA 5I9OA 1EWHA 2YU9B 2BOSA 2KEDA 1SNDA 2BE5D 1LO5D 4WORA 2KOLA 1RTOA 1KDCA 3K57A 3GTPB 2B63B 4PMWA 4IQZA 1H9MA 1Q12A 3KUPA 1O78A 1FD7D 2MP1A 3Q24A 3PUWA 2NTSA 1SYBA 1XTCD 2ZT9C 4K5VA 1JWMD 4IALA 3GV6A 2MPMA 4Z9CB 1DJRD 3K7AB 4K14A 1YNND 3S1NB 5FO8B 2EJMA 2FFKB 1M4VA 1WTPA 3A8IE 4IURA 4ZKBB 2F0GA 4KY5A 1VF5C 3S2DB 1LT5D 1SE2A 1UAPA 2PCFB 1OO9B 4MN3A 2F0JA 3SK5A 1AEXA 1AFPA 3RLFA 4U68A 2SOBA 4JK1C 3J7AV 1R4PB 5FLXL 5EBDA 4IFDI 1O7YA 4RH6A 1BNZA 3CKIB 2L4NA 3L3OC 5IT9L 1DOKA 1AZQA 1JWUD 1QWYA 2RA4A 3OPOA 4RHRA 3V96A 1RDPD 1ML0D 5DNFA 1HTPA 1F2YA 4K2KA 4XYQA 4C1NK 1IYUA 1G91A 1L0XB 2OXPA 4X3KA 3T53B 1E2ZA 4DAPA 1YNNC 1JOOA 2QEJC 2A73B 2F0QA 1A15A 2QDBA 2A74C 4MHEA 1EY9A 4RGOS 2F0OA 4FF1A 5D3DA 4Y7NB 3NQTA 1DOLA 1LACA 1SE3A 1LTAD 1LTTD 3M3YB 1SYEA 5A2QL 1F9PA 4V0BA 4RKLA 4ME5A 2IWHA 3BS1A 1O7LA 3KK7A 2E2HB 1CQVA 1TY0A 3Q22A 3SEBA 5ELFA 3TBIB 1ILPA 1T5XD 5I4DA 3D31A 3VYTA 3AB9A 3NTKA 2EY2A 2Q8IB 3I4MB 5DAUA 1JQYD 1SNPA 3SXHA 4CKEA 5M5XB 3HGBA 5KGUA 5JEAJ 5ISRA 2D62A 4B9XA 3W3AA 1FR3A 4DXGA 1LTRD 2L9HA 1S5ED 1QOHA 1SBBB 2PW7A 4P2CB 1LLRD 3S15B 1TWAB 1F2MA 2F4IA 3BVZA 4B08A 4J1MA 2VXWA 4IN3A 1JWSD 2K6AA 4XDXA 2F0WA 1ZKOA 4BBRB 1AW7A 3MA2B 1RF2D 2K01A 3NBIA 4ODGA 4HTHA 4FF4A 2G9HD 4V190 1EOTA 4RGNA 1V1PA 2HQEA 2CW0C 4OGQC 2NVXB 4F87A 1WTVA 3HS0C 1HA5A 2JXMB 1NUCA 3K59A 3ND8A 1HQMC 4DXFA 2WKCA 2PMZB 3AMUA 1HA6A 3PIP3 4HN7A 3KF8A 4HSPA 5CBEE 1Z7TA 2QKIC 3C1FA 4F88A 1LV9A 3KLRA 1NSNS 2F0LA 1EFID 4BBSB 2PNRC 1TWCB 4LMQD 2K5WA 5KNBA 4H0LC 1TWHB 5CV7A 5KRUA 2C5CA 2MGSA 2DN8A 2A5HA 5C6AA 2X69A 3VR5A 1KAAA 5G3LF 5K36G 5D3IB 1D5MC 1H9SB 2K32A 3T13A 4U673 1B53A 4R9WA 4X3TA 5D14A 1F9SA 5FOBB 1II3A 1DCZA 3D4RA 1EYAA 3DXJC 2K04A 4XQNA 2F3WA 2J7ZA 5C4HA 1PRTF 1LT3D 2M9VA 2AQ1B 2RVLA 3NTHA 1F9RA 2A6EC 1AN8A 2O2LD 2NN6H 4IUNA 1HTLD 1MI2A 2OEOA 2R3ZA 2AUKA 5CR3A 3J80E 3RMHA 4DFAA 1EYCA 1GUSA 4A3MB 3O13A 1HQRD 1STHA 1KLUD 4TSSA 5J1ZA 5C3XA 1LTID 2Q8TA 2VUMB 2QF7A 2HCIA 5CV5A 1YNJD 5FLXE 1JC7A 2L0CA 3K6OA 2KCNA 2X6LA 5K36H 5EJWA 1CZGA 4HMJA 4KMUC 3CRKC 2K5DA 1SDFA 1D6EC 4K6LA 1IHZA 4QB4A 2F0KA 2EJFC 5JJZA 5TSSA 3J7YW 5JVG3 1HRJA 4FYDA 1WTQA 1BCPD 3I90A 3MXGA 4ID6A 1AP0A 3DWQA 2E2JB 5JPMC 1EU4A 1ENAA 5ELBA 2I46A 1EY4A 1RKNA 3H09A 3N52A 4E6IA 2JE6I 2F0VA 3TZUA 2L11A 4ZUIA 1SEBD 1PRTB 3E5SA 4A3BB 4C1NI 1I3QB 1J9OA 1HPCA 1BF4A 2EPBA 5CGKA 1TY2A 1CA5A 1RODA 1CT1D 3ITPA 2EY5A 1BO0A 2JEAI 2EY6A 3IL8A 3FPPA 3NWTA 3F2UA 3M85A 1Y8NB 2B2TA 3FDTA 4K5WA 1CZWA 4K8IA 1KNEA 1OXXK 1Y8PB 4NW2A 5M3FB 3RZDB 3BDLA 2B2VA 2EJGC 2MHVA 2WKDA 1W6KA 2CHBD 5I9PA 1H9KA 1DYQA 3SVMA 4YIJA 1F77A 3M7GA 3S2HB 3Q23A 1Q3LA 1EIHA 1TS2A 2KQ3A 3IFDA 1PFBA 3PO3B 3TSSA 3GTMB 2XVSA 1EYDA 2A6HC 2JP1A 1GUOA 2EYMA 3PUVA 3VA7A 1B9NA 1EZ8A 5JEAH 2HDMA 1I4GA 3BVGA 3MEHA 1HFGA 4RCNA 5JEAG 1G2SA 5T1IA 2B2VC 4G4KA 4NP5A 4FVMA 3OIQA 3LWEA 1JE4A 1EL0A 4MIUA 2TMPA 2J0TD 3P1HA 1A3VA 1EZ6A 3T4AC 3QWNA 2H1EA 2B2WA 5A35A 3R2IA 4CGYB 3C2PA 5HGTA 3BYYB 4DU9A 3MXPA 5EQ0A 2NN6I 4KKUA 1I4QA 2F03A 2Q8RE 5EBCA 4ZLTF 3MFGA 4HAEA 3H91A 3OOCA 1Q1BA 1WD0A 5IGBA 2B8FA 1I6VC 3TDQA 1A6XA 3ONAB 1G291 3TN2A 1BQQT 3K5MA 4WJWA 4DNTB 5JAVA 4ZK9B 1TIID 3IFTA 3BDCA 1R9TB 1MBYA 2Z4IA 3L7ZC 2CW0D 1Q90A 4C2MB 1U4PA 4WFN3 5K5PA 3RUZA 3T16A 1KTKA 2SNMA 2JA6B 5CORA 2JA5B 4OO1G 4A3FB 1IKMA 4RAUC 3W2DA 1O7ZA 2Z1CA 3E0JA 1SNCA 1CK1A 2FMMA 4LJZC 2EYLA 1EY7A 3MAQA 2K33A 1UEAB 3NQIA 1GUNA 3PO2B 2A69C 3JAME 5IGFA 5FK9C 1GUTA 1S5FD 3VYSA 1GHKA 3HOWB 1STBA 2M2LA 3FRPB 2XRQD 3FMCA 3WOFA 1LABA 3I73A 1G2TA 1DM0B 5C44B 5A2QE 1IYVA 3PUXA 5E4WC 3H6MA 5C3EB 4A3DB 5C0XI 1TU2B 1WD1A 2RDHA 3D4WA 5BN4A 1NR2A 2R61A 1SYDA 1JCKB 1U4MA 2KJXA 5E4XA 1BCPC 3HP3A 1DD2A 2FMCA 1CI3M 3D4DA 1XX8A 1GUGA 2F0SA 4KTAA 5D65A 1CM9A 3NWSA 1STYA 4DA2A 4C3IG 3MC0B 2NVQB 3HEJA 3VR6A 1V1OA 4A3GB 1YNJC 3R8BA 2B8GA 4PQXA 4HCSA 1E2WA 4KY7A 1SMYC 2R92B 1CQFA 4KJOA 3SK8A 1HHVA 1BBXC 3SK6A 4LK1C 1JOKA 3U9OA 3E6ZX 1I4HA 3C1EA 3OW7A 3GTJB 4FXKC 1A2TA 1ET6A 3K58A 2NYZD 1X32A 4G7OC 1EY6A 1S5BD 1STNA 1PTOF 4C3JB 2IX0A 3G6JB 5E3FA 2O5IC 3AU7A 3MXUA 5IODA 2A6ED 2WV6D 3GQBA 1IL8A 2F0EA 3C46A 3NHHA 3NP8A 4O1NA 3GTLB 2J4XA 4K6DA 3S17B 1TWFB 3DWAA 4CHTB 3SK4A 2JA8B 4F8MA 1B44D 3GTGB 4QUCA 3D6CA 2N88A 3WOEA 3J80L 4KD3A 5I6WA 2Z4HA 3S1MB 5DM73 4L6TB 1S5DD 4TQUS 3OIPA 2AUJD 2BA0A 4CJ0B 1U4RA 5IGEA 2TSSA 3BVMA 4QMGA 1FNWA 1B2TA 3PUYA 1EQTA 3RD4A 4H13C 1K83B 3GD7A 1XWEA 1SNMA 3OHXC 2NUCA 5ELCA 2IL8A 3P20A 3VR3A 4C3JG 4C3HB 4DAYA 1KLGD 2F0TA 3HOZB 2N55A 3MFYA 2IX3A 4DN4M 2DNCA 4FP5D 2A68C 2E2DC 3A7LA 1C4QA 2NTTA 3OMCA 2CVRA 3ZYYX 2EVBA 4ULLA 1FGBD 1PRTD 3T51B 5FO7B 4DK0A 3A54A 1SMYD 1QILA 3MTSA 5EPKA 2F0DA 3T56B 1S5CD 5M3MB 5C4ZA 1HFNA 1PLFA 3S14B 2QILA 2EYFA 3LX0A 4G7ZC 2F0HA 1I6HB 1ENCA 4DK1A 4EVOA 3HG9A 3LWUA 4XQQA 1PTOD 4I7ZC 2L1BA 2PO4A 2NVTB 2DY7A 2WB1B 1LTGD 4RGTA 1EY5A 2OT2A 2KEEA 1DONA 4BY1B 1GUWA 1QNKA 3VYUA 1RHPA 2SNSA 1PFMA 4NDXA 4OO1I 1I50B 5KNCA 3VYRA 1SXTA 2IW3A 1RD9D 5IT9E 1PTOC 1F2ZA 1CA6A 4CKBA 3I3CA 2IJ0A 3I4LA 2XWJB 2XIWA 1BCPF 3J7AF 2LKVA 4G7HC 2A69D 3S1RB 3QJYA 4QCLA 4X3SA 2D2CC 4RCOA 5C0XH 1JB3A 4DGZA 4XQJA 5G3LD 2DY8A 3EJIA 1PMRA 5C0XJ 1EEFD 1HUMA 5HURA 2Z8LA 3QO2A 4FF3A 3H3VC 2NZ1D 1UNSA 3TP5A 1BUVT 1PRTC 1FNUA 3K0YA 5IIFA 3JAML 1D1IA 4GZYC 1J8IA 3M4YA 3QOJA 5IGDA 5J22A 2FINB 5LL6X 1ESFA 1QB5D 2A68D 3QOLA 5C4JB 4OHJA 4M1UB 2RKSA 1RJTA 2ENBA 2E76C 4N9PA 3A8JE 1O80A 1QG7A 2HUGA 5FKAC 4O42A 1PZKD 5T1GA 1LTSD 2PQEA 2KECA 3HZXA 4KI0A 5CV8A 4X3UA 1D1KA 1IKLA 2E2IB 5M5WB 1G6ZA 4UDUC 3S9WA 4A3KB 4CJ2C 1CFMA 2LS01 3CU7A 2DNEA 4BWGB 2BDNA 2YYZA 3IAYA 1LTBD 1MSHA 4ZYSA 2IT1A 2PZWA 3D3RA 3OSOA 5ELEA 4XYOA 1ZYRD 4BA1I 1UUPA 4M8AA 2IPKD 2BA1A 2OF1A 3NXWA 2AWOA 1AZPA 2XSCA 5DM63 2PYKA 1WTRA 2ICIA 2BE5C 5EKKA 2ICEC 2K03A 2D5DA 1V43A 2AQ2B 2RDGA 1H9RA 2KHSA 1H9SA 1X3PA 1PZID 1T5EA 3I4NB 5J39A 4C3HG 2EYOA 1STGA 3HOUB 2ZXRA 3I70A 2H4OA 1L0YB 3A7AB 1V8QA 5KIXA 5EKIA 1B1ZA 3EQLC 5CBAE 3GO5A 5FO9B 2O5JC 1EQVA 3FVQA 5M9OA 2FHTA 1Y69U 2GA4B 2KA7A 1FNVA 1ICWA 2V4DA 4NKLA 1CTMA 1OXUA 5IGGA 2E74C 3NK9A 1LT4D 4QUFA 2RQXA 5CYUA 1G8ZD 4IUPA 3D8GA 1WTWA 5CV4A 4PNYA 4BA2I 1PXUA 1EWCA 1TKWB 3MXNA 1B4OA 1QJOA 4UAIA 1DZ1A 1IW7D 4RGMA 3J81L 3LNNA 3GTKB 1TS4A 4ZUJA 3HKZB 2R93B 2AQ3B 2HCCA 2K28A 4JBWA 2PW5A 1M8AA 1HCZA 3A56A 1DOMA 2F0FA 4PMCA 2EYJA 1ILQA 4Q5VA 2X6GA 3Q0AA 5M5YB 4ZAIA 3NSWA 1S4ZA 2EYPA 4DF7A 3TP8A 2EXZA 1TR5A 4Q0FA 3VR2A 1U9RA 4J6HA 4A3EB 5IOCA 1K8OA 1Z47A 4R8NA 2AWNA 4LAAA 3UI2A 2PZTA 3R2TA 1SJED 2R6GA 5KNDA 4EQPA 2I07B 1RTNA 3GTQB 4CJ1B 4IUVA 1ZEQX 2O4XA 2LY7A 3QB3A 1F2LA 5F2DA 1GHJA 3FKIB 5AFWA 2CQAA 1I4RA 1SYFA 2B2UC 3I72A 3A55A 4KHVA 4C3IB 2F0UA 2XWBB 3WDNA 4I65A 3I91A 3HOVB 3SE0A 3FPUB 1SYGA 4EGVA 4TRDA 3K5OA 1ONLA 1VCIA 1TS3A 1JORA 3SHLA 2KCCA 4FNFA 1DXMA 1KDAA 1TWGB 4ZRZA 3DMUA 3VA5A 1PTOH 4OIJA 5EPLA 3EFXD 3H0GB 3TP6A 2L12A 1C8CA 1XYIA 2NBFA 2BDOA 4CKCA 2XN9C 1B50A 1JICA 2K5QA 3DUZA 3PIO3 2EE1A 1QE6A 1LT6D 2KVMA 2F0MA 3QIAA 2EY1A 2ID0A 1Y8OB 3HRZC 4IUQA 4F7XA 3RZOB 4K5XA 4KN4C 1Q1EA 4TKOB 1EEID 4IZ8A 4K8JA 3CHBD 3BG3A 4H7BA 4HEDA 4KD4A 1PYWD 4IFDJ 2SEBD 3CQZB 4L63B 4KY6A 2L55A 1OXSC 2ZXPA 5EKLA 1WTXA 1SNQA 1EY0A 1BOSA 1STEA 2G9DA 2E75C 2HDLA 5BN5A 5CV6A 5C5LA 3EROA 1KABA 2LMCB 4BS9A 4AYBB 2NN6G 2F0PA 1PTOB 4J8QA 5I2YA 1Y1WB 2JSOA 4HCEA 3PUZA 3CRLC 5JOBA 3A8KE 2K1BA 1K8MA 4KK7A 3K5NA 3NUCA 4XT1B 4XXEA 1B3AA 3V2TA 5KEEA 2A6HD 3V05A 2B39A 5C5MA 1VF7A 3MVVA 2C9OA 4EQNA 1STAA 3BZDB 3S1QB 1WTOA 1QNUA 4ILWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3V A;  3E5S A;  5IGF A;  4K2K A;  1EZ6 A;  2F0W A;  5I9O A;  1EYA A;  2PZU A;  1EY6 A;  1STN A;  2F3W A;  5C4H A;  2OXP A;  5I6Y A;  1SND A;  4RKB A;  2LKV A;  4J1M A;  5CGK A;  4KV6 A;  2F0F A;  2OF1 A;  3NXW A;  1EY8 A;  4PMC A;  2EYJ A;  1STB A;  1JOO A;  4WOR A;  3OMC A;  2F0M A;  5HGT A;  2F0Q A;  5E3F A;  2QDB A;  3ITP A;  2PYK A;  1KDC A;  2EY5 A;  4IUN A;  5HUR A;  4DU9 A;  2EY1 A;  3MXP A;  2EY6 A;  3DHQ A;  1KDB A;  3EVQ A;  5IOD A;  5EKK A;  1EY9 A;  2F0O A;  2OEO A;  4ODG A;  4DGZ A;  4HTH A;  3SR1 A;  5EGT A;  2F0E A;  2F3V A;  3MZ5 A;  4K2L A;  3NHH A;  5CR3 A;  3EJI A;  3NQT A;  4F7X A;  2HQE A;  3OWF A;  2EYP A;  3NP8 A;  4HMI A;  4K5X A;  3TP8 A;  4DFA A;  1EYC A;  2KHS A;  4IZ8 A;  4K8J A;  1SYB A;  5DEH A;  3H6M A;  2EXZ A;  4K5W A;  1SYE A;  2F0D A;  4K6D A;  4K8I A;  1TR5 A;  5CC4 A;  4H7B A;  1U9R A;  4DF7 A;  3TP5 A;  4PMB A;  1SYC A;  4J6H A;  4KD4 A;  4OL7 A;  1STH A;  4IAL A;  4K5V A;  5C4Z A;  5J39 A;  1NUC A;  3D4W A;  4RKL A;  5IGB A;  5J1Z A;  3SK4 A;  5C3X A;  4F8M A;  5IIF A;  5IOC A;  3OMG A;  2EYO A;  4R8N A;  1STG A;  3P75 A;  3BDL A;  4LAA A;  5NUC A;  4KY6 A;  1SYD A;  3QOJ A;  3D6C A;  2PZT A;  4K14 A;  4ZQ3 A;  4ME5 A;  5IGD A;  4QF4 A;  5J22 A;  2M00 A;  5E1F A;  2EYF A;  3LX0 A;  3TP7 A;  5I9P A;  2F0H A;  4EQP A;  1A3T A;  5EKL A;  5KYI A;  1SNQ A;  1EY0 A;  3C1F A;  5CV5 A;  3QOL A;  5JAV A;  5KIX A;  1ENC A;  4KD3 A;  5I6W A;  4EQO A;  3BDC A;  4YIJ A;  1NSN S;  2O4X A;  2F0L A;  2RKS A;  4EVO A;  2ENB A;  3QB3 A;  4N9P A;  3D4D A;  5CV6 A;  5F2D A;  2EYH A;  2F0G A;  1EQV A;  2KQ3 A;  4KY5 A;  4HMJ A;  5CV9 A;  5C5L A;  3ERQ A;  1A3U A;  1KAB A;  2F0N A;  3ERO A;  5M9O A;  2EY2 A;  4NMZ A;  4B9W A;  1SYF A;  2F0S A;  3RUZ A;  5K5P A;  2F0P A;  4KTA A;  3T16 A;  1EY5 A;  2RDF A;  4S3S A;  4KHV A;  4NKL A;  5IGC A;  1EYD A;  2SNM A;  5DAU A;  1SNP A;  3SXH A;  1IHZ A;  2F0U A;  5CV7 A;  5C3W A;  2F0J A;  3PMF A;  4QB4 A;  3SK5 A;  5IGG A;  1AEX A;  5KGU A;  1STY A;  2EYM A;  2F0K A;  2PQE A;  4KJN A;  5KRU A;  5ISR A;  3HZX A;  5KYL A;  3NK9 A;  4I65 A;  5CV8 A;  3P1H A;  1EZ8 A;  5IGE A;  1TQO A;  4B9X A;  5C6A A;  2F0I A;  4QMG A;  5JOB A;  2SOB A;  2RBM A;  1SNC A;  3HEJ A;  3D8G A;  1SYG A;  2SNS A;  3NUC A;  4TRD A;  5CV4 A;  1JOQ A;  4PNY A;  1KAA A;  3TME A;  3MEH A;  3R3O A;  1JOR A;  1SNM A;  3SHL A;  2NUC A;  1SNO A;  3S9W A;  2EYL A;  4ID6 A;  4KY7 A;  4NDX A;  1EY7 A;  1TT2 A;  2PW7 A;  1KDA A;  4KJO A;  3MHB A;  3SK8 A;  1ENA A;  4N9T A;  3V2T A;  5KEE A;  1EY4 A;  3SK6 A;  5C5M A;  4WRD A;  2WAC A;  3T13 A;  3DMU A;  1JOK A;  3VA5 A;  1RKN A;  3TP6 A;  4NP5 A;  3U9O A;  3MVV A;  4ZUJ A;  1F2M A;  2PZW A;  4E6I A;  4EQN A;  3OSO A;  1A2U A;  3C1E A;  2F0V A;  1STA A;  1A2T A;  4MIU A;  2F0T A;  1F2Z A;  1II3 A;  4ZUI A;  2PW5 A;  1F2Y A;  4G57 A; 
#chains in the Genus database with same CATH topology
 1OXV A;  3I8Z A;  4R4O A;  3RN2 A;  1I94 Q;  4JYA Q;  1VQ6 A;  5I6Y A;  4RKB A;  2E2I H;  4NXN Q;  4KV6 A;  1L1O C;  3STB D;  2A8V A;  1HNW L;  1TS5 A;  4QIW B;  5COY A;  1JJ2 A;  3DEO A;  1OXT A;  5BN3 A;  3DM1 A;  2UXD L;  1SSO A;  1I4P A;  1VDZ A;  2RCF A;  4YWK A;  3ND9 A;  5FLM H;  1KDB A;  1NR4 A;  4JPB W;  4XTC S;  3MZ5 A;  2NVY B;  2VUM H;  2VB3 X;  1U4L A;  3M7N A;  3OWF A;  4BBS H;  2XRS D;  2RHS B;  1QUQ B;  5CC4 A;  2WB1 E;  3B6Y A;  4JI0 L;  3R93 A;  2VY3 A;  5J3B A;  3NTI A;  2JYO A;  1W6J A;  2BCO A;  4APV A;  1BCP B;  1I94 L;  1X3G A;  4ABN A;  3TZD A;  1VQO A;  3PV0 A;  1SAP A;  4KHZ A;  1VQD A;  2ZM6 Q;  1B9M A;  2L5T A;  1RCV D;  2JA7 B;  1HXY D;  1PFN A;  2DGY A;  1PZJ D;  2MUY A;  3HOY H;  1EIF A;  1C48 A;  1MSG A;  3DWP A;  1Q46 A;  1CHQ D;  2UU9 L;  2EYH A;  2WAQ B;  1SFO B;  4A3D G;  1SJH D;  1A3U A;  3ERQ A;  4DV5 L;  4H44 C;  2E5L Q;  5EPJ A;  2PI2 E;  3C3L A;  2EXD A;  5IGC A;  2K05 A;  4OO1 H;  3Q6S A;  1JR0 D;  3PMF A;  4LUZ A;  4DAV A;  4Y52 H;  1Q81 C;  1TQO A;  4CDE C;  2Y0S B;  2AHO B;  1KNA A;  2B29 A;  3ULP A;  1GXD C;  4QIW E;  4AYB G;  2MJ8 A;  3R3O A;  1ZYR C;  4OEL B;  4C3J H;  4BY7 B;  4N9T A;  3EN2 A;  4LW1 A;  2GVB A;  4C56 C;  1XMO L;  5JVH 3;  4QY7 A;  2Y0S G;  2B2T C;  1A2U A;  5JPN C;  1NCV A;  4RWS C;  3GTO H;  4P71 A;  4G57 A;  4IFD G;  2EDG A;  2PZU A;  5LL6 S;  2NVX H;  1BDO A;  2B2Y C;  4PV1 C;  1VQP A;  4BBR G;  1EY8 A;  1ET9 A;  1LUZ A;  3CW2 C;  3PCO B;  4ZCK A;  1HH2 P;  1EQR A;  3NE5 B;  2VNU D;  3DHQ A;  3BDO A;  4JI6 L;  1SE4 A;  2F1M A;  5EGT A;  2F3V A;  4K2L A;  1IBL Q;  3HOY B;  1I3Q H;  1IXR A;  1MJE A;  2P5Z X;  2PQA A;  4HR7 B;  4KN7 C;  3W1G A;  3KLS A;  4HMI A;  5DEH A;  2JEB I;  4IUU A;  3OWE B;  4FO2 A;  4PMB A;  1SYC A;  2K7V A;  4OL7 A;  5ELD A;  4AH6 A;  3OMG A;  1MGS A;  3D6W A;  4QF4 A;  1Q8I A;  5E1F A;  3VR4 A;  1A3T A;  1PH6 A;  1GOZ A;  2OWO A;  5C3E H;  4KKS A;  5DLQ E;  3U9S A;  2RSO A;  2E2J H;  1VQH A;  4JI4 L;  3GV3 A;  1BKB A;  1V1P B;  3H94 A;  3RZD H;  4NMZ A;  4B9W A;  4R8I A;  4RHS A;  2RDF A;  1NMF A;  1XMO Q;  2UXC L;  3CCU A;  3NBH A;  3KBG A;  1X3Q A;  5C3W A;  2MNA A;  2D9U A;  4CBV A;  1X9N A;  1NMG A;  4A3E G;  5KYL A;  3S16 B;  4A3J G;  1VMC A;  4A3J B;  4IFD H;  2YU9 H;  3CPF A;  1K0S A;  2RBM A;  4IUT A;  1I4X A;  2PPB C;  1XMQ L;  2FJ2 A;  1JOQ A;  2WII B;  3TME A;  3FHW A;  2Q2H A;  1UE7 A;  2Z0S A;  2B63 G;  1EQQ A;  4KKT A;  1TT2 A;  1WYD A;  4C2M H;  2NB0 A;  3N6R A;  2QCP X;  4WRD A;  3X3M A;  1Y1V B;  3MWY W;  4HSV A;  1WVL A;  2IX1 A;  1E0B A;  1MD2 D;  1VQA A;  3KBX A;  1FYC A;  4R4Q A;  1CHP D;  3L9A X;  2R7Z B;  3EIV A;  1XXG A;  4L5R C;  3EA6 A;  5M3M H;  2PI2 A;  2VB2 X;  1X56 A;  1PH8 A;  1HUN A;  2ZXO A;  1ENF A;  3BYT B;  4DV2 Q;  2I5M X;  3P7J A;  3DEP A;  1MHW C;  2NWG A;  4FXG C;  1SMX A;  2BH2 A;  3X3N A;  4R4I A;  2WP8 J;  4RFB A;  3EVQ A;  1WCM B;  1TVX A;  1GJX A;  1D2B A;  3PO3 G;  3SR1 A;  1LYL A;  2NZO A;  2RSN A;  2SDF A;  2XNA C;  3QG1 A;  3SDZ A;  4LF9 L;  3TS0 A;  5CMD A;  4DR5 L;  4XT3 B;  1VMP A;  3F2D A;  4DNR B;  1D5X C;  4A93 B;  2KUM A;  4A3I B;  1BR9 A;  1BXT A;  1F9Q A;  4LF5 L;  4ZKC B;  4FF2 A;  3P75 A;  1IW7 C;  1NAP A;  5NUC A;  3URY A;  3IKJ A;  4DV0 L;  4GLX A;  4ZQ3 A;  2LXK A;  4XIG S;  2M00 A;  1YEZ A;  4O2D A;  3HOX G;  3TP7 A;  3HOX B;  1XNR Q;  5KYI A;  3M4O B;  1SRU A;  3TS2 A;  4EQO A;  2EOT A;  2EZV A;  2LFN A;  2Q2T A;  3BJU A;  1ZXT A;  5C0X G;  1I50 H;  5CV9 A;  4DR2 Q;  1ESR A;  2B2W C;  2F0N A;  1Z9F A;  4L8J A;  4S3S A;  1R4Q B;  5C4X B;  4B3T L;  3GP7 A;  2WIN B;  2MO1 A;  4KJN A;  3W1B A;  4LFB L;  1N9W A;  1Z6H A;  5EAY A;  4NXN L;  2F0I A;  2D0O A;  1PH9 A;  4GN4 B;  1E2V A;  3PGZ A;  4LF6 Q;  5I2X A;  3GTO B;  1QCB D;  4RA8 A;  4DAM A;  4KHP L;  1EU3 A;  4L5T A;  3J81 E;  1SNO A;  2B2U A;  2B2Y A;  1D5Z C;  1PDQ A;  3MHB A;  3K5L A;  3HKZ E;  3NBH B;  4B3M Q;  1H9J A;  4KLK A;  1TWC H;  2WAC A;  4BXX G;  4OIK A;  1PFS A;  3J7A 5;  3NPP A;  3H15 A;  2WB1 G;  3G7L A;  1EIG A;  5LHY 1;  5JJI A;  3NEL A;  1X3F A;  3FEW X;  3KLS X;  1X3E A;  4FXD A;  5I9O A;  4GKK Q;  1EWH A;  3ZJY C;  2YU9 B;  2BOS A;  2KED A;  1SND A;  2JA8 H;  4JW0 A;  2BE5 D;  4RMF A;  1LO5 D;  2NZH A;  4GN5 A;  4BBS G;  4WOR A;  2KOL A;  1M90 C;  1VQB A;  1RTO A;  1KDC A;  3HOX H;  1BVS A;  5AJ3 L;  1WTH A;  4DV2 L;  5HY6 A;  1L1O B;  3K57 A;  3HOU H;  3GTP B;  2B63 B;  4PMW A;  4IQZ A;  1H9M A;  1Q12 A;  3KUP A;  1O78 A;  1FD7 D;  2MP1 A;  3Q24 A;  3K8A A;  3PUW A;  2NTS A;  1SYB A;  1XTC D;  1FJG L;  2ZT9 C;  4K5V A;  1JWM D;  4IAL A;  3GV6 A;  5LMU Q;  2AKW B;  2E8G A;  2MPM A;  4Z9C B;  4A4I A;  1DJR D;  3K7A B;  4IPC A;  4K14 A;  1YNN D;  3S1R H;  3S1N B;  4IOC A;  2I5L X;  5FO8 B;  2EJM A;  2FFK B;  2VQE Q;  1M4V A;  1V1Q A;  3G71 A;  4DR6 Q;  1WTP A;  3A8I E;  4IUR A;  2HIV A;  1GM5 A;  1CSQ A;  4JI7 Q;  3S16 H;  2ZJQ A;  4AQY Q;  4ZKB B;  1A8V A;  2F0G A;  3HFZ B;  4KY5 A;  1VF5 C;  3S2D B;  3S14 H;  3PQI A;  1LT5 D;  1TWF H;  1VQ5 A;  1SE2 A;  1VQK A;  1UAP A;  2PCF B;  1OO9 B;  4MN3 A;  3MEF A;  2F0J A;  3SK5 A;  1AEX A;  3TRZ A;  5JJL A;  1IZ6 A;  1AFP A;  1N36 Q;  4UP9 A;  3RLF A;  5GAE C;  4U68 A;  2SOB A;  2GN5 A;  4JK1 C;  4QJF A;  3J7A V;  1H95 A;  1R4P B;  5FLX L;  3Q8D A;  4DV6 L;  5EBD A;  4A3G G;  4IFD I;  1O7Y A;  4RH6 A;  3F1Z A;  2R7Z H;  2JN4 A;  1BNZ A;  4UY8 C;  3CKI B;  2L4N A;  4A3L H;  3L3O C;  5IT9 L;  1DOK A;  1AZQ A;  1JWU D;  1QWY A;  2RA4 A;  4AQY L;  3OPO A;  4RHR A;  2AMC B;  2K52 A;  3AFP A;  3KJO A;  4LFC L;  3V96 A;  1RDP D;  1ML0 D;  3CD6 A;  3F8T A;  5DNF A;  3MXN B;  1HTP A;  1F2Y A;  4K2K A;  3BU2 A;  2UUB L;  4XYQ A;  4C1N K;  1IYU A;  3T1Y Q;  1L0X B;  1G91 A;  1NBW A;  2OXP A;  4X3K A;  3L0O A;  3M4Q A;  3T53 B;  3TQY A;  1E2Z A;  1JE5 A;  4DAP A;  1N34 L;  1YNN C;  1JOO A;  2QEJ C;  2A73 B;  2F0Q A;  1A15 A;  2QDB A;  2A74 C;  4MHE A;  4CDF C;  1TWG H;  4P72 A;  1EY9 A;  3H0G G;  2F0O A;  4RGO S;  1PH5 A;  4FF1 A;  5D3D A;  2ES2 A;  4Y7N B;  3NQT A;  4X62 Q;  1DOL A;  2N78 A;  1LAC A;  1UE6 A;  1SE3 A;  2JA7 H;  1LTA D;  4DUY L;  1LTT D;  3M3Y B;  1SYE A;  5A2Q L;  1F9P A;  2YTV A;  2DJF C;  1D8L A;  4V0B A;  3JC6 6;  4RKL A;  2ASB A;  4FDB A;  4ME5 A;  2IWH A;  4OEM B;  3BS1 A;  1O7L A;  3KK7 A;  4X65 L;  2E2H B;  4GNX A;  1CQV A;  1TY0 A;  1HZB A;  3Q22 A;  3KF6 A;  2KCT A;  3SEB A;  5ELF A;  3TBI B;  1ILP A;  2F4V Q;  1T5X D;  5I4D A;  3D31 A;  3VYT A;  4HIM A;  1XPO A;  4LF8 L;  4JI3 Q;  3I2Z A;  5H1S E;  3AB9 A;  3NTK A;  2EY2 A;  2Q8I B;  3I4M B;  2HHH L;  4BY1 G;  5HGQ A;  4NXM Q;  5DAU A;  1JQY D;  5BR8 Q;  1SNP A;  3SXH A;  4CKE A;  4NPS A;  2VL6 A;  5M5X B;  3HGB A;  5KGU A;  5JEA J;  5ISR A;  4LF4 Q;  2D62 A;  4JI2 Q;  4B9X A;  2KBN A;  3W3A A;  1FR3 A;  3WWV A;  4DXG A;  4A3I G;  1LTR D;  3T1Y L;  3H0G H;  4MTK A;  2L9H A;  1S5E D;  3J81 j;  1QOH A;  2R7D A;  1SBB B;  2PW7 A;  4P2C B;  1P16 A;  3GDE A;  1AP0 A;  1HR0 Q;  1LLR D;  3S15 B;  1TWA B;  1BBW A;  4YHH Q;  1W3S A;  3OW2 A;  3HOV G;  4AYB E;  1Q82 C;  1HNZ Q;  1F2M A;  2YTX A;  2F4I A;  1A63 A;  3BVZ A;  1G6P A;  1EIY B;  4B08 A;  4J1M A;  2VXW A;  4IN3 A;  1JWS D;  1J6Q A;  2K6A A;  4XDX A;  2F0W A;  1ZKO A;  1X6O A;  4GOP A;  1CKN B;  2K14 A;  1QVC A;  2Y0S E;  3CAM A;  4BBR B;  2JA7 G;  1AW7 A;  3MA2 B;  1RF2 D;  1N33 Q;  2K01 A;  3NBI A;  5IP9 G;  2K75 A;  5GRO A;  4ODG A;  3A74 A;  4HTH A;  4FF4 A;  2G9H D;  4V19 0;  3GTK H;  1EOT A;  4RGN A;  1V1P A;  2HQE A;  4OON A;  2CW0 C;  4OGQ C;  3UDI A;  3S1Q H;  2NVX B;  1VS0 A;  4F87 A;  3HKS A;  1WTV A;  3HS0 C;  5C4X H;  1HA5 A;  2JXM B;  1NUC A;  3K59 A;  3ND8 A;  1MKH A;  4H02 A;  1HQM C;  4DXF A;  2WKC A;  2PMZ B;  2UUC L;  3AMU A;  3DM3 A;  1HA6 A;  3PIP 3;  4ME3 A;  4HN7 A;  4EQ5 A;  3KF8 A;  4HSP A;  5CBE E;  1Z7T A;  2QKI C;  3C1F A;  4F88 A;  1LV9 A;  3U50 C;  3KLR A;  2R93 G;  3UDX A;  1B70 B;  1NSN S;  3KFU A;  2F0L A;  4HJ5 A;  1QVF A;  1EFI D;  4X6A H;  4BBS B;  2PNR C;  1HR0 W;  1TWC B;  4LMQ D;  1SE8 A;  2K5W A;  1OTC A;  4X64 L;  2F3I A;  2QDL A;  4PZ7 A;  4H0L C;  5KNB A;  2GVA A;  1TWH B;  5CV7 A;  5LMN Q;  4JBK A;  5KRU A;  4GNX B;  2C5C A;  2HHH Q;  2H5X A;  2MGS A;  2DN8 A;  2A5H A;  5C6A A;  2UXB L;  1QVG A;  2RF4 A;  2X69 A;  3CCQ A;  3VR5 A;  1KAA A;  5G3L F;  5K36 G;  1KRT A;  5D3I B;  3A0J A;  1D5M C;  2Z6K C;  1H9S B;  1VQ7 A;  2K32 A;  3T13 A;  4U67 3;  4DV3 L;  1E24 A;  1B53 A;  1K73 C;  5M3M G;  4R9W A;  4X3T A;  5D14 A;  1F9S A;  5M5Y H;  1NTG A;  5FOB B;  1II3 A;  2QGQ A;  1DCZ A;  3D4R A;  1JJC B;  1EYA A;  3DXJ C;  2K04 A;  2MO0 A;  2F3W A;  2J7Z A;  5C4H A;  1PRT F;  4XQN A;  4MNO A;  1LT3 D;  2M9V A;  4BXX H;  2AQ1 B;  2RVL A;  1XNQ Q;  4A3F G;  5IYD H;  3NTH A;  1F9R A;  2A6E C;  1AN8 A;  4WJ4 A;  2O2L D;  2NN6 H;  4IUN A;  1HTL D;  1MI2 A;  4DR4 Q;  2OEO A;  2R3Z A;  2AUK A;  2VZA A;  4B3T Q;  5CR3 A;  3J80 E;  3KJP A;  3RMH A;  4DFA A;  4HIO A;  1EYC A;  1GUS A;  2Z6K A;  4A3M B;  3O13 A;  1HQR D;  2PNH A;  4P75 A;  3GTM H;  1T9H A;  2QEX A;  1E7Z A;  1STH A;  1KLU D;  4TSS A;  5J1Z A;  5C3X A;  1HR0 L;  1LTI D;  1XPU A;  1VQ8 A;  1E1O A;  2IHE A;  2Q8T A;  2VUM B;  2QF7 A;  1SRO A;  1UEB A;  2HCI A;  5CV5 A;  1YNJ D;  1PH4 A;  5FLX E;  1JC7 A;  2D0P A;  4A93 H;  4JCV E;  3G6E A;  2L0C A;  3K6O A;  2KCN A;  2X6L A;  4TVA B;  3KOJ A;  5K36 H;  5EJW A;  1CZG A;  5IWA L;  1N32 Q;  5C44 G;  4HMJ A;  4KMU C;  1ASZ A;  3GTG H;  4OXP A;  3CRK C;  2K5D A;  2N49 A;  1SDF A;  1D6E C;  4K6L A;  1IHZ A;  1RL2 A;  4QB4 A;  2F0K A;  2EJF C;  5JJZ A;  5TSS A;  3J7Y W;  5L37 A;  2DJG C;  5JVG 3;  2ZTE A;  1HRJ A;  4FYD A;  1WTQ A;  1BCP D;  4JG2 A;  3I90 A;  3MXG A;  4ID6 A;  3UDF A;  3DWQ A;  1EWI A;  4DR2 L;  4GLV B;  5JPM C;  4A3K G;  1EU4 A;  2E2J B;  1ENA A;  5ELB A;  4DV7 Q;  2I46 A;  4BBR H;  1EY4 A;  3HOW H;  2KCM A;  3KDF B;  1RKN A;  4DK6 C;  3H09 A;  3N52 A;  4E6I A;  4IPG A;  2JE6 I;  2ZM6 L;  2F0V A;  3IRB A;  3KYH C;  3TZU A;  4YWL A;  2L11 A;  4ZUI A;  2VQE L;  1SEB D;  2LSS A;  1PRT B;  1L2F A;  3E5S A;  4A3B B;  3J7Z C;  4C1N I;  1I3Q B;  4A3J H;  5IE8 A;  1J9O A;  1HPC A;  3RZO H;  1BF4 A;  2EPB A;  5CGK A;  1TY2 A;  1CA5 A;  1TWA H;  1ASY A;  1ROD A;  1CT1 D;  5FLX c;  2R92 H;  3ITP A;  2EY5 A;  1BO0 A;  2JA9 A;  2JEA I;  2EY6 A;  1YIT A;  3IL8 A;  3FP9 A;  4DUZ Q;  3FPP A;  4RG1 A;  3NWT A;  3ULJ A;  3F2U A;  3I7F A;  3M85 A;  2R93 H;  1L0W A;  1YJ9 A;  1Y8N B;  2B2T A;  2XGT A;  1I6H H;  3FDT A;  4K5W A;  1CZW A;  4GKK L;  4K8I A;  1KNE A;  3RLN A;  1OXX K;  2JA5 G;  4YY3 L;  1GVP A;  1Y8P B;  4NW2 A;  5M3F B;  3K7U C;  2RCN A;  1AE2 A;  3A5Z B;  3RZD B;  3BDL A;  4QL5 A;  2B2V A;  4JI1 Q;  2JA5 H;  2EJG C;  2MHV A;  2WKD A;  3STB C;  3PF4 A;  1W6K A;  2CHB D;  3HOV H;  5I9P A;  1CKM A;  1H9K A;  1DYQ A;  3T1H Q;  3SVM A;  4YIJ A;  1F77 A;  3M7G A;  2UUA Q;  3S2H B;  3Q23 A;  1Q3L A;  1EIH A;  1HNX L;  1TS2 A;  1YHQ A;  1YNX A;  2KQ3 A;  3IFD A;  1PFB A;  3PO3 B;  3TSS A;  4MTN A;  3PO2 G;  4A3I H;  1WFQ A;  4EX5 A;  3GTM B;  3EBE A;  1D7Q A;  2XVS A;  1EYD A;  2A6H C;  2JP1 A;  1GUO A;  4NB3 A;  2EYM A;  3PUV A;  1BBU A;  3VA7 A;  4R4C A;  1B9N A;  1EZ8 A;  2JQO A;  3RNU A;  2MFI A;  3GTJ H;  5GQO A;  4JOI C;  5JEA H;  2HDM A;  1I4G A;  3AYH B;  1J5E Q;  3BVG A;  2UXD Q;  3MEH A;  3J81 c;  1HFG A;  4RCN A;  5JEA G;  1N34 Q;  4YCW A;  1G2S A;  5T1I A;  1TWH H;  3CME A;  1XMQ Q;  2B2V C;  4G4K A;  4NP5 A;  4FVM A;  3OIQ A;  3LWE A;  1JE4 A;  1K9M C;  1EL0 A;  4MIU A;  2TMP A;  2F52 A;  4X65 Q;  4JI0 Q;  2J0T D;  3P1H A;  1A3V A;  3CF5 A;  1EZ6 A;  2NVY H;  3T4A C;  3QWN A;  2H1E A;  2B2W A;  4JI4 Q;  5A35 A;  2YTY A;  3R2I A;  3CC4 A;  4CGY B;  3C2P A;  5HGT A;  3KDF A;  3BYY B;  4KHP Q;  1PVO A;  4DU9 A;  3MXP A;  4IOA A;  5EQ0 A;  2NN6 I;  5BR8 L;  4KKU A;  3I55 A;  4C3H H;  1I4Q A;  4IPH A;  2F03 A;  2Q8R E;  5EBC A;  4ZLT F;  3MFG A;  5C4J H;  2E5L L;  3GTQ H;  4GN3 B;  4HAE A;  1DGS A;  3H91 A;  3OOC A;  1Q1B A;  1WD0 A;  4DV7 L;  5IGB A;  2B8F A;  1I6V C;  3TDQ A;  1A6X A;  3ONA B;  3H3V H;  2A19 A;  1G29 1;  3TN2 A;  1BQQ T;  1K3B C;  3K5M A;  4WJW A;  4DNT B;  1HNZ L;  3HOY G;  3U4V A;  2RHQ B;  5JAV A;  4ZK9 B;  1TII D;  4DV0 Q;  2I0Q A;  3IFT A;  3BDC A;  4UPA A;  1Q86 C;  4A3C H;  1R9T B;  1MBY A;  2Z4I A;  3L7Z C;  2CW0 D;  1MIU A;  4DUY Q;  1Q90 A;  4C2M B;  1U4P A;  4WFN 3;  4DK3 C;  2R7F A;  5K5P A;  3RUZ A;  3T16 A;  1KTK A;  1N8R C;  2OQK A;  2SNM A;  3CCR A;  2JA6 B;  5COR A;  4CDC C;  1UE1 A;  2JA5 B;  4OO1 G;  3LGJ A;  4A3F B;  1IKM A;  4RAU C;  3W2D A;  1O7Z A;  2Z1C A;  3E0J A;  1HZA A;  1SNC A;  1SFO H;  1KAW A;  4LF9 Q;  3FKI H;  1CK1 A;  5IP7 G;  3HOU G;  2FMM A;  1C0A A;  4LJZ C;  2EYL A;  4LF8 Q;  1JJG A;  1EY7 A;  2WAQ E;  3MAQ A;  2K33 A;  1SR3 A;  1UEA B;  3NQI A;  1GUN A;  3PO2 B;  2A69 C;  3JAM E;  4JOI A;  5IGF A;  1GO3 E;  4DNI A;  5FK9 C;  1KL9 A;  1GUT A;  4BY7 H;  1S5F D;  1JT8 A;  3VYS A;  1GHK A;  1W2B A;  3HOW B;  1STB A;  1KC8 C;  2M2L A;  3FRP B;  2XRQ D;  3FMC A;  1Y14 B;  2XTI A;  3WOF A;  1LAB A;  3I73 A;  1GKH A;  1C7Y A;  1HNW Q;  1G2T A;  1DM0 B;  5C44 B;  4JI2 L;  5A2Q E;  1IYV A;  1VQE A;  3PUX A;  5E4W C;  4HJ8 A;  1Y1V G;  3H6M A;  2KHI A;  5C3E B;  2JA8 G;  4BY7 G;  4A3D B;  5C0X I;  1TU2 B;  1WD1 A;  1NY4 A;  2RDH A;  3D4W A;  5BN4 A;  1NR2 A;  2R61 A;  4HJ7 A;  1B7Y B;  3PSI A;  1JMC A;  3PO3 H;  1SYD A;  1JCK B;  1N33 L;  4LFA Q;  1U4M A;  2UUA L;  3E9H A;  2KJX A;  5E4X A;  4A3B G;  1YHA A;  4LNQ A;  1BCP C;  3HP3 A;  4DKA C;  2OTJ A;  2LXJ A;  1QZG A;  1DD2 A;  2FMC A;  1CI3 M;  2NVQ H;  3D4D A;  2ATW A;  1IBL L;  1WI5 A;  1XX8 A;  1GUG A;  1HJP A;  4A3G H;  2Z9H A;  2F0S A;  1XNQ L;  4KTA A;  5D65 A;  1CM9 A;  3NWS A;  2N8N A;  1HZ9 A;  3CC7 A;  4LF6 L;  1STY A;  4DA2 A;  4DR7 Q;  4HID A;  4DAY B;  4C3I G;  3MC0 B;  1KIX A;  2NVQ B;  1E22 A;  3HEJ A;  3VR6 A;  1XTD A;  3S2D H;  1V1O A;  4A3G B;  1YNJ C;  3R8B A;  2B8G A;  4PQX A;  4HCS A;  1N36 L;  2PQA B;  1X54 A;  1E2W A;  5JJK A;  4KY7 A;  1SMY C;  2R92 B;  2CWA A;  1CQF A;  4KJO A;  3SK8 A;  2VW9 A;  1HHV A;  2Q2U A;  1Y1W H;  3CPW A;  1BBX C;  3SK6 A;  4LK1 C;  4A76 A;  4DV1 L;  2B63 H;  1JOK A;  2HT1 A;  3HOZ G;  4IO9 A;  4JI8 L;  3U9O A;  3E6Z X;  1I4H A;  3C1E A;  3OW7 A;  3GTJ B;  4FXK C;  1A2T A;  1ET6 A;  3K58 A;  2CKZ B;  2NYZ D;  4YY3 Q;  1S40 A;  1WOC A;  4DR1 L;  1X32 A;  4G7O C;  3UE1 A;  4UP7 A;  1EY6 A;  3KLW A;  1S5B D;  1K0R A;  1STN A;  3PIO A;  1K28 A;  1PTO F;  1VQL A;  4LF7 Q;  5C3E G;  4C3J B;  2IX0 A;  3G6J B;  3A5U A;  5E3F A;  2O5I C;  1QUQ A;  1FGU A;  3AU7 A;  3MXU A;  5IOD A;  2A6E D;  1CSP A;  2WV6 D;  3GQB A;  1IL8 A;  1K3R A;  2F0E A;  4CDD C;  5FJ8 G;  3C46 A;  3NHH A;  1VQN A;  3E9I A;  5LMU L;  3NP8 A;  4O1N A;  3GTL B;  2J4X A;  2JK8 A;  4K6D A;  4LWC A;  3S17 B;  1TWF B;  3DWA A;  4CHT B;  3AEV A;  3SK4 A;  4DR1 Q;  2JA8 B;  4F8M A;  4OX9 Q;  1XPR A;  1B44 D;  3GTG B;  4QUC A;  3D6C A;  3I4M H;  1PHJ A;  4LUO A;  2N88 A;  5AJ3 Q;  3WOE A;  3J80 L;  4JV5 Q;  3TRE A;  4KD3 A;  4JI5 L;  5I6W A;  2Z4H A;  3S1M B;  1PH1 A;  2UUB Q;  5DM7 3;  1Q7Y C;  1U5K A;  4L6T B;  1S5D D;  5M5W H;  1L1O A;  1VQ9 A;  1VQM A;  4TQU S;  3CCE A;  3OIP A;  4JI8 Q;  4JI3 L;  2AUJ D;  2BA0 A;  3CP0 A;  3S15 H;  4CJ0 B;  1G51 A;  4NXM L;  1U4R A;  1EUJ A;  3ERS X;  5IGE A;  2TSS A;  3BVM A;  4QMG A;  1FNW A;  3PO2 H;  1B2T A;  3PUY A;  1EQT A;  3RD4 A;  4H13 C;  3U4Z A;  4GNX C;  1K83 B;  3GD7 A;  1XWE A;  1SNM A;  3OHX C;  2WFW A;  2IY5 B;  2NUC A;  5ELC A;  2IL8 A;  3P20 A;  5IYB H;  3VR3 A;  1ICF B;  4YCV A;  4GLA C;  4C3J G;  4C3H B;  4GKJ Q;  1YVC A;  1KQS A;  4DAY A;  1XJV A;  1KLG D;  2F0T A;  2N55 A;  4BY1 H;  3HOZ B;  3ICE A;  3MFY A;  2IX3 A;  1K8G A;  1NNX A;  3J81 i;  4DN4 M;  3T1H L;  2DNC A;  4FP5 D;  3S17 H;  2A68 C;  2E2D C;  3A7L A;  3CCS A;  1C4Q A;  3F2C A;  1AH9 A;  1VQC A;  1FVI A;  5IYB G;  2NTT A;  3OMC A;  4A75 A;  2CVR A;  3ZYY X;  2EVB A;  4ULL A;  1FGB D;  1Q8K A;  1PRT D;  3T51 B;  5FO7 B;  4I7A A;  4JV5 L;  4DK0 A;  1WJJ A;  3A54 A;  1SMY D;  2V1C C;  1PYS B;  1QIL A;  3MTS A;  3ULL A;  4IJL A;  5EPK A;  2F0D A;  3M9B A;  3T56 B;  1S5C D;  5M3M B;  2DUD A;  5ELO A;  5C4Z A;  4HJ9 A;  1HFN A;  2VUM G;  4DV1 Q;  1PLF A;  3S14 B;  2C35 B;  4B3S Q;  5C44 H;  2QIL A;  2EYF A;  3LX0 A;  4PZ6 A;  4G7Z C;  2F0H A;  1CUK A;  1I6H B;  3UE0 A;  1ENC A;  2QA4 A;  2HIX A;  4DK1 A;  1VQI A;  4EVO A;  3HG9 A;  3LWU A;  4XQQ A;  1KD1 C;  1PTO D;  4I7Z C;  2L1B A;  2R7Z G;  1O7I A;  2PO4 A;  2NVT B;  3F2B A;  2DY7 A;  2WB1 B;  1LTG D;  4RGT A;  3TEH B;  3NEN A;  4R4T A;  1EY5 A;  2OT2 A;  4DR7 L;  2KEE A;  2VS1 A;  2YV5 A;  1DON A;  4BY1 B;  3HOZ H;  1GUW A;  1QNK A;  3PIP A;  3VYU A;  1RHP A;  2OTL A;  5ELN A;  2SNS A;  5GAH C;  1SN8 A;  2Z6B A;  1PFM A;  1QZH A;  4JI6 Q;  4NDX A;  3HOW G;  4OO1 I;  4X66 Q;  1I50 B;  1IBK L;  4UHV A;  4B3R Q;  5KNC A;  3VYR A;  3KF6 B;  1SXT A;  2IW3 A;  2JA6 H;  3I4N G;  1RD9 D;  5IT9 E;  3I4M G;  1PTO C;  1F2Z A;  1CA6 A;  3I3C A;  1WCM G;  2G5D A;  4CKB A;  2IJ0 A;  3I4L A;  2XWJ B;  2XIW A;  4DV3 Q;  2JA6 G;  3I4N H;  4GKJ L;  4A3D H;  1BCP F;  1FJG Q;  1PYB A;  3J7A F;  2LKV A;  2ALY B;  4DR3 Q;  2BH8 A;  4G7H C;  2A69 D;  3GTL H;  1IL2 A;  2I5H A;  3S1R B;  3QJY A;  4QCL A;  4X3S A;  2D2C C;  1KXL A;  4RCO A;  1P8L A;  4LFB Q;  5C0X H;  1JB3 A;  4DGZ A;  4XQJ A;  2EQS A;  3E0E A;  5G3L D;  4K0K Q;  2DY8 A;  3EJI A;  1PMR A;  4LFC Q;  2E2H H;  5C0X J;  1EEF D;  1HUM A;  5HUR A;  2Z8L A;  3QO2 A;  4FF3 A;  4A3B H;  3H3V C;  2NZ1 D;  2UXC Q;  1UNS A;  3TP5 A;  3L2P A;  1YJW A;  3VDY A;  1BUV T;  1PRT C;  1FNU A;  1S3O A;  3K0Y A;  1EFW A;  5IIF A;  1X55 A;  3JAM L;  1D1I A;  3G4S A;  4GZY C;  1J8I A;  4IPD A;  3M4Y A;  3QOJ A;  5IGD A;  5J22 A;  2FIN B;  4P74 A;  1TXY A;  3AFQ A;  5LL6 X;  1ESF A;  2L15 A;  1QB5 D;  1I5F A;  2A68 D;  3QOL A;  5C4J B;  1NE3 A;  1VQG A;  4OHJ A;  4AIM A;  4M1U B;  1E1T A;  2K50 A;  5IYD G;  4A3F H;  2RKS A;  1RJT A;  3E3X A;  2E76 C;  2ENB A;  4N9P A;  4A3L G;  2B3G A;  3A8J E;  2OCE A;  1IBK Q;  1K83 H;  4YCU A;  1O80 A;  1QG7 A;  2HUG A;  1HZC A;  5FKA C;  4O42 A;  1PA6 A;  3M4O H;  1PZK D;  5T1G A;  1VQJ A;  1LTS D;  3RN5 A;  2PQE A;  4DR4 L;  2KEC A;  3HZX A;  4KI0 A;  3S1N H;  5CV8 A;  4LF7 L;  4X3U A;  1D1K A;  4PZ8 A;  5IT9 c;  1RIP A;  1IKL A;  2E2I B;  4B3M L;  5M5W B;  1LM0 A;  1G6Z A;  4J15 A;  4UDU C;  3S9W A;  4A3K B;  2Q2I A;  4CJ2 C;  1CFM A;  2LS0 1;  3CU7 A;  3RLO A;  2DNE A;  4BWG B;  2BDN A;  2YYZ A;  4C3I H;  3IAY A;  1LTB D;  1MSH A;  4L5Q A;  1PV4 A;  4X64 Q;  4ZYS A;  2IT1 A;  2PZW A;  3D3R A;  4DR6 L;  3OSO A;  1A62 A;  1C9O A;  5ELE A;  2CFM A;  1EOV A;  4XYO A;  4A3M H;  1ZYR D;  4LF5 Q;  3D0F A;  2WAQ G;  4BA1 I;  1UUP A;  1UWV A;  4OX9 L;  4A3E H;  1YJN A;  4M8A A;  2IPK D;  2UUC Q;  2BA1 A;  5IWA Q;  4WJ3 M;  2OF1 A;  3NXW A;  2AWO A;  1AZP A;  1IBM L;  2XSC A;  5DM6 3;  1S72 A;  2PYK A;  1WTR A;  2ICI A;  4JC0 A;  2BE5 C;  5EKK A;  4N8X 1;  5IP9 H;  2ICE C;  2K03 A;  2D5D A;  1V43 A;  1R9T H;  2IHF A;  2F4V L;  2AQ2 B;  2RDG A;  1H9R A;  2QW7 A;  2KHS A;  1H9S A;  1X3P A;  1PZI D;  1M1K C;  1T5E A;  3I4N B;  5J39 A;  4OWX B;  2ZJR A;  1UE5 A;  5GAG C;  4JYA L;  4C3H G;  2EYO A;  1B3Q A;  1STG A;  3DLL A;  3GTP H;  2ZXR A;  3HOU B;  1CKO A;  3I70 A;  4LF4 L;  2H4O A;  3JAM i;  3H3V I;  4ALP A;  1L0Y B;  3A7A B;  4L5S A;  1V8Q A;  5KIX A;  5EKI A;  3OTO Q;  1A0I A;  1B1Z A;  3EQL C;  4QQB X;  3S24 A;  5CBA E;  4JVZ A;  3GO5 A;  5FO9 B;  2O5J C;  4QGU A;  5LMN W;  1EQV A;  3FVQ A;  5M9O A;  2FHT A;  3CQZ H;  1Y69 U;  3J80 c;  2GA4 B;  3K80 C;  1CKN A;  2KA7 A;  1FNV A;  1ICW A;  2V4D A;  4NKL A;  1CTM A;  3CXC A;  1OXU A;  5IGG A;  3K81 C;  2E74 C;  4X62 L;  4DUZ L;  3NK9 A;  4DV4 L;  4LUV A;  1LT4 D;  4QUF A;  2RQX A;  5CYU A;  4X66 L;  1G8Z D;  4IUP A;  3D8G A;  1WTW A;  2ZTD A;  1NJI C;  5CV4 A;  4PNY A;  4DR5 Q;  1PXU A;  4BA2 I;  1EWC A;  1TKW B;  3MXN A;  1B4O A;  1QJO A;  4A3C G;  1N32 L;  3S1M H;  3CCJ A;  4UAI A;  1DZ1 A;  1J5E L;  2ZTC A;  1IW7 D;  4RGM A;  3J81 L;  3LNN A;  4HIK A;  3GTK B;  2OQ0 A;  1JB7 A;  1TS4 A;  4DV5 Q;  4ZUJ A;  3HKZ B;  2R93 B;  2AQ3 B;  2HCC A;  2K28 A;  4JBW A;  2CCZ A;  1AE3 A;  2PW5 A;  1VQ4 A;  1M8A A;  4POG A;  1HCZ A;  3A56 A;  1DOM A;  5C4X G;  5E7N A;  2F0F A;  4UP8 A;  2KHJ A;  4PMC A;  2EYJ A;  4K0K L;  3G48 A;  1ILQ A;  2K5H A;  2X6G A;  4Q5V A;  1YZ6 A;  3BZK A;  3Q0A A;  5M5Y B;  5IY0 A;  4ZAI A;  2ZJP A;  3NSW A;  3JAM c;  2K5V A;  1S4Z A;  2EYP A;  4DF7 A;  3TP8 A;  4YWM A;  3QR8 A;  2EXZ A;  1KRS A;  1TR5 A;  4Q0F A;  3VR2 A;  1U9R A;  4GS3 A;  4J6H A;  4A3E B;  3M4P A;  2EIF A;  3I4O A;  5IOC A;  1Z47 A;  4R8N A;  1K8O A;  4YHH L;  2AWN A;  4LAA A;  3UI2 A;  2PZT A;  3W5O A;  3R2T A;  1SJE D;  3J80 i;  2R6G A;  2R92 G;  5KND A;  4EQP A;  2I07 B;  5M5X H;  1RTN A;  3GTQ B;  4CJ1 B;  4IUV A;  1ZEQ X;  2PMZ E;  4O0A A;  2O4X A;  1E3P A;  2LY7 A;  1U0L A;  3QB3 A;  2VQF L;  3ER0 A;  1F2L A;  1FL0 A;  4B3R L;  5F2D A;  2MQH A;  1GHJ A;  3FKI B;  4JBJ A;  5AFW A;  2CQA A;  2CWP A;  1I4R A;  1SYF A;  2B2U C;  2K5N A;  3I72 A;  4N8F A;  3A55 A;  2CH4 W;  4KHV A;  4C3I B;  3AQQ A;  2F0U A;  2XWB B;  3K7A H;  3WDN A;  1PH2 A;  4POF A;  4I65 A;  1XNR L;  3BZC A;  3I91 A;  3HKZ G;  3HOV B;  4A3M G;  3PF5 A;  5FJ8 H;  3SE0 A;  3FPU B;  4JI5 Q;  1SYG A;  4EGV A;  1X65 A;  4TRD A;  3K5O A;  1ONL A;  1VCI A;  1TS3 A;  1JOR A;  4DV4 Q;  3SHL A;  2KCC A;  3S2H H;  4R1J A;  3I56 A;  4FNF A;  1DXM A;  1KDA A;  1TWG B;  3RR5 A;  2VQF Q;  1VQF A;  4P73 A;  4ZRZ A;  4GOP B;  3U58 A;  3DMU A;  3VA5 A;  1PTO H;  4OIJ A;  5EPL A;  3EFX D;  3OTO L;  2KEN A;  3H0G B;  3TP6 A;  2L12 A;  1C8C A;  3M3Y H;  3K0X A;  1XYI A;  3NEM A;  2NBF A;  2BDO A;  4CKC A;  2XN9 C;  1B50 A;  1JIC A;  4JI1 L;  2K5Q A;  3DUZ A;  3PIO 3;  2EE1 A;  3CCM A;  1QE6 A;  1IYJ B;  1LT6 D;  2KVM A;  2F0M A;  3QIA A;  2EY1 A;  5IYC H;  2ID0 A;  1Y8O B;  3HRZ C;  2UXB Q;  3SGI A;  1HNX Q;  4IUQ A;  3CC2 A;  1MJC A;  4F7X A;  4MZ9 A;  3RZO B;  2HD3 A;  4K5X A;  4KN4 C;  1Q1E A;  4TKO B;  1EEI D;  1GD7 A;  4IZ8 A;  4K8J A;  3CHB D;  3BG3 A;  2A1A A;  4H7B A;  4DPG A;  4HED A;  4KD4 A;  3KF8 B;  1PYW D;  4IFD J;  2SEB D;  2NVT H;  3CQZ B;  4L63 B;  1YI2 A;  1YHB A;  4KY6 A;  2L55 A;  4PG3 A;  1OXS C;  1PH7 A;  4OWT B;  3CCL A;  2ZXP A;  5EKL A;  1WTX A;  1SNQ A;  1EY0 A;  1BOS A;  1STE A;  2G9D A;  1Y1W G;  4LFA L;  4DV6 Q;  4Y7N H;  2E75 C;  2HDL A;  4A3K H;  5BN5 A;  4GOP C;  1KHI A;  5CV6 A;  5M3F H;  1SLJ A;  5C5L A;  5FLM G;  3ERO A;  1KAB A;  2FXQ A;  1PH3 A;  4OWW B;  5LMN L;  2LMC B;  4BS9 A;  4AYB B;  2NN6 G;  4DR3 L;  2F0P A;  1PTO B;  4J8Q A;  1B8A A;  4JBM A;  3OYY A;  2CH4 A;  5I2Y A;  3CCV A;  1Y1W B;  2JSO A;  1Y1V H;  2K4K A;  3UDG A;  1LTL A;  4HCE A;  3PUZ A;  3CRL C;  1V9P A;  5JOB A;  3A8K E;  2K1B A;  1K8M A;  4KK7 A;  3K5N A;  1IBM Q;  5IYC G;  2JJQ A;  3NUC A;  4JI7 L;  1K8A C;  4XT1 B;  5M3F G;  4XXE A;  1EYG A;  1B3A A;  2UU9 Q;  4A93 G;  1YBY A;  5GAD C;  3V2T A;  5KEE A;  2A6H D;  3V05 A;  4HJA A;  1YIJ A;  4B3S L;  2B39 A;  5C5M A;  1VF7 A;  2HQL A;  3MVV A;  2C9O A;  4EQN A;  4IJH A;  2CQO A;  3FKI G;  1STA A;  3BZD B;  5IP7 H;  3S1Q B;  1WTO A;  1WCM H;  1QNU A;  3CMA A;  4ILW A;  2N3S A; 
#chains in the Genus database with same CATH homology
 1OXV A;  3I8Z A;  5I6Y A;  4RKB A;  4KV6 A;  1TS5 A;  4QIW B;  5COY A;  3DEO A;  1OXT A;  5BN3 A;  3DM1 A;  1SSO A;  1I4P A;  1VDZ A;  3ND9 A;  1KDB A;  1NR4 A;  4XTC S;  3MZ5 A;  2NVY B;  2VB3 X;  1U4L A;  3M7N A;  3OWF A;  2XRS D;  5CC4 A;  3R93 A;  3NTI A;  2JYO A;  1W6J A;  2BCO A;  1BCP B;  4ABN A;  3TZD A;  3PV0 A;  1SAP A;  4KHZ A;  1B9M A;  2L5T A;  1RCV D;  2JA7 B;  1HXY D;  1PFN A;  1PZJ D;  2MUY A;  1C48 A;  1MSG A;  3DWP A;  1CHQ D;  2EYH A;  2WAQ B;  1SFO B;  1SJH D;  1A3U A;  3ERQ A;  4H44 C;  5EPJ A;  3C3L A;  5IGC A;  2K05 A;  4OO1 H;  3Q6S A;  1JR0 D;  3PMF A;  4DAV A;  1TQO A;  2Y0S B;  1KNA A;  1GXD C;  2MJ8 A;  3R3O A;  1ZYR C;  4BY7 B;  4N9T A;  4C56 C;  5JVH 3;  2B2T C;  1A2U A;  5JPN C;  1NCV A;  4RWS C;  4G57 A;  4IFD G;  2EDG A;  2PZU A;  5LL6 S;  1BDO A;  2B2Y C;  4PV1 C;  1EY8 A;  1ET9 A;  3NE5 B;  2VNU D;  3DHQ A;  3BDO A;  1SE4 A;  2F1M A;  5EGT A;  2F3V A;  4K2L A;  3HOY B;  4HR7 B;  4KN7 C;  3KLS A;  4HMI A;  5DEH A;  2JEB I;  4IUU A;  3OWE B;  4FO2 A;  4PMB A;  1SYC A;  2K7V A;  4OL7 A;  5ELD A;  3OMG A;  1MGS A;  3D6W A;  4QF4 A;  1Q8I A;  5E1F A;  3VR4 A;  1A3T A;  1GOZ A;  4KKS A;  3U9S A;  2RSO A;  3GV3 A;  1V1P B;  3H94 A;  4NMZ A;  4B9W A;  4R8I A;  4RHS A;  2RDF A;  3NBH A;  3KBG A;  1X3Q A;  5C3W A;  2D9U A;  4CBV A;  5KYL A;  3S16 B;  1VMC A;  4A3J B;  4IFD H;  2RBM A;  4IUT A;  1I4X A;  2PPB C;  2FJ2 A;  1JOQ A;  2WII B;  3TME A;  4KKT A;  1TT2 A;  2NB0 A;  3N6R A;  2QCP X;  4WRD A;  3X3M A;  1Y1V B;  3MWY W;  4HSV A;  1WVL A;  2IX1 A;  1E0B A;  1MD2 D;  3KBX A;  1FYC A;  1CHP D;  3L9A X;  2R7Z B;  1XXG A;  3EA6 A;  2VB2 X;  1HUN A;  2ZXO A;  1ENF A;  3BYT B;  3P7J A;  3DEP A;  2NWG A;  4FXG C;  3X3N A;  2WP8 J;  4RFB A;  3EVQ A;  1WCM B;  1TVX A;  1GJX A;  1D2B A;  3SR1 A;  2RSN A;  2XNA C;  2SDF A;  3QG1 A;  3SDZ A;  5CMD A;  4XT3 B;  1VMP A;  4DNR B;  1D5X C;  4A93 B;  2KUM A;  4A3I B;  1BR9 A;  1BXT A;  1F9Q A;  4ZKC B;  4FF2 A;  3P75 A;  1IW7 C;  1NAP A;  5NUC A;  3URY A;  3IKJ A;  4ZQ3 A;  4XIG S;  2M00 A;  3HOX B;  3TP7 A;  5KYI A;  3M4O B;  4EQO A;  2EOT A;  2EZV A;  2LFN A;  1ZXT A;  5C0X G;  5CV9 A;  1ESR A;  2B2W C;  2F0N A;  4L8J A;  4S3S A;  1R4Q B;  5C4X B;  3GP7 A;  2WIN B;  4KJN A;  1Z6H A;  2F0I A;  1E2V A;  5I2X A;  3GTO B;  1QCB D;  4RA8 A;  1EU3 A;  3J81 E;  1SNO A;  2B2U A;  2B2Y A;  1D5Z C;  1PDQ A;  3MHB A;  3K5L A;  1H9J A;  2WAC A;  4OIK A;  3NPP A;  3G7L A;  1EIG A;  5LHY 1;  3FEW X;  3KLS X;  4FXD A;  5I9O A;  1EWH A;  2YU9 B;  2BOS A;  2KED A;  1SND A;  2BE5 D;  1LO5 D;  4WOR A;  2KOL A;  1RTO A;  1KDC A;  3K57 A;  3GTP B;  2B63 B;  4PMW A;  4IQZ A;  1H9M A;  1Q12 A;  3KUP A;  1O78 A;  1FD7 D;  2MP1 A;  3Q24 A;  3PUW A;  2NTS A;  1SYB A;  1XTC D;  2ZT9 C;  4K5V A;  1JWM D;  4IAL A;  3GV6 A;  2MPM A;  4Z9C B;  1DJR D;  3K7A B;  4K14 A;  1YNN D;  3S1N B;  5FO8 B;  2EJM A;  2FFK B;  1M4V A;  1WTP A;  3A8I E;  4IUR A;  4ZKB B;  2F0G A;  4KY5 A;  1VF5 C;  3S2D B;  1LT5 D;  1SE2 A;  1UAP A;  2PCF B;  1OO9 B;  4MN3 A;  2F0J A;  3SK5 A;  1AEX A;  1AFP A;  3RLF A;  4U68 A;  2SOB A;  4JK1 C;  3J7A V;  1R4P B;  5FLX L;  5EBD A;  4IFD I;  1O7Y A;  4RH6 A;  1BNZ A;  3CKI B;  2L4N A;  3L3O C;  5IT9 L;  1DOK A;  1AZQ A;  1JWU D;  1QWY A;  2RA4 A;  3OPO A;  4RHR A;  3V96 A;  1RDP D;  1ML0 D;  5DNF A;  1HTP A;  1F2Y A;  4K2K A;  4XYQ A;  4C1N K;  1IYU A;  1G91 A;  1L0X B;  2OXP A;  4X3K A;  3T53 B;  1E2Z A;  4DAP A;  1YNN C;  1JOO A;  2QEJ C;  2A73 B;  2F0Q A;  1A15 A;  2QDB A;  2A74 C;  4MHE A;  1EY9 A;  4RGO S;  2F0O A;  4FF1 A;  5D3D A;  4Y7N B;  3NQT A;  1DOL A;  1LAC A;  1SE3 A;  1LTA D;  1LTT D;  3M3Y B;  1SYE A;  5A2Q L;  1F9P A;  4V0B A;  4RKL A;  4ME5 A;  2IWH A;  3BS1 A;  1O7L A;  3KK7 A;  2E2H B;  1CQV A;  1TY0 A;  3Q22 A;  3SEB A;  5ELF A;  3TBI B;  1ILP A;  1T5X D;  5I4D A;  3D31 A;  3VYT A;  3AB9 A;  3NTK A;  2EY2 A;  2Q8I B;  3I4M B;  5DAU A;  1JQY D;  1SNP A;  3SXH A;  4CKE A;  5M5X B;  3HGB A;  5KGU A;  5JEA J;  5ISR A;  2D62 A;  4B9X A;  3W3A A;  1FR3 A;  4DXG A;  1LTR D;  2L9H A;  1S5E D;  1QOH A;  1SBB B;  2PW7 A;  4P2C B;  1LLR D;  3S15 B;  1TWA B;  1F2M A;  2F4I A;  3BVZ A;  4B08 A;  4J1M A;  2VXW A;  4IN3 A;  1JWS D;  2K6A A;  4XDX A;  2F0W A;  1ZKO A;  4BBR B;  1AW7 A;  3MA2 B;  1RF2 D;  2K01 A;  3NBI A;  4ODG A;  4HTH A;  4FF4 A;  2G9H D;  4V19 0;  1EOT A;  4RGN A;  1V1P A;  2HQE A;  2CW0 C;  4OGQ C;  2NVX B;  4F87 A;  1WTV A;  3HS0 C;  1HA5 A;  2JXM B;  1NUC A;  3K59 A;  3ND8 A;  1HQM C;  4DXF A;  2WKC A;  2PMZ B;  3AMU A;  1HA6 A;  3PIP 3;  4HN7 A;  3KF8 A;  4HSP A;  5CBE E;  1Z7T A;  2QKI C;  3C1F A;  4F88 A;  1LV9 A;  3KLR A;  1NSN S;  2F0L A;  1EFI D;  4BBS B;  2PNR C;  1TWC B;  4LMQ D;  2K5W A;  5KNB A;  4H0L C;  1TWH B;  5CV7 A;  5KRU A;  2C5C A;  2MGS A;  2DN8 A;  2A5H A;  5C6A A;  2X69 A;  3VR5 A;  1KAA A;  5G3L F;  5K36 G;  5D3I B;  1D5M C;  1H9S B;  2K32 A;  3T13 A;  4U67 3;  1B53 A;  4R9W A;  4X3T A;  5D14 A;  1F9S A;  5FOB B;  1II3 A;  1DCZ A;  3D4R A;  1EYA A;  3DXJ C;  2K04 A;  4XQN A;  2F3W A;  2J7Z A;  5C4H A;  1PRT F;  1LT3 D;  2M9V A;  2AQ1 B;  2RVL A;  3NTH A;  1F9R A;  2A6E C;  1AN8 A;  2O2L D;  2NN6 H;  4IUN A;  1HTL D;  1MI2 A;  2OEO A;  2R3Z A;  2AUK A;  5CR3 A;  3J80 E;  3RMH A;  4DFA A;  1EYC A;  1GUS A;  4A3M B;  3O13 A;  1HQR D;  1STH A;  1KLU D;  4TSS A;  5J1Z A;  5C3X A;  1LTI D;  2Q8T A;  2VUM B;  2QF7 A;  2HCI A;  5CV5 A;  1YNJ D;  5FLX E;  1JC7 A;  2L0C A;  3K6O A;  2KCN A;  2X6L A;  5K36 H;  5EJW A;  1CZG A;  4HMJ A;  4KMU C;  3CRK C;  2K5D A;  1SDF A;  1D6E C;  4K6L A;  1IHZ A;  4QB4 A;  2F0K A;  2EJF C;  5JJZ A;  5TSS A;  3J7Y W;  5JVG 3;  1HRJ A;  4FYD A;  1WTQ A;  1BCP D;  3I90 A;  3MXG A;  4ID6 A;  1AP0 A;  3DWQ A;  2E2J B;  5JPM C;  1EU4 A;  1ENA A;  5ELB A;  2I46 A;  1EY4 A;  1RKN A;  3H09 A;  3N52 A;  4E6I A;  2JE6 I;  2F0V A;  3TZU A;  2L11 A;  4ZUI A;  1SEB D;  1PRT B;  3E5S A;  4A3B B;  4C1N I;  1I3Q B;  1J9O A;  1HPC A;  1BF4 A;  2EPB A;  5CGK A;  1TY2 A;  1CA5 A;  1ROD A;  1CT1 D;  3ITP A;  2EY5 A;  1BO0 A;  2JEA I;  2EY6 A;  3IL8 A;  3FPP A;  3NWT A;  3F2U A;  3M85 A;  1Y8N B;  2B2T A;  3FDT A;  4K5W A;  1CZW A;  4K8I A;  1KNE A;  1OXX K;  1Y8P B;  4NW2 A;  5M3F B;  3RZD B;  3BDL A;  2B2V A;  2EJG C;  2MHV A;  2WKD A;  1W6K A;  2CHB D;  5I9P A;  1H9K A;  1DYQ A;  3SVM A;  4YIJ A;  1F77 A;  3M7G A;  3S2H B;  3Q23 A;  1Q3L A;  1EIH A;  1TS2 A;  2KQ3 A;  3IFD A;  1PFB A;  3PO3 B;  3TSS A;  3GTM B;  2XVS A;  1EYD A;  2A6H C;  2JP1 A;  1GUO A;  2EYM A;  3PUV A;  3VA7 A;  1B9N A;  1EZ8 A;  5JEA H;  2HDM A;  1I4G A;  3BVG A;  3MEH A;  1HFG A;  4RCN A;  5JEA G;  1G2S A;  5T1I A;  2B2V C;  4G4K A;  4NP5 A;  4FVM A;  3OIQ A;  3LWE A;  1JE4 A;  1EL0 A;  4MIU A;  2TMP A;  2J0T D;  3P1H A;  1A3V A;  1EZ6 A;  3T4A C;  3QWN A;  2H1E A;  2B2W A;  5A35 A;  3R2I A;  4CGY B;  3C2P A;  5HGT A;  3BYY B;  4DU9 A;  3MXP A;  5EQ0 A;  2NN6 I;  4KKU A;  1I4Q A;  2F03 A;  2Q8R E;  5EBC A;  4ZLT F;  3MFG A;  4HAE A;  3H91 A;  3OOC A;  1Q1B A;  1WD0 A;  5IGB A;  2B8F A;  1I6V C;  3TDQ A;  1A6X A;  3ONA B;  1G29 1;  3TN2 A;  1BQQ T;  3K5M A;  4WJW A;  4DNT B;  5JAV A;  4ZK9 B;  1TII D;  3IFT A;  3BDC A;  1R9T B;  1MBY A;  2Z4I A;  3L7Z C;  2CW0 D;  1Q90 A;  4C2M B;  1U4P A;  4WFN 3;  5K5P A;  3RUZ A;  3T16 A;  1KTK A;  2SNM A;  2JA6 B;  5COR A;  2JA5 B;  4OO1 G;  4A3F B;  1IKM A;  4RAU C;  3W2D A;  1O7Z A;  2Z1C A;  3E0J A;  1SNC A;  1CK1 A;  2FMM A;  4LJZ C;  2EYL A;  1EY7 A;  3MAQ A;  2K33 A;  1UEA B;  3NQI A;  1GUN A;  3PO2 B;  2A69 C;  3JAM E;  5IGF A;  5FK9 C;  1GUT A;  1S5F D;  3VYS A;  1GHK A;  3HOW B;  1STB A;  2M2L A;  3FRP B;  2XRQ D;  3FMC A;  3WOF A;  1LAB A;  3I73 A;  1G2T A;  1DM0 B;  5C44 B;  5A2Q E;  1IYV A;  3PUX A;  5E4W C;  3H6M A;  5C3E B;  4A3D B;  5C0X I;  1TU2 B;  1WD1 A;  2RDH A;  3D4W A;  5BN4 A;  1NR2 A;  2R61 A;  1SYD A;  1JCK B;  1U4M A;  2KJX A;  5E4X A;  1BCP C;  3HP3 A;  1DD2 A;  2FMC A;  1CI3 M;  3D4D A;  1XX8 A;  1GUG A;  2F0S A;  4KTA A;  5D65 A;  1CM9 A;  3NWS A;  1STY A;  4DA2 A;  4C3I G;  3MC0 B;  2NVQ B;  3HEJ A;  3VR6 A;  1V1O A;  4A3G B;  1YNJ C;  3R8B A;  2B8G A;  4PQX A;  4HCS A;  1E2W A;  4KY7 A;  1SMY C;  2R92 B;  1CQF A;  4KJO A;  3SK8 A;  1HHV A;  1BBX C;  3SK6 A;  4LK1 C;  1JOK A;  3U9O A;  3E6Z X;  1I4H A;  3C1E A;  3OW7 A;  3GTJ B;  4FXK C;  1A2T A;  1ET6 A;  3K58 A;  2NYZ D;  1X32 A;  4G7O C;  1EY6 A;  1S5B D;  1STN A;  1PTO F;  4C3J B;  2IX0 A;  3G6J B;  5E3F A;  2O5I C;  3AU7 A;  3MXU A;  5IOD A;  2A6E D;  2WV6 D;  3GQB A;  1IL8 A;  2F0E A;  3C46 A;  3NHH A;  3NP8 A;  4O1N A;  3GTL B;  2J4X A;  4K6D A;  3S17 B;  1TWF B;  3DWA A;  4CHT B;  3SK4 A;  2JA8 B;  4F8M A;  1B44 D;  3GTG B;  4QUC A;  3D6C A;  2N88 A;  3WOE A;  3J80 L;  4KD3 A;  5I6W A;  2Z4H A;  3S1M B;  5DM7 3;  4L6T B;  1S5D D;  4TQU S;  3OIP A;  2AUJ D;  2BA0 A;  4CJ0 B;  1U4R A;  5IGE A;  2TSS A;  3BVM A;  4QMG A;  1FNW A;  1B2T A;  3PUY A;  1EQT A;  3RD4 A;  4H13 C;  1K83 B;  3GD7 A;  1XWE A;  1SNM A;  3OHX C;  2NUC A;  5ELC A;  2IL8 A;  3P20 A;  3VR3 A;  4C3J G;  4C3H B;  4DAY A;  1KLG D;  2F0T A;  3HOZ B;  2N55 A;  3MFY A;  2IX3 A;  4DN4 M;  2DNC A;  4FP5 D;  2A68 C;  2E2D C;  3A7L A;  1C4Q A;  2NTT A;  3OMC A;  2CVR A;  3ZYY X;  2EVB A;  4ULL A;  1FGB D;  1PRT D;  3T51 B;  5FO7 B;  4DK0 A;  3A54 A;  1SMY D;  1QIL A;  3MTS A;  5EPK A;  2F0D A;  3T56 B;  1S5C D;  5M3M B;  5C4Z A;  1HFN A;  1PLF A;  3S14 B;  2QIL A;  2EYF A;  3LX0 A;  4G7Z C;  2F0H A;  1I6H B;  1ENC A;  4DK1 A;  4EVO A;  3HG9 A;  3LWU A;  4XQQ A;  1PTO D;  4I7Z C;  2L1B A;  2PO4 A;  2NVT B;  2DY7 A;  2WB1 B;  1LTG D;  4RGT A;  1EY5 A;  2OT2 A;  2KEE A;  1DON A;  4BY1 B;  1GUW A;  1QNK A;  3VYU A;  1RHP A;  2SNS A;  1PFM A;  4NDX A;  4OO1 I;  1I50 B;  5KNC A;  3VYR A;  1SXT A;  2IW3 A;  1RD9 D;  5IT9 E;  1PTO C;  1F2Z A;  1CA6 A;  4CKB A;  3I3C A;  2IJ0 A;  3I4L A;  2XWJ B;  2XIW A;  1BCP F;  3J7A F;  2LKV A;  4G7H C;  2A69 D;  3S1R B;  3QJY A;  4QCL A;  4X3S A;  2D2C C;  4RCO A;  5C0X H;  1JB3 A;  4DGZ A;  4XQJ A;  5G3L D;  2DY8 A;  3EJI A;  1PMR A;  5C0X J;  1EEF D;  1HUM A;  5HUR A;  2Z8L A;  3QO2 A;  4FF3 A;  3H3V C;  2NZ1 D;  1UNS A;  3TP5 A;  1BUV T;  1PRT C;  1FNU A;  3K0Y A;  5IIF A;  3JAM L;  1D1I A;  4GZY C;  1J8I A;  3M4Y A;  3QOJ A;  5IGD A;  5J22 A;  2FIN B;  5LL6 X;  1ESF A;  1QB5 D;  2A68 D;  3QOL A;  5C4J B;  4OHJ A;  4M1U B;  2RKS A;  1RJT A;  2ENB A;  2E76 C;  4N9P A;  3A8J E;  1O80 A;  1QG7 A;  2HUG A;  5FKA C;  4O42 A;  1PZK D;  5T1G A;  1LTS D;  2PQE A;  2KEC A;  3HZX A;  4KI0 A;  5CV8 A;  4X3U A;  1D1K A;  1IKL A;  2E2I B;  5M5W B;  1G6Z A;  4UDU C;  3S9W A;  4A3K B;  4CJ2 C;  1CFM A;  2LS0 1;  3CU7 A;  2DNE A;  4BWG B;  2BDN A;  2YYZ A;  3IAY A;  1LTB D;  1MSH A;  4ZYS A;  2IT1 A;  2PZW A;  3D3R A;  3OSO A;  5ELE A;  4XYO A;  1ZYR D;  4BA1 I;  1UUP A;  4M8A A;  2IPK D;  2BA1 A;  2OF1 A;  3NXW A;  2AWO A;  1AZP A;  2XSC A;  5DM6 3;  2PYK A;  1WTR A;  2ICI A;  2BE5 C;  5EKK A;  2ICE C;  2K03 A;  2D5D A;  1V43 A;  2AQ2 B;  2RDG A;  1H9R A;  2KHS A;  1H9S A;  1X3P A;  1PZI D;  1T5E A;  3I4N B;  5J39 A;  4C3H G;  2EYO A;  1STG A;  3HOU B;  2ZXR A;  3I70 A;  2H4O A;  1L0Y B;  3A7A B;  1V8Q A;  5KIX A;  5EKI A;  1B1Z A;  3EQL C;  5CBA E;  3GO5 A;  5FO9 B;  2O5J C;  1EQV A;  3FVQ A;  5M9O A;  2FHT A;  1Y69 U;  2GA4 B;  2KA7 A;  1FNV A;  1ICW A;  2V4D A;  4NKL A;  1CTM A;  1OXU A;  5IGG A;  2E74 C;  3NK9 A;  1LT4 D;  4QUF A;  2RQX A;  5CYU A;  1G8Z D;  4IUP A;  3D8G A;  1WTW A;  5CV4 A;  4PNY A;  4BA2 I;  1PXU A;  1EWC A;  1TKW B;  3MXN A;  1B4O A;  1QJO A;  4UAI A;  1DZ1 A;  1IW7 D;  4RGM A;  3J81 L;  3LNN A;  3GTK B;  1TS4 A;  4ZUJ A;  3HKZ B;  2R93 B;  2AQ3 B;  2HCC A;  2K28 A;  4JBW A;  2PW5 A;  1M8A A;  1HCZ A;  3A56 A;  1DOM A;  2F0F A;  4PMC A;  2EYJ A;  1ILQ A;  4Q5V A;  2X6G A;  3Q0A A;  5M5Y B;  4ZAI A;  3NSW A;  1S4Z A;  2EYP A;  4DF7 A;  3TP8 A;  2EXZ A;  1TR5 A;  4Q0F A;  3VR2 A;  1U9R A;  4J6H A;  4A3E B;  5IOC A;  1K8O A;  1Z47 A;  4R8N A;  2AWN A;  4LAA A;  3UI2 A;  2PZT A;  3R2T A;  1SJE D;  2R6G A;  5KND A;  4EQP A;  2I07 B;  1RTN A;  3GTQ B;  4CJ1 B;  4IUV A;  1ZEQ X;  2O4X A;  2LY7 A;  3QB3 A;  1F2L A;  5F2D A;  1GHJ A;  3FKI B;  5AFW A;  2CQA A;  1I4R A;  1SYF A;  2B2U C;  3I72 A;  3A55 A;  4KHV A;  4C3I B;  2F0U A;  2XWB B;  3WDN A;  4I65 A;  3I91 A;  3HOV B;  3SE0 A;  3FPU B;  1SYG A;  4EGV A;  4TRD A;  3K5O A;  1ONL A;  1VCI A;  1TS3 A;  1JOR A;  3SHL A;  2KCC A;  4FNF A;  1DXM A;  1KDA A;  1TWG B;  4ZRZ A;  3DMU A;  3VA5 A;  1PTO H;  4OIJ A;  5EPL A;  3EFX D;  3H0G B;  3TP6 A;  2L12 A;  1C8C A;  1XYI A;  2NBF A;  2BDO A;  4CKC A;  2XN9 C;  1B50 A;  1JIC A;  2K5Q A;  3DUZ A;  3PIO 3;  2EE1 A;  1QE6 A;  1LT6 D;  2KVM A;  2F0M A;  3QIA A;  2EY1 A;  2ID0 A;  1Y8O B;  3HRZ C;  4IUQ A;  4F7X A;  3RZO B;  4K5X A;  4KN4 C;  1Q1E A;  4TKO B;  1EEI D;  4IZ8 A;  4K8J A;  3CHB D;  3BG3 A;  4H7B A;  4HED A;  4KD4 A;  1PYW D;  4IFD J;  2SEB D;  3CQZ B;  4L63 B;  4KY6 A;  2L55 A;  1OXS C;  2ZXP A;  5EKL A;  1WTX A;  1SNQ A;  1EY0 A;  1BOS A;  1STE A;  2G9D A;  2E75 C;  2HDL A;  5BN5 A;  5CV6 A;  5C5L A;  3ERO A;  1KAB A;  2LMC B;  4BS9 A;  4AYB B;  2NN6 G;  2F0P A;  1PTO B;  4J8Q A;  5I2Y A;  1Y1W B;  2JSO A;  4HCE A;  3PUZ A;  3CRL C;  5JOB A;  3A8K E;  2K1B A;  1K8M A;  4KK7 A;  3K5N A;  3NUC A;  4XT1 B;  4XXE A;  1B3A A;  3V2T A;  5KEE A;  2A6H D;  3V05 A;  2B39 A;  5C5M A;  1VF7 A;  3MVV A;  2C9O A;  4EQN A;  1STA A;  3BZD B;  3S1Q B;  1WTO A;  1QNU A;  4ILW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...