2F0SA

Crystal structure of staphylococcal nuclease mutant v66l/i92v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0sA00
4RKLA 2SNSA 5IGCA 1SNDA 2F3WA 1EY7A 5J39A 1A2UA 4KD4A 4LAAA 4ZQ3A 4NMZA 1SNPA 3BDCA 4ME5A 5DEHA 1F2ZA 1SNQA 5CV4A 2PZWA 4KHVA 2LKVA 4KY7A 2PYKA 3OWFA 2F0QA 4PMCA 5CV8A 4EQNA 2EYPA 3NXWA 2OXPA 2F0VA 2O4XA 2KQ3A 4ODGA 3SK4A 4DGZA 5IODA 3SK6A 4I65A 1EY4A 2EY2A 2F0EA 5EGTA 5CR3A 3PMFA 5DAUA 3OMGA 4F8MA 4H7BA 3QOJA 3HZXA 3EJIA 2QDBA 4K8IA 1SYGA 4QMGA 3SHLA 1A3TA 5CC4A 4WORA 2F0UA 3LX0A 1SYFA 4WRDA 4DF7A 4MIUA 5KRUA 4RKBA 3V2TA 4YIJA 3S9WA 2HQEA 3D6CA 4HMJA 4K2KA 2F0OA 4QF4A 2RBMA 4K5WA 4KD3A 3T13A 4EQPA 2SNMA 1SNOA 2F0NA 3MHBA 4DU9A 3MZ5A 1RKNA 3HEJA 3MXPA 1A3VA 3TP6A 5E3FA 5C5LA 2F0IA 4ID6A 5I9PA 2SOBA 5KYIA 1TQOA 1KDAA 2EYHA 4G57A 1SYEA 2PZUA 2F0GA 3EVQA 3H6MA 4QB4A 1IHZA 4K2LA 2F0JA 5J1ZA 2PQEA 3T16A 5I6WA 5JOBA 5M9OA 2OEOA 3TP5A 2EXZA 4KV6A 2F3VA 3NUCA 5IGEA 1EZ8A 2F0LA 4IZ8A 2F0HA 2KHSA 3OMCA 4KY6A 2F0MA 2PW5A 2M00A 5CV9A 5HGTA 5I9OA 4EQOA 3R3OA 5KEEA 5KYLA 4KY5A 3NQTA 4K5XA 3TP8A 2F0KA 5C4ZA 1ENCA 1STNA 4S3SA 1SNCA 4N9PA 1JOQA 2EY1A 4K6DA 3BDLA 1JOOA 2NUCA 5IIFA 4HTHA 3P75A 4B9WA 1A2TA 4J6HA 1KDCA 4J1MA 4KTAA 3E5SA 1EZ6A 1KDBA 4B9XA 1TT2A 1EYCA 1EY9A 2EYLA 5IOCA 1EYDA 1NSNS 5J22A 5KGUA 5CV7A 3C1EA 5C4HA 5IGGA 1EY6A 3EROA 1KABA 2EYMA 2F0SA 2EYFA 1ENAA 5JAVA 3NP8A 1STBA 3D4DA 3D8GA 5ISRA 5CV6A 2F0PA 2RKSA 4IUNA 5CV5A 3SXHA 3TMEA 5NUCA 3OSOA 3P1HA 5E1FA 1NUCA 2PZTA 3ITPA 3D4WA 4DFAA 1SYDA 5C5MA 2WACA 3SK5A 3SK8A 4K5VA 5CGKA 4R8NA 1STAA 1KAAA 4ZUJA 4NDXA 2RDFA 2F0FA 4KJNA 2EY5A 4HMIA 2F0WA 3TP7A 1EY8A 3U9OA 3ERQA 1SYCA 1F2YA 4NKLA 5KIXA 3QOLA 1A3UA 4OL7A 1EQVA 4ZUIA 5C3XA 4PMBA 3MVVA 4IALA 3C1FA 4PNYA 1JORA 3RUZA 4E6IA 3MEHA 1STHA 2OF1A 2ENBA 5EKKA 5C6AA 3NHHA 4TRDA 1F2MA 1STGA 2F0DA 4K14A 2PW7A 4F7XA 2EYJA 1EY5A 1SNMA 1AEXA 5IGBA 5K5PA 3NK9A 2EYOA 5I6YA 5IGDA 3DHQA 1JOKA 1EYAA 4NP5A 1SYBA 5HURA 1U9RA 5EKLA 1EY0A 4EVOA 4KJOA 5F2DA 1II3A 3QB3A 5IGFA 4N9TA 3VA5A 4K8JA 1STYA 3DMUA 3SR1A 2F0TA 5C3WA 1TR5A 2EY6A
chains in the Genus database with same CATH superfamily
4JOIA 4DV0L 3I2ZA 3NTIA 3CC7A 4QCLA 4K6LA 1F9SA 1K8AC 1K3BC 1SNQA 1IW7D 3KLSA 1D5ZC 1TS3A 4LFCL 4C3HG 2NTSA 1EIHA 4JG2A 4LF9Q 4R4IA 2L1BA 3SVMA 4FYDA 3PQIA 4UAIA 4LFBL 3SHLA 5CC4A 2QILA 4LF5L 5KRUA 4RMFA 1VQDA 2HQEA 1G291 1N33Q 3S17H 1YJ9A 4A3BH 3A5ZB 2MGSA 1YJNA 3T13A 4DR2L 4X64Q 3S15B 4RCOA 1N32Q 2VQFQ 1D7QA 3IKJA 3HOYG 3I70A 2F0GA 2JA8H 1K0RA 4DA2A 4BXXG 3AEVA 4PMWA 4RWSC 5ELNA 4DK0A 2A6ED 2K4KA 4GN4B 3KLRA 3S1RH 2R7ZH 3BDOA 4FVMA 4DR3L 2KHSA 3OMCA 2UXCL 5FJ8G 1A0IA 1K83B 5FLXc 1J6QA 2NN6H 1ENCA 1VQKA 3VYTA 2VB3X 1TWCH 5JJKA 2EJMA 3E6ZX 2A5HA 4TQUS 4JC0A 5D3DA 1V1OA 2DN8A 3QJYA 1QJOA 2XTIA 3KOJA 4RG1A 1WOCA 2D2CC 3CQZH 1FJGL 2IT1A 3RZDH 3QO2A 3RN5A 3C3LA 1SMXA 2MO0A 1CM9A 2WB1G 2GA4B 3WOFA 3TDQA 4DR7Q 3D4RA 2PNRC 4L5QA 1EYGA 2F0WA 2MQHA 2UXDL 1SYCA 1DYQA 1LM0A 4CDEC 2JA7H 2CVRA 1HA6A 1F2LA 1R4QB 1BBXC 1Q1EA 1EFWA 3CKIB 3GD7A 4AQYQ 1VDZA 2H5XA 1UWVA 2UUCL 2JJQA 2A8VA 2XVSA 1WCMH 2UU9L 3PIOA 4JI4L 1I3QH 3CP0A 1EYAA 2JA9A 1ICWA 1YHQA 4P71A 1QG7A 2MJ8A 2PI2E 1NJIC 2WAQG 4BY1G 4JVZA 2YU9B 1Y1VB 4CKBA 2K50A 3QWNA 4P74A 4KD4A 1SRUA 3AU7A 4X3UA 3CXCA 5LHY1 1Y1WB 2UUBQ 2JA5B 4PZ7A 1PH3A 5C4JB 1NMGA 3SK4A 2B2VC 1CKOA 4YHHL 4BY7H 1E7ZA 4QIWE 1IBML 3BYTB 3H0GH 1A8VA 2B63B 1TS2A 2QDBA 4FNFA 1A3TA 1G6ZA 4JI0Q 5FO7B 4RKBA 1TWAB 3C2PA 4GLAC 1VQPA 2L5TA 1CKNA 4OWWB 1OXXK 1I6VC 1F77A 2BE5D 3A54A 3AB9A 1CA5A 3DWAA 1KLGD 1KDAA 1TQOA 2RSNA 3RR5A 3GTQB 3DUZA 2QW7A 2CQAA 2WB1E 1IBLQ 1EQQA 4RHRA 1DOMA 1LUZA 3UDIA 5HGTA 1Y8PB 4A3MB 4MNOA 1HTLD 4DV5L 3K58A 3BVGA 3K7AH 1L0XB 4OIKA 1J9OA 3EBEA 1B50A 1Q81C 1LTID 5FLMG 2VNUD 4C1NK 1G6PA 1LT3D 2A6EC 1YITA 5J22A 4L5TA 5IGGA 4DK3C 4IUTA 1C4QA 1HTPA 2WAQE 1H9RA 4DUYL 3RD4A 2MO1A 1T5EA 3CC4A 3M3YB 1E2VA 4HIKA 1V1PA 2IL8A 2WACA 5IYDG 3GTGB 2B8FA 3TP7A 3NWTA 3U9OA 2LS01 4OO1H 4DAMA 2HD3A 2TMPA 3RLNA 1K28A 1CSQA 3S1MH 4JV5L 3NHHA 1ONLA 3K5MA 5IGBA 1I4QA 1EY5A 2A1AA 1IBKL 1KNAA 4G7HC 1WTXA 1H95A 4JOIC 5GAHC 5IT9L 4RKLA 4A3IB 2L55A 4J8QA 1DZ1A 1HQMC 1BNZA 4LAAA 2VW9A 1EFID 4UPAA 4IPDA 4X65L 4P75A 1X6OA 3U4ZA 2F0QA 3TBIB 5A2QL 2ZXOA 1K8GA 1LTAD 4DK1A 1AZPA 2XGTA 2OWOA 4UP9A 2ICEC 3FEWX 3A56A 1SYFA 2WINB 2VB2X 3J81c 4K5WA 2WKCA 4A3DB 3G4SA 4DR4Q 2FMCA 4JI1Q 4OELB 3TP6A 2E2JH 3QIAA 3H3VI 1VQMA 5GADC 2I5MX 4FP5D 4HN7A 2NTTA 2YTVA 1PH2A 3TP5A 1HXYD 2IW3A 4DR1Q 1X3PA 2CWAA 3VA7A 3DM1A 3BZCA 3SE0A 3LGJA 1QNUA 4BWGB 1EZ8A 4LUOA 4QUFA 1QVFA 3JAME 2K5DA 4MTNA 2BE5C 3F1ZA 2MP1A 4G4KA 4B3TL 3R3OA 3CCEA 1R9TB 2B2WA 4HSVA 3PUZA 4G7ZC 1G8ZD 2E5LQ 2F03A 4K6DA 1JOOA 3TEHB 2JN4A 3T1YQ 3N52A 1HQRD 4J1MA 1I6HB 4DAPA 1IL8A 2VUMB 2L0CA 4HIMA 2EYLA 2HCIA 2IWHA 1KABA 3ZYYX 3J80E 3FP9A 1VQGA 2F0SA 4BBRH 1Q82C 4GN3B 3J7AF 1U0LA 1B70B 3I7FA 4QY7A 3D4WA 4R9WA 2DJGC 3GTOB 2IY5B 3F8TA 1NMFA 2BDOA 5CGKA 5C44G 5EBCA 2R92G 3HOZH 4DR5L 4C3JB 5C4XB 1PRTF 3LWUA 1PH7A 1O7IA 1YNND 4IALA 1S5FD 4GOPA 1I50B 4A4IA 4ZAIA 1Q86C 3S15H 1Q3LA 2VL6A 1VQ7A 1EEID 1VQHA 5K5PA 4K0KQ 2WV6D 1MGSA 1JOKA 5G3LD 3QB3A 2R61A 3GQBA 1KNEA 3DMUA 2ZXRA 2SNSA 4F87A 2Q8IB 2QDLA 2A6HD 1VQ5A 2ZTDA 4ZQ3A 1XPOA 1K83H 4NMZA 2Z6KC 3I4MB 4EQNA 3MEFA 3R2IA 3S1RB 2WFWA 4BS9A 4A3EB 1BXTA 2JK8A 1S72A 3NBHB 1EL0A 1C0AA 5CR3A 4F8MA 5DAUA 1KC8C 3EJIA 2K01A 1I5FA 2DUDA 4DUZQ 4R8IA 3W2DA 3PUVA 2Y0SG 4EGVA 1K3RA 5LL6S 3PO2B 3E3XA 1WTPA 1XNQQ 4ABNA 3AQQA 3ND9A 4DKAC 4MTKA 1V43A 2PO4A 1IKLA 1CFMA 3K5LA 2YYZA 2NN6I 2PQAA 1M1KC 3WOEA 4PG3A 4XQNA 1HHVA 4DN4M 4L6TB 5E4WC 1I4RA 5KYLA 2X69A 1PH4A 3JC66 4GKKL 3CF5A 3F2BA 1QCBD 1TWGB 2ZXPA 2PPBC 5C0XH 4UDUC 2C5CA 2A68D 3H3VC 3GP7A 3HKZE 4J6HA 1KDCA 1QUQA 3A7LA 4ZLTF 2UUAQ 3NPPA 1VQLA 3AMUA 2QA4A 2O5JC 1HRJA 2YU9H 1Y1VH 5KNBA 1ENAA 4H02A 2JA5H 2L12A 1QZGA 2EVBA 4F88A 4H0LC 2K5WA 5C4JH 1TVXA 1JMCA 5CBAE 1HNZL 3PUWA 4ZUJA 3OTOQ 2BCOA 2RDFA 1EIFA 1S5ED 1ZYRD 3AYHB 2KENA 1TWAH 1EQVA 2DNCA 3H0GB 1K9MC 3UE1A 1TXYA 3MEHA 1HNXQ 1QOHA 2F0DA 2L9HA 3GTQH 4XXEA 4CDCC 5IYBG 4R4CA 1N36Q 2R93G 3FMCA 1EYDA 5M5YB 2O4XA 1YNNC 4A3FG 5IGCA 2K04A 1EY7A 4A3JG 4KMUC 2HUGA 4O2DA 2KCTA 4R4QA 4HJAA 1PA6A 5HGQA 3LWEA 1CK1A 1RDPD 2OXPA 2J0TD 2HCCA 5EPJA 4LNQA 4OWTB 1AH9A 4C2MB 2V4DA 1BCPB 1DM0B 3G6EA 3DEOA 1RIPA 1TIID 1VMCA 1A15A 2A6HC 1BOSA 5JVH3 3KJOA 5JJIA 1AP0A 3MFYA 3M3YH 2SNMA 2VQEL 1EQTA 3GTGH 5J3BA 1BF4A 3GO5A 2EXZA 2K03A 3I3CA 4DAYB 2B2VA 1PH1A 2E75C 1XTCD 3I4NG 1VQEA 2DNEA 2E8GA 1SJHD 3MXNB 4L63B 2F0MA 2I07B 3CMEA 3UDGA 2B2WC 2LSSA 1G51A 5T1IA 1LACA 4X66Q 1JCKB 1MJCA 3S1MB 4DV3Q 3HG9A 1EZ6A 3STBD 3L9AX 3U50C 3PF4A 1SLJA 1C9OA 3RN2A 1TY0A 3TMEA 4OO1I 4J15A 2PMZE 3ITPA 4JI8L 3HOUH 1ILPA 1GKHA 1WTOA 1X9NA 4K5VA 2IX3A 3K80C 1KAAA 2BA1A 4P72A 1XMQL 1VCIA 1EOVA 4CHTB 3JAML 1KLUD 4O42A 3Q6SA 1I94L 5IWAQ 1GHJA 4CJ0B 2R7FA 4DV4Q 1VF7A 4A3DH 1B3AA 4NW2A 4DR6L 2F4VL 4F7XA 2CWPA 3URYA 2Z9HA 4A3CH 2Z6BA 2F4VQ 2EYOA 2JA6B 5EKLA 5F2DA 1ZYRC 1F9QA 4YWMA 4K8JA 3TSSA 1N34Q 2E2JB 3J80L 4RAUC 1ET6A 1BVSA 2EY6A 2CH4W 1GUSA 3EIVA 1O78A 3ND8A 4ME5A 3MFGA 4AYBE 1PXUA 1R9TH 2LKVA 4C3HB 1I4XA 1MKHA 3W5OA 4I65A 1I6HH 1BKBA 2VUMH 1EEFD 3PGZA 5EQ0A 4NXNL 2N88A 3UDFA 1PV4A 4DF7A 4DNTB 4WJ4A 2A74C 2G9HD 3FDTA 3KLWA 5LMNW 2V1CC 3CCLA 3FKIG 3ICEA 3GTOH 5E3FA 2F0IA 2N55A 4BBRB 5JEAJ 4DV0Q 3GTKH 2K1BA 3HOVG 1G2TA 5J1ZA 3L7ZC 4JYAL 4A3LH 4JW0A 3I72A 5JOBA 3X3NA 2KUMA 1BO0A 4KLKA 4LFCQ 2XRQD 4C3JH 5IP7H 1X3GA 4IJHA 5C4XH 1OO9B 3HOZB 4C1NI 1WYDA 1I50H 3S14H 5KEEA 4A3KG 1HR0W 3NWSA 4OEMB 4CJ1B 4LFBQ 4QIWB 1RJTA 4O1NA 1EWHA 1TS5A 1PFBA 4LF5Q 2D62A 2DJFC 2E74C 1JOQA 2EY1A 2ZM6L 2AQ2B 3T56B 2HHHL 5IP9G 4DR2Q 4WJ3M 4MHEA 4DV7L 1EY9A 2QEXA 1NSNS 3K0XA 1PZKD 1H9MA 1LTGD 3ONAB 3R93A 3BG3A 2F0PA 1A62A 4IUNA 2RA4A 3I4MH 3OSOA 1BUVT 1NUCA 1JC7A 1T9HA 2ICIA 4GNXB 2EZVA 4A3EH 3KBGA 5FLXL 4DR3Q 3OWEB 2UXCQ 3STBC 2KEEA 1Y69U 5K36G 4R4TA 1ZKOA 2QEJC 1GVPA 2A19A 1TKWB 3C46A 4M8AA 1IKMA 3VYSA 3PO2H 4POFA 2NZHA 1BDOA 4ZCKA 3PO3H 5C3EG 4K14A 3CRKC 1W6JA 2TSSA 4X62L 1SNMA 1K8OA 2Z8LA 2Z4HA 1EY0A 4GS3A 1FJGQ 1DCZA 4A3GG 3SR1A 2VS1A 4ILWA 1VQJA 3DWQA 2G9DA 4KKTA 4NB3A 1CHQD 4OGQC 5CV4A 2UXDQ 3J7ZC 1RHPA 4QQBX 4PZ8A 2EYPA 1LYLA 2K05A 4XYOA 1TWGH 4FF3A 4IOAA 4HJ9A 3OMGA 2UUCQ 1RTNA 1YIJA 4WRDA 3RNUA 1QE6A 2UU9Q 4JI4Q 1D5MC 3CW2C 1GUTA 5JPNC 1PFNA 2F0OA 2K5HA 4UY8C 1DJRD 1C7YA 1ASZA 3VR6A 4WJWA 5C5LA 4ID6A 4BBSG 4G57A 5L37A 4Y52H 3HGBA 2WIIB 2Z6KA 3T4AC 3V96A 2O2LD 2K7VA 4C3IG 2JP1A 4DV1L 5C0XI 4YHHQ 1PHJA 3GTJB 2ES2A 4IZ8A 4HSPA 1WTVA 1IBMQ 2KEDA 4GLVB 1FD7D 5GROA 3J80i 1YHBA 1IZ6A 1GXDC 1WTRA 1STNA 1SNCA 4A75A 3S2HB 1HNWL 1S4ZA 5JEAG 3FPPA 2EXDA 4RGMA 1S5CD 4R1JA 1B9NA 5M5YH 5DLQE 1X54A 5KGUA 5CV7A 2Q8TA 3HOXG 3CD6A 1QVGA 1TY2A 4HJ8A 1HH2P 1WTQA 3E9HA 4IUPA 1WI5A 1NE3A 3CC2A 2AUKA 2PZTA 1W3SA 1WD0A 4C2MH 2NYZD 1AFPA 4NDXA 2H4OA 4DV5Q 1GOZA 1LTTD 5EKIA 3QOLA 4LF8L 1Y1WG 2A69D 3ULPA 1JB7A 3HP3A 3C1FA 3K5NA 4PQXA 1VF5C 1LTRD 3BJUA 2K32A 3KDFB 1RODA 3EFXD 5EKKA 1GO3E 2K5QA 1D5XC 1STGA 3K59A 4UP8A 2B63G 1PYWD 2N49A 1ESRA 4LF6L 4DUYQ 2N8NA 1UNSA 5LMNL 3HS0C 1LTSD 5E1FA 3S2DB 1SNDA 1TU2B 4NPSA 4XT1B 1CSPA 3CCMA 1QILA 5DEHA 2AKWB 1F2ZA 1PH6A 5IYCH 1HJPA 1JB3A 2D9UA 1V9PA 3CAMA 1S40A 4HEDA 3BYYB 4KKSA 3H09A 1HR0L 2XWBB 4QMGA 4IPCA 4Z9CB 4JV5Q 1HR0Q 4IOCA 4IFDH 1IBKQ 4LUVA 4A3MG 4HMJA 1S5DD 4JBJA 1CKNB 1SSOA 1RKNA 4IUVA 3BZKA 3A8JE 3H6MA 4QL5A 4P2CB 3W1BA 4X65Q 1K0SA 1XXGA 3OHXC 4UHVA 4NXML 3HOUB 1YBYA 3PCOB 1V8QA 3M4PA 1Z6HA 1PTOF 1VQAA 1PFSA 2OQ0A 4JI6L 2F0LA 1SXTA 1KD1C 3B6YA 4MN3A 1PZID 4FF2A 5IT9c 3E9IA 3NENA 2JA6H 1UE6A 2RQXA 4B9WA 3CCQA 1A2TA 4A93G 4B9XA 4KI0A 1XPUA 1M4VA 5JJZA 1MJEA 1SDFA 3EN2A 2JSOA 2M2LA 5ISRA 5D14A 1I4HA 2FFKB 4ZRZA 2NWGA 4C3HH 4LK1C 3SK5A 5C44B 4B3TQ 5GAEC 2R92B 1E2WA 2YV5A 4A3IG 3HOWG 2F1MA 2RCNA 1UE7A 3Q8DA 4ZK9B 3NBHA 1RD9D 3NTKA 1MSHA 2B2UC 4EX5A 1E1OA 3HOYH 4U673 2AQ3B 4RGOS 2J7ZA 1GD7A 4BXXH 5IGDA 2CH4A 2IPKD 2K5NA 2L4NA 4N9TA 3VA5A 1E24A 2EDGA 1PZJD 4DNRB 3GTKB 1RL2A 2A69C 1K73C 5M3MG 4FXDA 5FJ8H 5I2YA 1A2UA 1SNPA 5BN3A 1HUMA 1PH9A 5E7NA 3OWFA 4KN4C 4DR5Q 3A55A 3DXJC 3BZDB 3S14B 2EE1A 3U4VA 2EY2A 3VYRA 2F3IA 2UXBL 3KF6B 3HKZG 2FINB 2F4IA 2Y0SB 2BH2A 4FXKC 3V2TA 4IUUA 4ZKCB 3PIO3 3Q23A 1J5EL 4B3RL 4JI5L 4QF4A 3GV3A 3NSWA 4ME3A 4L5SA 3MXPA 1SE4A 4U68A 2X6GA 5I9PA 3Q22A 4XYQA 3PIP3 1QNKA 4A76A 5M3FG 2PQEA 3G6JB 2C35B 1YJWA 4KV6A 3MXUA 5BN4A 3HRZC 1VQFA 2YTXA 4CJ2C 2F0HA 2EQSA 1LT5D 1RCVD 4KY5A 4K5XA 5HY6A 5I4DA 1EOTA 3F2DA 5IIFA 3OPOA 4FXGC 2Z1CA 3TN2A 3TS0A 3PO3B 1U5KA 3D6WA 2I5HA 1NTGA 4BY1H 2NVXH 1BR9A 4RGNA 1LO5D 5CMDA 1VQOA 5ELCA 5FLXE 3NEMA 5JVG3 2C9OA 5CV6A 1IYUA 4RH6A 3SXHA 4A3BG 1X3EA 3OYYA 3P1HA 2R6GA 2GVBA 1PYBA 1E22A 1JT8A 2JA8G 5FK9C 4GKKQ 1EY8A 1WFQA 5CORA 1LABA 4QUCA 5KNCA 4GLXA 1E2ZA 4KN7C 2R7ZG 2OTJA 2IHFA 1B2TA 4JI3L 2NN6G 1H9SB 1X55A 3IFDA 4JI3Q 1VMPA 3CPFA 4JI7L 1SBBB 3IL8A 4A3FB 1X65A 3GTJH 4XTCS 4A3JB 4OX9L 2F3WA 1HNZQ 1SN8A 3M85A 2B2TA 5GQOA 5LL6X 4LFAL 3H15A 3FPUB 1UUPA 3S2HH 3DLLA 1Q90A 4HIDA 2EJGC 4DAYA 3SK6A 5FLMH 1L1OB 3IFTA 1I4GA 2F0EA 4LJZC 2RF4A 4Y7NB 1FVIA 4IFDJ 3KUPA 1YEZA 1BBWA 3MXNA 3I4LA 1FNWA 1QZHA 4WORA 2NZOA 4CKEA 1J8IA 4MIUA 5EBDA 1SE8A 2P5ZX 1UAPA 2JA7G 1TWFH 2FHTA 2WKDA 3G7LA 1XMOL 4PV1C 4LF4L 3M7NA 4PZ6A 4HCEA 3BU2A 1Z47A 3I90A 3GTMH 1PRTB 1LV9A 5IYDH 5T1GA 1WCMG 4BA1I 1U4PA 1L2FA 4JI2L 2OEOA 1DOLA 3KF8B 3BVZA 1JICA 1KXLA 4GZYC 1OXVA 2K33A 2QGQA 3NUCA 3I4NB 3PUYA 4HCSA 4YY3L 2KCMA 4GKJL 5J39A 3PF5A 1QVCA 1SAPA 1YNXA 1B44D 3F2CA 3CRLC 4IJLA 1SFOB 1W2BA 1HA5A 2EJFC 4ULLA 3T51B 1VQ8A 3P75A 5ELOA 1JWMD 4FF1A 4BY7G 4RFBA 5FOBB 3E5SA 1YHAA 2D0PA 3P7JA 3H0GG 2KVMA 2VQEQ 3S2DH 1LLRD 4FDBA 5AJ3L 1XYIA 3A8KE 3NELA 1Q1BA 4GN5A 3D8GA 1UEBA 1ILQA 4AYBG 2BDNA 1BCPD 1CHPD 1F9PA 1ICFB 1KRTA 1B9MA 4IPHA 4IO9A 3R2TA 3CHBD 4KHZA 5DM73 3SK8A 5I2XA 1C8CA 1OTCA 2XSCA 3G71A 4YCVA 2KHIA 2B8GA 2D0OA 1CKMA 1KL9A 2EY5A 4FO2A 4ZUIA 5D65A 4B3SL 4V190 4PNYA 4RA8A 1K8MA 1KIXA 4B3SQ 3L3OC 4YCWA 1JE4A 5C6AA 1EU4A 3CMAA 4LF7L 2PW7A 1A6XA 2R3ZA 3ER0A 3NK9A 3SEBA 2NVQB 3RLFA 2PCFB 1U9RA 2H1EA 1GUWA 2LFNA 1W6KA 4RGTA 3AFPA 2RHSB 4FF4A 2ZJQA 1MIUA 3PV0A 4IUQA 2WP8J 4JI8Q 2OT2A 3I91A 1XMQQ 2J4XA 4IFDI 2CHBD 1B53A 3MTSA 2PYKA 3H91A 5EAYA 1U4RA 1ESFA 4ODGA 2KQ3A 1I94Q 3MC0B 1EY4A 5EGTA 3K0YA 1CQFA 1O7ZA 4WFN3 2NZ1D 4JBMA 4DR6Q 2PNHA 4L5RC 4OO1G 2EPBA 3D6CA 4HJ5A 3FKIB 2RBMA 4I7ZC 2AQ1B 3T1HL 1PMRA 1FGBD 4DU9A 4IURA 1SE2A 3A5UA 5C44H 2R92H 3DEPA 5I6WA 3FVQA 3J81E 4YWKA 4LUZA 2BH8A 2Q2IA 3WWVA 2K52A 2VY3A 2Q8RE 4DV6L 4A3KB 5BR8L 1DONA 1N9WA 2OTLA 2PW5A 2M00A 5CV9A 1U4LA 3CCRA 4NXNQ 3J80c 3TP8A 5C4ZA 3D0FA 4JPBW 3ZJYC 3TREA 2OQKA 4LW1A 3E0JA 2AWNA 3J7YW 3HOYB 1CQVA 2NB0A 4I7AA 5M5XB 3M4OB 5IOCA 2O5IC 1SEBD 2QF7A 3C1EA 4DV2L 4JYAQ 3D4DA 4HR7B 3K81C 2CFMA 4Q5VA 1O80A 1WVLA 4B3ML 1MD2D 1NAPA 1NNXA 5CYUA 1Z7TA 5C0XJ 1V1QA 1SROA 3S1QB 4DXFA 4HMIA 1LT4D 4XT3B 2EIFA 4NKLA 3ULLA 2ZM6Q 4PMBA 2HHHQ 1JE5A 3GTLB 3MVVA 1ZXTA 4LF9L 1JORA 5CBEE 1BCPC 2KJXA 4X3SA 4DV7Q 1P16A 2E76C 2NVYB 3FHWA 5C3EB 1E1TA 1I4PA 3N6RA 3KBXA 4TRDA 5KIXA 1JJCB 1AEXA 1JJGA 1F9RA 5JPMC 1N33L 4A3GB 3MA2B 3TS2A 2WB1B 4X64L 3OW7A 3VDYA 1N32L 2VQFL 1XTDA 1PFMA 4P73A 2B2TC 3W1GA 4X6AH 5KNDA 2I5LX 4OHJA 2NVTB 4BBRG 4KY7A 3VR3A 2K28A 5CV8A 1S5BD 4TVAB 2B2UA 1X3QA 3HOZG 1PTOH 3LX0A 4X62Q 4CGYB 4L8JA 3E0EA 2WAQB 3W3AA 4QGUA 4BY1B 2NVXB 4R4OA 3MHBA 1A3VA 4BBSB 2PZUA 2MNAA 1Y8NB 2AUJD 5M9OA 2IJ0A 4C3IB 2F3VA 1QB5D 4LMQD 4KY6A 4G7OC 2LMCB 4DR7L 1L0YB 3Q24A 3NE5B 3S16B 4LWCA 1JR0D 3K6OA 3JAMi 2HT1A 5IYBH 1YI2A 3UDXA 2R93H 4AQYL 3ULJA 3AFQA 4A3FH 4APVA 1X56A 3KDFA 3HOXB 4A3JH 1SE3A 3KJPA 1TWHB 2E2HB 1JWSD 5H1SE 2EYMA 2N3SA 3NP8A 1STBA 1EUJA 4OONA 4H13C 2RVLA 1D6EC 2IHEA 1O7YA 5NUCA 3I73A 4DFAA 4DV1Q 4POGA 1U4MA 1M8AA 4Y7NH 1DOKA 4R8NA 2QKIC 3PIPA 1B3QA 2LXKA 3KLSX 2F0FA 2F52A 2UUBL 1HNWQ 2Z4IA 3MWYW 1UE1A 1Q8KA 2A73B 2VXWA 2KA7A 1EIGA 3NQIA 1NR2A 2EYJA 4DAVA 1VQ4A 1TWFB 4JI0L 3M4YA 3K57A 1II3A 5C0XG 3GTMB 1IW7C 5C3WA 4K2LA 1Y8OB 1FGUA 3I4NH 5FKAC 1B1ZA 1CZGA 1RTOA 2IX0A 3WDNA 1Y1VG 1LTBD 4KHVA 2K6AA 1SFOH 1GHKA 2D5DA 1IBLL 3PSIA 2JA5G 3J7AV 5E4XA 4LF8Q 4DGZA 1H9KA 1CZWA 4HAEA 3GDEA 4XIGS 3EQLC 2ZT9C 4N8X1 2JYOA 2Q2UA 1SYGA 2DY7A 3J7A5 1PDQA 2FXQA 1FL0A 5G3LF 2XRSD 4LF6Q 5LMNQ 4EQPA 3TZUA 3H94A 3MZ5A 1IYJB 3HEJA 1JJ2A 4IN3A 2B39A 5KYIA 1SYEA 1P8LA 1PVOA 1AZQA 1HZ9A 1UE5A 4GNXC 5M5WB 1OXUA 2FMMA 1XPRA 1L0WA 1KQSA 1ZEQX 5I9OA 2RDHA 1E3PA 5BN5A 1CT1D 3D3RA 3P20A 3NBIA 2NVQH 2NUCA 4HTHA 1KTKA 4A93B 2ZTEA 3F2UA 3L0OA 5AFWA 1NBWA 1TT2A 2NBFA 1MBYA 3VR4A 3KK7A 3EROA 1DXMA 4NXMQ 4N8FA 2E2DC 3L2PA 2E2IH 4JI6Q 5IY0A 3J81L 3VYUA 1STAA 5ELBA 3HOWB 4YCUA 4O0AA 3DM3A 3KFUA 1SR3A 1AE3A 5C3XA 3FKIH 1DGSA 2ALYB 3KF6A 4DNIA 2OF1A 3HOVH 4JCVE 1HCZA 3A7AB 2VZAA 2AHOB 1HFGA 4KJOA 5DNFA 4CDDC 2K5VA 3M4QA 4DR4L 5COYA 1V1PB 5M3MB 4JI1L 1DD2A 3RZOH 1SMYD 4A3KH 3S1NB 2Q2HA 2I46A 2PZWA 1GM5A 4ZKBB 4DR1L 3NXWA 2F0VA 2JE6I 3HFZB 4RCNA 5IODA 5IP9H 3HOUG 4AH6A 1VQIA 3HKZB 2BA0A 4K8IA 1MHWC 5IE8A 5M5XH 3M4OH 1CI3M 2HQLA 1YVCA 1X32A 4YIJA 2E5LL 4K2KA 1E0BA 2QCPX 3T1YL 3GTPH 1A63A 4KD3A 1SNOA 1FYCA 4A3DG 1X3FA 3CPWA 1YNJD 2N78A 3CCUA 2KCNA 5M3FB 2EYHA 3EVQA 1OXSC 4QB4A 3V05A 2RCFA 4A3CG 5K36H 3T16A 2HIVA 3S1QH 1IYVA 3K8AA 1GJXA 2ATWA 5ELEA 4DPGA 3OW2A 3GTLH 2UXBQ 1VQBA 1AE2A 4EQOA 1XX8A 2NVYH 3OOCA 5C3EH 2ZJPA 4S3SA 1J5EQ 4B3RQ 4JI5Q 4A3GH 3VR2A 2JEAI 2VUMG 3MAQA 3OIPA 2RSOA 2CCZA 4YWLA 1H9SA 4X3KA 4K0KL 1XJVA 2EYFA 3RMHA 3S17B 2SDFA 2NVTH 4A3BB 1R4PB 1SJED 2K75A 1BCPF 2MFIA 1ET9A 3J81j 4CKCA 2B2YA 1VS0A 1LTLA 1EQRA 2JA8B 1D2BA 1EWIA 1YZ6A 1NCVA 4KJNA 4A3LG 1M90C 3ERQA 5JJLA 4C3JG 1IL2A 5IP7G 2R7ZB 5C4XG 1FNVA 1L1OA 4E6IA 2XN9C 3M9BA 1PTOB 1PH8A 4BBSH 2HDMA 4DUZL 1WD1A 1TWCB 5I6YA 1HFNA 1GUGA 3DWPA 4JK1C 2K14A 2ZTCA 4C3IH 1XNQL 1AN8A 4ALPA 2OCEA 3CQZB 3TRZA 1Z9FA 2SEBD 3I56A 4OIJA 5DM63 3QG1A 4HJ7A 5A35A 3S16H 1MSGA 4PMCA 3KF8A 2HIXA 4JBWA 2L11A 3RZDB 3I4MG 1H9JA 5JEAH 1G2SA 5EPLA 4GOPB 2MUYA 1PTOD 2CW0D 3PMFA 4A3EG 1D1IA 4X3TA 3HZXA 1PLFA 3CU7A 3O13A 3HOXH 2MHVA 4JBKA 2F0UA 1SMYC 1B7YB 1STEA 1TWHH 3J81i 3BS1A 2E2HH 3IAYA 3M7GA 1Q46A 2JA7B 2CKZB 1Q7YC 3I4OA 2R93B 1T5XD 3PO2G 1KHIA 3A8IE 4JI7Q 2AMCB 2F0NA 2LXJA 2PMZB 5FO9B 1B8AA 2UUAL 4OX9Q 2SOBA 1HZAA 1WCMB 1HPCA 3CCSA 3PO3G 1I3QB 3QR8A 2BOSA 1IHZA 2F0JA 4MZ9A 1KRSA 4LFAQ 4CDFC 4KHPL 5GAGC 2B29A 1TS4A 4KHPQ 1Y1WH 5IGEA 1ENFA 2M9VA 4UP7A 1Q8IA 2KECA 3K7UC 1YNJC 3OTOL 2RDGA 1G91A 2F0KA 2B63H 2KHJA 4XQQA 5LMUL 4N9PA 3TQYA 3BDLA 2JQOA 4BY7B 5LMUQ 2Z0SA 2DY8A 1XMOQ 4LF4Q 4KTAA 1WTHA 1HNXL 4HIOA 2B3GA 1VQNA 2Y0SE 1VQ9A 4TKOB 1GUOA 1Q12A 3RLOA 1ASYA 2PQAB 3ERSX 2GVAA 4JI2Q 3MXGA 4AYBB 2RKSA 3D31A 1MI2A 5CV5A 1N36L 5TSSA 1S3OA 3A0JA 4YY3Q 4GKJQ 4CBVA 1NR4A 1O7LA 4KK7A 1WJJA 4A3MH 4OL7A 3EA6A 1PRTD 3NTHA 2XWJB 5EJWA 1HZCA 1QUQB 3RUZA 1B4OA 4B08A 1STHA 3I55A 1N8RC 2ENBA 1F2MA 1KAWA 5HURA 4XQJA 1JQYD 3K7AB 5AJ3Q 1OXTA 2EOTA 4TSSA 1EWCA 4NP5A 1SYBA 4EQ5A 5IGFA 4M1UB 1HZBA 2KBNA 5M5WH 3DHQA 5FO8B 4Q0FA 1NY4A 3A74A 3GV6A 1BQQT 3BDCA 4DK6C 2DGYA 5ELDA 3K5OA 4RHSA 4C56C 1WTWA 4A93H 4H7BA 3QOJA 4XDXA 3FRPB 2LY7A 1HUNA 1AW7A 3SDZA 3SGIA 1VQ6A 4LF7Q 4IPGA 3CCJA 2ASBA 3G48A 1D1KA 3R8BA 4X66L 3U58A 2GN5A 4DV3L 2XNAC 2PI2A 4DXGA 1PTOC 2CW0C 2FJ2A 2L15A 4QJFA 4OXPA 3PUXA 4A3IH 3HOWH 1IXRA 2E2IB 2XIWA 1CUKA 1JWUD 1FNUA 1FR3A 3T53B 3H3VH 3KYHC 2A68C 3LNNA 3S9WA 4BA2I 3NQTA 4V0BA 1EIYB 2KOLA 5IYCG 1PYSB 1LT6D 4OWXB 2MPMA 5IWAL 3JAMc 1GUNA 4GOPC 4DV4L 3Q0AA 3T1HQ 3OIQA 1KDBA 3U9SA 3HOVB 1EYCA 5M3MH 2RHQB 1D8LA 5C4HA 1EY6A 2AWOA 1Y14B 3I8ZA 3S1NH 1CTMA 4ZYSA 4IFDG 5IT9E 5JAVA 2HDLA 3HKSA 3CCVA 1C48A 1UEAB 4GNXA 1N34L 2B2YC 1XNRL 3RZOB 1SYDA 3UI2A 5C5MA 1EU3A 2JXMB 2G5DA 1XNRQ 3VR5A 3TZDA 4DV6Q 2KCCA 2YTYA 1QWYA 5BR8Q 5A2QE 5EPKA 4AIMA 1PH5A 1VQCA 1F2YA 2ZJRA 4IQZA 1A3UA 4KKUA 1L1OC 2JEBI 5ELFA 2IX1A 2ID0A 1RF2D 3UE0A 3IRBA 1BBUA 3BVMA 5D3IB 5M3FH 1CA6A 3GTPB 4DV2Q 4H44C 2CQOA 2I0QA 3X3MA 1ML0D 4EVOA 2R7DA 2JA6G 1XWEA 2Q2TA 3S24A 1STYA 4B3MQ 2F0TA 2X6LA 1PRTC 1TR5A
chains in the Genus database with same CATH topology
3NTIA 4QCLA 4K6LA 1F9SA 1SNQA 1IW7D 3KLSA 1D5ZC 1TS3A 4C3HG 2NTSA 1EIHA 2L1BA 3SVMA 4FYDA 4UAIA 3SHLA 5CC4A 2QILA 5KRUA 2HQEA 1G291 2MGSA 3T13A 3S15B 4RCOA 3IKJA 3I70A 2F0GA 4DA2A 4PMWA 4RWSC 4DK0A 2A6ED 3KLRA 3BDOA 4FVMA 2KHSA 3OMCA 1K83B 2NN6H 1ENCA 3VYTA 2VB3X 2EJMA 3E6ZX 2A5HA 4TQUS 5D3DA 1V1OA 2DN8A 3QJYA 1QJOA 2D2CC 2IT1A 3QO2A 3C3LA 1CM9A 2GA4B 3WOFA 3TDQA 3D4RA 2PNRC 2F0WA 1SYCA 1DYQA 2CVRA 1HA6A 1F2LA 1R4QB 1BBXC 1Q1EA 3CKIB 3GD7A 1VDZA 2XVSA 1EYAA 1ICWA 1QG7A 2MJ8A 2YU9B 1Y1VB 4CKBA 3QWNA 4KD4A 4X3UA 3AU7A 1Y1WB 5LHY1 2JA5B 5C4JB 3SK4A 2B2VC 3BYTB 2B63B 1TS2A 2QDBA 4FNFA 1A3TA 1G6ZA 5FO7B 4RKBA 1TWAB 3C2PA 2L5TA 1OXXK 1I6VC 1F77A 2BE5D 3A54A 3AB9A 1CA5A 3DWAA 1KLGD 1KDAA 1TQOA 2RSNA 3GTQB 3DUZA 2CQAA 4RHRA 1DOMA 5HGTA 1Y8PB 4A3MB 1HTLD 3K58A 3BVGA 1L0XB 4OIKA 1J9OA 1B50A 1LTID 2VNUD 4C1NK 1LT3D 2A6EC 5J22A 5IGGA 4IUTA 1C4QA 1HTPA 1H9RA 3RD4A 1T5EA 3M3YB 1E2VA 1V1PA 2IL8A 2WACA 3GTGB 2B8FA 3TP7A 3NWTA 3U9OA 2LS01 4OO1H 2TMPA 3NHHA 1ONLA 3K5MA 5IGBA 1I4QA 1EY5A 1KNAA 4G7HC 1WTXA 5IT9L 4RKLA 4A3IB 2L55A 4J8QA 1DZ1A 1HQMC 1BNZA 4LAAA 1EFID 2F0QA 3TBIB 5A2QL 2ZXOA 1LTAD 4DK1A 1AZPA 2ICEC 3FEWX 3A56A 1SYFA 2WINB 2VB2X 4K5WA 2WKCA 4A3DB 2FMCA 3TP6A 3QIAA 4FP5D 4HN7A 2NTTA 3TP5A 1HXYD 2IW3A 1X3PA 3VA7A 3DM1A 3SE0A 1QNUA 4BWGB 1EZ8A 4QUFA 3JAME 2K5DA 2BE5C 4G4KA 2MP1A 3R3OA 1R9TB 2B2WA 4HSVA 3PUZA 4G7ZC 1G8ZD 2F03A 4K6DA 1JOOA 3N52A 1HQRD 4J1MA 1I6HB 4DAPA 1IL8A 2VUMB 2L0CA 2EYLA 2HCIA 2IWHA 1KABA 3ZYYX 3J80E 2F0SA 3J7AF 3D4WA 4R9WA 3GTOB 2BDOA 5CGKA 5EBCA 4C3JB 5C4XB 1PRTF 3LWUA 1YNND 4IALA 1S5FD 1I50B 4ZAIA 1Q3LA 1EEID 5K5PA 2WV6D 1MGSA 1JOKA 5G3LD 3QB3A 2R61A 3GQBA 1KNEA 3DMUA 2ZXRA 2SNSA 4F87A 2Q8IB 2A6HD 4ZQ3A 4NMZA 3I4MB 4EQNA 3R2IA 3S1RB 4BS9A 4A3EB 1BXTA 1EL0A 5CR3A 4F8MA 5DAUA 3EJIA 2K01A 4R8IA 3W2DA 3PUVA 4EGVA 5LL6S 3PO2B 1WTPA 4ABNA 3ND9A 1V43A 2PO4A 1IKLA 1CFMA 3K5LA 2YYZA 2NN6I 3WOEA 4XQNA 1HHVA 4DN4M 4L6TB 5E4WC 1I4RA 5KYLA 2X69A 1QCBD 1TWGB 2ZXPA 2PPBC 5C0XH 4UDUC 2C5CA 2A68D 3H3VC 3GP7A 4J6HA 1KDCA 3A7LA 4ZLTF 3NPPA 3AMUA 2O5JC 1HRJA 5KNBA 1ENAA 2L12A 2EVBA 4F88A 4H0LC 2K5WA 1TVXA 5CBAE 3PUWA 4ZUJA 2BCOA 2RDFA 1S5ED 1ZYRD 1EQVA 2DNCA 3H0GB 3MEHA 1QOHA 2F0DA 2L9HA 4XXEA 3FMCA 1EYDA 5M5YB 2O4XA 1YNNC 5IGCA 2K04A 1EY7A 4KMUC 2HUGA 3LWEA 1CK1A 1RDPD 2OXPA 2J0TD 2HCCA 5EPJA 4C2MB 2V4DA 1BCPB 1DM0B 3DEOA 1TIID 1VMCA 1A15A 2A6HC 1BOSA 5JVH3 1AP0A 3MFYA 2SNMA 1EQTA 1BF4A 3GO5A 2EXZA 2K03A 3I3CA 2B2VA 2E75C 1XTCD 2DNEA 1SJHD 4L63B 2F0MA 2I07B 2B2WC 5T1IA 1LACA 1JCKB 3S1MB 3HG9A 1EZ6A 3L9AX 1TY0A 3TMEA 4OO1I 3ITPA 1ILPA 1WTOA 4K5VA 2IX3A 1KAAA 2BA1A 1VCIA 4CHTB 3JAML 1KLUD 4O42A 3Q6SA 1GHJA 4CJ0B 1VF7A 1B3AA 4NW2A 4F7XA 3URYA 2EYOA 2JA6B 5EKLA 5F2DA 1ZYRC 1F9QA 4K8JA 3TSSA 2E2JB 3J80L 4RAUC 1ET6A 2EY6A 1GUSA 1O78A 3ND8A 4ME5A 3MFGA 1PXUA 2LKVA 4C3HB 1I4XA 4I65A 1EEFD 5EQ0A 2N88A 4DF7A 4DNTB 2A74C 2G9HD 3FDTA 5E3FA 2F0IA 2N55A 4BBRB 5JEAJ 2K1BA 1G2TA 5J1ZA 3L7ZC 3I72A 5JOBA 3X3NA 2KUMA 1BO0A 2XRQD 1OO9B 3HOZB 4C1NI 5KEEA 3NWSA 4CJ1B 4QIWB 1RJTA 4O1NA 1EWHA 1TS5A 1PFBA 2D62A 2E74C 1JOQA 2EY1A 2AQ2B 3T56B 4MHEA 1EY9A 1NSNS 1PZKD 1H9MA 1LTGD 3ONAB 3R93A 3BG3A 2F0PA 4IUNA 2RA4A 3OSOA 1BUVT 1NUCA 1JC7A 2ICIA 2EZVA 3KBGA 5FLXL 3OWEB 2KEEA 1Y69U 5K36G 1ZKOA 2QEJC 1TKWB 3C46A 4M8AA 1IKMA 3VYSA 1BDOA 4K14A 3CRKC 1W6JA 2TSSA 1K8OA 1SNMA 2Z8LA 2Z4HA 1EY0A 1DCZA 3SR1A 4ILWA 3DWQA 2G9DA 4KKTA 1CHQD 4OGQC 5CV4A 1RHPA 2EYPA 2K05A 4XYOA 4FF3A 3OMGA 1RTNA 4WRDA 1QE6A 1D5MC 1GUTA 5JPNC 1PFNA 2F0OA 1DJRD 3VR6A 4WJWA 5C5LA 4ID6A 4G57A 3HGBA 2WIIB 3T4AC 3V96A 2O2LD 2K7VA 4C3IG 2JP1A 5C0XI 3GTJB 4IZ8A 4HSPA 1WTVA 2KEDA 1FD7D 1GXDC 1WTRA 1STNA 1SNCA 3S2HB 1S4ZA 5JEAG 3FPPA 4RGMA 1S5CD 1B9NA 5KGUA 5CV7A 2Q8TA 1TY2A 1WTQA 4IUPA 2AUKA 2PZTA 1WD0A 2NYZD 1AFPA 4NDXA 2H4OA 1GOZA 1LTTD 5EKIA 3QOLA 2A69D 3HP3A 3C1FA 3K5NA 4PQXA 1VF5C 1LTRD 2K32A 1RODA 3EFXD 5EKKA 2K5QA 1D5XC 1STGA 3K59A 1PYWD 1ESRA 1UNSA 3HS0C 1LTSD 5E1FA 3S2DB 1SNDA 1TU2B 4XT1B 1QILA 5DEHA 1F2ZA 1JB3A 2D9UA 4HEDA 3BYYB 4KKSA 3H09A 2XWBB 4QMGA 4Z9CB 4IFDH 4HMJA 1S5DD 1SSOA 1RKNA 4IUVA 3A8JE 3H6MA 4P2CB 1XXGA 3OHXC 3HOUB 1V8QA 1Z6HA 1PTOF 2F0LA 1SXTA 4MN3A 1PZID 4FF2A 2RQXA 4B9WA 1A2TA 4B9XA 4KI0A 1M4VA 5JJZA 1SDFA 2JSOA 2M2LA 5ISRA 5D14A 1I4HA 2FFKB 4ZRZA 2NWGA 4LK1C 3SK5A 5C44B 2R92B 1E2WA 2F1MA 4ZK9B 3NBHA 1RD9D 3NTKA 1MSHA 2B2UC 4U673 2AQ3B 4RGOS 2J7ZA 5IGDA 2IPKD 2L4NA 4N9TA 3VA5A 2EDGA 4DNRB 1PZJD 3GTKB 2A69C 4FXDA 5I2YA 1A2UA 1SNPA 5BN3A 1HUMA 3OWFA 4KN4C 3A55A 3DXJC 3BZDB 3S14B 2EE1A 2EY2A 3VYRA 2FINB 2F4IA 2Y0SB 4FXKC 3V2TA 4IUUA 4ZKCB 3PIO3 3Q23A 4QF4A 3GV3A 3NSWA 3MXPA 1SE4A 4U68A 2X6GA 5I9PA 3Q22A 4XYQA 3PIP3 1QNKA 2PQEA 3G6JB 4KV6A 3MXUA 5BN4A 3HRZC 4CJ2C 2F0HA 1LT5D 1RCVD 4KY5A 4K5XA 5I4DA 1EOTA 5IIFA 3OPOA 4FXGC 2Z1CA 3TN2A 3PO3B 3D6WA 1BR9A 4RGNA 1LO5D 5CMDA 5ELCA 5FLXE 5JVG3 2C9OA 5CV6A 1IYUA 4RH6A 3SXHA 3P1HA 2R6GA 5FK9C 1EY8A 5CORA 1LABA 4QUCA 5KNCA 1E2ZA 4KN7C 1B2TA 2NN6G 1H9SB 3IFDA 1VMPA 1SBBB 3IL8A 4A3FB 4A3JB 4XTCS 2F3WA 3M85A 2B2TA 5LL6X 3FPUB 1UUPA 1Q90A 2EJGC 4DAYA 3SK6A 3IFTA 1I4GA 2F0EA 4LJZC 4IFDJ 4Y7NB 3KUPA 3MXNA 3I4LA 1FNWA 4WORA 4CKEA 1J8IA 4MIUA 5EBDA 1UAPA 2FHTA 2WKDA 3G7LA 3M7NA 4PV1C 4HCEA 1Z47A 3I90A 1PRTB 1LV9A 5T1GA 4BA1I 1U4PA 2OEOA 1DOLA 3BVZA 1JICA 4GZYC 1OXVA 2K33A 3NUCA 3I4NB 3PUYA 4HCSA 5J39A 1SAPA 1B44D 3CRLC 1SFOB 1HA5A 2EJFC 4ULLA 3T51B 3P75A 1JWMD 4FF1A 4RFBA 5FOBB 3E5SA 3P7JA 2KVMA 1LLRD 1XYIA 3A8KE 1Q1BA 3D8GA 1ILQA 2BDNA 1BCPD 1CHPD 1F9PA 1B9MA 3R2TA 3CHBD 4KHZA 5DM73 3SK8A 5I2XA 1C8CA 2XSCA 2B8GA 2EY5A 4FO2A 4ZUIA 5D65A 4V190 4PNYA 4RA8A 1K8MA 3L3OC 1JE4A 5C6AA 1EU4A 2PW7A 1A6XA 2R3ZA 3NK9A 3SEBA 2NVQB 3RLFA 2PCFB 1U9RA 2H1EA 1GUWA 2LFNA 1W6KA 4RGTA 4FF4A 3PV0A 4IUQA 2WP8J 2OT2A 3I91A 2J4XA 4IFDI 2CHBD 1B53A 3MTSA 2PYKA 3H91A 1U4RA 1ESFA 4ODGA 2KQ3A 3MC0B 1EY4A 5EGTA 3K0YA 1CQFA 1O7ZA 4WFN3 2NZ1D 4OO1G 2EPBA 3D6CA 3FKIB 2RBMA 4I7ZC 2AQ1B 1PMRA 1FGBD 4DU9A 4IURA 1SE2A 3DEPA 5I6WA 3FVQA 3J81E 2Q8RE 4A3KB 1DONA 2PW5A 2M00A 5CV9A 1U4LA 3TP8A 5C4ZA 3E0JA 2AWNA 3J7YW 3HOYB 1CQVA 2NB0A 5M5XB 3M4OB 5IOCA 2O5IC 1SEBD 2QF7A 3C1EA 3D4DA 4HR7B 4Q5VA 1O80A 1WVLA 1MD2D 1NAPA 5CYUA 1Z7TA 5C0XJ 3S1QB 4DXFA 4HMIA 1LT4D 4XT3B 4NKLA 4PMBA 3GTLB 1ZXTA 3MVVA 1JORA 5CBEE 1BCPC 2KJXA 4X3SA 2E76C 2NVYB 5C3EB 1I4PA 3N6RA 3KBXA 4TRDA 5KIXA 1AEXA 1F9RA 5JPMC 4A3GB 3MA2B 2WB1B 3OW7A 1PFMA 2B2TC 5KNDA 4OHJA 2NVTB 4KY7A 3VR3A 2K28A 5CV8A 1S5BD 2B2UA 1X3QA 1PTOH 3LX0A 4CGYB 4L8JA 2WAQB 3W3AA 4BY1B 2NVXB 3MHBA 1A3VA 4BBSB 2PZUA 1Y8NB 2AUJD 5M9OA 2IJ0A 4C3IB 2F3VA 1QB5D 4LMQD 4KY6A 4G7OC 2LMCB 1L0YB 3Q24A 3NE5B 3S16B 1JR0D 3K6OA 3HOXB 1SE3A 1TWHB 2E2HB 1JWSD 2EYMA 3NP8A 1STBA 4H13C 2RVLA 1D6EC 1O7YA 5NUCA 3I73A 4DFAA 1U4MA 1M8AA 1DOKA 4R8NA 2QKIC 3KLSX 2F0FA 2Z4IA 3MWYW 2A73B 2VXWA 2KA7A 1EIGA 3NQIA 1NR2A 2EYJA 4DAVA 1TWFB 3M4YA 3K57A 1II3A 5C0XG 3GTMB 1IW7C 5C3WA 4K2LA 1Y8OB 5FKAC 1B1ZA 1CZGA 1RTOA 2IX0A 3WDNA 1LTBD 4KHVA 2K6AA 1GHKA 2D5DA 3J7AV 5E4XA 4DGZA 1H9KA 1CZWA 4HAEA 4XIGS 3EQLC 2ZT9C 2JYOA 1SYGA 2DY7A 1PDQA 5G3LF 2XRSD 4EQPA 3TZUA 3H94A 3MZ5A 3HEJA 4IN3A 2B39A 5KYIA 1SYEA 1AZQA 5M5WB 1OXUA 2FMMA 1ZEQX 5I9OA 2RDHA 5BN5A 1CT1D 3D3RA 3P20A 3NBIA 2NUCA 4HTHA 1KTKA 4A93B 3F2UA 5AFWA 1TT2A 2NBFA 1MBYA 3VR4A 3KK7A 3EROA 1DXMA 2E2DC 3J81L 3VYUA 1STAA 5ELBA 3HOWB 5C3XA 2OF1A 1HCZA 3A7AB 1HFGA 4KJOA 5DNFA 5COYA 1V1PB 5M3MB 1DD2A 1SMYD 3S1NB 2I46A 2PZWA 4ZKBB 3NXWA 2F0VA 2JE6I 4RCNA 5IODA 3HKZB 2BA0A 4K8IA 1CI3M 1X32A 4YIJA 4K2KA 1E0BA 2QCPX 4KD3A 1SNOA 1FYCA 1YNJD 2KCNA 5M3FB 2EYHA 3EVQA 1OXSC 4QB4A 3V05A 5K36H 3T16A 1IYVA 1GJXA 5ELEA 4EQOA 1XX8A 3OOCA 4S3SA 3VR2A 2JEAI 3MAQA 3OIPA 2RSOA 1H9SA 4X3KA 2EYFA 3RMHA 3S17B 2SDFA 4A3BB 1SJED 1R4PB 1BCPF 1ET9A 4CKCA 2B2YA 2JA8B 1D2BA 1NCVA 4KJNA 3ERQA 4C3JG 2R7ZB 1FNVA 4E6IA 2XN9C 1PTOB 2HDMA 1WD1A 1TWCB 5I6YA 1HFNA 1GUGA 3DWPA 4JK1C 1AN8A 3CQZB 2SEBD 4OIJA 5DM63 3QG1A 5A35A 1MSGA 4PMCA 3KF8A 3RZDB 4JBWA 2L11A 1H9JA 5JEAH 1G2SA 5EPLA 2MUYA 1PTOD 2CW0D 3PMFA 1D1IA 4X3TA 3HZXA 1PLFA 3CU7A 3O13A 2MHVA 2F0UA 1SMYC 1STEA 3BS1A 3IAYA 3M7GA 2JA7B 2R93B 1T5XD 3A8IE 2F0NA 2PMZB 5FO9B 2SOBA 1WCMB 1HPCA 1I3QB 2BOSA 1IHZA 2F0JA 1TS4A 5IGEA 1ENFA 2M9VA 1Q8IA 2KECA 1YNJC 2RDGA 1G91A 2F0KA 4XQQA 4N9PA 3BDLA 4BY7B 2DY8A 4KTAA 4TKOB 1GUOA 1Q12A 3MXGA 4AYBB 2RKSA 3D31A 1MI2A 5CV5A 5TSSA 4CBVA 1NR4A 1O7LA 4KK7A 4OL7A 3EA6A 1PRTD 2XWJB 3NTHA 5EJWA 3RUZA 1B4OA 4B08A 1STHA 2ENBA 1F2MA 5HURA 4XQJA 1JQYD 3K7AB 1OXTA 2EOTA 4TSSA 1EWCA 4NP5A 1SYBA 5IGFA 4M1UB 3DHQA 5FO8B 4Q0FA 3GV6A 1BQQT 3BDCA 5ELDA 3K5OA 4RHSA 4C56C 1WTWA 4H7BA 3QOJA 4XDXA 3FRPB 2LY7A 1HUNA 1AW7A 3SDZA 1D1KA 3R8BA 2XNAC 4DXGA 1PTOC 2CW0C 2FJ2A 3PUXA 2E2IB 2XIWA 1JWUD 1FNUA 1FR3A 3T53B 2A68C 3LNNA 3S9WA 4BA2I 3NQTA 4V0BA 2KOLA 1LT6D 2MPMA 1GUNA 3Q0AA 3OIQA 1KDBA 3U9SA 3HOVB 1EYCA 5C4HA 1EY6A 2AWOA 3I8ZA 1CTMA 4ZYSA 4IFDG 5IT9E 5JAVA 2HDLA 1C48A 1UEAB 2B2YC 3RZOB 1SYDA 3UI2A 5C5MA 1EU3A 2JXMB 3VR5A 3TZDA 2KCCA 1QWYA 5A2QE 5EPKA 1F2YA 4IQZA 1A3UA 4KKUA 2JEBI 5ELFA 2IX1A 2ID0A 1RF2D 1CA6A 3BVMA 5D3IB 3GTPB 4H44C 3X3MA 1ML0D 4EVOA 1XWEA 1STYA 2F0TA 2X6LA 1PRTC 1TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKL A;  2SNS A;  5IGC A;  1SND A;  2F3W A;  1EY7 A;  5J39 A;  1A2U A;  4KD4 A;  4LAA A;  4ZQ3 A;  4NMZ A;  1SNP A;  3BDC A;  4ME5 A;  5DEH A;  1F2Z A;  1SNQ A;  5CV4 A;  2PZW A;  4KHV A;  2LKV A;  4KY7 A;  2PYK A;  3OWF A;  2F0Q A;  4PMC A;  5CV8 A;  4EQN A;  2EYP A;  3NXW A;  2OXP A;  2F0V A;  2O4X A;  2KQ3 A;  4ODG A;  3SK4 A;  4DGZ A;  5IOD A;  3SK6 A;  4I65 A;  1EY4 A;  2EY2 A;  2F0E A;  5EGT A;  5CR3 A;  3PMF A;  5DAU A;  3OMG A;  4F8M A;  4H7B A;  3QOJ A;  3HZX A;  3EJI A;  2QDB A;  4K8I A;  1SYG A;  4QMG A;  3SHL A;  1A3T A;  5CC4 A;  4WOR A;  2F0U A;  3LX0 A;  1SYF A;  4WRD A;  4DF7 A;  4MIU A;  5KRU A;  4RKB A;  3V2T A;  4YIJ A;  3S9W A;  2HQE A;  3D6C A;  4HMJ A;  4K2K A;  2F0O A;  4QF4 A;  2RBM A;  4K5W A;  4KD3 A;  3T13 A;  4EQP A;  2SNM A;  1SNO A;  2F0N A;  3MHB A;  4DU9 A;  3MZ5 A;  1RKN A;  3HEJ A;  3MXP A;  1A3V A;  3TP6 A;  5E3F A;  5C5L A;  2F0I A;  4ID6 A;  5I9P A;  2SOB A;  5KYI A;  1TQO A;  1KDA A;  2EYH A;  4G57 A;  1SYE A;  2PZU A;  2F0G A;  3EVQ A;  3H6M A;  4QB4 A;  1IHZ A;  4K2L A;  2F0J A;  5J1Z A;  2PQE A;  3T16 A;  5I6W A;  5JOB A;  5M9O A;  2OEO A;  3TP5 A;  2EXZ A;  4KV6 A;  2F3V A;  3NUC A;  5IGE A;  1EZ8 A;  2F0L A;  4IZ8 A;  2F0H A;  2KHS A;  3OMC A;  4KY6 A;  2F0M A;  2PW5 A;  2M00 A;  5CV9 A;  5HGT A;  5I9O A;  4EQO A;  3R3O A;  5KEE A;  5KYL A;  4KY5 A;  3NQT A;  4K5X A;  3TP8 A;  2F0K A;  5C4Z A;  1ENC A;  1STN A;  4S3S A;  1SNC A;  4N9P A;  1JOQ A;  2EY1 A;  4K6D A;  3BDL A;  1JOO A;  2NUC A;  5IIF A;  4HTH A;  3P75 A;  4B9W A;  1A2T A;  4J6H A;  1KDC A;  4J1M A;  4KTA A;  3E5S A;  1EZ6 A;  1KDB A;  4B9X A;  1TT2 A;  1EYC A;  1EY9 A;  2EYL A;  5IOC A;  1EYD A;  1NSN S;  5J22 A;  5KGU A;  5CV7 A;  3C1E A;  5C4H A;  5IGG A;  1EY6 A;  3ERO A;  1KAB A;  2EYM A;  2F0S A;  2EYF A;  1ENA A;  5JAV A;  3NP8 A;  1STB A;  3D4D A;  3D8G A;  5ISR A;  5CV6 A;  2F0P A;  2RKS A;  4IUN A;  5CV5 A;  3SXH A;  3TME A;  5NUC A;  3OSO A;  3P1H A;  5E1F A;  1NUC A;  2PZT A;  3ITP A;  3D4W A;  4DFA A;  1SYD A;  5C5M A;  2WAC A;  3SK5 A;  3SK8 A;  4K5V A;  5CGK A;  4R8N A;  1STA A;  1KAA A;  4ZUJ A;  4NDX A;  2RDF A;  2F0F A;  4KJN A;  2EY5 A;  4HMI A;  2F0W A;  3TP7 A;  1EY8 A;  3U9O A;  3ERQ A;  1SYC A;  1F2Y A;  4NKL A;  5KIX A;  3QOL A;  1A3U A;  4OL7 A;  1EQV A;  4ZUI A;  5C3X A;  4PMB A;  3MVV A;  4IAL A;  3C1F A;  4PNY A;  1JOR A;  3RUZ A;  4E6I A;  3MEH A;  1STH A;  2OF1 A;  2ENB A;  5EKK A;  5C6A A;  3NHH A;  4TRD A;  1F2M A;  1STG A;  2F0D A;  4K14 A;  2PW7 A;  4F7X A;  2EYJ A;  1EY5 A;  1SNM A;  1AEX A;  5IGB A;  5K5P A;  3NK9 A;  2EYO A;  5I6Y A;  5IGD A;  3DHQ A;  1JOK A;  1EYA A;  4NP5 A;  1SYB A;  5HUR A;  1U9R A;  5EKL A;  1EY0 A;  4EVO A;  4KJO A;  5F2D A;  1II3 A;  3QB3 A;  5IGF A;  4N9T A;  3VA5 A;  4K8J A;  1STY A;  3DMU A;  3SR1 A;  2F0T A;  5C3W A;  1TR5 A;  2EY6 A; 
#chains in the Genus database with same CATH topology
 4JOI A;  4DV0 L;  3I2Z A;  3NTI A;  3CC7 A;  4QCL A;  4K6L A;  1F9S A;  1K8A C;  1K3B C;  1SNQ A;  1IW7 D;  3KLS A;  1D5Z C;  1TS3 A;  4LFC L;  4C3H G;  2NTS A;  1EIH A;  4JG2 A;  4LF9 Q;  4R4I A;  2L1B A;  3SVM A;  4FYD A;  3PQI A;  4UAI A;  4LFB L;  3SHL A;  5CC4 A;  2QIL A;  4LF5 L;  5KRU A;  4RMF A;  1VQD A;  2HQE A;  1G29 1;  1N33 Q;  3S17 H;  1YJ9 A;  4A3B H;  3A5Z B;  2MGS A;  1YJN A;  3T13 A;  4DR2 L;  4X64 Q;  3S15 B;  4RCO A;  1N32 Q;  2VQF Q;  1D7Q A;  3IKJ A;  3HOY G;  3I70 A;  2F0G A;  2JA8 H;  1K0R A;  4DA2 A;  4BXX G;  3AEV A;  4PMW A;  4RWS C;  5ELN A;  4DK0 A;  2A6E D;  2K4K A;  4GN4 B;  3KLR A;  3S1R H;  2R7Z H;  3BDO A;  4FVM A;  4DR3 L;  2KHS A;  3OMC A;  2UXC L;  5FJ8 G;  1A0I A;  1K83 B;  5FLX c;  1J6Q A;  2NN6 H;  1ENC A;  1VQK A;  3VYT A;  2VB3 X;  1TWC H;  5JJK A;  2EJM A;  3E6Z X;  2A5H A;  4TQU S;  4JC0 A;  5D3D A;  1V1O A;  2DN8 A;  3QJY A;  1QJO A;  2XTI A;  3KOJ A;  4RG1 A;  1WOC A;  2D2C C;  3CQZ H;  1FJG L;  2IT1 A;  3RZD H;  3QO2 A;  3RN5 A;  3C3L A;  1SMX A;  2MO0 A;  1CM9 A;  2WB1 G;  2GA4 B;  3WOF A;  3TDQ A;  4DR7 Q;  3D4R A;  2PNR C;  4L5Q A;  1EYG A;  2F0W A;  2MQH A;  2UXD L;  1SYC A;  1DYQ A;  1LM0 A;  4CDE C;  2JA7 H;  2CVR A;  1HA6 A;  1F2L A;  1R4Q B;  1BBX C;  1Q1E A;  1EFW A;  3CKI B;  3GD7 A;  4AQY Q;  1VDZ A;  2H5X A;  1UWV A;  2UUC L;  2JJQ A;  2A8V A;  2XVS A;  1WCM H;  2UU9 L;  3PIO A;  4JI4 L;  1I3Q H;  3CP0 A;  1EYA A;  2JA9 A;  1ICW A;  1YHQ A;  4P71 A;  1QG7 A;  2MJ8 A;  2PI2 E;  1NJI C;  2WAQ G;  4BY1 G;  4JVZ A;  2YU9 B;  1Y1V B;  4CKB A;  2K50 A;  3QWN A;  4P74 A;  4KD4 A;  1SRU A;  3AU7 A;  4X3U A;  3CXC A;  5LHY 1;  1Y1W B;  2UUB Q;  2JA5 B;  4PZ7 A;  1PH3 A;  5C4J B;  1NMG A;  3SK4 A;  2B2V C;  1CKO A;  4YHH L;  4BY7 H;  1E7Z A;  4QIW E;  1IBM L;  3BYT B;  3H0G H;  1A8V A;  2B63 B;  1TS2 A;  2QDB A;  4FNF A;  1A3T A;  1G6Z A;  4JI0 Q;  5FO7 B;  4RKB A;  1TWA B;  3C2P A;  4GLA C;  1VQP A;  2L5T A;  1CKN A;  4OWW B;  1OXX K;  1I6V C;  1F77 A;  2BE5 D;  3A54 A;  3AB9 A;  1CA5 A;  3DWA A;  1KLG D;  1KDA A;  1TQO A;  2RSN A;  3RR5 A;  3GTQ B;  3DUZ A;  2QW7 A;  2CQA A;  2WB1 E;  1IBL Q;  1EQQ A;  4RHR A;  1DOM A;  1LUZ A;  3UDI A;  5HGT A;  1Y8P B;  4A3M B;  4MNO A;  1HTL D;  4DV5 L;  3K58 A;  3BVG A;  3K7A H;  1L0X B;  4OIK A;  1J9O A;  3EBE A;  1B50 A;  1Q81 C;  1LTI D;  5FLM G;  2VNU D;  4C1N K;  1G6P A;  1LT3 D;  2A6E C;  1YIT A;  5J22 A;  4L5T A;  5IGG A;  4DK3 C;  4IUT A;  1C4Q A;  1HTP A;  2WAQ E;  1H9R A;  4DUY L;  3RD4 A;  2MO1 A;  1T5E A;  3CC4 A;  3M3Y B;  1E2V A;  4HIK A;  1V1P A;  2IL8 A;  2WAC A;  5IYD G;  3GTG B;  2B8F A;  3TP7 A;  3NWT A;  3U9O A;  2LS0 1;  4OO1 H;  4DAM A;  2HD3 A;  2TMP A;  3RLN A;  1K28 A;  1CSQ A;  3S1M H;  4JV5 L;  3NHH A;  1ONL A;  3K5M A;  5IGB A;  1I4Q A;  1EY5 A;  2A1A A;  1IBK L;  1KNA A;  4G7H C;  1WTX A;  1H95 A;  4JOI C;  5GAH C;  5IT9 L;  4RKL A;  4A3I B;  2L55 A;  4J8Q A;  1DZ1 A;  1HQM C;  1BNZ A;  4LAA A;  2VW9 A;  1EFI D;  4UPA A;  4IPD A;  4X65 L;  4P75 A;  1X6O A;  3U4Z A;  2F0Q A;  3TBI B;  5A2Q L;  2ZXO A;  1K8G A;  1LTA D;  4DK1 A;  1AZP A;  2XGT A;  2OWO A;  4UP9 A;  2ICE C;  3FEW X;  3A56 A;  1SYF A;  2WIN B;  2VB2 X;  3J81 c;  4K5W A;  2WKC A;  4A3D B;  3G4S A;  4DR4 Q;  2FMC A;  4JI1 Q;  4OEL B;  3TP6 A;  2E2J H;  3QIA A;  3H3V I;  1VQM A;  5GAD C;  2I5M X;  4FP5 D;  4HN7 A;  2NTT A;  2YTV A;  1PH2 A;  3TP5 A;  1HXY D;  2IW3 A;  4DR1 Q;  1X3P A;  2CWA A;  3VA7 A;  3DM1 A;  3BZC A;  3SE0 A;  3LGJ A;  1QNU A;  4BWG B;  1EZ8 A;  4LUO A;  4QUF A;  1QVF A;  3JAM E;  2K5D A;  4MTN A;  2BE5 C;  3F1Z A;  2MP1 A;  4G4K A;  4B3T L;  3R3O A;  3CCE A;  1R9T B;  2B2W A;  4HSV A;  3PUZ A;  4G7Z C;  1G8Z D;  2E5L Q;  2F03 A;  4K6D A;  1JOO A;  3TEH B;  2JN4 A;  3T1Y Q;  3N52 A;  1HQR D;  4J1M A;  1I6H B;  4DAP A;  1IL8 A;  2VUM B;  2L0C A;  4HIM A;  2EYL A;  2HCI A;  2IWH A;  1KAB A;  3ZYY X;  3J80 E;  3FP9 A;  1VQG A;  2F0S A;  4BBR H;  1Q82 C;  4GN3 B;  3J7A F;  1U0L A;  1B70 B;  3I7F A;  4QY7 A;  3D4W A;  4R9W A;  2DJG C;  3GTO B;  2IY5 B;  3F8T A;  1NMF A;  2BDO A;  5CGK A;  5C44 G;  5EBC A;  2R92 G;  3HOZ H;  4DR5 L;  4C3J B;  5C4X B;  1PRT F;  3LWU A;  1PH7 A;  1O7I A;  1YNN D;  4IAL A;  1S5F D;  4GOP A;  1I50 B;  4A4I A;  4ZAI A;  1Q86 C;  3S15 H;  1Q3L A;  2VL6 A;  1VQ7 A;  1EEI D;  1VQH A;  5K5P A;  4K0K Q;  2WV6 D;  1MGS A;  1JOK A;  5G3L D;  3QB3 A;  2R61 A;  3GQB A;  1KNE A;  3DMU A;  2ZXR A;  2SNS A;  4F87 A;  2Q8I B;  2QDL A;  2A6H D;  1VQ5 A;  2ZTD A;  4ZQ3 A;  1XPO A;  1K83 H;  4NMZ A;  2Z6K C;  3I4M B;  4EQN A;  3MEF A;  3R2I A;  3S1R B;  2WFW A;  4BS9 A;  4A3E B;  1BXT A;  2JK8 A;  1S72 A;  3NBH B;  1EL0 A;  1C0A A;  5CR3 A;  4F8M A;  5DAU A;  1KC8 C;  3EJI A;  2K01 A;  1I5F A;  2DUD A;  4DUZ Q;  4R8I A;  3W2D A;  3PUV A;  2Y0S G;  4EGV A;  1K3R A;  5LL6 S;  3PO2 B;  3E3X A;  1WTP A;  1XNQ Q;  4ABN A;  3AQQ A;  3ND9 A;  4DKA C;  4MTK A;  1V43 A;  2PO4 A;  1IKL A;  1CFM A;  3K5L A;  2YYZ A;  2NN6 I;  2PQA A;  1M1K C;  3WOE A;  4PG3 A;  4XQN A;  1HHV A;  4DN4 M;  4L6T B;  5E4W C;  1I4R A;  5KYL A;  2X69 A;  1PH4 A;  3JC6 6;  4GKK L;  3CF5 A;  3F2B A;  1QCB D;  1TWG B;  2ZXP A;  2PPB C;  5C0X H;  4UDU C;  2C5C A;  2A68 D;  3H3V C;  3GP7 A;  3HKZ E;  4J6H A;  1KDC A;  1QUQ A;  3A7L A;  4ZLT F;  2UUA Q;  3NPP A;  1VQL A;  3AMU A;  2QA4 A;  2O5J C;  1HRJ A;  2YU9 H;  1Y1V H;  5KNB A;  1ENA A;  4H02 A;  2JA5 H;  2L12 A;  1QZG A;  2EVB A;  4F88 A;  4H0L C;  2K5W A;  5C4J H;  1TVX A;  1JMC A;  5CBA E;  1HNZ L;  3PUW A;  4ZUJ A;  3OTO Q;  2BCO A;  2RDF A;  1EIF A;  1S5E D;  1ZYR D;  3AYH B;  2KEN A;  1TWA H;  1EQV A;  2DNC A;  3H0G B;  1K9M C;  3UE1 A;  1TXY A;  3MEH A;  1HNX Q;  1QOH A;  2F0D A;  2L9H A;  3GTQ H;  4XXE A;  4CDC C;  5IYB G;  4R4C A;  1N36 Q;  2R93 G;  3FMC A;  1EYD A;  5M5Y B;  2O4X A;  1YNN C;  4A3F G;  5IGC A;  2K04 A;  1EY7 A;  4A3J G;  4KMU C;  2HUG A;  4O2D A;  2KCT A;  4R4Q A;  4HJA A;  1PA6 A;  5HGQ A;  3LWE A;  1CK1 A;  1RDP D;  2OXP A;  2J0T D;  2HCC A;  5EPJ A;  4LNQ A;  4OWT B;  1AH9 A;  4C2M B;  2V4D A;  1BCP B;  1DM0 B;  3G6E A;  3DEO A;  1RIP A;  1TII D;  1VMC A;  1A15 A;  2A6H C;  1BOS A;  5JVH 3;  3KJO A;  5JJI A;  1AP0 A;  3MFY A;  3M3Y H;  2SNM A;  2VQE L;  1EQT A;  3GTG H;  5J3B A;  1BF4 A;  3GO5 A;  2EXZ A;  2K03 A;  3I3C A;  4DAY B;  2B2V A;  1PH1 A;  2E75 C;  1XTC D;  3I4N G;  1VQE A;  2DNE A;  2E8G A;  1SJH D;  3MXN B;  4L63 B;  2F0M A;  2I07 B;  3CME A;  3UDG A;  2B2W C;  2LSS A;  1G51 A;  5T1I A;  1LAC A;  4X66 Q;  1JCK B;  1MJC A;  3S1M B;  4DV3 Q;  3HG9 A;  1EZ6 A;  3STB D;  3L9A X;  3U50 C;  3PF4 A;  1SLJ A;  1C9O A;  3RN2 A;  1TY0 A;  3TME A;  4OO1 I;  4J15 A;  2PMZ E;  3ITP A;  4JI8 L;  3HOU H;  1ILP A;  1GKH A;  1WTO A;  1X9N A;  4K5V A;  2IX3 A;  3K80 C;  1KAA A;  2BA1 A;  4P72 A;  1XMQ L;  1VCI A;  1EOV A;  4CHT B;  3JAM L;  1KLU D;  4O42 A;  3Q6S A;  1I94 L;  5IWA Q;  1GHJ A;  4CJ0 B;  2R7F A;  4DV4 Q;  1VF7 A;  4A3D H;  1B3A A;  4NW2 A;  4DR6 L;  2F4V L;  4F7X A;  2CWP A;  3URY A;  2Z9H A;  4A3C H;  2Z6B A;  2F4V Q;  2EYO A;  2JA6 B;  5EKL A;  5F2D A;  1ZYR C;  1F9Q A;  4YWM A;  4K8J A;  3TSS A;  1N34 Q;  2E2J B;  3J80 L;  4RAU C;  1ET6 A;  1BVS A;  2EY6 A;  2CH4 W;  1GUS A;  3EIV A;  1O78 A;  3ND8 A;  4ME5 A;  3MFG A;  4AYB E;  1PXU A;  1R9T H;  2LKV A;  4C3H B;  1I4X A;  1MKH A;  3W5O A;  4I65 A;  1I6H H;  1BKB A;  2VUM H;  1EEF D;  3PGZ A;  5EQ0 A;  4NXN L;  2N88 A;  3UDF A;  1PV4 A;  4DF7 A;  4DNT B;  4WJ4 A;  2A74 C;  2G9H D;  3FDT A;  3KLW A;  5LMN W;  2V1C C;  3CCL A;  3FKI G;  3ICE A;  3GTO H;  5E3F A;  2F0I A;  2N55 A;  4BBR B;  5JEA J;  4DV0 Q;  3GTK H;  2K1B A;  3HOV G;  1G2T A;  5J1Z A;  3L7Z C;  4JYA L;  4A3L H;  4JW0 A;  3I72 A;  5JOB A;  3X3N A;  2KUM A;  1BO0 A;  4KLK A;  4LFC Q;  2XRQ D;  4C3J H;  5IP7 H;  1X3G A;  4IJH A;  5C4X H;  1OO9 B;  3HOZ B;  4C1N I;  1WYD A;  1I50 H;  3S14 H;  5KEE A;  4A3K G;  1HR0 W;  3NWS A;  4OEM B;  4CJ1 B;  4LFB Q;  4QIW B;  1RJT A;  4O1N A;  1EWH A;  1TS5 A;  1PFB A;  4LF5 Q;  2D62 A;  2DJF C;  2E74 C;  1JOQ A;  2EY1 A;  2ZM6 L;  2AQ2 B;  3T56 B;  2HHH L;  5IP9 G;  4DR2 Q;  4WJ3 M;  4MHE A;  4DV7 L;  1EY9 A;  2QEX A;  1NSN S;  3K0X A;  1PZK D;  1H9M A;  1LTG D;  3ONA B;  3R93 A;  3BG3 A;  2F0P A;  1A62 A;  4IUN A;  2RA4 A;  3I4M H;  3OSO A;  1BUV T;  1NUC A;  1JC7 A;  1T9H A;  2ICI A;  4GNX B;  2EZV A;  4A3E H;  3KBG A;  5FLX L;  4DR3 Q;  3OWE B;  2UXC Q;  3STB C;  2KEE A;  1Y69 U;  5K36 G;  4R4T A;  1ZKO A;  2QEJ C;  1GVP A;  2A19 A;  1TKW B;  3C46 A;  4M8A A;  1IKM A;  3VYS A;  3PO2 H;  4POF A;  2NZH A;  1BDO A;  4ZCK A;  3PO3 H;  5C3E G;  4K14 A;  3CRK C;  1W6J A;  2TSS A;  4X62 L;  1SNM A;  1K8O A;  2Z8L A;  2Z4H A;  1EY0 A;  4GS3 A;  1FJG Q;  1DCZ A;  4A3G G;  3SR1 A;  2VS1 A;  4ILW A;  1VQJ A;  3DWQ A;  2G9D A;  4KKT A;  4NB3 A;  1CHQ D;  4OGQ C;  5CV4 A;  2UXD Q;  3J7Z C;  1RHP A;  4QQB X;  4PZ8 A;  2EYP A;  1LYL A;  2K05 A;  4XYO A;  1TWG H;  4FF3 A;  4IOA A;  4HJ9 A;  3OMG A;  2UUC Q;  1RTN A;  1YIJ A;  4WRD A;  3RNU A;  1QE6 A;  2UU9 Q;  4JI4 Q;  1D5M C;  3CW2 C;  1GUT A;  5JPN C;  1PFN A;  2F0O A;  2K5H A;  4UY8 C;  1DJR D;  1C7Y A;  1ASZ A;  3VR6 A;  4WJW A;  5C5L A;  4ID6 A;  4BBS G;  4G57 A;  5L37 A;  4Y52 H;  3HGB A;  2WII B;  2Z6K A;  3T4A C;  3V96 A;  2O2L D;  2K7V A;  4C3I G;  2JP1 A;  4DV1 L;  5C0X I;  4YHH Q;  1PHJ A;  3GTJ B;  2ES2 A;  4IZ8 A;  4HSP A;  1WTV A;  1IBM Q;  2KED A;  4GLV B;  1FD7 D;  5GRO A;  3J80 i;  1YHB A;  1IZ6 A;  1GXD C;  1WTR A;  1STN A;  1SNC A;  4A75 A;  3S2H B;  1HNW L;  1S4Z A;  5JEA G;  3FPP A;  2EXD A;  4RGM A;  1S5C D;  4R1J A;  1B9N A;  5M5Y H;  5DLQ E;  1X54 A;  5KGU A;  5CV7 A;  2Q8T A;  3HOX G;  3CD6 A;  1QVG A;  1TY2 A;  4HJ8 A;  1HH2 P;  1WTQ A;  3E9H A;  4IUP A;  1WI5 A;  1NE3 A;  3CC2 A;  2AUK A;  2PZT A;  1W3S A;  1WD0 A;  4C2M H;  2NYZ D;  1AFP A;  4NDX A;  2H4O A;  4DV5 Q;  1GOZ A;  1LTT D;  5EKI A;  3QOL A;  4LF8 L;  1Y1W G;  2A69 D;  3ULP A;  1JB7 A;  3HP3 A;  3C1F A;  3K5N A;  4PQX A;  1VF5 C;  1LTR D;  3BJU A;  2K32 A;  3KDF B;  1ROD A;  3EFX D;  5EKK A;  1GO3 E;  2K5Q A;  1D5X C;  1STG A;  3K59 A;  4UP8 A;  2B63 G;  1PYW D;  2N49 A;  1ESR A;  4LF6 L;  4DUY Q;  2N8N A;  1UNS A;  5LMN L;  3HS0 C;  1LTS D;  5E1F A;  3S2D B;  1SND A;  1TU2 B;  4NPS A;  4XT1 B;  1CSP A;  3CCM A;  1QIL A;  5DEH A;  2AKW B;  1F2Z A;  1PH6 A;  5IYC H;  1HJP A;  1JB3 A;  2D9U A;  1V9P A;  3CAM A;  1S40 A;  4HED A;  3BYY B;  4KKS A;  3H09 A;  1HR0 L;  2XWB B;  4QMG A;  4IPC A;  4Z9C B;  4JV5 Q;  1HR0 Q;  4IOC A;  4IFD H;  1IBK Q;  4LUV A;  4A3M G;  4HMJ A;  1S5D D;  4JBJ A;  1CKN B;  1SSO A;  1RKN A;  4IUV A;  3BZK A;  3A8J E;  3H6M A;  4QL5 A;  4P2C B;  3W1B A;  4X65 Q;  1K0S A;  1XXG A;  3OHX C;  4UHV A;  4NXM L;  3HOU B;  1YBY A;  3PCO B;  1V8Q A;  3M4P A;  1Z6H A;  1PTO F;  1VQA A;  1PFS A;  2OQ0 A;  4JI6 L;  2F0L A;  1SXT A;  1KD1 C;  3B6Y A;  4MN3 A;  1PZI D;  4FF2 A;  5IT9 c;  3E9I A;  3NEN A;  2JA6 H;  1UE6 A;  2RQX A;  4B9W A;  3CCQ A;  1A2T A;  4A93 G;  4B9X A;  4KI0 A;  1XPU A;  1M4V A;  5JJZ A;  1MJE A;  1SDF A;  3EN2 A;  2JSO A;  2M2L A;  5ISR A;  5D14 A;  1I4H A;  2FFK B;  4ZRZ A;  2NWG A;  4C3H H;  4LK1 C;  3SK5 A;  5C44 B;  4B3T Q;  5GAE C;  2R92 B;  1E2W A;  2YV5 A;  4A3I G;  3HOW G;  2F1M A;  2RCN A;  1UE7 A;  3Q8D A;  4ZK9 B;  3NBH A;  1RD9 D;  3NTK A;  1MSH A;  2B2U C;  4EX5 A;  1E1O A;  3HOY H;  4U67 3;  2AQ3 B;  4RGO S;  2J7Z A;  1GD7 A;  4BXX H;  5IGD A;  2CH4 A;  2IPK D;  2K5N A;  2L4N A;  4N9T A;  3VA5 A;  1E24 A;  2EDG A;  1PZJ D;  4DNR B;  3GTK B;  1RL2 A;  2A69 C;  1K73 C;  5M3M G;  4FXD A;  5FJ8 H;  5I2Y A;  1A2U A;  1SNP A;  5BN3 A;  1HUM A;  1PH9 A;  5E7N A;  3OWF A;  4KN4 C;  4DR5 Q;  3A55 A;  3DXJ C;  3BZD B;  3S14 B;  2EE1 A;  3U4V A;  2EY2 A;  3VYR A;  2F3I A;  2UXB L;  3KF6 B;  3HKZ G;  2FIN B;  2F4I A;  2Y0S B;  2BH2 A;  4FXK C;  3V2T A;  4IUU A;  4ZKC B;  3PIO 3;  3Q23 A;  1J5E L;  4B3R L;  4JI5 L;  4QF4 A;  3GV3 A;  3NSW A;  4ME3 A;  4L5S A;  3MXP A;  1SE4 A;  4U68 A;  2X6G A;  5I9P A;  3Q22 A;  4XYQ A;  3PIP 3;  1QNK A;  4A76 A;  5M3F G;  2PQE A;  3G6J B;  2C35 B;  1YJW A;  4KV6 A;  3MXU A;  5BN4 A;  3HRZ C;  1VQF A;  2YTX A;  4CJ2 C;  2F0H A;  2EQS A;  1LT5 D;  1RCV D;  4KY5 A;  4K5X A;  5HY6 A;  5I4D A;  1EOT A;  3F2D A;  5IIF A;  3OPO A;  4FXG C;  2Z1C A;  3TN2 A;  3TS0 A;  3PO3 B;  1U5K A;  3D6W A;  2I5H A;  1NTG A;  4BY1 H;  2NVX H;  1BR9 A;  4RGN A;  1LO5 D;  5CMD A;  1VQO A;  5ELC A;  5FLX E;  3NEM A;  5JVG 3;  2C9O A;  5CV6 A;  1IYU A;  4RH6 A;  3SXH A;  4A3B G;  1X3E A;  3OYY A;  3P1H A;  2R6G A;  2GVB A;  1PYB A;  1E22 A;  1JT8 A;  2JA8 G;  5FK9 C;  4GKK Q;  1EY8 A;  1WFQ A;  5COR A;  1LAB A;  4QUC A;  5KNC A;  4GLX A;  1E2Z A;  4KN7 C;  2R7Z G;  2OTJ A;  2IHF A;  1B2T A;  4JI3 L;  2NN6 G;  1H9S B;  1X55 A;  3IFD A;  4JI3 Q;  1VMP A;  3CPF A;  4JI7 L;  1SBB B;  3IL8 A;  4A3F B;  1X65 A;  3GTJ H;  4XTC S;  4A3J B;  4OX9 L;  2F3W A;  1HNZ Q;  1SN8 A;  3M85 A;  2B2T A;  5GQO A;  5LL6 X;  4LFA L;  3H15 A;  3FPU B;  1UUP A;  3S2H H;  3DLL A;  1Q90 A;  4HID A;  2EJG C;  4DAY A;  3SK6 A;  5FLM H;  1L1O B;  3IFT A;  1I4G A;  2F0E A;  4LJZ C;  2RF4 A;  4Y7N B;  1FVI A;  4IFD J;  3KUP A;  1YEZ A;  1BBW A;  3MXN A;  3I4L A;  1FNW A;  1QZH A;  4WOR A;  2NZO A;  4CKE A;  1J8I A;  4MIU A;  5EBD A;  1SE8 A;  2P5Z X;  1UAP A;  2JA7 G;  1TWF H;  2FHT A;  2WKD A;  3G7L A;  1XMO L;  4PV1 C;  4LF4 L;  3M7N A;  4PZ6 A;  4HCE A;  3BU2 A;  1Z47 A;  3I90 A;  3GTM H;  1PRT B;  1LV9 A;  5IYD H;  5T1G A;  1WCM G;  4BA1 I;  1U4P A;  1L2F A;  4JI2 L;  2OEO A;  1DOL A;  3KF8 B;  3BVZ A;  1JIC A;  1KXL A;  4GZY C;  1OXV A;  2K33 A;  2QGQ A;  3NUC A;  3I4N B;  3PUY A;  4HCS A;  4YY3 L;  2KCM A;  4GKJ L;  5J39 A;  3PF5 A;  1QVC A;  1SAP A;  1YNX A;  1B44 D;  3F2C A;  3CRL C;  4IJL A;  1SFO B;  1W2B A;  1HA5 A;  2EJF C;  4ULL A;  3T51 B;  1VQ8 A;  3P75 A;  5ELO A;  1JWM D;  4FF1 A;  4BY7 G;  4RFB A;  5FOB B;  3E5S A;  1YHA A;  2D0P A;  3P7J A;  3H0G G;  2KVM A;  2VQE Q;  3S2D H;  1LLR D;  4FDB A;  5AJ3 L;  1XYI A;  3A8K E;  3NEL A;  1Q1B A;  4GN5 A;  3D8G A;  1UEB A;  1ILQ A;  4AYB G;  2BDN A;  1BCP D;  1CHP D;  1F9P A;  1ICF B;  1KRT A;  1B9M A;  4IPH A;  4IO9 A;  3R2T A;  3CHB D;  4KHZ A;  5DM7 3;  3SK8 A;  5I2X A;  1C8C A;  1OTC A;  2XSC A;  3G71 A;  4YCV A;  2KHI A;  2B8G A;  2D0O A;  1CKM A;  1KL9 A;  2EY5 A;  4FO2 A;  4ZUI A;  5D65 A;  4B3S L;  4V19 0;  4PNY A;  4RA8 A;  1K8M A;  1KIX A;  4B3S Q;  3L3O C;  4YCW A;  1JE4 A;  5C6A A;  1EU4 A;  3CMA A;  4LF7 L;  2PW7 A;  1A6X A;  2R3Z A;  3ER0 A;  3NK9 A;  3SEB A;  2NVQ B;  3RLF A;  2PCF B;  1U9R A;  2H1E A;  1GUW A;  2LFN A;  1W6K A;  4RGT A;  3AFP A;  2RHS B;  4FF4 A;  2ZJQ A;  1MIU A;  3PV0 A;  4IUQ A;  2WP8 J;  4JI8 Q;  2OT2 A;  3I91 A;  1XMQ Q;  2J4X A;  4IFD I;  2CHB D;  1B53 A;  3MTS A;  2PYK A;  3H91 A;  5EAY A;  1U4R A;  1ESF A;  4ODG A;  2KQ3 A;  1I94 Q;  3MC0 B;  1EY4 A;  5EGT A;  3K0Y A;  1CQF A;  1O7Z A;  4WFN 3;  2NZ1 D;  4JBM A;  4DR6 Q;  2PNH A;  4L5R C;  4OO1 G;  2EPB A;  3D6C A;  4HJ5 A;  3FKI B;  2RBM A;  4I7Z C;  2AQ1 B;  3T1H L;  1PMR A;  1FGB D;  4DU9 A;  4IUR A;  1SE2 A;  3A5U A;  5C44 H;  2R92 H;  3DEP A;  5I6W A;  3FVQ A;  3J81 E;  4YWK A;  4LUZ A;  2BH8 A;  2Q2I A;  3WWV A;  2K52 A;  2VY3 A;  2Q8R E;  4DV6 L;  4A3K B;  5BR8 L;  1DON A;  1N9W A;  2OTL A;  2PW5 A;  2M00 A;  5CV9 A;  1U4L A;  3CCR A;  4NXN Q;  3J80 c;  3TP8 A;  5C4Z A;  3D0F A;  4JPB W;  3ZJY C;  3TRE A;  2OQK A;  4LW1 A;  3E0J A;  2AWN A;  3J7Y W;  3HOY B;  1CQV A;  2NB0 A;  4I7A A;  5M5X B;  3M4O B;  5IOC A;  2O5I C;  1SEB D;  2QF7 A;  3C1E A;  4DV2 L;  4JYA Q;  3D4D A;  4HR7 B;  3K81 C;  2CFM A;  4Q5V A;  1O80 A;  1WVL A;  4B3M L;  1MD2 D;  1NAP A;  1NNX A;  5CYU A;  1Z7T A;  5C0X J;  1V1Q A;  1SRO A;  3S1Q B;  4DXF A;  4HMI A;  1LT4 D;  4XT3 B;  2EIF A;  4NKL A;  3ULL A;  2ZM6 Q;  4PMB A;  2HHH Q;  1JE5 A;  3GTL B;  3MVV A;  1ZXT A;  4LF9 L;  1JOR A;  5CBE E;  1BCP C;  2KJX A;  4X3S A;  4DV7 Q;  1P16 A;  2E76 C;  2NVY B;  3FHW A;  5C3E B;  1E1T A;  1I4P A;  3N6R A;  3KBX A;  4TRD A;  5KIX A;  1JJC B;  1AEX A;  1JJG A;  1F9R A;  5JPM C;  1N33 L;  4A3G B;  3MA2 B;  3TS2 A;  2WB1 B;  4X64 L;  3OW7 A;  3VDY A;  1N32 L;  2VQF L;  1XTD A;  1PFM A;  4P73 A;  2B2T C;  3W1G A;  4X6A H;  5KND A;  2I5L X;  4OHJ A;  2NVT B;  4BBR G;  4KY7 A;  3VR3 A;  2K28 A;  5CV8 A;  1S5B D;  4TVA B;  2B2U A;  1X3Q A;  3HOZ G;  1PTO H;  3LX0 A;  4X62 Q;  4CGY B;  4L8J A;  3E0E A;  2WAQ B;  3W3A A;  4QGU A;  4BY1 B;  2NVX B;  4R4O A;  3MHB A;  1A3V A;  4BBS B;  2PZU A;  2MNA A;  1Y8N B;  2AUJ D;  5M9O A;  2IJ0 A;  4C3I B;  2F3V A;  1QB5 D;  4LMQ D;  4KY6 A;  4G7O C;  2LMC B;  4DR7 L;  1L0Y B;  3Q24 A;  3NE5 B;  3S16 B;  4LWC A;  1JR0 D;  3K6O A;  3JAM i;  2HT1 A;  5IYB H;  1YI2 A;  3UDX A;  2R93 H;  4AQY L;  3ULJ A;  3AFQ A;  4A3F H;  4APV A;  1X56 A;  3KDF A;  3HOX B;  4A3J H;  1SE3 A;  3KJP A;  1TWH B;  2E2H B;  1JWS D;  5H1S E;  2EYM A;  2N3S A;  3NP8 A;  1STB A;  1EUJ A;  4OON A;  4H13 C;  2RVL A;  1D6E C;  2IHE A;  1O7Y A;  5NUC A;  3I73 A;  4DFA A;  4DV1 Q;  4POG A;  1U4M A;  1M8A A;  4Y7N H;  1DOK A;  4R8N A;  2QKI C;  3PIP A;  1B3Q A;  2LXK A;  3KLS X;  2F0F A;  2F52 A;  2UUB L;  1HNW Q;  2Z4I A;  3MWY W;  1UE1 A;  1Q8K A;  2A73 B;  2VXW A;  2KA7 A;  1EIG A;  3NQI A;  1NR2 A;  2EYJ A;  4DAV A;  1VQ4 A;  1TWF B;  4JI0 L;  3M4Y A;  3K57 A;  1II3 A;  5C0X G;  3GTM B;  1IW7 C;  5C3W A;  4K2L A;  1Y8O B;  1FGU A;  3I4N H;  5FKA C;  1B1Z A;  1CZG A;  1RTO A;  2IX0 A;  3WDN A;  1Y1V G;  1LTB D;  4KHV A;  2K6A A;  1SFO H;  1GHK A;  2D5D A;  1IBL L;  3PSI A;  2JA5 G;  3J7A V;  5E4X A;  4LF8 Q;  4DGZ A;  1H9K A;  1CZW A;  4HAE A;  3GDE A;  4XIG S;  3EQL C;  2ZT9 C;  4N8X 1;  2JYO A;  2Q2U A;  1SYG A;  2DY7 A;  3J7A 5;  1PDQ A;  2FXQ A;  1FL0 A;  5G3L F;  2XRS D;  4LF6 Q;  5LMN Q;  4EQP A;  3TZU A;  3H94 A;  3MZ5 A;  1IYJ B;  3HEJ A;  1JJ2 A;  4IN3 A;  2B39 A;  5KYI A;  1SYE A;  1P8L A;  1PVO A;  1AZQ A;  1HZ9 A;  1UE5 A;  4GNX C;  5M5W B;  1OXU A;  2FMM A;  1XPR A;  1L0W A;  1KQS A;  1ZEQ X;  5I9O A;  2RDH A;  1E3P A;  5BN5 A;  1CT1 D;  3D3R A;  3P20 A;  3NBI A;  2NVQ H;  2NUC A;  4HTH A;  1KTK A;  4A93 B;  2ZTE A;  3F2U A;  3L0O A;  5AFW A;  1NBW A;  1TT2 A;  2NBF A;  1MBY A;  3VR4 A;  3KK7 A;  3ERO A;  1DXM A;  4NXM Q;  4N8F A;  2E2D C;  3L2P A;  2E2I H;  4JI6 Q;  5IY0 A;  3J81 L;  3VYU A;  1STA A;  5ELB A;  3HOW B;  4YCU A;  4O0A A;  3DM3 A;  3KFU A;  1SR3 A;  1AE3 A;  5C3X A;  3FKI H;  1DGS A;  2ALY B;  3KF6 A;  4DNI A;  2OF1 A;  3HOV H;  4JCV E;  1HCZ A;  3A7A B;  2VZA A;  2AHO B;  1HFG A;  4KJO A;  5DNF A;  4CDD C;  2K5V A;  3M4Q A;  4DR4 L;  5COY A;  1V1P B;  5M3M B;  4JI1 L;  1DD2 A;  3RZO H;  1SMY D;  4A3K H;  3S1N B;  2Q2H A;  2I46 A;  2PZW A;  1GM5 A;  4ZKB B;  4DR1 L;  3NXW A;  2F0V A;  2JE6 I;  3HFZ B;  4RCN A;  5IOD A;  5IP9 H;  3HOU G;  4AH6 A;  1VQI A;  3HKZ B;  2BA0 A;  4K8I A;  1MHW C;  5IE8 A;  5M5X H;  3M4O H;  1CI3 M;  2HQL A;  1YVC A;  1X32 A;  4YIJ A;  2E5L L;  4K2K A;  1E0B A;  2QCP X;  3T1Y L;  3GTP H;  1A63 A;  4KD3 A;  1SNO A;  1FYC A;  4A3D G;  1X3F A;  3CPW A;  1YNJ D;  2N78 A;  3CCU A;  2KCN A;  5M3F B;  2EYH A;  3EVQ A;  1OXS C;  4QB4 A;  3V05 A;  2RCF A;  4A3C G;  5K36 H;  3T16 A;  2HIV A;  3S1Q H;  1IYV A;  3K8A A;  1GJX A;  2ATW A;  5ELE A;  4DPG A;  3OW2 A;  3GTL H;  2UXB Q;  1VQB A;  1AE2 A;  4EQO A;  1XX8 A;  2NVY H;  3OOC A;  5C3E H;  2ZJP A;  4S3S A;  1J5E Q;  4B3R Q;  4JI5 Q;  4A3G H;  3VR2 A;  2JEA I;  2VUM G;  3MAQ A;  3OIP A;  2RSO A;  2CCZ A;  4YWL A;  1H9S A;  4X3K A;  4K0K L;  1XJV A;  2EYF A;  3RMH A;  3S17 B;  2SDF A;  2NVT H;  4A3B B;  1R4P B;  1SJE D;  2K75 A;  1BCP F;  2MFI A;  1ET9 A;  3J81 j;  4CKC A;  2B2Y A;  1VS0 A;  1LTL A;  1EQR A;  2JA8 B;  1D2B A;  1EWI A;  1YZ6 A;  1NCV A;  4KJN A;  4A3L G;  1M90 C;  3ERQ A;  5JJL A;  4C3J G;  1IL2 A;  5IP7 G;  2R7Z B;  5C4X G;  1FNV A;  1L1O A;  4E6I A;  2XN9 C;  3M9B A;  1PTO B;  1PH8 A;  4BBS H;  2HDM A;  4DUZ L;  1WD1 A;  1TWC B;  5I6Y A;  1HFN A;  1GUG A;  3DWP A;  4JK1 C;  2K14 A;  2ZTC A;  4C3I H;  1XNQ L;  1AN8 A;  4ALP A;  2OCE A;  3CQZ B;  3TRZ A;  1Z9F A;  2SEB D;  3I56 A;  4OIJ A;  5DM6 3;  3QG1 A;  4HJ7 A;  5A35 A;  3S16 H;  1MSG A;  4PMC A;  3KF8 A;  2HIX A;  4JBW A;  2L11 A;  3RZD B;  3I4M G;  1H9J A;  5JEA H;  1G2S A;  5EPL A;  4GOP B;  2MUY A;  1PTO D;  2CW0 D;  3PMF A;  4A3E G;  1D1I A;  4X3T A;  3HZX A;  1PLF A;  3CU7 A;  3O13 A;  3HOX H;  2MHV A;  4JBK A;  2F0U A;  1SMY C;  1B7Y B;  1STE A;  1TWH H;  3J81 i;  3BS1 A;  2E2H H;  3IAY A;  3M7G A;  1Q46 A;  2JA7 B;  2CKZ B;  1Q7Y C;  3I4O A;  2R93 B;  1T5X D;  3PO2 G;  1KHI A;  3A8I E;  4JI7 Q;  2AMC B;  2F0N A;  2LXJ A;  2PMZ B;  5FO9 B;  1B8A A;  2UUA L;  4OX9 Q;  2SOB A;  1HZA A;  1WCM B;  1HPC A;  3CCS A;  3PO3 G;  1I3Q B;  3QR8 A;  2BOS A;  1IHZ A;  2F0J A;  4MZ9 A;  1KRS A;  4LFA Q;  4CDF C;  4KHP L;  5GAG C;  2B29 A;  1TS4 A;  4KHP Q;  1Y1W H;  5IGE A;  1ENF A;  2M9V A;  4UP7 A;  1Q8I A;  2KEC A;  3K7U C;  1YNJ C;  3OTO L;  2RDG A;  1G91 A;  2F0K A;  2B63 H;  2KHJ A;  4XQQ A;  5LMU L;  4N9P A;  3TQY A;  3BDL A;  2JQO A;  4BY7 B;  5LMU Q;  2Z0S A;  2DY8 A;  1XMO Q;  4LF4 Q;  4KTA A;  1WTH A;  1HNX L;  4HIO A;  2B3G A;  1VQN A;  2Y0S E;  1VQ9 A;  4TKO B;  1GUO A;  1Q12 A;  3RLO A;  1ASY A;  2PQA B;  3ERS X;  2GVA A;  4JI2 Q;  3MXG A;  4AYB B;  2RKS A;  3D31 A;  1MI2 A;  5CV5 A;  1N36 L;  5TSS A;  1S3O A;  3A0J A;  4YY3 Q;  4GKJ Q;  4CBV A;  1NR4 A;  1O7L A;  4KK7 A;  1WJJ A;  4A3M H;  4OL7 A;  3EA6 A;  1PRT D;  3NTH A;  2XWJ B;  5EJW A;  1HZC A;  1QUQ B;  3RUZ A;  1B4O A;  4B08 A;  1STH A;  3I55 A;  1N8R C;  2ENB A;  1F2M A;  1KAW A;  5HUR A;  4XQJ A;  1JQY D;  3K7A B;  5AJ3 Q;  1OXT A;  2EOT A;  4TSS A;  1EWC A;  4NP5 A;  1SYB A;  4EQ5 A;  5IGF A;  4M1U B;  1HZB A;  2KBN A;  5M5W H;  3DHQ A;  5FO8 B;  4Q0F A;  1NY4 A;  3A74 A;  3GV6 A;  1BQQ T;  3BDC A;  4DK6 C;  2DGY A;  5ELD A;  3K5O A;  4RHS A;  4C56 C;  1WTW A;  4A93 H;  4H7B A;  3QOJ A;  4XDX A;  3FRP B;  2LY7 A;  1HUN A;  1AW7 A;  3SDZ A;  3SGI A;  1VQ6 A;  4LF7 Q;  4IPG A;  3CCJ A;  2ASB A;  3G48 A;  1D1K A;  3R8B A;  4X66 L;  3U58 A;  2GN5 A;  4DV3 L;  2XNA C;  2PI2 A;  4DXG A;  1PTO C;  2CW0 C;  2FJ2 A;  2L15 A;  4QJF A;  4OXP A;  3PUX A;  4A3I H;  3HOW H;  1IXR A;  2E2I B;  2XIW A;  1CUK A;  1JWU D;  1FNU A;  1FR3 A;  3T53 B;  3H3V H;  3KYH C;  2A68 C;  3LNN A;  3S9W A;  4BA2 I;  3NQT A;  4V0B A;  1EIY B;  2KOL A;  5IYC G;  1PYS B;  1LT6 D;  4OWX B;  2MPM A;  5IWA L;  3JAM c;  1GUN A;  4GOP C;  4DV4 L;  3Q0A A;  3T1H Q;  3OIQ A;  1KDB A;  3U9S A;  3HOV B;  1EYC A;  5M3M H;  2RHQ B;  1D8L A;  5C4H A;  1EY6 A;  2AWO A;  1Y14 B;  3I8Z A;  3S1N H;  1CTM A;  4ZYS A;  4IFD G;  5IT9 E;  5JAV A;  2HDL A;  3HKS A;  3CCV A;  1C48 A;  1UEA B;  4GNX A;  1N34 L;  2B2Y C;  1XNR L;  3RZO B;  1SYD A;  3UI2 A;  5C5M A;  1EU3 A;  2JXM B;  2G5D A;  1XNR Q;  3VR5 A;  3TZD A;  4DV6 Q;  2KCC A;  2YTY A;  1QWY A;  5BR8 Q;  5A2Q E;  5EPK A;  4AIM A;  1PH5 A;  1VQC A;  1F2Y A;  2ZJR A;  4IQZ A;  1A3U A;  4KKU A;  1L1O C;  2JEB I;  5ELF A;  2IX1 A;  2ID0 A;  1RF2 D;  3UE0 A;  3IRB A;  1BBU A;  3BVM A;  5D3I B;  5M3F H;  1CA6 A;  3GTP B;  4DV2 Q;  4H44 C;  2CQO A;  2I0Q A;  3X3M A;  1ML0 D;  4EVO A;  2R7D A;  2JA6 G;  1XWE A;  2Q2T A;  3S24 A;  1STY A;  4B3M Q;  2F0T A;  2X6L A;  1PRT C;  1TR5 A; 
#chains in the Genus database with same CATH homology
 3NTI A;  4QCL A;  4K6L A;  1F9S A;  1SNQ A;  1IW7 D;  3KLS A;  1D5Z C;  1TS3 A;  4C3H G;  2NTS A;  1EIH A;  2L1B A;  3SVM A;  4FYD A;  4UAI A;  3SHL A;  5CC4 A;  2QIL A;  5KRU A;  2HQE A;  1G29 1;  2MGS A;  3T13 A;  3S15 B;  4RCO A;  3IKJ A;  3I70 A;  2F0G A;  4DA2 A;  4PMW A;  4RWS C;  4DK0 A;  2A6E D;  3KLR A;  3BDO A;  4FVM A;  2KHS A;  3OMC A;  1K83 B;  2NN6 H;  1ENC A;  3VYT A;  2VB3 X;  2EJM A;  3E6Z X;  2A5H A;  4TQU S;  5D3D A;  1V1O A;  2DN8 A;  3QJY A;  1QJO A;  2D2C C;  2IT1 A;  3QO2 A;  3C3L A;  1CM9 A;  2GA4 B;  3WOF A;  3TDQ A;  3D4R A;  2PNR C;  2F0W A;  1SYC A;  1DYQ A;  2CVR A;  1HA6 A;  1F2L A;  1R4Q B;  1BBX C;  1Q1E A;  3CKI B;  3GD7 A;  1VDZ A;  2XVS A;  1EYA A;  1ICW A;  1QG7 A;  2MJ8 A;  2YU9 B;  1Y1V B;  4CKB A;  3QWN A;  4KD4 A;  4X3U A;  3AU7 A;  1Y1W B;  5LHY 1;  2JA5 B;  5C4J B;  3SK4 A;  2B2V C;  3BYT B;  2B63 B;  1TS2 A;  2QDB A;  4FNF A;  1A3T A;  1G6Z A;  5FO7 B;  4RKB A;  1TWA B;  3C2P A;  2L5T A;  1OXX K;  1I6V C;  1F77 A;  2BE5 D;  3A54 A;  3AB9 A;  1CA5 A;  3DWA A;  1KLG D;  1KDA A;  1TQO A;  2RSN A;  3GTQ B;  3DUZ A;  2CQA A;  4RHR A;  1DOM A;  5HGT A;  1Y8P B;  4A3M B;  1HTL D;  3K58 A;  3BVG A;  1L0X B;  4OIK A;  1J9O A;  1B50 A;  1LTI D;  2VNU D;  4C1N K;  1LT3 D;  2A6E C;  5J22 A;  5IGG A;  4IUT A;  1C4Q A;  1HTP A;  1H9R A;  3RD4 A;  1T5E A;  3M3Y B;  1E2V A;  1V1P A;  2IL8 A;  2WAC A;  3GTG B;  2B8F A;  3TP7 A;  3NWT A;  3U9O A;  2LS0 1;  4OO1 H;  2TMP A;  3NHH A;  1ONL A;  3K5M A;  5IGB A;  1I4Q A;  1EY5 A;  1KNA A;  4G7H C;  1WTX A;  5IT9 L;  4RKL A;  4A3I B;  2L55 A;  4J8Q A;  1DZ1 A;  1HQM C;  1BNZ A;  4LAA A;  1EFI D;  2F0Q A;  3TBI B;  5A2Q L;  2ZXO A;  1LTA D;  4DK1 A;  1AZP A;  2ICE C;  3FEW X;  3A56 A;  1SYF A;  2WIN B;  2VB2 X;  4K5W A;  2WKC A;  4A3D B;  2FMC A;  3TP6 A;  3QIA A;  4FP5 D;  4HN7 A;  2NTT A;  3TP5 A;  1HXY D;  2IW3 A;  1X3P A;  3VA7 A;  3DM1 A;  3SE0 A;  1QNU A;  4BWG B;  1EZ8 A;  4QUF A;  3JAM E;  2K5D A;  2BE5 C;  4G4K A;  2MP1 A;  3R3O A;  1R9T B;  2B2W A;  4HSV A;  3PUZ A;  4G7Z C;  1G8Z D;  2F03 A;  4K6D A;  1JOO A;  3N52 A;  1HQR D;  4J1M A;  1I6H B;  4DAP A;  1IL8 A;  2VUM B;  2L0C A;  2EYL A;  2HCI A;  2IWH A;  1KAB A;  3ZYY X;  3J80 E;  2F0S A;  3J7A F;  3D4W A;  4R9W A;  3GTO B;  2BDO A;  5CGK A;  5EBC A;  4C3J B;  5C4X B;  1PRT F;  3LWU A;  1YNN D;  4IAL A;  1S5F D;  1I50 B;  4ZAI A;  1Q3L A;  1EEI D;  5K5P A;  2WV6 D;  1MGS A;  1JOK A;  5G3L D;  3QB3 A;  2R61 A;  3GQB A;  1KNE A;  3DMU A;  2ZXR A;  2SNS A;  4F87 A;  2Q8I B;  2A6H D;  4ZQ3 A;  4NMZ A;  3I4M B;  4EQN A;  3R2I A;  3S1R B;  4BS9 A;  4A3E B;  1BXT A;  1EL0 A;  5CR3 A;  4F8M A;  5DAU A;  3EJI A;  2K01 A;  4R8I A;  3W2D A;  3PUV A;  4EGV A;  5LL6 S;  3PO2 B;  1WTP A;  4ABN A;  3ND9 A;  1V43 A;  2PO4 A;  1IKL A;  1CFM A;  3K5L A;  2YYZ A;  2NN6 I;  3WOE A;  4XQN A;  1HHV A;  4DN4 M;  4L6T B;  5E4W C;  1I4R A;  5KYL A;  2X69 A;  1QCB D;  1TWG B;  2ZXP A;  2PPB C;  5C0X H;  4UDU C;  2C5C A;  2A68 D;  3H3V C;  3GP7 A;  4J6H A;  1KDC A;  3A7L A;  4ZLT F;  3NPP A;  3AMU A;  2O5J C;  1HRJ A;  5KNB A;  1ENA A;  2L12 A;  2EVB A;  4F88 A;  4H0L C;  2K5W A;  1TVX A;  5CBA E;  3PUW A;  4ZUJ A;  2BCO A;  2RDF A;  1S5E D;  1ZYR D;  1EQV A;  2DNC A;  3H0G B;  3MEH A;  1QOH A;  2F0D A;  2L9H A;  4XXE A;  3FMC A;  1EYD A;  5M5Y B;  2O4X A;  1YNN C;  5IGC A;  2K04 A;  1EY7 A;  4KMU C;  2HUG A;  3LWE A;  1CK1 A;  1RDP D;  2OXP A;  2J0T D;  2HCC A;  5EPJ A;  4C2M B;  2V4D A;  1BCP B;  1DM0 B;  3DEO A;  1TII D;  1VMC A;  1A15 A;  2A6H C;  1BOS A;  5JVH 3;  1AP0 A;  3MFY A;  2SNM A;  1EQT A;  1BF4 A;  3GO5 A;  2EXZ A;  2K03 A;  3I3C A;  2B2V A;  2E75 C;  1XTC D;  2DNE A;  1SJH D;  4L63 B;  2F0M A;  2I07 B;  2B2W C;  5T1I A;  1LAC A;  1JCK B;  3S1M B;  3HG9 A;  1EZ6 A;  3L9A X;  1TY0 A;  3TME A;  4OO1 I;  3ITP A;  1ILP A;  1WTO A;  4K5V A;  2IX3 A;  1KAA A;  2BA1 A;  1VCI A;  4CHT B;  3JAM L;  1KLU D;  4O42 A;  3Q6S A;  1GHJ A;  4CJ0 B;  1VF7 A;  1B3A A;  4NW2 A;  4F7X A;  3URY A;  2EYO A;  2JA6 B;  5EKL A;  5F2D A;  1ZYR C;  1F9Q A;  4K8J A;  3TSS A;  2E2J B;  3J80 L;  4RAU C;  1ET6 A;  2EY6 A;  1GUS A;  1O78 A;  3ND8 A;  4ME5 A;  3MFG A;  1PXU A;  2LKV A;  4C3H B;  1I4X A;  4I65 A;  1EEF D;  5EQ0 A;  2N88 A;  4DF7 A;  4DNT B;  2A74 C;  2G9H D;  3FDT A;  5E3F A;  2F0I A;  2N55 A;  4BBR B;  5JEA J;  2K1B A;  1G2T A;  5J1Z A;  3L7Z C;  3I72 A;  5JOB A;  3X3N A;  2KUM A;  1BO0 A;  2XRQ D;  1OO9 B;  3HOZ B;  4C1N I;  5KEE A;  3NWS A;  4CJ1 B;  4QIW B;  1RJT A;  4O1N A;  1EWH A;  1TS5 A;  1PFB A;  2D62 A;  2E74 C;  1JOQ A;  2EY1 A;  2AQ2 B;  3T56 B;  4MHE A;  1EY9 A;  1NSN S;  1PZK D;  1H9M A;  1LTG D;  3ONA B;  3R93 A;  3BG3 A;  2F0P A;  4IUN A;  2RA4 A;  3OSO A;  1BUV T;  1NUC A;  1JC7 A;  2ICI A;  2EZV A;  3KBG A;  5FLX L;  3OWE B;  2KEE A;  1Y69 U;  5K36 G;  1ZKO A;  2QEJ C;  1TKW B;  3C46 A;  4M8A A;  1IKM A;  3VYS A;  1BDO A;  4K14 A;  3CRK C;  1W6J A;  2TSS A;  1K8O A;  1SNM A;  2Z8L A;  2Z4H A;  1EY0 A;  1DCZ A;  3SR1 A;  4ILW A;  3DWQ A;  2G9D A;  4KKT A;  1CHQ D;  4OGQ C;  5CV4 A;  1RHP A;  2EYP A;  2K05 A;  4XYO A;  4FF3 A;  3OMG A;  1RTN A;  4WRD A;  1QE6 A;  1D5M C;  1GUT A;  5JPN C;  1PFN A;  2F0O A;  1DJR D;  3VR6 A;  4WJW A;  5C5L A;  4ID6 A;  4G57 A;  3HGB A;  2WII B;  3T4A C;  3V96 A;  2O2L D;  2K7V A;  4C3I G;  2JP1 A;  5C0X I;  3GTJ B;  4IZ8 A;  4HSP A;  1WTV A;  2KED A;  1FD7 D;  1GXD C;  1WTR A;  1STN A;  1SNC A;  3S2H B;  1S4Z A;  5JEA G;  3FPP A;  4RGM A;  1S5C D;  1B9N A;  5KGU A;  5CV7 A;  2Q8T A;  1TY2 A;  1WTQ A;  4IUP A;  2AUK A;  2PZT A;  1WD0 A;  2NYZ D;  1AFP A;  4NDX A;  2H4O A;  1GOZ A;  1LTT D;  5EKI A;  3QOL A;  2A69 D;  3HP3 A;  3C1F A;  3K5N A;  4PQX A;  1VF5 C;  1LTR D;  2K32 A;  1ROD A;  3EFX D;  5EKK A;  2K5Q A;  1D5X C;  1STG A;  3K59 A;  1PYW D;  1ESR A;  1UNS A;  3HS0 C;  1LTS D;  5E1F A;  3S2D B;  1SND A;  1TU2 B;  4XT1 B;  1QIL A;  5DEH A;  1F2Z A;  1JB3 A;  2D9U A;  4HED A;  3BYY B;  4KKS A;  3H09 A;  2XWB B;  4QMG A;  4Z9C B;  4IFD H;  4HMJ A;  1S5D D;  1SSO A;  1RKN A;  4IUV A;  3A8J E;  3H6M A;  4P2C B;  1XXG A;  3OHX C;  3HOU B;  1V8Q A;  1Z6H A;  1PTO F;  2F0L A;  1SXT A;  4MN3 A;  1PZI D;  4FF2 A;  2RQX A;  4B9W A;  1A2T A;  4B9X A;  4KI0 A;  1M4V A;  5JJZ A;  1SDF A;  2JSO A;  2M2L A;  5ISR A;  5D14 A;  1I4H A;  2FFK B;  4ZRZ A;  2NWG A;  4LK1 C;  3SK5 A;  5C44 B;  2R92 B;  1E2W A;  2F1M A;  4ZK9 B;  3NBH A;  1RD9 D;  3NTK A;  1MSH A;  2B2U C;  4U67 3;  2AQ3 B;  4RGO S;  2J7Z A;  5IGD A;  2IPK D;  2L4N A;  4N9T A;  3VA5 A;  2EDG A;  4DNR B;  1PZJ D;  3GTK B;  2A69 C;  4FXD A;  5I2Y A;  1A2U A;  1SNP A;  5BN3 A;  1HUM A;  3OWF A;  4KN4 C;  3A55 A;  3DXJ C;  3BZD B;  3S14 B;  2EE1 A;  2EY2 A;  3VYR A;  2FIN B;  2F4I A;  2Y0S B;  4FXK C;  3V2T A;  4IUU A;  4ZKC B;  3PIO 3;  3Q23 A;  4QF4 A;  3GV3 A;  3NSW A;  3MXP A;  1SE4 A;  4U68 A;  2X6G A;  5I9P A;  3Q22 A;  4XYQ A;  3PIP 3;  1QNK A;  2PQE A;  3G6J B;  4KV6 A;  3MXU A;  5BN4 A;  3HRZ C;  4CJ2 C;  2F0H A;  1LT5 D;  1RCV D;  4KY5 A;  4K5X A;  5I4D A;  1EOT A;  5IIF A;  3OPO A;  4FXG C;  2Z1C A;  3TN2 A;  3PO3 B;  3D6W A;  1BR9 A;  4RGN A;  1LO5 D;  5CMD A;  5ELC A;  5FLX E;  5JVG 3;  2C9O A;  5CV6 A;  1IYU A;  4RH6 A;  3SXH A;  3P1H A;  2R6G A;  5FK9 C;  1EY8 A;  5COR A;  1LAB A;  4QUC A;  5KNC A;  1E2Z A;  4KN7 C;  1B2T A;  2NN6 G;  1H9S B;  3IFD A;  1VMP A;  1SBB B;  3IL8 A;  4A3F B;  4A3J B;  4XTC S;  2F3W A;  3M85 A;  2B2T A;  5LL6 X;  3FPU B;  1UUP A;  1Q90 A;  2EJG C;  4DAY A;  3SK6 A;  3IFT A;  1I4G A;  2F0E A;  4LJZ C;  4IFD J;  4Y7N B;  3KUP A;  3MXN A;  3I4L A;  1FNW A;  4WOR A;  4CKE A;  1J8I A;  4MIU A;  5EBD A;  1UAP A;  2FHT A;  2WKD A;  3G7L A;  3M7N A;  4PV1 C;  4HCE A;  1Z47 A;  3I90 A;  1PRT B;  1LV9 A;  5T1G A;  4BA1 I;  1U4P A;  2OEO A;  1DOL A;  3BVZ A;  1JIC A;  4GZY C;  1OXV A;  2K33 A;  3NUC A;  3I4N B;  3PUY A;  4HCS A;  5J39 A;  1SAP A;  1B44 D;  3CRL C;  1SFO B;  1HA5 A;  2EJF C;  4ULL A;  3T51 B;  3P75 A;  1JWM D;  4FF1 A;  4RFB A;  5FOB B;  3E5S A;  3P7J A;  2KVM A;  1LLR D;  1XYI A;  3A8K E;  1Q1B A;  3D8G A;  1ILQ A;  2BDN A;  1BCP D;  1CHP D;  1F9P A;  1B9M A;  3R2T A;  3CHB D;  4KHZ A;  5DM7 3;  3SK8 A;  5I2X A;  1C8C A;  2XSC A;  2B8G A;  2EY5 A;  4FO2 A;  4ZUI A;  5D65 A;  4V19 0;  4PNY A;  4RA8 A;  1K8M A;  3L3O C;  1JE4 A;  5C6A A;  1EU4 A;  2PW7 A;  1A6X A;  2R3Z A;  3NK9 A;  3SEB A;  2NVQ B;  3RLF A;  2PCF B;  1U9R A;  2H1E A;  1GUW A;  2LFN A;  1W6K A;  4RGT A;  4FF4 A;  3PV0 A;  4IUQ A;  2WP8 J;  2OT2 A;  3I91 A;  2J4X A;  4IFD I;  2CHB D;  1B53 A;  3MTS A;  2PYK A;  3H91 A;  1U4R A;  1ESF A;  4ODG A;  2KQ3 A;  3MC0 B;  1EY4 A;  5EGT A;  3K0Y A;  1CQF A;  1O7Z A;  4WFN 3;  2NZ1 D;  4OO1 G;  2EPB A;  3D6C A;  3FKI B;  2RBM A;  4I7Z C;  2AQ1 B;  1PMR A;  1FGB D;  4DU9 A;  4IUR A;  1SE2 A;  3DEP A;  5I6W A;  3FVQ A;  3J81 E;  2Q8R E;  4A3K B;  1DON A;  2PW5 A;  2M00 A;  5CV9 A;  1U4L A;  3TP8 A;  5C4Z A;  3E0J A;  2AWN A;  3J7Y W;  3HOY B;  1CQV A;  2NB0 A;  5M5X B;  3M4O B;  5IOC A;  2O5I C;  1SEB D;  2QF7 A;  3C1E A;  3D4D A;  4HR7 B;  4Q5V A;  1O80 A;  1WVL A;  1MD2 D;  1NAP A;  5CYU A;  1Z7T A;  5C0X J;  3S1Q B;  4DXF A;  4HMI A;  1LT4 D;  4XT3 B;  4NKL A;  4PMB A;  3GTL B;  1ZXT A;  3MVV A;  1JOR A;  5CBE E;  1BCP C;  2KJX A;  4X3S A;  2E76 C;  2NVY B;  5C3E B;  1I4P A;  3N6R A;  3KBX A;  4TRD A;  5KIX A;  1AEX A;  1F9R A;  5JPM C;  4A3G B;  3MA2 B;  2WB1 B;  3OW7 A;  1PFM A;  2B2T C;  5KND A;  4OHJ A;  2NVT B;  4KY7 A;  3VR3 A;  2K28 A;  5CV8 A;  1S5B D;  2B2U A;  1X3Q A;  1PTO H;  3LX0 A;  4CGY B;  4L8J A;  2WAQ B;  3W3A A;  4BY1 B;  2NVX B;  3MHB A;  1A3V A;  4BBS B;  2PZU A;  1Y8N B;  2AUJ D;  5M9O A;  2IJ0 A;  4C3I B;  2F3V A;  1QB5 D;  4LMQ D;  4KY6 A;  4G7O C;  2LMC B;  1L0Y B;  3Q24 A;  3NE5 B;  3S16 B;  1JR0 D;  3K6O A;  3HOX B;  1SE3 A;  1TWH B;  2E2H B;  1JWS D;  2EYM A;  3NP8 A;  1STB A;  4H13 C;  2RVL A;  1D6E C;  1O7Y A;  5NUC A;  3I73 A;  4DFA A;  1U4M A;  1M8A A;  1DOK A;  4R8N A;  2QKI C;  3KLS X;  2F0F A;  2Z4I A;  3MWY W;  2A73 B;  2VXW A;  2KA7 A;  1EIG A;  3NQI A;  1NR2 A;  2EYJ A;  4DAV A;  1TWF B;  3M4Y A;  3K57 A;  1II3 A;  5C0X G;  3GTM B;  1IW7 C;  5C3W A;  4K2L A;  1Y8O B;  5FKA C;  1B1Z A;  1CZG A;  1RTO A;  2IX0 A;  3WDN A;  1LTB D;  4KHV A;  2K6A A;  1GHK A;  2D5D A;  3J7A V;  5E4X A;  4DGZ A;  1H9K A;  1CZW A;  4HAE A;  4XIG S;  3EQL C;  2ZT9 C;  2JYO A;  1SYG A;  2DY7 A;  1PDQ A;  5G3L F;  2XRS D;  4EQP A;  3TZU A;  3H94 A;  3MZ5 A;  3HEJ A;  4IN3 A;  2B39 A;  5KYI A;  1SYE A;  1AZQ A;  5M5W B;  1OXU A;  2FMM A;  1ZEQ X;  5I9O A;  2RDH A;  5BN5 A;  1CT1 D;  3D3R A;  3P20 A;  3NBI A;  2NUC A;  4HTH A;  1KTK A;  4A93 B;  3F2U A;  5AFW A;  1TT2 A;  2NBF A;  1MBY A;  3VR4 A;  3KK7 A;  3ERO A;  1DXM A;  2E2D C;  3J81 L;  3VYU A;  1STA A;  5ELB A;  3HOW B;  5C3X A;  2OF1 A;  1HCZ A;  3A7A B;  1HFG A;  4KJO A;  5DNF A;  5COY A;  1V1P B;  5M3M B;  1DD2 A;  1SMY D;  3S1N B;  2I46 A;  2PZW A;  4ZKB B;  3NXW A;  2F0V A;  2JE6 I;  4RCN A;  5IOD A;  3HKZ B;  2BA0 A;  4K8I A;  1CI3 M;  1X32 A;  4YIJ A;  4K2K A;  1E0B A;  2QCP X;  4KD3 A;  1SNO A;  1FYC A;  1YNJ D;  2KCN A;  5M3F B;  2EYH A;  3EVQ A;  1OXS C;  4QB4 A;  3V05 A;  5K36 H;  3T16 A;  1IYV A;  1GJX A;  5ELE A;  4EQO A;  1XX8 A;  3OOC A;  4S3S A;  3VR2 A;  2JEA I;  3MAQ A;  3OIP A;  2RSO A;  1H9S A;  4X3K A;  2EYF A;  3RMH A;  3S17 B;  2SDF A;  4A3B B;  1SJE D;  1R4P B;  1BCP F;  1ET9 A;  4CKC A;  2B2Y A;  2JA8 B;  1D2B A;  1NCV A;  4KJN A;  3ERQ A;  4C3J G;  2R7Z B;  1FNV A;  4E6I A;  2XN9 C;  1PTO B;  2HDM A;  1WD1 A;  1TWC B;  5I6Y A;  1HFN A;  1GUG A;  3DWP A;  4JK1 C;  1AN8 A;  3CQZ B;  2SEB D;  4OIJ A;  5DM6 3;  3QG1 A;  5A35 A;  1MSG A;  4PMC A;  3KF8 A;  3RZD B;  4JBW A;  2L11 A;  1H9J A;  5JEA H;  1G2S A;  5EPL A;  2MUY A;  1PTO D;  2CW0 D;  3PMF A;  1D1I A;  4X3T A;  3HZX A;  1PLF A;  3CU7 A;  3O13 A;  2MHV A;  2F0U A;  1SMY C;  1STE A;  3BS1 A;  3IAY A;  3M7G A;  2JA7 B;  2R93 B;  1T5X D;  3A8I E;  2F0N A;  2PMZ B;  5FO9 B;  2SOB A;  1WCM B;  1HPC A;  1I3Q B;  2BOS A;  1IHZ A;  2F0J A;  1TS4 A;  5IGE A;  1ENF A;  2M9V A;  1Q8I A;  2KEC A;  1YNJ C;  2RDG A;  1G91 A;  2F0K A;  4XQQ A;  4N9P A;  3BDL A;  4BY7 B;  2DY8 A;  4KTA A;  4TKO B;  1GUO A;  1Q12 A;  3MXG A;  4AYB B;  2RKS A;  3D31 A;  1MI2 A;  5CV5 A;  5TSS A;  4CBV A;  1NR4 A;  1O7L A;  4KK7 A;  4OL7 A;  3EA6 A;  1PRT D;  2XWJ B;  3NTH A;  5EJW A;  3RUZ A;  1B4O A;  4B08 A;  1STH A;  2ENB A;  1F2M A;  5HUR A;  4XQJ A;  1JQY D;  3K7A B;  1OXT A;  2EOT A;  4TSS A;  1EWC A;  4NP5 A;  1SYB A;  5IGF A;  4M1U B;  3DHQ A;  5FO8 B;  4Q0F A;  3GV6 A;  1BQQ T;  3BDC A;  5ELD A;  3K5O A;  4RHS A;  4C56 C;  1WTW A;  4H7B A;  3QOJ A;  4XDX A;  3FRP B;  2LY7 A;  1HUN A;  1AW7 A;  3SDZ A;  1D1K A;  3R8B A;  2XNA C;  4DXG A;  1PTO C;  2CW0 C;  2FJ2 A;  3PUX A;  2E2I B;  2XIW A;  1JWU D;  1FNU A;  1FR3 A;  3T53 B;  2A68 C;  3LNN A;  3S9W A;  4BA2 I;  3NQT A;  4V0B A;  2KOL A;  1LT6 D;  2MPM A;  1GUN A;  3Q0A A;  3OIQ A;  1KDB A;  3U9S A;  3HOV B;  1EYC A;  5C4H A;  1EY6 A;  2AWO A;  3I8Z A;  1CTM A;  4ZYS A;  4IFD G;  5IT9 E;  5JAV A;  2HDL A;  1C48 A;  1UEA B;  2B2Y C;  3RZO B;  1SYD A;  3UI2 A;  5C5M A;  1EU3 A;  2JXM B;  3VR5 A;  3TZD A;  2KCC A;  1QWY A;  5A2Q E;  5EPK A;  1F2Y A;  4IQZ A;  1A3U A;  4KKU A;  2JEB I;  5ELF A;  2IX1 A;  2ID0 A;  1RF2 D;  1CA6 A;  3BVM A;  5D3I B;  3GTP B;  4H44 C;  3X3M A;  1ML0 D;  4EVO A;  1XWE A;  1STY A;  2F0T A;  2X6L A;  1PRT C;  1TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...