2F0SA

Crystal structure of staphylococcal nuclease mutant v66l/i92v
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0sA00
3EJIA 2HQEA 4F7XA 5I6YA 3EVQA 3VA5A 4ZUIA 5CV8A 1EY8A 3SXHA 4ME5A 5C3WA 2EYHA 3BDLA 4KJNA 5C4HA 1SNQA 5I9OA 1JOKA 5J22A 2PW7A 3OSOA 3ITPA 3MHBA 4PMBA 4DU9A 1SYFA 2F0UA 4I65A 2F0JA 2RDFA 3U9OA 4J1MA 3P1HA 2EY1A 1KDAA 3V2TA 5IIFA 1NUCA 2EYLA 1STAA 2SOBA 1EY5A 1ENAA 2F0PA 2F3VA 5KEEA 3MZ5A 3D8GA 4HMJA 5C3XA 3MEHA 1SYBA 5DAUA 5I6WA 2EY6A 4EQPA 4K14A 2EYJA 2EYPA 4QF4A 3D6CA 5C6AA 4NMZA 3TP5A 4ODGA 5E1FA 4QMGA 5IGBA 4MIUA 5CV9A 5DEHA 4E6IA 3QOJA 3NHHA 3OMCA 4WRDA 3SK4A 4DF7A 4KD4A 2SNSA 4K2LA 4KJOA 5CC4A 2O4XA 1EY9A 3HZXA 2F0EA 2OF1A 2PZTA 3NXWA 3TP6A 3QB3A 4NKLA 5C5LA 5J1ZA 4KV6A 2EYOA 2F0DA 4WORA 5CV4A 3NP8A 3LX0A 3QOLA 1SNDA 5EGTA 4K5WA 4PNYA 2OEOA 3T16A 4LAAA 1SNMA 1EYDA 2RKSA 5HURA 5JOBA 3MXPA 1KABA 5KGUA 4N9PA 2QDBA 3ERQA 1A3TA 5CV6A 1STBA 1JORA 3E5SA 1SYGA 2KHSA 2EXZA 3H6MA 5JAVA 3C1FA 4IZ8A 4KY7A 2PYKA 1II3A 3T13A 1A2TA 5IOCA 5IODA 1JOQA 3P75A 1SYCA 1NSNS 3MVVA 4EQNA 3HEJA 4EQOA 2F0HA 5IGCA 5K5PA 2F0NA 1JOOA 1TR5A 2F3WA 1F2MA 3BDCA 4H7BA 3SK5A 5E3FA 2F0TA 1EY7A 4K6DA 4ZQ3A 5IGDA 1EYCA 1AEXA 1KAAA 1KDBA 1STHA 3RUZA 3D4WA 1SYEA 4KY5A 4J6HA 4QB4A 4KD3A 4DFAA 3DMUA 1A2UA 5IGEA 5CR3A 1STGA 2F0FA 4KY6A 4KTAA 5CGKA 5KYLA 2F0MA 3EROA 1TT2A 5KRUA 5EKKA 3NUCA 5IGFA 4RKLA 5ISRA 2OXPA 4NDXA 3SK8A 3NQTA 1EZ8A 5M9OA 1EY6A 2F0LA 3DHQA 1F2YA 4HTHA 1EZ6A 1EY4A 4OL7A 4DGZA 5IGGA 2EY5A 1TQOA 4HMIA 4S3SA 4YIJA 3SR1A 2SNMA 1A3UA 1STYA 1EYAA 3NK9A 5C5MA 5J39A 3C1EA 3TMEA 4B9WA 2ENBA 5KIXA 2F0QA 3S9WA 1STNA 4PMCA 2F0SA 4G57A 2M00A 4B9XA 2EYMA 1IHZA 5CV7A 5F2DA 4IUNA 1ENCA 3OWFA 3D4DA 4EVOA 4IALA 4TRDA 2F0WA 3OMGA 1RKNA 2PQEA 3PMFA 4NP5A 4RKBA 3TP8A 1SNCA 2EY2A 4K5VA 1SYDA 4K8JA 4F8MA 1A3VA 3SHLA 5KYIA 4K5XA 2NUCA 4K2KA 4N9TA 4K8IA 2F0IA 2F0KA 1SNPA 3TP7A 2EYFA 2LKVA 1U9RA 1EQVA 2KQ3A 2F0VA 5EKLA 4R8NA 5HGTA 4KHVA 2PZWA 3R3OA 2PW5A 2RBMA 4ID6A 2PZUA 1KDCA 1SNOA 1EY0A 3SK6A 4ZUJA 1F2ZA 2WACA 5I9PA 5C4ZA 2F0GA 2F0OA 5NUCA 5CV5A
chains in the Genus database with same CATH superfamily
4JW0A 5I6YA 4PQXA 4P75A 4ZUIA 4KJNA 3QO2A 4A3IB 4B3RQ 1D5XC 4JBMA 1PTOB 1SXTA 3F1ZA 4DU9A 1SYFA 2F0UA 4I65A 2WKCA 4UAIA 3V2TA 5E4XA 1NR2A 2LSSA 2FHTA 2R7ZH 1PHJA 5IYDG 4CDFC 1X9NA 2CWPA 4A3GG 1SMYC 4C2MB 1S5ED 2MJ8A 1HZBA 1O78A 1IBLL 2EOTA 3R2TA 1YNXA 1DOMA 1DZ1A 4A3BB 2A6EC 3RZDH 2YTXA 2I5MX 4OX9L 1I4RA 3S16H 4JI2Q 5M3FB 4XTCS 3RLOA 3K5LA 1PV4A 2J7ZA 1GUGA 1QOHA 4L5RC 3ERQA 1STBA 5EKIA 3I4NB 1JORA 2EE1A 2Z9HA 2EXZA 3CCEA 1N33L 1SAPA 1EQRA 1Y14B 3T13A 4B3MQ 1JWMD 1HR0W 3FKIG 3HEJA 2F0HA 3H15A 4PV1C 3S2DH 1FD7D 2D5DA 2F0TA 3NWTA 4XYOA 4X3UA 4ZQ3A 4BBRG 2JA5G 2UUBL 1KAAA 2GVBA 4IUVA 5FKAC 3U50C 3D6WA 4DR2Q 2F0FA 2QF7A 2ICIA 4CHTB 1E1TA 4LF6Q 4MNOA 3NQTA 4X62L 1GD7A 4JOIA 1RDPD 2EY5A 3HGBA 1OXSC 4JG2A 3T53B 4DK1A 5IWAL 4OX9Q 1AP0A 5I4DA 3NK9A 1SN8A 5J39A 1VF5C 3VYTA 4QUFA 3MAQA 2ZTEA 4QJFA 1RL2A 2EYMA 4GKKL 2B2VA 2R7ZG 3M4QA 3Q23A 5D14A 1PA6A 1SE2A 2Q2IA 1XYIA 2A73B 4BBSH 3NEMA 5C3EG 3L9AX 4POGA 2K4KA 3S1RB 5EBDA 2RCFA 1B3QA 3CKIB 3VDYA 3SVMA 5LMNL 2A68D 4R9WA 1HH2P 2N8NA 3A56A 5T1IA 4P72A 4C3HG 1EY0A 1E7ZA 3FMCA 5C4ZA 4RG1A 4X64Q 3K81C 2LXKA 2E74C 1EY8A 1R9TB 3I55A 4HSPA 2B2TC 1Z6HA 3HOYG 2RDFA 1X6OA 2HDLA 3LWEA 4GLXA 1LTAD 1HNWQ 1QNUA 1HA6A 3KF8B 1PH7A 4A3DG 2F3VA 2QEJC 4A3JG 4HMJA 3PIPA 2EYJA 5E4WC 1PYWD 4CDDC 3TP5A 1ILQA 3I4MG 3CHBD 3J7A5 3KDFB 2JQOA 3D3RA 4JBWA 4DF7A 3K58A 4LJZC 1CHQD 1EYGA 4FYDA 2F0EA 1WJJA 4DAVA 3K59A 1H9RA 5EGTA 4GOPA 3T16A 4C3IH 4LAAA 3BYTB 1MSHA 1VQCA 3E5SA 3K57A 4IUTA 1MGSA 4IZ8A 2OWOA 4X3KA 1LTBD 1JOQA 3HOUH 1EWIA 4MN3A 1SYCA 3KLSX 2Z6KA 3K7UC 1YJWA 3ZYYX 3NSWA 1BOSA 3M4YA 1RTOA 5DLQE 4K6DA 2ES2A 4IOCA 3HOVG 2A5HA 1B9NA 4JI6L 1E2VA 1A2UA 4RGMA 3GTQB 3CPFA 4ABNA 5M5XH 1SE4A 1HHVA 4QIWE 2JE6I 4OGQC 1SRUA 5M9OA 2K6AA 4DV4Q 1B53A 4A3MH 1V9PA 3DHQA 4A3FG 1EY4A 2NVTB 1YEZA 2MHVA 4RHRA 1BF4A 2VB2X 2NVTH 3C1EA 4RGTA 1NE3A 5I2YA 1NY4A 2X69A 5EPJA 3IAYA 1XNRL 1EQQA 1R4PB 1VQAA 5FJ8H 3M7GA 3CCLA 3RZDB 3GP7A 3PO2H 4P2CB 4A3BH 2PNHA 3KLSA 3TP8A 2OTJA 5LHY1 4IOAA 2R6GA 1I3QH 2EYFA 2L5TA 4QIWB 5EKLA 4R4TA 3H3VC 1XPUA 2KCMA 1MIUA 3GTLH 1X3EA 4ZKCB 3L2PA 4DR3L 4R1JA 2WAQB 1O7YA 3KDFA 5FLXE 4IPHA 3PUYA 1JC7A 4RFBA 4XXEA 5ELCA 3GTKB 1PRTC 4OWTB 4ME5A 3I7FA 5C4XH 3HOXH 1SNQA 4AYBE 3J7AF 1WCMG 3RD4A 2E8GA 2RCNA 2K28A 2ZXPA 3R2IA 2IX3A 4DR5Q 3ULLA 1YJNA 4HJ8A 4EGVA 1ENAA 3OIPA 4IN3A 4A3KG 4XQJA 3KJOA 1X32A 4A3JH 4EQPA 4BA2I 4UP8A 2JA7B 2A69C 3L3OC 1B7YB 4X65Q 1MHWC 1V43A 2PZTA 1L2FA 1Y8NB 3HKZE 4IFDG 2V4DA 3F2CA 3K5NA 4Q0FA 3G48A 3I70A 4RGNA 2Q8TA 1CKNB 3S1MB 1FJGQ 3MXPA 4QL5A 3U4ZA 1CKNA 3I3CA 3HOZB 4DUYQ 3KYHC 2KECA 3PUZA 2IHEA 4XQNA 5ELOA 3OIQA 3S1RH 2PCFB 5IGCA 1QVFA 1EIGA 1TR5A 3TS0A 4OEMB 4YY3L 3TN2A 5JVH3 1R9TH 4HSVA 3A74A 2JA8H 2F0MA 1LLRD 5M3FG 3GTPH 4RKLA 4NDXA 3PIP3 3D0FA 5C0XH 2IX0A 4JPBW 4H02A 1ML0D 1LT6D 1TQOA 2IW3A 1BKBA 1GOZA 2JYOA 2JA8G 3A5UA 3PV0A 3VR2A 1BVSA 1T5EA 3RNUA 4K0KQ 4ME3A 1MSGA 4TRDA 5J3BA 1Q1EA 2HT1A 1KQSA 1W3SA 3C2PA 3ULPA 2BDNA 1IW7C 4N9TA 1NJIC 3OYYA 1RHPA 2B2VC 4DV7L 1PFMA 2GVAA 2VNUD 2F1MA 1VQHA 2K5DA 2K03A 4R8NA 2JA9A 1U4RA 4KHVA 1K9MC 1GXDC 5C44G 2RBMA 2UUCL 3SDZA 1CTMA 2F0GA 2NVQB 4C3JB 2MGSA 3HKSA 2F4VL 1LT4D 5GROA 2L9HA 4EQ5A 3BZKA 5M5YB 3V05A 2R93H 1W6JA 4BBRB 3RLFA 2KBNA 3BVZA 2K32A 3HRZC 2N88A 5EQ0A 1AW7A 1JCKB 1PH2A 2EYLA 1DJRD 3W1GA 1G6PA 2YV5A 3G7LA 4YY3Q 2BE5C 4PZ6A 2EY6A 4H44C 2R7ZB 1VQKA 1TWAH 4MIUA 3Q0AA 3W2DA 3BG3A 4JYAQ 2K5WA 3IL8A 4KHPL 2VS1A 5ELEA 4ILWA 2RA4A 3J80c 1PFSA 3HZXA 4JI8L 2UXCL 3SGIA 4HAEA 1KTKA 4R8IA 4KKSA 4DUYL 4C3JG 4R4OA 4IUUA 3QOLA 4FXKC 5HURA 1GHJA 2K1BA 4IFDH 1XXGA 1X3GA 1VCIA 1JWUD 4A75A 3RZOB 2PYKA 1TS4A 1BBXC 1MJCA 5EPLA 4V190 1NSNS 4OXPA 1HNWL 3I72A 1QE6A 1V8QA 1LO5D 2JJQA 2WB1E 1ZKOA 5ELNA 2UXDQ 1C4QA 2EVBA 2EPBA 4A76A 4FF1A 1H9MA 3OW7A 4I7ZC 3CCJA 3T1YL 5IGEA 3C46A 4KY6A 3H0GB 1HNXQ 2DNEA 3SE0A 1JE5A 3G4SA 2E2HH 1BCPF 2OXPA 3C3LA 2WP8J 1F2YA 5COYA 3HOZH 3SR1A 1YIJA 5C4XG 1PRTF 3FEWX 4N8FA 1PZJD 4MTKA 4B9WA 2VB3X 4UDUC 2M00A 3OWFA 3TQYA 3STBD 4GN4B 1RODA 4RKBA 2QGQA 3AEVA 4A3KB 3S1NH 2F0IA 2A68C 2E5LQ 4TVAB 1IBKL 4JV5L 1U9RA 2WV6D 2R92B 4NPSA 4X62Q 2Q2HA 5I9PA 2DGYA 2R7DA 1QCBD 4DV6L 1UE7A 5NUCA 5IE8A 1VQDA 4G4KA 1WYDA 4F7XA 3NELA 3CCRA 5H1SE 3SXHA 4BS9A 2YU9H 1Q12A 4DV4L 4C1NI 3DM1A 3ZJYC 5FOBB 2CWAA 2F03A 3ICEA 1E1OA 2FMMA 2F0PA 2VZAA 5KEEA 1N33Q 1TY0A 1SYBA 5DAUA 1VQ4A 4CJ2C 1GKHA 1F2LA 3N52A 5TSSA 1VDZA 2D0PA 4HN7A 4DR2L 2AMCB 5KNDA 3FRPB 2M9VA 2PMZB 4C3HB 1PYSB 5FLXL 3CCMA 5C5LA 4A3GH 2K5HA 2F0DA 3M85A 2EZVA 2E75C 3K7AB 2BA1A 4B3ML 2QDBA 3N6RA 4JI7Q 1G8ZD 4JBKA 1W6KA 3GTMB 1I4GA 1D1IA 1VQOA 5JAVA 5KNBA 4G7HC 4OONA 1JICA 3CRLC 1UEAB 1I6HH 2D2CC 3UI2A 1SFOB 3I4MH 4JI2L 3BZCA 1BBUA 5K36G 4AYBB 5JEAG 4DAYB 4X6AH 4TSSA 4ZRZA 3I4LA 4GNXB 4DK3C 2Z6KC 4HTHA 1WTVA 3GTMH 5D65A 2NN6I 3IFTA 5JJKA 5C44H 1P16A 1HQRD 1STNA 2ZJQA 2CKZB 1NR4A 1B3AA 2RVLA 3NTHA 4C3JH 2ALYB 1LUZA 3W5OA 3VR4A 2B39A 4OHJA 3TP7A 2HHHL 3TEHB 1TU2B 1K3BC 2IHFA 1U4PA 3E9IA 1Q7YC 4JI7L 4ZYSA 3CMEA 3HOVH 2CCZA 4HCSA 4POFA 5CGKA 1UAPA 1QUQB 4YWKA 2DY8A 4C56C 5C4HA 2EYHA 3M4OH 1GO3E 1YHBA 2BDOA 4Q5VA 1PMRA 1A15A 3M9BA 1B50A 1KDAA 1Y8PB 3S2HH 4FVMA 3I2ZA 4R4IA 4JI8Q 2UXCQ 4KN7C 4KK7A 2B2WA 1KRSA 4DV2Q 2EYPA 3VYRA 1XPOA 2VW9A 4RWSC 4OO1H 3FPPA 5DEHA 5JVG3 5IP9G 1XX8A 3E9HA 3K5MA 1K73C 4DR6L 4DV0Q 1EY9A 2J0TD 1N32L 1QB5D 3AYHB 2GA4B 1GUTA 4PNYA 2OEOA 4LFAL 3OHXC 1EYDA 4GKJL 2E2JB 1SJED 1JB3A 1D1KA 2DJGC 2XTIA 3OW2A 3HOYB 2E2HB 2E2JH 4B08A 4KN4C 1A2TA 3EA6A 3AU7A 3DXJC 5IOCA 1WTPA 3S1MH 3H0GH 3J80L 3MA2B 3SK5A 3QWNA 4DV1Q 4GOPC 1EY7A 4P73A 4P71A 1NCVA 4RCOA 2JA6B 2N3SA 1SYEA 2C35B 1BXTA 4J15A 5KYLA 5JEAH 4KTAA 2K5NA 1CFMA 5EKKA 1CSPA 2WINB 5C3EH 3SK8A 1TWFH 5LMUQ 1STEA 5I2XA 1UUPA 1XMOQ 3OOCA 1ENFA 1EYAA 5JEAJ 1CKMA 2KENA 2Q8IB 3GTPB 2C9OA 4OIKA 1CM9A 2KHIA 1X3QA 3J80i 3Q24A 1LM0A 5BR8L 4IPGA 3MFGA 1HR0L 3HS0C 1O7ZA 1S5DD 3PO3B 2VUMH 4HIDA 1UE1A 1JMCA 1E2WA 2EJFC 4K5VA 3NQIA 4B3TL 5GAGC 3SEBA 1JQYD 3ERSX 2ATWA 1YNND 3D31A 1ASYA 3CU7A 3KK7A 1J6QA 3I90A 1I94L 4DR5L 2IWHA 1XPRA 3I4NG 4ID6A 1GUNA 1KDCA 1XMQQ 4O0AA 4LF4Q 2L11A 1CZGA 5C3WA 2BOSA 3J7ZC 1EWCA 4DA2A 2RQXA 1B1ZA 3P1HA 1F9RA 5CORA 2B2YC 1KXLA 4HJ7A 5DM63 3E3XA 1F9PA 4K14A 4ODGA 2MO0A 3GTQH 1L0YB 1M8AA 5AJ3Q 1E2ZA 1TS2A 3KUPA 3NXWA 3I4MB 4IPDA 4LFCQ 4WJ4A 3S1QH 3LX0A 2XIWA 3GTKH 1S5BD 5M3MB 4A3CG 1D5ZC 3GQBA 3HOUB 4HJ5A 4N8X1 4PZ8A 1WCMB 4F87A 4ULLA 5LMUL 4LUOA 1TIID 1Q86C 4KHPQ 3L7ZC 4U673 1V1OA 1C0AA 4DR3Q 1VS0A 2IPKD 5ELDA 2Q2UA 3GTOH 4CKCA 1HCZA 3BJUA 1HNZQ 1FNVA 1ZYRD 3KOJA 1VQGA 3DMUA 5G3LD 5T1GA 2QKIC 4L6TB 1L1OB 5IY0A 2B63H 3JAME 2K52A 3EROA 2NVXH 5KRUA 1ILPA 3RN5A 4MHEA 3DWPA 1CT1D 1PFNA 5C0XI 3HOYH 1EY6A 2F0LA 4XDXA 4KKUA 4KLKA 3E6ZX 2VUMG 2B2YA 1KNEA 4BWGB 2PI2A 2F4VQ 4V0BA 2G9DA 2KHJA 3HG9A 5KIXA 3DEPA 4L5QA 3A8IE 2B3GA 3S17B 4CKEA 5CV7A 3FVQA 1GHKA 5CYUA 3RR5A 3A0JA 2VXWA 1PH9A 4DNIA 3PMFA 1MBYA 3W3AA 2ID0A 2JA7H 2PNRC 4DV7Q 1JE4A 4FP5D 3GTLB 4A3JB 4JI1L 2CH4W 2A8VA 2LKVA 5C4JH 1DGSA 1CQFA 1QVCA 1VQJA 4OWWB 1SMXA 1Y1VH 1TWHB 5HGTA 4GNXC 4H13C 5HY6A 1Q46A 2PZUA 5D3DA 1WD0A 4OWXB 1J5EL 2D0OA 1XMQL 3EJIA 1YBYA 2LMCB 5IYCH 1LTSD 4WFN3 5HGQA 3JAMi 2NN6G 1N36L 3PSIA 1VMCA 2F0JA 2JA6G 4IUQA 3U9OA 4CJ0B 3MXNB 2AUKA 1JR0D 2SOBA 5IYBH 4Y7NH 2BCOA 4DV3Q 1HTPA 4A3MB 3F2BA 2O5JC 1HUNA 4DR7Q 2J4XA 3S2HB 1TXYA 5IGBA 4RH6A 2BH2A 1BCPD 3OMCA 1HZCA 4LK1C 1HPCA 1XMOL 1SFOH 4KV6A 1XWEA 5CV4A 3KBGA 1VQFA 1P8LA 1PZID 4IFDI 3H09A 4A3IG 1RF2D 5L37A 1IL8A 2NWGA 4A3CH 2L0CA 3C1FA 1TVXA 3GTGB 3OWEB 3L0OA 2UUAL 3FDTA 1GM5A 2ZXRA 1SSOA 2L4NA 1WTWA 1GUOA 1PLFA 5CBAE 3R8BA 4BY1G 5JJLA 3CCUA 3DWAA 5K36H 3D4RA 1STHA 1H9JA 1H9SA 1K0RA 2PQAA 4C3IG 1I50B 2XGTA 3UDFA 5BR8Q 4DKAC 1VQ6A 3J81c 5CR3A 3HKZB 2NVQH 4YCVA 4DV5Q 1Y1WH 3VR6A 1N32Q 5M3MG 5JJZA 2CQAA 2SNMA 3U4VA 4LWCA 4DV0L 4IURA 2I5LX 4DV2L 3D4DA 4B3SQ 1I50H 1E0BA 4IALA 4CBVA 1X54A 4LF6L 5KNCA 1RKNA 4A3DB 1FL0A 2RSOA 4FF4A 1QJOA 1EIFA 2B29A 2I0QA 3K5OA 4NXMQ 2CVRA 4JOIC 3IFDA 1DM0B 2A6HD 2NYZD 4XT1B 3WOFA 2WB1G 3KF6B 3R3OA 4LNQA 3MC0B 1U0LA 3G6EA 2XSCA 4YCWA 1D2BA 3MXUA 2Y0SE 1EWHA 3VR5A 1QUQA 4DV6Q 3MHBA 2HHHQ 1H95A 3E0EA 4BY7G 1SE8A 4A4IA 3U9SA 2SDFA 1VQ9A 2UXDL 1SE3A 3RMHA 2QA4A 3OTOQ 3MEHA 3ND9A 1CA5A 3AFQA 1TWGB 3EBEA 3NBHB 5FLMG 1VF7A 1IXRA 1KL9A 5LL6X 1JT8A 4QCLA 2HCCA 3QJYA 1SJHD 1BCPB 2A6ED 2KCNA 2HD3A 4X64L 3CD6A 1DOLA 1LTGD 4QY7A 5FJ8G 1PZKD 2E2IH 5AFWA 1KLUD 1EU4A 5JPNC 1KRTA 1Y1VB 2XWJB 4JYAL 4OO1G 4JI5Q 2EDGA 1F77A 1HUMA 1WFQA 5M3MH 1L0XB 4CGYB 3TSSA 2ZJPA 2F0NA 4IPCA 4KI0A 2NZ1D 1CZWA 5E3FA 4RAUC 3MEFA 5IGDA 1C9OA 2RF4A 1S3OA 4Z9CB 4FO2A 1R4QB 4GN3B 1I4QA 2KVMA 1TT2A 4FNFA 1TY2A 1NAPA 5ELBA 1HJPA 2NN6H 3VYUA 4JI0Q 1DD2A 3F2DA 1G51A 2JEAI 3S14B 5C4XB 4O2DA 1SLJA 4JVZA 3BU2A 4J8QA 4DNRB 1ESFA 3PO2B 1I4PA 4HEDA 3HOZG 3CXCA 2OQ0A 1O80A 3A55A 5A2QE 4RHSA 2NUCA 1CI3M 2KEDA 3WWVA 1SNPA 2BA0A 4A3EH 1M1KC 2JA7G 2HIVA 3I73A 4ZKBB 2PW5A 3M4PA 3UE0A 5CBEE 4BY1B 3NPPA 4GKKQ 1YVCA 3T56B 1VQLA 1K83B 2F0OA 2R92G 3FPUB 3CQZH 2YU9B 4B3SL 4GLVB 4G7ZC 3H0GG 3AFPA 3HFZB 1QVGA 3VA7A 2EJGC 1UWVA 1D6EC 1K83H 2PW7A 1EUJA 4NXML 3FHWA 1CQVA 3A5ZB 1SDFA 1UNSA 3WDNA 1I6HB 2R92H 2DNCA 3BYYB 5LMNW 1SBBB 5GADC 1HA5A 1S5CD 3BZDB 4R4CA 3D8GA 1PH6A 5FO8B 1WCMH 4OO1I 2R61A 4RGOS 3PGZA 1HTLD 1PH1A 3DEOA 4LW1A 5FO9B 1VQNA 1CK1A 3TP6A 3BDOA 3S16B 2PI2E 2EYOA 4LF5Q 1FJGL 1LTID 4DV5L 4YCUA 1YNJC 3E0JA 1IW7D 2PPBC 3NE5B 5CV6A 3DM3A 1SYGA 1C48A 1EOTA 3T1YQ 2K7VA 1KAWA 1Q8IA 3S24A 3J7YW 1D5MC 2E5LL 2LFNA 1KC8C 1OXUA 3TBIB 3EIVA 2WB1B 1JOOA 3GO5A 1PRTB 2K01A 1FYCA 2DJFC 3RN2A 3A54A 2JSOA 3UDGA 1EYCA 2HQLA 2QCPX 4BBRH 3CCVA 1WTRA 1L1OC 1KNAA 2R3ZA 3A7LA 2A1AA 4A3IH 1FNUA 2JP1A 5GAHC 4L5SA 2WKDA 1VQEA 4GZYC 2B8GA 3RZOH 3Q8DA 1K3RA 2B8FA 1EL0A 2I07B 4OL7A 2UXBL 5IP7H 1S40A 4A3LH 4LF4L 5IT9c 2FJ2A 1TS5A 4DUZQ 3S9WA 2RHSB 4PMCA 2VQFL 4P74A 1IHZA 1VQPA 5IT9E 4BXXH 3KF8A 3ONAB 1O7LA 1J9OA 1J5EQ 1X3FA 2K5VA 2L1BA 2XVSA 1A3VA 2DY7A 1HRJA 1TWCB 2G5DA 3GV6A 2Y0SB 1SMYD 2GN5A 2A19A 5DM73 2NZOA 3SK6A 2MUYA 1YITA 3P7JA 1IYVA 1JJCB 2UUCQ 3HOXG 3BDLA 3J81i 2XRQD 2QW7A 2VQEL 4PMBA 2IJ0A 4FF3A 1IYJB 1L1OA 3GTOB 3G6JB 1EY5A 3JAML 1I3QB 2A6HC 3MZ5A 4ZK9B 1EFID 3A7AB 3K0YA 4WJWA 1N34Q 5M5WB 1NMGA 2N49A 2NTTA 4JCVE 2RDGA 4E6IA 1JJGA 2Z4IA 4WRDA 4KD4A 4KJOA 1LYLA 3CP0A 1OXTA 2K50A 4IUPA 3M3YH 4WORA 2MPMA 1SNDA 4YHHL 4LFAQ 3J81E 1WI5A 2VQEQ 2XN9C 4A3EG 5IP7G 2ZTDA 4A3LG 4A3FH 1AE2A 4GN5A 4DR6Q 1JWSD 3ER0A 5IP9H 3A8JE 1EFWA 3DLLA 3K7AH 3MVVA 2EXDA 3J7AV 4H7BA 3KFUA 3PO3G 2BE5D 4IJHA 2D62A 4J6HA 4CDEC 3Q6SA 4K0KL 2F4IA 3H3VI 2F3IA 3K6OA 3S14H 1K8AC 5IGFA 4X66Q 5C44B 1RJTA 3H91A 1PH4A 1EZ8A 1OXVA 2QDLA 1EZ6A 1I4XA 2AQ1B 2EJMA 1KLGD 4A3BG 4A3EB 1U4LA 1TS3A 4A93G 3HOWH 4B3TQ 4A3GB 2F0SA 4IQZA 1X3PA 3TS2A 3H94A 1LTRD 1CUKA 1J8IA 3NTIA 3URYA 1DOKA 5FK9C 3OMGA 2DUDA 1W2BA 2JA5B 3BVGA 3GD7A 3MXGA 4K8IA 1HZAA 3HKZG 5IT9L 1I94Q 4O1NA 3FP9A 1PXUA 3DUZA 1PVOA 3OPOA 1S72A 2FXQA 1FGBD 3NBHA 3W1BA 1PH8A 2CFMA 3HOWG 2OT2A 2NTSA 3S17H 3HOUG 4DAYA 2HUGA 3ITPA 2Z1CA 2C5CA 3HOVB 3BS1A 4CKBA 3HP3A 4LF5L 4KKTA 1ZEQX 1E22A 3KBXA 2UXBQ 3F8TA 1G2SA 5C3XA 1M90C 1AZPA 1ICFB 5I6WA 1FNWA 1S5FD 1AZQA 1OO9B 1XNRQ 1XJVA 3QOJA 3ULJA 2SNSA 4XT3B 2O4XA 2MNAA 2V1CC 1QNKA 4XYQA 1LV9A 4L8JA 4NKLA 1YNNC 1B8AA 3HOWB 3RLNA 2KJXA 3JAMc 1LACA 1SNMA 2RKSA 1KABA 3EN2A 5KGUA 3CMAA 1X55A 3H6MA 3J81j 3KJPA 3I4NH 4QGUA 1C7YA 2B2UC 3CF5A 1KIXA 5M5XB 2B63G 2H1EA 1N9WA 1IBLQ 4HCEA 1RD9D 3PO2G 1VQIA 1QG7A 1BNZA 2UUBQ 1B70B 3HOXB 1K8MA 4LUVA 3DWQA 1Y8OB 2WFWA 1LT5D 2LY7A 5IGGA 1XNQL 2YTYA 1WVLA 4HMIA 2ZM6L 4MTNA 1DONA 3CC7A 3NENA 1DXMA 3QIAA 2AWNA 3UDXA 1GVPA 4EX5A 1V1QA 4UP9A 1B9MA 4BY7B 4EVOA 3S15B 5EAYA 4A93B 4FDBA 3PUVA 1NMFA 2KEEA 4JI3Q 2K75A 1G291 3F2UA 4M1UB 2B2UA 4K8JA 4F8MA 3S2DB 2N55A 3STBC 2MP1A 4JI0L 4Y52H 2Z0SA 1Y1WB 3I4OA 3PCOB 2WACA 4DUZL 3PO3H 1XTDA 1RIPA 1I5FA 3CC4A 4FXDA 2A74C 3KLWA 5CV8A 3GV3A 1B2TA 3PIOA 1Q3LA 1JOKA 2E76C 5J22A 1PRTD 2KCTA 4GNXA 4TKOB 5EJWA 2D9UA 1WTOA 2EY1A 1YHAA 1NUCA 3T4AC 1HFNA 3CW2C 1TWHH 1WTHA 1G91A 2PMZE 4YWMA 3MFYA 4ZLTF 4JI4Q 1GUWA 1VQ8A 4QF4A 4A3FB 1EEFD 5E1FA 3K80C 2VUMB 1PYBA 1WD1A 3NHHA 2JA6H 2K5QA 1SROA 1ET6A 1IKLA 5D3IB 4K5WA 1U5KA 3CQZB 1YJ9A 3KF6A 2IX1A 4JI5L 1LTLA 3CPWA 4L5TA 2BH8A 1WTXA 2AWOA 3OTOL 5LMNQ 4DR4L 2ICEC 2Y0SG 4DR1L 1N8RC 1B4OA 1PTOC 3P75A 3K8AA 3TREA 2NVYH 3BDCA 1EIYB 1D8LA 2E2DC 1IL2A 2FMCA 1AEXA 1Q90A 1KDBA 5EBCA 3RUZA 4KY5A 1STGA 2K14A 1LT3D 3EQLC 5E7NA 5BN5A 2OTLA 4RCNA 4DK6C 1Z47A 3KLRA 4NXNL 4DGZA 2R93G 1EQTA 4NXNQ 1CHPD 3U58A 1IBKQ 3R93A 4JV5Q 4OIJA 2H5XA 5C0XJ 2F0QA 4QQBX 1H9SB 2PQAB 3TZUA 3M4OB 1PTOF 2M2LA 2AHOB 5F2DA 1XNQQ 1ENCA 2HDMA 1T9HA 3LWUA 4BBSG 4DK0A 2Z6BA 3UDIA 2ZT9C 2NB0A 4H0LC 5KYIA 4K5XA 3T1HL 3T1HQ 1QILA 5BN4A 2F0KA 4WJ3M 1AE3A 2LS01 4FF2A 5LL6S 2WAQG 5IYBG 3JC66 1ET9A 4B3RL 2K04A 1G6ZA 4DAPA 2N78A 5A35A 1F2ZA 2E2IB 1PTOH 4A93H 2HQEA 2RSNA 2Z8LA 3TZDA 5CMDA 3EVQA 1C8CA 2B63B 3S1QB 4PZ7A 4IO9A 1G2TA 2G9HD 4K6LA 5I9OA 2KUMA 4LMQD 2UU9L 3H3VH 4IJLA 1A62A 5IIFA 2XNAC 3VR3A 2UUAQ 3CCSA 1Y1VG 1VQ5A 1YHQA 1NNXA 1CSQA 4XIGS 5JPMC 1IBML 1BR9A 2KCCA 3PF4A 3D6CA 4NMZA 1HNXL 3QG1A 4QMGA 3K0XA 5JJIA 3SK4A 1B44D 3AMUA 3FKIH 4K2LA 1VQMA 5CC4A 4AIMA 4LF9L 3PF5A 3PQIA 4DR4Q 4AQYQ 4BA1I 5J1ZA 2RHQB 4NW2A 4O42A 2CHBD 2RDHA 1KD1C 4JK1C 4C2MH 2KHSA 2X6LA 1TWFB 4UHVA 1PDQA 5FO7B 4X66L 4LF8L 1V1PA 2IL8A 1LTTD 1BUVT 4EQNA 1I4HA 2XRSD 5K5PA 2B2TA 1F9SA 5FLXc 2L15A 3CRKC 1F2MA 1FGUA 1O7IA 3PIO3 1FR3A 3T51B 4C3HH 1N36Q 3FKIB 3NWSA 3AQQA 4JBJA 4X3SA 1MJEA 1BCPC 3A8KE 1Y69U 2ZXOA 5M5WH 4BY7H 1NBWA 2IY5B 1L0WA 1VQBA 3NUCA 3ND8A 1SEBD 3GDEA 2K05A 2Q2TA 2TSSA 1CKOA 4RA8A 1PH5A 4DAMA 5C5MA 2JN4A 3QR8A 4QUCA 2CW0D 2VL6A 4JI1Q 4MZ9A 1HFGA 4B9XA 2CH4A 3BVMA 4UY8C 2F0WA 2K33A 2PQEA 3TRZA 2FFKB 3I56A 1A6XA 4DPGA 1IKMA 1IZ6A 3LNNA 1PH3A 2TMPA 4BXXG 4YWLA 4JI3L 3X3MA 2F0VA 1VQ7A 2H4OA 3GTGH 2NZHA 4IFDJ 1F9QA 1WTQA 4ZUJA 2Z4HA 2JA5H 4APVA 1M4VA 4C3IB 5CV5A 3I8ZA 2EIFA 2KOLA 5ELFA 3VA5A 1Y1WG 2ZM6Q 2DN8A 1ZYRC 3OSOA 2WIIB 1EEID 4A3MG 1Z7TA 4LFBL 3PUWA 2L55A 1E24A 4GS3A 4AYBG 4YHHQ 4J1MA 1ICWA 1EU3A 3CCQA 1UEBA 3IRBA 1STAA 4NB3A 2AQ3B 1IYUA 1YI2A 3CC2A 1KHIA 1A0IA 2OQKA 3X3NA 5CV9A 5IYCG 3PUXA 1LABA 4XQQA 1UE5A 3NP8A 2WAQE 1X56A 3B6YA 4HIKA 2PO4A 4CDCC 1Q1BA 3O13A 4ALPA 1TWGH 2P5ZX 2NBFA 4N9PA 2QEXA 4LF7Q 3J81L 2JXMB 1MKHA 1D7QA 4F88A 2O2LD 1RTNA 4KY7A 2VY3A 2HIXA 1II3A 2HCIA 1Q8KA 1TWCH 2F3WA 4CJ1B 4LFCL 1IBMQ 4DR7L 1HZ9A 1HQMC 4A3DH 2JK8A 1V1PB 2SEBD 3G71A 3D4WA 1UE6A 4U68A 1AN8A 4QB4A 4KD3A 1BBWA 3TDQA 4DFAA 1U4MA 5AJ3L 4DV3L 1TWAB 2R7FA 1WOCA 2OCEA 2O5IC 2YTVA 5ISRA 1GJXA 1HR0Q 4JC0A 4DNTB 3J80E 4HJ9A 4YIJA 2KA7A 1X65A 3MXNA 1ONLA 4X65L 4LUZA 5DNFA 3TMEA 1DCZA 1SR3A 4BBSB 5M3FH 2R93B 4G57A 2ASBA 4AQYL 3NTKA 2ZTCA 1TKWB 4KMUC 1MI2A 1K8GA 2AQ2B 3S15H 4NP5A 2LXJA 1EIHA 1I6VC 2EY2A 3SHLA 1BQQT 4K2KA 2MQHA 1YZ6A 1FVIA 4LFBQ 1Z9FA 5C4JB 2B2WC 4Y7NB 1BDOA 3Q22A 2PZWA 5G3LF 1OTCA 2YYZA 4LF7L 1ASZA 1SNOA 2XWBB 1EOVA 2X6GA 1BO0A 4TQUS 1E3PA 4DXFA 1QZGA 4OELB 4GKJQ 2CW0C 4UPAA 1K8OA 3GTJH 2JEBI 3M7NA 2AKWB 1A63A 1K0SA 3WOEA 5C3EB 2ZJRA 2FINB 4A3KH 2NVXB 1HNZL 1Q82C 5C6AA 4DXGA 4RMFA 4DR1Q 1YNJD 5GQOA 3MTSA 4GLAC 2OF1A 3M3YB 1CA6A 3QB3A 4FXGC 3IKJA 5EPKA 4DV1L 1AH9A 1HXYD 4HIOA 2MO1A 5JOBA 1MD2D 1A3TA 2Q8RE 5C0XG 4BY1H 1QWYA 4JI6Q 4HIMA 3AB9A 1OXXK 1RCVD 5IODA 1PFBA 4EQOA 5FLMH 3S1NB 4HR7B 1N34L 1T5XD 1QZHA 2I5HA 2QILA 4JI4L 4AH6A 4R4QA 2NVYB 1H9KA 3CAMA 4UP7A 2IT1A 5IYDH 1ZXTA 3LGJA 4M8AA 3P20A 1XTCD 4L63B 4G7OC 3V96A 4I7AA 4S3SA 2EQSA 3I91A 4ZAIA 4ZCKA 1A3UA 1STYA 4PG3A 3VYSA 3GTJB 4LF9Q 1ESRA 1JB7A 1K28A 2ENBA 1DYQA 4X3TA 1PTOD 4GOPB 4IUNA 2JA8B 2F52A 5GAEC 2A69D 3MWYW 3NBIA 1SNCA 4PMWA 4DN4M 1SYDA 2MFIA 1GUSA 4KHZA 5BN3A 2CQOA 1AFPA 1NTGA 2AUJD 5A2QL 2I46A 1EQVA 2KQ3A 4LF8Q 1VMPA 2UU9Q 1Q81C 5IWAQ 4C1NK 3EFXD 4HJAA 2VQFQ 1A8VA 3UE1A 1JJ2A 2L12A 1S4ZA 5M5YH
chains in the Genus database with same CATH topology
5I6YA 4PQXA 4ZUIA 4KJNA 3QO2A 4A3IB 1D5XC 1PTOB 1SXTA 4DU9A 1SYFA 2F0UA 4I65A 2WKCA 4UAIA 3V2TA 5E4XA 1NR2A 2FHTA 1SMYC 4C2MB 1S5ED 2MJ8A 1O78A 2EOTA 3R2TA 1DZ1A 1DOMA 4A3BB 2A6EC 1I4RA 5M3FB 4XTCS 3K5LA 2J7ZA 1GUGA 1QOHA 3ERQA 1STBA 5EKIA 3I4NB 1JORA 2EE1A 2EXZA 1SAPA 3T13A 1JWMD 3HEJA 2F0HA 4PV1C 1FD7D 2D5DA 2F0TA 3NWTA 4XYOA 4X3UA 4ZQ3A 1KAAA 4IUVA 5FKAC 3D6WA 2F0FA 2QF7A 2ICIA 4CHTB 3NQTA 1RDPD 2EY5A 3HGBA 1OXSC 3T53B 4DK1A 1AP0A 5I4DA 3NK9A 5J39A 1VF5C 3VYTA 4QUFA 3MAQA 2EYMA 2B2VA 3Q23A 5D14A 1SE2A 1XYIA 2A73B 3L9AX 3S1RB 5EBDA 3CKIB 3SVMA 2A68D 4R9WA 3A56A 5T1IA 4C3HG 1EY0A 3FMCA 5C4ZA 2E74C 1EY8A 1R9TB 4HSPA 2B2TC 1Z6HA 2RDFA 2HDLA 3LWEA 1LTAD 1QNUA 1HA6A 2F3VA 2QEJC 4HMJA 2EYJA 5E4WC 1PYWD 3TP5A 1ILQA 3CHBD 3D3RA 4JBWA 4DF7A 3K58A 4LJZC 1CHQD 4FYDA 2F0EA 4DAVA 3K59A 1H9RA 5EGTA 3T16A 4LAAA 3BYTB 1MSHA 3E5SA 3K57A 4IUTA 1MGSA 4IZ8A 4X3KA 1LTBD 1JOQA 4MN3A 1SYCA 3KLSX 3ZYYX 3NSWA 1BOSA 3M4YA 1RTOA 4K6DA 2A5HA 1B9NA 1E2VA 1A2UA 4RGMA 3GTQB 4ABNA 1SE4A 1HHVA 2JE6I 4OGQC 5M9OA 2K6AA 1B53A 3DHQA 1EY4A 2NVTB 2MHVA 4RHRA 1BF4A 2VB2X 3C1EA 4RGTA 5I2YA 2X69A 5EPJA 3IAYA 1R4PB 3M7GA 3RZDB 3GP7A 4P2CB 3KLSA 3TP8A 5LHY1 2R6GA 2EYFA 2L5TA 4QIWB 5EKLA 3H3VC 4ZKCB 2WAQB 1O7YA 5FLXE 3PUYA 1JC7A 4RFBA 4XXEA 5ELCA 3GTKB 1PRTC 4ME5A 1SNQA 3J7AF 3RD4A 2K28A 2ZXPA 3R2IA 2IX3A 4EGVA 1ENAA 3OIPA 4IN3A 4XQJA 1X32A 4EQPA 4BA2I 2JA7B 2A69C 3L3OC 1V43A 2PZTA 1Y8NB 4IFDG 2V4DA 3K5NA 4Q0FA 3I70A 4RGNA 2Q8TA 3S1MB 3MXPA 3I3CA 3HOZB 2KECA 3PUZA 4XQNA 3OIQA 2PCFB 5IGCA 1EIGA 1TR5A 3TN2A 5JVH3 4HSVA 2F0MA 1LLRD 4RKLA 4NDXA 3PIP3 5C0XH 2IX0A 1ML0D 1LT6D 1TQOA 2IW3A 1GOZA 2JYOA 3PV0A 3VR2A 1T5EA 1MSGA 4TRDA 1Q1EA 3C2PA 2BDNA 1IW7C 4N9TA 1RHPA 2B2VC 1PFMA 2VNUD 2F1MA 2K5DA 2K03A 4R8NA 1U4RA 4KHVA 1GXDC 2RBMA 3SDZA 1CTMA 2F0GA 2NVQB 4C3JB 2MGSA 1LT4D 2L9HA 5M5YB 3V05A 1W6JA 4BBRB 3RLFA 3BVZA 2K32A 3HRZC 2N88A 5EQ0A 1JCKB 1AW7A 2EYLA 1DJRD 3G7LA 2BE5C 2EY6A 4H44C 2R7ZB 4MIUA 3Q0AA 3W2DA 3BG3A 2K5WA 3IL8A 5ELEA 4ILWA 2RA4A 3HZXA 4HAEA 1KTKA 4R8IA 4KKSA 4C3JG 4IUUA 3QOLA 4FXKC 5HURA 1GHJA 2K1BA 4IFDH 1XXGA 1VCIA 1JWUD 3RZOB 2PYKA 1TS4A 1BBXC 5EPLA 4V190 1NSNS 3I72A 1QE6A 1V8QA 1LO5D 1ZKOA 1C4QA 2EVBA 2EPBA 4FF1A 1H9MA 3OW7A 4I7ZC 5IGEA 3C46A 4KY6A 3H0GB 2DNEA 3SE0A 1BCPF 2OXPA 3C3LA 2WP8J 1F2YA 5COYA 3SR1A 1PRTF 3FEWX 1PZJD 4B9WA 2VB3X 4UDUC 2M00A 3OWFA 1RODA 4RKBA 4A3KB 2F0IA 2A68C 1U9RA 2WV6D 2R92B 5I9PA 1QCBD 5NUCA 4G4KA 4F7XA 3SXHA 4BS9A 1Q12A 4C1NI 3DM1A 5FOBB 2F03A 2FMMA 2F0PA 5KEEA 1TY0A 1SYBA 5DAUA 4CJ2C 1F2LA 3N52A 5TSSA 1VDZA 4HN7A 5KNDA 3FRPB 2M9VA 2PMZB 4C3HB 5FLXL 5C5LA 2F0DA 3M85A 2EZVA 2E75C 3K7AB 2BA1A 2QDBA 3N6RA 1G8ZD 3GTMB 1W6KA 1I4GA 1D1IA 5JAVA 5KNBA 4G7HC 1JICA 3CRLC 1UEAB 2D2CC 3UI2A 1SFOB 5K36G 4AYBB 5JEAG 4TSSA 4ZRZA 3I4LA 4HTHA 1WTVA 5D65A 2NN6I 3IFTA 1HQRD 1STNA 1NR4A 1B3AA 2RVLA 3NTHA 3VR4A 2B39A 4OHJA 3TP7A 1TU2B 1U4PA 4ZYSA 4HCSA 5CGKA 1UAPA 2DY8A 4C56C 5C4HA 2EYHA 2BDOA 4Q5VA 1PMRA 1A15A 1B50A 1KDAA 1Y8PB 4FVMA 4KN7C 4KK7A 2B2WA 2EYPA 3VYRA 4RWSC 4OO1H 3FPPA 5DEHA 5JVG3 1XX8A 3K5MA 1EY9A 2J0TD 1QB5D 2GA4B 1GUTA 4PNYA 2OEOA 3OHXC 1EYDA 2E2JB 1SJED 1JB3A 1D1KA 3HOYB 2E2HB 4B08A 4KN4C 1A2TA 3EA6A 3AU7A 3DXJC 1WTPA 5IOCA 3J80L 3MA2B 3SK5A 3QWNA 1EY7A 1NCVA 4RCOA 2JA6B 1SYEA 1BXTA 5KYLA 5JEAH 4KTAA 1CFMA 5EKKA 2WINB 3SK8A 1STEA 5I2XA 1UUPA 3OOCA 1ENFA 1EYAA 5JEAJ 2Q8IB 3GTPB 2C9OA 4OIKA 1CM9A 1X3QA 3Q24A 3MFGA 3HS0C 1O7ZA 1S5DD 3PO3B 1E2WA 2EJFC 4K5VA 3NQIA 3SEBA 1JQYD 1YNND 3D31A 3CU7A 3KK7A 3I90A 2IWHA 4ID6A 1GUNA 1KDCA 2L11A 1CZGA 5C3WA 2BOSA 1EWCA 4DA2A 2RQXA 1B1ZA 3P1HA 1F9RA 5CORA 2B2YC 5DM63 1F9PA 4K14A 4ODGA 1L0YB 1M8AA 1E2ZA 1TS2A 3KUPA 3NXWA 3I4MB 2XIWA 3LX0A 1S5BD 5M3MB 1D5ZC 3GQBA 3HOUB 1WCMB 4F87A 4ULLA 1TIID 3L7ZC 4U673 1V1OA 2IPKD 5ELDA 4CKCA 1HCZA 1FNVA 1ZYRD 3DMUA 5G3LD 5T1GA 2QKIC 4L6TB 3JAME 3EROA 5KRUA 1ILPA 4MHEA 3DWPA 1CT1D 1PFNA 5C0XI 1EY6A 2F0LA 4XDXA 4KKUA 3E6ZX 2B2YA 1KNEA 4BWGB 4V0BA 2G9DA 3HG9A 5KIXA 3DEPA 3A8IE 3S17B 4CKEA 5CV7A 3FVQA 1GHKA 5CYUA 2VXWA 3PMFA 1MBYA 3W3AA 2ID0A 2PNRC 1JE4A 4FP5D 3GTLB 4A3JB 2LKVA 1CQFA 1TWHB 5HGTA 4H13C 2PZUA 5D3DA 1WD0A 3EJIA 2LMCB 1LTSD 4WFN3 2NN6G 1VMCA 2F0JA 4IUQA 3U9OA 4CJ0B 2AUKA 1JR0D 2SOBA 2BCOA 1HTPA 4A3MB 2O5JC 1HUNA 2J4XA 3S2HB 5IGBA 4RH6A 1BCPD 3OMCA 4LK1C 1HPCA 4KV6A 1XWEA 5CV4A 3KBGA 1PZID 4IFDI 3H09A 1RF2D 1IL8A 2NWGA 2L0CA 3C1FA 1TVXA 3GTGB 3OWEB 3FDTA 2ZXRA 1SSOA 2L4NA 1WTWA 1GUOA 1PLFA 5CBAE 3R8BA 5K36H 3DWAA 3D4RA 1STHA 1H9JA 1H9SA 4C3IG 1I50B 5CR3A 3HKZB 3VR6A 5JJZA 2CQAA 2SNMA 4IURA 3D4DA 4IALA 1E0BA 4CBVA 5KNCA 1RKNA 4A3DB 4FF4A 2RSOA 1QJOA 3K5OA 2CVRA 3IFDA 1DM0B 2A6HD 2NYZD 4XT1B 3WOFA 3R3OA 3MC0B 2XSCA 1D2BA 3MXUA 1EWHA 3VR5A 3MHBA 3U9SA 2SDFA 1SE3A 3RMHA 3MEHA 3ND9A 1CA5A 1TWGB 1VF7A 5LL6X 4QCLA 2HCCA 3QJYA 1SJHD 1BCPB 2A6ED 2KCNA 1DOLA 1LTGD 1PZKD 5AFWA 1KLUD 1EU4A 5JPNC 1Y1VB 2XWJB 4OO1G 2EDGA 1F77A 1HUMA 1L0XB 4CGYB 3TSSA 2F0NA 4KI0A 2NZ1D 5E3FA 1CZWA 4RAUC 5IGDA 4Z9CB 4FO2A 1R4QB 1I4QA 2KVMA 1TT2A 4FNFA 1TY2A 1NAPA 5ELBA 2NN6H 3VYUA 1DD2A 2JEAI 3S14B 5C4XB 4J8QA 4DNRB 1ESFA 3PO2B 1I4PA 4HEDA 3A55A 1O80A 5A2QE 4RHSA 2NUCA 1CI3M 2KEDA 1SNPA 2BA0A 3I73A 4ZKBB 2PW5A 5CBEE 4BY1B 3NPPA 3T56B 1K83B 2F0OA 3FPUB 2YU9B 4G7ZC 3VA7A 2EJGC 1D6EC 2PW7A 1CQVA 1SDFA 1UNSA 3WDNA 1I6HB 2DNCA 3BYYB 1SBBB 1HA5A 1S5CD 3BZDB 3D8GA 5FO8B 4OO1I 2R61A 4RGOS 1HTLD 3DEOA 5FO9B 1CK1A 3TP6A 3BDOA 3S16B 2EYOA 1LTID 1YNJC 3E0JA 1IW7D 2PPBC 3NE5B 5CV6A 1SYGA 1C48A 1EOTA 2K7VA 1Q8IA 3J7YW 1D5MC 2LFNA 3TBIB 1OXUA 2WB1B 1JOOA 1PRTB 2K01A 3GO5A 1FYCA 3A54A 2JSOA 1EYCA 2QCPX 1WTRA 1KNAA 2R3ZA 3A7LA 1FNUA 2JP1A 2WKDA 4GZYC 2B8GA 2B8FA 1EL0A 2I07B 4OL7A 2FJ2A 1TS5A 3S9WA 4PMCA 1IHZA 5IT9E 3KF8A 3ONAB 1O7LA 1J9OA 2L1BA 2XVSA 1A3VA 2DY7A 1HRJA 1TWCB 3GV6A 2Y0SB 1SMYD 5DM73 3SK6A 2MUYA 3P7JA 1IYVA 3BDLA 2XRQD 4PMBA 2IJ0A 4FF3A 3GTOB 3G6JB 1EY5A 3JAML 1I3QB 2A6HC 3MZ5A 4ZK9B 1EFID 3A7AB 3K0YA 4WJWA 5M5WB 2NTTA 2RDGA 4E6IA 2Z4IA 4WRDA 4KD4A 4KJOA 4IUPA 1OXTA 4WORA 2MPMA 1SNDA 3J81E 2XN9C 1JWSD 3A8JE 3MVVA 3J7AV 4H7BA 2BE5D 2D62A 4J6HA 3Q6SA 2F4IA 3K6OA 5IGFA 5C44B 1RJTA 3H91A 1EZ8A 1OXVA 1EZ6A 1I4XA 2AQ1B 2EJMA 1KLGD 4A3EB 1U4LA 1TS3A 4A3GB 2F0SA 4IQZA 1X3PA 3H94A 1LTRD 1J8IA 3NTIA 3URYA 1DOKA 5FK9C 3OMGA 2JA5B 3BVGA 3GD7A 3MXGA 4K8IA 5IT9L 4O1NA 1PXUA 3DUZA 3OPOA 1FGBD 3NBHA 2OT2A 2NTSA 4DAYA 2HUGA 3ITPA 2Z1CA 3HOVB 2C5CA 3BS1A 4CKBA 3HP3A 4KKTA 1ZEQX 3KBXA 1G2SA 5C3XA 1AZPA 5I6WA 1FNWA 1S5FD 1AZQA 1OO9B 3QOJA 2SNSA 4XT3B 2O4XA 1QNKA 4XYQA 1LV9A 4L8JA 4NKLA 1YNNC 3HOWB 2KJXA 1LACA 1SNMA 2RKSA 1KABA 5KGUA 3H6MA 2B2UC 5M5XB 2H1EA 4HCEA 1RD9D 1QG7A 1BNZA 3HOXB 1K8MA 3DWQA 1Y8OB 1LT5D 2LY7A 5IGGA 1WVLA 4HMIA 1DONA 1DXMA 3QIAA 2AWNA 1B9MA 4BY7B 4EVOA 3S15B 4A93B 3PUVA 2KEEA 1G291 3F2UA 2B2UA 4K8JA 4M1UB 4F8MA 3S2DB 2N55A 2MP1A 1Y1WB 2WACA 4FXDA 2A74C 5CV8A 1B2TA 3GV3A 1Q3LA 1JOKA 2E76C 5J22A 1PRTD 4TKOB 5EJWA 2D9UA 1WTOA 2EY1A 1NUCA 3T4AC 1HFNA 1G91A 3MFYA 4ZLTF 1GUWA 4QF4A 4A3FB 1EEFD 5E1FA 2VUMB 1WD1A 3NHHA 2K5QA 1ET6A 1IKLA 5D3IB 4K5WA 3CQZB 2IX1A 1WTXA 2AWOA 2ICEC 1B4OA 1PTOC 3P75A 3BDCA 2E2DC 2FMCA 1AEXA 1Q90A 1KDBA 5EBCA 3RUZA 4KY5A 1STGA 1LT3D 3EQLC 5BN5A 4RCNA 1Z47A 3KLRA 4DGZA 1EQTA 1CHPD 3R93A 4OIJA 5C0XJ 2F0QA 1H9SB 3TZUA 3M4OB 1PTOF 2M2LA 5F2DA 1ENCA 2HDMA 3LWUA 4DK0A 2ZT9C 2NB0A 4H0LC 5KYIA 4K5XA 1QILA 5BN4A 2F0KA 2LS01 4FF2A 5LL6S 1ET9A 2K04A 1G6ZA 4DAPA 5A35A 1F2ZA 2E2IB 1PTOH 2HQEA 2RSNA 2Z8LA 3TZDA 5CMDA 3EVQA 1C8CA 2B63B 3S1QB 1G2TA 2G9HD 4K6LA 5I9OA 2KUMA 4LMQD 5IIFA 2XNAC 3VR3A 4XIGS 5JPMC 1BR9A 2KCCA 3D6CA 4NMZA 3QG1A 4QMGA 3SK4A 1B44D 3AMUA 4K2LA 5CC4A 4BA1I 5J1ZA 4NW2A 4O42A 2CHBD 2RDHA 4JK1C 2KHSA 2X6LA 1TWFB 1PDQA 5FO7B 1V1PA 2IL8A 1LTTD 1BUVT 4EQNA 1I4HA 2XRSD 5K5PA 2B2TA 1F9SA 1F2MA 3CRKC 3PIO3 1FR3A 3T51B 3FKIB 3NWSA 4X3SA 1BCPC 3A8KE 1Y69U 2ZXOA 3NUCA 3ND8A 1SEBD 2K05A 2TSSA 4RA8A 5C5MA 4QUCA 2CW0D 1HFGA 4B9XA 3BVMA 2F0WA 2K33A 2PQEA 2FFKB 1A6XA 1IKMA 3LNNA 2TMPA 3X3MA 2F0VA 2H4OA 4IFDJ 1F9QA 1WTQA 4ZUJA 2Z4HA 1M4VA 4C3IB 5CV5A 3I8ZA 2KOLA 5ELFA 3VA5A 2DN8A 1ZYRC 3OSOA 2WIIB 1EEID 1Z7TA 3PUWA 2L55A 4J1MA 1ICWA 1EU3A 1STAA 2AQ3B 1IYUA 3X3NA 5CV9A 3PUXA 1LABA 4XQQA 3NP8A 2PO4A 1Q1BA 3O13A 2NBFA 4N9PA 3J81L 2JXMB 4F88A 2O2LD 1RTNA 4KY7A 1II3A 2HCIA 2F3WA 4CJ1B 1HQMC 1V1PB 2SEBD 3D4WA 4U68A 3TDQA 1AN8A 4QB4A 4KD3A 4DFAA 1U4MA 1TWAB 2O5IC 5ISRA 1GJXA 4DNTB 3J80E 4YIJA 2KA7A 3MXNA 1ONLA 5DNFA 3TMEA 1DCZA 4BBSB 2R93B 4G57A 3NTKA 1TKWB 4KMUC 1MI2A 2AQ2B 4NP5A 1EIHA 1I6VC 2EY2A 3SHLA 1BQQT 4K2KA 5C4JB 2B2WC 4Y7NB 1BDOA 3Q22A 2PZWA 5G3LF 2YYZA 1SNOA 2XWBB 2X6GA 1BO0A 4TQUS 4DXFA 2CW0C 1K8OA 2JEBI 3M7NA 3WOEA 5C3EB 2FINB 2NVXB 5C6AA 4DXGA 1YNJD 3MTSA 2OF1A 3M3YB 1CA6A 3QB3A 4FXGC 3IKJA 5EPKA 1HXYD 5JOBA 1MD2D 1A3TA 2Q8RE 5C0XG 1QWYA 3AB9A 1OXXK 1RCVD 5IODA 1PFBA 4EQOA 3S1NB 4HR7B 1T5XD 2QILA 2NVYB 1H9KA 2IT1A 1ZXTA 4M8AA 3P20A 1XTCD 4L63B 4G7OC 3V96A 4S3SA 3I91A 4ZAIA 1A3UA 1STYA 3VYSA 3GTJB 1ESRA 2ENBA 1DYQA 4X3TA 1PTOD 4IUNA 2JA8B 2A69D 3MWYW 4PMWA 4DN4M 3NBIA 1SNCA 1SYDA 1GUSA 4KHZA 5BN3A 1AFPA 2AUJD 5A2QL 2I46A 1EQVA 2KQ3A 1VMPA 4C1NK 3EFXD 2L12A 1S4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJI A;  2HQE A;  4F7X A;  5I6Y A;  3EVQ A;  3VA5 A;  4ZUI A;  5CV8 A;  1EY8 A;  3SXH A;  4ME5 A;  5C3W A;  2EYH A;  3BDL A;  4KJN A;  5C4H A;  1SNQ A;  5I9O A;  1JOK A;  5J22 A;  2PW7 A;  3OSO A;  3ITP A;  3MHB A;  4PMB A;  4DU9 A;  1SYF A;  2F0U A;  4I65 A;  2F0J A;  2RDF A;  3U9O A;  4J1M A;  3P1H A;  2EY1 A;  1KDA A;  3V2T A;  5IIF A;  1NUC A;  2EYL A;  1STA A;  2SOB A;  1EY5 A;  1ENA A;  2F0P A;  2F3V A;  5KEE A;  3MZ5 A;  3D8G A;  4HMJ A;  5C3X A;  3MEH A;  1SYB A;  5DAU A;  5I6W A;  2EY6 A;  4EQP A;  4K14 A;  2EYJ A;  2EYP A;  4QF4 A;  3D6C A;  5C6A A;  4NMZ A;  3TP5 A;  4ODG A;  5E1F A;  4QMG A;  5IGB A;  4MIU A;  5CV9 A;  5DEH A;  4E6I A;  3QOJ A;  3NHH A;  3OMC A;  4WRD A;  3SK4 A;  4DF7 A;  4KD4 A;  2SNS A;  4K2L A;  4KJO A;  5CC4 A;  2O4X A;  1EY9 A;  3HZX A;  2F0E A;  2OF1 A;  2PZT A;  3NXW A;  3TP6 A;  3QB3 A;  4NKL A;  5C5L A;  5J1Z A;  4KV6 A;  2EYO A;  2F0D A;  4WOR A;  5CV4 A;  3NP8 A;  3LX0 A;  3QOL A;  1SND A;  5EGT A;  4K5W A;  4PNY A;  2OEO A;  3T16 A;  4LAA A;  1SNM A;  1EYD A;  2RKS A;  5HUR A;  5JOB A;  3MXP A;  1KAB A;  5KGU A;  4N9P A;  2QDB A;  3ERQ A;  1A3T A;  5CV6 A;  1STB A;  1JOR A;  3E5S A;  1SYG A;  2KHS A;  2EXZ A;  3H6M A;  5JAV A;  3C1F A;  4IZ8 A;  4KY7 A;  2PYK A;  1II3 A;  3T13 A;  1A2T A;  5IOC A;  5IOD A;  1JOQ A;  3P75 A;  1SYC A;  1NSN S;  3MVV A;  4EQN A;  3HEJ A;  4EQO A;  2F0H A;  5IGC A;  5K5P A;  2F0N A;  1JOO A;  1TR5 A;  2F3W A;  1F2M A;  3BDC A;  4H7B A;  3SK5 A;  5E3F A;  2F0T A;  1EY7 A;  4K6D A;  4ZQ3 A;  5IGD A;  1EYC A;  1AEX A;  1KAA A;  1KDB A;  1STH A;  3RUZ A;  3D4W A;  1SYE A;  4KY5 A;  4J6H A;  4QB4 A;  4KD3 A;  4DFA A;  3DMU A;  1A2U A;  5IGE A;  5CR3 A;  1STG A;  2F0F A;  4KY6 A;  4KTA A;  5CGK A;  5KYL A;  2F0M A;  3ERO A;  1TT2 A;  5KRU A;  5EKK A;  3NUC A;  5IGF A;  4RKL A;  5ISR A;  2OXP A;  4NDX A;  3SK8 A;  3NQT A;  1EZ8 A;  5M9O A;  1EY6 A;  2F0L A;  3DHQ A;  1F2Y A;  4HTH A;  1EZ6 A;  1EY4 A;  4OL7 A;  4DGZ A;  5IGG A;  2EY5 A;  1TQO A;  4HMI A;  4S3S A;  4YIJ A;  3SR1 A;  2SNM A;  1A3U A;  1STY A;  1EYA A;  3NK9 A;  5C5M A;  5J39 A;  3C1E A;  3TME A;  4B9W A;  2ENB A;  5KIX A;  2F0Q A;  3S9W A;  1STN A;  4PMC A;  2F0S A;  4G57 A;  2M00 A;  4B9X A;  2EYM A;  1IHZ A;  5CV7 A;  5F2D A;  4IUN A;  1ENC A;  3OWF A;  3D4D A;  4EVO A;  4IAL A;  4TRD A;  2F0W A;  3OMG A;  1RKN A;  2PQE A;  3PMF A;  4NP5 A;  4RKB A;  3TP8 A;  1SNC A;  2EY2 A;  4K5V A;  1SYD A;  4K8J A;  4F8M A;  1A3V A;  3SHL A;  5KYI A;  4K5X A;  2NUC A;  4K2K A;  4N9T A;  4K8I A;  2F0I A;  2F0K A;  1SNP A;  3TP7 A;  2EYF A;  2LKV A;  1U9R A;  1EQV A;  2KQ3 A;  2F0V A;  5EKL A;  4R8N A;  5HGT A;  4KHV A;  2PZW A;  3R3O A;  2PW5 A;  2RBM A;  4ID6 A;  2PZU A;  1KDC A;  1SNO A;  1EY0 A;  3SK6 A;  4ZUJ A;  1F2Z A;  2WAC A;  5I9P A;  5C4Z A;  2F0G A;  2F0O A;  5NUC A;  5CV5 A; 
#chains in the Genus database with same CATH topology
 4JW0 A;  5I6Y A;  4PQX A;  4P75 A;  4ZUI A;  4KJN A;  3QO2 A;  4A3I B;  4B3R Q;  1D5X C;  4JBM A;  1PTO B;  1SXT A;  3F1Z A;  4DU9 A;  1SYF A;  2F0U A;  4I65 A;  2WKC A;  4UAI A;  3V2T A;  5E4X A;  1NR2 A;  2LSS A;  2FHT A;  2R7Z H;  1PHJ A;  5IYD G;  4CDF C;  1X9N A;  2CWP A;  4A3G G;  1SMY C;  4C2M B;  1S5E D;  2MJ8 A;  1HZB A;  1O78 A;  1IBL L;  2EOT A;  3R2T A;  1YNX A;  1DOM A;  1DZ1 A;  4A3B B;  2A6E C;  3RZD H;  2YTX A;  2I5M X;  4OX9 L;  1I4R A;  3S16 H;  4JI2 Q;  5M3F B;  4XTC S;  3RLO A;  3K5L A;  1PV4 A;  2J7Z A;  1GUG A;  1QOH A;  4L5R C;  3ERQ A;  1STB A;  5EKI A;  3I4N B;  1JOR A;  2EE1 A;  2Z9H A;  2EXZ A;  3CCE A;  1N33 L;  1SAP A;  1EQR A;  1Y14 B;  3T13 A;  4B3M Q;  1JWM D;  1HR0 W;  3FKI G;  3HEJ A;  2F0H A;  3H15 A;  4PV1 C;  3S2D H;  1FD7 D;  2D5D A;  2F0T A;  3NWT A;  4XYO A;  4X3U A;  4ZQ3 A;  4BBR G;  2JA5 G;  2UUB L;  1KAA A;  2GVB A;  4IUV A;  5FKA C;  3U50 C;  3D6W A;  4DR2 Q;  2F0F A;  2QF7 A;  2ICI A;  4CHT B;  1E1T A;  4LF6 Q;  4MNO A;  3NQT A;  4X62 L;  1GD7 A;  4JOI A;  1RDP D;  2EY5 A;  3HGB A;  1OXS C;  4JG2 A;  3T53 B;  4DK1 A;  5IWA L;  4OX9 Q;  1AP0 A;  5I4D A;  3NK9 A;  1SN8 A;  5J39 A;  1VF5 C;  3VYT A;  4QUF A;  3MAQ A;  2ZTE A;  4QJF A;  1RL2 A;  2EYM A;  4GKK L;  2B2V A;  2R7Z G;  3M4Q A;  3Q23 A;  5D14 A;  1PA6 A;  1SE2 A;  2Q2I A;  1XYI A;  2A73 B;  4BBS H;  3NEM A;  5C3E G;  3L9A X;  4POG A;  2K4K A;  3S1R B;  5EBD A;  2RCF A;  1B3Q A;  3CKI B;  3VDY A;  3SVM A;  5LMN L;  2A68 D;  4R9W A;  1HH2 P;  2N8N A;  3A56 A;  5T1I A;  4P72 A;  4C3H G;  1EY0 A;  1E7Z A;  3FMC A;  5C4Z A;  4RG1 A;  4X64 Q;  3K81 C;  2LXK A;  2E74 C;  1EY8 A;  1R9T B;  3I55 A;  4HSP A;  2B2T C;  1Z6H A;  3HOY G;  2RDF A;  1X6O A;  2HDL A;  3LWE A;  4GLX A;  1LTA D;  1HNW Q;  1QNU A;  1HA6 A;  3KF8 B;  1PH7 A;  4A3D G;  2F3V A;  2QEJ C;  4A3J G;  4HMJ A;  3PIP A;  2EYJ A;  5E4W C;  1PYW D;  4CDD C;  3TP5 A;  1ILQ A;  3I4M G;  3CHB D;  3J7A 5;  3KDF B;  2JQO A;  3D3R A;  4JBW A;  4DF7 A;  3K58 A;  4LJZ C;  1CHQ D;  1EYG A;  4FYD A;  2F0E A;  1WJJ A;  4DAV A;  3K59 A;  1H9R A;  5EGT A;  4GOP A;  3T16 A;  4C3I H;  4LAA A;  3BYT B;  1MSH A;  1VQC A;  3E5S A;  3K57 A;  4IUT A;  1MGS A;  4IZ8 A;  2OWO A;  4X3K A;  1LTB D;  1JOQ A;  3HOU H;  1EWI A;  4MN3 A;  1SYC A;  3KLS X;  2Z6K A;  3K7U C;  1YJW A;  3ZYY X;  3NSW A;  1BOS A;  3M4Y A;  1RTO A;  5DLQ E;  4K6D A;  2ES2 A;  4IOC A;  3HOV G;  2A5H A;  1B9N A;  4JI6 L;  1E2V A;  1A2U A;  4RGM A;  3GTQ B;  3CPF A;  4ABN A;  5M5X H;  1SE4 A;  1HHV A;  4QIW E;  2JE6 I;  4OGQ C;  1SRU A;  5M9O A;  2K6A A;  4DV4 Q;  1B53 A;  4A3M H;  1V9P A;  3DHQ A;  4A3F G;  1EY4 A;  2NVT B;  1YEZ A;  2MHV A;  4RHR A;  1BF4 A;  2VB2 X;  2NVT H;  3C1E A;  4RGT A;  1NE3 A;  5I2Y A;  1NY4 A;  2X69 A;  5EPJ A;  3IAY A;  1XNR L;  1EQQ A;  1R4P B;  1VQA A;  5FJ8 H;  3M7G A;  3CCL A;  3RZD B;  3GP7 A;  3PO2 H;  4P2C B;  4A3B H;  2PNH A;  3KLS A;  3TP8 A;  2OTJ A;  5LHY 1;  4IOA A;  2R6G A;  1I3Q H;  2EYF A;  2L5T A;  4QIW B;  5EKL A;  4R4T A;  3H3V C;  1XPU A;  2KCM A;  1MIU A;  3GTL H;  1X3E A;  4ZKC B;  3L2P A;  4DR3 L;  4R1J A;  2WAQ B;  1O7Y A;  3KDF A;  5FLX E;  4IPH A;  3PUY A;  1JC7 A;  4RFB A;  4XXE A;  5ELC A;  3GTK B;  1PRT C;  4OWT B;  4ME5 A;  3I7F A;  5C4X H;  3HOX H;  1SNQ A;  4AYB E;  3J7A F;  1WCM G;  3RD4 A;  2E8G A;  2RCN A;  2K28 A;  2ZXP A;  3R2I A;  2IX3 A;  4DR5 Q;  3ULL A;  1YJN A;  4HJ8 A;  4EGV A;  1ENA A;  3OIP A;  4IN3 A;  4A3K G;  4XQJ A;  3KJO A;  1X32 A;  4A3J H;  4EQP A;  4BA2 I;  4UP8 A;  2JA7 B;  2A69 C;  3L3O C;  1B7Y B;  4X65 Q;  1MHW C;  1V43 A;  2PZT A;  1L2F A;  1Y8N B;  3HKZ E;  4IFD G;  2V4D A;  3F2C A;  3K5N A;  4Q0F A;  3G48 A;  3I70 A;  4RGN A;  2Q8T A;  1CKN B;  3S1M B;  1FJG Q;  3MXP A;  4QL5 A;  3U4Z A;  1CKN A;  3I3C A;  3HOZ B;  4DUY Q;  3KYH C;  2KEC A;  3PUZ A;  2IHE A;  4XQN A;  5ELO A;  3OIQ A;  3S1R H;  2PCF B;  5IGC A;  1QVF A;  1EIG A;  1TR5 A;  3TS0 A;  4OEM B;  4YY3 L;  3TN2 A;  5JVH 3;  1R9T H;  4HSV A;  3A74 A;  2JA8 H;  2F0M A;  1LLR D;  5M3F G;  3GTP H;  4RKL A;  4NDX A;  3PIP 3;  3D0F A;  5C0X H;  2IX0 A;  4JPB W;  4H02 A;  1ML0 D;  1LT6 D;  1TQO A;  2IW3 A;  1BKB A;  1GOZ A;  2JYO A;  2JA8 G;  3A5U A;  3PV0 A;  3VR2 A;  1BVS A;  1T5E A;  3RNU A;  4K0K Q;  4ME3 A;  1MSG A;  4TRD A;  5J3B A;  1Q1E A;  2HT1 A;  1KQS A;  1W3S A;  3C2P A;  3ULP A;  2BDN A;  1IW7 C;  4N9T A;  1NJI C;  3OYY A;  1RHP A;  2B2V C;  4DV7 L;  1PFM A;  2GVA A;  2VNU D;  2F1M A;  1VQH A;  2K5D A;  2K03 A;  4R8N A;  2JA9 A;  1U4R A;  4KHV A;  1K9M C;  1GXD C;  5C44 G;  2RBM A;  2UUC L;  3SDZ A;  1CTM A;  2F0G A;  2NVQ B;  4C3J B;  2MGS A;  3HKS A;  2F4V L;  1LT4 D;  5GRO A;  2L9H A;  4EQ5 A;  3BZK A;  5M5Y B;  3V05 A;  2R93 H;  1W6J A;  4BBR B;  3RLF A;  2KBN A;  3BVZ A;  2K32 A;  3HRZ C;  2N88 A;  5EQ0 A;  1AW7 A;  1JCK B;  1PH2 A;  2EYL A;  1DJR D;  3W1G A;  1G6P A;  2YV5 A;  3G7L A;  4YY3 Q;  2BE5 C;  4PZ6 A;  2EY6 A;  4H44 C;  2R7Z B;  1VQK A;  1TWA H;  4MIU A;  3Q0A A;  3W2D A;  3BG3 A;  4JYA Q;  2K5W A;  3IL8 A;  4KHP L;  2VS1 A;  5ELE A;  4ILW A;  2RA4 A;  3J80 c;  1PFS A;  3HZX A;  4JI8 L;  2UXC L;  3SGI A;  4HAE A;  1KTK A;  4R8I A;  4KKS A;  4DUY L;  4C3J G;  4R4O A;  4IUU A;  3QOL A;  4FXK C;  5HUR A;  1GHJ A;  2K1B A;  4IFD H;  1XXG A;  1X3G A;  1VCI A;  1JWU D;  4A75 A;  3RZO B;  2PYK A;  1TS4 A;  1BBX C;  1MJC A;  5EPL A;  4V19 0;  1NSN S;  4OXP A;  1HNW L;  3I72 A;  1QE6 A;  1V8Q A;  1LO5 D;  2JJQ A;  2WB1 E;  1ZKO A;  5ELN A;  2UXD Q;  1C4Q A;  2EVB A;  2EPB A;  4A76 A;  4FF1 A;  1H9M A;  3OW7 A;  4I7Z C;  3CCJ A;  3T1Y L;  5IGE A;  3C46 A;  4KY6 A;  3H0G B;  1HNX Q;  2DNE A;  3SE0 A;  1JE5 A;  3G4S A;  2E2H H;  1BCP F;  2OXP A;  3C3L A;  2WP8 J;  1F2Y A;  5COY A;  3HOZ H;  3SR1 A;  1YIJ A;  5C4X G;  1PRT F;  3FEW X;  4N8F A;  1PZJ D;  4MTK A;  4B9W A;  2VB3 X;  4UDU C;  2M00 A;  3OWF A;  3TQY A;  3STB D;  4GN4 B;  1ROD A;  4RKB A;  2QGQ A;  3AEV A;  4A3K B;  3S1N H;  2F0I A;  2A68 C;  2E5L Q;  4TVA B;  1IBK L;  4JV5 L;  1U9R A;  2WV6 D;  2R92 B;  4NPS A;  4X62 Q;  2Q2H A;  5I9P A;  2DGY A;  2R7D A;  1QCB D;  4DV6 L;  1UE7 A;  5NUC A;  5IE8 A;  1VQD A;  4G4K A;  1WYD A;  4F7X A;  3NEL A;  3CCR A;  5H1S E;  3SXH A;  4BS9 A;  2YU9 H;  1Q12 A;  4DV4 L;  4C1N I;  3DM1 A;  3ZJY C;  5FOB B;  2CWA A;  2F03 A;  3ICE A;  1E1O A;  2FMM A;  2F0P A;  2VZA A;  5KEE A;  1N33 Q;  1TY0 A;  1SYB A;  5DAU A;  1VQ4 A;  4CJ2 C;  1GKH A;  1F2L A;  3N52 A;  5TSS A;  1VDZ A;  2D0P A;  4HN7 A;  4DR2 L;  2AMC B;  5KND A;  3FRP B;  2M9V A;  2PMZ B;  4C3H B;  1PYS B;  5FLX L;  3CCM A;  5C5L A;  4A3G H;  2K5H A;  2F0D A;  3M85 A;  2EZV A;  2E75 C;  3K7A B;  2BA1 A;  4B3M L;  2QDB A;  3N6R A;  4JI7 Q;  1G8Z D;  4JBK A;  1W6K A;  3GTM B;  1I4G A;  1D1I A;  1VQO A;  5JAV A;  5KNB A;  4G7H C;  4OON A;  1JIC A;  3CRL C;  1UEA B;  1I6H H;  2D2C C;  3UI2 A;  1SFO B;  3I4M H;  4JI2 L;  3BZC A;  1BBU A;  5K36 G;  4AYB B;  5JEA G;  4DAY B;  4X6A H;  4TSS A;  4ZRZ A;  3I4L A;  4GNX B;  4DK3 C;  2Z6K C;  4HTH A;  1WTV A;  3GTM H;  5D65 A;  2NN6 I;  3IFT A;  5JJK A;  5C44 H;  1P16 A;  1HQR D;  1STN A;  2ZJQ A;  2CKZ B;  1NR4 A;  1B3A A;  2RVL A;  3NTH A;  4C3J H;  2ALY B;  1LUZ A;  3W5O A;  3VR4 A;  2B39 A;  4OHJ A;  3TP7 A;  2HHH L;  3TEH B;  1TU2 B;  1K3B C;  2IHF A;  1U4P A;  3E9I A;  1Q7Y C;  4JI7 L;  4ZYS A;  3CME A;  3HOV H;  2CCZ A;  4HCS A;  4POF A;  5CGK A;  1UAP A;  1QUQ B;  4YWK A;  2DY8 A;  4C56 C;  5C4H A;  2EYH A;  3M4O H;  1GO3 E;  1YHB A;  2BDO A;  4Q5V A;  1PMR A;  1A15 A;  3M9B A;  1B50 A;  1KDA A;  1Y8P B;  3S2H H;  4FVM A;  3I2Z A;  4R4I A;  4JI8 Q;  2UXC Q;  4KN7 C;  4KK7 A;  2B2W A;  1KRS A;  4DV2 Q;  2EYP A;  3VYR A;  1XPO A;  2VW9 A;  4RWS C;  4OO1 H;  3FPP A;  5DEH A;  5JVG 3;  5IP9 G;  1XX8 A;  3E9H A;  3K5M A;  1K73 C;  4DR6 L;  4DV0 Q;  1EY9 A;  2J0T D;  1N32 L;  1QB5 D;  3AYH B;  2GA4 B;  1GUT A;  4PNY A;  2OEO A;  4LFA L;  3OHX C;  1EYD A;  4GKJ L;  2E2J B;  1SJE D;  1JB3 A;  1D1K A;  2DJG C;  2XTI A;  3OW2 A;  3HOY B;  2E2H B;  2E2J H;  4B08 A;  4KN4 C;  1A2T A;  3EA6 A;  3AU7 A;  3DXJ C;  5IOC A;  1WTP A;  3S1M H;  3H0G H;  3J80 L;  3MA2 B;  3SK5 A;  3QWN A;  4DV1 Q;  4GOP C;  1EY7 A;  4P73 A;  4P71 A;  1NCV A;  4RCO A;  2JA6 B;  2N3S A;  1SYE A;  2C35 B;  1BXT A;  4J15 A;  5KYL A;  5JEA H;  4KTA A;  2K5N A;  1CFM A;  5EKK A;  1CSP A;  2WIN B;  5C3E H;  3SK8 A;  1TWF H;  5LMU Q;  1STE A;  5I2X A;  1UUP A;  1XMO Q;  3OOC A;  1ENF A;  1EYA A;  5JEA J;  1CKM A;  2KEN A;  2Q8I B;  3GTP B;  2C9O A;  4OIK A;  1CM9 A;  2KHI A;  1X3Q A;  3J80 i;  3Q24 A;  1LM0 A;  5BR8 L;  4IPG A;  3MFG A;  1HR0 L;  3HS0 C;  1O7Z A;  1S5D D;  3PO3 B;  2VUM H;  4HID A;  1UE1 A;  1JMC A;  1E2W A;  2EJF C;  4K5V A;  3NQI A;  4B3T L;  5GAG C;  3SEB A;  1JQY D;  3ERS X;  2ATW A;  1YNN D;  3D31 A;  1ASY A;  3CU7 A;  3KK7 A;  1J6Q A;  3I90 A;  1I94 L;  4DR5 L;  2IWH A;  1XPR A;  3I4N G;  4ID6 A;  1GUN A;  1KDC A;  1XMQ Q;  4O0A A;  4LF4 Q;  2L11 A;  1CZG A;  5C3W A;  2BOS A;  3J7Z C;  1EWC A;  4DA2 A;  2RQX A;  1B1Z A;  3P1H A;  1F9R A;  5COR A;  2B2Y C;  1KXL A;  4HJ7 A;  5DM6 3;  3E3X A;  1F9P A;  4K14 A;  4ODG A;  2MO0 A;  3GTQ H;  1L0Y B;  1M8A A;  5AJ3 Q;  1E2Z A;  1TS2 A;  3KUP A;  3NXW A;  3I4M B;  4IPD A;  4LFC Q;  4WJ4 A;  3S1Q H;  3LX0 A;  2XIW A;  3GTK H;  1S5B D;  5M3M B;  4A3C G;  1D5Z C;  3GQB A;  3HOU B;  4HJ5 A;  4N8X 1;  4PZ8 A;  1WCM B;  4F87 A;  4ULL A;  5LMU L;  4LUO A;  1TII D;  1Q86 C;  4KHP Q;  3L7Z C;  4U67 3;  1V1O A;  1C0A A;  4DR3 Q;  1VS0 A;  2IPK D;  5ELD A;  2Q2U A;  3GTO H;  4CKC A;  1HCZ A;  3BJU A;  1HNZ Q;  1FNV A;  1ZYR D;  3KOJ A;  1VQG A;  3DMU A;  5G3L D;  5T1G A;  2QKI C;  4L6T B;  1L1O B;  5IY0 A;  2B63 H;  3JAM E;  2K52 A;  3ERO A;  2NVX H;  5KRU A;  1ILP A;  3RN5 A;  4MHE A;  3DWP A;  1CT1 D;  1PFN A;  5C0X I;  3HOY H;  1EY6 A;  2F0L A;  4XDX A;  4KKU A;  4KLK A;  3E6Z X;  2VUM G;  2B2Y A;  1KNE A;  4BWG B;  2PI2 A;  2F4V Q;  4V0B A;  2G9D A;  2KHJ A;  3HG9 A;  5KIX A;  3DEP A;  4L5Q A;  3A8I E;  2B3G A;  3S17 B;  4CKE A;  5CV7 A;  3FVQ A;  1GHK A;  5CYU A;  3RR5 A;  3A0J A;  2VXW A;  1PH9 A;  4DNI A;  3PMF A;  1MBY A;  3W3A A;  2ID0 A;  2JA7 H;  2PNR C;  4DV7 Q;  1JE4 A;  4FP5 D;  3GTL B;  4A3J B;  4JI1 L;  2CH4 W;  2A8V A;  2LKV A;  5C4J H;  1DGS A;  1CQF A;  1QVC A;  1VQJ A;  4OWW B;  1SMX A;  1Y1V H;  1TWH B;  5HGT A;  4GNX C;  4H13 C;  5HY6 A;  1Q46 A;  2PZU A;  5D3D A;  1WD0 A;  4OWX B;  1J5E L;  2D0O A;  1XMQ L;  3EJI A;  1YBY A;  2LMC B;  5IYC H;  1LTS D;  4WFN 3;  5HGQ A;  3JAM i;  2NN6 G;  1N36 L;  3PSI A;  1VMC A;  2F0J A;  2JA6 G;  4IUQ A;  3U9O A;  4CJ0 B;  3MXN B;  2AUK A;  1JR0 D;  2SOB A;  5IYB H;  4Y7N H;  2BCO A;  4DV3 Q;  1HTP A;  4A3M B;  3F2B A;  2O5J C;  1HUN A;  4DR7 Q;  2J4X A;  3S2H B;  1TXY A;  5IGB A;  4RH6 A;  2BH2 A;  1BCP D;  3OMC A;  1HZC A;  4LK1 C;  1HPC A;  1XMO L;  1SFO H;  4KV6 A;  1XWE A;  5CV4 A;  3KBG A;  1VQF A;  1P8L A;  1PZI D;  4IFD I;  3H09 A;  4A3I G;  1RF2 D;  5L37 A;  1IL8 A;  2NWG A;  4A3C H;  2L0C A;  3C1F A;  1TVX A;  3GTG B;  3OWE B;  3L0O A;  2UUA L;  3FDT A;  1GM5 A;  2ZXR A;  1SSO A;  2L4N A;  1WTW A;  1GUO A;  1PLF A;  5CBA E;  3R8B A;  4BY1 G;  5JJL A;  3CCU A;  3DWA A;  5K36 H;  3D4R A;  1STH A;  1H9J A;  1H9S A;  1K0R A;  2PQA A;  4C3I G;  1I50 B;  2XGT A;  3UDF A;  5BR8 Q;  4DKA C;  1VQ6 A;  3J81 c;  5CR3 A;  3HKZ B;  2NVQ H;  4YCV A;  4DV5 Q;  1Y1W H;  3VR6 A;  1N32 Q;  5M3M G;  5JJZ A;  2CQA A;  2SNM A;  3U4V A;  4LWC A;  4DV0 L;  4IUR A;  2I5L X;  4DV2 L;  3D4D A;  4B3S Q;  1I50 H;  1E0B A;  4IAL A;  4CBV A;  1X54 A;  4LF6 L;  5KNC A;  1RKN A;  4A3D B;  1FL0 A;  2RSO A;  4FF4 A;  1QJO A;  1EIF A;  2B29 A;  2I0Q A;  3K5O A;  4NXM Q;  2CVR A;  4JOI C;  3IFD A;  1DM0 B;  2A6H D;  2NYZ D;  4XT1 B;  3WOF A;  2WB1 G;  3KF6 B;  3R3O A;  4LNQ A;  3MC0 B;  1U0L A;  3G6E A;  2XSC A;  4YCW A;  1D2B A;  3MXU A;  2Y0S E;  1EWH A;  3VR5 A;  1QUQ A;  4DV6 Q;  3MHB A;  2HHH Q;  1H95 A;  3E0E A;  4BY7 G;  1SE8 A;  4A4I A;  3U9S A;  2SDF A;  1VQ9 A;  2UXD L;  1SE3 A;  3RMH A;  2QA4 A;  3OTO Q;  3MEH A;  3ND9 A;  1CA5 A;  3AFQ A;  1TWG B;  3EBE A;  3NBH B;  5FLM G;  1VF7 A;  1IXR A;  1KL9 A;  5LL6 X;  1JT8 A;  4QCL A;  2HCC A;  3QJY A;  1SJH D;  1BCP B;  2A6E D;  2KCN A;  2HD3 A;  4X64 L;  3CD6 A;  1DOL A;  1LTG D;  4QY7 A;  5FJ8 G;  1PZK D;  2E2I H;  5AFW A;  1KLU D;  1EU4 A;  5JPN C;  1KRT A;  1Y1V B;  2XWJ B;  4JYA L;  4OO1 G;  4JI5 Q;  2EDG A;  1F77 A;  1HUM A;  1WFQ A;  5M3M H;  1L0X B;  4CGY B;  3TSS A;  2ZJP A;  2F0N A;  4IPC A;  4KI0 A;  2NZ1 D;  1CZW A;  5E3F A;  4RAU C;  3MEF A;  5IGD A;  1C9O A;  2RF4 A;  1S3O A;  4Z9C B;  4FO2 A;  1R4Q B;  4GN3 B;  1I4Q A;  2KVM A;  1TT2 A;  4FNF A;  1TY2 A;  1NAP A;  5ELB A;  1HJP A;  2NN6 H;  3VYU A;  4JI0 Q;  1DD2 A;  3F2D A;  1G51 A;  2JEA I;  3S14 B;  5C4X B;  4O2D A;  1SLJ A;  4JVZ A;  3BU2 A;  4J8Q A;  4DNR B;  1ESF A;  3PO2 B;  1I4P A;  4HED A;  3HOZ G;  3CXC A;  2OQ0 A;  1O80 A;  3A55 A;  5A2Q E;  4RHS A;  2NUC A;  1CI3 M;  2KED A;  3WWV A;  1SNP A;  2BA0 A;  4A3E H;  1M1K C;  2JA7 G;  2HIV A;  3I73 A;  4ZKB B;  2PW5 A;  3M4P A;  3UE0 A;  5CBE E;  4BY1 B;  3NPP A;  4GKK Q;  1YVC A;  3T56 B;  1VQL A;  1K83 B;  2F0O A;  2R92 G;  3FPU B;  3CQZ H;  2YU9 B;  4B3S L;  4GLV B;  4G7Z C;  3H0G G;  3AFP A;  3HFZ B;  1QVG A;  3VA7 A;  2EJG C;  1UWV A;  1D6E C;  1K83 H;  2PW7 A;  1EUJ A;  4NXM L;  3FHW A;  1CQV A;  3A5Z B;  1SDF A;  1UNS A;  3WDN A;  1I6H B;  2R92 H;  2DNC A;  3BYY B;  5LMN W;  1SBB B;  5GAD C;  1HA5 A;  1S5C D;  3BZD B;  4R4C A;  3D8G A;  1PH6 A;  5FO8 B;  1WCM H;  4OO1 I;  2R61 A;  4RGO S;  3PGZ A;  1HTL D;  1PH1 A;  3DEO A;  4LW1 A;  5FO9 B;  1VQN A;  1CK1 A;  3TP6 A;  3BDO A;  3S16 B;  2PI2 E;  2EYO A;  4LF5 Q;  1FJG L;  1LTI D;  4DV5 L;  4YCU A;  1YNJ C;  3E0J A;  1IW7 D;  2PPB C;  3NE5 B;  5CV6 A;  3DM3 A;  1SYG A;  1C48 A;  1EOT A;  3T1Y Q;  2K7V A;  1KAW A;  1Q8I A;  3S24 A;  3J7Y W;  1D5M C;  2E5L L;  2LFN A;  1KC8 C;  1OXU A;  3TBI B;  3EIV A;  2WB1 B;  1JOO A;  3GO5 A;  1PRT B;  2K01 A;  1FYC A;  2DJF C;  3RN2 A;  3A54 A;  2JSO A;  3UDG A;  1EYC A;  2HQL A;  2QCP X;  4BBR H;  3CCV A;  1WTR A;  1L1O C;  1KNA A;  2R3Z A;  3A7L A;  2A1A A;  4A3I H;  1FNU A;  2JP1 A;  5GAH C;  4L5S A;  2WKD A;  1VQE A;  4GZY C;  2B8G A;  3RZO H;  3Q8D A;  1K3R A;  2B8F A;  1EL0 A;  2I07 B;  4OL7 A;  2UXB L;  5IP7 H;  1S40 A;  4A3L H;  4LF4 L;  5IT9 c;  2FJ2 A;  1TS5 A;  4DUZ Q;  3S9W A;  2RHS B;  4PMC A;  2VQF L;  4P74 A;  1IHZ A;  1VQP A;  5IT9 E;  4BXX H;  3KF8 A;  3ONA B;  1O7L A;  1J9O A;  1J5E Q;  1X3F A;  2K5V A;  2L1B A;  2XVS A;  1A3V A;  2DY7 A;  1HRJ A;  1TWC B;  2G5D A;  3GV6 A;  2Y0S B;  1SMY D;  2GN5 A;  2A19 A;  5DM7 3;  2NZO A;  3SK6 A;  2MUY A;  1YIT A;  3P7J A;  1IYV A;  1JJC B;  2UUC Q;  3HOX G;  3BDL A;  3J81 i;  2XRQ D;  2QW7 A;  2VQE L;  4PMB A;  2IJ0 A;  4FF3 A;  1IYJ B;  1L1O A;  3GTO B;  3G6J B;  1EY5 A;  3JAM L;  1I3Q B;  2A6H C;  3MZ5 A;  4ZK9 B;  1EFI D;  3A7A B;  3K0Y A;  4WJW A;  1N34 Q;  5M5W B;  1NMG A;  2N49 A;  2NTT A;  4JCV E;  2RDG A;  4E6I A;  1JJG A;  2Z4I A;  4WRD A;  4KD4 A;  4KJO A;  1LYL A;  3CP0 A;  1OXT A;  2K50 A;  4IUP A;  3M3Y H;  4WOR A;  2MPM A;  1SND A;  4YHH L;  4LFA Q;  3J81 E;  1WI5 A;  2VQE Q;  2XN9 C;  4A3E G;  5IP7 G;  2ZTD A;  4A3L G;  4A3F H;  1AE2 A;  4GN5 A;  4DR6 Q;  1JWS D;  3ER0 A;  5IP9 H;  3A8J E;  1EFW A;  3DLL A;  3K7A H;  3MVV A;  2EXD A;  3J7A V;  4H7B A;  3KFU A;  3PO3 G;  2BE5 D;  4IJH A;  2D62 A;  4J6H A;  4CDE C;  3Q6S A;  4K0K L;  2F4I A;  3H3V I;  2F3I A;  3K6O A;  3S14 H;  1K8A C;  5IGF A;  4X66 Q;  5C44 B;  1RJT A;  3H91 A;  1PH4 A;  1EZ8 A;  1OXV A;  2QDL A;  1EZ6 A;  1I4X A;  2AQ1 B;  2EJM A;  1KLG D;  4A3B G;  4A3E B;  1U4L A;  1TS3 A;  4A93 G;  3HOW H;  4B3T Q;  4A3G B;  2F0S A;  4IQZ A;  1X3P A;  3TS2 A;  3H94 A;  1LTR D;  1CUK A;  1J8I A;  3NTI A;  3URY A;  1DOK A;  5FK9 C;  3OMG A;  2DUD A;  1W2B A;  2JA5 B;  3BVG A;  3GD7 A;  3MXG A;  4K8I A;  1HZA A;  3HKZ G;  5IT9 L;  1I94 Q;  4O1N A;  3FP9 A;  1PXU A;  3DUZ A;  1PVO A;  3OPO A;  1S72 A;  2FXQ A;  1FGB D;  3NBH A;  3W1B A;  1PH8 A;  2CFM A;  3HOW G;  2OT2 A;  2NTS A;  3S17 H;  3HOU G;  4DAY A;  2HUG A;  3ITP A;  2Z1C A;  2C5C A;  3HOV B;  3BS1 A;  4CKB A;  3HP3 A;  4LF5 L;  4KKT A;  1ZEQ X;  1E22 A;  3KBX A;  2UXB Q;  3F8T A;  1G2S A;  5C3X A;  1M90 C;  1AZP A;  1ICF B;  5I6W A;  1FNW A;  1S5F D;  1AZQ A;  1OO9 B;  1XNR Q;  1XJV A;  3QOJ A;  3ULJ A;  2SNS A;  4XT3 B;  2O4X A;  2MNA A;  2V1C C;  1QNK A;  4XYQ A;  1LV9 A;  4L8J A;  4NKL A;  1YNN C;  1B8A A;  3HOW B;  3RLN A;  2KJX A;  3JAM c;  1LAC A;  1SNM A;  2RKS A;  1KAB A;  3EN2 A;  5KGU A;  3CMA A;  1X55 A;  3H6M A;  3J81 j;  3KJP A;  3I4N H;  4QGU A;  1C7Y A;  2B2U C;  3CF5 A;  1KIX A;  5M5X B;  2B63 G;  2H1E A;  1N9W A;  1IBL Q;  4HCE A;  1RD9 D;  3PO2 G;  1VQI A;  1QG7 A;  1BNZ A;  2UUB Q;  1B70 B;  3HOX B;  1K8M A;  4LUV A;  3DWQ A;  1Y8O B;  2WFW A;  1LT5 D;  2LY7 A;  5IGG A;  1XNQ L;  2YTY A;  1WVL A;  4HMI A;  2ZM6 L;  4MTN A;  1DON A;  3CC7 A;  3NEN A;  1DXM A;  3QIA A;  2AWN A;  3UDX A;  1GVP A;  4EX5 A;  1V1Q A;  4UP9 A;  1B9M A;  4BY7 B;  4EVO A;  3S15 B;  5EAY A;  4A93 B;  4FDB A;  3PUV A;  1NMF A;  2KEE A;  4JI3 Q;  2K75 A;  1G29 1;  3F2U A;  4M1U B;  2B2U A;  4K8J A;  4F8M A;  3S2D B;  2N55 A;  3STB C;  2MP1 A;  4JI0 L;  4Y52 H;  2Z0S A;  1Y1W B;  3I4O A;  3PCO B;  2WAC A;  4DUZ L;  3PO3 H;  1XTD A;  1RIP A;  1I5F A;  3CC4 A;  4FXD A;  2A74 C;  3KLW A;  5CV8 A;  3GV3 A;  1B2T A;  3PIO A;  1Q3L A;  1JOK A;  2E76 C;  5J22 A;  1PRT D;  2KCT A;  4GNX A;  4TKO B;  5EJW A;  2D9U A;  1WTO A;  2EY1 A;  1YHA A;  1NUC A;  3T4A C;  1HFN A;  3CW2 C;  1TWH H;  1WTH A;  1G91 A;  2PMZ E;  4YWM A;  3MFY A;  4ZLT F;  4JI4 Q;  1GUW A;  1VQ8 A;  4QF4 A;  4A3F B;  1EEF D;  5E1F A;  3K80 C;  2VUM B;  1PYB A;  1WD1 A;  3NHH A;  2JA6 H;  2K5Q A;  1SRO A;  1ET6 A;  1IKL A;  5D3I B;  4K5W A;  1U5K A;  3CQZ B;  1YJ9 A;  3KF6 A;  2IX1 A;  4JI5 L;  1LTL A;  3CPW A;  4L5T A;  2BH8 A;  1WTX A;  2AWO A;  3OTO L;  5LMN Q;  4DR4 L;  2ICE C;  2Y0S G;  4DR1 L;  1N8R C;  1B4O A;  1PTO C;  3P75 A;  3K8A A;  3TRE A;  2NVY H;  3BDC A;  1EIY B;  1D8L A;  2E2D C;  1IL2 A;  2FMC A;  1AEX A;  1Q90 A;  1KDB A;  5EBC A;  3RUZ A;  4KY5 A;  1STG A;  2K14 A;  1LT3 D;  3EQL C;  5E7N A;  5BN5 A;  2OTL A;  4RCN A;  4DK6 C;  1Z47 A;  3KLR A;  4NXN L;  4DGZ A;  2R93 G;  1EQT A;  4NXN Q;  1CHP D;  3U58 A;  1IBK Q;  3R93 A;  4JV5 Q;  4OIJ A;  2H5X A;  5C0X J;  2F0Q A;  4QQB X;  1H9S B;  2PQA B;  3TZU A;  3M4O B;  1PTO F;  2M2L A;  2AHO B;  5F2D A;  1XNQ Q;  1ENC A;  2HDM A;  1T9H A;  3LWU A;  4BBS G;  4DK0 A;  2Z6B A;  3UDI A;  2ZT9 C;  2NB0 A;  4H0L C;  5KYI A;  4K5X A;  3T1H L;  3T1H Q;  1QIL A;  5BN4 A;  2F0K A;  4WJ3 M;  1AE3 A;  2LS0 1;  4FF2 A;  5LL6 S;  2WAQ G;  5IYB G;  3JC6 6;  1ET9 A;  4B3R L;  2K04 A;  1G6Z A;  4DAP A;  2N78 A;  5A35 A;  1F2Z A;  2E2I B;  1PTO H;  4A93 H;  2HQE A;  2RSN A;  2Z8L A;  3TZD A;  5CMD A;  3EVQ A;  1C8C A;  2B63 B;  3S1Q B;  4PZ7 A;  4IO9 A;  1G2T A;  2G9H D;  4K6L A;  5I9O A;  2KUM A;  4LMQ D;  2UU9 L;  3H3V H;  4IJL A;  1A62 A;  5IIF A;  2XNA C;  3VR3 A;  2UUA Q;  3CCS A;  1Y1V G;  1VQ5 A;  1YHQ A;  1NNX A;  1CSQ A;  4XIG S;  5JPM C;  1IBM L;  1BR9 A;  2KCC A;  3PF4 A;  3D6C A;  4NMZ A;  1HNX L;  3QG1 A;  4QMG A;  3K0X A;  5JJI A;  3SK4 A;  1B44 D;  3AMU A;  3FKI H;  4K2L A;  1VQM A;  5CC4 A;  4AIM A;  4LF9 L;  3PF5 A;  3PQI A;  4DR4 Q;  4AQY Q;  4BA1 I;  5J1Z A;  2RHQ B;  4NW2 A;  4O42 A;  2CHB D;  2RDH A;  1KD1 C;  4JK1 C;  4C2M H;  2KHS A;  2X6L A;  1TWF B;  4UHV A;  1PDQ A;  5FO7 B;  4X66 L;  4LF8 L;  1V1P A;  2IL8 A;  1LTT D;  1BUV T;  4EQN A;  1I4H A;  2XRS D;  5K5P A;  2B2T A;  1F9S A;  5FLX c;  2L15 A;  3CRK C;  1F2M A;  1FGU A;  1O7I A;  3PIO 3;  1FR3 A;  3T51 B;  4C3H H;  1N36 Q;  3FKI B;  3NWS A;  3AQQ A;  4JBJ A;  4X3S A;  1MJE A;  1BCP C;  3A8K E;  1Y69 U;  2ZXO A;  5M5W H;  4BY7 H;  1NBW A;  2IY5 B;  1L0W A;  1VQB A;  3NUC A;  3ND8 A;  1SEB D;  3GDE A;  2K05 A;  2Q2T A;  2TSS A;  1CKO A;  4RA8 A;  1PH5 A;  4DAM A;  5C5M A;  2JN4 A;  3QR8 A;  4QUC A;  2CW0 D;  2VL6 A;  4JI1 Q;  4MZ9 A;  1HFG A;  4B9X A;  2CH4 A;  3BVM A;  4UY8 C;  2F0W A;  2K33 A;  2PQE A;  3TRZ A;  2FFK B;  3I56 A;  1A6X A;  4DPG A;  1IKM A;  1IZ6 A;  3LNN A;  1PH3 A;  2TMP A;  4BXX G;  4YWL A;  4JI3 L;  3X3M A;  2F0V A;  1VQ7 A;  2H4O A;  3GTG H;  2NZH A;  4IFD J;  1F9Q A;  1WTQ A;  4ZUJ A;  2Z4H A;  2JA5 H;  4APV A;  1M4V A;  4C3I B;  5CV5 A;  3I8Z A;  2EIF A;  2KOL A;  5ELF A;  3VA5 A;  1Y1W G;  2ZM6 Q;  2DN8 A;  1ZYR C;  3OSO A;  2WII B;  1EEI D;  4A3M G;  1Z7T A;  4LFB L;  3PUW A;  2L55 A;  1E24 A;  4GS3 A;  4AYB G;  4YHH Q;  4J1M A;  1ICW A;  1EU3 A;  3CCQ A;  1UEB A;  3IRB A;  1STA A;  4NB3 A;  2AQ3 B;  1IYU A;  1YI2 A;  3CC2 A;  1KHI A;  1A0I A;  2OQK A;  3X3N A;  5CV9 A;  5IYC G;  3PUX A;  1LAB A;  4XQQ A;  1UE5 A;  3NP8 A;  2WAQ E;  1X56 A;  3B6Y A;  4HIK A;  2PO4 A;  4CDC C;  1Q1B A;  3O13 A;  4ALP A;  1TWG H;  2P5Z X;  2NBF A;  4N9P A;  2QEX A;  4LF7 Q;  3J81 L;  2JXM B;  1MKH A;  1D7Q A;  4F88 A;  2O2L D;  1RTN A;  4KY7 A;  2VY3 A;  2HIX A;  1II3 A;  2HCI A;  1Q8K A;  1TWC H;  2F3W A;  4CJ1 B;  4LFC L;  1IBM Q;  4DR7 L;  1HZ9 A;  1HQM C;  4A3D H;  2JK8 A;  1V1P B;  2SEB D;  3G71 A;  3D4W A;  1UE6 A;  4U68 A;  1AN8 A;  4QB4 A;  4KD3 A;  1BBW A;  3TDQ A;  4DFA A;  1U4M A;  5AJ3 L;  4DV3 L;  1TWA B;  2R7F A;  1WOC A;  2OCE A;  2O5I C;  2YTV A;  5ISR A;  1GJX A;  1HR0 Q;  4JC0 A;  4DNT B;  3J80 E;  4HJ9 A;  4YIJ A;  2KA7 A;  1X65 A;  3MXN A;  1ONL A;  4X65 L;  4LUZ A;  5DNF A;  3TME A;  1DCZ A;  1SR3 A;  4BBS B;  5M3F H;  2R93 B;  4G57 A;  2ASB A;  4AQY L;  3NTK A;  2ZTC A;  1TKW B;  4KMU C;  1MI2 A;  1K8G A;  2AQ2 B;  3S15 H;  4NP5 A;  2LXJ A;  1EIH A;  1I6V C;  2EY2 A;  3SHL A;  1BQQ T;  4K2K A;  2MQH A;  1YZ6 A;  1FVI A;  4LFB Q;  1Z9F A;  5C4J B;  2B2W C;  4Y7N B;  1BDO A;  3Q22 A;  2PZW A;  5G3L F;  1OTC A;  2YYZ A;  4LF7 L;  1ASZ A;  1SNO A;  2XWB B;  1EOV A;  2X6G A;  1BO0 A;  4TQU S;  1E3P A;  4DXF A;  1QZG A;  4OEL B;  4GKJ Q;  2CW0 C;  4UPA A;  1K8O A;  3GTJ H;  2JEB I;  3M7N A;  2AKW B;  1A63 A;  1K0S A;  3WOE A;  5C3E B;  2ZJR A;  2FIN B;  4A3K H;  2NVX B;  1HNZ L;  1Q82 C;  5C6A A;  4DXG A;  4RMF A;  4DR1 Q;  1YNJ D;  5GQO A;  3MTS A;  4GLA C;  2OF1 A;  3M3Y B;  1CA6 A;  3QB3 A;  4FXG C;  3IKJ A;  5EPK A;  4DV1 L;  1AH9 A;  1HXY D;  4HIO A;  2MO1 A;  5JOB A;  1MD2 D;  1A3T A;  2Q8R E;  5C0X G;  4BY1 H;  1QWY A;  4JI6 Q;  4HIM A;  3AB9 A;  1OXX K;  1RCV D;  5IOD A;  1PFB A;  4EQO A;  5FLM H;  3S1N B;  4HR7 B;  1N34 L;  1T5X D;  1QZH A;  2I5H A;  2QIL A;  4JI4 L;  4AH6 A;  4R4Q A;  2NVY B;  1H9K A;  3CAM A;  4UP7 A;  2IT1 A;  5IYD H;  1ZXT A;  3LGJ A;  4M8A A;  3P20 A;  1XTC D;  4L63 B;  4G7O C;  3V96 A;  4I7A A;  4S3S A;  2EQS A;  3I91 A;  4ZAI A;  4ZCK A;  1A3U A;  1STY A;  4PG3 A;  3VYS A;  3GTJ B;  4LF9 Q;  1ESR A;  1JB7 A;  1K28 A;  2ENB A;  1DYQ A;  4X3T A;  1PTO D;  4GOP B;  4IUN A;  2JA8 B;  2F52 A;  5GAE C;  2A69 D;  3MWY W;  3NBI A;  1SNC A;  4PMW A;  4DN4 M;  1SYD A;  2MFI A;  1GUS A;  4KHZ A;  5BN3 A;  2CQO A;  1AFP A;  1NTG A;  2AUJ D;  5A2Q L;  2I46 A;  1EQV A;  2KQ3 A;  4LF8 Q;  1VMP A;  2UU9 Q;  1Q81 C;  5IWA Q;  4C1N K;  3EFX D;  4HJA A;  2VQF Q;  1A8V A;  3UE1 A;  1JJ2 A;  2L12 A;  1S4Z A;  5M5Y H; 
#chains in the Genus database with same CATH homology
 5I6Y A;  4PQX A;  4ZUI A;  4KJN A;  3QO2 A;  4A3I B;  1D5X C;  1PTO B;  1SXT A;  4DU9 A;  1SYF A;  2F0U A;  4I65 A;  2WKC A;  4UAI A;  3V2T A;  5E4X A;  1NR2 A;  2FHT A;  1SMY C;  4C2M B;  1S5E D;  2MJ8 A;  1O78 A;  2EOT A;  3R2T A;  1DZ1 A;  1DOM A;  4A3B B;  2A6E C;  1I4R A;  5M3F B;  4XTC S;  3K5L A;  2J7Z A;  1GUG A;  1QOH A;  3ERQ A;  1STB A;  5EKI A;  3I4N B;  1JOR A;  2EE1 A;  2EXZ A;  1SAP A;  3T13 A;  1JWM D;  3HEJ A;  2F0H A;  4PV1 C;  1FD7 D;  2D5D A;  2F0T A;  3NWT A;  4XYO A;  4X3U A;  4ZQ3 A;  1KAA A;  4IUV A;  5FKA C;  3D6W A;  2F0F A;  2QF7 A;  2ICI A;  4CHT B;  3NQT A;  1RDP D;  2EY5 A;  3HGB A;  1OXS C;  3T53 B;  4DK1 A;  1AP0 A;  5I4D A;  3NK9 A;  5J39 A;  1VF5 C;  3VYT A;  4QUF A;  3MAQ A;  2EYM A;  2B2V A;  3Q23 A;  5D14 A;  1SE2 A;  1XYI A;  2A73 B;  3L9A X;  3S1R B;  5EBD A;  3CKI B;  3SVM A;  2A68 D;  4R9W A;  3A56 A;  5T1I A;  4C3H G;  1EY0 A;  3FMC A;  5C4Z A;  2E74 C;  1EY8 A;  1R9T B;  4HSP A;  2B2T C;  1Z6H A;  2RDF A;  2HDL A;  3LWE A;  1LTA D;  1QNU A;  1HA6 A;  2F3V A;  2QEJ C;  4HMJ A;  2EYJ A;  5E4W C;  1PYW D;  3TP5 A;  1ILQ A;  3CHB D;  3D3R A;  4JBW A;  4DF7 A;  3K58 A;  4LJZ C;  1CHQ D;  4FYD A;  2F0E A;  4DAV A;  3K59 A;  1H9R A;  5EGT A;  3T16 A;  4LAA A;  3BYT B;  1MSH A;  3E5S A;  3K57 A;  4IUT A;  1MGS A;  4IZ8 A;  4X3K A;  1LTB D;  1JOQ A;  4MN3 A;  1SYC A;  3KLS X;  3ZYY X;  3NSW A;  1BOS A;  3M4Y A;  1RTO A;  4K6D A;  2A5H A;  1B9N A;  1E2V A;  1A2U A;  4RGM A;  3GTQ B;  4ABN A;  1SE4 A;  1HHV A;  2JE6 I;  4OGQ C;  5M9O A;  2K6A A;  1B53 A;  3DHQ A;  1EY4 A;  2NVT B;  2MHV A;  4RHR A;  1BF4 A;  2VB2 X;  3C1E A;  4RGT A;  5I2Y A;  2X69 A;  5EPJ A;  3IAY A;  1R4P B;  3M7G A;  3RZD B;  3GP7 A;  4P2C B;  3KLS A;  3TP8 A;  5LHY 1;  2R6G A;  2EYF A;  2L5T A;  4QIW B;  5EKL A;  3H3V C;  4ZKC B;  2WAQ B;  1O7Y A;  5FLX E;  3PUY A;  1JC7 A;  4RFB A;  4XXE A;  5ELC A;  3GTK B;  1PRT C;  4ME5 A;  1SNQ A;  3J7A F;  3RD4 A;  2K28 A;  2ZXP A;  3R2I A;  2IX3 A;  4EGV A;  1ENA A;  3OIP A;  4IN3 A;  4XQJ A;  1X32 A;  4EQP A;  4BA2 I;  2JA7 B;  2A69 C;  3L3O C;  1V43 A;  2PZT A;  1Y8N B;  4IFD G;  2V4D A;  3K5N A;  4Q0F A;  3I70 A;  4RGN A;  2Q8T A;  3S1M B;  3MXP A;  3I3C A;  3HOZ B;  2KEC A;  3PUZ A;  4XQN A;  3OIQ A;  2PCF B;  5IGC A;  1EIG A;  1TR5 A;  3TN2 A;  5JVH 3;  4HSV A;  2F0M A;  1LLR D;  4RKL A;  4NDX A;  3PIP 3;  5C0X H;  2IX0 A;  1ML0 D;  1LT6 D;  1TQO A;  2IW3 A;  1GOZ A;  2JYO A;  3PV0 A;  3VR2 A;  1T5E A;  1MSG A;  4TRD A;  1Q1E A;  3C2P A;  2BDN A;  1IW7 C;  4N9T A;  1RHP A;  2B2V C;  1PFM A;  2VNU D;  2F1M A;  2K5D A;  2K03 A;  4R8N A;  1U4R A;  4KHV A;  1GXD C;  2RBM A;  3SDZ A;  1CTM A;  2F0G A;  2NVQ B;  4C3J B;  2MGS A;  1LT4 D;  2L9H A;  5M5Y B;  3V05 A;  1W6J A;  4BBR B;  3RLF A;  3BVZ A;  2K32 A;  3HRZ C;  2N88 A;  5EQ0 A;  1JCK B;  1AW7 A;  2EYL A;  1DJR D;  3G7L A;  2BE5 C;  2EY6 A;  4H44 C;  2R7Z B;  4MIU A;  3Q0A A;  3W2D A;  3BG3 A;  2K5W A;  3IL8 A;  5ELE A;  4ILW A;  2RA4 A;  3HZX A;  4HAE A;  1KTK A;  4R8I A;  4KKS A;  4C3J G;  4IUU A;  3QOL A;  4FXK C;  5HUR A;  1GHJ A;  2K1B A;  4IFD H;  1XXG A;  1VCI A;  1JWU D;  3RZO B;  2PYK A;  1TS4 A;  1BBX C;  5EPL A;  4V19 0;  1NSN S;  3I72 A;  1QE6 A;  1V8Q A;  1LO5 D;  1ZKO A;  1C4Q A;  2EVB A;  2EPB A;  4FF1 A;  1H9M A;  3OW7 A;  4I7Z C;  5IGE A;  3C46 A;  4KY6 A;  3H0G B;  2DNE A;  3SE0 A;  1BCP F;  2OXP A;  3C3L A;  2WP8 J;  1F2Y A;  5COY A;  3SR1 A;  1PRT F;  3FEW X;  1PZJ D;  4B9W A;  2VB3 X;  4UDU C;  2M00 A;  3OWF A;  1ROD A;  4RKB A;  4A3K B;  2F0I A;  2A68 C;  1U9R A;  2WV6 D;  2R92 B;  5I9P A;  1QCB D;  5NUC A;  4G4K A;  4F7X A;  3SXH A;  4BS9 A;  1Q12 A;  4C1N I;  3DM1 A;  5FOB B;  2F03 A;  2FMM A;  2F0P A;  5KEE A;  1TY0 A;  1SYB A;  5DAU A;  4CJ2 C;  1F2L A;  3N52 A;  5TSS A;  1VDZ A;  4HN7 A;  5KND A;  3FRP B;  2M9V A;  2PMZ B;  4C3H B;  5FLX L;  5C5L A;  2F0D A;  3M85 A;  2EZV A;  2E75 C;  3K7A B;  2BA1 A;  2QDB A;  3N6R A;  1G8Z D;  3GTM B;  1W6K A;  1I4G A;  1D1I A;  5JAV A;  5KNB A;  4G7H C;  1JIC A;  3CRL C;  1UEA B;  2D2C C;  3UI2 A;  1SFO B;  5K36 G;  4AYB B;  5JEA G;  4TSS A;  4ZRZ A;  3I4L A;  4HTH A;  1WTV A;  5D65 A;  2NN6 I;  3IFT A;  1HQR D;  1STN A;  1NR4 A;  1B3A A;  2RVL A;  3NTH A;  3VR4 A;  2B39 A;  4OHJ A;  3TP7 A;  1TU2 B;  1U4P A;  4ZYS A;  4HCS A;  5CGK A;  1UAP A;  2DY8 A;  4C56 C;  5C4H A;  2EYH A;  2BDO A;  4Q5V A;  1PMR A;  1A15 A;  1B50 A;  1KDA A;  1Y8P B;  4FVM A;  4KN7 C;  4KK7 A;  2B2W A;  2EYP A;  3VYR A;  4RWS C;  4OO1 H;  3FPP A;  5DEH A;  5JVG 3;  1XX8 A;  3K5M A;  1EY9 A;  2J0T D;  1QB5 D;  2GA4 B;  1GUT A;  4PNY A;  2OEO A;  3OHX C;  1EYD A;  2E2J B;  1SJE D;  1JB3 A;  1D1K A;  3HOY B;  2E2H B;  4B08 A;  4KN4 C;  1A2T A;  3EA6 A;  3AU7 A;  3DXJ C;  1WTP A;  5IOC A;  3J80 L;  3MA2 B;  3SK5 A;  3QWN A;  1EY7 A;  1NCV A;  4RCO A;  2JA6 B;  1SYE A;  1BXT A;  5KYL A;  5JEA H;  4KTA A;  1CFM A;  5EKK A;  2WIN B;  3SK8 A;  1STE A;  5I2X A;  1UUP A;  3OOC A;  1ENF A;  1EYA A;  5JEA J;  2Q8I B;  3GTP B;  2C9O A;  4OIK A;  1CM9 A;  1X3Q A;  3Q24 A;  3MFG A;  3HS0 C;  1O7Z A;  1S5D D;  3PO3 B;  1E2W A;  2EJF C;  4K5V A;  3NQI A;  3SEB A;  1JQY D;  1YNN D;  3D31 A;  3CU7 A;  3KK7 A;  3I90 A;  2IWH A;  4ID6 A;  1GUN A;  1KDC A;  2L11 A;  1CZG A;  5C3W A;  2BOS A;  1EWC A;  4DA2 A;  2RQX A;  1B1Z A;  3P1H A;  1F9R A;  5COR A;  2B2Y C;  5DM6 3;  1F9P A;  4K14 A;  4ODG A;  1L0Y B;  1M8A A;  1E2Z A;  1TS2 A;  3KUP A;  3NXW A;  3I4M B;  2XIW A;  3LX0 A;  1S5B D;  5M3M B;  1D5Z C;  3GQB A;  3HOU B;  1WCM B;  4F87 A;  4ULL A;  1TII D;  3L7Z C;  4U67 3;  1V1O A;  2IPK D;  5ELD A;  4CKC A;  1HCZ A;  1FNV A;  1ZYR D;  3DMU A;  5G3L D;  5T1G A;  2QKI C;  4L6T B;  3JAM E;  3ERO A;  5KRU A;  1ILP A;  4MHE A;  3DWP A;  1CT1 D;  1PFN A;  5C0X I;  1EY6 A;  2F0L A;  4XDX A;  4KKU A;  3E6Z X;  2B2Y A;  1KNE A;  4BWG B;  4V0B A;  2G9D A;  3HG9 A;  5KIX A;  3DEP A;  3A8I E;  3S17 B;  4CKE A;  5CV7 A;  3FVQ A;  1GHK A;  5CYU A;  2VXW A;  3PMF A;  1MBY A;  3W3A A;  2ID0 A;  2PNR C;  1JE4 A;  4FP5 D;  3GTL B;  4A3J B;  2LKV A;  1CQF A;  1TWH B;  5HGT A;  4H13 C;  2PZU A;  5D3D A;  1WD0 A;  3EJI A;  2LMC B;  1LTS D;  4WFN 3;  2NN6 G;  1VMC A;  2F0J A;  4IUQ A;  3U9O A;  4CJ0 B;  2AUK A;  1JR0 D;  2SOB A;  2BCO A;  1HTP A;  4A3M B;  2O5J C;  1HUN A;  2J4X A;  3S2H B;  5IGB A;  4RH6 A;  1BCP D;  3OMC A;  4LK1 C;  1HPC A;  4KV6 A;  1XWE A;  5CV4 A;  3KBG A;  1PZI D;  4IFD I;  3H09 A;  1RF2 D;  1IL8 A;  2NWG A;  2L0C A;  3C1F A;  1TVX A;  3GTG B;  3OWE B;  3FDT A;  2ZXR A;  1SSO A;  2L4N A;  1WTW A;  1GUO A;  1PLF A;  5CBA E;  3R8B A;  5K36 H;  3DWA A;  3D4R A;  1STH A;  1H9J A;  1H9S A;  4C3I G;  1I50 B;  5CR3 A;  3HKZ B;  3VR6 A;  5JJZ A;  2CQA A;  2SNM A;  4IUR A;  3D4D A;  4IAL A;  1E0B A;  4CBV A;  5KNC A;  1RKN A;  4A3D B;  4FF4 A;  2RSO A;  1QJO A;  3K5O A;  2CVR A;  3IFD A;  1DM0 B;  2A6H D;  2NYZ D;  4XT1 B;  3WOF A;  3R3O A;  3MC0 B;  2XSC A;  1D2B A;  3MXU A;  1EWH A;  3VR5 A;  3MHB A;  3U9S A;  2SDF A;  1SE3 A;  3RMH A;  3MEH A;  3ND9 A;  1CA5 A;  1TWG B;  1VF7 A;  5LL6 X;  4QCL A;  2HCC A;  3QJY A;  1SJH D;  1BCP B;  2A6E D;  2KCN A;  1DOL A;  1LTG D;  1PZK D;  5AFW A;  1KLU D;  1EU4 A;  5JPN C;  1Y1V B;  2XWJ B;  4OO1 G;  2EDG A;  1F77 A;  1HUM A;  1L0X B;  4CGY B;  3TSS A;  2F0N A;  4KI0 A;  2NZ1 D;  5E3F A;  1CZW A;  4RAU C;  5IGD A;  4Z9C B;  4FO2 A;  1R4Q B;  1I4Q A;  2KVM A;  1TT2 A;  4FNF A;  1TY2 A;  1NAP A;  5ELB A;  2NN6 H;  3VYU A;  1DD2 A;  2JEA I;  3S14 B;  5C4X B;  4J8Q A;  4DNR B;  1ESF A;  3PO2 B;  1I4P A;  4HED A;  3A55 A;  1O80 A;  5A2Q E;  4RHS A;  2NUC A;  1CI3 M;  2KED A;  1SNP A;  2BA0 A;  3I73 A;  4ZKB B;  2PW5 A;  5CBE E;  4BY1 B;  3NPP A;  3T56 B;  1K83 B;  2F0O A;  3FPU B;  2YU9 B;  4G7Z C;  3VA7 A;  2EJG C;  1D6E C;  2PW7 A;  1CQV A;  1SDF A;  1UNS A;  3WDN A;  1I6H B;  2DNC A;  3BYY B;  1SBB B;  1HA5 A;  1S5C D;  3BZD B;  3D8G A;  5FO8 B;  4OO1 I;  2R61 A;  4RGO S;  1HTL D;  3DEO A;  5FO9 B;  1CK1 A;  3TP6 A;  3BDO A;  3S16 B;  2EYO A;  1LTI D;  1YNJ C;  3E0J A;  1IW7 D;  2PPB C;  3NE5 B;  5CV6 A;  1SYG A;  1C48 A;  1EOT A;  2K7V A;  1Q8I A;  3J7Y W;  1D5M C;  2LFN A;  3TBI B;  1OXU A;  2WB1 B;  1JOO A;  1PRT B;  2K01 A;  3GO5 A;  1FYC A;  3A54 A;  2JSO A;  1EYC A;  2QCP X;  1WTR A;  1KNA A;  2R3Z A;  3A7L A;  1FNU A;  2JP1 A;  2WKD A;  4GZY C;  2B8G A;  2B8F A;  1EL0 A;  2I07 B;  4OL7 A;  2FJ2 A;  1TS5 A;  3S9W A;  4PMC A;  1IHZ A;  5IT9 E;  3KF8 A;  3ONA B;  1O7L A;  1J9O A;  2L1B A;  2XVS A;  1A3V A;  2DY7 A;  1HRJ A;  1TWC B;  3GV6 A;  2Y0S B;  1SMY D;  5DM7 3;  3SK6 A;  2MUY A;  3P7J A;  1IYV A;  3BDL A;  2XRQ D;  4PMB A;  2IJ0 A;  4FF3 A;  3GTO B;  3G6J B;  1EY5 A;  3JAM L;  1I3Q B;  2A6H C;  3MZ5 A;  4ZK9 B;  1EFI D;  3A7A B;  3K0Y A;  4WJW A;  5M5W B;  2NTT A;  2RDG A;  4E6I A;  2Z4I A;  4WRD A;  4KD4 A;  4KJO A;  4IUP A;  1OXT A;  4WOR A;  2MPM A;  1SND A;  3J81 E;  2XN9 C;  1JWS D;  3A8J E;  3MVV A;  3J7A V;  4H7B A;  2BE5 D;  2D62 A;  4J6H A;  3Q6S A;  2F4I A;  3K6O A;  5IGF A;  5C44 B;  1RJT A;  3H91 A;  1EZ8 A;  1OXV A;  1EZ6 A;  1I4X A;  2AQ1 B;  2EJM A;  1KLG D;  4A3E B;  1U4L A;  1TS3 A;  4A3G B;  2F0S A;  4IQZ A;  1X3P A;  3H94 A;  1LTR D;  1J8I A;  3NTI A;  3URY A;  1DOK A;  5FK9 C;  3OMG A;  2JA5 B;  3BVG A;  3GD7 A;  3MXG A;  4K8I A;  5IT9 L;  4O1N A;  1PXU A;  3DUZ A;  3OPO A;  1FGB D;  3NBH A;  2OT2 A;  2NTS A;  4DAY A;  2HUG A;  3ITP A;  2Z1C A;  3HOV B;  2C5C A;  3BS1 A;  4CKB A;  3HP3 A;  4KKT A;  1ZEQ X;  3KBX A;  1G2S A;  5C3X A;  1AZP A;  5I6W A;  1FNW A;  1S5F D;  1AZQ A;  1OO9 B;  3QOJ A;  2SNS A;  4XT3 B;  2O4X A;  1QNK A;  4XYQ A;  1LV9 A;  4L8J A;  4NKL A;  1YNN C;  3HOW B;  2KJX A;  1LAC A;  1SNM A;  2RKS A;  1KAB A;  5KGU A;  3H6M A;  2B2U C;  5M5X B;  2H1E A;  4HCE A;  1RD9 D;  1QG7 A;  1BNZ A;  3HOX B;  1K8M A;  3DWQ A;  1Y8O B;  1LT5 D;  2LY7 A;  5IGG A;  1WVL A;  4HMI A;  1DON A;  1DXM A;  3QIA A;  2AWN A;  1B9M A;  4BY7 B;  4EVO A;  3S15 B;  4A93 B;  3PUV A;  2KEE A;  1G29 1;  3F2U A;  2B2U A;  4K8J A;  4M1U B;  4F8M A;  3S2D B;  2N55 A;  2MP1 A;  1Y1W B;  2WAC A;  4FXD A;  2A74 C;  5CV8 A;  1B2T A;  3GV3 A;  1Q3L A;  1JOK A;  2E76 C;  5J22 A;  1PRT D;  4TKO B;  5EJW A;  2D9U A;  1WTO A;  2EY1 A;  1NUC A;  3T4A C;  1HFN A;  1G91 A;  3MFY A;  4ZLT F;  1GUW A;  4QF4 A;  4A3F B;  1EEF D;  5E1F A;  2VUM B;  1WD1 A;  3NHH A;  2K5Q A;  1ET6 A;  1IKL A;  5D3I B;  4K5W A;  3CQZ B;  2IX1 A;  1WTX A;  2AWO A;  2ICE C;  1B4O A;  1PTO C;  3P75 A;  3BDC A;  2E2D C;  2FMC A;  1AEX A;  1Q90 A;  1KDB A;  5EBC A;  3RUZ A;  4KY5 A;  1STG A;  1LT3 D;  3EQL C;  5BN5 A;  4RCN A;  1Z47 A;  3KLR A;  4DGZ A;  1EQT A;  1CHP D;  3R93 A;  4OIJ A;  5C0X J;  2F0Q A;  1H9S B;  3TZU A;  3M4O B;  1PTO F;  2M2L A;  5F2D A;  1ENC A;  2HDM A;  3LWU A;  4DK0 A;  2ZT9 C;  2NB0 A;  4H0L C;  5KYI A;  4K5X A;  1QIL A;  5BN4 A;  2F0K A;  2LS0 1;  4FF2 A;  5LL6 S;  1ET9 A;  2K04 A;  1G6Z A;  4DAP A;  5A35 A;  1F2Z A;  2E2I B;  1PTO H;  2HQE A;  2RSN A;  2Z8L A;  3TZD A;  5CMD A;  3EVQ A;  1C8C A;  2B63 B;  3S1Q B;  1G2T A;  2G9H D;  4K6L A;  5I9O A;  2KUM A;  4LMQ D;  5IIF A;  2XNA C;  3VR3 A;  4XIG S;  5JPM C;  1BR9 A;  2KCC A;  3D6C A;  4NMZ A;  3QG1 A;  4QMG A;  3SK4 A;  1B44 D;  3AMU A;  4K2L A;  5CC4 A;  4BA1 I;  5J1Z A;  4NW2 A;  4O42 A;  2CHB D;  2RDH A;  4JK1 C;  2KHS A;  2X6L A;  1TWF B;  1PDQ A;  5FO7 B;  1V1P A;  2IL8 A;  1LTT D;  1BUV T;  4EQN A;  1I4H A;  2XRS D;  5K5P A;  2B2T A;  1F9S A;  1F2M A;  3CRK C;  3PIO 3;  1FR3 A;  3T51 B;  3FKI B;  3NWS A;  4X3S A;  1BCP C;  3A8K E;  1Y69 U;  2ZXO A;  3NUC A;  3ND8 A;  1SEB D;  2K05 A;  2TSS A;  4RA8 A;  5C5M A;  4QUC A;  2CW0 D;  1HFG A;  4B9X A;  3BVM A;  2F0W A;  2K33 A;  2PQE A;  2FFK B;  1A6X A;  1IKM A;  3LNN A;  2TMP A;  3X3M A;  2F0V A;  2H4O A;  4IFD J;  1F9Q A;  1WTQ A;  4ZUJ A;  2Z4H A;  1M4V A;  4C3I B;  5CV5 A;  3I8Z A;  2KOL A;  5ELF A;  3VA5 A;  2DN8 A;  1ZYR C;  3OSO A;  2WII B;  1EEI D;  1Z7T A;  3PUW A;  2L55 A;  4J1M A;  1ICW A;  1EU3 A;  1STA A;  2AQ3 B;  1IYU A;  3X3N A;  5CV9 A;  3PUX A;  1LAB A;  4XQQ A;  3NP8 A;  2PO4 A;  1Q1B A;  3O13 A;  2NBF A;  4N9P A;  3J81 L;  2JXM B;  4F88 A;  2O2L D;  1RTN A;  4KY7 A;  1II3 A;  2HCI A;  2F3W A;  4CJ1 B;  1HQM C;  1V1P B;  2SEB D;  3D4W A;  4U68 A;  3TDQ A;  1AN8 A;  4QB4 A;  4KD3 A;  4DFA A;  1U4M A;  1TWA B;  2O5I C;  5ISR A;  1GJX A;  4DNT B;  3J80 E;  4YIJ A;  2KA7 A;  3MXN A;  1ONL A;  5DNF A;  3TME A;  1DCZ A;  4BBS B;  2R93 B;  4G57 A;  3NTK A;  1TKW B;  4KMU C;  1MI2 A;  2AQ2 B;  4NP5 A;  1EIH A;  1I6V C;  2EY2 A;  3SHL A;  1BQQ T;  4K2K A;  5C4J B;  2B2W C;  4Y7N B;  1BDO A;  3Q22 A;  2PZW A;  5G3L F;  2YYZ A;  1SNO A;  2XWB B;  2X6G A;  1BO0 A;  4TQU S;  4DXF A;  2CW0 C;  1K8O A;  2JEB I;  3M7N A;  3WOE A;  5C3E B;  2FIN B;  2NVX B;  5C6A A;  4DXG A;  1YNJ D;  3MTS A;  2OF1 A;  3M3Y B;  1CA6 A;  3QB3 A;  4FXG C;  3IKJ A;  5EPK A;  1HXY D;  5JOB A;  1MD2 D;  1A3T A;  2Q8R E;  5C0X G;  1QWY A;  3AB9 A;  1OXX K;  1RCV D;  5IOD A;  1PFB A;  4EQO A;  3S1N B;  4HR7 B;  1T5X D;  2QIL A;  2NVY B;  1H9K A;  2IT1 A;  1ZXT A;  4M8A A;  3P20 A;  1XTC D;  4L63 B;  4G7O C;  3V96 A;  4S3S A;  3I91 A;  4ZAI A;  1A3U A;  1STY A;  3VYS A;  3GTJ B;  1ESR A;  2ENB A;  1DYQ A;  4X3T A;  1PTO D;  4IUN A;  2JA8 B;  2A69 D;  3MWY W;  4PMW A;  4DN4 M;  3NBI A;  1SNC A;  1SYD A;  1GUS A;  4KHZ A;  5BN3 A;  1AFP A;  2AUJ D;  5A2Q L;  2I46 A;  1EQV A;  2KQ3 A;  1VMP A;  4C1N K;  3EFX D;  2L12 A;  1S4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...