3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
5C0XG 5JEAG 3PUWA 3BDOA 1Q1EA 2L5TA 3A8KE 3PUXA 3VR6A 4GZYC 1DD2A 3PUVA 2QF7A 3M7NA 3FPPA 4BA2I 1B9MA 2PPBC 3KLRA 1DXMA 4KKTA 3I73A 4TKOB 3QG1A 1OXSC 4JBWA 1Q12A 4KN7C 3M4YA 1GHKA 1G291 2B8FA 4JK1C 2BA1A 3M85A 1E2VA 1ONLA 1Q90A 3EQLC 1GUTA 3A7AB 3QIAA 4KMUC 2KA7A 2BDOA 3IKJA 4RCNA 1T5EA 2LMCB 2KCCA 1O78A 4PV1C 1HTPA 3LNNA 1B9NA 2NN6I 1FYCA 2PNRC 4LJZC 1BDOA 2A69C 1ZKOA 2EDGA 4IFDH 1TKWB 2ZT9C 4IFDG 1K8OA 4OGQC 3VR2A 4HR7B 3A8JE 1TU2B 5KNDA 2JXMB 2E75C 2JE6I 4L8JA 3SE0A 1Y8NB 2AUKA 3FMCA 1CTMA 3OOCA 2Q8IB 2EVBA 4H44C 2EJGC 3PUZA 1OXUA 1CI3M 5A35A 1VDZA 2A68D 2D62A 2A68C 4DNTB 2YYZA 4KKUA 4G7HC 3P20A 1H9KA 4KKSA 1V43A 1VF7A 1Y8PB 2EJMA 1GUOA 1O7LA 2K32A 3T51B 1FR3A 2R6GA 3VR4A 1SMYC 3U9SA 1GJXA 3H94A 1Q1BA 2PCFB 5JEAH 2A6HD 1K8MA 2A6HC 3A7LA 4DNRB 3RLFA 3VR5A 1E2ZA 1H9JA 3D31A 3QJYA 1VF5C 2A69D 2D5DA 1OXXK 2E74C 3T56B 2BE5C 2DNCA 1PMRA 1IYVA 1GUNA 1DCZA 1H9SB 5BN5A 4H13C 1GHJA 3N6RA 2A6EC 3D4RA 4IQZA 2AUJD 2DN8A 5KNCA 1A6XA 3GD7A 4XTCS 5KNBA 1E2WA 2E76C 1Z7TA 1Y8OB 3MXUA 1VCIA 3CRKC 1H9RA 4KHZA 3VR3A 4OO1H 3MFYA 1ZYRC 4H0LC 2K7VA 2AWOA 3A8IE 1IW7D 1GUGA 3OPOA 2F1MA 1IW7C 1QJOA 2EJFC 4I7ZC 3SDZA 3CRLC 3T53B 3W3AA 4KI0A 3WDNA 2JEAI 5BN3A 5K36H 3L7ZC 1OXVA 1LACA 2K33A 5C0XH 2NN6H 2BE5D 3ND9A 2NN6G 3NE5B 2CW0C 3GQBA 3PV0A 4G7ZC 1LABA 1HQMC 3VA7A 3PUYA 3ND8A 3I72A 3IFTA 3TZUA 1H9SA 4DK0A 4LK1C 4TQUS 2O5JC 1Z6HA 4G7OC 1IYUA 1GUSA 2BA0A 2A6ED 1YNNC 2D2CC 4BA1I 3OW7A 1H9MA 2DNEA 1CFMA 1HPCA 3DXJC 3HGBA 4XIGS 1Y69U 3BG3A 2V4DA 2IT1A 2JEBI 4DK1A 4OO1G 3AB9A 1V8QA 5BN4A 1HCZA 1YNJC 1EWHA 1OXTA 3LWUA 2B8GA 5K36G 3I4LA 4KN4C 2O5IC 1I6VC
chains in the Genus database with same CATH superfamily
1TWAH 1K0RA 1CKNA 3PUWA 3M3YB 4HCSA 2MUYA 3DWAA 4A93H 3VDYA 2EYFA 2SOBA 2ICIA 3L0OA 3VYUA 1IBMQ 1GHKA 1K0SA 4JK1C 1I4GA 2RDHA 1QNUA 3KJPA 2UXCL 2LMCB 4J15A 1EQRA 2KUMA 3H0GH 4PV1C 5C44H 1TWGH 2PNRC 2MQHA 1EY9A 1N9WA 1ZKOA 3KBGA 4Q5VA 2R92B 3CHBD 5CGKA 3QOLA 5GAHC 1X32A 1FGBD 4HR7B 5KNDA 1JB7A 1KRSA 1IXRA 1U4MA 2JE6I 4A3JG 4KV6A 3CXCA 4BXXH 1I94Q 5DM73 1HXYD 2JSOA 3D0FA 5LL6X 2EY1A 1EQVA 1BUVT 4BY1B 4DR3L 5DEHA 3M4OB 1ENAA 4LF4Q 1V1QA 1LTGD 1O7LA 3M4PA 1FR3A 4JYAQ 2JQOA 2HCIA 5E1FA 1PH2A 4KY5A 1B2TA 4AQYL 1E2ZA 4GOPA 3PIP3 4YIJA 2I0QA 2L4NA 3MXNB 3H15A 1W2BA 1D5ZC 4QMGA 2UXBL 4A3GG 4HMJA 2DJGC 2K05A 4JI3Q 4EX5A 4JOIA 1MI2A 3J7ZC 4JW0A 1A15A 1X54A 1V9PA 1EIYB 1B4OA 5EKLA 2VUMG 4UP9A 1TWHH 3CMAA 4DU9A 3HOVH 1VMPA 4HJAA 4B3MQ 4KJNA 4C3IG 2BCOA 2NN6H 2I5MX 1DYQA 1XYIA 4N9TA 1I6HB 2Z6BA 1FD7D 4GN3B 3X3NA 3T13A 1Z6HA 1PRTB 2EE1A 5CR3A 4YWLA 3BDLA 1QOHA 3A5ZB 1PFMA 1SNMA 2SNMA 4UPAA 1CSQA 1SEBD 4GKKQ 4K0KL 3QR8A 3GTKH 1STNA 4L5RC 1HZCA 4UHVA 2K14A 5C5LA 2QDBA 1SAPA 2XVSA 1LV9A 4KN4C 4QB4A 3S1MH 1MBYA 1LT4D 1ZEQX 3CPFA 3CC4A 3LWEA 1JJCB 1QZGA 3P75A 1DD2A 2QF7A 5GROA 2PPBC 5CYUA 4UAIA 4KKTA 2D9UA 3I73A 2F4VL 1PH7A 4XYOA 3VYSA 3RN5A 4FF2A 4JBWA 4DR4Q 3EA6A 3M4YA 4DV2Q 1G291 1SYEA 1Q8IA 2BA1A 3PIO3 1AEXA 2R93B 1UWVA 2CKZB 3NPPA 5HY6A 1PTOD 1Y1VB 3TS2A 1PTOC 1QG7A 5C5MA 3J81L 3LNNA 2PI2E 5LMUL 2ZJQA 1FYCA 1C4QA 1NUCA 4MTKA 4IFDH 1TKWB 1SYFA 4YHHQ 1NY4A 4BBSB 1NSNS 4BY7B 1VQ8A 2QILA 2WP8J 4K8IA 3FMCA 1A2TA 1SJED 3MZ5A 1N33L 4EQNA 5ELBA 2NZOA 1Q1BA 3C1FA 4POFA 1PTOH 5BR8L 1I4PA 2NBFA 1IBLL 4DAYB 3BVMA 2E74C 5M3MB 3AMUA 3EFXD 4EQPA 4DR6L 4DV3L 4JI7Q 1XPOA 4K6LA 4A3DB 3TBIB 1Y1WG 3GO5A 5A2QL 4ME5A 1PA6A 5IE8A 5C3XA 4A3IH 5JJLA 1E3PA 1VQEA 4PZ7A 3K5MA 3MXUA 1Y8OB 1WTVA 4R4CA 4HN7A 4P2CB 3IAYA 1HA6A 2KCTA 2O2LD 4B3SQ 4JG2A 5IP9G 1RKNA 1WVLA 2UXDQ 2RBMA 2VQFQ 5C3WA 1CKNB 2Z8LA 1XXGA 3CW2C 2K5WA 4DK6C 3W2DA 1QUQA 4OELB 1RD9D 4DV6L 2CQAA 1TS3A 1S5CD 3B6YA 2CWAA 4CDDC 2NVQB 4A3BB 1JCKB 1HPCA 1LLRD 2EQSA 1RCVD 2KJXA 4KHPQ 3OSOA 5I2XA 2IT1A 5T1GA 1DZ1A 1QVGA 3KLWA 3HOYG 1SNCA 1WYDA 3BDOA 3I4NH 1L0WA 4GN5A 1LM0A 3RZDH 1RHPA 4GNXA 1DXMA 3J81i 5KIXA 3RR5A 2RHSB 4X65L 1HR0L 2N8NA 3IKJA 1BO0A 1EOTA 4GOPB 3IFDA 2LXJA 3UDGA 4JI4L 5IT9c 1VQGA 5EBDA 2V1CC 2KCNA 3MEHA 2E2DC 2AUKA 4B08A 1PZJD 2EJGC 2VQEQ 1VDZA 4KTAA 4JI2Q 2ID0A 3MC0B 4YWKA 1L0YB 2D0OA 4IUTA 1GJXA 2Z6KC 5M5WB 5FLXE 1K9MC 1XNRQ 1JQYD 2WB1G 1A63A 1A3VA 1QILA 2F3VA 3A7LA 3HP3A 1K3BC 5GAGC 5C4JH 3F2DA 2XWJB 3D6WA 3R8BA 4YY3Q 2CH4A 1WTRA 1DCZA 2YU9B 2OTJA 3KF6A 4A3GB 2Y0SE 3FP9A 5IP7H 4JCVE 5KNBA 5ELDA 1WTQA 2BH2A 4IJLA 1RDPD 5D3DA 3A8IE 4RHRA 2PZTA 2VUMB 2CHBD 5JEAG 5JVG3 1HZ9A 5K36H 1YHBA 2K28A 2KHJA 1LUZA 2BE5D 3UE0A 4C3IB 5IYDH 4F7XA 5ELCA 1BBXC 1XMOQ 4OWXB 1CHQD 1EQTA 4A3FG 1CQVA 1IZ6A 3DWPA 1SYBA 2RHQB 2NVTB 2KVMA 4XIGS 1LYLA 2X69A 3D3RA 1YI2A 1W3SA 3GTPH 5KYIA 2JA6G 1ET9A 3RNUA 2ZM6Q 2AQ1B 2TSSA 2I07B 5C0XG 2CW0D 1VQPA 4M1UB 1YVCA 3PUVA 3HOWB 2HHHL 1X6OA 1WOCA 1RTNA 4Z9CB 5LMNL 1UE6A 1HNWQ 4WJ4A 4JBJA 1KNEA 5JJZA 1Q12A 4DFAA 1VQOA 4MIUA 4AYBG 1ONLA 4LW1A 3SVMA 4XQNA 1EWIA 4DR2L 1K73C 5M3FH 3RUZA 2VXWA 4L5QA 5ELFA 4A3KH 4HSPA 4ZQ3A 1EZ8A 4KY6A 3OIPA 4WJWA 5A35A 1CI3M 4NMZA 4NW2A 2F0OA 5EGTA 2YYZA 4DV0Q 3E0EA 5KYLA 1NE3A 4LF8L 2AQ3B 4CDFC 1NJIC 3PF5A 1UEAB 1LO5D 2FXQA 3PO2B 3HKSA 4HMIA 5FLMG 4PMBA 1E1OA 3G71A 1UE1A 2B2VC 2CVRA 3S17H 4QCLA 1WFQA 3FHWA 1QUQB 3T1YQ 1ICFB 2M00A 2F0JA 3CF5A 1HNZQ 4J6HA 1Y1WB 1I50B 3HKZG 4BY1G 4DV1L 5M9OA 4QJFA 1VS0A 3NQTA 1HNXL 4A3EB 1TVXA 2F0WA 3PO3B 1STHA 4X64Q 3I4MH 1EZ6A 4P72A 1UAPA 2EXDA 2UUCQ 4NXMQ 1EY5A 1ENFA 4YCUA 2PO4A 5JEAJ 1E22A 4LF5Q 1AZQA 3J81E 4RGTA 2HDLA 3M9BA 5J1ZA 3VA7A 4RHSA 1CSPA 4JI0Q 1STAA 4GNXB 4F88A 3HOZH 5IYCH 3M7GA 2JJQA 4R4QA 3TP7A 1HFGA 5J39A 2O5JC 2H4OA 3K8AA 3MFGA 3VYRA 2IX3A 4DNIA 1PLFA 2X6LA 2DGYA 2R92H 4LF6Q 3GTQH 4DV5Q 2A1AA 3HOYB 1G6ZA 2A73B 5C0XJ 4DXFA 3M4OH 1YZ6A 3O13A 1NCVA 3I56A 3TP6A 3S1RB 1OXSC 1AW7A 1UE7A 5A2QE 1JJ2A 3CC7A 1Q90A 1JJGA 4KMUC 1D1KA 2PMZE 4K2KA 4X3SA 1HTPA 2A19A 2F0VA 4RAUC 5JJIA 3BU2A 4C1NK 4EVOA 2B2YC 2B2TC 5G3LF 4L8JA 1PH8A 2JA7G 5GADC 1AZPA 3OMGA 5D14A 2EVBA 1PRTD 2Z9HA 1PRTC 2B2YA 4OIJA 2HT1A 4L63B 1XTCD 3Q23A 1V43A 1XNQQ 2EJMA 3CCSA 2PZUA 4UP7A 1KD1C 2E8GA 3UDXA 2K52A 3OTOQ 5KRUA 4IUPA 2F0UA 4GLAC 2OT2A 3EBEA 1PRTF 1PV4A 2E2JH 2WKCA 3R93A 4BY7G 2DNCA 2JA8G 1VQKA 4A4IA 1VQNA 1VQ5A 4A3CH 1XPUA 2Z4HA 3S2HB 3BZKA 4HJ5A 4X3TA 4LUVA 1LT6D 1WD0A 5M5YH 2Q2HA 5E3FA 2A6EC 2UUAL 2CFMA 1EYAA 3G6EA 3VR3A 4NPSA 2MJ8A 4IPCA 4DGZA 4M8AA 4DUYQ 3M7NA 3SDZA 5JJKA 2EJFC 4XDXA 4DV7Q 3CRLC 3E6ZX 4KI0A 2B63G 4APVA 3KFUA 2K33A 3PF4A 4A3LH 2JA5G 1X3FA 3PV0A 3P7JA 4A3DG 3PUYA 5AJ3L 4LFCQ 4MNOA 5EPKA 1CA6A 4NXNQ 1EY6A 1K28A 5ELOA 3GTOB 4G7OC 2R93H 1TWFB 4TVAB 4FYDA 3JAMc 1HRJA 2C9OA 1PH6A 4B9XA 1Y1VH 4K14A 2FMCA 4C3HG 3A74A 3DM1A 3J80c 1LT5D 3ICEA 3S16H 4BBSH 2JA6B 2NWGA 1EWCA 4DAYA 2LFNA 4NKLA 3ULJA 1VQ9A 2RVLA 5IYBG 1BQQT 4C56C 5EAYA 4CJ2C 5CBEE 4DN4M 1H95A 4V190 3S1QB 2WB1E 4A3BG 2JN4A 1B3AA 4KN7C 3TEHB 5FJ8H 3KDFA 2K5QA 4OIKA 4AYBB 1C9OA 2K6AA 4OX9L 2RKSA 1G91A 5C44G 4LJZC 3G7LA 4XT1B 2ZT9C 3I91A 2YTVA 1RIPA 1MSHA 2QA4A 2MHVA 1UEBA 3FDTA 2ZXPA 3K0XA 4H44C 4JBKA 4BXXG 2D62A 2EYLA 1D1IA 1Y8PB 3GP7A 5ISRA 2XNAC 1GUOA 3SK5A 1IBML 1DOLA 1PFNA 3K5LA 2N49A 2WV6D 1S5ED 4KD4A 1AH9A 3ULLA 5FLXc 4KLKA 4JI8Q 3D31A 3RN2A 5H1SE 5IY0A 3TQYA 1EFWA 3Q22A 3I2ZA 1SMXA 4ZLTF 4LF9Q 3NBIA 4XQQA 1IBKQ 1IKMA 1I94L 1R9TH 2G9HD 3D4RA 3T4AC 2DN8A 3HKZB 1NMFA 3I90A 5I9PA 1PYSB 2E76C 4LF4L 1DONA 4YCVA 3CRKC 1SBBB 1H9RA 3K7AH 2KBNA 1LTBD 4GOPC 2UXCQ 1HJPA 1M8AA 1N36Q 1GUGA 4MHEA 4O2DA 1W6JA 2NVYB 4DR5Q 2NN6G 3NE5B 1XMQQ 4JOIC 4DA2A 1LABA 1AE3A 3MEFA 4ULLA 1VQFA 4QY7A 1SNPA 3TZUA 4ZKBB 3J7YW 3S14B 3CCVA 2UU9Q 4JI3L 5DAUA 1STBA 3U9OA 5JAVA 4WJ3M 1WI5A 2WACA 4IZ8A 2IX0A 2JEBI 4OO1G 2OXPA 5BN4A 1GUWA 1D2BA 1NBWA 4G57A 4MTNA 3HOXG 2L1BA 4GS3A 3NXWA 1JOOA 4A3JH 2NTSA 3SK4A 2NVXH 1ASZA 3PCOB 1FJGQ 1LTRD 1J9OA 1KL9A 2QEXA 2L9HA 5M5WH 3CCRA 1JWSD 3EJIA 1G51A 1ET6A 2I5HA 1SE8A 3MXGA 4K5VA 1TS2A 1Z9FA 1RJTA 5IOCA 3Q24A 1T5EA 1J5EQ 1NMGA 3ERSX 4GKKL 4EQ5A 4IFDG 3RZOH 1KRTA 3CAMA 3QO2A 4CDEC 1TY2A 1TWCH 1TU2B 2JXMB 3HOWG 4A3GH 3R3OA 2JA7B 1S5DD 2A68D 3D4WA 1PXUA 2A68C 4DNTB 2KEDA 3F8TA 4DR4L 1FVIA 1R4PB 1GKHA 4DV2L 3T51B 2VUMH 1S5BD 3L9AX 4UY8C 1N8RC 2F0DA 2O4XA 1DM0B 1TR5A 2Z0SA 3K5OA 1VQ6A 3GV3A 1AFPA 1H9JA 4LUZA 4C3IH 2E2HB 1MKHA 2XRSD 4YHHL 4PQXA 1JE5A 4CJ1B 1PMRA 1YJ9A 3GTMB 3DWQA 1KHIA 1U4PA 1UNSA 2Q8RE 2VW9A 2MFIA 2JA8B 3ERQA 1VQLA 1X3GA 2B29A 2EIFA 1A0IA 2NTTA 1YITA 5FO7B 2LY7A 1YEZA 3TREA 3R2IA 1VCIA 2WINB 1A3UA 4ABNA 4R8NA 1U4LA 3PO2G 4C3JB 4IUVA 4OHJA 2F0MA 4RKBA 2B63B 2K5DA 2XGTA 4JI7L 1AN8A 2JA5B 1IKLA 1F9PA 3IFTA 3NENA 1J8IA 5D3IB 4DK0A 3C2PA 1T9HA 3PSIA 3KDFB 2YV5A 4A3EG 3S1NH 3PO3G 1CKOA 1LTTD 1SROA 5JPNC 3HOUG 4FF1A 4C3HB 2NZ1D 4B3SL 2LS01 5KEEA 1TQOA 2UXDL 4K5XA 2VQFL 3GTLB 2GA4B 4O42A 3K59A 2K5VA 4K8JA 4HJ7A 3CMEA 1SDFA 1KDAA 1HTLD 4A93B 3BS1A 1B9MA 1ILQA 1STYA 2EYOA 3QG1A 4WRDA 1JMCA 4LFAQ 2OTLA 5K5PA 1EY0A 4KHPL 1U9RA 2BDOA 2H1EA 4N8FA 4QF4A 2A69C 3H09A 3H0GB 3NEMA 5C44B 4IFDJ 4GNXC 1PHJA 4QUFA 4LWCA 3K80C 5IGDA 4PMWA 1Y1WH 1I50H 2D0PA 4I65A 4DV6Q 3NSWA 1OXUA 4ZYSA 5IGCA 4U673 5IT9L 2PW7A 1P16A 3URYA 3TP5A 2R7DA 3H94A 4JV5Q 3FEWX 5I9OA 4F8MA 5IP9H 4XYQA 1X9NA 1JORA 3VR5A 5CV5A 2CCZA 5TSSA 5ELNA 2L15A 1XPRA 2EXZA 5EPJA 1JOQA 1SYDA 4ILWA 3NBHA 5FK9C 4F87A 2VQEL 4JVZA 1DGSA 2F0LA 4JI2L 1B3QA 1CUKA 1JE4A 2XIWA 1Z7TA 1BCPF 2EYMA 1BOSA 4IN3A 5FO9B 1XNRL 1WCMG 1UUPA 1VQCA 2QEJC 3V05A 5J3BA 5FO8B 1TWHB 4IJHA 1Q82C 3HOYH 1N32Q 2YTXA 4A3MG 3KOJA 2HQLA 4YY3L 3GQBA 2DUDA 3EROA 3DLLA 3I72A 4X66Q 3OHXC 3WOFA 2VZAA 1L1OB 4AIMA 3VA5A 4IUNA 2HIVA 3OW7A 4IUQA 1TXYA 4C2MH 2B39A 1YNJD 1YNJC 2CWPA 1ICWA 3GTKB 2B8GA 3HOXB 2A74C 1I6VC 1U5KA 1KDCA 2KOLA 1Q86C 1EY7A 2F3IA 2RSNA 1IL8A 5ELEA 3E9IA 4GZYC 1YJNA 1XMOL 2JK8A 1ZXTA 3NTHA 5IODA 2PQEA 3KLRA 3HG9A 1VQBA 1ESRA 4L6TB 1X55A 4BS9A 4RKLA 4FXDA 4DAVA 3QIAA 4RCNA 5M5XB 3T1HQ 3EIVA 1VQHA 1BDOA 2RQXA 5M3FG 3NK9A 2KENA 3CP0A 2ZM6L 3S2HH 4IALA 4FP5D 5C4XG 5IWAQ 5FKAC 2CQOA 4HIKA 1STEA 3ER0A 1XWEA 2ZJPA 2G5DA 2MP1A 1A8VA 4KKSA 1PZKD 1G2TA 1HNWL 1EEID 2K32A 3KJOA 4R8IA 2M9VA 3VR4A 4R4TA 2E5LQ 3KF8B 5JEAH 4LF7L 3AFQA 1Q8KA 2F0GA 3NWSA 3QJYA 4RH6A 5CV4A 5CV9A 3CPWA 3KBXA 2R7ZG 1M90C 5L37A 1EU4A 5T1IA 4FF3A 3UDFA 4CDCC 4HSVA 3BJUA 4LMQD 1W6KA 4KY7A 1GHJA 1WTXA 3TMEA 4A3FH 3Q8DA 1EQQA 3CC2A 4HAEA 1BF4A 1SYGA 3FKIG 2NUCA 4DV0L 3HFZB 2AUJD 4A3IB 3S2DB 4MN3A 4GKJQ 4A75A 3MAQA 1C0AA 1GD7A 3L7ZC 2E2IB 5C0XH 3GTJH 4YCWA 3T1YL 3S1QH 3HOZG 1HNZL 2YTYA 3A55A 1GOZA 1GUSA 1YNXA 1H9MA 2RF4A 3NTKA 3OWEB 4FVMA 4H02A 4R4IA 1K83B 5C3EH 5IGBA 4X64L 2IX1A 3BG3A 3Q0AA 1JOKA 3HOUB 2UUCL 5NUCA 1PYWD 4Y7NB 3CQZH 2AWNA 2XN9C 3M3YH 4DF7A 4LF5L 1QWYA 4YWMA 1B1ZA 3H3VI 2RCFA 3I8ZA 1KABA 2N55A 3QWNA 4FDBA 5FOBB 2QGQA 1BVSA 4TKOB 4OO1I 1WTHA 3L2PA 3CCMA 3FRPB 3I55A 3E0JA 1LT3D 1SE3A 2HDMA 5FLMH 4LF6L 2C35B 1KNAA 1HQRD 2VS1A 3CD6A 3C3LA 4DV5L 5IGFA 4R4OA 1EY8A 3F2UA 4B3TL 3NBHB 2E75C 2R7FA 1Y8NB 1BCPB 1FL0A 1FNUA 2IHFA 1SFOB 4BY1H 5GQOA 1QB5D 2F0QA 4JI6Q 4KKUA 1ENCA 2HCCA 3P20A 4ZCKA 1ESFA 5G3LD 1SNOA 3A5UA 4GN4B 4DUZQ 1VQ7A 4IURA 1G2SA 1YBYA 1K8MA 1SNQA 2PQAB 3KLSX 4IPHA 3J7AV 1GVPA 2D5DA 4BWGB 1EU3A 3DEPA 4RFBA 4CKCA 4X62Q 3LGJA 4B3RQ 1CT1D 3HRZC 1WJJA 4EQOA 4WFN3 1GM5A 4LFBQ 2IWHA 1D7QA 5CORA 1WD1A 1E24A 5CV6A 2PI2A 3EVQA 2F0FA 4HIOA 1XNQL 3CCLA 2H5XA 3BZCA 3UI2A 4QUCA 4HJ8A 3OTOL 4DR1Q 2AQ2B 4PNYA 1WCMB 1YIJA 4KHVA 2Z4IA 1CM9A 3BYTB 3AEVA 1I6HH 4A3MB 2WAQB 3H91A 1NR2A 3SK8A 1SR3A 3K7UC 4JPBW 1H9SA 5AFWA 5CBAE 3HZXA 3ULPA 1YNND 2A6ED 1YNNC 4BA1I 2LSSA 3CCQA 1IHZA 4C3JG 2QW7A 3CCJA 2BH8A 2ALYB 2UUBQ 1RODA 4DV7L 1EWHA 4X6AH 3D4DA 1OXTA 1KIXA 2BOSA 3K57A 1CZWA 3NELA 2HIXA 3I4LA 3RLOA 1DJRD 3JAML 2O5IC 4JI1Q 4J1MA 3ZJYC 2JA7H 1ML0D 3NWTA 5I6YA 3C1EA 3J80L 4LFCL 1I4RA 2L12A 2NYZD 3ONAB 2PW5A 4NXNL 3K58A 1WTOA 3M85A 4P75A 3U58A 3EQLC 4RCOA 5E4XA 1N34Q 4BBRG 5EJWA 3P1HA 4DV4Q 1MD2D 1NAPA 1OTCA 4CKBA 3MHBA 3GTMH 3G48A 4BY7H 5M3FB 2JA8H 1K3RA 3WWVA 1L2FA 1Q46A 5C4XB 3LX0A 4A93G 3PUZA 2EPBA 1O7YA 1H9KA 3CU7A 1D6EC 3CCEA 2IL8A 2EYJA 3K5NA 2DY8A 1Q3LA 2IW3A 1EYDA 1I3QB 2A6HD 2A6HC 2B63H 4UP8A 4DR7L 1B44D 1VQ4A 5M3MH 2AMCB 3H0GG 1VF5C 3GTGB 2R7ZB 4A3DH 4PMCA 4JI5Q 4OL7A 1GUNA 1GXDC 2B2UA 3N6RA 2F0KA 4IPDA 5FLXL 2F0SA 1LTAD 1V1PA 2XTIA 3FKIB 4XTCS 3BDCA 3BZDB 4C3HH 1XTDA 3MFYA 1S72A 4I7ZC 1MHWC 3GTLH 1O80A 1QJOA 4P71A 4JI8L 5LHY1 1AE2A 2ATWA 2TMPA 4RGMA 4RGNA 1EEFD 5HGTA 5IYBH 5LMNW 4H7BA 2P5ZX 1JWMD 1JR0D 4LF9L 2NVQH 3STBD 1IBKL 4A3BH 3E9HA 3STBC 3AU7A 4ZKCB 1Q81C 1RF2D 3HOZB 1F77A 1JT8A 2OQ0A 1F9RA 4R9WA 2N88A 3JAMi 4PZ8A 4JYAL 1N36L 2DY7A 5DNFA 3J80i 1TY0A 4NB3A 2FHTA 1K8AC 3GTQB 3HOVG 1F2MA 2EOTA 1A2UA 1P8LA 2EY6A 4DR5L 1XMQL 3PUXA 2VB2X 3NTIA 4ALPA 1DOMA 2KHIA 4AYBE 5KGUA 2LXKA 2UU9L 3MWYW 4DR3Q 2L0CA 4HIDA 1K8GA 3PQIA 4P73A 3S15B 1VQIA 5E4WC 5LL6S 2B8FA 4E6IA 1JWUD 3K6OA 1L0XB 2WKDA 4QGUA 3X3MA 1SSOA 1O78A 4LAAA 1NTGA 4OXPA 4AQYQ 2M2LA 1QCBD 2EYHA 1PYBA 4B3ML 2SEBD 4OGQC 3RMHA 3KLSA 2ZJRA 1SLJA 1CA5A 2RDGA 3SE0A 3TSSA 5J22A 2UXBQ 1L1OC 3U50C 1LTID 4MZ9A 3DUZA 2XSCA 1TT2A 1A3TA 3FPUB 1FJGL 3H3VC 4DK3C 4CHTB 2F0EA 3SHLA 1RTOA 2AHOB 1L1OA 3A56A 2NB0A 1EIFA 4IOCA 3OWFA 2IY5B 1J5EL 3VYTA 3RLFA 5C0XI 1KDBA 3HEJA 3S9WA 1WTPA 3HKZE 2E2JB 2YU9H 3AQQA 4N8X1 1H9SB 2K04A 1PH5A 3H3VH 2HUGA 5M5YB 1A6XA 4KHZA 2F3WA 2ES2A 2F0HA 4OO1H 2RCNA 1J6QA 3AFPA 2PYKA 2K7VA 2AWOA 4K0KQ 4RA8A 3W5OA 2RA4A 3QOJA 3W3AA 3WOEA 3HOXH 1PH1A 3E5SA 3W1BA 1OXVA 1XJVA 3ND9A 4S3SA 2G9DA 4G7ZC 1PVOA 3NQIA 1VQJA 4LK1C 4TQUS 2F4VQ 3UE1A 2MPMA 2NVTH 1QZHA 5M5XH 4A3IG 3DXJC 3DEOA 1Y69U 2K75A 3J81j 4DK1A 1HZBA 5JVH3 4TSSA 4RMFA 5LMUQ 3DMUA 3S16B 3KF8A 3A54A 2MO1A 1C7YA 3HOWH 4RWSC 3NP8A 4G4KA 3PMFA 2HD3A 3FPPA 4BA2I 4QL5A 3J81c 1D5XC 1PTOF 4IUUA 4Q0FA 1N33Q 3TRZA 1SRUA 2X6GA 1KAAA 4IOAA 1E2VA 1SNDA 4O1NA 3KYHC 2KA7A 4ODGA 5BR8Q 1LTSD 1IBLQ 2Q2UA 2J0TD 1JC7A 1BXTA 4BBRB 3TZDA 4EGVA 5EKKA 4OEMB 1FNWA 2K4KA 4DR6Q 1KLGD 4DV3Q 1Z47A 4CBVA 3N52A 4HJ9A 1TS4A 3I4NG 1TWAB 1V1PB 1EL0A 2BDNA 4X3UA 2L11A 3IRBA 4B9WA 4QQBX 4O0AA 4G7HC 1IYJB 1F9SA 1MGSA 3S2DH 1S3OA 2SNSA 1KLUD 4K5WA 3PO2H 3BVGA 4LFAL 1S5FD 2A5HA 2E2IH 4DNRB 5D65A 1BKBA 3R2TA 3C46A 2A69D 3KUPA 2IHEA 3T56B 1B7YB 1TWGB 1SYCA 1T5XD 1PFSA 2VY3A 3AYHB 4H13C 3OYYA 1QVFA 3JAME 2ASBA 4IPGA 1K83H 4A3EH 2Q8TA 2SDFA 1R9TB 3GD7A 3J80E 3PO3H 1EIHA 3NHHA 3SGIA 5DLQE 3HOUH 5EKIA 1B70B 4H0LC 3K7AB 4Y7NH 4JV5L 1IW7D 2L55A 1IW7C 2RSOA 2Y0SB 3OMCA 3BVZA 1PH4A 2JEAI 4DPGA 3PGZA 4LNQA 1LACA 1BCPD 2ZXOA 4TRDA 2N78A 1BCPC 1YJWA 1KXLA 4X3KA 4FO2A 2J7ZA 3SK6A 4OWTB 2F0TA 2KECA 1B8AA 1KAWA 4Y52H 5IP7G 4X65Q 1HR0Q 1QNKA 3TS0A 3I4OA 1BNZA 3JC66 3AB9A 1D5MC 1V8QA 2FFKB 4XXEA 4JI4Q 5CV7A 1A62A 1N32L 5K36G 2PQAA 2F4IA 2WAQG 1F2LA 5EPLA 3HOVB 1SFOH 3VR6A 2L5TA 3A8KE 2C5CA 1X65A 3U4ZA 5IYDG 4A3JB 4K2LA 4X66L 3S1RH 4OONA 2NVXB 4ZRZA 1II3A 3G4SA 4RGOS 1HA5A 3MXPA 4FF4A 1GUTA 3A7AB 1E7ZA 1B9NA 2NZHA 4ID6A 2Z6KA 1JICA 2FINB 1NNXA 3TDQA 3VR2A 1STGA 3RZOB 4DAPA 3I70A 1U4RA 2RDFA 1E1TA 1VQAA 1TWCB 4R1JA 1CTMA 2A8VA 2Q8IB 3S1MB 3J7A5 3NUCA 2MGSA 1EIGA 1QVCA 2VNUD 5DM63 1WCMH 1MSGA 2PCFB 1XX8A 4LUOA 3T1HL 2ZXRA 2HQEA 1EOVA 1MJCA 1HUMA 4A3MH 4JBMA 1MIUA 3SEBA 1DOKA 3BYYB 1CQFA 4K6DA 2BE5C 1F2ZA 1B53A 1RL2A 4A3KG 4I7AA 3L3OC 5IWAL 3F2CA 5BN5A 2ZTEA 4HTHA 4FNFA 2OCEA 3A0JA 2N3SA 3CKIB 3V96A 5KNCA 1HUNA 2PNHA 4A76A 5F2DA 1EFID 1ZYRD 2E5LL 2GVBA 1ZYRC 3KK7A 2ENBA 3OPOA 3T53B 1AP0A 2LKVA 2R3ZA 1CK1A 5BN3A 1PTOB 3K0YA 3MVVA 2CW0C 2KCMA 3ND8A 1B50A 2HHHQ 1IL2A 3GTOH 4GLXA 1TWFH 4PG3A 5LMNQ 1IYUA 4KK7A 5HGQA 1KC8C 1O7IA 3H6MA 1CFMA 4XQJA 1FGUA 3HGBA 5I6WA 5C3EG 4LF7Q 3S1NB 2V4DA 5EBCA 3I4MG 2I5LX 4DR2Q 4GKJL 2JA6H 2MO0A 5C4XH 2XWBB 1G8ZD 1X3QA 3U4VA 1HFNA 5I2YA 1VQMA 1Q1EA 1O7ZA 1I4HA 1LTLA 5C6AA 2F03A 2JYOA 5IYCG 1BBWA 2FJ2A 1S40A 4LF8Q 2GN5A 1I3QH 3I7FA 2KEEA 1R4QB 4KD3A 4ZAIA 2PZWA 1F2YA 1SJHD 4NXML 3GTGH 2NN6I 3ZYYX 2R92G 2R7ZH 4ZUJA 3M4QA 1CZGA 4OWWB 2KHSA 1PDQA 5HURA 2OEOA 3A8JE 1CHPD 2PMZB 2B2VA 3OIQA 4JI0L 3OOCA 3FKIH 3GDEA 3I4NB 4JC0A 4DV1Q 1HNXQ 3RZDB 1SXTA 1SMYD 2R6GA 1SMYC 3IL8A 1Y14B 1X3EA 1V1OA 3F1ZA 4XT3B 1PFBA 2K01A 2JA9A 1GO3E 2Q2IA 1IYVA 1SN8A 5EQ0A 3PIPA 1PZID 1VQDA 3MA2B 4P74A 4JI6L 2QKIC 3D8GA 4N9PA 4NDXA 2K5HA 3UDIA 4DUZL 3SR1A 3F2BA 4POGA 4FXGC 5IIFA 2WFWA 4IFDI 2VL6A 4QIWB 2NVYH 3J7AF 2K5NA 3WDNA 2Q2TA 1X56A 5C4JB 4B3TQ 2MNAA 3T16A 2WIIB 4X62L 4PZ6A 1PH3A 4ZK9B 1KTKA 4B3RL 4L5SA 2ZTCA 2J4XA 3S14H 3MXNA 1ILPA 4A3CG 4LFBL 3HS0C 1G6PA 2QCPX 1HHVA 1WTWA 3S15H 3RLNA 3G6JB 3DM3A 2EY5A 2K03A 1YHQA 1I4XA 2DNEA 1F9QA 4GLVB 5I4DA 1I5FA 1BR9A 5JOBA 2IJ0A 4DR1L 4C2MB 1HCZA 5CC4A 2GVAA 1I4QA 1KQSA 4NP5A 1Q7YC 4U68A 4HCEA 3EN2A 2FMMA 1TS5A 4A3LG 3KF6B 5E7NA 4ME3A 4ZUIA 2QDLA 1TIID 1EY4A 2B2TA 4DKAC 4V0BA 1C8CA 1HR0W 3ITPA 1PH9A 5IGGA 2OF1A 3MTSA 2R93G 2F52A 1EYGA 1Y1VG 3QB3A 5IT9E 2KCCA 1BBUA 2WB1B 1SE4A 4DUYL 2UUBL 3PIOA 2B2WC 3GTPB 2CH4W 2EDGA 4BBSG 1MJEA 1K8OA 1EYCA 1QE6A 3TP8A 1X3PA 1U0LA 3W1GA 4CGYB 4JI1L 2XRQD 1JB3A 2B2WA 4QIWE 3V2TA 1ASYA 2UUAQ 2K50A 2EYPA 1HH2P 1VF7A 3S24A 2OQKA 4DXGA 4RG1A 2DJFC 3U9SA 5FJ8G 4CKEA 2ZTDA 5CV8A 5CMDA 1N34L 1VMCA 3E3XA 2E2HH 3SXHA 1C48A 4DV4L 5M3MG 2IPKD 3GV6A 1OXXK 5COYA 5JPMC 5AJ3Q 1M1KC 4A3KB 2KQ3A 2ICEC 3RD4A 3K81C 4HEDA 5GAEC 1NR4A 4IQZA 4A3FB 4FXKC 2AKWB 2EY2A 1E2WA 4UDUC 4C3JH 4DAMA 2WAQE 3OW2A 1S4ZA 4CJ0B 4L5TA 2F1MA 2F0NA 3FVQA 4IO9A 3DHQA 2B2UC 2B3GA 1SE2A 4WORA 4HIMA 2JA5H 1YHAA 2EZVA 1EUJA 2OWOA 1HQMC 4JI5L 3Q6SA 5IGEA 3GTJB 3S17B 1FNVA 1HZAA 2VB3X 1D8LA 4AH6A 3CCUA 1CKMA 2K1BA 2F0PA 3I3CA 2R61A 2BA0A 2D2CC 1E0BA 2Z1CA 3TN2A 3D6CA 4J8QA 5C4HA 4KJOA 4BBRH 4DR7Q 5C3EB 2F0IA 4OX9Q 4C1NI 2I46A 3I4MB 2Y0SG 2JP1A 1OO9B 3LWUA 1M4VA 5C4ZA 1UE5A 3CQZB
chains in the Genus database with same CATH topology
3PUWA 3M3YB 4HCSA 2MUYA 3DWAA 2EYFA 2SOBA 2ICIA 3VYUA 1GHKA 4JK1C 1I4GA 2RDHA 1QNUA 2LMCB 2KUMA 4PV1C 2PNRC 1EY9A 3KBGA 1ZKOA 4Q5VA 2R92B 3CHBD 5CGKA 3QOLA 1X32A 1FGBD 4HR7B 5KNDA 1U4MA 2JE6I 4KV6A 5DM73 1HXYD 2JSOA 5LL6X 2EY1A 1EQVA 1BUVT 4BY1B 5DEHA 3M4OB 1ENAA 1LTGD 1O7LA 1FR3A 2HCIA 5E1FA 4KY5A 1B2TA 1E2ZA 3PIP3 4YIJA 2L4NA 1D5ZC 4QMGA 4HMJA 2K05A 1MI2A 1A15A 1B4OA 5EKLA 4DU9A 1VMPA 4KJNA 4C3IG 2BCOA 2NN6H 1DYQA 1XYIA 4N9TA 1I6HB 1FD7D 3X3NA 3T13A 1Z6HA 1PRTB 2EE1A 5CR3A 3BDLA 1QOHA 1PFMA 1SNMA 2SNMA 1SEBD 1STNA 5C5LA 2QDBA 1SAPA 2XVSA 1LV9A 4KN4C 4QB4A 1MBYA 1LT4D 1ZEQX 3LWEA 3P75A 1DD2A 2QF7A 2PPBC 5CYUA 4UAIA 4KKTA 2D9UA 3I73A 4XYOA 3VYSA 4FF2A 4JBWA 3EA6A 3M4YA 1G291 1SYEA 1Q8IA 2BA1A 3PIO3 1AEXA 2R93B 3NPPA 1PTOD 1Y1VB 1PTOC 1QG7A 5C5MA 3J81L 3LNNA 1FYCA 1C4QA 1NUCA 4IFDH 1TKWB 1SYFA 4BBSB 1NSNS 4BY7B 2QILA 2WP8J 4K8IA 3FMCA 1A2TA 1SJED 3MZ5A 4EQNA 5ELBA 1Q1BA 3C1FA 1PTOH 1I4PA 2NBFA 3BVMA 2E74C 5M3MB 3AMUA 3EFXD 4EQPA 4K6LA 4A3DB 3TBIB 3GO5A 5A2QL 4ME5A 5C3XA 3K5MA 3MXUA 1Y8OB 1WTVA 4HN7A 4P2CB 3IAYA 1HA6A 2O2LD 1RKNA 1WVLA 2RBMA 5C3WA 2Z8LA 1XXGA 2K5WA 3W2DA 1RD9D 2CQAA 1TS3A 1S5CD 2NVQB 4A3BB 1JCKB 1HPCA 1LLRD 1RCVD 2KJXA 3OSOA 5I2XA 2IT1A 5T1GA 1DZ1A 1SNCA 3BDOA 1RHPA 1DXMA 5KIXA 3IKJA 1BO0A 1EOTA 3IFDA 5EBDA 2KCNA 3MEHA 2E2DC 2AUKA 4B08A 1PZJD 2EJGC 1VDZA 4KTAA 2ID0A 3MC0B 1L0YB 4IUTA 1GJXA 5M5WB 5FLXE 1JQYD 1A3VA 1QILA 2F3VA 3A7LA 3HP3A 2XWJB 3D6WA 3R8BA 1WTRA 1DCZA 2YU9B 4A3GB 5KNBA 5ELDA 1WTQA 1RDPD 5D3DA 3A8IE 4RHRA 2PZTA 2VUMB 2CHBD 5JEAG 5JVG3 5K36H 2K28A 2BE5D 4C3IB 4F7XA 5ELCA 1BBXC 1CHQD 1EQTA 1CQVA 3DWPA 1SYBA 2NVTB 2KVMA 4XIGS 2X69A 3D3RA 5KYIA 1ET9A 2AQ1B 2TSSA 2I07B 5C0XG 2CW0D 4M1UB 3PUVA 3HOWB 1RTNA 4Z9CB 1KNEA 5JJZA 1Q12A 4DFAA 4MIUA 1ONLA 3SVMA 4XQNA 3RUZA 2VXWA 5ELFA 4HSPA 4ZQ3A 1EZ8A 4KY6A 3OIPA 4WJWA 5A35A 1CI3M 4NMZA 4NW2A 2F0OA 5EGTA 2YYZA 5KYLA 2AQ3B 1UEAB 1LO5D 3PO2B 4HMIA 4PMBA 2B2VC 2CVRA 4QCLA 2M00A 2F0JA 4J6HA 1Y1WB 1I50B 5M9OA 3NQTA 4A3EB 1TVXA 2F0WA 3PO3B 1STHA 1EZ6A 1UAPA 1EY5A 1ENFA 2PO4A 5JEAJ 1AZQA 3J81E 4RGTA 2HDLA 5J1ZA 3VA7A 4RHSA 1STAA 4F88A 3M7GA 3TP7A 1HFGA 5J39A 2O5JC 2H4OA 3MFGA 3VYRA 2IX3A 1PLFA 2X6LA 3HOYB 1G6ZA 2A73B 5C0XJ 4DXFA 3O13A 1NCVA 3TP6A 3S1RB 1OXSC 1AW7A 5A2QE 1Q90A 4KMUC 1D1KA 4K2KA 4X3SA 1HTPA 4RAUC 2F0VA 4C1NK 4EVOA 2B2YC 2B2TC 5G3LF 4L8JA 1AZPA 3OMGA 5D14A 2EVBA 1PRTD 1PRTC 2B2YA 4OIJA 4L63B 1XTCD 3Q23A 1V43A 2EJMA 2PZUA 5KRUA 4IUPA 2F0UA 2OT2A 1PRTF 2WKCA 3R93A 2DNCA 2Z4HA 3S2HB 4X3TA 1LT6D 1WD0A 5E3FA 2A6EC 1EYAA 3VR3A 2MJ8A 4DGZA 4M8AA 3M7NA 3SDZA 2EJFC 4XDXA 3CRLC 3E6ZX 4KI0A 2K33A 3PV0A 3P7JA 3PUYA 5EPKA 1CA6A 1EY6A 3GTOB 4G7OC 1TWFB 4FYDA 1HRJA 2C9OA 4B9XA 4K14A 2FMCA 4C3HG 3DM1A 1LT5D 2JA6B 2NWGA 1EWCA 4DAYA 2LFNA 4NKLA 2RVLA 1BQQT 4C56C 4CJ2C 5CBEE 4DN4M 4V190 3S1QB 1B3AA 4KN7C 2K5QA 4OIKA 4AYBB 2K6AA 2RKSA 1G91A 4LJZC 3G7LA 4XT1B 2ZT9C 3I91A 1MSHA 2MHVA 3FDTA 2ZXPA 4H44C 2D62A 2EYLA 1D1IA 1Y8PB 3GP7A 5ISRA 2XNAC 1GUOA 3SK5A 1DOLA 1PFNA 3K5LA 2WV6D 1S5ED 4KD4A 3D31A 3Q22A 4ZLTF 3NBIA 4XQQA 1IKMA 2G9HD 3D4RA 3T4AC 2DN8A 3HKZB 3I90A 5I9PA 2E76C 1DONA 3CRKC 1SBBB 1H9RA 1LTBD 1M8AA 1GUGA 4MHEA 1W6JA 2NVYB 2NN6G 3NE5B 4DA2A 1LABA 4ULLA 1SNPA 3TZUA 4ZKBB 3J7YW 3S14B 5DAUA 1STBA 3U9OA 5JAVA 2WACA 4IZ8A 2IX0A 2JEBI 4OO1G 2OXPA 5BN4A 1GUWA 1D2BA 4G57A 2L1BA 3NXWA 1JOOA 2NTSA 3SK4A 1LTRD 1J9OA 2L9HA 1JWSD 3EJIA 1ET6A 4K5VA 3MXGA 1TS2A 1RJTA 5IOCA 3Q24A 1T5EA 4IFDG 3QO2A 1TY2A 1TU2B 2JXMB 3R3OA 2JA7B 1S5DD 2A68D 3D4WA 1PXUA 2A68C 4DNTB 2KEDA 1R4PB 3T51B 1S5BD 3L9AX 2F0DA 2O4XA 1DM0B 1TR5A 3K5OA 3GV3A 1AFPA 1H9JA 2E2HB 2XRSD 4PQXA 4CJ1B 1PMRA 3GTMB 2Q8RE 3DWQA 1U4PA 1UNSA 2JA8B 3ERQA 2NTTA 5FO7B 2LY7A 3R2IA 1VCIA 2WINB 1A3UA 4ABNA 4R8NA 1U4LA 4C3JB 4IUVA 4OHJA 2F0MA 4RKBA 2B63B 2K5DA 1AN8A 2JA5B 1IKLA 1F9PA 3IFTA 1J8IA 5D3IB 4DK0A 3C2PA 1LTTD 5JPNC 4FF1A 4C3HB 2NZ1D 2LS01 5KEEA 1TQOA 4K5XA 3GTLB 2GA4B 4O42A 3K59A 4K8JA 1SDFA 1KDAA 1HTLD 4A93B 3BS1A 1B9MA 1ILQA 1STYA 2EYOA 3QG1A 4WRDA 5K5PA 1EY0A 1U9RA 2BDOA 2H1EA 4QF4A 2A69C 3H09A 3H0GB 5C44B 4IFDJ 4QUFA 5IGDA 4PMWA 4I65A 3NSWA 1OXUA 4ZYSA 5IGCA 4U673 5IT9L 2PW7A 3URYA 3TP5A 3H94A 3FEWX 5I9OA 4F8MA 4XYQA 1JORA 3VR5A 5CV5A 5TSSA 2EXZA 5EPJA 1JOQA 1SYDA 4ILWA 3NBHA 5FK9C 4F87A 2F0LA 1JE4A 2XIWA 1Z7TA 1BCPF 2EYMA 1BOSA 4IN3A 5FO9B 1UUPA 2QEJC 3V05A 5FO8B 1TWHB 3GQBA 3EROA 3I72A 3OHXC 3WOFA 3VA5A 4IUNA 3OW7A 4IUQA 2B39A 1YNJD 1YNJC 1ICWA 3GTKB 2B8GA 3HOXB 2A74C 1I6VC 1KDCA 2KOLA 1EY7A 2RSNA 1IL8A 5ELEA 4GZYC 1ZXTA 3NTHA 5IODA 2PQEA 3KLRA 3HG9A 1ESRA 4L6TB 4BS9A 4RKLA 4FXDA 4DAVA 3QIAA 4RCNA 5M5XB 1BDOA 2RQXA 3NK9A 4IALA 4FP5D 5FKAC 1STEA 1XWEA 2MP1A 4KKSA 1PZKD 1G2TA 1EEID 2K32A 4R8IA 2M9VA 3VR4A 5JEAH 3QJYA 2F0GA 3NWSA 4RH6A 5CV4A 5CV9A 3KBXA 1EU4A 5T1IA 4FF3A 4HSVA 4LMQD 1W6KA 4KY7A 1GHJA 1WTXA 3TMEA 4HAEA 1BF4A 1SYGA 2NUCA 2AUJD 4A3IB 3S2DB 4MN3A 3MAQA 3L7ZC 2E2IB 5C0XH 3A55A 1GOZA 1GUSA 1H9MA 3NTKA 4FVMA 3OWEB 1K83B 5IGBA 2IX1A 3BG3A 3Q0AA 1JOKA 3HOUB 5NUCA 1PYWD 4Y7NB 2AWNA 2XN9C 4DF7A 1QWYA 1B1ZA 3I8ZA 1KABA 2N55A 3QWNA 5FOBB 4TKOB 4OO1I 3FRPB 3E0JA 1LT3D 1SE3A 2HDMA 1KNAA 1HQRD 3C3LA 5IGFA 1EY8A 3F2UA 2E75C 1Y8NB 1BCPB 1FNUA 1SFOB 1QB5D 2F0QA 4KKUA 1ENCA 2HCCA 3P20A 1ESFA 5G3LD 1SNOA 4IURA 1G2SA 1K8MA 1SNQA 3KLSX 3J7AV 2D5DA 4BWGB 1EU3A 3DEPA 4RFBA 4CKCA 1CT1D 3HRZC 4EQOA 4WFN3 2IWHA 5CORA 1WD1A 5CV6A 3EVQA 2F0FA 3UI2A 4QUCA 2AQ2B 4PNYA 1WCMB 4KHVA 2Z4IA 1CM9A 3BYTB 4A3MB 2WAQB 3H91A 1NR2A 3SK8A 1H9SA 5AFWA 5CBAE 3HZXA 1YNND 2A6ED 1YNNC 4BA1I 1IHZA 4C3JG 1RODA 1EWHA 3D4DA 1OXTA 2BOSA 3K57A 1CZWA 3I4LA 1DJRD 3JAML 2O5IC 4J1MA 1ML0D 3NWTA 5I6YA 3C1EA 3J80L 1I4RA 2L12A 2NYZD 3ONAB 2PW5A 3K58A 1WTOA 3M85A 3EQLC 4RCOA 5E4XA 5EJWA 3P1HA 1MD2D 1NAPA 4CKBA 3MHBA 5M3FB 5C4XB 3LX0A 3PUZA 2EPBA 1O7YA 1H9KA 3CU7A 1D6EC 2EYJA 2IL8A 3K5NA 2DY8A 1Q3LA 2IW3A 1EYDA 1I3QB 2A6HD 2A6HC 1B44D 1VF5C 3GTGB 2R7ZB 4PMCA 4OL7A 1GUNA 1GXDC 2B2UA 3N6RA 2F0KA 5FLXL 2F0SA 1LTAD 1V1PA 3FKIB 4XTCS 3BDCA 3BZDB 3MFYA 4I7ZC 1O80A 1QJOA 5LHY1 2TMPA 4RGMA 4RGNA 1EEFD 5HGTA 4H7BA 1JWMD 1JR0D 4ZKCB 3AU7A 1RF2D 3HOZB 1F77A 1F9RA 4R9WA 2N88A 2DY7A 5DNFA 1TY0A 2FHTA 3GTQB 1F2MA 2EOTA 1A2UA 2EY6A 3PUXA 2VB2X 3NTIA 1DOMA 5KGUA 3MWYW 2L0CA 3S15B 5E4WC 5LL6S 2B8FA 4E6IA 1JWUD 3K6OA 1L0XB 2WKDA 3X3MA 1SSOA 1O78A 4LAAA 2M2LA 1QCBD 2EYHA 2SEBD 4OGQC 3RMHA 3KLSA 1CA5A 2RDGA 3SE0A 3TSSA 5J22A 1LTID 3DUZA 2XSCA 1TT2A 1A3TA 3FPUB 3H3VC 4CHTB 2F0EA 3SHLA 1RTOA 3A56A 2NB0A 3OWFA 3VYTA 3RLFA 5C0XI 1KDBA 3HEJA 3S9WA 1WTPA 2E2JB 1H9SB 2K04A 2HUGA 5M5YB 1A6XA 4KHZA 2F3WA 4OO1H 2F0HA 2PYKA 2K7VA 2AWOA 4RA8A 2RA4A 3QOJA 3W3AA 3WOEA 3E5SA 1OXVA 3ND9A 4S3SA 2G9DA 4G7ZC 3NQIA 4LK1C 4TQUS 2MPMA 3DXJC 3DEOA 1Y69U 4DK1A 5JVH3 4TSSA 3DMUA 3S16B 3KF8A 3A54A 4RWSC 3NP8A 4G4KA 3PMFA 3FPPA 4BA2I 1D5XC 1PTOF 4IUUA 4Q0FA 2X6GA 1KAAA 1E2VA 1SNDA 4O1NA 2KA7A 4ODGA 1LTSD 2J0TD 1JC7A 1BXTA 4BBRB 3TZDA 4EGVA 5EKKA 1FNWA 1KLGD 1Z47A 4CBVA 3N52A 1TS4A 1TWAB 1V1PB 1EL0A 2BDNA 4X3UA 2L11A 4B9WA 4G7HC 1F9SA 1MGSA 2SNSA 1KLUD 4K5WA 3BVGA 1S5FD 2A5HA 4DNRB 5D65A 3R2TA 3C46A 2A69D 3KUPA 3T56B 1TWGB 1SYCA 1T5XD 4H13C 3JAME 2Q8TA 2SDFA 1R9TB 3GD7A 3J80E 1EIHA 3NHHA 5EKIA 4H0LC 3K7AB 1IW7D 2L55A 1IW7C 2RSOA 2Y0SB 3OMCA 3BVZA 2JEAI 1LACA 1BCPD 2ZXOA 4TRDA 1BCPC 4X3KA 4FO2A 2J7ZA 3SK6A 2F0TA 2KECA 1QNKA 1BNZA 3AB9A 1D5MC 1V8QA 2FFKB 4XXEA 5CV7A 5K36G 2F4IA 1F2LA 5EPLA 3HOVB 3VR6A 2L5TA 3A8KE 2C5CA 4A3JB 4K2LA 2NVXB 4ZRZA 1II3A 4RGOS 1HA5A 3MXPA 4FF4A 1GUTA 3A7AB 1B9NA 4ID6A 1JICA 2FINB 3TDQA 3VR2A 1STGA 3RZOB 4DAPA 3I70A 1U4RA 2RDFA 1TWCB 1CTMA 2Q8IB 3S1MB 3NUCA 2MGSA 1EIGA 2VNUD 5DM63 1MSGA 2PCFB 1XX8A 2ZXRA 2HQEA 1HUMA 3SEBA 1DOKA 3BYYB 1CQFA 4K6DA 2BE5C 1F2ZA 1B53A 3L3OC 5BN5A 4HTHA 4FNFA 3CKIB 3V96A 5KNCA 1HUNA 5F2DA 1EFID 1ZYRD 1ZYRC 3KK7A 2ENBA 3OPOA 3T53B 1AP0A 2LKVA 2R3ZA 1CK1A 5BN3A 1PTOB 3K0YA 3MVVA 2CW0C 3ND8A 1B50A 1IYUA 4KK7A 3H6MA 1CFMA 4XQJA 3HGBA 5I6WA 3S1NB 2V4DA 5EBCA 2XWBB 1G8ZD 1X3QA 1HFNA 5I2YA 1Q1EA 1O7ZA 1I4HA 5C6AA 2F03A 2JYOA 2FJ2A 2KEEA 1R4QB 4KD3A 4ZAIA 2PZWA 1F2YA 1SJHD 2NN6I 3ZYYX 4ZUJA 1CZGA 2KHSA 1PDQA 5HURA 2OEOA 3A8JE 1CHPD 2PMZB 2B2VA 3OIQA 3OOCA 3I4NB 3RZDB 1SXTA 1SMYD 2R6GA 1SMYC 3IL8A 1V1OA 4XT3B 1PFBA 2K01A 1IYVA 5EQ0A 1PZID 3MA2B 2QKIC 3D8GA 4N9PA 4NDXA 3SR1A 4FXGC 5IIFA 4IFDI 4QIWB 3J7AF 3WDNA 5C4JB 3T16A 2WIIB 4ZK9B 1KTKA 2J4XA 3MXNA 1ILPA 3HS0C 2QCPX 1HHVA 1WTWA 3G6JB 2EY5A 2K03A 1I4XA 2DNEA 1F9QA 5I4DA 1BR9A 5JOBA 2IJ0A 4C2MB 1HCZA 5CC4A 1I4QA 4NP5A 4U68A 4HCEA 2FMMA 1TS5A 4ZUIA 1TIID 1EY4A 2B2TA 4V0BA 1C8CA 3ITPA 5IGGA 2OF1A 3MTSA 3QB3A 5IT9E 2KCCA 2WB1B 1SE4A 2B2WC 3GTPB 2EDGA 1K8OA 1EYCA 1QE6A 3TP8A 1X3PA 4CGYB 2XRQD 1JB3A 2B2WA 3V2TA 2EYPA 1VF7A 4DXGA 3U9SA 4CKEA 5CV8A 5CMDA 1VMCA 3SXHA 1C48A 2IPKD 3GV6A 1OXXK 5COYA 5JPMC 4A3KB 2KQ3A 2ICEC 3RD4A 4HEDA 1NR4A 4IQZA 4A3FB 4FXKC 2EY2A 1E2WA 4UDUC 1S4ZA 4CJ0B 2F1MA 2F0NA 3FVQA 3DHQA 2B2UC 1SE2A 4WORA 2EZVA 1HQMC 3GTJB 3Q6SA 5IGEA 3S17B 1FNVA 2VB3X 2K1BA 2F0PA 3I3CA 2R61A 2BA0A 2D2CC 1E0BA 2Z1CA 3TN2A 3D6CA 4J8QA 5C4HA 4KJOA 5C3EB 2F0IA 4C1NI 2I46A 3I4MB 2JP1A 1OO9B 3LWUA 1M4VA 5C4ZA 3CQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X G;  5JEA G;  3PUW A;  3BDO A;  1Q1E A;  2L5T A;  3A8K E;  3PUX A;  3VR6 A;  4GZY C;  1DD2 A;  3PUV A;  2QF7 A;  3M7N A;  3FPP A;  4BA2 I;  1B9M A;  2PPB C;  3KLR A;  1DXM A;  4KKT A;  3I73 A;  4TKO B;  3QG1 A;  1OXS C;  4JBW A;  1Q12 A;  4KN7 C;  3M4Y A;  1GHK A;  1G29 1;  2B8F A;  4JK1 C;  2BA1 A;  3M85 A;  1E2V A;  1ONL A;  1Q90 A;  3EQL C;  1GUT A;  3A7A B;  3QIA A;  4KMU C;  2KA7 A;  2BDO A;  3IKJ A;  4RCN A;  1T5E A;  2LMC B;  2KCC A;  1O78 A;  4PV1 C;  1HTP A;  3LNN A;  1B9N A;  2NN6 I;  1FYC A;  2PNR C;  4LJZ C;  1BDO A;  2A69 C;  1ZKO A;  2EDG A;  4IFD H;  1TKW B;  2ZT9 C;  4IFD G;  1K8O A;  4OGQ C;  3VR2 A;  4HR7 B;  3A8J E;  1TU2 B;  5KND A;  2JXM B;  2E75 C;  2JE6 I;  4L8J A;  3SE0 A;  1Y8N B;  2AUK A;  3FMC A;  1CTM A;  3OOC A;  2Q8I B;  2EVB A;  4H44 C;  2EJG C;  3PUZ A;  1OXU A;  1CI3 M;  5A35 A;  1VDZ A;  2A68 D;  2D62 A;  2A68 C;  4DNT B;  2YYZ A;  4KKU A;  4G7H C;  3P20 A;  1H9K A;  4KKS A;  1V43 A;  1VF7 A;  1Y8P B;  2EJM A;  1GUO A;  1O7L A;  2K32 A;  3T51 B;  1FR3 A;  2R6G A;  3VR4 A;  1SMY C;  3U9S A;  1GJX A;  3H94 A;  1Q1B A;  2PCF B;  5JEA H;  2A6H D;  1K8M A;  2A6H C;  3A7L A;  4DNR B;  3RLF A;  3VR5 A;  1E2Z A;  1H9J A;  3D31 A;  3QJY A;  1VF5 C;  2A69 D;  2D5D A;  1OXX K;  2E74 C;  3T56 B;  2BE5 C;  2DNC A;  1PMR A;  1IYV A;  1GUN A;  1DCZ A;  1H9S B;  5BN5 A;  4H13 C;  1GHJ A;  3N6R A;  2A6E C;  3D4R A;  4IQZ A;  2AUJ D;  2DN8 A;  5KNC A;  1A6X A;  3GD7 A;  4XTC S;  5KNB A;  1E2W A;  2E76 C;  1Z7T A;  1Y8O B;  3MXU A;  1VCI A;  3CRK C;  1H9R A;  4KHZ A;  3VR3 A;  4OO1 H;  3MFY A;  1ZYR C;  4H0L C;  2K7V A;  2AWO A;  3A8I E;  1IW7 D;  1GUG A;  3OPO A;  2F1M A;  1IW7 C;  1QJO A;  2EJF C;  4I7Z C;  3SDZ A;  3CRL C;  3T53 B;  3W3A A;  4KI0 A;  3WDN A;  2JEA I;  5BN3 A;  5K36 H;  3L7Z C;  1OXV A;  1LAC A;  2K33 A;  5C0X H;  2NN6 H;  2BE5 D;  3ND9 A;  2NN6 G;  3NE5 B;  2CW0 C;  3GQB A;  3PV0 A;  4G7Z C;  1LAB A;  1HQM C;  3VA7 A;  3PUY A;  3ND8 A;  3I72 A;  3IFT A;  3TZU A;  1H9S A;  4DK0 A;  4LK1 C;  4TQU S;  2O5J C;  1Z6H A;  4G7O C;  1IYU A;  1GUS A;  2BA0 A;  2A6E D;  1YNN C;  2D2C C;  4BA1 I;  3OW7 A;  1H9M A;  2DNE A;  1CFM A;  1HPC A;  3DXJ C;  3HGB A;  4XIG S;  1Y69 U;  3BG3 A;  2V4D A;  2IT1 A;  2JEB I;  4DK1 A;  4OO1 G;  3AB9 A;  1V8Q A;  5BN4 A;  1HCZ A;  1YNJ C;  1EWH A;  1OXT A;  3LWU A;  2B8G A;  5K36 G;  3I4L A;  4KN4 C;  2O5I C;  1I6V C; 
#chains in the Genus database with same CATH topology
 1TWA H;  1K0R A;  1CKN A;  3PUW A;  3M3Y B;  4HCS A;  2MUY A;  3DWA A;  4A93 H;  3VDY A;  2EYF A;  2SOB A;  2ICI A;  3L0O A;  3VYU A;  1IBM Q;  1GHK A;  1K0S A;  4JK1 C;  1I4G A;  2RDH A;  1QNU A;  3KJP A;  2UXC L;  2LMC B;  4J15 A;  1EQR A;  2KUM A;  3H0G H;  4PV1 C;  5C44 H;  1TWG H;  2PNR C;  2MQH A;  1EY9 A;  1N9W A;  1ZKO A;  3KBG A;  4Q5V A;  2R92 B;  3CHB D;  5CGK A;  3QOL A;  5GAH C;  1X32 A;  1FGB D;  4HR7 B;  5KND A;  1JB7 A;  1KRS A;  1IXR A;  1U4M A;  2JE6 I;  4A3J G;  4KV6 A;  3CXC A;  4BXX H;  1I94 Q;  5DM7 3;  1HXY D;  2JSO A;  3D0F A;  5LL6 X;  2EY1 A;  1EQV A;  1BUV T;  4BY1 B;  4DR3 L;  5DEH A;  3M4O B;  1ENA A;  4LF4 Q;  1V1Q A;  1LTG D;  1O7L A;  3M4P A;  1FR3 A;  4JYA Q;  2JQO A;  2HCI A;  5E1F A;  1PH2 A;  4KY5 A;  1B2T A;  4AQY L;  1E2Z A;  4GOP A;  3PIP 3;  4YIJ A;  2I0Q A;  2L4N A;  3MXN B;  3H15 A;  1W2B A;  1D5Z C;  4QMG A;  2UXB L;  4A3G G;  4HMJ A;  2DJG C;  2K05 A;  4JI3 Q;  4EX5 A;  4JOI A;  1MI2 A;  3J7Z C;  4JW0 A;  1A15 A;  1X54 A;  1V9P A;  1EIY B;  1B4O A;  5EKL A;  2VUM G;  4UP9 A;  1TWH H;  3CMA A;  4DU9 A;  3HOV H;  1VMP A;  4HJA A;  4B3M Q;  4KJN A;  4C3I G;  2BCO A;  2NN6 H;  2I5M X;  1DYQ A;  1XYI A;  4N9T A;  1I6H B;  2Z6B A;  1FD7 D;  4GN3 B;  3X3N A;  3T13 A;  1Z6H A;  1PRT B;  2EE1 A;  5CR3 A;  4YWL A;  3BDL A;  1QOH A;  3A5Z B;  1PFM A;  1SNM A;  2SNM A;  4UPA A;  1CSQ A;  1SEB D;  4GKK Q;  4K0K L;  3QR8 A;  3GTK H;  1STN A;  4L5R C;  1HZC A;  4UHV A;  2K14 A;  5C5L A;  2QDB A;  1SAP A;  2XVS A;  1LV9 A;  4KN4 C;  4QB4 A;  3S1M H;  1MBY A;  1LT4 D;  1ZEQ X;  3CPF A;  3CC4 A;  3LWE A;  1JJC B;  1QZG A;  3P75 A;  1DD2 A;  2QF7 A;  5GRO A;  2PPB C;  5CYU A;  4UAI A;  4KKT A;  2D9U A;  3I73 A;  2F4V L;  1PH7 A;  4XYO A;  3VYS A;  3RN5 A;  4FF2 A;  4JBW A;  4DR4 Q;  3EA6 A;  3M4Y A;  4DV2 Q;  1G29 1;  1SYE A;  1Q8I A;  2BA1 A;  3PIO 3;  1AEX A;  2R93 B;  1UWV A;  2CKZ B;  3NPP A;  5HY6 A;  1PTO D;  1Y1V B;  3TS2 A;  1PTO C;  1QG7 A;  5C5M A;  3J81 L;  3LNN A;  2PI2 E;  5LMU L;  2ZJQ A;  1FYC A;  1C4Q A;  1NUC A;  4MTK A;  4IFD H;  1TKW B;  1SYF A;  4YHH Q;  1NY4 A;  4BBS B;  1NSN S;  4BY7 B;  1VQ8 A;  2QIL A;  2WP8 J;  4K8I A;  3FMC A;  1A2T A;  1SJE D;  3MZ5 A;  1N33 L;  4EQN A;  5ELB A;  2NZO A;  1Q1B A;  3C1F A;  4POF A;  1PTO H;  5BR8 L;  1I4P A;  2NBF A;  1IBL L;  4DAY B;  3BVM A;  2E74 C;  5M3M B;  3AMU A;  3EFX D;  4EQP A;  4DR6 L;  4DV3 L;  4JI7 Q;  1XPO A;  4K6L A;  4A3D B;  3TBI B;  1Y1W G;  3GO5 A;  5A2Q L;  4ME5 A;  1PA6 A;  5IE8 A;  5C3X A;  4A3I H;  5JJL A;  1E3P A;  1VQE A;  4PZ7 A;  3K5M A;  3MXU A;  1Y8O B;  1WTV A;  4R4C A;  4HN7 A;  4P2C B;  3IAY A;  1HA6 A;  2KCT A;  2O2L D;  4B3S Q;  4JG2 A;  5IP9 G;  1RKN A;  1WVL A;  2UXD Q;  2RBM A;  2VQF Q;  5C3W A;  1CKN B;  2Z8L A;  1XXG A;  3CW2 C;  2K5W A;  4DK6 C;  3W2D A;  1QUQ A;  4OEL B;  1RD9 D;  4DV6 L;  2CQA A;  1TS3 A;  1S5C D;  3B6Y A;  2CWA A;  4CDD C;  2NVQ B;  4A3B B;  1JCK B;  1HPC A;  1LLR D;  2EQS A;  1RCV D;  2KJX A;  4KHP Q;  3OSO A;  5I2X A;  2IT1 A;  5T1G A;  1DZ1 A;  1QVG A;  3KLW A;  3HOY G;  1SNC A;  1WYD A;  3BDO A;  3I4N H;  1L0W A;  4GN5 A;  1LM0 A;  3RZD H;  1RHP A;  4GNX A;  1DXM A;  3J81 i;  5KIX A;  3RR5 A;  2RHS B;  4X65 L;  1HR0 L;  2N8N A;  3IKJ A;  1BO0 A;  1EOT A;  4GOP B;  3IFD A;  2LXJ A;  3UDG A;  4JI4 L;  5IT9 c;  1VQG A;  5EBD A;  2V1C C;  2KCN A;  3MEH A;  2E2D C;  2AUK A;  4B08 A;  1PZJ D;  2EJG C;  2VQE Q;  1VDZ A;  4KTA A;  4JI2 Q;  2ID0 A;  3MC0 B;  4YWK A;  1L0Y B;  2D0O A;  4IUT A;  1GJX A;  2Z6K C;  5M5W B;  5FLX E;  1K9M C;  1XNR Q;  1JQY D;  2WB1 G;  1A63 A;  1A3V A;  1QIL A;  2F3V A;  3A7L A;  3HP3 A;  1K3B C;  5GAG C;  5C4J H;  3F2D A;  2XWJ B;  3D6W A;  3R8B A;  4YY3 Q;  2CH4 A;  1WTR A;  1DCZ A;  2YU9 B;  2OTJ A;  3KF6 A;  4A3G B;  2Y0S E;  3FP9 A;  5IP7 H;  4JCV E;  5KNB A;  5ELD A;  1WTQ A;  2BH2 A;  4IJL A;  1RDP D;  5D3D A;  3A8I E;  4RHR A;  2PZT A;  2VUM B;  2CHB D;  5JEA G;  5JVG 3;  1HZ9 A;  5K36 H;  1YHB A;  2K28 A;  2KHJ A;  1LUZ A;  2BE5 D;  3UE0 A;  4C3I B;  5IYD H;  4F7X A;  5ELC A;  1BBX C;  1XMO Q;  4OWX B;  1CHQ D;  1EQT A;  4A3F G;  1CQV A;  1IZ6 A;  3DWP A;  1SYB A;  2RHQ B;  2NVT B;  2KVM A;  4XIG S;  1LYL A;  2X69 A;  3D3R A;  1YI2 A;  1W3S A;  3GTP H;  5KYI A;  2JA6 G;  1ET9 A;  3RNU A;  2ZM6 Q;  2AQ1 B;  2TSS A;  2I07 B;  5C0X G;  2CW0 D;  1VQP A;  4M1U B;  1YVC A;  3PUV A;  3HOW B;  2HHH L;  1X6O A;  1WOC A;  1RTN A;  4Z9C B;  5LMN L;  1UE6 A;  1HNW Q;  4WJ4 A;  4JBJ A;  1KNE A;  5JJZ A;  1Q12 A;  4DFA A;  1VQO A;  4MIU A;  4AYB G;  1ONL A;  4LW1 A;  3SVM A;  4XQN A;  1EWI A;  4DR2 L;  1K73 C;  5M3F H;  3RUZ A;  2VXW A;  4L5Q A;  5ELF A;  4A3K H;  4HSP A;  4ZQ3 A;  1EZ8 A;  4KY6 A;  3OIP A;  4WJW A;  5A35 A;  1CI3 M;  4NMZ A;  4NW2 A;  2F0O A;  5EGT A;  2YYZ A;  4DV0 Q;  3E0E A;  5KYL A;  1NE3 A;  4LF8 L;  2AQ3 B;  4CDF C;  1NJI C;  3PF5 A;  1UEA B;  1LO5 D;  2FXQ A;  3PO2 B;  3HKS A;  4HMI A;  5FLM G;  4PMB A;  1E1O A;  3G71 A;  1UE1 A;  2B2V C;  2CVR A;  3S17 H;  4QCL A;  1WFQ A;  3FHW A;  1QUQ B;  3T1Y Q;  1ICF B;  2M00 A;  2F0J A;  3CF5 A;  1HNZ Q;  4J6H A;  1Y1W B;  1I50 B;  3HKZ G;  4BY1 G;  4DV1 L;  5M9O A;  4QJF A;  1VS0 A;  3NQT A;  1HNX L;  4A3E B;  1TVX A;  2F0W A;  3PO3 B;  1STH A;  4X64 Q;  3I4M H;  1EZ6 A;  4P72 A;  1UAP A;  2EXD A;  2UUC Q;  4NXM Q;  1EY5 A;  1ENF A;  4YCU A;  2PO4 A;  5JEA J;  1E22 A;  4LF5 Q;  1AZQ A;  3J81 E;  4RGT A;  2HDL A;  3M9B A;  5J1Z A;  3VA7 A;  4RHS A;  1CSP A;  4JI0 Q;  1STA A;  4GNX B;  4F88 A;  3HOZ H;  5IYC H;  3M7G A;  2JJQ A;  4R4Q A;  3TP7 A;  1HFG A;  5J39 A;  2O5J C;  2H4O A;  3K8A A;  3MFG A;  3VYR A;  2IX3 A;  4DNI A;  1PLF A;  2X6L A;  2DGY A;  2R92 H;  4LF6 Q;  3GTQ H;  4DV5 Q;  2A1A A;  3HOY B;  1G6Z A;  2A73 B;  5C0X J;  4DXF A;  3M4O H;  1YZ6 A;  3O13 A;  1NCV A;  3I56 A;  3TP6 A;  3S1R B;  1OXS C;  1AW7 A;  1UE7 A;  5A2Q E;  1JJ2 A;  3CC7 A;  1Q90 A;  1JJG A;  4KMU C;  1D1K A;  2PMZ E;  4K2K A;  4X3S A;  1HTP A;  2A19 A;  2F0V A;  4RAU C;  5JJI A;  3BU2 A;  4C1N K;  4EVO A;  2B2Y C;  2B2T C;  5G3L F;  4L8J A;  1PH8 A;  2JA7 G;  5GAD C;  1AZP A;  3OMG A;  5D14 A;  2EVB A;  1PRT D;  2Z9H A;  1PRT C;  2B2Y A;  4OIJ A;  2HT1 A;  4L63 B;  1XTC D;  3Q23 A;  1V43 A;  1XNQ Q;  2EJM A;  3CCS A;  2PZU A;  4UP7 A;  1KD1 C;  2E8G A;  3UDX A;  2K52 A;  3OTO Q;  5KRU A;  4IUP A;  2F0U A;  4GLA C;  2OT2 A;  3EBE A;  1PRT F;  1PV4 A;  2E2J H;  2WKC A;  3R93 A;  4BY7 G;  2DNC A;  2JA8 G;  1VQK A;  4A4I A;  1VQN A;  1VQ5 A;  4A3C H;  1XPU A;  2Z4H A;  3S2H B;  3BZK A;  4HJ5 A;  4X3T A;  4LUV A;  1LT6 D;  1WD0 A;  5M5Y H;  2Q2H A;  5E3F A;  2A6E C;  2UUA L;  2CFM A;  1EYA A;  3G6E A;  3VR3 A;  4NPS A;  2MJ8 A;  4IPC A;  4DGZ A;  4M8A A;  4DUY Q;  3M7N A;  3SDZ A;  5JJK A;  2EJF C;  4XDX A;  4DV7 Q;  3CRL C;  3E6Z X;  4KI0 A;  2B63 G;  4APV A;  3KFU A;  2K33 A;  3PF4 A;  4A3L H;  2JA5 G;  1X3F A;  3PV0 A;  3P7J A;  4A3D G;  3PUY A;  5AJ3 L;  4LFC Q;  4MNO A;  5EPK A;  1CA6 A;  4NXN Q;  1EY6 A;  1K28 A;  5ELO A;  3GTO B;  4G7O C;  2R93 H;  1TWF B;  4TVA B;  4FYD A;  3JAM c;  1HRJ A;  2C9O A;  1PH6 A;  4B9X A;  1Y1V H;  4K14 A;  2FMC A;  4C3H G;  3A74 A;  3DM1 A;  3J80 c;  1LT5 D;  3ICE A;  3S16 H;  4BBS H;  2JA6 B;  2NWG A;  1EWC A;  4DAY A;  2LFN A;  4NKL A;  3ULJ A;  1VQ9 A;  2RVL A;  5IYB G;  1BQQ T;  4C56 C;  5EAY A;  4CJ2 C;  5CBE E;  4DN4 M;  1H95 A;  4V19 0;  3S1Q B;  2WB1 E;  4A3B G;  2JN4 A;  1B3A A;  4KN7 C;  3TEH B;  5FJ8 H;  3KDF A;  2K5Q A;  4OIK A;  4AYB B;  1C9O A;  2K6A A;  4OX9 L;  2RKS A;  1G91 A;  5C44 G;  4LJZ C;  3G7L A;  4XT1 B;  2ZT9 C;  3I91 A;  2YTV A;  1RIP A;  1MSH A;  2QA4 A;  2MHV A;  1UEB A;  3FDT A;  2ZXP A;  3K0X A;  4H44 C;  4JBK A;  4BXX G;  2D62 A;  2EYL A;  1D1I A;  1Y8P B;  3GP7 A;  5ISR A;  2XNA C;  1GUO A;  3SK5 A;  1IBM L;  1DOL A;  1PFN A;  3K5L A;  2N49 A;  2WV6 D;  1S5E D;  4KD4 A;  1AH9 A;  3ULL A;  5FLX c;  4KLK A;  4JI8 Q;  3D31 A;  3RN2 A;  5H1S E;  5IY0 A;  3TQY A;  1EFW A;  3Q22 A;  3I2Z A;  1SMX A;  4ZLT F;  4LF9 Q;  3NBI A;  4XQQ A;  1IBK Q;  1IKM A;  1I94 L;  1R9T H;  2G9H D;  3D4R A;  3T4A C;  2DN8 A;  3HKZ B;  1NMF A;  3I90 A;  5I9P A;  1PYS B;  2E76 C;  4LF4 L;  1DON A;  4YCV A;  3CRK C;  1SBB B;  1H9R A;  3K7A H;  2KBN A;  1LTB D;  4GOP C;  2UXC Q;  1HJP A;  1M8A A;  1N36 Q;  1GUG A;  4MHE A;  4O2D A;  1W6J A;  2NVY B;  4DR5 Q;  2NN6 G;  3NE5 B;  1XMQ Q;  4JOI C;  4DA2 A;  1LAB A;  1AE3 A;  3MEF A;  4ULL A;  1VQF A;  4QY7 A;  1SNP A;  3TZU A;  4ZKB B;  3J7Y W;  3S14 B;  3CCV A;  2UU9 Q;  4JI3 L;  5DAU A;  1STB A;  3U9O A;  5JAV A;  4WJ3 M;  1WI5 A;  2WAC A;  4IZ8 A;  2IX0 A;  2JEB I;  4OO1 G;  2OXP A;  5BN4 A;  1GUW A;  1D2B A;  1NBW A;  4G57 A;  4MTN A;  3HOX G;  2L1B A;  4GS3 A;  3NXW A;  1JOO A;  4A3J H;  2NTS A;  3SK4 A;  2NVX H;  1ASZ A;  3PCO B;  1FJG Q;  1LTR D;  1J9O A;  1KL9 A;  2QEX A;  2L9H A;  5M5W H;  3CCR A;  1JWS D;  3EJI A;  1G51 A;  1ET6 A;  2I5H A;  1SE8 A;  3MXG A;  4K5V A;  1TS2 A;  1Z9F A;  1RJT A;  5IOC A;  3Q24 A;  1T5E A;  1J5E Q;  1NMG A;  3ERS X;  4GKK L;  4EQ5 A;  4IFD G;  3RZO H;  1KRT A;  3CAM A;  3QO2 A;  4CDE C;  1TY2 A;  1TWC H;  1TU2 B;  2JXM B;  3HOW G;  4A3G H;  3R3O A;  2JA7 B;  1S5D D;  2A68 D;  3D4W A;  1PXU A;  2A68 C;  4DNT B;  2KED A;  3F8T A;  4DR4 L;  1FVI A;  1R4P B;  1GKH A;  4DV2 L;  3T51 B;  2VUM H;  1S5B D;  3L9A X;  4UY8 C;  1N8R C;  2F0D A;  2O4X A;  1DM0 B;  1TR5 A;  2Z0S A;  3K5O A;  1VQ6 A;  3GV3 A;  1AFP A;  1H9J A;  4LUZ A;  4C3I H;  2E2H B;  1MKH A;  2XRS D;  4YHH L;  4PQX A;  1JE5 A;  4CJ1 B;  1PMR A;  1YJ9 A;  3GTM B;  3DWQ A;  1KHI A;  1U4P A;  1UNS A;  2Q8R E;  2VW9 A;  2MFI A;  2JA8 B;  3ERQ A;  1VQL A;  1X3G A;  2B29 A;  2EIF A;  1A0I A;  2NTT A;  1YIT A;  5FO7 B;  2LY7 A;  1YEZ A;  3TRE A;  3R2I A;  1VCI A;  2WIN B;  1A3U A;  4ABN A;  4R8N A;  1U4L A;  3PO2 G;  4C3J B;  4IUV A;  4OHJ A;  2F0M A;  4RKB A;  2B63 B;  2K5D A;  2XGT A;  4JI7 L;  1AN8 A;  2JA5 B;  1IKL A;  1F9P A;  3IFT A;  3NEN A;  1J8I A;  5D3I B;  4DK0 A;  3C2P A;  1T9H A;  3PSI A;  3KDF B;  2YV5 A;  4A3E G;  3S1N H;  3PO3 G;  1CKO A;  1LTT D;  1SRO A;  5JPN C;  3HOU G;  4FF1 A;  4C3H B;  2NZ1 D;  4B3S L;  2LS0 1;  5KEE A;  1TQO A;  2UXD L;  4K5X A;  2VQF L;  3GTL B;  2GA4 B;  4O42 A;  3K59 A;  2K5V A;  4K8J A;  4HJ7 A;  3CME A;  1SDF A;  1KDA A;  1HTL D;  4A93 B;  3BS1 A;  1B9M A;  1ILQ A;  1STY A;  2EYO A;  3QG1 A;  4WRD A;  1JMC A;  4LFA Q;  2OTL A;  5K5P A;  1EY0 A;  4KHP L;  1U9R A;  2BDO A;  2H1E A;  4N8F A;  4QF4 A;  2A69 C;  3H09 A;  3H0G B;  3NEM A;  5C44 B;  4IFD J;  4GNX C;  1PHJ A;  4QUF A;  4LWC A;  3K80 C;  5IGD A;  4PMW A;  1Y1W H;  1I50 H;  2D0P A;  4I65 A;  4DV6 Q;  3NSW A;  1OXU A;  4ZYS A;  5IGC A;  4U67 3;  5IT9 L;  2PW7 A;  1P16 A;  3URY A;  3TP5 A;  2R7D A;  3H94 A;  4JV5 Q;  3FEW X;  5I9O A;  4F8M A;  5IP9 H;  4XYQ A;  1X9N A;  1JOR A;  3VR5 A;  5CV5 A;  2CCZ A;  5TSS A;  5ELN A;  2L15 A;  1XPR A;  2EXZ A;  5EPJ A;  1JOQ A;  1SYD A;  4ILW A;  3NBH A;  5FK9 C;  4F87 A;  2VQE L;  4JVZ A;  1DGS A;  2F0L A;  4JI2 L;  1B3Q A;  1CUK A;  1JE4 A;  2XIW A;  1Z7T A;  1BCP F;  2EYM A;  1BOS A;  4IN3 A;  5FO9 B;  1XNR L;  1WCM G;  1UUP A;  1VQC A;  2QEJ C;  3V05 A;  5J3B A;  5FO8 B;  1TWH B;  4IJH A;  1Q82 C;  3HOY H;  1N32 Q;  2YTX A;  4A3M G;  3KOJ A;  2HQL A;  4YY3 L;  3GQB A;  2DUD A;  3ERO A;  3DLL A;  3I72 A;  4X66 Q;  3OHX C;  3WOF A;  2VZA A;  1L1O B;  4AIM A;  3VA5 A;  4IUN A;  2HIV A;  3OW7 A;  4IUQ A;  1TXY A;  4C2M H;  2B39 A;  1YNJ D;  1YNJ C;  2CWP A;  1ICW A;  3GTK B;  2B8G A;  3HOX B;  2A74 C;  1I6V C;  1U5K A;  1KDC A;  2KOL A;  1Q86 C;  1EY7 A;  2F3I A;  2RSN A;  1IL8 A;  5ELE A;  3E9I A;  4GZY C;  1YJN A;  1XMO L;  2JK8 A;  1ZXT A;  3NTH A;  5IOD A;  2PQE A;  3KLR A;  3HG9 A;  1VQB A;  1ESR A;  4L6T B;  1X55 A;  4BS9 A;  4RKL A;  4FXD A;  4DAV A;  3QIA A;  4RCN A;  5M5X B;  3T1H Q;  3EIV A;  1VQH A;  1BDO A;  2RQX A;  5M3F G;  3NK9 A;  2KEN A;  3CP0 A;  2ZM6 L;  3S2H H;  4IAL A;  4FP5 D;  5C4X G;  5IWA Q;  5FKA C;  2CQO A;  4HIK A;  1STE A;  3ER0 A;  1XWE A;  2ZJP A;  2G5D A;  2MP1 A;  1A8V A;  4KKS A;  1PZK D;  1G2T A;  1HNW L;  1EEI D;  2K32 A;  3KJO A;  4R8I A;  2M9V A;  3VR4 A;  4R4T A;  2E5L Q;  3KF8 B;  5JEA H;  4LF7 L;  3AFQ A;  1Q8K A;  2F0G A;  3NWS A;  3QJY A;  4RH6 A;  5CV4 A;  5CV9 A;  3CPW A;  3KBX A;  2R7Z G;  1M90 C;  5L37 A;  1EU4 A;  5T1I A;  4FF3 A;  3UDF A;  4CDC C;  4HSV A;  3BJU A;  4LMQ D;  1W6K A;  4KY7 A;  1GHJ A;  1WTX A;  3TME A;  4A3F H;  3Q8D A;  1EQQ A;  3CC2 A;  4HAE A;  1BF4 A;  1SYG A;  3FKI G;  2NUC A;  4DV0 L;  3HFZ B;  2AUJ D;  4A3I B;  3S2D B;  4MN3 A;  4GKJ Q;  4A75 A;  3MAQ A;  1C0A A;  1GD7 A;  3L7Z C;  2E2I B;  5C0X H;  3GTJ H;  4YCW A;  3T1Y L;  3S1Q H;  3HOZ G;  1HNZ L;  2YTY A;  3A55 A;  1GOZ A;  1GUS A;  1YNX A;  1H9M A;  2RF4 A;  3NTK A;  3OWE B;  4FVM A;  4H02 A;  4R4I A;  1K83 B;  5C3E H;  5IGB A;  4X64 L;  2IX1 A;  3BG3 A;  3Q0A A;  1JOK A;  3HOU B;  2UUC L;  5NUC A;  1PYW D;  4Y7N B;  3CQZ H;  2AWN A;  2XN9 C;  3M3Y H;  4DF7 A;  4LF5 L;  1QWY A;  4YWM A;  1B1Z A;  3H3V I;  2RCF A;  3I8Z A;  1KAB A;  2N55 A;  3QWN A;  4FDB A;  5FOB B;  2QGQ A;  1BVS A;  4TKO B;  4OO1 I;  1WTH A;  3L2P A;  3CCM A;  3FRP B;  3I55 A;  3E0J A;  1LT3 D;  1SE3 A;  2HDM A;  5FLM H;  4LF6 L;  2C35 B;  1KNA A;  1HQR D;  2VS1 A;  3CD6 A;  3C3L A;  4DV5 L;  5IGF A;  4R4O A;  1EY8 A;  3F2U A;  4B3T L;  3NBH B;  2E75 C;  2R7F A;  1Y8N B;  1BCP B;  1FL0 A;  1FNU A;  2IHF A;  1SFO B;  4BY1 H;  5GQO A;  1QB5 D;  2F0Q A;  4JI6 Q;  4KKU A;  1ENC A;  2HCC A;  3P20 A;  4ZCK A;  1ESF A;  5G3L D;  1SNO A;  3A5U A;  4GN4 B;  4DUZ Q;  1VQ7 A;  4IUR A;  1G2S A;  1YBY A;  1K8M A;  1SNQ A;  2PQA B;  3KLS X;  4IPH A;  3J7A V;  1GVP A;  2D5D A;  4BWG B;  1EU3 A;  3DEP A;  4RFB A;  4CKC A;  4X62 Q;  3LGJ A;  4B3R Q;  1CT1 D;  3HRZ C;  1WJJ A;  4EQO A;  4WFN 3;  1GM5 A;  4LFB Q;  2IWH A;  1D7Q A;  5COR A;  1WD1 A;  1E24 A;  5CV6 A;  2PI2 A;  3EVQ A;  2F0F A;  4HIO A;  1XNQ L;  3CCL A;  2H5X A;  3BZC A;  3UI2 A;  4QUC A;  4HJ8 A;  3OTO L;  4DR1 Q;  2AQ2 B;  4PNY A;  1WCM B;  1YIJ A;  4KHV A;  2Z4I A;  1CM9 A;  3BYT B;  3AEV A;  1I6H H;  4A3M B;  2WAQ B;  3H91 A;  1NR2 A;  3SK8 A;  1SR3 A;  3K7U C;  4JPB W;  1H9S A;  5AFW A;  5CBA E;  3HZX A;  3ULP A;  1YNN D;  2A6E D;  1YNN C;  4BA1 I;  2LSS A;  3CCQ A;  1IHZ A;  4C3J G;  2QW7 A;  3CCJ A;  2BH8 A;  2ALY B;  2UUB Q;  1ROD A;  4DV7 L;  1EWH A;  4X6A H;  3D4D A;  1OXT A;  1KIX A;  2BOS A;  3K57 A;  1CZW A;  3NEL A;  2HIX A;  3I4L A;  3RLO A;  1DJR D;  3JAM L;  2O5I C;  4JI1 Q;  4J1M A;  3ZJY C;  2JA7 H;  1ML0 D;  3NWT A;  5I6Y A;  3C1E A;  3J80 L;  4LFC L;  1I4R A;  2L12 A;  2NYZ D;  3ONA B;  2PW5 A;  4NXN L;  3K58 A;  1WTO A;  3M85 A;  4P75 A;  3U58 A;  3EQL C;  4RCO A;  5E4X A;  1N34 Q;  4BBR G;  5EJW A;  3P1H A;  4DV4 Q;  1MD2 D;  1NAP A;  1OTC A;  4CKB A;  3MHB A;  3GTM H;  3G48 A;  4BY7 H;  5M3F B;  2JA8 H;  1K3R A;  3WWV A;  1L2F A;  1Q46 A;  5C4X B;  3LX0 A;  4A93 G;  3PUZ A;  2EPB A;  1O7Y A;  1H9K A;  3CU7 A;  1D6E C;  3CCE A;  2IL8 A;  2EYJ A;  3K5N A;  2DY8 A;  1Q3L A;  2IW3 A;  1EYD A;  1I3Q B;  2A6H D;  2A6H C;  2B63 H;  4UP8 A;  4DR7 L;  1B44 D;  1VQ4 A;  5M3M H;  2AMC B;  3H0G G;  1VF5 C;  3GTG B;  2R7Z B;  4A3D H;  4PMC A;  4JI5 Q;  4OL7 A;  1GUN A;  1GXD C;  2B2U A;  3N6R A;  2F0K A;  4IPD A;  5FLX L;  2F0S A;  1LTA D;  1V1P A;  2XTI A;  3FKI B;  4XTC S;  3BDC A;  3BZD B;  4C3H H;  1XTD A;  3MFY A;  1S72 A;  4I7Z C;  1MHW C;  3GTL H;  1O80 A;  1QJO A;  4P71 A;  4JI8 L;  5LHY 1;  1AE2 A;  2ATW A;  2TMP A;  4RGM A;  4RGN A;  1EEF D;  5HGT A;  5IYB H;  5LMN W;  4H7B A;  2P5Z X;  1JWM D;  1JR0 D;  4LF9 L;  2NVQ H;  3STB D;  1IBK L;  4A3B H;  3E9H A;  3STB C;  3AU7 A;  4ZKC B;  1Q81 C;  1RF2 D;  3HOZ B;  1F77 A;  1JT8 A;  2OQ0 A;  1F9R A;  4R9W A;  2N88 A;  3JAM i;  4PZ8 A;  4JYA L;  1N36 L;  2DY7 A;  5DNF A;  3J80 i;  1TY0 A;  4NB3 A;  2FHT A;  1K8A C;  3GTQ B;  3HOV G;  1F2M A;  2EOT A;  1A2U A;  1P8L A;  2EY6 A;  4DR5 L;  1XMQ L;  3PUX A;  2VB2 X;  3NTI A;  4ALP A;  1DOM A;  2KHI A;  4AYB E;  5KGU A;  2LXK A;  2UU9 L;  3MWY W;  4DR3 Q;  2L0C A;  4HID A;  1K8G A;  3PQI A;  4P73 A;  3S15 B;  1VQI A;  5E4W C;  5LL6 S;  2B8F A;  4E6I A;  1JWU D;  3K6O A;  1L0X B;  2WKD A;  4QGU A;  3X3M A;  1SSO A;  1O78 A;  4LAA A;  1NTG A;  4OXP A;  4AQY Q;  2M2L A;  1QCB D;  2EYH A;  1PYB A;  4B3M L;  2SEB D;  4OGQ C;  3RMH A;  3KLS A;  2ZJR A;  1SLJ A;  1CA5 A;  2RDG A;  3SE0 A;  3TSS A;  5J22 A;  2UXB Q;  1L1O C;  3U50 C;  1LTI D;  4MZ9 A;  3DUZ A;  2XSC A;  1TT2 A;  1A3T A;  3FPU B;  1FJG L;  3H3V C;  4DK3 C;  4CHT B;  2F0E A;  3SHL A;  1RTO A;  2AHO B;  1L1O A;  3A56 A;  2NB0 A;  1EIF A;  4IOC A;  3OWF A;  2IY5 B;  1J5E L;  3VYT A;  3RLF A;  5C0X I;  1KDB A;  3HEJ A;  3S9W A;  1WTP A;  3HKZ E;  2E2J B;  2YU9 H;  3AQQ A;  4N8X 1;  1H9S B;  2K04 A;  1PH5 A;  3H3V H;  2HUG A;  5M5Y B;  1A6X A;  4KHZ A;  2F3W A;  2ES2 A;  2F0H A;  4OO1 H;  2RCN A;  1J6Q A;  3AFP A;  2PYK A;  2K7V A;  2AWO A;  4K0K Q;  4RA8 A;  3W5O A;  2RA4 A;  3QOJ A;  3W3A A;  3WOE A;  3HOX H;  1PH1 A;  3E5S A;  3W1B A;  1OXV A;  1XJV A;  3ND9 A;  4S3S A;  2G9D A;  4G7Z C;  1PVO A;  3NQI A;  1VQJ A;  4LK1 C;  4TQU S;  2F4V Q;  3UE1 A;  2MPM A;  2NVT H;  1QZH A;  5M5X H;  4A3I G;  3DXJ C;  3DEO A;  1Y69 U;  2K75 A;  3J81 j;  4DK1 A;  1HZB A;  5JVH 3;  4TSS A;  4RMF A;  5LMU Q;  3DMU A;  3S16 B;  3KF8 A;  3A54 A;  2MO1 A;  1C7Y A;  3HOW H;  4RWS C;  3NP8 A;  4G4K A;  3PMF A;  2HD3 A;  3FPP A;  4BA2 I;  4QL5 A;  3J81 c;  1D5X C;  1PTO F;  4IUU A;  4Q0F A;  1N33 Q;  3TRZ A;  1SRU A;  2X6G A;  1KAA A;  4IOA A;  1E2V A;  1SND A;  4O1N A;  3KYH C;  2KA7 A;  4ODG A;  5BR8 Q;  1LTS D;  1IBL Q;  2Q2U A;  2J0T D;  1JC7 A;  1BXT A;  4BBR B;  3TZD A;  4EGV A;  5EKK A;  4OEM B;  1FNW A;  2K4K A;  4DR6 Q;  1KLG D;  4DV3 Q;  1Z47 A;  4CBV A;  3N52 A;  4HJ9 A;  1TS4 A;  3I4N G;  1TWA B;  1V1P B;  1EL0 A;  2BDN A;  4X3U A;  2L11 A;  3IRB A;  4B9W A;  4QQB X;  4O0A A;  4G7H C;  1IYJ B;  1F9S A;  1MGS A;  3S2D H;  1S3O A;  2SNS A;  1KLU D;  4K5W A;  3PO2 H;  3BVG A;  4LFA L;  1S5F D;  2A5H A;  2E2I H;  4DNR B;  5D65 A;  1BKB A;  3R2T A;  3C46 A;  2A69 D;  3KUP A;  2IHE A;  3T56 B;  1B7Y B;  1TWG B;  1SYC A;  1T5X D;  1PFS A;  2VY3 A;  3AYH B;  4H13 C;  3OYY A;  1QVF A;  3JAM E;  2ASB A;  4IPG A;  1K83 H;  4A3E H;  2Q8T A;  2SDF A;  1R9T B;  3GD7 A;  3J80 E;  3PO3 H;  1EIH A;  3NHH A;  3SGI A;  5DLQ E;  3HOU H;  5EKI A;  1B70 B;  4H0L C;  3K7A B;  4Y7N H;  4JV5 L;  1IW7 D;  2L55 A;  1IW7 C;  2RSO A;  2Y0S B;  3OMC A;  3BVZ A;  1PH4 A;  2JEA I;  4DPG A;  3PGZ A;  4LNQ A;  1LAC A;  1BCP D;  2ZXO A;  4TRD A;  2N78 A;  1BCP C;  1YJW A;  1KXL A;  4X3K A;  4FO2 A;  2J7Z A;  3SK6 A;  4OWT B;  2F0T A;  2KEC A;  1B8A A;  1KAW A;  4Y52 H;  5IP7 G;  4X65 Q;  1HR0 Q;  1QNK A;  3TS0 A;  3I4O A;  1BNZ A;  3JC6 6;  3AB9 A;  1D5M C;  1V8Q A;  2FFK B;  4XXE A;  4JI4 Q;  5CV7 A;  1A62 A;  1N32 L;  5K36 G;  2PQA A;  2F4I A;  2WAQ G;  1F2L A;  5EPL A;  3HOV B;  1SFO H;  3VR6 A;  2L5T A;  3A8K E;  2C5C A;  1X65 A;  3U4Z A;  5IYD G;  4A3J B;  4K2L A;  4X66 L;  3S1R H;  4OON A;  2NVX B;  4ZRZ A;  1II3 A;  3G4S A;  4RGO S;  1HA5 A;  3MXP A;  4FF4 A;  1GUT A;  3A7A B;  1E7Z A;  1B9N A;  2NZH A;  4ID6 A;  2Z6K A;  1JIC A;  2FIN B;  1NNX A;  3TDQ A;  3VR2 A;  1STG A;  3RZO B;  4DAP A;  3I70 A;  1U4R A;  2RDF A;  1E1T A;  1VQA A;  1TWC B;  4R1J A;  1CTM A;  2A8V A;  2Q8I B;  3S1M B;  3J7A 5;  3NUC A;  2MGS A;  1EIG A;  1QVC A;  2VNU D;  5DM6 3;  1WCM H;  1MSG A;  2PCF B;  1XX8 A;  4LUO A;  3T1H L;  2ZXR A;  2HQE A;  1EOV A;  1MJC A;  1HUM A;  4A3M H;  4JBM A;  1MIU A;  3SEB A;  1DOK A;  3BYY B;  1CQF A;  4K6D A;  2BE5 C;  1F2Z A;  1B53 A;  1RL2 A;  4A3K G;  4I7A A;  3L3O C;  5IWA L;  3F2C A;  5BN5 A;  2ZTE A;  4HTH A;  4FNF A;  2OCE A;  3A0J A;  2N3S A;  3CKI B;  3V96 A;  5KNC A;  1HUN A;  2PNH A;  4A76 A;  5F2D A;  1EFI D;  1ZYR D;  2E5L L;  2GVB A;  1ZYR C;  3KK7 A;  2ENB A;  3OPO A;  3T53 B;  1AP0 A;  2LKV A;  2R3Z A;  1CK1 A;  5BN3 A;  1PTO B;  3K0Y A;  3MVV A;  2CW0 C;  2KCM A;  3ND8 A;  1B50 A;  2HHH Q;  1IL2 A;  3GTO H;  4GLX A;  1TWF H;  4PG3 A;  5LMN Q;  1IYU A;  4KK7 A;  5HGQ A;  1KC8 C;  1O7I A;  3H6M A;  1CFM A;  4XQJ A;  1FGU A;  3HGB A;  5I6W A;  5C3E G;  4LF7 Q;  3S1N B;  2V4D A;  5EBC A;  3I4M G;  2I5L X;  4DR2 Q;  4GKJ L;  2JA6 H;  2MO0 A;  5C4X H;  2XWB B;  1G8Z D;  1X3Q A;  3U4V A;  1HFN A;  5I2Y A;  1VQM A;  1Q1E A;  1O7Z A;  1I4H A;  1LTL A;  5C6A A;  2F03 A;  2JYO A;  5IYC G;  1BBW A;  2FJ2 A;  1S40 A;  4LF8 Q;  2GN5 A;  1I3Q H;  3I7F A;  2KEE A;  1R4Q B;  4KD3 A;  4ZAI A;  2PZW A;  1F2Y A;  1SJH D;  4NXM L;  3GTG H;  2NN6 I;  3ZYY X;  2R92 G;  2R7Z H;  4ZUJ A;  3M4Q A;  1CZG A;  4OWW B;  2KHS A;  1PDQ A;  5HUR A;  2OEO A;  3A8J E;  1CHP D;  2PMZ B;  2B2V A;  3OIQ A;  4JI0 L;  3OOC A;  3FKI H;  3GDE A;  3I4N B;  4JC0 A;  4DV1 Q;  1HNX Q;  3RZD B;  1SXT A;  1SMY D;  2R6G A;  1SMY C;  3IL8 A;  1Y14 B;  1X3E A;  1V1O A;  3F1Z A;  4XT3 B;  1PFB A;  2K01 A;  2JA9 A;  1GO3 E;  2Q2I A;  1IYV A;  1SN8 A;  5EQ0 A;  3PIP A;  1PZI D;  1VQD A;  3MA2 B;  4P74 A;  4JI6 L;  2QKI C;  3D8G A;  4N9P A;  4NDX A;  2K5H A;  3UDI A;  4DUZ L;  3SR1 A;  3F2B A;  4POG A;  4FXG C;  5IIF A;  2WFW A;  4IFD I;  2VL6 A;  4QIW B;  2NVY H;  3J7A F;  2K5N A;  3WDN A;  2Q2T A;  1X56 A;  5C4J B;  4B3T Q;  2MNA A;  3T16 A;  2WII B;  4X62 L;  4PZ6 A;  1PH3 A;  4ZK9 B;  1KTK A;  4B3R L;  4L5S A;  2ZTC A;  2J4X A;  3S14 H;  3MXN A;  1ILP A;  4A3C G;  4LFB L;  3HS0 C;  1G6P A;  2QCP X;  1HHV A;  1WTW A;  3S15 H;  3RLN A;  3G6J B;  3DM3 A;  2EY5 A;  2K03 A;  1YHQ A;  1I4X A;  2DNE A;  1F9Q A;  4GLV B;  5I4D A;  1I5F A;  1BR9 A;  5JOB A;  2IJ0 A;  4DR1 L;  4C2M B;  1HCZ A;  5CC4 A;  2GVA A;  1I4Q A;  1KQS A;  4NP5 A;  1Q7Y C;  4U68 A;  4HCE A;  3EN2 A;  2FMM A;  1TS5 A;  4A3L G;  3KF6 B;  5E7N A;  4ME3 A;  4ZUI A;  2QDL A;  1TII D;  1EY4 A;  2B2T A;  4DKA C;  4V0B A;  1C8C A;  1HR0 W;  3ITP A;  1PH9 A;  5IGG A;  2OF1 A;  3MTS A;  2R93 G;  2F52 A;  1EYG A;  1Y1V G;  3QB3 A;  5IT9 E;  2KCC A;  1BBU A;  2WB1 B;  1SE4 A;  4DUY L;  2UUB L;  3PIO A;  2B2W C;  3GTP B;  2CH4 W;  2EDG A;  4BBS G;  1MJE A;  1K8O A;  1EYC A;  1QE6 A;  3TP8 A;  1X3P A;  1U0L A;  3W1G A;  4CGY B;  4JI1 L;  2XRQ D;  1JB3 A;  2B2W A;  4QIW E;  3V2T A;  1ASY A;  2UUA Q;  2K50 A;  2EYP A;  1HH2 P;  1VF7 A;  3S24 A;  2OQK A;  4DXG A;  4RG1 A;  2DJF C;  3U9S A;  5FJ8 G;  4CKE A;  2ZTD A;  5CV8 A;  5CMD A;  1N34 L;  1VMC A;  3E3X A;  2E2H H;  3SXH A;  1C48 A;  4DV4 L;  5M3M G;  2IPK D;  3GV6 A;  1OXX K;  5COY A;  5JPM C;  5AJ3 Q;  1M1K C;  4A3K B;  2KQ3 A;  2ICE C;  3RD4 A;  3K81 C;  4HED A;  5GAE C;  1NR4 A;  4IQZ A;  4A3F B;  4FXK C;  2AKW B;  2EY2 A;  1E2W A;  4UDU C;  4C3J H;  4DAM A;  2WAQ E;  3OW2 A;  1S4Z A;  4CJ0 B;  4L5T A;  2F1M A;  2F0N A;  3FVQ A;  4IO9 A;  3DHQ A;  2B2U C;  2B3G A;  1SE2 A;  4WOR A;  4HIM A;  2JA5 H;  1YHA A;  2EZV A;  1EUJ A;  2OWO A;  1HQM C;  4JI5 L;  3Q6S A;  5IGE A;  3GTJ B;  3S17 B;  1FNV A;  1HZA A;  2VB3 X;  1D8L A;  4AH6 A;  3CCU A;  1CKM A;  2K1B A;  2F0P A;  3I3C A;  2R61 A;  2BA0 A;  2D2C C;  1E0B A;  2Z1C A;  3TN2 A;  3D6C A;  4J8Q A;  5C4H A;  4KJO A;  4BBR H;  4DR7 Q;  5C3E B;  2F0I A;  4OX9 Q;  4C1N I;  2I46 A;  3I4M B;  2Y0S G;  2JP1 A;  1OO9 B;  3LWU A;  1M4V A;  5C4Z A;  1UE5 A;  3CQZ B; 
#chains in the Genus database with same CATH homology
 3PUW A;  3M3Y B;  4HCS A;  2MUY A;  3DWA A;  2EYF A;  2SOB A;  2ICI A;  3VYU A;  1GHK A;  4JK1 C;  1I4G A;  2RDH A;  1QNU A;  2LMC B;  2KUM A;  4PV1 C;  2PNR C;  1EY9 A;  3KBG A;  1ZKO A;  4Q5V A;  2R92 B;  3CHB D;  5CGK A;  3QOL A;  1X32 A;  1FGB D;  4HR7 B;  5KND A;  1U4M A;  2JE6 I;  4KV6 A;  5DM7 3;  1HXY D;  2JSO A;  5LL6 X;  2EY1 A;  1EQV A;  1BUV T;  4BY1 B;  5DEH A;  3M4O B;  1ENA A;  1LTG D;  1O7L A;  1FR3 A;  2HCI A;  5E1F A;  4KY5 A;  1B2T A;  1E2Z A;  3PIP 3;  4YIJ A;  2L4N A;  1D5Z C;  4QMG A;  4HMJ A;  2K05 A;  1MI2 A;  1A15 A;  1B4O A;  5EKL A;  4DU9 A;  1VMP A;  4KJN A;  4C3I G;  2BCO A;  2NN6 H;  1DYQ A;  1XYI A;  4N9T A;  1I6H B;  1FD7 D;  3X3N A;  3T13 A;  1Z6H A;  1PRT B;  2EE1 A;  5CR3 A;  3BDL A;  1QOH A;  1PFM A;  1SNM A;  2SNM A;  1SEB D;  1STN A;  5C5L A;  2QDB A;  1SAP A;  2XVS A;  1LV9 A;  4KN4 C;  4QB4 A;  1MBY A;  1LT4 D;  1ZEQ X;  3LWE A;  3P75 A;  1DD2 A;  2QF7 A;  2PPB C;  5CYU A;  4UAI A;  4KKT A;  2D9U A;  3I73 A;  4XYO A;  3VYS A;  4FF2 A;  4JBW A;  3EA6 A;  3M4Y A;  1G29 1;  1SYE A;  1Q8I A;  2BA1 A;  3PIO 3;  1AEX A;  2R93 B;  3NPP A;  1PTO D;  1Y1V B;  1PTO C;  1QG7 A;  5C5M A;  3J81 L;  3LNN A;  1FYC A;  1C4Q A;  1NUC A;  4IFD H;  1TKW B;  1SYF A;  4BBS B;  1NSN S;  4BY7 B;  2QIL A;  2WP8 J;  4K8I A;  3FMC A;  1A2T A;  1SJE D;  3MZ5 A;  4EQN A;  5ELB A;  1Q1B A;  3C1F A;  1PTO H;  1I4P A;  2NBF A;  3BVM A;  2E74 C;  5M3M B;  3AMU A;  3EFX D;  4EQP A;  4K6L A;  4A3D B;  3TBI B;  3GO5 A;  5A2Q L;  4ME5 A;  5C3X A;  3K5M A;  3MXU A;  1Y8O B;  1WTV A;  4HN7 A;  4P2C B;  3IAY A;  1HA6 A;  2O2L D;  1RKN A;  1WVL A;  2RBM A;  5C3W A;  2Z8L A;  1XXG A;  2K5W A;  3W2D A;  1RD9 D;  2CQA A;  1TS3 A;  1S5C D;  2NVQ B;  4A3B B;  1JCK B;  1HPC A;  1LLR D;  1RCV D;  2KJX A;  3OSO A;  5I2X A;  2IT1 A;  5T1G A;  1DZ1 A;  1SNC A;  3BDO A;  1RHP A;  1DXM A;  5KIX A;  3IKJ A;  1BO0 A;  1EOT A;  3IFD A;  5EBD A;  2KCN A;  3MEH A;  2E2D C;  2AUK A;  4B08 A;  1PZJ D;  2EJG C;  1VDZ A;  4KTA A;  2ID0 A;  3MC0 B;  1L0Y B;  4IUT A;  1GJX A;  5M5W B;  5FLX E;  1JQY D;  1A3V A;  1QIL A;  2F3V A;  3A7L A;  3HP3 A;  2XWJ B;  3D6W A;  3R8B A;  1WTR A;  1DCZ A;  2YU9 B;  4A3G B;  5KNB A;  5ELD A;  1WTQ A;  1RDP D;  5D3D A;  3A8I E;  4RHR A;  2PZT A;  2VUM B;  2CHB D;  5JEA G;  5JVG 3;  5K36 H;  2K28 A;  2BE5 D;  4C3I B;  4F7X A;  5ELC A;  1BBX C;  1CHQ D;  1EQT A;  1CQV A;  3DWP A;  1SYB A;  2NVT B;  2KVM A;  4XIG S;  2X69 A;  3D3R A;  5KYI A;  1ET9 A;  2AQ1 B;  2TSS A;  2I07 B;  5C0X G;  2CW0 D;  4M1U B;  3PUV A;  3HOW B;  1RTN A;  4Z9C B;  1KNE A;  5JJZ A;  1Q12 A;  4DFA A;  4MIU A;  1ONL A;  3SVM A;  4XQN A;  3RUZ A;  2VXW A;  5ELF A;  4HSP A;  4ZQ3 A;  1EZ8 A;  4KY6 A;  3OIP A;  4WJW A;  5A35 A;  1CI3 M;  4NMZ A;  4NW2 A;  2F0O A;  5EGT A;  2YYZ A;  5KYL A;  2AQ3 B;  1UEA B;  1LO5 D;  3PO2 B;  4HMI A;  4PMB A;  2B2V C;  2CVR A;  4QCL A;  2M00 A;  2F0J A;  4J6H A;  1Y1W B;  1I50 B;  5M9O A;  3NQT A;  4A3E B;  1TVX A;  2F0W A;  3PO3 B;  1STH A;  1EZ6 A;  1UAP A;  1EY5 A;  1ENF A;  2PO4 A;  5JEA J;  1AZQ A;  3J81 E;  4RGT A;  2HDL A;  5J1Z A;  3VA7 A;  4RHS A;  1STA A;  4F88 A;  3M7G A;  3TP7 A;  1HFG A;  5J39 A;  2O5J C;  2H4O A;  3MFG A;  3VYR A;  2IX3 A;  1PLF A;  2X6L A;  3HOY B;  1G6Z A;  2A73 B;  5C0X J;  4DXF A;  3O13 A;  1NCV A;  3TP6 A;  3S1R B;  1OXS C;  1AW7 A;  5A2Q E;  1Q90 A;  4KMU C;  1D1K A;  4K2K A;  4X3S A;  1HTP A;  4RAU C;  2F0V A;  4C1N K;  4EVO A;  2B2Y C;  2B2T C;  5G3L F;  4L8J A;  1AZP A;  3OMG A;  5D14 A;  2EVB A;  1PRT D;  1PRT C;  2B2Y A;  4OIJ A;  4L63 B;  1XTC D;  3Q23 A;  1V43 A;  2EJM A;  2PZU A;  5KRU A;  4IUP A;  2F0U A;  2OT2 A;  1PRT F;  2WKC A;  3R93 A;  2DNC A;  2Z4H A;  3S2H B;  4X3T A;  1LT6 D;  1WD0 A;  5E3F A;  2A6E C;  1EYA A;  3VR3 A;  2MJ8 A;  4DGZ A;  4M8A A;  3M7N A;  3SDZ A;  2EJF C;  4XDX A;  3CRL C;  3E6Z X;  4KI0 A;  2K33 A;  3PV0 A;  3P7J A;  3PUY A;  5EPK A;  1CA6 A;  1EY6 A;  3GTO B;  4G7O C;  1TWF B;  4FYD A;  1HRJ A;  2C9O A;  4B9X A;  4K14 A;  2FMC A;  4C3H G;  3DM1 A;  1LT5 D;  2JA6 B;  2NWG A;  1EWC A;  4DAY A;  2LFN A;  4NKL A;  2RVL A;  1BQQ T;  4C56 C;  4CJ2 C;  5CBE E;  4DN4 M;  4V19 0;  3S1Q B;  1B3A A;  4KN7 C;  2K5Q A;  4OIK A;  4AYB B;  2K6A A;  2RKS A;  1G91 A;  4LJZ C;  3G7L A;  4XT1 B;  2ZT9 C;  3I91 A;  1MSH A;  2MHV A;  3FDT A;  2ZXP A;  4H44 C;  2D62 A;  2EYL A;  1D1I A;  1Y8P B;  3GP7 A;  5ISR A;  2XNA C;  1GUO A;  3SK5 A;  1DOL A;  1PFN A;  3K5L A;  2WV6 D;  1S5E D;  4KD4 A;  3D31 A;  3Q22 A;  4ZLT F;  3NBI A;  4XQQ A;  1IKM A;  2G9H D;  3D4R A;  3T4A C;  2DN8 A;  3HKZ B;  3I90 A;  5I9P A;  2E76 C;  1DON A;  3CRK C;  1SBB B;  1H9R A;  1LTB D;  1M8A A;  1GUG A;  4MHE A;  1W6J A;  2NVY B;  2NN6 G;  3NE5 B;  4DA2 A;  1LAB A;  4ULL A;  1SNP A;  3TZU A;  4ZKB B;  3J7Y W;  3S14 B;  5DAU A;  1STB A;  3U9O A;  5JAV A;  2WAC A;  4IZ8 A;  2IX0 A;  2JEB I;  4OO1 G;  2OXP A;  5BN4 A;  1GUW A;  1D2B A;  4G57 A;  2L1B A;  3NXW A;  1JOO A;  2NTS A;  3SK4 A;  1LTR D;  1J9O A;  2L9H A;  1JWS D;  3EJI A;  1ET6 A;  4K5V A;  3MXG A;  1TS2 A;  1RJT A;  5IOC A;  3Q24 A;  1T5E A;  4IFD G;  3QO2 A;  1TY2 A;  1TU2 B;  2JXM B;  3R3O A;  2JA7 B;  1S5D D;  2A68 D;  3D4W A;  1PXU A;  2A68 C;  4DNT B;  2KED A;  1R4P B;  3T51 B;  1S5B D;  3L9A X;  2F0D A;  2O4X A;  1DM0 B;  1TR5 A;  3K5O A;  3GV3 A;  1AFP A;  1H9J A;  2E2H B;  2XRS D;  4PQX A;  4CJ1 B;  1PMR A;  3GTM B;  2Q8R E;  3DWQ A;  1U4P A;  1UNS A;  2JA8 B;  3ERQ A;  2NTT A;  5FO7 B;  2LY7 A;  3R2I A;  1VCI A;  2WIN B;  1A3U A;  4ABN A;  4R8N A;  1U4L A;  4C3J B;  4IUV A;  4OHJ A;  2F0M A;  4RKB A;  2B63 B;  2K5D A;  1AN8 A;  2JA5 B;  1IKL A;  1F9P A;  3IFT A;  1J8I A;  5D3I B;  4DK0 A;  3C2P A;  1LTT D;  5JPN C;  4FF1 A;  4C3H B;  2NZ1 D;  2LS0 1;  5KEE A;  1TQO A;  4K5X A;  3GTL B;  2GA4 B;  4O42 A;  3K59 A;  4K8J A;  1SDF A;  1KDA A;  1HTL D;  4A93 B;  3BS1 A;  1B9M A;  1ILQ A;  1STY A;  2EYO A;  3QG1 A;  4WRD A;  5K5P A;  1EY0 A;  1U9R A;  2BDO A;  2H1E A;  4QF4 A;  2A69 C;  3H09 A;  3H0G B;  5C44 B;  4IFD J;  4QUF A;  5IGD A;  4PMW A;  4I65 A;  3NSW A;  1OXU A;  4ZYS A;  5IGC A;  4U67 3;  5IT9 L;  2PW7 A;  3URY A;  3TP5 A;  3H94 A;  3FEW X;  5I9O A;  4F8M A;  4XYQ A;  1JOR A;  3VR5 A;  5CV5 A;  5TSS A;  2EXZ A;  5EPJ A;  1JOQ A;  1SYD A;  4ILW A;  3NBH A;  5FK9 C;  4F87 A;  2F0L A;  1JE4 A;  2XIW A;  1Z7T A;  1BCP F;  2EYM A;  1BOS A;  4IN3 A;  5FO9 B;  1UUP A;  2QEJ C;  3V05 A;  5FO8 B;  1TWH B;  3GQB A;  3ERO A;  3I72 A;  3OHX C;  3WOF A;  3VA5 A;  4IUN A;  3OW7 A;  4IUQ A;  2B39 A;  1YNJ D;  1YNJ C;  1ICW A;  3GTK B;  2B8G A;  3HOX B;  2A74 C;  1I6V C;  1KDC A;  2KOL A;  1EY7 A;  2RSN A;  1IL8 A;  5ELE A;  4GZY C;  1ZXT A;  3NTH A;  5IOD A;  2PQE A;  3KLR A;  3HG9 A;  1ESR A;  4L6T B;  4BS9 A;  4RKL A;  4FXD A;  4DAV A;  3QIA A;  4RCN A;  5M5X B;  1BDO A;  2RQX A;  3NK9 A;  4IAL A;  4FP5 D;  5FKA C;  1STE A;  1XWE A;  2MP1 A;  4KKS A;  1PZK D;  1G2T A;  1EEI D;  2K32 A;  4R8I A;  2M9V A;  3VR4 A;  5JEA H;  3QJY A;  2F0G A;  3NWS A;  4RH6 A;  5CV4 A;  5CV9 A;  3KBX A;  1EU4 A;  5T1I A;  4FF3 A;  4HSV A;  4LMQ D;  1W6K A;  4KY7 A;  1GHJ A;  1WTX A;  3TME A;  4HAE A;  1BF4 A;  1SYG A;  2NUC A;  2AUJ D;  4A3I B;  3S2D B;  4MN3 A;  3MAQ A;  3L7Z C;  2E2I B;  5C0X H;  3A55 A;  1GOZ A;  1GUS A;  1H9M A;  3NTK A;  4FVM A;  3OWE B;  1K83 B;  5IGB A;  2IX1 A;  3BG3 A;  3Q0A A;  1JOK A;  3HOU B;  5NUC A;  1PYW D;  4Y7N B;  2AWN A;  2XN9 C;  4DF7 A;  1QWY A;  1B1Z A;  3I8Z A;  1KAB A;  2N55 A;  3QWN A;  5FOB B;  4TKO B;  4OO1 I;  3FRP B;  3E0J A;  1LT3 D;  1SE3 A;  2HDM A;  1KNA A;  1HQR D;  3C3L A;  5IGF A;  1EY8 A;  3F2U A;  2E75 C;  1Y8N B;  1BCP B;  1FNU A;  1SFO B;  1QB5 D;  2F0Q A;  4KKU A;  1ENC A;  2HCC A;  3P20 A;  1ESF A;  5G3L D;  1SNO A;  4IUR A;  1G2S A;  1K8M A;  1SNQ A;  3KLS X;  3J7A V;  2D5D A;  4BWG B;  1EU3 A;  3DEP A;  4RFB A;  4CKC A;  1CT1 D;  3HRZ C;  4EQO A;  4WFN 3;  2IWH A;  5COR A;  1WD1 A;  5CV6 A;  3EVQ A;  2F0F A;  3UI2 A;  4QUC A;  2AQ2 B;  4PNY A;  1WCM B;  4KHV A;  2Z4I A;  1CM9 A;  3BYT B;  4A3M B;  2WAQ B;  3H91 A;  1NR2 A;  3SK8 A;  1H9S A;  5AFW A;  5CBA E;  3HZX A;  1YNN D;  2A6E D;  1YNN C;  4BA1 I;  1IHZ A;  4C3J G;  1ROD A;  1EWH A;  3D4D A;  1OXT A;  2BOS A;  3K57 A;  1CZW A;  3I4L A;  1DJR D;  3JAM L;  2O5I C;  4J1M A;  1ML0 D;  3NWT A;  5I6Y A;  3C1E A;  3J80 L;  1I4R A;  2L12 A;  2NYZ D;  3ONA B;  2PW5 A;  3K58 A;  1WTO A;  3M85 A;  3EQL C;  4RCO A;  5E4X A;  5EJW A;  3P1H A;  1MD2 D;  1NAP A;  4CKB A;  3MHB A;  5M3F B;  5C4X B;  3LX0 A;  3PUZ A;  2EPB A;  1O7Y A;  1H9K A;  3CU7 A;  1D6E C;  2EYJ A;  2IL8 A;  3K5N A;  2DY8 A;  1Q3L A;  2IW3 A;  1EYD A;  1I3Q B;  2A6H D;  2A6H C;  1B44 D;  1VF5 C;  3GTG B;  2R7Z B;  4PMC A;  4OL7 A;  1GUN A;  1GXD C;  2B2U A;  3N6R A;  2F0K A;  5FLX L;  2F0S A;  1LTA D;  1V1P A;  3FKI B;  4XTC S;  3BDC A;  3BZD B;  3MFY A;  4I7Z C;  1O80 A;  1QJO A;  5LHY 1;  2TMP A;  4RGM A;  4RGN A;  1EEF D;  5HGT A;  4H7B A;  1JWM D;  1JR0 D;  4ZKC B;  3AU7 A;  1RF2 D;  3HOZ B;  1F77 A;  1F9R A;  4R9W A;  2N88 A;  2DY7 A;  5DNF A;  1TY0 A;  2FHT A;  3GTQ B;  1F2M A;  2EOT A;  1A2U A;  2EY6 A;  3PUX A;  2VB2 X;  3NTI A;  1DOM A;  5KGU A;  3MWY W;  2L0C A;  3S15 B;  5E4W C;  5LL6 S;  2B8F A;  4E6I A;  1JWU D;  3K6O A;  1L0X B;  2WKD A;  3X3M A;  1SSO A;  1O78 A;  4LAA A;  2M2L A;  1QCB D;  2EYH A;  2SEB D;  4OGQ C;  3RMH A;  3KLS A;  1CA5 A;  2RDG A;  3SE0 A;  3TSS A;  5J22 A;  1LTI D;  3DUZ A;  2XSC A;  1TT2 A;  1A3T A;  3FPU B;  3H3V C;  4CHT B;  2F0E A;  3SHL A;  1RTO A;  3A56 A;  2NB0 A;  3OWF A;  3VYT A;  3RLF A;  5C0X I;  1KDB A;  3HEJ A;  3S9W A;  1WTP A;  2E2J B;  1H9S B;  2K04 A;  2HUG A;  5M5Y B;  1A6X A;  4KHZ A;  2F3W A;  4OO1 H;  2F0H A;  2PYK A;  2K7V A;  2AWO A;  4RA8 A;  2RA4 A;  3QOJ A;  3W3A A;  3WOE A;  3E5S A;  1OXV A;  3ND9 A;  4S3S A;  2G9D A;  4G7Z C;  3NQI A;  4LK1 C;  4TQU S;  2MPM A;  3DXJ C;  3DEO A;  1Y69 U;  4DK1 A;  5JVH 3;  4TSS A;  3DMU A;  3S16 B;  3KF8 A;  3A54 A;  4RWS C;  3NP8 A;  4G4K A;  3PMF A;  3FPP A;  4BA2 I;  1D5X C;  1PTO F;  4IUU A;  4Q0F A;  2X6G A;  1KAA A;  1E2V A;  1SND A;  4O1N A;  2KA7 A;  4ODG A;  1LTS D;  2J0T D;  1JC7 A;  1BXT A;  4BBR B;  3TZD A;  4EGV A;  5EKK A;  1FNW A;  1KLG D;  1Z47 A;  4CBV A;  3N52 A;  1TS4 A;  1TWA B;  1V1P B;  1EL0 A;  2BDN A;  4X3U A;  2L11 A;  4B9W A;  4G7H C;  1F9S A;  1MGS A;  2SNS A;  1KLU D;  4K5W A;  3BVG A;  1S5F D;  2A5H A;  4DNR B;  5D65 A;  3R2T A;  3C46 A;  2A69 D;  3KUP A;  3T56 B;  1TWG B;  1SYC A;  1T5X D;  4H13 C;  3JAM E;  2Q8T A;  2SDF A;  1R9T B;  3GD7 A;  3J80 E;  1EIH A;  3NHH A;  5EKI A;  4H0L C;  3K7A B;  1IW7 D;  2L55 A;  1IW7 C;  2RSO A;  2Y0S B;  3OMC A;  3BVZ A;  2JEA I;  1LAC A;  1BCP D;  2ZXO A;  4TRD A;  1BCP C;  4X3K A;  4FO2 A;  2J7Z A;  3SK6 A;  2F0T A;  2KEC A;  1QNK A;  1BNZ A;  3AB9 A;  1D5M C;  1V8Q A;  2FFK B;  4XXE A;  5CV7 A;  5K36 G;  2F4I A;  1F2L A;  5EPL A;  3HOV B;  3VR6 A;  2L5T A;  3A8K E;  2C5C A;  4A3J B;  4K2L A;  2NVX B;  4ZRZ A;  1II3 A;  4RGO S;  1HA5 A;  3MXP A;  4FF4 A;  1GUT A;  3A7A B;  1B9N A;  4ID6 A;  1JIC A;  2FIN B;  3TDQ A;  3VR2 A;  1STG A;  3RZO B;  4DAP A;  3I70 A;  1U4R A;  2RDF A;  1TWC B;  1CTM A;  2Q8I B;  3S1M B;  3NUC A;  2MGS A;  1EIG A;  2VNU D;  5DM6 3;  1MSG A;  2PCF B;  1XX8 A;  2ZXR A;  2HQE A;  1HUM A;  3SEB A;  1DOK A;  3BYY B;  1CQF A;  4K6D A;  2BE5 C;  1F2Z A;  1B53 A;  3L3O C;  5BN5 A;  4HTH A;  4FNF A;  3CKI B;  3V96 A;  5KNC A;  1HUN A;  5F2D A;  1EFI D;  1ZYR D;  1ZYR C;  3KK7 A;  2ENB A;  3OPO A;  3T53 B;  1AP0 A;  2LKV A;  2R3Z A;  1CK1 A;  5BN3 A;  1PTO B;  3K0Y A;  3MVV A;  2CW0 C;  3ND8 A;  1B50 A;  1IYU A;  4KK7 A;  3H6M A;  1CFM A;  4XQJ A;  3HGB A;  5I6W A;  3S1N B;  2V4D A;  5EBC A;  2XWB B;  1G8Z D;  1X3Q A;  1HFN A;  5I2Y A;  1Q1E A;  1O7Z A;  1I4H A;  5C6A A;  2F03 A;  2JYO A;  2FJ2 A;  2KEE A;  1R4Q B;  4KD3 A;  4ZAI A;  2PZW A;  1F2Y A;  1SJH D;  2NN6 I;  3ZYY X;  4ZUJ A;  1CZG A;  2KHS A;  1PDQ A;  5HUR A;  2OEO A;  3A8J E;  1CHP D;  2PMZ B;  2B2V A;  3OIQ A;  3OOC A;  3I4N B;  3RZD B;  1SXT A;  1SMY D;  2R6G A;  1SMY C;  3IL8 A;  1V1O A;  4XT3 B;  1PFB A;  2K01 A;  1IYV A;  5EQ0 A;  1PZI D;  3MA2 B;  2QKI C;  3D8G A;  4N9P A;  4NDX A;  3SR1 A;  4FXG C;  5IIF A;  4IFD I;  4QIW B;  3J7A F;  3WDN A;  5C4J B;  3T16 A;  2WII B;  4ZK9 B;  1KTK A;  2J4X A;  3MXN A;  1ILP A;  3HS0 C;  2QCP X;  1HHV A;  1WTW A;  3G6J B;  2EY5 A;  2K03 A;  1I4X A;  2DNE A;  1F9Q A;  5I4D A;  1BR9 A;  5JOB A;  2IJ0 A;  4C2M B;  1HCZ A;  5CC4 A;  1I4Q A;  4NP5 A;  4U68 A;  4HCE A;  2FMM A;  1TS5 A;  4ZUI A;  1TII D;  1EY4 A;  2B2T A;  4V0B A;  1C8C A;  3ITP A;  5IGG A;  2OF1 A;  3MTS A;  3QB3 A;  5IT9 E;  2KCC A;  2WB1 B;  1SE4 A;  2B2W C;  3GTP B;  2EDG A;  1K8O A;  1EYC A;  1QE6 A;  3TP8 A;  1X3P A;  4CGY B;  2XRQ D;  1JB3 A;  2B2W A;  3V2T A;  2EYP A;  1VF7 A;  4DXG A;  3U9S A;  4CKE A;  5CV8 A;  5CMD A;  1VMC A;  3SXH A;  1C48 A;  2IPK D;  3GV6 A;  1OXX K;  5COY A;  5JPM C;  4A3K B;  2KQ3 A;  2ICE C;  3RD4 A;  4HED A;  1NR4 A;  4IQZ A;  4A3F B;  4FXK C;  2EY2 A;  1E2W A;  4UDU C;  1S4Z A;  4CJ0 B;  2F1M A;  2F0N A;  3FVQ A;  3DHQ A;  2B2U C;  1SE2 A;  4WOR A;  2EZV A;  1HQM C;  3GTJ B;  3Q6S A;  5IGE A;  3S17 B;  1FNV A;  2VB3 X;  2K1B A;  2F0P A;  3I3C A;  2R61 A;  2BA0 A;  2D2C C;  1E0B A;  2Z1C A;  3TN2 A;  3D6C A;  4J8Q A;  5C4H A;  4KJO A;  5C3E B;  2F0I A;  4C1N I;  2I46 A;  3I4M B;  2JP1 A;  1OO9 B;  3LWU A;  1M4V A;  5C4Z A;  3CQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...