3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
1GHKA 1OXXK 2D2CC 1VF7A 2AUKA 2E75C 3PUXA 1IYUA 5KNBA 3GD7A 3M4YA 4TQUS 3RLFA 2QF7A 1VDZA 3A8IE 1VF5C 1DXMA 3I72A 3GQBA 3I73A 4OGQC 4IQZA 4G7HC 1TU2B 2JE6I 3D31A 3SDZA 4KI0A 2BE5C 2E76C 5JEAG 5A35A 3BG3A 3VA7A 5C0XH 3QJYA 3VR3A 1YNJC 4IFDH 4JBWA 4RCNA 2D5DA 3EQLC 2IT1A 2O5JC 1CTMA 2YYZA 1B9NA 1ONLA 2EJFC 3MXUA 2O5IC 4GZYC 1VCIA 4H0LC 4TKOB 2PPBC 1V8QA 3DXJC 3OOCA 1DCZA 1FR3A 1G291 2CW0C 3H94A 4KHZA 4JK1C 2DN8A 1IW7C 2DNCA 1E2WA 3T56B 4LK1C 3OPOA 4DNTB 1H9KA 3U9SA 5JEAH 4KN7C 3W3AA 1CFMA 2EVBA 2V4DA 2KCCA 4DK1A 4L8JA 4DNRB 3TZUA 1LACA 2KA7A 2D62A 2ZT9C 2DNEA 2A69C 3T51B 4G7ZC 3VR6A 5K36G 4KKTA 1OXUA 2BA1A 1K8OA 2A6EC 1Y8PB 2AWOA 2BDOA 2E74C 3M7NA 3M85A 2R6GA 1GUTA 2A6HC 2PNRC 1H9SB 2F1MA 3KLRA 3IFTA 1HPCA 1ZYRC 3NE5B 2A68C 1K8MA 1H9RA 1HCZA 2B8FA 2BA0A 2K7VA 1SMYC 3MFYA 4HR7B 4LJZC 1GJXA 2BE5D 2L5TA 1YNNC 4KMUC 3L7ZC 1H9MA 2K33A 5K36H 1I6VC 3VR2A 4XTCS 4BA2I 3ND9A 3D4RA 3FMCA 1OXVA 3SE0A 5BN4A 3LWUA 4KKUA 5KNDA 3A8KE 3OW7A 5BN3A 3WDNA 2AUJD 1Y8OB 1EWHA 4H13C 1PMRA 1DD2A 3PUYA 1O78A 1CI3M 2K32A 1TKWB 3A7AB 1H9SA 1IW7D 4I7ZC 3HGBA 2EJGC 1ZKOA 3CRKC 3FPPA 1QJOA 1Q1EA 1E2VA 2JEAI 1Z6HA 3PUWA 3A7LA 4OO1G 4G7OC 3VR5A 1IYVA 1Q12A 3A8JE 2NN6G 4DK0A 3PUZA 3ND8A 2Q8IB 1V43A 3P20A 1HQMC 1BDOA 1H9JA 3IKJA 1OXSC 2A69D 1O7LA 2EJMA 1Y69U 1GUGA 1HTPA 1GUNA 3QG1A 4PV1C 1OXTA 3PV0A 4XIGS 2JXMB 2A6ED 3T53B 1FYCA 1Q90A 5BN5A 2NN6I 4H44C 1LABA 1Z7TA 1GUOA 2A6HD 3AB9A 2EDGA 3QIAA 4KN4C 3CRLC 1GHJA 1E2ZA 3N6RA 2B8GA 4OO1H 2JEBI 4BA1I 2A68D 3BDOA 2LMCB 1Q1BA 2NN6H 5C0XG 1T5EA 3I4LA 5KNCA 1GUSA 4IFDG 3VR4A 1A6XA 3LNNA 1Y8NB 2PCFB 3PUVA 1B9MA 4KKSA
chains in the Genus database with same CATH superfamily
3GTLH 1NBWA 3TRZA 1S5CD 2VQFL 2JA8H 3MAQA 4IALA 1JQYD 4A3KG 3A8IE 4LWCA 1DXMA 3SGIA 3L3OC 3K5NA 3SDZA 4KI0A 1PTOF 2PI2E 1L0WA 2NWGA 4KV6A 4C2MH 1I94Q 1D1IA 3ULLA 1B2TA 4A3DH 1ENCA 2DJFC 3J81i 2D5DA 3HKZB 1YJNA 4A3CH 1JC7A 1JB7A 2K5VA 4E6IA 1C8CA 5CYUA 4DV0Q 1M1KC 1K83B 1NAPA 2C9OA 2PNHA 2ZM6Q 4GOPB 5C4JB 1FVIA 5EKKA 5JEAH 1PH5A 2F0HA 2RSNA 3NWSA 3CD6A 4UDUC 4IPDA 3I2ZA 2EYFA 3CF5A 1IBKQ 4NXNQ 1O7YA 3T51B 4PG3A 1CA6A 4B9XA 5CV7A 2KCNA 5CV4A 3QB3A 3TREA 2GVAA 1O80A 2NVTH 1QWYA 5EBCA 1WTXA 3FHWA 1S40A 2A6HC 2J7ZA 3CPFA 1AN8A 2DJGC 5JPMC 5G3LD 4KK7A 3NHHA 2A5HA 2B8FA 3BVZA 2EXDA 1VQDA 2ID0A 3MFYA 4EQOA 4H7BA 1DZ1A 5HGQA 1UE5A 5FJ8G 4J1MA 3FMCA 4DR5Q 3R8BA 5IP7H 4H13C 2R93H 1QZGA 1A2UA 1IBMQ 1EIHA 3GTGH 3CRKC 3I3CA 4RHSA 3MEFA 4FDBA 1LV9A 2MNAA 1QNKA 1QUQB 4GNXC 4AQYL 2K05A 1H9JA 1G2SA 2KCMA 1UEAB 4B9WA 4A3IG 3CC2A 4QJFA 1E24A 5FLMH 2PQAB 1V1PA 1VQEA 1LABA 1E2ZA 1HNXQ 3P75A 4IJHA 1Q1BA 1HZAA 4PQXA 4CHTB 3I90A 1GD7A 1RTOA 3SR1A 2JA6H 3RZOH 2VZAA 4RAUC 5IIFA 1JWUD 4BY1H 1IYJB 1B50A 1K3BC 4CKBA 2OF1A 4RKBA 1NE3A 1LTRD 1TU2B 2VXWA 5FO8B 1HTLD 5A35A 5C0XH 4A93B 4DAMA 1SAPA 3Q23A 1BCPB 2XRSD 4LMQD 1K9MC 4A3EB 1X3FA 5COYA 1ONLA 1VQ4A 3HOXB 3PO2G 2PPBC 3AQQA 4C3JB 1G291 2R61A 3JAME 1Y1WH 1QZHA 2MO1A 1PYBA 2RBMA 1B53A 1CSPA 1NY4A 4BBSG 2V1CC 2IJ0A 3AFPA 4PMBA 2IW3A 1TIID 1QCBD 1OXUA 1VQHA 2BDOA 4BBRH 4DK3C 5KGUA 4JI6L 4DR3L 4CJ2C 2VQEQ 3I8ZA 3IFTA 4OWTB 3H3VH 4HN7A 4KTAA 3KJOA 2OTJA 3QOLA 4KJOA 3CMAA 4PZ7A 3KBXA 2KECA 4DU9A 4UY8C 4LNQA 3J7AV 3H6MA 1EYCA 1R9TH 2M00A 3K81C 3E0JA 3HOZH 5BN4A 4HMJA 3L9AX 1Q3LA 5M3MB 2VL6A 1XX8A 1X9NA 1EQVA 1MGSA 1YI2A 4WRDA 3CCLA 1FD7D 2XGTA 1XMQQ 1XNRL 3NUCA 5T1GA 4DAPA 4JI2L 1SE4A 5LMNL 1IYVA 4LFAL 5I9PA 3GTQH 5M5YH 3E9HA 3T4AC 1BDOA 2EY5A 3CCVA 1JJGA 2B2YA 4JI5L 4P2CB 3T1HL 3WWVA 4B3TL 2FINB 4B3SL 4OIJA 3K58A 4JI7L 2NYZD 3ER0A 1N36Q 1XWEA 2B8GA 1RL2A 3CQZB 2EZVA 1LT3D 1TS2A 3HKSA 5CV6A 2EPBA 3MZ5A 1K8AC 4O1NA 1KRSA 2FMCA 4X62L 5AJ3Q 5ELCA 5JJLA 2K14A 4N8X1 4K8IA 2R7ZB 3KUPA 1V1QA 1EZ8A 2A1AA 4QIWE 1SEBD 3Q0AA 3EFXD 1KIXA 2RDHA 1QVGA 5C5MA 1SE8A 1SYGA 4X66L 4PNYA 1LT5D 3BYYB 5HY6A 4DV1L 2O5JC 3S1MB 2K5QA 4H02A 1V8QA 4A3GH 4PMCA 1WTVA 1C0AA 2X69A 3RLOA 1H9KA 3HOWH 4GKJQ 1CFMA 3PO3B 3HS0C 3S2HH 1GXDC 5IODA 3TS2A 2UXBL 1UNSA 2IHEA 4C3HB 1EIYB 4IUUA 3H3VC 3M7NA 3MA2B 4YY3Q 4F7XA 3CCSA 1Y1VG 5IYBH 4CDFC 3JAML 5DM73 3MVVA 2WKDA 4V0BA 1YIJA 3L7ZC 4CKEA 4CJ0B 5M5WH 3NP8A 2H5XA 4ZRZA 3S9WA 1UUPA 2F4IA 1OO9B 3K7UC 3STBC 2Q8TA 2ASBA 1HZCA 2MHVA 2IWHA 2OQ0A 1SFOB 1ESFA 2K5WA 5IYDH 1G2TA 4GOPC 1RF2D 1Q1EA 3IFDA 4YCVA 1L0YB 1Z6HA 4IPGA 3J80E 4TRDA 1Q12A 2F0IA 3HKZG 4NMZA 1L1OA 3BZDB 4IOCA 1PRTB 2WKCA 3I4MB 1TWAB 5IGBA 3S1NB 1D5MC 2KEEA 2R3ZA 1CQVA 2JXMB 4QB4A 2R92B 2JA7H 1QVCA 1TS4A 4LF5Q 2K5NA 3CP0A 5FO7B 4UHVA 1PXUA 4ID6A 4DV0L 4OO1H 2Q2TA 2MFIA 3BDOA 4NP5A 2ZM6L 1BBUA 4DUZQ 1HXYD 4BS9A 3TP7A 4A3BB 5HGTA 1GHKA 1XPUA 3DEPA 1LTAD 4NXNL 2YU9H 4UPAA 1VF5C 4QMGA 3K8AA 2SNSA 1UE1A 4IUNA 4RHRA 1HR0Q 2EYLA 2ZXOA 2BH2A 3FPUB 4DNIA 2IX1A 1YEZA 2JQOA 2NZHA 4NB3A 1AE2A 1CSQA 2IT1A 4QGUA 5ISRA 1Q81C 3GTKB 1YHQA 3UDGA 5LMUL 1TWGH 4ABNA 2B2YC 3G7LA 4XQNA 1JB3A 1IHZA 2V4DA 3OW2A 4JBJA 2L11A 5IGFA 3TZUA 1LTGD 4GN3B 1IBML 5EJWA 2AMCB 4QIWB 5DAUA 2A69C 1K3RA 1CKOA 4K2KA 3GTMB 5IOCA 4L63B 1HHVA 4Y7NB 4FF4A 4DR7Q 1ILPA 2K5HA 3K80C 1SE2A 2XN9C 3DWPA 4R9WA 4BWGB 1K8MA 1PH1A 1S5FD 1OTCA 5M9OA 3SVMA 2BE5D 3CKIB 1M8AA 4P75A 4YCWA 1K0SA 1EFID 3ND9A 3J7A5 3LWUA 5IYCG 1VQ8A 3KF8B 5JVH3 5JJKA 3DEOA 1PMRA 4DR1L 3PUYA 1RDPD 2IHFA 1PTOD 4KD4A 2CVRA 4JI0Q 1AZQA 4J6HA 3A7AB 2L15A 2CH4W 1ZKOA 2PO4A 4A93G 4UP7A 3W1GA 1I6HB 3A7LA 3VR5A 5EAYA 1D8LA 4CGYB 1HUNA 3OSOA 4NW2A 2NVYB 4K6LA 1KHIA 1FGBD 5M3FH 3H0GG 3PIOA 3KJPA 1WTOA 4RFBA 2JA5B 2VB2X 1FYCA 3CCUA 2AHOB 4P71A 4IPHA 1GHJA 1G8ZD 1ESRA 5JPNC 3RD4A 4K8JA 1KDBA 2NN6H 4LF7Q 1BBXC 2QDBA 3J80L 3GTLB 3HOVB 4DR2L 1PHJA 4WORA 3S14H 3PCOB 3GTOH 2HD3A 3CCMA 5F2DA 1F9PA 2QF7A 4S3SA 4C1NI 2I5MX 2ZJPA 3S2DB 2TMPA 1ET6A 2WINB 4DN4M 2E76C 3CPWA 3F2BA 1HFNA 4R4OA 2A8VA 2MQHA 2FJ2A 4IFDJ 5M3MG 3E0EA 1A3TA 4P74A 2O5IC 1S5BD 1PA6A 4R4CA 5J3BA 4TKOB 4KY6A 1Q8KA 1B4OA 4DNTB 4LK1C 3OTOQ 1JWMD 2FMMA 3U9SA 5K5PA 2NUCA 2UUCQ 1PV4A 2KCCA 4RH6A 1LACA 1LTBD 3VDYA 1YBYA 4JBKA 5IGDA 3GP7A 5IE8A 1KC8C 4FF1A 1TWFH 5LL6X 3TS0A 1K8OA 4OONA 2AWOA 4DAVA 3C1EA 4LUZA 4A3JB 1E3PA 2F1MA 1QVFA 4DAYB 4LF9Q 3UDFA 3JC66 2ZJQA 1I50H 1SMYC 1NMGA 1W2BA 3D6CA 1H9MA 2LXKA 2NZ1D 3QOJA 1N36L 1VQIA 1JJ2A 3S16H 2R93B 4BY7B 3D8GA 1CKNB 3GTGB 3C1FA 3Q24A 2OT2A 1E1OA 4GKKQ 1X54A 3MFGA 4I7ZC 5AJ3L 1EOTA 2UUBL 2CQAA 4JI4L 2E2JB 3J7YW 1RJTA 1E2VA 3MWYW 1WYDA 5FJ8H 3MEHA 4O42A 3ND8A 3I91A 3DMUA 3NQTA 2CWPA 3I4OA 3PSIA 1EEFD 1KDAA 2KJXA 1Y69U 3QG1A 5CC4A 5C3WA 4H44C 3NQIA 3OMGA 2A6HD 5ELFA 4X3SA 1XPOA 3PO3G 4QQBX 1KQSA 1S5ED 4DV3L 2K1BA 4GKJL 4IFDG 2K6AA 1FGUA 5E4WC 1KXLA 4CJ1B 4A3IH 1VF7A 3SEBA 2K28A 1PH2A 1IXRA 5NUCA 2RDFA 1Z9FA 2EY2A 2ZTEA 1STHA 4YY3L 4DV6L 1ASZA 4K0KL 4DKAC 1V1OA 2VS1A 1LO5D 3KLWA 3S17B 1RD9D 3DHQA 3DWQA 5CGKA 1Y1WB 1D6EC 3M9BA 4DUYL 4L5RC 4DR6Q 3DXJC 3OOCA 1DCZA 5LL6S 1GKHA 5IWAQ 3DUZA 2HIVA 1TWHH 4U68A 1MIUA 4DNRB 3CU7A 3EVQA 5CV9A 1XYIA 2UUAQ 3V96A 1HA5A 3GTJH 4LF4Q 1D1KA 5GADC 4BBRB 1NSNS 1RCVD 3K7AH 1ICFB 3I4MG 3MXPA 3PO2H 3WOFA 4UP8A 4N9TA 2R92G 4PZ8A 1H9SB 1KAWA 3BS1A 3MXNA 3NBHA 3SHLA 1Y14B 2HQEA 2LFNA 3G48A 4XT1B 4F87A 2MGSA 4BBSH 3HOZB 1LM0A 2AQ2B 5AFWA 2WB1E 1G6ZA 3GV3A 4HEDA 4Z9CB 2ENBA 5IP9G 4A3BG 2QILA 1SDFA 4QY7A 4WJWA 2I5LX 2B63G 2N3SA 1EYAA 1WTWA 1Z47A 1IBLQ 1B7YB 3LWEA 1EY5A 3OYYA 1FJGQ 1I4RA 2K50A 4DV7L 3E9IA 2OXPA 4XYOA 4HIKA 2KHSA 4O2DA 1Q86C 4P72A 1EY8A 1HR0L 3RN5A 3GTPH 3JAMi 1WI5A 3P1HA 2IL8A 1X3PA 1HRJA 4XQQA 3OIPA 2N88A 2E2IH 3KOJA 1Q82C 2HCCA 3CRLC 1B1ZA 1BQQT 3FRPB 2HUGA 3ICEA 2CFMA 3G6JB 4RA8A 2QA4A 2B3GA 1MSGA 3ULJA 5BR8Q 1STEA 4YHHQ 2F0FA 1BKBA 5KIXA 1XTCD 2CQOA 3AU7A 4RGNA 1E1TA 1MKHA 1IYUA 4GN5A 4ME3A 1VDZA 3M3YH 1STBA 4C3IB 1EQQA 1I3QB 4G7HC 4EGVA 3J81c 3NPPA 5HURA 1Q46A 1TWCH 1JOOA 4X65L 5M5XH 1PZKD 5CR3A 1BVSA 2F0NA 4ZUJA 3NXWA 1N32Q 4OL7A 4DXFA 3RR5A 4A3GB 2F0MA 2F0VA 3S1RH 2CW0C 3MXGA 3K5MA 1XJVA 2RCNA 2ZXPA 1F2YA 1KLGD 4KN7C 1KNAA 5IY0A 3W5OA 3NSWA 2PZWA 1EY4A 4L8JA 4P73A 5CBAE 2PMZE 5FO9B 5I6YA 2EYPA 2SNMA 5FLXL 3VR6A 1FNUA 1VQNA 3AEVA 3NENA 3M4PA 3T16A 1MBYA 4IZ8A 1NMFA 2HDMA 5L37A 1GUTA 1QILA 4HSVA 1X3GA 1PFMA 3P7JA 3HP3A 4GOPA 4A3FB 1HCZA 1N9WA 4NXML 1X32A 3I70A 1YNNC 4MHEA 3HOVG 3VR2A 3ITPA 3R93A 4HJ5A 4ZLTF 1DOMA 1VMPA 3T1YQ 2DUDA 1B3AA 4WJ3M 1SYCA 3PGZA 2OCEA 1LLRD 1Y1VH 2ZXRA 1F2MA 3BZKA 2L1BA 2EY6A 5IT9c 3GO5A 1I5FA 3BZCA 3VYUA 5D14A 3AYHB 4APVA 1GUWA 2GA4B 4V190 4DV4L 2E2HB 2B2VA 4JCVE 2JA7B 2EE1A 1U9RA 1J9OA 3BDLA 2WB1B 4OWXB 2GN5A 3EBEA 4OO1I 2H1EA 1SNPA 2YTYA 1TS5A 4XXEA 1EIGA 3S15B 3N6RA 2JEBI 1T5EA 3OTOL 4A3LG 1RTNA 3TBIB 1KL9A 2Z4HA 2Z1CA 5ELBA 4QCLA 1QUQA 4DK6C 4KKSA 3STBD 1K83H 3K5OA 4A4IA 1PH8A 2D2CC 4A3JG 5C4JH 1PFSA 3M4YA 3HRZC 5C3EB 2LXJA 1SNCA 3I72A 2PQAA 1VQ7A 2RSOA 1HUMA 3VR3A 3FKIB 3FP9A 3TQYA 5FOBB 3TN2A 4BXXG 1CK1A 5C44B 4BY7G 4JV5Q 4C56C 1FR3A 1EYGA 2F0PA 4ZKCB 1HNZL 3R2IA 2NTTA 2UU9L 1JWSD 3J80i 4ZK9B 1X56A 3HOYB 1XTDA 3SK5A 4DF7A 4HMIA 4DK1A 1E7ZA 3KFUA 2DNEA 4DV2Q 3HOUG 2UXCQ 5K36G 1IZ6A 4KKTA 5D65A 4ZCKA 1JJCB 1W3SA 3RLNA 1VQJA 3GDEA 2QCPX 1GVPA 3BJUA 2K75A 4GN4B 2BA0A 3VA5A 1PTOB 4AIMA 4N8FA 2I0QA 4XTCS 2MP1A 1A63A 3PMFA 1N8RC 4KKUA 3A0JA 4OX9L 1U4PA 1EZ6A 3K0XA 2PI2A 2PMZB 3IRBA 1N33Q 1Y8OB 1FL0A 1WTHA 4K6DA 3QR8A 5I9OA 3NEMA 1EQRA 4LF8Q 5CORA 1SNMA 2DGYA 5M3FB 3EJIA 2RHQB 1AP0A 5IYCH 2A69D 1QNUA 1I4HA 1WD0A 3PV0A 4DXGA 3TZDA 2NN6I 3V2TA 4B3ML 3AB9A 1S72A 4A3MB 4A93H 4DR6L 1XMOL 1JORA 2LMCB 5EGTA 1VQOA 1WCMB 1JR0D 3FDTA 1A6XA 3H0GH 3U58A 5EPKA 3TP6A 1B9MA 3TP5A 1WTRA 2AKWB 1OXXK 2G9DA 2IY5B 2JP1A 2SEBD 4LF4L 1I94L 1IKMA 3KF6B 3RMHA 1JE4A 1WD1A 3F2DA 1C4QA 1A62A 2VUMB 2JYOA 1BO0A 2XWBB 3I4NB 4X6AH 4XYQA 2RA4A 3ONAB 4ZUIA 1KDCA 5CV5A 5KYIA 4A3KB 3MXUA 3J81j 4LFCQ 5EPLA 1VQ5A 2UXDQ 2DNCA 4Q5VA 2F0WA 4MNOA 3T56B 2B2VC 2RF4A 1IBKL 2KHJA 5I6WA 3RZDB 2AQ1B 1IBLL 2B2UA 2XVSA 5M3MH 1FJGL 3KBGA 3RNUA 1WTPA 1EL0A 4AYBE 2RVLA 1PYSB 4JYAQ 1DM0B 1SRUA 2RQXA 2ZTCA 4FF2A 1D7QA 1VQ9A 1MHWC 3D4WA 2QDLA 1H9RA 3NK9A 3H15A 2XTIA 2HDLA 4DR5L 1STGA 1TQOA 3NWTA 5T1IA 2Z8LA 1PZJD 1C48A 2KOLA 2MJ8A 2MO0A 4LW1A 5C4XB 2E5LQ 4IO9A 1DD2A 1TR5A 4C3IG 4YHHL 5LMNW 1TKWB 1PH7A 2CWAA 2QEJC 1J8IA 2EJGC 3CQZH 1F77A 1II3A 3D6WA 3PUWA 4J15A 3FEWX 2F3VA 4DK0A 4FP5D 5ELEA 2IX3A 1G51A 1NCVA 1OXSC 4KJNA 3A55A 3CCJA 1XXGA 3S1QH 4PV1C 2WP8J 3KDFB 4AQYQ 4ALPA 2BCOA 4TVAB 2YV5A 3RUZA 1HNXL 5I2XA 2HHHQ 2N49A 1F2LA 1BCPC 4PMWA 1XNQQ 1SLJA 4EQ5A 1Q8IA 1QOHA 1SMYD 1UE6A 1Y8NB 1W6KA 3S1MH 2JA9A 3LGJA 5KNBA 4A3EG 1ENAA 1T5XD 3TMEA 4GNXB 4A3FG 3HOXG 2EIFA 4C3JG 3A54A 5IGGA 1LTID 3PO3H 4B3RQ 4RGTA 1L2FA 2A19A 1BBWA 4IFDH 4RCNA 1CM9A 4OWWB 1E22A 2K4KA 5JJIA 1CA5A 4LAAA 1D2BA 1EOVA 1EWCA 5DNFA 4LF6Q 1YHBA 2M2LA 1EU3A 4IOAA 2SDFA 2DY7A 4JC0A 1QB5D 3C46A 3F2UA 2NVQH 1BF4A 2JA8B 3C2PA 5EPJA 4HCEA 1EU4A 4C2MB 4FNFA 3TSSA 5C4HA 3C3LA 4AH6A 2D0OA 4A3DB 1EEID 3URYA 3IAYA 2VQEL 4CDEC 2F0UA 2WB1G 2YTXA 2A6EC 4FXKC 2KEDA 1SFOH 2P5ZX 2PNRC 1ZYRC 4DR3Q 2A68C 2D9UA 2K7VA 3RN2A 1SJHD 1VMCA 2L4NA 2K03A 2K33A 1U4MA 1GOZA 2FXQA 3I4MH 1TWAH 2Z0SA 3S1NH 3HEJA 3A8KE 1SYFA 2R92H 1XMQL 2NVTB 3KLSA 4HSPA 2K04A 1CI3M 5C3EG 3X3MA 1EYDA 2I46A 2A74C 1MD2D 4AYBB 3UE0A 1N34Q 1X3QA 3FKIG 1BCPF 2PZTA 3UE1A 1XNRQ 5I4DA 4POGA 5IP9H 4A3BH 3M4QA 5LMNQ 3HG9A 4LFAQ 2E2IB 2OTLA 1VS0A 5C44G 2B63H 2B2UC 1MI2A 4FXDA 3KF8A 1UEBA 2QW7A 2NVXH 2ATWA 1GUOA 4R4QA 3HOYG 4B3SQ 2R7ZG 4ZYSA 2CKZB 1VQAA 1PDQA 3WOEA 2F0KA 1X6OA 1SYBA 1M4VA 1EY0A 2B2TA 5E1FA 5I2YA 3GTKH 1I4PA 1ET9A 1YHAA 3M3YB 2E75C 1ZXTA 1QE6A 4DV2L 2UXCL 4HAEA 3TP8A 1IKLA 1TWCB 4X62Q 3NELA 4OGQC 3PF5A 1FNWA 4B08A 3VA7A 3QJYA 1HFGA 4HJ7A 4JBWA 3GTMH 4UP9A 4JG2A 2EY1A 4Y7NH 1CTMA 2HT1A 3UDIA 4X66Q 3EROA 2JA6B 3RZOB 1VCIA 1U5KA 3H09A 4DV1Q 4C3HG 4BY1B 4NKLA 1AE3A 1K73C 1F9RA 1WFQA 4EX5A 3CC4A 1N33L 1HH2P 1KTKA 5C0XI 5H1SE 1CQFA 3NTIA 3J7AF 2D62A 4MTNA 5FLXc 4DFAA 4ZAIA 1JE5A 1ZEQX 1ENFA 1X3EA 1JOKA 5ELNA 1EY6A 5C5LA 1Y8PB 4QUFA 2WV6D 5CBEE 2EYOA 1PYWD 4OELB 4A3MG 1VQMA 4K2LA 3X3NA 1PRTC 1WTQA 2BDNA 3UI2A 4KHPQ 1WCMG 2Q2IA 4KMUC 2O2LD 2NVYH 3Q22A 2E8GA 1JOQA 3ULPA 3S24A 1NJIC 3OW7A 3KYHC 1V1PB 1CHQD 4L5SA 2Y0SE 2B2WA 3H3VI 2CW0D 2Z6KA 1TXYA 3R2TA 4KY5A 1BOSA 2BH8A 1QJOA 4DAYA 2PW5A 2VUMG 3BYTB 1FNVA 4G7OC 3HOVH 3I4NG 2XSCA 2LY7A 1R9TB 1BUVT 3IKJA 4LF5L 2L12A 2EJMA 1GUGA 1LT4D 2GVBA 4QL5A 1LYLA 5J1ZA 4JI8Q 3S2DH 2EDGA 1CKNA 2WAQE 3DM1A 2N8NA 3SK4A 2PW7A 4LFCL 4DUZL 3SK8A 4BA1I 5ELDA 1UAPA 4GS3A 3TEHB 2UXDL 1J5EQ 1A8VA 1YNND 2JK8A 1SN8A 3GTQB 5M5YB 2B29A 2QGQA 1MJEA 3F8TA 4R4TA 2PQEA 1TY2A 1HA6A 5CV8A 3I73A 4ILWA 4IQZA 1VQBA 4JW0A 4X3UA 3E3XA 4JYAL 2F3WA 4PZ6A 1YNJC 4A3LH 4XT3B 2NBFA 1NR4A 3EQLC 5JVG3 1ML0D 1E0BA 1KNEA 5C4XG 2EJFC 2WIIB 4A3JH 3H94A 4KHZA 4OEMB 1IW7C 4DGZA 5J22A 5GAHC 1HNWQ 3CMEA 1EFWA 4G57A 3OIQA 2VY3A 2F0GA 5JEAJ 1VQGA 5LMUQ 2E5LL 1JCKB 2G5DA 4K5WA 5EQ0A 4Y52H 4DR7L 4G7ZC 1PRTF 3EA6A 1Q7YC 3ZYYX 4BXXH 4TSSA 3CC7A 4BY7H 3A74A 3M85A 2R6GA 4ZQ3A 3F1ZA 3G4SA 1HQRD 2B2TC 1BR9A 3V05A 5A2QE 2Q2UA 4CBVA 4I7AA 1C7YA 2E2JH 4DR4Q 3OWFA 1I4GA 4LJZC 3HOWB 1YJ9A 2QKIC 1STAA 2HHHL 2XNAC 3A56A 3VYTA 3HOUH 5K36H 3S2HB 1I6VC 2VB3X 1PH4A 1XNQL 2JSOA 3J81E 1M90C 1CKMA 4JI0L 1IL2A 1EWHA 2VNUD 2F0LA 1RHPA 1S4ZA 3LX0A 4MZ9A 1H9SA 2MUYA 4CKCA 2JA5G 3CCEA 4K14A 4MTKA 4DR1Q 2J4XA 1KLUD 4IN3A 1F2ZA 1MJCA 3A8JE 3JAMc 1CUKA 2Q8IB 2KBNA 2IPKD 1PZID 5M5WB 3K59A 4B3RL 2LS01 1WVLA 2R7FA 1VQLA 4LFBQ 5LHY1 4N9PA 2L55A 4LF6L 2JA8G 1G6PA 4LF7L 2O4XA 1U4RA 4FF3A 1AH9A 1YJWA 2Y0SB 4MIUA 3I4LA 3T13A 5KNCA 3H0GB 4A3DG 3S17H 4R4IA 2F4VQ 1I4QA 1S3OA 3D0FA 3PUVA 4A3CG 1K28A 2QEXA 4C1NK 3M4OH 2AUKA 1WJJA 3A5UA 4OIKA 4DR2Q 2WACA 4DPGA 3RLFA 4Q0FA 4U673 1YZ6A 3N52A 3GQBA 1SJED 4L5QA 5JOBA 5JEAG 4QUCA 3I55A 2RDGA 2B2WC 1A3UA 5C0XJ 4FO2A 2Z6KC 1SE3A 3DM3A 3GV6A 2WAQB 2CHBD 3M7GA 1DOKA 5EKLA 5IT9E 1DJRD 2EYMA 2NB0A 2YYZA 3VYRA 3DLLA 2ZJRA 2KQ3A 2UUCL 2HCIA 5GAGC 2PYKA 4RMFA 2D0PA 1KABA 2CCZA 4JI3Q 2YU9B 1X55A 4AYBG 3W3AA 1MSHA 3CHBD 1J6QA 2KA7A 1QG7A 1EIFA 2F0JA 2Z6BA 1U0LA 2XIWA 2N78A 3ZJYC 2F03A 1LTSD 2G9HD 1N34L 1P8LA 5JAVA 1JICA 4LF9L 2XRQD 5IP7G 4J8QA 2R93G 2F0DA 4X64Q 1TWGB 5GQOA 4YCUA 3HZXA 4HR7B 1PH3A 1L1OB 1TT2A 1TS3A 2TSSA 2ICEC 3OWEB 2L9HA 4EQPA 3D4RA 5KNDA 1VQFA 4GKKL 3CAMA 2AUJD 2AQ3B 1VQ6A 1EY7A 5FLMG 5DM63 4NPSA 2LSSA 1T9HA 2Z4IA 1ICWA 3FPPA 5A2QL 1AW7A 3MC0B 2JEAI 2F0QA 1HR0W 4DV5Q 2UUBQ 2K5DA 4EVOA 3P20A 4JI4Q 1A15A 3S1QB 1HQMC 3B6YA 3I7FA 5ELOA 2KENA 1RIPA 4JI1Q 4JBMA 2JA6G 1SNQA 1PH9A 3IL8A 1CHPD 3J81L 3F2CA 4BY1G 2K01A 4HJAA 4XIGS 4C3IH 1I3QH 2JN4A 1Z7TA 3QIAA 3PIPA 2RCFA 3U9OA 5J39A 5G3LF 4DA2A 3AMUA 2I5HA 5EKIA 2Z9HA 5C0XG 1YITA 4JOIA 3VYSA 1GUSA 4R8IA 1DGSA 3TDQA 4ODGA 1S5DD 3Q8DA 4HIOA 2PCFB 4DV3Q 1G91A 3A5ZB 4HIDA 4HJ9A 1ASYA 1AZPA 1CT1D 4O0AA 5TSSA 1Y1WG 4IFDI 3DWAA 2HIXA 3O13A 3R3OA 4R1JA 5DEHA 1NUCA 2EYJA 5IGCA 1A0IA 3G71A 1P16A 4RCOA 4M8AA 3K0YA 4X3KA 1LTTD 2I07B 4DV6Q 4KHPL 4K0KQ 5IWAL 4XDXA 2NVQB 2RHSB 4BBRG 4A3EH 3S14B 3Q6SA 3J80c 4JK1C 3BDCA 3HOXH 4A3FH 3GTOB 4DUYQ 1WOCA 4C3JH 1UWVA 1SROA 3PIP3 3MTSA 2UUAL 1LT6D 1AFPA 1BCPD 3PQIA 4IUVA 2F0TA 2ZT9C 3BU2A 5E3FA 1JMCA 4X3TA 2PZUA 2VQFQ 3HOZG 1YNXA 2E74C 1PFBA 5CMDA 2WFWA 5IT9L 3KK7A 3L0OA 4JVZA 1U4LA 1HPCA 3W1BA 2VW9A 2LKVA 5FKAC 4A76A 4JI8L 2E2HH 3EN2A 2ES2A 4OHJA 1TWFB 1I4XA 4OXPA 1J5EL 3ERSX 4R8NA 1TY0A 5DLQE 5E7NA 1GO3E 3S15H 4IPCA 5GAEC 4A75A 1PFNA 1PVOA 4RGOS 5KRUA 1I50B 2CH4A 3PUZA 1HZ9A 2H4OA 4MN3A 4DV7Q 3NTKA 2B63B 4L5TA 4RKLA 2FFKB 4CDCC 1KD1C 1O7LA 1UE7A 1IL8A 1SR3A 2F0OA 4KLKA 3S16B 2NVXB 1DOLA 5C3EH 2A6ED 4FVMA 2N55A 1XPRA 1SYDA 4LUOA 5BR8L 4YWKA 1SSOA 2X6GA 1LUZA 1ZYRD 3FKIH 3W2DA 3L2PA 2A68D 4IJLA 2F52A 1HNWL 4HCSA 4RG1A 5FK9C 4JPBW 1JT8A 3LNNA 1B8AA 5C44H 3G6EA 2X6LA 3PUXA 3NTHA 4IURA 4WFN3 3GD7A 1K8GA 4A3GG 3J7ZC 1STYA 4FYDA 3HOYH 3HOWG 4KHVA 2JE6I 3D31A 2R7ZH 1BXTA 3BG3A 3D3RA 1HJPA 1N32L 2E2DC 1L0XB 1F9SA 3U4VA 1F9QA 4X65Q 4DR4L 4F8MA 2NZOA 1EY9A 1V9PA 2F3IA 4K5XA 2F0EA 2EXZA 2AWNA 1HZBA 4A3IB 1KAAA 1NR2A 1SYEA 1E2WA 3OPOA 5IYBG 1A2TA 3KF6A 1CZGA 1PTOH 3EIVA 2EVBA 4XQJA 5KYLA 2EOTA 2KUMA 1O7ZA 1EUJA 1NNXA 2NTSA 1DYQA 1SXTA 2DY8A 4C3HH 4JOIC 4POFA 1AEXA 4RGMA 2Q2HA 3CCRA 2M9VA 1R4PB 3NE5B 4LFBL 2Y0SG 5IYDG 1TWHB 3E5SA 5E4XA 4UAIA 3T1YL 3FVQA 3CXCA 2OEOA 2KHIA 4BA2I 4NXMQ 1OXVA 2IX0A 3GTJB 5D3IB 5BN3A 3K7AB 5IGEA 3WDNA 3PO2B 1EWIA 1O78A 2BOSA 4M1UB 2F4VL 4A3MH 2JA7G 3OMCA 4IUQA 1CZWA 4WJ4A 4HTHA 2F0SA 1WCMH 4OO1G 3BVGA 1ILQA 3HFZB 4JI6Q 2WAQG 4BBSB 4EQNA 2B39A 1H95A 4F88A 1X65A 4YWLA 1GUNA 4KD3A 5D3DA 1OXTA 4DV4Q 3OHXC 3CW2C 1Q90A 3U50C 5KEEA 3E6ZX 4YIJA 4G4KA 3HKZE 4HIMA 2VUMH 1PRTD 1A3VA 3I4NH 3QWNA 3PIO3 1R4QB 4JI3L 2SOBA 3VR4A 4A3KH 1L1OC 4IUPA 1EQTA 1NTGA 3NBIA 4L6TB 3GTPB 4JI2Q 2J0TD 4TQUS 3KDFA 2ZTDA 2OQKA 3RZDH 2FHTA 2BE5C 2Q8RE 2ICIA 1W6JA 4K5VA 4JI5Q 3T1HQ 2L0CA 4X64L 3BVMA 2C5CA 4B3TQ 1VQPA 4JV5L 4JI7Q 1K0RA 3K57A 1SMXA 1B9NA 1SBBB 4GZYC 4H0LC 1PTOC 1VQCA 5JJZA 3MXNB 3NBHB 4LUVA 2DN8A 2C35B 4KY7A 2HQLA 4GNXA 3K6OA 4QF4A 2EYHA 3H91A 1HNZQ 3K5LA 4ULLA 3PF4A 1STNA 5C4ZA 3SXHA 5EBDA 3UDXA 2UU9Q 5M5XB 1RODA 2KCTA 4HJ8A 4CDDC 1SNOA 2EQSA 5C4XH 2BA1A 3KLSX 1SNDA 2ALYB 4ME5A 4DV5L 2RKSA 3KLRA 1YVCA 3S1RB 2XWJB 4JI1L 5GROA 1B70B 4FXGC 3HOUB 2YTVA 1GJXA 1VQKA 2L5TA 1D5ZC 1D5XC 4YWMA 1YNJD 3QO2A 1TVXA 3SE0A 3D4DA 4GLAC 4GLXA 1RKNA 5M3FG 4OX9Q 2K32A 3AFQA 1B3QA 1O7IA 3ERQA 1KRTA 4I65A 4LF8L 1IW7D 3HGBA 3U4ZA 2UXBQ 3SK6A 2OWOA 2A73B 2MPMA 2NN6G 4NDXA 5C3XA 1I6HH 1V43A 1B44D 1LTLA 2R7DA 1HTPA 1C9OA 3I56A 4IUTA 5FLXE 3T53B 4ZKBB 5BN5A 3CCQA 1PLFA 1PH6A 1BNZA 2KVMA 4KN4C 4RWSC 1Y1VB 2JA5H 1GM5A 5C6AA 3MHBA 4B3MQ 2K52A 1DONA 2JJQA 4GLVB 1XMOQ 3M4OB
chains in the Genus database with same CATH topology
1S5CD 3MAQA 4IALA 1JQYD 3A8IE 1DXMA 3L3OC 3K5NA 3SDZA 4KI0A 1PTOF 2NWGA 4KV6A 1D1IA 1B2TA 1ENCA 2D5DA 3HKZB 1JC7A 4E6IA 1C8CA 5CYUA 1K83B 1NAPA 2C9OA 5C4JB 5EKKA 5JEAH 2F0HA 2RSNA 3NWSA 4UDUC 2EYFA 1O7YA 3T51B 1CA6A 4B9XA 5CV7A 2KCNA 5CV4A 3QB3A 1O80A 1QWYA 5EBCA 1WTXA 2A6HC 2J7ZA 1AN8A 5JPMC 5G3LD 4KK7A 3NHHA 2A5HA 2B8FA 3BVZA 4EQOA 2ID0A 3MFYA 4H7BA 1DZ1A 4J1MA 3FMCA 3R8BA 4H13C 1A2UA 1EIHA 3CRKC 3I3CA 4RHSA 1LV9A 1QNKA 2K05A 1H9JA 1G2SA 1UEAB 4B9WA 1V1PA 1LABA 1E2ZA 3P75A 1Q1BA 4PQXA 4CHTB 3I90A 1RTOA 3SR1A 5IIFA 4RAUC 1JWUD 1B50A 4CKBA 2OF1A 4RKBA 1LTRD 1TU2B 2VXWA 5FO8B 1HTLD 5A35A 5C0XH 4A93B 1SAPA 3Q23A 1BCPB 2XRSD 4LMQD 4A3EB 5COYA 1ONLA 3HOXB 2PPBC 4C3JB 3JAME 1G291 2R61A 2RBMA 1B53A 2IJ0A 4PMBA 2IW3A 1TIID 1QCBD 1OXUA 2BDOA 5KGUA 4CJ2C 3I8ZA 3IFTA 4HN7A 4KTAA 3QOLA 4KJOA 3KBXA 2KECA 4DU9A 3J7AV 3H6MA 1EYCA 2M00A 3E0JA 5BN4A 4HMJA 3L9AX 1Q3LA 5M3MB 1XX8A 1EQVA 1MGSA 4WRDA 1FD7D 3NUCA 5T1GA 4DAPA 1SE4A 1IYVA 5I9PA 3T4AC 1BDOA 2EY5A 2B2YA 4P2CB 2FINB 4OIJA 3K58A 2NYZD 1XWEA 2B8GA 3CQZB 2EZVA 1LT3D 1TS2A 5CV6A 2EPBA 3MZ5A 4O1NA 2FMCA 5ELCA 4K8IA 2R7ZB 3KUPA 1EZ8A 1SEBD 3Q0AA 3EFXD 2RDHA 5C5MA 1SYGA 4PNYA 1LT5D 3BYYB 2O5JC 3S1MB 2K5QA 1V8QA 4PMCA 1WTVA 2X69A 1H9KA 1CFMA 3PO3B 3HS0C 1GXDC 5IODA 1UNSA 4C3HB 4IUUA 3H3VC 3M7NA 3MA2B 4F7XA 3JAML 5DM73 3MVVA 2WKDA 4V0BA 3L7ZC 4CKEA 4CJ0B 3NP8A 3S9WA 4ZRZA 1UUPA 2F4IA 1OO9B 2Q8TA 2MHVA 2IWHA 1SFOB 1ESFA 2K5WA 1G2TA 1RF2D 1Q1EA 3IFDA 1L0YB 1Z6HA 3J80E 4TRDA 1Q12A 2F0IA 4NMZA 3BZDB 1PRTB 2WKCA 3I4MB 5IGBA 1TWAB 3S1NB 1D5MC 2KEEA 2R3ZA 1CQVA 2JXMB 4QB4A 2R92B 1TS4A 5FO7B 1PXUA 4ID6A 4OO1H 3BDOA 4NP5A 1HXYD 4BS9A 3TP7A 4A3BB 5HGTA 1GHKA 3DEPA 1LTAD 1VF5C 4QMGA 2SNSA 4IUNA 4RHRA 2EYLA 2ZXOA 3FPUB 2IX1A 2IT1A 5ISRA 3GTKB 4ABNA 2B2YC 3G7LA 4XQNA 1JB3A 1IHZA 2V4DA 2L11A 5IGFA 3TZUA 1LTGD 5EJWA 4QIWB 5DAUA 2A69C 4K2KA 3GTMB 5IOCA 4L63B 1HHVA 4Y7NB 4FF4A 1ILPA 1SE2A 2XN9C 3DWPA 4R9WA 4BWGB 1K8MA 1S5FD 5M9OA 3SVMA 2BE5D 3CKIB 1M8AA 1EFID 3ND9A 3LWUA 5JVH3 3DEOA 1PMRA 3PUYA 1RDPD 1PTOD 4KD4A 2CVRA 1AZQA 4J6HA 3A7AB 1ZKOA 2PO4A 1I6HB 3A7LA 3VR5A 4CGYB 1HUNA 3OSOA 4NW2A 2NVYB 4K6LA 1FGBD 1WTOA 4RFBA 2JA5B 2VB2X 1FYCA 1GHJA 1G8ZD 1ESRA 5JPNC 3RD4A 4K8JA 1KDBA 2NN6H 1BBXC 2QDBA 3J80L 3GTLB 3HOVB 4WORA 5F2DA 1F9PA 2QF7A 4S3SA 4C1NI 3S2DB 2TMPA 1ET6A 2WINB 4DN4M 2E76C 1HFNA 2FJ2A 4IFDJ 1A3TA 2O5IC 1S5BD 4TKOB 4KY6A 1B4OA 4DNTB 4LK1C 1JWMD 2FMMA 3U9SA 5K5PA 2NUCA 2KCCA 4RH6A 1LACA 1LTBD 5IGDA 3GP7A 4FF1A 5LL6X 1K8OA 2AWOA 4DAVA 3C1EA 4A3JB 2F1MA 1SMYC 3D6CA 1H9MA 2NZ1D 3QOJA 2R93B 4BY7B 3D8GA 3GTGB 3C1FA 3Q24A 2OT2A 3MFGA 4I7ZC 1EOTA 2CQAA 2E2JB 3J7YW 1RJTA 1E2VA 3MWYW 3MEHA 4O42A 3ND8A 3I91A 3DMUA 3NQTA 1EEFD 1KDAA 2KJXA 1Y69U 3QG1A 5CC4A 5C3WA 4H44C 3NQIA 3OMGA 2A6HD 5ELFA 4X3SA 1S5ED 2K1BA 4IFDG 2K6AA 5E4WC 4CJ1B 1VF7A 3SEBA 2K28A 5NUCA 2RDFA 2EY2A 1STHA 1V1OA 1LO5D 3S17B 1RD9D 3DHQA 3DWQA 5CGKA 1Y1WB 1D6EC 3DXJC 3OOCA 1DCZA 5LL6S 3DUZA 4U68A 4DNRB 3CU7A 3EVQA 5CV9A 1XYIA 3V96A 1HA5A 1D1KA 4BBRB 1NSNS 1RCVD 3MXPA 3WOFA 4N9TA 1H9SB 3BS1A 3MXNA 3NBHA 3SHLA 2HQEA 2LFNA 4XT1B 4F87A 2MGSA 3HOZB 2AQ2B 5AFWA 1G6ZA 3GV3A 4HEDA 4Z9CB 2ENBA 2QILA 1SDFA 4WJWA 1EYAA 1WTWA 1Z47A 3LWEA 1EY5A 1I4RA 2OXPA 4XYOA 2KHSA 1EY8A 3P1HA 2IL8A 1X3PA 1HRJA 4XQQA 3OIPA 2N88A 2HCCA 3CRLC 1B1ZA 1BQQT 3FRPB 2HUGA 3G6JB 4RA8A 1MSGA 1STEA 2F0FA 5KIXA 1XTCD 4RGNA 3AU7A 1IYUA 1VDZA 1STBA 4C3IB 1I3QB 4G7HC 4EGVA 3NPPA 5HURA 1JOOA 1PZKD 5CR3A 2F0NA 4ZUJA 3NXWA 4OL7A 4DXFA 4A3GB 2F0MA 2F0VA 2CW0C 3MXGA 3K5MA 2ZXPA 1F2YA 1KLGD 4KN7C 1KNAA 3NSWA 2PZWA 1EY4A 4L8JA 5CBAE 5FLXL 5FO9B 5I6YA 2EYPA 2SNMA 3VR6A 1FNUA 3T16A 1MBYA 4IZ8A 2HDMA 1GUTA 1QILA 4HSVA 1PFMA 3P7JA 3HP3A 4A3FB 1HCZA 1X32A 3I70A 1YNNC 4MHEA 3VR2A 3ITPA 3R93A 4ZLTF 1DOMA 1VMPA 1B3AA 1SYCA 1LLRD 2ZXRA 1F2MA 2L1BA 2EY6A 3GO5A 3VYUA 5D14A 1GUWA 2GA4B 4V190 2E2HB 2B2VA 2JA7B 2EE1A 1U9RA 1J9OA 2WB1B 3BDLA 4OO1I 2H1EA 1SNPA 1TS5A 4XXEA 1EIGA 3S15B 3N6RA 2JEBI 1T5EA 1RTNA 3TBIB 2Z4HA 2Z1CA 5ELBA 4QCLA 4KKSA 3K5OA 2D2CC 3M4YA 3HRZC 5C3EB 1SNCA 3I72A 2RSOA 1HUMA 3VR3A 3FKIB 5FOBB 3TN2A 1CK1A 5C44B 4C56C 1FR3A 2F0PA 4ZKCB 3R2IA 2NTTA 1JWSD 4ZK9B 3HOYB 3SK5A 4DK1A 4DF7A 4HMIA 2DNEA 5K36G 4KKTA 5D65A 2QCPX 2BA0A 3VA5A 1PTOB 4XTCS 2MP1A 3PMFA 4KKUA 1U4PA 1EZ6A 2PMZB 1Y8OB 4K6DA 5I9OA 5CORA 1SNMA 5M3FB 3EJIA 1AP0A 2A69D 1QNUA 1I4HA 1WD0A 3PV0A 4DXGA 3TZDA 2NN6I 3V2TA 3AB9A 4A3MB 1JORA 2LMCB 5EGTA 1WCMB 1JR0D 3FDTA 1A6XA 3TP6A 3TP5A 5EPKA 1B9MA 1WTRA 1OXXK 2G9DA 2JP1A 2SEBD 1IKMA 3RMHA 1JE4A 1WD1A 1C4QA 2VUMB 2JYOA 1BO0A 2XWBB 3I4NB 4XYQA 2RA4A 3ONAB 4ZUIA 1KDCA 5CV5A 5KYIA 4A3KB 3MXUA 5EPLA 2DNCA 4Q5VA 2F0WA 3T56B 2B2VC 5I6WA 3RZDB 2AQ1B 2B2UA 2XVSA 3KBGA 1WTPA 1EL0A 2RVLA 1DM0B 2RQXA 4FF2A 3D4WA 1H9RA 3NK9A 2HDLA 1STGA 1TQOA 3NWTA 5T1IA 2Z8LA 1PZJD 1C48A 2KOLA 2MJ8A 5C4XB 1DD2A 1TR5A 4C3IG 1TKWB 2QEJC 1J8IA 2EJGC 1F77A 1II3A 3D6WA 3PUWA 3FEWX 2F3VA 4DK0A 4FP5D 5ELEA 2IX3A 1NCVA 1OXSC 4KJNA 3A55A 1XXGA 4PV1C 2WP8J 2BCOA 3RUZA 5I2XA 1F2LA 1BCPC 4PMWA 1Q8IA 1QOHA 1SMYD 1Y8NB 1W6KA 5KNBA 1ENAA 1T5XD 3TMEA 4C3JG 3A54A 5IGGA 1LTID 4RGTA 4IFDH 4RCNA 1CM9A 1CA5A 4LAAA 1D2BA 1EWCA 5DNFA 2M2LA 1EU3A 2SDFA 2DY7A 1QB5D 3C46A 3F2UA 1BF4A 2JA8B 3C2PA 5EPJA 4HCEA 1EU4A 4C2MB 5C4HA 4FNFA 3TSSA 3C3LA 4A3DB 1EEID 3URYA 3IAYA 2F0UA 2A6EC 4FXKC 2KEDA 2PNRC 1ZYRC 2A68C 2D9UA 2K7VA 1SJHD 1VMCA 2L4NA 2K03A 2K33A 1U4MA 1GOZA 3HEJA 3A8KE 1SYFA 2NVTB 3KLSA 4HSPA 2K04A 1CI3M 3X3MA 1EYDA 2I46A 2A74C 1MD2D 4AYBB 1X3QA 1BCPF 2PZTA 5I4DA 3HG9A 2E2IB 2B2UC 1MI2A 4FXDA 3KF8A 1GUOA 4ZYSA 3WOEA 1PDQA 2F0KA 1SYBA 1M4VA 1EY0A 2B2TA 5E1FA 5I2YA 1I4PA 1ET9A 3M3YB 2E75C 1ZXTA 1QE6A 4HAEA 3TP8A 1IKLA 1TWCB 4OGQC 1FNWA 4B08A 3VA7A 3QJYA 1HFGA 4JBWA 2EY1A 1CTMA 3EROA 2JA6B 3RZOB 1VCIA 3H09A 4C3HG 4BY1B 4NKLA 1F9RA 1KTKA 5C0XI 1CQFA 3NTIA 3J7AF 2D62A 4DFAA 4ZAIA 1ZEQX 1ENFA 1JOKA 5C5LA 1EY6A 1Y8PB 4QUFA 2WV6D 5CBEE 2EYOA 1PYWD 4K2LA 3X3NA 1PRTC 1WTQA 2BDNA 3UI2A 4KMUC 2O2LD 3Q22A 1JOQA 3OW7A 1V1PB 1CHQD 2B2WA 2CW0D 3R2TA 4KY5A 1BOSA 1QJOA 4DAYA 2PW5A 3BYTB 1FNVA 4G7OC 2XSCA 2LY7A 1R9TB 1BUVT 3IKJA 2L12A 2EJMA 1GUGA 1LT4D 5J1ZA 2EDGA 3DM1A 3SK4A 2PW7A 3SK8A 4BA1I 5ELDA 1UAPA 1YNND 3GTQB 5M5YB 2PQEA 1TY2A 1HA6A 5CV8A 3I73A 4ILWA 4IQZA 4X3UA 2F3WA 1YNJC 4XT3B 2NBFA 1NR4A 3EQLC 5JVG3 1ML0D 1E0BA 1KNEA 2EJFC 2WIIB 3H94A 4KHZA 1IW7C 4DGZA 5J22A 4G57A 3OIQA 5JEAJ 2F0GA 1JCKB 4K5WA 5EQ0A 4G7ZC 1PRTF 3EA6A 3ZYYX 4TSSA 3M85A 2R6GA 4ZQ3A 1HQRD 2B2TC 1BR9A 3V05A 5A2QE 4CBVA 3OWFA 1I4GA 4LJZC 3HOWB 2QKIC 1STAA 2XNAC 3A56A 3VYTA 5K36H 3S2HB 1I6VC 2VB3X 2JSOA 3J81E 1EWHA 2VNUD 2F0LA 1RHPA 1S4ZA 3LX0A 1H9SA 2MUYA 4CKCA 4K14A 2J4XA 1KLUD 4IN3A 1F2ZA 3A8JE 2Q8IB 2IPKD 1PZID 5M5WB 3K59A 2LS01 1WVLA 5LHY1 4N9PA 2L55A 2O4XA 1U4RA 4FF3A 2Y0SB 4MIUA 3I4LA 3T13A 5KNCA 3H0GB 1I4QA 3PUVA 4C1NK 2AUKA 4OIKA 2WACA 3RLFA 4Q0FA 4U673 3N52A 3GQBA 1SJED 5JOBA 5JEAG 4QUCA 2RDGA 2B2WC 1A3UA 5C0XJ 4FO2A 1SE3A 3GV6A 2WAQB 2CHBD 3M7GA 1DOKA 5EKLA 5IT9E 1DJRD 2EYMA 2NB0A 2YYZA 3VYRA 2KQ3A 2HCIA 2PYKA 1KABA 2YU9B 3W3AA 1MSHA 3CHBD 2KA7A 1QG7A 2F0JA 2XIWA 2F03A 1LTSD 2G9HD 5JAVA 1JICA 2XRQD 4J8QA 2F0DA 1TWGB 3HZXA 4HR7B 1TT2A 1TS3A 2TSSA 2ICEC 3OWEB 2L9HA 4EQPA 3D4RA 5KNDA 2AUJD 2AQ3B 1EY7A 5DM63 2Z4IA 1ICWA 3FPPA 5A2QL 1AW7A 3MC0B 2JEAI 2F0QA 2K5DA 4EVOA 3P20A 1A15A 3S1QB 1HQMC 1SNQA 3IL8A 1CHPD 3J81L 2K01A 4XIGS 1Z7TA 3QIAA 3U9OA 5J39A 5G3LF 4DA2A 3AMUA 5EKIA 5C0XG 3VYSA 1GUSA 4R8IA 3TDQA 4ODGA 1S5DD 2PCFB 1G91A 1AZPA 1CT1D 5TSSA 4IFDI 3DWAA 3O13A 3R3OA 5DEHA 1NUCA 2EYJA 5IGCA 4RCOA 4M8AA 3K0YA 4X3KA 1LTTD 2I07B 4XDXA 2NVQB 3S14B 3Q6SA 4JK1C 3BDCA 3GTOB 3PIP3 3MTSA 1LT6D 1AFPA 1BCPD 4IUVA 2F0TA 2ZT9C 5E3FA 4X3TA 2PZUA 2E74C 1PFBA 5CMDA 5IT9L 3KK7A 1U4LA 1HPCA 2LKVA 5FKAC 4OHJA 1TWFB 1I4XA 4R8NA 1TY0A 1PFNA 4RGOS 5KRUA 1I50B 3PUZA 2H4OA 4MN3A 3NTKA 2B63B 4RKLA 2FFKB 1O7LA 1IL8A 2F0OA 2NVXB 3S16B 1DOLA 2A6ED 4FVMA 2N55A 1SYDA 1SSOA 2X6GA 3W2DA 1ZYRD 2A68D 4HCSA 5FK9C 3LNNA 2X6LA 3PUXA 3NTHA 4IURA 4WFN3 3GD7A 1STYA 4FYDA 4KHVA 2JE6I 3D31A 1BXTA 3BG3A 3D3RA 2E2DC 1L0XB 1F9SA 1F9QA 4F8MA 1EY9A 4K5XA 2F0EA 2EXZA 2AWNA 4A3IB 1KAAA 1NR2A 1SYEA 1E2WA 3OPOA 1A2TA 1CZGA 1PTOH 2EVBA 4XQJA 5KYLA 2EOTA 2KUMA 1O7ZA 2NTSA 1DYQA 1SXTA 2DY8A 1AEXA 4RGMA 2M9VA 1R4PB 3NE5B 1TWHB 3E5SA 5E4XA 4UAIA 3FVQA 2OEOA 4BA2I 1OXVA 2IX0A 3GTJB 5D3IB 5BN3A 3K7AB 5IGEA 3WDNA 3PO2B 1O78A 2BOSA 4M1UB 3OMCA 4IUQA 1CZWA 4HTHA 2F0SA 4OO1G 3BVGA 1ILQA 4BBSB 4EQNA 2B39A 4F88A 1GUNA 4KD3A 5D3DA 1OXTA 3OHXC 1Q90A 5KEEA 3E6ZX 4YIJA 4G4KA 1PRTD 1A3VA 3QWNA 3PIO3 1R4QB 2SOBA 3VR4A 4IUPA 1EQTA 3NBIA 4L6TB 3GTPB 2J0TD 4TQUS 2FHTA 2BE5C 2Q8RE 2ICIA 1W6JA 4K5VA 2L0CA 3BVMA 2C5CA 3K57A 1B9NA 1SBBB 4GZYC 4H0LC 1PTOC 5JJZA 2DN8A 4KY7A 3K6OA 4QF4A 2EYHA 3H91A 3K5LA 4ULLA 1STNA 5C4ZA 3SXHA 5EBDA 5M5XB 1RODA 1SNOA 2BA1A 3KLSX 1SNDA 4ME5A 2RKSA 3KLRA 3S1RB 2XWJB 4FXGC 3HOUB 1GJXA 2L5TA 1D5ZC 1D5XC 1YNJD 3QO2A 1TVXA 3SE0A 3D4DA 1RKNA 2K32A 3ERQA 4I65A 1IW7D 3HGBA 3SK6A 2A73B 2MPMA 2NN6G 4NDXA 5C3XA 1V43A 1B44D 1HTPA 4IUTA 5FLXE 3T53B 4ZKBB 5BN5A 1PLFA 1BNZA 2KVMA 4KN4C 4RWSC 1Y1VB 5C6AA 3MHBA 1DONA 3M4OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHK A;  1OXX K;  2D2C C;  1VF7 A;  2AUK A;  2E75 C;  3PUX A;  1IYU A;  5KNB A;  3GD7 A;  3M4Y A;  4TQU S;  3RLF A;  2QF7 A;  1VDZ A;  3A8I E;  1VF5 C;  1DXM A;  3I72 A;  3GQB A;  3I73 A;  4OGQ C;  4IQZ A;  4G7H C;  1TU2 B;  2JE6 I;  3D31 A;  3SDZ A;  4KI0 A;  2BE5 C;  2E76 C;  5JEA G;  5A35 A;  3BG3 A;  3VA7 A;  5C0X H;  3QJY A;  3VR3 A;  1YNJ C;  4IFD H;  4JBW A;  4RCN A;  2D5D A;  3EQL C;  2IT1 A;  2O5J C;  1CTM A;  2YYZ A;  1B9N A;  1ONL A;  2EJF C;  3MXU A;  2O5I C;  4GZY C;  1VCI A;  4H0L C;  4TKO B;  2PPB C;  1V8Q A;  3DXJ C;  3OOC A;  1DCZ A;  1FR3 A;  1G29 1;  2CW0 C;  3H94 A;  4KHZ A;  4JK1 C;  2DN8 A;  1IW7 C;  2DNC A;  1E2W A;  3T56 B;  4LK1 C;  3OPO A;  4DNT B;  1H9K A;  3U9S A;  5JEA H;  4KN7 C;  3W3A A;  1CFM A;  2EVB A;  2V4D A;  2KCC A;  4DK1 A;  4L8J A;  4DNR B;  3TZU A;  1LAC A;  2KA7 A;  2D62 A;  2ZT9 C;  2DNE A;  2A69 C;  3T51 B;  4G7Z C;  3VR6 A;  5K36 G;  4KKT A;  1OXU A;  2BA1 A;  1K8O A;  2A6E C;  1Y8P B;  2AWO A;  2BDO A;  2E74 C;  3M7N A;  3M85 A;  2R6G A;  1GUT A;  2A6H C;  2PNR C;  1H9S B;  2F1M A;  3KLR A;  3IFT A;  1HPC A;  1ZYR C;  3NE5 B;  2A68 C;  1K8M A;  1H9R A;  1HCZ A;  2B8F A;  2BA0 A;  2K7V A;  1SMY C;  3MFY A;  4HR7 B;  4LJZ C;  1GJX A;  2BE5 D;  2L5T A;  1YNN C;  4KMU C;  3L7Z C;  1H9M A;  2K33 A;  5K36 H;  1I6V C;  3VR2 A;  4XTC S;  4BA2 I;  3ND9 A;  3D4R A;  3FMC A;  1OXV A;  3SE0 A;  5BN4 A;  3LWU A;  4KKU A;  5KND A;  3A8K E;  3OW7 A;  5BN3 A;  3WDN A;  2AUJ D;  1Y8O B;  1EWH A;  4H13 C;  1PMR A;  1DD2 A;  3PUY A;  1O78 A;  1CI3 M;  2K32 A;  1TKW B;  3A7A B;  1H9S A;  1IW7 D;  4I7Z C;  3HGB A;  2EJG C;  1ZKO A;  3CRK C;  3FPP A;  1QJO A;  1Q1E A;  1E2V A;  2JEA I;  1Z6H A;  3PUW A;  3A7L A;  4OO1 G;  4G7O C;  3VR5 A;  1IYV A;  1Q12 A;  3A8J E;  2NN6 G;  4DK0 A;  3PUZ A;  3ND8 A;  2Q8I B;  1V43 A;  3P20 A;  1HQM C;  1BDO A;  1H9J A;  3IKJ A;  1OXS C;  2A69 D;  1O7L A;  2EJM A;  1Y69 U;  1GUG A;  1HTP A;  1GUN A;  3QG1 A;  4PV1 C;  1OXT A;  3PV0 A;  4XIG S;  2JXM B;  2A6E D;  3T53 B;  1FYC A;  1Q90 A;  5BN5 A;  2NN6 I;  4H44 C;  1LAB A;  1Z7T A;  1GUO A;  2A6H D;  3AB9 A;  2EDG A;  3QIA A;  4KN4 C;  3CRL C;  1GHJ A;  1E2Z A;  3N6R A;  2B8G A;  4OO1 H;  2JEB I;  4BA1 I;  2A68 D;  3BDO A;  2LMC B;  1Q1B A;  2NN6 H;  5C0X G;  1T5E A;  3I4L A;  5KNC A;  1GUS A;  4IFD G;  3VR4 A;  1A6X A;  3LNN A;  1Y8N B;  2PCF B;  3PUV A;  1B9M A;  4KKS A; 
#chains in the Genus database with same CATH topology
 3GTL H;  1NBW A;  3TRZ A;  1S5C D;  2VQF L;  2JA8 H;  3MAQ A;  4IAL A;  1JQY D;  4A3K G;  3A8I E;  4LWC A;  1DXM A;  3SGI A;  3L3O C;  3K5N A;  3SDZ A;  4KI0 A;  1PTO F;  2PI2 E;  1L0W A;  2NWG A;  4KV6 A;  4C2M H;  1I94 Q;  1D1I A;  3ULL A;  1B2T A;  4A3D H;  1ENC A;  2DJF C;  3J81 i;  2D5D A;  3HKZ B;  1YJN A;  4A3C H;  1JC7 A;  1JB7 A;  2K5V A;  4E6I A;  1C8C A;  5CYU A;  4DV0 Q;  1M1K C;  1K83 B;  1NAP A;  2C9O A;  2PNH A;  2ZM6 Q;  4GOP B;  5C4J B;  1FVI A;  5EKK A;  5JEA H;  1PH5 A;  2F0H A;  2RSN A;  3NWS A;  3CD6 A;  4UDU C;  4IPD A;  3I2Z A;  2EYF A;  3CF5 A;  1IBK Q;  4NXN Q;  1O7Y A;  3T51 B;  4PG3 A;  1CA6 A;  4B9X A;  5CV7 A;  2KCN A;  5CV4 A;  3QB3 A;  3TRE A;  2GVA A;  1O80 A;  2NVT H;  1QWY A;  5EBC A;  1WTX A;  3FHW A;  1S40 A;  2A6H C;  2J7Z A;  3CPF A;  1AN8 A;  2DJG C;  5JPM C;  5G3L D;  4KK7 A;  3NHH A;  2A5H A;  2B8F A;  3BVZ A;  2EXD A;  1VQD A;  2ID0 A;  3MFY A;  4EQO A;  4H7B A;  1DZ1 A;  5HGQ A;  1UE5 A;  5FJ8 G;  4J1M A;  3FMC A;  4DR5 Q;  3R8B A;  5IP7 H;  4H13 C;  2R93 H;  1QZG A;  1A2U A;  1IBM Q;  1EIH A;  3GTG H;  3CRK C;  3I3C A;  4RHS A;  3MEF A;  4FDB A;  1LV9 A;  2MNA A;  1QNK A;  1QUQ B;  4GNX C;  4AQY L;  2K05 A;  1H9J A;  1G2S A;  2KCM A;  1UEA B;  4B9W A;  4A3I G;  3CC2 A;  4QJF A;  1E24 A;  5FLM H;  2PQA B;  1V1P A;  1VQE A;  1LAB A;  1E2Z A;  1HNX Q;  3P75 A;  4IJH A;  1Q1B A;  1HZA A;  4PQX A;  4CHT B;  3I90 A;  1GD7 A;  1RTO A;  3SR1 A;  2JA6 H;  3RZO H;  2VZA A;  4RAU C;  5IIF A;  1JWU D;  4BY1 H;  1IYJ B;  1B50 A;  1K3B C;  4CKB A;  2OF1 A;  4RKB A;  1NE3 A;  1LTR D;  1TU2 B;  2VXW A;  5FO8 B;  1HTL D;  5A35 A;  5C0X H;  4A93 B;  4DAM A;  1SAP A;  3Q23 A;  1BCP B;  2XRS D;  4LMQ D;  1K9M C;  4A3E B;  1X3F A;  5COY A;  1ONL A;  1VQ4 A;  3HOX B;  3PO2 G;  2PPB C;  3AQQ A;  4C3J B;  1G29 1;  2R61 A;  3JAM E;  1Y1W H;  1QZH A;  2MO1 A;  1PYB A;  2RBM A;  1B53 A;  1CSP A;  1NY4 A;  4BBS G;  2V1C C;  2IJ0 A;  3AFP A;  4PMB A;  2IW3 A;  1TII D;  1QCB D;  1OXU A;  1VQH A;  2BDO A;  4BBR H;  4DK3 C;  5KGU A;  4JI6 L;  4DR3 L;  4CJ2 C;  2VQE Q;  3I8Z A;  3IFT A;  4OWT B;  3H3V H;  4HN7 A;  4KTA A;  3KJO A;  2OTJ A;  3QOL A;  4KJO A;  3CMA A;  4PZ7 A;  3KBX A;  2KEC A;  4DU9 A;  4UY8 C;  4LNQ A;  3J7A V;  3H6M A;  1EYC A;  1R9T H;  2M00 A;  3K81 C;  3E0J A;  3HOZ H;  5BN4 A;  4HMJ A;  3L9A X;  1Q3L A;  5M3M B;  2VL6 A;  1XX8 A;  1X9N A;  1EQV A;  1MGS A;  1YI2 A;  4WRD A;  3CCL A;  1FD7 D;  2XGT A;  1XMQ Q;  1XNR L;  3NUC A;  5T1G A;  4DAP A;  4JI2 L;  1SE4 A;  5LMN L;  1IYV A;  4LFA L;  5I9P A;  3GTQ H;  5M5Y H;  3E9H A;  3T4A C;  1BDO A;  2EY5 A;  3CCV A;  1JJG A;  2B2Y A;  4JI5 L;  4P2C B;  3T1H L;  3WWV A;  4B3T L;  2FIN B;  4B3S L;  4OIJ A;  3K58 A;  4JI7 L;  2NYZ D;  3ER0 A;  1N36 Q;  1XWE A;  2B8G A;  1RL2 A;  3CQZ B;  2EZV A;  1LT3 D;  1TS2 A;  3HKS A;  5CV6 A;  2EPB A;  3MZ5 A;  1K8A C;  4O1N A;  1KRS A;  2FMC A;  4X62 L;  5AJ3 Q;  5ELC A;  5JJL A;  2K14 A;  4N8X 1;  4K8I A;  2R7Z B;  3KUP A;  1V1Q A;  1EZ8 A;  2A1A A;  4QIW E;  1SEB D;  3Q0A A;  3EFX D;  1KIX A;  2RDH A;  1QVG A;  5C5M A;  1SE8 A;  1SYG A;  4X66 L;  4PNY A;  1LT5 D;  3BYY B;  5HY6 A;  4DV1 L;  2O5J C;  3S1M B;  2K5Q A;  4H02 A;  1V8Q A;  4A3G H;  4PMC A;  1WTV A;  1C0A A;  2X69 A;  3RLO A;  1H9K A;  3HOW H;  4GKJ Q;  1CFM A;  3PO3 B;  3HS0 C;  3S2H H;  1GXD C;  5IOD A;  3TS2 A;  2UXB L;  1UNS A;  2IHE A;  4C3H B;  1EIY B;  4IUU A;  3H3V C;  3M7N A;  3MA2 B;  4YY3 Q;  4F7X A;  3CCS A;  1Y1V G;  5IYB H;  4CDF C;  3JAM L;  5DM7 3;  3MVV A;  2WKD A;  4V0B A;  1YIJ A;  3L7Z C;  4CKE A;  4CJ0 B;  5M5W H;  3NP8 A;  2H5X A;  4ZRZ A;  3S9W A;  1UUP A;  2F4I A;  1OO9 B;  3K7U C;  3STB C;  2Q8T A;  2ASB A;  1HZC A;  2MHV A;  2IWH A;  2OQ0 A;  1SFO B;  1ESF A;  2K5W A;  5IYD H;  1G2T A;  4GOP C;  1RF2 D;  1Q1E A;  3IFD A;  4YCV A;  1L0Y B;  1Z6H A;  4IPG A;  3J80 E;  4TRD A;  1Q12 A;  2F0I A;  3HKZ G;  4NMZ A;  1L1O A;  3BZD B;  4IOC A;  1PRT B;  2WKC A;  3I4M B;  1TWA B;  5IGB A;  3S1N B;  1D5M C;  2KEE A;  2R3Z A;  1CQV A;  2JXM B;  4QB4 A;  2R92 B;  2JA7 H;  1QVC A;  1TS4 A;  4LF5 Q;  2K5N A;  3CP0 A;  5FO7 B;  4UHV A;  1PXU A;  4ID6 A;  4DV0 L;  4OO1 H;  2Q2T A;  2MFI A;  3BDO A;  4NP5 A;  2ZM6 L;  1BBU A;  4DUZ Q;  1HXY D;  4BS9 A;  3TP7 A;  4A3B B;  5HGT A;  1GHK A;  1XPU A;  3DEP A;  1LTA D;  4NXN L;  2YU9 H;  4UPA A;  1VF5 C;  4QMG A;  3K8A A;  2SNS A;  1UE1 A;  4IUN A;  4RHR A;  1HR0 Q;  2EYL A;  2ZXO A;  2BH2 A;  3FPU B;  4DNI A;  2IX1 A;  1YEZ A;  2JQO A;  2NZH A;  4NB3 A;  1AE2 A;  1CSQ A;  2IT1 A;  4QGU A;  5ISR A;  1Q81 C;  3GTK B;  1YHQ A;  3UDG A;  5LMU L;  1TWG H;  4ABN A;  2B2Y C;  3G7L A;  4XQN A;  1JB3 A;  1IHZ A;  2V4D A;  3OW2 A;  4JBJ A;  2L11 A;  5IGF A;  3TZU A;  1LTG D;  4GN3 B;  1IBM L;  5EJW A;  2AMC B;  4QIW B;  5DAU A;  2A69 C;  1K3R A;  1CKO A;  4K2K A;  3GTM B;  5IOC A;  4L63 B;  1HHV A;  4Y7N B;  4FF4 A;  4DR7 Q;  1ILP A;  2K5H A;  3K80 C;  1SE2 A;  2XN9 C;  3DWP A;  4R9W A;  4BWG B;  1K8M A;  1PH1 A;  1S5F D;  1OTC A;  5M9O A;  3SVM A;  2BE5 D;  3CKI B;  1M8A A;  4P75 A;  4YCW A;  1K0S A;  1EFI D;  3ND9 A;  3J7A 5;  3LWU A;  5IYC G;  1VQ8 A;  3KF8 B;  5JVH 3;  5JJK A;  3DEO A;  1PMR A;  4DR1 L;  3PUY A;  1RDP D;  2IHF A;  1PTO D;  4KD4 A;  2CVR A;  4JI0 Q;  1AZQ A;  4J6H A;  3A7A B;  2L15 A;  2CH4 W;  1ZKO A;  2PO4 A;  4A93 G;  4UP7 A;  3W1G A;  1I6H B;  3A7L A;  3VR5 A;  5EAY A;  1D8L A;  4CGY B;  1HUN A;  3OSO A;  4NW2 A;  2NVY B;  4K6L A;  1KHI A;  1FGB D;  5M3F H;  3H0G G;  3PIO A;  3KJP A;  1WTO A;  4RFB A;  2JA5 B;  2VB2 X;  1FYC A;  3CCU A;  2AHO B;  4P71 A;  4IPH A;  1GHJ A;  1G8Z D;  1ESR A;  5JPN C;  3RD4 A;  4K8J A;  1KDB A;  2NN6 H;  4LF7 Q;  1BBX C;  2QDB A;  3J80 L;  3GTL B;  3HOV B;  4DR2 L;  1PHJ A;  4WOR A;  3S14 H;  3PCO B;  3GTO H;  2HD3 A;  3CCM A;  5F2D A;  1F9P A;  2QF7 A;  4S3S A;  4C1N I;  2I5M X;  2ZJP A;  3S2D B;  2TMP A;  1ET6 A;  2WIN B;  4DN4 M;  2E76 C;  3CPW A;  3F2B A;  1HFN A;  4R4O A;  2A8V A;  2MQH A;  2FJ2 A;  4IFD J;  5M3M G;  3E0E A;  1A3T A;  4P74 A;  2O5I C;  1S5B D;  1PA6 A;  4R4C A;  5J3B A;  4TKO B;  4KY6 A;  1Q8K A;  1B4O A;  4DNT B;  4LK1 C;  3OTO Q;  1JWM D;  2FMM A;  3U9S A;  5K5P A;  2NUC A;  2UUC Q;  1PV4 A;  2KCC A;  4RH6 A;  1LAC A;  1LTB D;  3VDY A;  1YBY A;  4JBK A;  5IGD A;  3GP7 A;  5IE8 A;  1KC8 C;  4FF1 A;  1TWF H;  5LL6 X;  3TS0 A;  1K8O A;  4OON A;  2AWO A;  4DAV A;  3C1E A;  4LUZ A;  4A3J B;  1E3P A;  2F1M A;  1QVF A;  4DAY B;  4LF9 Q;  3UDF A;  3JC6 6;  2ZJQ A;  1I50 H;  1SMY C;  1NMG A;  1W2B A;  3D6C A;  1H9M A;  2LXK A;  2NZ1 D;  3QOJ A;  1N36 L;  1VQI A;  1JJ2 A;  3S16 H;  2R93 B;  4BY7 B;  3D8G A;  1CKN B;  3GTG B;  3C1F A;  3Q24 A;  2OT2 A;  1E1O A;  4GKK Q;  1X54 A;  3MFG A;  4I7Z C;  5AJ3 L;  1EOT A;  2UUB L;  2CQA A;  4JI4 L;  2E2J B;  3J7Y W;  1RJT A;  1E2V A;  3MWY W;  1WYD A;  5FJ8 H;  3MEH A;  4O42 A;  3ND8 A;  3I91 A;  3DMU A;  3NQT A;  2CWP A;  3I4O A;  3PSI A;  1EEF D;  1KDA A;  2KJX A;  1Y69 U;  3QG1 A;  5CC4 A;  5C3W A;  4H44 C;  3NQI A;  3OMG A;  2A6H D;  5ELF A;  4X3S A;  1XPO A;  3PO3 G;  4QQB X;  1KQS A;  1S5E D;  4DV3 L;  2K1B A;  4GKJ L;  4IFD G;  2K6A A;  1FGU A;  5E4W C;  1KXL A;  4CJ1 B;  4A3I H;  1VF7 A;  3SEB A;  2K28 A;  1PH2 A;  1IXR A;  5NUC A;  2RDF A;  1Z9F A;  2EY2 A;  2ZTE A;  1STH A;  4YY3 L;  4DV6 L;  1ASZ A;  4K0K L;  4DKA C;  1V1O A;  2VS1 A;  1LO5 D;  3KLW A;  3S17 B;  1RD9 D;  3DHQ A;  3DWQ A;  5CGK A;  1Y1W B;  1D6E C;  3M9B A;  4DUY L;  4L5R C;  4DR6 Q;  3DXJ C;  3OOC A;  1DCZ A;  5LL6 S;  1GKH A;  5IWA Q;  3DUZ A;  2HIV A;  1TWH H;  4U68 A;  1MIU A;  4DNR B;  3CU7 A;  3EVQ A;  5CV9 A;  1XYI A;  2UUA Q;  3V96 A;  1HA5 A;  3GTJ H;  4LF4 Q;  1D1K A;  5GAD C;  4BBR B;  1NSN S;  1RCV D;  3K7A H;  1ICF B;  3I4M G;  3MXP A;  3PO2 H;  3WOF A;  4UP8 A;  4N9T A;  2R92 G;  4PZ8 A;  1H9S B;  1KAW A;  3BS1 A;  3MXN A;  3NBH A;  3SHL A;  1Y14 B;  2HQE A;  2LFN A;  3G48 A;  4XT1 B;  4F87 A;  2MGS A;  4BBS H;  3HOZ B;  1LM0 A;  2AQ2 B;  5AFW A;  2WB1 E;  1G6Z A;  3GV3 A;  4HED A;  4Z9C B;  2ENB A;  5IP9 G;  4A3B G;  2QIL A;  1SDF A;  4QY7 A;  4WJW A;  2I5L X;  2B63 G;  2N3S A;  1EYA A;  1WTW A;  1Z47 A;  1IBL Q;  1B7Y B;  3LWE A;  1EY5 A;  3OYY A;  1FJG Q;  1I4R A;  2K50 A;  4DV7 L;  3E9I A;  2OXP A;  4XYO A;  4HIK A;  2KHS A;  4O2D A;  1Q86 C;  4P72 A;  1EY8 A;  1HR0 L;  3RN5 A;  3GTP H;  3JAM i;  1WI5 A;  3P1H A;  2IL8 A;  1X3P A;  1HRJ A;  4XQQ A;  3OIP A;  2N88 A;  2E2I H;  3KOJ A;  1Q82 C;  2HCC A;  3CRL C;  1B1Z A;  1BQQ T;  3FRP B;  2HUG A;  3ICE A;  2CFM A;  3G6J B;  4RA8 A;  2QA4 A;  2B3G A;  1MSG A;  3ULJ A;  5BR8 Q;  1STE A;  4YHH Q;  2F0F A;  1BKB A;  5KIX A;  1XTC D;  2CQO A;  3AU7 A;  4RGN A;  1E1T A;  1MKH A;  1IYU A;  4GN5 A;  4ME3 A;  1VDZ A;  3M3Y H;  1STB A;  4C3I B;  1EQQ A;  1I3Q B;  4G7H C;  4EGV A;  3J81 c;  3NPP A;  5HUR A;  1Q46 A;  1TWC H;  1JOO A;  4X65 L;  5M5X H;  1PZK D;  5CR3 A;  1BVS A;  2F0N A;  4ZUJ A;  3NXW A;  1N32 Q;  4OL7 A;  4DXF A;  3RR5 A;  4A3G B;  2F0M A;  2F0V A;  3S1R H;  2CW0 C;  3MXG A;  3K5M A;  1XJV A;  2RCN A;  2ZXP A;  1F2Y A;  1KLG D;  4KN7 C;  1KNA A;  5IY0 A;  3W5O A;  3NSW A;  2PZW A;  1EY4 A;  4L8J A;  4P73 A;  5CBA E;  2PMZ E;  5FO9 B;  5I6Y A;  2EYP A;  2SNM A;  5FLX L;  3VR6 A;  1FNU A;  1VQN A;  3AEV A;  3NEN A;  3M4P A;  3T16 A;  1MBY A;  4IZ8 A;  1NMF A;  2HDM A;  5L37 A;  1GUT A;  1QIL A;  4HSV A;  1X3G A;  1PFM A;  3P7J A;  3HP3 A;  4GOP A;  4A3F B;  1HCZ A;  1N9W A;  4NXM L;  1X32 A;  3I70 A;  1YNN C;  4MHE A;  3HOV G;  3VR2 A;  3ITP A;  3R93 A;  4HJ5 A;  4ZLT F;  1DOM A;  1VMP A;  3T1Y Q;  2DUD A;  1B3A A;  4WJ3 M;  1SYC A;  3PGZ A;  2OCE A;  1LLR D;  1Y1V H;  2ZXR A;  1F2M A;  3BZK A;  2L1B A;  2EY6 A;  5IT9 c;  3GO5 A;  1I5F A;  3BZC A;  3VYU A;  5D14 A;  3AYH B;  4APV A;  1GUW A;  2GA4 B;  4V19 0;  4DV4 L;  2E2H B;  2B2V A;  4JCV E;  2JA7 B;  2EE1 A;  1U9R A;  1J9O A;  3BDL A;  2WB1 B;  4OWX B;  2GN5 A;  3EBE A;  4OO1 I;  2H1E A;  1SNP A;  2YTY A;  1TS5 A;  4XXE A;  1EIG A;  3S15 B;  3N6R A;  2JEB I;  1T5E A;  3OTO L;  4A3L G;  1RTN A;  3TBI B;  1KL9 A;  2Z4H A;  2Z1C A;  5ELB A;  4QCL A;  1QUQ A;  4DK6 C;  4KKS A;  3STB D;  1K83 H;  3K5O A;  4A4I A;  1PH8 A;  2D2C C;  4A3J G;  5C4J H;  1PFS A;  3M4Y A;  3HRZ C;  5C3E B;  2LXJ A;  1SNC A;  3I72 A;  2PQA A;  1VQ7 A;  2RSO A;  1HUM A;  3VR3 A;  3FKI B;  3FP9 A;  3TQY A;  5FOB B;  3TN2 A;  4BXX G;  1CK1 A;  5C44 B;  4BY7 G;  4JV5 Q;  4C56 C;  1FR3 A;  1EYG A;  2F0P A;  4ZKC B;  1HNZ L;  3R2I A;  2NTT A;  2UU9 L;  1JWS D;  3J80 i;  4ZK9 B;  1X56 A;  3HOY B;  1XTD A;  3SK5 A;  4DF7 A;  4HMI A;  4DK1 A;  1E7Z A;  3KFU A;  2DNE A;  4DV2 Q;  3HOU G;  2UXC Q;  5K36 G;  1IZ6 A;  4KKT A;  5D65 A;  4ZCK A;  1JJC B;  1W3S A;  3RLN A;  1VQJ A;  3GDE A;  2QCP X;  1GVP A;  3BJU A;  2K75 A;  4GN4 B;  2BA0 A;  3VA5 A;  1PTO B;  4AIM A;  4N8F A;  2I0Q A;  4XTC S;  2MP1 A;  1A63 A;  3PMF A;  1N8R C;  4KKU A;  3A0J A;  4OX9 L;  1U4P A;  1EZ6 A;  3K0X A;  2PI2 A;  2PMZ B;  3IRB A;  1N33 Q;  1Y8O B;  1FL0 A;  1WTH A;  4K6D A;  3QR8 A;  5I9O A;  3NEM A;  1EQR A;  4LF8 Q;  5COR A;  1SNM A;  2DGY A;  5M3F B;  3EJI A;  2RHQ B;  1AP0 A;  5IYC H;  2A69 D;  1QNU A;  1I4H A;  1WD0 A;  3PV0 A;  4DXG A;  3TZD A;  2NN6 I;  3V2T A;  4B3M L;  3AB9 A;  1S72 A;  4A3M B;  4A93 H;  4DR6 L;  1XMO L;  1JOR A;  2LMC B;  5EGT A;  1VQO A;  1WCM B;  1JR0 D;  3FDT A;  1A6X A;  3H0G H;  3U58 A;  5EPK A;  3TP6 A;  1B9M A;  3TP5 A;  1WTR A;  2AKW B;  1OXX K;  2G9D A;  2IY5 B;  2JP1 A;  2SEB D;  4LF4 L;  1I94 L;  1IKM A;  3KF6 B;  3RMH A;  1JE4 A;  1WD1 A;  3F2D A;  1C4Q A;  1A62 A;  2VUM B;  2JYO A;  1BO0 A;  2XWB B;  3I4N B;  4X6A H;  4XYQ A;  2RA4 A;  3ONA B;  4ZUI A;  1KDC A;  5CV5 A;  5KYI A;  4A3K B;  3MXU A;  3J81 j;  4LFC Q;  5EPL A;  1VQ5 A;  2UXD Q;  2DNC A;  4Q5V A;  2F0W A;  4MNO A;  3T56 B;  2B2V C;  2RF4 A;  1IBK L;  2KHJ A;  5I6W A;  3RZD B;  2AQ1 B;  1IBL L;  2B2U A;  2XVS A;  5M3M H;  1FJG L;  3KBG A;  3RNU A;  1WTP A;  1EL0 A;  4AYB E;  2RVL A;  1PYS B;  4JYA Q;  1DM0 B;  1SRU A;  2RQX A;  2ZTC A;  4FF2 A;  1D7Q A;  1VQ9 A;  1MHW C;  3D4W A;  2QDL A;  1H9R A;  3NK9 A;  3H15 A;  2XTI A;  2HDL A;  4DR5 L;  1STG A;  1TQO A;  3NWT A;  5T1I A;  2Z8L A;  1PZJ D;  1C48 A;  2KOL A;  2MJ8 A;  2MO0 A;  4LW1 A;  5C4X B;  2E5L Q;  4IO9 A;  1DD2 A;  1TR5 A;  4C3I G;  4YHH L;  5LMN W;  1TKW B;  1PH7 A;  2CWA A;  2QEJ C;  1J8I A;  2EJG C;  3CQZ H;  1F77 A;  1II3 A;  3D6W A;  3PUW A;  4J15 A;  3FEW X;  2F3V A;  4DK0 A;  4FP5 D;  5ELE A;  2IX3 A;  1G51 A;  1NCV A;  1OXS C;  4KJN A;  3A55 A;  3CCJ A;  1XXG A;  3S1Q H;  4PV1 C;  2WP8 J;  3KDF B;  4AQY Q;  4ALP A;  2BCO A;  4TVA B;  2YV5 A;  3RUZ A;  1HNX L;  5I2X A;  2HHH Q;  2N49 A;  1F2L A;  1BCP C;  4PMW A;  1XNQ Q;  1SLJ A;  4EQ5 A;  1Q8I A;  1QOH A;  1SMY D;  1UE6 A;  1Y8N B;  1W6K A;  3S1M H;  2JA9 A;  3LGJ A;  5KNB A;  4A3E G;  1ENA A;  1T5X D;  3TME A;  4GNX B;  4A3F G;  3HOX G;  2EIF A;  4C3J G;  3A54 A;  5IGG A;  1LTI D;  3PO3 H;  4B3R Q;  4RGT A;  1L2F A;  2A19 A;  1BBW A;  4IFD H;  4RCN A;  1CM9 A;  4OWW B;  1E22 A;  2K4K A;  5JJI A;  1CA5 A;  4LAA A;  1D2B A;  1EOV A;  1EWC A;  5DNF A;  4LF6 Q;  1YHB A;  2M2L A;  1EU3 A;  4IOA A;  2SDF A;  2DY7 A;  4JC0 A;  1QB5 D;  3C46 A;  3F2U A;  2NVQ H;  1BF4 A;  2JA8 B;  3C2P A;  5EPJ A;  4HCE A;  1EU4 A;  4C2M B;  4FNF A;  3TSS A;  5C4H A;  3C3L A;  4AH6 A;  2D0O A;  4A3D B;  1EEI D;  3URY A;  3IAY A;  2VQE L;  4CDE C;  2F0U A;  2WB1 G;  2YTX A;  2A6E C;  4FXK C;  2KED A;  1SFO H;  2P5Z X;  2PNR C;  1ZYR C;  4DR3 Q;  2A68 C;  2D9U A;  2K7V A;  3RN2 A;  1SJH D;  1VMC A;  2L4N A;  2K03 A;  2K33 A;  1U4M A;  1GOZ A;  2FXQ A;  3I4M H;  1TWA H;  2Z0S A;  3S1N H;  3HEJ A;  3A8K E;  1SYF A;  2R92 H;  1XMQ L;  2NVT B;  3KLS A;  4HSP A;  2K04 A;  1CI3 M;  5C3E G;  3X3M A;  1EYD A;  2I46 A;  2A74 C;  1MD2 D;  4AYB B;  3UE0 A;  1N34 Q;  1X3Q A;  3FKI G;  1BCP F;  2PZT A;  3UE1 A;  1XNR Q;  5I4D A;  4POG A;  5IP9 H;  4A3B H;  3M4Q A;  5LMN Q;  3HG9 A;  4LFA Q;  2E2I B;  2OTL A;  1VS0 A;  5C44 G;  2B63 H;  2B2U C;  1MI2 A;  4FXD A;  3KF8 A;  1UEB A;  2QW7 A;  2NVX H;  2ATW A;  1GUO A;  4R4Q A;  3HOY G;  4B3S Q;  2R7Z G;  4ZYS A;  2CKZ B;  1VQA A;  1PDQ A;  3WOE A;  2F0K A;  1X6O A;  1SYB A;  1M4V A;  1EY0 A;  2B2T A;  5E1F A;  5I2Y A;  3GTK H;  1I4P A;  1ET9 A;  1YHA A;  3M3Y B;  2E75 C;  1ZXT A;  1QE6 A;  4DV2 L;  2UXC L;  4HAE A;  3TP8 A;  1IKL A;  1TWC B;  4X62 Q;  3NEL A;  4OGQ C;  3PF5 A;  1FNW A;  4B08 A;  3VA7 A;  3QJY A;  1HFG A;  4HJ7 A;  4JBW A;  3GTM H;  4UP9 A;  4JG2 A;  2EY1 A;  4Y7N H;  1CTM A;  2HT1 A;  3UDI A;  4X66 Q;  3ERO A;  2JA6 B;  3RZO B;  1VCI A;  1U5K A;  3H09 A;  4DV1 Q;  4C3H G;  4BY1 B;  4NKL A;  1AE3 A;  1K73 C;  1F9R A;  1WFQ A;  4EX5 A;  3CC4 A;  1N33 L;  1HH2 P;  1KTK A;  5C0X I;  5H1S E;  1CQF A;  3NTI A;  3J7A F;  2D62 A;  4MTN A;  5FLX c;  4DFA A;  4ZAI A;  1JE5 A;  1ZEQ X;  1ENF A;  1X3E A;  1JOK A;  5ELN A;  1EY6 A;  5C5L A;  1Y8P B;  4QUF A;  2WV6 D;  5CBE E;  2EYO A;  1PYW D;  4OEL B;  4A3M G;  1VQM A;  4K2L A;  3X3N A;  1PRT C;  1WTQ A;  2BDN A;  3UI2 A;  4KHP Q;  1WCM G;  2Q2I A;  4KMU C;  2O2L D;  2NVY H;  3Q22 A;  2E8G A;  1JOQ A;  3ULP A;  3S24 A;  1NJI C;  3OW7 A;  3KYH C;  1V1P B;  1CHQ D;  4L5S A;  2Y0S E;  2B2W A;  3H3V I;  2CW0 D;  2Z6K A;  1TXY A;  3R2T A;  4KY5 A;  1BOS A;  2BH8 A;  1QJO A;  4DAY A;  2PW5 A;  2VUM G;  3BYT B;  1FNV A;  4G7O C;  3HOV H;  3I4N G;  2XSC A;  2LY7 A;  1R9T B;  1BUV T;  3IKJ A;  4LF5 L;  2L12 A;  2EJM A;  1GUG A;  1LT4 D;  2GVB A;  4QL5 A;  1LYL A;  5J1Z A;  4JI8 Q;  3S2D H;  2EDG A;  1CKN A;  2WAQ E;  3DM1 A;  2N8N A;  3SK4 A;  2PW7 A;  4LFC L;  4DUZ L;  3SK8 A;  4BA1 I;  5ELD A;  1UAP A;  4GS3 A;  3TEH B;  2UXD L;  1J5E Q;  1A8V A;  1YNN D;  2JK8 A;  1SN8 A;  3GTQ B;  5M5Y B;  2B29 A;  2QGQ A;  1MJE A;  3F8T A;  4R4T A;  2PQE A;  1TY2 A;  1HA6 A;  5CV8 A;  3I73 A;  4ILW A;  4IQZ A;  1VQB A;  4JW0 A;  4X3U A;  3E3X A;  4JYA L;  2F3W A;  4PZ6 A;  1YNJ C;  4A3L H;  4XT3 B;  2NBF A;  1NR4 A;  3EQL C;  5JVG 3;  1ML0 D;  1E0B A;  1KNE A;  5C4X G;  2EJF C;  2WII B;  4A3J H;  3H94 A;  4KHZ A;  4OEM B;  1IW7 C;  4DGZ A;  5J22 A;  5GAH C;  1HNW Q;  3CME A;  1EFW A;  4G57 A;  3OIQ A;  2VY3 A;  2F0G A;  5JEA J;  1VQG A;  5LMU Q;  2E5L L;  1JCK B;  2G5D A;  4K5W A;  5EQ0 A;  4Y52 H;  4DR7 L;  4G7Z C;  1PRT F;  3EA6 A;  1Q7Y C;  3ZYY X;  4BXX H;  4TSS A;  3CC7 A;  4BY7 H;  3A74 A;  3M85 A;  2R6G A;  4ZQ3 A;  3F1Z A;  3G4S A;  1HQR D;  2B2T C;  1BR9 A;  3V05 A;  5A2Q E;  2Q2U A;  4CBV A;  4I7A A;  1C7Y A;  2E2J H;  4DR4 Q;  3OWF A;  1I4G A;  4LJZ C;  3HOW B;  1YJ9 A;  2QKI C;  1STA A;  2HHH L;  2XNA C;  3A56 A;  3VYT A;  3HOU H;  5K36 H;  3S2H B;  1I6V C;  2VB3 X;  1PH4 A;  1XNQ L;  2JSO A;  3J81 E;  1M90 C;  1CKM A;  4JI0 L;  1IL2 A;  1EWH A;  2VNU D;  2F0L A;  1RHP A;  1S4Z A;  3LX0 A;  4MZ9 A;  1H9S A;  2MUY A;  4CKC A;  2JA5 G;  3CCE A;  4K14 A;  4MTK A;  4DR1 Q;  2J4X A;  1KLU D;  4IN3 A;  1F2Z A;  1MJC A;  3A8J E;  3JAM c;  1CUK A;  2Q8I B;  2KBN A;  2IPK D;  1PZI D;  5M5W B;  3K59 A;  4B3R L;  2LS0 1;  1WVL A;  2R7F A;  1VQL A;  4LFB Q;  5LHY 1;  4N9P A;  2L55 A;  4LF6 L;  2JA8 G;  1G6P A;  4LF7 L;  2O4X A;  1U4R A;  4FF3 A;  1AH9 A;  1YJW A;  2Y0S B;  4MIU A;  3I4L A;  3T13 A;  5KNC A;  3H0G B;  4A3D G;  3S17 H;  4R4I A;  2F4V Q;  1I4Q A;  1S3O A;  3D0F A;  3PUV A;  4A3C G;  1K28 A;  2QEX A;  4C1N K;  3M4O H;  2AUK A;  1WJJ A;  3A5U A;  4OIK A;  4DR2 Q;  2WAC A;  4DPG A;  3RLF A;  4Q0F A;  4U67 3;  1YZ6 A;  3N52 A;  3GQB A;  1SJE D;  4L5Q A;  5JOB A;  5JEA G;  4QUC A;  3I55 A;  2RDG A;  2B2W C;  1A3U A;  5C0X J;  4FO2 A;  2Z6K C;  1SE3 A;  3DM3 A;  3GV6 A;  2WAQ B;  2CHB D;  3M7G A;  1DOK A;  5EKL A;  5IT9 E;  1DJR D;  2EYM A;  2NB0 A;  2YYZ A;  3VYR A;  3DLL A;  2ZJR A;  2KQ3 A;  2UUC L;  2HCI A;  5GAG C;  2PYK A;  4RMF A;  2D0P A;  1KAB A;  2CCZ A;  4JI3 Q;  2YU9 B;  1X55 A;  4AYB G;  3W3A A;  1MSH A;  3CHB D;  1J6Q A;  2KA7 A;  1QG7 A;  1EIF A;  2F0J A;  2Z6B A;  1U0L A;  2XIW A;  2N78 A;  3ZJY C;  2F03 A;  1LTS D;  2G9H D;  1N34 L;  1P8L A;  5JAV A;  1JIC A;  4LF9 L;  2XRQ D;  5IP7 G;  4J8Q A;  2R93 G;  2F0D A;  4X64 Q;  1TWG B;  5GQO A;  4YCU A;  3HZX A;  4HR7 B;  1PH3 A;  1L1O B;  1TT2 A;  1TS3 A;  2TSS A;  2ICE C;  3OWE B;  2L9H A;  4EQP A;  3D4R A;  5KND A;  1VQF A;  4GKK L;  3CAM A;  2AUJ D;  2AQ3 B;  1VQ6 A;  1EY7 A;  5FLM G;  5DM6 3;  4NPS A;  2LSS A;  1T9H A;  2Z4I A;  1ICW A;  3FPP A;  5A2Q L;  1AW7 A;  3MC0 B;  2JEA I;  2F0Q A;  1HR0 W;  4DV5 Q;  2UUB Q;  2K5D A;  4EVO A;  3P20 A;  4JI4 Q;  1A15 A;  3S1Q B;  1HQM C;  3B6Y A;  3I7F A;  5ELO A;  2KEN A;  1RIP A;  4JI1 Q;  4JBM A;  2JA6 G;  1SNQ A;  1PH9 A;  3IL8 A;  1CHP D;  3J81 L;  3F2C A;  4BY1 G;  2K01 A;  4HJA A;  4XIG S;  4C3I H;  1I3Q H;  2JN4 A;  1Z7T A;  3QIA A;  3PIP A;  2RCF A;  3U9O A;  5J39 A;  5G3L F;  4DA2 A;  3AMU A;  2I5H A;  5EKI A;  2Z9H A;  5C0X G;  1YIT A;  4JOI A;  3VYS A;  1GUS A;  4R8I A;  1DGS A;  3TDQ A;  4ODG A;  1S5D D;  3Q8D A;  4HIO A;  2PCF B;  4DV3 Q;  1G91 A;  3A5Z B;  4HID A;  4HJ9 A;  1ASY A;  1AZP A;  1CT1 D;  4O0A A;  5TSS A;  1Y1W G;  4IFD I;  3DWA A;  2HIX A;  3O13 A;  3R3O A;  4R1J A;  5DEH A;  1NUC A;  2EYJ A;  5IGC A;  1A0I A;  3G71 A;  1P16 A;  4RCO A;  4M8A A;  3K0Y A;  4X3K A;  1LTT D;  2I07 B;  4DV6 Q;  4KHP L;  4K0K Q;  5IWA L;  4XDX A;  2NVQ B;  2RHS B;  4BBR G;  4A3E H;  3S14 B;  3Q6S A;  3J80 c;  4JK1 C;  3BDC A;  3HOX H;  4A3F H;  3GTO B;  4DUY Q;  1WOC A;  4C3J H;  1UWV A;  1SRO A;  3PIP 3;  3MTS A;  2UUA L;  1LT6 D;  1AFP A;  1BCP D;  3PQI A;  4IUV A;  2F0T A;  2ZT9 C;  3BU2 A;  5E3F A;  1JMC A;  4X3T A;  2PZU A;  2VQF Q;  3HOZ G;  1YNX A;  2E74 C;  1PFB A;  5CMD A;  2WFW A;  5IT9 L;  3KK7 A;  3L0O A;  4JVZ A;  1U4L A;  1HPC A;  3W1B A;  2VW9 A;  2LKV A;  5FKA C;  4A76 A;  4JI8 L;  2E2H H;  3EN2 A;  2ES2 A;  4OHJ A;  1TWF B;  1I4X A;  4OXP A;  1J5E L;  3ERS X;  4R8N A;  1TY0 A;  5DLQ E;  5E7N A;  1GO3 E;  3S15 H;  4IPC A;  5GAE C;  4A75 A;  1PFN A;  1PVO A;  4RGO S;  5KRU A;  1I50 B;  2CH4 A;  3PUZ A;  1HZ9 A;  2H4O A;  4MN3 A;  4DV7 Q;  3NTK A;  2B63 B;  4L5T A;  4RKL A;  2FFK B;  4CDC C;  1KD1 C;  1O7L A;  1UE7 A;  1IL8 A;  1SR3 A;  2F0O A;  4KLK A;  3S16 B;  2NVX B;  1DOL A;  5C3E H;  2A6E D;  4FVM A;  2N55 A;  1XPR A;  1SYD A;  4LUO A;  5BR8 L;  4YWK A;  1SSO A;  2X6G A;  1LUZ A;  1ZYR D;  3FKI H;  3W2D A;  3L2P A;  2A68 D;  4IJL A;  2F52 A;  1HNW L;  4HCS A;  4RG1 A;  5FK9 C;  4JPB W;  1JT8 A;  3LNN A;  1B8A A;  5C44 H;  3G6E A;  2X6L A;  3PUX A;  3NTH A;  4IUR A;  4WFN 3;  3GD7 A;  1K8G A;  4A3G G;  3J7Z C;  1STY A;  4FYD A;  3HOY H;  3HOW G;  4KHV A;  2JE6 I;  3D31 A;  2R7Z H;  1BXT A;  3BG3 A;  3D3R A;  1HJP A;  1N32 L;  2E2D C;  1L0X B;  1F9S A;  3U4V A;  1F9Q A;  4X65 Q;  4DR4 L;  4F8M A;  2NZO A;  1EY9 A;  1V9P A;  2F3I A;  4K5X A;  2F0E A;  2EXZ A;  2AWN A;  1HZB A;  4A3I B;  1KAA A;  1NR2 A;  1SYE A;  1E2W A;  3OPO A;  5IYB G;  1A2T A;  3KF6 A;  1CZG A;  1PTO H;  3EIV A;  2EVB A;  4XQJ A;  5KYL A;  2EOT A;  2KUM A;  1O7Z A;  1EUJ A;  1NNX A;  2NTS A;  1DYQ A;  1SXT A;  2DY8 A;  4C3H H;  4JOI C;  4POF A;  1AEX A;  4RGM A;  2Q2H A;  3CCR A;  2M9V A;  1R4P B;  3NE5 B;  4LFB L;  2Y0S G;  5IYD G;  1TWH B;  3E5S A;  5E4X A;  4UAI A;  3T1Y L;  3FVQ A;  3CXC A;  2OEO A;  2KHI A;  4BA2 I;  4NXM Q;  1OXV A;  2IX0 A;  3GTJ B;  5D3I B;  5BN3 A;  3K7A B;  5IGE A;  3WDN A;  3PO2 B;  1EWI A;  1O78 A;  2BOS A;  4M1U B;  2F4V L;  4A3M H;  2JA7 G;  3OMC A;  4IUQ A;  1CZW A;  4WJ4 A;  4HTH A;  2F0S A;  1WCM H;  4OO1 G;  3BVG A;  1ILQ A;  3HFZ B;  4JI6 Q;  2WAQ G;  4BBS B;  4EQN A;  2B39 A;  1H95 A;  4F88 A;  1X65 A;  4YWL A;  1GUN A;  4KD3 A;  5D3D A;  1OXT A;  4DV4 Q;  3OHX C;  3CW2 C;  1Q90 A;  3U50 C;  5KEE A;  3E6Z X;  4YIJ A;  4G4K A;  3HKZ E;  4HIM A;  2VUM H;  1PRT D;  1A3V A;  3I4N H;  3QWN A;  3PIO 3;  1R4Q B;  4JI3 L;  2SOB A;  3VR4 A;  4A3K H;  1L1O C;  4IUP A;  1EQT A;  1NTG A;  3NBI A;  4L6T B;  3GTP B;  4JI2 Q;  2J0T D;  4TQU S;  3KDF A;  2ZTD A;  2OQK A;  3RZD H;  2FHT A;  2BE5 C;  2Q8R E;  2ICI A;  1W6J A;  4K5V A;  4JI5 Q;  3T1H Q;  2L0C A;  4X64 L;  3BVM A;  2C5C A;  4B3T Q;  1VQP A;  4JV5 L;  4JI7 Q;  1K0R A;  3K57 A;  1SMX A;  1B9N A;  1SBB B;  4GZY C;  4H0L C;  1PTO C;  1VQC A;  5JJZ A;  3MXN B;  3NBH B;  4LUV A;  2DN8 A;  2C35 B;  4KY7 A;  2HQL A;  4GNX A;  3K6O A;  4QF4 A;  2EYH A;  3H91 A;  1HNZ Q;  3K5L A;  4ULL A;  3PF4 A;  1STN A;  5C4Z A;  3SXH A;  5EBD A;  3UDX A;  2UU9 Q;  5M5X B;  1ROD A;  2KCT A;  4HJ8 A;  4CDD C;  1SNO A;  2EQS A;  5C4X H;  2BA1 A;  3KLS X;  1SND A;  2ALY B;  4ME5 A;  4DV5 L;  2RKS A;  3KLR A;  1YVC A;  3S1R B;  2XWJ B;  4JI1 L;  5GRO A;  1B70 B;  4FXG C;  3HOU B;  2YTV A;  1GJX A;  1VQK A;  2L5T A;  1D5Z C;  1D5X C;  4YWM A;  1YNJ D;  3QO2 A;  1TVX A;  3SE0 A;  3D4D A;  4GLA C;  4GLX A;  1RKN A;  5M3F G;  4OX9 Q;  2K32 A;  3AFQ A;  1B3Q A;  1O7I A;  3ERQ A;  1KRT A;  4I65 A;  4LF8 L;  1IW7 D;  3HGB A;  3U4Z A;  2UXB Q;  3SK6 A;  2OWO A;  2A73 B;  2MPM A;  2NN6 G;  4NDX A;  5C3X A;  1I6H H;  1V43 A;  1B44 D;  1LTL A;  2R7D A;  1HTP A;  1C9O A;  3I56 A;  4IUT A;  5FLX E;  3T53 B;  4ZKB B;  5BN5 A;  3CCQ A;  1PLF A;  1PH6 A;  1BNZ A;  2KVM A;  4KN4 C;  4RWS C;  1Y1V B;  2JA5 H;  1GM5 A;  5C6A A;  3MHB A;  4B3M Q;  2K52 A;  1DON A;  2JJQ A;  4GLV B;  1XMO Q;  3M4O B; 
#chains in the Genus database with same CATH homology
 1S5C D;  3MAQ A;  4IAL A;  1JQY D;  3A8I E;  1DXM A;  3L3O C;  3K5N A;  3SDZ A;  4KI0 A;  1PTO F;  2NWG A;  4KV6 A;  1D1I A;  1B2T A;  1ENC A;  2D5D A;  3HKZ B;  1JC7 A;  4E6I A;  1C8C A;  5CYU A;  1K83 B;  1NAP A;  2C9O A;  5C4J B;  5EKK A;  5JEA H;  2F0H A;  2RSN A;  3NWS A;  4UDU C;  2EYF A;  1O7Y A;  3T51 B;  1CA6 A;  4B9X A;  5CV7 A;  2KCN A;  5CV4 A;  3QB3 A;  1O80 A;  1QWY A;  5EBC A;  1WTX A;  2A6H C;  2J7Z A;  1AN8 A;  5JPM C;  5G3L D;  4KK7 A;  3NHH A;  2A5H A;  2B8F A;  3BVZ A;  4EQO A;  2ID0 A;  3MFY A;  4H7B A;  1DZ1 A;  4J1M A;  3FMC A;  3R8B A;  4H13 C;  1A2U A;  1EIH A;  3CRK C;  3I3C A;  4RHS A;  1LV9 A;  1QNK A;  2K05 A;  1H9J A;  1G2S A;  1UEA B;  4B9W A;  1V1P A;  1LAB A;  1E2Z A;  3P75 A;  1Q1B A;  4PQX A;  4CHT B;  3I90 A;  1RTO A;  3SR1 A;  5IIF A;  4RAU C;  1JWU D;  1B50 A;  4CKB A;  2OF1 A;  4RKB A;  1LTR D;  1TU2 B;  2VXW A;  5FO8 B;  1HTL D;  5A35 A;  5C0X H;  4A93 B;  1SAP A;  3Q23 A;  1BCP B;  2XRS D;  4LMQ D;  4A3E B;  5COY A;  1ONL A;  3HOX B;  2PPB C;  4C3J B;  3JAM E;  1G29 1;  2R61 A;  2RBM A;  1B53 A;  2IJ0 A;  4PMB A;  2IW3 A;  1TII D;  1QCB D;  1OXU A;  2BDO A;  5KGU A;  4CJ2 C;  3I8Z A;  3IFT A;  4HN7 A;  4KTA A;  3QOL A;  4KJO A;  3KBX A;  2KEC A;  4DU9 A;  3J7A V;  3H6M A;  1EYC A;  2M00 A;  3E0J A;  5BN4 A;  4HMJ A;  3L9A X;  1Q3L A;  5M3M B;  1XX8 A;  1EQV A;  1MGS A;  4WRD A;  1FD7 D;  3NUC A;  5T1G A;  4DAP A;  1SE4 A;  1IYV A;  5I9P A;  3T4A C;  1BDO A;  2EY5 A;  2B2Y A;  4P2C B;  2FIN B;  4OIJ A;  3K58 A;  2NYZ D;  1XWE A;  2B8G A;  3CQZ B;  2EZV A;  1LT3 D;  1TS2 A;  5CV6 A;  2EPB A;  3MZ5 A;  4O1N A;  2FMC A;  5ELC A;  4K8I A;  2R7Z B;  3KUP A;  1EZ8 A;  1SEB D;  3Q0A A;  3EFX D;  2RDH A;  5C5M A;  1SYG A;  4PNY A;  1LT5 D;  3BYY B;  2O5J C;  3S1M B;  2K5Q A;  1V8Q A;  4PMC A;  1WTV A;  2X69 A;  1H9K A;  1CFM A;  3PO3 B;  3HS0 C;  1GXD C;  5IOD A;  1UNS A;  4C3H B;  4IUU A;  3H3V C;  3M7N A;  3MA2 B;  4F7X A;  3JAM L;  5DM7 3;  3MVV A;  2WKD A;  4V0B A;  3L7Z C;  4CKE A;  4CJ0 B;  3NP8 A;  3S9W A;  4ZRZ A;  1UUP A;  2F4I A;  1OO9 B;  2Q8T A;  2MHV A;  2IWH A;  1SFO B;  1ESF A;  2K5W A;  1G2T A;  1RF2 D;  1Q1E A;  3IFD A;  1L0Y B;  1Z6H A;  3J80 E;  4TRD A;  1Q12 A;  2F0I A;  4NMZ A;  3BZD B;  1PRT B;  2WKC A;  3I4M B;  5IGB A;  1TWA B;  3S1N B;  1D5M C;  2KEE A;  2R3Z A;  1CQV A;  2JXM B;  4QB4 A;  2R92 B;  1TS4 A;  5FO7 B;  1PXU A;  4ID6 A;  4OO1 H;  3BDO A;  4NP5 A;  1HXY D;  4BS9 A;  3TP7 A;  4A3B B;  5HGT A;  1GHK A;  3DEP A;  1LTA D;  1VF5 C;  4QMG A;  2SNS A;  4IUN A;  4RHR A;  2EYL A;  2ZXO A;  3FPU B;  2IX1 A;  2IT1 A;  5ISR A;  3GTK B;  4ABN A;  2B2Y C;  3G7L A;  4XQN A;  1JB3 A;  1IHZ A;  2V4D A;  2L11 A;  5IGF A;  3TZU A;  1LTG D;  5EJW A;  4QIW B;  5DAU A;  2A69 C;  4K2K A;  3GTM B;  5IOC A;  4L63 B;  1HHV A;  4Y7N B;  4FF4 A;  1ILP A;  1SE2 A;  2XN9 C;  3DWP A;  4R9W A;  4BWG B;  1K8M A;  1S5F D;  5M9O A;  3SVM A;  2BE5 D;  3CKI B;  1M8A A;  1EFI D;  3ND9 A;  3LWU A;  5JVH 3;  3DEO A;  1PMR A;  3PUY A;  1RDP D;  1PTO D;  4KD4 A;  2CVR A;  1AZQ A;  4J6H A;  3A7A B;  1ZKO A;  2PO4 A;  1I6H B;  3A7L A;  3VR5 A;  4CGY B;  1HUN A;  3OSO A;  4NW2 A;  2NVY B;  4K6L A;  1FGB D;  1WTO A;  4RFB A;  2JA5 B;  2VB2 X;  1FYC A;  1GHJ A;  1G8Z D;  1ESR A;  5JPN C;  3RD4 A;  4K8J A;  1KDB A;  2NN6 H;  1BBX C;  2QDB A;  3J80 L;  3GTL B;  3HOV B;  4WOR A;  5F2D A;  1F9P A;  2QF7 A;  4S3S A;  4C1N I;  3S2D B;  2TMP A;  1ET6 A;  2WIN B;  4DN4 M;  2E76 C;  1HFN A;  2FJ2 A;  4IFD J;  1A3T A;  2O5I C;  1S5B D;  4TKO B;  4KY6 A;  1B4O A;  4DNT B;  4LK1 C;  1JWM D;  2FMM A;  3U9S A;  5K5P A;  2NUC A;  2KCC A;  4RH6 A;  1LAC A;  1LTB D;  5IGD A;  3GP7 A;  4FF1 A;  5LL6 X;  1K8O A;  2AWO A;  4DAV A;  3C1E A;  4A3J B;  2F1M A;  1SMY C;  3D6C A;  1H9M A;  2NZ1 D;  3QOJ A;  2R93 B;  4BY7 B;  3D8G A;  3GTG B;  3C1F A;  3Q24 A;  2OT2 A;  3MFG A;  4I7Z C;  1EOT A;  2CQA A;  2E2J B;  3J7Y W;  1RJT A;  1E2V A;  3MWY W;  3MEH A;  4O42 A;  3ND8 A;  3I91 A;  3DMU A;  3NQT A;  1EEF D;  1KDA A;  2KJX A;  1Y69 U;  3QG1 A;  5CC4 A;  5C3W A;  4H44 C;  3NQI A;  3OMG A;  2A6H D;  5ELF A;  4X3S A;  1S5E D;  2K1B A;  4IFD G;  2K6A A;  5E4W C;  4CJ1 B;  1VF7 A;  3SEB A;  2K28 A;  5NUC A;  2RDF A;  2EY2 A;  1STH A;  1V1O A;  1LO5 D;  3S17 B;  1RD9 D;  3DHQ A;  3DWQ A;  5CGK A;  1Y1W B;  1D6E C;  3DXJ C;  3OOC A;  1DCZ A;  5LL6 S;  3DUZ A;  4U68 A;  4DNR B;  3CU7 A;  3EVQ A;  5CV9 A;  1XYI A;  3V96 A;  1HA5 A;  1D1K A;  4BBR B;  1NSN S;  1RCV D;  3MXP A;  3WOF A;  4N9T A;  1H9S B;  3BS1 A;  3MXN A;  3NBH A;  3SHL A;  2HQE A;  2LFN A;  4XT1 B;  4F87 A;  2MGS A;  3HOZ B;  2AQ2 B;  5AFW A;  1G6Z A;  3GV3 A;  4HED A;  4Z9C B;  2ENB A;  2QIL A;  1SDF A;  4WJW A;  1EYA A;  1WTW A;  1Z47 A;  3LWE A;  1EY5 A;  1I4R A;  2OXP A;  4XYO A;  2KHS A;  1EY8 A;  3P1H A;  2IL8 A;  1X3P A;  1HRJ A;  4XQQ A;  3OIP A;  2N88 A;  2HCC A;  3CRL C;  1B1Z A;  1BQQ T;  3FRP B;  2HUG A;  3G6J B;  4RA8 A;  1MSG A;  1STE A;  2F0F A;  5KIX A;  1XTC D;  4RGN A;  3AU7 A;  1IYU A;  1VDZ A;  1STB A;  4C3I B;  1I3Q B;  4G7H C;  4EGV A;  3NPP A;  5HUR A;  1JOO A;  1PZK D;  5CR3 A;  2F0N A;  4ZUJ A;  3NXW A;  4OL7 A;  4DXF A;  4A3G B;  2F0M A;  2F0V A;  2CW0 C;  3MXG A;  3K5M A;  2ZXP A;  1F2Y A;  1KLG D;  4KN7 C;  1KNA A;  3NSW A;  2PZW A;  1EY4 A;  4L8J A;  5CBA E;  5FLX L;  5FO9 B;  5I6Y A;  2EYP A;  2SNM A;  3VR6 A;  1FNU A;  3T16 A;  1MBY A;  4IZ8 A;  2HDM A;  1GUT A;  1QIL A;  4HSV A;  1PFM A;  3P7J A;  3HP3 A;  4A3F B;  1HCZ A;  1X32 A;  3I70 A;  1YNN C;  4MHE A;  3VR2 A;  3ITP A;  3R93 A;  4ZLT F;  1DOM A;  1VMP A;  1B3A A;  1SYC A;  1LLR D;  2ZXR A;  1F2M A;  2L1B A;  2EY6 A;  3GO5 A;  3VYU A;  5D14 A;  1GUW A;  2GA4 B;  4V19 0;  2E2H B;  2B2V A;  2JA7 B;  2EE1 A;  1U9R A;  1J9O A;  2WB1 B;  3BDL A;  4OO1 I;  2H1E A;  1SNP A;  1TS5 A;  4XXE A;  1EIG A;  3S15 B;  3N6R A;  2JEB I;  1T5E A;  1RTN A;  3TBI B;  2Z4H A;  2Z1C A;  5ELB A;  4QCL A;  4KKS A;  3K5O A;  2D2C C;  3M4Y A;  3HRZ C;  5C3E B;  1SNC A;  3I72 A;  2RSO A;  1HUM A;  3VR3 A;  3FKI B;  5FOB B;  3TN2 A;  1CK1 A;  5C44 B;  4C56 C;  1FR3 A;  2F0P A;  4ZKC B;  3R2I A;  2NTT A;  1JWS D;  4ZK9 B;  3HOY B;  3SK5 A;  4DK1 A;  4DF7 A;  4HMI A;  2DNE A;  5K36 G;  4KKT A;  5D65 A;  2QCP X;  2BA0 A;  3VA5 A;  1PTO B;  4XTC S;  2MP1 A;  3PMF A;  4KKU A;  1U4P A;  1EZ6 A;  2PMZ B;  1Y8O B;  4K6D A;  5I9O A;  5COR A;  1SNM A;  5M3F B;  3EJI A;  1AP0 A;  2A69 D;  1QNU A;  1I4H A;  1WD0 A;  3PV0 A;  4DXG A;  3TZD A;  2NN6 I;  3V2T A;  3AB9 A;  4A3M B;  1JOR A;  2LMC B;  5EGT A;  1WCM B;  1JR0 D;  3FDT A;  1A6X A;  3TP6 A;  3TP5 A;  5EPK A;  1B9M A;  1WTR A;  1OXX K;  2G9D A;  2JP1 A;  2SEB D;  1IKM A;  3RMH A;  1JE4 A;  1WD1 A;  1C4Q A;  2VUM B;  2JYO A;  1BO0 A;  2XWB B;  3I4N B;  4XYQ A;  2RA4 A;  3ONA B;  4ZUI A;  1KDC A;  5CV5 A;  5KYI A;  4A3K B;  3MXU A;  5EPL A;  2DNC A;  4Q5V A;  2F0W A;  3T56 B;  2B2V C;  5I6W A;  3RZD B;  2AQ1 B;  2B2U A;  2XVS A;  3KBG A;  1WTP A;  1EL0 A;  2RVL A;  1DM0 B;  2RQX A;  4FF2 A;  3D4W A;  1H9R A;  3NK9 A;  2HDL A;  1STG A;  1TQO A;  3NWT A;  5T1I A;  2Z8L A;  1PZJ D;  1C48 A;  2KOL A;  2MJ8 A;  5C4X B;  1DD2 A;  1TR5 A;  4C3I G;  1TKW B;  2QEJ C;  1J8I A;  2EJG C;  1F77 A;  1II3 A;  3D6W A;  3PUW A;  3FEW X;  2F3V A;  4DK0 A;  4FP5 D;  5ELE A;  2IX3 A;  1NCV A;  1OXS C;  4KJN A;  3A55 A;  1XXG A;  4PV1 C;  2WP8 J;  2BCO A;  3RUZ A;  5I2X A;  1F2L A;  1BCP C;  4PMW A;  1Q8I A;  1QOH A;  1SMY D;  1Y8N B;  1W6K A;  5KNB A;  1ENA A;  1T5X D;  3TME A;  4C3J G;  3A54 A;  5IGG A;  1LTI D;  4RGT A;  4IFD H;  4RCN A;  1CM9 A;  1CA5 A;  4LAA A;  1D2B A;  1EWC A;  5DNF A;  2M2L A;  1EU3 A;  2SDF A;  2DY7 A;  1QB5 D;  3C46 A;  3F2U A;  1BF4 A;  2JA8 B;  3C2P A;  5EPJ A;  4HCE A;  1EU4 A;  4C2M B;  5C4H A;  4FNF A;  3TSS A;  3C3L A;  4A3D B;  1EEI D;  3URY A;  3IAY A;  2F0U A;  2A6E C;  4FXK C;  2KED A;  2PNR C;  1ZYR C;  2A68 C;  2D9U A;  2K7V A;  1SJH D;  1VMC A;  2L4N A;  2K03 A;  2K33 A;  1U4M A;  1GOZ A;  3HEJ A;  3A8K E;  1SYF A;  2NVT B;  3KLS A;  4HSP A;  2K04 A;  1CI3 M;  3X3M A;  1EYD A;  2I46 A;  2A74 C;  1MD2 D;  4AYB B;  1X3Q A;  1BCP F;  2PZT A;  5I4D A;  3HG9 A;  2E2I B;  2B2U C;  1MI2 A;  4FXD A;  3KF8 A;  1GUO A;  4ZYS A;  3WOE A;  1PDQ A;  2F0K A;  1SYB A;  1M4V A;  1EY0 A;  2B2T A;  5E1F A;  5I2Y A;  1I4P A;  1ET9 A;  3M3Y B;  2E75 C;  1ZXT A;  1QE6 A;  4HAE A;  3TP8 A;  1IKL A;  1TWC B;  4OGQ C;  1FNW A;  4B08 A;  3VA7 A;  3QJY A;  1HFG A;  4JBW A;  2EY1 A;  1CTM A;  3ERO A;  2JA6 B;  3RZO B;  1VCI A;  3H09 A;  4C3H G;  4BY1 B;  4NKL A;  1F9R A;  1KTK A;  5C0X I;  1CQF A;  3NTI A;  3J7A F;  2D62 A;  4DFA A;  4ZAI A;  1ZEQ X;  1ENF A;  1JOK A;  5C5L A;  1EY6 A;  1Y8P B;  4QUF A;  2WV6 D;  5CBE E;  2EYO A;  1PYW D;  4K2L A;  3X3N A;  1PRT C;  1WTQ A;  2BDN A;  3UI2 A;  4KMU C;  2O2L D;  3Q22 A;  1JOQ A;  3OW7 A;  1V1P B;  1CHQ D;  2B2W A;  2CW0 D;  3R2T A;  4KY5 A;  1BOS A;  1QJO A;  4DAY A;  2PW5 A;  3BYT B;  1FNV A;  4G7O C;  2XSC A;  2LY7 A;  1R9T B;  1BUV T;  3IKJ A;  2L12 A;  2EJM A;  1GUG A;  1LT4 D;  5J1Z A;  2EDG A;  3DM1 A;  3SK4 A;  2PW7 A;  3SK8 A;  4BA1 I;  5ELD A;  1UAP A;  1YNN D;  3GTQ B;  5M5Y B;  2PQE A;  1TY2 A;  1HA6 A;  5CV8 A;  3I73 A;  4ILW A;  4IQZ A;  4X3U A;  2F3W A;  1YNJ C;  4XT3 B;  2NBF A;  1NR4 A;  3EQL C;  5JVG 3;  1ML0 D;  1E0B A;  1KNE A;  2EJF C;  2WII B;  3H94 A;  4KHZ A;  1IW7 C;  4DGZ A;  5J22 A;  4G57 A;  3OIQ A;  5JEA J;  2F0G A;  1JCK B;  4K5W A;  5EQ0 A;  4G7Z C;  1PRT F;  3EA6 A;  3ZYY X;  4TSS A;  3M85 A;  2R6G A;  4ZQ3 A;  1HQR D;  2B2T C;  1BR9 A;  3V05 A;  5A2Q E;  4CBV A;  3OWF A;  1I4G A;  4LJZ C;  3HOW B;  2QKI C;  1STA A;  2XNA C;  3A56 A;  3VYT A;  5K36 H;  3S2H B;  1I6V C;  2VB3 X;  2JSO A;  3J81 E;  1EWH A;  2VNU D;  2F0L A;  1RHP A;  1S4Z A;  3LX0 A;  1H9S A;  2MUY A;  4CKC A;  4K14 A;  2J4X A;  1KLU D;  4IN3 A;  1F2Z A;  3A8J E;  2Q8I B;  2IPK D;  1PZI D;  5M5W B;  3K59 A;  2LS0 1;  1WVL A;  5LHY 1;  4N9P A;  2L55 A;  2O4X A;  1U4R A;  4FF3 A;  2Y0S B;  4MIU A;  3I4L A;  3T13 A;  5KNC A;  3H0G B;  1I4Q A;  3PUV A;  4C1N K;  2AUK A;  4OIK A;  2WAC A;  3RLF A;  4Q0F A;  4U67 3;  3N52 A;  3GQB A;  1SJE D;  5JOB A;  5JEA G;  4QUC A;  2RDG A;  2B2W C;  1A3U A;  5C0X J;  4FO2 A;  1SE3 A;  3GV6 A;  2WAQ B;  2CHB D;  3M7G A;  1DOK A;  5EKL A;  5IT9 E;  1DJR D;  2EYM A;  2NB0 A;  2YYZ A;  3VYR A;  2KQ3 A;  2HCI A;  2PYK A;  1KAB A;  2YU9 B;  3W3A A;  1MSH A;  3CHB D;  2KA7 A;  1QG7 A;  2F0J A;  2XIW A;  2F03 A;  1LTS D;  2G9H D;  5JAV A;  1JIC A;  2XRQ D;  4J8Q A;  2F0D A;  1TWG B;  3HZX A;  4HR7 B;  1TT2 A;  1TS3 A;  2TSS A;  2ICE C;  3OWE B;  2L9H A;  4EQP A;  3D4R A;  5KND A;  2AUJ D;  2AQ3 B;  1EY7 A;  5DM6 3;  2Z4I A;  1ICW A;  3FPP A;  5A2Q L;  1AW7 A;  3MC0 B;  2JEA I;  2F0Q A;  2K5D A;  4EVO A;  3P20 A;  1A15 A;  3S1Q B;  1HQM C;  1SNQ A;  3IL8 A;  1CHP D;  3J81 L;  2K01 A;  4XIG S;  1Z7T A;  3QIA A;  3U9O A;  5J39 A;  5G3L F;  4DA2 A;  3AMU A;  5EKI A;  5C0X G;  3VYS A;  1GUS A;  4R8I A;  3TDQ A;  4ODG A;  1S5D D;  2PCF B;  1G91 A;  1AZP A;  1CT1 D;  5TSS A;  4IFD I;  3DWA A;  3O13 A;  3R3O A;  5DEH A;  1NUC A;  2EYJ A;  5IGC A;  4RCO A;  4M8A A;  3K0Y A;  4X3K A;  1LTT D;  2I07 B;  4XDX A;  2NVQ B;  3S14 B;  3Q6S A;  4JK1 C;  3BDC A;  3GTO B;  3PIP 3;  3MTS A;  1LT6 D;  1AFP A;  1BCP D;  4IUV A;  2F0T A;  2ZT9 C;  5E3F A;  4X3T A;  2PZU A;  2E74 C;  1PFB A;  5CMD A;  5IT9 L;  3KK7 A;  1U4L A;  1HPC A;  2LKV A;  5FKA C;  4OHJ A;  1TWF B;  1I4X A;  4R8N A;  1TY0 A;  1PFN A;  4RGO S;  5KRU A;  1I50 B;  3PUZ A;  2H4O A;  4MN3 A;  3NTK A;  2B63 B;  4RKL A;  2FFK B;  1O7L A;  1IL8 A;  2F0O A;  2NVX B;  3S16 B;  1DOL A;  2A6E D;  4FVM A;  2N55 A;  1SYD A;  1SSO A;  2X6G A;  3W2D A;  1ZYR D;  2A68 D;  4HCS A;  5FK9 C;  3LNN A;  2X6L A;  3PUX A;  3NTH A;  4IUR A;  4WFN 3;  3GD7 A;  1STY A;  4FYD A;  4KHV A;  2JE6 I;  3D31 A;  1BXT A;  3BG3 A;  3D3R A;  2E2D C;  1L0X B;  1F9S A;  1F9Q A;  4F8M A;  1EY9 A;  4K5X A;  2F0E A;  2EXZ A;  2AWN A;  4A3I B;  1KAA A;  1NR2 A;  1SYE A;  1E2W A;  3OPO A;  1A2T A;  1CZG A;  1PTO H;  2EVB A;  4XQJ A;  5KYL A;  2EOT A;  2KUM A;  1O7Z A;  2NTS A;  1DYQ A;  1SXT A;  2DY8 A;  1AEX A;  4RGM A;  2M9V A;  1R4P B;  3NE5 B;  1TWH B;  3E5S A;  5E4X A;  4UAI A;  3FVQ A;  2OEO A;  4BA2 I;  1OXV A;  2IX0 A;  3GTJ B;  5D3I B;  5BN3 A;  3K7A B;  5IGE A;  3WDN A;  3PO2 B;  1O78 A;  2BOS A;  4M1U B;  3OMC A;  4IUQ A;  1CZW A;  4HTH A;  2F0S A;  4OO1 G;  3BVG A;  1ILQ A;  4BBS B;  4EQN A;  2B39 A;  4F88 A;  1GUN A;  4KD3 A;  5D3D A;  1OXT A;  3OHX C;  1Q90 A;  5KEE A;  3E6Z X;  4YIJ A;  4G4K A;  1PRT D;  1A3V A;  3QWN A;  3PIO 3;  1R4Q B;  2SOB A;  3VR4 A;  4IUP A;  1EQT A;  3NBI A;  4L6T B;  3GTP B;  2J0T D;  4TQU S;  2FHT A;  2BE5 C;  2Q8R E;  2ICI A;  1W6J A;  4K5V A;  2L0C A;  3BVM A;  2C5C A;  3K57 A;  1B9N A;  1SBB B;  4GZY C;  4H0L C;  1PTO C;  5JJZ A;  2DN8 A;  4KY7 A;  3K6O A;  4QF4 A;  2EYH A;  3H91 A;  3K5L A;  4ULL A;  1STN A;  5C4Z A;  3SXH A;  5EBD A;  5M5X B;  1ROD A;  1SNO A;  2BA1 A;  3KLS X;  1SND A;  4ME5 A;  2RKS A;  3KLR A;  3S1R B;  2XWJ B;  4FXG C;  3HOU B;  1GJX A;  2L5T A;  1D5Z C;  1D5X C;  1YNJ D;  3QO2 A;  1TVX A;  3SE0 A;  3D4D A;  1RKN A;  2K32 A;  3ERQ A;  4I65 A;  1IW7 D;  3HGB A;  3SK6 A;  2A73 B;  2MPM A;  2NN6 G;  4NDX A;  5C3X A;  1V43 A;  1B44 D;  1HTP A;  4IUT A;  5FLX E;  3T53 B;  4ZKB B;  5BN5 A;  1PLF A;  1BNZ A;  2KVM A;  4KN4 C;  4RWS C;  1Y1V B;  5C6A A;  3MHB A;  1DON A;  3M4O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...