3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
1FYCA 1PMRA 2A69C 2NN6H 3M7NA 3I72A 3PUWA 1IW7C 5BN3A 2EJFC 4DNRB 1Q90A 1TKWB 2PCFB 1DD2A 2O5JC 5BN4A 3SE0A 3T56B 4OGQC 2B8FA 1T5EA 3SDZA 1IYUA 1GUTA 2E74C 3DXJC 3QG1A 4H13C 3U9SA 2E76C 3TZUA 1HQMC 2B8GA 2IT1A 2KCCA 2JE6I 5JEAG 1VCIA 5C0XG 5K36H 3L7ZC 4KN4C 3A7AB 2O5IC 1DCZA 5KNCA 4KKUA 2D62A 2EDGA 1OXVA 3BDOA 4JK1C 4KMUC 3ND9A 2KA7A 1VDZA 2E75C 4L8JA 3OW7A 1HCZA 1FR3A 1IW7D 4DK0A 1OXUA 2LMCB 1OXTA 3AB9A 3HGBA 4H44C 3P20A 4OO1H 4KN7C 3I73A 2L5TA 3ND8A 1Q1EA 4H0LC 1K8MA 3IKJA 4KKSA 3A8JE 2QF7A 4KKTA 5BN5A 4IFDH 3GD7A 3RLFA 1YNNC 2NN6G 2BE5D 3NE5B 2YYZA 3MXUA 1BDOA 4LJZC 4IQZA 1V43A 2BA0A 3M85A 1Z7TA 4TKOB 1VF7A 2A68D 2JEAI 1CFMA 2K32A 2DNCA 1OXXK 1GUNA 2BE5C 1Y8PB 3QIAA 3M4YA 5K36G 4G7ZC 1EWHA 1Y8NB 1SMYC 2JXMB 3T51B 2A68C 2K33A 2K7VA 3W3AA 3GQBA 1LACA 3LWUA 1K8OA 1GUOA 1TU2B 3CRLC 1HPCA 3FPPA 1Y69U 2DN8A 2Q8IB 1H9MA 3PV0A 2PNRC 4HR7B 4OO1G 3OOCA 4KI0A 4XTCS 3PUXA 4DK1A 2A6EC 1DXMA 2AWOA 4IFDG 2D2CC 2EJMA 3N6RA 1Y8OB 1E2ZA 3CRKC 2PPBC 3VR5A 1OXSC 2R6GA 4XIGS 5C0XH 2DNEA 1ZKOA 2EVBA 3VA7A 2A6HC 3PUZA 1V8QA 3D31A 1O7LA 3KLRA 3WDNA 1CI3M 4I7ZC 4DNTB 3D4RA 3VR4A 1H9JA 1Z6HA 1VF5C 1GUSA 1A6XA 2BA1A 3EQLC 4KHZA 2CW0C 3PUVA 2A6ED 3A8IE 3FMCA 2BDOA 1E2VA 5KNDA 2V4DA 3IFTA 2F1MA 3A8KE 3VR2A 2ZT9C 4G7OC 3T53B 3H94A 5A35A 3MFYA 3QJYA 4G7HC 2AUKA 2EJGC 2A6HD 5KNBA 1GUGA 1G291 2AUJD 2NN6I 3BG3A 2JEBI 1O78A 1B9NA 3A7LA 1IYVA 3LNNA 5JEAH 1Q12A 4RCNA 1H9SB 1LABA 1H9SA 1ZYRC 1GHJA 3I4LA 3OPOA 3VR3A 4LK1C 3PUYA 1CTMA 1E2WA 4TQUS 4BA2I 4GZYC 1GJXA 4BA1I 4PV1C 1H9RA 2A69D 2D5DA 1H9KA 1YNJC 1ONLA 1GHKA 1B9MA 1QJOA 3VR6A 4JBWA 1Q1BA 1I6VC 1HTPA
chains in the Genus database with same CATH superfamily
1P16A 4S3SA 2G5DA 5C6AA 1EY9A 4X62L 5EGTA 3MHBA 4GNXA 3M3YH 1PTOF 4A3IB 2KHJA 2DJGC 1IBLL 1EL0A 5CR3A 1IYUA 2F03A 3S1RB 3CP0A 2QCPX 4A3DH 2CH4W 4QIWB 3HKZG 1QILA 1MJCA 2CVRA 4QUCA 1PTOH 1WTHA 5LL6S 3IFDA 4A3MH 4LF9L 4NP5A 2FMCA 3SEBA 5J3BA 4PNYA 1UNSA 5T1GA 5C3WA 1O7ZA 2NN6G 1Z9FA 4DK3C 2B63B 5C4HA 2K14A 2L1BA 4IFDI 2LFNA 5EKIA 3Q22A 1YEZA 1VMCA 4FXGC 3QB3A 1NY4A 1B3AA 3QIAA 2AMCB 1Y8NB 2K33A 3MXGA 3GTMB 1LACA 1YNND 2L0CA 1S5ED 5IT9E 4EX5A 3F1ZA 1WVLA 2WINB 3NTIA 4YHHQ 3C1EA 4C56C 1RD9D 3Q0AA 2F0FA 4WORA 2EJMA 3KDFA 5KIXA 3CRKC 1S72A 3VR5A 4DUYQ 3KLWA 2R7ZB 4B9XA 4IUVA 3HOZH 4A3FG 1NMGA 5M3FB 4KHZA 4OL7A 2V1CC 1E2VA 2E2HH 2F0QA 1QZGA 4K5WA 2VL6A 2ZT9C 3M9BA 3T53B 3H3VC 1JB3A 4XQNA 1XNRQ 2VUMB 5IYDH 4Y52H 2LS01 2EYOA 1W6JA 2F0NA 3TBIB 4QGUA 4A3GH 3BG3A 2CWAA 3KDFB 3CPWA 1O78A 4TVAB 2TMPA 5IYBG 5JEAH 2X6GA 4DV6Q 5H1SE 5IWAQ 1I5FA 2K75A 3FPUB 3ULLA 5CMDA 2A19A 2AHOB 1KQSA 2VNUD 2K5NA 1E22A 2IL8A 4DR5Q 4K0KQ 1X3QA 4A3BG 3L0OA 4X3UA 1BCPB 2K04A 3GTGB 1TWCH 3TP5A 3HOYB 1EU4A 2E2IH 1TR5A 4LAAA 4EQ5A 3K7AB 3MWYW 4BBRH 3HOXB 2IT1A 3I8ZA 3CCJA 4NB3A 2EYMA 3JAMi 1MSGA 4KKUA 4KMUC 1VQFA 2IHEA 4ODGA 1TY0A 3RLOA 4QL5A 1WCMB 1X54A 4B3SQ 2MO0A 4HMIA 4YHHL 1EFWA 1NNXA 3R8BA 1I50B 2BE5D 3EFXD 4DUYL 3CCSA 1PH7A 1KAWA 1XYIA 4RKLA 5E4XA 2J0TD 1HR0W 5IY0A 4BBSB 5JVH3 2RVLA 2WFWA 1SROA 4U68A 1RHPA 1RIPA 4A3DG 3GTJH 3S1QH 1DM0B 4PMCA 4QF4A 3CRLC 1HPCA 3TQYA 1D5XC 4JYAQ 1B4OA 3A74A 4POGA 4PZ6A 2E5LQ 2NVTB 4A3MG 4XTCS 5JJZA 4IPCA 2AWOA 5FO9B 1HZBA 1QE6A 1PH9A 2PMZE 4IN3A 4DR6Q 3RZOH 2R92B 4DV6L 3D8GA 1ZKOA 2I5MX 4IALA 4KHPL 2HIVA 1S5BD 2ZTEA 4WRDA 5EKLA 1SDFA 1GUSA 1HR0Q 1PZKD 3S16H 4K0KL 2YTVA 1IBKQ 4KK7A 3S2DB 3MEHA 1VQ6A 4DV7Q 3GTGH 2R93B 2PYKA 5KNBA 1G291 4FYDA 1C9OA 1PH1A 2UUAQ 3ONAB 3PCOB 2NZHA 5M5WB 1ZYRC 1DZ1A 3W5OA 3G7LA 3J80i 5ISRA 4K6DA 5IIFA 1I94Q 1YNJC 3HOZG 1SE3A 2N55A 4CDDC 2ZJQA 1IXRA 2EZVA 2N78A 1FYCA 1OO9B 2F4IA 2A69C 2RQXA 3IRBA 4L5RC 3J81c 3EA6A 3K6OA 4K5VA 1Q90A 5IYDG 4P75A 2X6LA 5DLQE 2VXWA 1XMOQ 4CDCC 5IGGA 1MKHA 3H3VI 4H13C 3KLSX 1HQMC 4OX9Q 1J5EQ 2K6AA 5JEAG 4LUVA 1L0YB 2HUGA 3BS1A 2KECA 2AWNA 3BDOA 5M9OA 2E5LL 3FHWA 3OIPA 4IJHA 3P20A 5M5XH 4KN7C 2F0KA 3NENA 4OWWB 4DXGA 1JWUD 2KCNA 1HNWQ 1VQHA 2HD3A 2SEBD 3TZDA 2G9HD 4AYBG 1VQCA 5EAYA 2YYZA 4HJ8A 3HOWB 1BDOA 3M85A 4LF7L 1Y1WH 3I7FA 2JK8A 3VA5A 1I4XA 4C3JH 4BBRG 1PH8A 1B8AA 1EWHA 4OEMB 1HR0L 1SJHD 2H1EA 1SMYC 1HA6A 5CV9A 1LTGD 4L5SA 5ELNA 3Q8DA 1SYBA 4EQOA 2WACA 1U5KA 4DV7L 1I6HB 3RUZA 1SFOB 2EY6A 2A6EC 1EY5A 2B2YC 3FRPB 1SEBD 1E2ZA 4LUZA 1ENCA 2UUAL 1ASZA 2NVQH 1YJ9A 2XNAC 3TREA 1PRTF 1VQJA 2FMMA 3J7AF 3AFPA 4DU9A 3S24A 1I94L 3I70A 1A6XA 4HJ5A 1CQVA 3CF5A 4YWMA 3HOUH 3OIQA 5C3EH 3S17H 5TSSA 3VR2A 1QVFA 1Q46A 4O2DA 2JA6H 2AUKA 1FL0A 5M3MG 4LWCA 5IP7H 2D9UA 2OXPA 3FKIH 4OX9L 1HZAA 3CHBD 4RCOA 1QUQA 3AEVA 2F0EA 1LABA 1X3PA 1LT6D 2K5HA 1A62A 2IWHA 3F2CA 1R9TB 2OF1A 4Q5VA 3HOVB 1AEXA 2R7FA 2ZJRA 1PFBA 2BDNA 2JQOA 5HURA 4N9PA 2IW3A 3VYRA 1NAPA 2YTXA 2L9HA 1N33Q 1BO0A 2F0JA 2EIFA 2D0PA 2FFKB 1EZ6A 1YHQA 2EJFC 5JOBA 2F0LA 1CKMA 1AZQA 2EE1A 3DXJC 3ITPA 4QUFA 3S2HH 2EY1A 1QUQB 3I4NB 3S14B 3NPPA 3L7ZC 4LFCQ 5CBAE 1SNPA 2MGSA 1FNWA 2K01A 2KA7A 2WB1E 3J81j 1YZ6A 1BOSA 3E3XA 2KEEA 1G51A 4XXEA 1E24A 1OXUA 3HKZE 1PYBA 1X9NA 4OO1H 5DAUA 3TN2A 4LW1A 1A3VA 2UXDQ 4FF2A 2NYZD 3CC7A 3DMUA 4K2LA 1F77A 3PO3H 3GDEA 1AW7A 1TQOA 1D6EC 4UPAA 1OXXK 1GOZA 5FOBB 1TWHB 2A68C 4ZKBB 1E1OA 3RN5A 1NUCA 1TU2B 1AFPA 1MBYA 1X55A 4FXKC 2B2YA 2WKCA 5C4XH 4CJ1B 1VQ9A 2PQEA 3SGIA 5FO7B 3M4PA 2WB1B 1OXSC 4QQBX 4QB4A 4DAPA 1Y1WG 1PFMA 4FO2A 4AH6A 2EYHA 2MO1A 2KCTA 3ULJA 1L2FA 1F2MA 4K6LA 1NTGA 3STBC 3Q23A 4LUOA 2NTTA 2VW9A 1N33L 3R93A 3I56A 2RKSA 4ULLA 2RHQB 4X3SA 3MFYA 3HRZC 1EOVA 2AUJD 2NN6I 2GA4B 4IUUA 1NCVA 3H09A 1GHJA 1B50A 1AE3A 2PNHA 5D3IB 1ESFA 2F0PA 3SK5A 5EPKA 1EQQA 4UP7A 4NXMQ 4RGNA 3GTOB 3OYYA 4F8MA 4GOPC 3HOUG 3TS2A 5C3EG 2UXDL 3M4OH 1PMRA 3SK8A 1SNQA 3NBIA 3M7NA 4A3KH 1IBMQ 4DNRB 2JA6G 5GADC 4A93B 5IP7G 3T1YQ 1GUTA 4DV2L 1AP0A 3FKIG 2F0HA 3JAME 4UY8C 2CWPA 3SK6A 3A7AB 1EYCA 4ZLTF 3S15H 3ND9A 4UAIA 1FR3A 3QOLA 4EQPA 1K9MC 4R4IA 2ES2A 4H44C 1STBA 2Q2HA 4R4CA 3A8JE 1SR3A 3PGZA 3U58A 2XN9C 4DF7A 1FVIA 3NSWA 3J81i 1B3QA 3UDFA 2Z8LA 4O1NA 3G4SA 2DGYA 3FP9A 4A3EG 3BU2A 3S1MB 4WJ3M 5IGCA 2A5HA 2DN8A 1V1QA 4OO1G 4X64Q 5GAGC 1PLFA 1F9SA 5ELEA 3PO3G 4XIGS 1HH2P 4J15A 5E7NA 4LFBL 2K05A 4IOAA 1QNKA 1O7LA 1WYDA 2CQAA 4NXML 4I7AA 1VF5C 5DEHA 2EY5A 1I4PA 4HCSA 2UXBQ 3ERQA 4G4KA 2BDOA 1VQOA 1STHA 4OWXB 4LF8Q 5KNDA 3F2DA 2ATWA 1IL2A 1PH2A 1YJNA 4GN3B 3V96A 1VQ8A 3GTKH 3S1NH 3VYTA 3NWTA 2Y0SG 5C4XG 1VQDA 1VQPA 1HNZQ 3T1YL 4B3MQ 1JMCA 1CHPD 4IJLA 3MZ5A 3PIPA 3VR3A 1H9SA 4MZ9A 3J80E 1LYLA 3PO2H 1D5MC 4PV1C 2A69D 2WAQG 4QMGA 2F3VA 2F3WA 1ONLA 4GOPA 4V190 3DWQA 3NUCA 1LT3D 1KDAA 4C3HH 4BWGB 1HA5A 3BDLA 3O13A 2RCFA 4DV5L 3BZDB 3N52A 4C1NI 3CMAA 4YY3L 1Y14B 1BCPC 1CK1A 2LSSA 1RF2D 5BN4A 2GVAA 1PH6A 1QB5D 3SDZA 1G8ZD 3QG1A 1IKMA 4ZUIA 5C0XG 1K83H 5LMNL 1HFNA 2I46A 3C3LA 3T13A 4LMQD 2KUMA 3OMCA 4L8JA 4FXDA 2MFIA 3KF6B 4X3TA 3BVZA 2L11A 2ASBA 4DR2Q 1WOCA 2XWJB 4JI4Q 2Z1CA 3AQQA 4X64L 3V05A 4KKSA 3P75A 1UE5A 4DV4Q 4GLAC 4A3KG 1DOMA 1P8LA 4X65Q 4ZQ3A 4L6TB 1Y1VH 2ID0A 1SMYD 4AYBE 3H6MA 3J7ZC 2UUCQ 1IL8A 4A3JB 4BY7B 4O42A 4HMJA 3AFQA 4OONA 2JXMB 2A74C 5E4WC 4JBJA 3T51B 2K7VA 4LF8L 3UE0A 4R4TA 3G48A 1AZPA 2PNRC 1E7ZA 2KOLA 5ELCA 4PG3A 2UXCQ 1JT8A 1HNZL 4RHSA 2OQ0A 1BQQT 1KABA 1T9HA 1UEBA 3H0GB 1YI2A 3X3MA 2DNEA 4OIKA 4HJ9A 3G71A 4DNTB 3D4RA 3FVQA 1ILPA 1C48A 4X6AH 1QCBD 4HJ7A 1NE3A 3GV3A 3R3OA 1KRTA 4ALPA 1I3QB 2F52A 2LY7A 3K58A 2JA5B 4R8IA 4YCWA 2NVXB 1R4QB 4Y7NH 1VMPA 2DUDA 1BBWA 4JV5Q 1LTAD 4OIJA 3E0EA 2PW5A 1JB7A 3D4WA 1LTID 1SXTA 2Q8TA 2VQEQ 2OWOA 4X66Q 2NZOA 5J39A 2JA7H 5FJ8H 4HSPA 4KJNA 1KLUD 1WTXA 4DR2L 1B9MA 2ICEC 4JBWA 3MXPA 3VYSA 1I6VC 2VY3A 3E5SA 2K28A 4ILWA 1E1TA 4U673 5JVG3 4DV4L 3HEJA 1LV9A 3CPFA 1UAPA 1HQRD 5IODA 3KJOA 1EY8A 2PCFB 1BUVT 4ABNA 4A3IH 4NPSA 5CGKA 5EKKA 4A76A 1K73C 2E74C 1EWCA 2F4VQ 1LTSD 3CCMA 4JBKA 2OT2A 1N32Q 4CKEA 3S1RH 4KN4C 1STAA 5KYIA 1JOQA 5ELBA 3PO2G 2F0WA 3NBHA 4HN7A 5C4JB 1DYQA 1IHZA 3HGBA 1X3EA 1BBUA 4C3HG 5KEEA 4IFDH 3U4ZA 3CMEA 3RLNA 2L55A 4TRDA 1PZID 4HJAA 1Z47A 2B63H 1JORA 1GKHA 5CV6A 3MXUA 4IPDA 5E3FA 2A68D 2PW7A 2E2JB 2BH2A 1RTOA 2EXZA 4DFAA 2QKIC 4V0BA 3PMFA 4ME5A 3NBHB 4ZUJA 3GTMH 3P7JA 3PV0A 4Z9CB 3NWSA 1G2TA 3OHXC 3I2ZA 2J4XA 3K5OA 4JV5L 1UE6A 1X3GA 3EVQA 1ET6A 3KOJA 2NWGA 3STBD 1F2LA 1Y1VG 2VQEL 2FJ2A 4X66L 1QG7A 2ZTCA 1S3OA 2R7ZH 1XXGA 4K14A 3E9IA 5M3FH 1TWGB 4EQNA 4UHVA 4ZK9B 5I9OA 1XMQQ 1GXDC 3M4QA 1XNRL 1DOLA 3MC0B 2K5VA 2KHSA 5A2QL 4IPGA 1JICA 5L37A 2VUMH 1GUGA 4RKBA 1TIID 1XX8A 3CU7A 4EGVA 1B70B 1BBXC 3U50C 4RCNA 5G3LD 5IWAL 3NP8A 4LK1C 1E2WA 4BA1I 4B08A 1N9WA 2JP1A 1Q81C 1GHKA 2QW7A 1QJOA 2C35B 2SNSA 1TY2A 5M5YB 1U4LA 3OWFA 4DR5L 3E6ZX 3VR4A 3A5UA 1EYGA 4J1MA 3E9HA 1EYAA 1SE8A 4IUPA 1VQBA 4TSSA 1K3BC 4DV3Q 5FLMH 1PH5A 1DD2A 2O5JC 3HOYH 1LO5D 5HGTA 4NKLA 1MIUA 3TZUA 3K7AH 4JPBW 4KD4A 2F0OA 4F7XA 3HOXH 4CKBA 1GD7A 2IX1A 2D62A 2KJXA 3C1FA 5CV8A 1VDZA 5FJ8G 2JA7G 2XTIA 1IW7D 4B3SL 1B2TA 1WCMH 2PMZB 3I73A 4M1UB 4H0LC 3GTQB 3RLFA 3NELA 2JA8B 1I50H 4GLVB 4K8JA 1RTNA 3OMGA 1VQLA 1V43A 3BJUA 4A3IG 4A3GG 3J81E 1CFMA 4AQYQ 2XSCA 3HG9A 1D5ZC 3JAML 1Y8PB 5FLXc 2F0GA 4FVMA 5C4ZA 4BBSH 1BF4A 1KAAA 5AJ3Q 4JYAL 3FPPA 3I90A 2ZJPA 1Y69U 1K3RA 1NMFA 2PZUA 4DR4Q 1D2BA 1N34Q 3OOCA 2NVTH 1ENFA 2YU9B 1KDBA 2EYLA 4ZRZA 4IFDG 3GTPB 1Y8OB 1VQMA 4DR6L 3BYYB 2B63G 3GTLB 4B9WA 2L4NA 2R92H 5CORA 1KXLA 3CCEA 2A6HC 3HP3A 4NDXA 3WDNA 1OTCA 1XJVA 3LX0A 4RWSC 2CW0C 3FMCA 3LGJA 1IBKL 1VQNA 2MPMA 5KGUA 5DM73 4C3IB 4DAYA 3S2DH 1F9RA 2KCMA 1H95A 3UDXA 1I4GA 4DV3L 4QCLA 2AQ2B 3I4MB 1EIHA 1FJGQ 1SE2A 4DV0Q 3JC66 3A56A 2R93H 1J8IA 2Y0SE 1W6KA 4CHTB 2VB2X 1GUWA 2JA9A 1FGUA 5M5WH 1EFID 3DWPA 1KC8C 2D5DA 4P72A 4ZCKA 2Z6KC 2R7ZG 1U9RA 1BCPD 2HDMA 2WAQE 2VZAA 1HTPA 4R8NA 4DAYB 2NTSA 2RBMA 1G91A 5IYCH 4WFN3 3H3VH 1K8AC 1XMOL 5EQ0A 1TKWB 4WJWA 2EY2A 2VUMG 1IKLA 3SHLA 1MSHA 4HIMA 3RZDB 2B8FA 3T4AC 1ET9A 4BY1B 2EQSA 4R4OA 4IZ8A 1J5EL 2JJQA 1NSNS 4IUNA 1EYDA 3J80L 2K1BA 2HDLA 1CKOA 1MD2D 5AJ3L 1XPOA 3OW7A 2K5QA 4DPGA 4DR4L 1JJCB 2LMCB 1N34L 3FEWX 2L5TA 1STGA 2SNMA 4R1JA 5GAEC 1D8LA 4KY5A 2QF7A 1HNWL 1YNNC 5C44B 5J22A 3GO5A 1Q3LA 2OCEA 1ICWA 3NE5B 5FLMG 2TSSA 1B53A 2FHTA 3HOWH 5KRUA 3HOYG 4QY7A 4B3RQ 4FDBA 4KTAA 2QEJC 1GUNA 3M4YA 1ASYA 1S5FD 3A0JA 3HOXG 1D7QA 2KEDA 1CUKA 2Q2TA 5CYUA 3PIOA 4DR7Q 2HIXA 3MA2B 5HY6A 5JAVA 2Q8IB 1A3UA 1VQIA 1VQAA 5E1FA 4JI0Q 4FF1A 3Q6SA 1WCMG 2I07B 3J7YW 3PUXA 1I6HH 1FJGL 1SFOH 3I4MH 4RHRA 1DONA 4XT1B 1HUNA 2CH4A 4RGTA 3MXNA 4N9TA 3VA7A 2HCIA 1HJPA 4UP8A 4I7ZC 3MEFA 5C5MA 5C0XI 2MJ8A 3ERSX 3SK4A 5C3XA 2MUYA 1PHJA 4BBSG 1K8GA 1CA5A 1X3FA 5D3DA 2NBFA 2V4DA 4KD3A 4B3TQ 2F1MA 1KLGD 1CHQD 3H94A 1TS2A 1IZ6A 2HCCA 4RGMA 5A2QE 4YCVA 3EROA 3MAQA 3A7LA 2IHFA 2IX0A 3MXNB 1EOTA 4X3KA 4LF6Q 3HKZB 2R92G 4G7OC 3J7AV 1CTMA 5BR8Q 4C3JG 3H15A 2ZTDA 2Z6KA 2B2UC 1R9TH 1VQKA 1PTOC 3HOVH 2P5ZX 1JJ2A 3K57A 1WTWA 3NXWA 5NUCA 2RF4A 3K5LA 3EJIA 3PUWA 3TP7A 3AYHB 4PQXA 4G57A 1LTBD 1X56A 4IUQA 5CBEE 1QNUA 2RCNA 4OGQC 4B3RL 2R93G 1C8CA 5ELFA 5K36H 4LFCL 4JI8Q 3ZYYX 3I4NH 3S14H 3BZCA 4MN3A 1HTLD 2O5IC 2EYPA 5KNCA 1OXVA 1BNZA 4DR7L 1SN8A 1O7IA 3PSIA 4HEDA 4JI0L 1ILQA 3P1HA 2QDLA 3NQTA 5D14A 1KD1C 3D6WA 2X69A 5IYCG 3RNUA 5K5PA 4H02A 1CSPA 4H7BA 1YIJA 1WTQA 3WOEA 1WD1A 1VF7A 2K5WA 1I4QA 4J6HA 2QGQA 2DNCA 4PZ7A 5EJWA 5JJLA 4A3FB 1C4QA 4HAEA 2J7ZA 4DK6C 2Z4HA 2A8VA 1QWYA 3M7GA 1V9PA 4PMWA 5FO8B 1TWHH 5COYA 2K5DA 3TRZA 1GUOA 4B3TL 4EVOA 5FKAC 5LL6X 3CCVA 2PI2E 2SDFA 3KUPA 5IGBA 2OQKA 2F3IA 1XTCD 3L9AX 1D1IA 3PQIA 1WTPA 1SE4A 1PZJD 3CQZB 2EVBA 5FK9C 1L0XB 5BR8L 1AE2A 3F2BA 1KDCA 4YCUA 2H5XA 4RH6A 2LXKA 2R61A 1V1PA 4MNOA 3IAYA 3U4VA 4MHEA 4CBVA 4ZYSA 4A3BB 1LLRD 4C2MB 4CDFC 1CM9A 3K7UC 1F9QA 3A5ZB 5EBCA 1VQ5A 5ELOA 4JI8L 1STYA 5IGFA 4BA2I 2I5HA 4GZYC 2CKZB 2B2UA 1UE1A 2NVYB 4XYQA 1SYDA 4FP5D 4I65A 1II3A 1TWFB 1V1PB 3GTOH 3GD7A 3UDGA 1PA6A 5JJKA 4K2KA 1IBML 4F88A 3M3YB 1HUMA 2EXDA 4ID6A 1ZYRD 3TDQA 2YTYA 1K0RA 3PF5A 3SE0A 5I2XA 1IBLQ 3F2UA 2IJ0A 4A93H 1J9OA 1UUPA 1M8AA 1YNJD 2B8GA 2JE6I 2B39A 5JEAJ 4A3DB 3GP7A 2WKDA 2O4XA 3H91A 2E75C 1PTOB 3KF6A 1G6PA 4A3MB 1N36Q 1J6QA 3HOVG 1JJGA 3CC4A 4A3LH 5CV7A 4LF9Q 3ND8A 1K8MA 2MHVA 2AKWB 2YV5A 4HSVA 4JBMA 3G6JB 1NBWA 3I55A 4LF4Q 3CCLA 4L5TA 3R2TA 1F2ZA 1B7YB 1UE7A 3KJPA 2AQ3B 3TSSA 4MIUA 5K36G 5KYLA 3I4NG 5EBDA 5T1IA 5CV4A 3BVMA 4JI2Q 2F0SA 3C2PA 3S1MH 1JC7A 3MVVA 1KNAA 4QIWE 4HR7B 3CCUA 2XRSD 4JW0A 1SYFA 2D2CC 2QDBA 4F87A 5LMUQ 3TS0A 4JI5Q 1FNUA 2H4OA 3GV6A 1YJWA 3J81L 2ZM6Q 2RSNA 1YHBA 2B2WC 2QILA 3PUZA 1Q8IA 2LXJA 4IO9A 3HOZB 4A4IA 1VQ4A 2KENA 3HFZB 2UXBL 3DUZA 2VB3X 4P74A 2A6ED 2E2HB 1A3TA 1PYWD 1EQRA 2Z9HA 1X65A 3SXHA 1F2YA 5CC4A 2XRQD 1E3PA 4A3GB 4APVA 2WIIB 1JE4A 4P71A 4B3ML 2RSOA 2PZWA 1B1ZA 2B3GA 2WB1G 1GM5A 4YWLA 1GJXA 1EIFA 4TQUS 1JR0D 2CFMA 1TXYA 4UDUC 3NHHA 4P73A 3DM3A 1X6OA 1N36L 1M4VA 4KY7A 1EUJA 3W2DA 4RGOS 1Q8KA 3KYHC 4AYBB 4C1NK 4GNXB 1TWCB 2F0DA 4LF4L 2MP1A 4JOIC 2E2IB 5G3LF 1K0SA 3I4OA 4BBRB 4NMZA 2E76C 1UWVA 1WTVA 3OW2A 3CKIB 1VCIA 2K50A 1SYGA 4GN4B 5IT9c 4JI2L 1LM0A 4XT3B 2K03A 3IL8A 1HCZA 3HKSA 4JI4L 3TMEA 2R3ZA 1PH4A 2HT1A 5F2DA 1SAPA 3IKJA 4FF3A 5LMUL 3E0JA 4JI5L 3EBEA 4X65L 3NTKA 4CJ2C 2XWBB 2ZM6L 3QR8A 4TKOB 3HS0C 4A93G 2UUCL 2C5CA 2KQ3A 3OTOQ 1PH3A 4A3JH 4BY7H 2XVSA 3GTJB 4R9WA 3S1QB 5DM63 2EYJA 3K0YA 1I4RA 3GQBA 1FNVA 3LWUA 1K8OA 1W3SA 2DY8A 5M3MB 1HHVA 4KJOA 4JG2A 4A3LG 1JWMD 1SNDA 2L12A 1PRTC 2UXCL 3KLSA 4J8QA 4JVZA 3RZOB 2E8GA 2DJFC 1ICFB 2R6GA 3H0GH 4Q0FA 3U9OA 2B2WA 5GAHC 3D4DA 3RN2A 1VQ7A 2RHSB 4KHPQ 3SR1A 1A0IA 1EZ8A 3CW2C 1JWSD 1Z6HA 3S16B 1M90C 1QVCA 3A8IE 3I3CA 4MTNA 2BCOA 4GS3A 2JYOA 1EY7A 3L2PA 1I3QH 2IPKD 2JA5H 3QJYA 4G7HC 1KTKA 2NVXH 2FINB 1XWEA 3QO2A 1LT4D 1SJED 1ESRA 1HFGA 3RD4A 2JN4A 1RKNA 2B29A 1PTOD 1JCKB 2RA4A 3OPOA 1LTRD 3PUYA 1XPRA 2ZXOA 3BDCA 4BXXH 1EQVA 2K4KA 2HQEA 3I91A 4JI1Q 2UUBQ 2BH8A 3PIP3 4RFBA 5JJIA 4HIOA 2HQLA 4JOIA 5BN3A 3DM1A 1CT1D 1XTDA 1T5EA 2F4VL 3U9SA 1CZGA 3LWEA 1N32L 3KF8A 3G6EA 3OTOL 3NK9A 2K52A 1BR9A 1ENAA 4DGZA 1BCPF 2KVMA 3MFGA 2EDGA 1EIYB 4OHJA 3OWEB 4KY6A 4DNIA 4DR3Q 3L3OC 3BVGA 5M5XB 3SVMA 5C4JH 1MI2A 2ICIA 5M3MH 2XGTA 4M8AA 4KKTA 1EIGA 1KL9A 1Y1WB 3WOFA 4PMBA 1JE5A 1Z7TA 4C3JB 4LF7Q 2JEAI 5IOCA 2B2VC 2DY7A 2M2LA 2I5LX 3KF8B 1PV4A 2E2JH 3HZXA 4AIMA 2Z6BA 1CA6A 1FD7D 3WWVA 1E0BA 1SNMA 1AH9A 3F8TA 2CHBD 2KHIA 1DOKA 1H9MA 1MGSA 3DEPA 1SMXA 4KI0A 5LHY1 1PDQA 3DWAA 1IYJB 1YITA 1PFNA 3W1GA 4ZAIA 2NVQB 5C5LA 4JI7Q 3KK7A 2MNAA 3KLRA 3D0FA 4WJ4A 4OELB 1L1OC 2M00A 1EWIA 4JI1L 2UUBL 3HOUB 4A3JG 4BY7G 5C3EB 3S17B 1JOKA 1R4PB 1CKNA 5FLXE 3QWNA 1XMQL 1TWGH 1EY6A 3A8KE 4CKCA 3UE1A 2QEXA 2JA6B 4NXNQ 1PRTB 5IP9H 2EOTA 3T1HQ 3MTSA 1I4HA 3KBGA 1EEID 3FKIB 2EYFA 1LT5D 1TT2A 1F9PA 1HNXQ 2CCZA 4E6IA 3LNNA 1YNXA 3H0GG 4L63B 1T5XD 1X32A 2A1AA 1H9RA 4DR3L 5D65A 1SBBB 1DGSA 1WJJA 3KBXA 3TEHB 3AMUA 1SRUA 1Q7YC 1CKNB 5M5YH 2IY5B 4DR1Q 4OWTB 3K81C 2BOSA 2JA5G 5CV5A 3URYA 4GKKQ 3RR5A 2F0MA 3T56B 3S2HB 5JPNC 4DKAC 4XQQA 1NJIC 2ENBA 3T16A 4IUTA 4K5XA 5DNFA 1HZ9A 5C0XJ 4P2CB 1A15A 3D3RA 4KLKA 2M9VA 1PFSA 5HGQA 4A3EB 1G2SA 4DN4M 4BXXG 4R4QA 4KV6A 4MTKA 2QA4A 5M3FG 5J1ZA 1A8VA 1Q1EA 2KBNA 2WV6D 3DHQA 3VYUA 1HZCA 2GN5A 4DUZQ 3GTQH 4OO1I 3D6CA 3PO3B 5EPJA 1RCVD 2JA8H 4JI7L 2HHHQ 3DLLA 1HRJA 4CJ0B 4AQYL 1ML0D 2B2VA 2Z0SA 4HIDA 1EY4A 4G7ZC 4ZKCB 3CC2A 1SYCA 4CDEC 1VQGA 2VQFQ 4NXNL 4RA8A 1JQYD 3K8AA 3VDYA 3T1HL 2Y0SB 5C4XB 1NR4A 1K28A 4DK1A 1RDPD 1TS4A 2YU9H 1HNXL 1MHWC 3GTPH 2PPBC 4N8FA 2NUCA 3Q24A 3K5MA 3GTLH 2R7DA 1EU3A 3D31A 1L1OA 2WAQB 4DV1Q 1S40A 1WD0A 3QOJA 1EQTA 5AFWA 5IGDA 3EQLC 5I2YA 1BKBA 1SNOA 1AN8A 1WTOA 1WTRA 5EPLA 3AU7A 3IFTA 2ZXPA 4DR1L 4FF4A 1YBYA 4C3IH 1QVGA 4O0AA 2IX3A 4GKKL 2EJGC 3EIVA 3K59A 4DV0L 3FDTA 3C46A 4GLXA 1UEAB 1STEA 2XIWA 4IURA 4L5QA 4ME3A 3I4LA 3NTHA 1L1OB 4A3EH 1CZWA 1O80A 4IPHA 1H9KA 2VS1A 4PZ8A 1TVXA 3M4OB 2F0UA 3CCQA 4N8X1 4A3KB 3NEMA 4DUZL 4HCEA 1XNQQ 2OEOA 1S5DD 1GO3E 3B6YA 5IE8A 5IP9G 1QOHA 2AQ1B 2HHHL 2MQHA 4YWKA 3RZDH 2N8NA 3DEOA 4DV2Q 2SOBA 4BY1H 4RAUC 1CQFA 1S5CD 1WFQA 1D1KA 3OSOA 1L0WA 2PZTA 3S15B 1DCZA 1WI5A 3CD6A 1B44D 4DXFA 2VQFL 4DK0A 1OXTA 3UI2A 3ER0A 5BN5A 2UU9Q 5JPMC 4RG1A 1JOOA 1MJEA 4GKJQ 2FXQA 1YVCA 1RJTA 5C44H 1CSQA 4GN5A 1A63A 1U4MA 4DV1L 2K32A 2RDGA 2BE5C 3V2TA 2PQAA 1FGBD 3PF4A 2PO4A 4A3CH 1S4ZA 5GROA 1PRTD 3W3AA 1DJRD 1U4RA 5IT9L 1SLJA 4BS9A 1PVOA 3K0XA 1SYEA 1SSOA 1LTLA 4UP9A 1NR2A 3N6RA 3ULPA 2NB0A 5C0XH 2JA8G 4OXPA 1V1OA 4LFBQ 1C0AA 2RDFA 4CGYB 1KNEA 4HTHA 2PQAB 3X3NA 2LKVA 1LTTD 4JI6Q 3PUVA 1Q86C 1PYSB 2NZ1D 3ZJYC 4JI3Q 4DAMA 1XNQL 1G6ZA 3S1NB 3GTKB 2GVBA 2N49A 2E2DC 3K5NA 3JAMc 2JEBI 2JSOA 1B9NA 4JCVE 5I6WA 1Q82C 1IYVA 4LF6L 1A2TA 5LMNW 2O2LD 5I9PA 3HOWG 3PO2B 1TWAB 1GVPA 2PI2A 2A73B 3VR6A 4C3HB 1STNA 2G9DA 2CQOA 2OTJA 2B2TC 1Q1BA 3RMHA 2UU9L 1KHIA 4XDXA 1VQEA 4GKJL 2NN6H 1KRSA 4DV5Q 2F0IA 4C3IG 3I72A 5ELDA 1IW7C 1ZXTA 3EN2A 4GNXC 3A55A 4LFAQ 4YY3Q 4IOCA 4LF5Q 5I6YA 3I4MG 1QZHA 1LUZA 1K83B 2KCCA 3BYTB 2N88A 4XYOA 4HIKA 5LMNQ 2L15A 4JK1C 1BXTA 1KIXA 1VS0A 2OTLA 3AB9A 1A2UA 4QJFA 1RL2A 4DA2A 1N8RC 5I4DA 4NW2A 4X62Q 2D0OA 1Y1VB 3KFUA 4LJZC 2C9OA 4IQZA 2BA0A 1PXUA 1SNCA 1M1KC 1U4PA 3W1BA 2Q2UA 2Z4IA 2N3SA 3A54A 4JC0A 4BY1G 4A3FH 4JI6L 1EEFD 2RDHA 2Q2IA 5IGEA 3R2IA 1EY0A 4JI3L 1W2BA 4KHVA 1O7YA 4RMFA 3J7A5 4POFA 2ALYB 3TP6A 1DXMA 1HXYD 3PIO3 4IFDJ 2F0TA 1U0LA 5IYBH 4DAVA 3J80c 3UDIA 5C44G 3CAMA 1YHAA 2F0VA 4YIJA 1V8QA 3CQZH 4XQJA 1CI3M 1TS5A 3NQIA 1TWAH 1RODA 1H9JA 2EPBA 2BA1A 1TS3A 3ICEA 4A3CG 1BVSA 4FNFA 2I0QA 4A3BH 1C7YA 3CXCA 2WP8J 4C2MH 5A35A 3K80C 4LFAL 4Y7NB 3BZKA 4K8IA 1ZEQX 2A6HD 3S9WA 3CCRA 4LF5L 4A75A 2Q8RE 1Q12A 2CW0D 1H9SB 2JA7B 2ZXRA 5GQOA 1XPUA 2NVYH 4GOPB 3TP8A 2B2TA 5FLXL 1TWFH 4LNQA
chains in the Genus database with same CATH topology
4S3SA 5C6AA 1EY9A 5EGTA 3MHBA 1PTOF 4A3IB 1EL0A 5CR3A 1IYUA 2F03A 3S1RB 2QCPX 4QIWB 1QILA 2CVRA 4QUCA 1PTOH 5LL6S 3IFDA 4NP5A 2FMCA 3SEBA 4PNYA 1UNSA 5T1GA 5C3WA 1O7ZA 2NN6G 2B63B 5C4HA 2L1BA 4IFDI 2LFNA 5EKIA 3Q22A 1VMCA 4FXGC 3QB3A 3QIAA 1B3AA 1Y8NB 2K33A 3MXGA 3GTMB 1LACA 1YNND 2L0CA 1S5ED 5IT9E 1WVLA 2WINB 3NTIA 3C1EA 4C56C 1RD9D 3Q0AA 2F0FA 4WORA 2EJMA 5KIXA 3CRKC 3VR5A 2R7ZB 4B9XA 4IUVA 5M3FB 4KHZA 4OL7A 1E2VA 2F0QA 4K5WA 2ZT9C 3T53B 3H3VC 1JB3A 4XQNA 2VUMB 2LS01 2EYOA 1W6JA 2F0NA 3TBIB 3BG3A 1O78A 2TMPA 5JEAH 2X6GA 3FPUB 5CMDA 2VNUD 2IL8A 1X3QA 4X3UA 1BCPB 2K04A 3GTGB 3TP5A 3HOYB 1EU4A 1TR5A 4LAAA 3K7AB 3MWYW 3HOXB 2IT1A 3I8ZA 2EYMA 1MSGA 4KKUA 4KMUC 4ODGA 1TY0A 1WCMB 4HMIA 3R8BA 1I50B 2BE5D 3EFXD 1XYIA 4RKLA 5E4XA 2J0TD 4BBSB 5JVH3 2RVLA 4U68A 1RHPA 1DM0B 4PMCA 4QF4A 3CRLC 1HPCA 1D5XC 1B4OA 2NVTB 4XTCS 5JJZA 2AWOA 5FO9B 1QE6A 4IN3A 2R92B 3D8GA 1ZKOA 4IALA 1S5BD 4WRDA 5EKLA 1SDFA 1GUSA 1PZKD 3S2DB 4KK7A 3MEHA 2R93B 2PYKA 5KNBA 1G291 4FYDA 3ONAB 5M5WB 1ZYRC 1DZ1A 3G7LA 5ISRA 4K6DA 5IIFA 1YNJC 1SE3A 2N55A 2EZVA 1FYCA 1OO9B 2F4IA 2A69C 2RQXA 3EA6A 3K6OA 4K5VA 1Q90A 2X6LA 2VXWA 5IGGA 4H13C 3KLSX 1HQMC 2K6AA 5JEAG 1L0YB 2HUGA 3BS1A 2KECA 2AWNA 3BDOA 5M9OA 3OIPA 3P20A 4KN7C 2F0KA 4DXGA 1JWUD 2KCNA 2SEBD 3TZDA 2G9HD 3HOWB 2YYZA 1BDOA 3M85A 3VA5A 1I4XA 1EWHA 1SJHD 2H1EA 1SMYC 1HA6A 5CV9A 1LTGD 1SYBA 4EQOA 2WACA 1I6HB 3RUZA 1SFOB 2EY6A 2A6EC 1EY5A 2B2YC 3FRPB 1SEBD 1E2ZA 1ENCA 2XNAC 1PRTF 2FMMA 3J7AF 4DU9A 1A6XA 3I70A 1CQVA 3OIQA 5TSSA 3VR2A 2AUKA 2D9UA 2OXPA 3CHBD 4RCOA 2F0EA 1LABA 1X3PA 1LT6D 2IWHA 1R9TB 2OF1A 4Q5VA 3HOVB 1AEXA 1PFBA 5HURA 2BDNA 4N9PA 2IW3A 3VYRA 1NAPA 2L9HA 1BO0A 2F0JA 2FFKB 1EZ6A 2EJFC 5JOBA 2F0LA 1AZQA 2EE1A 3DXJC 3ITPA 4QUFA 2EY1A 3I4NB 3S14B 3NPPA 3L7ZC 5CBAE 1SNPA 2MGSA 1FNWA 2K01A 2KA7A 1BOSA 2KEEA 4XXEA 1OXUA 4OO1H 5DAUA 3TN2A 1A3VA 4FF2A 2NYZD 3DMUA 4K2LA 1F77A 1AW7A 1TQOA 1D6EC 1OXXK 1GOZA 5FOBB 1TWHB 2A68C 4ZKBB 1NUCA 1TU2B 1AFPA 1MBYA 4FXKC 2B2YA 2WKCA 4CJ1B 2PQEA 5FO7B 2WB1B 1OXSC 4QB4A 4DAPA 1PFMA 4FO2A 2EYHA 1F2MA 4K6LA 3Q23A 2NTTA 3R93A 2RKSA 4ULLA 4X3SA 3MFYA 3HRZC 2AUJD 2NN6I 2GA4B 4IUUA 1NCVA 3H09A 1GHJA 1B50A 5D3IB 1ESFA 2F0PA 3SK5A 5EPKA 4RGNA 3GTOB 4F8MA 1PMRA 3SK8A 1SNQA 3NBIA 3M7NA 4DNRB 4A93B 1GUTA 1AP0A 2F0HA 3JAME 3SK6A 3A7AB 1EYCA 4ZLTF 3ND9A 4UAIA 1FR3A 3QOLA 4EQPA 4H44C 1STBA 3A8JE 2XN9C 4DF7A 3NSWA 2Z8LA 4O1NA 3S1MB 5IGCA 2A5HA 2DN8A 4OO1G 1PLFA 1F9SA 5ELEA 4XIGS 2K05A 1QNKA 1O7LA 2CQAA 1VF5C 5DEHA 2EY5A 1I4PA 4HCSA 3ERQA 4G4KA 2BDOA 1STHA 5KNDA 3V96A 3VYTA 3NWTA 1CHPD 3MZ5A 3VR3A 1H9SA 3J80E 1D5MC 4PV1C 2A69D 4QMGA 2F3VA 2F3WA 1ONLA 4V190 3DWQA 3NUCA 1LT3D 1KDAA 4BWGB 1HA5A 3BDLA 3O13A 3BZDB 3N52A 4C1NI 1BCPC 1CK1A 1RF2D 5BN4A 1QB5D 3SDZA 1G8ZD 3QG1A 1IKMA 4ZUIA 5C0XG 1HFNA 2I46A 3C3LA 3T13A 4LMQD 2KUMA 3OMCA 4L8JA 4FXDA 4X3TA 3BVZA 2L11A 2XWJB 2Z1CA 3V05A 4KKSA 3P75A 1DOMA 4ZQ3A 4L6TB 2ID0A 1SMYD 3H6MA 1IL8A 4A3JB 4BY7B 4O42A 4HMJA 2JXMB 2A74C 5E4WC 3T51B 2K7VA 1AZPA 2PNRC 2KOLA 5ELCA 4RHSA 1BQQT 1KABA 3H0GB 3X3MA 2DNEA 4OIKA 4DNTB 3D4RA 3FVQA 1ILPA 1C48A 1QCBD 3GV3A 3R3OA 1I3QB 2LY7A 3K58A 2JA5B 4R8IA 2NVXB 1R4QB 1VMPA 1LTAD 4OIJA 2PW5A 3D4WA 1LTID 1SXTA 2Q8TA 5J39A 4HSPA 4KJNA 1KLUD 1WTXA 1B9MA 2ICEC 4JBWA 3MXPA 3VYSA 1I6VC 3E5SA 2K28A 4ILWA 4U673 5JVG3 3HEJA 1LV9A 1UAPA 1HQRD 5IODA 1EY8A 2PCFB 1BUVT 4ABNA 5CGKA 5EKKA 2E74C 1EWCA 1LTSD 2OT2A 4CKEA 4KN4C 1STAA 5KYIA 1JOQA 5ELBA 2F0WA 3NBHA 4HN7A 5C4JB 1DYQA 1IHZA 3HGBA 4C3HG 5KEEA 4IFDH 2L55A 4TRDA 1PZID 1Z47A 1JORA 5CV6A 3MXUA 5E3FA 2A68D 2PW7A 2E2JB 1RTOA 2EXZA 4DFAA 2QKIC 4V0BA 3PMFA 4ME5A 4ZUJA 3P7JA 3PV0A 4Z9CB 3NWSA 1G2TA 3OHXC 2J4XA 3K5OA 3EVQA 1ET6A 2NWGA 1F2LA 2FJ2A 1QG7A 1XXGA 4K14A 1TWGB 4EQNA 4ZK9B 5I9OA 1GXDC 1DOLA 3MC0B 2KHSA 5A2QL 1JICA 1GUGA 4RKBA 1TIID 1XX8A 3CU7A 4EGVA 1BBXC 4RCNA 5G3LD 3NP8A 4LK1C 1E2WA 4BA1I 4B08A 2JP1A 1GHKA 1QJOA 2SNSA 1TY2A 5M5YB 1U4LA 3OWFA 3E6ZX 3VR4A 4J1MA 4IUPA 1EYAA 4TSSA 1DD2A 2O5JC 1LO5D 5HGTA 4NKLA 3TZUA 4KD4A 2F0OA 4F7XA 4CKBA 2IX1A 2D62A 2KJXA 3C1FA 5CV8A 1VDZA 1IW7D 1B2TA 2PMZB 3I73A 4M1UB 4H0LC 3GTQB 3RLFA 2JA8B 4K8JA 1RTNA 3OMGA 1V43A 3J81E 1CFMA 2XSCA 3HG9A 1D5ZC 3JAML 1Y8PB 2F0GA 4FVMA 5C4ZA 1BF4A 1KAAA 3FPPA 3I90A 1Y69U 2PZUA 1D2BA 3OOCA 1ENFA 2YU9B 1KDBA 2EYLA 4ZRZA 4IFDG 3GTPB 1Y8OB 3BYYB 3GTLB 4B9WA 2L4NA 5CORA 2A6HC 3HP3A 4NDXA 3WDNA 3LX0A 4RWSC 2CW0C 3FMCA 2MPMA 5KGUA 5DM73 4C3IB 4DAYA 1F9RA 1I4GA 4QCLA 2AQ2B 3I4MB 1EIHA 1SE2A 3A56A 1J8IA 1W6KA 4CHTB 2VB2X 1GUWA 1EFID 3DWPA 2D5DA 1U9RA 1BCPD 2HDMA 1HTPA 4R8NA 2NTSA 2RBMA 1G91A 4WFN3 5EQ0A 1TKWB 4WJWA 2EY2A 1IKLA 3SHLA 1MSHA 3RZDB 2B8FA 3T4AC 1ET9A 4BY1B 4IZ8A 1NSNS 4IUNA 1EYDA 3J80L 2K1BA 2HDLA 1MD2D 3OW7A 2K5QA 2LMCB 3FEWX 2L5TA 1STGA 2SNMA 4KY5A 2QF7A 1YNNC 5C44B 5J22A 3GO5A 1Q3LA 3NE5B 1ICWA 2TSSA 1B53A 2FHTA 5KRUA 4KTAA 2QEJC 1GUNA 3M4YA 1S5FD 2KEDA 5CYUA 3MA2B 5JAVA 2Q8IB 1A3UA 5E1FA 4FF1A 3Q6SA 2I07B 3J7YW 3PUXA 4RHRA 1DONA 4XT1B 1HUNA 4RGTA 3MXNA 4N9TA 3VA7A 2HCIA 4I7ZC 5C5MA 5C0XI 2MJ8A 3SK4A 5C3XA 2MUYA 1CA5A 5D3DA 2NBFA 2V4DA 4KD3A 2F1MA 1KLGD 1CHQD 3H94A 1TS2A 2HCCA 4RGMA 5A2QE 3EROA 3MAQA 3A7LA 2IX0A 1EOTA 4X3KA 3HKZB 4G7OC 3J7AV 1CTMA 4C3JG 2B2UC 1PTOC 3K57A 1WTWA 3NXWA 5NUCA 3K5LA 3EJIA 3PUWA 3TP7A 4PQXA 4G57A 1LTBD 4IUQA 5CBEE 1QNUA 4OGQC 1C8CA 5ELFA 5K36H 3ZYYX 4MN3A 1HTLD 2O5IC 2EYPA 5KNCA 1OXVA 1BNZA 4HEDA 1ILQA 3P1HA 3NQTA 5D14A 3D6WA 2X69A 5K5PA 4H7BA 1WTQA 3WOEA 1WD1A 1VF7A 2K5WA 1I4QA 4J6HA 2DNCA 5EJWA 4A3FB 1C4QA 4HAEA 2J7ZA 2Z4HA 1QWYA 3M7GA 4PMWA 5FO8B 5COYA 2K5DA 1GUOA 4EVOA 5FKAC 5LL6X 2SDFA 3KUPA 5IGBA 1XTCD 3L9AX 1D1IA 1WTPA 1SE4A 1PZJD 3CQZB 2EVBA 5FK9C 1L0XB 1KDCA 4RH6A 2R61A 1V1PA 3IAYA 4MHEA 4CBVA 4ZYSA 4A3BB 1LLRD 4C2MB 1CM9A 1F9QA 5EBCA 1STYA 5IGFA 4BA2I 4GZYC 2B2UA 2NVYB 1SYDA 4FP5D 4I65A 1II3A 1TWFB 1V1PB 3GD7A 4K2KA 3M3YB 4F88A 1HUMA 4ID6A 1ZYRD 3TDQA 3SE0A 5I2XA 3F2UA 2IJ0A 1J9OA 1UUPA 1M8AA 1YNJD 2B8GA 2JE6I 2B39A 5JEAJ 4A3DB 3GP7A 2WKDA 2O4XA 3H91A 2E75C 1PTOB 4A3MB 5CV7A 3ND8A 1K8MA 2MHVA 4HSVA 3G6JB 3R2TA 1F2ZA 2AQ3B 3TSSA 4MIUA 5K36G 5KYLA 5EBDA 5T1IA 5CV4A 3BVMA 2F0SA 3C2PA 1JC7A 3MVVA 1KNAA 4HR7B 2XRSD 1SYFA 2D2CC 2QDBA 4F87A 1FNUA 2H4OA 3GV6A 3J81L 2RSNA 2B2WC 2QILA 3PUZA 1Q8IA 3HOZB 3DUZA 2VB3X 2A6ED 2E2HB 1A3TA 1PYWD 3SXHA 1F2YA 5CC4A 2XRQD 4A3GB 2WIIB 1JE4A 2RSOA 2PZWA 1B1ZA 1GJXA 4TQUS 1JR0D 4UDUC 3NHHA 1M4VA 4KY7A 3W2DA 4RGOS 4AYBB 4C1NK 1TWCB 2F0DA 2MP1A 2E2IB 5G3LF 4BBRB 4NMZA 2E76C 1WTVA 3CKIB 1VCIA 1SYGA 4XT3B 2K03A 3IL8A 1HCZA 3TMEA 2R3ZA 5F2DA 1SAPA 3IKJA 4FF3A 3E0JA 3NTKA 4CJ2C 2XWBB 4TKOB 3HS0C 2C5CA 2KQ3A 2XVSA 3GTJB 4R9WA 3S1QB 5DM63 2EYJA 3K0YA 1I4RA 3GQBA 1FNVA 3LWUA 1K8OA 2DY8A 5M3MB 1HHVA 4KJOA 1JWMD 1SNDA 2L12A 1PRTC 3KLSA 4J8QA 3RZOB 4Q0FA 2R6GA 3U9OA 2B2WA 3D4DA 3SR1A 1EZ8A 1JWSD 1Z6HA 3S16B 3A8IE 3I3CA 2BCOA 2JYOA 1EY7A 2IPKD 3QJYA 4G7HC 1KTKA 2FINB 1XWEA 3QO2A 1LT4D 1SJED 1ESRA 1HFGA 3RD4A 1RKNA 1PTOD 1JCKB 2RA4A 3OPOA 1LTRD 3PUYA 2ZXOA 3BDCA 1EQVA 2HQEA 3I91A 3PIP3 4RFBA 5BN3A 3DM1A 1CT1D 1T5EA 3U9SA 1CZGA 3LWEA 3KF8A 3NK9A 1BR9A 1ENAA 4DGZA 1BCPF 2KVMA 3MFGA 2EDGA 4OHJA 3OWEB 4KY6A 3L3OC 3BVGA 5M5XB 3SVMA 1MI2A 2ICIA 4M8AA 4KKTA 1EIGA 1Y1WB 3WOFA 4PMBA 1Z7TA 4C3JB 2JEAI 5IOCA 2B2VC 2DY7A 2M2LA 3HZXA 1CA6A 1FD7D 1E0BA 1SNMA 2CHBD 1DOKA 1H9MA 1MGSA 3DEPA 4KI0A 5LHY1 1PDQA 3DWAA 1PFNA 4ZAIA 2NVQB 5C5LA 3KK7A 3KLRA 2M00A 3HOUB 5C3EB 3S17B 1JOKA 1R4PB 5FLXE 3QWNA 1EY6A 3A8KE 4CKCA 2JA6B 1PRTB 2EOTA 3MTSA 1I4HA 3KBGA 1EEID 3FKIB 2EYFA 1LT5D 1TT2A 1F9PA 4E6IA 3LNNA 4L63B 1T5XD 1X32A 1H9RA 5D65A 1SBBB 3KBXA 3AMUA 2BOSA 5CV5A 3URYA 2F0MA 3T56B 3S2HB 5JPNC 4XQQA 2ENBA 3T16A 4IUTA 4K5XA 5DNFA 5C0XJ 4P2CB 1A15A 3D3RA 2M9VA 4A3EB 1G2SA 4DN4M 4KV6A 5J1ZA 1Q1EA 2WV6D 3DHQA 3VYUA 4OO1I 3D6CA 3PO3B 5EPJA 1RCVD 1HRJA 4CJ0B 1ML0D 2B2VA 1EY4A 4G7ZC 4ZKCB 1SYCA 4RA8A 1JQYD 2Y0SB 5C4XB 1NR4A 4DK1A 1RDPD 1TS4A 2PPBC 2NUCA 3Q24A 3K5MA 1EU3A 3D31A 2WAQB 1WD0A 3QOJA 1EQTA 5AFWA 5IGDA 3EQLC 5I2YA 1SNOA 1AN8A 1WTOA 1WTRA 5EPLA 3AU7A 3IFTA 2ZXPA 4FF4A 2IX3A 2EJGC 3K59A 3FDTA 3C46A 1UEAB 1STEA 2XIWA 4IURA 3I4LA 3NTHA 1CZWA 1O80A 1H9KA 1TVXA 3M4OB 2F0UA 4A3KB 4HCEA 2OEOA 1S5DD 1QOHA 2AQ1B 3DEOA 2SOBA 4RAUC 1CQFA 1S5CD 1D1KA 3OSOA 2PZTA 3S15B 1DCZA 1B44D 4DXFA 4DK0A 1OXTA 3UI2A 5BN5A 5JPMC 1JOOA 1RJTA 1U4MA 2K32A 2RDGA 2BE5C 3V2TA 1FGBD 2PO4A 1S4ZA 1PRTD 3W3AA 1DJRD 1U4RA 5IT9L 4BS9A 1SYEA 1SSOA 1NR2A 3N6RA 2NB0A 5C0XH 1V1OA 2RDFA 4CGYB 1KNEA 4HTHA 3X3NA 2LKVA 1LTTD 3PUVA 2NZ1D 1G6ZA 3S1NB 3GTKB 2E2DC 3K5NA 2JEBI 2JSOA 1B9NA 5I6WA 1IYVA 1A2TA 2O2LD 5I9PA 3PO2B 1TWAB 2A73B 3VR6A 4C3HB 1STNA 2G9DA 2B2TC 1Q1BA 3RMHA 4XDXA 2NN6H 4C3IG 2F0IA 3I72A 5ELDA 1IW7C 1ZXTA 3A55A 5I6YA 1K83B 2KCCA 3BYTB 2N88A 4XYOA 4JK1C 1BXTA 3AB9A 1A2UA 4DA2A 5I4DA 4NW2A 1Y1VB 4LJZC 2C9OA 4IQZA 2BA0A 1PXUA 1SNCA 1U4PA 2Z4IA 3A54A 1EEFD 2RDHA 5IGEA 1EY0A 3R2IA 4KHVA 1O7YA 3TP6A 1DXMA 1HXYD 3PIO3 4IFDJ 2F0TA 4DAVA 4YIJA 2F0VA 1V8QA 4XQJA 1CI3M 1TS5A 3NQIA 1RODA 1H9JA 2EPBA 2BA1A 1TS3A 4FNFA 2WP8J 5A35A 4Y7NB 4K8IA 1ZEQX 2A6HD 3S9WA 2Q8RE 1Q12A 2CW0D 1H9SB 2JA7B 2ZXRA 3TP8A 2B2TA 5FLXL 4XYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYC A;  1PMR A;  2A69 C;  2NN6 H;  3M7N A;  3I72 A;  3PUW A;  1IW7 C;  5BN3 A;  2EJF C;  4DNR B;  1Q90 A;  1TKW B;  2PCF B;  1DD2 A;  2O5J C;  5BN4 A;  3SE0 A;  3T56 B;  4OGQ C;  2B8F A;  1T5E A;  3SDZ A;  1IYU A;  1GUT A;  2E74 C;  3DXJ C;  3QG1 A;  4H13 C;  3U9S A;  2E76 C;  3TZU A;  1HQM C;  2B8G A;  2IT1 A;  2KCC A;  2JE6 I;  5JEA G;  1VCI A;  5C0X G;  5K36 H;  3L7Z C;  4KN4 C;  3A7A B;  2O5I C;  1DCZ A;  5KNC A;  4KKU A;  2D62 A;  2EDG A;  1OXV A;  3BDO A;  4JK1 C;  4KMU C;  3ND9 A;  2KA7 A;  1VDZ A;  2E75 C;  4L8J A;  3OW7 A;  1HCZ A;  1FR3 A;  1IW7 D;  4DK0 A;  1OXU A;  2LMC B;  1OXT A;  3AB9 A;  3HGB A;  4H44 C;  3P20 A;  4OO1 H;  4KN7 C;  3I73 A;  2L5T A;  3ND8 A;  1Q1E A;  4H0L C;  1K8M A;  3IKJ A;  4KKS A;  3A8J E;  2QF7 A;  4KKT A;  5BN5 A;  4IFD H;  3GD7 A;  3RLF A;  1YNN C;  2NN6 G;  2BE5 D;  3NE5 B;  2YYZ A;  3MXU A;  1BDO A;  4LJZ C;  4IQZ A;  1V43 A;  2BA0 A;  3M85 A;  1Z7T A;  4TKO B;  1VF7 A;  2A68 D;  2JEA I;  1CFM A;  2K32 A;  2DNC A;  1OXX K;  1GUN A;  2BE5 C;  1Y8P B;  3QIA A;  3M4Y A;  5K36 G;  4G7Z C;  1EWH A;  1Y8N B;  1SMY C;  2JXM B;  3T51 B;  2A68 C;  2K33 A;  2K7V A;  3W3A A;  3GQB A;  1LAC A;  3LWU A;  1K8O A;  1GUO A;  1TU2 B;  3CRL C;  1HPC A;  3FPP A;  1Y69 U;  2DN8 A;  2Q8I B;  1H9M A;  3PV0 A;  2PNR C;  4HR7 B;  4OO1 G;  3OOC A;  4KI0 A;  4XTC S;  3PUX A;  4DK1 A;  2A6E C;  1DXM A;  2AWO A;  4IFD G;  2D2C C;  2EJM A;  3N6R A;  1Y8O B;  1E2Z A;  3CRK C;  2PPB C;  3VR5 A;  1OXS C;  2R6G A;  4XIG S;  5C0X H;  2DNE A;  1ZKO A;  2EVB A;  3VA7 A;  2A6H C;  3PUZ A;  1V8Q A;  3D31 A;  1O7L A;  3KLR A;  3WDN A;  1CI3 M;  4I7Z C;  4DNT B;  3D4R A;  3VR4 A;  1H9J A;  1Z6H A;  1VF5 C;  1GUS A;  1A6X A;  2BA1 A;  3EQL C;  4KHZ A;  2CW0 C;  3PUV A;  2A6E D;  3A8I E;  3FMC A;  2BDO A;  1E2V A;  5KND A;  2V4D A;  3IFT A;  2F1M A;  3A8K E;  3VR2 A;  2ZT9 C;  4G7O C;  3T53 B;  3H94 A;  5A35 A;  3MFY A;  3QJY A;  4G7H C;  2AUK A;  2EJG C;  2A6H D;  5KNB A;  1GUG A;  1G29 1;  2AUJ D;  2NN6 I;  3BG3 A;  2JEB I;  1O78 A;  1B9N A;  3A7L A;  1IYV A;  3LNN A;  5JEA H;  1Q12 A;  4RCN A;  1H9S B;  1LAB A;  1H9S A;  1ZYR C;  1GHJ A;  3I4L A;  3OPO A;  3VR3 A;  4LK1 C;  3PUY A;  1CTM A;  1E2W A;  4TQU S;  4BA2 I;  4GZY C;  1GJX A;  4BA1 I;  4PV1 C;  1H9R A;  2A69 D;  2D5D A;  1H9K A;  1YNJ C;  1ONL A;  1GHK A;  1B9M A;  1QJO A;  3VR6 A;  4JBW A;  1Q1B A;  1I6V C;  1HTP A; 
#chains in the Genus database with same CATH topology
 1P16 A;  4S3S A;  2G5D A;  5C6A A;  1EY9 A;  4X62 L;  5EGT A;  3MHB A;  4GNX A;  3M3Y H;  1PTO F;  4A3I B;  2KHJ A;  2DJG C;  1IBL L;  1EL0 A;  5CR3 A;  1IYU A;  2F03 A;  3S1R B;  3CP0 A;  2QCP X;  4A3D H;  2CH4 W;  4QIW B;  3HKZ G;  1QIL A;  1MJC A;  2CVR A;  4QUC A;  1PTO H;  1WTH A;  5LL6 S;  3IFD A;  4A3M H;  4LF9 L;  4NP5 A;  2FMC A;  3SEB A;  5J3B A;  4PNY A;  1UNS A;  5T1G A;  5C3W A;  1O7Z A;  2NN6 G;  1Z9F A;  4DK3 C;  2B63 B;  5C4H A;  2K14 A;  2L1B A;  4IFD I;  2LFN A;  5EKI A;  3Q22 A;  1YEZ A;  1VMC A;  4FXG C;  3QB3 A;  1NY4 A;  1B3A A;  3QIA A;  2AMC B;  1Y8N B;  2K33 A;  3MXG A;  3GTM B;  1LAC A;  1YNN D;  2L0C A;  1S5E D;  5IT9 E;  4EX5 A;  3F1Z A;  1WVL A;  2WIN B;  3NTI A;  4YHH Q;  3C1E A;  4C56 C;  1RD9 D;  3Q0A A;  2F0F A;  4WOR A;  2EJM A;  3KDF A;  5KIX A;  3CRK C;  1S72 A;  3VR5 A;  4DUY Q;  3KLW A;  2R7Z B;  4B9X A;  4IUV A;  3HOZ H;  4A3F G;  1NMG A;  5M3F B;  4KHZ A;  4OL7 A;  2V1C C;  1E2V A;  2E2H H;  2F0Q A;  1QZG A;  4K5W A;  2VL6 A;  2ZT9 C;  3M9B A;  3T53 B;  3H3V C;  1JB3 A;  4XQN A;  1XNR Q;  2VUM B;  5IYD H;  4Y52 H;  2LS0 1;  2EYO A;  1W6J A;  2F0N A;  3TBI B;  4QGU A;  4A3G H;  3BG3 A;  2CWA A;  3KDF B;  3CPW A;  1O78 A;  4TVA B;  2TMP A;  5IYB G;  5JEA H;  2X6G A;  4DV6 Q;  5H1S E;  5IWA Q;  1I5F A;  2K75 A;  3FPU B;  3ULL A;  5CMD A;  2A19 A;  2AHO B;  1KQS A;  2VNU D;  2K5N A;  1E22 A;  2IL8 A;  4DR5 Q;  4K0K Q;  1X3Q A;  4A3B G;  3L0O A;  4X3U A;  1BCP B;  2K04 A;  3GTG B;  1TWC H;  3TP5 A;  3HOY B;  1EU4 A;  2E2I H;  1TR5 A;  4LAA A;  4EQ5 A;  3K7A B;  3MWY W;  4BBR H;  3HOX B;  2IT1 A;  3I8Z A;  3CCJ A;  4NB3 A;  2EYM A;  3JAM i;  1MSG A;  4KKU A;  4KMU C;  1VQF A;  2IHE A;  4ODG A;  1TY0 A;  3RLO A;  4QL5 A;  1WCM B;  1X54 A;  4B3S Q;  2MO0 A;  4HMI A;  4YHH L;  1EFW A;  1NNX A;  3R8B A;  1I50 B;  2BE5 D;  3EFX D;  4DUY L;  3CCS A;  1PH7 A;  1KAW A;  1XYI A;  4RKL A;  5E4X A;  2J0T D;  1HR0 W;  5IY0 A;  4BBS B;  5JVH 3;  2RVL A;  2WFW A;  1SRO A;  4U68 A;  1RHP A;  1RIP A;  4A3D G;  3GTJ H;  3S1Q H;  1DM0 B;  4PMC A;  4QF4 A;  3CRL C;  1HPC A;  3TQY A;  1D5X C;  4JYA Q;  1B4O A;  3A74 A;  4POG A;  4PZ6 A;  2E5L Q;  2NVT B;  4A3M G;  4XTC S;  5JJZ A;  4IPC A;  2AWO A;  5FO9 B;  1HZB A;  1QE6 A;  1PH9 A;  2PMZ E;  4IN3 A;  4DR6 Q;  3RZO H;  2R92 B;  4DV6 L;  3D8G A;  1ZKO A;  2I5M X;  4IAL A;  4KHP L;  2HIV A;  1S5B D;  2ZTE A;  4WRD A;  5EKL A;  1SDF A;  1GUS A;  1HR0 Q;  1PZK D;  3S16 H;  4K0K L;  2YTV A;  1IBK Q;  4KK7 A;  3S2D B;  3MEH A;  1VQ6 A;  4DV7 Q;  3GTG H;  2R93 B;  2PYK A;  5KNB A;  1G29 1;  4FYD A;  1C9O A;  1PH1 A;  2UUA Q;  3ONA B;  3PCO B;  2NZH A;  5M5W B;  1ZYR C;  1DZ1 A;  3W5O A;  3G7L A;  3J80 i;  5ISR A;  4K6D A;  5IIF A;  1I94 Q;  1YNJ C;  3HOZ G;  1SE3 A;  2N55 A;  4CDD C;  2ZJQ A;  1IXR A;  2EZV A;  2N78 A;  1FYC A;  1OO9 B;  2F4I A;  2A69 C;  2RQX A;  3IRB A;  4L5R C;  3J81 c;  3EA6 A;  3K6O A;  4K5V A;  1Q90 A;  5IYD G;  4P75 A;  2X6L A;  5DLQ E;  2VXW A;  1XMO Q;  4CDC C;  5IGG A;  1MKH A;  3H3V I;  4H13 C;  3KLS X;  1HQM C;  4OX9 Q;  1J5E Q;  2K6A A;  5JEA G;  4LUV A;  1L0Y B;  2HUG A;  3BS1 A;  2KEC A;  2AWN A;  3BDO A;  5M9O A;  2E5L L;  3FHW A;  3OIP A;  4IJH A;  3P20 A;  5M5X H;  4KN7 C;  2F0K A;  3NEN A;  4OWW B;  4DXG A;  1JWU D;  2KCN A;  1HNW Q;  1VQH A;  2HD3 A;  2SEB D;  3TZD A;  2G9H D;  4AYB G;  1VQC A;  5EAY A;  2YYZ A;  4HJ8 A;  3HOW B;  1BDO A;  3M85 A;  4LF7 L;  1Y1W H;  3I7F A;  2JK8 A;  3VA5 A;  1I4X A;  4C3J H;  4BBR G;  1PH8 A;  1B8A A;  1EWH A;  4OEM B;  1HR0 L;  1SJH D;  2H1E A;  1SMY C;  1HA6 A;  5CV9 A;  1LTG D;  4L5S A;  5ELN A;  3Q8D A;  1SYB A;  4EQO A;  2WAC A;  1U5K A;  4DV7 L;  1I6H B;  3RUZ A;  1SFO B;  2EY6 A;  2A6E C;  1EY5 A;  2B2Y C;  3FRP B;  1SEB D;  1E2Z A;  4LUZ A;  1ENC A;  2UUA L;  1ASZ A;  2NVQ H;  1YJ9 A;  2XNA C;  3TRE A;  1PRT F;  1VQJ A;  2FMM A;  3J7A F;  3AFP A;  4DU9 A;  3S24 A;  1I94 L;  3I70 A;  1A6X A;  4HJ5 A;  1CQV A;  3CF5 A;  4YWM A;  3HOU H;  3OIQ A;  5C3E H;  3S17 H;  5TSS A;  3VR2 A;  1QVF A;  1Q46 A;  4O2D A;  2JA6 H;  2AUK A;  1FL0 A;  5M3M G;  4LWC A;  5IP7 H;  2D9U A;  2OXP A;  3FKI H;  4OX9 L;  1HZA A;  3CHB D;  4RCO A;  1QUQ A;  3AEV A;  2F0E A;  1LAB A;  1X3P A;  1LT6 D;  2K5H A;  1A62 A;  2IWH A;  3F2C A;  1R9T B;  2OF1 A;  4Q5V A;  3HOV B;  1AEX A;  2R7F A;  2ZJR A;  1PFB A;  2BDN A;  2JQO A;  5HUR A;  4N9P A;  2IW3 A;  3VYR A;  1NAP A;  2YTX A;  2L9H A;  1N33 Q;  1BO0 A;  2F0J A;  2EIF A;  2D0P A;  2FFK B;  1EZ6 A;  1YHQ A;  2EJF C;  5JOB A;  2F0L A;  1CKM A;  1AZQ A;  2EE1 A;  3DXJ C;  3ITP A;  4QUF A;  3S2H H;  2EY1 A;  1QUQ B;  3I4N B;  3S14 B;  3NPP A;  3L7Z C;  4LFC Q;  5CBA E;  1SNP A;  2MGS A;  1FNW A;  2K01 A;  2KA7 A;  2WB1 E;  3J81 j;  1YZ6 A;  1BOS A;  3E3X A;  2KEE A;  1G51 A;  4XXE A;  1E24 A;  1OXU A;  3HKZ E;  1PYB A;  1X9N A;  4OO1 H;  5DAU A;  3TN2 A;  4LW1 A;  1A3V A;  2UXD Q;  4FF2 A;  2NYZ D;  3CC7 A;  3DMU A;  4K2L A;  1F77 A;  3PO3 H;  3GDE A;  1AW7 A;  1TQO A;  1D6E C;  4UPA A;  1OXX K;  1GOZ A;  5FOB B;  1TWH B;  2A68 C;  4ZKB B;  1E1O A;  3RN5 A;  1NUC A;  1TU2 B;  1AFP A;  1MBY A;  1X55 A;  4FXK C;  2B2Y A;  2WKC A;  5C4X H;  4CJ1 B;  1VQ9 A;  2PQE A;  3SGI A;  5FO7 B;  3M4P A;  2WB1 B;  1OXS C;  4QQB X;  4QB4 A;  4DAP A;  1Y1W G;  1PFM A;  4FO2 A;  4AH6 A;  2EYH A;  2MO1 A;  2KCT A;  3ULJ A;  1L2F A;  1F2M A;  4K6L A;  1NTG A;  3STB C;  3Q23 A;  4LUO A;  2NTT A;  2VW9 A;  1N33 L;  3R93 A;  3I56 A;  2RKS A;  4ULL A;  2RHQ B;  4X3S A;  3MFY A;  3HRZ C;  1EOV A;  2AUJ D;  2NN6 I;  2GA4 B;  4IUU A;  1NCV A;  3H09 A;  1GHJ A;  1B50 A;  1AE3 A;  2PNH A;  5D3I B;  1ESF A;  2F0P A;  3SK5 A;  5EPK A;  1EQQ A;  4UP7 A;  4NXM Q;  4RGN A;  3GTO B;  3OYY A;  4F8M A;  4GOP C;  3HOU G;  3TS2 A;  5C3E G;  2UXD L;  3M4O H;  1PMR A;  3SK8 A;  1SNQ A;  3NBI A;  3M7N A;  4A3K H;  1IBM Q;  4DNR B;  2JA6 G;  5GAD C;  4A93 B;  5IP7 G;  3T1Y Q;  1GUT A;  4DV2 L;  1AP0 A;  3FKI G;  2F0H A;  3JAM E;  4UY8 C;  2CWP A;  3SK6 A;  3A7A B;  1EYC A;  4ZLT F;  3S15 H;  3ND9 A;  4UAI A;  1FR3 A;  3QOL A;  4EQP A;  1K9M C;  4R4I A;  2ES2 A;  4H44 C;  1STB A;  2Q2H A;  4R4C A;  3A8J E;  1SR3 A;  3PGZ A;  3U58 A;  2XN9 C;  4DF7 A;  1FVI A;  3NSW A;  3J81 i;  1B3Q A;  3UDF A;  2Z8L A;  4O1N A;  3G4S A;  2DGY A;  3FP9 A;  4A3E G;  3BU2 A;  3S1M B;  4WJ3 M;  5IGC A;  2A5H A;  2DN8 A;  1V1Q A;  4OO1 G;  4X64 Q;  5GAG C;  1PLF A;  1F9S A;  5ELE A;  3PO3 G;  4XIG S;  1HH2 P;  4J15 A;  5E7N A;  4LFB L;  2K05 A;  4IOA A;  1QNK A;  1O7L A;  1WYD A;  2CQA A;  4NXM L;  4I7A A;  1VF5 C;  5DEH A;  2EY5 A;  1I4P A;  4HCS A;  2UXB Q;  3ERQ A;  4G4K A;  2BDO A;  1VQO A;  1STH A;  4OWX B;  4LF8 Q;  5KND A;  3F2D A;  2ATW A;  1IL2 A;  1PH2 A;  1YJN A;  4GN3 B;  3V96 A;  1VQ8 A;  3GTK H;  3S1N H;  3VYT A;  3NWT A;  2Y0S G;  5C4X G;  1VQD A;  1VQP A;  1HNZ Q;  3T1Y L;  4B3M Q;  1JMC A;  1CHP D;  4IJL A;  3MZ5 A;  3PIP A;  3VR3 A;  1H9S A;  4MZ9 A;  3J80 E;  1LYL A;  3PO2 H;  1D5M C;  4PV1 C;  2A69 D;  2WAQ G;  4QMG A;  2F3V A;  2F3W A;  1ONL A;  4GOP A;  4V19 0;  3DWQ A;  3NUC A;  1LT3 D;  1KDA A;  4C3H H;  4BWG B;  1HA5 A;  3BDL A;  3O13 A;  2RCF A;  4DV5 L;  3BZD B;  3N52 A;  4C1N I;  3CMA A;  4YY3 L;  1Y14 B;  1BCP C;  1CK1 A;  2LSS A;  1RF2 D;  5BN4 A;  2GVA A;  1PH6 A;  1QB5 D;  3SDZ A;  1G8Z D;  3QG1 A;  1IKM A;  4ZUI A;  5C0X G;  1K83 H;  5LMN L;  1HFN A;  2I46 A;  3C3L A;  3T13 A;  4LMQ D;  2KUM A;  3OMC A;  4L8J A;  4FXD A;  2MFI A;  3KF6 B;  4X3T A;  3BVZ A;  2L11 A;  2ASB A;  4DR2 Q;  1WOC A;  2XWJ B;  4JI4 Q;  2Z1C A;  3AQQ A;  4X64 L;  3V05 A;  4KKS A;  3P75 A;  1UE5 A;  4DV4 Q;  4GLA C;  4A3K G;  1DOM A;  1P8L A;  4X65 Q;  4ZQ3 A;  4L6T B;  1Y1V H;  2ID0 A;  1SMY D;  4AYB E;  3H6M A;  3J7Z C;  2UUC Q;  1IL8 A;  4A3J B;  4BY7 B;  4O42 A;  4HMJ A;  3AFQ A;  4OON A;  2JXM B;  2A74 C;  5E4W C;  4JBJ A;  3T51 B;  2K7V A;  4LF8 L;  3UE0 A;  4R4T A;  3G48 A;  1AZP A;  2PNR C;  1E7Z A;  2KOL A;  5ELC A;  4PG3 A;  2UXC Q;  1JT8 A;  1HNZ L;  4RHS A;  2OQ0 A;  1BQQ T;  1KAB A;  1T9H A;  1UEB A;  3H0G B;  1YI2 A;  3X3M A;  2DNE A;  4OIK A;  4HJ9 A;  3G71 A;  4DNT B;  3D4R A;  3FVQ A;  1ILP A;  1C48 A;  4X6A H;  1QCB D;  4HJ7 A;  1NE3 A;  3GV3 A;  3R3O A;  1KRT A;  4ALP A;  1I3Q B;  2F52 A;  2LY7 A;  3K58 A;  2JA5 B;  4R8I A;  4YCW A;  2NVX B;  1R4Q B;  4Y7N H;  1VMP A;  2DUD A;  1BBW A;  4JV5 Q;  1LTA D;  4OIJ A;  3E0E A;  2PW5 A;  1JB7 A;  3D4W A;  1LTI D;  1SXT A;  2Q8T A;  2VQE Q;  2OWO A;  4X66 Q;  2NZO A;  5J39 A;  2JA7 H;  5FJ8 H;  4HSP A;  4KJN A;  1KLU D;  1WTX A;  4DR2 L;  1B9M A;  2ICE C;  4JBW A;  3MXP A;  3VYS A;  1I6V C;  2VY3 A;  3E5S A;  2K28 A;  4ILW A;  1E1T A;  4U67 3;  5JVG 3;  4DV4 L;  3HEJ A;  1LV9 A;  3CPF A;  1UAP A;  1HQR D;  5IOD A;  3KJO A;  1EY8 A;  2PCF B;  1BUV T;  4ABN A;  4A3I H;  4NPS A;  5CGK A;  5EKK A;  4A76 A;  1K73 C;  2E74 C;  1EWC A;  2F4V Q;  1LTS D;  3CCM A;  4JBK A;  2OT2 A;  1N32 Q;  4CKE A;  3S1R H;  4KN4 C;  1STA A;  5KYI A;  1JOQ A;  5ELB A;  3PO2 G;  2F0W A;  3NBH A;  4HN7 A;  5C4J B;  1DYQ A;  1IHZ A;  3HGB A;  1X3E A;  1BBU A;  4C3H G;  5KEE A;  4IFD H;  3U4Z A;  3CME A;  3RLN A;  2L55 A;  4TRD A;  1PZI D;  4HJA A;  1Z47 A;  2B63 H;  1JOR A;  1GKH A;  5CV6 A;  3MXU A;  4IPD A;  5E3F A;  2A68 D;  2PW7 A;  2E2J B;  2BH2 A;  1RTO A;  2EXZ A;  4DFA A;  2QKI C;  4V0B A;  3PMF A;  4ME5 A;  3NBH B;  4ZUJ A;  3GTM H;  3P7J A;  3PV0 A;  4Z9C B;  3NWS A;  1G2T A;  3OHX C;  3I2Z A;  2J4X A;  3K5O A;  4JV5 L;  1UE6 A;  1X3G A;  3EVQ A;  1ET6 A;  3KOJ A;  2NWG A;  3STB D;  1F2L A;  1Y1V G;  2VQE L;  2FJ2 A;  4X66 L;  1QG7 A;  2ZTC A;  1S3O A;  2R7Z H;  1XXG A;  4K14 A;  3E9I A;  5M3F H;  1TWG B;  4EQN A;  4UHV A;  4ZK9 B;  5I9O A;  1XMQ Q;  1GXD C;  3M4Q A;  1XNR L;  1DOL A;  3MC0 B;  2K5V A;  2KHS A;  5A2Q L;  4IPG A;  1JIC A;  5L37 A;  2VUM H;  1GUG A;  4RKB A;  1TII D;  1XX8 A;  3CU7 A;  4EGV A;  1B70 B;  1BBX C;  3U50 C;  4RCN A;  5G3L D;  5IWA L;  3NP8 A;  4LK1 C;  1E2W A;  4BA1 I;  4B08 A;  1N9W A;  2JP1 A;  1Q81 C;  1GHK A;  2QW7 A;  1QJO A;  2C35 B;  2SNS A;  1TY2 A;  5M5Y B;  1U4L A;  3OWF A;  4DR5 L;  3E6Z X;  3VR4 A;  3A5U A;  1EYG A;  4J1M A;  3E9H A;  1EYA A;  1SE8 A;  4IUP A;  1VQB A;  4TSS A;  1K3B C;  4DV3 Q;  5FLM H;  1PH5 A;  1DD2 A;  2O5J C;  3HOY H;  1LO5 D;  5HGT A;  4NKL A;  1MIU A;  3TZU A;  3K7A H;  4JPB W;  4KD4 A;  2F0O A;  4F7X A;  3HOX H;  4CKB A;  1GD7 A;  2IX1 A;  2D62 A;  2KJX A;  3C1F A;  5CV8 A;  1VDZ A;  5FJ8 G;  2JA7 G;  2XTI A;  1IW7 D;  4B3S L;  1B2T A;  1WCM H;  2PMZ B;  3I73 A;  4M1U B;  4H0L C;  3GTQ B;  3RLF A;  3NEL A;  2JA8 B;  1I50 H;  4GLV B;  4K8J A;  1RTN A;  3OMG A;  1VQL A;  1V43 A;  3BJU A;  4A3I G;  4A3G G;  3J81 E;  1CFM A;  4AQY Q;  2XSC A;  3HG9 A;  1D5Z C;  3JAM L;  1Y8P B;  5FLX c;  2F0G A;  4FVM A;  5C4Z A;  4BBS H;  1BF4 A;  1KAA A;  5AJ3 Q;  4JYA L;  3FPP A;  3I90 A;  2ZJP A;  1Y69 U;  1K3R A;  1NMF A;  2PZU A;  4DR4 Q;  1D2B A;  1N34 Q;  3OOC A;  2NVT H;  1ENF A;  2YU9 B;  1KDB A;  2EYL A;  4ZRZ A;  4IFD G;  3GTP B;  1Y8O B;  1VQM A;  4DR6 L;  3BYY B;  2B63 G;  3GTL B;  4B9W A;  2L4N A;  2R92 H;  5COR A;  1KXL A;  3CCE A;  2A6H C;  3HP3 A;  4NDX A;  3WDN A;  1OTC A;  1XJV A;  3LX0 A;  4RWS C;  2CW0 C;  3FMC A;  3LGJ A;  1IBK L;  1VQN A;  2MPM A;  5KGU A;  5DM7 3;  4C3I B;  4DAY A;  3S2D H;  1F9R A;  2KCM A;  1H95 A;  3UDX A;  1I4G A;  4DV3 L;  4QCL A;  2AQ2 B;  3I4M B;  1EIH A;  1FJG Q;  1SE2 A;  4DV0 Q;  3JC6 6;  3A56 A;  2R93 H;  1J8I A;  2Y0S E;  1W6K A;  4CHT B;  2VB2 X;  1GUW A;  2JA9 A;  1FGU A;  5M5W H;  1EFI D;  3DWP A;  1KC8 C;  2D5D A;  4P72 A;  4ZCK A;  2Z6K C;  2R7Z G;  1U9R A;  1BCP D;  2HDM A;  2WAQ E;  2VZA A;  1HTP A;  4R8N A;  4DAY B;  2NTS A;  2RBM A;  1G91 A;  5IYC H;  4WFN 3;  3H3V H;  1K8A C;  1XMO L;  5EQ0 A;  1TKW B;  4WJW A;  2EY2 A;  2VUM G;  1IKL A;  3SHL A;  1MSH A;  4HIM A;  3RZD B;  2B8F A;  3T4A C;  1ET9 A;  4BY1 B;  2EQS A;  4R4O A;  4IZ8 A;  1J5E L;  2JJQ A;  1NSN S;  4IUN A;  1EYD A;  3J80 L;  2K1B A;  2HDL A;  1CKO A;  1MD2 D;  5AJ3 L;  1XPO A;  3OW7 A;  2K5Q A;  4DPG A;  4DR4 L;  1JJC B;  2LMC B;  1N34 L;  3FEW X;  2L5T A;  1STG A;  2SNM A;  4R1J A;  5GAE C;  1D8L A;  4KY5 A;  2QF7 A;  1HNW L;  1YNN C;  5C44 B;  5J22 A;  3GO5 A;  1Q3L A;  2OCE A;  1ICW A;  3NE5 B;  5FLM G;  2TSS A;  1B53 A;  2FHT A;  3HOW H;  5KRU A;  3HOY G;  4QY7 A;  4B3R Q;  4FDB A;  4KTA A;  2QEJ C;  1GUN A;  3M4Y A;  1ASY A;  1S5F D;  3A0J A;  3HOX G;  1D7Q A;  2KED A;  1CUK A;  2Q2T A;  5CYU A;  3PIO A;  4DR7 Q;  2HIX A;  3MA2 B;  5HY6 A;  5JAV A;  2Q8I B;  1A3U A;  1VQI A;  1VQA A;  5E1F A;  4JI0 Q;  4FF1 A;  3Q6S A;  1WCM G;  2I07 B;  3J7Y W;  3PUX A;  1I6H H;  1FJG L;  1SFO H;  3I4M H;  4RHR A;  1DON A;  4XT1 B;  1HUN A;  2CH4 A;  4RGT A;  3MXN A;  4N9T A;  3VA7 A;  2HCI A;  1HJP A;  4UP8 A;  4I7Z C;  3MEF A;  5C5M A;  5C0X I;  2MJ8 A;  3ERS X;  3SK4 A;  5C3X A;  2MUY A;  1PHJ A;  4BBS G;  1K8G A;  1CA5 A;  1X3F A;  5D3D A;  2NBF A;  2V4D A;  4KD3 A;  4B3T Q;  2F1M A;  1KLG D;  1CHQ D;  3H94 A;  1TS2 A;  1IZ6 A;  2HCC A;  4RGM A;  5A2Q E;  4YCV A;  3ERO A;  3MAQ A;  3A7L A;  2IHF A;  2IX0 A;  3MXN B;  1EOT A;  4X3K A;  4LF6 Q;  3HKZ B;  2R92 G;  4G7O C;  3J7A V;  1CTM A;  5BR8 Q;  4C3J G;  3H15 A;  2ZTD A;  2Z6K A;  2B2U C;  1R9T H;  1VQK A;  1PTO C;  3HOV H;  2P5Z X;  1JJ2 A;  3K57 A;  1WTW A;  3NXW A;  5NUC A;  2RF4 A;  3K5L A;  3EJI A;  3PUW A;  3TP7 A;  3AYH B;  4PQX A;  4G57 A;  1LTB D;  1X56 A;  4IUQ A;  5CBE E;  1QNU A;  2RCN A;  4OGQ C;  4B3R L;  2R93 G;  1C8C A;  5ELF A;  5K36 H;  4LFC L;  4JI8 Q;  3ZYY X;  3I4N H;  3S14 H;  3BZC A;  4MN3 A;  1HTL D;  2O5I C;  2EYP A;  5KNC A;  1OXV A;  1BNZ A;  4DR7 L;  1SN8 A;  1O7I A;  3PSI A;  4HED A;  4JI0 L;  1ILQ A;  3P1H A;  2QDL A;  3NQT A;  5D14 A;  1KD1 C;  3D6W A;  2X69 A;  5IYC G;  3RNU A;  5K5P A;  4H02 A;  1CSP A;  4H7B A;  1YIJ A;  1WTQ A;  3WOE A;  1WD1 A;  1VF7 A;  2K5W A;  1I4Q A;  4J6H A;  2QGQ A;  2DNC A;  4PZ7 A;  5EJW A;  5JJL A;  4A3F B;  1C4Q A;  4HAE A;  2J7Z A;  4DK6 C;  2Z4H A;  2A8V A;  1QWY A;  3M7G A;  1V9P A;  4PMW A;  5FO8 B;  1TWH H;  5COY A;  2K5D A;  3TRZ A;  1GUO A;  4B3T L;  4EVO A;  5FKA C;  5LL6 X;  3CCV A;  2PI2 E;  2SDF A;  3KUP A;  5IGB A;  2OQK A;  2F3I A;  1XTC D;  3L9A X;  1D1I A;  3PQI A;  1WTP A;  1SE4 A;  1PZJ D;  3CQZ B;  2EVB A;  5FK9 C;  1L0X B;  5BR8 L;  1AE2 A;  3F2B A;  1KDC A;  4YCU A;  2H5X A;  4RH6 A;  2LXK A;  2R61 A;  1V1P A;  4MNO A;  3IAY A;  3U4V A;  4MHE A;  4CBV A;  4ZYS A;  4A3B B;  1LLR D;  4C2M B;  4CDF C;  1CM9 A;  3K7U C;  1F9Q A;  3A5Z B;  5EBC A;  1VQ5 A;  5ELO A;  4JI8 L;  1STY A;  5IGF A;  4BA2 I;  2I5H A;  4GZY C;  2CKZ B;  2B2U A;  1UE1 A;  2NVY B;  4XYQ A;  1SYD A;  4FP5 D;  4I65 A;  1II3 A;  1TWF B;  1V1P B;  3GTO H;  3GD7 A;  3UDG A;  1PA6 A;  5JJK A;  4K2K A;  1IBM L;  4F88 A;  3M3Y B;  1HUM A;  2EXD A;  4ID6 A;  1ZYR D;  3TDQ A;  2YTY A;  1K0R A;  3PF5 A;  3SE0 A;  5I2X A;  1IBL Q;  3F2U A;  2IJ0 A;  4A93 H;  1J9O A;  1UUP A;  1M8A A;  1YNJ D;  2B8G A;  2JE6 I;  2B39 A;  5JEA J;  4A3D B;  3GP7 A;  2WKD A;  2O4X A;  3H91 A;  2E75 C;  1PTO B;  3KF6 A;  1G6P A;  4A3M B;  1N36 Q;  1J6Q A;  3HOV G;  1JJG A;  3CC4 A;  4A3L H;  5CV7 A;  4LF9 Q;  3ND8 A;  1K8M A;  2MHV A;  2AKW B;  2YV5 A;  4HSV A;  4JBM A;  3G6J B;  1NBW A;  3I55 A;  4LF4 Q;  3CCL A;  4L5T A;  3R2T A;  1F2Z A;  1B7Y B;  1UE7 A;  3KJP A;  2AQ3 B;  3TSS A;  4MIU A;  5K36 G;  5KYL A;  3I4N G;  5EBD A;  5T1I A;  5CV4 A;  3BVM A;  4JI2 Q;  2F0S A;  3C2P A;  3S1M H;  1JC7 A;  3MVV A;  1KNA A;  4QIW E;  4HR7 B;  3CCU A;  2XRS D;  4JW0 A;  1SYF A;  2D2C C;  2QDB A;  4F87 A;  5LMU Q;  3TS0 A;  4JI5 Q;  1FNU A;  2H4O A;  3GV6 A;  1YJW A;  3J81 L;  2ZM6 Q;  2RSN A;  1YHB A;  2B2W C;  2QIL A;  3PUZ A;  1Q8I A;  2LXJ A;  4IO9 A;  3HOZ B;  4A4I A;  1VQ4 A;  2KEN A;  3HFZ B;  2UXB L;  3DUZ A;  2VB3 X;  4P74 A;  2A6E D;  2E2H B;  1A3T A;  1PYW D;  1EQR A;  2Z9H A;  1X65 A;  3SXH A;  1F2Y A;  5CC4 A;  2XRQ D;  1E3P A;  4A3G B;  4APV A;  2WII B;  1JE4 A;  4P71 A;  4B3M L;  2RSO A;  2PZW A;  1B1Z A;  2B3G A;  2WB1 G;  1GM5 A;  4YWL A;  1GJX A;  1EIF A;  4TQU S;  1JR0 D;  2CFM A;  1TXY A;  4UDU C;  3NHH A;  4P73 A;  3DM3 A;  1X6O A;  1N36 L;  1M4V A;  4KY7 A;  1EUJ A;  3W2D A;  4RGO S;  1Q8K A;  3KYH C;  4AYB B;  4C1N K;  4GNX B;  1TWC B;  2F0D A;  4LF4 L;  2MP1 A;  4JOI C;  2E2I B;  5G3L F;  1K0S A;  3I4O A;  4BBR B;  4NMZ A;  2E76 C;  1UWV A;  1WTV A;  3OW2 A;  3CKI B;  1VCI A;  2K50 A;  1SYG A;  4GN4 B;  5IT9 c;  4JI2 L;  1LM0 A;  4XT3 B;  2K03 A;  3IL8 A;  1HCZ A;  3HKS A;  4JI4 L;  3TME A;  2R3Z A;  1PH4 A;  2HT1 A;  5F2D A;  1SAP A;  3IKJ A;  4FF3 A;  5LMU L;  3E0J A;  4JI5 L;  3EBE A;  4X65 L;  3NTK A;  4CJ2 C;  2XWB B;  2ZM6 L;  3QR8 A;  4TKO B;  3HS0 C;  4A93 G;  2UUC L;  2C5C A;  2KQ3 A;  3OTO Q;  1PH3 A;  4A3J H;  4BY7 H;  2XVS A;  3GTJ B;  4R9W A;  3S1Q B;  5DM6 3;  2EYJ A;  3K0Y A;  1I4R A;  3GQB A;  1FNV A;  3LWU A;  1K8O A;  1W3S A;  2DY8 A;  5M3M B;  1HHV A;  4KJO A;  4JG2 A;  4A3L G;  1JWM D;  1SND A;  2L12 A;  1PRT C;  2UXC L;  3KLS A;  4J8Q A;  4JVZ A;  3RZO B;  2E8G A;  2DJF C;  1ICF B;  2R6G A;  3H0G H;  4Q0F A;  3U9O A;  2B2W A;  5GAH C;  3D4D A;  3RN2 A;  1VQ7 A;  2RHS B;  4KHP Q;  3SR1 A;  1A0I A;  1EZ8 A;  3CW2 C;  1JWS D;  1Z6H A;  3S16 B;  1M90 C;  1QVC A;  3A8I E;  3I3C A;  4MTN A;  2BCO A;  4GS3 A;  2JYO A;  1EY7 A;  3L2P A;  1I3Q H;  2IPK D;  2JA5 H;  3QJY A;  4G7H C;  1KTK A;  2NVX H;  2FIN B;  1XWE A;  3QO2 A;  1LT4 D;  1SJE D;  1ESR A;  1HFG A;  3RD4 A;  2JN4 A;  1RKN A;  2B29 A;  1PTO D;  1JCK B;  2RA4 A;  3OPO A;  1LTR D;  3PUY A;  1XPR A;  2ZXO A;  3BDC A;  4BXX H;  1EQV A;  2K4K A;  2HQE A;  3I91 A;  4JI1 Q;  2UUB Q;  2BH8 A;  3PIP 3;  4RFB A;  5JJI A;  4HIO A;  2HQL A;  4JOI A;  5BN3 A;  3DM1 A;  1CT1 D;  1XTD A;  1T5E A;  2F4V L;  3U9S A;  1CZG A;  3LWE A;  1N32 L;  3KF8 A;  3G6E A;  3OTO L;  3NK9 A;  2K52 A;  1BR9 A;  1ENA A;  4DGZ A;  1BCP F;  2KVM A;  3MFG A;  2EDG A;  1EIY B;  4OHJ A;  3OWE B;  4KY6 A;  4DNI A;  4DR3 Q;  3L3O C;  3BVG A;  5M5X B;  3SVM A;  5C4J H;  1MI2 A;  2ICI A;  5M3M H;  2XGT A;  4M8A A;  4KKT A;  1EIG A;  1KL9 A;  1Y1W B;  3WOF A;  4PMB A;  1JE5 A;  1Z7T A;  4C3J B;  4LF7 Q;  2JEA I;  5IOC A;  2B2V C;  2DY7 A;  2M2L A;  2I5L X;  3KF8 B;  1PV4 A;  2E2J H;  3HZX A;  4AIM A;  2Z6B A;  1CA6 A;  1FD7 D;  3WWV A;  1E0B A;  1SNM A;  1AH9 A;  3F8T A;  2CHB D;  2KHI A;  1DOK A;  1H9M A;  1MGS A;  3DEP A;  1SMX A;  4KI0 A;  5LHY 1;  1PDQ A;  3DWA A;  1IYJ B;  1YIT A;  1PFN A;  3W1G A;  4ZAI A;  2NVQ B;  5C5L A;  4JI7 Q;  3KK7 A;  2MNA A;  3KLR A;  3D0F A;  4WJ4 A;  4OEL B;  1L1O C;  2M00 A;  1EWI A;  4JI1 L;  2UUB L;  3HOU B;  4A3J G;  4BY7 G;  5C3E B;  3S17 B;  1JOK A;  1R4P B;  1CKN A;  5FLX E;  3QWN A;  1XMQ L;  1TWG H;  1EY6 A;  3A8K E;  4CKC A;  3UE1 A;  2QEX A;  2JA6 B;  4NXN Q;  1PRT B;  5IP9 H;  2EOT A;  3T1H Q;  3MTS A;  1I4H A;  3KBG A;  1EEI D;  3FKI B;  2EYF A;  1LT5 D;  1TT2 A;  1F9P A;  1HNX Q;  2CCZ A;  4E6I A;  3LNN A;  1YNX A;  3H0G G;  4L63 B;  1T5X D;  1X32 A;  2A1A A;  1H9R A;  4DR3 L;  5D65 A;  1SBB B;  1DGS A;  1WJJ A;  3KBX A;  3TEH B;  3AMU A;  1SRU A;  1Q7Y C;  1CKN B;  5M5Y H;  2IY5 B;  4DR1 Q;  4OWT B;  3K81 C;  2BOS A;  2JA5 G;  5CV5 A;  3URY A;  4GKK Q;  3RR5 A;  2F0M A;  3T56 B;  3S2H B;  5JPN C;  4DKA C;  4XQQ A;  1NJI C;  2ENB A;  3T16 A;  4IUT A;  4K5X A;  5DNF A;  1HZ9 A;  5C0X J;  4P2C B;  1A15 A;  3D3R A;  4KLK A;  2M9V A;  1PFS A;  5HGQ A;  4A3E B;  1G2S A;  4DN4 M;  4BXX G;  4R4Q A;  4KV6 A;  4MTK A;  2QA4 A;  5M3F G;  5J1Z A;  1A8V A;  1Q1E A;  2KBN A;  2WV6 D;  3DHQ A;  3VYU A;  1HZC A;  2GN5 A;  4DUZ Q;  3GTQ H;  4OO1 I;  3D6C A;  3PO3 B;  5EPJ A;  1RCV D;  2JA8 H;  4JI7 L;  2HHH Q;  3DLL A;  1HRJ A;  4CJ0 B;  4AQY L;  1ML0 D;  2B2V A;  2Z0S A;  4HID A;  1EY4 A;  4G7Z C;  4ZKC B;  3CC2 A;  1SYC A;  4CDE C;  1VQG A;  2VQF Q;  4NXN L;  4RA8 A;  1JQY D;  3K8A A;  3VDY A;  3T1H L;  2Y0S B;  5C4X B;  1NR4 A;  1K28 A;  4DK1 A;  1RDP D;  1TS4 A;  2YU9 H;  1HNX L;  1MHW C;  3GTP H;  2PPB C;  4N8F A;  2NUC A;  3Q24 A;  3K5M A;  3GTL H;  2R7D A;  1EU3 A;  3D31 A;  1L1O A;  2WAQ B;  4DV1 Q;  1S40 A;  1WD0 A;  3QOJ A;  1EQT A;  5AFW A;  5IGD A;  3EQL C;  5I2Y A;  1BKB A;  1SNO A;  1AN8 A;  1WTO A;  1WTR A;  5EPL A;  3AU7 A;  3IFT A;  2ZXP A;  4DR1 L;  4FF4 A;  1YBY A;  4C3I H;  1QVG A;  4O0A A;  2IX3 A;  4GKK L;  2EJG C;  3EIV A;  3K59 A;  4DV0 L;  3FDT A;  3C46 A;  4GLX A;  1UEA B;  1STE A;  2XIW A;  4IUR A;  4L5Q A;  4ME3 A;  3I4L A;  3NTH A;  1L1O B;  4A3E H;  1CZW A;  1O80 A;  4IPH A;  1H9K A;  2VS1 A;  4PZ8 A;  1TVX A;  3M4O B;  2F0U A;  3CCQ A;  4N8X 1;  4A3K B;  3NEM A;  4DUZ L;  4HCE A;  1XNQ Q;  2OEO A;  1S5D D;  1GO3 E;  3B6Y A;  5IE8 A;  5IP9 G;  1QOH A;  2AQ1 B;  2HHH L;  2MQH A;  4YWK A;  3RZD H;  2N8N A;  3DEO A;  4DV2 Q;  2SOB A;  4BY1 H;  4RAU C;  1CQF A;  1S5C D;  1WFQ A;  1D1K A;  3OSO A;  1L0W A;  2PZT A;  3S15 B;  1DCZ A;  1WI5 A;  3CD6 A;  1B44 D;  4DXF A;  2VQF L;  4DK0 A;  1OXT A;  3UI2 A;  3ER0 A;  5BN5 A;  2UU9 Q;  5JPM C;  4RG1 A;  1JOO A;  1MJE A;  4GKJ Q;  2FXQ A;  1YVC A;  1RJT A;  5C44 H;  1CSQ A;  4GN5 A;  1A63 A;  1U4M A;  4DV1 L;  2K32 A;  2RDG A;  2BE5 C;  3V2T A;  2PQA A;  1FGB D;  3PF4 A;  2PO4 A;  4A3C H;  1S4Z A;  5GRO A;  1PRT D;  3W3A A;  1DJR D;  1U4R A;  5IT9 L;  1SLJ A;  4BS9 A;  1PVO A;  3K0X A;  1SYE A;  1SSO A;  1LTL A;  4UP9 A;  1NR2 A;  3N6R A;  3ULP A;  2NB0 A;  5C0X H;  2JA8 G;  4OXP A;  1V1O A;  4LFB Q;  1C0A A;  2RDF A;  4CGY B;  1KNE A;  4HTH A;  2PQA B;  3X3N A;  2LKV A;  1LTT D;  4JI6 Q;  3PUV A;  1Q86 C;  1PYS B;  2NZ1 D;  3ZJY C;  4JI3 Q;  4DAM A;  1XNQ L;  1G6Z A;  3S1N B;  3GTK B;  2GVB A;  2N49 A;  2E2D C;  3K5N A;  3JAM c;  2JEB I;  2JSO A;  1B9N A;  4JCV E;  5I6W A;  1Q82 C;  1IYV A;  4LF6 L;  1A2T A;  5LMN W;  2O2L D;  5I9P A;  3HOW G;  3PO2 B;  1TWA B;  1GVP A;  2PI2 A;  2A73 B;  3VR6 A;  4C3H B;  1STN A;  2G9D A;  2CQO A;  2OTJ A;  2B2T C;  1Q1B A;  3RMH A;  2UU9 L;  1KHI A;  4XDX A;  1VQE A;  4GKJ L;  2NN6 H;  1KRS A;  4DV5 Q;  2F0I A;  4C3I G;  3I72 A;  5ELD A;  1IW7 C;  1ZXT A;  3EN2 A;  4GNX C;  3A55 A;  4LFA Q;  4YY3 Q;  4IOC A;  4LF5 Q;  5I6Y A;  3I4M G;  1QZH A;  1LUZ A;  1K83 B;  2KCC A;  3BYT B;  2N88 A;  4XYO A;  4HIK A;  5LMN Q;  2L15 A;  4JK1 C;  1BXT A;  1KIX A;  1VS0 A;  2OTL A;  3AB9 A;  1A2U A;  4QJF A;  1RL2 A;  4DA2 A;  1N8R C;  5I4D A;  4NW2 A;  4X62 Q;  2D0O A;  1Y1V B;  3KFU A;  4LJZ C;  2C9O A;  4IQZ A;  2BA0 A;  1PXU A;  1SNC A;  1M1K C;  1U4P A;  3W1B A;  2Q2U A;  2Z4I A;  2N3S A;  3A54 A;  4JC0 A;  4BY1 G;  4A3F H;  4JI6 L;  1EEF D;  2RDH A;  2Q2I A;  5IGE A;  3R2I A;  1EY0 A;  4JI3 L;  1W2B A;  4KHV A;  1O7Y A;  4RMF A;  3J7A 5;  4POF A;  2ALY B;  3TP6 A;  1DXM A;  1HXY D;  3PIO 3;  4IFD J;  2F0T A;  1U0L A;  5IYB H;  4DAV A;  3J80 c;  3UDI A;  5C44 G;  3CAM A;  1YHA A;  2F0V A;  4YIJ A;  1V8Q A;  3CQZ H;  4XQJ A;  1CI3 M;  1TS5 A;  3NQI A;  1TWA H;  1ROD A;  1H9J A;  2EPB A;  2BA1 A;  1TS3 A;  3ICE A;  4A3C G;  1BVS A;  4FNF A;  2I0Q A;  4A3B H;  1C7Y A;  3CXC A;  2WP8 J;  4C2M H;  5A35 A;  3K80 C;  4LFA L;  4Y7N B;  3BZK A;  4K8I A;  1ZEQ X;  2A6H D;  3S9W A;  3CCR A;  4LF5 L;  4A75 A;  2Q8R E;  1Q12 A;  2CW0 D;  1H9S B;  2JA7 B;  2ZXR A;  5GQO A;  1XPU A;  2NVY H;  4GOP B;  3TP8 A;  2B2T A;  5FLX L;  1TWF H;  4LNQ A; 
#chains in the Genus database with same CATH homology
 4S3S A;  5C6A A;  1EY9 A;  5EGT A;  3MHB A;  1PTO F;  4A3I B;  1EL0 A;  5CR3 A;  1IYU A;  2F03 A;  3S1R B;  2QCP X;  4QIW B;  1QIL A;  2CVR A;  4QUC A;  1PTO H;  5LL6 S;  3IFD A;  4NP5 A;  2FMC A;  3SEB A;  4PNY A;  1UNS A;  5T1G A;  5C3W A;  1O7Z A;  2NN6 G;  2B63 B;  5C4H A;  2L1B A;  4IFD I;  2LFN A;  5EKI A;  3Q22 A;  1VMC A;  4FXG C;  3QB3 A;  3QIA A;  1B3A A;  1Y8N B;  2K33 A;  3MXG A;  3GTM B;  1LAC A;  1YNN D;  2L0C A;  1S5E D;  5IT9 E;  1WVL A;  2WIN B;  3NTI A;  3C1E A;  4C56 C;  1RD9 D;  3Q0A A;  2F0F A;  4WOR A;  2EJM A;  5KIX A;  3CRK C;  3VR5 A;  2R7Z B;  4B9X A;  4IUV A;  5M3F B;  4KHZ A;  4OL7 A;  1E2V A;  2F0Q A;  4K5W A;  2ZT9 C;  3T53 B;  3H3V C;  1JB3 A;  4XQN A;  2VUM B;  2LS0 1;  2EYO A;  1W6J A;  2F0N A;  3TBI B;  3BG3 A;  1O78 A;  2TMP A;  5JEA H;  2X6G A;  3FPU B;  5CMD A;  2VNU D;  2IL8 A;  1X3Q A;  4X3U A;  1BCP B;  2K04 A;  3GTG B;  3TP5 A;  3HOY B;  1EU4 A;  1TR5 A;  4LAA A;  3K7A B;  3MWY W;  3HOX B;  2IT1 A;  3I8Z A;  2EYM A;  1MSG A;  4KKU A;  4KMU C;  4ODG A;  1TY0 A;  1WCM B;  4HMI A;  3R8B A;  1I50 B;  2BE5 D;  3EFX D;  1XYI A;  4RKL A;  5E4X A;  2J0T D;  4BBS B;  5JVH 3;  2RVL A;  4U68 A;  1RHP A;  1DM0 B;  4PMC A;  4QF4 A;  3CRL C;  1HPC A;  1D5X C;  1B4O A;  2NVT B;  4XTC S;  5JJZ A;  2AWO A;  5FO9 B;  1QE6 A;  4IN3 A;  2R92 B;  3D8G A;  1ZKO A;  4IAL A;  1S5B D;  4WRD A;  5EKL A;  1SDF A;  1GUS A;  1PZK D;  3S2D B;  4KK7 A;  3MEH A;  2R93 B;  2PYK A;  5KNB A;  1G29 1;  4FYD A;  3ONA B;  5M5W B;  1ZYR C;  1DZ1 A;  3G7L A;  5ISR A;  4K6D A;  5IIF A;  1YNJ C;  1SE3 A;  2N55 A;  2EZV A;  1FYC A;  1OO9 B;  2F4I A;  2A69 C;  2RQX A;  3EA6 A;  3K6O A;  4K5V A;  1Q90 A;  2X6L A;  2VXW A;  5IGG A;  4H13 C;  3KLS X;  1HQM C;  2K6A A;  5JEA G;  1L0Y B;  2HUG A;  3BS1 A;  2KEC A;  2AWN A;  3BDO A;  5M9O A;  3OIP A;  3P20 A;  4KN7 C;  2F0K A;  4DXG A;  1JWU D;  2KCN A;  2SEB D;  3TZD A;  2G9H D;  3HOW B;  2YYZ A;  1BDO A;  3M85 A;  3VA5 A;  1I4X A;  1EWH A;  1SJH D;  2H1E A;  1SMY C;  1HA6 A;  5CV9 A;  1LTG D;  1SYB A;  4EQO A;  2WAC A;  1I6H B;  3RUZ A;  1SFO B;  2EY6 A;  2A6E C;  1EY5 A;  2B2Y C;  3FRP B;  1SEB D;  1E2Z A;  1ENC A;  2XNA C;  1PRT F;  2FMM A;  3J7A F;  4DU9 A;  1A6X A;  3I70 A;  1CQV A;  3OIQ A;  5TSS A;  3VR2 A;  2AUK A;  2D9U A;  2OXP A;  3CHB D;  4RCO A;  2F0E A;  1LAB A;  1X3P A;  1LT6 D;  2IWH A;  1R9T B;  2OF1 A;  4Q5V A;  3HOV B;  1AEX A;  1PFB A;  5HUR A;  2BDN A;  4N9P A;  2IW3 A;  3VYR A;  1NAP A;  2L9H A;  1BO0 A;  2F0J A;  2FFK B;  1EZ6 A;  2EJF C;  5JOB A;  2F0L A;  1AZQ A;  2EE1 A;  3DXJ C;  3ITP A;  4QUF A;  2EY1 A;  3I4N B;  3S14 B;  3NPP A;  3L7Z C;  5CBA E;  1SNP A;  2MGS A;  1FNW A;  2K01 A;  2KA7 A;  1BOS A;  2KEE A;  4XXE A;  1OXU A;  4OO1 H;  5DAU A;  3TN2 A;  1A3V A;  4FF2 A;  2NYZ D;  3DMU A;  4K2L A;  1F77 A;  1AW7 A;  1TQO A;  1D6E C;  1OXX K;  1GOZ A;  5FOB B;  1TWH B;  2A68 C;  4ZKB B;  1NUC A;  1TU2 B;  1AFP A;  1MBY A;  4FXK C;  2B2Y A;  2WKC A;  4CJ1 B;  2PQE A;  5FO7 B;  2WB1 B;  1OXS C;  4QB4 A;  4DAP A;  1PFM A;  4FO2 A;  2EYH A;  1F2M A;  4K6L A;  3Q23 A;  2NTT A;  3R93 A;  2RKS A;  4ULL A;  4X3S A;  3MFY A;  3HRZ C;  2AUJ D;  2NN6 I;  2GA4 B;  4IUU A;  1NCV A;  3H09 A;  1GHJ A;  1B50 A;  5D3I B;  1ESF A;  2F0P A;  3SK5 A;  5EPK A;  4RGN A;  3GTO B;  4F8M A;  1PMR A;  3SK8 A;  1SNQ A;  3NBI A;  3M7N A;  4DNR B;  4A93 B;  1GUT A;  1AP0 A;  2F0H A;  3JAM E;  3SK6 A;  3A7A B;  1EYC A;  4ZLT F;  3ND9 A;  4UAI A;  1FR3 A;  3QOL A;  4EQP A;  4H44 C;  1STB A;  3A8J E;  2XN9 C;  4DF7 A;  3NSW A;  2Z8L A;  4O1N A;  3S1M B;  5IGC A;  2A5H A;  2DN8 A;  4OO1 G;  1PLF A;  1F9S A;  5ELE A;  4XIG S;  2K05 A;  1QNK A;  1O7L A;  2CQA A;  1VF5 C;  5DEH A;  2EY5 A;  1I4P A;  4HCS A;  3ERQ A;  4G4K A;  2BDO A;  1STH A;  5KND A;  3V96 A;  3VYT A;  3NWT A;  1CHP D;  3MZ5 A;  3VR3 A;  1H9S A;  3J80 E;  1D5M C;  4PV1 C;  2A69 D;  4QMG A;  2F3V A;  2F3W A;  1ONL A;  4V19 0;  3DWQ A;  3NUC A;  1LT3 D;  1KDA A;  4BWG B;  1HA5 A;  3BDL A;  3O13 A;  3BZD B;  3N52 A;  4C1N I;  1BCP C;  1CK1 A;  1RF2 D;  5BN4 A;  1QB5 D;  3SDZ A;  1G8Z D;  3QG1 A;  1IKM A;  4ZUI A;  5C0X G;  1HFN A;  2I46 A;  3C3L A;  3T13 A;  4LMQ D;  2KUM A;  3OMC A;  4L8J A;  4FXD A;  4X3T A;  3BVZ A;  2L11 A;  2XWJ B;  2Z1C A;  3V05 A;  4KKS A;  3P75 A;  1DOM A;  4ZQ3 A;  4L6T B;  2ID0 A;  1SMY D;  3H6M A;  1IL8 A;  4A3J B;  4BY7 B;  4O42 A;  4HMJ A;  2JXM B;  2A74 C;  5E4W C;  3T51 B;  2K7V A;  1AZP A;  2PNR C;  2KOL A;  5ELC A;  4RHS A;  1BQQ T;  1KAB A;  3H0G B;  3X3M A;  2DNE A;  4OIK A;  4DNT B;  3D4R A;  3FVQ A;  1ILP A;  1C48 A;  1QCB D;  3GV3 A;  3R3O A;  1I3Q B;  2LY7 A;  3K58 A;  2JA5 B;  4R8I A;  2NVX B;  1R4Q B;  1VMP A;  1LTA D;  4OIJ A;  2PW5 A;  3D4W A;  1LTI D;  1SXT A;  2Q8T A;  5J39 A;  4HSP A;  4KJN A;  1KLU D;  1WTX A;  1B9M A;  2ICE C;  4JBW A;  3MXP A;  3VYS A;  1I6V C;  3E5S A;  2K28 A;  4ILW A;  4U67 3;  5JVG 3;  3HEJ A;  1LV9 A;  1UAP A;  1HQR D;  5IOD A;  1EY8 A;  2PCF B;  1BUV T;  4ABN A;  5CGK A;  5EKK A;  2E74 C;  1EWC A;  1LTS D;  2OT2 A;  4CKE A;  4KN4 C;  1STA A;  5KYI A;  1JOQ A;  5ELB A;  2F0W A;  3NBH A;  4HN7 A;  5C4J B;  1DYQ A;  1IHZ A;  3HGB A;  4C3H G;  5KEE A;  4IFD H;  2L55 A;  4TRD A;  1PZI D;  1Z47 A;  1JOR A;  5CV6 A;  3MXU A;  5E3F A;  2A68 D;  2PW7 A;  2E2J B;  1RTO A;  2EXZ A;  4DFA A;  2QKI C;  4V0B A;  3PMF A;  4ME5 A;  4ZUJ A;  3P7J A;  3PV0 A;  4Z9C B;  3NWS A;  1G2T A;  3OHX C;  2J4X A;  3K5O A;  3EVQ A;  1ET6 A;  2NWG A;  1F2L A;  2FJ2 A;  1QG7 A;  1XXG A;  4K14 A;  1TWG B;  4EQN A;  4ZK9 B;  5I9O A;  1GXD C;  1DOL A;  3MC0 B;  2KHS A;  5A2Q L;  1JIC A;  1GUG A;  4RKB A;  1TII D;  1XX8 A;  3CU7 A;  4EGV A;  1BBX C;  4RCN A;  5G3L D;  3NP8 A;  4LK1 C;  1E2W A;  4BA1 I;  4B08 A;  2JP1 A;  1GHK A;  1QJO A;  2SNS A;  1TY2 A;  5M5Y B;  1U4L A;  3OWF A;  3E6Z X;  3VR4 A;  4J1M A;  4IUP A;  1EYA A;  4TSS A;  1DD2 A;  2O5J C;  1LO5 D;  5HGT A;  4NKL A;  3TZU A;  4KD4 A;  2F0O A;  4F7X A;  4CKB A;  2IX1 A;  2D62 A;  2KJX A;  3C1F A;  5CV8 A;  1VDZ A;  1IW7 D;  1B2T A;  2PMZ B;  3I73 A;  4M1U B;  4H0L C;  3GTQ B;  3RLF A;  2JA8 B;  4K8J A;  1RTN A;  3OMG A;  1V43 A;  3J81 E;  1CFM A;  2XSC A;  3HG9 A;  1D5Z C;  3JAM L;  1Y8P B;  2F0G A;  4FVM A;  5C4Z A;  1BF4 A;  1KAA A;  3FPP A;  3I90 A;  1Y69 U;  2PZU A;  1D2B A;  3OOC A;  1ENF A;  2YU9 B;  1KDB A;  2EYL A;  4ZRZ A;  4IFD G;  3GTP B;  1Y8O B;  3BYY B;  3GTL B;  4B9W A;  2L4N A;  5COR A;  2A6H C;  3HP3 A;  4NDX A;  3WDN A;  3LX0 A;  4RWS C;  2CW0 C;  3FMC A;  2MPM A;  5KGU A;  5DM7 3;  4C3I B;  4DAY A;  1F9R A;  1I4G A;  4QCL A;  2AQ2 B;  3I4M B;  1EIH A;  1SE2 A;  3A56 A;  1J8I A;  1W6K A;  4CHT B;  2VB2 X;  1GUW A;  1EFI D;  3DWP A;  2D5D A;  1U9R A;  1BCP D;  2HDM A;  1HTP A;  4R8N A;  2NTS A;  2RBM A;  1G91 A;  4WFN 3;  5EQ0 A;  1TKW B;  4WJW A;  2EY2 A;  1IKL A;  3SHL A;  1MSH A;  3RZD B;  2B8F A;  3T4A C;  1ET9 A;  4BY1 B;  4IZ8 A;  1NSN S;  4IUN A;  1EYD A;  3J80 L;  2K1B A;  2HDL A;  1MD2 D;  3OW7 A;  2K5Q A;  2LMC B;  3FEW X;  2L5T A;  1STG A;  2SNM A;  4KY5 A;  2QF7 A;  1YNN C;  5C44 B;  5J22 A;  3GO5 A;  1Q3L A;  3NE5 B;  1ICW A;  2TSS A;  1B53 A;  2FHT A;  5KRU A;  4KTA A;  2QEJ C;  1GUN A;  3M4Y A;  1S5F D;  2KED A;  5CYU A;  3MA2 B;  5JAV A;  2Q8I B;  1A3U A;  5E1F A;  4FF1 A;  3Q6S A;  2I07 B;  3J7Y W;  3PUX A;  4RHR A;  1DON A;  4XT1 B;  1HUN A;  4RGT A;  3MXN A;  4N9T A;  3VA7 A;  2HCI A;  4I7Z C;  5C5M A;  5C0X I;  2MJ8 A;  3SK4 A;  5C3X A;  2MUY A;  1CA5 A;  5D3D A;  2NBF A;  2V4D A;  4KD3 A;  2F1M A;  1KLG D;  1CHQ D;  3H94 A;  1TS2 A;  2HCC A;  4RGM A;  5A2Q E;  3ERO A;  3MAQ A;  3A7L A;  2IX0 A;  1EOT A;  4X3K A;  3HKZ B;  4G7O C;  3J7A V;  1CTM A;  4C3J G;  2B2U C;  1PTO C;  3K57 A;  1WTW A;  3NXW A;  5NUC A;  3K5L A;  3EJI A;  3PUW A;  3TP7 A;  4PQX A;  4G57 A;  1LTB D;  4IUQ A;  5CBE E;  1QNU A;  4OGQ C;  1C8C A;  5ELF A;  5K36 H;  3ZYY X;  4MN3 A;  1HTL D;  2O5I C;  2EYP A;  5KNC A;  1OXV A;  1BNZ A;  4HED A;  1ILQ A;  3P1H A;  3NQT A;  5D14 A;  3D6W A;  2X69 A;  5K5P A;  4H7B A;  1WTQ A;  3WOE A;  1WD1 A;  1VF7 A;  2K5W A;  1I4Q A;  4J6H A;  2DNC A;  5EJW A;  4A3F B;  1C4Q A;  4HAE A;  2J7Z A;  2Z4H A;  1QWY A;  3M7G A;  4PMW A;  5FO8 B;  5COY A;  2K5D A;  1GUO A;  4EVO A;  5FKA C;  5LL6 X;  2SDF A;  3KUP A;  5IGB A;  1XTC D;  3L9A X;  1D1I A;  1WTP A;  1SE4 A;  1PZJ D;  3CQZ B;  2EVB A;  5FK9 C;  1L0X B;  1KDC A;  4RH6 A;  2R61 A;  1V1P A;  3IAY A;  4MHE A;  4CBV A;  4ZYS A;  4A3B B;  1LLR D;  4C2M B;  1CM9 A;  1F9Q A;  5EBC A;  1STY A;  5IGF A;  4BA2 I;  4GZY C;  2B2U A;  2NVY B;  1SYD A;  4FP5 D;  4I65 A;  1II3 A;  1TWF B;  1V1P B;  3GD7 A;  4K2K A;  3M3Y B;  4F88 A;  1HUM A;  4ID6 A;  1ZYR D;  3TDQ A;  3SE0 A;  5I2X A;  3F2U A;  2IJ0 A;  1J9O A;  1UUP A;  1M8A A;  1YNJ D;  2B8G A;  2JE6 I;  2B39 A;  5JEA J;  4A3D B;  3GP7 A;  2WKD A;  2O4X A;  3H91 A;  2E75 C;  1PTO B;  4A3M B;  5CV7 A;  3ND8 A;  1K8M A;  2MHV A;  4HSV A;  3G6J B;  3R2T A;  1F2Z A;  2AQ3 B;  3TSS A;  4MIU A;  5K36 G;  5KYL A;  5EBD A;  5T1I A;  5CV4 A;  3BVM A;  2F0S A;  3C2P A;  1JC7 A;  3MVV A;  1KNA A;  4HR7 B;  2XRS D;  1SYF A;  2D2C C;  2QDB A;  4F87 A;  1FNU A;  2H4O A;  3GV6 A;  3J81 L;  2RSN A;  2B2W C;  2QIL A;  3PUZ A;  1Q8I A;  3HOZ B;  3DUZ A;  2VB3 X;  2A6E D;  2E2H B;  1A3T A;  1PYW D;  3SXH A;  1F2Y A;  5CC4 A;  2XRQ D;  4A3G B;  2WII B;  1JE4 A;  2RSO A;  2PZW A;  1B1Z A;  1GJX A;  4TQU S;  1JR0 D;  4UDU C;  3NHH A;  1M4V A;  4KY7 A;  3W2D A;  4RGO S;  4AYB B;  4C1N K;  1TWC B;  2F0D A;  2MP1 A;  2E2I B;  5G3L F;  4BBR B;  4NMZ A;  2E76 C;  1WTV A;  3CKI B;  1VCI A;  1SYG A;  4XT3 B;  2K03 A;  3IL8 A;  1HCZ A;  3TME A;  2R3Z A;  5F2D A;  1SAP A;  3IKJ A;  4FF3 A;  3E0J A;  3NTK A;  4CJ2 C;  2XWB B;  4TKO B;  3HS0 C;  2C5C A;  2KQ3 A;  2XVS A;  3GTJ B;  4R9W A;  3S1Q B;  5DM6 3;  2EYJ A;  3K0Y A;  1I4R A;  3GQB A;  1FNV A;  3LWU A;  1K8O A;  2DY8 A;  5M3M B;  1HHV A;  4KJO A;  1JWM D;  1SND A;  2L12 A;  1PRT C;  3KLS A;  4J8Q A;  3RZO B;  4Q0F A;  2R6G A;  3U9O A;  2B2W A;  3D4D A;  3SR1 A;  1EZ8 A;  1JWS D;  1Z6H A;  3S16 B;  3A8I E;  3I3C A;  2BCO A;  2JYO A;  1EY7 A;  2IPK D;  3QJY A;  4G7H C;  1KTK A;  2FIN B;  1XWE A;  3QO2 A;  1LT4 D;  1SJE D;  1ESR A;  1HFG A;  3RD4 A;  1RKN A;  1PTO D;  1JCK B;  2RA4 A;  3OPO A;  1LTR D;  3PUY A;  2ZXO A;  3BDC A;  1EQV A;  2HQE A;  3I91 A;  3PIP 3;  4RFB A;  5BN3 A;  3DM1 A;  1CT1 D;  1T5E A;  3U9S A;  1CZG A;  3LWE A;  3KF8 A;  3NK9 A;  1BR9 A;  1ENA A;  4DGZ A;  1BCP F;  2KVM A;  3MFG A;  2EDG A;  4OHJ A;  3OWE B;  4KY6 A;  3L3O C;  3BVG A;  5M5X B;  3SVM A;  1MI2 A;  2ICI A;  4M8A A;  4KKT A;  1EIG A;  1Y1W B;  3WOF A;  4PMB A;  1Z7T A;  4C3J B;  2JEA I;  5IOC A;  2B2V C;  2DY7 A;  2M2L A;  3HZX A;  1CA6 A;  1FD7 D;  1E0B A;  1SNM A;  2CHB D;  1DOK A;  1H9M A;  1MGS A;  3DEP A;  4KI0 A;  5LHY 1;  1PDQ A;  3DWA A;  1PFN A;  4ZAI A;  2NVQ B;  5C5L A;  3KK7 A;  3KLR A;  2M00 A;  3HOU B;  5C3E B;  3S17 B;  1JOK A;  1R4P B;  5FLX E;  3QWN A;  1EY6 A;  3A8K E;  4CKC A;  2JA6 B;  1PRT B;  2EOT A;  3MTS A;  1I4H A;  3KBG A;  1EEI D;  3FKI B;  2EYF A;  1LT5 D;  1TT2 A;  1F9P A;  4E6I A;  3LNN A;  4L63 B;  1T5X D;  1X32 A;  1H9R A;  5D65 A;  1SBB B;  3KBX A;  3AMU A;  2BOS A;  5CV5 A;  3URY A;  2F0M A;  3T56 B;  3S2H B;  5JPN C;  4XQQ A;  2ENB A;  3T16 A;  4IUT A;  4K5X A;  5DNF A;  5C0X J;  4P2C B;  1A15 A;  3D3R A;  2M9V A;  4A3E B;  1G2S A;  4DN4 M;  4KV6 A;  5J1Z A;  1Q1E A;  2WV6 D;  3DHQ A;  3VYU A;  4OO1 I;  3D6C A;  3PO3 B;  5EPJ A;  1RCV D;  1HRJ A;  4CJ0 B;  1ML0 D;  2B2V A;  1EY4 A;  4G7Z C;  4ZKC B;  1SYC A;  4RA8 A;  1JQY D;  2Y0S B;  5C4X B;  1NR4 A;  4DK1 A;  1RDP D;  1TS4 A;  2PPB C;  2NUC A;  3Q24 A;  3K5M A;  1EU3 A;  3D31 A;  2WAQ B;  1WD0 A;  3QOJ A;  1EQT A;  5AFW A;  5IGD A;  3EQL C;  5I2Y A;  1SNO A;  1AN8 A;  1WTO A;  1WTR A;  5EPL A;  3AU7 A;  3IFT A;  2ZXP A;  4FF4 A;  2IX3 A;  2EJG C;  3K59 A;  3FDT A;  3C46 A;  1UEA B;  1STE A;  2XIW A;  4IUR A;  3I4L A;  3NTH A;  1CZW A;  1O80 A;  1H9K A;  1TVX A;  3M4O B;  2F0U A;  4A3K B;  4HCE A;  2OEO A;  1S5D D;  1QOH A;  2AQ1 B;  3DEO A;  2SOB A;  4RAU C;  1CQF A;  1S5C D;  1D1K A;  3OSO A;  2PZT A;  3S15 B;  1DCZ A;  1B44 D;  4DXF A;  4DK0 A;  1OXT A;  3UI2 A;  5BN5 A;  5JPM C;  1JOO A;  1RJT A;  1U4M A;  2K32 A;  2RDG A;  2BE5 C;  3V2T A;  1FGB D;  2PO4 A;  1S4Z A;  1PRT D;  3W3A A;  1DJR D;  1U4R A;  5IT9 L;  4BS9 A;  1SYE A;  1SSO A;  1NR2 A;  3N6R A;  2NB0 A;  5C0X H;  1V1O A;  2RDF A;  4CGY B;  1KNE A;  4HTH A;  3X3N A;  2LKV A;  1LTT D;  3PUV A;  2NZ1 D;  1G6Z A;  3S1N B;  3GTK B;  2E2D C;  3K5N A;  2JEB I;  2JSO A;  1B9N A;  5I6W A;  1IYV A;  1A2T A;  2O2L D;  5I9P A;  3PO2 B;  1TWA B;  2A73 B;  3VR6 A;  4C3H B;  1STN A;  2G9D A;  2B2T C;  1Q1B A;  3RMH A;  4XDX A;  2NN6 H;  4C3I G;  2F0I A;  3I72 A;  5ELD A;  1IW7 C;  1ZXT A;  3A55 A;  5I6Y A;  1K83 B;  2KCC A;  3BYT B;  2N88 A;  4XYO A;  4JK1 C;  1BXT A;  3AB9 A;  1A2U A;  4DA2 A;  5I4D A;  4NW2 A;  1Y1V B;  4LJZ C;  2C9O A;  4IQZ A;  2BA0 A;  1PXU A;  1SNC A;  1U4P A;  2Z4I A;  3A54 A;  1EEF D;  2RDH A;  5IGE A;  1EY0 A;  3R2I A;  4KHV A;  1O7Y A;  3TP6 A;  1DXM A;  1HXY D;  3PIO 3;  4IFD J;  2F0T A;  4DAV A;  4YIJ A;  2F0V A;  1V8Q A;  4XQJ A;  1CI3 M;  1TS5 A;  3NQI A;  1ROD A;  1H9J A;  2EPB A;  2BA1 A;  1TS3 A;  4FNF A;  2WP8 J;  5A35 A;  4Y7N B;  4K8I A;  1ZEQ X;  2A6H D;  3S9W A;  2Q8R E;  1Q12 A;  2CW0 D;  1H9S B;  2JA7 B;  2ZXR A;  3TP8 A;  2B2T A;  5FLX L;  4XYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...