3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
molecule keywords Glycine cleavage system H protein
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
1Y8OB 3IKJA 3D4RA 2F1MA 4BA2I 1SMYC 1OXUA 2R6GA 3BG3A 2EVBA 4KKSA 2Q8IB 3VR6A 3QJYA 1GUSA 1V43A 2EDGA 3AB9A 5BN3A 5KNCA 3VR3A 2L5TA 3I72A 2A6EC 3QG1A 2BE5D 3N6RA 2A6ED 3EQLC 3HGBA 1H9JA 1YNNC 2BA0A 3A8IE 2NN6I 3T51B 2IT1A 1YNJC 3P20A 4H13C 2EJGC 4LJZC 2PNRC 3TZUA 1GHKA 1Q12A 1Y8PB 5C0XH 2K33A 2E75C 3LNNA 3W3AA 2D62A 4LK1C 2YYZA 3ND9A 4DK1A 4G7ZC 1GUGA 2JEBI 2K7VA 3GD7A 3CRLC 3OW7A 4I7ZC 4OGQC 3RLFA 2LMCB 3LWUA 1Z7TA 4KMUC 4IFDH 3MXUA 3QIAA 2O5IC 2ZT9C 2JXMB 3FMCA 4KKTA 1CTMA 2V4DA 1O78A 2E74C 3PUWA 3T56B 4TKOB 1ZKOA 1GHJA 1G291 1O7LA 2A6HC 3A7AB 1OXXK 4OO1G 1PMRA 1GUOA 2KA7A 2KCCA 5JEAG 1GUTA 1LABA 4KN4C 1FYCA 1VCIA 3L7ZC 4G7HC 1E2ZA 1DXMA 1VF5C 2K32A 2D5DA 1H9KA 1OXSC 1FR3A 1V8QA 1LACA 1IYVA 2B8FA 1Q1BA 2AWOA 4KHZA 4H44C 2A69D 3PUVA 4XIGS 2A69C 2A68C 3M7NA 4JK1C 1H9SB 3CRKC 2DNCA 1IW7D 1H9MA 5A35A 2AUJD 1ZYRC 1H9RA 5K36H 3A7LA 1TKWB 1OXTA 2PCFB 1E2WA 2O5JC 5BN4A 4H0LC 3SDZA 3KLRA 2QF7A 2BA1A 5KNBA 1EWHA 1IW7C 3NE5B 3IFTA 4KKUA 1DD2A 3A8KE 3BDOA 2DNEA 4PV1C 3D31A 4DNRB 5C0XG 1VF7A 1T5EA 1Y69U 4TQUS 1BDOA 3I73A 3H94A 3I4LA 4BA1I 4DNTB 3SE0A 3VR4A 3M4YA 1A6XA 2D2CC 2JEAI 2A68D 2DN8A 3PUYA 1VDZA 2BE5C 2PPBC 1OXVA 1HCZA 3DXJC 2BDOA 2E76C 2NN6H 4KN7C 3A8JE 1HTPA 1HPCA 1ONLA 3VR2A 1GJXA 3VR5A 3U9SA 4KI0A 2EJMA 1CI3M 3T53B 2A6HD 1Q90A 2EJFC 1I6VC 4OO1H 3ND8A 1IYUA 3GQBA 3OPOA 1DCZA 2AUKA 3PUZA 5JEAH 2NN6G 3PUXA 5BN5A 1B9MA 5K36G 1CFMA 2JE6I 3M85A 1Q1EA 1E2VA 3OOCA 4JBWA 2CW0C 4DK0A 3VA7A 1H9SA 4L8JA 3WDNA 1HQMC 5KNDA 4GZYC 3PV0A 1K8OA 1K8MA 1QJOA 4G7OC 4RCNA 4XTCS 4IFDG 1Z6HA 1GUNA 3MFYA 3FPPA 4HR7B 1TU2B 1B9NA 2B8GA 1Y8NB 4IQZA
chains in the Genus database with same CATH superfamily
3RLOA 1JWUD 3A5UA 3RR5A 4DR5L 4IURA 1I4QA 2L5TA 5IODA 2XRQD 2H4OA 3J7A5 3EQLC 4GKJQ 2F0TA 1VQAA 2IT1A 1YNJC 2RSOA 2K01A 1GHKA 5C0XH 2J0TD 5K36G 3GTGB 3U58A 1ESRA 4C3JH 1F2ZA 4JVZA 1I4HA 4POFA 4DV7Q 3FKIB 5HGQA 3NQTA 2JXMB 3FMCA 4KTAA 3PIOA 3A5ZB 3NWTA 3GDEA 3T1HQ 4C3JB 4JI7L 4B9WA 5J39A 2YTXA 5K5PA 4KJOA 2O4XA 5EKKA 5LMUQ 1PYSB 3J7AF 1K0RA 4G7HC 3UE1A 3SGIA 2K32A 4BBRG 2JYOA 3CCJA 1NAPA 4ILWA 2KHJA 5IYCG 3HOYG 1LT5D 3F8TA 1E3PA 4BXXH 1RKNA 1U4PA 2ENBA 5CV7A 3S1RH 4JI3Q 1QNKA 3ER0A 5C5MA 1I4XA 2DY8A 4X65Q 3G7LA 4DV3Q 1EWHA 3FPUB 1DOKA 1VQMA 4B3SL 5CMDA 4DU9A 2SOBA 3CAMA 2EOTA 4LF5L 3I4LA 4BA1I 1QCBD 4DNTB 2XWJB 3I91A 4P72A 2KEDA 3TS2A 3PIO3 1VQEA 2RDGA 3RN2A 4IALA 1QUQB 4PZ7A 2MFIA 3WOEA 1BBWA 1PH5A 2PI2E 3FHWA 3QO2A 4QCLA 1R4QB 2CQAA 3OPOA 5FO8B 1RD9D 3CCQA 4QL5A 2NN6G 4LF7L 4J8QA 2JE6I 3L3OC 4F7XA 5GADC 3M85A 4K8IA 3J7ZC 3FDTA 2F3VA 4RA8A 2UXBQ 5DLQE 2NTSA 3HOWH 2PW7A 3GTOB 3D4RA 1XMQQ 2EVBA 1L1OB 3AB9A 4CDFC 2A6EC 5CGKA 2F3IA 4X6AH 3HGBA 4DR3Q 2F0EA 2F0JA 1X3PA 3S1MH 3M9BA 4AQYL 3P20A 3FVQA 4APVA 3HOUH 2F52A 3OW7A 4MHEA 4ZRZA 2JK8A 3CPWA 4KHVA 3CXCA 1MJCA 2CWAA 2E74C 2JSOA 5JJZA 4TVAB 4JI5L 1WCMH 2RQXA 4LF7Q 1XNQL 1FVIA 1H95A 1SROA 1M8AA 1C4QA 1SYGA 1V1PA 4FF1A 4JV5L 2D0PA 1S5ED 1HUMA 2WIIB 2ZTDA 3ULJA 5AFWA 3BZCA 2K5WA 2UXCL 1IL2A 2NUCA 1UWVA 1QILA 3KJOA 1EL0A 3GP7A 5IGFA 1V1QA 3J80E 4N9TA 1AEXA 1BCPF 3BVGA 3P75A 1PH3A 3IFTA 1I94Q 5C4XB 1PTOD 1LTRD 1SNCA 5I4DA 4L6TB 1T5EA 1VMPA 3HOYB 1FNWA 3I56A 3PF5A 3DUZA 2UXBL 2BDOA 5M3FB 4A93H 3F2BA 1X3GA 1CHQD 2EIFA 1RIPA 1BCPB 1STEA 4PMCA 2IX0A 2MNAA 1A2TA 1N32L 1TWAB 2K75A 3ITPA 4IPCA 2QDBA 2WACA 2HQEA 4ZKCB 2L0CA 3DMUA 4DUYQ 1J5EQ 3HG9A 1E2VA 1EWCA 3GTMH 2ZTEA 3VA7A 2CH4W 1VQLA 4RCNA 5CC4A 5IYDH 4DR4L 1B9NA 4C3IH 5BN3A 4IPGA 1W6JA 4BA2I 1NY4A 1KXLA 1ICFB 4IUVA 1PFMA 2Q8IB 3NK9A 2I5HA 3I72A 5I6YA 2ALYB 3FEWX 2Z0SA 3MEHA 5C3EB 4GNXB 3GTPH 1MSGA 2UUCQ 2KOLA 1D5XC 5IP7H 3ULLA 3H0GB 1Q7YC 1Y8PB 4ZUIA 4DK1A 2D62A 3X3NA 1GXDC 3TP7A 1O80A 4OO1I 2EYOA 3LWUA 1F2LA 1YJ9A 2FMCA 4P74A 1X3QA 4A3BG 2ZT9C 4DAPA 3T56B 1SYEA 5C4JH 1P8LA 1TQOA 1IBMQ 1RODA 1G2TA 2SEBD 1SYCA 5CORA 5D65A 3S1RB 2ID0A 4EGVA 1RTOA 4C3IG 4N8X1 4A3BH 5GAGC 1ZEQX 5I2XA 1X54A 2Z1CA 1XMQL 3K5OA 3PO2H 4HMIA 1SMXA 4QMGA 1CM9A 4JK1C 4A3FB 3PO2B 3S2HH 1TWHH 2LS01 2EPBA 2WAQB 3K5MA 1X3FA 4B3ML 3A55A 4Y7NB 3JAME 1E1OA 2Z9HA 3W2DA 1SNDA 2TMPA 2F3WA 1ILPA 2NBFA 3NUCA 2NVTB 2EYHA 1F9RA 4DF7A 2EXZA 4ZKBB 5C4JB 4GLAC 1KQSA 3AEVA 5JJLA 2IWHA 3K5NA 4KY6A 3KF6A 5A2QL 1DD2A 2PZTA 4IUNA 1YBYA 4R8IA 5IP9H 4K8JA 4OX9L 1A6XA 1JCKB 3PUYA 1BO0A 4GS3A 4GLXA 4EX5A 2K6AA 3TDQA 2F0VA 4OHJA 2PYKA 5M3MB 1B53A 3KLWA 3VR5A 1X6OA 1GJXA 4CKCA 5HY6A 1D1KA 3D6WA 2KECA 5D3DA 5C4XH 2UUAQ 2WV6D 1K3RA 3J81L 2ZJPA 3STBC 4XYQA 1SBBB 1JORA 3I4MB 4K5VA 3OOCA 1B1ZA 1A2UA 2B39A 3C3LA 3S17H 3S2DH 4GZYC 1EYCA 5IGEA 4UP7A 3I4NB 3TP8A 2JP1A 4A3KG 1DJRD 3CCEA 5IGBA 4OONA 2EYJA 1WVLA 1U4MA 4BBSB 1CUKA 2R92G 4DN4M 1C48A 4K14A 4JI1Q 2B2TC 3K58A 2E2JH 4A3GG 3OTOQ 4JI2L 3J7AV 2NZOA 4QB4A 3DM1A 2E75C 3HKSA 4A3CG 1LTTD 3ZJYC 4C1NK 5M5XB 1TS3A 1Z7TA 2VS1A 1N32Q 1WOCA 3HP3A 3U50C 1EY7A 1HXYD 1LTID 3RZDB 5EKLA 5EPJA 3NTKA 2B2YA 1EY0A 3HFZB 4HIMA 2F0UA 4HTHA 2YU9H 5DNFA 4KN4C 3W5OA 4F87A 1W3SA 1K8AC 5IYBH 1ASYA 1M4VA 1OXSC 5FLMH 5IGGA 4LF9Q 1G6ZA 1TWAH 1SNOA 1HZBA 1HR0L 3PSIA 4MTKA 4GKKQ 1PFNA 5A35A 5CV9A 2FJ2A 1K28A 2PCFB 4JOIC 4BWGB 4JI4L 5KYLA 1O7IA 4H0LC 1HQRD 2SNSA 3ONAB 4JG2A 4ZQ3A 1WTHA 3NE5B 1WTPA 1XPRA 1CT1D 4IPDA 1S5BD 2EZVA 3IFDA 3J81j 2FMMA 2AQ2B 5ELBA 1SNPA 1EYGA 1NMGA 3D0FA 4C1NI 3GTMB 5IE8A 1HCZA 4BY7G 3UDFA 5IYBG 5A2QE 5FLMG 4DV1L 2PI2A 4O2DA 1Q8IA 4O0AA 3B6YA 4IUQA 4IUTA 2VNUD 3KLSA 4HIOA 1YNJD 3HEJA 4UP9A 4A3MG 4DR5Q 3MVVA 1AFPA 4BBRH 4N9PA 2F0WA 3TRZA 1N9WA 1EY4A 4H7BA 4A3DG 2TSSA 4G7OC 2J7ZA 4C3HH 4IJHA 4IUPA 2R61A 3L0OA 2QDLA 1SLJA 1RDPD 4JI4Q 1VQ5A 4KKSA 1SYDA 1B3AA 1FD7D 3HOXB 3NEMA 3ERSX 2PZWA 3QG1A 3BZDB 4WJ3M 1TS5A 2AKWB 3KOJA 5M5YB 4RAUC 5CV5A 2EJGC 5ELFA 3H3VH 4LK1C 4A3LH 3ND9A 1IL8A 4WFN3 3R93A 1VQJA 2R7ZG 4BXXG 4ZCKA 2N55A 3P7JA 4R8NA 4UDUC 2V4DA 1KC8C 1NR4A 4HN7A 5JEAJ 1KLUD 4GOPA 1HR0W 2Q8RE 2Z4IA 3G48A 3CCSA 2K52A 2N49A 3FKIG 2R7ZB 1CQFA 5J1ZA 4A3FH 1X3EA 2CKZB 3L7ZC 2H5XA 4WJ4A 4R4CA 1K3BC 3AFQA 5EAYA 4NW2A 1EEID 4GOPB 3H3VC 1LACA 5IOCA 1IYVA 1FJGL 1X56A 3UDGA 1YI2A 4KHZA 1TT2A 1II3A 2RA4A 3OWFA 3TEHB 2VQEL 2UUBL 3M3YB 1I3QB 1MHWC 2HIXA 2MO1A 2DNCA 3VYRA 2E2IH 1H9MA 4LFAQ 3S1MB 1IKMA 1STHA 5G3LD 3NTIA 5M3MH 1PRTD 2F0OA 2QF7A 3HRZC 2DUDA 3LWEA 1HA5A 1RJTA 3KYHC 4LAAA 5BR8L 4IFDJ 3HOUG 2YV5A 4RWSC 4R9WA 4DXFA 4L63B 1VQHA 1J8IA 1OXVA 1C8CA 4A3FG 1QB5D 2KEEA 3S9WA 4X3SA 2B63H 4X3KA 4XYOA 1I6HH 1KL9A 3VR2A 3GTGH 5JVG3 1TS2A 2X6GA 1KDAA 1VQ6A 1Q90A 2E2DC 2EJFC 2A5HA 4DR1Q 1XNQQ 3KF8B 1SE4A 2H1EA 5GROA 1QOHA 3SK8A 4DV2Q 4JBWA 4CKEA 3LX0A 2A8VA 1D5MC 2EQSA 1HNXQ 4IFDG 1EIFA 2I5MX 3L9AX 1U9RA 3S1QB 4UY8C 3IKJA 3I7FA 4XDXA 4K0KQ 4MTNA 1HJPA 3TMEA 4A93G 5EPLA 3H0GG 5KNCA 4ME5A 4DXGA 1CKOA 3ULPA 1ENCA 4JPBW 3HOVH 3A8IE 2HUGA 1Y1VH 1BQQT 1BUVT 2K5VA 1M1KC 1J5EL 1EOTA 1PTOC 2KVMA 2EY6A 4B3TL 1XPUA 4R4IA 4I7ZC 4RH6A 1YJWA 2VUMB 2VUMH 1YNND 2OEOA 1RF2D 3AFPA 3PUWA 5E1FA 1G291 3I2ZA 1BOSA 1MGSA 4DR1L 5IT9E 4ZAIA 5JEAG 1A3UA 3IRBA 2VUMG 5JAVA 2M00A 3OHXC 5J3BA 4DV4L 3DWQA 1CA5A 4KHPL 2D5DA 3S16B 3D6CA 5M5WB 4YCVA 2RHQB 4LF4Q 3NXWA 4DK3C 1PH2A 2D9UA 1FJGQ 1SFOH 1S5FD 3R2IA 3RUZA 4DA2A 5KIXA 3GTJH 3K8AA 1I4RA 3S14H 1MJEA 3PF4A 1JB3A 2F0HA 4PV1C 1C7YA 4YHHL 1Y69U 1ET9A 4RKBA 2ZJRA 5LL6S 1VQBA 2D2CC 4QUFA 2JEAI 1JR0D 1MSHA 2X69A 2R7FA 1DYQA 1NNXA 2K4KA 3NHHA 2JA6H 1VQ8A 1ONLA 1TY0A 2OF1A 3ICEA 4B3RQ 4YY3Q 1STYA 1SJED 4XXEA 1WTRA 1IYUA 3OIPA 3MZ5A 2XN9C 1VQNA 2HT1A 1XX8A 3PO3B 4K5WA 3TP6A 4K6DA 1UAPA 5L37A 1CSPA 2X6LA 3MXNB 4L8JA 3E5SA 2RDHA 2WKDA 3J80c 2Z4HA 3BU2A 1UUPA 4DNIA 4NKLA 2A19A 5M5YH 1L1OC 4QGUA 2KQ3A 4CDDC 3BS1A 1XMOQ 3DM3A 4AYBE 5LMNW 1V1PB 1F9SA 2F4IA 1ZXTA 1NE3A 1JJGA 1NJIC 5I6WA 3ERQA 3HOUB 1EFID 2A6ED 4JBMA 3RN5A 1XTCD 1SE3A 1D2BA 1BKBA 4FXGC 2WP8J 1IBML 1EWIA 3NBHA 3K7AB 1GUGA 3RLFA 1UEBA 3VYTA 3HKZG 1AH9A 3SK4A 3GTQB 3CU7A 4RG1A 4A3KH 1CTMA 5EQ0A 2R3ZA 3T1YL 3QOLA 2ICIA 3GO5A 4XQNA 2UXCQ 4YWKA 5I2YA 4RGNA 1PH9A 2KA7A 3S2DB 5M3FH 3JAML 4K0KL 1J9OA 2F0QA 4MNOA 1FR3A 2RSNA 4GKKL 4LFBQ 1EQTA 5H1SE 1Z9FA 1YNXA 1Y1WH 3C1FA 1H9SB 3CRKC 4JI6Q 5M5XH 4JI3L 2E2JB 2E2HB 3HOXG 2XRSD 1TR5A 3KF8A 5C44B 3S1NH 4XT1B 1JMCA 3V96A 2BA1A 3I4OA 4QIWE 3C46A 1TWGB 1KD1C 4FXDA 5FOBB 1WD1A 1QUQA 3D31A 4H02A 4DNRB 4A3DB 5CV6A 5LMUL 2Y0SE 1PV4A 2VXWA 1U4RA 1GO3E 1VDZA 2F0MA 3TREA 3E3XA 4KN7C 3T1YQ 2B2VA 3G6JB 2B2WC 4DV4Q 1KIXA 2JA5G 1LO5D 2XSCA 2JQOA 1YEZA 2PQAB 5JOBA 5DM63 5AJ3L 4Q5VA 1IBLL 4OELB 5CV4A 2CWPA 5KNDA 4CHTB 1NUCA 3K0YA 2DY7A 2MHVA 3MFYA 5IT9c 1PRTB 3H94A 1Y8NB 1LTSD 4IQZA 3CCRA 3NSWA 3GV3A 1N34Q 1ML0D 3BG3A 1K0SA 4GNXC 1QVGA 2EDGA 1A3VA 3F2UA 3D4WA 3M4OB 4ZYSA 1K83B 1JB7A 1UE6A 2Z6KA 2JA8H 1G6PA 4LJZC 4B3TQ 1T9HA 3HOWB 2RKSA 3VYSA 2QCPX 3W3AA 2JA7G 4LUVA 2HDMA 2PO4A 1W2BA 2F0KA 1AZPA 3MXUA 5IY0A 3I4MG 3UI2A 2ASBA 2CFMA 4DUYL 4TKOB 5J22A 2K5QA 1PFBA 1VMCA 2WB1E 3K80C 4DV0L 3OWEB 5JJIA 3A0JA 4JV5Q 3M4OH 1H9KA 1CKNB 4A3CH 5C4HA 5ISRA 2AWOA 3GTQH 2PMZE 1JC7A 1VQFA 3K81C 4OX9Q 1S5DD 2K5HA 2WFWA 1Z47A 2AUJD 2L9HA 4BY1H 3T1HL 2JA7H 1TKWB 4HIDA 3AMUA 1G8ZD 3C2PA 4KD4A 1TWCH 5E7NA 1JQYD 3KLRA 2A1AA 1K73C 1IHZA 3WOFA 1KAAA 4ABNA 1TWFH 4F8MA 1VF7A 1EYDA 2XNAC 5F2DA 5AJ3Q 4A75A 3M4PA 3M4YA 3MA2B 5IIFA 2BE5C 5T1IA 2HCIA 4A3KB 5CV8A 4R4TA 2FHTA 1STGA 2ES2A 4R4QA 2UUCL 1EIYB 1TXYA 1I6VC 2HCCA 3ND8A 2K5DA 4DV3L 1C0AA 2AUKA 4UHVA 2RF4A 4YWMA 5IGDA 2UXDL 4X64L 2XIWA 2OCEA 4IJLA 5GAHC 4NXML 2YU9B 1OTCA 2FINB 3MTSA 4LUZA 4NXNL 4XTCS 3CMEA 2ZM6Q 4A3IB 2QEJC 2RCFA 2VB3X 3EBEA 3JC66 4FP5D 4AIMA 3VR6A 3QJYA 1KDCA 1GUSA 4FDBA 3VR3A 3CCVA 5C0XJ 4HSVA 4DR7Q 5FLXL 3D4DA 2F0PA 2KHSA 2WB1G 1HUNA 1A3TA 3T51B 1TY2A 1UE5A 1Y1VB 2K5NA 4JI0Q 4KV6A 3U4ZA 1CK1A 4PMBA 3J81i 3GV6A 5ELCA 2Q2IA 1PDQA 2NZ1D 3QIAA 3MEFA 4DKAC 3JAMi 1XYIA 2Y0SB 1QZHA 3IL8A 4HJAA 1NCVA 4DV5L 4C3JG 1PFSA 4OO1G 2L11A 1CHPD 2BH8A 4AYBB 4X62L 4LF6Q 1ENFA 4WRDA 1EZ8A 4C3IB 4LUOA 3R8BA 2DJGC 3MXGA 4HCEA 4DV0Q 5IGCA 3A56A 4GN4B 2J4XA 1DGSA 2ZM6L 1SNMA 2IPKD 1O7YA 2F0NA 5EJWA 1PTOH 4RGOS 4GLVB 4Z9CB 4PMWA 2MPMA 2OXPA 1F2YA 1LYLA 3MHBA 3CCMA 2LSSA 5K36H 1VS0A 3RZOH 3CQZH 2O5JC 2VY3A 1BVSA 3HKZE 4FYDA 1S3OA 1YVCA 3SK6A 1Y1VG 3CKIB 4GN5A 2I5LX 4TQUS 4P75A 5FO7B 2N88A 2B2YC 3T16A 1M90C 1O7ZA 2YTYA 2PPBC 1XXGA 4B3RL 3DXJC 4A4IA 4HIKA 1SYBA 3A8JE 1CSQA 1ICWA 3H3VI 3KF6B 1CI3M 3A54A 1TWFB 2AQ1B 2VL6A 5E4WC 4GKJL 3FRPB 3U9OA 3V2TA 5JEAH 5EBCA 1B9MA 1CFMA 1NSNS 4N8FA 2L15A 1Q1EA 1Q8KA 2SDFA 1H9SA 1HQMC 3NBIA 4JI8Q 3VA5A 2EYFA 2R7ZH 4QJFA 1S72A 4NXMQ 1EOVA 5LHY1 3MXPA 1SMYC 4P71A 2R6GA 1LUZA 2RHSB 2ZXOA 4K2LA 4C2MB 2KHIA 4DK6C 2M2LA 3V05A 3DWPA 5HGTA 2WINB 3SVMA 3NENA 3PMFA 4DV5Q 3H09A 4LF9L 4JI5Q 2Q2HA 1LTBD 2QGQA 2MJ8A 4M1UB 2OT2A 4ZLTF 4ZUJA 1E7ZA 3LNNA 2LMCB 1EY5A 1V9PA 5IWAQ 4IFDH 2E5LQ 1IBKQ 1N36Q 2UU9L 4FF3A 3EROA 1SE8A 1SN8A 1KTKA 2A6HC 1YIJA 1WI5A 3A7AB 1EY9A 3U4VA 4L5RC 1LLRD 4X65L 1GUOA 3NWSA 1VQCA 3PO3G 2Z8LA 3PQIA 4A3MH 2R93B 4K6LA 1JE4A 1LT6D 4OEMB 1EIHA 1NTGA 3I90A 1WTXA 2FXQA 2JA7B 4JI6L 1WCMG 3F2CA 4A3EH 4LF6L 2F0FA 1D7QA 1HNZQ 1SNQA 3KBGA 1OO9B 3EIVA 1LV9A 2Q2UA 1UEAB 4DR2Q 5C0XI 1JOKA 3Q22A 4POGA 4A3JB 5FO9B 5IP9G 5I9OA 3HOYH 4JW0A 5KYIA 3HOVG 4DR6L 3EJIA 2NWGA 4OIKA 2WAQG 1YHAA 1E24A 2EYPA 2C5CA 4MN3A 2IY5B 3VR4A 1EEFD 3T4AC 3KJPA 3ZYYX 1JJ2A 5DEHA 1WJJA 2DN8A 1U4LA 3WWVA 1DOMA 4V190 2B63B 1I6HB 1HA6A 2GVBA 4DV1Q 4B3MQ 3MFGA 3AYHB 2EJMA 4E6IA 1FGBD 1S5CD 4CJ0B 5G3LF 4UAIA 3FKIH 2NTTA 3GQBA 2VQEQ 2RCNA 3TS0A 2UUBQ 3PUXA 3K7UC 4DAYA 5IYDG 3RMHA 1NMFA 2B3GA 2NZHA 1AW7A 4RGTA 3RLNA 2ZJQA 1QE6A 4XQJA 4IZ8A 1GUWA 3VDYA 5EKIA 1SAPA 1LTAD 2QA4A 1S40A 2I07B 1GUNA 4O1NA 2HHHL 4HR7B 2B8GA 3Q8DA 4IN3A 1BBUA 1L0YB 3MC0B 1EQRA 4BY1G 1KHIA 1WTWA 2CH4A 4C56C 1V43A 1AE3A 2E5LL 3HOWG 4L5SA 3RZDH 3I70A 5ELOA 1F9PA 1RHPA 4IOCA 1HH2P 3F2DA 1DM0B 1PXUA 4RMFA 4FF2A 4EQPA 3GTJB 1QNUA 1JWMD 1WFQA 2R92H 1UNSA 2KCNA 4OGQC 1XWEA 1SFOB 2E8GA 1K83H 4NMZA 3C1EA 3KLSX 1TS4A 4G57A 2NVTH 4X3UA 3W1BA 1ZKOA 1BNZA 2L4NA 2Y0SG 2DGYA 3A74A 4FO2A 4LFCQ 4JOIA 5C3WA 3HKZB 1GUTA 2GA4B 4CGYB 3LGJA 5LMNQ 1VF5C 4M8AA 2WKCA 1IBLQ 1B44D 2KUMA 1IZ6A 5KEEA 5COYA 1Q86C 2A69D 1TVXA 1PYBA 2BDNA 3CP0A 1IW7D 4GN3B 1ZYRC 1EU4A 3OMGA 3J81E 1OXTA 2AMCB 5C5LA 3SDZA 2ZXPA 1A15A 1STNA 2N8NA 2OTLA 1IW7C 4YY3L 4PG3A 1A62A 1AE2A 1I5FA 5FJ8G 2C35B 2O2LD 3SE0A 3K59A 1Q46A 1WTVA 1AP0A 2OQKA 1Y1WG 1PH6A 1R9TH 3OMCA 4IOAA 1STBA 1PH8A 3K7AH 1D5ZC 2QKIC 2KCTA 2DJFC 1QVCA 2F0DA 1DCZA 1HZ9A 3PUZA 3NBHB 5M3FG 3CC4A 1HRJA 1DONA 1VQPA 4DV2L 4DR2L 1X9NA 2CHBD 4TSSA 5I9PA 4UP8A 5JPNC 5EPKA 3WDNA 3E0JA 3Q24A 5C4XG 1HZAA 1S4ZA 5CBEE 4BBSH 1Z6HA 1FNVA 1L0XB 4PNYA 5IT9L 2NVQH 3TP5A 5FJ8H 1FNUA 1W6KA 4HEDA 4U68A 4PZ6A 4A3EB 1YHQA 4JYAL 1JOQA 3I8ZA 4O42A 4BBSG 3S1QH 1SRUA 2B2VC 4JBJA 3GTKB 1BF4A 3I3CA 3TZUA 3HOZG 1HTLD 2K33A 4DV6L 4AQYQ 3S1NB 4P2CB 1HFGA 1ESFA 3NTHA 2K7VA 4YCUA 3CRLC 1EQVA 3E9HA 5IWAL 3NPPA 4ALPA 2JA9A 2KJXA 4U673 3AQQA 2I0QA 3S15B 3CC2A 4LNQA 2P5ZX 3E9IA 3H6MA 4CBVA 4Q0FA 2CCZA 1L2FA 2B2UA 1O78A 1JJCB 4J6HA 1GHJA 4FVMA 4DUZL 1ASZA 1OXXK 2VW9A 4DR7L 5JJKA 1DXMA 1WTOA 4K2KA 3PGZA 1G91A 2VQFQ 4DV7L 1K9MC 3H15A 1F2MA 2LY7A 3PUVA 1B70B 2A74C 2A73B 5C44H 4MIUA 5NUCA 4V0BA 2EY1A 4RHSA 2E2HH 2NYZD 3STBD 4JBKA 3S16H 3RZOB 1A8VA 2HD3A 4P73A 4A93B 4CDEC 2F03A 2UUAL 5C44G 3OIQA 1L1OA 4NDXA 1JE5A 1PTOB 3VYUA 4EQ5A 4B9XA 3I4NG 2DNEA 4DV6Q 3CCLA 2F4VL 2G5DA 3I73A 4FXKC 4DR4Q 3UE0A 4DR3L 1KAWA 2B2WA 2IL8A 4LFCL 3S24A 3CF5A 5CYUA 2JA8B 3TN2A 1SDFA 4ZK9B 4LFAL 1K8GA 4KI0A 2XGTA 1PZJD 3RNUA 1ET6A 1EZ6A 3AU7A 4OO1H 4JI1L 2R93G 4FF4A 4QQBX 5BN5A 3K0XA 3FP9A 1IYJB 4HJ5A 4LF5Q 1KABA 2WAQE 4A76A 1KNEA 1I94L 3URYA 1PH1A 3CQZB 3H0GH 1F77A 2PNHA 1YZ6A 1SE2A 1LT4D 1VQOA 3K6OA 5C3EH 1Y8OB 1N8RC 1TWHB 3GTPB 5ELEA 3P1HA 1HNWL 3BDLA 4HJ7A 1Q81C 1ILQA 4QY7A 4OWXB 3S14B 3N6RA 2Q2TA 1DOLA 4BY7H 4BY1B 2NN6I 3PIPA 4JYAQ 2VZAA 1JWSD 4LFBL 1P16A 1Q12A 5M9OA 4A3IG 5KGUA 3DEPA 4LF8L 2D0OA 4FNFA 3KDFA 3KK7A 3HZXA 1E22A 3NQIA 4CDCC 5FLXE 3PIP3 4KY5A 3N52A 4K5XA 3J80L 2M9VA 2JA6B 2LXKA 1VQIA 3Q0AA 3TSSA 2B2TA 2JA5H 3OYYA 1D6EC 1SJHD 3SEBA 4ID6A 2K05A 2KCCA 3CD6A 4ODGA 4KJNA 1NBWA 4DUZQ 1LTLA 1VCIA 2Z6BA 1IXRA 4XT3B 2B63G 4BY7B 4B08A 1N34L 4HAEA 1HHVA 3E6ZX 4YIJA 2KBNA 5M3MG 5LL6X 2CVRA 1SEBD 1TWCB 4XIGS 5KRUA 3M7NA 2VQFL 1SYFA 4G4KA 2MQHA 2Q8TA 1N36L 1Q3LA 1C9OA 1B3QA 3BYTB 5BN4A 3R2TA 3BVZA 2BH2A 1VQDA 3R3OA 2CQOA 4KLKA 5C6AA 3GTKH 2NVQB 3A8KE 3BDOA 5GAEC 4KHPQ 1B2TA 1KNAA 3SK5A 2F0GA 2KCMA 2UXDQ 2MP1A 3M4QA 3G71A 2K50A 1WCMB 3T13A 1HNZL 1PTOF 5IYCH 1B50A 3MWYW 1BCPD 1SMYD 2AWNA 4JI7Q 3BJUA 1I3QH 1LTGD 1IBKL 4HJ8A 2UU9Q 2OTJA 2K14A 1YITA 1N33Q 3S15H 2A6HD 3TZDA 4RHRA 3TQYA 1BCPC 1RTNA 4X66Q 1PHJA 5E3FA 2MGSA 4YHHQ 1U5KA 1HZCA 4L5QA 2CW0C 4J15A 4DK0A 1WTQA 3BDCA 2PQAA 3NELA 2L1BA 2F0LA 5C3XA 4LF8Q 4DPGA 2QW7A 3K5LA 1TWGH 3CC7A 3M7GA 3TBIB 5HURA 2GN5A 2CW0D 4WJWA 1I50H 4RGMA 1I50B 4A3DH 2B2UC 1H9JA 2BA0A 2WB1B 5C3EG 1HFNA 1MIUA 1VQ9A 1GOZA 4LWCA 4X62Q 2JEBI 3GD7A 3QR8A 2IJ0A 3Q23A 4J1MA 4NB3A 3BVMA 2O5IC 4WORA 2GVAA 4KKTA 2EYMA 5CR3A 5JVH3 1CKNA 4RKLA 1X65A 1EUJA 4AH6A 1B4OA 4LF4L 2K1BA 4OWWB 4NXNQ 4JCVE 1G51A 4UPAA 1FYCA 1E2ZA 1LM0A 2OWOA 1UE7A 5EBDA 4JI2Q 3OTOL 1PRTC 5EGTA 4NPSA 4H44C 3KBXA 4KY7A 3OSOA 2A68C 1KRSA 2QILA 1T5XD 2EXDA 2PQEA 5C4ZA 4JI0L 2QEXA 1EU3A 2KENA 4Y7NH 1E2WA 1JOOA 4DAYB 3D3RA 1B7YB 3QOJA 3SR1A 4X3TA 5ELDA 4YCWA 2EY2A 2F4VQ 4A3GH 4I7AA 5C0XG 4A3GB 2K04A 5LMNL 3HOXH 1BDOA 4KD3A 4B3SQ 1MI2A 2LXJA 1HNXL 5DM73 3EA6A 4BBRB 1RL2A 3G4SA 5GQOA 2ATWA 1HPCA 4AYBG 5E4XA 3GTLB 2JA5B 3T53B 1XNRQ 2HHHQ 3CCUA 2HIVA 4QIWB 1PA6A 3PO3H 3DEOA 3GTLH 1N33L 5FLXc 2JA6G 5ELNA 3J7YW 3S2HB 2IW3A 1CZGA 1DZ1A 4X66L 1K8OA 3PV0A 1K8MA 1QJOA 1R4PB 2MUYA 4OIJA 3I55A 1EY6A 3KUPA 2E2IB 5D3IB 2F1MA 3NP8A 1U0LA 1ZYRD 1FGUA 3HOZB 2NVXB 4KK7A 1Y14B 5FKAC 1WYDA 1YNNC 4RFBA 1D1IA 2JN4A 1GM5A 2BOSA 4H13C 4I65A 1KDBA 4G7ZC 4A3EG 2R7DA 1VQGA 5TSSA 2PMZB 1CKMA 1A63A 4DAMA 1QG7A 2F0IA 1B8AA 2HQLA 3BYYB 4MZ9A 4Y52H 3CHBD 4A3MB 2NVYB 1CZWA 4LMQD 5FK9C 1O7LA 1UE1A 4CJ1B 2FFKB 3MAQA 4JI8L 1PH4A 1EYAA 1F9QA 2R93H 2K03A 3E0EA 2NB0A 2PW5A 4IO9A 1PRTF 2B8FA 1Q1BA 2OQ0A 4NP5A 2RVLA 3KFUA 5CBAE 4A3JH 1PVOA 1Y1WB 5D14A 2PZUA 1BXTA 1EY8A 2RBMA 4QUCA 1H9RA 4HJ9A 3A7LA 2YTVA 1SR3A 1E1TA 2EY5A 1CA6A 1GD7A 3G6EA 2NVYH 4A3JG 5KNBA 1XNRL 1PYWD 4R4OA 1G2SA 2LKVA 4ME3A 3IAYA 1EQQA 4CJ2C 2AHOB 3DLLA 3OW2A 3CMAA 3PO2G 3RD4A 2ZXRA 4BS9A 2K28A 2BCOA 1RCVD 1XMOL 1QVFA 1PZID 4TRDA 4LW1A 1BBXC 2L12A 2ICEC 1VQ7A 3X3MA 4IPHA 2G9HD 4ULLA 3D8GA 1XTDA 1SXTA 2RDFA 4QF4A 4YWLA 3O13A 4GNXA 2F0SA 3EVQA 2C9OA 4A3BB 3QWNA 3FPPA 1TU2B 3HOVB 1AZQA 1A0IA 4OXPA 2G9DA 1PH7A 2JJQA 1OXUA 1VQ4A 1TIID 2N3SA 4DAVA 5M5WH 3H91A 4EQOA 3Q6SA 4OL7A 1JT8A 1GKHA 1QWYA 2XWBB 2BE5D 2R92B 4IFDI 3MXNA 3BZKA 3EFXD 4HCSA 2PNRC 4X64Q 1EIGA 1EFWA 3PCOB 2YYZA 4L5TA 2N78A 4F88A 1X55A 3UDXA 4KMUC 3KDFB 1PZKD 4IUUA 1KRTA 4C3HG 5BR8Q 3EN2A 1ENAA 2IHEA 4DGZA 1E0BA 2ZTCA 3J80i 1PMRA 4S3SA 2L55A 1LABA 4HSPA 4C3HB 1L0WA 5DAUA 3SXHA 2IHFA 2V1CC 1CQVA 3K57A 2EE1A 1V8QA 4HMJA 3W1GA 4A3LG 1Q82C 4JC0A 1FL0A 4C2MH 1D8LA 1IKLA 4RCOA 2VB2X 3L2PA 4GOPC 1XPOA 2A69C 3DWAA 2MO0A 2JA8G 3GTOH 1MKHA 1PLFA 1KLGD 1XJVA 1JICA 3F1ZA 1WD0A 5JPMC 3UDIA 1I4GA 3M3YH 4R1JA 2XTIA 4DR6Q 3JAMc 1YHBA 1YJNA 3I4MH 1QZGA 3CPFA 5IP7G 4PQXA 4XQQA 1SSOA 4KKUA 3HOZH 3J81c 4EVOA 2NVXH 2LFNA 1R9TB 1NR2A 1I4PA 2IX3A 4A3IH 2XVSA 2IX1A 1AN8A 2AQ3B 4OWTB 4DFAA 2A68D 2Z6KC 1X32A 2E76C 2NN6H 2SNMA 3DHQA 4EQNA 1HTPA 3SHLA 1BR9A 4CKBA 3U9SA 1VQKA 1LT3D 2EYLA 4PZ8A 1MBYA 2HDLA 3HS0C 1V1OA 3CW2C 1MD2D 3I4NH 1STAA 1HNWQ 2I46A 5T1GA 1GVPA 2B29A 3S17B 1J6QA 3QB3A 1HR0Q
chains in the Genus database with same CATH topology
1JWUD 4IURA 1I4QA 2L5TA 5IODA 2XRQD 2H4OA 3EQLC 2F0TA 2IT1A 1YNJC 2RSOA 2K01A 1GHKA 5C0XH 2J0TD 5K36G 3GTGB 1ESRA 1F2ZA 1I4HA 3FKIB 3NQTA 2JXMB 3FMCA 4KTAA 3NWTA 4C3JB 4B9WA 5J39A 5K5PA 4KJOA 2O4XA 5EKKA 3J7AF 4G7HC 2K32A 2JYOA 1NAPA 4ILWA 1LT5D 1RKNA 1U4PA 2ENBA 5CV7A 1QNKA 5C5MA 1I4XA 2DY8A 3G7LA 1EWHA 3FPUB 1DOKA 5CMDA 4DU9A 2SOBA 2EOTA 3I4LA 4BA1I 1QCBD 4DNTB 2XWJB 3I91A 2KEDA 3PIO3 2RDGA 4IALA 3WOEA 3QO2A 4QCLA 1R4QB 2CQAA 3OPOA 5FO8B 1RD9D 2NN6G 4J8QA 2JE6I 3L3OC 4F7XA 3M85A 4K8IA 3FDTA 2F3VA 4RA8A 2NTSA 2PW7A 3GTOB 3D4RA 2EVBA 3AB9A 2A6EC 5CGKA 3HGBA 2F0EA 2F0JA 1X3PA 3P20A 3FVQA 3OW7A 4MHEA 4ZRZA 4KHVA 2E74C 2JSOA 5JJZA 2RQXA 1M8AA 1C4QA 1SYGA 1V1PA 4FF1A 1S5ED 1HUMA 2WIIB 5AFWA 2K5WA 2NUCA 1QILA 1EL0A 3GP7A 5IGFA 3J80E 4N9TA 1AEXA 1BCPF 3BVGA 3P75A 3IFTA 5C4XB 1PTOD 1LTRD 1SNCA 5I4DA 4L6TB 1T5EA 1VMPA 3HOYB 1FNWA 3DUZA 2BDOA 5M3FB 1CHQD 1STEA 1BCPB 4PMCA 2IX0A 1A2TA 1TWAB 3ITPA 2QDBA 2WACA 2HQEA 4ZKCB 2L0CA 3DMUA 3HG9A 1E2VA 1EWCA 3VA7A 4RCNA 5CC4A 1B9NA 5BN3A 1W6JA 4BA2I 4IUVA 1PFMA 2Q8IB 3NK9A 3I72A 5I6YA 3FEWX 3MEHA 5C3EB 1MSGA 2KOLA 1D5XC 3H0GB 1Y8PB 4ZUIA 4DK1A 2D62A 3X3NA 1GXDC 3TP7A 1O80A 4OO1I 2EYOA 3LWUA 1F2LA 2FMCA 1X3QA 2ZT9C 4DAPA 3T56B 1SYEA 1TQOA 1RODA 1G2TA 2SEBD 1SYCA 5CORA 5D65A 3S1RB 2ID0A 4EGVA 1RTOA 4C3IG 1ZEQX 5I2XA 2Z1CA 3K5OA 4HMIA 4A3FB 4QMGA 1CM9A 4JK1C 3PO2B 2LS01 2EPBA 2WAQB 3K5MA 3A55A 4Y7NB 3JAME 3W2DA 1SNDA 2TMPA 2F3WA 1ILPA 2NBFA 3NUCA 2NVTB 2EYHA 1F9RA 4DF7A 2EXZA 4ZKBB 5C4JB 2IWHA 3K5NA 4KY6A 5A2QL 1DD2A 2PZTA 4IUNA 4R8IA 4K8JA 1A6XA 1JCKB 3PUYA 1BO0A 2K6AA 3TDQA 2F0VA 4OHJA 2PYKA 5M3MB 1B53A 3VR5A 1GJXA 4CKCA 1D1KA 3D6WA 2KECA 5D3DA 2WV6D 3J81L 4XYQA 1SBBB 1JORA 3I4MB 4K5VA 3OOCA 1B1ZA 1A2UA 2B39A 3C3LA 4GZYC 1EYCA 5IGEA 3I4NB 3TP8A 2JP1A 1DJRD 5IGBA 2EYJA 1WVLA 1U4MA 4BBSB 4DN4M 1C48A 4K14A 2B2TC 3K58A 3J7AV 4QB4A 3DM1A 2E75C 1LTTD 4C1NK 5M5XB 1TS3A 1Z7TA 3HP3A 1EY7A 1HXYD 1LTID 3RZDB 5EKLA 5EPJA 3NTKA 2B2YA 1EY0A 2F0UA 4HTHA 5DNFA 4KN4C 4F87A 1M4VA 1OXSC 5IGGA 1G6ZA 1SNOA 1PFNA 5A35A 5CV9A 2FJ2A 2PCFB 4BWGB 5KYLA 4H0LC 1HQRD 2SNSA 3ONAB 4ZQ3A 3NE5B 1WTPA 1CT1D 1S5BD 2EZVA 3IFDA 2FMMA 2AQ2B 5ELBA 1SNPA 4C1NI 3GTMB 1HCZA 5A2QE 1Q8IA 4IUQA 4IUTA 2VNUD 3KLSA 1YNJD 3HEJA 3MVVA 1AFPA 4N9PA 2F0WA 1EY4A 4H7BA 2TSSA 4G7OC 2J7ZA 4IUPA 2R61A 1RDPD 4KKSA 1SYDA 1B3AA 1FD7D 3HOXB 2PZWA 3QG1A 3BZDB 5M5YB 1TS5A 4RAUC 5CV5A 2EJGC 5ELFA 4LK1C 3ND9A 1IL8A 4WFN3 3R93A 2N55A 3P7JA 4R8NA 4UDUC 2V4DA 1NR4A 4HN7A 5JEAJ 1KLUD 2Q8RE 2Z4IA 2R7ZB 1CQFA 5J1ZA 3L7ZC 3H3VC 4NW2A 1EEID 1LACA 5IOCA 1IYVA 4KHZA 1TT2A 1II3A 2RA4A 3OWFA 3M3YB 1I3QB 2DNCA 3VYRA 1H9MA 3S1MB 1IKMA 1STHA 5G3LD 3NTIA 1PRTD 2F0OA 2QF7A 3HRZC 3LWEA 1HA5A 1RJTA 4LAAA 4IFDJ 4RWSC 4R9WA 4DXFA 4L63B 1J8IA 1OXVA 1C8CA 1QB5D 2KEEA 3S9WA 4X3SA 4X3KA 4XYOA 3VR2A 5JVG3 1TS2A 2X6GA 1KDAA 1Q90A 2E2DC 2EJFC 2A5HA 1SE4A 2H1EA 1QOHA 3SK8A 4JBWA 4CKEA 3LX0A 1D5MC 4IFDG 3L9AX 1U9RA 3S1QB 3IKJA 4XDXA 3TMEA 5EPLA 5KNCA 4ME5A 4DXGA 1ENCA 3A8IE 2HUGA 1BQQT 1BUVT 1EOTA 1PTOC 2KVMA 2EY6A 4I7ZC 4RH6A 2VUMB 1YNND 2OEOA 1RF2D 3PUWA 5E1FA 1G291 1BOSA 1MGSA 5IT9E 4ZAIA 5JEAG 1A3UA 5JAVA 2M00A 3OHXC 1CA5A 3DWQA 2D5DA 3S16B 3D6CA 5M5WB 3NXWA 2D9UA 1S5FD 3R2IA 3RUZA 4DA2A 5KIXA 1I4RA 1JB3A 2F0HA 4PV1C 1Y69U 1ET9A 4RKBA 5LL6S 4QUFA 2D2CC 2JEAI 1JR0D 1MSHA 2X69A 1DYQA 3NHHA 1ONLA 1TY0A 2OF1A 1STYA 1SJED 4XXEA 1WTRA 1IYUA 3OIPA 3MZ5A 2XN9C 3PO3B 1XX8A 4K5WA 3TP6A 4K6DA 1UAPA 2X6LA 4L8JA 3E5SA 2RDHA 2WKDA 2Z4HA 1UUPA 4NKLA 2KQ3A 3BS1A 1V1PB 1F9SA 2F4IA 1ZXTA 5I6WA 3ERQA 3HOUB 1EFID 2A6ED 1XTCD 1SE3A 1D2BA 4FXGC 2WP8J 3NBHA 3K7AB 1GUGA 3RLFA 3VYTA 3SK4A 3GTQB 3CU7A 1CTMA 5EQ0A 2R3ZA 3QOLA 2ICIA 3GO5A 4XQNA 5I2YA 4RGNA 2KA7A 3S2DB 3JAML 1J9OA 2F0QA 1FR3A 2RSNA 1EQTA 3C1FA 1H9SB 3CRKC 2E2JB 2E2HB 2XRSD 1TR5A 3KF8A 5C44B 4XT1B 3V96A 2BA1A 3C46A 1TWGB 4FXDA 5FOBB 1WD1A 4DNRB 3D31A 4A3DB 5CV6A 2VXWA 1U4RA 1VDZA 2F0MA 4KN7C 2B2VA 3G6JB 2B2WC 1LO5D 2XSCA 5JOBA 5DM63 4Q5VA 5CV4A 5KNDA 4CHTB 1NUCA 3K0YA 2DY7A 2MHVA 3MFYA 1PRTB 3H94A 1Y8NB 1LTSD 4IQZA 3NSWA 3GV3A 1ML0D 3BG3A 2EDGA 1A3VA 3F2UA 3D4WA 3M4OB 4ZYSA 1K83B 4LJZC 3HOWB 2RKSA 3VYSA 2QCPX 3W3AA 2HDMA 2PO4A 2F0KA 1AZPA 3MXUA 3UI2A 4TKOB 5J22A 2K5QA 1PFBA 1VMCA 3OWEB 1H9KA 5C4HA 5ISRA 2AWOA 1JC7A 1S5DD 1Z47A 2AUJD 2L9HA 1TKWB 3AMUA 1G8ZD 3C2PA 4KD4A 1JQYD 3KLRA 1IHZA 3WOFA 1KAAA 4ABNA 4F8MA 1VF7A 1EYDA 2XNAC 5F2DA 3MA2B 3M4YA 5IIFA 2BE5C 5T1IA 2HCIA 4A3KB 5CV8A 2FHTA 1STGA 1I6VC 2HCCA 3ND8A 2K5DA 2AUKA 5IGDA 2XIWA 2YU9B 2FINB 3MTSA 4XTCS 4A3IB 2QEJC 2VB3X 4FP5D 3VR6A 3QJYA 1KDCA 1GUSA 3VR3A 5C0XJ 4HSVA 5FLXL 3D4DA 2F0PA 2KHSA 1HUNA 1A3TA 3T51B 1TY2A 1Y1VB 4KV6A 1CK1A 4PMBA 3GV6A 5ELCA 1PDQA 2NZ1D 3QIAA 1XYIA 2Y0SB 3IL8A 1NCVA 4C3JG 4OO1G 2L11A 1CHPD 4AYBB 1ENFA 4WRDA 1EZ8A 4C3IB 3R8BA 4HCEA 3MXGA 5IGCA 3A56A 2J4XA 1SNMA 2IPKD 1O7YA 2F0NA 5EJWA 1PTOH 4RGOS 4Z9CB 4PMWA 2MPMA 2OXPA 1F2YA 3MHBA 5K36H 2O5JC 4FYDA 3SK6A 3CKIB 4TQUS 5FO7B 2N88A 2B2YC 3T16A 1O7ZA 2PPBC 1XXGA 3DXJC 1SYBA 3A8JE 1ICWA 1CI3M 3A54A 1TWFB 2AQ1B 5E4WC 3FRPB 3U9OA 3V2TA 5JEAH 5EBCA 1B9MA 1CFMA 1NSNS 1Q1EA 2SDFA 1H9SA 1HQMC 3NBIA 3VA5A 2EYFA 5LHY1 3MXPA 1SMYC 2R6GA 4K2LA 2ZXOA 4C2MB 2M2LA 3V05A 3DWPA 5HGTA 2WINB 3SVMA 3PMFA 3H09A 1LTBD 2MJ8A 4M1UB 2OT2A 4ZLTF 4ZUJA 3LNNA 2LMCB 1EY5A 4IFDH 4FF3A 3EROA 1KTKA 2A6HC 3A7AB 1EY9A 1LLRD 1GUOA 3NWSA 2Z8LA 2R93B 4K6LA 1JE4A 1LT6D 1EIHA 3I90A 1WTXA 2JA7B 2F0FA 1SNQA 3KBGA 1OO9B 1LV9A 1UEAB 5C0XI 1JOKA 3Q22A 4A3JB 5FO9B 5I9OA 5KYIA 3EJIA 2NWGA 4OIKA 2EYPA 2C5CA 4MN3A 3VR4A 1EEFD 3T4AC 3ZYYX 5DEHA 2DN8A 1U4LA 1DOMA 4V190 2B63B 1I6HB 1HA6A 3MFGA 2EJMA 4E6IA 1FGBD 1S5CD 4CJ0B 5G3LF 4UAIA 2NTTA 3GQBA 3PUXA 4DAYA 3RMHA 1AW7A 4RGTA 1QE6A 4XQJA 4IZ8A 1GUWA 5EKIA 1SAPA 1LTAD 2I07B 1GUNA 4O1NA 4HR7B 2B8GA 4IN3A 1L0YB 3MC0B 1WTWA 4C56C 1V43A 3I70A 1F9PA 1RHPA 1DM0B 1PXUA 4FF2A 4EQPA 3GTJB 1QNUA 1JWMD 1UNSA 2KCNA 4OGQC 1XWEA 1SFOB 4NMZA 3C1EA 3KLSX 1TS4A 4G57A 4X3UA 1ZKOA 1BNZA 2L4NA 4FO2A 5C3WA 3HKZB 1GUTA 2GA4B 4CGYB 1VF5C 4M8AA 2WKCA 1B44D 2KUMA 5KEEA 5COYA 2A69D 1TVXA 2BDNA 1IW7D 1ZYRC 1EU4A 3OMGA 3J81E 1OXTA 5C5LA 3SDZA 2ZXPA 1A15A 1STNA 1IW7C 2O2LD 3SE0A 3K59A 1WTVA 1AP0A 3OMCA 1STBA 1D5ZC 2QKIC 2F0DA 1DCZA 3PUZA 1HRJA 1DONA 2CHBD 4TSSA 5I9PA 5JPNC 5EPKA 3WDNA 3E0JA 3Q24A 1S4ZA 5CBEE 1Z6HA 1FNVA 1L0XB 4PNYA 5IT9L 3TP5A 1FNUA 4A3EB 1W6KA 4HEDA 4U68A 1JOQA 3I8ZA 4O42A 3GTKB 2B2VC 1BF4A 3I3CA 3TZUA 1HTLD 2K33A 3S1NB 1HFGA 4P2CB 1ESFA 3NTHA 2K7VA 3CRLC 1EQVA 3NPPA 2KJXA 4U673 3S15B 3H6MA 4CBVA 4Q0FA 2B2UA 1O78A 4J6HA 1GHJA 4FVMA 1OXXK 1DXMA 1WTOA 4K2KA 1G91A 1F2MA 2LY7A 2A73B 2A74C 3PUVA 4MIUA 5NUCA 4V0BA 2EY1A 4RHSA 2NYZD 3RZOB 4A93B 2F03A 3OIQA 4NDXA 1PTOB 3VYUA 4B9XA 2DNEA 3I73A 4FXKC 2IL8A 2B2WA 2JA8B 5CYUA 3TN2A 1SDFA 4ZK9B 4KI0A 1PZJD 1ET6A 1EZ6A 3AU7A 4OO1H 4FF4A 5BN5A 1KABA 1KNEA 3URYA 3CQZB 1F77A 1SE2A 1LT4D 3K6OA 3GTPB 1Y8OB 1TWHB 5ELEA 3P1HA 3BDLA 1ILQA 3S14B 3N6RA 1DOLA 4BY1B 2NN6I 1JWSD 1Q12A 5M9OA 5KGUA 3DEPA 4FNFA 3KK7A 3HZXA 3NQIA 5FLXE 3PIP3 4KY5A 3N52A 4K5XA 3J80L 2M9VA 2JA6B 3Q0AA 3TSSA 2B2TA 1D6EC 1SJHD 3SEBA 4ID6A 2K05A 2KCCA 4ODGA 4KJNA 1VCIA 4XT3B 4BY7B 4B08A 4HAEA 1HHVA 3E6ZX 4YIJA 5LL6X 2CVRA 1SEBD 1TWCB 4XIGS 5KRUA 3M7NA 1SYFA 4G4KA 2Q8TA 1Q3LA 3BYTB 5BN4A 3R2TA 3BVZA 3R3OA 5C6AA 2NVQB 3A8KE 3BDOA 1B2TA 1KNAA 3SK5A 2F0GA 2MP1A 1WCMB 3T13A 1PTOF 1B50A 3MWYW 1BCPD 1SMYD 2AWNA 1LTGD 2A6HD 3TZDA 4RHRA 1BCPC 1RTNA 5E3FA 2MGSA 2CW0C 4DK0A 1WTQA 3BDCA 2L1BA 2F0LA 5C3XA 3K5LA 3M7GA 3TBIB 5HURA 2CW0D 4WJWA 4RGMA 1I50B 2B2UC 1H9JA 2BA0A 2WB1B 1HFNA 1GOZA 2JEBI 3GD7A 2IJ0A 3Q23A 4J1MA 3BVMA 2O5IC 4WORA 4KKTA 2EYMA 5CR3A 5JVH3 4RKLA 1B4OA 2K1BA 1FYCA 1E2ZA 5EBDA 1PRTC 5EGTA 4H44C 3KBXA 4KY7A 3OSOA 2A68C 2QILA 1T5XD 2PQEA 5C4ZA 1EU3A 1E2WA 1JOOA 3D3RA 3QOJA 3SR1A 4X3TA 5ELDA 2EY2A 5C0XG 4A3GB 2K04A 1BDOA 4KD3A 1MI2A 5DM73 3EA6A 4BBRB 1HPCA 5E4XA 3GTLB 2JA5B 3T53B 4QIWB 3DEOA 3J7YW 3S2HB 2IW3A 1CZGA 1DZ1A 1K8OA 3PV0A 1K8MA 1QJOA 1R4PB 2MUYA 4OIJA 1EY6A 3KUPA 2E2IB 5D3IB 2F1MA 3NP8A 1ZYRD 3HOZB 2NVXB 4KK7A 5FKAC 1YNNC 4RFBA 1D1IA 2BOSA 4H13C 4I65A 1KDBA 4G7ZC 5TSSA 2PMZB 1QG7A 2F0IA 3BYYB 3CHBD 4A3MB 2NVYB 1CZWA 4LMQD 5FK9C 1O7LA 4CJ1B 2FFKB 3MAQA 1EYAA 1F9QA 2K03A 2NB0A 2PW5A 1PRTF 2B8FA 1Q1BA 4NP5A 2RVLA 5CBAE 1Y1WB 5D14A 2PZUA 1BXTA 1EY8A 2RBMA 4QUCA 1H9RA 3A7LA 2EY5A 1CA6A 5KNBA 1PYWD 1G2SA 2LKVA 3IAYA 4CJ2C 3RD4A 2ZXRA 4BS9A 2K28A 2BCOA 1RCVD 1PZID 4TRDA 1BBXC 2L12A 2ICEC 3X3MA 2G9HD 4ULLA 3D8GA 1SXTA 2RDFA 4QF4A 3O13A 2F0SA 3EVQA 2C9OA 4A3BB 3QWNA 3FPPA 1TU2B 3HOVB 1AZQA 2G9DA 1OXUA 4DAVA 1TIID 3H91A 4EQOA 3Q6SA 4OL7A 1QWYA 2XWBB 2BE5D 2R92B 4IFDI 3MXNA 3EFXD 4HCSA 2PNRC 1EIGA 2YYZA 4F88A 4KMUC 1PZKD 4IUUA 4C3HG 1ENAA 4DGZA 1E0BA 1PMRA 4S3SA 2L55A 1LABA 4HSPA 4C3HB 5DAUA 3SXHA 1CQVA 3K57A 2EE1A 1V8QA 4HMJA 4RCOA 1IKLA 2VB2X 2A69C 3DWAA 1PLFA 1KLGD 1JICA 1WD0A 5JPMC 1I4GA 4PQXA 4XQQA 1SSOA 4KKUA 4EVOA 2LFNA 1R9TB 1NR2A 1I4PA 2IX3A 2XVSA 2IX1A 1AN8A 2AQ3B 4DFAA 2A68D 1X32A 2E76C 2NN6H 2SNMA 3DHQA 4EQNA 1HTPA 3SHLA 1BR9A 4CKBA 3U9SA 1LT3D 2EYLA 1MBYA 2HDLA 3HS0C 1V1OA 1MD2D 1STAA 2I46A 5T1GA 3S17B 3QB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8O B;  3IKJ A;  3D4R A;  2F1M A;  4BA2 I;  1SMY C;  1OXU A;  2R6G A;  3BG3 A;  2EVB A;  4KKS A;  2Q8I B;  3VR6 A;  3QJY A;  1GUS A;  1V43 A;  2EDG A;  3AB9 A;  5BN3 A;  5KNC A;  3VR3 A;  2L5T A;  3I72 A;  2A6E C;  3QG1 A;  2BE5 D;  3N6R A;  2A6E D;  3EQL C;  3HGB A;  1H9J A;  1YNN C;  2BA0 A;  3A8I E;  2NN6 I;  3T51 B;  2IT1 A;  1YNJ C;  3P20 A;  4H13 C;  2EJG C;  4LJZ C;  2PNR C;  3TZU A;  1GHK A;  1Q12 A;  1Y8P B;  5C0X H;  2K33 A;  2E75 C;  3LNN A;  3W3A A;  2D62 A;  4LK1 C;  2YYZ A;  3ND9 A;  4DK1 A;  4G7Z C;  1GUG A;  2JEB I;  2K7V A;  3GD7 A;  3CRL C;  3OW7 A;  4I7Z C;  4OGQ C;  3RLF A;  2LMC B;  3LWU A;  1Z7T A;  4KMU C;  4IFD H;  3MXU A;  3QIA A;  2O5I C;  2ZT9 C;  2JXM B;  3FMC A;  4KKT A;  1CTM A;  2V4D A;  1O78 A;  2E74 C;  3PUW A;  3T56 B;  4TKO B;  1ZKO A;  1GHJ A;  1G29 1;  1O7L A;  2A6H C;  3A7A B;  1OXX K;  4OO1 G;  1PMR A;  1GUO A;  2KA7 A;  2KCC A;  5JEA G;  1GUT A;  1LAB A;  4KN4 C;  1FYC A;  1VCI A;  3L7Z C;  4G7H C;  1E2Z A;  1DXM A;  1VF5 C;  2K32 A;  2D5D A;  1H9K A;  1OXS C;  1FR3 A;  1V8Q A;  1LAC A;  1IYV A;  2B8F A;  1Q1B A;  2AWO A;  4KHZ A;  4H44 C;  2A69 D;  3PUV A;  4XIG S;  2A69 C;  2A68 C;  3M7N A;  4JK1 C;  1H9S B;  3CRK C;  2DNC A;  1IW7 D;  1H9M A;  5A35 A;  2AUJ D;  1ZYR C;  1H9R A;  5K36 H;  3A7L A;  1TKW B;  1OXT A;  2PCF B;  1E2W A;  2O5J C;  5BN4 A;  4H0L C;  3SDZ A;  3KLR A;  2QF7 A;  2BA1 A;  5KNB A;  1EWH A;  1IW7 C;  3NE5 B;  3IFT A;  4KKU A;  1DD2 A;  3A8K E;  3BDO A;  2DNE A;  4PV1 C;  3D31 A;  4DNR B;  5C0X G;  1VF7 A;  1T5E A;  1Y69 U;  4TQU S;  1BDO A;  3I73 A;  3H94 A;  3I4L A;  4BA1 I;  4DNT B;  3SE0 A;  3VR4 A;  3M4Y A;  1A6X A;  2D2C C;  2JEA I;  2A68 D;  2DN8 A;  3PUY A;  1VDZ A;  2BE5 C;  2PPB C;  1OXV A;  1HCZ A;  3DXJ C;  2BDO A;  2E76 C;  2NN6 H;  4KN7 C;  3A8J E;  1HTP A;  1HPC A;  1ONL A;  3VR2 A;  1GJX A;  3VR5 A;  3U9S A;  4KI0 A;  2EJM A;  1CI3 M;  3T53 B;  2A6H D;  1Q90 A;  2EJF C;  1I6V C;  4OO1 H;  3ND8 A;  1IYU A;  3GQB A;  3OPO A;  1DCZ A;  2AUK A;  3PUZ A;  5JEA H;  2NN6 G;  3PUX A;  5BN5 A;  1B9M A;  5K36 G;  1CFM A;  2JE6 I;  3M85 A;  1Q1E A;  1E2V A;  3OOC A;  4JBW A;  2CW0 C;  4DK0 A;  3VA7 A;  1H9S A;  4L8J A;  3WDN A;  1HQM C;  5KND A;  4GZY C;  3PV0 A;  1K8O A;  1K8M A;  1QJO A;  4G7O C;  4RCN A;  4XTC S;  4IFD G;  1Z6H A;  1GUN A;  3MFY A;  3FPP A;  4HR7 B;  1TU2 B;  1B9N A;  2B8G A;  1Y8N B;  4IQZ A; 
#chains in the Genus database with same CATH topology
 3RLO A;  1JWU D;  3A5U A;  3RR5 A;  4DR5 L;  4IUR A;  1I4Q A;  2L5T A;  5IOD A;  2XRQ D;  2H4O A;  3J7A 5;  3EQL C;  4GKJ Q;  2F0T A;  1VQA A;  2IT1 A;  1YNJ C;  2RSO A;  2K01 A;  1GHK A;  5C0X H;  2J0T D;  5K36 G;  3GTG B;  3U58 A;  1ESR A;  4C3J H;  1F2Z A;  4JVZ A;  1I4H A;  4POF A;  4DV7 Q;  3FKI B;  5HGQ A;  3NQT A;  2JXM B;  3FMC A;  4KTA A;  3PIO A;  3A5Z B;  3NWT A;  3GDE A;  3T1H Q;  4C3J B;  4JI7 L;  4B9W A;  5J39 A;  2YTX A;  5K5P A;  4KJO A;  2O4X A;  5EKK A;  5LMU Q;  1PYS B;  3J7A F;  1K0R A;  4G7H C;  3UE1 A;  3SGI A;  2K32 A;  4BBR G;  2JYO A;  3CCJ A;  1NAP A;  4ILW A;  2KHJ A;  5IYC G;  3HOY G;  1LT5 D;  3F8T A;  1E3P A;  4BXX H;  1RKN A;  1U4P A;  2ENB A;  5CV7 A;  3S1R H;  4JI3 Q;  1QNK A;  3ER0 A;  5C5M A;  1I4X A;  2DY8 A;  4X65 Q;  3G7L A;  4DV3 Q;  1EWH A;  3FPU B;  1DOK A;  1VQM A;  4B3S L;  5CMD A;  4DU9 A;  2SOB A;  3CAM A;  2EOT A;  4LF5 L;  3I4L A;  4BA1 I;  1QCB D;  4DNT B;  2XWJ B;  3I91 A;  4P72 A;  2KED A;  3TS2 A;  3PIO 3;  1VQE A;  2RDG A;  3RN2 A;  4IAL A;  1QUQ B;  4PZ7 A;  2MFI A;  3WOE A;  1BBW A;  1PH5 A;  2PI2 E;  3FHW A;  3QO2 A;  4QCL A;  1R4Q B;  2CQA A;  3OPO A;  5FO8 B;  1RD9 D;  3CCQ A;  4QL5 A;  2NN6 G;  4LF7 L;  4J8Q A;  2JE6 I;  3L3O C;  4F7X A;  5GAD C;  3M85 A;  4K8I A;  3J7Z C;  3FDT A;  2F3V A;  4RA8 A;  2UXB Q;  5DLQ E;  2NTS A;  3HOW H;  2PW7 A;  3GTO B;  3D4R A;  1XMQ Q;  2EVB A;  1L1O B;  3AB9 A;  4CDF C;  2A6E C;  5CGK A;  2F3I A;  4X6A H;  3HGB A;  4DR3 Q;  2F0E A;  2F0J A;  1X3P A;  3S1M H;  3M9B A;  4AQY L;  3P20 A;  3FVQ A;  4APV A;  3HOU H;  2F52 A;  3OW7 A;  4MHE A;  4ZRZ A;  2JK8 A;  3CPW A;  4KHV A;  3CXC A;  1MJC A;  2CWA A;  2E74 C;  2JSO A;  5JJZ A;  4TVA B;  4JI5 L;  1WCM H;  2RQX A;  4LF7 Q;  1XNQ L;  1FVI A;  1H95 A;  1SRO A;  1M8A A;  1C4Q A;  1SYG A;  1V1P A;  4FF1 A;  4JV5 L;  2D0P A;  1S5E D;  1HUM A;  2WII B;  2ZTD A;  3ULJ A;  5AFW A;  3BZC A;  2K5W A;  2UXC L;  1IL2 A;  2NUC A;  1UWV A;  1QIL A;  3KJO A;  1EL0 A;  3GP7 A;  5IGF A;  1V1Q A;  3J80 E;  4N9T A;  1AEX A;  1BCP F;  3BVG A;  3P75 A;  1PH3 A;  3IFT A;  1I94 Q;  5C4X B;  1PTO D;  1LTR D;  1SNC A;  5I4D A;  4L6T B;  1T5E A;  1VMP A;  3HOY B;  1FNW A;  3I56 A;  3PF5 A;  3DUZ A;  2UXB L;  2BDO A;  5M3F B;  4A93 H;  3F2B A;  1X3G A;  1CHQ D;  2EIF A;  1RIP A;  1BCP B;  1STE A;  4PMC A;  2IX0 A;  2MNA A;  1A2T A;  1N32 L;  1TWA B;  2K75 A;  3ITP A;  4IPC A;  2QDB A;  2WAC A;  2HQE A;  4ZKC B;  2L0C A;  3DMU A;  4DUY Q;  1J5E Q;  3HG9 A;  1E2V A;  1EWC A;  3GTM H;  2ZTE A;  3VA7 A;  2CH4 W;  1VQL A;  4RCN A;  5CC4 A;  5IYD H;  4DR4 L;  1B9N A;  4C3I H;  5BN3 A;  4IPG A;  1W6J A;  4BA2 I;  1NY4 A;  1KXL A;  1ICF B;  4IUV A;  1PFM A;  2Q8I B;  3NK9 A;  2I5H A;  3I72 A;  5I6Y A;  2ALY B;  3FEW X;  2Z0S A;  3MEH A;  5C3E B;  4GNX B;  3GTP H;  1MSG A;  2UUC Q;  2KOL A;  1D5X C;  5IP7 H;  3ULL A;  3H0G B;  1Q7Y C;  1Y8P B;  4ZUI A;  4DK1 A;  2D62 A;  3X3N A;  1GXD C;  3TP7 A;  1O80 A;  4OO1 I;  2EYO A;  3LWU A;  1F2L A;  1YJ9 A;  2FMC A;  4P74 A;  1X3Q A;  4A3B G;  2ZT9 C;  4DAP A;  3T56 B;  1SYE A;  5C4J H;  1P8L A;  1TQO A;  1IBM Q;  1ROD A;  1G2T A;  2SEB D;  1SYC A;  5COR A;  5D65 A;  3S1R B;  2ID0 A;  4EGV A;  1RTO A;  4C3I G;  4N8X 1;  4A3B H;  5GAG C;  1ZEQ X;  5I2X A;  1X54 A;  2Z1C A;  1XMQ L;  3K5O A;  3PO2 H;  4HMI A;  1SMX A;  4QMG A;  1CM9 A;  4JK1 C;  4A3F B;  3PO2 B;  3S2H H;  1TWH H;  2LS0 1;  2EPB A;  2WAQ B;  3K5M A;  1X3F A;  4B3M L;  3A55 A;  4Y7N B;  3JAM E;  1E1O A;  2Z9H A;  3W2D A;  1SND A;  2TMP A;  2F3W A;  1ILP A;  2NBF A;  3NUC A;  2NVT B;  2EYH A;  1F9R A;  4DF7 A;  2EXZ A;  4ZKB B;  5C4J B;  4GLA C;  1KQS A;  3AEV A;  5JJL A;  2IWH A;  3K5N A;  4KY6 A;  3KF6 A;  5A2Q L;  1DD2 A;  2PZT A;  4IUN A;  1YBY A;  4R8I A;  5IP9 H;  4K8J A;  4OX9 L;  1A6X A;  1JCK B;  3PUY A;  1BO0 A;  4GS3 A;  4GLX A;  4EX5 A;  2K6A A;  3TDQ A;  2F0V A;  4OHJ A;  2PYK A;  5M3M B;  1B53 A;  3KLW A;  3VR5 A;  1X6O A;  1GJX A;  4CKC A;  5HY6 A;  1D1K A;  3D6W A;  2KEC A;  5D3D A;  5C4X H;  2UUA Q;  2WV6 D;  1K3R A;  3J81 L;  2ZJP A;  3STB C;  4XYQ A;  1SBB B;  1JOR A;  3I4M B;  4K5V A;  3OOC A;  1B1Z A;  1A2U A;  2B39 A;  3C3L A;  3S17 H;  3S2D H;  4GZY C;  1EYC A;  5IGE A;  4UP7 A;  3I4N B;  3TP8 A;  2JP1 A;  4A3K G;  1DJR D;  3CCE A;  5IGB A;  4OON A;  2EYJ A;  1WVL A;  1U4M A;  4BBS B;  1CUK A;  2R92 G;  4DN4 M;  1C48 A;  4K14 A;  4JI1 Q;  2B2T C;  3K58 A;  2E2J H;  4A3G G;  3OTO Q;  4JI2 L;  3J7A V;  2NZO A;  4QB4 A;  3DM1 A;  2E75 C;  3HKS A;  4A3C G;  1LTT D;  3ZJY C;  4C1N K;  5M5X B;  1TS3 A;  1Z7T A;  2VS1 A;  1N32 Q;  1WOC A;  3HP3 A;  3U50 C;  1EY7 A;  1HXY D;  1LTI D;  3RZD B;  5EKL A;  5EPJ A;  3NTK A;  2B2Y A;  1EY0 A;  3HFZ B;  4HIM A;  2F0U A;  4HTH A;  2YU9 H;  5DNF A;  4KN4 C;  3W5O A;  4F87 A;  1W3S A;  1K8A C;  5IYB H;  1ASY A;  1M4V A;  1OXS C;  5FLM H;  5IGG A;  4LF9 Q;  1G6Z A;  1TWA H;  1SNO A;  1HZB A;  1HR0 L;  3PSI A;  4MTK A;  4GKK Q;  1PFN A;  5A35 A;  5CV9 A;  2FJ2 A;  1K28 A;  2PCF B;  4JOI C;  4BWG B;  4JI4 L;  5KYL A;  1O7I A;  4H0L C;  1HQR D;  2SNS A;  3ONA B;  4JG2 A;  4ZQ3 A;  1WTH A;  3NE5 B;  1WTP A;  1XPR A;  1CT1 D;  4IPD A;  1S5B D;  2EZV A;  3IFD A;  3J81 j;  2FMM A;  2AQ2 B;  5ELB A;  1SNP A;  1EYG A;  1NMG A;  3D0F A;  4C1N I;  3GTM B;  5IE8 A;  1HCZ A;  4BY7 G;  3UDF A;  5IYB G;  5A2Q E;  5FLM G;  4DV1 L;  2PI2 A;  4O2D A;  1Q8I A;  4O0A A;  3B6Y A;  4IUQ A;  4IUT A;  2VNU D;  3KLS A;  4HIO A;  1YNJ D;  3HEJ A;  4UP9 A;  4A3M G;  4DR5 Q;  3MVV A;  1AFP A;  4BBR H;  4N9P A;  2F0W A;  3TRZ A;  1N9W A;  1EY4 A;  4H7B A;  4A3D G;  2TSS A;  4G7O C;  2J7Z A;  4C3H H;  4IJH A;  4IUP A;  2R61 A;  3L0O A;  2QDL A;  1SLJ A;  1RDP D;  4JI4 Q;  1VQ5 A;  4KKS A;  1SYD A;  1B3A A;  1FD7 D;  3HOX B;  3NEM A;  3ERS X;  2PZW A;  3QG1 A;  3BZD B;  4WJ3 M;  1TS5 A;  2AKW B;  3KOJ A;  5M5Y B;  4RAU C;  5CV5 A;  2EJG C;  5ELF A;  3H3V H;  4LK1 C;  4A3L H;  3ND9 A;  1IL8 A;  4WFN 3;  3R93 A;  1VQJ A;  2R7Z G;  4BXX G;  4ZCK A;  2N55 A;  3P7J A;  4R8N A;  4UDU C;  2V4D A;  1KC8 C;  1NR4 A;  4HN7 A;  5JEA J;  1KLU D;  4GOP A;  1HR0 W;  2Q8R E;  2Z4I A;  3G48 A;  3CCS A;  2K52 A;  2N49 A;  3FKI G;  2R7Z B;  1CQF A;  5J1Z A;  4A3F H;  1X3E A;  2CKZ B;  3L7Z C;  2H5X A;  4WJ4 A;  4R4C A;  1K3B C;  3AFQ A;  5EAY A;  4NW2 A;  1EEI D;  4GOP B;  3H3V C;  1LAC A;  5IOC A;  1IYV A;  1FJG L;  1X56 A;  3UDG A;  1YI2 A;  4KHZ A;  1TT2 A;  1II3 A;  2RA4 A;  3OWF A;  3TEH B;  2VQE L;  2UUB L;  3M3Y B;  1I3Q B;  1MHW C;  2HIX A;  2MO1 A;  2DNC A;  3VYR A;  2E2I H;  1H9M A;  4LFA Q;  3S1M B;  1IKM A;  1STH A;  5G3L D;  3NTI A;  5M3M H;  1PRT D;  2F0O A;  2QF7 A;  3HRZ C;  2DUD A;  3LWE A;  1HA5 A;  1RJT A;  3KYH C;  4LAA A;  5BR8 L;  4IFD J;  3HOU G;  2YV5 A;  4RWS C;  4R9W A;  4DXF A;  4L63 B;  1VQH A;  1J8I A;  1OXV A;  1C8C A;  4A3F G;  1QB5 D;  2KEE A;  3S9W A;  4X3S A;  2B63 H;  4X3K A;  4XYO A;  1I6H H;  1KL9 A;  3VR2 A;  3GTG H;  5JVG 3;  1TS2 A;  2X6G A;  1KDA A;  1VQ6 A;  1Q90 A;  2E2D C;  2EJF C;  2A5H A;  4DR1 Q;  1XNQ Q;  3KF8 B;  1SE4 A;  2H1E A;  5GRO A;  1QOH A;  3SK8 A;  4DV2 Q;  4JBW A;  4CKE A;  3LX0 A;  2A8V A;  1D5M C;  2EQS A;  1HNX Q;  4IFD G;  1EIF A;  2I5M X;  3L9A X;  1U9R A;  3S1Q B;  4UY8 C;  3IKJ A;  3I7F A;  4XDX A;  4K0K Q;  4MTN A;  1HJP A;  3TME A;  4A93 G;  5EPL A;  3H0G G;  5KNC A;  4ME5 A;  4DXG A;  1CKO A;  3ULP A;  1ENC A;  4JPB W;  3HOV H;  3A8I E;  2HUG A;  1Y1V H;  1BQQ T;  1BUV T;  2K5V A;  1M1K C;  1J5E L;  1EOT A;  1PTO C;  2KVM A;  2EY6 A;  4B3T L;  1XPU A;  4R4I A;  4I7Z C;  4RH6 A;  1YJW A;  2VUM B;  2VUM H;  1YNN D;  2OEO A;  1RF2 D;  3AFP A;  3PUW A;  5E1F A;  1G29 1;  3I2Z A;  1BOS A;  1MGS A;  4DR1 L;  5IT9 E;  4ZAI A;  5JEA G;  1A3U A;  3IRB A;  2VUM G;  5JAV A;  2M00 A;  3OHX C;  5J3B A;  4DV4 L;  3DWQ A;  1CA5 A;  4KHP L;  2D5D A;  3S16 B;  3D6C A;  5M5W B;  4YCV A;  2RHQ B;  4LF4 Q;  3NXW A;  4DK3 C;  1PH2 A;  2D9U A;  1FJG Q;  1SFO H;  1S5F D;  3R2I A;  3RUZ A;  4DA2 A;  5KIX A;  3GTJ H;  3K8A A;  1I4R A;  3S14 H;  1MJE A;  3PF4 A;  1JB3 A;  2F0H A;  4PV1 C;  1C7Y A;  4YHH L;  1Y69 U;  1ET9 A;  4RKB A;  2ZJR A;  5LL6 S;  1VQB A;  2D2C C;  4QUF A;  2JEA I;  1JR0 D;  1MSH A;  2X69 A;  2R7F A;  1DYQ A;  1NNX A;  2K4K A;  3NHH A;  2JA6 H;  1VQ8 A;  1ONL A;  1TY0 A;  2OF1 A;  3ICE A;  4B3R Q;  4YY3 Q;  1STY A;  1SJE D;  4XXE A;  1WTR A;  1IYU A;  3OIP A;  3MZ5 A;  2XN9 C;  1VQN A;  2HT1 A;  1XX8 A;  3PO3 B;  4K5W A;  3TP6 A;  4K6D A;  1UAP A;  5L37 A;  1CSP A;  2X6L A;  3MXN B;  4L8J A;  3E5S A;  2RDH A;  2WKD A;  3J80 c;  2Z4H A;  3BU2 A;  1UUP A;  4DNI A;  4NKL A;  2A19 A;  5M5Y H;  1L1O C;  4QGU A;  2KQ3 A;  4CDD C;  3BS1 A;  1XMO Q;  3DM3 A;  4AYB E;  5LMN W;  1V1P B;  1F9S A;  2F4I A;  1ZXT A;  1NE3 A;  1JJG A;  1NJI C;  5I6W A;  3ERQ A;  3HOU B;  1EFI D;  2A6E D;  4JBM A;  3RN5 A;  1XTC D;  1SE3 A;  1D2B A;  1BKB A;  4FXG C;  2WP8 J;  1IBM L;  1EWI A;  3NBH A;  3K7A B;  1GUG A;  3RLF A;  1UEB A;  3VYT A;  3HKZ G;  1AH9 A;  3SK4 A;  3GTQ B;  3CU7 A;  4RG1 A;  4A3K H;  1CTM A;  5EQ0 A;  2R3Z A;  3T1Y L;  3QOL A;  2ICI A;  3GO5 A;  4XQN A;  2UXC Q;  4YWK A;  5I2Y A;  4RGN A;  1PH9 A;  2KA7 A;  3S2D B;  5M3F H;  3JAM L;  4K0K L;  1J9O A;  2F0Q A;  4MNO A;  1FR3 A;  2RSN A;  4GKK L;  4LFB Q;  1EQT A;  5H1S E;  1Z9F A;  1YNX A;  1Y1W H;  3C1F A;  1H9S B;  3CRK C;  4JI6 Q;  5M5X H;  4JI3 L;  2E2J B;  2E2H B;  3HOX G;  2XRS D;  1TR5 A;  3KF8 A;  5C44 B;  3S1N H;  4XT1 B;  1JMC A;  3V96 A;  2BA1 A;  3I4O A;  4QIW E;  3C46 A;  1TWG B;  1KD1 C;  4FXD A;  5FOB B;  1WD1 A;  1QUQ A;  3D31 A;  4H02 A;  4DNR B;  4A3D B;  5CV6 A;  5LMU L;  2Y0S E;  1PV4 A;  2VXW A;  1U4R A;  1GO3 E;  1VDZ A;  2F0M A;  3TRE A;  3E3X A;  4KN7 C;  3T1Y Q;  2B2V A;  3G6J B;  2B2W C;  4DV4 Q;  1KIX A;  2JA5 G;  1LO5 D;  2XSC A;  2JQO A;  1YEZ A;  2PQA B;  5JOB A;  5DM6 3;  5AJ3 L;  4Q5V A;  1IBL L;  4OEL B;  5CV4 A;  2CWP A;  5KND A;  4CHT B;  1NUC A;  3K0Y A;  2DY7 A;  2MHV A;  3MFY A;  5IT9 c;  1PRT B;  3H94 A;  1Y8N B;  1LTS D;  4IQZ A;  3CCR A;  3NSW A;  3GV3 A;  1N34 Q;  1ML0 D;  3BG3 A;  1K0S A;  4GNX C;  1QVG A;  2EDG A;  1A3V A;  3F2U A;  3D4W A;  3M4O B;  4ZYS A;  1K83 B;  1JB7 A;  1UE6 A;  2Z6K A;  2JA8 H;  1G6P A;  4LJZ C;  4B3T Q;  1T9H A;  3HOW B;  2RKS A;  3VYS A;  2QCP X;  3W3A A;  2JA7 G;  4LUV A;  2HDM A;  2PO4 A;  1W2B A;  2F0K A;  1AZP A;  3MXU A;  5IY0 A;  3I4M G;  3UI2 A;  2ASB A;  2CFM A;  4DUY L;  4TKO B;  5J22 A;  2K5Q A;  1PFB A;  1VMC A;  2WB1 E;  3K80 C;  4DV0 L;  3OWE B;  5JJI A;  3A0J A;  4JV5 Q;  3M4O H;  1H9K A;  1CKN B;  4A3C H;  5C4H A;  5ISR A;  2AWO A;  3GTQ H;  2PMZ E;  1JC7 A;  1VQF A;  3K81 C;  4OX9 Q;  1S5D D;  2K5H A;  2WFW A;  1Z47 A;  2AUJ D;  2L9H A;  4BY1 H;  3T1H L;  2JA7 H;  1TKW B;  4HID A;  3AMU A;  1G8Z D;  3C2P A;  4KD4 A;  1TWC H;  5E7N A;  1JQY D;  3KLR A;  2A1A A;  1K73 C;  1IHZ A;  3WOF A;  1KAA A;  4ABN A;  1TWF H;  4F8M A;  1VF7 A;  1EYD A;  2XNA C;  5F2D A;  5AJ3 Q;  4A75 A;  3M4P A;  3M4Y A;  3MA2 B;  5IIF A;  2BE5 C;  5T1I A;  2HCI A;  4A3K B;  5CV8 A;  4R4T A;  2FHT A;  1STG A;  2ES2 A;  4R4Q A;  2UUC L;  1EIY B;  1TXY A;  1I6V C;  2HCC A;  3ND8 A;  2K5D A;  4DV3 L;  1C0A A;  2AUK A;  4UHV A;  2RF4 A;  4YWM A;  5IGD A;  2UXD L;  4X64 L;  2XIW A;  2OCE A;  4IJL A;  5GAH C;  4NXM L;  2YU9 B;  1OTC A;  2FIN B;  3MTS A;  4LUZ A;  4NXN L;  4XTC S;  3CME A;  2ZM6 Q;  4A3I B;  2QEJ C;  2RCF A;  2VB3 X;  3EBE A;  3JC6 6;  4FP5 D;  4AIM A;  3VR6 A;  3QJY A;  1KDC A;  1GUS A;  4FDB A;  3VR3 A;  3CCV A;  5C0X J;  4HSV A;  4DR7 Q;  5FLX L;  3D4D A;  2F0P A;  2KHS A;  2WB1 G;  1HUN A;  1A3T A;  3T51 B;  1TY2 A;  1UE5 A;  1Y1V B;  2K5N A;  4JI0 Q;  4KV6 A;  3U4Z A;  1CK1 A;  4PMB A;  3J81 i;  3GV6 A;  5ELC A;  2Q2I A;  1PDQ A;  2NZ1 D;  3QIA A;  3MEF A;  4DKA C;  3JAM i;  1XYI A;  2Y0S B;  1QZH A;  3IL8 A;  4HJA A;  1NCV A;  4DV5 L;  4C3J G;  1PFS A;  4OO1 G;  2L11 A;  1CHP D;  2BH8 A;  4AYB B;  4X62 L;  4LF6 Q;  1ENF A;  4WRD A;  1EZ8 A;  4C3I B;  4LUO A;  3R8B A;  2DJG C;  3MXG A;  4HCE A;  4DV0 Q;  5IGC A;  3A56 A;  4GN4 B;  2J4X A;  1DGS A;  2ZM6 L;  1SNM A;  2IPK D;  1O7Y A;  2F0N A;  5EJW A;  1PTO H;  4RGO S;  4GLV B;  4Z9C B;  4PMW A;  2MPM A;  2OXP A;  1F2Y A;  1LYL A;  3MHB A;  3CCM A;  2LSS A;  5K36 H;  1VS0 A;  3RZO H;  3CQZ H;  2O5J C;  2VY3 A;  1BVS A;  3HKZ E;  4FYD A;  1S3O A;  1YVC A;  3SK6 A;  1Y1V G;  3CKI B;  4GN5 A;  2I5L X;  4TQU S;  4P75 A;  5FO7 B;  2N88 A;  2B2Y C;  3T16 A;  1M90 C;  1O7Z A;  2YTY A;  2PPB C;  1XXG A;  4B3R L;  3DXJ C;  4A4I A;  4HIK A;  1SYB A;  3A8J E;  1CSQ A;  1ICW A;  3H3V I;  3KF6 B;  1CI3 M;  3A54 A;  1TWF B;  2AQ1 B;  2VL6 A;  5E4W C;  4GKJ L;  3FRP B;  3U9O A;  3V2T A;  5JEA H;  5EBC A;  1B9M A;  1CFM A;  1NSN S;  4N8F A;  2L15 A;  1Q1E A;  1Q8K A;  2SDF A;  1H9S A;  1HQM C;  3NBI A;  4JI8 Q;  3VA5 A;  2EYF A;  2R7Z H;  4QJF A;  1S72 A;  4NXM Q;  1EOV A;  5LHY 1;  3MXP A;  1SMY C;  4P71 A;  2R6G A;  1LUZ A;  2RHS B;  2ZXO A;  4K2L A;  4C2M B;  2KHI A;  4DK6 C;  2M2L A;  3V05 A;  3DWP A;  5HGT A;  2WIN B;  3SVM A;  3NEN A;  3PMF A;  4DV5 Q;  3H09 A;  4LF9 L;  4JI5 Q;  2Q2H A;  1LTB D;  2QGQ A;  2MJ8 A;  4M1U B;  2OT2 A;  4ZLT F;  4ZUJ A;  1E7Z A;  3LNN A;  2LMC B;  1EY5 A;  1V9P A;  5IWA Q;  4IFD H;  2E5L Q;  1IBK Q;  1N36 Q;  2UU9 L;  4FF3 A;  3ERO A;  1SE8 A;  1SN8 A;  1KTK A;  2A6H C;  1YIJ A;  1WI5 A;  3A7A B;  1EY9 A;  3U4V A;  4L5R C;  1LLR D;  4X65 L;  1GUO A;  3NWS A;  1VQC A;  3PO3 G;  2Z8L A;  3PQI A;  4A3M H;  2R93 B;  4K6L A;  1JE4 A;  1LT6 D;  4OEM B;  1EIH A;  1NTG A;  3I90 A;  1WTX A;  2FXQ A;  2JA7 B;  4JI6 L;  1WCM G;  3F2C A;  4A3E H;  4LF6 L;  2F0F A;  1D7Q A;  1HNZ Q;  1SNQ A;  3KBG A;  1OO9 B;  3EIV A;  1LV9 A;  2Q2U A;  1UEA B;  4DR2 Q;  5C0X I;  1JOK A;  3Q22 A;  4POG A;  4A3J B;  5FO9 B;  5IP9 G;  5I9O A;  3HOY H;  4JW0 A;  5KYI A;  3HOV G;  4DR6 L;  3EJI A;  2NWG A;  4OIK A;  2WAQ G;  1YHA A;  1E24 A;  2EYP A;  2C5C A;  4MN3 A;  2IY5 B;  3VR4 A;  1EEF D;  3T4A C;  3KJP A;  3ZYY X;  1JJ2 A;  5DEH A;  1WJJ A;  2DN8 A;  1U4L A;  3WWV A;  1DOM A;  4V19 0;  2B63 B;  1I6H B;  1HA6 A;  2GVB A;  4DV1 Q;  4B3M Q;  3MFG A;  3AYH B;  2EJM A;  4E6I A;  1FGB D;  1S5C D;  4CJ0 B;  5G3L F;  4UAI A;  3FKI H;  2NTT A;  3GQB A;  2VQE Q;  2RCN A;  3TS0 A;  2UUB Q;  3PUX A;  3K7U C;  4DAY A;  5IYD G;  3RMH A;  1NMF A;  2B3G A;  2NZH A;  1AW7 A;  4RGT A;  3RLN A;  2ZJQ A;  1QE6 A;  4XQJ A;  4IZ8 A;  1GUW A;  3VDY A;  5EKI A;  1SAP A;  1LTA D;  2QA4 A;  1S40 A;  2I07 B;  1GUN A;  4O1N A;  2HHH L;  4HR7 B;  2B8G A;  3Q8D A;  4IN3 A;  1BBU A;  1L0Y B;  3MC0 B;  1EQR A;  4BY1 G;  1KHI A;  1WTW A;  2CH4 A;  4C56 C;  1V43 A;  1AE3 A;  2E5L L;  3HOW G;  4L5S A;  3RZD H;  3I70 A;  5ELO A;  1F9P A;  1RHP A;  4IOC A;  1HH2 P;  3F2D A;  1DM0 B;  1PXU A;  4RMF A;  4FF2 A;  4EQP A;  3GTJ B;  1QNU A;  1JWM D;  1WFQ A;  2R92 H;  1UNS A;  2KCN A;  4OGQ C;  1XWE A;  1SFO B;  2E8G A;  1K83 H;  4NMZ A;  3C1E A;  3KLS X;  1TS4 A;  4G57 A;  2NVT H;  4X3U A;  3W1B A;  1ZKO A;  1BNZ A;  2L4N A;  2Y0S G;  2DGY A;  3A74 A;  4FO2 A;  4LFC Q;  4JOI A;  5C3W A;  3HKZ B;  1GUT A;  2GA4 B;  4CGY B;  3LGJ A;  5LMN Q;  1VF5 C;  4M8A A;  2WKC A;  1IBL Q;  1B44 D;  2KUM A;  1IZ6 A;  5KEE A;  5COY A;  1Q86 C;  2A69 D;  1TVX A;  1PYB A;  2BDN A;  3CP0 A;  1IW7 D;  4GN3 B;  1ZYR C;  1EU4 A;  3OMG A;  3J81 E;  1OXT A;  2AMC B;  5C5L A;  3SDZ A;  2ZXP A;  1A15 A;  1STN A;  2N8N A;  2OTL A;  1IW7 C;  4YY3 L;  4PG3 A;  1A62 A;  1AE2 A;  1I5F A;  5FJ8 G;  2C35 B;  2O2L D;  3SE0 A;  3K59 A;  1Q46 A;  1WTV A;  1AP0 A;  2OQK A;  1Y1W G;  1PH6 A;  1R9T H;  3OMC A;  4IOA A;  1STB A;  1PH8 A;  3K7A H;  1D5Z C;  2QKI C;  2KCT A;  2DJF C;  1QVC A;  2F0D A;  1DCZ A;  1HZ9 A;  3PUZ A;  3NBH B;  5M3F G;  3CC4 A;  1HRJ A;  1DON A;  1VQP A;  4DV2 L;  4DR2 L;  1X9N A;  2CHB D;  4TSS A;  5I9P A;  4UP8 A;  5JPN C;  5EPK A;  3WDN A;  3E0J A;  3Q24 A;  5C4X G;  1HZA A;  1S4Z A;  5CBE E;  4BBS H;  1Z6H A;  1FNV A;  1L0X B;  4PNY A;  5IT9 L;  2NVQ H;  3TP5 A;  5FJ8 H;  1FNU A;  1W6K A;  4HED A;  4U68 A;  4PZ6 A;  4A3E B;  1YHQ A;  4JYA L;  1JOQ A;  3I8Z A;  4O42 A;  4BBS G;  3S1Q H;  1SRU A;  2B2V C;  4JBJ A;  3GTK B;  1BF4 A;  3I3C A;  3TZU A;  3HOZ G;  1HTL D;  2K33 A;  4DV6 L;  4AQY Q;  3S1N B;  4P2C B;  1HFG A;  1ESF A;  3NTH A;  2K7V A;  4YCU A;  3CRL C;  1EQV A;  3E9H A;  5IWA L;  3NPP A;  4ALP A;  2JA9 A;  2KJX A;  4U67 3;  3AQQ A;  2I0Q A;  3S15 B;  3CC2 A;  4LNQ A;  2P5Z X;  3E9I A;  3H6M A;  4CBV A;  4Q0F A;  2CCZ A;  1L2F A;  2B2U A;  1O78 A;  1JJC B;  4J6H A;  1GHJ A;  4FVM A;  4DUZ L;  1ASZ A;  1OXX K;  2VW9 A;  4DR7 L;  5JJK A;  1DXM A;  1WTO A;  4K2K A;  3PGZ A;  1G91 A;  2VQF Q;  4DV7 L;  1K9M C;  3H15 A;  1F2M A;  2LY7 A;  3PUV A;  1B70 B;  2A74 C;  2A73 B;  5C44 H;  4MIU A;  5NUC A;  4V0B A;  2EY1 A;  4RHS A;  2E2H H;  2NYZ D;  3STB D;  4JBK A;  3S16 H;  3RZO B;  1A8V A;  2HD3 A;  4P73 A;  4A93 B;  4CDE C;  2F03 A;  2UUA L;  5C44 G;  3OIQ A;  1L1O A;  4NDX A;  1JE5 A;  1PTO B;  3VYU A;  4EQ5 A;  4B9X A;  3I4N G;  2DNE A;  4DV6 Q;  3CCL A;  2F4V L;  2G5D A;  3I73 A;  4FXK C;  4DR4 Q;  3UE0 A;  4DR3 L;  1KAW A;  2B2W A;  2IL8 A;  4LFC L;  3S24 A;  3CF5 A;  5CYU A;  2JA8 B;  3TN2 A;  1SDF A;  4ZK9 B;  4LFA L;  1K8G A;  4KI0 A;  2XGT A;  1PZJ D;  3RNU A;  1ET6 A;  1EZ6 A;  3AU7 A;  4OO1 H;  4JI1 L;  2R93 G;  4FF4 A;  4QQB X;  5BN5 A;  3K0X A;  3FP9 A;  1IYJ B;  4HJ5 A;  4LF5 Q;  1KAB A;  2WAQ E;  4A76 A;  1KNE A;  1I94 L;  3URY A;  1PH1 A;  3CQZ B;  3H0G H;  1F77 A;  2PNH A;  1YZ6 A;  1SE2 A;  1LT4 D;  1VQO A;  3K6O A;  5C3E H;  1Y8O B;  1N8R C;  1TWH B;  3GTP B;  5ELE A;  3P1H A;  1HNW L;  3BDL A;  4HJ7 A;  1Q81 C;  1ILQ A;  4QY7 A;  4OWX B;  3S14 B;  3N6R A;  2Q2T A;  1DOL A;  4BY7 H;  4BY1 B;  2NN6 I;  3PIP A;  4JYA Q;  2VZA A;  1JWS D;  4LFB L;  1P16 A;  1Q12 A;  5M9O A;  4A3I G;  5KGU A;  3DEP A;  4LF8 L;  2D0O A;  4FNF A;  3KDF A;  3KK7 A;  3HZX A;  1E22 A;  3NQI A;  4CDC C;  5FLX E;  3PIP 3;  4KY5 A;  3N52 A;  4K5X A;  3J80 L;  2M9V A;  2JA6 B;  2LXK A;  1VQI A;  3Q0A A;  3TSS A;  2B2T A;  2JA5 H;  3OYY A;  1D6E C;  1SJH D;  3SEB A;  4ID6 A;  2K05 A;  2KCC A;  3CD6 A;  4ODG A;  4KJN A;  1NBW A;  4DUZ Q;  1LTL A;  1VCI A;  2Z6B A;  1IXR A;  4XT3 B;  2B63 G;  4BY7 B;  4B08 A;  1N34 L;  4HAE A;  1HHV A;  3E6Z X;  4YIJ A;  2KBN A;  5M3M G;  5LL6 X;  2CVR A;  1SEB D;  1TWC B;  4XIG S;  5KRU A;  3M7N A;  2VQF L;  1SYF A;  4G4K A;  2MQH A;  2Q8T A;  1N36 L;  1Q3L A;  1C9O A;  1B3Q A;  3BYT B;  5BN4 A;  3R2T A;  3BVZ A;  2BH2 A;  1VQD A;  3R3O A;  2CQO A;  4KLK A;  5C6A A;  3GTK H;  2NVQ B;  3A8K E;  3BDO A;  5GAE C;  4KHP Q;  1B2T A;  1KNA A;  3SK5 A;  2F0G A;  2KCM A;  2UXD Q;  2MP1 A;  3M4Q A;  3G71 A;  2K50 A;  1WCM B;  3T13 A;  1HNZ L;  1PTO F;  5IYC H;  1B50 A;  3MWY W;  1BCP D;  1SMY D;  2AWN A;  4JI7 Q;  3BJU A;  1I3Q H;  1LTG D;  1IBK L;  4HJ8 A;  2UU9 Q;  2OTJ A;  2K14 A;  1YIT A;  1N33 Q;  3S15 H;  2A6H D;  3TZD A;  4RHR A;  3TQY A;  1BCP C;  1RTN A;  4X66 Q;  1PHJ A;  5E3F A;  2MGS A;  4YHH Q;  1U5K A;  1HZC A;  4L5Q A;  2CW0 C;  4J15 A;  4DK0 A;  1WTQ A;  3BDC A;  2PQA A;  3NEL A;  2L1B A;  2F0L A;  5C3X A;  4LF8 Q;  4DPG A;  2QW7 A;  3K5L A;  1TWG H;  3CC7 A;  3M7G A;  3TBI B;  5HUR A;  2GN5 A;  2CW0 D;  4WJW A;  1I50 H;  4RGM A;  1I50 B;  4A3D H;  2B2U C;  1H9J A;  2BA0 A;  2WB1 B;  5C3E G;  1HFN A;  1MIU A;  1VQ9 A;  1GOZ A;  4LWC A;  4X62 Q;  2JEB I;  3GD7 A;  3QR8 A;  2IJ0 A;  3Q23 A;  4J1M A;  4NB3 A;  3BVM A;  2O5I C;  4WOR A;  2GVA A;  4KKT A;  2EYM A;  5CR3 A;  5JVH 3;  1CKN A;  4RKL A;  1X65 A;  1EUJ A;  4AH6 A;  1B4O A;  4LF4 L;  2K1B A;  4OWW B;  4NXN Q;  4JCV E;  1G51 A;  4UPA A;  1FYC A;  1E2Z A;  1LM0 A;  2OWO A;  1UE7 A;  5EBD A;  4JI2 Q;  3OTO L;  1PRT C;  5EGT A;  4NPS A;  4H44 C;  3KBX A;  4KY7 A;  3OSO A;  2A68 C;  1KRS A;  2QIL A;  1T5X D;  2EXD A;  2PQE A;  5C4Z A;  4JI0 L;  2QEX A;  1EU3 A;  2KEN A;  4Y7N H;  1E2W A;  1JOO A;  4DAY B;  3D3R A;  1B7Y B;  3QOJ A;  3SR1 A;  4X3T A;  5ELD A;  4YCW A;  2EY2 A;  2F4V Q;  4A3G H;  4I7A A;  5C0X G;  4A3G B;  2K04 A;  5LMN L;  3HOX H;  1BDO A;  4KD3 A;  4B3S Q;  1MI2 A;  2LXJ A;  1HNX L;  5DM7 3;  3EA6 A;  4BBR B;  1RL2 A;  3G4S A;  5GQO A;  2ATW A;  1HPC A;  4AYB G;  5E4X A;  3GTL B;  2JA5 B;  3T53 B;  1XNR Q;  2HHH Q;  3CCU A;  2HIV A;  4QIW B;  1PA6 A;  3PO3 H;  3DEO A;  3GTL H;  1N33 L;  5FLX c;  2JA6 G;  5ELN A;  3J7Y W;  3S2H B;  2IW3 A;  1CZG A;  1DZ1 A;  4X66 L;  1K8O A;  3PV0 A;  1K8M A;  1QJO A;  1R4P B;  2MUY A;  4OIJ A;  3I55 A;  1EY6 A;  3KUP A;  2E2I B;  5D3I B;  2F1M A;  3NP8 A;  1U0L A;  1ZYR D;  1FGU A;  3HOZ B;  2NVX B;  4KK7 A;  1Y14 B;  5FKA C;  1WYD A;  1YNN C;  4RFB A;  1D1I A;  2JN4 A;  1GM5 A;  2BOS A;  4H13 C;  4I65 A;  1KDB A;  4G7Z C;  4A3E G;  2R7D A;  1VQG A;  5TSS A;  2PMZ B;  1CKM A;  1A63 A;  4DAM A;  1QG7 A;  2F0I A;  1B8A A;  2HQL A;  3BYY B;  4MZ9 A;  4Y52 H;  3CHB D;  4A3M B;  2NVY B;  1CZW A;  4LMQ D;  5FK9 C;  1O7L A;  1UE1 A;  4CJ1 B;  2FFK B;  3MAQ A;  4JI8 L;  1PH4 A;  1EYA A;  1F9Q A;  2R93 H;  2K03 A;  3E0E A;  2NB0 A;  2PW5 A;  4IO9 A;  1PRT F;  2B8F A;  1Q1B A;  2OQ0 A;  4NP5 A;  2RVL A;  3KFU A;  5CBA E;  4A3J H;  1PVO A;  1Y1W B;  5D14 A;  2PZU A;  1BXT A;  1EY8 A;  2RBM A;  4QUC A;  1H9R A;  4HJ9 A;  3A7L A;  2YTV A;  1SR3 A;  1E1T A;  2EY5 A;  1CA6 A;  1GD7 A;  3G6E A;  2NVY H;  4A3J G;  5KNB A;  1XNR L;  1PYW D;  4R4O A;  1G2S A;  2LKV A;  4ME3 A;  3IAY A;  1EQQ A;  4CJ2 C;  2AHO B;  3DLL A;  3OW2 A;  3CMA A;  3PO2 G;  3RD4 A;  2ZXR A;  4BS9 A;  2K28 A;  2BCO A;  1RCV D;  1XMO L;  1QVF A;  1PZI D;  4TRD A;  4LW1 A;  1BBX C;  2L12 A;  2ICE C;  1VQ7 A;  3X3M A;  4IPH A;  2G9H D;  4ULL A;  3D8G A;  1XTD A;  1SXT A;  2RDF A;  4QF4 A;  4YWL A;  3O13 A;  4GNX A;  2F0S A;  3EVQ A;  2C9O A;  4A3B B;  3QWN A;  3FPP A;  1TU2 B;  3HOV B;  1AZQ A;  1A0I A;  4OXP A;  2G9D A;  1PH7 A;  2JJQ A;  1OXU A;  1VQ4 A;  1TII D;  2N3S A;  4DAV A;  5M5W H;  3H91 A;  4EQO A;  3Q6S A;  4OL7 A;  1JT8 A;  1GKH A;  1QWY A;  2XWB B;  2BE5 D;  2R92 B;  4IFD I;  3MXN A;  3BZK A;  3EFX D;  4HCS A;  2PNR C;  4X64 Q;  1EIG A;  1EFW A;  3PCO B;  2YYZ A;  4L5T A;  2N78 A;  4F88 A;  1X55 A;  3UDX A;  4KMU C;  3KDF B;  1PZK D;  4IUU A;  1KRT A;  4C3H G;  5BR8 Q;  3EN2 A;  1ENA A;  2IHE A;  4DGZ A;  1E0B A;  2ZTC A;  3J80 i;  1PMR A;  4S3S A;  2L55 A;  1LAB A;  4HSP A;  4C3H B;  1L0W A;  5DAU A;  3SXH A;  2IHF A;  2V1C C;  1CQV A;  3K57 A;  2EE1 A;  1V8Q A;  4HMJ A;  3W1G A;  4A3L G;  1Q82 C;  4JC0 A;  1FL0 A;  4C2M H;  1D8L A;  1IKL A;  4RCO A;  2VB2 X;  3L2P A;  4GOP C;  1XPO A;  2A69 C;  3DWA A;  2MO0 A;  2JA8 G;  3GTO H;  1MKH A;  1PLF A;  1KLG D;  1XJV A;  1JIC A;  3F1Z A;  1WD0 A;  5JPM C;  3UDI A;  1I4G A;  3M3Y H;  4R1J A;  2XTI A;  4DR6 Q;  3JAM c;  1YHB A;  1YJN A;  3I4M H;  1QZG A;  3CPF A;  5IP7 G;  4PQX A;  4XQQ A;  1SSO A;  4KKU A;  3HOZ H;  3J81 c;  4EVO A;  2NVX H;  2LFN A;  1R9T B;  1NR2 A;  1I4P A;  2IX3 A;  4A3I H;  2XVS A;  2IX1 A;  1AN8 A;  2AQ3 B;  4OWT B;  4DFA A;  2A68 D;  2Z6K C;  1X32 A;  2E76 C;  2NN6 H;  2SNM A;  3DHQ A;  4EQN A;  1HTP A;  3SHL A;  1BR9 A;  4CKB A;  3U9S A;  1VQK A;  1LT3 D;  2EYL A;  4PZ8 A;  1MBY A;  2HDL A;  3HS0 C;  1V1O A;  3CW2 C;  1MD2 D;  3I4N H;  1STA A;  1HNW Q;  2I46 A;  5T1G A;  1GVP A;  2B29 A;  3S17 B;  1J6Q A;  3QB3 A;  1HR0 Q; 
#chains in the Genus database with same CATH homology
 1JWU D;  4IUR A;  1I4Q A;  2L5T A;  5IOD A;  2XRQ D;  2H4O A;  3EQL C;  2F0T A;  2IT1 A;  1YNJ C;  2RSO A;  2K01 A;  1GHK A;  5C0X H;  2J0T D;  5K36 G;  3GTG B;  1ESR A;  1F2Z A;  1I4H A;  3FKI B;  3NQT A;  2JXM B;  3FMC A;  4KTA A;  3NWT A;  4C3J B;  4B9W A;  5J39 A;  5K5P A;  4KJO A;  2O4X A;  5EKK A;  3J7A F;  4G7H C;  2K32 A;  2JYO A;  1NAP A;  4ILW A;  1LT5 D;  1RKN A;  1U4P A;  2ENB A;  5CV7 A;  1QNK A;  5C5M A;  1I4X A;  2DY8 A;  3G7L A;  1EWH A;  3FPU B;  1DOK A;  5CMD A;  4DU9 A;  2SOB A;  2EOT A;  3I4L A;  4BA1 I;  1QCB D;  4DNT B;  2XWJ B;  3I91 A;  2KED A;  3PIO 3;  2RDG A;  4IAL A;  3WOE A;  3QO2 A;  4QCL A;  1R4Q B;  2CQA A;  3OPO A;  5FO8 B;  1RD9 D;  2NN6 G;  4J8Q A;  2JE6 I;  3L3O C;  4F7X A;  3M85 A;  4K8I A;  3FDT A;  2F3V A;  4RA8 A;  2NTS A;  2PW7 A;  3GTO B;  3D4R A;  2EVB A;  3AB9 A;  2A6E C;  5CGK A;  3HGB A;  2F0E A;  2F0J A;  1X3P A;  3P20 A;  3FVQ A;  3OW7 A;  4MHE A;  4ZRZ A;  4KHV A;  2E74 C;  2JSO A;  5JJZ A;  2RQX A;  1M8A A;  1C4Q A;  1SYG A;  1V1P A;  4FF1 A;  1S5E D;  1HUM A;  2WII B;  5AFW A;  2K5W A;  2NUC A;  1QIL A;  1EL0 A;  3GP7 A;  5IGF A;  3J80 E;  4N9T A;  1AEX A;  1BCP F;  3BVG A;  3P75 A;  3IFT A;  5C4X B;  1PTO D;  1LTR D;  1SNC A;  5I4D A;  4L6T B;  1T5E A;  1VMP A;  3HOY B;  1FNW A;  3DUZ A;  2BDO A;  5M3F B;  1CHQ D;  1STE A;  1BCP B;  4PMC A;  2IX0 A;  1A2T A;  1TWA B;  3ITP A;  2QDB A;  2WAC A;  2HQE A;  4ZKC B;  2L0C A;  3DMU A;  3HG9 A;  1E2V A;  1EWC A;  3VA7 A;  4RCN A;  5CC4 A;  1B9N A;  5BN3 A;  1W6J A;  4BA2 I;  4IUV A;  1PFM A;  2Q8I B;  3NK9 A;  3I72 A;  5I6Y A;  3FEW X;  3MEH A;  5C3E B;  1MSG A;  2KOL A;  1D5X C;  3H0G B;  1Y8P B;  4ZUI A;  4DK1 A;  2D62 A;  3X3N A;  1GXD C;  3TP7 A;  1O80 A;  4OO1 I;  2EYO A;  3LWU A;  1F2L A;  2FMC A;  1X3Q A;  2ZT9 C;  4DAP A;  3T56 B;  1SYE A;  1TQO A;  1ROD A;  1G2T A;  2SEB D;  1SYC A;  5COR A;  5D65 A;  3S1R B;  2ID0 A;  4EGV A;  1RTO A;  4C3I G;  1ZEQ X;  5I2X A;  2Z1C A;  3K5O A;  4HMI A;  4A3F B;  4QMG A;  1CM9 A;  4JK1 C;  3PO2 B;  2LS0 1;  2EPB A;  2WAQ B;  3K5M A;  3A55 A;  4Y7N B;  3JAM E;  3W2D A;  1SND A;  2TMP A;  2F3W A;  1ILP A;  2NBF A;  3NUC A;  2NVT B;  2EYH A;  1F9R A;  4DF7 A;  2EXZ A;  4ZKB B;  5C4J B;  2IWH A;  3K5N A;  4KY6 A;  5A2Q L;  1DD2 A;  2PZT A;  4IUN A;  4R8I A;  4K8J A;  1A6X A;  1JCK B;  3PUY A;  1BO0 A;  2K6A A;  3TDQ A;  2F0V A;  4OHJ A;  2PYK A;  5M3M B;  1B53 A;  3VR5 A;  1GJX A;  4CKC A;  1D1K A;  3D6W A;  2KEC A;  5D3D A;  2WV6 D;  3J81 L;  4XYQ A;  1SBB B;  1JOR A;  3I4M B;  4K5V A;  3OOC A;  1B1Z A;  1A2U A;  2B39 A;  3C3L A;  4GZY C;  1EYC A;  5IGE A;  3I4N B;  3TP8 A;  2JP1 A;  1DJR D;  5IGB A;  2EYJ A;  1WVL A;  1U4M A;  4BBS B;  4DN4 M;  1C48 A;  4K14 A;  2B2T C;  3K58 A;  3J7A V;  4QB4 A;  3DM1 A;  2E75 C;  1LTT D;  4C1N K;  5M5X B;  1TS3 A;  1Z7T A;  3HP3 A;  1EY7 A;  1HXY D;  1LTI D;  3RZD B;  5EKL A;  5EPJ A;  3NTK A;  2B2Y A;  1EY0 A;  2F0U A;  4HTH A;  5DNF A;  4KN4 C;  4F87 A;  1M4V A;  1OXS C;  5IGG A;  1G6Z A;  1SNO A;  1PFN A;  5A35 A;  5CV9 A;  2FJ2 A;  2PCF B;  4BWG B;  5KYL A;  4H0L C;  1HQR D;  2SNS A;  3ONA B;  4ZQ3 A;  3NE5 B;  1WTP A;  1CT1 D;  1S5B D;  2EZV A;  3IFD A;  2FMM A;  2AQ2 B;  5ELB A;  1SNP A;  4C1N I;  3GTM B;  1HCZ A;  5A2Q E;  1Q8I A;  4IUQ A;  4IUT A;  2VNU D;  3KLS A;  1YNJ D;  3HEJ A;  3MVV A;  1AFP A;  4N9P A;  2F0W A;  1EY4 A;  4H7B A;  2TSS A;  4G7O C;  2J7Z A;  4IUP A;  2R61 A;  1RDP D;  4KKS A;  1SYD A;  1B3A A;  1FD7 D;  3HOX B;  2PZW A;  3QG1 A;  3BZD B;  5M5Y B;  1TS5 A;  4RAU C;  5CV5 A;  2EJG C;  5ELF A;  4LK1 C;  3ND9 A;  1IL8 A;  4WFN 3;  3R93 A;  2N55 A;  3P7J A;  4R8N A;  4UDU C;  2V4D A;  1NR4 A;  4HN7 A;  5JEA J;  1KLU D;  2Q8R E;  2Z4I A;  2R7Z B;  1CQF A;  5J1Z A;  3L7Z C;  3H3V C;  4NW2 A;  1EEI D;  1LAC A;  5IOC A;  1IYV A;  4KHZ A;  1TT2 A;  1II3 A;  2RA4 A;  3OWF A;  3M3Y B;  1I3Q B;  2DNC A;  3VYR A;  1H9M A;  3S1M B;  1IKM A;  1STH A;  5G3L D;  3NTI A;  1PRT D;  2F0O A;  2QF7 A;  3HRZ C;  3LWE A;  1HA5 A;  1RJT A;  4LAA A;  4IFD J;  4RWS C;  4R9W A;  4DXF A;  4L63 B;  1J8I A;  1OXV A;  1C8C A;  1QB5 D;  2KEE A;  3S9W A;  4X3S A;  4X3K A;  4XYO A;  3VR2 A;  5JVG 3;  1TS2 A;  2X6G A;  1KDA A;  1Q90 A;  2E2D C;  2EJF C;  2A5H A;  1SE4 A;  2H1E A;  1QOH A;  3SK8 A;  4JBW A;  4CKE A;  3LX0 A;  1D5M C;  4IFD G;  3L9A X;  1U9R A;  3S1Q B;  3IKJ A;  4XDX A;  3TME A;  5EPL A;  5KNC A;  4ME5 A;  4DXG A;  1ENC A;  3A8I E;  2HUG A;  1BQQ T;  1BUV T;  1EOT A;  1PTO C;  2KVM A;  2EY6 A;  4I7Z C;  4RH6 A;  2VUM B;  1YNN D;  2OEO A;  1RF2 D;  3PUW A;  5E1F A;  1G29 1;  1BOS A;  1MGS A;  5IT9 E;  4ZAI A;  5JEA G;  1A3U A;  5JAV A;  2M00 A;  3OHX C;  1CA5 A;  3DWQ A;  2D5D A;  3S16 B;  3D6C A;  5M5W B;  3NXW A;  2D9U A;  1S5F D;  3R2I A;  3RUZ A;  4DA2 A;  5KIX A;  1I4R A;  1JB3 A;  2F0H A;  4PV1 C;  1Y69 U;  1ET9 A;  4RKB A;  5LL6 S;  4QUF A;  2D2C C;  2JEA I;  1JR0 D;  1MSH A;  2X69 A;  1DYQ A;  3NHH A;  1ONL A;  1TY0 A;  2OF1 A;  1STY A;  1SJE D;  4XXE A;  1WTR A;  1IYU A;  3OIP A;  3MZ5 A;  2XN9 C;  3PO3 B;  1XX8 A;  4K5W A;  3TP6 A;  4K6D A;  1UAP A;  2X6L A;  4L8J A;  3E5S A;  2RDH A;  2WKD A;  2Z4H A;  1UUP A;  4NKL A;  2KQ3 A;  3BS1 A;  1V1P B;  1F9S A;  2F4I A;  1ZXT A;  5I6W A;  3ERQ A;  3HOU B;  1EFI D;  2A6E D;  1XTC D;  1SE3 A;  1D2B A;  4FXG C;  2WP8 J;  3NBH A;  3K7A B;  1GUG A;  3RLF A;  3VYT A;  3SK4 A;  3GTQ B;  3CU7 A;  1CTM A;  5EQ0 A;  2R3Z A;  3QOL A;  2ICI A;  3GO5 A;  4XQN A;  5I2Y A;  4RGN A;  2KA7 A;  3S2D B;  3JAM L;  1J9O A;  2F0Q A;  1FR3 A;  2RSN A;  1EQT A;  3C1F A;  1H9S B;  3CRK C;  2E2J B;  2E2H B;  2XRS D;  1TR5 A;  3KF8 A;  5C44 B;  4XT1 B;  3V96 A;  2BA1 A;  3C46 A;  1TWG B;  4FXD A;  5FOB B;  1WD1 A;  4DNR B;  3D31 A;  4A3D B;  5CV6 A;  2VXW A;  1U4R A;  1VDZ A;  2F0M A;  4KN7 C;  2B2V A;  3G6J B;  2B2W C;  1LO5 D;  2XSC A;  5JOB A;  5DM6 3;  4Q5V A;  5CV4 A;  5KND A;  4CHT B;  1NUC A;  3K0Y A;  2DY7 A;  2MHV A;  3MFY A;  1PRT B;  3H94 A;  1Y8N B;  1LTS D;  4IQZ A;  3NSW A;  3GV3 A;  1ML0 D;  3BG3 A;  2EDG A;  1A3V A;  3F2U A;  3D4W A;  3M4O B;  4ZYS A;  1K83 B;  4LJZ C;  3HOW B;  2RKS A;  3VYS A;  2QCP X;  3W3A A;  2HDM A;  2PO4 A;  2F0K A;  1AZP A;  3MXU A;  3UI2 A;  4TKO B;  5J22 A;  2K5Q A;  1PFB A;  1VMC A;  3OWE B;  1H9K A;  5C4H A;  5ISR A;  2AWO A;  1JC7 A;  1S5D D;  1Z47 A;  2AUJ D;  2L9H A;  1TKW B;  3AMU A;  1G8Z D;  3C2P A;  4KD4 A;  1JQY D;  3KLR A;  1IHZ A;  3WOF A;  1KAA A;  4ABN A;  4F8M A;  1VF7 A;  1EYD A;  2XNA C;  5F2D A;  3MA2 B;  3M4Y A;  5IIF A;  2BE5 C;  5T1I A;  2HCI A;  4A3K B;  5CV8 A;  2FHT A;  1STG A;  1I6V C;  2HCC A;  3ND8 A;  2K5D A;  2AUK A;  5IGD A;  2XIW A;  2YU9 B;  2FIN B;  3MTS A;  4XTC S;  4A3I B;  2QEJ C;  2VB3 X;  4FP5 D;  3VR6 A;  3QJY A;  1KDC A;  1GUS A;  3VR3 A;  5C0X J;  4HSV A;  5FLX L;  3D4D A;  2F0P A;  2KHS A;  1HUN A;  1A3T A;  3T51 B;  1TY2 A;  1Y1V B;  4KV6 A;  1CK1 A;  4PMB A;  3GV6 A;  5ELC A;  1PDQ A;  2NZ1 D;  3QIA A;  1XYI A;  2Y0S B;  3IL8 A;  1NCV A;  4C3J G;  4OO1 G;  2L11 A;  1CHP D;  4AYB B;  1ENF A;  4WRD A;  1EZ8 A;  4C3I B;  3R8B A;  4HCE A;  3MXG A;  5IGC A;  3A56 A;  2J4X A;  1SNM A;  2IPK D;  1O7Y A;  2F0N A;  5EJW A;  1PTO H;  4RGO S;  4Z9C B;  4PMW A;  2MPM A;  2OXP A;  1F2Y A;  3MHB A;  5K36 H;  2O5J C;  4FYD A;  3SK6 A;  3CKI B;  4TQU S;  5FO7 B;  2N88 A;  2B2Y C;  3T16 A;  1O7Z A;  2PPB C;  1XXG A;  3DXJ C;  1SYB A;  3A8J E;  1ICW A;  1CI3 M;  3A54 A;  1TWF B;  2AQ1 B;  5E4W C;  3FRP B;  3U9O A;  3V2T A;  5JEA H;  5EBC A;  1B9M A;  1CFM A;  1NSN S;  1Q1E A;  2SDF A;  1H9S A;  1HQM C;  3NBI A;  3VA5 A;  2EYF A;  5LHY 1;  3MXP A;  1SMY C;  2R6G A;  4K2L A;  2ZXO A;  4C2M B;  2M2L A;  3V05 A;  3DWP A;  5HGT A;  2WIN B;  3SVM A;  3PMF A;  3H09 A;  1LTB D;  2MJ8 A;  4M1U B;  2OT2 A;  4ZLT F;  4ZUJ A;  3LNN A;  2LMC B;  1EY5 A;  4IFD H;  4FF3 A;  3ERO A;  1KTK A;  2A6H C;  3A7A B;  1EY9 A;  1LLR D;  1GUO A;  3NWS A;  2Z8L A;  2R93 B;  4K6L A;  1JE4 A;  1LT6 D;  1EIH A;  3I90 A;  1WTX A;  2JA7 B;  2F0F A;  1SNQ A;  3KBG A;  1OO9 B;  1LV9 A;  1UEA B;  5C0X I;  1JOK A;  3Q22 A;  4A3J B;  5FO9 B;  5I9O A;  5KYI A;  3EJI A;  2NWG A;  4OIK A;  2EYP A;  2C5C A;  4MN3 A;  3VR4 A;  1EEF D;  3T4A C;  3ZYY X;  5DEH A;  2DN8 A;  1U4L A;  1DOM A;  4V19 0;  2B63 B;  1I6H B;  1HA6 A;  3MFG A;  2EJM A;  4E6I A;  1FGB D;  1S5C D;  4CJ0 B;  5G3L F;  4UAI A;  2NTT A;  3GQB A;  3PUX A;  4DAY A;  3RMH A;  1AW7 A;  4RGT A;  1QE6 A;  4XQJ A;  4IZ8 A;  1GUW A;  5EKI A;  1SAP A;  1LTA D;  2I07 B;  1GUN A;  4O1N A;  4HR7 B;  2B8G A;  4IN3 A;  1L0Y B;  3MC0 B;  1WTW A;  4C56 C;  1V43 A;  3I70 A;  1F9P A;  1RHP A;  1DM0 B;  1PXU A;  4FF2 A;  4EQP A;  3GTJ B;  1QNU A;  1JWM D;  1UNS A;  2KCN A;  4OGQ C;  1XWE A;  1SFO B;  4NMZ A;  3C1E A;  3KLS X;  1TS4 A;  4G57 A;  4X3U A;  1ZKO A;  1BNZ A;  2L4N A;  4FO2 A;  5C3W A;  3HKZ B;  1GUT A;  2GA4 B;  4CGY B;  1VF5 C;  4M8A A;  2WKC A;  1B44 D;  2KUM A;  5KEE A;  5COY A;  2A69 D;  1TVX A;  2BDN A;  1IW7 D;  1ZYR C;  1EU4 A;  3OMG A;  3J81 E;  1OXT A;  5C5L A;  3SDZ A;  2ZXP A;  1A15 A;  1STN A;  1IW7 C;  2O2L D;  3SE0 A;  3K59 A;  1WTV A;  1AP0 A;  3OMC A;  1STB A;  1D5Z C;  2QKI C;  2F0D A;  1DCZ A;  3PUZ A;  1HRJ A;  1DON A;  2CHB D;  4TSS A;  5I9P A;  5JPN C;  5EPK A;  3WDN A;  3E0J A;  3Q24 A;  1S4Z A;  5CBE E;  1Z6H A;  1FNV A;  1L0X B;  4PNY A;  5IT9 L;  3TP5 A;  1FNU A;  4A3E B;  1W6K A;  4HED A;  4U68 A;  1JOQ A;  3I8Z A;  4O42 A;  3GTK B;  2B2V C;  1BF4 A;  3I3C A;  3TZU A;  1HTL D;  2K33 A;  3S1N B;  1HFG A;  4P2C B;  1ESF A;  3NTH A;  2K7V A;  3CRL C;  1EQV A;  3NPP A;  2KJX A;  4U67 3;  3S15 B;  3H6M A;  4CBV A;  4Q0F A;  2B2U A;  1O78 A;  4J6H A;  1GHJ A;  4FVM A;  1OXX K;  1DXM A;  1WTO A;  4K2K A;  1G91 A;  1F2M A;  2LY7 A;  2A73 B;  2A74 C;  3PUV A;  4MIU A;  5NUC A;  4V0B A;  2EY1 A;  4RHS A;  2NYZ D;  3RZO B;  4A93 B;  2F03 A;  3OIQ A;  4NDX A;  1PTO B;  3VYU A;  4B9X A;  2DNE A;  3I73 A;  4FXK C;  2IL8 A;  2B2W A;  2JA8 B;  5CYU A;  3TN2 A;  1SDF A;  4ZK9 B;  4KI0 A;  1PZJ D;  1ET6 A;  1EZ6 A;  3AU7 A;  4OO1 H;  4FF4 A;  5BN5 A;  1KAB A;  1KNE A;  3URY A;  3CQZ B;  1F77 A;  1SE2 A;  1LT4 D;  3K6O A;  3GTP B;  1Y8O B;  1TWH B;  5ELE A;  3P1H A;  3BDL A;  1ILQ A;  3S14 B;  3N6R A;  1DOL A;  4BY1 B;  2NN6 I;  1JWS D;  1Q12 A;  5M9O A;  5KGU A;  3DEP A;  4FNF A;  3KK7 A;  3HZX A;  3NQI A;  5FLX E;  3PIP 3;  4KY5 A;  3N52 A;  4K5X A;  3J80 L;  2M9V A;  2JA6 B;  3Q0A A;  3TSS A;  2B2T A;  1D6E C;  1SJH D;  3SEB A;  4ID6 A;  2K05 A;  2KCC A;  4ODG A;  4KJN A;  1VCI A;  4XT3 B;  4BY7 B;  4B08 A;  4HAE A;  1HHV A;  3E6Z X;  4YIJ A;  5LL6 X;  2CVR A;  1SEB D;  1TWC B;  4XIG S;  5KRU A;  3M7N A;  1SYF A;  4G4K A;  2Q8T A;  1Q3L A;  3BYT B;  5BN4 A;  3R2T A;  3BVZ A;  3R3O A;  5C6A A;  2NVQ B;  3A8K E;  3BDO A;  1B2T A;  1KNA A;  3SK5 A;  2F0G A;  2MP1 A;  1WCM B;  3T13 A;  1PTO F;  1B50 A;  3MWY W;  1BCP D;  1SMY D;  2AWN A;  1LTG D;  2A6H D;  3TZD A;  4RHR A;  1BCP C;  1RTN A;  5E3F A;  2MGS A;  2CW0 C;  4DK0 A;  1WTQ A;  3BDC A;  2L1B A;  2F0L A;  5C3X A;  3K5L A;  3M7G A;  3TBI B;  5HUR A;  2CW0 D;  4WJW A;  4RGM A;  1I50 B;  2B2U C;  1H9J A;  2BA0 A;  2WB1 B;  1HFN A;  1GOZ A;  2JEB I;  3GD7 A;  2IJ0 A;  3Q23 A;  4J1M A;  3BVM A;  2O5I C;  4WOR A;  4KKT A;  2EYM A;  5CR3 A;  5JVH 3;  4RKL A;  1B4O A;  2K1B A;  1FYC A;  1E2Z A;  5EBD A;  1PRT C;  5EGT A;  4H44 C;  3KBX A;  4KY7 A;  3OSO A;  2A68 C;  2QIL A;  1T5X D;  2PQE A;  5C4Z A;  1EU3 A;  1E2W A;  1JOO A;  3D3R A;  3QOJ A;  3SR1 A;  4X3T A;  5ELD A;  2EY2 A;  5C0X G;  4A3G B;  2K04 A;  1BDO A;  4KD3 A;  1MI2 A;  5DM7 3;  3EA6 A;  4BBR B;  1HPC A;  5E4X A;  3GTL B;  2JA5 B;  3T53 B;  4QIW B;  3DEO A;  3J7Y W;  3S2H B;  2IW3 A;  1CZG A;  1DZ1 A;  1K8O A;  3PV0 A;  1K8M A;  1QJO A;  1R4P B;  2MUY A;  4OIJ A;  1EY6 A;  3KUP A;  2E2I B;  5D3I B;  2F1M A;  3NP8 A;  1ZYR D;  3HOZ B;  2NVX B;  4KK7 A;  5FKA C;  1YNN C;  4RFB A;  1D1I A;  2BOS A;  4H13 C;  4I65 A;  1KDB A;  4G7Z C;  5TSS A;  2PMZ B;  1QG7 A;  2F0I A;  3BYY B;  3CHB D;  4A3M B;  2NVY B;  1CZW A;  4LMQ D;  5FK9 C;  1O7L A;  4CJ1 B;  2FFK B;  3MAQ A;  1EYA A;  1F9Q A;  2K03 A;  2NB0 A;  2PW5 A;  1PRT F;  2B8F A;  1Q1B A;  4NP5 A;  2RVL A;  5CBA E;  1Y1W B;  5D14 A;  2PZU A;  1BXT A;  1EY8 A;  2RBM A;  4QUC A;  1H9R A;  3A7L A;  2EY5 A;  1CA6 A;  5KNB A;  1PYW D;  1G2S A;  2LKV A;  3IAY A;  4CJ2 C;  3RD4 A;  2ZXR A;  4BS9 A;  2K28 A;  2BCO A;  1RCV D;  1PZI D;  4TRD A;  1BBX C;  2L12 A;  2ICE C;  3X3M A;  2G9H D;  4ULL A;  3D8G A;  1SXT A;  2RDF A;  4QF4 A;  3O13 A;  2F0S A;  3EVQ A;  2C9O A;  4A3B B;  3QWN A;  3FPP A;  1TU2 B;  3HOV B;  1AZQ A;  2G9D A;  1OXU A;  4DAV A;  1TII D;  3H91 A;  4EQO A;  3Q6S A;  4OL7 A;  1QWY A;  2XWB B;  2BE5 D;  2R92 B;  4IFD I;  3MXN A;  3EFX D;  4HCS A;  2PNR C;  1EIG A;  2YYZ A;  4F88 A;  4KMU C;  1PZK D;  4IUU A;  4C3H G;  1ENA A;  4DGZ A;  1E0B A;  1PMR A;  4S3S A;  2L55 A;  1LAB A;  4HSP A;  4C3H B;  5DAU A;  3SXH A;  1CQV A;  3K57 A;  2EE1 A;  1V8Q A;  4HMJ A;  4RCO A;  1IKL A;  2VB2 X;  2A69 C;  3DWA A;  1PLF A;  1KLG D;  1JIC A;  1WD0 A;  5JPM C;  1I4G A;  4PQX A;  4XQQ A;  1SSO A;  4KKU A;  4EVO A;  2LFN A;  1R9T B;  1NR2 A;  1I4P A;  2IX3 A;  2XVS A;  2IX1 A;  1AN8 A;  2AQ3 B;  4DFA A;  2A68 D;  1X32 A;  2E76 C;  2NN6 H;  2SNM A;  3DHQ A;  4EQN A;  1HTP A;  3SHL A;  1BR9 A;  4CKB A;  3U9S A;  1LT3 D;  2EYL A;  1MBY A;  2HDL A;  3HS0 C;  1V1O A;  1MD2 D;  1STA A;  2I46 A;  5T1G A;  3S17 B;  3QB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...