3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
b'MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
5BN3A 3PUVA 2Q8IB 1VDZA 3P20A 2O5IC 4IFDH 3LNNA 2D2CC 3I72A 3MXUA 1B9MA 5JEAH 1LACA 3QIAA 1Q90A 1G291 2YYZA 1GUGA 2QF7A 3A7LA 3ND9A 2JEAI 1GUNA 1Y8NB 2BE5C 1I6VC 2K33A 2A6ED 3I4LA 2AWOA 1Y8OB 3FPPA 3M4YA 3QG1A 3L7ZC 1LABA 4BA2I 3CRLC 4OGQC 4TKOB 1TKWB 2A6HD 2E75C 4DK0A 2B8FA 1OXTA 2D5DA 5K36H 4OO1G 3OOCA 1Z6HA 4TQUS 4H44C 1GUSA 1DXMA 3U9SA 2PPBC 4G7ZC 2BDOA 5C0XG 1K8OA 1HQMC 3A8IE 3SDZA 3OW7A 1GUTA 1OXSC 1VF5C 2O5JC 1H9JA 1CTMA 1HPCA 1OXVA 3QJYA 3VR2A 3VR3A 1HCZA 3IFTA 3RLFA 2A68D 1GUOA 1TU2B 1Z7TA 1GHJA 2IT1A 2NN6I 1BDOA 2A68C 3DXJC 4KHZA 1OXXK 3LWUA 4KMUC 2EJFC 5KNDA 1EWHA 2K7VA 5BN4A 1A6XA 4KKTA 3KLRA 2D62A 3D4RA 2R6GA 3H94A 4LK1C 4RCNA 1K8MA 2A6EC 1O78A 1O7LA 4I7ZC 4KN7C 4OO1H 4GZYC 3HGBA 3PUXA 4G7OC 1H9SB 2B8GA 4G7HC 2CW0C 3PUYA 5C0XH 1Q12A 2A6HC 3VR5A 4DNTB 1YNNC 4H13C 3SE0A 1Y69U 3D31A 2AUKA 1QJOA 1VCIA 4DK1A 1H9KA 5JEAG 1SMYC 3NE5B 1YNJC 4LJZC 3WDNA 2K32A 1VF7A 2JXMB 3N6RA 1PMRA 2KCCA 4HR7B 3T53B 1T5EA 1ZKOA 1GHKA 3T51B 3MFYA 3T56B 1CFMA 4DNRB 4KKSA 2AUJD 1GJXA 2V4DA 3M85A 2E74C 3VR4A 1H9SA 1Q1EA 4H0LC 3BG3A 3M7NA 1H9RA 2EJMA 2NN6G 1IW7D 1DCZA 2DN8A 1Q1BA 2EJGC 1ONLA 5KNBA 2JEBI 3EQLC 4PV1C 3ND8A 1B9NA 3CRKC 4XIGS 1IW7C 3GQBA 4JBWA 4XTCS 3PUZA 5KNCA 1CI3M 3AB9A 4KN4C 1E2WA 4IFDG 1E2VA 2F1MA 3PV0A 3IKJA 4JK1C 2A69D 1V43A 1FYCA 2BE5D 1Y8PB 2PCFB 3OPOA 1ZYRC 2BA1A 2E76C 3W3AA 2A69C 1IYVA 2JE6I 1FR3A 4BA1I 4KKUA 5BN5A 4L8JA 3A8JE 3PUWA 2PNRC 2LMCB 2DNEA 1E2ZA 3BDOA 3FMCA 1DD2A 2L5TA 1OXUA 4KI0A 1IYUA 5A35A 2NN6H 2KA7A 2EDGA 2ZT9C 3VA7A 1H9MA 1HTPA 3GD7A 3TZUA 2BA0A 2DNCA 3I73A 3A8KE 2EVBA 5K36G 3VR6A 3A7AB 4IQZA 1V8QA
chains in the Genus database with same CATH superfamily
2Q8IB 1ET6A 4ME5A 1SR3A 3BYYB 4HAEA 2E2IB 3GV3A 2J7ZA 1AE2A 5C3EB 3CPWA 1OO9B 2KHSA 2WFWA 3EROA 3I56A 5E3FA 1ENFA 1F77A 4DXGA 1L0XB 5IGBA 2E2JH 4FF1A 1FJGQ 1AZPA 2YTYA 2G5DA 4DF7A 3BJUA 5COYA 1PZID 4A3DG 4DV5L 1SYEA 5GQOA 1G2TA 1NMGA 1O7IA 3IFDA 1ICWA 2EE1A 3ITPA 4F87A 1PTOC 1XTDA 3ER0A 2RA4A 3SDZA 3SK5A 2F0FA 1VQ4A 1X56A 1A63A 2HIXA 5HY6A 4YWMA 2KUMA 2PMZE 1P16A 3E9HA 4DV5Q 2B63G 1BNZA 3SVMA 3SXHA 1TS5A 1FGBD 3J80c 2EIFA 4DA2A 2SDFA 4RFBA 4LK1C 5FLXc 4A3FB 4DU9A 2F0HA 4ZKCB 3HGBA 2KQ3A 1FNVA 2RQXA 1MD2D 1CHPD 4BBSB 3DMUA 1EYGA 1Y1WH 4LUOA 5IP7H 3WDNA 5IIFA 2K32A 2JA5B 1PMRA 2B2TC 1VQKA 2JA8H 1GHKA 3MFYA 1R9TH 3GTLH 1PTOH 2XVSA 5FLMH 4PNYA 2ALYB 1Q1EA 1TS3A 2O4XA 3GP7A 1QB5D 4V190 1SJED 3GTGB 1NCVA 3UDXA 2LXKA 1X32A 4I7AA 1VQLA 3PSIA 3KK7A 1LTID 3CAMA 3E6ZX 1E22A 4RHSA 2E76C 3RZDH 1RHPA 3CCRA 2JE6I 1KRSA 3J80i 5BN5A 4L8JA 3GTPH 1BUVT 4WJWA 3BDCA 3ICEA 2EYMA 2L5TA 4X62Q 4KI0A 2WP8J 1STBA 1VQMA 2HD3A 3T1HL 4C3IG 2B2TA 1CKOA 2LXJA 4UP9A 3TZUA 2UXBQ 3T16A 1PH8A 3VR6A 3A7AB 3I4MH 1WTRA 3OWFA 2Q2IA 2HDLA 2OWOA 1ASYA 2QW7A 5GADC 3PQIA 1LO5D 3OMGA 2QA4A 1Q86C 2NTSA 3CCVA 1NR2A 5AFWA 2A74C 3CCLA 4WRDA 3T1HQ 3CC2A 5DAUA 5HGQA 1GUNA 2NVXB 2NZOA 4FF2A 1WOCA 3J81E 1LABA 2F0JA 4OGQC 2A6HD 1QE6A 1WI5A 4DR5L 4FYDA 3U9SA 3NUCA 5DEHA 1AFPA 1EY4A 1EWIA 5C5LA 2RSOA 1H9JA 1HPCA 3PIP3 3VR3A 1E3PA 4BXXG 3OTOL 4DR5Q 1SE8A 3HEJA 4PMBA 5BN4A 2WACA 4KKTA 5IWAL 1N9WA 3D4RA 4JBKA 1WTQA 3MEFA 3PUXA 1XYIA 2Q2UA 1FVIA 2IW3A 1HUMA 2F4IA 3K58A 5LMUL 1Q12A 3NHHA 3U58A 1E1OA 3OTOQ 3IAYA 1VQIA 3D31A 1ENCA 3KF8B 1B53A 1N36Q 5IWAQ 1F2YA 2UXDL 3CQZB 4ABNA 1TQOA 5M5WB 3T53B 1M90C 1KDBA 3S15H 3GTQH 1H9SA 5EPJA 5CV4A 2MPMA 1B50A 2B2VC 2UXDQ 4WORA 1R4PB 3MC0B 1IW7C 1K8AC 4XQJA 3KJPA 2EOTA 4DV3Q 4XXEA 1W6JA 3KLSX 2FHTA 3O13A 4U673 4C3HG 3OPOA 2F0DA 3AFPA 1A2UA 5I9PA 4P73A 2AQ1B 2Y0SE 4JI5L 3TP6A 4A3IG 2G9DA 1WCMG 3D4DA 4Y7NH 4UP7A 2NN6H 1S3OA 5C44B 4MZ9A 4A3EG 4IFDJ 2NBFA 4JBMA 4R4CA 1EEID 2FMCA 2Z4HA 1VQEA 1E1TA 1PA6A 1UE5A 1UUPA 4JI5Q 1K3BC 3T13A 5CV6A 4DV6Q 2B2VA 1KAAA 1TIID 1O7ZA 4K14A 1IZ6A 4IOCA 5FOBB 1U4MA 1WCMB 4Y52H 1OXTA 1EQTA 3HOZH 4HEDA 1Z6HA 2UUAL 2K04A 4R8IA 3S1MH 2A1AA 2PPBC 4G7ZC 4OIJA 4DK6C 3NTHA 4CHTB 3OW7A 4BY1H 1VF5C 2EYFA 1WTXA 3IFTA 2A68D 1HNXL 3BVGA 3BVMA 3VYRA 1N34L 4C3JH 1A3VA 2RSNA 3KBXA 4C2MB 4PQXA 3NBHA 5D3DA 1D5XC 4A3CH 1SNMA 3PGZA 5EKIA 4G7OC 1HNXQ 1YZ6A 1TY0A 2VQEQ 1N34Q 3VR5A 1PFMA 1N33L 2K5HA 2Z6BA 2PW7A 3CCJA 3S17H 1LUZA 3SGIA 1K0RA 2ZJRA 1ZKOA 2ZTCA 3T56B 1VMPA 1LTGD 4KKSA 4DNRB 1GJXA 3C46A 2ENBA 4LF5Q 3U9OA 1B7YB 1BVSA 1KNAA 2EJMA 1X3FA 2Y0SG 1QZHA 4RMFA 2SEBD 3ND8A 5KGUA 4DGZA 1A3TA 1TT2A 3D6CA 3D6WA 1ESFA 1CI3M 3N52A 2F1MA 2RHQB 1U0LA 3HZXA 4HIKA 1B70B 1NJIC 2A69C 2XRSD 2JA7H 3CMEA 2F3IA 3TMEA 5LMNQ 1PH2A 4JI7Q 2E2JB 4FXKC 1MHWC 4BBRH 3FMCA 3BDOA 3OYYA 1GXDC 2ZXPA 1CQFA 3A55A 2EDGA 3KDFB 1Y1VG 1CSQA 3F2DA 3GDEA 4PZ8A 2E2DC 1V8QA 4MHEA 4KJNA 3FKIG 2K14A 5M5XH 1PZKD 3A0JA 2WB1G 2D2CC 1PYWD 4DR3Q 3LWEA 1YEZA 1LACA 3URYA 2WKCA 2E5LQ 4IO9A 2ZXRA 4B9XA 2YYZA 3Q0AA 3ND9A 4YHHL 4A75A 5GAGC 3QR8A 4A3BH 1M8AA 2P5ZX 3NQIA 5CV5A 2HQEA 2JA8G 1PH3A 4TSSA 4NXMQ 3BZCA 4TKOB 1STNA 1TKWB 1K3RA 1XX8A 1B1ZA 2K75A 3E3XA 2IPKD 1BXTA 2N78A 4RKLA 3GTGH 1IHZA 4OO1G 4TQUS 4X65L 2H1EA 3H3VI 5DM73 1D5MC 1NAPA 4LF8L 2A5HA 1HQMC 2X69A 2NVQH 1IBLL 2WB1B 1QWYA 4C1NK 1GUOA 4EQ5A 2F4VQ 1Y1WB 5CYUA 4IALA 5EPKA 4KMUC 4X65Q 1SDFA 2JA8B 4LF8Q 1A6XA 4IUUA 1R9TB 2HT1A 3GTLB 4X64Q 1PTOB 3H0GH 1GOZA 3J80L 1IBLQ 1VQGA 5E4XA 3VYUA 4PMWA 2TSSA 3EA6A 1N32L 3IRBA 5FLXL 4KY5A 1XNQQ 4QIWE 1CK1A 3TP5A 1NSNS 3C2PA 1TVXA 1YI2A 2V1CC 2XN9C 1EWCA 3RZDB 4DAVA 4C1NI 1N32Q 4IUPA 4R4QA 4YCVA 3HOVH 3GTPB 2E74C 1YHBA 2DY8A 3K5MA 3CKIB 4H0LC 2XWJB 4I65A 1W3SA 1Q1BA 1JWMD 4DUYL 3RZOH 3MA2B 2EYPA 1SE4A 1JMCA 2SOBA 1L0YB 3I4MB 5ELEA 1I4GA 4R4TA 3I4NH 1TS4A 1VQ9A 1R4QB 4GS3A 3VYSA 4ID6A 1Y8PB 4ILWA 2RDFA 2K05A 4HSPA 3GV6A 2KECA 4DUYQ 4KKUA 4HJAA 3A8JE 2EY5A 3PO2H 3PO3G 4A3KH 5A35A 3VDYA 3VA7A 1F9QA 2XIWA 3DWPA 4RHRA 3V2TA 4TVAB 1SEBD 3BVZA 2Q2TA 1JQYD 2UXCL 4HCSA 1D2BA 1HA5A 2PO4A 3VA5A 1MJEA 5IT9c 3GTKH 4RWSC 4P72A 3MVVA 4NB3A 4JI6Q 1EOTA 5JJKA 2L4NA 3CCEA 2JEAI 4X3TA 2K5NA 1KD1C 2R92G 2AWOA 1I3QH 1QCBD 2ICEC 2OTJA 1PV4A 5ELBA 5IGGA 3QO2A 4GNXC 1ILPA 1SYFA 1NY4A 3B6YA 1PHJA 5EGTA 4DNIA 2KHIA 1IBMQ 5C0XG 1BOSA 2GVBA 3PIO3 1EY0A 3TN2A 2M9VA 4OIKA 3VR2A 1GHJA 4QUCA 4X3UA 4XQNA 4OX9L 1LTTD 1PVOA 4DKAC 2B3GA 2I5MX 4PMCA 1EWHA 2KOLA 3KLRA 1LTAD 5EPLA 2F3WA 3GTQB 2A6EC 3F2CA 4A3GH 1UEBA 1H9SB 5M3FG 4AQYL 1SRUA 3K6OA 3CHBD 4IPGA 4GKKQ 5NUCA 1EFWA 3C1EA 3TS2A 3JAME 4B3RL 3C3LA 4GNXA 2AUKA 4FXDA 4CKEA 3R8BA 3GO5A 1EY6A 3ULJA 2WV6D 2LY7A 5J39A 5LL6S 1ENAA 5C4HA 2NZHA 4HR7B 5I4DA 2VXWA 3E9IA 3G7LA 1SNCA 1TWCH 1SNPA 5ELDA 4B3RQ 1PXUA 5CORA 3OWEB 1QZGA 1B44D 1XMQQ 2AHOB 5C0XJ 2PZWA 1P8LA 2FXQA 4Y7NB 1KDCA 1SNOA 3CP0A 2EJGC 2RF4A 5J22A 4JV5L 3Q8DA 3SHLA 2Z4IA 4G4KA 4LF7Q 4XTCS 1Y14B 2ZM6L 2Z9HA 3L0OA 3BZDB 2B2YC 4DR6L 1CZWA 1ZYRC 4GN3B 4C3JG 2SNSA 1NNXA 5IODA 5AJ3L 2OQKA 3NTIA 2PNRC 3AYHB 3W5OA 1YNXA 4HTHA 1QNUA 1PTOD 4KD4A 2HDMA 2JA6G 5K36G 3HOZB 3DWQA 2R7FA 3EIVA 3S1MB 1FGUA 5AJ3Q 4JI8L 4RGMA 3HOUH 5C3EG 4LFBL 4BY1B 1HQRD 2L12A 1LTLA 4IOAA 3HOYH 4C3JB 4K8JA 1LT6D 5JVH3 1Y8OB 4K5XA 4QQBX 1EQVA 2B2YA 3G6EA 3E0JA 1TWAH 1YJWA 4IPHA 4N9PA 1WVLA 3NBHB 2WIIB 1I4RA 4YCWA 3HOWH 2EY6A 1FJGL 1JC7A 3KFUA 1Z7TA 2WAQB 4WJ4A 3S17B 2KCMA 4O42A 4DAYA 5C4XH 1JT8A 2KEEA 1JJGA 2NWGA 2HCCA 1HFNA 3HOXH 2NYZD 4A3FG 1H95A 2JSOA 3F8TA 2NVYH 1AE3A 2CW0C 4OWTB 4BBSG 4XQQA 1C48A 1EOVA 1MGSA 1QJOA 3J7ZC 1AEXA 3EBEA 3EN2A 4F8MA 4RG1A 3RLOA 1JWSD 2JXMB 1HZCA 2JA5G 5KYLA 4R4OA 1F2ZA 1VQPA 3OIPA 2H5XA 2JA7B 4KK7A 2PQAA 1UWVA 1WTVA 2LSSA 4BBRB 2C5CA 3DLLA 3M7NA 5LL6X 1F9SA 4XIGS 3GTMH 1B9NA 2PYKA 1C4QA 4FP5D 5C3XA 4FO2A 5C4JH 3NP8A 5M5XB 4CGYB 4F7XA 3MXNB 5FJ8H 2OEOA 1VQ5A 3FVQA 5ELFA 1LT5D 2KCTA 4A3LH 4DV0Q 5JVG3 2N49A 3H15A 4GLXA 1CA5A 2LS01 1VMCA 4A3BB 3H0GG 4DR2Q 3S24A 2KA7A 4ZYSA 2BA0A 4A76A 2HIVA 1QUQB 2OCEA 1CQVA 3U50C 1U5KA 4ME3A 1PH5A 2HHHL 3NQTA 5BN3A 3P20A 2O5IC 4UPAA 4X62L 1D7QA 2NVQB 1Q90A 3AMUA 1G291 2UXBL 4CDDC 1HNWL 1ESRA 2MUYA 1C0AA 1DOMA 2QDBA 3S16H 2HHHQ 5EJWA 3CRLC 3H0GB 1PH9A 1PRTC 1GM5A 2QDLA 3OOCA 4AIMA 1BQQT 1QG7A 3KF6A 1HNWQ 2BDOA 4H7BA 5M3MH 1K8OA 3TS0A 3D4WA 3TDQA 1LV9A 3DUZA 3UDGA 1BCPC 4ZRZA 4K5VA 1HCZA 3UI2A 2I0QA 2IT1A 3DM1A 3EJIA 1EIGA 4KHZA 3D0FA 5A2QL 2UUBL 3HOVB 1EYAA 2AMCB 3I2ZA 2R6GA 4N9TA 1K8MA 4DV2Q 1O7LA 4GZYC 1JORA 1IXRA 4GLAC 5IYBG 1TXYA 3KLSA 4IURA 3LX0A 3RZOB 1T9HA 1G8ZD 1YNNC 5HURA 4MN3A 2UUBQ 1JWUD 5J1ZA 3I4NB 1BF4A 4QJFA 4HJ7A 4DV1Q 5JAVA 3W2DA 1SSOA 3T1YQ 4YIJA 5EKKA 5IP9H 3HFZB 3T51B 1PTOF 1RD9D 2L1BA 3VR4A 5C4ZA 1RTNA 1U4PA 3PO2B 1N36L 2KENA 4A3KB 2VUMH 4JYAL 2K01A 5KNBA 1RTOA 4B08A 2VL6A 2SNMA 5D65A 4IUQA 5IE8A 5KNCA 5CR3A 4IFDG 1VQCA 2DJFC 1ZEQX 1W2BA 3GTKB 2C9OA 3R2IA 2JN4A 4LNQA 4OO1I 4K8IA 5KEEA 4JYAQ 2L55A 2R7ZH 3RN5A 2PMZB 4DV3L 5CGKA 4IJLA 1I3QB 2OQ0A 1X3GA 1Q3LA 2K5DA 4AH6A 5C44G 1RODA 4OWWB 2AQ2B 2IHFA 4DK3C 1X65A 1QNKA 3A8KE 1RL2A 4P2CB 4A3GG 1K0SA 3MXPA 3RUZA 1WD0A 2RBMA 5ISRA 3AFQA 2R7DA 3I3CA 3QWNA 3MTSA 2PZUA 4UP8A 3GTJH 1B9MA 2A73B 1JJ2A 1CZGA 1LM0A 4NW2A 2QF7A 1D1KA 5IT9L 4U68A 5D14A 3TZDA 2QEJC 3LGJA 2PI2E 1U4LA 2XWBB 1RF2D 4NDXA 3L3OC 4DV6L 4K6LA 2B8FA 3K59A 4HIOA 1KDAA 5LHY1 4A3GB 4H44C 3M9BA 1DXMA 1K8GA 2A8VA 1PH1A 5KYIA 3CXCA 2UUCQ 3HP3A 1Z9FA 1Q8KA 1S5CD 5JJZA 3RD4A 1WYDA 4GNXB 3D8GA 3TP7A 3PF4A 4POFA 4YWKA 1K73C 1C7YA 3K5OA 3F2UA 2KCNA 1TWCB 2I5HA 1Q81C 1KQSA 2PZTA 2VB2X 1MBYA 3I8ZA 2WB1E 4OEMB 4JI2Q 3H3VC 4QGUA 2F0PA 2M00A 4AYBB 2ASBA 1CT1D 1UE1A 3AU7A 1X6OA 1YNJC 3A74A 4L5SA 2HQLA 4DR1L 3S1NH 2DJGC 3ERSX 1IYJB 3NEMA 2VQEL 4C56C 4RKBA 1EY9A 1QVGA 3KLWA 2YTVA 1BKBA 3K5LA 4HJ5A 2F52A 4L5QA 1F9PA 3U4ZA 5LMNW 1LTSD 2F0SA 4DR1Q 1NE3A 2KEDA 2TMPA 3HOWG 3GQBA 1V1PA 4JG2A 2E2HH 1U9RA 1E2WA 1E2VA 3K0XA 3HOUB 4LF5L 5DNFA 3I90A 1K28A 1EYCA 1HH2P 2B2UC 2DGYA 3H3VH 2K6AA 1HJPA 3HOYB 5C0XI 1STGA 2FINB 3STBC 4MTKA 4K6DA 1AN8A 1VQBA 1F2LA 3J81j 1H9MA 1HTPA 1TWAB 3S9WA 3S1QH 2EVBA 2Z6KC 1YITA 1DONA 4BY7H 5LMNL 3HOWB 3PUVA 4JI7L 5ELNA 1S4ZA 1D6EC 5EAYA 5L37A 2VZAA 1FNWA 3S14H 4CJ0B 1GUGA 4IZ8A 1Y8NB 1I6VC 1HR0W 5C4XB 1UEAB 3QG1A 4DAYB 4DR3L 4K2KA 2ZJQA 2KHJA 1O7YA 5EBDA 2E5LL 2B2UA 2XNAC 3HOXB 3CU7A 1N8RC 1JJCB 2F0MA 2NVYB 2I46A 3MAQA 1ZXTA 1B3QA 2BH2A 4NXML 4BWGB 2O5JC 1JOKA 1PYSB 5G3LD 1SYDA 5CV9A 2Z6KA 2K5WA 2RKSA 5IP7G 1Y1WG 1I4QA 2A68C 3DHQA 1STEA 2NZ1D 1X3PA 3J81c 4GN4B 4ULLA 1HR0L 4A3DH 5FLMG 2EYOA 4DR4L 2D9UA 2IWHA 2PQAB 2F4VL 3CCUA 1I4XA 1SYGA 2VQFL 1L1OC 2KVMA 3BZKA 3GTMB 1Q7YC 1AH9A 1SMYD 3MFGA 4X64L 3I7FA 1HR0Q 5C4JB 3RLNA 3NE5B 3H91A 2B63H 4LJZC 5TSSA 1KHIA 1D5ZC 3FP9A 4LF6Q 3SK8A 4GLVB 1XNQL 3H09A 3BYTB 2VQFQ 2CCZA 3PIPA 4NXNL 2AUJD 2V4DA 5M9OA 1S5FD 5F2DA 2ICIA 1EIHA 1CM9A 4B3MQ 2QILA 3TREA 1NTGA 3ERQA 3CRKC 1MSHA 4FVMA 3F2BA 3I4MG 1JOOA 1TS2A 3HKSA 4KN4C 4DFAA 4NXNQ 3H6MA 3PV0A 3MWYW 2WKDA 1M1KC 1L1OA 1VQAA 3J81i 4UAIA 3S16B 3SK6A 2IJ0A 1L0WA 4A3JH 3AQQA 4KY6A 2EXZA 2R3ZA 5M3MB 1YBYA 1SAPA 4OL7A 4ZCKA 3I72A 3KF6B 5JEAH 4HMJA 2F0LA 5GAEC 1B4OA 4ALPA 1II3A 4NKLA 5JJIA 3F1ZA 4LAAA 2OF1A 4X3SA 4XT1B 5IP9G 2A6ED 5KRUA 3J80E 3OSOA 2F0NA 4BA2I 1KLUD 4LFAL 3DWAA 3KJOA 3SR1A 4GKJL 4JW0A 4C3IH 4JI6L 5FLXE 2D5DA 1VQ7A 4RH6A 5E4WC 4GOPC 1VQHA 4P71A 1A0IA 1X3EA 2J0TD 3CW2C 3M4PA 1XTCD 3NELA 4B3SL 1D8LA 1TWGH 2K5VA 4LFAQ 2KJXA 4GKJQ 4GN5A 3CCQA 1PRTB 4RA8A 1OTCA 2PW5A 3DXJC 1IBML 2QKIC 4JCVE 4B3SQ 5FK9C 1BCPB 4KN7C 2F0WA 1WTPA 3C1FA 3A54A 4JI0L 1KNEA 2F0KA 1PZJD 4JI1Q 2VUMB 3U4VA 4RGTA 3IL8A 1AW7A 4DNTB 3KBGA 2WAQE 1ZYRD 1RJTA 1WTWA 4JBJA 4GOPA 1FD7D 4MNOA 1QILA 1XPOA 5IY0A 4JI0Q 4BXXH 2K28A 4GKKL 2R7ZB 1TWHH 5FO9B 4ZUIA 1I94L 1G51A 2NN6G 2L11A 1F2MA 4LMQD 3S2DH 5BR8L 4JC0A 3NXWA 4EQPA 2K4KA 4MTNA 2L9HA 1SXTA 1CUKA 1XMQL 1I6HH 3M3YH 3Q22A 3GTJB 1EEFD 3KUPA 1I94Q 1LT4D 2LKVA 3W3AA 3SEBA 4N8FA 1DYQA 2H4OA 5J3BA 3R93A 4LF7L 2N88A 3K57A 5BR8Q 1UE6A 3PUWA 4QB4A 1XNRQ 2N8NA 4K0KQ 1DOKA 2MJ8A 2G9HD 5IYCH 2RHSB 4R4IA 3HOZG 2RCFA 5G3LF 3IKJA 3FHWA 4ZK9B 2PNHA 1VDZA 4XYOA 4R1JA 1HZBA 4C3HH 5JOBA 3MXUA 4BY1G 4QIWB 1J6QA 3NTKA 2UU9L 1G2SA 1RIPA 4ZAIA 2R93H 2AWNA 4A3IH 4IPCA 3MXGA 4K5WA 2CW0D 4A3EH 4A3CG 2UU9Q 5C6AA 1HNZQ 1STYA 1SFOH 1GUTA 3TBIB 1DM0B 1OXVA 3A5ZB 3A5UA 4RCOA 3MZ5A 3R2TA 2WAQG 3S1NB 3Q23A 1LTRD 4LFCQ 3HKZG 2Q8RE 4A93B 1OXXK 1QOHA 2EJFC 4EGVA 1VQ8A 4IFDI 5ELOA 1O78A 4M1UB 4O0AA 3A56A 4X66L 3UE0A 5IGDA 2B8GA 4DV7Q 1FL0A 1NUCA 4ZQ3A 4FDBA 1EZ6A 4JI4Q 2K1BA 4M8AA 2E2HB 1V1PB 4OONA 4OWXB 4DK1A 2EPBA 4X66Q 2FJ2A 4YWLA 1EY8A 1T5EA 5E1FA 1EIYB 3J7A5 3HKZB 4IJHA 1SE3A 3J7YW 2JA7G 3M85A 1MIUA 2F0IA 4BBRG 1LT3D 3X3MA 1HA6A 5DM63 4LW1A 3EQLC 3S1QB 3K81C 4BY7B 1EFID 5DLQE 4JK1C 5EBCA 2N3SA 4OELB 3TEHB 5FKAC 3S14B 2FMMA 3KDFA 3QB3A 4A3BG 1PRTD 1HRJA 2PI2A 2DNEA 1OXUA 2XRQD 5T1IA 1PDQA 1EY7A 4JVZA 4EQNA 2DNCA 3I73A 4OHJA 3TQYA 1BCPD 1SN8A 5CV8A 2CH4W 3G4SA 1VQOA 2OTLA 4DV0L 3V05A 1A8VA 4CDCC 3QOLA 1GVPA 1HTLD 5EKLA 1RDPD 2NUCA 4DR2L 4DAPA 3W1BA 3HRZC 2EXDA 4HN7A 2BE5C 4RAUC 2ZJPA 2K33A 2IX1A 3Q6SA 1IKMA 4OXPA 1S40A 5C3WA 3UDIA 1Y1VH 2OXPA 4A3DB 1YNND 4CJ2C 1RKNA 3NENA 3UE1A 2YU9B 1GUSA 3FKIH 4JOIC 1VQ6A 1YJ9A 3A8IE 1DZ1A 1J8IA 3NK9A 3RN2A 1TY2A 2JP1A 3M4OH 5FO8B 2BCOA 2RCNA 2F0GA 1TWFH 2B63B 3D3RA 1YIJA 3LWUA 4UY8C 1B8AA 1KL9A 2LFNA 4DXFA 1Q46A 3HOVG 2MGSA 4KJOA 4DR7L 3J81L 4OO1H 2VS1A 4A3JG 3BS1A 2J4XA 5IYDH 4IUNA 2L0CA 1CKNA 3SE0A 2QEXA 1PFSA 4PZ6A 1EQQA 3I4NG 4RGOS 4DV2L 5JEAG 4DR7Q 4HMIA 5CMDA 3PIOA 4JOIA 2F03A 2C35B 3OIQA 3KYHC 1L1OB 3P75A 2BDNA 4N8X1 3PO2G 4AYBE 3S1RH 2AQ3B 3EVQA 4A3KG 1IW7D 4DV1L 1DCZA 3CPFA 3T1YL 3S2HH 4A3JB 3CMAA 1Q8IA 1E7ZA 3JAMc 2NVTH 1ET9A 2F0QA 5D3IB 2NTTA 2PCFB 2RDHA 3BU2A 5JPMC 5JPNC 2JA9A 4Q0FA 1VS0A 3PMFA 5IGCA 1DD2A 3GTOH 2IL8A 1HXYD 1IYUA 1A2TA 1SMXA 1WTOA 4LUZA 4C3IB 4IN3A 1I4HA 5JEAJ 1DJRD 4EX5A 2ZTDA 3FRPB 2IHEA 2X6GA 1TWGB 1UNSA 4CKBA 3X3NA 1CKMA 5A2QE 4EVOA 1BBWA 3G6JB 2RDGA 5M5YH 3KOJA 1SYCA 3I4LA 4BS9A 5IOCA 3L7ZC 3PO3H 1K83H 1VQJA 2E75C 1CSPA 2AKWB 1IL8A 2MP1A 3JAMi 1B3AA 1YNJD 3PF5A 1HZ9A 4V0BA 1HZAA 5I6WA 1OXSC 2F0TA 1IBKL 1NMFA 2YV5A 1UE7A 3RLFA 2I5LX 4WJ3M 1GO3E 2X6LA 5LMUQ 2R92H 4GOPB 2EQSA 2UUCL 2K7VA 4CBVA 3K7AH 4LWCA 1TWHB 4RCNA 1G91A 1IBKQ 3TP8A 5IYCG 2CQOA 1KRTA 3FPUB 5C0XH 4AYBG 2A6HC 3S2DB 2VW9A 1VQNA 3M7GA 1XPUA 1SBBB 3J7AF 1I6HB 3M3YB 2K03A 1A62A 4ODGA 1PRTF 3STBD 5K5PA 2R93G 1EYDA 4KV6A 4JI2L 2YTXA 2DUDA 1CFMA 3W1GA 1I4PA 4TRDA 2F3VA 1BCPF 3CCSA 2JQOA 3HG9A 2BH8A 3L2PA 2CKZB 2F0OA 1CA6A 3AEVA 1SYBA 2DY7A 3ZYYX 1V1QA 5M3FH 1PYBA 4PV1C 1ICFB 2CHBD 2HUGA 3HOUG 2A69D 3P7JA 1V43A 1FYCA 4C3HB 3DEOA 5IT9E 2BA1A 2R93B 1BO0A 1JB7A 4A93H 3HOYG 4J8QA 1JB3A 2ES2A 4A3IB 1GKHA 1E24A 4A4IA 3CC4A 1AP0A 4H02A 2MNAA 4A3EB 3E5SA 1LTBD 3ONAB 3E0EA 3ULPA 1I50H 1B2TA 1EQRA 3LNNA 1UAPA 1SFOB 3QIAA 4A3MH 2JJQA 4J1MA 5GROA 2UUAQ 1L2FA 1WJJA 1JE5A 5C4XG 1MJCA 1XPRA 2K5QA 3I91A 3OW2A 1DGSA 4PG3A 2VY3A 2M2LA 1PFNA 3OHXC 3HOXG 2JA6H 5K36H 1SROA 3K0YA 2VB3X 1BBUA 1SLJA 2E2IH 1J5EL 1JR0D 1NBWA 5C3EH 3JC66 1QVFA 1YJNA 2IY5B 1CTMA 3CD6A 3DM3A 2JYOA 4QCLA 2NN6I 2IX0A 4UHVA 2MFIA 2XSCA 3T4AC 1STHA 2ZXOA 3M4QA 3Q24A 3WOFA 1N33Q 1J5EQ 4UDUC 3P1HA 4FF4A 1JCKB 1X9NA 4IUVA 1JOQA 2CQAA 3PUYA 4G57A 4MIUA 2MQHA 5CBEE 1MSGA 1JICA 4Q5VA 2Z0SA 1CHQD 3NWTA 3UDFA 4FXGC 2D0OA 5FJ8G 2Q8TA 1V1OA 2B39A 4CDFC 4DPGA 2KCCA 4HIMA 4XDXA 1HHVA 4A3LG 1EL0A 2NB0A 4K2LA 2B2WC 1GD7A 4A3FH 1QVCA 1H9RA 4J15A 2Y0SB 1JE4A 4KHPL 5H1SE 2YU9H 2JEBI 4LF6L 3MXNA 4BBSH 4S3SA 2R61A 4ZUJA 3PUZA 4NMZA 3AB9A 1X3QA 2ZTEA 3CCMA 4B3ML 1X54A 2MHVA 2JA5H 1O80A 4KHPQ 4LF9L 2GVAA 4BA1I 4QUFA 2GA4B 2F0UA 1QUQA 2ZT9C 1Y1VB 1ILQA 2E8GA 4YHHQ 5IYDG 3V96A 4LF9Q 1KIXA 2B2WA 3FKIB 4APVA 2PQEA 5M3MG 3NBIA 1Q82C 1HFGA 4LUVA 2Q2HA 4ZKBB 3M4OB 4X3KA 1KAWA 1TWFB 1S72A 4P75A 1S5BD 3FPPA 3M4YA 1EZ8A 4LF4L 5GAHC 1DOLA 1YHQA 1HUNA 4DK0A 3CC7A 1MI2A 2CVRA 3BDLA 3NWSA 1IKLA 2OT2A 2D0PA 4R8NA 3QOJA 2F0EA 1TR5A 5KIXA 1EU4A 4LF4Q 1CKNB 4L5TA 1WTHA 3FDTA 1M4VA 1TU2B 4O2DA 2JK8A 2NVXH 1BDOA 3CF5A 5CBAE 4CDEC 1EU3A 4HSVA 4L5RC 1KC8C 2XTIA 1NR4A 3K7UC 5KNDA 3I55A 3K8AA 1G6PA 4POGA 2WINB 1YHAA 1ML0D 2D62A 2I07B 5EQ0A 4PZ7A 3S1RB 2Z8LA 2VUMG 2K50A 3NPPA 4QY7A 5CV7A 4G7HC 2B29A 2EYJA 3S2HB 1XWEA 4H13C 1Y69U 1ASZA 2NVTB 4KLKA 2CFMA 4O1NA 1H9KA 1SMYC 1KTKA 1XJVA 1BBXC 1VF7A 4JI1L 3N6RA 3R3OA 4KY7A 4XT3B 4B9WA 4YCUA 1W6KA 4KTAA 1C9OA 4CJ1B 4DUZL 2R7ZG 2O2LD 4KHVA 4QF4A 3GTOB 5ELCA 1PH7A 4P74A 3TRZA 1EIFA 5IYBH 5JJLA 1ONLA 1MKHA 3KF8A 4HJ9A 4JBWA 2CWAA 4DUZQ 4IUTA 2EYHA 3CQZH 2BOSA 3I4OA 1E0BA 4KD3A 4F88A 3HKZE 2EYLA 5CC4A 3MEHA 3JAML 3RR5A 3MHBA 5M5WH 5I2YA 3PCOB 1GUWA 2L15A 1V9PA 2UXCQ 1PFBA 2VNUD 5M5YB 1E2ZA 5FO7B 4HIDA 3PO3B 1BR9A 1K83B 3J7AV 3G71A 4DR4Q 1PH6A 1PLFA 1F9RA 4RGNA 3TSSA 4J6HA 1XNRL 5I2XA 3EFXD 1S5ED 3WOEA 4IFDH 4NP5A 3OMCA 1KABA 4K0KL 5I6YA 4NPSA 4JI3L 2EZVA 5I9OA 3G48A 3A7LA 4WFN3 1FNUA 2Z1CA 3FEWX 2R92B 2EY2A 3S15B 1X55A 5C44H 3K7AB 4CKCA 4JI3Q 1STAA 4FF3A 2CWPA 4OX9Q 4IPDA 1EY5A 1J9OA 2N55A 5HGTA 4QL5A 1SNQA 1SNDA 5IGEA 1EUJA 5IGFA 5C5MA 5T1GA 3QJYA 3SK4A 1G6ZA 2MO0A 1XXGA 1RCVD 1HNZL 1D1IA 1LLRD 3L9AX 1VQFA 4EQOA 4AQYQ 4A93G 3WWVA 2K52A 3DEPA 3I70A 1WCMH 3H94A 4DV4L 4I7ZC 4HCEA 3K5NA 1PH4A 1T5XD 4YY3L 4LFCL 2QGQA 5M3FB 2CH4A 1WD1A 4FNFA 2QCPX 1C8CA 4B3TL 1S5DD 2IX3A 3RNUA 1VCIA 1LYLA 2MO1A 4A3MG 4DV4Q 4Z9CB 1WFQA 4XYQA 4DV7L 4X6AH 4C2MH 2XGTA 1K9MC 3ULLA 4YY3Q 2ATWA 4JV5Q 4DAMA 3HS0C 2ZM6Q 4JI4L 4B3TQ 1VQDA 2ID0A 1Z47A 1A15A 1A3UA 2GN5A 3BG3A 1XMOL 4DR6Q 3ZJYC 2DN8A 4ZLTF 2RVLA 3VYTA 4HJ8A 4BY7G 1I50B 1YVCA 1I5FA 4E6IA 4L6TB 2F0VA 2BE5D 3NSWA 1U4RA 2KBNA 4DN4M 2A19A 1KLGD 2EY1A 4A3MB 1XMOQ 1IYVA 3K80C 4QMGA 1FR3A 1SE2A 1IL2A 2LMCB 4R9WA 4JI8Q 1SJHD 2HCIA 3RMHA 4LFBQ 1KXLA 4L63B 1AZQA 3GD7A 2FFKB 5E7NA 2JA6B 4IQZA 4JPBW
chains in the Genus database with same CATH topology
2Q8IB 1ET6A 4ME5A 3BYYB 4HAEA 2E2IB 3GV3A 2J7ZA 5C3EB 1OO9B 2KHSA 3EROA 5E3FA 1ENFA 1F77A 4DXGA 1L0XB 5IGBA 4FF1A 1AZPA 4DF7A 5COYA 1PZID 1SYEA 1G2TA 3IFDA 1ICWA 2EE1A 3ITPA 4F87A 1PTOC 3SK5A 2RA4A 3SDZA 2F0FA 2KUMA 1BNZA 3SVMA 3SXHA 1TS5A 1FGBD 4DA2A 2SDFA 4RFBA 4LK1C 4A3FB 4DU9A 2F0HA 4ZKCB 3HGBA 2KQ3A 1FNVA 2RQXA 1MD2D 1CHPD 4BBSB 3DMUA 3WDNA 5IIFA 2K32A 2JA5B 1PMRA 2B2TC 1GHKA 3MFYA 1PTOH 2XVSA 4PNYA 1Q1EA 1TS3A 2O4XA 3GP7A 1QB5D 4V190 1SJED 3GTGB 1NCVA 1X32A 3KK7A 1LTID 3E6ZX 4RHSA 2E76C 1RHPA 2JE6I 5BN5A 4L8JA 1BUVT 4WJWA 3BDCA 2EYMA 2L5TA 4KI0A 2WP8J 1STBA 4C3IG 2B2TA 3TZUA 3T16A 3VR6A 3A7AB 1WTRA 3OWFA 2HDLA 1LO5D 3OMGA 2NTSA 1NR2A 5AFWA 2A74C 4WRDA 5DAUA 1GUNA 2NVXB 4FF2A 3J81E 1LABA 2F0JA 4OGQC 2A6HD 1QE6A 4FYDA 3U9SA 3NUCA 5DEHA 1AFPA 1EY4A 5C5LA 2RSOA 1H9JA 1HPCA 3PIP3 3VR3A 3HEJA 4PMBA 5BN4A 2WACA 4KKTA 3D4RA 1WTQA 1XYIA 3PUXA 2IW3A 1HUMA 2F4IA 3K58A 1Q12A 3NHHA 3IAYA 3D31A 1ENCA 1B53A 1F2YA 3CQZB 4ABNA 1TQOA 5M5WB 3T53B 1KDBA 1H9SA 5EPJA 5CV4A 2MPMA 1B50A 2B2VC 4WORA 1R4PB 3MC0B 1IW7C 4XQJA 2EOTA 4XXEA 1W6JA 3KLSX 2FHTA 3O13A 4U673 4C3HG 3OPOA 2F0DA 1A2UA 5I9PA 2AQ1B 3TP6A 2G9DA 3D4DA 2NN6H 5C44B 4IFDJ 2NBFA 1EEID 2FMCA 2Z4HA 1UUPA 3T13A 5CV6A 2B2VA 1KAAA 1TIID 1O7ZA 4K14A 5FOBB 1U4MA 1WCMB 1OXTA 1EQTA 4HEDA 1Z6HA 2K04A 4R8IA 2PPBC 4G7ZC 4OIJA 3NTHA 4CHTB 3OW7A 1VF5C 2EYFA 1WTXA 3IFTA 2A68D 3BVGA 3BVMA 3VYRA 1A3VA 2RSNA 3KBXA 4C2MB 4PQXA 3NBHA 5D3DA 1D5XC 1SNMA 5EKIA 4G7OC 1TY0A 3VR5A 1PFMA 2PW7A 1ZKOA 3T56B 1VMPA 1LTGD 4KKSA 4DNRB 1GJXA 3C46A 2ENBA 3U9OA 1KNAA 2EJMA 2SEBD 3ND8A 5KGUA 4DGZA 1A3TA 1TT2A 3D6CA 3D6WA 1ESFA 1CI3M 3N52A 2F1MA 3HZXA 2A69C 2XRSD 3TMEA 2E2JB 4FXKC 3BDOA 3FMCA 1GXDC 2ZXPA 1CQFA 3A55A 2EDGA 2E2DC 1V8QA 4MHEA 4KJNA 1PZKD 2D2CC 1PYWD 3LWEA 1LACA 3URYA 2WKCA 2ZXRA 4B9XA 2YYZA 3Q0AA 3ND9A 1M8AA 3NQIA 5CV5A 2HQEA 4TSSA 4TKOB 1STNA 1TKWB 1XX8A 1B1ZA 2IPKD 1BXTA 4RKLA 4OO1G 1IHZA 4TQUS 2H1EA 5DM73 1D5MC 1NAPA 2A5HA 1HQMC 2X69A 2WB1B 1QWYA 4C1NK 1GUOA 1Y1WB 5CYUA 4IALA 5EPKA 4KMUC 1SDFA 2JA8B 1A6XA 4IUUA 1R9TB 3GTLB 1PTOB 1GOZA 3J80L 5E4XA 3VYUA 4PMWA 2TSSA 3EA6A 5FLXL 4KY5A 1CK1A 3TP5A 1NSNS 3C2PA 1TVXA 2XN9C 1EWCA 3RZDB 4DAVA 4C1NI 4IUPA 3GTPB 2E74C 2DY8A 3K5MA 3CKIB 4H0LC 2XWJB 4I65A 1Q1BA 1JWMD 3MA2B 2EYPA 1SE4A 2SOBA 1L0YB 3I4MB 5ELEA 1I4GA 1TS4A 1R4QB 3VYSA 4ID6A 1Y8PB 4ILWA 2RDFA 2K05A 4HSPA 3GV6A 2KECA 4KKUA 3A8JE 2EY5A 5A35A 3VA7A 1F9QA 2XIWA 3DWPA 4RHRA 3V2TA 1SEBD 3BVZA 1JQYD 4HCSA 1D2BA 1HA5A 2PO4A 3VA5A 4RWSC 3MVVA 1EOTA 2L4NA 2JEAI 4X3TA 2AWOA 1QCBD 2ICEC 1ILPA 5ELBA 5IGGA 3QO2A 1SYFA 5EGTA 5C0XG 1BOSA 3PIO3 1EY0A 3TN2A 2M9VA 4OIKA 3VR2A 1GHJA 4QUCA 4X3UA 4XQNA 1LTTD 4PMCA 1EWHA 2KOLA 3KLRA 1LTAD 5EPLA 2F3WA 3GTQB 2A6EC 1H9SB 3K6OA 3CHBD 5NUCA 3C1EA 3JAME 3C3LA 2AUKA 4FXDA 4CKEA 3R8BA 3GO5A 1EY6A 2WV6D 2LY7A 5J39A 5LL6S 1ENAA 5C4HA 4HR7B 5I4DA 2VXWA 3G7LA 1SNCA 1SNPA 5ELDA 1PXUA 5CORA 3OWEB 1B44D 5C0XJ 2PZWA 4Y7NB 1KDCA 1SNOA 2EJGC 5J22A 3SHLA 2Z4IA 4G4KA 4XTCS 3BZDB 2B2YC 1CZWA 1ZYRC 4C3JG 2SNSA 5IODA 3NTIA 2PNRC 4HTHA 1QNUA 1PTOD 4KD4A 2HDMA 5K36G 3HOZB 3DWQA 3S1MB 4RGMA 4BY1B 1HQRD 2L12A 4C3JB 4K8JA 1LT6D 5JVH3 1Y8OB 4K5XA 1EQVA 2B2YA 3E0JA 4N9PA 1WVLA 2WIIB 1I4RA 2EY6A 1JC7A 1Z7TA 2WAQB 3S17B 4O42A 4DAYA 2KEEA 2NWGA 2HCCA 1HFNA 2NYZD 2JSOA 2CW0C 4XQQA 1C48A 1MGSA 1QJOA 1AEXA 4F8MA 1JWSD 2JXMB 5KYLA 1F2ZA 3OIPA 2JA7B 4KK7A 1WTVA 4BBRB 2C5CA 3M7NA 5LL6X 1F9SA 4XIGS 1B9NA 2PYKA 1C4QA 4FP5D 5C3XA 4FO2A 3NP8A 5M5XB 4CGYB 4F7XA 2OEOA 3FVQA 5ELFA 1LT5D 5JVG3 1CA5A 4A3BB 2LS01 1VMCA 2KA7A 4ZYSA 2BA0A 1CQVA 3NQTA 5BN3A 3P20A 2O5IC 2NVQB 1Q90A 3AMUA 1G291 1ESRA 2MUYA 1DOMA 2QDBA 5EJWA 3CRLC 3H0GB 1PRTC 3OOCA 1BQQT 1QG7A 2BDOA 4H7BA 1K8OA 3D4WA 3TDQA 1LV9A 3DUZA 1BCPC 4ZRZA 4K5VA 1HCZA 3UI2A 2IT1A 3DM1A 3EJIA 1EIGA 4KHZA 5A2QL 3HOVB 1EYAA 2R6GA 4N9TA 1K8MA 1O7LA 4GZYC 1JORA 3KLSA 4IURA 3LX0A 3RZOB 1G8ZD 1YNNC 5HURA 4MN3A 1JWUD 5J1ZA 3I4NB 1BF4A 5JAVA 3W2DA 1SSOA 4YIJA 5EKKA 3T51B 1PTOF 1RD9D 2L1BA 3VR4A 5C4ZA 1RTNA 1U4PA 3PO2B 4A3KB 2K01A 5KNBA 1RTOA 4B08A 2SNMA 5D65A 4IUQA 5KNCA 5CR3A 4IFDG 1ZEQX 3GTKB 2C9OA 3R2IA 4OO1I 4K8IA 5KEEA 2L55A 2PMZB 5CGKA 1I3QB 1Q3LA 2K5DA 1RODA 2AQ2B 1QNKA 3A8KE 4P2CB 3MXPA 3RUZA 1WD0A 2RBMA 5ISRA 3I3CA 3MTSA 3QWNA 2PZUA 1B9MA 2A73B 1CZGA 4NW2A 2QF7A 1D1KA 5IT9L 4U68A 5D14A 3TZDA 2QEJC 1U4LA 2XWBB 1RF2D 4NDXA 3L3OC 4K6LA 2B8FA 3K59A 1KDAA 5LHY1 4A3GB 4H44C 1DXMA 5KYIA 3HP3A 1S5CD 5JJZA 3RD4A 3D8GA 3TP7A 3K5OA 3F2UA 2KCNA 1TWCB 2PZTA 2VB2X 1MBYA 3I8ZA 3H3VC 2F0PA 2M00A 4AYBB 1CT1D 3AU7A 1YNJC 4C56C 4RKBA 1EY9A 3K5LA 1F9PA 1LTSD 2F0SA 2KEDA 2TMPA 3GQBA 1V1PA 1U9RA 1E2WA 1E2VA 3HOUB 5DNFA 3I90A 1EYCA 2B2UC 2K6AA 3HOYB 5C0XI 1STGA 2FINB 4K6DA 1AN8A 1F2LA 1H9MA 1HTPA 1TWAB 3S9WA 2EVBA 1DONA 3HOWB 3PUVA 1S4ZA 1D6EC 1FNWA 4CJ0B 1GUGA 4IZ8A 1Y8NB 1I6VC 5C4XB 1UEAB 3QG1A 4K2KA 1O7YA 5EBDA 2B2UA 2XNAC 3HOXB 3CU7A 2F0MA 2NVYB 2I46A 3MAQA 1ZXTA 4BWGB 2O5JC 1JOKA 5G3LD 1SYDA 5CV9A 2K5WA 2RKSA 1I4QA 2A68C 3DHQA 1STEA 2NZ1D 1X3PA 4ULLA 2EYOA 2D9UA 2IWHA 1I4XA 1SYGA 2KVMA 3GTMB 1SMYD 3MFGA 5C4JB 3NE5B 3H91A 4LJZC 5TSSA 1D5ZC 3SK8A 3H09A 3BYTB 2AUJD 2V4DA 5M9OA 1S5FD 5F2DA 2ICIA 1EIHA 1CM9A 2QILA 3ERQA 3CRKC 1MSHA 4FVMA 1JOOA 1TS2A 4KN4C 4DFAA 3H6MA 3PV0A 3MWYW 2WKDA 4UAIA 3S16B 3SK6A 2IJ0A 4KY6A 2EXZA 2R3ZA 5M3MB 1SAPA 4OL7A 3I72A 5JEAH 4HMJA 2F0LA 1B4OA 1II3A 4NKLA 4LAAA 2OF1A 4X3SA 4XT1B 2A6ED 5KRUA 3J80E 3OSOA 2F0NA 4BA2I 1KLUD 3DWAA 3SR1A 5FLXE 2D5DA 4RH6A 5E4WC 2J0TD 1XTCD 2KJXA 1PRTB 4RA8A 2PW5A 3DXJC 2QKIC 5FK9C 1BCPB 4KN7C 2F0WA 1WTPA 3C1FA 3A54A 1KNEA 2F0KA 1PZJD 2VUMB 4RGTA 3IL8A 1AW7A 4DNTB 3KBGA 1ZYRD 1RJTA 1WTWA 1FD7D 1QILA 2K28A 2R7ZB 5FO9B 4ZUIA 2NN6G 2L11A 1F2MA 4LMQD 3NXWA 4EQPA 2L9HA 1SXTA 3Q22A 3GTJB 1EEFD 3KUPA 1LT4D 2LKVA 3W3AA 3SEBA 1DYQA 2H4OA 3R93A 2N88A 3K57A 4QB4A 3PUWA 1DOKA 2MJ8A 2G9HD 5G3LF 3IKJA 4ZK9B 1VDZA 4XYOA 5JOBA 3MXUA 4QIWB 3NTKA 1G2SA 4ZAIA 2AWNA 3MXGA 4K5WA 2CW0D 5C6AA 1STYA 3TBIB 1GUTA 1DM0B 1OXVA 4RCOA 3MZ5A 3R2TA 3S1NB 3Q23A 1LTRD 2Q8RE 4A93B 1OXXK 1QOHA 2EJFC 4EGVA 4IFDI 1O78A 4M1UB 3A56A 5IGDA 2B8GA 1NUCA 4ZQ3A 1EZ6A 2K1BA 4M8AA 2E2HB 1V1PB 4DK1A 2EPBA 2FJ2A 1EY8A 1T5EA 5E1FA 3HKZB 1SE3A 3J7YW 3M85A 2F0IA 1LT3D 3X3MA 1HA6A 5DM63 3EQLC 3S1QB 4BY7B 1EFID 4JK1C 5EBCA 5FKAC 3S14B 2FMMA 3QB3A 1PRTD 1HRJA 2DNEA 1OXUA 2XRQD 5T1IA 1PDQA 1EY7A 4EQNA 2DNCA 3I73A 4OHJA 1BCPD 5CV8A 3V05A 3QOLA 1HTLD 5EKLA 1RDPD 2NUCA 4DAPA 3HRZC 4HN7A 2BE5C 4RAUC 2K33A 2IX1A 3Q6SA 1IKMA 5C3WA 4A3DB 2OXPA 1YNND 4CJ2C 1RKNA 2YU9B 1GUSA 3A8IE 1DZ1A 1J8IA 3NK9A 1TY2A 2JP1A 5FO8B 2BCOA 2F0GA 2B63B 3D3RA 3LWUA 2LFNA 4DXFA 2MGSA 4KJOA 3J81L 4OO1H 3BS1A 2J4XA 4IUNA 2L0CA 3SE0A 4RGOS 5JEAG 4HMIA 5CMDA 2F03A 3OIQA 3P75A 2BDNA 2AQ3B 3EVQA 1IW7D 1DCZA 4A3JB 1Q8IA 1ET9A 2F0QA 5D3IB 2NTTA 2PCFB 2RDHA 5JPMC 5JPNC 4Q0FA 3PMFA 5IGCA 1DD2A 2IL8A 1HXYD 1IYUA 1A2TA 1WTOA 4C3IB 4IN3A 1I4HA 5JEAJ 1DJRD 3FRPB 2X6GA 1TWGB 1UNSA 4CKBA 3X3NA 5A2QE 4EVOA 3G6JB 2RDGA 1SYCA 3I4LA 4BS9A 5IOCA 3L7ZC 2E75C 1IL8A 2MP1A 1B3AA 1YNJD 4V0BA 5I6WA 1OXSC 2F0TA 3RLFA 2X6LA 2K7VA 4CBVA 1TWHB 4RCNA 1G91A 3TP8A 3FPUB 5C0XH 2A6HC 3S2DB 3M7GA 1SBBB 3J7AF 1I6HB 3M3YB 2K03A 4ODGA 5K5PA 1PRTF 1EYDA 4KV6A 1CFMA 1I4PA 4TRDA 2F3VA 1BCPF 3HG9A 1CA6A 2F0OA 1SYBA 2DY7A 3ZYYX 4PV1C 2CHBD 2HUGA 2A69D 3P7JA 1V43A 1FYCA 4C3HB 3DEOA 5IT9E 2BA1A 2R93B 1BO0A 4J8QA 1JB3A 4A3IB 1AP0A 4A3EB 3E5SA 1LTBD 3ONAB 1B2TA 3LNNA 1UAPA 1SFOB 3QIAA 4J1MA 2K5QA 3I91A 2M2LA 1PFNA 3OHXC 5K36H 3K0YA 2VB3X 1JR0D 1CTMA 2JYOA 4QCLA 2NN6I 2IX0A 2XSCA 3T4AC 1STHA 2ZXOA 3Q24A 3WOFA 4UDUC 3P1HA 4FF4A 1JCKB 4IUVA 1JOQA 2CQAA 3PUYA 4G57A 4MIUA 5CBEE 1MSGA 1JICA 4Q5VA 1CHQD 3NWTA 4FXGC 2Q8TA 1V1OA 2B39A 2KCCA 4XDXA 1HHVA 1EL0A 2NB0A 4K2LA 2B2WC 1H9RA 2Y0SB 1JE4A 2JEBI 3MXNA 4S3SA 2R61A 4ZUJA 3PUZA 4NMZA 3AB9A 1X3QA 2MHVA 1O80A 4BA1I 4QUFA 2GA4B 2F0UA 2ZT9C 1Y1VB 1ILQA 3V96A 2B2WA 3FKIB 2PQEA 3NBIA 1HFGA 4ZKBB 3M4OB 4X3KA 1TWFB 1S5BD 3FPPA 3M4YA 1EZ8A 1DOLA 1HUNA 4DK0A 1MI2A 2CVRA 3BDLA 3NWSA 1IKLA 2OT2A 4R8NA 3QOJA 2F0EA 1TR5A 5KIXA 1EU4A 3FDTA 1M4VA 1TU2B 1BDOA 5CBAE 1EU3A 4HSVA 1NR4A 5KNDA 2WINB 1ML0D 2D62A 2I07B 5EQ0A 3S1RB 2Z8LA 3NPPA 5CV7A 4G7HC 2EYJA 3S2HB 1XWEA 4H13C 1Y69U 2NVTB 4O1NA 1H9KA 1SMYC 1KTKA 1BBXC 1VF7A 3N6RA 3R3OA 4KY7A 4XT3B 4B9WA 1W6KA 4KTAA 4CJ1B 2O2LD 4KHVA 4QF4A 3GTOB 5ELCA 1ONLA 3KF8A 4JBWA 4IUTA 2EYHA 2BOSA 5CC4A 1E0BA 4KD3A 4F88A 3JAML 2EYLA 3MEHA 3MHBA 5I2YA 1GUWA 1PFBA 2VNUD 5M5YB 1E2ZA 5FO7B 3PO3B 1BR9A 1K83B 3J7AV 1PLFA 1F9RA 4RGNA 3TSSA 4J6HA 5I2XA 3EFXD 1S5ED 3WOEA 4IFDH 4NP5A 3OMCA 1KABA 5I6YA 2EZVA 5I9OA 3A7LA 4WFN3 1FNUA 2Z1CA 3FEWX 2R92B 2EY2A 3S15B 3K7AB 4CKCA 1STAA 4FF3A 5HGTA 1EY5A 1J9OA 2N55A 1SNQA 1SNDA 5IGEA 5IGFA 5C5MA 5T1GA 3QJYA 3SK4A 1G6ZA 1XXGA 1RCVD 1D1IA 1LLRD 3L9AX 4EQOA 3DEPA 3I70A 3H94A 4I7ZC 4HCEA 3K5NA 1T5XD 5M3FB 1WD1A 4FNFA 2QCPX 1C8CA 1S5DD 2IX3A 1VCIA 4Z9CB 4XYQA 3HS0C 2ID0A 1Z47A 1A15A 1A3UA 3BG3A 2DN8A 4ZLTF 2RVLA 3VYTA 1I50B 4E6IA 4L6TB 2F0VA 2BE5D 1U4RA 3NSWA 4DN4M 1KLGD 2EY1A 4A3MB 1IYVA 4QMGA 1FR3A 1SE2A 2LMCB 4R9WA 1SJHD 2HCIA 3RMHA 4L63B 1AZQA 3GD7A 2FFKB 2JA6B 4IQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BN3 A;  3PUV A;  2Q8I B;  1VDZ A;  3P20 A;  2O5I C;  4IFD H;  3LNN A;  2D2C C;  3I72 A;  3MXU A;  1B9M A;  5JEA H;  1LAC A;  3QIA A;  1Q90 A;  1G29 1;  2YYZ A;  1GUG A;  2QF7 A;  3A7L A;  3ND9 A;  2JEA I;  1GUN A;  1Y8N B;  2BE5 C;  1I6V C;  2K33 A;  2A6E D;  3I4L A;  2AWO A;  1Y8O B;  3FPP A;  3M4Y A;  3QG1 A;  3L7Z C;  1LAB A;  4BA2 I;  3CRL C;  4OGQ C;  4TKO B;  1TKW B;  2A6H D;  2E75 C;  4DK0 A;  2B8F A;  1OXT A;  2D5D A;  5K36 H;  4OO1 G;  3OOC A;  1Z6H A;  4TQU S;  4H44 C;  1GUS A;  1DXM A;  3U9S A;  2PPB C;  4G7Z C;  2BDO A;  5C0X G;  1K8O A;  1HQM C;  3A8I E;  3SDZ A;  3OW7 A;  1GUT A;  1OXS C;  1VF5 C;  2O5J C;  1H9J A;  1CTM A;  1HPC A;  1OXV A;  3QJY A;  3VR2 A;  3VR3 A;  1HCZ A;  3IFT A;  3RLF A;  2A68 D;  1GUO A;  1TU2 B;  1Z7T A;  1GHJ A;  2IT1 A;  2NN6 I;  1BDO A;  2A68 C;  3DXJ C;  4KHZ A;  1OXX K;  3LWU A;  4KMU C;  2EJF C;  5KND A;  1EWH A;  2K7V A;  5BN4 A;  1A6X A;  4KKT A;  3KLR A;  2D62 A;  3D4R A;  2R6G A;  3H94 A;  4LK1 C;  4RCN A;  1K8M A;  2A6E C;  1O78 A;  1O7L A;  4I7Z C;  4KN7 C;  4OO1 H;  4GZY C;  3HGB A;  3PUX A;  4G7O C;  1H9S B;  2B8G A;  4G7H C;  2CW0 C;  3PUY A;  5C0X H;  1Q12 A;  2A6H C;  3VR5 A;  4DNT B;  1YNN C;  4H13 C;  3SE0 A;  1Y69 U;  3D31 A;  2AUK A;  1QJO A;  1VCI A;  4DK1 A;  1H9K A;  5JEA G;  1SMY C;  3NE5 B;  1YNJ C;  4LJZ C;  3WDN A;  2K32 A;  1VF7 A;  2JXM B;  3N6R A;  1PMR A;  2KCC A;  4HR7 B;  3T53 B;  1T5E A;  1ZKO A;  1GHK A;  3T51 B;  3MFY A;  3T56 B;  1CFM A;  4DNR B;  4KKS A;  2AUJ D;  1GJX A;  2V4D A;  3M85 A;  2E74 C;  3VR4 A;  1H9S A;  1Q1E A;  4H0L C;  3BG3 A;  3M7N A;  1H9R A;  2EJM A;  2NN6 G;  1IW7 D;  1DCZ A;  2DN8 A;  1Q1B A;  2EJG C;  1ONL A;  5KNB A;  2JEB I;  3EQL C;  4PV1 C;  3ND8 A;  1B9N A;  3CRK C;  4XIG S;  1IW7 C;  3GQB A;  4JBW A;  4XTC S;  3PUZ A;  5KNC A;  1CI3 M;  3AB9 A;  4KN4 C;  1E2W A;  4IFD G;  1E2V A;  2F1M A;  3PV0 A;  3IKJ A;  4JK1 C;  2A69 D;  1V43 A;  1FYC A;  2BE5 D;  1Y8P B;  2PCF B;  3OPO A;  1ZYR C;  2BA1 A;  2E76 C;  3W3A A;  2A69 C;  1IYV A;  2JE6 I;  1FR3 A;  4BA1 I;  4KKU A;  5BN5 A;  4L8J A;  3A8J E;  3PUW A;  2PNR C;  2LMC B;  2DNE A;  1E2Z A;  3BDO A;  3FMC A;  1DD2 A;  2L5T A;  1OXU A;  4KI0 A;  1IYU A;  5A35 A;  2NN6 H;  2KA7 A;  2EDG A;  2ZT9 C;  3VA7 A;  1H9M A;  1HTP A;  3GD7 A;  3TZU A;  2BA0 A;  2DNC A;  3I73 A;  3A8K E;  2EVB A;  5K36 G;  3VR6 A;  3A7A B;  4IQZ A;  1V8Q A; 
#chains in the Genus database with same CATH topology
 2Q8I B;  1ET6 A;  4ME5 A;  1SR3 A;  3BYY B;  4HAE A;  2E2I B;  3GV3 A;  2J7Z A;  1AE2 A;  5C3E B;  3CPW A;  1OO9 B;  2KHS A;  2WFW A;  3ERO A;  3I56 A;  5E3F A;  1ENF A;  1F77 A;  4DXG A;  1L0X B;  5IGB A;  2E2J H;  4FF1 A;  1FJG Q;  1AZP A;  2YTY A;  2G5D A;  4DF7 A;  3BJU A;  5COY A;  1PZI D;  4A3D G;  4DV5 L;  1SYE A;  5GQO A;  1G2T A;  1NMG A;  1O7I A;  3IFD A;  1ICW A;  2EE1 A;  3ITP A;  4F87 A;  1PTO C;  1XTD A;  3ER0 A;  2RA4 A;  3SDZ A;  3SK5 A;  2F0F A;  1VQ4 A;  1X56 A;  1A63 A;  2HIX A;  5HY6 A;  4YWM A;  2KUM A;  2PMZ E;  1P16 A;  3E9H A;  4DV5 Q;  2B63 G;  1BNZ A;  3SVM A;  3SXH A;  1TS5 A;  1FGB D;  3J80 c;  2EIF A;  4DA2 A;  2SDF A;  4RFB A;  4LK1 C;  5FLX c;  4A3F B;  4DU9 A;  2F0H A;  4ZKC B;  3HGB A;  2KQ3 A;  1FNV A;  2RQX A;  1MD2 D;  1CHP D;  4BBS B;  3DMU A;  1EYG A;  1Y1W H;  4LUO A;  5IP7 H;  3WDN A;  5IIF A;  2K32 A;  2JA5 B;  1PMR A;  2B2T C;  1VQK A;  2JA8 H;  1GHK A;  3MFY A;  1R9T H;  3GTL H;  1PTO H;  2XVS A;  5FLM H;  4PNY A;  2ALY B;  1Q1E A;  1TS3 A;  2O4X A;  3GP7 A;  1QB5 D;  4V19 0;  1SJE D;  3GTG B;  1NCV A;  3UDX A;  2LXK A;  1X32 A;  4I7A A;  1VQL A;  3PSI A;  3KK7 A;  1LTI D;  3CAM A;  3E6Z X;  1E22 A;  4RHS A;  2E76 C;  3RZD H;  1RHP A;  3CCR A;  2JE6 I;  1KRS A;  3J80 i;  5BN5 A;  4L8J A;  3GTP H;  1BUV T;  4WJW A;  3BDC A;  3ICE A;  2EYM A;  2L5T A;  4X62 Q;  4KI0 A;  2WP8 J;  1STB A;  1VQM A;  2HD3 A;  3T1H L;  4C3I G;  2B2T A;  1CKO A;  2LXJ A;  4UP9 A;  3TZU A;  2UXB Q;  3T16 A;  1PH8 A;  3VR6 A;  3A7A B;  3I4M H;  1WTR A;  3OWF A;  2Q2I A;  2HDL A;  2OWO A;  1ASY A;  2QW7 A;  5GAD C;  3PQI A;  1LO5 D;  3OMG A;  2QA4 A;  1Q86 C;  2NTS A;  3CCV A;  1NR2 A;  5AFW A;  2A74 C;  3CCL A;  4WRD A;  3T1H Q;  3CC2 A;  5DAU A;  5HGQ A;  1GUN A;  2NVX B;  2NZO A;  4FF2 A;  1WOC A;  3J81 E;  1LAB A;  2F0J A;  4OGQ C;  2A6H D;  1QE6 A;  1WI5 A;  4DR5 L;  4FYD A;  3U9S A;  3NUC A;  5DEH A;  1AFP A;  1EY4 A;  1EWI A;  5C5L A;  2RSO A;  1H9J A;  1HPC A;  3PIP 3;  3VR3 A;  1E3P A;  4BXX G;  3OTO L;  4DR5 Q;  1SE8 A;  3HEJ A;  4PMB A;  5BN4 A;  2WAC A;  4KKT A;  5IWA L;  1N9W A;  3D4R A;  4JBK A;  1WTQ A;  3MEF A;  3PUX A;  1XYI A;  2Q2U A;  1FVI A;  2IW3 A;  1HUM A;  2F4I A;  3K58 A;  5LMU L;  1Q12 A;  3NHH A;  3U58 A;  1E1O A;  3OTO Q;  3IAY A;  1VQI A;  3D31 A;  1ENC A;  3KF8 B;  1B53 A;  1N36 Q;  5IWA Q;  1F2Y A;  2UXD L;  3CQZ B;  4ABN A;  1TQO A;  5M5W B;  3T53 B;  1M90 C;  1KDB A;  3S15 H;  3GTQ H;  1H9S A;  5EPJ A;  5CV4 A;  2MPM A;  1B50 A;  2B2V C;  2UXD Q;  4WOR A;  1R4P B;  3MC0 B;  1IW7 C;  1K8A C;  4XQJ A;  3KJP A;  2EOT A;  4DV3 Q;  4XXE A;  1W6J A;  3KLS X;  2FHT A;  3O13 A;  4U67 3;  4C3H G;  3OPO A;  2F0D A;  3AFP A;  1A2U A;  5I9P A;  4P73 A;  2AQ1 B;  2Y0S E;  4JI5 L;  3TP6 A;  4A3I G;  2G9D A;  1WCM G;  3D4D A;  4Y7N H;  4UP7 A;  2NN6 H;  1S3O A;  5C44 B;  4MZ9 A;  4A3E G;  4IFD J;  2NBF A;  4JBM A;  4R4C A;  1EEI D;  2FMC A;  2Z4H A;  1VQE A;  1E1T A;  1PA6 A;  1UE5 A;  1UUP A;  4JI5 Q;  1K3B C;  3T13 A;  5CV6 A;  4DV6 Q;  2B2V A;  1KAA A;  1TII D;  1O7Z A;  4K14 A;  1IZ6 A;  4IOC A;  5FOB B;  1U4M A;  1WCM B;  4Y52 H;  1OXT A;  1EQT A;  3HOZ H;  4HED A;  1Z6H A;  2UUA L;  2K04 A;  4R8I A;  3S1M H;  2A1A A;  2PPB C;  4G7Z C;  4OIJ A;  4DK6 C;  3NTH A;  4CHT B;  3OW7 A;  4BY1 H;  1VF5 C;  2EYF A;  1WTX A;  3IFT A;  2A68 D;  1HNX L;  3BVG A;  3BVM A;  3VYR A;  1N34 L;  4C3J H;  1A3V A;  2RSN A;  3KBX A;  4C2M B;  4PQX A;  3NBH A;  5D3D A;  1D5X C;  4A3C H;  1SNM A;  3PGZ A;  5EKI A;  4G7O C;  1HNX Q;  1YZ6 A;  1TY0 A;  2VQE Q;  1N34 Q;  3VR5 A;  1PFM A;  1N33 L;  2K5H A;  2Z6B A;  2PW7 A;  3CCJ A;  3S17 H;  1LUZ A;  3SGI A;  1K0R A;  2ZJR A;  1ZKO A;  2ZTC A;  3T56 B;  1VMP A;  1LTG D;  4KKS A;  4DNR B;  1GJX A;  3C46 A;  2ENB A;  4LF5 Q;  3U9O A;  1B7Y B;  1BVS A;  1KNA A;  2EJM A;  1X3F A;  2Y0S G;  1QZH A;  4RMF A;  2SEB D;  3ND8 A;  5KGU A;  4DGZ A;  1A3T A;  1TT2 A;  3D6C A;  3D6W A;  1ESF A;  1CI3 M;  3N52 A;  2F1M A;  2RHQ B;  1U0L A;  3HZX A;  4HIK A;  1B70 B;  1NJI C;  2A69 C;  2XRS D;  2JA7 H;  3CME A;  2F3I A;  3TME A;  5LMN Q;  1PH2 A;  4JI7 Q;  2E2J B;  4FXK C;  1MHW C;  4BBR H;  3FMC A;  3BDO A;  3OYY A;  1GXD C;  2ZXP A;  1CQF A;  3A55 A;  2EDG A;  3KDF B;  1Y1V G;  1CSQ A;  3F2D A;  3GDE A;  4PZ8 A;  2E2D C;  1V8Q A;  4MHE A;  4KJN A;  3FKI G;  2K14 A;  5M5X H;  1PZK D;  3A0J A;  2WB1 G;  2D2C C;  1PYW D;  4DR3 Q;  3LWE A;  1YEZ A;  1LAC A;  3URY A;  2WKC A;  2E5L Q;  4IO9 A;  2ZXR A;  4B9X A;  2YYZ A;  3Q0A A;  3ND9 A;  4YHH L;  4A75 A;  5GAG C;  3QR8 A;  4A3B H;  1M8A A;  2P5Z X;  3NQI A;  5CV5 A;  2HQE A;  2JA8 G;  1PH3 A;  4TSS A;  4NXM Q;  3BZC A;  4TKO B;  1STN A;  1TKW B;  1K3R A;  1XX8 A;  1B1Z A;  2K75 A;  3E3X A;  2IPK D;  1BXT A;  2N78 A;  4RKL A;  3GTG H;  1IHZ A;  4OO1 G;  4TQU S;  4X65 L;  2H1E A;  3H3V I;  5DM7 3;  1D5M C;  1NAP A;  4LF8 L;  2A5H A;  1HQM C;  2X69 A;  2NVQ H;  1IBL L;  2WB1 B;  1QWY A;  4C1N K;  1GUO A;  4EQ5 A;  2F4V Q;  1Y1W B;  5CYU A;  4IAL A;  5EPK A;  4KMU C;  4X65 Q;  1SDF A;  2JA8 B;  4LF8 Q;  1A6X A;  4IUU A;  1R9T B;  2HT1 A;  3GTL B;  4X64 Q;  1PTO B;  3H0G H;  1GOZ A;  3J80 L;  1IBL Q;  1VQG A;  5E4X A;  3VYU A;  4PMW A;  2TSS A;  3EA6 A;  1N32 L;  3IRB A;  5FLX L;  4KY5 A;  1XNQ Q;  4QIW E;  1CK1 A;  3TP5 A;  1NSN S;  3C2P A;  1TVX A;  1YI2 A;  2V1C C;  2XN9 C;  1EWC A;  3RZD B;  4DAV A;  4C1N I;  1N32 Q;  4IUP A;  4R4Q A;  4YCV A;  3HOV H;  3GTP B;  2E74 C;  1YHB A;  2DY8 A;  3K5M A;  3CKI B;  4H0L C;  2XWJ B;  4I65 A;  1W3S A;  1Q1B A;  1JWM D;  4DUY L;  3RZO H;  3MA2 B;  2EYP A;  1SE4 A;  1JMC A;  2SOB A;  1L0Y B;  3I4M B;  5ELE A;  1I4G A;  4R4T A;  3I4N H;  1TS4 A;  1VQ9 A;  1R4Q B;  4GS3 A;  3VYS A;  4ID6 A;  1Y8P B;  4ILW A;  2RDF A;  2K05 A;  4HSP A;  3GV6 A;  2KEC A;  4DUY Q;  4KKU A;  4HJA A;  3A8J E;  2EY5 A;  3PO2 H;  3PO3 G;  4A3K H;  5A35 A;  3VDY A;  3VA7 A;  1F9Q A;  2XIW A;  3DWP A;  4RHR A;  3V2T A;  4TVA B;  1SEB D;  3BVZ A;  2Q2T A;  1JQY D;  2UXC L;  4HCS A;  1D2B A;  1HA5 A;  2PO4 A;  3VA5 A;  1MJE A;  5IT9 c;  3GTK H;  4RWS C;  4P72 A;  3MVV A;  4NB3 A;  4JI6 Q;  1EOT A;  5JJK A;  2L4N A;  3CCE A;  2JEA I;  4X3T A;  2K5N A;  1KD1 C;  2R92 G;  2AWO A;  1I3Q H;  1QCB D;  2ICE C;  2OTJ A;  1PV4 A;  5ELB A;  5IGG A;  3QO2 A;  4GNX C;  1ILP A;  1SYF A;  1NY4 A;  3B6Y A;  1PHJ A;  5EGT A;  4DNI A;  2KHI A;  1IBM Q;  5C0X G;  1BOS A;  2GVB A;  3PIO 3;  1EY0 A;  3TN2 A;  2M9V A;  4OIK A;  3VR2 A;  1GHJ A;  4QUC A;  4X3U A;  4XQN A;  4OX9 L;  1LTT D;  1PVO A;  4DKA C;  2B3G A;  2I5M X;  4PMC A;  1EWH A;  2KOL A;  3KLR A;  1LTA D;  5EPL A;  2F3W A;  3GTQ B;  2A6E C;  3F2C A;  4A3G H;  1UEB A;  1H9S B;  5M3F G;  4AQY L;  1SRU A;  3K6O A;  3CHB D;  4IPG A;  4GKK Q;  5NUC A;  1EFW A;  3C1E A;  3TS2 A;  3JAM E;  4B3R L;  3C3L A;  4GNX A;  2AUK A;  4FXD A;  4CKE A;  3R8B A;  3GO5 A;  1EY6 A;  3ULJ A;  2WV6 D;  2LY7 A;  5J39 A;  5LL6 S;  1ENA A;  5C4H A;  2NZH A;  4HR7 B;  5I4D A;  2VXW A;  3E9I A;  3G7L A;  1SNC A;  1TWC H;  1SNP A;  5ELD A;  4B3R Q;  1PXU A;  5COR A;  3OWE B;  1QZG A;  1B44 D;  1XMQ Q;  2AHO B;  5C0X J;  2PZW A;  1P8L A;  2FXQ A;  4Y7N B;  1KDC A;  1SNO A;  3CP0 A;  2EJG C;  2RF4 A;  5J22 A;  4JV5 L;  3Q8D A;  3SHL A;  2Z4I A;  4G4K A;  4LF7 Q;  4XTC S;  1Y14 B;  2ZM6 L;  2Z9H A;  3L0O A;  3BZD B;  2B2Y C;  4DR6 L;  1CZW A;  1ZYR C;  4GN3 B;  4C3J G;  2SNS A;  1NNX A;  5IOD A;  5AJ3 L;  2OQK A;  3NTI A;  2PNR C;  3AYH B;  3W5O A;  1YNX A;  4HTH A;  1QNU A;  1PTO D;  4KD4 A;  2HDM A;  2JA6 G;  5K36 G;  3HOZ B;  3DWQ A;  2R7F A;  3EIV A;  3S1M B;  1FGU A;  5AJ3 Q;  4JI8 L;  4RGM A;  3HOU H;  5C3E G;  4LFB L;  4BY1 B;  1HQR D;  2L12 A;  1LTL A;  4IOA A;  3HOY H;  4C3J B;  4K8J A;  1LT6 D;  5JVH 3;  1Y8O B;  4K5X A;  4QQB X;  1EQV A;  2B2Y A;  3G6E A;  3E0J A;  1TWA H;  1YJW A;  4IPH A;  4N9P A;  1WVL A;  3NBH B;  2WII B;  1I4R A;  4YCW A;  3HOW H;  2EY6 A;  1FJG L;  1JC7 A;  3KFU A;  1Z7T A;  2WAQ B;  4WJ4 A;  3S17 B;  2KCM A;  4O42 A;  4DAY A;  5C4X H;  1JT8 A;  2KEE A;  1JJG A;  2NWG A;  2HCC A;  1HFN A;  3HOX H;  2NYZ D;  4A3F G;  1H95 A;  2JSO A;  3F8T A;  2NVY H;  1AE3 A;  2CW0 C;  4OWT B;  4BBS G;  4XQQ A;  1C48 A;  1EOV A;  1MGS A;  1QJO A;  3J7Z C;  1AEX A;  3EBE A;  3EN2 A;  4F8M A;  4RG1 A;  3RLO A;  1JWS D;  2JXM B;  1HZC A;  2JA5 G;  5KYL A;  4R4O A;  1F2Z A;  1VQP A;  3OIP A;  2H5X A;  2JA7 B;  4KK7 A;  2PQA A;  1UWV A;  1WTV A;  2LSS A;  4BBR B;  2C5C A;  3DLL A;  3M7N A;  5LL6 X;  1F9S A;  4XIG S;  3GTM H;  1B9N A;  2PYK A;  1C4Q A;  4FP5 D;  5C3X A;  4FO2 A;  5C4J H;  3NP8 A;  5M5X B;  4CGY B;  4F7X A;  3MXN B;  5FJ8 H;  2OEO A;  1VQ5 A;  3FVQ A;  5ELF A;  1LT5 D;  2KCT A;  4A3L H;  4DV0 Q;  5JVG 3;  2N49 A;  3H15 A;  4GLX A;  1CA5 A;  2LS0 1;  1VMC A;  4A3B B;  3H0G G;  4DR2 Q;  3S24 A;  2KA7 A;  4ZYS A;  2BA0 A;  4A76 A;  2HIV A;  1QUQ B;  2OCE A;  1CQV A;  3U50 C;  1U5K A;  4ME3 A;  1PH5 A;  2HHH L;  3NQT A;  5BN3 A;  3P20 A;  2O5I C;  4UPA A;  4X62 L;  1D7Q A;  2NVQ B;  1Q90 A;  3AMU A;  1G29 1;  2UXB L;  4CDD C;  1HNW L;  1ESR A;  2MUY A;  1C0A A;  1DOM A;  2QDB A;  3S16 H;  2HHH Q;  5EJW A;  3CRL C;  3H0G B;  1PH9 A;  1PRT C;  1GM5 A;  2QDL A;  3OOC A;  4AIM A;  1BQQ T;  1QG7 A;  3KF6 A;  1HNW Q;  2BDO A;  4H7B A;  5M3M H;  1K8O A;  3TS0 A;  3D4W A;  3TDQ A;  1LV9 A;  3DUZ A;  3UDG A;  1BCP C;  4ZRZ A;  4K5V A;  1HCZ A;  3UI2 A;  2I0Q A;  2IT1 A;  3DM1 A;  3EJI A;  1EIG A;  4KHZ A;  3D0F A;  5A2Q L;  2UUB L;  3HOV B;  1EYA A;  2AMC B;  3I2Z A;  2R6G A;  4N9T A;  1K8M A;  4DV2 Q;  1O7L A;  4GZY C;  1JOR A;  1IXR A;  4GLA C;  5IYB G;  1TXY A;  3KLS A;  4IUR A;  3LX0 A;  3RZO B;  1T9H A;  1G8Z D;  1YNN C;  5HUR A;  4MN3 A;  2UUB Q;  1JWU D;  5J1Z A;  3I4N B;  1BF4 A;  4QJF A;  4HJ7 A;  4DV1 Q;  5JAV A;  3W2D A;  1SSO A;  3T1Y Q;  4YIJ A;  5EKK A;  5IP9 H;  3HFZ B;  3T51 B;  1PTO F;  1RD9 D;  2L1B A;  3VR4 A;  5C4Z A;  1RTN A;  1U4P A;  3PO2 B;  1N36 L;  2KEN A;  4A3K B;  2VUM H;  4JYA L;  2K01 A;  5KNB A;  1RTO A;  4B08 A;  2VL6 A;  2SNM A;  5D65 A;  4IUQ A;  5IE8 A;  5KNC A;  5CR3 A;  4IFD G;  1VQC A;  2DJF C;  1ZEQ X;  1W2B A;  3GTK B;  2C9O A;  3R2I A;  2JN4 A;  4LNQ A;  4OO1 I;  4K8I A;  5KEE A;  4JYA Q;  2L55 A;  2R7Z H;  3RN5 A;  2PMZ B;  4DV3 L;  5CGK A;  4IJL A;  1I3Q B;  2OQ0 A;  1X3G A;  1Q3L A;  2K5D A;  4AH6 A;  5C44 G;  1ROD A;  4OWW B;  2AQ2 B;  2IHF A;  4DK3 C;  1X65 A;  1QNK A;  3A8K E;  1RL2 A;  4P2C B;  4A3G G;  1K0S A;  3MXP A;  3RUZ A;  1WD0 A;  2RBM A;  5ISR A;  3AFQ A;  2R7D A;  3I3C A;  3QWN A;  3MTS A;  2PZU A;  4UP8 A;  3GTJ H;  1B9M A;  2A73 B;  1JJ2 A;  1CZG A;  1LM0 A;  4NW2 A;  2QF7 A;  1D1K A;  5IT9 L;  4U68 A;  5D14 A;  3TZD A;  2QEJ C;  3LGJ A;  2PI2 E;  1U4L A;  2XWB B;  1RF2 D;  4NDX A;  3L3O C;  4DV6 L;  4K6L A;  2B8F A;  3K59 A;  4HIO A;  1KDA A;  5LHY 1;  4A3G B;  4H44 C;  3M9B A;  1DXM A;  1K8G A;  2A8V A;  1PH1 A;  5KYI A;  3CXC A;  2UUC Q;  3HP3 A;  1Z9F A;  1Q8K A;  1S5C D;  5JJZ A;  3RD4 A;  1WYD A;  4GNX B;  3D8G A;  3TP7 A;  3PF4 A;  4POF A;  4YWK A;  1K73 C;  1C7Y A;  3K5O A;  3F2U A;  2KCN A;  1TWC B;  2I5H A;  1Q81 C;  1KQS A;  2PZT A;  2VB2 X;  1MBY A;  3I8Z A;  2WB1 E;  4OEM B;  4JI2 Q;  3H3V C;  4QGU A;  2F0P A;  2M00 A;  4AYB B;  2ASB A;  1CT1 D;  1UE1 A;  3AU7 A;  1X6O A;  1YNJ C;  3A74 A;  4L5S A;  2HQL A;  4DR1 L;  3S1N H;  2DJG C;  3ERS X;  1IYJ B;  3NEM A;  2VQE L;  4C56 C;  4RKB A;  1EY9 A;  1QVG A;  3KLW A;  2YTV A;  1BKB A;  3K5L A;  4HJ5 A;  2F52 A;  4L5Q A;  1F9P A;  3U4Z A;  5LMN W;  1LTS D;  2F0S A;  4DR1 Q;  1NE3 A;  2KED A;  2TMP A;  3HOW G;  3GQB A;  1V1P A;  4JG2 A;  2E2H H;  1U9R A;  1E2W A;  1E2V A;  3K0X A;  3HOU B;  4LF5 L;  5DNF A;  3I90 A;  1K28 A;  1EYC A;  1HH2 P;  2B2U C;  2DGY A;  3H3V H;  2K6A A;  1HJP A;  3HOY B;  5C0X I;  1STG A;  2FIN B;  3STB C;  4MTK A;  4K6D A;  1AN8 A;  1VQB A;  1F2L A;  3J81 j;  1H9M A;  1HTP A;  1TWA B;  3S9W A;  3S1Q H;  2EVB A;  2Z6K C;  1YIT A;  1DON A;  4BY7 H;  5LMN L;  3HOW B;  3PUV A;  4JI7 L;  5ELN A;  1S4Z A;  1D6E C;  5EAY A;  5L37 A;  2VZA A;  1FNW A;  3S14 H;  4CJ0 B;  1GUG A;  4IZ8 A;  1Y8N B;  1I6V C;  1HR0 W;  5C4X B;  1UEA B;  3QG1 A;  4DAY B;  4DR3 L;  4K2K A;  2ZJQ A;  2KHJ A;  1O7Y A;  5EBD A;  2E5L L;  2B2U A;  2XNA C;  3HOX B;  3CU7 A;  1N8R C;  1JJC B;  2F0M A;  2NVY B;  2I46 A;  3MAQ A;  1ZXT A;  1B3Q A;  2BH2 A;  4NXM L;  4BWG B;  2O5J C;  1JOK A;  1PYS B;  5G3L D;  1SYD A;  5CV9 A;  2Z6K A;  2K5W A;  2RKS A;  5IP7 G;  1Y1W G;  1I4Q A;  2A68 C;  3DHQ A;  1STE A;  2NZ1 D;  1X3P A;  3J81 c;  4GN4 B;  4ULL A;  1HR0 L;  4A3D H;  5FLM G;  2EYO A;  4DR4 L;  2D9U A;  2IWH A;  2PQA B;  2F4V L;  3CCU A;  1I4X A;  1SYG A;  2VQF L;  1L1O C;  2KVM A;  3BZK A;  3GTM B;  1Q7Y C;  1AH9 A;  1SMY D;  3MFG A;  4X64 L;  3I7F A;  1HR0 Q;  5C4J B;  3RLN A;  3NE5 B;  3H91 A;  2B63 H;  4LJZ C;  5TSS A;  1KHI A;  1D5Z C;  3FP9 A;  4LF6 Q;  3SK8 A;  4GLV B;  1XNQ L;  3H09 A;  3BYT B;  2VQF Q;  2CCZ A;  3PIP A;  4NXN L;  2AUJ D;  2V4D A;  5M9O A;  1S5F D;  5F2D A;  2ICI A;  1EIH A;  1CM9 A;  4B3M Q;  2QIL A;  3TRE A;  1NTG A;  3ERQ A;  3CRK C;  1MSH A;  4FVM A;  3F2B A;  3I4M G;  1JOO A;  1TS2 A;  3HKS A;  4KN4 C;  4DFA A;  4NXN Q;  3H6M A;  3PV0 A;  3MWY W;  2WKD A;  1M1K C;  1L1O A;  1VQA A;  3J81 i;  4UAI A;  3S16 B;  3SK6 A;  2IJ0 A;  1L0W A;  4A3J H;  3AQQ A;  4KY6 A;  2EXZ A;  2R3Z A;  5M3M B;  1YBY A;  1SAP A;  4OL7 A;  4ZCK A;  3I72 A;  3KF6 B;  5JEA H;  4HMJ A;  2F0L A;  5GAE C;  1B4O A;  4ALP A;  1II3 A;  4NKL A;  5JJI A;  3F1Z A;  4LAA A;  2OF1 A;  4X3S A;  4XT1 B;  5IP9 G;  2A6E D;  5KRU A;  3J80 E;  3OSO A;  2F0N A;  4BA2 I;  1KLU D;  4LFA L;  3DWA A;  3KJO A;  3SR1 A;  4GKJ L;  4JW0 A;  4C3I H;  4JI6 L;  5FLX E;  2D5D A;  1VQ7 A;  4RH6 A;  5E4W C;  4GOP C;  1VQH A;  4P71 A;  1A0I A;  1X3E A;  2J0T D;  3CW2 C;  3M4P A;  1XTC D;  3NEL A;  4B3S L;  1D8L A;  1TWG H;  2K5V A;  4LFA Q;  2KJX A;  4GKJ Q;  4GN5 A;  3CCQ A;  1PRT B;  4RA8 A;  1OTC A;  2PW5 A;  3DXJ C;  1IBM L;  2QKI C;  4JCV E;  4B3S Q;  5FK9 C;  1BCP B;  4KN7 C;  2F0W A;  1WTP A;  3C1F A;  3A54 A;  4JI0 L;  1KNE A;  2F0K A;  1PZJ D;  4JI1 Q;  2VUM B;  3U4V A;  4RGT A;  3IL8 A;  1AW7 A;  4DNT B;  3KBG A;  2WAQ E;  1ZYR D;  1RJT A;  1WTW A;  4JBJ A;  4GOP A;  1FD7 D;  4MNO A;  1QIL A;  1XPO A;  5IY0 A;  4JI0 Q;  4BXX H;  2K28 A;  4GKK L;  2R7Z B;  1TWH H;  5FO9 B;  4ZUI A;  1I94 L;  1G51 A;  2NN6 G;  2L11 A;  1F2M A;  4LMQ D;  3S2D H;  5BR8 L;  4JC0 A;  3NXW A;  4EQP A;  2K4K A;  4MTN A;  2L9H A;  1SXT A;  1CUK A;  1XMQ L;  1I6H H;  3M3Y H;  3Q22 A;  3GTJ B;  1EEF D;  3KUP A;  1I94 Q;  1LT4 D;  2LKV A;  3W3A A;  3SEB A;  4N8F A;  1DYQ A;  2H4O A;  5J3B A;  3R93 A;  4LF7 L;  2N88 A;  3K57 A;  5BR8 Q;  1UE6 A;  3PUW A;  4QB4 A;  1XNR Q;  2N8N A;  4K0K Q;  1DOK A;  2MJ8 A;  2G9H D;  5IYC H;  2RHS B;  4R4I A;  3HOZ G;  2RCF A;  5G3L F;  3IKJ A;  3FHW A;  4ZK9 B;  2PNH A;  1VDZ A;  4XYO A;  4R1J A;  1HZB A;  4C3H H;  5JOB A;  3MXU A;  4BY1 G;  4QIW B;  1J6Q A;  3NTK A;  2UU9 L;  1G2S A;  1RIP A;  4ZAI A;  2R93 H;  2AWN A;  4A3I H;  4IPC A;  3MXG A;  4K5W A;  2CW0 D;  4A3E H;  4A3C G;  2UU9 Q;  5C6A A;  1HNZ Q;  1STY A;  1SFO H;  1GUT A;  3TBI B;  1DM0 B;  1OXV A;  3A5Z B;  3A5U A;  4RCO A;  3MZ5 A;  3R2T A;  2WAQ G;  3S1N B;  3Q23 A;  1LTR D;  4LFC Q;  3HKZ G;  2Q8R E;  4A93 B;  1OXX K;  1QOH A;  2EJF C;  4EGV A;  1VQ8 A;  4IFD I;  5ELO A;  1O78 A;  4M1U B;  4O0A A;  3A56 A;  4X66 L;  3UE0 A;  5IGD A;  2B8G A;  4DV7 Q;  1FL0 A;  1NUC A;  4ZQ3 A;  4FDB A;  1EZ6 A;  4JI4 Q;  2K1B A;  4M8A A;  2E2H B;  1V1P B;  4OON A;  4OWX B;  4DK1 A;  2EPB A;  4X66 Q;  2FJ2 A;  4YWL A;  1EY8 A;  1T5E A;  5E1F A;  1EIY B;  3J7A 5;  3HKZ B;  4IJH A;  1SE3 A;  3J7Y W;  2JA7 G;  3M85 A;  1MIU A;  2F0I A;  4BBR G;  1LT3 D;  3X3M A;  1HA6 A;  5DM6 3;  4LW1 A;  3EQL C;  3S1Q B;  3K81 C;  4BY7 B;  1EFI D;  5DLQ E;  4JK1 C;  5EBC A;  2N3S A;  4OEL B;  3TEH B;  5FKA C;  3S14 B;  2FMM A;  3KDF A;  3QB3 A;  4A3B G;  1PRT D;  1HRJ A;  2PI2 A;  2DNE A;  1OXU A;  2XRQ D;  5T1I A;  1PDQ A;  1EY7 A;  4JVZ A;  4EQN A;  2DNC A;  3I73 A;  4OHJ A;  3TQY A;  1BCP D;  1SN8 A;  5CV8 A;  2CH4 W;  3G4S A;  1VQO A;  2OTL A;  4DV0 L;  3V05 A;  1A8V A;  4CDC C;  3QOL A;  1GVP A;  1HTL D;  5EKL A;  1RDP D;  2NUC A;  4DR2 L;  4DAP A;  3W1B A;  3HRZ C;  2EXD A;  4HN7 A;  2BE5 C;  4RAU C;  2ZJP A;  2K33 A;  2IX1 A;  3Q6S A;  1IKM A;  4OXP A;  1S40 A;  5C3W A;  3UDI A;  1Y1V H;  2OXP A;  4A3D B;  1YNN D;  4CJ2 C;  1RKN A;  3NEN A;  3UE1 A;  2YU9 B;  1GUS A;  3FKI H;  4JOI C;  1VQ6 A;  1YJ9 A;  3A8I E;  1DZ1 A;  1J8I A;  3NK9 A;  3RN2 A;  1TY2 A;  2JP1 A;  3M4O H;  5FO8 B;  2BCO A;  2RCN A;  2F0G A;  1TWF H;  2B63 B;  3D3R A;  1YIJ A;  3LWU A;  4UY8 C;  1B8A A;  1KL9 A;  2LFN A;  4DXF A;  1Q46 A;  3HOV G;  2MGS A;  4KJO A;  4DR7 L;  3J81 L;  4OO1 H;  2VS1 A;  4A3J G;  3BS1 A;  2J4X A;  5IYD H;  4IUN A;  2L0C A;  1CKN A;  3SE0 A;  2QEX A;  1PFS A;  4PZ6 A;  1EQQ A;  3I4N G;  4RGO S;  4DV2 L;  5JEA G;  4DR7 Q;  4HMI A;  5CMD A;  3PIO A;  4JOI A;  2F03 A;  2C35 B;  3OIQ A;  3KYH C;  1L1O B;  3P75 A;  2BDN A;  4N8X 1;  3PO2 G;  4AYB E;  3S1R H;  2AQ3 B;  3EVQ A;  4A3K G;  1IW7 D;  4DV1 L;  1DCZ A;  3CPF A;  3T1Y L;  3S2H H;  4A3J B;  3CMA A;  1Q8I A;  1E7Z A;  3JAM c;  2NVT H;  1ET9 A;  2F0Q A;  5D3I B;  2NTT A;  2PCF B;  2RDH A;  3BU2 A;  5JPM C;  5JPN C;  2JA9 A;  4Q0F A;  1VS0 A;  3PMF A;  5IGC A;  1DD2 A;  3GTO H;  2IL8 A;  1HXY D;  1IYU A;  1A2T A;  1SMX A;  1WTO A;  4LUZ A;  4C3I B;  4IN3 A;  1I4H A;  5JEA J;  1DJR D;  4EX5 A;  2ZTD A;  3FRP B;  2IHE A;  2X6G A;  1TWG B;  1UNS A;  4CKB A;  3X3N A;  1CKM A;  5A2Q E;  4EVO A;  1BBW A;  3G6J B;  2RDG A;  5M5Y H;  3KOJ A;  1SYC A;  3I4L A;  4BS9 A;  5IOC A;  3L7Z C;  3PO3 H;  1K83 H;  1VQJ A;  2E75 C;  1CSP A;  2AKW B;  1IL8 A;  2MP1 A;  3JAM i;  1B3A A;  1YNJ D;  3PF5 A;  1HZ9 A;  4V0B A;  1HZA A;  5I6W A;  1OXS C;  2F0T A;  1IBK L;  1NMF A;  2YV5 A;  1UE7 A;  3RLF A;  2I5L X;  4WJ3 M;  1GO3 E;  2X6L A;  5LMU Q;  2R92 H;  4GOP B;  2EQS A;  2UUC L;  2K7V A;  4CBV A;  3K7A H;  4LWC A;  1TWH B;  4RCN A;  1G91 A;  1IBK Q;  3TP8 A;  5IYC G;  2CQO A;  1KRT A;  3FPU B;  5C0X H;  4AYB G;  2A6H C;  3S2D B;  2VW9 A;  1VQN A;  3M7G A;  1XPU A;  1SBB B;  3J7A F;  1I6H B;  3M3Y B;  2K03 A;  1A62 A;  4ODG A;  1PRT F;  3STB D;  5K5P A;  2R93 G;  1EYD A;  4KV6 A;  4JI2 L;  2YTX A;  2DUD A;  1CFM A;  3W1G A;  1I4P A;  4TRD A;  2F3V A;  1BCP F;  3CCS A;  2JQO A;  3HG9 A;  2BH8 A;  3L2P A;  2CKZ B;  2F0O A;  1CA6 A;  3AEV A;  1SYB A;  2DY7 A;  3ZYY X;  1V1Q A;  5M3F H;  1PYB A;  4PV1 C;  1ICF B;  2CHB D;  2HUG A;  3HOU G;  2A69 D;  3P7J A;  1V43 A;  1FYC A;  4C3H B;  3DEO A;  5IT9 E;  2BA1 A;  2R93 B;  1BO0 A;  1JB7 A;  4A93 H;  3HOY G;  4J8Q A;  1JB3 A;  2ES2 A;  4A3I B;  1GKH A;  1E24 A;  4A4I A;  3CC4 A;  1AP0 A;  4H02 A;  2MNA A;  4A3E B;  3E5S A;  1LTB D;  3ONA B;  3E0E A;  3ULP A;  1I50 H;  1B2T A;  1EQR A;  3LNN A;  1UAP A;  1SFO B;  3QIA A;  4A3M H;  2JJQ A;  4J1M A;  5GRO A;  2UUA Q;  1L2F A;  1WJJ A;  1JE5 A;  5C4X G;  1MJC A;  1XPR A;  2K5Q A;  3I91 A;  3OW2 A;  1DGS A;  4PG3 A;  2VY3 A;  2M2L A;  1PFN A;  3OHX C;  3HOX G;  2JA6 H;  5K36 H;  1SRO A;  3K0Y A;  2VB3 X;  1BBU A;  1SLJ A;  2E2I H;  1J5E L;  1JR0 D;  1NBW A;  5C3E H;  3JC6 6;  1QVF A;  1YJN A;  2IY5 B;  1CTM A;  3CD6 A;  3DM3 A;  2JYO A;  4QCL A;  2NN6 I;  2IX0 A;  4UHV A;  2MFI A;  2XSC A;  3T4A C;  1STH A;  2ZXO A;  3M4Q A;  3Q24 A;  3WOF A;  1N33 Q;  1J5E Q;  4UDU C;  3P1H A;  4FF4 A;  1JCK B;  1X9N A;  4IUV A;  1JOQ A;  2CQA A;  3PUY A;  4G57 A;  4MIU A;  2MQH A;  5CBE E;  1MSG A;  1JIC A;  4Q5V A;  2Z0S A;  1CHQ D;  3NWT A;  3UDF A;  4FXG C;  2D0O A;  5FJ8 G;  2Q8T A;  1V1O A;  2B39 A;  4CDF C;  4DPG A;  2KCC A;  4HIM A;  4XDX A;  1HHV A;  4A3L G;  1EL0 A;  2NB0 A;  4K2L A;  2B2W C;  1GD7 A;  4A3F H;  1QVC A;  1H9R A;  4J15 A;  2Y0S B;  1JE4 A;  4KHP L;  5H1S E;  2YU9 H;  2JEB I;  4LF6 L;  3MXN A;  4BBS H;  4S3S A;  2R61 A;  4ZUJ A;  3PUZ A;  4NMZ A;  3AB9 A;  1X3Q A;  2ZTE A;  3CCM A;  4B3M L;  1X54 A;  2MHV A;  2JA5 H;  1O80 A;  4KHP Q;  4LF9 L;  2GVA A;  4BA1 I;  4QUF A;  2GA4 B;  2F0U A;  1QUQ A;  2ZT9 C;  1Y1V B;  1ILQ A;  2E8G A;  4YHH Q;  5IYD G;  3V96 A;  4LF9 Q;  1KIX A;  2B2W A;  3FKI B;  4APV A;  2PQE A;  5M3M G;  3NBI A;  1Q82 C;  1HFG A;  4LUV A;  2Q2H A;  4ZKB B;  3M4O B;  4X3K A;  1KAW A;  1TWF B;  1S72 A;  4P75 A;  1S5B D;  3FPP A;  3M4Y A;  1EZ8 A;  4LF4 L;  5GAH C;  1DOL A;  1YHQ A;  1HUN A;  4DK0 A;  3CC7 A;  1MI2 A;  2CVR A;  3BDL A;  3NWS A;  1IKL A;  2OT2 A;  2D0P A;  4R8N A;  3QOJ A;  2F0E A;  1TR5 A;  5KIX A;  1EU4 A;  4LF4 Q;  1CKN B;  4L5T A;  1WTH A;  3FDT A;  1M4V A;  1TU2 B;  4O2D A;  2JK8 A;  2NVX H;  1BDO A;  3CF5 A;  5CBA E;  4CDE C;  1EU3 A;  4HSV A;  4L5R C;  1KC8 C;  2XTI A;  1NR4 A;  3K7U C;  5KND A;  3I55 A;  3K8A A;  1G6P A;  4POG A;  2WIN B;  1YHA A;  1ML0 D;  2D62 A;  2I07 B;  5EQ0 A;  4PZ7 A;  3S1R B;  2Z8L A;  2VUM G;  2K50 A;  3NPP A;  4QY7 A;  5CV7 A;  4G7H C;  2B29 A;  2EYJ A;  3S2H B;  1XWE A;  4H13 C;  1Y69 U;  1ASZ A;  2NVT B;  4KLK A;  2CFM A;  4O1N A;  1H9K A;  1SMY C;  1KTK A;  1XJV A;  1BBX C;  1VF7 A;  4JI1 L;  3N6R A;  3R3O A;  4KY7 A;  4XT3 B;  4B9W A;  4YCU A;  1W6K A;  4KTA A;  1C9O A;  4CJ1 B;  4DUZ L;  2R7Z G;  2O2L D;  4KHV A;  4QF4 A;  3GTO B;  5ELC A;  1PH7 A;  4P74 A;  3TRZ A;  1EIF A;  5IYB H;  5JJL A;  1ONL A;  1MKH A;  3KF8 A;  4HJ9 A;  4JBW A;  2CWA A;  4DUZ Q;  4IUT A;  2EYH A;  3CQZ H;  2BOS A;  3I4O A;  1E0B A;  4KD3 A;  4F88 A;  3HKZ E;  2EYL A;  5CC4 A;  3MEH A;  3JAM L;  3RR5 A;  3MHB A;  5M5W H;  5I2Y A;  3PCO B;  1GUW A;  2L15 A;  1V9P A;  2UXC Q;  1PFB A;  2VNU D;  5M5Y B;  1E2Z A;  5FO7 B;  4HID A;  3PO3 B;  1BR9 A;  1K83 B;  3J7A V;  3G71 A;  4DR4 Q;  1PH6 A;  1PLF A;  1F9R A;  4RGN A;  3TSS A;  4J6H A;  1XNR L;  5I2X A;  3EFX D;  1S5E D;  3WOE A;  4IFD H;  4NP5 A;  3OMC A;  1KAB A;  4K0K L;  5I6Y A;  4NPS A;  4JI3 L;  2EZV A;  5I9O A;  3G48 A;  3A7L A;  4WFN 3;  1FNU A;  2Z1C A;  3FEW X;  2R92 B;  2EY2 A;  3S15 B;  1X55 A;  5C44 H;  3K7A B;  4CKC A;  4JI3 Q;  1STA A;  4FF3 A;  2CWP A;  4OX9 Q;  4IPD A;  1EY5 A;  1J9O A;  2N55 A;  5HGT A;  4QL5 A;  1SNQ A;  1SND A;  5IGE A;  1EUJ A;  5IGF A;  5C5M A;  5T1G A;  3QJY A;  3SK4 A;  1G6Z A;  2MO0 A;  1XXG A;  1RCV D;  1HNZ L;  1D1I A;  1LLR D;  3L9A X;  1VQF A;  4EQO A;  4AQY Q;  4A93 G;  3WWV A;  2K52 A;  3DEP A;  3I70 A;  1WCM H;  3H94 A;  4DV4 L;  4I7Z C;  4HCE A;  3K5N A;  1PH4 A;  1T5X D;  4YY3 L;  4LFC L;  2QGQ A;  5M3F B;  2CH4 A;  1WD1 A;  4FNF A;  2QCP X;  1C8C A;  4B3T L;  1S5D D;  2IX3 A;  3RNU A;  1VCI A;  1LYL A;  2MO1 A;  4A3M G;  4DV4 Q;  4Z9C B;  1WFQ A;  4XYQ A;  4DV7 L;  4X6A H;  4C2M H;  2XGT A;  1K9M C;  3ULL A;  4YY3 Q;  2ATW A;  4JV5 Q;  4DAM A;  3HS0 C;  2ZM6 Q;  4JI4 L;  4B3T Q;  1VQD A;  2ID0 A;  1Z47 A;  1A15 A;  1A3U A;  2GN5 A;  3BG3 A;  1XMO L;  4DR6 Q;  3ZJY C;  2DN8 A;  4ZLT F;  2RVL A;  3VYT A;  4HJ8 A;  4BY7 G;  1I50 B;  1YVC A;  1I5F A;  4E6I A;  4L6T B;  2F0V A;  2BE5 D;  3NSW A;  1U4R A;  2KBN A;  4DN4 M;  2A19 A;  1KLG D;  2EY1 A;  4A3M B;  1XMO Q;  1IYV A;  3K80 C;  4QMG A;  1FR3 A;  1SE2 A;  1IL2 A;  2LMC B;  4R9W A;  4JI8 Q;  1SJH D;  2HCI A;  3RMH A;  4LFB Q;  1KXL A;  4L63 B;  1AZQ A;  3GD7 A;  2FFK B;  5E7N A;  2JA6 B;  4IQZ A;  4JPB W; 
#chains in the Genus database with same CATH homology
 2Q8I B;  1ET6 A;  4ME5 A;  3BYY B;  4HAE A;  2E2I B;  3GV3 A;  2J7Z A;  5C3E B;  1OO9 B;  2KHS A;  3ERO A;  5E3F A;  1ENF A;  1F77 A;  4DXG A;  1L0X B;  5IGB A;  4FF1 A;  1AZP A;  4DF7 A;  5COY A;  1PZI D;  1SYE A;  1G2T A;  3IFD A;  1ICW A;  2EE1 A;  3ITP A;  4F87 A;  1PTO C;  3SK5 A;  2RA4 A;  3SDZ A;  2F0F A;  2KUM A;  1BNZ A;  3SVM A;  3SXH A;  1TS5 A;  1FGB D;  4DA2 A;  2SDF A;  4RFB A;  4LK1 C;  4A3F B;  4DU9 A;  2F0H A;  4ZKC B;  3HGB A;  2KQ3 A;  1FNV A;  2RQX A;  1MD2 D;  1CHP D;  4BBS B;  3DMU A;  3WDN A;  5IIF A;  2K32 A;  2JA5 B;  1PMR A;  2B2T C;  1GHK A;  3MFY A;  1PTO H;  2XVS A;  4PNY A;  1Q1E A;  1TS3 A;  2O4X A;  3GP7 A;  1QB5 D;  4V19 0;  1SJE D;  3GTG B;  1NCV A;  1X32 A;  3KK7 A;  1LTI D;  3E6Z X;  4RHS A;  2E76 C;  1RHP A;  2JE6 I;  5BN5 A;  4L8J A;  1BUV T;  4WJW A;  3BDC A;  2EYM A;  2L5T A;  4KI0 A;  2WP8 J;  1STB A;  4C3I G;  2B2T A;  3TZU A;  3T16 A;  3VR6 A;  3A7A B;  1WTR A;  3OWF A;  2HDL A;  1LO5 D;  3OMG A;  2NTS A;  1NR2 A;  5AFW A;  2A74 C;  4WRD A;  5DAU A;  1GUN A;  2NVX B;  4FF2 A;  3J81 E;  1LAB A;  2F0J A;  4OGQ C;  2A6H D;  1QE6 A;  4FYD A;  3U9S A;  3NUC A;  5DEH A;  1AFP A;  1EY4 A;  5C5L A;  2RSO A;  1H9J A;  1HPC A;  3PIP 3;  3VR3 A;  3HEJ A;  4PMB A;  5BN4 A;  2WAC A;  4KKT A;  3D4R A;  1WTQ A;  1XYI A;  3PUX A;  2IW3 A;  1HUM A;  2F4I A;  3K58 A;  1Q12 A;  3NHH A;  3IAY A;  3D31 A;  1ENC A;  1B53 A;  1F2Y A;  3CQZ B;  4ABN A;  1TQO A;  5M5W B;  3T53 B;  1KDB A;  1H9S A;  5EPJ A;  5CV4 A;  2MPM A;  1B50 A;  2B2V C;  4WOR A;  1R4P B;  3MC0 B;  1IW7 C;  4XQJ A;  2EOT A;  4XXE A;  1W6J A;  3KLS X;  2FHT A;  3O13 A;  4U67 3;  4C3H G;  3OPO A;  2F0D A;  1A2U A;  5I9P A;  2AQ1 B;  3TP6 A;  2G9D A;  3D4D A;  2NN6 H;  5C44 B;  4IFD J;  2NBF A;  1EEI D;  2FMC A;  2Z4H A;  1UUP A;  3T13 A;  5CV6 A;  2B2V A;  1KAA A;  1TII D;  1O7Z A;  4K14 A;  5FOB B;  1U4M A;  1WCM B;  1OXT A;  1EQT A;  4HED A;  1Z6H A;  2K04 A;  4R8I A;  2PPB C;  4G7Z C;  4OIJ A;  3NTH A;  4CHT B;  3OW7 A;  1VF5 C;  2EYF A;  1WTX A;  3IFT A;  2A68 D;  3BVG A;  3BVM A;  3VYR A;  1A3V A;  2RSN A;  3KBX A;  4C2M B;  4PQX A;  3NBH A;  5D3D A;  1D5X C;  1SNM A;  5EKI A;  4G7O C;  1TY0 A;  3VR5 A;  1PFM A;  2PW7 A;  1ZKO A;  3T56 B;  1VMP A;  1LTG D;  4KKS A;  4DNR B;  1GJX A;  3C46 A;  2ENB A;  3U9O A;  1KNA A;  2EJM A;  2SEB D;  3ND8 A;  5KGU A;  4DGZ A;  1A3T A;  1TT2 A;  3D6C A;  3D6W A;  1ESF A;  1CI3 M;  3N52 A;  2F1M A;  3HZX A;  2A69 C;  2XRS D;  3TME A;  2E2J B;  4FXK C;  3BDO A;  3FMC A;  1GXD C;  2ZXP A;  1CQF A;  3A55 A;  2EDG A;  2E2D C;  1V8Q A;  4MHE A;  4KJN A;  1PZK D;  2D2C C;  1PYW D;  3LWE A;  1LAC A;  3URY A;  2WKC A;  2ZXR A;  4B9X A;  2YYZ A;  3Q0A A;  3ND9 A;  1M8A A;  3NQI A;  5CV5 A;  2HQE A;  4TSS A;  4TKO B;  1STN A;  1TKW B;  1XX8 A;  1B1Z A;  2IPK D;  1BXT A;  4RKL A;  4OO1 G;  1IHZ A;  4TQU S;  2H1E A;  5DM7 3;  1D5M C;  1NAP A;  2A5H A;  1HQM C;  2X69 A;  2WB1 B;  1QWY A;  4C1N K;  1GUO A;  1Y1W B;  5CYU A;  4IAL A;  5EPK A;  4KMU C;  1SDF A;  2JA8 B;  1A6X A;  4IUU A;  1R9T B;  3GTL B;  1PTO B;  1GOZ A;  3J80 L;  5E4X A;  3VYU A;  4PMW A;  2TSS A;  3EA6 A;  5FLX L;  4KY5 A;  1CK1 A;  3TP5 A;  1NSN S;  3C2P A;  1TVX A;  2XN9 C;  1EWC A;  3RZD B;  4DAV A;  4C1N I;  4IUP A;  3GTP B;  2E74 C;  2DY8 A;  3K5M A;  3CKI B;  4H0L C;  2XWJ B;  4I65 A;  1Q1B A;  1JWM D;  3MA2 B;  2EYP A;  1SE4 A;  2SOB A;  1L0Y B;  3I4M B;  5ELE A;  1I4G A;  1TS4 A;  1R4Q B;  3VYS A;  4ID6 A;  1Y8P B;  4ILW A;  2RDF A;  2K05 A;  4HSP A;  3GV6 A;  2KEC A;  4KKU A;  3A8J E;  2EY5 A;  5A35 A;  3VA7 A;  1F9Q A;  2XIW A;  3DWP A;  4RHR A;  3V2T A;  1SEB D;  3BVZ A;  1JQY D;  4HCS A;  1D2B A;  1HA5 A;  2PO4 A;  3VA5 A;  4RWS C;  3MVV A;  1EOT A;  2L4N A;  2JEA I;  4X3T A;  2AWO A;  1QCB D;  2ICE C;  1ILP A;  5ELB A;  5IGG A;  3QO2 A;  1SYF A;  5EGT A;  5C0X G;  1BOS A;  3PIO 3;  1EY0 A;  3TN2 A;  2M9V A;  4OIK A;  3VR2 A;  1GHJ A;  4QUC A;  4X3U A;  4XQN A;  1LTT D;  4PMC A;  1EWH A;  2KOL A;  3KLR A;  1LTA D;  5EPL A;  2F3W A;  3GTQ B;  2A6E C;  1H9S B;  3K6O A;  3CHB D;  5NUC A;  3C1E A;  3JAM E;  3C3L A;  2AUK A;  4FXD A;  4CKE A;  3R8B A;  3GO5 A;  1EY6 A;  2WV6 D;  2LY7 A;  5J39 A;  5LL6 S;  1ENA A;  5C4H A;  4HR7 B;  5I4D A;  2VXW A;  3G7L A;  1SNC A;  1SNP A;  5ELD A;  1PXU A;  5COR A;  3OWE B;  1B44 D;  5C0X J;  2PZW A;  4Y7N B;  1KDC A;  1SNO A;  2EJG C;  5J22 A;  3SHL A;  2Z4I A;  4G4K A;  4XTC S;  3BZD B;  2B2Y C;  1CZW A;  1ZYR C;  4C3J G;  2SNS A;  5IOD A;  3NTI A;  2PNR C;  4HTH A;  1QNU A;  1PTO D;  4KD4 A;  2HDM A;  5K36 G;  3HOZ B;  3DWQ A;  3S1M B;  4RGM A;  4BY1 B;  1HQR D;  2L12 A;  4C3J B;  4K8J A;  1LT6 D;  5JVH 3;  1Y8O B;  4K5X A;  1EQV A;  2B2Y A;  3E0J A;  4N9P A;  1WVL A;  2WII B;  1I4R A;  2EY6 A;  1JC7 A;  1Z7T A;  2WAQ B;  3S17 B;  4O42 A;  4DAY A;  2KEE A;  2NWG A;  2HCC A;  1HFN A;  2NYZ D;  2JSO A;  2CW0 C;  4XQQ A;  1C48 A;  1MGS A;  1QJO A;  1AEX A;  4F8M A;  1JWS D;  2JXM B;  5KYL A;  1F2Z A;  3OIP A;  2JA7 B;  4KK7 A;  1WTV A;  4BBR B;  2C5C A;  3M7N A;  5LL6 X;  1F9S A;  4XIG S;  1B9N A;  2PYK A;  1C4Q A;  4FP5 D;  5C3X A;  4FO2 A;  3NP8 A;  5M5X B;  4CGY B;  4F7X A;  2OEO A;  3FVQ A;  5ELF A;  1LT5 D;  5JVG 3;  1CA5 A;  4A3B B;  2LS0 1;  1VMC A;  2KA7 A;  4ZYS A;  2BA0 A;  1CQV A;  3NQT A;  5BN3 A;  3P20 A;  2O5I C;  2NVQ B;  1Q90 A;  3AMU A;  1G29 1;  1ESR A;  2MUY A;  1DOM A;  2QDB A;  5EJW A;  3CRL C;  3H0G B;  1PRT C;  3OOC A;  1BQQ T;  1QG7 A;  2BDO A;  4H7B A;  1K8O A;  3D4W A;  3TDQ A;  1LV9 A;  3DUZ A;  1BCP C;  4ZRZ A;  4K5V A;  1HCZ A;  3UI2 A;  2IT1 A;  3DM1 A;  3EJI A;  1EIG A;  4KHZ A;  5A2Q L;  3HOV B;  1EYA A;  2R6G A;  4N9T A;  1K8M A;  1O7L A;  4GZY C;  1JOR A;  3KLS A;  4IUR A;  3LX0 A;  3RZO B;  1G8Z D;  1YNN C;  5HUR A;  4MN3 A;  1JWU D;  5J1Z A;  3I4N B;  1BF4 A;  5JAV A;  3W2D A;  1SSO A;  4YIJ A;  5EKK A;  3T51 B;  1PTO F;  1RD9 D;  2L1B A;  3VR4 A;  5C4Z A;  1RTN A;  1U4P A;  3PO2 B;  4A3K B;  2K01 A;  5KNB A;  1RTO A;  4B08 A;  2SNM A;  5D65 A;  4IUQ A;  5KNC A;  5CR3 A;  4IFD G;  1ZEQ X;  3GTK B;  2C9O A;  3R2I A;  4OO1 I;  4K8I A;  5KEE A;  2L55 A;  2PMZ B;  5CGK A;  1I3Q B;  1Q3L A;  2K5D A;  1ROD A;  2AQ2 B;  1QNK A;  3A8K E;  4P2C B;  3MXP A;  3RUZ A;  1WD0 A;  2RBM A;  5ISR A;  3I3C A;  3MTS A;  3QWN A;  2PZU A;  1B9M A;  2A73 B;  1CZG A;  4NW2 A;  2QF7 A;  1D1K A;  5IT9 L;  4U68 A;  5D14 A;  3TZD A;  2QEJ C;  1U4L A;  2XWB B;  1RF2 D;  4NDX A;  3L3O C;  4K6L A;  2B8F A;  3K59 A;  1KDA A;  5LHY 1;  4A3G B;  4H44 C;  1DXM A;  5KYI A;  3HP3 A;  1S5C D;  5JJZ A;  3RD4 A;  3D8G A;  3TP7 A;  3K5O A;  3F2U A;  2KCN A;  1TWC B;  2PZT A;  2VB2 X;  1MBY A;  3I8Z A;  3H3V C;  2F0P A;  2M00 A;  4AYB B;  1CT1 D;  3AU7 A;  1YNJ C;  4C56 C;  4RKB A;  1EY9 A;  3K5L A;  1F9P A;  1LTS D;  2F0S A;  2KED A;  2TMP A;  3GQB A;  1V1P A;  1U9R A;  1E2W A;  1E2V A;  3HOU B;  5DNF A;  3I90 A;  1EYC A;  2B2U C;  2K6A A;  3HOY B;  5C0X I;  1STG A;  2FIN B;  4K6D A;  1AN8 A;  1F2L A;  1H9M A;  1HTP A;  1TWA B;  3S9W A;  2EVB A;  1DON A;  3HOW B;  3PUV A;  1S4Z A;  1D6E C;  1FNW A;  4CJ0 B;  1GUG A;  4IZ8 A;  1Y8N B;  1I6V C;  5C4X B;  1UEA B;  3QG1 A;  4K2K A;  1O7Y A;  5EBD A;  2B2U A;  2XNA C;  3HOX B;  3CU7 A;  2F0M A;  2NVY B;  2I46 A;  3MAQ A;  1ZXT A;  4BWG B;  2O5J C;  1JOK A;  5G3L D;  1SYD A;  5CV9 A;  2K5W A;  2RKS A;  1I4Q A;  2A68 C;  3DHQ A;  1STE A;  2NZ1 D;  1X3P A;  4ULL A;  2EYO A;  2D9U A;  2IWH A;  1I4X A;  1SYG A;  2KVM A;  3GTM B;  1SMY D;  3MFG A;  5C4J B;  3NE5 B;  3H91 A;  4LJZ C;  5TSS A;  1D5Z C;  3SK8 A;  3H09 A;  3BYT B;  2AUJ D;  2V4D A;  5M9O A;  1S5F D;  5F2D A;  2ICI A;  1EIH A;  1CM9 A;  2QIL A;  3ERQ A;  3CRK C;  1MSH A;  4FVM A;  1JOO A;  1TS2 A;  4KN4 C;  4DFA A;  3H6M A;  3PV0 A;  3MWY W;  2WKD A;  4UAI A;  3S16 B;  3SK6 A;  2IJ0 A;  4KY6 A;  2EXZ A;  2R3Z A;  5M3M B;  1SAP A;  4OL7 A;  3I72 A;  5JEA H;  4HMJ A;  2F0L A;  1B4O A;  1II3 A;  4NKL A;  4LAA A;  2OF1 A;  4X3S A;  4XT1 B;  2A6E D;  5KRU A;  3J80 E;  3OSO A;  2F0N A;  4BA2 I;  1KLU D;  3DWA A;  3SR1 A;  5FLX E;  2D5D A;  4RH6 A;  5E4W C;  2J0T D;  1XTC D;  2KJX A;  1PRT B;  4RA8 A;  2PW5 A;  3DXJ C;  2QKI C;  5FK9 C;  1BCP B;  4KN7 C;  2F0W A;  1WTP A;  3C1F A;  3A54 A;  1KNE A;  2F0K A;  1PZJ D;  2VUM B;  4RGT A;  3IL8 A;  1AW7 A;  4DNT B;  3KBG A;  1ZYR D;  1RJT A;  1WTW A;  1FD7 D;  1QIL A;  2K28 A;  2R7Z B;  5FO9 B;  4ZUI A;  2NN6 G;  2L11 A;  1F2M A;  4LMQ D;  3NXW A;  4EQP A;  2L9H A;  1SXT A;  3Q22 A;  3GTJ B;  1EEF D;  3KUP A;  1LT4 D;  2LKV A;  3W3A A;  3SEB A;  1DYQ A;  2H4O A;  3R93 A;  2N88 A;  3K57 A;  4QB4 A;  3PUW A;  1DOK A;  2MJ8 A;  2G9H D;  5G3L F;  3IKJ A;  4ZK9 B;  1VDZ A;  4XYO A;  5JOB A;  3MXU A;  4QIW B;  3NTK A;  1G2S A;  4ZAI A;  2AWN A;  3MXG A;  4K5W A;  2CW0 D;  5C6A A;  1STY A;  3TBI B;  1GUT A;  1DM0 B;  1OXV A;  4RCO A;  3MZ5 A;  3R2T A;  3S1N B;  3Q23 A;  1LTR D;  2Q8R E;  4A93 B;  1OXX K;  1QOH A;  2EJF C;  4EGV A;  4IFD I;  1O78 A;  4M1U B;  3A56 A;  5IGD A;  2B8G A;  1NUC A;  4ZQ3 A;  1EZ6 A;  2K1B A;  4M8A A;  2E2H B;  1V1P B;  4DK1 A;  2EPB A;  2FJ2 A;  1EY8 A;  1T5E A;  5E1F A;  3HKZ B;  1SE3 A;  3J7Y W;  3M85 A;  2F0I A;  1LT3 D;  3X3M A;  1HA6 A;  5DM6 3;  3EQL C;  3S1Q B;  4BY7 B;  1EFI D;  4JK1 C;  5EBC A;  5FKA C;  3S14 B;  2FMM A;  3QB3 A;  1PRT D;  1HRJ A;  2DNE A;  1OXU A;  2XRQ D;  5T1I A;  1PDQ A;  1EY7 A;  4EQN A;  2DNC A;  3I73 A;  4OHJ A;  1BCP D;  5CV8 A;  3V05 A;  3QOL A;  1HTL D;  5EKL A;  1RDP D;  2NUC A;  4DAP A;  3HRZ C;  4HN7 A;  2BE5 C;  4RAU C;  2K33 A;  2IX1 A;  3Q6S A;  1IKM A;  5C3W A;  4A3D B;  2OXP A;  1YNN D;  4CJ2 C;  1RKN A;  2YU9 B;  1GUS A;  3A8I E;  1DZ1 A;  1J8I A;  3NK9 A;  1TY2 A;  2JP1 A;  5FO8 B;  2BCO A;  2F0G A;  2B63 B;  3D3R A;  3LWU A;  2LFN A;  4DXF A;  2MGS A;  4KJO A;  3J81 L;  4OO1 H;  3BS1 A;  2J4X A;  4IUN A;  2L0C A;  3SE0 A;  4RGO S;  5JEA G;  4HMI A;  5CMD A;  2F03 A;  3OIQ A;  3P75 A;  2BDN A;  2AQ3 B;  3EVQ A;  1IW7 D;  1DCZ A;  4A3J B;  1Q8I A;  1ET9 A;  2F0Q A;  5D3I B;  2NTT A;  2PCF B;  2RDH A;  5JPM C;  5JPN C;  4Q0F A;  3PMF A;  5IGC A;  1DD2 A;  2IL8 A;  1HXY D;  1IYU A;  1A2T A;  1WTO A;  4C3I B;  4IN3 A;  1I4H A;  5JEA J;  1DJR D;  3FRP B;  2X6G A;  1TWG B;  1UNS A;  4CKB A;  3X3N A;  5A2Q E;  4EVO A;  3G6J B;  2RDG A;  1SYC A;  3I4L A;  4BS9 A;  5IOC A;  3L7Z C;  2E75 C;  1IL8 A;  2MP1 A;  1B3A A;  1YNJ D;  4V0B A;  5I6W A;  1OXS C;  2F0T A;  3RLF A;  2X6L A;  2K7V A;  4CBV A;  1TWH B;  4RCN A;  1G91 A;  3TP8 A;  3FPU B;  5C0X H;  2A6H C;  3S2D B;  3M7G A;  1SBB B;  3J7A F;  1I6H B;  3M3Y B;  2K03 A;  4ODG A;  5K5P A;  1PRT F;  1EYD A;  4KV6 A;  1CFM A;  1I4P A;  4TRD A;  2F3V A;  1BCP F;  3HG9 A;  1CA6 A;  2F0O A;  1SYB A;  2DY7 A;  3ZYY X;  4PV1 C;  2CHB D;  2HUG A;  2A69 D;  3P7J A;  1V43 A;  1FYC A;  4C3H B;  3DEO A;  5IT9 E;  2BA1 A;  2R93 B;  1BO0 A;  4J8Q A;  1JB3 A;  4A3I B;  1AP0 A;  4A3E B;  3E5S A;  1LTB D;  3ONA B;  1B2T A;  3LNN A;  1UAP A;  1SFO B;  3QIA A;  4J1M A;  2K5Q A;  3I91 A;  2M2L A;  1PFN A;  3OHX C;  5K36 H;  3K0Y A;  2VB3 X;  1JR0 D;  1CTM A;  2JYO A;  4QCL A;  2NN6 I;  2IX0 A;  2XSC A;  3T4A C;  1STH A;  2ZXO A;  3Q24 A;  3WOF A;  4UDU C;  3P1H A;  4FF4 A;  1JCK B;  4IUV A;  1JOQ A;  2CQA A;  3PUY A;  4G57 A;  4MIU A;  5CBE E;  1MSG A;  1JIC A;  4Q5V A;  1CHQ D;  3NWT A;  4FXG C;  2Q8T A;  1V1O A;  2B39 A;  2KCC A;  4XDX A;  1HHV A;  1EL0 A;  2NB0 A;  4K2L A;  2B2W C;  1H9R A;  2Y0S B;  1JE4 A;  2JEB I;  3MXN A;  4S3S A;  2R61 A;  4ZUJ A;  3PUZ A;  4NMZ A;  3AB9 A;  1X3Q A;  2MHV A;  1O80 A;  4BA1 I;  4QUF A;  2GA4 B;  2F0U A;  2ZT9 C;  1Y1V B;  1ILQ A;  3V96 A;  2B2W A;  3FKI B;  2PQE A;  3NBI A;  1HFG A;  4ZKB B;  3M4O B;  4X3K A;  1TWF B;  1S5B D;  3FPP A;  3M4Y A;  1EZ8 A;  1DOL A;  1HUN A;  4DK0 A;  1MI2 A;  2CVR A;  3BDL A;  3NWS A;  1IKL A;  2OT2 A;  4R8N A;  3QOJ A;  2F0E A;  1TR5 A;  5KIX A;  1EU4 A;  3FDT A;  1M4V A;  1TU2 B;  1BDO A;  5CBA E;  1EU3 A;  4HSV A;  1NR4 A;  5KND A;  2WIN B;  1ML0 D;  2D62 A;  2I07 B;  5EQ0 A;  3S1R B;  2Z8L A;  3NPP A;  5CV7 A;  4G7H C;  2EYJ A;  3S2H B;  1XWE A;  4H13 C;  1Y69 U;  2NVT B;  4O1N A;  1H9K A;  1SMY C;  1KTK A;  1BBX C;  1VF7 A;  3N6R A;  3R3O A;  4KY7 A;  4XT3 B;  4B9W A;  1W6K A;  4KTA A;  4CJ1 B;  2O2L D;  4KHV A;  4QF4 A;  3GTO B;  5ELC A;  1ONL A;  3KF8 A;  4JBW A;  4IUT A;  2EYH A;  2BOS A;  5CC4 A;  1E0B A;  4KD3 A;  4F88 A;  3JAM L;  2EYL A;  3MEH A;  3MHB A;  5I2Y A;  1GUW A;  1PFB A;  2VNU D;  5M5Y B;  1E2Z A;  5FO7 B;  3PO3 B;  1BR9 A;  1K83 B;  3J7A V;  1PLF A;  1F9R A;  4RGN A;  3TSS A;  4J6H A;  5I2X A;  3EFX D;  1S5E D;  3WOE A;  4IFD H;  4NP5 A;  3OMC A;  1KAB A;  5I6Y A;  2EZV A;  5I9O A;  3A7L A;  4WFN 3;  1FNU A;  2Z1C A;  3FEW X;  2R92 B;  2EY2 A;  3S15 B;  3K7A B;  4CKC A;  1STA A;  4FF3 A;  5HGT A;  1EY5 A;  1J9O A;  2N55 A;  1SNQ A;  1SND A;  5IGE A;  5IGF A;  5C5M A;  5T1G A;  3QJY A;  3SK4 A;  1G6Z A;  1XXG A;  1RCV D;  1D1I A;  1LLR D;  3L9A X;  4EQO A;  3DEP A;  3I70 A;  3H94 A;  4I7Z C;  4HCE A;  3K5N A;  1T5X D;  5M3F B;  1WD1 A;  4FNF A;  2QCP X;  1C8C A;  1S5D D;  2IX3 A;  1VCI A;  4Z9C B;  4XYQ A;  3HS0 C;  2ID0 A;  1Z47 A;  1A15 A;  1A3U A;  3BG3 A;  2DN8 A;  4ZLT F;  2RVL A;  3VYT A;  1I50 B;  4E6I A;  4L6T B;  2F0V A;  2BE5 D;  1U4R A;  3NSW A;  4DN4 M;  1KLG D;  2EY1 A;  4A3M B;  1IYV A;  4QMG A;  1FR3 A;  1SE2 A;  2LMC B;  4R9W A;  1SJH D;  2HCI A;  3RMH A;  4L63 B;  1AZQ A;  3GD7 A;  2FFK B;  2JA6 B;  4IQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...