3MXUA

Crystal structure of glycine cleavage system protein h from bartonella henselae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
MGTLEAQTQGPGSMSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNGTKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTVQDETQLERLLDEAAYKELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycine cleavage system protein H from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Oxidoreductase
molecule keywords Glycine cleavage system H protein
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxuA00
4KKTA 1HPCA 1LACA 2A69D 2AWOA 2NN6G 1Q90A 5JEAG 2K32A 3MXUA 4G7OC 1OXSC 4DK0A 1VCIA 2CW0C 3A8JE 3L7ZC 3VR5A 4H13C 1FYCA 3QG1A 1CTMA 4G7HC 2JEAI 2BE5D 2B8GA 1GHKA 3OPOA 1PMRA 4XTCS 3H94A 3M7NA 1FR3A 2PCFB 3SDZA 2AUKA 1DD2A 3CRLC 3I73A 5JEAH 1E2ZA 1Y8NB 1TKWB 2E75C 3M4YA 1YNJC 3IKJA 1CI3M 3NE5B 4XIGS 5BN3A 2B8FA 3OOCA 4DNRB 2BA1A 4KN4C 3PUXA 3BG3A 5C0XG 3DXJC 1B9MA 4KKUA 1K8MA 3VR3A 1LABA 4KI0A 1IYUA 3QJYA 1ZKOA 1BDOA 4I7ZC 1CFMA 4HR7B 3VA7A 1GJXA 1OXTA 1T5EA 1H9SA 2A6HD 4PV1C 2NN6I 1GUTA 2PPBC 2IT1A 3I72A 3M85A 2A6EC 2DNCA 2EJFC 2YYZA 1IYVA 1O7LA 1HCZA 2JEBI 4IFDG 2EJMA 5K36H 3WDNA 3LWUA 3T53B 2L5TA 2O5JC 3A8KE 3SE0A 1E2WA 3GQBA 5BN5A 2K33A 1A6XA 1K8OA 1G291 3VR6A 2D2CC 4KHZA 5KNBA 4GZYC 1Q1BA 1YNNC 3A7AB 4DNTB 4LK1C 4LJZC 4OGQC 1Y8PB 3T51B 2O5IC 1HTPA 3RLFA 1VF5C 3PV0A 1DCZA 3D31A 1OXUA 3IFTA 4IQZA 2A6HC 5C0XH 2D5DA 2QF7A 1ONLA 3KLRA 3VR4A 4H44C 5BN4A 1H9MA 1SMYC 2Q8IB 4KMUC 1QJOA 3QIAA 3EQLC 2ZT9C 2JXMB 1H9RA 2LMCB 2R6GA 3P20A 4TKOB 2F1MA 1Q1EA 2E74C 3I4LA 4IFDH 3TZUA 3OW7A 5K36G 2E76C 3FMCA 1GUSA 1OXVA 3T56B 1O78A 3LNNA 2BE5C 4RCNA 1GUOA 2AUJD 2A68D 2DN8A 1VDZA 3A7LA 5KNDA 2BDOA 1Y69U 1H9SB 1EWHA 1B9NA 2A6ED 4JBWA 1HQMC 1I6VC 1GUNA 1Q12A 3PUWA 4H0LC 4DK1A 1Z7TA 4L8JA 2KCCA 3HGBA 3GD7A 1TU2B 1DXMA 1E2VA 1Z6HA 2V4DA 2BA0A 2DNEA 4BA2I 2A69C 4OO1H 2EDGA 2PNRC 1GUGA 1VF7A 1V43A 3ND8A 3VR2A 3ND9A 4KKSA 1GHJA 2KA7A 5KNCA 1ZYRC 2K7VA 2EVBA 1IW7C 3A8IE 3BDOA 4OO1G 1H9JA 3PUVA 4G7ZC 2D62A 2EJGC 3AB9A 3MFYA 2JE6I 4TQUS 5A35A 1H9KA 3W3AA 3U9SA 1IW7D 2NN6H 1Y8OB 1OXXK 3FPPA 4KN7C 3CRKC 3N6RA 3PUZA 3D4RA 1V8QA 2A68C 4JK1C 4BA1I 3PUYA
chains in the Genus database with same CATH superfamily
1HPCA 1LACA 3J81E 1KTKA 5LL6S 5JEAG 3N52A 3CMAA 1AFPA 4RHRA 2A73B 1CTMA 2HHHQ 3S1QB 3H94A 2G5DA 1DZ1A 1F2LA 1JT8A 4DUYL 1GO3E 2QILA 2B2YA 5IYDG 1F2ZA 3CD6A 3PUXA 2X6GA 3I4NH 3G48A 4HJAA 4KD4A 4OHJA 4A3JH 5E7NA 3CPFA 2F0VA 4GN5A 2A6HD 3C1EA 2IT1A 5FOBB 4YHHL 1Y1WH 2OXPA 1EIGA 3DLLA 1KDAA 2QW7A 5M3MG 3KK7A 2FMMA 4A3KG 3EIVA 1ET6A 4QY7A 4LF5L 3D3RA 3RLOA 2OF1A 1M1KC 1VMPA 5ELEA 5IGEA 1LT4D 5LMUL 3VYSA 1HXYD 1GVPA 1I50B 4NB3A 1YHQA 4A3FG 4TVAB 1PH7A 3RZOB 1B8AA 2HD3A 1H9MA 2PNHA 1GM5A 1H9RA 4RWSC 4DF7A 1DONA 4KK7A 3LX0A 2X6LA 3S9WA 5TSSA 4RMFA 2UXCQ 1HA6A 3TS2A 1OXVA 2DY8A 3LNNA 5KNDA 3A7LA 4NPSA 3M4OH 2F0MA 1ESFA 5I2XA 2A6ED 1SBBB 1JORA 3KLWA 2UXDQ 1TWGB 4DXFA 5FLXc 3HGBA 1LT5D 2B39A 4HJ7A 4A93B 2Z8LA 1I50H 4JOIA 1VQAA 3RZOH 4Q5VA 1YEZA 1H95A 4KKSA 2I0QA 4F88A 1GUWA 1HJPA 5IP9H 1V1PA 1QE6A 2TSSA 3L9AX 1KDBA 1FD7D 3UDXA 2QDLA 4ME5A 1B7YB 4APVA 1JC7A 3CAMA 3URYA 1U4RA 4DGZA 4DN4M 5FLXE 4YCWA 4JVZA 3M4OB 1UUPA 3Q6SA 2VUMG 4ZAIA 3AFQA 3E3XA 1XPOA 2HIXA 3QO2A 5CC4A 3ULPA 4A93H 3QG1A 2AQ3B 3PO3G 1B44D 1CSPA 2PQAB 3U4VA 3IKJA 4BY1G 2EYFA 2EYLA 1HR0Q 2XWJB 2B8FA 5JJKA 3K0XA 1HUMA 3SEBA 1XX8A 3K57A 4RKBA 4GKJQ 1IL2A 5CV4A 2AMCB 3MFGA 3GTKB 3KF6A 2OT2A 1NY4A 1XNQL 1OXTA 2Q2HA 3S1RH 1IKLA 1C7YA 4OXPA 4BBSH 2FHTA 4N8FA 1A62A 4LF9Q 5AJ3Q 4HJ8A 1X6OA 5EPLA 4QL5A 3A5ZB 2PZUA 3TN2A 2ZM6L 4UAIA 5J3BA 3EJIA 4EX5A 2PI2E 4KHZA 2I46A 3K6OA 3UI2A 4UP7A 3UDGA 2ZJRA 1EEID 5ISRA 5ELCA 3QB3A 2BDNA 1EQRA 5LMUQ 4ABNA 5C3XA 3GTQB 4JI5Q 2ZJQA 3KLRA 1EFID 3S14H 3S15B 4LF4Q 1I4HA 4LF7L 3GTKH 1STEA 4R4TA 1PH1A 1E1TA 2JP1A 1JQYD 4IURA 2EXZA 4OO1I 2E5LQ 1LTLA 3M4QA 1U4PA 3GTGH 5I9OA 4V190 1E22A 2BDOA 4DV3L 1VQMA 1HQMC 2F0WA 3E5SA 2MHVA 1CQVA 4FVMA 2EYOA 4DR5L 5KIXA 2I5LX 1BQQT 2WB1E 4GOPC 1SE4A 1TU2B 4H7BA 1V1QA 1Z6HA 1L0WA 2IL8A 3J7YW 2N78A 1G2SA 2NVXH 3JAMi 2HHHL 2KOLA 2NVYB 3CP0A 4DV3Q 3S14B 4R4CA 1HZ9A 2VUMB 2K7VA 1WTVA 1MJEA 2DJFC 1VQBA 3PUVA 4AH6A 4MHEA 1O80A 1Q8KA 4QGUA 1RODA 4QCLA 4GN4B 1OXXK 2CH4W 1F2YA 3NELA 4BA1I 3D4RA 3GTOB 1YVCA 2B2UC 2AWOA 1EY4A 4UDUC 2YTXA 2K32A 3C46A 1TS5A 2B8GA 5I6YA 4XTCS 3I56A 2F3VA 2MUYA 2M00A 1E1OA 1I6HB 5T1GA 4XQQA 1LTSD 2JA5H 1PV4A 1DM0B 1B9MA 4KD3A 1M90C 2XRSD 1SLJA 1N36L 2NZ1D 2HIVA 4HR7B 2B2TA 1NE3A 3HKZG 4AQYQ 2DNCA 2WB1G 1B70B 4FNFA 3D0FA 1HH2P 3K59A 1VQPA 1LTTD 1CQFA 2JA6H 1PH4A 2EYPA 1RKNA 4LF6Q 3ZJYC 1E2WA 1MIUA 3S24A 4KV6A 4A3LH 4KJNA 3W5OA 2F03A 2LSSA 2B29A 5JOBA 3FPUB 2PQAA 3S1MB 2Z0SA 4XYOA 3ER0A 1ML0D 1SYGA 4IJLA 3HKZB 5C0XH 3MTSA 3BYYB 4C3HG 3I90A 1HFGA 3JAME 4QJFA 2LMCB 4ID6A 4IPGA 3E0EA 2K5WA 4IN3A 2JA8H 2R92G 4IFDH 1MHWC 1FVIA 1XXGA 3KF8B 2R93B 3EA6A 2CCZA 3G6JB 4CDFC 1ASYA 1ICFB 3B6YA 2JA9A 4LUZA 4F7XA 2JK8A 1A3TA 4X3TA 2OQKA 1I4GA 3V05A 4C3IH 5IYBG 3GDEA 1HNXL 1B9NA 1EWHA 2HQEA 4O2DA 4B3TL 3ERSX 2QGQA 2B2VC 1N33L 2B2TC 5E1FA 2BH8A 4AIMA 1BNZA 3J81c 4CDCC 1N33Q 4YY3L 1XNRL 1ENFA 1WYDA 2NBFA 3M7GA 1X3FA 3ND8A 1V43A 1C4QA 4B3TQ 4DAMA 1JJCB 5BR8Q 1BCPD 2KA7A 1TWCB 3K7AB 1NUCA 1ZYRD 2F0TA 3GTJH 2R3ZA 2IHFA 4DPGA 1PHJA 1BCPF 2JE6I 4ZQ3A 5FLMG 3HOUB 3U9SA 5LHY1 1QWYA 2AQ2B 5D14A 3I4NB 4C3JG 2CQOA 1EIHA 4Y52H 3CRKC 4C3IB 1F9SA 5EPJA 2K01A 4RCOA 1EWIA 5M5WB 2SNSA 1KAAA 4JW0A 3VYRA 1E24A 3OPOA 3R2TA 5C4JB 4DKAC 2UUCL 1FR3A 2B63H 5JEAH 3M4YA 1S4ZA 2E75C 2Z4HA 3CC4A 5AFWA 4UP8A 3KF8A 1F9QA 1JOKA 1SEBD 1X32A 3D8GA 2ASBA 4HIMA 1KQSA 1K8MA 3T4AC 4I7ZC 3HOVB 4DAYB 1VQEA 3K7UC 3I72A 5JPNC 1GD7A 3PF5A 4LNQA 1GKHA 2PI2A 1PZID 1STGA 3IL8A 4A3DG 3LWUA 1STAA 1B3AA 2RHSB 3SE0A 3PIO3 5CV7A 5C4XB 1BBWA 1SMXA 4JI0L 4ZKBB 3J80i 5M3MH 1NR4A 3M3YH 1PYSB 5CR3A 2F0JA 1KRTA 2XWBB 3S2HB 3I2ZA 4K5XA 3SR1A 2JSOA 4LFAL 1X54A 2A6HC 2Q8RE 4POFA 2RQXA 3H15A 4KMUC 1V9PA 1R9TB 4KTAA 2JXMB 1LTRD 2HUGA 1AE3A 1AN8A 2N55A 1XTDA 3PIOA 1SYCA 4Z9CB 1BCPB 4OELB 2MNAA 1O78A 1TWFH 4A75A 1KDCA 4BY7B 3KFUA 5IE8A 2H4OA 1UEBA 1EUJA 5EKKA 1Q12A 2DY7A 1WCMG 2KEEA 5IT9E 4L8JA 4A3KB 3BVGA 2QKIC 3GD7A 5I2YA 2E2IH 1A2TA 4N8X1 1QCBD 3I4MB 5IGBA 2K03A 1G2TA 1DOKA 1OO9B 4JYAQ 4FDBA 1J8IA 4HSVA 1HHVA 1I94L 4DR4L 3H91A 4JPBW 2NN6H 1IL8A 5CV8A 2F3IA 1Q8IA 2A68C 1RD9D 2F0GA 3EFXD 4JI5L 3NWTA 3J80E 2IPKD 4C3HB 4MTKA 1FGBD 2Z6KC 1PTOD 4CHTB 2PCFB 4DR3Q 2X69A 3VYTA 3CRLC 1KHIA 5BN3A 3OIQA 1IKMA 2F0DA 4IUVA 5AJ3L 1SNOA 2FJ2A 4R1JA 4IO9A 3GTQH 3NK9A 1BR9A 2ZTCA 1XNQQ 4DR2L 2EJFC 4JOIC 1E3PA 2JEBI 1EQVA 1F77A 3MAQA 3S15H 4HEDA 2OWOA 1SR3A 3S1NB 1MBYA 1EWCA 3K81C 1PVOA 2J7ZA 2QDBA 4BBSG 2RCFA 4LJZC 4X62L 3GTPB 4P73A 4K0KL 4DV5L 3GP7A 1QUQB 1VF5C 2K28A 3PF4A 1OXUA 2QF7A 1HNWL 1KC8C 4DR1Q 2Q8IB 2YTYA 1U4MA 1JOQA 1ILQA 2CH4A 2Z6KA 1W3SA 2F4VQ 4GN3B 1IBKL 3OW7A 4A93G 1YHBA 1SNMA 1GUOA 5EQ0A 5DLQE 3T1YQ 2I5MX 1LUZA 3LWEA 3U58A 3HOYH 1EZ8A 4B3MQ 1FNWA 5K5PA 3W1GA 1SFOB 2EZVA 1E2VA 3AFPA 5T1IA 2F3WA 4ZRZA 3K8AA 2C9OA 4X66L 3RN2A 1ET9A 1QZHA 1K9MC 2SNMA 3JAML 3G71A 4JI6Q 3FKIB 4OO1G 1PYBA 1HA5A 4A76A 3T16A 3L0OA 3W3AA 4V0BA 1LT3D 2Z6BA 4I65A 1TS2A 3IAYA 2K05A 5IT9c 5EAYA 2UU9Q 1F2MA 3VYUA 3NBIA 1Q90A 1AZQA 1LO5D 1S5BD 4RG1A 2RA4A 1YBYA 4G7HC 1SFOH 2ALYB 4YY3Q 5FJ8G 4RGOS 1ZXTA 1D8LA 1E2ZA 2AHOB 2K50A 1MJCA 3E9IA 2PZWA 1DOLA 1NMFA 3NE5B 2ZXRA 2KHIA 1U0LA 1M4VA 2KQ3A 2CQAA 1LV9A 3CCJA 3CCEA 1GJXA 4YHHQ 1YHAA 4XDXA 3MXGA 4IPHA 3J7A5 4GOPA 4BBRH 1PH8A 3HFZB 1CA5A 2HCIA 1W2BA 5EPKA 3JAMc 2KEDA 3J80c 4WJ4A 1TWAB 1YZ6A 3CCVA 1MSGA 5IP9G 2K4KA 3C1FA 2ZTEA 3VR6A 1WTRA 2HCCA 1XMOL 4GZYC 1QNKA 4DV2Q 1C8CA 3PGZA 4XT3B 4ZKCB 1S40A 1SRUA 4FXKC 4YWMA 2ZJPA 5FLMH 1Y14B 4IQZA 1Q81C 4LF8Q 3F2DA 1Y1WB 4H44C 1VQFA 3C2PA 4PG3A 2B2UA 2NVQB 2ZT9C 2KECA 1NCVA 4O0AA 1HTLD 3EBEA 2L0CA 2M9VA 2Y0SE 1KNEA 1CKOA 1CSQA 2WAQE 2B63G 4QMGA 4EQ5A 4WRDA 4AQYL 2E76C 3F2BA 5D3DA 4HTHA 4K2LA 1NBWA 5EGTA 3UDFA 1NNXA 3P75A 1SSOA 1VQHA 2A1AA 1A3UA 4K6LA 3HOUH 4JI2L 3PUWA 1VQ8A 3I4NG 2KHJA 2KCCA 4C3IG 2Q2TA 1DOMA 1DXMA 2L1BA 4S3SA 4DR3L 3T1HQ 2BA0A 2IY5B 5M5YB 1MKHA 4Q0FA 4IFDI 2RSNA 3HOZB 1VF7A 2J0TD 3DM1A 4NMZA 1N32Q 2EVBA 1SNQA 1HZAA 5C4JH 4LUOA 1TS3A 4R8NA 4RAUC 2R7FA 3S2DH 1L1OA 1LTBD 1SROA 4TQUS 1I4XA 1SYDA 2FMCA 1STHA 2D0PA 1Y8OB 4HJ5A 4NKLA 3PMFA 1SE2A 1UAPA 1J9OA 1VQDA 1JMCA 3BZKA 3HOVH 4OONA 2SDFA 4KKTA 1I94Q 4DK3C 1NR2A 5JVH3 2Q8TA 4F87A 3OSOA 2O4XA 3U50C 1VCIA 3VR5A 4H13C 1VQOA 5EJWA 1F9PA 2F0LA 5C4XH 4QQBX 2LXKA 1B3QA 1KNAA 3NWSA 3S17H 4N9PA 3R2IA 1TY0A 4KKUA 2JJQA 3VR3A 4JV5Q 3VA7A 1PH3A 2A6EC 3MWYW 3K5LA 1QILA 1XYIA 4BY1B 4ZCKA 4AYBB 2VQFL 2EJMA 1QZGA 2JQOA 5GAGC 4GLAC 3D4WA 3TP8A 4LFCQ 4LF4L 4N9TA 1KABA 4B3SL 1PFBA 1YNNC 3KDFB 2N3SA 1Y8PB 1JOOA 4X3KA 1DCZA 4K6DA 1EIFA 1S5FD 1WCMB 3CCMA 3S17B 2NTSA 1HFNA 1CKMA 2HT1A 4BBSB 3HOXG 1EU3A 1QJOA 3D6CA 3H0GB 5GAEC 3A5UA 2R6GA 4GOPB 4LF9L 5J22A 3S16B 3T13A 4GS3A 5M3FG 3HOWH 4A3GH 1P16A 4B9WA 4A3DH 1UE1A 5D65A 4PMBA 5JEAJ 3Q0AA 4GNXA 1IZ6A 3T56B 3L3OC 1Q46A 3E0JA 3G7LA 1VDZA 4HIDA 1XTCD 4FXGC 4HJ9A 2C5CA 4DK1A 1K73C 1X56A 4KY6A 2VL6A 1TVXA 1IYJB 2F0NA 3CQZB 3MHBA 1VQLA 1O7IA 4L5QA 2NTTA 4J6HA 3A74A 2C35B 2O2LD 1EYGA 4FF4A 1CZGA 3H0GH 1SAPA 2JA7B 2NB0A 4KY5A 4MIUA 1B4OA 4A3DB 1EYCA 1PLFA 4R4IA 3FRPB 4ILWA 3FVQA 1EIYB 1AE2A 2G9HD 2NZOA 5E3FA 3PUZA 4DR1L 1ESRA 1HNWQ 1LTID 4A3EG 1KIXA 3I55A 4CGYB 2KCTA 2NVYH 3R3OA 4K0KQ 1FYCA 1X3PA 2BE5D 2VUMH 1JWSD 4J8QA 1SDFA 3DMUA 4A3MH 3S1NH 1TXYA 5JJLA 1WTWA 4GNXC 3I73A 4B3SQ 2P5ZX 5JPMC 1EY7A 3SK4A 2LY7A 1SJED 2E2JB 1A3VA 2LXJA 2BA1A 4DNRB 1EZ6A 2PO4A 4IUNA 4A3CH 3GV3A 1R4PB 1HNXQ 2ICIA 3OMCA 2GN5A 1IYUA 2JN4A 3NENA 4LFBL 2KUMA 2Q2UA 1T5EA 3UE0A 1RL2A 3DWAA 2PMZE 1X55A 4JV5L 5C44G 1N34Q 2IHEA 5FO7B 1SE3A 1A2UA 3DWQA 4L5SA 5KNBA 4PNYA 1ILPA 3CF5A 2XTIA 4JI3L 2WACA 4IUQA 3PV0A 3GO5A 3D31A 4K2KA 4A3IG 1HZCA 3MA2B 4CKCA 1JWUD 4PQXA 3FDTA 3UDIA 3U9OA 1RF2D 5M5XH 1B53A 1K83B 3ULLA 2FXQA 1G51A 2F1MA 3PO2H 2PW7A 5K36G 3JC66 1II3A 2VW9A 1L2FA 1SNDA 5IYDH 4IFDJ 1SYEA 2XSCA 3I4MG 3RLNA 2AUJD 4CKEA 2PQEA 4A3IB 3H3VC 4A3CG 5FKAC 4C2MB 5LMNW 4DV1L 1J5EQ 2A69C 1EY6A 3TS0A 4HN7A 2PNRC 1I4QA 3TMEA 3TSSA 2A8VA 1XWEA 2JA8B 5C44H 3MVVA 1SNCA 4RHSA 4IALA 2F0PA 1PTOH 1QVCA 4HIOA 2VQEQ 1H9JA 1WVLA 3KF6B 4POGA 2F0KA 3J81i 4ZLTF 2F0EA 1L0YB 2UXBQ 2R7ZB 1BF4A 4UY8C 4KJOA 1U5KA 2OTJA 3NXWA 4BBRB 3SK6A 4OIJA 1WTOA 1CZWA 1RCVD 4JI8L 1TWCH 2F0UA 4A3EH 4RH6A 2F0IA 1IHZA 2OTLA 3KYHC 4NDXA 2EXDA 1YNJC 5IYBH 5C44B 1I3QB 3HEJA 4MN3A 2F0HA 3OTOQ 2KCMA 1MGSA 5HGTA 4A4IA 1BO0A 2AWNA 1VQ4A 2VY3A 1LABA 3MXPA 3OW2A 1PZJD 1A0IA 4LUVA 2E5LL 1WTXA 5C4HA 2KENA 4K14A 2R7ZH 5D3IB 4RGMA 1K3RA 5FO8B 2B63B 3GQBA 4R4QA 1K8OA 4X3SA 2D2CC 4A3MG 1RHPA 1EU4A 2WAQB 4XQJA 2WP8J 4LK1C 2O5IC 3BJUA 2A5HA 3MEFA 3IFDA 2Q2IA 4J15A 5IOCA 5IP7H 1IBLQ 3PSIA 3RR5A 2D5DA 3BS1A 3A56A 3I3CA 1TIID 5J1ZA 2ZM6Q 2YV5A 5IP7G 5LMNQ 3Q23A 2Z1CA 4K8JA 2F0OA 2GVAA 2EYJA 2MO1A 4FP5D 1YI2A 3BDCA 5KGUA 2RVLA 5HY6A 3M3YB 1KL9A 3HOXB 4CBVA 5IY0A 5JAVA 1EY9A 4JCVE 2VB2X 1YNXA 2RF4A 1Z7TA 3OWEB 3SXHA 2KHSA 2ZXPA 1R9TH 5DM73 2Z4IA 3T1YL 1E0BA 4OWXB 1GHJA 1PRTC 2KVMA 1BVSA 4JI1Q 4RGTA 1TWFB 4BY7H 5HURA 3UE1A 1PRTB 4DV6L 2EJGC 3NEMA 3NQTA 4X65L 2F4VL 4KY7A 4DU9A 1T9HA 4LMQD 3HOXH 1BXTA 1RTOA 2E2DC 4DV0L 1EOTA 4HSPA 2NZHA 4ZUJA 4A3BB 5F2DA 4DUZL 5A2QE 4WJ3M 4G7OC 4MZ9A 3L7ZC 2CW0C 1PA6A 4BY1H 1K8GA 5C3EH 3F8TA 5COYA 3TQYA 4K5WA 4A3GG 2SEBD 3BZCA 3CPWA 4LF6L 4BXXH 1EFWA 1PXUA 1CFMA 2RBMA 4HIKA 3MC0B 4PV1C 2UXCL 4DV4L 1WCMH 2RCNA 4JC0A 3R8BA 2YYZA 1N36Q 1VQ9A 4DAVA 2VZAA 5EBCA 3DEPA 3D4DA 2A74C 2FFKB 3TP5A 3T53B 1PFNA 3NTKA 4M1UB 3S16H 2K33A 4OIKA 4A3GB 1G291 3VA5A 2VNUD 1L1OC 2K5HA 4OGQC 5C3EB 1V1PB 3MEHA 2MFIA 3C3LA 4DAYA 3RLFA 5GROA 2BCOA 5BN4A 1SMYC 1Z47A 1K0RA 1WI5A 3J7AV 3P7JA 2NVTH 4LFCL 4ZUIA 4L5RC 3NUCA 4JI7L 1X65A 1CKNB 5EBDA 2L15A 2E74C 4NXNL 4H02A 2WINB 2L11A 3HZXA 3K5NA 1EQTA 1NAPA 2F0SA 3WOEA 1QG7A 1KAWA 4OL7A 3GTPH 1H9SB 3HRZC 4JBWA 3LGJA 1GUNA 4H0LC 1LT6D 1KD1C 4JI4L 1D1IA 3NSWA 4X64Q 2EYMA 2XIWA 2WKDA 3NQIA 4BA2I 2XN9C 4XQNA 4JI8Q 1L0XB 3W2DA 3GTLB 1QNUA 1D5MC 4QUCA 1M8AA 3BYTB 5KNCA 1IW7C 4AYBE 4A3BG 1LLRD 1HRJA 4NXML 1D6EC 1X9NA 2UXBL 4CDDC 3HOYB 3BU2A 4B3RQ 1BBUA 1LYLA 2E2JH 4YWLA 1IW7D 4JI7Q 1A63A 2B3GA 5C4XG 4LF7Q 3A0JA 3I91A 2CW0D 3QWNA 4QUFA 3L2PA 2VQEL 2NUCA 2N49A 3FKIG 1N32L 1K3BC 4MTNA 3X3NA 2RHQB 4CKBA 1OXSC 4IJHA 3QOLA 2R92B 5CBAE 2EY6A 3TREA 4DV1Q 1J5EL 2MJ8A 1A15A 4JBMA 3T1HL 5DEHA 3SDZA 3J7ZC 3H6MA 3GTLH 1GOZA 3H0GG 3TDQA 1PH9A 1RTNA 4JI2Q 4MNOA 4KN4C 2UUBQ 2MQHA 1JE4A 2ATWA 1SJHD 3SVMA 1PYWD 1TQOA 2DUDA 1H9SA 1EL0A 4ALPA 3CCLA 1UWVA 2R93H 5M5XB 5ELBA 2KBNA 5IT9L 3GV6A 1Y1VH 4C1NK 3IRBA 4WFN3 1RJTA 4TSSA 3VDYA 4C1NI 2QEXA 4DAPA 3TP7A 1HR0L 3P1HA 5G3LD 4CJ1B 2ICEC 2F0QA 3K0YA 2RDFA 3M9BA 2TMPA 1HTPA 1ENCA 1PDQA 1UE6A 1G6PA 4CJ0B 1S72A 4OX9Q 3A55A 1SMYD 5IODA 5C3WA 1Q7YC 3AEVA 1XPRA 4DV7L 4DR7L 4RKLA 3I4LA 3STBC 2E2HH 5C0XJ 4PZ7A 5CMDA 5FLXL 1BKBA 3BVMA 1I6VC 3M4PA 1QB5D 5EKIA 5GAHC 1I4RA 1N9WA 1STYA 5IYCH 4XXEA 3NHHA 1A8VA 3J7AF 1ICWA 1X3GA 3HOYG 1KRSA 1K28A 2V1CC 3SK5A 1U4LA 2ZXOA 2EE1A 2EDGA 4PMWA 4IPCA 3TP6A 1XJVA 2CWAA 3KBGA 1KLUD 5IYCG 1ZYRC 3MXNA 3J81j 1XMQL 3S1QH 4A3EB 1CKNA 1K8AC 2UU9L 1WJJA 4BXXG 5C5LA 4ME3A 2EY1A 5FK9C 1I3QH 5A35A 3PO3H 4A3JB 5L37A 2I07B 3J81L 2WFWA 4JI6L 1P8LA 3HKSA 1WFQA 3HOZH 1JB7A 1HQRD 1PFSA 3OIPA 1JICA 2PW5A 1KXLA 1PFMA 3M7NA 1Q82C 3E6ZX 3CW2C 1DD2A 3CCRA 3S2DB 4XIGS 3ZYYX 1PTOC 1CI3M 2K75A 3PIP3 3OOCA 1F9RA 1JE5A 2Y0SG 5FO9B 1WTQA 1AH9A 4UPAA 1PRTD 3ONAB 2OCEA 1V1OA 1I4PA 1RIPA 2K6AA 1VQIA 3SGIA 1LTAD 3RN5A 1HUNA 1RDPD 5M3FH 3HOWG 4XT1B 1IBKQ 1HR0W 1SXTA 1XPUA 2CFMA 5A2QL 4R4OA 3OTOL 2JYOA 4C56C 2G9DA 3TZDA 3A54A 3STBD 5M5WH 4DUYQ 4U673 4RFBA 4X3UA 3A7AB 1SN8A 3OWFA 4UHVA 1ZEQX 4BBRG 4DV5Q 1X3QA 1JJGA 2D0OA 1EQQA 1G91A 4ODGA 1D5ZC 1UE5A 4QIWE 2MO0A 5CV6A 2XNAC 4EVOA 4FF3A 3RZDH 2YU9B 2IX3A 2RDGA 1IBMQ 1S5ED 3QR8A 3TZUA 1Y1VG 5KYIA 1MSHA 4DR2Q 4GKKQ 4L5TA 3G6EA 3FMCA 1SNPA 3PIPA 4TRDA 1UEAB 4HCEA 1Y69U 4EGVA 1SE8A 1IXRA 4YCVA 3TBIB 1QOHA 5JVG3 1O7ZA 1UNSA 2RKSA 2YTVA 2E8GA 4X64L 4DXGA 4DR5Q 4JBJA 4OEMB 4JI4Q 4A3BH 2ENBA 3ND9A 2BH2A 3KDFA 3RZDB 2YU9H 4G7ZC 5C0XI 1VQCA 1FJGQ 3KLSX 4QB4A 3KJPA 3SK8A 3EN2A 5ELOA 1VQ7A 2M2LA 1V8QA 4JG2A 4DR4Q 3CQZH 2JA7G 2EIFA 2A69D 3K5MA 3S1RB 4KHPL 1TS4A 3MXUA 4A3KH 1AW7A 5CV9A 1GHKA 4JI3Q 2E2IB 1S5CD 2LKVA 2B2WC 5KEEA 1Y1WG 5KYLA 1Y8NB 1TKWB 1S3OA 3CU7A 1G6ZA 4OWTB 3PQIA 2Z9HA 1HNZQ 1TWHB 2SOBA 4PZ6A 1CM9A 1CA6A 4CJ2C 3MZ5A 3ICEA 2VS1A 4KI0A 1ZKOA 1BDOA 5JJIA 1U9RA 4WORA 2F52A 4DNIA 5LL6X 4IOCA 1IYVA 3EROA 4LFBQ 1B2TA 1LTGD 4IFDG 5CYUA 4J1MA 1IBML 2WKCA 1EY0A 2O5JC 1VQGA 4K8IA 4UP9A 2LS01 4C3HH 1A6XA 2K5NA 5KRUA 4DNTB 4EQOA 4NW2A 3GTGB 1J6QA 4R9WA 4LFAQ 4BY7G 2RSOA 2IW3A 3CMEA 2IWHA 2VB3X 2F0FA 3KLSA 1BBXC 4DV2L 4A3JG 4F8MA 4ULLA 1XMOQ 1TWHH 3K80C 4DV0Q 1CK1A 3PO2G 4OWWB 3GTMH 4L63B 1G8ZD 3QIAA 3X3MA 3EQLC 5ELNA 3FKIH 3P20A 5FJ8H 2NVXB 2K5DA 4DV6Q 1L1OB 3DUZA 1JR0D 3NTIA 2J4XA 2BE5C 1FL0A 2L9HA 1UE7A 3FP9A 4P2CB 2HDMA 4IUTA 1T5XD 3BDLA 2UUCQ 2UUAQ 3AYHB 4OO1H 1EYAA 3I70A 2EY5A 5C3EG 1PRTF 3R93A 4EQNA 2JA6G 1O7YA 4FF1A 4A3FB 3DEOA 5IWAQ 1KLGD 3BDOA 4ZYSA 2ID0A 2WAQG 2GVBA 2PZTA 3WOFA 2PYKA 5NUCA 4A3IH 4XYQA 1NSNS 5LMNL 4IUUA 1YJNA 3FPPA 1C0AA 1CT1D 3QOJA 3N6RA 5CBEE 4IUPA 3PUYA 4PMCA 5IWAL 2NN6G 3CKIB 3RUZA 1IBLL 4X66Q 2JA6B 3A8JE 4LAAA 3F2UA 1D5XC 1Y1VB 3K5OA 2UUAL 1PTOB 4BS9A 1N8RC 1MD2D 2MPMA 3I8ZA 4O42A 1S5DD 4M8AA 4LF5Q 1ASZA 1WTHA 2XGTA 1YJWA 3BG3A 1SYBA 1FGUA 2K14A 4P74A 1WTPA 3QJYA 1OTCA 2CVRA 4KHVA 2WV6D 2BOSA 1WD1A 5I4DA 1GXDC 3HS0C 4GNXB 4DR7Q 1NTGA 1BCPC 1DYQA 3A8KE 3BZDB 1PH2A 2E2HB 1VS0A 2XRQD 1Q1BA 2D9UA 3MXNB 4BWGB 3T51B 4EQPA 4L6TB 3NP8A 2R61A 3FEWX 5M5YH 5E4WC 4YCUA 1YIJA 1JB3A 3IFTA 2H1EA 3F1ZA 4FXDA 3G4SA 3I7FA 4TKOB 5CV5A 4B9XA 2GA4B 1Q1EA 4LWCA 2IX1A 4FO2A 4DFAA 3SHLA 2AQ1B 1TWAH 1YNND 2KJXA 4DR6L 1GUSA 3D6WA 3K7AH 3CC2A 3GTJB 5DM63 2A68D 4P72A 3HKZE 2EYHA 3HP3A 3PO3B 5IIFA 4CDEC 1EOVA 3H3VH 2QCPX 3O13A 4YWKA 4O1NA 4AYBG 2VXWA 3HOUG 2IX0A 5IGCA 3AMUA 5J39A 4KHPQ 1AEXA 2NVQH 3BVZA 3V2TA 4DR6Q 2HQLA 4G57A 2L4NA 2D62A 2JA5G 2QEJC 3MFYA 3AB9A 5ELDA 1LM0A 1TWGH 1E7ZA 2PMZB 2CWPA 3RMHA 4KN7C 4HMIA 4JK1C 2EY2A 3CXCA 4P71A 4LF8L 1STBA 3EVQA 3PCOB 4DK0A 1MI2A 5M3FB 2JEAI 2DGYA 1C48A 3HOVG 2MP1A 4PZ8A 4JBKA 1CHQD 1NMGA 4WJWA 2AUKA 2R93G 2K5QA 3KUPA 3CCQA 3I4OA 1STNA 2LFNA 5C5MA 5M3MB 2L55A 3H3VI 1C9OA 3CCSA 1Q86C 5C0XG 1N34L 3S2HH 3TEHB 3OMGA 3NPPA 1JCKB 1B1ZA 1QUQA 5CGKA 5HGQA 2NN6I 1GUTA 5I6WA 4RGNA 2EOTA 3M85A 4GKKL 2XVSA 3W1BA 2I5HA 1O7LA 4NXNQ 2K04A 5I9PA 1YJ9A 2AKWB 5DAUA 5ELFA 5K36H 2L5TA 3J80L 5BN5A 2N88A 5G3LF 3K58A 3E9HA 1FNVA 1W6KA 3AU7A 3F2CA 3KOJA 2WB1B 1TR5A 3V96A 1R4QB 3DM3A 2JA8G 2CHBD 3DHQA 4GLXA 1AP0A 5M9OA 3CC7A 3TRZA 3KBXA 3VR4A 4JI0Q 1VQ5A 1PH5A 2JA7H 1PTOF 3I4MH 5IGDA 3HOZG 4Y7NH 1B50A 4DV4Q 3OHXC 2ZTDA 4RCNA 1EEFD 1ENAA 4GKJL 1DGSA 1TT2A 5GADC 1D7QA 5H1SE 2DJGC 4HMJA 2K5VA 3KJOA 1QVFA 2NVTB 1DJRD 4A3MB 2DNEA 2WIIB 2RDHA 1QVGA 4B3ML 1GUGA 1D2BA 3VR2A 1TY2A 3AQQA 4DUZQ 4U68A 2MGSA 2KCNA 4X6AH 5C6AA 3OYYA 4G4KA 4IPDA 4Y7NB 2EPBA 3HOWB 2L12A 3RD4A 1VQKA 4HAEA 2IJ0A 4GLVB 1VMCA 4X65Q 1X3EA 1FNUA 5JJZA 5E4XA 3H09A 2R7DA 4JI1L 4B08A 1XMQQ 2FINB 5BR8L 3Q24A 2NWGA 4X62Q 4NP5A 1PMRA 3Q22A 1XNRQ 2CKZB 2F4IA 3NBHB 1HZBA 5C4ZA 4FF2A 5CORA 4RA8A 2UXDL 4HCSA 3DXJC 1K83H 2NYZD 2VQFQ 1WD0A 1YNJD 3GTOH 2B2VA 4C3JH 2PPBC 4DA2A 2N8NA 3PO2B 1EYDA 3GTMB 1HCZA 4A3LG 2R92H 3WWVA 3WDNA 4K5VA 4DV7Q 1HNZL 1I6HH 2ES2A 4P75A 1Z9FA 2JA5B 4OX9L 4FYDA 4C2MH 2OQ0A 3ITPA 2R7ZG 2A19A 4KLKA 1ONLA 5EKLA 5GQOA 3NTHA 4DK6C 1Q3LA 3U4ZA 1JWMD 5IGGA 1VQ6A 3FHWA 4YIJA 4LW1A 1NJIC 4C3JB 1VQJA 1I5FA 5IGFA 1YITA 1D1KA 1FJGL 2EQSA 2B2WA 1EY8A 4IZ8A 1CUKA 5DNFA 2HDLA 3ULJA 3RNUA 4A3FH 2QA4A 2Y0SB 2B2YC 1VQNA 2DN8A 3NBHA 3S1MH 4JYAL 3CHBD 3Q8DA 2K52A 2UUBL 1W6JA 4ZK9B 2V4DA 1PH6A 1AZPA 4I7AA 1BUVT 3ERQA 4R8IA 4QF4A 1JJ2A 2K1BA 1PZKD 3CCUA 1K0SA 3A8IE 1WOCA 1SYFA 4QIWB 4E6IA 3HG9A 1EY5A 4IOAA 1H9KA 2H5XA 4B3RL 2OEOA 1CHPD 4NXMQ 1BOSA 3DWPA
chains in the Genus database with same CATH topology
1HPCA 1LACA 3J81E 1KTKA 5LL6S 5JEAG 3N52A 1AFPA 4RHRA 2A73B 1CTMA 3S1QB 3H94A 1DZ1A 1F2LA 2QILA 2B2YA 1F2ZA 3PUXA 2X6GA 4KD4A 4OHJA 2F0VA 2A6HD 3C1EA 2IT1A 5FOBB 2OXPA 1EIGA 1KDAA 3KK7A 2FMMA 1ET6A 3D3RA 2OF1A 1VMPA 5ELEA 5IGEA 1LT4D 3VYSA 1HXYD 1I50B 3RZOB 1H9MA 1H9RA 4RWSC 4DF7A 1DONA 4KK7A 3LX0A 2X6LA 3S9WA 5TSSA 1HA6A 1OXVA 2DY8A 3LNNA 5KNDA 3A7LA 2F0MA 1ESFA 5I2XA 2A6ED 1SBBB 1JORA 1TWGB 4DXFA 3HGBA 1LT5D 2B39A 4A93B 2Z8LA 4Q5VA 4KKSA 4F88A 1GUWA 1V1PA 1QE6A 2TSSA 3L9AX 1KDBA 1FD7D 4ME5A 1JC7A 3URYA 1U4RA 4DGZA 4DN4M 5FLXE 3M4OB 1UUPA 3Q6SA 4ZAIA 5CC4A 3QO2A 3QG1A 2AQ3B 1B44D 3IKJA 2EYFA 2EYLA 2XWJB 2B8FA 1HUMA 3SEBA 1XX8A 3K57A 4RKBA 5CV4A 3MFGA 3GTKB 2OT2A 1OXTA 1IKLA 2FHTA 5EPLA 3TN2A 2PZUA 4UAIA 3EJIA 4KHZA 2I46A 3K6OA 3UI2A 1EEID 5ISRA 5ELCA 3QB3A 2BDNA 4ABNA 5C3XA 3GTQB 3KLRA 1EFID 3S15B 1I4HA 1STEA 2JP1A 1JQYD 4IURA 2EXZA 4OO1I 1U4PA 5I9OA 4V190 2BDOA 1HQMC 2F0WA 3E5SA 2MHVA 1CQVA 4FVMA 2EYOA 5KIXA 1BQQT 1SE4A 1TU2B 4H7BA 1Z6HA 3J7YW 2IL8A 1G2SA 2KOLA 2NVYB 3S14B 2VUMB 2K7VA 1WTVA 3PUVA 4MHEA 1O80A 1RODA 4QCLA 1OXXK 1F2YA 4BA1I 3D4RA 3GTOB 2B2UC 2AWOA 1EY4A 4UDUC 2K32A 3C46A 1TS5A 2B8GA 5I6YA 4XTCS 2F3VA 2MUYA 2M00A 1I6HB 5T1GA 4XQQA 1LTSD 1DM0B 1B9MA 4KD3A 2XRSD 2NZ1D 4HR7B 2B2TA 2DNCA 4FNFA 3K59A 1LTTD 1CQFA 2EYPA 1RKNA 1E2WA 4KV6A 4KJNA 2F03A 5JOBA 3FPUB 3S1MB 4XYOA 1ML0D 1SYGA 3HKZB 5C0XH 3MTSA 3BYYB 4C3HG 3I90A 1HFGA 3JAME 2LMCB 4ID6A 4IN3A 2K5WA 4IFDH 1XXGA 2R93B 3EA6A 3G6JB 4F7XA 1A3TA 4X3TA 1I4GA 3V05A 1B9NA 1EWHA 2HQEA 2B2VC 2B2TC 5E1FA 1BNZA 1ENFA 2NBFA 3M7GA 3ND8A 1V43A 1C4QA 1BCPD 2KA7A 1TWCB 3K7AB 1NUCA 1ZYRD 2F0TA 2R3ZA 1BCPF 2JE6I 4ZQ3A 3HOUB 3U9SA 5LHY1 1QWYA 2AQ2B 5D14A 3I4NB 4C3JG 1EIHA 3CRKC 4C3IB 1F9SA 5EPJA 2K01A 4RCOA 5M5WB 2SNSA 1KAAA 3VYRA 3OPOA 3R2TA 5C4JB 1FR3A 5JEAH 3M4YA 1S4ZA 2E75C 2Z4HA 5AFWA 3KF8A 1F9QA 1JOKA 1SEBD 1X32A 3D8GA 1K8MA 3T4AC 4I7ZC 3HOVB 3I72A 5JPNC 1PZID 1STGA 3IL8A 3LWUA 1STAA 1B3AA 3SE0A 3PIO3 5CV7A 5C4XB 4ZKBB 1NR4A 5CR3A 2F0JA 2XWBB 3S2HB 4K5XA 3SR1A 2JSOA 2A6HC 2Q8RE 2RQXA 4KMUC 1R9TB 4KTAA 2JXMB 1LTRD 2HUGA 1AN8A 2N55A 1SYCA 4Z9CB 1BCPB 1O78A 4BY7B 1KDCA 2H4OA 5EKKA 1Q12A 2DY7A 2KEEA 5IT9E 4L8JA 4A3KB 3BVGA 2QKIC 3GD7A 5I2YA 1A2TA 3I4MB 1QCBD 5IGBA 2K03A 1G2TA 1DOKA 1OO9B 1J8IA 4HSVA 1HHVA 3H91A 2NN6H 1IL8A 5CV8A 1Q8IA 2A68C 1RD9D 2F0GA 3EFXD 3NWTA 3J80E 2IPKD 4C3HB 1FGBD 1PTOD 4CHTB 2PCFB 2X69A 3VYTA 3CRLC 5BN3A 3OIQA 1IKMA 2F0DA 4IUVA 1SNOA 2FJ2A 3NK9A 1BR9A 2EJFC 2JEBI 1EQVA 1F77A 3MAQA 4HEDA 3S1NB 1MBYA 1EWCA 2J7ZA 2QDBA 4LJZC 3GTPB 3GP7A 1VF5C 2K28A 1OXUA 2QF7A 2Q8IB 1U4MA 1JOQA 1ILQA 3OW7A 1SNMA 1GUOA 5EQ0A 3LWEA 1EZ8A 1FNWA 5K5PA 1SFOB 2EZVA 1E2VA 5T1IA 2F3WA 4ZRZA 2C9OA 1ET9A 2SNMA 3JAML 3FKIB 4OO1G 1HA5A 3T16A 3W3AA 4V0BA 1LT3D 4I65A 1TS2A 3IAYA 2K05A 1F2MA 3VYUA 3NBIA 1Q90A 1AZQA 1LO5D 1S5BD 2RA4A 4G7HC 4RGOS 1ZXTA 1E2ZA 3NE5B 2PZWA 1DOLA 2ZXRA 1M4VA 2KQ3A 2CQAA 1LV9A 1GJXA 4XDXA 3MXGA 1CA5A 2HCIA 5EPKA 2KEDA 1TWAB 1MSGA 3C1FA 3VR6A 1WTRA 2HCCA 4GZYC 1QNKA 1C8CA 4XT3B 4ZKCB 4FXKC 4IQZA 1Y1WB 4H44C 3C2PA 2B2UA 2NVQB 2ZT9C 2KECA 1NCVA 1HTLD 2L0CA 2M9VA 1KNEA 4QMGA 4WRDA 2E76C 5D3DA 4HTHA 4K2LA 5EGTA 3P75A 1SSOA 1A3UA 4K6LA 3PUWA 2KCCA 4C3IG 1DOMA 1DXMA 2L1BA 4S3SA 5M5YB 2BA0A 4Q0FA 4IFDI 2RSNA 3HOZB 1VF7A 2J0TD 3DM1A 4NMZA 2EVBA 1SNQA 1TS3A 4R8NA 4RAUC 1LTBD 4TQUS 1I4XA 1SYDA 1STHA 2FMCA 1Y8OB 4NKLA 3PMFA 1SE2A 1UAPA 1J9OA 2SDFA 4KKTA 1NR2A 5JVH3 2Q8TA 4F87A 3OSOA 2O4XA 1VCIA 3VR5A 4H13C 5EJWA 1F9PA 2F0LA 1KNAA 3NWSA 4N9PA 3R2IA 1TY0A 4KKUA 3VR3A 3VA7A 2A6EC 3MWYW 3K5LA 1QILA 1XYIA 4BY1B 4AYBB 2EJMA 3D4WA 3TP8A 4N9TA 1KABA 1PFBA 1YNNC 1Y8PB 1JOOA 4X3KA 1DCZA 4K6DA 1S5FD 1WCMB 3S17B 2NTSA 1HFNA 4BBSB 1EU3A 1QJOA 3D6CA 3H0GB 2R6GA 5J22A 3S16B 3T13A 4B9WA 5D65A 5JEAJ 4PMBA 3Q0AA 3T56B 3L3OC 3E0JA 3G7LA 1VDZA 1XTCD 4FXGC 2C5CA 4DK1A 4KY6A 1TVXA 2F0NA 3CQZB 3MHBA 2NTTA 4J6HA 2O2LD 4FF4A 1CZGA 1SAPA 2JA7B 2NB0A 4KY5A 4MIUA 1B4OA 4A3DB 1EYCA 1PLFA 3FRPB 4ILWA 3FVQA 2G9HD 5E3FA 3PUZA 1ESRA 1LTID 4CGYB 3R3OA 1FYCA 1X3PA 2BE5D 1JWSD 4J8QA 1SDFA 3DMUA 1WTWA 3I73A 5JPMC 1EY7A 3SK4A 2LY7A 1SJED 2E2JB 1A3VA 4DNRB 2BA1A 1EZ6A 2PO4A 4IUNA 3GV3A 1R4PB 2ICIA 3OMCA 1IYUA 2KUMA 1T5EA 3DWAA 5FO7B 1SE3A 1A2UA 3DWQA 5KNBA 4PNYA 1ILPA 2WACA 4IUQA 3PV0A 3GO5A 3D31A 4K2KA 3MA2B 4CKCA 1JWUD 4PQXA 3FDTA 3U9OA 1RF2D 1B53A 1K83B 2F1MA 2PW7A 5K36G 1II3A 1SNDA 4IFDJ 1SYEA 2XSCA 2AUJD 4CKEA 2PQEA 4A3IB 3H3VC 5FKAC 4C2MB 2A69C 1EY6A 4HN7A 2PNRC 1I4QA 3TMEA 3TSSA 2JA8B 1XWEA 3MVVA 1SNCA 4RHSA 4IALA 2F0PA 1PTOH 1H9JA 1WVLA 2F0KA 4ZLTF 2F0EA 1L0YB 2R7ZB 1BF4A 4KJOA 3NXWA 4BBRB 3SK6A 4OIJA 1WTOA 1CZWA 1RCVD 2F0UA 4RH6A 2F0IA 1IHZA 4NDXA 1YNJC 5C44B 1I3QB 3HEJA 4MN3A 2F0HA 1MGSA 5HGTA 1BO0A 2AWNA 1LABA 3MXPA 1PZJD 1WTXA 5C4HA 4K14A 5D3IB 4RGMA 5FO8B 2B63B 3GQBA 1K8OA 4X3SA 2D2CC 1RHPA 1EU4A 2WAQB 4XQJA 2WP8J 4LK1C 2O5IC 2A5HA 3IFDA 5IOCA 2D5DA 3BS1A 3A56A 3I3CA 1TIID 5J1ZA 3Q23A 2Z1CA 4K8JA 2F0OA 2EYJA 4FP5D 3BDCA 5KGUA 2RVLA 3M3YB 3HOXB 4CBVA 5JAVA 1EY9A 2VB2X 1Z7TA 3OWEB 3SXHA 2KHSA 2ZXPA 5DM73 2Z4IA 1E0BA 1GHJA 1PRTC 2KVMA 4RGTA 1TWFB 5HURA 1PRTB 2EJGC 3NQTA 4KY7A 4DU9A 4LMQD 1BXTA 1RTOA 2E2DC 1EOTA 4HSPA 4ZUJA 4A3BB 5F2DA 5A2QE 4G7OC 3L7ZC 2CW0C 5COYA 4K5WA 2SEBD 1PXUA 1CFMA 2RBMA 3MC0B 4PV1C 3R8BA 2YYZA 4DAVA 5EBCA 3DEPA 3D4DA 2A74C 2FFKB 3TP5A 3T53B 1PFNA 3NTKA 4M1UB 2K33A 4OIKA 4A3GB 1G291 3VA5A 2VNUD 4OGQC 5C3EB 1V1PB 3MEHA 3C3LA 4DAYA 3RLFA 2BCOA 5BN4A 1SMYC 1Z47A 3J7AV 3P7JA 4ZUIA 3NUCA 5EBDA 2E74C 2WINB 2L11A 3HZXA 3K5NA 1EQTA 1NAPA 2F0SA 3WOEA 1QG7A 4OL7A 1H9SB 3HRZC 4JBWA 1GUNA 4H0LC 1LT6D 1D1IA 3NSWA 2EYMA 2XIWA 2WKDA 3NQIA 4BA2I 2XN9C 4XQNA 1L0XB 3W2DA 3GTLB 1QNUA 1D5MC 4QUCA 1M8AA 3BYTB 5KNCA 1IW7C 1LLRD 1HRJA 1D6EC 3HOYB 1IW7D 3I91A 2CW0D 3QWNA 4QUFA 2NUCA 3X3NA 4CKBA 1OXSC 3QOLA 2R92B 5CBAE 2EY6A 2MJ8A 1A15A 5DEHA 3SDZA 3H6MA 1GOZA 3TDQA 1RTNA 4KN4C 1JE4A 1SJHD 3SVMA 1PYWD 1TQOA 1H9SA 1EL0A 5M5XB 5ELBA 5IT9L 3GV6A 4C1NK 4WFN3 1RJTA 4TSSA 4C1NI 4DAPA 3TP7A 3P1HA 5G3LD 4CJ1B 2ICEC 2F0QA 3K0YA 2RDFA 2TMPA 1HTPA 1ENCA 1PDQA 4CJ0B 3A55A 1SMYD 5IODA 5C3WA 4RKLA 3I4LA 5C0XJ 5CMDA 5FLXL 3BVMA 1I6VC 1QB5D 5EKIA 1I4RA 1STYA 4XXEA 3NHHA 3J7AF 1ICWA 3SK5A 1U4LA 2ZXOA 2EE1A 2EDGA 4PMWA 3TP6A 3KBGA 1KLUD 1ZYRC 3MXNA 4A3EB 5C5LA 2EY1A 5FK9C 5A35A 4A3JB 2I07B 3J81L 1HQRD 3OIPA 1JICA 2PW5A 1PFMA 3M7NA 3E6ZX 1DD2A 3S2DB 4XIGS 3ZYYX 1PTOC 1CI3M 3PIP3 3OOCA 1F9RA 5FO9B 1WTQA 1PRTD 3ONAB 1V1OA 1I4PA 2K6AA 1LTAD 1HUNA 1RDPD 4XT1B 1SXTA 5A2QL 2JYOA 4C56C 2G9DA 3TZDA 3A54A 4U673 4RFBA 4X3UA 3A7AB 3OWFA 1ZEQX 1X3QA 1G91A 1D5ZC 4ODGA 5CV6A 2XNAC 4EVOA 4FF3A 2YU9B 2IX3A 2RDGA 1S5ED 3TZUA 5KYIA 1MSHA 3FMCA 1SNPA 4TRDA 1UEAB 4HCEA 1Y69U 4EGVA 3TBIB 1QOHA 5JVG3 1O7ZA 1UNSA 2RKSA 4DXGA 2ENBA 3ND9A 3RZDB 4G7ZC 5C0XI 3KLSX 4QB4A 3SK8A 2M2LA 1V8QA 2A69D 3K5MA 3S1RB 1TS4A 3MXUA 1AW7A 5CV9A 1GHKA 2E2IB 1S5CD 2LKVA 2B2WC 5KEEA 5KYLA 1Y8NB 1TKWB 3CU7A 1G6ZA 1TWHB 2SOBA 1CM9A 1CA6A 4CJ2C 3MZ5A 4KI0A 1ZKOA 1BDOA 1U9RA 4WORA 5LL6X 1IYVA 3EROA 1B2TA 1LTGD 4IFDG 5CYUA 4J1MA 2WKCA 1EY0A 2O5JC 4K8IA 2LS01 1A6XA 5KRUA 4DNTB 4EQOA 4NW2A 3GTGB 4R9WA 2RSOA 2IW3A 2IWHA 2VB3X 2F0FA 3KLSA 1BBXC 4F8MA 4ULLA 1CK1A 4L63B 1G8ZD 3QIAA 3X3MA 3EQLC 3P20A 2NVXB 2K5DA 3DUZA 3NTIA 1JR0D 2J4XA 2BE5C 2L9HA 4P2CB 2HDMA 4IUTA 1T5XD 3BDLA 4OO1H 1EYAA 3I70A 2EY5A 1PRTF 3R93A 4EQNA 1O7YA 4FF1A 4A3FB 3DEOA 1KLGD 3BDOA 4ZYSA 2ID0A 2PZTA 3WOFA 2PYKA 5NUCA 4XYQA 1NSNS 4IUUA 3FPPA 1CT1D 3QOJA 3N6RA 5CBEE 4IUPA 3PUYA 4PMCA 2NN6G 3CKIB 3RUZA 2JA6B 3A8JE 4LAAA 3F2UA 1D5XC 1Y1VB 3K5OA 1PTOB 4BS9A 1MD2D 2MPMA 3I8ZA 4O42A 1S5DD 4M8AA 3BG3A 1SYBA 1WTPA 3QJYA 2CVRA 4KHVA 2WV6D 2BOSA 1WD1A 5I4DA 1GXDC 3HS0C 3A8KE 1BCPC 1DYQA 3BZDB 2E2HB 2XRQD 1Q1BA 2D9UA 4BWGB 3T51B 4EQPA 4L6TB 3NP8A 2R61A 3FEWX 5E4WC 1JB3A 3IFTA 2H1EA 4FXDA 4TKOB 5CV5A 4B9XA 2GA4B 1Q1EA 2IX1A 4FO2A 4DFAA 3SHLA 2AQ1B 1YNND 2KJXA 1GUSA 3D6WA 3GTJB 5DM63 2A68D 2EYHA 3HP3A 3PO3B 5IIFA 2QCPX 3O13A 4O1NA 2VXWA 2IX0A 5IGCA 3AMUA 5J39A 1AEXA 3BVZA 3V2TA 4G57A 2L4NA 2D62A 2QEJC 3MFYA 3AB9A 5ELDA 2PMZB 3RMHA 4KN7C 4HMIA 4JK1C 2EY2A 1STBA 3EVQA 4DK0A 1MI2A 5M3FB 2JEAI 1C48A 2MP1A 1CHQD 4WJWA 2AUKA 2K5QA 3KUPA 1STNA 2LFNA 5C5MA 5M3MB 2L55A 5C0XG 3OMGA 3NPPA 1JCKB 1B1ZA 5CGKA 2NN6I 1GUTA 5I6WA 4RGNA 2EOTA 3M85A 2XVSA 1O7LA 2K04A 5I9PA 5ELFA 5DAUA 5K36H 2L5TA 3J80L 5BN5A 2N88A 5G3LF 3K58A 1FNVA 1W6KA 3AU7A 3V96A 1TR5A 2WB1B 1R4QB 2CHBD 3DHQA 1AP0A 5M9OA 3KBXA 3VR4A 1PTOF 5IGDA 1B50A 3OHXC 4RCNA 1EEFD 1ENAA 1TT2A 4HMJA 2NVTB 1DJRD 4A3MB 2DNEA 2WIIB 2RDHA 1GUGA 1D2BA 3VR2A 1TY2A 4U68A 2MGSA 2KCNA 5C6AA 4G4KA 4Y7NB 3HOWB 2EPBA 2L12A 3RD4A 4HAEA 2IJ0A 1VMCA 1FNUA 5JJZA 5E4XA 3H09A 4B08A 2FINB 3Q24A 2NWGA 4NP5A 1PMRA 3Q22A 2F4IA 5C4ZA 4FF2A 5CORA 4RA8A 4HCSA 3DXJC 2NYZD 1WD0A 1YNJD 2B2VA 2PPBC 4DA2A 3PO2B 1EYDA 3GTMB 1HCZA 3WDNA 4K5VA 2JA5B 4FYDA 3ITPA 1ONLA 5EKLA 3NTHA 1Q3LA 5IGGA 1JWMD 4YIJA 4C3JB 5IGFA 1D1KA 2B2WA 1EY8A 4IZ8A 5DNFA 2HDLA 2Y0SB 2B2YC 2DN8A 3NBHA 3CHBD 1W6JA 4ZK9B 2V4DA 1AZPA 1BUVT 3ERQA 4R8IA 4QF4A 2K1BA 1PZKD 3A8IE 1SYFA 4QIWB 4E6IA 3HG9A 1EY5A 1H9KA 2OEOA 1CHPD 1BOSA 3DWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKT A;  1HPC A;  1LAC A;  2A69 D;  2AWO A;  2NN6 G;  1Q90 A;  5JEA G;  2K32 A;  3MXU A;  4G7O C;  1OXS C;  4DK0 A;  1VCI A;  2CW0 C;  3A8J E;  3L7Z C;  3VR5 A;  4H13 C;  1FYC A;  3QG1 A;  1CTM A;  4G7H C;  2JEA I;  2BE5 D;  2B8G A;  1GHK A;  3OPO A;  1PMR A;  4XTC S;  3H94 A;  3M7N A;  1FR3 A;  2PCF B;  3SDZ A;  2AUK A;  1DD2 A;  3CRL C;  3I73 A;  5JEA H;  1E2Z A;  1Y8N B;  1TKW B;  2E75 C;  3M4Y A;  1YNJ C;  3IKJ A;  1CI3 M;  3NE5 B;  4XIG S;  5BN3 A;  2B8F A;  3OOC A;  4DNR B;  2BA1 A;  4KN4 C;  3PUX A;  3BG3 A;  5C0X G;  3DXJ C;  1B9M A;  4KKU A;  1K8M A;  3VR3 A;  1LAB A;  4KI0 A;  1IYU A;  3QJY A;  1ZKO A;  1BDO A;  4I7Z C;  1CFM A;  4HR7 B;  3VA7 A;  1GJX A;  1OXT A;  1T5E A;  1H9S A;  2A6H D;  4PV1 C;  2NN6 I;  1GUT A;  2PPB C;  2IT1 A;  3I72 A;  3M85 A;  2A6E C;  2DNC A;  2EJF C;  2YYZ A;  1IYV A;  1O7L A;  1HCZ A;  2JEB I;  4IFD G;  2EJM A;  5K36 H;  3WDN A;  3LWU A;  3T53 B;  2L5T A;  2O5J C;  3A8K E;  3SE0 A;  1E2W A;  3GQB A;  5BN5 A;  2K33 A;  1A6X A;  1K8O A;  1G29 1;  3VR6 A;  2D2C C;  4KHZ A;  5KNB A;  4GZY C;  1Q1B A;  1YNN C;  3A7A B;  4DNT B;  4LK1 C;  4LJZ C;  4OGQ C;  1Y8P B;  3T51 B;  2O5I C;  1HTP A;  3RLF A;  1VF5 C;  3PV0 A;  1DCZ A;  3D31 A;  1OXU A;  3IFT A;  4IQZ A;  2A6H C;  5C0X H;  2D5D A;  2QF7 A;  1ONL A;  3KLR A;  3VR4 A;  4H44 C;  5BN4 A;  1H9M A;  1SMY C;  2Q8I B;  4KMU C;  1QJO A;  3QIA A;  3EQL C;  2ZT9 C;  2JXM B;  1H9R A;  2LMC B;  2R6G A;  3P20 A;  4TKO B;  2F1M A;  1Q1E A;  2E74 C;  3I4L A;  4IFD H;  3TZU A;  3OW7 A;  5K36 G;  2E76 C;  3FMC A;  1GUS A;  1OXV A;  3T56 B;  1O78 A;  3LNN A;  2BE5 C;  4RCN A;  1GUO A;  2AUJ D;  2A68 D;  2DN8 A;  1VDZ A;  3A7L A;  5KND A;  2BDO A;  1Y69 U;  1H9S B;  1EWH A;  1B9N A;  2A6E D;  4JBW A;  1HQM C;  1I6V C;  1GUN A;  1Q12 A;  3PUW A;  4H0L C;  4DK1 A;  1Z7T A;  4L8J A;  2KCC A;  3HGB A;  3GD7 A;  1TU2 B;  1DXM A;  1E2V A;  1Z6H A;  2V4D A;  2BA0 A;  2DNE A;  4BA2 I;  2A69 C;  4OO1 H;  2EDG A;  2PNR C;  1GUG A;  1VF7 A;  1V43 A;  3ND8 A;  3VR2 A;  3ND9 A;  4KKS A;  1GHJ A;  2KA7 A;  5KNC A;  1ZYR C;  2K7V A;  2EVB A;  1IW7 C;  3A8I E;  3BDO A;  4OO1 G;  1H9J A;  3PUV A;  4G7Z C;  2D62 A;  2EJG C;  3AB9 A;  3MFY A;  2JE6 I;  4TQU S;  5A35 A;  1H9K A;  3W3A A;  3U9S A;  1IW7 D;  2NN6 H;  1Y8O B;  1OXX K;  3FPP A;  4KN7 C;  3CRK C;  3N6R A;  3PUZ A;  3D4R A;  1V8Q A;  2A68 C;  4JK1 C;  4BA1 I;  3PUY A; 
#chains in the Genus database with same CATH topology
 1HPC A;  1LAC A;  3J81 E;  1KTK A;  5LL6 S;  5JEA G;  3N52 A;  3CMA A;  1AFP A;  4RHR A;  2A73 B;  1CTM A;  2HHH Q;  3S1Q B;  3H94 A;  2G5D A;  1DZ1 A;  1F2L A;  1JT8 A;  4DUY L;  1GO3 E;  2QIL A;  2B2Y A;  5IYD G;  1F2Z A;  3CD6 A;  3PUX A;  2X6G A;  3I4N H;  3G48 A;  4HJA A;  4KD4 A;  4OHJ A;  4A3J H;  5E7N A;  3CPF A;  2F0V A;  4GN5 A;  2A6H D;  3C1E A;  2IT1 A;  5FOB B;  4YHH L;  1Y1W H;  2OXP A;  1EIG A;  3DLL A;  1KDA A;  2QW7 A;  5M3M G;  3KK7 A;  2FMM A;  4A3K G;  3EIV A;  1ET6 A;  4QY7 A;  4LF5 L;  3D3R A;  3RLO A;  2OF1 A;  1M1K C;  1VMP A;  5ELE A;  5IGE A;  1LT4 D;  5LMU L;  3VYS A;  1HXY D;  1GVP A;  1I50 B;  4NB3 A;  1YHQ A;  4A3F G;  4TVA B;  1PH7 A;  3RZO B;  1B8A A;  2HD3 A;  1H9M A;  2PNH A;  1GM5 A;  1H9R A;  4RWS C;  4DF7 A;  1DON A;  4KK7 A;  3LX0 A;  2X6L A;  3S9W A;  5TSS A;  4RMF A;  2UXC Q;  1HA6 A;  3TS2 A;  1OXV A;  2DY8 A;  3LNN A;  5KND A;  3A7L A;  4NPS A;  3M4O H;  2F0M A;  1ESF A;  5I2X A;  2A6E D;  1SBB B;  1JOR A;  3KLW A;  2UXD Q;  1TWG B;  4DXF A;  5FLX c;  3HGB A;  1LT5 D;  2B39 A;  4HJ7 A;  4A93 B;  2Z8L A;  1I50 H;  4JOI A;  1VQA A;  3RZO H;  4Q5V A;  1YEZ A;  1H95 A;  4KKS A;  2I0Q A;  4F88 A;  1GUW A;  1HJP A;  5IP9 H;  1V1P A;  1QE6 A;  2TSS A;  3L9A X;  1KDB A;  1FD7 D;  3UDX A;  2QDL A;  4ME5 A;  1B7Y B;  4APV A;  1JC7 A;  3CAM A;  3URY A;  1U4R A;  4DGZ A;  4DN4 M;  5FLX E;  4YCW A;  4JVZ A;  3M4O B;  1UUP A;  3Q6S A;  2VUM G;  4ZAI A;  3AFQ A;  3E3X A;  1XPO A;  2HIX A;  3QO2 A;  5CC4 A;  3ULP A;  4A93 H;  3QG1 A;  2AQ3 B;  3PO3 G;  1B44 D;  1CSP A;  2PQA B;  3U4V A;  3IKJ A;  4BY1 G;  2EYF A;  2EYL A;  1HR0 Q;  2XWJ B;  2B8F A;  5JJK A;  3K0X A;  1HUM A;  3SEB A;  1XX8 A;  3K57 A;  4RKB A;  4GKJ Q;  1IL2 A;  5CV4 A;  2AMC B;  3MFG A;  3GTK B;  3KF6 A;  2OT2 A;  1NY4 A;  1XNQ L;  1OXT A;  2Q2H A;  3S1R H;  1IKL A;  1C7Y A;  4OXP A;  4BBS H;  2FHT A;  4N8F A;  1A62 A;  4LF9 Q;  5AJ3 Q;  4HJ8 A;  1X6O A;  5EPL A;  4QL5 A;  3A5Z B;  2PZU A;  3TN2 A;  2ZM6 L;  4UAI A;  5J3B A;  3EJI A;  4EX5 A;  2PI2 E;  4KHZ A;  2I46 A;  3K6O A;  3UI2 A;  4UP7 A;  3UDG A;  2ZJR A;  1EEI D;  5ISR A;  5ELC A;  3QB3 A;  2BDN A;  1EQR A;  5LMU Q;  4ABN A;  5C3X A;  3GTQ B;  4JI5 Q;  2ZJQ A;  3KLR A;  1EFI D;  3S14 H;  3S15 B;  4LF4 Q;  1I4H A;  4LF7 L;  3GTK H;  1STE A;  4R4T A;  1PH1 A;  1E1T A;  2JP1 A;  1JQY D;  4IUR A;  2EXZ A;  4OO1 I;  2E5L Q;  1LTL A;  3M4Q A;  1U4P A;  3GTG H;  5I9O A;  4V19 0;  1E22 A;  2BDO A;  4DV3 L;  1VQM A;  1HQM C;  2F0W A;  3E5S A;  2MHV A;  1CQV A;  4FVM A;  2EYO A;  4DR5 L;  5KIX A;  2I5L X;  1BQQ T;  2WB1 E;  4GOP C;  1SE4 A;  1TU2 B;  4H7B A;  1V1Q A;  1Z6H A;  1L0W A;  2IL8 A;  3J7Y W;  2N78 A;  1G2S A;  2NVX H;  3JAM i;  2HHH L;  2KOL A;  2NVY B;  3CP0 A;  4DV3 Q;  3S14 B;  4R4C A;  1HZ9 A;  2VUM B;  2K7V A;  1WTV A;  1MJE A;  2DJF C;  1VQB A;  3PUV A;  4AH6 A;  4MHE A;  1O80 A;  1Q8K A;  4QGU A;  1ROD A;  4QCL A;  4GN4 B;  1OXX K;  2CH4 W;  1F2Y A;  3NEL A;  4BA1 I;  3D4R A;  3GTO B;  1YVC A;  2B2U C;  2AWO A;  1EY4 A;  4UDU C;  2YTX A;  2K32 A;  3C46 A;  1TS5 A;  2B8G A;  5I6Y A;  4XTC S;  3I56 A;  2F3V A;  2MUY A;  2M00 A;  1E1O A;  1I6H B;  5T1G A;  4XQQ A;  1LTS D;  2JA5 H;  1PV4 A;  1DM0 B;  1B9M A;  4KD3 A;  1M90 C;  2XRS D;  1SLJ A;  1N36 L;  2NZ1 D;  2HIV A;  4HR7 B;  2B2T A;  1NE3 A;  3HKZ G;  4AQY Q;  2DNC A;  2WB1 G;  1B70 B;  4FNF A;  3D0F A;  1HH2 P;  3K59 A;  1VQP A;  1LTT D;  1CQF A;  2JA6 H;  1PH4 A;  2EYP A;  1RKN A;  4LF6 Q;  3ZJY C;  1E2W A;  1MIU A;  3S24 A;  4KV6 A;  4A3L H;  4KJN A;  3W5O A;  2F03 A;  2LSS A;  2B29 A;  5JOB A;  3FPU B;  2PQA A;  3S1M B;  2Z0S A;  4XYO A;  3ER0 A;  1ML0 D;  1SYG A;  4IJL A;  3HKZ B;  5C0X H;  3MTS A;  3BYY B;  4C3H G;  3I90 A;  1HFG A;  3JAM E;  4QJF A;  2LMC B;  4ID6 A;  4IPG A;  3E0E A;  2K5W A;  4IN3 A;  2JA8 H;  2R92 G;  4IFD H;  1MHW C;  1FVI A;  1XXG A;  3KF8 B;  2R93 B;  3EA6 A;  2CCZ A;  3G6J B;  4CDF C;  1ASY A;  1ICF B;  3B6Y A;  2JA9 A;  4LUZ A;  4F7X A;  2JK8 A;  1A3T A;  4X3T A;  2OQK A;  1I4G A;  3V05 A;  4C3I H;  5IYB G;  3GDE A;  1HNX L;  1B9N A;  1EWH A;  2HQE A;  4O2D A;  4B3T L;  3ERS X;  2QGQ A;  2B2V C;  1N33 L;  2B2T C;  5E1F A;  2BH8 A;  4AIM A;  1BNZ A;  3J81 c;  4CDC C;  1N33 Q;  4YY3 L;  1XNR L;  1ENF A;  1WYD A;  2NBF A;  3M7G A;  1X3F A;  3ND8 A;  1V43 A;  1C4Q A;  4B3T Q;  4DAM A;  1JJC B;  5BR8 Q;  1BCP D;  2KA7 A;  1TWC B;  3K7A B;  1NUC A;  1ZYR D;  2F0T A;  3GTJ H;  2R3Z A;  2IHF A;  4DPG A;  1PHJ A;  1BCP F;  2JE6 I;  4ZQ3 A;  5FLM G;  3HOU B;  3U9S A;  5LHY 1;  1QWY A;  2AQ2 B;  5D14 A;  3I4N B;  4C3J G;  2CQO A;  1EIH A;  4Y52 H;  3CRK C;  4C3I B;  1F9S A;  5EPJ A;  2K01 A;  4RCO A;  1EWI A;  5M5W B;  2SNS A;  1KAA A;  4JW0 A;  3VYR A;  1E24 A;  3OPO A;  3R2T A;  5C4J B;  4DKA C;  2UUC L;  1FR3 A;  2B63 H;  5JEA H;  3M4Y A;  1S4Z A;  2E75 C;  2Z4H A;  3CC4 A;  5AFW A;  4UP8 A;  3KF8 A;  1F9Q A;  1JOK A;  1SEB D;  1X32 A;  3D8G A;  2ASB A;  4HIM A;  1KQS A;  1K8M A;  3T4A C;  4I7Z C;  3HOV B;  4DAY B;  1VQE A;  3K7U C;  3I72 A;  5JPN C;  1GD7 A;  3PF5 A;  4LNQ A;  1GKH A;  2PI2 A;  1PZI D;  1STG A;  3IL8 A;  4A3D G;  3LWU A;  1STA A;  1B3A A;  2RHS B;  3SE0 A;  3PIO 3;  5CV7 A;  5C4X B;  1BBW A;  1SMX A;  4JI0 L;  4ZKB B;  3J80 i;  5M3M H;  1NR4 A;  3M3Y H;  1PYS B;  5CR3 A;  2F0J A;  1KRT A;  2XWB B;  3S2H B;  3I2Z A;  4K5X A;  3SR1 A;  2JSO A;  4LFA L;  1X54 A;  2A6H C;  2Q8R E;  4POF A;  2RQX A;  3H15 A;  4KMU C;  1V9P A;  1R9T B;  4KTA A;  2JXM B;  1LTR D;  2HUG A;  1AE3 A;  1AN8 A;  2N55 A;  1XTD A;  3PIO A;  1SYC A;  4Z9C B;  1BCP B;  4OEL B;  2MNA A;  1O78 A;  1TWF H;  4A75 A;  1KDC A;  4BY7 B;  3KFU A;  5IE8 A;  2H4O A;  1UEB A;  1EUJ A;  5EKK A;  1Q12 A;  2DY7 A;  1WCM G;  2KEE A;  5IT9 E;  4L8J A;  4A3K B;  3BVG A;  2QKI C;  3GD7 A;  5I2Y A;  2E2I H;  1A2T A;  4N8X 1;  1QCB D;  3I4M B;  5IGB A;  2K03 A;  1G2T A;  1DOK A;  1OO9 B;  4JYA Q;  4FDB A;  1J8I A;  4HSV A;  1HHV A;  1I94 L;  4DR4 L;  3H91 A;  4JPB W;  2NN6 H;  1IL8 A;  5CV8 A;  2F3I A;  1Q8I A;  2A68 C;  1RD9 D;  2F0G A;  3EFX D;  4JI5 L;  3NWT A;  3J80 E;  2IPK D;  4C3H B;  4MTK A;  1FGB D;  2Z6K C;  1PTO D;  4CHT B;  2PCF B;  4DR3 Q;  2X69 A;  3VYT A;  3CRL C;  1KHI A;  5BN3 A;  3OIQ A;  1IKM A;  2F0D A;  4IUV A;  5AJ3 L;  1SNO A;  2FJ2 A;  4R1J A;  4IO9 A;  3GTQ H;  3NK9 A;  1BR9 A;  2ZTC A;  1XNQ Q;  4DR2 L;  2EJF C;  4JOI C;  1E3P A;  2JEB I;  1EQV A;  1F77 A;  3MAQ A;  3S15 H;  4HED A;  2OWO A;  1SR3 A;  3S1N B;  1MBY A;  1EWC A;  3K81 C;  1PVO A;  2J7Z A;  2QDB A;  4BBS G;  2RCF A;  4LJZ C;  4X62 L;  3GTP B;  4P73 A;  4K0K L;  4DV5 L;  3GP7 A;  1QUQ B;  1VF5 C;  2K28 A;  3PF4 A;  1OXU A;  2QF7 A;  1HNW L;  1KC8 C;  4DR1 Q;  2Q8I B;  2YTY A;  1U4M A;  1JOQ A;  1ILQ A;  2CH4 A;  2Z6K A;  1W3S A;  2F4V Q;  4GN3 B;  1IBK L;  3OW7 A;  4A93 G;  1YHB A;  1SNM A;  1GUO A;  5EQ0 A;  5DLQ E;  3T1Y Q;  2I5M X;  1LUZ A;  3LWE A;  3U58 A;  3HOY H;  1EZ8 A;  4B3M Q;  1FNW A;  5K5P A;  3W1G A;  1SFO B;  2EZV A;  1E2V A;  3AFP A;  5T1I A;  2F3W A;  4ZRZ A;  3K8A A;  2C9O A;  4X66 L;  3RN2 A;  1ET9 A;  1QZH A;  1K9M C;  2SNM A;  3JAM L;  3G71 A;  4JI6 Q;  3FKI B;  4OO1 G;  1PYB A;  1HA5 A;  4A76 A;  3T16 A;  3L0O A;  3W3A A;  4V0B A;  1LT3 D;  2Z6B A;  4I65 A;  1TS2 A;  3IAY A;  2K05 A;  5IT9 c;  5EAY A;  2UU9 Q;  1F2M A;  3VYU A;  3NBI A;  1Q90 A;  1AZQ A;  1LO5 D;  1S5B D;  4RG1 A;  2RA4 A;  1YBY A;  4G7H C;  1SFO H;  2ALY B;  4YY3 Q;  5FJ8 G;  4RGO S;  1ZXT A;  1D8L A;  1E2Z A;  2AHO B;  2K50 A;  1MJC A;  3E9I A;  2PZW A;  1DOL A;  1NMF A;  3NE5 B;  2ZXR A;  2KHI A;  1U0L A;  1M4V A;  2KQ3 A;  2CQA A;  1LV9 A;  3CCJ A;  3CCE A;  1GJX A;  4YHH Q;  1YHA A;  4XDX A;  3MXG A;  4IPH A;  3J7A 5;  4GOP A;  4BBR H;  1PH8 A;  3HFZ B;  1CA5 A;  2HCI A;  1W2B A;  5EPK A;  3JAM c;  2KED A;  3J80 c;  4WJ4 A;  1TWA B;  1YZ6 A;  3CCV A;  1MSG A;  5IP9 G;  2K4K A;  3C1F A;  2ZTE A;  3VR6 A;  1WTR A;  2HCC A;  1XMO L;  4GZY C;  1QNK A;  4DV2 Q;  1C8C A;  3PGZ A;  4XT3 B;  4ZKC B;  1S40 A;  1SRU A;  4FXK C;  4YWM A;  2ZJP A;  5FLM H;  1Y14 B;  4IQZ A;  1Q81 C;  4LF8 Q;  3F2D A;  1Y1W B;  4H44 C;  1VQF A;  3C2P A;  4PG3 A;  2B2U A;  2NVQ B;  2ZT9 C;  2KEC A;  1NCV A;  4O0A A;  1HTL D;  3EBE A;  2L0C A;  2M9V A;  2Y0S E;  1KNE A;  1CKO A;  1CSQ A;  2WAQ E;  2B63 G;  4QMG A;  4EQ5 A;  4WRD A;  4AQY L;  2E76 C;  3F2B A;  5D3D A;  4HTH A;  4K2L A;  1NBW A;  5EGT A;  3UDF A;  1NNX A;  3P75 A;  1SSO A;  1VQH A;  2A1A A;  1A3U A;  4K6L A;  3HOU H;  4JI2 L;  3PUW A;  1VQ8 A;  3I4N G;  2KHJ A;  2KCC A;  4C3I G;  2Q2T A;  1DOM A;  1DXM A;  2L1B A;  4S3S A;  4DR3 L;  3T1H Q;  2BA0 A;  2IY5 B;  5M5Y B;  1MKH A;  4Q0F A;  4IFD I;  2RSN A;  3HOZ B;  1VF7 A;  2J0T D;  3DM1 A;  4NMZ A;  1N32 Q;  2EVB A;  1SNQ A;  1HZA A;  5C4J H;  4LUO A;  1TS3 A;  4R8N A;  4RAU C;  2R7F A;  3S2D H;  1L1O A;  1LTB D;  1SRO A;  4TQU S;  1I4X A;  1SYD A;  2FMC A;  1STH A;  2D0P A;  1Y8O B;  4HJ5 A;  4NKL A;  3PMF A;  1SE2 A;  1UAP A;  1J9O A;  1VQD A;  1JMC A;  3BZK A;  3HOV H;  4OON A;  2SDF A;  4KKT A;  1I94 Q;  4DK3 C;  1NR2 A;  5JVH 3;  2Q8T A;  4F87 A;  3OSO A;  2O4X A;  3U50 C;  1VCI A;  3VR5 A;  4H13 C;  1VQO A;  5EJW A;  1F9P A;  2F0L A;  5C4X H;  4QQB X;  2LXK A;  1B3Q A;  1KNA A;  3NWS A;  3S17 H;  4N9P A;  3R2I A;  1TY0 A;  4KKU A;  2JJQ A;  3VR3 A;  4JV5 Q;  3VA7 A;  1PH3 A;  2A6E C;  3MWY W;  3K5L A;  1QIL A;  1XYI A;  4BY1 B;  4ZCK A;  4AYB B;  2VQF L;  2EJM A;  1QZG A;  2JQO A;  5GAG C;  4GLA C;  3D4W A;  3TP8 A;  4LFC Q;  4LF4 L;  4N9T A;  1KAB A;  4B3S L;  1PFB A;  1YNN C;  3KDF B;  2N3S A;  1Y8P B;  1JOO A;  4X3K A;  1DCZ A;  4K6D A;  1EIF A;  1S5F D;  1WCM B;  3CCM A;  3S17 B;  2NTS A;  1HFN A;  1CKM A;  2HT1 A;  4BBS B;  3HOX G;  1EU3 A;  1QJO A;  3D6C A;  3H0G B;  5GAE C;  3A5U A;  2R6G A;  4GOP B;  4LF9 L;  5J22 A;  3S16 B;  3T13 A;  4GS3 A;  5M3F G;  3HOW H;  4A3G H;  1P16 A;  4B9W A;  4A3D H;  1UE1 A;  5D65 A;  4PMB A;  5JEA J;  3Q0A A;  4GNX A;  1IZ6 A;  3T56 B;  3L3O C;  1Q46 A;  3E0J A;  3G7L A;  1VDZ A;  4HID A;  1XTC D;  4FXG C;  4HJ9 A;  2C5C A;  4DK1 A;  1K73 C;  1X56 A;  4KY6 A;  2VL6 A;  1TVX A;  1IYJ B;  2F0N A;  3CQZ B;  3MHB A;  1VQL A;  1O7I A;  4L5Q A;  2NTT A;  4J6H A;  3A74 A;  2C35 B;  2O2L D;  1EYG A;  4FF4 A;  1CZG A;  3H0G H;  1SAP A;  2JA7 B;  2NB0 A;  4KY5 A;  4MIU A;  1B4O A;  4A3D B;  1EYC A;  1PLF A;  4R4I A;  3FRP B;  4ILW A;  3FVQ A;  1EIY B;  1AE2 A;  2G9H D;  2NZO A;  5E3F A;  3PUZ A;  4DR1 L;  1ESR A;  1HNW Q;  1LTI D;  4A3E G;  1KIX A;  3I55 A;  4CGY B;  2KCT A;  2NVY H;  3R3O A;  4K0K Q;  1FYC A;  1X3P A;  2BE5 D;  2VUM H;  1JWS D;  4J8Q A;  1SDF A;  3DMU A;  4A3M H;  3S1N H;  1TXY A;  5JJL A;  1WTW A;  4GNX C;  3I73 A;  4B3S Q;  2P5Z X;  5JPM C;  1EY7 A;  3SK4 A;  2LY7 A;  1SJE D;  2E2J B;  1A3V A;  2LXJ A;  2BA1 A;  4DNR B;  1EZ6 A;  2PO4 A;  4IUN A;  4A3C H;  3GV3 A;  1R4P B;  1HNX Q;  2ICI A;  3OMC A;  2GN5 A;  1IYU A;  2JN4 A;  3NEN A;  4LFB L;  2KUM A;  2Q2U A;  1T5E A;  3UE0 A;  1RL2 A;  3DWA A;  2PMZ E;  1X55 A;  4JV5 L;  5C44 G;  1N34 Q;  2IHE A;  5FO7 B;  1SE3 A;  1A2U A;  3DWQ A;  4L5S A;  5KNB A;  4PNY A;  1ILP A;  3CF5 A;  2XTI A;  4JI3 L;  2WAC A;  4IUQ A;  3PV0 A;  3GO5 A;  3D31 A;  4K2K A;  4A3I G;  1HZC A;  3MA2 B;  4CKC A;  1JWU D;  4PQX A;  3FDT A;  3UDI A;  3U9O A;  1RF2 D;  5M5X H;  1B53 A;  1K83 B;  3ULL A;  2FXQ A;  1G51 A;  2F1M A;  3PO2 H;  2PW7 A;  5K36 G;  3JC6 6;  1II3 A;  2VW9 A;  1L2F A;  1SND A;  5IYD H;  4IFD J;  1SYE A;  2XSC A;  3I4M G;  3RLN A;  2AUJ D;  4CKE A;  2PQE A;  4A3I B;  3H3V C;  4A3C G;  5FKA C;  4C2M B;  5LMN W;  4DV1 L;  1J5E Q;  2A69 C;  1EY6 A;  3TS0 A;  4HN7 A;  2PNR C;  1I4Q A;  3TME A;  3TSS A;  2A8V A;  1XWE A;  2JA8 B;  5C44 H;  3MVV A;  1SNC A;  4RHS A;  4IAL A;  2F0P A;  1PTO H;  1QVC A;  4HIO A;  2VQE Q;  1H9J A;  1WVL A;  3KF6 B;  4POG A;  2F0K A;  3J81 i;  4ZLT F;  2F0E A;  1L0Y B;  2UXB Q;  2R7Z B;  1BF4 A;  4UY8 C;  4KJO A;  1U5K A;  2OTJ A;  3NXW A;  4BBR B;  3SK6 A;  4OIJ A;  1WTO A;  1CZW A;  1RCV D;  4JI8 L;  1TWC H;  2F0U A;  4A3E H;  4RH6 A;  2F0I A;  1IHZ A;  2OTL A;  3KYH C;  4NDX A;  2EXD A;  1YNJ C;  5IYB H;  5C44 B;  1I3Q B;  3HEJ A;  4MN3 A;  2F0H A;  3OTO Q;  2KCM A;  1MGS A;  5HGT A;  4A4I A;  1BO0 A;  2AWN A;  1VQ4 A;  2VY3 A;  1LAB A;  3MXP A;  3OW2 A;  1PZJ D;  1A0I A;  4LUV A;  2E5L L;  1WTX A;  5C4H A;  2KEN A;  4K14 A;  2R7Z H;  5D3I B;  4RGM A;  1K3R A;  5FO8 B;  2B63 B;  3GQB A;  4R4Q A;  1K8O A;  4X3S A;  2D2C C;  4A3M G;  1RHP A;  1EU4 A;  2WAQ B;  4XQJ A;  2WP8 J;  4LK1 C;  2O5I C;  3BJU A;  2A5H A;  3MEF A;  3IFD A;  2Q2I A;  4J15 A;  5IOC A;  5IP7 H;  1IBL Q;  3PSI A;  3RR5 A;  2D5D A;  3BS1 A;  3A56 A;  3I3C A;  1TII D;  5J1Z A;  2ZM6 Q;  2YV5 A;  5IP7 G;  5LMN Q;  3Q23 A;  2Z1C A;  4K8J A;  2F0O A;  2GVA A;  2EYJ A;  2MO1 A;  4FP5 D;  1YI2 A;  3BDC A;  5KGU A;  2RVL A;  5HY6 A;  3M3Y B;  1KL9 A;  3HOX B;  4CBV A;  5IY0 A;  5JAV A;  1EY9 A;  4JCV E;  2VB2 X;  1YNX A;  2RF4 A;  1Z7T A;  3OWE B;  3SXH A;  2KHS A;  2ZXP A;  1R9T H;  5DM7 3;  2Z4I A;  3T1Y L;  1E0B A;  4OWX B;  1GHJ A;  1PRT C;  2KVM A;  1BVS A;  4JI1 Q;  4RGT A;  1TWF B;  4BY7 H;  5HUR A;  3UE1 A;  1PRT B;  4DV6 L;  2EJG C;  3NEM A;  3NQT A;  4X65 L;  2F4V L;  4KY7 A;  4DU9 A;  1T9H A;  4LMQ D;  3HOX H;  1BXT A;  1RTO A;  2E2D C;  4DV0 L;  1EOT A;  4HSP A;  2NZH A;  4ZUJ A;  4A3B B;  5F2D A;  4DUZ L;  5A2Q E;  4WJ3 M;  4G7O C;  4MZ9 A;  3L7Z C;  2CW0 C;  1PA6 A;  4BY1 H;  1K8G A;  5C3E H;  3F8T A;  5COY A;  3TQY A;  4K5W A;  4A3G G;  2SEB D;  3BZC A;  3CPW A;  4LF6 L;  4BXX H;  1EFW A;  1PXU A;  1CFM A;  2RBM A;  4HIK A;  3MC0 B;  4PV1 C;  2UXC L;  4DV4 L;  1WCM H;  2RCN A;  4JC0 A;  3R8B A;  2YYZ A;  1N36 Q;  1VQ9 A;  4DAV A;  2VZA A;  5EBC A;  3DEP A;  3D4D A;  2A74 C;  2FFK B;  3TP5 A;  3T53 B;  1PFN A;  3NTK A;  4M1U B;  3S16 H;  2K33 A;  4OIK A;  4A3G B;  1G29 1;  3VA5 A;  2VNU D;  1L1O C;  2K5H A;  4OGQ C;  5C3E B;  1V1P B;  3MEH A;  2MFI A;  3C3L A;  4DAY A;  3RLF A;  5GRO A;  2BCO A;  5BN4 A;  1SMY C;  1Z47 A;  1K0R A;  1WI5 A;  3J7A V;  3P7J A;  2NVT H;  4LFC L;  4ZUI A;  4L5R C;  3NUC A;  4JI7 L;  1X65 A;  1CKN B;  5EBD A;  2L15 A;  2E74 C;  4NXN L;  4H02 A;  2WIN B;  2L11 A;  3HZX A;  3K5N A;  1EQT A;  1NAP A;  2F0S A;  3WOE A;  1QG7 A;  1KAW A;  4OL7 A;  3GTP H;  1H9S B;  3HRZ C;  4JBW A;  3LGJ A;  1GUN A;  4H0L C;  1LT6 D;  1KD1 C;  4JI4 L;  1D1I A;  3NSW A;  4X64 Q;  2EYM A;  2XIW A;  2WKD A;  3NQI A;  4BA2 I;  2XN9 C;  4XQN A;  4JI8 Q;  1L0X B;  3W2D A;  3GTL B;  1QNU A;  1D5M C;  4QUC A;  1M8A A;  3BYT B;  5KNC A;  1IW7 C;  4AYB E;  4A3B G;  1LLR D;  1HRJ A;  4NXM L;  1D6E C;  1X9N A;  2UXB L;  4CDD C;  3HOY B;  3BU2 A;  4B3R Q;  1BBU A;  1LYL A;  2E2J H;  4YWL A;  1IW7 D;  4JI7 Q;  1A63 A;  2B3G A;  5C4X G;  4LF7 Q;  3A0J A;  3I91 A;  2CW0 D;  3QWN A;  4QUF A;  3L2P A;  2VQE L;  2NUC A;  2N49 A;  3FKI G;  1N32 L;  1K3B C;  4MTN A;  3X3N A;  2RHQ B;  4CKB A;  1OXS C;  4IJH A;  3QOL A;  2R92 B;  5CBA E;  2EY6 A;  3TRE A;  4DV1 Q;  1J5E L;  2MJ8 A;  1A15 A;  4JBM A;  3T1H L;  5DEH A;  3SDZ A;  3J7Z C;  3H6M A;  3GTL H;  1GOZ A;  3H0G G;  3TDQ A;  1PH9 A;  1RTN A;  4JI2 Q;  4MNO A;  4KN4 C;  2UUB Q;  2MQH A;  1JE4 A;  2ATW A;  1SJH D;  3SVM A;  1PYW D;  1TQO A;  2DUD A;  1H9S A;  1EL0 A;  4ALP A;  3CCL A;  1UWV A;  2R93 H;  5M5X B;  5ELB A;  2KBN A;  5IT9 L;  3GV6 A;  1Y1V H;  4C1N K;  3IRB A;  4WFN 3;  1RJT A;  4TSS A;  3VDY A;  4C1N I;  2QEX A;  4DAP A;  3TP7 A;  1HR0 L;  3P1H A;  5G3L D;  4CJ1 B;  2ICE C;  2F0Q A;  3K0Y A;  2RDF A;  3M9B A;  2TMP A;  1HTP A;  1ENC A;  1PDQ A;  1UE6 A;  1G6P A;  4CJ0 B;  1S72 A;  4OX9 Q;  3A55 A;  1SMY D;  5IOD A;  5C3W A;  1Q7Y C;  3AEV A;  1XPR A;  4DV7 L;  4DR7 L;  4RKL A;  3I4L A;  3STB C;  2E2H H;  5C0X J;  4PZ7 A;  5CMD A;  5FLX L;  1BKB A;  3BVM A;  1I6V C;  3M4P A;  1QB5 D;  5EKI A;  5GAH C;  1I4R A;  1N9W A;  1STY A;  5IYC H;  4XXE A;  3NHH A;  1A8V A;  3J7A F;  1ICW A;  1X3G A;  3HOY G;  1KRS A;  1K28 A;  2V1C C;  3SK5 A;  1U4L A;  2ZXO A;  2EE1 A;  2EDG A;  4PMW A;  4IPC A;  3TP6 A;  1XJV A;  2CWA A;  3KBG A;  1KLU D;  5IYC G;  1ZYR C;  3MXN A;  3J81 j;  1XMQ L;  3S1Q H;  4A3E B;  1CKN A;  1K8A C;  2UU9 L;  1WJJ A;  4BXX G;  5C5L A;  4ME3 A;  2EY1 A;  5FK9 C;  1I3Q H;  5A35 A;  3PO3 H;  4A3J B;  5L37 A;  2I07 B;  3J81 L;  2WFW A;  4JI6 L;  1P8L A;  3HKS A;  1WFQ A;  3HOZ H;  1JB7 A;  1HQR D;  1PFS A;  3OIP A;  1JIC A;  2PW5 A;  1KXL A;  1PFM A;  3M7N A;  1Q82 C;  3E6Z X;  3CW2 C;  1DD2 A;  3CCR A;  3S2D B;  4XIG S;  3ZYY X;  1PTO C;  1CI3 M;  2K75 A;  3PIP 3;  3OOC A;  1F9R A;  1JE5 A;  2Y0S G;  5FO9 B;  1WTQ A;  1AH9 A;  4UPA A;  1PRT D;  3ONA B;  2OCE A;  1V1O A;  1I4P A;  1RIP A;  2K6A A;  1VQI A;  3SGI A;  1LTA D;  3RN5 A;  1HUN A;  1RDP D;  5M3F H;  3HOW G;  4XT1 B;  1IBK Q;  1HR0 W;  1SXT A;  1XPU A;  2CFM A;  5A2Q L;  4R4O A;  3OTO L;  2JYO A;  4C56 C;  2G9D A;  3TZD A;  3A54 A;  3STB D;  5M5W H;  4DUY Q;  4U67 3;  4RFB A;  4X3U A;  3A7A B;  1SN8 A;  3OWF A;  4UHV A;  1ZEQ X;  4BBR G;  4DV5 Q;  1X3Q A;  1JJG A;  2D0O A;  1EQQ A;  1G91 A;  4ODG A;  1D5Z C;  1UE5 A;  4QIW E;  2MO0 A;  5CV6 A;  2XNA C;  4EVO A;  4FF3 A;  3RZD H;  2YU9 B;  2IX3 A;  2RDG A;  1IBM Q;  1S5E D;  3QR8 A;  3TZU A;  1Y1V G;  5KYI A;  1MSH A;  4DR2 Q;  4GKK Q;  4L5T A;  3G6E A;  3FMC A;  1SNP A;  3PIP A;  4TRD A;  1UEA B;  4HCE A;  1Y69 U;  4EGV A;  1SE8 A;  1IXR A;  4YCV A;  3TBI B;  1QOH A;  5JVG 3;  1O7Z A;  1UNS A;  2RKS A;  2YTV A;  2E8G A;  4X64 L;  4DXG A;  4DR5 Q;  4JBJ A;  4OEM B;  4JI4 Q;  4A3B H;  2ENB A;  3ND9 A;  2BH2 A;  3KDF A;  3RZD B;  2YU9 H;  4G7Z C;  5C0X I;  1VQC A;  1FJG Q;  3KLS X;  4QB4 A;  3KJP A;  3SK8 A;  3EN2 A;  5ELO A;  1VQ7 A;  2M2L A;  1V8Q A;  4JG2 A;  4DR4 Q;  3CQZ H;  2JA7 G;  2EIF A;  2A69 D;  3K5M A;  3S1R B;  4KHP L;  1TS4 A;  3MXU A;  4A3K H;  1AW7 A;  5CV9 A;  1GHK A;  4JI3 Q;  2E2I B;  1S5C D;  2LKV A;  2B2W C;  5KEE A;  1Y1W G;  5KYL A;  1Y8N B;  1TKW B;  1S3O A;  3CU7 A;  1G6Z A;  4OWT B;  3PQI A;  2Z9H A;  1HNZ Q;  1TWH B;  2SOB A;  4PZ6 A;  1CM9 A;  1CA6 A;  4CJ2 C;  3MZ5 A;  3ICE A;  2VS1 A;  4KI0 A;  1ZKO A;  1BDO A;  5JJI A;  1U9R A;  4WOR A;  2F52 A;  4DNI A;  5LL6 X;  4IOC A;  1IYV A;  3ERO A;  4LFB Q;  1B2T A;  1LTG D;  4IFD G;  5CYU A;  4J1M A;  1IBM L;  2WKC A;  1EY0 A;  2O5J C;  1VQG A;  4K8I A;  4UP9 A;  2LS0 1;  4C3H H;  1A6X A;  2K5N A;  5KRU A;  4DNT B;  4EQO A;  4NW2 A;  3GTG B;  1J6Q A;  4R9W A;  4LFA Q;  4BY7 G;  2RSO A;  2IW3 A;  3CME A;  2IWH A;  2VB3 X;  2F0F A;  3KLS A;  1BBX C;  4DV2 L;  4A3J G;  4F8M A;  4ULL A;  1XMO Q;  1TWH H;  3K80 C;  4DV0 Q;  1CK1 A;  3PO2 G;  4OWW B;  3GTM H;  4L63 B;  1G8Z D;  3QIA A;  3X3M A;  3EQL C;  5ELN A;  3FKI H;  3P20 A;  5FJ8 H;  2NVX B;  2K5D A;  4DV6 Q;  1L1O B;  3DUZ A;  1JR0 D;  3NTI A;  2J4X A;  2BE5 C;  1FL0 A;  2L9H A;  1UE7 A;  3FP9 A;  4P2C B;  2HDM A;  4IUT A;  1T5X D;  3BDL A;  2UUC Q;  2UUA Q;  3AYH B;  4OO1 H;  1EYA A;  3I70 A;  2EY5 A;  5C3E G;  1PRT F;  3R93 A;  4EQN A;  2JA6 G;  1O7Y A;  4FF1 A;  4A3F B;  3DEO A;  5IWA Q;  1KLG D;  3BDO A;  4ZYS A;  2ID0 A;  2WAQ G;  2GVB A;  2PZT A;  3WOF A;  2PYK A;  5NUC A;  4A3I H;  4XYQ A;  1NSN S;  5LMN L;  4IUU A;  1YJN A;  3FPP A;  1C0A A;  1CT1 D;  3QOJ A;  3N6R A;  5CBE E;  4IUP A;  3PUY A;  4PMC A;  5IWA L;  2NN6 G;  3CKI B;  3RUZ A;  1IBL L;  4X66 Q;  2JA6 B;  3A8J E;  4LAA A;  3F2U A;  1D5X C;  1Y1V B;  3K5O A;  2UUA L;  1PTO B;  4BS9 A;  1N8R C;  1MD2 D;  2MPM A;  3I8Z A;  4O42 A;  1S5D D;  4M8A A;  4LF5 Q;  1ASZ A;  1WTH A;  2XGT A;  1YJW A;  3BG3 A;  1SYB A;  1FGU A;  2K14 A;  4P74 A;  1WTP A;  3QJY A;  1OTC A;  2CVR A;  4KHV A;  2WV6 D;  2BOS A;  1WD1 A;  5I4D A;  1GXD C;  3HS0 C;  4GNX B;  4DR7 Q;  1NTG A;  1BCP C;  1DYQ A;  3A8K E;  3BZD B;  1PH2 A;  2E2H B;  1VS0 A;  2XRQ D;  1Q1B A;  2D9U A;  3MXN B;  4BWG B;  3T51 B;  4EQP A;  4L6T B;  3NP8 A;  2R61 A;  3FEW X;  5M5Y H;  5E4W C;  4YCU A;  1YIJ A;  1JB3 A;  3IFT A;  2H1E A;  3F1Z A;  4FXD A;  3G4S A;  3I7F A;  4TKO B;  5CV5 A;  4B9X A;  2GA4 B;  1Q1E A;  4LWC A;  2IX1 A;  4FO2 A;  4DFA A;  3SHL A;  2AQ1 B;  1TWA H;  1YNN D;  2KJX A;  4DR6 L;  1GUS A;  3D6W A;  3K7A H;  3CC2 A;  3GTJ B;  5DM6 3;  2A68 D;  4P72 A;  3HKZ E;  2EYH A;  3HP3 A;  3PO3 B;  5IIF A;  4CDE C;  1EOV A;  3H3V H;  2QCP X;  3O13 A;  4YWK A;  4O1N A;  4AYB G;  2VXW A;  3HOU G;  2IX0 A;  5IGC A;  3AMU A;  5J39 A;  4KHP Q;  1AEX A;  2NVQ H;  3BVZ A;  3V2T A;  4DR6 Q;  2HQL A;  4G57 A;  2L4N A;  2D62 A;  2JA5 G;  2QEJ C;  3MFY A;  3AB9 A;  5ELD A;  1LM0 A;  1TWG H;  1E7Z A;  2PMZ B;  2CWP A;  3RMH A;  4KN7 C;  4HMI A;  4JK1 C;  2EY2 A;  3CXC A;  4P71 A;  4LF8 L;  1STB A;  3EVQ A;  3PCO B;  4DK0 A;  1MI2 A;  5M3F B;  2JEA I;  2DGY A;  1C48 A;  3HOV G;  2MP1 A;  4PZ8 A;  4JBK A;  1CHQ D;  1NMG A;  4WJW A;  2AUK A;  2R93 G;  2K5Q A;  3KUP A;  3CCQ A;  3I4O A;  1STN A;  2LFN A;  5C5M A;  5M3M B;  2L55 A;  3H3V I;  1C9O A;  3CCS A;  1Q86 C;  5C0X G;  1N34 L;  3S2H H;  3TEH B;  3OMG A;  3NPP A;  1JCK B;  1B1Z A;  1QUQ A;  5CGK A;  5HGQ A;  2NN6 I;  1GUT A;  5I6W A;  4RGN A;  2EOT A;  3M85 A;  4GKK L;  2XVS A;  3W1B A;  2I5H A;  1O7L A;  4NXN Q;  2K04 A;  5I9P A;  1YJ9 A;  2AKW B;  5DAU A;  5ELF A;  5K36 H;  2L5T A;  3J80 L;  5BN5 A;  2N88 A;  5G3L F;  3K58 A;  3E9H A;  1FNV A;  1W6K A;  3AU7 A;  3F2C A;  3KOJ A;  2WB1 B;  1TR5 A;  3V96 A;  1R4Q B;  3DM3 A;  2JA8 G;  2CHB D;  3DHQ A;  4GLX A;  1AP0 A;  5M9O A;  3CC7 A;  3TRZ A;  3KBX A;  3VR4 A;  4JI0 Q;  1VQ5 A;  1PH5 A;  2JA7 H;  1PTO F;  3I4M H;  5IGD A;  3HOZ G;  4Y7N H;  1B50 A;  4DV4 Q;  3OHX C;  2ZTD A;  4RCN A;  1EEF D;  1ENA A;  4GKJ L;  1DGS A;  1TT2 A;  5GAD C;  1D7Q A;  5H1S E;  2DJG C;  4HMJ A;  2K5V A;  3KJO A;  1QVF A;  2NVT B;  1DJR D;  4A3M B;  2DNE A;  2WII B;  2RDH A;  1QVG A;  4B3M L;  1GUG A;  1D2B A;  3VR2 A;  1TY2 A;  3AQQ A;  4DUZ Q;  4U68 A;  2MGS A;  2KCN A;  4X6A H;  5C6A A;  3OYY A;  4G4K A;  4IPD A;  4Y7N B;  2EPB A;  3HOW B;  2L12 A;  3RD4 A;  1VQK A;  4HAE A;  2IJ0 A;  4GLV B;  1VMC A;  4X65 Q;  1X3E A;  1FNU A;  5JJZ A;  5E4X A;  3H09 A;  2R7D A;  4JI1 L;  4B08 A;  1XMQ Q;  2FIN B;  5BR8 L;  3Q24 A;  2NWG A;  4X62 Q;  4NP5 A;  1PMR A;  3Q22 A;  1XNR Q;  2CKZ B;  2F4I A;  3NBH B;  1HZB A;  5C4Z A;  4FF2 A;  5COR A;  4RA8 A;  2UXD L;  4HCS A;  3DXJ C;  1K83 H;  2NYZ D;  2VQF Q;  1WD0 A;  1YNJ D;  3GTO H;  2B2V A;  4C3J H;  2PPB C;  4DA2 A;  2N8N A;  3PO2 B;  1EYD A;  3GTM B;  1HCZ A;  4A3L G;  2R92 H;  3WWV A;  3WDN A;  4K5V A;  4DV7 Q;  1HNZ L;  1I6H H;  2ES2 A;  4P75 A;  1Z9F A;  2JA5 B;  4OX9 L;  4FYD A;  4C2M H;  2OQ0 A;  3ITP A;  2R7Z G;  2A19 A;  4KLK A;  1ONL A;  5EKL A;  5GQO A;  3NTH A;  4DK6 C;  1Q3L A;  3U4Z A;  1JWM D;  5IGG A;  1VQ6 A;  3FHW A;  4YIJ A;  4LW1 A;  1NJI C;  4C3J B;  1VQJ A;  1I5F A;  5IGF A;  1YIT A;  1D1K A;  1FJG L;  2EQS A;  2B2W A;  1EY8 A;  4IZ8 A;  1CUK A;  5DNF A;  2HDL A;  3ULJ A;  3RNU A;  4A3F H;  2QA4 A;  2Y0S B;  2B2Y C;  1VQN A;  2DN8 A;  3NBH A;  3S1M H;  4JYA L;  3CHB D;  3Q8D A;  2K52 A;  2UUB L;  1W6J A;  4ZK9 B;  2V4D A;  1PH6 A;  1AZP A;  4I7A A;  1BUV T;  3ERQ A;  4R8I A;  4QF4 A;  1JJ2 A;  2K1B A;  1PZK D;  3CCU A;  1K0S A;  3A8I E;  1WOC A;  1SYF A;  4QIW B;  4E6I A;  3HG9 A;  1EY5 A;  4IOA A;  1H9K A;  2H5X A;  4B3R L;  2OEO A;  1CHP D;  4NXM Q;  1BOS A;  3DWP A; 
#chains in the Genus database with same CATH homology
 1HPC A;  1LAC A;  3J81 E;  1KTK A;  5LL6 S;  5JEA G;  3N52 A;  1AFP A;  4RHR A;  2A73 B;  1CTM A;  3S1Q B;  3H94 A;  1DZ1 A;  1F2L A;  2QIL A;  2B2Y A;  1F2Z A;  3PUX A;  2X6G A;  4KD4 A;  4OHJ A;  2F0V A;  2A6H D;  3C1E A;  2IT1 A;  5FOB B;  2OXP A;  1EIG A;  1KDA A;  3KK7 A;  2FMM A;  1ET6 A;  3D3R A;  2OF1 A;  1VMP A;  5ELE A;  5IGE A;  1LT4 D;  3VYS A;  1HXY D;  1I50 B;  3RZO B;  1H9M A;  1H9R A;  4RWS C;  4DF7 A;  1DON A;  4KK7 A;  3LX0 A;  2X6L A;  3S9W A;  5TSS A;  1HA6 A;  1OXV A;  2DY8 A;  3LNN A;  5KND A;  3A7L A;  2F0M A;  1ESF A;  5I2X A;  2A6E D;  1SBB B;  1JOR A;  1TWG B;  4DXF A;  3HGB A;  1LT5 D;  2B39 A;  4A93 B;  2Z8L A;  4Q5V A;  4KKS A;  4F88 A;  1GUW A;  1V1P A;  1QE6 A;  2TSS A;  3L9A X;  1KDB A;  1FD7 D;  4ME5 A;  1JC7 A;  3URY A;  1U4R A;  4DGZ A;  4DN4 M;  5FLX E;  3M4O B;  1UUP A;  3Q6S A;  4ZAI A;  5CC4 A;  3QO2 A;  3QG1 A;  2AQ3 B;  1B44 D;  3IKJ A;  2EYF A;  2EYL A;  2XWJ B;  2B8F A;  1HUM A;  3SEB A;  1XX8 A;  3K57 A;  4RKB A;  5CV4 A;  3MFG A;  3GTK B;  2OT2 A;  1OXT A;  1IKL A;  2FHT A;  5EPL A;  3TN2 A;  2PZU A;  4UAI A;  3EJI A;  4KHZ A;  2I46 A;  3K6O A;  3UI2 A;  1EEI D;  5ISR A;  5ELC A;  3QB3 A;  2BDN A;  4ABN A;  5C3X A;  3GTQ B;  3KLR A;  1EFI D;  3S15 B;  1I4H A;  1STE A;  2JP1 A;  1JQY D;  4IUR A;  2EXZ A;  4OO1 I;  1U4P A;  5I9O A;  4V19 0;  2BDO A;  1HQM C;  2F0W A;  3E5S A;  2MHV A;  1CQV A;  4FVM A;  2EYO A;  5KIX A;  1BQQ T;  1SE4 A;  1TU2 B;  4H7B A;  1Z6H A;  3J7Y W;  2IL8 A;  1G2S A;  2KOL A;  2NVY B;  3S14 B;  2VUM B;  2K7V A;  1WTV A;  3PUV A;  4MHE A;  1O80 A;  1ROD A;  4QCL A;  1OXX K;  1F2Y A;  4BA1 I;  3D4R A;  3GTO B;  2B2U C;  2AWO A;  1EY4 A;  4UDU C;  2K32 A;  3C46 A;  1TS5 A;  2B8G A;  5I6Y A;  4XTC S;  2F3V A;  2MUY A;  2M00 A;  1I6H B;  5T1G A;  4XQQ A;  1LTS D;  1DM0 B;  1B9M A;  4KD3 A;  2XRS D;  2NZ1 D;  4HR7 B;  2B2T A;  2DNC A;  4FNF A;  3K59 A;  1LTT D;  1CQF A;  2EYP A;  1RKN A;  1E2W A;  4KV6 A;  4KJN A;  2F03 A;  5JOB A;  3FPU B;  3S1M B;  4XYO A;  1ML0 D;  1SYG A;  3HKZ B;  5C0X H;  3MTS A;  3BYY B;  4C3H G;  3I90 A;  1HFG A;  3JAM E;  2LMC B;  4ID6 A;  4IN3 A;  2K5W A;  4IFD H;  1XXG A;  2R93 B;  3EA6 A;  3G6J B;  4F7X A;  1A3T A;  4X3T A;  1I4G A;  3V05 A;  1B9N A;  1EWH A;  2HQE A;  2B2V C;  2B2T C;  5E1F A;  1BNZ A;  1ENF A;  2NBF A;  3M7G A;  3ND8 A;  1V43 A;  1C4Q A;  1BCP D;  2KA7 A;  1TWC B;  3K7A B;  1NUC A;  1ZYR D;  2F0T A;  2R3Z A;  1BCP F;  2JE6 I;  4ZQ3 A;  3HOU B;  3U9S A;  5LHY 1;  1QWY A;  2AQ2 B;  5D14 A;  3I4N B;  4C3J G;  1EIH A;  3CRK C;  4C3I B;  1F9S A;  5EPJ A;  2K01 A;  4RCO A;  5M5W B;  2SNS A;  1KAA A;  3VYR A;  3OPO A;  3R2T A;  5C4J B;  1FR3 A;  5JEA H;  3M4Y A;  1S4Z A;  2E75 C;  2Z4H A;  5AFW A;  3KF8 A;  1F9Q A;  1JOK A;  1SEB D;  1X32 A;  3D8G A;  1K8M A;  3T4A C;  4I7Z C;  3HOV B;  3I72 A;  5JPN C;  1PZI D;  1STG A;  3IL8 A;  3LWU A;  1STA A;  1B3A A;  3SE0 A;  3PIO 3;  5CV7 A;  5C4X B;  4ZKB B;  1NR4 A;  5CR3 A;  2F0J A;  2XWB B;  3S2H B;  4K5X A;  3SR1 A;  2JSO A;  2A6H C;  2Q8R E;  2RQX A;  4KMU C;  1R9T B;  4KTA A;  2JXM B;  1LTR D;  2HUG A;  1AN8 A;  2N55 A;  1SYC A;  4Z9C B;  1BCP B;  1O78 A;  4BY7 B;  1KDC A;  2H4O A;  5EKK A;  1Q12 A;  2DY7 A;  2KEE A;  5IT9 E;  4L8J A;  4A3K B;  3BVG A;  2QKI C;  3GD7 A;  5I2Y A;  1A2T A;  3I4M B;  1QCB D;  5IGB A;  2K03 A;  1G2T A;  1DOK A;  1OO9 B;  1J8I A;  4HSV A;  1HHV A;  3H91 A;  2NN6 H;  1IL8 A;  5CV8 A;  1Q8I A;  2A68 C;  1RD9 D;  2F0G A;  3EFX D;  3NWT A;  3J80 E;  2IPK D;  4C3H B;  1FGB D;  1PTO D;  4CHT B;  2PCF B;  2X69 A;  3VYT A;  3CRL C;  5BN3 A;  3OIQ A;  1IKM A;  2F0D A;  4IUV A;  1SNO A;  2FJ2 A;  3NK9 A;  1BR9 A;  2EJF C;  2JEB I;  1EQV A;  1F77 A;  3MAQ A;  4HED A;  3S1N B;  1MBY A;  1EWC A;  2J7Z A;  2QDB A;  4LJZ C;  3GTP B;  3GP7 A;  1VF5 C;  2K28 A;  1OXU A;  2QF7 A;  2Q8I B;  1U4M A;  1JOQ A;  1ILQ A;  3OW7 A;  1SNM A;  1GUO A;  5EQ0 A;  3LWE A;  1EZ8 A;  1FNW A;  5K5P A;  1SFO B;  2EZV A;  1E2V A;  5T1I A;  2F3W A;  4ZRZ A;  2C9O A;  1ET9 A;  2SNM A;  3JAM L;  3FKI B;  4OO1 G;  1HA5 A;  3T16 A;  3W3A A;  4V0B A;  1LT3 D;  4I65 A;  1TS2 A;  3IAY A;  2K05 A;  1F2M A;  3VYU A;  3NBI A;  1Q90 A;  1AZQ A;  1LO5 D;  1S5B D;  2RA4 A;  4G7H C;  4RGO S;  1ZXT A;  1E2Z A;  3NE5 B;  2PZW A;  1DOL A;  2ZXR A;  1M4V A;  2KQ3 A;  2CQA A;  1LV9 A;  1GJX A;  4XDX A;  3MXG A;  1CA5 A;  2HCI A;  5EPK A;  2KED A;  1TWA B;  1MSG A;  3C1F A;  3VR6 A;  1WTR A;  2HCC A;  4GZY C;  1QNK A;  1C8C A;  4XT3 B;  4ZKC B;  4FXK C;  4IQZ A;  1Y1W B;  4H44 C;  3C2P A;  2B2U A;  2NVQ B;  2ZT9 C;  2KEC A;  1NCV A;  1HTL D;  2L0C A;  2M9V A;  1KNE A;  4QMG A;  4WRD A;  2E76 C;  5D3D A;  4HTH A;  4K2L A;  5EGT A;  3P75 A;  1SSO A;  1A3U A;  4K6L A;  3PUW A;  2KCC A;  4C3I G;  1DOM A;  1DXM A;  2L1B A;  4S3S A;  5M5Y B;  2BA0 A;  4Q0F A;  4IFD I;  2RSN A;  3HOZ B;  1VF7 A;  2J0T D;  3DM1 A;  4NMZ A;  2EVB A;  1SNQ A;  1TS3 A;  4R8N A;  4RAU C;  1LTB D;  4TQU S;  1I4X A;  1SYD A;  1STH A;  2FMC A;  1Y8O B;  4NKL A;  3PMF A;  1SE2 A;  1UAP A;  1J9O A;  2SDF A;  4KKT A;  1NR2 A;  5JVH 3;  2Q8T A;  4F87 A;  3OSO A;  2O4X A;  1VCI A;  3VR5 A;  4H13 C;  5EJW A;  1F9P A;  2F0L A;  1KNA A;  3NWS A;  4N9P A;  3R2I A;  1TY0 A;  4KKU A;  3VR3 A;  3VA7 A;  2A6E C;  3MWY W;  3K5L A;  1QIL A;  1XYI A;  4BY1 B;  4AYB B;  2EJM A;  3D4W A;  3TP8 A;  4N9T A;  1KAB A;  1PFB A;  1YNN C;  1Y8P B;  1JOO A;  4X3K A;  1DCZ A;  4K6D A;  1S5F D;  1WCM B;  3S17 B;  2NTS A;  1HFN A;  4BBS B;  1EU3 A;  1QJO A;  3D6C A;  3H0G B;  2R6G A;  5J22 A;  3S16 B;  3T13 A;  4B9W A;  5D65 A;  5JEA J;  4PMB A;  3Q0A A;  3T56 B;  3L3O C;  3E0J A;  3G7L A;  1VDZ A;  1XTC D;  4FXG C;  2C5C A;  4DK1 A;  4KY6 A;  1TVX A;  2F0N A;  3CQZ B;  3MHB A;  2NTT A;  4J6H A;  2O2L D;  4FF4 A;  1CZG A;  1SAP A;  2JA7 B;  2NB0 A;  4KY5 A;  4MIU A;  1B4O A;  4A3D B;  1EYC A;  1PLF A;  3FRP B;  4ILW A;  3FVQ A;  2G9H D;  5E3F A;  3PUZ A;  1ESR A;  1LTI D;  4CGY B;  3R3O A;  1FYC A;  1X3P A;  2BE5 D;  1JWS D;  4J8Q A;  1SDF A;  3DMU A;  1WTW A;  3I73 A;  5JPM C;  1EY7 A;  3SK4 A;  2LY7 A;  1SJE D;  2E2J B;  1A3V A;  4DNR B;  2BA1 A;  1EZ6 A;  2PO4 A;  4IUN A;  3GV3 A;  1R4P B;  2ICI A;  3OMC A;  1IYU A;  2KUM A;  1T5E A;  3DWA A;  5FO7 B;  1SE3 A;  1A2U A;  3DWQ A;  5KNB A;  4PNY A;  1ILP A;  2WAC A;  4IUQ A;  3PV0 A;  3GO5 A;  3D31 A;  4K2K A;  3MA2 B;  4CKC A;  1JWU D;  4PQX A;  3FDT A;  3U9O A;  1RF2 D;  1B53 A;  1K83 B;  2F1M A;  2PW7 A;  5K36 G;  1II3 A;  1SND A;  4IFD J;  1SYE A;  2XSC A;  2AUJ D;  4CKE A;  2PQE A;  4A3I B;  3H3V C;  5FKA C;  4C2M B;  2A69 C;  1EY6 A;  4HN7 A;  2PNR C;  1I4Q A;  3TME A;  3TSS A;  2JA8 B;  1XWE A;  3MVV A;  1SNC A;  4RHS A;  4IAL A;  2F0P A;  1PTO H;  1H9J A;  1WVL A;  2F0K A;  4ZLT F;  2F0E A;  1L0Y B;  2R7Z B;  1BF4 A;  4KJO A;  3NXW A;  4BBR B;  3SK6 A;  4OIJ A;  1WTO A;  1CZW A;  1RCV D;  2F0U A;  4RH6 A;  2F0I A;  1IHZ A;  4NDX A;  1YNJ C;  5C44 B;  1I3Q B;  3HEJ A;  4MN3 A;  2F0H A;  1MGS A;  5HGT A;  1BO0 A;  2AWN A;  1LAB A;  3MXP A;  1PZJ D;  1WTX A;  5C4H A;  4K14 A;  5D3I B;  4RGM A;  5FO8 B;  2B63 B;  3GQB A;  1K8O A;  4X3S A;  2D2C C;  1RHP A;  1EU4 A;  2WAQ B;  4XQJ A;  2WP8 J;  4LK1 C;  2O5I C;  2A5H A;  3IFD A;  5IOC A;  2D5D A;  3BS1 A;  3A56 A;  3I3C A;  1TII D;  5J1Z A;  3Q23 A;  2Z1C A;  4K8J A;  2F0O A;  2EYJ A;  4FP5 D;  3BDC A;  5KGU A;  2RVL A;  3M3Y B;  3HOX B;  4CBV A;  5JAV A;  1EY9 A;  2VB2 X;  1Z7T A;  3OWE B;  3SXH A;  2KHS A;  2ZXP A;  5DM7 3;  2Z4I A;  1E0B A;  1GHJ A;  1PRT C;  2KVM A;  4RGT A;  1TWF B;  5HUR A;  1PRT B;  2EJG C;  3NQT A;  4KY7 A;  4DU9 A;  4LMQ D;  1BXT A;  1RTO A;  2E2D C;  1EOT A;  4HSP A;  4ZUJ A;  4A3B B;  5F2D A;  5A2Q E;  4G7O C;  3L7Z C;  2CW0 C;  5COY A;  4K5W A;  2SEB D;  1PXU A;  1CFM A;  2RBM A;  3MC0 B;  4PV1 C;  3R8B A;  2YYZ A;  4DAV A;  5EBC A;  3DEP A;  3D4D A;  2A74 C;  2FFK B;  3TP5 A;  3T53 B;  1PFN A;  3NTK A;  4M1U B;  2K33 A;  4OIK A;  4A3G B;  1G29 1;  3VA5 A;  2VNU D;  4OGQ C;  5C3E B;  1V1P B;  3MEH A;  3C3L A;  4DAY A;  3RLF A;  2BCO A;  5BN4 A;  1SMY C;  1Z47 A;  3J7A V;  3P7J A;  4ZUI A;  3NUC A;  5EBD A;  2E74 C;  2WIN B;  2L11 A;  3HZX A;  3K5N A;  1EQT A;  1NAP A;  2F0S A;  3WOE A;  1QG7 A;  4OL7 A;  1H9S B;  3HRZ C;  4JBW A;  1GUN A;  4H0L C;  1LT6 D;  1D1I A;  3NSW A;  2EYM A;  2XIW A;  2WKD A;  3NQI A;  4BA2 I;  2XN9 C;  4XQN A;  1L0X B;  3W2D A;  3GTL B;  1QNU A;  1D5M C;  4QUC A;  1M8A A;  3BYT B;  5KNC A;  1IW7 C;  1LLR D;  1HRJ A;  1D6E C;  3HOY B;  1IW7 D;  3I91 A;  2CW0 D;  3QWN A;  4QUF A;  2NUC A;  3X3N A;  4CKB A;  1OXS C;  3QOL A;  2R92 B;  5CBA E;  2EY6 A;  2MJ8 A;  1A15 A;  5DEH A;  3SDZ A;  3H6M A;  1GOZ A;  3TDQ A;  1RTN A;  4KN4 C;  1JE4 A;  1SJH D;  3SVM A;  1PYW D;  1TQO A;  1H9S A;  1EL0 A;  5M5X B;  5ELB A;  5IT9 L;  3GV6 A;  4C1N K;  4WFN 3;  1RJT A;  4TSS A;  4C1N I;  4DAP A;  3TP7 A;  3P1H A;  5G3L D;  4CJ1 B;  2ICE C;  2F0Q A;  3K0Y A;  2RDF A;  2TMP A;  1HTP A;  1ENC A;  1PDQ A;  4CJ0 B;  3A55 A;  1SMY D;  5IOD A;  5C3W A;  4RKL A;  3I4L A;  5C0X J;  5CMD A;  5FLX L;  3BVM A;  1I6V C;  1QB5 D;  5EKI A;  1I4R A;  1STY A;  4XXE A;  3NHH A;  3J7A F;  1ICW A;  3SK5 A;  1U4L A;  2ZXO A;  2EE1 A;  2EDG A;  4PMW A;  3TP6 A;  3KBG A;  1KLU D;  1ZYR C;  3MXN A;  4A3E B;  5C5L A;  2EY1 A;  5FK9 C;  5A35 A;  4A3J B;  2I07 B;  3J81 L;  1HQR D;  3OIP A;  1JIC A;  2PW5 A;  1PFM A;  3M7N A;  3E6Z X;  1DD2 A;  3S2D B;  4XIG S;  3ZYY X;  1PTO C;  1CI3 M;  3PIP 3;  3OOC A;  1F9R A;  5FO9 B;  1WTQ A;  1PRT D;  3ONA B;  1V1O A;  1I4P A;  2K6A A;  1LTA D;  1HUN A;  1RDP D;  4XT1 B;  1SXT A;  5A2Q L;  2JYO A;  4C56 C;  2G9D A;  3TZD A;  3A54 A;  4U67 3;  4RFB A;  4X3U A;  3A7A B;  3OWF A;  1ZEQ X;  1X3Q A;  1G91 A;  1D5Z C;  4ODG A;  5CV6 A;  2XNA C;  4EVO A;  4FF3 A;  2YU9 B;  2IX3 A;  2RDG A;  1S5E D;  3TZU A;  5KYI A;  1MSH A;  3FMC A;  1SNP A;  4TRD A;  1UEA B;  4HCE A;  1Y69 U;  4EGV A;  3TBI B;  1QOH A;  5JVG 3;  1O7Z A;  1UNS A;  2RKS A;  4DXG A;  2ENB A;  3ND9 A;  3RZD B;  4G7Z C;  5C0X I;  3KLS X;  4QB4 A;  3SK8 A;  2M2L A;  1V8Q A;  2A69 D;  3K5M A;  3S1R B;  1TS4 A;  3MXU A;  1AW7 A;  5CV9 A;  1GHK A;  2E2I B;  1S5C D;  2LKV A;  2B2W C;  5KEE A;  5KYL A;  1Y8N B;  1TKW B;  3CU7 A;  1G6Z A;  1TWH B;  2SOB A;  1CM9 A;  1CA6 A;  4CJ2 C;  3MZ5 A;  4KI0 A;  1ZKO A;  1BDO A;  1U9R A;  4WOR A;  5LL6 X;  1IYV A;  3ERO A;  1B2T A;  1LTG D;  4IFD G;  5CYU A;  4J1M A;  2WKC A;  1EY0 A;  2O5J C;  4K8I A;  2LS0 1;  1A6X A;  5KRU A;  4DNT B;  4EQO A;  4NW2 A;  3GTG B;  4R9W A;  2RSO A;  2IW3 A;  2IWH A;  2VB3 X;  2F0F A;  3KLS A;  1BBX C;  4F8M A;  4ULL A;  1CK1 A;  4L63 B;  1G8Z D;  3QIA A;  3X3M A;  3EQL C;  3P20 A;  2NVX B;  2K5D A;  3DUZ A;  3NTI A;  1JR0 D;  2J4X A;  2BE5 C;  2L9H A;  4P2C B;  2HDM A;  4IUT A;  1T5X D;  3BDL A;  4OO1 H;  1EYA A;  3I70 A;  2EY5 A;  1PRT F;  3R93 A;  4EQN A;  1O7Y A;  4FF1 A;  4A3F B;  3DEO A;  1KLG D;  3BDO A;  4ZYS A;  2ID0 A;  2PZT A;  3WOF A;  2PYK A;  5NUC A;  4XYQ A;  1NSN S;  4IUU A;  3FPP A;  1CT1 D;  3QOJ A;  3N6R A;  5CBE E;  4IUP A;  3PUY A;  4PMC A;  2NN6 G;  3CKI B;  3RUZ A;  2JA6 B;  3A8J E;  4LAA A;  3F2U A;  1D5X C;  1Y1V B;  3K5O A;  1PTO B;  4BS9 A;  1MD2 D;  2MPM A;  3I8Z A;  4O42 A;  1S5D D;  4M8A A;  3BG3 A;  1SYB A;  1WTP A;  3QJY A;  2CVR A;  4KHV A;  2WV6 D;  2BOS A;  1WD1 A;  5I4D A;  1GXD C;  3HS0 C;  3A8K E;  1BCP C;  1DYQ A;  3BZD B;  2E2H B;  2XRQ D;  1Q1B A;  2D9U A;  4BWG B;  3T51 B;  4EQP A;  4L6T B;  3NP8 A;  2R61 A;  3FEW X;  5E4W C;  1JB3 A;  3IFT A;  2H1E A;  4FXD A;  4TKO B;  5CV5 A;  4B9X A;  2GA4 B;  1Q1E A;  2IX1 A;  4FO2 A;  4DFA A;  3SHL A;  2AQ1 B;  1YNN D;  2KJX A;  1GUS A;  3D6W A;  3GTJ B;  5DM6 3;  2A68 D;  2EYH A;  3HP3 A;  3PO3 B;  5IIF A;  2QCP X;  3O13 A;  4O1N A;  2VXW A;  2IX0 A;  5IGC A;  3AMU A;  5J39 A;  1AEX A;  3BVZ A;  3V2T A;  4G57 A;  2L4N A;  2D62 A;  2QEJ C;  3MFY A;  3AB9 A;  5ELD A;  2PMZ B;  3RMH A;  4KN7 C;  4HMI A;  4JK1 C;  2EY2 A;  1STB A;  3EVQ A;  4DK0 A;  1MI2 A;  5M3F B;  2JEA I;  1C48 A;  2MP1 A;  1CHQ D;  4WJW A;  2AUK A;  2K5Q A;  3KUP A;  1STN A;  2LFN A;  5C5M A;  5M3M B;  2L55 A;  5C0X G;  3OMG A;  3NPP A;  1JCK B;  1B1Z A;  5CGK A;  2NN6 I;  1GUT A;  5I6W A;  4RGN A;  2EOT A;  3M85 A;  2XVS A;  1O7L A;  2K04 A;  5I9P A;  5ELF A;  5DAU A;  5K36 H;  2L5T A;  3J80 L;  5BN5 A;  2N88 A;  5G3L F;  3K58 A;  1FNV A;  1W6K A;  3AU7 A;  3V96 A;  1TR5 A;  2WB1 B;  1R4Q B;  2CHB D;  3DHQ A;  1AP0 A;  5M9O A;  3KBX A;  3VR4 A;  1PTO F;  5IGD A;  1B50 A;  3OHX C;  4RCN A;  1EEF D;  1ENA A;  1TT2 A;  4HMJ A;  2NVT B;  1DJR D;  4A3M B;  2DNE A;  2WII B;  2RDH A;  1GUG A;  1D2B A;  3VR2 A;  1TY2 A;  4U68 A;  2MGS A;  2KCN A;  5C6A A;  4G4K A;  4Y7N B;  3HOW B;  2EPB A;  2L12 A;  3RD4 A;  4HAE A;  2IJ0 A;  1VMC A;  1FNU A;  5JJZ A;  5E4X A;  3H09 A;  4B08 A;  2FIN B;  3Q24 A;  2NWG A;  4NP5 A;  1PMR A;  3Q22 A;  2F4I A;  5C4Z A;  4FF2 A;  5COR A;  4RA8 A;  4HCS A;  3DXJ C;  2NYZ D;  1WD0 A;  1YNJ D;  2B2V A;  2PPB C;  4DA2 A;  3PO2 B;  1EYD A;  3GTM B;  1HCZ A;  3WDN A;  4K5V A;  2JA5 B;  4FYD A;  3ITP A;  1ONL A;  5EKL A;  3NTH A;  1Q3L A;  5IGG A;  1JWM D;  4YIJ A;  4C3J B;  5IGF A;  1D1K A;  2B2W A;  1EY8 A;  4IZ8 A;  5DNF A;  2HDL A;  2Y0S B;  2B2Y C;  2DN8 A;  3NBH A;  3CHB D;  1W6J A;  4ZK9 B;  2V4D A;  1AZP A;  1BUV T;  3ERQ A;  4R8I A;  4QF4 A;  2K1B A;  1PZK D;  3A8I E;  1SYF A;  4QIW B;  4E6I A;  3HG9 A;  1EY5 A;  1H9K A;  2OEO A;  1CHP D;  1BOS A;  3DWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...