1PFBA

Structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for specific binding of Polycomb chromodomain to histone H3 methylated at Lys 27.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Peptide binding protein
molecule keywords Polycomb protein
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfbA00
5T1GA 4IUQA 1HFGA 1WTQA 1B53A 3KBXA 5EKIA 5D65A 1WTOA 1KNAA 2B2UC 1IKMA 1NR4A 2H1EA 2M2LA 3FPUB 5CMDA 4X3UA 3I90A 1U4MA 4MHEA 1J9OA 1IKLA 1MGSA 4QUCA 5EPKA 4XDXA 4CJ1B 2B2VC 1DOLA 5EQ0A 4QUFA 1WTVA 1SAPA 3N52A 4HAEA 5E4XA 2XIWA 2L12A 2B2YC 1G2SA 1WTPA 3P7JA 2KUMA 5CBAE 1AZQA 4U68A 2DY8A 3HP3A 4DN4M 4ZKBB 2VXWA 2FJ2A 1PDQA 4RA8A 4IUVA 5E4WC 1F9RA 1NAPA 2K01A 3I3CA 2N55A 2D9UA 2NWGA 1QNKA 2B2VA 1CA5A 5EJWA 4MN3A 2FFKB 2JYOA 1EIGA 5DNFA 1WVLA 3MTSA 2B2WC 1WTRA 1KNEA 3H91A 1PFMA 1B3AA 4IUTA 2MPMA 2K28A 2R3ZA 1A15A 1G91A 1Q3LA 1ILQA 1ZXTA 2Q8RE 1M8AA 1SSOA 2L4NA 4X3KA 2L9HA 1F9PA 2RSOA 1ML0D 1HUMA 5JJZA 1U4PA 2EOTA 2B2WA 5D14A 2B2TC 1DZ1A 1CA6A 1MSGA 2RSNA 2KECA 1RTNA 1HA6A 5CBEE 1IL8A 3D6WA 4O42A 1G6ZA 1TVXA 2RVLA 3ONAB 1BO0A 1WTWA 1X3PA 2FHTA 1ESRA 3Q6SA 4UAIA 4RAUC 1WTXA 5T1IA 1E0BA 3G7LA 1CM9A 4IUUA 1HHVA 3TZDA 2DY7A 2B2UA 1G2TA 2K03A 1RTOA 5EPLA 2X69A 1SDFA 4R8IA 2K04A 2BDNA 1F9SA 1AZPA 2X6LA 1HRJA 2HCCA 1VMPA 4LMQD 3TN2A 3MWYW 2NZ1D 1VMCA 1F2LA 1X3QA 2SDFA 3R93A 1PFNA 2NYZD 2J7ZA 2EE1A 2B2YA 1U4RA 1RODA 2FINB 1O7YA 4ZK9B 2N88A 2EPBA 3IFDA 1B50A 2HDLA 4X3SA 1DONA 3SVMA 1J8IA 1EL0A 1BBXC 2KEEA 1PFBA 3LWEA 2IL8A 3GV3A 4XT3B 1JICA 1QG7A 2KOLA 3I8ZA 4IUPA 1AP0A 1DOKA 1MI2A 2K1BA 4XT1B 1WD0A 3UI2A 1JE4A 1B2TA 3F2UA 3I91A 2KEDA 4OIKA 4OIJA 4ZAIA 2X6GA 1F9QA 1B4OA 2FMMA 2HUGA 3GV6A 4HSVA 1LV9A 2HDMA 1NR2A 3DEOA 4HCSA 4RWSC 1MSHA 2CVRA 5AFWA 1HUNA 1WD1A 1O7ZA 1RJTA 1EOTA 3KUPA 4ZKCB 1EQTA 5COYA 4CJ2C 3DEPA 1XX8A 3IL8A 4ZLTF 1BF4A 1GUWA 4X3TA 5CORA 2L1BA 4CJ0B 1EIHA 2RA4A 1QE6A 2MP1A 1RHPA 1PLFA 4HEDA 1XYIA 2B2TA 2KVMA 1O80A 2HCIA 1S4ZA 2JP1A 2MJ8A 4IURA 1DOMA 3DM1A 1U4LA 1C8CA 1X32A 1HFNA 2L11A 1ICWA 5EPJA 1NCVA 1BNZA 3FDTA 4R9WA 4NW2A 2Q8TA 3QO2A 1ILPA 2K05A 2MGSA
chains in the Genus database with same CATH superfamily
5AJ3L 4Y7NB 2DNEA 2F0GA 3U9OA 2M2LA 2JE6I 4Y52H 3GTOH 5DLQE 3H09A 3TBIB 2MNAA 2ES2A 4F7XA 1NE3A 1IBLQ 4A3KB 1BBUA 1K9MC 4UHVA 3KFUA 4XTCS 2KUMA 4DXGA 4LF4L 4C3IH 2F0NA 3S15B 1PDQA 3VR3A 1GM5A 1SYBA 2UXDL 2A6ED 1H9SB 3A8JE 2K5WA 3H91A 2CCZA 2R3ZA 4IFDI 4ZUIA 1VQOA 2Q8RE 3TP6A 3BJUA 2K5NA 3MFYA 4C3JG 4V0BA 2P5ZX 3NELA 2I0QA 3UDIA 3TP7A 1GUNA 3S1QH 5J22A 3CRKC 3RN5A 4N9TA 1XXGA 1IHZA 2EYLA 1STEA 1VQDA 1PZKD 3QB3A 2YU9H 3KYHC 3D4RA 4F8MA 3M7NA 3U58A 4POFA 4DPGA 1N33Q 1V43A 2DY7A 2Z6KC 5KNBA 1A62A 4N9PA 3SR1A 3Q24A 4JI6L 2E5LL 1TXYA 1U0LA 5EBDA 1L0YB 1KRSA 1VQNA 4LMQD 1R9TB 1QZHA 3J81c 1HJPA 4BBSG 1X3QA 1CKNA 3HOYG 5M3FH 3FVQA 2EE1A 4KI0A 2AQ3B 1OTCA 2I5MX 3EVQA 4DUZL 1V1QA 4UY8C 3CXCA 4XT3B 1JCKB 2KOLA 3L3OC 2K1BA 4XT1B 1ESFA 2JJQA 5LHY1 1H9MA 1E24A 2HDMA 2JA7H 2PW5A 5JPNC 3L2PA 1TWCH 2XWJB 2E2JB 4GS3A 4QY7A 3DEPA 1K73C 1Y8PB 1EEID 5CORA 2ZXOA 1NUCA 2YTXA 5JEAG 1IW7D 2RCNA 2A68C 3K0YA 3UE1A 4JI0L 3I4MG 4LFAQ 5IYDH 4N8X1 3GTGH 3D4WA 1SE8A 4R4IA 1NTGA 5K36H 2JA5B 5JJKA 3HFZB 3EJIA 3T16A 5IIFA 4A3JG 2XVSA 1TWGH 1KNAA 1IKMA 4YWMA 3OIQA 1A3UA 1IBKQ 4GOPA 3E9IA 5KYIA 3N52A 4PV1C 1G8ZD 1TWFH 4B08A 2UXDQ 1NMFA 2WKCA 3PV0A 1VQMA 4GOPB 1I6HB 3R2TA 2VQEQ 4U68A 5M5XH 4A3DB 4CDFC 5E4WC 4IUVA 1T9HA 1OO9B 1XMOL 4GZYC 3M9BA 1QNKA 4V190 4X66L 4A3JH 1HZ9A 3A7AB 4R1JA 3GTQB 3X3MA 4K6DA 3PMFA 1PYBA 1ZXTA 1M8AA 4U673 2RDHA 3OOCA 1K28A 3NUCA 4M8AA 4OONA 4DAVA 2GA4B 4EQ5A 2IPKD 2VUMH 4IQZA 1B7YB 4G4KA 4UDUC 1ENFA 1TWGB 4YIJA 5H1SE 2A8VA 3AYHB 3Q6SA 4RAUC 3J81E 1CM9A 1SMYD 4IUUA 4LF7Q 4H0LC 1VQKA 3J7AF 1YJ9A 2EVBA 4JI5Q 1RTOA 1HZCA 2RKSA 2ZTCA 1E3PA 2HT1A 4IALA 3DLLA 4IPGA 2OF1A 1EY9A 2F0HA 1BQQT 1VQAA 3AFPA 1N34Q 4IJLA 2E8GA 2IHFA 1PFBA 1H9RA 2F0IA 4FYDA 1A63A 2XGTA 2F0JA 4JV5Q 1QJOA 4RGOS 1RKNA 4DV7L 3T4AC 3T13A 1S5BD 1STNA 1HTLD 5EPJA 1B4OA 4ZLTF 4TKOB 2F0VA 2CVRA 2N78A 4ZKCB 2HIVA 1EQTA 1GOZA 4OO1G 4KJOA 5FLXL 3AQQA 2Z4HA 3PIP3 4A3FG 1GXDC 4GN5A 1HFNA 3JAML 4MIUA 2UXBL 4Q0FA 2GVAA 2ZXPA 3U9SA 4J1MA 5BN5A 5L37A 4BBRB 4O0AA 2WB1E 5D65A 1R4QB 1LT3D 1X54A 4JI3L 5ELBA 1Q1EA 3D3RA 1IKLA 4APVA 2H4OA 2B2VC 5AJ3Q 1XMOQ 3TP5A 2F0TA 1PZJD 4B3RQ 4IUNA 3FRPB 1WCMB 3DM3A 2UUBL 3J80L 4WFN3 1YI2A 5GADC 1SYFA 2NB0A 3MC0B 4RGTA 1SEBD 3IRBA 1MJCA 2N55A 2C5CA 4RHSA 2FFKB 3I73A 5DNFA 3RR5A 4AH6A 3I4NG 4IUTA 3FEWX 3HOWH 3NBHB 2IX3A 2L4NA 3J7AV 2MHVA 1LT5D 4KN4C 1VQFA 1YHBA 1CHQD 2BCOA 2QKIC 2EOTA 1EYDA 2GVBA 1SMXA 4EQPA 5HGQA 1HNWL 2YU9B 2IHEA 4PQXA 2MQHA 3PUWA 3CCRA 1G6ZA 3S1QB 5FO8B 1BO0A 3PO2B 2GN5A 1FNUA 3KF6B 4KD3A 2CH4A 1L1OB 2NZHA 1GHJA 2R7DA 1S5DD 4MZ9A 2ZT9C 4L5QA 2NZ1D 1ET6A 4A75A 5C4ZA 1RDPD 1ZYRD 4K14A 3GTKB 1VQ7A 1GJXA 1W6KA 3M3YB 4A3CH 2EPBA 3SVMA 1TS5A 5FLMH 2XSCA 1RIPA 5JOBA 4QJFA 2IJ0A 5IOCA 2PNRC 2WP8J 5I2YA 2DNCA 3UI2A 1Q1BA 2R93H 4H44C 2UUCL 1A8VA 4DV5Q 1HNXQ 1PZID 2F0WA 1K8AC 1H9KA 3DWQA 5JJLA 4CJ0B 4C3JB 5C4JB 1SJHD 4HEDA 1XYIA 4ZUJA 1Z47A 4PMCA 1SNOA 5ELOA 3KK7A 2F0QA 2MJ8A 4K5XA 1EZ6A 4DV1L 3A8IE 1UE6A 1ICWA 1EY8A 1K83B 3FDTA 4LF8Q 1K3RA 2DGYA 4L5TA 1SJED 1Y1VB 2A6HD 3UE0A 1E2ZA 2F0SA 1N32L 2EYOA 3EBEA 3HOWG 1Q12A 1FR3A 1G291 4QUCA 4HJ5A 3RZDB 2SOBA 1NBWA 3P1HA 4JI8L 4A3IG 3NTIA 3K7AB 2FJ2A 2F0DA 4C2MB 3GP7A 4GOPC 4AQYL 1XTDA 4QB4A 5C4JH 2AQ1B 2EDGA 4NB3A 1XNRL 3FKIB 2I46A 2B2WC 4XQQA 1STYA 3B6YA 2D0PA 1PH7A 1SYEA 1SBBB 3FP9A 3S1RB 2CQAA 1PTOH 4X66Q 2PI2A 1BCPB 1PA6A 4DK0A 4QF4A 1ML0D 4DR6L 1F2MA 1O7LA 1CA6A 2N3SA 3BZKA 2J0TD 3KLSA 1PYSB 5HGTA 5CBEE 4DR2Q 4TRDA 1T5XD 4JI2L 1C4QA 5LMNL 3T56B 2UXCL 4ULLA 4LFBL 1AZPA 3BU2A 1S72A 3JAMi 2DUDA 3KDFB 2I5LX 2J4XA 3TN2A 1IXRA 4DR4Q 2M00A 1LTGD 3J80c 4JI6Q 2FXQA 3S2DH 4BY7H 1W2BA 3A5UA 1E22A 1KQSA 5I4DA 4EQNA 5IGDA 1PTOF 1JICA 2Q8IB 1Z7TA 1VQHA 1PXUA 1B2TA 3I4MB 1V1OA 1F9QA 1PH4A 3SE0A 3ULJA 4BBSH 5CV7A 5AFWA 3K7UC 1O7ZA 2R7ZG 3CCLA 3JAMc 5GROA 2EYFA 2QA4A 2YTVA 1II3A 4A3LH 1J6QA 4BY1G 2JA6G 3Q8DA 1I50H 5IYDG 5C0XG 3H6MA 1EEFD 2L11A 4FF4A 4HN7A 2EYMA 4R9WA 2JA8B 1DYQA 2WAQE 4DAPA 1U9RA 1IYUA 1AH9A 3H0GB 2K5VA 5IT9E 1NNXA 2JA7G 4HTHA 2K7VA 3TP8A 4KY7A 1Q82C 4DR1L 4BBRH 4DR5Q 1WTVA 2XIWA 4J6HA 3MXPA 1WTPA 5C44H 2E75C 3KJOA 3HEJA 3RUZA 4ZKBB 1NAPA 2D9UA 2NWGA 5ELDA 4KHPL 2QEJC 2HHHQ 2JYOA 5ELFA 3K81C 1KLGD 1RL2A 2AMCB 1E1TA 1PFMA 2EJGC 1PH1A 1HZAA 2ICEC 1A15A 1PV4A 2EIFA 1QVCA 2NBFA 4X3KA 2VL6A 2HIXA 2VB2X 3DHQA 2QDBA 1UEBA 2AWOA 4AYBB 5M9OA 4ZRZA 1EIFA 1EY7A 2OQ0A 2RSNA 2D62A 1RTNA 1D5XC 5KGUA 3J81L 1JJGA 1Q86C 2A6HC 2JA8H 2QCPX 4QL5A 3SK4A 4EX5A 1VF5C 3GTLB 5ELEA 3NBHA 2IX0A 1K0SA 4HIOA 4R8IA 3MXNB 3TZUA 1S40A 2K50A 1F2LA 1XMQL 3HKZB 2F0UA 4A3EH 4L5RC 2AUKA 3MHBA 2A19A 3DUZA 2IL8A 4R4OA 1PH3A 3UDFA 4PZ7A 5CV4A 3HOUG 3OTOL 1Y8OB 3GTLH 2ZXRA 2RHSB 4MTKA 1JE4A 1QB5D 1KLUD 2K6AA 4ZAIA 4JI1L 1MD2D 2FMMA 2XN9C 4FNFA 5C0XI 1EIYB 5COYA 5IGEA 5DEHA 4A3EG 1TS3A 1PH6A 3VR5A 1X3EA 3CCSA 1HNXL 2R7FA 4A3FH 5C3XA 2JP1A 3CHBD 4C3HG 3DM1A 4UP8A 1LUZA 1OXXK 4QCLA 2NVQH 3ULPA 3QO2A 4BA1I 3VYUA 3E3XA 1L1OC 1HFGA 1Q46A 4ILWA 1ZKOA 1KHIA 3GDEA 4RFBA 1YHQA 2F4VL 3TEHB 3KF8A 2UU9Q 1WTHA 4P74A 4LF6Q 4DR7L 2EXZA 2HQEA 1K0RA 4HCEA 2ASBA 3CC2A 2Z1CA 1Q8KA 5IWAQ 4FF2A 3VA5A 4DR3Q 3GTGB 4XYOA 3CP0A 1PTOD 1SXTA 5D3IB 3RN2A 4RG1A 2NTSA 2K01A 4GKJL 2OQKA 3SEBA 4DUYQ 1GUOA 2JA8G 1SNDA 1WTRA 3BYYB 3MXUA 4K5WA 4C2MH 1TWCB 1S5FD 4HMJA 5KIXA 4DXFA 2XRQD 3RZDH 4MTNA 1NY4A 1BCPC 4XQNA 1I94Q 4OX9Q 1NSNS 3K5LA 3I4NB 4NP5A 2A1AA 2XNAC 3KF8B 4LJZC 3SK8A 3E0EA 3E0JA 1X3PA 5LL6S 2OTLA 2RBMA 3P20A 5GQOA 1EYGA 4LF5Q 2HD3A 3S17B 4K8JA 3VYTA 5LL6X 2X69A 2UUAQ 3PO3H 3BDLA 4A3GG 1NMGA 2ENBA 4FP5D 2BOSA 4OL7A 2AKWB 4KY5A 5JVH3 4LFBQ 1VQGA 1SNPA 5IGBA 1RODA 2D0OA 4OO1H 4KKTA 5FJ8G 3MXNA 3K6OA 4C3HH 2F0OA 5KEEA 2KEEA 3G71A 1N9WA 2R93B 3CKIB 3NWTA 2VQFQ 3S14H 3NQIA 2VY3A 3BVGA 4X65Q 4AYBE 2F0LA 2YYZA 3CCEA 3C46A 1I6VC 3OPOA 5EAYA 3J80E 1JOOA 2MO0A 5C6AA 1Y1VG 3NE5B 4BXXG 2UUCQ 3D8GA 3I7FA 5JJIA 4YHHQ 4JOIC 5JEAJ 4ALPA 2CFMA 3OW2A 1NCVA 2ZJQA 3HG9A 1PHJA 2O4XA 1Q81C 2K05A 3SK6A 5A2QE 3FKIH 2SNSA 2OXPA 5T1GA 3G48A 4RH6A 3F2DA 1SLJA 2QF7A 4NXNL 4TQUS 2PMZE 2CHBD 2IW3A 1CUKA 2ATWA 1SAPA 5E4XA 4GKJQ 1SE4A 1G2SA 2WV6D 1YNXA 2R92B 3Q0AA 4JBMA 2DY8A 1VDZA 4DN4M 4KKSA 4RKBA 3OHXC 3OWFA 3HOZG 3PIO3 4G57A 3GTMB 4MN3A 1PH2A 1LTTD 4PG3A 4S3SA 1PRTB 3OIPA 4LUVA 3KLSX 3NHHA 1TY0A 1HQRD 1N36L 2PZTA 1KD1C 4OX9L 4DV3Q 3PO3G 1V1PB 1HUMA 1MSGA 5K36G 4OWTB 1KAAA 4LW1A 1JWMD 4LF5L 4LUOA 2ZTDA 4WJWA 5FLXc 2VQEL 3HOZB 1OXSC 4IN3A 5E7NA 1X65A 5C4HA 5BR8Q 1CKNB 3TZDA 1D1IA 2F03A 3G4SA 2K03A 1XTCD 5LMUL 1EY0A 1SDFA 2K04A 3HOVH 1ENCA 1I4HA 4KK7A 4JI2Q 4JC0A 5M3MH 5KYLA 5LMNQ 3MWYW 3K5NA 3RLOA 3BVZA 5IP7G 1Y1WG 5M3FG 1IW7C 1BDOA 5D3DA 4G7OC 2E2DC 3EFXD 4KTAA 1AN8A 1N32Q 1SYCA 2EY6A 4ZQ3A 3PGZA 3PO2H 3IAYA 2DJFC 5C5MA 1RJTA 1IBLL 5JEAH 1HZBA 1BF4A 2LY7A 4PZ8A 4I65A 1LTRD 2NN6H 4HMIA 4A4IA 4WRDA 1EQRA 4GKKL 3J7A5 1I3QB 2JN4A 1BNZA 3W1GA 4WORA 1XWEA 4IUQA 1WTQA 1WTOA 1K3BC 2O5JC 4OXPA 2K5DA 1IYVA 4DR6Q 1MGSA 5ELCA 4DAMA 1UEAB 3MEHA 1WCMH 1L1OA 2CW0C 3A7LA 4BY1H 2JA6H 3TS2A 2B2YC 3QJYA 3J7YW 4DR2L 3LGJA 4B3SL 4LFCQ 1PRTF 4DR5L 5CV6A 3MAQA 1JQYD 5CV5A 3GTQH 5BN3A 1FJGQ 2AWNA 3ZJYC 1LTSD 1G91A 3NP8A 4JI4Q 1LABA 1Q3LA 3HOVG 1W6JA 1NJIC 3EIVA 2V4DA 3H3VC 3BZCA 2CWPA 4X64Q 4C1NI 2BH2A 1DZ1A 3CC7A 4DUZQ 1VQ6A 2E2HH 1IL8A 1DM0B 1TVXA 2Z9HA 4BY7G 1FVIA 3KJPA 3BZDB 4HJ8A 5J3BA 1YVCA 1D1KA 3G7LA 3UDXA 3BYTB 4JI7Q 4FDBA 3D6CA 4CDEC 2X6LA 4R8NA 3CMEA 2RCFA 2K32A 2SDFA 2NYZD 4AIMA 2J7ZA 1GO3E 1U4RA 1STHA 3IFDA 5M5YH 1LTAD 1PRTD 3K8AA 4K6LA 1STGA 4X62L 1G6PA 4OWWB 1IL2A 3MXGA 1A2TA 3I91A 2KEDA 4OIJA 4RHRA 3C3LA 1WYDA 2LMCB 4HSVA 3C1EA 2EJMA 1SYGA 4RWSC 1MSHA 2OTJA 4JV5L 2E2HB 3KUPA 1QVFA 2EYHA 2L1BA 2FMCA 4B3TQ 4NXMQ 4L6TB 1R9TH 1XJVA 4IO9A 1O80A 2HCIA 2NVQB 3STBD 5C44G 3RNUA 2VNUD 3VA7A 2CW0D 4DF7A 2MGSA 4DU9A 3J81j 4A3JB 1D2BA 4DV6L 4IFDH 5CMDA 4CKBA 3I90A 1ASYA 4MHEA 3H0GH 5M5XB 4A3DH 4A3BG 1H9SA 1I6HH 4CJ1B 2LS01 1B1ZA 2K4KA 1IBML 2KCNA 3HKZE 2AUJD 2F4VQ 4IFDJ 1VCIA 3QWNA 2UU9L 1I50B 4IPCA 3OYYA 1J5EQ 2B2VA 3DMUA 3F2BA 3A74A 1KTKA 1EIGA 4BA2I 1B3AA 3ER0A 3V2TA 4X64L 4H7BA 1AFPA 5GAGC 4ME5A 2F0PA 4IOCA 2PW7A 4R4CA 3E9HA 2PNHA 4A3KG 5HURA 1ICFB 1HH2P 5D14A 1EWHA 1P8LA 4RCOA 2KECA 5F2DA 3GTOB 3AMUA 3AFQA 4HSPA 3GO5A 4JOIA 2YTYA 1EFWA 3OTOQ 2CH4W 4J15A 2RVLA 1JOKA 3S16B 2FHTA 2R7ZB 1ESRA 1SFOB 4XXEA 1I94L 2F52A 2WACA 3A55A 3RLNA 3HOXG 3S1NB 1ET9A 1PH9A 3D0FA 3JC66 5KRUA 4LFAL 2B2YA 5LMNW 1Q90A 2O5IC 4PMWA 1EYCA 1B50A 3NWSA 5M3MB 1YIJA 3OMGA 1X56A 1QOHA 2F1MA 1LACA 2KHIA 2IX1A 2AQ2B 1SNMA 1LV9A 3A5ZB 3DEOA 4HCSA 1XNQL 1HUNA 1TIID 3L7ZC 1X3FA 3IL8A 3BDOA 2E5LQ 2Y0SE 4BXXH 1EIHA 4NDXA 1Y1WH 2Q2HA 3BDCA 4GNXB 4A3BH 4DV5L 1GKHA 2Q2IA 3A54A 3QOJA 4IURA 1DOMA 3K7AH 5IGGA 1PYWD 1U4LA 2BH8A 1MKHA 1A6XA 1AW7A 2VUMG 5IYCG 4NW2A 3CCUA 2WB1G 1IBMQ 1EU4A 3WOFA 2F0EA 4DNIA 4IPDA 5I9PA 3O13A 4CDDC 1C7YA 5EPKA 1Y1VH 2RHQB 1IYJB 4A3KH 1K83H 3DWPA 3GTPB 3GTJB 2QGQA 4I7AA 2LKVA 4K2LA 1AZQA 4O2DA 5EKLA 3M4YA 4JI0Q 4KD4A 1JC7A 4QQBX 4A3CG 1KIXA 5IYBH 3J7ZC 4Y7NH 1BBWA 1B8AA 1KRTA 1EU3A 4A3MG 3R8BA 2SNMA 5CV9A 1C9OA 3QOLA 1SSOA 1FJGL 2RSOA 5JJZA 1IBKL 2PZWA 3U4VA 2B2WA 4L8JA 2B8GA 3KDFA 4DK3C 3ITPA 5E3FA 4K2KA 4A93B 2F3IA 1CFMA 4FXDA 2Y0SG 1QUQA 2MFIA 2EYJA 5IY0A 1M90C 1E2VA 2ZTEA 5A35A 1B9NA 4IOAA 1O7IA 1V9PA 3R2IA 1UUPA 1HRJA 2HCCA 4C3HB 3RZOB 2B63B 5IP7H 1YNNC 1S5ED 2A6EC 3HOYH 1XPRA 4KLKA 4X3SA 5FLMG 3T1HL 3CPFA 1CK1A 1EL0A 2KQ3A 3ZYYX 1Y69U 3GTJH 1QG7A 3I8ZA 1PVOA 4IPHA 1C48A 1BUVT 2EYPA 3M85A 1TS2A 1YJNA 2CQOA 4OIKA 4K0KL 2O2LD 3HOWB 1N33L 1WJJA 2CKZB 3SDZA 3I4NH 1EOTA 2KA7A 1XX8A 2NN6G 1LLRD 2RA4A 1LYLA 1MJEA 1Q7YC 4DV4L 5C0XH 1KAWA 2ZJPA 3IKJA 1Q8IA 4POGA 2RDFA 4DFAA 1EOVA 3BVMA 2VW9A 2B8FA 1B53A 4YY3L 1FNWA 2A74C 5I6WA 3ICEA 4DV3L 4KHVA 4JI1Q 1ZEQX 3X3NA 2R92G 3J81i 4M1UB 2EY2A 2M9VA 5EQ0A 1SN8A 2RDGA 4HAEA 2NVXB 1BCPF 3S1MB 2JSOA 4A76A 3HP3A 2OEOA 2VXWA 3I3CA 1A2UA 4OGQC 2E2IH 3P75A 3M3YH 5EJWA 1YNJC 3S24A 2PQAB 3A0JA 4WJ3M 4HR7B 2WINB 1S5CD 1Y14B 5IGFA 4IJHA 1V8QA 3CCVA 1J5EL 4KHPQ 3HOUB 3CF5A 4LWCA 1EZ8A 3A56A 3OSOA 3RLFA 2XWBB 4Z9CB 5KNDA 2WAQB 4GLAC 4P71A 1WCMG 5GAHC 3I4LA 2R7ZH 1D5ZC 5FKAC 3S16H 5G3LD 1G51A 2Z6KA 2UUBQ 5IWAL 2JXMB 3PUYA 4DKAC 1YJWA 4JBKA 1MBYA 3PIOA 1PRTC 5HY6A 1CZGA 2F4IA 1Y8NB 2BA1A 4HJAA 2G9DA 1Z6HA 1UE7A 5CYUA 1EWCA 4YCVA 2C35B 1D8LA 1VMPA 1H9JA 3K57A 2MO1A 1SR3A 3KLWA 3R93A 2NZOA 3D31A 4LUZA 3PF4A 4ZK9B 3MEFA 2EQSA 3TQYA 3HOXB 4K0KQ 1QNUA 1O78A 1RCVD 1BBXC 4LF8L 2VUMB 4UPAA 1VS0A 5EKKA 1X3GA 1AP0A 3PF5A 1S3OA 2PQAA 1CT1D 1OXVA 3F2UA 3EQLC 4OO1I 2ZM6L 2X6GA 1CHPD 4CHTB 3CMAA 4KKUA 4NPSA 3TS0A 2Q2UA 4E6IA 2F3WA 5M5YB 2ALYB 4XYQA 4CJ2C 5C0XJ 1HR0W 2PO4A 2H5XA 4B3SQ 5JPMC 3G6EA 3VR2A 1N34L 2KCTA 1BKBA 2HHHL 4DV0L 1UE1A 4ABNA 2PPBC 4B3TL 4NXML 1TS4A 4R4QA 2PQEA 1FD7D 4JCVE 3GD7A 4TVAB 1SNQA 3AEVA 1GUGA 3K5MA 1YITA 5FO9B 1QILA 1B3QA 4CKCA 2EXDA 5FJ8H 5C44B 3F2CA 2YV5A 3L9AX 4RKLA 1K8OA 1TY2A 1BR9A 2K75A 4MNOA 1EQVA 1HTPA 4JI7L 2N8NA 2NVYB 5IGCA 3I72A 5IP9G 4NMZA 2UXBQ 4H13C 3K59A 1AE3A 1LO5D 1B70B 1ILQA 1JR0D 3NEMA 3SXHA 1SNCA 2WAQG 1JT8A 4AYBG 3PCOB 4KHZA 4BY1B 2JA6B 1U4PA 5K5PA 4G7HC 1X55A 1JWUD 3D6WA 4O42A 1K8MA 4BBSB 4GNXC 3I4MH 2G5DA 5J39A 5M3FB 5J1ZA 3I70A 4UAIA 4AQYQ 2WIIB 1E0BA 3EN2A 2LXKA 3PSIA 5JVG3 3R3OA 3FMCA 1PTOC 1DXMA 1JJCB 1TKWB 1UE5A 5M5WB 1JB7A 1VMCA 1VQBA 3JAME 4RGNA 5C5LA 3F8TA 3RD4A 1EWIA 4H02A 1YEZA 2ZM6Q 1T5EA 2KJXA 2WKDA 3ND9A 3U50C 2IY5B 2VS1A 3QG1A 1CTMA 3LWEA 2NVTB 1CSQA 1CQVA 3D4DA 1EFID 4JYAQ 1YNJD 4DV6Q 3T1HQ 2B29A 2F0KA 1Z9FA 3VR4A 1I4RA 4DNRB 1NR2A 2A5HA 3CRLC 3TRZA 4FF3A 4PNYA 4IFDG 3CAMA 4A93G 4X65L 2RQXA 2E2IB 1DGSA 2JA5H 2DJGC 4DGZA 1S4ZA 1BXTA 3AU7A 2JK8A 1I3QH 4OEMB 2HQLA 4B3ML 2B39A 3NSWA 3S1MH 2Q8TA 3MA2B 1A0IA 1ILPA 2NVXH 2XRSD 5M3MG 2PYKA 5KNCA 1VQPA 3I55A 5G3LF 3CU7A 1TQOA 2NUCA 4X3UA 1R4PB 4K5VA 2E2JH 3K0XA 2B63G 1HA5A 1HXYD 4YY3Q 3N6RA 2KHJA 3MZ5A 4A3IB 1X6OA 5C3EH 4HIDA 3QR8A 2EY5A 5I2XA 1EUJA 3FHWA 3H94A 4RA8A 5E1FA 5NUCA 2N49A 5C4XH 3PO2G 4DV1Q 1SRUA 2JQOA 3NTHA 1SROA 4CDCC 3GTMH 4F88A 3FKIG 4JI5L 3AB9A 2UUAL 5C4XB 2Z0SA 2OWOA 1L2FA 2MPMA 3VYSA 1HNWQ 1SE3A 2R92H 1XMQQ 3H15A 4CBVA 3GQBA 1L0XB 2L9HA 2K33A 5FK9C 3PUXA 5ISRA 4DR1Q 1YNND 3T53B 3TMEA 3SHLA 5GAEC 1TWHH 1A3TA 2I07B 1AEXA 1HA6A 1A3VA 3V05A 4JK1C 4YWKA 2ID0A 5CV8A 1B44D 3T1YQ 1QVGA 3ONAB 4DV7Q 1FGUA 1HNZQ 1WTWA 1SYDA 1VF7A 1HR0L 1PMRA 5T1IA 3M4PA 4YCWA 1G2TA 5EPLA 1BOSA 4P2CB 1I4XA 2A69D 1F9SA 4YCUA 1HQMC 1EY6A 4A3MB 3VR6A 3S2HB 1EYAA 3GTKH 2BA0A 4YHHL 5CR3A 2K14A 2Y0SB 1O7YA 4A93H 2N88A 2JA9A 3BG3A 2HDLA 5IT9c 5A2QL 1J8IA 1UWVA 4X6AH 1GUSA 2KBNA 1M1KC 2QILA 1QUQB 1VQ4A 3S14B 4EQOA 1E2WA 2TMPA 2VB3X 3V96A 4KJNA 5C3WA 2NVTH 2R61A 5FLXE 1WD1A 3LX0A 2QEXA 2VZAA 4B3RL 1TWHB 1GUWA 3TSSA 4X3TA 2B2TA 2JEBI 1HPCA 3ERQA 3S17H 1LTLA 5DAUA 1PH5A 3GTPH 3I2ZA 4RGMA 4C3IG 2L5TA 2IT1A 3MVVA 3M7GA 5EBCA 2QW7A 1N36Q 4DA2A 4DAYB 1WFQA 4DV4Q 1KDBA 2V1CC 4JI8Q 1E7ZA 3KLRA 3FPPA 5JAVA 1YZ6A 1PH8A 1J9OA 1CSPA 5EGTA 2D5DA 1STBA 1VQLA 3NQTA 1PFSA 4QUFA 3QIAA 3UDGA 2B3GA 1CQFA 3P7JA 4OWXB 3K5OA 5CBAE 3OMCA 4EGVA 4HJ7A 1CZWA 3DXJC 2WFWA 3OWEB 4G7ZC 5BR8L 4A3BB 4KV6A 1D7QA 2LFNA 1WVLA 5LMUQ 3WOEA 1KDAA 3VDYA 2K28A 3LWUA 4HIMA 4LFCL 1TWAH 1VQJA 1JMCA 4TSSA 2A73B 3PO3B 3WDNA 5DM63 5IT9L 4JBWA 3T51B 4FXGC 2NN6I 1X9NA 3G6JB 3HKSA 3M4OB 4YWLA 4J8QA 1VQIA 3NK9A 1KXLA 2F0MA 3CQZB 2Q2TA 5IP9H 4DK1A 2PCFB 3S1NH 2B2UA 1YHAA 3DWAA 3VYRA 1FNVA 4A3FB 1AE2A 1SFOH 3PUVA 2NTTA 2JEAI 4A3LG 4JPBW 4GKKQ 1K8GA 2FINB 5M5WH 3I56A 4HIKA 1DONA 4C56C 3ERSX 1LM0A 1M4VA 3E6ZX 1DJRD 3NBIA 3STBC 2TSSA 4LNQA 4Q5VA 1N8RC 2EZVA 1DOKA 4NXNQ 4UP7A 1WD0A 1ENAA 3J80i 3CPWA 4DV2Q 1XPUA 1JORA 2PZUA 4DAYA 4A3EB 1FGBD 2PI2E 2WB1B 3U4ZA 3C1FA 4JVZA 3KOJA 4O1NA 3RMHA 3URYA 1VQ9A 3HKZG 3TDQA 1MIUA 3C2PA 1JWSD 4F87A 1BVSA 4GNXA 1L0WA 2CWAA 1V1PA 4FF1A 4QIWE 2NVYH 4P73A 2VQFL 3KBXA 1CKOA 2BE5D 1TR5A 2H1EA 4QGUA 4QMGA 2KENA 2AHOB 2ICIA 2RF4A 2MUYA 3ND8A 1I4QA 4XDXA 1DOLA 5CC4A 1GVPA 1I4GA 4FXKC 2OCEA 1E1OA 4OHJA 4FO2A 1TWFB 2A68D 3PQIA 1ZYRC 4WJ4A 3HOUH 4L63B 1XPOA 2L0CA 2KHSA 2Z4IA 1CA5A 1U5KA 4PMBA 5I6YA 1ASZA 2L55A 3MTSA 1LTBD 3HGBA 3TREA 1KNEA 1OXTA 1MHWC 2SEBD 4ME3A 1W3SA 4ID6A 4JI3Q 3W1BA 2EJFC 3K58A 1DD2A 5IYCH 5BN4A 4ODGA 3K80C 4X62Q 2JA7B 1EY5A 3KBGA 3NENA 1VQ5A 4P75A 1WTXA 4ZYSA 1I4PA 1HHVA 5TSSA 2LXJA 4DNTB 1JE5A 2BDOA 3S9WA 4DUYL 5ELNA 4C1NK 2BDNA 1HNZL 2D2CC 3CW2C 3HOXH 3NPPA 2I5HA 2K52A 1FL0A 3CQZH 1PFNA 3LNNA 4N8FA 1KDCA 4DV0Q 4BBRG 1D5MC 1JB3A 3GV3A 4B9WA 2C9OA 2XTIA 1TT2A 1KABA 4IUPA 4GLVB 4OELB 4QIWB 3PIPA 2L15A 1ONLA 3OW7A 2F0FA 1WI5A 1BCPD 1OXUA 2HUGA 2KCMA 4ZCKA 3W2DA 1LT6D 1EY4A 5I9OA 4LF9Q 4JYAL 2LSSA 4IZ8A 4PZ6A 3W3AA 4L5SA 2JA5G 1QE6A 1F77A 2MP1A 1C0AA 2BE5C 4GN4B 1XNQQ 1VQCA 4LK1C 5DM73 3E5SA 1RF2D 1X32A 1EQQA 4GN3B 1GUTA 1JOQA 4UP9A 2R93G 3L0OA 4RCNA 4XIGS 1CKMA 2E74C 4FVMA 3CC4A 1JJ2A 5EKIA 1I5FA 1KL9A 2B2UC 4B3MQ 1NR4A 4DK6C 3FPUB 4A3DG 1U4MA 3S15H 2DN8A 2G9HD 4C3IB 1CI3M 3M4QA 3H3VH 3KF6A 4BWGB 2L12A 2Z8LA 3IFTA 3PUZA 4K8IA 3BS1A 4CGYB 3NXWA 3MFGA 3SK5A 2KCCA 3W5OA 3Q23A 4KN7C 1LT4D 1YBYA 3HS0C 1F9RA 3S2DB 4BY7B 3HZXA 4JW0A 1F2ZA 2E76C 1HCZA 5IYBG 3EROA 3SGIA 1KC8C 4LF4Q 5FOBB 4HJ9A 1P16A 3Q22A 4BS9A 3I4OA 2IWHA 2A69C 2Z6BA 5FO7B 1GD7A 3CD6A 1F9PA 1SMYC 1GHKA 3WWVA 2B2TC 2OT2A 4LF7L 3HRZC 5C4XG 2PMZB 1QWYA 3M4OH 5IE8A 3S2HH 4B9XA 4A3MH 2K5HA 4NKLA 1D6EC 3EA6A 1QZGA 1XNRQ 2QDLA 3HOVB 3T1YL 1PTOB 1TWAB 5CGKA 3S1RH 4RMFA 1HR0Q 4A3GH 5IODA 4R4TA 4JI4L 4P72A 1Y1WB 1RD9D 4C3JH 1VQEA 3HOYB 3H3VI 3H0GG 3HOZH 2B63H 3NTKA 3RZOH 4A3GB 4JG2A 1UAPA 1UNSA 4LF9L 5C3EG 2R6GA 1MI2A 1TU2B 1DCZA 1FYCA 3ULLA 4XQJA 1STAA 4KY6A 1LTID 4EVOA 1F2YA 3GV6A 2UXCQ 2ZJRA 1QCBD 4LF6L 4DR7Q 1B9MA 4GLXA 4JBJA 3CCQA 1VQ8A 4DR3L 1IZ6A 1RHPA 1PLFA 2KVMA 4I7ZC 3CCMA 4DV2L 2F3VA 4DR4L 1H95A 4LAAA 1C8CA 4CKEA 5C3EB 3F1ZA 4A3IH 4KMUC 2EY1A 2K5QA 1WOCA 1SE2A 3A8KE 3CCJA
chains in the Genus database with same CATH topology
4Y7NB 2DNEA 2F0GA 3U9OA 2M2LA 2JE6I 3H09A 3TBIB 4F7XA 4A3KB 4XTCS 2KUMA 4DXGA 2F0NA 3S15B 1PDQA 3VR3A 1SYBA 2A6ED 1H9SB 3A8JE 2K5WA 3H91A 2R3ZA 4IFDI 4ZUIA 2Q8RE 3TP6A 3MFYA 4C3JG 4V0BA 3TP7A 1GUNA 5J22A 3CRKC 4N9TA 1XXGA 1IHZA 2EYLA 1STEA 1PZKD 3QB3A 3D4RA 4F8MA 3M7NA 1V43A 2DY7A 5KNBA 4N9PA 3SR1A 3Q24A 5EBDA 1L0YB 4LMQD 1R9TB 1X3QA 3FVQA 2EE1A 4KI0A 2AQ3B 3EVQA 4XT3B 1JCKB 2KOLA 3L3OC 2K1BA 4XT1B 1ESFA 5LHY1 1H9MA 2HDMA 2PW5A 5JPNC 2XWJB 2E2JB 3DEPA 1Y8PB 1EEID 5CORA 2ZXOA 1NUCA 5JEAG 1IW7D 2A68C 3K0YA 3D4WA 5K36H 2JA5B 3EJIA 3T16A 5IIFA 2XVSA 1KNAA 1IKMA 3OIQA 1A3UA 5KYIA 3N52A 4PV1C 1G8ZD 4B08A 2WKCA 3PV0A 1I6HB 3R2TA 4U68A 4A3DB 5E4WC 4IUVA 1OO9B 4GZYC 1QNKA 4V190 3A7AB 3GTQB 3X3MA 4K6DA 3PMFA 1ZXTA 1M8AA 4U673 2RDHA 3OOCA 3NUCA 4M8AA 4DAVA 2GA4B 2IPKD 4IQZA 4G4KA 4UDUC 1ENFA 1TWGB 4YIJA 3Q6SA 4RAUC 3J81E 1CM9A 1SMYD 4IUUA 4H0LC 3J7AF 2EVBA 1RTOA 2RKSA 4IALA 2OF1A 1EY9A 2F0HA 1BQQT 1PFBA 1H9RA 2F0IA 4FYDA 2F0JA 1QJOA 4RGOS 1RKNA 3T4AC 3T13A 1S5BD 1STNA 1HTLD 5EPJA 1B4OA 4ZLTF 4TKOB 2F0VA 2CVRA 4ZKCB 1EQTA 1GOZA 4OO1G 4KJOA 5FLXL 2Z4HA 3PIP3 1GXDC 1HFNA 3JAML 4MIUA 4Q0FA 2ZXPA 3U9SA 4J1MA 5BN5A 4BBRB 5D65A 1R4QB 1LT3D 5ELBA 1Q1EA 3D3RA 1IKLA 2H4OA 2B2VC 3TP5A 2F0TA 1PZJD 3FRPB 4IUNA 1WCMB 3J80L 4WFN3 1SYFA 2NB0A 3MC0B 4RGTA 1SEBD 2N55A 2C5CA 4RHSA 2FFKB 3I73A 5DNFA 4IUTA 3FEWX 2IX3A 2L4NA 3J7AV 2MHVA 1LT5D 4KN4C 1CHQD 2BCOA 2QKIC 2EOTA 1EYDA 4EQPA 2YU9B 4PQXA 3PUWA 1G6ZA 3S1QB 5FO8B 1BO0A 3PO2B 1FNUA 4KD3A 1GHJA 1S5DD 2ZT9C 2NZ1D 1ET6A 5C4ZA 1RDPD 1ZYRD 4K14A 3GTKB 1GJXA 1W6KA 3M3YB 2EPBA 3SVMA 1TS5A 2XSCA 5JOBA 2IJ0A 5IOCA 2PNRC 2WP8J 5I2YA 2DNCA 3UI2A 1Q1BA 4H44C 1PZID 2F0WA 1H9KA 3DWQA 4CJ0B 4C3JB 5C4JB 1SJHD 4HEDA 1XYIA 4ZUJA 1Z47A 4PMCA 1SNOA 3KK7A 2F0QA 2MJ8A 4K5XA 1EZ6A 3A8IE 1ICWA 1EY8A 1K83B 3FDTA 1SJED 1Y1VB 2A6HD 1E2ZA 2F0SA 2EYOA 1Q12A 1FR3A 1G291 4QUCA 3RZDB 2SOBA 3P1HA 3NTIA 3K7AB 2FJ2A 2F0DA 4C2MB 3GP7A 4QB4A 2AQ1B 2EDGA 3FKIB 2I46A 2B2WC 4XQQA 1STYA 1SYEA 1SBBB 3S1RB 2CQAA 1PTOH 1BCPB 4DK0A 4QF4A 1ML0D 1F2MA 1O7LA 1CA6A 2J0TD 3KLSA 5HGTA 5CBEE 4TRDA 1T5XD 1C4QA 3T56B 4ULLA 1AZPA 2J4XA 3TN2A 2M00A 1LTGD 5I4DA 4EQNA 5IGDA 1PTOF 1JICA 2Q8IB 1Z7TA 1PXUA 1B2TA 3I4MB 1V1OA 1F9QA 3SE0A 5CV7A 5AFWA 1O7ZA 2EYFA 1II3A 5C0XG 3H6MA 1EEFD 2L11A 4FF4A 4HN7A 2EYMA 4R9WA 2JA8B 1DYQA 4DAPA 1U9RA 1IYUA 3H0GB 5IT9E 4HTHA 2K7VA 3TP8A 4KY7A 1WTVA 2XIWA 4J6HA 3MXPA 1WTPA 2E75C 3HEJA 3RUZA 4ZKBB 1NAPA 2D9UA 2NWGA 5ELDA 2QEJC 2JYOA 5ELFA 1KLGD 2EJGC 1PFMA 2ICEC 1A15A 2NBFA 4X3KA 3DHQA 2VB2X 4AYBB 5M9OA 2QDBA 2AWOA 4ZRZA 1EY7A 2RSNA 2D62A 1RTNA 1D5XC 5KGUA 3J81L 2A6HC 2QCPX 3SK4A 3GTLB 1VF5C 5ELEA 3NBHA 2IX0A 4R8IA 3TZUA 1F2LA 3HKZB 2F0UA 2AUKA 3MHBA 3DUZA 2IL8A 5CV4A 1Y8OB 2ZXRA 1JE4A 1QB5D 1KLUD 2K6AA 4ZAIA 1MD2D 2FMMA 2XN9C 4FNFA 5C0XI 5COYA 5IGEA 5DEHA 1TS3A 3VR5A 5C3XA 2JP1A 3CHBD 4C3HG 3DM1A 1OXXK 4QCLA 3QO2A 4BA1I 3VYUA 1HFGA 4ILWA 1ZKOA 4RFBA 3KF8A 2EXZA 2HQEA 4HCEA 2Z1CA 4FF2A 3VA5A 3GTGB 4XYOA 1PTOD 1SXTA 5D3IB 2NTSA 2K01A 3SEBA 1GUOA 1SNDA 1WTRA 3BYYB 3MXUA 4K5WA 1TWCB 1S5FD 4HMJA 5KIXA 4DXFA 2XRQD 1BCPC 4XQNA 1NSNS 3K5LA 3I4NB 4NP5A 2XNAC 3SK8A 4LJZC 3E0JA 1X3PA 5LL6S 2RBMA 3P20A 3S17B 4K8JA 3VYTA 5LL6X 2X69A 3BDLA 2ENBA 4FP5D 2BOSA 4OL7A 4KY5A 5JVH3 1SNPA 5IGBA 1RODA 4OO1H 4KKTA 3MXNA 3K6OA 2F0OA 5KEEA 2KEEA 2R93B 3CKIB 3NWTA 3NQIA 3BVGA 2F0LA 2YYZA 3C46A 1I6VC 3OPOA 3J80E 1JOOA 5C6AA 3NE5B 3D8GA 5JEAJ 1NCVA 3HG9A 2O4XA 2K05A 3SK6A 5A2QE 2SNSA 5T1GA 2OXPA 4RH6A 2QF7A 4TQUS 2CHBD 2IW3A 1SAPA 5E4XA 1SE4A 1G2SA 2WV6D 2R92B 3Q0AA 4DN4M 2DY8A 1VDZA 4KKSA 4RKBA 3OHXC 3OWFA 3PIO3 4G57A 3GTMB 4MN3A 1LTTD 4S3SA 1PRTB 3OIPA 3KLSX 3NHHA 1TY0A 1HQRD 2PZTA 1V1PB 1HUMA 1MSGA 5K36G 1KAAA 1JWMD 4WJWA 3HOZB 1OXSC 4IN3A 5C4HA 3TZDA 1D1IA 2F03A 2K03A 1XTCD 1EY0A 1SDFA 2K04A 1ENCA 1I4HA 4KK7A 5KYLA 3MWYW 3K5NA 3BVZA 1IW7C 1BDOA 5D3DA 4G7OC 2E2DC 3EFXD 4KTAA 1AN8A 1SYCA 2EY6A 4ZQ3A 3IAYA 5C5MA 1RJTA 5JEAH 1BF4A 2LY7A 4I65A 1LTRD 2NN6H 4HMIA 4WRDA 1I3QB 1BNZA 4WORA 1XWEA 4IUQA 1WTQA 1WTOA 2O5JC 2K5DA 1IYVA 1MGSA 5ELCA 1UEAB 3MEHA 2CW0C 3A7LA 2B2YC 3QJYA 3J7YW 1PRTF 5CV6A 3MAQA 1JQYD 5CV5A 5BN3A 2AWNA 1LTSD 1G91A 3NP8A 1LABA 1Q3LA 1W6JA 2V4DA 3H3VC 1DZ1A 4C1NI 1IL8A 1DM0B 1TVXA 3BZDB 1D1KA 3G7LA 3BYTB 3D6CA 2X6LA 4R8NA 2K32A 2SDFA 2NYZD 2J7ZA 1U4RA 1STHA 3IFDA 1LTAD 1PRTD 4K6LA 1STGA 3MXGA 1A2TA 3I91A 3C3LA 2KEDA 4OIJA 4RHRA 2LMCB 4HSVA 3C1EA 2EJMA 1SYGA 4RWSC 1MSHA 2E2HB 3KUPA 2EYHA 2L1BA 2FMCA 4L6TB 1O80A 2HCIA 2NVQB 2VNUD 3VA7A 2CW0D 4DF7A 2MGSA 4DU9A 4A3JB 1D2BA 4IFDH 5CMDA 4CKBA 3I90A 4MHEA 5M5XB 1H9SA 4CJ1B 2LS01 1B1ZA 2KCNA 2AUJD 4IFDJ 1VCIA 3QWNA 1I50B 2B2VA 3DMUA 1KTKA 1EIGA 4BA2I 1B3AA 3V2TA 4H7BA 1AFPA 4ME5A 2F0PA 2PW7A 5HURA 5D14A 1EWHA 4RCOA 5F2DA 2KECA 3GTOB 3AMUA 4HSPA 3GO5A 2RVLA 1JOKA 3S16B 2FHTA 2R7ZB 1ESRA 1SFOB 4XXEA 2WACA 3A55A 3S1NB 1ET9A 5KRUA 2B2YA 1Q90A 2O5IC 4PMWA 1EYCA 1B50A 3NWSA 5M3MB 3OMGA 1QOHA 2F1MA 1LACA 2IX1A 2AQ2B 1SNMA 1LV9A 3DEOA 4HCSA 1HUNA 1TIID 3L7ZC 3IL8A 3BDOA 1EIHA 4NDXA 3BDCA 3A54A 3QOJA 4IURA 1DOMA 5IGGA 1PYWD 1U4LA 1A6XA 1AW7A 4NW2A 1EU4A 3WOFA 2F0EA 5I9PA 3O13A 5EPKA 3DWPA 3GTPB 3GTJB 2LKVA 4K2LA 1AZQA 5EKLA 3M4YA 4KD4A 1JC7A 1EU3A 3R8BA 2SNMA 5CV9A 3QOLA 1SSOA 2RSOA 5JJZA 2PZWA 2B2WA 4L8JA 2B8GA 3ITPA 5E3FA 4K2KA 4A93B 1CFMA 4FXDA 2EYJA 1E2VA 5A35A 1B9NA 3R2IA 1UUPA 1HRJA 2HCCA 4C3HB 3RZOB 2B63B 1YNNC 1S5ED 2A6EC 4X3SA 1EL0A 1CK1A 2KQ3A 3ZYYX 1Y69U 1QG7A 3I8ZA 1C48A 1BUVT 2EYPA 3M85A 1TS2A 4OIKA 2O2LD 3HOWB 3SDZA 1EOTA 2KA7A 1XX8A 2NN6G 1LLRD 2RA4A 5C0XH 3IKJA 1Q8IA 2RDFA 4DFAA 3BVMA 2B8FA 1B53A 1FNWA 2A74C 5I6WA 4KHVA 1ZEQX 3X3NA 4M1UB 2EY2A 2M9VA 5EQ0A 2NVXB 2RDGA 4HAEA 1BCPF 3S1MB 2JSOA 3HP3A 2OEOA 2VXWA 3I3CA 1A2UA 4OGQC 3P75A 5EJWA 1YNJC 4HR7B 2WINB 1S5CD 5IGFA 1V8QA 3HOUB 1EZ8A 3A56A 3OSOA 3RLFA 2XWBB 4Z9CB 5KNDA 2WAQB 3I4LA 1D5ZC 5FKAC 5G3LD 2JXMB 3PUYA 1MBYA 1PRTC 1CZGA 2F4IA 1Y8NB 2BA1A 2G9DA 1Z6HA 5CYUA 1EWCA 1VMPA 3K57A 1H9JA 3R93A 3D31A 4ZK9B 3HOXB 1QNUA 1O78A 1RCVD 1BBXC 2VUMB 5EKKA 1AP0A 1CT1D 1OXVA 3F2UA 3EQLC 4OO1I 2X6GA 1CHPD 4CHTB 4KKUA 5M5YB 4E6IA 2F3WA 4XYQA 4CJ2C 5C0XJ 2PO4A 5JPMC 3VR2A 4ABNA 2PPBC 1TS4A 2PQEA 1FD7D 3GD7A 1SNQA 1GUGA 3K5MA 5FO9B 1QILA 4CKCA 5C44B 3L9AX 4RKLA 1K8OA 1TY2A 1BR9A 1EQVA 1HTPA 2NVYB 5IGCA 3I72A 4NMZA 4H13C 3K59A 1LO5D 1ILQA 3SXHA 1JR0D 1SNCA 2JA6B 4BY1B 4KHZA 1U4PA 5K5PA 4G7HC 1JWUD 3D6WA 4O42A 1K8MA 4BBSB 5J39A 5M3FB 5J1ZA 3I70A 4UAIA 2WIIB 1E0BA 5JVG3 3R3OA 3FMCA 1PTOC 1DXMA 1TKWB 5M5WB 1VMCA 3JAME 4RGNA 5C5LA 3RD4A 1T5EA 2KJXA 2WKDA 3ND9A 2NVTB 3QG1A 1CTMA 3LWEA 1CQVA 3D4DA 1EFID 1YNJD 2F0KA 3VR4A 4DNRB 1I4RA 1NR2A 2A5HA 3CRLC 4FF3A 4PNYA 4IFDG 2RQXA 2E2IB 4DGZA 1S4ZA 1BXTA 3AU7A 2B39A 3NSWA 2Q8TA 3MA2B 1ILPA 2XRSD 2PYKA 5KNCA 5G3LF 3CU7A 1TQOA 2NUCA 4X3UA 1R4PB 4K5VA 1HA5A 1HXYD 3N6RA 3MZ5A 4A3IB 2EY5A 5I2XA 4RA8A 3H94A 5E1FA 5NUCA 3NTHA 4F88A 3AB9A 5C4XB 2MPMA 3VYSA 1SE3A 4CBVA 3GQBA 1L0XB 2L9HA 2K33A 5FK9C 3PUXA 5ISRA 1YNND 3T53B 3TMEA 3SHLA 1A3TA 2I07B 1AEXA 1HA6A 1A3VA 3V05A 4JK1C 2ID0A 5CV8A 1B44D 3ONAB 1WTWA 1SYDA 1VF7A 1PMRA 5T1IA 1G2TA 5EPLA 1BOSA 4P2CB 1I4XA 2A69D 1F9SA 1HQMC 1EY6A 4A3MB 3VR6A 3S2HB 1EYAA 2BA0A 5CR3A 2Y0SB 1O7YA 2N88A 3BG3A 2HDLA 5A2QL 1J8IA 1GUSA 2QILA 3S14B 4EQOA 1E2WA 2TMPA 2VB3X 3V96A 4KJNA 5C3WA 2R61A 5FLXE 1WD1A 3LX0A 1TWHB 1GUWA 3TSSA 4X3TA 2B2TA 2JEBI 1HPCA 3ERQA 5DAUA 4RGMA 4C3IG 2L5TA 2IT1A 3MVVA 3M7GA 5EBCA 4DA2A 1KDBA 3KLRA 3FPPA 5JAVA 1J9OA 5EGTA 2D5DA 1STBA 3NQTA 4QUFA 3QIAA 1CQFA 3P7JA 3K5OA 5CBAE 3OMCA 4EGVA 1CZWA 3DXJC 3OWEB 4G7ZC 4A3BB 4KV6A 2LFNA 1WVLA 3WOEA 1KDAA 2K28A 3LWUA 4TSSA 2A73B 3PO3B 3WDNA 5DM63 5IT9L 4JBWA 3T51B 4FXGC 2NN6I 3G6JB 3M4OB 4J8QA 3NK9A 2F0MA 3CQZB 4DK1A 2PCFB 2B2UA 3DWAA 3VYRA 1FNVA 4A3FB 3PUVA 2NTTA 2JEAI 2FINB 1DONA 4C56C 1M4VA 3E6ZX 1DJRD 3NBIA 2TSSA 4Q5VA 2EZVA 1DOKA 1WD0A 1ENAA 1JORA 2PZUA 4DAYA 4A3EB 1FGBD 2WB1B 3C1FA 4O1NA 3RMHA 3URYA 3TDQA 3C2PA 1JWSD 4F87A 1V1PA 4FF1A 3KBXA 2BE5D 1TR5A 2H1EA 4QMGA 2ICIA 2MUYA 3ND8A 1I4QA 4XDXA 1DOLA 5CC4A 1I4GA 4FXKC 4OHJA 1TWFB 4FO2A 2A68D 1ZYRC 4L63B 2L0CA 2KHSA 2Z4IA 1CA5A 4PMBA 5I6YA 2L55A 3MTSA 1LTBD 3HGBA 1KNEA 1OXTA 2SEBD 4ID6A 2EJFC 3K58A 1DD2A 5BN4A 4ODGA 2JA7B 1EY5A 3KBGA 1WTXA 4ZYSA 1I4PA 1HHVA 5TSSA 4DNTB 2BDOA 3S9WA 4C1NK 2BDNA 2D2CC 3NPPA 1PFNA 3LNNA 1KDCA 1D5MC 1JB3A 3GV3A 4B9WA 2C9OA 1TT2A 1KABA 4IUPA 4QIWB 1ONLA 3OW7A 2F0FA 1BCPD 1OXUA 2HUGA 3W2DA 1LT6D 1EY4A 5I9OA 4IZ8A 3W3AA 1QE6A 1F77A 2MP1A 2BE5C 4LK1C 5DM73 3E5SA 1RF2D 1X32A 1GUTA 1JOQA 4RCNA 4XIGS 2E74C 4FVMA 5EKIA 2B2UC 1NR4A 3FPUB 1U4MA 2DN8A 2G9HD 4C3IB 1CI3M 4BWGB 2L12A 2Z8LA 3IFTA 3PUZA 4K8IA 3BS1A 4CGYB 3NXWA 3MFGA 3SK5A 2KCCA 3Q23A 4KN7C 1LT4D 3HS0C 1F9RA 3S2DB 4BY7B 3HZXA 1F2ZA 2E76C 1HCZA 3EROA 5FOBB 3Q22A 4BS9A 2IWHA 2A69C 5FO7B 1F9PA 1SMYC 1GHKA 2B2TC 2OT2A 3HRZC 2PMZB 1QWYA 4B9XA 4NKLA 1D6EC 3EA6A 3HOVB 1PTOB 1TWAB 5CGKA 5IODA 1Y1WB 1RD9D 3HOYB 3NTKA 4A3GB 1UAPA 1UNSA 2R6GA 1TU2B 1MI2A 1DCZA 1FYCA 4XQJA 1STAA 4KY6A 1LTID 4EVOA 1F2YA 3GV6A 1QCBD 1B9MA 1RHPA 1PLFA 2KVMA 4I7ZC 2F3VA 4LAAA 1C8CA 4CKEA 5C3EB 4KMUC 2EY1A 2K5QA 1SE2A 3A8KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1G A;  4IUQ A;  1HFG A;  1WTQ A;  1B53 A;  3KBX A;  5EKI A;  5D65 A;  1WTO A;  1KNA A;  2B2U C;  1IKM A;  1NR4 A;  2H1E A;  2M2L A;  3FPU B;  5CMD A;  4X3U A;  3I90 A;  1U4M A;  4MHE A;  1J9O A;  1IKL A;  1MGS A;  4QUC A;  5EPK A;  4XDX A;  4CJ1 B;  2B2V C;  1DOL A;  5EQ0 A;  4QUF A;  1WTV A;  1SAP A;  3N52 A;  4HAE A;  5E4X A;  2XIW A;  2L12 A;  2B2Y C;  1G2S A;  1WTP A;  3P7J A;  2KUM A;  5CBA E;  1AZQ A;  4U68 A;  2DY8 A;  3HP3 A;  4DN4 M;  4ZKB B;  2VXW A;  2FJ2 A;  1PDQ A;  4RA8 A;  4IUV A;  5E4W C;  1F9R A;  1NAP A;  2K01 A;  3I3C A;  2N55 A;  2D9U A;  2NWG A;  1QNK A;  2B2V A;  1CA5 A;  5EJW A;  4MN3 A;  2FFK B;  2JYO A;  1EIG A;  5DNF A;  1WVL A;  3MTS A;  2B2W C;  1WTR A;  1KNE A;  3H91 A;  1PFM A;  1B3A A;  4IUT A;  2MPM A;  2K28 A;  2R3Z A;  1A15 A;  1G91 A;  1Q3L A;  1ILQ A;  1ZXT A;  2Q8R E;  1M8A A;  1SSO A;  2L4N A;  4X3K A;  2L9H A;  1F9P A;  2RSO A;  1ML0 D;  1HUM A;  5JJZ A;  1U4P A;  2EOT A;  2B2W A;  5D14 A;  2B2T C;  1DZ1 A;  1CA6 A;  1MSG A;  2RSN A;  2KEC A;  1RTN A;  1HA6 A;  5CBE E;  1IL8 A;  3D6W A;  4O42 A;  1G6Z A;  1TVX A;  2RVL A;  3ONA B;  1BO0 A;  1WTW A;  1X3P A;  2FHT A;  1ESR A;  3Q6S A;  4UAI A;  4RAU C;  1WTX A;  5T1I A;  1E0B A;  3G7L A;  1CM9 A;  4IUU A;  1HHV A;  3TZD A;  2DY7 A;  2B2U A;  1G2T A;  2K03 A;  1RTO A;  5EPL A;  2X69 A;  1SDF A;  4R8I A;  2K04 A;  2BDN A;  1F9S A;  1AZP A;  2X6L A;  1HRJ A;  2HCC A;  1VMP A;  4LMQ D;  3TN2 A;  3MWY W;  2NZ1 D;  1VMC A;  1F2L A;  1X3Q A;  2SDF A;  3R93 A;  1PFN A;  2NYZ D;  2J7Z A;  2EE1 A;  2B2Y A;  1U4R A;  1ROD A;  2FIN B;  1O7Y A;  4ZK9 B;  2N88 A;  2EPB A;  3IFD A;  1B50 A;  2HDL A;  4X3S A;  1DON A;  3SVM A;  1J8I A;  1EL0 A;  1BBX C;  2KEE A;  1PFB A;  3LWE A;  2IL8 A;  3GV3 A;  4XT3 B;  1JIC A;  1QG7 A;  2KOL A;  3I8Z A;  4IUP A;  1AP0 A;  1DOK A;  1MI2 A;  2K1B A;  4XT1 B;  1WD0 A;  3UI2 A;  1JE4 A;  1B2T A;  3F2U A;  3I91 A;  2KED A;  4OIK A;  4OIJ A;  4ZAI A;  2X6G A;  1F9Q A;  1B4O A;  2FMM A;  2HUG A;  3GV6 A;  4HSV A;  1LV9 A;  2HDM A;  1NR2 A;  3DEO A;  4HCS A;  4RWS C;  1MSH A;  2CVR A;  5AFW A;  1HUN A;  1WD1 A;  1O7Z A;  1RJT A;  1EOT A;  3KUP A;  4ZKC B;  1EQT A;  5COY A;  4CJ2 C;  3DEP A;  1XX8 A;  3IL8 A;  4ZLT F;  1BF4 A;  1GUW A;  4X3T A;  5COR A;  2L1B A;  4CJ0 B;  1EIH A;  2RA4 A;  1QE6 A;  2MP1 A;  1RHP A;  1PLF A;  4HED A;  1XYI A;  2B2T A;  2KVM A;  1O80 A;  2HCI A;  1S4Z A;  2JP1 A;  2MJ8 A;  4IUR A;  1DOM A;  3DM1 A;  1U4L A;  1C8C A;  1X32 A;  1HFN A;  2L11 A;  1ICW A;  5EPJ A;  1NCV A;  1BNZ A;  3FDT A;  4R9W A;  4NW2 A;  2Q8T A;  3QO2 A;  1ILP A;  2K05 A;  2MGS A; 
#chains in the Genus database with same CATH topology
 5AJ3 L;  4Y7N B;  2DNE A;  2F0G A;  3U9O A;  2M2L A;  2JE6 I;  4Y52 H;  3GTO H;  5DLQ E;  3H09 A;  3TBI B;  2MNA A;  2ES2 A;  4F7X A;  1NE3 A;  1IBL Q;  4A3K B;  1BBU A;  1K9M C;  4UHV A;  3KFU A;  4XTC S;  2KUM A;  4DXG A;  4LF4 L;  4C3I H;  2F0N A;  3S15 B;  1PDQ A;  3VR3 A;  1GM5 A;  1SYB A;  2UXD L;  2A6E D;  1H9S B;  3A8J E;  2K5W A;  3H91 A;  2CCZ A;  2R3Z A;  4IFD I;  4ZUI A;  1VQO A;  2Q8R E;  3TP6 A;  3BJU A;  2K5N A;  3MFY A;  4C3J G;  4V0B A;  2P5Z X;  3NEL A;  2I0Q A;  3UDI A;  3TP7 A;  1GUN A;  3S1Q H;  5J22 A;  3CRK C;  3RN5 A;  4N9T A;  1XXG A;  1IHZ A;  2EYL A;  1STE A;  1VQD A;  1PZK D;  3QB3 A;  2YU9 H;  3KYH C;  3D4R A;  4F8M A;  3M7N A;  3U58 A;  4POF A;  4DPG A;  1N33 Q;  1V43 A;  2DY7 A;  2Z6K C;  5KNB A;  1A62 A;  4N9P A;  3SR1 A;  3Q24 A;  4JI6 L;  2E5L L;  1TXY A;  1U0L A;  5EBD A;  1L0Y B;  1KRS A;  1VQN A;  4LMQ D;  1R9T B;  1QZH A;  3J81 c;  1HJP A;  4BBS G;  1X3Q A;  1CKN A;  3HOY G;  5M3F H;  3FVQ A;  2EE1 A;  4KI0 A;  2AQ3 B;  1OTC A;  2I5M X;  3EVQ A;  4DUZ L;  1V1Q A;  4UY8 C;  3CXC A;  4XT3 B;  1JCK B;  2KOL A;  3L3O C;  2K1B A;  4XT1 B;  1ESF A;  2JJQ A;  5LHY 1;  1H9M A;  1E24 A;  2HDM A;  2JA7 H;  2PW5 A;  5JPN C;  3L2P A;  1TWC H;  2XWJ B;  2E2J B;  4GS3 A;  4QY7 A;  3DEP A;  1K73 C;  1Y8P B;  1EEI D;  5COR A;  2ZXO A;  1NUC A;  2YTX A;  5JEA G;  1IW7 D;  2RCN A;  2A68 C;  3K0Y A;  3UE1 A;  4JI0 L;  3I4M G;  4LFA Q;  5IYD H;  4N8X 1;  3GTG H;  3D4W A;  1SE8 A;  4R4I A;  1NTG A;  5K36 H;  2JA5 B;  5JJK A;  3HFZ B;  3EJI A;  3T16 A;  5IIF A;  4A3J G;  2XVS A;  1TWG H;  1KNA A;  1IKM A;  4YWM A;  3OIQ A;  1A3U A;  1IBK Q;  4GOP A;  3E9I A;  5KYI A;  3N52 A;  4PV1 C;  1G8Z D;  1TWF H;  4B08 A;  2UXD Q;  1NMF A;  2WKC A;  3PV0 A;  1VQM A;  4GOP B;  1I6H B;  3R2T A;  2VQE Q;  4U68 A;  5M5X H;  4A3D B;  4CDF C;  5E4W C;  4IUV A;  1T9H A;  1OO9 B;  1XMO L;  4GZY C;  3M9B A;  1QNK A;  4V19 0;  4X66 L;  4A3J H;  1HZ9 A;  3A7A B;  4R1J A;  3GTQ B;  3X3M A;  4K6D A;  3PMF A;  1PYB A;  1ZXT A;  1M8A A;  4U67 3;  2RDH A;  3OOC A;  1K28 A;  3NUC A;  4M8A A;  4OON A;  4DAV A;  2GA4 B;  4EQ5 A;  2IPK D;  2VUM H;  4IQZ A;  1B7Y B;  4G4K A;  4UDU C;  1ENF A;  1TWG B;  4YIJ A;  5H1S E;  2A8V A;  3AYH B;  3Q6S A;  4RAU C;  3J81 E;  1CM9 A;  1SMY D;  4IUU A;  4LF7 Q;  4H0L C;  1VQK A;  3J7A F;  1YJ9 A;  2EVB A;  4JI5 Q;  1RTO A;  1HZC A;  2RKS A;  2ZTC A;  1E3P A;  2HT1 A;  4IAL A;  3DLL A;  4IPG A;  2OF1 A;  1EY9 A;  2F0H A;  1BQQ T;  1VQA A;  3AFP A;  1N34 Q;  4IJL A;  2E8G A;  2IHF A;  1PFB A;  1H9R A;  2F0I A;  4FYD A;  1A63 A;  2XGT A;  2F0J A;  4JV5 Q;  1QJO A;  4RGO S;  1RKN A;  4DV7 L;  3T4A C;  3T13 A;  1S5B D;  1STN A;  1HTL D;  5EPJ A;  1B4O A;  4ZLT F;  4TKO B;  2F0V A;  2CVR A;  2N78 A;  4ZKC B;  2HIV A;  1EQT A;  1GOZ A;  4OO1 G;  4KJO A;  5FLX L;  3AQQ A;  2Z4H A;  3PIP 3;  4A3F G;  1GXD C;  4GN5 A;  1HFN A;  3JAM L;  4MIU A;  2UXB L;  4Q0F A;  2GVA A;  2ZXP A;  3U9S A;  4J1M A;  5BN5 A;  5L37 A;  4BBR B;  4O0A A;  2WB1 E;  5D65 A;  1R4Q B;  1LT3 D;  1X54 A;  4JI3 L;  5ELB A;  1Q1E A;  3D3R A;  1IKL A;  4APV A;  2H4O A;  2B2V C;  5AJ3 Q;  1XMO Q;  3TP5 A;  2F0T A;  1PZJ D;  4B3R Q;  4IUN A;  3FRP B;  1WCM B;  3DM3 A;  2UUB L;  3J80 L;  4WFN 3;  1YI2 A;  5GAD C;  1SYF A;  2NB0 A;  3MC0 B;  4RGT A;  1SEB D;  3IRB A;  1MJC A;  2N55 A;  2C5C A;  4RHS A;  2FFK B;  3I73 A;  5DNF A;  3RR5 A;  4AH6 A;  3I4N G;  4IUT A;  3FEW X;  3HOW H;  3NBH B;  2IX3 A;  2L4N A;  3J7A V;  2MHV A;  1LT5 D;  4KN4 C;  1VQF A;  1YHB A;  1CHQ D;  2BCO A;  2QKI C;  2EOT A;  1EYD A;  2GVB A;  1SMX A;  4EQP A;  5HGQ A;  1HNW L;  2YU9 B;  2IHE A;  4PQX A;  2MQH A;  3PUW A;  3CCR A;  1G6Z A;  3S1Q B;  5FO8 B;  1BO0 A;  3PO2 B;  2GN5 A;  1FNU A;  3KF6 B;  4KD3 A;  2CH4 A;  1L1O B;  2NZH A;  1GHJ A;  2R7D A;  1S5D D;  4MZ9 A;  2ZT9 C;  4L5Q A;  2NZ1 D;  1ET6 A;  4A75 A;  5C4Z A;  1RDP D;  1ZYR D;  4K14 A;  3GTK B;  1VQ7 A;  1GJX A;  1W6K A;  3M3Y B;  4A3C H;  2EPB A;  3SVM A;  1TS5 A;  5FLM H;  2XSC A;  1RIP A;  5JOB A;  4QJF A;  2IJ0 A;  5IOC A;  2PNR C;  2WP8 J;  5I2Y A;  2DNC A;  3UI2 A;  1Q1B A;  2R93 H;  4H44 C;  2UUC L;  1A8V A;  4DV5 Q;  1HNX Q;  1PZI D;  2F0W A;  1K8A C;  1H9K A;  3DWQ A;  5JJL A;  4CJ0 B;  4C3J B;  5C4J B;  1SJH D;  4HED A;  1XYI A;  4ZUJ A;  1Z47 A;  4PMC A;  1SNO A;  5ELO A;  3KK7 A;  2F0Q A;  2MJ8 A;  4K5X A;  1EZ6 A;  4DV1 L;  3A8I E;  1UE6 A;  1ICW A;  1EY8 A;  1K83 B;  3FDT A;  4LF8 Q;  1K3R A;  2DGY A;  4L5T A;  1SJE D;  1Y1V B;  2A6H D;  3UE0 A;  1E2Z A;  2F0S A;  1N32 L;  2EYO A;  3EBE A;  3HOW G;  1Q12 A;  1FR3 A;  1G29 1;  4QUC A;  4HJ5 A;  3RZD B;  2SOB A;  1NBW A;  3P1H A;  4JI8 L;  4A3I G;  3NTI A;  3K7A B;  2FJ2 A;  2F0D A;  4C2M B;  3GP7 A;  4GOP C;  4AQY L;  1XTD A;  4QB4 A;  5C4J H;  2AQ1 B;  2EDG A;  4NB3 A;  1XNR L;  3FKI B;  2I46 A;  2B2W C;  4XQQ A;  1STY A;  3B6Y A;  2D0P A;  1PH7 A;  1SYE A;  1SBB B;  3FP9 A;  3S1R B;  2CQA A;  1PTO H;  4X66 Q;  2PI2 A;  1BCP B;  1PA6 A;  4DK0 A;  4QF4 A;  1ML0 D;  4DR6 L;  1F2M A;  1O7L A;  1CA6 A;  2N3S A;  3BZK A;  2J0T D;  3KLS A;  1PYS B;  5HGT A;  5CBE E;  4DR2 Q;  4TRD A;  1T5X D;  4JI2 L;  1C4Q A;  5LMN L;  3T56 B;  2UXC L;  4ULL A;  4LFB L;  1AZP A;  3BU2 A;  1S72 A;  3JAM i;  2DUD A;  3KDF B;  2I5L X;  2J4X A;  3TN2 A;  1IXR A;  4DR4 Q;  2M00 A;  1LTG D;  3J80 c;  4JI6 Q;  2FXQ A;  3S2D H;  4BY7 H;  1W2B A;  3A5U A;  1E22 A;  1KQS A;  5I4D A;  4EQN A;  5IGD A;  1PTO F;  1JIC A;  2Q8I B;  1Z7T A;  1VQH A;  1PXU A;  1B2T A;  3I4M B;  1V1O A;  1F9Q A;  1PH4 A;  3SE0 A;  3ULJ A;  4BBS H;  5CV7 A;  5AFW A;  3K7U C;  1O7Z A;  2R7Z G;  3CCL A;  3JAM c;  5GRO A;  2EYF A;  2QA4 A;  2YTV A;  1II3 A;  4A3L H;  1J6Q A;  4BY1 G;  2JA6 G;  3Q8D A;  1I50 H;  5IYD G;  5C0X G;  3H6M A;  1EEF D;  2L11 A;  4FF4 A;  4HN7 A;  2EYM A;  4R9W A;  2JA8 B;  1DYQ A;  2WAQ E;  4DAP A;  1U9R A;  1IYU A;  1AH9 A;  3H0G B;  2K5V A;  5IT9 E;  1NNX A;  2JA7 G;  4HTH A;  2K7V A;  3TP8 A;  4KY7 A;  1Q82 C;  4DR1 L;  4BBR H;  4DR5 Q;  1WTV A;  2XIW A;  4J6H A;  3MXP A;  1WTP A;  5C44 H;  2E75 C;  3KJO A;  3HEJ A;  3RUZ A;  4ZKB B;  1NAP A;  2D9U A;  2NWG A;  5ELD A;  4KHP L;  2QEJ C;  2HHH Q;  2JYO A;  5ELF A;  3K81 C;  1KLG D;  1RL2 A;  2AMC B;  1E1T A;  1PFM A;  2EJG C;  1PH1 A;  1HZA A;  2ICE C;  1A15 A;  1PV4 A;  2EIF A;  1QVC A;  2NBF A;  4X3K A;  2VL6 A;  2HIX A;  2VB2 X;  3DHQ A;  2QDB A;  1UEB A;  2AWO A;  4AYB B;  5M9O A;  4ZRZ A;  1EIF A;  1EY7 A;  2OQ0 A;  2RSN A;  2D62 A;  1RTN A;  1D5X C;  5KGU A;  3J81 L;  1JJG A;  1Q86 C;  2A6H C;  2JA8 H;  2QCP X;  4QL5 A;  3SK4 A;  4EX5 A;  1VF5 C;  3GTL B;  5ELE A;  3NBH A;  2IX0 A;  1K0S A;  4HIO A;  4R8I A;  3MXN B;  3TZU A;  1S40 A;  2K50 A;  1F2L A;  1XMQ L;  3HKZ B;  2F0U A;  4A3E H;  4L5R C;  2AUK A;  3MHB A;  2A19 A;  3DUZ A;  2IL8 A;  4R4O A;  1PH3 A;  3UDF A;  4PZ7 A;  5CV4 A;  3HOU G;  3OTO L;  1Y8O B;  3GTL H;  2ZXR A;  2RHS B;  4MTK A;  1JE4 A;  1QB5 D;  1KLU D;  2K6A A;  4ZAI A;  4JI1 L;  1MD2 D;  2FMM A;  2XN9 C;  4FNF A;  5C0X I;  1EIY B;  5COY A;  5IGE A;  5DEH A;  4A3E G;  1TS3 A;  1PH6 A;  3VR5 A;  1X3E A;  3CCS A;  1HNX L;  2R7F A;  4A3F H;  5C3X A;  2JP1 A;  3CHB D;  4C3H G;  3DM1 A;  4UP8 A;  1LUZ A;  1OXX K;  4QCL A;  2NVQ H;  3ULP A;  3QO2 A;  4BA1 I;  3VYU A;  3E3X A;  1L1O C;  1HFG A;  1Q46 A;  4ILW A;  1ZKO A;  1KHI A;  3GDE A;  4RFB A;  1YHQ A;  2F4V L;  3TEH B;  3KF8 A;  2UU9 Q;  1WTH A;  4P74 A;  4LF6 Q;  4DR7 L;  2EXZ A;  2HQE A;  1K0R A;  4HCE A;  2ASB A;  3CC2 A;  2Z1C A;  1Q8K A;  5IWA Q;  4FF2 A;  3VA5 A;  4DR3 Q;  3GTG B;  4XYO A;  3CP0 A;  1PTO D;  1SXT A;  5D3I B;  3RN2 A;  4RG1 A;  2NTS A;  2K01 A;  4GKJ L;  2OQK A;  3SEB A;  4DUY Q;  1GUO A;  2JA8 G;  1SND A;  1WTR A;  3BYY B;  3MXU A;  4K5W A;  4C2M H;  1TWC B;  1S5F D;  4HMJ A;  5KIX A;  4DXF A;  2XRQ D;  3RZD H;  4MTN A;  1NY4 A;  1BCP C;  4XQN A;  1I94 Q;  4OX9 Q;  1NSN S;  3K5L A;  3I4N B;  4NP5 A;  2A1A A;  2XNA C;  3KF8 B;  4LJZ C;  3SK8 A;  3E0E A;  3E0J A;  1X3P A;  5LL6 S;  2OTL A;  2RBM A;  3P20 A;  5GQO A;  1EYG A;  4LF5 Q;  2HD3 A;  3S17 B;  4K8J A;  3VYT A;  5LL6 X;  2X69 A;  2UUA Q;  3PO3 H;  3BDL A;  4A3G G;  1NMG A;  2ENB A;  4FP5 D;  2BOS A;  4OL7 A;  2AKW B;  4KY5 A;  5JVH 3;  4LFB Q;  1VQG A;  1SNP A;  5IGB A;  1ROD A;  2D0O A;  4OO1 H;  4KKT A;  5FJ8 G;  3MXN A;  3K6O A;  4C3H H;  2F0O A;  5KEE A;  2KEE A;  3G71 A;  1N9W A;  2R93 B;  3CKI B;  3NWT A;  2VQF Q;  3S14 H;  3NQI A;  2VY3 A;  3BVG A;  4X65 Q;  4AYB E;  2F0L A;  2YYZ A;  3CCE A;  3C46 A;  1I6V C;  3OPO A;  5EAY A;  3J80 E;  1JOO A;  2MO0 A;  5C6A A;  1Y1V G;  3NE5 B;  4BXX G;  2UUC Q;  3D8G A;  3I7F A;  5JJI A;  4YHH Q;  4JOI C;  5JEA J;  4ALP A;  2CFM A;  3OW2 A;  1NCV A;  2ZJQ A;  3HG9 A;  1PHJ A;  2O4X A;  1Q81 C;  2K05 A;  3SK6 A;  5A2Q E;  3FKI H;  2SNS A;  2OXP A;  5T1G A;  3G48 A;  4RH6 A;  3F2D A;  1SLJ A;  2QF7 A;  4NXN L;  4TQU S;  2PMZ E;  2CHB D;  2IW3 A;  1CUK A;  2ATW A;  1SAP A;  5E4X A;  4GKJ Q;  1SE4 A;  1G2S A;  2WV6 D;  1YNX A;  2R92 B;  3Q0A A;  4JBM A;  2DY8 A;  1VDZ A;  4DN4 M;  4KKS A;  4RKB A;  3OHX C;  3OWF A;  3HOZ G;  3PIO 3;  4G57 A;  3GTM B;  4MN3 A;  1PH2 A;  1LTT D;  4PG3 A;  4S3S A;  1PRT B;  3OIP A;  4LUV A;  3KLS X;  3NHH A;  1TY0 A;  1HQR D;  1N36 L;  2PZT A;  1KD1 C;  4OX9 L;  4DV3 Q;  3PO3 G;  1V1P B;  1HUM A;  1MSG A;  5K36 G;  4OWT B;  1KAA A;  4LW1 A;  1JWM D;  4LF5 L;  4LUO A;  2ZTD A;  4WJW A;  5FLX c;  2VQE L;  3HOZ B;  1OXS C;  4IN3 A;  5E7N A;  1X65 A;  5C4H A;  5BR8 Q;  1CKN B;  3TZD A;  1D1I A;  2F03 A;  3G4S A;  2K03 A;  1XTC D;  5LMU L;  1EY0 A;  1SDF A;  2K04 A;  3HOV H;  1ENC A;  1I4H A;  4KK7 A;  4JI2 Q;  4JC0 A;  5M3M H;  5KYL A;  5LMN Q;  3MWY W;  3K5N A;  3RLO A;  3BVZ A;  5IP7 G;  1Y1W G;  5M3F G;  1IW7 C;  1BDO A;  5D3D A;  4G7O C;  2E2D C;  3EFX D;  4KTA A;  1AN8 A;  1N32 Q;  1SYC A;  2EY6 A;  4ZQ3 A;  3PGZ A;  3PO2 H;  3IAY A;  2DJF C;  5C5M A;  1RJT A;  1IBL L;  5JEA H;  1HZB A;  1BF4 A;  2LY7 A;  4PZ8 A;  4I65 A;  1LTR D;  2NN6 H;  4HMI A;  4A4I A;  4WRD A;  1EQR A;  4GKK L;  3J7A 5;  1I3Q B;  2JN4 A;  1BNZ A;  3W1G A;  4WOR A;  1XWE A;  4IUQ A;  1WTQ A;  1WTO A;  1K3B C;  2O5J C;  4OXP A;  2K5D A;  1IYV A;  4DR6 Q;  1MGS A;  5ELC A;  4DAM A;  1UEA B;  3MEH A;  1WCM H;  1L1O A;  2CW0 C;  3A7L A;  4BY1 H;  2JA6 H;  3TS2 A;  2B2Y C;  3QJY A;  3J7Y W;  4DR2 L;  3LGJ A;  4B3S L;  4LFC Q;  1PRT F;  4DR5 L;  5CV6 A;  3MAQ A;  1JQY D;  5CV5 A;  3GTQ H;  5BN3 A;  1FJG Q;  2AWN A;  3ZJY C;  1LTS D;  1G91 A;  3NP8 A;  4JI4 Q;  1LAB A;  1Q3L A;  3HOV G;  1W6J A;  1NJI C;  3EIV A;  2V4D A;  3H3V C;  3BZC A;  2CWP A;  4X64 Q;  4C1N I;  2BH2 A;  1DZ1 A;  3CC7 A;  4DUZ Q;  1VQ6 A;  2E2H H;  1IL8 A;  1DM0 B;  1TVX A;  2Z9H A;  4BY7 G;  1FVI A;  3KJP A;  3BZD B;  4HJ8 A;  5J3B A;  1YVC A;  1D1K A;  3G7L A;  3UDX A;  3BYT B;  4JI7 Q;  4FDB A;  3D6C A;  4CDE C;  2X6L A;  4R8N A;  3CME A;  2RCF A;  2K32 A;  2SDF A;  2NYZ D;  4AIM A;  2J7Z A;  1GO3 E;  1U4R A;  1STH A;  3IFD A;  5M5Y H;  1LTA D;  1PRT D;  3K8A A;  4K6L A;  1STG A;  4X62 L;  1G6P A;  4OWW B;  1IL2 A;  3MXG A;  1A2T A;  3I91 A;  2KED A;  4OIJ A;  4RHR A;  3C3L A;  1WYD A;  2LMC B;  4HSV A;  3C1E A;  2EJM A;  1SYG A;  4RWS C;  1MSH A;  2OTJ A;  4JV5 L;  2E2H B;  3KUP A;  1QVF A;  2EYH A;  2L1B A;  2FMC A;  4B3T Q;  4NXM Q;  4L6T B;  1R9T H;  1XJV A;  4IO9 A;  1O80 A;  2HCI A;  2NVQ B;  3STB D;  5C44 G;  3RNU A;  2VNU D;  3VA7 A;  2CW0 D;  4DF7 A;  2MGS A;  4DU9 A;  3J81 j;  4A3J B;  1D2B A;  4DV6 L;  4IFD H;  5CMD A;  4CKB A;  3I90 A;  1ASY A;  4MHE A;  3H0G H;  5M5X B;  4A3D H;  4A3B G;  1H9S A;  1I6H H;  4CJ1 B;  2LS0 1;  1B1Z A;  2K4K A;  1IBM L;  2KCN A;  3HKZ E;  2AUJ D;  2F4V Q;  4IFD J;  1VCI A;  3QWN A;  2UU9 L;  1I50 B;  4IPC A;  3OYY A;  1J5E Q;  2B2V A;  3DMU A;  3F2B A;  3A74 A;  1KTK A;  1EIG A;  4BA2 I;  1B3A A;  3ER0 A;  3V2T A;  4X64 L;  4H7B A;  1AFP A;  5GAG C;  4ME5 A;  2F0P A;  4IOC A;  2PW7 A;  4R4C A;  3E9H A;  2PNH A;  4A3K G;  5HUR A;  1ICF B;  1HH2 P;  5D14 A;  1EWH A;  1P8L A;  4RCO A;  2KEC A;  5F2D A;  3GTO B;  3AMU A;  3AFQ A;  4HSP A;  3GO5 A;  4JOI A;  2YTY A;  1EFW A;  3OTO Q;  2CH4 W;  4J15 A;  2RVL A;  1JOK A;  3S16 B;  2FHT A;  2R7Z B;  1ESR A;  1SFO B;  4XXE A;  1I94 L;  2F52 A;  2WAC A;  3A55 A;  3RLN A;  3HOX G;  3S1N B;  1ET9 A;  1PH9 A;  3D0F A;  3JC6 6;  5KRU A;  4LFA L;  2B2Y A;  5LMN W;  1Q90 A;  2O5I C;  4PMW A;  1EYC A;  1B50 A;  3NWS A;  5M3M B;  1YIJ A;  3OMG A;  1X56 A;  1QOH A;  2F1M A;  1LAC A;  2KHI A;  2IX1 A;  2AQ2 B;  1SNM A;  1LV9 A;  3A5Z B;  3DEO A;  4HCS A;  1XNQ L;  1HUN A;  1TII D;  3L7Z C;  1X3F A;  3IL8 A;  3BDO A;  2E5L Q;  2Y0S E;  4BXX H;  1EIH A;  4NDX A;  1Y1W H;  2Q2H A;  3BDC A;  4GNX B;  4A3B H;  4DV5 L;  1GKH A;  2Q2I A;  3A54 A;  3QOJ A;  4IUR A;  1DOM A;  3K7A H;  5IGG A;  1PYW D;  1U4L A;  2BH8 A;  1MKH A;  1A6X A;  1AW7 A;  2VUM G;  5IYC G;  4NW2 A;  3CCU A;  2WB1 G;  1IBM Q;  1EU4 A;  3WOF A;  2F0E A;  4DNI A;  4IPD A;  5I9P A;  3O13 A;  4CDD C;  1C7Y A;  5EPK A;  1Y1V H;  2RHQ B;  1IYJ B;  4A3K H;  1K83 H;  3DWP A;  3GTP B;  3GTJ B;  2QGQ A;  4I7A A;  2LKV A;  4K2L A;  1AZQ A;  4O2D A;  5EKL A;  3M4Y A;  4JI0 Q;  4KD4 A;  1JC7 A;  4QQB X;  4A3C G;  1KIX A;  5IYB H;  3J7Z C;  4Y7N H;  1BBW A;  1B8A A;  1KRT A;  1EU3 A;  4A3M G;  3R8B A;  2SNM A;  5CV9 A;  1C9O A;  3QOL A;  1SSO A;  1FJG L;  2RSO A;  5JJZ A;  1IBK L;  2PZW A;  3U4V A;  2B2W A;  4L8J A;  2B8G A;  3KDF A;  4DK3 C;  3ITP A;  5E3F A;  4K2K A;  4A93 B;  2F3I A;  1CFM A;  4FXD A;  2Y0S G;  1QUQ A;  2MFI A;  2EYJ A;  5IY0 A;  1M90 C;  1E2V A;  2ZTE A;  5A35 A;  1B9N A;  4IOA A;  1O7I A;  1V9P A;  3R2I A;  1UUP A;  1HRJ A;  2HCC A;  4C3H B;  3RZO B;  2B63 B;  5IP7 H;  1YNN C;  1S5E D;  2A6E C;  3HOY H;  1XPR A;  4KLK A;  4X3S A;  5FLM G;  3T1H L;  3CPF A;  1CK1 A;  1EL0 A;  2KQ3 A;  3ZYY X;  1Y69 U;  3GTJ H;  1QG7 A;  3I8Z A;  1PVO A;  4IPH A;  1C48 A;  1BUV T;  2EYP A;  3M85 A;  1TS2 A;  1YJN A;  2CQO A;  4OIK A;  4K0K L;  2O2L D;  3HOW B;  1N33 L;  1WJJ A;  2CKZ B;  3SDZ A;  3I4N H;  1EOT A;  2KA7 A;  1XX8 A;  2NN6 G;  1LLR D;  2RA4 A;  1LYL A;  1MJE A;  1Q7Y C;  4DV4 L;  5C0X H;  1KAW A;  2ZJP A;  3IKJ A;  1Q8I A;  4POG A;  2RDF A;  4DFA A;  1EOV A;  3BVM A;  2VW9 A;  2B8F A;  1B53 A;  4YY3 L;  1FNW A;  2A74 C;  5I6W A;  3ICE A;  4DV3 L;  4KHV A;  4JI1 Q;  1ZEQ X;  3X3N A;  2R92 G;  3J81 i;  4M1U B;  2EY2 A;  2M9V A;  5EQ0 A;  1SN8 A;  2RDG A;  4HAE A;  2NVX B;  1BCP F;  3S1M B;  2JSO A;  4A76 A;  3HP3 A;  2OEO A;  2VXW A;  3I3C A;  1A2U A;  4OGQ C;  2E2I H;  3P75 A;  3M3Y H;  5EJW A;  1YNJ C;  3S24 A;  2PQA B;  3A0J A;  4WJ3 M;  4HR7 B;  2WIN B;  1S5C D;  1Y14 B;  5IGF A;  4IJH A;  1V8Q A;  3CCV A;  1J5E L;  4KHP Q;  3HOU B;  3CF5 A;  4LWC A;  1EZ8 A;  3A56 A;  3OSO A;  3RLF A;  2XWB B;  4Z9C B;  5KND A;  2WAQ B;  4GLA C;  4P71 A;  1WCM G;  5GAH C;  3I4L A;  2R7Z H;  1D5Z C;  5FKA C;  3S16 H;  5G3L D;  1G51 A;  2Z6K A;  2UUB Q;  5IWA L;  2JXM B;  3PUY A;  4DKA C;  1YJW A;  4JBK A;  1MBY A;  3PIO A;  1PRT C;  5HY6 A;  1CZG A;  2F4I A;  1Y8N B;  2BA1 A;  4HJA A;  2G9D A;  1Z6H A;  1UE7 A;  5CYU A;  1EWC A;  4YCV A;  2C35 B;  1D8L A;  1VMP A;  1H9J A;  3K57 A;  2MO1 A;  1SR3 A;  3KLW A;  3R93 A;  2NZO A;  3D31 A;  4LUZ A;  3PF4 A;  4ZK9 B;  3MEF A;  2EQS A;  3TQY A;  3HOX B;  4K0K Q;  1QNU A;  1O78 A;  1RCV D;  1BBX C;  4LF8 L;  2VUM B;  4UPA A;  1VS0 A;  5EKK A;  1X3G A;  1AP0 A;  3PF5 A;  1S3O A;  2PQA A;  1CT1 D;  1OXV A;  3F2U A;  3EQL C;  4OO1 I;  2ZM6 L;  2X6G A;  1CHP D;  4CHT B;  3CMA A;  4KKU A;  4NPS A;  3TS0 A;  2Q2U A;  4E6I A;  2F3W A;  5M5Y B;  2ALY B;  4XYQ A;  4CJ2 C;  5C0X J;  1HR0 W;  2PO4 A;  2H5X A;  4B3S Q;  5JPM C;  3G6E A;  3VR2 A;  1N34 L;  2KCT A;  1BKB A;  2HHH L;  4DV0 L;  1UE1 A;  4ABN A;  2PPB C;  4B3T L;  4NXM L;  1TS4 A;  4R4Q A;  2PQE A;  1FD7 D;  4JCV E;  3GD7 A;  4TVA B;  1SNQ A;  3AEV A;  1GUG A;  3K5M A;  1YIT A;  5FO9 B;  1QIL A;  1B3Q A;  4CKC A;  2EXD A;  5FJ8 H;  5C44 B;  3F2C A;  2YV5 A;  3L9A X;  4RKL A;  1K8O A;  1TY2 A;  1BR9 A;  2K75 A;  4MNO A;  1EQV A;  1HTP A;  4JI7 L;  2N8N A;  2NVY B;  5IGC A;  3I72 A;  5IP9 G;  4NMZ A;  2UXB Q;  4H13 C;  3K59 A;  1AE3 A;  1LO5 D;  1B70 B;  1ILQ A;  1JR0 D;  3NEM A;  3SXH A;  1SNC A;  2WAQ G;  1JT8 A;  4AYB G;  3PCO B;  4KHZ A;  4BY1 B;  2JA6 B;  1U4P A;  5K5P A;  4G7H C;  1X55 A;  1JWU D;  3D6W A;  4O42 A;  1K8M A;  4BBS B;  4GNX C;  3I4M H;  2G5D A;  5J39 A;  5M3F B;  5J1Z A;  3I70 A;  4UAI A;  4AQY Q;  2WII B;  1E0B A;  3EN2 A;  2LXK A;  3PSI A;  5JVG 3;  3R3O A;  3FMC A;  1PTO C;  1DXM A;  1JJC B;  1TKW B;  1UE5 A;  5M5W B;  1JB7 A;  1VMC A;  1VQB A;  3JAM E;  4RGN A;  5C5L A;  3F8T A;  3RD4 A;  1EWI A;  4H02 A;  1YEZ A;  2ZM6 Q;  1T5E A;  2KJX A;  2WKD A;  3ND9 A;  3U50 C;  2IY5 B;  2VS1 A;  3QG1 A;  1CTM A;  3LWE A;  2NVT B;  1CSQ A;  1CQV A;  3D4D A;  1EFI D;  4JYA Q;  1YNJ D;  4DV6 Q;  3T1H Q;  2B29 A;  2F0K A;  1Z9F A;  3VR4 A;  1I4R A;  4DNR B;  1NR2 A;  2A5H A;  3CRL C;  3TRZ A;  4FF3 A;  4PNY A;  4IFD G;  3CAM A;  4A93 G;  4X65 L;  2RQX A;  2E2I B;  1DGS A;  2JA5 H;  2DJG C;  4DGZ A;  1S4Z A;  1BXT A;  3AU7 A;  2JK8 A;  1I3Q H;  4OEM B;  2HQL A;  4B3M L;  2B39 A;  3NSW A;  3S1M H;  2Q8T A;  3MA2 B;  1A0I A;  1ILP A;  2NVX H;  2XRS D;  5M3M G;  2PYK A;  5KNC A;  1VQP A;  3I55 A;  5G3L F;  3CU7 A;  1TQO A;  2NUC A;  4X3U A;  1R4P B;  4K5V A;  2E2J H;  3K0X A;  2B63 G;  1HA5 A;  1HXY D;  4YY3 Q;  3N6R A;  2KHJ A;  3MZ5 A;  4A3I B;  1X6O A;  5C3E H;  4HID A;  3QR8 A;  2EY5 A;  5I2X A;  1EUJ A;  3FHW A;  3H94 A;  4RA8 A;  5E1F A;  5NUC A;  2N49 A;  5C4X H;  3PO2 G;  4DV1 Q;  1SRU A;  2JQO A;  3NTH A;  1SRO A;  4CDC C;  3GTM H;  4F88 A;  3FKI G;  4JI5 L;  3AB9 A;  2UUA L;  5C4X B;  2Z0S A;  2OWO A;  1L2F A;  2MPM A;  3VYS A;  1HNW Q;  1SE3 A;  2R92 H;  1XMQ Q;  3H15 A;  4CBV A;  3GQB A;  1L0X B;  2L9H A;  2K33 A;  5FK9 C;  3PUX A;  5ISR A;  4DR1 Q;  1YNN D;  3T53 B;  3TME A;  3SHL A;  5GAE C;  1TWH H;  1A3T A;  2I07 B;  1AEX A;  1HA6 A;  1A3V A;  3V05 A;  4JK1 C;  4YWK A;  2ID0 A;  5CV8 A;  1B44 D;  3T1Y Q;  1QVG A;  3ONA B;  4DV7 Q;  1FGU A;  1HNZ Q;  1WTW A;  1SYD A;  1VF7 A;  1HR0 L;  1PMR A;  5T1I A;  3M4P A;  4YCW A;  1G2T A;  5EPL A;  1BOS A;  4P2C B;  1I4X A;  2A69 D;  1F9S A;  4YCU A;  1HQM C;  1EY6 A;  4A3M B;  3VR6 A;  3S2H B;  1EYA A;  3GTK H;  2BA0 A;  4YHH L;  5CR3 A;  2K14 A;  2Y0S B;  1O7Y A;  4A93 H;  2N88 A;  2JA9 A;  3BG3 A;  2HDL A;  5IT9 c;  5A2Q L;  1J8I A;  1UWV A;  4X6A H;  1GUS A;  2KBN A;  1M1K C;  2QIL A;  1QUQ B;  1VQ4 A;  3S14 B;  4EQO A;  1E2W A;  2TMP A;  2VB3 X;  3V96 A;  4KJN A;  5C3W A;  2NVT H;  2R61 A;  5FLX E;  1WD1 A;  3LX0 A;  2QEX A;  2VZA A;  4B3R L;  1TWH B;  1GUW A;  3TSS A;  4X3T A;  2B2T A;  2JEB I;  1HPC A;  3ERQ A;  3S17 H;  1LTL A;  5DAU A;  1PH5 A;  3GTP H;  3I2Z A;  4RGM A;  4C3I G;  2L5T A;  2IT1 A;  3MVV A;  3M7G A;  5EBC A;  2QW7 A;  1N36 Q;  4DA2 A;  4DAY B;  1WFQ A;  4DV4 Q;  1KDB A;  2V1C C;  4JI8 Q;  1E7Z A;  3KLR A;  3FPP A;  5JAV A;  1YZ6 A;  1PH8 A;  1J9O A;  1CSP A;  5EGT A;  2D5D A;  1STB A;  1VQL A;  3NQT A;  1PFS A;  4QUF A;  3QIA A;  3UDG A;  2B3G A;  1CQF A;  3P7J A;  4OWX B;  3K5O A;  5CBA E;  3OMC A;  4EGV A;  4HJ7 A;  1CZW A;  3DXJ C;  2WFW A;  3OWE B;  4G7Z C;  5BR8 L;  4A3B B;  4KV6 A;  1D7Q A;  2LFN A;  1WVL A;  5LMU Q;  3WOE A;  1KDA A;  3VDY A;  2K28 A;  3LWU A;  4HIM A;  4LFC L;  1TWA H;  1VQJ A;  1JMC A;  4TSS A;  2A73 B;  3PO3 B;  3WDN A;  5DM6 3;  5IT9 L;  4JBW A;  3T51 B;  4FXG C;  2NN6 I;  1X9N A;  3G6J B;  3HKS A;  3M4O B;  4YWL A;  4J8Q A;  1VQI A;  3NK9 A;  1KXL A;  2F0M A;  3CQZ B;  2Q2T A;  5IP9 H;  4DK1 A;  2PCF B;  3S1N H;  2B2U A;  1YHA A;  3DWA A;  3VYR A;  1FNV A;  4A3F B;  1AE2 A;  1SFO H;  3PUV A;  2NTT A;  2JEA I;  4A3L G;  4JPB W;  4GKK Q;  1K8G A;  2FIN B;  5M5W H;  3I56 A;  4HIK A;  1DON A;  4C56 C;  3ERS X;  1LM0 A;  1M4V A;  3E6Z X;  1DJR D;  3NBI A;  3STB C;  2TSS A;  4LNQ A;  4Q5V A;  1N8R C;  2EZV A;  1DOK A;  4NXN Q;  4UP7 A;  1WD0 A;  1ENA A;  3J80 i;  3CPW A;  4DV2 Q;  1XPU A;  1JOR A;  2PZU A;  4DAY A;  4A3E B;  1FGB D;  2PI2 E;  2WB1 B;  3U4Z A;  3C1F A;  4JVZ A;  3KOJ A;  4O1N A;  3RMH A;  3URY A;  1VQ9 A;  3HKZ G;  3TDQ A;  1MIU A;  3C2P A;  1JWS D;  4F87 A;  1BVS A;  4GNX A;  1L0W A;  2CWA A;  1V1P A;  4FF1 A;  4QIW E;  2NVY H;  4P73 A;  2VQF L;  3KBX A;  1CKO A;  2BE5 D;  1TR5 A;  2H1E A;  4QGU A;  4QMG A;  2KEN A;  2AHO B;  2ICI A;  2RF4 A;  2MUY A;  3ND8 A;  1I4Q A;  4XDX A;  1DOL A;  5CC4 A;  1GVP A;  1I4G A;  4FXK C;  2OCE A;  1E1O A;  4OHJ A;  4FO2 A;  1TWF B;  2A68 D;  3PQI A;  1ZYR C;  4WJ4 A;  3HOU H;  4L63 B;  1XPO A;  2L0C A;  2KHS A;  2Z4I A;  1CA5 A;  1U5K A;  4PMB A;  5I6Y A;  1ASZ A;  2L55 A;  3MTS A;  1LTB D;  3HGB A;  3TRE A;  1KNE A;  1OXT A;  1MHW C;  2SEB D;  4ME3 A;  1W3S A;  4ID6 A;  4JI3 Q;  3W1B A;  2EJF C;  3K58 A;  1DD2 A;  5IYC H;  5BN4 A;  4ODG A;  3K80 C;  4X62 Q;  2JA7 B;  1EY5 A;  3KBG A;  3NEN A;  1VQ5 A;  4P75 A;  1WTX A;  4ZYS A;  1I4P A;  1HHV A;  5TSS A;  2LXJ A;  4DNT B;  1JE5 A;  2BDO A;  3S9W A;  4DUY L;  5ELN A;  4C1N K;  2BDN A;  1HNZ L;  2D2C C;  3CW2 C;  3HOX H;  3NPP A;  2I5H A;  2K52 A;  1FL0 A;  3CQZ H;  1PFN A;  3LNN A;  4N8F A;  1KDC A;  4DV0 Q;  4BBR G;  1D5M C;  1JB3 A;  3GV3 A;  4B9W A;  2C9O A;  2XTI A;  1TT2 A;  1KAB A;  4IUP A;  4GLV B;  4OEL B;  4QIW B;  3PIP A;  2L15 A;  1ONL A;  3OW7 A;  2F0F A;  1WI5 A;  1BCP D;  1OXU A;  2HUG A;  2KCM A;  4ZCK A;  3W2D A;  1LT6 D;  1EY4 A;  5I9O A;  4LF9 Q;  4JYA L;  2LSS A;  4IZ8 A;  4PZ6 A;  3W3A A;  4L5S A;  2JA5 G;  1QE6 A;  1F77 A;  2MP1 A;  1C0A A;  2BE5 C;  4GN4 B;  1XNQ Q;  1VQC A;  4LK1 C;  5DM7 3;  3E5S A;  1RF2 D;  1X32 A;  1EQQ A;  4GN3 B;  1GUT A;  1JOQ A;  4UP9 A;  2R93 G;  3L0O A;  4RCN A;  4XIG S;  1CKM A;  2E74 C;  4FVM A;  3CC4 A;  1JJ2 A;  5EKI A;  1I5F A;  1KL9 A;  2B2U C;  4B3M Q;  1NR4 A;  4DK6 C;  3FPU B;  4A3D G;  1U4M A;  3S15 H;  2DN8 A;  2G9H D;  4C3I B;  1CI3 M;  3M4Q A;  3H3V H;  3KF6 A;  4BWG B;  2L12 A;  2Z8L A;  3IFT A;  3PUZ A;  4K8I A;  3BS1 A;  4CGY B;  3NXW A;  3MFG A;  3SK5 A;  2KCC A;  3W5O A;  3Q23 A;  4KN7 C;  1LT4 D;  1YBY A;  3HS0 C;  1F9R A;  3S2D B;  4BY7 B;  3HZX A;  4JW0 A;  1F2Z A;  2E76 C;  1HCZ A;  5IYB G;  3ERO A;  3SGI A;  1KC8 C;  4LF4 Q;  5FOB B;  4HJ9 A;  1P16 A;  3Q22 A;  4BS9 A;  3I4O A;  2IWH A;  2A69 C;  2Z6B A;  5FO7 B;  1GD7 A;  3CD6 A;  1F9P A;  1SMY C;  1GHK A;  3WWV A;  2B2T C;  2OT2 A;  4LF7 L;  3HRZ C;  5C4X G;  2PMZ B;  1QWY A;  3M4O H;  5IE8 A;  3S2H H;  4B9X A;  4A3M H;  2K5H A;  4NKL A;  1D6E C;  3EA6 A;  1QZG A;  1XNR Q;  2QDL A;  3HOV B;  3T1Y L;  1PTO B;  1TWA B;  5CGK A;  3S1R H;  4RMF A;  1HR0 Q;  4A3G H;  5IOD A;  4R4T A;  4JI4 L;  4P72 A;  1Y1W B;  1RD9 D;  4C3J H;  1VQE A;  3HOY B;  3H3V I;  3H0G G;  3HOZ H;  2B63 H;  3NTK A;  3RZO H;  4A3G B;  4JG2 A;  1UAP A;  1UNS A;  4LF9 L;  5C3E G;  2R6G A;  1MI2 A;  1TU2 B;  1DCZ A;  1FYC A;  3ULL A;  4XQJ A;  1STA A;  4KY6 A;  1LTI D;  4EVO A;  1F2Y A;  3GV6 A;  2UXC Q;  2ZJR A;  1QCB D;  4LF6 L;  4DR7 Q;  1B9M A;  4GLX A;  4JBJ A;  3CCQ A;  1VQ8 A;  4DR3 L;  1IZ6 A;  1RHP A;  1PLF A;  2KVM A;  4I7Z C;  3CCM A;  4DV2 L;  2F3V A;  4DR4 L;  1H95 A;  4LAA A;  1C8C A;  4CKE A;  5C3E B;  3F1Z A;  4A3I H;  4KMU C;  2EY1 A;  2K5Q A;  1WOC A;  1SE2 A;  3A8K E;  3CCJ A; 
#chains in the Genus database with same CATH homology
 4Y7N B;  2DNE A;  2F0G A;  3U9O A;  2M2L A;  2JE6 I;  3H09 A;  3TBI B;  4F7X A;  4A3K B;  4XTC S;  2KUM A;  4DXG A;  2F0N A;  3S15 B;  1PDQ A;  3VR3 A;  1SYB A;  2A6E D;  1H9S B;  3A8J E;  2K5W A;  3H91 A;  2R3Z A;  4IFD I;  4ZUI A;  2Q8R E;  3TP6 A;  3MFY A;  4C3J G;  4V0B A;  3TP7 A;  1GUN A;  5J22 A;  3CRK C;  4N9T A;  1XXG A;  1IHZ A;  2EYL A;  1STE A;  1PZK D;  3QB3 A;  3D4R A;  4F8M A;  3M7N A;  1V43 A;  2DY7 A;  5KNB A;  4N9P A;  3SR1 A;  3Q24 A;  5EBD A;  1L0Y B;  4LMQ D;  1R9T B;  1X3Q A;  3FVQ A;  2EE1 A;  4KI0 A;  2AQ3 B;  3EVQ A;  4XT3 B;  1JCK B;  2KOL A;  3L3O C;  2K1B A;  4XT1 B;  1ESF A;  5LHY 1;  1H9M A;  2HDM A;  2PW5 A;  5JPN C;  2XWJ B;  2E2J B;  3DEP A;  1Y8P B;  1EEI D;  5COR A;  2ZXO A;  1NUC A;  5JEA G;  1IW7 D;  2A68 C;  3K0Y A;  3D4W A;  5K36 H;  2JA5 B;  3EJI A;  3T16 A;  5IIF A;  2XVS A;  1KNA A;  1IKM A;  3OIQ A;  1A3U A;  5KYI A;  3N52 A;  4PV1 C;  1G8Z D;  4B08 A;  2WKC A;  3PV0 A;  1I6H B;  3R2T A;  4U68 A;  4A3D B;  5E4W C;  4IUV A;  1OO9 B;  4GZY C;  1QNK A;  4V19 0;  3A7A B;  3GTQ B;  3X3M A;  4K6D A;  3PMF A;  1ZXT A;  1M8A A;  4U67 3;  2RDH A;  3OOC A;  3NUC A;  4M8A A;  4DAV A;  2GA4 B;  2IPK D;  4IQZ A;  4G4K A;  4UDU C;  1ENF A;  1TWG B;  4YIJ A;  3Q6S A;  4RAU C;  3J81 E;  1CM9 A;  1SMY D;  4IUU A;  4H0L C;  3J7A F;  2EVB A;  1RTO A;  2RKS A;  4IAL A;  2OF1 A;  1EY9 A;  2F0H A;  1BQQ T;  1PFB A;  1H9R A;  2F0I A;  4FYD A;  2F0J A;  1QJO A;  4RGO S;  1RKN A;  3T4A C;  3T13 A;  1S5B D;  1STN A;  1HTL D;  5EPJ A;  1B4O A;  4ZLT F;  4TKO B;  2F0V A;  2CVR A;  4ZKC B;  1EQT A;  1GOZ A;  4OO1 G;  4KJO A;  5FLX L;  2Z4H A;  3PIP 3;  1GXD C;  1HFN A;  3JAM L;  4MIU A;  4Q0F A;  2ZXP A;  3U9S A;  4J1M A;  5BN5 A;  4BBR B;  5D65 A;  1R4Q B;  1LT3 D;  5ELB A;  1Q1E A;  3D3R A;  1IKL A;  2H4O A;  2B2V C;  3TP5 A;  2F0T A;  1PZJ D;  3FRP B;  4IUN A;  1WCM B;  3J80 L;  4WFN 3;  1SYF A;  2NB0 A;  3MC0 B;  4RGT A;  1SEB D;  2N55 A;  2C5C A;  4RHS A;  2FFK B;  3I73 A;  5DNF A;  4IUT A;  3FEW X;  2IX3 A;  2L4N A;  3J7A V;  2MHV A;  1LT5 D;  4KN4 C;  1CHQ D;  2BCO A;  2QKI C;  2EOT A;  1EYD A;  4EQP A;  2YU9 B;  4PQX A;  3PUW A;  1G6Z A;  3S1Q B;  5FO8 B;  1BO0 A;  3PO2 B;  1FNU A;  4KD3 A;  1GHJ A;  1S5D D;  2ZT9 C;  2NZ1 D;  1ET6 A;  5C4Z A;  1RDP D;  1ZYR D;  4K14 A;  3GTK B;  1GJX A;  1W6K A;  3M3Y B;  2EPB A;  3SVM A;  1TS5 A;  2XSC A;  5JOB A;  2IJ0 A;  5IOC A;  2PNR C;  2WP8 J;  5I2Y A;  2DNC A;  3UI2 A;  1Q1B A;  4H44 C;  1PZI D;  2F0W A;  1H9K A;  3DWQ A;  4CJ0 B;  4C3J B;  5C4J B;  1SJH D;  4HED A;  1XYI A;  4ZUJ A;  1Z47 A;  4PMC A;  1SNO A;  3KK7 A;  2F0Q A;  2MJ8 A;  4K5X A;  1EZ6 A;  3A8I E;  1ICW A;  1EY8 A;  1K83 B;  3FDT A;  1SJE D;  1Y1V B;  2A6H D;  1E2Z A;  2F0S A;  2EYO A;  1Q12 A;  1FR3 A;  1G29 1;  4QUC A;  3RZD B;  2SOB A;  3P1H A;  3NTI A;  3K7A B;  2FJ2 A;  2F0D A;  4C2M B;  3GP7 A;  4QB4 A;  2AQ1 B;  2EDG A;  3FKI B;  2I46 A;  2B2W C;  4XQQ A;  1STY A;  1SYE A;  1SBB B;  3S1R B;  2CQA A;  1PTO H;  1BCP B;  4DK0 A;  4QF4 A;  1ML0 D;  1F2M A;  1O7L A;  1CA6 A;  2J0T D;  3KLS A;  5HGT A;  5CBE E;  4TRD A;  1T5X D;  1C4Q A;  3T56 B;  4ULL A;  1AZP A;  2J4X A;  3TN2 A;  2M00 A;  1LTG D;  5I4D A;  4EQN A;  5IGD A;  1PTO F;  1JIC A;  2Q8I B;  1Z7T A;  1PXU A;  1B2T A;  3I4M B;  1V1O A;  1F9Q A;  3SE0 A;  5CV7 A;  5AFW A;  1O7Z A;  2EYF A;  1II3 A;  5C0X G;  3H6M A;  1EEF D;  2L11 A;  4FF4 A;  4HN7 A;  2EYM A;  4R9W A;  2JA8 B;  1DYQ A;  4DAP A;  1U9R A;  1IYU A;  3H0G B;  5IT9 E;  4HTH A;  2K7V A;  3TP8 A;  4KY7 A;  1WTV A;  2XIW A;  4J6H A;  3MXP A;  1WTP A;  2E75 C;  3HEJ A;  3RUZ A;  4ZKB B;  1NAP A;  2D9U A;  2NWG A;  5ELD A;  2QEJ C;  2JYO A;  5ELF A;  1KLG D;  2EJG C;  1PFM A;  2ICE C;  1A15 A;  2NBF A;  4X3K A;  3DHQ A;  2VB2 X;  4AYB B;  5M9O A;  2QDB A;  2AWO A;  4ZRZ A;  1EY7 A;  2RSN A;  2D62 A;  1RTN A;  1D5X C;  5KGU A;  3J81 L;  2A6H C;  2QCP X;  3SK4 A;  3GTL B;  1VF5 C;  5ELE A;  3NBH A;  2IX0 A;  4R8I A;  3TZU A;  1F2L A;  3HKZ B;  2F0U A;  2AUK A;  3MHB A;  3DUZ A;  2IL8 A;  5CV4 A;  1Y8O B;  2ZXR A;  1JE4 A;  1QB5 D;  1KLU D;  2K6A A;  4ZAI A;  1MD2 D;  2FMM A;  2XN9 C;  4FNF A;  5C0X I;  5COY A;  5IGE A;  5DEH A;  1TS3 A;  3VR5 A;  5C3X A;  2JP1 A;  3CHB D;  4C3H G;  3DM1 A;  1OXX K;  4QCL A;  3QO2 A;  4BA1 I;  3VYU A;  1HFG A;  4ILW A;  1ZKO A;  4RFB A;  3KF8 A;  2EXZ A;  2HQE A;  4HCE A;  2Z1C A;  4FF2 A;  3VA5 A;  3GTG B;  4XYO A;  1PTO D;  1SXT A;  5D3I B;  2NTS A;  2K01 A;  3SEB A;  1GUO A;  1SND A;  1WTR A;  3BYY B;  3MXU A;  4K5W A;  1TWC B;  1S5F D;  4HMJ A;  5KIX A;  4DXF A;  2XRQ D;  1BCP C;  4XQN A;  1NSN S;  3K5L A;  3I4N B;  4NP5 A;  2XNA C;  3SK8 A;  4LJZ C;  3E0J A;  1X3P A;  5LL6 S;  2RBM A;  3P20 A;  3S17 B;  4K8J A;  3VYT A;  5LL6 X;  2X69 A;  3BDL A;  2ENB A;  4FP5 D;  2BOS A;  4OL7 A;  4KY5 A;  5JVH 3;  1SNP A;  5IGB A;  1ROD A;  4OO1 H;  4KKT A;  3MXN A;  3K6O A;  2F0O A;  5KEE A;  2KEE A;  2R93 B;  3CKI B;  3NWT A;  3NQI A;  3BVG A;  2F0L A;  2YYZ A;  3C46 A;  1I6V C;  3OPO A;  3J80 E;  1JOO A;  5C6A A;  3NE5 B;  3D8G A;  5JEA J;  1NCV A;  3HG9 A;  2O4X A;  2K05 A;  3SK6 A;  5A2Q E;  2SNS A;  5T1G A;  2OXP A;  4RH6 A;  2QF7 A;  4TQU S;  2CHB D;  2IW3 A;  1SAP A;  5E4X A;  1SE4 A;  1G2S A;  2WV6 D;  2R92 B;  3Q0A A;  4DN4 M;  2DY8 A;  1VDZ A;  4KKS A;  4RKB A;  3OHX C;  3OWF A;  3PIO 3;  4G57 A;  3GTM B;  4MN3 A;  1LTT D;  4S3S A;  1PRT B;  3OIP A;  3KLS X;  3NHH A;  1TY0 A;  1HQR D;  2PZT A;  1V1P B;  1HUM A;  1MSG A;  5K36 G;  1KAA A;  1JWM D;  4WJW A;  3HOZ B;  1OXS C;  4IN3 A;  5C4H A;  3TZD A;  1D1I A;  2F03 A;  2K03 A;  1XTC D;  1EY0 A;  1SDF A;  2K04 A;  1ENC A;  1I4H A;  4KK7 A;  5KYL A;  3MWY W;  3K5N A;  3BVZ A;  1IW7 C;  1BDO A;  5D3D A;  4G7O C;  2E2D C;  3EFX D;  4KTA A;  1AN8 A;  1SYC A;  2EY6 A;  4ZQ3 A;  3IAY A;  5C5M A;  1RJT A;  5JEA H;  1BF4 A;  2LY7 A;  4I65 A;  1LTR D;  2NN6 H;  4HMI A;  4WRD A;  1I3Q B;  1BNZ A;  4WOR A;  1XWE A;  4IUQ A;  1WTQ A;  1WTO A;  2O5J C;  2K5D A;  1IYV A;  1MGS A;  5ELC A;  1UEA B;  3MEH A;  2CW0 C;  3A7L A;  2B2Y C;  3QJY A;  3J7Y W;  1PRT F;  5CV6 A;  3MAQ A;  1JQY D;  5CV5 A;  5BN3 A;  2AWN A;  1LTS D;  1G91 A;  3NP8 A;  1LAB A;  1Q3L A;  1W6J A;  2V4D A;  3H3V C;  1DZ1 A;  4C1N I;  1IL8 A;  1DM0 B;  1TVX A;  3BZD B;  1D1K A;  3G7L A;  3BYT B;  3D6C A;  2X6L A;  4R8N A;  2K32 A;  2SDF A;  2NYZ D;  2J7Z A;  1U4R A;  1STH A;  3IFD A;  1LTA D;  1PRT D;  4K6L A;  1STG A;  3MXG A;  1A2T A;  3I91 A;  3C3L A;  2KED A;  4OIJ A;  4RHR A;  2LMC B;  4HSV A;  3C1E A;  2EJM A;  1SYG A;  4RWS C;  1MSH A;  2E2H B;  3KUP A;  2EYH A;  2L1B A;  2FMC A;  4L6T B;  1O80 A;  2HCI A;  2NVQ B;  2VNU D;  3VA7 A;  2CW0 D;  4DF7 A;  2MGS A;  4DU9 A;  4A3J B;  1D2B A;  4IFD H;  5CMD A;  4CKB A;  3I90 A;  4MHE A;  5M5X B;  1H9S A;  4CJ1 B;  2LS0 1;  1B1Z A;  2KCN A;  2AUJ D;  4IFD J;  1VCI A;  3QWN A;  1I50 B;  2B2V A;  3DMU A;  1KTK A;  1EIG A;  4BA2 I;  1B3A A;  3V2T A;  4H7B A;  1AFP A;  4ME5 A;  2F0P A;  2PW7 A;  5HUR A;  5D14 A;  1EWH A;  4RCO A;  5F2D A;  2KEC A;  3GTO B;  3AMU A;  4HSP A;  3GO5 A;  2RVL A;  1JOK A;  3S16 B;  2FHT A;  2R7Z B;  1ESR A;  1SFO B;  4XXE A;  2WAC A;  3A55 A;  3S1N B;  1ET9 A;  5KRU A;  2B2Y A;  1Q90 A;  2O5I C;  4PMW A;  1EYC A;  1B50 A;  3NWS A;  5M3M B;  3OMG A;  1QOH A;  2F1M A;  1LAC A;  2IX1 A;  2AQ2 B;  1SNM A;  1LV9 A;  3DEO A;  4HCS A;  1HUN A;  1TII D;  3L7Z C;  3IL8 A;  3BDO A;  1EIH A;  4NDX A;  3BDC A;  3A54 A;  3QOJ A;  4IUR A;  1DOM A;  5IGG A;  1PYW D;  1U4L A;  1A6X A;  1AW7 A;  4NW2 A;  1EU4 A;  3WOF A;  2F0E A;  5I9P A;  3O13 A;  5EPK A;  3DWP A;  3GTP B;  3GTJ B;  2LKV A;  4K2L A;  1AZQ A;  5EKL A;  3M4Y A;  4KD4 A;  1JC7 A;  1EU3 A;  3R8B A;  2SNM A;  5CV9 A;  3QOL A;  1SSO A;  2RSO A;  5JJZ A;  2PZW A;  2B2W A;  4L8J A;  2B8G A;  3ITP A;  5E3F A;  4K2K A;  4A93 B;  1CFM A;  4FXD A;  2EYJ A;  1E2V A;  5A35 A;  1B9N A;  3R2I A;  1UUP A;  1HRJ A;  2HCC A;  4C3H B;  3RZO B;  2B63 B;  1YNN C;  1S5E D;  2A6E C;  4X3S A;  1EL0 A;  1CK1 A;  2KQ3 A;  3ZYY X;  1Y69 U;  1QG7 A;  3I8Z A;  1C48 A;  1BUV T;  2EYP A;  3M85 A;  1TS2 A;  4OIK A;  2O2L D;  3HOW B;  3SDZ A;  1EOT A;  2KA7 A;  1XX8 A;  2NN6 G;  1LLR D;  2RA4 A;  5C0X H;  3IKJ A;  1Q8I A;  2RDF A;  4DFA A;  3BVM A;  2B8F A;  1B53 A;  1FNW A;  2A74 C;  5I6W A;  4KHV A;  1ZEQ X;  3X3N A;  4M1U B;  2EY2 A;  2M9V A;  5EQ0 A;  2NVX B;  2RDG A;  4HAE A;  1BCP F;  3S1M B;  2JSO A;  3HP3 A;  2OEO A;  2VXW A;  3I3C A;  1A2U A;  4OGQ C;  3P75 A;  5EJW A;  1YNJ C;  4HR7 B;  2WIN B;  1S5C D;  5IGF A;  1V8Q A;  3HOU B;  1EZ8 A;  3A56 A;  3OSO A;  3RLF A;  2XWB B;  4Z9C B;  5KND A;  2WAQ B;  3I4L A;  1D5Z C;  5FKA C;  5G3L D;  2JXM B;  3PUY A;  1MBY A;  1PRT C;  1CZG A;  2F4I A;  1Y8N B;  2BA1 A;  2G9D A;  1Z6H A;  5CYU A;  1EWC A;  1VMP A;  3K57 A;  1H9J A;  3R93 A;  3D31 A;  4ZK9 B;  3HOX B;  1QNU A;  1O78 A;  1RCV D;  1BBX C;  2VUM B;  5EKK A;  1AP0 A;  1CT1 D;  1OXV A;  3F2U A;  3EQL C;  4OO1 I;  2X6G A;  1CHP D;  4CHT B;  4KKU A;  5M5Y B;  4E6I A;  2F3W A;  4XYQ A;  4CJ2 C;  5C0X J;  2PO4 A;  5JPM C;  3VR2 A;  4ABN A;  2PPB C;  1TS4 A;  2PQE A;  1FD7 D;  3GD7 A;  1SNQ A;  1GUG A;  3K5M A;  5FO9 B;  1QIL A;  4CKC A;  5C44 B;  3L9A X;  4RKL A;  1K8O A;  1TY2 A;  1BR9 A;  1EQV A;  1HTP A;  2NVY B;  5IGC A;  3I72 A;  4NMZ A;  4H13 C;  3K59 A;  1LO5 D;  1ILQ A;  3SXH A;  1JR0 D;  1SNC A;  2JA6 B;  4BY1 B;  4KHZ A;  1U4P A;  5K5P A;  4G7H C;  1JWU D;  3D6W A;  4O42 A;  1K8M A;  4BBS B;  5J39 A;  5M3F B;  5J1Z A;  3I70 A;  4UAI A;  2WII B;  1E0B A;  5JVG 3;  3R3O A;  3FMC A;  1PTO C;  1DXM A;  1TKW B;  5M5W B;  1VMC A;  3JAM E;  4RGN A;  5C5L A;  3RD4 A;  1T5E A;  2KJX A;  2WKD A;  3ND9 A;  2NVT B;  3QG1 A;  1CTM A;  3LWE A;  1CQV A;  3D4D A;  1EFI D;  1YNJ D;  2F0K A;  3VR4 A;  4DNR B;  1I4R A;  1NR2 A;  2A5H A;  3CRL C;  4FF3 A;  4PNY A;  4IFD G;  2RQX A;  2E2I B;  4DGZ A;  1S4Z A;  1BXT A;  3AU7 A;  2B39 A;  3NSW A;  2Q8T A;  3MA2 B;  1ILP A;  2XRS D;  2PYK A;  5KNC A;  5G3L F;  3CU7 A;  1TQO A;  2NUC A;  4X3U A;  1R4P B;  4K5V A;  1HA5 A;  1HXY D;  3N6R A;  3MZ5 A;  4A3I B;  2EY5 A;  5I2X A;  4RA8 A;  3H94 A;  5E1F A;  5NUC A;  3NTH A;  4F88 A;  3AB9 A;  5C4X B;  2MPM A;  3VYS A;  1SE3 A;  4CBV A;  3GQB A;  1L0X B;  2L9H A;  2K33 A;  5FK9 C;  3PUX A;  5ISR A;  1YNN D;  3T53 B;  3TME A;  3SHL A;  1A3T A;  2I07 B;  1AEX A;  1HA6 A;  1A3V A;  3V05 A;  4JK1 C;  2ID0 A;  5CV8 A;  1B44 D;  3ONA B;  1WTW A;  1SYD A;  1VF7 A;  1PMR A;  5T1I A;  1G2T A;  5EPL A;  1BOS A;  4P2C B;  1I4X A;  2A69 D;  1F9S A;  1HQM C;  1EY6 A;  4A3M B;  3VR6 A;  3S2H B;  1EYA A;  2BA0 A;  5CR3 A;  2Y0S B;  1O7Y A;  2N88 A;  3BG3 A;  2HDL A;  5A2Q L;  1J8I A;  1GUS A;  2QIL A;  3S14 B;  4EQO A;  1E2W A;  2TMP A;  2VB3 X;  3V96 A;  4KJN A;  5C3W A;  2R61 A;  5FLX E;  1WD1 A;  3LX0 A;  1TWH B;  1GUW A;  3TSS A;  4X3T A;  2B2T A;  2JEB I;  1HPC A;  3ERQ A;  5DAU A;  4RGM A;  4C3I G;  2L5T A;  2IT1 A;  3MVV A;  3M7G A;  5EBC A;  4DA2 A;  1KDB A;  3KLR A;  3FPP A;  5JAV A;  1J9O A;  5EGT A;  2D5D A;  1STB A;  3NQT A;  4QUF A;  3QIA A;  1CQF A;  3P7J A;  3K5O A;  5CBA E;  3OMC A;  4EGV A;  1CZW A;  3DXJ C;  3OWE B;  4G7Z C;  4A3B B;  4KV6 A;  2LFN A;  1WVL A;  3WOE A;  1KDA A;  2K28 A;  3LWU A;  4TSS A;  2A73 B;  3PO3 B;  3WDN A;  5DM6 3;  5IT9 L;  4JBW A;  3T51 B;  4FXG C;  2NN6 I;  3G6J B;  3M4O B;  4J8Q A;  3NK9 A;  2F0M A;  3CQZ B;  4DK1 A;  2PCF B;  2B2U A;  3DWA A;  3VYR A;  1FNV A;  4A3F B;  3PUV A;  2NTT A;  2JEA I;  2FIN B;  1DON A;  4C56 C;  1M4V A;  3E6Z X;  1DJR D;  3NBI A;  2TSS A;  4Q5V A;  2EZV A;  1DOK A;  1WD0 A;  1ENA A;  1JOR A;  2PZU A;  4DAY A;  4A3E B;  1FGB D;  2WB1 B;  3C1F A;  4O1N A;  3RMH A;  3URY A;  3TDQ A;  3C2P A;  1JWS D;  4F87 A;  1V1P A;  4FF1 A;  3KBX A;  2BE5 D;  1TR5 A;  2H1E A;  4QMG A;  2ICI A;  2MUY A;  3ND8 A;  1I4Q A;  4XDX A;  1DOL A;  5CC4 A;  1I4G A;  4FXK C;  4OHJ A;  1TWF B;  4FO2 A;  2A68 D;  1ZYR C;  4L63 B;  2L0C A;  2KHS A;  2Z4I A;  1CA5 A;  4PMB A;  5I6Y A;  2L55 A;  3MTS A;  1LTB D;  3HGB A;  1KNE A;  1OXT A;  2SEB D;  4ID6 A;  2EJF C;  3K58 A;  1DD2 A;  5BN4 A;  4ODG A;  2JA7 B;  1EY5 A;  3KBG A;  1WTX A;  4ZYS A;  1I4P A;  1HHV A;  5TSS A;  4DNT B;  2BDO A;  3S9W A;  4C1N K;  2BDN A;  2D2C C;  3NPP A;  1PFN A;  3LNN A;  1KDC A;  1D5M C;  1JB3 A;  3GV3 A;  4B9W A;  2C9O A;  1TT2 A;  1KAB A;  4IUP A;  4QIW B;  1ONL A;  3OW7 A;  2F0F A;  1BCP D;  1OXU A;  2HUG A;  3W2D A;  1LT6 D;  1EY4 A;  5I9O A;  4IZ8 A;  3W3A A;  1QE6 A;  1F77 A;  2MP1 A;  2BE5 C;  4LK1 C;  5DM7 3;  3E5S A;  1RF2 D;  1X32 A;  1GUT A;  1JOQ A;  4RCN A;  4XIG S;  2E74 C;  4FVM A;  5EKI A;  2B2U C;  1NR4 A;  3FPU B;  1U4M A;  2DN8 A;  2G9H D;  4C3I B;  1CI3 M;  4BWG B;  2L12 A;  2Z8L A;  3IFT A;  3PUZ A;  4K8I A;  3BS1 A;  4CGY B;  3NXW A;  3MFG A;  3SK5 A;  2KCC A;  3Q23 A;  4KN7 C;  1LT4 D;  3HS0 C;  1F9R A;  3S2D B;  4BY7 B;  3HZX A;  1F2Z A;  2E76 C;  1HCZ A;  3ERO A;  5FOB B;  3Q22 A;  4BS9 A;  2IWH A;  2A69 C;  5FO7 B;  1F9P A;  1SMY C;  1GHK A;  2B2T C;  2OT2 A;  3HRZ C;  2PMZ B;  1QWY A;  4B9X A;  4NKL A;  1D6E C;  3EA6 A;  3HOV B;  1PTO B;  1TWA B;  5CGK A;  5IOD A;  1Y1W B;  1RD9 D;  3HOY B;  3NTK A;  4A3G B;  1UAP A;  1UNS A;  2R6G A;  1TU2 B;  1MI2 A;  1DCZ A;  1FYC A;  4XQJ A;  1STA A;  4KY6 A;  1LTI D;  4EVO A;  1F2Y A;  3GV6 A;  1QCB D;  1B9M A;  1RHP A;  1PLF A;  2KVM A;  4I7Z C;  2F3V A;  4LAA A;  1C8C A;  4CKE A;  5C3E B;  4KMU C;  2EY1 A;  2K5Q A;  1SE2 A;  3A8K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...