1PFBA

Structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Polycomb protein
publication title Structural basis for specific binding of Polycomb chromodomain to histone H3 methylated at Lys 27.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfbA00
1VMPA 1B3AA 5CMDA 1X3PA 1F9RA 5E4XA 1F9QA 3H91A 4ZAIA 1AZQA 4LMQD 3GV6A 4CJ0B 1WTPA 4NW2A 4X3UA 1BF4A 1HUNA 1RJTA 4ZKBB 2JP1A 1WTWA 3DEPA 2MJ8A 4IUPA 4R9WA 1IKMA 1EQTA 1PLFA 2HUGA 3GV3A 2M2LA 3HP3A 1LV9A 1BNZA 1ESRA 2CVRA 5DNFA 2KEEA 3ONAB 4DN4M 5CBAE 2B2VC 3I8ZA 1XX8A 1MSGA 1WTQA 2SDFA 1G91A 1Q3LA 4ZLTF 4U68A 1B2TA 2K1BA 3QO2A 3I91A 4OIKA 1WD0A 5T1GA 3SVMA 1U4RA 1IKLA 2NWGA 1TVXA 5AFWA 4CJ2C 2B2UC 1F2LA 1RHPA 1KNEA 2B2TC 2J7ZA 2JYOA 2EE1A 2NZ1D 2XIWA 1ICWA 4HSVA 1GUWA 1A15A 4RWSC 5EJWA 4XT3B 1HFGA 3IFDA 3KUPA 2N88A 5EPJA 2B2TA 5T1IA 1QNKA 1XYIA 1DOMA 2FINB 4RA8A 5EPLA 4IURA 2FMMA 3R93A 2BDNA 2EOTA 1DOKA 3D6WA 1X32A 3FDTA 1WTOA 1S4ZA 1DZ1A 4CJ1B 1ML0D 1WD1A 2KEDA 2Q8RE 3F2UA 5EKIA 1PDQA 4X3KA 2IL8A 1CM9A 4IUQA 1NAPA 1O80A 5D65A 4R8IA 2RSNA 2RVLA 2D9UA 1QE6A 2HDLA 2L9HA 5CORA 2KUMA 1SSOA 1MI2A 2FJ2A 2L4NA 4HEDA 1NR2A 2B2VA 4IUTA 1EL0A 2L12A 1EIGA 1JICA 2KVMA 1EIHA 2K03A 1WTVA 1MSHA 1DOLA 1HUMA 2HDMA 1G2TA 1J9OA 3IL8A 1HA6A 1IL8A 1O7ZA 2B2UA 3DM1A 1ZXTA 1AP0A 1B53A 4XDXA 4O42A 1DONA 2KOLA 3P7JA 1WTRA 1X3QA 5EPKA 1NR4A 2B2YC 1WTXA 4HAEA 1RTOA 2L11A 2K04A 2R3ZA 2K01A 2FFKB 2H1EA 3TN2A 4XT1B 3UI2A 4UAIA 1SAPA 4IUUA 2X6GA 4RAUC 1M8AA 1PFBA 3MWYW 2KECA 2HCCA 1O7YA 4ZKCB 4MN3A 1KNAA 1WVLA 2MPMA 2DY8A 1B4OA 2K28A 1RODA 2RA4A 1C8CA 2L1BA 3I90A 2HCIA 2K05A 4HCSA 1MGSA 1CA5A 2MP1A 3N52A 1EOTA 1JE4A 2DY7A 1BO0A 3DEOA 3LWEA 2NYZD 1HFNA 2RSOA 1PFNA 4QUCA 4X3TA 1F9PA 1BBXC 2B2WC 1NCVA 1PFMA 1G2SA 1QG7A 3I3CA 5E4WC 2X6LA 3FPUB 1U4MA 1U4LA 2VXWA 4IUVA 4MHEA 3TZDA 5JJZA 1ILQA 1VMCA 1RTNA 3MTSA 2B2WA 2FHTA 5COYA 1ILPA 2Q8TA 3G7LA 4ZK9B 1U4PA 1AZPA 2B2YA 1CA6A 1HHVA 1HRJA 2EPBA 3Q6SA 4OIJA 5D14A 2MGSA 1B50A 1J8IA 3KBXA 5CBEE 5EQ0A 2X69A 1E0BA 4QUFA 1F9SA 4X3SA 1G6ZA 2N55A 1SDFA
chains in the Genus database with same CATH superfamily
4J8QA 3GTJB 1KAWA 4DR4L 2BH2A 4ODGA 4A3GB 3SK6A 3GV6A 5IIFA 4FF2A 3E3XA 1EIYB 1M1KC 2EYOA 2IX0A 1EYAA 1S5CD 4HIOA 2NVQB 5IP9G 3S17B 1D2BA 1XNRL 1PMRA 5DNFA 4X65L 1IBML 3X3MA 2AUJD 3FP9A 1WTQA 1VQHA 2CCZA 4AQYQ 4JI5L 1Q3LA 4YCWA 1K0SA 5T1GA 3HKZE 2AWNA 2NZ1D 3E6ZX 4B3MQ 3IKJA 2Z6KA 3J80c 5EJWA 2RBMA 1RDPD 2NBFA 2YYZA 4IO9A 4B3ML 2B2TA 2PZTA 1TKWB 4RA8A 5EPLA 1XJVA 1K8GA 4Y7NH 2TSSA 4JI7Q 1UEBA 2V4DA 4R4QA 3A5UA 1GJXA 1HQRD 2JA5H 3EVQA 3LGJA 1EFID 4XTCS 1PYWD 2ZM6L 2F0EA 4R8IA 2RSNA 2DUDA 3GTQH 1TWCB 1SNQA 3FEWX 4EQ5A 4GLVB 1WTVA 3IAYA 4AYBB 2Z4HA 1VQ4A 4JI2Q 1LTAD 2R61A 2A6HD 3A54A 4DK1A 5AJ3L 1YVCA 1VS0A 2Z9HA 1VQ8A 4JI2L 1E3PA 1FYCA 4XDXA 5GAHC 1GXDC 1DONA 1WTRA 4AYBG 2RF4A 4HAEA 2BA0A 5DM63 2YTVA 4OEMB 3CCSA 4BY1B 3H15A 3A0JA 3UDIA 2HCCA 3SGIA 1TIID 5IYDG 1JOKA 1LTBD 4DK3C 2DY8A 1HQMC 2JEAI 1PRTD 3V2TA 2F0GA 4G57A 4LF5Q 1XTDA 4WRDA 1V1OA 3GTLH 1A2TA 4ZYSA 2E2IH 4IFDI 4NP5A 1A3TA 4QIWB 4BY7B 2XGTA 4HIMA 4LUZA 5JPMC 5COYA 2KHIA 1HRJA 3I4NH 3U50C 4HJ5A 3GTGB 4JW0A 1A2UA 3PMFA 4HJ7A 5IP7H 1VQFA 3TSSA 2F0FA 4RGNA 3HOYB 2ALYB 1Q12A 3NQIA 4A3MB 4BA1I 1EY0A 1H9MA 1TXYA 2MNAA 5I6WA 4X3UA 2XSCA 2D2CC 3HOYG 1LTLA 2MJ8A 4NPSA 1F77A 2Z8LA 5M3MH 1IL2A 4PZ6A 1EY6A 4P73A 1PH5A 3CD6A 1NBWA 3L3OC 3T16A 1STYA 3SVMA 1V9PA 5ELBA 1HNZQ 4IFDH 4HSVA 1LO5D 1NMGA 4XT3B 5LL6S 2VNUD 3EQLC 5C0XH 5M3FH 1DOKA 4DV1Q 1S4ZA 4L6TB 4XQJA 4K2KA 3CW2C 1I6VC 4KY6A 1SROA 3T13A 2VZAA 2IL8A 3H3VI 4WORA 1PTOB 1IYVA 3QR8A 3CCMA 1HR0Q 2EQSA 4KJOA 1KXLA 1VF7A 1HR0L 3PO3H 5J22A 2DNEA 4ZUIA 4DR6L 5JJKA 2CQAA 1WTXA 2CHBD 3D4RA 1UAPA 2K04A 1BBWA 1D5ZC 3R2TA 4OX9Q 1M8AA 4ZKCB 4BXXG 2AUKA 3HOUG 3MFYA 4DAYB 4J15A 3NPPA 3IFTA 3NBIA 2QA4A 4A3EG 3GTMB 1SNPA 2BOSA 3HKSA 3J80i 3H3VH 1BBUA 2AKWB 1D5XC 3U58A 1Y1WH 2R7ZB 1N36L 4A3KH 2KJXA 5IGEA 3TBIB 1FL0A 2OTLA 2R7ZG 3KLSA 4GKJQ 4K8JA 5FOBB 1TWGH 4OIJA 2A8VA 4RKLA 4X62L 3T4AC 3KLSX 3QG1A 3PIPA 5E3FA 3BDLA 4NXNL 3VR6A 5KYLA 3HOVB 2CH4W 2NB0A 1WTPA 3CHBD 2PMZE 1BF4A 2A73B 1OXSC 2YTXA 3A55A 2K6AA 3QB3A 1PYSB 1MKHA 4I65A 3DWAA 1Z47A 1P8LA 1CK1A 5FLMG 3BZDB 1PH4A 3C2PA 4B9WA 3M9BA 4DR1Q 2JK8A 3RN2A 1RCVD 1TT2A 1ASYA 3HOWB 2B2UC 2UXBQ 1CUKA 1PH1A 3U4ZA 4UY8C 1Q90A 2FINB 2Q8IB 1DZ1A 2EOTA 4PMWA 3RLNA 2OT2A 3HKZB 1ML0D 1PRTB 5IYBH 2NVTH 3P75A 4X3KA 1XNQL 2UU9Q 1HTPA 5D65A 3OMCA 2D9UA 3HKZG 4JBJA 4C3HG 2FJ2A 1NR2A 2C5CA 3GTOB 1A8VA 3S14H 3AFQA 4O1NA 3MXNA 2R93G 4POGA 4IPDA 2F0OA 3RR5A 3K5MA 5GAGC 1NR4A 3OHXC 1B3QA 1LT4D 3Q22A 3TS2A 3EFXD 1JWMD 3PO2B 1SAPA 4YHHQ 1VQBA 2AWOA 3I4OA 3M3YH 2E8GA 5ELNA 1N33Q 1KNAA 2PQAA 2NVXB 3ICEA 1EQRA 1IW7C 2RA4A 2H4OA 2A6EC 3PUWA 1VQPA 3EROA 1Y69U 4K5XA 2MQHA 1TWAB 2QW7A 4QUCA 2JA6G 1F9PA 3Q24A 4ALPA 1PFMA 1U4MA 2FMCA 2UUAQ 3I70A 1JORA 3QOJA 2ES2A 1TS4A 1K83B 1CHPD 3G7LA 4DK6C 2K5VA 1ENFA 4GN5A 1SN8A 3H09A 1VQEA 3HRZC 3D0FA 1G6ZA 5TSSA 4V190 3PUZA 2VY3A 1UE5A 1F9QA 1QOHA 4A3FH 1JT8A 4C3IH 3S2DH 1J5EL 4KI0A 4C2MB 5CC4A 1SRUA 2F0VA 1WTWA 3NWTA 4EQOA 4WJ4A 2QKIC 2R92B 4QL5A 1PH9A 1S3OA 1PH7A 2OTJA 1CKNA 3S1NB 1YNND 3E5SA 4LNQA 1IYJB 1PTOC 1UEAB 4ZCKA 4DV4Q 1UWVA 1JCKB 3KF6B 5IWAQ 3R2IA 2NUCA 4J6HA 1VQLA 4RWSC 5A2QE 3HOZH 4JI6Q 1AE2A 5EBDA 2UXCL 4XQQA 3GDEA 5GROA 4GOPB 4C1NI 3NXWA 4BA2I 5BR8Q 2F0DA 1CHQD 3M4YA 4B3SL 2EJGC 2R6GA 4HEDA 2L4NA 4HCEA 2L12A 2KVMA 3SEBA 4GNXB 4PG3A 5KGUA 1BOSA 4OO1I 3A8KE 5D3IB 2IJ0A 3NUCA 4XXEA 4IOCA 3P7JA 3QOLA 5C5MA 2B39A 2RDHA 3FKIB 2L11A 2R3ZA 3WOEA 1HA5A 4JI8Q 4A3CG 1I4HA 4DV2L 3SK4A 1E22A 2IT1A 2E76C 3FKIG 4C1NK 5IODA 3T1YL 4R1JA 4DV5Q 1SE4A 2E75C 2VQFQ 4NB3A 4J1MA 3P20A 3I55A 2PW7A 4FYDA 4JOIC 2VQFL 5JEAH 1HZBA 3M4PA 1EU3A 3G71A 3WOFA 3A8IE 2OXPA 3BYTB 4MHEA 4EX5A 2UUBQ 4LF9L 4HMIA 3CC2A 2XNAC 3J81E 4OO1H 1U4PA 2G9HD 2E2HB 1HZAA 2A6HC 5IT9L 3CCUA 2HHHL 2RHQB 1JJCB 3SE0A 1QILA 2ATWA 3K7UC 3KLRA 3TREA 2F0SA 2PQEA 3I4MH 4HMJA 3URYA 1K0RA 4A3BH 2MFIA 4YY3Q 4A3DG 2LMCB 1HUNA 1DYQA 4ZKBB 3CCEA 1PLFA 2ICEC 1PRTC 3I2ZA 3NENA 1LTSD 2KCCA 1R4QB 3RLOA 4F87A 3UDGA 2WV6D 1UUPA 2OEOA 2K1BA 4EGVA 1QUQB 2NWGA 1KNEA 4JYAQ 1TWFB 2JA8H 1SYBA 3KJPA 4LF6L 1FJGL 3GD7A 3AU7A 1K28A 1L0WA 1W2BA 4I7ZC 5C44G 4A3LG 5JPNC 3BVMA 1WTOA 1SBBB 1QVCA 4YWLA 4UPAA 3U9OA 5LMNQ 2O5IC 1JB3A 1PYBA 1NAPA 1I4GA 3DM3A 3VYTA 1WI5A 1STBA 3T56B 3K5LA 4DV0L 1ZYRD 2K4KA 1XMOQ 3W1BA 4DUZQ 2JSOA 4MIUA 1XMOL 1M90C 2YTYA 1RF2D 2DGYA 1KRTA 4DUZL 3S2HB 5LHY1 3RMHA 1J9OA 1IL8A 3VR2A 4CDFC 1VQGA 1YJNA 3H0GG 2K5HA 5C4JH 3M4OB 4K0KL 3MC0B 3PIOA 3CPWA 3K57A 4BWGB 2CWPA 2AHOB 1Y14B 1VQ5A 3ULLA 2EJMA 2M9VA 4FDBA 3NWSA 4GLXA 1I4XA 2ZXPA 4LF7Q 3S1QH 3D31A 5M5XH 2OWOA 3S1MH 4B9XA 2N78A 5E7NA 1XPRA 4RHRA 1CA5A 1I94L 1H9SB 2WIIB 3HOXB 2F4IA 4OWTB 1E2WA 2OQKA 2Q2IA 1LUZA 5IT9c 3L0OA 1EWIA 2F0TA 2B63G 1U9RA 1G2SA 1X65A 1YZ6A 1N34L 3NP8A 1SNMA 3T1HL 4Q5VA 4BBRH 3ZYYX 1D5MC 1X54A 5KNCA 2B2WA 1HTLD 1TS5A 3K0YA 1KRSA 3K7AH 3GTJH 4PZ7A 4X3SA 5FO8B 4DAMA 5IP9H 4QB4A 5E4XA 3GO5A 1EQQA 5KNBA 2E2JH 5J39A 3EN2A 1RJTA 3ER0A 4IUPA 3JAMc 2VB3X 4G7OC 5IY0A 5M5YH 5CBAE 4GOPC 4LFBL 3DUZA 2EXDA 2RCNA 3OSOA 4U68A 1B2TA 3F2DA 3QO2A 1ET6A 4OIKA 1K8OA 1U0LA 3W2DA 5LMUQ 2NVYB 2J7ZA 3I56A 2JYOA 1EYDA 2N8NA 1W6KA 4CBVA 4YIJA 4RG1A 4KY5A 4GNXC 3BZKA 4PV1C 1YITA 1I3QB 1XXGA 4R4TA 4EQPA 4C3JB 3LWUA 3J7ZC 3G6EA 4BS9A 2BDNA 2XWJB 2LFNA 4JC0A 5IGFA 2PYKA 1XNRQ 1IBMQ 4X65Q 3K0XA 4C3JG 4A3JB 1XPUA 4A3GG 2J0TD 3DMUA 3CC7A 4JI5Q 5KYIA 2F03A 2O2LD 3AMUA 3V05A 4OWWB 1H9KA 4RKBA 4A3JG 1MI2A 2NN6G 1KIXA 2B2VA 3CCRA 1YNXA 1EWCA 5KNDA 2OCEA 4X64L 1QZGA 4CDEC 3DM1A 3N6RA 1JB7A 1AW7A 5IYDH 5JJIA 3KF8B 1SE8A 3GTPH 1RD9D 5F2DA 4CDDC 1YJWA 2EYPA 1B1ZA 4CHTB 5JOBA 2ZTDA 1N32L 2K32A 2F0JA 2ZM6Q 1SFOB 1Z7TA 1Q1BA 1EEID 2BE5D 2SOBA 4B3TQ 4MN3A 1PFSA 5ELDA 2WINB 1E2VA 1CFMA 4KD4A 3RZDH 1IBKL 4B3TL 1RODA 3MA2B 5C3EH 1KLUD 2HCIA 2XRSD 5FK9C 4YWKA 1OXTA 2BCOA 4XYQA 5AJ3Q 1L1OA 4QGUA 4GN3B 3GQBA 2E74C 4FXKC 5A35A 2Y0SE 4IPCA 1CQVA 2E5LQ 3MHBA 3AYHB 4N8X1 5EBCA 2J4XA 1JQYD 2E5LL 1ASZA 1VMCA 3D3RA 4U673 3DXJC 2VQEL 4K14A 5D14A 1XTCD 3K58A 1LTGD 4QUFA 4A93B 5GAEC 4BY1G 1MHWC 1B44D 3ZJYC 2KECA 4CKBA 4LF8L 1X3PA 1MD2D 4OL7A 1WFQA 2PNHA 4F88A 1D6EC 3BZCA 4A93G 2JA7H 2RHSB 1MJEA 4GLAC 5CV8A 4Y7NB 3MAQA 1BNZA 1YBYA 4JBWA 5FLXL 3TP5A 3VYSA 3VR3A 2JA5B 5CV5A 4JV5L 3PUVA 4OONA 1WD0A 3UDFA 4TSSA 1TVXA 3GTQB 2VUMH 2HIXA 3BG3A 2JA5G 4BY7G 3W1GA 1BDOA 4RCNA 1B9NA 3KDFA 1SYCA 1G291 2SEBD 5KIXA 1YI2A 1SNDA 1CKMA 2A69D 3GP7A 5EAYA 3TDQA 2JEBI 1E1OA 4A3MG 1EIFA 4G7ZC 1KQSA 2PO4A 3RN5A 1PTOH 5CV4A 5CORA 2YU9H 1JWSD 3ERQA 5ELOA 1DOLA 5FJ8G 1HUMA 3FHWA 5IYCH 3GTLB 1AP0A 2VL6A 4DR3L 1YNNC 4BXXH 1STHA 2UUCL 1RTOA 2PQAB 4KKSA 3HOUH 3JAMi 2E2IB 4GN4B 2PPBC 1SMYD 3MXPA 3UI2A 4A4IA 4IUUA 4A3EH 2F0HA 4RAUC 2Q2UA 1O7YA 3I4NB 2KBNA 1QNUA 2F0QA 3PF5A 1X55A 1ESFA 4K5WA 1I50H 3I4NG 4HCSA 1BCPF 3N52A 5KEEA 1EOTA 3CKIB 4F8MA 2R7ZH 3CQZH 4DR6Q 2RSOA 2I46A 3CP0A 1NCVA 1JMCA 1BUVT 3L2PA 5M3MB 1T5XD 4KY7A 1PH3A 1STNA 3EBEA 2FHTA 1AZPA 4RFBA 2WB1E 2LKVA 5M3MG 2K14A 3A7AB 4K6LA 4DR7Q 1QZHA 4IALA 4LFAL 1B3AA 2EY2A 4HR7B 4DR7L 5FLXc 5FLMH 3F2BA 2ZJPA 3S1RH 2A19A 3AB9A 2N49A 1N36Q 3L7ZC 2WP8J 3OPOA 1CKNB 2G5DA 3DEPA 5M3FB 4FXGC 1I4QA 4UP7A 2N3SA 1MSGA 5C0XG 1EU4A 5M3FG 2WAQE 4ZLTF 1B8AA 4DXGA 4X62Q 3CMEA 2VS1A 1KDAA 2KHSA 2JA9A 1ONLA 3VDYA 4KHPL 3M4QA 2EE1A 1RL2A 1ICWA 2SNMA 1AFPA 4NXNQ 1GUWA 2XN9C 2EDGA 4N8FA 2F0NA 4P2CB 2PI2A 3OYYA 4C3HH 2I5LX 1ICFB 1YEZA 5CR3A 3ND8A 3R3OA 3HOVG 1HNWQ 3FRPB 1N8RC 5NUCA 1EEFD 1CM9A 4Y52H 1KABA 1HNWL 2CFMA 2RVLA 2DNCA 2R93H 3DWPA 3I72A 1EYGA 2IX1A 3NTKA 5C3WA 4R4IA 1H95A 4DA2A 4DR5L 1STGA 3NBHB 1YJ9A 1W3SA 1LT6D 1DXMA 1HA6A 4L5RC 3HZXA 3K81C 3MFGA 3PUYA 5HGQA 5JAVA 3HOWG 4QJFA 1Y1WB 1X3QA 5EPKA 4A3KB 4BBSB 1AE3A 1XWEA 3OIQA 3RD4A 2F3VA 3F8TA 1XNQQ 2R7FA 3J81j 3GTKH 2X6GA 1CQFA 1Y1WG 4A3KG 1VQMA 4M8AA 3BS1A 4BBSG 1TWGB 3JAME 1F2ZA 1YNJD 2MPMA 3NEMA 4DU9A 4G7HC 2JA6H 1LTID 1CTMA 3HFZB 2K05A 5IGGA 1H9RA 3CXCA 1CT1D 2V1CC 3HS0C 1FVIA 3LWEA 4UHVA 3LNNA 2B29A 4WJ3M 4JI3L 1ZYRC 4H7BA 5JJLA 4KKUA 3RZOB 2A68C 1A3UA 1Y1VH 1ILQA 3MTSA 4ABNA 1PH8A 1FNUA 4NXML 2Y0SB 3PQIA 4KN4C 3UE1A 5DAUA 1STAA 3MZ5A 1Q86C 3CCJA 3PO2G 1VMPA 2PZWA 2OF1A 1TS3A 4CGYB 2Y0SG 4OWXB 3PSIA 3STBD 2O5JC 2F0WA 3F2CA 3HP3A 1LV9A 4IN3A 1V1PB 3KYHC 2FXQA 2KEEA 3J80E 1EYCA 4MTNA 4QCLA 3S15H 2EJFC 4A75A 1G91A 1GVPA 2LS01 1GD7A 4K8IA 3B6YA 5ELEA 3KBGA 4JI0Q 1C4QA 1J5EQ 3S14B 5LL6X 4JI0L 4L63B 4B08A 3CCVA 1X32A 1VQOA 1YHAA 4CJ1B 2HQEA 2AMCB 1NUCA 3SR1A 3M3YB 2R92G 2K5NA 1UE7A 1EL0A 1Q7YC 1AN8A 1IBLQ 3E9HA 3NELA 4LFCL 1G2TA 2F0LA 4LK1C 1IBLL 3M7NA 2UXCQ 4A3CH 4DAYA 2F4VL 4P71A 1HZCA 3FKIH 1K3RA 4JPBW 1NE3A 3Q23A 3J7AV 5C4XH 1CZWA 3TN2A 1SYDA 2L0CA 4B3SQ 3S16H 3A8JE 2EYLA 1LT3D 2IW3A 1U5KA 2QEJC 5DLQE 4DV3L 2K5DA 4ID6A 1TWHB 2QDLA 4XYOA 2WKCA 3OOCA 2MP1A 3L9AX 4A3FB 1JE4A 4DPGA 1BO0A 1ENCA 4C3IB 5E1FA 3D4DA 2NYZD 3VA7A 3BVGA 3NSWA 4DUYL 1P16A 4R4OA 1QG7A 4CJ0B 4YCVA 1HZ9A 2DN8A 2OQ0A 3TZDA 2QEXA 4DV2Q 1EY4A 5G3LF 3I73A 3T1YQ 1J8IA 4Z9CB 1SNCA 1E24A 5EQ0A 5GQOA 4A3DH 3D4WA 4ZRZA 4HIDA 2PNRC 1R9TB 1S5DD 2YV5A 1XMQL 3HOZB 3MEHA 3A56A 2WB1B 2BE5C 1C9OA 3IRBA 1S5FD 5CV6A 2JP1A 2C9OA 4JBKA 4LF9Q 1LABA 1DM0B 1GO3E 3OWEB 1SXTA 4DV7L 1GM5A 3HOZG 1GUGA 3DWQA 2CVRA 4DNIA 4L8JA 1LM0A 3E9IA 1UE1A 3SDZA 2SDFA 3SK5A 1LLRD 5I9PA 2HHHQ 4Q0FA 1TU2B 3TRZA 2WKDA 5M9OA 3BVZA 5C44H 2A74C 1KDCA 2F1MA 2RQXA 1A15A 2ID0A 2WAQB 4IJHA 5T1IA 2IHEA 3H3VC 3R93A 4DXFA 4DV6Q 1VCIA 4L5QA 1V43A 1JJ2A 4LW1A 4DV6L 4A76A 1L2FA 2Z6BA 3TEHB 2L55A 4X66L 5ISRA 3H0GH 4UP8A 2NTSA 1I5FA 1BCPD 4DR2L 2QF7A 1JICA 5IGBA 4LF6Q 1FJGQ 2CQOA 1MSHA 2ICIA 1E2ZA 2K33A 3IL8A 1UNSA 3M4OH 5EKKA 5M5WH 2SNSA 1FNVA 1ZXTA 1OXXK 1X3FA 3I4LA 4DV0Q 3C1EA 2I5MX 1L1OB 2JN4A 1NSNS 4B3RL 1CZGA 2B63H 1CSPA 4OO1G 3ND9A 4K0KQ 2IHFA 2DY7A 3C1FA 3TP6A 1L0YB 2K50A 4A3BB 5C4HA 3PV0A 2K5WA 1BBXC 3CMAA 2Z0SA 5BN3A 1HNXL 2F0PA 3VR4A 4E6IA 5D3DA 4LJZC 3KK7A 5BN5A 1VDZA 4A3IH 1Y8PB 2B2YA 1UE6A 4GKKL 2MGSA 1X6OA 4FP5D 2NN6I 3ULJA 2F0IA 4P74A 1DGSA 1HR0W 1I94Q 1F9RA 1PZJD 1SMYC 2KCNA 2JXMB 1O7IA 4L5TA 3KF6A 1G8ZD 4L5SA 4IPGA 4R9WA 1NJIC 1N34Q 1IKMA 3T1HQ 2HUGA 2A6ED 1IHZA 1KHIA 1QCBD 3HOXG 3QJYA 4RGMA 1HPCA 3CPFA 1KL9A 4FVMA 1U4RA 1IKLA 2B8GA 4CJ2C 1I6HB 5IOCA 2MO0A 3VR5A 4LF4L 2GA4B 4P75A 4A3GH 1F2MA 3BU2A 3IFDA 2N88A 1Z6HA 2F52A 1QNKA 5C4JB 4GNXA 2NVQH 2G9DA 1BKBA 4IZ8A 3S17H 3TMEA 4A3JH 3J7YW 2NN6H 4LFBQ 2MUYA 3OTOL 1D1IA 3I7FA 2EIFA 3V96A 1QB5D 1TS2A 3S1QB 5I6YA 3K6OA 2L15A 4EQNA 5M5XB 4ME3A 3S1MB 4MTKA 5A2QL 1SNOA 2HDMA 4V0BA 4IUNA 4WJWA 1PTOD 1SMXA 3TP7A 2EY5A 1DCZA 2UXDL 1WCMB 4I7AA 1Q8IA 3EA6A 1EZ8A 2F3IA 1FD7D 2FFKB 2M00A 2EVBA 3JC66 4UAIA 4BBRB 1PFBA 1WCMG 5KRUA 4APVA 1TWCH 3R8BA 3K7AB 4BBRG 1LACA 3G4SA 1MJCA 5I4DA 4QMGA 4JBMA 1MGSA 4X64Q 4DK0A 3KJOA 4FF3A 5CV9A 2KCMA 2F0UA 2E2JB 4X3TA 1HH2P 3RLFA 3FMCA 3ERSX 1N32Q 5M5YB 1A62A 4BY1H 2EYMA 1STEA 2LY7A 1CA6A 4S3SA 4XQNA 4R4CA 1IBKQ 4QF4A 4AQYL 5I2YA 4A93H 1JC7A 4HJ8A 1A6XA 1E0BA 2B8FA 1BVSA 1MBYA 4HTHA 1JOOA 5GADC 1Z9FA 4PNYA 4AIMA 2D5DA 2F0MA 5HURA 5K36G 2K7VA 2GVBA 1QUQA 4OGQC 1T9HA 2ZJQA 4IFDJ 1QVGA 1GUSA 4ZUJA 1BCPB 1YNJC 1NNXA 2EXZA 5C0XJ 4JI7L 4BY7H 3Q8DA 4K5VA 3ONAB 2VQEQ 2B2VC 3J81L 1O7LA 4H02A 3GTGH 1VQKA 2Z6KC 1IZ6A 2E2DC 5AFWA 4LF8Q 5C5LA 1RHPA 3QIAA 2B2TC 3HOYH 4RMFA 2XIWA 3E0JA 1FGUA 2CH4A 4A3MH 3WWVA 2EZVA 3E0EA 4LUVA 1XYIA 3RUZA 1VQCA 1V8QA 3VYUA 2IY5B 3GTPB 2Q8RE 3F2UA 3H6MA 1B9MA 1FGBD 5FJ8H 4JV5Q 5CYUA 2D62A 1ZEQX 4TQUS 1QVFA 3STBC 1SSOA 1L1OC 3RZDB 1KC8C 5C3EB 1EIHA 2RDFA 1E7ZA 3O13A 2EYFA 4LF5L 3NTHA 1C0AA 5C3EG 2QILA 1H9SA 3M7GA 4HN7A 5G3LD 1S40A 3LX0A 4O2DA 4TKOB 5C0XI 1KTKA 2L5TA 3MWYW 4X6AH 1S5ED 3P1HA 4H13C 3MXNB 1B4OA 4R8NA 2QDBA 1JJGA 2ZXRA 1VQNA 3CRLC 3T51B 4DR3Q 1PFNA 1VQAA 2JA7B 2UUCQ 4KTAA 4O0AA 4DF7A 4ZQ3A 1KAAA 3HGBA 5JJZA 1Q81C 1RTNA 2JA7G 3OWFA 1ILPA 2Q8TA 4C56C 1B50A 1WJJA 1K9MC 2X69A 4NMZA 1F9SA 5EKLA 3CU7A 3CC4A 2VUMB 4G4KA 3BDCA 1SDFA 5CMDA 2D0OA 4DAVA 3GTMH 1HNZL 5BN4A 1X9NA 2CW0D 3J81c 3KOJA 3CCQA 4CKCA 4RGOS 5IP7G 2VUMG 1IXRA 4FXDA 3GV3A 4P72A 2F3WA 4MZ9A 4DV1L 4UP9A 3K59A 1GHJA 4DN4M 4HIKA 1S5BD 4TRDA 3I91A 1YHBA 2YU9B 1R4PB 3FPPA 4LFAQ 5K5PA 1CKOA 4M1UB 3K5OA 3OMGA 1SLJA 3MXGA 4GZYC 3HOVH 2LSSA 1JWUD 2O4XA 1CSQA 3MVVA 1MIUA 4IOAA 1D1KA 2PZUA 1EY9A 3FDTA 5J1ZA 1K8MA 4IFDG 2KEDA 2A5HA 3HOUB 1SR3A 1HXYD 3CCLA 5IYCG 3F1ZA 1ENAA 3KF8A 4PMCA 4A3EB 3UDXA 4OX9L 1QE6A 2I07B 3KLWA 2KUMA 2K75A 5I2XA 4KHPQ 5H1SE 3BYYB 3HOWH 5JVH3 1DD2A 4IUTA 1EUJA 1TY0A 1I50B 3ULPA 1S72A 2XTIA 2NZOA 3OW2A 2RDGA 3PO3B 4XIGS 1B7YB 3A74A 2B2UA 3QWNA 3CQZB 4O42A 4BBSH 2KOLA 1SYFA 3SK8A 2DJFC 3PO3G 2R7DA 5L37A 2H1EA 2KCTA 4XT1B 3K5NA 3PIP3 4OXPA 5HGTA 1Q82C 4GKJL 4JG2A 5IT9E 2K5QA 1BXTA 4NKLA 3CAMA 1WVLA 1PV4A 4DR5Q 4UDUC 2BA1A 1C8CA 4KKTA 3GTOH 3I90A 2ZT9C 2CWAA 3PUXA 5C6AA 4JK1C 3S1RB 3K8AA 3W5OA 2IWHA 2A1AA 4FO2A 4ME5A 3I3CA 5C3XA 5CV7A 1BCPC 1SE3A 1XPOA 3RZOH 4IUVA 3PO2H 3EIVA 4H44C 4ZK9B 4RCOA 5LMNW 2NVXH 4GS3A 3UE0A 4DR1L 2F0KA 2I0QA 1X3EA 4HJ9A 1SYEA 4ZAIA 2CKZB 2UXBL 4JI3Q 1TWAH 4NW2A 2WFWA 2JJQA 1PA6A 4C3HB 2M2LA 1PTOF 3CRKC 3H94A 1PH6A 4HSPA 4NXMQ 4KV6A 4QQBX 1K83H 1HCZA 2IPKD 3X3NA 1SJED 2UU9L 1BQQT 2RCFA 2R93B 3VYRA 4AH6A 1GUOA 1GUNA 1PXUA 3SHLA 3PGZA 3KFUA 1LYLA 4C2MH 5EPJA 1DOMA 4JVZA 4IQZA 2R92H 1VQ6A 2ENBA 1PVOA 4ULLA 1KDBA 2B3GA 3PF4A 3TQYA 2NVTB 1WTHA 3GTKB 4YWMA 2TMPA 3S1NH 1PH2A 4YHHL 3A5ZB 1V1QA 1N33L 5IYBG 1JR0D 5JVG3 2JA6B 2Q2HA 1TY2A 3HEJA 2EY6A 2BDOA 1J6QA 2K52A 1EQVA 1TR5A 2D0PA 3T53B 3VA5A 5IGDA 1YHQA 3J81i 1NTGA 1B53A 1A63A 3S24A 2Q2TA 3TP8A 3AEVA 1EOVA 5JEAJ 3G6JB 2K01A 4KD3A 1D7QA 1IYUA 2UUAL 2NZHA 1Y1VB 2KENA 1SJHD 3J7AF 2MO1A 4PZ8A 5J3BA 2GN5A 1Y1VG 1TWHH 4LFCQ 1K3BC 3ITPA 2I5HA 4IPHA 3C3LA 2F4VQ 3MXUA 3DEOA 5DEHA 4HJAA 4DAPA 5FO9B 3AFPA 1EY8A 1W6JA 2VW9A 1H9JA 3FPUB 4N9TA 3J7A5 2LXJA 2PCFB 1C48A 3S15B 1O78A 3HG9A 4RHSA 3DHQA 3K80C 4DV3Q 3MEFA 4KN7C 3TZUA 4DV4L 1R9TH 2EYHA 1Q46A 5IWAL 1EY7A 4PQXA 3H91A 1D8LA 1PRTF 4OELB 1PZID 5DM73 4DUYQ 1AZQA 4LMQD 1GHKA 4JI6L 3S2DB 1QWYA 5CGKA 5HY6A 4JOIA 1EQTA 4KJNA 5I9OA 5ELFA 4A3FG 3NE5B 4C3IG 1EZ6A 5BR8L 2E2HH 1LTTD 1JOQA 3W3AA 4YCUA 1VQ9A 1VQDA 4FNFA 1F2LA 1G51A 4POFA 1JE5A 1XMQQ 4DNTB 1FNWA 1HFGA 3KUPA 1Q1EA 2Z4IA 1AEXA 3NBHA 3D8GA 4DV7Q 1I4RA 5FO7B 2XVSA 2XWBB 1WD1A 5C4XB 2KA7A 4AYBE 5EKIA 2PI2E 2WB1G 4JI8L 2MHVA 4F7XA 4IUQA 2ASBA 3S16B 1O80A 4KHZA 4TVAB 4IJLA 1Y8OB 1B70B 2HDLA 2L9HA 4JI1Q 1VF5C 1GUTA 1X56A 5C4XG 4JI1L 2NTTA 1NMFA 4A3LH 1OXVA 1EIGA 1TWFH 4DV5L 2K03A 2P5ZX 1E1TA 1K8AC 2XRQD 1EWHA 4MNOA 1FR3A 2WACA 4RH6A 2AQ2B 1SE2A 1OTCA 2WAQG 2UUBL 4H0LC 3M85A 4X66Q 1I4PA 1NY4A 3NTIA 2ZTEA 3Q0AA 4DR2Q 1TQOA 2ZTCA 3WDNA 4A3DB 1Y8NB 3S2HH 2HQLA 4QIWE 4QY7A 3EJIA 1SYGA 1LTRD 3OIPA 3PCOB 5FKAC 3CF5A 1HFNA 1HJPA 1PHJA 4YY3L 2VXWA 1YIJA 1KD1C 5FLXE 5JEAG 2EY1A 3FVQA 1ZKOA 2PMZB 2EPBA 2EYJA 3JAML 1V1PA 4B3RQ 5CBEE 4K2LA 5C44B 2A69C 5ELCA 3NK9A 2BH8A 3HOXH 4JYAL 3I4MB 2KHJA 3NHHA 3BDOA 1HNXQ 4CDCC 4KK7A 4CKEA 4NDXA 5C4ZA 3I4MG 2RKSA 1WYDA 1AH9A 1ESRA 1VQJA 1C7YA 3AQQA 3I8ZA 1XX8A 1VQ7A 4A3BG 5LMNL 4GKKQ 4DNRB 3U9SA 2LXKA 3H0GB 2AQ3B 1I6HH 1RIPA 5EGTA 2A68D 3PIO3 5IGCA 4DFAA 4N9PA 4LWCA 1QJOA 2JA8B 4WFN3 5M5WB 2VB2X 1N9WA 3OW7A 4IURA 2C35B 2FMMA 1IW7D 1EY5A 3BJUA 3D6WA 4KMUC 3DLLA 3D6CA 2JA8G 2H5XA 3J80L 4EVOA 1PDQA 4PMBA 2CW0C 1F2YA 1RKNA 3KDFB 2ZJRA 2NVYH 2QGQA 4GOPA 4DGZA 4LF7L 4LF4Q 3A7LA 2B63B 1I3QH 4C3JH 1O7ZA 4LAAA 1GKHA 1WCMH 2PW5A 2HT1A 4JI4Q 1G6PA 1PZKD 2B2YC 1SEBD 3OTOQ 4JI4L 1ET9A 4KHVA 2HIVA 4RGTA 2AQ1B 1GOZA 4DKAC 4A3IB 2JE6I 1Q8KA 3G48A 2Z1CA 2IX3A 3S9WA 1EFWA 1CI3M 2K28A 3TS0A 4KLKA 2L1BA 2QCPX 4JCVE 4A3IG 3RNUA 1OO9B 1WOCA 1K73C 2KQ3A 2DJGC 1A3VA 1KLGD 5IE8A 1II3A 3SXHA 1T5EA 1BR9A 2GVAA 3C46A 2UXDQ 4FF4A 2B2WC 2HD3A 1L0XB 5E4WC 2X6LA 4FF1A 1U4LA 3NQTA 4OHJA 2ZXOA 1LT5D 1SFOH 1X3GA 1DJRD 1HHVA 5K36H 3Q6SA 2JQOA 3KBXA 1A0IA 4ILWA 1VQIA 3U4VA 4LUOA 1M4VA 4K6DA 4DR4Q 5LMUL 2N55A 1OXUA
chains in the Genus database with same CATH topology
4J8QA 3GTJB 4ODGA 4A3GB 3SK6A 3GV6A 5IIFA 4FF2A 2EYOA 2IX0A 1EYAA 1S5CD 2NVQB 3S17B 1D2BA 1PMRA 5DNFA 3X3MA 2AUJD 1WTQA 1Q3LA 5T1GA 2AWNA 2NZ1D 3E6ZX 3IKJA 5EJWA 2RBMA 1RDPD 2NBFA 2YYZA 2B2TA 2PZTA 1TKWB 4RA8A 5EPLA 2TSSA 2V4DA 1GJXA 1HQRD 3EVQA 1EFID 4XTCS 1PYWD 2F0EA 4R8IA 2RSNA 1TWCB 1SNQA 3FEWX 1WTVA 3IAYA 4AYBB 2Z4HA 1LTAD 2R61A 2A6HD 3A54A 4DK1A 1FYCA 4XDXA 1GXDC 1DONA 1WTRA 4HAEA 2BA0A 5DM63 4BY1B 2HCCA 1TIID 1JOKA 1LTBD 2DY8A 1HQMC 2JEAI 1PRTD 3V2TA 2F0GA 4G57A 4WRDA 1V1OA 1A2TA 4ZYSA 4IFDI 4NP5A 1A3TA 4QIWB 4BY7B 5JPMC 5COYA 1HRJA 3GTGB 1A2UA 3PMFA 3TSSA 2F0FA 4RGNA 3HOYB 1Q12A 3NQIA 4A3MB 4BA1I 1EY0A 1H9MA 5I6WA 4X3UA 2XSCA 2D2CC 2MJ8A 1F77A 2Z8LA 1EY6A 3L3OC 3T16A 1STYA 3SVMA 5ELBA 4IFDH 4HSVA 1LO5D 4XT3B 5LL6S 2VNUD 3EQLC 5C0XH 1DOKA 1S4ZA 4L6TB 4XQJA 4K2KA 1I6VC 4KY6A 3T13A 2IL8A 4WORA 1PTOB 1IYVA 4KJOA 1VF7A 5J22A 2DNEA 4ZUIA 2CQAA 1WTXA 2CHBD 3D4RA 1UAPA 2K04A 1D5ZC 3R2TA 1M8AA 4ZKCB 2AUKA 3MFYA 3NPPA 3IFTA 3NBIA 3GTMB 1SNPA 2BOSA 1D5XC 2R7ZB 2KJXA 5IGEA 3TBIB 3KLSA 4K8JA 5FOBB 4OIJA 4RKLA 3T4AC 3KLSX 3QG1A 5E3FA 3BDLA 5KYLA 3VR6A 3HOVB 2NB0A 1WTPA 3CHBD 1BF4A 2A73B 1OXSC 3A55A 2K6AA 3QB3A 4I65A 3DWAA 1Z47A 1CK1A 3BZDB 3C2PA 4B9WA 1RCVD 1TT2A 3HOWB 2B2UC 1Q90A 2FINB 2Q8IB 1DZ1A 2EOTA 4PMWA 2OT2A 3HKZB 1ML0D 1PRTB 3P75A 4X3KA 1HTPA 5D65A 3OMCA 2D9UA 4C3HG 2FJ2A 1NR2A 2C5CA 3GTOB 4O1NA 3MXNA 2F0OA 3K5MA 1NR4A 3OHXC 1LT4D 3Q22A 3EFXD 1JWMD 3PO2B 1SAPA 2AWOA 1KNAA 2NVXB 1IW7C 2RA4A 2H4OA 2A6EC 3PUWA 3EROA 1Y69U 4K5XA 1TWAB 4QUCA 1F9PA 3Q24A 1PFMA 1U4MA 2FMCA 3I70A 1JORA 3QOJA 1TS4A 1K83B 1CHPD 3G7LA 1ENFA 3H09A 3HRZC 1G6ZA 5TSSA 4V190 3PUZA 1F9QA 1QOHA 4KI0A 4C2MB 5CC4A 2F0VA 1WTWA 3NWTA 4EQOA 2QKIC 2R92B 3S1NB 1YNND 3E5SA 1PTOC 1UEAB 1JCKB 3R2IA 2NUCA 4J6HA 4RWSC 5A2QE 5EBDA 4XQQA 4C1NI 3NXWA 4BA2I 2F0DA 1CHQD 3M4YA 2EJGC 2R6GA 4HEDA 2L4NA 4HCEA 2L12A 2KVMA 3SEBA 5KGUA 1BOSA 4OO1I 3A8KE 5D3IB 2IJ0A 3NUCA 4XXEA 3P7JA 3QOLA 5C5MA 2B39A 2RDHA 3FKIB 2L11A 2R3ZA 3WOEA 1HA5A 1I4HA 3SK4A 2IT1A 2E76C 4C1NK 5IODA 1SE4A 2E75C 4J1MA 3P20A 2PW7A 4FYDA 5JEAH 1EU3A 3WOFA 3A8IE 2OXPA 3BYTB 4MHEA 4HMIA 2XNAC 3J81E 4OO1H 1U4PA 2G9HD 2E2HB 2A6HC 5IT9L 3SE0A 1QILA 3KLRA 2F0SA 2PQEA 4HMJA 3URYA 1HUNA 2LMCB 1DYQA 4ZKBB 1PLFA 2ICEC 1PRTC 1LTSD 2KCCA 1R4QB 4F87A 2WV6D 1UUPA 2OEOA 2K1BA 4EGVA 2NWGA 1KNEA 1TWFB 1SYBA 3GD7A 3AU7A 4I7ZC 5JPNC 3BVMA 1WTOA 1SBBB 3U9OA 2O5IC 1JB3A 1NAPA 1I4GA 3K5LA 3VYTA 1STBA 3T56B 1ZYRD 2JSOA 4MIUA 1RF2D 3S2HB 5LHY1 3RMHA 1J9OA 1IL8A 3VR2A 3M4OB 3MC0B 3K57A 4BWGB 2EJMA 2M9VA 3NWSA 1I4XA 2ZXPA 3D31A 4B9XA 4RHRA 1CA5A 3HOXB 1H9SB 2WIIB 2F4IA 1E2WA 2F0TA 1U9RA 1G2SA 3NP8A 1SNMA 4Q5VA 3ZYYX 1D5MC 5KNCA 2B2WA 1HTLD 1TS5A 3K0YA 4X3SA 5FO8B 4QB4A 5E4XA 3GO5A 5KNBA 5J39A 1RJTA 4IUPA 2VB3X 4G7OC 5CBAE 3DUZA 3OSOA 4U68A 1B2TA 3QO2A 1ET6A 4OIKA 1K8OA 3W2DA 2NVYB 2J7ZA 2JYOA 1EYDA 4CBVA 1W6KA 4YIJA 4KY5A 4PV1C 1I3QB 1XXGA 4EQPA 4C3JB 3LWUA 4BS9A 2BDNA 2XWJB 2LFNA 5IGFA 2PYKA 4C3JG 4A3JB 2J0TD 3DMUA 5KYIA 2F03A 2O2LD 3AMUA 3V05A 1H9KA 4RKBA 1MI2A 2NN6G 2B2VA 1EWCA 5KNDA 3DM1A 3N6RA 1AW7A 1RD9D 5F2DA 2EYPA 1B1ZA 4CHTB 5JOBA 2K32A 2F0JA 1SFOB 1Z7TA 1Q1BA 1EEID 2BE5D 2SOBA 4MN3A 5ELDA 2WINB 1E2VA 1CFMA 4KD4A 1RODA 3MA2B 1KLUD 2HCIA 2XRSD 5FK9C 1OXTA 2BCOA 4XYQA 3GQBA 2E74C 4FXKC 5A35A 1CQVA 3MHBA 5EBCA 2J4XA 1JQYD 1VMCA 3D3RA 4U673 3DXJC 4K14A 5D14A 1XTCD 3K58A 1LTGD 4QUFA 4A93B 1B44D 4CKBA 2KECA 1X3PA 1MD2D 4OL7A 4F88A 1D6EC 5CV8A 4Y7NB 3MAQA 1BNZA 4JBWA 5FLXL 3TP5A 3VYSA 3VR3A 2JA5B 5CV5A 3PUVA 1WD0A 4TSSA 1TVXA 3GTQB 3BG3A 1BDOA 4RCNA 1B9NA 1SYCA 1G291 2SEBD 5KIXA 1SNDA 2A69D 3GP7A 3TDQA 2JEBI 4G7ZC 2PO4A 1PTOH 5CV4A 5CORA 1JWSD 3ERQA 1DOLA 1HUMA 3GTLB 1AP0A 1YNNC 1STHA 1RTOA 4KKSA 2E2IB 2PPBC 1SMYD 3MXPA 3UI2A 4IUUA 2F0HA 4RAUC 1O7YA 3I4NB 1QNUA 2F0QA 1ESFA 4K5WA 4HCSA 1BCPF 5KEEA 3N52A 1EOTA 3CKIB 4F8MA 2RSOA 2I46A 1NCVA 1BUVT 5M3MB 1T5XD 4KY7A 1STNA 2FHTA 1AZPA 4RFBA 2LKVA 3A7AB 4K6LA 4IALA 1B3AA 2EY2A 4HR7B 3AB9A 3L7ZC 2WP8J 3OPOA 5M3FB 3DEPA 4FXGC 1I4QA 1MSGA 5C0XG 1EU4A 4ZLTF 4DXGA 1KDAA 2KHSA 1ONLA 2EE1A 1ICWA 2SNMA 1AFPA 1GUWA 2XN9C 2EDGA 2F0NA 4P2CB 5CR3A 3ND8A 3R3OA 3FRPB 5NUCA 1EEFD 1CM9A 1KABA 2RVLA 2DNCA 3DWPA 3I72A 2IX1A 3NTKA 5C3WA 4DA2A 1STGA 1LT6D 1DXMA 1HA6A 3HZXA 3PUYA 3MFGA 5JAVA 1Y1WB 1X3QA 5EPKA 4A3KB 4BBSB 1XWEA 3OIQA 3RD4A 2F3VA 2X6GA 1CQFA 4M8AA 3BS1A 1TWGB 3JAME 1F2ZA 1YNJD 2MPMA 4DU9A 4G7HC 1LTID 1CTMA 2K05A 5IGGA 1H9RA 1CT1D 3HS0C 3LWEA 3LNNA 1ZYRC 4H7BA 4KKUA 3RZOB 2A68C 1A3UA 1ILQA 3MTSA 4ABNA 1FNUA 2Y0SB 4KN4C 5DAUA 1STAA 3MZ5A 1VMPA 2PZWA 2OF1A 1TS3A 4CGYB 2O5JC 2F0WA 3HP3A 1LV9A 4IN3A 1V1PB 2KEEA 3J80E 1EYCA 4QCLA 2EJFC 1G91A 2LS01 4K8IA 5ELEA 3KBGA 1C4QA 3S14B 5LL6X 4L63B 4B08A 1X32A 4CJ1B 2HQEA 1NUCA 3SR1A 3M3YB 1EL0A 1AN8A 1G2TA 2F0LA 4LK1C 3M7NA 4DAYA 3Q23A 3J7AV 1CZWA 3TN2A 1SYDA 2L0CA 3A8JE 2EYLA 1LT3D 2IW3A 2QEJC 2K5DA 4ID6A 1TWHB 4XYOA 2WKCA 3OOCA 2MP1A 3L9AX 4A3FB 1JE4A 4C3IB 1BO0A 1ENCA 5E1FA 3D4DA 2NYZD 3VA7A 3BVGA 3NSWA 1QG7A 4CJ0B 2DN8A 3TZDA 1EY4A 5G3LF 3I73A 1J8IA 4Z9CB 1SNCA 5EQ0A 3D4WA 4ZRZA 2PNRC 1R9TB 1S5DD 3HOZB 3MEHA 3A56A 2WB1B 2BE5C 1S5FD 5CV6A 2JP1A 2C9OA 1LABA 1DM0B 3OWEB 1SXTA 1GUGA 3DWQA 2CVRA 4L8JA 3SDZA 2SDFA 3SK5A 1LLRD 5I9PA 4Q0FA 1TU2B 2WKDA 5M9OA 3BVZA 2A74C 1KDCA 2F1MA 2RQXA 1A15A 2ID0A 2WAQB 5T1IA 3H3VC 3R93A 4DXFA 1VCIA 1V43A 2L55A 5ISRA 2NTSA 1BCPD 2QF7A 1JICA 5IGBA 1MSHA 2ICIA 1E2ZA 2K33A 3IL8A 1UNSA 5EKKA 2SNSA 1FNVA 1ZXTA 1OXXK 3I4LA 3C1EA 1NSNS 1CZGA 4OO1G 3ND9A 2DY7A 3C1FA 3TP6A 1L0YB 4A3BB 5C4HA 3PV0A 2K5WA 1BBXC 5BN3A 2F0PA 3VR4A 4E6IA 5D3DA 4LJZC 3KK7A 5BN5A 1VDZA 1Y8PB 2B2YA 2MGSA 4FP5D 2NN6I 2F0IA 1F9RA 1PZJD 1SMYC 2KCNA 2JXMB 1G8ZD 4R9WA 1IKMA 2HUGA 2A6ED 1IHZA 1QCBD 3QJYA 4RGMA 1HPCA 4FVMA 1U4RA 1IKLA 2B8GA 4CJ2C 1I6HB 5IOCA 3VR5A 2GA4B 1F2MA 3IFDA 2N88A 1Z6HA 1QNKA 5C4JB 2G9DA 4IZ8A 3TMEA 3J7YW 2NN6H 2MUYA 1D1IA 3V96A 1QB5D 1TS2A 3S1QB 5I6YA 3K6OA 4EQNA 5M5XB 3S1MB 5A2QL 1SNOA 2HDMA 4V0BA 4IUNA 4WJWA 1PTOD 3TP7A 2EY5A 1DCZA 1WCMB 1Q8IA 3EA6A 1EZ8A 1FD7D 2FFKB 2M00A 2EVBA 4UAIA 4BBRB 1PFBA 5KRUA 3R8BA 3K7AB 1LACA 5I4DA 4QMGA 1MGSA 4DK0A 4FF3A 5CV9A 2F0UA 2E2JB 4X3TA 3RLFA 3FMCA 5M5YB 2EYMA 1STEA 2LY7A 1CA6A 4S3SA 4XQNA 4QF4A 5I2YA 1JC7A 1A6XA 1E0BA 2B8FA 1MBYA 4HTHA 1JOOA 4PNYA 2D5DA 2F0MA 5HURA 5K36G 2K7VA 4OGQC 4IFDJ 1GUSA 4ZUJA 1BCPB 1YNJC 2EXZA 5C0XJ 4K5VA 3ONAB 2B2VC 3J81L 1O7LA 2E2DC 5AFWA 5C5LA 1RHPA 3QIAA 2B2TC 2XIWA 3E0JA 2EZVA 1XYIA 3RUZA 1V8QA 3VYUA 3GTPB 2Q8RE 3F2UA 3H6MA 1B9MA 1FGBD 5CYUA 2D62A 1ZEQX 4TQUS 1SSOA 3RZDB 5C3EB 1EIHA 2RDFA 3O13A 2EYFA 3NTHA 2QILA 1H9SA 3M7GA 4HN7A 5G3LD 3LX0A 4TKOB 5C0XI 1KTKA 2L5TA 3MWYW 1S5ED 3P1HA 4H13C 1B4OA 4R8NA 2QDBA 2ZXRA 3CRLC 3T51B 1PFNA 2JA7B 4KTAA 4DF7A 4ZQ3A 1KAAA 3HGBA 5JJZA 1RTNA 3OWFA 1ILPA 2Q8TA 4C56C 1B50A 2X69A 4NMZA 1F9SA 5EKLA 3CU7A 2VUMB 4G4KA 3BDCA 1SDFA 5CMDA 4DAVA 5BN4A 2CW0D 4CKCA 4RGOS 4FXDA 3GV3A 2F3WA 3K59A 1GHJA 4DN4M 1S5BD 4TRDA 3I91A 2YU9B 1R4PB 3FPPA 5K5PA 4M1UB 3K5OA 3OMGA 3MXGA 4GZYC 1JWUD 2O4XA 3MVVA 1D1KA 2PZUA 1EY9A 3FDTA 5J1ZA 1K8MA 4IFDG 2KEDA 2A5HA 3HOUB 1HXYD 1ENAA 3KF8A 4PMCA 4A3EB 1QE6A 2I07B 2KUMA 5I2XA 3BYYB 5JVH3 1DD2A 4IUTA 1TY0A 1I50B 2RDGA 3PO3B 4XIGS 2B2UA 3QWNA 3CQZB 4O42A 2KOLA 1SYFA 3SK8A 2H1EA 3K5NA 4XT1B 3PIP3 5HGTA 5IT9E 2K5QA 1BXTA 4NKLA 1WVLA 4UDUC 2BA1A 1C8CA 4KKTA 3I90A 2ZT9C 5C6AA 3PUXA 4JK1C 3S1RB 2IWHA 4ME5A 4FO2A 3I3CA 5C3XA 5CV7A 1BCPC 1SE3A 4IUVA 4H44C 4ZK9B 4RCOA 2F0KA 1SYEA 4ZAIA 4NW2A 4C3HB 2M2LA 1PTOF 3CRKC 3H94A 4HSPA 4KV6A 1HCZA 2IPKD 3X3NA 1SJED 1BQQT 2R93B 3VYRA 1GUOA 1GUNA 1PXUA 3SHLA 5EPJA 1DOMA 4IQZA 2ENBA 4ULLA 1KDBA 2NVTB 3GTKB 2TMPA 1JR0D 5JVG3 2JA6B 1TY2A 3HEJA 2EY6A 2BDOA 1EQVA 1TR5A 3T53B 3VA5A 5IGDA 1B53A 3TP8A 5JEAJ 3G6JB 2K01A 4KD3A 1IYUA 1Y1VB 1SJHD 3J7AF 3ITPA 3C3LA 3MXUA 3DEOA 5DEHA 4DAPA 5FO9B 1EY8A 1W6JA 1H9JA 3FPUB 4N9TA 2PCFB 1C48A 3S15B 1O78A 3HG9A 4RHSA 3DHQA 4KN7C 3TZUA 2EYHA 1EY7A 4PQXA 3H91A 1PRTF 1PZID 5DM73 1AZQA 4LMQD 1GHKA 3S2DB 1QWYA 5CGKA 1EQTA 4KJNA 5I9OA 5ELFA 3NE5B 4C3IG 1EZ6A 1LTTD 1JOQA 3W3AA 4FNFA 1F2LA 4DNTB 1FNWA 1HFGA 3KUPA 1Q1EA 2Z4IA 1AEXA 3NBHA 3D8GA 1I4RA 5FO7B 2XVSA 2XWBB 1WD1A 5C4XB 2KA7A 5EKIA 2MHVA 4F7XA 4IUQA 3S16B 1O80A 4KHZA 1Y8OB 2HDLA 2L9HA 1VF5C 1GUTA 2NTTA 1OXVA 1EIGA 2K03A 2XRQD 1EWHA 1FR3A 2WACA 4RH6A 2AQ2B 1SE2A 4H0LC 3M85A 1I4PA 3NTIA 3Q0AA 1TQOA 3WDNA 4A3DB 1Y8NB 3EJIA 1SYGA 1LTRD 3OIPA 5FKAC 1HFNA 2VXWA 5FLXE 5JEAG 2EY1A 3FVQA 1ZKOA 2PMZB 2EPBA 2EYJA 3JAML 1V1PA 5CBEE 4K2LA 5C44B 2A69C 5ELCA 3NK9A 3I4MB 3NHHA 3BDOA 4KK7A 4CKEA 4NDXA 5C4ZA 2RKSA 1ESRA 3I8ZA 1XX8A 4DNRB 3U9SA 2AQ3B 3H0GB 5EGTA 2A68D 3PIO3 5IGCA 4DFAA 4N9PA 2JA8B 1QJOA 4WFN3 5M5WB 2VB2X 3OW7A 4IURA 2FMMA 1IW7D 1EY5A 3D6WA 4KMUC 3D6CA 3J80L 4EVOA 1PDQA 4PMBA 2CW0C 1F2YA 1RKNA 4DGZA 3A7LA 2B63B 1O7ZA 4LAAA 2PW5A 1PZKD 2B2YC 1SEBD 1ET9A 4KHVA 4RGTA 2AQ1B 1GOZA 4A3IB 2JE6I 2Z1CA 2IX3A 3S9WA 1CI3M 2K28A 2L1BA 2QCPX 1OO9B 2KQ3A 1A3VA 1KLGD 1II3A 3SXHA 1T5EA 1BR9A 3C46A 4FF4A 2B2WC 1L0XB 5E4WC 2X6LA 4FF1A 1U4LA 3NQTA 4OHJA 2ZXOA 1LT5D 1DJRD 1HHVA 5K36H 3Q6SA 3KBXA 4ILWA 1M4VA 4K6DA 2N55A 1OXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMP A;  1B3A A;  5CMD A;  1X3P A;  1F9R A;  5E4X A;  1F9Q A;  3H91 A;  4ZAI A;  1AZQ A;  4LMQ D;  3GV6 A;  4CJ0 B;  1WTP A;  4NW2 A;  4X3U A;  1BF4 A;  1HUN A;  1RJT A;  4ZKB B;  2JP1 A;  1WTW A;  3DEP A;  2MJ8 A;  4IUP A;  4R9W A;  1IKM A;  1EQT A;  1PLF A;  2HUG A;  3GV3 A;  2M2L A;  3HP3 A;  1LV9 A;  1BNZ A;  1ESR A;  2CVR A;  5DNF A;  2KEE A;  3ONA B;  4DN4 M;  5CBA E;  2B2V C;  3I8Z A;  1XX8 A;  1MSG A;  1WTQ A;  2SDF A;  1G91 A;  1Q3L A;  4ZLT F;  4U68 A;  1B2T A;  2K1B A;  3QO2 A;  3I91 A;  4OIK A;  1WD0 A;  5T1G A;  3SVM A;  1U4R A;  1IKL A;  2NWG A;  1TVX A;  5AFW A;  4CJ2 C;  2B2U C;  1F2L A;  1RHP A;  1KNE A;  2B2T C;  2J7Z A;  2JYO A;  2EE1 A;  2NZ1 D;  2XIW A;  1ICW A;  4HSV A;  1GUW A;  1A15 A;  4RWS C;  5EJW A;  4XT3 B;  1HFG A;  3IFD A;  3KUP A;  2N88 A;  5EPJ A;  2B2T A;  5T1I A;  1QNK A;  1XYI A;  1DOM A;  2FIN B;  4RA8 A;  5EPL A;  4IUR A;  2FMM A;  3R93 A;  2BDN A;  2EOT A;  1DOK A;  3D6W A;  1X32 A;  3FDT A;  1WTO A;  1S4Z A;  1DZ1 A;  4CJ1 B;  1ML0 D;  1WD1 A;  2KED A;  2Q8R E;  3F2U A;  5EKI A;  1PDQ A;  4X3K A;  2IL8 A;  1CM9 A;  4IUQ A;  1NAP A;  1O80 A;  5D65 A;  4R8I A;  2RSN A;  2RVL A;  2D9U A;  1QE6 A;  2HDL A;  2L9H A;  5COR A;  2KUM A;  1SSO A;  1MI2 A;  2FJ2 A;  2L4N A;  4HED A;  1NR2 A;  2B2V A;  4IUT A;  1EL0 A;  2L12 A;  1EIG A;  1JIC A;  2KVM A;  1EIH A;  2K03 A;  1WTV A;  1MSH A;  1DOL A;  1HUM A;  2HDM A;  1G2T A;  1J9O A;  3IL8 A;  1HA6 A;  1IL8 A;  1O7Z A;  2B2U A;  3DM1 A;  1ZXT A;  1AP0 A;  1B53 A;  4XDX A;  4O42 A;  1DON A;  2KOL A;  3P7J A;  1WTR A;  1X3Q A;  5EPK A;  1NR4 A;  2B2Y C;  1WTX A;  4HAE A;  1RTO A;  2L11 A;  2K04 A;  2R3Z A;  2K01 A;  2FFK B;  2H1E A;  3TN2 A;  4XT1 B;  3UI2 A;  4UAI A;  1SAP A;  4IUU A;  2X6G A;  4RAU C;  1M8A A;  1PFB A;  3MWY W;  2KEC A;  2HCC A;  1O7Y A;  4ZKC B;  4MN3 A;  1KNA A;  1WVL A;  2MPM A;  2DY8 A;  1B4O A;  2K28 A;  1ROD A;  2RA4 A;  1C8C A;  2L1B A;  3I90 A;  2HCI A;  2K05 A;  4HCS A;  1MGS A;  1CA5 A;  2MP1 A;  3N52 A;  1EOT A;  1JE4 A;  2DY7 A;  1BO0 A;  3DEO A;  3LWE A;  2NYZ D;  1HFN A;  2RSO A;  1PFN A;  4QUC A;  4X3T A;  1F9P A;  1BBX C;  2B2W C;  1NCV A;  1PFM A;  1G2S A;  1QG7 A;  3I3C A;  5E4W C;  2X6L A;  3FPU B;  1U4M A;  1U4L A;  2VXW A;  4IUV A;  4MHE A;  3TZD A;  5JJZ A;  1ILQ A;  1VMC A;  1RTN A;  3MTS A;  2B2W A;  2FHT A;  5COY A;  1ILP A;  2Q8T A;  3G7L A;  4ZK9 B;  1U4P A;  1AZP A;  2B2Y A;  1CA6 A;  1HHV A;  1HRJ A;  2EPB A;  3Q6S A;  4OIJ A;  5D14 A;  2MGS A;  1B50 A;  1J8I A;  3KBX A;  5CBE E;  5EQ0 A;  2X69 A;  1E0B A;  4QUF A;  1F9S A;  4X3S A;  1G6Z A;  2N55 A;  1SDF A; 
#chains in the Genus database with same CATH topology
 4J8Q A;  3GTJ B;  1KAW A;  4DR4 L;  2BH2 A;  4ODG A;  4A3G B;  3SK6 A;  3GV6 A;  5IIF A;  4FF2 A;  3E3X A;  1EIY B;  1M1K C;  2EYO A;  2IX0 A;  1EYA A;  1S5C D;  4HIO A;  2NVQ B;  5IP9 G;  3S17 B;  1D2B A;  1XNR L;  1PMR A;  5DNF A;  4X65 L;  1IBM L;  3X3M A;  2AUJ D;  3FP9 A;  1WTQ A;  1VQH A;  2CCZ A;  4AQY Q;  4JI5 L;  1Q3L A;  4YCW A;  1K0S A;  5T1G A;  3HKZ E;  2AWN A;  2NZ1 D;  3E6Z X;  4B3M Q;  3IKJ A;  2Z6K A;  3J80 c;  5EJW A;  2RBM A;  1RDP D;  2NBF A;  2YYZ A;  4IO9 A;  4B3M L;  2B2T A;  2PZT A;  1TKW B;  4RA8 A;  5EPL A;  1XJV A;  1K8G A;  4Y7N H;  2TSS A;  4JI7 Q;  1UEB A;  2V4D A;  4R4Q A;  3A5U A;  1GJX A;  1HQR D;  2JA5 H;  3EVQ A;  3LGJ A;  1EFI D;  4XTC S;  1PYW D;  2ZM6 L;  2F0E A;  4R8I A;  2RSN A;  2DUD A;  3GTQ H;  1TWC B;  1SNQ A;  3FEW X;  4EQ5 A;  4GLV B;  1WTV A;  3IAY A;  4AYB B;  2Z4H A;  1VQ4 A;  4JI2 Q;  1LTA D;  2R61 A;  2A6H D;  3A54 A;  4DK1 A;  5AJ3 L;  1YVC A;  1VS0 A;  2Z9H A;  1VQ8 A;  4JI2 L;  1E3P A;  1FYC A;  4XDX A;  5GAH C;  1GXD C;  1DON A;  1WTR A;  4AYB G;  2RF4 A;  4HAE A;  2BA0 A;  5DM6 3;  2YTV A;  4OEM B;  3CCS A;  4BY1 B;  3H15 A;  3A0J A;  3UDI A;  2HCC A;  3SGI A;  1TII D;  5IYD G;  1JOK A;  1LTB D;  4DK3 C;  2DY8 A;  1HQM C;  2JEA I;  1PRT D;  3V2T A;  2F0G A;  4G57 A;  4LF5 Q;  1XTD A;  4WRD A;  1V1O A;  3GTL H;  1A2T A;  4ZYS A;  2E2I H;  4IFD I;  4NP5 A;  1A3T A;  4QIW B;  4BY7 B;  2XGT A;  4HIM A;  4LUZ A;  5JPM C;  5COY A;  2KHI A;  1HRJ A;  3I4N H;  3U50 C;  4HJ5 A;  3GTG B;  4JW0 A;  1A2U A;  3PMF A;  4HJ7 A;  5IP7 H;  1VQF A;  3TSS A;  2F0F A;  4RGN A;  3HOY B;  2ALY B;  1Q12 A;  3NQI A;  4A3M B;  4BA1 I;  1EY0 A;  1H9M A;  1TXY A;  2MNA A;  5I6W A;  4X3U A;  2XSC A;  2D2C C;  3HOY G;  1LTL A;  2MJ8 A;  4NPS A;  1F77 A;  2Z8L A;  5M3M H;  1IL2 A;  4PZ6 A;  1EY6 A;  4P73 A;  1PH5 A;  3CD6 A;  1NBW A;  3L3O C;  3T16 A;  1STY A;  3SVM A;  1V9P A;  5ELB A;  1HNZ Q;  4IFD H;  4HSV A;  1LO5 D;  1NMG A;  4XT3 B;  5LL6 S;  2VNU D;  3EQL C;  5C0X H;  5M3F H;  1DOK A;  4DV1 Q;  1S4Z A;  4L6T B;  4XQJ A;  4K2K A;  3CW2 C;  1I6V C;  4KY6 A;  1SRO A;  3T13 A;  2VZA A;  2IL8 A;  3H3V I;  4WOR A;  1PTO B;  1IYV A;  3QR8 A;  3CCM A;  1HR0 Q;  2EQS A;  4KJO A;  1KXL A;  1VF7 A;  1HR0 L;  3PO3 H;  5J22 A;  2DNE A;  4ZUI A;  4DR6 L;  5JJK A;  2CQA A;  1WTX A;  2CHB D;  3D4R A;  1UAP A;  2K04 A;  1BBW A;  1D5Z C;  3R2T A;  4OX9 Q;  1M8A A;  4ZKC B;  4BXX G;  2AUK A;  3HOU G;  3MFY A;  4DAY B;  4J15 A;  3NPP A;  3IFT A;  3NBI A;  2QA4 A;  4A3E G;  3GTM B;  1SNP A;  2BOS A;  3HKS A;  3J80 i;  3H3V H;  1BBU A;  2AKW B;  1D5X C;  3U58 A;  1Y1W H;  2R7Z B;  1N36 L;  4A3K H;  2KJX A;  5IGE A;  3TBI B;  1FL0 A;  2OTL A;  2R7Z G;  3KLS A;  4GKJ Q;  4K8J A;  5FOB B;  1TWG H;  4OIJ A;  2A8V A;  4RKL A;  4X62 L;  3T4A C;  3KLS X;  3QG1 A;  3PIP A;  5E3F A;  3BDL A;  4NXN L;  3VR6 A;  5KYL A;  3HOV B;  2CH4 W;  2NB0 A;  1WTP A;  3CHB D;  2PMZ E;  1BF4 A;  2A73 B;  1OXS C;  2YTX A;  3A55 A;  2K6A A;  3QB3 A;  1PYS B;  1MKH A;  4I65 A;  3DWA A;  1Z47 A;  1P8L A;  1CK1 A;  5FLM G;  3BZD B;  1PH4 A;  3C2P A;  4B9W A;  3M9B A;  4DR1 Q;  2JK8 A;  3RN2 A;  1RCV D;  1TT2 A;  1ASY A;  3HOW B;  2B2U C;  2UXB Q;  1CUK A;  1PH1 A;  3U4Z A;  4UY8 C;  1Q90 A;  2FIN B;  2Q8I B;  1DZ1 A;  2EOT A;  4PMW A;  3RLN A;  2OT2 A;  3HKZ B;  1ML0 D;  1PRT B;  5IYB H;  2NVT H;  3P75 A;  4X3K A;  1XNQ L;  2UU9 Q;  1HTP A;  5D65 A;  3OMC A;  2D9U A;  3HKZ G;  4JBJ A;  4C3H G;  2FJ2 A;  1NR2 A;  2C5C A;  3GTO B;  1A8V A;  3S14 H;  3AFQ A;  4O1N A;  3MXN A;  2R93 G;  4POG A;  4IPD A;  2F0O A;  3RR5 A;  3K5M A;  5GAG C;  1NR4 A;  3OHX C;  1B3Q A;  1LT4 D;  3Q22 A;  3TS2 A;  3EFX D;  1JWM D;  3PO2 B;  1SAP A;  4YHH Q;  1VQB A;  2AWO A;  3I4O A;  3M3Y H;  2E8G A;  5ELN A;  1N33 Q;  1KNA A;  2PQA A;  2NVX B;  3ICE A;  1EQR A;  1IW7 C;  2RA4 A;  2H4O A;  2A6E C;  3PUW A;  1VQP A;  3ERO A;  1Y69 U;  4K5X A;  2MQH A;  1TWA B;  2QW7 A;  4QUC A;  2JA6 G;  1F9P A;  3Q24 A;  4ALP A;  1PFM A;  1U4M A;  2FMC A;  2UUA Q;  3I70 A;  1JOR A;  3QOJ A;  2ES2 A;  1TS4 A;  1K83 B;  1CHP D;  3G7L A;  4DK6 C;  2K5V A;  1ENF A;  4GN5 A;  1SN8 A;  3H09 A;  1VQE A;  3HRZ C;  3D0F A;  1G6Z A;  5TSS A;  4V19 0;  3PUZ A;  2VY3 A;  1UE5 A;  1F9Q A;  1QOH A;  4A3F H;  1JT8 A;  4C3I H;  3S2D H;  1J5E L;  4KI0 A;  4C2M B;  5CC4 A;  1SRU A;  2F0V A;  1WTW A;  3NWT A;  4EQO A;  4WJ4 A;  2QKI C;  2R92 B;  4QL5 A;  1PH9 A;  1S3O A;  1PH7 A;  2OTJ A;  1CKN A;  3S1N B;  1YNN D;  3E5S A;  4LNQ A;  1IYJ B;  1PTO C;  1UEA B;  4ZCK A;  4DV4 Q;  1UWV A;  1JCK B;  3KF6 B;  5IWA Q;  3R2I A;  2NUC A;  4J6H A;  1VQL A;  4RWS C;  5A2Q E;  3HOZ H;  4JI6 Q;  1AE2 A;  5EBD A;  2UXC L;  4XQQ A;  3GDE A;  5GRO A;  4GOP B;  4C1N I;  3NXW A;  4BA2 I;  5BR8 Q;  2F0D A;  1CHQ D;  3M4Y A;  4B3S L;  2EJG C;  2R6G A;  4HED A;  2L4N A;  4HCE A;  2L12 A;  2KVM A;  3SEB A;  4GNX B;  4PG3 A;  5KGU A;  1BOS A;  4OO1 I;  3A8K E;  5D3I B;  2IJ0 A;  3NUC A;  4XXE A;  4IOC A;  3P7J A;  3QOL A;  5C5M A;  2B39 A;  2RDH A;  3FKI B;  2L11 A;  2R3Z A;  3WOE A;  1HA5 A;  4JI8 Q;  4A3C G;  1I4H A;  4DV2 L;  3SK4 A;  1E22 A;  2IT1 A;  2E76 C;  3FKI G;  4C1N K;  5IOD A;  3T1Y L;  4R1J A;  4DV5 Q;  1SE4 A;  2E75 C;  2VQF Q;  4NB3 A;  4J1M A;  3P20 A;  3I55 A;  2PW7 A;  4FYD A;  4JOI C;  2VQF L;  5JEA H;  1HZB A;  3M4P A;  1EU3 A;  3G71 A;  3WOF A;  3A8I E;  2OXP A;  3BYT B;  4MHE A;  4EX5 A;  2UUB Q;  4LF9 L;  4HMI A;  3CC2 A;  2XNA C;  3J81 E;  4OO1 H;  1U4P A;  2G9H D;  2E2H B;  1HZA A;  2A6H C;  5IT9 L;  3CCU A;  2HHH L;  2RHQ B;  1JJC B;  3SE0 A;  1QIL A;  2ATW A;  3K7U C;  3KLR A;  3TRE A;  2F0S A;  2PQE A;  3I4M H;  4HMJ A;  3URY A;  1K0R A;  4A3B H;  2MFI A;  4YY3 Q;  4A3D G;  2LMC B;  1HUN A;  1DYQ A;  4ZKB B;  3CCE A;  1PLF A;  2ICE C;  1PRT C;  3I2Z A;  3NEN A;  1LTS D;  2KCC A;  1R4Q B;  3RLO A;  4F87 A;  3UDG A;  2WV6 D;  1UUP A;  2OEO A;  2K1B A;  4EGV A;  1QUQ B;  2NWG A;  1KNE A;  4JYA Q;  1TWF B;  2JA8 H;  1SYB A;  3KJP A;  4LF6 L;  1FJG L;  3GD7 A;  3AU7 A;  1K28 A;  1L0W A;  1W2B A;  4I7Z C;  5C44 G;  4A3L G;  5JPN C;  3BVM A;  1WTO A;  1SBB B;  1QVC A;  4YWL A;  4UPA A;  3U9O A;  5LMN Q;  2O5I C;  1JB3 A;  1PYB A;  1NAP A;  1I4G A;  3DM3 A;  3VYT A;  1WI5 A;  1STB A;  3T56 B;  3K5L A;  4DV0 L;  1ZYR D;  2K4K A;  1XMO Q;  3W1B A;  4DUZ Q;  2JSO A;  4MIU A;  1XMO L;  1M90 C;  2YTY A;  1RF2 D;  2DGY A;  1KRT A;  4DUZ L;  3S2H B;  5LHY 1;  3RMH A;  1J9O A;  1IL8 A;  3VR2 A;  4CDF C;  1VQG A;  1YJN A;  3H0G G;  2K5H A;  5C4J H;  3M4O B;  4K0K L;  3MC0 B;  3PIO A;  3CPW A;  3K57 A;  4BWG B;  2CWP A;  2AHO B;  1Y14 B;  1VQ5 A;  3ULL A;  2EJM A;  2M9V A;  4FDB A;  3NWS A;  4GLX A;  1I4X A;  2ZXP A;  4LF7 Q;  3S1Q H;  3D31 A;  5M5X H;  2OWO A;  3S1M H;  4B9X A;  2N78 A;  5E7N A;  1XPR A;  4RHR A;  1CA5 A;  1I94 L;  1H9S B;  2WII B;  3HOX B;  2F4I A;  4OWT B;  1E2W A;  2OQK A;  2Q2I A;  1LUZ A;  5IT9 c;  3L0O A;  1EWI A;  2F0T A;  2B63 G;  1U9R A;  1G2S A;  1X65 A;  1YZ6 A;  1N34 L;  3NP8 A;  1SNM A;  3T1H L;  4Q5V A;  4BBR H;  3ZYY X;  1D5M C;  1X54 A;  5KNC A;  2B2W A;  1HTL D;  1TS5 A;  3K0Y A;  1KRS A;  3K7A H;  3GTJ H;  4PZ7 A;  4X3S A;  5FO8 B;  4DAM A;  5IP9 H;  4QB4 A;  5E4X A;  3GO5 A;  1EQQ A;  5KNB A;  2E2J H;  5J39 A;  3EN2 A;  1RJT A;  3ER0 A;  4IUP A;  3JAM c;  2VB3 X;  4G7O C;  5IY0 A;  5M5Y H;  5CBA E;  4GOP C;  4LFB L;  3DUZ A;  2EXD A;  2RCN A;  3OSO A;  4U68 A;  1B2T A;  3F2D A;  3QO2 A;  1ET6 A;  4OIK A;  1K8O A;  1U0L A;  3W2D A;  5LMU Q;  2NVY B;  2J7Z A;  3I56 A;  2JYO A;  1EYD A;  2N8N A;  1W6K A;  4CBV A;  4YIJ A;  4RG1 A;  4KY5 A;  4GNX C;  3BZK A;  4PV1 C;  1YIT A;  1I3Q B;  1XXG A;  4R4T A;  4EQP A;  4C3J B;  3LWU A;  3J7Z C;  3G6E A;  4BS9 A;  2BDN A;  2XWJ B;  2LFN A;  4JC0 A;  5IGF A;  2PYK A;  1XNR Q;  1IBM Q;  4X65 Q;  3K0X A;  4C3J G;  4A3J B;  1XPU A;  4A3G G;  2J0T D;  3DMU A;  3CC7 A;  4JI5 Q;  5KYI A;  2F03 A;  2O2L D;  3AMU A;  3V05 A;  4OWW B;  1H9K A;  4RKB A;  4A3J G;  1MI2 A;  2NN6 G;  1KIX A;  2B2V A;  3CCR A;  1YNX A;  1EWC A;  5KND A;  2OCE A;  4X64 L;  1QZG A;  4CDE C;  3DM1 A;  3N6R A;  1JB7 A;  1AW7 A;  5IYD H;  5JJI A;  3KF8 B;  1SE8 A;  3GTP H;  1RD9 D;  5F2D A;  4CDD C;  1YJW A;  2EYP A;  1B1Z A;  4CHT B;  5JOB A;  2ZTD A;  1N32 L;  2K32 A;  2F0J A;  2ZM6 Q;  1SFO B;  1Z7T A;  1Q1B A;  1EEI D;  2BE5 D;  2SOB A;  4B3T Q;  4MN3 A;  1PFS A;  5ELD A;  2WIN B;  1E2V A;  1CFM A;  4KD4 A;  3RZD H;  1IBK L;  4B3T L;  1ROD A;  3MA2 B;  5C3E H;  1KLU D;  2HCI A;  2XRS D;  5FK9 C;  4YWK A;  1OXT A;  2BCO A;  4XYQ A;  5AJ3 Q;  1L1O A;  4QGU A;  4GN3 B;  3GQB A;  2E74 C;  4FXK C;  5A35 A;  2Y0S E;  4IPC A;  1CQV A;  2E5L Q;  3MHB A;  3AYH B;  4N8X 1;  5EBC A;  2J4X A;  1JQY D;  2E5L L;  1ASZ A;  1VMC A;  3D3R A;  4U67 3;  3DXJ C;  2VQE L;  4K14 A;  5D14 A;  1XTC D;  3K58 A;  1LTG D;  4QUF A;  4A93 B;  5GAE C;  4BY1 G;  1MHW C;  1B44 D;  3ZJY C;  2KEC A;  4CKB A;  4LF8 L;  1X3P A;  1MD2 D;  4OL7 A;  1WFQ A;  2PNH A;  4F88 A;  1D6E C;  3BZC A;  4A93 G;  2JA7 H;  2RHS B;  1MJE A;  4GLA C;  5CV8 A;  4Y7N B;  3MAQ A;  1BNZ A;  1YBY A;  4JBW A;  5FLX L;  3TP5 A;  3VYS A;  3VR3 A;  2JA5 B;  5CV5 A;  4JV5 L;  3PUV A;  4OON A;  1WD0 A;  3UDF A;  4TSS A;  1TVX A;  3GTQ B;  2VUM H;  2HIX A;  3BG3 A;  2JA5 G;  4BY7 G;  3W1G A;  1BDO A;  4RCN A;  1B9N A;  3KDF A;  1SYC A;  1G29 1;  2SEB D;  5KIX A;  1YI2 A;  1SND A;  1CKM A;  2A69 D;  3GP7 A;  5EAY A;  3TDQ A;  2JEB I;  1E1O A;  4A3M G;  1EIF A;  4G7Z C;  1KQS A;  2PO4 A;  3RN5 A;  1PTO H;  5CV4 A;  5COR A;  2YU9 H;  1JWS D;  3ERQ A;  5ELO A;  1DOL A;  5FJ8 G;  1HUM A;  3FHW A;  5IYC H;  3GTL B;  1AP0 A;  2VL6 A;  4DR3 L;  1YNN C;  4BXX H;  1STH A;  2UUC L;  1RTO A;  2PQA B;  4KKS A;  3HOU H;  3JAM i;  2E2I B;  4GN4 B;  2PPB C;  1SMY D;  3MXP A;  3UI2 A;  4A4I A;  4IUU A;  4A3E H;  2F0H A;  4RAU C;  2Q2U A;  1O7Y A;  3I4N B;  2KBN A;  1QNU A;  2F0Q A;  3PF5 A;  1X55 A;  1ESF A;  4K5W A;  1I50 H;  3I4N G;  4HCS A;  1BCP F;  3N52 A;  5KEE A;  1EOT A;  3CKI B;  4F8M A;  2R7Z H;  3CQZ H;  4DR6 Q;  2RSO A;  2I46 A;  3CP0 A;  1NCV A;  1JMC A;  1BUV T;  3L2P A;  5M3M B;  1T5X D;  4KY7 A;  1PH3 A;  1STN A;  3EBE A;  2FHT A;  1AZP A;  4RFB A;  2WB1 E;  2LKV A;  5M3M G;  2K14 A;  3A7A B;  4K6L A;  4DR7 Q;  1QZH A;  4IAL A;  4LFA L;  1B3A A;  2EY2 A;  4HR7 B;  4DR7 L;  5FLX c;  5FLM H;  3F2B A;  2ZJP A;  3S1R H;  2A19 A;  3AB9 A;  2N49 A;  1N36 Q;  3L7Z C;  2WP8 J;  3OPO A;  1CKN B;  2G5D A;  3DEP A;  5M3F B;  4FXG C;  1I4Q A;  4UP7 A;  2N3S A;  1MSG A;  5C0X G;  1EU4 A;  5M3F G;  2WAQ E;  4ZLT F;  1B8A A;  4DXG A;  4X62 Q;  3CME A;  2VS1 A;  1KDA A;  2KHS A;  2JA9 A;  1ONL A;  3VDY A;  4KHP L;  3M4Q A;  2EE1 A;  1RL2 A;  1ICW A;  2SNM A;  1AFP A;  4NXN Q;  1GUW A;  2XN9 C;  2EDG A;  4N8F A;  2F0N A;  4P2C B;  2PI2 A;  3OYY A;  4C3H H;  2I5L X;  1ICF B;  1YEZ A;  5CR3 A;  3ND8 A;  3R3O A;  3HOV G;  1HNW Q;  3FRP B;  1N8R C;  5NUC A;  1EEF D;  1CM9 A;  4Y52 H;  1KAB A;  1HNW L;  2CFM A;  2RVL A;  2DNC A;  2R93 H;  3DWP A;  3I72 A;  1EYG A;  2IX1 A;  3NTK A;  5C3W A;  4R4I A;  1H95 A;  4DA2 A;  4DR5 L;  1STG A;  3NBH B;  1YJ9 A;  1W3S A;  1LT6 D;  1DXM A;  1HA6 A;  4L5R C;  3HZX A;  3K81 C;  3MFG A;  3PUY A;  5HGQ A;  5JAV A;  3HOW G;  4QJF A;  1Y1W B;  1X3Q A;  5EPK A;  4A3K B;  4BBS B;  1AE3 A;  1XWE A;  3OIQ A;  3RD4 A;  2F3V A;  3F8T A;  1XNQ Q;  2R7F A;  3J81 j;  3GTK H;  2X6G A;  1CQF A;  1Y1W G;  4A3K G;  1VQM A;  4M8A A;  3BS1 A;  4BBS G;  1TWG B;  3JAM E;  1F2Z A;  1YNJ D;  2MPM A;  3NEM A;  4DU9 A;  4G7H C;  2JA6 H;  1LTI D;  1CTM A;  3HFZ B;  2K05 A;  5IGG A;  1H9R A;  3CXC A;  1CT1 D;  2V1C C;  3HS0 C;  1FVI A;  3LWE A;  4UHV A;  3LNN A;  2B29 A;  4WJ3 M;  4JI3 L;  1ZYR C;  4H7B A;  5JJL A;  4KKU A;  3RZO B;  2A68 C;  1A3U A;  1Y1V H;  1ILQ A;  3MTS A;  4ABN A;  1PH8 A;  1FNU A;  4NXM L;  2Y0S B;  3PQI A;  4KN4 C;  3UE1 A;  5DAU A;  1STA A;  3MZ5 A;  1Q86 C;  3CCJ A;  3PO2 G;  1VMP A;  2PZW A;  2OF1 A;  1TS3 A;  4CGY B;  2Y0S G;  4OWX B;  3PSI A;  3STB D;  2O5J C;  2F0W A;  3F2C A;  3HP3 A;  1LV9 A;  4IN3 A;  1V1P B;  3KYH C;  2FXQ A;  2KEE A;  3J80 E;  1EYC A;  4MTN A;  4QCL A;  3S15 H;  2EJF C;  4A75 A;  1G91 A;  1GVP A;  2LS0 1;  1GD7 A;  4K8I A;  3B6Y A;  5ELE A;  3KBG A;  4JI0 Q;  1C4Q A;  1J5E Q;  3S14 B;  5LL6 X;  4JI0 L;  4L63 B;  4B08 A;  3CCV A;  1X32 A;  1VQO A;  1YHA A;  4CJ1 B;  2HQE A;  2AMC B;  1NUC A;  3SR1 A;  3M3Y B;  2R92 G;  2K5N A;  1UE7 A;  1EL0 A;  1Q7Y C;  1AN8 A;  1IBL Q;  3E9H A;  3NEL A;  4LFC L;  1G2T A;  2F0L A;  4LK1 C;  1IBL L;  3M7N A;  2UXC Q;  4A3C H;  4DAY A;  2F4V L;  4P71 A;  1HZC A;  3FKI H;  1K3R A;  4JPB W;  1NE3 A;  3Q23 A;  3J7A V;  5C4X H;  1CZW A;  3TN2 A;  1SYD A;  2L0C A;  4B3S Q;  3S16 H;  3A8J E;  2EYL A;  1LT3 D;  2IW3 A;  1U5K A;  2QEJ C;  5DLQ E;  4DV3 L;  2K5D A;  4ID6 A;  1TWH B;  2QDL A;  4XYO A;  2WKC A;  3OOC A;  2MP1 A;  3L9A X;  4A3F B;  1JE4 A;  4DPG A;  1BO0 A;  1ENC A;  4C3I B;  5E1F A;  3D4D A;  2NYZ D;  3VA7 A;  3BVG A;  3NSW A;  4DUY L;  1P16 A;  4R4O A;  1QG7 A;  4CJ0 B;  4YCV A;  1HZ9 A;  2DN8 A;  2OQ0 A;  3TZD A;  2QEX A;  4DV2 Q;  1EY4 A;  5G3L F;  3I73 A;  3T1Y Q;  1J8I A;  4Z9C B;  1SNC A;  1E24 A;  5EQ0 A;  5GQO A;  4A3D H;  3D4W A;  4ZRZ A;  4HID A;  2PNR C;  1R9T B;  1S5D D;  2YV5 A;  1XMQ L;  3HOZ B;  3MEH A;  3A56 A;  2WB1 B;  2BE5 C;  1C9O A;  3IRB A;  1S5F D;  5CV6 A;  2JP1 A;  2C9O A;  4JBK A;  4LF9 Q;  1LAB A;  1DM0 B;  1GO3 E;  3OWE B;  1SXT A;  4DV7 L;  1GM5 A;  3HOZ G;  1GUG A;  3DWQ A;  2CVR A;  4DNI A;  4L8J A;  1LM0 A;  3E9I A;  1UE1 A;  3SDZ A;  2SDF A;  3SK5 A;  1LLR D;  5I9P A;  2HHH Q;  4Q0F A;  1TU2 B;  3TRZ A;  2WKD A;  5M9O A;  3BVZ A;  5C44 H;  2A74 C;  1KDC A;  2F1M A;  2RQX A;  1A15 A;  2ID0 A;  2WAQ B;  4IJH A;  5T1I A;  2IHE A;  3H3V C;  3R93 A;  4DXF A;  4DV6 Q;  1VCI A;  4L5Q A;  1V43 A;  1JJ2 A;  4LW1 A;  4DV6 L;  4A76 A;  1L2F A;  2Z6B A;  3TEH B;  2L55 A;  4X66 L;  5ISR A;  3H0G H;  4UP8 A;  2NTS A;  1I5F A;  1BCP D;  4DR2 L;  2QF7 A;  1JIC A;  5IGB A;  4LF6 Q;  1FJG Q;  2CQO A;  1MSH A;  2ICI A;  1E2Z A;  2K33 A;  3IL8 A;  1UNS A;  3M4O H;  5EKK A;  5M5W H;  2SNS A;  1FNV A;  1ZXT A;  1OXX K;  1X3F A;  3I4L A;  4DV0 Q;  3C1E A;  2I5M X;  1L1O B;  2JN4 A;  1NSN S;  4B3R L;  1CZG A;  2B63 H;  1CSP A;  4OO1 G;  3ND9 A;  4K0K Q;  2IHF A;  2DY7 A;  3C1F A;  3TP6 A;  1L0Y B;  2K50 A;  4A3B B;  5C4H A;  3PV0 A;  2K5W A;  1BBX C;  3CMA A;  2Z0S A;  5BN3 A;  1HNX L;  2F0P A;  3VR4 A;  4E6I A;  5D3D A;  4LJZ C;  3KK7 A;  5BN5 A;  1VDZ A;  4A3I H;  1Y8P B;  2B2Y A;  1UE6 A;  4GKK L;  2MGS A;  1X6O A;  4FP5 D;  2NN6 I;  3ULJ A;  2F0I A;  4P74 A;  1DGS A;  1HR0 W;  1I94 Q;  1F9R A;  1PZJ D;  1SMY C;  2KCN A;  2JXM B;  1O7I A;  4L5T A;  3KF6 A;  1G8Z D;  4L5S A;  4IPG A;  4R9W A;  1NJI C;  1N34 Q;  1IKM A;  3T1H Q;  2HUG A;  2A6E D;  1IHZ A;  1KHI A;  1QCB D;  3HOX G;  3QJY A;  4RGM A;  1HPC A;  3CPF A;  1KL9 A;  4FVM A;  1U4R A;  1IKL A;  2B8G A;  4CJ2 C;  1I6H B;  5IOC A;  2MO0 A;  3VR5 A;  4LF4 L;  2GA4 B;  4P75 A;  4A3G H;  1F2M A;  3BU2 A;  3IFD A;  2N88 A;  1Z6H A;  2F52 A;  1QNK A;  5C4J B;  4GNX A;  2NVQ H;  2G9D A;  1BKB A;  4IZ8 A;  3S17 H;  3TME A;  4A3J H;  3J7Y W;  2NN6 H;  4LFB Q;  2MUY A;  3OTO L;  1D1I A;  3I7F A;  2EIF A;  3V96 A;  1QB5 D;  1TS2 A;  3S1Q B;  5I6Y A;  3K6O A;  2L15 A;  4EQN A;  5M5X B;  4ME3 A;  3S1M B;  4MTK A;  5A2Q L;  1SNO A;  2HDM A;  4V0B A;  4IUN A;  4WJW A;  1PTO D;  1SMX A;  3TP7 A;  2EY5 A;  1DCZ A;  2UXD L;  1WCM B;  4I7A A;  1Q8I A;  3EA6 A;  1EZ8 A;  2F3I A;  1FD7 D;  2FFK B;  2M00 A;  2EVB A;  3JC6 6;  4UAI A;  4BBR B;  1PFB A;  1WCM G;  5KRU A;  4APV A;  1TWC H;  3R8B A;  3K7A B;  4BBR G;  1LAC A;  3G4S A;  1MJC A;  5I4D A;  4QMG A;  4JBM A;  1MGS A;  4X64 Q;  4DK0 A;  3KJO A;  4FF3 A;  5CV9 A;  2KCM A;  2F0U A;  2E2J B;  4X3T A;  1HH2 P;  3RLF A;  3FMC A;  3ERS X;  1N32 Q;  5M5Y B;  1A62 A;  4BY1 H;  2EYM A;  1STE A;  2LY7 A;  1CA6 A;  4S3S A;  4XQN A;  4R4C A;  1IBK Q;  4QF4 A;  4AQY L;  5I2Y A;  4A93 H;  1JC7 A;  4HJ8 A;  1A6X A;  1E0B A;  2B8F A;  1BVS A;  1MBY A;  4HTH A;  1JOO A;  5GAD C;  1Z9F A;  4PNY A;  4AIM A;  2D5D A;  2F0M A;  5HUR A;  5K36 G;  2K7V A;  2GVB A;  1QUQ A;  4OGQ C;  1T9H A;  2ZJQ A;  4IFD J;  1QVG A;  1GUS A;  4ZUJ A;  1BCP B;  1YNJ C;  1NNX A;  2EXZ A;  5C0X J;  4JI7 L;  4BY7 H;  3Q8D A;  4K5V A;  3ONA B;  2VQE Q;  2B2V C;  3J81 L;  1O7L A;  4H02 A;  3GTG H;  1VQK A;  2Z6K C;  1IZ6 A;  2E2D C;  5AFW A;  4LF8 Q;  5C5L A;  1RHP A;  3QIA A;  2B2T C;  3HOY H;  4RMF A;  2XIW A;  3E0J A;  1FGU A;  2CH4 A;  4A3M H;  3WWV A;  2EZV A;  3E0E A;  4LUV A;  1XYI A;  3RUZ A;  1VQC A;  1V8Q A;  3VYU A;  2IY5 B;  3GTP B;  2Q8R E;  3F2U A;  3H6M A;  1B9M A;  1FGB D;  5FJ8 H;  4JV5 Q;  5CYU A;  2D62 A;  1ZEQ X;  4TQU S;  1QVF A;  3STB C;  1SSO A;  1L1O C;  3RZD B;  1KC8 C;  5C3E B;  1EIH A;  2RDF A;  1E7Z A;  3O13 A;  2EYF A;  4LF5 L;  3NTH A;  1C0A A;  5C3E G;  2QIL A;  1H9S A;  3M7G A;  4HN7 A;  5G3L D;  1S40 A;  3LX0 A;  4O2D A;  4TKO B;  5C0X I;  1KTK A;  2L5T A;  3MWY W;  4X6A H;  1S5E D;  3P1H A;  4H13 C;  3MXN B;  1B4O A;  4R8N A;  2QDB A;  1JJG A;  2ZXR A;  1VQN A;  3CRL C;  3T51 B;  4DR3 Q;  1PFN A;  1VQA A;  2JA7 B;  2UUC Q;  4KTA A;  4O0A A;  4DF7 A;  4ZQ3 A;  1KAA A;  3HGB A;  5JJZ A;  1Q81 C;  1RTN A;  2JA7 G;  3OWF A;  1ILP A;  2Q8T A;  4C56 C;  1B50 A;  1WJJ A;  1K9M C;  2X69 A;  4NMZ A;  1F9S A;  5EKL A;  3CU7 A;  3CC4 A;  2VUM B;  4G4K A;  3BDC A;  1SDF A;  5CMD A;  2D0O A;  4DAV A;  3GTM H;  1HNZ L;  5BN4 A;  1X9N A;  2CW0 D;  3J81 c;  3KOJ A;  3CCQ A;  4CKC A;  4RGO S;  5IP7 G;  2VUM G;  1IXR A;  4FXD A;  3GV3 A;  4P72 A;  2F3W A;  4MZ9 A;  4DV1 L;  4UP9 A;  3K59 A;  1GHJ A;  4DN4 M;  4HIK A;  1S5B D;  4TRD A;  3I91 A;  1YHB A;  2YU9 B;  1R4P B;  3FPP A;  4LFA Q;  5K5P A;  1CKO A;  4M1U B;  3K5O A;  3OMG A;  1SLJ A;  3MXG A;  4GZY C;  3HOV H;  2LSS A;  1JWU D;  2O4X A;  1CSQ A;  3MVV A;  1MIU A;  4IOA A;  1D1K A;  2PZU A;  1EY9 A;  3FDT A;  5J1Z A;  1K8M A;  4IFD G;  2KED A;  2A5H A;  3HOU B;  1SR3 A;  1HXY D;  3CCL A;  5IYC G;  3F1Z A;  1ENA A;  3KF8 A;  4PMC A;  4A3E B;  3UDX A;  4OX9 L;  1QE6 A;  2I07 B;  3KLW A;  2KUM A;  2K75 A;  5I2X A;  4KHP Q;  5H1S E;  3BYY B;  3HOW H;  5JVH 3;  1DD2 A;  4IUT A;  1EUJ A;  1TY0 A;  1I50 B;  3ULP A;  1S72 A;  2XTI A;  2NZO A;  3OW2 A;  2RDG A;  3PO3 B;  4XIG S;  1B7Y B;  3A74 A;  2B2U A;  3QWN A;  3CQZ B;  4O42 A;  4BBS H;  2KOL A;  1SYF A;  3SK8 A;  2DJF C;  3PO3 G;  2R7D A;  5L37 A;  2H1E A;  2KCT A;  4XT1 B;  3K5N A;  3PIP 3;  4OXP A;  5HGT A;  1Q82 C;  4GKJ L;  4JG2 A;  5IT9 E;  2K5Q A;  1BXT A;  4NKL A;  3CAM A;  1WVL A;  1PV4 A;  4DR5 Q;  4UDU C;  2BA1 A;  1C8C A;  4KKT A;  3GTO H;  3I90 A;  2ZT9 C;  2CWA A;  3PUX A;  5C6A A;  4JK1 C;  3S1R B;  3K8A A;  3W5O A;  2IWH A;  2A1A A;  4FO2 A;  4ME5 A;  3I3C A;  5C3X A;  5CV7 A;  1BCP C;  1SE3 A;  1XPO A;  3RZO H;  4IUV A;  3PO2 H;  3EIV A;  4H44 C;  4ZK9 B;  4RCO A;  5LMN W;  2NVX H;  4GS3 A;  3UE0 A;  4DR1 L;  2F0K A;  2I0Q A;  1X3E A;  4HJ9 A;  1SYE A;  4ZAI A;  2CKZ B;  2UXB L;  4JI3 Q;  1TWA H;  4NW2 A;  2WFW A;  2JJQ A;  1PA6 A;  4C3H B;  2M2L A;  1PTO F;  3CRK C;  3H94 A;  1PH6 A;  4HSP A;  4NXM Q;  4KV6 A;  4QQB X;  1K83 H;  1HCZ A;  2IPK D;  3X3N A;  1SJE D;  2UU9 L;  1BQQ T;  2RCF A;  2R93 B;  3VYR A;  4AH6 A;  1GUO A;  1GUN A;  1PXU A;  3SHL A;  3PGZ A;  3KFU A;  1LYL A;  4C2M H;  5EPJ A;  1DOM A;  4JVZ A;  4IQZ A;  2R92 H;  1VQ6 A;  2ENB A;  1PVO A;  4ULL A;  1KDB A;  2B3G A;  3PF4 A;  3TQY A;  2NVT B;  1WTH A;  3GTK B;  4YWM A;  2TMP A;  3S1N H;  1PH2 A;  4YHH L;  3A5Z B;  1V1Q A;  1N33 L;  5IYB G;  1JR0 D;  5JVG 3;  2JA6 B;  2Q2H A;  1TY2 A;  3HEJ A;  2EY6 A;  2BDO A;  1J6Q A;  2K52 A;  1EQV A;  1TR5 A;  2D0P A;  3T53 B;  3VA5 A;  5IGD A;  1YHQ A;  3J81 i;  1NTG A;  1B53 A;  1A63 A;  3S24 A;  2Q2T A;  3TP8 A;  3AEV A;  1EOV A;  5JEA J;  3G6J B;  2K01 A;  4KD3 A;  1D7Q A;  1IYU A;  2UUA L;  2NZH A;  1Y1V B;  2KEN A;  1SJH D;  3J7A F;  2MO1 A;  4PZ8 A;  5J3B A;  2GN5 A;  1Y1V G;  1TWH H;  4LFC Q;  1K3B C;  3ITP A;  2I5H A;  4IPH A;  3C3L A;  2F4V Q;  3MXU A;  3DEO A;  5DEH A;  4HJA A;  4DAP A;  5FO9 B;  3AFP A;  1EY8 A;  1W6J A;  2VW9 A;  1H9J A;  3FPU B;  4N9T A;  3J7A 5;  2LXJ A;  2PCF B;  1C48 A;  3S15 B;  1O78 A;  3HG9 A;  4RHS A;  3DHQ A;  3K80 C;  4DV3 Q;  3MEF A;  4KN7 C;  3TZU A;  4DV4 L;  1R9T H;  2EYH A;  1Q46 A;  5IWA L;  1EY7 A;  4PQX A;  3H91 A;  1D8L A;  1PRT F;  4OEL B;  1PZI D;  5DM7 3;  4DUY Q;  1AZQ A;  4LMQ D;  1GHK A;  4JI6 L;  3S2D B;  1QWY A;  5CGK A;  5HY6 A;  4JOI A;  1EQT A;  4KJN A;  5I9O A;  5ELF A;  4A3F G;  3NE5 B;  4C3I G;  1EZ6 A;  5BR8 L;  2E2H H;  1LTT D;  1JOQ A;  3W3A A;  4YCU A;  1VQ9 A;  1VQD A;  4FNF A;  1F2L A;  1G51 A;  4POF A;  1JE5 A;  1XMQ Q;  4DNT B;  1FNW A;  1HFG A;  3KUP A;  1Q1E A;  2Z4I A;  1AEX A;  3NBH A;  3D8G A;  4DV7 Q;  1I4R A;  5FO7 B;  2XVS A;  2XWB B;  1WD1 A;  5C4X B;  2KA7 A;  4AYB E;  5EKI A;  2PI2 E;  2WB1 G;  4JI8 L;  2MHV A;  4F7X A;  4IUQ A;  2ASB A;  3S16 B;  1O80 A;  4KHZ A;  4TVA B;  4IJL A;  1Y8O B;  1B70 B;  2HDL A;  2L9H A;  4JI1 Q;  1VF5 C;  1GUT A;  1X56 A;  5C4X G;  4JI1 L;  2NTT A;  1NMF A;  4A3L H;  1OXV A;  1EIG A;  1TWF H;  4DV5 L;  2K03 A;  2P5Z X;  1E1T A;  1K8A C;  2XRQ D;  1EWH A;  4MNO A;  1FR3 A;  2WAC A;  4RH6 A;  2AQ2 B;  1SE2 A;  1OTC A;  2WAQ G;  2UUB L;  4H0L C;  3M85 A;  4X66 Q;  1I4P A;  1NY4 A;  3NTI A;  2ZTE A;  3Q0A A;  4DR2 Q;  1TQO A;  2ZTC A;  3WDN A;  4A3D B;  1Y8N B;  3S2H H;  2HQL A;  4QIW E;  4QY7 A;  3EJI A;  1SYG A;  1LTR D;  3OIP A;  3PCO B;  5FKA C;  3CF5 A;  1HFN A;  1HJP A;  1PHJ A;  4YY3 L;  2VXW A;  1YIJ A;  1KD1 C;  5FLX E;  5JEA G;  2EY1 A;  3FVQ A;  1ZKO A;  2PMZ B;  2EPB A;  2EYJ A;  3JAM L;  1V1P A;  4B3R Q;  5CBE E;  4K2L A;  5C44 B;  2A69 C;  5ELC A;  3NK9 A;  2BH8 A;  3HOX H;  4JYA L;  3I4M B;  2KHJ A;  3NHH A;  3BDO A;  1HNX Q;  4CDC C;  4KK7 A;  4CKE A;  4NDX A;  5C4Z A;  3I4M G;  2RKS A;  1WYD A;  1AH9 A;  1ESR A;  1VQJ A;  1C7Y A;  3AQQ A;  3I8Z A;  1XX8 A;  1VQ7 A;  4A3B G;  5LMN L;  4GKK Q;  4DNR B;  3U9S A;  2LXK A;  3H0G B;  2AQ3 B;  1I6H H;  1RIP A;  5EGT A;  2A68 D;  3PIO 3;  5IGC A;  4DFA A;  4N9P A;  4LWC A;  1QJO A;  2JA8 B;  4WFN 3;  5M5W B;  2VB2 X;  1N9W A;  3OW7 A;  4IUR A;  2C35 B;  2FMM A;  1IW7 D;  1EY5 A;  3BJU A;  3D6W A;  4KMU C;  3DLL A;  3D6C A;  2JA8 G;  2H5X A;  3J80 L;  4EVO A;  1PDQ A;  4PMB A;  2CW0 C;  1F2Y A;  1RKN A;  3KDF B;  2ZJR A;  2NVY H;  2QGQ A;  4GOP A;  4DGZ A;  4LF7 L;  4LF4 Q;  3A7L A;  2B63 B;  1I3Q H;  4C3J H;  1O7Z A;  4LAA A;  1GKH A;  1WCM H;  2PW5 A;  2HT1 A;  4JI4 Q;  1G6P A;  1PZK D;  2B2Y C;  1SEB D;  3OTO Q;  4JI4 L;  1ET9 A;  4KHV A;  2HIV A;  4RGT A;  2AQ1 B;  1GOZ A;  4DKA C;  4A3I B;  2JE6 I;  1Q8K A;  3G48 A;  2Z1C A;  2IX3 A;  3S9W A;  1EFW A;  1CI3 M;  2K28 A;  3TS0 A;  4KLK A;  2L1B A;  2QCP X;  4JCV E;  4A3I G;  3RNU A;  1OO9 B;  1WOC A;  1K73 C;  2KQ3 A;  2DJG C;  1A3V A;  1KLG D;  5IE8 A;  1II3 A;  3SXH A;  1T5E A;  1BR9 A;  2GVA A;  3C46 A;  2UXD Q;  4FF4 A;  2B2W C;  2HD3 A;  1L0X B;  5E4W C;  2X6L A;  4FF1 A;  1U4L A;  3NQT A;  4OHJ A;  2ZXO A;  1LT5 D;  1SFO H;  1X3G A;  1DJR D;  1HHV A;  5K36 H;  3Q6S A;  2JQO A;  3KBX A;  1A0I A;  4ILW A;  1VQI A;  3U4V A;  4LUO A;  1M4V A;  4K6D A;  4DR4 Q;  5LMU L;  2N55 A;  1OXU A; 
#chains in the Genus database with same CATH homology
 4J8Q A;  3GTJ B;  4ODG A;  4A3G B;  3SK6 A;  3GV6 A;  5IIF A;  4FF2 A;  2EYO A;  2IX0 A;  1EYA A;  1S5C D;  2NVQ B;  3S17 B;  1D2B A;  1PMR A;  5DNF A;  3X3M A;  2AUJ D;  1WTQ A;  1Q3L A;  5T1G A;  2AWN A;  2NZ1 D;  3E6Z X;  3IKJ A;  5EJW A;  2RBM A;  1RDP D;  2NBF A;  2YYZ A;  2B2T A;  2PZT A;  1TKW B;  4RA8 A;  5EPL A;  2TSS A;  2V4D A;  1GJX A;  1HQR D;  3EVQ A;  1EFI D;  4XTC S;  1PYW D;  2F0E A;  4R8I A;  2RSN A;  1TWC B;  1SNQ A;  3FEW X;  1WTV A;  3IAY A;  4AYB B;  2Z4H A;  1LTA D;  2R61 A;  2A6H D;  3A54 A;  4DK1 A;  1FYC A;  4XDX A;  1GXD C;  1DON A;  1WTR A;  4HAE A;  2BA0 A;  5DM6 3;  4BY1 B;  2HCC A;  1TII D;  1JOK A;  1LTB D;  2DY8 A;  1HQM C;  2JEA I;  1PRT D;  3V2T A;  2F0G A;  4G57 A;  4WRD A;  1V1O A;  1A2T A;  4ZYS A;  4IFD I;  4NP5 A;  1A3T A;  4QIW B;  4BY7 B;  5JPM C;  5COY A;  1HRJ A;  3GTG B;  1A2U A;  3PMF A;  3TSS A;  2F0F A;  4RGN A;  3HOY B;  1Q12 A;  3NQI A;  4A3M B;  4BA1 I;  1EY0 A;  1H9M A;  5I6W A;  4X3U A;  2XSC A;  2D2C C;  2MJ8 A;  1F77 A;  2Z8L A;  1EY6 A;  3L3O C;  3T16 A;  1STY A;  3SVM A;  5ELB A;  4IFD H;  4HSV A;  1LO5 D;  4XT3 B;  5LL6 S;  2VNU D;  3EQL C;  5C0X H;  1DOK A;  1S4Z A;  4L6T B;  4XQJ A;  4K2K A;  1I6V C;  4KY6 A;  3T13 A;  2IL8 A;  4WOR A;  1PTO B;  1IYV A;  4KJO A;  1VF7 A;  5J22 A;  2DNE A;  4ZUI A;  2CQA A;  1WTX A;  2CHB D;  3D4R A;  1UAP A;  2K04 A;  1D5Z C;  3R2T A;  1M8A A;  4ZKC B;  2AUK A;  3MFY A;  3NPP A;  3IFT A;  3NBI A;  3GTM B;  1SNP A;  2BOS A;  1D5X C;  2R7Z B;  2KJX A;  5IGE A;  3TBI B;  3KLS A;  4K8J A;  5FOB B;  4OIJ A;  4RKL A;  3T4A C;  3KLS X;  3QG1 A;  5E3F A;  3BDL A;  5KYL A;  3VR6 A;  3HOV B;  2NB0 A;  1WTP A;  3CHB D;  1BF4 A;  2A73 B;  1OXS C;  3A55 A;  2K6A A;  3QB3 A;  4I65 A;  3DWA A;  1Z47 A;  1CK1 A;  3BZD B;  3C2P A;  4B9W A;  1RCV D;  1TT2 A;  3HOW B;  2B2U C;  1Q90 A;  2FIN B;  2Q8I B;  1DZ1 A;  2EOT A;  4PMW A;  2OT2 A;  3HKZ B;  1ML0 D;  1PRT B;  3P75 A;  4X3K A;  1HTP A;  5D65 A;  3OMC A;  2D9U A;  4C3H G;  2FJ2 A;  1NR2 A;  2C5C A;  3GTO B;  4O1N A;  3MXN A;  2F0O A;  3K5M A;  1NR4 A;  3OHX C;  1LT4 D;  3Q22 A;  3EFX D;  1JWM D;  3PO2 B;  1SAP A;  2AWO A;  1KNA A;  2NVX B;  1IW7 C;  2RA4 A;  2H4O A;  2A6E C;  3PUW A;  3ERO A;  1Y69 U;  4K5X A;  1TWA B;  4QUC A;  1F9P A;  3Q24 A;  1PFM A;  1U4M A;  2FMC A;  3I70 A;  1JOR A;  3QOJ A;  1TS4 A;  1K83 B;  1CHP D;  3G7L A;  1ENF A;  3H09 A;  3HRZ C;  1G6Z A;  5TSS A;  4V19 0;  3PUZ A;  1F9Q A;  1QOH A;  4KI0 A;  4C2M B;  5CC4 A;  2F0V A;  1WTW A;  3NWT A;  4EQO A;  2QKI C;  2R92 B;  3S1N B;  1YNN D;  3E5S A;  1PTO C;  1UEA B;  1JCK B;  3R2I A;  2NUC A;  4J6H A;  4RWS C;  5A2Q E;  5EBD A;  4XQQ A;  4C1N I;  3NXW A;  4BA2 I;  2F0D A;  1CHQ D;  3M4Y A;  2EJG C;  2R6G A;  4HED A;  2L4N A;  4HCE A;  2L12 A;  2KVM A;  3SEB A;  5KGU A;  1BOS A;  4OO1 I;  3A8K E;  5D3I B;  2IJ0 A;  3NUC A;  4XXE A;  3P7J A;  3QOL A;  5C5M A;  2B39 A;  2RDH A;  3FKI B;  2L11 A;  2R3Z A;  3WOE A;  1HA5 A;  1I4H A;  3SK4 A;  2IT1 A;  2E76 C;  4C1N K;  5IOD A;  1SE4 A;  2E75 C;  4J1M A;  3P20 A;  2PW7 A;  4FYD A;  5JEA H;  1EU3 A;  3WOF A;  3A8I E;  2OXP A;  3BYT B;  4MHE A;  4HMI A;  2XNA C;  3J81 E;  4OO1 H;  1U4P A;  2G9H D;  2E2H B;  2A6H C;  5IT9 L;  3SE0 A;  1QIL A;  3KLR A;  2F0S A;  2PQE A;  4HMJ A;  3URY A;  1HUN A;  2LMC B;  1DYQ A;  4ZKB B;  1PLF A;  2ICE C;  1PRT C;  1LTS D;  2KCC A;  1R4Q B;  4F87 A;  2WV6 D;  1UUP A;  2OEO A;  2K1B A;  4EGV A;  2NWG A;  1KNE A;  1TWF B;  1SYB A;  3GD7 A;  3AU7 A;  4I7Z C;  5JPN C;  3BVM A;  1WTO A;  1SBB B;  3U9O A;  2O5I C;  1JB3 A;  1NAP A;  1I4G A;  3K5L A;  3VYT A;  1STB A;  3T56 B;  1ZYR D;  2JSO A;  4MIU A;  1RF2 D;  3S2H B;  5LHY 1;  3RMH A;  1J9O A;  1IL8 A;  3VR2 A;  3M4O B;  3MC0 B;  3K57 A;  4BWG B;  2EJM A;  2M9V A;  3NWS A;  1I4X A;  2ZXP A;  3D31 A;  4B9X A;  4RHR A;  1CA5 A;  3HOX B;  1H9S B;  2WII B;  2F4I A;  1E2W A;  2F0T A;  1U9R A;  1G2S A;  3NP8 A;  1SNM A;  4Q5V A;  3ZYY X;  1D5M C;  5KNC A;  2B2W A;  1HTL D;  1TS5 A;  3K0Y A;  4X3S A;  5FO8 B;  4QB4 A;  5E4X A;  3GO5 A;  5KNB A;  5J39 A;  1RJT A;  4IUP A;  2VB3 X;  4G7O C;  5CBA E;  3DUZ A;  3OSO A;  4U68 A;  1B2T A;  3QO2 A;  1ET6 A;  4OIK A;  1K8O A;  3W2D A;  2NVY B;  2J7Z A;  2JYO A;  1EYD A;  4CBV A;  1W6K A;  4YIJ A;  4KY5 A;  4PV1 C;  1I3Q B;  1XXG A;  4EQP A;  4C3J B;  3LWU A;  4BS9 A;  2BDN A;  2XWJ B;  2LFN A;  5IGF A;  2PYK A;  4C3J G;  4A3J B;  2J0T D;  3DMU A;  5KYI A;  2F03 A;  2O2L D;  3AMU A;  3V05 A;  1H9K A;  4RKB A;  1MI2 A;  2NN6 G;  2B2V A;  1EWC A;  5KND A;  3DM1 A;  3N6R A;  1AW7 A;  1RD9 D;  5F2D A;  2EYP A;  1B1Z A;  4CHT B;  5JOB A;  2K32 A;  2F0J A;  1SFO B;  1Z7T A;  1Q1B A;  1EEI D;  2BE5 D;  2SOB A;  4MN3 A;  5ELD A;  2WIN B;  1E2V A;  1CFM A;  4KD4 A;  1ROD A;  3MA2 B;  1KLU D;  2HCI A;  2XRS D;  5FK9 C;  1OXT A;  2BCO A;  4XYQ A;  3GQB A;  2E74 C;  4FXK C;  5A35 A;  1CQV A;  3MHB A;  5EBC A;  2J4X A;  1JQY D;  1VMC A;  3D3R A;  4U67 3;  3DXJ C;  4K14 A;  5D14 A;  1XTC D;  3K58 A;  1LTG D;  4QUF A;  4A93 B;  1B44 D;  4CKB A;  2KEC A;  1X3P A;  1MD2 D;  4OL7 A;  4F88 A;  1D6E C;  5CV8 A;  4Y7N B;  3MAQ A;  1BNZ A;  4JBW A;  5FLX L;  3TP5 A;  3VYS A;  3VR3 A;  2JA5 B;  5CV5 A;  3PUV A;  1WD0 A;  4TSS A;  1TVX A;  3GTQ B;  3BG3 A;  1BDO A;  4RCN A;  1B9N A;  1SYC A;  1G29 1;  2SEB D;  5KIX A;  1SND A;  2A69 D;  3GP7 A;  3TDQ A;  2JEB I;  4G7Z C;  2PO4 A;  1PTO H;  5CV4 A;  5COR A;  1JWS D;  3ERQ A;  1DOL A;  1HUM A;  3GTL B;  1AP0 A;  1YNN C;  1STH A;  1RTO A;  4KKS A;  2E2I B;  2PPB C;  1SMY D;  3MXP A;  3UI2 A;  4IUU A;  2F0H A;  4RAU C;  1O7Y A;  3I4N B;  1QNU A;  2F0Q A;  1ESF A;  4K5W A;  4HCS A;  1BCP F;  5KEE A;  3N52 A;  1EOT A;  3CKI B;  4F8M A;  2RSO A;  2I46 A;  1NCV A;  1BUV T;  5M3M B;  1T5X D;  4KY7 A;  1STN A;  2FHT A;  1AZP A;  4RFB A;  2LKV A;  3A7A B;  4K6L A;  4IAL A;  1B3A A;  2EY2 A;  4HR7 B;  3AB9 A;  3L7Z C;  2WP8 J;  3OPO A;  5M3F B;  3DEP A;  4FXG C;  1I4Q A;  1MSG A;  5C0X G;  1EU4 A;  4ZLT F;  4DXG A;  1KDA A;  2KHS A;  1ONL A;  2EE1 A;  1ICW A;  2SNM A;  1AFP A;  1GUW A;  2XN9 C;  2EDG A;  2F0N A;  4P2C B;  5CR3 A;  3ND8 A;  3R3O A;  3FRP B;  5NUC A;  1EEF D;  1CM9 A;  1KAB A;  2RVL A;  2DNC A;  3DWP A;  3I72 A;  2IX1 A;  3NTK A;  5C3W A;  4DA2 A;  1STG A;  1LT6 D;  1DXM A;  1HA6 A;  3HZX A;  3PUY A;  3MFG A;  5JAV A;  1Y1W B;  1X3Q A;  5EPK A;  4A3K B;  4BBS B;  1XWE A;  3OIQ A;  3RD4 A;  2F3V A;  2X6G A;  1CQF A;  4M8A A;  3BS1 A;  1TWG B;  3JAM E;  1F2Z A;  1YNJ D;  2MPM A;  4DU9 A;  4G7H C;  1LTI D;  1CTM A;  2K05 A;  5IGG A;  1H9R A;  1CT1 D;  3HS0 C;  3LWE A;  3LNN A;  1ZYR C;  4H7B A;  4KKU A;  3RZO B;  2A68 C;  1A3U A;  1ILQ A;  3MTS A;  4ABN A;  1FNU A;  2Y0S B;  4KN4 C;  5DAU A;  1STA A;  3MZ5 A;  1VMP A;  2PZW A;  2OF1 A;  1TS3 A;  4CGY B;  2O5J C;  2F0W A;  3HP3 A;  1LV9 A;  4IN3 A;  1V1P B;  2KEE A;  3J80 E;  1EYC A;  4QCL A;  2EJF C;  1G91 A;  2LS0 1;  4K8I A;  5ELE A;  3KBG A;  1C4Q A;  3S14 B;  5LL6 X;  4L63 B;  4B08 A;  1X32 A;  4CJ1 B;  2HQE A;  1NUC A;  3SR1 A;  3M3Y B;  1EL0 A;  1AN8 A;  1G2T A;  2F0L A;  4LK1 C;  3M7N A;  4DAY A;  3Q23 A;  3J7A V;  1CZW A;  3TN2 A;  1SYD A;  2L0C A;  3A8J E;  2EYL A;  1LT3 D;  2IW3 A;  2QEJ C;  2K5D A;  4ID6 A;  1TWH B;  4XYO A;  2WKC A;  3OOC A;  2MP1 A;  3L9A X;  4A3F B;  1JE4 A;  4C3I B;  1BO0 A;  1ENC A;  5E1F A;  3D4D A;  2NYZ D;  3VA7 A;  3BVG A;  3NSW A;  1QG7 A;  4CJ0 B;  2DN8 A;  3TZD A;  1EY4 A;  5G3L F;  3I73 A;  1J8I A;  4Z9C B;  1SNC A;  5EQ0 A;  3D4W A;  4ZRZ A;  2PNR C;  1R9T B;  1S5D D;  3HOZ B;  3MEH A;  3A56 A;  2WB1 B;  2BE5 C;  1S5F D;  5CV6 A;  2JP1 A;  2C9O A;  1LAB A;  1DM0 B;  3OWE B;  1SXT A;  1GUG A;  3DWQ A;  2CVR A;  4L8J A;  3SDZ A;  2SDF A;  3SK5 A;  1LLR D;  5I9P A;  4Q0F A;  1TU2 B;  2WKD A;  5M9O A;  3BVZ A;  2A74 C;  1KDC A;  2F1M A;  2RQX A;  1A15 A;  2ID0 A;  2WAQ B;  5T1I A;  3H3V C;  3R93 A;  4DXF A;  1VCI A;  1V43 A;  2L55 A;  5ISR A;  2NTS A;  1BCP D;  2QF7 A;  1JIC A;  5IGB A;  1MSH A;  2ICI A;  1E2Z A;  2K33 A;  3IL8 A;  1UNS A;  5EKK A;  2SNS A;  1FNV A;  1ZXT A;  1OXX K;  3I4L A;  3C1E A;  1NSN S;  1CZG A;  4OO1 G;  3ND9 A;  2DY7 A;  3C1F A;  3TP6 A;  1L0Y B;  4A3B B;  5C4H A;  3PV0 A;  2K5W A;  1BBX C;  5BN3 A;  2F0P A;  3VR4 A;  4E6I A;  5D3D A;  4LJZ C;  3KK7 A;  5BN5 A;  1VDZ A;  1Y8P B;  2B2Y A;  2MGS A;  4FP5 D;  2NN6 I;  2F0I A;  1F9R A;  1PZJ D;  1SMY C;  2KCN A;  2JXM B;  1G8Z D;  4R9W A;  1IKM A;  2HUG A;  2A6E D;  1IHZ A;  1QCB D;  3QJY A;  4RGM A;  1HPC A;  4FVM A;  1U4R A;  1IKL A;  2B8G A;  4CJ2 C;  1I6H B;  5IOC A;  3VR5 A;  2GA4 B;  1F2M A;  3IFD A;  2N88 A;  1Z6H A;  1QNK A;  5C4J B;  2G9D A;  4IZ8 A;  3TME A;  3J7Y W;  2NN6 H;  2MUY A;  1D1I A;  3V96 A;  1QB5 D;  1TS2 A;  3S1Q B;  5I6Y A;  3K6O A;  4EQN A;  5M5X B;  3S1M B;  5A2Q L;  1SNO A;  2HDM A;  4V0B A;  4IUN A;  4WJW A;  1PTO D;  3TP7 A;  2EY5 A;  1DCZ A;  1WCM B;  1Q8I A;  3EA6 A;  1EZ8 A;  1FD7 D;  2FFK B;  2M00 A;  2EVB A;  4UAI A;  4BBR B;  1PFB A;  5KRU A;  3R8B A;  3K7A B;  1LAC A;  5I4D A;  4QMG A;  1MGS A;  4DK0 A;  4FF3 A;  5CV9 A;  2F0U A;  2E2J B;  4X3T A;  3RLF A;  3FMC A;  5M5Y B;  2EYM A;  1STE A;  2LY7 A;  1CA6 A;  4S3S A;  4XQN A;  4QF4 A;  5I2Y A;  1JC7 A;  1A6X A;  1E0B A;  2B8F A;  1MBY A;  4HTH A;  1JOO A;  4PNY A;  2D5D A;  2F0M A;  5HUR A;  5K36 G;  2K7V A;  4OGQ C;  4IFD J;  1GUS A;  4ZUJ A;  1BCP B;  1YNJ C;  2EXZ A;  5C0X J;  4K5V A;  3ONA B;  2B2V C;  3J81 L;  1O7L A;  2E2D C;  5AFW A;  5C5L A;  1RHP A;  3QIA A;  2B2T C;  2XIW A;  3E0J A;  2EZV A;  1XYI A;  3RUZ A;  1V8Q A;  3VYU A;  3GTP B;  2Q8R E;  3F2U A;  3H6M A;  1B9M A;  1FGB D;  5CYU A;  2D62 A;  1ZEQ X;  4TQU S;  1SSO A;  3RZD B;  5C3E B;  1EIH A;  2RDF A;  3O13 A;  2EYF A;  3NTH A;  2QIL A;  1H9S A;  3M7G A;  4HN7 A;  5G3L D;  3LX0 A;  4TKO B;  5C0X I;  1KTK A;  2L5T A;  3MWY W;  1S5E D;  3P1H A;  4H13 C;  1B4O A;  4R8N A;  2QDB A;  2ZXR A;  3CRL C;  3T51 B;  1PFN A;  2JA7 B;  4KTA A;  4DF7 A;  4ZQ3 A;  1KAA A;  3HGB A;  5JJZ A;  1RTN A;  3OWF A;  1ILP A;  2Q8T A;  4C56 C;  1B50 A;  2X69 A;  4NMZ A;  1F9S A;  5EKL A;  3CU7 A;  2VUM B;  4G4K A;  3BDC A;  1SDF A;  5CMD A;  4DAV A;  5BN4 A;  2CW0 D;  4CKC A;  4RGO S;  4FXD A;  3GV3 A;  2F3W A;  3K59 A;  1GHJ A;  4DN4 M;  1S5B D;  4TRD A;  3I91 A;  2YU9 B;  1R4P B;  3FPP A;  5K5P A;  4M1U B;  3K5O A;  3OMG A;  3MXG A;  4GZY C;  1JWU D;  2O4X A;  3MVV A;  1D1K A;  2PZU A;  1EY9 A;  3FDT A;  5J1Z A;  1K8M A;  4IFD G;  2KED A;  2A5H A;  3HOU B;  1HXY D;  1ENA A;  3KF8 A;  4PMC A;  4A3E B;  1QE6 A;  2I07 B;  2KUM A;  5I2X A;  3BYY B;  5JVH 3;  1DD2 A;  4IUT A;  1TY0 A;  1I50 B;  2RDG A;  3PO3 B;  4XIG S;  2B2U A;  3QWN A;  3CQZ B;  4O42 A;  2KOL A;  1SYF A;  3SK8 A;  2H1E A;  3K5N A;  4XT1 B;  3PIP 3;  5HGT A;  5IT9 E;  2K5Q A;  1BXT A;  4NKL A;  1WVL A;  4UDU C;  2BA1 A;  1C8C A;  4KKT A;  3I90 A;  2ZT9 C;  5C6A A;  3PUX A;  4JK1 C;  3S1R B;  2IWH A;  4ME5 A;  4FO2 A;  3I3C A;  5C3X A;  5CV7 A;  1BCP C;  1SE3 A;  4IUV A;  4H44 C;  4ZK9 B;  4RCO A;  2F0K A;  1SYE A;  4ZAI A;  4NW2 A;  4C3H B;  2M2L A;  1PTO F;  3CRK C;  3H94 A;  4HSP A;  4KV6 A;  1HCZ A;  2IPK D;  3X3N A;  1SJE D;  1BQQ T;  2R93 B;  3VYR A;  1GUO A;  1GUN A;  1PXU A;  3SHL A;  5EPJ A;  1DOM A;  4IQZ A;  2ENB A;  4ULL A;  1KDB A;  2NVT B;  3GTK B;  2TMP A;  1JR0 D;  5JVG 3;  2JA6 B;  1TY2 A;  3HEJ A;  2EY6 A;  2BDO A;  1EQV A;  1TR5 A;  3T53 B;  3VA5 A;  5IGD A;  1B53 A;  3TP8 A;  5JEA J;  3G6J B;  2K01 A;  4KD3 A;  1IYU A;  1Y1V B;  1SJH D;  3J7A F;  3ITP A;  3C3L A;  3MXU A;  3DEO A;  5DEH A;  4DAP A;  5FO9 B;  1EY8 A;  1W6J A;  1H9J A;  3FPU B;  4N9T A;  2PCF B;  1C48 A;  3S15 B;  1O78 A;  3HG9 A;  4RHS A;  3DHQ A;  4KN7 C;  3TZU A;  2EYH A;  1EY7 A;  4PQX A;  3H91 A;  1PRT F;  1PZI D;  5DM7 3;  1AZQ A;  4LMQ D;  1GHK A;  3S2D B;  1QWY A;  5CGK A;  1EQT A;  4KJN A;  5I9O A;  5ELF A;  3NE5 B;  4C3I G;  1EZ6 A;  1LTT D;  1JOQ A;  3W3A A;  4FNF A;  1F2L A;  4DNT B;  1FNW A;  1HFG A;  3KUP A;  1Q1E A;  2Z4I A;  1AEX A;  3NBH A;  3D8G A;  1I4R A;  5FO7 B;  2XVS A;  2XWB B;  1WD1 A;  5C4X B;  2KA7 A;  5EKI A;  2MHV A;  4F7X A;  4IUQ A;  3S16 B;  1O80 A;  4KHZ A;  1Y8O B;  2HDL A;  2L9H A;  1VF5 C;  1GUT A;  2NTT A;  1OXV A;  1EIG A;  2K03 A;  2XRQ D;  1EWH A;  1FR3 A;  2WAC A;  4RH6 A;  2AQ2 B;  1SE2 A;  4H0L C;  3M85 A;  1I4P A;  3NTI A;  3Q0A A;  1TQO A;  3WDN A;  4A3D B;  1Y8N B;  3EJI A;  1SYG A;  1LTR D;  3OIP A;  5FKA C;  1HFN A;  2VXW A;  5FLX E;  5JEA G;  2EY1 A;  3FVQ A;  1ZKO A;  2PMZ B;  2EPB A;  2EYJ A;  3JAM L;  1V1P A;  5CBE E;  4K2L A;  5C44 B;  2A69 C;  5ELC A;  3NK9 A;  3I4M B;  3NHH A;  3BDO A;  4KK7 A;  4CKE A;  4NDX A;  5C4Z A;  2RKS A;  1ESR A;  3I8Z A;  1XX8 A;  4DNR B;  3U9S A;  2AQ3 B;  3H0G B;  5EGT A;  2A68 D;  3PIO 3;  5IGC A;  4DFA A;  4N9P A;  2JA8 B;  1QJO A;  4WFN 3;  5M5W B;  2VB2 X;  3OW7 A;  4IUR A;  2FMM A;  1IW7 D;  1EY5 A;  3D6W A;  4KMU C;  3D6C A;  3J80 L;  4EVO A;  1PDQ A;  4PMB A;  2CW0 C;  1F2Y A;  1RKN A;  4DGZ A;  3A7L A;  2B63 B;  1O7Z A;  4LAA A;  2PW5 A;  1PZK D;  2B2Y C;  1SEB D;  1ET9 A;  4KHV A;  4RGT A;  2AQ1 B;  1GOZ A;  4A3I B;  2JE6 I;  2Z1C A;  2IX3 A;  3S9W A;  1CI3 M;  2K28 A;  2L1B A;  2QCP X;  1OO9 B;  2KQ3 A;  1A3V A;  1KLG D;  1II3 A;  3SXH A;  1T5E A;  1BR9 A;  3C46 A;  4FF4 A;  2B2W C;  1L0X B;  5E4W C;  2X6L A;  4FF1 A;  1U4L A;  3NQT A;  4OHJ A;  2ZXO A;  1LT5 D;  1DJR D;  1HHV A;  5K36 H;  3Q6S A;  3KBX A;  4ILW A;  1M4V A;  4K6D A;  2N55 A;  1OXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...