1PFBA

Structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein
publication title Structural basis for specific binding of Polycomb chromodomain to histone H3 methylated at Lys 27.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Peptide binding protein
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2003-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pfbA00
3TN2A 1KNAA 1RTOA 1VMPA 1IKMA 1EL0A 4MHEA 1F2LA 2NYZD 1GUWA 2X6GA 4DN4M 1MGSA 4HSVA 1G2TA 4IUQA 3D6WA 2N88A 2FMMA 2L4NA 1B53A 1DOLA 2B2YA 3R93A 1BNZA 4X3KA 2R3ZA 1QE6A 1SSOA 4IUUA 5D65A 2B2UA 2EPBA 2FJ2A 2K01A 2VXWA 5E4WC 1WTPA 2NWGA 1ILPA 1X32A 1AZPA 1X3PA 2EOTA 2MPMA 1U4RA 2RVLA 1XYIA 1RTNA 1CA6A 1SAPA 2L1BA 4X3SA 4QUCA 1WTVA 4XT3B 1E0BA 4UAIA 1IL8A 3N52A 1O7ZA 2B2WA 2K28A 1A15A 2L9HA 1WVLA 1U4MA 2FHTA 1S4ZA 3FPUB 4X3TA 1NAPA 3ONAB 2L12A 4ZLTF 1QG7A 1F9RA 1PFBA 2B2UC 2M2LA 3IL8A 4R9WA 2RSNA 4HCSA 3GV3A 1MSGA 4ZAIA 2HCCA 1DONA 4ZKBB 2JP1A 1X3QA 1WTRA 2Q8TA 1EIHA 3G7LA 1IKLA 1J8IA 1ML0D 1WTOA 1ZXTA 2KOLA 2MJ8A 5E4XA 2D9UA 2MGSA 1Q3LA 3QO2A 1LV9A 1HFGA 1EOTA 2B2VC 2K05A 1B4OA 1J9OA 1HUMA 2H1EA 1RJTA 2B2WC 2K04A 3H91A 2B2TA 1WTWA 1SDFA 1DOKA 2KEDA 3P7JA 1KNEA 2X6LA 4XDXA 5EKIA 5CBAE 4IURA 2EE1A 3F2UA 4IUPA 4ZK9B 1O7YA 4LMQD 2DY7A 1BBXC 1O80A 2FINB 2KEEA 4RAUC 1WTXA 1M8AA 1BO0A 3I90A 1ILQA 4OIJA 2B2YC 2CVRA 1WD1A 1ESRA 2HDLA 4O42A 3TZDA 5T1GA 2HCIA 1PLFA 2KUMA 2HDMA 2XIWA 5CMDA 2MP1A 1HHVA 1EQTA 3DEPA 3KUPA 3UI2A 1B50A 4HEDA 5AFWA 1G2SA 2RA4A 1WD0A 1U4PA 3MTSA 3DM1A 2FFKB 5CORA 2B2TC 3DEOA 4IUTA 4NW2A 2Q8RE 1PDQA 2RSOA 5EPJA 5DNFA 4RWSC 4QUFA 1TVXA 2BDNA 3LWEA 1C8CA 1NR4A 1JE4A 2IL8A 3SVMA 1AZQA 1G6ZA 3Q6SA 1F9PA 5EPKA 1F9QA 2DY8A 2K03A 5JJZA 1HUNA 1U4LA 2KVMA 1XX8A 1DZ1A 1JICA 1DOMA 4XT1B 2K1BA 1BF4A 1PFNA 1VMCA 5CBEE 3I8ZA 1NR2A 1G91A 4CJ0B 2N55A 4CJ2C 4HAEA 5EQ0A 4ZKCB 1B2TA 1HRJA 3FDTA 1WTQA 5EPLA 2SDFA 3I3CA 4RA8A 2X69A 3I91A 4X3UA 3IFDA 3GV6A 4MN3A 1B3AA 5T1IA 4U68A 1HA6A 2JYOA 1RODA 1MI2A 3MWYW 1ICWA 2HUGA 2L11A 1AP0A 4R8IA 1HFNA 1PFMA 2J7ZA 5COYA 1CA5A 1RHPA 5EJWA 2NZ1D 1CM9A 1F9SA 1MSHA 1NCVA 2B2VA 4OIKA 4CJ1B 3HP3A 1EIGA 3KBXA 2KECA 5D14A 4IUVA 1QNKA
chains in the Genus database with same CATH superfamily
1L1OB 1B44D 3BDCA 4JK1C 4TKOB 1OO9B 2RQXA 3EJIA 2IHFA 4DUYQ 1XPRA 4DR1Q 1HNWL 1QVGA 2Z6KC 1STEA 2N88A 4IUNA 3PO2B 1EY4A 3GTKH 1LO5D 2CCZA 1N36Q 5M5YB 2CWPA 1QVCA 1YI2A 4K8IA 1GOZA 2IY5B 3M9BA 1YHBA 3A5UA 2EVBA 3OOCA 2F3IA 5C4XB 1ASZA 1XYIA 1RTNA 2P5ZX 4BBSH 2RKSA 4OX9L 4JI1Q 4XT3B 3VR3A 1IL8A 4JBMA 5C0XH 4A3FG 2XVSA 4H7BA 3NTIA 1E2WA 5FLXc 4JW0A 1EY0A 4DAMA 1I6HB 1KABA 5KIXA 3H0GH 1PVOA 1IKLA 1HNWQ 3CCQA 1STAA 3ERSX 1K0SA 1H9SB 3KF8A 3KJOA 4DV7L 1SDFA 4LF9Q 1KNEA 3UE1A 5C44B 4CKBA 1K8GA 4TVAB 5H1SE 4EQOA 2UXDQ 5EGTA 1A6XA 4OX9Q 2HCIA 1K83B 3PF4A 4X64L 2F0SA 2MP1A 2QDLA 1QOHA 4C3JB 2MO0A 2H5XA 5CYUA 1PH6A 1U0LA 4G7ZC 2ES2A 4NW2A 1Y8OB 3S1NH 4F8MA 1RD9D 3SK4A 1JOQA 1S40A 3A7LA 3M4YA 3S9WA 1ENAA 3D4DA 4XQQA 2K03A 2MO1A 4DV7Q 1LM0A 1EY8A 4CDEC 3T16A 4CJ0B 4CJ2C 3J80E 2F0MA 2QCPX 2F0WA 3DHQA 3CCRA 3RZDH 3L9AX 5EPLA 1Q81C 4A3EG 3PUYA 3VR4A 4R8IA 3SGIA 4A3IG 3A7AB 1TY2A 1G6PA 1VMPA 2VY3A 4JOIA 4RG1A 1F2LA 3TSSA 4GN5A 1SFOH 1Q8KA 4JYAL 2HQLA 3K7UC 1ENCA 3CD6A 5IP7H 4X66Q 3PO2G 2KHSA 1HR0L 2Q2UA 3T56B 3NUCA 4NDXA 1VQBA 1CQFA 1DD2A 5E3FA 5I6YA 4YCWA 3L2PA 5C4XG 5JPNC 3KFUA 1V43A 1IW7C 3F2DA 4K5VA 1XWEA 5LMNW 4L5TA 2DNEA 1WVLA 3FPUB 3LGJA 1F9RA 2B2UC 2G5DA 1TWFB 4R9WA 4R1JA 4HN7A 2QEXA 1YNJD 1QWYA 4DV4L 1V1PB 3S15H 4FDBA 4DK0A 1VF7A 2KOLA 2EYPA 4CGYB 1K0RA 1YNJC 1SN8A 1HR0Q 5IGCA 4IPGA 2R61A 2F0HA 1DYQA 4XDXA 5M5XB 1B3QA 4C2MH 2R93G 3VR6A 3M7NA 1I3QH 3BYTB 4KY6A 2YTVA 3STBD 4A3LG 5ELCA 3T1HL 3PF5A 3BZKA 1KIXA 1OXVA 3L3OC 1Y1VB 1O7IA 4A3KH 1EY9A 1D6EC 3W1BA 3S17B 4NP5A 1LT3D 1SMYD 2D5DA 2OTJA 2F0QA 5L37A 4BBRB 1JT8A 4OWXB 3W2DA 4WRDA 2NBFA 2D0PA 3D4RA 1U4LA 3FMCA 1NBWA 4Z9CB 4C3HH 1DOMA 3C3LA 3S1RB 1EY6A 2VUMH 3I8ZA 2F0UA 3GDEA 4QY7A 5LL6X 4KLKA 1HRJA 3CCSA 1S3OA 4G7HC 2R7FA 1JCKB 4DXFA 2JA5B 1VQPA 1GO3E 1Z9FA 3P20A 3SR1A 4U68A 2PQEA 1ASYA 1ICFB 1ICWA 2NVQB 2L5TA 1STNA 2V4DA 5IE8A 2B2VA 1P16A 2I46A 2OWOA 2CKZB 1TS2A 4K5XA 4L5SA 4DV5L 5G3LD 4KK7A 3I56A 2KCMA 3WDNA 1K8AC 4FXDA 1H9KA 1PRTB 4R4TA 5DEHA 3I4MH 3U4VA 3M4PA 1ILPA 1PV4A 4ABNA 2WAQE 1HZ9A 3PGZA 2MNAA 2RVLA 4R4OA 3JAMi 2EDGA 1R9TH 2KJXA 3EROA 4N8X1 4PV1C 5JEAH 2PZTA 5KYLA 2V1CC 5AJ3L 5IGDA 4ZLTF 4GNXA 3HOVH 1C7YA 2HHHL 4QF4A 3HOWB 5C0XI 4ZKBB 2K5NA 2R7DA 3HOZH 3NWSA 1TWCB 1AN8A 2KBNA 3AQQA 1GUTA 3HRZC 1KC8C 1PYSB 4GLAC 2B2VC 1HUMA 3S16H 4DAYA 2K32A 1KQSA 2E74C 1G291 2RCFA 2WKCA 4QJFA 2VNUD 4RCOA 1IYJB 5CV4A 4FF3A 3MXGA 3NPPA 3OHXC 1FYCA 1EEID 2G9DA 3PMFA 1JOKA 1PTOB 5T1GA 1Y1WB 2XIWA 3AMUA 3OW2A 1CHPD 1YHAA 1N34L 3UI2A 5DM73 1WD0A 4ZRZA 3KDFA 1U4PA 3MTSA 5G3LF 3RN2A 5M5WB 4A3FH 1B8AA 2HHHQ 1Y1VG 2J4XA 2KA7A 5EPJA 2HIVA 3FPPA 2K5VA 1B7YB 4BBRG 2LS01 4OGQC 2UU9Q 4C1NK 4K2LA 1IZ6A 3Q6SA 1LTRD 3BDLA 4OO1G 2NN6G 2K6AA 4UDUC 5M3MB 3TP6A 3K81C 4XQJA 3OWFA 4HJ9A 4A3DG 1NTGA 4PMCA 3I4NH 1GUOA 3GTPH 1S72A 1ZKOA 3CAMA 1IBML 1KTKA 2JA9A 4GN3B 1KLUD 2R7ZB 2PI2E 2ZJQA 5C5LA 4HR7B 4KJNA 2RHQB 1N34Q 2JYOA 1MI2A 1CUKA 4A3GB 2JEAI 3DLLA 5KGUA 1RHPA 1VQIA 1VQGA 3K7AH 2A5HA 3HP3A 4F88A 2PI2A 2EJMA 3DWQA 3TS2A 1M4VA 2JJQA 4DN4M 3D6WA 4K5WA 3DMUA 3J7A5 1A2TA 2K52A 1PH5A 1GJXA 2PW5A 1SSOA 4WJ4A 5D65A 1B70B 5GQOA 2SNSA 1FNUA 1PH9A 1NY4A 1IBMQ 5E4WC 3A8KE 1Q12A 5IWAQ 1PH1A 2E2IH 5CR3A 2E8GA 5I6WA 2HD3A 2UUAL 2LMCB 4GOPB 3A74A 1PRTF 1QB5D 2B2WA 4R4CA 2ZTEA 4A3EH 1U4MA 1TXYA 1A3VA 1UNSA 1R4QB 1WYDA 3IL8A 4NKLA 4A3IH 3HOWG 3U9OA 4YHHL 1SMXA 1W3SA 2JA7B 1TWHB 1YHQA 3NQTA 2F3VA 2LXJA 3DWAA 4RGNA 2Z4IA 2A69D 4QGUA 3H91A 4LNQA 3PO2H 2OTLA 5LMNL 1JQYD 4IURA 1EEFD 1VQOA 5M5YH 2FINB 2VB2X 4WJ3M 4DV2L 1EYDA 2UUAQ 2A69C 2L0CA 3I90A 3RUZA 3A55A 3BDOA 3HEJA 5C4XH 4G7OC 2ZJPA 1Y1WG 1S5BD 4Y52H 3NWTA 4UPAA 4X65Q 4KHPL 2IPKD 5FO7B 3GTLH 1PTOF 4IPCA 4ME5A 4YHHQ 1JR0D 1RDPD 2K33A 1PZID 1F9PA 5FOBB 1I6HH 3VR2A 2DY8A 3DWPA 1EZ6A 2EYFA 4JI6L 1EU4A 5LMNQ 1GM5A 1EYGA 1YJNA 1BOSA 1VQ6A 4P72A 1ZYRD 4DV2Q 3WWVA 5C0XJ 2GVAA 1JB7A 1Q82C 2R7ZG 2R93H 2JA6B 2WFWA 3M4OB 2JN4A 2B8GA 1WOCA 4P71A 4N8FA 4CKCA 1ZYRC 4MN3A 5IYDG 3A5ZB 4JBWA 4A3LH 3FP9A 1WCMB 2F0FA 3CRKC 2ENBA 3C1EA 4KHPQ 1H9MA 2Q2TA 1X6OA 4BY1B 4JI4L 5NUCA 1KL9A 1STYA 1TWAH 2BOSA 3CP0A 2WV6D 3S14H 1U5KA 2ID0A 4IUQA 2IT1A 4JI6Q 4DR7L 4OWWB 3R93A 3OTOL 2R3ZA 2IWHA 2EQSA 5I9PA 1AEXA 4JV5L 3CCJA 3G6JB 3J81c 1YNNC 1S5FD 4WFN3 4NMZA 2CFMA 2EZVA 2RF4A 1I6VC 2L1BA 3ER0A 3AYHB 3I55A 2TSSA 2RHSB 4YIJA 3JAML 1C4QA 1HQRD 2DGYA 3N52A 1LT4D 1MD2D 1I94L 5IY0A 1QUQA 4JI4Q 3UDXA 4A3CG 4IFDG 3LNNA 1PH8A 1EIHA 5C4JB 4FF4A 3NHHA 1X3EA 3J7AV 2JA7G 1KHIA 3VYUA 4DR7Q 4LF4L 3OTOQ 4UP9A 1EYAA 3K80C 3ULPA 4JV5Q 1B1ZA 1TKWB 5CBAE 4JC0A 3F2UA 3FKIB 4ZK9B 1O7YA 4JI7Q 4Q0FA 2YYZA 4OIJA 3HG9A 1GHKA 4O42A 4UP7A 3RZOH 2JK8A 3HS0C 2ZXOA 1I94Q 1K28A 4LFBL 1OXUA 2DJFC 4HIKA 2RA4A 2UUCL 2PYKA 3K58A 1UE1A 3K0YA 5TSSA 3W1GA 1PH3A 1VQNA 3BJUA 3ERQA 1VDZA 1HH2P 3SK5A 4A3JB 2KVMA 4ZCKA 5IYCG 1MKHA 4ID6A 2XTIA 3K8AA 1A63A 1ZEQX 2OF1A 3PUWA 5M5XH 2EYJA 1FGUA 3NELA 2Z6KA 2JA6G 4WJWA 3I91A 3IFDA 4EGVA 4LFBQ 3MC0B 1W6KA 1WCMG 4UHVA 2R92B 2A68C 2NZ1D 3BG3A 1X56A 4DUYL 1V9PA 5FLXL 4DR1L 5IIFA 4P2CB 1Y1VH 1EL0A 4IPDA 4J8QA 3S17H 4QL5A 5FO9B 2F4IA 1W2BA 1G2TA 3FRPB 4BBRH 4IQZA 2RBMA 1B53A 1TY0A 3HKZG 4OO1H 2NN6H 4IUUA 4A3DH 1TR5A 2E2JB 2CQOA 1OXTA 5JJLA 2B3GA 3S1RH 2K50A 3GTJH 1X65A 5JPMC 2DUDA 4UAIA 1GUGA 4HSPA 4YY3L 4Y7NH 4K6LA 3D3RA 2A8VA 2SEBD 3GO5A 2NVQH 1UE6A 3NTHA 3JAME 1QNUA 4I7ZC 1MJCA 2A73B 3A54A 2F3WA 5CV7A 4KKUA 3J81j 4LF9L 4ILWA 1Q3LA 4JI8Q 2UXDL 1DOKA 3AB9A 2Y0SB 4IUPA 1KAWA 3NBHA 1VQAA 4JI3Q 3FKIG 1AFPA 5CGKA 2O5IC 5LHY1 4YY3Q 4P73A 1CFMA 2N49A 2VS1A 4QIWB 2SOBA 3I4NG 4O0AA 2JA8B 2B63B 2SNMA 3HOWH 3ZJYC 1LTID 1V1OA 4LAAA 3H09A 4KY7A 1PH2A 1TWCH 3F2BA 4FXGC 5IGEA 4A3JG 4XT1B 3F2CA 1EQVA 1G91A 4LFCL 1L0WA 2AQ2B 2A1AA 5EQ0A 2E2HB 5CC4A 5JEAJ 4XYOA 3VYRA 2ALYB 4MNOA 3S2DH 3S1MB 2VL6A 2AHOB 1KRSA 2HUGA 1Y1WH 1PFMA 1EU3A 1HNZL 3ITPA 1F9SA 2CQAA 3R2TA 3CPWA 1EIGA 4DNIA 2KECA 3KOJA 5BN4A 5F2DA 3UE0A 1NNXA 4X66L 4K0KL 1SNMA 1JJGA 3EQLC 1PZKD 5FLXE 3PIO3 4B3RL 3ULLA 2B2UA 1S5CD 4LFCQ 3GTQB 1JMCA 4N9PA 3H94A 2NWGA 1Q46A 4HMJA 3TQYA 3TS0A 1B9NA 3NP8A 2PQAA 5ELBA 2TMPA 2VB3X 3CQZH 5I4DA 4IJLA 3D4WA 2R7ZH 4AH6A 1FNVA 1O7ZA 3OPOA 5IYDH 5C3EB 5FLMG 2DJGC 1HNZQ 1HJPA 1Y8NB 3ONAB 4XXEA 3GV3A 3O13A 1X3QA 4K0KQ 2N8NA 4WORA 1ML0D 4RGTA 3M7GA 3FHWA 2NVXB 2MJ8A 3PCOB 3HGBA 4B3RQ 1LV9A 1BBUA 1VQLA 1WTHA 3I7FA 4RHSA 2KEDA 1SJHD 4JBJA 3PIPA 5M3FB 1I4RA 3S1QH 2QA4A 2Y0SG 3BYYB 5C3XA 4RAUC 2A6HD 4CDCC 4I65A 1SE4A 4S3SA 1TS4A 2MUYA 5C4ZA 2NB0A 1LTLA 1D2BA 4OWTB 2GA4B 4OONA 1N9WA 2B2TC 1EZ8A 1BKBA 2UXCQ 4HIOA 2JA8G 1NSNS 4A3CH 4KMUC 4IFDH 1A3TA 1AZQA 2B63G 1G6ZA 1XMOL 5C44G 4ODGA 3RR5A 2JA7H 1TWHH 2EYMA 4AYBB 1GHJA 1SE8A 3NXWA 2UXBL 1C48A 3J81i 2HIXA 4UP8A 3LWUA 4B9XA 1SNPA 4C3JG 2ZM6L 1D1IA 4RA8A 1XMQL 3STBC 3GV6A 5KRUA 4DF7A 4DNTB 1K3BC 2DN8A 2ASBA 1E2ZA 5A2QE 2LSSA 1J5EL 1HFNA 3MFYA 5EJWA 3B6YA 2F0IA 1MSHA 2KCNA 1H9JA 4CJ1B 2AQ1B 2PMZE 1SMYC 1Z6HA 5CV6A 3C46A 1XMOQ 1LUZA 1HA5A 3KBGA 3OYYA 1TQOA 2ZXRA 2EPBA 2UXBQ 1C0AA 5IYCH 4DV3L 2Q2HA 2NN6I 1EWIA 3E9HA 2ZM6Q 1SYBA 1JWMD 1XMQQ 2KCTA 2XWJB 3K5OA 2JA6H 1XPUA 3M4OH 2K28A 1STGA 1J5EQ 1IL2A 5C3EG 2FHTA 1S4ZA 1SNQA 4JI2L 1WCMH 1FD7D 2EXDA 5BN3A 1CSQA 3G7LA 1WTOA 1AE3A 2A19A 5ISRA 4IO9A 2Q2IA 3QB3A 5ELDA 2OT2A 1OXSC 3RNUA 3BS1A 2MFIA 5D3DA 1L2FA 5M3FG 3E6ZX 4DV3Q 1JWSD 1SYCA 2DNCA 1I50B 2DY7A 3SDZA 4AQYL 5J39A 3GP7A 3CCEA 3MHBA 1H95A 1WD1A 1ESRA 1QILA 2IJ0A 4H0LC 3MFGA 4A3MB 4JBKA 4GNXB 4GLXA 2XWBB 4JI2Q 4FNFA 2UU9L 2AUKA 2RSOA 5IGGA 2BDNA 2VZAA 3AEVA 2E5LL 2EY2A 1ET9A 3K5LA 4B3ML 1EOVA 4JVZA 4V0BA 4C1NI 1TS5A 4DAYB 4POFA 4K2KA 2E76C 5C4JH 2OQKA 1K73C 1DZ1A 2K4KA 2WIIB 3LX0A 3QWNA 4PMBA 2K1BA 4AYBG 4YWLA 1FGBD 3TDQA 1NR2A 4LF5L 3GTGB 1CK1A 3CC4A 4AQYQ 2O5JC 4BA2I 3T1YL 1BXTA 2ZTDA 4HAEA 3CF5A 2A6ED 3FKIH 1UUPA 3E0JA 3HOXB 3CRLC 2N3SA 1BCPB 2K5DA 3ZYYX 3WOFA 3KDFB 4DAVA 3E5SA 5LL6S 1PRTD 4RH6A 2F0OA 5C6AA 5I2YA 1Q90A 1SYEA 4A3BB 2JE6I 2MQHA 2E5LQ 3TN2A 1KNAA 1PRTC 4B3MQ 1HQMC 1YITA 2C9OA 1EY5A 2M00A 2X6GA 3T51B 2IX3A 3BVGA 1JJ2A 1B9MA 1HPCA 5IWAL 1K9MC 4UY8C 2FXQA 4DV1L 4ZYSA 3CHBD 1KD1C 4LF5Q 2F4VL 2K01A 4OL7A 1E1OA 4MTNA 5I9OA 4A3JH 3T1YQ 3VA7A 1EIFA 3ICEA 2NVTB 3QR8A 2JA5G 4KHVA 1CA6A 2AQ3B 4KD3A 2PZWA 3RMHA 1PA6A 4LF7L 1HCZA 2ZT9C 1A15A 1VS0A 2L9HA 5DLQE 2D2CC 5EKLA 2QILA 3MXPA 2M2LA 3MEHA 3G48A 2XGTA 3GQBA 5M9OA 4DUZL 3BZCA 1GKHA 2Z4HA 1PMRA 4B08A 1PTOD 3OIPA 1LTGD 5GADC 4TSSA 5LMUL 2D9UA 4DV1Q 4X3UA 2K05A 2H1EA 1BCPD 3SHLA 1RJTA 3KLSA 2KHIA 2F4VQ 2F0JA 2RDHA 4FF1A 2F0TA 1VQEA 4TQUS 4DAPA 1T9HA 3AU7A 3HOYB 1JWUD 3U9SA 2I5MX 4QB4A 1LABA 2LKVA 3CW2C 1K3RA 2JXMB 4X65L 4LF7Q 1PLFA 1FL0A 4HTHA 1HHVA 4A3MG 1GUNA 1UEAB 1L0YB 1A3UA 4F7XA 4DR5Q 4L5RC 5FLMH 3U50C 4DUZQ 2YV5A 4TRDA 3I70A 3NENA 1A2UA 4R4IA 5LMUQ 5EPKA 4R8NA 1SLJA 3CXCA 2CW0D 1HZBA 2YTXA 3M85A 2F0DA 2F0NA 1BUVT 1RF2D 2D0OA 2EYHA 4HIDA 4IFDI 4DR3Q 1EUJA 3Q8DA 1CQVA 3J81L 1Q8IA 1PHJA 5IT9c 4C2MB 3KLSX 4U673 4DXGA 3HOXG 1XJVA 1W6JA 2X69A 1VQ5A 4PQXA 1J6QA 1RODA 3J7AF 2BE5D 4RKLA 1XPOA 1K8OA 2JSOA 1CM9A 4O1NA 2F0PA 4A3BG 3PUVA 4A3KB 1BCPF 4DPGA 2HQEA 5M3MG 1FNWA 4NB3A 4IALA 2JA8H 3KF6A 1WFQA 3D31A 2B63H 1YVCA 3RLFA 5C44H 2PO4A 2IX1A 1VQCA 5IP9G 2J0TD 1WTPA 1EFWA 3HFZB 1HNXL 1EIYB 5CV8A 1X3PA 1SJED 2QF7A 1Z47A 4J6HA 4XQNA 3Q0AA 4A3GG 1K83H 3MVVA 4C3JH 3CU7A 4NXNL 3GTOB 1HTPA 1E7ZA 4LK1C 2BDOA 1N8RC 3A8IE 2XRQD 1N33Q 4LW1A 4X62Q 3PQIA 1BDOA 2JP1A 3E0EA 1J8IA 4IZ8A 2ZJRA 1JC7A 3MEFA 5ELOA 3HKZE 4GS3A 2L55A 2XRSD 1GUSA 4K8JA 1VQMA 2ZTCA 1J9OA 3I4LA 4JI7L 3EIVA 1WTWA 4I7AA 3P7JA 1HNXQ 3H3VH 3I4MB 4KHZA 3GTQH 5HGTA 1XNQL 2HDLA 3KYHC 2K14A 4NXNQ 2HDMA 1JOOA 3PV0A 1EQQA 1QUQB 4HCEA 1VCIA 3D6CA 1AW7A 1DCZA 1ESFA 1I4QA 3KUPA 1G2SA 1FR3A 2PW7A 1JB3A 5C3EH 1IHZA 2C5CA 2G9HD 3IKJA 4QUFA 4DU9A 3AFPA 2RDGA 5GAHC 1CKMA 5EAYA 4LF8L 3ULJA 2BCOA 2F1MA 2NVXH 3MXNA 1VF5C 1UEBA 1VQDA 2L15A 2KCCA 2LFNA 4JG2A 2IW3A 4DR2L 2PNHA 2QW7A 5M3FH 1XNQQ 4HJ8A 1VQ7A 1VQ9A 1XTCD 3SE0A 5C5MA 4K14A 3KJPA 1Q7YC 1NUCA 3J81E 4ME3A 4H44C 1TWFH 2UUBQ 3M3YB 3KBXA 3W5OA 5D14A 5KNBA 3NBIA 1F2YA 1PXUA 1HZAA 2WB1B 3F8TA 5J3BA 1IKMA 3RLNA 4KD4A 4C3IB 4IOAA 4YWKA 3OMGA 4HSVA 2VQEL 3CCUA 1LTSD 3CKIB 4LF8Q 4ZQ3A 3PIOA 1BNZA 1QE6A 1QZHA 3UDGA 4L6TB 2EJGC 4DR2Q 4DV6L 3CPFA 1SBBB 1TWGB 4OEMB 5BR8Q 5JAVA 4B3TL 1HTLD 4BY1G 1LT5D 4IFDJ 4X3TA 1SXTA 1SE3A 1E24A 4KJOA 5EKKA 3VYTA 4ZAIA 2HCCA 1YJWA 1NMFA 1CKNA 4JI8L 5IGBA 1JE5A 2VQEQ 3KK7A 4H13C 3OSOA 1ZXTA 1TU2B 5E4XA 2BH2A 2K5HA 4JI3L 1KLGD 3ND8A 2ICIA 3TRZA 5IODA 1D1KA 4AIMA 1IXRA 5ELEA 1PZJD 4DV6Q 1O80A 1SE2A 2KEEA 3BVZA 2QEJC 1BO0A 3MZ5A 4E6IA 4QMGA 1Q1EA 2JA5H 2WP8J 5EBDA 1ONLA 1PH4A 3OW7A 4B3TQ 1OXXK 3GTMB 3CMEA 2YU9B 4YCVA 1SNOA 1PYBA 3DEOA 4H02A 3X3MA 2CH4W 4A93B 4RWSC 4MTKA 1FVIA 1JE4A 2RCNA 5GAGC 2EJFC 3RD4A 1IYVA 1L1OA 2Z1CA 5HY6A 1SNDA 1XX8A 1BF4A 3NBHB 2Y0SE 4RGOS 2K5QA 3URYA 2MHVA 2BH8A 1WTQA 3I3CA 5J1ZA 1I50H 1QCBD 1O78A 4EQNA 2IX0A 3OWEB 4N9TA 1AE2A 3L0OA 2F52A 4QIWE 2NVYB 4A3MH 1NCVA 3KF8B 1RTOA 3J7YW 1YZ6A 3GTLB 2WB1G 4KTAA 4FF2A 1E1TA 4GKJL 1GUWA 4C3IG 3J80c 2O2LD 1MJEA 3KLWA 2KQ3A 3T13A 4ALPA 4BY7B 2H4OA 4L63B 5A2QL 4MIUA 5E1FA 5C4HA 1MHWC 4PMWA 5C3WA 3NE5B 3FVQA 4DV0L 1H9SA 3V2TA 1L1OC 3NTKA 3GTGH 4M8AA 1PTOH 4GN4B 1IBKL 3SEBA 2R92G 2R93B 1CHQD 1X3FA 3HOXH 5I2XA 1STHA 5M5WH 1NAPA 1CKOA 4RKBA 1PFBA 1KDBA 1MSGA 2AMCB 4PG3A 4A3BH 1TWAB 4GKJQ 3BZDB 5M3MH 1X3GA 3S14B 2WKDA 2MGSA 1UWVA 4IUVA 1BBXC 4HIMA 1B4OA 1GXDC 1KXLA 3NSWA 2B2TA 3M4QA 3HOUB 4HJ5A 2PQAB 4DV0Q 1EY7A 3MA2B 2PNRC 5IP9H 4IPHA 2Z9HA 1ILQA 1IBKQ 2NVTH 3TZDA 3QG1A 3A56A 5DAUA 2OXPA 3D0FA 2EIFA 4A3GH 3H3VI 4RGMA 1DGSA 1FJGL 2UXCL 1XTDA 3ND9A 3DM1A 1ET6A 2AWNA 4X64Q 3CCLA 4LF6L 1II3A 2F0LA 4A93G 1TVXA 3LWEA 1GD7A 4PZ7A 1XNRL 3CMAA 3MXUA 4KN7C 3G4SA 3D8GA 4A4IA 2OEOA 2CWAA 1SYDA 3EA6A 5CBEE 2N55A 3A0JA 1EQRA 2A6HC 1IW7D 3SK8A 3HOYH 3DXJC 3PSIA 2B29A 3RZOB 4IN3A 1HA6A 1EYCA 1FJGQ 4JCVE 1UAPA 1V1QA 4JI0L 5K36G 3EN2A 2L11A 4LF6Q 1SROA 1HZCA 2Q8TA 1QNKA 3H3VC 2NYZD 5J22A 1XNRQ 4RFBA 4BXXG 1SR3A 3IFTA 1MGSA 1V1PA 1NMGA 3S2HB 2FMMA 4BY7G 4JYAQ 4AYBE 2M9VA 1TS3A 3UDIA 2VXWA 4RHRA 4MZ9A 3NQIA 4G57A 2XSCA 1KAAA 2NTSA 3E3XA 3K57A 2EOTA 4JOIC 1NE3A 4LWCA 1Y69U 3VA5A 1SAPA 3I72A 1WTVA 2PPBC 2ICEC 3VYSA 2I5HA 4JI0Q 2D62A 3DUZA 3UDFA 2NTTA 2K75A 5BN5A 4A76A 4HCSA 1AH9A 3EBEA 4FVMA 3CC2A 1CT1D 4PZ8A 3QJYA 4DV4Q 3QO2A 4ZUIA 1EOTA 2PMZB 2K04A 4OO1I 5EKIA 3HOUG 4A3DB 4PZ6A 1YJ9A 4LMQD 4APVA 4ULLA 1EWCA 2CHBD 1WI5A 3PO3B 4J15A 2F0KA 1DXMA 4QQBX 3GTJB 4HMIA 4X6AH 5KEEA 4QCLA 3QOJA 3OIQA 4Y7NB 3NK9A 4BY1H 4EQ5A 1LLRD 1MBYA 1Z7TA 2FFKB 3T1HQ 3GTOH 1Q1BA 3F1ZA 1PDQA 1OTCA 3W3AA 1BQQT 2XN9C 1RL2A 3R3OA 4IJHA 1NR4A 1X55A 4LUOA 4V190 3GTKB 1F2MA 2B8FA 3WOEA 5GROA 1F9QA 1S5ED 2NZHA 1GVPA 3QOLA 1QVFA 5IYBG 1CZGA 1U9RA 3T4AC 5KNCA 4O2DA 4BBSB 3HZXA 1TIID 2WAQB 1CSPA 2QGQA 1VQHA 2F0EA 3CC7A 3L7ZC 1KDAA 1D7QA 5JVH3 1NJIC 5FJ8G 4Q5VA 3EVQA 5COYA 5KYIA 3H0GB 4L8JA 5IGFA 1G51A 2Z6BA 1XXGA 1JORA 3TP7A 4YWMA 1KDCA 1X9NA 2VQFL 4X3KA 4LUVA 1I4GA 3SK6A 5FO8B 4DK3C 2VW9A 4DV5Q 4G4KA 4M1UB 5KNDA 4OHJA 1LYLA 4CDFC 1T5EA 4XTCS 1P8LA 4LFAL 3PIP3 1D5MC 1U4RA 2E75C 1DJRD 2A6EC 3S2DB 2EY1A 3K0XA 1UE7A 4KI0A 4XIGS 1F77A 3S1NB 3CCVA 2R6GA 4P74A 3C2PA 1QG7A 3TP5A 1E2VA 1PH7A 2RDFA 5AJ3Q 4DR6L 1C9OA 1WTRA 3M3YH 2AKWB 3TMEA 1V8QA 1VQJA 2VQFQ 4A75A 5K5PA 4C3IH 4EX5A 4DKAC 3TREA 3K6OA 3TBIB 1WJJA 1I4HA 3RZDB 4GNXC 4LFAQ 1LT6D 2C35B 4KY5A 1WTXA 5IT9L 1F2ZA 2OQ0A 2CVRA 4LUZA 4POGA 3PO3G 4HJAA 1D5ZC 2ZXPA 4FYDA 3CQZB 2KUMA 4FO2A 5CMDA 4DR5L 1TWGH 4DK1A 2R92H 1EQTA 1EWHA 2NUCA 2ATWA 1S5DD 5CORA 3RN5A 1SFOB 2Q8RE 2Q8IB 5DNFA 4RCNA 4DR6Q 2KENA 2QKIC 1RCVD 2K7VA 1SRUA 3J80i 1PTOC 1L0XB 4EVOA 4DR3L 4DK6C 5JOBA 5HURA 2E2JH 1O7LA 1BCPC 1VMCA 4GKKL 3S24A 2I5LX 1CZWA 1QZGA 1QJOA 3S1QB 3BVMA 1D8LA 1SYFA 1X54A 3FDTA 4BBSG 3Q23A 3TEHB 3CCMA 3SXHA 2F03A 2JEBI 2WAQG 4KKTA 5C0XG 3VR5A 1ENFA 4CBVA 5HGQA 4GOPA 3TP8A 3MWYW 5FKAC 3I2ZA 1CA5A 4L5QA 1D5XC 2KHJA 1Y14B 3E9IA 3G6EA 3GTMH 1VQ8A 2YU9H 3H0GG 3JC66 3S15B 4C56C 2A74C 2YTYA 3J7ZC 4A93H 3BU2A 1LTTD 1MIUA 4KN4C 2CW0C 2B2YA 4DFAA 1BBWA 4GKKQ 2CH4A 5ELNA 3KLRA 1I3QB 4FXKC 3K5NA 1X32A 1AZPA 2MPMA 3OMCA 4BA1I 4QUCA 1E0BA 1N33L 1SYGA 4X62L 2BE5C 3P75A 3QIAA 2L12A 5K36H 1TT2A 3GD7A 1M1KC 1A62A 3KF6B 2NVYH 2Z8LA 4GOPC 2K5WA 4C3HB 3PUXA 3R2IA 3P1HA 4B9WA 2VUMB 4BXXH 1LTAD 2B2WC 4XYQA 3TZUA 4BY7H 1I4XA 4DR4L 2X6LA 2E2HH 2PCFB 1HXYD 5EBCA 1M8AA 2GVBA 3S1MH 4KKSA 2B2YC 1G8ZD 3H15A 1CTMA 1I5FA 1JJCB 4RMFA 3X3NA 4HEDA 4HJ7A 5IT9E 2Z0SA 4IUTA 2LY7A 2EYLA 5IOCA 1C8CA 1E3PA 3SVMA 5IP7G 2OCEA 3MAQA 3I4OA 1VQ4A 1YNXA 3HOYG 2HT1A 1T5XD 4BS9A 4DR4Q 1YNND 4J1MA 1BR9A 4P75A 3HKZB 4ZKCB 3HOUH 1K8MA 1R4PB 1R9TB 4CKEA 4JI5L 1HR0W 2AUJD 1B3AA 4CDDC 5JJKA 5T1IA 2IHEA 2UUBL 1SEBD 4CHTB 3HOVB 1AP0A 1E22A 2J7ZA 2E2DC 1A0IA 5DM63 3HOZB 1H9RA 4MHEA 2BA1A 3V96A 2EY5A 2I07B 3RLOA 4ZUJA 2WACA 3HKSA 1RIPA 2BA0A 3S16B 2I0QA 3MXNB 2L4NA 1DOLA 3H6MA 3IRBA 1YBYA 2FJ2A 2F0VA 4FP5D 5IYBH 1IBLL 5JJIA 4K6DA 5BR8L 4JI5Q 4X3SA 1IYUA 4A3FB 4EQPA 4A3KG 1PFSA 3IAYA 4GLVB 5FJ8H 2RSNA 2WB1E 3G71A 1YEZA 4GZYC 1DONA 4YCUA 3Q22A 3K5MA 1UE5A 3V05A 4C3HG 3I4NB 3GTPB 1DM0B 4IOCA 1YIJA 1VQKA 2EY6A 1HFGA 4LJZC 3K59A 2VUMG 5CV9A 1N32L 4NXML 3S2HH 2EYOA 4LF4Q 4B3SL 1CI3M 1RKNA 2EXZA 1A8VA 2EE1A 5FK9C 1IBLQ 2B39A 3C1FA 4OXPA 5ELFA 4JPBW 1LTBD 2WINB 3DM3A 4BWGB 4DNRB 4NPSA 3JAMc 4F87A 3U4ZA 4KV6A 3K7AB 3DEPA 2JQOA 1B50A 5CV5A 3PUZA 2A68D 5AFWA 3I73A 1PYWD 3U58A 1CKNB 2PZUA 2UUCQ 2IL8A 3J80L 1EFID 4R4QA 2AWOA 4DGZA 5A35A 5JJZA 1HUNA 2QDBA 5JVG3 3A8JE 1LACA 2XNAC 5D3IB 1N32Q 4NXMQ 2E2IB 1JICA 5E7NA 3EFXD 1Q86C 3AFQA 1N36L 3I4MG 4B3SQ 1PFNA 3NEMA 1SNCA 4DA2A 1STBA 1I4PA 1B2TA 4PNYA 1M90C 1KRTA 2O4XA 1BVSA 3R8BA 2N78A 3T53B 2F0GA 2FMCA 3N6RA 2SDFA 1VQFA 5JEAG 4A3EB 4OELB 1Y8PB 3PO3H 4JI1L 2GN5A 3VDYA 3HOVG 3Q24A 2NZOA 3FEWX 4A3IB 2LXKA 4OIKA 3HOZG 5GAEC
chains in the Genus database with same CATH topology
1B44D 3BDCA 4JK1C 4TKOB 1OO9B 2RQXA 3EJIA 1STEA 2N88A 4IUNA 3PO2B 1EY4A 1LO5D 5M5YB 4K8IA 1GOZA 2EVBA 3OOCA 5C4XB 1XYIA 1RTNA 2RKSA 4XT3B 3VR3A 1IL8A 5C0XH 2XVSA 4H7BA 3NTIA 1E2WA 1EY0A 1I6HB 1KABA 5KIXA 1IKLA 1STAA 1H9SB 3KF8A 1SDFA 1KNEA 5C44B 4CKBA 4EQOA 5EGTA 1A6XA 2HCIA 1K83B 2F0SA 2MP1A 1QOHA 4C3JB 5CYUA 4G7ZC 4NW2A 1Y8OB 4F8MA 1RD9D 3SK4A 1JOQA 3A7LA 3M4YA 3S9WA 1ENAA 3D4DA 4XQQA 2K03A 1EY8A 3T16A 4CJ0B 4CJ2C 3J80E 2F0MA 2QCPX 2F0WA 3DHQA 3L9AX 5EPLA 3PUYA 3VR4A 4R8IA 3A7AB 1TY2A 1VMPA 1F2LA 3TSSA 1ENCA 2KHSA 3T56B 3NUCA 4NDXA 1CQFA 1DD2A 5E3FA 5I6YA 5JPNC 1V43A 1IW7C 4K5VA 1XWEA 2DNEA 1WVLA 3FPUB 1F9RA 2B2UC 1TWFB 4R9WA 4HN7A 1YNJD 1QWYA 1V1PB 4DK0A 1VF7A 2KOLA 2EYPA 4CGYB 1YNJC 5IGCA 2R61A 2F0HA 1DYQA 4XDXA 5M5XB 3VR6A 3M7NA 3BYTB 4KY6A 5ELCA 1OXVA 3L3OC 1Y1VB 1EY9A 1D6EC 3S17B 4NP5A 1LT3D 1SMYD 2D5DA 2F0QA 4BBRB 3W2DA 4WRDA 2NBFA 3D4RA 1U4LA 3FMCA 4Z9CB 1DOMA 3C3LA 3S1RB 1EY6A 3I8ZA 2F0UA 5LL6X 1HRJA 4G7HC 1JCKB 4DXFA 2JA5B 3SR1A 3P20A 4U68A 2PQEA 2NVQB 1ICWA 2L5TA 1STNA 2V4DA 2B2VA 2I46A 1TS2A 4K5XA 5G3LD 4KK7A 3WDNA 4FXDA 1H9KA 1PRTB 5DEHA 1ILPA 4ABNA 2RVLA 2EDGA 2KJXA 3EROA 4PV1C 5JEAH 2PZTA 5KYLA 5IGDA 4ZLTF 4QF4A 3HOWB 5C0XI 4ZKBB 3NWSA 1TWCB 1AN8A 1GUTA 3HRZC 2B2VC 1HUMA 4DAYA 2K32A 2E74C 1G291 2WKCA 2VNUD 4RCOA 5CV4A 4FF3A 3MXGA 3NPPA 3OHXC 1FYCA 1EEID 2G9DA 3PMFA 1JOKA 1PTOB 5T1GA 1Y1WB 2XIWA 3AMUA 1CHPD 3UI2A 5DM73 1WD0A 4ZRZA 1U4PA 3MTSA 5G3LF 5M5WB 2J4XA 2KA7A 5EPJA 3FPPA 2LS01 4OGQC 4C1NK 4K2LA 3Q6SA 1LTRD 3BDLA 4OO1G 2NN6G 2K6AA 4UDUC 5M3MB 3TP6A 4XQJA 3OWFA 4PMCA 1GUOA 1ZKOA 1KTKA 1KLUD 2R7ZB 5C5LA 4HR7B 4KJNA 2JYOA 1MI2A 4A3GB 2JEAI 5KGUA 1RHPA 2A5HA 3HP3A 4F88A 2EJMA 3DWQA 1M4VA 4DN4M 3D6WA 4K5WA 3DMUA 1A2TA 1GJXA 2PW5A 1SSOA 5D65A 2SNSA 1FNUA 5E4WC 3A8KE 1Q12A 5CR3A 5I6WA 2LMCB 1PRTF 1QB5D 2B2WA 1U4MA 1A3VA 1UNSA 1R4QB 3IL8A 4NKLA 3U9OA 2JA7B 1TWHB 3NQTA 2F3VA 3DWAA 4RGNA 2Z4IA 2A69D 3H91A 1JQYD 4IURA 1EEFD 2FINB 2VB2X 1EYDA 2A69C 2L0CA 3I90A 3RUZA 3A55A 3BDOA 3HEJA 4G7OC 1S5BD 3NWTA 2IPKD 5FO7B 1PTOF 4ME5A 1JR0D 1RDPD 2K33A 1PZID 1F9PA 5FOBB 3VR2A 2DY8A 3DWPA 1EZ6A 2EYFA 1EU4A 1BOSA 1ZYRD 5C0XJ 2JA6B 3M4OB 2B8GA 4CKCA 1ZYRC 4MN3A 4JBWA 1WCMB 2F0FA 3CRKC 2ENBA 3C1EA 1H9MA 4BY1B 5NUCA 1STYA 2BOSA 2WV6D 2ID0A 4IUQA 2IT1A 3R93A 2R3ZA 2IWHA 5I9PA 1AEXA 3G6JB 1YNNC 1S5FD 4WFN3 4NMZA 2EZVA 1I6VC 2L1BA 2TSSA 3JAML 4YIJA 1C4QA 1HQRD 3N52A 1LT4D 1MD2D 4IFDG 3LNNA 1EIHA 5C4JB 4FF4A 3NHHA 3J7AV 3VYUA 1EYAA 1B1ZA 1TKWB 5CBAE 3F2UA 3FKIB 4ZK9B 1O7YA 4Q0FA 2YYZA 4OIJA 3HG9A 1GHKA 4O42A 3HS0C 2ZXOA 1OXUA 2RA4A 2PYKA 3K58A 3K0YA 5TSSA 3ERQA 1VDZA 3SK5A 4A3JB 2KVMA 4ID6A 1ZEQX 2OF1A 3PUWA 2EYJA 4WJWA 3I91A 3IFDA 4EGVA 3MC0B 1W6KA 2R92B 2A68C 2NZ1D 3BG3A 5FLXL 5IIFA 4P2CB 1EL0A 4J8QA 5FO9B 2F4IA 1G2TA 3FRPB 4IQZA 2RBMA 1B53A 1TY0A 4OO1H 2NN6H 4IUUA 1TR5A 2E2JB 1OXTA 5JPMC 4UAIA 1GUGA 4HSPA 4K6LA 3D3RA 2SEBD 3GO5A 3NTHA 3JAME 1QNUA 4I7ZC 2A73B 3A54A 2F3WA 5CV7A 4KKUA 4ILWA 1Q3LA 1DOKA 3AB9A 2Y0SB 4IUPA 3NBHA 1AFPA 5CGKA 2O5IC 5LHY1 1CFMA 4QIWB 2SOBA 2JA8B 2B63B 2SNMA 1LTID 1V1OA 4LAAA 3H09A 4KY7A 4FXGC 5IGEA 4XT1B 1EQVA 1G91A 2AQ2B 5EQ0A 2E2HB 5CC4A 5JEAJ 4XYOA 3VYRA 3S1MB 2HUGA 1PFMA 1EU3A 3ITPA 1F9SA 2CQAA 3R2TA 1EIGA 2KECA 5BN4A 5F2DA 1SNMA 3EQLC 1PZKD 5FLXE 3PIO3 2B2UA 1S5CD 3GTQB 4N9PA 3H94A 2NWGA 4HMJA 1B9NA 3NP8A 5ELBA 2TMPA 2VB3X 5I4DA 3D4WA 1FNVA 1O7ZA 3OPOA 5C3EB 1Y8NB 3ONAB 4XXEA 3GV3A 3O13A 1X3QA 4WORA 1ML0D 4RGTA 3M7GA 2NVXB 2MJ8A 3HGBA 1LV9A 4RHSA 2KEDA 1SJHD 5M3FB 1I4RA 3BYYB 5C3XA 4RAUC 2A6HD 4I65A 1SE4A 4S3SA 1TS4A 2MUYA 5C4ZA 2NB0A 1D2BA 2GA4B 2B2TC 1EZ8A 1NSNS 4KMUC 4IFDH 1A3TA 1AZQA 1G6ZA 4ODGA 2EYMA 4AYBB 1GHJA 3NXWA 1C48A 3LWUA 4B9XA 1SNPA 4C3JG 1D1IA 4RA8A 3GV6A 5KRUA 4DF7A 4DNTB 2DN8A 1E2ZA 5A2QE 1HFNA 3MFYA 5EJWA 2F0IA 1MSHA 2KCNA 1H9JA 4CJ1B 2AQ1B 1SMYC 1Z6HA 5CV6A 3C46A 1HA5A 3KBGA 1TQOA 2ZXRA 2EPBA 2NN6I 1SYBA 1JWMD 2XWJB 3K5OA 2K28A 1STGA 2FHTA 1S4ZA 1SNQA 1FD7D 5BN3A 3G7LA 1WTOA 5ISRA 3QB3A 5ELDA 2OT2A 1OXSC 3BS1A 5D3DA 3E6ZX 3SDZA 1JWSD 1SYCA 2DNCA 1I50B 2DY7A 5J39A 3GP7A 3MHBA 1WD1A 1ESRA 1QILA 2IJ0A 4H0LC 3MFGA 4A3MB 2XWBB 4FNFA 2AUKA 2RSOA 5IGGA 2BDNA 2EY2A 1ET9A 3K5LA 4V0BA 4C1NI 1TS5A 4K2KA 2E76C 1DZ1A 2WIIB 3LX0A 3QWNA 4PMBA 2K1BA 1FGBD 3TDQA 1NR2A 3GTGB 2O5JC 1CK1A 4BA2I 1BXTA 4HAEA 2A6ED 1UUPA 3E0JA 3HOXB 3CRLC 1BCPB 2K5DA 3ZYYX 3WOFA 4DAVA 3E5SA 5LL6S 1PRTD 4RH6A 2F0OA 5C6AA 5I2YA 1Q90A 1SYEA 4A3BB 2JE6I 3TN2A 1KNAA 1PRTC 1HQMC 2C9OA 1EY5A 2M00A 2X6GA 3T51B 2IX3A 3BVGA 1B9MA 1HPCA 4ZYSA 3CHBD 2K01A 4OL7A 5I9OA 3VA7A 2NVTB 4KHVA 1CA6A 2AQ3B 4KD3A 2PZWA 3RMHA 1HCZA 2ZT9C 1A15A 2L9HA 2D2CC 5EKLA 2QILA 3MXPA 2M2LA 3MEHA 3GQBA 5M9OA 2Z4HA 1PMRA 4B08A 1PTOD 3OIPA 1LTGD 4TSSA 2D9UA 4X3UA 2K05A 2H1EA 1BCPD 3SHLA 1RJTA 3KLSA 2F0JA 2RDHA 4FF1A 2F0TA 4TQUS 4DAPA 3HOYB 3AU7A 1JWUD 3U9SA 4QB4A 1LABA 2LKVA 2JXMB 1PLFA 4HTHA 1HHVA 1GUNA 1UEAB 1L0YB 1A3UA 4F7XA 4TRDA 3I70A 1A2UA 5EPKA 4R8NA 2CW0D 3M85A 2F0DA 2F0NA 1BUVT 1RF2D 2EYHA 4IFDI 1CQVA 3J81L 1Q8IA 4C2MB 3KLSX 4U673 4DXGA 1W6JA 2X69A 4PQXA 1RODA 3J7AF 2BE5D 4RKLA 1K8OA 2JSOA 1CM9A 4O1NA 2F0PA 3PUVA 4A3KB 1BCPF 2HQEA 1FNWA 4IALA 3D31A 3RLFA 2PO4A 2IX1A 2J0TD 1WTPA 5CV8A 1X3PA 1SJED 2QF7A 1Z47A 4J6HA 4XQNA 3Q0AA 3MVVA 3CU7A 3GTOB 1HTPA 4LK1C 2BDOA 3A8IE 2XRQD 1BDOA 2JP1A 1J8IA 4IZ8A 1JC7A 4K8JA 2L55A 2XRSD 1GUSA 1J9OA 3I4LA 1WTWA 3P7JA 3I4MB 4KHZA 5HGTA 2HDLA 2HDMA 1JOOA 3PV0A 4HCEA 1VCIA 3D6CA 1AW7A 1DCZA 1ESFA 1I4QA 3KUPA 1G2SA 1FR3A 2PW7A 1JB3A 1IHZA 2C5CA 2G9HD 3IKJA 4QUFA 4DU9A 2RDGA 2BCOA 2F1MA 1VF5C 3MXNA 2KCCA 2LFNA 2IW3A 1XTCD 3SE0A 5C5MA 4K14A 1NUCA 3J81E 4H44C 3M3YB 3KBXA 5KNBA 5D14A 3NBIA 1F2YA 1PXUA 2WB1B 1IKMA 4KD4A 4C3IB 3OMGA 4HSVA 1LTSD 3CKIB 4ZQ3A 1BNZA 1QE6A 4L6TB 2EJGC 1SBBB 1TWGB 5JAVA 1HTLD 1LT5D 4IFDJ 4X3TA 1SXTA 1SE3A 4KJOA 5EKKA 3VYTA 4ZAIA 2HCCA 5IGBA 3KK7A 4H13C 3OSOA 1ZXTA 1TU2B 5E4XA 1KLGD 3ND8A 2ICIA 5IODA 1D1KA 5ELEA 1PZJD 1O80A 1SE2A 2KEEA 3BVZA 2QEJC 1BO0A 3MZ5A 4E6IA 4QMGA 1Q1EA 2WP8J 5EBDA 1ONLA 3OW7A 1OXXK 3GTMB 2YU9B 1SNOA 3X3MA 3DEOA 4A93B 4RWSC 1JE4A 2EJFC 3RD4A 1IYVA 2Z1CA 1SNDA 1XX8A 1BF4A 4RGOS 2K5QA 3URYA 2MHVA 1WTQA 3I3CA 5J1ZA 1QCBD 1O78A 4EQNA 2IX0A 3OWEB 4N9TA 2NVYB 1NCVA 1RTOA 3J7YW 3GTLB 4KTAA 4FF2A 1GUWA 4C3IG 2O2LD 2KQ3A 3T13A 4BY7B 2H4OA 4L63B 5A2QL 4MIUA 5E1FA 5C4HA 4PMWA 5C3WA 3NE5B 3FVQA 1H9SA 3V2TA 3NTKA 4M8AA 1PTOH 3SEBA 2R93B 1CHQD 5I2XA 1STHA 1NAPA 4RKBA 1PFBA 1KDBA 1MSGA 1TWAB 3BZDB 3S14B 2WKDA 2MGSA 4IUVA 1BBXC 1B4OA 1GXDC 3NSWA 2B2TA 3HOUB 1EY7A 3MA2B 2PNRC 1ILQA 3TZDA 3QG1A 3A56A 5DAUA 2OXPA 4RGMA 3ND9A 3DM1A 1ET6A 2AWNA 1II3A 2F0LA 1TVXA 3LWEA 3MXUA 4KN7C 3D8GA 2OEOA 1SYDA 3EA6A 5CBEE 2N55A 2A6HC 1IW7D 3SK8A 3DXJC 3RZOB 4IN3A 1HA6A 1EYCA 1UAPA 5K36G 2L11A 2Q8TA 1QNKA 3H3VC 2NYZD 5J22A 4RFBA 3IFTA 1MGSA 1V1PA 3S2HB 2FMMA 2M9VA 1TS3A 2VXWA 4RHRA 3NQIA 4G57A 2XSCA 1KAAA 2NTSA 3K57A 2EOTA 1Y69U 3VA5A 1SAPA 3I72A 1WTVA 2PPBC 2ICEC 3VYSA 2D62A 3DUZA 2NTTA 5BN5A 4HCSA 4FVMA 1CT1D 3QJYA 3QO2A 4ZUIA 1EOTA 2PMZB 2K04A 4OO1I 5EKIA 4A3DB 4LMQD 4ULLA 1EWCA 2CHBD 3PO3B 2F0KA 1DXMA 3GTJB 4HMIA 5KEEA 4QCLA 3QOJA 3OIQA 4Y7NB 3NK9A 1LLRD 1MBYA 1Z7TA 2FFKB 1Q1BA 1PDQA 3W3AA 1BQQT 2XN9C 3R3OA 1NR4A 4V190 3GTKB 1F2MA 2B8FA 3WOEA 1F9QA 1S5ED 3QOLA 1CZGA 1U9RA 3T4AC 5KNCA 4BBSB 3HZXA 1TIID 2WAQB 2F0EA 3L7ZC 1KDAA 5JVH3 4Q5VA 3EVQA 5COYA 5KYIA 3H0GB 4L8JA 5IGFA 1XXGA 1JORA 3TP7A 1KDCA 4X3KA 3SK6A 1I4GA 5FO8B 4G4KA 4M1UB 5KNDA 4OHJA 1T5EA 4XTCS 3PIP3 1D5MC 1U4RA 2E75C 1DJRD 2A6EC 3S2DB 2EY1A 4KI0A 4XIGS 1F77A 3S1NB 2R6GA 3C2PA 1QG7A 3TP5A 1E2VA 2RDFA 1WTRA 3TMEA 1V8QA 5K5PA 3K6OA 3TBIB 1I4HA 3RZDB 1LT6D 4KY5A 1WTXA 5IT9L 1F2ZA 2CVRA 1D5ZC 2ZXPA 4FYDA 3CQZB 2KUMA 4FO2A 5CMDA 4DK1A 1EQTA 1EWHA 2NUCA 1S5DD 5CORA 1SFOB 2Q8RE 2Q8IB 5DNFA 4RCNA 2QKIC 1RCVD 2K7VA 1PTOC 1L0XB 4EVOA 5JOBA 5HURA 1O7LA 1BCPC 1VMCA 1CZWA 1QJOA 3S1QB 3BVMA 1SYFA 3FDTA 3Q23A 3SXHA 2F03A 2JEBI 4KKTA 5C0XG 3VR5A 1ENFA 4CBVA 3TP8A 3MWYW 5FKAC 1CA5A 1D5XC 3S15B 4C56C 2A74C 1LTTD 4KN4C 2CW0C 2B2YA 4DFAA 3KLRA 1I3QB 4FXKC 3K5NA 1X32A 1AZPA 2MPMA 3OMCA 4BA1I 4QUCA 1E0BA 1SYGA 2BE5C 3P75A 3QIAA 2L12A 5K36H 1TT2A 3GD7A 2Z8LA 2K5WA 4C3HB 3PUXA 3R2IA 3P1HA 4B9WA 2VUMB 1LTAD 2B2WC 4XYQA 3TZUA 1I4XA 2X6LA 2PCFB 1HXYD 5EBCA 1M8AA 4KKSA 2B2YC 1G8ZD 1CTMA 3X3NA 4HEDA 5IT9E 4IUTA 2LY7A 2EYLA 5IOCA 1C8CA 3SVMA 3MAQA 1T5XD 4BS9A 1YNND 4J1MA 1BR9A 3HKZB 4ZKCB 1K8MA 1R4PB 1R9TB 4CKEA 2AUJD 1B3AA 5T1IA 1SEBD 4CHTB 3HOVB 1AP0A 2J7ZA 2E2DC 5DM63 3HOZB 1H9RA 4MHEA 2BA1A 3V96A 2EY5A 2I07B 4ZUJA 2WACA 3S16B 2BA0A 2L4NA 1DOLA 3H6MA 2FJ2A 2F0VA 4FP5D 4K6DA 4X3SA 1IYUA 4A3FB 4EQPA 3IAYA 2RSNA 4GZYC 1DONA 3Q22A 3K5MA 3V05A 4C3HG 3I4NB 3GTPB 1DM0B 2EY6A 1HFGA 4LJZC 3K59A 5CV9A 2EYOA 1CI3M 1RKNA 2EXZA 2EE1A 5FK9C 2B39A 3C1FA 5ELFA 1LTBD 2WINB 4BWGB 4DNRB 4F87A 4KV6A 3K7AB 3DEPA 1B50A 5CV5A 3PUZA 2A68D 5AFWA 3I73A 1PYWD 2PZUA 2IL8A 3J80L 1EFID 2AWOA 4DGZA 5A35A 5JJZA 1HUNA 2QDBA 5JVG3 3A8JE 1LACA 2XNAC 5D3IB 2E2IB 1JICA 3EFXD 1PFNA 1SNCA 4DA2A 1STBA 1I4PA 1B2TA 4PNYA 3R8BA 2O4XA 3T53B 2F0GA 2FMCA 3N6RA 2SDFA 5JEAG 4A3EB 1Y8PB 3Q24A 3FEWX 4A3IB 4OIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TN2 A;  1KNA A;  1RTO A;  1VMP A;  1IKM A;  1EL0 A;  4MHE A;  1F2L A;  2NYZ D;  1GUW A;  2X6G A;  4DN4 M;  1MGS A;  4HSV A;  1G2T A;  4IUQ A;  3D6W A;  2N88 A;  2FMM A;  2L4N A;  1B53 A;  1DOL A;  2B2Y A;  3R93 A;  1BNZ A;  4X3K A;  2R3Z A;  1QE6 A;  1SSO A;  4IUU A;  5D65 A;  2B2U A;  2EPB A;  2FJ2 A;  2K01 A;  2VXW A;  5E4W C;  1WTP A;  2NWG A;  1ILP A;  1X32 A;  1AZP A;  1X3P A;  2EOT A;  2MPM A;  1U4R A;  2RVL A;  1XYI A;  1RTN A;  1CA6 A;  1SAP A;  2L1B A;  4X3S A;  4QUC A;  1WTV A;  4XT3 B;  1E0B A;  4UAI A;  1IL8 A;  3N52 A;  1O7Z A;  2B2W A;  2K28 A;  1A15 A;  2L9H A;  1WVL A;  1U4M A;  2FHT A;  1S4Z A;  3FPU B;  4X3T A;  1NAP A;  3ONA B;  2L12 A;  4ZLT F;  1QG7 A;  1F9R A;  1PFB A;  2B2U C;  2M2L A;  3IL8 A;  4R9W A;  2RSN A;  4HCS A;  3GV3 A;  1MSG A;  4ZAI A;  2HCC A;  1DON A;  4ZKB B;  2JP1 A;  1X3Q A;  1WTR A;  2Q8T A;  1EIH A;  3G7L A;  1IKL A;  1J8I A;  1ML0 D;  1WTO A;  1ZXT A;  2KOL A;  2MJ8 A;  5E4X A;  2D9U A;  2MGS A;  1Q3L A;  3QO2 A;  1LV9 A;  1HFG A;  1EOT A;  2B2V C;  2K05 A;  1B4O A;  1J9O A;  1HUM A;  2H1E A;  1RJT A;  2B2W C;  2K04 A;  3H91 A;  2B2T A;  1WTW A;  1SDF A;  1DOK A;  2KED A;  3P7J A;  1KNE A;  2X6L A;  4XDX A;  5EKI A;  5CBA E;  4IUR A;  2EE1 A;  3F2U A;  4IUP A;  4ZK9 B;  1O7Y A;  4LMQ D;  2DY7 A;  1BBX C;  1O80 A;  2FIN B;  2KEE A;  4RAU C;  1WTX A;  1M8A A;  1BO0 A;  3I90 A;  1ILQ A;  4OIJ A;  2B2Y C;  2CVR A;  1WD1 A;  1ESR A;  2HDL A;  4O42 A;  3TZD A;  5T1G A;  2HCI A;  1PLF A;  2KUM A;  2HDM A;  2XIW A;  5CMD A;  2MP1 A;  1HHV A;  1EQT A;  3DEP A;  3KUP A;  3UI2 A;  1B50 A;  4HED A;  5AFW A;  1G2S A;  2RA4 A;  1WD0 A;  1U4P A;  3MTS A;  3DM1 A;  2FFK B;  5COR A;  2B2T C;  3DEO A;  4IUT A;  4NW2 A;  2Q8R E;  1PDQ A;  2RSO A;  5EPJ A;  5DNF A;  4RWS C;  4QUF A;  1TVX A;  2BDN A;  3LWE A;  1C8C A;  1NR4 A;  1JE4 A;  2IL8 A;  3SVM A;  1AZQ A;  1G6Z A;  3Q6S A;  1F9P A;  5EPK A;  1F9Q A;  2DY8 A;  2K03 A;  5JJZ A;  1HUN A;  1U4L A;  2KVM A;  1XX8 A;  1DZ1 A;  1JIC A;  1DOM A;  4XT1 B;  2K1B A;  1BF4 A;  1PFN A;  1VMC A;  5CBE E;  3I8Z A;  1NR2 A;  1G91 A;  4CJ0 B;  2N55 A;  4CJ2 C;  4HAE A;  5EQ0 A;  4ZKC B;  1B2T A;  1HRJ A;  3FDT A;  1WTQ A;  5EPL A;  2SDF A;  3I3C A;  4RA8 A;  2X69 A;  3I91 A;  4X3U A;  3IFD A;  3GV6 A;  4MN3 A;  1B3A A;  5T1I A;  4U68 A;  1HA6 A;  2JYO A;  1ROD A;  1MI2 A;  3MWY W;  1ICW A;  2HUG A;  2L11 A;  1AP0 A;  4R8I A;  1HFN A;  1PFM A;  2J7Z A;  5COY A;  1CA5 A;  1RHP A;  5EJW A;  2NZ1 D;  1CM9 A;  1F9S A;  1MSH A;  1NCV A;  2B2V A;  4OIK A;  4CJ1 B;  3HP3 A;  1EIG A;  3KBX A;  2KEC A;  5D14 A;  4IUV A;  1QNK A; 
#chains in the Genus database with same CATH topology
 1L1O B;  1B44 D;  3BDC A;  4JK1 C;  4TKO B;  1OO9 B;  2RQX A;  3EJI A;  2IHF A;  4DUY Q;  1XPR A;  4DR1 Q;  1HNW L;  1QVG A;  2Z6K C;  1STE A;  2N88 A;  4IUN A;  3PO2 B;  1EY4 A;  3GTK H;  1LO5 D;  2CCZ A;  1N36 Q;  5M5Y B;  2CWP A;  1QVC A;  1YI2 A;  4K8I A;  1GOZ A;  2IY5 B;  3M9B A;  1YHB A;  3A5U A;  2EVB A;  3OOC A;  2F3I A;  5C4X B;  1ASZ A;  1XYI A;  1RTN A;  2P5Z X;  4BBS H;  2RKS A;  4OX9 L;  4JI1 Q;  4XT3 B;  3VR3 A;  1IL8 A;  4JBM A;  5C0X H;  4A3F G;  2XVS A;  4H7B A;  3NTI A;  1E2W A;  5FLX c;  4JW0 A;  1EY0 A;  4DAM A;  1I6H B;  1KAB A;  5KIX A;  3H0G H;  1PVO A;  1IKL A;  1HNW Q;  3CCQ A;  1STA A;  3ERS X;  1K0S A;  1H9S B;  3KF8 A;  3KJO A;  4DV7 L;  1SDF A;  4LF9 Q;  1KNE A;  3UE1 A;  5C44 B;  4CKB A;  1K8G A;  4TVA B;  5H1S E;  4EQO A;  2UXD Q;  5EGT A;  1A6X A;  4OX9 Q;  2HCI A;  1K83 B;  3PF4 A;  4X64 L;  2F0S A;  2MP1 A;  2QDL A;  1QOH A;  4C3J B;  2MO0 A;  2H5X A;  5CYU A;  1PH6 A;  1U0L A;  4G7Z C;  2ES2 A;  4NW2 A;  1Y8O B;  3S1N H;  4F8M A;  1RD9 D;  3SK4 A;  1JOQ A;  1S40 A;  3A7L A;  3M4Y A;  3S9W A;  1ENA A;  3D4D A;  4XQQ A;  2K03 A;  2MO1 A;  4DV7 Q;  1LM0 A;  1EY8 A;  4CDE C;  3T16 A;  4CJ0 B;  4CJ2 C;  3J80 E;  2F0M A;  2QCP X;  2F0W A;  3DHQ A;  3CCR A;  3RZD H;  3L9A X;  5EPL A;  1Q81 C;  4A3E G;  3PUY A;  3VR4 A;  4R8I A;  3SGI A;  4A3I G;  3A7A B;  1TY2 A;  1G6P A;  1VMP A;  2VY3 A;  4JOI A;  4RG1 A;  1F2L A;  3TSS A;  4GN5 A;  1SFO H;  1Q8K A;  4JYA L;  2HQL A;  3K7U C;  1ENC A;  3CD6 A;  5IP7 H;  4X66 Q;  3PO2 G;  2KHS A;  1HR0 L;  2Q2U A;  3T56 B;  3NUC A;  4NDX A;  1VQB A;  1CQF A;  1DD2 A;  5E3F A;  5I6Y A;  4YCW A;  3L2P A;  5C4X G;  5JPN C;  3KFU A;  1V43 A;  1IW7 C;  3F2D A;  4K5V A;  1XWE A;  5LMN W;  4L5T A;  2DNE A;  1WVL A;  3FPU B;  3LGJ A;  1F9R A;  2B2U C;  2G5D A;  1TWF B;  4R9W A;  4R1J A;  4HN7 A;  2QEX A;  1YNJ D;  1QWY A;  4DV4 L;  1V1P B;  3S15 H;  4FDB A;  4DK0 A;  1VF7 A;  2KOL A;  2EYP A;  4CGY B;  1K0R A;  1YNJ C;  1SN8 A;  1HR0 Q;  5IGC A;  4IPG A;  2R61 A;  2F0H A;  1DYQ A;  4XDX A;  5M5X B;  1B3Q A;  4C2M H;  2R93 G;  3VR6 A;  3M7N A;  1I3Q H;  3BYT B;  4KY6 A;  2YTV A;  3STB D;  4A3L G;  5ELC A;  3T1H L;  3PF5 A;  3BZK A;  1KIX A;  1OXV A;  3L3O C;  1Y1V B;  1O7I A;  4A3K H;  1EY9 A;  1D6E C;  3W1B A;  3S17 B;  4NP5 A;  1LT3 D;  1SMY D;  2D5D A;  2OTJ A;  2F0Q A;  5L37 A;  4BBR B;  1JT8 A;  4OWX B;  3W2D A;  4WRD A;  2NBF A;  2D0P A;  3D4R A;  1U4L A;  3FMC A;  1NBW A;  4Z9C B;  4C3H H;  1DOM A;  3C3L A;  3S1R B;  1EY6 A;  2VUM H;  3I8Z A;  2F0U A;  3GDE A;  4QY7 A;  5LL6 X;  4KLK A;  1HRJ A;  3CCS A;  1S3O A;  4G7H C;  2R7F A;  1JCK B;  4DXF A;  2JA5 B;  1VQP A;  1GO3 E;  1Z9F A;  3P20 A;  3SR1 A;  4U68 A;  2PQE A;  1ASY A;  1ICF B;  1ICW A;  2NVQ B;  2L5T A;  1STN A;  2V4D A;  5IE8 A;  2B2V A;  1P16 A;  2I46 A;  2OWO A;  2CKZ B;  1TS2 A;  4K5X A;  4L5S A;  4DV5 L;  5G3L D;  4KK7 A;  3I56 A;  2KCM A;  3WDN A;  1K8A C;  4FXD A;  1H9K A;  1PRT B;  4R4T A;  5DEH A;  3I4M H;  3U4V A;  3M4P A;  1ILP A;  1PV4 A;  4ABN A;  2WAQ E;  1HZ9 A;  3PGZ A;  2MNA A;  2RVL A;  4R4O A;  3JAM i;  2EDG A;  1R9T H;  2KJX A;  3ERO A;  4N8X 1;  4PV1 C;  5JEA H;  2PZT A;  5KYL A;  2V1C C;  5AJ3 L;  5IGD A;  4ZLT F;  4GNX A;  3HOV H;  1C7Y A;  2HHH L;  4QF4 A;  3HOW B;  5C0X I;  4ZKB B;  2K5N A;  2R7D A;  3HOZ H;  3NWS A;  1TWC B;  1AN8 A;  2KBN A;  3AQQ A;  1GUT A;  3HRZ C;  1KC8 C;  1PYS B;  4GLA C;  2B2V C;  1HUM A;  3S16 H;  4DAY A;  2K32 A;  1KQS A;  2E74 C;  1G29 1;  2RCF A;  2WKC A;  4QJF A;  2VNU D;  4RCO A;  1IYJ B;  5CV4 A;  4FF3 A;  3MXG A;  3NPP A;  3OHX C;  1FYC A;  1EEI D;  2G9D A;  3PMF A;  1JOK A;  1PTO B;  5T1G A;  1Y1W B;  2XIW A;  3AMU A;  3OW2 A;  1CHP D;  1YHA A;  1N34 L;  3UI2 A;  5DM7 3;  1WD0 A;  4ZRZ A;  3KDF A;  1U4P A;  3MTS A;  5G3L F;  3RN2 A;  5M5W B;  4A3F H;  1B8A A;  2HHH Q;  1Y1V G;  2J4X A;  2KA7 A;  5EPJ A;  2HIV A;  3FPP A;  2K5V A;  1B7Y B;  4BBR G;  2LS0 1;  4OGQ C;  2UU9 Q;  4C1N K;  4K2L A;  1IZ6 A;  3Q6S A;  1LTR D;  3BDL A;  4OO1 G;  2NN6 G;  2K6A A;  4UDU C;  5M3M B;  3TP6 A;  3K81 C;  4XQJ A;  3OWF A;  4HJ9 A;  4A3D G;  1NTG A;  4PMC A;  3I4N H;  1GUO A;  3GTP H;  1S72 A;  1ZKO A;  3CAM A;  1IBM L;  1KTK A;  2JA9 A;  4GN3 B;  1KLU D;  2R7Z B;  2PI2 E;  2ZJQ A;  5C5L A;  4HR7 B;  4KJN A;  2RHQ B;  1N34 Q;  2JYO A;  1MI2 A;  1CUK A;  4A3G B;  2JEA I;  3DLL A;  5KGU A;  1RHP A;  1VQI A;  1VQG A;  3K7A H;  2A5H A;  3HP3 A;  4F88 A;  2PI2 A;  2EJM A;  3DWQ A;  3TS2 A;  1M4V A;  2JJQ A;  4DN4 M;  3D6W A;  4K5W A;  3DMU A;  3J7A 5;  1A2T A;  2K52 A;  1PH5 A;  1GJX A;  2PW5 A;  1SSO A;  4WJ4 A;  5D65 A;  1B70 B;  5GQO A;  2SNS A;  1FNU A;  1PH9 A;  1NY4 A;  1IBM Q;  5E4W C;  3A8K E;  1Q12 A;  5IWA Q;  1PH1 A;  2E2I H;  5CR3 A;  2E8G A;  5I6W A;  2HD3 A;  2UUA L;  2LMC B;  4GOP B;  3A74 A;  1PRT F;  1QB5 D;  2B2W A;  4R4C A;  2ZTE A;  4A3E H;  1U4M A;  1TXY A;  1A3V A;  1UNS A;  1R4Q B;  1WYD A;  3IL8 A;  4NKL A;  4A3I H;  3HOW G;  3U9O A;  4YHH L;  1SMX A;  1W3S A;  2JA7 B;  1TWH B;  1YHQ A;  3NQT A;  2F3V A;  2LXJ A;  3DWA A;  4RGN A;  2Z4I A;  2A69 D;  4QGU A;  3H91 A;  4LNQ A;  3PO2 H;  2OTL A;  5LMN L;  1JQY D;  4IUR A;  1EEF D;  1VQO A;  5M5Y H;  2FIN B;  2VB2 X;  4WJ3 M;  4DV2 L;  1EYD A;  2UUA Q;  2A69 C;  2L0C A;  3I90 A;  3RUZ A;  3A55 A;  3BDO A;  3HEJ A;  5C4X H;  4G7O C;  2ZJP A;  1Y1W G;  1S5B D;  4Y52 H;  3NWT A;  4UPA A;  4X65 Q;  4KHP L;  2IPK D;  5FO7 B;  3GTL H;  1PTO F;  4IPC A;  4ME5 A;  4YHH Q;  1JR0 D;  1RDP D;  2K33 A;  1PZI D;  1F9P A;  5FOB B;  1I6H H;  3VR2 A;  2DY8 A;  3DWP A;  1EZ6 A;  2EYF A;  4JI6 L;  1EU4 A;  5LMN Q;  1GM5 A;  1EYG A;  1YJN A;  1BOS A;  1VQ6 A;  4P72 A;  1ZYR D;  4DV2 Q;  3WWV A;  5C0X J;  2GVA A;  1JB7 A;  1Q82 C;  2R7Z G;  2R93 H;  2JA6 B;  2WFW A;  3M4O B;  2JN4 A;  2B8G A;  1WOC A;  4P71 A;  4N8F A;  4CKC A;  1ZYR C;  4MN3 A;  5IYD G;  3A5Z B;  4JBW A;  4A3L H;  3FP9 A;  1WCM B;  2F0F A;  3CRK C;  2ENB A;  3C1E A;  4KHP Q;  1H9M A;  2Q2T A;  1X6O A;  4BY1 B;  4JI4 L;  5NUC A;  1KL9 A;  1STY A;  1TWA H;  2BOS A;  3CP0 A;  2WV6 D;  3S14 H;  1U5K A;  2ID0 A;  4IUQ A;  2IT1 A;  4JI6 Q;  4DR7 L;  4OWW B;  3R93 A;  3OTO L;  2R3Z A;  2IWH A;  2EQS A;  5I9P A;  1AEX A;  4JV5 L;  3CCJ A;  3G6J B;  3J81 c;  1YNN C;  1S5F D;  4WFN 3;  4NMZ A;  2CFM A;  2EZV A;  2RF4 A;  1I6V C;  2L1B A;  3ER0 A;  3AYH B;  3I55 A;  2TSS A;  2RHS B;  4YIJ A;  3JAM L;  1C4Q A;  1HQR D;  2DGY A;  3N52 A;  1LT4 D;  1MD2 D;  1I94 L;  5IY0 A;  1QUQ A;  4JI4 Q;  3UDX A;  4A3C G;  4IFD G;  3LNN A;  1PH8 A;  1EIH A;  5C4J B;  4FF4 A;  3NHH A;  1X3E A;  3J7A V;  2JA7 G;  1KHI A;  3VYU A;  4DR7 Q;  4LF4 L;  3OTO Q;  4UP9 A;  1EYA A;  3K80 C;  3ULP A;  4JV5 Q;  1B1Z A;  1TKW B;  5CBA E;  4JC0 A;  3F2U A;  3FKI B;  4ZK9 B;  1O7Y A;  4JI7 Q;  4Q0F A;  2YYZ A;  4OIJ A;  3HG9 A;  1GHK A;  4O42 A;  4UP7 A;  3RZO H;  2JK8 A;  3HS0 C;  2ZXO A;  1I94 Q;  1K28 A;  4LFB L;  1OXU A;  2DJF C;  4HIK A;  2RA4 A;  2UUC L;  2PYK A;  3K58 A;  1UE1 A;  3K0Y A;  5TSS A;  3W1G A;  1PH3 A;  1VQN A;  3BJU A;  3ERQ A;  1VDZ A;  1HH2 P;  3SK5 A;  4A3J B;  2KVM A;  4ZCK A;  5IYC G;  1MKH A;  4ID6 A;  2XTI A;  3K8A A;  1A63 A;  1ZEQ X;  2OF1 A;  3PUW A;  5M5X H;  2EYJ A;  1FGU A;  3NEL A;  2Z6K A;  2JA6 G;  4WJW A;  3I91 A;  3IFD A;  4EGV A;  4LFB Q;  3MC0 B;  1W6K A;  1WCM G;  4UHV A;  2R92 B;  2A68 C;  2NZ1 D;  3BG3 A;  1X56 A;  4DUY L;  1V9P A;  5FLX L;  4DR1 L;  5IIF A;  4P2C B;  1Y1V H;  1EL0 A;  4IPD A;  4J8Q A;  3S17 H;  4QL5 A;  5FO9 B;  2F4I A;  1W2B A;  1G2T A;  3FRP B;  4BBR H;  4IQZ A;  2RBM A;  1B53 A;  1TY0 A;  3HKZ G;  4OO1 H;  2NN6 H;  4IUU A;  4A3D H;  1TR5 A;  2E2J B;  2CQO A;  1OXT A;  5JJL A;  2B3G A;  3S1R H;  2K50 A;  3GTJ H;  1X65 A;  5JPM C;  2DUD A;  4UAI A;  1GUG A;  4HSP A;  4YY3 L;  4Y7N H;  4K6L A;  3D3R A;  2A8V A;  2SEB D;  3GO5 A;  2NVQ H;  1UE6 A;  3NTH A;  3JAM E;  1QNU A;  4I7Z C;  1MJC A;  2A73 B;  3A54 A;  2F3W A;  5CV7 A;  4KKU A;  3J81 j;  4LF9 L;  4ILW A;  1Q3L A;  4JI8 Q;  2UXD L;  1DOK A;  3AB9 A;  2Y0S B;  4IUP A;  1KAW A;  3NBH A;  1VQA A;  4JI3 Q;  3FKI G;  1AFP A;  5CGK A;  2O5I C;  5LHY 1;  4YY3 Q;  4P73 A;  1CFM A;  2N49 A;  2VS1 A;  4QIW B;  2SOB A;  3I4N G;  4O0A A;  2JA8 B;  2B63 B;  2SNM A;  3HOW H;  3ZJY C;  1LTI D;  1V1O A;  4LAA A;  3H09 A;  4KY7 A;  1PH2 A;  1TWC H;  3F2B A;  4FXG C;  5IGE A;  4A3J G;  4XT1 B;  3F2C A;  1EQV A;  1G91 A;  4LFC L;  1L0W A;  2AQ2 B;  2A1A A;  5EQ0 A;  2E2H B;  5CC4 A;  5JEA J;  4XYO A;  3VYR A;  2ALY B;  4MNO A;  3S2D H;  3S1M B;  2VL6 A;  2AHO B;  1KRS A;  2HUG A;  1Y1W H;  1PFM A;  1EU3 A;  1HNZ L;  3ITP A;  1F9S A;  2CQA A;  3R2T A;  3CPW A;  1EIG A;  4DNI A;  2KEC A;  3KOJ A;  5BN4 A;  5F2D A;  3UE0 A;  1NNX A;  4X66 L;  4K0K L;  1SNM A;  1JJG A;  3EQL C;  1PZK D;  5FLX E;  3PIO 3;  4B3R L;  3ULL A;  2B2U A;  1S5C D;  4LFC Q;  3GTQ B;  1JMC A;  4N9P A;  3H94 A;  2NWG A;  1Q46 A;  4HMJ A;  3TQY A;  3TS0 A;  1B9N A;  3NP8 A;  2PQA A;  5ELB A;  2TMP A;  2VB3 X;  3CQZ H;  5I4D A;  4IJL A;  3D4W A;  2R7Z H;  4AH6 A;  1FNV A;  1O7Z A;  3OPO A;  5IYD H;  5C3E B;  5FLM G;  2DJG C;  1HNZ Q;  1HJP A;  1Y8N B;  3ONA B;  4XXE A;  3GV3 A;  3O13 A;  1X3Q A;  4K0K Q;  2N8N A;  4WOR A;  1ML0 D;  4RGT A;  3M7G A;  3FHW A;  2NVX B;  2MJ8 A;  3PCO B;  3HGB A;  4B3R Q;  1LV9 A;  1BBU A;  1VQL A;  1WTH A;  3I7F A;  4RHS A;  2KED A;  1SJH D;  4JBJ A;  3PIP A;  5M3F B;  1I4R A;  3S1Q H;  2QA4 A;  2Y0S G;  3BYY B;  5C3X A;  4RAU C;  2A6H D;  4CDC C;  4I65 A;  1SE4 A;  4S3S A;  1TS4 A;  2MUY A;  5C4Z A;  2NB0 A;  1LTL A;  1D2B A;  4OWT B;  2GA4 B;  4OON A;  1N9W A;  2B2T C;  1EZ8 A;  1BKB A;  2UXC Q;  4HIO A;  2JA8 G;  1NSN S;  4A3C H;  4KMU C;  4IFD H;  1A3T A;  1AZQ A;  2B63 G;  1G6Z A;  1XMO L;  5C44 G;  4ODG A;  3RR5 A;  2JA7 H;  1TWH H;  2EYM A;  4AYB B;  1GHJ A;  1SE8 A;  3NXW A;  2UXB L;  1C48 A;  3J81 i;  2HIX A;  4UP8 A;  3LWU A;  4B9X A;  1SNP A;  4C3J G;  2ZM6 L;  1D1I A;  4RA8 A;  1XMQ L;  3STB C;  3GV6 A;  5KRU A;  4DF7 A;  4DNT B;  1K3B C;  2DN8 A;  2ASB A;  1E2Z A;  5A2Q E;  2LSS A;  1J5E L;  1HFN A;  3MFY A;  5EJW A;  3B6Y A;  2F0I A;  1MSH A;  2KCN A;  1H9J A;  4CJ1 B;  2AQ1 B;  2PMZ E;  1SMY C;  1Z6H A;  5CV6 A;  3C46 A;  1XMO Q;  1LUZ A;  1HA5 A;  3KBG A;  3OYY A;  1TQO A;  2ZXR A;  2EPB A;  2UXB Q;  1C0A A;  5IYC H;  4DV3 L;  2Q2H A;  2NN6 I;  1EWI A;  3E9H A;  2ZM6 Q;  1SYB A;  1JWM D;  1XMQ Q;  2KCT A;  2XWJ B;  3K5O A;  2JA6 H;  1XPU A;  3M4O H;  2K28 A;  1STG A;  1J5E Q;  1IL2 A;  5C3E G;  2FHT A;  1S4Z A;  1SNQ A;  4JI2 L;  1WCM H;  1FD7 D;  2EXD A;  5BN3 A;  1CSQ A;  3G7L A;  1WTO A;  1AE3 A;  2A19 A;  5ISR A;  4IO9 A;  2Q2I A;  3QB3 A;  5ELD A;  2OT2 A;  1OXS C;  3RNU A;  3BS1 A;  2MFI A;  5D3D A;  1L2F A;  5M3F G;  3E6Z X;  4DV3 Q;  1JWS D;  1SYC A;  2DNC A;  1I50 B;  2DY7 A;  3SDZ A;  4AQY L;  5J39 A;  3GP7 A;  3CCE A;  3MHB A;  1H95 A;  1WD1 A;  1ESR A;  1QIL A;  2IJ0 A;  4H0L C;  3MFG A;  4A3M B;  4JBK A;  4GNX B;  4GLX A;  2XWB B;  4JI2 Q;  4FNF A;  2UU9 L;  2AUK A;  2RSO A;  5IGG A;  2BDN A;  2VZA A;  3AEV A;  2E5L L;  2EY2 A;  1ET9 A;  3K5L A;  4B3M L;  1EOV A;  4JVZ A;  4V0B A;  4C1N I;  1TS5 A;  4DAY B;  4POF A;  4K2K A;  2E76 C;  5C4J H;  2OQK A;  1K73 C;  1DZ1 A;  2K4K A;  2WII B;  3LX0 A;  3QWN A;  4PMB A;  2K1B A;  4AYB G;  4YWL A;  1FGB D;  3TDQ A;  1NR2 A;  4LF5 L;  3GTG B;  1CK1 A;  3CC4 A;  4AQY Q;  2O5J C;  4BA2 I;  3T1Y L;  1BXT A;  2ZTD A;  4HAE A;  3CF5 A;  2A6E D;  3FKI H;  1UUP A;  3E0J A;  3HOX B;  3CRL C;  2N3S A;  1BCP B;  2K5D A;  3ZYY X;  3WOF A;  3KDF B;  4DAV A;  3E5S A;  5LL6 S;  1PRT D;  4RH6 A;  2F0O A;  5C6A A;  5I2Y A;  1Q90 A;  1SYE A;  4A3B B;  2JE6 I;  2MQH A;  2E5L Q;  3TN2 A;  1KNA A;  1PRT C;  4B3M Q;  1HQM C;  1YIT A;  2C9O A;  1EY5 A;  2M00 A;  2X6G A;  3T51 B;  2IX3 A;  3BVG A;  1JJ2 A;  1B9M A;  1HPC A;  5IWA L;  1K9M C;  4UY8 C;  2FXQ A;  4DV1 L;  4ZYS A;  3CHB D;  1KD1 C;  4LF5 Q;  2F4V L;  2K01 A;  4OL7 A;  1E1O A;  4MTN A;  5I9O A;  4A3J H;  3T1Y Q;  3VA7 A;  1EIF A;  3ICE A;  2NVT B;  3QR8 A;  2JA5 G;  4KHV A;  1CA6 A;  2AQ3 B;  4KD3 A;  2PZW A;  3RMH A;  1PA6 A;  4LF7 L;  1HCZ A;  2ZT9 C;  1A15 A;  1VS0 A;  2L9H A;  5DLQ E;  2D2C C;  5EKL A;  2QIL A;  3MXP A;  2M2L A;  3MEH A;  3G48 A;  2XGT A;  3GQB A;  5M9O A;  4DUZ L;  3BZC A;  1GKH A;  2Z4H A;  1PMR A;  4B08 A;  1PTO D;  3OIP A;  1LTG D;  5GAD C;  4TSS A;  5LMU L;  2D9U A;  4DV1 Q;  4X3U A;  2K05 A;  2H1E A;  1BCP D;  3SHL A;  1RJT A;  3KLS A;  2KHI A;  2F4V Q;  2F0J A;  2RDH A;  4FF1 A;  2F0T A;  1VQE A;  4TQU S;  4DAP A;  1T9H A;  3AU7 A;  3HOY B;  1JWU D;  3U9S A;  2I5M X;  4QB4 A;  1LAB A;  2LKV A;  3CW2 C;  1K3R A;  2JXM B;  4X65 L;  4LF7 Q;  1PLF A;  1FL0 A;  4HTH A;  1HHV A;  4A3M G;  1GUN A;  1UEA B;  1L0Y B;  1A3U A;  4F7X A;  4DR5 Q;  4L5R C;  5FLM H;  3U50 C;  4DUZ Q;  2YV5 A;  4TRD A;  3I70 A;  3NEN A;  1A2U A;  4R4I A;  5LMU Q;  5EPK A;  4R8N A;  1SLJ A;  3CXC A;  2CW0 D;  1HZB A;  2YTX A;  3M85 A;  2F0D A;  2F0N A;  1BUV T;  1RF2 D;  2D0O A;  2EYH A;  4HID A;  4IFD I;  4DR3 Q;  1EUJ A;  3Q8D A;  1CQV A;  3J81 L;  1Q8I A;  1PHJ A;  5IT9 c;  4C2M B;  3KLS X;  4U67 3;  4DXG A;  3HOX G;  1XJV A;  1W6J A;  2X69 A;  1VQ5 A;  4PQX A;  1J6Q A;  1ROD A;  3J7A F;  2BE5 D;  4RKL A;  1XPO A;  1K8O A;  2JSO A;  1CM9 A;  4O1N A;  2F0P A;  4A3B G;  3PUV A;  4A3K B;  1BCP F;  4DPG A;  2HQE A;  5M3M G;  1FNW A;  4NB3 A;  4IAL A;  2JA8 H;  3KF6 A;  1WFQ A;  3D31 A;  2B63 H;  1YVC A;  3RLF A;  5C44 H;  2PO4 A;  2IX1 A;  1VQC A;  5IP9 G;  2J0T D;  1WTP A;  1EFW A;  3HFZ B;  1HNX L;  1EIY B;  5CV8 A;  1X3P A;  1SJE D;  2QF7 A;  1Z47 A;  4J6H A;  4XQN A;  3Q0A A;  4A3G G;  1K83 H;  3MVV A;  4C3J H;  3CU7 A;  4NXN L;  3GTO B;  1HTP A;  1E7Z A;  4LK1 C;  2BDO A;  1N8R C;  3A8I E;  2XRQ D;  1N33 Q;  4LW1 A;  4X62 Q;  3PQI A;  1BDO A;  2JP1 A;  3E0E A;  1J8I A;  4IZ8 A;  2ZJR A;  1JC7 A;  3MEF A;  5ELO A;  3HKZ E;  4GS3 A;  2L55 A;  2XRS D;  1GUS A;  4K8J A;  1VQM A;  2ZTC A;  1J9O A;  3I4L A;  4JI7 L;  3EIV A;  1WTW A;  4I7A A;  3P7J A;  1HNX Q;  3H3V H;  3I4M B;  4KHZ A;  3GTQ H;  5HGT A;  1XNQ L;  2HDL A;  3KYH C;  2K14 A;  4NXN Q;  2HDM A;  1JOO A;  3PV0 A;  1EQQ A;  1QUQ B;  4HCE A;  1VCI A;  3D6C A;  1AW7 A;  1DCZ A;  1ESF A;  1I4Q A;  3KUP A;  1G2S A;  1FR3 A;  2PW7 A;  1JB3 A;  5C3E H;  1IHZ A;  2C5C A;  2G9H D;  3IKJ A;  4QUF A;  4DU9 A;  3AFP A;  2RDG A;  5GAH C;  1CKM A;  5EAY A;  4LF8 L;  3ULJ A;  2BCO A;  2F1M A;  2NVX H;  3MXN A;  1VF5 C;  1UEB A;  1VQD A;  2L15 A;  2KCC A;  2LFN A;  4JG2 A;  2IW3 A;  4DR2 L;  2PNH A;  2QW7 A;  5M3F H;  1XNQ Q;  4HJ8 A;  1VQ7 A;  1VQ9 A;  1XTC D;  3SE0 A;  5C5M A;  4K14 A;  3KJP A;  1Q7Y C;  1NUC A;  3J81 E;  4ME3 A;  4H44 C;  1TWF H;  2UUB Q;  3M3Y B;  3KBX A;  3W5O A;  5D14 A;  5KNB A;  3NBI A;  1F2Y A;  1PXU A;  1HZA A;  2WB1 B;  3F8T A;  5J3B A;  1IKM A;  3RLN A;  4KD4 A;  4C3I B;  4IOA A;  4YWK A;  3OMG A;  4HSV A;  2VQE L;  3CCU A;  1LTS D;  3CKI B;  4LF8 Q;  4ZQ3 A;  3PIO A;  1BNZ A;  1QE6 A;  1QZH A;  3UDG A;  4L6T B;  2EJG C;  4DR2 Q;  4DV6 L;  3CPF A;  1SBB B;  1TWG B;  4OEM B;  5BR8 Q;  5JAV A;  4B3T L;  1HTL D;  4BY1 G;  1LT5 D;  4IFD J;  4X3T A;  1SXT A;  1SE3 A;  1E24 A;  4KJO A;  5EKK A;  3VYT A;  4ZAI A;  2HCC A;  1YJW A;  1NMF A;  1CKN A;  4JI8 L;  5IGB A;  1JE5 A;  2VQE Q;  3KK7 A;  4H13 C;  3OSO A;  1ZXT A;  1TU2 B;  5E4X A;  2BH2 A;  2K5H A;  4JI3 L;  1KLG D;  3ND8 A;  2ICI A;  3TRZ A;  5IOD A;  1D1K A;  4AIM A;  1IXR A;  5ELE A;  1PZJ D;  4DV6 Q;  1O80 A;  1SE2 A;  2KEE A;  3BVZ A;  2QEJ C;  1BO0 A;  3MZ5 A;  4E6I A;  4QMG A;  1Q1E A;  2JA5 H;  2WP8 J;  5EBD A;  1ONL A;  1PH4 A;  3OW7 A;  4B3T Q;  1OXX K;  3GTM B;  3CME A;  2YU9 B;  4YCV A;  1SNO A;  1PYB A;  3DEO A;  4H02 A;  3X3M A;  2CH4 W;  4A93 B;  4RWS C;  4MTK A;  1FVI A;  1JE4 A;  2RCN A;  5GAG C;  2EJF C;  3RD4 A;  1IYV A;  1L1O A;  2Z1C A;  5HY6 A;  1SND A;  1XX8 A;  1BF4 A;  3NBH B;  2Y0S E;  4RGO S;  2K5Q A;  3URY A;  2MHV A;  2BH8 A;  1WTQ A;  3I3C A;  5J1Z A;  1I50 H;  1QCB D;  1O78 A;  4EQN A;  2IX0 A;  3OWE B;  4N9T A;  1AE2 A;  3L0O A;  2F52 A;  4QIW E;  2NVY B;  4A3M H;  1NCV A;  3KF8 B;  1RTO A;  3J7Y W;  1YZ6 A;  3GTL B;  2WB1 G;  4KTA A;  4FF2 A;  1E1T A;  4GKJ L;  1GUW A;  4C3I G;  3J80 c;  2O2L D;  1MJE A;  3KLW A;  2KQ3 A;  3T13 A;  4ALP A;  4BY7 B;  2H4O A;  4L63 B;  5A2Q L;  4MIU A;  5E1F A;  5C4H A;  1MHW C;  4PMW A;  5C3W A;  3NE5 B;  3FVQ A;  4DV0 L;  1H9S A;  3V2T A;  1L1O C;  3NTK A;  3GTG H;  4M8A A;  1PTO H;  4GN4 B;  1IBK L;  3SEB A;  2R92 G;  2R93 B;  1CHQ D;  1X3F A;  3HOX H;  5I2X A;  1STH A;  5M5W H;  1NAP A;  1CKO A;  4RKB A;  1PFB A;  1KDB A;  1MSG A;  2AMC B;  4PG3 A;  4A3B H;  1TWA B;  4GKJ Q;  3BZD B;  5M3M H;  1X3G A;  3S14 B;  2WKD A;  2MGS A;  1UWV A;  4IUV A;  1BBX C;  4HIM A;  1B4O A;  1GXD C;  1KXL A;  3NSW A;  2B2T A;  3M4Q A;  3HOU B;  4HJ5 A;  2PQA B;  4DV0 Q;  1EY7 A;  3MA2 B;  2PNR C;  5IP9 H;  4IPH A;  2Z9H A;  1ILQ A;  1IBK Q;  2NVT H;  3TZD A;  3QG1 A;  3A56 A;  5DAU A;  2OXP A;  3D0F A;  2EIF A;  4A3G H;  3H3V I;  4RGM A;  1DGS A;  1FJG L;  2UXC L;  1XTD A;  3ND9 A;  3DM1 A;  1ET6 A;  2AWN A;  4X64 Q;  3CCL A;  4LF6 L;  1II3 A;  2F0L A;  4A93 G;  1TVX A;  3LWE A;  1GD7 A;  4PZ7 A;  1XNR L;  3CMA A;  3MXU A;  4KN7 C;  3G4S A;  3D8G A;  4A4I A;  2OEO A;  2CWA A;  1SYD A;  3EA6 A;  5CBE E;  2N55 A;  3A0J A;  1EQR A;  2A6H C;  1IW7 D;  3SK8 A;  3HOY H;  3DXJ C;  3PSI A;  2B29 A;  3RZO B;  4IN3 A;  1HA6 A;  1EYC A;  1FJG Q;  4JCV E;  1UAP A;  1V1Q A;  4JI0 L;  5K36 G;  3EN2 A;  2L11 A;  4LF6 Q;  1SRO A;  1HZC A;  2Q8T A;  1QNK A;  3H3V C;  2NYZ D;  5J22 A;  1XNR Q;  4RFB A;  4BXX G;  1SR3 A;  3IFT A;  1MGS A;  1V1P A;  1NMG A;  3S2H B;  2FMM A;  4BY7 G;  4JYA Q;  4AYB E;  2M9V A;  1TS3 A;  3UDI A;  2VXW A;  4RHR A;  4MZ9 A;  3NQI A;  4G57 A;  2XSC A;  1KAA A;  2NTS A;  3E3X A;  3K57 A;  2EOT A;  4JOI C;  1NE3 A;  4LWC A;  1Y69 U;  3VA5 A;  1SAP A;  3I72 A;  1WTV A;  2PPB C;  2ICE C;  3VYS A;  2I5H A;  4JI0 Q;  2D62 A;  3DUZ A;  3UDF A;  2NTT A;  2K75 A;  5BN5 A;  4A76 A;  4HCS A;  1AH9 A;  3EBE A;  4FVM A;  3CC2 A;  1CT1 D;  4PZ8 A;  3QJY A;  4DV4 Q;  3QO2 A;  4ZUI A;  1EOT A;  2PMZ B;  2K04 A;  4OO1 I;  5EKI A;  3HOU G;  4A3D B;  4PZ6 A;  1YJ9 A;  4LMQ D;  4APV A;  4ULL A;  1EWC A;  2CHB D;  1WI5 A;  3PO3 B;  4J15 A;  2F0K A;  1DXM A;  4QQB X;  3GTJ B;  4HMI A;  4X6A H;  5KEE A;  4QCL A;  3QOJ A;  3OIQ A;  4Y7N B;  3NK9 A;  4BY1 H;  4EQ5 A;  1LLR D;  1MBY A;  1Z7T A;  2FFK B;  3T1H Q;  3GTO H;  1Q1B A;  3F1Z A;  1PDQ A;  1OTC A;  3W3A A;  1BQQ T;  2XN9 C;  1RL2 A;  3R3O A;  4IJH A;  1NR4 A;  1X55 A;  4LUO A;  4V19 0;  3GTK B;  1F2M A;  2B8F A;  3WOE A;  5GRO A;  1F9Q A;  1S5E D;  2NZH A;  1GVP A;  3QOL A;  1QVF A;  5IYB G;  1CZG A;  1U9R A;  3T4A C;  5KNC A;  4O2D A;  4BBS B;  3HZX A;  1TII D;  2WAQ B;  1CSP A;  2QGQ A;  1VQH A;  2F0E A;  3CC7 A;  3L7Z C;  1KDA A;  1D7Q A;  5JVH 3;  1NJI C;  5FJ8 G;  4Q5V A;  3EVQ A;  5COY A;  5KYI A;  3H0G B;  4L8J A;  5IGF A;  1G51 A;  2Z6B A;  1XXG A;  1JOR A;  3TP7 A;  4YWM A;  1KDC A;  1X9N A;  2VQF L;  4X3K A;  4LUV A;  1I4G A;  3SK6 A;  5FO8 B;  4DK3 C;  2VW9 A;  4DV5 Q;  4G4K A;  4M1U B;  5KND A;  4OHJ A;  1LYL A;  4CDF C;  1T5E A;  4XTC S;  1P8L A;  4LFA L;  3PIP 3;  1D5M C;  1U4R A;  2E75 C;  1DJR D;  2A6E C;  3S2D B;  2EY1 A;  3K0X A;  1UE7 A;  4KI0 A;  4XIG S;  1F77 A;  3S1N B;  3CCV A;  2R6G A;  4P74 A;  3C2P A;  1QG7 A;  3TP5 A;  1E2V A;  1PH7 A;  2RDF A;  5AJ3 Q;  4DR6 L;  1C9O A;  1WTR A;  3M3Y H;  2AKW B;  3TME A;  1V8Q A;  1VQJ A;  2VQF Q;  4A75 A;  5K5P A;  4C3I H;  4EX5 A;  4DKA C;  3TRE A;  3K6O A;  3TBI B;  1WJJ A;  1I4H A;  3RZD B;  4GNX C;  4LFA Q;  1LT6 D;  2C35 B;  4KY5 A;  1WTX A;  5IT9 L;  1F2Z A;  2OQ0 A;  2CVR A;  4LUZ A;  4POG A;  3PO3 G;  4HJA A;  1D5Z C;  2ZXP A;  4FYD A;  3CQZ B;  2KUM A;  4FO2 A;  5CMD A;  4DR5 L;  1TWG H;  4DK1 A;  2R92 H;  1EQT A;  1EWH A;  2NUC A;  2ATW A;  1S5D D;  5COR A;  3RN5 A;  1SFO B;  2Q8R E;  2Q8I B;  5DNF A;  4RCN A;  4DR6 Q;  2KEN A;  2QKI C;  1RCV D;  2K7V A;  1SRU A;  3J80 i;  1PTO C;  1L0X B;  4EVO A;  4DR3 L;  4DK6 C;  5JOB A;  5HUR A;  2E2J H;  1O7L A;  1BCP C;  1VMC A;  4GKK L;  3S24 A;  2I5L X;  1CZW A;  1QZG A;  1QJO A;  3S1Q B;  3BVM A;  1D8L A;  1SYF A;  1X54 A;  3FDT A;  4BBS G;  3Q23 A;  3TEH B;  3CCM A;  3SXH A;  2F03 A;  2JEB I;  2WAQ G;  4KKT A;  5C0X G;  3VR5 A;  1ENF A;  4CBV A;  5HGQ A;  4GOP A;  3TP8 A;  3MWY W;  5FKA C;  3I2Z A;  1CA5 A;  4L5Q A;  1D5X C;  2KHJ A;  1Y14 B;  3E9I A;  3G6E A;  3GTM H;  1VQ8 A;  2YU9 H;  3H0G G;  3JC6 6;  3S15 B;  4C56 C;  2A74 C;  2YTY A;  3J7Z C;  4A93 H;  3BU2 A;  1LTT D;  1MIU A;  4KN4 C;  2CW0 C;  2B2Y A;  4DFA A;  1BBW A;  4GKK Q;  2CH4 A;  5ELN A;  3KLR A;  1I3Q B;  4FXK C;  3K5N A;  1X32 A;  1AZP A;  2MPM A;  3OMC A;  4BA1 I;  4QUC A;  1E0B A;  1N33 L;  1SYG A;  4X62 L;  2BE5 C;  3P75 A;  3QIA A;  2L12 A;  5K36 H;  1TT2 A;  3GD7 A;  1M1K C;  1A62 A;  3KF6 B;  2NVY H;  2Z8L A;  4GOP C;  2K5W A;  4C3H B;  3PUX A;  3R2I A;  3P1H A;  4B9W A;  2VUM B;  4BXX H;  1LTA D;  2B2W C;  4XYQ A;  3TZU A;  4BY7 H;  1I4X A;  4DR4 L;  2X6L A;  2E2H H;  2PCF B;  1HXY D;  5EBC A;  1M8A A;  2GVB A;  3S1M H;  4KKS A;  2B2Y C;  1G8Z D;  3H15 A;  1CTM A;  1I5F A;  1JJC B;  4RMF A;  3X3N A;  4HED A;  4HJ7 A;  5IT9 E;  2Z0S A;  4IUT A;  2LY7 A;  2EYL A;  5IOC A;  1C8C A;  1E3P A;  3SVM A;  5IP7 G;  2OCE A;  3MAQ A;  3I4O A;  1VQ4 A;  1YNX A;  3HOY G;  2HT1 A;  1T5X D;  4BS9 A;  4DR4 Q;  1YNN D;  4J1M A;  1BR9 A;  4P75 A;  3HKZ B;  4ZKC B;  3HOU H;  1K8M A;  1R4P B;  1R9T B;  4CKE A;  4JI5 L;  1HR0 W;  2AUJ D;  1B3A A;  4CDD C;  5JJK A;  5T1I A;  2IHE A;  2UUB L;  1SEB D;  4CHT B;  3HOV B;  1AP0 A;  1E22 A;  2J7Z A;  2E2D C;  1A0I A;  5DM6 3;  3HOZ B;  1H9R A;  4MHE A;  2BA1 A;  3V96 A;  2EY5 A;  2I07 B;  3RLO A;  4ZUJ A;  2WAC A;  3HKS A;  1RIP A;  2BA0 A;  3S16 B;  2I0Q A;  3MXN B;  2L4N A;  1DOL A;  3H6M A;  3IRB A;  1YBY A;  2FJ2 A;  2F0V A;  4FP5 D;  5IYB H;  1IBL L;  5JJI A;  4K6D A;  5BR8 L;  4JI5 Q;  4X3S A;  1IYU A;  4A3F B;  4EQP A;  4A3K G;  1PFS A;  3IAY A;  4GLV B;  5FJ8 H;  2RSN A;  2WB1 E;  3G71 A;  1YEZ A;  4GZY C;  1DON A;  4YCU A;  3Q22 A;  3K5M A;  1UE5 A;  3V05 A;  4C3H G;  3I4N B;  3GTP B;  1DM0 B;  4IOC A;  1YIJ A;  1VQK A;  2EY6 A;  1HFG A;  4LJZ C;  3K59 A;  2VUM G;  5CV9 A;  1N32 L;  4NXM L;  3S2H H;  2EYO A;  4LF4 Q;  4B3S L;  1CI3 M;  1RKN A;  2EXZ A;  1A8V A;  2EE1 A;  5FK9 C;  1IBL Q;  2B39 A;  3C1F A;  4OXP A;  5ELF A;  4JPB W;  1LTB D;  2WIN B;  3DM3 A;  4BWG B;  4DNR B;  4NPS A;  3JAM c;  4F87 A;  3U4Z A;  4KV6 A;  3K7A B;  3DEP A;  2JQO A;  1B50 A;  5CV5 A;  3PUZ A;  2A68 D;  5AFW A;  3I73 A;  1PYW D;  3U58 A;  1CKN B;  2PZU A;  2UUC Q;  2IL8 A;  3J80 L;  1EFI D;  4R4Q A;  2AWO A;  4DGZ A;  5A35 A;  5JJZ A;  1HUN A;  2QDB A;  5JVG 3;  3A8J E;  1LAC A;  2XNA C;  5D3I B;  1N32 Q;  4NXM Q;  2E2I B;  1JIC A;  5E7N A;  3EFX D;  1Q86 C;  3AFQ A;  1N36 L;  3I4M G;  4B3S Q;  1PFN A;  3NEM A;  1SNC A;  4DA2 A;  1STB A;  1I4P A;  1B2T A;  4PNY A;  1M90 C;  1KRT A;  2O4X A;  1BVS A;  3R8B A;  2N78 A;  3T53 B;  2F0G A;  2FMC A;  3N6R A;  2SDF A;  1VQF A;  5JEA G;  4A3E B;  4OEL B;  1Y8P B;  3PO3 H;  4JI1 L;  2GN5 A;  3VDY A;  3HOV G;  3Q24 A;  2NZO A;  3FEW X;  4A3I B;  2LXK A;  4OIK A;  3HOZ G;  5GAE C; 
#chains in the Genus database with same CATH homology
 1B44 D;  3BDC A;  4JK1 C;  4TKO B;  1OO9 B;  2RQX A;  3EJI A;  1STE A;  2N88 A;  4IUN A;  3PO2 B;  1EY4 A;  1LO5 D;  5M5Y B;  4K8I A;  1GOZ A;  2EVB A;  3OOC A;  5C4X B;  1XYI A;  1RTN A;  2RKS A;  4XT3 B;  3VR3 A;  1IL8 A;  5C0X H;  2XVS A;  4H7B A;  3NTI A;  1E2W A;  1EY0 A;  1I6H B;  1KAB A;  5KIX A;  1IKL A;  1STA A;  1H9S B;  3KF8 A;  1SDF A;  1KNE A;  5C44 B;  4CKB A;  4EQO A;  5EGT A;  1A6X A;  2HCI A;  1K83 B;  2F0S A;  2MP1 A;  1QOH A;  4C3J B;  5CYU A;  4G7Z C;  4NW2 A;  1Y8O B;  4F8M A;  1RD9 D;  3SK4 A;  1JOQ A;  3A7L A;  3M4Y A;  3S9W A;  1ENA A;  3D4D A;  4XQQ A;  2K03 A;  1EY8 A;  3T16 A;  4CJ0 B;  4CJ2 C;  3J80 E;  2F0M A;  2QCP X;  2F0W A;  3DHQ A;  3L9A X;  5EPL A;  3PUY A;  3VR4 A;  4R8I A;  3A7A B;  1TY2 A;  1VMP A;  1F2L A;  3TSS A;  1ENC A;  2KHS A;  3T56 B;  3NUC A;  4NDX A;  1CQF A;  1DD2 A;  5E3F A;  5I6Y A;  5JPN C;  1V43 A;  1IW7 C;  4K5V A;  1XWE A;  2DNE A;  1WVL A;  3FPU B;  1F9R A;  2B2U C;  1TWF B;  4R9W A;  4HN7 A;  1YNJ D;  1QWY A;  1V1P B;  4DK0 A;  1VF7 A;  2KOL A;  2EYP A;  4CGY B;  1YNJ C;  5IGC A;  2R61 A;  2F0H A;  1DYQ A;  4XDX A;  5M5X B;  3VR6 A;  3M7N A;  3BYT B;  4KY6 A;  5ELC A;  1OXV A;  3L3O C;  1Y1V B;  1EY9 A;  1D6E C;  3S17 B;  4NP5 A;  1LT3 D;  1SMY D;  2D5D A;  2F0Q A;  4BBR B;  3W2D A;  4WRD A;  2NBF A;  3D4R A;  1U4L A;  3FMC A;  4Z9C B;  1DOM A;  3C3L A;  3S1R B;  1EY6 A;  3I8Z A;  2F0U A;  5LL6 X;  1HRJ A;  4G7H C;  1JCK B;  4DXF A;  2JA5 B;  3SR1 A;  3P20 A;  4U68 A;  2PQE A;  2NVQ B;  1ICW A;  2L5T A;  1STN A;  2V4D A;  2B2V A;  2I46 A;  1TS2 A;  4K5X A;  5G3L D;  4KK7 A;  3WDN A;  4FXD A;  1H9K A;  1PRT B;  5DEH A;  1ILP A;  4ABN A;  2RVL A;  2EDG A;  2KJX A;  3ERO A;  4PV1 C;  5JEA H;  2PZT A;  5KYL A;  5IGD A;  4ZLT F;  4QF4 A;  3HOW B;  5C0X I;  4ZKB B;  3NWS A;  1TWC B;  1AN8 A;  1GUT A;  3HRZ C;  2B2V C;  1HUM A;  4DAY A;  2K32 A;  2E74 C;  1G29 1;  2WKC A;  2VNU D;  4RCO A;  5CV4 A;  4FF3 A;  3MXG A;  3NPP A;  3OHX C;  1FYC A;  1EEI D;  2G9D A;  3PMF A;  1JOK A;  1PTO B;  5T1G A;  1Y1W B;  2XIW A;  3AMU A;  1CHP D;  3UI2 A;  5DM7 3;  1WD0 A;  4ZRZ A;  1U4P A;  3MTS A;  5G3L F;  5M5W B;  2J4X A;  2KA7 A;  5EPJ A;  3FPP A;  2LS0 1;  4OGQ C;  4C1N K;  4K2L A;  3Q6S A;  1LTR D;  3BDL A;  4OO1 G;  2NN6 G;  2K6A A;  4UDU C;  5M3M B;  3TP6 A;  4XQJ A;  3OWF A;  4PMC A;  1GUO A;  1ZKO A;  1KTK A;  1KLU D;  2R7Z B;  5C5L A;  4HR7 B;  4KJN A;  2JYO A;  1MI2 A;  4A3G B;  2JEA I;  5KGU A;  1RHP A;  2A5H A;  3HP3 A;  4F88 A;  2EJM A;  3DWQ A;  1M4V A;  4DN4 M;  3D6W A;  4K5W A;  3DMU A;  1A2T A;  1GJX A;  2PW5 A;  1SSO A;  5D65 A;  2SNS A;  1FNU A;  5E4W C;  3A8K E;  1Q12 A;  5CR3 A;  5I6W A;  2LMC B;  1PRT F;  1QB5 D;  2B2W A;  1U4M A;  1A3V A;  1UNS A;  1R4Q B;  3IL8 A;  4NKL A;  3U9O A;  2JA7 B;  1TWH B;  3NQT A;  2F3V A;  3DWA A;  4RGN A;  2Z4I A;  2A69 D;  3H91 A;  1JQY D;  4IUR A;  1EEF D;  2FIN B;  2VB2 X;  1EYD A;  2A69 C;  2L0C A;  3I90 A;  3RUZ A;  3A55 A;  3BDO A;  3HEJ A;  4G7O C;  1S5B D;  3NWT A;  2IPK D;  5FO7 B;  1PTO F;  4ME5 A;  1JR0 D;  1RDP D;  2K33 A;  1PZI D;  1F9P A;  5FOB B;  3VR2 A;  2DY8 A;  3DWP A;  1EZ6 A;  2EYF A;  1EU4 A;  1BOS A;  1ZYR D;  5C0X J;  2JA6 B;  3M4O B;  2B8G A;  4CKC A;  1ZYR C;  4MN3 A;  4JBW A;  1WCM B;  2F0F A;  3CRK C;  2ENB A;  3C1E A;  1H9M A;  4BY1 B;  5NUC A;  1STY A;  2BOS A;  2WV6 D;  2ID0 A;  4IUQ A;  2IT1 A;  3R93 A;  2R3Z A;  2IWH A;  5I9P A;  1AEX A;  3G6J B;  1YNN C;  1S5F D;  4WFN 3;  4NMZ A;  2EZV A;  1I6V C;  2L1B A;  2TSS A;  3JAM L;  4YIJ A;  1C4Q A;  1HQR D;  3N52 A;  1LT4 D;  1MD2 D;  4IFD G;  3LNN A;  1EIH A;  5C4J B;  4FF4 A;  3NHH A;  3J7A V;  3VYU A;  1EYA A;  1B1Z A;  1TKW B;  5CBA E;  3F2U A;  3FKI B;  4ZK9 B;  1O7Y A;  4Q0F A;  2YYZ A;  4OIJ A;  3HG9 A;  1GHK A;  4O42 A;  3HS0 C;  2ZXO A;  1OXU A;  2RA4 A;  2PYK A;  3K58 A;  3K0Y A;  5TSS A;  3ERQ A;  1VDZ A;  3SK5 A;  4A3J B;  2KVM A;  4ID6 A;  1ZEQ X;  2OF1 A;  3PUW A;  2EYJ A;  4WJW A;  3I91 A;  3IFD A;  4EGV A;  3MC0 B;  1W6K A;  2R92 B;  2A68 C;  2NZ1 D;  3BG3 A;  5FLX L;  5IIF A;  4P2C B;  1EL0 A;  4J8Q A;  5FO9 B;  2F4I A;  1G2T A;  3FRP B;  4IQZ A;  2RBM A;  1B53 A;  1TY0 A;  4OO1 H;  2NN6 H;  4IUU A;  1TR5 A;  2E2J B;  1OXT A;  5JPM C;  4UAI A;  1GUG A;  4HSP A;  4K6L A;  3D3R A;  2SEB D;  3GO5 A;  3NTH A;  3JAM E;  1QNU A;  4I7Z C;  2A73 B;  3A54 A;  2F3W A;  5CV7 A;  4KKU A;  4ILW A;  1Q3L A;  1DOK A;  3AB9 A;  2Y0S B;  4IUP A;  3NBH A;  1AFP A;  5CGK A;  2O5I C;  5LHY 1;  1CFM A;  4QIW B;  2SOB A;  2JA8 B;  2B63 B;  2SNM A;  1LTI D;  1V1O A;  4LAA A;  3H09 A;  4KY7 A;  4FXG C;  5IGE A;  4XT1 B;  1EQV A;  1G91 A;  2AQ2 B;  5EQ0 A;  2E2H B;  5CC4 A;  5JEA J;  4XYO A;  3VYR A;  3S1M B;  2HUG A;  1PFM A;  1EU3 A;  3ITP A;  1F9S A;  2CQA A;  3R2T A;  1EIG A;  2KEC A;  5BN4 A;  5F2D A;  1SNM A;  3EQL C;  1PZK D;  5FLX E;  3PIO 3;  2B2U A;  1S5C D;  3GTQ B;  4N9P A;  3H94 A;  2NWG A;  4HMJ A;  1B9N A;  3NP8 A;  5ELB A;  2TMP A;  2VB3 X;  5I4D A;  3D4W A;  1FNV A;  1O7Z A;  3OPO A;  5C3E B;  1Y8N B;  3ONA B;  4XXE A;  3GV3 A;  3O13 A;  1X3Q A;  4WOR A;  1ML0 D;  4RGT A;  3M7G A;  2NVX B;  2MJ8 A;  3HGB A;  1LV9 A;  4RHS A;  2KED A;  1SJH D;  5M3F B;  1I4R A;  3BYY B;  5C3X A;  4RAU C;  2A6H D;  4I65 A;  1SE4 A;  4S3S A;  1TS4 A;  2MUY A;  5C4Z A;  2NB0 A;  1D2B A;  2GA4 B;  2B2T C;  1EZ8 A;  1NSN S;  4KMU C;  4IFD H;  1A3T A;  1AZQ A;  1G6Z A;  4ODG A;  2EYM A;  4AYB B;  1GHJ A;  3NXW A;  1C48 A;  3LWU A;  4B9X A;  1SNP A;  4C3J G;  1D1I A;  4RA8 A;  3GV6 A;  5KRU A;  4DF7 A;  4DNT B;  2DN8 A;  1E2Z A;  5A2Q E;  1HFN A;  3MFY A;  5EJW A;  2F0I A;  1MSH A;  2KCN A;  1H9J A;  4CJ1 B;  2AQ1 B;  1SMY C;  1Z6H A;  5CV6 A;  3C46 A;  1HA5 A;  3KBG A;  1TQO A;  2ZXR A;  2EPB A;  2NN6 I;  1SYB A;  1JWM D;  2XWJ B;  3K5O A;  2K28 A;  1STG A;  2FHT A;  1S4Z A;  1SNQ A;  1FD7 D;  5BN3 A;  3G7L A;  1WTO A;  5ISR A;  3QB3 A;  5ELD A;  2OT2 A;  1OXS C;  3BS1 A;  5D3D A;  3E6Z X;  3SDZ A;  1JWS D;  1SYC A;  2DNC A;  1I50 B;  2DY7 A;  5J39 A;  3GP7 A;  3MHB A;  1WD1 A;  1ESR A;  1QIL A;  2IJ0 A;  4H0L C;  3MFG A;  4A3M B;  2XWB B;  4FNF A;  2AUK A;  2RSO A;  5IGG A;  2BDN A;  2EY2 A;  1ET9 A;  3K5L A;  4V0B A;  4C1N I;  1TS5 A;  4K2K A;  2E76 C;  1DZ1 A;  2WII B;  3LX0 A;  3QWN A;  4PMB A;  2K1B A;  1FGB D;  3TDQ A;  1NR2 A;  3GTG B;  2O5J C;  1CK1 A;  4BA2 I;  1BXT A;  4HAE A;  2A6E D;  1UUP A;  3E0J A;  3HOX B;  3CRL C;  1BCP B;  2K5D A;  3ZYY X;  3WOF A;  4DAV A;  3E5S A;  5LL6 S;  1PRT D;  4RH6 A;  2F0O A;  5C6A A;  5I2Y A;  1Q90 A;  1SYE A;  4A3B B;  2JE6 I;  3TN2 A;  1KNA A;  1PRT C;  1HQM C;  2C9O A;  1EY5 A;  2M00 A;  2X6G A;  3T51 B;  2IX3 A;  3BVG A;  1B9M A;  1HPC A;  4ZYS A;  3CHB D;  2K01 A;  4OL7 A;  5I9O A;  3VA7 A;  2NVT B;  4KHV A;  1CA6 A;  2AQ3 B;  4KD3 A;  2PZW A;  3RMH A;  1HCZ A;  2ZT9 C;  1A15 A;  2L9H A;  2D2C C;  5EKL A;  2QIL A;  3MXP A;  2M2L A;  3MEH A;  3GQB A;  5M9O A;  2Z4H A;  1PMR A;  4B08 A;  1PTO D;  3OIP A;  1LTG D;  4TSS A;  2D9U A;  4X3U A;  2K05 A;  2H1E A;  1BCP D;  3SHL A;  1RJT A;  3KLS A;  2F0J A;  2RDH A;  4FF1 A;  2F0T A;  4TQU S;  4DAP A;  3HOY B;  3AU7 A;  1JWU D;  3U9S A;  4QB4 A;  1LAB A;  2LKV A;  2JXM B;  1PLF A;  4HTH A;  1HHV A;  1GUN A;  1UEA B;  1L0Y B;  1A3U A;  4F7X A;  4TRD A;  3I70 A;  1A2U A;  5EPK A;  4R8N A;  2CW0 D;  3M85 A;  2F0D A;  2F0N A;  1BUV T;  1RF2 D;  2EYH A;  4IFD I;  1CQV A;  3J81 L;  1Q8I A;  4C2M B;  3KLS X;  4U67 3;  4DXG A;  1W6J A;  2X69 A;  4PQX A;  1ROD A;  3J7A F;  2BE5 D;  4RKL A;  1K8O A;  2JSO A;  1CM9 A;  4O1N A;  2F0P A;  3PUV A;  4A3K B;  1BCP F;  2HQE A;  1FNW A;  4IAL A;  3D31 A;  3RLF A;  2PO4 A;  2IX1 A;  2J0T D;  1WTP A;  5CV8 A;  1X3P A;  1SJE D;  2QF7 A;  1Z47 A;  4J6H A;  4XQN A;  3Q0A A;  3MVV A;  3CU7 A;  3GTO B;  1HTP A;  4LK1 C;  2BDO A;  3A8I E;  2XRQ D;  1BDO A;  2JP1 A;  1J8I A;  4IZ8 A;  1JC7 A;  4K8J A;  2L55 A;  2XRS D;  1GUS A;  1J9O A;  3I4L A;  1WTW A;  3P7J A;  3I4M B;  4KHZ A;  5HGT A;  2HDL A;  2HDM A;  1JOO A;  3PV0 A;  4HCE A;  1VCI A;  3D6C A;  1AW7 A;  1DCZ A;  1ESF A;  1I4Q A;  3KUP A;  1G2S A;  1FR3 A;  2PW7 A;  1JB3 A;  1IHZ A;  2C5C A;  2G9H D;  3IKJ A;  4QUF A;  4DU9 A;  2RDG A;  2BCO A;  2F1M A;  1VF5 C;  3MXN A;  2KCC A;  2LFN A;  2IW3 A;  1XTC D;  3SE0 A;  5C5M A;  4K14 A;  1NUC A;  3J81 E;  4H44 C;  3M3Y B;  3KBX A;  5KNB A;  5D14 A;  3NBI A;  1F2Y A;  1PXU A;  2WB1 B;  1IKM A;  4KD4 A;  4C3I B;  3OMG A;  4HSV A;  1LTS D;  3CKI B;  4ZQ3 A;  1BNZ A;  1QE6 A;  4L6T B;  2EJG C;  1SBB B;  1TWG B;  5JAV A;  1HTL D;  1LT5 D;  4IFD J;  4X3T A;  1SXT A;  1SE3 A;  4KJO A;  5EKK A;  3VYT A;  4ZAI A;  2HCC A;  5IGB A;  3KK7 A;  4H13 C;  3OSO A;  1ZXT A;  1TU2 B;  5E4X A;  1KLG D;  3ND8 A;  2ICI A;  5IOD A;  1D1K A;  5ELE A;  1PZJ D;  1O80 A;  1SE2 A;  2KEE A;  3BVZ A;  2QEJ C;  1BO0 A;  3MZ5 A;  4E6I A;  4QMG A;  1Q1E A;  2WP8 J;  5EBD A;  1ONL A;  3OW7 A;  1OXX K;  3GTM B;  2YU9 B;  1SNO A;  3X3M A;  3DEO A;  4A93 B;  4RWS C;  1JE4 A;  2EJF C;  3RD4 A;  1IYV A;  2Z1C A;  1SND A;  1XX8 A;  1BF4 A;  4RGO S;  2K5Q A;  3URY A;  2MHV A;  1WTQ A;  3I3C A;  5J1Z A;  1QCB D;  1O78 A;  4EQN A;  2IX0 A;  3OWE B;  4N9T A;  2NVY B;  1NCV A;  1RTO A;  3J7Y W;  3GTL B;  4KTA A;  4FF2 A;  1GUW A;  4C3I G;  2O2L D;  2KQ3 A;  3T13 A;  4BY7 B;  2H4O A;  4L63 B;  5A2Q L;  4MIU A;  5E1F A;  5C4H A;  4PMW A;  5C3W A;  3NE5 B;  3FVQ A;  1H9S A;  3V2T A;  3NTK A;  4M8A A;  1PTO H;  3SEB A;  2R93 B;  1CHQ D;  5I2X A;  1STH A;  1NAP A;  4RKB A;  1PFB A;  1KDB A;  1MSG A;  1TWA B;  3BZD B;  3S14 B;  2WKD A;  2MGS A;  4IUV A;  1BBX C;  1B4O A;  1GXD C;  3NSW A;  2B2T A;  3HOU B;  1EY7 A;  3MA2 B;  2PNR C;  1ILQ A;  3TZD A;  3QG1 A;  3A56 A;  5DAU A;  2OXP A;  4RGM A;  3ND9 A;  3DM1 A;  1ET6 A;  2AWN A;  1II3 A;  2F0L A;  1TVX A;  3LWE A;  3MXU A;  4KN7 C;  3D8G A;  2OEO A;  1SYD A;  3EA6 A;  5CBE E;  2N55 A;  2A6H C;  1IW7 D;  3SK8 A;  3DXJ C;  3RZO B;  4IN3 A;  1HA6 A;  1EYC A;  1UAP A;  5K36 G;  2L11 A;  2Q8T A;  1QNK A;  3H3V C;  2NYZ D;  5J22 A;  4RFB A;  3IFT A;  1MGS A;  1V1P A;  3S2H B;  2FMM A;  2M9V A;  1TS3 A;  2VXW A;  4RHR A;  3NQI A;  4G57 A;  2XSC A;  1KAA A;  2NTS A;  3K57 A;  2EOT A;  1Y69 U;  3VA5 A;  1SAP A;  3I72 A;  1WTV A;  2PPB C;  2ICE C;  3VYS A;  2D62 A;  3DUZ A;  2NTT A;  5BN5 A;  4HCS A;  4FVM A;  1CT1 D;  3QJY A;  3QO2 A;  4ZUI A;  1EOT A;  2PMZ B;  2K04 A;  4OO1 I;  5EKI A;  4A3D B;  4LMQ D;  4ULL A;  1EWC A;  2CHB D;  3PO3 B;  2F0K A;  1DXM A;  3GTJ B;  4HMI A;  5KEE A;  4QCL A;  3QOJ A;  3OIQ A;  4Y7N B;  3NK9 A;  1LLR D;  1MBY A;  1Z7T A;  2FFK B;  1Q1B A;  1PDQ A;  3W3A A;  1BQQ T;  2XN9 C;  3R3O A;  1NR4 A;  4V19 0;  3GTK B;  1F2M A;  2B8F A;  3WOE A;  1F9Q A;  1S5E D;  3QOL A;  1CZG A;  1U9R A;  3T4A C;  5KNC A;  4BBS B;  3HZX A;  1TII D;  2WAQ B;  2F0E A;  3L7Z C;  1KDA A;  5JVH 3;  4Q5V A;  3EVQ A;  5COY A;  5KYI A;  3H0G B;  4L8J A;  5IGF A;  1XXG A;  1JOR A;  3TP7 A;  1KDC A;  4X3K A;  3SK6 A;  1I4G A;  5FO8 B;  4G4K A;  4M1U B;  5KND A;  4OHJ A;  1T5E A;  4XTC S;  3PIP 3;  1D5M C;  1U4R A;  2E75 C;  1DJR D;  2A6E C;  3S2D B;  2EY1 A;  4KI0 A;  4XIG S;  1F77 A;  3S1N B;  2R6G A;  3C2P A;  1QG7 A;  3TP5 A;  1E2V A;  2RDF A;  1WTR A;  3TME A;  1V8Q A;  5K5P A;  3K6O A;  3TBI B;  1I4H A;  3RZD B;  1LT6 D;  4KY5 A;  1WTX A;  5IT9 L;  1F2Z A;  2CVR A;  1D5Z C;  2ZXP A;  4FYD A;  3CQZ B;  2KUM A;  4FO2 A;  5CMD A;  4DK1 A;  1EQT A;  1EWH A;  2NUC A;  1S5D D;  5COR A;  1SFO B;  2Q8R E;  2Q8I B;  5DNF A;  4RCN A;  2QKI C;  1RCV D;  2K7V A;  1PTO C;  1L0X B;  4EVO A;  5JOB A;  5HUR A;  1O7L A;  1BCP C;  1VMC A;  1CZW A;  1QJO A;  3S1Q B;  3BVM A;  1SYF A;  3FDT A;  3Q23 A;  3SXH A;  2F03 A;  2JEB I;  4KKT A;  5C0X G;  3VR5 A;  1ENF A;  4CBV A;  3TP8 A;  3MWY W;  5FKA C;  1CA5 A;  1D5X C;  3S15 B;  4C56 C;  2A74 C;  1LTT D;  4KN4 C;  2CW0 C;  2B2Y A;  4DFA A;  3KLR A;  1I3Q B;  4FXK C;  3K5N A;  1X32 A;  1AZP A;  2MPM A;  3OMC A;  4BA1 I;  4QUC A;  1E0B A;  1SYG A;  2BE5 C;  3P75 A;  3QIA A;  2L12 A;  5K36 H;  1TT2 A;  3GD7 A;  2Z8L A;  2K5W A;  4C3H B;  3PUX A;  3R2I A;  3P1H A;  4B9W A;  2VUM B;  1LTA D;  2B2W C;  4XYQ A;  3TZU A;  1I4X A;  2X6L A;  2PCF B;  1HXY D;  5EBC A;  1M8A A;  4KKS A;  2B2Y C;  1G8Z D;  1CTM A;  3X3N A;  4HED A;  5IT9 E;  4IUT A;  2LY7 A;  2EYL A;  5IOC A;  1C8C A;  3SVM A;  3MAQ A;  1T5X D;  4BS9 A;  1YNN D;  4J1M A;  1BR9 A;  3HKZ B;  4ZKC B;  1K8M A;  1R4P B;  1R9T B;  4CKE A;  2AUJ D;  1B3A A;  5T1I A;  1SEB D;  4CHT B;  3HOV B;  1AP0 A;  2J7Z A;  2E2D C;  5DM6 3;  3HOZ B;  1H9R A;  4MHE A;  2BA1 A;  3V96 A;  2EY5 A;  2I07 B;  4ZUJ A;  2WAC A;  3S16 B;  2BA0 A;  2L4N A;  1DOL A;  3H6M A;  2FJ2 A;  2F0V A;  4FP5 D;  4K6D A;  4X3S A;  1IYU A;  4A3F B;  4EQP A;  3IAY A;  2RSN A;  4GZY C;  1DON A;  3Q22 A;  3K5M A;  3V05 A;  4C3H G;  3I4N B;  3GTP B;  1DM0 B;  2EY6 A;  1HFG A;  4LJZ C;  3K59 A;  5CV9 A;  2EYO A;  1CI3 M;  1RKN A;  2EXZ A;  2EE1 A;  5FK9 C;  2B39 A;  3C1F A;  5ELF A;  1LTB D;  2WIN B;  4BWG B;  4DNR B;  4F87 A;  4KV6 A;  3K7A B;  3DEP A;  1B50 A;  5CV5 A;  3PUZ A;  2A68 D;  5AFW A;  3I73 A;  1PYW D;  2PZU A;  2IL8 A;  3J80 L;  1EFI D;  2AWO A;  4DGZ A;  5A35 A;  5JJZ A;  1HUN A;  2QDB A;  5JVG 3;  3A8J E;  1LAC A;  2XNA C;  5D3I B;  2E2I B;  1JIC A;  3EFX D;  1PFN A;  1SNC A;  4DA2 A;  1STB A;  1I4P A;  1B2T A;  4PNY A;  3R8B A;  2O4X A;  3T53 B;  2F0G A;  2FMC A;  3N6R A;  2SDF A;  5JEA G;  4A3E B;  1Y8P B;  3Q24 A;  3FEW X;  4A3I B;  4OIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...