4DR4L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4L00
1IBML 1VQ4A 4GNXB 4O0AA 1B70B 3HOVG 1FJGL 1G291 2ID0A 1IYJB 4C3HH 2JE6I 4X62L 1E1OA 1A8VA 2PQAB 3S2DH 1HR0L 1YVCA 3FP9A 1Q12A 3M85A 4GS3A 1I50H 3UDFA 1YHBA 3CMAA 2IHEA 4UP8A 4C3JH 1BVSA 3T1YL 1I3QH 3KDFB 5IWAL 2IX0A 1GVPA 3CP0A 4AYBE 1YITA 4POGA 2CKZB 3UDIA 5IP7H 4IPHA 2R92G 3A5UA 1N34Q 2UXBL 2UXDQ 1EWIA 1YIJA 4DR5L 3MXNB 4DR2L 3UE0A 1L1OA 2R7FA 3W1BA 4KI0A 5FLMG 4X6AH 1VQCA 1QUQA 2QEXA 5FJ8H 3GTGH 1KXLA 2K5HA 3G4SA 1YHAA 1V9PA 1N33L 4BY7H 2LXKA 1LM0A 5JJKA 4JBWA 4HIDA 3BJUA 4NXNQ 1X6OA 4BXXH 1JE5A 1VQGA 1Z9FA 2YU9H 1WYDA 1WFQA 1Y1VG 1IL2A 5JEAJ 2I5HA 3RN2A 2F52A 4JI1Q 2KENA 3CPWA 4JI7L 1D7QA 4UP9A 1HR0W 1H95A 1G6PA 1L1OC 4A3DH 3U4VA 2E5LQ 4J15A 3D31A 4UP7A 5IP9G 4YY3L 2Q2UA 3PF4A 4KHPL 1VQNA 2MO1A 2IY5B 4LNQA 1EIYB 3OTOQ 1PVOA 3AFPA 4AH6A 2ZTEA 5M3MG 4LF6Q 4JG2A 5GROA 4DV3L 1X3EA 3HOZG 4QQBX 2PI2A 5IYBG 4A3FG 4LF5L 2OQKA 5IYCG 3GTQH 2UUAQ 3S14H 3NELA 1KIXA 2WB1G 3CCRA 2AWNA 3DM3A 4A93H 3BZKA 3HOXH 3K7AH 3PUVA 1N36Q 1JB7A 4LF9Q 3Q8DA 4A3GH 4LFBQ 2N49A 4DV7L 2D0PA 3NENA 4DUYL 2N8NA 3CCSA 1RIPA 4HJ8A 2VL6A 1EQQA 1WI5A 4QY7A 4DR6L 4GKJQ 4NXML 2ZTDA 3HOUG 4DR4Q 4A3IH 3J81i 4DV0L 4OWWB 1OXSC 1XNRQ 3PF5A 1J5EL 3GTOH 1U0LA 2OTJA 3CMEA 1FJGQ 1RL2A 4DV6L 1N8RC 1K9MC 1HR0Q 3I4MG 5ELNA 2NN6G 4JBKA 2JA7G 3F2BA 2VS1A 4AIMA 3J81j 5JEAG 3T1YQ 2GVBA 5IY0A 5IWAQ 1QZHA 3I4NH 4A3JH 3ERSX 5LMNQ 3RNUA 2JA6G 2WAQE 2E8GA 4PZ7A 2IHFA 3CCQA 2V1CC 1C7YA 4AYBG 3KDFA 3W5OA 3A74A 3RZOH 3TRZA 2UXBQ 3J7ZC 1PHJA 1U5KA 4DR5Q 3TREA 4IOCA 1CKMA 1EUJA 4P74A 2VW9A 1VS0A 2MQHA 3CC4A 3BZCA 3K0XA 3EN2A 1HH2P 1OXUA 2E2IH 1EOVA 1B7YB 2GVAA 2VZAA 3A0JA 3VDYA 2R92H 2H5XA 1NJIC 2VUMG 2HIXA 2IX1A 1N33Q 4DR1L 3IRBA 4Y52H 5LMUL 3RLNA 1TXYA 3I55A 2K5VA 4LFCQ 1Y1WG 4IPDA 1E24A 4YCVA 4JI7Q 2HQLA 4DNIA 1XMQL 5C0XJ 5IYDH 2A8VA 4JI6L 4JI3L 3TS0A 3PO2G 4JYAL 2ZM6L 2PNHA 2LXJA 2R7DA 4KHPQ 1EYGA 1VQ5A 1FGUA 1VQ6A 5J3BA 3DLLA 3CCUA 1SLJA 4L5QA 1Y1VH 1MJEA 4JI5L 4OXPA 1N32L 2ES2A 4X65L 3AYHB 4DV4L 3AFQA 3H3VI 5C3EG 4KLKA 1GKHA 1HZ9A 5HGQA 3BU2A 5M5YH 1X9NA 4OO1I 5JJIA 1I94L 3HKSA 3HFZB 4PMWA 5BR8L 2UUCL 3ULLA 3KJPA 2RF4A 4OONA 4R4TA 5IP9H 5HY6A 5GAEC 1Q8KA 4OO1G 4DV7Q 3S17H 1SR3A 4A3CH 1X3FA 2YYZA 4DR7L 3E9HA 4DUYQ 1E3PA 4RG1A 2EIFA 4LF8Q 1IXRA 3HOZH 2CWAA 4B3TL 5IYBH 4A3FH 5M3FH 1HNWL 5EAYA 5IYCH 4DV2L 3OW2A 3CC2A 1PFSA 4K0KL 1JJCB 1YJWA 1UWVA 4L5SA 4JI0Q 1VQBA 4UPAA 1Y14B 4DR3L 1J5EQ 1IBLL 1XNQQ 3K7UC 3GTPH 4BY1G 2AMCB 1XPUA 3FHWA 4P75A 1NY4A 1VQDA 1WCMG 4DV6Q 3S1RH 4IPCA 3JAMc 2OQ0A 3FKIH 1G51A 4OWXB 1KL9A 2A1AA 4A3LH 1SE8A 2NVQH 2JJQA 3KYHC 3U50C 2GN5A 3W1GA 1TWHH 4LFAL 2CWPA 4DV1L 4QGUA 5C0XG 2QGQA 3T1HL 2F4VQ 1VQLA 2K4KA 5AJ3Q 3J80c 2B29A 4JI2L 4A3KH 2BA1A 2JA5H 4A3MG 1JT8A 1NMGA 2WAQG 2VNUD 4YWKA 2E2HH 1EQRA 3ZJYC 1AH9A 3K81C 1PH1A 2WFWA 2ASBA 2JA7H 1S72A 4QJFA 4HIOA 4DAYB 2KHJA 3F2CA 2JA8H 1PYBA 4L5TA 4IOAA 2KHIA 2JA6H 3MEFA 1SROA 1YNXA 1VQ9A 2AWOA 2RHQB 1UE5A 3E9IA 4DR1Q 3I4OA 1GM5A 3I7FA 1FL0A 5LMUQ 4HJ7A 4AQYQ 4MNOA 2NVTH 3M4OH 1BBUA 1K8GA 4LF7Q 2VQEL 1KQSA 1XMQQ 1YEZA 3PSIA 4JI6Q 4GN3B 4PG3A 3PIOA 5IT9c 4RMFA 4R4CA 2OWOA 2ZM6Q 2B63G 2R7ZG 1YHQA 4YWMA 4LW1A 1UE6A 2LSSA 4JI4L 1K83H 3CCMA 4DK3C 2CQOA 1XPOA 4JI5Q 2AHOB 1P8LA 4C3IH 4X65Q 3CF5A 5E7NA 4O2DA 1CKNA 3S2HH 4OX9Q 4APVA 1FVIA 1VCIA 2R6GA 2UUCQ 1SN8A 4BA2I 4JV5Q 4P72A 1PA6A 2K50A 4P73A 2UU9L 4A3BH 1YZ6A 2E2JH 2FXQA 3ULJA 1VQHA 1IBMQ 1EFWA 4X66L 2I5LX 3GTLH 3KFUA 1PH2A 4DR7Q 2NN6I 1OXVA 4X62Q 2WP8J 2YTVA 3CCVA 1HNWQ 2Q2HA 4DV2Q 4GNXA 1PH6A 2Z6KA 1KD1C 2UUBL 2ZJQA 3KJOA 4HJAA 3PUWA 4YHHL 2BA0A 2DGYA 2PQAA 2N78A 4GLAC 3H3VH 4BBSG 3UDXA 3UDGA 1IBKL 3CW2C 4JOIA 1VQMA 3HOVH 1JJGA 2ATWA 1VQIA 1PH7A 3PGZA 2ALYB 3AEVA 1A62A 1E1TA 2I5MX 3PCOB 1UE7A 3CAMA 4DR2Q 2VQFL 2NZHA 3E0EA 3T1HQ 1XTDA 2L15A 1PV4A 3L0OA 1N34L 4BY7G 2JQOA 2K75A 4DPGA 4GNXC 1QZGA 2Z6KC 4BY1H 3H0GG 4BXXG 1J6QA 3ICEA 1UEBA 4JCVE 4DV5L 4LWCA 4IFDJ 2R93G 1BBWA 4Y7NH 1TWFH 1WCMH 1OTCA 1HZCA 1TWAH 3OYYA 3GDEA 2OTLA 1XMOL 1KAWA 3S24A 3S1MH 1AE3A 1HNXL 4JOIC 1YI2A 4HIKA 1UE1A 5FLMH 4A3DG 4QIWE 4LUZA 1X3GA 2Y0SE 2NVXH 4NXNL 4A3MH 1SFOH 4YY3Q 2N3SA 1I6HH 1LYLA 4LUOA 4GLVB 2ZJPA 1X65A 1QVFA 1KHIA 3PO3G 1T9HA 1VQFA 4JI1L 3G6EA 2VQEQ 4DV3Q 1JMCA 3CXCA 4B3SL 4LF5Q 4UY8C 2K14A 3NEMA 3HOXG 1WJJA 2C35B 3KF6B 3H15A 5GADC 5M5WH 3JAMi 1MKHA 3OTOL 3ULPA 1R9TH 1HZAA 4WJ4A 1VQ7A 4JI4Q 1HNZL 1NBWA 1Q81C 1VQOA 3HKZE 5M3MH 1S40A 2UUAL 4NPSA 3J80i 1LUZA 2EQSA 2JA9A 2DUDA 4DR6Q 2XTIA 2OCEA 3K8AA 4NXMQ 3U58A 5JJLA 3F1ZA 2PMZE 4IFDI 1N36L 4LFBL 4DV0Q 2D0OA 2F3IA 2R7ZH 3HOWG 3A5ZB 2BH2A 4IFDG 2NVYH 2CFMA 1V1QA 5GQOA 4TQUS 3CCEA 4GOPB 2HT1A 2UXCL 4DK6C 2UUBQ 5FLXc 5C0XI 4DR4L 4GLXA 4YHHQ 3CCLA 4FDBA 1QVGA 1D8LA 3HOUH 2D62A 2HIVA 1IBKQ 2CCZA 5DLQE 4JBMA 3RR5A 2KCTA 5C44G 3NBHB 4BA1I 4B3ML 4A3EG 4A75A 1KRSA 4JI8L 4DAMA 1M1KC 3HOYG 3I4MH 1W3SA 2VQFQ 4GKKL 5LMNL 1X54A 4ALPA 4ME3A 4JBJA 4BBRG 2XGTA 5GAHC 4IJHA 5K36G 2RCNA 4BBSH 4DV5Q 1Q7YC 3D0FA 3ER0A 4A4IA 4X64L 4HJ5A 1NMFA 3I2ZA 4XTCS 1CSQA 1VQ8A 3EIVA 1P16A 1XMOQ 5IYDG 5GAGC 1HNXQ 4B3RL 1TWGH 2NZOA 3PIPA 3GTMH 1VQJA 1PH5A 3CQZH 4IJLA 2ZJRA 1Q82C 4JI3Q 4JYAQ 1VQKA 2VUMH 3GO5A 3H0GH 2ZTCA 3S16H 3KF8B 2R93H 2Y0SG 4XIGS 4DKAC 1XPRA 2HHHL 4LFCL 4POFA 3GTKH 4IPGA 1K3RA 3M3YH 2VY3A 2MO0A 4PZ8A 5C4XG 4R4QA 1Y1WH 3S1QH 4B3SQ 1N32Q 1I5FA 3TEHB 4DV4Q 1KRTA 1O7IA 1GO3E 2Q2TA 1CUKA 1XJVA 3PV0A 3PO2H 1I94Q 4YCWA 4LUVA 3S1NH 5BR8Q 5LMNW 4A3CG 4EX5A 1IZ6A 4LF4L 1YJ9A 3KF6A 1PH9A 5H1SE 1MIUA 4TVAB 3PUYA 1HNZQ 1OXTA 1X56A 5M3FG 3PO3H 3S15H 3CC7A 1N9WA 4GN5A 4DUZL 4JC0A 4B3TQ 3CPFA 3HKZG 4K0KQ 3UE1A 1NE3A 4EQ5A 5C3EH 1OXXK 1SRUA 3JC66 4R4IA 5IP7G 4DR3Q 1IBLQ 4L5RC 3STBD 4OWTB 3M7NA 4NB3A 1KC8C 4LF8L 3FKIG 4C2MH 1PH8A 2YTXA 1K73C 3AQQA 1Q1BA 1B8AA 4P71A 1Q86C 4A3LG 2JEBI 4GN4B 2UXCQ 1C9OA 4PZ6A 2EXDA 4R4OA 4QL5A 1X55A 4JI0L 1MJCA 1W2BA 4R1JA 3M4QA 3RLOA 4GOPA 1GD7A 1PH3A 2K52A 1XNQL 1C0AA 2YV5A 4LFAQ 4A3KG 5FJ8G 4DV1Q 2JA5G 4WJ3M 1L2FA 1V43A 3U4ZA 3HOWH 1A0IA 3M4PA 2BH8A 4JI2Q 2UXDL 1L1OB 2KCMA 4B3MQ 1PH4A 1BKBA 3G48A 1SMXA 4JI8Q 1WOCA 3TQYA 1QUQB 1QVCA 2JA8G 2Q2IA 4GKKQ 2I0QA 4HJ9A 2F4VL 5AJ3L 1HZBA 1A63A 3WWVA 3L7ZC 4MTNA 1VQPA 1K8AC 2QA4A 1ASZA 2B3GA 3SGIA 1ASYA 1HJPA 4X64Q 5C44H 3J81c 4HIMA 4GOPC 2KBNA 1L0WA 3CD6A 1NTGA 4A3EH 3CCJA 4A76A 1S3OA 3HOYH 4B3RQ 1E22A 2RHSB 4BBRH 3RLFA 1LTLA 2YTYA 4A93G 5IE8A 2K5NA 3M9BA 4IO9A 1CSPA 2PI2E 1K0RA 2E5LL 3RN5A 4A3GG 2JK8A 5C4JH 4AQYL 1YBYA 1VQAA 2HHHQ 4YWLA 4LF6L 4LF7L 3J7A5 3TS2A 1DGSA 3EBEA 3GTJH 2WB1E 2JEAI 2IT1A 1AE2A 3PUXA 3KOJA 1Z47A 2MNAA 4A3IG 1EIFA 1M90C 2MFIA 3RZDH 4A3BG 3STBC 1PYSB 3LGJA 4KHZA 4LF9L 1VQEA 1Q46A 3F2DA 1TWCH 2UU9Q 4LF4Q 2Z0SA 2B63H 3K80C 1CKNB 5M5XH 3F8TA 3PUZA 4X66Q 3G71A 2A19A 1E7ZA 3I56A 4YCUA 4DUZQ 5C4XH 4GKJL 3KLWA 4OX9L 3GD7A 5ELOA 2AKWB 1Q1EA 3L2PA 3I4NG 1CKOA 1YJNA 4JV5L 4A3JG 1XNRL 4MZ9A 4H02A 1JJ2A 3B6YA
chains in the Genus database with same CATH superfamily
1ZYRD 4N8FA 4O0AA 1LABA 2DY7A 4X62L 1CA5A 1BUVT 1HCZA 1U4LA 2JA7B 2K05A 3I70A 3UDFA 2HQEA 3P20A 1PZJD 4UP8A 4C3JH 3CMAA 1BVSA 5IWAL 3BVGA 1HQMC 1GVPA 3CP0A 3UDIA 2UXBL 3L3OC 1YIJA 3M4OB 3I90A 3MXNB 1TWGB 4FP5D 4NKLA 3UE0A 3W1BA 3N6RA 1I6VC 5I9OA 5FLMG 4K5WA 1H9KA 1VQCA 2WIIB 1QUQA 5FJ8H 3GTGH 2R93B 4JPBW 3GTKB 4BY7H 2LXKA 1LM0A 3NQIA 5JAVA 4HIDA 3BJUA 5JJKA 1X6OA 4DXFA 1CA6A 1Z9FA 1F2MA 4C3IB 2K5WA 4DU9A 4JVZA 3SEBA 3RN2A 4JI1Q 1D7QA 3LX0A 4M1UB 1XYIA 1L1OC 2EDGA 4KHPL 5IP9G 4YY3L 2KCCA 3K5MA 4LNQA 3OTOQ 1PVOA 5GROA 2XNAC 1X3EA 2WV6D 5IIFA 3HOZG 3S14H 1ET6A 3NELA 1KIXA 4A93H 1ZYRC 3K7AH 2N49A 4N9PA 2HCIA 1D1KA 5KEEA 2N8NA 4HJ8A 2VL6A 4NXML 1FYCA 2BDOA 4OWWB 1XNRQ 1B9NA 1OXSC 5EBCA 3GTOH 1J5EL 5J39A 3VR5A 3F2UA 1GXDC 1BCPB 1HR0Q 3I4MG 5KNCA 1EYCA 2FJ2A 5ELNA 1TT2A 2B2VC 4N9TA 4IALA 2V1CC 2L55A 4AYBG 4HMIA 1PHJA 4K6DA 3HOYB 4IOCA 2CH4W 4FNFA 4P74A 2VW9A 4L6TB 2MQHA 3CC4A 1B53A 3EN2A 1HH2P 2Z4IA 2GVAA 3A0JA 1QCBD 2VUMG 5C4JB 2IX1A 1RCVD 1DCZA 4G7ZC 1TXYA 1JC7A 3A7LA 5I6YA 5C0XJ 5CV5A 1GUWA 3A55A 3K59A 2K6AA 2LXJA 2JSOA 1VQ5A 4X3TA 1WD0A 5JPNC 4PMBA 3CCUA 3C3LA 2LFNA 5CV7A 4OXPA 1PZKD 2EXZA 5M5YH 1I94L 3HKSA 1NAPA 4PMWA 5BR8L 5IP9H 1LTID 4LK1C 1SR3A 4DV7Q 1E3PA 1MI2A 3SK6A 1IXRA 3HOZH 1JOQA 5M3FH 2RCFA 1RD9D 1CZWA 4J8QA 1YJWA 3E6ZX 4L5SA 4UPAA 3SR1A 2EPBA 1IBLL 4U68A 1CK1A 3NHHA 4RHSA 2QCPX 2SEBD 1IKLA 5D65A 2OQ0A 3FKIH 3G7LA 4OWXB 4ILWA 2EYMA 2JJQA 2GN5A 4KY6A 4LFAL 3OHXC 1U4RA 4DV1L 5C0XG 2H4OA 1VQLA 2K4KA 5AJ3Q 4JI2L 2HCCA 4DAVA 2WAQG 4IUQA 2F0VA 2RQXA 1AH9A 3QO2A 1V8QA 3K81C 4IUTA 1S5CD 4QMGA 2WFWA 1ENFA 1STEA 4HIOA 4DAYB 1SNMA 1SNQA 1K8MA 1F9SA 1O7ZA 2FMCA 5EKKA 3A8JE 3PMFA 2AWOA 2RHQB 1HUMA 4DR1Q 4KKUA 1FL0A 2XWJB 4MNOA 5E4WC 3TP7A 1KDBA 4JI6Q 3TMEA 2EY2A 5IT9c 2OWOA 2OXPA 2Q8RE 2R7ZG 1Q8IA 2O4XA 1K83H 1XPOA 2CQOA 4JI5Q 3CF5A 2MJ8A 3R93A 1CKNA 1KAAA 2UUCQ 1NSNS 1NR4A 2OF1A 2K50A 5FK9C 1SMYD 4A3BH 2M9VA 3HG9A 2FXQA 3KFUA 1IBMQ 3GTLH 2D5DA 2I5LX 1PH2A 2L12A 3FEWX 4DV2Q 1KD1C 4GNXA 2ZJQA 2Z6KA 4YHHL 3BDLA 2EY1A 4BBSG 3W3AA 1IBKL 2B2WC 3TZDA 1YNJC 2F4IA 1VQMA 3HOVH 4KHVA 1VQIA 2ATWA 1Y69U 1E1TA 4DR2Q 3CAMA 3E0EA 1PV4A 1VF7A 3T16A 1AN8A 5A2QL 1QZGA 1QE6A 4HSVA 1J6QA 4DV5L 4JCVE 4IFDJ 4LWCA 1ILQA 1TS3A 4K8JA 1ENCA 1KAWA 3S24A 2NZ1D 3W2DA 1O7LA 1WVLA 4K6LA 1KDCA 4A3DG 1X3GA 5FO8B 1RHPA 2Y0SB 4CGYB 1Y1VB 1BCPD 1LT5D 4GLVB 1AFPA 1QVFA 1KHIA 2VQEQ 2K32A 1LACA 5JOBA 1ML0D 1SMYC 5GADC 3JAMi 1DYQA 1MSHA 4RWSC 1VQ7A 1RODA 3I3CA 1NBWA 1VQOA 2QF7A 1S40A 5EKIA 5FLXE 3J80i 1LUZA 2EQSA 2JA9A 4KJNA 4EQNA 4DR6Q 3K8AA 3U58A 5HGTA 1N36L 1SDFA 3R8BA 2PMZB 2Z9HA 2R7ZH 1HFNA 3A5ZB 3E3XA 1QG7A 1JWUD 4IFDG 2DY8A 2NVYH 5GQOA 5FKAC 2PZTA 2R61A 2UUBQ 2J0TD 5C0XI 3H94A 4RHRA 2CCZA 4JBMA 1IKMA 2RSOA 1KRSA 3NE5B 5CC4A 3KLRA 2JA8B 3ND8A 2A69C 1W3SA 2VQFQ 4ZRZA 5LMNL 2M2LA 5K36G 3CU7A 4BBSH 3VR3A 3GP7A 1BCPC 4XTCS 4MTKA 1BQQT 2EJMA 3PIPA 3NQTA 3DWAA 3M4YA 4KY7A 4KJOA 3Q6SA 1Q82C 2H1EA 3KF8B 4V0BA 1ESRA 1IL8A 2HHHL 3M3YH 2KHSA 3MAQA 4PZ8A 3NTIA 1N32Q 5KNBA 4B3SQ 1I5FA 2E2JB 3PV0A 4DN4M 4LUVA 4A3CG 4RCOA 1HA5A 1C4QA 1IZ6A 2DJGC 1YJ9A 1X56A 4IQZA 4DUZL 4XQQA 4JC0A 3J7YW 3UE1A 4EQ5A 5C3EH 1OXXK 1SRUA 5IP7G 3NK9A 3R2TA 2M00A 1SYDA 4NB3A 1PH8A 4P71A 4A3LG 2UXCQ 4GN4B 4R4OA 4HTHA 4JI0L 4H13C 1GUNA 1XNQL 2IX3A 2JA5G 4WJ3M 1V43A 1WCMB 1MGSA 3M4PA 1A0IA 1EY7A 5J22A 2UXDL 1L1OB 1TWAB 2KCMA 4IFDH 5C3WA 1BKBA 1TS4A 1PXUA 3HRZC 1WOCA 4F8MA 5ELFA 3IFTA 4H0LC 4FXGC 2NVXB 4A3MB 3L7ZC 4MTNA 2OEOA 1K8AC 2E74C 1ASYA 4X64Q 4GOPC 1L0WA 2RDHA 1SYGA 1S3OA 3KBXA 4XQJA 4FXDA 5K36H 2E5LL 4A3GG 3BG3A 3ND9A 4AQYL 3BZDB 1GHKA 4YWLA 4LF6L 3VR4A 2A6HD 1DGSA 1H9RA 1RTOA 3EBEA 4A3FB 1PDQA 1AE2A 2QILA 4A3IG 1M90C 4IUUA 1EY6A 5CV9A 4IURA 3RZDH 1IW7D 3F2DA 2UU9Q 2B63H 4TSSA 2G5DA 5M5XH 2Z4HA 1EFID 3PUZA 3Q24A 1BBXC 5IGEA 3KLWA 4OX9L 3GD7A 3QOJA 3L2PA 4JV5L 1H9JA 4A3JG 1AP0A 2JXMB 2F0JA 3VA7A 1STBA 4KKTA 1FJGL 3ONAB 4C3HH 1IYJB 2F0QA 5EPJA 2PQAB 3IKJA 3OIPA 4DAPA 3S2DH 3FP9A 1EY0A 2IHEA 1RDPD 4NDXA 1JJGA 3KDFB 2IX0A 2X6GA 4AYBE 2LS01 1VF5C 5IP7H 3K5NA 3NPPA 1N34Q 5JPMC 2KECA 1EWIA 1ZXTA 3GTMB 2R7FA 4KI0A 2RDGA 5T1IA 5DNFA 3S16B 4HCSA 5KYLA 1KXLA 2K5HA 1ESFA 1YHAA 1N33L 1TQOA 4BXXH 4NXNQ 2A6HC 5CR3A 1Y1WB 3S1QB 3P1HA 2I5HA 4EGVA 4ID6A 2F52A 4JI7L 4UP9A 2CHBD 3PO2B 1HR0W 3U9SA 1D1IA 1IW7C 1F9QA 3A7AB 4R9WA 3D31A 5E4XA 3A56A 3PF4A 3PO3B 3S15B 1KDAA 5M3MG 2Z6BA 4DV3L 4LF5L 4CJ1B 5C4HA 3CCRA 2AWNA 2Q8TA 3BZKA 2XVSA 3HOXH 4A3GH 4LF9Q 1JB7A 4LFBQ 3Q8DA 1XTCD 1J8IA 3BVZA 4DUYL 3CCSA 4QY7A 1WTHA 1XX8A 2ZTDA 1B44D 2NYZD 3HOUG 4DR4Q 4A3IH 1GUTA 3J81i 3HOWB 4B9XA 1U0LA 2RDFA 1RL2A 3MZ5A 2G9HD 4DV6L 1QJOA 1N8RC 1HXYD 5IGCA 2JA7G 1AEXA 4AIMA 5IWAQ 4A3JH 2JA6G 3RNUA 2WAQE 4EVOA 2IHFA 2UXBQ 3RZOH 3A74A 2B2YA 4ZCKA 4A3EB 1CKMA 1VS0A 3BZCA 1LTGD 1OXUA 1EOVA 3TP6A 2H5XA 1NJIC 2HIXA 1STNA 4DNTB 3GTJB 4OGQC 4R8NA 5LMUL 1SJHD 5D3DA 2F0PA 2K5VA 1G2SA 4C3IG 1E24A 1SE2A 5IYDH 4ZUJA 4JI3L 4JYAL 2ZM6L 4KHPQ 1SLJA 1CQFA 4P2CB 4L5QA 1MJEA 1Q90A 1V1OA 3DWPA 4DV4L 3H3VI 1GKHA 4ABNA 4OO1I 5JJIA 1HFGA 3HFZB 3ULLA 5GAEC 4R4TA 5HY6A 4FYDA 3S17H 4K5VA 3MHBA 4C3JB 2CWAA 1HNWL 3OW2A 1IHZA 1L0XB 2KEEA 4DXGA 1J5EQ 1UUPA 3GTPH 3FHWA 1VQDA 3S1RH 2XSCA 3JAMc 1D2BA 4ZKBB 3QJYA 2A1AA 4KKSA 3SK4A 5CMDA 3KYHC 3U50C 3W1GA 3GTGB 1T5XD 2CWPA 3BYTB 4EQPA 4BY7B 1EEFD 3J80c 4A3KH 4E6IA 4L8JA 1I4GA 4WRDA 2E2HH 3SHLA 1PH1A 2B2TC 3LNNA 5IGFA 1S72A 2JA7H 1JWSD 2BE5D 3F2CA 5CV4A 1PYBA 2L1BA 3NWTA 4L5TA 2JA6H 3E9IA 2DNEA 1O80A 4I7AA 5I2YA 5IOCA 1L0YB 3I7FA 3Q0AA 3M4OH 5A2QE 1QWYA 2NVTH 2VXWA 1K8GA 1EU3A 2I46A 4GN3B 5FO9B 4MN3A 3K7AB 4R4CA 4C1NK 1Y8NB 2XIWA 4XDXA 1YHQA 4NW2A 4H7BA 4KD3A 3D6CA 4DK3C 3DEPA 1SJED 2AHOB 4C3IH 4CHTB 4O2DA 2MP1A 3GTOB 3S2HH 1R4QB 4RFBA 1SN8A 4BA2I 4P72A 1HTPA 4P73A 1EZ8A 1JICA 1LTSD 1E2ZA 4X66L 4X3KA 1DOLA 1OXVA 1WTWA 2RA4A 3GV3A 2YTVA 2Q2HA 4HJAA 1ONLA 1F9RA 2BA0A 2DGYA 3UDXA 4JOIA 1R4PB 5IT9L 2ALYB 5IGDA 1A62A 2I5MX 2BE5C 1DXMA 2K5QA 4U673 3H0GG 3ICEA 4Y7NH 1TWFH 1HZCA 3T13A 3OYYA 3GDEA 1Q3LA 1PTOH 1XMOL 1GUOA 2OTLA 1HNXL 1SEBD 5FLMH 2PCFB 4QIWB 1M4VA 1EYDA 4QCLA 5COYA 3IFDA 1JOKA 1LYLA 1X65A 1ZEQX 4JI1L 5M5YB 4UY8C 2K14A 4N8X1 4CDEC 3OWFA 2NBFA 3KF6B 3H15A 5M5WH 2TMPA 3OTOL 1R9TH 3HOZB 1KNEA 5CYUA 1O78A 4WJ4A 5M3FB 1AZPA 3C1FA 3HKZB 3SK8A 4RGMA 3F1ZA 4DV0Q 1CHQD 2VB2X 3FKIB 1UAPA 4TQUS 4GOPB 4I7ZC 1ILPA 4K2KA 3V2TA 5BN5A 4GLXA 4YHHQ 4FDBA 2RSNA 4F87A 1IBKQ 3H6MA 1BXTA 5C44G 2KCTA 1EQTA 4OELB 3NBHB 4B3ML 2TSSA 3I8ZA 4A75A 3D4WA 4JI8L 4DAMA 1YNJD 3OWEB 3P75A 3KLSX 3I4MH 4G7HC 4GKKL 2KA7A 2PQEA 4CJ2C 4ALPA 4BBRG 4C56C 1MBYA 4NP5A 5CBAE 4DV5Q 3D0FA 1NMFA 2K33A 5L37A 1VQ8A 3EIVA 3VYSA 5GAGC 4B3RL 4IN3A 3CQZH 1S5BD 2ZJRA 1VQKA 2SOBA 3H0GH 5C6AA 2ZTCA 2VUMH 1K83B 2JP1A 2Y0SG 1XPRA 1SE4A 4POFA 1DZ1A 3H91A 3DMUA 2PNRC 5C4XG 1D5ZC 1EIGA 1TS5A 3MC0B 2Q2TA 4A3BB 4XT1B 3TN2A 1NCVA 3GTLB 3S1NH 5H1SE 1MIUA 1G2TA 4F7XA 3NTHA 3GQBA 3TSSA 4GN5A 4B3TQ 3CPFA 4K0KQ 3EFXD 4DR3Q 1KNAA 2L4NA 3HOVB 3ITPA 3G6JB 4C2MH 5IODA 2YTXA 1CHPD 2ZXPA 3AQQA 3I73A 1Q1BA 1JOOA 2EXDA 4QL5A 1X55A 4R1JA 3M4QA 1STAA 1C0AA 2CVRA 4UHVA 2EVBA 1L2FA 2EE1A 2E75C 1QOHA 1QILA 2B2UC 1PH4A 3G48A 1SMXA 3TQYA 1CTMA 1FR3A 2JA8G 4PNYA 4LJZC 2I0QA 1S5FD 4JK1C 5AJ3L 1HZBA 1H9SB 2A69D 3WWVA 4XYOA 5C0XH 1VQPA 1ASZA 2KOLA 1HJPA 3D4RA 5C44H 3J81c 2KBNA 2KQ3A 3CCJA 2LKVA 3TP8A 2F0FA 4ZK9B 1E22A 1WTVA 1PRTD 4BBRH 4RGOS 2YTYA 1ICWA 4IO9A 3M9BA 2EYHA 1F77A 3RN5A 4CKEA 4Q5VA 1YBYA 1VQAA 2HHHQ 3A54A 2EYOA 3TS2A 3KF8A 2JEAI 2MNAA 3KOJA 1TIID 2R7ZB 1LTRD 3CHBD 2EYLA 3UI2A 1PYSB 1S5ED 5I9PA 1VQEA 1Q46A 4O1NA 1X3PA 1TWCH 2NVYB 2Z0SA 3FMCA 1CKNB 1DOKA 2JN4A 3F8TA 3G71A 3I56A 1G91A 5BN4A 4YCUA 4DUZQ 2NVQB 5C4XH 4GKJL 2VB3X 5ELOA 5KGUA 1Q1EA 3I4NG 2F0KA 2B8GA 5DM63 4H02A 3PSIA 1IBML 1VQ4A 1II3A 4GNXB 3MVVA 1G291 2JE6I 3IL8A 1I50H 3TP5A 4V190 3T1YL 1I3QH 4POGA 1YITA 2PPBC 4K14A 4BBSB 2CKZB 2R92G 4FF2A 4TRDA 2K01A 2UXDQ 4XXEA 4GZYC 4DR5L 1K3BC 4DR2L 1L1OA 3FVQA 1PRTC 4X6AH 5F2DA 4ZUIA 1FD7D 4ZYSA 4HSPA 3M3YB 4JBWA 3BS1A 1JE5A 3QR8A 1VQGA 3S9WA 1WYDA 1WFQA 2YU9H 1AZQA 4K2LA 5JEAJ 3D3RA 3CPWA 2KENA 2F0SA 1E2WA 1JR0D 4A3DH 3U4VA 1PTOC 2E5LQ 4J15A 4UP7A 2Q2UA 2NWGA 2D2CC 2GA4B 3QWNA 3AFPA 4LF6Q 2J7ZA 2ZTEA 1PLFA 4QQBX 2EY5A 2L11A 2PI2A 4DF7A 4A3FG 5C3EB 5IYCG 3GTQH 2UUAQ 2WB1G 3DM3A 1LLRD 3MA2B 1YNNC 2K04A 3DWQA 5EPKA 3MFYA 3NUCA 2B2VA 1RIPA 4FO2A 2F0LA 1EQQA 1WI5A 4DR6L 3EQLC 5DAUA 5G3LF 5M9OA 2FMMA 3L9AX 3R2IA 1X32A 1FJGQ 1K9MC 1STHA 4JBKA 1FNVA 1HQRD 1NUCA 3F2BA 4KMUC 1HA6A 3J81j 5JEAG 3I4NH 2GVBA 5IY0A 2F0NA 5ELBA 2CH4A 2F03A 3AU7A 1C7YA 2R3ZA 3CCQA 5ELDA 3KDFA 3W5OA 3TRZA 2C9OA 1WTOA 3TREA 1EUJA 1CI3M 4K8IA 2KEDA 2PW5A 1O7YA 3SDZA 2E2IH 2SNSA 3KK7A 4KK7A 3VDYA 2R92H 1PRTF 2K03A 2RVLA 1N33Q 3IRBA 3QG1A 3RLNA 3KBGA 4LFCQ 1Y1WG 2IW3A 4JI7Q 1XMQL 2NTTA 3RZDB 2A8VA 3PO2G 2B63B 2HUGA 2R7DA 1EYGA 5M5XB 1PTOF 3I91A 1JB3A 2F0WA 1N32L 2ES2A 4X65L 3N52A 3AYHB 5CBEE 2RBMA 1HZ9A 1B2TA 3C2PA 4IUPA 4C3HB 3KJPA 1I4PA 4OO1G 3S2DB 4A3CH 4CJ0B 4DR7L 4DUYQ 4RG1A 3E0JA 2EIFA 4LF8Q 3BDCA 4DFAA 3DM1A 4A3FH 1NNXA 4YIJA 5IYCH 1UWVA 1SYFA 3OPOA 4BY1G 1XPUA 2AQ2B 4KV6A 4P75A 1NY4A 4DV6Q 3VYRA 1TU2B 1KL9A 2A68D 4B08A 4A3LH 4DNRB 1EL0A 1EWCA 1TWHH 5LL6X 3T1HL 1KLGD 2F4VQ 2PW7A 3FDTA 2B29A 4K5XA 2BA1A 2JA5H 1A6XA 1JT8A 2DJFC 2VNUD 4YWKA 1LO5D 4R8IA 1BOSA 4IOAA 1FNWA 5IT9E 4BS9A 3AMUA 3MEFA 1SYBA 1YNXA 3J7AV 1UE5A 1Z6HA 3KLSA 2L5TA 4X3UA 1B50A 1HRJA 5LMUQ 1BBUA 3FRPB 4LF7Q 1YEZA 4PG3A 1TS2A 3HOXB 4A3GB 4FVMA 1IYVA 2ZM6Q 3JAML 4LW1A 2LSSA 4JI4L 2XWBB 3CCMA 2Z8LA 1F2YA 3J80L 2F0MA 4A3IB 2B2WA 3MXPA 5ELEA 2KUMA 4APVA 5DM73 1FVIA 2IJ0A 1EY5A 1XXGA 2UU9L 1YZ6A 3ULJA 2BDNA 1VQHA 4S3SA 4QF4A 2A68C 4X62Q 2WP8J 1EEID 2EYPA 3CCVA 1HNWQ 4C3JG 5C4ZA 1PH6A 4A3JB 1GUSA 3KJOA 1A2UA 1GHJA 2A6ED 3RZOB 3H3VH 3UDGA 4OO1H 3CW2C 1CT1D 1Y8PB 3PGZA 2FFKB 3PCOB 1QNUA 1TR5A 3MXNA 1XTDA 3L0OA 1N34L 4BY7G 4DPGA 4GNXC 2Z6KC 3I72A 4BY1H 1ZKOA 2R93G 3BDOA 5C3XA 5ELCA 3S1MH 1AE3A 2KJXA 4OL7A 1UE1A 2Y0SE 3I4LA 1DM0B 4NXNL 1JCKB 1SFOH 4YY3Q 3EVQA 1I6HH 2A73B 2ZJPA 3Q22A 1VQFA 1B1ZA 3PIO3 3CXCA 4ZKCB 1ENAA 1B3QA 1E2VA 1WJJA 2C35B 3S17B 5EKLA 4IUVA 3LWEA 4ZAIA 4ZLTF 5C5MA 1MKHA 1TKWB 1HZAA 1HNZL 1X3QA 5M3MH 1GJXA 4NPSA 1FNUA 1S5DD 5KRUA 3IAYA 3WOEA 2A6EC 4NXMQ 3GTPB 1LTTD 2AUKA 2PMZE 4I65A 4LFBL 2F1MA 2D0OA 2F3IA 1LT6D 3O13A 1V1QA 5BN3A 2HT1A 5FLXc 4DR4L 1K28A 4OIJA 1I4RA 4A3KB 2A74C 3CCLA 3HOUH 2HIVA 2E2HB 1VMPA 3MEHA 2MUYA 4FF4A 4BA1I 2O5IC 3K6OA 1M1KC 4NMZA 3WOFA 3HOYG 2JA6B 4PQXA 2XGTA 5GAHC 4IJHA 4RKBA 1A3UA 3ER0A 4A4IA 4HJ5A 2NVTB 4WJWA 1CSQA 2F3WA 4XT3B 4DGZA 1P16A 1XMOQ 3S14B 1HNXQ 1TWGH 3T56B 2NZOA 1PFMA 2O5JC 1VQJA 2ENBA 2ZT9C 2WKDA 3T53B 3VR6A 4A93B 4IJLA 4Q0FA 3GV6A 3Q23A 4H44C 2WINB 2R93H 1JORA 4B9WA 1V1PB 3GTKH 2E76C 1LV9A 3SK5A 3S2HB 1DOMA 2EZVA 2BCOA 4R4QA 1KRTA 1GO3E 2PZUA 1XJVA 2NTSA 1I94Q 4YCWA 5BR8Q 3ERQA 5LMNW 4EX5A 4LF4L 3KF6A 3VYTA 1OXTA 4JW0A 1K8OA 5M3FG 3CC7A 1N9WA 3HKZG 1NE3A 4R4IA 1KABA 1PRTB 1IBLQ 4L5RC 1I4HA 4OWTB 1KC8C 3FKIG 1A3TA 3M7GA 1QB5D 1UEAB 1H9MA 2IPKD 2JEBI 1C9OA 4PZ6A 3NSWA 4GOPA 1GD7A 3X3MA 1Y8OB 2YV5A 4LFAQ 4DV1Q 4CKBA 1TWFB 4Y7NB 4EQOA 4JI2Q 3HP3A 1PTOB 4B3MQ 4JI8Q 1QUQB 1QVCA 3NBHA 5KYIA 2Q2IA 1D5XC 4LAAA 4GKKQ 4HJ9A 2L9HA 3K0YA 1A63A 4HN7A 3FPUB 3DUZA 3D6WA 3TBIB 2QA4A 2B3GA 4DAYA 3CD6A 2EJGC 1NTGA 1IYUA 3HOYH 4FXKC 4B3RQ 2WKCA 1SXTA 2RHSB 5EPLA 1LTLA 1F2ZA 5M5WB 1R9TB 1CSPA 1DD2A 2PI2E 3PQIA 5C4JH 2HD3A 2CW0D 5FOBB 3J7A5 4HAEA 3D8GA 2WB1E 3BYYB 1STGA 4CKCA 5FO7B 1Z47A 2EY6A 3CRKC 3QOLA 1C48A 4A3BG 1SNOA 1HHVA 3X3NA 5J1ZA 3K80C 2F0UA 2A19A 1E7ZA 1RF2D 3FPPA 3J81L 4G4KA 1CKOA 1G6ZA 3A8IE 2K1BA 2MGSA 4MZ9A 1XNRL 3MFGA 3LWUA 1JJ2A 4HEDA 5EQ0A 1B70B 3HOVG 2ID0A 2X6LA 3SVMA 3T51B 5JVH3 1E1OA 2JYOA 1A8VA 3I4MB 2QW7A 1HR0L 1YVCA 4XYQA 1Q12A 3M85A 4GS3A 1FGBD 3ZYYX 1YHBA 3RUZA 3RD4A 4IPHA 4AYBB 4G7OC 2I07B 3A5UA 2QKIC 1HPCA 4LMQD 4HCEA 3SXHA 1VDZA 4KN7C 5IGBA 1TVXA 4OIKA 1PYWD 1QNKA 2Z1CA 1SYCA 3H3VC 3CQZB 3A8KE 3E5SA 3DEOA 3BVMA 2MHVA 2VUMB 3H0GB 2QEXA 2QEJC 1B9MA 5KIXA 3G4SA 1V9PA 1H9SA 2HDLA 2CW0C 4IUNA 1IL2A 3EROA 1Y1VG 2HDMA 1LTAD 5D3IB 2EOTA 3S1NB 1H95A 1G6PA 2F0OA 1MHWC 5CGKA 4KN4C 1VQNA 2MO1A 1GOZA 2IY5B 1EIYB 1A3VA 4AH6A 2O2LD 5CV8A 3MXGA 2N55A 4JG2A 2AQ1B 5IYBG 2OQKA 1T5EA 3NP8A 5ISRA 4HMJA 3MWYW 3PUVA 4C2MB 3TDQA 1N36Q 3C46A 4DV7L 3J7AF 1M8AA 2D0PA 3NENA 1LT4D 4FF1A 4GKJQ 2A5HA 5G3LD 2D9UA 1BO0A 3CRLC 1SE3A 4DV0L 3PF5A 4KY5A 2EJFC 3CMEA 2OTJA 2BOSA 4X3SA 4KTAA 3MTSA 2NN6G 2IWHA 1CM9A 2VS1A 1BDOA 5DEHA 1QZHA 3T1YQ 1WD1A 3V96A 2DNCA 3ERSX 5LMNQ 5C44B 2E8GA 2J4XA 4PZ7A 1CZGA 2WAQB 4ULLA 1E0BA 3J7ZC 1U5KA 4DR5Q 5CV6A 4M8AA 2V4DA 4XQNA 1PMRA 3K0XA 4BBRB 1F9PA 4FF3A 1LT3D 1B7YB 2VZAA 1KTKA 4DR1L 4OEMB 1SNCA 4Y52H 3VA5A 4F88A 3RMHA 3I55A 1B4OA 3HEJA 1JE4A 1EU4A 2B2YC 4IPDA 2G9DA 2PYKA 4YCVA 2HQLA 4DNIA 1SNDA 4JI6L 5AFWA 3TS0A 1CQVA 1TWCB 2PNHA 2SNMA 4RKLA 1FGUA 1VQ6A 4KD4A 3NWSA 1G8ZD 5J3BA 3DLLA 1PTOD 5C4XB 1Y1VH 4JI5L 3AFQA 5C3EG 4KLKA 5HGQA 4RA8A 3BU2A 1X9NA 5C5LA 4J1MA 2UUCL 4CDFC 2RF4A 4OONA 1Q8KA 2F0TA 4CBVA 1YNND 1X3FA 2YYZA 2Q8IB 3E9HA 1I50B 3JAME 4B3TL 2LY7A 5IYBH 1I3QB 5EAYA 4DV2L 1KLUD 3CC2A 3EJIA 1PFSA 4K0KL 1JJCB 5E3FA 4JI0Q 1VQBA 1Y14B 1SSOA 4DR3L 3J80E 1XNQQ 2K7VA 1DJRD 3K7UC 5EJWA 2B2TA 2AMCB 1VMCA 1WTPA 1WCMG 4IPCA 4QUFA 1G51A 2EYFA 4BWGB 1SE8A 2NVQH 2CQAA 1EY8A 4QGUA 2QGQA 1SNPA 4TKOB 5I6WA 2EYJA 2F0EA 1NMGA 4ME5A 4A3MG 2YU9B 1EQRA 3ZJYC 5I4DA 2NN6H 4O42A 1TY2A 2ASBA 5IGGA 4QJFA 5EBDA 4A3DB 2KHJA 2JA8H 4Z9CB 1EYAA 2KHIA 1SROA 1VQ9A 2N88A 3V05A 3K57A 1SBBB 2ICEC 3I4OA 1GM5A 5K5PA 1EY9A 4HJ7A 4AQYQ 3GTQB 5KNDA 2VQEL 3VYUA 1KQSA 1XMQQ 4ZQ3A 1STYA 2FHTA 4RMFA 1U4PA 3PIOA 2K28A 5HURA 2NUCA 2B63G 4YWMA 1D6EC 1UE6A 3D4DA 2PZWA 2XRSD 1ET9A 2RKSA 1P8LA 4G57A 4X65Q 5E7NA 2KVMA 1LTBD 4OX9Q 1K0SA 1VCIA 2R6GA 4JV5Q 4ODGA 4RH6A 1PA6A 4C3HG 2E2JH 2XRQD 2L0CA 1WTRA 1EFWA 4DR7Q 1MSGA 2NN6I 3I4NB 2UUBL 1SAPA 4QB4A 3PUWA 4MHEA 2PQAA 4GLAC 2N78A 4PMCA 1EOTA 1S4ZA 3OIQA 1PH7A 2E2IB 3AEVA 3K58A 5D14A 1B3AA 1UE7A 2VQFL 2NZHA 3OW7A 2R92B 3T1HQ 2L15A 3HZXA 2JQOA 2K75A 4BXXG 1UEBA 3OSOA 1BBWA 1OO9B 1WCMH 1OTCA 1UNSA 1J9OA 1RKNA 1TWAH 5JJZA 4JOIC 1I4XA 1YI2A 4HIKA 4QIWE 4UAIA 4J6HA 4LUZA 3K5LA 2C5CA 1F2LA 2NVXH 4A3MH 2KCNA 1HUNA 1BCPF 2N3SA 4RGTA 4LUOA 1I4QA 3PO3G 1T9HA 3G6EA 1D5MC 4DV3Q 1JMCA 4B3SL 4LF5Q 2ICIA 3NEMA 3HOXG 2P5ZX 3TZUA 3ULPA 4JI4Q 3WDNA 1A15A 3NTKA 1Q81C 2UUAL 1AW7A 2WB1B 3HKZE 2DUDA 2F0DA 2OCEA 2PO4A 2XTIA 1C8CA 5JJLA 4IFDI 4RAUC 1BR9A 3HOWG 2BH2A 3DXJC 3CCEA 2CFMA 4IZ8A 2UXCL 1TWHB 2B8FA 4DK6C 2X69A 1PFBA 5EGTA 1BNZA 4DA2A 3DHQA 3U9OA 1QVGA 1D8LA 2JA5B 3EA6A 2D62A 5DLQE 3RR5A 4A3EG 1GUGA 2ZXOA 4DK0A 1X54A 2E2DC 2B39A 4ME3A 4JBJA 2AUJD 5JEAH 2RCNA 1JWMD 1U9RA 1Q7YC 4X64L 3I2ZA 3KUPA 1MD2D 5IYDG 1EZ6A 4RGNA 2FINB 3GTMH 1PH5A 3QB3A 3CKIB 3P7JA 4JI3Q 4JYAQ 3R3OA 3GO5A 5NUCA 3S16H 5FLXL 2QDLA 3MXUA 4XIGS 4DKAC 4LFCL 4IPGA 1K3RA 4WORA 2VY3A 2MO0A 3NXWA 1Y1WH 3S1QH 3AB9A 3TEHB 4DV4Q 3OOCA 1O7IA 2DN8A 1CUKA 2QDBA 2F3VA 1PZID 4CDDC 3PO2H 3C1EA 5CORA 1U4MA 1PH9A 4TVAB 4PV1C 3PUYA 1CFMA 1HNZQ 2F0HA 3PO3H 3S15H 4QUCA 2IL8A 1EIHA 2B2UA 3JC66 1Z7TA 2WACA 1W6JA 3STBD 3M7NA 4RCNA 4LF8L 1K73C 1B8AA 1Q86C 2NB0A 2OT2A 2K5DA 3OMCA 2F0GA 3OMGA 1EY4A 1MJCA 1W2BA 1WTXA 3RLOA 1PH3A 1RJTA 2K52A 4BY1B 4A3KG 2MPMA 5FJ8G 1HTLD 3U4ZA 3HOWH 2BH8A 3J81E 5T1GA 1XWEA 3SE0A 4L63B 3S1MB 1ICFB 1SYEA 4WFN3 2F4VL 5JVG3 1PFNA 1SFOB 3URYA 1I6HB 3QIAA 3NBIA 1EQVA 3SGIA 3T4AC 4HIMA 1W6KA 4CDCC 4UDUC 5A35A 1TY0A 4DK1A 4A3EH 4A76A 2SDFA 3PIP3 1DONA 5I2XA 3RLFA 4A93G 5IE8A 2K5NA 2LMCB 1K0RA 2JK8A 3H09A 4MIUA 2ZXRA 5LHY1 5M3MB 4LF7L 3GTJH 3K5OA 1V1PA 2IT1A 3PUXA 5E1FA 2AQ3B 1EIFA 1JQYD 2MFIA 5TSSA 3HS0C 3STBC 3HGBA 3LGJA 4KHZA 1EWHA 1BF4A 4LF9L 4LF4Q 4OHJA 3S1RB 1WTQA 1RTNA 4X66Q 4HR7B 3VR2A 2XN9C 4C1NI 1NR2A 3HOUB 2AKWB 1YJNA 2F0IA 5LL6S 1A2TA 3B6YA
chains in the Genus database with same CATH topology
1IBML 1VQ4A 4GNXB 4O0AA 1B70B 3HOVG 1FJGL 1G291 2ID0A 1IYJB 4C3HH 2JE6I 4X62L 1E1OA 1A8VA 2PQAB 3S2DH 1HR0L 1YVCA 3FP9A 1Q12A 3M85A 4GS3A 1I50H 3UDFA 1YHBA 3CMAA 2IHEA 4UP8A 4C3JH 1BVSA 3T1YL 1I3QH 3KDFB 5IWAL 2IX0A 1GVPA 3CP0A 4AYBE 1YITA 4POGA 2CKZB 3UDIA 5IP7H 4IPHA 2R92G 3A5UA 1N34Q 2UXBL 2UXDQ 1EWIA 1YIJA 4DR5L 3MXNB 4DR2L 3UE0A 1L1OA 2R7FA 3W1BA 4KI0A 5FLMG 4X6AH 1VQCA 1QUQA 2QEXA 5FJ8H 3GTGH 1KXLA 2K5HA 3G4SA 1YHAA 1V9PA 1N33L 4BY7H 2LXKA 1LM0A 5JJKA 4JBWA 4HIDA 3BJUA 4NXNQ 1X6OA 4BXXH 1JE5A 1VQGA 1Z9FA 2YU9H 1WYDA 1WFQA 1Y1VG 1IL2A 5JEAJ 2I5HA 3RN2A 2F52A 4JI1Q 2KENA 3CPWA 4JI7L 1D7QA 4UP9A 1HR0W 1H95A 1G6PA 1L1OC 4A3DH 3U4VA 2E5LQ 4J15A 3D31A 4UP7A 5IP9G 4YY3L 2Q2UA 3PF4A 4KHPL 1VQNA 2MO1A 2IY5B 4LNQA 1EIYB 3OTOQ 1PVOA 3AFPA 4AH6A 2ZTEA 5M3MG 4LF6Q 4JG2A 5GROA 4DV3L 1X3EA 3HOZG 4QQBX 2PI2A 5IYBG 4A3FG 4LF5L 2OQKA 5IYCG 3GTQH 2UUAQ 3S14H 3NELA 1KIXA 2WB1G 3CCRA 2AWNA 3DM3A 4A93H 3BZKA 3HOXH 3K7AH 3PUVA 1N36Q 1JB7A 4LF9Q 3Q8DA 4A3GH 4LFBQ 2N49A 4DV7L 2D0PA 3NENA 4DUYL 2N8NA 3CCSA 1RIPA 4HJ8A 2VL6A 1EQQA 1WI5A 4QY7A 4DR6L 4GKJQ 4NXML 2ZTDA 3HOUG 4DR4Q 4A3IH 3J81i 4DV0L 4OWWB 1OXSC 1XNRQ 3PF5A 1J5EL 3GTOH 1U0LA 2OTJA 3CMEA 1FJGQ 1RL2A 4DV6L 1N8RC 1K9MC 1HR0Q 3I4MG 5ELNA 2NN6G 4JBKA 2JA7G 3F2BA 2VS1A 4AIMA 3J81j 5JEAG 3T1YQ 2GVBA 5IY0A 5IWAQ 1QZHA 3I4NH 4A3JH 3ERSX 5LMNQ 3RNUA 2JA6G 2WAQE 2E8GA 4PZ7A 2IHFA 3CCQA 2V1CC 1C7YA 4AYBG 3KDFA 3W5OA 3A74A 3RZOH 3TRZA 2UXBQ 3J7ZC 1PHJA 1U5KA 4DR5Q 3TREA 4IOCA 1CKMA 1EUJA 4P74A 2VW9A 1VS0A 2MQHA 3CC4A 3BZCA 3K0XA 3EN2A 1HH2P 1OXUA 2E2IH 1EOVA 1B7YB 2GVAA 2VZAA 3A0JA 3VDYA 2R92H 2H5XA 1NJIC 2VUMG 2HIXA 2IX1A 1N33Q 4DR1L 3IRBA 4Y52H 5LMUL 3RLNA 1TXYA 3I55A 2K5VA 4LFCQ 1Y1WG 4IPDA 1E24A 4YCVA 4JI7Q 2HQLA 4DNIA 1XMQL 5C0XJ 5IYDH 2A8VA 4JI6L 4JI3L 3TS0A 3PO2G 4JYAL 2ZM6L 2PNHA 2LXJA 2R7DA 4KHPQ 1EYGA 1VQ5A 1FGUA 1VQ6A 5J3BA 3DLLA 3CCUA 1SLJA 4L5QA 1Y1VH 1MJEA 4JI5L 4OXPA 1N32L 2ES2A 4X65L 3AYHB 4DV4L 3AFQA 3H3VI 5C3EG 4KLKA 1GKHA 1HZ9A 5HGQA 3BU2A 5M5YH 1X9NA 4OO1I 5JJIA 1I94L 3HKSA 3HFZB 4PMWA 5BR8L 2UUCL 3ULLA 3KJPA 2RF4A 4OONA 4R4TA 5IP9H 5HY6A 5GAEC 1Q8KA 4OO1G 4DV7Q 3S17H 1SR3A 4A3CH 1X3FA 2YYZA 4DR7L 3E9HA 4DUYQ 1E3PA 4RG1A 2EIFA 4LF8Q 1IXRA 3HOZH 2CWAA 4B3TL 5IYBH 4A3FH 5M3FH 1HNWL 5EAYA 5IYCH 4DV2L 3OW2A 3CC2A 1PFSA 4K0KL 1JJCB 1YJWA 1UWVA 4L5SA 4JI0Q 1VQBA 4UPAA 1Y14B 4DR3L 1J5EQ 1IBLL 1XNQQ 3K7UC 3GTPH 4BY1G 2AMCB 1XPUA 3FHWA 4P75A 1NY4A 1VQDA 1WCMG 4DV6Q 3S1RH 4IPCA 3JAMc 2OQ0A 3FKIH 1G51A 4OWXB 1KL9A 2A1AA 4A3LH 1SE8A 2NVQH 2JJQA 3KYHC 3U50C 2GN5A 3W1GA 1TWHH 4LFAL 2CWPA 4DV1L 4QGUA 5C0XG 2QGQA 3T1HL 2F4VQ 1VQLA 2K4KA 5AJ3Q 3J80c 2B29A 4JI2L 4A3KH 2BA1A 2JA5H 4A3MG 1JT8A 1NMGA 2WAQG 2VNUD 4YWKA 2E2HH 1EQRA 3ZJYC 1AH9A 3K81C 1PH1A 2WFWA 2ASBA 2JA7H 1S72A 4QJFA 4HIOA 4DAYB 2KHJA 3F2CA 2JA8H 1PYBA 4L5TA 4IOAA 2KHIA 2JA6H 3MEFA 1SROA 1YNXA 1VQ9A 2AWOA 2RHQB 1UE5A 3E9IA 4DR1Q 3I4OA 1GM5A 3I7FA 1FL0A 5LMUQ 4HJ7A 4AQYQ 4MNOA 2NVTH 3M4OH 1BBUA 1K8GA 4LF7Q 2VQEL 1KQSA 1XMQQ 1YEZA 3PSIA 4JI6Q 4GN3B 4PG3A 3PIOA 5IT9c 4RMFA 4R4CA 2OWOA 2ZM6Q 2B63G 2R7ZG 1YHQA 4YWMA 4LW1A 1UE6A 2LSSA 4JI4L 1K83H 3CCMA 4DK3C 2CQOA 1XPOA 4JI5Q 2AHOB 1P8LA 4C3IH 4X65Q 3CF5A 5E7NA 4O2DA 1CKNA 3S2HH 4OX9Q 4APVA 1FVIA 1VCIA 2R6GA 2UUCQ 1SN8A 4BA2I 4JV5Q 4P72A 1PA6A 2K50A 4P73A 2UU9L 4A3BH 1YZ6A 2E2JH 2FXQA 3ULJA 1VQHA 1IBMQ 1EFWA 4X66L 2I5LX 3GTLH 3KFUA 1PH2A 4DR7Q 2NN6I 1OXVA 4X62Q 2WP8J 2YTVA 3CCVA 1HNWQ 2Q2HA 4DV2Q 4GNXA 1PH6A 2Z6KA 1KD1C 2UUBL 2ZJQA 3KJOA 4HJAA 3PUWA 4YHHL 2BA0A 2DGYA 2PQAA 2N78A 4GLAC 3H3VH 4BBSG 3UDXA 3UDGA 1IBKL 3CW2C 4JOIA 1VQMA 3HOVH 1JJGA 2ATWA 1VQIA 1PH7A 3PGZA 2ALYB 3AEVA 1A62A 1E1TA 2I5MX 3PCOB 1UE7A 3CAMA 4DR2Q 2VQFL 2NZHA 3E0EA 3T1HQ 1XTDA 2L15A 1PV4A 3L0OA 1N34L 4BY7G 2JQOA 2K75A 4DPGA 4GNXC 1QZGA 2Z6KC 4BY1H 3H0GG 4BXXG 1J6QA 3ICEA 1UEBA 4JCVE 4DV5L 4LWCA 4IFDJ 2R93G 1BBWA 4Y7NH 1TWFH 1WCMH 1OTCA 1HZCA 1TWAH 3OYYA 3GDEA 2OTLA 1XMOL 1KAWA 3S24A 3S1MH 1AE3A 1HNXL 4JOIC 1YI2A 4HIKA 1UE1A 5FLMH 4A3DG 4QIWE 4LUZA 1X3GA 2Y0SE 2NVXH 4NXNL 4A3MH 1SFOH 4YY3Q 2N3SA 1I6HH 1LYLA 4LUOA 4GLVB 2ZJPA 1X65A 1QVFA 1KHIA 3PO3G 1T9HA 1VQFA 4JI1L 3G6EA 2VQEQ 4DV3Q 1JMCA 3CXCA 4B3SL 4LF5Q 4UY8C 2K14A 3NEMA 3HOXG 1WJJA 2C35B 3KF6B 3H15A 5GADC 5M5WH 3JAMi 1MKHA 3OTOL 3ULPA 1R9TH 1HZAA 4WJ4A 1VQ7A 4JI4Q 1HNZL 1NBWA 1Q81C 1VQOA 3HKZE 5M3MH 1S40A 2UUAL 4NPSA 3J80i 1LUZA 2EQSA 2JA9A 2DUDA 4DR6Q 2XTIA 2OCEA 3K8AA 4NXMQ 3U58A 5JJLA 3F1ZA 2PMZE 4IFDI 1N36L 4LFBL 4DV0Q 2D0OA 2F3IA 2R7ZH 3HOWG 3A5ZB 2BH2A 4IFDG 2NVYH 2CFMA 1V1QA 5GQOA 4TQUS 3CCEA 4GOPB 2HT1A 2UXCL 4DK6C 2UUBQ 5FLXc 5C0XI 4DR4L 4GLXA 4YHHQ 3CCLA 4FDBA 1QVGA 1D8LA 3HOUH 2D62A 2HIVA 1IBKQ 2CCZA 5DLQE 4JBMA 3RR5A 2KCTA 5C44G 3NBHB 4BA1I 4B3ML 4A3EG 4A75A 1KRSA 4JI8L 4DAMA 1M1KC 3HOYG 3I4MH 1W3SA 2VQFQ 4GKKL 5LMNL 1X54A 4ALPA 4ME3A 4JBJA 4BBRG 2XGTA 5GAHC 4IJHA 5K36G 2RCNA 4BBSH 4DV5Q 1Q7YC 3D0FA 3ER0A 4A4IA 4X64L 4HJ5A 1NMFA 3I2ZA 4XTCS 1CSQA 1VQ8A 3EIVA 1P16A 1XMOQ 5IYDG 5GAGC 1HNXQ 4B3RL 1TWGH 2NZOA 3PIPA 3GTMH 1VQJA 1PH5A 3CQZH 4IJLA 2ZJRA 1Q82C 4JI3Q 4JYAQ 1VQKA 2VUMH 3GO5A 3H0GH 2ZTCA 3S16H 3KF8B 2R93H 2Y0SG 4XIGS 4DKAC 1XPRA 2HHHL 4LFCL 4POFA 3GTKH 4IPGA 1K3RA 3M3YH 2VY3A 2MO0A 4PZ8A 5C4XG 4R4QA 1Y1WH 3S1QH 4B3SQ 1N32Q 1I5FA 3TEHB 4DV4Q 1KRTA 1O7IA 1GO3E 2Q2TA 1CUKA 1XJVA 3PV0A 3PO2H 1I94Q 4YCWA 4LUVA 3S1NH 5BR8Q 5LMNW 4A3CG 4EX5A 1IZ6A 4LF4L 1YJ9A 3KF6A 1PH9A 5H1SE 1MIUA 4TVAB 3PUYA 1HNZQ 1OXTA 1X56A 5M3FG 3PO3H 3S15H 3CC7A 1N9WA 4GN5A 4DUZL 4JC0A 4B3TQ 3CPFA 3HKZG 4K0KQ 3UE1A 1NE3A 4EQ5A 5C3EH 1OXXK 1SRUA 3JC66 4R4IA 5IP7G 4DR3Q 1IBLQ 4L5RC 3STBD 4OWTB 3M7NA 4NB3A 1KC8C 4LF8L 3FKIG 4C2MH 1PH8A 2YTXA 1K73C 3AQQA 1Q1BA 1B8AA 4P71A 1Q86C 4A3LG 2JEBI 4GN4B 2UXCQ 1C9OA 4PZ6A 2EXDA 4R4OA 4QL5A 1X55A 4JI0L 1MJCA 1W2BA 4R1JA 3M4QA 3RLOA 4GOPA 1GD7A 1PH3A 2K52A 1XNQL 1C0AA 2YV5A 4LFAQ 4A3KG 5FJ8G 4DV1Q 2JA5G 4WJ3M 1L2FA 1V43A 3U4ZA 3HOWH 1A0IA 3M4PA 2BH8A 4JI2Q 2UXDL 1L1OB 2KCMA 4B3MQ 1PH4A 1BKBA 3G48A 1SMXA 4JI8Q 1WOCA 3TQYA 1QUQB 1QVCA 2JA8G 2Q2IA 4GKKQ 2I0QA 4HJ9A 2F4VL 5AJ3L 1HZBA 1A63A 3WWVA 3L7ZC 4MTNA 1VQPA 1K8AC 2QA4A 1ASZA 2B3GA 3SGIA 1ASYA 1HJPA 4X64Q 5C44H 3J81c 4HIMA 4GOPC 2KBNA 1L0WA 3CD6A 1NTGA 4A3EH 3CCJA 4A76A 1S3OA 3HOYH 4B3RQ 1E22A 2RHSB 4BBRH 3RLFA 1LTLA 2YTYA 4A93G 5IE8A 2K5NA 3M9BA 4IO9A 1CSPA 2PI2E 1K0RA 2E5LL 3RN5A 4A3GG 2JK8A 5C4JH 4AQYL 1YBYA 1VQAA 2HHHQ 4YWLA 4LF6L 4LF7L 3J7A5 3TS2A 1DGSA 3EBEA 3GTJH 2WB1E 2JEAI 2IT1A 1AE2A 3PUXA 3KOJA 1Z47A 2MNAA 4A3IG 1EIFA 1M90C 2MFIA 3RZDH 4A3BG 3STBC 1PYSB 3LGJA 4KHZA 4LF9L 1VQEA 1Q46A 3F2DA 1TWCH 2UU9Q 4LF4Q 2Z0SA 2B63H 3K80C 1CKNB 5M5XH 3F8TA 3PUZA 4X66Q 3G71A 2A19A 1E7ZA 3I56A 4YCUA 4DUZQ 5C4XH 4GKJL 3KLWA 4OX9L 3GD7A 5ELOA 2AKWB 1Q1EA 3L2PA 3I4NG 1CKOA 1YJNA 4JV5L 4A3JG 1XNRL 4MZ9A 4H02A 1JJ2A 3B6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM L;  1VQ4 A;  4GNX B;  4O0A A;  1B70 B;  3HOV G;  1FJG L;  1G29 1;  2ID0 A;  1IYJ B;  4C3H H;  2JE6 I;  4X62 L;  1E1O A;  1A8V A;  2PQA B;  3S2D H;  1HR0 L;  1YVC A;  3FP9 A;  1Q12 A;  3M85 A;  4GS3 A;  1I50 H;  3UDF A;  1YHB A;  3CMA A;  2IHE A;  4UP8 A;  4C3J H;  1BVS A;  3T1Y L;  1I3Q H;  3KDF B;  5IWA L;  2IX0 A;  1GVP A;  3CP0 A;  4AYB E;  1YIT A;  4POG A;  2CKZ B;  3UDI A;  5IP7 H;  4IPH A;  2R92 G;  3A5U A;  1N34 Q;  2UXB L;  2UXD Q;  1EWI A;  1YIJ A;  4DR5 L;  3MXN B;  4DR2 L;  3UE0 A;  1L1O A;  2R7F A;  3W1B A;  4KI0 A;  5FLM G;  4X6A H;  1VQC A;  1QUQ A;  2QEX A;  5FJ8 H;  3GTG H;  1KXL A;  2K5H A;  3G4S A;  1YHA A;  1V9P A;  1N33 L;  4BY7 H;  2LXK A;  1LM0 A;  5JJK A;  4JBW A;  4HID A;  3BJU A;  4NXN Q;  1X6O A;  4BXX H;  1JE5 A;  1VQG A;  1Z9F A;  2YU9 H;  1WYD A;  1WFQ A;  1Y1V G;  1IL2 A;  5JEA J;  2I5H A;  3RN2 A;  2F52 A;  4JI1 Q;  2KEN A;  3CPW A;  4JI7 L;  1D7Q A;  4UP9 A;  1HR0 W;  1H95 A;  1G6P A;  1L1O C;  4A3D H;  3U4V A;  2E5L Q;  4J15 A;  3D31 A;  4UP7 A;  5IP9 G;  4YY3 L;  2Q2U A;  3PF4 A;  4KHP L;  1VQN A;  2MO1 A;  2IY5 B;  4LNQ A;  1EIY B;  3OTO Q;  1PVO A;  3AFP A;  4AH6 A;  2ZTE A;  5M3M G;  4LF6 Q;  4JG2 A;  5GRO A;  4DV3 L;  1X3E A;  3HOZ G;  4QQB X;  2PI2 A;  5IYB G;  4A3F G;  4LF5 L;  2OQK A;  5IYC G;  3GTQ H;  2UUA Q;  3S14 H;  3NEL A;  1KIX A;  2WB1 G;  3CCR A;  2AWN A;  3DM3 A;  4A93 H;  3BZK A;  3HOX H;  3K7A H;  3PUV A;  1N36 Q;  1JB7 A;  4LF9 Q;  3Q8D A;  4A3G H;  4LFB Q;  2N49 A;  4DV7 L;  2D0P A;  3NEN A;  4DUY L;  2N8N A;  3CCS A;  1RIP A;  4HJ8 A;  2VL6 A;  1EQQ A;  1WI5 A;  4QY7 A;  4DR6 L;  4GKJ Q;  4NXM L;  2ZTD A;  3HOU G;  4DR4 Q;  4A3I H;  3J81 i;  4DV0 L;  4OWW B;  1OXS C;  1XNR Q;  3PF5 A;  1J5E L;  3GTO H;  1U0L A;  2OTJ A;  3CME A;  1FJG Q;  1RL2 A;  4DV6 L;  1N8R C;  1K9M C;  1HR0 Q;  3I4M G;  5ELN A;  2NN6 G;  4JBK A;  2JA7 G;  3F2B A;  2VS1 A;  4AIM A;  3J81 j;  5JEA G;  3T1Y Q;  2GVB A;  5IY0 A;  5IWA Q;  1QZH A;  3I4N H;  4A3J H;  3ERS X;  5LMN Q;  3RNU A;  2JA6 G;  2WAQ E;  2E8G A;  4PZ7 A;  2IHF A;  3CCQ A;  2V1C C;  1C7Y A;  4AYB G;  3KDF A;  3W5O A;  3A74 A;  3RZO H;  3TRZ A;  2UXB Q;  3J7Z C;  1PHJ A;  1U5K A;  4DR5 Q;  3TRE A;  4IOC A;  1CKM A;  1EUJ A;  4P74 A;  2VW9 A;  1VS0 A;  2MQH A;  3CC4 A;  3BZC A;  3K0X A;  3EN2 A;  1HH2 P;  1OXU A;  2E2I H;  1EOV A;  1B7Y B;  2GVA A;  2VZA A;  3A0J A;  3VDY A;  2R92 H;  2H5X A;  1NJI C;  2VUM G;  2HIX A;  2IX1 A;  1N33 Q;  4DR1 L;  3IRB A;  4Y52 H;  5LMU L;  3RLN A;  1TXY A;  3I55 A;  2K5V A;  4LFC Q;  1Y1W G;  4IPD A;  1E24 A;  4YCV A;  4JI7 Q;  2HQL A;  4DNI A;  1XMQ L;  5C0X J;  5IYD H;  2A8V A;  4JI6 L;  4JI3 L;  3TS0 A;  3PO2 G;  4JYA L;  2ZM6 L;  2PNH A;  2LXJ A;  2R7D A;  4KHP Q;  1EYG A;  1VQ5 A;  1FGU A;  1VQ6 A;  5J3B A;  3DLL A;  3CCU A;  1SLJ A;  4L5Q A;  1Y1V H;  1MJE A;  4JI5 L;  4OXP A;  1N32 L;  2ES2 A;  4X65 L;  3AYH B;  4DV4 L;  3AFQ A;  3H3V I;  5C3E G;  4KLK A;  1GKH A;  1HZ9 A;  5HGQ A;  3BU2 A;  5M5Y H;  1X9N A;  4OO1 I;  5JJI A;  1I94 L;  3HKS A;  3HFZ B;  4PMW A;  5BR8 L;  2UUC L;  3ULL A;  3KJP A;  2RF4 A;  4OON A;  4R4T A;  5IP9 H;  5HY6 A;  5GAE C;  1Q8K A;  4OO1 G;  4DV7 Q;  3S17 H;  1SR3 A;  4A3C H;  1X3F A;  2YYZ A;  4DR7 L;  3E9H A;  4DUY Q;  1E3P A;  4RG1 A;  2EIF A;  4LF8 Q;  1IXR A;  3HOZ H;  2CWA A;  4B3T L;  5IYB H;  4A3F H;  5M3F H;  1HNW L;  5EAY A;  5IYC H;  4DV2 L;  3OW2 A;  3CC2 A;  1PFS A;  4K0K L;  1JJC B;  1YJW A;  1UWV A;  4L5S A;  4JI0 Q;  1VQB A;  4UPA A;  1Y14 B;  4DR3 L;  1J5E Q;  1IBL L;  1XNQ Q;  3K7U C;  3GTP H;  4BY1 G;  2AMC B;  1XPU A;  3FHW A;  4P75 A;  1NY4 A;  1VQD A;  1WCM G;  4DV6 Q;  3S1R H;  4IPC A;  3JAM c;  2OQ0 A;  3FKI H;  1G51 A;  4OWX B;  1KL9 A;  2A1A A;  4A3L H;  1SE8 A;  2NVQ H;  2JJQ A;  3KYH C;  3U50 C;  2GN5 A;  3W1G A;  1TWH H;  4LFA L;  2CWP A;  4DV1 L;  4QGU A;  5C0X G;  2QGQ A;  3T1H L;  2F4V Q;  1VQL A;  2K4K A;  5AJ3 Q;  3J80 c;  2B29 A;  4JI2 L;  4A3K H;  2BA1 A;  2JA5 H;  4A3M G;  1JT8 A;  1NMG A;  2WAQ G;  2VNU D;  4YWK A;  2E2H H;  1EQR A;  3ZJY C;  1AH9 A;  3K81 C;  1PH1 A;  2WFW A;  2ASB A;  2JA7 H;  1S72 A;  4QJF A;  4HIO A;  4DAY B;  2KHJ A;  3F2C A;  2JA8 H;  1PYB A;  4L5T A;  4IOA A;  2KHI A;  2JA6 H;  3MEF A;  1SRO A;  1YNX A;  1VQ9 A;  2AWO A;  2RHQ B;  1UE5 A;  3E9I A;  4DR1 Q;  3I4O A;  1GM5 A;  3I7F A;  1FL0 A;  5LMU Q;  4HJ7 A;  4AQY Q;  4MNO A;  2NVT H;  3M4O H;  1BBU A;  1K8G A;  4LF7 Q;  2VQE L;  1KQS A;  1XMQ Q;  1YEZ A;  3PSI A;  4JI6 Q;  4GN3 B;  4PG3 A;  3PIO A;  5IT9 c;  4RMF A;  4R4C A;  2OWO A;  2ZM6 Q;  2B63 G;  2R7Z G;  1YHQ A;  4YWM A;  4LW1 A;  1UE6 A;  2LSS A;  4JI4 L;  1K83 H;  3CCM A;  4DK3 C;  2CQO A;  1XPO A;  4JI5 Q;  2AHO B;  1P8L A;  4C3I H;  4X65 Q;  3CF5 A;  5E7N A;  4O2D A;  1CKN A;  3S2H H;  4OX9 Q;  4APV A;  1FVI A;  1VCI A;  2R6G A;  2UUC Q;  1SN8 A;  4BA2 I;  4JV5 Q;  4P72 A;  1PA6 A;  2K50 A;  4P73 A;  2UU9 L;  4A3B H;  1YZ6 A;  2E2J H;  2FXQ A;  3ULJ A;  1VQH A;  1IBM Q;  1EFW A;  4X66 L;  2I5L X;  3GTL H;  3KFU A;  1PH2 A;  4DR7 Q;  2NN6 I;  1OXV A;  4X62 Q;  2WP8 J;  2YTV A;  3CCV A;  1HNW Q;  2Q2H A;  4DV2 Q;  4GNX A;  1PH6 A;  2Z6K A;  1KD1 C;  2UUB L;  2ZJQ A;  3KJO A;  4HJA A;  3PUW A;  4YHH L;  2BA0 A;  2DGY A;  2PQA A;  2N78 A;  4GLA C;  3H3V H;  4BBS G;  3UDX A;  3UDG A;  1IBK L;  3CW2 C;  4JOI A;  1VQM A;  3HOV H;  1JJG A;  2ATW A;  1VQI A;  1PH7 A;  3PGZ A;  2ALY B;  3AEV A;  1A62 A;  1E1T A;  2I5M X;  3PCO B;  1UE7 A;  3CAM A;  4DR2 Q;  2VQF L;  2NZH A;  3E0E A;  3T1H Q;  1XTD A;  2L15 A;  1PV4 A;  3L0O A;  1N34 L;  4BY7 G;  2JQO A;  2K75 A;  4DPG A;  4GNX C;  1QZG A;  2Z6K C;  4BY1 H;  3H0G G;  4BXX G;  1J6Q A;  3ICE A;  1UEB A;  4JCV E;  4DV5 L;  4LWC A;  4IFD J;  2R93 G;  1BBW A;  4Y7N H;  1TWF H;  1WCM H;  1OTC A;  1HZC A;  1TWA H;  3OYY A;  3GDE A;  2OTL A;  1XMO L;  1KAW A;  3S24 A;  3S1M H;  1AE3 A;  1HNX L;  4JOI C;  1YI2 A;  4HIK A;  1UE1 A;  5FLM H;  4A3D G;  4QIW E;  4LUZ A;  1X3G A;  2Y0S E;  2NVX H;  4NXN L;  4A3M H;  1SFO H;  4YY3 Q;  2N3S A;  1I6H H;  1LYL A;  4LUO A;  4GLV B;  2ZJP A;  1X65 A;  1QVF A;  1KHI A;  3PO3 G;  1T9H A;  1VQF A;  4JI1 L;  3G6E A;  2VQE Q;  4DV3 Q;  1JMC A;  3CXC A;  4B3S L;  4LF5 Q;  4UY8 C;  2K14 A;  3NEM A;  3HOX G;  1WJJ A;  2C35 B;  3KF6 B;  3H15 A;  5GAD C;  5M5W H;  3JAM i;  1MKH A;  3OTO L;  3ULP A;  1R9T H;  1HZA A;  4WJ4 A;  1VQ7 A;  4JI4 Q;  1HNZ L;  1NBW A;  1Q81 C;  1VQO A;  3HKZ E;  5M3M H;  1S40 A;  2UUA L;  4NPS A;  3J80 i;  1LUZ A;  2EQS A;  2JA9 A;  2DUD A;  4DR6 Q;  2XTI A;  2OCE A;  3K8A A;  4NXM Q;  3U58 A;  5JJL A;  3F1Z A;  2PMZ E;  4IFD I;  1N36 L;  4LFB L;  4DV0 Q;  2D0O A;  2F3I A;  2R7Z H;  3HOW G;  3A5Z B;  2BH2 A;  4IFD G;  2NVY H;  2CFM A;  1V1Q A;  5GQO A;  4TQU S;  3CCE A;  4GOP B;  2HT1 A;  2UXC L;  4DK6 C;  2UUB Q;  5FLX c;  5C0X I;  4DR4 L;  4GLX A;  4YHH Q;  3CCL A;  4FDB A;  1QVG A;  1D8L A;  3HOU H;  2D62 A;  2HIV A;  1IBK Q;  2CCZ A;  5DLQ E;  4JBM A;  3RR5 A;  2KCT A;  5C44 G;  3NBH B;  4BA1 I;  4B3M L;  4A3E G;  4A75 A;  1KRS A;  4JI8 L;  4DAM A;  1M1K C;  3HOY G;  3I4M H;  1W3S A;  2VQF Q;  4GKK L;  5LMN L;  1X54 A;  4ALP A;  4ME3 A;  4JBJ A;  4BBR G;  2XGT A;  5GAH C;  4IJH A;  5K36 G;  2RCN A;  4BBS H;  4DV5 Q;  1Q7Y C;  3D0F A;  3ER0 A;  4A4I A;  4X64 L;  4HJ5 A;  1NMF A;  3I2Z A;  4XTC S;  1CSQ A;  1VQ8 A;  3EIV A;  1P16 A;  1XMO Q;  5IYD G;  5GAG C;  1HNX Q;  4B3R L;  1TWG H;  2NZO A;  3PIP A;  3GTM H;  1VQJ A;  1PH5 A;  3CQZ H;  4IJL A;  2ZJR A;  1Q82 C;  4JI3 Q;  4JYA Q;  1VQK A;  2VUM H;  3GO5 A;  3H0G H;  2ZTC A;  3S16 H;  3KF8 B;  2R93 H;  2Y0S G;  4XIG S;  4DKA C;  1XPR A;  2HHH L;  4LFC L;  4POF A;  3GTK H;  4IPG A;  1K3R A;  3M3Y H;  2VY3 A;  2MO0 A;  4PZ8 A;  5C4X G;  4R4Q A;  1Y1W H;  3S1Q H;  4B3S Q;  1N32 Q;  1I5F A;  3TEH B;  4DV4 Q;  1KRT A;  1O7I A;  1GO3 E;  2Q2T A;  1CUK A;  1XJV A;  3PV0 A;  3PO2 H;  1I94 Q;  4YCW A;  4LUV A;  3S1N H;  5BR8 Q;  5LMN W;  4A3C G;  4EX5 A;  1IZ6 A;  4LF4 L;  1YJ9 A;  3KF6 A;  1PH9 A;  5H1S E;  1MIU A;  4TVA B;  3PUY A;  1HNZ Q;  1OXT A;  1X56 A;  5M3F G;  3PO3 H;  3S15 H;  3CC7 A;  1N9W A;  4GN5 A;  4DUZ L;  4JC0 A;  4B3T Q;  3CPF A;  3HKZ G;  4K0K Q;  3UE1 A;  1NE3 A;  4EQ5 A;  5C3E H;  1OXX K;  1SRU A;  3JC6 6;  4R4I A;  5IP7 G;  4DR3 Q;  1IBL Q;  4L5R C;  3STB D;  4OWT B;  3M7N A;  4NB3 A;  1KC8 C;  4LF8 L;  3FKI G;  4C2M H;  1PH8 A;  2YTX A;  1K73 C;  3AQQ A;  1Q1B A;  1B8A A;  4P71 A;  1Q86 C;  4A3L G;  2JEB I;  4GN4 B;  2UXC Q;  1C9O A;  4PZ6 A;  2EXD A;  4R4O A;  4QL5 A;  1X55 A;  4JI0 L;  1MJC A;  1W2B A;  4R1J A;  3M4Q A;  3RLO A;  4GOP A;  1GD7 A;  1PH3 A;  2K52 A;  1XNQ L;  1C0A A;  2YV5 A;  4LFA Q;  4A3K G;  5FJ8 G;  4DV1 Q;  2JA5 G;  4WJ3 M;  1L2F A;  1V43 A;  3U4Z A;  3HOW H;  1A0I A;  3M4P A;  2BH8 A;  4JI2 Q;  2UXD L;  1L1O B;  2KCM A;  4B3M Q;  1PH4 A;  1BKB A;  3G48 A;  1SMX A;  4JI8 Q;  1WOC A;  3TQY A;  1QUQ B;  1QVC A;  2JA8 G;  2Q2I A;  4GKK Q;  2I0Q A;  4HJ9 A;  2F4V L;  5AJ3 L;  1HZB A;  1A63 A;  3WWV A;  3L7Z C;  4MTN A;  1VQP A;  1K8A C;  2QA4 A;  1ASZ A;  2B3G A;  3SGI A;  1ASY A;  1HJP A;  4X64 Q;  5C44 H;  3J81 c;  4HIM A;  4GOP C;  2KBN A;  1L0W A;  3CD6 A;  1NTG A;  4A3E H;  3CCJ A;  4A76 A;  1S3O A;  3HOY H;  4B3R Q;  1E22 A;  2RHS B;  4BBR H;  3RLF A;  1LTL A;  2YTY A;  4A93 G;  5IE8 A;  2K5N A;  3M9B A;  4IO9 A;  1CSP A;  2PI2 E;  1K0R A;  2E5L L;  3RN5 A;  4A3G G;  2JK8 A;  5C4J H;  4AQY L;  1YBY A;  1VQA A;  2HHH Q;  4YWL A;  4LF6 L;  4LF7 L;  3J7A 5;  3TS2 A;  1DGS A;  3EBE A;  3GTJ H;  2WB1 E;  2JEA I;  2IT1 A;  1AE2 A;  3PUX A;  3KOJ A;  1Z47 A;  2MNA A;  4A3I G;  1EIF A;  1M90 C;  2MFI A;  3RZD H;  4A3B G;  3STB C;  1PYS B;  3LGJ A;  4KHZ A;  4LF9 L;  1VQE A;  1Q46 A;  3F2D A;  1TWC H;  2UU9 Q;  4LF4 Q;  2Z0S A;  2B63 H;  3K80 C;  1CKN B;  5M5X H;  3F8T A;  3PUZ A;  4X66 Q;  3G71 A;  2A19 A;  1E7Z A;  3I56 A;  4YCU A;  4DUZ Q;  5C4X H;  4GKJ L;  3KLW A;  4OX9 L;  3GD7 A;  5ELO A;  2AKW B;  1Q1E A;  3L2P A;  3I4N G;  1CKO A;  1YJN A;  4JV5 L;  4A3J G;  1XNR L;  4MZ9 A;  4H02 A;  1JJ2 A;  3B6Y A; 
#chains in the Genus database with same CATH topology
 1ZYR D;  4N8F A;  4O0A A;  1LAB A;  2DY7 A;  4X62 L;  1CA5 A;  1BUV T;  1HCZ A;  1U4L A;  2JA7 B;  2K05 A;  3I70 A;  3UDF A;  2HQE A;  3P20 A;  1PZJ D;  4UP8 A;  4C3J H;  3CMA A;  1BVS A;  5IWA L;  3BVG A;  1HQM C;  1GVP A;  3CP0 A;  3UDI A;  2UXB L;  3L3O C;  1YIJ A;  3M4O B;  3I90 A;  3MXN B;  1TWG B;  4FP5 D;  4NKL A;  3UE0 A;  3W1B A;  3N6R A;  1I6V C;  5I9O A;  5FLM G;  4K5W A;  1H9K A;  1VQC A;  2WII B;  1QUQ A;  5FJ8 H;  3GTG H;  2R93 B;  4JPB W;  3GTK B;  4BY7 H;  2LXK A;  1LM0 A;  3NQI A;  5JAV A;  4HID A;  3BJU A;  5JJK A;  1X6O A;  4DXF A;  1CA6 A;  1Z9F A;  1F2M A;  4C3I B;  2K5W A;  4DU9 A;  4JVZ A;  3SEB A;  3RN2 A;  4JI1 Q;  1D7Q A;  3LX0 A;  4M1U B;  1XYI A;  1L1O C;  2EDG A;  4KHP L;  5IP9 G;  4YY3 L;  2KCC A;  3K5M A;  4LNQ A;  3OTO Q;  1PVO A;  5GRO A;  2XNA C;  1X3E A;  2WV6 D;  5IIF A;  3HOZ G;  3S14 H;  1ET6 A;  3NEL A;  1KIX A;  4A93 H;  1ZYR C;  3K7A H;  2N49 A;  4N9P A;  2HCI A;  1D1K A;  5KEE A;  2N8N A;  4HJ8 A;  2VL6 A;  4NXM L;  1FYC A;  2BDO A;  4OWW B;  1XNR Q;  1B9N A;  1OXS C;  5EBC A;  3GTO H;  1J5E L;  5J39 A;  3VR5 A;  3F2U A;  1GXD C;  1BCP B;  1HR0 Q;  3I4M G;  5KNC A;  1EYC A;  2FJ2 A;  5ELN A;  1TT2 A;  2B2V C;  4N9T A;  4IAL A;  2V1C C;  2L55 A;  4AYB G;  4HMI A;  1PHJ A;  4K6D A;  3HOY B;  4IOC A;  2CH4 W;  4FNF A;  4P74 A;  2VW9 A;  4L6T B;  2MQH A;  3CC4 A;  1B53 A;  3EN2 A;  1HH2 P;  2Z4I A;  2GVA A;  3A0J A;  1QCB D;  2VUM G;  5C4J B;  2IX1 A;  1RCV D;  1DCZ A;  4G7Z C;  1TXY A;  1JC7 A;  3A7L A;  5I6Y A;  5C0X J;  5CV5 A;  1GUW A;  3A55 A;  3K59 A;  2K6A A;  2LXJ A;  2JSO A;  1VQ5 A;  4X3T A;  1WD0 A;  5JPN C;  4PMB A;  3CCU A;  3C3L A;  2LFN A;  5CV7 A;  4OXP A;  1PZK D;  2EXZ A;  5M5Y H;  1I94 L;  3HKS A;  1NAP A;  4PMW A;  5BR8 L;  5IP9 H;  1LTI D;  4LK1 C;  1SR3 A;  4DV7 Q;  1E3P A;  1MI2 A;  3SK6 A;  1IXR A;  3HOZ H;  1JOQ A;  5M3F H;  2RCF A;  1RD9 D;  1CZW A;  4J8Q A;  1YJW A;  3E6Z X;  4L5S A;  4UPA A;  3SR1 A;  2EPB A;  1IBL L;  4U68 A;  1CK1 A;  3NHH A;  4RHS A;  2QCP X;  2SEB D;  1IKL A;  5D65 A;  2OQ0 A;  3FKI H;  3G7L A;  4OWX B;  4ILW A;  2EYM A;  2JJQ A;  2GN5 A;  4KY6 A;  4LFA L;  3OHX C;  1U4R A;  4DV1 L;  5C0X G;  2H4O A;  1VQL A;  2K4K A;  5AJ3 Q;  4JI2 L;  2HCC A;  4DAV A;  2WAQ G;  4IUQ A;  2F0V A;  2RQX A;  1AH9 A;  3QO2 A;  1V8Q A;  3K81 C;  4IUT A;  1S5C D;  4QMG A;  2WFW A;  1ENF A;  1STE A;  4HIO A;  4DAY B;  1SNM A;  1SNQ A;  1K8M A;  1F9S A;  1O7Z A;  2FMC A;  5EKK A;  3A8J E;  3PMF A;  2AWO A;  2RHQ B;  1HUM A;  4DR1 Q;  4KKU A;  1FL0 A;  2XWJ B;  4MNO A;  5E4W C;  3TP7 A;  1KDB A;  4JI6 Q;  3TME A;  2EY2 A;  5IT9 c;  2OWO A;  2OXP A;  2Q8R E;  2R7Z G;  1Q8I A;  2O4X A;  1K83 H;  1XPO A;  2CQO A;  4JI5 Q;  3CF5 A;  2MJ8 A;  3R93 A;  1CKN A;  1KAA A;  2UUC Q;  1NSN S;  1NR4 A;  2OF1 A;  2K50 A;  5FK9 C;  1SMY D;  4A3B H;  2M9V A;  3HG9 A;  2FXQ A;  3KFU A;  1IBM Q;  3GTL H;  2D5D A;  2I5L X;  1PH2 A;  2L12 A;  3FEW X;  4DV2 Q;  1KD1 C;  4GNX A;  2ZJQ A;  2Z6K A;  4YHH L;  3BDL A;  2EY1 A;  4BBS G;  3W3A A;  1IBK L;  2B2W C;  3TZD A;  1YNJ C;  2F4I A;  1VQM A;  3HOV H;  4KHV A;  1VQI A;  2ATW A;  1Y69 U;  1E1T A;  4DR2 Q;  3CAM A;  3E0E A;  1PV4 A;  1VF7 A;  3T16 A;  1AN8 A;  5A2Q L;  1QZG A;  1QE6 A;  4HSV A;  1J6Q A;  4DV5 L;  4JCV E;  4IFD J;  4LWC A;  1ILQ A;  1TS3 A;  4K8J A;  1ENC A;  1KAW A;  3S24 A;  2NZ1 D;  3W2D A;  1O7L A;  1WVL A;  4K6L A;  1KDC A;  4A3D G;  1X3G A;  5FO8 B;  1RHP A;  2Y0S B;  4CGY B;  1Y1V B;  1BCP D;  1LT5 D;  4GLV B;  1AFP A;  1QVF A;  1KHI A;  2VQE Q;  2K32 A;  1LAC A;  5JOB A;  1ML0 D;  1SMY C;  5GAD C;  3JAM i;  1DYQ A;  1MSH A;  4RWS C;  1VQ7 A;  1ROD A;  3I3C A;  1NBW A;  1VQO A;  2QF7 A;  1S40 A;  5EKI A;  5FLX E;  3J80 i;  1LUZ A;  2EQS A;  2JA9 A;  4KJN A;  4EQN A;  4DR6 Q;  3K8A A;  3U58 A;  5HGT A;  1N36 L;  1SDF A;  3R8B A;  2PMZ B;  2Z9H A;  2R7Z H;  1HFN A;  3A5Z B;  3E3X A;  1QG7 A;  1JWU D;  4IFD G;  2DY8 A;  2NVY H;  5GQO A;  5FKA C;  2PZT A;  2R61 A;  2UUB Q;  2J0T D;  5C0X I;  3H94 A;  4RHR A;  2CCZ A;  4JBM A;  1IKM A;  2RSO A;  1KRS A;  3NE5 B;  5CC4 A;  3KLR A;  2JA8 B;  3ND8 A;  2A69 C;  1W3S A;  2VQF Q;  4ZRZ A;  5LMN L;  2M2L A;  5K36 G;  3CU7 A;  4BBS H;  3VR3 A;  3GP7 A;  1BCP C;  4XTC S;  4MTK A;  1BQQ T;  2EJM A;  3PIP A;  3NQT A;  3DWA A;  3M4Y A;  4KY7 A;  4KJO A;  3Q6S A;  1Q82 C;  2H1E A;  3KF8 B;  4V0B A;  1ESR A;  1IL8 A;  2HHH L;  3M3Y H;  2KHS A;  3MAQ A;  4PZ8 A;  3NTI A;  1N32 Q;  5KNB A;  4B3S Q;  1I5F A;  2E2J B;  3PV0 A;  4DN4 M;  4LUV A;  4A3C G;  4RCO A;  1HA5 A;  1C4Q A;  1IZ6 A;  2DJG C;  1YJ9 A;  1X56 A;  4IQZ A;  4DUZ L;  4XQQ A;  4JC0 A;  3J7Y W;  3UE1 A;  4EQ5 A;  5C3E H;  1OXX K;  1SRU A;  5IP7 G;  3NK9 A;  3R2T A;  2M00 A;  1SYD A;  4NB3 A;  1PH8 A;  4P71 A;  4A3L G;  2UXC Q;  4GN4 B;  4R4O A;  4HTH A;  4JI0 L;  4H13 C;  1GUN A;  1XNQ L;  2IX3 A;  2JA5 G;  4WJ3 M;  1V43 A;  1WCM B;  1MGS A;  3M4P A;  1A0I A;  1EY7 A;  5J22 A;  2UXD L;  1L1O B;  1TWA B;  2KCM A;  4IFD H;  5C3W A;  1BKB A;  1TS4 A;  1PXU A;  3HRZ C;  1WOC A;  4F8M A;  5ELF A;  3IFT A;  4H0L C;  4FXG C;  2NVX B;  4A3M B;  3L7Z C;  4MTN A;  2OEO A;  1K8A C;  2E74 C;  1ASY A;  4X64 Q;  4GOP C;  1L0W A;  2RDH A;  1SYG A;  1S3O A;  3KBX A;  4XQJ A;  4FXD A;  5K36 H;  2E5L L;  4A3G G;  3BG3 A;  3ND9 A;  4AQY L;  3BZD B;  1GHK A;  4YWL A;  4LF6 L;  3VR4 A;  2A6H D;  1DGS A;  1H9R A;  1RTO A;  3EBE A;  4A3F B;  1PDQ A;  1AE2 A;  2QIL A;  4A3I G;  1M90 C;  4IUU A;  1EY6 A;  5CV9 A;  4IUR A;  3RZD H;  1IW7 D;  3F2D A;  2UU9 Q;  2B63 H;  4TSS A;  2G5D A;  5M5X H;  2Z4H A;  1EFI D;  3PUZ A;  3Q24 A;  1BBX C;  5IGE A;  3KLW A;  4OX9 L;  3GD7 A;  3QOJ A;  3L2P A;  4JV5 L;  1H9J A;  4A3J G;  1AP0 A;  2JXM B;  2F0J A;  3VA7 A;  1STB A;  4KKT A;  1FJG L;  3ONA B;  4C3H H;  1IYJ B;  2F0Q A;  5EPJ A;  2PQA B;  3IKJ A;  3OIP A;  4DAP A;  3S2D H;  3FP9 A;  1EY0 A;  2IHE A;  1RDP D;  4NDX A;  1JJG A;  3KDF B;  2IX0 A;  2X6G A;  4AYB E;  2LS0 1;  1VF5 C;  5IP7 H;  3K5N A;  3NPP A;  1N34 Q;  5JPM C;  2KEC A;  1EWI A;  1ZXT A;  3GTM B;  2R7F A;  4KI0 A;  2RDG A;  5T1I A;  5DNF A;  3S16 B;  4HCS A;  5KYL A;  1KXL A;  2K5H A;  1ESF A;  1YHA A;  1N33 L;  1TQO A;  4BXX H;  4NXN Q;  2A6H C;  5CR3 A;  1Y1W B;  3S1Q B;  3P1H A;  2I5H A;  4EGV A;  4ID6 A;  2F52 A;  4JI7 L;  4UP9 A;  2CHB D;  3PO2 B;  1HR0 W;  3U9S A;  1D1I A;  1IW7 C;  1F9Q A;  3A7A B;  4R9W A;  3D31 A;  5E4X A;  3A56 A;  3PF4 A;  3PO3 B;  3S15 B;  1KDA A;  5M3M G;  2Z6B A;  4DV3 L;  4LF5 L;  4CJ1 B;  5C4H A;  3CCR A;  2AWN A;  2Q8T A;  3BZK A;  2XVS A;  3HOX H;  4A3G H;  4LF9 Q;  1JB7 A;  4LFB Q;  3Q8D A;  1XTC D;  1J8I A;  3BVZ A;  4DUY L;  3CCS A;  4QY7 A;  1WTH A;  1XX8 A;  2ZTD A;  1B44 D;  2NYZ D;  3HOU G;  4DR4 Q;  4A3I H;  1GUT A;  3J81 i;  3HOW B;  4B9X A;  1U0L A;  2RDF A;  1RL2 A;  3MZ5 A;  2G9H D;  4DV6 L;  1QJO A;  1N8R C;  1HXY D;  5IGC A;  2JA7 G;  1AEX A;  4AIM A;  5IWA Q;  4A3J H;  2JA6 G;  3RNU A;  2WAQ E;  4EVO A;  2IHF A;  2UXB Q;  3RZO H;  3A74 A;  2B2Y A;  4ZCK A;  4A3E B;  1CKM A;  1VS0 A;  3BZC A;  1LTG D;  1OXU A;  1EOV A;  3TP6 A;  2H5X A;  1NJI C;  2HIX A;  1STN A;  4DNT B;  3GTJ B;  4OGQ C;  4R8N A;  5LMU L;  1SJH D;  5D3D A;  2F0P A;  2K5V A;  1G2S A;  4C3I G;  1E24 A;  1SE2 A;  5IYD H;  4ZUJ A;  4JI3 L;  4JYA L;  2ZM6 L;  4KHP Q;  1SLJ A;  1CQF A;  4P2C B;  4L5Q A;  1MJE A;  1Q90 A;  1V1O A;  3DWP A;  4DV4 L;  3H3V I;  1GKH A;  4ABN A;  4OO1 I;  5JJI A;  1HFG A;  3HFZ B;  3ULL A;  5GAE C;  4R4T A;  5HY6 A;  4FYD A;  3S17 H;  4K5V A;  3MHB A;  4C3J B;  2CWA A;  1HNW L;  3OW2 A;  1IHZ A;  1L0X B;  2KEE A;  4DXG A;  1J5E Q;  1UUP A;  3GTP H;  3FHW A;  1VQD A;  3S1R H;  2XSC A;  3JAM c;  1D2B A;  4ZKB B;  3QJY A;  2A1A A;  4KKS A;  3SK4 A;  5CMD A;  3KYH C;  3U50 C;  3W1G A;  3GTG B;  1T5X D;  2CWP A;  3BYT B;  4EQP A;  4BY7 B;  1EEF D;  3J80 c;  4A3K H;  4E6I A;  4L8J A;  1I4G A;  4WRD A;  2E2H H;  3SHL A;  1PH1 A;  2B2T C;  3LNN A;  5IGF A;  1S72 A;  2JA7 H;  1JWS D;  2BE5 D;  3F2C A;  5CV4 A;  1PYB A;  2L1B A;  3NWT A;  4L5T A;  2JA6 H;  3E9I A;  2DNE A;  1O80 A;  4I7A A;  5I2Y A;  5IOC A;  1L0Y B;  3I7F A;  3Q0A A;  3M4O H;  5A2Q E;  1QWY A;  2NVT H;  2VXW A;  1K8G A;  1EU3 A;  2I46 A;  4GN3 B;  5FO9 B;  4MN3 A;  3K7A B;  4R4C A;  4C1N K;  1Y8N B;  2XIW A;  4XDX A;  1YHQ A;  4NW2 A;  4H7B A;  4KD3 A;  3D6C A;  4DK3 C;  3DEP A;  1SJE D;  2AHO B;  4C3I H;  4CHT B;  4O2D A;  2MP1 A;  3GTO B;  3S2H H;  1R4Q B;  4RFB A;  1SN8 A;  4BA2 I;  4P72 A;  1HTP A;  4P73 A;  1EZ8 A;  1JIC A;  1LTS D;  1E2Z A;  4X66 L;  4X3K A;  1DOL A;  1OXV A;  1WTW A;  2RA4 A;  3GV3 A;  2YTV A;  2Q2H A;  4HJA A;  1ONL A;  1F9R A;  2BA0 A;  2DGY A;  3UDX A;  4JOI A;  1R4P B;  5IT9 L;  2ALY B;  5IGD A;  1A62 A;  2I5M X;  2BE5 C;  1DXM A;  2K5Q A;  4U67 3;  3H0G G;  3ICE A;  4Y7N H;  1TWF H;  1HZC A;  3T13 A;  3OYY A;  3GDE A;  1Q3L A;  1PTO H;  1XMO L;  1GUO A;  2OTL A;  1HNX L;  1SEB D;  5FLM H;  2PCF B;  4QIW B;  1M4V A;  1EYD A;  4QCL A;  5COY A;  3IFD A;  1JOK A;  1LYL A;  1X65 A;  1ZEQ X;  4JI1 L;  5M5Y B;  4UY8 C;  2K14 A;  4N8X 1;  4CDE C;  3OWF A;  2NBF A;  3KF6 B;  3H15 A;  5M5W H;  2TMP A;  3OTO L;  1R9T H;  3HOZ B;  1KNE A;  5CYU A;  1O78 A;  4WJ4 A;  5M3F B;  1AZP A;  3C1F A;  3HKZ B;  3SK8 A;  4RGM A;  3F1Z A;  4DV0 Q;  1CHQ D;  2VB2 X;  3FKI B;  1UAP A;  4TQU S;  4GOP B;  4I7Z C;  1ILP A;  4K2K A;  3V2T A;  5BN5 A;  4GLX A;  4YHH Q;  4FDB A;  2RSN A;  4F87 A;  1IBK Q;  3H6M A;  1BXT A;  5C44 G;  2KCT A;  1EQT A;  4OEL B;  3NBH B;  4B3M L;  2TSS A;  3I8Z A;  4A75 A;  3D4W A;  4JI8 L;  4DAM A;  1YNJ D;  3OWE B;  3P75 A;  3KLS X;  3I4M H;  4G7H C;  4GKK L;  2KA7 A;  2PQE A;  4CJ2 C;  4ALP A;  4BBR G;  4C56 C;  1MBY A;  4NP5 A;  5CBA E;  4DV5 Q;  3D0F A;  1NMF A;  2K33 A;  5L37 A;  1VQ8 A;  3EIV A;  3VYS A;  5GAG C;  4B3R L;  4IN3 A;  3CQZ H;  1S5B D;  2ZJR A;  1VQK A;  2SOB A;  3H0G H;  5C6A A;  2ZTC A;  2VUM H;  1K83 B;  2JP1 A;  2Y0S G;  1XPR A;  1SE4 A;  4POF A;  1DZ1 A;  3H91 A;  3DMU A;  2PNR C;  5C4X G;  1D5Z C;  1EIG A;  1TS5 A;  3MC0 B;  2Q2T A;  4A3B B;  4XT1 B;  3TN2 A;  1NCV A;  3GTL B;  3S1N H;  5H1S E;  1MIU A;  1G2T A;  4F7X A;  3NTH A;  3GQB A;  3TSS A;  4GN5 A;  4B3T Q;  3CPF A;  4K0K Q;  3EFX D;  4DR3 Q;  1KNA A;  2L4N A;  3HOV B;  3ITP A;  3G6J B;  4C2M H;  5IOD A;  2YTX A;  1CHP D;  2ZXP A;  3AQQ A;  3I73 A;  1Q1B A;  1JOO A;  2EXD A;  4QL5 A;  1X55 A;  4R1J A;  3M4Q A;  1STA A;  1C0A A;  2CVR A;  4UHV A;  2EVB A;  1L2F A;  2EE1 A;  2E75 C;  1QOH A;  1QIL A;  2B2U C;  1PH4 A;  3G48 A;  1SMX A;  3TQY A;  1CTM A;  1FR3 A;  2JA8 G;  4PNY A;  4LJZ C;  2I0Q A;  1S5F D;  4JK1 C;  5AJ3 L;  1HZB A;  1H9S B;  2A69 D;  3WWV A;  4XYO A;  5C0X H;  1VQP A;  1ASZ A;  2KOL A;  1HJP A;  3D4R A;  5C44 H;  3J81 c;  2KBN A;  2KQ3 A;  3CCJ A;  2LKV A;  3TP8 A;  2F0F A;  4ZK9 B;  1E22 A;  1WTV A;  1PRT D;  4BBR H;  4RGO S;  2YTY A;  1ICW A;  4IO9 A;  3M9B A;  2EYH A;  1F77 A;  3RN5 A;  4CKE A;  4Q5V A;  1YBY A;  1VQA A;  2HHH Q;  3A54 A;  2EYO A;  3TS2 A;  3KF8 A;  2JEA I;  2MNA A;  3KOJ A;  1TII D;  2R7Z B;  1LTR D;  3CHB D;  2EYL A;  3UI2 A;  1PYS B;  1S5E D;  5I9P A;  1VQE A;  1Q46 A;  4O1N A;  1X3P A;  1TWC H;  2NVY B;  2Z0S A;  3FMC A;  1CKN B;  1DOK A;  2JN4 A;  3F8T A;  3G71 A;  3I56 A;  1G91 A;  5BN4 A;  4YCU A;  4DUZ Q;  2NVQ B;  5C4X H;  4GKJ L;  2VB3 X;  5ELO A;  5KGU A;  1Q1E A;  3I4N G;  2F0K A;  2B8G A;  5DM6 3;  4H02 A;  3PSI A;  1IBM L;  1VQ4 A;  1II3 A;  4GNX B;  3MVV A;  1G29 1;  2JE6 I;  3IL8 A;  1I50 H;  3TP5 A;  4V19 0;  3T1Y L;  1I3Q H;  4POG A;  1YIT A;  2PPB C;  4K14 A;  4BBS B;  2CKZ B;  2R92 G;  4FF2 A;  4TRD A;  2K01 A;  2UXD Q;  4XXE A;  4GZY C;  4DR5 L;  1K3B C;  4DR2 L;  1L1O A;  3FVQ A;  1PRT C;  4X6A H;  5F2D A;  4ZUI A;  1FD7 D;  4ZYS A;  4HSP A;  3M3Y B;  4JBW A;  3BS1 A;  1JE5 A;  3QR8 A;  1VQG A;  3S9W A;  1WYD A;  1WFQ A;  2YU9 H;  1AZQ A;  4K2L A;  5JEA J;  3D3R A;  3CPW A;  2KEN A;  2F0S A;  1E2W A;  1JR0 D;  4A3D H;  3U4V A;  1PTO C;  2E5L Q;  4J15 A;  4UP7 A;  2Q2U A;  2NWG A;  2D2C C;  2GA4 B;  3QWN A;  3AFP A;  4LF6 Q;  2J7Z A;  2ZTE A;  1PLF A;  4QQB X;  2EY5 A;  2L11 A;  2PI2 A;  4DF7 A;  4A3F G;  5C3E B;  5IYC G;  3GTQ H;  2UUA Q;  2WB1 G;  3DM3 A;  1LLR D;  3MA2 B;  1YNN C;  2K04 A;  3DWQ A;  5EPK A;  3MFY A;  3NUC A;  2B2V A;  1RIP A;  4FO2 A;  2F0L A;  1EQQ A;  1WI5 A;  4DR6 L;  3EQL C;  5DAU A;  5G3L F;  5M9O A;  2FMM A;  3L9A X;  3R2I A;  1X32 A;  1FJG Q;  1K9M C;  1STH A;  4JBK A;  1FNV A;  1HQR D;  1NUC A;  3F2B A;  4KMU C;  1HA6 A;  3J81 j;  5JEA G;  3I4N H;  2GVB A;  5IY0 A;  2F0N A;  5ELB A;  2CH4 A;  2F03 A;  3AU7 A;  1C7Y A;  2R3Z A;  3CCQ A;  5ELD A;  3KDF A;  3W5O A;  3TRZ A;  2C9O A;  1WTO A;  3TRE A;  1EUJ A;  1CI3 M;  4K8I A;  2KED A;  2PW5 A;  1O7Y A;  3SDZ A;  2E2I H;  2SNS A;  3KK7 A;  4KK7 A;  3VDY A;  2R92 H;  1PRT F;  2K03 A;  2RVL A;  1N33 Q;  3IRB A;  3QG1 A;  3RLN A;  3KBG A;  4LFC Q;  1Y1W G;  2IW3 A;  4JI7 Q;  1XMQ L;  2NTT A;  3RZD B;  2A8V A;  3PO2 G;  2B63 B;  2HUG A;  2R7D A;  1EYG A;  5M5X B;  1PTO F;  3I91 A;  1JB3 A;  2F0W A;  1N32 L;  2ES2 A;  4X65 L;  3N52 A;  3AYH B;  5CBE E;  2RBM A;  1HZ9 A;  1B2T A;  3C2P A;  4IUP A;  4C3H B;  3KJP A;  1I4P A;  4OO1 G;  3S2D B;  4A3C H;  4CJ0 B;  4DR7 L;  4DUY Q;  4RG1 A;  3E0J A;  2EIF A;  4LF8 Q;  3BDC A;  4DFA A;  3DM1 A;  4A3F H;  1NNX A;  4YIJ A;  5IYC H;  1UWV A;  1SYF A;  3OPO A;  4BY1 G;  1XPU A;  2AQ2 B;  4KV6 A;  4P75 A;  1NY4 A;  4DV6 Q;  3VYR A;  1TU2 B;  1KL9 A;  2A68 D;  4B08 A;  4A3L H;  4DNR B;  1EL0 A;  1EWC A;  1TWH H;  5LL6 X;  3T1H L;  1KLG D;  2F4V Q;  2PW7 A;  3FDT A;  2B29 A;  4K5X A;  2BA1 A;  2JA5 H;  1A6X A;  1JT8 A;  2DJF C;  2VNU D;  4YWK A;  1LO5 D;  4R8I A;  1BOS A;  4IOA A;  1FNW A;  5IT9 E;  4BS9 A;  3AMU A;  3MEF A;  1SYB A;  1YNX A;  3J7A V;  1UE5 A;  1Z6H A;  3KLS A;  2L5T A;  4X3U A;  1B50 A;  1HRJ A;  5LMU Q;  1BBU A;  3FRP B;  4LF7 Q;  1YEZ A;  4PG3 A;  1TS2 A;  3HOX B;  4A3G B;  4FVM A;  1IYV A;  2ZM6 Q;  3JAM L;  4LW1 A;  2LSS A;  4JI4 L;  2XWB B;  3CCM A;  2Z8L A;  1F2Y A;  3J80 L;  2F0M A;  4A3I B;  2B2W A;  3MXP A;  5ELE A;  2KUM A;  4APV A;  5DM7 3;  1FVI A;  2IJ0 A;  1EY5 A;  1XXG A;  2UU9 L;  1YZ6 A;  3ULJ A;  2BDN A;  1VQH A;  4S3S A;  4QF4 A;  2A68 C;  4X62 Q;  2WP8 J;  1EEI D;  2EYP A;  3CCV A;  1HNW Q;  4C3J G;  5C4Z A;  1PH6 A;  4A3J B;  1GUS A;  3KJO A;  1A2U A;  1GHJ A;  2A6E D;  3RZO B;  3H3V H;  3UDG A;  4OO1 H;  3CW2 C;  1CT1 D;  1Y8P B;  3PGZ A;  2FFK B;  3PCO B;  1QNU A;  1TR5 A;  3MXN A;  1XTD A;  3L0O A;  1N34 L;  4BY7 G;  4DPG A;  4GNX C;  2Z6K C;  3I72 A;  4BY1 H;  1ZKO A;  2R93 G;  3BDO A;  5C3X A;  5ELC A;  3S1M H;  1AE3 A;  2KJX A;  4OL7 A;  1UE1 A;  2Y0S E;  3I4L A;  1DM0 B;  4NXN L;  1JCK B;  1SFO H;  4YY3 Q;  3EVQ A;  1I6H H;  2A73 B;  2ZJP A;  3Q22 A;  1VQF A;  1B1Z A;  3PIO 3;  3CXC A;  4ZKC B;  1ENA A;  1B3Q A;  1E2V A;  1WJJ A;  2C35 B;  3S17 B;  5EKL A;  4IUV A;  3LWE A;  4ZAI A;  4ZLT F;  5C5M A;  1MKH A;  1TKW B;  1HZA A;  1HNZ L;  1X3Q A;  5M3M H;  1GJX A;  4NPS A;  1FNU A;  1S5D D;  5KRU A;  3IAY A;  3WOE A;  2A6E C;  4NXM Q;  3GTP B;  1LTT D;  2AUK A;  2PMZ E;  4I65 A;  4LFB L;  2F1M A;  2D0O A;  2F3I A;  1LT6 D;  3O13 A;  1V1Q A;  5BN3 A;  2HT1 A;  5FLX c;  4DR4 L;  1K28 A;  4OIJ A;  1I4R A;  4A3K B;  2A74 C;  3CCL A;  3HOU H;  2HIV A;  2E2H B;  1VMP A;  3MEH A;  2MUY A;  4FF4 A;  4BA1 I;  2O5I C;  3K6O A;  1M1K C;  4NMZ A;  3WOF A;  3HOY G;  2JA6 B;  4PQX A;  2XGT A;  5GAH C;  4IJH A;  4RKB A;  1A3U A;  3ER0 A;  4A4I A;  4HJ5 A;  2NVT B;  4WJW A;  1CSQ A;  2F3W A;  4XT3 B;  4DGZ A;  1P16 A;  1XMO Q;  3S14 B;  1HNX Q;  1TWG H;  3T56 B;  2NZO A;  1PFM A;  2O5J C;  1VQJ A;  2ENB A;  2ZT9 C;  2WKD A;  3T53 B;  3VR6 A;  4A93 B;  4IJL A;  4Q0F A;  3GV6 A;  3Q23 A;  4H44 C;  2WIN B;  2R93 H;  1JOR A;  4B9W A;  1V1P B;  3GTK H;  2E76 C;  1LV9 A;  3SK5 A;  3S2H B;  1DOM A;  2EZV A;  2BCO A;  4R4Q A;  1KRT A;  1GO3 E;  2PZU A;  1XJV A;  2NTS A;  1I94 Q;  4YCW A;  5BR8 Q;  3ERQ A;  5LMN W;  4EX5 A;  4LF4 L;  3KF6 A;  3VYT A;  1OXT A;  4JW0 A;  1K8O A;  5M3F G;  3CC7 A;  1N9W A;  3HKZ G;  1NE3 A;  4R4I A;  1KAB A;  1PRT B;  1IBL Q;  4L5R C;  1I4H A;  4OWT B;  1KC8 C;  3FKI G;  1A3T A;  3M7G A;  1QB5 D;  1UEA B;  1H9M A;  2IPK D;  2JEB I;  1C9O A;  4PZ6 A;  3NSW A;  4GOP A;  1GD7 A;  3X3M A;  1Y8O B;  2YV5 A;  4LFA Q;  4DV1 Q;  4CKB A;  1TWF B;  4Y7N B;  4EQO A;  4JI2 Q;  3HP3 A;  1PTO B;  4B3M Q;  4JI8 Q;  1QUQ B;  1QVC A;  3NBH A;  5KYI A;  2Q2I A;  1D5X C;  4LAA A;  4GKK Q;  4HJ9 A;  2L9H A;  3K0Y A;  1A63 A;  4HN7 A;  3FPU B;  3DUZ A;  3D6W A;  3TBI B;  2QA4 A;  2B3G A;  4DAY A;  3CD6 A;  2EJG C;  1NTG A;  1IYU A;  3HOY H;  4FXK C;  4B3R Q;  2WKC A;  1SXT A;  2RHS B;  5EPL A;  1LTL A;  1F2Z A;  5M5W B;  1R9T B;  1CSP A;  1DD2 A;  2PI2 E;  3PQI A;  5C4J H;  2HD3 A;  2CW0 D;  5FOB B;  3J7A 5;  4HAE A;  3D8G A;  2WB1 E;  3BYY B;  1STG A;  4CKC A;  5FO7 B;  1Z47 A;  2EY6 A;  3CRK C;  3QOL A;  1C48 A;  4A3B G;  1SNO A;  1HHV A;  3X3N A;  5J1Z A;  3K80 C;  2F0U A;  2A19 A;  1E7Z A;  1RF2 D;  3FPP A;  3J81 L;  4G4K A;  1CKO A;  1G6Z A;  3A8I E;  2K1B A;  2MGS A;  4MZ9 A;  1XNR L;  3MFG A;  3LWU A;  1JJ2 A;  4HED A;  5EQ0 A;  1B70 B;  3HOV G;  2ID0 A;  2X6L A;  3SVM A;  3T51 B;  5JVH 3;  1E1O A;  2JYO A;  1A8V A;  3I4M B;  2QW7 A;  1HR0 L;  1YVC A;  4XYQ A;  1Q12 A;  3M85 A;  4GS3 A;  1FGB D;  3ZYY X;  1YHB A;  3RUZ A;  3RD4 A;  4IPH A;  4AYB B;  4G7O C;  2I07 B;  3A5U A;  2QKI C;  1HPC A;  4LMQ D;  4HCE A;  3SXH A;  1VDZ A;  4KN7 C;  5IGB A;  1TVX A;  4OIK A;  1PYW D;  1QNK A;  2Z1C A;  1SYC A;  3H3V C;  3CQZ B;  3A8K E;  3E5S A;  3DEO A;  3BVM A;  2MHV A;  2VUM B;  3H0G B;  2QEX A;  2QEJ C;  1B9M A;  5KIX A;  3G4S A;  1V9P A;  1H9S A;  2HDL A;  2CW0 C;  4IUN A;  1IL2 A;  3ERO A;  1Y1V G;  2HDM A;  1LTA D;  5D3I B;  2EOT A;  3S1N B;  1H95 A;  1G6P A;  2F0O A;  1MHW C;  5CGK A;  4KN4 C;  1VQN A;  2MO1 A;  1GOZ A;  2IY5 B;  1EIY B;  1A3V A;  4AH6 A;  2O2L D;  5CV8 A;  3MXG A;  2N55 A;  4JG2 A;  2AQ1 B;  5IYB G;  2OQK A;  1T5E A;  3NP8 A;  5ISR A;  4HMJ A;  3MWY W;  3PUV A;  4C2M B;  3TDQ A;  1N36 Q;  3C46 A;  4DV7 L;  3J7A F;  1M8A A;  2D0P A;  3NEN A;  1LT4 D;  4FF1 A;  4GKJ Q;  2A5H A;  5G3L D;  2D9U A;  1BO0 A;  3CRL C;  1SE3 A;  4DV0 L;  3PF5 A;  4KY5 A;  2EJF C;  3CME A;  2OTJ A;  2BOS A;  4X3S A;  4KTA A;  3MTS A;  2NN6 G;  2IWH A;  1CM9 A;  2VS1 A;  1BDO A;  5DEH A;  1QZH A;  3T1Y Q;  1WD1 A;  3V96 A;  2DNC A;  3ERS X;  5LMN Q;  5C44 B;  2E8G A;  2J4X A;  4PZ7 A;  1CZG A;  2WAQ B;  4ULL A;  1E0B A;  3J7Z C;  1U5K A;  4DR5 Q;  5CV6 A;  4M8A A;  2V4D A;  4XQN A;  1PMR A;  3K0X A;  4BBR B;  1F9P A;  4FF3 A;  1LT3 D;  1B7Y B;  2VZA A;  1KTK A;  4DR1 L;  4OEM B;  1SNC A;  4Y52 H;  3VA5 A;  4F88 A;  3RMH A;  3I55 A;  1B4O A;  3HEJ A;  1JE4 A;  1EU4 A;  2B2Y C;  4IPD A;  2G9D A;  2PYK A;  4YCV A;  2HQL A;  4DNI A;  1SND A;  4JI6 L;  5AFW A;  3TS0 A;  1CQV A;  1TWC B;  2PNH A;  2SNM A;  4RKL A;  1FGU A;  1VQ6 A;  4KD4 A;  3NWS A;  1G8Z D;  5J3B A;  3DLL A;  1PTO D;  5C4X B;  1Y1V H;  4JI5 L;  3AFQ A;  5C3E G;  4KLK A;  5HGQ A;  4RA8 A;  3BU2 A;  1X9N A;  5C5L A;  4J1M A;  2UUC L;  4CDF C;  2RF4 A;  4OON A;  1Q8K A;  2F0T A;  4CBV A;  1YNN D;  1X3F A;  2YYZ A;  2Q8I B;  3E9H A;  1I50 B;  3JAM E;  4B3T L;  2LY7 A;  5IYB H;  1I3Q B;  5EAY A;  4DV2 L;  1KLU D;  3CC2 A;  3EJI A;  1PFS A;  4K0K L;  1JJC B;  5E3F A;  4JI0 Q;  1VQB A;  1Y14 B;  1SSO A;  4DR3 L;  3J80 E;  1XNQ Q;  2K7V A;  1DJR D;  3K7U C;  5EJW A;  2B2T A;  2AMC B;  1VMC A;  1WTP A;  1WCM G;  4IPC A;  4QUF A;  1G51 A;  2EYF A;  4BWG B;  1SE8 A;  2NVQ H;  2CQA A;  1EY8 A;  4QGU A;  2QGQ A;  1SNP A;  4TKO B;  5I6W A;  2EYJ A;  2F0E A;  1NMG A;  4ME5 A;  4A3M G;  2YU9 B;  1EQR A;  3ZJY C;  5I4D A;  2NN6 H;  4O42 A;  1TY2 A;  2ASB A;  5IGG A;  4QJF A;  5EBD A;  4A3D B;  2KHJ A;  2JA8 H;  4Z9C B;  1EYA A;  2KHI A;  1SRO A;  1VQ9 A;  2N88 A;  3V05 A;  3K57 A;  1SBB B;  2ICE C;  3I4O A;  1GM5 A;  5K5P A;  1EY9 A;  4HJ7 A;  4AQY Q;  3GTQ B;  5KND A;  2VQE L;  3VYU A;  1KQS A;  1XMQ Q;  4ZQ3 A;  1STY A;  2FHT A;  4RMF A;  1U4P A;  3PIO A;  2K28 A;  5HUR A;  2NUC A;  2B63 G;  4YWM A;  1D6E C;  1UE6 A;  3D4D A;  2PZW A;  2XRS D;  1ET9 A;  2RKS A;  1P8L A;  4G57 A;  4X65 Q;  5E7N A;  2KVM A;  1LTB D;  4OX9 Q;  1K0S A;  1VCI A;  2R6G A;  4JV5 Q;  4ODG A;  4RH6 A;  1PA6 A;  4C3H G;  2E2J H;  2XRQ D;  2L0C A;  1WTR A;  1EFW A;  4DR7 Q;  1MSG A;  2NN6 I;  3I4N B;  2UUB L;  1SAP A;  4QB4 A;  3PUW A;  4MHE A;  2PQA A;  4GLA C;  2N78 A;  4PMC A;  1EOT A;  1S4Z A;  3OIQ A;  1PH7 A;  2E2I B;  3AEV A;  3K58 A;  5D14 A;  1B3A A;  1UE7 A;  2VQF L;  2NZH A;  3OW7 A;  2R92 B;  3T1H Q;  2L15 A;  3HZX A;  2JQO A;  2K75 A;  4BXX G;  1UEB A;  3OSO A;  1BBW A;  1OO9 B;  1WCM H;  1OTC A;  1UNS A;  1J9O A;  1RKN A;  1TWA H;  5JJZ A;  4JOI C;  1I4X A;  1YI2 A;  4HIK A;  4QIW E;  4UAI A;  4J6H A;  4LUZ A;  3K5L A;  2C5C A;  1F2L A;  2NVX H;  4A3M H;  2KCN A;  1HUN A;  1BCP F;  2N3S A;  4RGT A;  4LUO A;  1I4Q A;  3PO3 G;  1T9H A;  3G6E A;  1D5M C;  4DV3 Q;  1JMC A;  4B3S L;  4LF5 Q;  2ICI A;  3NEM A;  3HOX G;  2P5Z X;  3TZU A;  3ULP A;  4JI4 Q;  3WDN A;  1A15 A;  3NTK A;  1Q81 C;  2UUA L;  1AW7 A;  2WB1 B;  3HKZ E;  2DUD A;  2F0D A;  2OCE A;  2PO4 A;  2XTI A;  1C8C A;  5JJL A;  4IFD I;  4RAU C;  1BR9 A;  3HOW G;  2BH2 A;  3DXJ C;  3CCE A;  2CFM A;  4IZ8 A;  2UXC L;  1TWH B;  2B8F A;  4DK6 C;  2X69 A;  1PFB A;  5EGT A;  1BNZ A;  4DA2 A;  3DHQ A;  3U9O A;  1QVG A;  1D8L A;  2JA5 B;  3EA6 A;  2D62 A;  5DLQ E;  3RR5 A;  4A3E G;  1GUG A;  2ZXO A;  4DK0 A;  1X54 A;  2E2D C;  2B39 A;  4ME3 A;  4JBJ A;  2AUJ D;  5JEA H;  2RCN A;  1JWM D;  1U9R A;  1Q7Y C;  4X64 L;  3I2Z A;  3KUP A;  1MD2 D;  5IYD G;  1EZ6 A;  4RGN A;  2FIN B;  3GTM H;  1PH5 A;  3QB3 A;  3CKI B;  3P7J A;  4JI3 Q;  4JYA Q;  3R3O A;  3GO5 A;  5NUC A;  3S16 H;  5FLX L;  2QDL A;  3MXU A;  4XIG S;  4DKA C;  4LFC L;  4IPG A;  1K3R A;  4WOR A;  2VY3 A;  2MO0 A;  3NXW A;  1Y1W H;  3S1Q H;  3AB9 A;  3TEH B;  4DV4 Q;  3OOC A;  1O7I A;  2DN8 A;  1CUK A;  2QDB A;  2F3V A;  1PZI D;  4CDD C;  3PO2 H;  3C1E A;  5COR A;  1U4M A;  1PH9 A;  4TVA B;  4PV1 C;  3PUY A;  1CFM A;  1HNZ Q;  2F0H A;  3PO3 H;  3S15 H;  4QUC A;  2IL8 A;  1EIH A;  2B2U A;  3JC6 6;  1Z7T A;  2WAC A;  1W6J A;  3STB D;  3M7N A;  4RCN A;  4LF8 L;  1K73 C;  1B8A A;  1Q86 C;  2NB0 A;  2OT2 A;  2K5D A;  3OMC A;  2F0G A;  3OMG A;  1EY4 A;  1MJC A;  1W2B A;  1WTX A;  3RLO A;  1PH3 A;  1RJT A;  2K52 A;  4BY1 B;  4A3K G;  2MPM A;  5FJ8 G;  1HTL D;  3U4Z A;  3HOW H;  2BH8 A;  3J81 E;  5T1G A;  1XWE A;  3SE0 A;  4L63 B;  3S1M B;  1ICF B;  1SYE A;  4WFN 3;  2F4V L;  5JVG 3;  1PFN A;  1SFO B;  3URY A;  1I6H B;  3QIA A;  3NBI A;  1EQV A;  3SGI A;  3T4A C;  4HIM A;  1W6K A;  4CDC C;  4UDU C;  5A35 A;  1TY0 A;  4DK1 A;  4A3E H;  4A76 A;  2SDF A;  3PIP 3;  1DON A;  5I2X A;  3RLF A;  4A93 G;  5IE8 A;  2K5N A;  2LMC B;  1K0R A;  2JK8 A;  3H09 A;  4MIU A;  2ZXR A;  5LHY 1;  5M3M B;  4LF7 L;  3GTJ H;  3K5O A;  1V1P A;  2IT1 A;  3PUX A;  5E1F A;  2AQ3 B;  1EIF A;  1JQY D;  2MFI A;  5TSS A;  3HS0 C;  3STB C;  3HGB A;  3LGJ A;  4KHZ A;  1EWH A;  1BF4 A;  4LF9 L;  4LF4 Q;  4OHJ A;  3S1R B;  1WTQ A;  1RTN A;  4X66 Q;  4HR7 B;  3VR2 A;  2XN9 C;  4C1N I;  1NR2 A;  3HOU B;  2AKW B;  1YJN A;  2F0I A;  5LL6 S;  1A2T A;  3B6Y A; 
#chains in the Genus database with same CATH homology
 1IBM L;  1VQ4 A;  4GNX B;  4O0A A;  1B70 B;  3HOV G;  1FJG L;  1G29 1;  2ID0 A;  1IYJ B;  4C3H H;  2JE6 I;  4X62 L;  1E1O A;  1A8V A;  2PQA B;  3S2D H;  1HR0 L;  1YVC A;  3FP9 A;  1Q12 A;  3M85 A;  4GS3 A;  1I50 H;  3UDF A;  1YHB A;  3CMA A;  2IHE A;  4UP8 A;  4C3J H;  1BVS A;  3T1Y L;  1I3Q H;  3KDF B;  5IWA L;  2IX0 A;  1GVP A;  3CP0 A;  4AYB E;  1YIT A;  4POG A;  2CKZ B;  3UDI A;  5IP7 H;  4IPH A;  2R92 G;  3A5U A;  1N34 Q;  2UXB L;  2UXD Q;  1EWI A;  1YIJ A;  4DR5 L;  3MXN B;  4DR2 L;  3UE0 A;  1L1O A;  2R7F A;  3W1B A;  4KI0 A;  5FLM G;  4X6A H;  1VQC A;  1QUQ A;  2QEX A;  5FJ8 H;  3GTG H;  1KXL A;  2K5H A;  3G4S A;  1YHA A;  1V9P A;  1N33 L;  4BY7 H;  2LXK A;  1LM0 A;  5JJK A;  4JBW A;  4HID A;  3BJU A;  4NXN Q;  1X6O A;  4BXX H;  1JE5 A;  1VQG A;  1Z9F A;  2YU9 H;  1WYD A;  1WFQ A;  1Y1V G;  1IL2 A;  5JEA J;  2I5H A;  3RN2 A;  2F52 A;  4JI1 Q;  2KEN A;  3CPW A;  4JI7 L;  1D7Q A;  4UP9 A;  1HR0 W;  1H95 A;  1G6P A;  1L1O C;  4A3D H;  3U4V A;  2E5L Q;  4J15 A;  3D31 A;  4UP7 A;  5IP9 G;  4YY3 L;  2Q2U A;  3PF4 A;  4KHP L;  1VQN A;  2MO1 A;  2IY5 B;  4LNQ A;  1EIY B;  3OTO Q;  1PVO A;  3AFP A;  4AH6 A;  2ZTE A;  5M3M G;  4LF6 Q;  4JG2 A;  5GRO A;  4DV3 L;  1X3E A;  3HOZ G;  4QQB X;  2PI2 A;  5IYB G;  4A3F G;  4LF5 L;  2OQK A;  5IYC G;  3GTQ H;  2UUA Q;  3S14 H;  3NEL A;  1KIX A;  2WB1 G;  3CCR A;  2AWN A;  3DM3 A;  4A93 H;  3BZK A;  3HOX H;  3K7A H;  3PUV A;  1N36 Q;  1JB7 A;  4LF9 Q;  3Q8D A;  4A3G H;  4LFB Q;  2N49 A;  4DV7 L;  2D0P A;  3NEN A;  4DUY L;  2N8N A;  3CCS A;  1RIP A;  4HJ8 A;  2VL6 A;  1EQQ A;  1WI5 A;  4QY7 A;  4DR6 L;  4GKJ Q;  4NXM L;  2ZTD A;  3HOU G;  4DR4 Q;  4A3I H;  3J81 i;  4DV0 L;  4OWW B;  1OXS C;  1XNR Q;  3PF5 A;  1J5E L;  3GTO H;  1U0L A;  2OTJ A;  3CME A;  1FJG Q;  1RL2 A;  4DV6 L;  1N8R C;  1K9M C;  1HR0 Q;  3I4M G;  5ELN A;  2NN6 G;  4JBK A;  2JA7 G;  3F2B A;  2VS1 A;  4AIM A;  3J81 j;  5JEA G;  3T1Y Q;  2GVB A;  5IY0 A;  5IWA Q;  1QZH A;  3I4N H;  4A3J H;  3ERS X;  5LMN Q;  3RNU A;  2JA6 G;  2WAQ E;  2E8G A;  4PZ7 A;  2IHF A;  3CCQ A;  2V1C C;  1C7Y A;  4AYB G;  3KDF A;  3W5O A;  3A74 A;  3RZO H;  3TRZ A;  2UXB Q;  3J7Z C;  1PHJ A;  1U5K A;  4DR5 Q;  3TRE A;  4IOC A;  1CKM A;  1EUJ A;  4P74 A;  2VW9 A;  1VS0 A;  2MQH A;  3CC4 A;  3BZC A;  3K0X A;  3EN2 A;  1HH2 P;  1OXU A;  2E2I H;  1EOV A;  1B7Y B;  2GVA A;  2VZA A;  3A0J A;  3VDY A;  2R92 H;  2H5X A;  1NJI C;  2VUM G;  2HIX A;  2IX1 A;  1N33 Q;  4DR1 L;  3IRB A;  4Y52 H;  5LMU L;  3RLN A;  1TXY A;  3I55 A;  2K5V A;  4LFC Q;  1Y1W G;  4IPD A;  1E24 A;  4YCV A;  4JI7 Q;  2HQL A;  4DNI A;  1XMQ L;  5C0X J;  5IYD H;  2A8V A;  4JI6 L;  4JI3 L;  3TS0 A;  3PO2 G;  4JYA L;  2ZM6 L;  2PNH A;  2LXJ A;  2R7D A;  4KHP Q;  1EYG A;  1VQ5 A;  1FGU A;  1VQ6 A;  5J3B A;  3DLL A;  3CCU A;  1SLJ A;  4L5Q A;  1Y1V H;  1MJE A;  4JI5 L;  4OXP A;  1N32 L;  2ES2 A;  4X65 L;  3AYH B;  4DV4 L;  3AFQ A;  3H3V I;  5C3E G;  4KLK A;  1GKH A;  1HZ9 A;  5HGQ A;  3BU2 A;  5M5Y H;  1X9N A;  4OO1 I;  5JJI A;  1I94 L;  3HKS A;  3HFZ B;  4PMW A;  5BR8 L;  2UUC L;  3ULL A;  3KJP A;  2RF4 A;  4OON A;  4R4T A;  5IP9 H;  5HY6 A;  5GAE C;  1Q8K A;  4OO1 G;  4DV7 Q;  3S17 H;  1SR3 A;  4A3C H;  1X3F A;  2YYZ A;  4DR7 L;  3E9H A;  4DUY Q;  1E3P A;  4RG1 A;  2EIF A;  4LF8 Q;  1IXR A;  3HOZ H;  2CWA A;  4B3T L;  5IYB H;  4A3F H;  5M3F H;  1HNW L;  5EAY A;  5IYC H;  4DV2 L;  3OW2 A;  3CC2 A;  1PFS A;  4K0K L;  1JJC B;  1YJW A;  1UWV A;  4L5S A;  4JI0 Q;  1VQB A;  4UPA A;  1Y14 B;  4DR3 L;  1J5E Q;  1IBL L;  1XNQ Q;  3K7U C;  3GTP H;  4BY1 G;  2AMC B;  1XPU A;  3FHW A;  4P75 A;  1NY4 A;  1VQD A;  1WCM G;  4DV6 Q;  3S1R H;  4IPC A;  3JAM c;  2OQ0 A;  3FKI H;  1G51 A;  4OWX B;  1KL9 A;  2A1A A;  4A3L H;  1SE8 A;  2NVQ H;  2JJQ A;  3KYH C;  3U50 C;  2GN5 A;  3W1G A;  1TWH H;  4LFA L;  2CWP A;  4DV1 L;  4QGU A;  5C0X G;  2QGQ A;  3T1H L;  2F4V Q;  1VQL A;  2K4K A;  5AJ3 Q;  3J80 c;  2B29 A;  4JI2 L;  4A3K H;  2BA1 A;  2JA5 H;  4A3M G;  1JT8 A;  1NMG A;  2WAQ G;  2VNU D;  4YWK A;  2E2H H;  1EQR A;  3ZJY C;  1AH9 A;  3K81 C;  1PH1 A;  2WFW A;  2ASB A;  2JA7 H;  1S72 A;  4QJF A;  4HIO A;  4DAY B;  2KHJ A;  3F2C A;  2JA8 H;  1PYB A;  4L5T A;  4IOA A;  2KHI A;  2JA6 H;  3MEF A;  1SRO A;  1YNX A;  1VQ9 A;  2AWO A;  2RHQ B;  1UE5 A;  3E9I A;  4DR1 Q;  3I4O A;  1GM5 A;  3I7F A;  1FL0 A;  5LMU Q;  4HJ7 A;  4AQY Q;  4MNO A;  2NVT H;  3M4O H;  1BBU A;  1K8G A;  4LF7 Q;  2VQE L;  1KQS A;  1XMQ Q;  1YEZ A;  3PSI A;  4JI6 Q;  4GN3 B;  4PG3 A;  3PIO A;  5IT9 c;  4RMF A;  4R4C A;  2OWO A;  2ZM6 Q;  2B63 G;  2R7Z G;  1YHQ A;  4YWM A;  4LW1 A;  1UE6 A;  2LSS A;  4JI4 L;  1K83 H;  3CCM A;  4DK3 C;  2CQO A;  1XPO A;  4JI5 Q;  2AHO B;  1P8L A;  4C3I H;  4X65 Q;  3CF5 A;  5E7N A;  4O2D A;  1CKN A;  3S2H H;  4OX9 Q;  4APV A;  1FVI A;  1VCI A;  2R6G A;  2UUC Q;  1SN8 A;  4BA2 I;  4JV5 Q;  4P72 A;  1PA6 A;  2K50 A;  4P73 A;  2UU9 L;  4A3B H;  1YZ6 A;  2E2J H;  2FXQ A;  3ULJ A;  1VQH A;  1IBM Q;  1EFW A;  4X66 L;  2I5L X;  3GTL H;  3KFU A;  1PH2 A;  4DR7 Q;  2NN6 I;  1OXV A;  4X62 Q;  2WP8 J;  2YTV A;  3CCV A;  1HNW Q;  2Q2H A;  4DV2 Q;  4GNX A;  1PH6 A;  2Z6K A;  1KD1 C;  2UUB L;  2ZJQ A;  3KJO A;  4HJA A;  3PUW A;  4YHH L;  2BA0 A;  2DGY A;  2PQA A;  2N78 A;  4GLA C;  3H3V H;  4BBS G;  3UDX A;  3UDG A;  1IBK L;  3CW2 C;  4JOI A;  1VQM A;  3HOV H;  1JJG A;  2ATW A;  1VQI A;  1PH7 A;  3PGZ A;  2ALY B;  3AEV A;  1A62 A;  1E1T A;  2I5M X;  3PCO B;  1UE7 A;  3CAM A;  4DR2 Q;  2VQF L;  2NZH A;  3E0E A;  3T1H Q;  1XTD A;  2L15 A;  1PV4 A;  3L0O A;  1N34 L;  4BY7 G;  2JQO A;  2K75 A;  4DPG A;  4GNX C;  1QZG A;  2Z6K C;  4BY1 H;  3H0G G;  4BXX G;  1J6Q A;  3ICE A;  1UEB A;  4JCV E;  4DV5 L;  4LWC A;  4IFD J;  2R93 G;  1BBW A;  4Y7N H;  1TWF H;  1WCM H;  1OTC A;  1HZC A;  1TWA H;  3OYY A;  3GDE A;  2OTL A;  1XMO L;  1KAW A;  3S24 A;  3S1M H;  1AE3 A;  1HNX L;  4JOI C;  1YI2 A;  4HIK A;  1UE1 A;  5FLM H;  4A3D G;  4QIW E;  4LUZ A;  1X3G A;  2Y0S E;  2NVX H;  4NXN L;  4A3M H;  1SFO H;  4YY3 Q;  2N3S A;  1I6H H;  1LYL A;  4LUO A;  4GLV B;  2ZJP A;  1X65 A;  1QVF A;  1KHI A;  3PO3 G;  1T9H A;  1VQF A;  4JI1 L;  3G6E A;  2VQE Q;  4DV3 Q;  1JMC A;  3CXC A;  4B3S L;  4LF5 Q;  4UY8 C;  2K14 A;  3NEM A;  3HOX G;  1WJJ A;  2C35 B;  3KF6 B;  3H15 A;  5GAD C;  5M5W H;  3JAM i;  1MKH A;  3OTO L;  3ULP A;  1R9T H;  1HZA A;  4WJ4 A;  1VQ7 A;  4JI4 Q;  1HNZ L;  1NBW A;  1Q81 C;  1VQO A;  3HKZ E;  5M3M H;  1S40 A;  2UUA L;  4NPS A;  3J80 i;  1LUZ A;  2EQS A;  2JA9 A;  2DUD A;  4DR6 Q;  2XTI A;  2OCE A;  3K8A A;  4NXM Q;  3U58 A;  5JJL A;  3F1Z A;  2PMZ E;  4IFD I;  1N36 L;  4LFB L;  4DV0 Q;  2D0O A;  2F3I A;  2R7Z H;  3HOW G;  3A5Z B;  2BH2 A;  4IFD G;  2NVY H;  2CFM A;  1V1Q A;  5GQO A;  4TQU S;  3CCE A;  4GOP B;  2HT1 A;  2UXC L;  4DK6 C;  2UUB Q;  5FLX c;  5C0X I;  4DR4 L;  4GLX A;  4YHH Q;  3CCL A;  4FDB A;  1QVG A;  1D8L A;  3HOU H;  2D62 A;  2HIV A;  1IBK Q;  2CCZ A;  5DLQ E;  4JBM A;  3RR5 A;  2KCT A;  5C44 G;  3NBH B;  4BA1 I;  4B3M L;  4A3E G;  4A75 A;  1KRS A;  4JI8 L;  4DAM A;  1M1K C;  3HOY G;  3I4M H;  1W3S A;  2VQF Q;  4GKK L;  5LMN L;  1X54 A;  4ALP A;  4ME3 A;  4JBJ A;  4BBR G;  2XGT A;  5GAH C;  4IJH A;  5K36 G;  2RCN A;  4BBS H;  4DV5 Q;  1Q7Y C;  3D0F A;  3ER0 A;  4A4I A;  4X64 L;  4HJ5 A;  1NMF A;  3I2Z A;  4XTC S;  1CSQ A;  1VQ8 A;  3EIV A;  1P16 A;  1XMO Q;  5IYD G;  5GAG C;  1HNX Q;  4B3R L;  1TWG H;  2NZO A;  3PIP A;  3GTM H;  1VQJ A;  1PH5 A;  3CQZ H;  4IJL A;  2ZJR A;  1Q82 C;  4JI3 Q;  4JYA Q;  1VQK A;  2VUM H;  3GO5 A;  3H0G H;  2ZTC A;  3S16 H;  3KF8 B;  2R93 H;  2Y0S G;  4XIG S;  4DKA C;  1XPR A;  2HHH L;  4LFC L;  4POF A;  3GTK H;  4IPG A;  1K3R A;  3M3Y H;  2VY3 A;  2MO0 A;  4PZ8 A;  5C4X G;  4R4Q A;  1Y1W H;  3S1Q H;  4B3S Q;  1N32 Q;  1I5F A;  3TEH B;  4DV4 Q;  1KRT A;  1O7I A;  1GO3 E;  2Q2T A;  1CUK A;  1XJV A;  3PV0 A;  3PO2 H;  1I94 Q;  4YCW A;  4LUV A;  3S1N H;  5BR8 Q;  5LMN W;  4A3C G;  4EX5 A;  1IZ6 A;  4LF4 L;  1YJ9 A;  3KF6 A;  1PH9 A;  5H1S E;  1MIU A;  4TVA B;  3PUY A;  1HNZ Q;  1OXT A;  1X56 A;  5M3F G;  3PO3 H;  3S15 H;  3CC7 A;  1N9W A;  4GN5 A;  4DUZ L;  4JC0 A;  4B3T Q;  3CPF A;  3HKZ G;  4K0K Q;  3UE1 A;  1NE3 A;  4EQ5 A;  5C3E H;  1OXX K;  1SRU A;  3JC6 6;  4R4I A;  5IP7 G;  4DR3 Q;  1IBL Q;  4L5R C;  3STB D;  4OWT B;  3M7N A;  4NB3 A;  1KC8 C;  4LF8 L;  3FKI G;  4C2M H;  1PH8 A;  2YTX A;  1K73 C;  3AQQ A;  1Q1B A;  1B8A A;  4P71 A;  1Q86 C;  4A3L G;  2JEB I;  4GN4 B;  2UXC Q;  1C9O A;  4PZ6 A;  2EXD A;  4R4O A;  4QL5 A;  1X55 A;  4JI0 L;  1MJC A;  1W2B A;  4R1J A;  3M4Q A;  3RLO A;  4GOP A;  1GD7 A;  1PH3 A;  2K52 A;  1XNQ L;  1C0A A;  2YV5 A;  4LFA Q;  4A3K G;  5FJ8 G;  4DV1 Q;  2JA5 G;  4WJ3 M;  1L2F A;  1V43 A;  3U4Z A;  3HOW H;  1A0I A;  3M4P A;  2BH8 A;  4JI2 Q;  2UXD L;  1L1O B;  2KCM A;  4B3M Q;  1PH4 A;  1BKB A;  3G48 A;  1SMX A;  4JI8 Q;  1WOC A;  3TQY A;  1QUQ B;  1QVC A;  2JA8 G;  2Q2I A;  4GKK Q;  2I0Q A;  4HJ9 A;  2F4V L;  5AJ3 L;  1HZB A;  1A63 A;  3WWV A;  3L7Z C;  4MTN A;  1VQP A;  1K8A C;  2QA4 A;  1ASZ A;  2B3G A;  3SGI A;  1ASY A;  1HJP A;  4X64 Q;  5C44 H;  3J81 c;  4HIM A;  4GOP C;  2KBN A;  1L0W A;  3CD6 A;  1NTG A;  4A3E H;  3CCJ A;  4A76 A;  1S3O A;  3HOY H;  4B3R Q;  1E22 A;  2RHS B;  4BBR H;  3RLF A;  1LTL A;  2YTY A;  4A93 G;  5IE8 A;  2K5N A;  3M9B A;  4IO9 A;  1CSP A;  2PI2 E;  1K0R A;  2E5L L;  3RN5 A;  4A3G G;  2JK8 A;  5C4J H;  4AQY L;  1YBY A;  1VQA A;  2HHH Q;  4YWL A;  4LF6 L;  4LF7 L;  3J7A 5;  3TS2 A;  1DGS A;  3EBE A;  3GTJ H;  2WB1 E;  2JEA I;  2IT1 A;  1AE2 A;  3PUX A;  3KOJ A;  1Z47 A;  2MNA A;  4A3I G;  1EIF A;  1M90 C;  2MFI A;  3RZD H;  4A3B G;  3STB C;  1PYS B;  3LGJ A;  4KHZ A;  4LF9 L;  1VQE A;  1Q46 A;  3F2D A;  1TWC H;  2UU9 Q;  4LF4 Q;  2Z0S A;  2B63 H;  3K80 C;  1CKN B;  5M5X H;  3F8T A;  3PUZ A;  4X66 Q;  3G71 A;  2A19 A;  1E7Z A;  3I56 A;  4YCU A;  4DUZ Q;  5C4X H;  4GKJ L;  3KLW A;  4OX9 L;  3GD7 A;  5ELO A;  2AKW B;  1Q1E A;  3L2P A;  3I4N G;  1CKO A;  1YJN A;  4JV5 L;  4A3J G;  1XNR L;  4MZ9 A;  4H02 A;  1JJ2 A;  3B6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...