4DR4L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4L00
1X3FA 1X65A 4JG2A 2YTXA 3CCVA 4KHPQ 3CQZH 3J81i 4QIWE 2LXKA 4P73A 3W1BA 4A3DG 1Q8KA 4AYBG 3PO3G 2AWNA 3E9HA 4LUVA 2Q2TA 2JA7G 4O2DA 4A3EG 1KRTA 3JC66 5C3EH 1OXUA 3CXCA 4TVAB 2B63G 4BY1G 3PIPA 3A0JA 5M3MG 1QUQB 2KENA 4KI0A 5IWAL 4DR5L 3PF5A 4GLXA 1K73C 1K9MC 3CD6A 4MZ9A 4A3KH 1Q81C 3NBHB 1OXXK 2PI2A 4DV4L 4IO9A 2WAQE 3S2HH 2I0QA 3CAMA 4X66Q 1YJWA 1NJIC 5GAEC 4JI4L 3M85A 3CCEA 4A93H 1WI5A 2PQAB 3TEHB 4LF5Q 5LMNQ 1TXYA 2LSSA 2CQOA 2KCMA 2PNHA 4R4QA 3W5OA 1YBYA 2VQEL 1KQSA 4BY1H 2B63H 5GQOA 4UP9A 5FLXc 2CKZB 1L2FA 1VCIA 5DLQE 1EQRA 4YWMA 4ALPA 2JE6I 1YITA 4A75A 4JI2L 3F2BA 1L1OC 4DV2L 4QL5A 1PH2A 1QVCA 3TS0A 4R4CA 4JBWA 1N36Q 1X9NA 4IPCA 1PH3A 1JJGA 5C4XG 3U4ZA 3D0FA 5GROA 1R9TH 1PH4A 4GN5A 1PYSB 1OXVA 2WB1E 2MO0A 3KDFA 4GLVB 1CKNA 2A19A 4MNOA 3SGIA 4DAYB 3CMEA 1VQ5A 1YHBA 3PCOB 1N33Q 4DUZQ 3T1YL 3KFUA 2IHEA 3UE0A 2V1CC 1HZAA 1K3RA 4A3FG 5K36G 4LUZA 4LFCQ 2UXBQ 4B3MQ 4BXXG 1NTGA 1Y1VH 5FJ8H 2VW9A 2VUMH 3S2DH 5BR8Q 4AYBE 1HZCA 1E1OA 1J5EQ 2PI2E 2VZAA 3HOWG 2K5NA 3CP0A 1WCMH 4DUYQ 2K75A 3RNUA 1SROA 1HNZQ 4GKJQ 4NPSA 2ZTEA 2GVAA 5C0XJ 2NZOA 1I3QH 4NB3A 4LF6Q 2JA5G 3UDXA 4A3FH 4LF6L 3I4MH 3RLOA 3S24A 4JI0Q 2K52A 5GADC 4NXML 4LF9Q 2AHOB 3K7AH 4IPHA 4MTNA 4OXPA 4POFA 4BXXH 1FJGL 2E2IH 4X64L 1X54A 4A4IA 4DV0L 2AMCB 4A3GH 3PUWA 3GO5A 2R92G 3HOWH 4K0KQ 2I5LX 2N78A 1C9OA 5IP9G 2L15A 4DR5Q 4B3TQ 3UDFA 4PZ7A 1XNQL 4DK3C 3HOYG 3CCLA 2D62A 4LWCA 1Y1WG 4BA2I 4QY7A 3UDGA 4B3SQ 2NVQH 1N32Q 2ES2A 4LF8L 1Z47A 1YHQA 2YU9H 4IPGA 3S16H 2ZTDA 4QJFA 4X65Q 2R92H 5JJKA 1O7IA 2MQHA 3L7ZC 4A3LG 4IOAA 3S1QH 1K83H 3M7NA 1PH6A 3G6EA 3HOYH 1HR0L 2JA9A 2HT1A 1MJCA 3KJPA 2OTLA 1H95A 1IBLL 4A3BH 1HZ9A 1BBWA 3B6YA 4QGUA 3I56A 1Y1WH 1XMOL 1PH9A 2K14A 5C0XI 3ULJA 3TRZA 1AE3A 1L1OB 4A3JG 2UUBL 5C4JH 2YTYA 1VQAA 3PV0A 2HHHQ 2BH8A 3H15A 3HOVG 4P71A 1X3GA 2YV5A 1VQMA 2JA6H 5HGQA 1VQGA 4OO1G 3GTMH 1B7YB 1B8AA 1A63A 2ASBA 4GS3A 3STBD 3K80C 3K81C 1RIPA 1UE5A 3PUVA 2I5MX 5EAYA 1IL2A 4FDBA 4GLAC 4R4IA 4GOPC 4BY7H 1VQKA 1VQCA 4POGA 1KC8C 4DK6C 4JCVE 1HNXQ 4AIMA 2R7FA 3KLWA 4LF4L 2MO1A 4O0AA 3GTQH 3CMAA 1YEZA 4YCVA 1GVPA 4R1JA 1C0AA 3S15H 2WB1G 2R7ZH 1KXLA 2RCNA 4DV0Q 1NE3A 3CCQA 3CC7A 4A3MG 3VDYA 5LMUQ 3H0GG 2NVTH 2QEXA 1N8RC 1WFQA 2OWOA 3RZDH 4NXNQ 2VY3A 5JJIA 4BBSH 2OTJA 2GN5A 1Q12A 2ZJRA 2UXDQ 4DR1L 3PO2G 4DR2L 1I94L 2HQLA 2JK8A 4JI3L 3ER0A 1CSQA 2K5HA 3FP9A 1E7ZA 2CWPA 3NENA 3J7ZC 4A3MH 2CCZA 3BZCA 5GAHC 3H0GH 5IYCG 2JEAI 3RLNA 1A8VA 4JI8Q 1IXRA 1EIFA 2D0PA 3JAMc 1VQPA 1IBLQ 4A3DH 1VQNA 1KHIA 3PO3H 1YIJA 4EQ5A 2JA7H 3EN2A 3PO2H 4A3EH 3KF6A 2QA4A 3M9BA 2R6GA 3EBEA 5M5WH 3OW2A 4AQYL 2VS1A 4IJLA 2ZJQA 1UE6A 2YTVA 2UUBQ 5M3MH 2NN6G 1YNXA 3HOZG 1HJPA 4DAMA 1XPOA 1PV4A 4JV5L 1IBMQ 5M5XH 5IYCH 3KYHC 4JI1L 4ME3A 1KD1C 2UUCL 1X56A 4RG1A 1QZHA 1YZ6A 1ASYA 4P75A 1X55A 4UY8C 2JA8G 2UXCL 4L5QA 4XIGS 3GD7A 3CW2C 1V43A 5M3FG 3RN5A 2KHJA 4LF7L 1WOCA 3PUZA 3F2DA 1XMQQ 2UU9Q 4IFDG 1G6PA 3HKSA 3F1ZA 3LGJA 3AYHB 4A3IG 2VL6A 2R7DA 4HJ9A 4LFAL 2F52A 2IHFA 2ZM6L 1N34L 5JEAG 1FL0A 1WYDA 4GOPB 4YHHL 1T9HA 1TWHH 3F8TA 4R4OA 1S72A 3RZOH 5IYDG 2LXJA 1X3EA 3CCSA 4HIDA 1JT8A 2VQFQ 3OTOL 3H3VI 4DR6L 3BJUA 4HIKA 5C4XH 4YY3L 5IYBG 2E5LQ 1HNWQ 3PGZA 4A3IH 4DR7Q 1Q7YC 3GDEA 4OONA 4KLKA 1QVFA 2VNUD 4JOIA 1UE7A 3ZJYC 4JC0A 5FLMG 3HOXG 1PH7A 5LMNW 2JJQA 5AJ3Q 1MKHA 1ASZA 3AFPA 1TWAH 4B3RL 2Q2HA 2ATWA 3A5ZB 4IJHA 4DV1L 2E2HH 1SE8A 3I55A 2Q2UA 1LUZA 1NMGA 4DR2Q 1I94Q 5JJLA 1G291 4JI3Q 3M4OH 3J80c 1BVSA 1XPRA 1JJ2A 4QQBX 3K7UC 1XNRQ 5IWAQ 3HOXH 3RR5A 2I5HA 4LFBL 1K8GA 1N9WA 2HIXA 2RF4A 2JA5H 4DV4Q 1IBKL 3PF4A 2R93G 4PG3A 3G48A 1YJ9A 4JI4Q 1QUQA 4JBJA 2Y0SE 3U50C 4KHZA 2Z6KA 3J81c 3HFZB 3KJOA 2VQEQ 1RL2A 1XPUA 3DLLA 2KCTA 4BA1I 5IP9H 4OX9L 1VQ8A 4RMFA 3WWVA 4JV5Q 2PQAA 1KRSA 2JQOA 2R93H 4JI2Q 1VQ6A 1XTDA 3U58A 1JB7A 4DV7L 3K8AA 1QVGA 1UE1A 1LTLA 2EXDA 4R4TA 4DV2Q 1VQ9A 2UXCQ 2NVYH 2IX1A 3GTPH 3G4SA 4LF7Q 2B29A 3HOUG 2NZHA 1JJCB 2WFWA 3RLFA 4HJAA 4GNXA 4KHPL 3TREA 3ULPA 4A3LH 4OWWB 3PUYA 3AEVA 4HJ7A 4IOCA 1J6QA 4LFAQ 5ELNA 1XNRL 2ZM6Q 3ICEA 2OQ0A 5H1SE 3T1YQ 3HKZG 3M3YH 3GTOH 3F2CA 1JE5A 5IY0A 3S17H 1VQDA 1PYBA 1OTCA 1GO3E 4A3JH 3OTOQ 4A3KG 4C3HH 4X66L 2JEBI 4YY3Q 1PH5A 4DV6L 1OXSC 1YHAA 2F4VL 1A0IA 3HOVH 4LF5L 5LMNL 2YYZA 3CPWA 1WJJA 4HJ5A 1SN8A 4JYAL 2E8GA 1FGUA 4X62L 3I2ZA 3PSIA 4GNXC 4WJ4A 4IPDA 4OWXB 3I4OA 4NXMQ 1FJGQ 3S14H 1PFSA 4X64Q 3KDFB 1CKNB 4LUOA 1GKHA 1TWCH 4DR3L 3PIOA 1OXTA 4JI5L 3TQYA 1Q86C 1AE2A 2GVBA 1N36L 2CFMA 4C3IH 4LFBQ 1XNQQ 4P74A 3CCUA 5J3BA 4YCUA 5C0XG 4JBKA 2IT1A 3M4QA 5C44G 1IBKQ 2N8NA 1P8LA 1N33L 4DUZL 5IT9c 3CCMA 4LF8Q 4PZ8A 2C35B 1Q46A 4LFCL 2UXBL 3GTJH 4B3ML 3I4NG 2FXQA 1SLJA 4A3CG 4OX9Q 1E24A 4H02A 3MEFA 1HR0Q 1I50H 1E22A 1UEBA 4P72A 2A1AA 5C44H 1QZGA 1IZ6A 1HNZL 4GKJL 3HKZE 1XMOQ 4APVA 1PHJA 1D8LA 3W1GA 1VQ4A 4JI7L 3S1NH 4GN4B 4YWKA 1Q82C 2N49A 1A62A 4JI0L 1FVIA 4LF9L 2Z0SA 1EQQA 1VQJA 1CKMA 1SRUA 2RHSB 3I4NH 4Y7NH 4A93G 4A3CH 2ALYB 3U4VA 1SR3A 1L1OA 2Q2IA 3GTLH 5IE8A 4K0KL 4LW1A 3KF8B 3CCRA 2Y0SG 4B3TL 1I5FA 1SMXA 5GAGC 1TWFH 3TS2A 3AQQA 1E3PA 2RHQB 3HOZH 2B3GA 3A5UA 4B3SL 1N32L 4DV6Q 1EFWA 3M4PA 2F4VQ 1K0RA 1V9PA 3MXNB 4X65L 4JYAQ 1V1QA 4X62Q 3CC2A 2JA8H 5M5YH 4LF4Q 4HIOA 2E2JH 3E0EA 5M3FH 1VQLA 4JI6L 4DKAC 2N3SA 1PH8A 1I6HH 4GNXB 5HY6A 4EX5A 1B70B 2HIVA 1W3SA 2KHIA 4DV5L 1HR0W 1S40A 1NMFA 1VS0A 3OYYA 1IYJB 4DR3Q 4JI5Q 5IP7G 4HJ8A 1VQFA 1Y1VG 5FJ8G 2KBNA 1K8AC 2VUMG 1NY4A 1PH1A 1CSPA 1DGSA 3PUXA 3STBC 2OQKA 2PMZE 2HHHL 1XJVA 4LNQA 3D31A 5IYDH 1WCMG 2UUAL 2K4KA 4A76A 2ZJPA 3L2PA 4DR1Q 5IYBH 3I7FA 4XTCS 3I4MG 4BBRG 1BBUA 1CUKA 2IX0A 5E7NA 1U0LA 5IP7H 4J15A 5FLMH 4GKKL 4OWTB 1EUJA 3T1HL 1LM0A 1C7YA 1VQ7A 1KAWA 1Q1EA 2OCEA 1AH9A 4YCWA 4A3GG 1L0WA 1M90C 3L0OA 1LYLA 2BA0A 1PA6A 4JI7Q 1HNXL 1EYGA 4JOIC 4AQYQ 4X6AH 4BBRH 1D7QA 3EIVA 1Z9FA 1Q1BA 2XGTA 4PMWA 1YI2A 4OO1I 4DV3L 2H5XA 4JI1Q 4DNIA 2NVXH 2UUCQ 1KL9A 1EOVA 3JAMi 4UP7A 4DR4L 4TQUS 3KOJA 5LMUL 3ULLA 1X6OA 4NXNL 4DPGA 3DM3A 2AKWB 3RN2A 4A3BG 2UXDL 2K5VA 1Y14B 2MNAA 3BU2A 2EQSA 4AH6A 3CCJA 1N34Q 2ZTCA 4WJ3M 4UPAA 4YHHQ 4L5SA 2CWAA 4L5TA 3UDIA 3H3VH 1VQBA 2Z6KC 3UE1A 1M1KC 3G71A 2F3IA 3KF6B 3HOUH 3FKIG 2DUDA 4JI6Q 4L5RC 4JI8L 4DR6Q 2IY5B 2BH2A 2BA1A 1TWGH 4GOPA 2JA6G 4DV5Q 3S1MH 4IFDJ 2MFIA 1KIXA 2ID0A 1UWVA 3CPFA 1U5KA 1YVCA 2WP8J 3NEMA 1VQIA 1CKOA 4B3RQ 4GN3B 2AWOA 1GD7A 2EIFA 5JEAJ 1MJEA 1GM5A 1IBML 3AFQA 3FKIH 2A8VA 4BY7G 4DV1Q 3CC4A 1BKBA 1HZBA 2WAQG 2UUAQ 3Q8DA 4YWLA 2QGQA 3BZKA 4PZ6A 1W2BA 3E9IA 2DGYA 4Y52H 3CF5A 1NBWA 2UU9L 1XMQL 4GKKQ 1VQOA 1EWIA 3FHWA 3T1HQ 3GTGH 3J7A5 2R7ZG 1P16A 1HH2P 1MIUA 1S3OA 1VQHA 3IRBA 3NELA 1PVOA 2NN6I 3GTKH 3K0XA 4C3JH 2XTIA 1SFOH 1EIYB 2D0OA 4C2MH 4BBSG 3ERSX 3J80i 1YJNA 1JMCA 2VQFL 4DV3Q 3A74A 5BR8L 2E5LL 1G51A 4JBMA 3J81j 5C3EG 1J5EL 4DR7L 1HNWL 1VQEA 4HIMA 4IFDI 4DUYL 5ELOA 4DV7Q 4DR4Q 2K50A 3S1RH 4UP8A 5AJ3L 1E1TA
chains in the Genus database with same CATH superfamily
1IHZA 2L12A 3CCVA 1B9MA 4EGVA 1CHQD 4P73A 1WD1A 1Q8KA 4LUVA 5EKIA 4A3EG 5C3EH 3I4MB 4PNYA 5IWAL 1DOKA 3PF5A 3CD6A 2F0DA 4A3GB 2X6GA 1NJIC 1YJWA 4JI4L 4A93H 3CCEA 5ELCA 3OWEB 5CYUA 3TEHB 4LF5Q 2O4XA 4R4QA 1HTPA 2B63H 2A69C 4B9XA 4KTAA 1L2FA 1VCIA 5DLQE 1HUMA 3KBXA 4E6IA 5DM63 3OHXC 4G7ZC 1C48A 1E2VA 4A75A 1TS4A 1HFGA 2PZTA 4LMQD 3IFDA 4FF1A 4R4CA 1N36Q 5C4XG 3ND8A 3U4ZA 1R9TH 1PH4A 3S1MB 1CKNA 1H9JA 2A19A 3DXJC 4EQNA 4KY6A 5FO9B 2EY2A 4UAIA 3HKZB 5K36G 4LFCQ 2UXBQ 4C1NK 1NTGA 4AYBE 2EJMA 2XSCA 1ML0D 2WACA 3CP0A 1WCMH 2K75A 4NPSA 2ZTEA 5C0XJ 4NB3A 1I3QH 2F0IA 4HSVA 3IAYA 5JVH3 4BXXH 4V0BA 2WAQB 3J80L 4ZUJA 1UAPA 1DONA 2AMCB 4K0KQ 3MC0B 2N78A 4B3TQ 3UDFA 1GXDC 2R7ZB 3CCLA 5JPMC 3NSWA 3M4YA 5CC4A 4QY7A 4L6TB 3F2UA 2ES2A 1Z47A 1EFID 1SNPA 4QJFA 1Y8NB 3I70A 4IOAA 1FNUA 2MQHA 3S1QH 4FXGC 2ZXOA 3HOYH 5C3EB 4ZLTF 1IBLL 4A3BH 3B6YA 4QGUA 1PH9A 1WTQA 1PRTC 3BS1A 2WKDA 4N9TA 1AE3A 1L1OB 1QNUA 4A3JG 4A3DB 3A8JE 4UDUC 2YV5A 4DXFA 1QILA 2B63B 4K5VA 1B7YB 1B8AA 5M3MB 2B8FA 5CR3A 2ASBA 4GS3A 2I5MX 1WTWA 4R4IA 5C5MA 3SVMA 1QG7A 1VMCA 1SNQA 3X3MA 1KDAA 4C3IG 3K5MA 2B2YC 2I46A 4AIMA 1R9TB 1V1PA 3H94A 1GVPA 2EJGC 1TS3A 2FFKB 3EA6A 1TWHB 4WJWA 4DV0Q 3CCQA 1SE3A 4G4KA 2QEXA 3T16A 2OWOA 2VY3A 4BBSH 2K32A 1A2UA 2RKSA 2ZJRA 4DR1L 1I3QB 1BCPC 3FP9A 1E7ZA 3NENA 3I73A 1IL8A 4H13C 4BS9A 2KOLA 3RLNA 1I4RA 1IXRA 1VF7A 1VQPA 1SNDA 1KHIA 4A3EH 3KF6A 3EBEA 1GHKA 5M5WH 2VS1A 1LTTD 4XDXA 1HJPA 4DAMA 2B2UA 1JORA 2IJ0A 4RG1A 1CZGA 1QZHA 4P75A 1FYCA 4L5QA 3S1QB 1V43A 2LMCB 1SYBA 3HOYB 3F1ZA 3AYHB 4CJ1B 1CA5A 4H0LC 2F52A 3GQBA 2IHFA 3R2IA 4GOPB 3F8TA 3RZOH 4HIDA 3H3VI 4HIKA 3SEBA 5C4XH 4YY3L 5IYBG 2E5LQ 3PGZA 1Q7YC 1JB3A 1GUTA 3S17B 1AW7A 2D9UA 3H09A 1GUWA 5LMNW 2CQAA 1MKHA 1HPCA 1TWAH 5K36H 1E2ZA 4EVOA 3HOVB 5I2YA 3QIAA 1NMGA 1FR3A 5IIFA 4JI3Q 4DAPA 4QUFA 1XNRQ 1K8GA 2R93G 4KJOA 1U4PA 3TZDA 4KN7C 3QOLA 2ICIA 2F0FA 3U50C 4N8FA 3J7AF 5EKLA 1RL2A 1CK1A 1D1IA 2F0KA 4BA1I 3WWVA 4JV5Q 1KRSA 1O80A 2WB1B 1A3UA 4MIUA 3U58A 1JB7A 2A69D 1UE1A 2EXDA 5C5LA 3K5NA 1Q8IA 2F03A 4HJAA 1H9SB 5E4WC 4LJZC 4KKSA 4LFAQ 3DHQA 2ZM6Q 5M5WB 1II3A 1J8IA 4FF4A 4Y7NB 1PYBA 4EQPA 4KV6A 1GO3E 4CDFC 3OTOQ 4A3JH 1B3QA 1ICWA 1PH5A 5LMNL 2NBFA 1SN8A 2OF1A 4PMBA 1RTOA 3V05A 3I2ZA 4I7ZC 3PIP3 4NXMQ 5G3LD 5FKAC 3KDFB 5M5YB 1TWCH 1O78A 4DR3L 1OXTA 4JI5L 3RZOB 2L5TA 2CFMA 4C3IH 3VYRA 2F0QA 3DWQA 2IWHA 5C44G 2ICEC 3M4QA 4ABNA 1P8LA 4DU9A 1K8OA 4ZCKA 4PZ8A 1TWAB 1Q46A 5ISRA 4K6LA 1C4QA 3AU7A 1SLJA 4A3CG 3KBGA 5C0XH 1E22A 1EYCA 1HNZL 4GKJL 1XMOQ 1PHJA 1G6PA 4YWKA 1AP0A 1PRTB 2X6LA 4ID6A 3BVMA 3I4NH 1GUSA 3P75A 1AN8A 1PRTD 5ELEA 5J1ZA 2OT2A 4GZYC 2LFNA 4ULLA 1EIGA 2Y0SG 1NAPA 1SMXA 1VMPA 2N88A 3NHHA 1TWFH 4EQOA 1LTAD 4F87A 1N32L 2F0PA 2G9DA 2RA4A 3BYYB 4J1MA 2JXMB 5CORA 1STHA 4DV6Q 2H1EA 3IKJA 1RHPA 5KRUA 1IKLA 3CC2A 4X62Q 1TIID 4LF4Q 3E0EA 2F0TA 4JI6L 1PH8A 1XTCD 5HY6A 1B70B 3A54A 1QE6A 1S40A 2K01A 2XRSD 1MSGA 4HJ8A 3NE5B 4A3JB 2KEDA 3PUXA 3STBC 2OQKA 4J8QA 1B9NA 2M00A 3BDOA 4A76A 5IYBH 5G3LF 3I4MG 5CBAE 4K5WA 2IL8A 2SNMA 4GKKL 5JJZA 4ZAIA 3TP5A 1C7YA 1TQOA 3V96A 1AH9A 1H9KA 1TWCB 1L0WA 4A3GG 1BCPD 1R4PB 3DEOA 1ILQA 1O7LA 1RJTA 4JI7Q 4C3IB 5HURA 3RD4A 4X6AH 4BBRH 1D7QA 3LX0A 1Q1BA 4PMWA 4JI1Q 3GTKB 2HCCA 2K5WA 2EZVA 4DR4L 3KOJA 5LMUL 3MZ5A 5ELFA 1M4VA 4DPGA 2DJGC 5LL6X 1ENCA 4QB4A 5HGTA 1ZKOA 4HSPA 2EQSA 5LL6S 3DWAA 4UPAA 3TMEA 4YHHQ 1Z7TA 4L5TA 3I4NB 3UE1A 1M1KC 4CGYB 2F3IA 1SJED 4DR6Q 3AB9A 2BA1A 2BH2A 4DV5Q 1JQYD 5DAUA 3TP6A 1EWHA 1UWVA 3D6CA 1TWFB 4R8NA 1YVCA 1PTOH 2WP8J 3NEMA 1LT6D 1PFBA 2EYPA 4GN3B 1GUGA 1RODA 2AWOA 4UHVA 3SK5A 3FKIH 2F0WA 2WAQG 3BZKA 2K28A 3MEHA 3E9IA 3VR2A 1XMQL 4FF2A 3P20A 1EWIA 1WTPA 2R7ZG 1HUNA 1P16A 3L3OC 1HH2P 1S3OA 3RUZA 1PVOA 2NN6I 3BVGA 1NR4A 5LHY1 3NWSA 1SE2A 3K0XA 3G7LA 1SXTA 4C2MH 5IGFA 1EIYB 1LTID 4FO2A 3J80i 2VQFL 4DV3Q 5BR8L 5BN3A 4JBMA 4TSSA 1HNWL 5C3EG 4DR7L 1DYQA 4IFDI 4DUYL 2K6AA 1BCPF 1CT1D 1LLRD 1TS2A 4LF6L 1X3FA 1X65A 1V1OA 3WOFA 2KA7A 3TBIB 3DEPA 3MHBA 3J81i 4KHPQ 2F0UA 1SNCA 4A3DG 1G91A 2Q2TA 2KVMA 1S5ED 3CXCA 4BBRB 1UEAB 4TVAB 2B63G 5M3MG 4GLXA 2GA4B 1OXXK 4IO9A 3S2HH 3CAMA 5KNCA 3CU7A 3W5OA 1YBYA 2VQEL 1KQSA 4BY1H 4UP9A 2CKZB 4MHEA 1HFNA 1RTNA 2C5CA 3OMCA 4JI2L 3F2BA 1C8CA 1X3QA 1S5BD 1L1OC 1K83B 1PH2A 3TS0A 3VYSA 4CHTB 5EBCA 4JBWA 5I6YA 3GV3A 4IPCA 1JJGA 2F0GA 4GN5A 4R8IA 1A63A 4GLVB 4DAYB 3CMEA 2Z4IA 2PYKA 1YHBA 4V190 3A7AB 1PTOB 3K5LA 4DUZQ 1HZAA 1K3RA 3A55A 5E1FA 5I9PA 3FKIB 4BXXG 3BVZA 2JA6B 3J7YW 2Q8TA 1HZCA 1E1OA 1KDBA 2PI2E 4ZKBB 3RNUA 1SROA 3HS0C 5JAVA 4N9PA 2NZOA 2SEBD 4H44C 2XN9C 2JA5G 3I4MH 4A3FH 1ENFA 3S24A 3MTSA 5GADC 1ESFA 4LF9Q 2AHOB 4MTNA 4IPHA 3D6WA 4X64L 1X54A 3D8GA 4A4IA 3C1FA 4A3GH 3PUWA 4C2MB 3GTQB 2B2WA 4KN4C 2EYOA 1C9OA 4OGQC 1XNQL 4DK3C 3HOYG 3PQIA 2JYOA 1B53A 4BA2I 3KF8A 3H6MA 4LF8L 3NQTA 5CBEE 4A3LG 4BWGB 3HGBA 1PH6A 2PMZB 4X3SA 5KNBA 1HR0L 1EY9A 3E5SA 3KJPA 3A8KE 1H95A 3BG3A 2VB3X 3I56A 1JWMD 1Y1WH 4U68A 1F9QA 1V8QA 3S2HB 3TP7A 2YTYA 2HHHQ 1AZQA 3HOVG 3MXPA 1X3GA 2EE1A 1VQMA 4BY1B 2TSSA 3Q22A 4ZK9B 3UI2A 3STBD 3K80C 4IUQA 2BDOA 3TP8A 3X3NA 1IL2A 2QCPX 4GLAC 2KJXA 4GOPC 1LABA 2F0EA 1VQCA 2CW0C 1SYDA 1KC8C 3IL8A 4JCVE 1HNXQ 4OO1H 2R7FA 3KLWA 2MO1A 4O0AA 1STGA 4Q5VA 2A6HC 1LACA 4PV1C 1ET9A 4U673 2WB1G 2SDFA 2R7ZH 1KXLA 2SNSA 3R3OA 2A74C 4QF4A 3CC7A 2Q8RE 5D3IB 2NVTH 1IYUA 3DWPA 1N8RC 4NXNQ 2RSOA 3OW7A 3MXUA 1ONLA 2UXDQ 1I94L 2JK8A 4A3FB 1CSQA 3QR8A 3J7ZC 4A3MH 1EY4A 1TKWB 3H0GH 4KJNA 2JEAI 1FNWA 5CMDA 3U9SA 4JI8Q 5BN5A 1IBLQ 1KABA 4A3DH 1S5CD 1YIJA 1B3AA 2MGSA 3M9BA 4AQYL 4IJLA 1EEID 5M3MH 3HOZG 3SK8A 2UUCL 3OIPA 1I6VC 1Q3LA 1W6JA 1KTKA 1X55A 1EQVA 1O7YA 4LAAA 2UXCL 4XIGS 4XQNA 2EVBA 2A6EC 3RN5A 2CH4W 3MAQA 3PUZA 3F2DA 2UU9Q 1WVLA 2K04A 2B2VC 4OIKA 3LGJA 1Y1WB 2R7DA 4HJ9A 5FLXE 2KECA 4ODGA 1WYDA 1T9HA 4NDXA 1TWHH 4R4OA 1KNAA 3I8ZA 5IYDG 1LTSD 4OHJA 1QB5D 4QIWB 5BN4A 3WOEA 2J7ZA 4A3IH 4KLKA 2VNUD 4JOIA 4CDCC 5FLMG 2JJQA 1VDZA 2FHTA 3AFPA 2Q2HA 3A5ZB 4IJHA 2M9VA 2MHVA 1SE8A 3I55A 2PW7A 4FVMA 5FOBB 5JJLA 1EQTA 3J80c 1JJ2A 3K7UC 4QUCA 3RR5A 2L4NA 1MHWC 4LFBL 2PCFB 3WDNA 2JA5H 1N9WA 2RF4A 4DV4Q 4PG3A 3I4LA 5AFWA 4QCLA 1QUQA 1UNSA 2Y0SE 3J81L 2NVTB 1R4QB 2Z6KA 3NBHA 3J81c 3HFZB 4NW2A 3DLLA 1STNA 4OX9L 2PQAA 3K8AA 1LTLA 4DV2Q 4A3MB 5CGKA 1VQ9A 3H0GB 3G4SA 1QJOA 2B29A 2NZHA 3HRZC 4GNXA 2OEOA 1HTLD 1SMYC 3ULPA 4A3LH 4RFBA 3VR3A 3BYTB 5ELDA 2F0HA 3ICEA 2PZWA 3T1YQ 3T56B 3F2CA 3S17H 1F77A 1OTCA 4FYDA 4C3HH 1BXTA 2JEBI 4DN4M 4YY3Q 1YHAA 3A56A 3HOVH 4LF5L 3VYTA 1TY2A 1X32A 4JYAL 2EOTA 1A15A 4DK0A 3R93A 3G6JB 3T53B 4IPDA 4OWXB 3U9OA 1FJGQ 1PDQA 5A2QL 1PFSA 1CKNB 1GKHA 4K5XA 1CTMA 1N36L 1HHVA 4YCUA 5C0XG 4A3IB 4JBKA 2VB2X 2KQ3A 2EXZA 4HR7B 4LFCL 2UXBL 3I4NG 2FXQA 5EPJA 2NUCA 4H02A 4P72A 1SYGA 3HKZE 1D8LA 2B2TC 4K2LA 2JA5B 1A62A 2J4XA 1EQQA 1VQJA 1CKMA 3KLSX 5ELBA 4XT3B 4Y7NH 1SR3A 2KCCA 1AFPA 3QOJA 4K0KL 1HRJA 3JAME 4B3TL 1I5FA 5CV6A 3AQQA 2RHQB 5FO8B 2B3GA 3HOZH 1B2TA 3NK9A 4CKBA 5M5YH 2K05A 4HIOA 1JOKA 3DUZA 4HMJA 4DKAC 2N3SA 4K6DA 4GNXB 1QCBD 2KCNA 2CW0D 4HAEA 1G6ZA 1NMFA 4DR3Q 4JI5Q 5EGTA 2A6HD 5FJ8G 2KBNA 3SXHA 5C3WA 1PLFA 4C3HB 1CSPA 3NP8A 3D31A 5IYDH 1PZKD 2K4KA 3I7FA 4IUTA 4XTCS 3MWYW 4BBRG 2PNRC 2ZT9C 5CV5A 1JOQA 1BBUA 5IP7H 5FLMH 4J15A 1EZ8A 4OWTB 1EUJA 3T1HL 1VQ7A 2E2DC 1KAWA 1Q1EA 1G8ZD 1V1PB 2QW7A 3L0OA 1STEA 2BA0A 3Q24A 5JPNC 1PA6A 3NUCA 1EYGA 3GTGB 4P2CB 3EIVA 2XGTA 3O13A 1LT3D 4DNIA 2NVXH 1KL9A 5DNFA 4TQUS 2MUYA 5CV4A 3ULLA 4R9WA 1X6OA 1Y14B 3BU2A 2A6ED 1JOOA 3CCJA 1N34Q 2CWAA 3H3VH 3UDIA 2EY1A 2OXPA 1CZWA 1LTBD 3KF6B 3FKIG 2DUDA 4JI6Q 2F0JA 4ME5A 2IY5B 2JA6G 2E74C 1TWGH 2FMCA 4IFDJ 2MFIA 1KIXA 2ID0A 4C1NI 1U5KA 1Y8PB 1VQIA 2F0MA 3SE0A 2F0NA 1CKOA 3HOZB 4B3RQ 1GD7A 5JEAJ 3AFQA 4DV1Q 3Q8DA 1WD0A 4DK1A 1I4XA 4G7OC 4PZ6A 1MI2A 2RDGA 3FEWX 2DGYA 2G5DA 3CF5A 2BCOA 4GKKQ 1XXGA 2K7VA 3J7A5 2AQ1B 1PTOC 2EY5A 4NMZA 3NELA 2BOSA 3GTKH 3ND9A 1K0SA 2QEJC 2E5LL 1G51A 1J5EL 4DV7Q 4DR4Q 5T1GA 3EROA 3OWFA 1Y1VB 3S1RH 4UP8A 2VUMB 2Z6BA 2YTXA 1NUCA 3BDLA 5IT9E 2LXKA 4AYBG 4N8X1 3PO3G 3E9HA 2JA7G 3A7LA 2R3ZA 3JC66 2R61A 2AQ2B 3QG1A 4BY1G 3PIPA 3A0JA 1K73C 4DXGA 4KI0A 1SMYD 4DR5L 1K9MC 1XNRL 3VR4A 1MD2D 4MZ9A 4A3KH 2NVXB 1X3PA 2PI2A 4X66Q 5EQ0A 3M85A 1WI5A 2LSSA 2KCMA 1EQRA 4YWMA 4ALPA 4ILWA 1YITA 1YNNC 2EYJA 5IGEA 3HZXA 2F4IA 5M9OA 1HA5A 1PH3A 1TWGB 5GROA 1CI3M 1OXVA 2WB1E 2MO0A 3SGIA 1JC7A 3NXWA 3QJYA 2PPBC 1N33Q 1CM9A 3KUPA 4F88A 3UE0A 4C56C 4A3FG 4B3MQ 4HCEA 2LKVA 5FJ8H 2VW9A 2CH4A 3S2DH 5BR8Q 1HA6A 2V4DA 2ZXRA 1GUNA 2VZAA 4DUYQ 3D4WA 1Y8OB 2GVAA 1BNZA 4LF6Q 2EYMA 3J7AV 4JI0Q 2K52A 2XWBB 1ZEQX 4NXML 5IGGA 4POFA 3H91A 3MVVA 2E2IH 5COYA 3FVQA 4DF7A 3GO5A 3HOWH 2Z1CA 2PQEA 5IP9G 2L15A 2Z8LA 3OOCA 2VXWA 4LWCA 1Y1WG 4B3SQ 2NVQH 3S1RB 4G57A 2JN4A 1PRTF 2SOBA 4KHVA 4X65Q 2R92H 1O7ZA 3PIO3 1K83H 3M7NA 3NTKA 4YIJA 5KIXA 4DAVA 2HT1A 3MXNA 5E4XA 1HZ9A 1BBWA 1XMOL 4F7XA 4A3KB 1MGSA 3ULJA 2B2WC 3K6OA 2QDLA 2UUBL 1A2TA 1U4RA 3PV0A 4HTHA 2BH8A 2EYFA 1EEFD 3H15A 3S9WA 1EYAA 2JA6H 5HGQA 4OO1G 2BE5C 3CKIB 4FF3A 3K81C 4HN7A 1RIPA 2L0CA 1UE5A 4DNTB 5EAYA 4FDBA 3ZYYX 3R2TA 1TR5A 1CHPD 4LF4L 2K5DA 3GTQH 3CMAA 1YEZA 4YCVA 3SR1A 3Q0AA 4R1JA 4FNFA 1C0AA 2JP1A 3K58A 1FD7D 5J22A 2MPMA 4RCNA 1NE3A 2C9OA 1LTRD 4A3MG 3H0GG 3S2DB 1WFQA 3RZDH 5JJIA 4Z9CB 5IT9L 1Q12A 4DR2L 2ENBA 3ER0A 2K5HA 5IGBA 2BDNA 3BZCA 2E2IB 2Q8IB 4RKBA 1A8VA 1EIFA 2D0PA 2HCIA 1L0YB 3HOWB 1VQNA 3PO3H 4EQ5A 3GP7A 2JA7H 3PO2H 1D5MC 3OW2A 1UE6A 4HMIA 1EY5A 1YNXA 5DEHA 2NVQB 1XPOA 1IBMQ 5IYCH 1JWSD 4JI1L 4ME3A 1KD1C 3FRPB 4OELB 1ASYA 2R92B 3GD7A 4TKOB 4LF7L 2KHJA 1S5FD 2Z4HA 4X3UA 5I6WA 4ZQ3A 2NN6H 5A35A 4A3IG 4S3SA 2VL6A 2NVYB 2F0LA 1FL0A 2B39A 2LS01 4YHHL 2CHBD 2P5ZX 3CCSA 2LXJA 1X3EA 1PTOD 1RKNA 5EKKA 4IFDH 4DR6L 3BJUA 2QILA 3GTOB 1QVFA 3GDEA 1ICFB 4OONA 3ZJYC 1UE7A 1PH7A 4JC0A 5JEAH 1GOZA 5AJ3Q 2ATWA 5CV7A 1DOLA 5CV9A 1Q90A 1LUZA 5C4HA 1I94Q 1F9RA 3M4OH 4QQBX 4L8JA 5IWAQ 3HOXH 2I5HA 2G9HD 3S14B 1BBXC 4PMCA 3K59A 2HIXA 1IBKL 3PF4A 2EY6A 3G48A 4JI4Q 1G2TA 1D2BA 1EL0A 4JBJA 4K8JA 5D3DA 3RZDB 3EVQA 3P1HA 5FK9C 3KJOA 1XPUA 2KCTA 2I07B 5IP9H 1VQ8A 1I4PA 1DM0B 2JQOA 3OSOA 1VQ6A 2PO4A 1XTDA 1SBBB 4R4TA 1JE4A 2UXCQ 3GTPH 2WFWA 4KHPL 1I4QA 4C3HG 1RD9D 1YNND 2DNEA 3TREA 4OWWB 3AEVA 2XVSA 4AYBB 3PO3B 2JA7B 4IN3A 3PO2B 4HJ7A 4IOCA 1J6QA 5ELNA 3TZUA 4XXEA 1JE5A 5IY0A 4XT1B 5C6AA 3K0YA 3D3RA 2F4VL 1OXSC 1A0IA 3E6ZX 2RQXA 2YYZA 3CPWA 4HJ5A 3C3LA 2E8GA 1FGUA 4I65A 1W6KA 1GHJA 4GNXC 1A3VA 2FJ2A 2KEEA 1SYEA 5E3FA 1WTXA 1KLGD 3I4OA 1PTOF 1ZYRC 5KYLA 2JA8B 4LUOA 3TQYA 4J6HA 5M3FB 2HQEA 2LY7A 1YNJC 1HQRD 4LFBQ 4G7HC 3K5OA 5J3BA 1PYWD 2IT1A 5KNDA 1D5XC 2PZUA 4DUZL 2C35B 3GTJH 2J0TD 2A68C 1L0XB 1BF4A 4OX9Q 3W3AA 1IKMA 1E24A 3MEFA 1NSNS 1I50H 1UEBA 3M4OB 2EYHA 1ESRA 3LWEA 1EOTA 3HOXB 3VA5A 2FMMA 3W1GA 1VQ4A 2WKCA 1QWYA 1Q82C 1FVIA 4LF9L 4RWSC 1JICA 1T5XD 1F9SA 2ALYB 2IW3A 1L1OA 2Q2IA 3GTLH 5IE8A 2MP1A 1SEBD 3KF8B 3CCRA 3KK7A 3Q23A 2AUJD 1F2LA 1E3PA 1EZ6A 3W2DA 3A5UA 1EFWA 3M4PA 2BE5D 4IALA 1K0RA 3GTPB 1LT5D 4JYAQ 1V1QA 5KYIA 2DNCA 4K8IA 1VQLA 1I6HH 2HDLA 4KD3A 4EX5A 2B2UC 1W3SA 1VS0A 3OIQA 5IP7G 1MSHA 3HOUB 1VQFA 2NB0A 1Y1VG 5K5PA 1K8AC 2K1BA 2VUMG 1NY4A 1PH1A 1DGSA 2HHHL 2PMZE 4L63B 1FNVA 4LNQA 1PMRA 5KEEA 2UUAL 1CFMA 4DR1Q 3E0JA 1SSOA 1QNKA 3EQLC 5I2XA 1CUKA 2IX0A 5TSSA 1U0LA 1UUPA 4KK7A 1CQFA 1LYLA 3DMUA 1B1ZA 1HCZA 2O5JC 1HNXL 1Z9FA 3LNNA 5T1IA 3K57A 1YI2A 4FXDA 1IYVA 4OEMB 3JAMi 3GTJB 4UP7A 4FXKC 3VYUA 4NXNL 4NKLA 3DM3A 1BDOA 1I50B 2AKWB 3RN2A 4RCOA 2UXDL 3SHLA 2MNAA 3I90A 4AH6A 4WJ3M 2ZTCA 4RGTA 4KD4A 4L5SA 2XRQD 1VQBA 3G71A 4L5RC 4JI8L 2PW5A 4GOPA 3GTLB 3ERQA 3ITPA 3M7GA 4ZRZA 4B9WA 3CPFA 2RSNA 2AUKA 3FPUB 1ZXTA 2EYLA 2NYZD 1SNOA 4A93B 1TT2A 1BUVT 2EIFA 2A8VA 4BY7G 3CC4A 3H3VC 5I4DA 2XNAC 1RCVD 1W2BA 1Y69U 1NBWA 2UU9L 1I6HB 1EWCA 1VQOA 3FPPA 3T1HQ 3GTGH 3C2PA 1MIUA 3IRBA 1STYA 5F2DA 3NWTA 1D6EC 4C3JH 2XTIA 1SFOH 1DXMA 2D0OA 1D5ZC 2WV6D 4PQXA 1JMCA 4RHRA 1B4OA 3A74A 3SDZA 4HIMA 4DGZA 1EU3A 2K50A 4A3KG 1CA6A 3CRKC 4JG2A 4CKCA 3CQZH 4QIWE 1B44D 1WCMB 1PZJD 3W1BA 2AWNA 4O2DA 3TDQA 1KRTA 5C4ZA 1BOSA 1OXUA 2F0SA 1H9SA 2AQ3B 1QUQB 2KENA 1TVXA 4RAUC 1KLUD 2MJ8A 1K8MA 2B2VA 3P7JA 3NBHB 1Q81C 4DV4L 2RBMA 2WAQE 2I0QA 1STAA 3Q6SA 5GAEC 1TY0A 2PQAB 1WTOA 1PFNA 5LMNQ 1TXYA 2CQOA 2PNHA 5FLXL 5GQOA 5FLXc 4DNRB 2E76C 2JE6I 3TN2A 1EU4A 4JW0A 1PFMA 4DV2L 2XWJB 4IQZA 1NR2A 4QL5A 1SDFA 1GJXA 1QVCA 2F1MA 2TMPA 1X9NA 3MFYA 3D0FA 4JK1C 4A3BB 1ET6A 1PYSB 1ZYRD 3KDFA 4MNOA 1VQ5A 3I3CA 3MA2B 3PCOB 3T1YL 3KFUA 1I4GA 1YNJD 2IHEA 2V1CC 4LUZA 1NNXA 1Y1VH 2VUMH 2CVRA 3NTIA 2F3VA 1J5EQ 1SJHD 3HOWG 2K5NA 2QF7A 1KAAA 1HNZQ 4GKJQ 4JPBW 2A68D 2FINB 3UDXA 3IFTA 3RLOA 4F8MA 3K7AH 4OXPA 1RDPD 1FJGL 3SK4A 1SYFA 5IODA 1H9RA 2K5QA 4C3JB 1SFOB 4DV0L 2K03A 2R92G 4ZUIA 2I5LX 1F9PA 4DR5Q 1DZ1A 4PZ7A 4RA8A 2D62A 1XWEA 4RGOS 1B50A 1N32Q 3UDGA 3E3XA 3MXGA 4TRDA 1YHQA 4IPGA 4RKLA 2YU9H 3S16H 2ZTDA 3NBIA 3CQZB 4BBSB 2X69A 5JJKA 1O7IA 3L7ZC 4DFAA 5JOBA 1AEXA 3G6EA 2JA9A 1MJCA 2OTLA 3SK6A 1DCZA 2K14A 1EYDA 5C0XI 5C3XA 2B2YA 3TRZA 5C4JH 1VQAA 3BZDB 4K14A 3I91A 4P71A 4A3EB 4KY7A 1OO9B 3QWNA 1VQGA 3GTMH 1STBA 2WINB 3EFXD 3BDCA 3PUVA 2O2LD 1T5EA 3D4RA 2L11A 4BY7H 1VQKA 1SYCA 2NTSA 3NTHA 4POGA 1EY0A 2H4OA 3QB3A 4DK6C 3N52A 5D14A 2K33A 2E75C 1TU2B 1EY7A 1JWUD 3TSSA 3S15H 2RCNA 2B2TA 3VDYA 4O42A 4I7AA 5LMUQ 3ONAB 4H7BA 5C4XB 2RDHA 5JVG3 1HXYD 1J9OA 2OTJA 2GN5A 4MN3A 4O1NA 1QOHA 3HP3A 3PO2G 2HQLA 2HDMA 4JI3L 1SAPA 1EY6A 2CWPA 3K7AB 2CCZA 5GAHC 3AMUA 5IYCG 3JAML 3JAMc 1LTGD 2DJFC 4CJ0B 2IX3A 3EN2A 2QA4A 2ZJQA 2DY8A 2R6GA 2A73B 1H9MA 2YTVA 4DA2A 2UUBQ 2NN6G 1PV4A 4JV5L 5M5XH 3KYHC 2YU9B 1M8AA 1X56A 4KKTA 3S16B 1YZ6A 2L1BA 4UY8C 4HEDA 2JA8G 1FGBD 2D5DA 2A5HA 3CW2C 5EBDA 5M3FG 4MTKA 1F2MA 1WOCA 4IFDG 1XMQQ 3HKSA 4IUUA 5L37A 4LFAL 2ZM6L 1N34L 3PMFA 5JEAG 5C4JB 1E0BA 1S72A 1JT8A 2VQFQ 3OTOL 1GUOA 1S5DD 4IZ8A 3GTMB 1HNWQ 4DR7Q 2KHSA 4RH6A 4WRDA 1U9RA 1BQQT 3HOXG 2HUGA 2EJFC 1LT4D 1ASZA 4B3RL 3QO2A 2L9HA 4BY7B 4DV1L 2E2HH 2Q2UA 5IOCA 4JVZA 2F0OA 4DR2Q 1G291 5IGDA 3LWUA 2M2LA 1BVSA 1XPRA 1BCPB 2N55A 1F2YA 3S15B 1YJ9A 1AZPA 5EJWA 4KHZA 1IW7C 3GV6A 2VQEQ 5KGUA 2NWGA 3RMHA 1S4ZA 1JCKB 4RMFA 3T13A 2O5IC 2R93H 4HCSA 4JI2Q 1U4MA 1U4LA 2WIIB 4DV7L 1QVGA 2NVYH 2IX1A 4LF7Q 3HOUG 3C46A 1JJCB 3RLFA 5DM73 1SNMA 5IGCA 3PUYA 1VF5C 2DN8A 1MBYA 4RGNA 2OQ0A 5H1SE 3I72A 1BR9A 3HKZG 3M3YH 3GTOH 3R8BA 1SE4A 1VQDA 4DAYA 5M5XB 1A6XA 3VR6A 4X66L 1DJRD 4DV6L 4QMGA 4IURA 1WJJA 4X62L 3FDTA 3PSIA 4WJ4A 3N6RA 1KDCA 4CKEA 2L55A 5J39A 3S14H 4X64Q 1Q86C 4XYQA 4M1UB 2HD3A 3PIOA 1AE2A 2GVBA 5D65A 1XNQQ 4P74A 3CCUA 4CBVA 3MFGA 3NQIA 1IBKQ 2N8NA 1EY8A 2NZ1D 2ZXPA 1N33L 5IT9c 3CCMA 4LF8Q 1D1KA 4IUVA 1Z6HA 2DY7A 1XYIA 4B3ML 2E2HB 1HR0Q 4B08A 2A1AA 5C44H 2QDBA 1QZGA 1IZ6A 4APVA 3S1NH 4JI7L 4WFN3 4GN4B 4ZKCB 2N49A 4JI0L 2Z0SA 4A93G 1SRUA 2RHSB 4XQQA 4A3CH 1WTVA 1I4HA 3CRLC 1LV9A 3U4VA 1RF2D 3T4AC 3EJIA 4LW1A 4LK1C 2RVLA 5GAGC 1K28A 1LO5D 2F0VA 3TS2A 2R93B 4XYOA 4B3SL 2F4VQ 5I9OA 5FO7B 4Q0FA 1V9PA 3MXNB 4X65L 2JA8H 4RGMA 1KNEA 2E2JH 4KKUA 5M3FH 1NCVA 4XQJA 2HIVA 4DV5L 2KHIA 1HR0W 3M3YB 3CHBD 1IYJB 3OYYA 4WORA 1WTHA 3A8IE 3URYA 3T51B 2XIWA 3OPOA 1XJVA 4RHSA 4IUPA 1WCMG 1PZID 2ZJPA 3L2PA 3FMCA 5E7NA 3VA7A 2EPBA 1E2WA 1LM0A 2OCEA 3NPPA 4YCWA 1F2ZA 4CDEC 1M90C 1EIHA 3L9AX 2KUMA 4K2KA 4KMUC 4JOIC 1ENAA 4AQYQ 1BO0A 1CQVA 3VR5A 4OO1I 4DV3L 2H5XA 2JSOA 3J80E 4CJ2C 4M8AA 2UUCQ 1EOVA 3OMGA 1DOMA 5C44B 4A3BG 3J81E 3S1NB 2IPKD 2K5VA 2RDFA 4OIJA 5CV8A 5EPLA 2Z6KC 3DM1A 1HQMC 1JR0D 1TS5A 3HOUH 1G2SA 4NP5A 2RCFA 3S1MH 5NUCA 2B8GA 4KY5A 5EPKA 1DD2A 1K3BC 1MJEA 1GM5A 1IBML 4X3KA 2D2CC 2QKIC 1BKBA 1HZBA 3KLRA 2UUAQ 4YWLA 2QGQA 4IUNA 4X3TA 2EDGA 4C3JG 2Y0SB 2Z9HA 3V2TA 2E2JB 4Y52H 1ILPA 3FHWA 3C1EA 3D4DA 1VQHA 3HG9A 4FP5D 2NTTA 4CDDC 1XX8A 4BBSG 3ERSX 1A3TA 3KLSA 1YJNA 3HEJA 5A2QE 4ZYSA 1PXUA 3J81j 1VQEA 2F3WA 5ELOA 1IW7D 1WTRA 4OL7A 5AJ3L 1E1TA
chains in the Genus database with same CATH topology
1X3FA 1X65A 4JG2A 2YTXA 3CCVA 4KHPQ 3CQZH 3J81i 4QIWE 2LXKA 4P73A 3W1BA 4A3DG 1Q8KA 4AYBG 3PO3G 2AWNA 3E9HA 4LUVA 2Q2TA 2JA7G 4O2DA 4A3EG 1KRTA 3JC66 5C3EH 1OXUA 3CXCA 4TVAB 2B63G 4BY1G 3PIPA 3A0JA 5M3MG 1QUQB 2KENA 4KI0A 5IWAL 4DR5L 3PF5A 4GLXA 1K73C 1K9MC 3CD6A 4MZ9A 4A3KH 1Q81C 3NBHB 1OXXK 2PI2A 4DV4L 4IO9A 2WAQE 3S2HH 2I0QA 3CAMA 4X66Q 1YJWA 1NJIC 5GAEC 4JI4L 3M85A 3CCEA 4A93H 1WI5A 2PQAB 3TEHB 4LF5Q 5LMNQ 1TXYA 2LSSA 2CQOA 2KCMA 2PNHA 4R4QA 3W5OA 1YBYA 2VQEL 1KQSA 4BY1H 2B63H 5GQOA 4UP9A 5FLXc 2CKZB 1L2FA 1VCIA 5DLQE 1EQRA 4YWMA 4ALPA 2JE6I 1YITA 4A75A 4JI2L 3F2BA 1L1OC 4DV2L 4QL5A 1PH2A 1QVCA 3TS0A 4R4CA 4JBWA 1N36Q 1X9NA 4IPCA 1PH3A 1JJGA 5C4XG 3U4ZA 3D0FA 5GROA 1R9TH 1PH4A 4GN5A 1PYSB 1OXVA 2WB1E 2MO0A 3KDFA 4GLVB 1CKNA 2A19A 4MNOA 3SGIA 4DAYB 3CMEA 1VQ5A 1YHBA 3PCOB 1N33Q 4DUZQ 3T1YL 3KFUA 2IHEA 3UE0A 2V1CC 1HZAA 1K3RA 4A3FG 5K36G 4LUZA 4LFCQ 2UXBQ 4B3MQ 4BXXG 1NTGA 1Y1VH 5FJ8H 2VW9A 2VUMH 3S2DH 5BR8Q 4AYBE 1HZCA 1E1OA 1J5EQ 2PI2E 2VZAA 3HOWG 2K5NA 3CP0A 1WCMH 4DUYQ 2K75A 3RNUA 1SROA 1HNZQ 4GKJQ 4NPSA 2ZTEA 2GVAA 5C0XJ 2NZOA 1I3QH 4NB3A 4LF6Q 2JA5G 3UDXA 4A3FH 4LF6L 3I4MH 3RLOA 3S24A 4JI0Q 2K52A 5GADC 4NXML 4LF9Q 2AHOB 3K7AH 4IPHA 4MTNA 4OXPA 4POFA 4BXXH 1FJGL 2E2IH 4X64L 1X54A 4A4IA 4DV0L 2AMCB 4A3GH 3PUWA 3GO5A 2R92G 3HOWH 4K0KQ 2I5LX 2N78A 1C9OA 5IP9G 2L15A 4DR5Q 4B3TQ 3UDFA 4PZ7A 1XNQL 4DK3C 3HOYG 3CCLA 2D62A 4LWCA 1Y1WG 4BA2I 4QY7A 3UDGA 4B3SQ 2NVQH 1N32Q 2ES2A 4LF8L 1Z47A 1YHQA 2YU9H 4IPGA 3S16H 2ZTDA 4QJFA 4X65Q 2R92H 5JJKA 1O7IA 2MQHA 3L7ZC 4A3LG 4IOAA 3S1QH 1K83H 3M7NA 1PH6A 3G6EA 3HOYH 1HR0L 2JA9A 2HT1A 1MJCA 3KJPA 2OTLA 1H95A 1IBLL 4A3BH 1HZ9A 1BBWA 3B6YA 4QGUA 3I56A 1Y1WH 1XMOL 1PH9A 2K14A 5C0XI 3ULJA 3TRZA 1AE3A 1L1OB 4A3JG 2UUBL 5C4JH 2YTYA 1VQAA 3PV0A 2HHHQ 2BH8A 3H15A 3HOVG 4P71A 1X3GA 2YV5A 1VQMA 2JA6H 5HGQA 1VQGA 4OO1G 3GTMH 1B7YB 1B8AA 1A63A 2ASBA 4GS3A 3STBD 3K80C 3K81C 1RIPA 1UE5A 3PUVA 2I5MX 5EAYA 1IL2A 4FDBA 4GLAC 4R4IA 4GOPC 4BY7H 1VQKA 1VQCA 4POGA 1KC8C 4DK6C 4JCVE 1HNXQ 4AIMA 2R7FA 3KLWA 4LF4L 2MO1A 4O0AA 3GTQH 3CMAA 1YEZA 4YCVA 1GVPA 4R1JA 1C0AA 3S15H 2WB1G 2R7ZH 1KXLA 2RCNA 4DV0Q 1NE3A 3CCQA 3CC7A 4A3MG 3VDYA 5LMUQ 3H0GG 2NVTH 2QEXA 1N8RC 1WFQA 2OWOA 3RZDH 4NXNQ 2VY3A 5JJIA 4BBSH 2OTJA 2GN5A 1Q12A 2ZJRA 2UXDQ 4DR1L 3PO2G 4DR2L 1I94L 2HQLA 2JK8A 4JI3L 3ER0A 1CSQA 2K5HA 3FP9A 1E7ZA 2CWPA 3NENA 3J7ZC 4A3MH 2CCZA 3BZCA 5GAHC 3H0GH 5IYCG 2JEAI 3RLNA 1A8VA 4JI8Q 1IXRA 1EIFA 2D0PA 3JAMc 1VQPA 1IBLQ 4A3DH 1VQNA 1KHIA 3PO3H 1YIJA 4EQ5A 2JA7H 3EN2A 3PO2H 4A3EH 3KF6A 2QA4A 3M9BA 2R6GA 3EBEA 5M5WH 3OW2A 4AQYL 2VS1A 4IJLA 2ZJQA 1UE6A 2YTVA 2UUBQ 5M3MH 2NN6G 1YNXA 3HOZG 1HJPA 4DAMA 1XPOA 1PV4A 4JV5L 1IBMQ 5M5XH 5IYCH 3KYHC 4JI1L 4ME3A 1KD1C 2UUCL 1X56A 4RG1A 1QZHA 1YZ6A 1ASYA 4P75A 1X55A 4UY8C 2JA8G 2UXCL 4L5QA 4XIGS 3GD7A 3CW2C 1V43A 5M3FG 3RN5A 2KHJA 4LF7L 1WOCA 3PUZA 3F2DA 1XMQQ 2UU9Q 4IFDG 1G6PA 3HKSA 3F1ZA 3LGJA 3AYHB 4A3IG 2VL6A 2R7DA 4HJ9A 4LFAL 2F52A 2IHFA 2ZM6L 1N34L 5JEAG 1FL0A 1WYDA 4GOPB 4YHHL 1T9HA 1TWHH 3F8TA 4R4OA 1S72A 3RZOH 5IYDG 2LXJA 1X3EA 3CCSA 4HIDA 1JT8A 2VQFQ 3OTOL 3H3VI 4DR6L 3BJUA 4HIKA 5C4XH 4YY3L 5IYBG 2E5LQ 1HNWQ 3PGZA 4A3IH 4DR7Q 1Q7YC 3GDEA 4OONA 4KLKA 1QVFA 2VNUD 4JOIA 1UE7A 3ZJYC 4JC0A 5FLMG 3HOXG 1PH7A 5LMNW 2JJQA 5AJ3Q 1MKHA 1ASZA 3AFPA 1TWAH 4B3RL 2Q2HA 2ATWA 3A5ZB 4IJHA 4DV1L 2E2HH 1SE8A 3I55A 2Q2UA 1LUZA 1NMGA 4DR2Q 1I94Q 5JJLA 1G291 4JI3Q 3M4OH 3J80c 1BVSA 1XPRA 1JJ2A 4QQBX 3K7UC 1XNRQ 5IWAQ 3HOXH 3RR5A 2I5HA 4LFBL 1K8GA 1N9WA 2HIXA 2RF4A 2JA5H 4DV4Q 1IBKL 3PF4A 2R93G 4PG3A 3G48A 1YJ9A 4JI4Q 1QUQA 4JBJA 2Y0SE 3U50C 4KHZA 2Z6KA 3J81c 3HFZB 3KJOA 2VQEQ 1RL2A 1XPUA 3DLLA 2KCTA 4BA1I 5IP9H 4OX9L 1VQ8A 4RMFA 3WWVA 4JV5Q 2PQAA 1KRSA 2JQOA 2R93H 4JI2Q 1VQ6A 1XTDA 3U58A 1JB7A 4DV7L 3K8AA 1QVGA 1UE1A 1LTLA 2EXDA 4R4TA 4DV2Q 1VQ9A 2UXCQ 2NVYH 2IX1A 3GTPH 3G4SA 4LF7Q 2B29A 3HOUG 2NZHA 1JJCB 2WFWA 3RLFA 4HJAA 4GNXA 4KHPL 3TREA 3ULPA 4A3LH 4OWWB 3PUYA 3AEVA 4HJ7A 4IOCA 1J6QA 4LFAQ 5ELNA 1XNRL 2ZM6Q 3ICEA 2OQ0A 5H1SE 3T1YQ 3HKZG 3M3YH 3GTOH 3F2CA 1JE5A 5IY0A 3S17H 1VQDA 1PYBA 1OTCA 1GO3E 4A3JH 3OTOQ 4A3KG 4C3HH 4X66L 2JEBI 4YY3Q 1PH5A 4DV6L 1OXSC 1YHAA 2F4VL 1A0IA 3HOVH 4LF5L 5LMNL 2YYZA 3CPWA 1WJJA 4HJ5A 1SN8A 4JYAL 2E8GA 1FGUA 4X62L 3I2ZA 3PSIA 4GNXC 4WJ4A 4IPDA 4OWXB 3I4OA 4NXMQ 1FJGQ 3S14H 1PFSA 4X64Q 3KDFB 1CKNB 4LUOA 1GKHA 1TWCH 4DR3L 3PIOA 1OXTA 4JI5L 3TQYA 1Q86C 1AE2A 2GVBA 1N36L 2CFMA 4C3IH 4LFBQ 1XNQQ 4P74A 3CCUA 5J3BA 4YCUA 5C0XG 4JBKA 2IT1A 3M4QA 5C44G 1IBKQ 2N8NA 1P8LA 1N33L 4DUZL 5IT9c 3CCMA 4LF8Q 4PZ8A 2C35B 1Q46A 4LFCL 2UXBL 3GTJH 4B3ML 3I4NG 2FXQA 1SLJA 4A3CG 4OX9Q 1E24A 4H02A 3MEFA 1HR0Q 1I50H 1E22A 1UEBA 4P72A 2A1AA 5C44H 1QZGA 1IZ6A 1HNZL 4GKJL 3HKZE 1XMOQ 4APVA 1PHJA 1D8LA 3W1GA 1VQ4A 4JI7L 3S1NH 4GN4B 4YWKA 1Q82C 2N49A 1A62A 4JI0L 1FVIA 4LF9L 2Z0SA 1EQQA 1VQJA 1CKMA 1SRUA 2RHSB 3I4NH 4Y7NH 4A93G 4A3CH 2ALYB 3U4VA 1SR3A 1L1OA 2Q2IA 3GTLH 5IE8A 4K0KL 4LW1A 3KF8B 3CCRA 2Y0SG 4B3TL 1I5FA 1SMXA 5GAGC 1TWFH 3TS2A 3AQQA 1E3PA 2RHQB 3HOZH 2B3GA 3A5UA 4B3SL 1N32L 4DV6Q 1EFWA 3M4PA 2F4VQ 1K0RA 1V9PA 3MXNB 4X65L 4JYAQ 1V1QA 4X62Q 3CC2A 2JA8H 5M5YH 4LF4Q 4HIOA 2E2JH 3E0EA 5M3FH 1VQLA 4JI6L 4DKAC 2N3SA 1PH8A 1I6HH 4GNXB 5HY6A 4EX5A 1B70B 2HIVA 1W3SA 2KHIA 4DV5L 1HR0W 1S40A 1NMFA 1VS0A 3OYYA 1IYJB 4DR3Q 4JI5Q 5IP7G 4HJ8A 1VQFA 1Y1VG 5FJ8G 2KBNA 1K8AC 2VUMG 1NY4A 1PH1A 1CSPA 1DGSA 3PUXA 3STBC 2OQKA 2PMZE 2HHHL 1XJVA 4LNQA 3D31A 5IYDH 1WCMG 2UUAL 2K4KA 4A76A 2ZJPA 3L2PA 4DR1Q 5IYBH 3I7FA 4XTCS 3I4MG 4BBRG 1BBUA 1CUKA 2IX0A 5E7NA 1U0LA 5IP7H 4J15A 5FLMH 4GKKL 4OWTB 1EUJA 3T1HL 1LM0A 1C7YA 1VQ7A 1KAWA 1Q1EA 2OCEA 1AH9A 4YCWA 4A3GG 1L0WA 1M90C 3L0OA 1LYLA 2BA0A 1PA6A 4JI7Q 1HNXL 1EYGA 4JOIC 4AQYQ 4X6AH 4BBRH 1D7QA 3EIVA 1Z9FA 1Q1BA 2XGTA 4PMWA 1YI2A 4OO1I 4DV3L 2H5XA 4JI1Q 4DNIA 2NVXH 2UUCQ 1KL9A 1EOVA 3JAMi 4UP7A 4DR4L 4TQUS 3KOJA 5LMUL 3ULLA 1X6OA 4NXNL 4DPGA 3DM3A 2AKWB 3RN2A 4A3BG 2UXDL 2K5VA 1Y14B 2MNAA 3BU2A 2EQSA 4AH6A 3CCJA 1N34Q 2ZTCA 4WJ3M 4UPAA 4YHHQ 4L5SA 2CWAA 4L5TA 3UDIA 3H3VH 1VQBA 2Z6KC 3UE1A 1M1KC 3G71A 2F3IA 3KF6B 3HOUH 3FKIG 2DUDA 4JI6Q 4L5RC 4JI8L 4DR6Q 2IY5B 2BH2A 2BA1A 1TWGH 4GOPA 2JA6G 4DV5Q 3S1MH 4IFDJ 2MFIA 1KIXA 2ID0A 1UWVA 3CPFA 1U5KA 1YVCA 2WP8J 3NEMA 1VQIA 1CKOA 4B3RQ 4GN3B 2AWOA 1GD7A 2EIFA 5JEAJ 1MJEA 1GM5A 1IBML 3AFQA 3FKIH 2A8VA 4BY7G 4DV1Q 3CC4A 1BKBA 1HZBA 2WAQG 2UUAQ 3Q8DA 4YWLA 2QGQA 3BZKA 4PZ6A 1W2BA 3E9IA 2DGYA 4Y52H 3CF5A 1NBWA 2UU9L 1XMQL 4GKKQ 1VQOA 1EWIA 3FHWA 3T1HQ 3GTGH 3J7A5 2R7ZG 1P16A 1HH2P 1MIUA 1S3OA 1VQHA 3IRBA 3NELA 1PVOA 2NN6I 3GTKH 3K0XA 4C3JH 2XTIA 1SFOH 1EIYB 2D0OA 4C2MH 4BBSG 3ERSX 3J80i 1YJNA 1JMCA 2VQFL 4DV3Q 3A74A 5BR8L 2E5LL 1G51A 4JBMA 3J81j 5C3EG 1J5EL 4DR7L 1HNWL 1VQEA 4HIMA 4IFDI 4DUYL 5ELOA 4DV7Q 4DR4Q 2K50A 3S1RH 4UP8A 5AJ3L 1E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  1X65 A;  4JG2 A;  2YTX A;  3CCV A;  4KHP Q;  3CQZ H;  3J81 i;  4QIW E;  2LXK A;  4P73 A;  3W1B A;  4A3D G;  1Q8K A;  4AYB G;  3PO3 G;  2AWN A;  3E9H A;  4LUV A;  2Q2T A;  2JA7 G;  4O2D A;  4A3E G;  1KRT A;  3JC6 6;  5C3E H;  1OXU A;  3CXC A;  4TVA B;  2B63 G;  4BY1 G;  3PIP A;  3A0J A;  5M3M G;  1QUQ B;  2KEN A;  4KI0 A;  5IWA L;  4DR5 L;  3PF5 A;  4GLX A;  1K73 C;  1K9M C;  3CD6 A;  4MZ9 A;  4A3K H;  1Q81 C;  3NBH B;  1OXX K;  2PI2 A;  4DV4 L;  4IO9 A;  2WAQ E;  3S2H H;  2I0Q A;  3CAM A;  4X66 Q;  1YJW A;  1NJI C;  5GAE C;  4JI4 L;  3M85 A;  3CCE A;  4A93 H;  1WI5 A;  2PQA B;  3TEH B;  4LF5 Q;  5LMN Q;  1TXY A;  2LSS A;  2CQO A;  2KCM A;  2PNH A;  4R4Q A;  3W5O A;  1YBY A;  2VQE L;  1KQS A;  4BY1 H;  2B63 H;  5GQO A;  4UP9 A;  5FLX c;  2CKZ B;  1L2F A;  1VCI A;  5DLQ E;  1EQR A;  4YWM A;  4ALP A;  2JE6 I;  1YIT A;  4A75 A;  4JI2 L;  3F2B A;  1L1O C;  4DV2 L;  4QL5 A;  1PH2 A;  1QVC A;  3TS0 A;  4R4C A;  4JBW A;  1N36 Q;  1X9N A;  4IPC A;  1PH3 A;  1JJG A;  5C4X G;  3U4Z A;  3D0F A;  5GRO A;  1R9T H;  1PH4 A;  4GN5 A;  1PYS B;  1OXV A;  2WB1 E;  2MO0 A;  3KDF A;  4GLV B;  1CKN A;  2A19 A;  4MNO A;  3SGI A;  4DAY B;  3CME A;  1VQ5 A;  1YHB A;  3PCO B;  1N33 Q;  4DUZ Q;  3T1Y L;  3KFU A;  2IHE A;  3UE0 A;  2V1C C;  1HZA A;  1K3R A;  4A3F G;  5K36 G;  4LUZ A;  4LFC Q;  2UXB Q;  4B3M Q;  4BXX G;  1NTG A;  1Y1V H;  5FJ8 H;  2VW9 A;  2VUM H;  3S2D H;  5BR8 Q;  4AYB E;  1HZC A;  1E1O A;  1J5E Q;  2PI2 E;  2VZA A;  3HOW G;  2K5N A;  3CP0 A;  1WCM H;  4DUY Q;  2K75 A;  3RNU A;  1SRO A;  1HNZ Q;  4GKJ Q;  4NPS A;  2ZTE A;  2GVA A;  5C0X J;  2NZO A;  1I3Q H;  4NB3 A;  4LF6 Q;  2JA5 G;  3UDX A;  4A3F H;  4LF6 L;  3I4M H;  3RLO A;  3S24 A;  4JI0 Q;  2K52 A;  5GAD C;  4NXM L;  4LF9 Q;  2AHO B;  3K7A H;  4IPH A;  4MTN A;  4OXP A;  4POF A;  4BXX H;  1FJG L;  2E2I H;  4X64 L;  1X54 A;  4A4I A;  4DV0 L;  2AMC B;  4A3G H;  3PUW A;  3GO5 A;  2R92 G;  3HOW H;  4K0K Q;  2I5L X;  2N78 A;  1C9O A;  5IP9 G;  2L15 A;  4DR5 Q;  4B3T Q;  3UDF A;  4PZ7 A;  1XNQ L;  4DK3 C;  3HOY G;  3CCL A;  2D62 A;  4LWC A;  1Y1W G;  4BA2 I;  4QY7 A;  3UDG A;  4B3S Q;  2NVQ H;  1N32 Q;  2ES2 A;  4LF8 L;  1Z47 A;  1YHQ A;  2YU9 H;  4IPG A;  3S16 H;  2ZTD A;  4QJF A;  4X65 Q;  2R92 H;  5JJK A;  1O7I A;  2MQH A;  3L7Z C;  4A3L G;  4IOA A;  3S1Q H;  1K83 H;  3M7N A;  1PH6 A;  3G6E A;  3HOY H;  1HR0 L;  2JA9 A;  2HT1 A;  1MJC A;  3KJP A;  2OTL A;  1H95 A;  1IBL L;  4A3B H;  1HZ9 A;  1BBW A;  3B6Y A;  4QGU A;  3I56 A;  1Y1W H;  1XMO L;  1PH9 A;  2K14 A;  5C0X I;  3ULJ A;  3TRZ A;  1AE3 A;  1L1O B;  4A3J G;  2UUB L;  5C4J H;  2YTY A;  1VQA A;  3PV0 A;  2HHH Q;  2BH8 A;  3H15 A;  3HOV G;  4P71 A;  1X3G A;  2YV5 A;  1VQM A;  2JA6 H;  5HGQ A;  1VQG A;  4OO1 G;  3GTM H;  1B7Y B;  1B8A A;  1A63 A;  2ASB A;  4GS3 A;  3STB D;  3K80 C;  3K81 C;  1RIP A;  1UE5 A;  3PUV A;  2I5M X;  5EAY A;  1IL2 A;  4FDB A;  4GLA C;  4R4I A;  4GOP C;  4BY7 H;  1VQK A;  1VQC A;  4POG A;  1KC8 C;  4DK6 C;  4JCV E;  1HNX Q;  4AIM A;  2R7F A;  3KLW A;  4LF4 L;  2MO1 A;  4O0A A;  3GTQ H;  3CMA A;  1YEZ A;  4YCV A;  1GVP A;  4R1J A;  1C0A A;  3S15 H;  2WB1 G;  2R7Z H;  1KXL A;  2RCN A;  4DV0 Q;  1NE3 A;  3CCQ A;  3CC7 A;  4A3M G;  3VDY A;  5LMU Q;  3H0G G;  2NVT H;  2QEX A;  1N8R C;  1WFQ A;  2OWO A;  3RZD H;  4NXN Q;  2VY3 A;  5JJI A;  4BBS H;  2OTJ A;  2GN5 A;  1Q12 A;  2ZJR A;  2UXD Q;  4DR1 L;  3PO2 G;  4DR2 L;  1I94 L;  2HQL A;  2JK8 A;  4JI3 L;  3ER0 A;  1CSQ A;  2K5H A;  3FP9 A;  1E7Z A;  2CWP A;  3NEN A;  3J7Z C;  4A3M H;  2CCZ A;  3BZC A;  5GAH C;  3H0G H;  5IYC G;  2JEA I;  3RLN A;  1A8V A;  4JI8 Q;  1IXR A;  1EIF A;  2D0P A;  3JAM c;  1VQP A;  1IBL Q;  4A3D H;  1VQN A;  1KHI A;  3PO3 H;  1YIJ A;  4EQ5 A;  2JA7 H;  3EN2 A;  3PO2 H;  4A3E H;  3KF6 A;  2QA4 A;  3M9B A;  2R6G A;  3EBE A;  5M5W H;  3OW2 A;  4AQY L;  2VS1 A;  4IJL A;  2ZJQ A;  1UE6 A;  2YTV A;  2UUB Q;  5M3M H;  2NN6 G;  1YNX A;  3HOZ G;  1HJP A;  4DAM A;  1XPO A;  1PV4 A;  4JV5 L;  1IBM Q;  5M5X H;  5IYC H;  3KYH C;  4JI1 L;  4ME3 A;  1KD1 C;  2UUC L;  1X56 A;  4RG1 A;  1QZH A;  1YZ6 A;  1ASY A;  4P75 A;  1X55 A;  4UY8 C;  2JA8 G;  2UXC L;  4L5Q A;  4XIG S;  3GD7 A;  3CW2 C;  1V43 A;  5M3F G;  3RN5 A;  2KHJ A;  4LF7 L;  1WOC A;  3PUZ A;  3F2D A;  1XMQ Q;  2UU9 Q;  4IFD G;  1G6P A;  3HKS A;  3F1Z A;  3LGJ A;  3AYH B;  4A3I G;  2VL6 A;  2R7D A;  4HJ9 A;  4LFA L;  2F52 A;  2IHF A;  2ZM6 L;  1N34 L;  5JEA G;  1FL0 A;  1WYD A;  4GOP B;  4YHH L;  1T9H A;  1TWH H;  3F8T A;  4R4O A;  1S72 A;  3RZO H;  5IYD G;  2LXJ A;  1X3E A;  3CCS A;  4HID A;  1JT8 A;  2VQF Q;  3OTO L;  3H3V I;  4DR6 L;  3BJU A;  4HIK A;  5C4X H;  4YY3 L;  5IYB G;  2E5L Q;  1HNW Q;  3PGZ A;  4A3I H;  4DR7 Q;  1Q7Y C;  3GDE A;  4OON A;  4KLK A;  1QVF A;  2VNU D;  4JOI A;  1UE7 A;  3ZJY C;  4JC0 A;  5FLM G;  3HOX G;  1PH7 A;  5LMN W;  2JJQ A;  5AJ3 Q;  1MKH A;  1ASZ A;  3AFP A;  1TWA H;  4B3R L;  2Q2H A;  2ATW A;  3A5Z B;  4IJH A;  4DV1 L;  2E2H H;  1SE8 A;  3I55 A;  2Q2U A;  1LUZ A;  1NMG A;  4DR2 Q;  1I94 Q;  5JJL A;  1G29 1;  4JI3 Q;  3M4O H;  3J80 c;  1BVS A;  1XPR A;  1JJ2 A;  4QQB X;  3K7U C;  1XNR Q;  5IWA Q;  3HOX H;  3RR5 A;  2I5H A;  4LFB L;  1K8G A;  1N9W A;  2HIX A;  2RF4 A;  2JA5 H;  4DV4 Q;  1IBK L;  3PF4 A;  2R93 G;  4PG3 A;  3G48 A;  1YJ9 A;  4JI4 Q;  1QUQ A;  4JBJ A;  2Y0S E;  3U50 C;  4KHZ A;  2Z6K A;  3J81 c;  3HFZ B;  3KJO A;  2VQE Q;  1RL2 A;  1XPU A;  3DLL A;  2KCT A;  4BA1 I;  5IP9 H;  4OX9 L;  1VQ8 A;  4RMF A;  3WWV A;  4JV5 Q;  2PQA A;  1KRS A;  2JQO A;  2R93 H;  4JI2 Q;  1VQ6 A;  1XTD A;  3U58 A;  1JB7 A;  4DV7 L;  3K8A A;  1QVG A;  1UE1 A;  1LTL A;  2EXD A;  4R4T A;  4DV2 Q;  1VQ9 A;  2UXC Q;  2NVY H;  2IX1 A;  3GTP H;  3G4S A;  4LF7 Q;  2B29 A;  3HOU G;  2NZH A;  1JJC B;  2WFW A;  3RLF A;  4HJA A;  4GNX A;  4KHP L;  3TRE A;  3ULP A;  4A3L H;  4OWW B;  3PUY A;  3AEV A;  4HJ7 A;  4IOC A;  1J6Q A;  4LFA Q;  5ELN A;  1XNR L;  2ZM6 Q;  3ICE A;  2OQ0 A;  5H1S E;  3T1Y Q;  3HKZ G;  3M3Y H;  3GTO H;  3F2C A;  1JE5 A;  5IY0 A;  3S17 H;  1VQD A;  1PYB A;  1OTC A;  1GO3 E;  4A3J H;  3OTO Q;  4A3K G;  4C3H H;  4X66 L;  2JEB I;  4YY3 Q;  1PH5 A;  4DV6 L;  1OXS C;  1YHA A;  2F4V L;  1A0I A;  3HOV H;  4LF5 L;  5LMN L;  2YYZ A;  3CPW A;  1WJJ A;  4HJ5 A;  1SN8 A;  4JYA L;  2E8G A;  1FGU A;  4X62 L;  3I2Z A;  3PSI A;  4GNX C;  4WJ4 A;  4IPD A;  4OWX B;  3I4O A;  4NXM Q;  1FJG Q;  3S14 H;  1PFS A;  4X64 Q;  3KDF B;  1CKN B;  4LUO A;  1GKH A;  1TWC H;  4DR3 L;  3PIO A;  1OXT A;  4JI5 L;  3TQY A;  1Q86 C;  1AE2 A;  2GVB A;  1N36 L;  2CFM A;  4C3I H;  4LFB Q;  1XNQ Q;  4P74 A;  3CCU A;  5J3B A;  4YCU A;  5C0X G;  4JBK A;  2IT1 A;  3M4Q A;  5C44 G;  1IBK Q;  2N8N A;  1P8L A;  1N33 L;  4DUZ L;  5IT9 c;  3CCM A;  4LF8 Q;  4PZ8 A;  2C35 B;  1Q46 A;  4LFC L;  2UXB L;  3GTJ H;  4B3M L;  3I4N G;  2FXQ A;  1SLJ A;  4A3C G;  4OX9 Q;  1E24 A;  4H02 A;  3MEF A;  1HR0 Q;  1I50 H;  1E22 A;  1UEB A;  4P72 A;  2A1A A;  5C44 H;  1QZG A;  1IZ6 A;  1HNZ L;  4GKJ L;  3HKZ E;  1XMO Q;  4APV A;  1PHJ A;  1D8L A;  3W1G A;  1VQ4 A;  4JI7 L;  3S1N H;  4GN4 B;  4YWK A;  1Q82 C;  2N49 A;  1A62 A;  4JI0 L;  1FVI A;  4LF9 L;  2Z0S A;  1EQQ A;  1VQJ A;  1CKM A;  1SRU A;  2RHS B;  3I4N H;  4Y7N H;  4A93 G;  4A3C H;  2ALY B;  3U4V A;  1SR3 A;  1L1O A;  2Q2I A;  3GTL H;  5IE8 A;  4K0K L;  4LW1 A;  3KF8 B;  3CCR A;  2Y0S G;  4B3T L;  1I5F A;  1SMX A;  5GAG C;  1TWF H;  3TS2 A;  3AQQ A;  1E3P A;  2RHQ B;  3HOZ H;  2B3G A;  3A5U A;  4B3S L;  1N32 L;  4DV6 Q;  1EFW A;  3M4P A;  2F4V Q;  1K0R A;  1V9P A;  3MXN B;  4X65 L;  4JYA Q;  1V1Q A;  4X62 Q;  3CC2 A;  2JA8 H;  5M5Y H;  4LF4 Q;  4HIO A;  2E2J H;  3E0E A;  5M3F H;  1VQL A;  4JI6 L;  4DKA C;  2N3S A;  1PH8 A;  1I6H H;  4GNX B;  5HY6 A;  4EX5 A;  1B70 B;  2HIV A;  1W3S A;  2KHI A;  4DV5 L;  1HR0 W;  1S40 A;  1NMF A;  1VS0 A;  3OYY A;  1IYJ B;  4DR3 Q;  4JI5 Q;  5IP7 G;  4HJ8 A;  1VQF A;  1Y1V G;  5FJ8 G;  2KBN A;  1K8A C;  2VUM G;  1NY4 A;  1PH1 A;  1CSP A;  1DGS A;  3PUX A;  3STB C;  2OQK A;  2PMZ E;  2HHH L;  1XJV A;  4LNQ A;  3D31 A;  5IYD H;  1WCM G;  2UUA L;  2K4K A;  4A76 A;  2ZJP A;  3L2P A;  4DR1 Q;  5IYB H;  3I7F A;  4XTC S;  3I4M G;  4BBR G;  1BBU A;  1CUK A;  2IX0 A;  5E7N A;  1U0L A;  5IP7 H;  4J15 A;  5FLM H;  4GKK L;  4OWT B;  1EUJ A;  3T1H L;  1LM0 A;  1C7Y A;  1VQ7 A;  1KAW A;  1Q1E A;  2OCE A;  1AH9 A;  4YCW A;  4A3G G;  1L0W A;  1M90 C;  3L0O A;  1LYL A;  2BA0 A;  1PA6 A;  4JI7 Q;  1HNX L;  1EYG A;  4JOI C;  4AQY Q;  4X6A H;  4BBR H;  1D7Q A;  3EIV A;  1Z9F A;  1Q1B A;  2XGT A;  4PMW A;  1YI2 A;  4OO1 I;  4DV3 L;  2H5X A;  4JI1 Q;  4DNI A;  2NVX H;  2UUC Q;  1KL9 A;  1EOV A;  3JAM i;  4UP7 A;  4DR4 L;  4TQU S;  3KOJ A;  5LMU L;  3ULL A;  1X6O A;  4NXN L;  4DPG A;  3DM3 A;  2AKW B;  3RN2 A;  4A3B G;  2UXD L;  2K5V A;  1Y14 B;  2MNA A;  3BU2 A;  2EQS A;  4AH6 A;  3CCJ A;  1N34 Q;  2ZTC A;  4WJ3 M;  4UPA A;  4YHH Q;  4L5S A;  2CWA A;  4L5T A;  3UDI A;  3H3V H;  1VQB A;  2Z6K C;  3UE1 A;  1M1K C;  3G71 A;  2F3I A;  3KF6 B;  3HOU H;  3FKI G;  2DUD A;  4JI6 Q;  4L5R C;  4JI8 L;  4DR6 Q;  2IY5 B;  2BH2 A;  2BA1 A;  1TWG H;  4GOP A;  2JA6 G;  4DV5 Q;  3S1M H;  4IFD J;  2MFI A;  1KIX A;  2ID0 A;  1UWV A;  3CPF A;  1U5K A;  1YVC A;  2WP8 J;  3NEM A;  1VQI A;  1CKO A;  4B3R Q;  4GN3 B;  2AWO A;  1GD7 A;  2EIF A;  5JEA J;  1MJE A;  1GM5 A;  1IBM L;  3AFQ A;  3FKI H;  2A8V A;  4BY7 G;  4DV1 Q;  3CC4 A;  1BKB A;  1HZB A;  2WAQ G;  2UUA Q;  3Q8D A;  4YWL A;  2QGQ A;  3BZK A;  4PZ6 A;  1W2B A;  3E9I A;  2DGY A;  4Y52 H;  3CF5 A;  1NBW A;  2UU9 L;  1XMQ L;  4GKK Q;  1VQO A;  1EWI A;  3FHW A;  3T1H Q;  3GTG H;  3J7A 5;  2R7Z G;  1P16 A;  1HH2 P;  1MIU A;  1S3O A;  1VQH A;  3IRB A;  3NEL A;  1PVO A;  2NN6 I;  3GTK H;  3K0X A;  4C3J H;  2XTI A;  1SFO H;  1EIY B;  2D0O A;  4C2M H;  4BBS G;  3ERS X;  3J80 i;  1YJN A;  1JMC A;  2VQF L;  4DV3 Q;  3A74 A;  5BR8 L;  2E5L L;  1G51 A;  4JBM A;  3J81 j;  5C3E G;  1J5E L;  4DR7 L;  1HNW L;  1VQE A;  4HIM A;  4IFD I;  4DUY L;  5ELO A;  4DV7 Q;  4DR4 Q;  2K50 A;  3S1R H;  4UP8 A;  5AJ3 L;  1E1T A; 
#chains in the Genus database with same CATH topology
 1IHZ A;  2L12 A;  3CCV A;  1B9M A;  4EGV A;  1CHQ D;  4P73 A;  1WD1 A;  1Q8K A;  4LUV A;  5EKI A;  4A3E G;  5C3E H;  3I4M B;  4PNY A;  5IWA L;  1DOK A;  3PF5 A;  3CD6 A;  2F0D A;  4A3G B;  2X6G A;  1NJI C;  1YJW A;  4JI4 L;  4A93 H;  3CCE A;  5ELC A;  3OWE B;  5CYU A;  3TEH B;  4LF5 Q;  2O4X A;  4R4Q A;  1HTP A;  2B63 H;  2A69 C;  4B9X A;  4KTA A;  1L2F A;  1VCI A;  5DLQ E;  1HUM A;  3KBX A;  4E6I A;  5DM6 3;  3OHX C;  4G7Z C;  1C48 A;  1E2V A;  4A75 A;  1TS4 A;  1HFG A;  2PZT A;  4LMQ D;  3IFD A;  4FF1 A;  4R4C A;  1N36 Q;  5C4X G;  3ND8 A;  3U4Z A;  1R9T H;  1PH4 A;  3S1M B;  1CKN A;  1H9J A;  2A19 A;  3DXJ C;  4EQN A;  4KY6 A;  5FO9 B;  2EY2 A;  4UAI A;  3HKZ B;  5K36 G;  4LFC Q;  2UXB Q;  4C1N K;  1NTG A;  4AYB E;  2EJM A;  2XSC A;  1ML0 D;  2WAC A;  3CP0 A;  1WCM H;  2K75 A;  4NPS A;  2ZTE A;  5C0X J;  4NB3 A;  1I3Q H;  2F0I A;  4HSV A;  3IAY A;  5JVH 3;  4BXX H;  4V0B A;  2WAQ B;  3J80 L;  4ZUJ A;  1UAP A;  1DON A;  2AMC B;  4K0K Q;  3MC0 B;  2N78 A;  4B3T Q;  3UDF A;  1GXD C;  2R7Z B;  3CCL A;  5JPM C;  3NSW A;  3M4Y A;  5CC4 A;  4QY7 A;  4L6T B;  3F2U A;  2ES2 A;  1Z47 A;  1EFI D;  1SNP A;  4QJF A;  1Y8N B;  3I70 A;  4IOA A;  1FNU A;  2MQH A;  3S1Q H;  4FXG C;  2ZXO A;  3HOY H;  5C3E B;  4ZLT F;  1IBL L;  4A3B H;  3B6Y A;  4QGU A;  1PH9 A;  1WTQ A;  1PRT C;  3BS1 A;  2WKD A;  4N9T A;  1AE3 A;  1L1O B;  1QNU A;  4A3J G;  4A3D B;  3A8J E;  4UDU C;  2YV5 A;  4DXF A;  1QIL A;  2B63 B;  4K5V A;  1B7Y B;  1B8A A;  5M3M B;  2B8F A;  5CR3 A;  2ASB A;  4GS3 A;  2I5M X;  1WTW A;  4R4I A;  5C5M A;  3SVM A;  1QG7 A;  1VMC A;  1SNQ A;  3X3M A;  1KDA A;  4C3I G;  3K5M A;  2B2Y C;  2I46 A;  4AIM A;  1R9T B;  1V1P A;  3H94 A;  1GVP A;  2EJG C;  1TS3 A;  2FFK B;  3EA6 A;  1TWH B;  4WJW A;  4DV0 Q;  3CCQ A;  1SE3 A;  4G4K A;  2QEX A;  3T16 A;  2OWO A;  2VY3 A;  4BBS H;  2K32 A;  1A2U A;  2RKS A;  2ZJR A;  4DR1 L;  1I3Q B;  1BCP C;  3FP9 A;  1E7Z A;  3NEN A;  3I73 A;  1IL8 A;  4H13 C;  4BS9 A;  2KOL A;  3RLN A;  1I4R A;  1IXR A;  1VF7 A;  1VQP A;  1SND A;  1KHI A;  4A3E H;  3KF6 A;  3EBE A;  1GHK A;  5M5W H;  2VS1 A;  1LTT D;  4XDX A;  1HJP A;  4DAM A;  2B2U A;  1JOR A;  2IJ0 A;  4RG1 A;  1CZG A;  1QZH A;  4P75 A;  1FYC A;  4L5Q A;  3S1Q B;  1V43 A;  2LMC B;  1SYB A;  3HOY B;  3F1Z A;  3AYH B;  4CJ1 B;  1CA5 A;  4H0L C;  2F52 A;  3GQB A;  2IHF A;  3R2I A;  4GOP B;  3F8T A;  3RZO H;  4HID A;  3H3V I;  4HIK A;  3SEB A;  5C4X H;  4YY3 L;  5IYB G;  2E5L Q;  3PGZ A;  1Q7Y C;  1JB3 A;  1GUT A;  3S17 B;  1AW7 A;  2D9U A;  3H09 A;  1GUW A;  5LMN W;  2CQA A;  1MKH A;  1HPC A;  1TWA H;  5K36 H;  1E2Z A;  4EVO A;  3HOV B;  5I2Y A;  3QIA A;  1NMG A;  1FR3 A;  5IIF A;  4JI3 Q;  4DAP A;  4QUF A;  1XNR Q;  1K8G A;  2R93 G;  4KJO A;  1U4P A;  3TZD A;  4KN7 C;  3QOL A;  2ICI A;  2F0F A;  3U50 C;  4N8F A;  3J7A F;  5EKL A;  1RL2 A;  1CK1 A;  1D1I A;  2F0K A;  4BA1 I;  3WWV A;  4JV5 Q;  1KRS A;  1O80 A;  2WB1 B;  1A3U A;  4MIU A;  3U58 A;  1JB7 A;  2A69 D;  1UE1 A;  2EXD A;  5C5L A;  3K5N A;  1Q8I A;  2F03 A;  4HJA A;  1H9S B;  5E4W C;  4LJZ C;  4KKS A;  4LFA Q;  3DHQ A;  2ZM6 Q;  5M5W B;  1II3 A;  1J8I A;  4FF4 A;  4Y7N B;  1PYB A;  4EQP A;  4KV6 A;  1GO3 E;  4CDF C;  3OTO Q;  4A3J H;  1B3Q A;  1ICW A;  1PH5 A;  5LMN L;  2NBF A;  1SN8 A;  2OF1 A;  4PMB A;  1RTO A;  3V05 A;  3I2Z A;  4I7Z C;  3PIP 3;  4NXM Q;  5G3L D;  5FKA C;  3KDF B;  5M5Y B;  1TWC H;  1O78 A;  4DR3 L;  1OXT A;  4JI5 L;  3RZO B;  2L5T A;  2CFM A;  4C3I H;  3VYR A;  2F0Q A;  3DWQ A;  2IWH A;  5C44 G;  2ICE C;  3M4Q A;  4ABN A;  1P8L A;  4DU9 A;  1K8O A;  4ZCK A;  4PZ8 A;  1TWA B;  1Q46 A;  5ISR A;  4K6L A;  1C4Q A;  3AU7 A;  1SLJ A;  4A3C G;  3KBG A;  5C0X H;  1E22 A;  1EYC A;  1HNZ L;  4GKJ L;  1XMO Q;  1PHJ A;  1G6P A;  4YWK A;  1AP0 A;  1PRT B;  2X6L A;  4ID6 A;  3BVM A;  3I4N H;  1GUS A;  3P75 A;  1AN8 A;  1PRT D;  5ELE A;  5J1Z A;  2OT2 A;  4GZY C;  2LFN A;  4ULL A;  1EIG A;  2Y0S G;  1NAP A;  1SMX A;  1VMP A;  2N88 A;  3NHH A;  1TWF H;  4EQO A;  1LTA D;  4F87 A;  1N32 L;  2F0P A;  2G9D A;  2RA4 A;  3BYY B;  4J1M A;  2JXM B;  5COR A;  1STH A;  4DV6 Q;  2H1E A;  3IKJ A;  1RHP A;  5KRU A;  1IKL A;  3CC2 A;  4X62 Q;  1TII D;  4LF4 Q;  3E0E A;  2F0T A;  4JI6 L;  1PH8 A;  1XTC D;  5HY6 A;  1B70 B;  3A54 A;  1QE6 A;  1S40 A;  2K01 A;  2XRS D;  1MSG A;  4HJ8 A;  3NE5 B;  4A3J B;  2KED A;  3PUX A;  3STB C;  2OQK A;  4J8Q A;  1B9N A;  2M00 A;  3BDO A;  4A76 A;  5IYB H;  5G3L F;  3I4M G;  5CBA E;  4K5W A;  2IL8 A;  2SNM A;  4GKK L;  5JJZ A;  4ZAI A;  3TP5 A;  1C7Y A;  1TQO A;  3V96 A;  1AH9 A;  1H9K A;  1TWC B;  1L0W A;  4A3G G;  1BCP D;  1R4P B;  3DEO A;  1ILQ A;  1O7L A;  1RJT A;  4JI7 Q;  4C3I B;  5HUR A;  3RD4 A;  4X6A H;  4BBR H;  1D7Q A;  3LX0 A;  1Q1B A;  4PMW A;  4JI1 Q;  3GTK B;  2HCC A;  2K5W A;  2EZV A;  4DR4 L;  3KOJ A;  5LMU L;  3MZ5 A;  5ELF A;  1M4V A;  4DPG A;  2DJG C;  5LL6 X;  1ENC A;  4QB4 A;  5HGT A;  1ZKO A;  4HSP A;  2EQS A;  5LL6 S;  3DWA A;  4UPA A;  3TME A;  4YHH Q;  1Z7T A;  4L5T A;  3I4N B;  3UE1 A;  1M1K C;  4CGY B;  2F3I A;  1SJE D;  4DR6 Q;  3AB9 A;  2BA1 A;  2BH2 A;  4DV5 Q;  1JQY D;  5DAU A;  3TP6 A;  1EWH A;  1UWV A;  3D6C A;  1TWF B;  4R8N A;  1YVC A;  1PTO H;  2WP8 J;  3NEM A;  1LT6 D;  1PFB A;  2EYP A;  4GN3 B;  1GUG A;  1ROD A;  2AWO A;  4UHV A;  3SK5 A;  3FKI H;  2F0W A;  2WAQ G;  3BZK A;  2K28 A;  3MEH A;  3E9I A;  3VR2 A;  1XMQ L;  4FF2 A;  3P20 A;  1EWI A;  1WTP A;  2R7Z G;  1HUN A;  1P16 A;  3L3O C;  1HH2 P;  1S3O A;  3RUZ A;  1PVO A;  2NN6 I;  3BVG A;  1NR4 A;  5LHY 1;  3NWS A;  1SE2 A;  3K0X A;  3G7L A;  1SXT A;  4C2M H;  5IGF A;  1EIY B;  1LTI D;  4FO2 A;  3J80 i;  2VQF L;  4DV3 Q;  5BR8 L;  5BN3 A;  4JBM A;  4TSS A;  1HNW L;  5C3E G;  4DR7 L;  1DYQ A;  4IFD I;  4DUY L;  2K6A A;  1BCP F;  1CT1 D;  1LLR D;  1TS2 A;  4LF6 L;  1X3F A;  1X65 A;  1V1O A;  3WOF A;  2KA7 A;  3TBI B;  3DEP A;  3MHB A;  3J81 i;  4KHP Q;  2F0U A;  1SNC A;  4A3D G;  1G91 A;  2Q2T A;  2KVM A;  1S5E D;  3CXC A;  4BBR B;  1UEA B;  4TVA B;  2B63 G;  5M3M G;  4GLX A;  2GA4 B;  1OXX K;  4IO9 A;  3S2H H;  3CAM A;  5KNC A;  3CU7 A;  3W5O A;  1YBY A;  2VQE L;  1KQS A;  4BY1 H;  4UP9 A;  2CKZ B;  4MHE A;  1HFN A;  1RTN A;  2C5C A;  3OMC A;  4JI2 L;  3F2B A;  1C8C A;  1X3Q A;  1S5B D;  1L1O C;  1K83 B;  1PH2 A;  3TS0 A;  3VYS A;  4CHT B;  5EBC A;  4JBW A;  5I6Y A;  3GV3 A;  4IPC A;  1JJG A;  2F0G A;  4GN5 A;  4R8I A;  1A63 A;  4GLV B;  4DAY B;  3CME A;  2Z4I A;  2PYK A;  1YHB A;  4V19 0;  3A7A B;  1PTO B;  3K5L A;  4DUZ Q;  1HZA A;  1K3R A;  3A55 A;  5E1F A;  5I9P A;  3FKI B;  4BXX G;  3BVZ A;  2JA6 B;  3J7Y W;  2Q8T A;  1HZC A;  1E1O A;  1KDB A;  2PI2 E;  4ZKB B;  3RNU A;  1SRO A;  3HS0 C;  5JAV A;  4N9P A;  2NZO A;  2SEB D;  4H44 C;  2XN9 C;  2JA5 G;  3I4M H;  4A3F H;  1ENF A;  3S24 A;  3MTS A;  5GAD C;  1ESF A;  4LF9 Q;  2AHO B;  4MTN A;  4IPH A;  3D6W A;  4X64 L;  1X54 A;  3D8G A;  4A4I A;  3C1F A;  4A3G H;  3PUW A;  4C2M B;  3GTQ B;  2B2W A;  4KN4 C;  2EYO A;  1C9O A;  4OGQ C;  1XNQ L;  4DK3 C;  3HOY G;  3PQI A;  2JYO A;  1B53 A;  4BA2 I;  3KF8 A;  3H6M A;  4LF8 L;  3NQT A;  5CBE E;  4A3L G;  4BWG B;  3HGB A;  1PH6 A;  2PMZ B;  4X3S A;  5KNB A;  1HR0 L;  1EY9 A;  3E5S A;  3KJP A;  3A8K E;  1H95 A;  3BG3 A;  2VB3 X;  3I56 A;  1JWM D;  1Y1W H;  4U68 A;  1F9Q A;  1V8Q A;  3S2H B;  3TP7 A;  2YTY A;  2HHH Q;  1AZQ A;  3HOV G;  3MXP A;  1X3G A;  2EE1 A;  1VQM A;  4BY1 B;  2TSS A;  3Q22 A;  4ZK9 B;  3UI2 A;  3STB D;  3K80 C;  4IUQ A;  2BDO A;  3TP8 A;  3X3N A;  1IL2 A;  2QCP X;  4GLA C;  2KJX A;  4GOP C;  1LAB A;  2F0E A;  1VQC A;  2CW0 C;  1SYD A;  1KC8 C;  3IL8 A;  4JCV E;  1HNX Q;  4OO1 H;  2R7F A;  3KLW A;  2MO1 A;  4O0A A;  1STG A;  4Q5V A;  2A6H C;  1LAC A;  4PV1 C;  1ET9 A;  4U67 3;  2WB1 G;  2SDF A;  2R7Z H;  1KXL A;  2SNS A;  3R3O A;  2A74 C;  4QF4 A;  3CC7 A;  2Q8R E;  5D3I B;  2NVT H;  1IYU A;  3DWP A;  1N8R C;  4NXN Q;  2RSO A;  3OW7 A;  3MXU A;  1ONL A;  2UXD Q;  1I94 L;  2JK8 A;  4A3F B;  1CSQ A;  3QR8 A;  3J7Z C;  4A3M H;  1EY4 A;  1TKW B;  3H0G H;  4KJN A;  2JEA I;  1FNW A;  5CMD A;  3U9S A;  4JI8 Q;  5BN5 A;  1IBL Q;  1KAB A;  4A3D H;  1S5C D;  1YIJ A;  1B3A A;  2MGS A;  3M9B A;  4AQY L;  4IJL A;  1EEI D;  5M3M H;  3HOZ G;  3SK8 A;  2UUC L;  3OIP A;  1I6V C;  1Q3L A;  1W6J A;  1KTK A;  1X55 A;  1EQV A;  1O7Y A;  4LAA A;  2UXC L;  4XIG S;  4XQN A;  2EVB A;  2A6E C;  3RN5 A;  2CH4 W;  3MAQ A;  3PUZ A;  3F2D A;  2UU9 Q;  1WVL A;  2K04 A;  2B2V C;  4OIK A;  3LGJ A;  1Y1W B;  2R7D A;  4HJ9 A;  5FLX E;  2KEC A;  4ODG A;  1WYD A;  1T9H A;  4NDX A;  1TWH H;  4R4O A;  1KNA A;  3I8Z A;  5IYD G;  1LTS D;  4OHJ A;  1QB5 D;  4QIW B;  5BN4 A;  3WOE A;  2J7Z A;  4A3I H;  4KLK A;  2VNU D;  4JOI A;  4CDC C;  5FLM G;  2JJQ A;  1VDZ A;  2FHT A;  3AFP A;  2Q2H A;  3A5Z B;  4IJH A;  2M9V A;  2MHV A;  1SE8 A;  3I55 A;  2PW7 A;  4FVM A;  5FOB B;  5JJL A;  1EQT A;  3J80 c;  1JJ2 A;  3K7U C;  4QUC A;  3RR5 A;  2L4N A;  1MHW C;  4LFB L;  2PCF B;  3WDN A;  2JA5 H;  1N9W A;  2RF4 A;  4DV4 Q;  4PG3 A;  3I4L A;  5AFW A;  4QCL A;  1QUQ A;  1UNS A;  2Y0S E;  3J81 L;  2NVT B;  1R4Q B;  2Z6K A;  3NBH A;  3J81 c;  3HFZ B;  4NW2 A;  3DLL A;  1STN A;  4OX9 L;  2PQA A;  3K8A A;  1LTL A;  4DV2 Q;  4A3M B;  5CGK A;  1VQ9 A;  3H0G B;  3G4S A;  1QJO A;  2B29 A;  2NZH A;  3HRZ C;  4GNX A;  2OEO A;  1HTL D;  1SMY C;  3ULP A;  4A3L H;  4RFB A;  3VR3 A;  3BYT B;  5ELD A;  2F0H A;  3ICE A;  2PZW A;  3T1Y Q;  3T56 B;  3F2C A;  3S17 H;  1F77 A;  1OTC A;  4FYD A;  4C3H H;  1BXT A;  2JEB I;  4DN4 M;  4YY3 Q;  1YHA A;  3A56 A;  3HOV H;  4LF5 L;  3VYT A;  1TY2 A;  1X32 A;  4JYA L;  2EOT A;  1A15 A;  4DK0 A;  3R93 A;  3G6J B;  3T53 B;  4IPD A;  4OWX B;  3U9O A;  1FJG Q;  1PDQ A;  5A2Q L;  1PFS A;  1CKN B;  1GKH A;  4K5X A;  1CTM A;  1N36 L;  1HHV A;  4YCU A;  5C0X G;  4A3I B;  4JBK A;  2VB2 X;  2KQ3 A;  2EXZ A;  4HR7 B;  4LFC L;  2UXB L;  3I4N G;  2FXQ A;  5EPJ A;  2NUC A;  4H02 A;  4P72 A;  1SYG A;  3HKZ E;  1D8L A;  2B2T C;  4K2L A;  2JA5 B;  1A62 A;  2J4X A;  1EQQ A;  1VQJ A;  1CKM A;  3KLS X;  5ELB A;  4XT3 B;  4Y7N H;  1SR3 A;  2KCC A;  1AFP A;  3QOJ A;  4K0K L;  1HRJ A;  3JAM E;  4B3T L;  1I5F A;  5CV6 A;  3AQQ A;  2RHQ B;  5FO8 B;  2B3G A;  3HOZ H;  1B2T A;  3NK9 A;  4CKB A;  5M5Y H;  2K05 A;  4HIO A;  1JOK A;  3DUZ A;  4HMJ A;  4DKA C;  2N3S A;  4K6D A;  4GNX B;  1QCB D;  2KCN A;  2CW0 D;  4HAE A;  1G6Z A;  1NMF A;  4DR3 Q;  4JI5 Q;  5EGT A;  2A6H D;  5FJ8 G;  2KBN A;  3SXH A;  5C3W A;  1PLF A;  4C3H B;  1CSP A;  3NP8 A;  3D31 A;  5IYD H;  1PZK D;  2K4K A;  3I7F A;  4IUT A;  4XTC S;  3MWY W;  4BBR G;  2PNR C;  2ZT9 C;  5CV5 A;  1JOQ A;  1BBU A;  5IP7 H;  5FLM H;  4J15 A;  1EZ8 A;  4OWT B;  1EUJ A;  3T1H L;  1VQ7 A;  2E2D C;  1KAW A;  1Q1E A;  1G8Z D;  1V1P B;  2QW7 A;  3L0O A;  1STE A;  2BA0 A;  3Q24 A;  5JPN C;  1PA6 A;  3NUC A;  1EYG A;  3GTG B;  4P2C B;  3EIV A;  2XGT A;  3O13 A;  1LT3 D;  4DNI A;  2NVX H;  1KL9 A;  5DNF A;  4TQU S;  2MUY A;  5CV4 A;  3ULL A;  4R9W A;  1X6O A;  1Y14 B;  3BU2 A;  2A6E D;  1JOO A;  3CCJ A;  1N34 Q;  2CWA A;  3H3V H;  3UDI A;  2EY1 A;  2OXP A;  1CZW A;  1LTB D;  3KF6 B;  3FKI G;  2DUD A;  4JI6 Q;  2F0J A;  4ME5 A;  2IY5 B;  2JA6 G;  2E74 C;  1TWG H;  2FMC A;  4IFD J;  2MFI A;  1KIX A;  2ID0 A;  4C1N I;  1U5K A;  1Y8P B;  1VQI A;  2F0M A;  3SE0 A;  2F0N A;  1CKO A;  3HOZ B;  4B3R Q;  1GD7 A;  5JEA J;  3AFQ A;  4DV1 Q;  3Q8D A;  1WD0 A;  4DK1 A;  1I4X A;  4G7O C;  4PZ6 A;  1MI2 A;  2RDG A;  3FEW X;  2DGY A;  2G5D A;  3CF5 A;  2BCO A;  4GKK Q;  1XXG A;  2K7V A;  3J7A 5;  2AQ1 B;  1PTO C;  2EY5 A;  4NMZ A;  3NEL A;  2BOS A;  3GTK H;  3ND9 A;  1K0S A;  2QEJ C;  2E5L L;  1G51 A;  1J5E L;  4DV7 Q;  4DR4 Q;  5T1G A;  3ERO A;  3OWF A;  1Y1V B;  3S1R H;  4UP8 A;  2VUM B;  2Z6B A;  2YTX A;  1NUC A;  3BDL A;  5IT9 E;  2LXK A;  4AYB G;  4N8X 1;  3PO3 G;  3E9H A;  2JA7 G;  3A7L A;  2R3Z A;  3JC6 6;  2R61 A;  2AQ2 B;  3QG1 A;  4BY1 G;  3PIP A;  3A0J A;  1K73 C;  4DXG A;  4KI0 A;  1SMY D;  4DR5 L;  1K9M C;  1XNR L;  3VR4 A;  1MD2 D;  4MZ9 A;  4A3K H;  2NVX B;  1X3P A;  2PI2 A;  4X66 Q;  5EQ0 A;  3M85 A;  1WI5 A;  2LSS A;  2KCM A;  1EQR A;  4YWM A;  4ALP A;  4ILW A;  1YIT A;  1YNN C;  2EYJ A;  5IGE A;  3HZX A;  2F4I A;  5M9O A;  1HA5 A;  1PH3 A;  1TWG B;  5GRO A;  1CI3 M;  1OXV A;  2WB1 E;  2MO0 A;  3SGI A;  1JC7 A;  3NXW A;  3QJY A;  2PPB C;  1N33 Q;  1CM9 A;  3KUP A;  4F88 A;  3UE0 A;  4C56 C;  4A3F G;  4B3M Q;  4HCE A;  2LKV A;  5FJ8 H;  2VW9 A;  2CH4 A;  3S2D H;  5BR8 Q;  1HA6 A;  2V4D A;  2ZXR A;  1GUN A;  2VZA A;  4DUY Q;  3D4W A;  1Y8O B;  2GVA A;  1BNZ A;  4LF6 Q;  2EYM A;  3J7A V;  4JI0 Q;  2K52 A;  2XWB B;  1ZEQ X;  4NXM L;  5IGG A;  4POF A;  3H91 A;  3MVV A;  2E2I H;  5COY A;  3FVQ A;  4DF7 A;  3GO5 A;  3HOW H;  2Z1C A;  2PQE A;  5IP9 G;  2L15 A;  2Z8L A;  3OOC A;  2VXW A;  4LWC A;  1Y1W G;  4B3S Q;  2NVQ H;  3S1R B;  4G57 A;  2JN4 A;  1PRT F;  2SOB A;  4KHV A;  4X65 Q;  2R92 H;  1O7Z A;  3PIO 3;  1K83 H;  3M7N A;  3NTK A;  4YIJ A;  5KIX A;  4DAV A;  2HT1 A;  3MXN A;  5E4X A;  1HZ9 A;  1BBW A;  1XMO L;  4F7X A;  4A3K B;  1MGS A;  3ULJ A;  2B2W C;  3K6O A;  2QDL A;  2UUB L;  1A2T A;  1U4R A;  3PV0 A;  4HTH A;  2BH8 A;  2EYF A;  1EEF D;  3H15 A;  3S9W A;  1EYA A;  2JA6 H;  5HGQ A;  4OO1 G;  2BE5 C;  3CKI B;  4FF3 A;  3K81 C;  4HN7 A;  1RIP A;  2L0C A;  1UE5 A;  4DNT B;  5EAY A;  4FDB A;  3ZYY X;  3R2T A;  1TR5 A;  1CHP D;  4LF4 L;  2K5D A;  3GTQ H;  3CMA A;  1YEZ A;  4YCV A;  3SR1 A;  3Q0A A;  4R1J A;  4FNF A;  1C0A A;  2JP1 A;  3K58 A;  1FD7 D;  5J22 A;  2MPM A;  4RCN A;  1NE3 A;  2C9O A;  1LTR D;  4A3M G;  3H0G G;  3S2D B;  1WFQ A;  3RZD H;  5JJI A;  4Z9C B;  5IT9 L;  1Q12 A;  4DR2 L;  2ENB A;  3ER0 A;  2K5H A;  5IGB A;  2BDN A;  3BZC A;  2E2I B;  2Q8I B;  4RKB A;  1A8V A;  1EIF A;  2D0P A;  2HCI A;  1L0Y B;  3HOW B;  1VQN A;  3PO3 H;  4EQ5 A;  3GP7 A;  2JA7 H;  3PO2 H;  1D5M C;  3OW2 A;  1UE6 A;  4HMI A;  1EY5 A;  1YNX A;  5DEH A;  2NVQ B;  1XPO A;  1IBM Q;  5IYC H;  1JWS D;  4JI1 L;  4ME3 A;  1KD1 C;  3FRP B;  4OEL B;  1ASY A;  2R92 B;  3GD7 A;  4TKO B;  4LF7 L;  2KHJ A;  1S5F D;  2Z4H A;  4X3U A;  5I6W A;  4ZQ3 A;  2NN6 H;  5A35 A;  4A3I G;  4S3S A;  2VL6 A;  2NVY B;  2F0L A;  1FL0 A;  2B39 A;  2LS0 1;  4YHH L;  2CHB D;  2P5Z X;  3CCS A;  2LXJ A;  1X3E A;  1PTO D;  1RKN A;  5EKK A;  4IFD H;  4DR6 L;  3BJU A;  2QIL A;  3GTO B;  1QVF A;  3GDE A;  1ICF B;  4OON A;  3ZJY C;  1UE7 A;  1PH7 A;  4JC0 A;  5JEA H;  1GOZ A;  5AJ3 Q;  2ATW A;  5CV7 A;  1DOL A;  5CV9 A;  1Q90 A;  1LUZ A;  5C4H A;  1I94 Q;  1F9R A;  3M4O H;  4QQB X;  4L8J A;  5IWA Q;  3HOX H;  2I5H A;  2G9H D;  3S14 B;  1BBX C;  4PMC A;  3K59 A;  2HIX A;  1IBK L;  3PF4 A;  2EY6 A;  3G48 A;  4JI4 Q;  1G2T A;  1D2B A;  1EL0 A;  4JBJ A;  4K8J A;  5D3D A;  3RZD B;  3EVQ A;  3P1H A;  5FK9 C;  3KJO A;  1XPU A;  2KCT A;  2I07 B;  5IP9 H;  1VQ8 A;  1I4P A;  1DM0 B;  2JQO A;  3OSO A;  1VQ6 A;  2PO4 A;  1XTD A;  1SBB B;  4R4T A;  1JE4 A;  2UXC Q;  3GTP H;  2WFW A;  4KHP L;  1I4Q A;  4C3H G;  1RD9 D;  1YNN D;  2DNE A;  3TRE A;  4OWW B;  3AEV A;  2XVS A;  4AYB B;  3PO3 B;  2JA7 B;  4IN3 A;  3PO2 B;  4HJ7 A;  4IOC A;  1J6Q A;  5ELN A;  3TZU A;  4XXE A;  1JE5 A;  5IY0 A;  4XT1 B;  5C6A A;  3K0Y A;  3D3R A;  2F4V L;  1OXS C;  1A0I A;  3E6Z X;  2RQX A;  2YYZ A;  3CPW A;  4HJ5 A;  3C3L A;  2E8G A;  1FGU A;  4I65 A;  1W6K A;  1GHJ A;  4GNX C;  1A3V A;  2FJ2 A;  2KEE A;  1SYE A;  5E3F A;  1WTX A;  1KLG D;  3I4O A;  1PTO F;  1ZYR C;  5KYL A;  2JA8 B;  4LUO A;  3TQY A;  4J6H A;  5M3F B;  2HQE A;  2LY7 A;  1YNJ C;  1HQR D;  4LFB Q;  4G7H C;  3K5O A;  5J3B A;  1PYW D;  2IT1 A;  5KND A;  1D5X C;  2PZU A;  4DUZ L;  2C35 B;  3GTJ H;  2J0T D;  2A68 C;  1L0X B;  1BF4 A;  4OX9 Q;  3W3A A;  1IKM A;  1E24 A;  3MEF A;  1NSN S;  1I50 H;  1UEB A;  3M4O B;  2EYH A;  1ESR A;  3LWE A;  1EOT A;  3HOX B;  3VA5 A;  2FMM A;  3W1G A;  1VQ4 A;  2WKC A;  1QWY A;  1Q82 C;  1FVI A;  4LF9 L;  4RWS C;  1JIC A;  1T5X D;  1F9S A;  2ALY B;  2IW3 A;  1L1O A;  2Q2I A;  3GTL H;  5IE8 A;  2MP1 A;  1SEB D;  3KF8 B;  3CCR A;  3KK7 A;  3Q23 A;  2AUJ D;  1F2L A;  1E3P A;  1EZ6 A;  3W2D A;  3A5U A;  1EFW A;  3M4P A;  2BE5 D;  4IAL A;  1K0R A;  3GTP B;  1LT5 D;  4JYA Q;  1V1Q A;  5KYI A;  2DNC A;  4K8I A;  1VQL A;  1I6H H;  2HDL A;  4KD3 A;  4EX5 A;  2B2U C;  1W3S A;  1VS0 A;  3OIQ A;  5IP7 G;  1MSH A;  3HOU B;  1VQF A;  2NB0 A;  1Y1V G;  5K5P A;  1K8A C;  2K1B A;  2VUM G;  1NY4 A;  1PH1 A;  1DGS A;  2HHH L;  2PMZ E;  4L63 B;  1FNV A;  4LNQ A;  1PMR A;  5KEE A;  2UUA L;  1CFM A;  4DR1 Q;  3E0J A;  1SSO A;  1QNK A;  3EQL C;  5I2X A;  1CUK A;  2IX0 A;  5TSS A;  1U0L A;  1UUP A;  4KK7 A;  1CQF A;  1LYL A;  3DMU A;  1B1Z A;  1HCZ A;  2O5J C;  1HNX L;  1Z9F A;  3LNN A;  5T1I A;  3K57 A;  1YI2 A;  4FXD A;  1IYV A;  4OEM B;  3JAM i;  3GTJ B;  4UP7 A;  4FXK C;  3VYU A;  4NXN L;  4NKL A;  3DM3 A;  1BDO A;  1I50 B;  2AKW B;  3RN2 A;  4RCO A;  2UXD L;  3SHL A;  2MNA A;  3I90 A;  4AH6 A;  4WJ3 M;  2ZTC A;  4RGT A;  4KD4 A;  4L5S A;  2XRQ D;  1VQB A;  3G71 A;  4L5R C;  4JI8 L;  2PW5 A;  4GOP A;  3GTL B;  3ERQ A;  3ITP A;  3M7G A;  4ZRZ A;  4B9W A;  3CPF A;  2RSN A;  2AUK A;  3FPU B;  1ZXT A;  2EYL A;  2NYZ D;  1SNO A;  4A93 B;  1TT2 A;  1BUV T;  2EIF A;  2A8V A;  4BY7 G;  3CC4 A;  3H3V C;  5I4D A;  2XNA C;  1RCV D;  1W2B A;  1Y69 U;  1NBW A;  2UU9 L;  1I6H B;  1EWC A;  1VQO A;  3FPP A;  3T1H Q;  3GTG H;  3C2P A;  1MIU A;  3IRB A;  1STY A;  5F2D A;  3NWT A;  1D6E C;  4C3J H;  2XTI A;  1SFO H;  1DXM A;  2D0O A;  1D5Z C;  2WV6 D;  4PQX A;  1JMC A;  4RHR A;  1B4O A;  3A74 A;  3SDZ A;  4HIM A;  4DGZ A;  1EU3 A;  2K50 A;  4A3K G;  1CA6 A;  3CRK C;  4JG2 A;  4CKC A;  3CQZ H;  4QIW E;  1B44 D;  1WCM B;  1PZJ D;  3W1B A;  2AWN A;  4O2D A;  3TDQ A;  1KRT A;  5C4Z A;  1BOS A;  1OXU A;  2F0S A;  1H9S A;  2AQ3 B;  1QUQ B;  2KEN A;  1TVX A;  4RAU C;  1KLU D;  2MJ8 A;  1K8M A;  2B2V A;  3P7J A;  3NBH B;  1Q81 C;  4DV4 L;  2RBM A;  2WAQ E;  2I0Q A;  1STA A;  3Q6S A;  5GAE C;  1TY0 A;  2PQA B;  1WTO A;  1PFN A;  5LMN Q;  1TXY A;  2CQO A;  2PNH A;  5FLX L;  5GQO A;  5FLX c;  4DNR B;  2E76 C;  2JE6 I;  3TN2 A;  1EU4 A;  4JW0 A;  1PFM A;  4DV2 L;  2XWJ B;  4IQZ A;  1NR2 A;  4QL5 A;  1SDF A;  1GJX A;  1QVC A;  2F1M A;  2TMP A;  1X9N A;  3MFY A;  3D0F A;  4JK1 C;  4A3B B;  1ET6 A;  1PYS B;  1ZYR D;  3KDF A;  4MNO A;  1VQ5 A;  3I3C A;  3MA2 B;  3PCO B;  3T1Y L;  3KFU A;  1I4G A;  1YNJ D;  2IHE A;  2V1C C;  4LUZ A;  1NNX A;  1Y1V H;  2VUM H;  2CVR A;  3NTI A;  2F3V A;  1J5E Q;  1SJH D;  3HOW G;  2K5N A;  2QF7 A;  1KAA A;  1HNZ Q;  4GKJ Q;  4JPB W;  2A68 D;  2FIN B;  3UDX A;  3IFT A;  3RLO A;  4F8M A;  3K7A H;  4OXP A;  1RDP D;  1FJG L;  3SK4 A;  1SYF A;  5IOD A;  1H9R A;  2K5Q A;  4C3J B;  1SFO B;  4DV0 L;  2K03 A;  2R92 G;  4ZUI A;  2I5L X;  1F9P A;  4DR5 Q;  1DZ1 A;  4PZ7 A;  4RA8 A;  2D62 A;  1XWE A;  4RGO S;  1B50 A;  1N32 Q;  3UDG A;  3E3X A;  3MXG A;  4TRD A;  1YHQ A;  4IPG A;  4RKL A;  2YU9 H;  3S16 H;  2ZTD A;  3NBI A;  3CQZ B;  4BBS B;  2X69 A;  5JJK A;  1O7I A;  3L7Z C;  4DFA A;  5JOB A;  1AEX A;  3G6E A;  2JA9 A;  1MJC A;  2OTL A;  3SK6 A;  1DCZ A;  2K14 A;  1EYD A;  5C0X I;  5C3X A;  2B2Y A;  3TRZ A;  5C4J H;  1VQA A;  3BZD B;  4K14 A;  3I91 A;  4P71 A;  4A3E B;  4KY7 A;  1OO9 B;  3QWN A;  1VQG A;  3GTM H;  1STB A;  2WIN B;  3EFX D;  3BDC A;  3PUV A;  2O2L D;  1T5E A;  3D4R A;  2L11 A;  4BY7 H;  1VQK A;  1SYC A;  2NTS A;  3NTH A;  4POG A;  1EY0 A;  2H4O A;  3QB3 A;  4DK6 C;  3N52 A;  5D14 A;  2K33 A;  2E75 C;  1TU2 B;  1EY7 A;  1JWU D;  3TSS A;  3S15 H;  2RCN A;  2B2T A;  3VDY A;  4O42 A;  4I7A A;  5LMU Q;  3ONA B;  4H7B A;  5C4X B;  2RDH A;  5JVG 3;  1HXY D;  1J9O A;  2OTJ A;  2GN5 A;  4MN3 A;  4O1N A;  1QOH A;  3HP3 A;  3PO2 G;  2HQL A;  2HDM A;  4JI3 L;  1SAP A;  1EY6 A;  2CWP A;  3K7A B;  2CCZ A;  5GAH C;  3AMU A;  5IYC G;  3JAM L;  3JAM c;  1LTG D;  2DJF C;  4CJ0 B;  2IX3 A;  3EN2 A;  2QA4 A;  2ZJQ A;  2DY8 A;  2R6G A;  2A73 B;  1H9M A;  2YTV A;  4DA2 A;  2UUB Q;  2NN6 G;  1PV4 A;  4JV5 L;  5M5X H;  3KYH C;  2YU9 B;  1M8A A;  1X56 A;  4KKT A;  3S16 B;  1YZ6 A;  2L1B A;  4UY8 C;  4HED A;  2JA8 G;  1FGB D;  2D5D A;  2A5H A;  3CW2 C;  5EBD A;  5M3F G;  4MTK A;  1F2M A;  1WOC A;  4IFD G;  1XMQ Q;  3HKS A;  4IUU A;  5L37 A;  4LFA L;  2ZM6 L;  1N34 L;  3PMF A;  5JEA G;  5C4J B;  1E0B A;  1S72 A;  1JT8 A;  2VQF Q;  3OTO L;  1GUO A;  1S5D D;  4IZ8 A;  3GTM B;  1HNW Q;  4DR7 Q;  2KHS A;  4RH6 A;  4WRD A;  1U9R A;  1BQQ T;  3HOX G;  2HUG A;  2EJF C;  1LT4 D;  1ASZ A;  4B3R L;  3QO2 A;  2L9H A;  4BY7 B;  4DV1 L;  2E2H H;  2Q2U A;  5IOC A;  4JVZ A;  2F0O A;  4DR2 Q;  1G29 1;  5IGD A;  3LWU A;  2M2L A;  1BVS A;  1XPR A;  1BCP B;  2N55 A;  1F2Y A;  3S15 B;  1YJ9 A;  1AZP A;  5EJW A;  4KHZ A;  1IW7 C;  3GV6 A;  2VQE Q;  5KGU A;  2NWG A;  3RMH A;  1S4Z A;  1JCK B;  4RMF A;  3T13 A;  2O5I C;  2R93 H;  4HCS A;  4JI2 Q;  1U4M A;  1U4L A;  2WII B;  4DV7 L;  1QVG A;  2NVY H;  2IX1 A;  4LF7 Q;  3HOU G;  3C46 A;  1JJC B;  3RLF A;  5DM7 3;  1SNM A;  5IGC A;  3PUY A;  1VF5 C;  2DN8 A;  1MBY A;  4RGN A;  2OQ0 A;  5H1S E;  3I72 A;  1BR9 A;  3HKZ G;  3M3Y H;  3GTO H;  3R8B A;  1SE4 A;  1VQD A;  4DAY A;  5M5X B;  1A6X A;  3VR6 A;  4X66 L;  1DJR D;  4DV6 L;  4QMG A;  4IUR A;  1WJJ A;  4X62 L;  3FDT A;  3PSI A;  4WJ4 A;  3N6R A;  1KDC A;  4CKE A;  2L55 A;  5J39 A;  3S14 H;  4X64 Q;  1Q86 C;  4XYQ A;  4M1U B;  2HD3 A;  3PIO A;  1AE2 A;  2GVB A;  5D65 A;  1XNQ Q;  4P74 A;  3CCU A;  4CBV A;  3MFG A;  3NQI A;  1IBK Q;  2N8N A;  1EY8 A;  2NZ1 D;  2ZXP A;  1N33 L;  5IT9 c;  3CCM A;  4LF8 Q;  1D1K A;  4IUV A;  1Z6H A;  2DY7 A;  1XYI A;  4B3M L;  2E2H B;  1HR0 Q;  4B08 A;  2A1A A;  5C44 H;  2QDB A;  1QZG A;  1IZ6 A;  4APV A;  3S1N H;  4JI7 L;  4WFN 3;  4GN4 B;  4ZKC B;  2N49 A;  4JI0 L;  2Z0S A;  4A93 G;  1SRU A;  2RHS B;  4XQQ A;  4A3C H;  1WTV A;  1I4H A;  3CRL C;  1LV9 A;  3U4V A;  1RF2 D;  3T4A C;  3EJI A;  4LW1 A;  4LK1 C;  2RVL A;  5GAG C;  1K28 A;  1LO5 D;  2F0V A;  3TS2 A;  2R93 B;  4XYO A;  4B3S L;  2F4V Q;  5I9O A;  5FO7 B;  4Q0F A;  1V9P A;  3MXN B;  4X65 L;  2JA8 H;  4RGM A;  1KNE A;  2E2J H;  4KKU A;  5M3F H;  1NCV A;  4XQJ A;  2HIV A;  4DV5 L;  2KHI A;  1HR0 W;  3M3Y B;  3CHB D;  1IYJ B;  3OYY A;  4WOR A;  1WTH A;  3A8I E;  3URY A;  3T51 B;  2XIW A;  3OPO A;  1XJV A;  4RHS A;  4IUP A;  1WCM G;  1PZI D;  2ZJP A;  3L2P A;  3FMC A;  5E7N A;  3VA7 A;  2EPB A;  1E2W A;  1LM0 A;  2OCE A;  3NPP A;  4YCW A;  1F2Z A;  4CDE C;  1M90 C;  1EIH A;  3L9A X;  2KUM A;  4K2K A;  4KMU C;  4JOI C;  1ENA A;  4AQY Q;  1BO0 A;  1CQV A;  3VR5 A;  4OO1 I;  4DV3 L;  2H5X A;  2JSO A;  3J80 E;  4CJ2 C;  4M8A A;  2UUC Q;  1EOV A;  3OMG A;  1DOM A;  5C44 B;  4A3B G;  3J81 E;  3S1N B;  2IPK D;  2K5V A;  2RDF A;  4OIJ A;  5CV8 A;  5EPL A;  2Z6K C;  3DM1 A;  1HQM C;  1JR0 D;  1TS5 A;  3HOU H;  1G2S A;  4NP5 A;  2RCF A;  3S1M H;  5NUC A;  2B8G A;  4KY5 A;  5EPK A;  1DD2 A;  1K3B C;  1MJE A;  1GM5 A;  1IBM L;  4X3K A;  2D2C C;  2QKI C;  1BKB A;  1HZB A;  3KLR A;  2UUA Q;  4YWL A;  2QGQ A;  4IUN A;  4X3T A;  2EDG A;  4C3J G;  2Y0S B;  2Z9H A;  3V2T A;  2E2J B;  4Y52 H;  1ILP A;  3FHW A;  3C1E A;  3D4D A;  1VQH A;  3HG9 A;  4FP5 D;  2NTT A;  4CDD C;  1XX8 A;  4BBS G;  3ERS X;  1A3T A;  3KLS A;  1YJN A;  3HEJ A;  5A2Q E;  4ZYS A;  1PXU A;  3J81 j;  1VQE A;  2F3W A;  5ELO A;  1IW7 D;  1WTR A;  4OL7 A;  5AJ3 L;  1E1T A; 
#chains in the Genus database with same CATH homology
 1X3F A;  1X65 A;  4JG2 A;  2YTX A;  3CCV A;  4KHP Q;  3CQZ H;  3J81 i;  4QIW E;  2LXK A;  4P73 A;  3W1B A;  4A3D G;  1Q8K A;  4AYB G;  3PO3 G;  2AWN A;  3E9H A;  4LUV A;  2Q2T A;  2JA7 G;  4O2D A;  4A3E G;  1KRT A;  3JC6 6;  5C3E H;  1OXU A;  3CXC A;  4TVA B;  2B63 G;  4BY1 G;  3PIP A;  3A0J A;  5M3M G;  1QUQ B;  2KEN A;  4KI0 A;  5IWA L;  4DR5 L;  3PF5 A;  4GLX A;  1K73 C;  1K9M C;  3CD6 A;  4MZ9 A;  4A3K H;  1Q81 C;  3NBH B;  1OXX K;  2PI2 A;  4DV4 L;  4IO9 A;  2WAQ E;  3S2H H;  2I0Q A;  3CAM A;  4X66 Q;  1YJW A;  1NJI C;  5GAE C;  4JI4 L;  3M85 A;  3CCE A;  4A93 H;  1WI5 A;  2PQA B;  3TEH B;  4LF5 Q;  5LMN Q;  1TXY A;  2LSS A;  2CQO A;  2KCM A;  2PNH A;  4R4Q A;  3W5O A;  1YBY A;  2VQE L;  1KQS A;  4BY1 H;  2B63 H;  5GQO A;  4UP9 A;  5FLX c;  2CKZ B;  1L2F A;  1VCI A;  5DLQ E;  1EQR A;  4YWM A;  4ALP A;  2JE6 I;  1YIT A;  4A75 A;  4JI2 L;  3F2B A;  1L1O C;  4DV2 L;  4QL5 A;  1PH2 A;  1QVC A;  3TS0 A;  4R4C A;  4JBW A;  1N36 Q;  1X9N A;  4IPC A;  1PH3 A;  1JJG A;  5C4X G;  3U4Z A;  3D0F A;  5GRO A;  1R9T H;  1PH4 A;  4GN5 A;  1PYS B;  1OXV A;  2WB1 E;  2MO0 A;  3KDF A;  4GLV B;  1CKN A;  2A19 A;  4MNO A;  3SGI A;  4DAY B;  3CME A;  1VQ5 A;  1YHB A;  3PCO B;  1N33 Q;  4DUZ Q;  3T1Y L;  3KFU A;  2IHE A;  3UE0 A;  2V1C C;  1HZA A;  1K3R A;  4A3F G;  5K36 G;  4LUZ A;  4LFC Q;  2UXB Q;  4B3M Q;  4BXX G;  1NTG A;  1Y1V H;  5FJ8 H;  2VW9 A;  2VUM H;  3S2D H;  5BR8 Q;  4AYB E;  1HZC A;  1E1O A;  1J5E Q;  2PI2 E;  2VZA A;  3HOW G;  2K5N A;  3CP0 A;  1WCM H;  4DUY Q;  2K75 A;  3RNU A;  1SRO A;  1HNZ Q;  4GKJ Q;  4NPS A;  2ZTE A;  2GVA A;  5C0X J;  2NZO A;  1I3Q H;  4NB3 A;  4LF6 Q;  2JA5 G;  3UDX A;  4A3F H;  4LF6 L;  3I4M H;  3RLO A;  3S24 A;  4JI0 Q;  2K52 A;  5GAD C;  4NXM L;  4LF9 Q;  2AHO B;  3K7A H;  4IPH A;  4MTN A;  4OXP A;  4POF A;  4BXX H;  1FJG L;  2E2I H;  4X64 L;  1X54 A;  4A4I A;  4DV0 L;  2AMC B;  4A3G H;  3PUW A;  3GO5 A;  2R92 G;  3HOW H;  4K0K Q;  2I5L X;  2N78 A;  1C9O A;  5IP9 G;  2L15 A;  4DR5 Q;  4B3T Q;  3UDF A;  4PZ7 A;  1XNQ L;  4DK3 C;  3HOY G;  3CCL A;  2D62 A;  4LWC A;  1Y1W G;  4BA2 I;  4QY7 A;  3UDG A;  4B3S Q;  2NVQ H;  1N32 Q;  2ES2 A;  4LF8 L;  1Z47 A;  1YHQ A;  2YU9 H;  4IPG A;  3S16 H;  2ZTD A;  4QJF A;  4X65 Q;  2R92 H;  5JJK A;  1O7I A;  2MQH A;  3L7Z C;  4A3L G;  4IOA A;  3S1Q H;  1K83 H;  3M7N A;  1PH6 A;  3G6E A;  3HOY H;  1HR0 L;  2JA9 A;  2HT1 A;  1MJC A;  3KJP A;  2OTL A;  1H95 A;  1IBL L;  4A3B H;  1HZ9 A;  1BBW A;  3B6Y A;  4QGU A;  3I56 A;  1Y1W H;  1XMO L;  1PH9 A;  2K14 A;  5C0X I;  3ULJ A;  3TRZ A;  1AE3 A;  1L1O B;  4A3J G;  2UUB L;  5C4J H;  2YTY A;  1VQA A;  3PV0 A;  2HHH Q;  2BH8 A;  3H15 A;  3HOV G;  4P71 A;  1X3G A;  2YV5 A;  1VQM A;  2JA6 H;  5HGQ A;  1VQG A;  4OO1 G;  3GTM H;  1B7Y B;  1B8A A;  1A63 A;  2ASB A;  4GS3 A;  3STB D;  3K80 C;  3K81 C;  1RIP A;  1UE5 A;  3PUV A;  2I5M X;  5EAY A;  1IL2 A;  4FDB A;  4GLA C;  4R4I A;  4GOP C;  4BY7 H;  1VQK A;  1VQC A;  4POG A;  1KC8 C;  4DK6 C;  4JCV E;  1HNX Q;  4AIM A;  2R7F A;  3KLW A;  4LF4 L;  2MO1 A;  4O0A A;  3GTQ H;  3CMA A;  1YEZ A;  4YCV A;  1GVP A;  4R1J A;  1C0A A;  3S15 H;  2WB1 G;  2R7Z H;  1KXL A;  2RCN A;  4DV0 Q;  1NE3 A;  3CCQ A;  3CC7 A;  4A3M G;  3VDY A;  5LMU Q;  3H0G G;  2NVT H;  2QEX A;  1N8R C;  1WFQ A;  2OWO A;  3RZD H;  4NXN Q;  2VY3 A;  5JJI A;  4BBS H;  2OTJ A;  2GN5 A;  1Q12 A;  2ZJR A;  2UXD Q;  4DR1 L;  3PO2 G;  4DR2 L;  1I94 L;  2HQL A;  2JK8 A;  4JI3 L;  3ER0 A;  1CSQ A;  2K5H A;  3FP9 A;  1E7Z A;  2CWP A;  3NEN A;  3J7Z C;  4A3M H;  2CCZ A;  3BZC A;  5GAH C;  3H0G H;  5IYC G;  2JEA I;  3RLN A;  1A8V A;  4JI8 Q;  1IXR A;  1EIF A;  2D0P A;  3JAM c;  1VQP A;  1IBL Q;  4A3D H;  1VQN A;  1KHI A;  3PO3 H;  1YIJ A;  4EQ5 A;  2JA7 H;  3EN2 A;  3PO2 H;  4A3E H;  3KF6 A;  2QA4 A;  3M9B A;  2R6G A;  3EBE A;  5M5W H;  3OW2 A;  4AQY L;  2VS1 A;  4IJL A;  2ZJQ A;  1UE6 A;  2YTV A;  2UUB Q;  5M3M H;  2NN6 G;  1YNX A;  3HOZ G;  1HJP A;  4DAM A;  1XPO A;  1PV4 A;  4JV5 L;  1IBM Q;  5M5X H;  5IYC H;  3KYH C;  4JI1 L;  4ME3 A;  1KD1 C;  2UUC L;  1X56 A;  4RG1 A;  1QZH A;  1YZ6 A;  1ASY A;  4P75 A;  1X55 A;  4UY8 C;  2JA8 G;  2UXC L;  4L5Q A;  4XIG S;  3GD7 A;  3CW2 C;  1V43 A;  5M3F G;  3RN5 A;  2KHJ A;  4LF7 L;  1WOC A;  3PUZ A;  3F2D A;  1XMQ Q;  2UU9 Q;  4IFD G;  1G6P A;  3HKS A;  3F1Z A;  3LGJ A;  3AYH B;  4A3I G;  2VL6 A;  2R7D A;  4HJ9 A;  4LFA L;  2F52 A;  2IHF A;  2ZM6 L;  1N34 L;  5JEA G;  1FL0 A;  1WYD A;  4GOP B;  4YHH L;  1T9H A;  1TWH H;  3F8T A;  4R4O A;  1S72 A;  3RZO H;  5IYD G;  2LXJ A;  1X3E A;  3CCS A;  4HID A;  1JT8 A;  2VQF Q;  3OTO L;  3H3V I;  4DR6 L;  3BJU A;  4HIK A;  5C4X H;  4YY3 L;  5IYB G;  2E5L Q;  1HNW Q;  3PGZ A;  4A3I H;  4DR7 Q;  1Q7Y C;  3GDE A;  4OON A;  4KLK A;  1QVF A;  2VNU D;  4JOI A;  1UE7 A;  3ZJY C;  4JC0 A;  5FLM G;  3HOX G;  1PH7 A;  5LMN W;  2JJQ A;  5AJ3 Q;  1MKH A;  1ASZ A;  3AFP A;  1TWA H;  4B3R L;  2Q2H A;  2ATW A;  3A5Z B;  4IJH A;  4DV1 L;  2E2H H;  1SE8 A;  3I55 A;  2Q2U A;  1LUZ A;  1NMG A;  4DR2 Q;  1I94 Q;  5JJL A;  1G29 1;  4JI3 Q;  3M4O H;  3J80 c;  1BVS A;  1XPR A;  1JJ2 A;  4QQB X;  3K7U C;  1XNR Q;  5IWA Q;  3HOX H;  3RR5 A;  2I5H A;  4LFB L;  1K8G A;  1N9W A;  2HIX A;  2RF4 A;  2JA5 H;  4DV4 Q;  1IBK L;  3PF4 A;  2R93 G;  4PG3 A;  3G48 A;  1YJ9 A;  4JI4 Q;  1QUQ A;  4JBJ A;  2Y0S E;  3U50 C;  4KHZ A;  2Z6K A;  3J81 c;  3HFZ B;  3KJO A;  2VQE Q;  1RL2 A;  1XPU A;  3DLL A;  2KCT A;  4BA1 I;  5IP9 H;  4OX9 L;  1VQ8 A;  4RMF A;  3WWV A;  4JV5 Q;  2PQA A;  1KRS A;  2JQO A;  2R93 H;  4JI2 Q;  1VQ6 A;  1XTD A;  3U58 A;  1JB7 A;  4DV7 L;  3K8A A;  1QVG A;  1UE1 A;  1LTL A;  2EXD A;  4R4T A;  4DV2 Q;  1VQ9 A;  2UXC Q;  2NVY H;  2IX1 A;  3GTP H;  3G4S A;  4LF7 Q;  2B29 A;  3HOU G;  2NZH A;  1JJC B;  2WFW A;  3RLF A;  4HJA A;  4GNX A;  4KHP L;  3TRE A;  3ULP A;  4A3L H;  4OWW B;  3PUY A;  3AEV A;  4HJ7 A;  4IOC A;  1J6Q A;  4LFA Q;  5ELN A;  1XNR L;  2ZM6 Q;  3ICE A;  2OQ0 A;  5H1S E;  3T1Y Q;  3HKZ G;  3M3Y H;  3GTO H;  3F2C A;  1JE5 A;  5IY0 A;  3S17 H;  1VQD A;  1PYB A;  1OTC A;  1GO3 E;  4A3J H;  3OTO Q;  4A3K G;  4C3H H;  4X66 L;  2JEB I;  4YY3 Q;  1PH5 A;  4DV6 L;  1OXS C;  1YHA A;  2F4V L;  1A0I A;  3HOV H;  4LF5 L;  5LMN L;  2YYZ A;  3CPW A;  1WJJ A;  4HJ5 A;  1SN8 A;  4JYA L;  2E8G A;  1FGU A;  4X62 L;  3I2Z A;  3PSI A;  4GNX C;  4WJ4 A;  4IPD A;  4OWX B;  3I4O A;  4NXM Q;  1FJG Q;  3S14 H;  1PFS A;  4X64 Q;  3KDF B;  1CKN B;  4LUO A;  1GKH A;  1TWC H;  4DR3 L;  3PIO A;  1OXT A;  4JI5 L;  3TQY A;  1Q86 C;  1AE2 A;  2GVB A;  1N36 L;  2CFM A;  4C3I H;  4LFB Q;  1XNQ Q;  4P74 A;  3CCU A;  5J3B A;  4YCU A;  5C0X G;  4JBK A;  2IT1 A;  3M4Q A;  5C44 G;  1IBK Q;  2N8N A;  1P8L A;  1N33 L;  4DUZ L;  5IT9 c;  3CCM A;  4LF8 Q;  4PZ8 A;  2C35 B;  1Q46 A;  4LFC L;  2UXB L;  3GTJ H;  4B3M L;  3I4N G;  2FXQ A;  1SLJ A;  4A3C G;  4OX9 Q;  1E24 A;  4H02 A;  3MEF A;  1HR0 Q;  1I50 H;  1E22 A;  1UEB A;  4P72 A;  2A1A A;  5C44 H;  1QZG A;  1IZ6 A;  1HNZ L;  4GKJ L;  3HKZ E;  1XMO Q;  4APV A;  1PHJ A;  1D8L A;  3W1G A;  1VQ4 A;  4JI7 L;  3S1N H;  4GN4 B;  4YWK A;  1Q82 C;  2N49 A;  1A62 A;  4JI0 L;  1FVI A;  4LF9 L;  2Z0S A;  1EQQ A;  1VQJ A;  1CKM A;  1SRU A;  2RHS B;  3I4N H;  4Y7N H;  4A93 G;  4A3C H;  2ALY B;  3U4V A;  1SR3 A;  1L1O A;  2Q2I A;  3GTL H;  5IE8 A;  4K0K L;  4LW1 A;  3KF8 B;  3CCR A;  2Y0S G;  4B3T L;  1I5F A;  1SMX A;  5GAG C;  1TWF H;  3TS2 A;  3AQQ A;  1E3P A;  2RHQ B;  3HOZ H;  2B3G A;  3A5U A;  4B3S L;  1N32 L;  4DV6 Q;  1EFW A;  3M4P A;  2F4V Q;  1K0R A;  1V9P A;  3MXN B;  4X65 L;  4JYA Q;  1V1Q A;  4X62 Q;  3CC2 A;  2JA8 H;  5M5Y H;  4LF4 Q;  4HIO A;  2E2J H;  3E0E A;  5M3F H;  1VQL A;  4JI6 L;  4DKA C;  2N3S A;  1PH8 A;  1I6H H;  4GNX B;  5HY6 A;  4EX5 A;  1B70 B;  2HIV A;  1W3S A;  2KHI A;  4DV5 L;  1HR0 W;  1S40 A;  1NMF A;  1VS0 A;  3OYY A;  1IYJ B;  4DR3 Q;  4JI5 Q;  5IP7 G;  4HJ8 A;  1VQF A;  1Y1V G;  5FJ8 G;  2KBN A;  1K8A C;  2VUM G;  1NY4 A;  1PH1 A;  1CSP A;  1DGS A;  3PUX A;  3STB C;  2OQK A;  2PMZ E;  2HHH L;  1XJV A;  4LNQ A;  3D31 A;  5IYD H;  1WCM G;  2UUA L;  2K4K A;  4A76 A;  2ZJP A;  3L2P A;  4DR1 Q;  5IYB H;  3I7F A;  4XTC S;  3I4M G;  4BBR G;  1BBU A;  1CUK A;  2IX0 A;  5E7N A;  1U0L A;  5IP7 H;  4J15 A;  5FLM H;  4GKK L;  4OWT B;  1EUJ A;  3T1H L;  1LM0 A;  1C7Y A;  1VQ7 A;  1KAW A;  1Q1E A;  2OCE A;  1AH9 A;  4YCW A;  4A3G G;  1L0W A;  1M90 C;  3L0O A;  1LYL A;  2BA0 A;  1PA6 A;  4JI7 Q;  1HNX L;  1EYG A;  4JOI C;  4AQY Q;  4X6A H;  4BBR H;  1D7Q A;  3EIV A;  1Z9F A;  1Q1B A;  2XGT A;  4PMW A;  1YI2 A;  4OO1 I;  4DV3 L;  2H5X A;  4JI1 Q;  4DNI A;  2NVX H;  2UUC Q;  1KL9 A;  1EOV A;  3JAM i;  4UP7 A;  4DR4 L;  4TQU S;  3KOJ A;  5LMU L;  3ULL A;  1X6O A;  4NXN L;  4DPG A;  3DM3 A;  2AKW B;  3RN2 A;  4A3B G;  2UXD L;  2K5V A;  1Y14 B;  2MNA A;  3BU2 A;  2EQS A;  4AH6 A;  3CCJ A;  1N34 Q;  2ZTC A;  4WJ3 M;  4UPA A;  4YHH Q;  4L5S A;  2CWA A;  4L5T A;  3UDI A;  3H3V H;  1VQB A;  2Z6K C;  3UE1 A;  1M1K C;  3G71 A;  2F3I A;  3KF6 B;  3HOU H;  3FKI G;  2DUD A;  4JI6 Q;  4L5R C;  4JI8 L;  4DR6 Q;  2IY5 B;  2BH2 A;  2BA1 A;  1TWG H;  4GOP A;  2JA6 G;  4DV5 Q;  3S1M H;  4IFD J;  2MFI A;  1KIX A;  2ID0 A;  1UWV A;  3CPF A;  1U5K A;  1YVC A;  2WP8 J;  3NEM A;  1VQI A;  1CKO A;  4B3R Q;  4GN3 B;  2AWO A;  1GD7 A;  2EIF A;  5JEA J;  1MJE A;  1GM5 A;  1IBM L;  3AFQ A;  3FKI H;  2A8V A;  4BY7 G;  4DV1 Q;  3CC4 A;  1BKB A;  1HZB A;  2WAQ G;  2UUA Q;  3Q8D A;  4YWL A;  2QGQ A;  3BZK A;  4PZ6 A;  1W2B A;  3E9I A;  2DGY A;  4Y52 H;  3CF5 A;  1NBW A;  2UU9 L;  1XMQ L;  4GKK Q;  1VQO A;  1EWI A;  3FHW A;  3T1H Q;  3GTG H;  3J7A 5;  2R7Z G;  1P16 A;  1HH2 P;  1MIU A;  1S3O A;  1VQH A;  3IRB A;  3NEL A;  1PVO A;  2NN6 I;  3GTK H;  3K0X A;  4C3J H;  2XTI A;  1SFO H;  1EIY B;  2D0O A;  4C2M H;  4BBS G;  3ERS X;  3J80 i;  1YJN A;  1JMC A;  2VQF L;  4DV3 Q;  3A74 A;  5BR8 L;  2E5L L;  1G51 A;  4JBM A;  3J81 j;  5C3E G;  1J5E L;  4DR7 L;  1HNW L;  1VQE A;  4HIM A;  4IFD I;  4DUY L;  5ELO A;  4DV7 Q;  4DR4 Q;  2K50 A;  3S1R H;  4UP8 A;  5AJ3 L;  1E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...