2LKVA

Staphylococcal nuclease phs variant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Mannosylglycerate stabilizes staphylococcal nuclease with restriction of slow beta-sheet motions.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lkvA00
5NUCA 3SK6A 2RKSA 2EYHA 1ENCA 4HMJA 5M9OA 3C1EA 4KY7A 2F0KA 5KYIA 2F0IA 4KTAA 1KAAA 2F0LA 3NHHA 1TQOA 1STGA 2OXPA 4RKLA 3NXWA 5IGCA 1SNOA 4K5WA 1STAA 4KD4A 4KJOA 5JOBA 4E6IA 1SYCA 2O4XA 3ERQA 4F8MA 3EVQA 4G57A 2KQ3A 1NUCA 2OF1A 5CV9A 4N9PA 2EYLA 3BDLA 5EKLA 4EQPA 3QOLA 5CV4A 5IODA 1EYCA 3OWFA 4I65A 2WACA 2QDBA 3P1HA 4WORA 1EZ8A 5EGTA 4PMBA 5F2DA 3E5SA 4B9XA 2ENBA 5K5PA 5JAVA 3MZ5A 4R8NA 1F2MA 5IGDA 5I6WA 4H7BA 4ZUJA 1SYFA 4PMCA 4KJNA 5HURA 2F0NA 4B9WA 4ID6A 3VA5A 5C5MA 2EYJA 5J22A 4KY6A 4OL7A 1SYGA 2EY5A 5C3XA 5C4ZA 4HMIA 1JOKA 1JOQA 1JORA 1TT2A 2EY2A 5E1FA 5ISRA 3R3OA 2F0VA 5IGEA 2EY1A 5CV7A 5I9OA 1EY8A 5EKKA 1RKNA 3QB3A 4K5XA 4DF7A 4K5VA 2LKVA 2SOBA 3SK4A 2EYFA 3NP8A 4MIUA 1EY6A 1AEXA 2EY6A 1TR5A 2F0QA 2HQEA 2NUCA 4QF4A 3U9OA 4QMGA 3NUCA 3SK5A 3HEJA 4NP5A 2PZWA 4YIJA 1KDAA 1KDBA 4S3SA 2F0WA 3TP7A 3TP6A 3BDCA 3V2TA 5IGBA 3D4WA 1EYDA 1STHA 3T16A 3OMGA 4EQOA 5KYLA 2F0FA 1STNA 3EJIA 3MEHA 3SHLA 3EROA 1SNDA 4K8IA 1SNMA 5IGFA 4ODGA 4NKLA 3DHQA 1A2UA 1A3UA 3H6MA 2RDFA 3P75A 1SYEA 3LX0A 5KGUA 4IZ8A 5I6YA 1EQVA 2OEOA 3HZXA 3MXPA 4K14A 1EY0A 2F0TA 2F3VA 4K6DA 1NSNS 5C3WA 5CV6A 1SYBA 5IIFA 3OMCA 5CR3A 2EYPA 2PQEA 5C5LA 2F0MA 2PW7A 2SNSA 1JOOA 3SK8A 1U9RA 3T13A 5C4HA 5IOCA 1STYA 5I9PA 3D4DA 3TP5A 4N9TA 1IHZA 4EQNA 5C6AA 4DFAA 4LAAA 4EVOA 5CC4A 4IUNA 2F0EA 4K8JA 2EXZA 1A3TA 1KDCA 4ZQ3A 1SNCA 2PZTA 2M00A 5KIXA 5J1ZA 1EY4A 3DMUA 5DEHA 2PW5A 3RUZA 5HGTA 5KEEA 2EYOA 2F0UA 3D8GA 1STBA 3OSOA 2F0JA 3TP8A 4K2KA 3S9WA 5CV5A 4KHVA 2F0SA 3NK9A 2F0GA 1SNQA 2F0DA 3QOJA 3SXHA 1EY5A 2F0PA 4QB4A 2F3WA 4KY5A 5CGKA 5E3FA 1EY7A 1EY9A 2RBMA 1ENAA 3ITPA 4DU9A 4F7XA 2F0HA 1EYAA 3C1FA 5KRUA 4J1MA 5IGGA 2SNMA 3PMFA 4J6HA 5DAUA 1A2TA 1SNPA 4HTHA 4PNYA 4NMZA 1A3VA 1EZ6A 2F0OA 3SR1A 4IALA 2PZUA 4TRDA 4WRDA 4KD3A 2PYKA 4K2LA 3NQTA 1SYDA 2EYMA 4KV6A 4ZUIA 4ME5A 4DGZA 1F2YA 3MVVA 4RKBA 1II3A 3TMEA 2KHSA 3MHBA 5J39A 3D6CA 1F2ZA 1KABA 4NDXA 5CV8A
chains in the Genus database with same CATH superfamily
4DA2A 1ENCA 4LFCL 4DR7Q 2PPBC 1PMRA 2CCZA 2F0LA 2WKDA 1STGA 4LW1A 1SNOA 5I4DA 4C3HH 4E6IA 2O4XA 3GTLH 1PH2A 1TVXA 4C3JB 3BDLA 1PH6A 3TBIB 5F2DA 1EZ8A 4X6AH 1P8LA 5M3FB 1JE4A 2MUYA 1RTNA 3MZ5A 3W3AA 4H7BA 1M4VA 1TKWB 4ID6A 2XRQD 2RCNA 5KNBA 1KRSA 1RHPA 4KY6A 2QA4A 3RN2A 4DR4L 2PI2A 4IJLA 2KHJA 1C7YA 1W6KA 4X3KA 3PV0A 2K03A 1QZGA 1YHBA 1U5KA 4HJAA 4UY8C 1XWEA 5IYBH 4ULLA 2XNAC 4KHZA 3KLSA 2KJXA 1J5EL 2EY6A 4IUVA 2Q2UA 2JA7B 3TP6A 1TS3A 3G48A 3V2TA 1ONLA 4A93B 1HNZQ 4H13C 3HOZB 2E2JB 3X3NA 4LF7L 3HOWG 1LO5D 4DV2L 4LFBL 2K5VA 5I6YA 3WOEA 3HOXH 2Z8LA 1XMOQ 1SE4A 3HOUG 3J80c 1KLUD 1CFMA 1VQDA 2JA5B 5CBAE 1MHWC 1UEAB 3GTPB 1N34Q 1MSHA 1VQBA 5EJWA 4LF8Q 5T1GA 2Q8IB 1IBKL 5J1ZA 1V1PB 1OXUA 4LUVA 5GADC 1B8AA 3OTOL 3NK9A 3A74A 4JBJA 2E2JH 5CGKA 4OWXB 1K8AC 5ELEA 5JPNC 3I91A 3C1FA 1ML0D 4NXNQ 1A2TA 3BZKA 2JA6G 4BBSH 2BE5D 2KCTA 4O2DA 3KJOA 4FYDA 4XXEA 3PUZA 3HOVB 1K3RA 5IYDG 1N33Q 5ELNA 5L37A 2VY3A 4B3MQ 1I3QH 4AYBE 1SMXA 2RKSA 2EE1A 2MO1A 3IKJA 3RLFA 5KYIA 1D1KA 4DPGA 4X3UA 3LNNA 4M8AA 4NW2A 3J7YW 2QW7A 3ERQA 1OO9B 2Y0SB 2XTIA 1CHQD 1XPUA 1D5ZC 4DV7Q 5JEAJ 1LUZA 1IBLL 4WJ3M 5A2QE 3VDYA 2IJ0A 3HGBA 1SMYD 3RZOB 3TDQA 1I94Q 4FO2A 2PNRC 2LY7A 4JI5L 2GA4B 2N8NA 1X3GA 4DV3L 4HIKA 2RHSB 5C0XI 2DNCA 4KN4C 4Y7NB 4QCLA 1VMCA 3G6EA 1XNRL 4A3KH 3CD6A 1HPCA 1JWMD 4MIUA 5JJKA 3D4RA 2HQEA 4ZYSA 1B70B 2Q2HA 2VQEQ 1F2LA 4NXML 4OX9L 1DOLA 3BDCA 1LV9A 1SAPA 1STHA 1B53A 1STNA 1K8OA 1X3PA 1IBML 3NBHB 1LACA 4HIOA 4YHHQ 3RZOH 1LT6D 2HIXA 4OIJA 1EQVA 4Q0FA 4IUPA 1EY0A 1HR0L 1ET6A 3AQQA 5CYUA 2SDFA 2PQEA 4OO1H 1C0AA 4GKJQ 4YCUA 4AH6A 1XPOA 1LTLA 1QB5D 1RD9D 1B9MA 1NR4A 1U4MA 2WV6D 3G7LA 4JBKA 3NEMA 1EFWA 2EYOA 2L5TA 3HS0C 3K0XA 2HD3A 4DNRB 1H9JA 4FXGC 4F7XA 3CCMA 4DV5Q 1JR0D 2MFIA 1BCPD 1VMPA 3FKIH 2UU9L 1PRTB 4TSSA 1FJGQ 1FGBD 2DY8A 4IALA 3E0EA 3URYA 2JA8B 3NQTA 1O7IA 4HJ5A 3BZCA 1XPRA 4A75A 4HEDA 4P73A 4JI2Q 1HUMA 2LMCB 4B3RQ 5C0XG 3BYYB 4A3EH 1XXGA 4IPGA 4KKUA 1KAAA 4BBRB 5JEAG 1HQMC 1LTBD 1VQKA 1FD7D 5G3LD 1HNZL 1GHKA 4G57A 3ULPA 2WB1E 4HJ9A 3NPPA 3DEOA 4ALPA 1YJWA 4A3GH 5EGTA 1A8VA 2B39A 1IXRA 4FF1A 5JAVA 3A54A 2CWPA 2V4DA 5I6WA 1MSGA 4H0LC 2F0NA 3KLWA 1H9RA 3K7AH 2X69A 2HHHQ 1Z47A 4DAVA 1N34L 1O78A 2UUAQ 1VQGA 1HNXL 2Q2TA 2EY1A 4DV1Q 4LF8L 3W2DA 3J7A5 4HCEA 4DF7A 4BBRH 4JYAQ 3JC66 2FHTA 1K73C 2G5DA 5FLXE 5FLMG 1SROA 1EU3A 4CDFC 2J0TD 4OELB 4P71A 2PZWA 1EIHA 5COYA 1W6JA 4NXNL 2WAQB 4RGNA 3KUPA 4BY1H 2AMCB 3DHQA 4ILWA 3J81L 2I07B 4RG1A 1N33L 2L55A 5IT9L 4C3HG 1PH3A 5ELCA 5LMUQ 5C4HA 1FYCA 3KLSX 1FGUA 5E4XA 3SDZA 3HP3A 5CC4A 4QIWE 4EVOA 3BVGA 3A56A 1KDCA 2OQKA 3HOYB 3KF8B 3A8IE 2AWNA 3UDXA 1STBA 2N3SA 2ZXPA 3Q22A 2A1AA 4KHVA 2CHBD 3PSIA 4KI0A 2D0OA 1Q8IA 5IYBG 1D7QA 5E4WC 3CC2A 1LM0A 1H9MA 1EY9A 3S14B 2F3IA 1AH9A 1A0IA 1I94L 1L1OC 4FVMA 1VQNA 4TRDA 4BXXH 5EKIA 4QL5A 3KDFB 1VQPA 1BKBA 2CW0D 3DWPA 1HJPA 2A69D 5J39A 3IFTA 2VUMB 1KLGD 5CV8A 1L1OA 2YTVA 3HOYH 2OCEA 2EYHA 3HOWB 3HOXG 4P74A 1KRTA 1I6HB 2F0IA 4GZYC 2WINB 1YNNC 3HOUB 3FPUB 2J7ZA 3WWVA 4HSPA 3GTQH 2E2DC 3R2TA 3S14H 5CV4A 2E2HB 2JN4A 1EL0A 1EIGA 5DNFA 1I4PA 5AJ3L 1SE8A 1C8CA 1F2MA 2EXDA 4BA2I 5M5YB 2K7VA 3K5LA 1CSPA 1ZEQX 4GKJL 5C3XA 1VQMA 3I3CA 4HMIA 3A7AB 3CRKC 5D3DA 1JORA 3NE5B 5E1FA 5JJIA 1NR2A 1J9OA 1E7ZA 2Q2IA 5I9OA 3GV3A 4HAEA 1RKNA 2NB0A 2LKVA 1NMFA 4BBSG 4RCNA 2JA5G 1K0SA 1WVLA 1M1KC 1FR3A 3T1YQ 4OO1I 3TREA 4NP5A 3P7JA 5A35A 1PTOD 5C4XH 2HIVA 3IL8A 3HKZE 3K58A 3U4VA 1TWHB 3EJIA 4CJ0B 1X65A 2VB2X 1YNJC 4JI8Q 5LMNW 4C2MB 2UXBQ 2L1BA 2ZTDA 1QZHA 1HZ9A 3P75A 4RFBA 1VDZA 1VS0A 1CKMA 2F3VA 2O2LD 2N49A 4YWMA 4JI2L 2B63H 4B3SQ 2K5DA 2A8VA 3TP5A 3OPOA 4Q5VA 2BDOA 1Q3LA 4NB3A 1LTRD 2EPBA 2FXQA 3CCUA 3S15B 4RMFA 1PRTC 3NWTA 4JBMA 1EEFD 4A3KG 5E3FA 1EY7A 4GLAC 1ENAA 2E8GA 1WTHA 5IGGA 3FMCA 1VQCA 4FNFA 5JJLA 2NZ1D 4DR4Q 3MTSA 3EIVA 4CKBA 4A3MB 1ILQA 1S40A 4NMZA 1XX8A 1SRUA 2KECA 4DV1L 3NWSA 1F2YA 1NNXA 3DEPA 3MA2B 1DONA 4GN3B 1WOCA 3Q6SA 1WI5A 1PH4A 1EWIA 5JPMC 2ZJRA 2IW3A 2ZM6L 1A63A 2EOTA 1VCIA 1A62A 4X66Q 4OO1G 2QILA 2OF1A 1SSOA 3QR8A 4LJZC 4UHVA 4BS9A 4LF7Q 4A3MH 3CCQA 4DV2Q 2R93H 1TS4A 3H09A 4R4QA 1HFNA 1VQEA 4DAPA 5FO8B 2A5HA 5IGDA 1LTAD 3S16H 4KLKA 5LMUL 3CCVA 3J80E 5C5MA 2EYJA 5IP9H 1TT2A 3JAMi 2D9UA 3FVQA 2MJ8A 4LUZA 3D3RA 3EFXD 5LL6X 3QB3A 1GUSA 1GM5A 4CGYB 2V1CC 2NVQH 1B2TA 4QY7A 2EIFA 5A2QL 4IUTA 3M4PA 1BUVT 3A0JA 4OWWB 2YTYA 1Z6HA 5IWAL 1WTQA 3ERSX 2NN6H 1VQ6A 4A3EG 4BA1I 3SE0A 5KGUA 1C4QA 3VYRA 2DUDA 4DUZQ 2PO4A 3CCRA 5I2XA 2F0MA 2IPKD 4DNIA 4F88A 1PH8A 4A3GG 4U68A 1NAPA 1JB3A 1EQTA 4DN4M 4ZKBB 1LTGD 2A6EC 4OIKA 2ZTCA 4ZAIA 3R93A 2K52A 3VR3A 3KF8A 2Y0SE 5HGTA 3A7LA 4DUYL 1SNQA 2K4KA 1EY5A 1GO3E 3CPWA 2YU9B 2F3WA 4WJ4A 4BBRG 2B3GA 5KRUA 3S1QH 4GN4B 2SNMA 1IL2A 3B6YA 4V0BA 1CK1A 1SE2A 1G91A 2VB3X 4JI5Q 1SYDA 3KDFA 3R8BA 5JVH3 3BZDB 1G51A 1AE2A 2ZTEA 4BY1G 2B8FA 4XQNA 4CDEC 3T1YL 4MHEA 4G7HC 1TQOA 4NXMQ 4Y52H 4C3HB 1CUKA 4OX9Q 1Q86C 2YU9H 3GTLB 4APVA 4ZCKA 1FNWA 1PRTF 5HGQA 1OXVA 2UXBL 5FK9C 2D5DA 3KYHC 2VNUD 2ZT9C 2MHVA 4DK0A 1JT8A 4X64Q 3J81i 4ZUJA 3BVMA 4OONA 2KCMA 1I6VC 1OXTA 2WAQG 3DWAA 4B3SL 1JOQA 1KD1C 3OIQA 3KF6A 5FJ8H 4A3CH 2ZJPA 1EY8A 2LSSA 2HCIA 2EJMA 3L3OC 1TR5A 1HA6A 3TSSA 2Z4IA 1Y8NB 2F4VL 3CP0A 3K5NA 4POGA 3SGIA 5KYLA 3HOYG 5ELBA 2D0PA 3W1GA 3HKSA 2UU9Q 1V1OA 3HOXB 2CQOA 4RAUC 4HN7A 3ULJA 3H3VH 2R7ZH 3HZXA 1BBXC 4K14A 4JK1C 1Y8PB 3PO3H 1KL9A 1G6ZA 1BQQT 1T5EA 1UWVA 1TWGH 4N9TA 1IHZA 3MAQA 4DFAA 2R6GA 4CKEA 1ICWA 4X66L 1GHJA 4BWGB 1Y14B 4N8FA 2NYZD 2VUMG 1STEA 5CV5A 3D31A 3MC0B 1W2BA 1IW7D 2DN8A 1ILPA 2LFNA 4G7OC 4BBSB 3PMFA 1BBUA 1XMQL 3RLOA 1EZ6A 3IFDA 2PYKA 1HNXQ 5C4XG 4MTNA 4ZUIA 2B29A 4YCWA 5IE8A 3E0JA 2QEJC 1TXYA 3PUVA 2L11A 1GUTA 1I3QB 3UDFA 4LF4Q 5H1SE 1EOVA 1PZID 3CW2C 3P20A 1CTMA 2OWOA 2BOSA 2BA0A 1B3QA 3NHHA 2B63G 3LWUA 2O5JC 2OQ0A 1R9TH 1X6OA 2I46A 1SBBB 4XIGS 2A68C 4RHSA 4B3TL 1HHVA 4JOIC 2LXJA 4O0AA 3GQBA 2DJGC 4RCOA 1KNEA 4DUZL 1YBYA 4O1NA 4R8NA 3BG3A 2D62A 4JC0A 4AIMA 3VR6A 1OTCA 3O13A 5C4ZA 4JOIA 5ELOA 1AFPA 1L1OB 3I2ZA 3R3OA 5M5WH 3CU7A 2NN6I 5IGEA 2MPMA 3VYTA 2E5LQ 4A3KB 1HZBA 2NVXB 2Z9HA 4K5VA 3NTKA 4A3BH 5LHY1 1YIJA 1PVOA 3J81c 5C0XJ 4XYQA 3D0FA 1Q90A 5IT9c 3PCOB 5IYCH 3TZDA 1ASYA 4UPAA 2I0QA 1MGSA 3QO2A 5LMNQ 2JA9A 2OEOA 1I5FA 2VXWA 1TY0A 1JWSD 2NVXH 1BO0A 2A19A 2WFWA 3T13A 1STYA 5I9PA 1BCPB 4A3MG 2R93G 1QCBD 1SDFA 2HCCA 1HQRD 1VF5C 2AQ1B 1DXMA 3I7FA 3STBD 5IP9G 1WTOA 2NTSA 3DMUA 3N6RA 1P16A 1E1TA 4L5TA 3OSOA 5C3EH 1JJ2A 3J81j 1Z7TA 2XN9C 1QVCA 1EFID 5M5XH 2SEBD 2F0PA 5CBEE 4UDUC 3F1ZA 3M4YA 5AJ3Q 4X64L 3FKIB 3JAML 4R8IA 1TS5A 1WD1A 1S4ZA 4PNYA 1A3VA 2O5IC 2I5MX 3E9HA 4K6LA 2R92B 3C3LA 2NN6G 4GOPC 1Y8OB 1W3SA 3RMHA 1WTPA 4C56C 4A3EB 4I7ZC 1L2FA 2JE6I 2K5WA 3C1EA 2F0KA 4KY7A 2BCOA 1I4HA 1L0WA 2NTTA 1PDQA 4GOPA 4K5WA 4DV4L 2KQ3A 4A3GB 3ULLA 2KVMA 2AHOB 2K01A 4H02A 2PI2E 3H3VC 3QOLA 1X3EA 3U50C 3N52A 1WTVA 3S2HH 3K7AB 4UP7A 1WCMB 2R92H 1MKHA 3BJUA 1LABA 5C44H 2QDLA 1HNWL 3DUZA 5CV7A 2NWGA 4LUOA 4DR3Q 3H3VI 2DNEA 1YJ9A 1FL0A 2F0QA 3U9OA 2N55A 1WTRA 1S5DD 3J7ZC 4N8X1 3K5OA 1KDAA 2ALYB 2ZXOA 1KAWA 2F0WA 3TP7A 3C46A 4L6TB 4BY1B 3ICEA 3MEHA 1N9WA 4IOAA 3CXCA 3TS2A 4I7AA 1WCMH 3OWEB 2BE5C 3KK7A 3PGZA 1M90C 1Y1WH 3PIPA 2EJGC 2Q8RE 2E75C 1BVSA 4LF4L 2VZAA 4PZ7A 3S1RH 1N36L 2JEBI 2B2TA 2JQOA 5M3MH 2FMMA 4GNXC 4ME3A 2ZM6Q 2CKZB 1AW7A 1X56A 1H95A 2EXZA 4GLXA 3GTKH 2RA4A 2WP8J 3G71A 1E22A 2ZJQA 5DEHA 1AE3A 2RQXA 1YZ6A 2F0SA 5GROA 3SXHA 4GNXA 5FJ8G 4A3CG 3TEHB 3L2PA 5TSSA 1O80A 1H9SA 2MNAA 3BS1A 1IKMA 2K75A 2R7DA 4HTHA 1O7ZA 1SMYC 4C1NI 1SFOH 4KD3A 2EZVA 3CCJA 2E5LL 2Z6BA 2KHSA 1VQIA 5FKAC 4DK3C 3FP9A 1ZKOA 3MFGA 4R9WA 1TWAH 2R7ZG 3PUWA 1GVPA 4F87A 1BXTA 1ET9A 4P72A 4LF5Q 1YJNA 1A15A 2UUBQ 1TWFB 2N88A 3U4ZA 3PO3G 3GTQB 3MWYW 3FPPA 1D1IA 5IWAQ 4AYBB 3OWFA 1G6PA 4GKKQ 2QDBA 4B9XA 3GTJH 3DM3A 1AN8A 5LMNL 2M2LA 4AQYL 4RHRA 5EPJA 3UDIA 4U673 1TIID 2QCPX 4NPSA 4A3JH 1SYGA 1RCVD 1FVIA 1VQHA 2NVYH 1MI2A 1IYVA 3TZUA 1EUJA 1HA5A 3I70A 1ZYRD 1TWCH 5CMDA 3VYSA 1PFSA 3NP8A 4KMUC 3S1NH 1TWFH 4DUYQ 1CKOA 1E24A 5FOBB 4R1JA 5C4XB 1JJGA 1IKLA 4A3DH 3NTHA 3PO2H 2IY5B 1CA6A 3OMGA 3GD7A 3S1MH 1F9PA 5DM73 3CQZH 1BCPC 1PTOH 1T5XD 2KBNA 2PMZB 3LX0A 4YWLA 4IZ8A 2UUCL 1NBWA 4HSVA 2WIIB 3KF6B 2B63B 4RH6A 4B08A 3OOCA 2EYPA 2RDHA 4IFDH 2JSOA 1NY4A 2TMPA 1G2TA 3OIPA 1Q7YC 1Z9FA 3RLNA 2GN5A 1LTID 4IUNA 1BOSA 2K5HA 3UE0A 3RUZA 4BY7H 2PQAA 4EX5A 2CH4A 3D8GA 4DR2L 4G4KA 1RTOA 4A3IH 1UE5A 3K8AA 4A3BG 1EYAA 1HTPA 2JJQA 1NMGA 1I4GA 3SR1A 3NTIA 5EPLA 1QUQB 4MTKA 3J7AV 4ME5A 5IYCG 3MVVA 2QF7A 4JPBW 4RKBA 2R61A 3AFQA 4A4IA 4CHTB 4DR3L 4K0KL 3HRZC 1IYUA 2M00A 2UXCL 4NDXA 3T51B 3FEWX 4M1UB 1L0YB 1PFNA 2JXMB 3KBXA 1YNXA 1PXUA 2NZOA 3G6JB 2F4VQ 1U4RA 1BF4A 2OXPA 4RGTA 4QGUA 3M3YH 3PIOA 4F8MA 1NUCA 3KLRA 5CV9A 2YTXA 2F03A 1N8RC 2R93B 3QIAA 3E5SA 1LYLA 3S16B 4LFAQ 5BN5A 4FXDA 1QOHA 5C3EG 3K0YA 4ZKCB 1IYJB 1Q82C 4HCSA 3QG1A 2EY5A 3WOFA 1O7YA 3S17H 1IL8A 2A6HD 3CMAA 4YWKA 3QWNA 3R2IA 2B2WC 3FHWA 3LWEA 3F2DA 3H0GB 2SOBA 2H1EA 2NVQB 1B9NA 4X65L 4ABNA 3E9IA 1GUGA 3NQIA 3EQLC 4DV0L 3M7NA 2B2WA 1PH5A 2AQ3B 1HRJA 4WJWA 2H5XA 1VQ4A 1TY2A 4LK1C 3T16A 4KKSA 3MEFA 2KA7A 3SHLA 1SE3A 3UI2A 1SNDA 2VQFL 3A5ZB 4A3LH 3I56A 1XMQQ 3T53B 2RF4A 2P5ZX 1K8MA 4K6DA 2K28A 1JICA 1NJIC 3M7GA 2IHEA 3FKIG 4R4TA 2CW0C 2ZXRA 3H0GH 2A69C 1XTCD 5LL6S 3RN5A 2FJ2A 2ASBA 4LAAA 2RSNA 2XSCA 4LF5L 2FMCA 2UUBL 2X6LA 1N32L 3UE1A 2JEAI 1QWYA 2R92G 2F0UA 1I4RA 5C44G 4K2KA 1EIFA 3U58A 4B3TQ 4GKKL 2XRSD 1EIYB 1F9QA 4KY5A 1QVGA 3S1QB 3ONAB 2VW9A 4J6HA 1B44D 4J8QA 1BCPF 1VQAA 5BN4A 1CI3M 4EQ5A 4RWSC 3J7AF 5EPKA 2B8GA 3I4OA 4K2LA 4FXKC 2RCFA 2F52A 4KV6A 1CZGA 2G9DA 2KEDA 4DAYA 3EA6A 1TS2A 1RIPA 2PNHA 2CWAA 1WCMG 4HMJA 2N78A 2M9VA 1M8AA 1I50H 1Y1WG 3CAMA 1V43A 3DM1A 4KHPQ 3PIP3 5IT9E 3K5MA 5G3LF 1SYCA 1PTOC 5M3MG 5EKLA 1SR3A 3J80i 4I65A 4IO9A 5K5PA 4FDBA 3RZDH 5CORA 4C1NK 5DLQE 5HURA 4IFDJ 1R4QB 1S72A 1D8LA 1DD2A 3F8TA 2MGSA 1HZAA 2EQSA 3RNUA 1G2SA 3AFPA 1YI2A 4LWCA 3C2PA 1AP0A 4GOPB 2EYFA 1EU4A 5GQOA 1ASZA 3CKIB 2BA1A 3NUCA 4A3FH 1CZWA 4QUCA 3TRZA 4IFDI 1VQOA 1EEID 4S3SA 4XYOA 2EDGA 4X62L 4EQOA 1RL2A 3NELA 1JB7A 1SNMA 1KTKA 4QQBX 2R7ZB 4HR7B 1LT5D 4L5QA 1SYEA 2Z0SA 1GOZA 2PCFB 1VQFA 1UNSA 2XVSA 2KHIA 1E1OA 1Q1BA 2NVTH 3HKZB 5IIFA 3PO3B 1AZQA 3OMCA 5CR3A 3KBGA 3T1HL 1JOOA 3SK8A 1U9RA 2VS1A 1TWGB 3D4DA 5DM63 4BXXG 1MD2D 4OGQC 1DOKA 4A76A 1PA6A 4K8JA 4TVAB 4JI1L 3BYTB 3JAMc 3M4OB 1IZ6A 4A3JG 2BH2A 4PZ6A 4XQJA 4DV4Q 2F0JA 1JMCA 2K6AA 1PFMA 4X3SA 1K83B 3HG9A 3PF5A 3KJPA 4LFAL 3I8ZA 4L8JA 5C4JB 2I5HA 4DKAC 4O42A 4LNQA 5FLXL 4LF9Q 1V8QA 4L5SA 3I4NH 4IPCA 3QJYA 5EBCA 2F0OA 1CKNA 4AYBG 4CDCC 3GTGH 4A3DG 1QUQA 5T1IA 3F2BA 3PO2G 4DGZA 1HNWQ 1KXLA 3GTOB 2CVRA 4FF2A 1F2ZA 4EGVA 1F9SA 3M4OH 5AFWA 5M9OA 4DR6L 1WYDA 4HIDA 4GNXB 1D6EC 4KTAA 4H44C 4POFA 3OW7A 3MXGA 4JG2A 4RKLA 1UEBA 1H9SB 3NXWA 3RD4A 1K83H 4KD4A 1R9TB 3CCLA 2K14A 2IX1A 5JOBA 4LF6Q 4IFDG 1DCZA 3EVQA 5C4JH 1SEBD 4WORA 4C3JH 1PH1A 4CJ2C 3CC7A 1V1QA 2ENBA 2R7FA 1RJTA 2E2IB 5M3FH 1GKHA 4BY7G 3CF5A 4HJ8A 2IT1A 3VA5A 4A3IG 1N36Q 1E2WA 3GTOH 1RDPD 5M5WB 5K36H 3E6ZX 3CCSA 4P2CB 3GDEA 2IHFA 1DJRD 2JK8A 3VR5A 4A3BB 1UAPA 2OTLA 1CQFA 1JJCB 2WAQE 3DXJC 1E2VA 1AEXA 4IQZA 4JI4L 3I55A 3AB9A 3VYUA 3SK5A 1EQRA 3CHBD 1KDBA 1B4OA 2XWBB 5ELFA 2JA7H 1EYDA 1PTOF 3W1BA 2E2IH 2KCNA 4A93H 5IGFA 3FRPB 4CDDC 4NKLA 4PG3A 5GAEC 3HOZH 1Q8KA 5I2YA 4RGMA 1YEZA 1SYBA 2IX0A 1R4PB 5C5LA 3PIO3 4DR5Q 1S3OA 5IOCA 3PUYA 1GUWA 5EAYA 2JA5H 1BDOA 1CHPD 2DY7A 4C3IB 1XNQL 3K7UC 3GTPH 2L12A 1FNVA 4KHPL 2QKIC 5C3EB 5KEEA 3TP8A 1S5BD 5M5XB 1Y69U 1BR9A 1T9HA 3T4AC 2F0DA 1Y1VB 2YV5A 4CBVA 4JV5Q 1CM9A 2MO0A 2RBMA 4JI6L 4DV6Q 4AQYQ 2F0HA 1LTTD 2ID0A 1UE6A 2EJFC 1C9OA 1ZXTA 2PZUA 2K50A 5JVG3 1E2ZA 3MXNB 1II3A 3HOVH 4ZK9B 4C3IH 4A3LG 1G291 5NUCA 2PQAB 1XTDA 2WB1G 3D6WA 4DXFA 2ATWA 1GUOA 1X54A 2BH8A 5E7NA 1Q12A 3HFZB 5IY0A 4JI3Q 3TQYA 1UE1A 1Y1VH 5IGCA 1HFGA 3AMUA 2A74C 3H0GG 4TQUS 4YY3Q 1G8ZD 2XIWA 4N9PA 1B1ZA 5IODA 3CCEA 2PMZE 1EYCA 4YCVA 1U4LA 1QG7A 3CPFA 3S2HB 1YVCA 2OT2A 2UUCQ 4V190 1K28A 1SYFA 4B9WA 5J22A 5D14A 4OL7A 5C44B 1JOKA 1QE6A 2AUKA 3NBIA 2EY2A 2E76C 1PZKD 1NE3A 4IURA 1LTSD 3X3MA 1E0BA 4Y7NH 3SK4A 2A73B 2R3ZA 4DR2Q 2VL6A 1ENFA 4DR7L 1YNND 1HUNA 3ND9A 1PFBA 5IP7H 4YIJA 1IW7C 1SLJA 4KK7A 2MQHA 4LF9L 3H91A 3VR2A 1A2UA 4OXPA 3NSWA 3F2CA 1CSQA 4FF3A 3H6MA 2DGYA 1EWHA 4FF4A 2E74C 2B2VC 1Y1WB 3L0OA 2F0TA 1LT4D 4JI0Q 5CV6A 4IPHA 3S1RB 1JCKB 4K0KQ 2SNSA 1SN8A 5M3MB 2UXCQ 3TS0A 2B2VA 2K32A 3I4MB 3GTKB 3L9AX 1MJEA 1A3TA 3GP7A 1S5FD 2PZTA 4JBWA 4IUUA 5BR8Q 1K8GA 3J80L 4LF6L 4GN5A 2K5QA 4DNTB 3S9WA 2LXKA 2NBFA 3ER0A 3ZYYX 1X32A 1YHAA 4PMWA 1KQSA 2B2TC 3Q0AA 1X55A 1YNJD 2JP1A 2HQLA 2K1BA 4MZ9A 5JJZA 4XT3B 4R4IA 1SNPA 1MIUA 4A3FG 3ZJYC 1HR0W 1PYWD 1SFOB 4TKOB 1B50A 2G9HD 3GV6A 4WRDA 1NCVA 2L0CA 3V96A 1XMOL 1K3BC 2JA8H 1WJJA 1LLRD 4Z9CB 3TMEA 3UDGA 3I4MH 2KCCA 2B2YC 2RVLA 4QJFA 1KABA 1TWAB 1K9MC 4DXGA 2MP1A 4X65Q 4J15A 2B2UC 4DV0Q 2YYZA 1D5XC 2B2YA 3K81C 2HDLA 1STAA 1PRTD 2L9HA 3OYYA 2VQFQ 3GTJB 1X9NA 2EYLA 4EQPA 1O7LA 2B2UA 1PLFA 2H4OA 2WACA 4DK6C 3L7ZC 3P1HA 4KKTA 4PMBA 1VQ8A 1PYSB 2I5LX 3K6OA 5FO7B 4DAYB 4PMCA 3SVMA 3I4LA 4A3JB 4DR5L 4GLVB 4PV1C 4XT1B 2NVYB 3M9BA 3PF4A 1TWCB 3BU2A 3PQIA 5EQ0A 1DM0B 1K0RA 2K05A 1SJHD 1N32Q 4JI7Q 3S1NB 3HKZG 1BNZA 4B3ML 3I4NG 4UP8A 3BDOA 3STBC 1KNAA 1VQJA 4A3DB 3HEJA 4L5RC 1J6QA 3PO2B 3Q23A 4JV5L 3CMEA 4FP5D 1V1PA 1QJOA 4DV6L 3S1MB 4XTCS 1TU2B 2GVAA 3Q8DA 3CQZB 1H9KA 1PTOB 3EROA 4K8IA 2AUJD 3I73A 3S2DB 3EN2A 1A3UA 4DV7L 3TN2A 4IPDA 3KOJA 1ESFA 4X3TA 3VA7A 4C3JG 1QNUA 4GS3A 5C6AA 5M3FG 4PQXA 5KNDA 1ICFB 4JI3L 4ZQ3A 4BY7B 1SNCA 2XWJB 1Q1EA 2K5NA 2PW5A 4YY3L 3U9SA 5K36G 4A3IB 2IWHA 1E3PA 2JYOA 2L4NA 3QOJA 2F0GA 1KIXA 1CT1D 3A8JE 2VQEL 1U0LA 3AU7A 1CA5A 2HT1A 3S2DH 1X3QA 1VQ7A 3K80C 3GTMB 2EVBA 3ITPA 4MN3A 5KNCA 4YHHL 1V9PA 2UXDQ 2KENA 4UAIA 2EYMA 1PYBA 2JA7G 3MXNA 3M4QA 1AZPA 3DWQA 3H94A 4A93G 4L63B 3OW2A 4R4OA 3FDTA 3HOZG 2A6ED 2C9OA 2VUMH 2TSSA 3Q24A 4JVZA 4HIMA 3HOWH 1B3AA 1I6HH 3M3YB 4X62Q 2Q8TA 4ZRZA 4G7ZC 1PH9A 2JA6B 3GTMH 1VQ9A 3HOUH 4QUFA 2KEEA 2AQ2B 2Z1CA 3NENA 2RHQB 1JE5A 1HH2P 1CKNB 1JQYD 2CH4W 4DR1Q 2E2HH 1RF2D 1JWUD 2HUGA 3W5OA 4DV5L 4JI0L 3ND8A 1RODA 1GXDC 3T1HQ 3NBHA 1KHIA 2F1MA 3S17B 2AKWB 5M5YH 3K59A 4OWTB 4WFN3 1FJGL 5ISRA 2F0VA 4JI1Q 5EKKA 4K5XA 3CRLC 5BR8L 4B3RL 2CQAA 3JAME 2X6GA 1YITA 4LFCQ 2NUCA 5EBDA 4QMGA 2JA6H 4OHJA 3H15A 3HOVG 4C3IG 2IX3A 1PH7A 2FFKB 5IGBA 5IYDH 3D4WA 1WFQA 2DJFC 3I90A 1TWHH 4ODGA 3MXUA 3V05A 3SEBA 2WB1B 1XYIA 3WDNA 2RDFA 4C2MH 1Y1VG 5C3WA 1NSNS 2GVBA 2OTJA 2D2CC 2K33A 5BN3A 3A5UA 2PW7A 5D65A 2HHHL 2Y0SG 1OXSC 1DZ1A 4DR6Q 1HZCA 2RSOA 4P75A 2UUAL 1GJXA 1BBWA 4HJ7A 1SJED 3PUXA 5GAHC 1EOTA 4IOCA 4JYAL 5FLXc 3VR4A 1J5EQ 4UP9A 5FO9B 1YHQA 1EQQA 1F9RA 1GUNA 1VF7A 3S15H 3K57A 3I72A 1PV4A 4DU9A 4ZLTF 4IN3A 4J1MA 1KC8C 2LS01 2ES2A 5DAUA 3A55A 2BDNA 1HXYD 1WD0A 4LFBQ 5IP7G 2XGTA 1PHJA 4RGOS 3OHXC 2RDGA 3MFYA 5J3BA 4JI7L 1HTLD 5D3IB 1OXXK 5ELDA 1ZYRC 1DGSA 1I4QA 3SK6A 5GAGC 2HDMA 1I50B 1LT3D 4JI4Q 3F2UA 4QIWB 1IBKQ 1JC7A 3KFUA 2L15A 2J4XA 4KJOA 4XDXA 3OTOQ 3DLLA 4DAMA 3RZDB 3E3XA 1MJCA 4IUQA 4IJHA 2C35B 4OEMB 2CFMA 3RR5A 4KJNA 4CKCA 2KUMA 2FINB 1EYGA 4CJ1B 3J81E 1XNQQ 1S5CD 1DYQA 3M85A 4KN7C 1U4PA 1A6XA 3IRBA 1EY6A 4A3FB 1UUPA 1VQLA 4QF4A 3IAYA 2QGQA 1QNKA 2JA8G 3I4MG 4DK1A 4MNOA 2K04A 2AWOA 4RA8A 4JI6Q 1F77A 2A68D 2F0FA 1FNUA 5C0XH 4JCVE 3LGJA 2UXDL 4PZ8A 1QVFA 2NVTB 3MXPA 3BVZA 3GO5A 3AYHB 1IBLQ 3S24A 5JEAH 1I4XA 1J8IA 5HY6A 2ICIA 3CC4A 1B7YB 1EWCA 1D5MC 2C5CA 2IL8A 1ESRA 4XQQA 4EQNA 1L0XB 3G4SA 4DV3Q 2F0EA 4LMQD 1GD7A 1XNRQ 5KIXA 2KOLA 3T56B 1EY4A 1CQVA 1WTWA 1DOMA 4R4CA 2NZHA 1UE7A 4JW0A 2WKCA 1PZJD 4QB4A 4DR1L 1QILA 3A8KE 2F4IA 2Z6KC 1S5ED 1Q81C 1C48A 2Z4HA 3I4NB 3GTGB 4JI8L 1NTGA 1IBMQ 3EBEA 1X3FA 1SXTA 1MBYA 2QEXA 5FLMH 1XJVA 2Z6KA 2ICEC 1HR0Q 1D2BA 1Q46A 1VQ5A 2A6HC 1HCZA 3MHBA 3AEVA 3D6CA 1WTXA
chains in the Genus database with same CATH topology
4DA2A 1ENCA 2PPBC 1PMRA 2F0LA 2WKDA 1STGA 1SNOA 5I4DA 4E6IA 2O4XA 1TVXA 4C3JB 3BDLA 3TBIB 5F2DA 1EZ8A 5M3FB 1JE4A 2MUYA 1RTNA 3MZ5A 3W3AA 4H7BA 1M4VA 5KNBA 1TKWB 2XRQD 4ID6A 1RHPA 4KY6A 1W6KA 4X3KA 3PV0A 2K03A 1XWEA 4ULLA 2XNAC 4KHZA 3KLSA 2KJXA 2EY6A 4IUVA 2JA7B 3TP6A 1TS3A 3V2TA 1ONLA 4A93B 4H13C 3HOZB 2E2JB 3X3NA 1LO5D 5I6YA 3WOEA 2Z8LA 1SE4A 1KLUD 1CFMA 2JA5B 5CBAE 1UEAB 3GTPB 1MSHA 5EJWA 5T1GA 2Q8IB 5J1ZA 1V1PB 1OXUA 3NK9A 5CGKA 5ELEA 5JPNC 3I91A 3C1FA 1ML0D 1A2TA 2BE5D 4FYDA 4XXEA 3PUZA 3HOVB 2RKSA 2EE1A 3IKJA 3RLFA 5KYIA 1D1KA 4X3UA 3LNNA 4M8AA 4NW2A 3J7YW 3ERQA 1OO9B 2Y0SB 1CHQD 1D5ZC 5JEAJ 5A2QE 2IJ0A 3HGBA 1SMYD 3RZOB 3TDQA 4FO2A 2PNRC 2LY7A 2GA4B 5C0XI 2DNCA 4KN4C 4Y7NB 4QCLA 1VMCA 1HPCA 1JWMD 4MIUA 3D4RA 2HQEA 4ZYSA 1F2LA 1DOLA 3BDCA 1LV9A 1SAPA 1STHA 1B53A 1STNA 1K8OA 1X3PA 1LACA 1LT6D 4OIJA 1EQVA 4Q0FA 4IUPA 1EY0A 1ET6A 5CYUA 2SDFA 2PQEA 4OO1H 1QB5D 1RD9D 1B9MA 1NR4A 1U4MA 2WV6D 3G7LA 2EYOA 2L5TA 3HS0C 4DNRB 1H9JA 4FXGC 4F7XA 1JR0D 1BCPD 1VMPA 1PRTB 4TSSA 1FGBD 2DY8A 4IALA 3URYA 2JA8B 3NQTA 4HEDA 1HUMA 2LMCB 5C0XG 3BYYB 1XXGA 4KKUA 1KAAA 4BBRB 5JEAG 1HQMC 1LTBD 1FD7D 5G3LD 1GHKA 4G57A 3NPPA 3DEOA 5EGTA 2B39A 4FF1A 5JAVA 3A54A 2V4DA 5I6WA 1MSGA 4H0LC 2F0NA 1H9RA 2X69A 1Z47A 4DAVA 1O78A 2EY1A 3W2DA 4HCEA 4DF7A 2FHTA 5FLXE 1EU3A 2J0TD 2PZWA 1EIHA 5COYA 1W6JA 2WAQB 4RGNA 3KUPA 3DHQA 4ILWA 3J81L 2I07B 2L55A 5IT9L 4C3HG 5ELCA 5C4HA 1FYCA 3KLSX 5E4XA 3SDZA 3HP3A 5CC4A 4EVOA 3BVGA 3A56A 1KDCA 3HOYB 3A8IE 2AWNA 1STBA 2ZXPA 3Q22A 4KHVA 2CHBD 4KI0A 1Q8IA 5E4WC 1H9MA 1EY9A 3S14B 4FVMA 4TRDA 5EKIA 2CW0D 3DWPA 2A69D 5J39A 3IFTA 2VUMB 1KLGD 5CV8A 2EYHA 3HOWB 1I6HB 2F0IA 4GZYC 2WINB 1YNNC 3HOUB 3FPUB 2J7ZA 4HSPA 2E2DC 3R2TA 5CV4A 2E2HB 1EL0A 1EIGA 5DNFA 1I4PA 1C8CA 1F2MA 4BA2I 5M5YB 2K7VA 3K5LA 1ZEQX 5C3XA 3I3CA 4HMIA 3A7AB 3CRKC 5D3DA 1JORA 3NE5B 5E1FA 1NR2A 1J9OA 5I9OA 3GV3A 4HAEA 1RKNA 2NB0A 2LKVA 4RCNA 1WVLA 1FR3A 4OO1I 4NP5A 3P7JA 5A35A 1PTOD 3IL8A 3K58A 1TWHB 3EJIA 4CJ0B 2VB2X 1YNJC 4C2MB 2L1BA 3P75A 4RFBA 1VDZA 2F3VA 2O2LD 2K5DA 3TP5A 3OPOA 4Q5VA 2BDOA 1Q3LA 1LTRD 2EPBA 3S15B 1PRTC 3NWTA 1EEFD 5E3FA 1EY7A 1ENAA 5IGGA 3FMCA 4FNFA 2NZ1D 3MTSA 4CKBA 4A3MB 1ILQA 4NMZA 1XX8A 2KECA 3NWSA 1F2YA 3MA2B 3DEPA 1DONA 3Q6SA 5JPMC 2IW3A 2EOTA 1VCIA 4OO1G 2QILA 2OF1A 1SSOA 4LJZC 4BS9A 1TS4A 3H09A 1HFNA 4DAPA 5FO8B 2A5HA 5IGDA 1LTAD 3J80E 5C5MA 2EYJA 1TT2A 2D9UA 3FVQA 2MJ8A 3D3RA 3EFXD 5LL6X 3QB3A 1GUSA 4CGYB 1B2TA 5A2QL 4IUTA 1BUVT 1Z6HA 1WTQA 2NN6H 4BA1I 3SE0A 5KGUA 1C4QA 3VYRA 2PO4A 5I2XA 2F0MA 2IPKD 4F88A 4U68A 1NAPA 1JB3A 1EQTA 4DN4M 4ZKBB 1LTGD 2A6EC 4OIKA 4ZAIA 3R93A 3VR3A 3KF8A 5HGTA 3A7LA 1SNQA 1EY5A 2YU9B 2F3WA 5KRUA 2SNMA 4V0BA 1CK1A 1SE2A 1G91A 2VB3X 1SYDA 3R8BA 5JVH3 3BZDB 2B8FA 4XQNA 4MHEA 4G7HC 1TQOA 4C3HB 3GTLB 1FNWA 1PRTF 1OXVA 5FK9C 2D5DA 2VNUD 2ZT9C 2MHVA 4DK0A 4ZUJA 3BVMA 1I6VC 1OXTA 3DWAA 1JOQA 3OIQA 1EY8A 2HCIA 2EJMA 3L3OC 1TR5A 1HA6A 3TSSA 2Z4IA 1Y8NB 3K5NA 5KYLA 5ELBA 1V1OA 3HOXB 4RAUC 4HN7A 3HZXA 1BBXC 4K14A 4JK1C 1Y8PB 1G6ZA 1BQQT 1T5EA 4N9TA 3MAQA 1IHZA 4DFAA 2R6GA 4CKEA 1ICWA 1GHJA 4BWGB 2NYZD 1STEA 5CV5A 3D31A 3MC0B 1IW7D 2DN8A 1ILPA 2LFNA 4G7OC 4BBSB 3PMFA 1EZ6A 3IFDA 2PYKA 4ZUIA 3E0JA 2QEJC 3PUVA 2L11A 1GUTA 1I3QB 1PZID 3P20A 1CTMA 2BOSA 2BA0A 3NHHA 3LWUA 2O5JC 2I46A 1SBBB 4XIGS 2A68C 4RHSA 1HHVA 3GQBA 4RCOA 1KNEA 4O1NA 4R8NA 3BG3A 2D62A 3VR6A 3O13A 5C4ZA 1AFPA 3R3OA 3CU7A 2NN6I 5IGEA 2MPMA 3VYTA 4A3KB 2NVXB 4K5VA 3NTKA 5LHY1 5C0XJ 4XYQA 1Q90A 3TZDA 1MGSA 3QO2A 2OEOA 2VXWA 1TY0A 1JWSD 1BO0A 3T13A 1STYA 5I9PA 1BCPB 1QCBD 1SDFA 2HCCA 1HQRD 1VF5C 2AQ1B 1DXMA 1WTOA 2NTSA 3DMUA 3N6RA 3OSOA 1Z7TA 2XN9C 1EFID 2SEBD 2F0PA 5CBEE 4UDUC 3M4YA 3FKIB 3JAML 4R8IA 1TS5A 1WD1A 1S4ZA 4PNYA 1A3VA 2O5IC 4K6LA 2R92B 3C3LA 2NN6G 1Y8OB 3RMHA 1WTPA 4C56C 4A3EB 4I7ZC 2JE6I 2K5WA 3C1EA 2F0KA 4KY7A 2BCOA 1I4HA 2NTTA 1PDQA 4K5WA 2KQ3A 4A3GB 2KVMA 2K01A 3H3VC 3QOLA 3N52A 1WTVA 3K7AB 1WCMB 1LABA 3DUZA 5CV7A 2NWGA 2DNEA 2F0QA 3U9OA 2N55A 1WTRA 1S5DD 3K5OA 1KDAA 2ZXOA 2F0WA 3TP7A 3C46A 4L6TB 4BY1B 3MEHA 3OWEB 2BE5C 3KK7A 2EJGC 2Q8RE 2E75C 2JEBI 2B2TA 2FMMA 1AW7A 2EXZA 2RA4A 2WP8J 5DEHA 2RQXA 2F0SA 3SXHA 5TSSA 1O80A 1H9SA 3BS1A 1IKMA 4HTHA 1O7ZA 1SMYC 4C1NI 4KD3A 2EZVA 2KHSA 5FKAC 1ZKOA 3MFGA 4R9WA 3PUWA 4F87A 1BXTA 1ET9A 1A15A 1TWFB 2N88A 3GTQB 3MWYW 3FPPA 1D1IA 4AYBB 3OWFA 2QDBA 4B9XA 1AN8A 2M2LA 4RHRA 5EPJA 4U673 1TIID 2QCPX 1SYGA 1RCVD 1IYVA 1MI2A 3TZUA 1HA5A 3I70A 1ZYRD 5CMDA 3VYSA 3NP8A 4KMUC 5FOBB 5C4XB 1IKLA 3NTHA 1CA6A 3OMGA 3GD7A 1F9PA 5DM73 1BCPC 1PTOH 1T5XD 2PMZB 3LX0A 4IZ8A 4HSVA 2WIIB 2B63B 4RH6A 4B08A 3OOCA 2EYPA 2RDHA 4IFDH 2JSOA 2TMPA 1G2TA 3OIPA 4IUNA 1LTID 1BOSA 3RUZA 3D8GA 4G4KA 1RTOA 1EYAA 1HTPA 1I4GA 3SR1A 3NTIA 5EPLA 3J7AV 4ME5A 3MVVA 2QF7A 4RKBA 2R61A 4CHTB 3HRZC 1IYUA 2M00A 4NDXA 3T51B 3FEWX 4M1UB 1L0YB 1PFNA 2JXMB 3KBXA 1PXUA 3G6JB 1U4RA 1BF4A 2OXPA 4RGTA 4F8MA 1NUCA 3KLRA 5CV9A 2F03A 2R93B 3QIAA 3E5SA 3S16B 5BN5A 4FXDA 1QOHA 3K0YA 4ZKCB 4HCSA 3QG1A 2EY5A 3WOFA 1O7YA 1IL8A 2A6HD 3QWNA 3R2IA 2B2WC 3LWEA 3H0GB 2SOBA 2H1EA 2NVQB 1B9NA 4ABNA 1GUGA 3NQIA 3EQLC 3M7NA 2B2WA 2AQ3B 1HRJA 4WJWA 1TY2A 4LK1C 3T16A 4KKSA 2KA7A 3UI2A 3SHLA 1SE3A 1SNDA 3T53B 1K8MA 4K6DA 2K28A 1JICA 3M7GA 2CW0C 2ZXRA 2A69C 1XTCD 5LL6S 2FJ2A 4LAAA 2RSNA 2XSCA 2FMCA 2X6LA 2JEAI 1QWYA 2F0UA 1I4RA 4K2KA 2XRSD 1F9QA 4KY5A 3S1QB 3ONAB 4J6HA 1B44D 4J8QA 1BCPF 5BN4A 1CI3M 4RWSC 3J7AF 5EPKA 2B8GA 4K2LA 4FXKC 4KV6A 1CZGA 2G9DA 2KEDA 4DAYA 3EA6A 1TS2A 4HMJA 2M9VA 1M8AA 1V43A 3DM1A 3PIP3 5IT9E 3K5MA 5G3LF 1SYCA 1PTOC 5EKLA 4I65A 5K5PA 5CORA 4C1NK 4IFDJ 5HURA 1R4QB 1DD2A 2MGSA 1G2SA 3C2PA 1AP0A 2EYFA 1EU4A 3CKIB 2BA1A 3NUCA 1CZWA 4QUCA 4IFDI 1EEID 4S3SA 4XYOA 2EDGA 4EQOA 1SNMA 1KTKA 2R7ZB 4HR7B 1LT5D 1SYEA 1GOZA 2PCFB 1UNSA 2XVSA 1Q1BA 3HKZB 5IIFA 3PO3B 1AZQA 3OMCA 5CR3A 3KBGA 1JOOA 3SK8A 1U9RA 1TWGB 3D4DA 5DM63 1MD2D 4OGQC 1DOKA 4K8JA 3BYTB 3M4OB 4XQJA 2F0JA 2K6AA 1PFMA 4X3SA 1K83B 3HG9A 3I8ZA 4L8JA 5C4JB 4O42A 5FLXL 1V8QA 5EBCA 3QJYA 2F0OA 5T1IA 4DGZA 3GTOB 2CVRA 4FF2A 1F2ZA 4EGVA 1F9SA 5AFWA 5M9OA 1D6EC 4KTAA 4H44C 3OW7A 3MXGA 4RKLA 3RD4A 3NXWA 1H9SB 1R9TB 4IFDG 4KD4A 2IX1A 5JOBA 1DCZA 3EVQA 1SEBD 4WORA 4CJ2C 2ENBA 1RJTA 2E2IB 2IT1A 3VA5A 1E2WA 1RDPD 5M5WB 5K36H 3E6ZX 4P2CB 1DJRD 3VR5A 4A3BB 1UAPA 1CQFA 3DXJC 1E2VA 1AEXA 4IQZA 3AB9A 3VYUA 3SK5A 3CHBD 1KDBA 1B4OA 2XWBB 5ELFA 1EYDA 1PTOF 2KCNA 5IGFA 3FRPB 4NKLA 5I2YA 4RGMA 1SYBA 2IX0A 1R4PB 5C5LA 3PIO3 5IOCA 3PUYA 1GUWA 1BDOA 1CHPD 2DY7A 4C3IB 2L12A 1FNVA 2QKIC 5C3EB 5KEEA 3TP8A 1S5BD 5M5XB 1Y69U 1BR9A 3T4AC 2F0DA 1Y1VB 4CBVA 1CM9A 2RBMA 2F0HA 1LTTD 2ID0A 2EJFC 1ZXTA 2PZUA 5JVG3 1E2ZA 1II3A 4ZK9B 1G291 5NUCA 3D6WA 4DXFA 1GUOA 1Q12A 5IGCA 1HFGA 3AMUA 2A74C 4TQUS 1G8ZD 2XIWA 4N9PA 1B1ZA 5IODA 1EYCA 1U4LA 1QG7A 3S2HB 2OT2A 4V190 1SYFA 4B9WA 5J22A 5D14A 4OL7A 5C44B 1JOKA 1QE6A 2AUKA 3NBIA 2EY2A 2E76C 1PZKD 4IURA 1LTSD 3X3MA 1E0BA 3SK4A 2A73B 2R3ZA 1ENFA 1YNND 1HUNA 3ND9A 1PFBA 4YIJA 1IW7C 4KK7A 3H91A 3VR2A 1A2UA 3NSWA 4FF3A 3H6MA 1EWHA 4FF4A 2E74C 2B2VC 1Y1WB 2F0TA 1LT4D 5CV6A 3S1RB 1JCKB 2SNSA 5M3MB 2B2VA 2K32A 3I4MB 3GTKB 3L9AX 1A3TA 3GP7A 1S5FD 2PZTA 4JBWA 4IUUA 3J80L 4DNTB 2K5QA 3S9WA 2NBFA 3ZYYX 1X32A 4PMWA 2B2TC 3Q0AA 2JP1A 1YNJD 2K1BA 5JJZA 4XT3B 1SNPA 1PYWD 1SFOB 4TKOB 1B50A 2G9HD 3GV6A 4WRDA 1NCVA 2L0CA 3V96A 1LLRD 4Z9CB 3TMEA 2KCCA 2B2YC 2RVLA 1KABA 1TWAB 4DXGA 2MP1A 2B2UC 2YYZA 1D5XC 2B2YA 2HDLA 1STAA 1PRTD 2L9HA 3GTJB 2EYLA 4EQPA 1O7LA 2B2UA 1PLFA 2H4OA 2WACA 3L7ZC 3P1HA 4KKTA 4PMBA 3K6OA 5FO7B 4A3JB 4PMCA 3SVMA 3I4LA 4XT1B 4PV1C 2NVYB 1TWCB 5EQ0A 1DM0B 2K05A 1SJHD 3S1NB 1BNZA 3BDOA 1KNAA 4A3DB 3HEJA 3PO2B 3Q23A 4FP5D 1V1PA 1QJOA 3S1MB 4XTCS 1TU2B 3CQZB 1H9KA 1PTOB 3EROA 4K8IA 2AUJD 3I73A 3S2DB 1A3UA 3TN2A 1ESFA 4X3TA 3VA7A 4C3JG 1QNUA 5C6AA 4PQXA 5KNDA 4ZQ3A 4BY7B 1SNCA 2XWJB 1Q1EA 2PW5A 3U9SA 5K36G 4A3IB 2IWHA 2JYOA 2L4NA 3QOJA 2F0GA 1CT1D 3A8JE 3AU7A 1CA5A 1X3QA 3GTMB 2EVBA 3ITPA 4MN3A 5KNCA 4UAIA 2EYMA 3MXNA 1AZPA 3DWQA 3H94A 4L63B 3FDTA 2A6ED 2C9OA 2TSSA 3Q24A 1B3AA 3M3YB 2Q8TA 4ZRZA 4G7ZC 2JA6B 4QUFA 2KEEA 2AQ2B 2Z1CA 1JQYD 1RF2D 1JWUD 2HUGA 3ND8A 1RODA 1GXDC 3NBHA 3S17B 2F1MA 3K59A 4WFN3 5ISRA 2F0VA 5EKKA 4K5XA 3CRLC 2CQAA 3JAME 2X6GA 2NUCA 5EBDA 4QMGA 4OHJA 4C3IG 2IX3A 2FFKB 5IGBA 3D4WA 3I90A 4ODGA 3MXUA 3V05A 3SEBA 2WB1B 1XYIA 3WDNA 2RDFA 5C3WA 1NSNS 2D2CC 2K33A 5BN3A 2PW7A 5D65A 1OXSC 1DZ1A 2RSOA 1GJXA 1SJED 3PUXA 1EOTA 3VR4A 5FO9B 1F9RA 1GUNA 1VF7A 3K57A 3I72A 4DU9A 4ZLTF 4IN3A 4J1MA 2LS01 5DAUA 3A55A 2BDNA 1HXYD 1WD0A 4RGOS 3OHXC 2RDGA 3MFYA 1HTLD 5D3IB 1OXXK 5ELDA 1ZYRC 1I4QA 3SK6A 2HDMA 1I50B 1LT3D 3F2UA 4QIWB 1JC7A 2J4XA 4KJOA 4XDXA 3RZDB 4IUQA 4KJNA 4CKCA 2KUMA 2FINB 4CJ1B 3J81E 1S5CD 1DYQA 3M85A 4KN7C 1U4PA 1A6XA 1EY6A 4A3FB 1UUPA 3IAYA 4QF4A 1QNKA 4DK1A 4RA8A 2K04A 2AWOA 1F77A 2A68D 2F0FA 1FNUA 5C0XH 2NVTB 3MXPA 3BVZA 3GO5A 5JEAH 1I4XA 1J8IA 2ICIA 1EWCA 1D5MC 2C5CA 2IL8A 1ESRA 4XQQA 4EQNA 1L0XB 2F0EA 4LMQD 5KIXA 2KOLA 3T56B 1EY4A 1CQVA 1WTWA 1DOMA 2WKCA 1PZJD 4QB4A 1QILA 3A8KE 2F4IA 1S5ED 1C48A 2Z4HA 3I4NB 3GTGB 1SXTA 1MBYA 2ICEC 1D2BA 2A6HC 1HCZA 3MHBA 3D6CA 1WTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5NUC A;  3SK6 A;  2RKS A;  2EYH A;  1ENC A;  4HMJ A;  5M9O A;  3C1E A;  4KY7 A;  2F0K A;  5KYI A;  2F0I A;  4KTA A;  1KAA A;  2F0L A;  3NHH A;  1TQO A;  1STG A;  2OXP A;  4RKL A;  3NXW A;  5IGC A;  1SNO A;  4K5W A;  1STA A;  4KD4 A;  4KJO A;  5JOB A;  4E6I A;  1SYC A;  2O4X A;  3ERQ A;  4F8M A;  3EVQ A;  4G57 A;  2KQ3 A;  1NUC A;  2OF1 A;  5CV9 A;  4N9P A;  2EYL A;  3BDL A;  5EKL A;  4EQP A;  3QOL A;  5CV4 A;  5IOD A;  1EYC A;  3OWF A;  4I65 A;  2WAC A;  2QDB A;  3P1H A;  4WOR A;  1EZ8 A;  5EGT A;  4PMB A;  5F2D A;  3E5S A;  4B9X A;  2ENB A;  5K5P A;  5JAV A;  3MZ5 A;  4R8N A;  1F2M A;  5IGD A;  5I6W A;  4H7B A;  4ZUJ A;  1SYF A;  4PMC A;  4KJN A;  5HUR A;  2F0N A;  4B9W A;  4ID6 A;  3VA5 A;  5C5M A;  2EYJ A;  5J22 A;  4KY6 A;  4OL7 A;  1SYG A;  2EY5 A;  5C3X A;  5C4Z A;  4HMI A;  1JOK A;  1JOQ A;  1JOR A;  1TT2 A;  2EY2 A;  5E1F A;  5ISR A;  3R3O A;  2F0V A;  5IGE A;  2EY1 A;  5CV7 A;  5I9O A;  1EY8 A;  5EKK A;  1RKN A;  3QB3 A;  4K5X A;  4DF7 A;  4K5V A;  2LKV A;  2SOB A;  3SK4 A;  2EYF A;  3NP8 A;  4MIU A;  1EY6 A;  1AEX A;  2EY6 A;  1TR5 A;  2F0Q A;  2HQE A;  2NUC A;  4QF4 A;  3U9O A;  4QMG A;  3NUC A;  3SK5 A;  3HEJ A;  4NP5 A;  2PZW A;  4YIJ A;  1KDA A;  1KDB A;  4S3S A;  2F0W A;  3TP7 A;  3TP6 A;  3BDC A;  3V2T A;  5IGB A;  3D4W A;  1EYD A;  1STH A;  3T16 A;  3OMG A;  4EQO A;  5KYL A;  2F0F A;  1STN A;  3EJI A;  3MEH A;  3SHL A;  3ERO A;  1SND A;  4K8I A;  1SNM A;  5IGF A;  4ODG A;  4NKL A;  3DHQ A;  1A2U A;  1A3U A;  3H6M A;  2RDF A;  3P75 A;  1SYE A;  3LX0 A;  5KGU A;  4IZ8 A;  5I6Y A;  1EQV A;  2OEO A;  3HZX A;  3MXP A;  4K14 A;  1EY0 A;  2F0T A;  2F3V A;  4K6D A;  1NSN S;  5C3W A;  5CV6 A;  1SYB A;  5IIF A;  3OMC A;  5CR3 A;  2EYP A;  2PQE A;  5C5L A;  2F0M A;  2PW7 A;  2SNS A;  1JOO A;  3SK8 A;  1U9R A;  3T13 A;  5C4H A;  5IOC A;  1STY A;  5I9P A;  3D4D A;  3TP5 A;  4N9T A;  1IHZ A;  4EQN A;  5C6A A;  4DFA A;  4LAA A;  4EVO A;  5CC4 A;  4IUN A;  2F0E A;  4K8J A;  2EXZ A;  1A3T A;  1KDC A;  4ZQ3 A;  1SNC A;  2PZT A;  2M00 A;  5KIX A;  5J1Z A;  1EY4 A;  3DMU A;  5DEH A;  2PW5 A;  3RUZ A;  5HGT A;  5KEE A;  2EYO A;  2F0U A;  3D8G A;  1STB A;  3OSO A;  2F0J A;  3TP8 A;  4K2K A;  3S9W A;  5CV5 A;  4KHV A;  2F0S A;  3NK9 A;  2F0G A;  1SNQ A;  2F0D A;  3QOJ A;  3SXH A;  1EY5 A;  2F0P A;  4QB4 A;  2F3W A;  4KY5 A;  5CGK A;  5E3F A;  1EY7 A;  1EY9 A;  2RBM A;  1ENA A;  3ITP A;  4DU9 A;  4F7X A;  2F0H A;  1EYA A;  3C1F A;  5KRU A;  4J1M A;  5IGG A;  2SNM A;  3PMF A;  4J6H A;  5DAU A;  1A2T A;  1SNP A;  4HTH A;  4PNY A;  4NMZ A;  1A3V A;  1EZ6 A;  2F0O A;  3SR1 A;  4IAL A;  2PZU A;  4TRD A;  4WRD A;  4KD3 A;  2PYK A;  4K2L A;  3NQT A;  1SYD A;  2EYM A;  4KV6 A;  4ZUI A;  4ME5 A;  4DGZ A;  1F2Y A;  3MVV A;  4RKB A;  1II3 A;  3TME A;  2KHS A;  3MHB A;  5J39 A;  3D6C A;  1F2Z A;  1KAB A;  4NDX A;  5CV8 A; 
#chains in the Genus database with same CATH topology
 4DA2 A;  1ENC A;  4LFC L;  4DR7 Q;  2PPB C;  1PMR A;  2CCZ A;  2F0L A;  2WKD A;  1STG A;  4LW1 A;  1SNO A;  5I4D A;  4C3H H;  4E6I A;  2O4X A;  3GTL H;  1PH2 A;  1TVX A;  4C3J B;  3BDL A;  1PH6 A;  3TBI B;  5F2D A;  1EZ8 A;  4X6A H;  1P8L A;  5M3F B;  1JE4 A;  2MUY A;  1RTN A;  3MZ5 A;  3W3A A;  4H7B A;  1M4V A;  1TKW B;  4ID6 A;  2XRQ D;  2RCN A;  5KNB A;  1KRS A;  1RHP A;  4KY6 A;  2QA4 A;  3RN2 A;  4DR4 L;  2PI2 A;  4IJL A;  2KHJ A;  1C7Y A;  1W6K A;  4X3K A;  3PV0 A;  2K03 A;  1QZG A;  1YHB A;  1U5K A;  4HJA A;  4UY8 C;  1XWE A;  5IYB H;  4ULL A;  2XNA C;  4KHZ A;  3KLS A;  2KJX A;  1J5E L;  2EY6 A;  4IUV A;  2Q2U A;  2JA7 B;  3TP6 A;  1TS3 A;  3G48 A;  3V2T A;  1ONL A;  4A93 B;  1HNZ Q;  4H13 C;  3HOZ B;  2E2J B;  3X3N A;  4LF7 L;  3HOW G;  1LO5 D;  4DV2 L;  4LFB L;  2K5V A;  5I6Y A;  3WOE A;  3HOX H;  2Z8L A;  1XMO Q;  1SE4 A;  3HOU G;  3J80 c;  1KLU D;  1CFM A;  1VQD A;  2JA5 B;  5CBA E;  1MHW C;  1UEA B;  3GTP B;  1N34 Q;  1MSH A;  1VQB A;  5EJW A;  4LF8 Q;  5T1G A;  2Q8I B;  1IBK L;  5J1Z A;  1V1P B;  1OXU A;  4LUV A;  5GAD C;  1B8A A;  3OTO L;  3NK9 A;  3A74 A;  4JBJ A;  2E2J H;  5CGK A;  4OWX B;  1K8A C;  5ELE A;  5JPN C;  3I91 A;  3C1F A;  1ML0 D;  4NXN Q;  1A2T A;  3BZK A;  2JA6 G;  4BBS H;  2BE5 D;  2KCT A;  4O2D A;  3KJO A;  4FYD A;  4XXE A;  3PUZ A;  3HOV B;  1K3R A;  5IYD G;  1N33 Q;  5ELN A;  5L37 A;  2VY3 A;  4B3M Q;  1I3Q H;  4AYB E;  1SMX A;  2RKS A;  2EE1 A;  2MO1 A;  3IKJ A;  3RLF A;  5KYI A;  1D1K A;  4DPG A;  4X3U A;  3LNN A;  4M8A A;  4NW2 A;  3J7Y W;  2QW7 A;  3ERQ A;  1OO9 B;  2Y0S B;  2XTI A;  1CHQ D;  1XPU A;  1D5Z C;  4DV7 Q;  5JEA J;  1LUZ A;  1IBL L;  4WJ3 M;  5A2Q E;  3VDY A;  2IJ0 A;  3HGB A;  1SMY D;  3RZO B;  3TDQ A;  1I94 Q;  4FO2 A;  2PNR C;  2LY7 A;  4JI5 L;  2GA4 B;  2N8N A;  1X3G A;  4DV3 L;  4HIK A;  2RHS B;  5C0X I;  2DNC A;  4KN4 C;  4Y7N B;  4QCL A;  1VMC A;  3G6E A;  1XNR L;  4A3K H;  3CD6 A;  1HPC A;  1JWM D;  4MIU A;  5JJK A;  3D4R A;  2HQE A;  4ZYS A;  1B70 B;  2Q2H A;  2VQE Q;  1F2L A;  4NXM L;  4OX9 L;  1DOL A;  3BDC A;  1LV9 A;  1SAP A;  1STH A;  1B53 A;  1STN A;  1K8O A;  1X3P A;  1IBM L;  3NBH B;  1LAC A;  4HIO A;  4YHH Q;  3RZO H;  1LT6 D;  2HIX A;  4OIJ A;  1EQV A;  4Q0F A;  4IUP A;  1EY0 A;  1HR0 L;  1ET6 A;  3AQQ A;  5CYU A;  2SDF A;  2PQE A;  4OO1 H;  1C0A A;  4GKJ Q;  4YCU A;  4AH6 A;  1XPO A;  1LTL A;  1QB5 D;  1RD9 D;  1B9M A;  1NR4 A;  1U4M A;  2WV6 D;  3G7L A;  4JBK A;  3NEM A;  1EFW A;  2EYO A;  2L5T A;  3HS0 C;  3K0X A;  2HD3 A;  4DNR B;  1H9J A;  4FXG C;  4F7X A;  3CCM A;  4DV5 Q;  1JR0 D;  2MFI A;  1BCP D;  1VMP A;  3FKI H;  2UU9 L;  1PRT B;  4TSS A;  1FJG Q;  1FGB D;  2DY8 A;  4IAL A;  3E0E A;  3URY A;  2JA8 B;  3NQT A;  1O7I A;  4HJ5 A;  3BZC A;  1XPR A;  4A75 A;  4HED A;  4P73 A;  4JI2 Q;  1HUM A;  2LMC B;  4B3R Q;  5C0X G;  3BYY B;  4A3E H;  1XXG A;  4IPG A;  4KKU A;  1KAA A;  4BBR B;  5JEA G;  1HQM C;  1LTB D;  1VQK A;  1FD7 D;  5G3L D;  1HNZ L;  1GHK A;  4G57 A;  3ULP A;  2WB1 E;  4HJ9 A;  3NPP A;  3DEO A;  4ALP A;  1YJW A;  4A3G H;  5EGT A;  1A8V A;  2B39 A;  1IXR A;  4FF1 A;  5JAV A;  3A54 A;  2CWP A;  2V4D A;  5I6W A;  1MSG A;  4H0L C;  2F0N A;  3KLW A;  1H9R A;  3K7A H;  2X69 A;  2HHH Q;  1Z47 A;  4DAV A;  1N34 L;  1O78 A;  2UUA Q;  1VQG A;  1HNX L;  2Q2T A;  2EY1 A;  4DV1 Q;  4LF8 L;  3W2D A;  3J7A 5;  4HCE A;  4DF7 A;  4BBR H;  4JYA Q;  3JC6 6;  2FHT A;  1K73 C;  2G5D A;  5FLX E;  5FLM G;  1SRO A;  1EU3 A;  4CDF C;  2J0T D;  4OEL B;  4P71 A;  2PZW A;  1EIH A;  5COY A;  1W6J A;  4NXN L;  2WAQ B;  4RGN A;  3KUP A;  4BY1 H;  2AMC B;  3DHQ A;  4ILW A;  3J81 L;  2I07 B;  4RG1 A;  1N33 L;  2L55 A;  5IT9 L;  4C3H G;  1PH3 A;  5ELC A;  5LMU Q;  5C4H A;  1FYC A;  3KLS X;  1FGU A;  5E4X A;  3SDZ A;  3HP3 A;  5CC4 A;  4QIW E;  4EVO A;  3BVG A;  3A56 A;  1KDC A;  2OQK A;  3HOY B;  3KF8 B;  3A8I E;  2AWN A;  3UDX A;  1STB A;  2N3S A;  2ZXP A;  3Q22 A;  2A1A A;  4KHV A;  2CHB D;  3PSI A;  4KI0 A;  2D0O A;  1Q8I A;  5IYB G;  1D7Q A;  5E4W C;  3CC2 A;  1LM0 A;  1H9M A;  1EY9 A;  3S14 B;  2F3I A;  1AH9 A;  1A0I A;  1I94 L;  1L1O C;  4FVM A;  1VQN A;  4TRD A;  4BXX H;  5EKI A;  4QL5 A;  3KDF B;  1VQP A;  1BKB A;  2CW0 D;  3DWP A;  1HJP A;  2A69 D;  5J39 A;  3IFT A;  2VUM B;  1KLG D;  5CV8 A;  1L1O A;  2YTV A;  3HOY H;  2OCE A;  2EYH A;  3HOW B;  3HOX G;  4P74 A;  1KRT A;  1I6H B;  2F0I A;  4GZY C;  2WIN B;  1YNN C;  3HOU B;  3FPU B;  2J7Z A;  3WWV A;  4HSP A;  3GTQ H;  2E2D C;  3R2T A;  3S14 H;  5CV4 A;  2E2H B;  2JN4 A;  1EL0 A;  1EIG A;  5DNF A;  1I4P A;  5AJ3 L;  1SE8 A;  1C8C A;  1F2M A;  2EXD A;  4BA2 I;  5M5Y B;  2K7V A;  3K5L A;  1CSP A;  1ZEQ X;  4GKJ L;  5C3X A;  1VQM A;  3I3C A;  4HMI A;  3A7A B;  3CRK C;  5D3D A;  1JOR A;  3NE5 B;  5E1F A;  5JJI A;  1NR2 A;  1J9O A;  1E7Z A;  2Q2I A;  5I9O A;  3GV3 A;  4HAE A;  1RKN A;  2NB0 A;  2LKV A;  1NMF A;  4BBS G;  4RCN A;  2JA5 G;  1K0S A;  1WVL A;  1M1K C;  1FR3 A;  3T1Y Q;  4OO1 I;  3TRE A;  4NP5 A;  3P7J A;  5A35 A;  1PTO D;  5C4X H;  2HIV A;  3IL8 A;  3HKZ E;  3K58 A;  3U4V A;  1TWH B;  3EJI A;  4CJ0 B;  1X65 A;  2VB2 X;  1YNJ C;  4JI8 Q;  5LMN W;  4C2M B;  2UXB Q;  2L1B A;  2ZTD A;  1QZH A;  1HZ9 A;  3P75 A;  4RFB A;  1VDZ A;  1VS0 A;  1CKM A;  2F3V A;  2O2L D;  2N49 A;  4YWM A;  4JI2 L;  2B63 H;  4B3S Q;  2K5D A;  2A8V A;  3TP5 A;  3OPO A;  4Q5V A;  2BDO A;  1Q3L A;  4NB3 A;  1LTR D;  2EPB A;  2FXQ A;  3CCU A;  3S15 B;  4RMF A;  1PRT C;  3NWT A;  4JBM A;  1EEF D;  4A3K G;  5E3F A;  1EY7 A;  4GLA C;  1ENA A;  2E8G A;  1WTH A;  5IGG A;  3FMC A;  1VQC A;  4FNF A;  5JJL A;  2NZ1 D;  4DR4 Q;  3MTS A;  3EIV A;  4CKB A;  4A3M B;  1ILQ A;  1S40 A;  4NMZ A;  1XX8 A;  1SRU A;  2KEC A;  4DV1 L;  3NWS A;  1F2Y A;  1NNX A;  3DEP A;  3MA2 B;  1DON A;  4GN3 B;  1WOC A;  3Q6S A;  1WI5 A;  1PH4 A;  1EWI A;  5JPM C;  2ZJR A;  2IW3 A;  2ZM6 L;  1A63 A;  2EOT A;  1VCI A;  1A62 A;  4X66 Q;  4OO1 G;  2QIL A;  2OF1 A;  1SSO A;  3QR8 A;  4LJZ C;  4UHV A;  4BS9 A;  4LF7 Q;  4A3M H;  3CCQ A;  4DV2 Q;  2R93 H;  1TS4 A;  3H09 A;  4R4Q A;  1HFN A;  1VQE A;  4DAP A;  5FO8 B;  2A5H A;  5IGD A;  1LTA D;  3S16 H;  4KLK A;  5LMU L;  3CCV A;  3J80 E;  5C5M A;  2EYJ A;  5IP9 H;  1TT2 A;  3JAM i;  2D9U A;  3FVQ A;  2MJ8 A;  4LUZ A;  3D3R A;  3EFX D;  5LL6 X;  3QB3 A;  1GUS A;  1GM5 A;  4CGY B;  2V1C C;  2NVQ H;  1B2T A;  4QY7 A;  2EIF A;  5A2Q L;  4IUT A;  3M4P A;  1BUV T;  3A0J A;  4OWW B;  2YTY A;  1Z6H A;  5IWA L;  1WTQ A;  3ERS X;  2NN6 H;  1VQ6 A;  4A3E G;  4BA1 I;  3SE0 A;  5KGU A;  1C4Q A;  3VYR A;  2DUD A;  4DUZ Q;  2PO4 A;  3CCR A;  5I2X A;  2F0M A;  2IPK D;  4DNI A;  4F88 A;  1PH8 A;  4A3G G;  4U68 A;  1NAP A;  1JB3 A;  1EQT A;  4DN4 M;  4ZKB B;  1LTG D;  2A6E C;  4OIK A;  2ZTC A;  4ZAI A;  3R93 A;  2K52 A;  3VR3 A;  3KF8 A;  2Y0S E;  5HGT A;  3A7L A;  4DUY L;  1SNQ A;  2K4K A;  1EY5 A;  1GO3 E;  3CPW A;  2YU9 B;  2F3W A;  4WJ4 A;  4BBR G;  2B3G A;  5KRU A;  3S1Q H;  4GN4 B;  2SNM A;  1IL2 A;  3B6Y A;  4V0B A;  1CK1 A;  1SE2 A;  1G91 A;  2VB3 X;  4JI5 Q;  1SYD A;  3KDF A;  3R8B A;  5JVH 3;  3BZD B;  1G51 A;  1AE2 A;  2ZTE A;  4BY1 G;  2B8F A;  4XQN A;  4CDE C;  3T1Y L;  4MHE A;  4G7H C;  1TQO A;  4NXM Q;  4Y52 H;  4C3H B;  1CUK A;  4OX9 Q;  1Q86 C;  2YU9 H;  3GTL B;  4APV A;  4ZCK A;  1FNW A;  1PRT F;  5HGQ A;  1OXV A;  2UXB L;  5FK9 C;  2D5D A;  3KYH C;  2VNU D;  2ZT9 C;  2MHV A;  4DK0 A;  1JT8 A;  4X64 Q;  3J81 i;  4ZUJ A;  3BVM A;  4OON A;  2KCM A;  1I6V C;  1OXT A;  2WAQ G;  3DWA A;  4B3S L;  1JOQ A;  1KD1 C;  3OIQ A;  3KF6 A;  5FJ8 H;  4A3C H;  2ZJP A;  1EY8 A;  2LSS A;  2HCI A;  2EJM A;  3L3O C;  1TR5 A;  1HA6 A;  3TSS A;  2Z4I A;  1Y8N B;  2F4V L;  3CP0 A;  3K5N A;  4POG A;  3SGI A;  5KYL A;  3HOY G;  5ELB A;  2D0P A;  3W1G A;  3HKS A;  2UU9 Q;  1V1O A;  3HOX B;  2CQO A;  4RAU C;  4HN7 A;  3ULJ A;  3H3V H;  2R7Z H;  3HZX A;  1BBX C;  4K14 A;  4JK1 C;  1Y8P B;  3PO3 H;  1KL9 A;  1G6Z A;  1BQQ T;  1T5E A;  1UWV A;  1TWG H;  4N9T A;  1IHZ A;  3MAQ A;  4DFA A;  2R6G A;  4CKE A;  1ICW A;  4X66 L;  1GHJ A;  4BWG B;  1Y14 B;  4N8F A;  2NYZ D;  2VUM G;  1STE A;  5CV5 A;  3D31 A;  3MC0 B;  1W2B A;  1IW7 D;  2DN8 A;  1ILP A;  2LFN A;  4G7O C;  4BBS B;  3PMF A;  1BBU A;  1XMQ L;  3RLO A;  1EZ6 A;  3IFD A;  2PYK A;  1HNX Q;  5C4X G;  4MTN A;  4ZUI A;  2B29 A;  4YCW A;  5IE8 A;  3E0J A;  2QEJ C;  1TXY A;  3PUV A;  2L11 A;  1GUT A;  1I3Q B;  3UDF A;  4LF4 Q;  5H1S E;  1EOV A;  1PZI D;  3CW2 C;  3P20 A;  1CTM A;  2OWO A;  2BOS A;  2BA0 A;  1B3Q A;  3NHH A;  2B63 G;  3LWU A;  2O5J C;  2OQ0 A;  1R9T H;  1X6O A;  2I46 A;  1SBB B;  4XIG S;  2A68 C;  4RHS A;  4B3T L;  1HHV A;  4JOI C;  2LXJ A;  4O0A A;  3GQB A;  2DJG C;  4RCO A;  1KNE A;  4DUZ L;  1YBY A;  4O1N A;  4R8N A;  3BG3 A;  2D62 A;  4JC0 A;  4AIM A;  3VR6 A;  1OTC A;  3O13 A;  5C4Z A;  4JOI A;  5ELO A;  1AFP A;  1L1O B;  3I2Z A;  3R3O A;  5M5W H;  3CU7 A;  2NN6 I;  5IGE A;  2MPM A;  3VYT A;  2E5L Q;  4A3K B;  1HZB A;  2NVX B;  2Z9H A;  4K5V A;  3NTK A;  4A3B H;  5LHY 1;  1YIJ A;  1PVO A;  3J81 c;  5C0X J;  4XYQ A;  3D0F A;  1Q90 A;  5IT9 c;  3PCO B;  5IYC H;  3TZD A;  1ASY A;  4UPA A;  2I0Q A;  1MGS A;  3QO2 A;  5LMN Q;  2JA9 A;  2OEO A;  1I5F A;  2VXW A;  1TY0 A;  1JWS D;  2NVX H;  1BO0 A;  2A19 A;  2WFW A;  3T13 A;  1STY A;  5I9P A;  1BCP B;  4A3M G;  2R93 G;  1QCB D;  1SDF A;  2HCC A;  1HQR D;  1VF5 C;  2AQ1 B;  1DXM A;  3I7F A;  3STB D;  5IP9 G;  1WTO A;  2NTS A;  3DMU A;  3N6R A;  1P16 A;  1E1T A;  4L5T A;  3OSO A;  5C3E H;  1JJ2 A;  3J81 j;  1Z7T A;  2XN9 C;  1QVC A;  1EFI D;  5M5X H;  2SEB D;  2F0P A;  5CBE E;  4UDU C;  3F1Z A;  3M4Y A;  5AJ3 Q;  4X64 L;  3FKI B;  3JAM L;  4R8I A;  1TS5 A;  1WD1 A;  1S4Z A;  4PNY A;  1A3V A;  2O5I C;  2I5M X;  3E9H A;  4K6L A;  2R92 B;  3C3L A;  2NN6 G;  4GOP C;  1Y8O B;  1W3S A;  3RMH A;  1WTP A;  4C56 C;  4A3E B;  4I7Z C;  1L2F A;  2JE6 I;  2K5W A;  3C1E A;  2F0K A;  4KY7 A;  2BCO A;  1I4H A;  1L0W A;  2NTT A;  1PDQ A;  4GOP A;  4K5W A;  4DV4 L;  2KQ3 A;  4A3G B;  3ULL A;  2KVM A;  2AHO B;  2K01 A;  4H02 A;  2PI2 E;  3H3V C;  3QOL A;  1X3E A;  3U50 C;  3N52 A;  1WTV A;  3S2H H;  3K7A B;  4UP7 A;  1WCM B;  2R92 H;  1MKH A;  3BJU A;  1LAB A;  5C44 H;  2QDL A;  1HNW L;  3DUZ A;  5CV7 A;  2NWG A;  4LUO A;  4DR3 Q;  3H3V I;  2DNE A;  1YJ9 A;  1FL0 A;  2F0Q A;  3U9O A;  2N55 A;  1WTR A;  1S5D D;  3J7Z C;  4N8X 1;  3K5O A;  1KDA A;  2ALY B;  2ZXO A;  1KAW A;  2F0W A;  3TP7 A;  3C46 A;  4L6T B;  4BY1 B;  3ICE A;  3MEH A;  1N9W A;  4IOA A;  3CXC A;  3TS2 A;  4I7A A;  1WCM H;  3OWE B;  2BE5 C;  3KK7 A;  3PGZ A;  1M90 C;  1Y1W H;  3PIP A;  2EJG C;  2Q8R E;  2E75 C;  1BVS A;  4LF4 L;  2VZA A;  4PZ7 A;  3S1R H;  1N36 L;  2JEB I;  2B2T A;  2JQO A;  5M3M H;  2FMM A;  4GNX C;  4ME3 A;  2ZM6 Q;  2CKZ B;  1AW7 A;  1X56 A;  1H95 A;  2EXZ A;  4GLX A;  3GTK H;  2RA4 A;  2WP8 J;  3G71 A;  1E22 A;  2ZJQ A;  5DEH A;  1AE3 A;  2RQX A;  1YZ6 A;  2F0S A;  5GRO A;  3SXH A;  4GNX A;  5FJ8 G;  4A3C G;  3TEH B;  3L2P A;  5TSS A;  1O80 A;  1H9S A;  2MNA A;  3BS1 A;  1IKM A;  2K75 A;  2R7D A;  4HTH A;  1O7Z A;  1SMY C;  4C1N I;  1SFO H;  4KD3 A;  2EZV A;  3CCJ A;  2E5L L;  2Z6B A;  2KHS A;  1VQI A;  5FKA C;  4DK3 C;  3FP9 A;  1ZKO A;  3MFG A;  4R9W A;  1TWA H;  2R7Z G;  3PUW A;  1GVP A;  4F87 A;  1BXT A;  1ET9 A;  4P72 A;  4LF5 Q;  1YJN A;  1A15 A;  2UUB Q;  1TWF B;  2N88 A;  3U4Z A;  3PO3 G;  3GTQ B;  3MWY W;  3FPP A;  1D1I A;  5IWA Q;  4AYB B;  3OWF A;  1G6P A;  4GKK Q;  2QDB A;  4B9X A;  3GTJ H;  3DM3 A;  1AN8 A;  5LMN L;  2M2L A;  4AQY L;  4RHR A;  5EPJ A;  3UDI A;  4U67 3;  1TII D;  2QCP X;  4NPS A;  4A3J H;  1SYG A;  1RCV D;  1FVI A;  1VQH A;  2NVY H;  1MI2 A;  1IYV A;  3TZU A;  1EUJ A;  1HA5 A;  3I70 A;  1ZYR D;  1TWC H;  5CMD A;  3VYS A;  1PFS A;  3NP8 A;  4KMU C;  3S1N H;  1TWF H;  4DUY Q;  1CKO A;  1E24 A;  5FOB B;  4R1J A;  5C4X B;  1JJG A;  1IKL A;  4A3D H;  3NTH A;  3PO2 H;  2IY5 B;  1CA6 A;  3OMG A;  3GD7 A;  3S1M H;  1F9P A;  5DM7 3;  3CQZ H;  1BCP C;  1PTO H;  1T5X D;  2KBN A;  2PMZ B;  3LX0 A;  4YWL A;  4IZ8 A;  2UUC L;  1NBW A;  4HSV A;  2WII B;  3KF6 B;  2B63 B;  4RH6 A;  4B08 A;  3OOC A;  2EYP A;  2RDH A;  4IFD H;  2JSO A;  1NY4 A;  2TMP A;  1G2T A;  3OIP A;  1Q7Y C;  1Z9F A;  3RLN A;  2GN5 A;  1LTI D;  4IUN A;  1BOS A;  2K5H A;  3UE0 A;  3RUZ A;  4BY7 H;  2PQA A;  4EX5 A;  2CH4 A;  3D8G A;  4DR2 L;  4G4K A;  1RTO A;  4A3I H;  1UE5 A;  3K8A A;  4A3B G;  1EYA A;  1HTP A;  2JJQ A;  1NMG A;  1I4G A;  3SR1 A;  3NTI A;  5EPL A;  1QUQ B;  4MTK A;  3J7A V;  4ME5 A;  5IYC G;  3MVV A;  2QF7 A;  4JPB W;  4RKB A;  2R61 A;  3AFQ A;  4A4I A;  4CHT B;  4DR3 L;  4K0K L;  3HRZ C;  1IYU A;  2M00 A;  2UXC L;  4NDX A;  3T51 B;  3FEW X;  4M1U B;  1L0Y B;  1PFN A;  2JXM B;  3KBX A;  1YNX A;  1PXU A;  2NZO A;  3G6J B;  2F4V Q;  1U4R A;  1BF4 A;  2OXP A;  4RGT A;  4QGU A;  3M3Y H;  3PIO A;  4F8M A;  1NUC A;  3KLR A;  5CV9 A;  2YTX A;  2F03 A;  1N8R C;  2R93 B;  3QIA A;  3E5S A;  1LYL A;  3S16 B;  4LFA Q;  5BN5 A;  4FXD A;  1QOH A;  5C3E G;  3K0Y A;  4ZKC B;  1IYJ B;  1Q82 C;  4HCS A;  3QG1 A;  2EY5 A;  3WOF A;  1O7Y A;  3S17 H;  1IL8 A;  2A6H D;  3CMA A;  4YWK A;  3QWN A;  3R2I A;  2B2W C;  3FHW A;  3LWE A;  3F2D A;  3H0G B;  2SOB A;  2H1E A;  2NVQ B;  1B9N A;  4X65 L;  4ABN A;  3E9I A;  1GUG A;  3NQI A;  3EQL C;  4DV0 L;  3M7N A;  2B2W A;  1PH5 A;  2AQ3 B;  1HRJ A;  4WJW A;  2H5X A;  1VQ4 A;  1TY2 A;  4LK1 C;  3T16 A;  4KKS A;  3MEF A;  2KA7 A;  3SHL A;  1SE3 A;  3UI2 A;  1SND A;  2VQF L;  3A5Z B;  4A3L H;  3I56 A;  1XMQ Q;  3T53 B;  2RF4 A;  2P5Z X;  1K8M A;  4K6D A;  2K28 A;  1JIC A;  1NJI C;  3M7G A;  2IHE A;  3FKI G;  4R4T A;  2CW0 C;  2ZXR A;  3H0G H;  2A69 C;  1XTC D;  5LL6 S;  3RN5 A;  2FJ2 A;  2ASB A;  4LAA A;  2RSN A;  2XSC A;  4LF5 L;  2FMC A;  2UUB L;  2X6L A;  1N32 L;  3UE1 A;  2JEA I;  1QWY A;  2R92 G;  2F0U A;  1I4R A;  5C44 G;  4K2K A;  1EIF A;  3U58 A;  4B3T Q;  4GKK L;  2XRS D;  1EIY B;  1F9Q A;  4KY5 A;  1QVG A;  3S1Q B;  3ONA B;  2VW9 A;  4J6H A;  1B44 D;  4J8Q A;  1BCP F;  1VQA A;  5BN4 A;  1CI3 M;  4EQ5 A;  4RWS C;  3J7A F;  5EPK A;  2B8G A;  3I4O A;  4K2L A;  4FXK C;  2RCF A;  2F52 A;  4KV6 A;  1CZG A;  2G9D A;  2KED A;  4DAY A;  3EA6 A;  1TS2 A;  1RIP A;  2PNH A;  2CWA A;  1WCM G;  4HMJ A;  2N78 A;  2M9V A;  1M8A A;  1I50 H;  1Y1W G;  3CAM A;  1V43 A;  3DM1 A;  4KHP Q;  3PIP 3;  5IT9 E;  3K5M A;  5G3L F;  1SYC A;  1PTO C;  5M3M G;  5EKL A;  1SR3 A;  3J80 i;  4I65 A;  4IO9 A;  5K5P A;  4FDB A;  3RZD H;  5COR A;  4C1N K;  5DLQ E;  5HUR A;  4IFD J;  1R4Q B;  1S72 A;  1D8L A;  1DD2 A;  3F8T A;  2MGS A;  1HZA A;  2EQS A;  3RNU A;  1G2S A;  3AFP A;  1YI2 A;  4LWC A;  3C2P A;  1AP0 A;  4GOP B;  2EYF A;  1EU4 A;  5GQO A;  1ASZ A;  3CKI B;  2BA1 A;  3NUC A;  4A3F H;  1CZW A;  4QUC A;  3TRZ A;  4IFD I;  1VQO A;  1EEI D;  4S3S A;  4XYO A;  2EDG A;  4X62 L;  4EQO A;  1RL2 A;  3NEL A;  1JB7 A;  1SNM A;  1KTK A;  4QQB X;  2R7Z B;  4HR7 B;  1LT5 D;  4L5Q A;  1SYE A;  2Z0S A;  1GOZ A;  2PCF B;  1VQF A;  1UNS A;  2XVS A;  2KHI A;  1E1O A;  1Q1B A;  2NVT H;  3HKZ B;  5IIF A;  3PO3 B;  1AZQ A;  3OMC A;  5CR3 A;  3KBG A;  3T1H L;  1JOO A;  3SK8 A;  1U9R A;  2VS1 A;  1TWG B;  3D4D A;  5DM6 3;  4BXX G;  1MD2 D;  4OGQ C;  1DOK A;  4A76 A;  1PA6 A;  4K8J A;  4TVA B;  4JI1 L;  3BYT B;  3JAM c;  3M4O B;  1IZ6 A;  4A3J G;  2BH2 A;  4PZ6 A;  4XQJ A;  4DV4 Q;  2F0J A;  1JMC A;  2K6A A;  1PFM A;  4X3S A;  1K83 B;  3HG9 A;  3PF5 A;  3KJP A;  4LFA L;  3I8Z A;  4L8J A;  5C4J B;  2I5H A;  4DKA C;  4O42 A;  4LNQ A;  5FLX L;  4LF9 Q;  1V8Q A;  4L5S A;  3I4N H;  4IPC A;  3QJY A;  5EBC A;  2F0O A;  1CKN A;  4AYB G;  4CDC C;  3GTG H;  4A3D G;  1QUQ A;  5T1I A;  3F2B A;  3PO2 G;  4DGZ A;  1HNW Q;  1KXL A;  3GTO B;  2CVR A;  4FF2 A;  1F2Z A;  4EGV A;  1F9S A;  3M4O H;  5AFW A;  5M9O A;  4DR6 L;  1WYD A;  4HID A;  4GNX B;  1D6E C;  4KTA A;  4H44 C;  4POF A;  3OW7 A;  3MXG A;  4JG2 A;  4RKL A;  1UEB A;  1H9S B;  3NXW A;  3RD4 A;  1K83 H;  4KD4 A;  1R9T B;  3CCL A;  2K14 A;  2IX1 A;  5JOB A;  4LF6 Q;  4IFD G;  1DCZ A;  3EVQ A;  5C4J H;  1SEB D;  4WOR A;  4C3J H;  1PH1 A;  4CJ2 C;  3CC7 A;  1V1Q A;  2ENB A;  2R7F A;  1RJT A;  2E2I B;  5M3F H;  1GKH A;  4BY7 G;  3CF5 A;  4HJ8 A;  2IT1 A;  3VA5 A;  4A3I G;  1N36 Q;  1E2W A;  3GTO H;  1RDP D;  5M5W B;  5K36 H;  3E6Z X;  3CCS A;  4P2C B;  3GDE A;  2IHF A;  1DJR D;  2JK8 A;  3VR5 A;  4A3B B;  1UAP A;  2OTL A;  1CQF A;  1JJC B;  2WAQ E;  3DXJ C;  1E2V A;  1AEX A;  4IQZ A;  4JI4 L;  3I55 A;  3AB9 A;  3VYU A;  3SK5 A;  1EQR A;  3CHB D;  1KDB A;  1B4O A;  2XWB B;  5ELF A;  2JA7 H;  1EYD A;  1PTO F;  3W1B A;  2E2I H;  2KCN A;  4A93 H;  5IGF A;  3FRP B;  4CDD C;  4NKL A;  4PG3 A;  5GAE C;  3HOZ H;  1Q8K A;  5I2Y A;  4RGM A;  1YEZ A;  1SYB A;  2IX0 A;  1R4P B;  5C5L A;  3PIO 3;  4DR5 Q;  1S3O A;  5IOC A;  3PUY A;  1GUW A;  5EAY A;  2JA5 H;  1BDO A;  1CHP D;  2DY7 A;  4C3I B;  1XNQ L;  3K7U C;  3GTP H;  2L12 A;  1FNV A;  4KHP L;  2QKI C;  5C3E B;  5KEE A;  3TP8 A;  1S5B D;  5M5X B;  1Y69 U;  1BR9 A;  1T9H A;  3T4A C;  2F0D A;  1Y1V B;  2YV5 A;  4CBV A;  4JV5 Q;  1CM9 A;  2MO0 A;  2RBM A;  4JI6 L;  4DV6 Q;  4AQY Q;  2F0H A;  1LTT D;  2ID0 A;  1UE6 A;  2EJF C;  1C9O A;  1ZXT A;  2PZU A;  2K50 A;  5JVG 3;  1E2Z A;  3MXN B;  1II3 A;  3HOV H;  4ZK9 B;  4C3I H;  4A3L G;  1G29 1;  5NUC A;  2PQA B;  1XTD A;  2WB1 G;  3D6W A;  4DXF A;  2ATW A;  1GUO A;  1X54 A;  2BH8 A;  5E7N A;  1Q12 A;  3HFZ B;  5IY0 A;  4JI3 Q;  3TQY A;  1UE1 A;  1Y1V H;  5IGC A;  1HFG A;  3AMU A;  2A74 C;  3H0G G;  4TQU S;  4YY3 Q;  1G8Z D;  2XIW A;  4N9P A;  1B1Z A;  5IOD A;  3CCE A;  2PMZ E;  1EYC A;  4YCV A;  1U4L A;  1QG7 A;  3CPF A;  3S2H B;  1YVC A;  2OT2 A;  2UUC Q;  4V19 0;  1K28 A;  1SYF A;  4B9W A;  5J22 A;  5D14 A;  4OL7 A;  5C44 B;  1JOK A;  1QE6 A;  2AUK A;  3NBI A;  2EY2 A;  2E76 C;  1PZK D;  1NE3 A;  4IUR A;  1LTS D;  3X3M A;  1E0B A;  4Y7N H;  3SK4 A;  2A73 B;  2R3Z A;  4DR2 Q;  2VL6 A;  1ENF A;  4DR7 L;  1YNN D;  1HUN A;  3ND9 A;  1PFB A;  5IP7 H;  4YIJ A;  1IW7 C;  1SLJ A;  4KK7 A;  2MQH A;  4LF9 L;  3H91 A;  3VR2 A;  1A2U A;  4OXP A;  3NSW A;  3F2C A;  1CSQ A;  4FF3 A;  3H6M A;  2DGY A;  1EWH A;  4FF4 A;  2E74 C;  2B2V C;  1Y1W B;  3L0O A;  2F0T A;  1LT4 D;  4JI0 Q;  5CV6 A;  4IPH A;  3S1R B;  1JCK B;  4K0K Q;  2SNS A;  1SN8 A;  5M3M B;  2UXC Q;  3TS0 A;  2B2V A;  2K32 A;  3I4M B;  3GTK B;  3L9A X;  1MJE A;  1A3T A;  3GP7 A;  1S5F D;  2PZT A;  4JBW A;  4IUU A;  5BR8 Q;  1K8G A;  3J80 L;  4LF6 L;  4GN5 A;  2K5Q A;  4DNT B;  3S9W A;  2LXK A;  2NBF A;  3ER0 A;  3ZYY X;  1X32 A;  1YHA A;  4PMW A;  1KQS A;  2B2T C;  3Q0A A;  1X55 A;  1YNJ D;  2JP1 A;  2HQL A;  2K1B A;  4MZ9 A;  5JJZ A;  4XT3 B;  4R4I A;  1SNP A;  1MIU A;  4A3F G;  3ZJY C;  1HR0 W;  1PYW D;  1SFO B;  4TKO B;  1B50 A;  2G9H D;  3GV6 A;  4WRD A;  1NCV A;  2L0C A;  3V96 A;  1XMO L;  1K3B C;  2JA8 H;  1WJJ A;  1LLR D;  4Z9C B;  3TME A;  3UDG A;  3I4M H;  2KCC A;  2B2Y C;  2RVL A;  4QJF A;  1KAB A;  1TWA B;  1K9M C;  4DXG A;  2MP1 A;  4X65 Q;  4J15 A;  2B2U C;  4DV0 Q;  2YYZ A;  1D5X C;  2B2Y A;  3K81 C;  2HDL A;  1STA A;  1PRT D;  2L9H A;  3OYY A;  2VQF Q;  3GTJ B;  1X9N A;  2EYL A;  4EQP A;  1O7L A;  2B2U A;  1PLF A;  2H4O A;  2WAC A;  4DK6 C;  3L7Z C;  3P1H A;  4KKT A;  4PMB A;  1VQ8 A;  1PYS B;  2I5L X;  3K6O A;  5FO7 B;  4DAY B;  4PMC A;  3SVM A;  3I4L A;  4A3J B;  4DR5 L;  4GLV B;  4PV1 C;  4XT1 B;  2NVY B;  3M9B A;  3PF4 A;  1TWC B;  3BU2 A;  3PQI A;  5EQ0 A;  1DM0 B;  1K0R A;  2K05 A;  1SJH D;  1N32 Q;  4JI7 Q;  3S1N B;  3HKZ G;  1BNZ A;  4B3M L;  3I4N G;  4UP8 A;  3BDO A;  3STB C;  1KNA A;  1VQJ A;  4A3D B;  3HEJ A;  4L5R C;  1J6Q A;  3PO2 B;  3Q23 A;  4JV5 L;  3CME A;  4FP5 D;  1V1P A;  1QJO A;  4DV6 L;  3S1M B;  4XTC S;  1TU2 B;  2GVA A;  3Q8D A;  3CQZ B;  1H9K A;  1PTO B;  3ERO A;  4K8I A;  2AUJ D;  3I73 A;  3S2D B;  3EN2 A;  1A3U A;  4DV7 L;  3TN2 A;  4IPD A;  3KOJ A;  1ESF A;  4X3T A;  3VA7 A;  4C3J G;  1QNU A;  4GS3 A;  5C6A A;  5M3F G;  4PQX A;  5KND A;  1ICF B;  4JI3 L;  4ZQ3 A;  4BY7 B;  1SNC A;  2XWJ B;  1Q1E A;  2K5N A;  2PW5 A;  4YY3 L;  3U9S A;  5K36 G;  4A3I B;  2IWH A;  1E3P A;  2JYO A;  2L4N A;  3QOJ A;  2F0G A;  1KIX A;  1CT1 D;  3A8J E;  2VQE L;  1U0L A;  3AU7 A;  1CA5 A;  2HT1 A;  3S2D H;  1X3Q A;  1VQ7 A;  3K80 C;  3GTM B;  2EVB A;  3ITP A;  4MN3 A;  5KNC A;  4YHH L;  1V9P A;  2UXD Q;  2KEN A;  4UAI A;  2EYM A;  1PYB A;  2JA7 G;  3MXN A;  3M4Q A;  1AZP A;  3DWQ A;  3H94 A;  4A93 G;  4L63 B;  3OW2 A;  4R4O A;  3FDT A;  3HOZ G;  2A6E D;  2C9O A;  2VUM H;  2TSS A;  3Q24 A;  4JVZ A;  4HIM A;  3HOW H;  1B3A A;  1I6H H;  3M3Y B;  4X62 Q;  2Q8T A;  4ZRZ A;  4G7Z C;  1PH9 A;  2JA6 B;  3GTM H;  1VQ9 A;  3HOU H;  4QUF A;  2KEE A;  2AQ2 B;  2Z1C A;  3NEN A;  2RHQ B;  1JE5 A;  1HH2 P;  1CKN B;  1JQY D;  2CH4 W;  4DR1 Q;  2E2H H;  1RF2 D;  1JWU D;  2HUG A;  3W5O A;  4DV5 L;  4JI0 L;  3ND8 A;  1ROD A;  1GXD C;  3T1H Q;  3NBH A;  1KHI A;  2F1M A;  3S17 B;  2AKW B;  5M5Y H;  3K59 A;  4OWT B;  4WFN 3;  1FJG L;  5ISR A;  2F0V A;  4JI1 Q;  5EKK A;  4K5X A;  3CRL C;  5BR8 L;  4B3R L;  2CQA A;  3JAM E;  2X6G A;  1YIT A;  4LFC Q;  2NUC A;  5EBD A;  4QMG A;  2JA6 H;  4OHJ A;  3H15 A;  3HOV G;  4C3I G;  2IX3 A;  1PH7 A;  2FFK B;  5IGB A;  5IYD H;  3D4W A;  1WFQ A;  2DJF C;  3I90 A;  1TWH H;  4ODG A;  3MXU A;  3V05 A;  3SEB A;  2WB1 B;  1XYI A;  3WDN A;  2RDF A;  4C2M H;  1Y1V G;  5C3W A;  1NSN S;  2GVB A;  2OTJ A;  2D2C C;  2K33 A;  5BN3 A;  3A5U A;  2PW7 A;  5D65 A;  2HHH L;  2Y0S G;  1OXS C;  1DZ1 A;  4DR6 Q;  1HZC A;  2RSO A;  4P75 A;  2UUA L;  1GJX A;  1BBW A;  4HJ7 A;  1SJE D;  3PUX A;  5GAH C;  1EOT A;  4IOC A;  4JYA L;  5FLX c;  3VR4 A;  1J5E Q;  4UP9 A;  5FO9 B;  1YHQ A;  1EQQ A;  1F9R A;  1GUN A;  1VF7 A;  3S15 H;  3K57 A;  3I72 A;  1PV4 A;  4DU9 A;  4ZLT F;  4IN3 A;  4J1M A;  1KC8 C;  2LS0 1;  2ES2 A;  5DAU A;  3A55 A;  2BDN A;  1HXY D;  1WD0 A;  4LFB Q;  5IP7 G;  2XGT A;  1PHJ A;  4RGO S;  3OHX C;  2RDG A;  3MFY A;  5J3B A;  4JI7 L;  1HTL D;  5D3I B;  1OXX K;  5ELD A;  1ZYR C;  1DGS A;  1I4Q A;  3SK6 A;  5GAG C;  2HDM A;  1I50 B;  1LT3 D;  4JI4 Q;  3F2U A;  4QIW B;  1IBK Q;  1JC7 A;  3KFU A;  2L15 A;  2J4X A;  4KJO A;  4XDX A;  3OTO Q;  3DLL A;  4DAM A;  3RZD B;  3E3X A;  1MJC A;  4IUQ A;  4IJH A;  2C35 B;  4OEM B;  2CFM A;  3RR5 A;  4KJN A;  4CKC A;  2KUM A;  2FIN B;  1EYG A;  4CJ1 B;  3J81 E;  1XNQ Q;  1S5C D;  1DYQ A;  3M85 A;  4KN7 C;  1U4P A;  1A6X A;  3IRB A;  1EY6 A;  4A3F B;  1UUP A;  1VQL A;  4QF4 A;  3IAY A;  2QGQ A;  1QNK A;  2JA8 G;  3I4M G;  4DK1 A;  4MNO A;  2K04 A;  2AWO A;  4RA8 A;  4JI6 Q;  1F77 A;  2A68 D;  2F0F A;  1FNU A;  5C0X H;  4JCV E;  3LGJ A;  2UXD L;  4PZ8 A;  1QVF A;  2NVT B;  3MXP A;  3BVZ A;  3GO5 A;  3AYH B;  1IBL Q;  3S24 A;  5JEA H;  1I4X A;  1J8I A;  5HY6 A;  2ICI A;  3CC4 A;  1B7Y B;  1EWC A;  1D5M C;  2C5C A;  2IL8 A;  1ESR A;  4XQQ A;  4EQN A;  1L0X B;  3G4S A;  4DV3 Q;  2F0E A;  4LMQ D;  1GD7 A;  1XNR Q;  5KIX A;  2KOL A;  3T56 B;  1EY4 A;  1CQV A;  1WTW A;  1DOM A;  4R4C A;  2NZH A;  1UE7 A;  4JW0 A;  2WKC A;  1PZJ D;  4QB4 A;  4DR1 L;  1QIL A;  3A8K E;  2F4I A;  2Z6K C;  1S5E D;  1Q81 C;  1C48 A;  2Z4H A;  3I4N B;  3GTG B;  4JI8 L;  1NTG A;  1IBM Q;  3EBE A;  1X3F A;  1SXT A;  1MBY A;  2QEX A;  5FLM H;  1XJV A;  2Z6K A;  2ICE C;  1HR0 Q;  1D2B A;  1Q46 A;  1VQ5 A;  2A6H C;  1HCZ A;  3MHB A;  3AEV A;  3D6C A;  1WTX A; 
#chains in the Genus database with same CATH homology
 4DA2 A;  1ENC A;  2PPB C;  1PMR A;  2F0L A;  2WKD A;  1STG A;  1SNO A;  5I4D A;  4E6I A;  2O4X A;  1TVX A;  4C3J B;  3BDL A;  3TBI B;  5F2D A;  1EZ8 A;  5M3F B;  1JE4 A;  2MUY A;  1RTN A;  3MZ5 A;  3W3A A;  4H7B A;  1M4V A;  5KNB A;  1TKW B;  2XRQ D;  4ID6 A;  1RHP A;  4KY6 A;  1W6K A;  4X3K A;  3PV0 A;  2K03 A;  1XWE A;  4ULL A;  2XNA C;  4KHZ A;  3KLS A;  2KJX A;  2EY6 A;  4IUV A;  2JA7 B;  3TP6 A;  1TS3 A;  3V2T A;  1ONL A;  4A93 B;  4H13 C;  3HOZ B;  2E2J B;  3X3N A;  1LO5 D;  5I6Y A;  3WOE A;  2Z8L A;  1SE4 A;  1KLU D;  1CFM A;  2JA5 B;  5CBA E;  1UEA B;  3GTP B;  1MSH A;  5EJW A;  5T1G A;  2Q8I B;  5J1Z A;  1V1P B;  1OXU A;  3NK9 A;  5CGK A;  5ELE A;  5JPN C;  3I91 A;  3C1F A;  1ML0 D;  1A2T A;  2BE5 D;  4FYD A;  4XXE A;  3PUZ A;  3HOV B;  2RKS A;  2EE1 A;  3IKJ A;  3RLF A;  5KYI A;  1D1K A;  4X3U A;  3LNN A;  4M8A A;  4NW2 A;  3J7Y W;  3ERQ A;  1OO9 B;  2Y0S B;  1CHQ D;  1D5Z C;  5JEA J;  5A2Q E;  2IJ0 A;  3HGB A;  1SMY D;  3RZO B;  3TDQ A;  4FO2 A;  2PNR C;  2LY7 A;  2GA4 B;  5C0X I;  2DNC A;  4KN4 C;  4Y7N B;  4QCL A;  1VMC A;  1HPC A;  1JWM D;  4MIU A;  3D4R A;  2HQE A;  4ZYS A;  1F2L A;  1DOL A;  3BDC A;  1LV9 A;  1SAP A;  1STH A;  1B53 A;  1STN A;  1K8O A;  1X3P A;  1LAC A;  1LT6 D;  4OIJ A;  1EQV A;  4Q0F A;  4IUP A;  1EY0 A;  1ET6 A;  5CYU A;  2SDF A;  2PQE A;  4OO1 H;  1QB5 D;  1RD9 D;  1B9M A;  1NR4 A;  1U4M A;  2WV6 D;  3G7L A;  2EYO A;  2L5T A;  3HS0 C;  4DNR B;  1H9J A;  4FXG C;  4F7X A;  1JR0 D;  1BCP D;  1VMP A;  1PRT B;  4TSS A;  1FGB D;  2DY8 A;  4IAL A;  3URY A;  2JA8 B;  3NQT A;  4HED A;  1HUM A;  2LMC B;  5C0X G;  3BYY B;  1XXG A;  4KKU A;  1KAA A;  4BBR B;  5JEA G;  1HQM C;  1LTB D;  1FD7 D;  5G3L D;  1GHK A;  4G57 A;  3NPP A;  3DEO A;  5EGT A;  2B39 A;  4FF1 A;  5JAV A;  3A54 A;  2V4D A;  5I6W A;  1MSG A;  4H0L C;  2F0N A;  1H9R A;  2X69 A;  1Z47 A;  4DAV A;  1O78 A;  2EY1 A;  3W2D A;  4HCE A;  4DF7 A;  2FHT A;  5FLX E;  1EU3 A;  2J0T D;  2PZW A;  1EIH A;  5COY A;  1W6J A;  2WAQ B;  4RGN A;  3KUP A;  3DHQ A;  4ILW A;  3J81 L;  2I07 B;  2L55 A;  5IT9 L;  4C3H G;  5ELC A;  5C4H A;  1FYC A;  3KLS X;  5E4X A;  3SDZ A;  3HP3 A;  5CC4 A;  4EVO A;  3BVG A;  3A56 A;  1KDC A;  3HOY B;  3A8I E;  2AWN A;  1STB A;  2ZXP A;  3Q22 A;  4KHV A;  2CHB D;  4KI0 A;  1Q8I A;  5E4W C;  1H9M A;  1EY9 A;  3S14 B;  4FVM A;  4TRD A;  5EKI A;  2CW0 D;  3DWP A;  2A69 D;  5J39 A;  3IFT A;  2VUM B;  1KLG D;  5CV8 A;  2EYH A;  3HOW B;  1I6H B;  2F0I A;  4GZY C;  2WIN B;  1YNN C;  3HOU B;  3FPU B;  2J7Z A;  4HSP A;  2E2D C;  3R2T A;  5CV4 A;  2E2H B;  1EL0 A;  1EIG A;  5DNF A;  1I4P A;  1C8C A;  1F2M A;  4BA2 I;  5M5Y B;  2K7V A;  3K5L A;  1ZEQ X;  5C3X A;  3I3C A;  4HMI A;  3A7A B;  3CRK C;  5D3D A;  1JOR A;  3NE5 B;  5E1F A;  1NR2 A;  1J9O A;  5I9O A;  3GV3 A;  4HAE A;  1RKN A;  2NB0 A;  2LKV A;  4RCN A;  1WVL A;  1FR3 A;  4OO1 I;  4NP5 A;  3P7J A;  5A35 A;  1PTO D;  3IL8 A;  3K58 A;  1TWH B;  3EJI A;  4CJ0 B;  2VB2 X;  1YNJ C;  4C2M B;  2L1B A;  3P75 A;  4RFB A;  1VDZ A;  2F3V A;  2O2L D;  2K5D A;  3TP5 A;  3OPO A;  4Q5V A;  2BDO A;  1Q3L A;  1LTR D;  2EPB A;  3S15 B;  1PRT C;  3NWT A;  1EEF D;  5E3F A;  1EY7 A;  1ENA A;  5IGG A;  3FMC A;  4FNF A;  2NZ1 D;  3MTS A;  4CKB A;  4A3M B;  1ILQ A;  4NMZ A;  1XX8 A;  2KEC A;  3NWS A;  1F2Y A;  3MA2 B;  3DEP A;  1DON A;  3Q6S A;  5JPM C;  2IW3 A;  2EOT A;  1VCI A;  4OO1 G;  2QIL A;  2OF1 A;  1SSO A;  4LJZ C;  4BS9 A;  1TS4 A;  3H09 A;  1HFN A;  4DAP A;  5FO8 B;  2A5H A;  5IGD A;  1LTA D;  3J80 E;  5C5M A;  2EYJ A;  1TT2 A;  2D9U A;  3FVQ A;  2MJ8 A;  3D3R A;  3EFX D;  5LL6 X;  3QB3 A;  1GUS A;  4CGY B;  1B2T A;  5A2Q L;  4IUT A;  1BUV T;  1Z6H A;  1WTQ A;  2NN6 H;  4BA1 I;  3SE0 A;  5KGU A;  1C4Q A;  3VYR A;  2PO4 A;  5I2X A;  2F0M A;  2IPK D;  4F88 A;  4U68 A;  1NAP A;  1JB3 A;  1EQT A;  4DN4 M;  4ZKB B;  1LTG D;  2A6E C;  4OIK A;  4ZAI A;  3R93 A;  3VR3 A;  3KF8 A;  5HGT A;  3A7L A;  1SNQ A;  1EY5 A;  2YU9 B;  2F3W A;  5KRU A;  2SNM A;  4V0B A;  1CK1 A;  1SE2 A;  1G91 A;  2VB3 X;  1SYD A;  3R8B A;  5JVH 3;  3BZD B;  2B8F A;  4XQN A;  4MHE A;  4G7H C;  1TQO A;  4C3H B;  3GTL B;  1FNW A;  1PRT F;  1OXV A;  5FK9 C;  2D5D A;  2VNU D;  2ZT9 C;  2MHV A;  4DK0 A;  4ZUJ A;  3BVM A;  1I6V C;  1OXT A;  3DWA A;  1JOQ A;  3OIQ A;  1EY8 A;  2HCI A;  2EJM A;  3L3O C;  1TR5 A;  1HA6 A;  3TSS A;  2Z4I A;  1Y8N B;  3K5N A;  5KYL A;  5ELB A;  1V1O A;  3HOX B;  4RAU C;  4HN7 A;  3HZX A;  1BBX C;  4K14 A;  4JK1 C;  1Y8P B;  1G6Z A;  1BQQ T;  1T5E A;  4N9T A;  3MAQ A;  1IHZ A;  4DFA A;  2R6G A;  4CKE A;  1ICW A;  1GHJ A;  4BWG B;  2NYZ D;  1STE A;  5CV5 A;  3D31 A;  3MC0 B;  1IW7 D;  2DN8 A;  1ILP A;  2LFN A;  4G7O C;  4BBS B;  3PMF A;  1EZ6 A;  3IFD A;  2PYK A;  4ZUI A;  3E0J A;  2QEJ C;  3PUV A;  2L11 A;  1GUT A;  1I3Q B;  1PZI D;  3P20 A;  1CTM A;  2BOS A;  2BA0 A;  3NHH A;  3LWU A;  2O5J C;  2I46 A;  1SBB B;  4XIG S;  2A68 C;  4RHS A;  1HHV A;  3GQB A;  4RCO A;  1KNE A;  4O1N A;  4R8N A;  3BG3 A;  2D62 A;  3VR6 A;  3O13 A;  5C4Z A;  1AFP A;  3R3O A;  3CU7 A;  2NN6 I;  5IGE A;  2MPM A;  3VYT A;  4A3K B;  2NVX B;  4K5V A;  3NTK A;  5LHY 1;  5C0X J;  4XYQ A;  1Q90 A;  3TZD A;  1MGS A;  3QO2 A;  2OEO A;  2VXW A;  1TY0 A;  1JWS D;  1BO0 A;  3T13 A;  1STY A;  5I9P A;  1BCP B;  1QCB D;  1SDF A;  2HCC A;  1HQR D;  1VF5 C;  2AQ1 B;  1DXM A;  1WTO A;  2NTS A;  3DMU A;  3N6R A;  3OSO A;  1Z7T A;  2XN9 C;  1EFI D;  2SEB D;  2F0P A;  5CBE E;  4UDU C;  3M4Y A;  3FKI B;  3JAM L;  4R8I A;  1TS5 A;  1WD1 A;  1S4Z A;  4PNY A;  1A3V A;  2O5I C;  4K6L A;  2R92 B;  3C3L A;  2NN6 G;  1Y8O B;  3RMH A;  1WTP A;  4C56 C;  4A3E B;  4I7Z C;  2JE6 I;  2K5W A;  3C1E A;  2F0K A;  4KY7 A;  2BCO A;  1I4H A;  2NTT A;  1PDQ A;  4K5W A;  2KQ3 A;  4A3G B;  2KVM A;  2K01 A;  3H3V C;  3QOL A;  3N52 A;  1WTV A;  3K7A B;  1WCM B;  1LAB A;  3DUZ A;  5CV7 A;  2NWG A;  2DNE A;  2F0Q A;  3U9O A;  2N55 A;  1WTR A;  1S5D D;  3K5O A;  1KDA A;  2ZXO A;  2F0W A;  3TP7 A;  3C46 A;  4L6T B;  4BY1 B;  3MEH A;  3OWE B;  2BE5 C;  3KK7 A;  2EJG C;  2Q8R E;  2E75 C;  2JEB I;  2B2T A;  2FMM A;  1AW7 A;  2EXZ A;  2RA4 A;  2WP8 J;  5DEH A;  2RQX A;  2F0S A;  3SXH A;  5TSS A;  1O80 A;  1H9S A;  3BS1 A;  1IKM A;  4HTH A;  1O7Z A;  1SMY C;  4C1N I;  4KD3 A;  2EZV A;  2KHS A;  5FKA C;  1ZKO A;  3MFG A;  4R9W A;  3PUW A;  4F87 A;  1BXT A;  1ET9 A;  1A15 A;  1TWF B;  2N88 A;  3GTQ B;  3MWY W;  3FPP A;  1D1I A;  4AYB B;  3OWF A;  2QDB A;  4B9X A;  1AN8 A;  2M2L A;  4RHR A;  5EPJ A;  4U67 3;  1TII D;  2QCP X;  1SYG A;  1RCV D;  1IYV A;  1MI2 A;  3TZU A;  1HA5 A;  3I70 A;  1ZYR D;  5CMD A;  3VYS A;  3NP8 A;  4KMU C;  5FOB B;  5C4X B;  1IKL A;  3NTH A;  1CA6 A;  3OMG A;  3GD7 A;  1F9P A;  5DM7 3;  1BCP C;  1PTO H;  1T5X D;  2PMZ B;  3LX0 A;  4IZ8 A;  4HSV A;  2WII B;  2B63 B;  4RH6 A;  4B08 A;  3OOC A;  2EYP A;  2RDH A;  4IFD H;  2JSO A;  2TMP A;  1G2T A;  3OIP A;  4IUN A;  1LTI D;  1BOS A;  3RUZ A;  3D8G A;  4G4K A;  1RTO A;  1EYA A;  1HTP A;  1I4G A;  3SR1 A;  3NTI A;  5EPL A;  3J7A V;  4ME5 A;  3MVV A;  2QF7 A;  4RKB A;  2R61 A;  4CHT B;  3HRZ C;  1IYU A;  2M00 A;  4NDX A;  3T51 B;  3FEW X;  4M1U B;  1L0Y B;  1PFN A;  2JXM B;  3KBX A;  1PXU A;  3G6J B;  1U4R A;  1BF4 A;  2OXP A;  4RGT A;  4F8M A;  1NUC A;  3KLR A;  5CV9 A;  2F03 A;  2R93 B;  3QIA A;  3E5S A;  3S16 B;  5BN5 A;  4FXD A;  1QOH A;  3K0Y A;  4ZKC B;  4HCS A;  3QG1 A;  2EY5 A;  3WOF A;  1O7Y A;  1IL8 A;  2A6H D;  3QWN A;  3R2I A;  2B2W C;  3LWE A;  3H0G B;  2SOB A;  2H1E A;  2NVQ B;  1B9N A;  4ABN A;  1GUG A;  3NQI A;  3EQL C;  3M7N A;  2B2W A;  2AQ3 B;  1HRJ A;  4WJW A;  1TY2 A;  4LK1 C;  3T16 A;  4KKS A;  2KA7 A;  3UI2 A;  3SHL A;  1SE3 A;  1SND A;  3T53 B;  1K8M A;  4K6D A;  2K28 A;  1JIC A;  3M7G A;  2CW0 C;  2ZXR A;  2A69 C;  1XTC D;  5LL6 S;  2FJ2 A;  4LAA A;  2RSN A;  2XSC A;  2FMC A;  2X6L A;  2JEA I;  1QWY A;  2F0U A;  1I4R A;  4K2K A;  2XRS D;  1F9Q A;  4KY5 A;  3S1Q B;  3ONA B;  4J6H A;  1B44 D;  4J8Q A;  1BCP F;  5BN4 A;  1CI3 M;  4RWS C;  3J7A F;  5EPK A;  2B8G A;  4K2L A;  4FXK C;  4KV6 A;  1CZG A;  2G9D A;  2KED A;  4DAY A;  3EA6 A;  1TS2 A;  4HMJ A;  2M9V A;  1M8A A;  1V43 A;  3DM1 A;  3PIP 3;  5IT9 E;  3K5M A;  5G3L F;  1SYC A;  1PTO C;  5EKL A;  4I65 A;  5K5P A;  5COR A;  4C1N K;  4IFD J;  5HUR A;  1R4Q B;  1DD2 A;  2MGS A;  1G2S A;  3C2P A;  1AP0 A;  2EYF A;  1EU4 A;  3CKI B;  2BA1 A;  3NUC A;  1CZW A;  4QUC A;  4IFD I;  1EEI D;  4S3S A;  4XYO A;  2EDG A;  4EQO A;  1SNM A;  1KTK A;  2R7Z B;  4HR7 B;  1LT5 D;  1SYE A;  1GOZ A;  2PCF B;  1UNS A;  2XVS A;  1Q1B A;  3HKZ B;  5IIF A;  3PO3 B;  1AZQ A;  3OMC A;  5CR3 A;  3KBG A;  1JOO A;  3SK8 A;  1U9R A;  1TWG B;  3D4D A;  5DM6 3;  1MD2 D;  4OGQ C;  1DOK A;  4K8J A;  3BYT B;  3M4O B;  4XQJ A;  2F0J A;  2K6A A;  1PFM A;  4X3S A;  1K83 B;  3HG9 A;  3I8Z A;  4L8J A;  5C4J B;  4O42 A;  5FLX L;  1V8Q A;  5EBC A;  3QJY A;  2F0O A;  5T1I A;  4DGZ A;  3GTO B;  2CVR A;  4FF2 A;  1F2Z A;  4EGV A;  1F9S A;  5AFW A;  5M9O A;  1D6E C;  4KTA A;  4H44 C;  3OW7 A;  3MXG A;  4RKL A;  3RD4 A;  3NXW A;  1H9S B;  1R9T B;  4IFD G;  4KD4 A;  2IX1 A;  5JOB A;  1DCZ A;  3EVQ A;  1SEB D;  4WOR A;  4CJ2 C;  2ENB A;  1RJT A;  2E2I B;  2IT1 A;  3VA5 A;  1E2W A;  1RDP D;  5M5W B;  5K36 H;  3E6Z X;  4P2C B;  1DJR D;  3VR5 A;  4A3B B;  1UAP A;  1CQF A;  3DXJ C;  1E2V A;  1AEX A;  4IQZ A;  3AB9 A;  3VYU A;  3SK5 A;  3CHB D;  1KDB A;  1B4O A;  2XWB B;  5ELF A;  1EYD A;  1PTO F;  2KCN A;  5IGF A;  3FRP B;  4NKL A;  5I2Y A;  4RGM A;  1SYB A;  2IX0 A;  1R4P B;  5C5L A;  3PIO 3;  5IOC A;  3PUY A;  1GUW A;  1BDO A;  1CHP D;  2DY7 A;  4C3I B;  2L12 A;  1FNV A;  2QKI C;  5C3E B;  5KEE A;  3TP8 A;  1S5B D;  5M5X B;  1Y69 U;  1BR9 A;  3T4A C;  2F0D A;  1Y1V B;  4CBV A;  1CM9 A;  2RBM A;  2F0H A;  1LTT D;  2ID0 A;  2EJF C;  1ZXT A;  2PZU A;  5JVG 3;  1E2Z A;  1II3 A;  4ZK9 B;  1G29 1;  5NUC A;  3D6W A;  4DXF A;  1GUO A;  1Q12 A;  5IGC A;  1HFG A;  3AMU A;  2A74 C;  4TQU S;  1G8Z D;  2XIW A;  4N9P A;  1B1Z A;  5IOD A;  1EYC A;  1U4L A;  1QG7 A;  3S2H B;  2OT2 A;  4V19 0;  1SYF A;  4B9W A;  5J22 A;  5D14 A;  4OL7 A;  5C44 B;  1JOK A;  1QE6 A;  2AUK A;  3NBI A;  2EY2 A;  2E76 C;  1PZK D;  4IUR A;  1LTS D;  3X3M A;  1E0B A;  3SK4 A;  2A73 B;  2R3Z A;  1ENF A;  1YNN D;  1HUN A;  3ND9 A;  1PFB A;  4YIJ A;  1IW7 C;  4KK7 A;  3H91 A;  3VR2 A;  1A2U A;  3NSW A;  4FF3 A;  3H6M A;  1EWH A;  4FF4 A;  2E74 C;  2B2V C;  1Y1W B;  2F0T A;  1LT4 D;  5CV6 A;  3S1R B;  1JCK B;  2SNS A;  5M3M B;  2B2V A;  2K32 A;  3I4M B;  3GTK B;  3L9A X;  1A3T A;  3GP7 A;  1S5F D;  2PZT A;  4JBW A;  4IUU A;  3J80 L;  4DNT B;  2K5Q A;  3S9W A;  2NBF A;  3ZYY X;  1X32 A;  4PMW A;  2B2T C;  3Q0A A;  2JP1 A;  1YNJ D;  2K1B A;  5JJZ A;  4XT3 B;  1SNP A;  1PYW D;  1SFO B;  4TKO B;  1B50 A;  2G9H D;  3GV6 A;  4WRD A;  1NCV A;  2L0C A;  3V96 A;  1LLR D;  4Z9C B;  3TME A;  2KCC A;  2B2Y C;  2RVL A;  1KAB A;  1TWA B;  4DXG A;  2MP1 A;  2B2U C;  2YYZ A;  1D5X C;  2B2Y A;  2HDL A;  1STA A;  1PRT D;  2L9H A;  3GTJ B;  2EYL A;  4EQP A;  1O7L A;  2B2U A;  1PLF A;  2H4O A;  2WAC A;  3L7Z C;  3P1H A;  4KKT A;  4PMB A;  3K6O A;  5FO7 B;  4A3J B;  4PMC A;  3SVM A;  3I4L A;  4XT1 B;  4PV1 C;  2NVY B;  1TWC B;  5EQ0 A;  1DM0 B;  2K05 A;  1SJH D;  3S1N B;  1BNZ A;  3BDO A;  1KNA A;  4A3D B;  3HEJ A;  3PO2 B;  3Q23 A;  4FP5 D;  1V1P A;  1QJO A;  3S1M B;  4XTC S;  1TU2 B;  3CQZ B;  1H9K A;  1PTO B;  3ERO A;  4K8I A;  2AUJ D;  3I73 A;  3S2D B;  1A3U A;  3TN2 A;  1ESF A;  4X3T A;  3VA7 A;  4C3J G;  1QNU A;  5C6A A;  4PQX A;  5KND A;  4ZQ3 A;  4BY7 B;  1SNC A;  2XWJ B;  1Q1E A;  2PW5 A;  3U9S A;  5K36 G;  4A3I B;  2IWH A;  2JYO A;  2L4N A;  3QOJ A;  2F0G A;  1CT1 D;  3A8J E;  3AU7 A;  1CA5 A;  1X3Q A;  3GTM B;  2EVB A;  3ITP A;  4MN3 A;  5KNC A;  4UAI A;  2EYM A;  3MXN A;  1AZP A;  3DWQ A;  3H94 A;  4L63 B;  3FDT A;  2A6E D;  2C9O A;  2TSS A;  3Q24 A;  1B3A A;  3M3Y B;  2Q8T A;  4ZRZ A;  4G7Z C;  2JA6 B;  4QUF A;  2KEE A;  2AQ2 B;  2Z1C A;  1JQY D;  1RF2 D;  1JWU D;  2HUG A;  3ND8 A;  1ROD A;  1GXD C;  3NBH A;  3S17 B;  2F1M A;  3K59 A;  4WFN 3;  5ISR A;  2F0V A;  5EKK A;  4K5X A;  3CRL C;  2CQA A;  3JAM E;  2X6G A;  2NUC A;  5EBD A;  4QMG A;  4OHJ A;  4C3I G;  2IX3 A;  2FFK B;  5IGB A;  3D4W A;  3I90 A;  4ODG A;  3MXU A;  3V05 A;  3SEB A;  2WB1 B;  1XYI A;  3WDN A;  2RDF A;  5C3W A;  1NSN S;  2D2C C;  2K33 A;  5BN3 A;  2PW7 A;  5D65 A;  1OXS C;  1DZ1 A;  2RSO A;  1GJX A;  1SJE D;  3PUX A;  1EOT A;  3VR4 A;  5FO9 B;  1F9R A;  1GUN A;  1VF7 A;  3K57 A;  3I72 A;  4DU9 A;  4ZLT F;  4IN3 A;  4J1M A;  2LS0 1;  5DAU A;  3A55 A;  2BDN A;  1HXY D;  1WD0 A;  4RGO S;  3OHX C;  2RDG A;  3MFY A;  1HTL D;  5D3I B;  1OXX K;  5ELD A;  1ZYR C;  1I4Q A;  3SK6 A;  2HDM A;  1I50 B;  1LT3 D;  3F2U A;  4QIW B;  1JC7 A;  2J4X A;  4KJO A;  4XDX A;  3RZD B;  4IUQ A;  4KJN A;  4CKC A;  2KUM A;  2FIN B;  4CJ1 B;  3J81 E;  1S5C D;  1DYQ A;  3M85 A;  4KN7 C;  1U4P A;  1A6X A;  1EY6 A;  4A3F B;  1UUP A;  3IAY A;  4QF4 A;  1QNK A;  4DK1 A;  4RA8 A;  2K04 A;  2AWO A;  1F77 A;  2A68 D;  2F0F A;  1FNU A;  5C0X H;  2NVT B;  3MXP A;  3BVZ A;  3GO5 A;  5JEA H;  1I4X A;  1J8I A;  2ICI A;  1EWC A;  1D5M C;  2C5C A;  2IL8 A;  1ESR A;  4XQQ A;  4EQN A;  1L0X B;  2F0E A;  4LMQ D;  5KIX A;  2KOL A;  3T56 B;  1EY4 A;  1CQV A;  1WTW A;  1DOM A;  2WKC A;  1PZJ D;  4QB4 A;  1QIL A;  3A8K E;  2F4I A;  1S5E D;  1C48 A;  2Z4H A;  3I4N B;  3GTG B;  1SXT A;  1MBY A;  2ICE C;  1D2B A;  2A6H C;  1HCZ A;  3MHB A;  3D6C A;  1WTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...