2LKVA

Staphylococcal nuclease phs variant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Mannosylglycerate stabilizes staphylococcal nuclease with restriction of slow beta-sheet motions.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lkvA00
1STYA 3P1HA 5DAUA 3EVQA 1F2YA 2HQEA 3P75A 4K5VA 1EYDA 3DHQA 4KTAA 1SYCA 2EYFA 4YIJA 2PYKA 1EYCA 2EYJA 1KABA 4QMGA 1SYGA 4HTHA 4KD3A 5JAVA 4KY6A 3BDCA 5JOBA 3TMEA 2F3VA 4ZUJA 5IGEA 2EXZA 5EGTA 2EY5A 5IODA 3HZXA 5HGTA 2RKSA 1STBA 3OWFA 3D4WA 4K5XA 1EY4A 3QB3A 1AEXA 2KHSA 3R3OA 4OL7A 1STGA 3OSOA 2F0FA 1A2UA 1EY8A 5CGKA 3SR1A 1KAAA 3OMGA 3MEHA 2F0OA 5IGGA 4KV6A 4RKBA 5M9OA 5CV7A 2PW7A 4MIUA 1JOKA 5E1FA 1TQOA 3VA5A 1SYBA 3MVVA 5CV9A 1EY6A 5IGCA 2F0UA 5KYLA 4G57A 4ZUIA 2RBMA 3ITPA 4IZ8A 1STNA 5HURA 3T13A 4ID6A 2WACA 2PZTA 3MXPA 3SK8A 2F0MA 2F0JA 4QF4A 5EKLA 2F0LA 3SXHA 5KGUA 1SNQA 3H6MA 1EY9A 4J1MA 3NHHA 4K14A 5E3FA 1NUCA 5K5PA 1STAA 5I9OA 5C5LA 2ENBA 4DGZA 2F0PA 3EROA 4EQOA 5C4ZA 5KYIA 3TP7A 4IUNA 4N9PA 4IALA 3DMUA 3HEJA 1NSNS 4K8IA 2SNMA 5J22A 3TP5A 4DU9A 4EVOA 3RUZA 2F0DA 1EY5A 2F0WA 4KHVA 2F0IA 4F7XA 4PMCA 1SNCA 2EYHA 2O4XA 1KDCA 3C1FA 3S9WA 5CV5A 3NUCA 3SK6A 1A3UA 5IGFA 1A2TA 1ENCA 3V2TA 1EY0A 2EY1A 2F0NA 4B9WA 3SK4A 2EYOA 4B9XA 1SNMA 4ZQ3A 5I6WA 3C1EA 1RKNA 2EYPA 2PZUA 2PQEA 4K8JA 4TRDA 4WRDA 3SHLA 2SNSA 4NMZA 1KDAA 1ENAA 5J39A 1IHZA 3D4DA 3D6CA 2EYMA 2EY6A 4ME5A 3QOJA 2M00A 3D8GA 3U9OA 5CC4A 1TR5A 3T16A 3MHBA 5C4HA 1U9RA 1A3VA 5DEHA 2F0GA 5IOCA 4LAAA 2F0HA 5CV4A 2SOBA 5NUCA 4DF7A 2EYLA 2PZWA 2RDFA 5KRUA 4K6DA 3EJIA 1F2MA 3NK9A 4QB4A 3TP6A 1F2ZA 3QOLA 5J1ZA 4I65A 5I9PA 1SNPA 2PW5A 4NP5A 4HMIA 4F8MA 3PMFA 5IIFA 2F0EA 1EZ8A 3BDLA 1EY7A 5EKKA 1JORA 2EY2A 1A3TA 2LKVA 2OXPA 3LX0A 3NP8A 4KJOA 5IGDA 2F0KA 2F0QA 5F2DA 1JOQA 4N9TA 3TP8A 1SYFA 1JOOA 2F3WA 4KJNA 4KY5A 1SYDA 4H7BA 1EZ6A 2OEOA 5C3WA 1II3A 4J6HA 3NXWA 4DFAA 3ERQA 4K2KA 1SNDA 4NDXA 4PNYA 2F0TA 3E5SA 4KD4A 5C5MA 5IGBA 2QDBA 5ISRA 3NQTA 3OMCA 4K5WA 1SNOA 4ODGA 5C6AA 5KEEA 4EQNA 3MZ5A 4R8NA 4RKLA 4HMJA 4NKLA 1EQVA 3SK5A 4K2LA 4S3SA 2NUCA 1EYAA 2OF1A 4EQPA 5C3XA 1KDBA 2KQ3A 4WORA 2F0VA 1STHA 2F0SA 5CR3A 5KIXA 1SYEA 4KY7A 1TT2A 4PMBA 5CV8A 4E6IA 5CV6A 5I6YA
chains in the Genus database with same CATH superfamily
1F9PA 1K3BC 3KFUA 1HFGA 2PYKA 3I55A 3I4MG 1E2WA 2EXZA 1GHJA 2N55A 3EA6A 2XWBB 3GTQH 2EXDA 4RGNA 2E8GA 4V0BA 1VS0A 3EBEA 4PV1C 5D14A 1PTOH 3VA5A 4CJ1B 2Q2TA 2JA6G 4A76A 1YZ6A 2RBMA 1EWHA 1CSPA 5FLXL 5M5XH 2E2IH 1FGUA 3MFGA 1DM0B 1QUQB 1STAA 3H91A 2QW7A 3C3LA 4N9PA 1GD7A 4IALA 3BVZA 1E3PA 4BBRH 4WJ3M 2I46A 2NVTB 1KLUD 1XTDA 4GN4B 3RUZA 1ICWA 1H9MA 1SMXA 2TSSA 4DNRB 2VQEQ 4DR5L 1KDCA 1PVOA 1CA6A 1LM0A 4YWLA 3I4NH 4C3JH 3BVMA 4OIJA 5JPNC 2H1EA 5GAEC 2VQFL 1IBLL 4B3ML 2AQ1B 3JC66 5J39A 3PO2H 3D4DA 1WTWA 1YNJD 4WFN3 3HG9A 4JOIA 1HCZA 2QDLA 3NBHB 3IFTA 1GUGA 4ZLTF 1Y8NB 5BR8Q 1BCPF 3QR8A 1BDOA 3S1MB 1QE6A 4A3CG 3L3OC 5K36G 1O7ZA 2EY2A 1F9QA 2HD3A 1VQGA 1XNQQ 1FR3A 1IBKL 1AN8A 3J81L 1SYDA 3AYHB 5EQ0A 4R4OA 1PA6A 1CZGA 3RLNA 4DK0A 3NQTA 1SNOA 1QOHA 4JG2A 1N9WA 3MZ5A 5JEAG 4EQPA 4A93G 1I94Q 5C44H 3ERSX 1JWSD 3NEMA 1X32A 1VQOA 1AE2A 3E0JA 4GNXC 1GUNA 3R93A 3J81j 2K6AA 1ENFA 1CM9A 1JR0D 4U68A 5JAVA 2YTYA 3JAMc 1SROA 1C0AA 2NZHA 3EIVA 3T1YQ 3S1NH 2ICEC 5FO8B 3I4MH 2JP1A 1O80A 4DV6L 2Q2HA 2KHSA 5HY6A 1SFOH 2KCNA 1NAPA 3QJYA 1K8AC 1BF4A 4A3GB 2CW0D 2H4OA 4DV1Q 1H95A 1KRSA 3MXPA 1Q90A 4QL5A 2NN6G 2JA6H 1I50B 4K14A 3ICEA 2CH4W 2BE5D 1RJTA 4P75A 1N36Q 5L37A 4DUYL 1G51A 4JI1Q 1VQ7A 3DWAA 1JJ2A 2JK8A 2QKIC 5ELFA 4EVOA 1PH7A 4B3RQ 1G2TA 2F52A 1PRTF 1PRTB 2KUMA 1E7ZA 3J7YW 1HZAA 3TDQA 3AFQA 1HA6A 4DR6Q 3A8JE 5IP7H 1OXVA 1VMPA 1YNJC 3ULJA 3RMHA 1EUJA 1HQRD 5E4WC 2PNRC 1F9SA 1SSOA 3E9HA 1I6VC 4ME3A 1Y1WG 1KRTA 1SJHD 3D8GA 4X3UA 2Q2UA 4H13C 1XNRL 4LAAA 2L5TA 3GP7A 2E2HB 4DA2A 2B63G 1LTRD 4CGYB 4WJWA 1EZ8A 3KLRA 4OX9Q 4B08A 3KLSA 3PQIA 2EPBA 1RF2D 2B2UA 4RMFA 4A3CH 1X3EA 5K36H 4NDXA 5IT9c 3KK7A 4KD4A 3OMCA 1R9TH 1SE8A 1I4HA 1EQVA 1GXDC 4R8IA 1NNXA 2CWPA 1RD9D 1VQBA 1NTGA 3T1HQ 2C9OA 3RZDH 5JEAH 3M4OB 4A93H 3HOXB 3H09A 3W1GA 4DR1Q 2NBFA 2EYFA 5CBEE 4BS9A 4MNOA 4A3BH 3J80i 4G7HC 1LO5D 1V9PA 3OWEB 5IODA 4DUZL 1R4QB 2CW0C 3OSOA 2C35B 3NE5B 5G3LF 2LXKA 1DOLA 4KV6A 3U4VA 2XWJB 4X65L 2KHJA 1XMOQ 4HIOA 1SR3A 1SYBA 3BVGA 1X55A 5IGCA 4KI0A 4ZUIA 3FVQA 4IZ8A 2BE5C 4ID6A 1HTLD 1GJXA 3KBXA 1A15A 1B44D 4XQNA 5H1SE 5K5PA 3R2TA 4Q5VA 1BOSA 4MTNA 4IQZA 5ELDA 4XQJA 2F0PA 2ICIA 2LXJA 2NN6H 4LF5Q 4FXGC 4FF4A 4GN5A 2HCCA 1WTVA 1EY5A 1U4RA 2HUGA 4KHVA 4P71A 3TS2A 2B2UC 2R7FA 2LY7A 2EYHA 2O4XA 1IW7D 3C1FA 2WFWA 4G7OC 5C0XI 2VXWA 2ES2A 1A3UA 5KNCA 1A2TA 4QGUA 4B9WA 3SK4A 3CCMA 3GTKB 3OW2A 2CQOA 2EYPA 4BY1B 1EQQA 1XXGA 1MIUA 4DKAC 4N8FA 1I3QH 3QO2A 2NTTA 1MGSA 1TR5A 3HFZB 3M4PA 5KNBA 4FO2A 1DCZA 2B3GA 3KDFB 3KUPA 3BDOA 1Y1WH 1NE3A 1B9NA 1J9OA 3BU2A 2K03A 2B29A 5EPLA 3PIP3 3TEHB 1KQSA 3GTOB 4IFDG 1EWIA 2EDGA 2X69A 5EKIA 5F2DA 2B63H 1UEAB 2OEOA 2XRSD 1Y8PB 3I91A 1FJGL 1PZJD 3D31A 4HIKA 4DAPA 2RVLA 2HHHL 2L15A 1SDFA 4DR5Q 1JC7A 4DXFA 4UP9A 1EEFD 4LFCL 2D2CC 2R3ZA 3OOCA 4OHJA 4AH6A 2JA5B 5M5YB 3TZDA 1X54A 2IX0A 1UE5A 1STYA 3P1HA 2CVRA 2VQFQ 1IBLQ 1SYCA 3BJUA 4B3MQ 4POFA 3ZYYX 1CKMA 3F2UA 5IGEA 1LUZA 1VDZA 2PQAB 4JBJA 2GA4B 5HGTA 2VUMH 1BCPC 3DM3A 2RHQB 1GUTA 4K5XA 3HOXG 1AEXA 3PF4A 3GTQB 1EY8A 3LGJA 3SR1A 3NENA 2G5DA 3GDEA 4ILWA 1N33L 4M8AA 2LMCB 2WV6D 4LUVA 1IBKQ 3CCEA 1PTOF 1ILPA 3PCOB 1HUMA 4A3MG 4NXML 5M5XB 2E2IB 2PMZE 3NHHA 2PMZB 4MTKA 2I0QA 1MSHA 3ULLA 4ABNA 5D3IB 1B2TA 2VNUD 3HEJA 4ALPA 2XN9C 3HOUG 4X64L 1IW7C 3S2DH 5EBCA 4BBRB 2KEDA 1TXYA 3I90A 4QY7A 3A5UA 3GTPB 1Z7TA 4BA1I 3I4NB 4C3JB 1CKOA 1C8CA 1TS5A 4DV6Q 1RKNA 3PV0A 2PZUA 1WJJA 2Y0SE 4KN7C 1ENAA 1JCKB 1IHZA 2LS01 2Y0SB 2EY6A 1KC8C 3PO2B 2HIXA 1X9NA 5D3DA 3BZKA 3K58A 1L1OA 2F0HA 3A7AB 4RCOA 4RHRA 1PV4A 4YCVA 3J80E 3KJOA 1F2MA 1WTHA 4I65A 2B8FA 4LF7L 4EQ5A 5IYBG 1LT4D 1U4LA 4KJOA 2J4XA 3STBD 2RA4A 4DUYQ 1EFWA 2OWOA 2PPBC 3NQIA 3ERQA 1CKNA 2IW3A 2NZOA 1ZKOA 2KECA 4IFDH 3GTMH 4RKLA 4TVAB 3K6OA 2WINB 4FF3A 2MO1A 1ZEQX 4ZRZA 1LT3D 3K8AA 1E22A 1PZID 5CR3A 5C44B 2Z9HA 1T5XD 1V8QA 1LTBD 1TWGH 1EYDA 4HTHA 2JA9A 2YV5A 5T1IA 3F2BA 1VCIA 1XPRA 1XNRQ 4JPBW 3HKZE 3MXNB 4JVZA 3HKZB 3I8ZA 4JI3L 3S1NB 4IURA 4NXNL 4OL7A 2Q8IB 3I4MB 1A2UA 1D2BA 2F0OA 2PNHA 1A8VA 1SFOB 2PW7A 4PZ6A 2KBNA 3KDFA 1EIFA 4C1NK 3AQQA 3VR2A 5HURA 4B3RL 1WI5A 1CFMA 2JEAI 1JB7A 2JA6B 1I4XA 2YTXA 3TP7A 2K5NA 4A3MH 4YCWA 1QNKA 2B2YA 5J22A 1JE5A 2F0DA 3CMEA 3X3MA 3HOUH 4PZ7A 1HRJA 1C4QA 4QJFA 4XYOA 3CC4A 1IL8A 3Q6SA 3CC2A 4J8QA 2Z6KC 1H9KA 3I56A 4DUZQ 2A1AA 1KDAA 1Y14B 5CC4A 4X65Q 2GVAA 5HGQA 3PSIA 3FHWA 5DEHA 1VQMA 4A75A 1K83B 2SOBA 3T56B 4C3JG 3I4NG 5FJ8G 4H44C 4GOPC 2B8GA 3MXGA 2CWAA 4NP5A 2Y0SG 1EY7A 3D0FA 5EKKA 3NP8A 2WKDA 4DAVA 4JI8L 3PO2G 4N8X1 4CBVA 2KHIA 3B6YA 2K5QA 4N9TA 2M9VA 4DV4L 4KY5A 1EWCA 2YU9H 5EJWA 4H0LC 4J6HA 3QWNA 4O1NA 3T53B 4C2MH 4B3SL 1LYLA 5IYBH 3HOWG 4CKEA 1ASZA 2NVQH 3FEWX 3SK5A 1XMQL 5LL6S 2C5CA 4CDCC 3FKIG 4JCVE 1BVSA 3JAML 1SYEA 5CV8A 1CHQD 1RODA 1SN8A 3RZDB 3S2HH 1I4QA 1G91A 3MTSA 4YIJA 1VQJA 4A93B 4RAUC 4DV5L 4QMGA 1WFQA 3BDCA 4A3BB 4JC0A 4L6TB 4ZUJA 3U50C 2TMPA 4JYAL 5C44G 1QB5D 3Q24A 2QGQA 1STGA 3WOFA 3TQYA 3MEFA 5CGKA 1EOTA 1N32L 2D9UA 5A35A 1SE3A 4DV3L 1JOKA 3SGIA 4HIMA 1KL9A 3AU7A 3C2PA 3SK8A 3K5NA 1X3FA 2L55A 3CF5A 1FJGQ 4A3IH 1MI2A 3HKZG 2CHBD 2K5HA 2HHHQ 4NB3A 4UY8C 3J81i 2EJFC 1EIYB 1VQ5A 4R4IA 4LFCQ 1GUOA 3CMAA 1QVGA 1XTCD 4XQQA 3H0GH 4F88A 4K8IA 3Q0AA 2ALYB 4KKUA 2K33A 2F0WA 2N78A 5FKAC 1FYCA 1YNND 1IKMA 4P74A 2IL8A 1UAPA 4LMQD 3OW7A 4FF2A 3MAQA 3KYHC 2EYOA 2QCPX 3RN2A 2UXBL 3C1EA 1JWMD 1NR4A 3UI2A 4ZKBB 1V1QA 2PQEA 4WRDA 3URYA 2D0PA 4JBMA 4C3IH 4CKCA 3D6CA 1N33Q 4GNXA 3QOJA 5GADC 3T16A 4OGQC 1QZGA 1I3QB 3KF6A 3Q22A 1ICFB 3W3AA 3MXNA 2FHTA 3GV6A 2NVYH 2R7DA 3CCRA 4EX5A 5IP7G 1Y1WB 4NXMQ 3GTPH 2FMCA 1OXUA 3QG1A 1CI3M 5FJ8H 2OCEA 3CQZH 4X64Q 4Y52H 2B63B 3NTIA 1H9JA 1W6JA 5GQOA 4L5TA 5DM63 3HP3A 4NKLA 4ZAIA 3HOWH 2XGTA 1KDBA 2KQ3A 5KIXA 3GTGH 2B2TC 4LFBL 1TT2A 3SHLA 1WTQA 5CV6A 4K5VA 3FKIH 3RLFA 1KAWA 3OHXC 1J6QA 2IX3A 3W1BA 1B3AA 1SYGA 1QJOA 2A68D 3UDXA 1SAPA 2EY5A 3QIAA 1HZ9A 2K05A 2RKSA 3NTHA 3S14H 4ZKCB 2VUMB 3QB3A 4RG1A 3LWUA 4LF7Q 1U4PA 2MHVA 3Q23A 2ID0A 1OXSC 4A3BG 2AKWB 3ITPA 3G6EA 4DXGA 4C1NI 1CK1A 2A5HA 4XXEA 2CFMA 4LW1A 1SNQA 3H6MA 2VZAA 4J1MA 4RGOS 4XYQA 1VQPA 3CXCA 3CRLC 2XNAC 3KLWA 1PYWD 1Y1VG 4RGMA 3DM1A 3AMUA 1YNNC 2HCIA 3SE0A 2JA8G 2IWHA 1M8AA 1D5MC 1SMYD 2I5HA 4IN3A 5KNDA 5FLXE 3S2DB 1V1PA 3HOZG 3GD7A 3J7AF 1RHPA 2K7VA 3NUCA 1S72A 1QG7A 3A56A 4OO1H 1PHJA 2F0NA 1S3OA 2OTLA 1PFMA 1MSGA 3KOJA 4JI3Q 4KMUC 4NXNQ 1VQEA 4R4CA 4KHZA 4FVMA 5IOCA 5CV4A 2BDNA 2PZWA 5GAHC 3K0YA 3TP6A 2FINB 4A3FH 3E9IA 1E24A 1GOZA 1AZQA 1JOQA 1D1KA 1SRUA 4PNYA 2F0TA 1A0IA 1EFID 1K83H 4RGTA 2N8NA 2L0CA 3TSSA 3GTMB 2K1BA 1YIJA 3PUVA 5ELEA 2MQHA 1STHA 3VYRA 5AFWA 1Q8IA 3OIQA 2R61A 3J81E 4HN7A 2A68C 3EVQA 2GVBA 3P75A 4U673 3CKIB 4LF4Q 1TWGB 2A69D 3KF8B 1N8RC 1O7LA 5IY0A 1YJ9A 4FF1A 3D4WA 4GLVB 3S1QH 4OEMB 1EQRA 3H3VI 3EN2A 1CZWA 1CQVA 4RKBA 1BBWA 4A3JG 5CV7A 4MIUA 4JI8Q 2HT1A 3MVVA 1EY6A 2UU9L 3BZCA 4G57A 4DV4Q 1STNA 2F0MA 5M3MG 4B3SQ 1LLRD 4XDXA 2SEBD 2VUMG 1WVLA 1E1OA 4PG3A 1SMYC 4OXPA 5KYIA 1S5BD 1XMQQ 1F77A 4KKSA 3DMUA 1L1OB 3I2ZA 4X3KA 4A3MB 2ATWA 1JJGA 1PFNA 1TWHH 4KHPL 5EAYA 2RSOA 2UXDL 1CTMA 3SEBA 5LMNW 3V05A 1BCPD 1Y1VH 3VYTA 1Q7YC 2JA8H 1HR0W 4Y7NH 2XIWA 4DV5Q 3F2CA 1KXLA 3HOUB 3M4QA 1K8OA 1DJRD 3HOZH 1ENCA 4IUUA 4JYAQ 1HJPA 1CKNB 5IYCH 1SBBB 2JN4A 4ULLA 1Q46A 1ESFA 1S5FD 1U5KA 1YVCA 5E7NA 2O5IC 4NMZA 3TREA 4YCUA 4G4KA 1N32Q 4DV3Q 3CCJA 2R6GA 3TRZA 2UUBL 3WDNA 4K6DA 3L2PA 3M9BA 4CDEC 1PDQA 4I7AA 2FJ2A 1YI2A 1KNEA 1EIGA 3L9AX 1IBML 4AYBE 2RDHA 3IKJA 4AYBB 1LTGD 1CSQA 4QCLA 4LFAL 1II3A 4POGA 4HJ5A 2YU9B 2XRQD 3G4SA 1YNXA 4C2MB 3HOVG 4G7ZC 3P20A 5I4DA 4C3HG 3O13A 4BBSH 5C3EH 2NVQB 4UPAA 2RSNA 2RHSB 5C0XG 3K80C 2A69C 4KY7A 2X6GA 4PMBA 2JA7H 3WOEA 2OTJA 2UXBQ 4OIKA 1GKHA 1DXMA 1TIID 4KTAA 1S5DD 2EYJA 3K7AH 3PUZA 3S2HB 4JI4L 3CP0A 5J3BA 4RCNA 2QF7A 1H9RA 3A55A 5IWAL 3HZXA 5DLQE 2F4VL 3NTKA 1B9MA 3OWFA 4GKKL 1UE6A 4IPGA 4HJ9A 2JEBI 4K6LA 3MEHA 3MA2B 2AHOB 1PRTD 4DN4M 1VQ9A 1W3SA 5CV9A 1TWFB 1EL0A 1TWAH 3OIPA 4UP8A 4A3JH 2B2WC 1SEBD 2VB3X 5ELNA 4J15A 4A3IB 2D0OA 2UUCL 1U0LA 3FMCA 5M3MH 2SDFA 1YJWA 4AQYL 1Q81C 4XT1B 1IZ6A 1RTNA 4LFBQ 3H3VC 3H0GB 4UAIA 1F2LA 3W5OA 2F0IA 4F7XA 3H3VH 4APVA 2DY7A 2KA7A 1PH9A 4JBKA 3EFXD 5CBAE 1BNZA 1HFNA 3N6RA 3OTOL 3SK6A 2F4IA 3PUWA 3V2TA 2EY1A 2WB1E 3ZJYC 1I4GA 3NSWA 4ZQ3A 3K81C 2G9HD 4GN3B 1H9SA 5JJZA 2JE6I 1D5XC 3KF8A 5ELBA 2R92G 1EYGA 1PZKD 2A6HD 3S1RH 1L2FA 3TBIB 4C3IB 1HNWL 2F0GA 4LJZC 1E1TA 2IX1A 1B50A 2RDFA 5I9PA 2NVYB 4BXXG 4HMIA 1LTID 4PZ8A 4JV5L 4L8JA 1SE4A 3CRKC 4HCSA 4DV7Q 4BY7G 1P8LA 1SYFA 1ZYRD 3VR5A 5C3WA 1J8IA 1FNWA 3CQZB 1B1ZA 1TVXA 3BYTB 1L0YB 5C6AA 1G291 2HIVA 4HMJA 1XPOA 2ZXRA 4K2LA 1EYAA 2OF1A 3GV3A 3LWEA 2K5VA 5G3LD 4AYBG 1JT8A 4DR4L 3HOWB 3HOVH 4LUOA 5C4XG 4Z9CB 1LTAD 3HKSA 1HHVA 3L7ZC 4C3HH 3AEVA 3GTGB 3H15A 5DAUA 3K59A 1YHAA 2K5DA 5C0XH 3K0XA 3FKIB 4GS3A 5FK9C 4DNTB 1A62A 1YHQA 1K8MA 1D7QA 4A4IA 3RD4A 3S15H 5EGTA 2ZXOA 4DR7L 5AJ3L 4HJ8A 1PRTC 1K73C 1SE2A 2B2VC 5EBDA 2CH4A 3S14B 2Z6KA 3GQBA 2QEXA 1VQHA 5M9OA 4FXKC 2KCTA 5E1FA 1PH2A 1LTLA 2OT2A 2VB2X 2VW9A 1AZPA 4KLKA 4YY3L 1O7YA 3IL8A 1ASYA 4GNXB 4RH6A 1W2BA 2ZT9C 4GOPA 1S5ED 3KF6B 4L5RC 2EJMA 4HSPA 5ELOA 5C0XJ 2Z8LA 4DU9A 4OWWB 2DUDA 1NMGA 4A3LG 1LACA 4A3IG 1EU4A 3JAMi 1EIHA 3CHBD 3NWSA 2WIIB 1IL2A 1PMRA 2A6HC 4LWCA 2AMCB 3H0GG 1XWEA 3PIOA 4P73A 4EGVA 3UDFA 1GO3E 1LTTD 4O2DA 2SNSA 1AE3A 5M5WH 4A3KG 4TSSA 1E2VA 1TS3A 4C56C 3PGZA 4KK7A 3J80c 2UU9Q 4DF7A 4B3TL 3FRPB 2R92H 5JVH3 1WTOA 2HQLA 4A3EG 2WB1G 3NK9A 1F2ZA 4IPDA 5J1ZA 1PFBA 1ZYRC 2KCMA 3PMFA 4JI2L 1Q82C 2V4DA 2J0TD 4A3FB 2P5ZX 4IUPA 5M3FH 4C3IG 2Q8RE 2K4KA 4BXXH 1EZ6A 1XPUA 2NTSA 4CJ2C 2E5LL 1CT1D 1Z9FA 5C5MA 4KHPQ 2UXDQ 1SXTA 2AUJD 3PUXA 1SLJA 4LF4L 4BY7H 4ODGA 3TN2A 2A8VA 2E2JH 4X62L 5LL6X 1K3RA 4PQXA 4WORA 1AFPA 1FNVA 1PTOD 1B3QA 2AQ2B 1KNAA 1F2YA 3BS1A 2BH8A 1ET6A 5C4XH 4RFBA 5A2QL 4BA2I 1B4OA 1D8LA 3CCVA 2ZJRA 2UUBQ 1WTPA 2NWGA 2K04A 1M1KC 2BOSA 3I4LA 3RZOH 4R1JA 1V1PB 1UUPA 1BXTA 1X6OA 1IYVA 2F0FA 2KENA 3PO3H 2H5XA 3CCLA 5IGGA 4TQUS 3S1QB 3K5MA 1VQ4A 2BDOA 1IBMQ 4HIDA 4X66L 1MJEA 2AQ3B 4LFAQ 3T13A 2UUAL 5EKLA 2F0LA 2MP1A 1EY9A 3HS0C 4DGZA 3I4OA 5D65A 4CDFC 4LUZA 3D6WA 1VF5C 1WCMH 2R7ZG 2ZTDA 2EVBA 1KIXA 1VQAA 1X56A 2L11A 1TWHB 1ML0D 2L12A 4ZCKA 1SNCA 1TWFH 3R2IA 5GROA 2RCNA 2VS1A 4JI4Q 1Y1VB 2KOLA 1FL0A 3N52A 4F87A 2JA8B 4Y7NB 3NELA 2NZ1D 4IUQA 1U4MA 4A3LH 1GVPA 5IWAQ 1VQNA 1NMFA 2F4VQ 2ZTCA 1VQLA 3CPFA 3HOZB 3S16B 2KJXA 5IP9H 4GKKQ 4IUVA 4K8JA 1YITA 2B2TA 4DR2L 1GUSA 4BWGB 3J7AV 3TZUA 1TWCH 2UXCQ 4DNIA 3RN5A 3KLSX 3M7NA 4OO1G 4QB4A 2ASBA 2K32A 1VQIA 4A3KH 2WAQE 4OELB 1WYDA 2WAQB 2UUCQ 3ER0A 4A3EH 3GO5A 4CJ0B 2F0KA 1K0SA 4AQYQ 2YYZA 3DUZA 2N88A 2JQOA 2Z1CA 1SNDA 1DYQA 4A3DG 1PH4A 2FXQA 1Y8OB 4K5WA 3MC0B 3A8IE 1VQ6A 3M4YA 4R8NA 2O2LD 1PTOC 3OTOQ 4A3FG 1I6HH 4IPHA 4BBSB 5A2QE 5C3EB 1K28A 5LMUQ 5IT9L 4FNFA 2JA7B 3F1ZA 3DHQA 1M90C 3KJPA 1EYCA 1OXTA 1TU2B 1Y69U 2K50A 2Q2IA 3TMEA 3K7AB 3CU7A 1HNWQ 4QUFA 5LHY1 3JAME 1VMCA 4GLXA 3RR5A 1OXXK 3F8TA 5GAGC 2E2DC 2L1BA 1KAAA 2R93H 2V1CC 4IOAA 4JV5Q 1JQYD 1Q8KA 4DAMA 4HR7B 1IKLA 4MN3A 1VQCA 2Z6BA 3A54A 1TWAB 1V43A 4QF4A 4YHHL 1BR9A 3SXHA 2M2LA 4A3JB 3UDGA 3HOYH 2GN5A 4KN4C 5C4ZA 2ENBA 2AUKA 3A0JA 1UE7A 3NPPA 1E0BA 4DR4Q 5M3MB 4FDBA 1TS4A 2NYZD 4R4TA 2MUYA 2K75A 4LF6L 3A8KE 4JI6L 1BCPB 4PMCA 3I70A 3ND9A 2HDLA 2R7ZH 3MFYA 4DR7Q 5AJ3Q 4OWTB 3F2DA 3CC7A 1UEBA 2PI2E 3G6JB 2RQXA 3W2DA 1C9OA 3MXUA 4DV7L 2EYMA 4R4QA 1Q1BA 3MHBA 4UDUC 4YWMA 1U9RA 3S1RB 1BQQT 3E0EA 5BN4A 2EYLA 4YY3Q 1MKHA 1YBYA 4FP5D 4JI7L 5IYCG 1X3PA 1PXUA 1XX8A 1JORA 1A3TA 5IGDA 2DJGC 2NN6I 3DLLA 1HNXL 3UDIA 2EOTA 1FD7D 3E5SA 5CYUA 2QDBA 4MHEA 1PH3A 5IT9E 2B39A 4CHTB 4EQNA 1A63A 2WAQG 3FPPA 3J7ZC 1WTRA 3IFDA 5C3XA 4S3SA 1AP0A 2E76C 1G6PA 1ILQA 4A3DH 1LABA 4X3SA 4JW0A 2AWNA 2NVXH 1FGBD 2ZM6L 3HOVB 1V1OA 4JOIC 4C3HB 2QEJC 2ZXPA 1EU3A 1HPCA 4KD3A 2F1MA 3I7FA 4BBSG 2WP8J 5C3EG 3OYYA 2VY3A 4B3TQ 3GTLH 3S15B 5I2YA 3BG3A 4L5SA 3U4ZA 1QVFA 2JA7G 5C4JH 1QVCA 4JI2Q 1I4RA 3VA7A 4IPCA 1G2SA 4JI0L 1ET9A 1TQOA 1TY0A 2K28A 5JJKA 4DV2L 1LT5D 4X3TA 1JWUD 3FP9A 3PUYA 2K14A 4FXDA 2E5LQ 2DY8A 1H9SB 4L63B 5CMDA 1D1IA 1NY4A 5DM73 5KGUA 1TY2A 5E3FA 1UNSA 4X62Q 3NWTA 5JVG3 5FOBB 2MO0A 3V96A 2LSSA 3DWPA 1NSNS 5FLXc 1B8AA 1FNUA 1G6ZA 1T9HA 1J5EL 3R8BA 4DR3L 1KD1C 4XTCS 3G7LA 4PMWA 3X3NA 3H94A 1JJCB 4R9WA 5CV5A 3S9WA 2K01A 2JYOA 3BZDB 4DK1A 4B9XA 2N49A 3S17H 1DD2A 1QUQA 3IRBA 1CHPD 1Q1EA 2Z4IA 1S40A 5C4HA 2Z0SA 4NW2A 1A3VA 3I3CA 3VYUA 2XVSA 1VQFA 4X66Q 5M5WB 2UUAQ 4JI5L 1QNUA 1QCBD 2R92B 3CCQA 2DNCA 3IAYA 2QA4A 4DPGA 3GTJH 2K52A 4DV0L 4IOCA 3S16H 2X6LA 1D6EC 3DEPA 3TP8A 2N3SA 5M3FB 5LMNL 3HGBA 1EEID 2DN8A 1JE4A 3OPOA 3PIPA 1HR0L 3UE0A 2F3IA 2BA0A 5KEEA 2BH2A 1S4ZA 3ONAB 1UE1A 3AFPA 1ESRA 3D3RA 4BY7B 3VDYA 2B2WA 1MJCA 1VQDA 2NUCA 2E2JB 1CUKA 2A73B 3J81c 3A7LA 2OQKA 2F0VA 5COYA 3VR4A 3NBHA 1IYJB 1NBWA 3FPUB 3M85A 2K5WA 4DR2Q 3M3YB 4GOPB 2MPMA 5EPJA 5JEAJ 1Q86C 1C48A 5C4XB 4A3GG 1N34L 1HNZL 4GZYC 1B70B 1STBA 1TS2A 4GKJL 1XYIA 1EOVA 3RZOB 2PI2A 4I7ZC 4LF8L 2Z4HA 1WTXA 3E3XA 4K0KL 3PO3B 3L0OA 2F0UA 1O78A 4O42A 3FDTA 2PZTA 3D4RA 4HEDA 1YEZA 4DAYB 3CCSA 3M7GA 1IYUA 2G9DA 4O0AA 1NUCA 4UHVA 1NJIC 4IFDI 5BN5A 4EQOA 3U58A 1YJNA 1L0WA 1MD2D 4IUNA 2NVTH 4IJLA 2IT1A 1X3GA 3KBGA 4FYDA 2FFKB 2SNMA 4HCEA 1BBXC 2IHFA 1QWYA 1WCMB 2J7ZA 3VR3A 4LF9L 2MGSA 1QILA 4LK1C 2UXCL 2RDGA 1HA5A 4CDDC 3WWVA 1EY0A 4TKOB 5FLMG 3J80L 2DNEA 1RIPA 1PH6A 1CQFA 1MHWC 2KCCA 5JJIA 3S24A 3U9OA 3I72A 1K9MC 2JJQA 2E74C 1GHKA 2JXMB 3E6ZX 5E4XA 3C46A 1TWCB 4YWKA 1VF7A 2D5DA 4DK6C 1DGSA 4YHHQ 3ND8A 3DEOA 4ZK9B 3S1MH 4QIWE 1O7IA 4QIWB 1SNPA 2PW5A 4HJ7A 2OQ0A 1G8ZD 4IJHA 5IIFA 5IYDG 2CKZB 2PCFB 2LKVA 5BN3A 4A3KB 2B2VA 1JICA 2XTIA 1WD0A 1RL2A 5LMUL 5JPMC 2F0QA 1JOOA 2F3WA 4A3EB 2WB1B 4H7BA 3CCUA 5IGBA 4QQBX 1JMCA 4LF6Q 1S5CD 2A6ED 3K5OA 1VQKA 4JI6Q 4AIMA 2E75C 4X6AH 4HAEA 5FO7B 2IHEA 1I6HB 2D62A 4XT3B 5M3FG 2WKCA 1PTOB 3K57A 3NBIA 2VQEL 4CKBA 1KABA 4JK1C 1BUVT 1LTSD 4RA8A 1YHBA 1DONA 1DOMA 1QZHA 1X65A 1EY4A 3CD6A 1Q3LA 1W6KA 2EZVA 4A3GH 4JI7Q 3DXJC 1RTOA 3OMGA 1K0RA 2R93B 5KYLA 1HQMC 1Q12A 1HNXQ 4LNQA 2WACA 1I50H 5BR8L 1AH9A 1NR2A 4JBWA 1A6XA 4UP7A 3DWQA 5C5LA 3PO3G 3HOYB 1XNQL 4RWSC 2A19A 1T5EA 2EQSA 5T1GA 2ZM6Q 3TP5A 3U9SA 3G71A 1ONLA 4BY1G 1M4VA 3T51B 1I94L 4P72A 2R7ZB 1AW7A 1PH1A 4DK3C 1GM5A 2RF4A 2A74C 1RCVD 1F9RA 1WCMG 1X3QA 3AB9A 1E2ZA 2I5LX 5FLMH 2I5MX 2DJFC 4ME5A 2M00A 1LV9A 4JI0Q 2MNAA 4OWXB 1EQTA 4DV2Q 1I5FA 3T1YL 2E2HH 1MBYA 1BKBA 5KRUA 4P2CB 2AWOA 1B7YB 4F8MA 3EJIA 1PH5A 3QOLA 2ZJPA 1ZXTA 1WOCA 3P7JA 1JB3A 5IP9G 2F0EA 3CW2C 3LX0A 2OXPA 3K5LA 1PFSA 1L0XB 2EE1A 4RHSA 5CORA 2A6EC 4DV1L 3RLOA 1Z6HA 1KLGD 1IXRA 4KJNA 1OO9B 2BA1A 4DAYA 1BO0A 4K2KA 1K8GA 4KKTA 2JA5G 5IYDH 2KEEA 2BCOA 2LFNA 1J5EQ 2O5JC 4DR3Q 2CQAA 1FVIA 2NB0A 4GLAC 3TS0A 1N36L 4JI1L 4IFDJ 3M4OH 3HOXH 3A74A 4A3DB 2IPKD 5I6YA 1HXYD 3CAMA 2NVXB 2HQEA 1KHIA 5JJLA 1HZCA 1LT6D 1L1OC 3RNUA 4KY6A 5JOBA 3VR6A 4XIGS 1BBUA 2F3VA 2RCFA 4DR6L 4WJ4A 3SDZA 2EIFA 2DGYA 2ZTEA 4JI5Q 4IUTA 2ZJQA 2EJGC 3GTLB 3R3OA 1CA5A 1DZ1A 4QUCA 1NCVA 2L4NA 5C4JB 4DV0Q 3LNNA 4ZYSA 4IO9A 4H02A 5IE8A 1Z47A 5LMNQ 5TSSA 1B53A 2F0JA 3M3YH 1HR0Q 4BBRG 1HZBA 1HH2P 1P16A 4OONA 1RDPD 2MFIA 4M1UB 3PF5A 2FMMA 5I9OA 4OX9L 1PH8A 3EROA 3UE1A 1STEA 3MWYW 1VQ8A 2R93G 1PYSB 2IY5B 2PQAA 5I2XA 3I73A 2IJ0A 1I4PA 1D5ZC 2YTVA 3STBC 3BYYB 1OTCA 3EQLC 3PIO3 1WD1A 2Q8TA 3ULPA 3HOYG 2PO4A 2MJ8A 5IGFA 3T1HL 3GTKH 1C7YA 5ELCA 1N34Q 2KVMA 1HNZQ 4L5QA 4V190 4BY1H 1PYBA 1SNMA 1R4PB 5I6WA 4GKJQ 4HJAA 4LF8Q 4DR1L 4TRDA 3SVMA 3K7UC 3J7A5 3S17B 3HRZC 4K0KQ 1HUNA 1R9TB 2F03A 2XSCA 5NUCA 3T4AC 1XJVA 4MZ9A 2VL6A 4Q0FA 1UWVA 4NPSA 2QILA 5DNFA 2B2YC 3GTOH 3BDLA 1KTKA 2CCZA 1XMOL 1PLFA 2HDMA 3CPWA 3GTJB 3A5ZB 1GUWA 2I07B 3NXWA 1TKWB 3Q8DA 4DFAA 1HTPA 1SJED 5ISRA 4LF9Q 1DOKA 3G48A 5EPKA 4LF5L 5FO9B 5M5YH 2JA5H 3VYSA 2F0SA 2L9HA 4E6IA 4OO1I 4HSVA 2JSOA
chains in the Genus database with same CATH topology
1F9PA 1HFGA 2PYKA 1E2WA 2EXZA 1GHJA 2N55A 3EA6A 2XWBB 4RGNA 4V0BA 4CJ1B 4PV1C 3VA5A 1PTOH 5D14A 2RBMA 1EWHA 5FLXL 3MFGA 1DM0B 1STAA 3H91A 3C3LA 4N9PA 4IALA 3BVZA 2I46A 2NVTB 1KLUD 3RUZA 1ICWA 1H9MA 4DNRB 2TSSA 1KDCA 1CA6A 3BVMA 4OIJA 5JPNC 2H1EA 2AQ1B 5J39A 3D4DA 1WTWA 1YNJD 4WFN3 3HG9A 1HCZA 3IFTA 1GUGA 4ZLTF 1Y8NB 1BCPF 1BDOA 3S1MB 1QE6A 3L3OC 5K36G 1O7ZA 2EY2A 1F9QA 1FR3A 1AN8A 3J81L 1SYDA 5EQ0A 1CZGA 4DK0A 3NQTA 1SNOA 1QOHA 3MZ5A 5JEAG 4EQPA 1JWSD 1X32A 3E0JA 1GUNA 3R93A 2K6AA 1ENFA 1CM9A 1JR0D 4U68A 5JAVA 2ICEC 5FO8B 2JP1A 1O80A 2KHSA 2KCNA 1NAPA 3QJYA 1BF4A 4A3GB 2CW0D 2H4OA 3MXPA 1Q90A 2NN6G 1I50B 4K14A 2BE5D 1RJTA 3DWAA 2QKIC 5ELFA 4EVOA 1G2TA 1PRTF 1PRTB 2KUMA 3J7YW 3TDQA 1HA6A 3A8JE 1OXVA 1VMPA 1YNJC 3RMHA 1HQRD 5E4WC 2PNRC 1F9SA 1SSOA 1I6VC 1SJHD 3D8GA 4X3UA 4H13C 4LAAA 2L5TA 3GP7A 2E2HB 4DA2A 1LTRD 4CGYB 4WJWA 1EZ8A 3KLRA 4B08A 3KLSA 2EPBA 1RF2D 2B2UA 5K36H 4NDXA 3KK7A 4KD4A 3OMCA 1I4HA 1EQVA 1GXDC 4R8IA 1RD9D 2C9OA 5JEAH 3M4OB 3HOXB 3H09A 2NBFA 2EYFA 5CBEE 4BS9A 4G7HC 1LO5D 3OWEB 5IODA 1R4QB 2CW0C 3OSOA 3NE5B 5G3LF 1DOLA 4KV6A 2XWJB 1SYBA 3BVGA 5IGCA 4KI0A 4ZUIA 3FVQA 4IZ8A 2BE5C 4ID6A 1HTLD 1GJXA 3KBXA 1A15A 1B44D 4XQNA 5K5PA 3R2TA 4Q5VA 1BOSA 5ELDA 4IQZA 4XQJA 2F0PA 2ICIA 2NN6H 4FXGC 4FF4A 2HCCA 1WTVA 1EY5A 1U4RA 2HUGA 4KHVA 2B2UC 2LY7A 2EYHA 2O4XA 1IW7D 3C1FA 4G7OC 5C0XI 2VXWA 1A3UA 5KNCA 1A2TA 4B9WA 3SK4A 3GTKB 2EYPA 4BY1B 1XXGA 3QO2A 2NTTA 1MGSA 1TR5A 5KNBA 4FO2A 1DCZA 3KUPA 3BDOA 1B9NA 1J9OA 2K03A 5EPLA 3PIP3 3GTOB 4IFDG 2EDGA 2X69A 5EKIA 5F2DA 1UEAB 2OEOA 2XRSD 1Y8PB 3I91A 1PZJD 3D31A 4DAPA 2RVLA 1SDFA 1JC7A 4DXFA 1EEFD 2D2CC 2R3ZA 3OOCA 4OHJA 2JA5B 5M5YB 3TZDA 2IX0A 1STYA 3P1HA 2CVRA 1SYCA 3ZYYX 3F2UA 5IGEA 1VDZA 2GA4B 5HGTA 1BCPC 1GUTA 4K5XA 1AEXA 3GTQB 1EY8A 3SR1A 4ILWA 4M8AA 2LMCB 2WV6D 1PTOF 1ILPA 1HUMA 5M5XB 2E2IB 3NHHA 2PMZB 1MSHA 1B2TA 4ABNA 5D3IB 2VNUD 3HEJA 2XN9C 1IW7C 5EBCA 4BBRB 2KEDA 3I90A 3GTPB 1Z7TA 4BA1I 3I4NB 4C3JB 1C8CA 1TS5A 1RKNA 3PV0A 2PZUA 4KN7C 1ENAA 1JCKB 1IHZA 2LS01 2Y0SB 2EY6A 3PO2B 5D3DA 3K58A 2F0HA 3A7AB 4RCOA 4RHRA 3J80E 1F2MA 4I65A 2B8FA 1LT4D 1U4LA 4KJOA 2J4XA 2RA4A 2PPBC 3NQIA 3ERQA 2IW3A 1ZKOA 2KECA 4IFDH 4RKLA 3K6OA 2WINB 4FF3A 1ZEQX 4ZRZA 1LT3D 1PZID 5CR3A 5C44B 1T5XD 1V8QA 1LTBD 1EYDA 4HTHA 5T1IA 1VCIA 3HKZB 3I8ZA 3S1NB 4IURA 4OL7A 2Q8IB 3I4MB 1A2UA 1D2BA 2F0OA 1SFOB 2PW7A 4C1NK 5HURA 3VR2A 1CFMA 2JEAI 2JA6B 1I4XA 3TP7A 1QNKA 2B2YA 5J22A 2F0DA 3X3MA 1HRJA 1C4QA 4XYOA 1IL8A 3Q6SA 4J8QA 1H9KA 1KDAA 5CC4A 5DEHA 1K83B 2SOBA 3T56B 4C3JG 4H44C 2B8GA 3MXGA 4NP5A 1EY7A 5EKKA 3NP8A 2WKDA 4DAVA 4CBVA 2K5QA 4N9TA 2M9VA 4KY5A 1EWCA 5EJWA 4H0LC 4J6HA 3QWNA 4O1NA 3T53B 4CKEA 3FEWX 3SK5A 5LL6S 2C5CA 3JAML 1SYEA 5CV8A 1RODA 1CHQD 3RZDB 1G91A 1I4QA 3MTSA 4YIJA 4A93B 4RAUC 4QMGA 3BDCA 4A3BB 4L6TB 4ZUJA 2TMPA 1QB5D 3Q24A 1STGA 3WOFA 5CGKA 1EOTA 2D9UA 5A35A 1SE3A 1JOKA 3AU7A 3C2PA 3SK8A 3K5NA 2L55A 1MI2A 2CHBD 2EJFC 1GUOA 1XTCD 4XQQA 4F88A 4K8IA 3Q0AA 4KKUA 2K33A 2F0WA 5FKAC 1FYCA 1YNND 1IKMA 2IL8A 1UAPA 4LMQD 3OW7A 4FF2A 3MAQA 2EYOA 2QCPX 3C1EA 1JWMD 1NR4A 3UI2A 4ZKBB 2PQEA 3URYA 4WRDA 4CKCA 3D6CA 3QOJA 3T16A 4OGQC 1I3QB 3Q22A 3W3AA 3MXNA 2FHTA 3GV6A 1Y1WB 2FMCA 1OXUA 3QG1A 1CI3M 2B63B 3NTIA 1H9JA 1W6JA 5DM63 3HP3A 4NKLA 4ZAIA 1KDBA 2KQ3A 5KIXA 2B2TC 1TT2A 3SHLA 1WTQA 5CV6A 4K5VA 3RLFA 3OHXC 2IX3A 1B3AA 1SYGA 1QJOA 2A68D 1SAPA 2EY5A 3QIAA 2K05A 2RKSA 3NTHA 4ZKCB 2VUMB 3QB3A 3LWUA 1U4PA 2MHVA 3Q23A 2ID0A 1OXSC 3ITPA 4DXGA 4C1NI 1CK1A 2A5HA 4XXEA 1SNQA 3H6MA 4J1MA 4RGOS 4XYQA 3CRLC 2XNAC 4RGMA 1PYWD 3DM1A 3AMUA 1YNNC 2HCIA 3SE0A 2IWHA 1M8AA 1D5MC 1SMYD 4IN3A 5KNDA 5FLXE 3S2DB 1V1PA 3GD7A 3J7AF 1RHPA 2K7VA 3NUCA 1QG7A 3A56A 4OO1H 2F0NA 1PFMA 1MSGA 4KMUC 4KHZA 4FVMA 5IOCA 5CV4A 2BDNA 2PZWA 3K0YA 3TP6A 2FINB 1GOZA 1AZQA 1JOQA 1D1KA 4PNYA 2F0TA 1EFID 4RGTA 3GTMB 2L0CA 3TSSA 2K1BA 3PUVA 5ELEA 1STHA 3VYRA 5AFWA 1Q8IA 3OIQA 2R61A 3J81E 4HN7A 2A68C 3EVQA 3P75A 4U673 3CKIB 1TWGB 2A69D 1O7LA 4FF1A 3D4WA 1CZWA 1CQVA 4RKBA 5CV7A 4MIUA 3MVVA 1EY6A 4G57A 1STNA 2F0MA 1LLRD 4XDXA 2SEBD 1WVLA 1SMYC 5KYIA 1S5BD 1F77A 4KKSA 3DMUA 4X3KA 4A3MB 1PFNA 2RSOA 1CTMA 3SEBA 3V05A 1BCPD 3VYTA 2XIWA 3HOUB 1K8OA 1DJRD 1ENCA 4IUUA 1SBBB 4ULLA 1ESFA 1S5FD 2O5IC 4NMZA 4G4KA 2R6GA 3WDNA 4K6DA 1PDQA 2FJ2A 1KNEA 1EIGA 3L9AX 2RDHA 3IKJA 4AYBB 1LTGD 4QCLA 1II3A 2YU9B 2XRQD 4C2MB 4G7ZC 3P20A 5I4DA 4C3HG 3O13A 2NVQB 2RSNA 5C0XG 2A69C 4KY7A 2X6GA 4PMBA 3WOEA 4OIKA 1DXMA 1TIID 4KTAA 1S5DD 2EYJA 3PUZA 3S2HB 4RCNA 2QF7A 1H9RA 3A55A 3HZXA 3NTKA 1B9MA 3OWFA 2JEBI 4K6LA 3MEHA 3MA2B 1PRTD 4DN4M 5CV9A 1TWFB 1EL0A 3OIPA 2B2WC 1SEBD 2VB3X 4A3IB 3FMCA 2SDFA 4XT1B 1RTNA 3H3VC 3H0GB 4UAIA 1F2LA 2F0IA 4F7XA 2DY7A 2KA7A 3EFXD 5CBAE 1BNZA 1HFNA 3N6RA 3SK6A 2F4IA 3PUWA 3V2TA 2EY1A 1I4GA 3NSWA 4ZQ3A 2G9HD 1H9SA 5JJZA 2JE6I 1D5XC 3KF8A 5ELBA 1PZKD 2A6HD 3TBIB 4C3IB 2F0GA 4LJZC 2IX1A 1B50A 2RDFA 5I9PA 2NVYB 4HMIA 1LTID 4L8JA 1SE4A 3CRKC 4HCSA 1SYFA 1ZYRD 3VR5A 5C3WA 1J8IA 1FNWA 3CQZB 1B1ZA 1TVXA 3BYTB 1L0YB 5C6AA 1G291 4HMJA 2ZXRA 4K2LA 1EYAA 2OF1A 3GV3A 3LWEA 5G3LD 3HOWB 1HHVA 4Z9CB 1LTAD 3L7ZC 3GTGB 5DAUA 3K59A 2K5DA 5C0XH 3FKIB 4DNTB 5FK9C 1K8MA 3RD4A 5EGTA 2ZXOA 1PRTC 1SE2A 2B2VC 5EBDA 3S14B 3GQBA 5M9OA 4FXKC 5E1FA 2OT2A 2VB2X 1AZPA 1O7YA 3IL8A 4RH6A 2ZT9C 1S5ED 2EJMA 4HSPA 5C0XJ 2Z8LA 4DU9A 1LACA 1EU4A 1EIHA 3CHBD 3NWSA 2WIIB 1PMRA 2A6HC 1XWEA 4EGVA 1LTTD 2SNSA 4TSSA 1E2VA 1TS3A 4C56C 4KK7A 4DF7A 3FRPB 5JVH3 1WTOA 3NK9A 1F2ZA 5J1ZA 1PFBA 1ZYRC 3PMFA 2V4DA 2J0TD 4A3FB 4IUPA 4C3IG 2Q8RE 1EZ6A 2NTSA 4CJ2C 1CT1D 5C5MA 1SXTA 2AUJD 3PUXA 4ODGA 3TN2A 5LL6X 4PQXA 4WORA 1AFPA 1PTOD 1FNVA 2AQ2B 1KNAA 1F2YA 3BS1A 1ET6A 4BA2I 4RFBA 5A2QL 1B4OA 1WTPA 2NWGA 2K04A 2BOSA 3I4LA 1V1PB 1UUPA 1BXTA 1IYVA 2F0FA 5IGGA 4TQUS 3S1QB 3K5MA 2BDOA 2AQ3B 3T13A 5EKLA 2F0LA 2MP1A 1EY9A 3HS0C 4DGZA 5D65A 3D6WA 1VF5C 2EVBA 2L11A 1TWHB 1ML0D 2L12A 1SNCA 3R2IA 1Y1VB 2KOLA 4F87A 3N52A 2JA8B 4Y7NB 2NZ1D 4IUQA 1U4MA 3HOZB 3S16B 2KJXA 4IUVA 4K8JA 2B2TA 1GUSA 4BWGB 3J7AV 3TZUA 3KLSX 3M7NA 4OO1G 4QB4A 2K32A 2WAQB 3GO5A 4CJ0B 2F0KA 2YYZA 3DUZA 2N88A 2Z1CA 1SNDA 1DYQA 1Y8OB 4K5WA 3MC0B 3A8IE 3M4YA 4R8NA 2O2LD 1PTOC 4BBSB 5A2QE 5C3EB 5IT9L 4FNFA 2JA7B 3DHQA 1EYCA 1OXTA 1TU2B 1Y69U 3TMEA 3K7AB 3CU7A 4QUFA 5LHY1 3JAME 1VMCA 1OXXK 2E2DC 2L1BA 1KAAA 1JQYD 4HR7B 1IKLA 4MN3A 3A54A 1TWAB 1V43A 4QF4A 1BR9A 3SXHA 2M2LA 4A3JB 4KN4C 5C4ZA 2ENBA 2AUKA 3NPPA 1E0BA 5M3MB 1TS4A 2NYZD 2MUYA 3A8KE 1BCPB 4PMCA 3I70A 3ND9A 2HDLA 3MFYA 3G6JB 2RQXA 3W2DA 3MXUA 2EYMA 1Q1BA 3MHBA 4UDUC 3S1RB 1U9RA 1BQQT 5BN4A 2EYLA 4FP5D 1X3PA 1PXUA 1XX8A 1JORA 1A3TA 5IGDA 2NN6I 2EOTA 1FD7D 3E5SA 5CYUA 2QDBA 4MHEA 5IT9E 2B39A 4CHTB 4EQNA 3FPPA 1WTRA 3IFDA 5C3XA 4S3SA 1AP0A 2E76C 1ILQA 1LABA 4X3SA 2AWNA 1FGBD 3HOVB 1V1OA 4C3HB 2QEJC 2ZXPA 1EU3A 1HPCA 4KD3A 2F1MA 2WP8J 3S15B 5I2YA 3BG3A 1I4RA 3VA7A 1G2SA 1ET9A 1TQOA 1TY0A 2K28A 1LT5D 4X3TA 1JWUD 3PUYA 4FXDA 2DY8A 1H9SB 4L63B 5CMDA 1D1IA 5DM73 5KGUA 1TY2A 5E3FA 1UNSA 3NWTA 5JVG3 5FOBB 3V96A 3DWPA 1NSNS 1FNUA 1G6ZA 3R8BA 4XTCS 3G7LA 4PMWA 3X3NA 3H94A 3S9WA 4R9WA 5CV5A 2K01A 2JYOA 3BZDB 4DK1A 4B9XA 1DD2A 1CHPD 1Q1EA 2Z4IA 5C4HA 4NW2A 1A3VA 3I3CA 3VYUA 2XVSA 5M5WB 1QNUA 1QCBD 2R92B 2DNCA 3IAYA 2X6LA 1D6EC 3DEPA 3TP8A 5M3FB 3HGBA 1EEID 2DN8A 1JE4A 3OPOA 2BA0A 5KEEA 1S4ZA 3ONAB 1ESRA 3D3RA 4BY7B 2B2WA 2NUCA 2E2JB 2A73B 3A7LA 2F0VA 5COYA 3VR4A 3NBHA 3FPUB 3M85A 2K5WA 3M3YB 2MPMA 5EPJA 5JEAJ 1C48A 5C4XB 4GZYC 1STBA 1TS2A 1XYIA 3RZOB 4I7ZC 2Z4HA 1WTXA 3PO3B 2F0UA 1O78A 4O42A 3FDTA 2PZTA 3D4RA 4HEDA 3M7GA 1IYUA 2G9DA 1NUCA 4IFDI 5BN5A 4EQOA 1MD2D 4IUNA 2IT1A 3KBGA 4FYDA 2FFKB 2SNMA 4HCEA 1BBXC 1QWYA 1WCMB 2J7ZA 3VR3A 2MGSA 1QILA 4LK1C 2RDGA 1HA5A 1EY0A 4TKOB 3J80L 2DNEA 1CQFA 2KCCA 3U9OA 3I72A 2E74C 1GHKA 2JXMB 3E6ZX 5E4XA 3C46A 1TWCB 1VF7A 2D5DA 3ND8A 3DEOA 4ZK9B 4QIWB 1SNPA 2PW5A 5IIFA 1G8ZD 2PCFB 2LKVA 5BN3A 4A3KB 2B2VA 1JICA 1WD0A 5JPMC 2F0QA 1JOOA 2F3WA 4A3EB 2WB1B 4H7BA 5IGBA 1S5CD 2A6ED 3K5OA 2E75C 4HAEA 5FO7B 1I6HB 2D62A 4XT3B 2WKCA 1PTOB 3K57A 3NBIA 4CKBA 1KABA 4JK1C 1BUVT 1LTSD 4RA8A 1DONA 1DOMA 1EY4A 1Q3LA 1W6KA 2EZVA 3DXJC 1RTOA 3OMGA 2R93B 5KYLA 1HQMC 1Q12A 2WACA 1NR2A 4JBWA 1A6XA 3DWQA 5C5LA 3HOYB 4RWSC 1T5EA 5T1GA 3TP5A 3U9SA 1ONLA 1M4VA 3T51B 2R7ZB 1AW7A 2A74C 1RCVD 1F9RA 1X3QA 3AB9A 1E2ZA 4ME5A 2M00A 1LV9A 1EQTA 1MBYA 5KRUA 4P2CB 2AWOA 4F8MA 3EJIA 3QOLA 1ZXTA 3P7JA 1JB3A 2F0EA 3LX0A 2OXPA 3K5LA 2EE1A 1L0XB 4RHSA 5CORA 2A6EC 1Z6HA 1KLGD 4KJNA 1OO9B 4DAYA 2BA1A 1BO0A 4K2KA 4KKTA 2KEEA 2BCOA 2LFNA 2O5JC 2CQAA 2NB0A 4IFDJ 4A3DB 2IPKD 5I6YA 1HXYD 2NVXB 2HQEA 1LT6D 4KY6A 5JOBA 3VR6A 4XIGS 2F3VA 3SDZA 4IUTA 2EJGC 3GTLB 3R3OA 1CA5A 1DZ1A 4QUCA 1NCVA 2L4NA 5C4JB 3LNNA 4ZYSA 1Z47A 5TSSA 1B53A 2F0JA 1RDPD 4M1UB 2FMMA 5I9OA 3EROA 1STEA 3MWYW 5I2XA 3I73A 2IJ0A 1I4PA 1D5ZC 3BYYB 3EQLC 3PIO3 1WD1A 2Q8TA 2PO4A 2MJ8A 5IGFA 5ELCA 2KVMA 4V190 1SNMA 1R4PB 5I6WA 4TRDA 3SVMA 3S17B 3HRZC 1HUNA 1R9TB 2F03A 2XSCA 5NUCA 3T4AC 4Q0FA 2QILA 5DNFA 2B2YC 3BDLA 1KTKA 1PLFA 2HDMA 3GTJB 1GUWA 2I07B 3NXWA 1TKWB 4DFAA 1HTPA 1SJED 5ISRA 1DOKA 5EPKA 5FO9B 3VYSA 2F0SA 2L9HA 4E6IA 4OO1I 4HSVA 2JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  3P1H A;  5DAU A;  3EVQ A;  1F2Y A;  2HQE A;  3P75 A;  4K5V A;  1EYD A;  3DHQ A;  4KTA A;  1SYC A;  2EYF A;  4YIJ A;  2PYK A;  1EYC A;  2EYJ A;  1KAB A;  4QMG A;  1SYG A;  4HTH A;  4KD3 A;  5JAV A;  4KY6 A;  3BDC A;  5JOB A;  3TME A;  2F3V A;  4ZUJ A;  5IGE A;  2EXZ A;  5EGT A;  2EY5 A;  5IOD A;  3HZX A;  5HGT A;  2RKS A;  1STB A;  3OWF A;  3D4W A;  4K5X A;  1EY4 A;  3QB3 A;  1AEX A;  2KHS A;  3R3O A;  4OL7 A;  1STG A;  3OSO A;  2F0F A;  1A2U A;  1EY8 A;  5CGK A;  3SR1 A;  1KAA A;  3OMG A;  3MEH A;  2F0O A;  5IGG A;  4KV6 A;  4RKB A;  5M9O A;  5CV7 A;  2PW7 A;  4MIU A;  1JOK A;  5E1F A;  1TQO A;  3VA5 A;  1SYB A;  3MVV A;  5CV9 A;  1EY6 A;  5IGC A;  2F0U A;  5KYL A;  4G57 A;  4ZUI A;  2RBM A;  3ITP A;  4IZ8 A;  1STN A;  5HUR A;  3T13 A;  4ID6 A;  2WAC A;  2PZT A;  3MXP A;  3SK8 A;  2F0M A;  2F0J A;  4QF4 A;  5EKL A;  2F0L A;  3SXH A;  5KGU A;  1SNQ A;  3H6M A;  1EY9 A;  4J1M A;  3NHH A;  4K14 A;  5E3F A;  1NUC A;  5K5P A;  1STA A;  5I9O A;  5C5L A;  2ENB A;  4DGZ A;  2F0P A;  3ERO A;  4EQO A;  5C4Z A;  5KYI A;  3TP7 A;  4IUN A;  4N9P A;  4IAL A;  3DMU A;  3HEJ A;  1NSN S;  4K8I A;  2SNM A;  5J22 A;  3TP5 A;  4DU9 A;  4EVO A;  3RUZ A;  2F0D A;  1EY5 A;  2F0W A;  4KHV A;  2F0I A;  4F7X A;  4PMC A;  1SNC A;  2EYH A;  2O4X A;  1KDC A;  3C1F A;  3S9W A;  5CV5 A;  3NUC A;  3SK6 A;  1A3U A;  5IGF A;  1A2T A;  1ENC A;  3V2T A;  1EY0 A;  2EY1 A;  2F0N A;  4B9W A;  3SK4 A;  2EYO A;  4B9X A;  1SNM A;  4ZQ3 A;  5I6W A;  3C1E A;  1RKN A;  2EYP A;  2PZU A;  2PQE A;  4K8J A;  4TRD A;  4WRD A;  3SHL A;  2SNS A;  4NMZ A;  1KDA A;  1ENA A;  5J39 A;  1IHZ A;  3D4D A;  3D6C A;  2EYM A;  2EY6 A;  4ME5 A;  3QOJ A;  2M00 A;  3D8G A;  3U9O A;  5CC4 A;  1TR5 A;  3T16 A;  3MHB A;  5C4H A;  1U9R A;  1A3V A;  5DEH A;  2F0G A;  5IOC A;  4LAA A;  2F0H A;  5CV4 A;  2SOB A;  5NUC A;  4DF7 A;  2EYL A;  2PZW A;  2RDF A;  5KRU A;  4K6D A;  3EJI A;  1F2M A;  3NK9 A;  4QB4 A;  3TP6 A;  1F2Z A;  3QOL A;  5J1Z A;  4I65 A;  5I9P A;  1SNP A;  2PW5 A;  4NP5 A;  4HMI A;  4F8M A;  3PMF A;  5IIF A;  2F0E A;  1EZ8 A;  3BDL A;  1EY7 A;  5EKK A;  1JOR A;  2EY2 A;  1A3T A;  2LKV A;  2OXP A;  3LX0 A;  3NP8 A;  4KJO A;  5IGD A;  2F0K A;  2F0Q A;  5F2D A;  1JOQ A;  4N9T A;  3TP8 A;  1SYF A;  1JOO A;  2F3W A;  4KJN A;  4KY5 A;  1SYD A;  4H7B A;  1EZ6 A;  2OEO A;  5C3W A;  1II3 A;  4J6H A;  3NXW A;  4DFA A;  3ERQ A;  4K2K A;  1SND A;  4NDX A;  4PNY A;  2F0T A;  3E5S A;  4KD4 A;  5C5M A;  5IGB A;  2QDB A;  5ISR A;  3NQT A;  3OMC A;  4K5W A;  1SNO A;  4ODG A;  5C6A A;  5KEE A;  4EQN A;  3MZ5 A;  4R8N A;  4RKL A;  4HMJ A;  4NKL A;  1EQV A;  3SK5 A;  4K2L A;  4S3S A;  2NUC A;  1EYA A;  2OF1 A;  4EQP A;  5C3X A;  1KDB A;  2KQ3 A;  4WOR A;  2F0V A;  1STH A;  2F0S A;  5CR3 A;  5KIX A;  1SYE A;  4KY7 A;  1TT2 A;  4PMB A;  5CV8 A;  4E6I A;  5CV6 A;  5I6Y A; 
#chains in the Genus database with same CATH topology
 1F9P A;  1K3B C;  3KFU A;  1HFG A;  2PYK A;  3I55 A;  3I4M G;  1E2W A;  2EXZ A;  1GHJ A;  2N55 A;  3EA6 A;  2XWB B;  3GTQ H;  2EXD A;  4RGN A;  2E8G A;  4V0B A;  1VS0 A;  3EBE A;  4PV1 C;  5D14 A;  1PTO H;  3VA5 A;  4CJ1 B;  2Q2T A;  2JA6 G;  4A76 A;  1YZ6 A;  2RBM A;  1EWH A;  1CSP A;  5FLX L;  5M5X H;  2E2I H;  1FGU A;  3MFG A;  1DM0 B;  1QUQ B;  1STA A;  3H91 A;  2QW7 A;  3C3L A;  4N9P A;  1GD7 A;  4IAL A;  3BVZ A;  1E3P A;  4BBR H;  4WJ3 M;  2I46 A;  2NVT B;  1KLU D;  1XTD A;  4GN4 B;  3RUZ A;  1ICW A;  1H9M A;  1SMX A;  2TSS A;  4DNR B;  2VQE Q;  4DR5 L;  1KDC A;  1PVO A;  1CA6 A;  1LM0 A;  4YWL A;  3I4N H;  4C3J H;  3BVM A;  4OIJ A;  5JPN C;  2H1E A;  5GAE C;  2VQF L;  1IBL L;  4B3M L;  2AQ1 B;  3JC6 6;  5J39 A;  3PO2 H;  3D4D A;  1WTW A;  1YNJ D;  4WFN 3;  3HG9 A;  4JOI A;  1HCZ A;  2QDL A;  3NBH B;  3IFT A;  1GUG A;  4ZLT F;  1Y8N B;  5BR8 Q;  1BCP F;  3QR8 A;  1BDO A;  3S1M B;  1QE6 A;  4A3C G;  3L3O C;  5K36 G;  1O7Z A;  2EY2 A;  1F9Q A;  2HD3 A;  1VQG A;  1XNQ Q;  1FR3 A;  1IBK L;  1AN8 A;  3J81 L;  1SYD A;  3AYH B;  5EQ0 A;  4R4O A;  1PA6 A;  1CZG A;  3RLN A;  4DK0 A;  3NQT A;  1SNO A;  1QOH A;  4JG2 A;  1N9W A;  3MZ5 A;  5JEA G;  4EQP A;  4A93 G;  1I94 Q;  5C44 H;  3ERS X;  1JWS D;  3NEM A;  1X32 A;  1VQO A;  1AE2 A;  3E0J A;  4GNX C;  1GUN A;  3R93 A;  3J81 j;  2K6A A;  1ENF A;  1CM9 A;  1JR0 D;  4U68 A;  5JAV A;  2YTY A;  3JAM c;  1SRO A;  1C0A A;  2NZH A;  3EIV A;  3T1Y Q;  3S1N H;  2ICE C;  5FO8 B;  3I4M H;  2JP1 A;  1O80 A;  4DV6 L;  2Q2H A;  2KHS A;  5HY6 A;  1SFO H;  2KCN A;  1NAP A;  3QJY A;  1K8A C;  1BF4 A;  4A3G B;  2CW0 D;  2H4O A;  4DV1 Q;  1H95 A;  1KRS A;  3MXP A;  1Q90 A;  4QL5 A;  2NN6 G;  2JA6 H;  1I50 B;  4K14 A;  3ICE A;  2CH4 W;  2BE5 D;  1RJT A;  4P75 A;  1N36 Q;  5L37 A;  4DUY L;  1G51 A;  4JI1 Q;  1VQ7 A;  3DWA A;  1JJ2 A;  2JK8 A;  2QKI C;  5ELF A;  4EVO A;  1PH7 A;  4B3R Q;  1G2T A;  2F52 A;  1PRT F;  1PRT B;  2KUM A;  1E7Z A;  3J7Y W;  1HZA A;  3TDQ A;  3AFQ A;  1HA6 A;  4DR6 Q;  3A8J E;  5IP7 H;  1OXV A;  1VMP A;  1YNJ C;  3ULJ A;  3RMH A;  1EUJ A;  1HQR D;  5E4W C;  2PNR C;  1F9S A;  1SSO A;  3E9H A;  1I6V C;  4ME3 A;  1Y1W G;  1KRT A;  1SJH D;  3D8G A;  4X3U A;  2Q2U A;  4H13 C;  1XNR L;  4LAA A;  2L5T A;  3GP7 A;  2E2H B;  4DA2 A;  2B63 G;  1LTR D;  4CGY B;  4WJW A;  1EZ8 A;  3KLR A;  4OX9 Q;  4B08 A;  3KLS A;  3PQI A;  2EPB A;  1RF2 D;  2B2U A;  4RMF A;  4A3C H;  1X3E A;  5K36 H;  4NDX A;  5IT9 c;  3KK7 A;  4KD4 A;  3OMC A;  1R9T H;  1SE8 A;  1I4H A;  1EQV A;  1GXD C;  4R8I A;  1NNX A;  2CWP A;  1RD9 D;  1VQB A;  1NTG A;  3T1H Q;  2C9O A;  3RZD H;  5JEA H;  3M4O B;  4A93 H;  3HOX B;  3H09 A;  3W1G A;  4DR1 Q;  2NBF A;  2EYF A;  5CBE E;  4BS9 A;  4MNO A;  4A3B H;  3J80 i;  4G7H C;  1LO5 D;  1V9P A;  3OWE B;  5IOD A;  4DUZ L;  1R4Q B;  2CW0 C;  3OSO A;  2C35 B;  3NE5 B;  5G3L F;  2LXK A;  1DOL A;  4KV6 A;  3U4V A;  2XWJ B;  4X65 L;  2KHJ A;  1XMO Q;  4HIO A;  1SR3 A;  1SYB A;  3BVG A;  1X55 A;  5IGC A;  4KI0 A;  4ZUI A;  3FVQ A;  4IZ8 A;  2BE5 C;  4ID6 A;  1HTL D;  1GJX A;  3KBX A;  1A15 A;  1B44 D;  4XQN A;  5H1S E;  5K5P A;  3R2T A;  4Q5V A;  1BOS A;  4MTN A;  4IQZ A;  5ELD A;  4XQJ A;  2F0P A;  2ICI A;  2LXJ A;  2NN6 H;  4LF5 Q;  4FXG C;  4FF4 A;  4GN5 A;  2HCC A;  1WTV A;  1EY5 A;  1U4R A;  2HUG A;  4KHV A;  4P71 A;  3TS2 A;  2B2U C;  2R7F A;  2LY7 A;  2EYH A;  2O4X A;  1IW7 D;  3C1F A;  2WFW A;  4G7O C;  5C0X I;  2VXW A;  2ES2 A;  1A3U A;  5KNC A;  1A2T A;  4QGU A;  4B9W A;  3SK4 A;  3CCM A;  3GTK B;  3OW2 A;  2CQO A;  2EYP A;  4BY1 B;  1EQQ A;  1XXG A;  1MIU A;  4DKA C;  4N8F A;  1I3Q H;  3QO2 A;  2NTT A;  1MGS A;  1TR5 A;  3HFZ B;  3M4P A;  5KNB A;  4FO2 A;  1DCZ A;  2B3G A;  3KDF B;  3KUP A;  3BDO A;  1Y1W H;  1NE3 A;  1B9N A;  1J9O A;  3BU2 A;  2K03 A;  2B29 A;  5EPL A;  3PIP 3;  3TEH B;  1KQS A;  3GTO B;  4IFD G;  1EWI A;  2EDG A;  2X69 A;  5EKI A;  5F2D A;  2B63 H;  1UEA B;  2OEO A;  2XRS D;  1Y8P B;  3I91 A;  1FJG L;  1PZJ D;  3D31 A;  4HIK A;  4DAP A;  2RVL A;  2HHH L;  2L15 A;  1SDF A;  4DR5 Q;  1JC7 A;  4DXF A;  4UP9 A;  1EEF D;  4LFC L;  2D2C C;  2R3Z A;  3OOC A;  4OHJ A;  4AH6 A;  2JA5 B;  5M5Y B;  3TZD A;  1X54 A;  2IX0 A;  1UE5 A;  1STY A;  3P1H A;  2CVR A;  2VQF Q;  1IBL Q;  1SYC A;  3BJU A;  4B3M Q;  4POF A;  3ZYY X;  1CKM A;  3F2U A;  5IGE A;  1LUZ A;  1VDZ A;  2PQA B;  4JBJ A;  2GA4 B;  5HGT A;  2VUM H;  1BCP C;  3DM3 A;  2RHQ B;  1GUT A;  4K5X A;  3HOX G;  1AEX A;  3PF4 A;  3GTQ B;  1EY8 A;  3LGJ A;  3SR1 A;  3NEN A;  2G5D A;  3GDE A;  4ILW A;  1N33 L;  4M8A A;  2LMC B;  2WV6 D;  4LUV A;  1IBK Q;  3CCE A;  1PTO F;  1ILP A;  3PCO B;  1HUM A;  4A3M G;  4NXM L;  5M5X B;  2E2I B;  2PMZ E;  3NHH A;  2PMZ B;  4MTK A;  2I0Q A;  1MSH A;  3ULL A;  4ABN A;  5D3I B;  1B2T A;  2VNU D;  3HEJ A;  4ALP A;  2XN9 C;  3HOU G;  4X64 L;  1IW7 C;  3S2D H;  5EBC A;  4BBR B;  2KED A;  1TXY A;  3I90 A;  4QY7 A;  3A5U A;  3GTP B;  1Z7T A;  4BA1 I;  3I4N B;  4C3J B;  1CKO A;  1C8C A;  1TS5 A;  4DV6 Q;  1RKN A;  3PV0 A;  2PZU A;  1WJJ A;  2Y0S E;  4KN7 C;  1ENA A;  1JCK B;  1IHZ A;  2LS0 1;  2Y0S B;  2EY6 A;  1KC8 C;  3PO2 B;  2HIX A;  1X9N A;  5D3D A;  3BZK A;  3K58 A;  1L1O A;  2F0H A;  3A7A B;  4RCO A;  4RHR A;  1PV4 A;  4YCV A;  3J80 E;  3KJO A;  1F2M A;  1WTH A;  4I65 A;  2B8F A;  4LF7 L;  4EQ5 A;  5IYB G;  1LT4 D;  1U4L A;  4KJO A;  2J4X A;  3STB D;  2RA4 A;  4DUY Q;  1EFW A;  2OWO A;  2PPB C;  3NQI A;  3ERQ A;  1CKN A;  2IW3 A;  2NZO A;  1ZKO A;  2KEC A;  4IFD H;  3GTM H;  4RKL A;  4TVA B;  3K6O A;  2WIN B;  4FF3 A;  2MO1 A;  1ZEQ X;  4ZRZ A;  1LT3 D;  3K8A A;  1E22 A;  1PZI D;  5CR3 A;  5C44 B;  2Z9H A;  1T5X D;  1V8Q A;  1LTB D;  1TWG H;  1EYD A;  4HTH A;  2JA9 A;  2YV5 A;  5T1I A;  3F2B A;  1VCI A;  1XPR A;  1XNR Q;  4JPB W;  3HKZ E;  3MXN B;  4JVZ A;  3HKZ B;  3I8Z A;  4JI3 L;  3S1N B;  4IUR A;  4NXN L;  4OL7 A;  2Q8I B;  3I4M B;  1A2U A;  1D2B A;  2F0O A;  2PNH A;  1A8V A;  1SFO B;  2PW7 A;  4PZ6 A;  2KBN A;  3KDF A;  1EIF A;  4C1N K;  3AQQ A;  3VR2 A;  5HUR A;  4B3R L;  1WI5 A;  1CFM A;  2JEA I;  1JB7 A;  2JA6 B;  1I4X A;  2YTX A;  3TP7 A;  2K5N A;  4A3M H;  4YCW A;  1QNK A;  2B2Y A;  5J22 A;  1JE5 A;  2F0D A;  3CME A;  3X3M A;  3HOU H;  4PZ7 A;  1HRJ A;  1C4Q A;  4QJF A;  4XYO A;  3CC4 A;  1IL8 A;  3Q6S A;  3CC2 A;  4J8Q A;  2Z6K C;  1H9K A;  3I56 A;  4DUZ Q;  2A1A A;  1KDA A;  1Y14 B;  5CC4 A;  4X65 Q;  2GVA A;  5HGQ A;  3PSI A;  3FHW A;  5DEH A;  1VQM A;  4A75 A;  1K83 B;  2SOB A;  3T56 B;  4C3J G;  3I4N G;  5FJ8 G;  4H44 C;  4GOP C;  2B8G A;  3MXG A;  2CWA A;  4NP5 A;  2Y0S G;  1EY7 A;  3D0F A;  5EKK A;  3NP8 A;  2WKD A;  4DAV A;  4JI8 L;  3PO2 G;  4N8X 1;  4CBV A;  2KHI A;  3B6Y A;  2K5Q A;  4N9T A;  2M9V A;  4DV4 L;  4KY5 A;  1EWC A;  2YU9 H;  5EJW A;  4H0L C;  4J6H A;  3QWN A;  4O1N A;  3T53 B;  4C2M H;  4B3S L;  1LYL A;  5IYB H;  3HOW G;  4CKE A;  1ASZ A;  2NVQ H;  3FEW X;  3SK5 A;  1XMQ L;  5LL6 S;  2C5C A;  4CDC C;  3FKI G;  4JCV E;  1BVS A;  3JAM L;  1SYE A;  5CV8 A;  1CHQ D;  1ROD A;  1SN8 A;  3RZD B;  3S2H H;  1I4Q A;  1G91 A;  3MTS A;  4YIJ A;  1VQJ A;  4A93 B;  4RAU C;  4DV5 L;  4QMG A;  1WFQ A;  3BDC A;  4A3B B;  4JC0 A;  4L6T B;  4ZUJ A;  3U50 C;  2TMP A;  4JYA L;  5C44 G;  1QB5 D;  3Q24 A;  2QGQ A;  1STG A;  3WOF A;  3TQY A;  3MEF A;  5CGK A;  1EOT A;  1N32 L;  2D9U A;  5A35 A;  1SE3 A;  4DV3 L;  1JOK A;  3SGI A;  4HIM A;  1KL9 A;  3AU7 A;  3C2P A;  3SK8 A;  3K5N A;  1X3F A;  2L55 A;  3CF5 A;  1FJG Q;  4A3I H;  1MI2 A;  3HKZ G;  2CHB D;  2K5H A;  2HHH Q;  4NB3 A;  4UY8 C;  3J81 i;  2EJF C;  1EIY B;  1VQ5 A;  4R4I A;  4LFC Q;  1GUO A;  3CMA A;  1QVG A;  1XTC D;  4XQQ A;  3H0G H;  4F88 A;  4K8I A;  3Q0A A;  2ALY B;  4KKU A;  2K33 A;  2F0W A;  2N78 A;  5FKA C;  1FYC A;  1YNN D;  1IKM A;  4P74 A;  2IL8 A;  1UAP A;  4LMQ D;  3OW7 A;  4FF2 A;  3MAQ A;  3KYH C;  2EYO A;  2QCP X;  3RN2 A;  2UXB L;  3C1E A;  1JWM D;  1NR4 A;  3UI2 A;  4ZKB B;  1V1Q A;  2PQE A;  4WRD A;  3URY A;  2D0P A;  4JBM A;  4C3I H;  4CKC A;  3D6C A;  1N33 Q;  4GNX A;  3QOJ A;  5GAD C;  3T16 A;  4OGQ C;  1QZG A;  1I3Q B;  3KF6 A;  3Q22 A;  1ICF B;  3W3A A;  3MXN A;  2FHT A;  3GV6 A;  2NVY H;  2R7D A;  3CCR A;  4EX5 A;  5IP7 G;  1Y1W B;  4NXM Q;  3GTP H;  2FMC A;  1OXU A;  3QG1 A;  1CI3 M;  5FJ8 H;  2OCE A;  3CQZ H;  4X64 Q;  4Y52 H;  2B63 B;  3NTI A;  1H9J A;  1W6J A;  5GQO A;  4L5T A;  5DM6 3;  3HP3 A;  4NKL A;  4ZAI A;  3HOW H;  2XGT A;  1KDB A;  2KQ3 A;  5KIX A;  3GTG H;  2B2T C;  4LFB L;  1TT2 A;  3SHL A;  1WTQ A;  5CV6 A;  4K5V A;  3FKI H;  3RLF A;  1KAW A;  3OHX C;  1J6Q A;  2IX3 A;  3W1B A;  1B3A A;  1SYG A;  1QJO A;  2A68 D;  3UDX A;  1SAP A;  2EY5 A;  3QIA A;  1HZ9 A;  2K05 A;  2RKS A;  3NTH A;  3S14 H;  4ZKC B;  2VUM B;  3QB3 A;  4RG1 A;  3LWU A;  4LF7 Q;  1U4P A;  2MHV A;  3Q23 A;  2ID0 A;  1OXS C;  4A3B G;  2AKW B;  3ITP A;  3G6E A;  4DXG A;  4C1N I;  1CK1 A;  2A5H A;  4XXE A;  2CFM A;  4LW1 A;  1SNQ A;  3H6M A;  2VZA A;  4J1M A;  4RGO S;  4XYQ A;  1VQP A;  3CXC A;  3CRL C;  2XNA C;  3KLW A;  1PYW D;  1Y1V G;  4RGM A;  3DM1 A;  3AMU A;  1YNN C;  2HCI A;  3SE0 A;  2JA8 G;  2IWH A;  1M8A A;  1D5M C;  1SMY D;  2I5H A;  4IN3 A;  5KND A;  5FLX E;  3S2D B;  1V1P A;  3HOZ G;  3GD7 A;  3J7A F;  1RHP A;  2K7V A;  3NUC A;  1S72 A;  1QG7 A;  3A56 A;  4OO1 H;  1PHJ A;  2F0N A;  1S3O A;  2OTL A;  1PFM A;  1MSG A;  3KOJ A;  4JI3 Q;  4KMU C;  4NXN Q;  1VQE A;  4R4C A;  4KHZ A;  4FVM A;  5IOC A;  5CV4 A;  2BDN A;  2PZW A;  5GAH C;  3K0Y A;  3TP6 A;  2FIN B;  4A3F H;  3E9I A;  1E24 A;  1GOZ A;  1AZQ A;  1JOQ A;  1D1K A;  1SRU A;  4PNY A;  2F0T A;  1A0I A;  1EFI D;  1K83 H;  4RGT A;  2N8N A;  2L0C A;  3TSS A;  3GTM B;  2K1B A;  1YIJ A;  3PUV A;  5ELE A;  2MQH A;  1STH A;  3VYR A;  5AFW A;  1Q8I A;  3OIQ A;  2R61 A;  3J81 E;  4HN7 A;  2A68 C;  3EVQ A;  2GVB A;  3P75 A;  4U67 3;  3CKI B;  4LF4 Q;  1TWG B;  2A69 D;  3KF8 B;  1N8R C;  1O7L A;  5IY0 A;  1YJ9 A;  4FF1 A;  3D4W A;  4GLV B;  3S1Q H;  4OEM B;  1EQR A;  3H3V I;  3EN2 A;  1CZW A;  1CQV A;  4RKB A;  1BBW A;  4A3J G;  5CV7 A;  4MIU A;  4JI8 Q;  2HT1 A;  3MVV A;  1EY6 A;  2UU9 L;  3BZC A;  4G57 A;  4DV4 Q;  1STN A;  2F0M A;  5M3M G;  4B3S Q;  1LLR D;  4XDX A;  2SEB D;  2VUM G;  1WVL A;  1E1O A;  4PG3 A;  1SMY C;  4OXP A;  5KYI A;  1S5B D;  1XMQ Q;  1F77 A;  4KKS A;  3DMU A;  1L1O B;  3I2Z A;  4X3K A;  4A3M B;  2ATW A;  1JJG A;  1PFN A;  1TWH H;  4KHP L;  5EAY A;  2RSO A;  2UXD L;  1CTM A;  3SEB A;  5LMN W;  3V05 A;  1BCP D;  1Y1V H;  3VYT A;  1Q7Y C;  2JA8 H;  1HR0 W;  4Y7N H;  2XIW A;  4DV5 Q;  3F2C A;  1KXL A;  3HOU B;  3M4Q A;  1K8O A;  1DJR D;  3HOZ H;  1ENC A;  4IUU A;  4JYA Q;  1HJP A;  1CKN B;  5IYC H;  1SBB B;  2JN4 A;  4ULL A;  1Q46 A;  1ESF A;  1S5F D;  1U5K A;  1YVC A;  5E7N A;  2O5I C;  4NMZ A;  3TRE A;  4YCU A;  4G4K A;  1N32 Q;  4DV3 Q;  3CCJ A;  2R6G A;  3TRZ A;  2UUB L;  3WDN A;  4K6D A;  3L2P A;  3M9B A;  4CDE C;  1PDQ A;  4I7A A;  2FJ2 A;  1YI2 A;  1KNE A;  1EIG A;  3L9A X;  1IBM L;  4AYB E;  2RDH A;  3IKJ A;  4AYB B;  1LTG D;  1CSQ A;  4QCL A;  4LFA L;  1II3 A;  4POG A;  4HJ5 A;  2YU9 B;  2XRQ D;  3G4S A;  1YNX A;  4C2M B;  3HOV G;  4G7Z C;  3P20 A;  5I4D A;  4C3H G;  3O13 A;  4BBS H;  5C3E H;  2NVQ B;  4UPA A;  2RSN A;  2RHS B;  5C0X G;  3K80 C;  2A69 C;  4KY7 A;  2X6G A;  4PMB A;  2JA7 H;  3WOE A;  2OTJ A;  2UXB Q;  4OIK A;  1GKH A;  1DXM A;  1TII D;  4KTA A;  1S5D D;  2EYJ A;  3K7A H;  3PUZ A;  3S2H B;  4JI4 L;  3CP0 A;  5J3B A;  4RCN A;  2QF7 A;  1H9R A;  3A55 A;  5IWA L;  3HZX A;  5DLQ E;  2F4V L;  3NTK A;  1B9M A;  3OWF A;  4GKK L;  1UE6 A;  4IPG A;  4HJ9 A;  2JEB I;  4K6L A;  3MEH A;  3MA2 B;  2AHO B;  1PRT D;  4DN4 M;  1VQ9 A;  1W3S A;  5CV9 A;  1TWF B;  1EL0 A;  1TWA H;  3OIP A;  4UP8 A;  4A3J H;  2B2W C;  1SEB D;  2VB3 X;  5ELN A;  4J15 A;  4A3I B;  2D0O A;  2UUC L;  1U0L A;  3FMC A;  5M3M H;  2SDF A;  1YJW A;  4AQY L;  1Q81 C;  4XT1 B;  1IZ6 A;  1RTN A;  4LFB Q;  3H3V C;  3H0G B;  4UAI A;  1F2L A;  3W5O A;  2F0I A;  4F7X A;  3H3V H;  4APV A;  2DY7 A;  2KA7 A;  1PH9 A;  4JBK A;  3EFX D;  5CBA E;  1BNZ A;  1HFN A;  3N6R A;  3OTO L;  3SK6 A;  2F4I A;  3PUW A;  3V2T A;  2EY1 A;  2WB1 E;  3ZJY C;  1I4G A;  3NSW A;  4ZQ3 A;  3K81 C;  2G9H D;  4GN3 B;  1H9S A;  5JJZ A;  2JE6 I;  1D5X C;  3KF8 A;  5ELB A;  2R92 G;  1EYG A;  1PZK D;  2A6H D;  3S1R H;  1L2F A;  3TBI B;  4C3I B;  1HNW L;  2F0G A;  4LJZ C;  1E1T A;  2IX1 A;  1B50 A;  2RDF A;  5I9P A;  2NVY B;  4BXX G;  4HMI A;  1LTI D;  4PZ8 A;  4JV5 L;  4L8J A;  1SE4 A;  3CRK C;  4HCS A;  4DV7 Q;  4BY7 G;  1P8L A;  1SYF A;  1ZYR D;  3VR5 A;  5C3W A;  1J8I A;  1FNW A;  3CQZ B;  1B1Z A;  1TVX A;  3BYT B;  1L0Y B;  5C6A A;  1G29 1;  2HIV A;  4HMJ A;  1XPO A;  2ZXR A;  4K2L A;  1EYA A;  2OF1 A;  3GV3 A;  3LWE A;  2K5V A;  5G3L D;  4AYB G;  1JT8 A;  4DR4 L;  3HOW B;  3HOV H;  4LUO A;  5C4X G;  4Z9C B;  1LTA D;  3HKS A;  1HHV A;  3L7Z C;  4C3H H;  3AEV A;  3GTG B;  3H15 A;  5DAU A;  3K59 A;  1YHA A;  2K5D A;  5C0X H;  3K0X A;  3FKI B;  4GS3 A;  5FK9 C;  4DNT B;  1A62 A;  1YHQ A;  1K8M A;  1D7Q A;  4A4I A;  3RD4 A;  3S15 H;  5EGT A;  2ZXO A;  4DR7 L;  5AJ3 L;  4HJ8 A;  1PRT C;  1K73 C;  1SE2 A;  2B2V C;  5EBD A;  2CH4 A;  3S14 B;  2Z6K A;  3GQB A;  2QEX A;  1VQH A;  5M9O A;  4FXK C;  2KCT A;  5E1F A;  1PH2 A;  1LTL A;  2OT2 A;  2VB2 X;  2VW9 A;  1AZP A;  4KLK A;  4YY3 L;  1O7Y A;  3IL8 A;  1ASY A;  4GNX B;  4RH6 A;  1W2B A;  2ZT9 C;  4GOP A;  1S5E D;  3KF6 B;  4L5R C;  2EJM A;  4HSP A;  5ELO A;  5C0X J;  2Z8L A;  4DU9 A;  4OWW B;  2DUD A;  1NMG A;  4A3L G;  1LAC A;  4A3I G;  1EU4 A;  3JAM i;  1EIH A;  3CHB D;  3NWS A;  2WII B;  1IL2 A;  1PMR A;  2A6H C;  4LWC A;  2AMC B;  3H0G G;  1XWE A;  3PIO A;  4P73 A;  4EGV A;  3UDF A;  1GO3 E;  1LTT D;  4O2D A;  2SNS A;  1AE3 A;  5M5W H;  4A3K G;  4TSS A;  1E2V A;  1TS3 A;  4C56 C;  3PGZ A;  4KK7 A;  3J80 c;  2UU9 Q;  4DF7 A;  4B3T L;  3FRP B;  2R92 H;  5JVH 3;  1WTO A;  2HQL A;  4A3E G;  2WB1 G;  3NK9 A;  1F2Z A;  4IPD A;  5J1Z A;  1PFB A;  1ZYR C;  2KCM A;  3PMF A;  4JI2 L;  1Q82 C;  2V4D A;  2J0T D;  4A3F B;  2P5Z X;  4IUP A;  5M3F H;  4C3I G;  2Q8R E;  2K4K A;  4BXX H;  1EZ6 A;  1XPU A;  2NTS A;  4CJ2 C;  2E5L L;  1CT1 D;  1Z9F A;  5C5M A;  4KHP Q;  2UXD Q;  1SXT A;  2AUJ D;  3PUX A;  1SLJ A;  4LF4 L;  4BY7 H;  4ODG A;  3TN2 A;  2A8V A;  2E2J H;  4X62 L;  5LL6 X;  1K3R A;  4PQX A;  4WOR A;  1AFP A;  1FNV A;  1PTO D;  1B3Q A;  2AQ2 B;  1KNA A;  1F2Y A;  3BS1 A;  2BH8 A;  1ET6 A;  5C4X H;  4RFB A;  5A2Q L;  4BA2 I;  1B4O A;  1D8L A;  3CCV A;  2ZJR A;  2UUB Q;  1WTP A;  2NWG A;  2K04 A;  1M1K C;  2BOS A;  3I4L A;  3RZO H;  4R1J A;  1V1P B;  1UUP A;  1BXT A;  1X6O A;  1IYV A;  2F0F A;  2KEN A;  3PO3 H;  2H5X A;  3CCL A;  5IGG A;  4TQU S;  3S1Q B;  3K5M A;  1VQ4 A;  2BDO A;  1IBM Q;  4HID A;  4X66 L;  1MJE A;  2AQ3 B;  4LFA Q;  3T13 A;  2UUA L;  5EKL A;  2F0L A;  2MP1 A;  1EY9 A;  3HS0 C;  4DGZ A;  3I4O A;  5D65 A;  4CDF C;  4LUZ A;  3D6W A;  1VF5 C;  1WCM H;  2R7Z G;  2ZTD A;  2EVB A;  1KIX A;  1VQA A;  1X56 A;  2L11 A;  1TWH B;  1ML0 D;  2L12 A;  4ZCK A;  1SNC A;  1TWF H;  3R2I A;  5GRO A;  2RCN A;  2VS1 A;  4JI4 Q;  1Y1V B;  2KOL A;  1FL0 A;  3N52 A;  4F87 A;  2JA8 B;  4Y7N B;  3NEL A;  2NZ1 D;  4IUQ A;  1U4M A;  4A3L H;  1GVP A;  5IWA Q;  1VQN A;  1NMF A;  2F4V Q;  2ZTC A;  1VQL A;  3CPF A;  3HOZ B;  3S16 B;  2KJX A;  5IP9 H;  4GKK Q;  4IUV A;  4K8J A;  1YIT A;  2B2T A;  4DR2 L;  1GUS A;  4BWG B;  3J7A V;  3TZU A;  1TWC H;  2UXC Q;  4DNI A;  3RN5 A;  3KLS X;  3M7N A;  4OO1 G;  4QB4 A;  2ASB A;  2K32 A;  1VQI A;  4A3K H;  2WAQ E;  4OEL B;  1WYD A;  2WAQ B;  2UUC Q;  3ER0 A;  4A3E H;  3GO5 A;  4CJ0 B;  2F0K A;  1K0S A;  4AQY Q;  2YYZ A;  3DUZ A;  2N88 A;  2JQO A;  2Z1C A;  1SND A;  1DYQ A;  4A3D G;  1PH4 A;  2FXQ A;  1Y8O B;  4K5W A;  3MC0 B;  3A8I E;  1VQ6 A;  3M4Y A;  4R8N A;  2O2L D;  1PTO C;  3OTO Q;  4A3F G;  1I6H H;  4IPH A;  4BBS B;  5A2Q E;  5C3E B;  1K28 A;  5LMU Q;  5IT9 L;  4FNF A;  2JA7 B;  3F1Z A;  3DHQ A;  1M90 C;  3KJP A;  1EYC A;  1OXT A;  1TU2 B;  1Y69 U;  2K50 A;  2Q2I A;  3TME A;  3K7A B;  3CU7 A;  1HNW Q;  4QUF A;  5LHY 1;  3JAM E;  1VMC A;  4GLX A;  3RR5 A;  1OXX K;  3F8T A;  5GAG C;  2E2D C;  2L1B A;  1KAA A;  2R93 H;  2V1C C;  4IOA A;  4JV5 Q;  1JQY D;  1Q8K A;  4DAM A;  4HR7 B;  1IKL A;  4MN3 A;  1VQC A;  2Z6B A;  3A54 A;  1TWA B;  1V43 A;  4QF4 A;  4YHH L;  1BR9 A;  3SXH A;  2M2L A;  4A3J B;  3UDG A;  3HOY H;  2GN5 A;  4KN4 C;  5C4Z A;  2ENB A;  2AUK A;  3A0J A;  1UE7 A;  3NPP A;  1E0B A;  4DR4 Q;  5M3M B;  4FDB A;  1TS4 A;  2NYZ D;  4R4T A;  2MUY A;  2K75 A;  4LF6 L;  3A8K E;  4JI6 L;  1BCP B;  4PMC A;  3I70 A;  3ND9 A;  2HDL A;  2R7Z H;  3MFY A;  4DR7 Q;  5AJ3 Q;  4OWT B;  3F2D A;  3CC7 A;  1UEB A;  2PI2 E;  3G6J B;  2RQX A;  3W2D A;  1C9O A;  3MXU A;  4DV7 L;  2EYM A;  4R4Q A;  1Q1B A;  3MHB A;  4UDU C;  4YWM A;  1U9R A;  3S1R B;  1BQQ T;  3E0E A;  5BN4 A;  2EYL A;  4YY3 Q;  1MKH A;  1YBY A;  4FP5 D;  4JI7 L;  5IYC G;  1X3P A;  1PXU A;  1XX8 A;  1JOR A;  1A3T A;  5IGD A;  2DJG C;  2NN6 I;  3DLL A;  1HNX L;  3UDI A;  2EOT A;  1FD7 D;  3E5S A;  5CYU A;  2QDB A;  4MHE A;  1PH3 A;  5IT9 E;  2B39 A;  4CHT B;  4EQN A;  1A63 A;  2WAQ G;  3FPP A;  3J7Z C;  1WTR A;  3IFD A;  5C3X A;  4S3S A;  1AP0 A;  2E76 C;  1G6P A;  1ILQ A;  4A3D H;  1LAB A;  4X3S A;  4JW0 A;  2AWN A;  2NVX H;  1FGB D;  2ZM6 L;  3HOV B;  1V1O A;  4JOI C;  4C3H B;  2QEJ C;  2ZXP A;  1EU3 A;  1HPC A;  4KD3 A;  2F1M A;  3I7F A;  4BBS G;  2WP8 J;  5C3E G;  3OYY A;  2VY3 A;  4B3T Q;  3GTL H;  3S15 B;  5I2Y A;  3BG3 A;  4L5S A;  3U4Z A;  1QVF A;  2JA7 G;  5C4J H;  1QVC A;  4JI2 Q;  1I4R A;  3VA7 A;  4IPC A;  1G2S A;  4JI0 L;  1ET9 A;  1TQO A;  1TY0 A;  2K28 A;  5JJK A;  4DV2 L;  1LT5 D;  4X3T A;  1JWU D;  3FP9 A;  3PUY A;  2K14 A;  4FXD A;  2E5L Q;  2DY8 A;  1H9S B;  4L63 B;  5CMD A;  1D1I A;  1NY4 A;  5DM7 3;  5KGU A;  1TY2 A;  5E3F A;  1UNS A;  4X62 Q;  3NWT A;  5JVG 3;  5FOB B;  2MO0 A;  3V96 A;  2LSS A;  3DWP A;  1NSN S;  5FLX c;  1B8A A;  1FNU A;  1G6Z A;  1T9H A;  1J5E L;  3R8B A;  4DR3 L;  1KD1 C;  4XTC S;  3G7L A;  4PMW A;  3X3N A;  3H94 A;  1JJC B;  4R9W A;  5CV5 A;  3S9W A;  2K01 A;  2JYO A;  3BZD B;  4DK1 A;  4B9X A;  2N49 A;  3S17 H;  1DD2 A;  1QUQ A;  3IRB A;  1CHP D;  1Q1E A;  2Z4I A;  1S40 A;  5C4H A;  2Z0S A;  4NW2 A;  1A3V A;  3I3C A;  3VYU A;  2XVS A;  1VQF A;  4X66 Q;  5M5W B;  2UUA Q;  4JI5 L;  1QNU A;  1QCB D;  2R92 B;  3CCQ A;  2DNC A;  3IAY A;  2QA4 A;  4DPG A;  3GTJ H;  2K52 A;  4DV0 L;  4IOC A;  3S16 H;  2X6L A;  1D6E C;  3DEP A;  3TP8 A;  2N3S A;  5M3F B;  5LMN L;  3HGB A;  1EEI D;  2DN8 A;  1JE4 A;  3OPO A;  3PIP A;  1HR0 L;  3UE0 A;  2F3I A;  2BA0 A;  5KEE A;  2BH2 A;  1S4Z A;  3ONA B;  1UE1 A;  3AFP A;  1ESR A;  3D3R A;  4BY7 B;  3VDY A;  2B2W A;  1MJC A;  1VQD A;  2NUC A;  2E2J B;  1CUK A;  2A73 B;  3J81 c;  3A7L A;  2OQK A;  2F0V A;  5COY A;  3VR4 A;  3NBH A;  1IYJ B;  1NBW A;  3FPU B;  3M85 A;  2K5W A;  4DR2 Q;  3M3Y B;  4GOP B;  2MPM A;  5EPJ A;  5JEA J;  1Q86 C;  1C48 A;  5C4X B;  4A3G G;  1N34 L;  1HNZ L;  4GZY C;  1B70 B;  1STB A;  1TS2 A;  4GKJ L;  1XYI A;  1EOV A;  3RZO B;  2PI2 A;  4I7Z C;  4LF8 L;  2Z4H A;  1WTX A;  3E3X A;  4K0K L;  3PO3 B;  3L0O A;  2F0U A;  1O78 A;  4O42 A;  3FDT A;  2PZT A;  3D4R A;  4HED A;  1YEZ A;  4DAY B;  3CCS A;  3M7G A;  1IYU A;  2G9D A;  4O0A A;  1NUC A;  4UHV A;  1NJI C;  4IFD I;  5BN5 A;  4EQO A;  3U58 A;  1YJN A;  1L0W A;  1MD2 D;  4IUN A;  2NVT H;  4IJL A;  2IT1 A;  1X3G A;  3KBG A;  4FYD A;  2FFK B;  2SNM A;  4HCE A;  1BBX C;  2IHF A;  1QWY A;  1WCM B;  2J7Z A;  3VR3 A;  4LF9 L;  2MGS A;  1QIL A;  4LK1 C;  2UXC L;  2RDG A;  1HA5 A;  4CDD C;  3WWV A;  1EY0 A;  4TKO B;  5FLM G;  3J80 L;  2DNE A;  1RIP A;  1PH6 A;  1CQF A;  1MHW C;  2KCC A;  5JJI A;  3S24 A;  3U9O A;  3I72 A;  1K9M C;  2JJQ A;  2E74 C;  1GHK A;  2JXM B;  3E6Z X;  5E4X A;  3C46 A;  1TWC B;  4YWK A;  1VF7 A;  2D5D A;  4DK6 C;  1DGS A;  4YHH Q;  3ND8 A;  3DEO A;  4ZK9 B;  3S1M H;  4QIW E;  1O7I A;  4QIW B;  1SNP A;  2PW5 A;  4HJ7 A;  2OQ0 A;  1G8Z D;  4IJH A;  5IIF A;  5IYD G;  2CKZ B;  2PCF B;  2LKV A;  5BN3 A;  4A3K B;  2B2V A;  1JIC A;  2XTI A;  1WD0 A;  1RL2 A;  5LMU L;  5JPM C;  2F0Q A;  1JOO A;  2F3W A;  4A3E B;  2WB1 B;  4H7B A;  3CCU A;  5IGB A;  4QQB X;  1JMC A;  4LF6 Q;  1S5C D;  2A6E D;  3K5O A;  1VQK A;  4JI6 Q;  4AIM A;  2E75 C;  4X6A H;  4HAE A;  5FO7 B;  2IHE A;  1I6H B;  2D62 A;  4XT3 B;  5M3F G;  2WKC A;  1PTO B;  3K57 A;  3NBI A;  2VQE L;  4CKB A;  1KAB A;  4JK1 C;  1BUV T;  1LTS D;  4RA8 A;  1YHB A;  1DON A;  1DOM A;  1QZH A;  1X65 A;  1EY4 A;  3CD6 A;  1Q3L A;  1W6K A;  2EZV A;  4A3G H;  4JI7 Q;  3DXJ C;  1RTO A;  3OMG A;  1K0R A;  2R93 B;  5KYL A;  1HQM C;  1Q12 A;  1HNX Q;  4LNQ A;  2WAC A;  1I50 H;  5BR8 L;  1AH9 A;  1NR2 A;  4JBW A;  1A6X A;  4UP7 A;  3DWQ A;  5C5L A;  3PO3 G;  3HOY B;  1XNQ L;  4RWS C;  2A19 A;  1T5E A;  2EQS A;  5T1G A;  2ZM6 Q;  3TP5 A;  3U9S A;  3G71 A;  1ONL A;  4BY1 G;  1M4V A;  3T51 B;  1I94 L;  4P72 A;  2R7Z B;  1AW7 A;  1PH1 A;  4DK3 C;  1GM5 A;  2RF4 A;  2A74 C;  1RCV D;  1F9R A;  1WCM G;  1X3Q A;  3AB9 A;  1E2Z A;  2I5L X;  5FLM H;  2I5M X;  2DJF C;  4ME5 A;  2M00 A;  1LV9 A;  4JI0 Q;  2MNA A;  4OWX B;  1EQT A;  4DV2 Q;  1I5F A;  3T1Y L;  2E2H H;  1MBY A;  1BKB A;  5KRU A;  4P2C B;  2AWO A;  1B7Y B;  4F8M A;  3EJI A;  1PH5 A;  3QOL A;  2ZJP A;  1ZXT A;  1WOC A;  3P7J A;  1JB3 A;  5IP9 G;  2F0E A;  3CW2 C;  3LX0 A;  2OXP A;  3K5L A;  1PFS A;  1L0X B;  2EE1 A;  4RHS A;  5COR A;  2A6E C;  4DV1 L;  3RLO A;  1Z6H A;  1KLG D;  1IXR A;  4KJN A;  1OO9 B;  2BA1 A;  4DAY A;  1BO0 A;  4K2K A;  1K8G A;  4KKT A;  2JA5 G;  5IYD H;  2KEE A;  2BCO A;  2LFN A;  1J5E Q;  2O5J C;  4DR3 Q;  2CQA A;  1FVI A;  2NB0 A;  4GLA C;  3TS0 A;  1N36 L;  4JI1 L;  4IFD J;  3M4O H;  3HOX H;  3A74 A;  4A3D B;  2IPK D;  5I6Y A;  1HXY D;  3CAM A;  2NVX B;  2HQE A;  1KHI A;  5JJL A;  1HZC A;  1LT6 D;  1L1O C;  3RNU A;  4KY6 A;  5JOB A;  3VR6 A;  4XIG S;  1BBU A;  2F3V A;  2RCF A;  4DR6 L;  4WJ4 A;  3SDZ A;  2EIF A;  2DGY A;  2ZTE A;  4JI5 Q;  4IUT A;  2ZJQ A;  2EJG C;  3GTL B;  3R3O A;  1CA5 A;  1DZ1 A;  4QUC A;  1NCV A;  2L4N A;  5C4J B;  4DV0 Q;  3LNN A;  4ZYS A;  4IO9 A;  4H02 A;  5IE8 A;  1Z47 A;  5LMN Q;  5TSS A;  1B53 A;  2F0J A;  3M3Y H;  1HR0 Q;  4BBR G;  1HZB A;  1HH2 P;  1P16 A;  4OON A;  1RDP D;  2MFI A;  4M1U B;  3PF5 A;  2FMM A;  5I9O A;  4OX9 L;  1PH8 A;  3ERO A;  3UE1 A;  1STE A;  3MWY W;  1VQ8 A;  2R93 G;  1PYS B;  2IY5 B;  2PQA A;  5I2X A;  3I73 A;  2IJ0 A;  1I4P A;  1D5Z C;  2YTV A;  3STB C;  3BYY B;  1OTC A;  3EQL C;  3PIO 3;  1WD1 A;  2Q8T A;  3ULP A;  3HOY G;  2PO4 A;  2MJ8 A;  5IGF A;  3T1H L;  3GTK H;  1C7Y A;  5ELC A;  1N34 Q;  2KVM A;  1HNZ Q;  4L5Q A;  4V19 0;  4BY1 H;  1PYB A;  1SNM A;  1R4P B;  5I6W A;  4GKJ Q;  4HJA A;  4LF8 Q;  4DR1 L;  4TRD A;  3SVM A;  3K7U C;  3J7A 5;  3S17 B;  3HRZ C;  4K0K Q;  1HUN A;  1R9T B;  2F03 A;  2XSC A;  5NUC A;  3T4A C;  1XJV A;  4MZ9 A;  2VL6 A;  4Q0F A;  1UWV A;  4NPS A;  2QIL A;  5DNF A;  2B2Y C;  3GTO H;  3BDL A;  1KTK A;  2CCZ A;  1XMO L;  1PLF A;  2HDM A;  3CPW A;  3GTJ B;  3A5Z B;  1GUW A;  2I07 B;  3NXW A;  1TKW B;  3Q8D A;  4DFA A;  1HTP A;  1SJE D;  5ISR A;  4LF9 Q;  1DOK A;  3G48 A;  5EPK A;  4LF5 L;  5FO9 B;  5M5Y H;  2JA5 H;  3VYS A;  2F0S A;  2L9H A;  4E6I A;  4OO1 I;  4HSV A;  2JSO A; 
#chains in the Genus database with same CATH homology
 1F9P A;  1HFG A;  2PYK A;  1E2W A;  2EXZ A;  1GHJ A;  2N55 A;  3EA6 A;  2XWB B;  4RGN A;  4V0B A;  4CJ1 B;  4PV1 C;  3VA5 A;  1PTO H;  5D14 A;  2RBM A;  1EWH A;  5FLX L;  3MFG A;  1DM0 B;  1STA A;  3H91 A;  3C3L A;  4N9P A;  4IAL A;  3BVZ A;  2I46 A;  2NVT B;  1KLU D;  3RUZ A;  1ICW A;  1H9M A;  4DNR B;  2TSS A;  1KDC A;  1CA6 A;  3BVM A;  4OIJ A;  5JPN C;  2H1E A;  2AQ1 B;  5J39 A;  3D4D A;  1WTW A;  1YNJ D;  4WFN 3;  3HG9 A;  1HCZ A;  3IFT A;  1GUG A;  4ZLT F;  1Y8N B;  1BCP F;  1BDO A;  3S1M B;  1QE6 A;  3L3O C;  5K36 G;  1O7Z A;  2EY2 A;  1F9Q A;  1FR3 A;  1AN8 A;  3J81 L;  1SYD A;  5EQ0 A;  1CZG A;  4DK0 A;  3NQT A;  1SNO A;  1QOH A;  3MZ5 A;  5JEA G;  4EQP A;  1JWS D;  1X32 A;  3E0J A;  1GUN A;  3R93 A;  2K6A A;  1ENF A;  1CM9 A;  1JR0 D;  4U68 A;  5JAV A;  2ICE C;  5FO8 B;  2JP1 A;  1O80 A;  2KHS A;  2KCN A;  1NAP A;  3QJY A;  1BF4 A;  4A3G B;  2CW0 D;  2H4O A;  3MXP A;  1Q90 A;  2NN6 G;  1I50 B;  4K14 A;  2BE5 D;  1RJT A;  3DWA A;  2QKI C;  5ELF A;  4EVO A;  1G2T A;  1PRT F;  1PRT B;  2KUM A;  3J7Y W;  3TDQ A;  1HA6 A;  3A8J E;  1OXV A;  1VMP A;  1YNJ C;  3RMH A;  1HQR D;  5E4W C;  2PNR C;  1F9S A;  1SSO A;  1I6V C;  1SJH D;  3D8G A;  4X3U A;  4H13 C;  4LAA A;  2L5T A;  3GP7 A;  2E2H B;  4DA2 A;  1LTR D;  4CGY B;  4WJW A;  1EZ8 A;  3KLR A;  4B08 A;  3KLS A;  2EPB A;  1RF2 D;  2B2U A;  5K36 H;  4NDX A;  3KK7 A;  4KD4 A;  3OMC A;  1I4H A;  1EQV A;  1GXD C;  4R8I A;  1RD9 D;  2C9O A;  5JEA H;  3M4O B;  3HOX B;  3H09 A;  2NBF A;  2EYF A;  5CBE E;  4BS9 A;  4G7H C;  1LO5 D;  3OWE B;  5IOD A;  1R4Q B;  2CW0 C;  3OSO A;  3NE5 B;  5G3L F;  1DOL A;  4KV6 A;  2XWJ B;  1SYB A;  3BVG A;  5IGC A;  4KI0 A;  4ZUI A;  3FVQ A;  4IZ8 A;  2BE5 C;  4ID6 A;  1HTL D;  1GJX A;  3KBX A;  1A15 A;  1B44 D;  4XQN A;  5K5P A;  3R2T A;  4Q5V A;  1BOS A;  5ELD A;  4IQZ A;  4XQJ A;  2F0P A;  2ICI A;  2NN6 H;  4FXG C;  4FF4 A;  2HCC A;  1WTV A;  1EY5 A;  1U4R A;  2HUG A;  4KHV A;  2B2U C;  2LY7 A;  2EYH A;  2O4X A;  1IW7 D;  3C1F A;  4G7O C;  5C0X I;  2VXW A;  1A3U A;  5KNC A;  1A2T A;  4B9W A;  3SK4 A;  3GTK B;  2EYP A;  4BY1 B;  1XXG A;  3QO2 A;  2NTT A;  1MGS A;  1TR5 A;  5KNB A;  4FO2 A;  1DCZ A;  3KUP A;  3BDO A;  1B9N A;  1J9O A;  2K03 A;  5EPL A;  3PIP 3;  3GTO B;  4IFD G;  2EDG A;  2X69 A;  5EKI A;  5F2D A;  1UEA B;  2OEO A;  2XRS D;  1Y8P B;  3I91 A;  1PZJ D;  3D31 A;  4DAP A;  2RVL A;  1SDF A;  1JC7 A;  4DXF A;  1EEF D;  2D2C C;  2R3Z A;  3OOC A;  4OHJ A;  2JA5 B;  5M5Y B;  3TZD A;  2IX0 A;  1STY A;  3P1H A;  2CVR A;  1SYC A;  3ZYY X;  3F2U A;  5IGE A;  1VDZ A;  2GA4 B;  5HGT A;  1BCP C;  1GUT A;  4K5X A;  1AEX A;  3GTQ B;  1EY8 A;  3SR1 A;  4ILW A;  4M8A A;  2LMC B;  2WV6 D;  1PTO F;  1ILP A;  1HUM A;  5M5X B;  2E2I B;  3NHH A;  2PMZ B;  1MSH A;  1B2T A;  4ABN A;  5D3I B;  2VNU D;  3HEJ A;  2XN9 C;  1IW7 C;  5EBC A;  4BBR B;  2KED A;  3I90 A;  3GTP B;  1Z7T A;  4BA1 I;  3I4N B;  4C3J B;  1C8C A;  1TS5 A;  1RKN A;  3PV0 A;  2PZU A;  4KN7 C;  1ENA A;  1JCK B;  1IHZ A;  2LS0 1;  2Y0S B;  2EY6 A;  3PO2 B;  5D3D A;  3K58 A;  2F0H A;  3A7A B;  4RCO A;  4RHR A;  3J80 E;  1F2M A;  4I65 A;  2B8F A;  1LT4 D;  1U4L A;  4KJO A;  2J4X A;  2RA4 A;  2PPB C;  3NQI A;  3ERQ A;  2IW3 A;  1ZKO A;  2KEC A;  4IFD H;  4RKL A;  3K6O A;  2WIN B;  4FF3 A;  1ZEQ X;  4ZRZ A;  1LT3 D;  1PZI D;  5CR3 A;  5C44 B;  1T5X D;  1V8Q A;  1LTB D;  1EYD A;  4HTH A;  5T1I A;  1VCI A;  3HKZ B;  3I8Z A;  3S1N B;  4IUR A;  4OL7 A;  2Q8I B;  3I4M B;  1A2U A;  1D2B A;  2F0O A;  1SFO B;  2PW7 A;  4C1N K;  5HUR A;  3VR2 A;  1CFM A;  2JEA I;  2JA6 B;  1I4X A;  3TP7 A;  1QNK A;  2B2Y A;  5J22 A;  2F0D A;  3X3M A;  1HRJ A;  1C4Q A;  4XYO A;  1IL8 A;  3Q6S A;  4J8Q A;  1H9K A;  1KDA A;  5CC4 A;  5DEH A;  1K83 B;  2SOB A;  3T56 B;  4C3J G;  4H44 C;  2B8G A;  3MXG A;  4NP5 A;  1EY7 A;  5EKK A;  3NP8 A;  2WKD A;  4DAV A;  4CBV A;  2K5Q A;  4N9T A;  2M9V A;  4KY5 A;  1EWC A;  5EJW A;  4H0L C;  4J6H A;  3QWN A;  4O1N A;  3T53 B;  4CKE A;  3FEW X;  3SK5 A;  5LL6 S;  2C5C A;  3JAM L;  1SYE A;  5CV8 A;  1ROD A;  1CHQ D;  3RZD B;  1G91 A;  1I4Q A;  3MTS A;  4YIJ A;  4A93 B;  4RAU C;  4QMG A;  3BDC A;  4A3B B;  4L6T B;  4ZUJ A;  2TMP A;  1QB5 D;  3Q24 A;  1STG A;  3WOF A;  5CGK A;  1EOT A;  2D9U A;  5A35 A;  1SE3 A;  1JOK A;  3AU7 A;  3C2P A;  3SK8 A;  3K5N A;  2L55 A;  1MI2 A;  2CHB D;  2EJF C;  1GUO A;  1XTC D;  4XQQ A;  4F88 A;  4K8I A;  3Q0A A;  4KKU A;  2K33 A;  2F0W A;  5FKA C;  1FYC A;  1YNN D;  1IKM A;  2IL8 A;  1UAP A;  4LMQ D;  3OW7 A;  4FF2 A;  3MAQ A;  2EYO A;  2QCP X;  3C1E A;  1JWM D;  1NR4 A;  3UI2 A;  4ZKB B;  2PQE A;  3URY A;  4WRD A;  4CKC A;  3D6C A;  3QOJ A;  3T16 A;  4OGQ C;  1I3Q B;  3Q22 A;  3W3A A;  3MXN A;  2FHT A;  3GV6 A;  1Y1W B;  2FMC A;  1OXU A;  3QG1 A;  1CI3 M;  2B63 B;  3NTI A;  1H9J A;  1W6J A;  5DM6 3;  3HP3 A;  4NKL A;  4ZAI A;  1KDB A;  2KQ3 A;  5KIX A;  2B2T C;  1TT2 A;  3SHL A;  1WTQ A;  5CV6 A;  4K5V A;  3RLF A;  3OHX C;  2IX3 A;  1B3A A;  1SYG A;  1QJO A;  2A68 D;  1SAP A;  2EY5 A;  3QIA A;  2K05 A;  2RKS A;  3NTH A;  4ZKC B;  2VUM B;  3QB3 A;  3LWU A;  1U4P A;  2MHV A;  3Q23 A;  2ID0 A;  1OXS C;  3ITP A;  4DXG A;  4C1N I;  1CK1 A;  2A5H A;  4XXE A;  1SNQ A;  3H6M A;  4J1M A;  4RGO S;  4XYQ A;  3CRL C;  2XNA C;  4RGM A;  1PYW D;  3DM1 A;  3AMU A;  1YNN C;  2HCI A;  3SE0 A;  2IWH A;  1M8A A;  1D5M C;  1SMY D;  4IN3 A;  5KND A;  5FLX E;  3S2D B;  1V1P A;  3GD7 A;  3J7A F;  1RHP A;  2K7V A;  3NUC A;  1QG7 A;  3A56 A;  4OO1 H;  2F0N A;  1PFM A;  1MSG A;  4KMU C;  4KHZ A;  4FVM A;  5IOC A;  5CV4 A;  2BDN A;  2PZW A;  3K0Y A;  3TP6 A;  2FIN B;  1GOZ A;  1AZQ A;  1JOQ A;  1D1K A;  4PNY A;  2F0T A;  1EFI D;  4RGT A;  3GTM B;  2L0C A;  3TSS A;  2K1B A;  3PUV A;  5ELE A;  1STH A;  3VYR A;  5AFW A;  1Q8I A;  3OIQ A;  2R61 A;  3J81 E;  4HN7 A;  2A68 C;  3EVQ A;  3P75 A;  4U67 3;  3CKI B;  1TWG B;  2A69 D;  1O7L A;  4FF1 A;  3D4W A;  1CZW A;  1CQV A;  4RKB A;  5CV7 A;  4MIU A;  3MVV A;  1EY6 A;  4G57 A;  1STN A;  2F0M A;  1LLR D;  4XDX A;  2SEB D;  1WVL A;  1SMY C;  5KYI A;  1S5B D;  1F77 A;  4KKS A;  3DMU A;  4X3K A;  4A3M B;  1PFN A;  2RSO A;  1CTM A;  3SEB A;  3V05 A;  1BCP D;  3VYT A;  2XIW A;  3HOU B;  1K8O A;  1DJR D;  1ENC A;  4IUU A;  1SBB B;  4ULL A;  1ESF A;  1S5F D;  2O5I C;  4NMZ A;  4G4K A;  2R6G A;  3WDN A;  4K6D A;  1PDQ A;  2FJ2 A;  1KNE A;  1EIG A;  3L9A X;  2RDH A;  3IKJ A;  4AYB B;  1LTG D;  4QCL A;  1II3 A;  2YU9 B;  2XRQ D;  4C2M B;  4G7Z C;  3P20 A;  5I4D A;  4C3H G;  3O13 A;  2NVQ B;  2RSN A;  5C0X G;  2A69 C;  4KY7 A;  2X6G A;  4PMB A;  3WOE A;  4OIK A;  1DXM A;  1TII D;  4KTA A;  1S5D D;  2EYJ A;  3PUZ A;  3S2H B;  4RCN A;  2QF7 A;  1H9R A;  3A55 A;  3HZX A;  3NTK A;  1B9M A;  3OWF A;  2JEB I;  4K6L A;  3MEH A;  3MA2 B;  1PRT D;  4DN4 M;  5CV9 A;  1TWF B;  1EL0 A;  3OIP A;  2B2W C;  1SEB D;  2VB3 X;  4A3I B;  3FMC A;  2SDF A;  4XT1 B;  1RTN A;  3H3V C;  3H0G B;  4UAI A;  1F2L A;  2F0I A;  4F7X A;  2DY7 A;  2KA7 A;  3EFX D;  5CBA E;  1BNZ A;  1HFN A;  3N6R A;  3SK6 A;  2F4I A;  3PUW A;  3V2T A;  2EY1 A;  1I4G A;  3NSW A;  4ZQ3 A;  2G9H D;  1H9S A;  5JJZ A;  2JE6 I;  1D5X C;  3KF8 A;  5ELB A;  1PZK D;  2A6H D;  3TBI B;  4C3I B;  2F0G A;  4LJZ C;  2IX1 A;  1B50 A;  2RDF A;  5I9P A;  2NVY B;  4HMI A;  1LTI D;  4L8J A;  1SE4 A;  3CRK C;  4HCS A;  1SYF A;  1ZYR D;  3VR5 A;  5C3W A;  1J8I A;  1FNW A;  3CQZ B;  1B1Z A;  1TVX A;  3BYT B;  1L0Y B;  5C6A A;  1G29 1;  4HMJ A;  2ZXR A;  4K2L A;  1EYA A;  2OF1 A;  3GV3 A;  3LWE A;  5G3L D;  3HOW B;  1HHV A;  4Z9C B;  1LTA D;  3L7Z C;  3GTG B;  5DAU A;  3K59 A;  2K5D A;  5C0X H;  3FKI B;  4DNT B;  5FK9 C;  1K8M A;  3RD4 A;  5EGT A;  2ZXO A;  1PRT C;  1SE2 A;  2B2V C;  5EBD A;  3S14 B;  3GQB A;  5M9O A;  4FXK C;  5E1F A;  2OT2 A;  2VB2 X;  1AZP A;  1O7Y A;  3IL8 A;  4RH6 A;  2ZT9 C;  1S5E D;  2EJM A;  4HSP A;  5C0X J;  2Z8L A;  4DU9 A;  1LAC A;  1EU4 A;  1EIH A;  3CHB D;  3NWS A;  2WII B;  1PMR A;  2A6H C;  1XWE A;  4EGV A;  1LTT D;  2SNS A;  4TSS A;  1E2V A;  1TS3 A;  4C56 C;  4KK7 A;  4DF7 A;  3FRP B;  5JVH 3;  1WTO A;  3NK9 A;  1F2Z A;  5J1Z A;  1PFB A;  1ZYR C;  3PMF A;  2V4D A;  2J0T D;  4A3F B;  4IUP A;  4C3I G;  2Q8R E;  1EZ6 A;  2NTS A;  4CJ2 C;  1CT1 D;  5C5M A;  1SXT A;  2AUJ D;  3PUX A;  4ODG A;  3TN2 A;  5LL6 X;  4PQX A;  4WOR A;  1AFP A;  1PTO D;  1FNV A;  2AQ2 B;  1KNA A;  1F2Y A;  3BS1 A;  1ET6 A;  4BA2 I;  4RFB A;  5A2Q L;  1B4O A;  1WTP A;  2NWG A;  2K04 A;  2BOS A;  3I4L A;  1V1P B;  1UUP A;  1BXT A;  1IYV A;  2F0F A;  5IGG A;  4TQU S;  3S1Q B;  3K5M A;  2BDO A;  2AQ3 B;  3T13 A;  5EKL A;  2F0L A;  2MP1 A;  1EY9 A;  3HS0 C;  4DGZ A;  5D65 A;  3D6W A;  1VF5 C;  2EVB A;  2L11 A;  1TWH B;  1ML0 D;  2L12 A;  1SNC A;  3R2I A;  1Y1V B;  2KOL A;  4F87 A;  3N52 A;  2JA8 B;  4Y7N B;  2NZ1 D;  4IUQ A;  1U4M A;  3HOZ B;  3S16 B;  2KJX A;  4IUV A;  4K8J A;  2B2T A;  1GUS A;  4BWG B;  3J7A V;  3TZU A;  3KLS X;  3M7N A;  4OO1 G;  4QB4 A;  2K32 A;  2WAQ B;  3GO5 A;  4CJ0 B;  2F0K A;  2YYZ A;  3DUZ A;  2N88 A;  2Z1C A;  1SND A;  1DYQ A;  1Y8O B;  4K5W A;  3MC0 B;  3A8I E;  3M4Y A;  4R8N A;  2O2L D;  1PTO C;  4BBS B;  5A2Q E;  5C3E B;  5IT9 L;  4FNF A;  2JA7 B;  3DHQ A;  1EYC A;  1OXT A;  1TU2 B;  1Y69 U;  3TME A;  3K7A B;  3CU7 A;  4QUF A;  5LHY 1;  3JAM E;  1VMC A;  1OXX K;  2E2D C;  2L1B A;  1KAA A;  1JQY D;  4HR7 B;  1IKL A;  4MN3 A;  3A54 A;  1TWA B;  1V43 A;  4QF4 A;  1BR9 A;  3SXH A;  2M2L A;  4A3J B;  4KN4 C;  5C4Z A;  2ENB A;  2AUK A;  3NPP A;  1E0B A;  5M3M B;  1TS4 A;  2NYZ D;  2MUY A;  3A8K E;  1BCP B;  4PMC A;  3I70 A;  3ND9 A;  2HDL A;  3MFY A;  3G6J B;  2RQX A;  3W2D A;  3MXU A;  2EYM A;  1Q1B A;  3MHB A;  4UDU C;  3S1R B;  1U9R A;  1BQQ T;  5BN4 A;  2EYL A;  4FP5 D;  1X3P A;  1PXU A;  1XX8 A;  1JOR A;  1A3T A;  5IGD A;  2NN6 I;  2EOT A;  1FD7 D;  3E5S A;  5CYU A;  2QDB A;  4MHE A;  5IT9 E;  2B39 A;  4CHT B;  4EQN A;  3FPP A;  1WTR A;  3IFD A;  5C3X A;  4S3S A;  1AP0 A;  2E76 C;  1ILQ A;  1LAB A;  4X3S A;  2AWN A;  1FGB D;  3HOV B;  1V1O A;  4C3H B;  2QEJ C;  2ZXP A;  1EU3 A;  1HPC A;  4KD3 A;  2F1M A;  2WP8 J;  3S15 B;  5I2Y A;  3BG3 A;  1I4R A;  3VA7 A;  1G2S A;  1ET9 A;  1TQO A;  1TY0 A;  2K28 A;  1LT5 D;  4X3T A;  1JWU D;  3PUY A;  4FXD A;  2DY8 A;  1H9S B;  4L63 B;  5CMD A;  1D1I A;  5DM7 3;  5KGU A;  1TY2 A;  5E3F A;  1UNS A;  3NWT A;  5JVG 3;  5FOB B;  3V96 A;  3DWP A;  1NSN S;  1FNU A;  1G6Z A;  3R8B A;  4XTC S;  3G7L A;  4PMW A;  3X3N A;  3H94 A;  3S9W A;  4R9W A;  5CV5 A;  2K01 A;  2JYO A;  3BZD B;  4DK1 A;  4B9X A;  1DD2 A;  1CHP D;  1Q1E A;  2Z4I A;  5C4H A;  4NW2 A;  1A3V A;  3I3C A;  3VYU A;  2XVS A;  5M5W B;  1QNU A;  1QCB D;  2R92 B;  2DNC A;  3IAY A;  2X6L A;  1D6E C;  3DEP A;  3TP8 A;  5M3F B;  3HGB A;  1EEI D;  2DN8 A;  1JE4 A;  3OPO A;  2BA0 A;  5KEE A;  1S4Z A;  3ONA B;  1ESR A;  3D3R A;  4BY7 B;  2B2W A;  2NUC A;  2E2J B;  2A73 B;  3A7L A;  2F0V A;  5COY A;  3VR4 A;  3NBH A;  3FPU B;  3M85 A;  2K5W A;  3M3Y B;  2MPM A;  5EPJ A;  5JEA J;  1C48 A;  5C4X B;  4GZY C;  1STB A;  1TS2 A;  1XYI A;  3RZO B;  4I7Z C;  2Z4H A;  1WTX A;  3PO3 B;  2F0U A;  1O78 A;  4O42 A;  3FDT A;  2PZT A;  3D4R A;  4HED A;  3M7G A;  1IYU A;  2G9D A;  1NUC A;  4IFD I;  5BN5 A;  4EQO A;  1MD2 D;  4IUN A;  2IT1 A;  3KBG A;  4FYD A;  2FFK B;  2SNM A;  4HCE A;  1BBX C;  1QWY A;  1WCM B;  2J7Z A;  3VR3 A;  2MGS A;  1QIL A;  4LK1 C;  2RDG A;  1HA5 A;  1EY0 A;  4TKO B;  3J80 L;  2DNE A;  1CQF A;  2KCC A;  3U9O A;  3I72 A;  2E74 C;  1GHK A;  2JXM B;  3E6Z X;  5E4X A;  3C46 A;  1TWC B;  1VF7 A;  2D5D A;  3ND8 A;  3DEO A;  4ZK9 B;  4QIW B;  1SNP A;  2PW5 A;  5IIF A;  1G8Z D;  2PCF B;  2LKV A;  5BN3 A;  4A3K B;  2B2V A;  1JIC A;  1WD0 A;  5JPM C;  2F0Q A;  1JOO A;  2F3W A;  4A3E B;  2WB1 B;  4H7B A;  5IGB A;  1S5C D;  2A6E D;  3K5O A;  2E75 C;  4HAE A;  5FO7 B;  1I6H B;  2D62 A;  4XT3 B;  2WKC A;  1PTO B;  3K57 A;  3NBI A;  4CKB A;  1KAB A;  4JK1 C;  1BUV T;  1LTS D;  4RA8 A;  1DON A;  1DOM A;  1EY4 A;  1Q3L A;  1W6K A;  2EZV A;  3DXJ C;  1RTO A;  3OMG A;  2R93 B;  5KYL A;  1HQM C;  1Q12 A;  2WAC A;  1NR2 A;  4JBW A;  1A6X A;  3DWQ A;  5C5L A;  3HOY B;  4RWS C;  1T5E A;  5T1G A;  3TP5 A;  3U9S A;  1ONL A;  1M4V A;  3T51 B;  2R7Z B;  1AW7 A;  2A74 C;  1RCV D;  1F9R A;  1X3Q A;  3AB9 A;  1E2Z A;  4ME5 A;  2M00 A;  1LV9 A;  1EQT A;  1MBY A;  5KRU A;  4P2C B;  2AWO A;  4F8M A;  3EJI A;  3QOL A;  1ZXT A;  3P7J A;  1JB3 A;  2F0E A;  3LX0 A;  2OXP A;  3K5L A;  2EE1 A;  1L0X B;  4RHS A;  5COR A;  2A6E C;  1Z6H A;  1KLG D;  4KJN A;  1OO9 B;  4DAY A;  2BA1 A;  1BO0 A;  4K2K A;  4KKT A;  2KEE A;  2BCO A;  2LFN A;  2O5J C;  2CQA A;  2NB0 A;  4IFD J;  4A3D B;  2IPK D;  5I6Y A;  1HXY D;  2NVX B;  2HQE A;  1LT6 D;  4KY6 A;  5JOB A;  3VR6 A;  4XIG S;  2F3V A;  3SDZ A;  4IUT A;  2EJG C;  3GTL B;  3R3O A;  1CA5 A;  1DZ1 A;  4QUC A;  1NCV A;  2L4N A;  5C4J B;  3LNN A;  4ZYS A;  1Z47 A;  5TSS A;  1B53 A;  2F0J A;  1RDP D;  4M1U B;  2FMM A;  5I9O A;  3ERO A;  1STE A;  3MWY W;  5I2X A;  3I73 A;  2IJ0 A;  1I4P A;  1D5Z C;  3BYY B;  3EQL C;  3PIO 3;  1WD1 A;  2Q8T A;  2PO4 A;  2MJ8 A;  5IGF A;  5ELC A;  2KVM A;  4V19 0;  1SNM A;  1R4P B;  5I6W A;  4TRD A;  3SVM A;  3S17 B;  3HRZ C;  1HUN A;  1R9T B;  2F03 A;  2XSC A;  5NUC A;  3T4A C;  4Q0F A;  2QIL A;  5DNF A;  2B2Y C;  3BDL A;  1KTK A;  1PLF A;  2HDM A;  3GTJ B;  1GUW A;  2I07 B;  3NXW A;  1TKW B;  4DFA A;  1HTP A;  1SJE D;  5ISR A;  1DOK A;  5EPK A;  5FO9 B;  3VYS A;  2F0S A;  2L9H A;  4E6I A;  4OO1 I;  4HSV A;  2JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...