1ESRA

Crystal structure of human monocyte chemotactic protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
EPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords MONOCYTE CHEMOTACTIC PROTEIN 2
publication title Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1esrA00
1SSOA 2X69A 5CBEE 1VMPA 1JICA 1CA5A 2HCCA 2H1EA 1F9PA 2JYOA 1ILPA 2HDMA 1LV9A 1PFBA 1WTPA 2HCIA 3FDTA 1S4ZA 3F2UA 5EQ0A 3N52A 3I91A 1M8AA 2EOTA 3IFDA 1U4MA 3P7JA 1SDFA 5E4WC 4ZAIA 1O80A 2HUGA 1HRJA 3IL8A 2RA4A 1IKLA 2N88A 4ZKBB 1QNKA 1AP0A 5CMDA 5EKIA 4LMQD 3I8ZA 1DOMA 1X32A 4HEDA 4IUQA 4MN3A 4UAIA 1BNZA 3UI2A 2EE1A 5DNFA 1KNAA 2L1BA 1ICWA 3D6WA 4ZKCB 1DZ1A 1B50A 1JE4A 3I90A 4RWSC 5AFWA 1CM9A 1ESRA 2FINB 1J9OA 5D14A 2HDLA 5EJWA 2JP1A 1VMCA 4ZLTF 4OIKA 1BO0A 1WTVA 2DY8A 2B2UC 3LWEA 4NW2A 4U68A 4QUCA 1G91A 4CJ2C 3SVMA 1EIGA 2KEEA 1B3AA 2FHTA 4QUFA 4R8IA 1SAPA 2MJ8A 5CBAE 4CJ1B 1G6ZA 2NZ1D 1EOTA 2B2UA 2KOLA 1NAPA 4OIJA 2MP1A 3DEPA 4XT3B 1EIHA 1X3PA 2RVLA 2EPBA 1X3QA 1Q3LA 2B2YC 5E4XA 3G7LA 1ILQA 2L4NA 3TN2A 2N55A 1HFGA 1RHPA 2B2VC 3FPUB 1IKMA 1HUMA 2NYZD 2MPMA 3DEOA 2B2YA 1B4OA 1F9QA 1MSHA 5COYA 3I3CA 3Q6SA 1AZPA 3ONAB 2J7ZA 1WTWA 1U4LA 4X3KA 1ZXTA 1NR4A 2B2TC 5EPLA 2B2VA 4X3TA 2L12A 2Q8TA 2FMMA 1KNEA 1WTQA 2K1BA 4HSVA 5T1IA 1BF4A 2SDFA 1DONA 1MSGA 1XX8A 4ZK9B 1F9SA 1NCVA 2FJ2A 2KUMA 1PLFA 2M2LA 1DOKA 3DM1A 4IUUA 1XYIA 2L9HA 1F2LA 1F9RA 4XDXA 3H91A 3GV3A 1RTOA 4O42A 4R9WA 1AZQA 2IL8A 1NR2A 2K05A 5D65A 1TVXA 1BBXC 1G2TA 2X6GA 1U4PA 4DN4M 1E0BA 3R93A 1IL8A 4HCSA 1B2TA 3GV6A 2VXWA 1HHVA 1RJTA 4XT1B 1WD0A 4RA8A 1EL0A 2K03A 1EQTA 1PFMA 2BDNA 1QE6A 2L11A 2KVMA 1MI2A 4IUTA 3MWYW 1WTXA 5EPJA 2K01A 1RODA 2K28A 1PFNA 3HP3A 4X3SA 1WTRA 1GUWA 1QG7A 2R3ZA 1ML0D 4HAEA 5CORA 1WD1A 2X6LA 1C8CA 5JJZA 1A15A 2CVRA 1PDQA 1RTNA 2K04A 1B53A 2B2TA 4IUPA 1G2SA 2B2WC 2RSNA 4CJ0B 4IUVA 4IURA 4X3UA 4MHEA 2XIWA 1DOLA 1O7YA 2KEDA 1J8IA 2B2WA 1HFNA 3QO2A 1HA6A 3KUPA 1CA6A 2KECA 2D9UA 2RSOA 5T1GA 4RAUC 1WVLA 1O7ZA 2Q8RE 3KBXA 1WTOA 3TZDA 1U4RA 5EPKA 1MGSA 2MGSA 2NWGA 3MTSA 2FFKB 1HUNA 2DY7A
chains in the Genus database with same CATH superfamily
4CGYB 2EYHA 1HTLD 4DR2Q 4HIKA 3QJYA 1S5FD 4C3HB 4IO9A 1M8AA 2B29A 2HUGA 3HFZB 4ZKBB 4POGA 3CU7A 1MJEA 1YNXA 2H4OA 3DWPA 2DJFC 3X3MA 3AB9A 1PZID 1ICWA 4AQYL 4DR6L 5ELNA 1B50A 4QIWB 1IYJB 3S9WA 3OHXC 3PO2H 3T1YQ 5L37A 1X55A 2JA8H 3QB3A 1CI3M 1B3AA 5FK9C 1EOTA 2MO1A 3CAMA 3DXJC 4L6TB 1HQMC 2E8GA 4WRDA 4UDUC 4PQXA 4TRDA 1VQHA 1IBMQ 4RHSA 2ZXRA 2ZXOA 3M4YA 2MPMA 4JV5Q 1ZXTA 1JJ2A 2FMMA 3PV0A 5LL6X 4WJWA 4CKBA 5ELBA 5IT9L 3A8IE 1B9NA 2DGYA 2TMPA 4DV1L 2D5DA 4O42A 1AZQA 2EXDA 4DXGA 3D4DA 1PTOF 1EQQA 2BA1A 1F2MA 4HCSA 1B2TA 1PHJA 1XTCD 4XT1B 3BU2A 4LF4Q 3S1QH 3I4NB 2PQEA 1BCPF 3H0GG 4LFBQ 4UP8A 1V1QA 3PCOB 5KYLA 3CPWA 3CRKC 4V190 4KN7C 4YCUA 2F52A 2JK8A 5JJZA 1MD2D 4IUPA 4IURA 2N78A 4MHEA 3PMFA 2IWHA 1VQPA 2B63G 3D31A 2NVQB 3CMEA 1TWFH 3OMGA 1GO3E 2L55A 4NB3A 2JE6I 3T1HQ 2G9HD 3NHHA 4R4IA 4OXPA 3Q23A 1NSNS 2H5XA 3TZDA 5IGBA 2F0VA 3MTSA 4C3JB 2FFKB 4B3MQ 4KKUA 4FF4A 3S1MH 2E2JH 4RGNA 4P73A 4AIMA 1HPCA 2YU9H 3SHLA 1M4VA 1Y8PB 3VR6A 1JOKA 2NB0A 1SDFA 1LUZA 2A6ED 3S14H 4K14A 1XJVA 4OO1I 2Z6BA 3W3AA 3GTKB 4LMQD 2N8NA 4XQNA 3JAMc 1D8LA 3D3RA 1VMCA 4OIKA 1B9MA 1DGSA 3BYTB 2FXQA 1Q1BA 1X56A 4HMJA 3FMCA 1G6ZA 5BN4A 3J80L 2MP1A 1PRTB 2Q2IA 1Y1VB 4K0KL 4N9TA 4L5QA 2NVYB 1SNPA 4P71A 4APVA 3HOUG 4DR4L 2VUMB 2N55A 2SOBA 4KV6A 5COYA 2VNUD 3ONAB 2J7ZA 1UUPA 2WB1G 1PRTD 1KNEA 3KLWA 1EFID 2QDBA 5LMNQ 4DV4Q 2M2LA 1A8VA 2DNEA 4Y7NB 2L9HA 1PYWD 4XDXA 1ZEQX 1TWGB 4A3IG 4BY7G 5C3EB 2A6HD 2B63H 5K5PA 2F4IA 2K52A 4K2LA 2AWOA 1OXSC 2K14A 3NBHB 4FXDA 4DV2Q 4JI7Q 3VR5A 3KLSX 2AWNA 2UXBQ 4A3DB 2IJ0A 1TS4A 1EY4A 5CORA 3SK6A 5J39A 4GS3A 3KK7A 1SNOA 2B2WC 4O0AA 2AKWB 4JI2Q 3KJOA 2UU9L 5CR3A 4UPAA 4EQPA 3GO5A 4DAVA 5IE8A 3IRBA 1FGBD 1ESFA 2F0HA 1H9MA 2WB1E 2F4VL 4HN7A 2CQOA 4PZ8A 2CFMA 4JI4L 4A3FB 2NWGA 1G51A 2VS1A 1CTMA 5CBEE 4LK1C 2K32A 1LTLA 2EY1A 1JICA 2F0EA 2QF7A 4LNQA 4DR7L 1SMYC 1H9RA 3VA5A 4ZYSA 3CXCA 2VQFQ 3SK4A 1TS2A 3KF8A 3N52A 2RA4A 4JG2A 2N88A 1OTCA 3K59A 3SGIA 2R7ZB 5C44B 4IUQA 3KDFA 3HOUH 4H02A 3DLLA 2RCFA 3HOXB 1JOOA 2BCOA 1KRSA 2CCZA 1LTRD 2O2LD 2F03A 2YTXA 1PH3A 2V4DA 3D6CA 5G3LF 3OMCA 4YWKA 3URYA 5HY6A 1NTGA 4LUVA 2OQKA 3RN2A 2A73B 1VDZA 3OWEB 2B8GA 2RVLA 2M00A 1STYA 4LW1A 2QEXA 4A3IH 1QVGA 1ILQA 3STBC 3X3NA 4X66Q 1STNA 1WYDA 5JPMC 1EYAA 3ERQA 1RDPD 2B2TC 3OYYA 5C0XG 4OHJA 2XTIA 2Y0SG 5CYUA 4GNXB 4LJZC 1TY2A 4PMBA 1PRTF 1YITA 3HKZG 4FXKC 1TWAB 5GAEC 1K8AC 3A7LA 3M4QA 3MEHA 3CCRA 5M5WH 1FVIA 1HXYD 3DUZA 3M3YH 2OEOA 5E1FA 3TP5A 1I94Q 1PFMA 1FJGL 3T4AC 1E7ZA 5IODA 5CV5A 3M4PA 1CZGA 1WI5A 1SEBD 2E5LL 4UHVA 1VQMA 1EEID 2AMCB 4BA2I 1OXVA 3CQZB 1X3EA 4JCVE 1NMGA 1WCMB 1TKWB 2KEDA 5I4DA 2F0GA 2ZTCA 2KECA 4B3SQ 3GP7A 3GTPH 4HJAA 1TR5A 4GKKL 1HNWL 2CHBD 1PMRA 1VQJA 5C4JB 3S2HB 1O78A 1PXUA 5EPKA 2JA7G 1L0XB 2RCNA 4DR2L 3HKZE 3MXNA 3PO3B 3FKIG 5GROA 3EN2A 3N6RA 2F0PA 1R9TH 1VQLA 2IHEA 1VQ5A 1PVOA 2A68D 1LABA 1O80A 1HRJA 1D6EC 5EKIA 3ZJYC 4UAIA 3T1YL 5C5MA 3CCUA 3CMAA 2GA4B 1CM9A 1VQKA 1SLJA 2JP1A 3HG9A 4DR1Q 2DY8A 5C0XH 1NNXA 3KJPA 2R92B 5C4HA 2B2UA 4HJ9A 1SXTA 1L1OB 1LT5D 1IBML 1UWVA 4BY1G 4JV5L 3H09A 3HS0C 1QZHA 2B2YA 3ULPA 1MSHA 4NPSA 3CCQA 1WTWA 1CFMA 4X3KA 3EIVA 2B2VA 1U5KA 3CCJA 1WTQA 3FPPA 5KRUA 4A75A 1DONA 4OWXB 2KUMA 2E74C 3U9SA 3GV3A 5CC4A 1EOVA 1SRUA 4DXFA 3VYUA 4LF4L 3K7AB 1Y1WB 1K0SA 4DN4M 2IX1A 4LFBL 5JJKA 1HHVA 3MAQA 3QWNA 2A1AA 5JAVA 4ME3A 4DPGA 3E0EA 3CF5A 3RD4A 3HOVG 2K5NA 1BBUA 3S1QB 5EAYA 2C35B 5I2XA 1AE2A 2JA7H 4POFA 4B9WA 2F0TA 3FKIH 2EYMA 2K5VA 1E2WA 3T1HL 3V2TA 1KC8C 3CHBD 3E9HA 2I07B 3HKSA 1UNSA 4JC0A 4HIOA 4IPHA 4L8JA 5C4XG 2F0OA 1KLGD 1P16A 4WFN3 1O7ZA 1GVPA 4B3ML 1TWFB 1A2UA 5ELEA 4B3TQ 2O4XA 1LO5D 2K05A 2EOTA 1J5EQ 5M5YH 4FO2A 3K80C 1CHQD 1LTAD 1SJED 2NN6G 2NVTH 3O13A 3PUVA 4U673 4IALA 5E4WC 4ZAIA 3J80i 3S1MB 5BR8Q 2E2JB 1H9SA 4PV1C 2YU9B 3MFGA 2F0FA 5DM63 4ZUIA 3QOLA 4BY1H 1A6XA 4YCWA 2EE1A 1EYDA 3SXHA 1EY9A 1DZ1A 1UEBA 3I90A 3ND8A 1SFOH 4Q0FA 1BXTA 1KIXA 1JC7A 2XWJB 4TSSA 5FO9B 4KKSA 3HOZG 3G6EA 1X65A 2PYKA 1Q8IA 2Z1CA 4QUCA 3MXPA 1EIGA 1SYEA 3KFUA 4HJ5A 3TBIB 1D2BA 1XPRA 3TS0A 4FF1A 3FPUB 2NYZD 1PTOC 1LACA 3ITPA 3OW2A 1F9QA 4IOCA 2VZAA 3RLFA 1M1KC 2YTYA 5LMNL 3S15H 4DV4L 2Q8TA 4BWGB 4O1NA 1BCPC 1B44D 3HOVH 1T9HA 2ICEC 3DM1A 2KCCA 1BUVT 1U9RA 3H0GB 1W6JA 1FNUA 1PH2A 4A3KG 4A3CH 4KK7A 1X3GA 2EXZA 2OXPA 2F0IA 2A69D 1AN8A 4A76A 3HRZC 3R93A 4DF7A 1STHA 4DV2L 4JI7L 5KEEA 2UXBL 3L9AX 4K5VA 4LF9Q 4DNRB 2B63B 1I3QH 2HIXA 3NBHA 3PO2G 3SK8A 3MWYW 3U4ZA 2Q8IB 1ZYRD 4JI2L 4TKOB 4YCVA 4A3JH 1V9PA 1Q1EA 2F0QA 2K04A 1RTNA 4DK1A 1B53A 1X6OA 2ZM6Q 2JA5G 1KDCA 1PZJD 4GLVB 3FVQA 4DV7Q 1ICFB 1SNDA 4DV6Q 4X65Q 2RSOA 4L5TA 1SE8A 2Q8RE 3GTOB 3KBXA 4K8IA 1RKNA 1KHIA 2RHQB 2WV6D 1SSOA 1TS3A 3PIO3 2VQFL 3KYHC 2ES2A 1FL0A 3NXWA 3HOZH 4C3IB 5EQ0A 1WOCA 2MHVA 1OO9B 1A0IA 5CV6A 4NXNQ 3M85A 3A74A 4UP9A 4H44C 1IKLA 1QNKA 4IPGA 3NSWA 1NJIC 3UI2A 1I6HH 4P72A 1TU2B 1JE4A 1SE4A 5AFWA 1BVSA 3H94A 3MFYA 4FNFA 1UE7A 3HOUB 2B2UC 2LFNA 5A2QE 3CPFA 5ELFA 3CC4A 1PZKD 1SAPA 2WB1B 5CV4A 4KD4A 3RNUA 3GQBA 4X66L 5M3FH 4A3KH 1IBKQ 4DV5Q 1X3QA 2B2YC 2L4NA 4XQJA 3B6YA 2B2VC 1LLRD 4Z9CB 1UEAB 2PZWA 4YHHQ 1S72A 3KLRA 4A3IB 4BY7B 4I7ZC 3EVQA 3S1NH 4KHPQ 2F0JA 1EY7A 2A74C 2A19A 4P75A 4GNXA 4DU9A 2K50A 4H13C 2AUKA 3J81i 3J7YW 4G7ZC 1DYQA 3C1EA 2JA5H 4LF8Q 4JVZA 1U4PA 1I94L 1PV4A 1IHZA 2NVXH 1D1IA 3MA2B 5M5WB 4BBRG 3FEWX 2WAQG 3KF6B 1EYGA 1EQTA 1OXXK 1JJGA 4HMIA 1X9NA 1IW7C 3DHQA 4H7BA 5FLMG 1MI2A 1HA5A 3I55A 3CCVA 2R3ZA 4DK6C 1JCKB 2NN6I 1PH9A 2B2TA 1OXUA 2XRSD 4R8NA 1KABA 1Q8KA 1R4QB 4F7XA 1CKMA 2OF1A 3P20A 1IYUA 1ASYA 4B3SL 3PGZA 1EZ8A 3HOWG 1CA6A 2MQHA 5ELOA 1DXMA 4M1UB 2D9UA 2PI2A 1DJRD 1VQCA 3EQLC 1WVLA 3MXUA 4K8JA 1GOZA 4DFAA 2CQAA 5E3FA 1WTHA 4JOIA 1TY0A 2ZJPA 1U0LA 2HCCA 3NWSA 4ID6A 3I4MG 1ILPA 5JJIA 1LV9A 1BQQT 5M5XB 4DAYA 3BJUA 1S4ZA 3S17H 5J1ZA 3QOJA 4JBJA 4DK0A 4A3EG 2RBMA 3JC66 3T56B 3OIQA 1XPOA 4OONA 1BNZA 2WAQE 4Y52H 4KHVA 1SROA 5H1SE 2KA7A 1SJHD 1VQNA 5D3IB 2WKDA 3LGJA 3CCSA 1QB5D 4IPDA 5KNDA 3D0FA 1ESRA 2AHOB 3K6OA 2J4XA 4HSPA 1YJNA 1KRTA 3JAML 1BO0A 5BN3A 1G91A 3SVMA 4OL7A 2CWAA 4ZCKA 3J7A5 2LMCB 5C3WA 4R8IA 2K5QA 4GN4B 1PRTC 1STAA 3MHBA 4CHTB 1F2YA 2NTSA 5C3XA 2P5ZX 2C9OA 2Y0SB 5E4XA 1NUCA 1L1OA 1STBA 3HKZB 3PSIA 3R8BA 1HNZQ 4XTCS 1IKMA 3DEOA 2QCPX 4KLKA 2OQ0A 2ZT9C 3PQIA 1Q81C 1SE2A 1H9KA 4AYBG 4BBRH 3W5OA 4JI0Q 3F2CA 4HSVA 1UE1A 1LTBD 2PQAB 2XRQD 2SDFA 5FLMH 3J81E 1L0YB 1VQ7A 4GZYC 1G6PA 1Y14B 1Q12A 2AQ2B 4RMFA 2F1MA 3IAYA 5C5LA 1PH7A 3GTLB 2WIIB 1UAPA 5IWAQ 4HJ8A 2UXCQ 1I50B 3RR5A 5JEAG 2EYLA 3GTMH 3S2DB 1S5DD 3GV6A 3HOYG 3QR8A 3HOWH 2BE5C 4LUOA 1B1ZA 2E2HB 4PG3A 1LT6D 5FO8B 2R7DA 1Q90A 2EJMA 4CKEA 5EPJA 4G57A 4C2MB 2QGQA 3GTQB 3L2PA 4UP7A 1Q7YC 2OTLA 3PIP3 1HNXQ 3BDCA 4ZQ3A 4IN3A 3UDXA 3KLSA 3I4MH 5F2DA 1PH8A 2N3SA 2R6GA 1ZKOA 1HZAA 3FKIB 5JJLA 1E24A 4A3EH 4B3TL 3GTJH 5D3DA 3H3VC 1W3SA 2WACA 3UDGA 4AYBE 2EZVA 1J5EL 4LF5Q 4C3HG 1FYCA 5HGQA 2HT1A 5EBDA 1NY4A 1YJWA 5A2QL 4FYDA 1VMPA 4J8QA 1Z7TA 4X62Q 3I4OA 1DCZA 4KN4C 4DK3C 5BR8L 1PH1A 1CSPA 1K83H 4X6AH 3FDTA 5IY0A 3MC0B 1PTOH 1P8LA 2PMZE 4GLAC 1JWMD 1H95A 1G8ZD 3D4RA 2EY2A 4QJFA 2OTJA 1GUGA 1HZCA 3D6WA 5FJ8G 1VF7A 1HJPA 3U4VA 1GUNA 3MXGA 5LMUQ 4M8AA 5IP7H 4GN5A 2F0DA 4QGUA 1JB3A 4QMGA 2F0UA 3IKJA 5I6YA 4BXXG 4A4IA 4OWTB 4DR3Q 4CDCC 1TWCH 5GQOA 1K8GA 1EIFA 2DN8A 2QKIC 1Q3LA 5DEHA 2N49A 5JEAH 3A55A 3A54A 3HOYH 1K3BC 3BVGA 2IW3A 2F0MA 4GNXC 3RLOA 2SEBD 1CKNA 3S16B 2EQSA 2FJ2A 4C56C 2B39A 3CD6A 3KBGA 4QIWE 3WOEA 1QVCA 2Q2UA 4FDBA 3HOVB 3OW7A 4L63B 4BBSG 3BVZA 1G2TA 4Q5VA 2I5LX 4LF9L 4A3BG 3C1FA 3PIOA 5CGKA 1HR0W 2K03A 1S5CD 3RZOH 1X3FA 3GTGB 4R4QA 2R93G 2F3WA 4IQZA 1EQVA 1T5EA 2KVMA 5M9OA 4C3HH 2K28A 3Q22A 3HP3A 4JW0A 2ATWA 1PH4A 2KHJA 2ZM6L 3I2ZA 2IX0A 3MZ5A 4QCLA 4DV0Q 3TEHB 5C4XB 3WWVA 1I3QB 2XWBB 1YNJC 1LT4D 4CJ0B 3T13A 4DUZQ 4I65A 3UE1A 4DV7L 4DV6L 1O7YA 4O2DA 4X65L 4C3JG 5KYIA 2JN4A 3I4LA 2O5JC 5FLXE 1EY0A 4ZUJA 2MO0A 3BYYB 1SMYD 1JJCB 1ENCA 3A56A 4OGQC 4XYOA 5KGUA 2PNRC 3K5NA 4WORA 4JOIC 2YV5A 1Q86C 1QJOA 2D0PA 1C48A 5FJ8H 3L3OC 4IFDG 4A3LG 2CH4A 1F9PA 1NMFA 2JYOA 4NXNL 4ILWA 3TDQA 3VR4A 1WTPA 3NTIA 1E2VA 4OWWB 1UE6A 3IL8A 1A3TA 3HOZB 4BXXH 4GOPB 5EGTA 5CMDA 2EYOA 4K6DA 1WFQA 3OOCA 1STGA 1CSQA 4ZKCB 2XNAC 1LTGD 1EIYB 4XQQA 2HDLA 1GHJA 1LTTD 3K5MA 2ZXPA 1YEZA 1CT1D 4U68A 3STBD 4IOAA 4YY3Q 2KEEA 4HJ7A 1IBKL 4DV5L 4J6HA 1L1OC 1B3QA 3I4NH 5IYBG 3HZXA 2JA6G 4FP5D 2MNAA 1W2BA 2EIFA 4YHHL 3AQQA 1SE3A 3G7LA 4BBSH 1HFGA 1I4XA 5IGEA 1HUMA 5C6AA 4A3BH 4KHPL 1YBYA 2EVBA 2G5DA 3K8AA 3Q6SA 3OTOQ 1GUOA 1G291 3J81c 1KQSA 5C0XJ 4K6LA 2R93H 3K58A 2ICIA 1I4RA 3WOFA 4LF7Q 1MSGA 1KAWA 1D1KA 1DOKA 1FR3A 4LF8L 1KDAA 2CW0C 1EWHA 1NBWA 1YZ6A 3PO2B 2KCNA 1NR2A 3W1GA 3ICEA 2JA8B 4C3JH 3FP9A 1UE5A 1WD0A 2QDLA 4JI1Q 3W1BA 2JA5B 1HH2P 4MZ9A 2BDNA 3AFPA 3KF6A 2RDHA 2NVXB 4MNOA 1YVCA 1STEA 1QG7A 1XWEA 1RD9D 4IFDH 3S24A 2A5HA 2Z4IA 1IBLQ 4A3LH 1O7LA 1CK1A 3ZYYX 2J0TD 2HD3A 5NUCA 1FNVA 1QCBD 2K5HA 1YNNC 3DMUA 3KUPA 2D2CC 1VQDA 5E7NA 2RDFA 4EGVA 4BS9A 1TWHH 2LKVA 1GXDC 1VQEA 5IYCG 4HTHA 1EQRA 3GDEA 3RZDH 1FNWA 3PUYA 4KY7A 2NVYH 2VUMH 1PYSB 2F3VA 2CKZB 4DKAC 3FRPB 4A3CG 5I2YA 3F2DA 2JEAI 5DM73 4RG1A 1L0WA 2HIVA 1JWSD 3P7JA 1U4MA 2EYFA 3AEVA 5IYBH 4A3GG 2JA6H 1AP0A 5FOBB 3NELA 1SNQA 1DOMA 1I6VC 1AEXA 2E76C 3S17B 4WJ3M 1EU4A 4J1MA 3C3LA 4RWSC 3WDNA 3F8TA 1J9OA 4RGTA 5D14A 4A3JG 1TWGH 1L2FA 4ZLTF 5C3EH 3SK5A 5CV9A 4NW2A 4UY8C 4NKLA 3U50C 3K0YA 4R4CA 4JI6Q 2MJ8A 3NBIA 2NZ1D 3NQTA 1EIHA 2XSCA 1VQGA 4XXEA 1HNZL 1VQ6A 2VB2X 4A3DH 1KLUD 3GD7A 1AZPA 4JI0L 4EQOA 3S14B 1NR4A 4R4OA 1YHBA 3Q24A 5C0XI 4EQ5A 4DV3Q 4CDDC 3LNNA 2YTVA 1NCVA 2KJXA 5IWAL 2PQAA 3P75A 4BBRB 2UXCL 2WAQB 1XYIA 1XXGA 1KTKA 4EVOA 4B3RQ 1EEFD 1ZYRC 3H3VH 5IOCA 2BA0A 3MEFA 2RF4A 4PNYA 1GJXA 3E5SA 4R4TA 1X54A 3K57A 2PCFB 3HOWB 4IUTA 4R1JA 1HNXL 4IFDI 1CQFA 5IYCH 2HHHQ 4F88A 1WD1A 1AH9A 4NXMQ 3C2PA 2PZUA 1V8QA 2RSNA 3KF8B 3G71A 2JXMB 1BR9A 4X3UA 1DOLA 4NMZA 4N8X1 5FLXc 5M3FG 3ULLA 1Q46A 2E2IH 3BDLA 4JK1C 4PZ6A 4LF5L 4I7AA 2ALYB 3NK9A 3CC7A 3LX0A 1GD7A 4A3GH 3I4MB 1EWCA 1AFPA 3G48A 5CV8A 2K5DA 5HURA 3DM3A 4X62L 1MGSA 2AQ3B 4KTAA 2L5TA 5EJWA 4A3EB 3VDYA 1N32Q 2X69A 2AQ1B 3GTJB 4ODGA 2RHSB 2K6AA 1IYVA 4WJ4A 2R7FA 3TSSA 2GVBA 4RKLA 3R2TA 2VL6A 3VYTA 3LWUA 4KY6A 1FGUA 4RHRA 1K83B 4YIJA 1X32A 2KBNA 2UUCQ 1A63A 5LMUL 2VY3A 1TWAH 5JOBA 2Q2HA 1VQIA 2LY7A 3E3XA 1C4QA 1CZWA 2PI2E 2F0KA 1ET6A 1RL2A 1I4PA 1W6KA 4DR3L 1Z6HA 4IJHA 1PTOD 1TIID 5C4ZA 3EBEA 3J80E 4XT3B 3A7AB 3AFQA 4RKBA 1BCPD 5ISRA 4CDEC 3L7ZC 1B4OA 3T51B 1B7YB 4ZRZA 1SYDA 5J3BA 2ENBA 4QQBX 1K0RA 1EWIA 1SR3A 2PMZB 4RCOA 3TP6A 2Z6KA 3HOYB 3Q0AA 1D5XC 4ZK9B 1PLFA 2DUDA 1VQBA 2VQEQ 1VF5C 3Q8DA 1S5BD 4KD3A 5D65A 4IZ8A 5I9OA 5C4JH 1QZGA 3G4SA 4JPBW 2X6GA 1BBXC 3S2HH 1J6QA 4LAAA 2RDGA 3I56A 1QUQB 1MJCA 4V0BA 1V43A 4DNTB 4FF2A 1JORA 1S40A 3UDIA 4HIMA 2GVAA 1LTID 4DV0L 2EYPA 4DUZL 1E1OA 1HR0Q 3RZOB 4LF6Q 2ZTDA 3E6ZX 2SNSA 5J22A 1SNCA 2UUBQ 4KJNA 1CUKA 3F2BA 1BKBA 2EJGC 4A3MG 1JT8A 4OELB 2E2DC 4OO1H 3CCMA 1N8RC 3M7GA 2F0NA 2I0QA 3J7AF 3M3YB 2XN9C 2R92H 2MGSA 1EY8A 3H15A 4HCEA 4BA1I 1HZ9A 4RFBA 1A3UA 1JMCA 4DAMA 2HCIA 4PMWA 1F2ZA 4IJLA 4G7HC 1V1PB 4DUYQ 1VQ8A 5A35A 4DR5Q 4GOPA 2JSOA 1GKHA 1ASZA 2A6EC 2MFIA 4DAPA 3QIAA 4YY3L 4J15A 3GTPB 3K7AH 1WTVA 1Y1WH 3LWEA 3I72A 5FO7B 4HR7B 3VR2A 5CBAE 1ENAA 4OIJA 1NAPA 3UE0A 2F0LA 3DEPA 4N8FA 1XNRQ 4DGZA 3A5UA 3OTOL 3TN2A 4A93G 3NE5B 3BS1A 1R9TB 1D5ZC 2UXDQ 4LF7L 3A8JE 4DR1L 3D8GA 1K9MC 4BBSB 5IGCA 5IT9c 1KD1C 2K1BA 1A62A 4JI3Q 3I7FA 4A3BB 1N33Q 2PO4A 4JI8Q 1K73C 3TRZA 2F3IA 2PW5A 4KKTA 1VQ9A 2WKCA 5IP9G 2R93B 1SNMA 3H91A 1RTOA 4E6IA 1YI2A 4KI0A 1IW7D 1CQVA 4YWLA 4ULLA 2L0CA 4JI1L 3M9BA 4XIGS 4A3MH 2LXJA 3SR1A 1MBYA 5DAUA 3TZUA 4GKJQ 2JA9A 1Y8NB 1WTXA 2A6HC 1RODA 5IP7G 1PFNA 3TQYA 1IBLL 1XPUA 1GUWA 4HAEA 1C8CA 2EDGA 3CCEA 1B8AA 1XNQQ 3HGBA 3SE0A 3F1ZA 1BOSA 1CHPD 3RN5A 1PH5A 1H9SB 2JQOA 2K33A 2QILA 3NPPA 3OWFA 5JVG3 3A0JA 2ZTEA 3FHWA 2BH2A 1T5XD 1HA6A 4CBVA 3S1RH 2D62A 5T1GA 4B9XA 5IGFA 1I5FA 1MIUA 4ME5A 4C3IG 5G3LD 1EY5A 5HGTA 2EY5A 1II3A 2DY7A 3AMUA 1TWHB 3EA6A 4B08A 4LFAQ 4L5RC 1JOQA 3J81j 1Y69U 3RZDB 5EKKA 2IT1A 3I91A 5IGGA 4IPCA 5M3MG 2CWPA 2JA7B 1Z9FA 3M4OH 3G6JB 2DJGC 3IFTA 4A93H 1B70B 5DNFA 4HIDA 5JPNC 5LL6S 3BZKA 4XYQA 3H0GH 2JA6B 4EQNA 3K7UC 3A5ZB 1QNUA 4JI6L 5EKLA 3J80c 2PPBC 4QL5A 5KNBA 4QUFA 1SN8A 2D0OA 3RMHA 2BOSA 3UDFA 5M5YB 5IP9H 1RIPA 3VA7A 1VQAA 3NENA 4X64Q 2NVTB 3CKIB 2LSSA 1PH6A 1VQ4A 4DV3L 1QVFA 2Z6KC 3BVMA 4JYAQ 3V05A 1MHWC 2L12A 3HEJA 2AUJD 2Z4HA 1VQFA 3K81C 5T1IA 2KHIA 4K5WA 3VYRA 4BY1B 4B3RL 1F9SA 2UUAQ 2BE5D 2WFWA 3P1HA 1SFOB 1F9RA 1JE5A 5GAHC 3PUXA 1TT2A 5EBCA 3GTOH 5JEAJ 1IL2A 3VR3A 2NZOA 1QWYA 2I5HA 4PZ7A 1EL0A 2HQLA 4KJOA 1LYLA 2HHHL 3VYSA 1R4PB 4JI5Q 2L11A 5AJ3Q 4NXML 4C3IH 2IY5B 3OSOA 1QILA 1A15A 2DNCA 4AH6A 1CKOA 2ASBA 3I4NG 3EFXD 3S15B 4GN3B 2YYZA 1EYCA 1A3VA 5KNCA 1N34Q 4ALPA 1HFNA 4JBKA 4OX9Q 1N36Q 5M3MH 2VB3X 3NEMA 4MIUA 1N32L 2E2IB 2OCEA 3PUWA 3U58A 5I6WA 4A3GB 4LFCQ 1XMQQ 1BBWA 2Z8LA 1XMOQ 3OIPA 5BN5A 2H1EA 4K2KA 3SDZA 2HDMA 3W2DA 4IUNA 4GOPC 4A3JB 2UUCL 4BY7H 4KMUC 2BH8A 4HEDA 4LUZA 2G9DA 1H9JA 1HCZA 4MN3A 1KNAA 2L1BA 2QA4A 2EJFC 3NTHA 2A68C 5LHY1 5IGDA 1LTSD 1ET9A 4AQYQ 1KDBA 4DR6Q 1SYCA 1LT3D 3L0OA 5KIXA 1E2ZA 1EUJA 4CJ2C 3T16A 2ZJRA 1Q82C 4MTNA 5K36G 3NTKA 1SYBA 2CH4W 4CJ1B 1DD2A 2KOLA 4RH6A 3QG1A 2QEJC 4P74A 4K5XA 1X3PA 3A8KE 2EPBA 1HZBA 2O5IC 1IZ6A 1QOHA 2WINB 1K8MA 3T53B 4PMCA 5EPLA 4X3TA 2K7VA 1Y1VG 2VQEL 2VUMG 3J81L 2PNHA 1YHQA 1I6HB 2PZTA 1SBBB 3K0XA 1N9WA 2HQEA 3I70A 2Q2TA 2R61A 1F2LA 1YHAA 3NQIA 2IL8A 3U9OA 3R2IA 4DV1Q 4DNIA 1RJTA 3M7NA 1PYBA 3ULJA 1YNJD 1LM0A 2JEBI 4F8MA 1QUQA 1HR0L 5M3FB 1QE6A 4A3KB 3C46A 2Y0SE 4YWMA 4LF6L 5M5XH 1C0AA 4NDXA 4X3SA 5C3EG 1WTRA 1E1TA 2NUCA 2UUBL 1JB7A 2NVQH 3NUCA 4DAYB 3S1NB 2XIWA 1A2TA 3CC2A 1GUTA 2B8FA 4A3DG 1J8IA 1HQRD 2MUYA 3QO2A 5FKAC 1F77A 1C9OA 1D7QA 2IHFA 4DA2A 4L5SA 2K75A 5TSSA 4ABNA 2EY6A 3TREA 4IFDJ 1TQOA 1SYFA 2Z9HA 2LXKA 1CA5A 1IXRA 3CW2C 2B3GA 1PFBA 3GTKH 4DUYL 2PW7A 1V1OA 3F2UA 1PFSA 3IFDA 1VS0A 4DR5L 5K36H 4A3FG 2TSSA 3NP8A 1PA6A 1K28A 4CKCA 5GAGC 1V1PA 2I5MX 4CDFC 3I8ZA 4FVMA 2XGTA 1SYGA 1KAAA 1SMXA 2KCTA 5GADC 3GTLH 3OPOA 2KCMA 1I50H 1Y1VH 3S2DH 2R7ZG 5C44G 2I46A 3JAMi 1XNRL 1BDOA 2FHTA 2OT2A 4S3SA 3HOXG 3D4WA 2E2HH 1FD7D 2NZHA 3TP7A 2UXDL 3E9IA 1Z47A 2K5WA 2NTTA 2FMCA 1EFWA 5JVH3 1VQOA 4C2MH 2L15A 4K0KQ 3GTQH 1GUSA 2CW0D 5LMNW 4DR4Q 4JI3L 1S5ED 1M90C 1N33L 4Y7NH 4JI8L 1VCIA 3BZDB 2KENA 1BF4A 3NWTA 2BDOA 1XX8A 2IX3A 4MTKA 1XTDA 3EJIA 3ER0A 3H6MA 4QF4A 4R9WA 1TVXA 4RCNA 1K8OA 1IL8A 1OXTA 1TS5A 2VXWA 4LWCA 4GKJL 3CP0A 2RKSA 3DWQA 4RA8A 2QW7A 3PIPA 3K5LA 4G4KA 5DLQE 1XNQL 2GN5A 2A69C 4A3MB 1ML0D 1YNND 2X6LA 4P2CB 3BDOA 1PDQA 3KOJA 1Y8OB 1E3PA 5IT9E 4IUVA 4QY7A 3CCLA 2VW9A 1S3OA 5FLXL 2RQXA 1AE3A 4A3FH 2UU9Q 2ID0A 4RAUC 2WP8J 1WJJA 1WCMG 4JBWA 1KL9A 2OWOA 3GTMB 3S1RB 1YIJA 4LFAL 2F4VQ 2ZJQA 2KQ3A 5IYDG 3R3OA 4JI4Q 2JJQA 1C7YA 1I4HA 4H0LC 2R7ZH 5C44H 4KY5A 4NP5A 4C1NI 4QB4A 4DR7Q 3HOXH 2V1CC 5ELDA 5CV7A 3KDFB 3PO3G 3S16H 4TVAB 1DM0B 1E22A 3K5OA 4OEMB 1CKNB 3M4OB 2FINB 3J7ZC 1NE3A 4A93B 2KHSA 3JAME 4RGOS 2C5CA 2SNMA 4RGMA 1K3RA 3RUZA 1O7IA 2EYJA 3ERSX 2XVSA 4X64L 4FF3A 3GTGH 1I4GA 3PF5A 1I4QA 3SEBA 4OO1G 3BZCA 4JYAL 1RHPA 3E0JA 1YJ9A 3V96A 1JR0D 3AYHB 2E75C 4KHZA 4GLXA 1MKHA 3RLNA 3I3CA 5C4XH 5IIFA 4G7OC 2R92G 1PTOB 1U4LA 1EY6A 2UUAL 2JA8G 1ONLA 3CRLC 2Z0SA 2IPKD 3EROA 1BCPB 3TS2A 3PF4A 1HTPA 4N9PA 3TP8A 4IUUA 2NN6H 3MVVA 1JQYD 4AYBB 3ND9A 4FXGC 3TMEA 1E0BA 4JI5L 5AJ3L 2NBFA 2M9VA 1GM5A 1TWCB 2A8VA 3CQZH 1ENFA 3BG3A 2K01A 1WCMH 1KXLA 3I73A 2F0SA 1Y1WG 2K4KA 1FJGQ 1RF2D 4TQUS 2CVRA 2LS01 5IYDH 1G2SA 3AU7A 2E5LQ 3J7AV 1N34L 4C1NK 3H3VI 4OX9L 3DWAA 1N36L 4JBMA 1EU3A 1EZ6A 1JWUD 2B2WA 1AW7A 1D5MC 1RCVD 5ELCA 5I9PA 1TXYA 3PO3H 3PUZA 4LFCL 1XMQL 1WTOA 1U4RA 1XMOL 4F87A 3MXNB 5M3MB 4GKKQ 1HNWQ 4EX5A 1HUNA 1GHKA 2F0WA
chains in the Genus database with same CATH topology
4CGYB 2EYHA 1HTLD 3QJYA 1S5FD 4C3HB 1M8AA 2HUGA 4ZKBB 3CU7A 2H4OA 3DWPA 3X3MA 3AB9A 1PZID 1ICWA 1B50A 4QIWB 3S9WA 3OHXC 3QB3A 1CI3M 1B3AA 5FK9C 1EOTA 3DXJC 4L6TB 1HQMC 4WRDA 4UDUC 4PQXA 4TRDA 4RHSA 2ZXRA 2ZXOA 3M4YA 2MPMA 1ZXTA 2FMMA 3PV0A 5LL6X 4WJWA 4CKBA 5ELBA 5IT9L 3A8IE 1B9NA 2TMPA 2D5DA 4O42A 1AZQA 4DXGA 3D4DA 1PTOF 2BA1A 1F2MA 4HCSA 1B2TA 1XTCD 4XT1B 3I4NB 2PQEA 1BCPF 5KYLA 3CRKC 4V190 4KN7C 5JJZA 1MD2D 4IUPA 4IURA 4MHEA 3PMFA 2IWHA 3D31A 2NVQB 3OMGA 2L55A 2JE6I 2G9HD 3NHHA 3Q23A 1NSNS 3TZDA 5IGBA 2F0VA 3MTSA 4C3JB 2FFKB 4KKUA 4FF4A 4RGNA 1HPCA 3SHLA 1M4VA 1Y8PB 3VR6A 1JOKA 2NB0A 1SDFA 2A6ED 4K14A 4OO1I 3W3AA 3GTKB 4LMQD 4XQNA 3D3RA 1VMCA 4OIKA 1B9MA 3BYTB 1Q1BA 4HMJA 3FMCA 1G6ZA 5BN4A 3J80L 2MP1A 1PRTB 1Y1VB 4N9TA 2NVYB 1SNPA 2VUMB 2N55A 2SOBA 4KV6A 5COYA 2VNUD 3ONAB 2J7ZA 1UUPA 1PRTD 1KNEA 1EFID 2QDBA 2M2LA 2DNEA 4Y7NB 2L9HA 1PYWD 4XDXA 1ZEQX 1TWGB 5C3EB 2A6HD 5K5PA 2F4IA 4K2LA 2AWOA 1OXSC 4FXDA 3VR5A 3KLSX 2AWNA 4A3DB 2IJ0A 1TS4A 1EY4A 5CORA 3SK6A 5J39A 3KK7A 1SNOA 2B2WC 5CR3A 4EQPA 3GO5A 4DAVA 1FGBD 1ESFA 2F0HA 1H9MA 4HN7A 4A3FB 2NWGA 1CTMA 5CBEE 4LK1C 2K32A 2EY1A 1JICA 2F0EA 2QF7A 1SMYC 1H9RA 3VA5A 4ZYSA 3SK4A 1TS2A 3KF8A 3N52A 2RA4A 2N88A 3K59A 2R7ZB 5C44B 4IUQA 3HOXB 1JOOA 2BCOA 1LTRD 2O2LD 2F03A 2V4DA 3D6CA 5G3LF 3OMCA 3URYA 2A73B 1VDZA 3OWEB 2B8GA 2RVLA 2M00A 1STYA 1ILQA 3X3NA 1STNA 5JPMC 1EYAA 3ERQA 1RDPD 2B2TC 5C0XG 4OHJA 5CYUA 4LJZC 1TY2A 4PMBA 1PRTF 4FXKC 1TWAB 3A7LA 3MEHA 1HXYD 3DUZA 2OEOA 5E1FA 3TP5A 1PFMA 3T4AC 5IODA 5CV5A 1CZGA 1SEBD 1EEID 4BA2I 1OXVA 3CQZB 1WCMB 1TKWB 2KEDA 5I4DA 2F0GA 2KECA 3GP7A 1TR5A 2CHBD 1PMRA 5C4JB 3S2HB 1O78A 1PXUA 5EPKA 1L0XB 3MXNA 3PO3B 3N6RA 2F0PA 2A68D 1LABA 1O80A 1HRJA 1D6EC 5EKIA 4UAIA 5C5MA 2GA4B 1CM9A 2JP1A 3HG9A 2DY8A 5C0XH 2R92B 5C4HA 2B2UA 1SXTA 1LT5D 3H09A 3HS0C 2B2YA 1MSHA 1WTWA 1CFMA 4X3KA 2B2VA 1WTQA 3FPPA 5KRUA 1DONA 2KUMA 2E74C 3U9SA 3GV3A 5CC4A 4DXFA 3VYUA 3K7AB 1Y1WB 4DN4M 2IX1A 1HHVA 3MAQA 3QWNA 5JAVA 3RD4A 3S1QB 5I2XA 4B9WA 2F0TA 2EYMA 1E2WA 3V2TA 3CHBD 2I07B 1UNSA 4L8JA 2F0OA 1KLGD 4WFN3 1O7ZA 1TWFB 1A2UA 5ELEA 2O4XA 1LO5D 2K05A 2EOTA 4FO2A 1CHQD 1LTAD 1SJED 2NN6G 3O13A 3PUVA 4U673 4IALA 5E4WC 4ZAIA 3S1MB 2E2JB 1H9SA 4PV1C 2YU9B 3MFGA 2F0FA 5DM63 4ZUIA 3QOLA 1A6XA 2EE1A 1EYDA 3SXHA 1EY9A 1DZ1A 3I90A 3ND8A 4Q0FA 1BXTA 1JC7A 2XWJB 4TSSA 5FO9B 4KKSA 2PYKA 2Z1CA 1Q8IA 4QUCA 3MXPA 1EIGA 1SYEA 3TBIB 1D2BA 4FF1A 3FPUB 2NYZD 1PTOC 1LACA 3ITPA 1F9QA 3RLFA 2Q8TA 4BWGB 4O1NA 1BCPC 1B44D 2ICEC 3DM1A 2KCCA 1BUVT 1U9RA 3H0GB 1W6JA 1FNUA 4KK7A 2EXZA 2OXPA 2F0IA 2A69D 1AN8A 3HRZC 3R93A 4DF7A 1STHA 5KEEA 3L9AX 4K5VA 4DNRB 2B63B 3NBHA 3SK8A 3MWYW 2Q8IB 1ZYRD 4TKOB 2F0QA 1Q1EA 2K04A 1RTNA 4DK1A 1B53A 1KDCA 1PZJD 3FVQA 1SNDA 2RSOA 2Q8RE 3GTOB 3KBXA 4K8IA 1RKNA 2WV6D 1SSOA 1TS3A 3PIO3 3NXWA 4C3IB 5EQ0A 2MHVA 1OO9B 5CV6A 3M85A 4H44C 1IKLA 1QNKA 3NSWA 3UI2A 1TU2B 1JE4A 1SE4A 5AFWA 3H94A 3MFYA 4FNFA 3HOUB 2B2UC 2LFNA 5A2QE 5ELFA 1PZKD 1SAPA 2WB1B 5CV4A 4KD4A 3GQBA 1X3QA 2B2YC 2L4NA 4XQJA 2B2VC 1LLRD 4Z9CB 1UEAB 2PZWA 3KLRA 4A3IB 4BY7B 4I7ZC 3EVQA 2F0JA 1EY7A 2A74C 4DU9A 4H13C 2AUKA 3J7YW 4G7ZC 1DYQA 3C1EA 1U4PA 1IHZA 1D1IA 3MA2B 5M5WB 3FEWX 1EQTA 1OXXK 4HMIA 1IW7C 3DHQA 4H7BA 1MI2A 1HA5A 2R3ZA 1JCKB 2NN6I 2B2TA 1OXUA 2XRSD 4R8NA 1KABA 1R4QB 4F7XA 2OF1A 3P20A 1IYUA 1EZ8A 1CA6A 1DXMA 4M1UB 2D9UA 1DJRD 3EQLC 1WVLA 3MXUA 4K8JA 1GOZA 4DFAA 2CQAA 5E3FA 1TY0A 2HCCA 3NWSA 4ID6A 1ILPA 1LV9A 1BQQT 5M5XB 4DAYA 1S4ZA 5J1ZA 3QOJA 4DK0A 2RBMA 3T56B 3OIQA 1BNZA 4KHVA 2KA7A 1SJHD 5D3IB 2WKDA 1QB5D 5KNDA 1ESRA 3K6OA 4HSPA 2J4XA 3JAML 1BO0A 5BN3A 1G91A 3SVMA 4OL7A 2LMCB 5C3WA 4R8IA 2K5QA 1PRTC 1STAA 3MHBA 4CHTB 1F2YA 2NTSA 5C3XA 2C9OA 2Y0SB 5E4XA 1NUCA 1STBA 3HKZB 3R8BA 4XTCS 1IKMA 3DEOA 2QCPX 2ZT9C 1SE2A 1H9KA 4HSVA 1LTBD 2XRQD 2SDFA 3J81E 1L0YB 4GZYC 1Q12A 2AQ2B 2F1MA 3IAYA 5C5LA 3GTLB 2WIIB 1UAPA 1I50B 5JEAG 2EYLA 3S2DB 1S5DD 3GV6A 2BE5C 1B1ZA 2E2HB 1LT6D 5FO8B 4CKEA 1Q90A 2EJMA 5EPJA 4G57A 4C2MB 3GTQB 3PIP3 3BDCA 4ZQ3A 4IN3A 3KLSA 5F2DA 2R6GA 1ZKOA 3FKIB 5D3DA 3H3VC 2WACA 2EZVA 4C3HG 1FYCA 5EBDA 5A2QL 4FYDA 1VMPA 4J8QA 1Z7TA 1DCZA 4KN4C 3FDTA 3MC0B 1PTOH 1JWMD 1G8ZD 3D4RA 2EY2A 1GUGA 3D6WA 1VF7A 1GUNA 3MXGA 4M8AA 2F0DA 1JB3A 4QMGA 2F0UA 3IKJA 5I6YA 2DN8A 2QKIC 1Q3LA 5DEHA 5JEAH 3A55A 3A54A 3BVGA 2IW3A 2F0MA 2SEBD 3S16B 2FJ2A 4C56C 2B39A 3KBGA 3WOEA 3HOVB 3OW7A 4L63B 3BVZA 1G2TA 4Q5VA 3C1FA 5CGKA 2K03A 1S5CD 3GTGB 2F3WA 4IQZA 1EQVA 1T5EA 2KVMA 5M9OA 2K28A 3Q22A 3HP3A 2IX0A 3MZ5A 4QCLA 5C4XB 1I3QB 2XWBB 1YNJC 1LT4D 4CJ0B 3T13A 4I65A 1O7YA 4C3JG 5KYIA 2O5JC 3I4LA 5FLXE 1EY0A 4ZUJA 3BYYB 1SMYD 1ENCA 3A56A 4OGQC 4XYOA 5KGUA 2PNRC 3K5NA 4WORA 1QJOA 1C48A 4IFDG 3L3OC 1F9PA 2JYOA 4ILWA 3TDQA 3VR4A 1WTPA 3NTIA 1E2VA 3IL8A 1A3TA 3HOZB 5EGTA 5CMDA 2EYOA 4K6DA 3OOCA 1STGA 4ZKCB 2XNAC 1LTGD 4XQQA 2HDLA 1GHJA 1LTTD 3K5MA 2ZXPA 1CT1D 4U68A 2KEEA 4J6HA 3HZXA 4FP5D 3G7LA 1SE3A 1HFGA 1I4XA 5IGEA 1HUMA 5C6AA 2EVBA 3Q6SA 1GUOA 1G291 5C0XJ 4K6LA 3K58A 2ICIA 1I4RA 3WOFA 1MSGA 1D1KA 1DOKA 1FR3A 1KDAA 2CW0C 1EWHA 3PO2B 2KCNA 1NR2A 2JA8B 1WD0A 2JA5B 2BDNA 2RDHA 2NVXB 1STEA 1QG7A 1XWEA 1RD9D 4IFDH 2A5HA 2Z4IA 1O7LA 1CK1A 3ZYYX 2J0TD 5NUCA 1FNVA 1QCBD 1YNNC 3DMUA 3KUPA 2D2CC 2RDFA 4EGVA 4BS9A 2LKVA 1GXDC 4HTHA 1FNWA 3PUYA 4KY7A 2F3VA 3FRPB 5I2YA 2JEAI 5DM73 3P7JA 1JWSD 1U4MA 2EYFA 1AP0A 5FOBB 1SNQA 1DOMA 1I6VC 1AEXA 2E76C 3S17B 1EU4A 4J1MA 3C3LA 4RWSC 3WDNA 1J9OA 4RGTA 5D14A 4ZLTF 3SK5A 5CV9A 4NW2A 4NKLA 3K0YA 2MJ8A 3NBIA 2NZ1D 3NQTA 1EIHA 2XSCA 4XXEA 2VB2X 1KLUD 3GD7A 1AZPA 4EQOA 3S14B 1NR4A 3Q24A 5C0XI 3LNNA 1NCVA 2KJXA 3P75A 4BBRB 2WAQB 1XYIA 1XXGA 1KTKA 4EVOA 1EEFD 1ZYRC 5IOCA 2BA0A 4PNYA 1GJXA 3E5SA 3K57A 2PCFB 3HOWB 4IUTA 4IFDI 1CQFA 4F88A 1WD1A 3C2PA 2PZUA 1V8QA 2RSNA 2JXMB 1BR9A 4X3UA 1DOLA 4NMZA 3BDLA 4JK1C 3NK9A 3LX0A 3I4MB 1EWCA 1AFPA 5CV8A 2K5DA 5HURA 1MGSA 2AQ3B 4KTAA 2L5TA 5EJWA 4A3EB 2X69A 2AQ1B 3GTJB 4ODGA 2K6AA 1IYVA 3TSSA 4RKLA 3R2TA 3VYTA 3LWUA 4KY6A 4RHRA 4YIJA 1K83B 1X32A 5JOBA 2LY7A 1C4QA 1CZWA 2F0KA 1ET6A 1I4PA 1W6KA 1Z6HA 1PTOD 1TIID 5C4ZA 3J80E 4XT3B 3A7AB 4RKBA 1BCPD 5ISRA 3L7ZC 1B4OA 3T51B 4ZRZA 1SYDA 2ENBA 2PMZB 4RCOA 3TP6A 3HOYB 3Q0AA 1D5XC 4ZK9B 1PLFA 1VF5C 1S5BD 4KD3A 5D65A 4IZ8A 5I9OA 1BBXC 2X6GA 4LAAA 2RDGA 4V0BA 1V43A 4DNTB 4FF2A 1JORA 1LTID 2EYPA 3RZOB 3E6ZX 2SNSA 5J22A 1SNCA 4KJNA 2EJGC 2E2DC 4OO1H 3M7GA 2F0NA 3J7AF 3M3YB 2XN9C 2MGSA 1EY8A 4HCEA 4BA1I 4RFBA 1A3UA 2HCIA 4PMWA 1F2ZA 4G7HC 1V1PB 5A35A 2JSOA 2A6EC 4DAPA 3QIAA 3GTPB 1WTVA 3LWEA 3I72A 5FO7B 4HR7B 3VR2A 5CBAE 1ENAA 4OIJA 1NAPA 2F0LA 3DEPA 4DGZA 3TN2A 3NE5B 3BS1A 1R9TB 1D5ZC 3A8JE 3D8GA 4BBSB 5IGCA 2K1BA 4A3BB 2PO4A 2PW5A 4KKTA 2WKCA 2R93B 1SNMA 3H91A 1RTOA 4E6IA 4KI0A 1IW7D 1CQVA 4ULLA 2L0CA 4XIGS 3SR1A 1MBYA 5DAUA 3TZUA 1Y8NB 1WTXA 2A6HC 1RODA 1PFNA 1GUWA 4HAEA 1C8CA 2EDGA 3HGBA 3SE0A 1BOSA 1CHPD 1H9SB 2K33A 2QILA 3NPPA 3OWFA 5JVG3 1T5XD 1HA6A 4CBVA 2D62A 5T1GA 4B9XA 5IGFA 4ME5A 4C3IG 5G3LD 1EY5A 5HGTA 2EY5A 1II3A 2DY7A 3AMUA 1TWHB 3EA6A 4B08A 1JOQA 1Y69U 3RZDB 5EKKA 2IT1A 3I91A 5IGGA 2JA7B 3G6JB 3IFTA 5DNFA 5JPNC 5LL6S 4XYQA 2JA6B 4EQNA 1QNUA 5EKLA 2PPBC 5KNBA 4QUFA 3RMHA 2BOSA 5M5YB 3VA7A 2NVTB 3CKIB 3BVMA 3V05A 2L12A 3HEJA 2AUJD 2Z4HA 5T1IA 4BY1B 4K5WA 3VYRA 1F9SA 2BE5D 3P1HA 1SFOB 1F9RA 3PUXA 1TT2A 5EBCA 5JEAJ 3VR3A 1QWYA 1EL0A 4KJOA 3VYSA 1R4PB 2L11A 3OSOA 1QILA 1A15A 2DNCA 3EFXD 3S15B 2YYZA 1EYCA 1A3VA 5KNCA 1HFNA 2VB3X 4MIUA 2E2IB 3PUWA 5I6WA 4A3GB 2Z8LA 3OIPA 5BN5A 2H1EA 4K2KA 3SDZA 2HDMA 3W2DA 4IUNA 4A3JB 4KMUC 4HEDA 4MN3A 2G9DA 1H9JA 1HCZA 1KNAA 2L1BA 2EJFC 3NTHA 2A68C 5LHY1 5IGDA 1LTSD 1ET9A 1KDBA 1SYCA 1LT3D 5KIXA 1E2ZA 4CJ2C 3T16A 5K36G 3NTKA 1SYBA 1DD2A 4CJ1B 2KOLA 4RH6A 3QG1A 2QEJC 4K5XA 1X3PA 3A8KE 2EPBA 2O5IC 1QOHA 2WINB 1K8MA 3T53B 4PMCA 5EPLA 4X3TA 2K7VA 3J81L 1I6HB 2PZTA 1SBBB 2HQEA 3I70A 2R61A 1F2LA 3NQIA 2IL8A 3U9OA 3R2IA 1RJTA 3M7NA 1YNJD 2JEBI 4F8MA 5M3FB 1QE6A 4A3KB 3C46A 4NDXA 4X3SA 1WTRA 2NUCA 3NUCA 3S1NB 2XIWA 1A2TA 1GUTA 2B8FA 1J8IA 1HQRD 2MUYA 3QO2A 5FKAC 1F77A 4DA2A 5TSSA 4ABNA 2EY6A 4IFDJ 1TQOA 1SYFA 1CA5A 1PFBA 2PW7A 1V1OA 3F2UA 3IFDA 5K36H 2TSSA 3NP8A 4CKCA 1V1PA 3I8ZA 4FVMA 1SYGA 1KAAA 3OPOA 2I46A 1BDOA 2FHTA 2OT2A 4S3SA 3D4WA 1FD7D 3TP7A 1Z47A 2K5WA 2NTTA 2FMCA 5JVH3 1GUSA 2CW0D 1S5ED 1VCIA 3BZDB 1BF4A 3NWTA 2BDOA 1XX8A 2IX3A 3EJIA 3H6MA 4QF4A 4R9WA 1TVXA 4RCNA 1K8OA 1IL8A 1OXTA 1TS5A 2VXWA 2RKSA 3DWQA 4RA8A 3K5LA 4G4KA 2A69C 4A3MB 1ML0D 1YNND 2X6LA 4P2CB 3BDOA 1PDQA 1Y8OB 5IT9E 4IUVA 5FLXL 2RQXA 2ID0A 4RAUC 2WP8J 4JBWA 3GTMB 3S1RB 2KQ3A 3R3OA 1I4HA 4H0LC 4KY5A 4NP5A 4C1NI 4QB4A 5ELDA 5CV7A 1DM0B 3K5OA 3M4OB 2FINB 4A93B 2KHSA 3JAME 4RGOS 2C5CA 2SNMA 4RGMA 3RUZA 2EYJA 2XVSA 4FF3A 1I4GA 1I4QA 3SEBA 4OO1G 1RHPA 3E0JA 3V96A 1JR0D 4KHZA 2E75C 3I3CA 5IIFA 4G7OC 1PTOB 1U4LA 1EY6A 1ONLA 3CRLC 2IPKD 3EROA 1BCPB 1HTPA 4N9PA 3TP8A 4IUUA 2NN6H 3MVVA 1JQYD 4AYBB 3ND9A 4FXGC 3TMEA 1E0BA 2NBFA 2M9VA 1TWCB 1ENFA 3BG3A 2K01A 3I73A 2F0SA 1RF2D 4TQUS 2CVRA 2LS01 1G2SA 3AU7A 3J7AV 4C1NK 3DWAA 1EU3A 1EZ6A 1JWUD 2B2WA 1AW7A 1D5MC 5I9PA 1RCVD 5ELCA 3PUZA 1WTOA 1U4RA 4F87A 5M3MB 1HUNA 1GHKA 2F0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSO A;  2X69 A;  5CBE E;  1VMP A;  1JIC A;  1CA5 A;  2HCC A;  2H1E A;  1F9P A;  2JYO A;  1ILP A;  2HDM A;  1LV9 A;  1PFB A;  1WTP A;  2HCI A;  3FDT A;  1S4Z A;  3F2U A;  5EQ0 A;  3N52 A;  3I91 A;  1M8A A;  2EOT A;  3IFD A;  1U4M A;  3P7J A;  1SDF A;  5E4W C;  4ZAI A;  1O80 A;  2HUG A;  1HRJ A;  3IL8 A;  2RA4 A;  1IKL A;  2N88 A;  4ZKB B;  1QNK A;  1AP0 A;  5CMD A;  5EKI A;  4LMQ D;  3I8Z A;  1DOM A;  1X32 A;  4HED A;  4IUQ A;  4MN3 A;  4UAI A;  1BNZ A;  3UI2 A;  2EE1 A;  5DNF A;  1KNA A;  2L1B A;  1ICW A;  3D6W A;  4ZKC B;  1DZ1 A;  1B50 A;  1JE4 A;  3I90 A;  4RWS C;  5AFW A;  1CM9 A;  1ESR A;  2FIN B;  1J9O A;  5D14 A;  2HDL A;  5EJW A;  2JP1 A;  1VMC A;  4ZLT F;  4OIK A;  1BO0 A;  1WTV A;  2DY8 A;  2B2U C;  3LWE A;  4NW2 A;  4U68 A;  4QUC A;  1G91 A;  4CJ2 C;  3SVM A;  1EIG A;  2KEE A;  1B3A A;  2FHT A;  4QUF A;  4R8I A;  1SAP A;  2MJ8 A;  5CBA E;  4CJ1 B;  1G6Z A;  2NZ1 D;  1EOT A;  2B2U A;  2KOL A;  1NAP A;  4OIJ A;  2MP1 A;  3DEP A;  4XT3 B;  1EIH A;  1X3P A;  2RVL A;  2EPB A;  1X3Q A;  1Q3L A;  2B2Y C;  5E4X A;  3G7L A;  1ILQ A;  2L4N A;  3TN2 A;  2N55 A;  1HFG A;  1RHP A;  2B2V C;  3FPU B;  1IKM A;  1HUM A;  2NYZ D;  2MPM A;  3DEO A;  2B2Y A;  1B4O A;  1F9Q A;  1MSH A;  5COY A;  3I3C A;  3Q6S A;  1AZP A;  3ONA B;  2J7Z A;  1WTW A;  1U4L A;  4X3K A;  1ZXT A;  1NR4 A;  2B2T C;  5EPL A;  2B2V A;  4X3T A;  2L12 A;  2Q8T A;  2FMM A;  1KNE A;  1WTQ A;  2K1B A;  4HSV A;  5T1I A;  1BF4 A;  2SDF A;  1DON A;  1MSG A;  1XX8 A;  4ZK9 B;  1F9S A;  1NCV A;  2FJ2 A;  2KUM A;  1PLF A;  2M2L A;  1DOK A;  3DM1 A;  4IUU A;  1XYI A;  2L9H A;  1F2L A;  1F9R A;  4XDX A;  3H91 A;  3GV3 A;  1RTO A;  4O42 A;  4R9W A;  1AZQ A;  2IL8 A;  1NR2 A;  2K05 A;  5D65 A;  1TVX A;  1BBX C;  1G2T A;  2X6G A;  1U4P A;  4DN4 M;  1E0B A;  3R93 A;  1IL8 A;  4HCS A;  1B2T A;  3GV6 A;  2VXW A;  1HHV A;  1RJT A;  4XT1 B;  1WD0 A;  4RA8 A;  1EL0 A;  2K03 A;  1EQT A;  1PFM A;  2BDN A;  1QE6 A;  2L11 A;  2KVM A;  1MI2 A;  4IUT A;  3MWY W;  1WTX A;  5EPJ A;  2K01 A;  1ROD A;  2K28 A;  1PFN A;  3HP3 A;  4X3S A;  1WTR A;  1GUW A;  1QG7 A;  2R3Z A;  1ML0 D;  4HAE A;  5COR A;  1WD1 A;  2X6L A;  1C8C A;  5JJZ A;  1A15 A;  2CVR A;  1PDQ A;  1RTN A;  2K04 A;  1B53 A;  2B2T A;  4IUP A;  1G2S A;  2B2W C;  2RSN A;  4CJ0 B;  4IUV A;  4IUR A;  4X3U A;  4MHE A;  2XIW A;  1DOL A;  1O7Y A;  2KED A;  1J8I A;  2B2W A;  1HFN A;  3QO2 A;  1HA6 A;  3KUP A;  1CA6 A;  2KEC A;  2D9U A;  2RSO A;  5T1G A;  4RAU C;  1WVL A;  1O7Z A;  2Q8R E;  3KBX A;  1WTO A;  3TZD A;  1U4R A;  5EPK A;  1MGS A;  2MGS A;  2NWG A;  3MTS A;  2FFK B;  1HUN A;  2DY7 A; 
#chains in the Genus database with same CATH topology
 4CGY B;  2EYH A;  1HTL D;  4DR2 Q;  4HIK A;  3QJY A;  1S5F D;  4C3H B;  4IO9 A;  1M8A A;  2B29 A;  2HUG A;  3HFZ B;  4ZKB B;  4POG A;  3CU7 A;  1MJE A;  1YNX A;  2H4O A;  3DWP A;  2DJF C;  3X3M A;  3AB9 A;  1PZI D;  1ICW A;  4AQY L;  4DR6 L;  5ELN A;  1B50 A;  4QIW B;  1IYJ B;  3S9W A;  3OHX C;  3PO2 H;  3T1Y Q;  5L37 A;  1X55 A;  2JA8 H;  3QB3 A;  1CI3 M;  1B3A A;  5FK9 C;  1EOT A;  2MO1 A;  3CAM A;  3DXJ C;  4L6T B;  1HQM C;  2E8G A;  4WRD A;  4UDU C;  4PQX A;  4TRD A;  1VQH A;  1IBM Q;  4RHS A;  2ZXR A;  2ZXO A;  3M4Y A;  2MPM A;  4JV5 Q;  1ZXT A;  1JJ2 A;  2FMM A;  3PV0 A;  5LL6 X;  4WJW A;  4CKB A;  5ELB A;  5IT9 L;  3A8I E;  1B9N A;  2DGY A;  2TMP A;  4DV1 L;  2D5D A;  4O42 A;  1AZQ A;  2EXD A;  4DXG A;  3D4D A;  1PTO F;  1EQQ A;  2BA1 A;  1F2M A;  4HCS A;  1B2T A;  1PHJ A;  1XTC D;  4XT1 B;  3BU2 A;  4LF4 Q;  3S1Q H;  3I4N B;  2PQE A;  1BCP F;  3H0G G;  4LFB Q;  4UP8 A;  1V1Q A;  3PCO B;  5KYL A;  3CPW A;  3CRK C;  4V19 0;  4KN7 C;  4YCU A;  2F52 A;  2JK8 A;  5JJZ A;  1MD2 D;  4IUP A;  4IUR A;  2N78 A;  4MHE A;  3PMF A;  2IWH A;  1VQP A;  2B63 G;  3D31 A;  2NVQ B;  3CME A;  1TWF H;  3OMG A;  1GO3 E;  2L55 A;  4NB3 A;  2JE6 I;  3T1H Q;  2G9H D;  3NHH A;  4R4I A;  4OXP A;  3Q23 A;  1NSN S;  2H5X A;  3TZD A;  5IGB A;  2F0V A;  3MTS A;  4C3J B;  2FFK B;  4B3M Q;  4KKU A;  4FF4 A;  3S1M H;  2E2J H;  4RGN A;  4P73 A;  4AIM A;  1HPC A;  2YU9 H;  3SHL A;  1M4V A;  1Y8P B;  3VR6 A;  1JOK A;  2NB0 A;  1SDF A;  1LUZ A;  2A6E D;  3S14 H;  4K14 A;  1XJV A;  4OO1 I;  2Z6B A;  3W3A A;  3GTK B;  4LMQ D;  2N8N A;  4XQN A;  3JAM c;  1D8L A;  3D3R A;  1VMC A;  4OIK A;  1B9M A;  1DGS A;  3BYT B;  2FXQ A;  1Q1B A;  1X56 A;  4HMJ A;  3FMC A;  1G6Z A;  5BN4 A;  3J80 L;  2MP1 A;  1PRT B;  2Q2I A;  1Y1V B;  4K0K L;  4N9T A;  4L5Q A;  2NVY B;  1SNP A;  4P71 A;  4APV A;  3HOU G;  4DR4 L;  2VUM B;  2N55 A;  2SOB A;  4KV6 A;  5COY A;  2VNU D;  3ONA B;  2J7Z A;  1UUP A;  2WB1 G;  1PRT D;  1KNE A;  3KLW A;  1EFI D;  2QDB A;  5LMN Q;  4DV4 Q;  2M2L A;  1A8V A;  2DNE A;  4Y7N B;  2L9H A;  1PYW D;  4XDX A;  1ZEQ X;  1TWG B;  4A3I G;  4BY7 G;  5C3E B;  2A6H D;  2B63 H;  5K5P A;  2F4I A;  2K52 A;  4K2L A;  2AWO A;  1OXS C;  2K14 A;  3NBH B;  4FXD A;  4DV2 Q;  4JI7 Q;  3VR5 A;  3KLS X;  2AWN A;  2UXB Q;  4A3D B;  2IJ0 A;  1TS4 A;  1EY4 A;  5COR A;  3SK6 A;  5J39 A;  4GS3 A;  3KK7 A;  1SNO A;  2B2W C;  4O0A A;  2AKW B;  4JI2 Q;  3KJO A;  2UU9 L;  5CR3 A;  4UPA A;  4EQP A;  3GO5 A;  4DAV A;  5IE8 A;  3IRB A;  1FGB D;  1ESF A;  2F0H A;  1H9M A;  2WB1 E;  2F4V L;  4HN7 A;  2CQO A;  4PZ8 A;  2CFM A;  4JI4 L;  4A3F B;  2NWG A;  1G51 A;  2VS1 A;  1CTM A;  5CBE E;  4LK1 C;  2K32 A;  1LTL A;  2EY1 A;  1JIC A;  2F0E A;  2QF7 A;  4LNQ A;  4DR7 L;  1SMY C;  1H9R A;  3VA5 A;  4ZYS A;  3CXC A;  2VQF Q;  3SK4 A;  1TS2 A;  3KF8 A;  3N52 A;  2RA4 A;  4JG2 A;  2N88 A;  1OTC A;  3K59 A;  3SGI A;  2R7Z B;  5C44 B;  4IUQ A;  3KDF A;  3HOU H;  4H02 A;  3DLL A;  2RCF A;  3HOX B;  1JOO A;  2BCO A;  1KRS A;  2CCZ A;  1LTR D;  2O2L D;  2F03 A;  2YTX A;  1PH3 A;  2V4D A;  3D6C A;  5G3L F;  3OMC A;  4YWK A;  3URY A;  5HY6 A;  1NTG A;  4LUV A;  2OQK A;  3RN2 A;  2A73 B;  1VDZ A;  3OWE B;  2B8G A;  2RVL A;  2M00 A;  1STY A;  4LW1 A;  2QEX A;  4A3I H;  1QVG A;  1ILQ A;  3STB C;  3X3N A;  4X66 Q;  1STN A;  1WYD A;  5JPM C;  1EYA A;  3ERQ A;  1RDP D;  2B2T C;  3OYY A;  5C0X G;  4OHJ A;  2XTI A;  2Y0S G;  5CYU A;  4GNX B;  4LJZ C;  1TY2 A;  4PMB A;  1PRT F;  1YIT A;  3HKZ G;  4FXK C;  1TWA B;  5GAE C;  1K8A C;  3A7L A;  3M4Q A;  3MEH A;  3CCR A;  5M5W H;  1FVI A;  1HXY D;  3DUZ A;  3M3Y H;  2OEO A;  5E1F A;  3TP5 A;  1I94 Q;  1PFM A;  1FJG L;  3T4A C;  1E7Z A;  5IOD A;  5CV5 A;  3M4P A;  1CZG A;  1WI5 A;  1SEB D;  2E5L L;  4UHV A;  1VQM A;  1EEI D;  2AMC B;  4BA2 I;  1OXV A;  3CQZ B;  1X3E A;  4JCV E;  1NMG A;  1WCM B;  1TKW B;  2KED A;  5I4D A;  2F0G A;  2ZTC A;  2KEC A;  4B3S Q;  3GP7 A;  3GTP H;  4HJA A;  1TR5 A;  4GKK L;  1HNW L;  2CHB D;  1PMR A;  1VQJ A;  5C4J B;  3S2H B;  1O78 A;  1PXU A;  5EPK A;  2JA7 G;  1L0X B;  2RCN A;  4DR2 L;  3HKZ E;  3MXN A;  3PO3 B;  3FKI G;  5GRO A;  3EN2 A;  3N6R A;  2F0P A;  1R9T H;  1VQL A;  2IHE A;  1VQ5 A;  1PVO A;  2A68 D;  1LAB A;  1O80 A;  1HRJ A;  1D6E C;  5EKI A;  3ZJY C;  4UAI A;  3T1Y L;  5C5M A;  3CCU A;  3CMA A;  2GA4 B;  1CM9 A;  1VQK A;  1SLJ A;  2JP1 A;  3HG9 A;  4DR1 Q;  2DY8 A;  5C0X H;  1NNX A;  3KJP A;  2R92 B;  5C4H A;  2B2U A;  4HJ9 A;  1SXT A;  1L1O B;  1LT5 D;  1IBM L;  1UWV A;  4BY1 G;  4JV5 L;  3H09 A;  3HS0 C;  1QZH A;  2B2Y A;  3ULP A;  1MSH A;  4NPS A;  3CCQ A;  1WTW A;  1CFM A;  4X3K A;  3EIV A;  2B2V A;  1U5K A;  3CCJ A;  1WTQ A;  3FPP A;  5KRU A;  4A75 A;  1DON A;  4OWX B;  2KUM A;  2E74 C;  3U9S A;  3GV3 A;  5CC4 A;  1EOV A;  1SRU A;  4DXF A;  3VYU A;  4LF4 L;  3K7A B;  1Y1W B;  1K0S A;  4DN4 M;  2IX1 A;  4LFB L;  5JJK A;  1HHV A;  3MAQ A;  3QWN A;  2A1A A;  5JAV A;  4ME3 A;  4DPG A;  3E0E A;  3CF5 A;  3RD4 A;  3HOV G;  2K5N A;  1BBU A;  3S1Q B;  5EAY A;  2C35 B;  5I2X A;  1AE2 A;  2JA7 H;  4POF A;  4B9W A;  2F0T A;  3FKI H;  2EYM A;  2K5V A;  1E2W A;  3T1H L;  3V2T A;  1KC8 C;  3CHB D;  3E9H A;  2I07 B;  3HKS A;  1UNS A;  4JC0 A;  4HIO A;  4IPH A;  4L8J A;  5C4X G;  2F0O A;  1KLG D;  1P16 A;  4WFN 3;  1O7Z A;  1GVP A;  4B3M L;  1TWF B;  1A2U A;  5ELE A;  4B3T Q;  2O4X A;  1LO5 D;  2K05 A;  2EOT A;  1J5E Q;  5M5Y H;  4FO2 A;  3K80 C;  1CHQ D;  1LTA D;  1SJE D;  2NN6 G;  2NVT H;  3O13 A;  3PUV A;  4U67 3;  4IAL A;  5E4W C;  4ZAI A;  3J80 i;  3S1M B;  5BR8 Q;  2E2J B;  1H9S A;  4PV1 C;  2YU9 B;  3MFG A;  2F0F A;  5DM6 3;  4ZUI A;  3QOL A;  4BY1 H;  1A6X A;  4YCW A;  2EE1 A;  1EYD A;  3SXH A;  1EY9 A;  1DZ1 A;  1UEB A;  3I90 A;  3ND8 A;  1SFO H;  4Q0F A;  1BXT A;  1KIX A;  1JC7 A;  2XWJ B;  4TSS A;  5FO9 B;  4KKS A;  3HOZ G;  3G6E A;  1X65 A;  2PYK A;  1Q8I A;  2Z1C A;  4QUC A;  3MXP A;  1EIG A;  1SYE A;  3KFU A;  4HJ5 A;  3TBI B;  1D2B A;  1XPR A;  3TS0 A;  4FF1 A;  3FPU B;  2NYZ D;  1PTO C;  1LAC A;  3ITP A;  3OW2 A;  1F9Q A;  4IOC A;  2VZA A;  3RLF A;  1M1K C;  2YTY A;  5LMN L;  3S15 H;  4DV4 L;  2Q8T A;  4BWG B;  4O1N A;  1BCP C;  1B44 D;  3HOV H;  1T9H A;  2ICE C;  3DM1 A;  2KCC A;  1BUV T;  1U9R A;  3H0G B;  1W6J A;  1FNU A;  1PH2 A;  4A3K G;  4A3C H;  4KK7 A;  1X3G A;  2EXZ A;  2OXP A;  2F0I A;  2A69 D;  1AN8 A;  4A76 A;  3HRZ C;  3R93 A;  4DF7 A;  1STH A;  4DV2 L;  4JI7 L;  5KEE A;  2UXB L;  3L9A X;  4K5V A;  4LF9 Q;  4DNR B;  2B63 B;  1I3Q H;  2HIX A;  3NBH A;  3PO2 G;  3SK8 A;  3MWY W;  3U4Z A;  2Q8I B;  1ZYR D;  4JI2 L;  4TKO B;  4YCV A;  4A3J H;  1V9P A;  1Q1E A;  2F0Q A;  2K04 A;  1RTN A;  4DK1 A;  1B53 A;  1X6O A;  2ZM6 Q;  2JA5 G;  1KDC A;  1PZJ D;  4GLV B;  3FVQ A;  4DV7 Q;  1ICF B;  1SND A;  4DV6 Q;  4X65 Q;  2RSO A;  4L5T A;  1SE8 A;  2Q8R E;  3GTO B;  3KBX A;  4K8I A;  1RKN A;  1KHI A;  2RHQ B;  2WV6 D;  1SSO A;  1TS3 A;  3PIO 3;  2VQF L;  3KYH C;  2ES2 A;  1FL0 A;  3NXW A;  3HOZ H;  4C3I B;  5EQ0 A;  1WOC A;  2MHV A;  1OO9 B;  1A0I A;  5CV6 A;  4NXN Q;  3M85 A;  3A74 A;  4UP9 A;  4H44 C;  1IKL A;  1QNK A;  4IPG A;  3NSW A;  1NJI C;  3UI2 A;  1I6H H;  4P72 A;  1TU2 B;  1JE4 A;  1SE4 A;  5AFW A;  1BVS A;  3H94 A;  3MFY A;  4FNF A;  1UE7 A;  3HOU B;  2B2U C;  2LFN A;  5A2Q E;  3CPF A;  5ELF A;  3CC4 A;  1PZK D;  1SAP A;  2WB1 B;  5CV4 A;  4KD4 A;  3RNU A;  3GQB A;  4X66 L;  5M3F H;  4A3K H;  1IBK Q;  4DV5 Q;  1X3Q A;  2B2Y C;  2L4N A;  4XQJ A;  3B6Y A;  2B2V C;  1LLR D;  4Z9C B;  1UEA B;  2PZW A;  4YHH Q;  1S72 A;  3KLR A;  4A3I B;  4BY7 B;  4I7Z C;  3EVQ A;  3S1N H;  4KHP Q;  2F0J A;  1EY7 A;  2A74 C;  2A19 A;  4P75 A;  4GNX A;  4DU9 A;  2K50 A;  4H13 C;  2AUK A;  3J81 i;  3J7Y W;  4G7Z C;  1DYQ A;  3C1E A;  2JA5 H;  4LF8 Q;  4JVZ A;  1U4P A;  1I94 L;  1PV4 A;  1IHZ A;  2NVX H;  1D1I A;  3MA2 B;  5M5W B;  4BBR G;  3FEW X;  2WAQ G;  3KF6 B;  1EYG A;  1EQT A;  1OXX K;  1JJG A;  4HMI A;  1X9N A;  1IW7 C;  3DHQ A;  4H7B A;  5FLM G;  1MI2 A;  1HA5 A;  3I55 A;  3CCV A;  2R3Z A;  4DK6 C;  1JCK B;  2NN6 I;  1PH9 A;  2B2T A;  1OXU A;  2XRS D;  4R8N A;  1KAB A;  1Q8K A;  1R4Q B;  4F7X A;  1CKM A;  2OF1 A;  3P20 A;  1IYU A;  1ASY A;  4B3S L;  3PGZ A;  1EZ8 A;  3HOW G;  1CA6 A;  2MQH A;  5ELO A;  1DXM A;  4M1U B;  2D9U A;  2PI2 A;  1DJR D;  1VQC A;  3EQL C;  1WVL A;  3MXU A;  4K8J A;  1GOZ A;  4DFA A;  2CQA A;  5E3F A;  1WTH A;  4JOI A;  1TY0 A;  2ZJP A;  1U0L A;  2HCC A;  3NWS A;  4ID6 A;  3I4M G;  1ILP A;  5JJI A;  1LV9 A;  1BQQ T;  5M5X B;  4DAY A;  3BJU A;  1S4Z A;  3S17 H;  5J1Z A;  3QOJ A;  4JBJ A;  4DK0 A;  4A3E G;  2RBM A;  3JC6 6;  3T56 B;  3OIQ A;  1XPO A;  4OON A;  1BNZ A;  2WAQ E;  4Y52 H;  4KHV A;  1SRO A;  5H1S E;  2KA7 A;  1SJH D;  1VQN A;  5D3I B;  2WKD A;  3LGJ A;  3CCS A;  1QB5 D;  4IPD A;  5KND A;  3D0F A;  1ESR A;  2AHO B;  3K6O A;  2J4X A;  4HSP A;  1YJN A;  1KRT A;  3JAM L;  1BO0 A;  5BN3 A;  1G91 A;  3SVM A;  4OL7 A;  2CWA A;  4ZCK A;  3J7A 5;  2LMC B;  5C3W A;  4R8I A;  2K5Q A;  4GN4 B;  1PRT C;  1STA A;  3MHB A;  4CHT B;  1F2Y A;  2NTS A;  5C3X A;  2P5Z X;  2C9O A;  2Y0S B;  5E4X A;  1NUC A;  1L1O A;  1STB A;  3HKZ B;  3PSI A;  3R8B A;  1HNZ Q;  4XTC S;  1IKM A;  3DEO A;  2QCP X;  4KLK A;  2OQ0 A;  2ZT9 C;  3PQI A;  1Q81 C;  1SE2 A;  1H9K A;  4AYB G;  4BBR H;  3W5O A;  4JI0 Q;  3F2C A;  4HSV A;  1UE1 A;  1LTB D;  2PQA B;  2XRQ D;  2SDF A;  5FLM H;  3J81 E;  1L0Y B;  1VQ7 A;  4GZY C;  1G6P A;  1Y14 B;  1Q12 A;  2AQ2 B;  4RMF A;  2F1M A;  3IAY A;  5C5L A;  1PH7 A;  3GTL B;  2WII B;  1UAP A;  5IWA Q;  4HJ8 A;  2UXC Q;  1I50 B;  3RR5 A;  5JEA G;  2EYL A;  3GTM H;  3S2D B;  1S5D D;  3GV6 A;  3HOY G;  3QR8 A;  3HOW H;  2BE5 C;  4LUO A;  1B1Z A;  2E2H B;  4PG3 A;  1LT6 D;  5FO8 B;  2R7D A;  1Q90 A;  2EJM A;  4CKE A;  5EPJ A;  4G57 A;  4C2M B;  2QGQ A;  3GTQ B;  3L2P A;  4UP7 A;  1Q7Y C;  2OTL A;  3PIP 3;  1HNX Q;  3BDC A;  4ZQ3 A;  4IN3 A;  3UDX A;  3KLS A;  3I4M H;  5F2D A;  1PH8 A;  2N3S A;  2R6G A;  1ZKO A;  1HZA A;  3FKI B;  5JJL A;  1E24 A;  4A3E H;  4B3T L;  3GTJ H;  5D3D A;  3H3V C;  1W3S A;  2WAC A;  3UDG A;  4AYB E;  2EZV A;  1J5E L;  4LF5 Q;  4C3H G;  1FYC A;  5HGQ A;  2HT1 A;  5EBD A;  1NY4 A;  1YJW A;  5A2Q L;  4FYD A;  1VMP A;  4J8Q A;  1Z7T A;  4X62 Q;  3I4O A;  1DCZ A;  4KN4 C;  4DK3 C;  5BR8 L;  1PH1 A;  1CSP A;  1K83 H;  4X6A H;  3FDT A;  5IY0 A;  3MC0 B;  1PTO H;  1P8L A;  2PMZ E;  4GLA C;  1JWM D;  1H95 A;  1G8Z D;  3D4R A;  2EY2 A;  4QJF A;  2OTJ A;  1GUG A;  1HZC A;  3D6W A;  5FJ8 G;  1VF7 A;  1HJP A;  3U4V A;  1GUN A;  3MXG A;  5LMU Q;  4M8A A;  5IP7 H;  4GN5 A;  2F0D A;  4QGU A;  1JB3 A;  4QMG A;  2F0U A;  3IKJ A;  5I6Y A;  4BXX G;  4A4I A;  4OWT B;  4DR3 Q;  4CDC C;  1TWC H;  5GQO A;  1K8G A;  1EIF A;  2DN8 A;  2QKI C;  1Q3L A;  5DEH A;  2N49 A;  5JEA H;  3A55 A;  3A54 A;  3HOY H;  1K3B C;  3BVG A;  2IW3 A;  2F0M A;  4GNX C;  3RLO A;  2SEB D;  1CKN A;  3S16 B;  2EQS A;  2FJ2 A;  4C56 C;  2B39 A;  3CD6 A;  3KBG A;  4QIW E;  3WOE A;  1QVC A;  2Q2U A;  4FDB A;  3HOV B;  3OW7 A;  4L63 B;  4BBS G;  3BVZ A;  1G2T A;  4Q5V A;  2I5L X;  4LF9 L;  4A3B G;  3C1F A;  3PIO A;  5CGK A;  1HR0 W;  2K03 A;  1S5C D;  3RZO H;  1X3F A;  3GTG B;  4R4Q A;  2R93 G;  2F3W A;  4IQZ A;  1EQV A;  1T5E A;  2KVM A;  5M9O A;  4C3H H;  2K28 A;  3Q22 A;  3HP3 A;  4JW0 A;  2ATW A;  1PH4 A;  2KHJ A;  2ZM6 L;  3I2Z A;  2IX0 A;  3MZ5 A;  4QCL A;  4DV0 Q;  3TEH B;  5C4X B;  3WWV A;  1I3Q B;  2XWB B;  1YNJ C;  1LT4 D;  4CJ0 B;  3T13 A;  4DUZ Q;  4I65 A;  3UE1 A;  4DV7 L;  4DV6 L;  1O7Y A;  4O2D A;  4X65 L;  4C3J G;  5KYI A;  2JN4 A;  3I4L A;  2O5J C;  5FLX E;  1EY0 A;  4ZUJ A;  2MO0 A;  3BYY B;  1SMY D;  1JJC B;  1ENC A;  3A56 A;  4OGQ C;  4XYO A;  5KGU A;  2PNR C;  3K5N A;  4WOR A;  4JOI C;  2YV5 A;  1Q86 C;  1QJO A;  2D0P A;  1C48 A;  5FJ8 H;  3L3O C;  4IFD G;  4A3L G;  2CH4 A;  1F9P A;  1NMF A;  2JYO A;  4NXN L;  4ILW A;  3TDQ A;  3VR4 A;  1WTP A;  3NTI A;  1E2V A;  4OWW B;  1UE6 A;  3IL8 A;  1A3T A;  3HOZ B;  4BXX H;  4GOP B;  5EGT A;  5CMD A;  2EYO A;  4K6D A;  1WFQ A;  3OOC A;  1STG A;  1CSQ A;  4ZKC B;  2XNA C;  1LTG D;  1EIY B;  4XQQ A;  2HDL A;  1GHJ A;  1LTT D;  3K5M A;  2ZXP A;  1YEZ A;  1CT1 D;  4U68 A;  3STB D;  4IOA A;  4YY3 Q;  2KEE A;  4HJ7 A;  1IBK L;  4DV5 L;  4J6H A;  1L1O C;  1B3Q A;  3I4N H;  5IYB G;  3HZX A;  2JA6 G;  4FP5 D;  2MNA A;  1W2B A;  2EIF A;  4YHH L;  3AQQ A;  1SE3 A;  3G7L A;  4BBS H;  1HFG A;  1I4X A;  5IGE A;  1HUM A;  5C6A A;  4A3B H;  4KHP L;  1YBY A;  2EVB A;  2G5D A;  3K8A A;  3Q6S A;  3OTO Q;  1GUO A;  1G29 1;  3J81 c;  1KQS A;  5C0X J;  4K6L A;  2R93 H;  3K58 A;  2ICI A;  1I4R A;  3WOF A;  4LF7 Q;  1MSG A;  1KAW A;  1D1K A;  1DOK A;  1FR3 A;  4LF8 L;  1KDA A;  2CW0 C;  1EWH A;  1NBW A;  1YZ6 A;  3PO2 B;  2KCN A;  1NR2 A;  3W1G A;  3ICE A;  2JA8 B;  4C3J H;  3FP9 A;  1UE5 A;  1WD0 A;  2QDL A;  4JI1 Q;  3W1B A;  2JA5 B;  1HH2 P;  4MZ9 A;  2BDN A;  3AFP A;  3KF6 A;  2RDH A;  2NVX B;  4MNO A;  1YVC A;  1STE A;  1QG7 A;  1XWE A;  1RD9 D;  4IFD H;  3S24 A;  2A5H A;  2Z4I A;  1IBL Q;  4A3L H;  1O7L A;  1CK1 A;  3ZYY X;  2J0T D;  2HD3 A;  5NUC A;  1FNV A;  1QCB D;  2K5H A;  1YNN C;  3DMU A;  3KUP A;  2D2C C;  1VQD A;  5E7N A;  2RDF A;  4EGV A;  4BS9 A;  1TWH H;  2LKV A;  1GXD C;  1VQE A;  5IYC G;  4HTH A;  1EQR A;  3GDE A;  3RZD H;  1FNW A;  3PUY A;  4KY7 A;  2NVY H;  2VUM H;  1PYS B;  2F3V A;  2CKZ B;  4DKA C;  3FRP B;  4A3C G;  5I2Y A;  3F2D A;  2JEA I;  5DM7 3;  4RG1 A;  1L0W A;  2HIV A;  1JWS D;  3P7J A;  1U4M A;  2EYF A;  3AEV A;  5IYB H;  4A3G G;  2JA6 H;  1AP0 A;  5FOB B;  3NEL A;  1SNQ A;  1DOM A;  1I6V C;  1AEX A;  2E76 C;  3S17 B;  4WJ3 M;  1EU4 A;  4J1M A;  3C3L A;  4RWS C;  3WDN A;  3F8T A;  1J9O A;  4RGT A;  5D14 A;  4A3J G;  1TWG H;  1L2F A;  4ZLT F;  5C3E H;  3SK5 A;  5CV9 A;  4NW2 A;  4UY8 C;  4NKL A;  3U50 C;  3K0Y A;  4R4C A;  4JI6 Q;  2MJ8 A;  3NBI A;  2NZ1 D;  3NQT A;  1EIH A;  2XSC A;  1VQG A;  4XXE A;  1HNZ L;  1VQ6 A;  2VB2 X;  4A3D H;  1KLU D;  3GD7 A;  1AZP A;  4JI0 L;  4EQO A;  3S14 B;  1NR4 A;  4R4O A;  1YHB A;  3Q24 A;  5C0X I;  4EQ5 A;  4DV3 Q;  4CDD C;  3LNN A;  2YTV A;  1NCV A;  2KJX A;  5IWA L;  2PQA A;  3P75 A;  4BBR B;  2UXC L;  2WAQ B;  1XYI A;  1XXG A;  1KTK A;  4EVO A;  4B3R Q;  1EEF D;  1ZYR C;  3H3V H;  5IOC A;  2BA0 A;  3MEF A;  2RF4 A;  4PNY A;  1GJX A;  3E5S A;  4R4T A;  1X54 A;  3K57 A;  2PCF B;  3HOW B;  4IUT A;  4R1J A;  1HNX L;  4IFD I;  1CQF A;  5IYC H;  2HHH Q;  4F88 A;  1WD1 A;  1AH9 A;  4NXM Q;  3C2P A;  2PZU A;  1V8Q A;  2RSN A;  3KF8 B;  3G71 A;  2JXM B;  1BR9 A;  4X3U A;  1DOL A;  4NMZ A;  4N8X 1;  5FLX c;  5M3F G;  3ULL A;  1Q46 A;  2E2I H;  3BDL A;  4JK1 C;  4PZ6 A;  4LF5 L;  4I7A A;  2ALY B;  3NK9 A;  3CC7 A;  3LX0 A;  1GD7 A;  4A3G H;  3I4M B;  1EWC A;  1AFP A;  3G48 A;  5CV8 A;  2K5D A;  5HUR A;  3DM3 A;  4X62 L;  1MGS A;  2AQ3 B;  4KTA A;  2L5T A;  5EJW A;  4A3E B;  3VDY A;  1N32 Q;  2X69 A;  2AQ1 B;  3GTJ B;  4ODG A;  2RHS B;  2K6A A;  1IYV A;  4WJ4 A;  2R7F A;  3TSS A;  2GVB A;  4RKL A;  3R2T A;  2VL6 A;  3VYT A;  3LWU A;  4KY6 A;  1FGU A;  4RHR A;  1K83 B;  4YIJ A;  1X32 A;  2KBN A;  2UUC Q;  1A63 A;  5LMU L;  2VY3 A;  1TWA H;  5JOB A;  2Q2H A;  1VQI A;  2LY7 A;  3E3X A;  1C4Q A;  1CZW A;  2PI2 E;  2F0K A;  1ET6 A;  1RL2 A;  1I4P A;  1W6K A;  4DR3 L;  1Z6H A;  4IJH A;  1PTO D;  1TII D;  5C4Z A;  3EBE A;  3J80 E;  4XT3 B;  3A7A B;  3AFQ A;  4RKB A;  1BCP D;  5ISR A;  4CDE C;  3L7Z C;  1B4O A;  3T51 B;  1B7Y B;  4ZRZ A;  1SYD A;  5J3B A;  2ENB A;  4QQB X;  1K0R A;  1EWI A;  1SR3 A;  2PMZ B;  4RCO A;  3TP6 A;  2Z6K A;  3HOY B;  3Q0A A;  1D5X C;  4ZK9 B;  1PLF A;  2DUD A;  1VQB A;  2VQE Q;  1VF5 C;  3Q8D A;  1S5B D;  4KD3 A;  5D65 A;  4IZ8 A;  5I9O A;  5C4J H;  1QZG A;  3G4S A;  4JPB W;  2X6G A;  1BBX C;  3S2H H;  1J6Q A;  4LAA A;  2RDG A;  3I56 A;  1QUQ B;  1MJC A;  4V0B A;  1V43 A;  4DNT B;  4FF2 A;  1JOR A;  1S40 A;  3UDI A;  4HIM A;  2GVA A;  1LTI D;  4DV0 L;  2EYP A;  4DUZ L;  1E1O A;  1HR0 Q;  3RZO B;  4LF6 Q;  2ZTD A;  3E6Z X;  2SNS A;  5J22 A;  1SNC A;  2UUB Q;  4KJN A;  1CUK A;  3F2B A;  1BKB A;  2EJG C;  4A3M G;  1JT8 A;  4OEL B;  2E2D C;  4OO1 H;  3CCM A;  1N8R C;  3M7G A;  2F0N A;  2I0Q A;  3J7A F;  3M3Y B;  2XN9 C;  2R92 H;  2MGS A;  1EY8 A;  3H15 A;  4HCE A;  4BA1 I;  1HZ9 A;  4RFB A;  1A3U A;  1JMC A;  4DAM A;  2HCI A;  4PMW A;  1F2Z A;  4IJL A;  4G7H C;  1V1P B;  4DUY Q;  1VQ8 A;  5A35 A;  4DR5 Q;  4GOP A;  2JSO A;  1GKH A;  1ASZ A;  2A6E C;  2MFI A;  4DAP A;  3QIA A;  4YY3 L;  4J15 A;  3GTP B;  3K7A H;  1WTV A;  1Y1W H;  3LWE A;  3I72 A;  5FO7 B;  4HR7 B;  3VR2 A;  5CBA E;  1ENA A;  4OIJ A;  1NAP A;  3UE0 A;  2F0L A;  3DEP A;  4N8F A;  1XNR Q;  4DGZ A;  3A5U A;  3OTO L;  3TN2 A;  4A93 G;  3NE5 B;  3BS1 A;  1R9T B;  1D5Z C;  2UXD Q;  4LF7 L;  3A8J E;  4DR1 L;  3D8G A;  1K9M C;  4BBS B;  5IGC A;  5IT9 c;  1KD1 C;  2K1B A;  1A62 A;  4JI3 Q;  3I7F A;  4A3B B;  1N33 Q;  2PO4 A;  4JI8 Q;  1K73 C;  3TRZ A;  2F3I A;  2PW5 A;  4KKT A;  1VQ9 A;  2WKC A;  5IP9 G;  2R93 B;  1SNM A;  3H91 A;  1RTO A;  4E6I A;  1YI2 A;  4KI0 A;  1IW7 D;  1CQV A;  4YWL A;  4ULL A;  2L0C A;  4JI1 L;  3M9B A;  4XIG S;  4A3M H;  2LXJ A;  3SR1 A;  1MBY A;  5DAU A;  3TZU A;  4GKJ Q;  2JA9 A;  1Y8N B;  1WTX A;  2A6H C;  1ROD A;  5IP7 G;  1PFN A;  3TQY A;  1IBL L;  1XPU A;  1GUW A;  4HAE A;  1C8C A;  2EDG A;  3CCE A;  1B8A A;  1XNQ Q;  3HGB A;  3SE0 A;  3F1Z A;  1BOS A;  1CHP D;  3RN5 A;  1PH5 A;  1H9S B;  2JQO A;  2K33 A;  2QIL A;  3NPP A;  3OWF A;  5JVG 3;  3A0J A;  2ZTE A;  3FHW A;  2BH2 A;  1T5X D;  1HA6 A;  4CBV A;  3S1R H;  2D62 A;  5T1G A;  4B9X A;  5IGF A;  1I5F A;  1MIU A;  4ME5 A;  4C3I G;  5G3L D;  1EY5 A;  5HGT A;  2EY5 A;  1II3 A;  2DY7 A;  3AMU A;  1TWH B;  3EA6 A;  4B08 A;  4LFA Q;  4L5R C;  1JOQ A;  3J81 j;  1Y69 U;  3RZD B;  5EKK A;  2IT1 A;  3I91 A;  5IGG A;  4IPC A;  5M3M G;  2CWP A;  2JA7 B;  1Z9F A;  3M4O H;  3G6J B;  2DJG C;  3IFT A;  4A93 H;  1B70 B;  5DNF A;  4HID A;  5JPN C;  5LL6 S;  3BZK A;  4XYQ A;  3H0G H;  2JA6 B;  4EQN A;  3K7U C;  3A5Z B;  1QNU A;  4JI6 L;  5EKL A;  3J80 c;  2PPB C;  4QL5 A;  5KNB A;  4QUF A;  1SN8 A;  2D0O A;  3RMH A;  2BOS A;  3UDF A;  5M5Y B;  5IP9 H;  1RIP A;  3VA7 A;  1VQA A;  3NEN A;  4X64 Q;  2NVT B;  3CKI B;  2LSS A;  1PH6 A;  1VQ4 A;  4DV3 L;  1QVF A;  2Z6K C;  3BVM A;  4JYA Q;  3V05 A;  1MHW C;  2L12 A;  3HEJ A;  2AUJ D;  2Z4H A;  1VQF A;  3K81 C;  5T1I A;  2KHI A;  4K5W A;  3VYR A;  4BY1 B;  4B3R L;  1F9S A;  2UUA Q;  2BE5 D;  2WFW A;  3P1H A;  1SFO B;  1F9R A;  1JE5 A;  5GAH C;  3PUX A;  1TT2 A;  5EBC A;  3GTO H;  5JEA J;  1IL2 A;  3VR3 A;  2NZO A;  1QWY A;  2I5H A;  4PZ7 A;  1EL0 A;  2HQL A;  4KJO A;  1LYL A;  2HHH L;  3VYS A;  1R4P B;  4JI5 Q;  2L11 A;  5AJ3 Q;  4NXM L;  4C3I H;  2IY5 B;  3OSO A;  1QIL A;  1A15 A;  2DNC A;  4AH6 A;  1CKO A;  2ASB A;  3I4N G;  3EFX D;  3S15 B;  4GN3 B;  2YYZ A;  1EYC A;  1A3V A;  5KNC A;  1N34 Q;  4ALP A;  1HFN A;  4JBK A;  4OX9 Q;  1N36 Q;  5M3M H;  2VB3 X;  3NEM A;  4MIU A;  1N32 L;  2E2I B;  2OCE A;  3PUW A;  3U58 A;  5I6W A;  4A3G B;  4LFC Q;  1XMQ Q;  1BBW A;  2Z8L A;  1XMO Q;  3OIP A;  5BN5 A;  2H1E A;  4K2K A;  3SDZ A;  2HDM A;  3W2D A;  4IUN A;  4GOP C;  4A3J B;  2UUC L;  4BY7 H;  4KMU C;  2BH8 A;  4HED A;  4LUZ A;  2G9D A;  1H9J A;  1HCZ A;  4MN3 A;  1KNA A;  2L1B A;  2QA4 A;  2EJF C;  3NTH A;  2A68 C;  5LHY 1;  5IGD A;  1LTS D;  1ET9 A;  4AQY Q;  1KDB A;  4DR6 Q;  1SYC A;  1LT3 D;  3L0O A;  5KIX A;  1E2Z A;  1EUJ A;  4CJ2 C;  3T16 A;  2ZJR A;  1Q82 C;  4MTN A;  5K36 G;  3NTK A;  1SYB A;  2CH4 W;  4CJ1 B;  1DD2 A;  2KOL A;  4RH6 A;  3QG1 A;  2QEJ C;  4P74 A;  4K5X A;  1X3P A;  3A8K E;  2EPB A;  1HZB A;  2O5I C;  1IZ6 A;  1QOH A;  2WIN B;  1K8M A;  3T53 B;  4PMC A;  5EPL A;  4X3T A;  2K7V A;  1Y1V G;  2VQE L;  2VUM G;  3J81 L;  2PNH A;  1YHQ A;  1I6H B;  2PZT A;  1SBB B;  3K0X A;  1N9W A;  2HQE A;  3I70 A;  2Q2T A;  2R61 A;  1F2L A;  1YHA A;  3NQI A;  2IL8 A;  3U9O A;  3R2I A;  4DV1 Q;  4DNI A;  1RJT A;  3M7N A;  1PYB A;  3ULJ A;  1YNJ D;  1LM0 A;  2JEB I;  4F8M A;  1QUQ A;  1HR0 L;  5M3F B;  1QE6 A;  4A3K B;  3C46 A;  2Y0S E;  4YWM A;  4LF6 L;  5M5X H;  1C0A A;  4NDX A;  4X3S A;  5C3E G;  1WTR A;  1E1T A;  2NUC A;  2UUB L;  1JB7 A;  2NVQ H;  3NUC A;  4DAY B;  3S1N B;  2XIW A;  1A2T A;  3CC2 A;  1GUT A;  2B8F A;  4A3D G;  1J8I A;  1HQR D;  2MUY A;  3QO2 A;  5FKA C;  1F77 A;  1C9O A;  1D7Q A;  2IHF A;  4DA2 A;  4L5S A;  2K75 A;  5TSS A;  4ABN A;  2EY6 A;  3TRE A;  4IFD J;  1TQO A;  1SYF A;  2Z9H A;  2LXK A;  1CA5 A;  1IXR A;  3CW2 C;  2B3G A;  1PFB A;  3GTK H;  4DUY L;  2PW7 A;  1V1O A;  3F2U A;  1PFS A;  3IFD A;  1VS0 A;  4DR5 L;  5K36 H;  4A3F G;  2TSS A;  3NP8 A;  1PA6 A;  1K28 A;  4CKC A;  5GAG C;  1V1P A;  2I5M X;  4CDF C;  3I8Z A;  4FVM A;  2XGT A;  1SYG A;  1KAA A;  1SMX A;  2KCT A;  5GAD C;  3GTL H;  3OPO A;  2KCM A;  1I50 H;  1Y1V H;  3S2D H;  2R7Z G;  5C44 G;  2I46 A;  3JAM i;  1XNR L;  1BDO A;  2FHT A;  2OT2 A;  4S3S A;  3HOX G;  3D4W A;  2E2H H;  1FD7 D;  2NZH A;  3TP7 A;  2UXD L;  3E9I A;  1Z47 A;  2K5W A;  2NTT A;  2FMC A;  1EFW A;  5JVH 3;  1VQO A;  4C2M H;  2L15 A;  4K0K Q;  3GTQ H;  1GUS A;  2CW0 D;  5LMN W;  4DR4 Q;  4JI3 L;  1S5E D;  1M90 C;  1N33 L;  4Y7N H;  4JI8 L;  1VCI A;  3BZD B;  2KEN A;  1BF4 A;  3NWT A;  2BDO A;  1XX8 A;  2IX3 A;  4MTK A;  1XTD A;  3EJI A;  3ER0 A;  3H6M A;  4QF4 A;  4R9W A;  1TVX A;  4RCN A;  1K8O A;  1IL8 A;  1OXT A;  1TS5 A;  2VXW A;  4LWC A;  4GKJ L;  3CP0 A;  2RKS A;  3DWQ A;  4RA8 A;  2QW7 A;  3PIP A;  3K5L A;  4G4K A;  5DLQ E;  1XNQ L;  2GN5 A;  2A69 C;  4A3M B;  1ML0 D;  1YNN D;  2X6L A;  4P2C B;  3BDO A;  1PDQ A;  3KOJ A;  1Y8O B;  1E3P A;  5IT9 E;  4IUV A;  4QY7 A;  3CCL A;  2VW9 A;  1S3O A;  5FLX L;  2RQX A;  1AE3 A;  4A3F H;  2UU9 Q;  2ID0 A;  4RAU C;  2WP8 J;  1WJJ A;  1WCM G;  4JBW A;  1KL9 A;  2OWO A;  3GTM B;  3S1R B;  1YIJ A;  4LFA L;  2F4V Q;  2ZJQ A;  2KQ3 A;  5IYD G;  3R3O A;  4JI4 Q;  2JJQ A;  1C7Y A;  1I4H A;  4H0L C;  2R7Z H;  5C44 H;  4KY5 A;  4NP5 A;  4C1N I;  4QB4 A;  4DR7 Q;  3HOX H;  2V1C C;  5ELD A;  5CV7 A;  3KDF B;  3PO3 G;  3S16 H;  4TVA B;  1DM0 B;  1E22 A;  3K5O A;  4OEM B;  1CKN B;  3M4O B;  2FIN B;  3J7Z C;  1NE3 A;  4A93 B;  2KHS A;  3JAM E;  4RGO S;  2C5C A;  2SNM A;  4RGM A;  1K3R A;  3RUZ A;  1O7I A;  2EYJ A;  3ERS X;  2XVS A;  4X64 L;  4FF3 A;  3GTG H;  1I4G A;  3PF5 A;  1I4Q A;  3SEB A;  4OO1 G;  3BZC A;  4JYA L;  1RHP A;  3E0J A;  1YJ9 A;  3V96 A;  1JR0 D;  3AYH B;  2E75 C;  4KHZ A;  4GLX A;  1MKH A;  3RLN A;  3I3C A;  5C4X H;  5IIF A;  4G7O C;  2R92 G;  1PTO B;  1U4L A;  1EY6 A;  2UUA L;  2JA8 G;  1ONL A;  3CRL C;  2Z0S A;  2IPK D;  3ERO A;  1BCP B;  3TS2 A;  3PF4 A;  1HTP A;  4N9P A;  3TP8 A;  4IUU A;  2NN6 H;  3MVV A;  1JQY D;  4AYB B;  3ND9 A;  4FXG C;  3TME A;  1E0B A;  4JI5 L;  5AJ3 L;  2NBF A;  2M9V A;  1GM5 A;  1TWC B;  2A8V A;  3CQZ H;  1ENF A;  3BG3 A;  2K01 A;  1WCM H;  1KXL A;  3I73 A;  2F0S A;  1Y1W G;  2K4K A;  1FJG Q;  1RF2 D;  4TQU S;  2CVR A;  2LS0 1;  5IYD H;  1G2S A;  3AU7 A;  2E5L Q;  3J7A V;  1N34 L;  4C1N K;  3H3V I;  4OX9 L;  3DWA A;  1N36 L;  4JBM A;  1EU3 A;  1EZ6 A;  1JWU D;  2B2W A;  1AW7 A;  1D5M C;  1RCV D;  5ELC A;  5I9P A;  1TXY A;  3PO3 H;  3PUZ A;  4LFC L;  1XMQ L;  1WTO A;  1U4R A;  1XMO L;  4F87 A;  3MXN B;  5M3M B;  4GKK Q;  1HNW Q;  4EX5 A;  1HUN A;  1GHK A;  2F0W A; 
#chains in the Genus database with same CATH homology
 4CGY B;  2EYH A;  1HTL D;  3QJY A;  1S5F D;  4C3H B;  1M8A A;  2HUG A;  4ZKB B;  3CU7 A;  2H4O A;  3DWP A;  3X3M A;  3AB9 A;  1PZI D;  1ICW A;  1B50 A;  4QIW B;  3S9W A;  3OHX C;  3QB3 A;  1CI3 M;  1B3A A;  5FK9 C;  1EOT A;  3DXJ C;  4L6T B;  1HQM C;  4WRD A;  4UDU C;  4PQX A;  4TRD A;  4RHS A;  2ZXR A;  2ZXO A;  3M4Y A;  2MPM A;  1ZXT A;  2FMM A;  3PV0 A;  5LL6 X;  4WJW A;  4CKB A;  5ELB A;  5IT9 L;  3A8I E;  1B9N A;  2TMP A;  2D5D A;  4O42 A;  1AZQ A;  4DXG A;  3D4D A;  1PTO F;  2BA1 A;  1F2M A;  4HCS A;  1B2T A;  1XTC D;  4XT1 B;  3I4N B;  2PQE A;  1BCP F;  5KYL A;  3CRK C;  4V19 0;  4KN7 C;  5JJZ A;  1MD2 D;  4IUP A;  4IUR A;  4MHE A;  3PMF A;  2IWH A;  3D31 A;  2NVQ B;  3OMG A;  2L55 A;  2JE6 I;  2G9H D;  3NHH A;  3Q23 A;  1NSN S;  3TZD A;  5IGB A;  2F0V A;  3MTS A;  4C3J B;  2FFK B;  4KKU A;  4FF4 A;  4RGN A;  1HPC A;  3SHL A;  1M4V A;  1Y8P B;  3VR6 A;  1JOK A;  2NB0 A;  1SDF A;  2A6E D;  4K14 A;  4OO1 I;  3W3A A;  3GTK B;  4LMQ D;  4XQN A;  3D3R A;  1VMC A;  4OIK A;  1B9M A;  3BYT B;  1Q1B A;  4HMJ A;  3FMC A;  1G6Z A;  5BN4 A;  3J80 L;  2MP1 A;  1PRT B;  1Y1V B;  4N9T A;  2NVY B;  1SNP A;  2VUM B;  2N55 A;  2SOB A;  4KV6 A;  5COY A;  2VNU D;  3ONA B;  2J7Z A;  1UUP A;  1PRT D;  1KNE A;  1EFI D;  2QDB A;  2M2L A;  2DNE A;  4Y7N B;  2L9H A;  1PYW D;  4XDX A;  1ZEQ X;  1TWG B;  5C3E B;  2A6H D;  5K5P A;  2F4I A;  4K2L A;  2AWO A;  1OXS C;  4FXD A;  3VR5 A;  3KLS X;  2AWN A;  4A3D B;  2IJ0 A;  1TS4 A;  1EY4 A;  5COR A;  3SK6 A;  5J39 A;  3KK7 A;  1SNO A;  2B2W C;  5CR3 A;  4EQP A;  3GO5 A;  4DAV A;  1FGB D;  1ESF A;  2F0H A;  1H9M A;  4HN7 A;  4A3F B;  2NWG A;  1CTM A;  5CBE E;  4LK1 C;  2K32 A;  2EY1 A;  1JIC A;  2F0E A;  2QF7 A;  1SMY C;  1H9R A;  3VA5 A;  4ZYS A;  3SK4 A;  1TS2 A;  3KF8 A;  3N52 A;  2RA4 A;  2N88 A;  3K59 A;  2R7Z B;  5C44 B;  4IUQ A;  3HOX B;  1JOO A;  2BCO A;  1LTR D;  2O2L D;  2F03 A;  2V4D A;  3D6C A;  5G3L F;  3OMC A;  3URY A;  2A73 B;  1VDZ A;  3OWE B;  2B8G A;  2RVL A;  2M00 A;  1STY A;  1ILQ A;  3X3N A;  1STN A;  5JPM C;  1EYA A;  3ERQ A;  1RDP D;  2B2T C;  5C0X G;  4OHJ A;  5CYU A;  4LJZ C;  1TY2 A;  4PMB A;  1PRT F;  4FXK C;  1TWA B;  3A7L A;  3MEH A;  1HXY D;  3DUZ A;  2OEO A;  5E1F A;  3TP5 A;  1PFM A;  3T4A C;  5IOD A;  5CV5 A;  1CZG A;  1SEB D;  1EEI D;  4BA2 I;  1OXV A;  3CQZ B;  1WCM B;  1TKW B;  2KED A;  5I4D A;  2F0G A;  2KEC A;  3GP7 A;  1TR5 A;  2CHB D;  1PMR A;  5C4J B;  3S2H B;  1O78 A;  1PXU A;  5EPK A;  1L0X B;  3MXN A;  3PO3 B;  3N6R A;  2F0P A;  2A68 D;  1LAB A;  1O80 A;  1HRJ A;  1D6E C;  5EKI A;  4UAI A;  5C5M A;  2GA4 B;  1CM9 A;  2JP1 A;  3HG9 A;  2DY8 A;  5C0X H;  2R92 B;  5C4H A;  2B2U A;  1SXT A;  1LT5 D;  3H09 A;  3HS0 C;  2B2Y A;  1MSH A;  1WTW A;  1CFM A;  4X3K A;  2B2V A;  1WTQ A;  3FPP A;  5KRU A;  1DON A;  2KUM A;  2E74 C;  3U9S A;  3GV3 A;  5CC4 A;  4DXF A;  3VYU A;  3K7A B;  1Y1W B;  4DN4 M;  2IX1 A;  1HHV A;  3MAQ A;  3QWN A;  5JAV A;  3RD4 A;  3S1Q B;  5I2X A;  4B9W A;  2F0T A;  2EYM A;  1E2W A;  3V2T A;  3CHB D;  2I07 B;  1UNS A;  4L8J A;  2F0O A;  1KLG D;  4WFN 3;  1O7Z A;  1TWF B;  1A2U A;  5ELE A;  2O4X A;  1LO5 D;  2K05 A;  2EOT A;  4FO2 A;  1CHQ D;  1LTA D;  1SJE D;  2NN6 G;  3O13 A;  3PUV A;  4U67 3;  4IAL A;  5E4W C;  4ZAI A;  3S1M B;  2E2J B;  1H9S A;  4PV1 C;  2YU9 B;  3MFG A;  2F0F A;  5DM6 3;  4ZUI A;  3QOL A;  1A6X A;  2EE1 A;  1EYD A;  3SXH A;  1EY9 A;  1DZ1 A;  3I90 A;  3ND8 A;  4Q0F A;  1BXT A;  1JC7 A;  2XWJ B;  4TSS A;  5FO9 B;  4KKS A;  2PYK A;  2Z1C A;  1Q8I A;  4QUC A;  3MXP A;  1EIG A;  1SYE A;  3TBI B;  1D2B A;  4FF1 A;  3FPU B;  2NYZ D;  1PTO C;  1LAC A;  3ITP A;  1F9Q A;  3RLF A;  2Q8T A;  4BWG B;  4O1N A;  1BCP C;  1B44 D;  2ICE C;  3DM1 A;  2KCC A;  1BUV T;  1U9R A;  3H0G B;  1W6J A;  1FNU A;  4KK7 A;  2EXZ A;  2OXP A;  2F0I A;  2A69 D;  1AN8 A;  3HRZ C;  3R93 A;  4DF7 A;  1STH A;  5KEE A;  3L9A X;  4K5V A;  4DNR B;  2B63 B;  3NBH A;  3SK8 A;  3MWY W;  2Q8I B;  1ZYR D;  4TKO B;  2F0Q A;  1Q1E A;  2K04 A;  1RTN A;  4DK1 A;  1B53 A;  1KDC A;  1PZJ D;  3FVQ A;  1SND A;  2RSO A;  2Q8R E;  3GTO B;  3KBX A;  4K8I A;  1RKN A;  2WV6 D;  1SSO A;  1TS3 A;  3PIO 3;  3NXW A;  4C3I B;  5EQ0 A;  2MHV A;  1OO9 B;  5CV6 A;  3M85 A;  4H44 C;  1IKL A;  1QNK A;  3NSW A;  3UI2 A;  1TU2 B;  1JE4 A;  1SE4 A;  5AFW A;  3H94 A;  3MFY A;  4FNF A;  3HOU B;  2B2U C;  2LFN A;  5A2Q E;  5ELF A;  1PZK D;  1SAP A;  2WB1 B;  5CV4 A;  4KD4 A;  3GQB A;  1X3Q A;  2B2Y C;  2L4N A;  4XQJ A;  2B2V C;  1LLR D;  4Z9C B;  1UEA B;  2PZW A;  3KLR A;  4A3I B;  4BY7 B;  4I7Z C;  3EVQ A;  2F0J A;  1EY7 A;  2A74 C;  4DU9 A;  4H13 C;  2AUK A;  3J7Y W;  4G7Z C;  1DYQ A;  3C1E A;  1U4P A;  1IHZ A;  1D1I A;  3MA2 B;  5M5W B;  3FEW X;  1EQT A;  1OXX K;  4HMI A;  1IW7 C;  3DHQ A;  4H7B A;  1MI2 A;  1HA5 A;  2R3Z A;  1JCK B;  2NN6 I;  2B2T A;  1OXU A;  2XRS D;  4R8N A;  1KAB A;  1R4Q B;  4F7X A;  2OF1 A;  3P20 A;  1IYU A;  1EZ8 A;  1CA6 A;  1DXM A;  4M1U B;  2D9U A;  1DJR D;  3EQL C;  1WVL A;  3MXU A;  4K8J A;  1GOZ A;  4DFA A;  2CQA A;  5E3F A;  1TY0 A;  2HCC A;  3NWS A;  4ID6 A;  1ILP A;  1LV9 A;  1BQQ T;  5M5X B;  4DAY A;  1S4Z A;  5J1Z A;  3QOJ A;  4DK0 A;  2RBM A;  3T56 B;  3OIQ A;  1BNZ A;  4KHV A;  2KA7 A;  1SJH D;  5D3I B;  2WKD A;  1QB5 D;  5KND A;  1ESR A;  3K6O A;  4HSP A;  2J4X A;  3JAM L;  1BO0 A;  5BN3 A;  1G91 A;  3SVM A;  4OL7 A;  2LMC B;  5C3W A;  4R8I A;  2K5Q A;  1PRT C;  1STA A;  3MHB A;  4CHT B;  1F2Y A;  2NTS A;  5C3X A;  2C9O A;  2Y0S B;  5E4X A;  1NUC A;  1STB A;  3HKZ B;  3R8B A;  4XTC S;  1IKM A;  3DEO A;  2QCP X;  2ZT9 C;  1SE2 A;  1H9K A;  4HSV A;  1LTB D;  2XRQ D;  2SDF A;  3J81 E;  1L0Y B;  4GZY C;  1Q12 A;  2AQ2 B;  2F1M A;  3IAY A;  5C5L A;  3GTL B;  2WII B;  1UAP A;  1I50 B;  5JEA G;  2EYL A;  3S2D B;  1S5D D;  3GV6 A;  2BE5 C;  1B1Z A;  2E2H B;  1LT6 D;  5FO8 B;  4CKE A;  1Q90 A;  2EJM A;  5EPJ A;  4G57 A;  4C2M B;  3GTQ B;  3PIP 3;  3BDC A;  4ZQ3 A;  4IN3 A;  3KLS A;  5F2D A;  2R6G A;  1ZKO A;  3FKI B;  5D3D A;  3H3V C;  2WAC A;  2EZV A;  4C3H G;  1FYC A;  5EBD A;  5A2Q L;  4FYD A;  1VMP A;  4J8Q A;  1Z7T A;  1DCZ A;  4KN4 C;  3FDT A;  3MC0 B;  1PTO H;  1JWM D;  1G8Z D;  3D4R A;  2EY2 A;  1GUG A;  3D6W A;  1VF7 A;  1GUN A;  3MXG A;  4M8A A;  2F0D A;  1JB3 A;  4QMG A;  2F0U A;  3IKJ A;  5I6Y A;  2DN8 A;  2QKI C;  1Q3L A;  5DEH A;  5JEA H;  3A55 A;  3A54 A;  3BVG A;  2IW3 A;  2F0M A;  2SEB D;  3S16 B;  2FJ2 A;  4C56 C;  2B39 A;  3KBG A;  3WOE A;  3HOV B;  3OW7 A;  4L63 B;  3BVZ A;  1G2T A;  4Q5V A;  3C1F A;  5CGK A;  2K03 A;  1S5C D;  3GTG B;  2F3W A;  4IQZ A;  1EQV A;  1T5E A;  2KVM A;  5M9O A;  2K28 A;  3Q22 A;  3HP3 A;  2IX0 A;  3MZ5 A;  4QCL A;  5C4X B;  1I3Q B;  2XWB B;  1YNJ C;  1LT4 D;  4CJ0 B;  3T13 A;  4I65 A;  1O7Y A;  4C3J G;  5KYI A;  2O5J C;  3I4L A;  5FLX E;  1EY0 A;  4ZUJ A;  3BYY B;  1SMY D;  1ENC A;  3A56 A;  4OGQ C;  4XYO A;  5KGU A;  2PNR C;  3K5N A;  4WOR A;  1QJO A;  1C48 A;  4IFD G;  3L3O C;  1F9P A;  2JYO A;  4ILW A;  3TDQ A;  3VR4 A;  1WTP A;  3NTI A;  1E2V A;  3IL8 A;  1A3T A;  3HOZ B;  5EGT A;  5CMD A;  2EYO A;  4K6D A;  3OOC A;  1STG A;  4ZKC B;  2XNA C;  1LTG D;  4XQQ A;  2HDL A;  1GHJ A;  1LTT D;  3K5M A;  2ZXP A;  1CT1 D;  4U68 A;  2KEE A;  4J6H A;  3HZX A;  4FP5 D;  3G7L A;  1SE3 A;  1HFG A;  1I4X A;  5IGE A;  1HUM A;  5C6A A;  2EVB A;  3Q6S A;  1GUO A;  1G29 1;  5C0X J;  4K6L A;  3K58 A;  2ICI A;  1I4R A;  3WOF A;  1MSG A;  1D1K A;  1DOK A;  1FR3 A;  1KDA A;  2CW0 C;  1EWH A;  3PO2 B;  2KCN A;  1NR2 A;  2JA8 B;  1WD0 A;  2JA5 B;  2BDN A;  2RDH A;  2NVX B;  1STE A;  1QG7 A;  1XWE A;  1RD9 D;  4IFD H;  2A5H A;  2Z4I A;  1O7L A;  1CK1 A;  3ZYY X;  2J0T D;  5NUC A;  1FNV A;  1QCB D;  1YNN C;  3DMU A;  3KUP A;  2D2C C;  2RDF A;  4EGV A;  4BS9 A;  2LKV A;  1GXD C;  4HTH A;  1FNW A;  3PUY A;  4KY7 A;  2F3V A;  3FRP B;  5I2Y A;  2JEA I;  5DM7 3;  3P7J A;  1JWS D;  1U4M A;  2EYF A;  1AP0 A;  5FOB B;  1SNQ A;  1DOM A;  1I6V C;  1AEX A;  2E76 C;  3S17 B;  1EU4 A;  4J1M A;  3C3L A;  4RWS C;  3WDN A;  1J9O A;  4RGT A;  5D14 A;  4ZLT F;  3SK5 A;  5CV9 A;  4NW2 A;  4NKL A;  3K0Y A;  2MJ8 A;  3NBI A;  2NZ1 D;  3NQT A;  1EIH A;  2XSC A;  4XXE A;  2VB2 X;  1KLU D;  3GD7 A;  1AZP A;  4EQO A;  3S14 B;  1NR4 A;  3Q24 A;  5C0X I;  3LNN A;  1NCV A;  2KJX A;  3P75 A;  4BBR B;  2WAQ B;  1XYI A;  1XXG A;  1KTK A;  4EVO A;  1EEF D;  1ZYR C;  5IOC A;  2BA0 A;  4PNY A;  1GJX A;  3E5S A;  3K57 A;  2PCF B;  3HOW B;  4IUT A;  4IFD I;  1CQF A;  4F88 A;  1WD1 A;  3C2P A;  2PZU A;  1V8Q A;  2RSN A;  2JXM B;  1BR9 A;  4X3U A;  1DOL A;  4NMZ A;  3BDL A;  4JK1 C;  3NK9 A;  3LX0 A;  3I4M B;  1EWC A;  1AFP A;  5CV8 A;  2K5D A;  5HUR A;  1MGS A;  2AQ3 B;  4KTA A;  2L5T A;  5EJW A;  4A3E B;  2X69 A;  2AQ1 B;  3GTJ B;  4ODG A;  2K6A A;  1IYV A;  3TSS A;  4RKL A;  3R2T A;  3VYT A;  3LWU A;  4KY6 A;  4RHR A;  4YIJ A;  1K83 B;  1X32 A;  5JOB A;  2LY7 A;  1C4Q A;  1CZW A;  2F0K A;  1ET6 A;  1I4P A;  1W6K A;  1Z6H A;  1PTO D;  1TII D;  5C4Z A;  3J80 E;  4XT3 B;  3A7A B;  4RKB A;  1BCP D;  5ISR A;  3L7Z C;  1B4O A;  3T51 B;  4ZRZ A;  1SYD A;  2ENB A;  2PMZ B;  4RCO A;  3TP6 A;  3HOY B;  3Q0A A;  1D5X C;  4ZK9 B;  1PLF A;  1VF5 C;  1S5B D;  4KD3 A;  5D65 A;  4IZ8 A;  5I9O A;  1BBX C;  2X6G A;  4LAA A;  2RDG A;  4V0B A;  1V43 A;  4DNT B;  4FF2 A;  1JOR A;  1LTI D;  2EYP A;  3RZO B;  3E6Z X;  2SNS A;  5J22 A;  1SNC A;  4KJN A;  2EJG C;  2E2D C;  4OO1 H;  3M7G A;  2F0N A;  3J7A F;  3M3Y B;  2XN9 C;  2MGS A;  1EY8 A;  4HCE A;  4BA1 I;  4RFB A;  1A3U A;  2HCI A;  4PMW A;  1F2Z A;  4G7H C;  1V1P B;  5A35 A;  2JSO A;  2A6E C;  4DAP A;  3QIA A;  3GTP B;  1WTV A;  3LWE A;  3I72 A;  5FO7 B;  4HR7 B;  3VR2 A;  5CBA E;  1ENA A;  4OIJ A;  1NAP A;  2F0L A;  3DEP A;  4DGZ A;  3TN2 A;  3NE5 B;  3BS1 A;  1R9T B;  1D5Z C;  3A8J E;  3D8G A;  4BBS B;  5IGC A;  2K1B A;  4A3B B;  2PO4 A;  2PW5 A;  4KKT A;  2WKC A;  2R93 B;  1SNM A;  3H91 A;  1RTO A;  4E6I A;  4KI0 A;  1IW7 D;  1CQV A;  4ULL A;  2L0C A;  4XIG S;  3SR1 A;  1MBY A;  5DAU A;  3TZU A;  1Y8N B;  1WTX A;  2A6H C;  1ROD A;  1PFN A;  1GUW A;  4HAE A;  1C8C A;  2EDG A;  3HGB A;  3SE0 A;  1BOS A;  1CHP D;  1H9S B;  2K33 A;  2QIL A;  3NPP A;  3OWF A;  5JVG 3;  1T5X D;  1HA6 A;  4CBV A;  2D62 A;  5T1G A;  4B9X A;  5IGF A;  4ME5 A;  4C3I G;  5G3L D;  1EY5 A;  5HGT A;  2EY5 A;  1II3 A;  2DY7 A;  3AMU A;  1TWH B;  3EA6 A;  4B08 A;  1JOQ A;  1Y69 U;  3RZD B;  5EKK A;  2IT1 A;  3I91 A;  5IGG A;  2JA7 B;  3G6J B;  3IFT A;  5DNF A;  5JPN C;  5LL6 S;  4XYQ A;  2JA6 B;  4EQN A;  1QNU A;  5EKL A;  2PPB C;  5KNB A;  4QUF A;  3RMH A;  2BOS A;  5M5Y B;  3VA7 A;  2NVT B;  3CKI B;  3BVM A;  3V05 A;  2L12 A;  3HEJ A;  2AUJ D;  2Z4H A;  5T1I A;  4BY1 B;  4K5W A;  3VYR A;  1F9S A;  2BE5 D;  3P1H A;  1SFO B;  1F9R A;  3PUX A;  1TT2 A;  5EBC A;  5JEA J;  3VR3 A;  1QWY A;  1EL0 A;  4KJO A;  3VYS A;  1R4P B;  2L11 A;  3OSO A;  1QIL A;  1A15 A;  2DNC A;  3EFX D;  3S15 B;  2YYZ A;  1EYC A;  1A3V A;  5KNC A;  1HFN A;  2VB3 X;  4MIU A;  2E2I B;  3PUW A;  5I6W A;  4A3G B;  2Z8L A;  3OIP A;  5BN5 A;  2H1E A;  4K2K A;  3SDZ A;  2HDM A;  3W2D A;  4IUN A;  4A3J B;  4KMU C;  4HED A;  4MN3 A;  2G9D A;  1H9J A;  1HCZ A;  1KNA A;  2L1B A;  2EJF C;  3NTH A;  2A68 C;  5LHY 1;  5IGD A;  1LTS D;  1ET9 A;  1KDB A;  1SYC A;  1LT3 D;  5KIX A;  1E2Z A;  4CJ2 C;  3T16 A;  5K36 G;  3NTK A;  1SYB A;  1DD2 A;  4CJ1 B;  2KOL A;  4RH6 A;  3QG1 A;  2QEJ C;  4K5X A;  1X3P A;  3A8K E;  2EPB A;  2O5I C;  1QOH A;  2WIN B;  1K8M A;  3T53 B;  4PMC A;  5EPL A;  4X3T A;  2K7V A;  3J81 L;  1I6H B;  2PZT A;  1SBB B;  2HQE A;  3I70 A;  2R61 A;  1F2L A;  3NQI A;  2IL8 A;  3U9O A;  3R2I A;  1RJT A;  3M7N A;  1YNJ D;  2JEB I;  4F8M A;  5M3F B;  1QE6 A;  4A3K B;  3C46 A;  4NDX A;  4X3S A;  1WTR A;  2NUC A;  3NUC A;  3S1N B;  2XIW A;  1A2T A;  1GUT A;  2B8F A;  1J8I A;  1HQR D;  2MUY A;  3QO2 A;  5FKA C;  1F77 A;  4DA2 A;  5TSS A;  4ABN A;  2EY6 A;  4IFD J;  1TQO A;  1SYF A;  1CA5 A;  1PFB A;  2PW7 A;  1V1O A;  3F2U A;  3IFD A;  5K36 H;  2TSS A;  3NP8 A;  4CKC A;  1V1P A;  3I8Z A;  4FVM A;  1SYG A;  1KAA A;  3OPO A;  2I46 A;  1BDO A;  2FHT A;  2OT2 A;  4S3S A;  3D4W A;  1FD7 D;  3TP7 A;  1Z47 A;  2K5W A;  2NTT A;  2FMC A;  5JVH 3;  1GUS A;  2CW0 D;  1S5E D;  1VCI A;  3BZD B;  1BF4 A;  3NWT A;  2BDO A;  1XX8 A;  2IX3 A;  3EJI A;  3H6M A;  4QF4 A;  4R9W A;  1TVX A;  4RCN A;  1K8O A;  1IL8 A;  1OXT A;  1TS5 A;  2VXW A;  2RKS A;  3DWQ A;  4RA8 A;  3K5L A;  4G4K A;  2A69 C;  4A3M B;  1ML0 D;  1YNN D;  2X6L A;  4P2C B;  3BDO A;  1PDQ A;  1Y8O B;  5IT9 E;  4IUV A;  5FLX L;  2RQX A;  2ID0 A;  4RAU C;  2WP8 J;  4JBW A;  3GTM B;  3S1R B;  2KQ3 A;  3R3O A;  1I4H A;  4H0L C;  4KY5 A;  4NP5 A;  4C1N I;  4QB4 A;  5ELD A;  5CV7 A;  1DM0 B;  3K5O A;  3M4O B;  2FIN B;  4A93 B;  2KHS A;  3JAM E;  4RGO S;  2C5C A;  2SNM A;  4RGM A;  3RUZ A;  2EYJ A;  2XVS A;  4FF3 A;  1I4G A;  1I4Q A;  3SEB A;  4OO1 G;  1RHP A;  3E0J A;  3V96 A;  1JR0 D;  4KHZ A;  2E75 C;  3I3C A;  5IIF A;  4G7O C;  1PTO B;  1U4L A;  1EY6 A;  1ONL A;  3CRL C;  2IPK D;  3ERO A;  1BCP B;  1HTP A;  4N9P A;  3TP8 A;  4IUU A;  2NN6 H;  3MVV A;  1JQY D;  4AYB B;  3ND9 A;  4FXG C;  3TME A;  1E0B A;  2NBF A;  2M9V A;  1TWC B;  1ENF A;  3BG3 A;  2K01 A;  3I73 A;  2F0S A;  1RF2 D;  4TQU S;  2CVR A;  2LS0 1;  1G2S A;  3AU7 A;  3J7A V;  4C1N K;  3DWA A;  1EU3 A;  1EZ6 A;  1JWU D;  2B2W A;  1AW7 A;  1D5M C;  5I9P A;  1RCV D;  5ELC A;  3PUZ A;  1WTO A;  1U4R A;  4F87 A;  5M3M B;  1HUN A;  1GHK A;  2F0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...