1ESRA

Crystal structure of human monocyte chemotactic protein-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
EPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCYTE CHEMOTACTIC PROTEIN 2
publication title Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2000-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1esrA00
2B2UC 1G2TA 1VMPA 4ZAIA 2X69A 4XT3B 3D6WA 1AP0A 1O7YA 1HFNA 3ONAB 1HHVA 1KNEA 2M2LA 4OIJA 5COYA 1WTVA 1U4MA 2DY8A 1NR4A 3MTSA 1DZ1A 1JE4A 2NWGA 3I3CA 1PFNA 4CJ2C 1WVLA 1IKMA 1B53A 1WTQA 4IUTA 5EKIA 5T1GA 3R93A 1B4OA 1HUMA 2K03A 2KOLA 3IFDA 4RAUC 1WTRA 1ILQA 1RJTA 3IL8A 2SDFA 3TN2A 1G6ZA 2D9UA 2FMMA 5CBAE 4RWSC 1XYIA 2FINB 1NR2A 4IURA 4UAIA 2RSOA 1WTPA 1EIHA 1ML0D 4QUFA 2NYZD 1IKLA 2B2VA 5D14A 4HEDA 1DOMA 2DY7A 1RTOA 1A15A 2JP1A 3LWEA 4IUVA 4X3SA 5EPLA 2H1EA 1PDQA 5EPJA 1BNZA 1CM9A 1G2SA 2FHTA 1RTNA 3Q6SA 3F2UA 2B2TA 1KNAA 3P7JA 2B2WC 1O80A 1MGSA 3DM1A 5JJZA 2B2YA 3I91A 1PFMA 2MP1A 1SDFA 2MGSA 2KVMA 5CBEE 1ESRA 4O42A 5CORA 1J9OA 1EL0A 2L1BA 4QUCA 1MSHA 5AFWA 4IUPA 2L9HA 3DEOA 5T1IA 3UI2A 2N55A 1PLFA 3H91A 3HP3A 3TZDA 1VMCA 1MSGA 2B2VC 1ICWA 4OIKA 4NW2A 1M8AA 2NZ1D 2BDNA 1SSOA 2Q8TA 1DOKA 1HFGA 2J7ZA 1DONA 1GUWA 1HUNA 3GV3A 1U4LA 2VXWA 5DNFA 1XX8A 2MJ8A 2K28A 2B2TC 1ZXTA 2KEDA 1BF4A 2L12A 3DEPA 1B2TA 2KUMA 1MI2A 4DN4M 3QO2A 1HA6A 1G91A 1BO0A 4MHEA 1NAPA 2JYOA 2FFKB 2RA4A 3GV6A 1AZPA 3MWYW 4RA8A 5D65A 1HRJA 1F9SA 4CJ0B 1PFBA 2K1BA 2RVLA 5EPKA 2EE1A 2X6GA 2KECA 1U4RA 2R3ZA 4ZKBB 4HAEA 1TVXA 4MN3A 2IL8A 2HDMA 1WTWA 1RODA 1F9PA 1EIGA 1QE6A 1X32A 1DOLA 1E0BA 2K01A 2KEEA 1WTXA 1BBXC 3FDTA 4HCSA 4IUUA 5EQ0A 1B50A 2CVRA 4ZLTF 2HDLA 1RHPA 2MPMA 4ZK9B 1WD0A 4LMQD 2L4NA 1B3AA 1WD1A 1J8IA 1CA5A 1QNKA 1QG7A 1X3PA 2HUGA 4U68A 4XT1B 2K05A 1JICA 3G7LA 4IUQA 1LV9A 5E4WC 2XIWA 4R9WA 1Q3LA 5CMDA 3I90A 2B2YC 5E4XA 4R8IA 2B2UA 3SVMA 2HCCA 4ZKCB 1F9QA 2X6LA 1WTOA 3I8ZA 1U4PA 3KBXA 2N88A 1F9RA 1CA6A 2B2WA 2K04A 1O7ZA 4HSVA 5EJWA 2FJ2A 1EQTA 1F2LA 2L11A 1AZQA 4X3UA 1EOTA 4CJ1B 4X3KA 1S4ZA 3FPUB 1IL8A 1SAPA 3N52A 1ILPA 2HCIA 3KUPA 2EOTA 2Q8RE 1NCVA 4XDXA 1C8CA 2EPBA 2RSNA 1X3QA 4X3TA
chains in the Genus database with same CATH superfamily
4HSPA 3QB3A 3F2BA 3GTPH 3ND9A 1WTVA 3QWNA 2NN6G 1K0SA 1WVLA 1S40A 2Q2TA 4B3TQ 3PO3B 2K7VA 4RGMA 3HOVB 1B4OA 1WTRA 3L0OA 1B1ZA 1CI3M 1KDAA 2PW5A 3T53B 3FMCA 1EIHA 1SLJA 2JA8B 2G9HD 4C3IG 2R61A 3D4WA 4KHVA 3PGZA 1EUJA 5C0XG 3FKIH 3H0GG 2CW0C 1E24A 4HJAA 4JYAL 3MXPA 1AN8A 3A74A 4DV1L 2NTTA 1DM0B 1QUQB 2DNEA 3OIQA 2N55A 1AE2A 3HP3A 2OF1A 1I4XA 4POGA 1WCMH 1EYCA 1VQNA 3M4OH 2R93B 1A8VA 4WFN3 4YWLA 1IXRA 4X66Q 5IY0A 1LTID 3IFTA 2VB2X 2UXDQ 1B3QA 1VQBA 3ND8A 3PUVA 3TP6A 3UDXA 3GTLB 4A3GH 2JYOA 2PNHA 1HA5A 2F3WA 4ZUIA 3SDZA 5FLXc 2OQKA 2JA7B 5EBDA 4XQQA 1EY9A 3S1NH 4H7BA 2R3ZA 3U4ZA 2FMCA 2R7ZB 3GD7A 4OWTB 1IYJB 1HR0L 3EROA 3K0YA 4IJLA 1B3AA 4IPGA 3HGBA 1SYCA 1D5ZC 5CMDA 4PZ6A 5FO7B 2IPKD 2X6LA 1SNCA 2PO4A 4B08A 3BZCA 3S15H 2UUCL 5DLQE 2BH2A 2BCOA 1HZCA 3GTOH 3EQLC 3FPUB 4QL5A 1NUCA 1XPRA 1SE2A 1SNOA 3I4NB 4JK1C 3HKSA 3EVQA 5CR3A 3VDYA 1X9NA 2F0VA 2RCNA 1PTOH 1BUVT 4DV2L 5CV5A 2DN8A 3S1QH 4IPHA 1B8AA 3MEHA 1Q1BA 1Y1VB 4HTHA 4A3CH 2LS01 1XTCD 4QMGA 4QJFA 4LUZA 3SK6A 3FHWA 2NVYB 2Y0SB 3Q0AA 2PW7A 2UXBL 1M90C 4UPAA 4C1NK 1L2FA 1TXYA 2D9UA 3BZKA 2NZOA 5C0XJ 1XNRL 5H1SE 5JEAG 2JA5B 1EYDA 2XVSA 2OTLA 2F4VQ 4B9WA 3K81C 5C3WA 1JJGA 1CM9A 2K5NA 2FHTA 4KKSA 1RD9D 2B2YA 2BOSA 4L8JA 1S5DD 1I94L 2WB1B 3CP0A 1BBUA 4DAYA 2KQ3A 1GUTA 4LFAL 1YNNC 2KENA 4JI8L 1SFOH 4JI7Q 3DMUA 3V96A 3TP8A 1H9KA 3H6MA 2EQSA 3BS1A 1U4LA 3DXJC 2NB0A 2MHVA 1BCPF 1K3BC 2L5TA 1KLUD 1LO5D 3K5MA 1TKWB 4V190 2NN6I 4CHTB 1IBLL 2EYJA 5J39A 4UDUC 4UP9A 5C44H 1B70B 4JI4Q 5JJKA 4OO1H 2RDGA 3PF4A 4EQ5A 1Q8IA 4HJ7A 4ME3A 4A3GB 2NVQB 2C5CA 2K4KA 4A3IG 2CHBD 4H02A 3E0JA 3RN5A 1A6XA 3T1YQ 1YHQA 1UUPA 3BDLA 4J15A 5C0XI 2YYZA 3S1NB 1D2BA 4ZQ3A 1Z7TA 2HQLA 3GTKH 5KYLA 5FOBB 2XRQD 3KLRA 3PSIA 4HSVA 4TVAB 1X6OA 1W6KA 5IT9E 4A3JH 5I6YA 3GO5A 5I9OA 2LFNA 2K5VA 2WB1E 1M4VA 1KRTA 2Z0SA 3J7ZC 2R7DA 3J81j 3PV0A 2F0UA 3N6RA 5J1ZA 3U9OA 4DV0L 1SXTA 1AP0A 3S15B 1KNEA 1ZEQX 4OX9Q 2VUMH 1I6VC 1O7IA 3VR6A 4DV3L 1PFSA 3GTOB 1JWSD 5JEAJ 3HOUB 3VA5A 5IYBG 4RAUC 2JA9A 4AYBB 1VQ5A 2ID0A 1Z9FA 4LF9L 1PTOB 2XTIA 4JI3L 4DNRB 4LF4Q 1A2TA 3S1QB 3H3VI 4M1UB 3IRBA 2JEBI 3A0JA 5EPLA 3LWEA 1EU4A 3WOFA 3NSWA 1ZYRC 1DXMA 1XWEA 2N78A 4KV6A 4DV6L 1GOZA 3CAMA 1TWCH 3I72A 1KXLA 4CGYB 5C3EH 5CBEE 1Q7YC 1J9OA 3EA6A 1EL0A 1CUKA 3K0XA 5ELFA 3A8JE 5T1IA 3ICEA 4YCWA 3HKZG 2NVTH 2E2JB 1HTPA 2Q8TA 1SMXA 1YNJD 4C3HH 3GV3A 4JI1Q 2VXWA 3A54A 4NPSA 2MJ8A 5GAEC 1EY8A 4GOPC 3DEPA 3H15A 3CCSA 4KD4A 4KHPL 5IYCG 1WTHA 3F2DA 1T5EA 3LX0A 1F2ZA 5D65A 4CJ0B 5LMUQ 1HNXL 4BBSG 3CC4A 2F0MA 1TWAH 2I07B 2KBNA 1U4RA 3U4VA 1J5EL 1I6HH 4K14A 4AYBE 2OXPA 1VQKA 1PRTB 1SRUA 3VR4A 4DKAC 4EVOA 3TMEA 1QNKA 4KY7A 2IX1A 1X56A 2XIWA 5C44B 1TQOA 4PV1C 3J81i 2ICIA 4L5QA 2K5QA 2L0CA 4L5RC 1F2YA 2A69D 2AQ2B 1F9RA 4DV4L 1Q81C 4DR1L 1OXSC 1LUZA 4A3MB 1QB5D 5IODA 1XTDA 1NJIC 4JOIC 1O7LA 2R7FA 1HQRD 3I3CA 5BR8Q 2B2UC 2GVBA 2HT1A 1JE5A 3NXWA 1JE4A 1AW7A 1TS4A 1HTLD 2Z8LA 3PIOA 1XMQQ 1K0RA 1TWFH 3J80i 1XPUA 2DGYA 5C4XH 1K8OA 1GHKA 3KJPA 3DUZA 1XNQQ 1S5BD 2A6HD 2F03A 3DM3A 4BY7H 2VUMB 5BN5A 1XMOQ 4QUFA 1JWMD 1JOQA 4KJNA 5FLXL 3I56A 1EEID 2JP1A 4WJ4A 3M4PA 3K6OA 1V1PA 3HOZG 3CMAA 1ONLA 4X64L 4GN3B 3RMHA 1YJWA 3RZDH 1UEBA 1D7QA 3PO2H 3CRLC 4DXGA 4FNFA 3ZYYX 4GKJQ 2YTXA 1ICWA 3GTGH 3D4RA 4C2MB 3AQQA 1AFPA 1TWCB 3UDGA 1VQ9A 3J7YW 1EYGA 3M3YB 4A3FG 1S5ED 2K28A 1I4GA 5C3EB 2QEJC 4DUZL 1X65A 4DAMA 1BO0A 1MJCA 2A73B 4O0AA 5M5WB 4A75A 4FF2A 2B39A 5M3FB 2F0OA 1LTBD 3G48A 2ENBA 2B8FA 4C3HB 4KN4C 1GUOA 1OXXK 4OHJA 4CDCC 1ENFA 4DUYQ 4DR4L 2UUAQ 1EIGA 1YVCA 4KI0A 1IBML 2KHIA 5EAYA 1Z47A 1K73C 1Y1WH 2F3VA 4LMQD 3ULLA 1X3PA 5CYUA 4K5XA 2O4XA 3J7AV 1BXTA 1KD1C 1TWAB 3KF8B 5IGCA 2B2UA 3L9AX 4N8X1 1HZ9A 3KLWA 4JBMA 1F9QA 3FP9A 1I6HB 3FRPB 5JPMC 3I73A 2B2WA 3S1RH 1N34Q 2UU9L 4IUNA 1OO9B 4XDXA 1C8CA 3CHBD 5D3IB 5C3XA 5M3MH 1VQOA 1XPOA 4K8JA 5CGKA 1QVFA 2R92G 4K5VA 4ZYSA 1QZGA 5GAGC 2K32A 2B63G 1STGA 2K52A 2D0PA 1RJTA 3U9SA 1V8QA 1G6ZA 1ZKOA 2B3GA 2M9VA 4KKUA 5CBAE 2IHFA 3SEBA 4TKOB 3V05A 1SYEA 3EN2A 4AQYQ 1CHPD 3QG1A 2Q2HA 1TWFB 4B3TL 1M1KC 4LAAA 5C4XB 3Q22A 4GNXA 3NBHA 4MIUA 1OXTA 3S2DH 3F2UA 1HZAA 3P7JA 3VYRA 2HD3A 4BY7B 2VQEL 5JJLA 4K2KA 4IALA 4HMJA 2PQAB 2Z1CA 4P72A 4GS3A 1MD2D 1I50H 3STBC 5AJ3Q 2E76C 3M9BA 2ES2A 1MBYA 3S24A 2NN6H 1STBA 2F1MA 1DONA 1HUNA 2DNCA 5DNFA 1BF4A 1X55A 3OMCA 2N3SA 1JOKA 2AQ3B 3RZDB 4Y52H 1VQAA 2E8GA 2F0TA 3JAMi 4A3EB 1TWGH 2QF7A 2QEXA 3DWAA 2KHJA 2JA6G 1NAPA 3S1MH 3PCOB 4ME5A 1R9TH 4HJ5A 1YBYA 3OHXC 4C3IH 3AYHB 4H0LC 1PV4A 4G7ZC 1YNXA 1VQMA 1E1TA 4X66L 3H0GH 4RH6A 2G9DA 3K80C 3KOJA 4NXMQ 3JAME 2KEEA 1TY0A 2XWBB 1IYVA 4HCSA 5HURA 4JV5Q 2CVRA 1RHPA 3G4SA 1UE6A 1BCPC 3SHLA 1QG7A 4LF6Q 4OGQC 1LV9A 1EIYB 4R9WA 5EKKA 3RLFA 1RF2D 3SVMA 2HCCA 2YTVA 1S5CD 2IX0A 4CBVA 1BVSA 2Z9HA 2WINB 1WTOA 1HZBA 2BA1A 1X3EA 4KD3A 3P20A 5IWAQ 1SJHD 1AZQA 3E5SA 1Y1WB 2N8NA 3DHQA 3J7A5 3OMGA 4X62L 3KUPA 1E1OA 2EOTA 1BOSA 2JSOA 2Q8IB 1LM0A 1EU3A 3BZDB 4LFBQ 3BJUA 1JC7A 2J0TD 4F88A 3S1RB 1L0YB 4G7HC 1CKNA 5IGEA 1PFNA 3H3VH 1B9NA 1B53A 5T1GA 4RHSA 1HUMA 2EY1A 3IFDA 5DM63 3D4DA 3E6ZX 3BU2A 5C4JH 5M3MB 3GTQH 1XYIA 1WTPA 2RQXA 4PZ8A 3A8IE 5KIXA 3KF6B 3CC2A 1VF7A 2I5MX 4HEDA 2DY7A 1RTOA 4IUVA 3OW7A 2H1EA 1PDQA 2UUBQ 3A7AB 5IYDG 1KRSA 3PIPA 1ASZA 1PXUA 4ZCKA 4XQNA 2MUYA 2HHHL 2F0HA 1PZJD 4XIGS 1ESRA 4RCOA 1JT8A 1I4RA 2F4VL 3CMEA 4HR7B 1PLFA 4PMWA 3OTOQ 1HPCA 4OIKA 2ZT9C 2QA4A 2PQEA 1SSOA 3S2DB 2AUKA 2PZTA 2D2CC 2KEDA 5A2QL 1ZXTA 4ODGA 2RBMA 3R2IA 1B2TA 1ZYRD 4L6TB 5GROA 2WP8J 1DYQA 2ZJRA 1G91A 4YWMA 2EJMA 3B6YA 1I50B 4CKBA 2M00A 4G7OC 4LNQA 2F0SA 4DR6Q 5IGDA 1PFBA 2K1BA 2EE1A 2R93G 5G3LD 1NBWA 5FLXE 1E2VA 5E1FA 1QE6A 4NMZA 4K0KQ 1FJGQ 1TWGB 4KLKA 2DUDA 2MPMA 3KDFB 4YWKA 3X3NA 3S1MB 2K05A 2K50A 4JI2Q 3KLSA 1JJ2A 4R4CA 2B2YC 2DJFC 1E7ZA 4BS9A 4Z9CB 1Q8KA 3E9HA 3H0GB 1A0IA 3MXNB 2RCFA 3I8ZA 4A3KG 2A8VA 2R7ZG 2EIFA 2IJ0A 1CA6A 1VQGA 2K33A 5FLMG 4JW0A 4OXPA 3D0FA 4GKKQ 4EQOA 5LMNQ 3BDCA 1STYA 1VQIA 2K6AA 2F0PA 4WORA 3T1YL 4JI0Q 1E2WA 2E75C 2E2IH 1SYGA 4CDEC 5E3FA 1PVOA 4LW1A 2D5DA 4XT3B 2PCFB 5COYA 4LF8Q 3Q8DA 5HGTA 1PZID 4HIKA 3TREA 1O78A 3MFYA 3X3MA 5EKIA 4LF7L 3NP8A 3NEMA 4A3IH 2VNUD 3D31A 1CK1A 4YY3Q 1S3OA 1D1KA 4OX9L 1IZ6A 1GVPA 4KTAA 4PZ7A 5FK9C 2EZVA 4FF4A 4LFCQ 1Y1VG 3C1EA 1UWVA 4X3SA 5NUCA 3QR8A 4DV5Q 1Q12A 4QQBX 1UE1A 3EJIA 1VQJA 4JPBW 3T4AC 4LF4L 4O42A 2JA5G 1KL9A 5AFWA 4IFDG 1VF5C 3UI2A 4B3SQ 5KNCA 1PZKD 1AEXA 3LNNA 3RD4A 3K59A 4BXXG 3GTPB 1SROA 5M5XH 1D6EC 2Q2IA 4FXGC 4ALPA 1K9MC 3CD6A 4X65L 3CCJA 3OPOA 3ERSX 1HQMC 4CKCA 3R2TA 1CZGA 4XYOA 1F9SA 3PMFA 1KQSA 3MAQA 5EPKA 2IWHA 4JI1L 3UE1A 4HAEA 5IP9H 1CT1D 1RODA 2QILA 3FKIB 2ZXPA 1VQ6A 3HOWG 1I4HA 4JVZA 2V1CC 5C6AA 4NXNL 4PG3A 5LMUL 2JQOA 2OTJA 1EFWA 1ET9A 3CCUA 4HJ9A 1WCMB 2BE5D 3M4OB 1QILA 1FL0A 2F0DA 1D5MC 1UNSA 2KCTA 4K5WA 5LMNW 5CC4A 1TR5A 4R8NA 3CCVA 2EY6A 2N49A 3PUWA 2Y0SE 3VYUA 4DV1Q 5IYCH 2G5DA 1FYCA 2IT1A 4H44C 4BBSH 2F0GA 3TEHB 1II3A 4RHRA 1TWHH 2D0OA 4A3DG 1RCVD 4CJ2C 4J8QA 4LJZC 2E2IB 3MVVA 1R4QB 3E0EA 4PMBA 5BR8L 2CWAA 4RWSC 1EQRA 3K5OA 1NR2A 2WAQB 1ENAA 2ATWA 2XWJB 4A3BG 1CZWA 4DR5L 1PA6A 1IBKQ 1XMQL 3KLSX 5JPNC 3F1ZA 3SGIA 4HJ8A 3HOUG 1BNZA 1ASYA 3HEJA 3I70A 3M4QA 2JEAI 1I5FA 1XNQL 4IFDJ 1E2ZA 1QVCA 1KNAA 4AYBG 1L1OC 2QKIC 2PZWA 4JBWA 1PFMA 3AMUA 2MGSA 1XMOL 3I55A 2ALYB 3Q24A 3D8GA 4B3RQ 5IP7G 3PUZA 4FVMA 1ICFB 2BA0A 3L2PA 3E9IA 4OELB 2UUCQ 4UP7A 2J7ZA 2XN9C 5JOBA 5JVG3 3EBEA 4LF5Q 3AFPA 2KUMA 4MHEA 4CDDC 4A4IA 1AZPA 4FYDA 1NTGA 5CV4A 1JR0D 2KECA 4L63B 5M5XB 1JCKB 1QNUA 1SE8A 1F9PA 4JBJA 3HOZH 1DOLA 1BBWA 3KYHC 4HIMA 2WAQE 4KY6A 1XNRQ 1NY4A 4IZ8A 3G7LA 4V0BA 5J3BA 5JJIA 1VQCA 5E4XA 2F0EA 1PYWD 2YU9H 5I9PA 1EQQA 2ZJPA 3CPFA 2A74C 4BBRH 3GTJH 2K04A 1K8AC 4LUOA 1SFOB 4TRDA 1CKOA 1PH4A 4X3KA 1HNZQ 3M7NA 2QDLA 1PTOF 2O5IC 5A2QE 4IFDI 1ILPA 3I4MG 2RDHA 1V9PA 3HKZB 3NQTA 1SYFA 5FO8B 4ZAIA 2F0JA 2X69A 4JI8Q 4DPGA 1NR4A 2EXDA 4P73A 2WKDA 4YHHQ 1TS3A 5IGFA 1N36Q 3AU7A 4A3MG 1PH7A 2ZJQA 1L1OA 2VQFQ 1CTMA 2H4OA 3VA7A 3MHBA 4ULLA 1ML0D 1TWHB 1VQEA 5A35A 1NE3A 3K7AH 3M85A 3PQIA 3VYTA 3UDIA 3GTKB 2QCPX 2QDBA 4N9TA 4DNIA 1EWHA 3KF8A 3W5OA 4A3JB 4XYQA 2LMCB 2B2WC 1O80A 3OIPA 1MGSA 1BR9A 3I91A 4POFA 3HOXG 1SDFA 4C3JG 4PMCA 2XNAC 1D1IA 2A6EC 2L1BA 2VUMG 4AQYL 2NTSA 3K57A 2PPBC 1WYDA 2R92H 2E5LL 1PRTF 1RKNA 1X3GA 4I7AA 1JQYD 5ELCA 1YJNA 2B63H 2MFIA 5C5LA 1K3RA 1EFID 1FNWA 2Z4HA 1K28A 4LUVA 5ELNA 1MHWC 2EYLA 1LT5D 3W1BA 1UE7A 4XQJA 5AJ3L 1A2UA 5K36G 4RA8A 3WDNA 4JI6Q 1Q90A 1I4PA 4A93G 2HIXA 1WJJA 1AE3A 4JC0A 3URYA 2HDMA 1E22A 4BA2I 1LT6D 1U0LA 3ITPA 1EZ8A 5EQ0A 2EY2A 5C3EG 2K75A 2F0QA 3ULJA 2AKWB 4LF9Q 2RHSB 4GNXC 3G71A 4L5SA 1KDCA 2DJGC 1CSPA 1TS2A 2LSSA 4F8MA 3J7AF 1VQFA 5M3FG 5HY6A 2CW0D 3A7LA 4NXML 3HOZB 3CCRA 2NVTB 1RIPA 4JV5L 1O7ZA 4O2DA 1HXYD 1N33L 2NVXH 1LYLA 4DAPA 3J80c 4LF6L 3G6EA 1GO3E 1EY5A 4KK7A 4BA1I 5KYIA 4HIOA 2YU9B 4IJHA 1VMPA 1QOHA 3TP7A 4BBRB 1CHQD 3GTJB 1U4MA 3CW2C 5IWAL 1EOVA 2D62A 3F8TA 2KCCA 3U58A 1IW7C 4B9XA 4DR3Q 2HQEA 2ZXOA 4GZYC 2K03A 4AIMA 1VQ8A 2MO1A 4DK6C 3HOYG 1JB7A 3IL8A 4KHPQ 4NKLA 3JC66 3MXGA 4EQNA 1VQDA 1PH1A 4DXFA 3TP5A 5BN4A 1KAAA 1DOMA 1A15A 4ZRZA 2EYMA 3MFGA 3KBGA 1SNMA 1BKBA 4GLXA 3T56B 4WRDA 2SNSA 2UUBL 4DR1Q 3A8KE 2E2HH 2QGQA 4MTNA 1Y14B 5FO9B 1Q82C 1V1PB 1KHIA 2WV6D 4J1MA 3HS0C 2A68C 4GOPB 5M9OA 2VY3A 2FFKB 3OTOL 2K5WA 2R92B 2J4XA 4DFAA 2F0KA 1C4QA 4KJOA 1QVGA 5K5PA 2B63B 4XTCS 1H9RA 4YCVA 4ZKBB 1TVXA 5GADC 2EYPA 5IYDH 2K01A 4IPCA 3ZJYC 3QJYA 2NUCA 4DK1A 3M4YA 2HDLA 2CWPA 3KF6A 2LXJA 2WACA 4A3EG 4JI5Q 2HUGA 2RDFA 4U68A 4XT1B 4BY1G 4QY7A 4DR6L 3I90A 1H9SB 1C7YA 3PO2B 3NELA 3F2CA 1GUSA 1OXUA 3GTGB 2N88A 5EJWA 1I4QA 3OWFA 4X64Q 1EOTA 2Q2UA 1CQFA 1XJVA 5C0XH 4FP5D 5G3LF 1E3PA 1YNJC 1YNND 2AUJD 2UXDL 3T13A 4AH6A 3AB9A 4X3TA 1EY7A 2OT2A 3O13A 1HFNA 2R93H 2RF4A 4ILWA 3ERQA 3MTSA 1K83H 1DZ1A 2NVXB 4GKKL 5LMNL 1KTKA 1DGSA 4IUTA 1STNA 3HG9A 4JI0L 1X54A 5KEEA 1B44D 1GKHA 1QUQA 3GTMH 1A63A 1SE4A 1SMYC 1S5FD 1N32Q 5IT9L 4LF8L 4WJ3M 3L3OC 2JE6I 3KDFA 3CPWA 4A3KH 3TZUA 2R7ZH 2PI2E 2AQ1B 2E74C 4QGUA 3RUZA 3QOLA 1TY2A 3MXNA 3DM1A 2A69C 3MA2B 4YY3L 3V2TA 4X6AH 2ZXRA 2Z6KA 4GLVB 2JN4A 4L5TA 3E3XA 1MSHA 1SE3A 3DEOA 2F3IA 1MIUA 5KNBA 4NW2A 4XXEA 3A55A 4DV5L 3CCQA 1HFGA 1GUWA 3FPPA 2NBFA 4DV7Q 1SNQA 1UE5A 1JWUD 2FXQA 3PO3G 4DR7Q 5JAVA 3HOVG 3KFUA 1HA6A 5IGBA 1KLGD 4DA2A 1LTTD 3PIO3 1HRJA 2O5JC 2CH4A 1Y1VH 1NSNS 2RVLA 3I4LA 1HNWQ 4OONA 2JA8G 2E2HB 1CFMA 4R4TA 1LT4D 2IHEA 1W2BA 4IN3A 4ZLTF 4DNTB 4ZK9B 3T51B 1FNVA 1LACA 1D8LA 1LT3D 2CQOA 4KHZA 4BWGB 5ELOA 4IUQA 2JA5H 3AFQA 4EQPA 4IFDH 3OYYA 4FXKC 4RGOS 5GAHC 4G57A 4ZKCB 4O1NA 1HH2P 5JEAH 4BXXH 2OEOA 3U50C 4HCEA 3TSSA 4JI7L 5DAUA 5CV7A 1YHAA 1EY4A 2VQEQ 2Q8RE 2AWNA 2VZAA 1Q86C 4IQZA 5C5MA 2GA4B 2P5ZX 1R9TB 3S2HH 4B3MQ 1O7YA 2M2LA 4OIJA 4C3IB 2DY8A 1JOOA 4DK0A 4JI4L 2JA7G 1EZ6A 3HOWH 5FJ8G 2IW3A 3VR5A 2KOLA 2O2LD 1PTOC 1F77A 5KRUA 3TN2A 1FVIA 2ZM6Q 4MTKA 2YV5A 4A3LG 4UAIA 4RG1A 4F7XA 3IAYA 1MKHA 3DLLA 1K83B 1CSQA 3C1FA 2Z4IA 1Y8OB 1VQPA 2I5HA 3K5LA 3J81L 2ZTCA 4QIWB 1G2SA 2NVQH 2EDGA 1CKNB 3GTMB 4RKLA 3VYSA 2XRSD 2UXCQ 5JJZA 1V1OA 1A3UA 3NTIA 2VL6A 2LY7A 1K8GA 3I4NG 1G8ZD 1FGUA 1U9RA 3TS0A 4A3KB 1IBKL 4DR2Q 3Q23A 2CCZA 1EY6A 1VMCA 1M8AA 4A3DH 2NZ1D 3CU7A 1ET6A 3S14H 4A76A 4X62Q 2ICEC 1UEAB 5ISRA 2L12A 2C35B 3W2DA 4OWWB 2JXMB 3J80L 5J22A 1WOCA 2TSSA 3HRZC 4B3RL 5C4JB 1LTAD 2Y0SG 1JORA 1SN8A 3T1HQ 4A3BH 3GTQB 1G6PA 5IE8A 1PH5A 2A6ED 4CKEA 1PRTC 4UP8A 3HOUH 4MN3A 3VR2A 2A19A 3FDTA 4LF5L 1B50A 1PH9A 3M7GA 5IYBH 1Y69U 1VQLA 1GXDC 3A5UA 2K5DA 1BCPB 2CQAA 5IP7H 2CH4W 4FO2A 4QIWE 2WB1G 3W1GA 3MXUA 4FDBA 5LL6S 3UE0A 1OTCA 5IOCA 2L55A 3FKIG 1JB3A 1IHZA 1F2LA 1B7YB 2EYFA 1S72A 2HHHQ 4CJ1B 4P2CB 3S16H 1SJED 3N52A 3A5ZB 2V4DA 4DU9A 3ER0A 1QCBD 1T9HA 4DF7A 1G2TA 2E2JH 3I2ZA 1QWYA 4DAVA 1WCMG 1GD7A 5I6WA 5KNDA 5ELDA 1W3SA 5FKAC 1HNZL 2SEBD 1IKMA 4NDXA 3KJOA 3PUXA 3R93A 4P75A 3GDEA 3DWQA 2I5LX 1G51A 4JYAQ 4M8AA 1D5XC 2FMMA 3T16A 4A3GG 3S2HB 2FINB 3IKJA 3SK8A 5M5YH 5CV6A 1LLRD 3VR3A 1GUNA 4YHHL 4QF4A 5D14A 3HOWB 1N36L 1LTGD 1N9WA 2B29A 1TIID 2VB3X 1RTNA 2VQFL 1GM5A 3D3RA 3HZXA 1IW7D 1H9MA 1I3QH 3I4MH 4QCLA 4OWXB 1GJXA 1WFQA 2WAQG 3RLNA 1L0WA 1FR3A 4R4IA 1SR3A 3GP7A 2BH8A 4MNOA 1PYBA 2BDNA 5KGUA 3ULPA 3NE5B 2I46A 4A3MH 1YZ6A 4HMIA 4Q5VA 3L7ZC 1CQVA 2SNMA 3EIVA 4UHVA 4A3IB 1TU2B 3QO2A 4DN4M 1HR0Q 4FF1A 1GUGA 2F0WA 2RA4A 3GV6A 5LHY1 4A3DB 1U5KA 3H09A 2X6GA 2EYOA 4JBKA 2F0FA 2XGTA 3S14B 1LTLA 4A3CG 3SK4A 4LF7Q 1X32A 1BBXC 5LL6X 1E0BA 4KN7C 1NMFA 2ZTDA 1FD7D 3HOXH 3SE0A 4KMUC 1VCIA 4C3JH 1J8IA 5EBCA 1CA5A 4A3BB 3NQIA 4MZ9A 3DWPA 4JI6L 3NENA 2L15A 1KC8C 1Q3LA 3PIP3 4GKJL 2A68D 5IT9c 3WOEA 5IGGA 4DV2Q 3KBXA 3TDQA 5I2YA 3BVZA 1ENCA 1V1QA 1EQTA 1KIXA 2JK8A 4QB4A 4DAYB 1V43A 1F2MA 2HCIA 3STBD 2AHOB 2I0QA 2AMCB 2UXBQ 1QJOA 4OEMB 5K36H 1X3QA 3JAML 4YIJA 1PHJA 4A93H 5IP9G 4N9PA 2MQHA 3ONAB 4C2MH 1LTRD 1C48A 2NWGA 3M3YH 1DJRD 3S16B 3H94A 4YCUA 4DUYL 1Y8PB 2MO0A 1WTQA 2UUAL 3D6CA 4X65Q 3OSOA 4I65A 4U673 4RGTA 2VW9A 2C9OA 4A3FH 5M5WH 3MC0B 3K5NA 5M3FH 1I94Q 3OWEB 4Q0FA 2RSOA 2YTYA 2NYZD 5C44G 4DR3L 1BCPD 2Z6BA 4LFAQ 5HGQA 4OO1G 2PMZB 5EPJA 2EJGC 3A56A 5ELBA 4FF3A 1ESFA 1EQVA 1N34L 1TT2A 4NXNQ 3BDOA 2SOBA 1NNXA 4APVA 2A1AA 2KVMA 5M5YB 2KCMA 4QUCA 4IUPA 2L9HA 3C3LA 5I4DA 1YEZA 1SMYD 3H91A 3R3OA 4LK1C 1IBLQ 1LTSD 3TZDA 4BBSB 2EJFC 3RLOA 4A3JG 2F4IA 1I3QB 4IPDA 5EKLA 3HOYH 3I4MB 2WKCA 4IOAA 1HCZA 5JVH3 5CV8A 2VS1A 1HR0W 1VS0A 1P16A 1EEFD 2JJQA 3UDFA 1H9JA 1IYUA 2KA7A 4KKTA 3RN2A 1K8MA 3NBIA 1UAPA 3EFXD 2CFMA 1Q1EA 3J81E 2PNRC 1WTXA 2KJXA 1FNUA 2NZHA 4K6DA 4FXDA 4DK3C 4RGNA 1SEBD 3P75A 1YHBA 4JCVE 3HKZE 4OL7A 4DR5Q 1B9MA 1NMGA 1A3TA 4N8FA 4R8IA 2PMZE 2WIIB 1SYDA 4DV0Q 2PZUA 4PQXA 2MNAA 2L11A 3HOXB 3J81c 4JI5L 3CCEA 4C3JB 3P1HA 4RCNA 4DV3Q 2OCEA 2WFWA 1PH3A 2IX3A 1NCVA 1BDOA 3J80E 1A3VA 3CRKC 2EPBA 3BVMA 2RSNA 2CKZB 4RFBA 1P8LA 4TSSA 5EGTA 4JI3Q 3D6WA 4C1NI 2HIVA 4GOPA 4C3HG 2K14A 1PYSB 1RDPD 4A3EH 1X3FA 1ILQA 4DV6Q 3CKIB 3TBIB 2SDFA 4BY1H 2PQAA 1BQQT 3GQBA 5E7NA 2F52A 4A93B 3R8BA 4IURA 5F2DA 1R4PB 2PI2A 2A5HA 3CQZH 4BBRG 4IOCA 2JA6H 3S17H 1KDBA 5ELEA 3S9WA 3BYYB 1VQ4A 3I7FA 3CF5A 1H9SA 4J6HA 4ID6A 4A3FB 4EX5A 2PYKA 4Y7NH 1PH2A 1N32L 3BG3A 4S3SA 2BE5C 2MP1A 2ZTEA 3NTKA 5D3DA 5CORA 1PTOD 3RNUA 1L1OB 2EXZA 4LFBL 3K58A 3TRZA 1MSGA 3KK7A 2B2VC 1PH6A 1HNXQ 1VQHA 3CCMA 1J5EQ 1GHJA 1XX8A 2B2TC 4JOIA 4F87A 1HJPA 5I2XA 1EIFA 5BN3A 2R6GA 4UY8C 3MEFA 2EYHA 4I7ZC 3NUCA 2EVBA 3OOCA 1KAWA 1TS5A 4H13C 1T5XD 3K7AB 3HOYB 5IIFA 2IL8A 4WJWA 4DV7L 3QIAA 4IO9A 1Z6HA 3SK5A 1WTWA 3MZ5A 4GN5A 1WI5A 2EY5A 4DV4Q 3RZOH 4DR7L 1H95A 2XSCA 5C4XG 1LABA 1WD0A 3LWUA 1XXGA 4E6IA 2IY5B 2LKVA 2AWOA 3FVQA 4LWCA 4OO1I 3G6JB 1HNWL 2Z6KC 4EGVA 3CC7A 2OWOA 4BY7G 1YIJA 1N8RC 1KABA 1EYAA 3BVGA 4HIDA 1EWIA 4K6LA 4NB3A 3NWSA 1STAA 1L0XB 3I4OA 5C4HA 4P74A 4NP5A 4X3UA 1YJ9A 1PRTD 1IL2A 1S4ZA 3PO3H 1J6QA 1STHA 3HOVH 3TQYA 3SR1A 3CXCA 1JMCA 3BYTB 3NTHA 3PO2G 5CV9A 2OQ0A 3K8AA 4KY5A 1HHVA 4GLAC 2E5LQ 4GN4B 2JA8H 2GN5A 1AH9A 1YI2A 1W6JA 2H5XA 2ASBA 4R1JA 4K0KL 4R4OA 1FJGL 3K7UC 1C9OA 4C56C 3HFZB 2E2DC 4JG2A 4B3ML 5C4ZA 1PH8A 3H3VC 4JI2L 2BDOA 4P71A 4ZUJA 1IKLA 2B2VA 1SYBA 3WWVA 1OXVA 1Q46A 2F0NA 3Q6SA 4BY1B 2B2TA 3C2PA 3NPPA 2ZM6L 2RKSA 1CKMA 2GVAA 3AEVA 1Y1WG 5DEHA 3RR5A 1VDZA 3LGJA 1SBBB 2F0LA 3S17B 3CQZB 1SNDA 2JA6B 4DUZQ 3CCLA 3PUYA 3GTLH 1PMRA 3OW2A 4K2LA 1DD2A 3FEWX 5DM73 1N33Q 1DOKA 2JA7H 5FJ8H 5TSSA 4Y7NB 4DR4Q 2UXCL 1G291 2F0IA 1IBMQ 2K5HA 4HN7A 5FLMH 2LXKA 1MI2A 1QZHA 1FGBD 4DR2L 1SNPA 4A3LH 3NWTA 3SXHA 3MWYW 4R4QA 4G4KA 5M3MG 3NK9A 3JAMc 1A62A 2KCNA 2KHSA 4PNYA 1STEA 4CDFC 4LFCL 1EWCA 1VQ7A 3NHHA 3QOJA 4DGZA 3W3AA 4IUUA 1Y8NB 3C46A 2L4NA 1WD1A 4RKBA 3T1HL 2UU9Q 3I4NH 1JICA 5E4WC 5L37A 4GNXB 3NBHB 1YITA 1DCZA 2B8GA 1EY0A 4K8IA 4TQUS 1MJEA 2RHQB 4B3SL 1U4PA 3PF5A 3RZOB 2FJ2A 2A6HC 4ABNA 1IL8A 1SAPA 5GQOA 1RL2A 2NVYH 2TMPA 4RMFA 3TS2A 1C0AA 1JJCB 2QW7A
chains in the Genus database with same CATH topology
4HSPA 3QB3A 3ND9A 1WTVA 3QWNA 2NN6G 1WVLA 3PO3B 2K7VA 4RGMA 3HOVB 1B4OA 1WTRA 1B1ZA 1CI3M 1KDAA 2PW5A 3T53B 3FMCA 1EIHA 2JA8B 2G9HD 4C3IG 2R61A 3D4WA 4KHVA 5C0XG 2CW0C 3MXPA 1AN8A 2NTTA 1DM0B 2DNEA 3OIQA 2N55A 3HP3A 2OF1A 1I4XA 1EYCA 2R93B 4WFN3 1LTID 3IFTA 2VB2X 3ND8A 3PUVA 3TP6A 3GTLB 2JYOA 1HA5A 2F3WA 4ZUIA 3SDZA 2JA7B 5EBDA 4XQQA 1EY9A 4H7BA 2R3ZA 2FMCA 2R7ZB 3GD7A 3EROA 3K0YA 1B3AA 3HGBA 1SYCA 1D5ZC 5CMDA 5FO7B 2IPKD 2X6LA 1SNCA 2PO4A 4B08A 2BCOA 3EQLC 3FPUB 3I4NB 1NUCA 1SE2A 1SNOA 4JK1C 3EVQA 5CR3A 2F0VA 1PTOH 1BUVT 5CV5A 2DN8A 3MEHA 1Q1BA 1Y1VB 4HTHA 2LS01 1XTCD 4QMGA 3SK6A 2NVYB 2Y0SB 3Q0AA 2PW7A 4C1NK 2D9UA 5C0XJ 5JEAG 2JA5B 1EYDA 2XVSA 4B9WA 5C3WA 1CM9A 2FHTA 4KKSA 1RD9D 2B2YA 2BOSA 4L8JA 1S5DD 2WB1B 4DAYA 2KQ3A 1GUTA 1YNNC 3DMUA 3V96A 3TP8A 1H9KA 3H6MA 3BS1A 1U4LA 3DXJC 2NB0A 2MHVA 1BCPF 2L5TA 1KLUD 1LO5D 3K5MA 1TKWB 4V190 2NN6I 4CHTB 2EYJA 5J39A 4UDUC 4OO1H 2RDGA 1Q8IA 4A3GB 2NVQB 2C5CA 2CHBD 3E0JA 1A6XA 1UUPA 3BDLA 5C0XI 2YYZA 3S1NB 1D2BA 4ZQ3A 1Z7TA 5KYLA 5FOBB 2XRQD 3KLRA 4HSVA 5IT9E 1W6KA 5I6YA 3GO5A 5I9OA 2LFNA 3PV0A 2F0UA 3N6RA 5J1ZA 3U9OA 1SXTA 1AP0A 3S15B 1KNEA 1ZEQX 1I6VC 3VR6A 3GTOB 1JWSD 5JEAJ 3HOUB 3VA5A 4RAUC 4AYBB 2ID0A 1PTOB 4DNRB 1A2TA 3S1QB 4M1UB 2JEBI 5EPLA 3LWEA 1EU4A 3WOFA 3NSWA 1ZYRC 1DXMA 1XWEA 4KV6A 1GOZA 3I72A 4CGYB 5CBEE 1J9OA 3EA6A 1EL0A 5ELFA 3A8JE 5T1IA 2E2JB 1HTPA 2Q8TA 1YNJD 3GV3A 2VXWA 3A54A 2MJ8A 1EY8A 3DEPA 4KD4A 1T5EA 3LX0A 1F2ZA 5D65A 4CJ0B 2F0MA 2I07B 1U4RA 4K14A 2OXPA 1PRTB 3VR4A 4EVOA 3TMEA 1QNKA 4KY7A 2IX1A 2XIWA 5C44B 1TQOA 4PV1C 2ICIA 2K5QA 2L0CA 1F2YA 2A69D 2AQ2B 1F9RA 1OXSC 4A3MB 1QB5D 5IODA 1O7LA 1HQRD 3I3CA 2B2UC 3NXWA 1JE4A 1AW7A 1TS4A 1HTLD 2Z8LA 1K8OA 1GHKA 3DUZA 1S5BD 2A6HD 2F03A 2VUMB 5BN5A 4QUFA 1JWMD 1JOQA 4KJNA 5FLXL 1EEID 2JP1A 3K6OA 1V1PA 1ONLA 3RMHA 3CRLC 4DXGA 4FNFA 3ZYYX 1ICWA 3D4RA 4C2MB 1AFPA 1TWCB 3J7YW 3M3YB 1S5ED 2K28A 1I4GA 5C3EB 2QEJC 1BO0A 2A73B 5M5WB 4FF2A 2B39A 5M3FB 2F0OA 1LTBD 2ENBA 2B8FA 4C3HB 4KN4C 1GUOA 1OXXK 4OHJA 1ENFA 1EIGA 4KI0A 1Z47A 2F3VA 4LMQD 1X3PA 5CYUA 4K5XA 2O4XA 3J7AV 1BXTA 1TWAB 5IGCA 2B2UA 3L9AX 1F9QA 1I6HB 3FRPB 5JPMC 3I73A 2B2WA 4IUNA 1OO9B 4XDXA 1C8CA 3CHBD 5D3IB 5C3XA 4K8JA 5CGKA 4K5VA 4ZYSA 2K32A 1STGA 1RJTA 3U9SA 1V8QA 1G6ZA 1ZKOA 2M9VA 4KKUA 5CBAE 3SEBA 4TKOB 3V05A 1SYEA 1CHPD 3QG1A 1TWFB 4LAAA 5C4XB 3Q22A 3NBHA 4MIUA 1OXTA 3F2UA 3P7JA 3VYRA 4BY7B 4K2KA 4IALA 4HMJA 2Z1CA 1MD2D 2E76C 1MBYA 2NN6H 1STBA 2F1MA 1DONA 1HUNA 2DNCA 5DNFA 1BF4A 3OMCA 1JOKA 2AQ3B 3RZDB 2F0TA 4A3EB 2QF7A 3DWAA 1NAPA 4ME5A 3OHXC 4H0LC 4G7ZC 4RH6A 2G9DA 3JAME 2KEEA 1TY0A 2XWBB 1IYVA 4HCSA 5HURA 2CVRA 1RHPA 1BCPC 3SHLA 1QG7A 4OGQC 1LV9A 4R9WA 5EKKA 3RLFA 1RF2D 3SVMA 2HCCA 1S5CD 2IX0A 4CBVA 2WINB 1WTOA 2BA1A 4KD3A 3P20A 1SJHD 1AZQA 3E5SA 1Y1WB 3DHQA 3OMGA 3KUPA 2EOTA 1BOSA 2JSOA 2Q8IB 1EU3A 3BZDB 1JC7A 2J0TD 4F88A 3S1RB 1L0YB 4G7HC 5IGEA 1PFNA 1B9NA 1B53A 5T1GA 4RHSA 1HUMA 2EY1A 3IFDA 5DM63 3D4DA 3E6ZX 5M3MB 1XYIA 1WTPA 2RQXA 3A8IE 5KIXA 1VF7A 4HEDA 2DY7A 1RTOA 4IUVA 3OW7A 2H1EA 1PDQA 3A7AB 1PXUA 4XQNA 2MUYA 2F0HA 1PZJD 4XIGS 1ESRA 4RCOA 1I4RA 4HR7B 1PLFA 4PMWA 1HPCA 4OIKA 2ZT9C 2PQEA 1SSOA 3S2DB 2AUKA 2PZTA 2D2CC 2KEDA 5A2QL 1ZXTA 4ODGA 2RBMA 3R2IA 1B2TA 1ZYRD 4L6TB 2WP8J 1DYQA 1G91A 2EJMA 1I50B 4CKBA 2M00A 4G7OC 2F0SA 5IGDA 1PFBA 2K1BA 2EE1A 5G3LD 5FLXE 1E2VA 5E1FA 1QE6A 4NMZA 1TWGB 2MPMA 3X3NA 3S1MB 2K05A 3KLSA 2B2YC 4BS9A 4Z9CB 3H0GB 3I8ZA 2IJ0A 1CA6A 2K33A 4EQOA 3BDCA 1STYA 2K6AA 2F0PA 4WORA 1E2WA 2E75C 1SYGA 5E3FA 2D5DA 4XT3B 2PCFB 5COYA 5HGTA 1PZID 1O78A 3MFYA 3X3MA 5EKIA 3NP8A 2VNUD 3D31A 1CK1A 1D1KA 4KTAA 4FF4A 5FK9C 2EZVA 3C1EA 4X3SA 5NUCA 1Q12A 3EJIA 3T4AC 4O42A 5AFWA 4IFDG 1VF5C 3UI2A 5KNCA 1PZKD 1AEXA 3LNNA 3RD4A 3K59A 3GTPB 1D6EC 4FXGC 3OPOA 1HQMC 4CKCA 3R2TA 1CZGA 4XYOA 1F9SA 3PMFA 3MAQA 5EPKA 2IWHA 4HAEA 1CT1D 1RODA 2QILA 3FKIB 2ZXPA 1I4HA 5C6AA 1ET9A 1WCMB 2BE5D 3M4OB 1QILA 2F0DA 1D5MC 1UNSA 4K5WA 5CC4A 1TR5A 4R8NA 2EY6A 3PUWA 3VYUA 1FYCA 2IT1A 4H44C 2F0GA 1II3A 4RHRA 1RCVD 4CJ2C 4J8QA 4LJZC 2E2IB 3MVVA 1R4QB 4PMBA 4RWSC 3K5OA 1NR2A 2WAQB 1ENAA 2XWJB 1CZWA 3KLSX 5JPNC 1BNZA 3HEJA 3I70A 2JEAI 4IFDJ 1E2ZA 1KNAA 2QKIC 2PZWA 4JBWA 1PFMA 3AMUA 2MGSA 3Q24A 3D8GA 3PUZA 4FVMA 2BA0A 2J7ZA 2XN9C 5JOBA 5JVG3 2KUMA 4MHEA 1AZPA 4FYDA 5CV4A 1JR0D 2KECA 4L63B 5M5XB 1JCKB 1QNUA 1F9PA 1DOLA 4KY6A 4IZ8A 3G7LA 4V0BA 5E4XA 2F0EA 1PYWD 5I9PA 2A74C 2K04A 1SFOB 4TRDA 4X3KA 3M7NA 1PTOF 2O5IC 5A2QE 4IFDI 1ILPA 2RDHA 3HKZB 3NQTA 1SYFA 5FO8B 4ZAIA 2F0JA 2X69A 1NR4A 2WKDA 1TS3A 5IGFA 3AU7A 1CTMA 2H4OA 3VA7A 3MHBA 4ULLA 1ML0D 1TWHB 5A35A 3M85A 3VYTA 3GTKB 2QCPX 2QDBA 4N9TA 1EWHA 3KF8A 4A3JB 4XYQA 2LMCB 2B2WC 1O80A 3OIPA 1MGSA 1BR9A 3I91A 1SDFA 4C3JG 4PMCA 2XNAC 1D1IA 2A6EC 2L1BA 2NTSA 3K57A 2PPBC 1PRTF 1RKNA 1JQYD 5ELCA 5C5LA 1EFID 1FNWA 2Z4HA 2EYLA 1LT5D 4XQJA 1A2UA 5K36G 4RA8A 3WDNA 1Q90A 1I4PA 3URYA 2HDMA 4BA2I 1LT6D 3ITPA 1EZ8A 5EQ0A 2EY2A 2F0QA 1KDCA 1TS2A 4F8MA 3J7AF 2CW0D 3A7LA 3HOZB 2NVTB 1O7ZA 1HXYD 4DAPA 1EY5A 4KK7A 4BA1I 5KYIA 2YU9B 1VMPA 1QOHA 3TP7A 4BBRB 1CHQD 3GTJB 1U4MA 2D62A 2KCCA 1IW7C 4B9XA 2HQEA 2ZXOA 4GZYC 2K03A 3IL8A 4NKLA 3MXGA 4EQNA 4DXFA 3TP5A 5BN4A 1KAAA 1DOMA 1A15A 4ZRZA 2EYMA 3MFGA 3KBGA 1SNMA 3T56B 4WRDA 2SNSA 3A8KE 5FO9B 1V1PB 2WV6D 4J1MA 3HS0C 2A68C 5M9OA 2FFKB 2K5WA 2R92B 2J4XA 4DFAA 2F0KA 1C4QA 4KJOA 5K5PA 2B63B 4XTCS 1H9RA 4ZKBB 1TVXA 2EYPA 2K01A 3QJYA 2NUCA 4DK1A 2HDLA 3M4YA 2WACA 2HUGA 2RDFA 4U68A 4XT1B 3I90A 1H9SB 3PO2B 1GUSA 1OXUA 3GTGB 2N88A 5EJWA 1I4QA 3OWFA 1EOTA 1CQFA 5C0XH 4FP5D 5G3LF 1YNJC 1YNND 2AUJD 3T13A 3AB9A 4X3TA 1EY7A 2OT2A 3O13A 1HFNA 4ILWA 3ERQA 3MTSA 1DZ1A 2NVXB 1KTKA 4IUTA 1STNA 3HG9A 5KEEA 1B44D 1SE4A 1SMYC 1S5FD 5IT9L 3L3OC 2JE6I 3TZUA 2AQ1B 2E74C 3RUZA 3QOLA 1TY2A 3MXNA 3DM1A 2A69C 3MA2B 3V2TA 2ZXRA 1MSHA 1SE3A 3DEOA 5KNBA 4NW2A 4XXEA 3A55A 1HFGA 1GUWA 3FPPA 2NBFA 1SNQA 1JWUD 5JAVA 1HA6A 5IGBA 1KLGD 4DA2A 1LTTD 3PIO3 1HRJA 2O5JC 2RVLA 1NSNS 3I4LA 2E2HB 1CFMA 1LT4D 4IN3A 4ZLTF 4DNTB 4ZK9B 3T51B 1FNVA 1LACA 1LT3D 4KHZA 4BWGB 4IUQA 4EQPA 4IFDH 4FXKC 4RGOS 4G57A 4ZKCB 4O1NA 5JEAH 2OEOA 4HCEA 3TSSA 5DAUA 5CV7A 1EY4A 2Q8RE 2AWNA 4IQZA 5C5MA 2GA4B 1R9TB 1O7YA 2M2LA 4OIJA 4C3IB 2DY8A 1JOOA 4DK0A 1EZ6A 2IW3A 3VR5A 2KOLA 2O2LD 1PTOC 1F77A 5KRUA 3TN2A 4UAIA 4F7XA 3IAYA 1K83B 3C1FA 2Z4IA 1Y8OB 3K5LA 3J81L 4QIWB 1G2SA 2EDGA 3GTMB 4RKLA 3VYSA 2XRSD 5JJZA 1V1OA 1A3UA 3NTIA 2LY7A 1G8ZD 1U9RA 4A3KB 3Q23A 1EY6A 1VMCA 1M8AA 2NZ1D 3CU7A 1ET6A 2ICEC 1UEAB 5ISRA 2L12A 3W2DA 2JXMB 3J80L 5J22A 2TSSA 3HRZC 5C4JB 1LTAD 1JORA 3GTQB 2A6ED 4CKEA 1PRTC 4MN3A 3VR2A 3FDTA 1B50A 3M7GA 1Y69U 1GXDC 2K5DA 1BCPB 2CQAA 4FO2A 3MXUA 5LL6S 5IOCA 2L55A 1JB3A 1IHZA 1F2LA 2EYFA 4CJ1B 4P2CB 1SJED 3N52A 2V4DA 4DU9A 1QCBD 4DF7A 1G2TA 1QWYA 4DAVA 5I6WA 5KNDA 5ELDA 5FKAC 2SEBD 1IKMA 4NDXA 3PUXA 3R93A 3DWQA 4M8AA 1D5XC 2FMMA 3T16A 3S2HB 2FINB 3IKJA 3SK8A 5CV6A 1LLRD 3VR3A 1GUNA 4QF4A 5D14A 3HOWB 1LTGD 1TIID 2VB3X 1RTNA 3D3RA 3HZXA 1IW7D 1H9MA 4QCLA 1GJXA 1FR3A 3GP7A 2BDNA 5KGUA 3NE5B 2I46A 4HMIA 4Q5VA 3L7ZC 1CQVA 2SNMA 4A3IB 1TU2B 3QO2A 4DN4M 4FF1A 1GUGA 2F0WA 2RA4A 3GV6A 5LHY1 4A3DB 3H09A 2X6GA 2EYOA 3S14B 2F0FA 3SK4A 1X32A 1BBXC 5LL6X 1E0BA 4KN7C 1FD7D 3SE0A 4KMUC 1VCIA 1J8IA 5EBCA 1CA5A 4A3BB 3NQIA 3DWPA 1Q3LA 3PIP3 2A68D 3WOEA 5IGGA 3KBXA 3TDQA 5I2YA 3BVZA 1ENCA 1EQTA 4QB4A 1V43A 1F2MA 2HCIA 1QJOA 5K36H 1X3QA 3JAML 4YIJA 4N9PA 3ONAB 1LTRD 1C48A 2NWGA 1DJRD 3S16B 3H94A 1Y8PB 1WTQA 3D6CA 3OSOA 4I65A 4U673 4RGTA 2C9OA 3MC0B 3K5NA 3OWEB 4Q0FA 2RSOA 2NYZD 1BCPD 4OO1G 2PMZB 5EPJA 2EJGC 3A56A 5ELBA 4FF3A 1ESFA 1EQVA 1TT2A 3BDOA 2SOBA 2KVMA 5M5YB 4QUCA 4IUPA 2L9HA 3C3LA 5I4DA 1SMYD 3H91A 3R3OA 4LK1C 1LTSD 3TZDA 4BBSB 2EJFC 2F4IA 1I3QB 3I4MB 5EKLA 2WKCA 1HCZA 5JVH3 5CV8A 1EEFD 1H9JA 1IYUA 2KA7A 4KKTA 1K8MA 3NBIA 1UAPA 3EFXD 1Q1EA 3J81E 2PNRC 1WTXA 2KJXA 1FNUA 4K6DA 4FXDA 4RGNA 1SEBD 3P75A 4OL7A 1B9MA 1A3TA 4R8IA 2WIIB 1SYDA 2PZUA 4PQXA 2L11A 3HOXB 4C3JB 3P1HA 4RCNA 2IX3A 1NCVA 1BDOA 3J80E 1A3VA 3CRKC 2EPBA 3BVMA 2RSNA 4TSSA 4RFBA 5EGTA 3D6WA 4C1NI 4C3HG 1RDPD 1ILQA 3CKIB 3TBIB 2SDFA 1BQQT 3GQBA 4A93B 3R8BA 4IURA 5F2DA 1R4PB 2A5HA 1KDBA 5ELEA 3S9WA 3BYYB 1H9SA 4J6HA 4ID6A 4A3FB 2PYKA 3BG3A 4S3SA 2BE5C 2MP1A 3NTKA 5D3DA 5CORA 1PTOD 2EXZA 3K58A 1MSGA 3KK7A 2B2VC 1GHJA 1XX8A 2B2TC 4F87A 5I2XA 5BN3A 2R6GA 2EYHA 4I7ZC 3NUCA 2EVBA 3OOCA 1TS5A 4H13C 1T5XD 3K7AB 3HOYB 5IIFA 2IL8A 4WJWA 1WTWA 3QIAA 1Z6HA 3SK5A 3MZ5A 2EY5A 2XSCA 1LABA 1WD0A 3LWUA 1XXGA 4E6IA 2LKVA 2AWOA 3FVQA 4OO1I 3G6JB 4EGVA 1KABA 1EYAA 3BVGA 4K6LA 3NWSA 1STAA 1L0XB 5C4HA 4NP5A 4X3UA 1PRTD 1S4ZA 1STHA 3SR1A 3BYTB 3NTHA 5CV9A 4KY5A 1HHVA 1W6JA 4C56C 2E2DC 5C4ZA 3H3VC 2BDOA 4ZUJA 1IKLA 2B2VA 1SYBA 1OXVA 2F0NA 3Q6SA 4BY1B 2B2TA 3C2PA 3NPPA 2RKSA 5DEHA 1VDZA 1SBBB 2F0LA 3S17B 3CQZB 1SNDA 2JA6B 3PUYA 1PMRA 4K2LA 1DD2A 3FEWX 5DM73 1DOKA 5TSSA 4Y7NB 1G291 2F0IA 4HN7A 1MI2A 1FGBD 1SNPA 3NWTA 3SXHA 3MWYW 4G4KA 3NK9A 2KCNA 2KHSA 4PNYA 1STEA 1EWCA 3NHHA 3QOJA 4DGZA 3W3AA 4IUUA 1Y8NB 3C46A 2L4NA 1WD1A 4RKBA 1JICA 5E4WC 1DCZA 2B8GA 1EY0A 4K8IA 4TQUS 1U4PA 3RZOB 2FJ2A 2A6HC 4ABNA 1IL8A 1SAPA 2TMPA 1M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2U C;  1G2T A;  1VMP A;  4ZAI A;  2X69 A;  4XT3 B;  3D6W A;  1AP0 A;  1O7Y A;  1HFN A;  3ONA B;  1HHV A;  1KNE A;  2M2L A;  4OIJ A;  5COY A;  1WTV A;  1U4M A;  2DY8 A;  1NR4 A;  3MTS A;  1DZ1 A;  1JE4 A;  2NWG A;  3I3C A;  1PFN A;  4CJ2 C;  1WVL A;  1IKM A;  1B53 A;  1WTQ A;  4IUT A;  5EKI A;  5T1G A;  3R93 A;  1B4O A;  1HUM A;  2K03 A;  2KOL A;  3IFD A;  4RAU C;  1WTR A;  1ILQ A;  1RJT A;  3IL8 A;  2SDF A;  3TN2 A;  1G6Z A;  2D9U A;  2FMM A;  5CBA E;  4RWS C;  1XYI A;  2FIN B;  1NR2 A;  4IUR A;  4UAI A;  2RSO A;  1WTP A;  1EIH A;  1ML0 D;  4QUF A;  2NYZ D;  1IKL A;  2B2V A;  5D14 A;  4HED A;  1DOM A;  2DY7 A;  1RTO A;  1A15 A;  2JP1 A;  3LWE A;  4IUV A;  4X3S A;  5EPL A;  2H1E A;  1PDQ A;  5EPJ A;  1BNZ A;  1CM9 A;  1G2S A;  2FHT A;  1RTN A;  3Q6S A;  3F2U A;  2B2T A;  1KNA A;  3P7J A;  2B2W C;  1O80 A;  1MGS A;  3DM1 A;  5JJZ A;  2B2Y A;  3I91 A;  1PFM A;  2MP1 A;  1SDF A;  2MGS A;  2KVM A;  5CBE E;  1ESR A;  4O42 A;  5COR A;  1J9O A;  1EL0 A;  2L1B A;  4QUC A;  1MSH A;  5AFW A;  4IUP A;  2L9H A;  3DEO A;  5T1I A;  3UI2 A;  2N55 A;  1PLF A;  3H91 A;  3HP3 A;  3TZD A;  1VMC A;  1MSG A;  2B2V C;  1ICW A;  4OIK A;  4NW2 A;  1M8A A;  2NZ1 D;  2BDN A;  1SSO A;  2Q8T A;  1DOK A;  1HFG A;  2J7Z A;  1DON A;  1GUW A;  1HUN A;  3GV3 A;  1U4L A;  2VXW A;  5DNF A;  1XX8 A;  2MJ8 A;  2K28 A;  2B2T C;  1ZXT A;  2KED A;  1BF4 A;  2L12 A;  3DEP A;  1B2T A;  2KUM A;  1MI2 A;  4DN4 M;  3QO2 A;  1HA6 A;  1G91 A;  1BO0 A;  4MHE A;  1NAP A;  2JYO A;  2FFK B;  2RA4 A;  3GV6 A;  1AZP A;  3MWY W;  4RA8 A;  5D65 A;  1HRJ A;  1F9S A;  4CJ0 B;  1PFB A;  2K1B A;  2RVL A;  5EPK A;  2EE1 A;  2X6G A;  2KEC A;  1U4R A;  2R3Z A;  4ZKB B;  4HAE A;  1TVX A;  4MN3 A;  2IL8 A;  2HDM A;  1WTW A;  1ROD A;  1F9P A;  1EIG A;  1QE6 A;  1X32 A;  1DOL A;  1E0B A;  2K01 A;  2KEE A;  1WTX A;  1BBX C;  3FDT A;  4HCS A;  4IUU A;  5EQ0 A;  1B50 A;  2CVR A;  4ZLT F;  2HDL A;  1RHP A;  2MPM A;  4ZK9 B;  1WD0 A;  4LMQ D;  2L4N A;  1B3A A;  1WD1 A;  1J8I A;  1CA5 A;  1QNK A;  1QG7 A;  1X3P A;  2HUG A;  4U68 A;  4XT1 B;  2K05 A;  1JIC A;  3G7L A;  4IUQ A;  1LV9 A;  5E4W C;  2XIW A;  4R9W A;  1Q3L A;  5CMD A;  3I90 A;  2B2Y C;  5E4X A;  4R8I A;  2B2U A;  3SVM A;  2HCC A;  4ZKC B;  1F9Q A;  2X6L A;  1WTO A;  3I8Z A;  1U4P A;  3KBX A;  2N88 A;  1F9R A;  1CA6 A;  2B2W A;  2K04 A;  1O7Z A;  4HSV A;  5EJW A;  2FJ2 A;  1EQT A;  1F2L A;  2L11 A;  1AZQ A;  4X3U A;  1EOT A;  4CJ1 B;  4X3K A;  1S4Z A;  3FPU B;  1IL8 A;  1SAP A;  3N52 A;  1ILP A;  2HCI A;  3KUP A;  2EOT A;  2Q8R E;  1NCV A;  4XDX A;  1C8C A;  2EPB A;  2RSN A;  1X3Q A;  4X3T A; 
#chains in the Genus database with same CATH topology
 4HSP A;  3QB3 A;  3F2B A;  3GTP H;  3ND9 A;  1WTV A;  3QWN A;  2NN6 G;  1K0S A;  1WVL A;  1S40 A;  2Q2T A;  4B3T Q;  3PO3 B;  2K7V A;  4RGM A;  3HOV B;  1B4O A;  1WTR A;  3L0O A;  1B1Z A;  1CI3 M;  1KDA A;  2PW5 A;  3T53 B;  3FMC A;  1EIH A;  1SLJ A;  2JA8 B;  2G9H D;  4C3I G;  2R61 A;  3D4W A;  4KHV A;  3PGZ A;  1EUJ A;  5C0X G;  3FKI H;  3H0G G;  2CW0 C;  1E24 A;  4HJA A;  4JYA L;  3MXP A;  1AN8 A;  3A74 A;  4DV1 L;  2NTT A;  1DM0 B;  1QUQ B;  2DNE A;  3OIQ A;  2N55 A;  1AE2 A;  3HP3 A;  2OF1 A;  1I4X A;  4POG A;  1WCM H;  1EYC A;  1VQN A;  3M4O H;  2R93 B;  1A8V A;  4WFN 3;  4YWL A;  1IXR A;  4X66 Q;  5IY0 A;  1LTI D;  3IFT A;  2VB2 X;  2UXD Q;  1B3Q A;  1VQB A;  3ND8 A;  3PUV A;  3TP6 A;  3UDX A;  3GTL B;  4A3G H;  2JYO A;  2PNH A;  1HA5 A;  2F3W A;  4ZUI A;  3SDZ A;  5FLX c;  2OQK A;  2JA7 B;  5EBD A;  4XQQ A;  1EY9 A;  3S1N H;  4H7B A;  2R3Z A;  3U4Z A;  2FMC A;  2R7Z B;  3GD7 A;  4OWT B;  1IYJ B;  1HR0 L;  3ERO A;  3K0Y A;  4IJL A;  1B3A A;  4IPG A;  3HGB A;  1SYC A;  1D5Z C;  5CMD A;  4PZ6 A;  5FO7 B;  2IPK D;  2X6L A;  1SNC A;  2PO4 A;  4B08 A;  3BZC A;  3S15 H;  2UUC L;  5DLQ E;  2BH2 A;  2BCO A;  1HZC A;  3GTO H;  3EQL C;  3FPU B;  4QL5 A;  1NUC A;  1XPR A;  1SE2 A;  1SNO A;  3I4N B;  4JK1 C;  3HKS A;  3EVQ A;  5CR3 A;  3VDY A;  1X9N A;  2F0V A;  2RCN A;  1PTO H;  1BUV T;  4DV2 L;  5CV5 A;  2DN8 A;  3S1Q H;  4IPH A;  1B8A A;  3MEH A;  1Q1B A;  1Y1V B;  4HTH A;  4A3C H;  2LS0 1;  1XTC D;  4QMG A;  4QJF A;  4LUZ A;  3SK6 A;  3FHW A;  2NVY B;  2Y0S B;  3Q0A A;  2PW7 A;  2UXB L;  1M90 C;  4UPA A;  4C1N K;  1L2F A;  1TXY A;  2D9U A;  3BZK A;  2NZO A;  5C0X J;  1XNR L;  5H1S E;  5JEA G;  2JA5 B;  1EYD A;  2XVS A;  2OTL A;  2F4V Q;  4B9W A;  3K81 C;  5C3W A;  1JJG A;  1CM9 A;  2K5N A;  2FHT A;  4KKS A;  1RD9 D;  2B2Y A;  2BOS A;  4L8J A;  1S5D D;  1I94 L;  2WB1 B;  3CP0 A;  1BBU A;  4DAY A;  2KQ3 A;  1GUT A;  4LFA L;  1YNN C;  2KEN A;  4JI8 L;  1SFO H;  4JI7 Q;  3DMU A;  3V96 A;  3TP8 A;  1H9K A;  3H6M A;  2EQS A;  3BS1 A;  1U4L A;  3DXJ C;  2NB0 A;  2MHV A;  1BCP F;  1K3B C;  2L5T A;  1KLU D;  1LO5 D;  3K5M A;  1TKW B;  4V19 0;  2NN6 I;  4CHT B;  1IBL L;  2EYJ A;  5J39 A;  4UDU C;  4UP9 A;  5C44 H;  1B70 B;  4JI4 Q;  5JJK A;  4OO1 H;  2RDG A;  3PF4 A;  4EQ5 A;  1Q8I A;  4HJ7 A;  4ME3 A;  4A3G B;  2NVQ B;  2C5C A;  2K4K A;  4A3I G;  2CHB D;  4H02 A;  3E0J A;  3RN5 A;  1A6X A;  3T1Y Q;  1YHQ A;  1UUP A;  3BDL A;  4J15 A;  5C0X I;  2YYZ A;  3S1N B;  1D2B A;  4ZQ3 A;  1Z7T A;  2HQL A;  3GTK H;  5KYL A;  5FOB B;  2XRQ D;  3KLR A;  3PSI A;  4HSV A;  4TVA B;  1X6O A;  1W6K A;  5IT9 E;  4A3J H;  5I6Y A;  3GO5 A;  5I9O A;  2LFN A;  2K5V A;  2WB1 E;  1M4V A;  1KRT A;  2Z0S A;  3J7Z C;  2R7D A;  3J81 j;  3PV0 A;  2F0U A;  3N6R A;  5J1Z A;  3U9O A;  4DV0 L;  1SXT A;  1AP0 A;  3S15 B;  1KNE A;  1ZEQ X;  4OX9 Q;  2VUM H;  1I6V C;  1O7I A;  3VR6 A;  4DV3 L;  1PFS A;  3GTO B;  1JWS D;  5JEA J;  3HOU B;  3VA5 A;  5IYB G;  4RAU C;  2JA9 A;  4AYB B;  1VQ5 A;  2ID0 A;  1Z9F A;  4LF9 L;  1PTO B;  2XTI A;  4JI3 L;  4DNR B;  4LF4 Q;  1A2T A;  3S1Q B;  3H3V I;  4M1U B;  3IRB A;  2JEB I;  3A0J A;  5EPL A;  3LWE A;  1EU4 A;  3WOF A;  3NSW A;  1ZYR C;  1DXM A;  1XWE A;  2N78 A;  4KV6 A;  4DV6 L;  1GOZ A;  3CAM A;  1TWC H;  3I72 A;  1KXL A;  4CGY B;  5C3E H;  5CBE E;  1Q7Y C;  1J9O A;  3EA6 A;  1EL0 A;  1CUK A;  3K0X A;  5ELF A;  3A8J E;  5T1I A;  3ICE A;  4YCW A;  3HKZ G;  2NVT H;  2E2J B;  1HTP A;  2Q8T A;  1SMX A;  1YNJ D;  4C3H H;  3GV3 A;  4JI1 Q;  2VXW A;  3A54 A;  4NPS A;  2MJ8 A;  5GAE C;  1EY8 A;  4GOP C;  3DEP A;  3H15 A;  3CCS A;  4KD4 A;  4KHP L;  5IYC G;  1WTH A;  3F2D A;  1T5E A;  3LX0 A;  1F2Z A;  5D65 A;  4CJ0 B;  5LMU Q;  1HNX L;  4BBS G;  3CC4 A;  2F0M A;  1TWA H;  2I07 B;  2KBN A;  1U4R A;  3U4V A;  1J5E L;  1I6H H;  4K14 A;  4AYB E;  2OXP A;  1VQK A;  1PRT B;  1SRU A;  3VR4 A;  4DKA C;  4EVO A;  3TME A;  1QNK A;  4KY7 A;  2IX1 A;  1X56 A;  2XIW A;  5C44 B;  1TQO A;  4PV1 C;  3J81 i;  2ICI A;  4L5Q A;  2K5Q A;  2L0C A;  4L5R C;  1F2Y A;  2A69 D;  2AQ2 B;  1F9R A;  4DV4 L;  1Q81 C;  4DR1 L;  1OXS C;  1LUZ A;  4A3M B;  1QB5 D;  5IOD A;  1XTD A;  1NJI C;  4JOI C;  1O7L A;  2R7F A;  1HQR D;  3I3C A;  5BR8 Q;  2B2U C;  2GVB A;  2HT1 A;  1JE5 A;  3NXW A;  1JE4 A;  1AW7 A;  1TS4 A;  1HTL D;  2Z8L A;  3PIO A;  1XMQ Q;  1K0R A;  1TWF H;  3J80 i;  1XPU A;  2DGY A;  5C4X H;  1K8O A;  1GHK A;  3KJP A;  3DUZ A;  1XNQ Q;  1S5B D;  2A6H D;  2F03 A;  3DM3 A;  4BY7 H;  2VUM B;  5BN5 A;  1XMO Q;  4QUF A;  1JWM D;  1JOQ A;  4KJN A;  5FLX L;  3I56 A;  1EEI D;  2JP1 A;  4WJ4 A;  3M4P A;  3K6O A;  1V1P A;  3HOZ G;  3CMA A;  1ONL A;  4X64 L;  4GN3 B;  3RMH A;  1YJW A;  3RZD H;  1UEB A;  1D7Q A;  3PO2 H;  3CRL C;  4DXG A;  4FNF A;  3ZYY X;  4GKJ Q;  2YTX A;  1ICW A;  3GTG H;  3D4R A;  4C2M B;  3AQQ A;  1AFP A;  1TWC B;  3UDG A;  1VQ9 A;  3J7Y W;  1EYG A;  3M3Y B;  4A3F G;  1S5E D;  2K28 A;  1I4G A;  5C3E B;  2QEJ C;  4DUZ L;  1X65 A;  4DAM A;  1BO0 A;  1MJC A;  2A73 B;  4O0A A;  5M5W B;  4A75 A;  4FF2 A;  2B39 A;  5M3F B;  2F0O A;  1LTB D;  3G48 A;  2ENB A;  2B8F A;  4C3H B;  4KN4 C;  1GUO A;  1OXX K;  4OHJ A;  4CDC C;  1ENF A;  4DUY Q;  4DR4 L;  2UUA Q;  1EIG A;  1YVC A;  4KI0 A;  1IBM L;  2KHI A;  5EAY A;  1Z47 A;  1K73 C;  1Y1W H;  2F3V A;  4LMQ D;  3ULL A;  1X3P A;  5CYU A;  4K5X A;  2O4X A;  3J7A V;  1BXT A;  1KD1 C;  1TWA B;  3KF8 B;  5IGC A;  2B2U A;  3L9A X;  4N8X 1;  1HZ9 A;  3KLW A;  4JBM A;  1F9Q A;  3FP9 A;  1I6H B;  3FRP B;  5JPM C;  3I73 A;  2B2W A;  3S1R H;  1N34 Q;  2UU9 L;  4IUN A;  1OO9 B;  4XDX A;  1C8C A;  3CHB D;  5D3I B;  5C3X A;  5M3M H;  1VQO A;  1XPO A;  4K8J A;  5CGK A;  1QVF A;  2R92 G;  4K5V A;  4ZYS A;  1QZG A;  5GAG C;  2K32 A;  2B63 G;  1STG A;  2K52 A;  2D0P A;  1RJT A;  3U9S A;  1V8Q A;  1G6Z A;  1ZKO A;  2B3G A;  2M9V A;  4KKU A;  5CBA E;  2IHF A;  3SEB A;  4TKO B;  3V05 A;  1SYE A;  3EN2 A;  4AQY Q;  1CHP D;  3QG1 A;  2Q2H A;  1TWF B;  4B3T L;  1M1K C;  4LAA A;  5C4X B;  3Q22 A;  4GNX A;  3NBH A;  4MIU A;  1OXT A;  3S2D H;  3F2U A;  1HZA A;  3P7J A;  3VYR A;  2HD3 A;  4BY7 B;  2VQE L;  5JJL A;  4K2K A;  4IAL A;  4HMJ A;  2PQA B;  2Z1C A;  4P72 A;  4GS3 A;  1MD2 D;  1I50 H;  3STB C;  5AJ3 Q;  2E76 C;  3M9B A;  2ES2 A;  1MBY A;  3S24 A;  2NN6 H;  1STB A;  2F1M A;  1DON A;  1HUN A;  2DNC A;  5DNF A;  1BF4 A;  1X55 A;  3OMC A;  2N3S A;  1JOK A;  2AQ3 B;  3RZD B;  4Y52 H;  1VQA A;  2E8G A;  2F0T A;  3JAM i;  4A3E B;  1TWG H;  2QF7 A;  2QEX A;  3DWA A;  2KHJ A;  2JA6 G;  1NAP A;  3S1M H;  3PCO B;  4ME5 A;  1R9T H;  4HJ5 A;  1YBY A;  3OHX C;  4C3I H;  3AYH B;  4H0L C;  1PV4 A;  4G7Z C;  1YNX A;  1VQM A;  1E1T A;  4X66 L;  3H0G H;  4RH6 A;  2G9D A;  3K80 C;  3KOJ A;  4NXM Q;  3JAM E;  2KEE A;  1TY0 A;  2XWB B;  1IYV A;  4HCS A;  5HUR A;  4JV5 Q;  2CVR A;  1RHP A;  3G4S A;  1UE6 A;  1BCP C;  3SHL A;  1QG7 A;  4LF6 Q;  4OGQ C;  1LV9 A;  1EIY B;  4R9W A;  5EKK A;  3RLF A;  1RF2 D;  3SVM A;  2HCC A;  2YTV A;  1S5C D;  2IX0 A;  4CBV A;  1BVS A;  2Z9H A;  2WIN B;  1WTO A;  1HZB A;  2BA1 A;  1X3E A;  4KD3 A;  3P20 A;  5IWA Q;  1SJH D;  1AZQ A;  3E5S A;  1Y1W B;  2N8N A;  3DHQ A;  3J7A 5;  3OMG A;  4X62 L;  3KUP A;  1E1O A;  2EOT A;  1BOS A;  2JSO A;  2Q8I B;  1LM0 A;  1EU3 A;  3BZD B;  4LFB Q;  3BJU A;  1JC7 A;  2J0T D;  4F88 A;  3S1R B;  1L0Y B;  4G7H C;  1CKN A;  5IGE A;  1PFN A;  3H3V H;  1B9N A;  1B53 A;  5T1G A;  4RHS A;  1HUM A;  2EY1 A;  3IFD A;  5DM6 3;  3D4D A;  3E6Z X;  3BU2 A;  5C4J H;  5M3M B;  3GTQ H;  1XYI A;  1WTP A;  2RQX A;  4PZ8 A;  3A8I E;  5KIX A;  3KF6 B;  3CC2 A;  1VF7 A;  2I5M X;  4HED A;  2DY7 A;  1RTO A;  4IUV A;  3OW7 A;  2H1E A;  1PDQ A;  2UUB Q;  3A7A B;  5IYD G;  1KRS A;  3PIP A;  1ASZ A;  1PXU A;  4ZCK A;  4XQN A;  2MUY A;  2HHH L;  2F0H A;  1PZJ D;  4XIG S;  1ESR A;  4RCO A;  1JT8 A;  1I4R A;  2F4V L;  3CME A;  4HR7 B;  1PLF A;  4PMW A;  3OTO Q;  1HPC A;  4OIK A;  2ZT9 C;  2QA4 A;  2PQE A;  1SSO A;  3S2D B;  2AUK A;  2PZT A;  2D2C C;  2KED A;  5A2Q L;  1ZXT A;  4ODG A;  2RBM A;  3R2I A;  1B2T A;  1ZYR D;  4L6T B;  5GRO A;  2WP8 J;  1DYQ A;  2ZJR A;  1G91 A;  4YWM A;  2EJM A;  3B6Y A;  1I50 B;  4CKB A;  2M00 A;  4G7O C;  4LNQ A;  2F0S A;  4DR6 Q;  5IGD A;  1PFB A;  2K1B A;  2EE1 A;  2R93 G;  5G3L D;  1NBW A;  5FLX E;  1E2V A;  5E1F A;  1QE6 A;  4NMZ A;  4K0K Q;  1FJG Q;  1TWG B;  4KLK A;  2DUD A;  2MPM A;  3KDF B;  4YWK A;  3X3N A;  3S1M B;  2K05 A;  2K50 A;  4JI2 Q;  3KLS A;  1JJ2 A;  4R4C A;  2B2Y C;  2DJF C;  1E7Z A;  4BS9 A;  4Z9C B;  1Q8K A;  3E9H A;  3H0G B;  1A0I A;  3MXN B;  2RCF A;  3I8Z A;  4A3K G;  2A8V A;  2R7Z G;  2EIF A;  2IJ0 A;  1CA6 A;  1VQG A;  2K33 A;  5FLM G;  4JW0 A;  4OXP A;  3D0F A;  4GKK Q;  4EQO A;  5LMN Q;  3BDC A;  1STY A;  1VQI A;  2K6A A;  2F0P A;  4WOR A;  3T1Y L;  4JI0 Q;  1E2W A;  2E75 C;  2E2I H;  1SYG A;  4CDE C;  5E3F A;  1PVO A;  4LW1 A;  2D5D A;  4XT3 B;  2PCF B;  5COY A;  4LF8 Q;  3Q8D A;  5HGT A;  1PZI D;  4HIK A;  3TRE A;  1O78 A;  3MFY A;  3X3M A;  5EKI A;  4LF7 L;  3NP8 A;  3NEM A;  4A3I H;  2VNU D;  3D31 A;  1CK1 A;  4YY3 Q;  1S3O A;  1D1K A;  4OX9 L;  1IZ6 A;  1GVP A;  4KTA A;  4PZ7 A;  5FK9 C;  2EZV A;  4FF4 A;  4LFC Q;  1Y1V G;  3C1E A;  1UWV A;  4X3S A;  5NUC A;  3QR8 A;  4DV5 Q;  1Q12 A;  4QQB X;  1UE1 A;  3EJI A;  1VQJ A;  4JPB W;  3T4A C;  4LF4 L;  4O42 A;  2JA5 G;  1KL9 A;  5AFW A;  4IFD G;  1VF5 C;  3UI2 A;  4B3S Q;  5KNC A;  1PZK D;  1AEX A;  3LNN A;  3RD4 A;  3K59 A;  4BXX G;  3GTP B;  1SRO A;  5M5X H;  1D6E C;  2Q2I A;  4FXG C;  4ALP A;  1K9M C;  3CD6 A;  4X65 L;  3CCJ A;  3OPO A;  3ERS X;  1HQM C;  4CKC A;  3R2T A;  1CZG A;  4XYO A;  1F9S A;  3PMF A;  1KQS A;  3MAQ A;  5EPK A;  2IWH A;  4JI1 L;  3UE1 A;  4HAE A;  5IP9 H;  1CT1 D;  1ROD A;  2QIL A;  3FKI B;  2ZXP A;  1VQ6 A;  3HOW G;  1I4H A;  4JVZ A;  2V1C C;  5C6A A;  4NXN L;  4PG3 A;  5LMU L;  2JQO A;  2OTJ A;  1EFW A;  1ET9 A;  3CCU A;  4HJ9 A;  1WCM B;  2BE5 D;  3M4O B;  1QIL A;  1FL0 A;  2F0D A;  1D5M C;  1UNS A;  2KCT A;  4K5W A;  5LMN W;  5CC4 A;  1TR5 A;  4R8N A;  3CCV A;  2EY6 A;  2N49 A;  3PUW A;  2Y0S E;  3VYU A;  4DV1 Q;  5IYC H;  2G5D A;  1FYC A;  2IT1 A;  4H44 C;  4BBS H;  2F0G A;  3TEH B;  1II3 A;  4RHR A;  1TWH H;  2D0O A;  4A3D G;  1RCV D;  4CJ2 C;  4J8Q A;  4LJZ C;  2E2I B;  3MVV A;  1R4Q B;  3E0E A;  4PMB A;  5BR8 L;  2CWA A;  4RWS C;  1EQR A;  3K5O A;  1NR2 A;  2WAQ B;  1ENA A;  2ATW A;  2XWJ B;  4A3B G;  1CZW A;  4DR5 L;  1PA6 A;  1IBK Q;  1XMQ L;  3KLS X;  5JPN C;  3F1Z A;  3SGI A;  4HJ8 A;  3HOU G;  1BNZ A;  1ASY A;  3HEJ A;  3I70 A;  3M4Q A;  2JEA I;  1I5F A;  1XNQ L;  4IFD J;  1E2Z A;  1QVC A;  1KNA A;  4AYB G;  1L1O C;  2QKI C;  2PZW A;  4JBW A;  1PFM A;  3AMU A;  2MGS A;  1XMO L;  3I55 A;  2ALY B;  3Q24 A;  3D8G A;  4B3R Q;  5IP7 G;  3PUZ A;  4FVM A;  1ICF B;  2BA0 A;  3L2P A;  3E9I A;  4OEL B;  2UUC Q;  4UP7 A;  2J7Z A;  2XN9 C;  5JOB A;  5JVG 3;  3EBE A;  4LF5 Q;  3AFP A;  2KUM A;  4MHE A;  4CDD C;  4A4I A;  1AZP A;  4FYD A;  1NTG A;  5CV4 A;  1JR0 D;  2KEC A;  4L63 B;  5M5X B;  1JCK B;  1QNU A;  1SE8 A;  1F9P A;  4JBJ A;  3HOZ H;  1DOL A;  1BBW A;  3KYH C;  4HIM A;  2WAQ E;  4KY6 A;  1XNR Q;  1NY4 A;  4IZ8 A;  3G7L A;  4V0B A;  5J3B A;  5JJI A;  1VQC A;  5E4X A;  2F0E A;  1PYW D;  2YU9 H;  5I9P A;  1EQQ A;  2ZJP A;  3CPF A;  2A74 C;  4BBR H;  3GTJ H;  2K04 A;  1K8A C;  4LUO A;  1SFO B;  4TRD A;  1CKO A;  1PH4 A;  4X3K A;  1HNZ Q;  3M7N A;  2QDL A;  1PTO F;  2O5I C;  5A2Q E;  4IFD I;  1ILP A;  3I4M G;  2RDH A;  1V9P A;  3HKZ B;  3NQT A;  1SYF A;  5FO8 B;  4ZAI A;  2F0J A;  2X69 A;  4JI8 Q;  4DPG A;  1NR4 A;  2EXD A;  4P73 A;  2WKD A;  4YHH Q;  1TS3 A;  5IGF A;  1N36 Q;  3AU7 A;  4A3M G;  1PH7 A;  2ZJQ A;  1L1O A;  2VQF Q;  1CTM A;  2H4O A;  3VA7 A;  3MHB A;  4ULL A;  1ML0 D;  1TWH B;  1VQE A;  5A35 A;  1NE3 A;  3K7A H;  3M85 A;  3PQI A;  3VYT A;  3UDI A;  3GTK B;  2QCP X;  2QDB A;  4N9T A;  4DNI A;  1EWH A;  3KF8 A;  3W5O A;  4A3J B;  4XYQ A;  2LMC B;  2B2W C;  1O80 A;  3OIP A;  1MGS A;  1BR9 A;  3I91 A;  4POF A;  3HOX G;  1SDF A;  4C3J G;  4PMC A;  2XNA C;  1D1I A;  2A6E C;  2L1B A;  2VUM G;  4AQY L;  2NTS A;  3K57 A;  2PPB C;  1WYD A;  2R92 H;  2E5L L;  1PRT F;  1RKN A;  1X3G A;  4I7A A;  1JQY D;  5ELC A;  1YJN A;  2B63 H;  2MFI A;  5C5L A;  1K3R A;  1EFI D;  1FNW A;  2Z4H A;  1K28 A;  4LUV A;  5ELN A;  1MHW C;  2EYL A;  1LT5 D;  3W1B A;  1UE7 A;  4XQJ A;  5AJ3 L;  1A2U A;  5K36 G;  4RA8 A;  3WDN A;  4JI6 Q;  1Q90 A;  1I4P A;  4A93 G;  2HIX A;  1WJJ A;  1AE3 A;  4JC0 A;  3URY A;  2HDM A;  1E22 A;  4BA2 I;  1LT6 D;  1U0L A;  3ITP A;  1EZ8 A;  5EQ0 A;  2EY2 A;  5C3E G;  2K75 A;  2F0Q A;  3ULJ A;  2AKW B;  4LF9 Q;  2RHS B;  4GNX C;  3G71 A;  4L5S A;  1KDC A;  2DJG C;  1CSP A;  1TS2 A;  2LSS A;  4F8M A;  3J7A F;  1VQF A;  5M3F G;  5HY6 A;  2CW0 D;  3A7L A;  4NXM L;  3HOZ B;  3CCR A;  2NVT B;  1RIP A;  4JV5 L;  1O7Z A;  4O2D A;  1HXY D;  1N33 L;  2NVX H;  1LYL A;  4DAP A;  3J80 c;  4LF6 L;  3G6E A;  1GO3 E;  1EY5 A;  4KK7 A;  4BA1 I;  5KYI A;  4HIO A;  2YU9 B;  4IJH A;  1VMP A;  1QOH A;  3TP7 A;  4BBR B;  1CHQ D;  3GTJ B;  1U4M A;  3CW2 C;  5IWA L;  1EOV A;  2D62 A;  3F8T A;  2KCC A;  3U58 A;  1IW7 C;  4B9X A;  4DR3 Q;  2HQE A;  2ZXO A;  4GZY C;  2K03 A;  4AIM A;  1VQ8 A;  2MO1 A;  4DK6 C;  3HOY G;  1JB7 A;  3IL8 A;  4KHP Q;  4NKL A;  3JC6 6;  3MXG A;  4EQN A;  1VQD A;  1PH1 A;  4DXF A;  3TP5 A;  5BN4 A;  1KAA A;  1DOM A;  1A15 A;  4ZRZ A;  2EYM A;  3MFG A;  3KBG A;  1SNM A;  1BKB A;  4GLX A;  3T56 B;  4WRD A;  2SNS A;  2UUB L;  4DR1 Q;  3A8K E;  2E2H H;  2QGQ A;  4MTN A;  1Y14 B;  5FO9 B;  1Q82 C;  1V1P B;  1KHI A;  2WV6 D;  4J1M A;  3HS0 C;  2A68 C;  4GOP B;  5M9O A;  2VY3 A;  2FFK B;  3OTO L;  2K5W A;  2R92 B;  2J4X A;  4DFA A;  2F0K A;  1C4Q A;  4KJO A;  1QVG A;  5K5P A;  2B63 B;  4XTC S;  1H9R A;  4YCV A;  4ZKB B;  1TVX A;  5GAD C;  2EYP A;  5IYD H;  2K01 A;  4IPC A;  3ZJY C;  3QJY A;  2NUC A;  4DK1 A;  3M4Y A;  2HDL A;  2CWP A;  3KF6 A;  2LXJ A;  2WAC A;  4A3E G;  4JI5 Q;  2HUG A;  2RDF A;  4U68 A;  4XT1 B;  4BY1 G;  4QY7 A;  4DR6 L;  3I90 A;  1H9S B;  1C7Y A;  3PO2 B;  3NEL A;  3F2C A;  1GUS A;  1OXU A;  3GTG B;  2N88 A;  5EJW A;  1I4Q A;  3OWF A;  4X64 Q;  1EOT A;  2Q2U A;  1CQF A;  1XJV A;  5C0X H;  4FP5 D;  5G3L F;  1E3P A;  1YNJ C;  1YNN D;  2AUJ D;  2UXD L;  3T13 A;  4AH6 A;  3AB9 A;  4X3T A;  1EY7 A;  2OT2 A;  3O13 A;  1HFN A;  2R93 H;  2RF4 A;  4ILW A;  3ERQ A;  3MTS A;  1K83 H;  1DZ1 A;  2NVX B;  4GKK L;  5LMN L;  1KTK A;  1DGS A;  4IUT A;  1STN A;  3HG9 A;  4JI0 L;  1X54 A;  5KEE A;  1B44 D;  1GKH A;  1QUQ A;  3GTM H;  1A63 A;  1SE4 A;  1SMY C;  1S5F D;  1N32 Q;  5IT9 L;  4LF8 L;  4WJ3 M;  3L3O C;  2JE6 I;  3KDF A;  3CPW A;  4A3K H;  3TZU A;  2R7Z H;  2PI2 E;  2AQ1 B;  2E74 C;  4QGU A;  3RUZ A;  3QOL A;  1TY2 A;  3MXN A;  3DM1 A;  2A69 C;  3MA2 B;  4YY3 L;  3V2T A;  4X6A H;  2ZXR A;  2Z6K A;  4GLV B;  2JN4 A;  4L5T A;  3E3X A;  1MSH A;  1SE3 A;  3DEO A;  2F3I A;  1MIU A;  5KNB A;  4NW2 A;  4XXE A;  3A55 A;  4DV5 L;  3CCQ A;  1HFG A;  1GUW A;  3FPP A;  2NBF A;  4DV7 Q;  1SNQ A;  1UE5 A;  1JWU D;  2FXQ A;  3PO3 G;  4DR7 Q;  5JAV A;  3HOV G;  3KFU A;  1HA6 A;  5IGB A;  1KLG D;  4DA2 A;  1LTT D;  3PIO 3;  1HRJ A;  2O5J C;  2CH4 A;  1Y1V H;  1NSN S;  2RVL A;  3I4L A;  1HNW Q;  4OON A;  2JA8 G;  2E2H B;  1CFM A;  4R4T A;  1LT4 D;  2IHE A;  1W2B A;  4IN3 A;  4ZLT F;  4DNT B;  4ZK9 B;  3T51 B;  1FNV A;  1LAC A;  1D8L A;  1LT3 D;  2CQO A;  4KHZ A;  4BWG B;  5ELO A;  4IUQ A;  2JA5 H;  3AFQ A;  4EQP A;  4IFD H;  3OYY A;  4FXK C;  4RGO S;  5GAH C;  4G57 A;  4ZKC B;  4O1N A;  1HH2 P;  5JEA H;  4BXX H;  2OEO A;  3U50 C;  4HCE A;  3TSS A;  4JI7 L;  5DAU A;  5CV7 A;  1YHA A;  1EY4 A;  2VQE Q;  2Q8R E;  2AWN A;  2VZA A;  1Q86 C;  4IQZ A;  5C5M A;  2GA4 B;  2P5Z X;  1R9T B;  3S2H H;  4B3M Q;  1O7Y A;  2M2L A;  4OIJ A;  4C3I B;  2DY8 A;  1JOO A;  4DK0 A;  4JI4 L;  2JA7 G;  1EZ6 A;  3HOW H;  5FJ8 G;  2IW3 A;  3VR5 A;  2KOL A;  2O2L D;  1PTO C;  1F77 A;  5KRU A;  3TN2 A;  1FVI A;  2ZM6 Q;  4MTK A;  2YV5 A;  4A3L G;  4UAI A;  4RG1 A;  4F7X A;  3IAY A;  1MKH A;  3DLL A;  1K83 B;  1CSQ A;  3C1F A;  2Z4I A;  1Y8O B;  1VQP A;  2I5H A;  3K5L A;  3J81 L;  2ZTC A;  4QIW B;  1G2S A;  2NVQ H;  2EDG A;  1CKN B;  3GTM B;  4RKL A;  3VYS A;  2XRS D;  2UXC Q;  5JJZ A;  1V1O A;  1A3U A;  3NTI A;  2VL6 A;  2LY7 A;  1K8G A;  3I4N G;  1G8Z D;  1FGU A;  1U9R A;  3TS0 A;  4A3K B;  1IBK L;  4DR2 Q;  3Q23 A;  2CCZ A;  1EY6 A;  1VMC A;  1M8A A;  4A3D H;  2NZ1 D;  3CU7 A;  1ET6 A;  3S14 H;  4A76 A;  4X62 Q;  2ICE C;  1UEA B;  5ISR A;  2L12 A;  2C35 B;  3W2D A;  4OWW B;  2JXM B;  3J80 L;  5J22 A;  1WOC A;  2TSS A;  3HRZ C;  4B3R L;  5C4J B;  1LTA D;  2Y0S G;  1JOR A;  1SN8 A;  3T1H Q;  4A3B H;  3GTQ B;  1G6P A;  5IE8 A;  1PH5 A;  2A6E D;  4CKE A;  1PRT C;  4UP8 A;  3HOU H;  4MN3 A;  3VR2 A;  2A19 A;  3FDT A;  4LF5 L;  1B50 A;  1PH9 A;  3M7G A;  5IYB H;  1Y69 U;  1VQL A;  1GXD C;  3A5U A;  2K5D A;  1BCP B;  2CQA A;  5IP7 H;  2CH4 W;  4FO2 A;  4QIW E;  2WB1 G;  3W1G A;  3MXU A;  4FDB A;  5LL6 S;  3UE0 A;  1OTC A;  5IOC A;  2L55 A;  3FKI G;  1JB3 A;  1IHZ A;  1F2L A;  1B7Y B;  2EYF A;  1S72 A;  2HHH Q;  4CJ1 B;  4P2C B;  3S16 H;  1SJE D;  3N52 A;  3A5Z B;  2V4D A;  4DU9 A;  3ER0 A;  1QCB D;  1T9H A;  4DF7 A;  1G2T A;  2E2J H;  3I2Z A;  1QWY A;  4DAV A;  1WCM G;  1GD7 A;  5I6W A;  5KND A;  5ELD A;  1W3S A;  5FKA C;  1HNZ L;  2SEB D;  1IKM A;  4NDX A;  3KJO A;  3PUX A;  3R93 A;  4P75 A;  3GDE A;  3DWQ A;  2I5L X;  1G51 A;  4JYA Q;  4M8A A;  1D5X C;  2FMM A;  3T16 A;  4A3G G;  3S2H B;  2FIN B;  3IKJ A;  3SK8 A;  5M5Y H;  5CV6 A;  1LLR D;  3VR3 A;  1GUN A;  4YHH L;  4QF4 A;  5D14 A;  3HOW B;  1N36 L;  1LTG D;  1N9W A;  2B29 A;  1TII D;  2VB3 X;  1RTN A;  2VQF L;  1GM5 A;  3D3R A;  3HZX A;  1IW7 D;  1H9M A;  1I3Q H;  3I4M H;  4QCL A;  4OWX B;  1GJX A;  1WFQ A;  2WAQ G;  3RLN A;  1L0W A;  1FR3 A;  4R4I A;  1SR3 A;  3GP7 A;  2BH8 A;  4MNO A;  1PYB A;  2BDN A;  5KGU A;  3ULP A;  3NE5 B;  2I46 A;  4A3M H;  1YZ6 A;  4HMI A;  4Q5V A;  3L7Z C;  1CQV A;  2SNM A;  3EIV A;  4UHV A;  4A3I B;  1TU2 B;  3QO2 A;  4DN4 M;  1HR0 Q;  4FF1 A;  1GUG A;  2F0W A;  2RA4 A;  3GV6 A;  5LHY 1;  4A3D B;  1U5K A;  3H09 A;  2X6G A;  2EYO A;  4JBK A;  2F0F A;  2XGT A;  3S14 B;  1LTL A;  4A3C G;  3SK4 A;  4LF7 Q;  1X32 A;  1BBX C;  5LL6 X;  1E0B A;  4KN7 C;  1NMF A;  2ZTD A;  1FD7 D;  3HOX H;  3SE0 A;  4KMU C;  1VCI A;  4C3J H;  1J8I A;  5EBC A;  1CA5 A;  4A3B B;  3NQI A;  4MZ9 A;  3DWP A;  4JI6 L;  3NEN A;  2L15 A;  1KC8 C;  1Q3L A;  3PIP 3;  4GKJ L;  2A68 D;  5IT9 c;  3WOE A;  5IGG A;  4DV2 Q;  3KBX A;  3TDQ A;  5I2Y A;  3BVZ A;  1ENC A;  1V1Q A;  1EQT A;  1KIX A;  2JK8 A;  4QB4 A;  4DAY B;  1V43 A;  1F2M A;  2HCI A;  3STB D;  2AHO B;  2I0Q A;  2AMC B;  2UXB Q;  1QJO A;  4OEM B;  5K36 H;  1X3Q A;  3JAM L;  4YIJ A;  1PHJ A;  4A93 H;  5IP9 G;  4N9P A;  2MQH A;  3ONA B;  4C2M H;  1LTR D;  1C48 A;  2NWG A;  3M3Y H;  1DJR D;  3S16 B;  3H94 A;  4YCU A;  4DUY L;  1Y8P B;  2MO0 A;  1WTQ A;  2UUA L;  3D6C A;  4X65 Q;  3OSO A;  4I65 A;  4U67 3;  4RGT A;  2VW9 A;  2C9O A;  4A3F H;  5M5W H;  3MC0 B;  3K5N A;  5M3F H;  1I94 Q;  3OWE B;  4Q0F A;  2RSO A;  2YTY A;  2NYZ D;  5C44 G;  4DR3 L;  1BCP D;  2Z6B A;  4LFA Q;  5HGQ A;  4OO1 G;  2PMZ B;  5EPJ A;  2EJG C;  3A56 A;  5ELB A;  4FF3 A;  1ESF A;  1EQV A;  1N34 L;  1TT2 A;  4NXN Q;  3BDO A;  2SOB A;  1NNX A;  4APV A;  2A1A A;  2KVM A;  5M5Y B;  2KCM A;  4QUC A;  4IUP A;  2L9H A;  3C3L A;  5I4D A;  1YEZ A;  1SMY D;  3H91 A;  3R3O A;  4LK1 C;  1IBL Q;  1LTS D;  3TZD A;  4BBS B;  2EJF C;  3RLO A;  4A3J G;  2F4I A;  1I3Q B;  4IPD A;  5EKL A;  3HOY H;  3I4M B;  2WKC A;  4IOA A;  1HCZ A;  5JVH 3;  5CV8 A;  2VS1 A;  1HR0 W;  1VS0 A;  1P16 A;  1EEF D;  2JJQ A;  3UDF A;  1H9J A;  1IYU A;  2KA7 A;  4KKT A;  3RN2 A;  1K8M A;  3NBI A;  1UAP A;  3EFX D;  2CFM A;  1Q1E A;  3J81 E;  2PNR C;  1WTX A;  2KJX A;  1FNU A;  2NZH A;  4K6D A;  4FXD A;  4DK3 C;  4RGN A;  1SEB D;  3P75 A;  1YHB A;  4JCV E;  3HKZ E;  4OL7 A;  4DR5 Q;  1B9M A;  1NMG A;  1A3T A;  4N8F A;  4R8I A;  2PMZ E;  2WII B;  1SYD A;  4DV0 Q;  2PZU A;  4PQX A;  2MNA A;  2L11 A;  3HOX B;  3J81 c;  4JI5 L;  3CCE A;  4C3J B;  3P1H A;  4RCN A;  4DV3 Q;  2OCE A;  2WFW A;  1PH3 A;  2IX3 A;  1NCV A;  1BDO A;  3J80 E;  1A3V A;  3CRK C;  2EPB A;  3BVM A;  2RSN A;  2CKZ B;  4RFB A;  1P8L A;  4TSS A;  5EGT A;  4JI3 Q;  3D6W A;  4C1N I;  2HIV A;  4GOP A;  4C3H G;  2K14 A;  1PYS B;  1RDP D;  4A3E H;  1X3F A;  1ILQ A;  4DV6 Q;  3CKI B;  3TBI B;  2SDF A;  4BY1 H;  2PQA A;  1BQQ T;  3GQB A;  5E7N A;  2F52 A;  4A93 B;  3R8B A;  4IUR A;  5F2D A;  1R4P B;  2PI2 A;  2A5H A;  3CQZ H;  4BBR G;  4IOC A;  2JA6 H;  3S17 H;  1KDB A;  5ELE A;  3S9W A;  3BYY B;  1VQ4 A;  3I7F A;  3CF5 A;  1H9S A;  4J6H A;  4ID6 A;  4A3F B;  4EX5 A;  2PYK A;  4Y7N H;  1PH2 A;  1N32 L;  3BG3 A;  4S3S A;  2BE5 C;  2MP1 A;  2ZTE A;  3NTK A;  5D3D A;  5COR A;  1PTO D;  3RNU A;  1L1O B;  2EXZ A;  4LFB L;  3K58 A;  3TRZ A;  1MSG A;  3KK7 A;  2B2V C;  1PH6 A;  1HNX Q;  1VQH A;  3CCM A;  1J5E Q;  1GHJ A;  1XX8 A;  2B2T C;  4JOI A;  4F87 A;  1HJP A;  5I2X A;  1EIF A;  5BN3 A;  2R6G A;  4UY8 C;  3MEF A;  2EYH A;  4I7Z C;  3NUC A;  2EVB A;  3OOC A;  1KAW A;  1TS5 A;  4H13 C;  1T5X D;  3K7A B;  3HOY B;  5IIF A;  2IL8 A;  4WJW A;  4DV7 L;  3QIA A;  4IO9 A;  1Z6H A;  3SK5 A;  1WTW A;  3MZ5 A;  4GN5 A;  1WI5 A;  2EY5 A;  4DV4 Q;  3RZO H;  4DR7 L;  1H95 A;  2XSC A;  5C4X G;  1LAB A;  1WD0 A;  3LWU A;  1XXG A;  4E6I A;  2IY5 B;  2LKV A;  2AWO A;  3FVQ A;  4LWC A;  4OO1 I;  3G6J B;  1HNW L;  2Z6K C;  4EGV A;  3CC7 A;  2OWO A;  4BY7 G;  1YIJ A;  1N8R C;  1KAB A;  1EYA A;  3BVG A;  4HID A;  1EWI A;  4K6L A;  4NB3 A;  3NWS A;  1STA A;  1L0X B;  3I4O A;  5C4H A;  4P74 A;  4NP5 A;  4X3U A;  1YJ9 A;  1PRT D;  1IL2 A;  1S4Z A;  3PO3 H;  1J6Q A;  1STH A;  3HOV H;  3TQY A;  3SR1 A;  3CXC A;  1JMC A;  3BYT B;  3NTH A;  3PO2 G;  5CV9 A;  2OQ0 A;  3K8A A;  4KY5 A;  1HHV A;  4GLA C;  2E5L Q;  4GN4 B;  2JA8 H;  2GN5 A;  1AH9 A;  1YI2 A;  1W6J A;  2H5X A;  2ASB A;  4R1J A;  4K0K L;  4R4O A;  1FJG L;  3K7U C;  1C9O A;  4C56 C;  3HFZ B;  2E2D C;  4JG2 A;  4B3M L;  5C4Z A;  1PH8 A;  3H3V C;  4JI2 L;  2BDO A;  4P71 A;  4ZUJ A;  1IKL A;  2B2V A;  1SYB A;  3WWV A;  1OXV A;  1Q46 A;  2F0N A;  3Q6S A;  4BY1 B;  2B2T A;  3C2P A;  3NPP A;  2ZM6 L;  2RKS A;  1CKM A;  2GVA A;  3AEV A;  1Y1W G;  5DEH A;  3RR5 A;  1VDZ A;  3LGJ A;  1SBB B;  2F0L A;  3S17 B;  3CQZ B;  1SND A;  2JA6 B;  4DUZ Q;  3CCL A;  3PUY A;  3GTL H;  1PMR A;  3OW2 A;  4K2L A;  1DD2 A;  3FEW X;  5DM7 3;  1N33 Q;  1DOK A;  2JA7 H;  5FJ8 H;  5TSS A;  4Y7N B;  4DR4 Q;  2UXC L;  1G29 1;  2F0I A;  1IBM Q;  2K5H A;  4HN7 A;  5FLM H;  2LXK A;  1MI2 A;  1QZH A;  1FGB D;  4DR2 L;  1SNP A;  4A3L H;  3NWT A;  3SXH A;  3MWY W;  4R4Q A;  4G4K A;  5M3M G;  3NK9 A;  3JAM c;  1A62 A;  2KCN A;  2KHS A;  4PNY A;  1STE A;  4CDF C;  4LFC L;  1EWC A;  1VQ7 A;  3NHH A;  3QOJ A;  4DGZ A;  3W3A A;  4IUU A;  1Y8N B;  3C46 A;  2L4N A;  1WD1 A;  4RKB A;  3T1H L;  2UU9 Q;  3I4N H;  1JIC A;  5E4W C;  5L37 A;  4GNX B;  3NBH B;  1YIT A;  1DCZ A;  2B8G A;  1EY0 A;  4K8I A;  4TQU S;  1MJE A;  2RHQ B;  4B3S L;  1U4P A;  3PF5 A;  3RZO B;  2FJ2 A;  2A6H C;  4ABN A;  1IL8 A;  1SAP A;  5GQO A;  1RL2 A;  2NVY H;  2TMP A;  4RMF A;  3TS2 A;  1C0A A;  1JJC B;  2QW7 A; 
#chains in the Genus database with same CATH homology
 4HSP A;  3QB3 A;  3ND9 A;  1WTV A;  3QWN A;  2NN6 G;  1WVL A;  3PO3 B;  2K7V A;  4RGM A;  3HOV B;  1B4O A;  1WTR A;  1B1Z A;  1CI3 M;  1KDA A;  2PW5 A;  3T53 B;  3FMC A;  1EIH A;  2JA8 B;  2G9H D;  4C3I G;  2R61 A;  3D4W A;  4KHV A;  5C0X G;  2CW0 C;  3MXP A;  1AN8 A;  2NTT A;  1DM0 B;  2DNE A;  3OIQ A;  2N55 A;  3HP3 A;  2OF1 A;  1I4X A;  1EYC A;  2R93 B;  4WFN 3;  1LTI D;  3IFT A;  2VB2 X;  3ND8 A;  3PUV A;  3TP6 A;  3GTL B;  2JYO A;  1HA5 A;  2F3W A;  4ZUI A;  3SDZ A;  2JA7 B;  5EBD A;  4XQQ A;  1EY9 A;  4H7B A;  2R3Z A;  2FMC A;  2R7Z B;  3GD7 A;  3ERO A;  3K0Y A;  1B3A A;  3HGB A;  1SYC A;  1D5Z C;  5CMD A;  5FO7 B;  2IPK D;  2X6L A;  1SNC A;  2PO4 A;  4B08 A;  2BCO A;  3EQL C;  3FPU B;  3I4N B;  1NUC A;  1SE2 A;  1SNO A;  4JK1 C;  3EVQ A;  5CR3 A;  2F0V A;  1PTO H;  1BUV T;  5CV5 A;  2DN8 A;  3MEH A;  1Q1B A;  1Y1V B;  4HTH A;  2LS0 1;  1XTC D;  4QMG A;  3SK6 A;  2NVY B;  2Y0S B;  3Q0A A;  2PW7 A;  4C1N K;  2D9U A;  5C0X J;  5JEA G;  2JA5 B;  1EYD A;  2XVS A;  4B9W A;  5C3W A;  1CM9 A;  2FHT A;  4KKS A;  1RD9 D;  2B2Y A;  2BOS A;  4L8J A;  1S5D D;  2WB1 B;  4DAY A;  2KQ3 A;  1GUT A;  1YNN C;  3DMU A;  3V96 A;  3TP8 A;  1H9K A;  3H6M A;  3BS1 A;  1U4L A;  3DXJ C;  2NB0 A;  2MHV A;  1BCP F;  2L5T A;  1KLU D;  1LO5 D;  3K5M A;  1TKW B;  4V19 0;  2NN6 I;  4CHT B;  2EYJ A;  5J39 A;  4UDU C;  4OO1 H;  2RDG A;  1Q8I A;  4A3G B;  2NVQ B;  2C5C A;  2CHB D;  3E0J A;  1A6X A;  1UUP A;  3BDL A;  5C0X I;  2YYZ A;  3S1N B;  1D2B A;  4ZQ3 A;  1Z7T A;  5KYL A;  5FOB B;  2XRQ D;  3KLR A;  4HSV A;  5IT9 E;  1W6K A;  5I6Y A;  3GO5 A;  5I9O A;  2LFN A;  3PV0 A;  2F0U A;  3N6R A;  5J1Z A;  3U9O A;  1SXT A;  1AP0 A;  3S15 B;  1KNE A;  1ZEQ X;  1I6V C;  3VR6 A;  3GTO B;  1JWS D;  5JEA J;  3HOU B;  3VA5 A;  4RAU C;  4AYB B;  2ID0 A;  1PTO B;  4DNR B;  1A2T A;  3S1Q B;  4M1U B;  2JEB I;  5EPL A;  3LWE A;  1EU4 A;  3WOF A;  3NSW A;  1ZYR C;  1DXM A;  1XWE A;  4KV6 A;  1GOZ A;  3I72 A;  4CGY B;  5CBE E;  1J9O A;  3EA6 A;  1EL0 A;  5ELF A;  3A8J E;  5T1I A;  2E2J B;  1HTP A;  2Q8T A;  1YNJ D;  3GV3 A;  2VXW A;  3A54 A;  2MJ8 A;  1EY8 A;  3DEP A;  4KD4 A;  1T5E A;  3LX0 A;  1F2Z A;  5D65 A;  4CJ0 B;  2F0M A;  2I07 B;  1U4R A;  4K14 A;  2OXP A;  1PRT B;  3VR4 A;  4EVO A;  3TME A;  1QNK A;  4KY7 A;  2IX1 A;  2XIW A;  5C44 B;  1TQO A;  4PV1 C;  2ICI A;  2K5Q A;  2L0C A;  1F2Y A;  2A69 D;  2AQ2 B;  1F9R A;  1OXS C;  4A3M B;  1QB5 D;  5IOD A;  1O7L A;  1HQR D;  3I3C A;  2B2U C;  3NXW A;  1JE4 A;  1AW7 A;  1TS4 A;  1HTL D;  2Z8L A;  1K8O A;  1GHK A;  3DUZ A;  1S5B D;  2A6H D;  2F03 A;  2VUM B;  5BN5 A;  4QUF A;  1JWM D;  1JOQ A;  4KJN A;  5FLX L;  1EEI D;  2JP1 A;  3K6O A;  1V1P A;  1ONL A;  3RMH A;  3CRL C;  4DXG A;  4FNF A;  3ZYY X;  1ICW A;  3D4R A;  4C2M B;  1AFP A;  1TWC B;  3J7Y W;  3M3Y B;  1S5E D;  2K28 A;  1I4G A;  5C3E B;  2QEJ C;  1BO0 A;  2A73 B;  5M5W B;  4FF2 A;  2B39 A;  5M3F B;  2F0O A;  1LTB D;  2ENB A;  2B8F A;  4C3H B;  4KN4 C;  1GUO A;  1OXX K;  4OHJ A;  1ENF A;  1EIG A;  4KI0 A;  1Z47 A;  2F3V A;  4LMQ D;  1X3P A;  5CYU A;  4K5X A;  2O4X A;  3J7A V;  1BXT A;  1TWA B;  5IGC A;  2B2U A;  3L9A X;  1F9Q A;  1I6H B;  3FRP B;  5JPM C;  3I73 A;  2B2W A;  4IUN A;  1OO9 B;  4XDX A;  1C8C A;  3CHB D;  5D3I B;  5C3X A;  4K8J A;  5CGK A;  4K5V A;  4ZYS A;  2K32 A;  1STG A;  1RJT A;  3U9S A;  1V8Q A;  1G6Z A;  1ZKO A;  2M9V A;  4KKU A;  5CBA E;  3SEB A;  4TKO B;  3V05 A;  1SYE A;  1CHP D;  3QG1 A;  1TWF B;  4LAA A;  5C4X B;  3Q22 A;  3NBH A;  4MIU A;  1OXT A;  3F2U A;  3P7J A;  3VYR A;  4BY7 B;  4K2K A;  4IAL A;  4HMJ A;  2Z1C A;  1MD2 D;  2E76 C;  1MBY A;  2NN6 H;  1STB A;  2F1M A;  1DON A;  1HUN A;  2DNC A;  5DNF A;  1BF4 A;  3OMC A;  1JOK A;  2AQ3 B;  3RZD B;  2F0T A;  4A3E B;  2QF7 A;  3DWA A;  1NAP A;  4ME5 A;  3OHX C;  4H0L C;  4G7Z C;  4RH6 A;  2G9D A;  3JAM E;  2KEE A;  1TY0 A;  2XWB B;  1IYV A;  4HCS A;  5HUR A;  2CVR A;  1RHP A;  1BCP C;  3SHL A;  1QG7 A;  4OGQ C;  1LV9 A;  4R9W A;  5EKK A;  3RLF A;  1RF2 D;  3SVM A;  2HCC A;  1S5C D;  2IX0 A;  4CBV A;  2WIN B;  1WTO A;  2BA1 A;  4KD3 A;  3P20 A;  1SJH D;  1AZQ A;  3E5S A;  1Y1W B;  3DHQ A;  3OMG A;  3KUP A;  2EOT A;  1BOS A;  2JSO A;  2Q8I B;  1EU3 A;  3BZD B;  1JC7 A;  2J0T D;  4F88 A;  3S1R B;  1L0Y B;  4G7H C;  5IGE A;  1PFN A;  1B9N A;  1B53 A;  5T1G A;  4RHS A;  1HUM A;  2EY1 A;  3IFD A;  5DM6 3;  3D4D A;  3E6Z X;  5M3M B;  1XYI A;  1WTP A;  2RQX A;  3A8I E;  5KIX A;  1VF7 A;  4HED A;  2DY7 A;  1RTO A;  4IUV A;  3OW7 A;  2H1E A;  1PDQ A;  3A7A B;  1PXU A;  4XQN A;  2MUY A;  2F0H A;  1PZJ D;  4XIG S;  1ESR A;  4RCO A;  1I4R A;  4HR7 B;  1PLF A;  4PMW A;  1HPC A;  4OIK A;  2ZT9 C;  2PQE A;  1SSO A;  3S2D B;  2AUK A;  2PZT A;  2D2C C;  2KED A;  5A2Q L;  1ZXT A;  4ODG A;  2RBM A;  3R2I A;  1B2T A;  1ZYR D;  4L6T B;  2WP8 J;  1DYQ A;  1G91 A;  2EJM A;  1I50 B;  4CKB A;  2M00 A;  4G7O C;  2F0S A;  5IGD A;  1PFB A;  2K1B A;  2EE1 A;  5G3L D;  5FLX E;  1E2V A;  5E1F A;  1QE6 A;  4NMZ A;  1TWG B;  2MPM A;  3X3N A;  3S1M B;  2K05 A;  3KLS A;  2B2Y C;  4BS9 A;  4Z9C B;  3H0G B;  3I8Z A;  2IJ0 A;  1CA6 A;  2K33 A;  4EQO A;  3BDC A;  1STY A;  2K6A A;  2F0P A;  4WOR A;  1E2W A;  2E75 C;  1SYG A;  5E3F A;  2D5D A;  4XT3 B;  2PCF B;  5COY A;  5HGT A;  1PZI D;  1O78 A;  3MFY A;  3X3M A;  5EKI A;  3NP8 A;  2VNU D;  3D31 A;  1CK1 A;  1D1K A;  4KTA A;  4FF4 A;  5FK9 C;  2EZV A;  3C1E A;  4X3S A;  5NUC A;  1Q12 A;  3EJI A;  3T4A C;  4O42 A;  5AFW A;  4IFD G;  1VF5 C;  3UI2 A;  5KNC A;  1PZK D;  1AEX A;  3LNN A;  3RD4 A;  3K59 A;  3GTP B;  1D6E C;  4FXG C;  3OPO A;  1HQM C;  4CKC A;  3R2T A;  1CZG A;  4XYO A;  1F9S A;  3PMF A;  3MAQ A;  5EPK A;  2IWH A;  4HAE A;  1CT1 D;  1ROD A;  2QIL A;  3FKI B;  2ZXP A;  1I4H A;  5C6A A;  1ET9 A;  1WCM B;  2BE5 D;  3M4O B;  1QIL A;  2F0D A;  1D5M C;  1UNS A;  4K5W A;  5CC4 A;  1TR5 A;  4R8N A;  2EY6 A;  3PUW A;  3VYU A;  1FYC A;  2IT1 A;  4H44 C;  2F0G A;  1II3 A;  4RHR A;  1RCV D;  4CJ2 C;  4J8Q A;  4LJZ C;  2E2I B;  3MVV A;  1R4Q B;  4PMB A;  4RWS C;  3K5O A;  1NR2 A;  2WAQ B;  1ENA A;  2XWJ B;  1CZW A;  3KLS X;  5JPN C;  1BNZ A;  3HEJ A;  3I70 A;  2JEA I;  4IFD J;  1E2Z A;  1KNA A;  2QKI C;  2PZW A;  4JBW A;  1PFM A;  3AMU A;  2MGS A;  3Q24 A;  3D8G A;  3PUZ A;  4FVM A;  2BA0 A;  2J7Z A;  2XN9 C;  5JOB A;  5JVG 3;  2KUM A;  4MHE A;  1AZP A;  4FYD A;  5CV4 A;  1JR0 D;  2KEC A;  4L63 B;  5M5X B;  1JCK B;  1QNU A;  1F9P A;  1DOL A;  4KY6 A;  4IZ8 A;  3G7L A;  4V0B A;  5E4X A;  2F0E A;  1PYW D;  5I9P A;  2A74 C;  2K04 A;  1SFO B;  4TRD A;  4X3K A;  3M7N A;  1PTO F;  2O5I C;  5A2Q E;  4IFD I;  1ILP A;  2RDH A;  3HKZ B;  3NQT A;  1SYF A;  5FO8 B;  4ZAI A;  2F0J A;  2X69 A;  1NR4 A;  2WKD A;  1TS3 A;  5IGF A;  3AU7 A;  1CTM A;  2H4O A;  3VA7 A;  3MHB A;  4ULL A;  1ML0 D;  1TWH B;  5A35 A;  3M85 A;  3VYT A;  3GTK B;  2QCP X;  2QDB A;  4N9T A;  1EWH A;  3KF8 A;  4A3J B;  4XYQ A;  2LMC B;  2B2W C;  1O80 A;  3OIP A;  1MGS A;  1BR9 A;  3I91 A;  1SDF A;  4C3J G;  4PMC A;  2XNA C;  1D1I A;  2A6E C;  2L1B A;  2NTS A;  3K57 A;  2PPB C;  1PRT F;  1RKN A;  1JQY D;  5ELC A;  5C5L A;  1EFI D;  1FNW A;  2Z4H A;  2EYL A;  1LT5 D;  4XQJ A;  1A2U A;  5K36 G;  4RA8 A;  3WDN A;  1Q90 A;  1I4P A;  3URY A;  2HDM A;  4BA2 I;  1LT6 D;  3ITP A;  1EZ8 A;  5EQ0 A;  2EY2 A;  2F0Q A;  1KDC A;  1TS2 A;  4F8M A;  3J7A F;  2CW0 D;  3A7L A;  3HOZ B;  2NVT B;  1O7Z A;  1HXY D;  4DAP A;  1EY5 A;  4KK7 A;  4BA1 I;  5KYI A;  2YU9 B;  1VMP A;  1QOH A;  3TP7 A;  4BBR B;  1CHQ D;  3GTJ B;  1U4M A;  2D62 A;  2KCC A;  1IW7 C;  4B9X A;  2HQE A;  2ZXO A;  4GZY C;  2K03 A;  3IL8 A;  4NKL A;  3MXG A;  4EQN A;  4DXF A;  3TP5 A;  5BN4 A;  1KAA A;  1DOM A;  1A15 A;  4ZRZ A;  2EYM A;  3MFG A;  3KBG A;  1SNM A;  3T56 B;  4WRD A;  2SNS A;  3A8K E;  5FO9 B;  1V1P B;  2WV6 D;  4J1M A;  3HS0 C;  2A68 C;  5M9O A;  2FFK B;  2K5W A;  2R92 B;  2J4X A;  4DFA A;  2F0K A;  1C4Q A;  4KJO A;  5K5P A;  2B63 B;  4XTC S;  1H9R A;  4ZKB B;  1TVX A;  2EYP A;  2K01 A;  3QJY A;  2NUC A;  4DK1 A;  2HDL A;  3M4Y A;  2WAC A;  2HUG A;  2RDF A;  4U68 A;  4XT1 B;  3I90 A;  1H9S B;  3PO2 B;  1GUS A;  1OXU A;  3GTG B;  2N88 A;  5EJW A;  1I4Q A;  3OWF A;  1EOT A;  1CQF A;  5C0X H;  4FP5 D;  5G3L F;  1YNJ C;  1YNN D;  2AUJ D;  3T13 A;  3AB9 A;  4X3T A;  1EY7 A;  2OT2 A;  3O13 A;  1HFN A;  4ILW A;  3ERQ A;  3MTS A;  1DZ1 A;  2NVX B;  1KTK A;  4IUT A;  1STN A;  3HG9 A;  5KEE A;  1B44 D;  1SE4 A;  1SMY C;  1S5F D;  5IT9 L;  3L3O C;  2JE6 I;  3TZU A;  2AQ1 B;  2E74 C;  3RUZ A;  3QOL A;  1TY2 A;  3MXN A;  3DM1 A;  2A69 C;  3MA2 B;  3V2T A;  2ZXR A;  1MSH A;  1SE3 A;  3DEO A;  5KNB A;  4NW2 A;  4XXE A;  3A55 A;  1HFG A;  1GUW A;  3FPP A;  2NBF A;  1SNQ A;  1JWU D;  5JAV A;  1HA6 A;  5IGB A;  1KLG D;  4DA2 A;  1LTT D;  3PIO 3;  1HRJ A;  2O5J C;  2RVL A;  1NSN S;  3I4L A;  2E2H B;  1CFM A;  1LT4 D;  4IN3 A;  4ZLT F;  4DNT B;  4ZK9 B;  3T51 B;  1FNV A;  1LAC A;  1LT3 D;  4KHZ A;  4BWG B;  4IUQ A;  4EQP A;  4IFD H;  4FXK C;  4RGO S;  4G57 A;  4ZKC B;  4O1N A;  5JEA H;  2OEO A;  4HCE A;  3TSS A;  5DAU A;  5CV7 A;  1EY4 A;  2Q8R E;  2AWN A;  4IQZ A;  5C5M A;  2GA4 B;  1R9T B;  1O7Y A;  2M2L A;  4OIJ A;  4C3I B;  2DY8 A;  1JOO A;  4DK0 A;  1EZ6 A;  2IW3 A;  3VR5 A;  2KOL A;  2O2L D;  1PTO C;  1F77 A;  5KRU A;  3TN2 A;  4UAI A;  4F7X A;  3IAY A;  1K83 B;  3C1F A;  2Z4I A;  1Y8O B;  3K5L A;  3J81 L;  4QIW B;  1G2S A;  2EDG A;  3GTM B;  4RKL A;  3VYS A;  2XRS D;  5JJZ A;  1V1O A;  1A3U A;  3NTI A;  2LY7 A;  1G8Z D;  1U9R A;  4A3K B;  3Q23 A;  1EY6 A;  1VMC A;  1M8A A;  2NZ1 D;  3CU7 A;  1ET6 A;  2ICE C;  1UEA B;  5ISR A;  2L12 A;  3W2D A;  2JXM B;  3J80 L;  5J22 A;  2TSS A;  3HRZ C;  5C4J B;  1LTA D;  1JOR A;  3GTQ B;  2A6E D;  4CKE A;  1PRT C;  4MN3 A;  3VR2 A;  3FDT A;  1B50 A;  3M7G A;  1Y69 U;  1GXD C;  2K5D A;  1BCP B;  2CQA A;  4FO2 A;  3MXU A;  5LL6 S;  5IOC A;  2L55 A;  1JB3 A;  1IHZ A;  1F2L A;  2EYF A;  4CJ1 B;  4P2C B;  1SJE D;  3N52 A;  2V4D A;  4DU9 A;  1QCB D;  4DF7 A;  1G2T A;  1QWY A;  4DAV A;  5I6W A;  5KND A;  5ELD A;  5FKA C;  2SEB D;  1IKM A;  4NDX A;  3PUX A;  3R93 A;  3DWQ A;  4M8A A;  1D5X C;  2FMM A;  3T16 A;  3S2H B;  2FIN B;  3IKJ A;  3SK8 A;  5CV6 A;  1LLR D;  3VR3 A;  1GUN A;  4QF4 A;  5D14 A;  3HOW B;  1LTG D;  1TII D;  2VB3 X;  1RTN A;  3D3R A;  3HZX A;  1IW7 D;  1H9M A;  4QCL A;  1GJX A;  1FR3 A;  3GP7 A;  2BDN A;  5KGU A;  3NE5 B;  2I46 A;  4HMI A;  4Q5V A;  3L7Z C;  1CQV A;  2SNM A;  4A3I B;  1TU2 B;  3QO2 A;  4DN4 M;  4FF1 A;  1GUG A;  2F0W A;  2RA4 A;  3GV6 A;  5LHY 1;  4A3D B;  3H09 A;  2X6G A;  2EYO A;  3S14 B;  2F0F A;  3SK4 A;  1X32 A;  1BBX C;  5LL6 X;  1E0B A;  4KN7 C;  1FD7 D;  3SE0 A;  4KMU C;  1VCI A;  1J8I A;  5EBC A;  1CA5 A;  4A3B B;  3NQI A;  3DWP A;  1Q3L A;  3PIP 3;  2A68 D;  3WOE A;  5IGG A;  3KBX A;  3TDQ A;  5I2Y A;  3BVZ A;  1ENC A;  1EQT A;  4QB4 A;  1V43 A;  1F2M A;  2HCI A;  1QJO A;  5K36 H;  1X3Q A;  3JAM L;  4YIJ A;  4N9P A;  3ONA B;  1LTR D;  1C48 A;  2NWG A;  1DJR D;  3S16 B;  3H94 A;  1Y8P B;  1WTQ A;  3D6C A;  3OSO A;  4I65 A;  4U67 3;  4RGT A;  2C9O A;  3MC0 B;  3K5N A;  3OWE B;  4Q0F A;  2RSO A;  2NYZ D;  1BCP D;  4OO1 G;  2PMZ B;  5EPJ A;  2EJG C;  3A56 A;  5ELB A;  4FF3 A;  1ESF A;  1EQV A;  1TT2 A;  3BDO A;  2SOB A;  2KVM A;  5M5Y B;  4QUC A;  4IUP A;  2L9H A;  3C3L A;  5I4D A;  1SMY D;  3H91 A;  3R3O A;  4LK1 C;  1LTS D;  3TZD A;  4BBS B;  2EJF C;  2F4I A;  1I3Q B;  3I4M B;  5EKL A;  2WKC A;  1HCZ A;  5JVH 3;  5CV8 A;  1EEF D;  1H9J A;  1IYU A;  2KA7 A;  4KKT A;  1K8M A;  3NBI A;  1UAP A;  3EFX D;  1Q1E A;  3J81 E;  2PNR C;  1WTX A;  2KJX A;  1FNU A;  4K6D A;  4FXD A;  4RGN A;  1SEB D;  3P75 A;  4OL7 A;  1B9M A;  1A3T A;  4R8I A;  2WII B;  1SYD A;  2PZU A;  4PQX A;  2L11 A;  3HOX B;  4C3J B;  3P1H A;  4RCN A;  2IX3 A;  1NCV A;  1BDO A;  3J80 E;  1A3V A;  3CRK C;  2EPB A;  3BVM A;  2RSN A;  4TSS A;  4RFB A;  5EGT A;  3D6W A;  4C1N I;  4C3H G;  1RDP D;  1ILQ A;  3CKI B;  3TBI B;  2SDF A;  1BQQ T;  3GQB A;  4A93 B;  3R8B A;  4IUR A;  5F2D A;  1R4P B;  2A5H A;  1KDB A;  5ELE A;  3S9W A;  3BYY B;  1H9S A;  4J6H A;  4ID6 A;  4A3F B;  2PYK A;  3BG3 A;  4S3S A;  2BE5 C;  2MP1 A;  3NTK A;  5D3D A;  5COR A;  1PTO D;  2EXZ A;  3K58 A;  1MSG A;  3KK7 A;  2B2V C;  1GHJ A;  1XX8 A;  2B2T C;  4F87 A;  5I2X A;  5BN3 A;  2R6G A;  2EYH A;  4I7Z C;  3NUC A;  2EVB A;  3OOC A;  1TS5 A;  4H13 C;  1T5X D;  3K7A B;  3HOY B;  5IIF A;  2IL8 A;  4WJW A;  1WTW A;  3QIA A;  1Z6H A;  3SK5 A;  3MZ5 A;  2EY5 A;  2XSC A;  1LAB A;  1WD0 A;  3LWU A;  1XXG A;  4E6I A;  2LKV A;  2AWO A;  3FVQ A;  4OO1 I;  3G6J B;  4EGV A;  1KAB A;  1EYA A;  3BVG A;  4K6L A;  3NWS A;  1STA A;  1L0X B;  5C4H A;  4NP5 A;  4X3U A;  1PRT D;  1S4Z A;  1STH A;  3SR1 A;  3BYT B;  3NTH A;  5CV9 A;  4KY5 A;  1HHV A;  1W6J A;  4C56 C;  2E2D C;  5C4Z A;  3H3V C;  2BDO A;  4ZUJ A;  1IKL A;  2B2V A;  1SYB A;  1OXV A;  2F0N A;  3Q6S A;  4BY1 B;  2B2T A;  3C2P A;  3NPP A;  2RKS A;  5DEH A;  1VDZ A;  1SBB B;  2F0L A;  3S17 B;  3CQZ B;  1SND A;  2JA6 B;  3PUY A;  1PMR A;  4K2L A;  1DD2 A;  3FEW X;  5DM7 3;  1DOK A;  5TSS A;  4Y7N B;  1G29 1;  2F0I A;  4HN7 A;  1MI2 A;  1FGB D;  1SNP A;  3NWT A;  3SXH A;  3MWY W;  4G4K A;  3NK9 A;  2KCN A;  2KHS A;  4PNY A;  1STE A;  1EWC A;  3NHH A;  3QOJ A;  4DGZ A;  3W3A A;  4IUU A;  1Y8N B;  3C46 A;  2L4N A;  1WD1 A;  4RKB A;  1JIC A;  5E4W C;  1DCZ A;  2B8G A;  1EY0 A;  4K8I A;  4TQU S;  1U4P A;  3RZO B;  2FJ2 A;  2A6H C;  4ABN A;  1IL8 A;  1SAP A;  2TMP A;  1M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...