4NXMQ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nxmQ00
4HJAA 4QQBX 3CPFA 5GAEC 1VQBA 1EQRA 5GAHC 3CF5A 1PH9A 1RIPA 4BY1H 4B3ML 4JI0Q 1A62A 1QUQB 1U0LA 3E0EA 4GLXA 3CCQA 1YJWA 1VQ9A 2I5MX 4R1JA 2UXDQ 4GN5A 2Q2IA 4OX9L 2CCZA 1U5KA 4IFDG 2WFWA 4APVA 2IY5B 3BU2A 1EUJA 3JAMc 1SFOH 3AEVA 1UE6A 3J81c 2UXDL 5GQOA 1FGUA 4DV4L 1VQJA 3PF5A 4UPAA 2WAQG 1Z9FA 1I50H 1EIFA 2NN6I 3T1YQ 1N36L 4JI1Q 3D0FA 2ZM6Q 1FJGL 3M7NA 1M90C 4DR2Q 3M3YH 1D7QA 4EQ5A 1XMOL 1TWAH 3T1YL 3J81j 1A63A 1N36Q 5IYCH 1VQKA 4DR5L 3H3VI 3J80i 1HNZL 4LF4L 4DUYQ 1SE8A 3I4OA 5C3EG 1PH1A 4X6AH 2EQSA 5J3BA 1J5EL 1P8LA 4JBMA 1K0RA 4PZ8A 4X62L 3TS2A 1Q82C 4GKJL 4A3LG 2K52A 2F3IA 1H95A 2Z6KA 2A1AA 5JJIA 1LUZA 3ULLA 5H1SE 1QZHA 1N34L 2PMZE 3U4VA 1BBUA 1N33Q 4KI0A 3F8TA 1K9MC 4GKKQ 3KDFB 1VQ8A 2DGYA 4X64L 1VQ6A 4IOCA 4PMWA 3CAMA 4JYAQ 1NY4A 2CFMA 1YITA 1X3GA 5IYBH 1DGSA 4GN4B 1Y14B 2I5LX 2GVBA 2BA0A 4P74A 2ASBA 4XIGS 2PNHA 4OONA 3RLFA 3KJOA 3J81i 4GNXB 3VDYA 2BH2A 4A3DG 1W3SA 1GVPA 3K80C 4LF8L 3CCVA 4IOAA 4POFA 3I56A 2IHFA 3CCMA 1T9HA 1KHIA 1PFSA 1TWHH 3OW2A 1I5FA 4LF7Q 2UUCL 4A3BH 4O0AA 2R93H 1E24A 1PHJA 1PH5A 5IY0A 5IYCG 1IBKQ 4LFBQ 1Y1VH 3J7ZC 1MJEA 3HOWH 4JV5L 3F1ZA 2YYZA 3TS0A 3HKSA 3L2PA 3GTMH 5IT9c 4NXNL 1XMQL 1YHQA 4JBWA 4YCVA 4JV5Q 1XTDA 3KOJA 4UP8A 4OWWB 3A5ZB 4X66Q 4WJ3M 1EWIA 3B6YA 4B3MQ 2YTXA 4DAYB 4JI2L 3PO3G 3CQZH 3PUZA 5IP7H 1WFQA 5FLMH 2MNAA 1LYLA 1VQIA 3H0GH 4KHZA 4X66L 1KL9A 2HHHQ 3PGZA 4OX9Q 2WAQE 4JI2Q 1E22A 4L5QA 3U50C 4UP9A 5JEAG 3PO2G 1NE3A 1JMCA 2AKWB 4A4IA 2N8NA 1D8LA 4Y7NH 3HOXG 2E2IH 1A0IA 4JI1L 2HIXA 1Y1VG 1X65A 2VQEQ 4DV0L 4BBSG 5C44G 1HZ9A 5LMUL 4DKAC 1AH9A 2CQOA 4JOIA 4DR5Q 4LF4Q 2QGQA 1LM0A 3W5OA 3KFUA 2D62A 5M5YH 3JAMi 1J5EQ 2K14A 2HQLA 4BBRH 4X62Q 1WI5A 3H0GG 4OO1G 4PG3A 1YBYA 1K3RA 4DV6Q 3PO3H 4A3BG 2JA6H 4C3IH 2JJQA 3PV0A 2JA7H 1CSPA 4L5TA 1SMXA 3RN5A 1VQ7A 1N33L 2WP8J 2LXJA 1XMOQ 1Y1WG 2Y0SG 1Q86C 3PCOB 4DV5Q 4A93G 5C4JH 2IT1A 3NENA 4RG1A 2A8VA 4LF6Q 4BA2I 2IHEA 4OWXB 2VY3A 1OXVA 1VQGA 5M3MH 4DR1Q 2JA9A 3ULJA 1NJIC 1SROA 3T1HQ 4LUVA 4A3FH 4DPGA 4DUZL 4LNQA 4JCVE 4AQYL 2B63G 1PYSB 4A3CH 3HOVG 3KLWA 1L1OC 3K8AA 4MNOA 2JEBI 3I4NG 1UE1A 3RR5A 4H02A 4R4CA 4R4TA 5GADC 1QVCA 1YJNA 3GTJH 1C7YA 2ATWA 1V9PA 4MTNA 4EX5A 3M4OH 3CCLA 1BBWA 2MFIA 2A19A 2XGTA 2UUCQ 3PIOA 1NBWA 4GOPC 4B3SL 3LGJA 3AFPA 1A8VA 4DV2L 2BH8A 4DV7Q 3CC4A 3HOUG 1R9TH 4IJLA 3ULPA 4A3EG 1XPOA 3HOYG 4GN3B 5M5XH 3EN2A 2BA1A 1WYDA 4BY7H 4JOIC 1LTLA 1B8AA 4YHHQ 2N3SA 2R6GA 2E5LL 4O2DA 1KQSA 3KJPA 5IYDH 1AE3A 2OCEA 1X56A 2EIFA 1YEZA 1Q12A 3Q8DA 3RLOA 5FJ8H 2QEXA 1IBMQ 1CKMA 2E5LQ 3NEMA 2KHIA 1K8GA 3UDIA 4JG2A 4BY1G 1PH4A 3S1MH 4YY3L 2VQFQ 4A3DH 4LUOA 1O7IA 4LF9Q 4DR4L 4QL5A 4DR3L 2R7ZH 2B29A 3AQQA 3EIVA 1XMQQ 2H5XA 4YY3Q 2VQFL 4A3FG 1VQEA 5GAGC 3PUYA 5GROA 1PH7A 1I94L 3TREA 4A3JG 2VUMG 4DV0Q 5M3FG 3FP9A 4AIMA 5IP7G 4A93H 2B3GA 2K4KA 2RHQB 2Z0SA 3CCSA 1Q1EA 1WCMH 4JBJA 2VW9A 1M1KC 2CWPA 3KF6A 1BKBA 4HJ8A 3HOZG 3PUWA 5DLQE 2KBNA 2R92G 1G291 1V43A 5FJ8G 3CCJA 4HIKA 1HNWL 3F2DA 4A3KH 2V1CC 1VQMA 1YNXA 3E9HA 3W1GA 3PUVA 4MZ9A 2JA5H 3CCEA 4GOPB 4A3MH 1L1OA 2RHSB 4HJ7A 4DV5L 5HY6A 4C3JH 2NVQH 4J15A 1P16A 5ELOA 4JI7L 4B3RL 2F52A 2K50A 3K81C 2ALYB 4QIWE 1GM5A 3CC2A 4K0KQ 5C0XI 3J80c 4DNIA 2VS1A 4DV6L 1VQDA 4LF5Q 1HZBA 1EYGA 2OQKA 3WWVA 3CD6A 4AQYQ 1EOVA 4A3IH 1XNRL 3G48A 5BR8Q 4L5SA 4GKJQ 2ZJQA 4A3KG 1CKOA 2VNUD 1TXYA 2LSSA 2N49A 1S3OA 2R7DA 5BR8L 5C0XJ 5IE8A 3A5UA 4DR7Q 2Q2UA 4OXPA 2OTJA 2K5NA 1IYJB 1I6HH 5K36G 3NELA 1KD1C 1WJJA 4ME3A 1SLJA 4BXXH 3W1BA 2CWAA 4HIDA 5IYBG 1E1OA 2JK8A 2PQAA 1N32Q 1K8AC 1JE5A 4IPDA 1YJ9A 3HOWG 5JJLA 3KF8B 1Q46A 3G71A 3STBC 3GDEA 3M4PA 1ASZA 1OXXK 2OTLA 4IPGA 5M3MG 2L15A 1NTGA 2WB1G 1UE7A 1OXUA 4B3SQ 3K0XA 4AH6A 1JJ2A 2JEAI 2GVAA 4AYBG 4DV7L 1YZ6A 1V1QA 4OWTB 4LF7L 4WJ4A 1Q8KA 5LMNL 3L7ZC 2OQ0A 1VQOA 2F4VL 4LF9L 3GTPH 1E1TA 2Y0SE 1UWVA 1KRSA 4TVAB 3UDXA 5FLXc 1VQ4A 4JI5Q 2VUMH 3FKIH 4IPCA 1ASYA 2DUDA 4B3TQ 2MO1A 2FXQA 3CCUA 3F2CA 4R4IA 3S16H 1CKNA 1JT8A 1VQLA 1HJPA 4NXMQ 1K83H 4LWCA 4LFCL 2R7FA 3D31A 2UU9Q 1XPUA 2IX1A 1HZAA 4BY7G 2PI2A 4YWKA 4DR4Q 4GOPA 2YTVA 5ELNA 1GD7A 1L2FA 1Q1BA 2I0QA 4L5RC 1I94Q 3RZDH 3M4QA 3PO2H 2GN5A 5IWAQ 2UUAL 2NVTH 1EFWA 2UUBL 1EQQA 1X55A 1IZ6A 1N8RC 4HJ9A 3KYHC 3CPWA 3OTOL 1UEBA 2VQEL 3OYYA 5IP9G 3I4MH 5LMUQ 3SGIA 1X54A 2UUBQ 3I55A 1VQAA 3HOYH 3CP0A 4IO9A 3OTOQ 4DV4Q 1TWGH 3CMEA 1C9OA 1PV4A 4NB3A 2YU9H 4A3GH 2UXBL 2NVXH 3I2ZA 4BA1I 4DR2L 1NMGA 1PH2A 5C0XG 1JJCB 1BVSA 4KHPQ 3HOXH 4GS3A 1JB7A 4DUYL 4A3CG 4IPHA 1Y1WH 2D0PA 4KHPL 2RCNA 3G4SA 4DR7L 2XTIA 1XNQQ 3PIPA 4GLVB 3BJUA 5M5WH 3DLLA 2KCMA 2ZTCA 4YCUA 1IBLQ 3ICEA 3S17H 5FLMG 2WB1E 4LF5L 4IFDI 4RMFA 1SRUA 2JA5G 4DR1L 1E7ZA 2K5HA 3A74A 4X65Q 1MJCA 4AYBE 1I3QH 1IBLL 5C4XH 4JI3Q 1WOCA 1XNRQ 3HOUH 1S40A 3S15H 3STBD 4XTCS 4DUZQ 1YIJA 1EIYB 2OWOA 5HGQA 4JI6L 5LMNW 1IL2A 3PSIA 2E8GA 3A0JA 4JI3L 5C44H 1YHAA 2ZTDA 2NZHA 2MO0A 5JEAJ 3ZJYC 4ALPA 3J7A5 3S1RH 3RLNA 1JJGA 1RL2A 3UDGA 4C3HH 1AE2A 3TQYA 4DV3L 4OO1I 3K7UC 5IP9H 4LFAL 2NZOA 1N32L 3H15A 1YVCA 2KCTA 1HNXL 2KENA 3S2DH 4LF8Q 1QVFA 3I7FA 4JI8L 4LW1A 3GTQH 1C0AA 4LUZA 4LFAQ 1OTCA 4FDBA 1VQFA 4B3TL 2AHOB 1HH2P 4JI4L 4DV1Q 1HR0L 1VS0A 5M3FH 1IBKL 3GTLH 4BBRG 4LFBL 1PYBA 3CCRA 4R4QA 2UU9L 1CUKA 3F2BA 4JI4Q 3S1NH 2E2JH 1MIUA 2D0OA 2NN6G 3S1QH 1GKHA 2KHJA 4NXNQ 2ZJRA 1UE5A 3MEFA 4JBKA 2CKZB 2HT1A 2VZAA 4DK3C 2UUAQ 3BZKA 2JA8G 3HKZE 3M85A 4GNXC 1FJGQ 4NPSA 2C35B 3BZCA 1QUQA 2MQHA 2JA8H 1NMFA 2HHHL 3I4NH 2ES2A 1X3EA 5IYDG 4LFCQ 5AJ3L 2AMCB 1Z47A 2I5HA 3U4ZA 4UY8C 1G51A 2JA7G 1PH8A 4Y52H 4A75A 1VQCA 1X6OA 4YWLA 1GO3E 5AJ3Q 2JA6G 3NBHB 2HIVA 3HOVH 2UXBQ 2RF4A 1HNWQ 5IWAL 3UE0A 4A3EH 5EAYA 2NVYH 4JC0A 3CC7A 1OXTA 1KXLA 3M9BA 4QY7A 1X9NA 2VL6A 4R4OA 4JI0L 1PVOA 1QVGA 3CW2C 2LXKA 3RZOH 3H3VH 4A3MG 1L1OB 1WCMG 4GLAC 1B70B 3G6EA 4HIOA 1XNQL 4JI7Q 1Q7YC 3PF4A 4B3RQ 4K0KL 4P72A 4QGUA 1KAWA 4POGA 2B63H 2EXDA 4X65L 5E7NA 1L0WA 3S14H 1VQHA 1J6QA 2IX0A 4BXXG 2R7ZG 1HZCA 3I4MG 4IJHA 3S24A 2ZM6L 4A3IG 4JI6Q 1N34Q 1SN8A 4LF6L 2YTYA 3ERSX 1OXSC 3K7AH 4UP7A 3U58A 2YV5A 3ER0A 3HFZB 4TQUS 1KC8C 2E2HH 1VQ5A 3AFQA 1TWFH 1PA6A 1FVIA 2K75A 4P75A 2JE6I 2Q2HA 4X64Q 3RNUA 1HNZQ 1TWCH 3T1HL 4HIMA 1K73C 4A3GG 4A76A 4DR6Q 4IFDJ 4DV3Q 1XJVA 2K5VA 5JJKA 5C4XG 3TRZA 1IXRA 3JC66 4GNXA 4DR6L 4DAMA 1HNXQ 2R93G 1X3FA 4JI8Q 3UDFA 1KIXA 1E3PA 1PH6A 2PI2E 2N78A 3MXNB 2ID0A 1VQPA 1YI2A 1CSQA 1HR0W 4KLKA 4GKKL 1YHBA 4DV1L 3EBEA 3S2HH 4P71A 1XPRA 4QJFA 3DM3A 4HJ5A 1FL0A 4DV2Q 2R92H 3GTGH 3GTKH 3E9IA 1QZGA 1PH3A 4JYAL 1KRTA 2ZJPA 3GO5A 3KDFA 3KF6B 3RN2A 1N9WA 1VQNA 2ZTEA 4C2MH 4PZ7A 4P73A 4YHHL 1G6PA 3HKZG 4PZ6A 4YWMA 3UE1A 5LMNQ 2F4VQ 4DK6C 3CMAA 2AWOA 3AYHB 3IRBA 4JI5L 3CXCA 1IBML 3GTOH 5C3EH 1HR0Q 1SR3A 3HOZH 3FKIG 2Z6KC 2AWNA 1Q81C 3GD7A 4BBSH 2Q2TA 1B7YB 1W2BA 3PUXA 3TEHB 2UXCQ 1S72A 3L0OA 1MKHA 4DR3Q 4YCWA 2PQAB 3FHWA 4A3JH 4NXML 4A3LH 1VCIA 2JQOA 1CKNB 2QA4A 2UXCL
chains in the Genus database with same CATH superfamily
4HJAA 1WCMB 5FOBB 5GAEC 4BBSB 3CF5A 1SYCA 1SFOB 5CBEE 4BY1H 1S5CD 4O42A 4B3ML 4ABNA 1B1ZA 3W2DA 3T13A 4IFDG 1TIID 2IY5B 2WKCA 1SFOH 3AEVA 1CFMA 5GQOA 1VQJA 1AP0A 1EIFA 3NBIA 2ZM6Q 1M90C 2O4XA 1TWAH 3W3AA 3HOUB 3J81j 5FK9C 2AQ3B 1SE8A 5C3EG 4X6AH 1HA6A 2EQSA 1TR5A 5J3BA 1P8LA 1TVXA 3NWTA 4PZ8A 1BBXC 2YU9B 2F0KA 5C3XA 4GKJL 2HD3A 2K52A 2F3IA 4A3LG 5A2QL 1H95A 2I46A 2K32A 5JJIA 3ULLA 1N33Q 1BBUA 2RDHA 2B2YC 4KI0A 1EEID 1K9MC 3HRZC 3KDFB 3GTKB 1AZPA 4P2CB 1K28A 1ZKOA 3E5SA 5C6AA 3CAMA 4ULLA 3HZXA 3OW7A 3QWNA 1DGSA 1F2LA 4P74A 2GVBA 1HTPA 2PNHA 4XIGS 3KJOA 3S1MB 2BH2A 4A3DG 3M4OB 4A3BB 4X3SA 1NAPA 4KTAA 2EJGC 5EGTA 3I56A 3BYYB 3J7YW 1KTKA 3Q22A 1KHIA 2WKDA 5M5XB 1PH5A 1KLGD 1STHA 3J7ZC 3F1ZA 3L2PA 2XNAC 1XMQL 1YHQA 1S5DD 4JBWA 2XVSA 3MTSA 3KOJA 3HS0C 3B6YA 4HMJA 5EPLA 5CV6A 3CQZH 2MNAA 1LYLA 4OX9Q 3S16B 4A93B 1ICWA 1RD9D 5CV8A 3OHXC 1KABA 4JK1C 1STAA 1DOLA 1TWFB 2AKWB 4N8FA 3IKJA 1I4GA 4JI1L 4BBSG 3A55A 5FO7B 2EY2A 1HZ9A 4DKAC 1PZID 5DEHA 4LF4Q 4C56C 2D62A 3R8BA 1G8ZD 3I4NB 2K14A 4BBRH 4X62Q 2SDFA 3H0GG 4BWGB 3TP5A 3PO3H 2BE5C 1I4RA 2JA6H 4C3IH 2JJQA 1CSPA 4L5TA 1VQ7A 1B3AA 1BF4A 1RODA 1XMOQ 1Q86C 4K14A 4DV5Q 1HQMC 3VR3A 1LV9A 2X69A 2K04A 4BA2I 2MGSA 2BCOA 1VQGA 2F03A 1SYEA 2QDBA 1GUOA 1TT2A 4AQYL 2B63G 4A3CH 3GTLB 3RR5A 4H02A 5M3MB 3ZYYX 1C4QA 3VYUA 2UUCQ 5C44B 1NBWA 4B3SL 3QR8A 1FR3A 3GQBA 1HHVA 4BY7H 1LTLA 1S5ED 2A68C 5C4HA 1B8AA 1II3A 2NTSA 2R6GA 4O2DA 3KJPA 2EZVA 2EY5A 1D6EC 1SDFA 2LKVA 3RLOA 3AU7A 1CKMA 1I6VC 2LMCB 3NEMA 1HUMA 2KHIA 3UDIA 4JG2A 1PRTD 5EKLA 1ET6A 4F7XA 1KDCA 1O7IA 4LF9Q 3EJIA 2R7ZH 3EIVA 1VQEA 2PZWA 1J8IA 3X3NA 4ID6A 5M3FG 2AQ1B 4B9XA 1CM9A 1Q1EA 1RKNA 4HJ8A 1BKBA 2L9HA 3T51B 1G291 4BS9A 1IYUA 4A3KH 2NVTB 4LMQD 3EFXD 2Z1CA 4KY7A 3CCEA 4A3MH 3I4MB 1EYCA 3NWSA 4HJ7A 1JE4A 4RCNA 5HY6A 4PNYA 4B3RL 2F52A 2IL8A 2ALYB 3J80c 1TS3A 2B2TC 4KN7C 4DV6L 1JQYD 4DAYA 4KJNA 3SHLA 4J6HA 1HFGA 3P1HA 5D3IB 3G48A 1TWCB 2KEEA 1LTID 1TWAB 1CKOA 2VNUD 3TN2A 4F8MA 2F1MA 5CGKA 2N49A 3C1FA 2XWBB 2HDLA 3Q0AA 1STEA 4C3HB 4DR7Q 2OTJA 3KLRA 4ME3A 2F3WA 4IZ8A 2CWAA 1H9RA 2K7VA 2JK8A 1JE5A 2R7ZB 4ZCKA 4FF2A 3G71A 1GOZA 2EJMA 4DK0A 1NUCA 1CT1D 2L15A 4U673 2WB1G 4CKEA 4AH6A 3C3LA 1YZ6A 1V1QA 4OWTB 4WJ4A 1BR9A 4IN3A 4I7ZC 3FKIH 4IPCA 2MO1A 1AZQA 3NQIA 1JORA 3H0GB 1CKNA 4C3JG 1VQLA 1HJPA 4NXMQ 4ZUJA 2PO4A 3D31A 3SDZA 4BY7G 1PTOF 2PI2A 1CTMA 1SE3A 4DR4Q 1ONLA 2F0OA 2O2LD 3NBHA 4L5RC 4PMCA 2EYPA 1PLFA 1I94Q 1LLRD 1LTGD 1EZ6A 1IZ6A 4XT1B 3CPWA 1UEBA 2WIIB 2F0PA 3KBXA 3OYYA 5FO8B 4KD4A 5LMUQ 3SGIA 3I55A 1CQFA 3CRLC 4NB3A 2DNCA 3I2ZA 4CGYB 2IW3A 1NMGA 4RAUC 1CA6A 4RHSA 1A6XA 5F2DA 1JWUD 2RDFA 1ZYRC 3NSWA 3RMHA 1XNQQ 2LS01 3S9WA 2ZTCA 3S17H 5KNCA 5FLMG 1SRUA 4MN3A 1LACA 3VR5A 4X65Q 2HUGA 1MJCA 2MUYA 1I3QH 4AYBE 1XNRQ 1WOCA 3HOUH 1S40A 4XTCS 2IX3A 4BBRB 1LABA 4CKBA 5LMNW 3ONAB 2FINB 1IL2A 1M4VA 3OWEB 1CQVA 2AQ2B 5KNBA 3S1RH 2RBMA 5ELEA 5IP9H 4K2KA 2EPBA 3GTQH 4LW1A 3J7AF 3P75A 5K5PA 4FDBA 4C2MB 4WFN3 3Q23A 2PCFB 1S4ZA 1ENCA 1PYBA 4K8IA 2IPKD 4EQOA 1KNEA 1MIUA 4AYBB 1UE5A 1XWEA 3BS1A 1IKLA 2K5QA 4DF7A 4GNXC 2D5DA 4IUQA 2C35B 3PO2B 1NCVA 1X3EA 4LFCQ 4C3JB 2I5HA 2Z6BA 1A2UA 3BDOA 2JA6G 1GO3E 2PW7A 3NBHB 3H09A 4JPBW 3N52A 2NTTA 3MEHA 1M8AA 5COYA 5IWAL 4K5XA 1SYBA 3CC7A 1OXTA 5C3WA 4C1NK 3CW2C 3DMUA 1L1OB 3G6EA 1EY4A 1QOHA 3WOFA 1Q7YC 4K0KL 1PZJD 5E7NA 2IX0A 2R7ZG 1FJGQ 4JI6Q 1N34Q 5KNDA 2YTYA 3ERSX 1OXSC 2V4DA 3NQTA 3J80L 1JOKA 2L11A 1HNZQ 1FVIA 4P75A 2JE6I 4DR6Q 2F0TA 4HIMA 3IAYA 4DV3Q 5JJKA 5C4XG 2Z9HA 1B2TA 4DR6L 1GUNA 5IGBA 1CHQD 1B9NA 1X3FA 4JI8Q 1W6JA 1HPCA 2ID0A 1CSQA 4HR7B 4KLKA 1ICFB 1IHZA 1QCBD 1XPRA 4OHJA 1UUPA 2ZXOA 1PH3A 2EYHA 2ZJPA 3RN2A 1MGSA 3GO5A 2KJXA 3A7AB 4P73A 1G6PA 4YWMA 1TS5A 4FXDA 5JOBA 3GTOH 5JPNC 1HR0Q 1VMPA 1Q81C 3GD7A 1B7YB 3TEHB 3MFYA 4KV6A 2PQAB 2RVLA 1F9PA 4A3JH 4A3LH 1VCIA 1BDOA 3RZDB 4K5VA 1GUTA 5ELBA 5T1GA 4QB4A 4H0LC 1PTOC 3Q6SA 4QIWB 1EQRA 3SK8A 5GAHC 4JI0Q 1U0LA 3E0EA 5JVH3 3CCQA 4GN5A 3ND9A 1DZ1A 5C5LA 3PO3B 5JAVA 3HOWB 1VF5C 3JAMc 1FYCA 2NUCA 5CC4A 2E2IB 1F2ZA 1FGUA 1Z9FA 3T1YQ 2ZXPA 2O5IC 1D7QA 1STYA 3T1YL 1A63A 1EYDA 4XQQA 1EYAA 4DUYQ 1PH1A 5D65A 1J5EL 2CQAA 1K0RA 3TS2A 2EYOA 2Z6KA 1MHWC 2E2HB 5H1SE 4HMIA 2G9HD 3U4VA 5EPJA 3A8IE 2HCCA 1F2MA 1VQ6A 5M5YB 4V0BA 4DFAA 2Y0SB 4IOCA 4PMWA 1F9SA 1G91A 4JYAQ 1NY4A 2CFMA 5EPKA 1X3GA 1PFBA 5CBAE 2BA0A 2ASBA 3UI2A 5J1ZA 1W3SA 1Y69U 1GVPA 3DWAA 1ENFA 4DNTB 1SMYD 3CCVA 2EJFC 2IHFA 3BDCA 1EOTA 3CCMA 1T9HA 1I5FA 1QG7A 4O0AA 4OELB 1E24A 1PHJA 1Y1VB 1IBKQ 3P20A 1LT5D 1MJEA 2N55A 4WJWA 3HKSA 2F0JA 5IT9c 4NXNL 2K01A 2E2JB 2FJ2A 4OWWB 1PTOD 3A5ZB 1F2YA 3FMCA 2YTXA 4YIJA 1PYWD 5EKKA 2JA6B 4A93G 5FLMH 1VQIA 1ZYRD 4B08A 2SNSA 2F0QA 4UP9A 3PO2G 1F77A 4A3EB 2EVBA 4Y7NH 5CV4A 2E2IH 1FNVA 2HIXA 1Y1VG 3OOCA 4LJZC 2M00A 5CYUA 5LMUL 1AH9A 4RH6A 4JOIA 1AFPA 4DR5Q 3W5OA 3KFUA 3SEBA 5M5YH 1QNKA 4C3IG 1MBYA 3PV0A 3RN5A 1EWHA 1CK1A 5D14A 2Y0SG 3PCOB 3NENA 2B2WC 3VYRA 2IHEA 5FLXE 2RDGA 1EEFD 2CW0C 2BDOA 1SROA 4J1MA 4QF4A 4DPGA 4DXGA 3K8AA 1D5ZC 1SSOA 5GADC 1QVCA 1STBA 3PQIA 1YJNA 2FHTA 4IUUA 3GTJH 1C7YA 2ATWA 2KA7A 3U9OA 4MIUA 3M4OH 3CCLA 2XGTA 2MFIA 2NVXB 4GOPC 5EBDA 3LGJA 3AFPA 5EQ0A 2A6HC 2BH8A 4OIKA 3HOUG 1R9TH 3HOYG 4XYOA 1MD2D 4GN3B 4KY6A 5I6YA 3EN2A 1WYDA 3FKIB 1B4OA 1KQSA 5DNFA 1C8CA 5IYDH 1AE3A 1X56A 3K6OA 2QEXA 1JWMD 1Q12A 4G7ZC 1WTOA 1IBMQ 1WTHA 2F0EA 5IGEA 4HAEA 5M3FB 4YY3L 2VQFQ 4A3DH 3I90A 4LUOA 4QL5A 2B2VA 4DR3L 1G6ZA 1XMQQ 4YY3Q 1S5FD 2VQFL 4A3FG 2VUMG 3R93A 2XN9C 3TREA 4DV0Q 3CKIB 5IP7G 4AIMA 4H7BA 2B3GA 5T1IA 2RHQB 3R2TA 4JBJA 2VW9A 1M1KC 3VR4A 2KBNA 2WV6D 5FJ8G 1V43A 1IL8A 2B2TA 5M9OA 4HIKA 3U9SA 1I4HA 1IW7D 3A7LA 3SXHA 1VQMA 2J0TD 1YNXA 3KLSX 3W1GA 5BN5A 2F0VA 4MZ9A 4GOPB 4NMZA 4C3JH 4J15A 3T16A 1GUWA 4F88A 2K5DA 5ELOA 3DXJC 1Y8OB 2MPMA 1EZ8A 2K50A 3K81C 4QIWE 1GM5A 4K0KQ 3MC0B 4DNIA 2PMZB 2VS1A 3K57A 1VQDA 4RFBA 1EYGA 3WWVA 3CD6A 2L12A 1LO5D 4L5SA 2TMPA 3SK6A 2ZJQA 1PFNA 1KDBA 1TXYA 1I4PA 2LSSA 3T56B 5I2XA 1ESFA 3C46A 2KEDA 2E2DC 1Z7TA 4RGNA 2K5NA 1TKWB 1EY0A 4HIDA 1E1OA 2PQAA 1N32Q 1HCZA 2G9DA 2F0UA 2OT2A 1YJ9A 3KF8B 3TDQA 2QF7A 1Q46A 3STBC 3GDEA 3WOEA 1ASZA 2OTLA 2NBFA 3QB3A 4B3SQ 3K0XA 3MXGA 4A3FB 4DXFA 4LF7L 1VQOA 2ZXRA 1KDAA 2ICEC 1UWVA 3M7GA 4TVAB 1VQ4A 3FRPB 1LT3D 2DUDA 5JVG3 3MAQA 3CCUA 3NE5B 1DM0B 1K83H 1UEAB 2R7FA 2UU9Q 2M2LA 3FVQA 5CV7A 4GOPA 2R61A 2YTVA 5ELNA 1L2FA 1AW7A 2I0QA 3J7AV 5D3DA 3RZDH 3LWEA 2UUAL 1D1KA 3NTKA 1N8RC 4HJ9A 3KYHC 3OTOL 2VQEL 5DM73 3HOYH 3CP0A 5AFWA 4CDFC 1SXTA 2F4IA 3OTOQ 3D8GA 4FXKC 3HP3A 2YU9H 2UXBL 2NVXH 2XWJB 1PH2A 1NSNS 2RKSA 1JJCB 3X3MA 5C0XG 1PDQA 3A56A 1FGBD 4DUYL 5NUCA 1GHKA 1Y1WH 2F0LA 1ZXTA 2RCNA 3G4SA 1WTWA 3PIPA 2NN6H 5M5WH 3DLLA 3ICEA 1IBLQ 5G3LF 4IFDI 4RMFA 4NDXA 3BYTB 4DR1L 1K3BC 4MHEA 3DEOA 1IBLL 1SE2A 4DUZQ 1YIJA 2OWOA 5HGQA 4RKLA 3QO2A 2AUKA 3S2DB 4ODGA 1O80A 2MO0A 5E4WC 3IFDA 4XDXA 4IUPA 4IUTA 1RL2A 2JYOA 1AE2A 3K7UC 2A69C 2KCTA 1HNXL 1B9MA 1QVFA 3I7FA 2KQ3A 1OTCA 4FO2A 2FFKB 1VQFA 4B3TL 1BUVT 3D4DA 3E6ZX 1T5EA 5IT9E 1IBKL 5JEAH 3CCRA 2ZT9C 1SNDA 1LTAD 2NN6G 4WORA 1GKHA 3T4AC 4NXNQ 1RHPA 3PIP3 2B2UC 2HT1A 5LL6S 2VZAA 4DK3C 1WTPA 4I65A 3S2HB 3BZCA 2MQHA 2KHSA 3S1QB 3I4LA 5IYDG 4PV1C 1Z47A 2JA7G 4A75A 1VQCA 1X6OA 2A5HA 4YWLA 1WTQA 2HIVA 1A15A 2MJ8A 1CZGA 4A3EH 3UE0A 4DAVA 1LT4D 1Y1WB 1KXLA 3NK9A 1KNAA 1UNSA 4QY7A 2VL6A 4R4OA 1QVGA 3QJYA 3K59A 2LXKA 4TSSA 3J81L 2CVRA 4CDDC 2D9UA 3M4YA 4POGA 1L0WA 4BXXG 1DJRD 2ZM6L 1YNJD 4KJOA 1H9SA 3HOXB 4HCSA 3ER0A 3HFZB 2E2HH 2NYZD 2LY7A 1TWFH 1PA6A 2K75A 4X64Q 1ENAA 1SNCA 1VMCA 3SE0A 4A76A 2K5VA 2ICIA 4EGVA 1IXRA 3JC66 4GNXA 3GTJB 1K83B 4PMBA 1E3PA 3GV6A 4N9PA 1VQPA 1TU2B 3MWYW 1G2SA 5I2YA 4DV1L 3S1NB 4P71A 4RGOS 5JJZA 4QJFA 2R92H 1FL0A 2BE5D 1EY6A 4X3UA 3E9IA 5C3EB 1KRTA 5KYIA 4CJ1B 3OIPA 1BOSA 4C2MH 2F4VQ 1JR0D 2Z4IA 3CMAA 3AYHB 4JI5L 1DCZA 3CXCA 1IBML 1D2BA 3FKIG 2Z6KC 4N9TA 2QEJC 4OL7A 1MKHA 3G6JB 2K6AA 4FP5D 4DR3Q 4JW0A 4QUCA 1ET9A 1JB7A 1HA5A 5ELFA 3SR1A 4QQBX 1VQBA 3JAME 1HXYD 1HFNA 1PH9A 1JWSD 1PTOH 1YJWA 4ZRZA 2I5MX 1DOKA 4OX9L 2CCZA 1U5KA 2OEOA 1XXGA 3BU2A 1UAPA 1U4RA 1AN8A 2VB3X 1SYDA 4UPAA 4IFDH 1I50H 2NN6I 1N36L 2XRSD 4JI1Q 1V1PB 3D0FA 1Y8PB 3K58A 4DR2Q 1JCKB 4EQ5A 3S15B 1N36Q 5IYCH 1VQKA 3H3VI 4KY5A 4LF4L 3E0JA 3I4OA 4CJ2C 2R92B 3MXPA 4OGQC 5FLXL 4JBMA 4X62L 1PFMA 3FEWX 4S3SA 2K28A 3LWUA 1KAAA 3NTHA 4K8JA 2A1AA 1N34L 1G2TA 5LL6X 2XRQD 3F8TA 4GKKQ 2MP1A 1VQ8A 4TRDA 4HEDA 5M5WB 4IALA 1B44D 2CH4A 1YITA 2RQXA 5IYBH 2I5LX 1U4PA 4OONA 3VDYA 1DYQA 4GNXB 3J81i 3RUZA 3S1RB 2X6LA 3K80C 2RCFA 3NUCA 4LF8L 1RJTA 4FF4A 2VB2X 4I7AA 2KCCA 1PFSA 1TWHH 4EVOA 3OW2A 4LF7Q 2UUCL 4A3BH 2Z8LA 5IGFA 3QOJA 5IY0A 5IYCG 4LFBQ 5IGDA 2YYZA 3TBIB 3G7LA 1TWHB 3ITPA 4YCVA 3E3XA 1A2TA 3HOVB 4UP8A 2PNRC 4X66Q 4N8X1 1EWIA 4B3MQ 3PUZA 1WFQA 4GZYC 4X66L 3BDLA 2PPBC 4L5QA 1A3TA 4XXEA 2O5JC 1NE3A 1QNUA 2EDGA 1D8LA 1A0IA 2VQEQ 1QILA 3BVZA 2P5ZX 3NHHA 4WRDA 1FNWA 3NPPA 1LM0A 2KUMA 3A8JE 3JAMi 2LFNA 2L4NA 1EL0A 1X32A 1YBYA 1K3RA 4A3BG 3S14B 1N33L 3DHQA 1EQTA 2LXJA 5C4JH 2IT1A 4RG1A 2SEBD 3VYSA 4LF6Q 4HCEA 1SMYC 2NB0A 4Y7NB 4OWXB 3VR2A 5M3MH 4DR1Q 2F0DA 3ULJA 2A68D 2J4XA 3CHBD 3NXWA 3T1HQ 1BCPB 4LUVA 4A3FH 4DUZL 4LNQA 3D4WA 5IODA 4M1UB 4E6IA 1U4MA 2M9VA 3KLWA 1L1OC 4MNOA 3HOVG 2JEBI 1UE1A 3J81E 1HUNA 1R4PB 1V9PA 4MTNA 2DN8A 1PZKD 1BBWA 2A19A 1HQRD 5CORA 1DOMA 1O78A 2JP1A 5KEEA 2ENBA 2CH4W 1A8VA 3BVMA 4DV2L 4DV7Q 4DN4M 3ULPA 4A3EG 5M5XH 2QW7A 5IOCA 1EU4A 2BA1A 1Z6HA 4JOIC 3MXUA 4BY7B 5DM63 4CDCC 1J9OA 2E5LL 2WAQB 3HOZB 1EFID 3HG9A 1O7ZA 2EIFA 1YEZA 3Q8DA 2E5LQ 1K8GA 4BY1G 1PH4A 3TZUA 2CHBD 1RTNA 1QB5D 2PZUA 1SYFA 1K8MA 3AQQA 2H5XA 1PH7A 5GROA 1WD1A 4HTHA 1F9RA 3CCSA 4G4KA 5K36H 1DD2A 2CWPA 4RWSC 5DLQE 2R92G 1JOQA 4ZKCB 3F2DA 2B2VC 2V1CC 1I4QA 3AMUA 3KF8A 5ELCA 5EJWA 3SVMA 1L1OA 3C2PA 2RHSB 2A73B 4DV5L 2NVQH 1P16A 2JXMB 5DAUA 1WTVA 3CC2A 5C0XI 2L0CA 1SE4A 4BY1B 4C1NI 4LF5Q 1HZBA 3BVGA 1EWCA 4R8NA 1ML0D 5I9PA 4AQYQ 2DJFC 3KUPA 4A3IH 3GP7A 2EXZA 4IUNA 2J7ZA 4A3KG 5CR3A 2R7DA 5C0XJ 4KD3A 4Q0FA 5IE8A 3A5UA 2Q2UA 1DONA 3K5LA 5K36G 3NELA 1KD1C 1WJJA 4L6TB 4BXXH 5IT9L 1NR4A 3HOWG 5JJLA 4FYDA 1K0SA 3TP6A 1OXXK 4IPGA 1NTGA 1OO9B 1OXUA 1UE7A 3AB9A 1BCPF 1JJ2A 3S17B 2C5CA 4AYBG 3DWQA 3FPPA 3C1EA 2F4VL 2OQ0A 4LF9L 3GTPH 3TP7A 1E1TA 4JI5Q 2N88A 3UDXA 2R93B 1SNOA 1S5BD 1K8OA 5E1FA 2FXQA 3F2CA 4R4IA 1JT8A 1XPUA 4DK1A 2JA8G 3CRKC 4LWCA 4HSVA 4YWKA 5JPMC 2H4OA 4EQPA 1GD7A 1Q1BA 3A8KE 1R4QB 4TKOB 1BO0A 1X3QA 3M4QA 3PO2H 2GN5A 4A3KB 2NVTH 5CV9A 1EFWA 1EQQA 1GXDC 5J39A 4A3MB 3I4MH 1VQAA 2A69D 1WVLA 2EOTA 3IFTA 3CMEA 2B63B 2DY7A 2F0HA 1PV4A 4A3GH 2JA7B 1STNA 1BQQT 4DR2L 2VXWA 3F2UA 1LTTD 3HOXH 4GS3A 2A74C 4A3CG 4F87A 1QE6A 1YNJC 1ILQA 4DR7L 1Y8NB 2XTIA 2QILA 3BJUA 2KCMA 1YNNC 4MTKA 5TSSA 4J8QA 4JI3Q 3MZ5A 3S15H 3STBD 1EY9A 1EIYB 4JI6L 3A0JA 4JI3L 2ZTDA 3H6MA 4KK7A 3TSSA 4DV3L 2KCNA 1N32L 3H15A 1YVCA 2NZ1D 1JB3A 2TSSA 2KENA 4G7HC 4LF8Q 4JI8L 4IUVA 4LUZA 3GTMB 5HURA 1HTLD 1T5XD 4LAAA 2AHOB 1HH2P 4JI4L 5M3FH 1PXUA 4R9WA 3GTLH 4LFBL 1A3VA 4R4QA 1PTOB 1CUKA 2Q8IB 3F2BA 4JI4Q 2D0OA 1PMRA 3MEFA 1SNMA 4JBKA 3CQZB 1JOOA 3RD4A 2WACA 3EROA 2F0WA 3BZKA 3M85A 1QUQA 1NMFA 5AJ3L 1JC7A 2AMCB 4UY8C 3U4ZA 1G51A 1E2WA 4Y52H 1TQOA 4C3HG 4PQXA 5AJ3Q 1EIHA 3HOVH 3N6RA 1HNWQ 5EAYA 4JC0A 2VUMB 3URYA 3GV3A 4FXGC 3M9BA 3VR6A 1X9NA 4LK1C 4JI0L 4ZQ3A 1PVOA 3RZOH 4A3MG 1XNQL 4HIOA 2EE1A 3D4RA 4JI7Q 1CI3M 4NKLA 3HGBA 1L0YB 2EXDA 4X65L 1V8QA 2KVMA 2JSOA 3S14H 1VQHA 2KOLA 1HZCA 3I4MG 1ESRA 3S24A 4CKCA 3J80E 4LF6L 1RF2D 3U58A 4FNFA 1SNQA 2YV5A 1KC8C 1R9TB 3OSOA 3DWPA 2Q2HA 2C9OA 3H94A 3T1HL 1K73C 4IFDJ 1SBBB 3V05A 3TRZA 2EY1A 2F0FA 4DAMA 2R93G 1KIXA 2F0IA 2L55A 1PH6A 1IYVA 2PI2E 3MXNB 3MA2B 1YI2A 1HR0W 2EYLA 3EBEA 1E2VA 3GTGH 1JICA 3DM3A 3IL8A 4DV2Q 2R3ZA 1QZGA 4JYAL 5EKIA 1MI2A 1VQNA 1N9WA 4PZ7A 3BZDB 2E76C 5LMNQ 4CJ0B 3MFGA 3OIQA 1B53A 1E2ZA 5E4XA 1SR3A 3HOZH 3V2TA 3I3CA 3I8ZA 4FVMA 3VYTA 1W2BA 5KIXA 1O7YA 3D3RA 3PUXA 1S72A 4YCWA 3FHWA 4A3JB 3Q24A 3D6WA 1CKNB 2VUMH 3D6CA 2QA4A 2AUJD 3CPFA 3I91A 4ZYSA 1EY5A 1X3PA 5ELDA 1RIPA 5CV5A 1A62A 1QUQB 4GLXA 2EYMA 1VQ9A 4R1JA 2UXDQ 2Q2IA 2WFWA 4KMUC 4APVA 1EUJA 1UE6A 3J81c 2UXDL 3PF5A 4DV4L 2QDLA 2WAQG 3FPUB 5C4JB 1FJGL 3M3YB 4KKUA 3M7NA 3MHBA 2BOSA 2WINB 4K6DA 3M3YH 1XMOL 4DR5L 3J80i 1HNZL 4G57A 4A3IB 4ZAIA 2XSCA 4ME5A 1Q8IA 1EQVA 2OXPA 1O7LA 3K5OA 2FMMA 2K05A 1Q82C 3L9AX 1LUZA 1QZHA 2PMZE 1AEXA 1U9RA 2F0MA 1GUSA 1W6KA 2DGYA 2MHVA 2DY8A 1BCPD 4X64L 3KLSA 5I6WA 1GJXA 2EY6A 4GN4B 3O13A 1Y14B 1FNUA 4ZLTF 3RLFA 4G7OC 1GUGA 2Q8RE 4IOAA 3MXNA 1A3UA 2K33A 3R2IA 3T53B 4L8JA 4POFA 4B9WA 1EIGA 3LNNA 2E74C 3OMGA 3K5MA 2R93H 3I70A 4H44C 1Y1VH 1H9SB 3HOWH 4JV5L 3TS0A 5IIFA 1PRTF 5LHY1 3GTMH 2OF1A 3H3VC 2B8GA 5G3LD 4JV5Q 1XTDA 2JA8B 4WJ3M 4HN7A 4DAYB 4JI2L 1D1IA 2X6GA 4A3DB 3PO3G 5IP7H 1LTBD 3H0GH 4KHZA 2HHHQ 1KL9A 3TMEA 3PGZA 1BXTA 1ZEQX 2WAQE 3QIAA 4JI2Q 1E22A 1Q90A 3R3OA 3U50C 5JEAG 1TWGB 1JMCA 2NVYB 4A4IA 2N8NA 5I4DA 3HOXG 3BG3A 1B50A 1X65A 5KRUA 4DV0L 3EQLC 5C44G 2CQOA 3SK5A 4XT3B 5CMDA 1NR2A 2QGQA 1L0XB 4ZK9B 4X3TA 4CHTB 1J5EQ 2HQLA 4NW2A 1WI5A 4OO1G 4PG3A 4DV6Q 2JA5B 1BCPC 2JA7H 1SMXA 5C4ZA 2WP8J 5IGCA 1Y1WG 3FDTA 3OMCA 2A8VA 4RKBA 4X3KA 3CU7A 2VY3A 1OXVA 2JA9A 4EQNA 1NJIC 1D5MC 4XYQA 1C48A 1TY2A 4JCVE 1PYSB 3I4NG 4R4TA 4R4CA 2RA4A 4Z9CB 4U68A 4EX5A 2PW5A 5A2QE 3LX0A 3PIOA 4K5WA 1XTCD 4KKSA 3CC4A 3QG1A 4IJLA 1XPOA 3WDNA 1IW7C 4YHHQ 2N3SA 4KN4C 4XQJA 1ILPA 2OCEA 2D2CC 5FJ8H 5KYLA 1LTSD 3HKZB 1E0BA 4ZKBB 1CA5A 3S1MH 1XX8A 1CHPD 4DR4L 2B29A 5GAGC 3PUYA 1I94L 1RDPD 4DAPA 4A3JG 4ZUIA 4ILWA 1PRTC 3FP9A 4A93H 2SOBA 1SEBD 2K4KA 2Z0SA 2RSOA 1XYIA 1WCMH 2B2WA 3KF6A 2EYJA 1YNND 3HOZG 3PUWA 2K1BA 2G5DA 5FO9B 5I9OA 3CCJA 4A3GB 4DGZA 5ISRA 2F3VA 1HNWL 1SYGA 2HCIA 1I50B 3E9HA 3PUVA 2JA5H 3PMFA 3DM1A 4HSPA 4KKTA 1BNZA 5C0XH 4JI7L 2B2YA 3I72A 3I73A 1SAPA 4FF3A 2OQKA 1EOVA 2B39A 1XNRL 5BR8Q 4GKJQ 2DJGC 2XIWA 3NP8A 5L37A 2GA4B 1S3OA 5BR8L 4O1NA 3HOYB 4OXPA 4OIJA 5FKAC 1IYJB 1I6HH 2E75C 1SLJA 3W1BA 1H9KA 5IYBG 1DXMA 1V1OA 1B3QA 1K8AC 4IPDA 2DNEA 1QWYA 2F0SA 1RTOA 3M4PA 3MVVA 1I6HB 5M3MG 3JAML 3HEJA 1STGA 4CBVA 2JEAI 3GTGB 1QJOA 2GVAA 4DV7L 4QUFA 5IGGA 4RGMA 1Q8KA 3SK4A 5LMNL 3L7ZC 4JVZA 2Z4HA 5C4XB 1TS4A 2Y0SE 5FLXc 1KRSA 4OEMB 1GHJA 1SJED 1ASYA 1H9MA 4B3TQ 2FMCA 3GTOB 2CW0D 1EY7A 2SNMA 1LT6D 3S16H 3PIO3 1WTRA 2IX1A 3OPOA 5BN4A 4LFCL 1HZAA 5E3FA 1IKMA 1U4LA 5IWAQ 2UUBL 1X55A 4C3IB 4FF1A 5IP9G 2A6HD 4UDUC 1I3QB 1X54A 2UUBQ 4IO9A 1KLUD 4DV4Q 1TWGH 1C9OA 1EU3A 4IQZA 4K2LA 3P7JA 5J22A 2B2UA 2L5TA 4UHVA 4BA1I 1BVSA 4KHPQ 4DU9A 3EA6A 4L63B 4IPHA 2D0PA 4KHPL 2H1EA 4GLVB 5A35A 4YCUA 2WB1E 4LF5L 2WB1B 2JA5G 2Q8TA 1E7ZA 4OO1H 1F9QA 2JN4A 2K5HA 3A74A 4DNRB 5HGTA 5C4XH 3VA5A 4KHVA 3OWFA 2IJ0A 3NTIA 1PRTB 1H9JA 1FD7D 1V1PA 1VDZA 2K03A 2E8GA 3PSIA 1TS2A 1I4XA 5C44H 1YHAA 4ALPA 2NZHA 5JEAJ 2IWHA 3ZJYC 3J7A5 3RLNA 3K7AB 1EY8A 1JJGA 1MSGA 3UDGA 2B8FA 3TQYA 4C3HH 4OO1I 5EBCA 4LFAL 2NZOA 2QCPX 1RCVD 3TP8A 3S2DH 1C0AA 4LFAQ 2A6EC 4NP5A 3VA7A 1VF7A 4V190 4DV1Q 1HR0L 1VS0A 4K6LA 4IURA 3TZDA 4BBRG 1WD0A 3K0YA 2F0NA 2UU9L 3S1NH 2E2JH 2RSNA 4UAIA 3S1QH 2KHJA 2ZJRA 3ERQA 4R8IA 2CKZB 3RZOB 1MSHA 2I07B 2UUAQ 3HKZE 1TY0A 2F0GA 1WTXA 1NNXA 4NPSA 2JA8H 3I4NH 4DA2A 2HHHL 2ES2A 1LTRD 4H13C 3EVQA 3GTQB 2NVQB 2K5WA 1PH8A 2UXBQ 2RF4A 3K5NA 1SJHD 2NVYH 3KBGA 2PQEA 4Q5VA 1Q3LA 3H3VH 2PZTA 4GLAC 1WCMG 1B70B 4CDEC 3KK7A 4B3RQ 3PF4A 4XQNA 4P72A 4QGUA 1KAWA 2B63H 1D5XC 3V96A 3ND8A 1J6QA 4QMGA 3H91A 5C5MA 4IJHA 4M8AA 2EYFA 4A3IG 1SN8A 4RA8A 1HRJA 2HQEA 3K7AH 4UP7A 4TQUS 1VQ5A 3AFQA 1SNPA 3RNUA 4A3GG 1TWCH 2A6ED 1XJVA 5KGUA 2PYKA 3QOLA 1HNXQ 3DUZA 3UDFA 4QCLA 3GTPB 2N78A 2QKIC 4GKKL 1YHBA 3S2HH 2BDNA 2NWGA 4HJ5A 2HDMA 3A54A 3DEPA 3GTKH 4RHRA 3KDFA 3KF6B 2ZTEA 4YHHL 3HKZG 4PZ6A 1CZWA 3UE1A 4DK6C 2AWOA 3IRBA 2L1BA 4RCOA 2KECA 5C3EH 2AWNA 4BBSH 4RGTA 2Q2TA 2UXCQ 3L0OA 3L3OC 5BN3A 4NXML 2JQOA 2UXCL
chains in the Genus database with same CATH topology
4HJAA 4QQBX 3CPFA 5GAEC 1VQBA 1EQRA 5GAHC 3CF5A 1PH9A 1RIPA 4BY1H 4B3ML 4JI0Q 1A62A 1QUQB 1U0LA 3E0EA 4GLXA 3CCQA 1YJWA 1VQ9A 2I5MX 4R1JA 2UXDQ 4GN5A 2Q2IA 4OX9L 2CCZA 1U5KA 4IFDG 2WFWA 4APVA 2IY5B 3BU2A 1EUJA 3JAMc 1SFOH 3AEVA 1UE6A 3J81c 2UXDL 5GQOA 1FGUA 4DV4L 1VQJA 3PF5A 4UPAA 2WAQG 1Z9FA 1I50H 1EIFA 2NN6I 3T1YQ 1N36L 4JI1Q 3D0FA 2ZM6Q 1FJGL 3M7NA 1M90C 4DR2Q 3M3YH 1D7QA 4EQ5A 1XMOL 1TWAH 3T1YL 3J81j 1A63A 1N36Q 5IYCH 1VQKA 4DR5L 3H3VI 3J80i 1HNZL 4LF4L 4DUYQ 1SE8A 3I4OA 5C3EG 1PH1A 4X6AH 2EQSA 5J3BA 1J5EL 1P8LA 4JBMA 1K0RA 4PZ8A 4X62L 3TS2A 1Q82C 4GKJL 4A3LG 2K52A 2F3IA 1H95A 2Z6KA 2A1AA 5JJIA 1LUZA 3ULLA 5H1SE 1QZHA 1N34L 2PMZE 3U4VA 1BBUA 1N33Q 4KI0A 3F8TA 1K9MC 4GKKQ 3KDFB 1VQ8A 2DGYA 4X64L 1VQ6A 4IOCA 4PMWA 3CAMA 4JYAQ 1NY4A 2CFMA 1YITA 1X3GA 5IYBH 1DGSA 4GN4B 1Y14B 2I5LX 2GVBA 2BA0A 4P74A 2ASBA 4XIGS 2PNHA 4OONA 3RLFA 3KJOA 3J81i 4GNXB 3VDYA 2BH2A 4A3DG 1W3SA 1GVPA 3K80C 4LF8L 3CCVA 4IOAA 4POFA 3I56A 2IHFA 3CCMA 1T9HA 1KHIA 1PFSA 1TWHH 3OW2A 1I5FA 4LF7Q 2UUCL 4A3BH 4O0AA 2R93H 1E24A 1PHJA 1PH5A 5IY0A 5IYCG 1IBKQ 4LFBQ 1Y1VH 3J7ZC 1MJEA 3HOWH 4JV5L 3F1ZA 2YYZA 3TS0A 3HKSA 3L2PA 3GTMH 5IT9c 4NXNL 1XMQL 1YHQA 4JBWA 4YCVA 4JV5Q 1XTDA 3KOJA 4UP8A 4OWWB 3A5ZB 4X66Q 4WJ3M 1EWIA 3B6YA 4B3MQ 2YTXA 4DAYB 4JI2L 3PO3G 3CQZH 3PUZA 5IP7H 1WFQA 5FLMH 2MNAA 1LYLA 1VQIA 3H0GH 4KHZA 4X66L 1KL9A 2HHHQ 3PGZA 4OX9Q 2WAQE 4JI2Q 1E22A 4L5QA 3U50C 4UP9A 5JEAG 3PO2G 1NE3A 1JMCA 2AKWB 4A4IA 2N8NA 1D8LA 4Y7NH 3HOXG 2E2IH 1A0IA 4JI1L 2HIXA 1Y1VG 1X65A 2VQEQ 4DV0L 4BBSG 5C44G 1HZ9A 5LMUL 4DKAC 1AH9A 2CQOA 4JOIA 4DR5Q 4LF4Q 2QGQA 1LM0A 3W5OA 3KFUA 2D62A 5M5YH 3JAMi 1J5EQ 2K14A 2HQLA 4BBRH 4X62Q 1WI5A 3H0GG 4OO1G 4PG3A 1YBYA 1K3RA 4DV6Q 3PO3H 4A3BG 2JA6H 4C3IH 2JJQA 3PV0A 2JA7H 1CSPA 4L5TA 1SMXA 3RN5A 1VQ7A 1N33L 2WP8J 2LXJA 1XMOQ 1Y1WG 2Y0SG 1Q86C 3PCOB 4DV5Q 4A93G 5C4JH 2IT1A 3NENA 4RG1A 2A8VA 4LF6Q 4BA2I 2IHEA 4OWXB 2VY3A 1OXVA 1VQGA 5M3MH 4DR1Q 2JA9A 3ULJA 1NJIC 1SROA 3T1HQ 4LUVA 4A3FH 4DPGA 4DUZL 4LNQA 4JCVE 4AQYL 2B63G 1PYSB 4A3CH 3HOVG 3KLWA 1L1OC 3K8AA 4MNOA 2JEBI 3I4NG 1UE1A 3RR5A 4H02A 4R4CA 4R4TA 5GADC 1QVCA 1YJNA 3GTJH 1C7YA 2ATWA 1V9PA 4MTNA 4EX5A 3M4OH 3CCLA 1BBWA 2MFIA 2A19A 2XGTA 2UUCQ 3PIOA 1NBWA 4GOPC 4B3SL 3LGJA 3AFPA 1A8VA 4DV2L 2BH8A 4DV7Q 3CC4A 3HOUG 1R9TH 4IJLA 3ULPA 4A3EG 1XPOA 3HOYG 4GN3B 5M5XH 3EN2A 2BA1A 1WYDA 4BY7H 4JOIC 1LTLA 1B8AA 4YHHQ 2N3SA 2R6GA 2E5LL 4O2DA 1KQSA 3KJPA 5IYDH 1AE3A 2OCEA 1X56A 2EIFA 1YEZA 1Q12A 3Q8DA 3RLOA 5FJ8H 2QEXA 1IBMQ 1CKMA 2E5LQ 3NEMA 2KHIA 1K8GA 3UDIA 4JG2A 4BY1G 1PH4A 3S1MH 4YY3L 2VQFQ 4A3DH 4LUOA 1O7IA 4LF9Q 4DR4L 4QL5A 4DR3L 2R7ZH 2B29A 3AQQA 3EIVA 1XMQQ 2H5XA 4YY3Q 2VQFL 4A3FG 1VQEA 5GAGC 3PUYA 5GROA 1PH7A 1I94L 3TREA 4A3JG 2VUMG 4DV0Q 5M3FG 3FP9A 4AIMA 5IP7G 4A93H 2B3GA 2K4KA 2RHQB 2Z0SA 3CCSA 1Q1EA 1WCMH 4JBJA 2VW9A 1M1KC 2CWPA 3KF6A 1BKBA 4HJ8A 3HOZG 3PUWA 5DLQE 2KBNA 2R92G 1G291 1V43A 5FJ8G 3CCJA 4HIKA 1HNWL 3F2DA 4A3KH 2V1CC 1VQMA 1YNXA 3E9HA 3W1GA 3PUVA 4MZ9A 2JA5H 3CCEA 4GOPB 4A3MH 1L1OA 2RHSB 4HJ7A 4DV5L 5HY6A 4C3JH 2NVQH 4J15A 1P16A 5ELOA 4JI7L 4B3RL 2F52A 2K50A 3K81C 2ALYB 4QIWE 1GM5A 3CC2A 4K0KQ 5C0XI 3J80c 4DNIA 2VS1A 4DV6L 1VQDA 4LF5Q 1HZBA 1EYGA 2OQKA 3WWVA 3CD6A 4AQYQ 1EOVA 4A3IH 1XNRL 3G48A 5BR8Q 4L5SA 4GKJQ 2ZJQA 4A3KG 1CKOA 2VNUD 1TXYA 2LSSA 2N49A 1S3OA 2R7DA 5BR8L 5C0XJ 5IE8A 3A5UA 4DR7Q 2Q2UA 4OXPA 2OTJA 2K5NA 1IYJB 1I6HH 5K36G 3NELA 1KD1C 1WJJA 4ME3A 1SLJA 4BXXH 3W1BA 2CWAA 4HIDA 5IYBG 1E1OA 2JK8A 2PQAA 1N32Q 1K8AC 1JE5A 4IPDA 1YJ9A 3HOWG 5JJLA 3KF8B 1Q46A 3G71A 3STBC 3GDEA 3M4PA 1ASZA 1OXXK 2OTLA 4IPGA 5M3MG 2L15A 1NTGA 2WB1G 1UE7A 1OXUA 4B3SQ 3K0XA 4AH6A 1JJ2A 2JEAI 2GVAA 4AYBG 4DV7L 1YZ6A 1V1QA 4OWTB 4LF7L 4WJ4A 1Q8KA 5LMNL 3L7ZC 2OQ0A 1VQOA 2F4VL 4LF9L 3GTPH 1E1TA 2Y0SE 1UWVA 1KRSA 4TVAB 3UDXA 5FLXc 1VQ4A 4JI5Q 2VUMH 3FKIH 4IPCA 1ASYA 2DUDA 4B3TQ 2MO1A 2FXQA 3CCUA 3F2CA 4R4IA 3S16H 1CKNA 1JT8A 1VQLA 1HJPA 4NXMQ 1K83H 4LWCA 4LFCL 2R7FA 3D31A 2UU9Q 1XPUA 2IX1A 1HZAA 4BY7G 2PI2A 4YWKA 4DR4Q 4GOPA 2YTVA 5ELNA 1GD7A 1L2FA 1Q1BA 2I0QA 4L5RC 1I94Q 3RZDH 3M4QA 3PO2H 2GN5A 5IWAQ 2UUAL 2NVTH 1EFWA 2UUBL 1EQQA 1X55A 1IZ6A 1N8RC 4HJ9A 3KYHC 3CPWA 3OTOL 1UEBA 2VQEL 3OYYA 5IP9G 3I4MH 5LMUQ 3SGIA 1X54A 2UUBQ 3I55A 1VQAA 3HOYH 3CP0A 4IO9A 3OTOQ 4DV4Q 1TWGH 3CMEA 1C9OA 1PV4A 4NB3A 2YU9H 4A3GH 2UXBL 2NVXH 3I2ZA 4BA1I 4DR2L 1NMGA 1PH2A 5C0XG 1JJCB 1BVSA 4KHPQ 3HOXH 4GS3A 1JB7A 4DUYL 4A3CG 4IPHA 1Y1WH 2D0PA 4KHPL 2RCNA 3G4SA 4DR7L 2XTIA 1XNQQ 3PIPA 4GLVB 3BJUA 5M5WH 3DLLA 2KCMA 2ZTCA 4YCUA 1IBLQ 3ICEA 3S17H 5FLMG 2WB1E 4LF5L 4IFDI 4RMFA 1SRUA 2JA5G 4DR1L 1E7ZA 2K5HA 3A74A 4X65Q 1MJCA 4AYBE 1I3QH 1IBLL 5C4XH 4JI3Q 1WOCA 1XNRQ 3HOUH 1S40A 3S15H 3STBD 4XTCS 4DUZQ 1YIJA 1EIYB 2OWOA 5HGQA 4JI6L 5LMNW 1IL2A 3PSIA 2E8GA 3A0JA 4JI3L 5C44H 1YHAA 2ZTDA 2NZHA 2MO0A 5JEAJ 3ZJYC 4ALPA 3J7A5 3S1RH 3RLNA 1JJGA 1RL2A 3UDGA 4C3HH 1AE2A 3TQYA 4DV3L 4OO1I 3K7UC 5IP9H 4LFAL 2NZOA 1N32L 3H15A 1YVCA 2KCTA 1HNXL 2KENA 3S2DH 4LF8Q 1QVFA 3I7FA 4JI8L 4LW1A 3GTQH 1C0AA 4LUZA 4LFAQ 1OTCA 4FDBA 1VQFA 4B3TL 2AHOB 1HH2P 4JI4L 4DV1Q 1HR0L 1VS0A 5M3FH 1IBKL 3GTLH 4BBRG 4LFBL 1PYBA 3CCRA 4R4QA 2UU9L 1CUKA 3F2BA 4JI4Q 3S1NH 2E2JH 1MIUA 2D0OA 2NN6G 3S1QH 1GKHA 2KHJA 4NXNQ 2ZJRA 1UE5A 3MEFA 4JBKA 2CKZB 2HT1A 2VZAA 4DK3C 2UUAQ 3BZKA 2JA8G 3HKZE 3M85A 4GNXC 1FJGQ 4NPSA 2C35B 3BZCA 1QUQA 2MQHA 2JA8H 1NMFA 2HHHL 3I4NH 2ES2A 1X3EA 5IYDG 4LFCQ 5AJ3L 2AMCB 1Z47A 2I5HA 3U4ZA 4UY8C 1G51A 2JA7G 1PH8A 4Y52H 4A75A 1VQCA 1X6OA 4YWLA 1GO3E 5AJ3Q 2JA6G 3NBHB 2HIVA 3HOVH 2UXBQ 2RF4A 1HNWQ 5IWAL 3UE0A 4A3EH 5EAYA 2NVYH 4JC0A 3CC7A 1OXTA 1KXLA 3M9BA 4QY7A 1X9NA 2VL6A 4R4OA 4JI0L 1PVOA 1QVGA 3CW2C 2LXKA 3RZOH 3H3VH 4A3MG 1L1OB 1WCMG 4GLAC 1B70B 3G6EA 4HIOA 1XNQL 4JI7Q 1Q7YC 3PF4A 4B3RQ 4K0KL 4P72A 4QGUA 1KAWA 4POGA 2B63H 2EXDA 4X65L 5E7NA 1L0WA 3S14H 1VQHA 1J6QA 2IX0A 4BXXG 2R7ZG 1HZCA 3I4MG 4IJHA 3S24A 2ZM6L 4A3IG 4JI6Q 1N34Q 1SN8A 4LF6L 2YTYA 3ERSX 1OXSC 3K7AH 4UP7A 3U58A 2YV5A 3ER0A 3HFZB 4TQUS 1KC8C 2E2HH 1VQ5A 3AFQA 1TWFH 1PA6A 1FVIA 2K75A 4P75A 2JE6I 2Q2HA 4X64Q 3RNUA 1HNZQ 1TWCH 3T1HL 4HIMA 1K73C 4A3GG 4A76A 4DR6Q 4IFDJ 4DV3Q 1XJVA 2K5VA 5JJKA 5C4XG 3TRZA 1IXRA 3JC66 4GNXA 4DR6L 4DAMA 1HNXQ 2R93G 1X3FA 4JI8Q 3UDFA 1KIXA 1E3PA 1PH6A 2PI2E 2N78A 3MXNB 2ID0A 1VQPA 1YI2A 1CSQA 1HR0W 4KLKA 4GKKL 1YHBA 4DV1L 3EBEA 3S2HH 4P71A 1XPRA 4QJFA 3DM3A 4HJ5A 1FL0A 4DV2Q 2R92H 3GTGH 3GTKH 3E9IA 1QZGA 1PH3A 4JYAL 1KRTA 2ZJPA 3GO5A 3KDFA 3KF6B 3RN2A 1N9WA 1VQNA 2ZTEA 4C2MH 4PZ7A 4P73A 4YHHL 1G6PA 3HKZG 4PZ6A 4YWMA 3UE1A 5LMNQ 2F4VQ 4DK6C 3CMAA 2AWOA 3AYHB 3IRBA 4JI5L 3CXCA 1IBML 3GTOH 5C3EH 1HR0Q 1SR3A 3HOZH 3FKIG 2Z6KC 2AWNA 1Q81C 3GD7A 4BBSH 2Q2TA 1B7YB 1W2BA 3PUXA 3TEHB 2UXCQ 1S72A 3L0OA 1MKHA 4DR3Q 4YCWA 2PQAB 3FHWA 4A3JH 4NXML 4A3LH 1VCIA 2JQOA 1CKNB 2QA4A 2UXCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJA A;  4QQB X;  3CPF A;  5GAE C;  1VQB A;  1EQR A;  5GAH C;  3CF5 A;  1PH9 A;  1RIP A;  4BY1 H;  4B3M L;  4JI0 Q;  1A62 A;  1QUQ B;  1U0L A;  3E0E A;  4GLX A;  3CCQ A;  1YJW A;  1VQ9 A;  2I5M X;  4R1J A;  2UXD Q;  4GN5 A;  2Q2I A;  4OX9 L;  2CCZ A;  1U5K A;  4IFD G;  2WFW A;  4APV A;  2IY5 B;  3BU2 A;  1EUJ A;  3JAM c;  1SFO H;  3AEV A;  1UE6 A;  3J81 c;  2UXD L;  5GQO A;  1FGU A;  4DV4 L;  1VQJ A;  3PF5 A;  4UPA A;  2WAQ G;  1Z9F A;  1I50 H;  1EIF A;  2NN6 I;  3T1Y Q;  1N36 L;  4JI1 Q;  3D0F A;  2ZM6 Q;  1FJG L;  3M7N A;  1M90 C;  4DR2 Q;  3M3Y H;  1D7Q A;  4EQ5 A;  1XMO L;  1TWA H;  3T1Y L;  3J81 j;  1A63 A;  1N36 Q;  5IYC H;  1VQK A;  4DR5 L;  3H3V I;  3J80 i;  1HNZ L;  4LF4 L;  4DUY Q;  1SE8 A;  3I4O A;  5C3E G;  1PH1 A;  4X6A H;  2EQS A;  5J3B A;  1J5E L;  1P8L A;  4JBM A;  1K0R A;  4PZ8 A;  4X62 L;  3TS2 A;  1Q82 C;  4GKJ L;  4A3L G;  2K52 A;  2F3I A;  1H95 A;  2Z6K A;  2A1A A;  5JJI A;  1LUZ A;  3ULL A;  5H1S E;  1QZH A;  1N34 L;  2PMZ E;  3U4V A;  1BBU A;  1N33 Q;  4KI0 A;  3F8T A;  1K9M C;  4GKK Q;  3KDF B;  1VQ8 A;  2DGY A;  4X64 L;  1VQ6 A;  4IOC A;  4PMW A;  3CAM A;  4JYA Q;  1NY4 A;  2CFM A;  1YIT A;  1X3G A;  5IYB H;  1DGS A;  4GN4 B;  1Y14 B;  2I5L X;  2GVB A;  2BA0 A;  4P74 A;  2ASB A;  4XIG S;  2PNH A;  4OON A;  3RLF A;  3KJO A;  3J81 i;  4GNX B;  3VDY A;  2BH2 A;  4A3D G;  1W3S A;  1GVP A;  3K80 C;  4LF8 L;  3CCV A;  4IOA A;  4POF A;  3I56 A;  2IHF A;  3CCM A;  1T9H A;  1KHI A;  1PFS A;  1TWH H;  3OW2 A;  1I5F A;  4LF7 Q;  2UUC L;  4A3B H;  4O0A A;  2R93 H;  1E24 A;  1PHJ A;  1PH5 A;  5IY0 A;  5IYC G;  1IBK Q;  4LFB Q;  1Y1V H;  3J7Z C;  1MJE A;  3HOW H;  4JV5 L;  3F1Z A;  2YYZ A;  3TS0 A;  3HKS A;  3L2P A;  3GTM H;  5IT9 c;  4NXN L;  1XMQ L;  1YHQ A;  4JBW A;  4YCV A;  4JV5 Q;  1XTD A;  3KOJ A;  4UP8 A;  4OWW B;  3A5Z B;  4X66 Q;  4WJ3 M;  1EWI A;  3B6Y A;  4B3M Q;  2YTX A;  4DAY B;  4JI2 L;  3PO3 G;  3CQZ H;  3PUZ A;  5IP7 H;  1WFQ A;  5FLM H;  2MNA A;  1LYL A;  1VQI A;  3H0G H;  4KHZ A;  4X66 L;  1KL9 A;  2HHH Q;  3PGZ A;  4OX9 Q;  2WAQ E;  4JI2 Q;  1E22 A;  4L5Q A;  3U50 C;  4UP9 A;  5JEA G;  3PO2 G;  1NE3 A;  1JMC A;  2AKW B;  4A4I A;  2N8N A;  1D8L A;  4Y7N H;  3HOX G;  2E2I H;  1A0I A;  4JI1 L;  2HIX A;  1Y1V G;  1X65 A;  2VQE Q;  4DV0 L;  4BBS G;  5C44 G;  1HZ9 A;  5LMU L;  4DKA C;  1AH9 A;  2CQO A;  4JOI A;  4DR5 Q;  4LF4 Q;  2QGQ A;  1LM0 A;  3W5O A;  3KFU A;  2D62 A;  5M5Y H;  3JAM i;  1J5E Q;  2K14 A;  2HQL A;  4BBR H;  4X62 Q;  1WI5 A;  3H0G G;  4OO1 G;  4PG3 A;  1YBY A;  1K3R A;  4DV6 Q;  3PO3 H;  4A3B G;  2JA6 H;  4C3I H;  2JJQ A;  3PV0 A;  2JA7 H;  1CSP A;  4L5T A;  1SMX A;  3RN5 A;  1VQ7 A;  1N33 L;  2WP8 J;  2LXJ A;  1XMO Q;  1Y1W G;  2Y0S G;  1Q86 C;  3PCO B;  4DV5 Q;  4A93 G;  5C4J H;  2IT1 A;  3NEN A;  4RG1 A;  2A8V A;  4LF6 Q;  4BA2 I;  2IHE A;  4OWX B;  2VY3 A;  1OXV A;  1VQG A;  5M3M H;  4DR1 Q;  2JA9 A;  3ULJ A;  1NJI C;  1SRO A;  3T1H Q;  4LUV A;  4A3F H;  4DPG A;  4DUZ L;  4LNQ A;  4JCV E;  4AQY L;  2B63 G;  1PYS B;  4A3C H;  3HOV G;  3KLW A;  1L1O C;  3K8A A;  4MNO A;  2JEB I;  3I4N G;  1UE1 A;  3RR5 A;  4H02 A;  4R4C A;  4R4T A;  5GAD C;  1QVC A;  1YJN A;  3GTJ H;  1C7Y A;  2ATW A;  1V9P A;  4MTN A;  4EX5 A;  3M4O H;  3CCL A;  1BBW A;  2MFI A;  2A19 A;  2XGT A;  2UUC Q;  3PIO A;  1NBW A;  4GOP C;  4B3S L;  3LGJ A;  3AFP A;  1A8V A;  4DV2 L;  2BH8 A;  4DV7 Q;  3CC4 A;  3HOU G;  1R9T H;  4IJL A;  3ULP A;  4A3E G;  1XPO A;  3HOY G;  4GN3 B;  5M5X H;  3EN2 A;  2BA1 A;  1WYD A;  4BY7 H;  4JOI C;  1LTL A;  1B8A A;  4YHH Q;  2N3S A;  2R6G A;  2E5L L;  4O2D A;  1KQS A;  3KJP A;  5IYD H;  1AE3 A;  2OCE A;  1X56 A;  2EIF A;  1YEZ A;  1Q12 A;  3Q8D A;  3RLO A;  5FJ8 H;  2QEX A;  1IBM Q;  1CKM A;  2E5L Q;  3NEM A;  2KHI A;  1K8G A;  3UDI A;  4JG2 A;  4BY1 G;  1PH4 A;  3S1M H;  4YY3 L;  2VQF Q;  4A3D H;  4LUO A;  1O7I A;  4LF9 Q;  4DR4 L;  4QL5 A;  4DR3 L;  2R7Z H;  2B29 A;  3AQQ A;  3EIV A;  1XMQ Q;  2H5X A;  4YY3 Q;  2VQF L;  4A3F G;  1VQE A;  5GAG C;  3PUY A;  5GRO A;  1PH7 A;  1I94 L;  3TRE A;  4A3J G;  2VUM G;  4DV0 Q;  5M3F G;  3FP9 A;  4AIM A;  5IP7 G;  4A93 H;  2B3G A;  2K4K A;  2RHQ B;  2Z0S A;  3CCS A;  1Q1E A;  1WCM H;  4JBJ A;  2VW9 A;  1M1K C;  2CWP A;  3KF6 A;  1BKB A;  4HJ8 A;  3HOZ G;  3PUW A;  5DLQ E;  2KBN A;  2R92 G;  1G29 1;  1V43 A;  5FJ8 G;  3CCJ A;  4HIK A;  1HNW L;  3F2D A;  4A3K H;  2V1C C;  1VQM A;  1YNX A;  3E9H A;  3W1G A;  3PUV A;  4MZ9 A;  2JA5 H;  3CCE A;  4GOP B;  4A3M H;  1L1O A;  2RHS B;  4HJ7 A;  4DV5 L;  5HY6 A;  4C3J H;  2NVQ H;  4J15 A;  1P16 A;  5ELO A;  4JI7 L;  4B3R L;  2F52 A;  2K50 A;  3K81 C;  2ALY B;  4QIW E;  1GM5 A;  3CC2 A;  4K0K Q;  5C0X I;  3J80 c;  4DNI A;  2VS1 A;  4DV6 L;  1VQD A;  4LF5 Q;  1HZB A;  1EYG A;  2OQK A;  3WWV A;  3CD6 A;  4AQY Q;  1EOV A;  4A3I H;  1XNR L;  3G48 A;  5BR8 Q;  4L5S A;  4GKJ Q;  2ZJQ A;  4A3K G;  1CKO A;  2VNU D;  1TXY A;  2LSS A;  2N49 A;  1S3O A;  2R7D A;  5BR8 L;  5C0X J;  5IE8 A;  3A5U A;  4DR7 Q;  2Q2U A;  4OXP A;  2OTJ A;  2K5N A;  1IYJ B;  1I6H H;  5K36 G;  3NEL A;  1KD1 C;  1WJJ A;  4ME3 A;  1SLJ A;  4BXX H;  3W1B A;  2CWA A;  4HID A;  5IYB G;  1E1O A;  2JK8 A;  2PQA A;  1N32 Q;  1K8A C;  1JE5 A;  4IPD A;  1YJ9 A;  3HOW G;  5JJL A;  3KF8 B;  1Q46 A;  3G71 A;  3STB C;  3GDE A;  3M4P A;  1ASZ A;  1OXX K;  2OTL A;  4IPG A;  5M3M G;  2L15 A;  1NTG A;  2WB1 G;  1UE7 A;  1OXU A;  4B3S Q;  3K0X A;  4AH6 A;  1JJ2 A;  2JEA I;  2GVA A;  4AYB G;  4DV7 L;  1YZ6 A;  1V1Q A;  4OWT B;  4LF7 L;  4WJ4 A;  1Q8K A;  5LMN L;  3L7Z C;  2OQ0 A;  1VQO A;  2F4V L;  4LF9 L;  3GTP H;  1E1T A;  2Y0S E;  1UWV A;  1KRS A;  4TVA B;  3UDX A;  5FLX c;  1VQ4 A;  4JI5 Q;  2VUM H;  3FKI H;  4IPC A;  1ASY A;  2DUD A;  4B3T Q;  2MO1 A;  2FXQ A;  3CCU A;  3F2C A;  4R4I A;  3S16 H;  1CKN A;  1JT8 A;  1VQL A;  1HJP A;  4NXM Q;  1K83 H;  4LWC A;  4LFC L;  2R7F A;  3D31 A;  2UU9 Q;  1XPU A;  2IX1 A;  1HZA A;  4BY7 G;  2PI2 A;  4YWK A;  4DR4 Q;  4GOP A;  2YTV A;  5ELN A;  1GD7 A;  1L2F A;  1Q1B A;  2I0Q A;  4L5R C;  1I94 Q;  3RZD H;  3M4Q A;  3PO2 H;  2GN5 A;  5IWA Q;  2UUA L;  2NVT H;  1EFW A;  2UUB L;  1EQQ A;  1X55 A;  1IZ6 A;  1N8R C;  4HJ9 A;  3KYH C;  3CPW A;  3OTO L;  1UEB A;  2VQE L;  3OYY A;  5IP9 G;  3I4M H;  5LMU Q;  3SGI A;  1X54 A;  2UUB Q;  3I55 A;  1VQA A;  3HOY H;  3CP0 A;  4IO9 A;  3OTO Q;  4DV4 Q;  1TWG H;  3CME A;  1C9O A;  1PV4 A;  4NB3 A;  2YU9 H;  4A3G H;  2UXB L;  2NVX H;  3I2Z A;  4BA1 I;  4DR2 L;  1NMG A;  1PH2 A;  5C0X G;  1JJC B;  1BVS A;  4KHP Q;  3HOX H;  4GS3 A;  1JB7 A;  4DUY L;  4A3C G;  4IPH A;  1Y1W H;  2D0P A;  4KHP L;  2RCN A;  3G4S A;  4DR7 L;  2XTI A;  1XNQ Q;  3PIP A;  4GLV B;  3BJU A;  5M5W H;  3DLL A;  2KCM A;  2ZTC A;  4YCU A;  1IBL Q;  3ICE A;  3S17 H;  5FLM G;  2WB1 E;  4LF5 L;  4IFD I;  4RMF A;  1SRU A;  2JA5 G;  4DR1 L;  1E7Z A;  2K5H A;  3A74 A;  4X65 Q;  1MJC A;  4AYB E;  1I3Q H;  1IBL L;  5C4X H;  4JI3 Q;  1WOC A;  1XNR Q;  3HOU H;  1S40 A;  3S15 H;  3STB D;  4XTC S;  4DUZ Q;  1YIJ A;  1EIY B;  2OWO A;  5HGQ A;  4JI6 L;  5LMN W;  1IL2 A;  3PSI A;  2E8G A;  3A0J A;  4JI3 L;  5C44 H;  1YHA A;  2ZTD A;  2NZH A;  2MO0 A;  5JEA J;  3ZJY C;  4ALP A;  3J7A 5;  3S1R H;  3RLN A;  1JJG A;  1RL2 A;  3UDG A;  4C3H H;  1AE2 A;  3TQY A;  4DV3 L;  4OO1 I;  3K7U C;  5IP9 H;  4LFA L;  2NZO A;  1N32 L;  3H15 A;  1YVC A;  2KCT A;  1HNX L;  2KEN A;  3S2D H;  4LF8 Q;  1QVF A;  3I7F A;  4JI8 L;  4LW1 A;  3GTQ H;  1C0A A;  4LUZ A;  4LFA Q;  1OTC A;  4FDB A;  1VQF A;  4B3T L;  2AHO B;  1HH2 P;  4JI4 L;  4DV1 Q;  1HR0 L;  1VS0 A;  5M3F H;  1IBK L;  3GTL H;  4BBR G;  4LFB L;  1PYB A;  3CCR A;  4R4Q A;  2UU9 L;  1CUK A;  3F2B A;  4JI4 Q;  3S1N H;  2E2J H;  1MIU A;  2D0O A;  2NN6 G;  3S1Q H;  1GKH A;  2KHJ A;  4NXN Q;  2ZJR A;  1UE5 A;  3MEF A;  4JBK A;  2CKZ B;  2HT1 A;  2VZA A;  4DK3 C;  2UUA Q;  3BZK A;  2JA8 G;  3HKZ E;  3M85 A;  4GNX C;  1FJG Q;  4NPS A;  2C35 B;  3BZC A;  1QUQ A;  2MQH A;  2JA8 H;  1NMF A;  2HHH L;  3I4N H;  2ES2 A;  1X3E A;  5IYD G;  4LFC Q;  5AJ3 L;  2AMC B;  1Z47 A;  2I5H A;  3U4Z A;  4UY8 C;  1G51 A;  2JA7 G;  1PH8 A;  4Y52 H;  4A75 A;  1VQC A;  1X6O A;  4YWL A;  1GO3 E;  5AJ3 Q;  2JA6 G;  3NBH B;  2HIV A;  3HOV H;  2UXB Q;  2RF4 A;  1HNW Q;  5IWA L;  3UE0 A;  4A3E H;  5EAY A;  2NVY H;  4JC0 A;  3CC7 A;  1OXT A;  1KXL A;  3M9B A;  4QY7 A;  1X9N A;  2VL6 A;  4R4O A;  4JI0 L;  1PVO A;  1QVG A;  3CW2 C;  2LXK A;  3RZO H;  3H3V H;  4A3M G;  1L1O B;  1WCM G;  4GLA C;  1B70 B;  3G6E A;  4HIO A;  1XNQ L;  4JI7 Q;  1Q7Y C;  3PF4 A;  4B3R Q;  4K0K L;  4P72 A;  4QGU A;  1KAW A;  4POG A;  2B63 H;  2EXD A;  4X65 L;  5E7N A;  1L0W A;  3S14 H;  1VQH A;  1J6Q A;  2IX0 A;  4BXX G;  2R7Z G;  1HZC A;  3I4M G;  4IJH A;  3S24 A;  2ZM6 L;  4A3I G;  4JI6 Q;  1N34 Q;  1SN8 A;  4LF6 L;  2YTY A;  3ERS X;  1OXS C;  3K7A H;  4UP7 A;  3U58 A;  2YV5 A;  3ER0 A;  3HFZ B;  4TQU S;  1KC8 C;  2E2H H;  1VQ5 A;  3AFQ A;  1TWF H;  1PA6 A;  1FVI A;  2K75 A;  4P75 A;  2JE6 I;  2Q2H A;  4X64 Q;  3RNU A;  1HNZ Q;  1TWC H;  3T1H L;  4HIM A;  1K73 C;  4A3G G;  4A76 A;  4DR6 Q;  4IFD J;  4DV3 Q;  1XJV A;  2K5V A;  5JJK A;  5C4X G;  3TRZ A;  1IXR A;  3JC6 6;  4GNX A;  4DR6 L;  4DAM A;  1HNX Q;  2R93 G;  1X3F A;  4JI8 Q;  3UDF A;  1KIX A;  1E3P A;  1PH6 A;  2PI2 E;  2N78 A;  3MXN B;  2ID0 A;  1VQP A;  1YI2 A;  1CSQ A;  1HR0 W;  4KLK A;  4GKK L;  1YHB A;  4DV1 L;  3EBE A;  3S2H H;  4P71 A;  1XPR A;  4QJF A;  3DM3 A;  4HJ5 A;  1FL0 A;  4DV2 Q;  2R92 H;  3GTG H;  3GTK H;  3E9I A;  1QZG A;  1PH3 A;  4JYA L;  1KRT A;  2ZJP A;  3GO5 A;  3KDF A;  3KF6 B;  3RN2 A;  1N9W A;  1VQN A;  2ZTE A;  4C2M H;  4PZ7 A;  4P73 A;  4YHH L;  1G6P A;  3HKZ G;  4PZ6 A;  4YWM A;  3UE1 A;  5LMN Q;  2F4V Q;  4DK6 C;  3CMA A;  2AWO A;  3AYH B;  3IRB A;  4JI5 L;  3CXC A;  1IBM L;  3GTO H;  5C3E H;  1HR0 Q;  1SR3 A;  3HOZ H;  3FKI G;  2Z6K C;  2AWN A;  1Q81 C;  3GD7 A;  4BBS H;  2Q2T A;  1B7Y B;  1W2B A;  3PUX A;  3TEH B;  2UXC Q;  1S72 A;  3L0O A;  1MKH A;  4DR3 Q;  4YCW A;  2PQA B;  3FHW A;  4A3J H;  4NXM L;  4A3L H;  1VCI A;  2JQO A;  1CKN B;  2QA4 A;  2UXC L; 
#chains in the Genus database with same CATH topology
 4HJA A;  1WCM B;  5FOB B;  5GAE C;  4BBS B;  3CF5 A;  1SYC A;  1SFO B;  5CBE E;  4BY1 H;  1S5C D;  4O42 A;  4B3M L;  4ABN A;  1B1Z A;  3W2D A;  3T13 A;  4IFD G;  1TII D;  2IY5 B;  2WKC A;  1SFO H;  3AEV A;  1CFM A;  5GQO A;  1VQJ A;  1AP0 A;  1EIF A;  3NBI A;  2ZM6 Q;  1M90 C;  2O4X A;  1TWA H;  3W3A A;  3HOU B;  3J81 j;  5FK9 C;  2AQ3 B;  1SE8 A;  5C3E G;  4X6A H;  1HA6 A;  2EQS A;  1TR5 A;  5J3B A;  1P8L A;  1TVX A;  3NWT A;  4PZ8 A;  1BBX C;  2YU9 B;  2F0K A;  5C3X A;  4GKJ L;  2HD3 A;  2K52 A;  2F3I A;  4A3L G;  5A2Q L;  1H95 A;  2I46 A;  2K32 A;  5JJI A;  3ULL A;  1N33 Q;  1BBU A;  2RDH A;  2B2Y C;  4KI0 A;  1EEI D;  1K9M C;  3HRZ C;  3KDF B;  3GTK B;  1AZP A;  4P2C B;  1K28 A;  1ZKO A;  3E5S A;  5C6A A;  3CAM A;  4ULL A;  3HZX A;  3OW7 A;  3QWN A;  1DGS A;  1F2L A;  4P74 A;  2GVB A;  1HTP A;  2PNH A;  4XIG S;  3KJO A;  3S1M B;  2BH2 A;  4A3D G;  3M4O B;  4A3B B;  4X3S A;  1NAP A;  4KTA A;  2EJG C;  5EGT A;  3I56 A;  3BYY B;  3J7Y W;  1KTK A;  3Q22 A;  1KHI A;  2WKD A;  5M5X B;  1PH5 A;  1KLG D;  1STH A;  3J7Z C;  3F1Z A;  3L2P A;  2XNA C;  1XMQ L;  1YHQ A;  1S5D D;  4JBW A;  2XVS A;  3MTS A;  3KOJ A;  3HS0 C;  3B6Y A;  4HMJ A;  5EPL A;  5CV6 A;  3CQZ H;  2MNA A;  1LYL A;  4OX9 Q;  3S16 B;  4A93 B;  1ICW A;  1RD9 D;  5CV8 A;  3OHX C;  1KAB A;  4JK1 C;  1STA A;  1DOL A;  1TWF B;  2AKW B;  4N8F A;  3IKJ A;  1I4G A;  4JI1 L;  4BBS G;  3A55 A;  5FO7 B;  2EY2 A;  1HZ9 A;  4DKA C;  1PZI D;  5DEH A;  4LF4 Q;  4C56 C;  2D62 A;  3R8B A;  1G8Z D;  3I4N B;  2K14 A;  4BBR H;  4X62 Q;  2SDF A;  3H0G G;  4BWG B;  3TP5 A;  3PO3 H;  2BE5 C;  1I4R A;  2JA6 H;  4C3I H;  2JJQ A;  1CSP A;  4L5T A;  1VQ7 A;  1B3A A;  1BF4 A;  1ROD A;  1XMO Q;  1Q86 C;  4K14 A;  4DV5 Q;  1HQM C;  3VR3 A;  1LV9 A;  2X69 A;  2K04 A;  4BA2 I;  2MGS A;  2BCO A;  1VQG A;  2F03 A;  1SYE A;  2QDB A;  1GUO A;  1TT2 A;  4AQY L;  2B63 G;  4A3C H;  3GTL B;  3RR5 A;  4H02 A;  5M3M B;  3ZYY X;  1C4Q A;  3VYU A;  2UUC Q;  5C44 B;  1NBW A;  4B3S L;  3QR8 A;  1FR3 A;  3GQB A;  1HHV A;  4BY7 H;  1LTL A;  1S5E D;  2A68 C;  5C4H A;  1B8A A;  1II3 A;  2NTS A;  2R6G A;  4O2D A;  3KJP A;  2EZV A;  2EY5 A;  1D6E C;  1SDF A;  2LKV A;  3RLO A;  3AU7 A;  1CKM A;  1I6V C;  2LMC B;  3NEM A;  1HUM A;  2KHI A;  3UDI A;  4JG2 A;  1PRT D;  5EKL A;  1ET6 A;  4F7X A;  1KDC A;  1O7I A;  4LF9 Q;  3EJI A;  2R7Z H;  3EIV A;  1VQE A;  2PZW A;  1J8I A;  3X3N A;  4ID6 A;  5M3F G;  2AQ1 B;  4B9X A;  1CM9 A;  1Q1E A;  1RKN A;  4HJ8 A;  1BKB A;  2L9H A;  3T51 B;  1G29 1;  4BS9 A;  1IYU A;  4A3K H;  2NVT B;  4LMQ D;  3EFX D;  2Z1C A;  4KY7 A;  3CCE A;  4A3M H;  3I4M B;  1EYC A;  3NWS A;  4HJ7 A;  1JE4 A;  4RCN A;  5HY6 A;  4PNY A;  4B3R L;  2F52 A;  2IL8 A;  2ALY B;  3J80 c;  1TS3 A;  2B2T C;  4KN7 C;  4DV6 L;  1JQY D;  4DAY A;  4KJN A;  3SHL A;  4J6H A;  1HFG A;  3P1H A;  5D3I B;  3G48 A;  1TWC B;  2KEE A;  1LTI D;  1TWA B;  1CKO A;  2VNU D;  3TN2 A;  4F8M A;  2F1M A;  5CGK A;  2N49 A;  3C1F A;  2XWB B;  2HDL A;  3Q0A A;  1STE A;  4C3H B;  4DR7 Q;  2OTJ A;  3KLR A;  4ME3 A;  2F3W A;  4IZ8 A;  2CWA A;  1H9R A;  2K7V A;  2JK8 A;  1JE5 A;  2R7Z B;  4ZCK A;  4FF2 A;  3G71 A;  1GOZ A;  2EJM A;  4DK0 A;  1NUC A;  1CT1 D;  2L15 A;  4U67 3;  2WB1 G;  4CKE A;  4AH6 A;  3C3L A;  1YZ6 A;  1V1Q A;  4OWT B;  4WJ4 A;  1BR9 A;  4IN3 A;  4I7Z C;  3FKI H;  4IPC A;  2MO1 A;  1AZQ A;  3NQI A;  1JOR A;  3H0G B;  1CKN A;  4C3J G;  1VQL A;  1HJP A;  4NXM Q;  4ZUJ A;  2PO4 A;  3D31 A;  3SDZ A;  4BY7 G;  1PTO F;  2PI2 A;  1CTM A;  1SE3 A;  4DR4 Q;  1ONL A;  2F0O A;  2O2L D;  3NBH A;  4L5R C;  4PMC A;  2EYP A;  1PLF A;  1I94 Q;  1LLR D;  1LTG D;  1EZ6 A;  1IZ6 A;  4XT1 B;  3CPW A;  1UEB A;  2WII B;  2F0P A;  3KBX A;  3OYY A;  5FO8 B;  4KD4 A;  5LMU Q;  3SGI A;  3I55 A;  1CQF A;  3CRL C;  4NB3 A;  2DNC A;  3I2Z A;  4CGY B;  2IW3 A;  1NMG A;  4RAU C;  1CA6 A;  4RHS A;  1A6X A;  5F2D A;  1JWU D;  2RDF A;  1ZYR C;  3NSW A;  3RMH A;  1XNQ Q;  2LS0 1;  3S9W A;  2ZTC A;  3S17 H;  5KNC A;  5FLM G;  1SRU A;  4MN3 A;  1LAC A;  3VR5 A;  4X65 Q;  2HUG A;  1MJC A;  2MUY A;  1I3Q H;  4AYB E;  1XNR Q;  1WOC A;  3HOU H;  1S40 A;  4XTC S;  2IX3 A;  4BBR B;  1LAB A;  4CKB A;  5LMN W;  3ONA B;  2FIN B;  1IL2 A;  1M4V A;  3OWE B;  1CQV A;  2AQ2 B;  5KNB A;  3S1R H;  2RBM A;  5ELE A;  5IP9 H;  4K2K A;  2EPB A;  3GTQ H;  4LW1 A;  3J7A F;  3P75 A;  5K5P A;  4FDB A;  4C2M B;  4WFN 3;  3Q23 A;  2PCF B;  1S4Z A;  1ENC A;  1PYB A;  4K8I A;  2IPK D;  4EQO A;  1KNE A;  1MIU A;  4AYB B;  1UE5 A;  1XWE A;  3BS1 A;  1IKL A;  2K5Q A;  4DF7 A;  4GNX C;  2D5D A;  4IUQ A;  2C35 B;  3PO2 B;  1NCV A;  1X3E A;  4LFC Q;  4C3J B;  2I5H A;  2Z6B A;  1A2U A;  3BDO A;  2JA6 G;  1GO3 E;  2PW7 A;  3NBH B;  3H09 A;  4JPB W;  3N52 A;  2NTT A;  3MEH A;  1M8A A;  5COY A;  5IWA L;  4K5X A;  1SYB A;  3CC7 A;  1OXT A;  5C3W A;  4C1N K;  3CW2 C;  3DMU A;  1L1O B;  3G6E A;  1EY4 A;  1QOH A;  3WOF A;  1Q7Y C;  4K0K L;  1PZJ D;  5E7N A;  2IX0 A;  2R7Z G;  1FJG Q;  4JI6 Q;  1N34 Q;  5KND A;  2YTY A;  3ERS X;  1OXS C;  2V4D A;  3NQT A;  3J80 L;  1JOK A;  2L11 A;  1HNZ Q;  1FVI A;  4P75 A;  2JE6 I;  4DR6 Q;  2F0T A;  4HIM A;  3IAY A;  4DV3 Q;  5JJK A;  5C4X G;  2Z9H A;  1B2T A;  4DR6 L;  1GUN A;  5IGB A;  1CHQ D;  1B9N A;  1X3F A;  4JI8 Q;  1W6J A;  1HPC A;  2ID0 A;  1CSQ A;  4HR7 B;  4KLK A;  1ICF B;  1IHZ A;  1QCB D;  1XPR A;  4OHJ A;  1UUP A;  2ZXO A;  1PH3 A;  2EYH A;  2ZJP A;  3RN2 A;  1MGS A;  3GO5 A;  2KJX A;  3A7A B;  4P73 A;  1G6P A;  4YWM A;  1TS5 A;  4FXD A;  5JOB A;  3GTO H;  5JPN C;  1HR0 Q;  1VMP A;  1Q81 C;  3GD7 A;  1B7Y B;  3TEH B;  3MFY A;  4KV6 A;  2PQA B;  2RVL A;  1F9P A;  4A3J H;  4A3L H;  1VCI A;  1BDO A;  3RZD B;  4K5V A;  1GUT A;  5ELB A;  5T1G A;  4QB4 A;  4H0L C;  1PTO C;  3Q6S A;  4QIW B;  1EQR A;  3SK8 A;  5GAH C;  4JI0 Q;  1U0L A;  3E0E A;  5JVH 3;  3CCQ A;  4GN5 A;  3ND9 A;  1DZ1 A;  5C5L A;  3PO3 B;  5JAV A;  3HOW B;  1VF5 C;  3JAM c;  1FYC A;  2NUC A;  5CC4 A;  2E2I B;  1F2Z A;  1FGU A;  1Z9F A;  3T1Y Q;  2ZXP A;  2O5I C;  1D7Q A;  1STY A;  3T1Y L;  1A63 A;  1EYD A;  4XQQ A;  1EYA A;  4DUY Q;  1PH1 A;  5D65 A;  1J5E L;  2CQA A;  1K0R A;  3TS2 A;  2EYO A;  2Z6K A;  1MHW C;  2E2H B;  5H1S E;  4HMI A;  2G9H D;  3U4V A;  5EPJ A;  3A8I E;  2HCC A;  1F2M A;  1VQ6 A;  5M5Y B;  4V0B A;  4DFA A;  2Y0S B;  4IOC A;  4PMW A;  1F9S A;  1G91 A;  4JYA Q;  1NY4 A;  2CFM A;  5EPK A;  1X3G A;  1PFB A;  5CBA E;  2BA0 A;  2ASB A;  3UI2 A;  5J1Z A;  1W3S A;  1Y69 U;  1GVP A;  3DWA A;  1ENF A;  4DNT B;  1SMY D;  3CCV A;  2EJF C;  2IHF A;  3BDC A;  1EOT A;  3CCM A;  1T9H A;  1I5F A;  1QG7 A;  4O0A A;  4OEL B;  1E24 A;  1PHJ A;  1Y1V B;  1IBK Q;  3P20 A;  1LT5 D;  1MJE A;  2N55 A;  4WJW A;  3HKS A;  2F0J A;  5IT9 c;  4NXN L;  2K01 A;  2E2J B;  2FJ2 A;  4OWW B;  1PTO D;  3A5Z B;  1F2Y A;  3FMC A;  2YTX A;  4YIJ A;  1PYW D;  5EKK A;  2JA6 B;  4A93 G;  5FLM H;  1VQI A;  1ZYR D;  4B08 A;  2SNS A;  2F0Q A;  4UP9 A;  3PO2 G;  1F77 A;  4A3E B;  2EVB A;  4Y7N H;  5CV4 A;  2E2I H;  1FNV A;  2HIX A;  1Y1V G;  3OOC A;  4LJZ C;  2M00 A;  5CYU A;  5LMU L;  1AH9 A;  4RH6 A;  4JOI A;  1AFP A;  4DR5 Q;  3W5O A;  3KFU A;  3SEB A;  5M5Y H;  1QNK A;  4C3I G;  1MBY A;  3PV0 A;  3RN5 A;  1EWH A;  1CK1 A;  5D14 A;  2Y0S G;  3PCO B;  3NEN A;  2B2W C;  3VYR A;  2IHE A;  5FLX E;  2RDG A;  1EEF D;  2CW0 C;  2BDO A;  1SRO A;  4J1M A;  4QF4 A;  4DPG A;  4DXG A;  3K8A A;  1D5Z C;  1SSO A;  5GAD C;  1QVC A;  1STB A;  3PQI A;  1YJN A;  2FHT A;  4IUU A;  3GTJ H;  1C7Y A;  2ATW A;  2KA7 A;  3U9O A;  4MIU A;  3M4O H;  3CCL A;  2XGT A;  2MFI A;  2NVX B;  4GOP C;  5EBD A;  3LGJ A;  3AFP A;  5EQ0 A;  2A6H C;  2BH8 A;  4OIK A;  3HOU G;  1R9T H;  3HOY G;  4XYO A;  1MD2 D;  4GN3 B;  4KY6 A;  5I6Y A;  3EN2 A;  1WYD A;  3FKI B;  1B4O A;  1KQS A;  5DNF A;  1C8C A;  5IYD H;  1AE3 A;  1X56 A;  3K6O A;  2QEX A;  1JWM D;  1Q12 A;  4G7Z C;  1WTO A;  1IBM Q;  1WTH A;  2F0E A;  5IGE A;  4HAE A;  5M3F B;  4YY3 L;  2VQF Q;  4A3D H;  3I90 A;  4LUO A;  4QL5 A;  2B2V A;  4DR3 L;  1G6Z A;  1XMQ Q;  4YY3 Q;  1S5F D;  2VQF L;  4A3F G;  2VUM G;  3R93 A;  2XN9 C;  3TRE A;  4DV0 Q;  3CKI B;  5IP7 G;  4AIM A;  4H7B A;  2B3G A;  5T1I A;  2RHQ B;  3R2T A;  4JBJ A;  2VW9 A;  1M1K C;  3VR4 A;  2KBN A;  2WV6 D;  5FJ8 G;  1V43 A;  1IL8 A;  2B2T A;  5M9O A;  4HIK A;  3U9S A;  1I4H A;  1IW7 D;  3A7L A;  3SXH A;  1VQM A;  2J0T D;  1YNX A;  3KLS X;  3W1G A;  5BN5 A;  2F0V A;  4MZ9 A;  4GOP B;  4NMZ A;  4C3J H;  4J15 A;  3T16 A;  1GUW A;  4F88 A;  2K5D A;  5ELO A;  3DXJ C;  1Y8O B;  2MPM A;  1EZ8 A;  2K50 A;  3K81 C;  4QIW E;  1GM5 A;  4K0K Q;  3MC0 B;  4DNI A;  2PMZ B;  2VS1 A;  3K57 A;  1VQD A;  4RFB A;  1EYG A;  3WWV A;  3CD6 A;  2L12 A;  1LO5 D;  4L5S A;  2TMP A;  3SK6 A;  2ZJQ A;  1PFN A;  1KDB A;  1TXY A;  1I4P A;  2LSS A;  3T56 B;  5I2X A;  1ESF A;  3C46 A;  2KED A;  2E2D C;  1Z7T A;  4RGN A;  2K5N A;  1TKW B;  1EY0 A;  4HID A;  1E1O A;  2PQA A;  1N32 Q;  1HCZ A;  2G9D A;  2F0U A;  2OT2 A;  1YJ9 A;  3KF8 B;  3TDQ A;  2QF7 A;  1Q46 A;  3STB C;  3GDE A;  3WOE A;  1ASZ A;  2OTL A;  2NBF A;  3QB3 A;  4B3S Q;  3K0X A;  3MXG A;  4A3F B;  4DXF A;  4LF7 L;  1VQO A;  2ZXR A;  1KDA A;  2ICE C;  1UWV A;  3M7G A;  4TVA B;  1VQ4 A;  3FRP B;  1LT3 D;  2DUD A;  5JVG 3;  3MAQ A;  3CCU A;  3NE5 B;  1DM0 B;  1K83 H;  1UEA B;  2R7F A;  2UU9 Q;  2M2L A;  3FVQ A;  5CV7 A;  4GOP A;  2R61 A;  2YTV A;  5ELN A;  1L2F A;  1AW7 A;  2I0Q A;  3J7A V;  5D3D A;  3RZD H;  3LWE A;  2UUA L;  1D1K A;  3NTK A;  1N8R C;  4HJ9 A;  3KYH C;  3OTO L;  2VQE L;  5DM7 3;  3HOY H;  3CP0 A;  5AFW A;  4CDF C;  1SXT A;  2F4I A;  3OTO Q;  3D8G A;  4FXK C;  3HP3 A;  2YU9 H;  2UXB L;  2NVX H;  2XWJ B;  1PH2 A;  1NSN S;  2RKS A;  1JJC B;  3X3M A;  5C0X G;  1PDQ A;  3A56 A;  1FGB D;  4DUY L;  5NUC A;  1GHK A;  1Y1W H;  2F0L A;  1ZXT A;  2RCN A;  3G4S A;  1WTW A;  3PIP A;  2NN6 H;  5M5W H;  3DLL A;  3ICE A;  1IBL Q;  5G3L F;  4IFD I;  4RMF A;  4NDX A;  3BYT B;  4DR1 L;  1K3B C;  4MHE A;  3DEO A;  1IBL L;  1SE2 A;  4DUZ Q;  1YIJ A;  2OWO A;  5HGQ A;  4RKL A;  3QO2 A;  2AUK A;  3S2D B;  4ODG A;  1O80 A;  2MO0 A;  5E4W C;  3IFD A;  4XDX A;  4IUP A;  4IUT A;  1RL2 A;  2JYO A;  1AE2 A;  3K7U C;  2A69 C;  2KCT A;  1HNX L;  1B9M A;  1QVF A;  3I7F A;  2KQ3 A;  1OTC A;  4FO2 A;  2FFK B;  1VQF A;  4B3T L;  1BUV T;  3D4D A;  3E6Z X;  1T5E A;  5IT9 E;  1IBK L;  5JEA H;  3CCR A;  2ZT9 C;  1SND A;  1LTA D;  2NN6 G;  4WOR A;  1GKH A;  3T4A C;  4NXN Q;  1RHP A;  3PIP 3;  2B2U C;  2HT1 A;  5LL6 S;  2VZA A;  4DK3 C;  1WTP A;  4I65 A;  3S2H B;  3BZC A;  2MQH A;  2KHS A;  3S1Q B;  3I4L A;  5IYD G;  4PV1 C;  1Z47 A;  2JA7 G;  4A75 A;  1VQC A;  1X6O A;  2A5H A;  4YWL A;  1WTQ A;  2HIV A;  1A15 A;  2MJ8 A;  1CZG A;  4A3E H;  3UE0 A;  4DAV A;  1LT4 D;  1Y1W B;  1KXL A;  3NK9 A;  1KNA A;  1UNS A;  4QY7 A;  2VL6 A;  4R4O A;  1QVG A;  3QJY A;  3K59 A;  2LXK A;  4TSS A;  3J81 L;  2CVR A;  4CDD C;  2D9U A;  3M4Y A;  4POG A;  1L0W A;  4BXX G;  1DJR D;  2ZM6 L;  1YNJ D;  4KJO A;  1H9S A;  3HOX B;  4HCS A;  3ER0 A;  3HFZ B;  2E2H H;  2NYZ D;  2LY7 A;  1TWF H;  1PA6 A;  2K75 A;  4X64 Q;  1ENA A;  1SNC A;  1VMC A;  3SE0 A;  4A76 A;  2K5V A;  2ICI A;  4EGV A;  1IXR A;  3JC6 6;  4GNX A;  3GTJ B;  1K83 B;  4PMB A;  1E3P A;  3GV6 A;  4N9P A;  1VQP A;  1TU2 B;  3MWY W;  1G2S A;  5I2Y A;  4DV1 L;  3S1N B;  4P71 A;  4RGO S;  5JJZ A;  4QJF A;  2R92 H;  1FL0 A;  2BE5 D;  1EY6 A;  4X3U A;  3E9I A;  5C3E B;  1KRT A;  5KYI A;  4CJ1 B;  3OIP A;  1BOS A;  4C2M H;  2F4V Q;  1JR0 D;  2Z4I A;  3CMA A;  3AYH B;  4JI5 L;  1DCZ A;  3CXC A;  1IBM L;  1D2B A;  3FKI G;  2Z6K C;  4N9T A;  2QEJ C;  4OL7 A;  1MKH A;  3G6J B;  2K6A A;  4FP5 D;  4DR3 Q;  4JW0 A;  4QUC A;  1ET9 A;  1JB7 A;  1HA5 A;  5ELF A;  3SR1 A;  4QQB X;  1VQB A;  3JAM E;  1HXY D;  1HFN A;  1PH9 A;  1JWS D;  1PTO H;  1YJW A;  4ZRZ A;  2I5M X;  1DOK A;  4OX9 L;  2CCZ A;  1U5K A;  2OEO A;  1XXG A;  3BU2 A;  1UAP A;  1U4R A;  1AN8 A;  2VB3 X;  1SYD A;  4UPA A;  4IFD H;  1I50 H;  2NN6 I;  1N36 L;  2XRS D;  4JI1 Q;  1V1P B;  3D0F A;  1Y8P B;  3K58 A;  4DR2 Q;  1JCK B;  4EQ5 A;  3S15 B;  1N36 Q;  5IYC H;  1VQK A;  3H3V I;  4KY5 A;  4LF4 L;  3E0J A;  3I4O A;  4CJ2 C;  2R92 B;  3MXP A;  4OGQ C;  5FLX L;  4JBM A;  4X62 L;  1PFM A;  3FEW X;  4S3S A;  2K28 A;  3LWU A;  1KAA A;  3NTH A;  4K8J A;  2A1A A;  1N34 L;  1G2T A;  5LL6 X;  2XRQ D;  3F8T A;  4GKK Q;  2MP1 A;  1VQ8 A;  4TRD A;  4HED A;  5M5W B;  4IAL A;  1B44 D;  2CH4 A;  1YIT A;  2RQX A;  5IYB H;  2I5L X;  1U4P A;  4OON A;  3VDY A;  1DYQ A;  4GNX B;  3J81 i;  3RUZ A;  3S1R B;  2X6L A;  3K80 C;  2RCF A;  3NUC A;  4LF8 L;  1RJT A;  4FF4 A;  2VB2 X;  4I7A A;  2KCC A;  1PFS A;  1TWH H;  4EVO A;  3OW2 A;  4LF7 Q;  2UUC L;  4A3B H;  2Z8L A;  5IGF A;  3QOJ A;  5IY0 A;  5IYC G;  4LFB Q;  5IGD A;  2YYZ A;  3TBI B;  3G7L A;  1TWH B;  3ITP A;  4YCV A;  3E3X A;  1A2T A;  3HOV B;  4UP8 A;  2PNR C;  4X66 Q;  4N8X 1;  1EWI A;  4B3M Q;  3PUZ A;  1WFQ A;  4GZY C;  4X66 L;  3BDL A;  2PPB C;  4L5Q A;  1A3T A;  4XXE A;  2O5J C;  1NE3 A;  1QNU A;  2EDG A;  1D8L A;  1A0I A;  2VQE Q;  1QIL A;  3BVZ A;  2P5Z X;  3NHH A;  4WRD A;  1FNW A;  3NPP A;  1LM0 A;  2KUM A;  3A8J E;  3JAM i;  2LFN A;  2L4N A;  1EL0 A;  1X32 A;  1YBY A;  1K3R A;  4A3B G;  3S14 B;  1N33 L;  3DHQ A;  1EQT A;  2LXJ A;  5C4J H;  2IT1 A;  4RG1 A;  2SEB D;  3VYS A;  4LF6 Q;  4HCE A;  1SMY C;  2NB0 A;  4Y7N B;  4OWX B;  3VR2 A;  5M3M H;  4DR1 Q;  2F0D A;  3ULJ A;  2A68 D;  2J4X A;  3CHB D;  3NXW A;  3T1H Q;  1BCP B;  4LUV A;  4A3F H;  4DUZ L;  4LNQ A;  3D4W A;  5IOD A;  4M1U B;  4E6I A;  1U4M A;  2M9V A;  3KLW A;  1L1O C;  4MNO A;  3HOV G;  2JEB I;  1UE1 A;  3J81 E;  1HUN A;  1R4P B;  1V9P A;  4MTN A;  2DN8 A;  1PZK D;  1BBW A;  2A19 A;  1HQR D;  5COR A;  1DOM A;  1O78 A;  2JP1 A;  5KEE A;  2ENB A;  2CH4 W;  1A8V A;  3BVM A;  4DV2 L;  4DV7 Q;  4DN4 M;  3ULP A;  4A3E G;  5M5X H;  2QW7 A;  5IOC A;  1EU4 A;  2BA1 A;  1Z6H A;  4JOI C;  3MXU A;  4BY7 B;  5DM6 3;  4CDC C;  1J9O A;  2E5L L;  2WAQ B;  3HOZ B;  1EFI D;  3HG9 A;  1O7Z A;  2EIF A;  1YEZ A;  3Q8D A;  2E5L Q;  1K8G A;  4BY1 G;  1PH4 A;  3TZU A;  2CHB D;  1RTN A;  1QB5 D;  2PZU A;  1SYF A;  1K8M A;  3AQQ A;  2H5X A;  1PH7 A;  5GRO A;  1WD1 A;  4HTH A;  1F9R A;  3CCS A;  4G4K A;  5K36 H;  1DD2 A;  2CWP A;  4RWS C;  5DLQ E;  2R92 G;  1JOQ A;  4ZKC B;  3F2D A;  2B2V C;  2V1C C;  1I4Q A;  3AMU A;  3KF8 A;  5ELC A;  5EJW A;  3SVM A;  1L1O A;  3C2P A;  2RHS B;  2A73 B;  4DV5 L;  2NVQ H;  1P16 A;  2JXM B;  5DAU A;  1WTV A;  3CC2 A;  5C0X I;  2L0C A;  1SE4 A;  4BY1 B;  4C1N I;  4LF5 Q;  1HZB A;  3BVG A;  1EWC A;  4R8N A;  1ML0 D;  5I9P A;  4AQY Q;  2DJF C;  3KUP A;  4A3I H;  3GP7 A;  2EXZ A;  4IUN A;  2J7Z A;  4A3K G;  5CR3 A;  2R7D A;  5C0X J;  4KD3 A;  4Q0F A;  5IE8 A;  3A5U A;  2Q2U A;  1DON A;  3K5L A;  5K36 G;  3NEL A;  1KD1 C;  1WJJ A;  4L6T B;  4BXX H;  5IT9 L;  1NR4 A;  3HOW G;  5JJL A;  4FYD A;  1K0S A;  3TP6 A;  1OXX K;  4IPG A;  1NTG A;  1OO9 B;  1OXU A;  1UE7 A;  3AB9 A;  1BCP F;  1JJ2 A;  3S17 B;  2C5C A;  4AYB G;  3DWQ A;  3FPP A;  3C1E A;  2F4V L;  2OQ0 A;  4LF9 L;  3GTP H;  3TP7 A;  1E1T A;  4JI5 Q;  2N88 A;  3UDX A;  2R93 B;  1SNO A;  1S5B D;  1K8O A;  5E1F A;  2FXQ A;  3F2C A;  4R4I A;  1JT8 A;  1XPU A;  4DK1 A;  2JA8 G;  3CRK C;  4LWC A;  4HSV A;  4YWK A;  5JPM C;  2H4O A;  4EQP A;  1GD7 A;  1Q1B A;  3A8K E;  1R4Q B;  4TKO B;  1BO0 A;  1X3Q A;  3M4Q A;  3PO2 H;  2GN5 A;  4A3K B;  2NVT H;  5CV9 A;  1EFW A;  1EQQ A;  1GXD C;  5J39 A;  4A3M B;  3I4M H;  1VQA A;  2A69 D;  1WVL A;  2EOT A;  3IFT A;  3CME A;  2B63 B;  2DY7 A;  2F0H A;  1PV4 A;  4A3G H;  2JA7 B;  1STN A;  1BQQ T;  4DR2 L;  2VXW A;  3F2U A;  1LTT D;  3HOX H;  4GS3 A;  2A74 C;  4A3C G;  4F87 A;  1QE6 A;  1YNJ C;  1ILQ A;  4DR7 L;  1Y8N B;  2XTI A;  2QIL A;  3BJU A;  2KCM A;  1YNN C;  4MTK A;  5TSS A;  4J8Q A;  4JI3 Q;  3MZ5 A;  3S15 H;  3STB D;  1EY9 A;  1EIY B;  4JI6 L;  3A0J A;  4JI3 L;  2ZTD A;  3H6M A;  4KK7 A;  3TSS A;  4DV3 L;  2KCN A;  1N32 L;  3H15 A;  1YVC A;  2NZ1 D;  1JB3 A;  2TSS A;  2KEN A;  4G7H C;  4LF8 Q;  4JI8 L;  4IUV A;  4LUZ A;  3GTM B;  5HUR A;  1HTL D;  1T5X D;  4LAA A;  2AHO B;  1HH2 P;  4JI4 L;  5M3F H;  1PXU A;  4R9W A;  3GTL H;  4LFB L;  1A3V A;  4R4Q A;  1PTO B;  1CUK A;  2Q8I B;  3F2B A;  4JI4 Q;  2D0O A;  1PMR A;  3MEF A;  1SNM A;  4JBK A;  3CQZ B;  1JOO A;  3RD4 A;  2WAC A;  3ERO A;  2F0W A;  3BZK A;  3M85 A;  1QUQ A;  1NMF A;  5AJ3 L;  1JC7 A;  2AMC B;  4UY8 C;  3U4Z A;  1G51 A;  1E2W A;  4Y52 H;  1TQO A;  4C3H G;  4PQX A;  5AJ3 Q;  1EIH A;  3HOV H;  3N6R A;  1HNW Q;  5EAY A;  4JC0 A;  2VUM B;  3URY A;  3GV3 A;  4FXG C;  3M9B A;  3VR6 A;  1X9N A;  4LK1 C;  4JI0 L;  4ZQ3 A;  1PVO A;  3RZO H;  4A3M G;  1XNQ L;  4HIO A;  2EE1 A;  3D4R A;  4JI7 Q;  1CI3 M;  4NKL A;  3HGB A;  1L0Y B;  2EXD A;  4X65 L;  1V8Q A;  2KVM A;  2JSO A;  3S14 H;  1VQH A;  2KOL A;  1HZC A;  3I4M G;  1ESR A;  3S24 A;  4CKC A;  3J80 E;  4LF6 L;  1RF2 D;  3U58 A;  4FNF A;  1SNQ A;  2YV5 A;  1KC8 C;  1R9T B;  3OSO A;  3DWP A;  2Q2H A;  2C9O A;  3H94 A;  3T1H L;  1K73 C;  4IFD J;  1SBB B;  3V05 A;  3TRZ A;  2EY1 A;  2F0F A;  4DAM A;  2R93 G;  1KIX A;  2F0I A;  2L55 A;  1PH6 A;  1IYV A;  2PI2 E;  3MXN B;  3MA2 B;  1YI2 A;  1HR0 W;  2EYL A;  3EBE A;  1E2V A;  3GTG H;  1JIC A;  3DM3 A;  3IL8 A;  4DV2 Q;  2R3Z A;  1QZG A;  4JYA L;  5EKI A;  1MI2 A;  1VQN A;  1N9W A;  4PZ7 A;  3BZD B;  2E76 C;  5LMN Q;  4CJ0 B;  3MFG A;  3OIQ A;  1B53 A;  1E2Z A;  5E4X A;  1SR3 A;  3HOZ H;  3V2T A;  3I3C A;  3I8Z A;  4FVM A;  3VYT A;  1W2B A;  5KIX A;  1O7Y A;  3D3R A;  3PUX A;  1S72 A;  4YCW A;  3FHW A;  4A3J B;  3Q24 A;  3D6W A;  1CKN B;  2VUM H;  3D6C A;  2QA4 A;  2AUJ D;  3CPF A;  3I91 A;  4ZYS A;  1EY5 A;  1X3P A;  5ELD A;  1RIP A;  5CV5 A;  1A62 A;  1QUQ B;  4GLX A;  2EYM A;  1VQ9 A;  4R1J A;  2UXD Q;  2Q2I A;  2WFW A;  4KMU C;  4APV A;  1EUJ A;  1UE6 A;  3J81 c;  2UXD L;  3PF5 A;  4DV4 L;  2QDL A;  2WAQ G;  3FPU B;  5C4J B;  1FJG L;  3M3Y B;  4KKU A;  3M7N A;  3MHB A;  2BOS A;  2WIN B;  4K6D A;  3M3Y H;  1XMO L;  4DR5 L;  3J80 i;  1HNZ L;  4G57 A;  4A3I B;  4ZAI A;  2XSC A;  4ME5 A;  1Q8I A;  1EQV A;  2OXP A;  1O7L A;  3K5O A;  2FMM A;  2K05 A;  1Q82 C;  3L9A X;  1LUZ A;  1QZH A;  2PMZ E;  1AEX A;  1U9R A;  2F0M A;  1GUS A;  1W6K A;  2DGY A;  2MHV A;  2DY8 A;  1BCP D;  4X64 L;  3KLS A;  5I6W A;  1GJX A;  2EY6 A;  4GN4 B;  3O13 A;  1Y14 B;  1FNU A;  4ZLT F;  3RLF A;  4G7O C;  1GUG A;  2Q8R E;  4IOA A;  3MXN A;  1A3U A;  2K33 A;  3R2I A;  3T53 B;  4L8J A;  4POF A;  4B9W A;  1EIG A;  3LNN A;  2E74 C;  3OMG A;  3K5M A;  2R93 H;  3I70 A;  4H44 C;  1Y1V H;  1H9S B;  3HOW H;  4JV5 L;  3TS0 A;  5IIF A;  1PRT F;  5LHY 1;  3GTM H;  2OF1 A;  3H3V C;  2B8G A;  5G3L D;  4JV5 Q;  1XTD A;  2JA8 B;  4WJ3 M;  4HN7 A;  4DAY B;  4JI2 L;  1D1I A;  2X6G A;  4A3D B;  3PO3 G;  5IP7 H;  1LTB D;  3H0G H;  4KHZ A;  2HHH Q;  1KL9 A;  3TME A;  3PGZ A;  1BXT A;  1ZEQ X;  2WAQ E;  3QIA A;  4JI2 Q;  1E22 A;  1Q90 A;  3R3O A;  3U50 C;  5JEA G;  1TWG B;  1JMC A;  2NVY B;  4A4I A;  2N8N A;  5I4D A;  3HOX G;  3BG3 A;  1B50 A;  1X65 A;  5KRU A;  4DV0 L;  3EQL C;  5C44 G;  2CQO A;  3SK5 A;  4XT3 B;  5CMD A;  1NR2 A;  2QGQ A;  1L0X B;  4ZK9 B;  4X3T A;  4CHT B;  1J5E Q;  2HQL A;  4NW2 A;  1WI5 A;  4OO1 G;  4PG3 A;  4DV6 Q;  2JA5 B;  1BCP C;  2JA7 H;  1SMX A;  5C4Z A;  2WP8 J;  5IGC A;  1Y1W G;  3FDT A;  3OMC A;  2A8V A;  4RKB A;  4X3K A;  3CU7 A;  2VY3 A;  1OXV A;  2JA9 A;  4EQN A;  1NJI C;  1D5M C;  4XYQ A;  1C48 A;  1TY2 A;  4JCV E;  1PYS B;  3I4N G;  4R4T A;  4R4C A;  2RA4 A;  4Z9C B;  4U68 A;  4EX5 A;  2PW5 A;  5A2Q E;  3LX0 A;  3PIO A;  4K5W A;  1XTC D;  4KKS A;  3CC4 A;  3QG1 A;  4IJL A;  1XPO A;  3WDN A;  1IW7 C;  4YHH Q;  2N3S A;  4KN4 C;  4XQJ A;  1ILP A;  2OCE A;  2D2C C;  5FJ8 H;  5KYL A;  1LTS D;  3HKZ B;  1E0B A;  4ZKB B;  1CA5 A;  3S1M H;  1XX8 A;  1CHP D;  4DR4 L;  2B29 A;  5GAG C;  3PUY A;  1I94 L;  1RDP D;  4DAP A;  4A3J G;  4ZUI A;  4ILW A;  1PRT C;  3FP9 A;  4A93 H;  2SOB A;  1SEB D;  2K4K A;  2Z0S A;  2RSO A;  1XYI A;  1WCM H;  2B2W A;  3KF6 A;  2EYJ A;  1YNN D;  3HOZ G;  3PUW A;  2K1B A;  2G5D A;  5FO9 B;  5I9O A;  3CCJ A;  4A3G B;  4DGZ A;  5ISR A;  2F3V A;  1HNW L;  1SYG A;  2HCI A;  1I50 B;  3E9H A;  3PUV A;  2JA5 H;  3PMF A;  3DM1 A;  4HSP A;  4KKT A;  1BNZ A;  5C0X H;  4JI7 L;  2B2Y A;  3I72 A;  3I73 A;  1SAP A;  4FF3 A;  2OQK A;  1EOV A;  2B39 A;  1XNR L;  5BR8 Q;  4GKJ Q;  2DJG C;  2XIW A;  3NP8 A;  5L37 A;  2GA4 B;  1S3O A;  5BR8 L;  4O1N A;  3HOY B;  4OXP A;  4OIJ A;  5FKA C;  1IYJ B;  1I6H H;  2E75 C;  1SLJ A;  3W1B A;  1H9K A;  5IYB G;  1DXM A;  1V1O A;  1B3Q A;  1K8A C;  4IPD A;  2DNE A;  1QWY A;  2F0S A;  1RTO A;  3M4P A;  3MVV A;  1I6H B;  5M3M G;  3JAM L;  3HEJ A;  1STG A;  4CBV A;  2JEA I;  3GTG B;  1QJO A;  2GVA A;  4DV7 L;  4QUF A;  5IGG A;  4RGM A;  1Q8K A;  3SK4 A;  5LMN L;  3L7Z C;  4JVZ A;  2Z4H A;  5C4X B;  1TS4 A;  2Y0S E;  5FLX c;  1KRS A;  4OEM B;  1GHJ A;  1SJE D;  1ASY A;  1H9M A;  4B3T Q;  2FMC A;  3GTO B;  2CW0 D;  1EY7 A;  2SNM A;  1LT6 D;  3S16 H;  3PIO 3;  1WTR A;  2IX1 A;  3OPO A;  5BN4 A;  4LFC L;  1HZA A;  5E3F A;  1IKM A;  1U4L A;  5IWA Q;  2UUB L;  1X55 A;  4C3I B;  4FF1 A;  5IP9 G;  2A6H D;  4UDU C;  1I3Q B;  1X54 A;  2UUB Q;  4IO9 A;  1KLU D;  4DV4 Q;  1TWG H;  1C9O A;  1EU3 A;  4IQZ A;  4K2L A;  3P7J A;  5J22 A;  2B2U A;  2L5T A;  4UHV A;  4BA1 I;  1BVS A;  4KHP Q;  4DU9 A;  3EA6 A;  4L63 B;  4IPH A;  2D0P A;  4KHP L;  2H1E A;  4GLV B;  5A35 A;  4YCU A;  2WB1 E;  4LF5 L;  2WB1 B;  2JA5 G;  2Q8T A;  1E7Z A;  4OO1 H;  1F9Q A;  2JN4 A;  2K5H A;  3A74 A;  4DNR B;  5HGT A;  5C4X H;  3VA5 A;  4KHV A;  3OWF A;  2IJ0 A;  3NTI A;  1PRT B;  1H9J A;  1FD7 D;  1V1P A;  1VDZ A;  2K03 A;  2E8G A;  3PSI A;  1TS2 A;  1I4X A;  5C44 H;  1YHA A;  4ALP A;  2NZH A;  5JEA J;  2IWH A;  3ZJY C;  3J7A 5;  3RLN A;  3K7A B;  1EY8 A;  1JJG A;  1MSG A;  3UDG A;  2B8F A;  3TQY A;  4C3H H;  4OO1 I;  5EBC A;  4LFA L;  2NZO A;  2QCP X;  1RCV D;  3TP8 A;  3S2D H;  1C0A A;  4LFA Q;  2A6E C;  4NP5 A;  3VA7 A;  1VF7 A;  4V19 0;  4DV1 Q;  1HR0 L;  1VS0 A;  4K6L A;  4IUR A;  3TZD A;  4BBR G;  1WD0 A;  3K0Y A;  2F0N A;  2UU9 L;  3S1N H;  2E2J H;  2RSN A;  4UAI A;  3S1Q H;  2KHJ A;  2ZJR A;  3ERQ A;  4R8I A;  2CKZ B;  3RZO B;  1MSH A;  2I07 B;  2UUA Q;  3HKZ E;  1TY0 A;  2F0G A;  1WTX A;  1NNX A;  4NPS A;  2JA8 H;  3I4N H;  4DA2 A;  2HHH L;  2ES2 A;  1LTR D;  4H13 C;  3EVQ A;  3GTQ B;  2NVQ B;  2K5W A;  1PH8 A;  2UXB Q;  2RF4 A;  3K5N A;  1SJH D;  2NVY H;  3KBG A;  2PQE A;  4Q5V A;  1Q3L A;  3H3V H;  2PZT A;  4GLA C;  1WCM G;  1B70 B;  4CDE C;  3KK7 A;  4B3R Q;  3PF4 A;  4XQN A;  4P72 A;  4QGU A;  1KAW A;  2B63 H;  1D5X C;  3V96 A;  3ND8 A;  1J6Q A;  4QMG A;  3H91 A;  5C5M A;  4IJH A;  4M8A A;  2EYF A;  4A3I G;  1SN8 A;  4RA8 A;  1HRJ A;  2HQE A;  3K7A H;  4UP7 A;  4TQU S;  1VQ5 A;  3AFQ A;  1SNP A;  3RNU A;  4A3G G;  1TWC H;  2A6E D;  1XJV A;  5KGU A;  2PYK A;  3QOL A;  1HNX Q;  3DUZ A;  3UDF A;  4QCL A;  3GTP B;  2N78 A;  2QKI C;  4GKK L;  1YHB A;  3S2H H;  2BDN A;  2NWG A;  4HJ5 A;  2HDM A;  3A54 A;  3DEP A;  3GTK H;  4RHR A;  3KDF A;  3KF6 B;  2ZTE A;  4YHH L;  3HKZ G;  4PZ6 A;  1CZW A;  3UE1 A;  4DK6 C;  2AWO A;  3IRB A;  2L1B A;  4RCO A;  2KEC A;  5C3E H;  2AWN A;  4BBS H;  4RGT A;  2Q2T A;  2UXC Q;  3L0O A;  3L3O C;  5BN3 A;  4NXM L;  2JQO A;  2UXC L; 
#chains in the Genus database with same CATH homology
 4HJA A;  4QQB X;  3CPF A;  5GAE C;  1VQB A;  1EQR A;  5GAH C;  3CF5 A;  1PH9 A;  1RIP A;  4BY1 H;  4B3M L;  4JI0 Q;  1A62 A;  1QUQ B;  1U0L A;  3E0E A;  4GLX A;  3CCQ A;  1YJW A;  1VQ9 A;  2I5M X;  4R1J A;  2UXD Q;  4GN5 A;  2Q2I A;  4OX9 L;  2CCZ A;  1U5K A;  4IFD G;  2WFW A;  4APV A;  2IY5 B;  3BU2 A;  1EUJ A;  3JAM c;  1SFO H;  3AEV A;  1UE6 A;  3J81 c;  2UXD L;  5GQO A;  1FGU A;  4DV4 L;  1VQJ A;  3PF5 A;  4UPA A;  2WAQ G;  1Z9F A;  1I50 H;  1EIF A;  2NN6 I;  3T1Y Q;  1N36 L;  4JI1 Q;  3D0F A;  2ZM6 Q;  1FJG L;  3M7N A;  1M90 C;  4DR2 Q;  3M3Y H;  1D7Q A;  4EQ5 A;  1XMO L;  1TWA H;  3T1Y L;  3J81 j;  1A63 A;  1N36 Q;  5IYC H;  1VQK A;  4DR5 L;  3H3V I;  3J80 i;  1HNZ L;  4LF4 L;  4DUY Q;  1SE8 A;  3I4O A;  5C3E G;  1PH1 A;  4X6A H;  2EQS A;  5J3B A;  1J5E L;  1P8L A;  4JBM A;  1K0R A;  4PZ8 A;  4X62 L;  3TS2 A;  1Q82 C;  4GKJ L;  4A3L G;  2K52 A;  2F3I A;  1H95 A;  2Z6K A;  2A1A A;  5JJI A;  1LUZ A;  3ULL A;  5H1S E;  1QZH A;  1N34 L;  2PMZ E;  3U4V A;  1BBU A;  1N33 Q;  4KI0 A;  3F8T A;  1K9M C;  4GKK Q;  3KDF B;  1VQ8 A;  2DGY A;  4X64 L;  1VQ6 A;  4IOC A;  4PMW A;  3CAM A;  4JYA Q;  1NY4 A;  2CFM A;  1YIT A;  1X3G A;  5IYB H;  1DGS A;  4GN4 B;  1Y14 B;  2I5L X;  2GVB A;  2BA0 A;  4P74 A;  2ASB A;  4XIG S;  2PNH A;  4OON A;  3RLF A;  3KJO A;  3J81 i;  4GNX B;  3VDY A;  2BH2 A;  4A3D G;  1W3S A;  1GVP A;  3K80 C;  4LF8 L;  3CCV A;  4IOA A;  4POF A;  3I56 A;  2IHF A;  3CCM A;  1T9H A;  1KHI A;  1PFS A;  1TWH H;  3OW2 A;  1I5F A;  4LF7 Q;  2UUC L;  4A3B H;  4O0A A;  2R93 H;  1E24 A;  1PHJ A;  1PH5 A;  5IY0 A;  5IYC G;  1IBK Q;  4LFB Q;  1Y1V H;  3J7Z C;  1MJE A;  3HOW H;  4JV5 L;  3F1Z A;  2YYZ A;  3TS0 A;  3HKS A;  3L2P A;  3GTM H;  5IT9 c;  4NXN L;  1XMQ L;  1YHQ A;  4JBW A;  4YCV A;  4JV5 Q;  1XTD A;  3KOJ A;  4UP8 A;  4OWW B;  3A5Z B;  4X66 Q;  4WJ3 M;  1EWI A;  3B6Y A;  4B3M Q;  2YTX A;  4DAY B;  4JI2 L;  3PO3 G;  3CQZ H;  3PUZ A;  5IP7 H;  1WFQ A;  5FLM H;  2MNA A;  1LYL A;  1VQI A;  3H0G H;  4KHZ A;  4X66 L;  1KL9 A;  2HHH Q;  3PGZ A;  4OX9 Q;  2WAQ E;  4JI2 Q;  1E22 A;  4L5Q A;  3U50 C;  4UP9 A;  5JEA G;  3PO2 G;  1NE3 A;  1JMC A;  2AKW B;  4A4I A;  2N8N A;  1D8L A;  4Y7N H;  3HOX G;  2E2I H;  1A0I A;  4JI1 L;  2HIX A;  1Y1V G;  1X65 A;  2VQE Q;  4DV0 L;  4BBS G;  5C44 G;  1HZ9 A;  5LMU L;  4DKA C;  1AH9 A;  2CQO A;  4JOI A;  4DR5 Q;  4LF4 Q;  2QGQ A;  1LM0 A;  3W5O A;  3KFU A;  2D62 A;  5M5Y H;  3JAM i;  1J5E Q;  2K14 A;  2HQL A;  4BBR H;  4X62 Q;  1WI5 A;  3H0G G;  4OO1 G;  4PG3 A;  1YBY A;  1K3R A;  4DV6 Q;  3PO3 H;  4A3B G;  2JA6 H;  4C3I H;  2JJQ A;  3PV0 A;  2JA7 H;  1CSP A;  4L5T A;  1SMX A;  3RN5 A;  1VQ7 A;  1N33 L;  2WP8 J;  2LXJ A;  1XMO Q;  1Y1W G;  2Y0S G;  1Q86 C;  3PCO B;  4DV5 Q;  4A93 G;  5C4J H;  2IT1 A;  3NEN A;  4RG1 A;  2A8V A;  4LF6 Q;  4BA2 I;  2IHE A;  4OWX B;  2VY3 A;  1OXV A;  1VQG A;  5M3M H;  4DR1 Q;  2JA9 A;  3ULJ A;  1NJI C;  1SRO A;  3T1H Q;  4LUV A;  4A3F H;  4DPG A;  4DUZ L;  4LNQ A;  4JCV E;  4AQY L;  2B63 G;  1PYS B;  4A3C H;  3HOV G;  3KLW A;  1L1O C;  3K8A A;  4MNO A;  2JEB I;  3I4N G;  1UE1 A;  3RR5 A;  4H02 A;  4R4C A;  4R4T A;  5GAD C;  1QVC A;  1YJN A;  3GTJ H;  1C7Y A;  2ATW A;  1V9P A;  4MTN A;  4EX5 A;  3M4O H;  3CCL A;  1BBW A;  2MFI A;  2A19 A;  2XGT A;  2UUC Q;  3PIO A;  1NBW A;  4GOP C;  4B3S L;  3LGJ A;  3AFP A;  1A8V A;  4DV2 L;  2BH8 A;  4DV7 Q;  3CC4 A;  3HOU G;  1R9T H;  4IJL A;  3ULP A;  4A3E G;  1XPO A;  3HOY G;  4GN3 B;  5M5X H;  3EN2 A;  2BA1 A;  1WYD A;  4BY7 H;  4JOI C;  1LTL A;  1B8A A;  4YHH Q;  2N3S A;  2R6G A;  2E5L L;  4O2D A;  1KQS A;  3KJP A;  5IYD H;  1AE3 A;  2OCE A;  1X56 A;  2EIF A;  1YEZ A;  1Q12 A;  3Q8D A;  3RLO A;  5FJ8 H;  2QEX A;  1IBM Q;  1CKM A;  2E5L Q;  3NEM A;  2KHI A;  1K8G A;  3UDI A;  4JG2 A;  4BY1 G;  1PH4 A;  3S1M H;  4YY3 L;  2VQF Q;  4A3D H;  4LUO A;  1O7I A;  4LF9 Q;  4DR4 L;  4QL5 A;  4DR3 L;  2R7Z H;  2B29 A;  3AQQ A;  3EIV A;  1XMQ Q;  2H5X A;  4YY3 Q;  2VQF L;  4A3F G;  1VQE A;  5GAG C;  3PUY A;  5GRO A;  1PH7 A;  1I94 L;  3TRE A;  4A3J G;  2VUM G;  4DV0 Q;  5M3F G;  3FP9 A;  4AIM A;  5IP7 G;  4A93 H;  2B3G A;  2K4K A;  2RHQ B;  2Z0S A;  3CCS A;  1Q1E A;  1WCM H;  4JBJ A;  2VW9 A;  1M1K C;  2CWP A;  3KF6 A;  1BKB A;  4HJ8 A;  3HOZ G;  3PUW A;  5DLQ E;  2KBN A;  2R92 G;  1G29 1;  1V43 A;  5FJ8 G;  3CCJ A;  4HIK A;  1HNW L;  3F2D A;  4A3K H;  2V1C C;  1VQM A;  1YNX A;  3E9H A;  3W1G A;  3PUV A;  4MZ9 A;  2JA5 H;  3CCE A;  4GOP B;  4A3M H;  1L1O A;  2RHS B;  4HJ7 A;  4DV5 L;  5HY6 A;  4C3J H;  2NVQ H;  4J15 A;  1P16 A;  5ELO A;  4JI7 L;  4B3R L;  2F52 A;  2K50 A;  3K81 C;  2ALY B;  4QIW E;  1GM5 A;  3CC2 A;  4K0K Q;  5C0X I;  3J80 c;  4DNI A;  2VS1 A;  4DV6 L;  1VQD A;  4LF5 Q;  1HZB A;  1EYG A;  2OQK A;  3WWV A;  3CD6 A;  4AQY Q;  1EOV A;  4A3I H;  1XNR L;  3G48 A;  5BR8 Q;  4L5S A;  4GKJ Q;  2ZJQ A;  4A3K G;  1CKO A;  2VNU D;  1TXY A;  2LSS A;  2N49 A;  1S3O A;  2R7D A;  5BR8 L;  5C0X J;  5IE8 A;  3A5U A;  4DR7 Q;  2Q2U A;  4OXP A;  2OTJ A;  2K5N A;  1IYJ B;  1I6H H;  5K36 G;  3NEL A;  1KD1 C;  1WJJ A;  4ME3 A;  1SLJ A;  4BXX H;  3W1B A;  2CWA A;  4HID A;  5IYB G;  1E1O A;  2JK8 A;  2PQA A;  1N32 Q;  1K8A C;  1JE5 A;  4IPD A;  1YJ9 A;  3HOW G;  5JJL A;  3KF8 B;  1Q46 A;  3G71 A;  3STB C;  3GDE A;  3M4P A;  1ASZ A;  1OXX K;  2OTL A;  4IPG A;  5M3M G;  2L15 A;  1NTG A;  2WB1 G;  1UE7 A;  1OXU A;  4B3S Q;  3K0X A;  4AH6 A;  1JJ2 A;  2JEA I;  2GVA A;  4AYB G;  4DV7 L;  1YZ6 A;  1V1Q A;  4OWT B;  4LF7 L;  4WJ4 A;  1Q8K A;  5LMN L;  3L7Z C;  2OQ0 A;  1VQO A;  2F4V L;  4LF9 L;  3GTP H;  1E1T A;  2Y0S E;  1UWV A;  1KRS A;  4TVA B;  3UDX A;  5FLX c;  1VQ4 A;  4JI5 Q;  2VUM H;  3FKI H;  4IPC A;  1ASY A;  2DUD A;  4B3T Q;  2MO1 A;  2FXQ A;  3CCU A;  3F2C A;  4R4I A;  3S16 H;  1CKN A;  1JT8 A;  1VQL A;  1HJP A;  4NXM Q;  1K83 H;  4LWC A;  4LFC L;  2R7F A;  3D31 A;  2UU9 Q;  1XPU A;  2IX1 A;  1HZA A;  4BY7 G;  2PI2 A;  4YWK A;  4DR4 Q;  4GOP A;  2YTV A;  5ELN A;  1GD7 A;  1L2F A;  1Q1B A;  2I0Q A;  4L5R C;  1I94 Q;  3RZD H;  3M4Q A;  3PO2 H;  2GN5 A;  5IWA Q;  2UUA L;  2NVT H;  1EFW A;  2UUB L;  1EQQ A;  1X55 A;  1IZ6 A;  1N8R C;  4HJ9 A;  3KYH C;  3CPW A;  3OTO L;  1UEB A;  2VQE L;  3OYY A;  5IP9 G;  3I4M H;  5LMU Q;  3SGI A;  1X54 A;  2UUB Q;  3I55 A;  1VQA A;  3HOY H;  3CP0 A;  4IO9 A;  3OTO Q;  4DV4 Q;  1TWG H;  3CME A;  1C9O A;  1PV4 A;  4NB3 A;  2YU9 H;  4A3G H;  2UXB L;  2NVX H;  3I2Z A;  4BA1 I;  4DR2 L;  1NMG A;  1PH2 A;  5C0X G;  1JJC B;  1BVS A;  4KHP Q;  3HOX H;  4GS3 A;  1JB7 A;  4DUY L;  4A3C G;  4IPH A;  1Y1W H;  2D0P A;  4KHP L;  2RCN A;  3G4S A;  4DR7 L;  2XTI A;  1XNQ Q;  3PIP A;  4GLV B;  3BJU A;  5M5W H;  3DLL A;  2KCM A;  2ZTC A;  4YCU A;  1IBL Q;  3ICE A;  3S17 H;  5FLM G;  2WB1 E;  4LF5 L;  4IFD I;  4RMF A;  1SRU A;  2JA5 G;  4DR1 L;  1E7Z A;  2K5H A;  3A74 A;  4X65 Q;  1MJC A;  4AYB E;  1I3Q H;  1IBL L;  5C4X H;  4JI3 Q;  1WOC A;  1XNR Q;  3HOU H;  1S40 A;  3S15 H;  3STB D;  4XTC S;  4DUZ Q;  1YIJ A;  1EIY B;  2OWO A;  5HGQ A;  4JI6 L;  5LMN W;  1IL2 A;  3PSI A;  2E8G A;  3A0J A;  4JI3 L;  5C44 H;  1YHA A;  2ZTD A;  2NZH A;  2MO0 A;  5JEA J;  3ZJY C;  4ALP A;  3J7A 5;  3S1R H;  3RLN A;  1JJG A;  1RL2 A;  3UDG A;  4C3H H;  1AE2 A;  3TQY A;  4DV3 L;  4OO1 I;  3K7U C;  5IP9 H;  4LFA L;  2NZO A;  1N32 L;  3H15 A;  1YVC A;  2KCT A;  1HNX L;  2KEN A;  3S2D H;  4LF8 Q;  1QVF A;  3I7F A;  4JI8 L;  4LW1 A;  3GTQ H;  1C0A A;  4LUZ A;  4LFA Q;  1OTC A;  4FDB A;  1VQF A;  4B3T L;  2AHO B;  1HH2 P;  4JI4 L;  4DV1 Q;  1HR0 L;  1VS0 A;  5M3F H;  1IBK L;  3GTL H;  4BBR G;  4LFB L;  1PYB A;  3CCR A;  4R4Q A;  2UU9 L;  1CUK A;  3F2B A;  4JI4 Q;  3S1N H;  2E2J H;  1MIU A;  2D0O A;  2NN6 G;  3S1Q H;  1GKH A;  2KHJ A;  4NXN Q;  2ZJR A;  1UE5 A;  3MEF A;  4JBK A;  2CKZ B;  2HT1 A;  2VZA A;  4DK3 C;  2UUA Q;  3BZK A;  2JA8 G;  3HKZ E;  3M85 A;  4GNX C;  1FJG Q;  4NPS A;  2C35 B;  3BZC A;  1QUQ A;  2MQH A;  2JA8 H;  1NMF A;  2HHH L;  3I4N H;  2ES2 A;  1X3E A;  5IYD G;  4LFC Q;  5AJ3 L;  2AMC B;  1Z47 A;  2I5H A;  3U4Z A;  4UY8 C;  1G51 A;  2JA7 G;  1PH8 A;  4Y52 H;  4A75 A;  1VQC A;  1X6O A;  4YWL A;  1GO3 E;  5AJ3 Q;  2JA6 G;  3NBH B;  2HIV A;  3HOV H;  2UXB Q;  2RF4 A;  1HNW Q;  5IWA L;  3UE0 A;  4A3E H;  5EAY A;  2NVY H;  4JC0 A;  3CC7 A;  1OXT A;  1KXL A;  3M9B A;  4QY7 A;  1X9N A;  2VL6 A;  4R4O A;  4JI0 L;  1PVO A;  1QVG A;  3CW2 C;  2LXK A;  3RZO H;  3H3V H;  4A3M G;  1L1O B;  1WCM G;  4GLA C;  1B70 B;  3G6E A;  4HIO A;  1XNQ L;  4JI7 Q;  1Q7Y C;  3PF4 A;  4B3R Q;  4K0K L;  4P72 A;  4QGU A;  1KAW A;  4POG A;  2B63 H;  2EXD A;  4X65 L;  5E7N A;  1L0W A;  3S14 H;  1VQH A;  1J6Q A;  2IX0 A;  4BXX G;  2R7Z G;  1HZC A;  3I4M G;  4IJH A;  3S24 A;  2ZM6 L;  4A3I G;  4JI6 Q;  1N34 Q;  1SN8 A;  4LF6 L;  2YTY A;  3ERS X;  1OXS C;  3K7A H;  4UP7 A;  3U58 A;  2YV5 A;  3ER0 A;  3HFZ B;  4TQU S;  1KC8 C;  2E2H H;  1VQ5 A;  3AFQ A;  1TWF H;  1PA6 A;  1FVI A;  2K75 A;  4P75 A;  2JE6 I;  2Q2H A;  4X64 Q;  3RNU A;  1HNZ Q;  1TWC H;  3T1H L;  4HIM A;  1K73 C;  4A3G G;  4A76 A;  4DR6 Q;  4IFD J;  4DV3 Q;  1XJV A;  2K5V A;  5JJK A;  5C4X G;  3TRZ A;  1IXR A;  3JC6 6;  4GNX A;  4DR6 L;  4DAM A;  1HNX Q;  2R93 G;  1X3F A;  4JI8 Q;  3UDF A;  1KIX A;  1E3P A;  1PH6 A;  2PI2 E;  2N78 A;  3MXN B;  2ID0 A;  1VQP A;  1YI2 A;  1CSQ A;  1HR0 W;  4KLK A;  4GKK L;  1YHB A;  4DV1 L;  3EBE A;  3S2H H;  4P71 A;  1XPR A;  4QJF A;  3DM3 A;  4HJ5 A;  1FL0 A;  4DV2 Q;  2R92 H;  3GTG H;  3GTK H;  3E9I A;  1QZG A;  1PH3 A;  4JYA L;  1KRT A;  2ZJP A;  3GO5 A;  3KDF A;  3KF6 B;  3RN2 A;  1N9W A;  1VQN A;  2ZTE A;  4C2M H;  4PZ7 A;  4P73 A;  4YHH L;  1G6P A;  3HKZ G;  4PZ6 A;  4YWM A;  3UE1 A;  5LMN Q;  2F4V Q;  4DK6 C;  3CMA A;  2AWO A;  3AYH B;  3IRB A;  4JI5 L;  3CXC A;  1IBM L;  3GTO H;  5C3E H;  1HR0 Q;  1SR3 A;  3HOZ H;  3FKI G;  2Z6K C;  2AWN A;  1Q81 C;  3GD7 A;  4BBS H;  2Q2T A;  1B7Y B;  1W2B A;  3PUX A;  3TEH B;  2UXC Q;  1S72 A;  3L0O A;  1MKH A;  4DR3 Q;  4YCW A;  2PQA B;  3FHW A;  4A3J H;  4NXM L;  4A3L H;  1VCI A;  2JQO A;  1CKN B;  2QA4 A;  2UXC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...