4NXMQ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nxmQ00
5GAHC 3PO2G 1KAWA 3EN2A 2AHOB 1E1TA 2ZTDA 2OWOA 5FJ8G 4DV6Q 2PI2A 2XGTA 2ZM6Q 4BBSG 2JEAI 3PF4A 2E2HH 3B6YA 1S72A 1BBWA 1BKBA 1E24A 1WJJA 1X56A 3PV0A 4X6AH 2JA6G 4DK6C 4POFA 4IFDG 2CWAA 1PH5A 3CMAA 1H95A 4EX5A 3CP0A 4NXMQ 3CCEA 2R93G 1YZ6A 5C44H 1P16A 2VL6A 1MJEA 3KOJA 1WYDA 2PNHA 1K3RA 1YJNA 3I55A 4B3TL 2I5HA 2RHSB 4JI3L 1EWIA 4DV5L 4IPGA 1XTDA 3PUYA 3I4NG 2K75A 3MXNB 3A5ZB 1UE1A 1NMFA 3PO3H 5C4XG 3RNUA 4YHHL 2HIXA 2I5MX 3U50C 4EQ5A 4L5SA 4OWWB 4JI2L 2FXQA 1YJ9A 1WCMH 1UEBA 2BH2A 1OXXK 1SFOH 1EIYB 4R4CA 2E8GA 1JJGA 2WB1G 4LF4Q 4BBSH 4LF6Q 3U4ZA 1QUQB 2UUAQ 1TWAH 1X3EA 1YHAA 1QVCA 1X9NA 2BH8A 2VY3A 1EUJA 4BBRG 2B63G 1HNWL 3CC7A 1HZCA 5IYCG 5K36G 3GTQH 2VQFQ 3L0OA 2K52A 4IPCA 3PGZA 4QJFA 1X3GA 2Q2TA 5IYBH 3S1NH 2WP8J 4DK3C 4JOIA 4MTNA 4JI3Q 2VQFL 2VQEL 3SGIA 4OX9L 2LXJA 2C35B 3GTLH 4JYAQ 2UUAL 2XTIA 2Y0SE 3CF5A 1LM0A 3FKIG 1XPOA 4LFCQ 4OWXB 4LF4L 3G71A 4JC0A 2JQOA 3I2ZA 4DR3Q 1TWCH 4L5TA 4DV6L 1YITA 2N3SA 3S14H 5C0XG 3K7UC 5BR8L 1TWFH 2OTLA 4YCUA 4LF9Q 1B70B 4C3HH 4NXNQ 4LUOA 3TS0A 3CC4A 1FJGL 4YHHQ 4TVAB 4AYBG 2UU9Q 4JBWA 1Q82C 1Z9FA 3RLFA 5IYBG 4DV5Q 4P73A 4A3MH 2Z6KC 1R9TH 2JA6H 1Y1VH 3J81c 2YYZA 3KF6A 3RN5A 5M3FH 4GNXC 4NXML 2UUBL 4B3SL 4UP8A 1HZAA 3J81j 5M5YH 4UY8C 2JJQA 4JI8L 3U4VA 1GVPA 2PI2E 1E1OA 3ULPA 4RG1A 1FVIA 1CKOA 1MJCA 5JJLA 1KIXA 1TWGH 1IXRA 1QZHA 2MNAA 4DUYL 3M85A 3GO5A 1XMQQ 4JV5Q 1J6QA 3KDFA 5IY0A 2KHJA 3CCSA 2R7FA 4HJAA 1IBLL 2NVTH 3T1HL 4X66Q 2RHQB 4P72A 4NB3A 4DV7Q 2OQ0A 3G48A 5IT9c 2HIVA 5IYCH 3OW2A 5LMUL 2V1CC 1PH4A 3PIPA 2YU9H 2ZTCA 1WFQA 4K0KL 1L1OA 4O2DA 2AKWB 5C0XI 3T1HQ 3U58A 1TWHH 2LSSA 1JJCB 3GTGH 4BXXG 4J15A 4GOPC 5LMNW 1E22A 3CCUA 1XMQL 4GN3B 5JJKA 5EAYA 1KD1C 1GO3E 4NPSA 1A63A 4A3FH 1QVGA 4GS3A 1K9MC 3T1YQ 4HJ9A 4GLAC 3JAMc 1VQIA 4IPHA 3ERSX 4OO1G 1PVOA 1HZ9A 4GKKQ 2ZJPA 1TXYA 1OXUA 2WFWA 1OXVA 3NBHB 4Y7NH 4LFBL 4AYBE 2EQSA 4WJ4A 4JI4Q 1RIPA 1VQEA 3F2DA 3J7A5 4B3SQ 4X64L 1XNRL 3FP9A 5JJIA 1Q81C 1P8LA 4A3KG 3S1MH 2UXCQ 2R7ZH 1X54A 5C0XJ 3PO3G 2HHHQ 1VQ9A 3S15H 4ALPA 3G6EA 2UU9L 1YBYA 2GVBA 3HKZE 4L5RC 3M7NA 1IL2A 3OTOL 3UDFA 2NVXH 4IFDI 1K73C 1Q1EA 2IX0A 3CCMA 3RN2A 1KXLA 1N36L 3KJOA 1EFWA 4A93G 3PUVA 3ICEA 1QUQA 2N78A 3RLNA 4Y52H 4PZ8A 2QEXA 2YV5A 3M9BA 4JYAL 2CFMA 3EIVA 4DAYB 4DV4L 3VDYA 1PFSA 3OYYA 1VS0A 4RMFA 4OX9Q 3ZJYC 1RL2A 2NVYH 4R1JA 1XMOL 4HIOA 1HNXL 3RZOH 4BA2I 2KHIA 5LMNQ 3I4MH 4DR6L 4JBJA 4LFAL 2JA5H 2OQKA 4R4TA 2UXDQ 3KDFB 1MKHA 3TQYA 2LXKA 1G291 2N49A 1SR3A 2ATWA 2UXBQ 4HJ7A 4LUVA 1U0LA 4IPDA 5GAGC 4LF6L 5ELNA 4QL5A 1Y1WH 4A3DH 1CKNB 4HJ8A 1EQRA 4QIWE 3F2CA 4DR1L 2QA4A 3GTKH 4DNIA 1PH3A 2JA8G 3CMEA 2A8VA 1UE5A 4JI5L 1KHIA 5IE8A 3K7AH 4OONA 4YY3L 1NJIC 4IFDJ 4C2MH 4JI2Q 1HR0L 1AE2A 4GKJQ 4DV1Q 1N34Q 1N33Q 4LF7L 4HIKA 2IHEA 4QY7A 1CSPA 4P74A 3CD6A 2MFIA 1BBUA 1OXTA 2JEBI 4B3ML 4AQYQ 3M4QA 4B3TQ 2AMCB 3STBD 3GTJH 4B3RL 1A62A 2JA7H 1VQHA 1D8LA 1WI5A 4YWLA 4X65Q 5GAEC 3JAMi 3A5UA 2F4VL 1EYGA 1VQLA 2R7ZG 2RF4A 1FGUA 2MQHA 2VS1A 2YTVA 4GNXB 2CCZA 4A3CH 3AFPA 4UP7A 2CKZB 3W1GA 4DV0Q 2ZM6L 3FKIH 3S1RH 4A3EG 4JI1Q 2DGYA 1V43A 1IYJB 1SE8A 2ID0A 4AH6A 2K4KA 4JI0L 1QVFA 1XNQQ 1I5FA 2K14A 1HR0W 4PMWA 1XJVA 1Y14B 2VUMG 4ME3A 5IP9H 1YHBA 1I94L 1VQNA 1HJPA 2JE6I 3A74A 5M5WH 1YEZA 3UDGA 4DV2L 4LNQA 1W2BA 5AJ3L 4A3GH 1N9WA 4P75A 4B3RQ 1LYLA 1JB7A 4A3CG 3CQZH 3PIOA 2D0PA 2KCMA 4B3MQ 1PA6A 4A3LG 3I4MG 4IO9A 4JI6L 3I56A 2N8NA 1IBML 4LF7Q 1N33L 4KLKA 4DUZQ 2AWOA 3AFQA 2ZTEA 4R4QA 1IBKL 2IX1A 4C3JH 4LF5L 4FDBA 3H3VI 4YY3Q 1SMXA 5JEAG 2AWNA 3CCLA 2NN6G 3FHWA 1YJWA 4POGA 1U5KA 1Q86C 4LUZA 2NVQH 2OCEA 2ASBA 5FJ8H 2NZHA 4A3KH 3H15A 4DAMA 1PV4A 1M1KC 2I0QA 3GTOH 1XPUA 4C3IH 5C44G 4KHZA 3Q8DA 3M4OH 4A4IA 5IWAL 2ALYB 1HNZQ 1SN8A 3KF6B 3I4NH 4DR2L 4LFAQ 4BY1H 1VQFA 2Q2UA 3H3VH 5M3MG 5M3FG 3HKSA 3CCVA 1XMOQ 1X6OA 5FLXc 5C4JH 4IJHA 2ZJRA 1MIUA 4DV4Q 1C7YA 4X62L 1IZ6A 4JI7L 3F1ZA 2E5LQ 2K50A 3L2PA 2WB1E 4GLXA 2E2IH 1NBWA 1I50H 1E7ZA 3K81C 1G6PA 1VQ4A 4BY7H 1C0AA 3I4OA 2VUMH 1A0IA 3PF5A 2Z0SA 2UUCQ 3EBEA 4JI7Q 3J80i 2WAQE 1PYBA 4GN4B 4KI0A 4MNOA 1A8VA 4MZ9A 4QGUA 3M3YH 3S2HH 4DR2Q 1K0RA 3W1BA 3HFZB 1BVSA 5IWAQ 3PUXA 1HNZL 4YWMA 4LW1A 2NN6I 2QGQA 2VZAA 2YTXA 3BZCA 3WWVA 4DKAC 5C4XH 1KC8C 1Y1WG 2UUCL 4X64Q 3HOUH 1PH9A 4YWKA 4JI4L 5E7NA 4A76A 3KJPA 1D7QA 2KCTA 4A3BG 1LUZA 3NENA 1JJ2A 1GKHA 3DLLA 3KFUA 3T1YL 4YCWA 1L2FA 5GROA 2E5LL 4QQBX 4LF5Q 4X62Q 1UE6A 1S40A 3S1QH 1HNWQ 1IBMQ 3JC66 4DR7L 1S3OA 1VQOA 3TEHB 3AYHB 4OWTB 1K8GA 1VQ5A 5DLQE 3LGJA 4DV3Q 1PYSB 3IRBA 1B8AA 1VQMA 3HOXH 4HIDA 2DUDA 3PCOB 5M3MH 1AE3A 1NMGA 5AJ3Q 3BZKA 1G51A 2A1AA 4A3MG 1PH7A 3HOYH 4DV2Q 3S2DH 4X66L 1N32Q 1IBLQ 4GN5A 1C9OA 3G4SA 3W5OA 1J5EL 1YVCA 4DR4Q 4P71A 3HOWH 4O0AA 3NEMA 3CW2C 3AEVA 4JI0Q 3PUZA 3ULJA 1GD7A 1L0WA 4JI1L 4BY7G 4TQUS 2JK8A 3CCJA 4DUZL 1IBKQ 4GLVB 4DR5L 3KLWA 4JI6Q 4JI8Q 2VNUD 1EIFA 1KRSA 2IHFA 3UDXA 2A19A 4UPAA 2I5LX 4A3GG 3J7ZC 2OTJA 1Q8KA 2Z6KA 3CCQA 2MO0A 2UUBQ 3K80C 3BJUA 1N8RC 1OTCA 2R92G 4HIMA 3H0GH 1YHQA 1NY4A 2PMZE 4R4IA 4APVA 1XPRA 2F3IA 5JEAJ 4A3IG 4XIGS 1CSQA 2H5XA 1SLJA 2Y0SG 1V1QA 1FJGQ 3UE1A 4DR5Q 3CPWA 1L1OC 4DV1L 1N34L 4BXXH 1W3SA 3D0FA 3K0XA 1SRUA 3J80c 5BR8Q 5J3BA 3HOYG 2EXDA 1HZBA 1XNQL 1CKNA 3TRZA 4DR4L 3AQQA 4DR3L 1L1OB 4DPGA 3HOXG 4DR1Q 1OXSC 4BBRH 4HJ5A 4DV0L 1J5EQ 3ER0A 2B63H 2R6GA 4LFCL 2K5NA 1N32L 4BA1I 4IOCA 2HQLA 4YCVA 1AH9A 3M4PA 5FLMH 3L7ZC 4OXPA 2UXBL 3CAMA 2K5VA 4GOPB 1X3FA 4X65L 2F4VQ 2R93H 3GTPH 4DV3L 2VQEQ 2MO1A 3E9HA 3HOZH 4AQYL 2UXDL 3NELA 1VQGA 5LMNL 2GN5A 4A3IH 2F52A 4DR7Q 3K8AA 1HNXQ 3F8TA 1Q1BA 1VQPA 1UWVA 4PZ7A 1KL9A 4R4OA 3H0GG 1HR0Q 5IP7H 1Q46A 2D62A 5C3EG 4GNXA 1WOCA 3HKZG 2HT1A 3KF8B 5ELOA 3CC2A 3GD7A 2B29A 4JI5Q 3I7FA 1PH1A 1K8AC 4A3EH 3RZDH 2IY5B 4UP9A 1M90C 4JCVE 3TS2A 1PH8A 3UDIA 1O7IA 5GQOA 4XTCS 3S17H 3HOVH 1FL0A 2VW9A 1NE3A 3A0JA 2CQOA 3OTOQ 4A93H 2R92H 3E0EA 3S24A 1JT8A 1K83H 1VCIA 5GADC 4A3JH 4DR6Q 1EQQA 2L15A 5IP7G 5C3EH 2UXCL 2YTYA 4L5QA 1B7YB 4JG2A 3STBC 5M5XH 1KRTA 3MEFA 4A3LH 1Q12A 1JMCA 2JA5G 4WJ3M 4BY1G 3GTMH 4LWCA 4PZ6A 5H1SE 2JA8H 4IOAA 4LFBQ 1I3QH 1Q7YC 4A75A 1PH6A 4GKKL 1T9HA 1N36Q 2ZJQA 4A3DG 2B3GA 5IYDH 2D0OA 2GVAA 5FLMG 2CWPA 3UE0A 3HOVG 2KENA 3ULLA 5HGQA 1HH2P 1VQ7A 1VQCA 1Z47A 2RCNA 1DGSA 4LF8Q 2KBNA 1VQ8A 1V9PA 1YIJA 2HHHL 1VQKA 4KHPQ 1NTGA 4H02A 4GKJL 1I6HH 1PHJA 3HOUG 1VQAA 3RLOA 1Y1VG 5LMUQ 1VQJA 3D31A 1XNRQ 3J81i 2R7DA 3F2BA 1ASZA 1VQBA 3KYHC 3PO2H 4GOPA 4A3FG 4IJLA 5IYDG 1YI2A 1VQDA 4AIMA 5HY6A 2JA7G 1SROA 3PUWA 1UE7A 1CKMA 4A3BH 2NZOA 3CPFA 3BU2A 4DUYQ 1JE5A 1WCMG 3PSIA 3CXCA 1X65A 3TREA 2BA1A 2EIFA 2ES2A 3RR5A 1CUKA 4JBKA 1YNXA 3CCRA 5IP9G 3HOZG 3DM3A 2JA9A 3GDEA 2IT1A 4K0KQ 4JOIC 2WAQG 2Q2IA 1KQSA 1GM5A 1LTLA 1E3PA 4OO1I 1VQ6A 3E9IA 4DV7L 4KHPL 2E2JH 2Q2HA 4A3JG 4PG3A 2K5HA 1PH2A 2BA0A 3HOWG 1QZGA 1X55A 4LF8L 1I94Q 4JBMA 4NXNL 2PQAB 4JV5L 1EOVA 3S16H 2PQAA 4LF9L 1ASYA
chains in the Genus database with same CATH superfamily
3PO2G 5A35A 1E1TA 2ZM6Q 5FKAC 3GTKB 2JA8B 2HDMA 1ZYRC 1I3QB 1S72A 1BBWA 2NN6H 2FFKB 4IFDG 1DOKA 2EJGC 3CMAA 1EY4A 2LS01 3CRLC 2R93G 1P16A 3HOZH 2PNHA 3I55A 3MXUA 4DV5L 3H3VC 1XTDA 1I4PA 1CT1D 4KJOA 2CHBD 1WTQA 2HIXA 3U50C 3SDZA 3TN2A 3OSOA 3ZYYX 3DWPA 2BH2A 1OXXK 2F0EA 1SFOH 2DJGC 2E8GA 1JJGA 4CBVA 5FLXE 4BBSH 4LF6Q 1WCMB 2XNAC 1SYEA 1QVCA 2BH8A 2F1MA 1EUJA 2O2LD 2HQEA 5K36G 2F0IA 4A3JB 4QJFA 3S1NH 4IFDH 3V96A 2WP8J 5FLXL 2VQEL 4R8NA 4DK1A 2LXJA 1GUOA 2UUAL 1B9MA 1LM0A 1XPOA 4Y7NB 5C4XB 3G71A 2BDOA 4DR3Q 4DV6L 5E4WC 2N3SA 4G7HC 1STEA 5BR8L 4QCLA 3V2TA 3TS0A 3HP3A 4JBWA 3FVQA 2NWGA 5EPJA 2L4NA 1ONLA 4P73A 1R9TH 3URYA 3KF6A 4NXML 5M3FH 2Z8LA 3EA6A 2UUBL 4KV6A 4C3JG 1E1OA 1GUNA 4RG1A 3K57A 4MN3A 1KIXA 4DUYL 5C0XH 3M85A 2PPBC 3SK8A 4JV5Q 1J6QA 2L11A 3CCSA 2R7FA 4OHJA 1EY8A 2NVTH 3T1HL 2OQ0A 4FF2A 5IYCH 3SXHA 1BO0A 3Q0AA 3Q22A 2H1EA 5LMUL 1PH4A 2YU9H 2O5JC 4O2DA 2AKWB 3TZUA 4A3FB 3G6JB 2LSSA 3GTGH 3M7GA 1QNKA 2D9UA 5I9OA 1A63A 3A56A 4F7XA 4B9WA 2HDLA 2RDFA 1HZ9A 1OXUA 2QILA 3NBHB 4Y7NH 2EQSA 5IODA 1VQEA 4JI4Q 1I4GA 4X64L 1PYWD 4KY7A 4B08A 4M1UB 1WTWA 1EZ6A 2WKCA 1SJHD 1JR0D 2KQ3A 2UU9L 1YBYA 5IGGA 1S4ZA 3M7NA 2X6LA 4DAVA 1Q8IA 2NB0A 2NVXH 1JCKB 4K6DA 3BDLA 1SYCA 3RN2A 3CCMA 1N36L 3KJOA 1EFWA 3PUVA 4Q5VA 3ICEA 3H91A 3MHBA 3J7AF 1CHPD 4JYAL 4A3EB 1PFSA 1S5FD 1X3QA 4Z9CB 3NSWA 2NVTB 3ZJYC 1RL2A 1XMOL 1HNXL 5CV7A 4K5XA 2EZVA 4KK7A 3KDFB 1MKHA 2F0GA 3TQYA 2C5CA 4KD4A 1E2VA 2A6EC 3A7AB 4NDXA 4LUVA 4XT1B 5GAGC 5ELNA 1BQQT 4QL5A 4U673 1Y1WH 4HJ8A 1EQRA 4QIWE 3F2CA 3GTKH 3CMEA 1QNUA 4JI5L 1KHIA 3M4YA 3K5OA 1HA6A 1AE2A 4DV1Q 1N34Q 1STAA 4HIKA 4LF7L 2EXZA 3M4OB 1OXTA 3OMCA 2KJXA 2AMCB 1TT2A 2F4VL 3CKIB 1EYGA 3E3XA 1NNXA 3DUZA 2YTVA 4DNTB 3G7LA 4A3CH 3AFPA 2EYPA 2DNCA 3S1RH 2ID0A 1IYJB 4KKUA 4JI0L 2K14A 4PMWA 1HJPA 3I91A 5CV6A 3FEWX 5AJ3L 4A3GH 4P2CB 3A7LA 4BS9A 1NR4A 3J7YW 4B3RQ 5J39A 4DGZA 3KUPA 3NQIA 4A3CG 2D0PA 3R3OA 4B3MQ 4H0LC 4IO9A 1N33L 5D3DA 4DUZQ 4R4QA 2IX1A 1ESFA 1G8ZD 4X3UA 2B2WA 1HCZA 3FHWA 2L0CA 5C4ZA 2A6ED 2J0TD 3HG9A 4FO2A 4XDXA 1VMPA 2K28A 4KY5A 3CU7A 4A3KH 3H15A 2A5HA 3GTOH 1XPUA 2E74C 3VR5A 4C3IH 5C44G 4KHZA 5T1IA 2ALYB 1SN8A 1ESRA 4LFAQ 5CV9A 1GOZA 2Q2UA 1KDCA 1Q3LA 5M5YB 1X6OA 1AW7A 4JI7L 1H9RA 3NUCA 1EEFD 2E5LQ 4OGQC 1R4PB 3I70A 4BY7H 1R4QB 3RD4A 2VUMH 1STGA 3TSSA 2Z0SA 3WOEA 3JAME 1JQYD 3I4MB 1LTBD 3SR1A 3RZOB 4DR2Q 3BYTB 4FXGC 1K0RA 3W1BA 3HFZB 1ZEQX 1BVSA 5IWAQ 3PUXA 5I4DA 1SXTA 3MA2B 1MI2A 3S14B 1MSHA 2XIWA 1TR5A 4A76A 1KNEA 1TS2A 1I4XA 4ZAIA 1L2FA 1S40A 3S1QH 3MC0B 1EWCA 1IBMQ 1GJXA 1VQOA 3AYHB 2NTSA 3GTOB 3BVMA 2IWHA 1VQMA 1B8AA 1IW7D 1EL0A 3EFXD 4V190 5I2XA 1PH7A 4RA8A 4X66L 1J8IA 4GN5A 3NE5B 2WIIB 3HOWH 2IW3A 1L0WA 3CCJA 1V1PB 2HCCA 4JI8Q 2VNUD 2JN4A 1ZXTA 1ENCA 2I5LX 2OTJA 3CCQA 2MO0A 5CV4A 5KYIA 2WINB 2R92G 1M8AA 4R4IA 4APVA 1TS3A 5JEAJ 1CSQA 5JVH3 3S16B 1Y8PB 3K0XA 1SRUA 3Q23A 1B9NA 5J3BA 3QOLA 3HOYG 2M00A 4KD3A 1XNQL 1TWHB 4DPGA 1WTHA 4RKBA 4DR1Q 4DV0L 1HRJA 2R6GA 2XWJB 1H9MA 4YCVA 1AH9A 4GOPB 3BZDB 4BBRB 4IUNA 1Y8OB 4AQYL 3DMUA 1VQGA 2F52A 3V05A 2B8GA 2M9VA 1KL9A 1HR0Q 3H0GG 4GKJL 1V8QA 3HKZG 2R7ZB 2HT1A 5ELOA 3CC2A 3GD7A 2B29A 3P75A 2SDFA 2KCCA 4JCVE 4O1NA 1ENFA 3J80L 4XTCS 4IZ8A 1G2TA 2ENBA 2VW9A 3GV3A 4CKEA 1D1KA 3MFGA 1JT8A 1PTOF 5I2YA 1T5XD 1GHKA 4RH6A 4HEDA 3STBC 1BUVT 1XTCD 1JMCA 3MTSA 4IOAA 4LFBQ 4GKKL 2D0OA 5FO9B 2CWPA 3UE0A 3ULLA 4L63B 5HGQA 1EY7A 3DXJC 2HHHL 1D1IA 5C5MA 4TSSA 1NTGA 3NBIA 4WJWA 3OWEB 2L12A 5A2QE 1ASZA 3FRPB 1QILA 1B1ZA 1IHZA 2NBFA 1EIGA 1WCMG 3TREA 4JBKA 3S1NB 3DM3A 3SK6A 1B3QA 3HOVB 3H0GB 1KQSA 2RDGA 1QG7A 2A73B 3TZDA 2N88A 1LV9A 3GTLB 2Q2HA 3DHQA 4ZLTF 3HOWG 5C3EB 1EOVA 4U68A 5GAHC 1I4QA 5EPLA 2OWOA 5FJ8G 4HMJA 3D6WA 4BBSG 1A3VA 4EVOA 3D4WA 1WJJA 1X56A 2TSSA 3PV0A 4MHEA 4TKOB 2JA6G 4DK6C 1Y1VB 4POFA 4X6AH 1AP0A 5KEEA 4EX5A 3N6RA 3CCEA 4XXEA 5C5LA 2VL6A 4F8MA 1I6VC 1WYDA 3KOJA 1MJEA 2RHSB 5EPKA 1EWIA 2F0SA 2FINB 4IPGA 3I4NG 2K75A 3A5ZB 1UE1A 1NMFA 1AZPA 2F3WA 1KAAA 2I5MX 4EQ5A 1JB3A 4L5SA 3KLRA 2K6AA 4WFN3 4OWWB 1X3PA 1II3A 1UEBA 2Q8TA 3MWYW 1EIYB 2ZXPA 4A3BB 1GUSA 2WB1G 4PV1C 1E2ZA 4RHRA 2R61A 1G2SA 2PQEA 1A3UA 2K32A 2IJ0A 1X3EA 1O78A 1YHAA 2VY3A 2B63G 3NPPA 2G9HD 1SNDA 4IPCA 2L55A 3R93A 3LX0A 1O7LA 4JI3Q 2D2CC 1SMYD 4JYAQ 5FOBB 2XTIA 1QWYA 4JC0A 3I2ZA 1PXUA 5IGDA 1RF2D 5C0XG 3K7UC 2OTLA 4YCUA 3BG3A 4LF9Q 2JA6B 4C3HH 4NXNQ 2CQAA 4C2MB 4TVAB 2UU9Q 5IGFA 2E75C 1Z9FA 2FMCA 4IUUA 4NP5A 3C3LA 1SMYC 2Z6KC 1L0XB 1Y1VH 2YYZA 1AZQA 4RFBA 1HZAA 3J81j 2BCOA 2KEDA 5CORA 4EQPA 3U4VA 1F2MA 1WTXA 3HRZC 3Q24A 1SNCA 1JOKA 5IY0A 1PTOH 4IUQA 1IBLL 3NTIA 4QUCA 3MXGA 2V1CC 2A68D 3MZ5A 3C2PA 2KEEA 4J8QA 3T1HQ 3J81L 1PZKD 1STYA 2BE5C 1E22A 2HD3A 5EAYA 5KRUA 1KD1C 1GO3E 4NPSA 3OOCA 5KNBA 4GS3A 1K9MC 2SNMA 4GLAC 4HJ9A 1TKWB 2PCFB 1XX8A 4IPHA 3ERSX 1TWCB 1TXYA 2ZJPA 3VR2A 4N8FA 4AYBE 3J7A5 5IGBA 1SSOA 3S1MH 2UXCQ 1X54A 2HHHQ 2XN9C 2GVBA 4L5RC 1IL2A 3OTOL 2BOSA 3UDFA 4IFDI 1EYAA 1KXLA 2XRSD 3C1EA 1KDBA 4A93G 4OIKA 2JSOA 1MHWC 4CJ0B 4PZ8A 2QEXA 2YV5A 2CFMA 3RZDB 4DV4L 1VS0A 4AYBB 4R1JA 3RZOH 3C46A 3I4MH 3MFYA 4G7ZC 1RTNA 2LXKA 1SR3A 2ATWA 4HJ7A 3MAQA 4IQZA 4IPDA 4LF6L 3TP5A 2K33A 1EIHA 4V0BA 1PH3A 3Q6SA 4K8JA 4R8IA 2JA8G 2A8VA 1LT5D 1UE5A 5IE8A 3VA7A 1JWSD 3K7AH 3N52A 5HURA 5JAVA 1HR0L 4GKJQ 1G91A 4RHSA 1CSPA 4P74A 2MFIA 3MEHA 4AQYQ 2A74C 2EJFC 3DEPA 1BF4A 2A6HC 3STBD 5T1GA 4YWLA 1C4QA 1D8LA 5GAEC 2B8FA 1M4VA 2RCFA 3A5UA 1QOHA 1PRTD 2MQHA 5D65A 4DV0Q 2ZM6L 4A3EG 1XNQQ 4AH6A 4I65A 1H9SB 3NWSA 1HR0W 1XJVA 4ME3A 5IP9H 1YHBA 1I94L 1F9PA 3D3RA 2F0PA 1YEZA 3UDGA 3QJYA 4DV2L 2G5DA 4A93B 1W2BA 1A6XA 3S9WA 1N9WA 1LT3D 4P75A 1JB7A 1LLRD 3CQZH 1EEID 3PIOA 4RGMA 2KCMA 1PA6A 1IW7C 5C3WA 2N8NA 2DNEA 1VF5C 4KLKA 2AWOA 3AFQA 4C3JH 1QCBD 2F0FA 4YY3Q 1HTLD 4O42A 5DAUA 5JEAG 1A15A 3K0YA 2Z4IA 1F9SA 2XVSA 3HOZB 2NVQH 3NP8A 4G7OC 2I0QA 4XT3B 5EKLA 1DZ1A 2B2VA 3Q8DA 3M4OH 3IKJA 3KF6B 3H3VH 1EQTA 3K58A 5M3MG 5M3FG 3CCVA 4RAUC 4IJHA 1MIUA 2RQXA 3EROA 3F1ZA 1GHJA 5JVG3 2K50A 2WB1E 2EY6A 4GLXA 1HUMA 2E2IH 1K0SA 1G6PA 4IUVA 1VQ4A 4EQOA 1ILPA 4JK1C 4ZQ3A 2LY7A 1A0IA 3PF5A 3TP8A 3EBEA 1KNAA 3D6CA 4MZ9A 4QGUA 3QO2A 2KA7A 1FNVA 1BDOA 2ICIA 1J9OA 4H44C 4LW1A 2NN6I 4DKAC 4CKCA 1IKMA 1PDQA 3KJPA 1ML0D 2KCTA 1Z6HA 4HSVA 2KHSA 1JJ2A 3DLLA 5M9OA 3T1YL 4BWGB 1UEAB 2E5LL 3HOXB 1JWMD 2IPKD 2RVLA 3MXNA 3UI2A 3I4LA 4DR7L 3T51B 5I6WA 3KF8A 1TWFB 1EZ8A 3LGJA 1PYSB 4ZUJA 4A3KB 3HS0C 2A69C 3PCOB 1X32A 1DYQA 4C3IB 4A3MG 3T13A 4DV2Q 2G9DA 2K03A 1C9OA 2F0HA 3W5OA 1YVCA 4P71A 1V1OA 2IX3A 3NEMA 3CW2C 3I8ZA 3PUZA 3OHXC 2MHVA 4DUZL 1SYGA 3HZXA 4CHTB 3KLWA 5ELEA 3BVZA 2QCPX 1TWAB 3UDXA 4DAYA 2NYZD 4A3GG 4LK1C 2O4XA 4S3SA 2PW7A 3K80C 1HPCA 2K1BA 5JPNC 2MGSA 2PMZE 4K6LA 4K2LA 2QW7A 2K7VA 2Y0SG 1LTTD 3S2HB 3SEBA 4C3JB 1AEXA 4DR5Q 1FJGQ 1RJTA 1W3SA 3D0FA 4HR7B 4X3KA 2F0KA 3J80c 1CKNA 1L1OB 1J5EQ 2B63H 4JPBW 3MVVA 1CA6A 2AQ2B 4LFCL 1N32L 4IOCA 2HQLA 3M4PA 2BDNA 4OXPA 3AMUA 4ID6A 1X3FA 2AUKA 4XQNA 2F4VQ 2CW0C 1RCVD 2E2DC 2ZXRA 3P20A 4UDUC 3NELA 2GN5A 2EY2A 1CM9A 1Q1BA 1VQPA 3GTPB 5C3EG 1Q46A 4XYOA 4JI5Q 4K8IA 4FYDA 3RZDH 2BE5D 2IY5B 1M90C 2L1BA 1PH8A 1KLGD 5DNFA 2F0WA 2F3VA 3OTOQ 4HSPA 2R92H 3E0EA 2Q8IB 3S24A 4NKLA 4A3JH 3C1FA 5C3EH 2UXCL 4WORA 2YU9B 1CK1A 4A3LH 2JA5G 2NZ1D 3IAYA 4PMCA 2RKSA 4LWCA 3NTKA 5H1SE 1Q7YC 3A8IE 4A75A 2Z9HA 1T9HA 1N36Q 5CBAE 5FLMG 2ICEC 4E6IA 3QR8A 2WAQB 1DGSA 4LF8Q 5E3FA 1W6JA 3IFDA 1RD9D 3E6ZX 1U4MA 1JOQA 4H02A 3HOUG 1VQAA 3RLOA 5CC4A 1NUCA 1VQJA 3D31A 1PZID 3F2BA 4KY6A 5IT9E 2DN8A 3OIQA 4A3FG 2PZTA 1YI2A 3R8BA 2JA7G 1CQFA 1F2LA 4A3BH 2L5TA 1LTID 1PZJD 2DY7A 2NZOA 1JE5A 2B2TA 5CV8A 3CXCA 1O7YA 3RR5A 1CUKA 1KABA 1ET6A 3CCRA 3FKIB 2JA9A 2ZXOA 3GTQB 1HUNA 1D2BA 2AQ3B 2Q2IA 1GM5A 1LTLA 3MXPA 4CJ1B 4GZYC 3CRKC 4PG3A 1U9RA 5CV5A 2BA0A 3DWQA 4LF8L 1HHVA 4NXNL 1SAPA 3HOXH 4JV5L 3K59A 3S16H 4LF9L 3EN2A 2AHOB 3H94A 4Q0FA 3PIP3 2AUJD 2WB1B 2JEAI 3PF4A 4OO1H 3B6YA 1IYVA 3NK9A 1PH5A 1H95A 4NXMQ 5E1FA 1YZ6A 2KVMA 5G3LD 3SHLA 4C3IG 5C44H 4A3MB 1I4RA 1K3RA 4B3TL 2I5HA 4JI3L 5CGKA 3H6MA 4RKLA 3AU7A 3PO3H 2Y0SB 1RDPD 2FXQA 1YJ9A 3T53B 1TS4A 4IUTA 5DM63 3U4ZA 1RODA 2UUAQ 1TWAH 5D14A 5M5WB 1HZCA 5IYCG 3L0OA 2K52A 2PMZB 3PGZA 4KKTA 5IYBH 2EY5A 1MGSA 4DK3C 2VB2X 3GTLH 4J6HA 2Y0SE 3FKIG 1MBYA 4LFCQ 4OWXB 2JQOA 1F2ZA 1YITA 1TWCH 4L5TA 1WTPA 3BS1A 3W3AA 4RWSC 1RKNA 3CC4A 1FJGL 4OIJA 4KKSA 4AYBG 1EFID 1Q82C 3FPPA 3K6OA 3RLFA 5IYBG 4DV5Q 3NHHA 4ZRZA 4OL7A 3J81c 3DWAA 4GNXC 3PO2B 4X3TA 1GUWA 4B3SL 5M5YH 4UY8C 2PI2E 3VR4A 3ULPA 2IL8A 5FO8B 1PTOB 1NAPA 1CKOA 1S5BD 1TWGH 1IXRA 2K5DA 1SDFA 1QZHA 1JORA 1GXDC 3OPOA 5HGTA 3KDFA 2KHJA 3L9AX 4HJAA 5ELCA 2RHQB 4P72A 1EY0A 5NUCA 1EYCA 3OW2A 3P7JA 1ET9A 2ZTCA 3KK7A 4K0KL 1Y1WB 2PNRC 5C0XI 2KUMA 1JJCB 5JJKA 4GOPC 5LMNW 1XMQL 4FF1A 1MSGA 1K3BC 4A3FH 3T1YQ 3JAMc 1VQIA 1ZYRD 1E0BA 1PVOA 4GKKQ 1TY2A 1OXVA 4LFBL 1RIPA 3LNNA 3F2DA 1NR2A 3FP9A 3P1HA 4MIUA 4PMBA 4A3KG 2R7ZH 2NVXB 1R9TB 3S15H 3G6EA 2A69D 3A55A 1B3AA 4FP5D 1PLFA 1STNA 2OF1A 4HTHA 1K73C 1Q1EA 2IX0A 2E76C 3RLNA 1B44D 3M9BA 2WV6D 1F9RA 3EIVA 4DAYB 1A2TA 4ZKBB 5K36H 4RMFA 4OX9Q 2NVYH 4BA2I 4NMZA 4KN7C 2KHIA 4K5WA 4DR6L 4TRDA 2OQKA 4KHVA 2N49A 1EYDA 1DOLA 2K01A 3I3CA 5KYLA 3A8KE 1U0LA 4QF4A 1WD0A 5D3IB 1CKNB 1DXMA 4JVZA 4DR1L 5AFWA 2PYKA 4YY3L 1NJIC 2OEOA 1F77A 4JI2Q 1VDZA 3ND8A 2IHEA 4QY7A 2F0NA 1HFNA 1LABA 1JICA 2JEBI 5ELFA 1JOOA 1UAPA 4FF4A 3NBHA 1VQHA 1WI5A 1BXTA 3JAMi 3HOYB 2CCZA 2VS1A 2EYMA 1TY0A 1CHQD 3WOFA 3FKIH 1V43A 1SE8A 1FNWA 1AFPA 2VUMG 1Y14B 2D5DA 1VQNA 3A74A 3D4DA 4ZCKA 3EVQA 2KECA 1ILQA 3LWUA 4H13C 1D5XC 3PQIA 5C6AA 2B2YC 1K83B 3D8GA 4JI6L 3I56A 5I9PA 1PRTF 1IBML 1A3TA 2DJFC 4MTKA 2ZTEA 2P5ZX 3PIO3 1SEBD 1SMXA 4CKBA 3CCLA 2AWNA 2NN6G 1YJWA 1WTRA 4RCNA 4POGA 3HGBA 1U5KA 1DM0B 4LUZA 2OCEA 2ASBA 3OW7A 2FMMA 4DAMA 1PV4A 1M1KC 4CJ2C 3K5NA 1B4OA 3VR3A 5KIXA 5IOCA 4A4IA 5IWAL 1TQOA 5G3LF 3I4NH 4DR2L 1PRTC 3KLSA 1XYIA 3HOWB 1PTOC 1EU4A 2QDLA 1C7YA 1CQVA 4DV4Q 1IZ6A 4BY7B 1EOTA 2JA7B 2F0JA 5EKKA 2LMCB 1NBWA 1PMRA 4I7AA 1E7ZA 2VB3X 1C0AA 3I4OA 2B2TC 2E2IB 1PRTB 4JI7Q 3L3OC 5BN5A 4GN4B 4KI0A 4MNOA 3M3YH 3X3MA 4YWMA 2QGQA 3WWVA 5C4XH 2UUCL 1GUGA 3HOUH 4FF3A 5JEAH 4YWKA 3VYSA 5E7NA 4A3BG 1CZWA 1LUZA 3NENA 1GKHA 2MP1A 3KFUA 4YCWA 4CDCC 1LO5D 4X62Q 1UE6A 4CGYB 1FYCA 1HNWQ 1S3OA 4A3IB 1ENAA 3TEHB 1E2WA 2XSCA 4OWTB 1VQ5A 4I7ZC 5DLQE 1YNJC 2K05A 4DV3Q 3IRBA 2SEBD 5CYUA 4HIDA 2DUDA 1W6KA 4ODGA 1AE3A 1NMGA 5AJ3Q 4DFAA 2A1AA 5EBDA 3S2DH 1IBLQ 3X3NA 3G4SA 4DR4Q 1BOSA 4QIWB 4JI0Q 1S5ED 2B2UC 3ULJA 3E5SA 4BY7G 1SNOA 2JK8A 1IBKQ 2F0VA 2NVYB 1KRSA 1TWGB 2A19A 3J7ZC 1Q8KA 1A2UA 1N8RC 1XPRA 1XXGA 1Y69U 2H5XA 3UE1A 1L1OC 4NW2A 3GP7A 3BDCA 4K14A 2F0OA 2K5QA 4K5VA 4DV1L 1N34L 2CH4A 4BXXH 2F0UA 2EXDA 2M2LA 4ZUIA 3TRZA 1K8OA 4DR4L 3AQQA 5BN3A 5IGCA 3GTGB 4HJ5A 3ER0A 3BDOA 4BA1I 4HN7A 4CDDC 5COYA 3GTJB 3L7ZC 2K5VA 4FXDA 4X65L 2B63B 2R93H 4DV3L 3I90A 1BR9A 2MO1A 3E9HA 3QOJA 1WVLA 1Q90A 3TDQA 4A3IH 3K8AA 1HNXQ 1HNWL 4PZ7A 4R4OA 4LAAA 5IP7H 2JP1A 4GNXA 1SNMA 5BN4A 3I7FA 1PH1A 4A3EH 3PMFA 4UP9A 3KBXA 5JJZA 3SVMA 3ND9A 1O80A 3R2TA 2CQOA 5C3XA 4FVMA 1GUTA 2B39A 1SE3A 5M5XB 4HMIA 2Z4HA 5GADC 2WACA 1EQQA 2L15A 5IP7G 1IL8A 1V1PA 2YTYA 3NWTA 1SE2A 4L5QA 1B7YB 4JG2A 5M5XH 5IT9L 4DN4M 1U4PA 1EU3A 5K5PA 2JA8H 4H7BA 3ITPA 1HTPA 3FMCA 2EPBA 4A3DG 1U4LA 2Q8RE 2B3GA 1F9QA 1O7ZA 4ZKCB 5IYDH 2GVAA 5IGEA 4ILWA 2RCNA 3VYUA 3I4NB 1VQ8A 1YIJA 2QKIC 2I07B 1I6HH 1PHJA 1EWHA 5C4HA 2FJ2A 5LMUQ 3S1RB 1XNRQ 3J81i 2R93B 5M3FB 1VQBA 3KYHC 2PZUA 4GOPA 1LTRD 4DAPA 5CBEE 1VQDA 1SFOB 1SROA 1UE7A 1CKMA 3F2UA 3J81E 3CPFA 2NTTA 2GA4B 3OMGA 4DUYQ 3PSIA 1X65A 5ELBA 2BA1A 2ES2A 2CH4W 2V4DA 4G57A 2C9OA 3AB9A 2WAQG 3FPUB 4K2KA 2X69A 2HUGA 1STBA 3DEOA 3E9IA 4KN4C 4ZK9B 4DV7L 2K04A 2EVBA 2E2JH 2AQ1B 5KGUA 2EYLA 2I46A 2K5HA 4A3JG 1PH2A 3VYTA 2EDGA 4YIJA 1QZGA 4JBMA 2JA5B 5LHY1 2PQAA 1ASYA 2EJMA 1BCPD 1KAWA 2ZTDA 4DV6Q 2PI2A 2XGTA 2E2HH 2SNSA 3HEJA 1BKBA 1E24A 1DJRD 5CR3A 4DXFA 2CWAA 3CP0A 1SNPA 2F0DA 3QWNA 1CA5A 1RTOA 1IYUA 1YJNA 3NXWA 4J1MA 5EBCA 3PUYA 5CMDA 3MXNB 3VYRA 5C4XG 1KTKA 1EY6A 4QB4A 4YHHL 4DF7A 3RNUA 4RGOS 3ONAB 4JI2L 2RSOA 4X3SA 1WCMH 4BY1B 2OXPA 1D5ZC 5EKIA 1QB5D 4R4CA 2KCNA 4LF4Q 1FR3A 1QUQB 1HQRD 1X9NA 2RSNA 1QE6A 1SYFA 3EQLC 4BBRG 3VA5A 3CC7A 3GTQH 2VQFQ 2CW0D 1X3GA 2Q2TA 4JOIA 4MTNA 2VQFL 5JPMC 3SGIA 4CDEC 4OX9L 3U9SA 2C35B 2E2JB 1B53A 3CF5A 2B2YA 4IALA 2QF7A 5FK9C 4LF4L 1VMCA 3S14H 2X6GA 1TWFH 1EY5A 5LL6X 1XWEA 1SBBB 3TMEA 3BVGA 1B70B 1PFBA 4LUOA 4YHHQ 2F0TA 1BNZA 2K5WA 2JA6H 5C44B 4A3MH 3S15B 1WTOA 3RN5A 2EYHA 4DA2A 4UP8A 5TSSA 4G4KA 2JJQA 4JI8L 1GVPA 4HCEA 1FVIA 5JJLA 1MJCA 3D4RA 1QJOA 2MNAA 3GO5A 1XMQQ 3RUZA 4X66Q 2PZWA 3J7AV 1OO9B 4NB3A 4DV7Q 5IT9c 3G48A 2HIVA 3PIPA 4OELB 1BCPB 1LT6D 1WFQA 1L1OA 2A68C 5J1ZA 4OEMB 3U58A 1TWHH 2QDBA 4BXXG 4J15A 4CDFC 3WDNA 3CCUA 4GN3B 5A2QL 1QVGA 1FNUA 4QMGA 2F0LA 4OO1G 3BYYB 3U9OA 2NUCA 2WFWA 4WJ4A 1BCPC 2RA4A 4B3SQ 5FO7B 1XNRL 4HAEA 4ZYSA 5JJIA 1Q81C 4C3HG 5IIFA 1P8LA 1LTGD 4C56C 5C0XJ 3PO3G 1VQ9A 4XYQA 4ALPA 1UNSA 1YNND 1SNQA 3HKZE 2R3ZA 1ICFB 2LKVA 4UAIA 2MJ8A 2VUMB 1QUQA 2N78A 2RDHA 1CTMA 1D6EC 4Y52H 2EY1A 4N9TA 1DONA 1TS5A 1KDAA 3VDYA 3OYYA 4RGTA 4HIOA 3FDTA 1T5EA 5LMNQ 2B2VC 1TU2B 2N55A 4JBJA 3CHBD 1MD2D 1K28A 2JA5H 4LFAL 4R4TA 2UXDQ 2R92B 3LWEA 3NTHA 1G291 1K8MA 2UXBQ 2F0QA 3TP6A 5LL6S 4R9WA 1I4HA 4N8X1 4F88A 4A3DH 4ABNA 2QA4A 4DNIA 1H9KA 3T56B 4IFDJ 2FHTA 4OONA 4C2MH 2EYJA 1N33Q 3CD6A 4B3ML 1BBUA 3K7AB 3M4QA 2MUYA 4B3TQ 1ICWA 3PO3B 3GTJH 4B3RL 1A62A 1LACA 2JA7H 4X65Q 1HXYD 1VF7A 3S2DB 4M8AA 4LMQD 1I50B 1VQLA 3HKZB 2RF4A 1FGUA 4GNXB 2Z1CA 2R7ZG 4UP7A 3VR6A 2CKZB 3W1GA 4JI1Q 2DGYA 1STHA 1QVFA 2K4KA 4ULLA 4QUFA 1I5FA 1B2TA 2JE6I 5M5WH 5KNCA 2A6HD 5KNDA 3CQZB 4RCOA 4LNQA 4C1NK 3EJIA 3HOUB 5J22A 3DM1A 1LYLA 3O13A 4DK0A 4A3LG 3I4MG 4LF7Q 2B2WC 4RGNA 1H9JA 1ZKOA 1IBKL 3QB3A 4LF5L 4FDBA 1C48A 3H3VI 1TIID 1FGBD 4A3DB 3KLSX 1BCPF 4L6TB 1Q86C 3I73A 1JWUD 5FJ8H 2NZHA 3QIAA 1F2YA 3SE0A 5F2DA 2DY8A 1HNZQ 1TVXA 1NSNS 1B50A 4BY1H 1VQFA 1I6HB 3HKSA 1XMOQ 5FLXc 5C4JH 2VXWA 2ZJRA 3T4AC 3T16A 4X62L 4FXKC 1HA5A 3L2PA 5L37A 1BBXC 3H09A 1I50H 1CZGA 3K81C 4ME5A 2EOTA 1DD2A 1U4RA 1KLUD 2PW5A 2F03A 2UUCQ 3J80i 2WAQE 4IN3A 1AN8A 1PYBA 4N9PA 1A8VA 5DM73 2EYFA 5EJWA 1H9SA 3S2HH 4EGVA 1HNZL 2VZAA 2YTXA 3BZCA 3IFTA 1KC8C 1Y1WG 4X64Q 1PH9A 1YNJD 2O5IC 3TP7A 4JI4L 1D7QA 4XQJA 3GV6A 5JOBA 1G6ZA 2RBMA 5GROA 4QQBX 4LF5Q 4PQXA 4KJNA 5E4XA 4KTAA 3JC66 3R2IA 1DCZA 5DEHA 2J4XA 1K8GA 3S1MB 1S5DD 3A8JE 4WRDA 4KMUC 2NVQB 2JYOA 2MPMA 3GQBA 5M3MH 5EGTA 3BZKA 1G51A 3RMHA 3HOYH 1Y8NB 1SE4A 4C1NI 1N32Q 1J5EL 5M3MB 2CVRA 2LFNA 4O0AA 1SYBA 3AEVA 5ELDA 4LJZC 3SK4A 1GD7A 1UUPA 3E0JA 4JI1L 4TQUS 4GLVB 4DR5L 2TMPA 3SK5A 2B2UA 4JI6Q 1EIFA 2IHFA 4UPAA 2EYOA 2UUBQ 2Z6KA 2HCIA 3BJUA 1PTOD 1OTCA 4HIMA 3H0GH 2F4IA 1YHQA 1NY4A 1SJED 2XWBB 2F3IA 4A3IG 4XIGS 3M3YB 1SLJA 2SOBA 1V1QA 1C8CA 3ERQA 3CPWA 4DNRB 1EY9A 3K5MA 5BR8Q 1HZBA 1HFGA 4DR3L 3HOXG 1OXSC 4BBRH 1YNNC 2K5NA 1PFNA 5FLMH 2UXBL 1RHPA 2F0MA 3CAMA 2KOLA 4PNYA 1PFMA 3GTPH 2VQEQ 3S1QB 2UXDL 1WTVA 4HCSA 5LMNL 4XQQA 3W2DA 4DR7Q 3F8TA 3NQTA 1UWVA 2D62A 1WOCA 1CFMA 1LTSD 3KF8B 5C4JB 3S17B 1K8AC 1Z7TA 4IUPA 3A54A 3TS2A 3UDIA 1JE4A 1O7IA 3IL8A 1LTAD 5GQOA 3S17H 3HOVH 1FL0A 1NE3A 3A0JA 1SYDA 4A93H 4A3GB 3K5LA 2QEJC 1K83H 1VCIA 4DR6Q 3I72A 2J7ZA 1KRTA 3MEFA 1Q12A 4WJ3M 4BY1G 1CI3M 3GTMH 2E2HB 4PZ6A 4F87A 1I3QH 3QG1A 1L0YB 1PH6A 2ZJQA 4EQNA 3GTMB 3HOVG 1WD1A 2KENA 4C3HB 2EE1A 1HH2P 2ZT9C 1VQ7A 1VQCA 1Z47A 4L8JA 2XRQD 2KBNA 2H4OA 1V9PA 4IURA 4B9XA 4UHVA 1VQKA 4KHPQ 3KBGA 1IKLA 2Z6BA 1Y1VG 5EQ0A 2R7DA 2WKDA 3PO2H 2L9HA 4IJLA 5IYDG 4BBSB 4AIMA 4FNFA 5HY6A 3PUWA 1NCVA 1S5CD 3BU2A 1LT4D 2EIFA 1DOMA 1YNXA 3OWFA 5IP9G 3HOZG 1HQMC 4DXGA 3GDEA 3JAML 1FD7D 3J80E 2IT1A 4K0KQ 2PO4A 4JOIC 4JW0A 1E3PA 3OIPA 4OO1I 4DU9A 1EQVA 5I6YA 1VQ6A 4KHPL 1D5MC 3TBIB 2OT2A 1X55A 1I94Q 2PQAB 5ISRA 1JC7A 2JXMB
chains in the Genus database with same CATH topology
5GAHC 3PO2G 1KAWA 3EN2A 2AHOB 1E1TA 2ZTDA 2OWOA 5FJ8G 4DV6Q 2PI2A 2XGTA 2ZM6Q 4BBSG 2JEAI 3PF4A 2E2HH 3B6YA 1S72A 1BBWA 1BKBA 1E24A 1WJJA 1X56A 3PV0A 4X6AH 2JA6G 4DK6C 4POFA 4IFDG 2CWAA 1PH5A 3CMAA 1H95A 4EX5A 3CP0A 4NXMQ 3CCEA 2R93G 1YZ6A 5C44H 1P16A 2VL6A 1MJEA 3KOJA 1WYDA 2PNHA 1K3RA 1YJNA 3I55A 4B3TL 2I5HA 2RHSB 4JI3L 1EWIA 4DV5L 4IPGA 1XTDA 3PUYA 3I4NG 2K75A 3MXNB 3A5ZB 1UE1A 1NMFA 3PO3H 5C4XG 3RNUA 4YHHL 2HIXA 2I5MX 3U50C 4EQ5A 4L5SA 4OWWB 4JI2L 2FXQA 1YJ9A 1WCMH 1UEBA 2BH2A 1OXXK 1SFOH 1EIYB 4R4CA 2E8GA 1JJGA 2WB1G 4LF4Q 4BBSH 4LF6Q 3U4ZA 1QUQB 2UUAQ 1TWAH 1X3EA 1YHAA 1QVCA 1X9NA 2BH8A 2VY3A 1EUJA 4BBRG 2B63G 1HNWL 3CC7A 1HZCA 5IYCG 5K36G 3GTQH 2VQFQ 3L0OA 2K52A 4IPCA 3PGZA 4QJFA 1X3GA 2Q2TA 5IYBH 3S1NH 2WP8J 4DK3C 4JOIA 4MTNA 4JI3Q 2VQFL 2VQEL 3SGIA 4OX9L 2LXJA 2C35B 3GTLH 4JYAQ 2UUAL 2XTIA 2Y0SE 3CF5A 1LM0A 3FKIG 1XPOA 4LFCQ 4OWXB 4LF4L 3G71A 4JC0A 2JQOA 3I2ZA 4DR3Q 1TWCH 4L5TA 4DV6L 1YITA 2N3SA 3S14H 5C0XG 3K7UC 5BR8L 1TWFH 2OTLA 4YCUA 4LF9Q 1B70B 4C3HH 4NXNQ 4LUOA 3TS0A 3CC4A 1FJGL 4YHHQ 4TVAB 4AYBG 2UU9Q 4JBWA 1Q82C 1Z9FA 3RLFA 5IYBG 4DV5Q 4P73A 4A3MH 2Z6KC 1R9TH 2JA6H 1Y1VH 3J81c 2YYZA 3KF6A 3RN5A 5M3FH 4GNXC 4NXML 2UUBL 4B3SL 4UP8A 1HZAA 3J81j 5M5YH 4UY8C 2JJQA 4JI8L 3U4VA 1GVPA 2PI2E 1E1OA 3ULPA 4RG1A 1FVIA 1CKOA 1MJCA 5JJLA 1KIXA 1TWGH 1IXRA 1QZHA 2MNAA 4DUYL 3M85A 3GO5A 1XMQQ 4JV5Q 1J6QA 3KDFA 5IY0A 2KHJA 3CCSA 2R7FA 4HJAA 1IBLL 2NVTH 3T1HL 4X66Q 2RHQB 4P72A 4NB3A 4DV7Q 2OQ0A 3G48A 5IT9c 2HIVA 5IYCH 3OW2A 5LMUL 2V1CC 1PH4A 3PIPA 2YU9H 2ZTCA 1WFQA 4K0KL 1L1OA 4O2DA 2AKWB 5C0XI 3T1HQ 3U58A 1TWHH 2LSSA 1JJCB 3GTGH 4BXXG 4J15A 4GOPC 5LMNW 1E22A 3CCUA 1XMQL 4GN3B 5JJKA 5EAYA 1KD1C 1GO3E 4NPSA 1A63A 4A3FH 1QVGA 4GS3A 1K9MC 3T1YQ 4HJ9A 4GLAC 3JAMc 1VQIA 4IPHA 3ERSX 4OO1G 1PVOA 1HZ9A 4GKKQ 2ZJPA 1TXYA 1OXUA 2WFWA 1OXVA 3NBHB 4Y7NH 4LFBL 4AYBE 2EQSA 4WJ4A 4JI4Q 1RIPA 1VQEA 3F2DA 3J7A5 4B3SQ 4X64L 1XNRL 3FP9A 5JJIA 1Q81C 1P8LA 4A3KG 3S1MH 2UXCQ 2R7ZH 1X54A 5C0XJ 3PO3G 2HHHQ 1VQ9A 3S15H 4ALPA 3G6EA 2UU9L 1YBYA 2GVBA 3HKZE 4L5RC 3M7NA 1IL2A 3OTOL 3UDFA 2NVXH 4IFDI 1K73C 1Q1EA 2IX0A 3CCMA 3RN2A 1KXLA 1N36L 3KJOA 1EFWA 4A93G 3PUVA 3ICEA 1QUQA 2N78A 3RLNA 4Y52H 4PZ8A 2QEXA 2YV5A 3M9BA 4JYAL 2CFMA 3EIVA 4DAYB 4DV4L 3VDYA 1PFSA 3OYYA 1VS0A 4RMFA 4OX9Q 3ZJYC 1RL2A 2NVYH 4R1JA 1XMOL 4HIOA 1HNXL 3RZOH 4BA2I 2KHIA 5LMNQ 3I4MH 4DR6L 4JBJA 4LFAL 2JA5H 2OQKA 4R4TA 2UXDQ 3KDFB 1MKHA 3TQYA 2LXKA 1G291 2N49A 1SR3A 2ATWA 2UXBQ 4HJ7A 4LUVA 1U0LA 4IPDA 5GAGC 4LF6L 5ELNA 4QL5A 1Y1WH 4A3DH 1CKNB 4HJ8A 1EQRA 4QIWE 3F2CA 4DR1L 2QA4A 3GTKH 4DNIA 1PH3A 2JA8G 3CMEA 2A8VA 1UE5A 4JI5L 1KHIA 5IE8A 3K7AH 4OONA 4YY3L 1NJIC 4IFDJ 4C2MH 4JI2Q 1HR0L 1AE2A 4GKJQ 4DV1Q 1N34Q 1N33Q 4LF7L 4HIKA 2IHEA 4QY7A 1CSPA 4P74A 3CD6A 2MFIA 1BBUA 1OXTA 2JEBI 4B3ML 4AQYQ 3M4QA 4B3TQ 2AMCB 3STBD 3GTJH 4B3RL 1A62A 2JA7H 1VQHA 1D8LA 1WI5A 4YWLA 4X65Q 5GAEC 3JAMi 3A5UA 2F4VL 1EYGA 1VQLA 2R7ZG 2RF4A 1FGUA 2MQHA 2VS1A 2YTVA 4GNXB 2CCZA 4A3CH 3AFPA 4UP7A 2CKZB 3W1GA 4DV0Q 2ZM6L 3FKIH 3S1RH 4A3EG 4JI1Q 2DGYA 1V43A 1IYJB 1SE8A 2ID0A 4AH6A 2K4KA 4JI0L 1QVFA 1XNQQ 1I5FA 2K14A 1HR0W 4PMWA 1XJVA 1Y14B 2VUMG 4ME3A 5IP9H 1YHBA 1I94L 1VQNA 1HJPA 2JE6I 3A74A 5M5WH 1YEZA 3UDGA 4DV2L 4LNQA 1W2BA 5AJ3L 4A3GH 1N9WA 4P75A 4B3RQ 1LYLA 1JB7A 4A3CG 3CQZH 3PIOA 2D0PA 2KCMA 4B3MQ 1PA6A 4A3LG 3I4MG 4IO9A 4JI6L 3I56A 2N8NA 1IBML 4LF7Q 1N33L 4KLKA 4DUZQ 2AWOA 3AFQA 2ZTEA 4R4QA 1IBKL 2IX1A 4C3JH 4LF5L 4FDBA 3H3VI 4YY3Q 1SMXA 5JEAG 2AWNA 3CCLA 2NN6G 3FHWA 1YJWA 4POGA 1U5KA 1Q86C 4LUZA 2NVQH 2OCEA 2ASBA 5FJ8H 2NZHA 4A3KH 3H15A 4DAMA 1PV4A 1M1KC 2I0QA 3GTOH 1XPUA 4C3IH 5C44G 4KHZA 3Q8DA 3M4OH 4A4IA 5IWAL 2ALYB 1HNZQ 1SN8A 3KF6B 3I4NH 4DR2L 4LFAQ 4BY1H 1VQFA 2Q2UA 3H3VH 5M3MG 5M3FG 3HKSA 3CCVA 1XMOQ 1X6OA 5FLXc 5C4JH 4IJHA 2ZJRA 1MIUA 4DV4Q 1C7YA 4X62L 1IZ6A 4JI7L 3F1ZA 2E5LQ 2K50A 3L2PA 2WB1E 4GLXA 2E2IH 1NBWA 1I50H 1E7ZA 3K81C 1G6PA 1VQ4A 4BY7H 1C0AA 3I4OA 2VUMH 1A0IA 3PF5A 2Z0SA 2UUCQ 3EBEA 4JI7Q 3J80i 2WAQE 1PYBA 4GN4B 4KI0A 4MNOA 1A8VA 4MZ9A 4QGUA 3M3YH 3S2HH 4DR2Q 1K0RA 3W1BA 3HFZB 1BVSA 5IWAQ 3PUXA 1HNZL 4YWMA 4LW1A 2NN6I 2QGQA 2VZAA 2YTXA 3BZCA 3WWVA 4DKAC 5C4XH 1KC8C 1Y1WG 2UUCL 4X64Q 3HOUH 1PH9A 4YWKA 4JI4L 5E7NA 4A76A 3KJPA 1D7QA 2KCTA 4A3BG 1LUZA 3NENA 1JJ2A 1GKHA 3DLLA 3KFUA 3T1YL 4YCWA 1L2FA 5GROA 2E5LL 4QQBX 4LF5Q 4X62Q 1UE6A 1S40A 3S1QH 1HNWQ 1IBMQ 3JC66 4DR7L 1S3OA 1VQOA 3TEHB 3AYHB 4OWTB 1K8GA 1VQ5A 5DLQE 3LGJA 4DV3Q 1PYSB 3IRBA 1B8AA 1VQMA 3HOXH 4HIDA 2DUDA 3PCOB 5M3MH 1AE3A 1NMGA 5AJ3Q 3BZKA 1G51A 2A1AA 4A3MG 1PH7A 3HOYH 4DV2Q 3S2DH 4X66L 1N32Q 1IBLQ 4GN5A 1C9OA 3G4SA 3W5OA 1J5EL 1YVCA 4DR4Q 4P71A 3HOWH 4O0AA 3NEMA 3CW2C 3AEVA 4JI0Q 3PUZA 3ULJA 1GD7A 1L0WA 4JI1L 4BY7G 4TQUS 2JK8A 3CCJA 4DUZL 1IBKQ 4GLVB 4DR5L 3KLWA 4JI6Q 4JI8Q 2VNUD 1EIFA 1KRSA 2IHFA 3UDXA 2A19A 4UPAA 2I5LX 4A3GG 3J7ZC 2OTJA 1Q8KA 2Z6KA 3CCQA 2MO0A 2UUBQ 3K80C 3BJUA 1N8RC 1OTCA 2R92G 4HIMA 3H0GH 1YHQA 1NY4A 2PMZE 4R4IA 4APVA 1XPRA 2F3IA 5JEAJ 4A3IG 4XIGS 1CSQA 2H5XA 1SLJA 2Y0SG 1V1QA 1FJGQ 3UE1A 4DR5Q 3CPWA 1L1OC 4DV1L 1N34L 4BXXH 1W3SA 3D0FA 3K0XA 1SRUA 3J80c 5BR8Q 5J3BA 3HOYG 2EXDA 1HZBA 1XNQL 1CKNA 3TRZA 4DR4L 3AQQA 4DR3L 1L1OB 4DPGA 3HOXG 4DR1Q 1OXSC 4BBRH 4HJ5A 4DV0L 1J5EQ 3ER0A 2B63H 2R6GA 4LFCL 2K5NA 1N32L 4BA1I 4IOCA 2HQLA 4YCVA 1AH9A 3M4PA 5FLMH 3L7ZC 4OXPA 2UXBL 3CAMA 2K5VA 4GOPB 1X3FA 4X65L 2F4VQ 2R93H 3GTPH 4DV3L 2VQEQ 2MO1A 3E9HA 3HOZH 4AQYL 2UXDL 3NELA 1VQGA 5LMNL 2GN5A 4A3IH 2F52A 4DR7Q 3K8AA 1HNXQ 3F8TA 1Q1BA 1VQPA 1UWVA 4PZ7A 1KL9A 4R4OA 3H0GG 1HR0Q 5IP7H 1Q46A 2D62A 5C3EG 4GNXA 1WOCA 3HKZG 2HT1A 3KF8B 5ELOA 3CC2A 3GD7A 2B29A 4JI5Q 3I7FA 1PH1A 1K8AC 4A3EH 3RZDH 2IY5B 4UP9A 1M90C 4JCVE 3TS2A 1PH8A 3UDIA 1O7IA 5GQOA 4XTCS 3S17H 3HOVH 1FL0A 2VW9A 1NE3A 3A0JA 2CQOA 3OTOQ 4A93H 2R92H 3E0EA 3S24A 1JT8A 1K83H 1VCIA 5GADC 4A3JH 4DR6Q 1EQQA 2L15A 5IP7G 5C3EH 2UXCL 2YTYA 4L5QA 1B7YB 4JG2A 3STBC 5M5XH 1KRTA 3MEFA 4A3LH 1Q12A 1JMCA 2JA5G 4WJ3M 4BY1G 3GTMH 4LWCA 4PZ6A 5H1SE 2JA8H 4IOAA 4LFBQ 1I3QH 1Q7YC 4A75A 1PH6A 4GKKL 1T9HA 1N36Q 2ZJQA 4A3DG 2B3GA 5IYDH 2D0OA 2GVAA 5FLMG 2CWPA 3UE0A 3HOVG 2KENA 3ULLA 5HGQA 1HH2P 1VQ7A 1VQCA 1Z47A 2RCNA 1DGSA 4LF8Q 2KBNA 1VQ8A 1V9PA 1YIJA 2HHHL 1VQKA 4KHPQ 1NTGA 4H02A 4GKJL 1I6HH 1PHJA 3HOUG 1VQAA 3RLOA 1Y1VG 5LMUQ 1VQJA 3D31A 1XNRQ 3J81i 2R7DA 3F2BA 1ASZA 1VQBA 3KYHC 3PO2H 4GOPA 4A3FG 4IJLA 5IYDG 1YI2A 1VQDA 4AIMA 5HY6A 2JA7G 1SROA 3PUWA 1UE7A 1CKMA 4A3BH 2NZOA 3CPFA 3BU2A 4DUYQ 1JE5A 1WCMG 3PSIA 3CXCA 1X65A 3TREA 2BA1A 2EIFA 2ES2A 3RR5A 1CUKA 4JBKA 1YNXA 3CCRA 5IP9G 3HOZG 3DM3A 2JA9A 3GDEA 2IT1A 4K0KQ 4JOIC 2WAQG 2Q2IA 1KQSA 1GM5A 1LTLA 1E3PA 4OO1I 1VQ6A 3E9IA 4DV7L 4KHPL 2E2JH 2Q2HA 4A3JG 4PG3A 2K5HA 1PH2A 2BA0A 3HOWG 1QZGA 1X55A 4LF8L 1I94Q 4JBMA 4NXNL 2PQAB 4JV5L 1EOVA 3S16H 2PQAA 4LF9L 1ASYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAH C;  3PO2 G;  1KAW A;  3EN2 A;  2AHO B;  1E1T A;  2ZTD A;  2OWO A;  5FJ8 G;  4DV6 Q;  2PI2 A;  2XGT A;  2ZM6 Q;  4BBS G;  2JEA I;  3PF4 A;  2E2H H;  3B6Y A;  1S72 A;  1BBW A;  1BKB A;  1E24 A;  1WJJ A;  1X56 A;  3PV0 A;  4X6A H;  2JA6 G;  4DK6 C;  4POF A;  4IFD G;  2CWA A;  1PH5 A;  3CMA A;  1H95 A;  4EX5 A;  3CP0 A;  4NXM Q;  3CCE A;  2R93 G;  1YZ6 A;  5C44 H;  1P16 A;  2VL6 A;  1MJE A;  3KOJ A;  1WYD A;  2PNH A;  1K3R A;  1YJN A;  3I55 A;  4B3T L;  2I5H A;  2RHS B;  4JI3 L;  1EWI A;  4DV5 L;  4IPG A;  1XTD A;  3PUY A;  3I4N G;  2K75 A;  3MXN B;  3A5Z B;  1UE1 A;  1NMF A;  3PO3 H;  5C4X G;  3RNU A;  4YHH L;  2HIX A;  2I5M X;  3U50 C;  4EQ5 A;  4L5S A;  4OWW B;  4JI2 L;  2FXQ A;  1YJ9 A;  1WCM H;  1UEB A;  2BH2 A;  1OXX K;  1SFO H;  1EIY B;  4R4C A;  2E8G A;  1JJG A;  2WB1 G;  4LF4 Q;  4BBS H;  4LF6 Q;  3U4Z A;  1QUQ B;  2UUA Q;  1TWA H;  1X3E A;  1YHA A;  1QVC A;  1X9N A;  2BH8 A;  2VY3 A;  1EUJ A;  4BBR G;  2B63 G;  1HNW L;  3CC7 A;  1HZC A;  5IYC G;  5K36 G;  3GTQ H;  2VQF Q;  3L0O A;  2K52 A;  4IPC A;  3PGZ A;  4QJF A;  1X3G A;  2Q2T A;  5IYB H;  3S1N H;  2WP8 J;  4DK3 C;  4JOI A;  4MTN A;  4JI3 Q;  2VQF L;  2VQE L;  3SGI A;  4OX9 L;  2LXJ A;  2C35 B;  3GTL H;  4JYA Q;  2UUA L;  2XTI A;  2Y0S E;  3CF5 A;  1LM0 A;  3FKI G;  1XPO A;  4LFC Q;  4OWX B;  4LF4 L;  3G71 A;  4JC0 A;  2JQO A;  3I2Z A;  4DR3 Q;  1TWC H;  4L5T A;  4DV6 L;  1YIT A;  2N3S A;  3S14 H;  5C0X G;  3K7U C;  5BR8 L;  1TWF H;  2OTL A;  4YCU A;  4LF9 Q;  1B70 B;  4C3H H;  4NXN Q;  4LUO A;  3TS0 A;  3CC4 A;  1FJG L;  4YHH Q;  4TVA B;  4AYB G;  2UU9 Q;  4JBW A;  1Q82 C;  1Z9F A;  3RLF A;  5IYB G;  4DV5 Q;  4P73 A;  4A3M H;  2Z6K C;  1R9T H;  2JA6 H;  1Y1V H;  3J81 c;  2YYZ A;  3KF6 A;  3RN5 A;  5M3F H;  4GNX C;  4NXM L;  2UUB L;  4B3S L;  4UP8 A;  1HZA A;  3J81 j;  5M5Y H;  4UY8 C;  2JJQ A;  4JI8 L;  3U4V A;  1GVP A;  2PI2 E;  1E1O A;  3ULP A;  4RG1 A;  1FVI A;  1CKO A;  1MJC A;  5JJL A;  1KIX A;  1TWG H;  1IXR A;  1QZH A;  2MNA A;  4DUY L;  3M85 A;  3GO5 A;  1XMQ Q;  4JV5 Q;  1J6Q A;  3KDF A;  5IY0 A;  2KHJ A;  3CCS A;  2R7F A;  4HJA A;  1IBL L;  2NVT H;  3T1H L;  4X66 Q;  2RHQ B;  4P72 A;  4NB3 A;  4DV7 Q;  2OQ0 A;  3G48 A;  5IT9 c;  2HIV A;  5IYC H;  3OW2 A;  5LMU L;  2V1C C;  1PH4 A;  3PIP A;  2YU9 H;  2ZTC A;  1WFQ A;  4K0K L;  1L1O A;  4O2D A;  2AKW B;  5C0X I;  3T1H Q;  3U58 A;  1TWH H;  2LSS A;  1JJC B;  3GTG H;  4BXX G;  4J15 A;  4GOP C;  5LMN W;  1E22 A;  3CCU A;  1XMQ L;  4GN3 B;  5JJK A;  5EAY A;  1KD1 C;  1GO3 E;  4NPS A;  1A63 A;  4A3F H;  1QVG A;  4GS3 A;  1K9M C;  3T1Y Q;  4HJ9 A;  4GLA C;  3JAM c;  1VQI A;  4IPH A;  3ERS X;  4OO1 G;  1PVO A;  1HZ9 A;  4GKK Q;  2ZJP A;  1TXY A;  1OXU A;  2WFW A;  1OXV A;  3NBH B;  4Y7N H;  4LFB L;  4AYB E;  2EQS A;  4WJ4 A;  4JI4 Q;  1RIP A;  1VQE A;  3F2D A;  3J7A 5;  4B3S Q;  4X64 L;  1XNR L;  3FP9 A;  5JJI A;  1Q81 C;  1P8L A;  4A3K G;  3S1M H;  2UXC Q;  2R7Z H;  1X54 A;  5C0X J;  3PO3 G;  2HHH Q;  1VQ9 A;  3S15 H;  4ALP A;  3G6E A;  2UU9 L;  1YBY A;  2GVB A;  3HKZ E;  4L5R C;  3M7N A;  1IL2 A;  3OTO L;  3UDF A;  2NVX H;  4IFD I;  1K73 C;  1Q1E A;  2IX0 A;  3CCM A;  3RN2 A;  1KXL A;  1N36 L;  3KJO A;  1EFW A;  4A93 G;  3PUV A;  3ICE A;  1QUQ A;  2N78 A;  3RLN A;  4Y52 H;  4PZ8 A;  2QEX A;  2YV5 A;  3M9B A;  4JYA L;  2CFM A;  3EIV A;  4DAY B;  4DV4 L;  3VDY A;  1PFS A;  3OYY A;  1VS0 A;  4RMF A;  4OX9 Q;  3ZJY C;  1RL2 A;  2NVY H;  4R1J A;  1XMO L;  4HIO A;  1HNX L;  3RZO H;  4BA2 I;  2KHI A;  5LMN Q;  3I4M H;  4DR6 L;  4JBJ A;  4LFA L;  2JA5 H;  2OQK A;  4R4T A;  2UXD Q;  3KDF B;  1MKH A;  3TQY A;  2LXK A;  1G29 1;  2N49 A;  1SR3 A;  2ATW A;  2UXB Q;  4HJ7 A;  4LUV A;  1U0L A;  4IPD A;  5GAG C;  4LF6 L;  5ELN A;  4QL5 A;  1Y1W H;  4A3D H;  1CKN B;  4HJ8 A;  1EQR A;  4QIW E;  3F2C A;  4DR1 L;  2QA4 A;  3GTK H;  4DNI A;  1PH3 A;  2JA8 G;  3CME A;  2A8V A;  1UE5 A;  4JI5 L;  1KHI A;  5IE8 A;  3K7A H;  4OON A;  4YY3 L;  1NJI C;  4IFD J;  4C2M H;  4JI2 Q;  1HR0 L;  1AE2 A;  4GKJ Q;  4DV1 Q;  1N34 Q;  1N33 Q;  4LF7 L;  4HIK A;  2IHE A;  4QY7 A;  1CSP A;  4P74 A;  3CD6 A;  2MFI A;  1BBU A;  1OXT A;  2JEB I;  4B3M L;  4AQY Q;  3M4Q A;  4B3T Q;  2AMC B;  3STB D;  3GTJ H;  4B3R L;  1A62 A;  2JA7 H;  1VQH A;  1D8L A;  1WI5 A;  4YWL A;  4X65 Q;  5GAE C;  3JAM i;  3A5U A;  2F4V L;  1EYG A;  1VQL A;  2R7Z G;  2RF4 A;  1FGU A;  2MQH A;  2VS1 A;  2YTV A;  4GNX B;  2CCZ A;  4A3C H;  3AFP A;  4UP7 A;  2CKZ B;  3W1G A;  4DV0 Q;  2ZM6 L;  3FKI H;  3S1R H;  4A3E G;  4JI1 Q;  2DGY A;  1V43 A;  1IYJ B;  1SE8 A;  2ID0 A;  4AH6 A;  2K4K A;  4JI0 L;  1QVF A;  1XNQ Q;  1I5F A;  2K14 A;  1HR0 W;  4PMW A;  1XJV A;  1Y14 B;  2VUM G;  4ME3 A;  5IP9 H;  1YHB A;  1I94 L;  1VQN A;  1HJP A;  2JE6 I;  3A74 A;  5M5W H;  1YEZ A;  3UDG A;  4DV2 L;  4LNQ A;  1W2B A;  5AJ3 L;  4A3G H;  1N9W A;  4P75 A;  4B3R Q;  1LYL A;  1JB7 A;  4A3C G;  3CQZ H;  3PIO A;  2D0P A;  2KCM A;  4B3M Q;  1PA6 A;  4A3L G;  3I4M G;  4IO9 A;  4JI6 L;  3I56 A;  2N8N A;  1IBM L;  4LF7 Q;  1N33 L;  4KLK A;  4DUZ Q;  2AWO A;  3AFQ A;  2ZTE A;  4R4Q A;  1IBK L;  2IX1 A;  4C3J H;  4LF5 L;  4FDB A;  3H3V I;  4YY3 Q;  1SMX A;  5JEA G;  2AWN A;  3CCL A;  2NN6 G;  3FHW A;  1YJW A;  4POG A;  1U5K A;  1Q86 C;  4LUZ A;  2NVQ H;  2OCE A;  2ASB A;  5FJ8 H;  2NZH A;  4A3K H;  3H15 A;  4DAM A;  1PV4 A;  1M1K C;  2I0Q A;  3GTO H;  1XPU A;  4C3I H;  5C44 G;  4KHZ A;  3Q8D A;  3M4O H;  4A4I A;  5IWA L;  2ALY B;  1HNZ Q;  1SN8 A;  3KF6 B;  3I4N H;  4DR2 L;  4LFA Q;  4BY1 H;  1VQF A;  2Q2U A;  3H3V H;  5M3M G;  5M3F G;  3HKS A;  3CCV A;  1XMO Q;  1X6O A;  5FLX c;  5C4J H;  4IJH A;  2ZJR A;  1MIU A;  4DV4 Q;  1C7Y A;  4X62 L;  1IZ6 A;  4JI7 L;  3F1Z A;  2E5L Q;  2K50 A;  3L2P A;  2WB1 E;  4GLX A;  2E2I H;  1NBW A;  1I50 H;  1E7Z A;  3K81 C;  1G6P A;  1VQ4 A;  4BY7 H;  1C0A A;  3I4O A;  2VUM H;  1A0I A;  3PF5 A;  2Z0S A;  2UUC Q;  3EBE A;  4JI7 Q;  3J80 i;  2WAQ E;  1PYB A;  4GN4 B;  4KI0 A;  4MNO A;  1A8V A;  4MZ9 A;  4QGU A;  3M3Y H;  3S2H H;  4DR2 Q;  1K0R A;  3W1B A;  3HFZ B;  1BVS A;  5IWA Q;  3PUX A;  1HNZ L;  4YWM A;  4LW1 A;  2NN6 I;  2QGQ A;  2VZA A;  2YTX A;  3BZC A;  3WWV A;  4DKA C;  5C4X H;  1KC8 C;  1Y1W G;  2UUC L;  4X64 Q;  3HOU H;  1PH9 A;  4YWK A;  4JI4 L;  5E7N A;  4A76 A;  3KJP A;  1D7Q A;  2KCT A;  4A3B G;  1LUZ A;  3NEN A;  1JJ2 A;  1GKH A;  3DLL A;  3KFU A;  3T1Y L;  4YCW A;  1L2F A;  5GRO A;  2E5L L;  4QQB X;  4LF5 Q;  4X62 Q;  1UE6 A;  1S40 A;  3S1Q H;  1HNW Q;  1IBM Q;  3JC6 6;  4DR7 L;  1S3O A;  1VQO A;  3TEH B;  3AYH B;  4OWT B;  1K8G A;  1VQ5 A;  5DLQ E;  3LGJ A;  4DV3 Q;  1PYS B;  3IRB A;  1B8A A;  1VQM A;  3HOX H;  4HID A;  2DUD A;  3PCO B;  5M3M H;  1AE3 A;  1NMG A;  5AJ3 Q;  3BZK A;  1G51 A;  2A1A A;  4A3M G;  1PH7 A;  3HOY H;  4DV2 Q;  3S2D H;  4X66 L;  1N32 Q;  1IBL Q;  4GN5 A;  1C9O A;  3G4S A;  3W5O A;  1J5E L;  1YVC A;  4DR4 Q;  4P71 A;  3HOW H;  4O0A A;  3NEM A;  3CW2 C;  3AEV A;  4JI0 Q;  3PUZ A;  3ULJ A;  1GD7 A;  1L0W A;  4JI1 L;  4BY7 G;  4TQU S;  2JK8 A;  3CCJ A;  4DUZ L;  1IBK Q;  4GLV B;  4DR5 L;  3KLW A;  4JI6 Q;  4JI8 Q;  2VNU D;  1EIF A;  1KRS A;  2IHF A;  3UDX A;  2A19 A;  4UPA A;  2I5L X;  4A3G G;  3J7Z C;  2OTJ A;  1Q8K A;  2Z6K A;  3CCQ A;  2MO0 A;  2UUB Q;  3K80 C;  3BJU A;  1N8R C;  1OTC A;  2R92 G;  4HIM A;  3H0G H;  1YHQ A;  1NY4 A;  2PMZ E;  4R4I A;  4APV A;  1XPR A;  2F3I A;  5JEA J;  4A3I G;  4XIG S;  1CSQ A;  2H5X A;  1SLJ A;  2Y0S G;  1V1Q A;  1FJG Q;  3UE1 A;  4DR5 Q;  3CPW A;  1L1O C;  4DV1 L;  1N34 L;  4BXX H;  1W3S A;  3D0F A;  3K0X A;  1SRU A;  3J80 c;  5BR8 Q;  5J3B A;  3HOY G;  2EXD A;  1HZB A;  1XNQ L;  1CKN A;  3TRZ A;  4DR4 L;  3AQQ A;  4DR3 L;  1L1O B;  4DPG A;  3HOX G;  4DR1 Q;  1OXS C;  4BBR H;  4HJ5 A;  4DV0 L;  1J5E Q;  3ER0 A;  2B63 H;  2R6G A;  4LFC L;  2K5N A;  1N32 L;  4BA1 I;  4IOC A;  2HQL A;  4YCV A;  1AH9 A;  3M4P A;  5FLM H;  3L7Z C;  4OXP A;  2UXB L;  3CAM A;  2K5V A;  4GOP B;  1X3F A;  4X65 L;  2F4V Q;  2R93 H;  3GTP H;  4DV3 L;  2VQE Q;  2MO1 A;  3E9H A;  3HOZ H;  4AQY L;  2UXD L;  3NEL A;  1VQG A;  5LMN L;  2GN5 A;  4A3I H;  2F52 A;  4DR7 Q;  3K8A A;  1HNX Q;  3F8T A;  1Q1B A;  1VQP A;  1UWV A;  4PZ7 A;  1KL9 A;  4R4O A;  3H0G G;  1HR0 Q;  5IP7 H;  1Q46 A;  2D62 A;  5C3E G;  4GNX A;  1WOC A;  3HKZ G;  2HT1 A;  3KF8 B;  5ELO A;  3CC2 A;  3GD7 A;  2B29 A;  4JI5 Q;  3I7F A;  1PH1 A;  1K8A C;  4A3E H;  3RZD H;  2IY5 B;  4UP9 A;  1M90 C;  4JCV E;  3TS2 A;  1PH8 A;  3UDI A;  1O7I A;  5GQO A;  4XTC S;  3S17 H;  3HOV H;  1FL0 A;  2VW9 A;  1NE3 A;  3A0J A;  2CQO A;  3OTO Q;  4A93 H;  2R92 H;  3E0E A;  3S24 A;  1JT8 A;  1K83 H;  1VCI A;  5GAD C;  4A3J H;  4DR6 Q;  1EQQ A;  2L15 A;  5IP7 G;  5C3E H;  2UXC L;  2YTY A;  4L5Q A;  1B7Y B;  4JG2 A;  3STB C;  5M5X H;  1KRT A;  3MEF A;  4A3L H;  1Q12 A;  1JMC A;  2JA5 G;  4WJ3 M;  4BY1 G;  3GTM H;  4LWC A;  4PZ6 A;  5H1S E;  2JA8 H;  4IOA A;  4LFB Q;  1I3Q H;  1Q7Y C;  4A75 A;  1PH6 A;  4GKK L;  1T9H A;  1N36 Q;  2ZJQ A;  4A3D G;  2B3G A;  5IYD H;  2D0O A;  2GVA A;  5FLM G;  2CWP A;  3UE0 A;  3HOV G;  2KEN A;  3ULL A;  5HGQ A;  1HH2 P;  1VQ7 A;  1VQC A;  1Z47 A;  2RCN A;  1DGS A;  4LF8 Q;  2KBN A;  1VQ8 A;  1V9P A;  1YIJ A;  2HHH L;  1VQK A;  4KHP Q;  1NTG A;  4H02 A;  4GKJ L;  1I6H H;  1PHJ A;  3HOU G;  1VQA A;  3RLO A;  1Y1V G;  5LMU Q;  1VQJ A;  3D31 A;  1XNR Q;  3J81 i;  2R7D A;  3F2B A;  1ASZ A;  1VQB A;  3KYH C;  3PO2 H;  4GOP A;  4A3F G;  4IJL A;  5IYD G;  1YI2 A;  1VQD A;  4AIM A;  5HY6 A;  2JA7 G;  1SRO A;  3PUW A;  1UE7 A;  1CKM A;  4A3B H;  2NZO A;  3CPF A;  3BU2 A;  4DUY Q;  1JE5 A;  1WCM G;  3PSI A;  3CXC A;  1X65 A;  3TRE A;  2BA1 A;  2EIF A;  2ES2 A;  3RR5 A;  1CUK A;  4JBK A;  1YNX A;  3CCR A;  5IP9 G;  3HOZ G;  3DM3 A;  2JA9 A;  3GDE A;  2IT1 A;  4K0K Q;  4JOI C;  2WAQ G;  2Q2I A;  1KQS A;  1GM5 A;  1LTL A;  1E3P A;  4OO1 I;  1VQ6 A;  3E9I A;  4DV7 L;  4KHP L;  2E2J H;  2Q2H A;  4A3J G;  4PG3 A;  2K5H A;  1PH2 A;  2BA0 A;  3HOW G;  1QZG A;  1X55 A;  4LF8 L;  1I94 Q;  4JBM A;  4NXN L;  2PQA B;  4JV5 L;  1EOV A;  3S16 H;  2PQA A;  4LF9 L;  1ASY A; 
#chains in the Genus database with same CATH topology
 3PO2 G;  5A35 A;  1E1T A;  2ZM6 Q;  5FKA C;  3GTK B;  2JA8 B;  2HDM A;  1ZYR C;  1I3Q B;  1S72 A;  1BBW A;  2NN6 H;  2FFK B;  4IFD G;  1DOK A;  2EJG C;  3CMA A;  1EY4 A;  2LS0 1;  3CRL C;  2R93 G;  1P16 A;  3HOZ H;  2PNH A;  3I55 A;  3MXU A;  4DV5 L;  3H3V C;  1XTD A;  1I4P A;  1CT1 D;  4KJO A;  2CHB D;  1WTQ A;  2HIX A;  3U50 C;  3SDZ A;  3TN2 A;  3OSO A;  3ZYY X;  3DWP A;  2BH2 A;  1OXX K;  2F0E A;  1SFO H;  2DJG C;  2E8G A;  1JJG A;  4CBV A;  5FLX E;  4BBS H;  4LF6 Q;  1WCM B;  2XNA C;  1SYE A;  1QVC A;  2BH8 A;  2F1M A;  1EUJ A;  2O2L D;  2HQE A;  5K36 G;  2F0I A;  4A3J B;  4QJF A;  3S1N H;  4IFD H;  3V96 A;  2WP8 J;  5FLX L;  2VQE L;  4R8N A;  4DK1 A;  2LXJ A;  1GUO A;  2UUA L;  1B9M A;  1LM0 A;  1XPO A;  4Y7N B;  5C4X B;  3G71 A;  2BDO A;  4DR3 Q;  4DV6 L;  5E4W C;  2N3S A;  4G7H C;  1STE A;  5BR8 L;  4QCL A;  3V2T A;  3TS0 A;  3HP3 A;  4JBW A;  3FVQ A;  2NWG A;  5EPJ A;  2L4N A;  1ONL A;  4P73 A;  1R9T H;  3URY A;  3KF6 A;  4NXM L;  5M3F H;  2Z8L A;  3EA6 A;  2UUB L;  4KV6 A;  4C3J G;  1E1O A;  1GUN A;  4RG1 A;  3K57 A;  4MN3 A;  1KIX A;  4DUY L;  5C0X H;  3M85 A;  2PPB C;  3SK8 A;  4JV5 Q;  1J6Q A;  2L11 A;  3CCS A;  2R7F A;  4OHJ A;  1EY8 A;  2NVT H;  3T1H L;  2OQ0 A;  4FF2 A;  5IYC H;  3SXH A;  1BO0 A;  3Q0A A;  3Q22 A;  2H1E A;  5LMU L;  1PH4 A;  2YU9 H;  2O5J C;  4O2D A;  2AKW B;  3TZU A;  4A3F B;  3G6J B;  2LSS A;  3GTG H;  3M7G A;  1QNK A;  2D9U A;  5I9O A;  1A63 A;  3A56 A;  4F7X A;  4B9W A;  2HDL A;  2RDF A;  1HZ9 A;  1OXU A;  2QIL A;  3NBH B;  4Y7N H;  2EQS A;  5IOD A;  1VQE A;  4JI4 Q;  1I4G A;  4X64 L;  1PYW D;  4KY7 A;  4B08 A;  4M1U B;  1WTW A;  1EZ6 A;  2WKC A;  1SJH D;  1JR0 D;  2KQ3 A;  2UU9 L;  1YBY A;  5IGG A;  1S4Z A;  3M7N A;  2X6L A;  4DAV A;  1Q8I A;  2NB0 A;  2NVX H;  1JCK B;  4K6D A;  3BDL A;  1SYC A;  3RN2 A;  3CCM A;  1N36 L;  3KJO A;  1EFW A;  3PUV A;  4Q5V A;  3ICE A;  3H91 A;  3MHB A;  3J7A F;  1CHP D;  4JYA L;  4A3E B;  1PFS A;  1S5F D;  1X3Q A;  4Z9C B;  3NSW A;  2NVT B;  3ZJY C;  1RL2 A;  1XMO L;  1HNX L;  5CV7 A;  4K5X A;  2EZV A;  4KK7 A;  3KDF B;  1MKH A;  2F0G A;  3TQY A;  2C5C A;  4KD4 A;  1E2V A;  2A6E C;  3A7A B;  4NDX A;  4LUV A;  4XT1 B;  5GAG C;  5ELN A;  1BQQ T;  4QL5 A;  4U67 3;  1Y1W H;  4HJ8 A;  1EQR A;  4QIW E;  3F2C A;  3GTK H;  3CME A;  1QNU A;  4JI5 L;  1KHI A;  3M4Y A;  3K5O A;  1HA6 A;  1AE2 A;  4DV1 Q;  1N34 Q;  1STA A;  4HIK A;  4LF7 L;  2EXZ A;  3M4O B;  1OXT A;  3OMC A;  2KJX A;  2AMC B;  1TT2 A;  2F4V L;  3CKI B;  1EYG A;  3E3X A;  1NNX A;  3DUZ A;  2YTV A;  4DNT B;  3G7L A;  4A3C H;  3AFP A;  2EYP A;  2DNC A;  3S1R H;  2ID0 A;  1IYJ B;  4KKU A;  4JI0 L;  2K14 A;  4PMW A;  1HJP A;  3I91 A;  5CV6 A;  3FEW X;  5AJ3 L;  4A3G H;  4P2C B;  3A7L A;  4BS9 A;  1NR4 A;  3J7Y W;  4B3R Q;  5J39 A;  4DGZ A;  3KUP A;  3NQI A;  4A3C G;  2D0P A;  3R3O A;  4B3M Q;  4H0L C;  4IO9 A;  1N33 L;  5D3D A;  4DUZ Q;  4R4Q A;  2IX1 A;  1ESF A;  1G8Z D;  4X3U A;  2B2W A;  1HCZ A;  3FHW A;  2L0C A;  5C4Z A;  2A6E D;  2J0T D;  3HG9 A;  4FO2 A;  4XDX A;  1VMP A;  2K28 A;  4KY5 A;  3CU7 A;  4A3K H;  3H15 A;  2A5H A;  3GTO H;  1XPU A;  2E74 C;  3VR5 A;  4C3I H;  5C44 G;  4KHZ A;  5T1I A;  2ALY B;  1SN8 A;  1ESR A;  4LFA Q;  5CV9 A;  1GOZ A;  2Q2U A;  1KDC A;  1Q3L A;  5M5Y B;  1X6O A;  1AW7 A;  4JI7 L;  1H9R A;  3NUC A;  1EEF D;  2E5L Q;  4OGQ C;  1R4P B;  3I70 A;  4BY7 H;  1R4Q B;  3RD4 A;  2VUM H;  1STG A;  3TSS A;  2Z0S A;  3WOE A;  3JAM E;  1JQY D;  3I4M B;  1LTB D;  3SR1 A;  3RZO B;  4DR2 Q;  3BYT B;  4FXG C;  1K0R A;  3W1B A;  3HFZ B;  1ZEQ X;  1BVS A;  5IWA Q;  3PUX A;  5I4D A;  1SXT A;  3MA2 B;  1MI2 A;  3S14 B;  1MSH A;  2XIW A;  1TR5 A;  4A76 A;  1KNE A;  1TS2 A;  1I4X A;  4ZAI A;  1L2F A;  1S40 A;  3S1Q H;  3MC0 B;  1EWC A;  1IBM Q;  1GJX A;  1VQO A;  3AYH B;  2NTS A;  3GTO B;  3BVM A;  2IWH A;  1VQM A;  1B8A A;  1IW7 D;  1EL0 A;  3EFX D;  4V19 0;  5I2X A;  1PH7 A;  4RA8 A;  4X66 L;  1J8I A;  4GN5 A;  3NE5 B;  2WII B;  3HOW H;  2IW3 A;  1L0W A;  3CCJ A;  1V1P B;  2HCC A;  4JI8 Q;  2VNU D;  2JN4 A;  1ZXT A;  1ENC A;  2I5L X;  2OTJ A;  3CCQ A;  2MO0 A;  5CV4 A;  5KYI A;  2WIN B;  2R92 G;  1M8A A;  4R4I A;  4APV A;  1TS3 A;  5JEA J;  1CSQ A;  5JVH 3;  3S16 B;  1Y8P B;  3K0X A;  1SRU A;  3Q23 A;  1B9N A;  5J3B A;  3QOL A;  3HOY G;  2M00 A;  4KD3 A;  1XNQ L;  1TWH B;  4DPG A;  1WTH A;  4RKB A;  4DR1 Q;  4DV0 L;  1HRJ A;  2R6G A;  2XWJ B;  1H9M A;  4YCV A;  1AH9 A;  4GOP B;  3BZD B;  4BBR B;  4IUN A;  1Y8O B;  4AQY L;  3DMU A;  1VQG A;  2F52 A;  3V05 A;  2B8G A;  2M9V A;  1KL9 A;  1HR0 Q;  3H0G G;  4GKJ L;  1V8Q A;  3HKZ G;  2R7Z B;  2HT1 A;  5ELO A;  3CC2 A;  3GD7 A;  2B29 A;  3P75 A;  2SDF A;  2KCC A;  4JCV E;  4O1N A;  1ENF A;  3J80 L;  4XTC S;  4IZ8 A;  1G2T A;  2ENB A;  2VW9 A;  3GV3 A;  4CKE A;  1D1K A;  3MFG A;  1JT8 A;  1PTO F;  5I2Y A;  1T5X D;  1GHK A;  4RH6 A;  4HED A;  3STB C;  1BUV T;  1XTC D;  1JMC A;  3MTS A;  4IOA A;  4LFB Q;  4GKK L;  2D0O A;  5FO9 B;  2CWP A;  3UE0 A;  3ULL A;  4L63 B;  5HGQ A;  1EY7 A;  3DXJ C;  2HHH L;  1D1I A;  5C5M A;  4TSS A;  1NTG A;  3NBI A;  4WJW A;  3OWE B;  2L12 A;  5A2Q E;  1ASZ A;  3FRP B;  1QIL A;  1B1Z A;  1IHZ A;  2NBF A;  1EIG A;  1WCM G;  3TRE A;  4JBK A;  3S1N B;  3DM3 A;  3SK6 A;  1B3Q A;  3HOV B;  3H0G B;  1KQS A;  2RDG A;  1QG7 A;  2A73 B;  3TZD A;  2N88 A;  1LV9 A;  3GTL B;  2Q2H A;  3DHQ A;  4ZLT F;  3HOW G;  5C3E B;  1EOV A;  4U68 A;  5GAH C;  1I4Q A;  5EPL A;  2OWO A;  5FJ8 G;  4HMJ A;  3D6W A;  4BBS G;  1A3V A;  4EVO A;  3D4W A;  1WJJ A;  1X56 A;  2TSS A;  3PV0 A;  4MHE A;  4TKO B;  2JA6 G;  4DK6 C;  1Y1V B;  4POF A;  4X6A H;  1AP0 A;  5KEE A;  4EX5 A;  3N6R A;  3CCE A;  4XXE A;  5C5L A;  2VL6 A;  4F8M A;  1I6V C;  1WYD A;  3KOJ A;  1MJE A;  2RHS B;  5EPK A;  1EWI A;  2F0S A;  2FIN B;  4IPG A;  3I4N G;  2K75 A;  3A5Z B;  1UE1 A;  1NMF A;  1AZP A;  2F3W A;  1KAA A;  2I5M X;  4EQ5 A;  1JB3 A;  4L5S A;  3KLR A;  2K6A A;  4WFN 3;  4OWW B;  1X3P A;  1II3 A;  1UEB A;  2Q8T A;  3MWY W;  1EIY B;  2ZXP A;  4A3B B;  1GUS A;  2WB1 G;  4PV1 C;  1E2Z A;  4RHR A;  2R61 A;  1G2S A;  2PQE A;  1A3U A;  2K32 A;  2IJ0 A;  1X3E A;  1O78 A;  1YHA A;  2VY3 A;  2B63 G;  3NPP A;  2G9H D;  1SND A;  4IPC A;  2L55 A;  3R93 A;  3LX0 A;  1O7L A;  4JI3 Q;  2D2C C;  1SMY D;  4JYA Q;  5FOB B;  2XTI A;  1QWY A;  4JC0 A;  3I2Z A;  1PXU A;  5IGD A;  1RF2 D;  5C0X G;  3K7U C;  2OTL A;  4YCU A;  3BG3 A;  4LF9 Q;  2JA6 B;  4C3H H;  4NXN Q;  2CQA A;  4C2M B;  4TVA B;  2UU9 Q;  5IGF A;  2E75 C;  1Z9F A;  2FMC A;  4IUU A;  4NP5 A;  3C3L A;  1SMY C;  2Z6K C;  1L0X B;  1Y1V H;  2YYZ A;  1AZQ A;  4RFB A;  1HZA A;  3J81 j;  2BCO A;  2KED A;  5COR A;  4EQP A;  3U4V A;  1F2M A;  1WTX A;  3HRZ C;  3Q24 A;  1SNC A;  1JOK A;  5IY0 A;  1PTO H;  4IUQ A;  1IBL L;  3NTI A;  4QUC A;  3MXG A;  2V1C C;  2A68 D;  3MZ5 A;  3C2P A;  2KEE A;  4J8Q A;  3T1H Q;  3J81 L;  1PZK D;  1STY A;  2BE5 C;  1E22 A;  2HD3 A;  5EAY A;  5KRU A;  1KD1 C;  1GO3 E;  4NPS A;  3OOC A;  5KNB A;  4GS3 A;  1K9M C;  2SNM A;  4GLA C;  4HJ9 A;  1TKW B;  2PCF B;  1XX8 A;  4IPH A;  3ERS X;  1TWC B;  1TXY A;  2ZJP A;  3VR2 A;  4N8F A;  4AYB E;  3J7A 5;  5IGB A;  1SSO A;  3S1M H;  2UXC Q;  1X54 A;  2HHH Q;  2XN9 C;  2GVB A;  4L5R C;  1IL2 A;  3OTO L;  2BOS A;  3UDF A;  4IFD I;  1EYA A;  1KXL A;  2XRS D;  3C1E A;  1KDB A;  4A93 G;  4OIK A;  2JSO A;  1MHW C;  4CJ0 B;  4PZ8 A;  2QEX A;  2YV5 A;  2CFM A;  3RZD B;  4DV4 L;  1VS0 A;  4AYB B;  4R1J A;  3RZO H;  3C46 A;  3I4M H;  3MFY A;  4G7Z C;  1RTN A;  2LXK A;  1SR3 A;  2ATW A;  4HJ7 A;  3MAQ A;  4IQZ A;  4IPD A;  4LF6 L;  3TP5 A;  2K33 A;  1EIH A;  4V0B A;  1PH3 A;  3Q6S A;  4K8J A;  4R8I A;  2JA8 G;  2A8V A;  1LT5 D;  1UE5 A;  5IE8 A;  3VA7 A;  1JWS D;  3K7A H;  3N52 A;  5HUR A;  5JAV A;  1HR0 L;  4GKJ Q;  1G91 A;  4RHS A;  1CSP A;  4P74 A;  2MFI A;  3MEH A;  4AQY Q;  2A74 C;  2EJF C;  3DEP A;  1BF4 A;  2A6H C;  3STB D;  5T1G A;  4YWL A;  1C4Q A;  1D8L A;  5GAE C;  2B8F A;  1M4V A;  2RCF A;  3A5U A;  1QOH A;  1PRT D;  2MQH A;  5D65 A;  4DV0 Q;  2ZM6 L;  4A3E G;  1XNQ Q;  4AH6 A;  4I65 A;  1H9S B;  3NWS A;  1HR0 W;  1XJV A;  4ME3 A;  5IP9 H;  1YHB A;  1I94 L;  1F9P A;  3D3R A;  2F0P A;  1YEZ A;  3UDG A;  3QJY A;  4DV2 L;  2G5D A;  4A93 B;  1W2B A;  1A6X A;  3S9W A;  1N9W A;  1LT3 D;  4P75 A;  1JB7 A;  1LLR D;  3CQZ H;  1EEI D;  3PIO A;  4RGM A;  2KCM A;  1PA6 A;  1IW7 C;  5C3W A;  2N8N A;  2DNE A;  1VF5 C;  4KLK A;  2AWO A;  3AFQ A;  4C3J H;  1QCB D;  2F0F A;  4YY3 Q;  1HTL D;  4O42 A;  5DAU A;  5JEA G;  1A15 A;  3K0Y A;  2Z4I A;  1F9S A;  2XVS A;  3HOZ B;  2NVQ H;  3NP8 A;  4G7O C;  2I0Q A;  4XT3 B;  5EKL A;  1DZ1 A;  2B2V A;  3Q8D A;  3M4O H;  3IKJ A;  3KF6 B;  3H3V H;  1EQT A;  3K58 A;  5M3M G;  5M3F G;  3CCV A;  4RAU C;  4IJH A;  1MIU A;  2RQX A;  3ERO A;  3F1Z A;  1GHJ A;  5JVG 3;  2K50 A;  2WB1 E;  2EY6 A;  4GLX A;  1HUM A;  2E2I H;  1K0S A;  1G6P A;  4IUV A;  1VQ4 A;  4EQO A;  1ILP A;  4JK1 C;  4ZQ3 A;  2LY7 A;  1A0I A;  3PF5 A;  3TP8 A;  3EBE A;  1KNA A;  3D6C A;  4MZ9 A;  4QGU A;  3QO2 A;  2KA7 A;  1FNV A;  1BDO A;  2ICI A;  1J9O A;  4H44 C;  4LW1 A;  2NN6 I;  4DKA C;  4CKC A;  1IKM A;  1PDQ A;  3KJP A;  1ML0 D;  2KCT A;  1Z6H A;  4HSV A;  2KHS A;  1JJ2 A;  3DLL A;  5M9O A;  3T1Y L;  4BWG B;  1UEA B;  2E5L L;  3HOX B;  1JWM D;  2IPK D;  2RVL A;  3MXN A;  3UI2 A;  3I4L A;  4DR7 L;  3T51 B;  5I6W A;  3KF8 A;  1TWF B;  1EZ8 A;  3LGJ A;  1PYS B;  4ZUJ A;  4A3K B;  3HS0 C;  2A69 C;  3PCO B;  1X32 A;  1DYQ A;  4C3I B;  4A3M G;  3T13 A;  4DV2 Q;  2G9D A;  2K03 A;  1C9O A;  2F0H A;  3W5O A;  1YVC A;  4P71 A;  1V1O A;  2IX3 A;  3NEM A;  3CW2 C;  3I8Z A;  3PUZ A;  3OHX C;  2MHV A;  4DUZ L;  1SYG A;  3HZX A;  4CHT B;  3KLW A;  5ELE A;  3BVZ A;  2QCP X;  1TWA B;  3UDX A;  4DAY A;  2NYZ D;  4A3G G;  4LK1 C;  2O4X A;  4S3S A;  2PW7 A;  3K80 C;  1HPC A;  2K1B A;  5JPN C;  2MGS A;  2PMZ E;  4K6L A;  4K2L A;  2QW7 A;  2K7V A;  2Y0S G;  1LTT D;  3S2H B;  3SEB A;  4C3J B;  1AEX A;  4DR5 Q;  1FJG Q;  1RJT A;  1W3S A;  3D0F A;  4HR7 B;  4X3K A;  2F0K A;  3J80 c;  1CKN A;  1L1O B;  1J5E Q;  2B63 H;  4JPB W;  3MVV A;  1CA6 A;  2AQ2 B;  4LFC L;  1N32 L;  4IOC A;  2HQL A;  3M4P A;  2BDN A;  4OXP A;  3AMU A;  4ID6 A;  1X3F A;  2AUK A;  4XQN A;  2F4V Q;  2CW0 C;  1RCV D;  2E2D C;  2ZXR A;  3P20 A;  4UDU C;  3NEL A;  2GN5 A;  2EY2 A;  1CM9 A;  1Q1B A;  1VQP A;  3GTP B;  5C3E G;  1Q46 A;  4XYO A;  4JI5 Q;  4K8I A;  4FYD A;  3RZD H;  2BE5 D;  2IY5 B;  1M90 C;  2L1B A;  1PH8 A;  1KLG D;  5DNF A;  2F0W A;  2F3V A;  3OTO Q;  4HSP A;  2R92 H;  3E0E A;  2Q8I B;  3S24 A;  4NKL A;  4A3J H;  3C1F A;  5C3E H;  2UXC L;  4WOR A;  2YU9 B;  1CK1 A;  4A3L H;  2JA5 G;  2NZ1 D;  3IAY A;  4PMC A;  2RKS A;  4LWC A;  3NTK A;  5H1S E;  1Q7Y C;  3A8I E;  4A75 A;  2Z9H A;  1T9H A;  1N36 Q;  5CBA E;  5FLM G;  2ICE C;  4E6I A;  3QR8 A;  2WAQ B;  1DGS A;  4LF8 Q;  5E3F A;  1W6J A;  3IFD A;  1RD9 D;  3E6Z X;  1U4M A;  1JOQ A;  4H02 A;  3HOU G;  1VQA A;  3RLO A;  5CC4 A;  1NUC A;  1VQJ A;  3D31 A;  1PZI D;  3F2B A;  4KY6 A;  5IT9 E;  2DN8 A;  3OIQ A;  4A3F G;  2PZT A;  1YI2 A;  3R8B A;  2JA7 G;  1CQF A;  1F2L A;  4A3B H;  2L5T A;  1LTI D;  1PZJ D;  2DY7 A;  2NZO A;  1JE5 A;  2B2T A;  5CV8 A;  3CXC A;  1O7Y A;  3RR5 A;  1CUK A;  1KAB A;  1ET6 A;  3CCR A;  3FKI B;  2JA9 A;  2ZXO A;  3GTQ B;  1HUN A;  1D2B A;  2AQ3 B;  2Q2I A;  1GM5 A;  1LTL A;  3MXP A;  4CJ1 B;  4GZY C;  3CRK C;  4PG3 A;  1U9R A;  5CV5 A;  2BA0 A;  3DWQ A;  4LF8 L;  1HHV A;  4NXN L;  1SAP A;  3HOX H;  4JV5 L;  3K59 A;  3S16 H;  4LF9 L;  3EN2 A;  2AHO B;  3H94 A;  4Q0F A;  3PIP 3;  2AUJ D;  2WB1 B;  2JEA I;  3PF4 A;  4OO1 H;  3B6Y A;  1IYV A;  3NK9 A;  1PH5 A;  1H95 A;  4NXM Q;  5E1F A;  1YZ6 A;  2KVM A;  5G3L D;  3SHL A;  4C3I G;  5C44 H;  4A3M B;  1I4R A;  1K3R A;  4B3T L;  2I5H A;  4JI3 L;  5CGK A;  3H6M A;  4RKL A;  3AU7 A;  3PO3 H;  2Y0S B;  1RDP D;  2FXQ A;  1YJ9 A;  3T53 B;  1TS4 A;  4IUT A;  5DM6 3;  3U4Z A;  1ROD A;  2UUA Q;  1TWA H;  5D14 A;  5M5W B;  1HZC A;  5IYC G;  3L0O A;  2K52 A;  2PMZ B;  3PGZ A;  4KKT A;  5IYB H;  2EY5 A;  1MGS A;  4DK3 C;  2VB2 X;  3GTL H;  4J6H A;  2Y0S E;  3FKI G;  1MBY A;  4LFC Q;  4OWX B;  2JQO A;  1F2Z A;  1YIT A;  1TWC H;  4L5T A;  1WTP A;  3BS1 A;  3W3A A;  4RWS C;  1RKN A;  3CC4 A;  1FJG L;  4OIJ A;  4KKS A;  4AYB G;  1EFI D;  1Q82 C;  3FPP A;  3K6O A;  3RLF A;  5IYB G;  4DV5 Q;  3NHH A;  4ZRZ A;  4OL7 A;  3J81 c;  3DWA A;  4GNX C;  3PO2 B;  4X3T A;  1GUW A;  4B3S L;  5M5Y H;  4UY8 C;  2PI2 E;  3VR4 A;  3ULP A;  2IL8 A;  5FO8 B;  1PTO B;  1NAP A;  1CKO A;  1S5B D;  1TWG H;  1IXR A;  2K5D A;  1SDF A;  1QZH A;  1JOR A;  1GXD C;  3OPO A;  5HGT A;  3KDF A;  2KHJ A;  3L9A X;  4HJA A;  5ELC A;  2RHQ B;  4P72 A;  1EY0 A;  5NUC A;  1EYC A;  3OW2 A;  3P7J A;  1ET9 A;  2ZTC A;  3KK7 A;  4K0K L;  1Y1W B;  2PNR C;  5C0X I;  2KUM A;  1JJC B;  5JJK A;  4GOP C;  5LMN W;  1XMQ L;  4FF1 A;  1MSG A;  1K3B C;  4A3F H;  3T1Y Q;  3JAM c;  1VQI A;  1ZYR D;  1E0B A;  1PVO A;  4GKK Q;  1TY2 A;  1OXV A;  4LFB L;  1RIP A;  3LNN A;  3F2D A;  1NR2 A;  3FP9 A;  3P1H A;  4MIU A;  4PMB A;  4A3K G;  2R7Z H;  2NVX B;  1R9T B;  3S15 H;  3G6E A;  2A69 D;  3A55 A;  1B3A A;  4FP5 D;  1PLF A;  1STN A;  2OF1 A;  4HTH A;  1K73 C;  1Q1E A;  2IX0 A;  2E76 C;  3RLN A;  1B44 D;  3M9B A;  2WV6 D;  1F9R A;  3EIV A;  4DAY B;  1A2T A;  4ZKB B;  5K36 H;  4RMF A;  4OX9 Q;  2NVY H;  4BA2 I;  4NMZ A;  4KN7 C;  2KHI A;  4K5W A;  4DR6 L;  4TRD A;  2OQK A;  4KHV A;  2N49 A;  1EYD A;  1DOL A;  2K01 A;  3I3C A;  5KYL A;  3A8K E;  1U0L A;  4QF4 A;  1WD0 A;  5D3I B;  1CKN B;  1DXM A;  4JVZ A;  4DR1 L;  5AFW A;  2PYK A;  4YY3 L;  1NJI C;  2OEO A;  1F77 A;  4JI2 Q;  1VDZ A;  3ND8 A;  2IHE A;  4QY7 A;  2F0N A;  1HFN A;  1LAB A;  1JIC A;  2JEB I;  5ELF A;  1JOO A;  1UAP A;  4FF4 A;  3NBH A;  1VQH A;  1WI5 A;  1BXT A;  3JAM i;  3HOY B;  2CCZ A;  2VS1 A;  2EYM A;  1TY0 A;  1CHQ D;  3WOF A;  3FKI H;  1V43 A;  1SE8 A;  1FNW A;  1AFP A;  2VUM G;  1Y14 B;  2D5D A;  1VQN A;  3A74 A;  3D4D A;  4ZCK A;  3EVQ A;  2KEC A;  1ILQ A;  3LWU A;  4H13 C;  1D5X C;  3PQI A;  5C6A A;  2B2Y C;  1K83 B;  3D8G A;  4JI6 L;  3I56 A;  5I9P A;  1PRT F;  1IBM L;  1A3T A;  2DJF C;  4MTK A;  2ZTE A;  2P5Z X;  3PIO 3;  1SEB D;  1SMX A;  4CKB A;  3CCL A;  2AWN A;  2NN6 G;  1YJW A;  1WTR A;  4RCN A;  4POG A;  3HGB A;  1U5K A;  1DM0 B;  4LUZ A;  2OCE A;  2ASB A;  3OW7 A;  2FMM A;  4DAM A;  1PV4 A;  1M1K C;  4CJ2 C;  3K5N A;  1B4O A;  3VR3 A;  5KIX A;  5IOC A;  4A4I A;  5IWA L;  1TQO A;  5G3L F;  3I4N H;  4DR2 L;  1PRT C;  3KLS A;  1XYI A;  3HOW B;  1PTO C;  1EU4 A;  2QDL A;  1C7Y A;  1CQV A;  4DV4 Q;  1IZ6 A;  4BY7 B;  1EOT A;  2JA7 B;  2F0J A;  5EKK A;  2LMC B;  1NBW A;  1PMR A;  4I7A A;  1E7Z A;  2VB3 X;  1C0A A;  3I4O A;  2B2T C;  2E2I B;  1PRT B;  4JI7 Q;  3L3O C;  5BN5 A;  4GN4 B;  4KI0 A;  4MNO A;  3M3Y H;  3X3M A;  4YWM A;  2QGQ A;  3WWV A;  5C4X H;  2UUC L;  1GUG A;  3HOU H;  4FF3 A;  5JEA H;  4YWK A;  3VYS A;  5E7N A;  4A3B G;  1CZW A;  1LUZ A;  3NEN A;  1GKH A;  2MP1 A;  3KFU A;  4YCW A;  4CDC C;  1LO5 D;  4X62 Q;  1UE6 A;  4CGY B;  1FYC A;  1HNW Q;  1S3O A;  4A3I B;  1ENA A;  3TEH B;  1E2W A;  2XSC A;  4OWT B;  1VQ5 A;  4I7Z C;  5DLQ E;  1YNJ C;  2K05 A;  4DV3 Q;  3IRB A;  2SEB D;  5CYU A;  4HID A;  2DUD A;  1W6K A;  4ODG A;  1AE3 A;  1NMG A;  5AJ3 Q;  4DFA A;  2A1A A;  5EBD A;  3S2D H;  1IBL Q;  3X3N A;  3G4S A;  4DR4 Q;  1BOS A;  4QIW B;  4JI0 Q;  1S5E D;  2B2U C;  3ULJ A;  3E5S A;  4BY7 G;  1SNO A;  2JK8 A;  1IBK Q;  2F0V A;  2NVY B;  1KRS A;  1TWG B;  2A19 A;  3J7Z C;  1Q8K A;  1A2U A;  1N8R C;  1XPR A;  1XXG A;  1Y69 U;  2H5X A;  3UE1 A;  1L1O C;  4NW2 A;  3GP7 A;  3BDC A;  4K14 A;  2F0O A;  2K5Q A;  4K5V A;  4DV1 L;  1N34 L;  2CH4 A;  4BXX H;  2F0U A;  2EXD A;  2M2L A;  4ZUI A;  3TRZ A;  1K8O A;  4DR4 L;  3AQQ A;  5BN3 A;  5IGC A;  3GTG B;  4HJ5 A;  3ER0 A;  3BDO A;  4BA1 I;  4HN7 A;  4CDD C;  5COY A;  3GTJ B;  3L7Z C;  2K5V A;  4FXD A;  4X65 L;  2B63 B;  2R93 H;  4DV3 L;  3I90 A;  1BR9 A;  2MO1 A;  3E9H A;  3QOJ A;  1WVL A;  1Q90 A;  3TDQ A;  4A3I H;  3K8A A;  1HNX Q;  1HNW L;  4PZ7 A;  4R4O A;  4LAA A;  5IP7 H;  2JP1 A;  4GNX A;  1SNM A;  5BN4 A;  3I7F A;  1PH1 A;  4A3E H;  3PMF A;  4UP9 A;  3KBX A;  5JJZ A;  3SVM A;  3ND9 A;  1O80 A;  3R2T A;  2CQO A;  5C3X A;  4FVM A;  1GUT A;  2B39 A;  1SE3 A;  5M5X B;  4HMI A;  2Z4H A;  5GAD C;  2WAC A;  1EQQ A;  2L15 A;  5IP7 G;  1IL8 A;  1V1P A;  2YTY A;  3NWT A;  1SE2 A;  4L5Q A;  1B7Y B;  4JG2 A;  5M5X H;  5IT9 L;  4DN4 M;  1U4P A;  1EU3 A;  5K5P A;  2JA8 H;  4H7B A;  3ITP A;  1HTP A;  3FMC A;  2EPB A;  4A3D G;  1U4L A;  2Q8R E;  2B3G A;  1F9Q A;  1O7Z A;  4ZKC B;  5IYD H;  2GVA A;  5IGE A;  4ILW A;  2RCN A;  3VYU A;  3I4N B;  1VQ8 A;  1YIJ A;  2QKI C;  2I07 B;  1I6H H;  1PHJ A;  1EWH A;  5C4H A;  2FJ2 A;  5LMU Q;  3S1R B;  1XNR Q;  3J81 i;  2R93 B;  5M3F B;  1VQB A;  3KYH C;  2PZU A;  4GOP A;  1LTR D;  4DAP A;  5CBE E;  1VQD A;  1SFO B;  1SRO A;  1UE7 A;  1CKM A;  3F2U A;  3J81 E;  3CPF A;  2NTT A;  2GA4 B;  3OMG A;  4DUY Q;  3PSI A;  1X65 A;  5ELB A;  2BA1 A;  2ES2 A;  2CH4 W;  2V4D A;  4G57 A;  2C9O A;  3AB9 A;  2WAQ G;  3FPU B;  4K2K A;  2X69 A;  2HUG A;  1STB A;  3DEO A;  3E9I A;  4KN4 C;  4ZK9 B;  4DV7 L;  2K04 A;  2EVB A;  2E2J H;  2AQ1 B;  5KGU A;  2EYL A;  2I46 A;  2K5H A;  4A3J G;  1PH2 A;  3VYT A;  2EDG A;  4YIJ A;  1QZG A;  4JBM A;  2JA5 B;  5LHY 1;  2PQA A;  1ASY A;  2EJM A;  1BCP D;  1KAW A;  2ZTD A;  4DV6 Q;  2PI2 A;  2XGT A;  2E2H H;  2SNS A;  3HEJ A;  1BKB A;  1E24 A;  1DJR D;  5CR3 A;  4DXF A;  2CWA A;  3CP0 A;  1SNP A;  2F0D A;  3QWN A;  1CA5 A;  1RTO A;  1IYU A;  1YJN A;  3NXW A;  4J1M A;  5EBC A;  3PUY A;  5CMD A;  3MXN B;  3VYR A;  5C4X G;  1KTK A;  1EY6 A;  4QB4 A;  4YHH L;  4DF7 A;  3RNU A;  4RGO S;  3ONA B;  4JI2 L;  2RSO A;  4X3S A;  1WCM H;  4BY1 B;  2OXP A;  1D5Z C;  5EKI A;  1QB5 D;  4R4C A;  2KCN A;  4LF4 Q;  1FR3 A;  1QUQ B;  1HQR D;  1X9N A;  2RSN A;  1QE6 A;  1SYF A;  3EQL C;  4BBR G;  3VA5 A;  3CC7 A;  3GTQ H;  2VQF Q;  2CW0 D;  1X3G A;  2Q2T A;  4JOI A;  4MTN A;  2VQF L;  5JPM C;  3SGI A;  4CDE C;  4OX9 L;  3U9S A;  2C35 B;  2E2J B;  1B53 A;  3CF5 A;  2B2Y A;  4IAL A;  2QF7 A;  5FK9 C;  4LF4 L;  1VMC A;  3S14 H;  2X6G A;  1TWF H;  1EY5 A;  5LL6 X;  1XWE A;  1SBB B;  3TME A;  3BVG A;  1B70 B;  1PFB A;  4LUO A;  4YHH Q;  2F0T A;  1BNZ A;  2K5W A;  2JA6 H;  5C44 B;  4A3M H;  3S15 B;  1WTO A;  3RN5 A;  2EYH A;  4DA2 A;  4UP8 A;  5TSS A;  4G4K A;  2JJQ A;  4JI8 L;  1GVP A;  4HCE A;  1FVI A;  5JJL A;  1MJC A;  3D4R A;  1QJO A;  2MNA A;  3GO5 A;  1XMQ Q;  3RUZ A;  4X66 Q;  2PZW A;  3J7A V;  1OO9 B;  4NB3 A;  4DV7 Q;  5IT9 c;  3G48 A;  2HIV A;  3PIP A;  4OEL B;  1BCP B;  1LT6 D;  1WFQ A;  1L1O A;  2A68 C;  5J1Z A;  4OEM B;  3U58 A;  1TWH H;  2QDB A;  4BXX G;  4J15 A;  4CDF C;  3WDN A;  3CCU A;  4GN3 B;  5A2Q L;  1QVG A;  1FNU A;  4QMG A;  2F0L A;  4OO1 G;  3BYY B;  3U9O A;  2NUC A;  2WFW A;  4WJ4 A;  1BCP C;  2RA4 A;  4B3S Q;  5FO7 B;  1XNR L;  4HAE A;  4ZYS A;  5JJI A;  1Q81 C;  4C3H G;  5IIF A;  1P8L A;  1LTG D;  4C56 C;  5C0X J;  3PO3 G;  1VQ9 A;  4XYQ A;  4ALP A;  1UNS A;  1YNN D;  1SNQ A;  3HKZ E;  2R3Z A;  1ICF B;  2LKV A;  4UAI A;  2MJ8 A;  2VUM B;  1QUQ A;  2N78 A;  2RDH A;  1CTM A;  1D6E C;  4Y52 H;  2EY1 A;  4N9T A;  1DON A;  1TS5 A;  1KDA A;  3VDY A;  3OYY A;  4RGT A;  4HIO A;  3FDT A;  1T5E A;  5LMN Q;  2B2V C;  1TU2 B;  2N55 A;  4JBJ A;  3CHB D;  1MD2 D;  1K28 A;  2JA5 H;  4LFA L;  4R4T A;  2UXD Q;  2R92 B;  3LWE A;  3NTH A;  1G29 1;  1K8M A;  2UXB Q;  2F0Q A;  3TP6 A;  5LL6 S;  4R9W A;  1I4H A;  4N8X 1;  4F88 A;  4A3D H;  4ABN A;  2QA4 A;  4DNI A;  1H9K A;  3T56 B;  4IFD J;  2FHT A;  4OON A;  4C2M H;  2EYJ A;  1N33 Q;  3CD6 A;  4B3M L;  1BBU A;  3K7A B;  3M4Q A;  2MUY A;  4B3T Q;  1ICW A;  3PO3 B;  3GTJ H;  4B3R L;  1A62 A;  1LAC A;  2JA7 H;  4X65 Q;  1HXY D;  1VF7 A;  3S2D B;  4M8A A;  4LMQ D;  1I50 B;  1VQL A;  3HKZ B;  2RF4 A;  1FGU A;  4GNX B;  2Z1C A;  2R7Z G;  4UP7 A;  3VR6 A;  2CKZ B;  3W1G A;  4JI1 Q;  2DGY A;  1STH A;  1QVF A;  2K4K A;  4ULL A;  4QUF A;  1I5F A;  1B2T A;  2JE6 I;  5M5W H;  5KNC A;  2A6H D;  5KND A;  3CQZ B;  4RCO A;  4LNQ A;  4C1N K;  3EJI A;  3HOU B;  5J22 A;  3DM1 A;  1LYL A;  3O13 A;  4DK0 A;  4A3L G;  3I4M G;  4LF7 Q;  2B2W C;  4RGN A;  1H9J A;  1ZKO A;  1IBK L;  3QB3 A;  4LF5 L;  4FDB A;  1C48 A;  3H3V I;  1TII D;  1FGB D;  4A3D B;  3KLS X;  1BCP F;  4L6T B;  1Q86 C;  3I73 A;  1JWU D;  5FJ8 H;  2NZH A;  3QIA A;  1F2Y A;  3SE0 A;  5F2D A;  2DY8 A;  1HNZ Q;  1TVX A;  1NSN S;  1B50 A;  4BY1 H;  1VQF A;  1I6H B;  3HKS A;  1XMO Q;  5FLX c;  5C4J H;  2VXW A;  2ZJR A;  3T4A C;  3T16 A;  4X62 L;  4FXK C;  1HA5 A;  3L2P A;  5L37 A;  1BBX C;  3H09 A;  1I50 H;  1CZG A;  3K81 C;  4ME5 A;  2EOT A;  1DD2 A;  1U4R A;  1KLU D;  2PW5 A;  2F03 A;  2UUC Q;  3J80 i;  2WAQ E;  4IN3 A;  1AN8 A;  1PYB A;  4N9P A;  1A8V A;  5DM7 3;  2EYF A;  5EJW A;  1H9S A;  3S2H H;  4EGV A;  1HNZ L;  2VZA A;  2YTX A;  3BZC A;  3IFT A;  1KC8 C;  1Y1W G;  4X64 Q;  1PH9 A;  1YNJ D;  2O5I C;  3TP7 A;  4JI4 L;  1D7Q A;  4XQJ A;  3GV6 A;  5JOB A;  1G6Z A;  2RBM A;  5GRO A;  4QQB X;  4LF5 Q;  4PQX A;  4KJN A;  5E4X A;  4KTA A;  3JC6 6;  3R2I A;  1DCZ A;  5DEH A;  2J4X A;  1K8G A;  3S1M B;  1S5D D;  3A8J E;  4WRD A;  4KMU C;  2NVQ B;  2JYO A;  2MPM A;  3GQB A;  5M3M H;  5EGT A;  3BZK A;  1G51 A;  3RMH A;  3HOY H;  1Y8N B;  1SE4 A;  4C1N I;  1N32 Q;  1J5E L;  5M3M B;  2CVR A;  2LFN A;  4O0A A;  1SYB A;  3AEV A;  5ELD A;  4LJZ C;  3SK4 A;  1GD7 A;  1UUP A;  3E0J A;  4JI1 L;  4TQU S;  4GLV B;  4DR5 L;  2TMP A;  3SK5 A;  2B2U A;  4JI6 Q;  1EIF A;  2IHF A;  4UPA A;  2EYO A;  2UUB Q;  2Z6K A;  2HCI A;  3BJU A;  1PTO D;  1OTC A;  4HIM A;  3H0G H;  2F4I A;  1YHQ A;  1NY4 A;  1SJE D;  2XWB B;  2F3I A;  4A3I G;  4XIG S;  3M3Y B;  1SLJ A;  2SOB A;  1V1Q A;  1C8C A;  3ERQ A;  3CPW A;  4DNR B;  1EY9 A;  3K5M A;  5BR8 Q;  1HZB A;  1HFG A;  4DR3 L;  3HOX G;  1OXS C;  4BBR H;  1YNN C;  2K5N A;  1PFN A;  5FLM H;  2UXB L;  1RHP A;  2F0M A;  3CAM A;  2KOL A;  4PNY A;  1PFM A;  3GTP H;  2VQE Q;  3S1Q B;  2UXD L;  1WTV A;  4HCS A;  5LMN L;  4XQQ A;  3W2D A;  4DR7 Q;  3F8T A;  3NQT A;  1UWV A;  2D62 A;  1WOC A;  1CFM A;  1LTS D;  3KF8 B;  5C4J B;  3S17 B;  1K8A C;  1Z7T A;  4IUP A;  3A54 A;  3TS2 A;  3UDI A;  1JE4 A;  1O7I A;  3IL8 A;  1LTA D;  5GQO A;  3S17 H;  3HOV H;  1FL0 A;  1NE3 A;  3A0J A;  1SYD A;  4A93 H;  4A3G B;  3K5L A;  2QEJ C;  1K83 H;  1VCI A;  4DR6 Q;  3I72 A;  2J7Z A;  1KRT A;  3MEF A;  1Q12 A;  4WJ3 M;  4BY1 G;  1CI3 M;  3GTM H;  2E2H B;  4PZ6 A;  4F87 A;  1I3Q H;  3QG1 A;  1L0Y B;  1PH6 A;  2ZJQ A;  4EQN A;  3GTM B;  3HOV G;  1WD1 A;  2KEN A;  4C3H B;  2EE1 A;  1HH2 P;  2ZT9 C;  1VQ7 A;  1VQC A;  1Z47 A;  4L8J A;  2XRQ D;  2KBN A;  2H4O A;  1V9P A;  4IUR A;  4B9X A;  4UHV A;  1VQK A;  4KHP Q;  3KBG A;  1IKL A;  2Z6B A;  1Y1V G;  5EQ0 A;  2R7D A;  2WKD A;  3PO2 H;  2L9H A;  4IJL A;  5IYD G;  4BBS B;  4AIM A;  4FNF A;  5HY6 A;  3PUW A;  1NCV A;  1S5C D;  3BU2 A;  1LT4 D;  2EIF A;  1DOM A;  1YNX A;  3OWF A;  5IP9 G;  3HOZ G;  1HQM C;  4DXG A;  3GDE A;  3JAM L;  1FD7 D;  3J80 E;  2IT1 A;  4K0K Q;  2PO4 A;  4JOI C;  4JW0 A;  1E3P A;  3OIP A;  4OO1 I;  4DU9 A;  1EQV A;  5I6Y A;  1VQ6 A;  4KHP L;  1D5M C;  3TBI B;  2OT2 A;  1X55 A;  1I94 Q;  2PQA B;  5ISR A;  1JC7 A;  2JXM B; 
#chains in the Genus database with same CATH homology
 5GAH C;  3PO2 G;  1KAW A;  3EN2 A;  2AHO B;  1E1T A;  2ZTD A;  2OWO A;  5FJ8 G;  4DV6 Q;  2PI2 A;  2XGT A;  2ZM6 Q;  4BBS G;  2JEA I;  3PF4 A;  2E2H H;  3B6Y A;  1S72 A;  1BBW A;  1BKB A;  1E24 A;  1WJJ A;  1X56 A;  3PV0 A;  4X6A H;  2JA6 G;  4DK6 C;  4POF A;  4IFD G;  2CWA A;  1PH5 A;  3CMA A;  1H95 A;  4EX5 A;  3CP0 A;  4NXM Q;  3CCE A;  2R93 G;  1YZ6 A;  5C44 H;  1P16 A;  2VL6 A;  1MJE A;  3KOJ A;  1WYD A;  2PNH A;  1K3R A;  1YJN A;  3I55 A;  4B3T L;  2I5H A;  2RHS B;  4JI3 L;  1EWI A;  4DV5 L;  4IPG A;  1XTD A;  3PUY A;  3I4N G;  2K75 A;  3MXN B;  3A5Z B;  1UE1 A;  1NMF A;  3PO3 H;  5C4X G;  3RNU A;  4YHH L;  2HIX A;  2I5M X;  3U50 C;  4EQ5 A;  4L5S A;  4OWW B;  4JI2 L;  2FXQ A;  1YJ9 A;  1WCM H;  1UEB A;  2BH2 A;  1OXX K;  1SFO H;  1EIY B;  4R4C A;  2E8G A;  1JJG A;  2WB1 G;  4LF4 Q;  4BBS H;  4LF6 Q;  3U4Z A;  1QUQ B;  2UUA Q;  1TWA H;  1X3E A;  1YHA A;  1QVC A;  1X9N A;  2BH8 A;  2VY3 A;  1EUJ A;  4BBR G;  2B63 G;  1HNW L;  3CC7 A;  1HZC A;  5IYC G;  5K36 G;  3GTQ H;  2VQF Q;  3L0O A;  2K52 A;  4IPC A;  3PGZ A;  4QJF A;  1X3G A;  2Q2T A;  5IYB H;  3S1N H;  2WP8 J;  4DK3 C;  4JOI A;  4MTN A;  4JI3 Q;  2VQF L;  2VQE L;  3SGI A;  4OX9 L;  2LXJ A;  2C35 B;  3GTL H;  4JYA Q;  2UUA L;  2XTI A;  2Y0S E;  3CF5 A;  1LM0 A;  3FKI G;  1XPO A;  4LFC Q;  4OWX B;  4LF4 L;  3G71 A;  4JC0 A;  2JQO A;  3I2Z A;  4DR3 Q;  1TWC H;  4L5T A;  4DV6 L;  1YIT A;  2N3S A;  3S14 H;  5C0X G;  3K7U C;  5BR8 L;  1TWF H;  2OTL A;  4YCU A;  4LF9 Q;  1B70 B;  4C3H H;  4NXN Q;  4LUO A;  3TS0 A;  3CC4 A;  1FJG L;  4YHH Q;  4TVA B;  4AYB G;  2UU9 Q;  4JBW A;  1Q82 C;  1Z9F A;  3RLF A;  5IYB G;  4DV5 Q;  4P73 A;  4A3M H;  2Z6K C;  1R9T H;  2JA6 H;  1Y1V H;  3J81 c;  2YYZ A;  3KF6 A;  3RN5 A;  5M3F H;  4GNX C;  4NXM L;  2UUB L;  4B3S L;  4UP8 A;  1HZA A;  3J81 j;  5M5Y H;  4UY8 C;  2JJQ A;  4JI8 L;  3U4V A;  1GVP A;  2PI2 E;  1E1O A;  3ULP A;  4RG1 A;  1FVI A;  1CKO A;  1MJC A;  5JJL A;  1KIX A;  1TWG H;  1IXR A;  1QZH A;  2MNA A;  4DUY L;  3M85 A;  3GO5 A;  1XMQ Q;  4JV5 Q;  1J6Q A;  3KDF A;  5IY0 A;  2KHJ A;  3CCS A;  2R7F A;  4HJA A;  1IBL L;  2NVT H;  3T1H L;  4X66 Q;  2RHQ B;  4P72 A;  4NB3 A;  4DV7 Q;  2OQ0 A;  3G48 A;  5IT9 c;  2HIV A;  5IYC H;  3OW2 A;  5LMU L;  2V1C C;  1PH4 A;  3PIP A;  2YU9 H;  2ZTC A;  1WFQ A;  4K0K L;  1L1O A;  4O2D A;  2AKW B;  5C0X I;  3T1H Q;  3U58 A;  1TWH H;  2LSS A;  1JJC B;  3GTG H;  4BXX G;  4J15 A;  4GOP C;  5LMN W;  1E22 A;  3CCU A;  1XMQ L;  4GN3 B;  5JJK A;  5EAY A;  1KD1 C;  1GO3 E;  4NPS A;  1A63 A;  4A3F H;  1QVG A;  4GS3 A;  1K9M C;  3T1Y Q;  4HJ9 A;  4GLA C;  3JAM c;  1VQI A;  4IPH A;  3ERS X;  4OO1 G;  1PVO A;  1HZ9 A;  4GKK Q;  2ZJP A;  1TXY A;  1OXU A;  2WFW A;  1OXV A;  3NBH B;  4Y7N H;  4LFB L;  4AYB E;  2EQS A;  4WJ4 A;  4JI4 Q;  1RIP A;  1VQE A;  3F2D A;  3J7A 5;  4B3S Q;  4X64 L;  1XNR L;  3FP9 A;  5JJI A;  1Q81 C;  1P8L A;  4A3K G;  3S1M H;  2UXC Q;  2R7Z H;  1X54 A;  5C0X J;  3PO3 G;  2HHH Q;  1VQ9 A;  3S15 H;  4ALP A;  3G6E A;  2UU9 L;  1YBY A;  2GVB A;  3HKZ E;  4L5R C;  3M7N A;  1IL2 A;  3OTO L;  3UDF A;  2NVX H;  4IFD I;  1K73 C;  1Q1E A;  2IX0 A;  3CCM A;  3RN2 A;  1KXL A;  1N36 L;  3KJO A;  1EFW A;  4A93 G;  3PUV A;  3ICE A;  1QUQ A;  2N78 A;  3RLN A;  4Y52 H;  4PZ8 A;  2QEX A;  2YV5 A;  3M9B A;  4JYA L;  2CFM A;  3EIV A;  4DAY B;  4DV4 L;  3VDY A;  1PFS A;  3OYY A;  1VS0 A;  4RMF A;  4OX9 Q;  3ZJY C;  1RL2 A;  2NVY H;  4R1J A;  1XMO L;  4HIO A;  1HNX L;  3RZO H;  4BA2 I;  2KHI A;  5LMN Q;  3I4M H;  4DR6 L;  4JBJ A;  4LFA L;  2JA5 H;  2OQK A;  4R4T A;  2UXD Q;  3KDF B;  1MKH A;  3TQY A;  2LXK A;  1G29 1;  2N49 A;  1SR3 A;  2ATW A;  2UXB Q;  4HJ7 A;  4LUV A;  1U0L A;  4IPD A;  5GAG C;  4LF6 L;  5ELN A;  4QL5 A;  1Y1W H;  4A3D H;  1CKN B;  4HJ8 A;  1EQR A;  4QIW E;  3F2C A;  4DR1 L;  2QA4 A;  3GTK H;  4DNI A;  1PH3 A;  2JA8 G;  3CME A;  2A8V A;  1UE5 A;  4JI5 L;  1KHI A;  5IE8 A;  3K7A H;  4OON A;  4YY3 L;  1NJI C;  4IFD J;  4C2M H;  4JI2 Q;  1HR0 L;  1AE2 A;  4GKJ Q;  4DV1 Q;  1N34 Q;  1N33 Q;  4LF7 L;  4HIK A;  2IHE A;  4QY7 A;  1CSP A;  4P74 A;  3CD6 A;  2MFI A;  1BBU A;  1OXT A;  2JEB I;  4B3M L;  4AQY Q;  3M4Q A;  4B3T Q;  2AMC B;  3STB D;  3GTJ H;  4B3R L;  1A62 A;  2JA7 H;  1VQH A;  1D8L A;  1WI5 A;  4YWL A;  4X65 Q;  5GAE C;  3JAM i;  3A5U A;  2F4V L;  1EYG A;  1VQL A;  2R7Z G;  2RF4 A;  1FGU A;  2MQH A;  2VS1 A;  2YTV A;  4GNX B;  2CCZ A;  4A3C H;  3AFP A;  4UP7 A;  2CKZ B;  3W1G A;  4DV0 Q;  2ZM6 L;  3FKI H;  3S1R H;  4A3E G;  4JI1 Q;  2DGY A;  1V43 A;  1IYJ B;  1SE8 A;  2ID0 A;  4AH6 A;  2K4K A;  4JI0 L;  1QVF A;  1XNQ Q;  1I5F A;  2K14 A;  1HR0 W;  4PMW A;  1XJV A;  1Y14 B;  2VUM G;  4ME3 A;  5IP9 H;  1YHB A;  1I94 L;  1VQN A;  1HJP A;  2JE6 I;  3A74 A;  5M5W H;  1YEZ A;  3UDG A;  4DV2 L;  4LNQ A;  1W2B A;  5AJ3 L;  4A3G H;  1N9W A;  4P75 A;  4B3R Q;  1LYL A;  1JB7 A;  4A3C G;  3CQZ H;  3PIO A;  2D0P A;  2KCM A;  4B3M Q;  1PA6 A;  4A3L G;  3I4M G;  4IO9 A;  4JI6 L;  3I56 A;  2N8N A;  1IBM L;  4LF7 Q;  1N33 L;  4KLK A;  4DUZ Q;  2AWO A;  3AFQ A;  2ZTE A;  4R4Q A;  1IBK L;  2IX1 A;  4C3J H;  4LF5 L;  4FDB A;  3H3V I;  4YY3 Q;  1SMX A;  5JEA G;  2AWN A;  3CCL A;  2NN6 G;  3FHW A;  1YJW A;  4POG A;  1U5K A;  1Q86 C;  4LUZ A;  2NVQ H;  2OCE A;  2ASB A;  5FJ8 H;  2NZH A;  4A3K H;  3H15 A;  4DAM A;  1PV4 A;  1M1K C;  2I0Q A;  3GTO H;  1XPU A;  4C3I H;  5C44 G;  4KHZ A;  3Q8D A;  3M4O H;  4A4I A;  5IWA L;  2ALY B;  1HNZ Q;  1SN8 A;  3KF6 B;  3I4N H;  4DR2 L;  4LFA Q;  4BY1 H;  1VQF A;  2Q2U A;  3H3V H;  5M3M G;  5M3F G;  3HKS A;  3CCV A;  1XMO Q;  1X6O A;  5FLX c;  5C4J H;  4IJH A;  2ZJR A;  1MIU A;  4DV4 Q;  1C7Y A;  4X62 L;  1IZ6 A;  4JI7 L;  3F1Z A;  2E5L Q;  2K50 A;  3L2P A;  2WB1 E;  4GLX A;  2E2I H;  1NBW A;  1I50 H;  1E7Z A;  3K81 C;  1G6P A;  1VQ4 A;  4BY7 H;  1C0A A;  3I4O A;  2VUM H;  1A0I A;  3PF5 A;  2Z0S A;  2UUC Q;  3EBE A;  4JI7 Q;  3J80 i;  2WAQ E;  1PYB A;  4GN4 B;  4KI0 A;  4MNO A;  1A8V A;  4MZ9 A;  4QGU A;  3M3Y H;  3S2H H;  4DR2 Q;  1K0R A;  3W1B A;  3HFZ B;  1BVS A;  5IWA Q;  3PUX A;  1HNZ L;  4YWM A;  4LW1 A;  2NN6 I;  2QGQ A;  2VZA A;  2YTX A;  3BZC A;  3WWV A;  4DKA C;  5C4X H;  1KC8 C;  1Y1W G;  2UUC L;  4X64 Q;  3HOU H;  1PH9 A;  4YWK A;  4JI4 L;  5E7N A;  4A76 A;  3KJP A;  1D7Q A;  2KCT A;  4A3B G;  1LUZ A;  3NEN A;  1JJ2 A;  1GKH A;  3DLL A;  3KFU A;  3T1Y L;  4YCW A;  1L2F A;  5GRO A;  2E5L L;  4QQB X;  4LF5 Q;  4X62 Q;  1UE6 A;  1S40 A;  3S1Q H;  1HNW Q;  1IBM Q;  3JC6 6;  4DR7 L;  1S3O A;  1VQO A;  3TEH B;  3AYH B;  4OWT B;  1K8G A;  1VQ5 A;  5DLQ E;  3LGJ A;  4DV3 Q;  1PYS B;  3IRB A;  1B8A A;  1VQM A;  3HOX H;  4HID A;  2DUD A;  3PCO B;  5M3M H;  1AE3 A;  1NMG A;  5AJ3 Q;  3BZK A;  1G51 A;  2A1A A;  4A3M G;  1PH7 A;  3HOY H;  4DV2 Q;  3S2D H;  4X66 L;  1N32 Q;  1IBL Q;  4GN5 A;  1C9O A;  3G4S A;  3W5O A;  1J5E L;  1YVC A;  4DR4 Q;  4P71 A;  3HOW H;  4O0A A;  3NEM A;  3CW2 C;  3AEV A;  4JI0 Q;  3PUZ A;  3ULJ A;  1GD7 A;  1L0W A;  4JI1 L;  4BY7 G;  4TQU S;  2JK8 A;  3CCJ A;  4DUZ L;  1IBK Q;  4GLV B;  4DR5 L;  3KLW A;  4JI6 Q;  4JI8 Q;  2VNU D;  1EIF A;  1KRS A;  2IHF A;  3UDX A;  2A19 A;  4UPA A;  2I5L X;  4A3G G;  3J7Z C;  2OTJ A;  1Q8K A;  2Z6K A;  3CCQ A;  2MO0 A;  2UUB Q;  3K80 C;  3BJU A;  1N8R C;  1OTC A;  2R92 G;  4HIM A;  3H0G H;  1YHQ A;  1NY4 A;  2PMZ E;  4R4I A;  4APV A;  1XPR A;  2F3I A;  5JEA J;  4A3I G;  4XIG S;  1CSQ A;  2H5X A;  1SLJ A;  2Y0S G;  1V1Q A;  1FJG Q;  3UE1 A;  4DR5 Q;  3CPW A;  1L1O C;  4DV1 L;  1N34 L;  4BXX H;  1W3S A;  3D0F A;  3K0X A;  1SRU A;  3J80 c;  5BR8 Q;  5J3B A;  3HOY G;  2EXD A;  1HZB A;  1XNQ L;  1CKN A;  3TRZ A;  4DR4 L;  3AQQ A;  4DR3 L;  1L1O B;  4DPG A;  3HOX G;  4DR1 Q;  1OXS C;  4BBR H;  4HJ5 A;  4DV0 L;  1J5E Q;  3ER0 A;  2B63 H;  2R6G A;  4LFC L;  2K5N A;  1N32 L;  4BA1 I;  4IOC A;  2HQL A;  4YCV A;  1AH9 A;  3M4P A;  5FLM H;  3L7Z C;  4OXP A;  2UXB L;  3CAM A;  2K5V A;  4GOP B;  1X3F A;  4X65 L;  2F4V Q;  2R93 H;  3GTP H;  4DV3 L;  2VQE Q;  2MO1 A;  3E9H A;  3HOZ H;  4AQY L;  2UXD L;  3NEL A;  1VQG A;  5LMN L;  2GN5 A;  4A3I H;  2F52 A;  4DR7 Q;  3K8A A;  1HNX Q;  3F8T A;  1Q1B A;  1VQP A;  1UWV A;  4PZ7 A;  1KL9 A;  4R4O A;  3H0G G;  1HR0 Q;  5IP7 H;  1Q46 A;  2D62 A;  5C3E G;  4GNX A;  1WOC A;  3HKZ G;  2HT1 A;  3KF8 B;  5ELO A;  3CC2 A;  3GD7 A;  2B29 A;  4JI5 Q;  3I7F A;  1PH1 A;  1K8A C;  4A3E H;  3RZD H;  2IY5 B;  4UP9 A;  1M90 C;  4JCV E;  3TS2 A;  1PH8 A;  3UDI A;  1O7I A;  5GQO A;  4XTC S;  3S17 H;  3HOV H;  1FL0 A;  2VW9 A;  1NE3 A;  3A0J A;  2CQO A;  3OTO Q;  4A93 H;  2R92 H;  3E0E A;  3S24 A;  1JT8 A;  1K83 H;  1VCI A;  5GAD C;  4A3J H;  4DR6 Q;  1EQQ A;  2L15 A;  5IP7 G;  5C3E H;  2UXC L;  2YTY A;  4L5Q A;  1B7Y B;  4JG2 A;  3STB C;  5M5X H;  1KRT A;  3MEF A;  4A3L H;  1Q12 A;  1JMC A;  2JA5 G;  4WJ3 M;  4BY1 G;  3GTM H;  4LWC A;  4PZ6 A;  5H1S E;  2JA8 H;  4IOA A;  4LFB Q;  1I3Q H;  1Q7Y C;  4A75 A;  1PH6 A;  4GKK L;  1T9H A;  1N36 Q;  2ZJQ A;  4A3D G;  2B3G A;  5IYD H;  2D0O A;  2GVA A;  5FLM G;  2CWP A;  3UE0 A;  3HOV G;  2KEN A;  3ULL A;  5HGQ A;  1HH2 P;  1VQ7 A;  1VQC A;  1Z47 A;  2RCN A;  1DGS A;  4LF8 Q;  2KBN A;  1VQ8 A;  1V9P A;  1YIJ A;  2HHH L;  1VQK A;  4KHP Q;  1NTG A;  4H02 A;  4GKJ L;  1I6H H;  1PHJ A;  3HOU G;  1VQA A;  3RLO A;  1Y1V G;  5LMU Q;  1VQJ A;  3D31 A;  1XNR Q;  3J81 i;  2R7D A;  3F2B A;  1ASZ A;  1VQB A;  3KYH C;  3PO2 H;  4GOP A;  4A3F G;  4IJL A;  5IYD G;  1YI2 A;  1VQD A;  4AIM A;  5HY6 A;  2JA7 G;  1SRO A;  3PUW A;  1UE7 A;  1CKM A;  4A3B H;  2NZO A;  3CPF A;  3BU2 A;  4DUY Q;  1JE5 A;  1WCM G;  3PSI A;  3CXC A;  1X65 A;  3TRE A;  2BA1 A;  2EIF A;  2ES2 A;  3RR5 A;  1CUK A;  4JBK A;  1YNX A;  3CCR A;  5IP9 G;  3HOZ G;  3DM3 A;  2JA9 A;  3GDE A;  2IT1 A;  4K0K Q;  4JOI C;  2WAQ G;  2Q2I A;  1KQS A;  1GM5 A;  1LTL A;  1E3P A;  4OO1 I;  1VQ6 A;  3E9I A;  4DV7 L;  4KHP L;  2E2J H;  2Q2H A;  4A3J G;  4PG3 A;  2K5H A;  1PH2 A;  2BA0 A;  3HOW G;  1QZG A;  1X55 A;  4LF8 L;  1I94 Q;  4JBM A;  4NXN L;  2PQA B;  4JV5 L;  1EOV A;  3S16 H;  2PQA A;  4LF9 L;  1ASY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...