4NXMQ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nxmQ00
4P75A 1X56A 2GVBA 4QY7A 5LMNW 5IYBH 4DV4Q 4L5SA 3HOYH 3KF6B 3RLFA 3I4NH 3D31A 1N8RC 4DR7Q 1BBWA 3CAMA 3F2BA 1HNZQ 4QL5A 5GAHC 4LF4L 1UE5A 2YU9H 1KL9A 3CCSA 1HZCA 3I7FA 4R4QA 5C4XH 2PMZE 3UDXA 3FHWA 1X3EA 4A3LG 4DV1L 1VQMA 1PHJA 1YNXA 2E8GA 1QVFA 2C35B 2AHOB 1TWAH 2PQAB 2ZJRA 1UWVA 4UP9A 1X65A 2RHQB 2I5HA 1HNWL 4WJ3M 1YHBA 2YTXA 4LF7Q 1BKBA 1VQCA 2NN6G 3TEHB 1KC8C 4BY1H 1HNXQ 4HIMA 1PH6A 4HJ5A 2K4KA 2CCZA 3I4OA 4HIDA 2N78A 2RCNA 2JE6I 2Z6KC 3PUXA 5HGQA 4DR2Q 2KCMA 4GOPC 2E2JH 3NELA 3S16H 5IWAQ 1E1OA 3CPWA 4PZ8A 4YY3Q 1E24A 2UUCL 3JAMc 3M9BA 4DV5L 1ASZA 1X55A 4A3EG 4LWCA 1E7ZA 3AEVA 4A3KH 1VCIA 3ICEA 4YCWA 3A5ZB 2I5MX 4DV7Q 1Q46A 2ZTEA 3S14H 5IE8A 2MNAA 5M5YH 3BZKA 1G51A 4P71A 3F2DA 1Z47A 4NPSA 1YJWA 4A76A 4B3TQ 1A0IA 4LF5L 1QZHA 4DR4L 3K7AH 4A3FH 1L1OA 2UU9Q 3EIVA 3T1HL 5M3MG 2OTLA 1VQ5A 4B3SQ 2K5NA 3NENA 5C0XG 1N32Q 1XNRL 4LUVA 4DV2L 4MTNA 4LFAQ 3Q8DA 3W1GA 1MJCA 3AQQA 4B3RQ 3S1RH 2R7DA 3S1NH 2LXJA 4A3MH 1IBKL 4TVAB 1QUQB 3JC66 2JQOA 4LFCQ 4POFA 3GDEA 3TRZA 3T1YL 1VQEA 4P74A 4NXNL 5M3FH 3ER0A 5FLMG 5GROA 4DR6L 1IZ6A 1V1QA 2VY3A 4XTCS 1NTGA 2D0OA 2EIFA 4P72A 4JI4Q 4LF9Q 4JI0Q 1L2FA 4JI3Q 4DNIA 4AQYL 2JA8H 1D7QA 3EBEA 3J80c 1EIFA 5DLQE 2CWPA 2K14A 3MXNB 1VQPA 1XMQL 3CCEA 3CPFA 1YHQA 2EQSA 4JI5Q 4JBJA 3L7ZC 3MEFA 1VQJA 1HZAA 4OO1I 3G71A 4JI8L 2Q2HA 3H0GH 5LMUL 1PH9A 2MQHA 1N34Q 1IXRA 4JI6L 3KFUA 4A3BH 2VQFL 4PZ7A 1WYDA 3L2PA 1UE6A 1Y1WG 1E3PA 2N3SA 4QIWE 5IYBG 3VDYA 2UXDQ 3I4NG 1S40A 1IYJB 1KAWA 1KRSA 1N36L 2BA1A 2MO0A 4DV3Q 1SLJA 4YHHL 4GOPB 4IFDI 4HIOA 1V43A 4C3HH 3M7NA 1CKNA 2Q2TA 3BZCA 2Y0SG 5H1SE 3U4ZA 1XPUA 4GKJQ 5C4XG 2VQEL 1Q8KA 1YITA 1OXVA 3F2CA 1TWHH 5E7NA 1LTLA 1IBLL 2UUAL 1N33L 4QQBX 4JYAL 4BBRH 1XNQL 3DM3A 4LW1A 2RHSB 4RMFA 1HR0L 4GN4B 4BY1G 1UE7A 2H5XA 4BA1I 5JJIA 1OXSC 3S15H 2CFMA 4GN3B 2PNHA 4EQ5A 4APVA 4XIGS 1PYBA 2JA5G 2ZTCA 2R7FA 3G6EA 1CUKA 2VNUD 3PCOB 2QEXA 3HOXH 2FXQA 3KDFA 3U50C 1PV4A 4IFDJ 3HKZG 2F4VL 1YJNA 1KRTA 1Q81C 4A3KG 2B63G 1X3FA 3PF4A 2PQAA 3CC2A 5FJ8H 4K0KL 2AMCB 1A62A 1KHIA 1YEZA 2V1CC 3KLWA 4KHZA 1OXTA 4AYBE 1I3QH 2VUMG 1FJGL 5JEAG 4PG3A 1K0RA 2D0PA 2IT1A 3I55A 2E5LL 4B3ML 2JA6H 1H95A 1HNWQ 3W5OA 3PUYA 4DAYB 3CCUA 5JJLA 4NXMQ 3K8AA 3GTMH 1PH4A 4J15A 4JCVE 3CF5A 3PUVA 4A75A 3PO3H 3NEMA 5GADC 4OX9L 1UEBA 1L1OC 4LF8L 1XMOL 4DUYL 1E22A 3I2ZA 4HJ8A 1GVPA 2GN5A 4X62Q 4KHPQ 4A3MG 2UUCQ 1HR0W 3CQZH 4DPGA 1I6HH 3I4MH 1N9WA 3HOUH 5JJKA 4JBWA 3RNUA 4A93H 3M85A 3HOWH 1PH2A 4X6AH 5M3FG 2ZM6Q 4ME3A 2B3GA 2YYZA 1MKHA 4MZ9A 4DUZQ 4DV6L 4A3IH 2NVQH 2F3IA 3HOVG 3G4SA 2E2IH 3WWVA 1D8LA 2R7ZH 3S2DH 1SN8A 4A3DH 1CSPA 3PUWA 4DR4Q 2A19A 5J3BA 3U4VA 1J5EL 4R4OA 2F52A 1FGUA 1VQFA 1YBYA 3K80C 1HZBA 4IPDA 3ULJA 1WFQA 3UDIA 1Q86C 2ES2A 4DV2Q 1QUQA 1EUJA 1HH2P 2HIVA 3H0GG 3TS2A 4DR5L 3CCMA 3GTKH 1EOVA 5IP7G 3H3VI 4A3BG 2LSSA 1WCMH 5IP9H 4GNXC 1TWGH 1YJ9A 1S72A 2YTVA 4YCUA 4YCVA 2AWNA 4A3GH 3KYHC 5IYCH 1EYGA 4LFBQ 1NE3A 3T1YQ 4GN5A 2IHFA 2HHHQ 4NXNQ 2Q2UA 4A3CG 2WAQE 4DR2L 1TXYA 2HT1A 1OXUA 4KI0A 1YZ6A 3ULPA 4JOIC 5EAYA 4DAMA 2OTJA 3PV0A 1OTCA 4HJ9A 4AQYQ 4A3LH 2PI2E 3KOJA 4JV5L 3L0OA 3GTLH 5GAGC 1XMQQ 3G48A 1XJVA 4BBRG 4LF6L 1PFSA 1O7IA 2NVXH 5C0XI 4X64L 2KHJA 2JJQA 2KBNA 4TQUS 5M5XH 4JI8Q 5IYDH 5C44H 4WJ4A 1X3GA 1I50H 2ZTDA 1Q1EA 1L0WA 2R92H 1NY4A 1VQ7A 1FL0A 4DR3L 4HJ7A 2UUBQ 2B29A 2A1AA 1C7YA 3KJOA 1SRUA 2IX0A 4YWMA 4JI2Q 3OTOL 3KF8B 3HOXG 3CC4A 1IBMQ 4GKKQ 1HZ9A 1VQBA 1JE5A 5GQOA 4LFAL 1VQ6A 2MO1A 3CCRA 3J81i 2R6GA 5K36G 4YHHQ 3E9HA 4X66Q 2IHEA 1G291 1EFWA 2E2HH 5FJ8G 1K83H 2K75A 3HFZB 1VQGA 1QVCA 1OXXK 4R1JA 1YI2A 3HOYG 4BBSH 4DKAC 3J81j 4LFCL 1VQLA 1E1TA 2Q2IA 2OQKA 2VS1A 4L5QA 3UDFA 4A3EH 3CCLA 5C0XJ 2JA6G 2K50A 1X54A 4P73A 3TREA 1IBLQ 4RG1A 3S1MH 2WP8J 4JYAQ 1JJCB 1P8LA 5IT9c 4AH6A 2BA0A 3JAMi 3I56A 1HR0Q 4JI4L 3M4OH 2BH8A 1RL2A 3PO3G 2WB1G 4DV0L 2ID0A 4JI0L 3A74A 4JI7L 5C3EH 1BVSA 1YHAA 2NZHA 5BR8L 3RR5A 5GAEC 4C2MH 5M3MH 1Z9FA 5ELNA 3A5UA 4ALPA 5LMNL 1QZGA 1AE2A 3HOUG 3KF6A 3A0JA 4A93G 3HOWG 2F4VQ 1XPRA 1I94L 1EWIA 1N34L 4POGA 3S2HH 1GD7A 2ZJQA 1JMCA 1GM5A 2K5HA 4O2DA 4K0KQ 4A3IG 4GNXB 3BJUA 5M5WH 1NJIC 3M3YH 3S1QH 3CP0A 4C3IH 1EQQA 3K81C 2R7ZG 3HOZH 4OWWB 1FJGQ 3S24A 1PH5A 4B3MQ 4A3DG 1Y1VH 2UXBL 3W1BA 1Y14B 1W2BA 1K8GA 4LF4Q 2OCEA 4JI1L 3J7A5 4DR1L 3UE1A 1VS0A 3LGJA 4LUOA 4BA2I 1C9OA 4GKJL 4DV1Q 2XTIA 4IOCA 2QA4A 1XPOA 2N49A 2PI2A 3HKZE 4DUYQ 4A3FG 1XMOQ 4HJAA 2BH2A 4R4CA 1T9HA 3BU2A 5AJ3L 3GD7A 1K8AC 1WCMG 5IP9G 4X65L 2YV5A 3PSIA 4UP8A 4A3GG 5IYCG 3ZJYC 2AWOA 1PH3A 4YWKA 1G6PA 4IPCA 3PGZA 2VW9A 4GS3A 1PYSB 4DV6Q 1LYLA 2VZAA 3GTJH 1Y1WH 1A63A 3CD6A 1U5KA 4FDBA 4OONA 3RLNA 4DV5Q 2ASBA 4JBKA 1Q1BA 3FP9A 3CCJA 4C3JH 3F8TA 3TS0A 3GTQH 3GTPH 3OW2A 1VQ4A 1VQ8A 2IY5B 3UE0A 1J5EQ 3AYHB 4R4IA 3FKIH 2ATWA 1GO3E 2MFIA 5IY0A 1JB7A 4DV4L 2UXCL 1VQOA 2R93H 4A3JH 3KDFB 2JA8G 5IYDG 1VQHA 1Q7YC 4LF5Q 5C44G 4DR7L 3TQYA 1NMGA 1K3RA 4DR5Q 2K5VA 1HNZL 3T1HQ 2R92G 2JA7H 1Q12A 1WJJA 3J81c 2NVTH 2NN6I 1JJGA 3RZOH 2EXDA 3J7ZC 1XNRQ 4NXML 1KQSA 2JK8A 3EN2A 3AFPA 4EX5A 4KLKA 3D0FA 3ERSX 4JBMA 2K52A 3HKSA 2JA5H 1EIYB 5HY6A 3B6YA 4GLVB 4IPHA 2JEBI 4IPGA 5JEAJ 3PIOA 1IBKQ 4X62L 4LF7L 4BXXH 4KHPL 3STBC 4OWXB 5C4JH 1HNXL 4BBSG 4JV5Q 1AH9A 1FVIA 2KCTA 3RN2A 2CQOA 4OXPA 3CCQA 1M90C 1K9MC 4BY7G 4DR6Q 2B63H 4NB3A 1ASYA 4LF6Q 2ZM6L 1C0AA 4LUZA 5IWAL 4X64Q 4DUZL 1CSQA 4YY3L 3CCVA 3PF5A 2DUDA 1KXLA 3RLOA 2RF4A 3SGIA 1PH7A 2ZJPA 2I0QA 2VUMH 4LNQA 5C3EG 2D62A 2WAQG 4YWLA 3RN5A 2DGYA 2XGTA 2CKZB 1MJEA 1VQDA 4DR3Q 2GVAA 4L5RC 1B8AA 2HIXA 1X6OA 4DV7L 3M4PA 3OTOQ 3GO5A 1BBUA 3CW2C 5LMUQ 1PH8A 4B3TL 1VQNA 2L15A 3CXCA 4JI6Q 1PVOA 3ULLA 2Z6KA 1M1KC 4HIKA 4OWTB 2VQFQ 1YIJA 2UU9L 4GOPA 2Z0SA 3OYYA 1SROA 3H15A 2OWOA 4B3SL 4Y52H 1EQRA 1AE3A 1P16A 2QGQA 1YVCA 1J6QA 4OO1G 1N32L 3HOZG 4LFBL 3IRBA 5ELOA 1N36Q 2KENA 1Y1VG 1KD1C 2HHHL 4B3RL 1L1OB 1TWFH 4Y7NH 3S17H 3H3VH 1DGSA 4GLXA 4IJHA 1KIXA 4GLAC 1X9NA 1WOCA 3HOVH 2VQEQ 4DV0Q 1HJPA 4JI7Q 1NBWA 1XTDA 1K73C 2UUAQ 1N33Q 5BR8Q 3U58A 2I5LX 4IFDG 1XNQQ 4DK6C 2JA9A 4JC0A 1UE1A 4R4TA 3GTGH 1JT8A 4GNXA 4LF9L 4PMWA 5LMNQ 1LM0A 1SFOH 1PH1A 1U0LA 2ALYB 4JI3L 3STBD 1PA6A 1I94Q 2N8NA 1RIPA 3DLLA 4IJLA 3E0EA 1SMXA 5IP7H 1B7YB 1CKMA 4JI5L 1WI5A 1CKOA 4JG2A 4JOIA 2UUBL 3PUZA 1IL2A 2Y0SE 1B70B 3I4MG 3UDGA 5FLXc 4JI2L 4GKKL 2WFWA 3NBHB 2JEAI 2WB1E 1IBML 2UXBQ 1SE8A 4A3CH 3PO2H 3F1ZA 1VQIA 2LXKA 4X66L 4JI1Q 4DR1Q 2OQ0A 3FKIG 4PZ6A 4QJFA 3M4QA 2R93G 1NMFA 4A3JG 2NVYH 2UXDL 4UY8C 4IO9A 2E5LQ 1GKHA 4DK3C 3E9IA 5FLMH 4DV3L 2JA7G 5AJ3Q 2IX1A 4O0AA 4AIMA 4X65Q 1W3SA 1VQKA 1MIUA 4BY7H 2VL6A 3KJPA 3K0XA 2A8VA 3RZDH 4OX9Q 3CMAA 4QGUA 4A4IA 4LF8Q 3GTOH 1I5FA 1VQAA 4H02A 1QVGA 1CKNB 1S3OA 4UP7A 3PO2G 3AFQA 2NZOA 3PIPA 1A8VA 1R9TH 4BXXG 2AKWB 4AYBG 2KHIA 4UPAA 3J80i 1LUZA 3CC7A 2HQLA 1VQ9A 4IOAA 2YTYA 1SR3A 4L5TA 4MNOA 1Q82C 2CWAA 1V9PA 1TWCH 3K7UC 1JJ2A 3CMEA 2UXCQ
chains in the Genus database with same CATH superfamily
2F0KA 3D31A 2EYHA 1M8AA 3F2BA 3JAME 1HNZQ 4QL5A 5GAHC 4KV6A 3MVVA 1UE5A 4BY7B 3QJYA 3I73A 3KBXA 3TZUA 2EXZA 2N55A 4DV1L 1PHJA 2E8GA 2EYJA 2AHOB 1HNWL 1UWVA 2I5HA 2BOSA 4LF7Q 1VQCA 3TEHB 3P7JA 4CKEA 4KY5A 5J22A 5HGQA 1T5XD 2DJFC 4GOPC 3S15B 1EIGA 3CPWA 4YY3Q 3HP3A 2MP1A 3JAMc 2F4IA 4A3EG 1E7ZA 3AEVA 1HRJA 2PYKA 4C1NK 1YNJD 1Y1VB 3D3RA 4YCWA 2I5MX 3S14H 3OW7A 1PTOB 2MNAA 3BZKA 4P71A 1ONLA 1S5CD 3KLRA 5IT9L 3K7AH 4A3FH 1L1OA 2UU9Q 3EIVA 2K5NA 5C0XG 1WTQA 4DV2L 2TMPA 1D1IA 3Q8DA 1MJCA 2R7DA 5JAVA 2LXJA 4UDUC 4CDDC 4HCEA 3H3VC 3PIO3 3JC66 2JQOA 1K0SA 1CHQD 3TRZA 4FNFA 5M3FH 3ER0A 5FLMG 4DR6L 1IZ6A 1V1QA 2B2TC 2VY3A 4XTCS 3TDQA 2ZXRA 1Z6HA 1NTGA 1UAPA 2CH4W 1D7QA 5C4HA 2B2VA 2JA8H 1PRTD 5I6YA 5DLQE 3MXNB 1VQPA 1XMQL 4KN4C 3TP6A 2Q2HA 5LMUL 1MSHA 4A3BH 4JPBW 3L2PA 2L11A 1Y1WG 1K3BC 2N3SA 4QIWE 1F2MA 2RDFA 1KAWA 1KRSA 2BA1A 4DV3Q 4CJ1B 4GOPB 4IFDI 1EYDA 4HIOA 1PMRA 1CKNA 4QUFA 4KHVA 5IGCA 4XYQA 2O5IC 2KEEA 4GKJQ 3N52A 3A8JE 3F2CA 5E7NA 1CQVA 3H91A 3DM3A 3TBIB 1DJRD 1CHPD 4APVA 4XIGS 1PYBA 2RVLA 2Q8IB 4K5XA 2R7FA 1CUKA 2QEXA 3HOXH 2FXQA 2Z4HA 3IKJA 1D5XC 3KDFA 4IFDJ 3FPPA 1YJNA 3PF4A 3Q0AA 5G3LD 1A62A 4Y7NB 1KDBA 1OXTA 3D4WA 1C48A 2E75C 4XXEA 4PG3A 2JA6H 2F0WA 5CC4A 3Q22A 3W5OA 2C5CA 5I6WA 4RCNA 5I4DA 4NXMQ 3NQTA 5KEEA 4J15A 4IQZA 4OX9L 3M4OB 1L0YB 1AP0A 1VMCA 5M9OA 1XMOL 4DUYL 2ZXPA 1E22A 2RA4A 3SHLA 1QJOA 3PIP3 2K5QA 3I4MH 2ICIA 4A93H 1O7LA 2A6ED 1DOLA 5M3FG 3DMUA 4DV6L 5C3WA 1EZ8A 3G4SA 3WWVA 1BOSA 2EPBA 3M3YB 4C3IB 3PUWA 1I4RA 2R3ZA 3ULJA 4IPDA 1Q86C 2F0OA 4KJNA 3C3LA 1HH2P 2NB0A 1DOKA 1EOVA 5IP7G 4A3BG 1WCMH 3TMEA 2F0EA 1NE3A 1VF7A 4GN5A 1NNXA 2E76C 1XXGA 2B2WA 2Q2UA 3MXUA 3MXNA 1G2SA 2DY8A 5FLXL 3LNNA 4DAMA 2OTJA 1OTCA 3GTJB 3VR5A 3KOJA 4QCLA 4C56C 3GTLH 5GAGC 1V1PA 4XQNA 4ZQ3A 1SYFA 1PFSA 4LF6L 3WOEA 4KTAA 4YIJA 2KHJA 5M5XH 4TQUS 2B8GA 5C44H 2JXMB 2R93B 4A3JB 1Q1EA 1NY4A 2UUBQ 2B29A 1C7YA 2IW3A 3HZXA 2A68D 4RHSA 3HOXG 1BCPD 4CJ0B 1VQBA 1IBMQ 1JE5A 5GQOA 4YHHQ 1EFWA 4CDEC 1K83H 3HFZB 3IFDA 2F0GA 2JA5B 4BBSH 4CBVA 3J81j 1E1TA 2Q2IA 2VS1A 2JA6G 2K50A 1X54A 3IL8A 3TREA 1IBLQ 3D8GA 1D6EC 3E6ZX 3EVQA 1O7YA 1P8LA 4AH6A 2B63B 5CR3A 1MGSA 2BH8A 3DWAA 4N9PA 1YHAA 2VUMB 5GAEC 1S5FD 1JR0D 5EJWA 3N6RA 3VR6A 1AE2A 2ENBA 4A93G 1BNZA 2F4VQ 4RGNA 3K5NA 4IZ8A 3BJUA 5M5WH 3S1QH 2NTTA 4OO1H 3CP0A 1EY9A 2HCCA 4EQOA 1JE4A 2FHTA 3CHBD 2EY5A 2KECA 1DCZA 2IPKD 2SDFA 1XTCD 1TWFB 1SE2A 1Z7TA 4BA2I 2HDMA 4GKJL 3HOVB 3BS1A 2XTIA 2QA4A 4ULLA 2N49A 2BH2A 4R4CA 3GD7A 1LLRD 1WCMG 1KAAA 4X65L 2YV5A 1ZYRD 1EYAA 1QG7A 4QMGA 5T1GA 1U4MA 4GS3A 3CKIB 2VZAA 3CD6A 1U5KA 4DV5Q 2D9UA 3FP9A 3CCJA 4C3JH 3F8TA 3QWNA 5ELDA 2Z9HA 3SEBA 3VA5A 1A15A 3AYHB 4XYOA 3RD4A 1STBA 3BYTB 3FKIH 2ATWA 1DD2A 2RKSA 2UXCL 5CV8A 1VQHA 2K33A 4LF5Q 5C44G 2MUYA 4DR5Q 3T1HQ 2JA7H 2NVTH 2NN6I 2VB2X 4NXML 4BBRB 2JK8A 1BUVT 4EX5A 1YNNC 3D0FA 3ERSX 2F0MA 1CZGA 2KCNA 5EKKA 4KD4A 1PDQA 3PO2H 4GLVB 5JEAJ 1KDAA 4BS9A 4I7AA 1HNXL 4BBSG 3KUPA 4OEMB 3RN2A 2EJGC 3BVMA 2CQOA 4OXPA 3CCQA 1A3TA 1M90C 1K9MC 4NB3A 1ASYA 1S5ED 3U9SA 1ZKOA 4LUZA 4X64Q 1MI2A 4DA2A 1CSQA 1TWCB 1AFPA 4DF7A 4K5VA 1KXLA 2PNRC 1EY8A 3HOYB 2WAQG 2DGYA 1B4OA 1I3QB 4KMUC 1TT2A 1VQDA 2EY1A 4I7ZC 4L5RC 1IYUA 1I4HA 2G9HD 1I4XA 3M4PA 4DV7L 2J7ZA 1EY6A 5IT9E 1VQNA 2DNEA 3MXPA 4JI6Q 1PVOA 2Z6KA 1M1KC 1YIJA 2F0SA 3MTSA 2NWGA 1TWAB 1IHZA 2NN6H 4LAAA 1AE3A 4OO1G 1YVCA 2SEBD 4F88A 5BN4A 1N36Q 1EY5A 2KENA 1NR4A 1DXMA 1I6HB 1AEXA 2Z4IA 2N88A 1EY0A 4Q5VA 3BVZA 1SMYC 2VQEQ 4DV0Q 4S3SA 4JI7Q 1EU3A 3MC0B 1XTDA 1PFBA 1BBXC 2BE5C 2I5LX 2KJXA 1UE1A 1C8CA 3ZYYX 1LM0A 1SFOH 1U0LA 4JI3L 3STBD 1PA6A 3NWSA 2CHBD 5M5YB 1SJED 3E0EA 1SMXA 2KUMA 1STGA 2RSNA 2UUBL 4CKCA 3K5LA 2Y0SE 1B70B 4C1NI 1TWGB 1IBML 4C3JG 1STYA 3EJIA 3V96A 2OQ0A 3FKIG 5JVH3 4PZ6A 1AZPA 3MA2B 4J6HA 3OSOA 4A3MB 1PFNA 2F0FA 5JPMC 2JA7G 3IAYA 1VQKA 2A8VA 2NVXB 2WIIB 2KEDA 1SNDA 1EU4A 3VR4A 3CMAA 1YNJC 2AQ3B 3GTOH 1I5FA 1ET6A 4RGTA 1T5EA 4UP7A 3PO2G 3NK9A 2NZOA 5HGTA 1SE4A 3I72A 3SK5A 3CC7A 1CA6A 2XWJB 3G6JB 1F9SA 1U4RA 3D4RA 1V9PA 4ID6A 4K8JA 2Z6BA 2GVBA 5LMNW 4MIUA 4DV4Q 2XVSA 3NBIA 2K32A 2QDLA 3CAMA 1RF2D 1VF5C 4XQJA 2YU9H 3MWYW 1BDOA 3CCSA 1HZCA 2KHSA 4R4QA 5C4XH 1VQMA 1YNXA 2EYPA 1ILQA 4UP9A 5KIXA 3H94A 2CQAA 1TWHB 2NN6G 3NQIA 4HIMA 1PRTC 4C2MB 1PH6A 4HTHA 4HJ5A 2K4KA 4HIDA 2JE6I 4RCOA 2KCMA 2E2JH 3S16H 5IWAQ 1E1OA 3MEHA 4N8X1 1E24A 1EWCA 3WOFA 2B2UC 4DV5L 4LK1C 4ZRZA 1VCIA 2KQ3A 1QNKA 2ZTEA 4H44C 5IE8A 1H9SB 3F2DA 4B3TQ 1YJWA 4LF5L 3BDLA 1AZQA 4DR4L 3T1HL 5M3MG 2OTLA 1N32Q 4ZUIA 4LUVA 4QIWB 4DNTB 2PZWA 3PO3B 4B3RQ 3S1RH 5FOBB 1NUCA 5EPJA 4G57A 2P5ZX 1QWYA 4DFAA 3X3NA 2EY2A 4PV1C 4NXNL 5FLXE 1WD0A 4RKLA 5GROA 3HGBA 1IL8A 4LF9Q 4JI0Q 2NVQB 3SK8A 4DNIA 3T13A 5E4WC 2E2IB 2PCFB 3EBEA 1LT6D 3OOCA 5CV4A 3CPFA 1B9NA 2EQSA 4JI5Q 3L7ZC 4NMZA 1HZAA 3G71A 4JI8L 1WTRA 3RZOB 2MQHA 1IXRA 4JI6L 2B2YC 4K6DA 1UE6A 3R2TA 1Y8OB 3VDYA 1PRTB 2UXDQ 2PW7A 1STAA 1IYJB 1N36L 1V43A 4C3HH 2A5HA 3BZCA 3I8ZA 5EQ0A 2A74C 5C4XG 3DEOA 2VQEL 1OXVA 3FDTA 1LTLA 4JYAL 4XDXA 1I6VC 4LW1A 1HA6A 4GN4B 2H5XA 5JJIA 3S15H 2CFMA 3F2UA 1LT3D 2X6LA 4EQ5A 1PZID 3T56B 5EBCA 1LABA 3U50C 1LTGD 1X3FA 3GV3A 1KHIA 2JP1A 2TSSA 2V1CC 2FMMA 4NKLA 1HUNA 2KCCA 1K0RA 2D0PA 1H95A 3FPUB 4DAYB 4A3EB 1FYCA 1LTSD 1EY4A 4A75A 4U673 1TU2B 1D5MC 2PQEA 3R2IA 1EQTA 1GOZA 4OHJA 3I2ZA 1GVPA 1RODA 2XNAC 2UUCQ 1HR0W 3HOUH 5IGFA 5JJKA 3RNUA 1H9SA 1PXUA 1I4PA 4X3KA 3M85A 3HOWH 1PH2A 1EYCA 4B9XA 4X6AH 4ME3A 3S2HB 2YYZA 4DUZQ 2A68C 2F3IA 2KVMA 2MGSA 1BCPC 1G2TA 1KTKA 4MTKA 4H13C 5J3BA 2IWHA 4R4OA 1FGUA 1VQFA 1E2ZA 1YBYA 3K80C 5DAUA 1WFQA 4K8IA 3J80L 3MFYA 1XX8A 4FXKC 1TY0A 3NPPA 3H3VI 2VB3X 1S72A 4YCVA 3TP8A 1HQRD 2AWNA 3KYHC 2H4OA 4LFBQ 3T1YQ 2HHHQ 1LTBD 2HT1A 1WD1A 3ULPA 4C3HG 5J1ZA 1CI3M 4AQYQ 1Y1WB 1C4QA 3GTQB 1XJVA 1CTMA 4H7BA 1NSNS 5ELCA 1ZXTA 2KBNA 2F0QA 5IYDH 3NBHA 2K01A 1I50H 2ZTDA 4R8IA 3J7YW 1L0XB 4DR3L 1KNEA 1SRUA 3OTOL 4YWMA 1HZ9A 4ME5A 4KJOA 3CCRA 3J81i 2E2HH 2IHEA 5D3DA 4OIKA 2K75A 1ZYRC 1VQGA 1OXXK 3VR3A 5COYA 2EYMA 1VQLA 3CCLA 1MD2D 4N8FA 4U68A 2BA0A 5JJZA 1HR0Q 1GHJA 5ISRA 3M4OH 1BCPB 1G6ZA 1EWHA 4JI0L 1HFGA 5C3EH 1SNCA 3RR5A 3VYTA 2OT2A 1Q3LA 4ZAIA 2NZ1D 4CDCC 5LMNL 4ALPA 1QZGA 3HOUG 1ICWA 2QF7A 1X3QA 3KK7A 3HOWG 1WTOA 1GD7A 2XSCA 1JMCA 2K5HA 2O4XA 4O2DA 4K0KQ 5IGGA 1KNAA 4KKTA 1JWUD 1NJIC 3M3YH 2O5JC 4C3IH 1EQQA 3K81C 2EOTA 3P75A 4DK0A 1FJGQ 4B3MQ 2UXBL 1B50A 4LF4Q 5CV7A 1SNQA 1PTOF 4JI1L 4DR1L 4FF4A 3TZDA 5M3FB 3S17B 4K6LA 4A3FG 4IFDH 4HJAA 4ABNA 5AJ3L 2A6HC 4UP8A 2EVBA 1PH3A 2OXPA 1JICA 3GTJH 4A3BB 2KOLA 3P20A 5ELEA 1Q1BA 3GTPH 2EZVA 1CQFA 1J5EQ 4M1UB 4R4IA 1WTHA 1GO3E 2MFIA 5IY0A 1JB7A 4K2KA 1F9QA 1VQOA 2R93H 4A3JH 2JA8G 5IYDG 3DXJC 1CT1D 2XRQD 1J9OA 2NVYB 1HNZL 1CFMA 2K5VA 1Q12A 3J81c 5L37A 2EXDA 1XNRQ 1ESRA 3AFPA 3D4DA 3RZDB 2K52A 3EA6A 2JA5H 1EIYB 5HY6A 1IBKQ 4IPHA 4BXXH 4LF7L 1UNSA 1SXTA 3STBC 5C4JH 4JV5Q 1IKLA 2B63H 5A2QL 4RAUC 1C0AA 4DUZL 4YY3L 3CCVA 1S5DD 2VUMH 2I0QA 2ZJPA 5C3EG 1I4QA 2IX3A 2CKZB 3M4YA 4ZK9B 1JCKB 2HIXA 3C1EA 3K58A 1BBUA 3CW2C 2Y0SB 2L15A 3CXCA 1PYWD 3ULLA 2WKCA 4HIKA 2UU9L 4GOPA 5DM73 3H15A 2GA4B 4L6TB 5CYUA 4WFN3 4Y52H 4K14A 1P16A 1J6QA 4I65A 4LFBL 2QEJC 5F2DA 3MXGA 2HHHL 1HQMC 3L3OC 1TWFH 4A93B 1DGSA 3TP7A 1LT4D 5I2YA 3HOVH 5BN3A 2K1BA 4IALA 2UUAQ 3HEJA 5DNFA 5BR8Q 4IFDG 2JA9A 4JC0A 3GTGH 2F3WA 2QILA 1I94Q 4RKBA 3VYUA 2IL8A 3DLLA 1SAPA 3Q6SA 1GUOA 2WKDA 1WI5A 1CKOA 5C5MA 5JPNC 1IL2A 3PUZA 3I4MG 2M2LA 3UDGA 1WCMB 2WFWA 5LHY1 4A3CH 5JVG3 3F1ZA 2LXKA 2FFKB 4KY7A 3V2TA 3BDOA 4G7ZC 2B2TA 4QJFA 3S1NB 1HCZA 2R93G 4A3JG 5D65A 4UY8C 3RUZA 2E5LQ 1GKHA 4H0LC 4DK3C 4DV3L 1PZKD 3GTLB 4O0AA 3MAQA 4AIMA 5KGUA 1W3SA 4RGMA 1M4VA 1OO9B 4LF8Q 2MHVA 1VQAA 3TN2A 3C46A 4IUQA 3P1HA 4BXXG 1R9TH 1GXDC 2AKWB 3NTHA 4UPAA 4AYBG 4BWGB 3J80i 1LUZA 3URYA 4L5TA 5CBEE 1BF4A 1TS3A 1TWCH 3K7UC 2HCIA 1X56A 3MFGA 4QY7A 3HOYH 5IYBH 1SYBA 3BYYB 1FGBD 3KF6B 3RLFA 3I4NH 5C3XA 4DR7Q 1BBWA 4ZCKA 4BBSB 1GUSA 2QW7A 4LF4L 4IN3A 3DWQA 3GQBA 3UDXA 3FHWA 3A56A 3DWPA 2C35B 1TWAH 4WJ3M 1ESFA 3CU7A 3EFXD 3QR8A 1CZWA 1KC8C 4BY1H 5BN5A 2R61A 4K5WA 3I4OA 1SBBB 2N78A 1EZ6A 2QDBA 2RCNA 5EGTA 4DR2Q 3K0YA 3KBGA 4PZ8A 2L0CA 1X55A 3S1QB 4A3KH 1LTRD 2RDGA 4ZYSA 5KYIA 1QB5D 3A5ZB 4OGQC 5M5YH 1G51A 1Z47A 4NPSA 5JEAH 4IUVA 1QZHA 1A6XA 3Q23A 4B3SQ 1VQ5A 1I4GA 1TY2A 1XNRL 2E2DC 2PPBC 2A73B 3W1GA 3SE0A 1ICFB 3NTIA 4QB4A 5FO9B 2Q8RE 3U9OA 3T4AC 4A3MH 1HTLD 4TVAB 1IBKL 1DM0B 1LTID 2RCFA 4POFA 4CHTB 3CQZB 3PMFA 1NCVA 4P74A 4PNYA 4X3TA 3L9AX 4JI4Q 4P72A 2EIFA 3Q24A 2I46A 4TSSA 1L2FA 2CW0D 3FKIB 3QB3A 3QOLA 1QNUA 3J80c 1EIFA 4HAEA 2CWPA 2K14A 3CCEA 3EQLC 4A3DB 3KLSA 4JBJA 5HURA 1VQJA 3A8IE 2JA7B 2L12A 2NVTB 3H0GH 1N34Q 2F0IA 3NE5B 1WTPA 5KRUA 4PZ7A 1WYDA 1E3PA 1ENFA 5IYBG 5IGDA 3PO2B 3I4NG 1S40A 4PMBA 4A3GB 2MO0A 5E1FA 4YHHL 3U4ZA 1XPUA 2QKIC 1Q8KA 1YITA 2F0NA 1MSGA 1KLUD 1TWHH 2UUAL 2B39A 1IBLL 1XWEA 1SNOA 2RHSB 4BY1G 1OXSC 1JOKA 4GN3B 3J81L 2PNHA 2RQXA 1K8MA 3FRPB 3HKZG 2F4VL 3QO2A 1KRTA 4A3KG 2XWBB 2AMCB 1FNWA 4KN7C 1YEZA 1JQYD 2HDLA 4AYBE 4J8QA 2LS01 5JEAG 2E5LL 1HNWQ 2CVRA 4MN3A 3CCUA 4FO2A 3S1MB 5D3IB 5JJLA 4OIJA 3K8AA 3GTMH 4JCVE 3CF5A 3PO3H 5GADC 1SEBD 3C1FA 4Z9CB 1SFOB 4O42A 1UEBA 1L1OC 4LF8L 1RCVD 3ND9A 1NR2A 2GN5A 4KHPQ 4IUPA 4A3MG 4DPGA 2A69D 5M3MB 2L4NA 5D14A 1TS4A 2B3GA 4A3IH 1MKHA 2KA7A 4MZ9A 2NVQH 2E2IH 1D8LA 2ZXOA 2K04A 2G9DA 2JSOA 2R7ZH 5JOBA 3S2DH 1SN8A 2K28A 2PW5A 1GUNA 3HOZB 3U4VA 3K6OA 3UDIA 5EBDA 2ES2A 4FF2A 1IW7D 4DV2Q 4PMCA 2L55A 1EUJA 2D5DA 3H0GG 3J7AV 1JOQA 4DR5L 1B44D 3GTKH 1JC7A 3NUCA 5IP9H 4GNXC 1UEAB 3GTOB 2YTVA 1BXTA 1SYDA 1B3QA 1SYEA 2WAQE 3NWTA 1TXYA 4DR2L 3HS0C 4KI0A 3VYSA 1HXYD 1Q8IA 4HJ9A 4A3LH 4NW2A 2PI2E 2F0DA 5A2QE 1HTPA 1SE3A 3L0OA 1XMQQ 3G48A 4EQNA 4HR7B 2L9HA 5C0XI 4IUUA 4X64L 5CV9A 1HFNA 1LTAD 4WJ4A 1X3GA 4GZYC 3J7AF 2R92H 2K7VA 1VQ7A 4HJ7A 1GHKA 3K57A 2IX0A 4L63B 3CC4A 2R6GA 3E9HA 1QOHA 1JB3A 5DEHA 1U4LA 4R1JA 2E2JB 1F2ZA 3S16B 3QOJA 2OQKA 3T16A 3UDFA 4A3EH 1STHA 5C0XJ 4BY7H 4P73A 4RG1A 2WP8J 1JJCB 3E5SA 2RSOA 3JAMi 4PQXA 4G7HC 4JI4L 3PO3G 2A6EC 2WB1G 4J1MA 2ID0A 4DV0L 4JI7L 1UUPA 4WORA 1Z9FA 5C0XH 3K59A 3A0JA 1SYCA 1S4ZA 1XPRA 4POGA 1EWIA 1N34L 3S2HH 2EE1A 1FNVA 2ZJQA 1GM5A 4EGVA 4A3IG 1HHVA 1SYGA 2EYFA 4GNXB 4TKOB 4DXFA 3OPOA 2R7ZG 3S24A 4B9WA 1PH5A 1Y1VH 1W2BA 1SJHD 1Y14B 1K8GA 1Y69U 4EVOA 1PTOH 3J7A5 3UE1A 1VS0A 3LGJA 4ZUJA 5K5PA 3I3CA 3SVMA 4OL7A 1XPOA 1XMOQ 3HKZE 4DUYQ 2EYLA 1T9HA 3BU2A 3E3XA 4RA8A 5IP9G 3PSIA 4OELB 2WINB 4FVMA 3ZJYC 5EPLA 1G6PA 5C5LA 4IPCA 3PGZA 4DV6Q 1Y1WH 1A63A 2BDOA 4OONA 2ASBA 3GTQH 4A3LG 4JBKA 1V8QA 2B2WC 3TS0A 3OW2A 2OEOA 3NSWA 2LY7A 3I70A 4DV4L 1GUWA 1F9RA 2MJ8A 3KDFB 4C3HB 1WVLA 1U9RA 1K3RA 2R92G 4NP5A 4WJWA 2X69A 1SNMA 4KK7A 1RTNA 2HUGA 1A3VA 1Y8NB 3HKSA 1PRTF 4IPGA 4FXGC 4KHPL 1GUGA 1O7ZA 1ENCA 1FVIA 1AH9A 1EOTA 4BY7G 4FF1A 3O13A 4LF6Q 5IWAL 1TR5A 3PF5A 3G7LA 3RLOA 2RF4A 3SGIA 1PH7A 4YWLA 2RBMA 2XGTA 1AW7A 5LL6S 1MJEA 4FXDA 2GVAA 1B8AA 4CKBA 4B3TL 4JK1C 3GV6A 1F2YA 2Z8LA 2X6GA 4OWTB 2VQFQ 3T51B 2Z0SA 1SROA 2OWOA 4FF3A 2LFNA 2NYZD 1N32L 2B2UA 3HRZC 3IRBA 5ELOA 1Y1VG 4B3RL 2SNMA 3HOUB 2EJFC 4FYDA 3S17H 3OMGA 4Y7NH 3H3VH 2J4XA 4E6IA 3CRKC 3HOWB 1BO0A 4V190 4IJHA 1KIXA 3V05A 1X9NA 1O78A 1WOCA 1LO5D 3VA7A 1HJPA 1H9RA 1H9KA 1NBWA 2SNSA 1N33Q 1W6JA 1XNQQ 4DK6C 3LWUA 1BR9A 4R4TA 1JT8A 4UHVA 4DU9A 4GNXA 4LF9L 4PMWA 2ALYB 5G3LF 1DONA 3S14B 1V1PB 2XRSD 2N8NA 4TRDA 4IJLA 4X3UA 5IP7H 4JI5L 2BDNA 3K7AB 4A3FB 2F0VA 2WB1E 5KNBA 3R3OA 1VQIA 4CJ2C 4DAYA 4RFBA 3M4QA 2NTSA 2NVYH 2UXDL 5IGEA 3SXHA 1AN8A 4X65Q 2EYOA 2VL6A 3KJPA 3RZDH 1CA5A 4RWSC 1MBYA 4QGUA 2JA8B 2B2YA 1RDPD 4JVZA 1S3OA 1WTWA 1I50B 1A8VA 3J81E 2HQLA 1VQ9A 5CMDA 2YTYA 1SR3A 4IOAA 3GP7A 2K03A 4XQQA 1JJ2A 2UXCQ 4P75A 2E2HB 4L5SA 5A35A 2K5WA 2V4DA 1N8RC 3ND8A 4XT3B 5EPKA 2JN4A 3OIQA 3R93A 3RMHA 1IKMA 4DXGA 1KL9A 2L1BA 1F77A 3K5OA 3I7FA 2PMZE 1X3EA 2FINB 5CBAE 1EL0A 1EQVA 1QVFA 2ZJRA 2PQAB 2H1EA 1X65A 2RHQB 5C3EB 1K8OA 1YHBA 2YTXA 1BKBA 2CW0C 1HNXQ 1EY7A 3D6CA 2HQEA 2CCZA 1PTOD 3IFTA 2Z6KC 3PUXA 1JORA 4ZLTF 3NELA 2UUCL 1ML0D 3M9BA 1ASZA 3AMUA 4LWCA 3HOXB 3SR1A 1BCPF 3ICEA 5FO8B 3PQIA 2NUCA 4DV7Q 1Q46A 4R8NA 4A76A 1A0IA 2AQ2B 4KKSA 2JA6B 1CK1A 2IJ0A 3NENA 2Z1CA 3H09A 1X32A 4MTNA 4X3SA 4LFAQ 1ENAA 3AQQA 3WDNA 3S1NH 1QUQB 4HSVA 5I9OA 4C3IG 4LFCQ 3GDEA 3T1YL 2F1MA 2K6AA 1VQEA 3I4MB 2DJGC 3HG9A 3GTPB 4HMIA 2DN8A 2D0OA 5E3FA 2DNCA 1TVXA 4JI3Q 4AQYL 1KABA 4P2CB 1SSOA 3A7AB 1YHQA 1W6KA 3MEFA 1TIID 2WACA 5IOCA 4OO1I 2F3VA 1PH9A 3KFUA 2VQFL 2AUJD 2F0UA 1JWSD 2MPMA 4AYBB 3A55A 1B53A 5C4JB 1STEA 1SLJA 3M7NA 2A69C 2Q2TA 2F0JA 2Y0SG 5H1SE 2E74C 2LMCB 5CGKA 3NXWA 1TKWB 4KKUA 1BQQT 3NP8A 4QQBX 1N33L 1R4QB 2EDGA 4BBRH 1XNQL 4DAPA 4RMFA 1HR0L 5DM63 5EKLA 1UE7A 4BA1I 1FNUA 5M5XB 4ZKBB 1RKNA 3DHQA 5C44B 2JA5G 2ZTCA 3G6EA 1IW7C 2VNUD 2HD3A 3FVQA 3PCOB 4EQPA 1XYIA 5I2XA 1PV4A 3X3MA 1GJXA 2ZT9C 1II3A 5K36H 1Q81C 2B63G 2PQAA 3CC2A 5FJ8H 2PZTA 4K0KL 3JAML 2D2CC 4KHZA 3KLWA 1K83B 1I3QH 2VUMG 1FJGL 3I4LA 2EJMA 4B3ML 2IT1A 3I55A 4DN4M 1ILPA 2FJ2A 3PUYA 3W3AA 2JYOA 2L5TA 1PH4A 3PUVA 3DM1A 3NEMA 3GTGB 1LTTD 1SNPA 2DY7A 3MHBA 3CRLC 1FD7D 1S5BD 5IGBA 4R9WA 2WAQB 4HJ8A 4X62Q 3W2DA 4CDFC 3CQZH 1I6HH 1N9WA 4QF4A 4HEDA 2J0TD 4JBWA 1FR3A 4ILWA 3A7LA 4IURA 4QUCA 2ZM6Q 4F7XA 4DNRB 3HOVG 4A3DH 5M5WB 3ERQA 1CSPA 4DR4Q 2A19A 4N9TA 1J5EL 2F52A 1HZBA 1QUQA 3TP5A 4Q0FA 2HIVA 2SOBA 2BCOA 4RGOS 3QIAA 4MHEA 1QE6A 3TS2A 3CCMA 3J80E 2LSSA 1JOOA 1TWGH 1YJ9A 1KLGD 4YCUA 1A2UA 4A3GH 5IYCH 1EYGA 1R4PB 4UAIA 2IHFA 1R9TB 1LACA 1Y8PB 4NXNQ 4A3CG 3I90A 3S9WA 1NAPA 3SDZA 1OXUA 5IODA 1YZ6A 4CGYB 4JOIC 5EAYA 3PV0A 2A6HD 1A2TA 4JV5L 4HSPA 3TSSA 3I4NB 4C3JB 3OIPA 4BBRG 1QCBD 1H9JA 1O7IA 2NVXH 5KNDA 2JJQA 1CM9A 1F2LA 4JI8Q 1J8IA 1D5ZC 2VXWA 2NBFA 1L0WA 1FL0A 3OMCA 2A1AA 3KJOA 1G91A 3K5MA 4JI2Q 4GKKQ 3KF8B 1RTOA 4LFAL 1VQ6A 2MO1A 4BY1B 5K36G 4X66Q 1DOMA 1B1ZA 1G291 5FJ8G 5EKIA 3BDCA 1QVCA 2K5DA 1YI2A 3HOYG 4DKAC 2Q8TA 4LFCL 1A3UA 4L5QA 5TSSA 4LJZC 3S1MH 2PZUA 4JYAQ 3HKZB 5IT9c 4A3KB 3EROA 3I56A 1ET9A 1RL2A 4F8MA 1ZEQX 3A74A 3H6MA 3LX0A 5FK9C 1E2VA 2ICEC 1BVSA 2FMCA 3FMCA 3UI2A 2NZHA 3ITPA 5BR8L 5J39A 1QILA 4C2MH 5M3MH 4JW0A 5ELNA 3A5UA 5KYLA 1O80A 4HN7A 1X3PA 1HA5A 3KF6A 1RJTA 1I94L 2QCPX 3NHHA 3OHXC 4IUTA 4FP5D 2F03A 1VDZA 1HPCA 1JWMD 1WTXA 4IUNA 3HOZH 4OWWB 3VYRA 4A3DG 3DUZA 3W1BA 2OCEA 3E0JA 2M9VA 4LUOA 1C9OA 4DV1Q 4IOCA 2PI2A 4L8JA 1K8AC 2F0PA 4RHRA 1GUTA 1PZJD 1STNA 4A3GG 5IYCG 2AWOA 1EEID 4YWKA 1RHPA 2AQ1B 5CORA 2F0LA 2VW9A 3H0GB 1PYSB 1K28A 1LYLA 2K05A 1Q90A 4FDBA 3RLNA 3OWFA 5C6AA 1VQ4A 1VQ8A 2IY5B 3UE0A 1SDFA 2F0TA 1LT5D 4ODGA 5E4XA 3MZ5A 3BZDB 2XIWA 1VMPA 1Q7YC 4DR7L 3TQYA 3C2PA 3FEWX 1NMGA 2PO4A 5T1IA 1WJJA 2RDHA 1JJGA 3RZOH 3J7ZC 1KQSA 2B2VC 3EN2A 4G4KA 4KLKA 3OWEB 4RH6A 4G7OC 1EFID 4JBMA 4KY6A 3B6YA 4HCSA 3PIOA 2JEBI 2O2LD 2WV6D 4KD3A 4X62L 4OWXB 1B2TA 2KCTA 3AU7A 1DZ1A 3R8BA 5C4ZA 4DR6Q 4DGZA 2ZM6L 4LMQD 2DUDA 4WRDA 3KF8A 1RD9D 4LNQA 3RN5A 2D62A 3SK6A 3I91A 4O1NA 4XT1B 1E0BA 1DYQA 5IIFA 4DR3Q 3ONAB 4V0BA 1X6OA 1B3AA 3OTOQ 3GO5A 4F87A 5LMUQ 4NDXA 4B08A 1PH8A 2YU9B 4K2LA 2M00A 3GTMB 5C4XB 2WB1B 3D6WA 3OYYA 4B3SL 1PLFA 5FO7B 1EQRA 1TS5A 2QGQA 3HOZG 1TQOA 1KD1C 4M8AA 5LL6X 1L1OB 1EIHA 3NTKA 3DEPA 3QG1A 2I07B 5AFWA 4GLXA 1MHWC 4GLAC 3LWEA 1EEFD 4A3IB 1KDCA 1K73C 1H9MA 1YNND 3U58A 3S2DB 2R7ZB 5KNCA 1U4PA 3M7GA 5LMNQ 1PH1A 2B8FA 3A8KE 1D2BA 5FKAC 1RIPA 1WTVA 1B7YB 1CKMA 3SK4A 1E2WA 5NUCA 4JG2A 4JOIA 3GTKB 3T53B 5CV5A 5FLXc 4JI2L 4GKKL 2JEAI 3NBHB 2UXBQ 1SE8A 4X66L 2LKVA 4JI1Q 4DR1Q 3S1RB 3VR2A 1G8ZD 1PTOC 1NMFA 4ZKCB 4IO9A 2PMZB 3AB9A 4DK1A 3E9IA 5FLMH 2OF1A 4HMJA 1TS2A 5AJ3Q 2IX1A 1PFMA 2AUKA 1MIUA 2XN9C 1F9PA 2F0HA 2CH4A 1LV9A 3K0XA 4DAVA 4OX9Q 4A4IA 1IYVA 3A54A 4H02A 1QVGA 1V1OA 2C9OA 3KLSX 1CKNB 3AFQA 3PIPA 2R92B 5ELFA 2KHIA 3BVGA 1D1KA 5CV6A 1SMYD 4MNOA 1Q82C 3BG3A 1B9MA 1HUMA 2EY6A 2CWAA 5I9PA 2BE5D 2G5DA 5ELBA 3CMEA
chains in the Genus database with same CATH topology
4P75A 1X56A 2GVBA 4QY7A 5LMNW 5IYBH 4DV4Q 4L5SA 3HOYH 3KF6B 3RLFA 3I4NH 3D31A 1N8RC 4DR7Q 1BBWA 3CAMA 3F2BA 1HNZQ 4QL5A 5GAHC 4LF4L 1UE5A 2YU9H 1KL9A 3CCSA 1HZCA 3I7FA 4R4QA 5C4XH 2PMZE 3UDXA 3FHWA 1X3EA 4A3LG 4DV1L 1VQMA 1PHJA 1YNXA 2E8GA 1QVFA 2C35B 2AHOB 1TWAH 2PQAB 2ZJRA 1UWVA 4UP9A 1X65A 2RHQB 2I5HA 1HNWL 4WJ3M 1YHBA 2YTXA 4LF7Q 1BKBA 1VQCA 2NN6G 3TEHB 1KC8C 4BY1H 1HNXQ 4HIMA 1PH6A 4HJ5A 2K4KA 2CCZA 3I4OA 4HIDA 2N78A 2RCNA 2JE6I 2Z6KC 3PUXA 5HGQA 4DR2Q 2KCMA 4GOPC 2E2JH 3NELA 3S16H 5IWAQ 1E1OA 3CPWA 4PZ8A 4YY3Q 1E24A 2UUCL 3JAMc 3M9BA 4DV5L 1ASZA 1X55A 4A3EG 4LWCA 1E7ZA 3AEVA 4A3KH 1VCIA 3ICEA 4YCWA 3A5ZB 2I5MX 4DV7Q 1Q46A 2ZTEA 3S14H 5IE8A 2MNAA 5M5YH 3BZKA 1G51A 4P71A 3F2DA 1Z47A 4NPSA 1YJWA 4A76A 4B3TQ 1A0IA 4LF5L 1QZHA 4DR4L 3K7AH 4A3FH 1L1OA 2UU9Q 3EIVA 3T1HL 5M3MG 2OTLA 1VQ5A 4B3SQ 2K5NA 3NENA 5C0XG 1N32Q 1XNRL 4LUVA 4DV2L 4MTNA 4LFAQ 3Q8DA 3W1GA 1MJCA 3AQQA 4B3RQ 3S1RH 2R7DA 3S1NH 2LXJA 4A3MH 1IBKL 4TVAB 1QUQB 3JC66 2JQOA 4LFCQ 4POFA 3GDEA 3TRZA 3T1YL 1VQEA 4P74A 4NXNL 5M3FH 3ER0A 5FLMG 5GROA 4DR6L 1IZ6A 1V1QA 2VY3A 4XTCS 1NTGA 2D0OA 2EIFA 4P72A 4JI4Q 4LF9Q 4JI0Q 1L2FA 4JI3Q 4DNIA 4AQYL 2JA8H 1D7QA 3EBEA 3J80c 1EIFA 5DLQE 2CWPA 2K14A 3MXNB 1VQPA 1XMQL 3CCEA 3CPFA 1YHQA 2EQSA 4JI5Q 4JBJA 3L7ZC 3MEFA 1VQJA 1HZAA 4OO1I 3G71A 4JI8L 2Q2HA 3H0GH 5LMUL 1PH9A 2MQHA 1N34Q 1IXRA 4JI6L 3KFUA 4A3BH 2VQFL 4PZ7A 1WYDA 3L2PA 1UE6A 1Y1WG 1E3PA 2N3SA 4QIWE 5IYBG 3VDYA 2UXDQ 3I4NG 1S40A 1IYJB 1KAWA 1KRSA 1N36L 2BA1A 2MO0A 4DV3Q 1SLJA 4YHHL 4GOPB 4IFDI 4HIOA 1V43A 4C3HH 3M7NA 1CKNA 2Q2TA 3BZCA 2Y0SG 5H1SE 3U4ZA 1XPUA 4GKJQ 5C4XG 2VQEL 1Q8KA 1YITA 1OXVA 3F2CA 1TWHH 5E7NA 1LTLA 1IBLL 2UUAL 1N33L 4QQBX 4JYAL 4BBRH 1XNQL 3DM3A 4LW1A 2RHSB 4RMFA 1HR0L 4GN4B 4BY1G 1UE7A 2H5XA 4BA1I 5JJIA 1OXSC 3S15H 2CFMA 4GN3B 2PNHA 4EQ5A 4APVA 4XIGS 1PYBA 2JA5G 2ZTCA 2R7FA 3G6EA 1CUKA 2VNUD 3PCOB 2QEXA 3HOXH 2FXQA 3KDFA 3U50C 1PV4A 4IFDJ 3HKZG 2F4VL 1YJNA 1KRTA 1Q81C 4A3KG 2B63G 1X3FA 3PF4A 2PQAA 3CC2A 5FJ8H 4K0KL 2AMCB 1A62A 1KHIA 1YEZA 2V1CC 3KLWA 4KHZA 1OXTA 4AYBE 1I3QH 2VUMG 1FJGL 5JEAG 4PG3A 1K0RA 2D0PA 2IT1A 3I55A 2E5LL 4B3ML 2JA6H 1H95A 1HNWQ 3W5OA 3PUYA 4DAYB 3CCUA 5JJLA 4NXMQ 3K8AA 3GTMH 1PH4A 4J15A 4JCVE 3CF5A 3PUVA 4A75A 3PO3H 3NEMA 5GADC 4OX9L 1UEBA 1L1OC 4LF8L 1XMOL 4DUYL 1E22A 3I2ZA 4HJ8A 1GVPA 2GN5A 4X62Q 4KHPQ 4A3MG 2UUCQ 1HR0W 3CQZH 4DPGA 1I6HH 3I4MH 1N9WA 3HOUH 5JJKA 4JBWA 3RNUA 4A93H 3M85A 3HOWH 1PH2A 4X6AH 5M3FG 2ZM6Q 4ME3A 2B3GA 2YYZA 1MKHA 4MZ9A 4DUZQ 4DV6L 4A3IH 2NVQH 2F3IA 3HOVG 3G4SA 2E2IH 3WWVA 1D8LA 2R7ZH 3S2DH 1SN8A 4A3DH 1CSPA 3PUWA 4DR4Q 2A19A 5J3BA 3U4VA 1J5EL 4R4OA 2F52A 1FGUA 1VQFA 1YBYA 3K80C 1HZBA 4IPDA 3ULJA 1WFQA 3UDIA 1Q86C 2ES2A 4DV2Q 1QUQA 1EUJA 1HH2P 2HIVA 3H0GG 3TS2A 4DR5L 3CCMA 3GTKH 1EOVA 5IP7G 3H3VI 4A3BG 2LSSA 1WCMH 5IP9H 4GNXC 1TWGH 1YJ9A 1S72A 2YTVA 4YCUA 4YCVA 2AWNA 4A3GH 3KYHC 5IYCH 1EYGA 4LFBQ 1NE3A 3T1YQ 4GN5A 2IHFA 2HHHQ 4NXNQ 2Q2UA 4A3CG 2WAQE 4DR2L 1TXYA 2HT1A 1OXUA 4KI0A 1YZ6A 3ULPA 4JOIC 5EAYA 4DAMA 2OTJA 3PV0A 1OTCA 4HJ9A 4AQYQ 4A3LH 2PI2E 3KOJA 4JV5L 3L0OA 3GTLH 5GAGC 1XMQQ 3G48A 1XJVA 4BBRG 4LF6L 1PFSA 1O7IA 2NVXH 5C0XI 4X64L 2KHJA 2JJQA 2KBNA 4TQUS 5M5XH 4JI8Q 5IYDH 5C44H 4WJ4A 1X3GA 1I50H 2ZTDA 1Q1EA 1L0WA 2R92H 1NY4A 1VQ7A 1FL0A 4DR3L 4HJ7A 2UUBQ 2B29A 2A1AA 1C7YA 3KJOA 1SRUA 2IX0A 4YWMA 4JI2Q 3OTOL 3KF8B 3HOXG 3CC4A 1IBMQ 4GKKQ 1HZ9A 1VQBA 1JE5A 5GQOA 4LFAL 1VQ6A 2MO1A 3CCRA 3J81i 2R6GA 5K36G 4YHHQ 3E9HA 4X66Q 2IHEA 1G291 1EFWA 2E2HH 5FJ8G 1K83H 2K75A 3HFZB 1VQGA 1QVCA 1OXXK 4R1JA 1YI2A 3HOYG 4BBSH 4DKAC 3J81j 4LFCL 1VQLA 1E1TA 2Q2IA 2OQKA 2VS1A 4L5QA 3UDFA 4A3EH 3CCLA 5C0XJ 2JA6G 2K50A 1X54A 4P73A 3TREA 1IBLQ 4RG1A 3S1MH 2WP8J 4JYAQ 1JJCB 1P8LA 5IT9c 4AH6A 2BA0A 3JAMi 3I56A 1HR0Q 4JI4L 3M4OH 2BH8A 1RL2A 3PO3G 2WB1G 4DV0L 2ID0A 4JI0L 3A74A 4JI7L 5C3EH 1BVSA 1YHAA 2NZHA 5BR8L 3RR5A 5GAEC 4C2MH 5M3MH 1Z9FA 5ELNA 3A5UA 4ALPA 5LMNL 1QZGA 1AE2A 3HOUG 3KF6A 3A0JA 4A93G 3HOWG 2F4VQ 1XPRA 1I94L 1EWIA 1N34L 4POGA 3S2HH 1GD7A 2ZJQA 1JMCA 1GM5A 2K5HA 4O2DA 4K0KQ 4A3IG 4GNXB 3BJUA 5M5WH 1NJIC 3M3YH 3S1QH 3CP0A 4C3IH 1EQQA 3K81C 2R7ZG 3HOZH 4OWWB 1FJGQ 3S24A 1PH5A 4B3MQ 4A3DG 1Y1VH 2UXBL 3W1BA 1Y14B 1W2BA 1K8GA 4LF4Q 2OCEA 4JI1L 3J7A5 4DR1L 3UE1A 1VS0A 3LGJA 4LUOA 4BA2I 1C9OA 4GKJL 4DV1Q 2XTIA 4IOCA 2QA4A 1XPOA 2N49A 2PI2A 3HKZE 4DUYQ 4A3FG 1XMOQ 4HJAA 2BH2A 4R4CA 1T9HA 3BU2A 5AJ3L 3GD7A 1K8AC 1WCMG 5IP9G 4X65L 2YV5A 3PSIA 4UP8A 4A3GG 5IYCG 3ZJYC 2AWOA 1PH3A 4YWKA 1G6PA 4IPCA 3PGZA 2VW9A 4GS3A 1PYSB 4DV6Q 1LYLA 2VZAA 3GTJH 1Y1WH 1A63A 3CD6A 1U5KA 4FDBA 4OONA 3RLNA 4DV5Q 2ASBA 4JBKA 1Q1BA 3FP9A 3CCJA 4C3JH 3F8TA 3TS0A 3GTQH 3GTPH 3OW2A 1VQ4A 1VQ8A 2IY5B 3UE0A 1J5EQ 3AYHB 4R4IA 3FKIH 2ATWA 1GO3E 2MFIA 5IY0A 1JB7A 4DV4L 2UXCL 1VQOA 2R93H 4A3JH 3KDFB 2JA8G 5IYDG 1VQHA 1Q7YC 4LF5Q 5C44G 4DR7L 3TQYA 1NMGA 1K3RA 4DR5Q 2K5VA 1HNZL 3T1HQ 2R92G 2JA7H 1Q12A 1WJJA 3J81c 2NVTH 2NN6I 1JJGA 3RZOH 2EXDA 3J7ZC 1XNRQ 4NXML 1KQSA 2JK8A 3EN2A 3AFPA 4EX5A 4KLKA 3D0FA 3ERSX 4JBMA 2K52A 3HKSA 2JA5H 1EIYB 5HY6A 3B6YA 4GLVB 4IPHA 2JEBI 4IPGA 5JEAJ 3PIOA 1IBKQ 4X62L 4LF7L 4BXXH 4KHPL 3STBC 4OWXB 5C4JH 1HNXL 4BBSG 4JV5Q 1AH9A 1FVIA 2KCTA 3RN2A 2CQOA 4OXPA 3CCQA 1M90C 1K9MC 4BY7G 4DR6Q 2B63H 4NB3A 1ASYA 4LF6Q 2ZM6L 1C0AA 4LUZA 5IWAL 4X64Q 4DUZL 1CSQA 4YY3L 3CCVA 3PF5A 2DUDA 1KXLA 3RLOA 2RF4A 3SGIA 1PH7A 2ZJPA 2I0QA 2VUMH 4LNQA 5C3EG 2D62A 2WAQG 4YWLA 3RN5A 2DGYA 2XGTA 2CKZB 1MJEA 1VQDA 4DR3Q 2GVAA 4L5RC 1B8AA 2HIXA 1X6OA 4DV7L 3M4PA 3OTOQ 3GO5A 1BBUA 3CW2C 5LMUQ 1PH8A 4B3TL 1VQNA 2L15A 3CXCA 4JI6Q 1PVOA 3ULLA 2Z6KA 1M1KC 4HIKA 4OWTB 2VQFQ 1YIJA 2UU9L 4GOPA 2Z0SA 3OYYA 1SROA 3H15A 2OWOA 4B3SL 4Y52H 1EQRA 1AE3A 1P16A 2QGQA 1YVCA 1J6QA 4OO1G 1N32L 3HOZG 4LFBL 3IRBA 5ELOA 1N36Q 2KENA 1Y1VG 1KD1C 2HHHL 4B3RL 1L1OB 1TWFH 4Y7NH 3S17H 3H3VH 1DGSA 4GLXA 4IJHA 1KIXA 4GLAC 1X9NA 1WOCA 3HOVH 2VQEQ 4DV0Q 1HJPA 4JI7Q 1NBWA 1XTDA 1K73C 2UUAQ 1N33Q 5BR8Q 3U58A 2I5LX 4IFDG 1XNQQ 4DK6C 2JA9A 4JC0A 1UE1A 4R4TA 3GTGH 1JT8A 4GNXA 4LF9L 4PMWA 5LMNQ 1LM0A 1SFOH 1PH1A 1U0LA 2ALYB 4JI3L 3STBD 1PA6A 1I94Q 2N8NA 1RIPA 3DLLA 4IJLA 3E0EA 1SMXA 5IP7H 1B7YB 1CKMA 4JI5L 1WI5A 1CKOA 4JG2A 4JOIA 2UUBL 3PUZA 1IL2A 2Y0SE 1B70B 3I4MG 3UDGA 5FLXc 4JI2L 4GKKL 2WFWA 3NBHB 2JEAI 2WB1E 1IBML 2UXBQ 1SE8A 4A3CH 3PO2H 3F1ZA 1VQIA 2LXKA 4X66L 4JI1Q 4DR1Q 2OQ0A 3FKIG 4PZ6A 4QJFA 3M4QA 2R93G 1NMFA 4A3JG 2NVYH 2UXDL 4UY8C 4IO9A 2E5LQ 1GKHA 4DK3C 3E9IA 5FLMH 4DV3L 2JA7G 5AJ3Q 2IX1A 4O0AA 4AIMA 4X65Q 1W3SA 1VQKA 1MIUA 4BY7H 2VL6A 3KJPA 3K0XA 2A8VA 3RZDH 4OX9Q 3CMAA 4QGUA 4A4IA 4LF8Q 3GTOH 1I5FA 1VQAA 4H02A 1QVGA 1CKNB 1S3OA 4UP7A 3PO2G 3AFQA 2NZOA 3PIPA 1A8VA 1R9TH 4BXXG 2AKWB 4AYBG 2KHIA 4UPAA 3J80i 1LUZA 3CC7A 2HQLA 1VQ9A 4IOAA 2YTYA 1SR3A 4L5TA 4MNOA 1Q82C 2CWAA 1V9PA 1TWCH 3K7UC 1JJ2A 3CMEA 2UXCQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  1X56 A;  2GVB A;  4QY7 A;  5LMN W;  5IYB H;  4DV4 Q;  4L5S A;  3HOY H;  3KF6 B;  3RLF A;  3I4N H;  3D31 A;  1N8R C;  4DR7 Q;  1BBW A;  3CAM A;  3F2B A;  1HNZ Q;  4QL5 A;  5GAH C;  4LF4 L;  1UE5 A;  2YU9 H;  1KL9 A;  3CCS A;  1HZC A;  3I7F A;  4R4Q A;  5C4X H;  2PMZ E;  3UDX A;  3FHW A;  1X3E A;  4A3L G;  4DV1 L;  1VQM A;  1PHJ A;  1YNX A;  2E8G A;  1QVF A;  2C35 B;  2AHO B;  1TWA H;  2PQA B;  2ZJR A;  1UWV A;  4UP9 A;  1X65 A;  2RHQ B;  2I5H A;  1HNW L;  4WJ3 M;  1YHB A;  2YTX A;  4LF7 Q;  1BKB A;  1VQC A;  2NN6 G;  3TEH B;  1KC8 C;  4BY1 H;  1HNX Q;  4HIM A;  1PH6 A;  4HJ5 A;  2K4K A;  2CCZ A;  3I4O A;  4HID A;  2N78 A;  2RCN A;  2JE6 I;  2Z6K C;  3PUX A;  5HGQ A;  4DR2 Q;  2KCM A;  4GOP C;  2E2J H;  3NEL A;  3S16 H;  5IWA Q;  1E1O A;  3CPW A;  4PZ8 A;  4YY3 Q;  1E24 A;  2UUC L;  3JAM c;  3M9B A;  4DV5 L;  1ASZ A;  1X55 A;  4A3E G;  4LWC A;  1E7Z A;  3AEV A;  4A3K H;  1VCI A;  3ICE A;  4YCW A;  3A5Z B;  2I5M X;  4DV7 Q;  1Q46 A;  2ZTE A;  3S14 H;  5IE8 A;  2MNA A;  5M5Y H;  3BZK A;  1G51 A;  4P71 A;  3F2D A;  1Z47 A;  4NPS A;  1YJW A;  4A76 A;  4B3T Q;  1A0I A;  4LF5 L;  1QZH A;  4DR4 L;  3K7A H;  4A3F H;  1L1O A;  2UU9 Q;  3EIV A;  3T1H L;  5M3M G;  2OTL A;  1VQ5 A;  4B3S Q;  2K5N A;  3NEN A;  5C0X G;  1N32 Q;  1XNR L;  4LUV A;  4DV2 L;  4MTN A;  4LFA Q;  3Q8D A;  3W1G A;  1MJC A;  3AQQ A;  4B3R Q;  3S1R H;  2R7D A;  3S1N H;  2LXJ A;  4A3M H;  1IBK L;  4TVA B;  1QUQ B;  3JC6 6;  2JQO A;  4LFC Q;  4POF A;  3GDE A;  3TRZ A;  3T1Y L;  1VQE A;  4P74 A;  4NXN L;  5M3F H;  3ER0 A;  5FLM G;  5GRO A;  4DR6 L;  1IZ6 A;  1V1Q A;  2VY3 A;  4XTC S;  1NTG A;  2D0O A;  2EIF A;  4P72 A;  4JI4 Q;  4LF9 Q;  4JI0 Q;  1L2F A;  4JI3 Q;  4DNI A;  4AQY L;  2JA8 H;  1D7Q A;  3EBE A;  3J80 c;  1EIF A;  5DLQ E;  2CWP A;  2K14 A;  3MXN B;  1VQP A;  1XMQ L;  3CCE A;  3CPF A;  1YHQ A;  2EQS A;  4JI5 Q;  4JBJ A;  3L7Z C;  3MEF A;  1VQJ A;  1HZA A;  4OO1 I;  3G71 A;  4JI8 L;  2Q2H A;  3H0G H;  5LMU L;  1PH9 A;  2MQH A;  1N34 Q;  1IXR A;  4JI6 L;  3KFU A;  4A3B H;  2VQF L;  4PZ7 A;  1WYD A;  3L2P A;  1UE6 A;  1Y1W G;  1E3P A;  2N3S A;  4QIW E;  5IYB G;  3VDY A;  2UXD Q;  3I4N G;  1S40 A;  1IYJ B;  1KAW A;  1KRS A;  1N36 L;  2BA1 A;  2MO0 A;  4DV3 Q;  1SLJ A;  4YHH L;  4GOP B;  4IFD I;  4HIO A;  1V43 A;  4C3H H;  3M7N A;  1CKN A;  2Q2T A;  3BZC A;  2Y0S G;  5H1S E;  3U4Z A;  1XPU A;  4GKJ Q;  5C4X G;  2VQE L;  1Q8K A;  1YIT A;  1OXV A;  3F2C A;  1TWH H;  5E7N A;  1LTL A;  1IBL L;  2UUA L;  1N33 L;  4QQB X;  4JYA L;  4BBR H;  1XNQ L;  3DM3 A;  4LW1 A;  2RHS B;  4RMF A;  1HR0 L;  4GN4 B;  4BY1 G;  1UE7 A;  2H5X A;  4BA1 I;  5JJI A;  1OXS C;  3S15 H;  2CFM A;  4GN3 B;  2PNH A;  4EQ5 A;  4APV A;  4XIG S;  1PYB A;  2JA5 G;  2ZTC A;  2R7F A;  3G6E A;  1CUK A;  2VNU D;  3PCO B;  2QEX A;  3HOX H;  2FXQ A;  3KDF A;  3U50 C;  1PV4 A;  4IFD J;  3HKZ G;  2F4V L;  1YJN A;  1KRT A;  1Q81 C;  4A3K G;  2B63 G;  1X3F A;  3PF4 A;  2PQA A;  3CC2 A;  5FJ8 H;  4K0K L;  2AMC B;  1A62 A;  1KHI A;  1YEZ A;  2V1C C;  3KLW A;  4KHZ A;  1OXT A;  4AYB E;  1I3Q H;  2VUM G;  1FJG L;  5JEA G;  4PG3 A;  1K0R A;  2D0P A;  2IT1 A;  3I55 A;  2E5L L;  4B3M L;  2JA6 H;  1H95 A;  1HNW Q;  3W5O A;  3PUY A;  4DAY B;  3CCU A;  5JJL A;  4NXM Q;  3K8A A;  3GTM H;  1PH4 A;  4J15 A;  4JCV E;  3CF5 A;  3PUV A;  4A75 A;  3PO3 H;  3NEM A;  5GAD C;  4OX9 L;  1UEB A;  1L1O C;  4LF8 L;  1XMO L;  4DUY L;  1E22 A;  3I2Z A;  4HJ8 A;  1GVP A;  2GN5 A;  4X62 Q;  4KHP Q;  4A3M G;  2UUC Q;  1HR0 W;  3CQZ H;  4DPG A;  1I6H H;  3I4M H;  1N9W A;  3HOU H;  5JJK A;  4JBW A;  3RNU A;  4A93 H;  3M85 A;  3HOW H;  1PH2 A;  4X6A H;  5M3F G;  2ZM6 Q;  4ME3 A;  2B3G A;  2YYZ A;  1MKH A;  4MZ9 A;  4DUZ Q;  4DV6 L;  4A3I H;  2NVQ H;  2F3I A;  3HOV G;  3G4S A;  2E2I H;  3WWV A;  1D8L A;  2R7Z H;  3S2D H;  1SN8 A;  4A3D H;  1CSP A;  3PUW A;  4DR4 Q;  2A19 A;  5J3B A;  3U4V A;  1J5E L;  4R4O A;  2F52 A;  1FGU A;  1VQF A;  1YBY A;  3K80 C;  1HZB A;  4IPD A;  3ULJ A;  1WFQ A;  3UDI A;  1Q86 C;  2ES2 A;  4DV2 Q;  1QUQ A;  1EUJ A;  1HH2 P;  2HIV A;  3H0G G;  3TS2 A;  4DR5 L;  3CCM A;  3GTK H;  1EOV A;  5IP7 G;  3H3V I;  4A3B G;  2LSS A;  1WCM H;  5IP9 H;  4GNX C;  1TWG H;  1YJ9 A;  1S72 A;  2YTV A;  4YCU A;  4YCV A;  2AWN A;  4A3G H;  3KYH C;  5IYC H;  1EYG A;  4LFB Q;  1NE3 A;  3T1Y Q;  4GN5 A;  2IHF A;  2HHH Q;  4NXN Q;  2Q2U A;  4A3C G;  2WAQ E;  4DR2 L;  1TXY A;  2HT1 A;  1OXU A;  4KI0 A;  1YZ6 A;  3ULP A;  4JOI C;  5EAY A;  4DAM A;  2OTJ A;  3PV0 A;  1OTC A;  4HJ9 A;  4AQY Q;  4A3L H;  2PI2 E;  3KOJ A;  4JV5 L;  3L0O A;  3GTL H;  5GAG C;  1XMQ Q;  3G48 A;  1XJV A;  4BBR G;  4LF6 L;  1PFS A;  1O7I A;  2NVX H;  5C0X I;  4X64 L;  2KHJ A;  2JJQ A;  2KBN A;  4TQU S;  5M5X H;  4JI8 Q;  5IYD H;  5C44 H;  4WJ4 A;  1X3G A;  1I50 H;  2ZTD A;  1Q1E A;  1L0W A;  2R92 H;  1NY4 A;  1VQ7 A;  1FL0 A;  4DR3 L;  4HJ7 A;  2UUB Q;  2B29 A;  2A1A A;  1C7Y A;  3KJO A;  1SRU A;  2IX0 A;  4YWM A;  4JI2 Q;  3OTO L;  3KF8 B;  3HOX G;  3CC4 A;  1IBM Q;  4GKK Q;  1HZ9 A;  1VQB A;  1JE5 A;  5GQO A;  4LFA L;  1VQ6 A;  2MO1 A;  3CCR A;  3J81 i;  2R6G A;  5K36 G;  4YHH Q;  3E9H A;  4X66 Q;  2IHE A;  1G29 1;  1EFW A;  2E2H H;  5FJ8 G;  1K83 H;  2K75 A;  3HFZ B;  1VQG A;  1QVC A;  1OXX K;  4R1J A;  1YI2 A;  3HOY G;  4BBS H;  4DKA C;  3J81 j;  4LFC L;  1VQL A;  1E1T A;  2Q2I A;  2OQK A;  2VS1 A;  4L5Q A;  3UDF A;  4A3E H;  3CCL A;  5C0X J;  2JA6 G;  2K50 A;  1X54 A;  4P73 A;  3TRE A;  1IBL Q;  4RG1 A;  3S1M H;  2WP8 J;  4JYA Q;  1JJC B;  1P8L A;  5IT9 c;  4AH6 A;  2BA0 A;  3JAM i;  3I56 A;  1HR0 Q;  4JI4 L;  3M4O H;  2BH8 A;  1RL2 A;  3PO3 G;  2WB1 G;  4DV0 L;  2ID0 A;  4JI0 L;  3A74 A;  4JI7 L;  5C3E H;  1BVS A;  1YHA A;  2NZH A;  5BR8 L;  3RR5 A;  5GAE C;  4C2M H;  5M3M H;  1Z9F A;  5ELN A;  3A5U A;  4ALP A;  5LMN L;  1QZG A;  1AE2 A;  3HOU G;  3KF6 A;  3A0J A;  4A93 G;  3HOW G;  2F4V Q;  1XPR A;  1I94 L;  1EWI A;  1N34 L;  4POG A;  3S2H H;  1GD7 A;  2ZJQ A;  1JMC A;  1GM5 A;  2K5H A;  4O2D A;  4K0K Q;  4A3I G;  4GNX B;  3BJU A;  5M5W H;  1NJI C;  3M3Y H;  3S1Q H;  3CP0 A;  4C3I H;  1EQQ A;  3K81 C;  2R7Z G;  3HOZ H;  4OWW B;  1FJG Q;  3S24 A;  1PH5 A;  4B3M Q;  4A3D G;  1Y1V H;  2UXB L;  3W1B A;  1Y14 B;  1W2B A;  1K8G A;  4LF4 Q;  2OCE A;  4JI1 L;  3J7A 5;  4DR1 L;  3UE1 A;  1VS0 A;  3LGJ A;  4LUO A;  4BA2 I;  1C9O A;  4GKJ L;  4DV1 Q;  2XTI A;  4IOC A;  2QA4 A;  1XPO A;  2N49 A;  2PI2 A;  3HKZ E;  4DUY Q;  4A3F G;  1XMO Q;  4HJA A;  2BH2 A;  4R4C A;  1T9H A;  3BU2 A;  5AJ3 L;  3GD7 A;  1K8A C;  1WCM G;  5IP9 G;  4X65 L;  2YV5 A;  3PSI A;  4UP8 A;  4A3G G;  5IYC G;  3ZJY C;  2AWO A;  1PH3 A;  4YWK A;  1G6P A;  4IPC A;  3PGZ A;  2VW9 A;  4GS3 A;  1PYS B;  4DV6 Q;  1LYL A;  2VZA A;  3GTJ H;  1Y1W H;  1A63 A;  3CD6 A;  1U5K A;  4FDB A;  4OON A;  3RLN A;  4DV5 Q;  2ASB A;  4JBK A;  1Q1B A;  3FP9 A;  3CCJ A;  4C3J H;  3F8T A;  3TS0 A;  3GTQ H;  3GTP H;  3OW2 A;  1VQ4 A;  1VQ8 A;  2IY5 B;  3UE0 A;  1J5E Q;  3AYH B;  4R4I A;  3FKI H;  2ATW A;  1GO3 E;  2MFI A;  5IY0 A;  1JB7 A;  4DV4 L;  2UXC L;  1VQO A;  2R93 H;  4A3J H;  3KDF B;  2JA8 G;  5IYD G;  1VQH A;  1Q7Y C;  4LF5 Q;  5C44 G;  4DR7 L;  3TQY A;  1NMG A;  1K3R A;  4DR5 Q;  2K5V A;  1HNZ L;  3T1H Q;  2R92 G;  2JA7 H;  1Q12 A;  1WJJ A;  3J81 c;  2NVT H;  2NN6 I;  1JJG A;  3RZO H;  2EXD A;  3J7Z C;  1XNR Q;  4NXM L;  1KQS A;  2JK8 A;  3EN2 A;  3AFP A;  4EX5 A;  4KLK A;  3D0F A;  3ERS X;  4JBM A;  2K52 A;  3HKS A;  2JA5 H;  1EIY B;  5HY6 A;  3B6Y A;  4GLV B;  4IPH A;  2JEB I;  4IPG A;  5JEA J;  3PIO A;  1IBK Q;  4X62 L;  4LF7 L;  4BXX H;  4KHP L;  3STB C;  4OWX B;  5C4J H;  1HNX L;  4BBS G;  4JV5 Q;  1AH9 A;  1FVI A;  2KCT A;  3RN2 A;  2CQO A;  4OXP A;  3CCQ A;  1M90 C;  1K9M C;  4BY7 G;  4DR6 Q;  2B63 H;  4NB3 A;  1ASY A;  4LF6 Q;  2ZM6 L;  1C0A A;  4LUZ A;  5IWA L;  4X64 Q;  4DUZ L;  1CSQ A;  4YY3 L;  3CCV A;  3PF5 A;  2DUD A;  1KXL A;  3RLO A;  2RF4 A;  3SGI A;  1PH7 A;  2ZJP A;  2I0Q A;  2VUM H;  4LNQ A;  5C3E G;  2D62 A;  2WAQ G;  4YWL A;  3RN5 A;  2DGY A;  2XGT A;  2CKZ B;  1MJE A;  1VQD A;  4DR3 Q;  2GVA A;  4L5R C;  1B8A A;  2HIX A;  1X6O A;  4DV7 L;  3M4P A;  3OTO Q;  3GO5 A;  1BBU A;  3CW2 C;  5LMU Q;  1PH8 A;  4B3T L;  1VQN A;  2L15 A;  3CXC A;  4JI6 Q;  1PVO A;  3ULL A;  2Z6K A;  1M1K C;  4HIK A;  4OWT B;  2VQF Q;  1YIJ A;  2UU9 L;  4GOP A;  2Z0S A;  3OYY A;  1SRO A;  3H15 A;  2OWO A;  4B3S L;  4Y52 H;  1EQR A;  1AE3 A;  1P16 A;  2QGQ A;  1YVC A;  1J6Q A;  4OO1 G;  1N32 L;  3HOZ G;  4LFB L;  3IRB A;  5ELO A;  1N36 Q;  2KEN A;  1Y1V G;  1KD1 C;  2HHH L;  4B3R L;  1L1O B;  1TWF H;  4Y7N H;  3S17 H;  3H3V H;  1DGS A;  4GLX A;  4IJH A;  1KIX A;  4GLA C;  1X9N A;  1WOC A;  3HOV H;  2VQE Q;  4DV0 Q;  1HJP A;  4JI7 Q;  1NBW A;  1XTD A;  1K73 C;  2UUA Q;  1N33 Q;  5BR8 Q;  3U58 A;  2I5L X;  4IFD G;  1XNQ Q;  4DK6 C;  2JA9 A;  4JC0 A;  1UE1 A;  4R4T A;  3GTG H;  1JT8 A;  4GNX A;  4LF9 L;  4PMW A;  5LMN Q;  1LM0 A;  1SFO H;  1PH1 A;  1U0L A;  2ALY B;  4JI3 L;  3STB D;  1PA6 A;  1I94 Q;  2N8N A;  1RIP A;  3DLL A;  4IJL A;  3E0E A;  1SMX A;  5IP7 H;  1B7Y B;  1CKM A;  4JI5 L;  1WI5 A;  1CKO A;  4JG2 A;  4JOI A;  2UUB L;  3PUZ A;  1IL2 A;  2Y0S E;  1B70 B;  3I4M G;  3UDG A;  5FLX c;  4JI2 L;  4GKK L;  2WFW A;  3NBH B;  2JEA I;  2WB1 E;  1IBM L;  2UXB Q;  1SE8 A;  4A3C H;  3PO2 H;  3F1Z A;  1VQI A;  2LXK A;  4X66 L;  4JI1 Q;  4DR1 Q;  2OQ0 A;  3FKI G;  4PZ6 A;  4QJF A;  3M4Q A;  2R93 G;  1NMF A;  4A3J G;  2NVY H;  2UXD L;  4UY8 C;  4IO9 A;  2E5L Q;  1GKH A;  4DK3 C;  3E9I A;  5FLM H;  4DV3 L;  2JA7 G;  5AJ3 Q;  2IX1 A;  4O0A A;  4AIM A;  4X65 Q;  1W3S A;  1VQK A;  1MIU A;  4BY7 H;  2VL6 A;  3KJP A;  3K0X A;  2A8V A;  3RZD H;  4OX9 Q;  3CMA A;  4QGU A;  4A4I A;  4LF8 Q;  3GTO H;  1I5F A;  1VQA A;  4H02 A;  1QVG A;  1CKN B;  1S3O A;  4UP7 A;  3PO2 G;  3AFQ A;  2NZO A;  3PIP A;  1A8V A;  1R9T H;  4BXX G;  2AKW B;  4AYB G;  2KHI A;  4UPA A;  3J80 i;  1LUZ A;  3CC7 A;  2HQL A;  1VQ9 A;  4IOA A;  2YTY A;  1SR3 A;  4L5T A;  4MNO A;  1Q82 C;  2CWA A;  1V9P A;  1TWC H;  3K7U C;  1JJ2 A;  3CME A;  2UXC Q; 
#chains in the Genus database with same CATH topology
 2F0K A;  3D31 A;  2EYH A;  1M8A A;  3F2B A;  3JAM E;  1HNZ Q;  4QL5 A;  5GAH C;  4KV6 A;  3MVV A;  1UE5 A;  4BY7 B;  3QJY A;  3I73 A;  3KBX A;  3TZU A;  2EXZ A;  2N55 A;  4DV1 L;  1PHJ A;  2E8G A;  2EYJ A;  2AHO B;  1HNW L;  1UWV A;  2I5H A;  2BOS A;  4LF7 Q;  1VQC A;  3TEH B;  3P7J A;  4CKE A;  4KY5 A;  5J22 A;  5HGQ A;  1T5X D;  2DJF C;  4GOP C;  3S15 B;  1EIG A;  3CPW A;  4YY3 Q;  3HP3 A;  2MP1 A;  3JAM c;  2F4I A;  4A3E G;  1E7Z A;  3AEV A;  1HRJ A;  2PYK A;  4C1N K;  1YNJ D;  1Y1V B;  3D3R A;  4YCW A;  2I5M X;  3S14 H;  3OW7 A;  1PTO B;  2MNA A;  3BZK A;  4P71 A;  1ONL A;  1S5C D;  3KLR A;  5IT9 L;  3K7A H;  4A3F H;  1L1O A;  2UU9 Q;  3EIV A;  2K5N A;  5C0X G;  1WTQ A;  4DV2 L;  2TMP A;  1D1I A;  3Q8D A;  1MJC A;  2R7D A;  5JAV A;  2LXJ A;  4UDU C;  4CDD C;  4HCE A;  3H3V C;  3PIO 3;  3JC6 6;  2JQO A;  1K0S A;  1CHQ D;  3TRZ A;  4FNF A;  5M3F H;  3ER0 A;  5FLM G;  4DR6 L;  1IZ6 A;  1V1Q A;  2B2T C;  2VY3 A;  4XTC S;  3TDQ A;  2ZXR A;  1Z6H A;  1NTG A;  1UAP A;  2CH4 W;  1D7Q A;  5C4H A;  2B2V A;  2JA8 H;  1PRT D;  5I6Y A;  5DLQ E;  3MXN B;  1VQP A;  1XMQ L;  4KN4 C;  3TP6 A;  2Q2H A;  5LMU L;  1MSH A;  4A3B H;  4JPB W;  3L2P A;  2L11 A;  1Y1W G;  1K3B C;  2N3S A;  4QIW E;  1F2M A;  2RDF A;  1KAW A;  1KRS A;  2BA1 A;  4DV3 Q;  4CJ1 B;  4GOP B;  4IFD I;  1EYD A;  4HIO A;  1PMR A;  1CKN A;  4QUF A;  4KHV A;  5IGC A;  4XYQ A;  2O5I C;  2KEE A;  4GKJ Q;  3N52 A;  3A8J E;  3F2C A;  5E7N A;  1CQV A;  3H91 A;  3DM3 A;  3TBI B;  1DJR D;  1CHP D;  4APV A;  4XIG S;  1PYB A;  2RVL A;  2Q8I B;  4K5X A;  2R7F A;  1CUK A;  2QEX A;  3HOX H;  2FXQ A;  2Z4H A;  3IKJ A;  1D5X C;  3KDF A;  4IFD J;  3FPP A;  1YJN A;  3PF4 A;  3Q0A A;  5G3L D;  1A62 A;  4Y7N B;  1KDB A;  1OXT A;  3D4W A;  1C48 A;  2E75 C;  4XXE A;  4PG3 A;  2JA6 H;  2F0W A;  5CC4 A;  3Q22 A;  3W5O A;  2C5C A;  5I6W A;  4RCN A;  5I4D A;  4NXM Q;  3NQT A;  5KEE A;  4J15 A;  4IQZ A;  4OX9 L;  3M4O B;  1L0Y B;  1AP0 A;  1VMC A;  5M9O A;  1XMO L;  4DUY L;  2ZXP A;  1E22 A;  2RA4 A;  3SHL A;  1QJO A;  3PIP 3;  2K5Q A;  3I4M H;  2ICI A;  4A93 H;  1O7L A;  2A6E D;  1DOL A;  5M3F G;  3DMU A;  4DV6 L;  5C3W A;  1EZ8 A;  3G4S A;  3WWV A;  1BOS A;  2EPB A;  3M3Y B;  4C3I B;  3PUW A;  1I4R A;  2R3Z A;  3ULJ A;  4IPD A;  1Q86 C;  2F0O A;  4KJN A;  3C3L A;  1HH2 P;  2NB0 A;  1DOK A;  1EOV A;  5IP7 G;  4A3B G;  1WCM H;  3TME A;  2F0E A;  1NE3 A;  1VF7 A;  4GN5 A;  1NNX A;  2E76 C;  1XXG A;  2B2W A;  2Q2U A;  3MXU A;  3MXN A;  1G2S A;  2DY8 A;  5FLX L;  3LNN A;  4DAM A;  2OTJ A;  1OTC A;  3GTJ B;  3VR5 A;  3KOJ A;  4QCL A;  4C56 C;  3GTL H;  5GAG C;  1V1P A;  4XQN A;  4ZQ3 A;  1SYF A;  1PFS A;  4LF6 L;  3WOE A;  4KTA A;  4YIJ A;  2KHJ A;  5M5X H;  4TQU S;  2B8G A;  5C44 H;  2JXM B;  2R93 B;  4A3J B;  1Q1E A;  1NY4 A;  2UUB Q;  2B29 A;  1C7Y A;  2IW3 A;  3HZX A;  2A68 D;  4RHS A;  3HOX G;  1BCP D;  4CJ0 B;  1VQB A;  1IBM Q;  1JE5 A;  5GQO A;  4YHH Q;  1EFW A;  4CDE C;  1K83 H;  3HFZ B;  3IFD A;  2F0G A;  2JA5 B;  4BBS H;  4CBV A;  3J81 j;  1E1T A;  2Q2I A;  2VS1 A;  2JA6 G;  2K50 A;  1X54 A;  3IL8 A;  3TRE A;  1IBL Q;  3D8G A;  1D6E C;  3E6Z X;  3EVQ A;  1O7Y A;  1P8L A;  4AH6 A;  2B63 B;  5CR3 A;  1MGS A;  2BH8 A;  3DWA A;  4N9P A;  1YHA A;  2VUM B;  5GAE C;  1S5F D;  1JR0 D;  5EJW A;  3N6R A;  3VR6 A;  1AE2 A;  2ENB A;  4A93 G;  1BNZ A;  2F4V Q;  4RGN A;  3K5N A;  4IZ8 A;  3BJU A;  5M5W H;  3S1Q H;  2NTT A;  4OO1 H;  3CP0 A;  1EY9 A;  2HCC A;  4EQO A;  1JE4 A;  2FHT A;  3CHB D;  2EY5 A;  2KEC A;  1DCZ A;  2IPK D;  2SDF A;  1XTC D;  1TWF B;  1SE2 A;  1Z7T A;  4BA2 I;  2HDM A;  4GKJ L;  3HOV B;  3BS1 A;  2XTI A;  2QA4 A;  4ULL A;  2N49 A;  2BH2 A;  4R4C A;  3GD7 A;  1LLR D;  1WCM G;  1KAA A;  4X65 L;  2YV5 A;  1ZYR D;  1EYA A;  1QG7 A;  4QMG A;  5T1G A;  1U4M A;  4GS3 A;  3CKI B;  2VZA A;  3CD6 A;  1U5K A;  4DV5 Q;  2D9U A;  3FP9 A;  3CCJ A;  4C3J H;  3F8T A;  3QWN A;  5ELD A;  2Z9H A;  3SEB A;  3VA5 A;  1A15 A;  3AYH B;  4XYO A;  3RD4 A;  1STB A;  3BYT B;  3FKI H;  2ATW A;  1DD2 A;  2RKS A;  2UXC L;  5CV8 A;  1VQH A;  2K33 A;  4LF5 Q;  5C44 G;  2MUY A;  4DR5 Q;  3T1H Q;  2JA7 H;  2NVT H;  2NN6 I;  2VB2 X;  4NXM L;  4BBR B;  2JK8 A;  1BUV T;  4EX5 A;  1YNN C;  3D0F A;  3ERS X;  2F0M A;  1CZG A;  2KCN A;  5EKK A;  4KD4 A;  1PDQ A;  3PO2 H;  4GLV B;  5JEA J;  1KDA A;  4BS9 A;  4I7A A;  1HNX L;  4BBS G;  3KUP A;  4OEM B;  3RN2 A;  2EJG C;  3BVM A;  2CQO A;  4OXP A;  3CCQ A;  1A3T A;  1M90 C;  1K9M C;  4NB3 A;  1ASY A;  1S5E D;  3U9S A;  1ZKO A;  4LUZ A;  4X64 Q;  1MI2 A;  4DA2 A;  1CSQ A;  1TWC B;  1AFP A;  4DF7 A;  4K5V A;  1KXL A;  2PNR C;  1EY8 A;  3HOY B;  2WAQ G;  2DGY A;  1B4O A;  1I3Q B;  4KMU C;  1TT2 A;  1VQD A;  2EY1 A;  4I7Z C;  4L5R C;  1IYU A;  1I4H A;  2G9H D;  1I4X A;  3M4P A;  4DV7 L;  2J7Z A;  1EY6 A;  5IT9 E;  1VQN A;  2DNE A;  3MXP A;  4JI6 Q;  1PVO A;  2Z6K A;  1M1K C;  1YIJ A;  2F0S A;  3MTS A;  2NWG A;  1TWA B;  1IHZ A;  2NN6 H;  4LAA A;  1AE3 A;  4OO1 G;  1YVC A;  2SEB D;  4F88 A;  5BN4 A;  1N36 Q;  1EY5 A;  2KEN A;  1NR4 A;  1DXM A;  1I6H B;  1AEX A;  2Z4I A;  2N88 A;  1EY0 A;  4Q5V A;  3BVZ A;  1SMY C;  2VQE Q;  4DV0 Q;  4S3S A;  4JI7 Q;  1EU3 A;  3MC0 B;  1XTD A;  1PFB A;  1BBX C;  2BE5 C;  2I5L X;  2KJX A;  1UE1 A;  1C8C A;  3ZYY X;  1LM0 A;  1SFO H;  1U0L A;  4JI3 L;  3STB D;  1PA6 A;  3NWS A;  2CHB D;  5M5Y B;  1SJE D;  3E0E A;  1SMX A;  2KUM A;  1STG A;  2RSN A;  2UUB L;  4CKC A;  3K5L A;  2Y0S E;  1B70 B;  4C1N I;  1TWG B;  1IBM L;  4C3J G;  1STY A;  3EJI A;  3V96 A;  2OQ0 A;  3FKI G;  5JVH 3;  4PZ6 A;  1AZP A;  3MA2 B;  4J6H A;  3OSO A;  4A3M B;  1PFN A;  2F0F A;  5JPM C;  2JA7 G;  3IAY A;  1VQK A;  2A8V A;  2NVX B;  2WII B;  2KED A;  1SND A;  1EU4 A;  3VR4 A;  3CMA A;  1YNJ C;  2AQ3 B;  3GTO H;  1I5F A;  1ET6 A;  4RGT A;  1T5E A;  4UP7 A;  3PO2 G;  3NK9 A;  2NZO A;  5HGT A;  1SE4 A;  3I72 A;  3SK5 A;  3CC7 A;  1CA6 A;  2XWJ B;  3G6J B;  1F9S A;  1U4R A;  3D4R A;  1V9P A;  4ID6 A;  4K8J A;  2Z6B A;  2GVB A;  5LMN W;  4MIU A;  4DV4 Q;  2XVS A;  3NBI A;  2K32 A;  2QDL A;  3CAM A;  1RF2 D;  1VF5 C;  4XQJ A;  2YU9 H;  3MWY W;  1BDO A;  3CCS A;  1HZC A;  2KHS A;  4R4Q A;  5C4X H;  1VQM A;  1YNX A;  2EYP A;  1ILQ A;  4UP9 A;  5KIX A;  3H94 A;  2CQA A;  1TWH B;  2NN6 G;  3NQI A;  4HIM A;  1PRT C;  4C2M B;  1PH6 A;  4HTH A;  4HJ5 A;  2K4K A;  4HID A;  2JE6 I;  4RCO A;  2KCM A;  2E2J H;  3S16 H;  5IWA Q;  1E1O A;  3MEH A;  4N8X 1;  1E24 A;  1EWC A;  3WOF A;  2B2U C;  4DV5 L;  4LK1 C;  4ZRZ A;  1VCI A;  2KQ3 A;  1QNK A;  2ZTE A;  4H44 C;  5IE8 A;  1H9S B;  3F2D A;  4B3T Q;  1YJW A;  4LF5 L;  3BDL A;  1AZQ A;  4DR4 L;  3T1H L;  5M3M G;  2OTL A;  1N32 Q;  4ZUI A;  4LUV A;  4QIW B;  4DNT B;  2PZW A;  3PO3 B;  4B3R Q;  3S1R H;  5FOB B;  1NUC A;  5EPJ A;  4G57 A;  2P5Z X;  1QWY A;  4DFA A;  3X3N A;  2EY2 A;  4PV1 C;  4NXN L;  5FLX E;  1WD0 A;  4RKL A;  5GRO A;  3HGB A;  1IL8 A;  4LF9 Q;  4JI0 Q;  2NVQ B;  3SK8 A;  4DNI A;  3T13 A;  5E4W C;  2E2I B;  2PCF B;  3EBE A;  1LT6 D;  3OOC A;  5CV4 A;  3CPF A;  1B9N A;  2EQS A;  4JI5 Q;  3L7Z C;  4NMZ A;  1HZA A;  3G71 A;  4JI8 L;  1WTR A;  3RZO B;  2MQH A;  1IXR A;  4JI6 L;  2B2Y C;  4K6D A;  1UE6 A;  3R2T A;  1Y8O B;  3VDY A;  1PRT B;  2UXD Q;  2PW7 A;  1STA A;  1IYJ B;  1N36 L;  1V43 A;  4C3H H;  2A5H A;  3BZC A;  3I8Z A;  5EQ0 A;  2A74 C;  5C4X G;  3DEO A;  2VQE L;  1OXV A;  3FDT A;  1LTL A;  4JYA L;  4XDX A;  1I6V C;  4LW1 A;  1HA6 A;  4GN4 B;  2H5X A;  5JJI A;  3S15 H;  2CFM A;  3F2U A;  1LT3 D;  2X6L A;  4EQ5 A;  1PZI D;  3T56 B;  5EBC A;  1LAB A;  3U50 C;  1LTG D;  1X3F A;  3GV3 A;  1KHI A;  2JP1 A;  2TSS A;  2V1C C;  2FMM A;  4NKL A;  1HUN A;  2KCC A;  1K0R A;  2D0P A;  1H95 A;  3FPU B;  4DAY B;  4A3E B;  1FYC A;  1LTS D;  1EY4 A;  4A75 A;  4U67 3;  1TU2 B;  1D5M C;  2PQE A;  3R2I A;  1EQT A;  1GOZ A;  4OHJ A;  3I2Z A;  1GVP A;  1ROD A;  2XNA C;  2UUC Q;  1HR0 W;  3HOU H;  5IGF A;  5JJK A;  3RNU A;  1H9S A;  1PXU A;  1I4P A;  4X3K A;  3M85 A;  3HOW H;  1PH2 A;  1EYC A;  4B9X A;  4X6A H;  4ME3 A;  3S2H B;  2YYZ A;  4DUZ Q;  2A68 C;  2F3I A;  2KVM A;  2MGS A;  1BCP C;  1G2T A;  1KTK A;  4MTK A;  4H13 C;  5J3B A;  2IWH A;  4R4O A;  1FGU A;  1VQF A;  1E2Z A;  1YBY A;  3K80 C;  5DAU A;  1WFQ A;  4K8I A;  3J80 L;  3MFY A;  1XX8 A;  4FXK C;  1TY0 A;  3NPP A;  3H3V I;  2VB3 X;  1S72 A;  4YCV A;  3TP8 A;  1HQR D;  2AWN A;  3KYH C;  2H4O A;  4LFB Q;  3T1Y Q;  2HHH Q;  1LTB D;  2HT1 A;  1WD1 A;  3ULP A;  4C3H G;  5J1Z A;  1CI3 M;  4AQY Q;  1Y1W B;  1C4Q A;  3GTQ B;  1XJV A;  1CTM A;  4H7B A;  1NSN S;  5ELC A;  1ZXT A;  2KBN A;  2F0Q A;  5IYD H;  3NBH A;  2K01 A;  1I50 H;  2ZTD A;  4R8I A;  3J7Y W;  1L0X B;  4DR3 L;  1KNE A;  1SRU A;  3OTO L;  4YWM A;  1HZ9 A;  4ME5 A;  4KJO A;  3CCR A;  3J81 i;  2E2H H;  2IHE A;  5D3D A;  4OIK A;  2K75 A;  1ZYR C;  1VQG A;  1OXX K;  3VR3 A;  5COY A;  2EYM A;  1VQL A;  3CCL A;  1MD2 D;  4N8F A;  4U68 A;  2BA0 A;  5JJZ A;  1HR0 Q;  1GHJ A;  5ISR A;  3M4O H;  1BCP B;  1G6Z A;  1EWH A;  4JI0 L;  1HFG A;  5C3E H;  1SNC A;  3RR5 A;  3VYT A;  2OT2 A;  1Q3L A;  4ZAI A;  2NZ1 D;  4CDC C;  5LMN L;  4ALP A;  1QZG A;  3HOU G;  1ICW A;  2QF7 A;  1X3Q A;  3KK7 A;  3HOW G;  1WTO A;  1GD7 A;  2XSC A;  1JMC A;  2K5H A;  2O4X A;  4O2D A;  4K0K Q;  5IGG A;  1KNA A;  4KKT A;  1JWU D;  1NJI C;  3M3Y H;  2O5J C;  4C3I H;  1EQQ A;  3K81 C;  2EOT A;  3P75 A;  4DK0 A;  1FJG Q;  4B3M Q;  2UXB L;  1B50 A;  4LF4 Q;  5CV7 A;  1SNQ A;  1PTO F;  4JI1 L;  4DR1 L;  4FF4 A;  3TZD A;  5M3F B;  3S17 B;  4K6L A;  4A3F G;  4IFD H;  4HJA A;  4ABN A;  5AJ3 L;  2A6H C;  4UP8 A;  2EVB A;  1PH3 A;  2OXP A;  1JIC A;  3GTJ H;  4A3B B;  2KOL A;  3P20 A;  5ELE A;  1Q1B A;  3GTP H;  2EZV A;  1CQF A;  1J5E Q;  4M1U B;  4R4I A;  1WTH A;  1GO3 E;  2MFI A;  5IY0 A;  1JB7 A;  4K2K A;  1F9Q A;  1VQO A;  2R93 H;  4A3J H;  2JA8 G;  5IYD G;  3DXJ C;  1CT1 D;  2XRQ D;  1J9O A;  2NVY B;  1HNZ L;  1CFM A;  2K5V A;  1Q12 A;  3J81 c;  5L37 A;  2EXD A;  1XNR Q;  1ESR A;  3AFP A;  3D4D A;  3RZD B;  2K52 A;  3EA6 A;  2JA5 H;  1EIY B;  5HY6 A;  1IBK Q;  4IPH A;  4BXX H;  4LF7 L;  1UNS A;  1SXT A;  3STB C;  5C4J H;  4JV5 Q;  1IKL A;  2B63 H;  5A2Q L;  4RAU C;  1C0A A;  4DUZ L;  4YY3 L;  3CCV A;  1S5D D;  2VUM H;  2I0Q A;  2ZJP A;  5C3E G;  1I4Q A;  2IX3 A;  2CKZ B;  3M4Y A;  4ZK9 B;  1JCK B;  2HIX A;  3C1E A;  3K58 A;  1BBU A;  3CW2 C;  2Y0S B;  2L15 A;  3CXC A;  1PYW D;  3ULL A;  2WKC A;  4HIK A;  2UU9 L;  4GOP A;  5DM7 3;  3H15 A;  2GA4 B;  4L6T B;  5CYU A;  4WFN 3;  4Y52 H;  4K14 A;  1P16 A;  1J6Q A;  4I65 A;  4LFB L;  2QEJ C;  5F2D A;  3MXG A;  2HHH L;  1HQM C;  3L3O C;  1TWF H;  4A93 B;  1DGS A;  3TP7 A;  1LT4 D;  5I2Y A;  3HOV H;  5BN3 A;  2K1B A;  4IAL A;  2UUA Q;  3HEJ A;  5DNF A;  5BR8 Q;  4IFD G;  2JA9 A;  4JC0 A;  3GTG H;  2F3W A;  2QIL A;  1I94 Q;  4RKB A;  3VYU A;  2IL8 A;  3DLL A;  1SAP A;  3Q6S A;  1GUO A;  2WKD A;  1WI5 A;  1CKO A;  5C5M A;  5JPN C;  1IL2 A;  3PUZ A;  3I4M G;  2M2L A;  3UDG A;  1WCM B;  2WFW A;  5LHY 1;  4A3C H;  5JVG 3;  3F1Z A;  2LXK A;  2FFK B;  4KY7 A;  3V2T A;  3BDO A;  4G7Z C;  2B2T A;  4QJF A;  3S1N B;  1HCZ A;  2R93 G;  4A3J G;  5D65 A;  4UY8 C;  3RUZ A;  2E5L Q;  1GKH A;  4H0L C;  4DK3 C;  4DV3 L;  1PZK D;  3GTL B;  4O0A A;  3MAQ A;  4AIM A;  5KGU A;  1W3S A;  4RGM A;  1M4V A;  1OO9 B;  4LF8 Q;  2MHV A;  1VQA A;  3TN2 A;  3C46 A;  4IUQ A;  3P1H A;  4BXX G;  1R9T H;  1GXD C;  2AKW B;  3NTH A;  4UPA A;  4AYB G;  4BWG B;  3J80 i;  1LUZ A;  3URY A;  4L5T A;  5CBE E;  1BF4 A;  1TS3 A;  1TWC H;  3K7U C;  2HCI A;  1X56 A;  3MFG A;  4QY7 A;  3HOY H;  5IYB H;  1SYB A;  3BYY B;  1FGB D;  3KF6 B;  3RLF A;  3I4N H;  5C3X A;  4DR7 Q;  1BBW A;  4ZCK A;  4BBS B;  1GUS A;  2QW7 A;  4LF4 L;  4IN3 A;  3DWQ A;  3GQB A;  3UDX A;  3FHW A;  3A56 A;  3DWP A;  2C35 B;  1TWA H;  4WJ3 M;  1ESF A;  3CU7 A;  3EFX D;  3QR8 A;  1CZW A;  1KC8 C;  4BY1 H;  5BN5 A;  2R61 A;  4K5W A;  3I4O A;  1SBB B;  2N78 A;  1EZ6 A;  2QDB A;  2RCN A;  5EGT A;  4DR2 Q;  3K0Y A;  3KBG A;  4PZ8 A;  2L0C A;  1X55 A;  3S1Q B;  4A3K H;  1LTR D;  2RDG A;  4ZYS A;  5KYI A;  1QB5 D;  3A5Z B;  4OGQ C;  5M5Y H;  1G51 A;  1Z47 A;  4NPS A;  5JEA H;  4IUV A;  1QZH A;  1A6X A;  3Q23 A;  4B3S Q;  1VQ5 A;  1I4G A;  1TY2 A;  1XNR L;  2E2D C;  2PPB C;  2A73 B;  3W1G A;  3SE0 A;  1ICF B;  3NTI A;  4QB4 A;  5FO9 B;  2Q8R E;  3U9O A;  3T4A C;  4A3M H;  1HTL D;  4TVA B;  1IBK L;  1DM0 B;  1LTI D;  2RCF A;  4POF A;  4CHT B;  3CQZ B;  3PMF A;  1NCV A;  4P74 A;  4PNY A;  4X3T A;  3L9A X;  4JI4 Q;  4P72 A;  2EIF A;  3Q24 A;  2I46 A;  4TSS A;  1L2F A;  2CW0 D;  3FKI B;  3QB3 A;  3QOL A;  1QNU A;  3J80 c;  1EIF A;  4HAE A;  2CWP A;  2K14 A;  3CCE A;  3EQL C;  4A3D B;  3KLS A;  4JBJ A;  5HUR A;  1VQJ A;  3A8I E;  2JA7 B;  2L12 A;  2NVT B;  3H0G H;  1N34 Q;  2F0I A;  3NE5 B;  1WTP A;  5KRU A;  4PZ7 A;  1WYD A;  1E3P A;  1ENF A;  5IYB G;  5IGD A;  3PO2 B;  3I4N G;  1S40 A;  4PMB A;  4A3G B;  2MO0 A;  5E1F A;  4YHH L;  3U4Z A;  1XPU A;  2QKI C;  1Q8K A;  1YIT A;  2F0N A;  1MSG A;  1KLU D;  1TWH H;  2UUA L;  2B39 A;  1IBL L;  1XWE A;  1SNO A;  2RHS B;  4BY1 G;  1OXS C;  1JOK A;  4GN3 B;  3J81 L;  2PNH A;  2RQX A;  1K8M A;  3FRP B;  3HKZ G;  2F4V L;  3QO2 A;  1KRT A;  4A3K G;  2XWB B;  2AMC B;  1FNW A;  4KN7 C;  1YEZ A;  1JQY D;  2HDL A;  4AYB E;  4J8Q A;  2LS0 1;  5JEA G;  2E5L L;  1HNW Q;  2CVR A;  4MN3 A;  3CCU A;  4FO2 A;  3S1M B;  5D3I B;  5JJL A;  4OIJ A;  3K8A A;  3GTM H;  4JCV E;  3CF5 A;  3PO3 H;  5GAD C;  1SEB D;  3C1F A;  4Z9C B;  1SFO B;  4O42 A;  1UEB A;  1L1O C;  4LF8 L;  1RCV D;  3ND9 A;  1NR2 A;  2GN5 A;  4KHP Q;  4IUP A;  4A3M G;  4DPG A;  2A69 D;  5M3M B;  2L4N A;  5D14 A;  1TS4 A;  2B3G A;  4A3I H;  1MKH A;  2KA7 A;  4MZ9 A;  2NVQ H;  2E2I H;  1D8L A;  2ZXO A;  2K04 A;  2G9D A;  2JSO A;  2R7Z H;  5JOB A;  3S2D H;  1SN8 A;  2K28 A;  2PW5 A;  1GUN A;  3HOZ B;  3U4V A;  3K6O A;  3UDI A;  5EBD A;  2ES2 A;  4FF2 A;  1IW7 D;  4DV2 Q;  4PMC A;  2L55 A;  1EUJ A;  2D5D A;  3H0G G;  3J7A V;  1JOQ A;  4DR5 L;  1B44 D;  3GTK H;  1JC7 A;  3NUC A;  5IP9 H;  4GNX C;  1UEA B;  3GTO B;  2YTV A;  1BXT A;  1SYD A;  1B3Q A;  1SYE A;  2WAQ E;  3NWT A;  1TXY A;  4DR2 L;  3HS0 C;  4KI0 A;  3VYS A;  1HXY D;  1Q8I A;  4HJ9 A;  4A3L H;  4NW2 A;  2PI2 E;  2F0D A;  5A2Q E;  1HTP A;  1SE3 A;  3L0O A;  1XMQ Q;  3G48 A;  4EQN A;  4HR7 B;  2L9H A;  5C0X I;  4IUU A;  4X64 L;  5CV9 A;  1HFN A;  1LTA D;  4WJ4 A;  1X3G A;  4GZY C;  3J7A F;  2R92 H;  2K7V A;  1VQ7 A;  4HJ7 A;  1GHK A;  3K57 A;  2IX0 A;  4L63 B;  3CC4 A;  2R6G A;  3E9H A;  1QOH A;  1JB3 A;  5DEH A;  1U4L A;  4R1J A;  2E2J B;  1F2Z A;  3S16 B;  3QOJ A;  2OQK A;  3T16 A;  3UDF A;  4A3E H;  1STH A;  5C0X J;  4BY7 H;  4P73 A;  4RG1 A;  2WP8 J;  1JJC B;  3E5S A;  2RSO A;  3JAM i;  4PQX A;  4G7H C;  4JI4 L;  3PO3 G;  2A6E C;  2WB1 G;  4J1M A;  2ID0 A;  4DV0 L;  4JI7 L;  1UUP A;  4WOR A;  1Z9F A;  5C0X H;  3K59 A;  3A0J A;  1SYC A;  1S4Z A;  1XPR A;  4POG A;  1EWI A;  1N34 L;  3S2H H;  2EE1 A;  1FNV A;  2ZJQ A;  1GM5 A;  4EGV A;  4A3I G;  1HHV A;  1SYG A;  2EYF A;  4GNX B;  4TKO B;  4DXF A;  3OPO A;  2R7Z G;  3S24 A;  4B9W A;  1PH5 A;  1Y1V H;  1W2B A;  1SJH D;  1Y14 B;  1K8G A;  1Y69 U;  4EVO A;  1PTO H;  3J7A 5;  3UE1 A;  1VS0 A;  3LGJ A;  4ZUJ A;  5K5P A;  3I3C A;  3SVM A;  4OL7 A;  1XPO A;  1XMO Q;  3HKZ E;  4DUY Q;  2EYL A;  1T9H A;  3BU2 A;  3E3X A;  4RA8 A;  5IP9 G;  3PSI A;  4OEL B;  2WIN B;  4FVM A;  3ZJY C;  5EPL A;  1G6P A;  5C5L A;  4IPC A;  3PGZ A;  4DV6 Q;  1Y1W H;  1A63 A;  2BDO A;  4OON A;  2ASB A;  3GTQ H;  4A3L G;  4JBK A;  1V8Q A;  2B2W C;  3TS0 A;  3OW2 A;  2OEO A;  3NSW A;  2LY7 A;  3I70 A;  4DV4 L;  1GUW A;  1F9R A;  2MJ8 A;  3KDF B;  4C3H B;  1WVL A;  1U9R A;  1K3R A;  2R92 G;  4NP5 A;  4WJW A;  2X69 A;  1SNM A;  4KK7 A;  1RTN A;  2HUG A;  1A3V A;  1Y8N B;  3HKS A;  1PRT F;  4IPG A;  4FXG C;  4KHP L;  1GUG A;  1O7Z A;  1ENC A;  1FVI A;  1AH9 A;  1EOT A;  4BY7 G;  4FF1 A;  3O13 A;  4LF6 Q;  5IWA L;  1TR5 A;  3PF5 A;  3G7L A;  3RLO A;  2RF4 A;  3SGI A;  1PH7 A;  4YWL A;  2RBM A;  2XGT A;  1AW7 A;  5LL6 S;  1MJE A;  4FXD A;  2GVA A;  1B8A A;  4CKB A;  4B3T L;  4JK1 C;  3GV6 A;  1F2Y A;  2Z8L A;  2X6G A;  4OWT B;  2VQF Q;  3T51 B;  2Z0S A;  1SRO A;  2OWO A;  4FF3 A;  2LFN A;  2NYZ D;  1N32 L;  2B2U A;  3HRZ C;  3IRB A;  5ELO A;  1Y1V G;  4B3R L;  2SNM A;  3HOU B;  2EJF C;  4FYD A;  3S17 H;  3OMG A;  4Y7N H;  3H3V H;  2J4X A;  4E6I A;  3CRK C;  3HOW B;  1BO0 A;  4V19 0;  4IJH A;  1KIX A;  3V05 A;  1X9N A;  1O78 A;  1WOC A;  1LO5 D;  3VA7 A;  1HJP A;  1H9R A;  1H9K A;  1NBW A;  2SNS A;  1N33 Q;  1W6J A;  1XNQ Q;  4DK6 C;  3LWU A;  1BR9 A;  4R4T A;  1JT8 A;  4UHV A;  4DU9 A;  4GNX A;  4LF9 L;  4PMW A;  2ALY B;  5G3L F;  1DON A;  3S14 B;  1V1P B;  2XRS D;  2N8N A;  4TRD A;  4IJL A;  4X3U A;  5IP7 H;  4JI5 L;  2BDN A;  3K7A B;  4A3F B;  2F0V A;  2WB1 E;  5KNB A;  3R3O A;  1VQI A;  4CJ2 C;  4DAY A;  4RFB A;  3M4Q A;  2NTS A;  2NVY H;  2UXD L;  5IGE A;  3SXH A;  1AN8 A;  4X65 Q;  2EYO A;  2VL6 A;  3KJP A;  3RZD H;  1CA5 A;  4RWS C;  1MBY A;  4QGU A;  2JA8 B;  2B2Y A;  1RDP D;  4JVZ A;  1S3O A;  1WTW A;  1I50 B;  1A8V A;  3J81 E;  2HQL A;  1VQ9 A;  5CMD A;  2YTY A;  1SR3 A;  4IOA A;  3GP7 A;  2K03 A;  4XQQ A;  1JJ2 A;  2UXC Q;  4P75 A;  2E2H B;  4L5S A;  5A35 A;  2K5W A;  2V4D A;  1N8R C;  3ND8 A;  4XT3 B;  5EPK A;  2JN4 A;  3OIQ A;  3R93 A;  3RMH A;  1IKM A;  4DXG A;  1KL9 A;  2L1B A;  1F77 A;  3K5O A;  3I7F A;  2PMZ E;  1X3E A;  2FIN B;  5CBA E;  1EL0 A;  1EQV A;  1QVF A;  2ZJR A;  2PQA B;  2H1E A;  1X65 A;  2RHQ B;  5C3E B;  1K8O A;  1YHB A;  2YTX A;  1BKB A;  2CW0 C;  1HNX Q;  1EY7 A;  3D6C A;  2HQE A;  2CCZ A;  1PTO D;  3IFT A;  2Z6K C;  3PUX A;  1JOR A;  4ZLT F;  3NEL A;  2UUC L;  1ML0 D;  3M9B A;  1ASZ A;  3AMU A;  4LWC A;  3HOX B;  3SR1 A;  1BCP F;  3ICE A;  5FO8 B;  3PQI A;  2NUC A;  4DV7 Q;  1Q46 A;  4R8N A;  4A76 A;  1A0I A;  2AQ2 B;  4KKS A;  2JA6 B;  1CK1 A;  2IJ0 A;  3NEN A;  2Z1C A;  3H09 A;  1X32 A;  4MTN A;  4X3S A;  4LFA Q;  1ENA A;  3AQQ A;  3WDN A;  3S1N H;  1QUQ B;  4HSV A;  5I9O A;  4C3I G;  4LFC Q;  3GDE A;  3T1Y L;  2F1M A;  2K6A A;  1VQE A;  3I4M B;  2DJG C;  3HG9 A;  3GTP B;  4HMI A;  2DN8 A;  2D0O A;  5E3F A;  2DNC A;  1TVX A;  4JI3 Q;  4AQY L;  1KAB A;  4P2C B;  1SSO A;  3A7A B;  1YHQ A;  1W6K A;  3MEF A;  1TII D;  2WAC A;  5IOC A;  4OO1 I;  2F3V A;  1PH9 A;  3KFU A;  2VQF L;  2AUJ D;  2F0U A;  1JWS D;  2MPM A;  4AYB B;  3A55 A;  1B53 A;  5C4J B;  1STE A;  1SLJ A;  3M7N A;  2A69 C;  2Q2T A;  2F0J A;  2Y0S G;  5H1S E;  2E74 C;  2LMC B;  5CGK A;  3NXW A;  1TKW B;  4KKU A;  1BQQ T;  3NP8 A;  4QQB X;  1N33 L;  1R4Q B;  2EDG A;  4BBR H;  1XNQ L;  4DAP A;  4RMF A;  1HR0 L;  5DM6 3;  5EKL A;  1UE7 A;  4BA1 I;  1FNU A;  5M5X B;  4ZKB B;  1RKN A;  3DHQ A;  5C44 B;  2JA5 G;  2ZTC A;  3G6E A;  1IW7 C;  2VNU D;  2HD3 A;  3FVQ A;  3PCO B;  4EQP A;  1XYI A;  5I2X A;  1PV4 A;  3X3M A;  1GJX A;  2ZT9 C;  1II3 A;  5K36 H;  1Q81 C;  2B63 G;  2PQA A;  3CC2 A;  5FJ8 H;  2PZT A;  4K0K L;  3JAM L;  2D2C C;  4KHZ A;  3KLW A;  1K83 B;  1I3Q H;  2VUM G;  1FJG L;  3I4L A;  2EJM A;  4B3M L;  2IT1 A;  3I55 A;  4DN4 M;  1ILP A;  2FJ2 A;  3PUY A;  3W3A A;  2JYO A;  2L5T A;  1PH4 A;  3PUV A;  3DM1 A;  3NEM A;  3GTG B;  1LTT D;  1SNP A;  2DY7 A;  3MHB A;  3CRL C;  1FD7 D;  1S5B D;  5IGB A;  4R9W A;  2WAQ B;  4HJ8 A;  4X62 Q;  3W2D A;  4CDF C;  3CQZ H;  1I6H H;  1N9W A;  4QF4 A;  4HED A;  2J0T D;  4JBW A;  1FR3 A;  4ILW A;  3A7L A;  4IUR A;  4QUC A;  2ZM6 Q;  4F7X A;  4DNR B;  3HOV G;  4A3D H;  5M5W B;  3ERQ A;  1CSP A;  4DR4 Q;  2A19 A;  4N9T A;  1J5E L;  2F52 A;  1HZB A;  1QUQ A;  3TP5 A;  4Q0F A;  2HIV A;  2SOB A;  2BCO A;  4RGO S;  3QIA A;  4MHE A;  1QE6 A;  3TS2 A;  3CCM A;  3J80 E;  2LSS A;  1JOO A;  1TWG H;  1YJ9 A;  1KLG D;  4YCU A;  1A2U A;  4A3G H;  5IYC H;  1EYG A;  1R4P B;  4UAI A;  2IHF A;  1R9T B;  1LAC A;  1Y8P B;  4NXN Q;  4A3C G;  3I90 A;  3S9W A;  1NAP A;  3SDZ A;  1OXU A;  5IOD A;  1YZ6 A;  4CGY B;  4JOI C;  5EAY A;  3PV0 A;  2A6H D;  1A2T A;  4JV5 L;  4HSP A;  3TSS A;  3I4N B;  4C3J B;  3OIP A;  4BBR G;  1QCB D;  1H9J A;  1O7I A;  2NVX H;  5KND A;  2JJQ A;  1CM9 A;  1F2L A;  4JI8 Q;  1J8I A;  1D5Z C;  2VXW A;  2NBF A;  1L0W A;  1FL0 A;  3OMC A;  2A1A A;  3KJO A;  1G91 A;  3K5M A;  4JI2 Q;  4GKK Q;  3KF8 B;  1RTO A;  4LFA L;  1VQ6 A;  2MO1 A;  4BY1 B;  5K36 G;  4X66 Q;  1DOM A;  1B1Z A;  1G29 1;  5FJ8 G;  5EKI A;  3BDC A;  1QVC A;  2K5D A;  1YI2 A;  3HOY G;  4DKA C;  2Q8T A;  4LFC L;  1A3U A;  4L5Q A;  5TSS A;  4LJZ C;  3S1M H;  2PZU A;  4JYA Q;  3HKZ B;  5IT9 c;  4A3K B;  3ERO A;  3I56 A;  1ET9 A;  1RL2 A;  4F8M A;  1ZEQ X;  3A74 A;  3H6M A;  3LX0 A;  5FK9 C;  1E2V A;  2ICE C;  1BVS A;  2FMC A;  3FMC A;  3UI2 A;  2NZH A;  3ITP A;  5BR8 L;  5J39 A;  1QIL A;  4C2M H;  5M3M H;  4JW0 A;  5ELN A;  3A5U A;  5KYL A;  1O80 A;  4HN7 A;  1X3P A;  1HA5 A;  3KF6 A;  1RJT A;  1I94 L;  2QCP X;  3NHH A;  3OHX C;  4IUT A;  4FP5 D;  2F03 A;  1VDZ A;  1HPC A;  1JWM D;  1WTX A;  4IUN A;  3HOZ H;  4OWW B;  3VYR A;  4A3D G;  3DUZ A;  3W1B A;  2OCE A;  3E0J A;  2M9V A;  4LUO A;  1C9O A;  4DV1 Q;  4IOC A;  2PI2 A;  4L8J A;  1K8A C;  2F0P A;  4RHR A;  1GUT A;  1PZJ D;  1STN A;  4A3G G;  5IYC G;  2AWO A;  1EEI D;  4YWK A;  1RHP A;  2AQ1 B;  5COR A;  2F0L A;  2VW9 A;  3H0G B;  1PYS B;  1K28 A;  1LYL A;  2K05 A;  1Q90 A;  4FDB A;  3RLN A;  3OWF A;  5C6A A;  1VQ4 A;  1VQ8 A;  2IY5 B;  3UE0 A;  1SDF A;  2F0T A;  1LT5 D;  4ODG A;  5E4X A;  3MZ5 A;  3BZD B;  2XIW A;  1VMP A;  1Q7Y C;  4DR7 L;  3TQY A;  3C2P A;  3FEW X;  1NMG A;  2PO4 A;  5T1I A;  1WJJ A;  2RDH A;  1JJG A;  3RZO H;  3J7Z C;  1KQS A;  2B2V C;  3EN2 A;  4G4K A;  4KLK A;  3OWE B;  4RH6 A;  4G7O C;  1EFI D;  4JBM A;  4KY6 A;  3B6Y A;  4HCS A;  3PIO A;  2JEB I;  2O2L D;  2WV6 D;  4KD3 A;  4X62 L;  4OWX B;  1B2T A;  2KCT A;  3AU7 A;  1DZ1 A;  3R8B A;  5C4Z A;  4DR6 Q;  4DGZ A;  2ZM6 L;  4LMQ D;  2DUD A;  4WRD A;  3KF8 A;  1RD9 D;  4LNQ A;  3RN5 A;  2D62 A;  3SK6 A;  3I91 A;  4O1N A;  4XT1 B;  1E0B A;  1DYQ A;  5IIF A;  4DR3 Q;  3ONA B;  4V0B A;  1X6O A;  1B3A A;  3OTO Q;  3GO5 A;  4F87 A;  5LMU Q;  4NDX A;  4B08 A;  1PH8 A;  2YU9 B;  4K2L A;  2M00 A;  3GTM B;  5C4X B;  2WB1 B;  3D6W A;  3OYY A;  4B3S L;  1PLF A;  5FO7 B;  1EQR A;  1TS5 A;  2QGQ A;  3HOZ G;  1TQO A;  1KD1 C;  4M8A A;  5LL6 X;  1L1O B;  1EIH A;  3NTK A;  3DEP A;  3QG1 A;  2I07 B;  5AFW A;  4GLX A;  1MHW C;  4GLA C;  3LWE A;  1EEF D;  4A3I B;  1KDC A;  1K73 C;  1H9M A;  1YNN D;  3U58 A;  3S2D B;  2R7Z B;  5KNC A;  1U4P A;  3M7G A;  5LMN Q;  1PH1 A;  2B8F A;  3A8K E;  1D2B A;  5FKA C;  1RIP A;  1WTV A;  1B7Y B;  1CKM A;  3SK4 A;  1E2W A;  5NUC A;  4JG2 A;  4JOI A;  3GTK B;  3T53 B;  5CV5 A;  5FLX c;  4JI2 L;  4GKK L;  2JEA I;  3NBH B;  2UXB Q;  1SE8 A;  4X66 L;  2LKV A;  4JI1 Q;  4DR1 Q;  3S1R B;  3VR2 A;  1G8Z D;  1PTO C;  1NMF A;  4ZKC B;  4IO9 A;  2PMZ B;  3AB9 A;  4DK1 A;  3E9I A;  5FLM H;  2OF1 A;  4HMJ A;  1TS2 A;  5AJ3 Q;  2IX1 A;  1PFM A;  2AUK A;  1MIU A;  2XN9 C;  1F9P A;  2F0H A;  2CH4 A;  1LV9 A;  3K0X A;  4DAV A;  4OX9 Q;  4A4I A;  1IYV A;  3A54 A;  4H02 A;  1QVG A;  1V1O A;  2C9O A;  3KLS X;  1CKN B;  3AFQ A;  3PIP A;  2R92 B;  5ELF A;  2KHI A;  3BVG A;  1D1K A;  5CV6 A;  1SMY D;  4MNO A;  1Q82 C;  3BG3 A;  1B9M A;  1HUM A;  2EY6 A;  2CWA A;  5I9P A;  2BE5 D;  2G5D A;  5ELB A;  3CME A; 
#chains in the Genus database with same CATH homology
 4P75 A;  1X56 A;  2GVB A;  4QY7 A;  5LMN W;  5IYB H;  4DV4 Q;  4L5S A;  3HOY H;  3KF6 B;  3RLF A;  3I4N H;  3D31 A;  1N8R C;  4DR7 Q;  1BBW A;  3CAM A;  3F2B A;  1HNZ Q;  4QL5 A;  5GAH C;  4LF4 L;  1UE5 A;  2YU9 H;  1KL9 A;  3CCS A;  1HZC A;  3I7F A;  4R4Q A;  5C4X H;  2PMZ E;  3UDX A;  3FHW A;  1X3E A;  4A3L G;  4DV1 L;  1VQM A;  1PHJ A;  1YNX A;  2E8G A;  1QVF A;  2C35 B;  2AHO B;  1TWA H;  2PQA B;  2ZJR A;  1UWV A;  4UP9 A;  1X65 A;  2RHQ B;  2I5H A;  1HNW L;  4WJ3 M;  1YHB A;  2YTX A;  4LF7 Q;  1BKB A;  1VQC A;  2NN6 G;  3TEH B;  1KC8 C;  4BY1 H;  1HNX Q;  4HIM A;  1PH6 A;  4HJ5 A;  2K4K A;  2CCZ A;  3I4O A;  4HID A;  2N78 A;  2RCN A;  2JE6 I;  2Z6K C;  3PUX A;  5HGQ A;  4DR2 Q;  2KCM A;  4GOP C;  2E2J H;  3NEL A;  3S16 H;  5IWA Q;  1E1O A;  3CPW A;  4PZ8 A;  4YY3 Q;  1E24 A;  2UUC L;  3JAM c;  3M9B A;  4DV5 L;  1ASZ A;  1X55 A;  4A3E G;  4LWC A;  1E7Z A;  3AEV A;  4A3K H;  1VCI A;  3ICE A;  4YCW A;  3A5Z B;  2I5M X;  4DV7 Q;  1Q46 A;  2ZTE A;  3S14 H;  5IE8 A;  2MNA A;  5M5Y H;  3BZK A;  1G51 A;  4P71 A;  3F2D A;  1Z47 A;  4NPS A;  1YJW A;  4A76 A;  4B3T Q;  1A0I A;  4LF5 L;  1QZH A;  4DR4 L;  3K7A H;  4A3F H;  1L1O A;  2UU9 Q;  3EIV A;  3T1H L;  5M3M G;  2OTL A;  1VQ5 A;  4B3S Q;  2K5N A;  3NEN A;  5C0X G;  1N32 Q;  1XNR L;  4LUV A;  4DV2 L;  4MTN A;  4LFA Q;  3Q8D A;  3W1G A;  1MJC A;  3AQQ A;  4B3R Q;  3S1R H;  2R7D A;  3S1N H;  2LXJ A;  4A3M H;  1IBK L;  4TVA B;  1QUQ B;  3JC6 6;  2JQO A;  4LFC Q;  4POF A;  3GDE A;  3TRZ A;  3T1Y L;  1VQE A;  4P74 A;  4NXN L;  5M3F H;  3ER0 A;  5FLM G;  5GRO A;  4DR6 L;  1IZ6 A;  1V1Q A;  2VY3 A;  4XTC S;  1NTG A;  2D0O A;  2EIF A;  4P72 A;  4JI4 Q;  4LF9 Q;  4JI0 Q;  1L2F A;  4JI3 Q;  4DNI A;  4AQY L;  2JA8 H;  1D7Q A;  3EBE A;  3J80 c;  1EIF A;  5DLQ E;  2CWP A;  2K14 A;  3MXN B;  1VQP A;  1XMQ L;  3CCE A;  3CPF A;  1YHQ A;  2EQS A;  4JI5 Q;  4JBJ A;  3L7Z C;  3MEF A;  1VQJ A;  1HZA A;  4OO1 I;  3G71 A;  4JI8 L;  2Q2H A;  3H0G H;  5LMU L;  1PH9 A;  2MQH A;  1N34 Q;  1IXR A;  4JI6 L;  3KFU A;  4A3B H;  2VQF L;  4PZ7 A;  1WYD A;  3L2P A;  1UE6 A;  1Y1W G;  1E3P A;  2N3S A;  4QIW E;  5IYB G;  3VDY A;  2UXD Q;  3I4N G;  1S40 A;  1IYJ B;  1KAW A;  1KRS A;  1N36 L;  2BA1 A;  2MO0 A;  4DV3 Q;  1SLJ A;  4YHH L;  4GOP B;  4IFD I;  4HIO A;  1V43 A;  4C3H H;  3M7N A;  1CKN A;  2Q2T A;  3BZC A;  2Y0S G;  5H1S E;  3U4Z A;  1XPU A;  4GKJ Q;  5C4X G;  2VQE L;  1Q8K A;  1YIT A;  1OXV A;  3F2C A;  1TWH H;  5E7N A;  1LTL A;  1IBL L;  2UUA L;  1N33 L;  4QQB X;  4JYA L;  4BBR H;  1XNQ L;  3DM3 A;  4LW1 A;  2RHS B;  4RMF A;  1HR0 L;  4GN4 B;  4BY1 G;  1UE7 A;  2H5X A;  4BA1 I;  5JJI A;  1OXS C;  3S15 H;  2CFM A;  4GN3 B;  2PNH A;  4EQ5 A;  4APV A;  4XIG S;  1PYB A;  2JA5 G;  2ZTC A;  2R7F A;  3G6E A;  1CUK A;  2VNU D;  3PCO B;  2QEX A;  3HOX H;  2FXQ A;  3KDF A;  3U50 C;  1PV4 A;  4IFD J;  3HKZ G;  2F4V L;  1YJN A;  1KRT A;  1Q81 C;  4A3K G;  2B63 G;  1X3F A;  3PF4 A;  2PQA A;  3CC2 A;  5FJ8 H;  4K0K L;  2AMC B;  1A62 A;  1KHI A;  1YEZ A;  2V1C C;  3KLW A;  4KHZ A;  1OXT A;  4AYB E;  1I3Q H;  2VUM G;  1FJG L;  5JEA G;  4PG3 A;  1K0R A;  2D0P A;  2IT1 A;  3I55 A;  2E5L L;  4B3M L;  2JA6 H;  1H95 A;  1HNW Q;  3W5O A;  3PUY A;  4DAY B;  3CCU A;  5JJL A;  4NXM Q;  3K8A A;  3GTM H;  1PH4 A;  4J15 A;  4JCV E;  3CF5 A;  3PUV A;  4A75 A;  3PO3 H;  3NEM A;  5GAD C;  4OX9 L;  1UEB A;  1L1O C;  4LF8 L;  1XMO L;  4DUY L;  1E22 A;  3I2Z A;  4HJ8 A;  1GVP A;  2GN5 A;  4X62 Q;  4KHP Q;  4A3M G;  2UUC Q;  1HR0 W;  3CQZ H;  4DPG A;  1I6H H;  3I4M H;  1N9W A;  3HOU H;  5JJK A;  4JBW A;  3RNU A;  4A93 H;  3M85 A;  3HOW H;  1PH2 A;  4X6A H;  5M3F G;  2ZM6 Q;  4ME3 A;  2B3G A;  2YYZ A;  1MKH A;  4MZ9 A;  4DUZ Q;  4DV6 L;  4A3I H;  2NVQ H;  2F3I A;  3HOV G;  3G4S A;  2E2I H;  3WWV A;  1D8L A;  2R7Z H;  3S2D H;  1SN8 A;  4A3D H;  1CSP A;  3PUW A;  4DR4 Q;  2A19 A;  5J3B A;  3U4V A;  1J5E L;  4R4O A;  2F52 A;  1FGU A;  1VQF A;  1YBY A;  3K80 C;  1HZB A;  4IPD A;  3ULJ A;  1WFQ A;  3UDI A;  1Q86 C;  2ES2 A;  4DV2 Q;  1QUQ A;  1EUJ A;  1HH2 P;  2HIV A;  3H0G G;  3TS2 A;  4DR5 L;  3CCM A;  3GTK H;  1EOV A;  5IP7 G;  3H3V I;  4A3B G;  2LSS A;  1WCM H;  5IP9 H;  4GNX C;  1TWG H;  1YJ9 A;  1S72 A;  2YTV A;  4YCU A;  4YCV A;  2AWN A;  4A3G H;  3KYH C;  5IYC H;  1EYG A;  4LFB Q;  1NE3 A;  3T1Y Q;  4GN5 A;  2IHF A;  2HHH Q;  4NXN Q;  2Q2U A;  4A3C G;  2WAQ E;  4DR2 L;  1TXY A;  2HT1 A;  1OXU A;  4KI0 A;  1YZ6 A;  3ULP A;  4JOI C;  5EAY A;  4DAM A;  2OTJ A;  3PV0 A;  1OTC A;  4HJ9 A;  4AQY Q;  4A3L H;  2PI2 E;  3KOJ A;  4JV5 L;  3L0O A;  3GTL H;  5GAG C;  1XMQ Q;  3G48 A;  1XJV A;  4BBR G;  4LF6 L;  1PFS A;  1O7I A;  2NVX H;  5C0X I;  4X64 L;  2KHJ A;  2JJQ A;  2KBN A;  4TQU S;  5M5X H;  4JI8 Q;  5IYD H;  5C44 H;  4WJ4 A;  1X3G A;  1I50 H;  2ZTD A;  1Q1E A;  1L0W A;  2R92 H;  1NY4 A;  1VQ7 A;  1FL0 A;  4DR3 L;  4HJ7 A;  2UUB Q;  2B29 A;  2A1A A;  1C7Y A;  3KJO A;  1SRU A;  2IX0 A;  4YWM A;  4JI2 Q;  3OTO L;  3KF8 B;  3HOX G;  3CC4 A;  1IBM Q;  4GKK Q;  1HZ9 A;  1VQB A;  1JE5 A;  5GQO A;  4LFA L;  1VQ6 A;  2MO1 A;  3CCR A;  3J81 i;  2R6G A;  5K36 G;  4YHH Q;  3E9H A;  4X66 Q;  2IHE A;  1G29 1;  1EFW A;  2E2H H;  5FJ8 G;  1K83 H;  2K75 A;  3HFZ B;  1VQG A;  1QVC A;  1OXX K;  4R1J A;  1YI2 A;  3HOY G;  4BBS H;  4DKA C;  3J81 j;  4LFC L;  1VQL A;  1E1T A;  2Q2I A;  2OQK A;  2VS1 A;  4L5Q A;  3UDF A;  4A3E H;  3CCL A;  5C0X J;  2JA6 G;  2K50 A;  1X54 A;  4P73 A;  3TRE A;  1IBL Q;  4RG1 A;  3S1M H;  2WP8 J;  4JYA Q;  1JJC B;  1P8L A;  5IT9 c;  4AH6 A;  2BA0 A;  3JAM i;  3I56 A;  1HR0 Q;  4JI4 L;  3M4O H;  2BH8 A;  1RL2 A;  3PO3 G;  2WB1 G;  4DV0 L;  2ID0 A;  4JI0 L;  3A74 A;  4JI7 L;  5C3E H;  1BVS A;  1YHA A;  2NZH A;  5BR8 L;  3RR5 A;  5GAE C;  4C2M H;  5M3M H;  1Z9F A;  5ELN A;  3A5U A;  4ALP A;  5LMN L;  1QZG A;  1AE2 A;  3HOU G;  3KF6 A;  3A0J A;  4A93 G;  3HOW G;  2F4V Q;  1XPR A;  1I94 L;  1EWI A;  1N34 L;  4POG A;  3S2H H;  1GD7 A;  2ZJQ A;  1JMC A;  1GM5 A;  2K5H A;  4O2D A;  4K0K Q;  4A3I G;  4GNX B;  3BJU A;  5M5W H;  1NJI C;  3M3Y H;  3S1Q H;  3CP0 A;  4C3I H;  1EQQ A;  3K81 C;  2R7Z G;  3HOZ H;  4OWW B;  1FJG Q;  3S24 A;  1PH5 A;  4B3M Q;  4A3D G;  1Y1V H;  2UXB L;  3W1B A;  1Y14 B;  1W2B A;  1K8G A;  4LF4 Q;  2OCE A;  4JI1 L;  3J7A 5;  4DR1 L;  3UE1 A;  1VS0 A;  3LGJ A;  4LUO A;  4BA2 I;  1C9O A;  4GKJ L;  4DV1 Q;  2XTI A;  4IOC A;  2QA4 A;  1XPO A;  2N49 A;  2PI2 A;  3HKZ E;  4DUY Q;  4A3F G;  1XMO Q;  4HJA A;  2BH2 A;  4R4C A;  1T9H A;  3BU2 A;  5AJ3 L;  3GD7 A;  1K8A C;  1WCM G;  5IP9 G;  4X65 L;  2YV5 A;  3PSI A;  4UP8 A;  4A3G G;  5IYC G;  3ZJY C;  2AWO A;  1PH3 A;  4YWK A;  1G6P A;  4IPC A;  3PGZ A;  2VW9 A;  4GS3 A;  1PYS B;  4DV6 Q;  1LYL A;  2VZA A;  3GTJ H;  1Y1W H;  1A63 A;  3CD6 A;  1U5K A;  4FDB A;  4OON A;  3RLN A;  4DV5 Q;  2ASB A;  4JBK A;  1Q1B A;  3FP9 A;  3CCJ A;  4C3J H;  3F8T A;  3TS0 A;  3GTQ H;  3GTP H;  3OW2 A;  1VQ4 A;  1VQ8 A;  2IY5 B;  3UE0 A;  1J5E Q;  3AYH B;  4R4I A;  3FKI H;  2ATW A;  1GO3 E;  2MFI A;  5IY0 A;  1JB7 A;  4DV4 L;  2UXC L;  1VQO A;  2R93 H;  4A3J H;  3KDF B;  2JA8 G;  5IYD G;  1VQH A;  1Q7Y C;  4LF5 Q;  5C44 G;  4DR7 L;  3TQY A;  1NMG A;  1K3R A;  4DR5 Q;  2K5V A;  1HNZ L;  3T1H Q;  2R92 G;  2JA7 H;  1Q12 A;  1WJJ A;  3J81 c;  2NVT H;  2NN6 I;  1JJG A;  3RZO H;  2EXD A;  3J7Z C;  1XNR Q;  4NXM L;  1KQS A;  2JK8 A;  3EN2 A;  3AFP A;  4EX5 A;  4KLK A;  3D0F A;  3ERS X;  4JBM A;  2K52 A;  3HKS A;  2JA5 H;  1EIY B;  5HY6 A;  3B6Y A;  4GLV B;  4IPH A;  2JEB I;  4IPG A;  5JEA J;  3PIO A;  1IBK Q;  4X62 L;  4LF7 L;  4BXX H;  4KHP L;  3STB C;  4OWX B;  5C4J H;  1HNX L;  4BBS G;  4JV5 Q;  1AH9 A;  1FVI A;  2KCT A;  3RN2 A;  2CQO A;  4OXP A;  3CCQ A;  1M90 C;  1K9M C;  4BY7 G;  4DR6 Q;  2B63 H;  4NB3 A;  1ASY A;  4LF6 Q;  2ZM6 L;  1C0A A;  4LUZ A;  5IWA L;  4X64 Q;  4DUZ L;  1CSQ A;  4YY3 L;  3CCV A;  3PF5 A;  2DUD A;  1KXL A;  3RLO A;  2RF4 A;  3SGI A;  1PH7 A;  2ZJP A;  2I0Q A;  2VUM H;  4LNQ A;  5C3E G;  2D62 A;  2WAQ G;  4YWL A;  3RN5 A;  2DGY A;  2XGT A;  2CKZ B;  1MJE A;  1VQD A;  4DR3 Q;  2GVA A;  4L5R C;  1B8A A;  2HIX A;  1X6O A;  4DV7 L;  3M4P A;  3OTO Q;  3GO5 A;  1BBU A;  3CW2 C;  5LMU Q;  1PH8 A;  4B3T L;  1VQN A;  2L15 A;  3CXC A;  4JI6 Q;  1PVO A;  3ULL A;  2Z6K A;  1M1K C;  4HIK A;  4OWT B;  2VQF Q;  1YIJ A;  2UU9 L;  4GOP A;  2Z0S A;  3OYY A;  1SRO A;  3H15 A;  2OWO A;  4B3S L;  4Y52 H;  1EQR A;  1AE3 A;  1P16 A;  2QGQ A;  1YVC A;  1J6Q A;  4OO1 G;  1N32 L;  3HOZ G;  4LFB L;  3IRB A;  5ELO A;  1N36 Q;  2KEN A;  1Y1V G;  1KD1 C;  2HHH L;  4B3R L;  1L1O B;  1TWF H;  4Y7N H;  3S17 H;  3H3V H;  1DGS A;  4GLX A;  4IJH A;  1KIX A;  4GLA C;  1X9N A;  1WOC A;  3HOV H;  2VQE Q;  4DV0 Q;  1HJP A;  4JI7 Q;  1NBW A;  1XTD A;  1K73 C;  2UUA Q;  1N33 Q;  5BR8 Q;  3U58 A;  2I5L X;  4IFD G;  1XNQ Q;  4DK6 C;  2JA9 A;  4JC0 A;  1UE1 A;  4R4T A;  3GTG H;  1JT8 A;  4GNX A;  4LF9 L;  4PMW A;  5LMN Q;  1LM0 A;  1SFO H;  1PH1 A;  1U0L A;  2ALY B;  4JI3 L;  3STB D;  1PA6 A;  1I94 Q;  2N8N A;  1RIP A;  3DLL A;  4IJL A;  3E0E A;  1SMX A;  5IP7 H;  1B7Y B;  1CKM A;  4JI5 L;  1WI5 A;  1CKO A;  4JG2 A;  4JOI A;  2UUB L;  3PUZ A;  1IL2 A;  2Y0S E;  1B70 B;  3I4M G;  3UDG A;  5FLX c;  4JI2 L;  4GKK L;  2WFW A;  3NBH B;  2JEA I;  2WB1 E;  1IBM L;  2UXB Q;  1SE8 A;  4A3C H;  3PO2 H;  3F1Z A;  1VQI A;  2LXK A;  4X66 L;  4JI1 Q;  4DR1 Q;  2OQ0 A;  3FKI G;  4PZ6 A;  4QJF A;  3M4Q A;  2R93 G;  1NMF A;  4A3J G;  2NVY H;  2UXD L;  4UY8 C;  4IO9 A;  2E5L Q;  1GKH A;  4DK3 C;  3E9I A;  5FLM H;  4DV3 L;  2JA7 G;  5AJ3 Q;  2IX1 A;  4O0A A;  4AIM A;  4X65 Q;  1W3S A;  1VQK A;  1MIU A;  4BY7 H;  2VL6 A;  3KJP A;  3K0X A;  2A8V A;  3RZD H;  4OX9 Q;  3CMA A;  4QGU A;  4A4I A;  4LF8 Q;  3GTO H;  1I5F A;  1VQA A;  4H02 A;  1QVG A;  1CKN B;  1S3O A;  4UP7 A;  3PO2 G;  3AFQ A;  2NZO A;  3PIP A;  1A8V A;  1R9T H;  4BXX G;  2AKW B;  4AYB G;  2KHI A;  4UPA A;  3J80 i;  1LUZ A;  3CC7 A;  2HQL A;  1VQ9 A;  4IOA A;  2YTY A;  1SR3 A;  4L5T A;  4MNO A;  1Q82 C;  2CWA A;  1V9P A;  1TWC H;  3K7U C;  1JJ2 A;  3CME A;  2UXC Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...