5CV9A

Crystal structure of staphylococcal nuclease variant delta+phs l36e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv9A00
2PW5A 1IHZA 4ME5A 3SXHA 4IZ8A 1EZ8A 3LX0A 3BDCA 5KGUA 3D4WA 2QDBA 3MXPA 4KHVA 5IGEA 1EY8A 1A3UA 1KDBA 2EXZA 4OL7A 2F0DA 2OEOA 4DF7A 2EYPA 5KYIA 5ISRA 3NQTA 3V2TA 4KJNA 1SYGA 4KTAA 4K2LA 4YIJA 2SNSA 4K6DA 4EVOA 5IGFA 4F8MA 5E3FA 1TQOA 4K5VA 3DHQA 2SNMA 4K5XA 5C6AA 2F3WA 5HURA 2EY5A 2F0OA 1SYBA 4ZUIA 3D4DA 5JAVA 1ENCA 1F2MA 2F0UA 1EY7A 3NK9A 3TP8A 5C4HA 5CV8A 4QF4A 5CV9A 2F0VA 4NP5A 1II3A 5E1FA 1KDAA 4WORA 5M9OA 2EY2A 4HTHA 4R8NA 3R3OA 5C4ZA 1SNPA 2KHSA 4F7XA 5CC4A 1EQVA 3U9OA 3SK8A 3BDLA 3D8GA 1JOQA 1A3TA 4MIUA 3T13A 4DU9A 4G57A 5CV6A 4PNYA 5K5PA 4RKBA 2PZWA 2OXPA 1NSNS 4WRDA 5DAUA 4KD4A 2PZUA 4EQPA 5C3XA 4KV6A 3NXWA 3C1EA 3NP8A 5KEEA 2RBMA 1EZ6A 5EGTA 4NMZA 3SK4A 1JOOA 3PMFA 1KAAA 1JORA 2O4XA 1SYEA 3H6MA 4B9XA 3TP5A 4PMCA 2F0MA 4TRDA 1A2UA 3QOJA 3SR1A 5KIXA 3RUZA 1KABA 3MZ5A 1SNMA 3HZXA 4N9TA 5J39A 2HQEA 5DEHA 1EYAA 1SYDA 1STAA 3C1FA 3T16A 5HGTA 5I6YA 1A2TA 3TP7A 2EYMA 3D6CA 5I9OA 4B9WA 1A3VA 5JOBA 4EQOA 4DGZA 5KYLA 1F2YA 5CV4A 2F0EA 1STNA 5IGCA 4K8JA 3OSOA 2OF1A 4RKLA 5F2DA 5J22A 1AEXA 4KY5A 1EY0A 5IODA 4QB4A 2F0PA 2F0QA 2SOBA 4K14A 1EYCA 1TR5A 2EYJA 5IIFA 2RDFA 3SK5A 3NHHA 4KD3A 5IGGA 5CGKA 2F0FA 4K2KA 1JOKA 3TP6A 2F3VA 3EVQA 4H7BA 4HMJA 3DMUA 5CR3A 1ENAA 1SYFA 4HMIA 4KJOA 5I6WA 3SK6A 1STYA 3TMEA 4KY6A 4QMGA 5I9PA 5IGBA 3MVVA 3HEJA 2F0HA 2EYOA 3QOLA 4LAAA 4DFAA 4I65A 1STHA 2F0KA 2KQ3A 1SNOA 2F0JA 1EY4A 3P75A 4PMBA 5C3WA 5IGDA 5CV7A 1STBA 3S9WA 2RKSA 4K8IA 4IALA 4S3SA 2F0GA 3ERQA 2LKVA 3OMGA 3OMCA 5J1ZA 2F0WA 3EJIA 5NUCA 1EY6A 1EY9A 2F0SA 4J6HA 4J1MA 3QB3A 1SNCA 1F2ZA 1STGA 1SYCA 4K5WA 5C5MA 2EY6A 4ZUJA 5IOCA 2PZTA 2EYHA 2PYKA 1RKNA 2ENBA 2M00A 3NUCA 3ITPA 3MEHA 3OWFA 1U9RA 3P1HA 1NUCA 4E6IA 4EQNA 1KDCA 1TT2A 2F0IA 2NUCA 4NDXA 2F0LA 3EROA 4IUNA 3MHBA 4N9PA 1SNDA 2F0NA 4NKLA 5KRUA 1EY5A 4KY7A 4ZQ3A 3E5SA 5EKLA 5C5LA 1SNQA 2EY1A 2EYFA 2EYLA 3VA5A 2PW7A 4ODGA 2F0TA 2PQEA 4ID6A 5EKKA 2WACA 1EYDA 5CV5A 3SHLA
chains in the Genus database with same CATH superfamily
3HOUB 5ISRA 4IZ8A 5I2YA 3HKZB 1EY8A 1FNVA 1MSHA 3AQQA 1NE3A 3VYTA 1CKNA 2EYPA 3AFPA 2G9HD 3V2TA 4QJFA 1TS3A 4K5XA 2KVMA 5C44B 2N8NA 4HSPA 1SLJA 4DA2A 3TZUA 4EGVA 3QO2A 1ENCA 3A55A 3VR6A 2K5DA 2N49A 4BBRH 2C5CA 2E2JB 3H0GB 2BCOA 3GQBA 1YEZA 1PRTD 3J7YW 1PRTB 1OO9B 1O78A 3J81L 1VQ4A 5C4ZA 2E8GA 1TVXA 2CQOA 3TS0A 3ND8A 3FPUB 4G57A 3W3AA 3F8TA 4QCLA 1WTQA 4UDUC 2PZWA 3KJPA 1ONLA 3HRZC 1CKOA 4DUYQ 4DR3Q 1U5KA 2HQLA 5D14A 3HFZB 1GUSA 4DAYA 3TP5A 2JXMB 4TRDA 2UXCQ 3STBC 5J39A 1S3OA 2B2WC 3KYHC 1JJGA 5I9OA 1AE2A 4DGZA 2VB3X 2YU9B 3AFQA 5EBCA 2AKWB 5GADC 3CCVA 1G8ZD 2JP1A 1SE4A 3RMHA 1J5EL 2IY5B 4Q5VA 2PI2A 4BBRG 4P71A 4UY8C 2ALYB 1SYFA 3S17B 3SK6A 1STYA 1LYLA 3LWUA 3A7LA 2RVLA 3MVVA 1ZYRC 1YI2A 3P20A 3OW7A 1HNWQ 1D5XC 2J7ZA 1SJED 2I5LX 3L2PA 4GNXC 1JB7A 3A7AB 1W6KA 4A3JB 1HCZA 3J81i 3PO2H 1EY9A 2CQAA 5C5MA 1C0AA 3BZKA 3GD7A 1CA5A 3K81C 1A0IA 4LFAL 4XIGS 1L0YB 4N9PA 1XYIA 1ZKOA 4YCVA 1IL8A 2A74C 2NVQH 4JI8L 3CCUA 3J7AF 4IURA 1X56A 4JCVE 4O1NA 3J81j 3M85A 4WJ4A 3BDCA 1JMCA 4KHVA 1L0WA 5LMUQ 1BBXC 4ZRZA 2OEOA 2VZAA 3K5OA 4LFBQ 1GUNA 4KJNA 4LFCL 4X3SA 1NR4A 3PIPA 2KECA 2F3WA 1OXVA 3F2BA 1YHBA 3JAME 1K8AC 1WCMB 2ZXRA 2UXDL 4IFDH 4HAEA 1WJJA 3HOYH 1JCKB 5M5YB 3MXGA 3SE0A 2PI2E 4FF4A 3GTQH 1VQGA 1VQHA 4NXMQ 3RN5A 2NVYB 3HKZE 4F7XA 4WJWA 5CC4A 2HT1A 3BDLA 5IWAQ 3I70A 4ZLTF 3PO2G 1I4HA 3S1NB 3I55A 1U0LA 1S5BD 4C3IH 3C1EA 2CKZB 1O7LA 3TREA 5EGTA 3VR3A 1VQOA 1LTAD 2P5ZX 1JE5A 2B8FA 3J80c 1VQIA 2CHBD 1YNJC 5ELNA 3S1RH 5JVG3 4FF1A 1S5DD 4OWWB 4DV4Q 4EQOA 3M7GA 3K0YA 4C3HB 2A8VA 3PO3H 3RR5A 2E2DC 1D1IA 1WTPA 5ELOA 1AEXA 4LMQD 5L37A 3OYYA 3S24A 3NBHA 2SOBA 2C35B 4K14A 3U50C 2QF7A 5IIFA 3S15B 2AUKA 2I0QA 3HOYG 1AZQA 3RLFA 1HUMA 4A3DH 2R7FA 2ICEC 3S16H 4KY6A 1DXMA 2FHTA 3DWAA 1BCPC 1YVCA 3NTKA 2OTLA 4LF8Q 5IE8A 4A3LH 1X3QA 3S9WA 1SFOB 2B2VA 3GTGB 2CCZA 4C3IG 2F0SA 2BA0A 2NZOA 2K03A 1MGSA 1R4PB 5D65A 1QB5D 2HDLA 3T1HL 1LT5D 1V1OA 1DCZA 1KXLA 5JJLA 5M5XB 2K28A 4LF5Q 3NTIA 3H3VC 2PQEA 1KNAA 1EYDA 2D0OA 1V8QA 1EIHA 3UDGA 1B53A 1UNSA 4QUCA 1XMQQ 3BVMA 4CBVA 1E22A 1QG7A 4DF7A 3R2TA 3C3LA 1TWAB 1LTTD 4GN3B 3GV6A 3X3NA 1Y1WB 1I94L 1BNZA 5JAVA 4A3DG 1Y8NB 3CW2C 4RHSA 1PH9A 5CV9A 5CBAE 2B29A 1X55A 2A1AA 1B9NA 3QG1A 1N33Q 4X65Q 4A3LG 3TBIB 2KHJA 4LWCA 1DM0B 1UE6A 4U68A 1VF5C 4QQBX 1XTDA 3LWEA 5ELEA 5FO9B 5AJ3Q 4NXNQ 5I2XA 1EOTA 1E7ZA 2GVAA 4A3FH 5C3XA 2L0CA 3A74A 3RN2A 4R8IA 5IT9E 3HOWH 1VQ6A 1LLRD 3H6MA 4GKKQ 1VCIA 2LMCB 2ID0A 4NPSA 4O0AA 4DN4M 1UE7A 1HR0W 3GTKB 1PHJA 3BG3A 1STAA 1VQ8A 2DUDA 3W5OA 2PNRC 5BR8Q 4HJ7A 1LABA 4HJ5A 1JWSD 4DV6Q 1EL0A 4K8JA 2OF1A 1EIYB 4JBMA 4GOPB 1C48A 4U673 2F0QA 4DUYL 4DR3L 1K3RA 4Y7NB 1M90C 1Y1VB 5CGKA 1PTOF 2WKCA 2PQAA 1K8MA 3J7ZC 1HFNA 5CR3A 4KJOA 4LF7Q 2UXCL 1AW7A 1V9PA 2G5DA 3J80L 3HEJA 3GDEA 2F0HA 1I3QB 3K80C 5I4DA 1SEBD 2GA4B 5CV7A 1K8OA 1PMRA 4JPBW 1SMXA 4A3EH 3ULJA 2XWJB 4UP8A 3GO5A 4A3FG 4BBSH 4FO2A 4RGTA 2OQKA 1EWIA 4AH6A 3HOWG 3GTJH 2YTVA 2ENBA 2UUCQ 4L5TA 1IW7C 2F0IA 3K5MA 5FLXE 5LMNW 5EKLA 1TY2A 3VYSA 5EKKA 4CJ1B 3HOXG 2XVSA 3CMEA 1VQKA 1HNWL 1YJWA 4XDXA 1EWCA 1A3UA 1GUTA 3IRBA 1PFNA 1TS2A 1RF2D 2L15A 4P74A 2RHSB 2ZTDA 4M8AA 5LHY1 1PFMA 2NVXB 1SSOA 1RHPA 1PH8A 1HR0Q 3D4DA 1R9TB 3B6YA 2QILA 1EU3A 4UP9A 1EQQA 4RGNA 4DR7Q 3RLNA 1LO5D 4GZYC 2PMZB 1EEFD 5LMUL 4RGOS 5FK9C 3G6EA 4A3EG 2K1BA 4LFBL 1V1PA 1Y8PB 3D8GA 3J7AV 4BBSG 1BUVT 1H9MA 1TXYA 4DV0Q 1DOMA 4RGMA 4L8JA 4DR2Q 5LL6X 1B3QA 4YWLA 3A5UA 3U9SA 2DN8A 1B4OA 4LK1C 2Q2HA 1BCPF 4X62Q 4FXGC 4NXML 2BH2A 1EFID 3Q6SA 3T16A 3HGBA 2EYMA 3A8IE 3ONAB 5JPNC 3V96A 1JE4A 5IWAL 4FXKC 4A3KB 4ZKBB 1EY0A 4QB4A 3G4SA 4DK0A 1EYCA 3NHHA 5LMNQ 3OOCA 2F0FA 2I5HA 4J8QA 5G3LF 2NVTH 1K83H 3Q23A 2CH4A 3I4NH 1MBYA 4JI7Q 1ENFA 4IUQA 1YNNC 4DV4L 3EFXD 2Y0SG 4MHEA 5HY6A 4PQXA 3HOUH 5M3MB 1UE5A 2F0WA 1XTCD 2WINB 2YYZA 5EJWA 2ZM6Q 3AB9A 2CWPA 2KOLA 4N8X1 2HCCA 1BVSA 1FR3A 1K28A 4IJHA 1ET6A 2PO4A 2F0LA 5ELFA 2KCNA 5J3BA 1OTCA 4X3TA 2EY1A 4HIKA 4C3JB 2AQ1B 1SE8A 4OEMB 2E2JH 1PH2A 5CV5A 4LF8L 1VQNA 1FNWA 1FNUA 3F2DA 3IFTA 3K0XA 3D4WA 1O7IA 4DV5Q 1KDBA 1NNXA 1XX8A 4H0LC 5FKAC 1CI3M 1FL0A 1Y8OB 3DEPA 1DOLA 2NWGA 3NSWA 3PF5A 2Q2UA 3I4NG 1FJGL 1LTSD 3OW2A 4POGA 1MIUA 2TMPA 4LF5L 2RHQB 5EAYA 1KDAA 1NMFA 2EY2A 2QEJC 3N52A 4GN5A 1XMQL 3HOUG 2KHSA 5M5WH 2XN9C 1CSQA 4LW1A 2YU9H 2MO0A 2N78A 3MC0B 5CORA 2JA7B 2VQEQ 2GVBA 1NMGA 1P16A 3VR4A 1KAAA 4B3RQ 1Y69U 2E2IH 3QR8A 1WTHA 2WV6D 5CYUA 4A4IA 1N33L 1E1OA 2PMZE 4X65L 4RCNA 3CCQA 2KENA 1OXTA 3CCRA 1I5FA 1Q3LA 1H9RA 1MJCA 5DM73 1LTLA 1QVCA 2RA4A 5AJ3L 4NXNL 2I46A 2A6HD 4AYBG 1PTOD 1PTOB 2Z1CA 3BJUA 4OONA 4ALPA 5JJKA 4GKKL 3Q8DA 1H9JA 3W2DA 2R7ZH 4IOCA 4KK7A 3I4MB 4A3GB 4PMWA 3CD6A 4X3UA 2BE5C 4QMGA 5IGBA 3TQYA 1K3BC 4L5SA 3JAMc 4ZYSA 2BOSA 5CMDA 5BR8L 1IYVA 4JI3Q 2RKSA 2WB1G 4DV6L 1SMYD 4IALA 3OMGA 1TWHB 2IL8A 1EY6A 4XT3B 4QGUA 2QDLA 5FLMH 1ET9A 3TEHB 3GTLH 3CC7A 3MEHA 4E6IA 4RAUC 4NKLA 4LF7L 3CHBD 5KRUA 4KY7A 1WCMH 5IY0A 2N3SA 3KBGA 4X64Q 5M5YH 3WDNA 1TU2B 2ICIA 2OQ0A 1WTXA 1PH4A 1Z6HA 3M4PA 1JR0D 2EXZA 2JA5H 3PCOB 3VA7A 5C4JB 3S1NH 2UUCL 1H9KA 4YWKA 2R7ZG 3KF8B 4GNXA 1SYBA 4A3MB 2L4NA 1ESFA 4A3BB 3KFUA 5FJ8H 4A3IB 1Q8IA 2A69D 2NZHA 3I3CA 1LTGD 4H13C 4RG1A 1W2BA 3R3OA 1VQ5A 1G6ZA 2BA1A 5IYDH 5EQ0A 1JOQA 4CJ0B 1TWFH 3WOEA 2J4XA 2O2LD 4H44C 5FLMG 4KV6A 1HR0L 1WOCA 1E3PA 3G48A 1H9SA 1CTMA 4Q0FA 4B9XA 3S15H 4JI6Q 1WCMG 4MNOA 4DR7L 2YTYA 3RZDH 1B2TA 1PYBA 4HJAA 1NR2A 2HHHQ 2IX3A 3UDXA 1IBKQ 2JQOA 2JA5G 1VF7A 5KYLA 2MO1A 4FP5D 1LTID 3EIVA 1PA6A 3GTMH 1M4VA 4DV0L 5LL6S 1SFOH 4DR2L 5G3LD 3GTGH 1PDQA 1U4MA 2RDFA 3SK5A 4KD3A 3K57A 4RCOA 1C7YA 5FJ8G 3G71A 2GN5A 4X62L 4Z9CB 2VUMB 1D7QA 4OXPA 1PH6A 4C1NK 3KF6A 4A93B 3MFGA 1KQSA 5IYDG 1SNOA 1YJ9A 3UE0A 5IGDA 1SE2A 4YCUA 2RCFA 3HOVB 4K8IA 2K5VA 1B7YB 1NTGA 3ERQA 4DK6C 2Q2TA 2HD3A 2AUJD 2K4KA 1TWAH 2EY6A 2JA6B 5LMNL 3M9BA 2EYHA 1WTVA 2CWAA 2AHOB 1QVGA 1AP0A 4NDXA 3K6OA 3FDTA 3C46A 2F0NA 4JI7L 4IFDI 1OXSC 5C5LA 3KJOA 1JJCB 4ODGA 5IT9c 2EPBA 2KCCA 1PH1A 4OX9Q 3KBXA 3MXPA 2VY3A 1G291 3CU7A 3K7UC 4DK3C 2Z0SA 3FPPA 3JAML 2F0DA 2NTSA 3FVQA 4LUZA 1EWHA 2ZM6L 2D62A 2SNMA 3SVMA 4P75A 4N8FA 2D0PA 2Z6KC 3CPFA 3NBHB 3GTKH 1LUZA 2IX0A 4L5QA 2FFKB 2A6ED 4DV5L 1CZWA 5M3FB 4CHTB 2R93B 2L12A 2HIVA 1MSGA 4X6AH 3BYYB 2NYZD 2OXPA 1NSNS 2K5HA 1Q1BA 3NP8A 1YJNA 4NMZA 5FO7B 1PZJD 4DV1Q 2PPBC 5C4XH 1L2FA 4Y7NH 1WVLA 3VYUA 3W1GA 4I7ZC 1KABA 2V1CC 1IKMA 2ZTCA 4POFA 5H1SE 3TP7A 2L5TA 4IPCA 1A3VA 3CQZB 1F2YA 5FLXc 3G6JB 4F87A 4YHHQ 4JI2Q 4CKCA 1SE3A 4KY5A 1D1KA 2VQEL 1H95A 1S5FD 3JAMi 5HGQA 1X3GA 4B3RL 4UAIA 2F3VA 2MUYA 2OTJA 3CCLA 3WOFA 2K6AA 1YHAA 3HKSA 5I6WA 2Q2IA 2ZTEA 3FRPB 4NW2A 2MGSA 4R4TA 2JJQA 1F9QA 4AIMA 4JBJA 3FEWX 2B2UC 1VQDA 5JPMC 2K05A 3BVZA 1JICA 2EQSA 2LKVA 1GXDC 2AQ2B 4J1MA 3KLSX 4ZUJA 3M7NA 5C4XG 2PZTA 1BXTA 3SDZA 2F4VQ 1B9MA 3H09A 5D3IB 3S2DH 1ASYA 4IFDG 3P7JA 2NVXH 4YCWA 2RCNA 1EY5A 5KIXA 2X6GA 4LF4Q 2VS1A 3OHXC 2WAQE 3PUWA 3V05A 5IGGA 3CCJA 3NENA 3U58A 1NJIC 3SXHA 4JI3L 3LX0A 1I6VC 1HJPA 2VXWA 5IGEA 2EDGA 3QWNA 5KYIA 4CDFC 3DUZA 3A54A 3IAYA 2SNSA 5C3EH 1VMCA 3NWSA 1S5CD 4DAVA 3ER0A 2F0OA 4OIKA 4R4IA 3NK9A 1IBLQ 1SAPA 1FJGQ 3M3YB 2IW3A 4X64L 3L0OA 2KEEA 4IPHA 5JVH3 3NE5B 1NY4A 4P2CB 1HQRD 2D2CC 1U4PA 3WWVA 2NBFA 3PO3G 1DOKA 1F9SA 1PRTC 5IT9L 3T13A 3K7AH 4KLKA 1QCBD 5DNFA 3KDFB 3LNNA 4DV2Q 1JB3A 4GKJQ 3ICEA 2KCMA 2L9HA 4RMFA 5E4XA 1QE6A 1GD7A 2WFWA 3EA6A 1YBYA 4R9WA 4X3KA 2D5DA 2F0MA 3OTOQ 3I4OA 1RIPA 1V43A 1KL9A 5GAEC 1KD1C 2RQXA 1P8LA 3CC2A 2F1MA 1STNA 1U4LA 1YHQA 3OSOA 1KTKA 1XNRQ 5M3MH 5C3EG 1GHKA 4JV5Q 1MKHA 2Z4HA 2EYJA 2O5JC 2VQFQ 4JI6L 4IN3A 4HN7A 1KNEA 4JBWA 1ENAA 1HA5A 4B3SQ 3TMEA 4EQ5A 2HHHL 1KLUD 1LTBD 3FHWA 1IBKL 3S1QB 4C3JH 2JE6I 4R1JA 4DR4Q 3M4OH 2RDGA 1HA6A 3NELA 4IUPA 5FO8B 3OMCA 4IJLA 5FLXL 1VQPA 4V0BA 2UU9Q 1UAPA 4V190 3TSSA 4EQNA 4OO1I 3EROA 4JK1C 5EPJA 1SNDA 1Q12A 1HRJA 1A63A 4HR7B 3VA5A 1KIXA 4ID6A 1F77A 3BS1A 1XPUA 1BO0A 1EZ8A 3L7ZC 4YY3Q 1ESRA 4GLAC 1AZPA 5KNDA 2JK8A 4EVOA 3FP9A 5BN5A 4OGQC 3DEOA 1TS4A 2J0TD 3HOYB 2JA7H 2Z9HA 1RODA 4OIJA 5E4WC 5C4HA 1SROA 2F0VA 3PIP3 2Q8RE 4NP5A 4ILWA 4L5RC 4C3JG 2A68D 2B2YC 1LM0A 4OX9L 5D3DA 1EUJA 4JI4Q 1I4XA 4C3IB 1YZ6A 4ZKCB 2BH8A 2A73B 1O80A 3J7A5 3I8ZA 4OO1H 3S1RB 2EOTA 1GM5A 4B3TQ 1XPOA 3RZOB 4A76A 3BDOA 2PNHA 2Z8LA 2DNCA 3SEBA 1IKLA 4LF9Q 1PLFA 2LY7A 2Q8TA 3BU2A 4HCEA 4JVZA 2AMCB 1T9HA 5GAGC 2UXBQ 4FDBA 3J80E 1TWGH 3AU7A 1L1OB 3G7LA 2NN6I 5AFWA 4G7OC 1X3PA 1TWHH 4DV1L 5BN4A 2FJ2A 3TDQA 3NPPA 4FVMA 1K8GA 3K5NA 1RTNA 4A3CH 1HHVA 3RD4A 4PMBA 2WP8J 2E2HB 1XMOQ 4YHHL 4JI2L 4LF6Q 2F0GA 2ZJRA 3I4LA 1N9WA 1IZ6A 1KHIA 3EBEA 2H4OA 3A8JE 4LUOA 2MNAA 3D3RA 1YIJA 1TS5A 2F52A 1UE1A 5C0XI 4G7HC 5C4JH 1RKNA 4OO1G 4XQJA 1QNUA 1E1TA 4UPAA 2HIXA 1CUKA 2IHFA 4ME3A 2MHVA 2F0TA 3T4AC 2WACA 1A15A 1IXRA 1MD2D 1PRTF 1ASZA 1A8VA 4JI0Q 2NN6H 4L6TB 1VQBA 2M2LA 3KLSA 4F8MA 3CCSA 2B3GA 2F4VL 1JC7A 3M4YA 2MP1A 4ZUIA 3F1ZA 3A5ZB 2Z4IA 4CDEC 5C44H 1EEID 3HOZB 1N8RC 2X6LA 3CCMA 3TP8A 1EIGA 4LF4L 4P72A 4A3CG 4DV3Q 1VQ9A 1II3A 2UUBQ 4WORA 1X65A 4XXEA 1XXGA 3S2HB 3E0JA 1D5MC 3H0GH 1AFPA 5A2QE 2OT2A 3PUYA 1BBWA 3U9OA 1BBUA 1HH2P 3SK8A 2K32A 2NTTA 5CV6A 5EBDA 3GTOB 1O7ZA 1E0BA 3FKIB 3DLLA 5C0XH 2RF4A 3NXWA 1EZ6A 3MWYW 3STBD 4KN7C 3BZDB 3L9AX 5FOBB 1IBLL 4MTKA 2XGTA 4O2DA 4RHRA 3SGIA 3QOJA 3HOXB 2IJ0A 2XRQD 1SNMA 4CDDC 5DEHA 2EZVA 5HGTA 3S14B 2VUMH 1UUPA 4B9WA 3IKJA 1I4QA 3S1MB 5CV4A 1CM9A 2EJFC 2R3ZA 2NN6G 5BN3A 3PF4A 3HKZG 5IGCA 1J9OA 4DV2L 3MXNA 3CMAA 4KKTA 4GKJL 1HNXQ 1VQAA 4GOPC 5C44G 2B39A 4JOIC 4KN4C 2JA6H 3OTOL 3ZJYC 1ZYRD 4DNIA 3AMUA 1VDZA 1M1KC 3E6ZX 4G4KA 4BY1B 4BY7B 4FF3A 1CT1D 4PZ6A 4IOAA 3S17H 2JN4A 3H0GG 3K59A 1E2VA 2HCIA 3NWTA 4A3EB 4BBSB 1MHWC 1XNRL 4DKAC 1X9NA 4JYAQ 2FMMA 4AQYQ 4JV5L 3EJIA 3GTJB 4JBKA 1JJ2A 5C0XG 1B8AA 3QB3A 4A3JH 3KUPA 1PXUA 2VQFL 4P73A 2CFMA 1U9RA 2R6GA 1B70B 1KDCA 1TT2A 1CQFA 2K01A 4IUNA 5DM63 4B3SL 1CKNB 1X54A 2XNAC 3E5SA 4PG3A 3PUVA 2EYLA 3VYRA 1GUOA 4HEDA 3DXJC 3BYTB 4QUFA 4DR4L 1IHZA 4HIMA 1H9SB 2DGYA 5JEAH 1LACA 2MPMA 5T1IA 3E9HA 3CAMA 2NB0A 1VQCA 3I73A 3OIQA 1Q7YC 3UDIA 4K2LA 2R93H 2UU9L 4C2MB 3UE1A 2IX1A 1DJRD 1J6QA 2I07B 4OWTB 5HURA 1HNZQ 2JA6G 2EY5A 4F88A 2X69A 2DY8A 1QUQA 1VMPA 3K58A 3ULPA 3OIPA 1LTRD 4FF2A 1CSPA 3T1YQ 4XYQA 4KHPQ 2R92B 2R7DA 5JJZA 4YY3L 1I4PA 1ML0D 1EQVA 4DAYB 4EX5A 4XYOA 1N34Q 2JEAI 3CQZH 2NVYH 5K36H 3E3XA 3T51B 1I4GA 3KF6B 1SN8A 4A3JG 4HJ9A 1VQ7A 1T5XD 2PZUA 2RSOA 5JJIA 1VQEA 2LSSA 2MJ8A 1LT4D 4ABNA 5KEEA 1YNJD 3H94A 1TKWB 1Z47A 2K04A 2V4DA 4DV7Q 3CC4A 3MZ5A 1G91A 3MAQA 1E2WA 3C1FA 1NCVA 5JEAG 4BS9A 5JOBA 2Z6KA 2D9UA 2QKIC 4JI4L 1LT6D 1YITA 1X3EA 4HJ8A 4KKUA 3D0FA 4BWGB 4RKLA 2R93G 4C3HH 3E0EA 1KRSA 2F0PA 4IQZA 1VQMA 2NVTB 1K83B 1SBBB 1UWVA 4ZCKA 3I4NB 3A0JA 4B3TL 3EQLC 4IUVA 4LUVA 1BCPD 1BCPB 4ZAIA 1L0XB 1M8AA 3URYA 2B63B 4IFDJ 2Q8IB 4LF9L 1IYJB 5A35A 1AH9A 4DAMA 1Q8KA 4JG2A 4K6LA 4LAAA 4DFAA 3IL8A 5KNCA 1DD2A 1ICWA 2UXBL 1D5ZC 1STBA 2DNEA 5K36G 3ERSX 2UUAQ 1CKMA 1B50A 3VR5A 4R4OA 1QVFA 4GN4B 1TWCB 1G51A 1PZKD 3PV0A 4PMCA 3W1BA 4CKEA 4XQNA 2EYFA 2CW0C 4JI1Q 1S40A 1K73C 5M5XH 3M3YH 3DWQA 2WAQB 3BZCA 2JEBI 1XMOL 2E5LQ 1N36Q 1F9RA 2YV5A 4LF6L 4O42A 1S4ZA 3L3OC 1CZGA 4C3HG 1SXTA 1WTOA 4AYBB 1SYGA 5IGFA 3PIO3 5E3FA 1TQOA 3DHQA 2B2UA 4OWXB 5COYA 2N88A 1A62A 1AE3A 1KAWA 1RL2A 5E7NA 5CV8A 3Q24A 1Y1WH 3I56A 4R4CA 1QZHA 5M5WB 2JA8B 1RDPD 3I91A 1QNKA 4KMUC 3KF8A 2WB1B 1EIFA 1K9MC 4GS3A 1F2LA 4JI0L 1HPCA 3ND9A 1A3TA 3U4VA 1I6HB 5GQOA 2OCEA 3J81E 2K5QA 4KD4A 1QZGA 3KLWA 2E2IB 1HZBA 2HDMA 1EQTA 4NB3A 4FXDA 3T56B 4DR5Q 2JYOA 4DV3L 4R4QA 1LT3D 2UUBL 3RUZA 3A56A 2Y0SE 3TN2A 2HQEA 2CH4W 2B2TA 1A2TA 1CHQD 3D6CA 3S1QH 1QILA 1EOVA 2F0EA 3A8KE 1GUGA 2NZ1D 5J22A 1Q82C 3GTPB 2R7ZB 1HUNA 2BDNA 4JW0A 3DM3A 2A6HC 4QL5A 4HMJA 1PTOC 2FMCA 1Y1VH 1Y1WG 2F03A 4WJ3M 1EQRA 3CRLC 1I50B 3TS2A 4OHJA 2F0KA 2KQ3A 1QOHA 3P75A 2HUGA 1I3QH 4CJ2C 2ATWA 4CKBA 4B08A 1UEBA 4TSSA 5J1ZA 1HNXL 5GAHC 1G2SA 3GTLB 1IW7D 4DXFA 1B44D 4DAPA 3K5LA 4K5WA 1G2TA 1DYQA 1SMYC 4H02A 3HG9A 5IOCA 2VW9A 1ILPA 2ZJQA 1WTRA 3ITPA 2AWNA 4CDCC 2NUCA 1EU4A 4IPDA 3F2UA 4UHVA 1GVPA 4ULLA 1JWUD 2PW5A 1FVIA 2JA5B 4ME5A 1C8CA 1GOZA 4B3MQ 4L63B 3GV3A 4JYAL 4AQYL 3TZDA 3E9IA 4KTAA 4YIJA 2IWHA 1PFBA 3H91A 1DONA 2LXKA 1STEA 1PFSA 1Y1VG 4LJZC 1F2MA 1EY7A 2MFIA 1R9TH 3RZOH 3NTHA 4R8NA 4ZK9B 4QIWB 1HTPA 2QW7A 1MJEA 1TWFB 4XTCS 2A69C 1RCVD 3CP0A 4MIUA 4AYBE 1XNQQ 1YNXA 2IT1A 4PNYA 4UP7A 1FYCA 1N32Q 4WRDA 5DAUA 5GROA 1HNZL 4LNQA 4APVA 4BBRB 2K75A 3MFYA 3RZDB 4DR1Q 1TY0A 2B2TC 1VQFA 1GO3E 2L55A 2G9DA 5EKIA 3T1YL 1S5ED 5EPKA 2OWOA 4KHPL 1X3FA 1CA6A 4DUZQ 2KA7A 5I6YA 2WB1E 3GTMB 1HXYD 1DZ1A 1S72A 2WKDA 1XJVA 1N34L 1ZEQX 2I5MX 2PQAB 4RFBA 1LV9A 3OPOA 2E2HH 2B2YA 4WFN3 5TSSA 1CFMA 1HFGA 1K0SA 4A3KH 4KHZA 4PV1C 3R2IA 1JOKA 4DV7L 1YNND 2KHIA 4HMIA 4GLVB 3EN2A 4DXGA 2R61A 2EYOA 3CPWA 3AEVA 1FGUA 4YWMA 5C3WA 3KK7A 2K50A 2CVRA 3U4ZA 3DM1A 4J6HA 3RLOA 2SEBD 4RKBA 2PYKA 2M00A 3PSIA 3OWFA 2B8GA 4BA1I 5IP9H 3HOZH 3TRZA 2TSSA 2ZT9C 3MXUA 2PW7A 1Z9FA 1SJHD 2EJMA 3NQIA 2QEXA 3SHLA 1WD0A 2K7VA 3S2HH 3CF5A 2JA9A 1IBMQ 4OL7A 4MZ9A 2UUAL 3PO2B 3X3MA 3PGZA 4TQUS 4A3KG 1PH7A 1GJXA 4K0KQ 4K5VA 5C6AA 1X6OA 5IP7H 3GTOH 2LXJA 1PYWD 3FKIH 3I90A 4XT1B 1NBWA 2H1EA 4KKSA 1V1PB 1UEAB 2NVQB 3NEMA 4HSVA 4JI1L 1VQJA 3D4RA 4RH6A 3I72A 5M9OA 3HOXH 2K33A 2ZJPA 2E5LL 1OXXK 1ILQA 1FD7D 1N36L 3S14H 4DPGA 1B1ZA 4DU9A 1HQMC 5M3MG 3S1MH 2A6EC 1JT8A 2L11A 4X66Q 1Q1EA 5C4XB 4DR6Q 1MI2A 2K5NA 1GHJA 4HIDA 4JI5Q 3PMFA 1JORA 5IP9G 2O4XA 4HCSA 3HOZG 3I7FA 3FMCA 2F4IA 3GTQB 2BDOA 3KDFA 3HZXA 4BY1H 1ICFB 2B2VC 4BY7H 2E74C 4QIWE 2VL6A 3F2CA 2KEDA 3CXCA 4JC0A 3M4QA 2XSCA 4BA2I 2IPKD 3HP3A 4HIOA 4GLXA 1D8LA 2K5WA 4QY7A 5IYCH 1IYUA 2ZXPA 5IP7G 1HZCA 3FKIG 1RJTA 1TR5A 2H5XA 1Q90A 2BE5D 4DR5L 4K2KA 5C0XJ 3TP6A 3MTSA 4H7BA 1PTOH 1PH5A 3DMUA 5EPLA 1U4RA 1VS0A 3ZYYX 3I4MH 1XPRA 3CKIB 4A3GH 2Z6BA 4I65A 3PO3B 2XWBB 3OWEB 4MN3A 2WIIB 3JC66 2XRSD 5NUCA 3S2DB 1SNCA 1STGA 1SR3A 1SYCA 1PH3A 4DNTB 2JA7G 2IHEA 3NUCA 3SK4A 4C2MH 2VNUD 4A3DB 3PQIA 2AWOA 3S16B 3MHBA 1TIID 3UDFA 4BY1G 4BY7G 4GOPA 4OELB 4JOIA 2XIWA 5IYBH 1WFQA 5ELBA 4XQQA 2R92H 2AQ3B 3I2ZA 5IYCG 3J80i 2DY7A 5C3EB 3N6RA 2EJGC 1KRTA 3VR2A 4K6DA 1T5EA 3UI2A 1W3SA 1IL2A 1HZAA 1Q46A 1O7YA 1NAPA 5A2QL 3R93A 1RTOA 4CGYB 3MXNB 3Q22A 4QF4A 4IO9A 3H3VI 4A3MH 1JWMD 3CRKC 3I4MG 4A3GG 4A3BH 1X32A 1D2BA 2FINB 2QCPX 4KI0A 4HTHA 4B3ML 2EE1A 3K7AB 4A3IH 1SNPA 5JEAJ 2YTXA 5DLQE 3MEFA 4J15A 4I7AA 4TKOB 2PCFB 1J5EQ 3BVGA 1RD9D 2RBMA 1GKHA 1QJOA 3ULLA 1JOOA 1PV4A 4C56C 2KJXA 1CQVA 4M1UB 1KC8C 4N9TA 5IYBG 2A5HA 3PUZA 2ZXOA 2LFNA 2B63H 2R92G 2K52A 1Y14B 3KLRA 5KNBA 1B3AA 2O5IC 1K0RA 1XNQL 4A3FB 3O13A 1N32L 2A19A 5IODA 3HOWB 1F9PA 2EIFA 2N55A 4DR1L 2CW0D 1TWCH 1WYDA 3RNUA 4LFAQ 4A3MG 3H3VH 4A3BG 1BF4A 1L1OA 4RWSC 4DUZL 5I9PA 3M4OB 1BR9A 3PIOA 1EYGA 4JI8Q 4A3IG 1STHA 4IPGA 2F0JA 2L1BA 1QUQB 4A93H 3IFDA 3C2PA 3HOVH 4IUUA 4LFCQ 2KBNA 2ASBA 3K8AA 1QWYA 5CBEE 2M9VA 1NUCA 2UXDQ 4ZQ3A 2E76C 3J81c 1SNQA 2E75C 3KOJA 1PZID 2B63G 1WI5A 3LGJA 1J8IA 2MQHA 5KGUA 4GNXB 3VDYA 2JA8H 2QDBA 1R4QB 2EXDA 1I4RA 3PUXA 3NQTA 1SDFA 4FNFA 4DK1A 3Q0AA 2KCTA 3H15A 3QIAA 1I6HH 3NBIA 1HTLD 2ES2A 1BQQT 4MTNA 1WTWA 2F0UA 1ZXTA 2DJGC 4IUTA 2SDFA 2JSOA 2LS01 5E1FA 2XTIA 4RA8A 2VUMG 5T1GA 2WAQG 2QA4A 4A93G 1IBML 2A68C 1KLGD 3HOVG 4PZ8A 1SRUA 4C1NI 4K0KL 2EVBA 5K5PA 1Q81C 1Z7TA 5M3FH 4A75A 4EQPA 3DWPA 3GTPH 2KUMA 3T53B 1HZ9A 4FYDA 1DGSA 1SYEA 1A2UA 3SR1A 1W6JA 4BXXH 2RDHA 1EYAA 1SYDA 2QGQA 2JA8G 2Y0SB 4DNRB 1V1QA 1XWEA 1FGBD 2DJFC 1TWGB 1I50H 3MA2B 3GP7A 5F2DA 2B2WA 4X66L 1A6XA 4DR6L 5ELDA 1JQYD 1L1OC 1OXUA 4JI5L 2RSNA 1E24A 3EVQA 1Q86C 3T1HQ 3CCEA 4G7ZC 3QOLA 1CHPD 2FXQA 1C9OA 4TVAB 1GUWA 1EY4A 3R8BA 3HS0C 1E2ZA 2F3IA 3D31A 3QJYA 4S3SA 3AYHB 1BDOA 5M3FG 3D6WA 1G6PA 1F2ZA 1BOSA 1CK1A 1PYSB 1WD1A 5ELCA 4Y52H 3P1HA 1PVOA 1EFWA 1I94Q 1BKBA 2VB2X 1C4QA 4BXXG 4PZ7A 2C9OA 1VQLA 1AN8A 2K14A 1D6EC
chains in the Genus database with same CATH topology
3HOUB 5ISRA 4IZ8A 5I2YA 3HKZB 1EY8A 1FNVA 1MSHA 3VYTA 2EYPA 2G9HD 3V2TA 1TS3A 4K5XA 2KVMA 5C44B 4HSPA 4DA2A 3TZUA 4EGVA 3QO2A 1ENCA 3A55A 3VR6A 2K5DA 2C5CA 2E2JB 3H0GB 2BCOA 3GQBA 1PRTD 3J7YW 1PRTB 1OO9B 1O78A 3J81L 5C4ZA 1TVXA 3ND8A 3FPUB 4G57A 3W3AA 4QCLA 1WTQA 4UDUC 2PZWA 1ONLA 3HRZC 5D14A 1GUSA 4DAYA 3TP5A 2JXMB 4TRDA 5J39A 2B2WC 5I9OA 4DGZA 2VB3X 2YU9B 5EBCA 1G8ZD 2JP1A 1SE4A 3RMHA 4Q5VA 1SYFA 3S17B 3SK6A 1STYA 3LWUA 3A7LA 2RVLA 3MVVA 1ZYRC 3P20A 3OW7A 1D5XC 2J7ZA 1SJED 3A7AB 1W6KA 4A3JB 1HCZA 1EY9A 2CQAA 5C5MA 3GD7A 1CA5A 4XIGS 1L0YB 4N9PA 1XYIA 1ZKOA 1IL8A 2A74C 3J7AF 4IURA 4O1NA 3M85A 3BDCA 4KHVA 1BBXC 4ZRZA 2OEOA 3K5OA 1GUNA 4KJNA 4X3SA 1NR4A 2KECA 2F3WA 1OXVA 3JAME 1WCMB 2ZXRA 4IFDH 4HAEA 1JCKB 5M5YB 3MXGA 3SE0A 4FF4A 2NVYB 4F7XA 4WJWA 5CC4A 3BDLA 3I70A 4ZLTF 1I4HA 3S1NB 1S5BD 3C1EA 1O7LA 3VR3A 5EGTA 1LTAD 2B8FA 2CHBD 1YNJC 4FF1A 5JVG3 1S5DD 4EQOA 4C3HB 3M7GA 3K0YA 2E2DC 1D1IA 1WTPA 1AEXA 4LMQD 3NBHA 2SOBA 4K14A 2QF7A 5IIFA 3S15B 2AUKA 1AZQA 3RLFA 1HUMA 2ICEC 4KY6A 1DXMA 2FHTA 3DWAA 1BCPC 3NTKA 1X3QA 3S9WA 1SFOB 2B2VA 3GTGB 4C3IG 2F0SA 2BA0A 2K03A 1MGSA 1R4PB 5D65A 1QB5D 2HDLA 1LT5D 1V1OA 1DCZA 5M5XB 2K28A 3H3VC 3NTIA 2PQEA 1KNAA 1EYDA 1V8QA 1EIHA 1B53A 1UNSA 4QUCA 3BVMA 4CBVA 1QG7A 4DF7A 3R2TA 3C3LA 1TWAB 1LTTD 3GV6A 3X3NA 1Y1WB 1BNZA 5JAVA 1Y8NB 4RHSA 5CV9A 5CBAE 1B9NA 3QG1A 3TBIB 1DM0B 4U68A 1VF5C 3LWEA 5ELEA 5FO9B 5I2XA 1EOTA 5C3XA 2L0CA 4R8IA 5IT9E 1LLRD 3H6MA 1VCIA 2LMCB 2ID0A 4DN4M 3GTKB 3BG3A 1STAA 2PNRC 1LABA 1JWSD 1EL0A 4K8JA 2OF1A 1C48A 4U673 2F0QA 4Y7NB 1Y1VB 5CGKA 1PTOF 2WKCA 1K8MA 1HFNA 5CR3A 4KJOA 1AW7A 3J80L 3HEJA 2F0HA 1I3QB 5I4DA 1SEBD 2GA4B 5CV7A 1K8OA 1PMRA 2XWJB 3GO5A 4FO2A 4RGTA 2ENBA 1IW7C 2F0IA 3K5MA 5FLXE 5EKLA 1TY2A 3VYSA 5EKKA 4CJ1B 2XVSA 4XDXA 1EWCA 1A3UA 1GUTA 1PFNA 1TS2A 1RF2D 4M8AA 5LHY1 1PFMA 2NVXB 1SSOA 1RHPA 3D4DA 1R9TB 2QILA 1EU3A 4RGNA 1LO5D 4GZYC 2PMZB 1EEFD 4RGOS 5FK9C 2K1BA 1V1PA 1Y8PB 3D8GA 3J7AV 1BUVT 1H9MA 1DOMA 4RGMA 4L8JA 5LL6X 3U9SA 2DN8A 1B4OA 4LK1C 1BCPF 4FXGC 1EFID 3Q6SA 3T16A 3HGBA 2EYMA 3A8IE 3ONAB 5JPNC 3V96A 1JE4A 4FXKC 4A3KB 4ZKBB 1EY0A 4QB4A 4DK0A 1EYCA 3NHHA 3OOCA 2F0FA 4J8QA 5G3LF 3Q23A 1MBYA 1ENFA 4IUQA 1YNNC 3EFXD 4MHEA 4PQXA 5M3MB 2F0WA 1XTCD 2WINB 2YYZA 5EJWA 3AB9A 2KOLA 2HCCA 1FR3A 1ET6A 2PO4A 2F0LA 5ELFA 2KCNA 4X3TA 2EY1A 4C3JB 2AQ1B 5CV5A 1FNWA 1FNUA 3IFTA 3D4WA 1KDBA 1XX8A 4H0LC 5FKAC 1CI3M 1Y8OB 3DEPA 1DOLA 2NWGA 3NSWA 1LTSD 2TMPA 1KDAA 2EY2A 2QEJC 3N52A 2KHSA 2XN9C 3MC0B 5CORA 2JA7B 3VR4A 1KAAA 1Y69U 2WV6D 5CYUA 4RCNA 1OXTA 1Q3LA 1H9RA 5DM73 2RA4A 2I46A 2A6HD 1PTOD 1PTOB 2Z1CA 1H9JA 3W2DA 4KK7A 3I4MB 4A3GB 4PMWA 4X3UA 2BE5C 4QMGA 5IGBA 4ZYSA 2BOSA 5CMDA 1IYVA 2RKSA 1SMYD 4IALA 3OMGA 1TWHB 2IL8A 1EY6A 4XT3B 1ET9A 3MEHA 4E6IA 4RAUC 4NKLA 3CHBD 5KRUA 4KY7A 3KBGA 3WDNA 1TU2B 2ICIA 1WTXA 1Z6HA 1JR0D 2EXZA 3VA7A 5C4JB 1H9KA 1SYBA 4A3MB 2L4NA 1ESFA 4A3BB 4A3IB 1Q8IA 2A69D 3I3CA 1LTGD 4H13C 1G6ZA 3R3OA 2BA1A 5EQ0A 1JOQA 4CJ0B 3WOEA 2J4XA 2O2LD 4H44C 4KV6A 1H9SA 1CTMA 4Q0FA 4B9XA 1B2TA 1NR2A 2IX3A 1VF7A 5KYLA 4FP5D 1LTID 1M4VA 5LL6S 5G3LD 1PDQA 1U4MA 2RDFA 3SK5A 4KD3A 3K57A 4RCOA 4Z9CB 2VUMB 4C1NK 4A93B 3MFGA 1SNOA 5IGDA 1SE2A 3HOVB 4K8IA 3ERQA 2AUJD 2EY6A 2JA6B 2EYHA 1WTVA 1AP0A 4NDXA 3K6OA 3FDTA 3C46A 2F0NA 4IFDI 1OXSC 5C5LA 4ODGA 2EPBA 2KCCA 3KBXA 3MXPA 3CU7A 1G291 3FPPA 3JAML 2F0DA 2NTSA 3FVQA 1EWHA 2D62A 2SNMA 3SVMA 2IX0A 2FFKB 2A6ED 1CZWA 5M3FB 4CHTB 2R93B 2L12A 1MSGA 3BYYB 2NYZD 2OXPA 1NSNS 1Q1BA 3NP8A 4NMZA 5FO7B 1PZJD 2PPBC 1WVLA 3VYUA 4I7ZC 1KABA 1IKMA 3TP7A 2L5TA 1A3VA 3CQZB 1F2YA 3G6JB 4F87A 4CKCA 1SE3A 4KY5A 1D1KA 1S5FD 4UAIA 2F3VA 2MUYA 3WOFA 2K6AA 5I6WA 3FRPB 4NW2A 2MGSA 1F9QA 3FEWX 2B2UC 5JPMC 2K05A 3BVZA 1JICA 2LKVA 1GXDC 2AQ2B 4J1MA 3KLSX 4ZUJA 3M7NA 2PZTA 1BXTA 3SDZA 1B9MA 3H09A 5D3IB 4IFDG 3P7JA 1EY5A 5KIXA 2X6GA 3OHXC 3PUWA 3V05A 5IGGA 3SXHA 3LX0A 1I6VC 2VXWA 5IGEA 2EDGA 3QWNA 5KYIA 3DUZA 3A54A 3IAYA 2SNSA 1VMCA 3NWSA 1S5CD 4DAVA 2F0OA 4OIKA 3NK9A 1SAPA 3M3YB 2IW3A 2KEEA 5JVH3 3NE5B 4P2CB 1HQRD 2D2CC 1U4PA 2NBFA 1DOKA 1F9SA 1PRTC 5IT9L 3T13A 1QCBD 5DNFA 3LNNA 1JB3A 2L9HA 5E4XA 1QE6A 3EA6A 4R9WA 4X3KA 2D5DA 2F0MA 1V43A 2RQXA 2F1MA 1STNA 1U4LA 3OSOA 1KTKA 1GHKA 2Z4HA 2EYJA 2O5JC 4IN3A 4HN7A 1KNEA 4JBWA 1ENAA 1HA5A 3TMEA 1KLUD 1LTBD 3S1QB 2JE6I 2RDGA 1HA6A 4IUPA 5FO8B 3OMCA 5FLXL 4V0BA 1UAPA 4V190 3TSSA 4EQNA 4OO1I 3EROA 4JK1C 5EPJA 1SNDA 1Q12A 1HRJA 4HR7B 3VA5A 4ID6A 1F77A 3BS1A 1BO0A 1EZ8A 3L7ZC 1ESRA 1AZPA 5KNDA 4EVOA 5BN5A 4OGQC 3DEOA 1TS4A 2J0TD 3HOYB 1RODA 4OIJA 5E4WC 5C4HA 2F0VA 3PIP3 2Q8RE 4NP5A 4ILWA 4C3JG 2A68D 2B2YC 5D3DA 1I4XA 4C3IB 4ZKCB 2A73B 1O80A 3I8ZA 4OO1H 3S1RB 2EOTA 3RZOB 3BDOA 2Z8LA 2DNCA 3SEBA 1IKLA 1PLFA 2LY7A 2Q8TA 4HCEA 3J80E 3AU7A 3G7LA 2NN6I 5AFWA 4G7OC 1X3PA 5BN4A 2FJ2A 3TDQA 3NPPA 4FVMA 3K5NA 1RTNA 1HHVA 3RD4A 4PMBA 2WP8J 2E2HB 2F0GA 3I4LA 2H4OA 3A8JE 3D3RA 1TS5A 4OO1G 5C0XI 4G7HC 1RKNA 4XQJA 1QNUA 2MHVA 2F0TA 3T4AC 2WACA 1A15A 1MD2D 1PRTF 2NN6H 4L6TB 2M2LA 3KLSA 4F8MA 1JC7A 3M4YA 2MP1A 4ZUIA 2Z4IA 3HOZB 1EEID 2X6LA 3TP8A 1EIGA 1II3A 4WORA 4XXEA 1XXGA 3S2HB 3E0JA 1D5MC 1AFPA 5A2QE 2OT2A 3PUYA 3U9OA 3SK8A 2K32A 2NTTA 5CV6A 5EBDA 3GTOB 1O7ZA 1E0BA 3FKIB 5C0XH 3NXWA 1EZ6A 3MWYW 4KN7C 3BZDB 3L9AX 5FOBB 4RHRA 3QOJA 3HOXB 2IJ0A 2XRQD 1SNMA 5DEHA 2EZVA 5HGTA 3S14B 1UUPA 4B9WA 3IKJA 1I4QA 3S1MB 5CV4A 1CM9A 2EJFC 2R3ZA 2NN6G 5BN3A 5IGCA 1J9OA 3MXNA 4KKTA 2B39A 4KN4C 1ZYRD 3AMUA 1VDZA 3E6ZX 4G4KA 4BY1B 4BY7B 4FF3A 1CT1D 3K59A 1E2VA 2HCIA 3NWTA 4A3EB 4BBSB 2FMMA 3EJIA 3GTJB 5C0XG 3QB3A 3KUPA 1PXUA 1U9RA 2R6GA 1KDCA 1TT2A 1CQFA 2K01A 4IUNA 5DM63 2XNAC 3E5SA 3VYRA 3PUVA 2EYLA 1GUOA 4HEDA 3DXJC 3BYTB 4QUFA 1IHZA 1H9SB 5JEAH 1LACA 2MPMA 5T1IA 2NB0A 3I73A 3OIQA 4K2LA 4C2MB 2IX1A 1DJRD 2I07B 5HURA 2EY5A 4F88A 2X69A 2DY8A 1VMPA 3K58A 3OIPA 1LTRD 4FF2A 4XYQA 2R92B 5JJZA 1I4PA 1ML0D 1EQVA 4XYOA 2JEAI 5K36H 3T51B 1I4GA 1T5XD 2PZUA 2RSOA 2MJ8A 1LT4D 4ABNA 5KEEA 1YNJD 3H94A 1TKWB 1Z47A 2K04A 2V4DA 3MZ5A 1G91A 3MAQA 1E2WA 3C1FA 1NCVA 5JEAG 4BS9A 5JOBA 2D9UA 2QKIC 1LT6D 4KKUA 4BWGB 4RKLA 2F0PA 4IQZA 2NVTB 1SBBB 1K83B 3I4NB 3EQLC 4IUVA 1BCPD 1BCPB 4ZAIA 1L0XB 1M8AA 3URYA 2B63B 4IFDJ 2Q8IB 5A35A 4K6LA 4LAAA 4DFAA 3IL8A 5KNCA 1DD2A 1ICWA 1D5ZC 1STBA 2DNEA 5K36G 1B50A 3VR5A 1TWCB 1PZKD 3PV0A 4PMCA 4CKEA 4XQNA 2EYFA 2CW0C 3DWQA 2WAQB 2JEBI 1F9RA 4O42A 1S4ZA 3L3OC 1CZGA 4C3HG 1SXTA 1WTOA 4AYBB 1SYGA 5IGFA 3PIO3 5E3FA 1TQOA 3DHQA 2B2UA 5COYA 2N88A 5CV8A 3Q24A 5M5WB 2JA8B 1RDPD 3I91A 1QNKA 4KMUC 3KF8A 2WB1B 1F2LA 1HPCA 3ND9A 1A3TA 1I6HB 3J81E 2K5QA 4KD4A 2E2IB 2HDMA 1EQTA 4FXDA 3T56B 2JYOA 1LT3D 3RUZA 3A56A 3TN2A 2HQEA 2B2TA 1A2TA 1CHQD 3D6CA 1QILA 2F0EA 3A8KE 1GUGA 2NZ1D 5J22A 3GTPB 2R7ZB 1HUNA 2BDNA 2A6HC 4HMJA 1PTOC 2FMCA 2F03A 3CRLC 1I50B 4OHJA 2F0KA 2KQ3A 1QOHA 3P75A 2HUGA 4CJ2C 4CKBA 4B08A 4TSSA 5J1ZA 1G2SA 3GTLB 1IW7D 4DXFA 1B44D 4DAPA 3K5LA 4K5WA 1G2TA 1DYQA 1SMYC 3HG9A 5IOCA 1ILPA 1WTRA 3ITPA 2AWNA 2NUCA 1EU4A 3F2UA 4ULLA 1JWUD 2PW5A 2JA5B 4ME5A 1C8CA 1GOZA 4L63B 3GV3A 3TZDA 4KTAA 4YIJA 2IWHA 1PFBA 3H91A 1DONA 1STEA 4LJZC 1F2MA 1EY7A 3NTHA 4R8NA 4ZK9B 4QIWB 1HTPA 1TWFB 4XTCS 2A69C 1RCVD 4MIUA 2IT1A 4PNYA 1FYCA 4WRDA 5DAUA 4BBRB 3MFYA 3RZDB 1TY0A 2B2TC 2L55A 2G9DA 5EKIA 1S5ED 5EPKA 1CA6A 2KA7A 5I6YA 3GTMB 1HXYD 1DZ1A 2WKDA 1ZEQX 4RFBA 1LV9A 3OPOA 2B2YA 4WFN3 5TSSA 1CFMA 1HFGA 4KHZA 4PV1C 3R2IA 1JOKA 1YNND 4HMIA 4DXGA 2R61A 2EYOA 5C3WA 3KK7A 2CVRA 3DM1A 4J6HA 2SEBD 4RKBA 2PYKA 2M00A 3OWFA 2B8GA 4BA1I 2TSSA 2ZT9C 3MXUA 2PW7A 1SJHD 2EJMA 3NQIA 3SHLA 1WD0A 2K7VA 4OL7A 3PO2B 3X3MA 4TQUS 1GJXA 4K5VA 5C6AA 1PYWD 3I90A 4XT1B 2H1EA 4KKSA 1V1PB 1UEAB 2NVQB 4HSVA 3D4RA 4RH6A 3I72A 5M9OA 2K33A 1OXXK 1ILQA 1FD7D 1B1ZA 4DU9A 1HQMC 2A6EC 2L11A 1Q1EA 5C4XB 1MI2A 1GHJA 3PMFA 1JORA 2O4XA 4HCSA 3FMCA 2F4IA 3GTQB 2BDOA 3HZXA 2B2VC 2E74C 2KEDA 2XSCA 4BA2I 2IPKD 3HP3A 2K5WA 1IYUA 2ZXPA 1RJTA 1TR5A 1Q90A 2BE5D 4K2KA 5C0XJ 3TP6A 3MTSA 4H7BA 1PTOH 3DMUA 5EPLA 1U4RA 3ZYYX 3CKIB 4I65A 3PO3B 2XWBB 3OWEB 4MN3A 2WIIB 2XRSD 5NUCA 3S2DB 1SNCA 1STGA 1SYCA 4DNTB 3NUCA 3SK4A 2VNUD 4A3DB 2AWOA 3S16B 3MHBA 1TIID 2XIWA 5ELBA 4XQQA 2AQ3B 2DY7A 5C3EB 3N6RA 2EJGC 3VR2A 4K6DA 1T5EA 3UI2A 1O7YA 1NAPA 5A2QL 3R93A 1RTOA 4CGYB 3Q22A 4QF4A 1JWMD 3CRKC 1X32A 1D2BA 2FINB 2QCPX 4KI0A 4HTHA 2EE1A 3K7AB 1SNPA 5JEAJ 4TKOB 2PCFB 3BVGA 1RD9D 2RBMA 1QJOA 1JOOA 4C56C 2KJXA 1CQVA 4M1UB 4N9TA 2A5HA 3PUZA 2ZXOA 2LFNA 3KLRA 5KNBA 1B3AA 2O5IC 4A3FB 3O13A 5IODA 3HOWB 1F9PA 2N55A 2CW0D 1BF4A 4RWSC 5I9PA 3M4OB 1BR9A 1STHA 2F0JA 2L1BA 3IFDA 3C2PA 4IUUA 1QWYA 5CBEE 2M9VA 1NUCA 4ZQ3A 2E76C 1SNQA 2E75C 1PZID 1J8IA 5KGUA 2QDBA 1R4QB 1I4RA 3PUXA 3NQTA 1SDFA 4FNFA 4DK1A 3Q0AA 3QIAA 3NBIA 1HTLD 1BQQT 1WTWA 2F0UA 1ZXTA 4IUTA 2SDFA 2JSOA 2LS01 5E1FA 4RA8A 5T1GA 2A68C 1KLGD 4C1NI 2EVBA 5K5PA 1Z7TA 4EQPA 3DWPA 2KUMA 3T53B 4FYDA 1SYEA 1A2UA 3SR1A 1W6JA 2RDHA 1EYAA 1SYDA 4DNRB 2Y0SB 1XWEA 1FGBD 1TWGB 3MA2B 3GP7A 5F2DA 2B2WA 1A6XA 5ELDA 1JQYD 1OXUA 2RSNA 3EVQA 4G7ZC 3QOLA 1CHPD 1GUWA 1EY4A 3R8BA 3HS0C 1E2ZA 3D31A 3QJYA 4S3SA 1BDOA 3D6WA 1F2ZA 1BOSA 1CK1A 1WD1A 5ELCA 3P1HA 2VB2X 1C4QA 2C9OA 1AN8A 1D6EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW5 A;  1IHZ A;  4ME5 A;  3SXH A;  4IZ8 A;  1EZ8 A;  3LX0 A;  3BDC A;  5KGU A;  3D4W A;  2QDB A;  3MXP A;  4KHV A;  5IGE A;  1EY8 A;  1A3U A;  1KDB A;  2EXZ A;  4OL7 A;  2F0D A;  2OEO A;  4DF7 A;  2EYP A;  5KYI A;  5ISR A;  3NQT A;  3V2T A;  4KJN A;  1SYG A;  4KTA A;  4K2L A;  4YIJ A;  2SNS A;  4K6D A;  4EVO A;  5IGF A;  4F8M A;  5E3F A;  1TQO A;  4K5V A;  3DHQ A;  2SNM A;  4K5X A;  5C6A A;  2F3W A;  5HUR A;  2EY5 A;  2F0O A;  1SYB A;  4ZUI A;  3D4D A;  5JAV A;  1ENC A;  1F2M A;  2F0U A;  1EY7 A;  3NK9 A;  3TP8 A;  5C4H A;  5CV8 A;  4QF4 A;  5CV9 A;  2F0V A;  4NP5 A;  1II3 A;  5E1F A;  1KDA A;  4WOR A;  5M9O A;  2EY2 A;  4HTH A;  4R8N A;  3R3O A;  5C4Z A;  1SNP A;  2KHS A;  4F7X A;  5CC4 A;  1EQV A;  3U9O A;  3SK8 A;  3BDL A;  3D8G A;  1JOQ A;  1A3T A;  4MIU A;  3T13 A;  4DU9 A;  4G57 A;  5CV6 A;  4PNY A;  5K5P A;  4RKB A;  2PZW A;  2OXP A;  1NSN S;  4WRD A;  5DAU A;  4KD4 A;  2PZU A;  4EQP A;  5C3X A;  4KV6 A;  3NXW A;  3C1E A;  3NP8 A;  5KEE A;  2RBM A;  1EZ6 A;  5EGT A;  4NMZ A;  3SK4 A;  1JOO A;  3PMF A;  1KAA A;  1JOR A;  2O4X A;  1SYE A;  3H6M A;  4B9X A;  3TP5 A;  4PMC A;  2F0M A;  4TRD A;  1A2U A;  3QOJ A;  3SR1 A;  5KIX A;  3RUZ A;  1KAB A;  3MZ5 A;  1SNM A;  3HZX A;  4N9T A;  5J39 A;  2HQE A;  5DEH A;  1EYA A;  1SYD A;  1STA A;  3C1F A;  3T16 A;  5HGT A;  5I6Y A;  1A2T A;  3TP7 A;  2EYM A;  3D6C A;  5I9O A;  4B9W A;  1A3V A;  5JOB A;  4EQO A;  4DGZ A;  5KYL A;  1F2Y A;  5CV4 A;  2F0E A;  1STN A;  5IGC A;  4K8J A;  3OSO A;  2OF1 A;  4RKL A;  5F2D A;  5J22 A;  1AEX A;  4KY5 A;  1EY0 A;  5IOD A;  4QB4 A;  2F0P A;  2F0Q A;  2SOB A;  4K14 A;  1EYC A;  1TR5 A;  2EYJ A;  5IIF A;  2RDF A;  3SK5 A;  3NHH A;  4KD3 A;  5IGG A;  5CGK A;  2F0F A;  4K2K A;  1JOK A;  3TP6 A;  2F3V A;  3EVQ A;  4H7B A;  4HMJ A;  3DMU A;  5CR3 A;  1ENA A;  1SYF A;  4HMI A;  4KJO A;  5I6W A;  3SK6 A;  1STY A;  3TME A;  4KY6 A;  4QMG A;  5I9P A;  5IGB A;  3MVV A;  3HEJ A;  2F0H A;  2EYO A;  3QOL A;  4LAA A;  4DFA A;  4I65 A;  1STH A;  2F0K A;  2KQ3 A;  1SNO A;  2F0J A;  1EY4 A;  3P75 A;  4PMB A;  5C3W A;  5IGD A;  5CV7 A;  1STB A;  3S9W A;  2RKS A;  4K8I A;  4IAL A;  4S3S A;  2F0G A;  3ERQ A;  2LKV A;  3OMG A;  3OMC A;  5J1Z A;  2F0W A;  3EJI A;  5NUC A;  1EY6 A;  1EY9 A;  2F0S A;  4J6H A;  4J1M A;  3QB3 A;  1SNC A;  1F2Z A;  1STG A;  1SYC A;  4K5W A;  5C5M A;  2EY6 A;  4ZUJ A;  5IOC A;  2PZT A;  2EYH A;  2PYK A;  1RKN A;  2ENB A;  2M00 A;  3NUC A;  3ITP A;  3MEH A;  3OWF A;  1U9R A;  3P1H A;  1NUC A;  4E6I A;  4EQN A;  1KDC A;  1TT2 A;  2F0I A;  2NUC A;  4NDX A;  2F0L A;  3ERO A;  4IUN A;  3MHB A;  4N9P A;  1SND A;  2F0N A;  4NKL A;  5KRU A;  1EY5 A;  4KY7 A;  4ZQ3 A;  3E5S A;  5EKL A;  5C5L A;  1SNQ A;  2EY1 A;  2EYF A;  2EYL A;  3VA5 A;  2PW7 A;  4ODG A;  2F0T A;  2PQE A;  4ID6 A;  5EKK A;  2WAC A;  1EYD A;  5CV5 A;  3SHL A; 
#chains in the Genus database with same CATH topology
 3HOU B;  5ISR A;  4IZ8 A;  5I2Y A;  3HKZ B;  1EY8 A;  1FNV A;  1MSH A;  3AQQ A;  1NE3 A;  3VYT A;  1CKN A;  2EYP A;  3AFP A;  2G9H D;  3V2T A;  4QJF A;  1TS3 A;  4K5X A;  2KVM A;  5C44 B;  2N8N A;  4HSP A;  1SLJ A;  4DA2 A;  3TZU A;  4EGV A;  3QO2 A;  1ENC A;  3A55 A;  3VR6 A;  2K5D A;  2N49 A;  4BBR H;  2C5C A;  2E2J B;  3H0G B;  2BCO A;  3GQB A;  1YEZ A;  1PRT D;  3J7Y W;  1PRT B;  1OO9 B;  1O78 A;  3J81 L;  1VQ4 A;  5C4Z A;  2E8G A;  1TVX A;  2CQO A;  3TS0 A;  3ND8 A;  3FPU B;  4G57 A;  3W3A A;  3F8T A;  4QCL A;  1WTQ A;  4UDU C;  2PZW A;  3KJP A;  1ONL A;  3HRZ C;  1CKO A;  4DUY Q;  4DR3 Q;  1U5K A;  2HQL A;  5D14 A;  3HFZ B;  1GUS A;  4DAY A;  3TP5 A;  2JXM B;  4TRD A;  2UXC Q;  3STB C;  5J39 A;  1S3O A;  2B2W C;  3KYH C;  1JJG A;  5I9O A;  1AE2 A;  4DGZ A;  2VB3 X;  2YU9 B;  3AFQ A;  5EBC A;  2AKW B;  5GAD C;  3CCV A;  1G8Z D;  2JP1 A;  1SE4 A;  3RMH A;  1J5E L;  2IY5 B;  4Q5V A;  2PI2 A;  4BBR G;  4P71 A;  4UY8 C;  2ALY B;  1SYF A;  3S17 B;  3SK6 A;  1STY A;  1LYL A;  3LWU A;  3A7L A;  2RVL A;  3MVV A;  1ZYR C;  1YI2 A;  3P20 A;  3OW7 A;  1HNW Q;  1D5X C;  2J7Z A;  1SJE D;  2I5L X;  3L2P A;  4GNX C;  1JB7 A;  3A7A B;  1W6K A;  4A3J B;  1HCZ A;  3J81 i;  3PO2 H;  1EY9 A;  2CQA A;  5C5M A;  1C0A A;  3BZK A;  3GD7 A;  1CA5 A;  3K81 C;  1A0I A;  4LFA L;  4XIG S;  1L0Y B;  4N9P A;  1XYI A;  1ZKO A;  4YCV A;  1IL8 A;  2A74 C;  2NVQ H;  4JI8 L;  3CCU A;  3J7A F;  4IUR A;  1X56 A;  4JCV E;  4O1N A;  3J81 j;  3M85 A;  4WJ4 A;  3BDC A;  1JMC A;  4KHV A;  1L0W A;  5LMU Q;  1BBX C;  4ZRZ A;  2OEO A;  2VZA A;  3K5O A;  4LFB Q;  1GUN A;  4KJN A;  4LFC L;  4X3S A;  1NR4 A;  3PIP A;  2KEC A;  2F3W A;  1OXV A;  3F2B A;  1YHB A;  3JAM E;  1K8A C;  1WCM B;  2ZXR A;  2UXD L;  4IFD H;  4HAE A;  1WJJ A;  3HOY H;  1JCK B;  5M5Y B;  3MXG A;  3SE0 A;  2PI2 E;  4FF4 A;  3GTQ H;  1VQG A;  1VQH A;  4NXM Q;  3RN5 A;  2NVY B;  3HKZ E;  4F7X A;  4WJW A;  5CC4 A;  2HT1 A;  3BDL A;  5IWA Q;  3I70 A;  4ZLT F;  3PO2 G;  1I4H A;  3S1N B;  3I55 A;  1U0L A;  1S5B D;  4C3I H;  3C1E A;  2CKZ B;  1O7L A;  3TRE A;  5EGT A;  3VR3 A;  1VQO A;  1LTA D;  2P5Z X;  1JE5 A;  2B8F A;  3J80 c;  1VQI A;  2CHB D;  1YNJ C;  5ELN A;  3S1R H;  5JVG 3;  4FF1 A;  1S5D D;  4OWW B;  4DV4 Q;  4EQO A;  3M7G A;  3K0Y A;  4C3H B;  2A8V A;  3PO3 H;  3RR5 A;  2E2D C;  1D1I A;  1WTP A;  5ELO A;  1AEX A;  4LMQ D;  5L37 A;  3OYY A;  3S24 A;  3NBH A;  2SOB A;  2C35 B;  4K14 A;  3U50 C;  2QF7 A;  5IIF A;  3S15 B;  2AUK A;  2I0Q A;  3HOY G;  1AZQ A;  3RLF A;  1HUM A;  4A3D H;  2R7F A;  2ICE C;  3S16 H;  4KY6 A;  1DXM A;  2FHT A;  3DWA A;  1BCP C;  1YVC A;  3NTK A;  2OTL A;  4LF8 Q;  5IE8 A;  4A3L H;  1X3Q A;  3S9W A;  1SFO B;  2B2V A;  3GTG B;  2CCZ A;  4C3I G;  2F0S A;  2BA0 A;  2NZO A;  2K03 A;  1MGS A;  1R4P B;  5D65 A;  1QB5 D;  2HDL A;  3T1H L;  1LT5 D;  1V1O A;  1DCZ A;  1KXL A;  5JJL A;  5M5X B;  2K28 A;  4LF5 Q;  3NTI A;  3H3V C;  2PQE A;  1KNA A;  1EYD A;  2D0O A;  1V8Q A;  1EIH A;  3UDG A;  1B53 A;  1UNS A;  4QUC A;  1XMQ Q;  3BVM A;  4CBV A;  1E22 A;  1QG7 A;  4DF7 A;  3R2T A;  3C3L A;  1TWA B;  1LTT D;  4GN3 B;  3GV6 A;  3X3N A;  1Y1W B;  1I94 L;  1BNZ A;  5JAV A;  4A3D G;  1Y8N B;  3CW2 C;  4RHS A;  1PH9 A;  5CV9 A;  5CBA E;  2B29 A;  1X55 A;  2A1A A;  1B9N A;  3QG1 A;  1N33 Q;  4X65 Q;  4A3L G;  3TBI B;  2KHJ A;  4LWC A;  1DM0 B;  1UE6 A;  4U68 A;  1VF5 C;  4QQB X;  1XTD A;  3LWE A;  5ELE A;  5FO9 B;  5AJ3 Q;  4NXN Q;  5I2X A;  1EOT A;  1E7Z A;  2GVA A;  4A3F H;  5C3X A;  2L0C A;  3A74 A;  3RN2 A;  4R8I A;  5IT9 E;  3HOW H;  1VQ6 A;  1LLR D;  3H6M A;  4GKK Q;  1VCI A;  2LMC B;  2ID0 A;  4NPS A;  4O0A A;  4DN4 M;  1UE7 A;  1HR0 W;  3GTK B;  1PHJ A;  3BG3 A;  1STA A;  1VQ8 A;  2DUD A;  3W5O A;  2PNR C;  5BR8 Q;  4HJ7 A;  1LAB A;  4HJ5 A;  1JWS D;  4DV6 Q;  1EL0 A;  4K8J A;  2OF1 A;  1EIY B;  4JBM A;  4GOP B;  1C48 A;  4U67 3;  2F0Q A;  4DUY L;  4DR3 L;  1K3R A;  4Y7N B;  1M90 C;  1Y1V B;  5CGK A;  1PTO F;  2WKC A;  2PQA A;  1K8M A;  3J7Z C;  1HFN A;  5CR3 A;  4KJO A;  4LF7 Q;  2UXC L;  1AW7 A;  1V9P A;  2G5D A;  3J80 L;  3HEJ A;  3GDE A;  2F0H A;  1I3Q B;  3K80 C;  5I4D A;  1SEB D;  2GA4 B;  5CV7 A;  1K8O A;  1PMR A;  4JPB W;  1SMX A;  4A3E H;  3ULJ A;  2XWJ B;  4UP8 A;  3GO5 A;  4A3F G;  4BBS H;  4FO2 A;  4RGT A;  2OQK A;  1EWI A;  4AH6 A;  3HOW G;  3GTJ H;  2YTV A;  2ENB A;  2UUC Q;  4L5T A;  1IW7 C;  2F0I A;  3K5M A;  5FLX E;  5LMN W;  5EKL A;  1TY2 A;  3VYS A;  5EKK A;  4CJ1 B;  3HOX G;  2XVS A;  3CME A;  1VQK A;  1HNW L;  1YJW A;  4XDX A;  1EWC A;  1A3U A;  1GUT A;  3IRB A;  1PFN A;  1TS2 A;  1RF2 D;  2L15 A;  4P74 A;  2RHS B;  2ZTD A;  4M8A A;  5LHY 1;  1PFM A;  2NVX B;  1SSO A;  1RHP A;  1PH8 A;  1HR0 Q;  3D4D A;  1R9T B;  3B6Y A;  2QIL A;  1EU3 A;  4UP9 A;  1EQQ A;  4RGN A;  4DR7 Q;  3RLN A;  1LO5 D;  4GZY C;  2PMZ B;  1EEF D;  5LMU L;  4RGO S;  5FK9 C;  3G6E A;  4A3E G;  2K1B A;  4LFB L;  1V1P A;  1Y8P B;  3D8G A;  3J7A V;  4BBS G;  1BUV T;  1H9M A;  1TXY A;  4DV0 Q;  1DOM A;  4RGM A;  4L8J A;  4DR2 Q;  5LL6 X;  1B3Q A;  4YWL A;  3A5U A;  3U9S A;  2DN8 A;  1B4O A;  4LK1 C;  2Q2H A;  1BCP F;  4X62 Q;  4FXG C;  4NXM L;  2BH2 A;  1EFI D;  3Q6S A;  3T16 A;  3HGB A;  2EYM A;  3A8I E;  3ONA B;  5JPN C;  3V96 A;  1JE4 A;  5IWA L;  4FXK C;  4A3K B;  4ZKB B;  1EY0 A;  4QB4 A;  3G4S A;  4DK0 A;  1EYC A;  3NHH A;  5LMN Q;  3OOC A;  2F0F A;  2I5H A;  4J8Q A;  5G3L F;  2NVT H;  1K83 H;  3Q23 A;  2CH4 A;  3I4N H;  1MBY A;  4JI7 Q;  1ENF A;  4IUQ A;  1YNN C;  4DV4 L;  3EFX D;  2Y0S G;  4MHE A;  5HY6 A;  4PQX A;  3HOU H;  5M3M B;  1UE5 A;  2F0W A;  1XTC D;  2WIN B;  2YYZ A;  5EJW A;  2ZM6 Q;  3AB9 A;  2CWP A;  2KOL A;  4N8X 1;  2HCC A;  1BVS A;  1FR3 A;  1K28 A;  4IJH A;  1ET6 A;  2PO4 A;  2F0L A;  5ELF A;  2KCN A;  5J3B A;  1OTC A;  4X3T A;  2EY1 A;  4HIK A;  4C3J B;  2AQ1 B;  1SE8 A;  4OEM B;  2E2J H;  1PH2 A;  5CV5 A;  4LF8 L;  1VQN A;  1FNW A;  1FNU A;  3F2D A;  3IFT A;  3K0X A;  3D4W A;  1O7I A;  4DV5 Q;  1KDB A;  1NNX A;  1XX8 A;  4H0L C;  5FKA C;  1CI3 M;  1FL0 A;  1Y8O B;  3DEP A;  1DOL A;  2NWG A;  3NSW A;  3PF5 A;  2Q2U A;  3I4N G;  1FJG L;  1LTS D;  3OW2 A;  4POG A;  1MIU A;  2TMP A;  4LF5 L;  2RHQ B;  5EAY A;  1KDA A;  1NMF A;  2EY2 A;  2QEJ C;  3N52 A;  4GN5 A;  1XMQ L;  3HOU G;  2KHS A;  5M5W H;  2XN9 C;  1CSQ A;  4LW1 A;  2YU9 H;  2MO0 A;  2N78 A;  3MC0 B;  5COR A;  2JA7 B;  2VQE Q;  2GVB A;  1NMG A;  1P16 A;  3VR4 A;  1KAA A;  4B3R Q;  1Y69 U;  2E2I H;  3QR8 A;  1WTH A;  2WV6 D;  5CYU A;  4A4I A;  1N33 L;  1E1O A;  2PMZ E;  4X65 L;  4RCN A;  3CCQ A;  2KEN A;  1OXT A;  3CCR A;  1I5F A;  1Q3L A;  1H9R A;  1MJC A;  5DM7 3;  1LTL A;  1QVC A;  2RA4 A;  5AJ3 L;  4NXN L;  2I46 A;  2A6H D;  4AYB G;  1PTO D;  1PTO B;  2Z1C A;  3BJU A;  4OON A;  4ALP A;  5JJK A;  4GKK L;  3Q8D A;  1H9J A;  3W2D A;  2R7Z H;  4IOC A;  4KK7 A;  3I4M B;  4A3G B;  4PMW A;  3CD6 A;  4X3U A;  2BE5 C;  4QMG A;  5IGB A;  3TQY A;  1K3B C;  4L5S A;  3JAM c;  4ZYS A;  2BOS A;  5CMD A;  5BR8 L;  1IYV A;  4JI3 Q;  2RKS A;  2WB1 G;  4DV6 L;  1SMY D;  4IAL A;  3OMG A;  1TWH B;  2IL8 A;  1EY6 A;  4XT3 B;  4QGU A;  2QDL A;  5FLM H;  1ET9 A;  3TEH B;  3GTL H;  3CC7 A;  3MEH A;  4E6I A;  4RAU C;  4NKL A;  4LF7 L;  3CHB D;  5KRU A;  4KY7 A;  1WCM H;  5IY0 A;  2N3S A;  3KBG A;  4X64 Q;  5M5Y H;  3WDN A;  1TU2 B;  2ICI A;  2OQ0 A;  1WTX A;  1PH4 A;  1Z6H A;  3M4P A;  1JR0 D;  2EXZ A;  2JA5 H;  3PCO B;  3VA7 A;  5C4J B;  3S1N H;  2UUC L;  1H9K A;  4YWK A;  2R7Z G;  3KF8 B;  4GNX A;  1SYB A;  4A3M B;  2L4N A;  1ESF A;  4A3B B;  3KFU A;  5FJ8 H;  4A3I B;  1Q8I A;  2A69 D;  2NZH A;  3I3C A;  1LTG D;  4H13 C;  4RG1 A;  1W2B A;  3R3O A;  1VQ5 A;  1G6Z A;  2BA1 A;  5IYD H;  5EQ0 A;  1JOQ A;  4CJ0 B;  1TWF H;  3WOE A;  2J4X A;  2O2L D;  4H44 C;  5FLM G;  4KV6 A;  1HR0 L;  1WOC A;  1E3P A;  3G48 A;  1H9S A;  1CTM A;  4Q0F A;  4B9X A;  3S15 H;  4JI6 Q;  1WCM G;  4MNO A;  4DR7 L;  2YTY A;  3RZD H;  1B2T A;  1PYB A;  4HJA A;  1NR2 A;  2HHH Q;  2IX3 A;  3UDX A;  1IBK Q;  2JQO A;  2JA5 G;  1VF7 A;  5KYL A;  2MO1 A;  4FP5 D;  1LTI D;  3EIV A;  1PA6 A;  3GTM H;  1M4V A;  4DV0 L;  5LL6 S;  1SFO H;  4DR2 L;  5G3L D;  3GTG H;  1PDQ A;  1U4M A;  2RDF A;  3SK5 A;  4KD3 A;  3K57 A;  4RCO A;  1C7Y A;  5FJ8 G;  3G71 A;  2GN5 A;  4X62 L;  4Z9C B;  2VUM B;  1D7Q A;  4OXP A;  1PH6 A;  4C1N K;  3KF6 A;  4A93 B;  3MFG A;  1KQS A;  5IYD G;  1SNO A;  1YJ9 A;  3UE0 A;  5IGD A;  1SE2 A;  4YCU A;  2RCF A;  3HOV B;  4K8I A;  2K5V A;  1B7Y B;  1NTG A;  3ERQ A;  4DK6 C;  2Q2T A;  2HD3 A;  2AUJ D;  2K4K A;  1TWA H;  2EY6 A;  2JA6 B;  5LMN L;  3M9B A;  2EYH A;  1WTV A;  2CWA A;  2AHO B;  1QVG A;  1AP0 A;  4NDX A;  3K6O A;  3FDT A;  3C46 A;  2F0N A;  4JI7 L;  4IFD I;  1OXS C;  5C5L A;  3KJO A;  1JJC B;  4ODG A;  5IT9 c;  2EPB A;  2KCC A;  1PH1 A;  4OX9 Q;  3KBX A;  3MXP A;  2VY3 A;  1G29 1;  3CU7 A;  3K7U C;  4DK3 C;  2Z0S A;  3FPP A;  3JAM L;  2F0D A;  2NTS A;  3FVQ A;  4LUZ A;  1EWH A;  2ZM6 L;  2D62 A;  2SNM A;  3SVM A;  4P75 A;  4N8F A;  2D0P A;  2Z6K C;  3CPF A;  3NBH B;  3GTK H;  1LUZ A;  2IX0 A;  4L5Q A;  2FFK B;  2A6E D;  4DV5 L;  1CZW A;  5M3F B;  4CHT B;  2R93 B;  2L12 A;  2HIV A;  1MSG A;  4X6A H;  3BYY B;  2NYZ D;  2OXP A;  1NSN S;  2K5H A;  1Q1B A;  3NP8 A;  1YJN A;  4NMZ A;  5FO7 B;  1PZJ D;  4DV1 Q;  2PPB C;  5C4X H;  1L2F A;  4Y7N H;  1WVL A;  3VYU A;  3W1G A;  4I7Z C;  1KAB A;  2V1C C;  1IKM A;  2ZTC A;  4POF A;  5H1S E;  3TP7 A;  2L5T A;  4IPC A;  1A3V A;  3CQZ B;  1F2Y A;  5FLX c;  3G6J B;  4F87 A;  4YHH Q;  4JI2 Q;  4CKC A;  1SE3 A;  4KY5 A;  1D1K A;  2VQE L;  1H95 A;  1S5F D;  3JAM i;  5HGQ A;  1X3G A;  4B3R L;  4UAI A;  2F3V A;  2MUY A;  2OTJ A;  3CCL A;  3WOF A;  2K6A A;  1YHA A;  3HKS A;  5I6W A;  2Q2I A;  2ZTE A;  3FRP B;  4NW2 A;  2MGS A;  4R4T A;  2JJQ A;  1F9Q A;  4AIM A;  4JBJ A;  3FEW X;  2B2U C;  1VQD A;  5JPM C;  2K05 A;  3BVZ A;  1JIC A;  2EQS A;  2LKV A;  1GXD C;  2AQ2 B;  4J1M A;  3KLS X;  4ZUJ A;  3M7N A;  5C4X G;  2PZT A;  1BXT A;  3SDZ A;  2F4V Q;  1B9M A;  3H09 A;  5D3I B;  3S2D H;  1ASY A;  4IFD G;  3P7J A;  2NVX H;  4YCW A;  2RCN A;  1EY5 A;  5KIX A;  2X6G A;  4LF4 Q;  2VS1 A;  3OHX C;  2WAQ E;  3PUW A;  3V05 A;  5IGG A;  3CCJ A;  3NEN A;  3U58 A;  1NJI C;  3SXH A;  4JI3 L;  3LX0 A;  1I6V C;  1HJP A;  2VXW A;  5IGE A;  2EDG A;  3QWN A;  5KYI A;  4CDF C;  3DUZ A;  3A54 A;  3IAY A;  2SNS A;  5C3E H;  1VMC A;  3NWS A;  1S5C D;  4DAV A;  3ER0 A;  2F0O A;  4OIK A;  4R4I A;  3NK9 A;  1IBL Q;  1SAP A;  1FJG Q;  3M3Y B;  2IW3 A;  4X64 L;  3L0O A;  2KEE A;  4IPH A;  5JVH 3;  3NE5 B;  1NY4 A;  4P2C B;  1HQR D;  2D2C C;  1U4P A;  3WWV A;  2NBF A;  3PO3 G;  1DOK A;  1F9S A;  1PRT C;  5IT9 L;  3T13 A;  3K7A H;  4KLK A;  1QCB D;  5DNF A;  3KDF B;  3LNN A;  4DV2 Q;  1JB3 A;  4GKJ Q;  3ICE A;  2KCM A;  2L9H A;  4RMF A;  5E4X A;  1QE6 A;  1GD7 A;  2WFW A;  3EA6 A;  1YBY A;  4R9W A;  4X3K A;  2D5D A;  2F0M A;  3OTO Q;  3I4O A;  1RIP A;  1V43 A;  1KL9 A;  5GAE C;  1KD1 C;  2RQX A;  1P8L A;  3CC2 A;  2F1M A;  1STN A;  1U4L A;  1YHQ A;  3OSO A;  1KTK A;  1XNR Q;  5M3M H;  5C3E G;  1GHK A;  4JV5 Q;  1MKH A;  2Z4H A;  2EYJ A;  2O5J C;  2VQF Q;  4JI6 L;  4IN3 A;  4HN7 A;  1KNE A;  4JBW A;  1ENA A;  1HA5 A;  4B3S Q;  3TME A;  4EQ5 A;  2HHH L;  1KLU D;  1LTB D;  3FHW A;  1IBK L;  3S1Q B;  4C3J H;  2JE6 I;  4R1J A;  4DR4 Q;  3M4O H;  2RDG A;  1HA6 A;  3NEL A;  4IUP A;  5FO8 B;  3OMC A;  4IJL A;  5FLX L;  1VQP A;  4V0B A;  2UU9 Q;  1UAP A;  4V19 0;  3TSS A;  4EQN A;  4OO1 I;  3ERO A;  4JK1 C;  5EPJ A;  1SND A;  1Q12 A;  1HRJ A;  1A63 A;  4HR7 B;  3VA5 A;  1KIX A;  4ID6 A;  1F77 A;  3BS1 A;  1XPU A;  1BO0 A;  1EZ8 A;  3L7Z C;  4YY3 Q;  1ESR A;  4GLA C;  1AZP A;  5KND A;  2JK8 A;  4EVO A;  3FP9 A;  5BN5 A;  4OGQ C;  3DEO A;  1TS4 A;  2J0T D;  3HOY B;  2JA7 H;  2Z9H A;  1ROD A;  4OIJ A;  5E4W C;  5C4H A;  1SRO A;  2F0V A;  3PIP 3;  2Q8R E;  4NP5 A;  4ILW A;  4L5R C;  4C3J G;  2A68 D;  2B2Y C;  1LM0 A;  4OX9 L;  5D3D A;  1EUJ A;  4JI4 Q;  1I4X A;  4C3I B;  1YZ6 A;  4ZKC B;  2BH8 A;  2A73 B;  1O80 A;  3J7A 5;  3I8Z A;  4OO1 H;  3S1R B;  2EOT A;  1GM5 A;  4B3T Q;  1XPO A;  3RZO B;  4A76 A;  3BDO A;  2PNH A;  2Z8L A;  2DNC A;  3SEB A;  1IKL A;  4LF9 Q;  1PLF A;  2LY7 A;  2Q8T A;  3BU2 A;  4HCE A;  4JVZ A;  2AMC B;  1T9H A;  5GAG C;  2UXB Q;  4FDB A;  3J80 E;  1TWG H;  3AU7 A;  1L1O B;  3G7L A;  2NN6 I;  5AFW A;  4G7O C;  1X3P A;  1TWH H;  4DV1 L;  5BN4 A;  2FJ2 A;  3TDQ A;  3NPP A;  4FVM A;  1K8G A;  3K5N A;  1RTN A;  4A3C H;  1HHV A;  3RD4 A;  4PMB A;  2WP8 J;  2E2H B;  1XMO Q;  4YHH L;  4JI2 L;  4LF6 Q;  2F0G A;  2ZJR A;  3I4L A;  1N9W A;  1IZ6 A;  1KHI A;  3EBE A;  2H4O A;  3A8J E;  4LUO A;  2MNA A;  3D3R A;  1YIJ A;  1TS5 A;  2F52 A;  1UE1 A;  5C0X I;  4G7H C;  5C4J H;  1RKN A;  4OO1 G;  4XQJ A;  1QNU A;  1E1T A;  4UPA A;  2HIX A;  1CUK A;  2IHF A;  4ME3 A;  2MHV A;  2F0T A;  3T4A C;  2WAC A;  1A15 A;  1IXR A;  1MD2 D;  1PRT F;  1ASZ A;  1A8V A;  4JI0 Q;  2NN6 H;  4L6T B;  1VQB A;  2M2L A;  3KLS A;  4F8M A;  3CCS A;  2B3G A;  2F4V L;  1JC7 A;  3M4Y A;  2MP1 A;  4ZUI A;  3F1Z A;  3A5Z B;  2Z4I A;  4CDE C;  5C44 H;  1EEI D;  3HOZ B;  1N8R C;  2X6L A;  3CCM A;  3TP8 A;  1EIG A;  4LF4 L;  4P72 A;  4A3C G;  4DV3 Q;  1VQ9 A;  1II3 A;  2UUB Q;  4WOR A;  1X65 A;  4XXE A;  1XXG A;  3S2H B;  3E0J A;  1D5M C;  3H0G H;  1AFP A;  5A2Q E;  2OT2 A;  3PUY A;  1BBW A;  3U9O A;  1BBU A;  1HH2 P;  3SK8 A;  2K32 A;  2NTT A;  5CV6 A;  5EBD A;  3GTO B;  1O7Z A;  1E0B A;  3FKI B;  3DLL A;  5C0X H;  2RF4 A;  3NXW A;  1EZ6 A;  3MWY W;  3STB D;  4KN7 C;  3BZD B;  3L9A X;  5FOB B;  1IBL L;  4MTK A;  2XGT A;  4O2D A;  4RHR A;  3SGI A;  3QOJ A;  3HOX B;  2IJ0 A;  2XRQ D;  1SNM A;  4CDD C;  5DEH A;  2EZV A;  5HGT A;  3S14 B;  2VUM H;  1UUP A;  4B9W A;  3IKJ A;  1I4Q A;  3S1M B;  5CV4 A;  1CM9 A;  2EJF C;  2R3Z A;  2NN6 G;  5BN3 A;  3PF4 A;  3HKZ G;  5IGC A;  1J9O A;  4DV2 L;  3MXN A;  3CMA A;  4KKT A;  4GKJ L;  1HNX Q;  1VQA A;  4GOP C;  5C44 G;  2B39 A;  4JOI C;  4KN4 C;  2JA6 H;  3OTO L;  3ZJY C;  1ZYR D;  4DNI A;  3AMU A;  1VDZ A;  1M1K C;  3E6Z X;  4G4K A;  4BY1 B;  4BY7 B;  4FF3 A;  1CT1 D;  4PZ6 A;  4IOA A;  3S17 H;  2JN4 A;  3H0G G;  3K59 A;  1E2V A;  2HCI A;  3NWT A;  4A3E B;  4BBS B;  1MHW C;  1XNR L;  4DKA C;  1X9N A;  4JYA Q;  2FMM A;  4AQY Q;  4JV5 L;  3EJI A;  3GTJ B;  4JBK A;  1JJ2 A;  5C0X G;  1B8A A;  3QB3 A;  4A3J H;  3KUP A;  1PXU A;  2VQF L;  4P73 A;  2CFM A;  1U9R A;  2R6G A;  1B70 B;  1KDC A;  1TT2 A;  1CQF A;  2K01 A;  4IUN A;  5DM6 3;  4B3S L;  1CKN B;  1X54 A;  2XNA C;  3E5S A;  4PG3 A;  3PUV A;  2EYL A;  3VYR A;  1GUO A;  4HED A;  3DXJ C;  3BYT B;  4QUF A;  4DR4 L;  1IHZ A;  4HIM A;  1H9S B;  2DGY A;  5JEA H;  1LAC A;  2MPM A;  5T1I A;  3E9H A;  3CAM A;  2NB0 A;  1VQC A;  3I73 A;  3OIQ A;  1Q7Y C;  3UDI A;  4K2L A;  2R93 H;  2UU9 L;  4C2M B;  3UE1 A;  2IX1 A;  1DJR D;  1J6Q A;  2I07 B;  4OWT B;  5HUR A;  1HNZ Q;  2JA6 G;  2EY5 A;  4F88 A;  2X69 A;  2DY8 A;  1QUQ A;  1VMP A;  3K58 A;  3ULP A;  3OIP A;  1LTR D;  4FF2 A;  1CSP A;  3T1Y Q;  4XYQ A;  4KHP Q;  2R92 B;  2R7D A;  5JJZ A;  4YY3 L;  1I4P A;  1ML0 D;  1EQV A;  4DAY B;  4EX5 A;  4XYO A;  1N34 Q;  2JEA I;  3CQZ H;  2NVY H;  5K36 H;  3E3X A;  3T51 B;  1I4G A;  3KF6 B;  1SN8 A;  4A3J G;  4HJ9 A;  1VQ7 A;  1T5X D;  2PZU A;  2RSO A;  5JJI A;  1VQE A;  2LSS A;  2MJ8 A;  1LT4 D;  4ABN A;  5KEE A;  1YNJ D;  3H94 A;  1TKW B;  1Z47 A;  2K04 A;  2V4D A;  4DV7 Q;  3CC4 A;  3MZ5 A;  1G91 A;  3MAQ A;  1E2W A;  3C1F A;  1NCV A;  5JEA G;  4BS9 A;  5JOB A;  2Z6K A;  2D9U A;  2QKI C;  4JI4 L;  1LT6 D;  1YIT A;  1X3E A;  4HJ8 A;  4KKU A;  3D0F A;  4BWG B;  4RKL A;  2R93 G;  4C3H H;  3E0E A;  1KRS A;  2F0P A;  4IQZ A;  1VQM A;  2NVT B;  1K83 B;  1SBB B;  1UWV A;  4ZCK A;  3I4N B;  3A0J A;  4B3T L;  3EQL C;  4IUV A;  4LUV A;  1BCP D;  1BCP B;  4ZAI A;  1L0X B;  1M8A A;  3URY A;  2B63 B;  4IFD J;  2Q8I B;  4LF9 L;  1IYJ B;  5A35 A;  1AH9 A;  4DAM A;  1Q8K A;  4JG2 A;  4K6L A;  4LAA A;  4DFA A;  3IL8 A;  5KNC A;  1DD2 A;  1ICW A;  2UXB L;  1D5Z C;  1STB A;  2DNE A;  5K36 G;  3ERS X;  2UUA Q;  1CKM A;  1B50 A;  3VR5 A;  4R4O A;  1QVF A;  4GN4 B;  1TWC B;  1G51 A;  1PZK D;  3PV0 A;  4PMC A;  3W1B A;  4CKE A;  4XQN A;  2EYF A;  2CW0 C;  4JI1 Q;  1S40 A;  1K73 C;  5M5X H;  3M3Y H;  3DWQ A;  2WAQ B;  3BZC A;  2JEB I;  1XMO L;  2E5L Q;  1N36 Q;  1F9R A;  2YV5 A;  4LF6 L;  4O42 A;  1S4Z A;  3L3O C;  1CZG A;  4C3H G;  1SXT A;  1WTO A;  4AYB B;  1SYG A;  5IGF A;  3PIO 3;  5E3F A;  1TQO A;  3DHQ A;  2B2U A;  4OWX B;  5COY A;  2N88 A;  1A62 A;  1AE3 A;  1KAW A;  1RL2 A;  5E7N A;  5CV8 A;  3Q24 A;  1Y1W H;  3I56 A;  4R4C A;  1QZH A;  5M5W B;  2JA8 B;  1RDP D;  3I91 A;  1QNK A;  4KMU C;  3KF8 A;  2WB1 B;  1EIF A;  1K9M C;  4GS3 A;  1F2L A;  4JI0 L;  1HPC A;  3ND9 A;  1A3T A;  3U4V A;  1I6H B;  5GQO A;  2OCE A;  3J81 E;  2K5Q A;  4KD4 A;  1QZG A;  3KLW A;  2E2I B;  1HZB A;  2HDM A;  1EQT A;  4NB3 A;  4FXD A;  3T56 B;  4DR5 Q;  2JYO A;  4DV3 L;  4R4Q A;  1LT3 D;  2UUB L;  3RUZ A;  3A56 A;  2Y0S E;  3TN2 A;  2HQE A;  2CH4 W;  2B2T A;  1A2T A;  1CHQ D;  3D6C A;  3S1Q H;  1QIL A;  1EOV A;  2F0E A;  3A8K E;  1GUG A;  2NZ1 D;  5J22 A;  1Q82 C;  3GTP B;  2R7Z B;  1HUN A;  2BDN A;  4JW0 A;  3DM3 A;  2A6H C;  4QL5 A;  4HMJ A;  1PTO C;  2FMC A;  1Y1V H;  1Y1W G;  2F03 A;  4WJ3 M;  1EQR A;  3CRL C;  1I50 B;  3TS2 A;  4OHJ A;  2F0K A;  2KQ3 A;  1QOH A;  3P75 A;  2HUG A;  1I3Q H;  4CJ2 C;  2ATW A;  4CKB A;  4B08 A;  1UEB A;  4TSS A;  5J1Z A;  1HNX L;  5GAH C;  1G2S A;  3GTL B;  1IW7 D;  4DXF A;  1B44 D;  4DAP A;  3K5L A;  4K5W A;  1G2T A;  1DYQ A;  1SMY C;  4H02 A;  3HG9 A;  5IOC A;  2VW9 A;  1ILP A;  2ZJQ A;  1WTR A;  3ITP A;  2AWN A;  4CDC C;  2NUC A;  1EU4 A;  4IPD A;  3F2U A;  4UHV A;  1GVP A;  4ULL A;  1JWU D;  2PW5 A;  1FVI A;  2JA5 B;  4ME5 A;  1C8C A;  1GOZ A;  4B3M Q;  4L63 B;  3GV3 A;  4JYA L;  4AQY L;  3TZD A;  3E9I A;  4KTA A;  4YIJ A;  2IWH A;  1PFB A;  3H91 A;  1DON A;  2LXK A;  1STE A;  1PFS A;  1Y1V G;  4LJZ C;  1F2M A;  1EY7 A;  2MFI A;  1R9T H;  3RZO H;  3NTH A;  4R8N A;  4ZK9 B;  4QIW B;  1HTP A;  2QW7 A;  1MJE A;  1TWF B;  4XTC S;  2A69 C;  1RCV D;  3CP0 A;  4MIU A;  4AYB E;  1XNQ Q;  1YNX A;  2IT1 A;  4PNY A;  4UP7 A;  1FYC A;  1N32 Q;  4WRD A;  5DAU A;  5GRO A;  1HNZ L;  4LNQ A;  4APV A;  4BBR B;  2K75 A;  3MFY A;  3RZD B;  4DR1 Q;  1TY0 A;  2B2T C;  1VQF A;  1GO3 E;  2L55 A;  2G9D A;  5EKI A;  3T1Y L;  1S5E D;  5EPK A;  2OWO A;  4KHP L;  1X3F A;  1CA6 A;  4DUZ Q;  2KA7 A;  5I6Y A;  2WB1 E;  3GTM B;  1HXY D;  1DZ1 A;  1S72 A;  2WKD A;  1XJV A;  1N34 L;  1ZEQ X;  2I5M X;  2PQA B;  4RFB A;  1LV9 A;  3OPO A;  2E2H H;  2B2Y A;  4WFN 3;  5TSS A;  1CFM A;  1HFG A;  1K0S A;  4A3K H;  4KHZ A;  4PV1 C;  3R2I A;  1JOK A;  4DV7 L;  1YNN D;  2KHI A;  4HMI A;  4GLV B;  3EN2 A;  4DXG A;  2R61 A;  2EYO A;  3CPW A;  3AEV A;  1FGU A;  4YWM A;  5C3W A;  3KK7 A;  2K50 A;  2CVR A;  3U4Z A;  3DM1 A;  4J6H A;  3RLO A;  2SEB D;  4RKB A;  2PYK A;  2M00 A;  3PSI A;  3OWF A;  2B8G A;  4BA1 I;  5IP9 H;  3HOZ H;  3TRZ A;  2TSS A;  2ZT9 C;  3MXU A;  2PW7 A;  1Z9F A;  1SJH D;  2EJM A;  3NQI A;  2QEX A;  3SHL A;  1WD0 A;  2K7V A;  3S2H H;  3CF5 A;  2JA9 A;  1IBM Q;  4OL7 A;  4MZ9 A;  2UUA L;  3PO2 B;  3X3M A;  3PGZ A;  4TQU S;  4A3K G;  1PH7 A;  1GJX A;  4K0K Q;  4K5V A;  5C6A A;  1X6O A;  5IP7 H;  3GTO H;  2LXJ A;  1PYW D;  3FKI H;  3I90 A;  4XT1 B;  1NBW A;  2H1E A;  4KKS A;  1V1P B;  1UEA B;  2NVQ B;  3NEM A;  4HSV A;  4JI1 L;  1VQJ A;  3D4R A;  4RH6 A;  3I72 A;  5M9O A;  3HOX H;  2K33 A;  2ZJP A;  2E5L L;  1OXX K;  1ILQ A;  1FD7 D;  1N36 L;  3S14 H;  4DPG A;  1B1Z A;  4DU9 A;  1HQM C;  5M3M G;  3S1M H;  2A6E C;  1JT8 A;  2L11 A;  4X66 Q;  1Q1E A;  5C4X B;  4DR6 Q;  1MI2 A;  2K5N A;  1GHJ A;  4HID A;  4JI5 Q;  3PMF A;  1JOR A;  5IP9 G;  2O4X A;  4HCS A;  3HOZ G;  3I7F A;  3FMC A;  2F4I A;  3GTQ B;  2BDO A;  3KDF A;  3HZX A;  4BY1 H;  1ICF B;  2B2V C;  4BY7 H;  2E74 C;  4QIW E;  2VL6 A;  3F2C A;  2KED A;  3CXC A;  4JC0 A;  3M4Q A;  2XSC A;  4BA2 I;  2IPK D;  3HP3 A;  4HIO A;  4GLX A;  1D8L A;  2K5W A;  4QY7 A;  5IYC H;  1IYU A;  2ZXP A;  5IP7 G;  1HZC A;  3FKI G;  1RJT A;  1TR5 A;  2H5X A;  1Q90 A;  2BE5 D;  4DR5 L;  4K2K A;  5C0X J;  3TP6 A;  3MTS A;  4H7B A;  1PTO H;  1PH5 A;  3DMU A;  5EPL A;  1U4R A;  1VS0 A;  3ZYY X;  3I4M H;  1XPR A;  3CKI B;  4A3G H;  2Z6B A;  4I65 A;  3PO3 B;  2XWB B;  3OWE B;  4MN3 A;  2WII B;  3JC6 6;  2XRS D;  5NUC A;  3S2D B;  1SNC A;  1STG A;  1SR3 A;  1SYC A;  1PH3 A;  4DNT B;  2JA7 G;  2IHE A;  3NUC A;  3SK4 A;  4C2M H;  2VNU D;  4A3D B;  3PQI A;  2AWO A;  3S16 B;  3MHB A;  1TII D;  3UDF A;  4BY1 G;  4BY7 G;  4GOP A;  4OEL B;  4JOI A;  2XIW A;  5IYB H;  1WFQ A;  5ELB A;  4XQQ A;  2R92 H;  2AQ3 B;  3I2Z A;  5IYC G;  3J80 i;  2DY7 A;  5C3E B;  3N6R A;  2EJG C;  1KRT A;  3VR2 A;  4K6D A;  1T5E A;  3UI2 A;  1W3S A;  1IL2 A;  1HZA A;  1Q46 A;  1O7Y A;  1NAP A;  5A2Q L;  3R93 A;  1RTO A;  4CGY B;  3MXN B;  3Q22 A;  4QF4 A;  4IO9 A;  3H3V I;  4A3M H;  1JWM D;  3CRK C;  3I4M G;  4A3G G;  4A3B H;  1X32 A;  1D2B A;  2FIN B;  2QCP X;  4KI0 A;  4HTH A;  4B3M L;  2EE1 A;  3K7A B;  4A3I H;  1SNP A;  5JEA J;  2YTX A;  5DLQ E;  3MEF A;  4J15 A;  4I7A A;  4TKO B;  2PCF B;  1J5E Q;  3BVG A;  1RD9 D;  2RBM A;  1GKH A;  1QJO A;  3ULL A;  1JOO A;  1PV4 A;  4C56 C;  2KJX A;  1CQV A;  4M1U B;  1KC8 C;  4N9T A;  5IYB G;  2A5H A;  3PUZ A;  2ZXO A;  2LFN A;  2B63 H;  2R92 G;  2K52 A;  1Y14 B;  3KLR A;  5KNB A;  1B3A A;  2O5I C;  1K0R A;  1XNQ L;  4A3F B;  3O13 A;  1N32 L;  2A19 A;  5IOD A;  3HOW B;  1F9P A;  2EIF A;  2N55 A;  4DR1 L;  2CW0 D;  1TWC H;  1WYD A;  3RNU A;  4LFA Q;  4A3M G;  3H3V H;  4A3B G;  1BF4 A;  1L1O A;  4RWS C;  4DUZ L;  5I9P A;  3M4O B;  1BR9 A;  3PIO A;  1EYG A;  4JI8 Q;  4A3I G;  1STH A;  4IPG A;  2F0J A;  2L1B A;  1QUQ B;  4A93 H;  3IFD A;  3C2P A;  3HOV H;  4IUU A;  4LFC Q;  2KBN A;  2ASB A;  3K8A A;  1QWY A;  5CBE E;  2M9V A;  1NUC A;  2UXD Q;  4ZQ3 A;  2E76 C;  3J81 c;  1SNQ A;  2E75 C;  3KOJ A;  1PZI D;  2B63 G;  1WI5 A;  3LGJ A;  1J8I A;  2MQH A;  5KGU A;  4GNX B;  3VDY A;  2JA8 H;  2QDB A;  1R4Q B;  2EXD A;  1I4R A;  3PUX A;  3NQT A;  1SDF A;  4FNF A;  4DK1 A;  3Q0A A;  2KCT A;  3H15 A;  3QIA A;  1I6H H;  3NBI A;  1HTL D;  2ES2 A;  1BQQ T;  4MTN A;  1WTW A;  2F0U A;  1ZXT A;  2DJG C;  4IUT A;  2SDF A;  2JSO A;  2LS0 1;  5E1F A;  2XTI A;  4RA8 A;  2VUM G;  5T1G A;  2WAQ G;  2QA4 A;  4A93 G;  1IBM L;  2A68 C;  1KLG D;  3HOV G;  4PZ8 A;  1SRU A;  4C1N I;  4K0K L;  2EVB A;  5K5P A;  1Q81 C;  1Z7T A;  5M3F H;  4A75 A;  4EQP A;  3DWP A;  3GTP H;  2KUM A;  3T53 B;  1HZ9 A;  4FYD A;  1DGS A;  1SYE A;  1A2U A;  3SR1 A;  1W6J A;  4BXX H;  2RDH A;  1EYA A;  1SYD A;  2QGQ A;  2JA8 G;  2Y0S B;  4DNR B;  1V1Q A;  1XWE A;  1FGB D;  2DJF C;  1TWG B;  1I50 H;  3MA2 B;  3GP7 A;  5F2D A;  2B2W A;  4X66 L;  1A6X A;  4DR6 L;  5ELD A;  1JQY D;  1L1O C;  1OXU A;  4JI5 L;  2RSN A;  1E24 A;  3EVQ A;  1Q86 C;  3T1H Q;  3CCE A;  4G7Z C;  3QOL A;  1CHP D;  2FXQ A;  1C9O A;  4TVA B;  1GUW A;  1EY4 A;  3R8B A;  3HS0 C;  1E2Z A;  2F3I A;  3D31 A;  3QJY A;  4S3S A;  3AYH B;  1BDO A;  5M3F G;  3D6W A;  1G6P A;  1F2Z A;  1BOS A;  1CK1 A;  1PYS B;  1WD1 A;  5ELC A;  4Y52 H;  3P1H A;  1PVO A;  1EFW A;  1I94 Q;  1BKB A;  2VB2 X;  1C4Q A;  4BXX G;  4PZ7 A;  2C9O A;  1VQL A;  1AN8 A;  2K14 A;  1D6E C; 
#chains in the Genus database with same CATH homology
 3HOU B;  5ISR A;  4IZ8 A;  5I2Y A;  3HKZ B;  1EY8 A;  1FNV A;  1MSH A;  3VYT A;  2EYP A;  2G9H D;  3V2T A;  1TS3 A;  4K5X A;  2KVM A;  5C44 B;  4HSP A;  4DA2 A;  3TZU A;  4EGV A;  3QO2 A;  1ENC A;  3A55 A;  3VR6 A;  2K5D A;  2C5C A;  2E2J B;  3H0G B;  2BCO A;  3GQB A;  1PRT D;  3J7Y W;  1PRT B;  1OO9 B;  1O78 A;  3J81 L;  5C4Z A;  1TVX A;  3ND8 A;  3FPU B;  4G57 A;  3W3A A;  4QCL A;  1WTQ A;  4UDU C;  2PZW A;  1ONL A;  3HRZ C;  5D14 A;  1GUS A;  4DAY A;  3TP5 A;  2JXM B;  4TRD A;  5J39 A;  2B2W C;  5I9O A;  4DGZ A;  2VB3 X;  2YU9 B;  5EBC A;  1G8Z D;  2JP1 A;  1SE4 A;  3RMH A;  4Q5V A;  1SYF A;  3S17 B;  3SK6 A;  1STY A;  3LWU A;  3A7L A;  2RVL A;  3MVV A;  1ZYR C;  3P20 A;  3OW7 A;  1D5X C;  2J7Z A;  1SJE D;  3A7A B;  1W6K A;  4A3J B;  1HCZ A;  1EY9 A;  2CQA A;  5C5M A;  3GD7 A;  1CA5 A;  4XIG S;  1L0Y B;  4N9P A;  1XYI A;  1ZKO A;  1IL8 A;  2A74 C;  3J7A F;  4IUR A;  4O1N A;  3M85 A;  3BDC A;  4KHV A;  1BBX C;  4ZRZ A;  2OEO A;  3K5O A;  1GUN A;  4KJN A;  4X3S A;  1NR4 A;  2KEC A;  2F3W A;  1OXV A;  3JAM E;  1WCM B;  2ZXR A;  4IFD H;  4HAE A;  1JCK B;  5M5Y B;  3MXG A;  3SE0 A;  4FF4 A;  2NVY B;  4F7X A;  4WJW A;  5CC4 A;  3BDL A;  3I70 A;  4ZLT F;  1I4H A;  3S1N B;  1S5B D;  3C1E A;  1O7L A;  3VR3 A;  5EGT A;  1LTA D;  2B8F A;  2CHB D;  1YNJ C;  4FF1 A;  5JVG 3;  1S5D D;  4EQO A;  4C3H B;  3M7G A;  3K0Y A;  2E2D C;  1D1I A;  1WTP A;  1AEX A;  4LMQ D;  3NBH A;  2SOB A;  4K14 A;  2QF7 A;  5IIF A;  3S15 B;  2AUK A;  1AZQ A;  3RLF A;  1HUM A;  2ICE C;  4KY6 A;  1DXM A;  2FHT A;  3DWA A;  1BCP C;  3NTK A;  1X3Q A;  3S9W A;  1SFO B;  2B2V A;  3GTG B;  4C3I G;  2F0S A;  2BA0 A;  2K03 A;  1MGS A;  1R4P B;  5D65 A;  1QB5 D;  2HDL A;  1LT5 D;  1V1O A;  1DCZ A;  5M5X B;  2K28 A;  3H3V C;  3NTI A;  2PQE A;  1KNA A;  1EYD A;  1V8Q A;  1EIH A;  1B53 A;  1UNS A;  4QUC A;  3BVM A;  4CBV A;  1QG7 A;  4DF7 A;  3R2T A;  3C3L A;  1TWA B;  1LTT D;  3GV6 A;  3X3N A;  1Y1W B;  1BNZ A;  5JAV A;  1Y8N B;  4RHS A;  5CV9 A;  5CBA E;  1B9N A;  3QG1 A;  3TBI B;  1DM0 B;  4U68 A;  1VF5 C;  3LWE A;  5ELE A;  5FO9 B;  5I2X A;  1EOT A;  5C3X A;  2L0C A;  4R8I A;  5IT9 E;  1LLR D;  3H6M A;  1VCI A;  2LMC B;  2ID0 A;  4DN4 M;  3GTK B;  3BG3 A;  1STA A;  2PNR C;  1LAB A;  1JWS D;  1EL0 A;  4K8J A;  2OF1 A;  1C48 A;  4U67 3;  2F0Q A;  4Y7N B;  1Y1V B;  5CGK A;  1PTO F;  2WKC A;  1K8M A;  1HFN A;  5CR3 A;  4KJO A;  1AW7 A;  3J80 L;  3HEJ A;  2F0H A;  1I3Q B;  5I4D A;  1SEB D;  2GA4 B;  5CV7 A;  1K8O A;  1PMR A;  2XWJ B;  3GO5 A;  4FO2 A;  4RGT A;  2ENB A;  1IW7 C;  2F0I A;  3K5M A;  5FLX E;  5EKL A;  1TY2 A;  3VYS A;  5EKK A;  4CJ1 B;  2XVS A;  4XDX A;  1EWC A;  1A3U A;  1GUT A;  1PFN A;  1TS2 A;  1RF2 D;  4M8A A;  5LHY 1;  1PFM A;  2NVX B;  1SSO A;  1RHP A;  3D4D A;  1R9T B;  2QIL A;  1EU3 A;  4RGN A;  1LO5 D;  4GZY C;  2PMZ B;  1EEF D;  4RGO S;  5FK9 C;  2K1B A;  1V1P A;  1Y8P B;  3D8G A;  3J7A V;  1BUV T;  1H9M A;  1DOM A;  4RGM A;  4L8J A;  5LL6 X;  3U9S A;  2DN8 A;  1B4O A;  4LK1 C;  1BCP F;  4FXG C;  1EFI D;  3Q6S A;  3T16 A;  3HGB A;  2EYM A;  3A8I E;  3ONA B;  5JPN C;  3V96 A;  1JE4 A;  4FXK C;  4A3K B;  4ZKB B;  1EY0 A;  4QB4 A;  4DK0 A;  1EYC A;  3NHH A;  3OOC A;  2F0F A;  4J8Q A;  5G3L F;  3Q23 A;  1MBY A;  1ENF A;  4IUQ A;  1YNN C;  3EFX D;  4MHE A;  4PQX A;  5M3M B;  2F0W A;  1XTC D;  2WIN B;  2YYZ A;  5EJW A;  3AB9 A;  2KOL A;  2HCC A;  1FR3 A;  1ET6 A;  2PO4 A;  2F0L A;  5ELF A;  2KCN A;  4X3T A;  2EY1 A;  4C3J B;  2AQ1 B;  5CV5 A;  1FNW A;  1FNU A;  3IFT A;  3D4W A;  1KDB A;  1XX8 A;  4H0L C;  5FKA C;  1CI3 M;  1Y8O B;  3DEP A;  1DOL A;  2NWG A;  3NSW A;  1LTS D;  2TMP A;  1KDA A;  2EY2 A;  2QEJ C;  3N52 A;  2KHS A;  2XN9 C;  3MC0 B;  5COR A;  2JA7 B;  3VR4 A;  1KAA A;  1Y69 U;  2WV6 D;  5CYU A;  4RCN A;  1OXT A;  1Q3L A;  1H9R A;  5DM7 3;  2RA4 A;  2I46 A;  2A6H D;  1PTO D;  1PTO B;  2Z1C A;  1H9J A;  3W2D A;  4KK7 A;  3I4M B;  4A3G B;  4PMW A;  4X3U A;  2BE5 C;  4QMG A;  5IGB A;  4ZYS A;  2BOS A;  5CMD A;  1IYV A;  2RKS A;  1SMY D;  4IAL A;  3OMG A;  1TWH B;  2IL8 A;  1EY6 A;  4XT3 B;  1ET9 A;  3MEH A;  4E6I A;  4RAU C;  4NKL A;  3CHB D;  5KRU A;  4KY7 A;  3KBG A;  3WDN A;  1TU2 B;  2ICI A;  1WTX A;  1Z6H A;  1JR0 D;  2EXZ A;  3VA7 A;  5C4J B;  1H9K A;  1SYB A;  4A3M B;  2L4N A;  1ESF A;  4A3B B;  4A3I B;  1Q8I A;  2A69 D;  3I3C A;  1LTG D;  4H13 C;  1G6Z A;  3R3O A;  2BA1 A;  5EQ0 A;  1JOQ A;  4CJ0 B;  3WOE A;  2J4X A;  2O2L D;  4H44 C;  4KV6 A;  1H9S A;  1CTM A;  4Q0F A;  4B9X A;  1B2T A;  1NR2 A;  2IX3 A;  1VF7 A;  5KYL A;  4FP5 D;  1LTI D;  1M4V A;  5LL6 S;  5G3L D;  1PDQ A;  1U4M A;  2RDF A;  3SK5 A;  4KD3 A;  3K57 A;  4RCO A;  4Z9C B;  2VUM B;  4C1N K;  4A93 B;  3MFG A;  1SNO A;  5IGD A;  1SE2 A;  3HOV B;  4K8I A;  3ERQ A;  2AUJ D;  2EY6 A;  2JA6 B;  2EYH A;  1WTV A;  1AP0 A;  4NDX A;  3K6O A;  3FDT A;  3C46 A;  2F0N A;  4IFD I;  1OXS C;  5C5L A;  4ODG A;  2EPB A;  2KCC A;  3KBX A;  3MXP A;  3CU7 A;  1G29 1;  3FPP A;  3JAM L;  2F0D A;  2NTS A;  3FVQ A;  1EWH A;  2D62 A;  2SNM A;  3SVM A;  2IX0 A;  2FFK B;  2A6E D;  1CZW A;  5M3F B;  4CHT B;  2R93 B;  2L12 A;  1MSG A;  3BYY B;  2NYZ D;  2OXP A;  1NSN S;  1Q1B A;  3NP8 A;  4NMZ A;  5FO7 B;  1PZJ D;  2PPB C;  1WVL A;  3VYU A;  4I7Z C;  1KAB A;  1IKM A;  3TP7 A;  2L5T A;  1A3V A;  3CQZ B;  1F2Y A;  3G6J B;  4F87 A;  4CKC A;  1SE3 A;  4KY5 A;  1D1K A;  1S5F D;  4UAI A;  2F3V A;  2MUY A;  3WOF A;  2K6A A;  5I6W A;  3FRP B;  4NW2 A;  2MGS A;  1F9Q A;  3FEW X;  2B2U C;  5JPM C;  2K05 A;  3BVZ A;  1JIC A;  2LKV A;  1GXD C;  2AQ2 B;  4J1M A;  3KLS X;  4ZUJ A;  3M7N A;  2PZT A;  1BXT A;  3SDZ A;  1B9M A;  3H09 A;  5D3I B;  4IFD G;  3P7J A;  1EY5 A;  5KIX A;  2X6G A;  3OHX C;  3PUW A;  3V05 A;  5IGG A;  3SXH A;  3LX0 A;  1I6V C;  2VXW A;  5IGE A;  2EDG A;  3QWN A;  5KYI A;  3DUZ A;  3A54 A;  3IAY A;  2SNS A;  1VMC A;  3NWS A;  1S5C D;  4DAV A;  2F0O A;  4OIK A;  3NK9 A;  1SAP A;  3M3Y B;  2IW3 A;  2KEE A;  5JVH 3;  3NE5 B;  4P2C B;  1HQR D;  2D2C C;  1U4P A;  2NBF A;  1DOK A;  1F9S A;  1PRT C;  5IT9 L;  3T13 A;  1QCB D;  5DNF A;  3LNN A;  1JB3 A;  2L9H A;  5E4X A;  1QE6 A;  3EA6 A;  4R9W A;  4X3K A;  2D5D A;  2F0M A;  1V43 A;  2RQX A;  2F1M A;  1STN A;  1U4L A;  3OSO A;  1KTK A;  1GHK A;  2Z4H A;  2EYJ A;  2O5J C;  4IN3 A;  4HN7 A;  1KNE A;  4JBW A;  1ENA A;  1HA5 A;  3TME A;  1KLU D;  1LTB D;  3S1Q B;  2JE6 I;  2RDG A;  1HA6 A;  4IUP A;  5FO8 B;  3OMC A;  5FLX L;  4V0B A;  1UAP A;  4V19 0;  3TSS A;  4EQN A;  4OO1 I;  3ERO A;  4JK1 C;  5EPJ A;  1SND A;  1Q12 A;  1HRJ A;  4HR7 B;  3VA5 A;  4ID6 A;  1F77 A;  3BS1 A;  1BO0 A;  1EZ8 A;  3L7Z C;  1ESR A;  1AZP A;  5KND A;  4EVO A;  5BN5 A;  4OGQ C;  3DEO A;  1TS4 A;  2J0T D;  3HOY B;  1ROD A;  4OIJ A;  5E4W C;  5C4H A;  2F0V A;  3PIP 3;  2Q8R E;  4NP5 A;  4ILW A;  4C3J G;  2A68 D;  2B2Y C;  5D3D A;  1I4X A;  4C3I B;  4ZKC B;  2A73 B;  1O80 A;  3I8Z A;  4OO1 H;  3S1R B;  2EOT A;  3RZO B;  3BDO A;  2Z8L A;  2DNC A;  3SEB A;  1IKL A;  1PLF A;  2LY7 A;  2Q8T A;  4HCE A;  3J80 E;  3AU7 A;  3G7L A;  2NN6 I;  5AFW A;  4G7O C;  1X3P A;  5BN4 A;  2FJ2 A;  3TDQ A;  3NPP A;  4FVM A;  3K5N A;  1RTN A;  1HHV A;  3RD4 A;  4PMB A;  2WP8 J;  2E2H B;  2F0G A;  3I4L A;  2H4O A;  3A8J E;  3D3R A;  1TS5 A;  4OO1 G;  5C0X I;  4G7H C;  1RKN A;  4XQJ A;  1QNU A;  2MHV A;  2F0T A;  3T4A C;  2WAC A;  1A15 A;  1MD2 D;  1PRT F;  2NN6 H;  4L6T B;  2M2L A;  3KLS A;  4F8M A;  1JC7 A;  3M4Y A;  2MP1 A;  4ZUI A;  2Z4I A;  3HOZ B;  1EEI D;  2X6L A;  3TP8 A;  1EIG A;  1II3 A;  4WOR A;  4XXE A;  1XXG A;  3S2H B;  3E0J A;  1D5M C;  1AFP A;  5A2Q E;  2OT2 A;  3PUY A;  3U9O A;  3SK8 A;  2K32 A;  2NTT A;  5CV6 A;  5EBD A;  3GTO B;  1O7Z A;  1E0B A;  3FKI B;  5C0X H;  3NXW A;  1EZ6 A;  3MWY W;  4KN7 C;  3BZD B;  3L9A X;  5FOB B;  4RHR A;  3QOJ A;  3HOX B;  2IJ0 A;  2XRQ D;  1SNM A;  5DEH A;  2EZV A;  5HGT A;  3S14 B;  1UUP A;  4B9W A;  3IKJ A;  1I4Q A;  3S1M B;  5CV4 A;  1CM9 A;  2EJF C;  2R3Z A;  2NN6 G;  5BN3 A;  5IGC A;  1J9O A;  3MXN A;  4KKT A;  2B39 A;  4KN4 C;  1ZYR D;  3AMU A;  1VDZ A;  3E6Z X;  4G4K A;  4BY1 B;  4BY7 B;  4FF3 A;  1CT1 D;  3K59 A;  1E2V A;  2HCI A;  3NWT A;  4A3E B;  4BBS B;  2FMM A;  3EJI A;  3GTJ B;  5C0X G;  3QB3 A;  3KUP A;  1PXU A;  1U9R A;  2R6G A;  1KDC A;  1TT2 A;  1CQF A;  2K01 A;  4IUN A;  5DM6 3;  2XNA C;  3E5S A;  3VYR A;  3PUV A;  2EYL A;  1GUO A;  4HED A;  3DXJ C;  3BYT B;  4QUF A;  1IHZ A;  1H9S B;  5JEA H;  1LAC A;  2MPM A;  5T1I A;  2NB0 A;  3I73 A;  3OIQ A;  4K2L A;  4C2M B;  2IX1 A;  1DJR D;  2I07 B;  5HUR A;  2EY5 A;  4F88 A;  2X69 A;  2DY8 A;  1VMP A;  3K58 A;  3OIP A;  1LTR D;  4FF2 A;  4XYQ A;  2R92 B;  5JJZ A;  1I4P A;  1ML0 D;  1EQV A;  4XYO A;  2JEA I;  5K36 H;  3T51 B;  1I4G A;  1T5X D;  2PZU A;  2RSO A;  2MJ8 A;  1LT4 D;  4ABN A;  5KEE A;  1YNJ D;  3H94 A;  1TKW B;  1Z47 A;  2K04 A;  2V4D A;  3MZ5 A;  1G91 A;  3MAQ A;  1E2W A;  3C1F A;  1NCV A;  5JEA G;  4BS9 A;  5JOB A;  2D9U A;  2QKI C;  1LT6 D;  4KKU A;  4BWG B;  4RKL A;  2F0P A;  4IQZ A;  2NVT B;  1SBB B;  1K83 B;  3I4N B;  3EQL C;  4IUV A;  1BCP D;  1BCP B;  4ZAI A;  1L0X B;  1M8A A;  3URY A;  2B63 B;  4IFD J;  2Q8I B;  5A35 A;  4K6L A;  4LAA A;  4DFA A;  3IL8 A;  5KNC A;  1DD2 A;  1ICW A;  1D5Z C;  1STB A;  2DNE A;  5K36 G;  1B50 A;  3VR5 A;  1TWC B;  1PZK D;  3PV0 A;  4PMC A;  4CKE A;  4XQN A;  2EYF A;  2CW0 C;  3DWQ A;  2WAQ B;  2JEB I;  1F9R A;  4O42 A;  1S4Z A;  3L3O C;  1CZG A;  4C3H G;  1SXT A;  1WTO A;  4AYB B;  1SYG A;  5IGF A;  3PIO 3;  5E3F A;  1TQO A;  3DHQ A;  2B2U A;  5COY A;  2N88 A;  5CV8 A;  3Q24 A;  5M5W B;  2JA8 B;  1RDP D;  3I91 A;  1QNK A;  4KMU C;  3KF8 A;  2WB1 B;  1F2L A;  1HPC A;  3ND9 A;  1A3T A;  1I6H B;  3J81 E;  2K5Q A;  4KD4 A;  2E2I B;  2HDM A;  1EQT A;  4FXD A;  3T56 B;  2JYO A;  1LT3 D;  3RUZ A;  3A56 A;  3TN2 A;  2HQE A;  2B2T A;  1A2T A;  1CHQ D;  3D6C A;  1QIL A;  2F0E A;  3A8K E;  1GUG A;  2NZ1 D;  5J22 A;  3GTP B;  2R7Z B;  1HUN A;  2BDN A;  2A6H C;  4HMJ A;  1PTO C;  2FMC A;  2F03 A;  3CRL C;  1I50 B;  4OHJ A;  2F0K A;  2KQ3 A;  1QOH A;  3P75 A;  2HUG A;  4CJ2 C;  4CKB A;  4B08 A;  4TSS A;  5J1Z A;  1G2S A;  3GTL B;  1IW7 D;  4DXF A;  1B44 D;  4DAP A;  3K5L A;  4K5W A;  1G2T A;  1DYQ A;  1SMY C;  3HG9 A;  5IOC A;  1ILP A;  1WTR A;  3ITP A;  2AWN A;  2NUC A;  1EU4 A;  3F2U A;  4ULL A;  1JWU D;  2PW5 A;  2JA5 B;  4ME5 A;  1C8C A;  1GOZ A;  4L63 B;  3GV3 A;  3TZD A;  4KTA A;  4YIJ A;  2IWH A;  1PFB A;  3H91 A;  1DON A;  1STE A;  4LJZ C;  1F2M A;  1EY7 A;  3NTH A;  4R8N A;  4ZK9 B;  4QIW B;  1HTP A;  1TWF B;  4XTC S;  2A69 C;  1RCV D;  4MIU A;  2IT1 A;  4PNY A;  1FYC A;  4WRD A;  5DAU A;  4BBR B;  3MFY A;  3RZD B;  1TY0 A;  2B2T C;  2L55 A;  2G9D A;  5EKI A;  1S5E D;  5EPK A;  1CA6 A;  2KA7 A;  5I6Y A;  3GTM B;  1HXY D;  1DZ1 A;  2WKD A;  1ZEQ X;  4RFB A;  1LV9 A;  3OPO A;  2B2Y A;  4WFN 3;  5TSS A;  1CFM A;  1HFG A;  4KHZ A;  4PV1 C;  3R2I A;  1JOK A;  1YNN D;  4HMI A;  4DXG A;  2R61 A;  2EYO A;  5C3W A;  3KK7 A;  2CVR A;  3DM1 A;  4J6H A;  2SEB D;  4RKB A;  2PYK A;  2M00 A;  3OWF A;  2B8G A;  4BA1 I;  2TSS A;  2ZT9 C;  3MXU A;  2PW7 A;  1SJH D;  2EJM A;  3NQI A;  3SHL A;  1WD0 A;  2K7V A;  4OL7 A;  3PO2 B;  3X3M A;  4TQU S;  1GJX A;  4K5V A;  5C6A A;  1PYW D;  3I90 A;  4XT1 B;  2H1E A;  4KKS A;  1V1P B;  1UEA B;  2NVQ B;  4HSV A;  3D4R A;  4RH6 A;  3I72 A;  5M9O A;  2K33 A;  1OXX K;  1ILQ A;  1FD7 D;  1B1Z A;  4DU9 A;  1HQM C;  2A6E C;  2L11 A;  1Q1E A;  5C4X B;  1MI2 A;  1GHJ A;  3PMF A;  1JOR A;  2O4X A;  4HCS A;  3FMC A;  2F4I A;  3GTQ B;  2BDO A;  3HZX A;  2B2V C;  2E74 C;  2KED A;  2XSC A;  4BA2 I;  2IPK D;  3HP3 A;  2K5W A;  1IYU A;  2ZXP A;  1RJT A;  1TR5 A;  1Q90 A;  2BE5 D;  4K2K A;  5C0X J;  3TP6 A;  3MTS A;  4H7B A;  1PTO H;  3DMU A;  5EPL A;  1U4R A;  3ZYY X;  3CKI B;  4I65 A;  3PO3 B;  2XWB B;  3OWE B;  4MN3 A;  2WII B;  2XRS D;  5NUC A;  3S2D B;  1SNC A;  1STG A;  1SYC A;  4DNT B;  3NUC A;  3SK4 A;  2VNU D;  4A3D B;  2AWO A;  3S16 B;  3MHB A;  1TII D;  2XIW A;  5ELB A;  4XQQ A;  2AQ3 B;  2DY7 A;  5C3E B;  3N6R A;  2EJG C;  3VR2 A;  4K6D A;  1T5E A;  3UI2 A;  1O7Y A;  1NAP A;  5A2Q L;  3R93 A;  1RTO A;  4CGY B;  3Q22 A;  4QF4 A;  1JWM D;  3CRK C;  1X32 A;  1D2B A;  2FIN B;  2QCP X;  4KI0 A;  4HTH A;  2EE1 A;  3K7A B;  1SNP A;  5JEA J;  4TKO B;  2PCF B;  3BVG A;  1RD9 D;  2RBM A;  1QJO A;  1JOO A;  4C56 C;  2KJX A;  1CQV A;  4M1U B;  4N9T A;  2A5H A;  3PUZ A;  2ZXO A;  2LFN A;  3KLR A;  5KNB A;  1B3A A;  2O5I C;  4A3F B;  3O13 A;  5IOD A;  3HOW B;  1F9P A;  2N55 A;  2CW0 D;  1BF4 A;  4RWS C;  5I9P A;  3M4O B;  1BR9 A;  1STH A;  2F0J A;  2L1B A;  3IFD A;  3C2P A;  4IUU A;  1QWY A;  5CBE E;  2M9V A;  1NUC A;  4ZQ3 A;  2E76 C;  1SNQ A;  2E75 C;  1PZI D;  1J8I A;  5KGU A;  2QDB A;  1R4Q B;  1I4R A;  3PUX A;  3NQT A;  1SDF A;  4FNF A;  4DK1 A;  3Q0A A;  3QIA A;  3NBI A;  1HTL D;  1BQQ T;  1WTW A;  2F0U A;  1ZXT A;  4IUT A;  2SDF A;  2JSO A;  2LS0 1;  5E1F A;  4RA8 A;  5T1G A;  2A68 C;  1KLG D;  4C1N I;  2EVB A;  5K5P A;  1Z7T A;  4EQP A;  3DWP A;  2KUM A;  3T53 B;  4FYD A;  1SYE A;  1A2U A;  3SR1 A;  1W6J A;  2RDH A;  1EYA A;  1SYD A;  4DNR B;  2Y0S B;  1XWE A;  1FGB D;  1TWG B;  3MA2 B;  3GP7 A;  5F2D A;  2B2W A;  1A6X A;  5ELD A;  1JQY D;  1OXU A;  2RSN A;  3EVQ A;  4G7Z C;  3QOL A;  1CHP D;  1GUW A;  1EY4 A;  3R8B A;  3HS0 C;  1E2Z A;  3D31 A;  3QJY A;  4S3S A;  1BDO A;  3D6W A;  1F2Z A;  1BOS A;  1CK1 A;  1WD1 A;  5ELC A;  3P1H A;  2VB2 X;  1C4Q A;  2C9O A;  1AN8 A;  1D6E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...