5CV9A

Crystal structure of staphylococcal nuclease variant delta+phs l36e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRELLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cv9A00
2F3WA 5KRUA 1F2MA 5CC4A 1SYBA 4K14A 2QDBA 4B9WA 2OF1A 4LAAA 2F0WA 4R8NA 4EQPA 4PNYA 3MHBA 4ME5A 2EY2A 3QOJA 4EVOA 2EYLA 1A2TA 5CV6A 4RKLA 5IOCA 4IALA 1SNPA 1NUCA 3OMCA 4K6DA 1SYGA 3SK4A 1A3TA 5HGTA 4K5VA 4KD4A 4S3SA 4F8MA 2M00A 2F0FA 3D8GA 4HMIA 2EY1A 2OXPA 5K5PA 1EYAA 4QB4A 5KGUA 3NQTA 2F0UA 1U9RA 3R3OA 3NK9A 4KTAA 4ID6A 5C4HA 3NXWA 2LKVA 4KV6A 2RDFA 2HQEA 1SYFA 3EJIA 4H7BA 1KAAA 4DU9A 4I65A 4ZQ3A 1SYDA 3BDLA 4KHVA 2RBMA 3HEJA 1STNA 1EYDA 5DAUA 1F2YA 5M9OA 1RKNA 5ISRA 1KDBA 1EY6A 3NHHA 4K8IA 4QMGA 2KQ3A 3D6CA 5J1ZA 3SK6A 3V2TA 1JORA 3C1FA 4ZUIA 1EYCA 5CV8A 3RUZA 5KIXA 4E6IA 3QB3A 3QOLA 2EY6A 5HURA 5EGTA 4F7XA 3SK8A 2EY5A 4DF7A 3OMGA 3LX0A 1EQVA 4KJNA 2F0PA 1SNCA 4HTHA 5IGFA 2PYKA 2F0GA 3D4WA 3MXPA 2RKSA 3SXHA 2F0LA 4K5WA 1AEXA 4K5XA 5DEHA 3S9WA 2EYMA 2EYOA 4MIUA 2F3VA 1STYA 2OEOA 2PQEA 3U9OA 5JAVA 1JOOA 4PMCA 2EYPA 1SYEA 2WACA 5I6YA 1KDAA 3MVVA 4KY7A 1TT2A 4EQNA 4KY6A 1EY8A 4IUNA 3MEHA 4TRDA 5CV5A 5E3FA 5CV7A 1NSNS 1EY5A 2PW5A 2SNSA 4J1MA 4KJOA 4NP5A 2EYHA 3TP6A 5IGCA 3EVQA 5CV9A 4IZ8A 3TP8A 2F0SA 1EY0A 2NUCA 5IGDA 3D4DA 3E5SA 2F0KA 2F0EA 5KYIA 3OWFA 4EQOA 5J22A 3OSOA 3NP8A 5I9OA 1SYCA 2F0HA 3EROA 5CGKA 3SK5A 1ENAA 2O4XA 4J6HA 5IGBA 3P75A 1STHA 2F0DA 1EZ8A 4RKBA 5I9PA 5C4ZA 3BDCA 5EKLA 1SNQA 1TR5A 2F0IA 4QF4A 1F2ZA 5IODA 5IGEA 5J39A 1EY4A 1KABA 2EXZA 1SNMA 4YIJA 1TQOA 2EYFA 4DFAA 2F0VA 1STGA 4NMZA 2F0TA 3TP7A 2F0OA 5IIFA 4HMJA 3TP5A 1SNDA 1A3VA 2F0QA 2F0JA 4K2KA 1STAA 4N9PA 1A2UA 1IHZA 4NDXA 3SHLA 3T13A 4K8JA 3H6MA 1A3UA 3HZXA 4KD3A 4OL7A 5F2DA 4B9XA 5E1FA 3P1HA 3MZ5A 3ITPA 4G57A 5C6AA 4K2LA 4WORA 1KDCA 1EY7A 5KYLA 1JOQA 1EY9A 4NKLA 4WRDA 2F0MA 2PZWA 3C1EA 2ENBA 2KHSA 2PZTA 5C3XA 5I6WA 2PW7A 5EKKA 3ERQA 4PMBA 3T16A 1EZ6A 3PMFA 1STBA 2SOBA 5KEEA 4ODGA 3DHQA 4KY5A 5CR3A 3DMUA 4N9TA 2SNMA 1JOKA 1SNOA 2F0NA 5C5MA 4ZUJA 5C5LA 3SR1A 2EYJA 5CV4A 3TMEA 3VA5A 5JOBA 2PZUA 1ENCA 5NUCA 5C3WA 5IGGA 4DGZA 1II3A 3NUCA
chains in the Genus database with same CATH superfamily
2MO0A 3RNUA 1V9PA 2M2LA 1DONA 4C56C 5JPMC 2MQHA 1Y1VH 1XPRA 4K6DA 4BY1G 4OWXB 1PLFA 3C2PA 4HCEA 3GTLH 3W3AA 4L6TB 3PO2B 4TQUS 1LTSD 4RG1A 3RLOA 4KN4C 1TIID 3G4SA 2K4KA 4DV0Q 1WCMG 4ZQ3A 1Q82C 3M85A 3HOXB 2GN5A 4HJ7A 4G7OC 1E24A 3T4AC 2UUBQ 2EE1A 5M5YB 3U9SA 2DJGC 1GJXA 2G9HD 1XX8A 1LV9A 2RKSA 2F0LA 1UEAB 4HIMA 4NXNQ 2EXDA 2NVYH 4X3UA 3S9WA 2ZM6Q 4FXDA 3DXJC 3ONAB 2VUMG 2EJGC 3CCRA 2VQFL 1L1OC 5IGCA 1ASZA 3FDTA 4JI6L 4OO1I 5FLMH 4HEDA 3OSOA 1LT5D 2R7ZH 3CCSA 3RLFA 2L9HA 4DR2Q 1CI3M 1QG7A 4RKBA 4NW2A 4GOPB 1VF5C 3HOUH 2EXZA 3PUXA 1RCVD 1SNMA 4XQNA 5E4XA 3SEBA 4A3BG 1PYSB 3VYTA 3M4OH 3T13A 1VDZA 5KNDA 1JQYD 2YTVA 4DAMA 4K2LA 4QUFA 1N34L 1EY7A 1D5MC 2JA6B 2ENBA 1U4MA 2KHSA 2PZTA 2J4XA 4IO9A 4GOPA 2SOBA 4X66Q 1WTWA 5CR3A 1Y1WB 2WB1E 2F0NA 3QR8A 1CK1A 1E1OA 3TMEA 2PZUA 1HCZA 2R7DA 1VQJA 1PYWD 2O2LD 2I5MX 2NTTA 4JOIC 1P8LA 1LT4D 2A68D 3BZDB 2F0WA 4R8NA 4DV5L 3K0YA 3QOJA 4O2DA 1WTOA 2MPMA 1PVOA 3OHXC 1EWHA 5HGTA 2NZOA 1LTID 2IW3A 2F0FA 1PH2A 1LO5D 1NJIC 5IYDG 1JJ2A 2OXPA 3DWAA 4DR6Q 2D9UA 3NXWA 4B3SL 2A6EC 2ZTCA 1KTKA 4I7ZC 4A3KH 5ISRA 4FNFA 4C3JH 3PO3B 3C1FA 4ZUIA 2KCCA 1QNUA 5KIXA 5FLXE 3I4MG 1XNQL 3V96A 1HUMA 3SK8A 3I4NH 1LACA 3STBC 3J81E 4HSPA 3D31A 1AFPA 3A7LA 1TVXA 5G3LD 3MXPA 4RGNA 1W2BA 2KUMA 1YZ6A 3KJPA 2RA4A 1EEFD 2HDMA 4NP5A 4U673 4FF1A 2KHIA 5CV9A 5EAYA 4YHHQ 1EY0A 5M3FH 5A35A 4EQOA 2K6AA 1PRTF 4BY1H 4QGUA 3BS1A 1VQCA 3BU2A 1TWFH 3R2IA 3P75A 4JCVE 4A3FG 2NB0A 4B3SQ 3S2HH 3AEVA 1B4OA 3HGBA 2CH4W 1F2ZA 5IODA 3PQIA 3DUZA 5LMNW 1DCZA 1TWGH 1RTOA 4DFAA 3T1YL 1GUSA 4HMJA 2ALYB 1QB5D 5I2YA 1BF4A 2E76C 4UP7A 3W1BA 4FF3A 2B29A 4A3GG 2K52A 2WAQB 1RHPA 2JA7H 1E0BA 4IFDH 1JOQA 1CUKA 3HOYG 5C0XH 3S24A 2EZVA 3F2CA 2A69C 3S2DB 1V43A 2H5XA 2A19A 4N9TA 2B63G 1XNRL 3OTOL 3A55A 4DV2Q 3FKIB 3PIP3 1SMYD 1SBBB 2ZJRA 1EQQA 2QCPX 4LUOA 2HCCA 5KRUA 1Y8PB 4K14A 2DNCA 1YNXA 3EIVA 2EIFA 2K14A 5IOCA 1QILA 1MSGA 3I91A 2RSNA 2AWNA 2XNAC 4K5VA 5FOBB 2UUCL 2I0QA 1IW7C 1F77A 3R93A 4C3IH 2K5VA 5JVH3 1BBWA 3S1MB 2AWOA 4BBRB 3CXCA 1L1OB 4P71A 4A3IB 5DAUA 3GTPB 3WOEA 3M9BA 3L2PA 2PMZB 1K28A 1KDBA 1I4HA 2AUJD 3BJUA 3CD6A 5C4XB 2IX3A 1PRTC 4E6IA 3I70A 4QUCA 4OGQC 1E3PA 1PH5A 4LF7Q 3G6EA 1YEZA 2Z9HA 5C44B 1L1OA 5DEHA 2NVQB 1M1KC 2CVRA 1YIJA 1EFWA 1Q90A 2E74C 3Q24A 2D0PA 4IFDI 3MEHA 3GV6A 5C0XI 1EIYB 5DLQE 4X3SA 3DM3A 2VXWA 3S1NB 2BE5C 2NUCA 2F0EA 4O1NA 2XN9C 3U50C 5FJ8G 2B3GA 3CCMA 2UUCQ 1SYCA 1WTRA 2UXDQ 1ILPA 1S5CD 1D1KA 1ENAA 2AQ1B 3MA2B 3CCEA 2B2YC 1FD7D 3N6RA 4JI5L 1NY4A 3PCOB 4BXXG 2EYFA 1STGA 4JBJA 3VYUA 1SFOB 2NN6G 1D5XC 2X6LA 4K2KA 1TWAH 4IPCA 4KK7A 3BZCA 2ZXPA 1WD0A 1QWYA 4BBSB 2HD3A 5M3MG 1V1PB 3D4RA 1CFMA 1VQLA 2E8GA 3GTQH 1X6OA 2KCTA 1CKOA 4DAYB 3E6ZX 5C3XA 5FLXc 1EWIA 2OTJA 1K73C 4A93G 4LF4Q 1OXUA 3J81c 4EGVA 1ONLA 4JOIA 1Y1VB 5C5MA 4ZUJA 1ENCA 4LFCQ 4AQYQ 1A8VA 2RCFA 1JJCB 4EQ5A 2IHEA 1U4RA 2OF1A 3CP0A 1V1PA 2Q8TA 4PNYA 3MHBA 4NPSA 2CH4A 4A3EH 2LY7A 1A2TA 3BZKA 4DAYA 4IALA 1K8MA 2KA7A 4XTCS 3KK7A 4RMFA 2X6GA 4DR5L 4MZ9A 4YY3L 3RMHA 3LWUA 2X69A 1M8AA 2Y0SG 4BY7H 3OW7A 1GOZA 1U0LA 2BH8A 5BN4A 4LNQA 1AZPA 4J15A 4YCWA 2FFKB 1A62A 3K5NA 1MKHA 3NHHA 1JT8A 1BOSA 4R1JA 4FYDA 3QOLA 1J6QA 3VR2A 2RDGA 1E1TA 1V8QA 1H9SA 3NPPA 5BN3A 2F0GA 2K01A 3CHBD 1WTXA 4CGYB 1X3FA 3HKZE 3K5LA 1IZ6A 2R7ZB 1STYA 2OEOA 3JC66 4PMCA 2AUKA 1NNXA 4JYAQ 4JW0A 4EQNA 3HOUB 1PXUA 2K7VA 3LWEA 4JC0A 2F0KA 3OWFA 3M4OB 4KLKA 2RVLA 1EUJA 4RGTA 3SK5A 2ASBA 4DR5Q 1M4VA 2GVBA 5EPJA 4CKBA 1TS3A 1EU3A 4B08A 2CHBD 2IWHA 3GTJH 1SNDA 1A3VA 5GAGC 4GKKL 3MZ5A 5LHY1 3CPFA 4ZK9B 1QUQB 2FHTA 1KQSA 2CWPA 5IT9E 3K6OA 4V190 1XPUA 1SE2A 2BH2A 3KOJA 3R2TA 4IQZA 1HA6A 5C4JH 1GD7A 4Q5VA 2EYJA 5JPNC 2KJXA 2KENA 5NUCA 3NELA 3PF4A 3F2UA 1PRTB 2AQ3B 1VQ5A 2HHHL 1QUQA 2R92H 1SXTA 4V0BA 1C8CA 1PTOF 4EVOA 1WFQA 2NZHA 1ILQA 4RKLA 2PO4A 4ZKBB 1B9NA 4JI7Q 4A3KB 4CDDC 4FF4A 1X3PA 5J3BA 4C3JB 2XGTA 2O5IC 4HMIA 3GD7A 1VQ9A 3K80C 5JEAG 1PH4A 1E7ZA 4DUZQ 2RDFA 3EJIA 1SYFA 1W3SA 2SDFA 4H7BA 1XPOA 3I73A 2FXQA 4KHVA 3HEJA 2KEDA 3CCQA 4DV4L 2WB1B 2DY7A 2N8NA 4L5QA 1LTAD 1TY0A 3F1ZA 5CV8A 3RUZA 3FEWX 1FNVA 1B7YB 1SN8A 4GN5A 1ZKOA 1OXVA 3LX0A 2K1BA 3G7LA 4KJNA 1UEBA 4ILWA 2A6ED 2L5TA 4DR4Q 2UXBQ 5M3FB 1HTLD 2R93H 2EYOA 1TWFB 1O7IA 1YJNA 2JA8G 3MXUA 4IUNA 1VQOA 1IXRA 2HHHQ 1K3RA 3S2HB 1JC7A 4OX9L 3B6YA 1ESRA 3STBD 4DR7L 2F0SA 4X65L 1BXTA 1QCBD 2L0CA 4MTKA 5I9OA 1Q46A 4UPAA 4HIOA 2VW9A 2CWAA 4P72A 1N36Q 1B2TA 3E0EA 3K7UC 2JA7B 1I3QH 4QF4A 1TQOA 3T51B 3TS0A 1QZGA 4YCVA 3T56B 1D7QA 4JVZA 2MUYA 2PCFB 3KLRA 4DKAC 4I7AA 5IY0A 1WTPA 1S5FD 3MXGA 1FJGL 1A3UA 1HNZL 3UDIA 5IYBG 1PTOC 3S14H 5CYUA 3HOZB 1XYIA 3J7YW 2LFNA 2B2VC 2I5HA 5I6WA 2JQOA 4A3LH 2UU9Q 1SJHD 1PH9A 4KKTA 1TY2A 3G48A 3JAME 4YWKA 4C3HH 3F8TA 4DV0L 4C3IB 4HN7A 1DOKA 4HAEA 4EQPA 1D1IA 4G4KA 1SAPA 1TWCB 3HOVH 3HFZB 2A69D 2UUBL 1CT1D 2OT2A 4GS3A 1SYGA 4A3JG 2WP8J 5IWAQ 3DM1A 1SE8A 5EPLA 2HIXA 4DXFA 3M7GA 4HSVA 1U9RA 5DM63 4ID6A 4NXNL 3R8BA 1IYVA 3L3OC 4FO2A 2QF7A 1B3AA 2ZM6L 4AH6A 1FJGQ 1TS5A 3L9AX 1VS0A 2N55A 3FHWA 5J1ZA 1D5ZC 3J80E 1QNKA 1IW7D 3DEOA 3ULLA 2BA1A 3I3CA 4F7XA 5EBCA 1K9MC 3NSWA 1X9NA 5COYA 4YWMA 5IT9c 3S1RH 4IUTA 1Q81C 2JP1A 4X64Q 3ULJA 2E5LQ 3PV0A 5GADC 2TMPA 4CKEA 2QEJC 1JWUD 1VMCA 4DR2L 2HQLA 1PH1A 3Q0AA 2WACA 2UXCL 1S3OA 2BA0A 2G5DA 4KY6A 1PRTD 4PZ6A 4J1MA 1EY5A 1R4PB 3EVQA 1MJEA 4TKOB 1MIUA 1MD2D 1J9OA 3EBEA 2JEBI 3GTKH 3U4ZA 2HT1A 1GHJA 3J81i 4X62Q 1EYGA 4RCNA 2VQEL 1VQHA 1EZ8A 2K28A 2XVSA 2I5LX 5C4ZA 1SNQA 3OIPA 4DR1Q 4X66L 3H3VH 1FL0A 3WWVA 4BA2I 2F0TA 2VL6A 4RH6A 2BE5D 4GLVB 2Z8LA 4WFN3 2E2HH 2F0JA 5FLXL 1RJTA 1FNUA 3H6MA 3HZXA 1YHQA 2ZXRA 3J81L 1VQ8A 1D6EC 2JA5G 2EDGA 1LLRD 5IP9H 1WTVA 5C3EG 3RN5A 4DUYQ 4DK0A 3I7FA 1IBMQ 3C1EA 4KMUC 1KLUD 5EKKA 1H9MA 3S17H 5JJKA 4KKUA 1MBYA 1HFGA 3NQIA 4HJ5A 4QL5A 3HOZG 3TRZA 4MTNA 2UXCQ 4O42A 1YHBA 4DR6L 1II3A 3A8KE 5GAEC 2E2DC 1IL2A 3H0GH 1UE6A 2RQXA 1EIHA 3LGJA 3I90A 4BY7B 1M90C 1Y8NB 1O7ZA 3KUPA 1DGSA 1IBLQ 4A3DG 3HOWH 3BVMA 1TS2A 2VQEQ 1R9TH 3D6WA 4A3CH 2AHOB 3MTSA 2KBNA 4KTAA 1KAAA 2QEXA 4I65A 1EIGA 1PFSA 1STEA 4FP5D 3F2BA 1FGBD 3W5OA 4CBVA 1DJRD 3GO5A 1I6HH 1I50B 3QB3A 3CQZH 3ULPA 4YHHL 3S16H 3H3VI 4KKSA 2DJFC 1BVSA 1Z9FA 3MFGA 5IP7G 3D4WA 4MN3A 4MHEA 3E0JA 2EYMA 1F2LA 3KF8A 1PTOB 1AP0A 3JAMc 3J7ZC 4LF6Q 1X56A 1NSNS 2RF4A 3G6JB 3FVQA 3GTGH 1MSHA 3F2DA 3PO2G 4B3RQ 5K36H 1RD9D 1GUGA 5IGDA 1HNWL 1TXYA 2F4VQ 1ICWA 1DOLA 3GTJB 1HRJA 2PNHA 3H94A 1BO0A 2WIIB 3HOXG 3URYA 2YYZA 4JPBW 2DNEA 3BDCA 3FRPB 2F0IA 1YNJC 2WKCA 4JK1C 2JYOA 3WOFA 3SVMA 5BR8L 4GKJQ 4PG3A 1PZJD 4DV2L 4NDXA 3VR3A 3SHLA 1IHZA 1MHWC 1I4XA 2B2VA 1S72A 3HKZB 1J5EQ 3WDNA 5C4JB 2B8GA 1TU2B 4L8JA 2IPKD 1YNNC 2JA9A 5IYCG 2I46A 3J80c 4A3MB 4U68A 2DY8A 3S15H 2C9OA 3T16A 3SE0A 3DHQA 5LMUQ 1EU4A 2C5CA 1HR0W 3X3MA 4PZ8A 3TSSA 1Z6HA 1WCMH 4HJ9A 2WFWA 3KFUA 2F3IA 1HNWQ 4OONA 4AYBB 4LFBQ 3CMEA 2NYZD 1A63A 3ZJYC 4Y7NH 3I2ZA 1K8AC 1AE3A 4O0AA 3CU7A 2F52A 3K8AA 1IBKQ 1A3TA 5M5XH 2KVMA 2A73B 2M00A 3NWSA 2YU9B 2Z6BA 1AH9A 1XMOQ 3UI2A 1MI2A 5K5PA 4POGA 2PNRC 3DLLA 4C2MH 3R3OA 4LF7L 2L15A 5BR8Q 4PZ7A 4ZKCB 2EOTA 2JA6G 2VUMH 4JI4Q 3UDFA 1STNA 1HZ9A 3FPPA 2G9DA 3KBXA 4GNXA 5FO8B 2R93B 3NTHA 1Y1WG 1BCPC 1UNSA 1I4PA 2A5HA 4B3TQ 2MO1A 5M5WH 3AU7A 1HUNA 5IGFA 2UXDL 2ATWA 1B9MA 1RL2A 2MGSA 3W2DA 1EEID 3NBHB 3DWPA 5JAVA 3EN2A 1KDAA 3MVVA 1X32A 4A3BH 1JMCA 1EY8A 1VQKA 3KLSX 4C1NK 5EKIA 1F9RA 1I3QB 3V05A 4IURA 3U58A 2BCOA 2IT1A 3O13A 5ELDA 4DV6Q 5J22A 1C9OA 2F0HA 2FMCA 2CW0D 2O4XA 2XRQD 3S14B 4XYOA 1LUZA 1GUNA 4QQBX 4UDUC 4APVA 1EFID 3NBHA 2B39A 3PO3G 1KABA 3RD4A 4LF4L 1H9KA 1GXDC 2F0OA 1JWMD 1Z7TA 1LTLA 2L1BA 3OW2A 4C1NI 4K0KL 1CTMA 1PYBA 5A2QE 2XIWA 3AMUA 4LFCL 4AQYL 5D3IB 1VQFA 3ER0A 2D5DA 2JK8A 4X3KA 1ASYA 3IAYA 1VQ6A 2WKDA 3I4OA 4C3HB 1K8OA 2PZWA 3IL8A 3GDEA 1STBA 3HOVB 1PDQA 2ID0A 5IYDH 2NWGA 1BNZA 4KN7C 1CA5A 1HNXQ 3EA6A 1I94Q 1PTOD 5CV4A 1KNEA 3VA5A 5JJIA 1PMRA 4A3MG 3H15A 4B9WA 1J8IA 1VQGA 1K0SA 2BDNA 3A74A 3IKJA 1E2ZA 1F9PA 4H44C 1OTCA 1HHVA 4LWCA 2A6HC 1ZYRD 2RCNA 1SNPA 3OMCA 3I4MH 2KCMA 3SK4A 3PUVA 4P2CB 4QIWB 2IJ0A 1F9SA 4L5TA 2UUAL 1ET9A 1MGSA 4XDXA 3RR5A 3NQTA 2F0UA 2OCEA 1I4GA 3S1RB 4DN4M 4K0KQ 5M5YH 2WAQG 3Q23A 3QG1A 2RBMA 5IT9L 3GTLB 4LUVA 5HY6A 2K5WA 1CM9A 1KLGD 4HIKA 4DXGA 4JYAL 4QMGA 3D0FA 3V2TA 2FJ2A 1U4LA 2BDOA 3OYYA 4A76A 2TSSA 1I4RA 4IJHA 3FKIG 2B2WC 5FO9B 1NR4A 2F0PA 1SNCA 4HTHA 2E2IH 3VDYA 1H9SB 5D3DA 2V1CC 1GM5A 4K5WA 2WINB 4A3FH 5TSSA 3GV3A 1P16A 1V1QA 1CHQD 3GTKB 3K0XA 1SYEA 3BVGA 5KNCA 1GKHA 2NVXH 2DUDA 3J7A5 3VA7A 2NVYB 1JE4A 4LF5Q 4PV1C 3T1HQ 2E2HB 4BBRG 2A68C 4A3GH 2K75A 2UUAQ 3HOYH 3I55A 4JI0Q 4A3IG 1MJCA 1STHA 5KNBA 5H1SE 4L5RC 5E4WC 4G7ZC 4ABNA 2B63H 5C4XG 1AZQA 3S17B 4N9PA 3PUWA 4ZRZA 5E1FA 1VQDA 5C44G 4CJ1B 4P75A 1PV4A 3K81C 5KYLA 3HKSA 4LF8Q 3NWTA 1KRSA 3H0GB 5CORA 2EJMA 2Q2UA 3ND9A 4BA1I 3RZOH 1EZ6A 3PMFA 1S5BD 4AIMA 3CCVA 4JI7L 2A8VA 2K04A 4MNOA 3H91A 4KY5A 1O80A 5D14A 1UWVA 2C35B 4JI2L 4KHPQ 3HOWB 1T5XD 1EL0A 4AYBE 1R9TB 4ZLTF 1CHPD 2BOSA 3CC7A 4DUZL 2ZT9C 1KHIA 2QILA 3NENA 1BCPB 2NVTH 3A54A 1HQRD 1XWEA 2NBFA 1H9JA 2Q2IA 3A5UA 1G2SA 4HR7B 1TWHH 4NB3A 1PH8A 3C46A 4OO1G 3K58A 1AW7A 4JV5Q 1I6HB 4BBSG 3CQZB 4DR4L 4H02A 4RA8A 2UXBL 3MEFA 2HQEA 4DU9A 1ET6A 1EQRA 3CPWA 3PIPA 1EY6A 3SK6A 5JVG3 1Y1VG 4UY8C 4GN4B 3H09A 2EY5A 2R6GA 5FJ8H 2VB3X 3ERSX 1C48A 2YV5A 3JAML 3GTGB 1ML0D 4UHVA 1X3GA 1WTQA 3NTKA 4FVMA 4JI2Q 1N36L 1YI2A 1G8ZD 5FKAC 2ZJPA 1B1ZA 2F3VA 3I8ZA 2J0TD 3I4NB 4BXXH 5I6YA 2Y0SE 2NN6H 4Z9CB 3TDQA 1K83H 3D3RA 2F1MA 3CKIB 4IZ8A 2K5NA 1E2VA 3E5SA 5M3MH 3J80i 1BR9A 3TS2A 4UP8A 3J7AV 2EQSA 1YITA 4L63B 4LFAQ 1HR0Q 5I9PA 4A93H 5LMNQ 1NTGA 2UU9L 1EIFA 4R4QA 4YIJA 2R61A 4BY1B 1WOCA 1WJJA 3TP7A 3S15B 5LL6S 1VQPA 4IPDA 4X3TA 3GTOH 2F0QA 2XTIA 1KRTA 3J80L 4FXKC 4JBMA 2LMCB 4TVAB 1CA6A 3M4PA 4RCOA 5C6AA 5FLMG 1TWGB 2MP1A 1WCMB 3S1QH 2R7ZG 3NTIA 2YTXA 4RGOS 4XYQA 1IYJB 1N32Q 4ODGA 5IWAL 4Y7NB 3HOUG 4JBWA 4R4CA 4DNTB 1C0AA 1SNOA 4JBKA 5L37A 5M5XB 1QVCA 2MFIA 3HG9A 1SYBA 2IL8A 1GVPA 5GQOA 1FR3A 4QIWE 2VUMB 4B3ML 1BKBA 4LF9Q 2AQ2B 1EQTA 4KD4A 1O78A 3BYYB 2NN6I 4X64L 5KGUA 1UE5A 5AJ3Q 2E5LL 5M5WB 3SGIA 4BWGB 1DM0B 1RIPA 3AFQA 4CJ2C 1IYUA 5M9OA 4IOAA 2O5JC 1LM0A 2B2WA 2IX0A 4K8IA 4UAIA 3KLSA 3BG3A 4H13C 3VR4A 2MJ8A 2ICEC 4J8QA 1H95A 3KYHC 1S5ED 1NR2A 1FGUA 4DV1L 3I72A 1PHJA 4RFBA 3N52A 3J81j 3SXHA 1C7YA 1AEXA 4WJWA 1HQMC 4P73A 5ELOA 3VYRA 2DGYA 4X62L 3AFPA 3S1NH 1CSQA 5D65A 4DR1L 3A8IE 1CZGA 4A3KG 2RDHA 4C3JG 1QOHA 2EYHA 1DD2A 1Q8KA 4B3MQ 1D8LA 5KYIA 2PI2E 2JE6I 1HPCA 1VQ4A 1YHAA 1SRUA 3EROA 3QJYA 5CGKA 4DUYL 4GNXC 1RF2D 2K33A 1IBML 5IE8A 1U5KA 4OELB 2WB1G 3P20A 3GP7A 2PQAA 1OXXK 3Q6SA 2QW7A 1A15A 2F0VA 2EPBA 4NMZA 2Z1CA 2AMCB 4OHJA 1STAA 4JI3L 1A2UA 1OO9B 3PIOA 2I07B 3OOCA 1R4QB 5M3FG 3TEHB 2A74C 1G2TA 4XQJA 4IUPA 1AN8A 4DV1Q 1N9WA 1TWAB 4NKLA 3TBIB 2PW7A 3L7ZC 4DV3Q 1IBLL 1LT3D 3BVZA 4LK1C 2PPBC 1LYLA 2DN8A 1SEBD 3GTQB 4R8IA 3I4MB 1CQVA 2OWOA 1XTDA 5JEAH 1N33Q 1A6XA 1X3EA 5LL6X 5C3WA 4Q0FA 2E2JH 2KOLA 5AFWA 5CC4A 4LAAA 1T5EA 1XMQQ 2JA7G 4IFDG 5C0XG 2JXMB 2A1AA 3CRKC 3PUZA 2Z0SA 4S3SA 3NEMA 3PGZA 3PF5A 1GUWA 1C4QA 1OXTA 4A3EB 1UUPA 2FINB 4KV6A 1S5DD 1HZAA 4RWSC 4EX5A 4JI3Q 1QVFA 1X54A 2E2IB 4TSSA 2A6HD 2JA8H 4FXGC 5DM73 3RLNA 4A3FB 4LF6L 2EJFC 4B3RL 2NVXB 2L4NA 1CZWA 2F4VL 1PFBA 2Z6KC 1G6PA 1OXSC 2KCNA 4C3IG 5ELCA 2MHVA 4XT1B 1QVGA 1KIXA 4CDCC 5GROA 4A3GB 1HA5A 2QGQA 3HOYB 1PFMA 1NBWA 4OIKA 1VQAA 3MWYW 4IUUA 3KLWA 1VQBA 1Q1EA 3KF8B 2QKIC 1B70B 4GKJL 1L0XB 2K50A 4DV7L 4HJAA 2B63B 2YTYA 3A0JA 1HZCA 5IYBH 1J5EL 2K05A 4OWWB 2IX1A 2CKZB 4IPGA 4JI8L 4DAPA 2RSOA 3Q22A 1S40A 1PFNA 2CQOA 5EKLA 1TR5A 3K7AH 5IGEA 2GA4B 2VQFQ 3VYSA 4FF2A 5LMUL 1JB3A 3RZOB 4JI6Q 1L2FA 2LS01 2B2UC 1DZ1A 2VNUD 3CC2A 1KAWA 4B9XA 1Q1BA 3OIQA 5ELNA 4G57A 4A75A 2VY3A 1Q7YC 4K6LA 4ME3A 1EY9A 4LFBL 2F0MA 1BCPF 5CBEE 2NVTB 4RGMA 4A3JH 1JR0D 4FDBA 1IBKL 2LXKA 3ND8A 1TWHB 2MNAA 1XMOL 4M1UB 3SDZA 5JOBA 4DV7Q 4DK3C 3E9HA 1IKMA 3RN2A 1N34Q 4JI4L 5GAHC 3MAQA 1HFNA 1U4PA 1B3QA 3GTMH 4JI8Q 3PSIA 1NUCA 3UE0A 3H3VC 4R9WA 2HDLA 4B3TL 3FP9A 1HZBA 2R92B 2EY1A 5CMDA 2OTLA 1QJOA 3NK9A 5A2QL 2Q2HA 4IJLA 1JB7A 4IPHA 4LW1A 2Z4IA 2JSOA 2D62A 3T53B 4PMWA 4DV5Q 4R4TA 5DNFA 1CKNB 1H9RA 1SR3A 4ZYSA 4A3EG 2N49A 4HJ8A 1TKWB 4GNXB 3Q8DA 3OMGA 1K83B 1KL9A 4DV6L 1K3BC 5M3MB 2R3ZA 2Q2TA 2V4DA 3IFDA 1PH6A 1WI5A 1XXGA 3FMCA 4BY7G 3U4VA 3CW2C 4MIUA 1I5FA 2PQEA 2QA4A 3A5ZB 4HIDA 3OWEB 2EYPA 2K03A 3UE1A 2H1EA 2L11A 4A93B 2B2TA 3NE5B 2PW5A 1CKNA 5I4DA 1XNQQ 3TP8A 2KHJA 2NZ1D 2F03A 4IUQA 5T1GA 1YBYA 2JA5H 2N78A 3GTOB 4G7HC 5C3EH 3NP8A 1G91A 4HCSA 4GN3B 4RHRA 2HIVA 1DOMA 4N8FA 3HP3A 1FYCA 4Y52H 4F87A 3M3YH 3S1QB 3HOZH 5IIFA 3AQQA 1HNXL 3VR5A 3MXNB 5CV6A 2JJQA 1KC8C 1I94L 1K0RA 2Q8RE 2VS1A 4H0LC 3EQLC 5F2DA 2IY5B 3P1HA 2B8FA 3OPOA 1LTBD 2D2CC 2Y0SB 4WORA 1PZKD 3UDGA 4WRDA 2RHQB 1PH3A 1PH7A 4A3DH 4A4IA 4DK6C 3ERQA 4CDEC 4BS9A 1HJPA 1CQFA 1W6KA 5KEEA 1HXYD 3T1YQ 2CQAA 3RZDH 1TWCH 3MXNA 3SR1A 1CSPA 1CKMA 1ENFA 4DNIA 4XQQA 4IOCA 4P74A 1L0YB 1SE4A 3C3LA 2N88A 4NXML 3CMAA 1IKLA 1JE5A 1UE1A 1HH2P 1XNRQ 3OTOQ 3HKZG 5IP7H 5C4HA 1X55A 4QJFA 3BDLA 1LT6D 1V1OA 4WJ3M 2GVAA 1SROA 2R92G 1AE2A 2M9VA 2IHFA 2Z6KA 3PO2H 1EYCA 5HURA 1E2WA 2N3SA 4LF5L 3A56A 3T1HL 3A7AB 3HOXH 4M8AA 3DWQA 2RHSB 4AYBG 3M4YA 4UP9A 3CCJA 4JI0L 3HRZC 3U9OA 4OEMB 1JOOA 3BDOA 1PA6A 3EFXD 1TT2A 5G3LF 1YVCA 5JEAJ 5CV5A 1QZHA 1FVIA 5CV7A 1N8RC 4NXMQ 2FMMA 1IL8A 2Z4HA 4GZYC 1EOTA 1BDOA 5IYCH 1VMPA 1G51A 1SSOA 1Q8IA 1B8AA 4LF8L 3K5MA 3HS0C 2B2UA 4N8X1 2R93G 2H4OA 4ZCKA 3CF5A 4F88A 3E9IA 5E7NA 2QDLA 4DPGA 3TP5A 4KHPL 3NBIA 5I2XA 4IN3A 4LMQD 1JCKB 3ITPA 4QY7A 1EOVA 1KDCA 2E2JB 1SMXA 2J7ZA 1KXLA 4LUZA 2AKWB 2ZJQA 2LSSA 4PMBA 4JI5Q 4DR3L 4RHSA 4JV5L 2SNMA 3TZDA 4DGZA 2JA6H 1F2MA 2QDBA 1O7LA 2KECA 4JI1L 4LJZC 2ZTDA 4DNRB 1HTPA 3LNNA 2EY2A 1QE6A 1WD1A 1Y1WH 1DXMA 1K8GA 2JA8B 1JJGA 5ELFA 5EJWA 4A3LG 1BBXC 3KDFB 3D8GA 2PI2A 3QWNA 1VQNA 3M7NA 4OIJA 5T1IA 2JN4A 1O7YA 1EYAA 3PIO3 4CJ0B 1I50H 4KHZA 2L55A 1SYDA 3AB9A 4C3HG 3UDXA 1D2BA 1BUVT 2HCIA 1NAPA 1EWCA 3KF6B 3HOVG 1Y14B 1LTGD 3D6CA 1Y69U 1Y8OB 4DK1A 3KDFA 5EGTA 2VZAA 1EQVA 3G71A 1PTOH 4YY3Q 1WTHA 2PYKA 4DR3Q 4CHTB 1SLJA 2K5DA 4LFAL 3PO3H 1GUTA 1HR0L 5LMNL 3S16B 4XT3B 3JAMi 1WVLA 4KY7A 2WAQE 4JI1Q 2XSCA 3KF6A 5E3FA 1X65A 2SNSA 2E75C 2ICIA 1UAPA 4KJOA 3K7AB 3M4QA 1NMGA 3W1GA 3D4DA 4CKCA 1VQEA 4RAUC 1G291 1Q86C 2EVBA 5EQ0A 4L5SA 4XIGS 1GHKA 3ICEA 3DEPA 1I6VC 1Z47A 5J39A 4X6AH 1EY4A 1W6JA 1TS4A 1N32L 1B50A 4A3JB 2NTSA 5JJLA 4WJ4A 4A3MH 1YJ9A 4OL7A 1SMYC 5BN5A 3IFTA 2D0OA 1LTTD 2ZTEA 4LF9L 3L0OA 2VB2X 3QO2A 1JWSD 2XRSD 4GLAC 4CDFC 3GTMB 1I4QA 2PMZE 1B44D 3J7AF 4KI0A 1Q12A 5AJ3L 1G6ZA 5IGGA 1DYQA 5FO7B 4GOPC 3NUCA 4GKKQ 2F3WA 4XXEA 1NE3A 3KBGA 2YU9H 3MC0B 2F4IA 2CFMA 5IP9G 2WV6D 1KD1C 3S2DH 3QIAA 4ME5A 4DAVA 2K32A 1E22A 2EYLA 1SJED 2L12A 1FNWA 5FK9C 4F8MA 4IFDJ 3FKIH 3X3NA 1YNJD 5C0XJ 4OXPA 1XJVA 5CBAE 5JJZA 4IUVA 3CAMA 1GUOA 2K5HA 2OQKA 2SEBD 3FPUB 1ZEQX 3MFYA 4QB4A 4QCLA 2CW0C 1BBUA 2XWJB 1Q3LA 3K5OA 2LKVA 5EPKA 3CCLA 3PUYA 2R7FA 1VQ7A 1EYDA 1F2YA 3H0GG 1RKNA 1SDFA 1YNND 4ALPA 4C2MB 2KQ3A 1JORA 2XWBB 2B2YA 3TREA 4JG2A 3HOWG 2EY6A 3S1MH 4BBRH 1F9QA 2CCZA 4DF7A 5ELEA 3I4LA 4A3CG 3P7JA 3GQBA 3TN2A 4A3IH 2JA5B 3K59A 1VCIA 3GTPH 4K5XA 3TZUA 5C3EB 3KJOA 1NCVA 4R4OA 2KEEA 1XTCD 3TQYA 1A0IA 4DV4Q 5C4XH 3K57A 1GO3E 3CCUA 3ZYYX 3A8JE 4GLXA 4TRDA 1B53A 1VQIA 1ZXTA 3M3YB 3CC4A 3TP6A 3VR6A 1WYDA 4YCUA 1ICFB 1BQQT 4POFA 5C44H 1VQMA 2HUGA 4OWTB 1S4ZA 2NVQH 1RDPD 4A3BB 1UE7A 2ZXOA 1ZYRC 1T9HA 4ULLA 4J6HA 5IGBA 1SE3A 5HGQA 2F0DA 4DV3L 2LXJA 3BYTB 1RODA 5ELBA 3E3XA 2Q8IB 4A3DB 2PQAB 3CRLC 4ZAIA 2JEAI 1PZID 1VF7A 1N33L 1JICA 4OX9Q 4DR7Q 4X65Q 1X3QA 1BCPD 4PQXA 4K8JA 4DA2A 5K36G 3IRBA 4KD3A 3RZDB 4R4IA 1KNAA 3AYHB 1RTNA 2OQ0A 1XMQL 1NMFA 3I4NG 2B2TC 1ESFA 1SFOH 5EBDA 1YJWA 4OO1H 3DMUA 4BBSH 3I56A 1JOKA 1LABA 1L0WA 5C5LA 2P5ZX 2K5QA 1LTRD 2ES2A 1HNZQ 4YWLA
chains in the Genus database with same CATH topology
2M2LA 1DONA 4C56C 5JPMC 4K6DA 1PLFA 3C2PA 4HCEA 3W3AA 4L6TB 3PO2B 4TQUS 1LTSD 4KN4C 1TIID 4ZQ3A 3M85A 3HOXB 4G7OC 3T4AC 2EE1A 5M5YB 3U9SA 1GJXA 2G9HD 1XX8A 1LV9A 2RKSA 2F0LA 1UEAB 4X3UA 3S9WA 4FXDA 3DXJC 3ONAB 2EJGC 5IGCA 3FDTA 4OO1I 4HEDA 3OSOA 1LT5D 3RLFA 2L9HA 1CI3M 1QG7A 4RKBA 4NW2A 1VF5C 2EXZA 3PUXA 1RCVD 1SNMA 4XQNA 5E4XA 3SEBA 3VYTA 3T13A 1VDZA 5KNDA 1JQYD 4QUFA 4K2LA 1EY7A 1D5MC 2JA6B 2ENBA 1U4MA 2KHSA 2PZTA 2J4XA 2SOBA 1WTWA 5CR3A 1Y1WB 2F0NA 1CK1A 3TMEA 2PZUA 1HCZA 1PYWD 2O2LD 2NTTA 1LT4D 2A68D 3BZDB 2F0WA 4R8NA 3K0YA 3QOJA 1WTOA 2MPMA 3OHXC 1EWHA 5HGTA 1LTID 2IW3A 2F0FA 1LO5D 2OXPA 3DWAA 2D9UA 3NXWA 2A6EC 1KTKA 4I7ZC 5ISRA 4FNFA 3PO3B 3C1FA 4ZUIA 2KCCA 1QNUA 5KIXA 5FLXE 3V96A 1HUMA 3SK8A 1LACA 3J81E 4HSPA 3D31A 1AFPA 3A7LA 1TVXA 5G3LD 3MXPA 4RGNA 2KUMA 2RA4A 1EEFD 2HDMA 4NP5A 4U673 4FF1A 5CV9A 1EY0A 5A35A 4EQOA 2K6AA 1PRTF 3BS1A 3R2IA 3P75A 2NB0A 1B4OA 3HGBA 5IODA 1F2ZA 3DUZA 1DCZA 4DFAA 1RTOA 1GUSA 4HMJA 1QB5D 5I2YA 1BF4A 2E76C 4FF3A 2WAQB 1RHPA 1JOQA 1E0BA 4IFDH 5C0XH 2EZVA 2A69C 3S2DB 1V43A 4N9TA 3A55A 3FKIB 3PIP3 1SMYD 1SBBB 2QCPX 2HCCA 5KRUA 1Y8PB 4K14A 2DNCA 5IOCA 1QILA 1MSGA 3I91A 2RSNA 2AWNA 2XNAC 4K5VA 5FOBB 1IW7C 1F77A 3R93A 5JVH3 3S1MB 2AWOA 4BBRB 4A3IB 5DAUA 3GTPB 3WOEA 2PMZB 1KDBA 1I4HA 2AUJD 5C4XB 2IX3A 1PRTC 4E6IA 3I70A 4QUCA 4OGQC 5C44B 5DEHA 2NVQB 2CVRA 1Q90A 2E74C 3Q24A 4IFDI 3MEHA 3GV6A 5C0XI 4X3SA 2VXWA 3S1NB 2BE5C 2NUCA 2F0EA 4O1NA 2XN9C 1SYCA 1WTRA 1ILPA 1S5CD 1D1KA 1ENAA 2AQ1B 3MA2B 2B2YC 1FD7D 3N6RA 2EYFA 1STGA 3VYUA 1SFOB 2NN6G 1D5XC 2X6LA 4K2KA 4KK7A 1WD0A 2ZXPA 4BBSB 1QWYA 1V1PB 3D4RA 1CFMA 3E6ZX 5C3XA 1OXUA 4EGVA 1ONLA 1Y1VB 5C5MA 4ZUJA 1ENCA 1U4RA 2OF1A 1V1PA 2Q8TA 4PNYA 3MHBA 2LY7A 1A2TA 4DAYA 4IALA 1K8MA 2KA7A 4XTCS 3KK7A 2X6GA 3RMHA 3LWUA 2X69A 1M8AA 3OW7A 1GOZA 5BN4A 1AZPA 2FFKB 3K5NA 3NHHA 1BOSA 4FYDA 3QOLA 3VR2A 2RDGA 1V8QA 1H9SA 3NPPA 5BN3A 2F0GA 2K01A 3CHBD 1WTXA 4CGYB 3K5LA 2R7ZB 1STYA 2OEOA 4PMCA 2AUKA 4EQNA 3HOUB 1PXUA 2K7VA 3LWEA 2F0KA 3OWFA 3M4OB 2RVLA 4RGTA 3SK5A 1M4VA 5EPJA 4CKBA 1TS3A 1EU3A 4B08A 2CHBD 2IWHA 1SNDA 1A3VA 3MZ5A 5LHY1 4ZK9B 2FHTA 5IT9E 3K6OA 4V190 1SE2A 3R2TA 4IQZA 1HA6A 4Q5VA 2EYJA 5JPNC 2KJXA 5NUCA 3F2UA 1PRTB 2AQ3B 1SXTA 4V0BA 1C8CA 1PTOF 4EVOA 1ILQA 4RKLA 2PO4A 4ZKBB 1B9NA 4A3KB 4FF4A 1X3PA 4C3JB 2O5IC 4HMIA 3GD7A 5JEAG 2RDFA 3EJIA 1SYFA 2SDFA 4H7BA 3I73A 4KHVA 3HEJA 2KEDA 2WB1B 2DY7A 1LTAD 1TY0A 5CV8A 3RUZA 3FEWX 1FNVA 1ZKOA 1OXVA 3LX0A 2K1BA 3G7LA 4KJNA 4ILWA 2A6ED 2L5TA 5M3FB 1HTLD 2EYOA 1TWFB 3MXUA 4IUNA 3S2HB 1JC7A 1ESRA 2F0SA 1BXTA 1QCBD 2L0CA 5I9OA 1B2TA 2JA7B 4QF4A 1TQOA 3T51B 3T56B 2MUYA 2PCFB 3KLRA 1WTPA 1S5FD 3MXGA 1A3UA 1PTOC 5CYUA 3HOZB 1XYIA 3J7YW 2LFNA 2B2VC 5I6WA 1SJHD 4KKTA 1TY2A 3JAME 4C3IB 4HN7A 1DOKA 4HAEA 4EQPA 1D1IA 4G4KA 1SAPA 1TWCB 2A69D 1CT1D 2OT2A 1SYGA 2WP8J 3DM1A 5EPLA 4DXFA 3M7GA 4HSVA 1U9RA 5DM63 4ID6A 3R8BA 1IYVA 3L3OC 4FO2A 2QF7A 1B3AA 1TS5A 3L9AX 2N55A 5J1ZA 1D5ZC 3J80E 1QNKA 1IW7D 3DEOA 2BA1A 4F7XA 3I3CA 5EBCA 3NSWA 5COYA 4IUTA 2JP1A 3PV0A 2TMPA 4CKEA 2QEJC 1JWUD 1VMCA 3Q0AA 2WACA 2BA0A 4KY6A 1PRTD 4J1MA 1EY5A 1R4PB 3EVQA 4TKOB 1MD2D 1J9OA 2JEBI 1GHJA 4RCNA 1EZ8A 2K28A 2XVSA 5C4ZA 1SNQA 3OIPA 4BA2I 2F0TA 4RH6A 2BE5D 4WFN3 2Z8LA 2F0JA 5FLXL 1RJTA 1FNUA 3H6MA 3HZXA 2ZXRA 3J81L 1D6EC 2EDGA 1LLRD 1WTVA 4DK0A 3C1EA 4KMUC 1KLUD 5EKKA 1H9MA 4KKUA 1MBYA 1HFGA 3NQIA 4O42A 1II3A 3A8KE 2E2DC 2RQXA 1EIHA 3I90A 4BY7B 1Y8NB 1O7ZA 3KUPA 3BVMA 1TS2A 3D6WA 3MTSA 4KTAA 1KAAA 4I65A 1EIGA 1STEA 4FP5D 1FGBD 4CBVA 1DJRD 3GO5A 1I50B 3QB3A 4KKSA 3MFGA 3D4WA 4MN3A 4MHEA 3E0JA 2EYMA 1F2LA 3KF8A 1PTOB 1AP0A 1NSNS 3FVQA 3G6JB 1MSHA 5K36H 1RD9D 1GUGA 5IGDA 1ICWA 1DOLA 3GTJB 1HRJA 3H94A 1BO0A 2WIIB 3URYA 2YYZA 2DNEA 3BDCA 3FRPB 2F0IA 1YNJC 2WKCA 4JK1C 2JYOA 3WOFA 3SVMA 1PZJD 4NDXA 3VR3A 3SHLA 1IHZA 1I4XA 2B2VA 3HKZB 3WDNA 5C4JB 2B8GA 1TU2B 4L8JA 2IPKD 1YNNC 2I46A 4A3MB 4U68A 2DY8A 2C9OA 3T16A 3SE0A 3DHQA 1EU4A 2C5CA 3X3MA 3TSSA 1Z6HA 4AYBB 2NYZD 3CU7A 1A3TA 2KVMA 2A73B 2M00A 3NWSA 2YU9B 3UI2A 1MI2A 5K5PA 2PNRC 3R3OA 4ZKCB 2EOTA 1STNA 3FPPA 2G9DA 3KBXA 5FO8B 2R93B 3NTHA 1BCPC 1UNSA 1I4PA 2A5HA 3AU7A 1HUNA 5IGFA 1B9MA 2MGSA 3W2DA 1EEID 3DWPA 5JAVA 1KDAA 3MVVA 1X32A 1EY8A 3KLSX 4C1NK 5EKIA 1F9RA 1I3QB 3V05A 4IURA 2BCOA 2IT1A 3O13A 5ELDA 5J22A 2F0HA 2FMCA 2CW0D 2O4XA 2XRQD 3S14B 4XYOA 1GUNA 4UDUC 1EFID 3NBHA 2B39A 1KABA 3RD4A 1H9KA 1GXDC 2F0OA 1JWMD 1Z7TA 2L1BA 4C1NI 1CTMA 5A2QE 2XIWA 3AMUA 5D3IB 2D5DA 4X3KA 3IAYA 2WKDA 4C3HB 1K8OA 2PZWA 3IL8A 1STBA 3HOVB 1PDQA 2ID0A 2NWGA 1BNZA 4KN7C 1CA5A 3EA6A 1PTOD 5CV4A 1KNEA 3VA5A 1PMRA 4B9WA 1J8IA 2BDNA 3IKJA 1E2ZA 1F9PA 4H44C 1HHVA 2A6HC 1ZYRD 1SNPA 3OMCA 3SK4A 3PUVA 4P2CB 4QIWB 2IJ0A 1F9SA 1ET9A 1MGSA 4XDXA 3NQTA 2F0UA 1I4GA 3S1RB 4DN4M 3Q23A 3QG1A 2RBMA 5IT9L 3GTLB 2K5WA 1CM9A 1KLGD 4DXGA 4QMGA 3V2TA 2FJ2A 1U4LA 2BDOA 2TSSA 1I4RA 2B2WC 5FO9B 1NR4A 2F0PA 1SNCA 4HTHA 1H9SB 5D3DA 4K5WA 2WINB 5TSSA 3GV3A 1CHQD 3GTKB 1SYEA 3BVGA 5KNCA 3VA7A 2NVYB 1JE4A 4PV1C 2E2HB 2A68C 1STHA 5KNBA 5E4WC 4G7ZC 4ABNA 1AZQA 3S17B 4N9PA 3PUWA 4ZRZA 5E1FA 4CJ1B 5KYLA 3NWTA 3H0GB 5CORA 2EJMA 3ND9A 4BA1I 1EZ6A 3PMFA 1S5BD 2K04A 3H91A 4KY5A 1O80A 5D14A 3HOWB 1T5XD 1EL0A 1R9TB 4ZLTF 1CHPD 2BOSA 2ZT9C 2QILA 1BCPB 3A54A 1HQRD 1XWEA 2NBFA 1H9JA 1G2SA 4HR7B 3C46A 4OO1G 3K58A 1AW7A 1I6HB 3CQZB 4RA8A 2HQEA 4DU9A 1ET6A 1EY6A 3SK6A 5JVG3 3H09A 2EY5A 2R6GA 2VB3X 1C48A 3GTGB 3JAML 1ML0D 1WTQA 3NTKA 4FVMA 1G8ZD 5FKAC 1B1ZA 2F3VA 3I8ZA 2J0TD 3I4NB 5I6YA 2NN6H 4Z9CB 3TDQA 3D3RA 2F1MA 3CKIB 4IZ8A 1E2VA 3E5SA 1BR9A 3J7AV 4L63B 5I9PA 4YIJA 2R61A 4BY1B 3TP7A 3S15B 5LL6S 4X3TA 2F0QA 3J80L 4FXKC 2LMCB 1CA6A 4RCOA 5C6AA 1TWGB 2MP1A 1WCMB 3NTIA 4RGOS 4XYQA 4ODGA 4Y7NB 4JBWA 4DNTB 1SNOA 5M5XB 3HG9A 1SYBA 2IL8A 1FR3A 2VUMB 2AQ2B 1EQTA 4KD4A 1O78A 3BYYB 2NN6I 5KGUA 5M5WB 4BWGB 1DM0B 4CJ2C 1IYUA 5M9OA 2O5JC 2B2WA 2IX0A 4K8IA 4UAIA 3KLSA 3BG3A 4H13C 3VR4A 2MJ8A 2ICEC 4J8QA 1S5ED 1NR2A 3I72A 4RFBA 3N52A 3SXHA 1AEXA 4WJWA 1HQMC 3VYRA 5D65A 3A8IE 1CZGA 2RDHA 4C3JG 1QOHA 2EYHA 1DD2A 5KYIA 2JE6I 1HPCA 3QJYA 3EROA 5CGKA 1RF2D 2K33A 3P20A 3GP7A 1OXXK 3Q6SA 1A15A 2F0VA 2EPBA 4NMZA 2Z1CA 4OHJA 1STAA 1A2UA 1OO9B 2I07B 3OOCA 1R4QB 2A74C 1G2TA 4XQJA 4IUPA 1AN8A 1TWAB 4NKLA 3TBIB 2PW7A 3L7ZC 1LT3D 3BVZA 4LK1C 2PPBC 2DN8A 1SEBD 3GTQB 4R8IA 3I4MB 1CQVA 5JEAH 1A6XA 5LL6X 5C3WA 4Q0FA 2KOLA 5AFWA 5CC4A 4LAAA 1T5EA 4IFDG 5C0XG 2JXMB 3CRKC 3PUZA 4S3SA 1GUWA 1C4QA 1OXTA 4A3EB 1UUPA 2FINB 4KV6A 1S5DD 4RWSC 2E2IB 4TSSA 2A6HD 4FXGC 5DM73 4A3FB 2EJFC 2NVXB 2L4NA 1CZWA 1PFBA 1OXSC 2KCNA 4C3IG 5ELCA 2MHVA 4XT1B 4A3GB 1HA5A 3HOYB 1PFMA 4OIKA 3MWYW 4IUUA 1Q1EA 2QKIC 1L0XB 2B63B 2K05A 2IX1A 4DAPA 2RSOA 3Q22A 1PFNA 5EKLA 1TR5A 5IGEA 2GA4B 3VYSA 4FF2A 3RZOB 1JB3A 2LS01 2B2UC 1DZ1A 2VNUD 4B9XA 1Q1BA 3OIQA 4G57A 4K6LA 1EY9A 2F0MA 1BCPF 5CBEE 2NVTB 4RGMA 1JR0D 3ND8A 1TWHB 4M1UB 3SDZA 5JOBA 1IKMA 3MAQA 1HFNA 1U4PA 1NUCA 3H3VC 4R9WA 2HDLA 2R92B 2EY1A 5CMDA 1QJOA 3NK9A 5A2QL 2Z4IA 2JSOA 2D62A 3T53B 4PMWA 5DNFA 1H9RA 4ZYSA 1TKWB 3OMGA 1K83B 5M3MB 2R3ZA 2V4DA 3IFDA 3FMCA 1XXGA 4MIUA 2PQEA 3OWEB 2EYPA 2K03A 2H1EA 2L11A 4A93B 2B2TA 3NE5B 2PW5A 5I4DA 3TP8A 2NZ1D 2F03A 4IUQA 5T1GA 3GTOB 4G7HC 3NP8A 1G91A 4HCSA 4RHRA 1DOMA 3HP3A 1FYCA 4F87A 3S1QB 5IIFA 3VR5A 5CV6A 2Q8RE 4H0LC 3EQLC 5F2DA 3P1HA 2B8FA 3OPOA 1LTBD 2D2CC 2Y0SB 4WORA 1PZKD 4WRDA 3ERQA 4BS9A 1CQFA 1W6KA 5KEEA 1HXYD 2CQAA 3MXNA 3SR1A 1ENFA 4XQQA 1L0YB 1SE4A 3C3LA 2N88A 1IKLA 5C4HA 3BDLA 1LT6D 1V1OA 2M9VA 1EYCA 5HURA 1E2WA 3A56A 3A7AB 4M8AA 3DWQA 3M4YA 3HRZC 3U9OA 1JOOA 3BDOA 3EFXD 1TT2A 5G3LF 5JEAJ 5CV5A 5CV7A 2FMMA 1IL8A 2Z4HA 4GZYC 1EOTA 1BDOA 1VMPA 1SSOA 1Q8IA 3K5MA 3HS0C 2B2UA 2H4OA 4F88A 3TP5A 3NBIA 5I2XA 4IN3A 4LMQD 1JCKB 3ITPA 1KDCA 2E2JB 2J7ZA 4PMBA 4RHSA 2SNMA 3TZDA 4DGZA 1F2MA 2QDBA 1O7LA 2KECA 4LJZC 4DNRB 1HTPA 3LNNA 2EY2A 1QE6A 1WD1A 1DXMA 2JA8B 5ELFA 5EJWA 1BBXC 3D8GA 3QWNA 3M7NA 4OIJA 5T1IA 1O7YA 1EYAA 3PIO3 4CJ0B 4KHZA 2L55A 1SYDA 3AB9A 4C3HG 1D2BA 1BUVT 2HCIA 1NAPA 1EWCA 3D6CA 1LTGD 1Y69U 1Y8OB 4DK1A 5EGTA 1EQVA 1PTOH 2PYKA 4CHTB 2K5DA 1GUTA 3S16B 4XT3B 1WVLA 4KY7A 2XSCA 5E3FA 2SNSA 2E75C 2ICIA 1UAPA 4KJOA 3K7AB 3D4DA 4CKCA 4RAUC 1G291 2EVBA 5EQ0A 4XIGS 1GHKA 3DEPA 1I6VC 1Z47A 5J39A 1EY4A 1W6JA 1TS4A 1B50A 4A3JB 2NTSA 4OL7A 1SMYC 5BN5A 3IFTA 1LTTD 2VB2X 3QO2A 1JWSD 2XRSD 3GTMB 1I4QA 1B44D 3J7AF 4KI0A 1Q12A 1G6ZA 5IGGA 1DYQA 5FO7B 3NUCA 2F3WA 4XXEA 3KBGA 3MC0B 2F4IA 2WV6D 3QIAA 4ME5A 4DAVA 2K32A 2EYLA 1SJED 2L12A 1FNWA 5FK9C 4F8MA 4IFDJ 3X3NA 1YNJD 5C0XJ 5CBAE 5JJZA 4IUVA 1GUOA 3FPUB 4QCLA 2SEBD 4QB4A 1ZEQX 3MFYA 2CW0C 2XWJB 1Q3LA 3K5OA 2LKVA 5EPKA 3PUYA 1EYDA 1F2YA 1RKNA 1SDFA 1YNND 4C2MB 2KQ3A 1JORA 2XWBB 2B2YA 2EY6A 1F9QA 4DF7A 5ELEA 3I4LA 3P7JA 3GQBA 3TN2A 2JA5B 3K59A 1VCIA 4K5XA 3TZUA 5C3EB 1NCVA 2KEEA 1XTCD 3K57A 3ZYYX 3A8JE 4TRDA 1B53A 1ZXTA 3M3YB 3TP6A 3VR6A 1BQQT 2HUGA 1S4ZA 1RDPD 4A3BB 2ZXOA 1ZYRC 4ULLA 4J6HA 5IGBA 1SE3A 2F0DA 3BYTB 1RODA 5ELBA 2Q8IB 4A3DB 3CRLC 4ZAIA 2JEAI 1PZID 1VF7A 1JICA 1X3QA 1BCPD 4PQXA 4K8JA 4DA2A 5K36G 4KD3A 3RZDB 1KNAA 1RTNA 2B2TC 1ESFA 5EBDA 4OO1H 3DMUA 1JOKA 1LABA 5C5LA 2K5QA 1LTRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3W A;  5KRU A;  1F2M A;  5CC4 A;  1SYB A;  4K14 A;  2QDB A;  4B9W A;  2OF1 A;  4LAA A;  2F0W A;  4R8N A;  4EQP A;  4PNY A;  3MHB A;  4ME5 A;  2EY2 A;  3QOJ A;  4EVO A;  2EYL A;  1A2T A;  5CV6 A;  4RKL A;  5IOC A;  4IAL A;  1SNP A;  1NUC A;  3OMC A;  4K6D A;  1SYG A;  3SK4 A;  1A3T A;  5HGT A;  4K5V A;  4KD4 A;  4S3S A;  4F8M A;  2M00 A;  2F0F A;  3D8G A;  4HMI A;  2EY1 A;  2OXP A;  5K5P A;  1EYA A;  4QB4 A;  5KGU A;  3NQT A;  2F0U A;  1U9R A;  3R3O A;  3NK9 A;  4KTA A;  4ID6 A;  5C4H A;  3NXW A;  2LKV A;  4KV6 A;  2RDF A;  2HQE A;  1SYF A;  3EJI A;  4H7B A;  1KAA A;  4DU9 A;  4I65 A;  4ZQ3 A;  1SYD A;  3BDL A;  4KHV A;  2RBM A;  3HEJ A;  1STN A;  1EYD A;  5DAU A;  1F2Y A;  5M9O A;  1RKN A;  5ISR A;  1KDB A;  1EY6 A;  3NHH A;  4K8I A;  4QMG A;  2KQ3 A;  3D6C A;  5J1Z A;  3SK6 A;  3V2T A;  1JOR A;  3C1F A;  4ZUI A;  1EYC A;  5CV8 A;  3RUZ A;  5KIX A;  4E6I A;  3QB3 A;  3QOL A;  2EY6 A;  5HUR A;  5EGT A;  4F7X A;  3SK8 A;  2EY5 A;  4DF7 A;  3OMG A;  3LX0 A;  1EQV A;  4KJN A;  2F0P A;  1SNC A;  4HTH A;  5IGF A;  2PYK A;  2F0G A;  3D4W A;  3MXP A;  2RKS A;  3SXH A;  2F0L A;  4K5W A;  1AEX A;  4K5X A;  5DEH A;  3S9W A;  2EYM A;  2EYO A;  4MIU A;  2F3V A;  1STY A;  2OEO A;  2PQE A;  3U9O A;  5JAV A;  1JOO A;  4PMC A;  2EYP A;  1SYE A;  2WAC A;  5I6Y A;  1KDA A;  3MVV A;  4KY7 A;  1TT2 A;  4EQN A;  4KY6 A;  1EY8 A;  4IUN A;  3MEH A;  4TRD A;  5CV5 A;  5E3F A;  5CV7 A;  1NSN S;  1EY5 A;  2PW5 A;  2SNS A;  4J1M A;  4KJO A;  4NP5 A;  2EYH A;  3TP6 A;  5IGC A;  3EVQ A;  5CV9 A;  4IZ8 A;  3TP8 A;  2F0S A;  1EY0 A;  2NUC A;  5IGD A;  3D4D A;  3E5S A;  2F0K A;  2F0E A;  5KYI A;  3OWF A;  4EQO A;  5J22 A;  3OSO A;  3NP8 A;  5I9O A;  1SYC A;  2F0H A;  3ERO A;  5CGK A;  3SK5 A;  1ENA A;  2O4X A;  4J6H A;  5IGB A;  3P75 A;  1STH A;  2F0D A;  1EZ8 A;  4RKB A;  5I9P A;  5C4Z A;  3BDC A;  5EKL A;  1SNQ A;  1TR5 A;  2F0I A;  4QF4 A;  1F2Z A;  5IOD A;  5IGE A;  5J39 A;  1EY4 A;  1KAB A;  2EXZ A;  1SNM A;  4YIJ A;  1TQO A;  2EYF A;  4DFA A;  2F0V A;  1STG A;  4NMZ A;  2F0T A;  3TP7 A;  2F0O A;  5IIF A;  4HMJ A;  3TP5 A;  1SND A;  1A3V A;  2F0Q A;  2F0J A;  4K2K A;  1STA A;  4N9P A;  1A2U A;  1IHZ A;  4NDX A;  3SHL A;  3T13 A;  4K8J A;  3H6M A;  1A3U A;  3HZX A;  4KD3 A;  4OL7 A;  5F2D A;  4B9X A;  5E1F A;  3P1H A;  3MZ5 A;  3ITP A;  4G57 A;  5C6A A;  4K2L A;  4WOR A;  1KDC A;  1EY7 A;  5KYL A;  1JOQ A;  1EY9 A;  4NKL A;  4WRD A;  2F0M A;  2PZW A;  3C1E A;  2ENB A;  2KHS A;  2PZT A;  5C3X A;  5I6W A;  2PW7 A;  5EKK A;  3ERQ A;  4PMB A;  3T16 A;  1EZ6 A;  3PMF A;  1STB A;  2SOB A;  5KEE A;  4ODG A;  3DHQ A;  4KY5 A;  5CR3 A;  3DMU A;  4N9T A;  2SNM A;  1JOK A;  1SNO A;  2F0N A;  5C5M A;  4ZUJ A;  5C5L A;  3SR1 A;  2EYJ A;  5CV4 A;  3TME A;  3VA5 A;  5JOB A;  2PZU A;  1ENC A;  5NUC A;  5C3W A;  5IGG A;  4DGZ A;  1II3 A;  3NUC A; 
#chains in the Genus database with same CATH topology
 2MO0 A;  3RNU A;  1V9P A;  2M2L A;  1DON A;  4C56 C;  5JPM C;  2MQH A;  1Y1V H;  1XPR A;  4K6D A;  4BY1 G;  4OWX B;  1PLF A;  3C2P A;  4HCE A;  3GTL H;  3W3A A;  4L6T B;  3PO2 B;  4TQU S;  1LTS D;  4RG1 A;  3RLO A;  4KN4 C;  1TII D;  3G4S A;  2K4K A;  4DV0 Q;  1WCM G;  4ZQ3 A;  1Q82 C;  3M85 A;  3HOX B;  2GN5 A;  4HJ7 A;  4G7O C;  1E24 A;  3T4A C;  2UUB Q;  2EE1 A;  5M5Y B;  3U9S A;  2DJG C;  1GJX A;  2G9H D;  1XX8 A;  1LV9 A;  2RKS A;  2F0L A;  1UEA B;  4HIM A;  4NXN Q;  2EXD A;  2NVY H;  4X3U A;  3S9W A;  2ZM6 Q;  4FXD A;  3DXJ C;  3ONA B;  2VUM G;  2EJG C;  3CCR A;  2VQF L;  1L1O C;  5IGC A;  1ASZ A;  3FDT A;  4JI6 L;  4OO1 I;  5FLM H;  4HED A;  3OSO A;  1LT5 D;  2R7Z H;  3CCS A;  3RLF A;  2L9H A;  4DR2 Q;  1CI3 M;  1QG7 A;  4RKB A;  4NW2 A;  4GOP B;  1VF5 C;  3HOU H;  2EXZ A;  3PUX A;  1RCV D;  1SNM A;  4XQN A;  5E4X A;  3SEB A;  4A3B G;  1PYS B;  3VYT A;  3M4O H;  3T13 A;  1VDZ A;  5KND A;  1JQY D;  2YTV A;  4DAM A;  4K2L A;  4QUF A;  1N34 L;  1EY7 A;  1D5M C;  2JA6 B;  2ENB A;  1U4M A;  2KHS A;  2PZT A;  2J4X A;  4IO9 A;  4GOP A;  2SOB A;  4X66 Q;  1WTW A;  5CR3 A;  1Y1W B;  2WB1 E;  2F0N A;  3QR8 A;  1CK1 A;  1E1O A;  3TME A;  2PZU A;  1HCZ A;  2R7D A;  1VQJ A;  1PYW D;  2O2L D;  2I5M X;  2NTT A;  4JOI C;  1P8L A;  1LT4 D;  2A68 D;  3BZD B;  2F0W A;  4R8N A;  4DV5 L;  3K0Y A;  3QOJ A;  4O2D A;  1WTO A;  2MPM A;  1PVO A;  3OHX C;  1EWH A;  5HGT A;  2NZO A;  1LTI D;  2IW3 A;  2F0F A;  1PH2 A;  1LO5 D;  1NJI C;  5IYD G;  1JJ2 A;  2OXP A;  3DWA A;  4DR6 Q;  2D9U A;  3NXW A;  4B3S L;  2A6E C;  2ZTC A;  1KTK A;  4I7Z C;  4A3K H;  5ISR A;  4FNF A;  4C3J H;  3PO3 B;  3C1F A;  4ZUI A;  2KCC A;  1QNU A;  5KIX A;  5FLX E;  3I4M G;  1XNQ L;  3V96 A;  1HUM A;  3SK8 A;  3I4N H;  1LAC A;  3STB C;  3J81 E;  4HSP A;  3D31 A;  1AFP A;  3A7L A;  1TVX A;  5G3L D;  3MXP A;  4RGN A;  1W2B A;  2KUM A;  1YZ6 A;  3KJP A;  2RA4 A;  1EEF D;  2HDM A;  4NP5 A;  4U67 3;  4FF1 A;  2KHI A;  5CV9 A;  5EAY A;  4YHH Q;  1EY0 A;  5M3F H;  5A35 A;  4EQO A;  2K6A A;  1PRT F;  4BY1 H;  4QGU A;  3BS1 A;  1VQC A;  3BU2 A;  1TWF H;  3R2I A;  3P75 A;  4JCV E;  4A3F G;  2NB0 A;  4B3S Q;  3S2H H;  3AEV A;  1B4O A;  3HGB A;  2CH4 W;  1F2Z A;  5IOD A;  3PQI A;  3DUZ A;  5LMN W;  1DCZ A;  1TWG H;  1RTO A;  4DFA A;  3T1Y L;  1GUS A;  4HMJ A;  2ALY B;  1QB5 D;  5I2Y A;  1BF4 A;  2E76 C;  4UP7 A;  3W1B A;  4FF3 A;  2B29 A;  4A3G G;  2K52 A;  2WAQ B;  1RHP A;  2JA7 H;  1E0B A;  4IFD H;  1JOQ A;  1CUK A;  3HOY G;  5C0X H;  3S24 A;  2EZV A;  3F2C A;  2A69 C;  3S2D B;  1V43 A;  2H5X A;  2A19 A;  4N9T A;  2B63 G;  1XNR L;  3OTO L;  3A55 A;  4DV2 Q;  3FKI B;  3PIP 3;  1SMY D;  1SBB B;  2ZJR A;  1EQQ A;  2QCP X;  4LUO A;  2HCC A;  5KRU A;  1Y8P B;  4K14 A;  2DNC A;  1YNX A;  3EIV A;  2EIF A;  2K14 A;  5IOC A;  1QIL A;  1MSG A;  3I91 A;  2RSN A;  2AWN A;  2XNA C;  4K5V A;  5FOB B;  2UUC L;  2I0Q A;  1IW7 C;  1F77 A;  3R93 A;  4C3I H;  2K5V A;  5JVH 3;  1BBW A;  3S1M B;  2AWO A;  4BBR B;  3CXC A;  1L1O B;  4P71 A;  4A3I B;  5DAU A;  3GTP B;  3WOE A;  3M9B A;  3L2P A;  2PMZ B;  1K28 A;  1KDB A;  1I4H A;  2AUJ D;  3BJU A;  3CD6 A;  5C4X B;  2IX3 A;  1PRT C;  4E6I A;  3I70 A;  4QUC A;  4OGQ C;  1E3P A;  1PH5 A;  4LF7 Q;  3G6E A;  1YEZ A;  2Z9H A;  5C44 B;  1L1O A;  5DEH A;  2NVQ B;  1M1K C;  2CVR A;  1YIJ A;  1EFW A;  1Q90 A;  2E74 C;  3Q24 A;  2D0P A;  4IFD I;  3MEH A;  3GV6 A;  5C0X I;  1EIY B;  5DLQ E;  4X3S A;  3DM3 A;  2VXW A;  3S1N B;  2BE5 C;  2NUC A;  2F0E A;  4O1N A;  2XN9 C;  3U50 C;  5FJ8 G;  2B3G A;  3CCM A;  2UUC Q;  1SYC A;  1WTR A;  2UXD Q;  1ILP A;  1S5C D;  1D1K A;  1ENA A;  2AQ1 B;  3MA2 B;  3CCE A;  2B2Y C;  1FD7 D;  3N6R A;  4JI5 L;  1NY4 A;  3PCO B;  4BXX G;  2EYF A;  1STG A;  4JBJ A;  3VYU A;  1SFO B;  2NN6 G;  1D5X C;  2X6L A;  4K2K A;  1TWA H;  4IPC A;  4KK7 A;  3BZC A;  2ZXP A;  1WD0 A;  1QWY A;  4BBS B;  2HD3 A;  5M3M G;  1V1P B;  3D4R A;  1CFM A;  1VQL A;  2E8G A;  3GTQ H;  1X6O A;  2KCT A;  1CKO A;  4DAY B;  3E6Z X;  5C3X A;  5FLX c;  1EWI A;  2OTJ A;  1K73 C;  4A93 G;  4LF4 Q;  1OXU A;  3J81 c;  4EGV A;  1ONL A;  4JOI A;  1Y1V B;  5C5M A;  4ZUJ A;  1ENC A;  4LFC Q;  4AQY Q;  1A8V A;  2RCF A;  1JJC B;  4EQ5 A;  2IHE A;  1U4R A;  2OF1 A;  3CP0 A;  1V1P A;  2Q8T A;  4PNY A;  3MHB A;  4NPS A;  2CH4 A;  4A3E H;  2LY7 A;  1A2T A;  3BZK A;  4DAY A;  4IAL A;  1K8M A;  2KA7 A;  4XTC S;  3KK7 A;  4RMF A;  2X6G A;  4DR5 L;  4MZ9 A;  4YY3 L;  3RMH A;  3LWU A;  2X69 A;  1M8A A;  2Y0S G;  4BY7 H;  3OW7 A;  1GOZ A;  1U0L A;  2BH8 A;  5BN4 A;  4LNQ A;  1AZP A;  4J15 A;  4YCW A;  2FFK B;  1A62 A;  3K5N A;  1MKH A;  3NHH A;  1JT8 A;  1BOS A;  4R1J A;  4FYD A;  3QOL A;  1J6Q A;  3VR2 A;  2RDG A;  1E1T A;  1V8Q A;  1H9S A;  3NPP A;  5BN3 A;  2F0G A;  2K01 A;  3CHB D;  1WTX A;  4CGY B;  1X3F A;  3HKZ E;  3K5L A;  1IZ6 A;  2R7Z B;  1STY A;  2OEO A;  3JC6 6;  4PMC A;  2AUK A;  1NNX A;  4JYA Q;  4JW0 A;  4EQN A;  3HOU B;  1PXU A;  2K7V A;  3LWE A;  4JC0 A;  2F0K A;  3OWF A;  3M4O B;  4KLK A;  2RVL A;  1EUJ A;  4RGT A;  3SK5 A;  2ASB A;  4DR5 Q;  1M4V A;  2GVB A;  5EPJ A;  4CKB A;  1TS3 A;  1EU3 A;  4B08 A;  2CHB D;  2IWH A;  3GTJ H;  1SND A;  1A3V A;  5GAG C;  4GKK L;  3MZ5 A;  5LHY 1;  3CPF A;  4ZK9 B;  1QUQ B;  2FHT A;  1KQS A;  2CWP A;  5IT9 E;  3K6O A;  4V19 0;  1XPU A;  1SE2 A;  2BH2 A;  3KOJ A;  3R2T A;  4IQZ A;  1HA6 A;  5C4J H;  1GD7 A;  4Q5V A;  2EYJ A;  5JPN C;  2KJX A;  2KEN A;  5NUC A;  3NEL A;  3PF4 A;  3F2U A;  1PRT B;  2AQ3 B;  1VQ5 A;  2HHH L;  1QUQ A;  2R92 H;  1SXT A;  4V0B A;  1C8C A;  1PTO F;  4EVO A;  1WFQ A;  2NZH A;  1ILQ A;  4RKL A;  2PO4 A;  4ZKB B;  1B9N A;  4JI7 Q;  4A3K B;  4CDD C;  4FF4 A;  1X3P A;  5J3B A;  4C3J B;  2XGT A;  2O5I C;  4HMI A;  3GD7 A;  1VQ9 A;  3K80 C;  5JEA G;  1PH4 A;  1E7Z A;  4DUZ Q;  2RDF A;  3EJI A;  1SYF A;  1W3S A;  2SDF A;  4H7B A;  1XPO A;  3I73 A;  2FXQ A;  4KHV A;  3HEJ A;  2KED A;  3CCQ A;  4DV4 L;  2WB1 B;  2DY7 A;  2N8N A;  4L5Q A;  1LTA D;  1TY0 A;  3F1Z A;  5CV8 A;  3RUZ A;  3FEW X;  1FNV A;  1B7Y B;  1SN8 A;  4GN5 A;  1ZKO A;  1OXV A;  3LX0 A;  2K1B A;  3G7L A;  4KJN A;  1UEB A;  4ILW A;  2A6E D;  2L5T A;  4DR4 Q;  2UXB Q;  5M3F B;  1HTL D;  2R93 H;  2EYO A;  1TWF B;  1O7I A;  1YJN A;  2JA8 G;  3MXU A;  4IUN A;  1VQO A;  1IXR A;  2HHH Q;  1K3R A;  3S2H B;  1JC7 A;  4OX9 L;  3B6Y A;  1ESR A;  3STB D;  4DR7 L;  2F0S A;  4X65 L;  1BXT A;  1QCB D;  2L0C A;  4MTK A;  5I9O A;  1Q46 A;  4UPA A;  4HIO A;  2VW9 A;  2CWA A;  4P72 A;  1N36 Q;  1B2T A;  3E0E A;  3K7U C;  2JA7 B;  1I3Q H;  4QF4 A;  1TQO A;  3T51 B;  3TS0 A;  1QZG A;  4YCV A;  3T56 B;  1D7Q A;  4JVZ A;  2MUY A;  2PCF B;  3KLR A;  4DKA C;  4I7A A;  5IY0 A;  1WTP A;  1S5F D;  3MXG A;  1FJG L;  1A3U A;  1HNZ L;  3UDI A;  5IYB G;  1PTO C;  3S14 H;  5CYU A;  3HOZ B;  1XYI A;  3J7Y W;  2LFN A;  2B2V C;  2I5H A;  5I6W A;  2JQO A;  4A3L H;  2UU9 Q;  1SJH D;  1PH9 A;  4KKT A;  1TY2 A;  3G48 A;  3JAM E;  4YWK A;  4C3H H;  3F8T A;  4DV0 L;  4C3I B;  4HN7 A;  1DOK A;  4HAE A;  4EQP A;  1D1I A;  4G4K A;  1SAP A;  1TWC B;  3HOV H;  3HFZ B;  2A69 D;  2UUB L;  1CT1 D;  2OT2 A;  4GS3 A;  1SYG A;  4A3J G;  2WP8 J;  5IWA Q;  3DM1 A;  1SE8 A;  5EPL A;  2HIX A;  4DXF A;  3M7G A;  4HSV A;  1U9R A;  5DM6 3;  4ID6 A;  4NXN L;  3R8B A;  1IYV A;  3L3O C;  4FO2 A;  2QF7 A;  1B3A A;  2ZM6 L;  4AH6 A;  1FJG Q;  1TS5 A;  3L9A X;  1VS0 A;  2N55 A;  3FHW A;  5J1Z A;  1D5Z C;  3J80 E;  1QNK A;  1IW7 D;  3DEO A;  3ULL A;  2BA1 A;  3I3C A;  4F7X A;  5EBC A;  1K9M C;  3NSW A;  1X9N A;  5COY A;  4YWM A;  5IT9 c;  3S1R H;  4IUT A;  1Q81 C;  2JP1 A;  4X64 Q;  3ULJ A;  2E5L Q;  3PV0 A;  5GAD C;  2TMP A;  4CKE A;  2QEJ C;  1JWU D;  1VMC A;  4DR2 L;  2HQL A;  1PH1 A;  3Q0A A;  2WAC A;  2UXC L;  1S3O A;  2BA0 A;  2G5D A;  4KY6 A;  1PRT D;  4PZ6 A;  4J1M A;  1EY5 A;  1R4P B;  3EVQ A;  1MJE A;  4TKO B;  1MIU A;  1MD2 D;  1J9O A;  3EBE A;  2JEB I;  3GTK H;  3U4Z A;  2HT1 A;  1GHJ A;  3J81 i;  4X62 Q;  1EYG A;  4RCN A;  2VQE L;  1VQH A;  1EZ8 A;  2K28 A;  2XVS A;  2I5L X;  5C4Z A;  1SNQ A;  3OIP A;  4DR1 Q;  4X66 L;  3H3V H;  1FL0 A;  3WWV A;  4BA2 I;  2F0T A;  2VL6 A;  4RH6 A;  2BE5 D;  4GLV B;  2Z8L A;  4WFN 3;  2E2H H;  2F0J A;  5FLX L;  1RJT A;  1FNU A;  3H6M A;  3HZX A;  1YHQ A;  2ZXR A;  3J81 L;  1VQ8 A;  1D6E C;  2JA5 G;  2EDG A;  1LLR D;  5IP9 H;  1WTV A;  5C3E G;  3RN5 A;  4DUY Q;  4DK0 A;  3I7F A;  1IBM Q;  3C1E A;  4KMU C;  1KLU D;  5EKK A;  1H9M A;  3S17 H;  5JJK A;  4KKU A;  1MBY A;  1HFG A;  3NQI A;  4HJ5 A;  4QL5 A;  3HOZ G;  3TRZ A;  4MTN A;  2UXC Q;  4O42 A;  1YHB A;  4DR6 L;  1II3 A;  3A8K E;  5GAE C;  2E2D C;  1IL2 A;  3H0G H;  1UE6 A;  2RQX A;  1EIH A;  3LGJ A;  3I90 A;  4BY7 B;  1M90 C;  1Y8N B;  1O7Z A;  3KUP A;  1DGS A;  1IBL Q;  4A3D G;  3HOW H;  3BVM A;  1TS2 A;  2VQE Q;  1R9T H;  3D6W A;  4A3C H;  2AHO B;  3MTS A;  2KBN A;  4KTA A;  1KAA A;  2QEX A;  4I65 A;  1EIG A;  1PFS A;  1STE A;  4FP5 D;  3F2B A;  1FGB D;  3W5O A;  4CBV A;  1DJR D;  3GO5 A;  1I6H H;  1I50 B;  3QB3 A;  3CQZ H;  3ULP A;  4YHH L;  3S16 H;  3H3V I;  4KKS A;  2DJF C;  1BVS A;  1Z9F A;  3MFG A;  5IP7 G;  3D4W A;  4MN3 A;  4MHE A;  3E0J A;  2EYM A;  1F2L A;  3KF8 A;  1PTO B;  1AP0 A;  3JAM c;  3J7Z C;  4LF6 Q;  1X56 A;  1NSN S;  2RF4 A;  3G6J B;  3FVQ A;  3GTG H;  1MSH A;  3F2D A;  3PO2 G;  4B3R Q;  5K36 H;  1RD9 D;  1GUG A;  5IGD A;  1HNW L;  1TXY A;  2F4V Q;  1ICW A;  1DOL A;  3GTJ B;  1HRJ A;  2PNH A;  3H94 A;  1BO0 A;  2WII B;  3HOX G;  3URY A;  2YYZ A;  4JPB W;  2DNE A;  3BDC A;  3FRP B;  2F0I A;  1YNJ C;  2WKC A;  4JK1 C;  2JYO A;  3WOF A;  3SVM A;  5BR8 L;  4GKJ Q;  4PG3 A;  1PZJ D;  4DV2 L;  4NDX A;  3VR3 A;  3SHL A;  1IHZ A;  1MHW C;  1I4X A;  2B2V A;  1S72 A;  3HKZ B;  1J5E Q;  3WDN A;  5C4J B;  2B8G A;  1TU2 B;  4L8J A;  2IPK D;  1YNN C;  2JA9 A;  5IYC G;  2I46 A;  3J80 c;  4A3M B;  4U68 A;  2DY8 A;  3S15 H;  2C9O A;  3T16 A;  3SE0 A;  3DHQ A;  5LMU Q;  1EU4 A;  2C5C A;  1HR0 W;  3X3M A;  4PZ8 A;  3TSS A;  1Z6H A;  1WCM H;  4HJ9 A;  2WFW A;  3KFU A;  2F3I A;  1HNW Q;  4OON A;  4AYB B;  4LFB Q;  3CME A;  2NYZ D;  1A63 A;  3ZJY C;  4Y7N H;  3I2Z A;  1K8A C;  1AE3 A;  4O0A A;  3CU7 A;  2F52 A;  3K8A A;  1IBK Q;  1A3T A;  5M5X H;  2KVM A;  2A73 B;  2M00 A;  3NWS A;  2YU9 B;  2Z6B A;  1AH9 A;  1XMO Q;  3UI2 A;  1MI2 A;  5K5P A;  4POG A;  2PNR C;  3DLL A;  4C2M H;  3R3O A;  4LF7 L;  2L15 A;  5BR8 Q;  4PZ7 A;  4ZKC B;  2EOT A;  2JA6 G;  2VUM H;  4JI4 Q;  3UDF A;  1STN A;  1HZ9 A;  3FPP A;  2G9D A;  3KBX A;  4GNX A;  5FO8 B;  2R93 B;  3NTH A;  1Y1W G;  1BCP C;  1UNS A;  1I4P A;  2A5H A;  4B3T Q;  2MO1 A;  5M5W H;  3AU7 A;  1HUN A;  5IGF A;  2UXD L;  2ATW A;  1B9M A;  1RL2 A;  2MGS A;  3W2D A;  1EEI D;  3NBH B;  3DWP A;  5JAV A;  3EN2 A;  1KDA A;  3MVV A;  1X32 A;  4A3B H;  1JMC A;  1EY8 A;  1VQK A;  3KLS X;  4C1N K;  5EKI A;  1F9R A;  1I3Q B;  3V05 A;  4IUR A;  3U58 A;  2BCO A;  2IT1 A;  3O13 A;  5ELD A;  4DV6 Q;  5J22 A;  1C9O A;  2F0H A;  2FMC A;  2CW0 D;  2O4X A;  2XRQ D;  3S14 B;  4XYO A;  1LUZ A;  1GUN A;  4QQB X;  4UDU C;  4APV A;  1EFI D;  3NBH A;  2B39 A;  3PO3 G;  1KAB A;  3RD4 A;  4LF4 L;  1H9K A;  1GXD C;  2F0O A;  1JWM D;  1Z7T A;  1LTL A;  2L1B A;  3OW2 A;  4C1N I;  4K0K L;  1CTM A;  1PYB A;  5A2Q E;  2XIW A;  3AMU A;  4LFC L;  4AQY L;  5D3I B;  1VQF A;  3ER0 A;  2D5D A;  2JK8 A;  4X3K A;  1ASY A;  3IAY A;  1VQ6 A;  2WKD A;  3I4O A;  4C3H B;  1K8O A;  2PZW A;  3IL8 A;  3GDE A;  1STB A;  3HOV B;  1PDQ A;  2ID0 A;  5IYD H;  2NWG A;  1BNZ A;  4KN7 C;  1CA5 A;  1HNX Q;  3EA6 A;  1I94 Q;  1PTO D;  5CV4 A;  1KNE A;  3VA5 A;  5JJI A;  1PMR A;  4A3M G;  3H15 A;  4B9W A;  1J8I A;  1VQG A;  1K0S A;  2BDN A;  3A74 A;  3IKJ A;  1E2Z A;  1F9P A;  4H44 C;  1OTC A;  1HHV A;  4LWC A;  2A6H C;  1ZYR D;  2RCN A;  1SNP A;  3OMC A;  3I4M H;  2KCM A;  3SK4 A;  3PUV A;  4P2C B;  4QIW B;  2IJ0 A;  1F9S A;  4L5T A;  2UUA L;  1ET9 A;  1MGS A;  4XDX A;  3RR5 A;  3NQT A;  2F0U A;  2OCE A;  1I4G A;  3S1R B;  4DN4 M;  4K0K Q;  5M5Y H;  2WAQ G;  3Q23 A;  3QG1 A;  2RBM A;  5IT9 L;  3GTL B;  4LUV A;  5HY6 A;  2K5W A;  1CM9 A;  1KLG D;  4HIK A;  4DXG A;  4JYA L;  4QMG A;  3D0F A;  3V2T A;  2FJ2 A;  1U4L A;  2BDO A;  3OYY A;  4A76 A;  2TSS A;  1I4R A;  4IJH A;  3FKI G;  2B2W C;  5FO9 B;  1NR4 A;  2F0P A;  1SNC A;  4HTH A;  2E2I H;  3VDY A;  1H9S B;  5D3D A;  2V1C C;  1GM5 A;  4K5W A;  2WIN B;  4A3F H;  5TSS A;  3GV3 A;  1P16 A;  1V1Q A;  1CHQ D;  3GTK B;  3K0X A;  1SYE A;  3BVG A;  5KNC A;  1GKH A;  2NVX H;  2DUD A;  3J7A 5;  3VA7 A;  2NVY B;  1JE4 A;  4LF5 Q;  4PV1 C;  3T1H Q;  2E2H B;  4BBR G;  2A68 C;  4A3G H;  2K75 A;  2UUA Q;  3HOY H;  3I55 A;  4JI0 Q;  4A3I G;  1MJC A;  1STH A;  5KNB A;  5H1S E;  4L5R C;  5E4W C;  4G7Z C;  4ABN A;  2B63 H;  5C4X G;  1AZQ A;  3S17 B;  4N9P A;  3PUW A;  4ZRZ A;  5E1F A;  1VQD A;  5C44 G;  4CJ1 B;  4P75 A;  1PV4 A;  3K81 C;  5KYL A;  3HKS A;  4LF8 Q;  3NWT A;  1KRS A;  3H0G B;  5COR A;  2EJM A;  2Q2U A;  3ND9 A;  4BA1 I;  3RZO H;  1EZ6 A;  3PMF A;  1S5B D;  4AIM A;  3CCV A;  4JI7 L;  2A8V A;  2K04 A;  4MNO A;  3H91 A;  4KY5 A;  1O80 A;  5D14 A;  1UWV A;  2C35 B;  4JI2 L;  4KHP Q;  3HOW B;  1T5X D;  1EL0 A;  4AYB E;  1R9T B;  4ZLT F;  1CHP D;  2BOS A;  3CC7 A;  4DUZ L;  2ZT9 C;  1KHI A;  2QIL A;  3NEN A;  1BCP B;  2NVT H;  3A54 A;  1HQR D;  1XWE A;  2NBF A;  1H9J A;  2Q2I A;  3A5U A;  1G2S A;  4HR7 B;  1TWH H;  4NB3 A;  1PH8 A;  3C46 A;  4OO1 G;  3K58 A;  1AW7 A;  4JV5 Q;  1I6H B;  4BBS G;  3CQZ B;  4DR4 L;  4H02 A;  4RA8 A;  2UXB L;  3MEF A;  2HQE A;  4DU9 A;  1ET6 A;  1EQR A;  3CPW A;  3PIP A;  1EY6 A;  3SK6 A;  5JVG 3;  1Y1V G;  4UY8 C;  4GN4 B;  3H09 A;  2EY5 A;  2R6G A;  5FJ8 H;  2VB3 X;  3ERS X;  1C48 A;  2YV5 A;  3JAM L;  3GTG B;  1ML0 D;  4UHV A;  1X3G A;  1WTQ A;  3NTK A;  4FVM A;  4JI2 Q;  1N36 L;  1YI2 A;  1G8Z D;  5FKA C;  2ZJP A;  1B1Z A;  2F3V A;  3I8Z A;  2J0T D;  3I4N B;  4BXX H;  5I6Y A;  2Y0S E;  2NN6 H;  4Z9C B;  3TDQ A;  1K83 H;  3D3R A;  2F1M A;  3CKI B;  4IZ8 A;  2K5N A;  1E2V A;  3E5S A;  5M3M H;  3J80 i;  1BR9 A;  3TS2 A;  4UP8 A;  3J7A V;  2EQS A;  1YIT A;  4L63 B;  4LFA Q;  1HR0 Q;  5I9P A;  4A93 H;  5LMN Q;  1NTG A;  2UU9 L;  1EIF A;  4R4Q A;  4YIJ A;  2R61 A;  4BY1 B;  1WOC A;  1WJJ A;  3TP7 A;  3S15 B;  5LL6 S;  1VQP A;  4IPD A;  4X3T A;  3GTO H;  2F0Q A;  2XTI A;  1KRT A;  3J80 L;  4FXK C;  4JBM A;  2LMC B;  4TVA B;  1CA6 A;  3M4P A;  4RCO A;  5C6A A;  5FLM G;  1TWG B;  2MP1 A;  1WCM B;  3S1Q H;  2R7Z G;  3NTI A;  2YTX A;  4RGO S;  4XYQ A;  1IYJ B;  1N32 Q;  4ODG A;  5IWA L;  4Y7N B;  3HOU G;  4JBW A;  4R4C A;  4DNT B;  1C0A A;  1SNO A;  4JBK A;  5L37 A;  5M5X B;  1QVC A;  2MFI A;  3HG9 A;  1SYB A;  2IL8 A;  1GVP A;  5GQO A;  1FR3 A;  4QIW E;  2VUM B;  4B3M L;  1BKB A;  4LF9 Q;  2AQ2 B;  1EQT A;  4KD4 A;  1O78 A;  3BYY B;  2NN6 I;  4X64 L;  5KGU A;  1UE5 A;  5AJ3 Q;  2E5L L;  5M5W B;  3SGI A;  4BWG B;  1DM0 B;  1RIP A;  3AFQ A;  4CJ2 C;  1IYU A;  5M9O A;  4IOA A;  2O5J C;  1LM0 A;  2B2W A;  2IX0 A;  4K8I A;  4UAI A;  3KLS A;  3BG3 A;  4H13 C;  3VR4 A;  2MJ8 A;  2ICE C;  4J8Q A;  1H95 A;  3KYH C;  1S5E D;  1NR2 A;  1FGU A;  4DV1 L;  3I72 A;  1PHJ A;  4RFB A;  3N52 A;  3J81 j;  3SXH A;  1C7Y A;  1AEX A;  4WJW A;  1HQM C;  4P73 A;  5ELO A;  3VYR A;  2DGY A;  4X62 L;  3AFP A;  3S1N H;  1CSQ A;  5D65 A;  4DR1 L;  3A8I E;  1CZG A;  4A3K G;  2RDH A;  4C3J G;  1QOH A;  2EYH A;  1DD2 A;  1Q8K A;  4B3M Q;  1D8L A;  5KYI A;  2PI2 E;  2JE6 I;  1HPC A;  1VQ4 A;  1YHA A;  1SRU A;  3ERO A;  3QJY A;  5CGK A;  4DUY L;  4GNX C;  1RF2 D;  2K33 A;  1IBM L;  5IE8 A;  1U5K A;  4OEL B;  2WB1 G;  3P20 A;  3GP7 A;  2PQA A;  1OXX K;  3Q6S A;  2QW7 A;  1A15 A;  2F0V A;  2EPB A;  4NMZ A;  2Z1C A;  2AMC B;  4OHJ A;  1STA A;  4JI3 L;  1A2U A;  1OO9 B;  3PIO A;  2I07 B;  3OOC A;  1R4Q B;  5M3F G;  3TEH B;  2A74 C;  1G2T A;  4XQJ A;  4IUP A;  1AN8 A;  4DV1 Q;  1N9W A;  1TWA B;  4NKL A;  3TBI B;  2PW7 A;  3L7Z C;  4DV3 Q;  1IBL L;  1LT3 D;  3BVZ A;  4LK1 C;  2PPB C;  1LYL A;  2DN8 A;  1SEB D;  3GTQ B;  4R8I A;  3I4M B;  1CQV A;  2OWO A;  1XTD A;  5JEA H;  1N33 Q;  1A6X A;  1X3E A;  5LL6 X;  5C3W A;  4Q0F A;  2E2J H;  2KOL A;  5AFW A;  5CC4 A;  4LAA A;  1T5E A;  1XMQ Q;  2JA7 G;  4IFD G;  5C0X G;  2JXM B;  2A1A A;  3CRK C;  3PUZ A;  2Z0S A;  4S3S A;  3NEM A;  3PGZ A;  3PF5 A;  1GUW A;  1C4Q A;  1OXT A;  4A3E B;  1UUP A;  2FIN B;  4KV6 A;  1S5D D;  1HZA A;  4RWS C;  4EX5 A;  4JI3 Q;  1QVF A;  1X54 A;  2E2I B;  4TSS A;  2A6H D;  2JA8 H;  4FXG C;  5DM7 3;  3RLN A;  4A3F B;  4LF6 L;  2EJF C;  4B3R L;  2NVX B;  2L4N A;  1CZW A;  2F4V L;  1PFB A;  2Z6K C;  1G6P A;  1OXS C;  2KCN A;  4C3I G;  5ELC A;  2MHV A;  4XT1 B;  1QVG A;  1KIX A;  4CDC C;  5GRO A;  4A3G B;  1HA5 A;  2QGQ A;  3HOY B;  1PFM A;  1NBW A;  4OIK A;  1VQA A;  3MWY W;  4IUU A;  3KLW A;  1VQB A;  1Q1E A;  3KF8 B;  2QKI C;  1B70 B;  4GKJ L;  1L0X B;  2K50 A;  4DV7 L;  4HJA A;  2B63 B;  2YTY A;  3A0J A;  1HZC A;  5IYB H;  1J5E L;  2K05 A;  4OWW B;  2IX1 A;  2CKZ B;  4IPG A;  4JI8 L;  4DAP A;  2RSO A;  3Q22 A;  1S40 A;  1PFN A;  2CQO A;  5EKL A;  1TR5 A;  3K7A H;  5IGE A;  2GA4 B;  2VQF Q;  3VYS A;  4FF2 A;  5LMU L;  1JB3 A;  3RZO B;  4JI6 Q;  1L2F A;  2LS0 1;  2B2U C;  1DZ1 A;  2VNU D;  3CC2 A;  1KAW A;  4B9X A;  1Q1B A;  3OIQ A;  5ELN A;  4G57 A;  4A75 A;  2VY3 A;  1Q7Y C;  4K6L A;  4ME3 A;  1EY9 A;  4LFB L;  2F0M A;  1BCP F;  5CBE E;  2NVT B;  4RGM A;  4A3J H;  1JR0 D;  4FDB A;  1IBK L;  2LXK A;  3ND8 A;  1TWH B;  2MNA A;  1XMO L;  4M1U B;  3SDZ A;  5JOB A;  4DV7 Q;  4DK3 C;  3E9H A;  1IKM A;  3RN2 A;  1N34 Q;  4JI4 L;  5GAH C;  3MAQ A;  1HFN A;  1U4P A;  1B3Q A;  3GTM H;  4JI8 Q;  3PSI A;  1NUC A;  3UE0 A;  3H3V C;  4R9W A;  2HDL A;  4B3T L;  3FP9 A;  1HZB A;  2R92 B;  2EY1 A;  5CMD A;  2OTL A;  1QJO A;  3NK9 A;  5A2Q L;  2Q2H A;  4IJL A;  1JB7 A;  4IPH A;  4LW1 A;  2Z4I A;  2JSO A;  2D62 A;  3T53 B;  4PMW A;  4DV5 Q;  4R4T A;  5DNF A;  1CKN B;  1H9R A;  1SR3 A;  4ZYS A;  4A3E G;  2N49 A;  4HJ8 A;  1TKW B;  4GNX B;  3Q8D A;  3OMG A;  1K83 B;  1KL9 A;  4DV6 L;  1K3B C;  5M3M B;  2R3Z A;  2Q2T A;  2V4D A;  3IFD A;  1PH6 A;  1WI5 A;  1XXG A;  3FMC A;  4BY7 G;  3U4V A;  3CW2 C;  4MIU A;  1I5F A;  2PQE A;  2QA4 A;  3A5Z B;  4HID A;  3OWE B;  2EYP A;  2K03 A;  3UE1 A;  2H1E A;  2L11 A;  4A93 B;  2B2T A;  3NE5 B;  2PW5 A;  1CKN A;  5I4D A;  1XNQ Q;  3TP8 A;  2KHJ A;  2NZ1 D;  2F03 A;  4IUQ A;  5T1G A;  1YBY A;  2JA5 H;  2N78 A;  3GTO B;  4G7H C;  5C3E H;  3NP8 A;  1G91 A;  4HCS A;  4GN3 B;  4RHR A;  2HIV A;  1DOM A;  4N8F A;  3HP3 A;  1FYC A;  4Y52 H;  4F87 A;  3M3Y H;  3S1Q B;  3HOZ H;  5IIF A;  3AQQ A;  1HNX L;  3VR5 A;  3MXN B;  5CV6 A;  2JJQ A;  1KC8 C;  1I94 L;  1K0R A;  2Q8R E;  2VS1 A;  4H0L C;  3EQL C;  5F2D A;  2IY5 B;  3P1H A;  2B8F A;  3OPO A;  1LTB D;  2D2C C;  2Y0S B;  4WOR A;  1PZK D;  3UDG A;  4WRD A;  2RHQ B;  1PH3 A;  1PH7 A;  4A3D H;  4A4I A;  4DK6 C;  3ERQ A;  4CDE C;  4BS9 A;  1HJP A;  1CQF A;  1W6K A;  5KEE A;  1HXY D;  3T1Y Q;  2CQA A;  3RZD H;  1TWC H;  3MXN A;  3SR1 A;  1CSP A;  1CKM A;  1ENF A;  4DNI A;  4XQQ A;  4IOC A;  4P74 A;  1L0Y B;  1SE4 A;  3C3L A;  2N88 A;  4NXM L;  3CMA A;  1IKL A;  1JE5 A;  1UE1 A;  1HH2 P;  1XNR Q;  3OTO Q;  3HKZ G;  5IP7 H;  5C4H A;  1X55 A;  4QJF A;  3BDL A;  1LT6 D;  1V1O A;  4WJ3 M;  2GVA A;  1SRO A;  2R92 G;  1AE2 A;  2M9V A;  2IHF A;  2Z6K A;  3PO2 H;  1EYC A;  5HUR A;  1E2W A;  2N3S A;  4LF5 L;  3A56 A;  3T1H L;  3A7A B;  3HOX H;  4M8A A;  3DWQ A;  2RHS B;  4AYB G;  3M4Y A;  4UP9 A;  3CCJ A;  4JI0 L;  3HRZ C;  3U9O A;  4OEM B;  1JOO A;  3BDO A;  1PA6 A;  3EFX D;  1TT2 A;  5G3L F;  1YVC A;  5JEA J;  5CV5 A;  1QZH A;  1FVI A;  5CV7 A;  1N8R C;  4NXM Q;  2FMM A;  1IL8 A;  2Z4H A;  4GZY C;  1EOT A;  1BDO A;  5IYC H;  1VMP A;  1G51 A;  1SSO A;  1Q8I A;  1B8A A;  4LF8 L;  3K5M A;  3HS0 C;  2B2U A;  4N8X 1;  2R93 G;  2H4O A;  4ZCK A;  3CF5 A;  4F88 A;  3E9I A;  5E7N A;  2QDL A;  4DPG A;  3TP5 A;  4KHP L;  3NBI A;  5I2X A;  4IN3 A;  4LMQ D;  1JCK B;  3ITP A;  4QY7 A;  1EOV A;  1KDC A;  2E2J B;  1SMX A;  2J7Z A;  1KXL A;  4LUZ A;  2AKW B;  2ZJQ A;  2LSS A;  4PMB A;  4JI5 Q;  4DR3 L;  4RHS A;  4JV5 L;  2SNM A;  3TZD A;  4DGZ A;  2JA6 H;  1F2M A;  2QDB A;  1O7L A;  2KEC A;  4JI1 L;  4LJZ C;  2ZTD A;  4DNR B;  1HTP A;  3LNN A;  2EY2 A;  1QE6 A;  1WD1 A;  1Y1W H;  1DXM A;  1K8G A;  2JA8 B;  1JJG A;  5ELF A;  5EJW A;  4A3L G;  1BBX C;  3KDF B;  3D8G A;  2PI2 A;  3QWN A;  1VQN A;  3M7N A;  4OIJ A;  5T1I A;  2JN4 A;  1O7Y A;  1EYA A;  3PIO 3;  4CJ0 B;  1I50 H;  4KHZ A;  2L55 A;  1SYD A;  3AB9 A;  4C3H G;  3UDX A;  1D2B A;  1BUV T;  2HCI A;  1NAP A;  1EWC A;  3KF6 B;  3HOV G;  1Y14 B;  1LTG D;  3D6C A;  1Y69 U;  1Y8O B;  4DK1 A;  3KDF A;  5EGT A;  2VZA A;  1EQV A;  3G71 A;  1PTO H;  4YY3 Q;  1WTH A;  2PYK A;  4DR3 Q;  4CHT B;  1SLJ A;  2K5D A;  4LFA L;  3PO3 H;  1GUT A;  1HR0 L;  5LMN L;  3S16 B;  4XT3 B;  3JAM i;  1WVL A;  4KY7 A;  2WAQ E;  4JI1 Q;  2XSC A;  3KF6 A;  5E3F A;  1X65 A;  2SNS A;  2E75 C;  2ICI A;  1UAP A;  4KJO A;  3K7A B;  3M4Q A;  1NMG A;  3W1G A;  3D4D A;  4CKC A;  1VQE A;  4RAU C;  1G29 1;  1Q86 C;  2EVB A;  5EQ0 A;  4L5S A;  4XIG S;  1GHK A;  3ICE A;  3DEP A;  1I6V C;  1Z47 A;  5J39 A;  4X6A H;  1EY4 A;  1W6J A;  1TS4 A;  1N32 L;  1B50 A;  4A3J B;  2NTS A;  5JJL A;  4WJ4 A;  4A3M H;  1YJ9 A;  4OL7 A;  1SMY C;  5BN5 A;  3IFT A;  2D0O A;  1LTT D;  2ZTE A;  4LF9 L;  3L0O A;  2VB2 X;  3QO2 A;  1JWS D;  2XRS D;  4GLA C;  4CDF C;  3GTM B;  1I4Q A;  2PMZ E;  1B44 D;  3J7A F;  4KI0 A;  1Q12 A;  5AJ3 L;  1G6Z A;  5IGG A;  1DYQ A;  5FO7 B;  4GOP C;  3NUC A;  4GKK Q;  2F3W A;  4XXE A;  1NE3 A;  3KBG A;  2YU9 H;  3MC0 B;  2F4I A;  2CFM A;  5IP9 G;  2WV6 D;  1KD1 C;  3S2D H;  3QIA A;  4ME5 A;  4DAV A;  2K32 A;  1E22 A;  2EYL A;  1SJE D;  2L12 A;  1FNW A;  5FK9 C;  4F8M A;  4IFD J;  3FKI H;  3X3N A;  1YNJ D;  5C0X J;  4OXP A;  1XJV A;  5CBA E;  5JJZ A;  4IUV A;  3CAM A;  1GUO A;  2K5H A;  2OQK A;  2SEB D;  3FPU B;  1ZEQ X;  3MFY A;  4QB4 A;  4QCL A;  2CW0 C;  1BBU A;  2XWJ B;  1Q3L A;  3K5O A;  2LKV A;  5EPK A;  3CCL A;  3PUY A;  2R7F A;  1VQ7 A;  1EYD A;  1F2Y A;  3H0G G;  1RKN A;  1SDF A;  1YNN D;  4ALP A;  4C2M B;  2KQ3 A;  1JOR A;  2XWB B;  2B2Y A;  3TRE A;  4JG2 A;  3HOW G;  2EY6 A;  3S1M H;  4BBR H;  1F9Q A;  2CCZ A;  4DF7 A;  5ELE A;  3I4L A;  4A3C G;  3P7J A;  3GQB A;  3TN2 A;  4A3I H;  2JA5 B;  3K59 A;  1VCI A;  3GTP H;  4K5X A;  3TZU A;  5C3E B;  3KJO A;  1NCV A;  4R4O A;  2KEE A;  1XTC D;  3TQY A;  1A0I A;  4DV4 Q;  5C4X H;  3K57 A;  1GO3 E;  3CCU A;  3ZYY X;  3A8J E;  4GLX A;  4TRD A;  1B53 A;  1VQI A;  1ZXT A;  3M3Y B;  3CC4 A;  3TP6 A;  3VR6 A;  1WYD A;  4YCU A;  1ICF B;  1BQQ T;  4POF A;  5C44 H;  1VQM A;  2HUG A;  4OWT B;  1S4Z A;  2NVQ H;  1RDP D;  4A3B B;  1UE7 A;  2ZXO A;  1ZYR C;  1T9H A;  4ULL A;  4J6H A;  5IGB A;  1SE3 A;  5HGQ A;  2F0D A;  4DV3 L;  2LXJ A;  3BYT B;  1ROD A;  5ELB A;  3E3X A;  2Q8I B;  4A3D B;  2PQA B;  3CRL C;  4ZAI A;  2JEA I;  1PZI D;  1VF7 A;  1N33 L;  1JIC A;  4OX9 Q;  4DR7 Q;  4X65 Q;  1X3Q A;  1BCP D;  4PQX A;  4K8J A;  4DA2 A;  5K36 G;  3IRB A;  4KD3 A;  3RZD B;  4R4I A;  1KNA A;  3AYH B;  1RTN A;  2OQ0 A;  1XMQ L;  1NMF A;  3I4N G;  2B2T C;  1ESF A;  1SFO H;  5EBD A;  1YJW A;  4OO1 H;  3DMU A;  4BBS H;  3I56 A;  1JOK A;  1LAB A;  1L0W A;  5C5L A;  2P5Z X;  2K5Q A;  1LTR D;  2ES2 A;  1HNZ Q;  4YWL A; 
#chains in the Genus database with same CATH homology
 2M2L A;  1DON A;  4C56 C;  5JPM C;  4K6D A;  1PLF A;  3C2P A;  4HCE A;  3W3A A;  4L6T B;  3PO2 B;  4TQU S;  1LTS D;  4KN4 C;  1TII D;  4ZQ3 A;  3M85 A;  3HOX B;  4G7O C;  3T4A C;  2EE1 A;  5M5Y B;  3U9S A;  1GJX A;  2G9H D;  1XX8 A;  1LV9 A;  2RKS A;  2F0L A;  1UEA B;  4X3U A;  3S9W A;  4FXD A;  3DXJ C;  3ONA B;  2EJG C;  5IGC A;  3FDT A;  4OO1 I;  4HED A;  3OSO A;  1LT5 D;  3RLF A;  2L9H A;  1CI3 M;  1QG7 A;  4RKB A;  4NW2 A;  1VF5 C;  2EXZ A;  3PUX A;  1RCV D;  1SNM A;  4XQN A;  5E4X A;  3SEB A;  3VYT A;  3T13 A;  1VDZ A;  5KND A;  1JQY D;  4QUF A;  4K2L A;  1EY7 A;  1D5M C;  2JA6 B;  2ENB A;  1U4M A;  2KHS A;  2PZT A;  2J4X A;  2SOB A;  1WTW A;  5CR3 A;  1Y1W B;  2F0N A;  1CK1 A;  3TME A;  2PZU A;  1HCZ A;  1PYW D;  2O2L D;  2NTT A;  1LT4 D;  2A68 D;  3BZD B;  2F0W A;  4R8N A;  3K0Y A;  3QOJ A;  1WTO A;  2MPM A;  3OHX C;  1EWH A;  5HGT A;  1LTI D;  2IW3 A;  2F0F A;  1LO5 D;  2OXP A;  3DWA A;  2D9U A;  3NXW A;  2A6E C;  1KTK A;  4I7Z C;  5ISR A;  4FNF A;  3PO3 B;  3C1F A;  4ZUI A;  2KCC A;  1QNU A;  5KIX A;  5FLX E;  3V96 A;  1HUM A;  3SK8 A;  1LAC A;  3J81 E;  4HSP A;  3D31 A;  1AFP A;  3A7L A;  1TVX A;  5G3L D;  3MXP A;  4RGN A;  2KUM A;  2RA4 A;  1EEF D;  2HDM A;  4NP5 A;  4U67 3;  4FF1 A;  5CV9 A;  1EY0 A;  5A35 A;  4EQO A;  2K6A A;  1PRT F;  3BS1 A;  3R2I A;  3P75 A;  2NB0 A;  1B4O A;  3HGB A;  5IOD A;  1F2Z A;  3DUZ A;  1DCZ A;  4DFA A;  1RTO A;  1GUS A;  4HMJ A;  1QB5 D;  5I2Y A;  1BF4 A;  2E76 C;  4FF3 A;  2WAQ B;  1RHP A;  1JOQ A;  1E0B A;  4IFD H;  5C0X H;  2EZV A;  2A69 C;  3S2D B;  1V43 A;  4N9T A;  3A55 A;  3FKI B;  3PIP 3;  1SMY D;  1SBB B;  2QCP X;  2HCC A;  5KRU A;  1Y8P B;  4K14 A;  2DNC A;  5IOC A;  1QIL A;  1MSG A;  3I91 A;  2RSN A;  2AWN A;  2XNA C;  4K5V A;  5FOB B;  1IW7 C;  1F77 A;  3R93 A;  5JVH 3;  3S1M B;  2AWO A;  4BBR B;  4A3I B;  5DAU A;  3GTP B;  3WOE A;  2PMZ B;  1KDB A;  1I4H A;  2AUJ D;  5C4X B;  2IX3 A;  1PRT C;  4E6I A;  3I70 A;  4QUC A;  4OGQ C;  5C44 B;  5DEH A;  2NVQ B;  2CVR A;  1Q90 A;  2E74 C;  3Q24 A;  4IFD I;  3MEH A;  3GV6 A;  5C0X I;  4X3S A;  2VXW A;  3S1N B;  2BE5 C;  2NUC A;  2F0E A;  4O1N A;  2XN9 C;  1SYC A;  1WTR A;  1ILP A;  1S5C D;  1D1K A;  1ENA A;  2AQ1 B;  3MA2 B;  2B2Y C;  1FD7 D;  3N6R A;  2EYF A;  1STG A;  3VYU A;  1SFO B;  2NN6 G;  1D5X C;  2X6L A;  4K2K A;  4KK7 A;  1WD0 A;  2ZXP A;  4BBS B;  1QWY A;  1V1P B;  3D4R A;  1CFM A;  3E6Z X;  5C3X A;  1OXU A;  4EGV A;  1ONL A;  1Y1V B;  5C5M A;  4ZUJ A;  1ENC A;  1U4R A;  2OF1 A;  1V1P A;  2Q8T A;  4PNY A;  3MHB A;  2LY7 A;  1A2T A;  4DAY A;  4IAL A;  1K8M A;  2KA7 A;  4XTC S;  3KK7 A;  2X6G A;  3RMH A;  3LWU A;  2X69 A;  1M8A A;  3OW7 A;  1GOZ A;  5BN4 A;  1AZP A;  2FFK B;  3K5N A;  3NHH A;  1BOS A;  4FYD A;  3QOL A;  3VR2 A;  2RDG A;  1V8Q A;  1H9S A;  3NPP A;  5BN3 A;  2F0G A;  2K01 A;  3CHB D;  1WTX A;  4CGY B;  3K5L A;  2R7Z B;  1STY A;  2OEO A;  4PMC A;  2AUK A;  4EQN A;  3HOU B;  1PXU A;  2K7V A;  3LWE A;  2F0K A;  3OWF A;  3M4O B;  2RVL A;  4RGT A;  3SK5 A;  1M4V A;  5EPJ A;  4CKB A;  1TS3 A;  1EU3 A;  4B08 A;  2CHB D;  2IWH A;  1SND A;  1A3V A;  3MZ5 A;  5LHY 1;  4ZK9 B;  2FHT A;  5IT9 E;  3K6O A;  4V19 0;  1SE2 A;  3R2T A;  4IQZ A;  1HA6 A;  4Q5V A;  2EYJ A;  5JPN C;  2KJX A;  5NUC A;  3F2U A;  1PRT B;  2AQ3 B;  1SXT A;  4V0B A;  1C8C A;  1PTO F;  4EVO A;  1ILQ A;  4RKL A;  2PO4 A;  4ZKB B;  1B9N A;  4A3K B;  4FF4 A;  1X3P A;  4C3J B;  2O5I C;  4HMI A;  3GD7 A;  5JEA G;  2RDF A;  3EJI A;  1SYF A;  2SDF A;  4H7B A;  3I73 A;  4KHV A;  3HEJ A;  2KED A;  2WB1 B;  2DY7 A;  1LTA D;  1TY0 A;  5CV8 A;  3RUZ A;  3FEW X;  1FNV A;  1ZKO A;  1OXV A;  3LX0 A;  2K1B A;  3G7L A;  4KJN A;  4ILW A;  2A6E D;  2L5T A;  5M3F B;  1HTL D;  2EYO A;  1TWF B;  3MXU A;  4IUN A;  3S2H B;  1JC7 A;  1ESR A;  2F0S A;  1BXT A;  1QCB D;  2L0C A;  5I9O A;  1B2T A;  2JA7 B;  4QF4 A;  1TQO A;  3T51 B;  3T56 B;  2MUY A;  2PCF B;  3KLR A;  1WTP A;  1S5F D;  3MXG A;  1A3U A;  1PTO C;  5CYU A;  3HOZ B;  1XYI A;  3J7Y W;  2LFN A;  2B2V C;  5I6W A;  1SJH D;  4KKT A;  1TY2 A;  3JAM E;  4C3I B;  4HN7 A;  1DOK A;  4HAE A;  4EQP A;  1D1I A;  4G4K A;  1SAP A;  1TWC B;  2A69 D;  1CT1 D;  2OT2 A;  1SYG A;  2WP8 J;  3DM1 A;  5EPL A;  4DXF A;  3M7G A;  4HSV A;  1U9R A;  5DM6 3;  4ID6 A;  3R8B A;  1IYV A;  3L3O C;  4FO2 A;  2QF7 A;  1B3A A;  1TS5 A;  3L9A X;  2N55 A;  5J1Z A;  1D5Z C;  3J80 E;  1QNK A;  1IW7 D;  3DEO A;  2BA1 A;  4F7X A;  3I3C A;  5EBC A;  3NSW A;  5COY A;  4IUT A;  2JP1 A;  3PV0 A;  2TMP A;  4CKE A;  2QEJ C;  1JWU D;  1VMC A;  3Q0A A;  2WAC A;  2BA0 A;  4KY6 A;  1PRT D;  4J1M A;  1EY5 A;  1R4P B;  3EVQ A;  4TKO B;  1MD2 D;  1J9O A;  2JEB I;  1GHJ A;  4RCN A;  1EZ8 A;  2K28 A;  2XVS A;  5C4Z A;  1SNQ A;  3OIP A;  4BA2 I;  2F0T A;  4RH6 A;  2BE5 D;  4WFN 3;  2Z8L A;  2F0J A;  5FLX L;  1RJT A;  1FNU A;  3H6M A;  3HZX A;  2ZXR A;  3J81 L;  1D6E C;  2EDG A;  1LLR D;  1WTV A;  4DK0 A;  3C1E A;  4KMU C;  1KLU D;  5EKK A;  1H9M A;  4KKU A;  1MBY A;  1HFG A;  3NQI A;  4O42 A;  1II3 A;  3A8K E;  2E2D C;  2RQX A;  1EIH A;  3I90 A;  4BY7 B;  1Y8N B;  1O7Z A;  3KUP A;  3BVM A;  1TS2 A;  3D6W A;  3MTS A;  4KTA A;  1KAA A;  4I65 A;  1EIG A;  1STE A;  4FP5 D;  1FGB D;  4CBV A;  1DJR D;  3GO5 A;  1I50 B;  3QB3 A;  4KKS A;  3MFG A;  3D4W A;  4MN3 A;  4MHE A;  3E0J A;  2EYM A;  1F2L A;  3KF8 A;  1PTO B;  1AP0 A;  1NSN S;  3FVQ A;  3G6J B;  1MSH A;  5K36 H;  1RD9 D;  1GUG A;  5IGD A;  1ICW A;  1DOL A;  3GTJ B;  1HRJ A;  3H94 A;  1BO0 A;  2WII B;  3URY A;  2YYZ A;  2DNE A;  3BDC A;  3FRP B;  2F0I A;  1YNJ C;  2WKC A;  4JK1 C;  2JYO A;  3WOF A;  3SVM A;  1PZJ D;  4NDX A;  3VR3 A;  3SHL A;  1IHZ A;  1I4X A;  2B2V A;  3HKZ B;  3WDN A;  5C4J B;  2B8G A;  1TU2 B;  4L8J A;  2IPK D;  1YNN C;  2I46 A;  4A3M B;  4U68 A;  2DY8 A;  2C9O A;  3T16 A;  3SE0 A;  3DHQ A;  1EU4 A;  2C5C A;  3X3M A;  3TSS A;  1Z6H A;  4AYB B;  2NYZ D;  3CU7 A;  1A3T A;  2KVM A;  2A73 B;  2M00 A;  3NWS A;  2YU9 B;  3UI2 A;  1MI2 A;  5K5P A;  2PNR C;  3R3O A;  4ZKC B;  2EOT A;  1STN A;  3FPP A;  2G9D A;  3KBX A;  5FO8 B;  2R93 B;  3NTH A;  1BCP C;  1UNS A;  1I4P A;  2A5H A;  3AU7 A;  1HUN A;  5IGF A;  1B9M A;  2MGS A;  3W2D A;  1EEI D;  3DWP A;  5JAV A;  1KDA A;  3MVV A;  1X32 A;  1EY8 A;  3KLS X;  4C1N K;  5EKI A;  1F9R A;  1I3Q B;  3V05 A;  4IUR A;  2BCO A;  2IT1 A;  3O13 A;  5ELD A;  5J22 A;  2F0H A;  2FMC A;  2CW0 D;  2O4X A;  2XRQ D;  3S14 B;  4XYO A;  1GUN A;  4UDU C;  1EFI D;  3NBH A;  2B39 A;  1KAB A;  3RD4 A;  1H9K A;  1GXD C;  2F0O A;  1JWM D;  1Z7T A;  2L1B A;  4C1N I;  1CTM A;  5A2Q E;  2XIW A;  3AMU A;  5D3I B;  2D5D A;  4X3K A;  3IAY A;  2WKD A;  4C3H B;  1K8O A;  2PZW A;  3IL8 A;  1STB A;  3HOV B;  1PDQ A;  2ID0 A;  2NWG A;  1BNZ A;  4KN7 C;  1CA5 A;  3EA6 A;  1PTO D;  5CV4 A;  1KNE A;  3VA5 A;  1PMR A;  4B9W A;  1J8I A;  2BDN A;  3IKJ A;  1E2Z A;  1F9P A;  4H44 C;  1HHV A;  2A6H C;  1ZYR D;  1SNP A;  3OMC A;  3SK4 A;  3PUV A;  4P2C B;  4QIW B;  2IJ0 A;  1F9S A;  1ET9 A;  1MGS A;  4XDX A;  3NQT A;  2F0U A;  1I4G A;  3S1R B;  4DN4 M;  3Q23 A;  3QG1 A;  2RBM A;  5IT9 L;  3GTL B;  2K5W A;  1CM9 A;  1KLG D;  4DXG A;  4QMG A;  3V2T A;  2FJ2 A;  1U4L A;  2BDO A;  2TSS A;  1I4R A;  2B2W C;  5FO9 B;  1NR4 A;  2F0P A;  1SNC A;  4HTH A;  1H9S B;  5D3D A;  4K5W A;  2WIN B;  5TSS A;  3GV3 A;  1CHQ D;  3GTK B;  1SYE A;  3BVG A;  5KNC A;  3VA7 A;  2NVY B;  1JE4 A;  4PV1 C;  2E2H B;  2A68 C;  1STH A;  5KNB A;  5E4W C;  4G7Z C;  4ABN A;  1AZQ A;  3S17 B;  4N9P A;  3PUW A;  4ZRZ A;  5E1F A;  4CJ1 B;  5KYL A;  3NWT A;  3H0G B;  5COR A;  2EJM A;  3ND9 A;  4BA1 I;  1EZ6 A;  3PMF A;  1S5B D;  2K04 A;  3H91 A;  4KY5 A;  1O80 A;  5D14 A;  3HOW B;  1T5X D;  1EL0 A;  1R9T B;  4ZLT F;  1CHP D;  2BOS A;  2ZT9 C;  2QIL A;  1BCP B;  3A54 A;  1HQR D;  1XWE A;  2NBF A;  1H9J A;  1G2S A;  4HR7 B;  3C46 A;  4OO1 G;  3K58 A;  1AW7 A;  1I6H B;  3CQZ B;  4RA8 A;  2HQE A;  4DU9 A;  1ET6 A;  1EY6 A;  3SK6 A;  5JVG 3;  3H09 A;  2EY5 A;  2R6G A;  2VB3 X;  1C48 A;  3GTG B;  3JAM L;  1ML0 D;  1WTQ A;  3NTK A;  4FVM A;  1G8Z D;  5FKA C;  1B1Z A;  2F3V A;  3I8Z A;  2J0T D;  3I4N B;  5I6Y A;  2NN6 H;  4Z9C B;  3TDQ A;  3D3R A;  2F1M A;  3CKI B;  4IZ8 A;  1E2V A;  3E5S A;  1BR9 A;  3J7A V;  4L63 B;  5I9P A;  4YIJ A;  2R61 A;  4BY1 B;  3TP7 A;  3S15 B;  5LL6 S;  4X3T A;  2F0Q A;  3J80 L;  4FXK C;  2LMC B;  1CA6 A;  4RCO A;  5C6A A;  1TWG B;  2MP1 A;  1WCM B;  3NTI A;  4RGO S;  4XYQ A;  4ODG A;  4Y7N B;  4JBW A;  4DNT B;  1SNO A;  5M5X B;  3HG9 A;  1SYB A;  2IL8 A;  1FR3 A;  2VUM B;  2AQ2 B;  1EQT A;  4KD4 A;  1O78 A;  3BYY B;  2NN6 I;  5KGU A;  5M5W B;  4BWG B;  1DM0 B;  4CJ2 C;  1IYU A;  5M9O A;  2O5J C;  2B2W A;  2IX0 A;  4K8I A;  4UAI A;  3KLS A;  3BG3 A;  4H13 C;  3VR4 A;  2MJ8 A;  2ICE C;  4J8Q A;  1S5E D;  1NR2 A;  3I72 A;  4RFB A;  3N52 A;  3SXH A;  1AEX A;  4WJW A;  1HQM C;  3VYR A;  5D65 A;  3A8I E;  1CZG A;  2RDH A;  4C3J G;  1QOH A;  2EYH A;  1DD2 A;  5KYI A;  2JE6 I;  1HPC A;  3QJY A;  3ERO A;  5CGK A;  1RF2 D;  2K33 A;  3P20 A;  3GP7 A;  1OXX K;  3Q6S A;  1A15 A;  2F0V A;  2EPB A;  4NMZ A;  2Z1C A;  4OHJ A;  1STA A;  1A2U A;  1OO9 B;  2I07 B;  3OOC A;  1R4Q B;  2A74 C;  1G2T A;  4XQJ A;  4IUP A;  1AN8 A;  1TWA B;  4NKL A;  3TBI B;  2PW7 A;  3L7Z C;  1LT3 D;  3BVZ A;  4LK1 C;  2PPB C;  2DN8 A;  1SEB D;  3GTQ B;  4R8I A;  3I4M B;  1CQV A;  5JEA H;  1A6X A;  5LL6 X;  5C3W A;  4Q0F A;  2KOL A;  5AFW A;  5CC4 A;  4LAA A;  1T5E A;  4IFD G;  5C0X G;  2JXM B;  3CRK C;  3PUZ A;  4S3S A;  1GUW A;  1C4Q A;  1OXT A;  4A3E B;  1UUP A;  2FIN B;  4KV6 A;  1S5D D;  4RWS C;  2E2I B;  4TSS A;  2A6H D;  4FXG C;  5DM7 3;  4A3F B;  2EJF C;  2NVX B;  2L4N A;  1CZW A;  1PFB A;  1OXS C;  2KCN A;  4C3I G;  5ELC A;  2MHV A;  4XT1 B;  4A3G B;  1HA5 A;  3HOY B;  1PFM A;  4OIK A;  3MWY W;  4IUU A;  1Q1E A;  2QKI C;  1L0X B;  2B63 B;  2K05 A;  2IX1 A;  4DAP A;  2RSO A;  3Q22 A;  1PFN A;  5EKL A;  1TR5 A;  5IGE A;  2GA4 B;  3VYS A;  4FF2 A;  3RZO B;  1JB3 A;  2LS0 1;  2B2U C;  1DZ1 A;  2VNU D;  4B9X A;  1Q1B A;  3OIQ A;  4G57 A;  4K6L A;  1EY9 A;  2F0M A;  1BCP F;  5CBE E;  2NVT B;  4RGM A;  1JR0 D;  3ND8 A;  1TWH B;  4M1U B;  3SDZ A;  5JOB A;  1IKM A;  3MAQ A;  1HFN A;  1U4P A;  1NUC A;  3H3V C;  4R9W A;  2HDL A;  2R92 B;  2EY1 A;  5CMD A;  1QJO A;  3NK9 A;  5A2Q L;  2Z4I A;  2JSO A;  2D62 A;  3T53 B;  4PMW A;  5DNF A;  1H9R A;  4ZYS A;  1TKW B;  3OMG A;  1K83 B;  5M3M B;  2R3Z A;  2V4D A;  3IFD A;  3FMC A;  1XXG A;  4MIU A;  2PQE A;  3OWE B;  2EYP A;  2K03 A;  2H1E A;  2L11 A;  4A93 B;  2B2T A;  3NE5 B;  2PW5 A;  5I4D A;  3TP8 A;  2NZ1 D;  2F03 A;  4IUQ A;  5T1G A;  3GTO B;  4G7H C;  3NP8 A;  1G91 A;  4HCS A;  4RHR A;  1DOM A;  3HP3 A;  1FYC A;  4F87 A;  3S1Q B;  5IIF A;  3VR5 A;  5CV6 A;  2Q8R E;  4H0L C;  3EQL C;  5F2D A;  3P1H A;  2B8F A;  3OPO A;  1LTB D;  2D2C C;  2Y0S B;  4WOR A;  1PZK D;  4WRD A;  3ERQ A;  4BS9 A;  1CQF A;  1W6K A;  5KEE A;  1HXY D;  2CQA A;  3MXN A;  3SR1 A;  1ENF A;  4XQQ A;  1L0Y B;  1SE4 A;  3C3L A;  2N88 A;  1IKL A;  5C4H A;  3BDL A;  1LT6 D;  1V1O A;  2M9V A;  1EYC A;  5HUR A;  1E2W A;  3A56 A;  3A7A B;  4M8A A;  3DWQ A;  3M4Y A;  3HRZ C;  3U9O A;  1JOO A;  3BDO A;  3EFX D;  1TT2 A;  5G3L F;  5JEA J;  5CV5 A;  5CV7 A;  2FMM A;  1IL8 A;  2Z4H A;  4GZY C;  1EOT A;  1BDO A;  1VMP A;  1SSO A;  1Q8I A;  3K5M A;  3HS0 C;  2B2U A;  2H4O A;  4F88 A;  3TP5 A;  3NBI A;  5I2X A;  4IN3 A;  4LMQ D;  1JCK B;  3ITP A;  1KDC A;  2E2J B;  2J7Z A;  4PMB A;  4RHS A;  2SNM A;  3TZD A;  4DGZ A;  1F2M A;  2QDB A;  1O7L A;  2KEC A;  4LJZ C;  4DNR B;  1HTP A;  3LNN A;  2EY2 A;  1QE6 A;  1WD1 A;  1DXM A;  2JA8 B;  5ELF A;  5EJW A;  1BBX C;  3D8G A;  3QWN A;  3M7N A;  4OIJ A;  5T1I A;  1O7Y A;  1EYA A;  3PIO 3;  4CJ0 B;  4KHZ A;  2L55 A;  1SYD A;  3AB9 A;  4C3H G;  1D2B A;  1BUV T;  2HCI A;  1NAP A;  1EWC A;  3D6C A;  1LTG D;  1Y69 U;  1Y8O B;  4DK1 A;  5EGT A;  1EQV A;  1PTO H;  2PYK A;  4CHT B;  2K5D A;  1GUT A;  3S16 B;  4XT3 B;  1WVL A;  4KY7 A;  2XSC A;  5E3F A;  2SNS A;  2E75 C;  2ICI A;  1UAP A;  4KJO A;  3K7A B;  3D4D A;  4CKC A;  4RAU C;  1G29 1;  2EVB A;  5EQ0 A;  4XIG S;  1GHK A;  3DEP A;  1I6V C;  1Z47 A;  5J39 A;  1EY4 A;  1W6J A;  1TS4 A;  1B50 A;  4A3J B;  2NTS A;  4OL7 A;  1SMY C;  5BN5 A;  3IFT A;  1LTT D;  2VB2 X;  3QO2 A;  1JWS D;  2XRS D;  3GTM B;  1I4Q A;  1B44 D;  3J7A F;  4KI0 A;  1Q12 A;  1G6Z A;  5IGG A;  1DYQ A;  5FO7 B;  3NUC A;  2F3W A;  4XXE A;  3KBG A;  3MC0 B;  2F4I A;  2WV6 D;  3QIA A;  4ME5 A;  4DAV A;  2K32 A;  2EYL A;  1SJE D;  2L12 A;  1FNW A;  5FK9 C;  4F8M A;  4IFD J;  3X3N A;  1YNJ D;  5C0X J;  5CBA E;  5JJZ A;  4IUV A;  1GUO A;  3FPU B;  4QCL A;  2SEB D;  4QB4 A;  1ZEQ X;  3MFY A;  2CW0 C;  2XWJ B;  1Q3L A;  3K5O A;  2LKV A;  5EPK A;  3PUY A;  1EYD A;  1F2Y A;  1RKN A;  1SDF A;  1YNN D;  4C2M B;  2KQ3 A;  1JOR A;  2XWB B;  2B2Y A;  2EY6 A;  1F9Q A;  4DF7 A;  5ELE A;  3I4L A;  3P7J A;  3GQB A;  3TN2 A;  2JA5 B;  3K59 A;  1VCI A;  4K5X A;  3TZU A;  5C3E B;  1NCV A;  2KEE A;  1XTC D;  3K57 A;  3ZYY X;  3A8J E;  4TRD A;  1B53 A;  1ZXT A;  3M3Y B;  3TP6 A;  3VR6 A;  1BQQ T;  2HUG A;  1S4Z A;  1RDP D;  4A3B B;  2ZXO A;  1ZYR C;  4ULL A;  4J6H A;  5IGB A;  1SE3 A;  2F0D A;  3BYT B;  1ROD A;  5ELB A;  2Q8I B;  4A3D B;  3CRL C;  4ZAI A;  2JEA I;  1PZI D;  1VF7 A;  1JIC A;  1X3Q A;  1BCP D;  4PQX A;  4K8J A;  4DA2 A;  5K36 G;  4KD3 A;  3RZD B;  1KNA A;  1RTN A;  2B2T C;  1ESF A;  5EBD A;  4OO1 H;  3DMU A;  1JOK A;  1LAB A;  5C5L A;  2K5Q A;  1LTR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...