4CJ2C

Crystal structure of hewl in complex with affitin h4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
VKVKFFWNGEEKEVDTSKIVWVKRAGKSVLFIYDDNGKNGYGDVTEKDAPKELLDMLARAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/de novo protein
molecule keywords LYSOZYME C
total genus 13
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj2C00
2SDFA 1O7ZA 5DNFA 1G2TA 2HDLA 2X6GA 4MHEA 1J8IA 1KNEA 1G2SA 2EOTA 3GV3A 1QNKA 4OIKA 2RA4A 1CA5A 2KUMA 3IFDA 3P7JA 1WD0A 1PFMA 4O42A 2HUGA 2X69A 5T1GA 1HA6A 2FMMA 2CVRA 1G91A 1NAPA 3H91A 5EJWA 1AP0A 3FDTA 1WD1A 2L12A 4NW2A 2B2YA 2Q8RE 3G7LA 1AZQA 4X3UA 4CJ1B 1IKLA 1A15A 1NCVA 4RA8A 2B2TC 1XX8A 2B2WA 2NZ1D 2FJ2A 1J9OA 3D6WA 1DOMA 5EKIA 1DOLA 1WTQA 4X3SA 1WTXA 2FFKB 3Q6SA 1ZXTA 2JP1A 3FPUB 1GUWA 1RHPA 1ESRA 1TVXA 2RSOA 1WTOA 2MGSA 5CMDA 4R9WA 1WTVA 1EQTA 1RODA 4ZAIA 1C8CA 2FINB 1B4OA 1WTPA 2K28A 4IUUA 2IL8A 3TN2A 1EIHA 1QE6A 1U4MA 2DY8A 2HDMA 2KVMA 4HSVA 4IUQA 4UAIA 1IKMA 1AZPA 4QUCA 1F2LA 1Q3LA 4QUFA 5CBAE 2L9HA 5D65A 2L4NA 4DN4M 1XYIA 2HCIA 1KNAA 1U4LA 1RTNA 2XIWA 3I3CA 1B53A 1WVLA 1MGSA 1HRJA 3QO2A 1ICWA 4ZLTF 2KEEA 1HUNA 2B2VA 3I91A 4X3TA 1E0BA 1O7YA 1DONA 4XT3B 2N55A 2K1BA 1PFNA 1BO0A 1MSHA 2KOLA 5COYA 3UI2A 2N88A 1X3PA 3GV6A 4CJ2C 1ILQA 4ZK9B 2B2WC 1NR2A 1B2TA 1G6ZA 3ONAB 3DEPA 1F9PA 4IUTA 2HCCA 4MN3A 1PDQA 4HEDA 4ZKBB 2Q8TA 5CBEE 1SAPA 4XDXA 1WTRA 4XT1B 1MI2A 2KECA 3F2UA 3I8ZA 1JICA 5T1IA 2MP1A 4U68A 2K03A 1M8AA 2KEDA 1F9QA 2J7ZA 1BBXC 2JYOA 1SSOA 5EQ0A 2MPMA 1B3AA 2NYZD 1DZ1A 1EIGA 1ML0D 1QG7A 3KBXA 4RAUC 1X3QA 3N52A 1HHVA 2K05A 1BNZA 2DY7A 1O80A 1RTOA 2B2YC 3MWYW 2FHTA 5CORA 2L1BA 2X6LA 3DM1A 1VMPA 5EPLA 3MTSA 2NWGA 1X32A 4IUVA 1PLFA 2M2LA 4HAEA 1SDFA 3DEOA 2B2TA 2B2UC 3IL8A 5JJZA 5EPKA 2B2UA 1HFGA 1F9RA 3TZDA 4LMQD 1JE4A 1EOTA 5E4XA 2RSNA 1HFNA 4CJ0B 2EE1A 4ZKCB 3SVMA 3LWEA 5D14A 5E4WC 1U4RA 4OIJA 2L11A 1CA6A 1B50A 5EPJA 1MSGA 3HP3A 4HCSA 4X3KA 1CM9A 2BDNA 2D9UA 1LV9A 1F9SA 1NR4A 2MJ8A 1DOKA 1S4ZA 2H1EA 2VXWA 3I90A 3KUPA 4IUPA 1PFBA 2K04A 1WTWA 1BF4A 4IURA 2EPBA 2R3ZA 2B2VC 1VMCA 1U4PA 1EL0A 1RJTA 3R93A 1HUMA 4R8IA 5AFWA 4RWSC 1ILPA 2K01A 2RVLA 1IL8A
chains in the Genus database with same CATH superfamily
1VQ7A 1B9NA 2K6AA 1Y1VB 3WDNA 2R7ZG 1A0IA 5LL6X 3SK6A 3RN2A 1EYDA 4ULLA 3R2IA 3DLLA 4B3SL 2FMMA 4R4QA 4JOIA 1E2ZA 3A8KE 1NUCA 1CHQD 1PRTB 2NUCA 3UDFA 3NELA 1EWHA 5EBCA 2OT2A 1VQ9A 4A3DB 1PH4A 5FO7B 1EOVA 2XRSD 2MGSA 3V05A 5C4HA 2WAQG 3EROA 3SHLA 1QCBD 2WACA 1V43A 3PCOB 4JI6Q 4A93H 3FPPA 2K28A 3A5ZB 5C44H 1GO3E 3CMEA 3VYSA 3AU7A 2AKWB 5IGGA 4DU9A 3HOVG 1C4QA 3ULPA 1BCPC 4LF6L 1NE3A 5C3XA 5C3EH 2WAQE 5KNCA 5ELNA 4WFN3 3U50C 4DPGA 3HOXB 4C56C 5M5YB 3I73A 2O5JC 3A54A 1M4VA 4K5XA 4AYBB 2IY5B 5COYA 5CBAE 1DONA 1G6ZA 3NTHA 3PO3G 4YWMA 3DEPA 1K73C 4IZ8A 2BH2A 2ZXRA 1AN8A 2Z9HA 1A62A 1JICA 5D3DA 4KK7A 1K8MA 3H94A 5KYIA 1QZGA 2CWAA 2C9OA 4GOPC 1U9RA 1A2TA 1JB3A 2A19A 3PUWA 5CORA 4DV1L 1IBML 2Q2IA 3URYA 4C3IB 1VQ8A 3CF5A 4A93B 5KRUA 3TZDA 2VUMH 5C4XH 1Q8KA 4J6HA 3J7AF 3ICEA 3IKJA 5ELCA 3HOZB 1FR3A 2CW0C 3EFXD 5C3EB 1B9MA 1Y8NB 1A63A 1VCIA 3HOXH 3BZKA 5FJ8G 1K8OA 1H9JA 1JC7A 4XQNA 1GM5A 3IAYA 5ELFA 3D4WA 2I5MX 4IJHA 3R93A 1ILPA 2JA7H 2XN9C 1T9HA 2OQ0A 1G2TA 2HDLA 4HJ8A 3GTLB 2F0KA 5JEAJ 1Q46A 1ENAA 1HA6A 5A35A 1WD1A 3D4DA 3M4PA 1FNUA 3GTOH 2JE6I 2F0WA 2B2WA 1T5EA 4A4IA 1Y1WG 3F2CA 1J9OA 2PW7A 3I72A 1WJJA 2HIXA 5KYLA 3CW2C 4LF9L 1I6HH 4OWXB 3A74A 4BWGB 4FF2A 4IPCA 2AMCB 2VB3X 3SGIA 5I4DA 4ZAIA 3OPOA 4JC0A 4ZYSA 4QMGA 1GUOA 3MXNA 1C0AA 2F0IA 2CKZB 4B3SQ 1LYLA 4HCEA 5IWAQ 2KBNA 5FLXc 4MNOA 4DN4M 1U4LA 2QDLA 2JA7B 1ICWA 2EY1A 3L7ZC 4YY3Q 4R8IA 1MD2D 1HZCA 3S1RB 3GTLH 4FF1A 1ILQA 2A74C 1U5KA 1VQEA 1X54A 4C2MB 4DXGA 1EQRA 1W6KA 4HEDA 4LAAA 3CQZH 1TS5A 1VQCA 2HHHL 4DK1A 5JAVA 2I07B 4XXEA 2D5DA 5M3MG 4XIGS 3Q23A 3I4MG 2EQSA 2E74C 3D8GA 2PZWA 1YI2A 1Q90A 1XXGA 5FKAC 1GD7A 3K8AA 4O2DA 1VQIA 4JW0A 1Q81C 1LT5D 5BR8Q 3PF5A 4XQQA 2RCNA 4DV3L 2R7DA 4RGOS 1KDAA 4HTHA 4IFDG 2UXBL 4LMQD 1EOTA 3K6OA 3E0JA 3LWEA 1KAAA 4DV5Q 3HP3A 3R8BA 2QKIC 4A3BH 1EQVA 3K5LA 2MJ8A 5M9OA 1D5XC 4QIWB 3TMEA 4LFAQ 3JAMi 1E1OA 1VMCA 1VS0A 4K5VA 3S1RH 4HJ5A 4I65A 5JEAG 4QL5A 2E2HB 1EYCA 3PF4A 1VQHA 2DN8A 2OF1A 3TS2A 2JJQA 1Q86C 3CQZB 5CV6A 1SYBA 1JB7A 4P75A 2EOTA 4DV5L 3HKZG 2G9HD 3T1YQ 3H15A 2K32A 3BU2A 2X69A 3AYHB 4S3SA 4DR6Q 1L1OC 4JBKA 1FJGL 3E9IA 1FD7D 1R4QB 4X3UA 4EQ5A 1IKLA 2B63H 1T5XD 2YU9B 2CCZA 1LTAD 4A75A 1GJXA 4ME5A 3GTKB 1L0XB 5EKIA 1J6QA 4FF3A 3A8JE 4A3GG 3GTMH 2HQEA 5BN5A 5JJIA 3S1NH 2EY6A 4YIJA 4A3BB 4C1NK 1QE6A 2A8VA 3KF8B 4UAIA 4QGUA 5JVG3 4DGZA 1F2LA 4F7XA 4YY3L 1GUNA 5HY6A 4FVMA 3BS1A 2KEEA 1A3VA 3PUZA 3PIOA 1O7YA 2Y0SE 1SE3A 3OMCA 4LWCA 3T53B 4BS9A 4A3LH 1STNA 3ITPA 3SDZA 1ASYA 2B2WC 3PO2G 5IWAL 2ICIA 1VQGA 1CKOA 3FP9A 2GN5A 2YTVA 4OO1I 2JN4A 2QGQA 1D7QA 3NXWA 1VQAA 2EJFC 1IYVA 1EEID 3QIAA 1ZYRD 1SSOA 5EQ0A 5IYDH 3OWEB 4LF9Q 2K05A 1L0WA 3MWYW 2M00A 5EPLA 4NPSA 3GTMB 1N9WA 4JBJA 3HOWG 2UU9L 2EYHA 1RKNA 4BBRH 2K4KA 2K14A 2RSNA 3RD4A 5KEEA 3CCEA 3S24A 3K0YA 1F77A 1TWAB 5IYCG 2A6HC 2AQ3B 1PH3A 3KK7A 1EU3A 1VQLA 4K14A 3KLRA 1EFID 1XJVA 3QJYA 5CR3A 5ELBA 4HMIA 2IHFA 3DWQA 5GROA 4MTNA 4KD3A 3M9BA 1EY6A 4A3JG 5GAEC 2X6GA 2M9VA 3TBIB 2E76C 4HSPA 2ENBA 5IP9G 4DK0A 4OIKA 5CC4A 4TVAB 5DM63 4AIMA 2XSCA 1ASZA 1WD0A 2B8GA 3MXPA 2L12A 2UUAQ 1VQ4A 4MIUA 4WORA 4DFAA 1O7IA 3HS0C 1SNDA 4DV1Q 1K0RA 1IBMQ 1GXDC 1TIID 3CAMA 3A7AB 3OOCA 4DNIA 4BBRB 1ZXTA 2JP1A 4Z9CB 5CMDA 1WTVA 1QJOA 1HNWQ 1GUSA 3J80L 1TWAH 1WTPA 4QCLA 3G4SA 3S2HH 3FKIG 2PMZE 3G6JB 4QF4A 4PZ8A 4UY8C 2ZJPA 2YTXA 1TR5A 2O4XA 1HA5A 4PV1C 3C1FA 2F0OA 2K5WA 4DAMA 2R92B 1QZHA 2JA8G 1UWVA 1FNVA 1N36L 1XMOL 4ZUIA 4LF6Q 1NR2A 4KD4A 3S15B 1S40A 4KJOA 2WP8J 1TWGH 3T16A 3VA7A 2LKVA 2K03A 2KCMA 4JI6L 2E8GA 3M3YH 3CPFA 3HOUG 4UP8A 1ICFB 3BDLA 4QB4A 4BY7H 3VR4A 4ILWA 4YCUA 1VQBA 1TWFB 1SJED 3OTOL 3I4NH 2NN6H 4LF8L 1PZID 3KLSA 3X3NA 2FHTA 4XYQA 2F0LA 4H7BA 3TSSA 3HKSA 5I9OA 1D6EC 4DR4Q 4OWTB 1L0YB 1VF7A 4A3KG 2D62A 1PLFA 3J81c 4BBSG 2SNSA 2ZXPA 3DEOA 5AJ3Q 2B2UC 2QA4A 2PZUA 5JJLA 4FXKC 1JT8A 5I6YA 1F9RA 3CC2A 5ELDA 5J39A 4DXFA 1CSQA 1HH2P 4OELB 2AUKA 1CA6A 2N3SA 3CCSA 3PIPA 2OXPA 1P16A 1QUQA 4FXDA 4JOIC 4UPAA 1LV9A 1YHAA 1EY4A 1NR4A 2R92H 1S4ZA 3I90A 2JA5B 2OQKA 3DWPA 1NSNS 2UXDQ 1EL0A 3OIPA 3SXHA 4BXXH 2RVLA 4GKKQ 1IL8A 1GHJA 3PMFA 4A3IB 3EIVA 1J8IA 1KNEA 1G2SA 3GV3A 1UEBA 2VW9A 2RA4A 3M3YB 1ET9A 3E3XA 4J1MA 1TWFH 1M90C 5GADC 4JVZA 1Y8OB 2UXCL 2LSSA 4NW2A 2B2YA 5EKKA 5JPNC 1LTBD 2IHEA 3VYRA 3S1QH 4RHRA 3Q8DA 4JI2L 4X65L 1X55A 4HJ7A 3VR5A 1K9MC 2ZTCA 5M3FB 2ASBA 1JR0D 2JA5G 3TP8A 4JV5Q 3R2TA 2MFIA 4NP5A 5C0XJ 4WJ3M 3EVQA 3JAMc 4DR1Q 3NE5B 4HSVA 3HFZB 3PQIA 1JMCA 4GOPB 4QUFA 4DV4Q 3H3VC 1XYIA 1KNAA 1TT2A 4UP7A 1B53A 3T56B 4G4KA 3MZ5A 1EIFA 1SEBD 5M5XH 4GNXC 3SE0A 4DV0Q 1D1KA 3ZJYC 3C2PA 3Q24A 1LTID 3E6ZX 1BKBA 4XT3B 1WTRA 4BBSB 1PH8A 4ZK9B 4UDUC 1Y1VH 4IN3A 3FMCA 4Q5VA 1HTLD 1V1OA 3ER0A 3UDXA 3WOEA 1YNNC 1IBKQ 3SVMA 3DUZA 3MC0B 4NXNL 2Z4HA 3CU7A 1ZEQX 5IGFA 3MAQA 2J4XA 2JYOA 1NY4A 4YWLA 3VR3A 3S14H 2BE5C 3HOUB 2MPMA 4IALA 3S1QB 2XRQD 5LMNQ 4GKJQ 1IYJB 2EJMA 2A73B 4AQYL 2X6LA 1B70B 2KHSA 3IFTA 1YNJC 3ULJA 4WJWA 2WIIB 4L5QA 1N34Q 4OX9Q 1IHZA 1H9RA 2R92G 2C5CA 4DAYB 1ESFA 1HFNA 4CJ0B 2N8NA 1B1ZA 2EE1A 4N8X1 4DK6C 4F8MA 1B7YB 4ZKCB 3CC7A 4OIJA 1I50B 1VQKA 3FKIB 3E5SA 3MFYA 2BDNA 2B29A 2QILA 3M7GA 1IXRA 5LMUQ 5JJKA 4A3KH 1LACA 3D0FA 2LY7A 5ISRA 3S17B 1SBBB 3RZDH 3I4NG 2B3GA 4X66L 4LFCL 3I55A 3BG3A 3M4QA 4BY7G 4HJ9A 1S5CD 3MA2B 3S14B 4DNTB 1CZGA 3CD6A 1UE5A 4KKTA 3NENA 3MEFA 1TQOA 1YEZA 4NXMQ 3X3MA 3MXUA 3KF6B 2BH8A 3J81L 1N32L 2OTJA 3OWFA 2B2TC 4PMBA 3CP0A 3U9SA 5C4XB 4CDCC 3KLWA 1WTOA 2MNAA 2F0JA 1RODA 3G48A 1C8CA 2FINB 1PFSA 1I50H 1LT4D 4H02A 5C4ZA 2R7FA 4X6AH 3VYUA 4L6TB 1S3OA 4EX5A 4POGA 4YWKA 1Q82C 4JI3Q 2ZM6L 4P73A 4K6DA 4LFBQ 3RN5A 1WVLA 4B3MQ 3TP7A 1HNZL 5KGUA 4GZYC 3RZDB 1K3BC 3ZYYX 2F0TA 2N88A 3ND8A 4I7ZC 4DAYA 4KI0A 1KRSA 1STHA 1SLJA 1DCZA 1X3GA 4IUTA 1TWCB 1II3A 1I6VC 2IX3A 1E7ZA 1J5EQ 3CRKC 1IZ6A 3BVMA 2I0QA 3OW7A 4P71A 1EU4A 1B3AA 2NYZD 3SK8A 5IP9H 2Z6KC 2ZJQA 4N9TA 4JI5Q 1RTOA 3CPWA 3CCJA 4G7HC 2UUBQ 4LF5L 1AE3A 1O7LA 3WWVA 3HG9A 4IUVA 4JI7L 1XWEA 5FLXE 2DNEA 4DUYL 1HR0L 4OEMB 1QVFA 4X62L 2PNRC 2NZHA 5IYCH 4L5TA 1PTOH 2ATWA 3GTJB 5EPJA 2E5LL 1ZKOA 3K57A 4GLVB 1I4GA 1V1PB 1DOKA 3Q0AA 2H5XA 2VNUD 2JQOA 2BCOA 1U4PA 2A69C 4A3GB 4YHHL 1Q1BA 1I5FA 5K36H 1SNMA 1TWCH 2Z6BA 3R3OA 1YJWA 1SR3A 1CUKA 1P8LA 5IYDG 2KUMA 3PUVA 1NNXA 2A6EC 1CQVA 2DGYA 3H91A 1PV4A 1BOSA 1CKNA 2EXZA 2K5HA 3PO2H 3HKZB 1I4HA 1EY9A 2CQOA 3N6RA 2Q2TA 2QF7A 5KIXA 4KMUC 4E6IA 4GLXA 1XPRA 5LMNW 3NQIA 4PG3A 3KFUA 3W3AA 1H9KA 4NMZA 1ESRA 1HZ9A 1TVXA 1MJCA 2R61A 2SNMA 1IBLL 3C3LA 1PTOB 1KAWA 3CCQA 1K28A 4HIOA 1I94L 3QB3A 1WYDA 4KTAA 4B3TL 1CZWA 2BOSA 1KD1C 4KJNA 4B9XA 2QEJC 2CHBD 1HPCA 2KHJA 3AQQA 4A3GH 3DMUA 2E2HH 3P75A 3A7LA 1SRUA 1I4RA 1S5FD 1H9SB 4I7AA 2R6GA 5CV7A 4XQJA 2HCCA 1DGSA 5FO9B 5E3FA 1X56A 3MXGA 4YCWA 2EYFA 3A8IE 4DAVA 4DUZQ 2ZXOA 4OONA 3C1EA 5M3MB 2RHSB 1N33L 5HURA 3TQYA 1JWMD 2TMPA 4OXPA 1IL2A 1KLUD 4N8FA 2YU9H 4GLAC 3DXJC 3GTKH 3PUYA 5K36G 3PIP3 1VMPA 5JEAH 1YNND 3NUCA 4LF7L 2B2UA 1PYWD 3U4VA 1HFGA 2F1MA 4DR7L 2UUCL 3AEVA 2WINB 5D14A 3MFGA 2L11A 2MQHA 2PO4A 4IQZA 4JI0Q 2NN6I 4IFDH 2K04A 1TU2B 2MO1A 1JQYD 4FO2A 4A76A 2A6ED 4K2LA 4LJZC 4ODGA 2PCFB 4JI8L 3BDCA 3P7JA 1D5ZC 1G291 1L1OA 3L2PA 1TKWB 1W3SA 4DKAC 1NJIC 1FYCA 3D31A 2JK8A 2K5DA 1BCPF 2RF4A 2G5DA 2CWPA 4BA2I 3F1ZA 1SROA 1NCVA 5DLQE 4TKOB 3HRZC 3GQBA 2F3VA 3CHBD 1WTXA 3FPUB 1IYUA 4FYDA 3F2DA 2CH4A 1I4XA 2NTSA 1S5DD 5JOBA 4IOAA 3TP5A 1H9MA 1VF5C 2JSOA 2HDMA 1KTKA 5M5WH 2F03A 4RGNA 2E75C 3EA6A 1NTGA 4PQXA 3CCVA 2NBFA 4J15A 3NQTA 2NB0A 5G3LD 2AUJD 3I91A 3G71A 4K8JA 3M85A 1ZYRC 1X3PA 4K0KL 1PRTC 1VQJA 4K8IA 2G9DA 1PDQA 3IRBA 2KECA 3KJPA 1S72A 3BVZA 1DJRD 5DAUA 3NWTA 4RAUC 4JBMA 1HHVA 1O80A 1S5ED 4B9WA 4QJFA 1RL2A 3VR6A 2VB2X 1HR0W 4APVA 1DD2A 4LF4L 3KYHC 3UDGA 5CV9A 3HOXG 4LUVA 3S2HB 5DEHA 1X3FA 5M5WB 1BBWA 3RMHA 3HOVB 3CCRA 3L3OC 4HCSA 2QEXA 5C4XG 5CYUA 1PH6A 1JJ2A 1I3QB 4X3SA 3QOJA 2VXWA 5CV4A 2YV5A 1HNXQ 1X3EA 2R3ZA 3K58A 5IY0A 5TSSA 2NTTA 1LM0A 4KY5A 3TP6A 3U9OA 2DUDA 3GTPH 1JWUD 1PZKD 4LUOA 1GOZA 2EYOA 2KJXA 2Z8LA 2VQEL 1QNKA 1CI3M 4EVOA 4BY7B 3BYTB 1RDPD 3SK4A 3EN2A 3I4NB 1VQMA 3T1HL 2F0EA 2F0NA 2EIFA 2VQFL 1XNRL 1HTPA 1JOOA 4CJ1B 3PO3H 5IE8A 4R4TA 1Y1VG 1LTLA 2F4VL 3QG1A 2OTLA 1QILA 5H1SE 3RLOA 2L0CA 1DOMA 3AFQA 1LTSD 4JI4Q 4PMWA 1K0SA 3Q6SA 3V96A 2RSOA 4CDDC 1G6PA 1UNSA 2KQ3A 1CT1D 3I2ZA 3J7ZC 4U673 1SN8A 4ID6A 1KQSA 4YCVA 2K5QA 1I3QH 4AH6A 2F0PA 2A6HD 2JA5H 1D8LA 3A56A 4M1UB 1FGUA 3EQLC 1Z9FA 2L4NA 1PRTF 2BA1A 4K5WA 2CFMA 1BVSA 2TSSA 3J7YW 4X64Q 1GHKA 3PIO3 2BE5D 1CK1A 1L2FA 3W1BA 2I46A 2IPKD 4QQBX 2DJGC 4B3RL 1ENCA 2JXMB 4HIDA 2MP1A 2J7ZA 4JI1L 4DV6Q 3NK9A 4A3FB 1DZ1A 1QG7A 3KBXA 3N52A 4EQNA 1BNZA 3GTQB 2RQXA 4BXXG 4DV2Q 3DHQA 4DV2L 5JJZA 5IT9c 4RFBA 5C4JH 2ID0A 3J7A5 1JE4A 4H44C 2WFWA 5E4WC 1U4RA 5M3FG 4ZQ3A 2D9UA 1B3QA 3J81j 2E2IB 4DR2L 1F2ZA 4DV7L 5M5XB 1DM0B 1I4QA 2ZT9C 1AFPA 4BBSH 1PVOA 3NSWA 3OIQA 3KJOA 4ALPA 1XPOA 1SFOH 3BZCA 1KHIA 3G6EA 1NMGA 4RA8A 4CKEA 1MIUA 4X64L 1B8AA 3S1MB 2NN6G 2XGTA 3H09A 5GAHC 1BCPB 2A68C 3WOFA 1KL9A 3NTIA 2WV6D 2A1AA 2RDHA 3HOUH 2RBMA 4ZUJA 4DR3Q 2BDOA 3BJUA 4KHZA 3UE1A 2EXDA 1NAPA 3GTQH 4JYAQ 1BXTA 4A3IG 2Q8RE 4KN4C 1CHPD 4Y7NH 3T13A 1YNXA 2XTIA 2NZ1D 4JI4L 2JA8H 1A3UA 1WTQA 2RDFA 3D3RA 4L8JA 4MZ9A 3TS0A 2F4VQ 2YYZA 1EIYB 2F0SA 1RIPA 4R1JA 4RKLA 3BZDB 3FKIH 4DR5L 1OXVA 3T1HQ 2IL8A 2E2IH 1U4MA 3H3VI 4PZ6A 4FP5D 1EZ8A 2O5IC 2ZTDA 4KHPL 1UE7A 4A3KB 1XTDA 5EBDA 1SFOB 2XIWA 2F0UA 3STBC 4KV6A 1SE8A 3T4AC 1AW7A 5F2DA 1PH2A 4QY7A 1STYA 3S17H 1E0BA 3UI2A 2N55A 1BO0A 2GVBA 3M7NA 4HIMA 1XNQQ 1EYAA 4QIWE 2F0GA 5CBEE 1SAPA 1STBA 2PNHA 2IX1A 1BBXC 1QVCA 1PYSB 1GUGA 2Q2HA 5G3LF 4EQOA 4A3JH 4V190 3QOLA 1YVCA 3H0GB 2JA8B 1VQPA 2L1BA 1VQ5A 2XNAC 5KNBA 1Y14B 2PMZB 2NWGA 4XYOA 4LF4Q 4EQPA 1CSPA 5IODA 1SDFA 5IOCA 2EJGC 5IT9L 1SNCA 2QCPX 2QW7A 5E4XA 3M4OB 1B50A 5FOBB 1VQ6A 1QB5D 2NVTH 3OHXC 4F88A 4BBRG 5GAGC 1PFBA 1XMQQ 1RCVD 2C35B 3W5OA 3HOWH 1RJTA 3EJIA 3VYTA 1HZBA 4C1NI 1XMQL 5ELEA 1EY7A 3NWSA 4KN7C 2FMCA 5C3WA 3HOYH 3ERSX 1HQMC 4JBWA 5DNFA 4ZCKA 1S5BD 3VR2A 4N9PA 3OW2A 1LT6D 1SMYC 2KCCA 4LK1C 1Q8IA 1TWHH 3CC4A 2YTYA 5IGBA 4A3JB 2FXQA 1G91A 1LTTD 3K7AB 5NUCA 1BUVT 3FDTA 4XTCS 3U58A 1LUZA 4RHSA 1AZQA 2L55A 2NZOA 1A15A 4A3LG 1XX8A 2HD3A 3I7FA 3C46A 1LT3D 1DOLA 1E2VA 1X9NA 3RLFA 1C48A 4HMJA 3E0EA 5I9PA 1RF2D 1YNJD 3GTJH 3S16H 3NEMA 2D0OA 3A55A 4IUUA 3KF8A 4UP9A 1JCKB 5IGDA 2CW0D 1XNQL 4JI8Q 3HOWB 1HQRD 1Q12A 2F3WA 4LNQA 4GN5A 1HUNA 4ZRZA 3J81E 3AMUA 2B63G 4KHPQ 1VDZA 1TWHB 2OCEA 3ND9A 4HN7A 1G8ZD 1MI2A 3K7AH 1SE4A 4DR5Q 4JI0L 5BN4A 2F0HA 2ZJRA 2D0PA 3PO2B 3DM3A 4DR7Q 1ML0D 3FHWA 4ME3A 3MVVA 4IJLA 1WFQA 1DYQA 4TRDA 3RUZA 2K7VA 2F0VA 1SMXA 3BDOA 3K5NA 5EPKA 4JYAL 4POFA 5J22A 4A3BG 4DR3L 3F8TA 1TY0A 1ET6A 4FXGC 1OXTA 1N33Q 1KABA 3J80E 4DUZL 1F9SA 4IUPA 4CGYB 1EEFD 2B2VC 4OL7A 1A2UA 3RR5A 1BBUA 3FEWX 2BA0A 2I5HA 1EQTA 2KA7A 1KC8C 3V2TA 4DV7Q 1FGBD 4DR2Q 3HGBA 5IYBH 1E22A 3I4MH 2JA9A 5FLXL 5M3MH 1Y69U 1V8QA 1CTMA 2F0DA 3PV0A 1CA5A 3IFDA 1YJNA 2K5NA 4O42A 2HUGA 5KNDA 4A3EB 3PGZA 4R8NA 4IO9A 4HJAA 1N8RC 2LMCB 4GN3B 3NP8A 1SYDA 4IPGA 1IBLQ 2CQAA 4DK3C 1KRTA 3HEJA 4F87A 1KDBA 1KDCA 4DV6L 3A0JA 4JI1Q 3UE0A 4RGTA 1E24A 5E1FA 2DY8A 4B3RQ 4CDFC 2F4IA 2L9HA 2MUYA 4C3HB 2PQAB 1PMRA 2IJ0A 2OWOA 1SYGA 1WCMB 2K5VA 4CKCA 4A3MB 5C0XH 1Y1WH 1A8VA 1EUJA 1WTHA 4YHHQ 2HIVA 3I4MB 2KOLA 4G7OC 5CGKA 2R93H 2MHVA 5IP7H 2Z1CA 2VS1A 1SNQA 4MN3A 4ZKBB 2AWOA 5IGCA 2RHQB 3W2DA 4U68A 3K7UC 3TDQA 2ALYB 1F9QA 1LLRD 2Z4IA 4FDBA 2K50A 1STEA 4G57A 1E1TA 1YJ9A 4X62Q 4HR7B 1HR0Q 3H6MA 4PNYA 1OXSC 1V9PA 4DUYQ 2JA7G 1D2BA 2M2LA 4LF5Q 1XNRQ 2VQFQ 2UUBL 3IL8A 1F2YA 1STGA 5FJ8H 2LXJA 3JAME 2B8FA 2V4DA 1UE1A 2PPBC 1STAA 2EYJA 2LXKA 3NBHB 4GNXB 4WRDA 3E9HA 1PRTD 1JOKA 2VL6A 4OHJA 5JVH3 2VQEQ 4X3KA 1HJPA 2Z6KA 1CM9A 1IW7C 1W6JA 4C3HH 5C44B 3CCLA 2VUMG 1PH1A 1WCMH 2GVAA 1WTWA 1Y1WB 3LNNA 5FLMG 1R9TH 2RKSA 2J0TD 4RKBA 2PZTA 1EZ6A 1HUMA 1HNXL 3OYYA 4CBVA 1EY5A 5L37A 4IPHA 2F3IA 3GDEA 5M5YH 4B3ML 4LFBL 2ZM6Q 1G51A 4IPDA 2A69D 4RGMA 3JAML 4OO1G 3J80c 1TXYA 5EJWA 1Z6HA 1SJHD 3EBEA 2NVYH 2IW3A 3P20A 2IT1A 2JEBI 1VQOA 1PA6A 5I6WA 1M1KC 3TREA 4JPBW 4KLKA 1E2WA 2XWJB 3D6WA 3TEHB 4KKSA 4RCNA 4V0BA 1GUWA 1X6OA 1RHPA 5C3EG 4IOCA 4L5SA 4RCOA 3HOZG 4C3IH 3HOVH 1XTCD 2ZTEA 3AB9A 1B4OA 3KOJA 4HIKA 1XPUA 3TN2A 3GP7A 3PSIA 4P74A 2VUMB 1LO5D 5C44G 4NB3A 4IUQA 1HZAA 4A93G 1Q3LA 2I5LX 5C5LA 4C3IG 1R9TB 3HOZH 4K0KQ 1GVPA 1QOHA 2WKCA 4X66Q 1HRJA 1MGSA 4H13C 3GTPB 3QWNA 1H95A 1AEXA 1FVIA 1PTOD 1I4PA 5JPMC 1EWCA 2K1BA 2L15A 3I4OA 1Q1EA 1X65A 2EVBA 4XDXA 4XT1B 3BYYB 3I8ZA 1Q7YC 3DWAA 4H0LC 4OO1H 3NPPA 3H3VH 2NVYB 3SK5A 3ERQA 4PZ7A 2R7ZH 3PO3B 3I70A 4LUZA 2F0QA 4AYBG 1BCPD 2AWNA 2OEOA 5LHY1 4FF4A 2B39A 1X32A 2KCNA 3GTOB 5FLMH 1C9OA 2F0FA 4AQYQ 5E7NA 4A3MG 1WCMG 3J80i 1KLGD 3RLNA 3S2DH 1HXYD 1I6HB 4C3HG 4DA2A 1YITA 1MJEA 2LFNA 1UEAB 1O78A 5A2QE 1K8AC 2WAQB 1CKMA 1JJCB 1PH7A 1YBYA 4NXNQ 5D65A 4A3DG 1QWYA 2H4OA 2K33A 5I2YA 4DV0L 2EDGA 2K52A 2RDGA 3CCMA 3A5UA 1R4PB 1GUTA 2XVSA 2O2LD 4WJ4A 3B6YA 4MHEA 5C6AA 3J7AV 3L0OA 2R7ZB 4C2MH 3K5OA 4R4CA 3U4ZA 4A3FH 2UUCQ 5T1GA 4A3EG 1K8GA 1BDOA 1KIXA 2SOBA 1NMFA 4LF7Q 1B44D 4JV5L 3LWUA 3J81i 4KKUA 4MTKA 3CRLC 1AE2A 5IP7G 2R93G 1PXUA 2FJ2A 2IWHA 5C0XG 5C4JB 1Z7TA 4M8AA 3OMGA 3LGJA 3S2DB 2ES2A 1A3TA 2A68D 3HKZE 3K81C 3K0XA 2WKDA 2WB1B 4IFDI 4QUCA 1TS4A 5HGQA 3TZUA 2HCIA 1RTNA 5DM73 3MHBA 3QO2A 3W1GA 2JA6G 3RZOH 3K59A 4GKKL 3K80C 2B2VA 3S1MH 2Q8IB 1GKHA 1PFNA 2UXDL 3M4YA 4BY1G 3I4LA 1F9PA 3GTGB 2DNCA 3F2UA 4TQUS 1DXMA 2F52A 4B3TQ 2L5TA 2P5ZX 1I94Q 2Q2UA 1YIJA 4Y7NB 3OSOA 4Y52H 1PTOC 5IYBG 4IFDJ 1X3QA 4NDXA 1PZJD 2AHOB 5AJ3L 5IT9E 4JK1C 3MTSA 3SEBA 2B63B 1WOCA 3KDFA 3GO5A 4HAEA 4DR4L 3KDFB 2B2TA 3NBHA 4GNXA 3FVQA 1H9SA 1SE2A 1RD9D 5K5PA 4LF8Q 3QR8A 4CKBA 3OTOQ 4DF7A 2A5HA 4P2CB 3S1NB 1UE6A 1V1PA 4C3JH 1OXUA 4O1NA 1EWIA 3KUPA 1LTGD 4J8QA 3RZOB 4IURA 3VDYA 3CCUA 1XMOQ 1N36Q 4AYBE 3FRPB 5AFWA 1AZPA 3GTGH 2SDFA 2LS01 1O7ZA 3O13A 4KHVA 3F2BA 4B08A 4EGVA 2E5LQ 4KY6A 2EYPA 1LTRD 1K83H 3P1HA 1CKNB 1TY2A 3H0GH 1CQFA 1AP0A 3MXNB 4A3CH 1HNWL 2NVXB 4PMCA 4JI7Q 1PHJA 1SMYD 2PW5A 5EKLA 2PI2E 2HQLA 5ELOA 4JI5L 1PYBA 3NBIA 3T51B 1JORA 5LL6S 2N49A 3PUXA 3M4OH 4R9WA 1U0LA 1JE5A 3AFPA 2UUAL 1QUQB 4BA1I 4C3JB 1J5EL 1TS2A 1EIHA 2E2JB 2NVTB 1BQQT 2EY2A 2KVMA 1IKMA 1SYCA 3GD7A 4KY7A 1L1OB 1FL0A 2PI2A 5CV8A 2Y0SB 2QDBA 2AQ2B 3I3CA 1HNZQ 2RCFA 4X3TA 2E2DC 3HOYB 4JI3L 4CJ2C 1MSHA 2CH4W 3TRZA 2PQEA 3GV6A 1EFWA 1SNPA 1B2TA 2WB1E 1F2MA 4A3CG 3ONAB 2XWBB 2Q8TA 3H0GG 5FO8B 1K83B 3D4RA 1M8AA 2KEDA 2EYLA 1K3RA 5EGTA 4DAPA 2NVXH 2V1CC 4K2KA 3HOYG 3K5MA 4P72A 5HGTA 2B2YC 3DM1A 2VY3A 1E3PA 5C0XI 2UU9Q 1SYEA 2Y0SG 1N32Q 4JG2A 1VQDA 1JOQA 2MO0A 5I2XA 3S16B 1MHWC 3JC66 4NXML 4G7ZC 4GS3A 2E2JH 4C3JG 1UAPA 3STBD 5D3IB 1OO9B 1YHQA 4LFCQ 1YHBA 1D5MC 2KENA 3NHHA 3NTKA 4R4OA 4ABNA 4L5RC 3ULLA 3LX0A 2GA4B 1SXTA 2EPBA 3D6CA 4UHVA 3RNUA 3KLSX 4RWSC 5LMUL 1LABA 1JWSD 2K01A 5GQOA 4NKLA 2ICEC 4FNFA 5C5MA 2IX0A 3MEHA 4IUNA 2Z0SA 5A2QL 1V1QA 5J1ZA 3S15H 1SYFA 3L9AX 1PFMA 1TWGB 2HT1A 2CVRA 4K6LA 4RH6A 3G7LA 1N34L 4BY1H 4OX9L 3CMAA 1EQQA 1CFMA 3CKIB 1A6XA 4L63B 1EY8A 2JA6H 5LMNL 4GKJL 2EZVA 2FFKB 2K75A 5EAYA 1PH9A 4OWWB 2KCTA 1FJGQ 1KXLA 1EY0A 4DR6L 1MKHA 2NVQB 3KBGA 4CDEC 1IW7D 1IBKL 1VQFA 3T1YL 2EY5A 2KHIA 5CV5A 1EYGA 4DNRB 2VZAA 4ZLTF 2N78A 4RMFA 1BR9A 2F0MA 4R4IA 3UDIA 5BN3A 1BF4A 4O0AA 4DV4L 3HZXA 4LFAL 2PYKA 4A3IH 1PH5A 1QVGA 5IIFA 4DR1L 1D1IA 1SNOA 2JEAI 4A3EH 5T1IA 4A3FG 2EYMA 1QNUA 4Q0FA 1C7YA 3KF6A 4BY1B 4RG1A 4OGQC 1EIGA 1TS3A 4X65Q 3SR1A 1W2BA 1MBYA 2DY7A 2UXBQ 1Y8PB 2JA6B 4JI2Q 2DJFC 4CHTB 1FNWA 4DV3Q 1ONLA 5BR8L 1Z47A 3S9WA 2WB1G 3I56A 5FK9C 5J3BA 2SEBD 4A3DH 1PTOF 2UXCQ 1AH9A 3Q22A 3VA5A 1ENFA 2NVQH 4JCVE 2AQ1B 2PQAA 5M3FH 1WI5A 1MSGA 5IGEA 4LW1A 2D2CC 4TSSA 2HHHQ 3CXCA 2H1EA 1JJGA 4A3MH 1YZ6A 4GN4B 1OXXK 2R93B 1VQNA 1UUPA 3BVGA 1OTCA 1NBWA 1HCZA 4GOPA
chains in the Genus database with same CATH topology
1B9NA 2K6AA 1Y1VB 3WDNA 5LL6X 3SK6A 1EYDA 4ULLA 3R2IA 2FMMA 1E2ZA 3A8KE 1NUCA 1CHQD 1PRTB 2NUCA 1EWHA 5EBCA 2OT2A 4A3DB 5FO7B 2XRSD 2MGSA 3V05A 5C4HA 3EROA 3SHLA 1QCBD 2WACA 1V43A 3FPPA 2K28A 3VYSA 3AU7A 5IGGA 4DU9A 1C4QA 1BCPC 5C3XA 5KNCA 4WFN3 3HOXB 4C56C 5M5YB 3I73A 2O5JC 3A54A 1M4VA 4K5XA 4AYBB 5COYA 5CBAE 1DONA 1G6ZA 3NTHA 3DEPA 4IZ8A 2ZXRA 1AN8A 1JICA 5D3DA 4KK7A 1K8MA 3H94A 5KYIA 2C9OA 1U9RA 1A2TA 1JB3A 3PUWA 5CORA 3URYA 4C3IB 4A93B 5KRUA 3TZDA 4J6HA 3J7AF 3IKJA 5ELCA 3HOZB 1FR3A 2CW0C 3EFXD 5C3EB 1B9MA 1Y8NB 1VCIA 1K8OA 1H9JA 1JC7A 4XQNA 3IAYA 5ELFA 3D4WA 3R93A 1ILPA 2XN9C 1G2TA 2HDLA 3GTLB 2F0KA 5JEAJ 1ENAA 1HA6A 5A35A 1WD1A 3D4DA 1FNUA 2JE6I 2F0WA 2B2WA 1T5EA 1J9OA 2PW7A 3I72A 5KYLA 4BWGB 4FF2A 2VB3X 5I4DA 4ZAIA 3OPOA 4ZYSA 4QMGA 1GUOA 3MXNA 2F0IA 4HCEA 4DN4M 1U4LA 2JA7B 1ICWA 2EY1A 3L7ZC 4R8IA 1MD2D 3S1RB 4FF1A 1ILQA 2A74C 4C2MB 4DXGA 1W6KA 4HEDA 4LAAA 1TS5A 4DK1A 5JAVA 2I07B 4XXEA 2D5DA 4XIGS 3Q23A 2E74C 3D8GA 2PZWA 1Q90A 1XXGA 5FKAC 1LT5D 4XQQA 4RGOS 1KDAA 4HTHA 4IFDG 4LMQD 1EOTA 3K6OA 3E0JA 3LWEA 1KAAA 3HP3A 3R8BA 2QKIC 1EQVA 3K5LA 2MJ8A 5M9OA 1D5XC 4QIWB 3TMEA 1VMCA 4K5VA 4I65A 5JEAG 2E2HB 1EYCA 2DN8A 2OF1A 3CQZB 5CV6A 1SYBA 2EOTA 2G9HD 2K32A 2X69A 4S3SA 1FD7D 1R4QB 4X3UA 1IKLA 1T5XD 2YU9B 1LTAD 1GJXA 4ME5A 3GTKB 1L0XB 5EKIA 4FF3A 3A8JE 2HQEA 5BN5A 2EY6A 4YIJA 4A3BB 4C1NK 1QE6A 4UAIA 5JVG3 4DGZA 1F2LA 4F7XA 1GUNA 4FVMA 3BS1A 2KEEA 1A3VA 3PUZA 1O7YA 4BS9A 1SE3A 3OMCA 3T53B 1STNA 3ITPA 3SDZA 2B2WC 2ICIA 4OO1I 3NXWA 2EJFC 1IYVA 1EEID 3QIAA 1ZYRD 1SSOA 5EQ0A 3OWEB 2K05A 3MWYW 2M00A 5EPLA 3GTMB 2EYHA 1RKNA 2RSNA 3RD4A 5KEEA 3K0YA 1F77A 1TWAB 2A6HC 2AQ3B 3KK7A 1EU3A 4K14A 3KLRA 1EFID 3QJYA 5CR3A 5ELBA 4HMIA 3DWQA 4KD3A 1EY6A 2X6GA 3TBIB 2M9VA 2E76C 4HSPA 2ENBA 4DK0A 4OIKA 5CC4A 5DM63 2XSCA 1WD0A 2B8GA 3MXPA 2L12A 4MIUA 4WORA 4DFAA 3HS0C 1SNDA 1GXDC 1TIID 3A7AB 3OOCA 4BBRB 1ZXTA 2JP1A 4Z9CB 5CMDA 1WTVA 1QJOA 1GUSA 3J80L 1WTPA 4QCLA 3G6JB 4QF4A 1TR5A 2O4XA 1HA5A 4PV1C 3C1FA 2F0OA 2K5WA 2R92B 1FNVA 4ZUIA 1NR2A 4KD4A 3S15B 4KJOA 2WP8J 3T16A 3VA7A 2LKVA 2K03A 3BDLA 4QB4A 3VR4A 4ILWA 1TWFB 1SJED 2NN6H 1PZID 3KLSA 3X3NA 2FHTA 4XYQA 2F0LA 4H7BA 5I9OA 3TSSA 1D6EC 1L0YB 1VF7A 2D62A 1PLFA 2SNSA 2ZXPA 3DEOA 2B2UC 2PZUA 4FXKC 5I6YA 1F9RA 5ELDA 5J39A 4DXFA 2AUKA 1CA6A 2OXPA 4FXDA 1LV9A 1EY4A 1NR4A 1S4ZA 3I90A 2JA5B 3DWPA 1NSNS 1EL0A 3OIPA 3SXHA 2RVLA 1IL8A 1GHJA 3PMFA 4A3IB 1J8IA 1KNEA 1G2SA 3GV3A 3M3YB 2RA4A 1ET9A 4J1MA 1Y8OB 4NW2A 2B2YA 5EKKA 5JPNC 1LTBD 3VYRA 4RHRA 3VR5A 5M3FB 1JR0D 3TP8A 3R2TA 4NP5A 5C0XJ 3EVQA 3NE5B 4HSVA 4QUFA 3H3VC 1XYIA 1KNAA 1TT2A 1B53A 3T56B 4G4KA 3MZ5A 1SEBD 3SE0A 1D1KA 3C2PA 3Q24A 1LTID 3E6ZX 4XT3B 1WTRA 4BBSB 4ZK9B 4UDUC 4IN3A 3FMCA 4Q5VA 1HTLD 1V1OA 3WOEA 1YNNC 3SVMA 3DUZA 3MC0B 2Z4HA 3CU7A 1ZEQX 5IGFA 3MAQA 2J4XA 2JYOA 3VR3A 3HOUB 2BE5C 2MPMA 4IALA 3S1QB 2XRQD 2EJMA 2A73B 2X6LA 2KHSA 3IFTA 1YNJC 4WJWA 2WIIB 1IHZA 1H9RA 2C5CA 1ESFA 1HFNA 4CJ0B 1B1ZA 2EE1A 4F8MA 4ZKCB 4OIJA 1I50B 3FKIB 3E5SA 3MFYA 2BDNA 2QILA 3M7GA 1LACA 2LY7A 5ISRA 3S17B 1SBBB 3BG3A 1S5CD 3MA2B 3S14B 4DNTB 1CZGA 4KKTA 1TQOA 3X3MA 3MXUA 3J81L 3OWFA 2B2TC 4PMBA 3U9SA 5C4XB 1WTOA 2F0JA 1RODA 1C8CA 2FINB 1LT4D 5C4ZA 3VYUA 4L6TB 4K6DA 1WVLA 3TP7A 5KGUA 4GZYC 3RZDB 3ZYYX 2F0TA 2N88A 3ND8A 4I7ZC 4DAYA 4KI0A 1STHA 1DCZA 4IUTA 1TWCB 1II3A 1I6VC 2IX3A 3CRKC 3BVMA 3OW7A 1EU4A 1B3AA 2NYZD 3SK8A 4N9TA 1RTOA 4G7HC 1O7LA 3HG9A 4IUVA 1XWEA 5FLXE 2DNEA 2PNRC 1PTOH 3GTJB 5EPJA 1ZKOA 3K57A 1I4GA 1V1PB 1DOKA 3Q0AA 2VNUD 2BCOA 1U4PA 2A69C 4A3GB 1Q1BA 5K36H 1SNMA 3R3OA 2KUMA 3PUVA 2A6EC 1CQVA 3H91A 1BOSA 2EXZA 3HKZB 1I4HA 1EY9A 3N6RA 2QF7A 5KIXA 4KMUC 4E6IA 3NQIA 3W3AA 1H9KA 4NMZA 1ESRA 1TVXA 2R61A 2SNMA 3C3LA 1PTOB 3QB3A 4KTAA 1CZWA 2BOSA 4KJNA 4B9XA 2QEJC 2CHBD 1HPCA 3DMUA 3P75A 3A7LA 1I4RA 1S5FD 1H9SB 2R6GA 5CV7A 4XQJA 2HCCA 5FO9B 5E3FA 3MXGA 2EYFA 3A8IE 4DAVA 2ZXOA 3C1EA 5M3MB 5HURA 1JWMD 2TMPA 1KLUD 3DXJC 3PUYA 5K36G 3PIP3 1VMPA 5JEAH 1YNND 3NUCA 2B2UA 1PYWD 1HFGA 2F1MA 2WINB 5D14A 3MFGA 2L11A 2PO4A 4IQZA 2NN6I 4IFDH 2K04A 1TU2B 1JQYD 4FO2A 2A6ED 4K2LA 4LJZC 4ODGA 2PCFB 3BDCA 3P7JA 1D5ZC 1G291 1TKWB 1FYCA 3D31A 2K5DA 1BCPF 4BA2I 1NCVA 4TKOB 3HRZC 3GQBA 2F3VA 3CHBD 1WTXA 3FPUB 1IYUA 4FYDA 1I4XA 2NTSA 1S5DD 5JOBA 3TP5A 1H9MA 1VF5C 2JSOA 2HDMA 1KTKA 2F03A 4RGNA 2E75C 3EA6A 4PQXA 2NBFA 3NQTA 2NB0A 5G3LD 2AUJD 3I91A 4K8JA 3M85A 1ZYRC 1X3PA 1PRTC 4K8IA 2G9DA 1PDQA 2KECA 3BVZA 1DJRD 5DAUA 3NWTA 4RAUC 1HHVA 1O80A 1S5ED 4B9WA 3VR6A 2VB2X 1DD2A 5CV9A 3S2HB 5DEHA 5M5WB 3RMHA 3HOVB 3L3OC 4HCSA 5CYUA 1I3QB 4X3SA 3QOJA 2VXWA 5CV4A 2R3ZA 3K58A 5TSSA 3TP6A 2NTTA 4KY5A 3U9OA 1JWUD 1PZKD 1GOZA 2EYOA 2KJXA 2Z8LA 1QNKA 1CI3M 4EVOA 4BY7B 3BYTB 1RDPD 3SK4A 3I4NB 2F0EA 2F0NA 1HTPA 1JOOA 4CJ1B 3QG1A 1QILA 2L0CA 1DOMA 1LTSD 4PMWA 3Q6SA 3V96A 2RSOA 1UNSA 2KQ3A 1CT1D 4U673 4ID6A 2K5QA 2F0PA 2A6HD 4M1UB 3A56A 3EQLC 2L4NA 1PRTF 2BA1A 4K5WA 2TSSA 3J7YW 1GHKA 3PIO3 2BE5D 1CK1A 2I46A 2IPKD 1ENCA 2JXMB 2MP1A 2J7ZA 3NK9A 4A3FB 1DZ1A 1QG7A 3KBXA 3N52A 4EQNA 1BNZA 3GTQB 2RQXA 3DHQA 5JJZA 4RFBA 2ID0A 1JE4A 4H44C 5E4WC 1U4RA 4ZQ3A 2D9UA 2E2IB 1F2ZA 5M5XB 1DM0B 1I4QA 2ZT9C 1AFPA 3NSWA 3OIQA 4RA8A 4CKEA 3S1MB 2NN6G 3H09A 1BCPB 2A68C 3WOFA 3NTIA 2WV6D 2RDHA 2RBMA 4ZUJA 2BDOA 4KHZA 1NAPA 1BXTA 2Q8RE 4KN4C 1CHPD 3T13A 2NZ1D 1A3UA 1WTQA 2RDFA 3D3RA 4L8JA 2YYZA 2F0SA 4RKLA 3BZDB 1OXVA 2IL8A 1U4MA 4FP5D 1EZ8A 2O5IC 4A3KB 1SFOB 5EBDA 2XIWA 2F0UA 4KV6A 3T4AC 1AW7A 5F2DA 1STYA 1E0BA 3UI2A 2N55A 1BO0A 3M7NA 1EYAA 2F0GA 5CBEE 1SAPA 1STBA 2IX1A 1BBXC 1GUGA 5G3LF 4EQOA 4V190 3QOLA 3H0GB 2JA8B 2L1BA 2XNAC 5KNBA 2PMZB 2NWGA 4XYOA 4EQPA 5IODA 1SDFA 5IOCA 2EJGC 5IT9L 1SNCA 2QCPX 5E4XA 3M4OB 1B50A 5FOBB 1QB5D 3OHXC 4F88A 1PFBA 1RCVD 1RJTA 3EJIA 3VYTA 4C1NI 5ELEA 1EY7A 3NWSA 4KN7C 2FMCA 5C3WA 1HQMC 4JBWA 5DNFA 1S5BD 3VR2A 4N9PA 1LT6D 1SMYC 2KCCA 4LK1C 1Q8IA 5IGBA 4A3JB 1G91A 1LTTD 3K7AB 5NUCA 1BUVT 3FDTA 4XTCS 4RHSA 1AZQA 2L55A 1A15A 1XX8A 3C46A 1LT3D 1DOLA 1E2VA 3RLFA 1C48A 4HMJA 5I9PA 1RF2D 1YNJD 3A55A 4IUUA 3KF8A 1JCKB 5IGDA 2CW0D 3HOWB 1HQRD 1Q12A 2F3WA 1HUNA 4ZRZA 3J81E 3AMUA 1VDZA 1TWHB 3ND9A 4HN7A 1G8ZD 1MI2A 1SE4A 5BN4A 2F0HA 3PO2B 1ML0D 3MVVA 1DYQA 4TRDA 3RUZA 2K7VA 2F0VA 3BDOA 3K5NA 5EPKA 5J22A 1TY0A 1ET6A 4FXGC 1OXTA 1KABA 3J80E 1F9SA 4IUPA 4CGYB 1EEFD 2B2VC 4OL7A 1A2UA 3FEWX 2BA0A 1EQTA 2KA7A 3V2TA 1FGBD 3HGBA 5FLXL 1Y69U 1V8QA 1CTMA 2F0DA 1CA5A 3PV0A 3IFDA 4O42A 2HUGA 5KNDA 4A3EB 4R8NA 2LMCB 3NP8A 1SYDA 2CQAA 3HEJA 4F87A 1KDBA 1KDCA 4RGTA 5E1FA 2DY8A 2F4IA 2L9HA 2MUYA 4C3HB 1PMRA 2IJ0A 1SYGA 1WCMB 4CKCA 4A3MB 5C0XH 3I4MB 4G7OC 2KOLA 5CGKA 2MHVA 2Z1CA 1SNQA 4MN3A 4ZKBB 2AWOA 5IGCA 3W2DA 4U68A 3TDQA 2Z4IA 1F9QA 1LLRD 1STEA 4G57A 4HR7B 3H6MA 4PNYA 1OXSC 1D2BA 2M2LA 3IL8A 1F2YA 1STGA 3JAME 2B8FA 2V4DA 2PPBC 1STAA 2EYJA 4WRDA 1PRTD 1JOKA 4OHJA 5JVH3 4X3KA 1CM9A 1IW7C 1W6JA 5C44B 1WTWA 1Y1WB 3LNNA 2RKSA 2J0TD 4RKBA 2PZTA 1EZ6A 1HUMA 4CBVA 1EY5A 2A69D 4RGMA 3JAML 4OO1G 5EJWA 1Z6HA 1SJHD 2IW3A 3P20A 2IT1A 2JEBI 5I6WA 1E2WA 2XWJB 3D6WA 4KKSA 4RCNA 4V0BA 1GUWA 1RHPA 4RCOA 1XTCD 3AB9A 1B4OA 3TN2A 3GP7A 2VUMB 1LO5D 4IUQA 1Q3LA 5C5LA 4C3IG 1R9TB 1QOHA 2WKCA 1HRJA 1MGSA 4H13C 3GTPB 3QWNA 1AEXA 1PTOD 1I4PA 5JPMC 1EWCA 2K1BA 1Q1EA 2EVBA 4XDXA 4XT1B 3BYYB 3I8ZA 3DWAA 4H0LC 4OO1H 3NPPA 2NVYB 3SK5A 3ERQA 3PO3B 3I70A 2F0QA 1BCPD 2AWNA 2OEOA 5LHY1 4FF4A 2B39A 1X32A 2KCNA 3GTOB 2F0FA 1KLGD 1HXYD 1I6HB 4C3HG 4DA2A 2LFNA 1UEAB 1O78A 5A2QE 2WAQB 5D65A 1QWYA 2H4OA 2K33A 5I2YA 2EDGA 2RDGA 1R4PB 1GUTA 2XVSA 2O2LD 4MHEA 5C6AA 3J7AV 2R7ZB 3K5OA 5T1GA 1BDOA 2SOBA 1B44D 3LWUA 4KKUA 3CRLC 1PXUA 2FJ2A 2IWHA 5C0XG 5C4JB 1Z7TA 4M8AA 3OMGA 3S2DB 1A3TA 2A68D 2WKDA 2WB1B 4IFDI 4QUCA 1TS4A 3TZUA 2HCIA 1RTNA 5DM73 3MHBA 3QO2A 3K59A 2B2VA 2Q8IB 1PFNA 3M4YA 3I4LA 1F9PA 3GTGB 2DNCA 3F2UA 4TQUS 1DXMA 2L5TA 4Y7NB 3OSOA 1PTOC 4IFDJ 1X3QA 4NDXA 1PZJD 5IT9E 4JK1C 3MTSA 3SEBA 2B63B 3GO5A 4HAEA 2B2TA 3NBHA 3FVQA 1H9SA 1SE2A 1RD9D 5K5PA 4CKBA 4DF7A 2A5HA 4P2CB 3S1NB 1V1PA 1OXUA 4O1NA 3KUPA 1LTGD 4J8QA 3RZOB 4IURA 3FRPB 5AFWA 1AZPA 2SDFA 2LS01 1O7ZA 3O13A 4KHVA 4B08A 4EGVA 4KY6A 2EYPA 1LTRD 3P1HA 1TY2A 1CQFA 1AP0A 2NVXB 4PMCA 1SMYD 2PW5A 5EKLA 3NBIA 3T51B 1JORA 5LL6S 3PUXA 4R9WA 4BA1I 4C3JB 1TS2A 1EIHA 2E2JB 2NVTB 1BQQT 2EY2A 2KVMA 1IKMA 1SYCA 3GD7A 4KY7A 5CV8A 2Y0SB 2QDBA 2AQ2B 3I3CA 4X3TA 3HOYB 2E2DC 4CJ2C 1MSHA 2PQEA 3GV6A 1SNPA 1B2TA 1F2MA 3ONAB 2XWBB 2Q8TA 5FO8B 1K83B 3D4RA 1M8AA 2KEDA 2EYLA 5EGTA 4DAPA 4K2KA 3K5MA 5HGTA 2B2YC 3DM1A 5C0XI 1SYEA 1JOQA 5I2XA 3S16B 4G7ZC 4C3JG 1UAPA 5D3IB 1OO9B 1D5MC 3NHHA 3NTKA 4ABNA 3LX0A 2GA4B 1SXTA 2EPBA 3D6CA 3KLSX 4RWSC 1LABA 1JWSD 2K01A 4NKLA 2ICEC 4FNFA 5C5MA 2IX0A 3MEHA 4IUNA 5A2QL 5J1ZA 1SYFA 3L9AX 1PFMA 1TWGB 2CVRA 4K6LA 4RH6A 3G7LA 1CFMA 3CKIB 1A6XA 4L63B 1EY8A 2EZVA 2FFKB 1EY0A 2NVQB 3KBGA 1IW7D 2EY5A 5CV5A 4DNRB 4ZLTF 1BR9A 2F0MA 1BF4A 5BN3A 3HZXA 2PYKA 5IIFA 1D1IA 1SNOA 2JEAI 5T1IA 2EYMA 1QNUA 4Q0FA 4BY1B 4OGQC 1EIGA 1TS3A 3SR1A 1MBYA 2DY7A 1Y8PB 2JA6B 4CHTB 1FNWA 1ONLA 1Z47A 3S9WA 5FK9C 2SEBD 1PTOF 3Q22A 3VA5A 1ENFA 2AQ1B 1MSGA 5IGEA 2D2CC 4TSSA 2H1EA 1OXXK 2R93B 1UUPA 3BVGA 1HCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SDF A;  1O7Z A;  5DNF A;  1G2T A;  2HDL A;  2X6G A;  4MHE A;  1J8I A;  1KNE A;  1G2S A;  2EOT A;  3GV3 A;  1QNK A;  4OIK A;  2RA4 A;  1CA5 A;  2KUM A;  3IFD A;  3P7J A;  1WD0 A;  1PFM A;  4O42 A;  2HUG A;  2X69 A;  5T1G A;  1HA6 A;  2FMM A;  2CVR A;  1G91 A;  1NAP A;  3H91 A;  5EJW A;  1AP0 A;  3FDT A;  1WD1 A;  2L12 A;  4NW2 A;  2B2Y A;  2Q8R E;  3G7L A;  1AZQ A;  4X3U A;  4CJ1 B;  1IKL A;  1A15 A;  1NCV A;  4RA8 A;  2B2T C;  1XX8 A;  2B2W A;  2NZ1 D;  2FJ2 A;  1J9O A;  3D6W A;  1DOM A;  5EKI A;  1DOL A;  1WTQ A;  4X3S A;  1WTX A;  2FFK B;  3Q6S A;  1ZXT A;  2JP1 A;  3FPU B;  1GUW A;  1RHP A;  1ESR A;  1TVX A;  2RSO A;  1WTO A;  2MGS A;  5CMD A;  4R9W A;  1WTV A;  1EQT A;  1ROD A;  4ZAI A;  1C8C A;  2FIN B;  1B4O A;  1WTP A;  2K28 A;  4IUU A;  2IL8 A;  3TN2 A;  1EIH A;  1QE6 A;  1U4M A;  2DY8 A;  2HDM A;  2KVM A;  4HSV A;  4IUQ A;  4UAI A;  1IKM A;  1AZP A;  4QUC A;  1F2L A;  1Q3L A;  4QUF A;  5CBA E;  2L9H A;  5D65 A;  2L4N A;  4DN4 M;  1XYI A;  2HCI A;  1KNA A;  1U4L A;  1RTN A;  2XIW A;  3I3C A;  1B53 A;  1WVL A;  1MGS A;  1HRJ A;  3QO2 A;  1ICW A;  4ZLT F;  2KEE A;  1HUN A;  2B2V A;  3I91 A;  4X3T A;  1E0B A;  1O7Y A;  1DON A;  4XT3 B;  2N55 A;  2K1B A;  1PFN A;  1BO0 A;  1MSH A;  2KOL A;  5COY A;  3UI2 A;  2N88 A;  1X3P A;  3GV6 A;  4CJ2 C;  1ILQ A;  4ZK9 B;  2B2W C;  1NR2 A;  1B2T A;  1G6Z A;  3ONA B;  3DEP A;  1F9P A;  4IUT A;  2HCC A;  4MN3 A;  1PDQ A;  4HED A;  4ZKB B;  2Q8T A;  5CBE E;  1SAP A;  4XDX A;  1WTR A;  4XT1 B;  1MI2 A;  2KEC A;  3F2U A;  3I8Z A;  1JIC A;  5T1I A;  2MP1 A;  4U68 A;  2K03 A;  1M8A A;  2KED A;  1F9Q A;  2J7Z A;  1BBX C;  2JYO A;  1SSO A;  5EQ0 A;  2MPM A;  1B3A A;  2NYZ D;  1DZ1 A;  1EIG A;  1ML0 D;  1QG7 A;  3KBX A;  4RAU C;  1X3Q A;  3N52 A;  1HHV A;  2K05 A;  1BNZ A;  2DY7 A;  1O80 A;  1RTO A;  2B2Y C;  3MWY W;  2FHT A;  5COR A;  2L1B A;  2X6L A;  3DM1 A;  1VMP A;  5EPL A;  3MTS A;  2NWG A;  1X32 A;  4IUV A;  1PLF A;  2M2L A;  4HAE A;  1SDF A;  3DEO A;  2B2T A;  2B2U C;  3IL8 A;  5JJZ A;  5EPK A;  2B2U A;  1HFG A;  1F9R A;  3TZD A;  4LMQ D;  1JE4 A;  1EOT A;  5E4X A;  2RSN A;  1HFN A;  4CJ0 B;  2EE1 A;  4ZKC B;  3SVM A;  3LWE A;  5D14 A;  5E4W C;  1U4R A;  4OIJ A;  2L11 A;  1CA6 A;  1B50 A;  5EPJ A;  1MSG A;  3HP3 A;  4HCS A;  4X3K A;  1CM9 A;  2BDN A;  2D9U A;  1LV9 A;  1F9S A;  1NR4 A;  2MJ8 A;  1DOK A;  1S4Z A;  2H1E A;  2VXW A;  3I90 A;  3KUP A;  4IUP A;  1PFB A;  2K04 A;  1WTW A;  1BF4 A;  4IUR A;  2EPB A;  2R3Z A;  2B2V C;  1VMC A;  1U4P A;  1EL0 A;  1RJT A;  3R93 A;  1HUM A;  4R8I A;  5AFW A;  4RWS C;  1ILP A;  2K01 A;  2RVL A;  1IL8 A; 
#chains in the Genus database with same CATH topology
 1VQ7 A;  1B9N A;  2K6A A;  1Y1V B;  3WDN A;  2R7Z G;  1A0I A;  5LL6 X;  3SK6 A;  3RN2 A;  1EYD A;  4ULL A;  3R2I A;  3DLL A;  4B3S L;  2FMM A;  4R4Q A;  4JOI A;  1E2Z A;  3A8K E;  1NUC A;  1CHQ D;  1PRT B;  2NUC A;  3UDF A;  3NEL A;  1EWH A;  5EBC A;  2OT2 A;  1VQ9 A;  4A3D B;  1PH4 A;  5FO7 B;  1EOV A;  2XRS D;  2MGS A;  3V05 A;  5C4H A;  2WAQ G;  3ERO A;  3SHL A;  1QCB D;  2WAC A;  1V43 A;  3PCO B;  4JI6 Q;  4A93 H;  3FPP A;  2K28 A;  3A5Z B;  5C44 H;  1GO3 E;  3CME A;  3VYS A;  3AU7 A;  2AKW B;  5IGG A;  4DU9 A;  3HOV G;  1C4Q A;  3ULP A;  1BCP C;  4LF6 L;  1NE3 A;  5C3X A;  5C3E H;  2WAQ E;  5KNC A;  5ELN A;  4WFN 3;  3U50 C;  4DPG A;  3HOX B;  4C56 C;  5M5Y B;  3I73 A;  2O5J C;  3A54 A;  1M4V A;  4K5X A;  4AYB B;  2IY5 B;  5COY A;  5CBA E;  1DON A;  1G6Z A;  3NTH A;  3PO3 G;  4YWM A;  3DEP A;  1K73 C;  4IZ8 A;  2BH2 A;  2ZXR A;  1AN8 A;  2Z9H A;  1A62 A;  1JIC A;  5D3D A;  4KK7 A;  1K8M A;  3H94 A;  5KYI A;  1QZG A;  2CWA A;  2C9O A;  4GOP C;  1U9R A;  1A2T A;  1JB3 A;  2A19 A;  3PUW A;  5COR A;  4DV1 L;  1IBM L;  2Q2I A;  3URY A;  4C3I B;  1VQ8 A;  3CF5 A;  4A93 B;  5KRU A;  3TZD A;  2VUM H;  5C4X H;  1Q8K A;  4J6H A;  3J7A F;  3ICE A;  3IKJ A;  5ELC A;  3HOZ B;  1FR3 A;  2CW0 C;  3EFX D;  5C3E B;  1B9M A;  1Y8N B;  1A63 A;  1VCI A;  3HOX H;  3BZK A;  5FJ8 G;  1K8O A;  1H9J A;  1JC7 A;  4XQN A;  1GM5 A;  3IAY A;  5ELF A;  3D4W A;  2I5M X;  4IJH A;  3R93 A;  1ILP A;  2JA7 H;  2XN9 C;  1T9H A;  2OQ0 A;  1G2T A;  2HDL A;  4HJ8 A;  3GTL B;  2F0K A;  5JEA J;  1Q46 A;  1ENA A;  1HA6 A;  5A35 A;  1WD1 A;  3D4D A;  3M4P A;  1FNU A;  3GTO H;  2JE6 I;  2F0W A;  2B2W A;  1T5E A;  4A4I A;  1Y1W G;  3F2C A;  1J9O A;  2PW7 A;  3I72 A;  1WJJ A;  2HIX A;  5KYL A;  3CW2 C;  4LF9 L;  1I6H H;  4OWX B;  3A74 A;  4BWG B;  4FF2 A;  4IPC A;  2AMC B;  2VB3 X;  3SGI A;  5I4D A;  4ZAI A;  3OPO A;  4JC0 A;  4ZYS A;  4QMG A;  1GUO A;  3MXN A;  1C0A A;  2F0I A;  2CKZ B;  4B3S Q;  1LYL A;  4HCE A;  5IWA Q;  2KBN A;  5FLX c;  4MNO A;  4DN4 M;  1U4L A;  2QDL A;  2JA7 B;  1ICW A;  2EY1 A;  3L7Z C;  4YY3 Q;  4R8I A;  1MD2 D;  1HZC A;  3S1R B;  3GTL H;  4FF1 A;  1ILQ A;  2A74 C;  1U5K A;  1VQE A;  1X54 A;  4C2M B;  4DXG A;  1EQR A;  1W6K A;  4HED A;  4LAA A;  3CQZ H;  1TS5 A;  1VQC A;  2HHH L;  4DK1 A;  5JAV A;  2I07 B;  4XXE A;  2D5D A;  5M3M G;  4XIG S;  3Q23 A;  3I4M G;  2EQS A;  2E74 C;  3D8G A;  2PZW A;  1YI2 A;  1Q90 A;  1XXG A;  5FKA C;  1GD7 A;  3K8A A;  4O2D A;  1VQI A;  4JW0 A;  1Q81 C;  1LT5 D;  5BR8 Q;  3PF5 A;  4XQQ A;  2RCN A;  4DV3 L;  2R7D A;  4RGO S;  1KDA A;  4HTH A;  4IFD G;  2UXB L;  4LMQ D;  1EOT A;  3K6O A;  3E0J A;  3LWE A;  1KAA A;  4DV5 Q;  3HP3 A;  3R8B A;  2QKI C;  4A3B H;  1EQV A;  3K5L A;  2MJ8 A;  5M9O A;  1D5X C;  4QIW B;  3TME A;  4LFA Q;  3JAM i;  1E1O A;  1VMC A;  1VS0 A;  4K5V A;  3S1R H;  4HJ5 A;  4I65 A;  5JEA G;  4QL5 A;  2E2H B;  1EYC A;  3PF4 A;  1VQH A;  2DN8 A;  2OF1 A;  3TS2 A;  2JJQ A;  1Q86 C;  3CQZ B;  5CV6 A;  1SYB A;  1JB7 A;  4P75 A;  2EOT A;  4DV5 L;  3HKZ G;  2G9H D;  3T1Y Q;  3H15 A;  2K32 A;  3BU2 A;  2X69 A;  3AYH B;  4S3S A;  4DR6 Q;  1L1O C;  4JBK A;  1FJG L;  3E9I A;  1FD7 D;  1R4Q B;  4X3U A;  4EQ5 A;  1IKL A;  2B63 H;  1T5X D;  2YU9 B;  2CCZ A;  1LTA D;  4A75 A;  1GJX A;  4ME5 A;  3GTK B;  1L0X B;  5EKI A;  1J6Q A;  4FF3 A;  3A8J E;  4A3G G;  3GTM H;  2HQE A;  5BN5 A;  5JJI A;  3S1N H;  2EY6 A;  4YIJ A;  4A3B B;  4C1N K;  1QE6 A;  2A8V A;  3KF8 B;  4UAI A;  4QGU A;  5JVG 3;  4DGZ A;  1F2L A;  4F7X A;  4YY3 L;  1GUN A;  5HY6 A;  4FVM A;  3BS1 A;  2KEE A;  1A3V A;  3PUZ A;  3PIO A;  1O7Y A;  2Y0S E;  1SE3 A;  3OMC A;  4LWC A;  3T53 B;  4BS9 A;  4A3L H;  1STN A;  3ITP A;  3SDZ A;  1ASY A;  2B2W C;  3PO2 G;  5IWA L;  2ICI A;  1VQG A;  1CKO A;  3FP9 A;  2GN5 A;  2YTV A;  4OO1 I;  2JN4 A;  2QGQ A;  1D7Q A;  3NXW A;  1VQA A;  2EJF C;  1IYV A;  1EEI D;  3QIA A;  1ZYR D;  1SSO A;  5EQ0 A;  5IYD H;  3OWE B;  4LF9 Q;  2K05 A;  1L0W A;  3MWY W;  2M00 A;  5EPL A;  4NPS A;  3GTM B;  1N9W A;  4JBJ A;  3HOW G;  2UU9 L;  2EYH A;  1RKN A;  4BBR H;  2K4K A;  2K14 A;  2RSN A;  3RD4 A;  5KEE A;  3CCE A;  3S24 A;  3K0Y A;  1F77 A;  1TWA B;  5IYC G;  2A6H C;  2AQ3 B;  1PH3 A;  3KK7 A;  1EU3 A;  1VQL A;  4K14 A;  3KLR A;  1EFI D;  1XJV A;  3QJY A;  5CR3 A;  5ELB A;  4HMI A;  2IHF A;  3DWQ A;  5GRO A;  4MTN A;  4KD3 A;  3M9B A;  1EY6 A;  4A3J G;  5GAE C;  2X6G A;  2M9V A;  3TBI B;  2E76 C;  4HSP A;  2ENB A;  5IP9 G;  4DK0 A;  4OIK A;  5CC4 A;  4TVA B;  5DM6 3;  4AIM A;  2XSC A;  1ASZ A;  1WD0 A;  2B8G A;  3MXP A;  2L12 A;  2UUA Q;  1VQ4 A;  4MIU A;  4WOR A;  4DFA A;  1O7I A;  3HS0 C;  1SND A;  4DV1 Q;  1K0R A;  1IBM Q;  1GXD C;  1TII D;  3CAM A;  3A7A B;  3OOC A;  4DNI A;  4BBR B;  1ZXT A;  2JP1 A;  4Z9C B;  5CMD A;  1WTV A;  1QJO A;  1HNW Q;  1GUS A;  3J80 L;  1TWA H;  1WTP A;  4QCL A;  3G4S A;  3S2H H;  3FKI G;  2PMZ E;  3G6J B;  4QF4 A;  4PZ8 A;  4UY8 C;  2ZJP A;  2YTX A;  1TR5 A;  2O4X A;  1HA5 A;  4PV1 C;  3C1F A;  2F0O A;  2K5W A;  4DAM A;  2R92 B;  1QZH A;  2JA8 G;  1UWV A;  1FNV A;  1N36 L;  1XMO L;  4ZUI A;  4LF6 Q;  1NR2 A;  4KD4 A;  3S15 B;  1S40 A;  4KJO A;  2WP8 J;  1TWG H;  3T16 A;  3VA7 A;  2LKV A;  2K03 A;  2KCM A;  4JI6 L;  2E8G A;  3M3Y H;  3CPF A;  3HOU G;  4UP8 A;  1ICF B;  3BDL A;  4QB4 A;  4BY7 H;  3VR4 A;  4ILW A;  4YCU A;  1VQB A;  1TWF B;  1SJE D;  3OTO L;  3I4N H;  2NN6 H;  4LF8 L;  1PZI D;  3KLS A;  3X3N A;  2FHT A;  4XYQ A;  2F0L A;  4H7B A;  3TSS A;  3HKS A;  5I9O A;  1D6E C;  4DR4 Q;  4OWT B;  1L0Y B;  1VF7 A;  4A3K G;  2D62 A;  1PLF A;  3J81 c;  4BBS G;  2SNS A;  2ZXP A;  3DEO A;  5AJ3 Q;  2B2U C;  2QA4 A;  2PZU A;  5JJL A;  4FXK C;  1JT8 A;  5I6Y A;  1F9R A;  3CC2 A;  5ELD A;  5J39 A;  4DXF A;  1CSQ A;  1HH2 P;  4OEL B;  2AUK A;  1CA6 A;  2N3S A;  3CCS A;  3PIP A;  2OXP A;  1P16 A;  1QUQ A;  4FXD A;  4JOI C;  4UPA A;  1LV9 A;  1YHA A;  1EY4 A;  1NR4 A;  2R92 H;  1S4Z A;  3I90 A;  2JA5 B;  2OQK A;  3DWP A;  1NSN S;  2UXD Q;  1EL0 A;  3OIP A;  3SXH A;  4BXX H;  2RVL A;  4GKK Q;  1IL8 A;  1GHJ A;  3PMF A;  4A3I B;  3EIV A;  1J8I A;  1KNE A;  1G2S A;  3GV3 A;  1UEB A;  2VW9 A;  2RA4 A;  3M3Y B;  1ET9 A;  3E3X A;  4J1M A;  1TWF H;  1M90 C;  5GAD C;  4JVZ A;  1Y8O B;  2UXC L;  2LSS A;  4NW2 A;  2B2Y A;  5EKK A;  5JPN C;  1LTB D;  2IHE A;  3VYR A;  3S1Q H;  4RHR A;  3Q8D A;  4JI2 L;  4X65 L;  1X55 A;  4HJ7 A;  3VR5 A;  1K9M C;  2ZTC A;  5M3F B;  2ASB A;  1JR0 D;  2JA5 G;  3TP8 A;  4JV5 Q;  3R2T A;  2MFI A;  4NP5 A;  5C0X J;  4WJ3 M;  3EVQ A;  3JAM c;  4DR1 Q;  3NE5 B;  4HSV A;  3HFZ B;  3PQI A;  1JMC A;  4GOP B;  4QUF A;  4DV4 Q;  3H3V C;  1XYI A;  1KNA A;  1TT2 A;  4UP7 A;  1B53 A;  3T56 B;  4G4K A;  3MZ5 A;  1EIF A;  1SEB D;  5M5X H;  4GNX C;  3SE0 A;  4DV0 Q;  1D1K A;  3ZJY C;  3C2P A;  3Q24 A;  1LTI D;  3E6Z X;  1BKB A;  4XT3 B;  1WTR A;  4BBS B;  1PH8 A;  4ZK9 B;  4UDU C;  1Y1V H;  4IN3 A;  3FMC A;  4Q5V A;  1HTL D;  1V1O A;  3ER0 A;  3UDX A;  3WOE A;  1YNN C;  1IBK Q;  3SVM A;  3DUZ A;  3MC0 B;  4NXN L;  2Z4H A;  3CU7 A;  1ZEQ X;  5IGF A;  3MAQ A;  2J4X A;  2JYO A;  1NY4 A;  4YWL A;  3VR3 A;  3S14 H;  2BE5 C;  3HOU B;  2MPM A;  4IAL A;  3S1Q B;  2XRQ D;  5LMN Q;  4GKJ Q;  1IYJ B;  2EJM A;  2A73 B;  4AQY L;  2X6L A;  1B70 B;  2KHS A;  3IFT A;  1YNJ C;  3ULJ A;  4WJW A;  2WII B;  4L5Q A;  1N34 Q;  4OX9 Q;  1IHZ A;  1H9R A;  2R92 G;  2C5C A;  4DAY B;  1ESF A;  1HFN A;  4CJ0 B;  2N8N A;  1B1Z A;  2EE1 A;  4N8X 1;  4DK6 C;  4F8M A;  1B7Y B;  4ZKC B;  3CC7 A;  4OIJ A;  1I50 B;  1VQK A;  3FKI B;  3E5S A;  3MFY A;  2BDN A;  2B29 A;  2QIL A;  3M7G A;  1IXR A;  5LMU Q;  5JJK A;  4A3K H;  1LAC A;  3D0F A;  2LY7 A;  5ISR A;  3S17 B;  1SBB B;  3RZD H;  3I4N G;  2B3G A;  4X66 L;  4LFC L;  3I55 A;  3BG3 A;  3M4Q A;  4BY7 G;  4HJ9 A;  1S5C D;  3MA2 B;  3S14 B;  4DNT B;  1CZG A;  3CD6 A;  1UE5 A;  4KKT A;  3NEN A;  3MEF A;  1TQO A;  1YEZ A;  4NXM Q;  3X3M A;  3MXU A;  3KF6 B;  2BH8 A;  3J81 L;  1N32 L;  2OTJ A;  3OWF A;  2B2T C;  4PMB A;  3CP0 A;  3U9S A;  5C4X B;  4CDC C;  3KLW A;  1WTO A;  2MNA A;  2F0J A;  1ROD A;  3G48 A;  1C8C A;  2FIN B;  1PFS A;  1I50 H;  1LT4 D;  4H02 A;  5C4Z A;  2R7F A;  4X6A H;  3VYU A;  4L6T B;  1S3O A;  4EX5 A;  4POG A;  4YWK A;  1Q82 C;  4JI3 Q;  2ZM6 L;  4P73 A;  4K6D A;  4LFB Q;  3RN5 A;  1WVL A;  4B3M Q;  3TP7 A;  1HNZ L;  5KGU A;  4GZY C;  3RZD B;  1K3B C;  3ZYY X;  2F0T A;  2N88 A;  3ND8 A;  4I7Z C;  4DAY A;  4KI0 A;  1KRS A;  1STH A;  1SLJ A;  1DCZ A;  1X3G A;  4IUT A;  1TWC B;  1II3 A;  1I6V C;  2IX3 A;  1E7Z A;  1J5E Q;  3CRK C;  1IZ6 A;  3BVM A;  2I0Q A;  3OW7 A;  4P71 A;  1EU4 A;  1B3A A;  2NYZ D;  3SK8 A;  5IP9 H;  2Z6K C;  2ZJQ A;  4N9T A;  4JI5 Q;  1RTO A;  3CPW A;  3CCJ A;  4G7H C;  2UUB Q;  4LF5 L;  1AE3 A;  1O7L A;  3WWV A;  3HG9 A;  4IUV A;  4JI7 L;  1XWE A;  5FLX E;  2DNE A;  4DUY L;  1HR0 L;  4OEM B;  1QVF A;  4X62 L;  2PNR C;  2NZH A;  5IYC H;  4L5T A;  1PTO H;  2ATW A;  3GTJ B;  5EPJ A;  2E5L L;  1ZKO A;  3K57 A;  4GLV B;  1I4G A;  1V1P B;  1DOK A;  3Q0A A;  2H5X A;  2VNU D;  2JQO A;  2BCO A;  1U4P A;  2A69 C;  4A3G B;  4YHH L;  1Q1B A;  1I5F A;  5K36 H;  1SNM A;  1TWC H;  2Z6B A;  3R3O A;  1YJW A;  1SR3 A;  1CUK A;  1P8L A;  5IYD G;  2KUM A;  3PUV A;  1NNX A;  2A6E C;  1CQV A;  2DGY A;  3H91 A;  1PV4 A;  1BOS A;  1CKN A;  2EXZ A;  2K5H A;  3PO2 H;  3HKZ B;  1I4H A;  1EY9 A;  2CQO A;  3N6R A;  2Q2T A;  2QF7 A;  5KIX A;  4KMU C;  4E6I A;  4GLX A;  1XPR A;  5LMN W;  3NQI A;  4PG3 A;  3KFU A;  3W3A A;  1H9K A;  4NMZ A;  1ESR A;  1HZ9 A;  1TVX A;  1MJC A;  2R61 A;  2SNM A;  1IBL L;  3C3L A;  1PTO B;  1KAW A;  3CCQ A;  1K28 A;  4HIO A;  1I94 L;  3QB3 A;  1WYD A;  4KTA A;  4B3T L;  1CZW A;  2BOS A;  1KD1 C;  4KJN A;  4B9X A;  2QEJ C;  2CHB D;  1HPC A;  2KHJ A;  3AQQ A;  4A3G H;  3DMU A;  2E2H H;  3P75 A;  3A7L A;  1SRU A;  1I4R A;  1S5F D;  1H9S B;  4I7A A;  2R6G A;  5CV7 A;  4XQJ A;  2HCC A;  1DGS A;  5FO9 B;  5E3F A;  1X56 A;  3MXG A;  4YCW A;  2EYF A;  3A8I E;  4DAV A;  4DUZ Q;  2ZXO A;  4OON A;  3C1E A;  5M3M B;  2RHS B;  1N33 L;  5HUR A;  3TQY A;  1JWM D;  2TMP A;  4OXP A;  1IL2 A;  1KLU D;  4N8F A;  2YU9 H;  4GLA C;  3DXJ C;  3GTK H;  3PUY A;  5K36 G;  3PIP 3;  1VMP A;  5JEA H;  1YNN D;  3NUC A;  4LF7 L;  2B2U A;  1PYW D;  3U4V A;  1HFG A;  2F1M A;  4DR7 L;  2UUC L;  3AEV A;  2WIN B;  5D14 A;  3MFG A;  2L11 A;  2MQH A;  2PO4 A;  4IQZ A;  4JI0 Q;  2NN6 I;  4IFD H;  2K04 A;  1TU2 B;  2MO1 A;  1JQY D;  4FO2 A;  4A76 A;  2A6E D;  4K2L A;  4LJZ C;  4ODG A;  2PCF B;  4JI8 L;  3BDC A;  3P7J A;  1D5Z C;  1G29 1;  1L1O A;  3L2P A;  1TKW B;  1W3S A;  4DKA C;  1NJI C;  1FYC A;  3D31 A;  2JK8 A;  2K5D A;  1BCP F;  2RF4 A;  2G5D A;  2CWP A;  4BA2 I;  3F1Z A;  1SRO A;  1NCV A;  5DLQ E;  4TKO B;  3HRZ C;  3GQB A;  2F3V A;  3CHB D;  1WTX A;  3FPU B;  1IYU A;  4FYD A;  3F2D A;  2CH4 A;  1I4X A;  2NTS A;  1S5D D;  5JOB A;  4IOA A;  3TP5 A;  1H9M A;  1VF5 C;  2JSO A;  2HDM A;  1KTK A;  5M5W H;  2F03 A;  4RGN A;  2E75 C;  3EA6 A;  1NTG A;  4PQX A;  3CCV A;  2NBF A;  4J15 A;  3NQT A;  2NB0 A;  5G3L D;  2AUJ D;  3I91 A;  3G71 A;  4K8J A;  3M85 A;  1ZYR C;  1X3P A;  4K0K L;  1PRT C;  1VQJ A;  4K8I A;  2G9D A;  1PDQ A;  3IRB A;  2KEC A;  3KJP A;  1S72 A;  3BVZ A;  1DJR D;  5DAU A;  3NWT A;  4RAU C;  4JBM A;  1HHV A;  1O80 A;  1S5E D;  4B9W A;  4QJF A;  1RL2 A;  3VR6 A;  2VB2 X;  1HR0 W;  4APV A;  1DD2 A;  4LF4 L;  3KYH C;  3UDG A;  5CV9 A;  3HOX G;  4LUV A;  3S2H B;  5DEH A;  1X3F A;  5M5W B;  1BBW A;  3RMH A;  3HOV B;  3CCR A;  3L3O C;  4HCS A;  2QEX A;  5C4X G;  5CYU A;  1PH6 A;  1JJ2 A;  1I3Q B;  4X3S A;  3QOJ A;  2VXW A;  5CV4 A;  2YV5 A;  1HNX Q;  1X3E A;  2R3Z A;  3K58 A;  5IY0 A;  5TSS A;  2NTT A;  1LM0 A;  4KY5 A;  3TP6 A;  3U9O A;  2DUD A;  3GTP H;  1JWU D;  1PZK D;  4LUO A;  1GOZ A;  2EYO A;  2KJX A;  2Z8L A;  2VQE L;  1QNK A;  1CI3 M;  4EVO A;  4BY7 B;  3BYT B;  1RDP D;  3SK4 A;  3EN2 A;  3I4N B;  1VQM A;  3T1H L;  2F0E A;  2F0N A;  2EIF A;  2VQF L;  1XNR L;  1HTP A;  1JOO A;  4CJ1 B;  3PO3 H;  5IE8 A;  4R4T A;  1Y1V G;  1LTL A;  2F4V L;  3QG1 A;  2OTL A;  1QIL A;  5H1S E;  3RLO A;  2L0C A;  1DOM A;  3AFQ A;  1LTS D;  4JI4 Q;  4PMW A;  1K0S A;  3Q6S A;  3V96 A;  2RSO A;  4CDD C;  1G6P A;  1UNS A;  2KQ3 A;  1CT1 D;  3I2Z A;  3J7Z C;  4U67 3;  1SN8 A;  4ID6 A;  1KQS A;  4YCV A;  2K5Q A;  1I3Q H;  4AH6 A;  2F0P A;  2A6H D;  2JA5 H;  1D8L A;  3A56 A;  4M1U B;  1FGU A;  3EQL C;  1Z9F A;  2L4N A;  1PRT F;  2BA1 A;  4K5W A;  2CFM A;  1BVS A;  2TSS A;  3J7Y W;  4X64 Q;  1GHK A;  3PIO 3;  2BE5 D;  1CK1 A;  1L2F A;  3W1B A;  2I46 A;  2IPK D;  4QQB X;  2DJG C;  4B3R L;  1ENC A;  2JXM B;  4HID A;  2MP1 A;  2J7Z A;  4JI1 L;  4DV6 Q;  3NK9 A;  4A3F B;  1DZ1 A;  1QG7 A;  3KBX A;  3N52 A;  4EQN A;  1BNZ A;  3GTQ B;  2RQX A;  4BXX G;  4DV2 Q;  3DHQ A;  4DV2 L;  5JJZ A;  5IT9 c;  4RFB A;  5C4J H;  2ID0 A;  3J7A 5;  1JE4 A;  4H44 C;  2WFW A;  5E4W C;  1U4R A;  5M3F G;  4ZQ3 A;  2D9U A;  1B3Q A;  3J81 j;  2E2I B;  4DR2 L;  1F2Z A;  4DV7 L;  5M5X B;  1DM0 B;  1I4Q A;  2ZT9 C;  1AFP A;  4BBS H;  1PVO A;  3NSW A;  3OIQ A;  3KJO A;  4ALP A;  1XPO A;  1SFO H;  3BZC A;  1KHI A;  3G6E A;  1NMG A;  4RA8 A;  4CKE A;  1MIU A;  4X64 L;  1B8A A;  3S1M B;  2NN6 G;  2XGT A;  3H09 A;  5GAH C;  1BCP B;  2A68 C;  3WOF A;  1KL9 A;  3NTI A;  2WV6 D;  2A1A A;  2RDH A;  3HOU H;  2RBM A;  4ZUJ A;  4DR3 Q;  2BDO A;  3BJU A;  4KHZ A;  3UE1 A;  2EXD A;  1NAP A;  3GTQ H;  4JYA Q;  1BXT A;  4A3I G;  2Q8R E;  4KN4 C;  1CHP D;  4Y7N H;  3T13 A;  1YNX A;  2XTI A;  2NZ1 D;  4JI4 L;  2JA8 H;  1A3U A;  1WTQ A;  2RDF A;  3D3R A;  4L8J A;  4MZ9 A;  3TS0 A;  2F4V Q;  2YYZ A;  1EIY B;  2F0S A;  1RIP A;  4R1J A;  4RKL A;  3BZD B;  3FKI H;  4DR5 L;  1OXV A;  3T1H Q;  2IL8 A;  2E2I H;  1U4M A;  3H3V I;  4PZ6 A;  4FP5 D;  1EZ8 A;  2O5I C;  2ZTD A;  4KHP L;  1UE7 A;  4A3K B;  1XTD A;  5EBD A;  1SFO B;  2XIW A;  2F0U A;  3STB C;  4KV6 A;  1SE8 A;  3T4A C;  1AW7 A;  5F2D A;  1PH2 A;  4QY7 A;  1STY A;  3S17 H;  1E0B A;  3UI2 A;  2N55 A;  1BO0 A;  2GVB A;  3M7N A;  4HIM A;  1XNQ Q;  1EYA A;  4QIW E;  2F0G A;  5CBE E;  1SAP A;  1STB A;  2PNH A;  2IX1 A;  1BBX C;  1QVC A;  1PYS B;  1GUG A;  2Q2H A;  5G3L F;  4EQO A;  4A3J H;  4V19 0;  3QOL A;  1YVC A;  3H0G B;  2JA8 B;  1VQP A;  2L1B A;  1VQ5 A;  2XNA C;  5KNB A;  1Y14 B;  2PMZ B;  2NWG A;  4XYO A;  4LF4 Q;  4EQP A;  1CSP A;  5IOD A;  1SDF A;  5IOC A;  2EJG C;  5IT9 L;  1SNC A;  2QCP X;  2QW7 A;  5E4X A;  3M4O B;  1B50 A;  5FOB B;  1VQ6 A;  1QB5 D;  2NVT H;  3OHX C;  4F88 A;  4BBR G;  5GAG C;  1PFB A;  1XMQ Q;  1RCV D;  2C35 B;  3W5O A;  3HOW H;  1RJT A;  3EJI A;  3VYT A;  1HZB A;  4C1N I;  1XMQ L;  5ELE A;  1EY7 A;  3NWS A;  4KN7 C;  2FMC A;  5C3W A;  3HOY H;  3ERS X;  1HQM C;  4JBW A;  5DNF A;  4ZCK A;  1S5B D;  3VR2 A;  4N9P A;  3OW2 A;  1LT6 D;  1SMY C;  2KCC A;  4LK1 C;  1Q8I A;  1TWH H;  3CC4 A;  2YTY A;  5IGB A;  4A3J B;  2FXQ A;  1G91 A;  1LTT D;  3K7A B;  5NUC A;  1BUV T;  3FDT A;  4XTC S;  3U58 A;  1LUZ A;  4RHS A;  1AZQ A;  2L55 A;  2NZO A;  1A15 A;  4A3L G;  1XX8 A;  2HD3 A;  3I7F A;  3C46 A;  1LT3 D;  1DOL A;  1E2V A;  1X9N A;  3RLF A;  1C48 A;  4HMJ A;  3E0E A;  5I9P A;  1RF2 D;  1YNJ D;  3GTJ H;  3S16 H;  3NEM A;  2D0O A;  3A55 A;  4IUU A;  3KF8 A;  4UP9 A;  1JCK B;  5IGD A;  2CW0 D;  1XNQ L;  4JI8 Q;  3HOW B;  1HQR D;  1Q12 A;  2F3W A;  4LNQ A;  4GN5 A;  1HUN A;  4ZRZ A;  3J81 E;  3AMU A;  2B63 G;  4KHP Q;  1VDZ A;  1TWH B;  2OCE A;  3ND9 A;  4HN7 A;  1G8Z D;  1MI2 A;  3K7A H;  1SE4 A;  4DR5 Q;  4JI0 L;  5BN4 A;  2F0H A;  2ZJR A;  2D0P A;  3PO2 B;  3DM3 A;  4DR7 Q;  1ML0 D;  3FHW A;  4ME3 A;  3MVV A;  4IJL A;  1WFQ A;  1DYQ A;  4TRD A;  3RUZ A;  2K7V A;  2F0V A;  1SMX A;  3BDO A;  3K5N A;  5EPK A;  4JYA L;  4POF A;  5J22 A;  4A3B G;  4DR3 L;  3F8T A;  1TY0 A;  1ET6 A;  4FXG C;  1OXT A;  1N33 Q;  1KAB A;  3J80 E;  4DUZ L;  1F9S A;  4IUP A;  4CGY B;  1EEF D;  2B2V C;  4OL7 A;  1A2U A;  3RR5 A;  1BBU A;  3FEW X;  2BA0 A;  2I5H A;  1EQT A;  2KA7 A;  1KC8 C;  3V2T A;  4DV7 Q;  1FGB D;  4DR2 Q;  3HGB A;  5IYB H;  1E22 A;  3I4M H;  2JA9 A;  5FLX L;  5M3M H;  1Y69 U;  1V8Q A;  1CTM A;  2F0D A;  3PV0 A;  1CA5 A;  3IFD A;  1YJN A;  2K5N A;  4O42 A;  2HUG A;  5KND A;  4A3E B;  3PGZ A;  4R8N A;  4IO9 A;  4HJA A;  1N8R C;  2LMC B;  4GN3 B;  3NP8 A;  1SYD A;  4IPG A;  1IBL Q;  2CQA A;  4DK3 C;  1KRT A;  3HEJ A;  4F87 A;  1KDB A;  1KDC A;  4DV6 L;  3A0J A;  4JI1 Q;  3UE0 A;  4RGT A;  1E24 A;  5E1F A;  2DY8 A;  4B3R Q;  4CDF C;  2F4I A;  2L9H A;  2MUY A;  4C3H B;  2PQA B;  1PMR A;  2IJ0 A;  2OWO A;  1SYG A;  1WCM B;  2K5V A;  4CKC A;  4A3M B;  5C0X H;  1Y1W H;  1A8V A;  1EUJ A;  1WTH A;  4YHH Q;  2HIV A;  3I4M B;  2KOL A;  4G7O C;  5CGK A;  2R93 H;  2MHV A;  5IP7 H;  2Z1C A;  2VS1 A;  1SNQ A;  4MN3 A;  4ZKB B;  2AWO A;  5IGC A;  2RHQ B;  3W2D A;  4U68 A;  3K7U C;  3TDQ A;  2ALY B;  1F9Q A;  1LLR D;  2Z4I A;  4FDB A;  2K50 A;  1STE A;  4G57 A;  1E1T A;  1YJ9 A;  4X62 Q;  4HR7 B;  1HR0 Q;  3H6M A;  4PNY A;  1OXS C;  1V9P A;  4DUY Q;  2JA7 G;  1D2B A;  2M2L A;  4LF5 Q;  1XNR Q;  2VQF Q;  2UUB L;  3IL8 A;  1F2Y A;  1STG A;  5FJ8 H;  2LXJ A;  3JAM E;  2B8F A;  2V4D A;  1UE1 A;  2PPB C;  1STA A;  2EYJ A;  2LXK A;  3NBH B;  4GNX B;  4WRD A;  3E9H A;  1PRT D;  1JOK A;  2VL6 A;  4OHJ A;  5JVH 3;  2VQE Q;  4X3K A;  1HJP A;  2Z6K A;  1CM9 A;  1IW7 C;  1W6J A;  4C3H H;  5C44 B;  3CCL A;  2VUM G;  1PH1 A;  1WCM H;  2GVA A;  1WTW A;  1Y1W B;  3LNN A;  5FLM G;  1R9T H;  2RKS A;  2J0T D;  4RKB A;  2PZT A;  1EZ6 A;  1HUM A;  1HNX L;  3OYY A;  4CBV A;  1EY5 A;  5L37 A;  4IPH A;  2F3I A;  3GDE A;  5M5Y H;  4B3M L;  4LFB L;  2ZM6 Q;  1G51 A;  4IPD A;  2A69 D;  4RGM A;  3JAM L;  4OO1 G;  3J80 c;  1TXY A;  5EJW A;  1Z6H A;  1SJH D;  3EBE A;  2NVY H;  2IW3 A;  3P20 A;  2IT1 A;  2JEB I;  1VQO A;  1PA6 A;  5I6W A;  1M1K C;  3TRE A;  4JPB W;  4KLK A;  1E2W A;  2XWJ B;  3D6W A;  3TEH B;  4KKS A;  4RCN A;  4V0B A;  1GUW A;  1X6O A;  1RHP A;  5C3E G;  4IOC A;  4L5S A;  4RCO A;  3HOZ G;  4C3I H;  3HOV H;  1XTC D;  2ZTE A;  3AB9 A;  1B4O A;  3KOJ A;  4HIK A;  1XPU A;  3TN2 A;  3GP7 A;  3PSI A;  4P74 A;  2VUM B;  1LO5 D;  5C44 G;  4NB3 A;  4IUQ A;  1HZA A;  4A93 G;  1Q3L A;  2I5L X;  5C5L A;  4C3I G;  1R9T B;  3HOZ H;  4K0K Q;  1GVP A;  1QOH A;  2WKC A;  4X66 Q;  1HRJ A;  1MGS A;  4H13 C;  3GTP B;  3QWN A;  1H95 A;  1AEX A;  1FVI A;  1PTO D;  1I4P A;  5JPM C;  1EWC A;  2K1B A;  2L15 A;  3I4O A;  1Q1E A;  1X65 A;  2EVB A;  4XDX A;  4XT1 B;  3BYY B;  3I8Z A;  1Q7Y C;  3DWA A;  4H0L C;  4OO1 H;  3NPP A;  3H3V H;  2NVY B;  3SK5 A;  3ERQ A;  4PZ7 A;  2R7Z H;  3PO3 B;  3I70 A;  4LUZ A;  2F0Q A;  4AYB G;  1BCP D;  2AWN A;  2OEO A;  5LHY 1;  4FF4 A;  2B39 A;  1X32 A;  2KCN A;  3GTO B;  5FLM H;  1C9O A;  2F0F A;  4AQY Q;  5E7N A;  4A3M G;  1WCM G;  3J80 i;  1KLG D;  3RLN A;  3S2D H;  1HXY D;  1I6H B;  4C3H G;  4DA2 A;  1YIT A;  1MJE A;  2LFN A;  1UEA B;  1O78 A;  5A2Q E;  1K8A C;  2WAQ B;  1CKM A;  1JJC B;  1PH7 A;  1YBY A;  4NXN Q;  5D65 A;  4A3D G;  1QWY A;  2H4O A;  2K33 A;  5I2Y A;  4DV0 L;  2EDG A;  2K52 A;  2RDG A;  3CCM A;  3A5U A;  1R4P B;  1GUT A;  2XVS A;  2O2L D;  4WJ4 A;  3B6Y A;  4MHE A;  5C6A A;  3J7A V;  3L0O A;  2R7Z B;  4C2M H;  3K5O A;  4R4C A;  3U4Z A;  4A3F H;  2UUC Q;  5T1G A;  4A3E G;  1K8G A;  1BDO A;  1KIX A;  2SOB A;  1NMF A;  4LF7 Q;  1B44 D;  4JV5 L;  3LWU A;  3J81 i;  4KKU A;  4MTK A;  3CRL C;  1AE2 A;  5IP7 G;  2R93 G;  1PXU A;  2FJ2 A;  2IWH A;  5C0X G;  5C4J B;  1Z7T A;  4M8A A;  3OMG A;  3LGJ A;  3S2D B;  2ES2 A;  1A3T A;  2A68 D;  3HKZ E;  3K81 C;  3K0X A;  2WKD A;  2WB1 B;  4IFD I;  4QUC A;  1TS4 A;  5HGQ A;  3TZU A;  2HCI A;  1RTN A;  5DM7 3;  3MHB A;  3QO2 A;  3W1G A;  2JA6 G;  3RZO H;  3K59 A;  4GKK L;  3K80 C;  2B2V A;  3S1M H;  2Q8I B;  1GKH A;  1PFN A;  2UXD L;  3M4Y A;  4BY1 G;  3I4L A;  1F9P A;  3GTG B;  2DNC A;  3F2U A;  4TQU S;  1DXM A;  2F52 A;  4B3T Q;  2L5T A;  2P5Z X;  1I94 Q;  2Q2U A;  1YIJ A;  4Y7N B;  3OSO A;  4Y52 H;  1PTO C;  5IYB G;  4IFD J;  1X3Q A;  4NDX A;  1PZJ D;  2AHO B;  5AJ3 L;  5IT9 E;  4JK1 C;  3MTS A;  3SEB A;  2B63 B;  1WOC A;  3KDF A;  3GO5 A;  4HAE A;  4DR4 L;  3KDF B;  2B2T A;  3NBH A;  4GNX A;  3FVQ A;  1H9S A;  1SE2 A;  1RD9 D;  5K5P A;  4LF8 Q;  3QR8 A;  4CKB A;  3OTO Q;  4DF7 A;  2A5H A;  4P2C B;  3S1N B;  1UE6 A;  1V1P A;  4C3J H;  1OXU A;  4O1N A;  1EWI A;  3KUP A;  1LTG D;  4J8Q A;  3RZO B;  4IUR A;  3VDY A;  3CCU A;  1XMO Q;  1N36 Q;  4AYB E;  3FRP B;  5AFW A;  1AZP A;  3GTG H;  2SDF A;  2LS0 1;  1O7Z A;  3O13 A;  4KHV A;  3F2B A;  4B08 A;  4EGV A;  2E5L Q;  4KY6 A;  2EYP A;  1LTR D;  1K83 H;  3P1H A;  1CKN B;  1TY2 A;  3H0G H;  1CQF A;  1AP0 A;  3MXN B;  4A3C H;  1HNW L;  2NVX B;  4PMC A;  4JI7 Q;  1PHJ A;  1SMY D;  2PW5 A;  5EKL A;  2PI2 E;  2HQL A;  5ELO A;  4JI5 L;  1PYB A;  3NBI A;  3T51 B;  1JOR A;  5LL6 S;  2N49 A;  3PUX A;  3M4O H;  4R9W A;  1U0L A;  1JE5 A;  3AFP A;  2UUA L;  1QUQ B;  4BA1 I;  4C3J B;  1J5E L;  1TS2 A;  1EIH A;  2E2J B;  2NVT B;  1BQQ T;  2EY2 A;  2KVM A;  1IKM A;  1SYC A;  3GD7 A;  4KY7 A;  1L1O B;  1FL0 A;  2PI2 A;  5CV8 A;  2Y0S B;  2QDB A;  2AQ2 B;  3I3C A;  1HNZ Q;  2RCF A;  4X3T A;  2E2D C;  3HOY B;  4JI3 L;  4CJ2 C;  1MSH A;  2CH4 W;  3TRZ A;  2PQE A;  3GV6 A;  1EFW A;  1SNP A;  1B2T A;  2WB1 E;  1F2M A;  4A3C G;  3ONA B;  2XWB B;  2Q8T A;  3H0G G;  5FO8 B;  1K83 B;  3D4R A;  1M8A A;  2KED A;  2EYL A;  1K3R A;  5EGT A;  4DAP A;  2NVX H;  2V1C C;  4K2K A;  3HOY G;  3K5M A;  4P72 A;  5HGT A;  2B2Y C;  3DM1 A;  2VY3 A;  1E3P A;  5C0X I;  2UU9 Q;  1SYE A;  2Y0S G;  1N32 Q;  4JG2 A;  1VQD A;  1JOQ A;  2MO0 A;  5I2X A;  3S16 B;  1MHW C;  3JC6 6;  4NXM L;  4G7Z C;  4GS3 A;  2E2J H;  4C3J G;  1UAP A;  3STB D;  5D3I B;  1OO9 B;  1YHQ A;  4LFC Q;  1YHB A;  1D5M C;  2KEN A;  3NHH A;  3NTK A;  4R4O A;  4ABN A;  4L5R C;  3ULL A;  3LX0 A;  2GA4 B;  1SXT A;  2EPB A;  3D6C A;  4UHV A;  3RNU A;  3KLS X;  4RWS C;  5LMU L;  1LAB A;  1JWS D;  2K01 A;  5GQO A;  4NKL A;  2ICE C;  4FNF A;  5C5M A;  2IX0 A;  3MEH A;  4IUN A;  2Z0S A;  5A2Q L;  1V1Q A;  5J1Z A;  3S15 H;  1SYF A;  3L9A X;  1PFM A;  1TWG B;  2HT1 A;  2CVR A;  4K6L A;  4RH6 A;  3G7L A;  1N34 L;  4BY1 H;  4OX9 L;  3CMA A;  1EQQ A;  1CFM A;  3CKI B;  1A6X A;  4L63 B;  1EY8 A;  2JA6 H;  5LMN L;  4GKJ L;  2EZV A;  2FFK B;  2K75 A;  5EAY A;  1PH9 A;  4OWW B;  2KCT A;  1FJG Q;  1KXL A;  1EY0 A;  4DR6 L;  1MKH A;  2NVQ B;  3KBG A;  4CDE C;  1IW7 D;  1IBK L;  1VQF A;  3T1Y L;  2EY5 A;  2KHI A;  5CV5 A;  1EYG A;  4DNR B;  2VZA A;  4ZLT F;  2N78 A;  4RMF A;  1BR9 A;  2F0M A;  4R4I A;  3UDI A;  5BN3 A;  1BF4 A;  4O0A A;  4DV4 L;  3HZX A;  4LFA L;  2PYK A;  4A3I H;  1PH5 A;  1QVG A;  5IIF A;  4DR1 L;  1D1I A;  1SNO A;  2JEA I;  4A3E H;  5T1I A;  4A3F G;  2EYM A;  1QNU A;  4Q0F A;  1C7Y A;  3KF6 A;  4BY1 B;  4RG1 A;  4OGQ C;  1EIG A;  1TS3 A;  4X65 Q;  3SR1 A;  1W2B A;  1MBY A;  2DY7 A;  2UXB Q;  1Y8P B;  2JA6 B;  4JI2 Q;  2DJF C;  4CHT B;  1FNW A;  4DV3 Q;  1ONL A;  5BR8 L;  1Z47 A;  3S9W A;  2WB1 G;  3I56 A;  5FK9 C;  5J3B A;  2SEB D;  4A3D H;  1PTO F;  2UXC Q;  1AH9 A;  3Q22 A;  3VA5 A;  1ENF A;  2NVQ H;  4JCV E;  2AQ1 B;  2PQA A;  5M3F H;  1WI5 A;  1MSG A;  5IGE A;  4LW1 A;  2D2C C;  4TSS A;  2HHH Q;  3CXC A;  2H1E A;  1JJG A;  4A3M H;  1YZ6 A;  4GN4 B;  1OXX K;  2R93 B;  1VQN A;  1UUP A;  3BVG A;  1OTC A;  1NBW A;  1HCZ A;  4GOP A; 
#chains in the Genus database with same CATH homology
 1B9N A;  2K6A A;  1Y1V B;  3WDN A;  5LL6 X;  3SK6 A;  1EYD A;  4ULL A;  3R2I A;  2FMM A;  1E2Z A;  3A8K E;  1NUC A;  1CHQ D;  1PRT B;  2NUC A;  1EWH A;  5EBC A;  2OT2 A;  4A3D B;  5FO7 B;  2XRS D;  2MGS A;  3V05 A;  5C4H A;  3ERO A;  3SHL A;  1QCB D;  2WAC A;  1V43 A;  3FPP A;  2K28 A;  3VYS A;  3AU7 A;  5IGG A;  4DU9 A;  1C4Q A;  1BCP C;  5C3X A;  5KNC A;  4WFN 3;  3HOX B;  4C56 C;  5M5Y B;  3I73 A;  2O5J C;  3A54 A;  1M4V A;  4K5X A;  4AYB B;  5COY A;  5CBA E;  1DON A;  1G6Z A;  3NTH A;  3DEP A;  4IZ8 A;  2ZXR A;  1AN8 A;  1JIC A;  5D3D A;  4KK7 A;  1K8M A;  3H94 A;  5KYI A;  2C9O A;  1U9R A;  1A2T A;  1JB3 A;  3PUW A;  5COR A;  3URY A;  4C3I B;  4A93 B;  5KRU A;  3TZD A;  4J6H A;  3J7A F;  3IKJ A;  5ELC A;  3HOZ B;  1FR3 A;  2CW0 C;  3EFX D;  5C3E B;  1B9M A;  1Y8N B;  1VCI A;  1K8O A;  1H9J A;  1JC7 A;  4XQN A;  3IAY A;  5ELF A;  3D4W A;  3R93 A;  1ILP A;  2XN9 C;  1G2T A;  2HDL A;  3GTL B;  2F0K A;  5JEA J;  1ENA A;  1HA6 A;  5A35 A;  1WD1 A;  3D4D A;  1FNU A;  2JE6 I;  2F0W A;  2B2W A;  1T5E A;  1J9O A;  2PW7 A;  3I72 A;  5KYL A;  4BWG B;  4FF2 A;  2VB3 X;  5I4D A;  4ZAI A;  3OPO A;  4ZYS A;  4QMG A;  1GUO A;  3MXN A;  2F0I A;  4HCE A;  4DN4 M;  1U4L A;  2JA7 B;  1ICW A;  2EY1 A;  3L7Z C;  4R8I A;  1MD2 D;  3S1R B;  4FF1 A;  1ILQ A;  2A74 C;  4C2M B;  4DXG A;  1W6K A;  4HED A;  4LAA A;  1TS5 A;  4DK1 A;  5JAV A;  2I07 B;  4XXE A;  2D5D A;  4XIG S;  3Q23 A;  2E74 C;  3D8G A;  2PZW A;  1Q90 A;  1XXG A;  5FKA C;  1LT5 D;  4XQQ A;  4RGO S;  1KDA A;  4HTH A;  4IFD G;  4LMQ D;  1EOT A;  3K6O A;  3E0J A;  3LWE A;  1KAA A;  3HP3 A;  3R8B A;  2QKI C;  1EQV A;  3K5L A;  2MJ8 A;  5M9O A;  1D5X C;  4QIW B;  3TME A;  1VMC A;  4K5V A;  4I65 A;  5JEA G;  2E2H B;  1EYC A;  2DN8 A;  2OF1 A;  3CQZ B;  5CV6 A;  1SYB A;  2EOT A;  2G9H D;  2K32 A;  2X69 A;  4S3S A;  1FD7 D;  1R4Q B;  4X3U A;  1IKL A;  1T5X D;  2YU9 B;  1LTA D;  1GJX A;  4ME5 A;  3GTK B;  1L0X B;  5EKI A;  4FF3 A;  3A8J E;  2HQE A;  5BN5 A;  2EY6 A;  4YIJ A;  4A3B B;  4C1N K;  1QE6 A;  4UAI A;  5JVG 3;  4DGZ A;  1F2L A;  4F7X A;  1GUN A;  4FVM A;  3BS1 A;  2KEE A;  1A3V A;  3PUZ A;  1O7Y A;  4BS9 A;  1SE3 A;  3OMC A;  3T53 B;  1STN A;  3ITP A;  3SDZ A;  2B2W C;  2ICI A;  4OO1 I;  3NXW A;  2EJF C;  1IYV A;  1EEI D;  3QIA A;  1ZYR D;  1SSO A;  5EQ0 A;  3OWE B;  2K05 A;  3MWY W;  2M00 A;  5EPL A;  3GTM B;  2EYH A;  1RKN A;  2RSN A;  3RD4 A;  5KEE A;  3K0Y A;  1F77 A;  1TWA B;  2A6H C;  2AQ3 B;  3KK7 A;  1EU3 A;  4K14 A;  3KLR A;  1EFI D;  3QJY A;  5CR3 A;  5ELB A;  4HMI A;  3DWQ A;  4KD3 A;  1EY6 A;  2X6G A;  3TBI B;  2M9V A;  2E76 C;  4HSP A;  2ENB A;  4DK0 A;  4OIK A;  5CC4 A;  5DM6 3;  2XSC A;  1WD0 A;  2B8G A;  3MXP A;  2L12 A;  4MIU A;  4WOR A;  4DFA A;  3HS0 C;  1SND A;  1GXD C;  1TII D;  3A7A B;  3OOC A;  4BBR B;  1ZXT A;  2JP1 A;  4Z9C B;  5CMD A;  1WTV A;  1QJO A;  1GUS A;  3J80 L;  1WTP A;  4QCL A;  3G6J B;  4QF4 A;  1TR5 A;  2O4X A;  1HA5 A;  4PV1 C;  3C1F A;  2F0O A;  2K5W A;  2R92 B;  1FNV A;  4ZUI A;  1NR2 A;  4KD4 A;  3S15 B;  4KJO A;  2WP8 J;  3T16 A;  3VA7 A;  2LKV A;  2K03 A;  3BDL A;  4QB4 A;  3VR4 A;  4ILW A;  1TWF B;  1SJE D;  2NN6 H;  1PZI D;  3KLS A;  3X3N A;  2FHT A;  4XYQ A;  2F0L A;  4H7B A;  5I9O A;  3TSS A;  1D6E C;  1L0Y B;  1VF7 A;  2D62 A;  1PLF A;  2SNS A;  2ZXP A;  3DEO A;  2B2U C;  2PZU A;  4FXK C;  5I6Y A;  1F9R A;  5ELD A;  5J39 A;  4DXF A;  2AUK A;  1CA6 A;  2OXP A;  4FXD A;  1LV9 A;  1EY4 A;  1NR4 A;  1S4Z A;  3I90 A;  2JA5 B;  3DWP A;  1NSN S;  1EL0 A;  3OIP A;  3SXH A;  2RVL A;  1IL8 A;  1GHJ A;  3PMF A;  4A3I B;  1J8I A;  1KNE A;  1G2S A;  3GV3 A;  3M3Y B;  2RA4 A;  1ET9 A;  4J1M A;  1Y8O B;  4NW2 A;  2B2Y A;  5EKK A;  5JPN C;  1LTB D;  3VYR A;  4RHR A;  3VR5 A;  5M3F B;  1JR0 D;  3TP8 A;  3R2T A;  4NP5 A;  5C0X J;  3EVQ A;  3NE5 B;  4HSV A;  4QUF A;  3H3V C;  1XYI A;  1KNA A;  1TT2 A;  1B53 A;  3T56 B;  4G4K A;  3MZ5 A;  1SEB D;  3SE0 A;  1D1K A;  3C2P A;  3Q24 A;  1LTI D;  3E6Z X;  4XT3 B;  1WTR A;  4BBS B;  4ZK9 B;  4UDU C;  4IN3 A;  3FMC A;  4Q5V A;  1HTL D;  1V1O A;  3WOE A;  1YNN C;  3SVM A;  3DUZ A;  3MC0 B;  2Z4H A;  3CU7 A;  1ZEQ X;  5IGF A;  3MAQ A;  2J4X A;  2JYO A;  3VR3 A;  3HOU B;  2BE5 C;  2MPM A;  4IAL A;  3S1Q B;  2XRQ D;  2EJM A;  2A73 B;  2X6L A;  2KHS A;  3IFT A;  1YNJ C;  4WJW A;  2WII B;  1IHZ A;  1H9R A;  2C5C A;  1ESF A;  1HFN A;  4CJ0 B;  1B1Z A;  2EE1 A;  4F8M A;  4ZKC B;  4OIJ A;  1I50 B;  3FKI B;  3E5S A;  3MFY A;  2BDN A;  2QIL A;  3M7G A;  1LAC A;  2LY7 A;  5ISR A;  3S17 B;  1SBB B;  3BG3 A;  1S5C D;  3MA2 B;  3S14 B;  4DNT B;  1CZG A;  4KKT A;  1TQO A;  3X3M A;  3MXU A;  3J81 L;  3OWF A;  2B2T C;  4PMB A;  3U9S A;  5C4X B;  1WTO A;  2F0J A;  1ROD A;  1C8C A;  2FIN B;  1LT4 D;  5C4Z A;  3VYU A;  4L6T B;  4K6D A;  1WVL A;  3TP7 A;  5KGU A;  4GZY C;  3RZD B;  3ZYY X;  2F0T A;  2N88 A;  3ND8 A;  4I7Z C;  4DAY A;  4KI0 A;  1STH A;  1DCZ A;  4IUT A;  1TWC B;  1II3 A;  1I6V C;  2IX3 A;  3CRK C;  3BVM A;  3OW7 A;  1EU4 A;  1B3A A;  2NYZ D;  3SK8 A;  4N9T A;  1RTO A;  4G7H C;  1O7L A;  3HG9 A;  4IUV A;  1XWE A;  5FLX E;  2DNE A;  2PNR C;  1PTO H;  3GTJ B;  5EPJ A;  1ZKO A;  3K57 A;  1I4G A;  1V1P B;  1DOK A;  3Q0A A;  2VNU D;  2BCO A;  1U4P A;  2A69 C;  4A3G B;  1Q1B A;  5K36 H;  1SNM A;  3R3O A;  2KUM A;  3PUV A;  2A6E C;  1CQV A;  3H91 A;  1BOS A;  2EXZ A;  3HKZ B;  1I4H A;  1EY9 A;  3N6R A;  2QF7 A;  5KIX A;  4KMU C;  4E6I A;  3NQI A;  3W3A A;  1H9K A;  4NMZ A;  1ESR A;  1TVX A;  2R61 A;  2SNM A;  3C3L A;  1PTO B;  3QB3 A;  4KTA A;  1CZW A;  2BOS A;  4KJN A;  4B9X A;  2QEJ C;  2CHB D;  1HPC A;  3DMU A;  3P75 A;  3A7L A;  1I4R A;  1S5F D;  1H9S B;  2R6G A;  5CV7 A;  4XQJ A;  2HCC A;  5FO9 B;  5E3F A;  3MXG A;  2EYF A;  3A8I E;  4DAV A;  2ZXO A;  3C1E A;  5M3M B;  5HUR A;  1JWM D;  2TMP A;  1KLU D;  3DXJ C;  3PUY A;  5K36 G;  3PIP 3;  1VMP A;  5JEA H;  1YNN D;  3NUC A;  2B2U A;  1PYW D;  1HFG A;  2F1M A;  2WIN B;  5D14 A;  3MFG A;  2L11 A;  2PO4 A;  4IQZ A;  2NN6 I;  4IFD H;  2K04 A;  1TU2 B;  1JQY D;  4FO2 A;  2A6E D;  4K2L A;  4LJZ C;  4ODG A;  2PCF B;  3BDC A;  3P7J A;  1D5Z C;  1G29 1;  1TKW B;  1FYC A;  3D31 A;  2K5D A;  1BCP F;  4BA2 I;  1NCV A;  4TKO B;  3HRZ C;  3GQB A;  2F3V A;  3CHB D;  1WTX A;  3FPU B;  1IYU A;  4FYD A;  1I4X A;  2NTS A;  1S5D D;  5JOB A;  3TP5 A;  1H9M A;  1VF5 C;  2JSO A;  2HDM A;  1KTK A;  2F03 A;  4RGN A;  2E75 C;  3EA6 A;  4PQX A;  2NBF A;  3NQT A;  2NB0 A;  5G3L D;  2AUJ D;  3I91 A;  4K8J A;  3M85 A;  1ZYR C;  1X3P A;  1PRT C;  4K8I A;  2G9D A;  1PDQ A;  2KEC A;  3BVZ A;  1DJR D;  5DAU A;  3NWT A;  4RAU C;  1HHV A;  1O80 A;  1S5E D;  4B9W A;  3VR6 A;  2VB2 X;  1DD2 A;  5CV9 A;  3S2H B;  5DEH A;  5M5W B;  3RMH A;  3HOV B;  3L3O C;  4HCS A;  5CYU A;  1I3Q B;  4X3S A;  3QOJ A;  2VXW A;  5CV4 A;  2R3Z A;  3K58 A;  5TSS A;  3TP6 A;  2NTT A;  4KY5 A;  3U9O A;  1JWU D;  1PZK D;  1GOZ A;  2EYO A;  2KJX A;  2Z8L A;  1QNK A;  1CI3 M;  4EVO A;  4BY7 B;  3BYT B;  1RDP D;  3SK4 A;  3I4N B;  2F0E A;  2F0N A;  1HTP A;  1JOO A;  4CJ1 B;  3QG1 A;  1QIL A;  2L0C A;  1DOM A;  1LTS D;  4PMW A;  3Q6S A;  3V96 A;  2RSO A;  1UNS A;  2KQ3 A;  1CT1 D;  4U67 3;  4ID6 A;  2K5Q A;  2F0P A;  2A6H D;  4M1U B;  3A56 A;  3EQL C;  2L4N A;  1PRT F;  2BA1 A;  4K5W A;  2TSS A;  3J7Y W;  1GHK A;  3PIO 3;  2BE5 D;  1CK1 A;  2I46 A;  2IPK D;  1ENC A;  2JXM B;  2MP1 A;  2J7Z A;  3NK9 A;  4A3F B;  1DZ1 A;  1QG7 A;  3KBX A;  3N52 A;  4EQN A;  1BNZ A;  3GTQ B;  2RQX A;  3DHQ A;  5JJZ A;  4RFB A;  2ID0 A;  1JE4 A;  4H44 C;  5E4W C;  1U4R A;  4ZQ3 A;  2D9U A;  2E2I B;  1F2Z A;  5M5X B;  1DM0 B;  1I4Q A;  2ZT9 C;  1AFP A;  3NSW A;  3OIQ A;  4RA8 A;  4CKE A;  3S1M B;  2NN6 G;  3H09 A;  1BCP B;  2A68 C;  3WOF A;  3NTI A;  2WV6 D;  2RDH A;  2RBM A;  4ZUJ A;  2BDO A;  4KHZ A;  1NAP A;  1BXT A;  2Q8R E;  4KN4 C;  1CHP D;  3T13 A;  2NZ1 D;  1A3U A;  1WTQ A;  2RDF A;  3D3R A;  4L8J A;  2YYZ A;  2F0S A;  4RKL A;  3BZD B;  1OXV A;  2IL8 A;  1U4M A;  4FP5 D;  1EZ8 A;  2O5I C;  4A3K B;  1SFO B;  5EBD A;  2XIW A;  2F0U A;  4KV6 A;  3T4A C;  1AW7 A;  5F2D A;  1STY A;  1E0B A;  3UI2 A;  2N55 A;  1BO0 A;  3M7N A;  1EYA A;  2F0G A;  5CBE E;  1SAP A;  1STB A;  2IX1 A;  1BBX C;  1GUG A;  5G3L F;  4EQO A;  4V19 0;  3QOL A;  3H0G B;  2JA8 B;  2L1B A;  2XNA C;  5KNB A;  2PMZ B;  2NWG A;  4XYO A;  4EQP A;  5IOD A;  1SDF A;  5IOC A;  2EJG C;  5IT9 L;  1SNC A;  2QCP X;  5E4X A;  3M4O B;  1B50 A;  5FOB B;  1QB5 D;  3OHX C;  4F88 A;  1PFB A;  1RCV D;  1RJT A;  3EJI A;  3VYT A;  4C1N I;  5ELE A;  1EY7 A;  3NWS A;  4KN7 C;  2FMC A;  5C3W A;  1HQM C;  4JBW A;  5DNF A;  1S5B D;  3VR2 A;  4N9P A;  1LT6 D;  1SMY C;  2KCC A;  4LK1 C;  1Q8I A;  5IGB A;  4A3J B;  1G91 A;  1LTT D;  3K7A B;  5NUC A;  1BUV T;  3FDT A;  4XTC S;  4RHS A;  1AZQ A;  2L55 A;  1A15 A;  1XX8 A;  3C46 A;  1LT3 D;  1DOL A;  1E2V A;  3RLF A;  1C48 A;  4HMJ A;  5I9P A;  1RF2 D;  1YNJ D;  3A55 A;  4IUU A;  3KF8 A;  1JCK B;  5IGD A;  2CW0 D;  3HOW B;  1HQR D;  1Q12 A;  2F3W A;  1HUN A;  4ZRZ A;  3J81 E;  3AMU A;  1VDZ A;  1TWH B;  3ND9 A;  4HN7 A;  1G8Z D;  1MI2 A;  1SE4 A;  5BN4 A;  2F0H A;  3PO2 B;  1ML0 D;  3MVV A;  1DYQ A;  4TRD A;  3RUZ A;  2K7V A;  2F0V A;  3BDO A;  3K5N A;  5EPK A;  5J22 A;  1TY0 A;  1ET6 A;  4FXG C;  1OXT A;  1KAB A;  3J80 E;  1F9S A;  4IUP A;  4CGY B;  1EEF D;  2B2V C;  4OL7 A;  1A2U A;  3FEW X;  2BA0 A;  1EQT A;  2KA7 A;  3V2T A;  1FGB D;  3HGB A;  5FLX L;  1Y69 U;  1V8Q A;  1CTM A;  2F0D A;  1CA5 A;  3PV0 A;  3IFD A;  4O42 A;  2HUG A;  5KND A;  4A3E B;  4R8N A;  2LMC B;  3NP8 A;  1SYD A;  2CQA A;  3HEJ A;  4F87 A;  1KDB A;  1KDC A;  4RGT A;  5E1F A;  2DY8 A;  2F4I A;  2L9H A;  2MUY A;  4C3H B;  1PMR A;  2IJ0 A;  1SYG A;  1WCM B;  4CKC A;  4A3M B;  5C0X H;  3I4M B;  4G7O C;  2KOL A;  5CGK A;  2MHV A;  2Z1C A;  1SNQ A;  4MN3 A;  4ZKB B;  2AWO A;  5IGC A;  3W2D A;  4U68 A;  3TDQ A;  2Z4I A;  1F9Q A;  1LLR D;  1STE A;  4G57 A;  4HR7 B;  3H6M A;  4PNY A;  1OXS C;  1D2B A;  2M2L A;  3IL8 A;  1F2Y A;  1STG A;  3JAM E;  2B8F A;  2V4D A;  2PPB C;  1STA A;  2EYJ A;  4WRD A;  1PRT D;  1JOK A;  4OHJ A;  5JVH 3;  4X3K A;  1CM9 A;  1IW7 C;  1W6J A;  5C44 B;  1WTW A;  1Y1W B;  3LNN A;  2RKS A;  2J0T D;  4RKB A;  2PZT A;  1EZ6 A;  1HUM A;  4CBV A;  1EY5 A;  2A69 D;  4RGM A;  3JAM L;  4OO1 G;  5EJW A;  1Z6H A;  1SJH D;  2IW3 A;  3P20 A;  2IT1 A;  2JEB I;  5I6W A;  1E2W A;  2XWJ B;  3D6W A;  4KKS A;  4RCN A;  4V0B A;  1GUW A;  1RHP A;  4RCO A;  1XTC D;  3AB9 A;  1B4O A;  3TN2 A;  3GP7 A;  2VUM B;  1LO5 D;  4IUQ A;  1Q3L A;  5C5L A;  4C3I G;  1R9T B;  1QOH A;  2WKC A;  1HRJ A;  1MGS A;  4H13 C;  3GTP B;  3QWN A;  1AEX A;  1PTO D;  1I4P A;  5JPM C;  1EWC A;  2K1B A;  1Q1E A;  2EVB A;  4XDX A;  4XT1 B;  3BYY B;  3I8Z A;  3DWA A;  4H0L C;  4OO1 H;  3NPP A;  2NVY B;  3SK5 A;  3ERQ A;  3PO3 B;  3I70 A;  2F0Q A;  1BCP D;  2AWN A;  2OEO A;  5LHY 1;  4FF4 A;  2B39 A;  1X32 A;  2KCN A;  3GTO B;  2F0F A;  1KLG D;  1HXY D;  1I6H B;  4C3H G;  4DA2 A;  2LFN A;  1UEA B;  1O78 A;  5A2Q E;  2WAQ B;  5D65 A;  1QWY A;  2H4O A;  2K33 A;  5I2Y A;  2EDG A;  2RDG A;  1R4P B;  1GUT A;  2XVS A;  2O2L D;  4MHE A;  5C6A A;  3J7A V;  2R7Z B;  3K5O A;  5T1G A;  1BDO A;  2SOB A;  1B44 D;  3LWU A;  4KKU A;  3CRL C;  1PXU A;  2FJ2 A;  2IWH A;  5C0X G;  5C4J B;  1Z7T A;  4M8A A;  3OMG A;  3S2D B;  1A3T A;  2A68 D;  2WKD A;  2WB1 B;  4IFD I;  4QUC A;  1TS4 A;  3TZU A;  2HCI A;  1RTN A;  5DM7 3;  3MHB A;  3QO2 A;  3K59 A;  2B2V A;  2Q8I B;  1PFN A;  3M4Y A;  3I4L A;  1F9P A;  3GTG B;  2DNC A;  3F2U A;  4TQU S;  1DXM A;  2L5T A;  4Y7N B;  3OSO A;  1PTO C;  4IFD J;  1X3Q A;  4NDX A;  1PZJ D;  5IT9 E;  4JK1 C;  3MTS A;  3SEB A;  2B63 B;  3GO5 A;  4HAE A;  2B2T A;  3NBH A;  3FVQ A;  1H9S A;  1SE2 A;  1RD9 D;  5K5P A;  4CKB A;  4DF7 A;  2A5H A;  4P2C B;  3S1N B;  1V1P A;  1OXU A;  4O1N A;  3KUP A;  1LTG D;  4J8Q A;  3RZO B;  4IUR A;  3FRP B;  5AFW A;  1AZP A;  2SDF A;  2LS0 1;  1O7Z A;  3O13 A;  4KHV A;  4B08 A;  4EGV A;  4KY6 A;  2EYP A;  1LTR D;  3P1H A;  1TY2 A;  1CQF A;  1AP0 A;  2NVX B;  4PMC A;  1SMY D;  2PW5 A;  5EKL A;  3NBI A;  3T51 B;  1JOR A;  5LL6 S;  3PUX A;  4R9W A;  4BA1 I;  4C3J B;  1TS2 A;  1EIH A;  2E2J B;  2NVT B;  1BQQ T;  2EY2 A;  2KVM A;  1IKM A;  1SYC A;  3GD7 A;  4KY7 A;  5CV8 A;  2Y0S B;  2QDB A;  2AQ2 B;  3I3C A;  4X3T A;  3HOY B;  2E2D C;  4CJ2 C;  1MSH A;  2PQE A;  3GV6 A;  1SNP A;  1B2T A;  1F2M A;  3ONA B;  2XWB B;  2Q8T A;  5FO8 B;  1K83 B;  3D4R A;  1M8A A;  2KED A;  2EYL A;  5EGT A;  4DAP A;  4K2K A;  3K5M A;  5HGT A;  2B2Y C;  3DM1 A;  5C0X I;  1SYE A;  1JOQ A;  5I2X A;  3S16 B;  4G7Z C;  4C3J G;  1UAP A;  5D3I B;  1OO9 B;  1D5M C;  3NHH A;  3NTK A;  4ABN A;  3LX0 A;  2GA4 B;  1SXT A;  2EPB A;  3D6C A;  3KLS X;  4RWS C;  1LAB A;  1JWS D;  2K01 A;  4NKL A;  2ICE C;  4FNF A;  5C5M A;  2IX0 A;  3MEH A;  4IUN A;  5A2Q L;  5J1Z A;  1SYF A;  3L9A X;  1PFM A;  1TWG B;  2CVR A;  4K6L A;  4RH6 A;  3G7L A;  1CFM A;  3CKI B;  1A6X A;  4L63 B;  1EY8 A;  2EZV A;  2FFK B;  1EY0 A;  2NVQ B;  3KBG A;  1IW7 D;  2EY5 A;  5CV5 A;  4DNR B;  4ZLT F;  1BR9 A;  2F0M A;  1BF4 A;  5BN3 A;  3HZX A;  2PYK A;  5IIF A;  1D1I A;  1SNO A;  2JEA I;  5T1I A;  2EYM A;  1QNU A;  4Q0F A;  4BY1 B;  4OGQ C;  1EIG A;  1TS3 A;  3SR1 A;  1MBY A;  2DY7 A;  1Y8P B;  2JA6 B;  4CHT B;  1FNW A;  1ONL A;  1Z47 A;  3S9W A;  5FK9 C;  2SEB D;  1PTO F;  3Q22 A;  3VA5 A;  1ENF A;  2AQ1 B;  1MSG A;  5IGE A;  2D2C C;  4TSS A;  2H1E A;  1OXX K;  2R93 B;  1UUP A;  3BVG A;  1HCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...