4CJ2C

Crystal structure of hewl in complex with affitin h4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
VKVKFFWNGEEKEVDTSKIVWVKRAGKSVLFIYDDNGKNGYGDVTEKDAPKELLDMLARAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME C
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/de novo protein
total genus 13
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj2C00
4CJ1B 2HDLA 2B2UA 1SSOA 2HCIA 2HDMA 5EPLA 1S4ZA 4ZLTF 2FFKB 2RVLA 3Q6SA 1WVLA 1HUMA 2HCCA 2X69A 3TN2A 1BNZA 5D14A 1PFNA 1PFMA 1WTRA 5T1IA 1EIGA 1MSGA 5AFWA 1NR4A 2KOLA 1MI2A 4IUPA 2M2LA 2KEDA 3R93A 2RSOA 1IKMA 5CORA 2EE1A 2KECA 4IUVA 3IL8A 1Q3LA 1U4RA 4IUTA 4IUQA 5E4WC 2B2WA 1BBXC 2EPBA 2BDNA 4NW2A 1WD0A 2L12A 2K28A 1NR2A 3DEOA 1ESRA 2FMMA 4X3KA 1CA6A 1GUWA 3LWEA 2H1EA 3GV6A 2X6GA 4QUCA 2K04A 4HAEA 2B2VC 4RWSC 2B2YC 1A15A 2D9UA 5D65A 1AZPA 4XT1B 4CJ0B 2CVRA 2JYOA 3IFDA 5EPJA 5DNFA 1O7YA 4R9WA 4DN4M 1IKLA 3HP3A 1WD1A 1LV9A 4U68A 3I91A 1M8AA 2MP1A 1G6ZA 3I3CA 4IUUA 3MWYW 1WTPA 1EOTA 2B2TA 1B50A 3G7LA 3QO2A 1RHPA 2J7ZA 4HSVA 1DOMA 1ML0D 1PFBA 4CJ2C 1WTWA 2MPMA 4ZK9B 4XT3B 2Q8TA 1F9PA 1F9QA 2FHTA 1RTOA 4X3UA 1VMCA 4ZKBB 1QG7A 1E0BA 1F9SA 2B2UC 4IURA 2JP1A 4XDXA 4QUFA 1HRJA 1WTXA 3I90A 1JICA 2N55A 4OIKA 3SVMA 1BF4A 5E4XA 2NYZD 1F2LA 2KEEA 1C8CA 2DY7A 1ILQA 1QE6A 2MGSA 4O42A 1U4MA 1MGSA 2B2TC 2RA4A 4OIJA 5CMDA 2R3ZA 2X6LA 1MSHA 2NZ1D 1PDQA 1EL0A 5CBAE 2N88A 2RSNA 4ZKCB 1HUNA 1G2TA 1X32A 1RJTA 2VXWA 2B2WC 3D6WA 4LMQD 2K01A 2DY8A 2NWGA 3FDTA 1WTVA 4X3SA 3N52A 4RA8A 1B4OA 2L4NA 1O80A 1RODA 5EJWA 5EPKA 1XYIA 2L1BA 1WTQA 4R8IA 1X3QA 1F9RA 2KVMA 1IL8A 1J9OA 1DOLA 2KUMA 3DM1A 1QNKA 4ZAIA 4RAUC 3DEPA 4X3TA 1B2TA 1NAPA 1SAPA 3GV3A 2SDFA 5CBEE 3KUPA 2XIWA 5EQ0A 3FPUB 3H91A 1RTNA 1CA5A 1PLFA 1JE4A 4HEDA 2K05A 1WTOA 5T1GA 5EKIA 2EOTA 1B53A 3F2UA 2IL8A 2L9HA 1B3AA 1HFNA 1O7ZA 2B2VA 2B2YA 1X3PA 5COYA 1DZ1A 1G91A 1ILPA 1HHVA 1ZXTA 2MJ8A 1G2SA 1HA6A 1XX8A 3P7JA 1HFGA 4UAIA 4HCSA 3UI2A 1VMPA 1ICWA 2Q8RE 2K1BA 3TZDA 4MN3A 3I8ZA 1DONA 2HUGA 1AZQA 4MHEA 1DOKA 1U4LA 1J8IA 1SDFA 3KBXA 5JJZA 1KNEA 1NCVA 1U4PA 2L11A 1EIHA 3MTSA 1EQTA 2FJ2A 3ONAB 1AP0A 2FINB 1CM9A 2K03A 1BO0A 1KNAA 1TVXA
chains in the Genus database with same CATH superfamily
1Y1WH 3J7A5 4V0BA 4HMIA 3NENA 2K32A 1TWCB 3J7AV 3CCLA 3TP6A 3C3LA 4I7AA 1VQ9A 1EY7A 2A69C 4GLVB 4BWGB 1NR4A 2E8GA 3KLSX 1K0RA 5DM73 5FOBB 2B63B 1BBXC 4NW2A 4KHPQ 3OSOA 1TY0A 2XNAC 4FF4A 3H3VC 4A3GG 4GN4B 5HGQA 1CT1D 1A63A 1B7YB 1X3EA 1EYAA 4BBRB 4KJNA 1Q8IA 3I3CA 4N8FA 1GUSA 3RLFA 4CJ2C 3PUWA 3TSSA 2MPMA 3O13A 4N9TA 1RTOA 4C3IB 5M3FG 3K0XA 3I72A 4JI0Q 3SVMA 3MFYA 3DWQA 5E4XA 2RDFA 2Z6BA 4A3FB 1JJGA 2RDHA 1PTOC 3HRZC 2E2HB 2AQ3B 2RKSA 4J6HA 4JI2L 4A3DH 1IL2A 1STBA 4DV1L 4JI5Q 3NSWA 2IT1A 2MUYA 3AB9A 3GTKH 2V1CC 4RA8A 5EPKA 1AEXA 4IOCA 3HGBA 1GKHA 4GOPC 2D0PA 3SK5A 2KUMA 2NVTB 1SYEA 3KUPA 4AQYL 4CDFC 3HOYG 5IOCA 2K05A 1WTOA 3AEVA 3OTOL 3S16B 1B3AA 4X64L 5J39A 1K73C 2OTJA 2PCFB 1HZAA 5EKKA 3P1HA 2K1BA 5LMUQ 3KF8B 4X62Q 3BVZA 2R7FA 5C3XA 3C1FA 2E5LQ 4GZYC 4UP7A 4F87A 1BO0A 1UEBA 2VQEQ 1LT4D 4A3MB 2F03A 1CSPA 4WJWA 4B08A 4DK6C 1M90C 1BNZA 5GAGC 1D2BA 1EFID 4C3JG 1KD1C 5D3DA 3PO2H 2XSCA 1GHKA 4BY7G 1Q3LA 3K5OA 3NUCA 1EWCA 1KQSA 4JI1Q 3BJUA 2A73B 5EBCA 5ELEA 2K04A 1HQMC 1Y1VB 2B2YC 4LF5Q 1A15A 4LF7Q 5IWAL 2NN6H 3FKIB 2ZM6L 1STAA 5FLMG 2YTVA 3CKIB 2K5NA 1G6ZA 2EZVA 1HZBA 1T5XD 1QNUA 2J7ZA 4HSVA 2PMZB 4IUNA 4RKBA 2BH2A 2K52A 1QVGA 1B44D 3DWAA 3VA5A 1HZ9A 4ZK9B 1TS5A 3KYHC 1SMYD 1YVCA 4OO1H 1QCBD 3VDYA 3GTJH 4JC0A 4P73A 1WTXA 1LLRD 4K2KA 4DNTB 1PH1A 1QE6A 4JBJA 1EY8A 1KIXA 4FNFA 3S2HH 1EEFD 2Z0SA 1LTSD 3TDQA 1V1QA 3D6WA 5C5LA 1G6PA 3M7NA 2F0TA 2QGQA 3K5MA 3GTLB 5IP7G 2L1BA 4KY6A 3HEJA 2N8NA 3QOLA 1ZEQX 3STBC 3C1EA 3W2DA 5M3MG 1I5FA 2R92H 3H94A 3S1NB 3K5LA 3S17B 3I4LA 3HOWG 4WFN3 2L9HA 2NVXB 1HFNA 3DWPA 3J81j 1Q1EA 4B3MQ 3X3MA 3X3NA 1S72A 3I55A 3CC2A 4GLXA 3I4NB 1XMQL 2HUGA 1TQOA 1DOKA 2LMCB 3TEHB 1SDFA 3KBXA 3K7AB 1WOCA 4KN4C 2VY3A 4JI2Q 4DV1Q 1NCVA 4FF2A 1FD7D 1N9WA 2EY6A 3RN5A 4CGYB 2FINB 3KF8A 1NUCA 3HOUB 3KF6B 3K58A 1HNXL 1G8ZD 1YJ9A 2B2UA 3M3YH 2K5QA 3S1QB 3Q6SA 1WVLA 4OHJA 2NTTA 2BH8A 1CTMA 4X66L 1HPCA 4IUPA 3FP9A 4AQYQ 5C0XG 2ENBA 1VQLA 2JSOA 2ZXOA 1BKBA 2KCMA 5I9PA 4YWLA 3OTOQ 1JB7A 5BR8L 3T51B 4X64Q 3DEOA 4H13C 4ABNA 1CA6A 1Q46A 3I4MH 4A3BH 4JBWA 4QUCA 1SE8A 3KLWA 2PNRC 4OGQC 2JA8G 4JW0A 1HCZA 2Z6KC 3HG9A 4IFDJ 2D2CC 1TR5A 5LL6S 2B2TA 3G7LA 5KIXA 1DOMA 3KJOA 5JJKA 1Q86C 4XT3B 5C44G 4X3UA 3BDLA 4XTCS 1VMCA 2R7ZH 1EU4A 2XTIA 3R2TA 5JEAJ 1CHPD 1D5ZC 1G2TA 2A8VA 5C5MA 2B2TC 5CMDA 3GP7A 4LJZC 2IX3A 1BVSA 3KLSA 2RCNA 1EL0A 2H5XA 2RSNA 1R9TB 1HJPA 5A35A 5LL6X 1JQYD 2F4IA 4DV3L 1GJXA 5C0XI 2RQXA 3CRLC 5KRUA 1Y1WB 2RDGA 1I6HH 1STNA 1CFMA 4BXXG 1GUOA 2ZM6Q 4R4CA 4C2MH 4K0KQ 2CQOA 3SE0A 3TRZA 4RAUC 4RKLA 3SXHA 4FXKC 5LMNW 3FPUB 1CK1A 2ASBA 3PIPA 1H9RA 2Y0SE 1EQQA 1DZ1A 4K5VA 1ILPA 3WWVA 1HFGA 3NHHA 4MN3A 4BA2I 4DV4L 2UXDL 4B9WA 1CZGA 4R8NA 2DJFC 1X65A 4IPDA 1RD9D 2FJ2A 4IPCA 4RMFA 3AFQA 1I94L 1LTGD 3J7ZC 1GHJA 2FFKB 2QW7A 4A93B 1PFNA 3QJYA 1E2ZA 1Q8KA 3CU7A 3KF6A 1NY4A 4JOIA 1IKMA 3TP7A 4UP9A 1T9HA 1NBWA 1QZHA 1ENFA 1Q81C 1JMCA 4DV7L 2WB1E 1Q7YC 2GN5A 2A5HA 1Q82C 1AH9A 1B9NA 4DR5L 3S1MH 1EY9A 5GADC 3GTKB 4IFDH 1SMYC 4JOIC 1VQBA 3W3AA 2QKIC 1DCZA 4BY1G 1ESFA 2JYOA 4A3DG 5IYBH 3FMCA 4XQNA 3P20A 3RN2A 3UDXA 1M8AA 3L9AX 1JE5A 1C48A 4OELB 1J5EL 1UEAB 3QO2A 4FXGC 1RHPA 1MJCA 2MHVA 1PYBA 1JWSD 2F4VL 5JEAH 2FHTA 3EVQA 3A55A 1HR0L 3KLRA 2KQ3A 1SE3A 1EEID 5FO7B 2XN9C 3T1HQ 4QIWB 2B29A 3CC4A 2K50A 3OPOA 4JI8L 1YHBA 4JYAL 3EIVA 2NZ1D 1SEBD 2N88A 3BZDB 2XRQD 5BR8Q 2F0FA 5C4ZA 4PQXA 2B2WC 2Q8IB 2QCPX 3RMHA 2EY2A 3PUXA 2F52A 4JG2A 3VYUA 1F2MA 1YI2A 2KCNA 1SROA 5CV9A 3I2ZA 4QF4A 3J80c 1RKNA 1V9PA 1X3GA 1L0XB 4EVOA 1F9RA 2F1MA 1DXMA 3KJPA 4B3RL 3AU7A 1DOLA 2K33A 3OW7A 1PYSB 4A3JB 3HOVG 3PO2B 1MD2D 3NE5B 3OWEB 5ELFA 1JE4A 1ASYA 1EY6A 1PH8A 3NXWA 2I46A 1VQ4A 4DR4L 3BG3A 2QA4A 3PO2G 4DU9A 2EYLA 3OMCA 1K8AC 3W1GA 4UAIA 2I5MX 4DK3C 1XNRQ 3OHXC 2HQLA 3AFPA 1DONA 1AZQA 3ERSX 3FKIH 5GAHC 1YHQA 5K36G 5F2DA 2PO4A 4DV3Q 1CKMA 3A74A 4BBSB 1SE4A 1KNAA 1VDZA 1VQMA 3CPWA 4B9XA 1ZYRC 2F3IA 1TS2A 3PF5A 4RCNA 1PHJA 3RZOH 3M4QA 2O2LD 1VQ6A 2K5HA 4A3KB 3GTJB 4KHPL 5C3EB 4LW1A 4GN5A 5CYUA 3VR4A 3CCEA 1SLJA 1VQGA 4OO1G 1N32L 3JC66 1GUNA 4OWTB 1U5KA 3PSIA 4ZQ3A 2B2VC 2EJFC 4DKAC 2L0CA 2UXDQ 4CJ0B 5DNFA 1O7YA 4R9WA 4NXNL 3NEMA 1EOTA 4JI0L 1E1TA 2ZTCA 1P8LA 2R92B 1WTWA 1I94Q 3S1NH 3PO3H 4WJ4A 4LUOA 1N34L 5CGKA 1Y8OB 2F0PA 3NWSA 1QG7A 3CCSA 1HRJA 4LF8Q 1E7ZA 2PZUA 2NVXH 5IYDH 3NTIA 4JI5L 2NB0A 1U4MA 1SYFA 3E6ZX 5M5YB 4DV7Q 2Y0SG 4JBKA 2O5IC 2Q2IA 1ENAA 2OQ0A 5HURA 3K7AH 4DR5Q 2Z4HA 4KMUC 4QQBX 4YWKA 5FLXE 2NWGA 1VQCA 3G6EA 1RODA 3H0GB 4OO1I 2YTXA 5FLXL 1SYCA 3S1QH 2KVMA 3DM1A 4K6LA 3BYYB 3VR3A 2XWBB 3DEPA 3D31A 1NAPA 1FNWA 4H44C 1SRUA 2AKWB 3V05A 1WJJA 5LMUL 4DV6L 5IP9G 1VQKA 4RFBA 5EKIA 1VCIA 5ISRA 1HR0Q 4HIOA 3NPPA 2P5ZX 1U0LA 1H9SB 5L37A 1W6JA 4L5TA 3MC0B 4AYBB 4A3BB 2JQOA 3EBEA 1F2YA 3OIQA 3M85A 2VQEL 3PUVA 1KDAA 2SEBD 1Z7TA 3MVVA 2WB1G 5ELDA 1XPUA 1U4LA 3EJIA 1J8IA 4JK1C 2ATWA 1SNDA 2MO0A 4A3EH 1PH3A 3I4MG 1PXUA 2EIFA 3HKZB 2K14A 1H9KA 4XQQA 2PMZE 1S5BD 3J7AF 4KTAA 1SR3A 2X69A 2R7ZB 4B3RQ 5D14A 1QVCA 4DK1A 4O2DA 3K0YA 2EYMA 5KEEA 1L1OA 2RSOA 4FDBA 3UDFA 1OXUA 2BE5D 3IL8A 2DUDA 4LF5L 4DAMA 1SNQA 4EQ5A 4DUZQ 4DR4Q 1WCMH 2L12A 4ID6A 4L6TB 3SEBA 3QR8A 1ESRA 2FMMA 4X3KA 1R9TH 2JA6G 1HTLD 1I6HB 4YHHQ 4RCOA 4B3SL 3F2BA 1L1OC 1RF2D 4XT1B 1UAPA 2K7VA 1JR0D 1EWHA 1DYQA 1D1KA 4C2MB 1V1OA 2JXMB 5C4XB 3HOXB 2Q8TA 3NTHA 4P74A 1F9SA 1II3A 2N55A 2CWPA 1PV4A 2WINB 2OXPA 3OMGA 3L0OA 1GUTA 5IYCH 1YJNA 2ZJQA 1D5MC 1SNMA 3ND8A 2B63G 2AMCB 2ZT9C 1IBML 1UNSA 1D7QA 3GTMH 1TIID 2A19A 5CBAE 1N32Q 2VB3X 1I50H 3OIPA 3EQLC 4KD4A 1VQJA 2K01A 2RHQB 1E22A 2HD3A 2UXBQ 4UY8C 1S5ED 3FRPB 1CQVA 2L55A 4KHVA 3RLOA 4BBRG 1Y69U 3A8IE 1I3QB 3S24A 4NXNQ 1PFSA 4A93H 1LTLA 4B3ML 2XIWA 1JOOA 1L0WA 1UUPA 3IFTA 1A6XA 4KK7A 1N34Q 4C3IG 3M9BA 5IGCA 1HA5A 1YBYA 3S1MB 1HHVA 2ZJRA 4PNYA 1XX8A 2VB2X 4HSPA 3UI2A 4A3FG 4JBMA 3OOCA 4ZYSA 4RGTA 1CKNB 3K81C 1RIPA 2F0GA 1KLUD 3QB3A 4PG3A 2E2JH 2EYJA 5HGTA 3CCRA 2R93B 2WKDA 4IFDG 3SK6A 1ET9A 2KECA 4IQZA 1RCVD 2HHHL 5EPLA 1SSOA 1GD7A 2IX0A 2JN4A 1BR9A 1SNCA 3T53B 1I4GA 1PRTB 2PI2A 1FGBD 3R93A 1WI5A 3KOJA 4DV6Q 2OT2A 2IW3A 4A75A 4GN3B 1GVPA 3CMAA 4CDEC 1EY4A 4H02A 4JI6Q 3U9OA 4LF4L 3BYTB 2VL6A 3VR6A 2GVBA 2QEJC 2E74C 2DNEA 4LAAA 4L63B 4LF6Q 1OXVA 1VQFA 2LXJA 4A3JH 4K5WA 5CC4A 1IXRA 3FEWX 2NZHA 4A3MG 2EYPA 3E0JA 3CPFA 3HS0C 1PH9A 2E2IH 4IFDI 5I6YA 3WOEA 3QOJA 1F2LA 2A74C 1C9OA 4C56C 1VQDA 3I70A 4L5RC 3MXNB 2RCFA 4K0KL 1RJTA 4PMCA 3FDTA 4BBSH 3N52A 1Y1VG 2L4NA 5J3BA 4B3SQ 4KD3A 4KLKA 4EGVA 4ILWA 3FKIG 2SNMA 4A76A 3T56B 5FO8B 3RZOB 4XIGS 1QNKA 4A3KH 1IYVA 5C3EH 1NMFA 2WP8J 1QOHA 4DR7Q 2F0SA 1RTNA 3QIAA 2YYZA 2NVQH 3KDFB 5CV6A 2HIVA 1VF7A 4EQPA 4NDXA 1VMPA 1ICWA 3EN2A 1NNXA 1SXTA 1IBMQ 2DGYA 1I6VC 2YV5A 3CCUA 4J8QA 2BE5C 4ALPA 1QVFA 5I6WA 2KCTA 4L8JA 1TVXA 1CKNA 3ER0A 3PO3B 4ZLTF 4JV5L 1XTDA 2HCCA 1LTBD 4EX5A 1PFMA 1TS3A 1K8OA 5T1IA 1VQAA 1Z9FA 3H3VH 4QIWE 2BDOA 1TWGH 1QJOA 5KYLA 3MXGA 5M5YH 1EY5A 4UP8A 2JA7B 4HMJA 1LTRD 4KI0A 4JI3Q 2CFMA 1TT2A 3I4NG 3H0GH 1XJVA 1N33L 3Q0AA 1XWEA 3A5ZB 5KNDA 1LV9A 1EWIA 4DV5L 1CZWA 2D0OA 4DAPA 3HOZB 3T1HL 3HOUG 3BU2A 2HHHQ 1KRTA 4I7ZC 3TZUA 4ZUJA 1F9PA 2DNCA 3NQTA 2R6GA 4POGA 4M1UB 4ZKBB 1E2WA 2B2UC 1A8VA 4V190 3I90A 4OIKA 2R61A 4POFA 2BOSA 3DXJC 1C7YA 4OIJA 2GVAA 1MGSA 2RA4A 2UU9L 1VQHA 2M9VA 4FVMA 1STEA 2F0EA 1VF5C 5GAEC 3GTPB 2J0TD 4A3EB 5FK9C 4Y7NH 4A3IH 3DUZA 4LF4Q 1B4OA 3MXNA 4XYOA 2E75C 4R8IA 4K6DA 4CBVA 3BZCA 4LK1C 2A68D 2NZOA 2JA5H 2Z1CA 2SDFA 4C1NK 4JVZA 2F3VA 1XNRL 3P75A 4HEDA 1DD2A 2EOTA 1WCMB 5ELCA 3MA2B 2NUCA 5COYA 4GKKQ 1SFOB 1XPRA 1W6KA 1F77A 1TU2B 3KDFA 2ID0A 4HIDA 1A3TA 5TSSA 4S3SA 4FP5D 2C9OA 3NBHB 4LUZA 5C4XH 3HOXH 1S40A 3TMEA 1Y1WG 2HCIA 5H1SE 5KGUA 3URYA 1YNND 3T1YL 1S5FD 3EA6A 4R4OA 2CHBD 3A8JE 3RUZA 3I73A 3MXUA 2WAQB 5EKLA 3I56A 1B3QA 2F0OA 4H0LC 3GTMB 1I50B 1SE2A 4PMBA 1EY0A 2OCEA 3ULJA 2EJGC 3GV6A 4A3GH 1XNQL 2F0UA 4EQOA 3SK8A 1BCPB 2D9UA 5I4DA 5CV4A 3I91A 2MP1A 2VNUD 1I3QH 4IUUA 1JJCB 4LF8L 1SNPA 3BDCA 2EYOA 1K8GA 4AH6A 4LFAL 1O7IA 2Z8LA 1B9MA 1JWMD 4JV5Q 4NMZA 4A93G 1BQQT 4IJHA 4J15A 1KHIA 3NELA 1I4PA 4AYBE 1Y14B 2ICEC 4Q5VA 1TWHH 5JOBA 2R3ZA 2GA4B 2E2JB 3BVMA 5C4JH 5IGEA 2IPKD 5C6AA 1C4QA 4OX9L 2R93H 3HKZE 4RGMA 2PI2E 3CCJA 1DJRD 3PUYA 1T5EA 3RLNA 1N33Q 4KKSA 4DV5Q 5JPNC 4X3TA 3J7YW 2VQFQ 1RDPD 3U50C 3TQYA 4HJAA 3MHBA 3UDGA 2J4XA 3J81E 4YWMA 4RHRA 1B53A 4K5XA 1PZKD 3HKSA 3J81L 3GTQB 1IYUA 1ASZA 3GDEA 3CRKC 5FJ8H 1ZKOA 5GQOA 2UU9Q 4O1NA 1JC7A 1IBLL 3HFZB 4OL7A 1KNEA 4RHSA 4FXDA 1YZ6A 1JJ2A 3LWUA 1AP0A 1U9RA 2BA0A 2WKCA 1AFPA 1LO5D 1EFWA 2A69D 3R8BA 1D8LA 1CUKA 3JAMi 1O78A 1VQEA 2E2IB 4DUZL 3NBHA 5E1FA 4KY7A 2F0LA 4KY5A 4A3JG 5AFWA 3F8TA 3RD4A 1UE7A 4BY7H 4IUQA 4YHHL 2HIXA 1FR3A 4MTNA 3RZDH 5HY6A 2K6AA 1LUZA 3NBIA 2VUMB 1FGUA 4DR1L 2F0NA 2H4OA 1E3PA 4RWSC 2I0QA 1YNJD 5CV7A 3VYTA 3F2DA 2NN6G 4DN4M 4NPSA 2VZAA 3T16A 1BXTA 4U68A 1BOSA 2K5WA 5C4HA 1WTPA 1L2FA 4BBSG 4LFBL 4RGNA 4A4IA 4IN3A 4MIUA 2NVQB 3AMUA 3T1YQ 3CD6A 2SOBA 4YCWA 4A3KG 2UUCL 4XQJA 5IY0A 2IY5B 1JICA 5C3EG 4IPHA 1N36Q 1MBYA 1JORA 4KN7C 2XWJB 1CA5A 1XXGA 1C8CA 4DA2A 2UXBL 2ICIA 2A68C 4F8MA 1JCKB 1HUNA 1PH6A 4I65A 5DAUA 1XNQQ 1WTHA 1XYIA 4TQUS 5FLXc 4HTHA 1IBKL 4ZRZA 4DNRB 1JB3A 5NUCA 3UE1A 3W1BA 3A7AB 2NN6I 1I4RA 1TWGB 5M3MH 3Q24A 4LFAQ 3L7ZC 1NE3A 2R92G 4KKTA 2B8GA 4HJ5A 5E7NA 3HOWH 3S2DB 3NK9A 3F2UA 3JAMc 2E2DC 5C3WA 1KRSA 3CCVA 2JA7H 3I4OA 1G91A 2LY7A 1ZXTA 2V4DA 3OYYA 2MQHA 3S1RH 3CHBD 4DXGA 1YNNC 1X56A 2F0HA 3TZDA 4GKJL 2ZTEA 2EJMA 4PZ6A 3M4OB 3EFXD 3TP8A 4OX9Q 3A54A 5J1ZA 3HOZH 1Y8NB 4CJ1B 3H0GG 2HDMA 4KV6A 2PW7A 3JAME 3K57A 1LABA 1S4ZA 3GTGH 1X6OA 3TN2A 2ZJPA 1LT6D 1WTRA 2N78A 3MEHA 3JAML 4C3HB 1MI2A 4G7ZC 3E0EA 4P2CB 4MTKA 1NTGA 4JI6L 2O5JC 4LWCA 4GOPB 4O0AA 1PZID 4CDDC 3SDZA 2BDNA 4DAVA 3DMUA 1WD0A 2JE6I 4YIJA 4Y7NB 3GTPH 3NQIA 4AYBG 4A3BG 4A3IB 4LF6L 2IWHA 4HJ8A 4UDUC 1OXXK 1WYDA 5AJ3L 3OW2A 2F0WA 1JOQA 1IBLQ 2D62A 3FHWA 2SNSA 4UHVA 1A2UA 2XRSD 4HCEA 3HKZG 1EQVA 2JA5B 1YEZA 5M9OA 3TS2A 3ITPA 1FNUA 2OEOA 1H9MA 1HH2P 2JEBI 2EDGA 1ENCA 4DV0L 2OWOA 1S5DD 2R7ZG 1A62A 3OWFA 1BF4A 1SFOH 4HR7B 1HR0W 2PZWA 1ILQA 2JJQA 4Z9CB 1GUGA 3LX0A 2X6LA 3W5OA 1C0AA 1I4HA 1X9NA 4QB4A 1HTPA 3LGJA 2G5DA 4JCVE 2C5CA 4DR1Q 5JVH3 3UDIA 2AUKA 4BS9A 4X3SA 1KDBA 2VS1A 4DR7L 1K28A 3STBD 4IZ8A 2CH4A 4XXEA 3F1ZA 4BXXH 2AQ1B 5ELNA 3ULPA 2F0MA 4NP5A 3SGIA 5C4XG 3E5SA 4YCVA 2AUJD 1YHAA 3HOXG 2F0DA 3E3XA 4LFBQ 2NVYB 1EIYB 3K59A 1PRTD 5T1GA 1SNOA 4JI4L 1HNWQ 1MHWC 1B8AA 3ULLA 1O7ZA 2UUCQ 4L5SA 1V43A 1KC8C 3MZ5A 1H9JA 2K5DA 4ME5A 4A3GB 4OWXB 1TY2A 3K80C 1PA6A 1PH2A 1A0IA 5JJZA 1SYDA 1ET6A 3G6JB 1PRTF 4FYDA 4QCLA 4J1MA 1IBKQ 1HUMA 1KLGD 4FO2A 3A5UA 5M3FB 1YNJC 5DM63 1K3RA 3L2PA 3D4DA 4JI3L 5A2QE 3R2IA 2RF4A 2WIIB 3SHLA 2EE1A 2KJXA 2A6ED 1TWHB 4IUVA 3BZKA 1U4RA 4P72A 3CF5A 5A2QL 5BN4A 3NTKA 1H9SA 4P71A 5C4JB 1NR2A 3AYHB 2OTLA 5IE8A 1D5XC 2Q2TA 4GOPA 3D3RA 1UWVA 4CKBA 2CW0D 3E9HA 4GKJQ 1GM5A 1AZPA 4BY1H 3F2CA 2IHEA 2NTSA 1WFQA 5IYBG 1I4XA 3CQZH 2KCCA 4GNXB 5KNCA 2R93G 2F0VA 2PQEA 2ZXRA 4HN7A 4CKEA 3QWNA 4DF7A 3HOYB 4A3CH 1VQOA 5JEAG 3GD7A 1F9QA 5D3IB 4YCUA 2EY1A 2MFIA 3NWTA 4DR2L 1EU3A 2LSSA 4R4IA 2KEEA 3GTQH 2MGSA 5DLQE 3U4VA 2OF1A 2DN8A 4HIKA 1EYDA 2VXWA 4IO9A 1LT3D 5E3FA 2LXKA 5FJ8G 3C2PA 4DFAA 1WTVA 5KNBA 5AJ3Q 4PZ8A 4DXFA 1FJGQ 3PIOA 1X3QA 3PV0A 4N9PA 5LMNL 5JJLA 3PUZA 1BDOA 2IX1A 4DGZA 4U673 4GKKL 4C3JB 3HOVH 1Z6HA 1VS0A 1TWFH 4BY7B 5FKAC 2WAQE 1S3OA 4DV0Q 1VQ7A 4TKOB 4QY7A 3RZDB 1NMGA 4N8X1 1G291 2VUMH 1LTTD 5EBDA 2B2YA 4FF3A 1XMOL 1G2SA 1HA6A 1KAWA 2HQEA 2PW5A 5GROA 3ZJYC 1SN8A 3CCMA 1HNZQ 4QMGA 1G51A 1H95A 2YU9B 2B3GA 4DPGA 5K36H 3IRBA 3QG1A 3VR5A 1EQTA 1L0YB 3DM3A 1CM9A 4Q0FA 5JPMC 2CCZA 3RR5A 3L3OC 2KENA 3T13A 1EYGA 1LYLA 2WV6D 2EYHA 3UE0A 1A2TA 3BVGA 4F88A 4B3TL 2QDBA 2I5HA 4IJLA 4DV2L 1MSGA 1J6QA 2XVSA 5CORA 1STHA 5IGFA 3ZYYX 3S15H 3A7LA 2F0IA 1VQPA 1SBBB 3CMEA 4JI4Q 3HZXA 3A0JA 1GUWA 1RL2A 2MO1A 3H09A 5EGTA 2X6GA 3U58A 2PZTA 4K2LA 1EUJA 2C35B 1X55A 1SYGA 2CVRA 2AQ2B 3A56A 4G4KA 4CDCC 4RH6A 3PQIA 1IZ6A 1SMXA 3CXCA 2A1AA 2OQKA 4IOAA 1LM0A 5M5WH 2PPBC 5M3MB 1XTCD 1TKWB 1PFBA 3PO3G 3HOWB 5KYIA 4GNXA 2B8FA 3S2DH 1E0BA 5IYDG 2NBFA 2D5DA 3S1RB 2KHIA 3G71A 1AE2A 2NYZD 1AW7A 4O42A 3MFGA 2AWOA 3VYRA 1UE6A 2ALYB 1BUVT 2JA7G 4ZKCB 1X32A 1KABA 3M4OH 1FVIA 4GNXC 3U4ZA 1NJIC 1OXSC 1PRTC 1PH7A 4ZUIA 4M8AA 1FL0A 1M4VA 1QWYA 2VQFL 1O80A 5EJWA 4PZ7A 2MNAA 1IW7D 3G4SA 1K8MA 3PIO3 1PTOH 1GO3E 1WTQA 3GTGB 2I07B 2O4XA 3V2TA 2LS01 1J9OA 1R4PB 2UUBL 1HQRD 5FO9B 1UE1A 1B2TA 3HOZG 1B1ZA 1HXYD 5EQ0A 4C3HH 3WDNA 3H91A 3K6OA 5IP9H 3IKJA 4TSSA 4TVAB 1EYCA 3PCOB 2L5TA 2Z6KA 3E9IA 5M5XH 4DR2Q 3P7JA 5J22A 4HCSA 2A6HD 3LNNA 2JA8B 4G7HC 1CSQA 3CP0A 3NP8A 1STYA 5CV5A 5DEHA 3T4AC 3S14B 1FYCA 4JI7L 4APVA 2A6EC 1ZYRD 2WFWA 3CC7A 4A3LH 3FPPA 1EIHA 4A3EG 2KBNA 1BCPD 3K7UC 1QZGA 4PV1C 4UPAA 3J81i 5C44B 3ICEA 4FF1A 5LMNQ 2CW0C 1Q1BA 2PQAB 4G7OC 2KOLA 3GTOH 4WJ3M 2M2LA 2KEDA 1KDCA 1MIUA 4R4TA 3VR2A 4IALA 3Q22A 1BCPF 3K8AA 5E4WC 2EPBA 1WCMG 1M1KC 4L5QA 4P75A 2JEAI 1XMOQ 3M4YA 2JA6H 1LACA 1Q12A 5G3LD 2ZTDA 4K14A 1TWAB 5D65A 5I2XA 5EPJA 1EQRA 2Z4IA 1BBUA 1K83H 1CI3M 1S5CD 2LFNA 1N36L 3MEFA 3IAYA 4DR6L 1ML0D 2EYFA 4QGUA 5IWAQ 1W2BA 1GOZA 2NVYH 4DK0A 3GQBA 1MJEA 5G3LF 1TWCH 1D1IA 4GS3A 4ULLA 2JP1A 2EXZA 4B3TQ 4DV2Q 1TXYA 3V96A 5IYCG 4LNQA 4KHZA 1K0SA 1Z47A 3Q8DA 2WAQG 5I9OA 2B63H 1PDQA 2LKVA 5EAYA 4HIMA 1SYBA 4F7XA 2ES2A 3RNUA 3J80i 4X65L 4DUYL 1PH5A 1VQ5A 3B6YA 2N49A 2EXDA 3PMFA 4Y52H 1E24A 3KK7A 1TS4A 4BBRH 5CR3A 1IL8A 1N8RC 5M3FH 5JJIA 2L15A 4OONA 4KJOA 3H6MA 5LHY1 2G9DA 2JK8A 4OEMB 4LFCL 2YTYA 4CKCA 1AN8A 4C3IH 3J81c 4LUVA 3N6RA 4OXPA 2QEXA 3BS1A 1QUQB 1YIJA 3KBGA 1VQNA 2R7DA 4R4QA 1A3VA 1PH4A 4A3FH 4X6AH 4KKUA 3ERQA 1AE3A 4BY1B 2Z9HA 2TSSA 4A3DB 2E2HH 5JVG3 3CQZB 1LTAD 1CQFA 4GLAC 2L11A 1A3UA 1X3FA 3MTSA 4RGOS 2EQSA 4LF9L 1YNXA 3KFUA 2EY5A 1OTCA 2HDLA 1X54A 1XMQQ 3HOYH 1VQ8A 1EOVA 2UUBQ 4DR3L 1EIGA 4JPBW 1EZ6A 2K5VA 2NVTH 1HNXQ 1STGA 4A3CG 2DJGC 2I5LX 5ELOA 2BCOA 2IHFA 3TREA 2B2WA 2PQAA 3S16H 2VW9A 4X66Q 1Y8PB 1K9MC 3LWEA 1KTKA 2H1EA 4HAEA 3A8KE 2F0KA 3ND9A 3IFDA 1IKLA 4BA1I 2UXCL 1CKOA 4JI7Q 4YY3L 4NB3A 1DM0B 1QILA 3MWYW 3HOVB 1E2VA 1B50A 4MZ9A 3GO5A 4C3JH 2UUAL 1EIFA 1TWFB 1P16A 1SJHD 4A3MH 4NXML 1PMRA 5IGBA 4XDXA 4DAYB 5CV8A 1IW7C 5C0XJ 1KAAA 4ME3A 3G48A 5IIFA 1YITA 2RHSB 3WOFA 1I4QA 2DY7A 3PIP3 1IHZA 2JA9A 1MSHA 2F3WA 2VUMG 2YU9H 4EQNA 1VQIA 3FVQA 5FLMH 3J80E 2XGTA 3CW2C 4XYQA 1Y1VH 4HJ7A 5IODA 4AIMA 1JT8A 3S9WA 3J80L 5K5PA 2A6HC 1HNWL 4ZAIA 1V8QA 3PGZA 1PTOD 3GV3A 1V1PB 2CKZB 5CBEE 3MXPA 4DR6Q 3SR1A 1L1OB 3S15B 1BCPC 2TMPA 1FNVA 1K3BC 2PYKA 4IPGA 2RBMA 3TS0A 3AQQA 2B2VA 2BA1A 2F0JA 1Q90A 1F2ZA 4C1NI 3S2HB 1PTOF 3I8ZA 2G9HD 3CAMA 4NKLA 5IP7H 1QUQA 1UE5A 1U4PA 1OO9B 2FMCA 3ONAB 5M5WB 1PYWD 2IJ0A 4X65Q 1OXTA 4MNOA 4DUYQ 4DV4Q 3TBIB 3GTLH 2RVLA 2CH4W 4PMWA 1ICFB 4WORA 1KXLA 1NSNS 4QJFA 3D4RA 3PF4A 2K4KA 4WRDA 2CQAA 3S17H 3BDOA 4IUTA 2AWNA 2Y0SB 4LFCQ 3D6CA 1HZCA 2K28A 1SJED 2KHSA 4TRDA 3D8GA 2K75A 2ZXPA 1PVOA 3I4NH 2KA7A 1PTOB 2CWAA 2B39A 2QILA 4K8JA 5JAVA 1WD1A 3DLLA 3HP3A 4QL5A 4LF9Q 4DNIA 3HOUH 2QDLA 1BBWA 3M3YB 1XPOA 5C0XH 3VA7A 4RG1A 1R4QB 4IURA 4E6IA 4QUFA 3I7FA 4ODGA 1JWUD 1LTID 4DR3Q 2M00A 5M5XB 1J5EQ 3M7GA 3MAQA 4C3HG 4R1JA 1D6EC 1KL9A 2Q2HA 5BN5A 2JA8H 4X62L 2F4VQ 5ELBA 2QF7A 5IGDA 2WB1B 5IT9c 4DAYA 1FJGL 3H3VI 1DGSA 2WACA 1PZJD 3S14H 3VYSA 4HJ9A 1ONLA 2E5LL 3I4MB 4LMQD 3TP5A 2HT1A 2DY8A 1YJWA 4A3IG 3M4PA 3Q23A 4JI8Q 1O7LA 4JYAQ 5IGGA 3R3OA 3H15A 5C44H 2UXCQ 4A3LG 4OWWB 4YY3Q 2Q2UA 2E76C 3GTOB 2JA5G 1SAPA 2UUAQ 4CHTB 5IT9E 1W3SA 4ZCKA 1PLFA 2N3SA 1MKHA 2F0QA 1IYJB 4NXMQ 5I2YA 2PNHA 3D0FA 2EVBA 1HNZL 3D4WA 2IL8A 5IT9L 3DHQA 1V1PA 4JI1L 4H7BA 3U9SA 1X3PA 5BN3A 2MJ8A 2JA6B 4K8IA 2AHOB 1GXDC 2Q8RE 3CCQA 4G57A 1B70B 1E1OA 2KHJA 4LF7L 1JOKA 1LT5D 3SK4A 1TWAH 4MHEA 1EZ8A 3K5NA 3C46A 3EROA 1CHQD 1QB5D 1K83B 2K03A 2FXQA
chains in the Genus database with same CATH topology
4V0BA 4HMIA 2K32A 1TWCB 3J7AV 3C3LA 3TP6A 1EY7A 2A69C 4BWGB 1NR4A 3KLSX 5DM73 5FOBB 2B63B 1BBXC 4NW2A 3OSOA 1TY0A 2XNAC 4FF4A 3H3VC 1CT1D 1EYAA 4BBRB 4KJNA 1Q8IA 3I3CA 1GUSA 3RLFA 4CJ2C 3PUWA 3TSSA 2MPMA 3O13A 4N9TA 1RTOA 4C3IB 3I72A 3SVMA 3MFYA 3DWQA 5E4XA 2RDFA 4A3FB 2RDHA 1PTOC 3HRZC 2E2HB 2AQ3B 2RKSA 4J6HA 1STBA 3NSWA 2IT1A 2MUYA 3AB9A 4RA8A 5EPKA 1AEXA 3HGBA 3SK5A 2KUMA 2NVTB 1SYEA 3KUPA 5IOCA 2K05A 1WTOA 3S16B 1B3AA 5J39A 2PCFB 5EKKA 3P1HA 2K1BA 3BVZA 5C3XA 3C1FA 4GZYC 4F87A 1BO0A 1LT4D 4A3MB 2F03A 4WJWA 4B08A 1BNZA 1D2BA 1EFID 4C3JG 5D3DA 1GHKA 2XSCA 1Q3LA 3K5OA 3NUCA 1EWCA 2A73B 5EBCA 5ELEA 2K04A 1HQMC 1Y1VB 2B2YC 1A15A 2NN6H 3FKIB 1STAA 3CKIB 1G6ZA 2EZVA 1T5XD 2J7ZA 1QNUA 4HSVA 2PMZB 4IUNA 4RKBA 1B44D 3DWAA 3VA5A 4ZK9B 1TS5A 1SMYD 4OO1H 1QCBD 1WTXA 1LLRD 4K2KA 4DNTB 1QE6A 1EY8A 4FNFA 1EEFD 1LTSD 3TDQA 3D6WA 5C5LA 3M7NA 2F0TA 3K5MA 3GTLB 2L1BA 4KY6A 3HEJA 3QOLA 1ZEQX 3C1EA 3W2DA 3S1NB 3H94A 3S17B 3K5LA 3I4LA 4WFN3 2L9HA 2NVXB 1HFNA 3DWPA 1Q1EA 3X3MA 3X3NA 3I4NB 2HUGA 1TQOA 1DOKA 2LMCB 1SDFA 3KBXA 3K7AB 4KN4C 1NCVA 4FF2A 1FD7D 2EY6A 4CGYB 2FINB 3KF8A 1NUCA 3HOUB 3K58A 1G8ZD 2B2UA 2K5QA 3S1QB 3Q6SA 1WVLA 4OHJA 2NTTA 1CTMA 1HPCA 4IUPA 5C0XG 2ENBA 2JSOA 2ZXOA 5I9PA 3T51B 3DEOA 4H13C 4ABNA 1CA6A 4JBWA 4QUCA 4OGQC 2PNRC 1HCZA 3HG9A 4IFDJ 2D2CC 1TR5A 5LL6S 2B2TA 3G7LA 5KIXA 1DOMA 4XT3B 4X3UA 3BDLA 4XTCS 1VMCA 1EU4A 3R2TA 5JEAJ 1CHPD 1D5ZC 1G2TA 5C5MA 2B2TC 5CMDA 3GP7A 4LJZC 2IX3A 3KLSA 1EL0A 2RSNA 1R9TB 5A35A 5LL6X 1JQYD 2F4IA 1GJXA 5C0XI 2RQXA 3CRLC 5KRUA 1Y1WB 2RDGA 1STNA 1CFMA 1GUOA 3SE0A 4RAUC 4RKLA 3SXHA 4FXKC 3FPUB 1CK1A 1H9RA 1DZ1A 4K5VA 1ILPA 1HFGA 3NHHA 4MN3A 4BA2I 4B9WA 1CZGA 4R8NA 1RD9D 2FJ2A 1LTGD 1GHJA 2FFKB 4A93B 1PFNA 3QJYA 1E2ZA 3CU7A 1IKMA 3TP7A 1ENFA 2A5HA 1B9NA 1EY9A 3GTKB 4IFDH 1SMYC 3W3AA 2QKIC 1DCZA 1ESFA 2JYOA 3FMCA 4XQNA 3P20A 1M8AA 3L9AX 1C48A 1UEAB 3QO2A 4FXGC 1RHPA 2MHVA 1JWSD 5JEAH 2FHTA 3EVQA 3A55A 2KQ3A 3KLRA 1SE3A 1EEID 5FO7B 2XN9C 4QIWB 3OPOA 2NZ1D 1SEBD 2N88A 3BZDB 2XRQD 5C4ZA 2F0FA 4PQXA 2B2WC 2Q8IB 2QCPX 3RMHA 2EY2A 3PUXA 3VYUA 1F2MA 2KCNA 5CV9A 4QF4A 1RKNA 1L0XB 4EVOA 1F9RA 2F1MA 1DXMA 3AU7A 1DOLA 2K33A 3OW7A 4A3JB 3PO2B 1MD2D 3NE5B 3OWEB 5ELFA 1JE4A 1EY6A 3NXWA 2I46A 3BG3A 4DU9A 2EYLA 3OMCA 4UAIA 3OHXC 1DONA 1AZQA 5K36G 5F2DA 2PO4A 4BBSB 1SE4A 1KNAA 1VDZA 4B9XA 1ZYRC 1TS2A 4RCNA 2O2LD 4A3KB 3GTJB 5C3EB 5CYUA 3VR4A 4OO1G 1GUNA 4ZQ3A 2B2VC 2EJFC 2L0CA 4CJ0B 5DNFA 1O7YA 4R9WA 1EOTA 2R92B 1WTWA 5CGKA 1Y8OB 2F0PA 3NWSA 1QG7A 1HRJA 2PZUA 3NTIA 2NB0A 1U4MA 1SYFA 3E6ZX 5M5YB 2O5IC 1ENAA 5HURA 2Z4HA 4KMUC 5FLXE 2NWGA 1RODA 3H0GB 4OO1I 5FLXL 1SYCA 2KVMA 3DM1A 4K6LA 3BYYB 3VR3A 2XWBB 3DEPA 3D31A 1NAPA 1FNWA 4H44C 3V05A 4RFBA 5EKIA 1VCIA 5ISRA 3NPPA 1H9SB 1W6JA 3MC0B 4AYBB 4A3BB 1F2YA 3OIQA 3M85A 3PUVA 1KDAA 2SEBD 1Z7TA 3MVVA 5ELDA 1U4LA 3EJIA 1J8IA 4JK1C 1SNDA 1PXUA 3HKZB 1H9KA 4XQQA 1S5BD 3J7AF 4KTAA 2X69A 2R7ZB 5D14A 4DK1A 3K0YA 2EYMA 5KEEA 2RSOA 1OXUA 2BE5D 3IL8A 1SNQA 2L12A 4ID6A 4L6TB 3SEBA 1ESRA 2FMMA 4X3KA 1HTLD 1I6HB 4RCOA 1RF2D 4XT1B 1UAPA 2K7VA 1JR0D 1EWHA 1DYQA 1D1KA 4C2MB 1V1OA 2JXMB 5C4XB 3HOXB 2Q8TA 3NTHA 1F9SA 1II3A 2N55A 2WINB 2OXPA 3OMGA 1GUTA 1D5MC 1SNMA 3ND8A 2ZT9C 1UNSA 1TIID 5CBAE 2VB3X 3OIPA 3EQLC 4KD4A 2K01A 1S5ED 3FRPB 1CQVA 2L55A 4KHVA 1Y69U 3A8IE 1I3QB 2XIWA 1JOOA 1UUPA 3IFTA 1A6XA 4KK7A 4C3IG 5IGCA 1HA5A 3S1MB 1HHVA 4PNYA 1XX8A 2VB2X 4HSPA 3UI2A 3OOCA 4ZYSA 4RGTA 2F0GA 3QB3A 1KLUD 2EYJA 5HGTA 2R93B 2WKDA 4IFDG 3SK6A 1ET9A 2KECA 4IQZA 1RCVD 5EPLA 1SSOA 2IX0A 1BR9A 1SNCA 3T53B 1I4GA 1PRTB 1FGBD 3R93A 2OT2A 2IW3A 1EY4A 3U9OA 3BYTB 3VR6A 2QEJC 2E74C 4LAAA 2DNEA 4L63B 1OXVA 4K5WA 5CC4A 3FEWX 2EYPA 3E0JA 3HS0C 4IFDI 5I6YA 3WOEA 3QOJA 1F2LA 2A74C 4C56C 3I70A 1RJTA 4PMCA 3FDTA 3N52A 2L4NA 4KD3A 4EGVA 4ILWA 2SNMA 3RZOB 3T56B 5FO8B 4XIGS 1QNKA 1IYVA 2WP8J 1QOHA 2F0SA 1RTNA 3QIAA 2YYZA 5CV6A 1VF7A 4EQPA 4NDXA 1VMPA 1ICWA 1SXTA 1I6VC 4J8QA 2BE5C 5I6WA 4L8JA 1TVXA 3PO3B 4ZLTF 2HCCA 1LTBD 1PFMA 1TS3A 1K8OA 5T1IA 2BDOA 1QJOA 5KYLA 3MXGA 1EY5A 2JA7B 4HMJA 1LTRD 4KI0A 1TT2A 3Q0AA 1XWEA 5KNDA 1LV9A 1CZWA 4DAPA 3HOZB 4I7ZC 3TZUA 4ZUJA 1F9PA 2DNCA 3NQTA 2R6GA 4M1UB 4ZKBB 1E2WA 2B2UC 4V190 3I90A 4OIKA 2R61A 2BOSA 3DXJC 4OIJA 1MGSA 2RA4A 2M9VA 4FVMA 1STEA 2F0EA 1VF5C 3GTPB 2J0TD 4A3EB 5FK9C 3DUZA 1B4OA 3MXNA 4XYOA 2E75C 4R8IA 4K6DA 4CBVA 4LK1C 2A68D 2Z1CA 2SDFA 4C1NK 2F3VA 3P75A 4HEDA 1DD2A 2EOTA 1WCMB 5ELCA 3MA2B 2NUCA 5COYA 1SFOB 1W6KA 1F77A 1TU2B 2ID0A 1A3TA 5TSSA 4S3SA 4FP5D 2C9OA 3TMEA 2HCIA 5KGUA 3URYA 1YNND 1S5FD 3EA6A 2CHBD 3A8JE 3RUZA 3I73A 3MXUA 2WAQB 5EKLA 2F0OA 4H0LC 3GTMB 1I50B 1SE2A 4PMBA 1EY0A 2EJGC 3GV6A 2F0UA 4EQOA 3SK8A 1BCPB 2D9UA 5I4DA 5CV4A 3I91A 2MP1A 2VNUD 4IUUA 1SNPA 3BDCA 2EYOA 2Z8LA 1B9MA 1JWMD 4NMZA 1BQQT 1I4PA 2ICEC 4Q5VA 5JOBA 2R3ZA 2GA4B 2E2JB 3BVMA 5IGEA 2IPKD 5C6AA 1C4QA 4RGMA 1DJRD 3PUYA 1T5EA 4KKSA 5JPNC 4X3TA 3J7YW 1RDPD 3MHBA 2J4XA 3J81E 4RHRA 1B53A 4K5XA 1PZKD 3J81L 3GTQB 1IYUA 3CRKC 1ZKOA 4O1NA 1JC7A 4OL7A 1KNEA 4RHSA 4FXDA 3LWUA 1AP0A 1U9RA 2BA0A 2WKCA 1AFPA 1LO5D 2A69D 3R8BA 1O78A 2E2IB 3NBHA 5E1FA 4KY7A 2F0LA 4KY5A 5AFWA 3RD4A 4IUQA 1FR3A 2K6AA 3NBIA 2VUMB 2F0NA 2H4OA 4RWSC 1YNJD 3VYTA 5CV7A 2NN6G 4DN4M 3T16A 1BXTA 4U68A 1BOSA 2K5WA 5C4HA 1WTPA 4RGNA 4IN3A 4MIUA 2NVQB 3AMUA 2SOBA 4XQJA 1JICA 1MBYA 1JORA 4KN7C 2XWJB 1CA5A 1XXGA 1C8CA 4DA2A 2ICIA 2A68C 4F8MA 1JCKB 1HUNA 4I65A 5DAUA 1XYIA 4TQUS 4HTHA 4ZRZA 4DNRB 1JB3A 5NUCA 3A7AB 2NN6I 1I4RA 1TWGB 3Q24A 3L7ZC 4KKTA 2B8GA 3S2DB 3NK9A 3F2UA 2E2DC 5C3WA 1G91A 2LY7A 1ZXTA 2V4DA 4DXGA 3CHBD 1YNNC 2F0HA 3TZDA 2EJMA 3M4OB 3EFXD 3TP8A 3A54A 5J1ZA 1Y8NB 4CJ1B 2HDMA 4KV6A 2PW7A 3JAME 3K57A 1LABA 1S4ZA 3TN2A 1LT6D 1WTRA 3MEHA 3JAML 4C3HB 1MI2A 4G7ZC 4P2CB 2O5JC 1PZID 4DAVA 3SDZA 2BDNA 3DMUA 1WD0A 2JE6I 4YIJA 4Y7NB 3NQIA 4A3IB 2IWHA 4UDUC 1OXXK 2F0WA 1JOQA 2D62A 2SNSA 1A2UA 2XRSD 4HCEA 1EQVA 2JA5B 5M9OA 3ITPA 1FNUA 2OEOA 1H9MA 2JEBI 2EDGA 1ENCA 1S5DD 3OWFA 1BF4A 4HR7B 2PZWA 1ILQA 4Z9CB 1GUGA 3LX0A 2X6LA 1I4HA 4QB4A 1HTPA 2C5CA 5JVH3 2AUKA 4BS9A 4X3SA 1KDBA 4IZ8A 4XXEA 2AQ1B 2F0MA 4NP5A 3E5SA 2AUJD 2F0DA 2NVYB 3K59A 1PRTD 5T1GA 1SNOA 1O7ZA 1V43A 3MZ5A 1H9JA 2K5DA 4ME5A 4A3GB 1TY2A 5JJZA 1SYDA 1ET6A 3G6JB 1PRTF 4FYDA 4QCLA 4J1MA 1HUMA 1KLGD 4FO2A 5M3FB 1YNJC 5DM63 3D4DA 5A2QE 3R2IA 2WIIB 3SHLA 2EE1A 2KJXA 2A6ED 1TWHB 4IUVA 1U4RA 5A2QL 5BN4A 3NTKA 1H9SA 5C4JB 1NR2A 1D5XC 3D3RA 4CKBA 2CW0D 1AZPA 2NTSA 1I4XA 2KCCA 5KNCA 2F0VA 2PQEA 2ZXRA 4HN7A 4CKEA 3QWNA 4DF7A 3HOYB 5JEAG 3GD7A 1F9QA 5D3IB 2EY1A 3NWTA 1EU3A 2KEEA 2MGSA 2OF1A 2DN8A 1EYDA 2VXWA 1LT3D 5E3FA 3C2PA 4DFAA 1WTVA 5KNBA 4DXFA 1X3QA 3PV0A 4N9PA 3PUZA 1BDOA 2IX1A 4DGZA 4U673 4C3JB 1Z6HA 4BY7B 5FKAC 4TKOB 3RZDB 1G291 1LTTD 5EBDA 2B2YA 4FF3A 1G2SA 1HA6A 2HQEA 2PW5A 4QMGA 2YU9B 5K36H 3QG1A 3VR5A 1EQTA 1L0YB 1CM9A 4Q0FA 5JPMC 3L3OC 3T13A 2WV6D 2EYHA 1A2TA 3BVGA 4F88A 2QDBA 1MSGA 2XVSA 5CORA 1STHA 5IGFA 3ZYYX 3A7LA 2F0IA 1SBBB 3HZXA 1GUWA 3H09A 5EGTA 2X6GA 2PZTA 4K2LA 1SYGA 2CVRA 2AQ2B 3A56A 4G4KA 4RH6A 2PPBC 5M3MB 1XTCD 1TKWB 1PFBA 3HOWB 5KYIA 2B8FA 1E0BA 2NBFA 2D5DA 3S1RB 2NYZD 1AW7A 4O42A 3MFGA 2AWOA 3VYRA 1BUVT 4ZKCB 1X32A 1KABA 1OXSC 1PRTC 4ZUIA 4M8AA 1M4VA 1QWYA 1O80A 5EJWA 1IW7D 1K8MA 3PIO3 1PTOH 1WTQA 3GTGB 2I07B 2O4XA 3V2TA 2LS01 1J9OA 1R4PB 1HQRD 5FO9B 1B2TA 1B1ZA 1HXYD 5EQ0A 3WDNA 3H91A 3K6OA 3IKJA 4TSSA 1EYCA 2L5TA 3P7JA 5J22A 4HCSA 2A6HD 3LNNA 2JA8B 4G7HC 3NP8A 1STYA 5CV5A 5DEHA 3T4AC 3S14B 1FYCA 2A6EC 1ZYRD 1EIHA 3FPPA 1BCPD 4PV1C 5C44B 4FF1A 2CW0C 1Q1BA 4G7OC 2KOLA 2M2LA 2KEDA 1KDCA 3VR2A 4IALA 3Q22A 1BCPF 5E4WC 2EPBA 2JEAI 3M4YA 1LACA 1Q12A 5G3LD 4K14A 1TWAB 5D65A 5I2XA 5EPJA 2Z4IA 1CI3M 1S5CD 2LFNA 3IAYA 1ML0D 2EYFA 1GOZA 4DK0A 3GQBA 5G3LF 1D1IA 4ULLA 2JP1A 2EXZA 3V96A 4KHZA 1Z47A 5I9OA 1PDQA 2LKVA 1SYBA 4F7XA 3PMFA 3KK7A 1TS4A 5CR3A 1IL8A 4KJOA 3H6MA 5LHY1 2G9DA 4CKCA 1AN8A 3N6RA 3BS1A 3KBGA 1A3VA 4KKUA 3ERQA 4BY1B 2TSSA 4A3DB 5JVG3 3CQZB 1LTAD 1CQFA 2L11A 1A3UA 3MTSA 4RGOS 2EY5A 2HDLA 1EIGA 1EZ6A 1STGA 2BCOA 2B2WA 1Y8PB 3LWEA 1KTKA 2H1EA 4HAEA 3A8KE 2F0KA 3ND9A 3IFDA 1IKLA 4BA1I 1DM0B 1QILA 3MWYW 3HOVB 1E2VA 1B50A 3GO5A 1TWFB 1SJHD 1PMRA 5IGBA 4XDXA 5CV8A 1IW7C 5C0XJ 1KAAA 5IIFA 3WOFA 1I4QA 2DY7A 3PIP3 1IHZA 1MSHA 2F3WA 4EQNA 3FVQA 3J80E 4XYQA 5IODA 3S9WA 3J80L 5K5PA 2A6HC 4ZAIA 1V8QA 1PTOD 3GV3A 1V1PB 5CBEE 3MXPA 3SR1A 3S15B 1BCPC 2TMPA 1FNVA 2PYKA 2RBMA 2B2VA 2BA1A 2F0JA 1Q90A 1F2ZA 4C1NI 3S2HB 1PTOF 3I8ZA 2G9HD 4NKLA 1U4PA 1OO9B 2FMCA 3ONAB 5M5WB 1PYWD 2IJ0A 1OXTA 3TBIB 2RVLA 4PMWA 4WORA 1NSNS 3D4RA 4WRDA 2CQAA 3BDOA 4IUTA 2AWNA 2Y0SB 3D6CA 2K28A 1SJED 2KHSA 4TRDA 3D8GA 2ZXPA 2KA7A 1PTOB 2B39A 2QILA 4K8JA 5JAVA 1WD1A 3HP3A 3M3YB 5C0XH 3VA7A 1R4QB 4IURA 4E6IA 4QUFA 4ODGA 1JWUD 1LTID 2M00A 5M5XB 3M7GA 3MAQA 4C3HG 1D6EC 5BN5A 5ELBA 2QF7A 5IGDA 2WB1B 4DAYA 2WACA 1PZJD 3VYSA 1ONLA 3I4MB 4LMQD 3TP5A 2DY8A 3Q23A 1O7LA 5IGGA 3R3OA 2E76C 3GTOB 1SAPA 4CHTB 5IT9E 1PLFA 2F0QA 5I2YA 2EVBA 3D4WA 2IL8A 5IT9L 3DHQA 3U9SA 1V1PA 4H7BA 1X3PA 5BN3A 2MJ8A 2JA6B 4K8IA 1GXDC 2Q8RE 4G57A 1JOKA 1LT5D 3SK4A 4MHEA 3K5NA 1EZ8A 3C46A 3EROA 1CHQD 1QB5D 1K83B 2K03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ1 B;  2HDL A;  2B2U A;  1SSO A;  2HCI A;  2HDM A;  5EPL A;  1S4Z A;  4ZLT F;  2FFK B;  2RVL A;  3Q6S A;  1WVL A;  1HUM A;  2HCC A;  2X69 A;  3TN2 A;  1BNZ A;  5D14 A;  1PFN A;  1PFM A;  1WTR A;  5T1I A;  1EIG A;  1MSG A;  5AFW A;  1NR4 A;  2KOL A;  1MI2 A;  4IUP A;  2M2L A;  2KED A;  3R93 A;  2RSO A;  1IKM A;  5COR A;  2EE1 A;  2KEC A;  4IUV A;  3IL8 A;  1Q3L A;  1U4R A;  4IUT A;  4IUQ A;  5E4W C;  2B2W A;  1BBX C;  2EPB A;  2BDN A;  4NW2 A;  1WD0 A;  2L12 A;  2K28 A;  1NR2 A;  3DEO A;  1ESR A;  2FMM A;  4X3K A;  1CA6 A;  1GUW A;  3LWE A;  2H1E A;  3GV6 A;  2X6G A;  4QUC A;  2K04 A;  4HAE A;  2B2V C;  4RWS C;  2B2Y C;  1A15 A;  2D9U A;  5D65 A;  1AZP A;  4XT1 B;  4CJ0 B;  2CVR A;  2JYO A;  3IFD A;  5EPJ A;  5DNF A;  1O7Y A;  4R9W A;  4DN4 M;  1IKL A;  3HP3 A;  1WD1 A;  1LV9 A;  4U68 A;  3I91 A;  1M8A A;  2MP1 A;  1G6Z A;  3I3C A;  4IUU A;  3MWY W;  1WTP A;  1EOT A;  2B2T A;  1B50 A;  3G7L A;  3QO2 A;  1RHP A;  2J7Z A;  4HSV A;  1DOM A;  1ML0 D;  1PFB A;  4CJ2 C;  1WTW A;  2MPM A;  4ZK9 B;  4XT3 B;  2Q8T A;  1F9P A;  1F9Q A;  2FHT A;  1RTO A;  4X3U A;  1VMC A;  4ZKB B;  1QG7 A;  1E0B A;  1F9S A;  2B2U C;  4IUR A;  2JP1 A;  4XDX A;  4QUF A;  1HRJ A;  1WTX A;  3I90 A;  1JIC A;  2N55 A;  4OIK A;  3SVM A;  1BF4 A;  5E4X A;  2NYZ D;  1F2L A;  2KEE A;  1C8C A;  2DY7 A;  1ILQ A;  1QE6 A;  2MGS A;  4O42 A;  1U4M A;  1MGS A;  2B2T C;  2RA4 A;  4OIJ A;  5CMD A;  2R3Z A;  2X6L A;  1MSH A;  2NZ1 D;  1PDQ A;  1EL0 A;  5CBA E;  2N88 A;  2RSN A;  4ZKC B;  1HUN A;  1G2T A;  1X32 A;  1RJT A;  2VXW A;  2B2W C;  3D6W A;  4LMQ D;  2K01 A;  2DY8 A;  2NWG A;  3FDT A;  1WTV A;  4X3S A;  3N52 A;  4RA8 A;  1B4O A;  2L4N A;  1O80 A;  1ROD A;  5EJW A;  5EPK A;  1XYI A;  2L1B A;  1WTQ A;  4R8I A;  1X3Q A;  1F9R A;  2KVM A;  1IL8 A;  1J9O A;  1DOL A;  2KUM A;  3DM1 A;  1QNK A;  4ZAI A;  4RAU C;  3DEP A;  4X3T A;  1B2T A;  1NAP A;  1SAP A;  3GV3 A;  2SDF A;  5CBE E;  3KUP A;  2XIW A;  5EQ0 A;  3FPU B;  3H91 A;  1RTN A;  1CA5 A;  1PLF A;  1JE4 A;  4HED A;  2K05 A;  1WTO A;  5T1G A;  5EKI A;  2EOT A;  1B53 A;  3F2U A;  2IL8 A;  2L9H A;  1B3A A;  1HFN A;  1O7Z A;  2B2V A;  2B2Y A;  1X3P A;  5COY A;  1DZ1 A;  1G91 A;  1ILP A;  1HHV A;  1ZXT A;  2MJ8 A;  1G2S A;  1HA6 A;  1XX8 A;  3P7J A;  1HFG A;  4UAI A;  4HCS A;  3UI2 A;  1VMP A;  1ICW A;  2Q8R E;  2K1B A;  3TZD A;  4MN3 A;  3I8Z A;  1DON A;  2HUG A;  1AZQ A;  4MHE A;  1DOK A;  1U4L A;  1J8I A;  1SDF A;  3KBX A;  5JJZ A;  1KNE A;  1NCV A;  1U4P A;  2L11 A;  1EIH A;  3MTS A;  1EQT A;  2FJ2 A;  3ONA B;  1AP0 A;  2FIN B;  1CM9 A;  2K03 A;  1BO0 A;  1KNA A;  1TVX A; 
#chains in the Genus database with same CATH topology
 1Y1W H;  3J7A 5;  4V0B A;  4HMI A;  3NEN A;  2K32 A;  1TWC B;  3J7A V;  3CCL A;  3TP6 A;  3C3L A;  4I7A A;  1VQ9 A;  1EY7 A;  2A69 C;  4GLV B;  4BWG B;  1NR4 A;  2E8G A;  3KLS X;  1K0R A;  5DM7 3;  5FOB B;  2B63 B;  1BBX C;  4NW2 A;  4KHP Q;  3OSO A;  1TY0 A;  2XNA C;  4FF4 A;  3H3V C;  4A3G G;  4GN4 B;  5HGQ A;  1CT1 D;  1A63 A;  1B7Y B;  1X3E A;  1EYA A;  4BBR B;  4KJN A;  1Q8I A;  3I3C A;  4N8F A;  1GUS A;  3RLF A;  4CJ2 C;  3PUW A;  3TSS A;  2MPM A;  3O13 A;  4N9T A;  1RTO A;  4C3I B;  5M3F G;  3K0X A;  3I72 A;  4JI0 Q;  3SVM A;  3MFY A;  3DWQ A;  5E4X A;  2RDF A;  2Z6B A;  4A3F B;  1JJG A;  2RDH A;  1PTO C;  3HRZ C;  2E2H B;  2AQ3 B;  2RKS A;  4J6H A;  4JI2 L;  4A3D H;  1IL2 A;  1STB A;  4DV1 L;  4JI5 Q;  3NSW A;  2IT1 A;  2MUY A;  3AB9 A;  3GTK H;  2V1C C;  4RA8 A;  5EPK A;  1AEX A;  4IOC A;  3HGB A;  1GKH A;  4GOP C;  2D0P A;  3SK5 A;  2KUM A;  2NVT B;  1SYE A;  3KUP A;  4AQY L;  4CDF C;  3HOY G;  5IOC A;  2K05 A;  1WTO A;  3AEV A;  3OTO L;  3S16 B;  1B3A A;  4X64 L;  5J39 A;  1K73 C;  2OTJ A;  2PCF B;  1HZA A;  5EKK A;  3P1H A;  2K1B A;  5LMU Q;  3KF8 B;  4X62 Q;  3BVZ A;  2R7F A;  5C3X A;  3C1F A;  2E5L Q;  4GZY C;  4UP7 A;  4F87 A;  1BO0 A;  1UEB A;  2VQE Q;  1LT4 D;  4A3M B;  2F03 A;  1CSP A;  4WJW A;  4B08 A;  4DK6 C;  1M90 C;  1BNZ A;  5GAG C;  1D2B A;  1EFI D;  4C3J G;  1KD1 C;  5D3D A;  3PO2 H;  2XSC A;  1GHK A;  4BY7 G;  1Q3L A;  3K5O A;  3NUC A;  1EWC A;  1KQS A;  4JI1 Q;  3BJU A;  2A73 B;  5EBC A;  5ELE A;  2K04 A;  1HQM C;  1Y1V B;  2B2Y C;  4LF5 Q;  1A15 A;  4LF7 Q;  5IWA L;  2NN6 H;  3FKI B;  2ZM6 L;  1STA A;  5FLM G;  2YTV A;  3CKI B;  2K5N A;  1G6Z A;  2EZV A;  1HZB A;  1T5X D;  1QNU A;  2J7Z A;  4HSV A;  2PMZ B;  4IUN A;  4RKB A;  2BH2 A;  2K52 A;  1QVG A;  1B44 D;  3DWA A;  3VA5 A;  1HZ9 A;  4ZK9 B;  1TS5 A;  3KYH C;  1SMY D;  1YVC A;  4OO1 H;  1QCB D;  3VDY A;  3GTJ H;  4JC0 A;  4P73 A;  1WTX A;  1LLR D;  4K2K A;  4DNT B;  1PH1 A;  1QE6 A;  4JBJ A;  1EY8 A;  1KIX A;  4FNF A;  3S2H H;  1EEF D;  2Z0S A;  1LTS D;  3TDQ A;  1V1Q A;  3D6W A;  5C5L A;  1G6P A;  3M7N A;  2F0T A;  2QGQ A;  3K5M A;  3GTL B;  5IP7 G;  2L1B A;  4KY6 A;  3HEJ A;  2N8N A;  3QOL A;  1ZEQ X;  3STB C;  3C1E A;  3W2D A;  5M3M G;  1I5F A;  2R92 H;  3H94 A;  3S1N B;  3K5L A;  3S17 B;  3I4L A;  3HOW G;  4WFN 3;  2L9H A;  2NVX B;  1HFN A;  3DWP A;  3J81 j;  1Q1E A;  4B3M Q;  3X3M A;  3X3N A;  1S72 A;  3I55 A;  3CC2 A;  4GLX A;  3I4N B;  1XMQ L;  2HUG A;  1TQO A;  1DOK A;  2LMC B;  3TEH B;  1SDF A;  3KBX A;  3K7A B;  1WOC A;  4KN4 C;  2VY3 A;  4JI2 Q;  4DV1 Q;  1NCV A;  4FF2 A;  1FD7 D;  1N9W A;  2EY6 A;  3RN5 A;  4CGY B;  2FIN B;  3KF8 A;  1NUC A;  3HOU B;  3KF6 B;  3K58 A;  1HNX L;  1G8Z D;  1YJ9 A;  2B2U A;  3M3Y H;  2K5Q A;  3S1Q B;  3Q6S A;  1WVL A;  4OHJ A;  2NTT A;  2BH8 A;  1CTM A;  4X66 L;  1HPC A;  4IUP A;  3FP9 A;  4AQY Q;  5C0X G;  2ENB A;  1VQL A;  2JSO A;  2ZXO A;  1BKB A;  2KCM A;  5I9P A;  4YWL A;  3OTO Q;  1JB7 A;  5BR8 L;  3T51 B;  4X64 Q;  3DEO A;  4H13 C;  4ABN A;  1CA6 A;  1Q46 A;  3I4M H;  4A3B H;  4JBW A;  4QUC A;  1SE8 A;  3KLW A;  2PNR C;  4OGQ C;  2JA8 G;  4JW0 A;  1HCZ A;  2Z6K C;  3HG9 A;  4IFD J;  2D2C C;  1TR5 A;  5LL6 S;  2B2T A;  3G7L A;  5KIX A;  1DOM A;  3KJO A;  5JJK A;  1Q86 C;  4XT3 B;  5C44 G;  4X3U A;  3BDL A;  4XTC S;  1VMC A;  2R7Z H;  1EU4 A;  2XTI A;  3R2T A;  5JEA J;  1CHP D;  1D5Z C;  1G2T A;  2A8V A;  5C5M A;  2B2T C;  5CMD A;  3GP7 A;  4LJZ C;  2IX3 A;  1BVS A;  3KLS A;  2RCN A;  1EL0 A;  2H5X A;  2RSN A;  1R9T B;  1HJP A;  5A35 A;  5LL6 X;  1JQY D;  2F4I A;  4DV3 L;  1GJX A;  5C0X I;  2RQX A;  3CRL C;  5KRU A;  1Y1W B;  2RDG A;  1I6H H;  1STN A;  1CFM A;  4BXX G;  1GUO A;  2ZM6 Q;  4R4C A;  4C2M H;  4K0K Q;  2CQO A;  3SE0 A;  3TRZ A;  4RAU C;  4RKL A;  3SXH A;  4FXK C;  5LMN W;  3FPU B;  1CK1 A;  2ASB A;  3PIP A;  1H9R A;  2Y0S E;  1EQQ A;  1DZ1 A;  4K5V A;  1ILP A;  3WWV A;  1HFG A;  3NHH A;  4MN3 A;  4BA2 I;  4DV4 L;  2UXD L;  4B9W A;  1CZG A;  4R8N A;  2DJF C;  1X65 A;  4IPD A;  1RD9 D;  2FJ2 A;  4IPC A;  4RMF A;  3AFQ A;  1I94 L;  1LTG D;  3J7Z C;  1GHJ A;  2FFK B;  2QW7 A;  4A93 B;  1PFN A;  3QJY A;  1E2Z A;  1Q8K A;  3CU7 A;  3KF6 A;  1NY4 A;  4JOI A;  1IKM A;  3TP7 A;  4UP9 A;  1T9H A;  1NBW A;  1QZH A;  1ENF A;  1Q81 C;  1JMC A;  4DV7 L;  2WB1 E;  1Q7Y C;  2GN5 A;  2A5H A;  1Q82 C;  1AH9 A;  1B9N A;  4DR5 L;  3S1M H;  1EY9 A;  5GAD C;  3GTK B;  4IFD H;  1SMY C;  4JOI C;  1VQB A;  3W3A A;  2QKI C;  1DCZ A;  4BY1 G;  1ESF A;  2JYO A;  4A3D G;  5IYB H;  3FMC A;  4XQN A;  3P20 A;  3RN2 A;  3UDX A;  1M8A A;  3L9A X;  1JE5 A;  1C48 A;  4OEL B;  1J5E L;  1UEA B;  3QO2 A;  4FXG C;  1RHP A;  1MJC A;  2MHV A;  1PYB A;  1JWS D;  2F4V L;  5JEA H;  2FHT A;  3EVQ A;  3A55 A;  1HR0 L;  3KLR A;  2KQ3 A;  1SE3 A;  1EEI D;  5FO7 B;  2XN9 C;  3T1H Q;  4QIW B;  2B29 A;  3CC4 A;  2K50 A;  3OPO A;  4JI8 L;  1YHB A;  4JYA L;  3EIV A;  2NZ1 D;  1SEB D;  2N88 A;  3BZD B;  2XRQ D;  5BR8 Q;  2F0F A;  5C4Z A;  4PQX A;  2B2W C;  2Q8I B;  2QCP X;  3RMH A;  2EY2 A;  3PUX A;  2F52 A;  4JG2 A;  3VYU A;  1F2M A;  1YI2 A;  2KCN A;  1SRO A;  5CV9 A;  3I2Z A;  4QF4 A;  3J80 c;  1RKN A;  1V9P A;  1X3G A;  1L0X B;  4EVO A;  1F9R A;  2F1M A;  1DXM A;  3KJP A;  4B3R L;  3AU7 A;  1DOL A;  2K33 A;  3OW7 A;  1PYS B;  4A3J B;  3HOV G;  3PO2 B;  1MD2 D;  3NE5 B;  3OWE B;  5ELF A;  1JE4 A;  1ASY A;  1EY6 A;  1PH8 A;  3NXW A;  2I46 A;  1VQ4 A;  4DR4 L;  3BG3 A;  2QA4 A;  3PO2 G;  4DU9 A;  2EYL A;  3OMC A;  1K8A C;  3W1G A;  4UAI A;  2I5M X;  4DK3 C;  1XNR Q;  3OHX C;  2HQL A;  3AFP A;  1DON A;  1AZQ A;  3ERS X;  3FKI H;  5GAH C;  1YHQ A;  5K36 G;  5F2D A;  2PO4 A;  4DV3 Q;  1CKM A;  3A74 A;  4BBS B;  1SE4 A;  1KNA A;  1VDZ A;  1VQM A;  3CPW A;  4B9X A;  1ZYR C;  2F3I A;  1TS2 A;  3PF5 A;  4RCN A;  1PHJ A;  3RZO H;  3M4Q A;  2O2L D;  1VQ6 A;  2K5H A;  4A3K B;  3GTJ B;  4KHP L;  5C3E B;  4LW1 A;  4GN5 A;  5CYU A;  3VR4 A;  3CCE A;  1SLJ A;  1VQG A;  4OO1 G;  1N32 L;  3JC6 6;  1GUN A;  4OWT B;  1U5K A;  3PSI A;  4ZQ3 A;  2B2V C;  2EJF C;  4DKA C;  2L0C A;  2UXD Q;  4CJ0 B;  5DNF A;  1O7Y A;  4R9W A;  4NXN L;  3NEM A;  1EOT A;  4JI0 L;  1E1T A;  2ZTC A;  1P8L A;  2R92 B;  1WTW A;  1I94 Q;  3S1N H;  3PO3 H;  4WJ4 A;  4LUO A;  1N34 L;  5CGK A;  1Y8O B;  2F0P A;  3NWS A;  1QG7 A;  3CCS A;  1HRJ A;  4LF8 Q;  1E7Z A;  2PZU A;  2NVX H;  5IYD H;  3NTI A;  4JI5 L;  2NB0 A;  1U4M A;  1SYF A;  3E6Z X;  5M5Y B;  4DV7 Q;  2Y0S G;  4JBK A;  2O5I C;  2Q2I A;  1ENA A;  2OQ0 A;  5HUR A;  3K7A H;  4DR5 Q;  2Z4H A;  4KMU C;  4QQB X;  4YWK A;  5FLX E;  2NWG A;  1VQC A;  3G6E A;  1ROD A;  3H0G B;  4OO1 I;  2YTX A;  5FLX L;  1SYC A;  3S1Q H;  2KVM A;  3DM1 A;  4K6L A;  3BYY B;  3VR3 A;  2XWB B;  3DEP A;  3D31 A;  1NAP A;  1FNW A;  4H44 C;  1SRU A;  2AKW B;  3V05 A;  1WJJ A;  5LMU L;  4DV6 L;  5IP9 G;  1VQK A;  4RFB A;  5EKI A;  1VCI A;  5ISR A;  1HR0 Q;  4HIO A;  3NPP A;  2P5Z X;  1U0L A;  1H9S B;  5L37 A;  1W6J A;  4L5T A;  3MC0 B;  4AYB B;  4A3B B;  2JQO A;  3EBE A;  1F2Y A;  3OIQ A;  3M85 A;  2VQE L;  3PUV A;  1KDA A;  2SEB D;  1Z7T A;  3MVV A;  2WB1 G;  5ELD A;  1XPU A;  1U4L A;  3EJI A;  1J8I A;  4JK1 C;  2ATW A;  1SND A;  2MO0 A;  4A3E H;  1PH3 A;  3I4M G;  1PXU A;  2EIF A;  3HKZ B;  2K14 A;  1H9K A;  4XQQ A;  2PMZ E;  1S5B D;  3J7A F;  4KTA A;  1SR3 A;  2X69 A;  2R7Z B;  4B3R Q;  5D14 A;  1QVC A;  4DK1 A;  4O2D A;  3K0Y A;  2EYM A;  5KEE A;  1L1O A;  2RSO A;  4FDB A;  3UDF A;  1OXU A;  2BE5 D;  3IL8 A;  2DUD A;  4LF5 L;  4DAM A;  1SNQ A;  4EQ5 A;  4DUZ Q;  4DR4 Q;  1WCM H;  2L12 A;  4ID6 A;  4L6T B;  3SEB A;  3QR8 A;  1ESR A;  2FMM A;  4X3K A;  1R9T H;  2JA6 G;  1HTL D;  1I6H B;  4YHH Q;  4RCO A;  4B3S L;  3F2B A;  1L1O C;  1RF2 D;  4XT1 B;  1UAP A;  2K7V A;  1JR0 D;  1EWH A;  1DYQ A;  1D1K A;  4C2M B;  1V1O A;  2JXM B;  5C4X B;  3HOX B;  2Q8T A;  3NTH A;  4P74 A;  1F9S A;  1II3 A;  2N55 A;  2CWP A;  1PV4 A;  2WIN B;  2OXP A;  3OMG A;  3L0O A;  1GUT A;  5IYC H;  1YJN A;  2ZJQ A;  1D5M C;  1SNM A;  3ND8 A;  2B63 G;  2AMC B;  2ZT9 C;  1IBM L;  1UNS A;  1D7Q A;  3GTM H;  1TII D;  2A19 A;  5CBA E;  1N32 Q;  2VB3 X;  1I50 H;  3OIP A;  3EQL C;  4KD4 A;  1VQJ A;  2K01 A;  2RHQ B;  1E22 A;  2HD3 A;  2UXB Q;  4UY8 C;  1S5E D;  3FRP B;  1CQV A;  2L55 A;  4KHV A;  3RLO A;  4BBR G;  1Y69 U;  3A8I E;  1I3Q B;  3S24 A;  4NXN Q;  1PFS A;  4A93 H;  1LTL A;  4B3M L;  2XIW A;  1JOO A;  1L0W A;  1UUP A;  3IFT A;  1A6X A;  4KK7 A;  1N34 Q;  4C3I G;  3M9B A;  5IGC A;  1HA5 A;  1YBY A;  3S1M B;  1HHV A;  2ZJR A;  4PNY A;  1XX8 A;  2VB2 X;  4HSP A;  3UI2 A;  4A3F G;  4JBM A;  3OOC A;  4ZYS A;  4RGT A;  1CKN B;  3K81 C;  1RIP A;  2F0G A;  1KLU D;  3QB3 A;  4PG3 A;  2E2J H;  2EYJ A;  5HGT A;  3CCR A;  2R93 B;  2WKD A;  4IFD G;  3SK6 A;  1ET9 A;  2KEC A;  4IQZ A;  1RCV D;  2HHH L;  5EPL A;  1SSO A;  1GD7 A;  2IX0 A;  2JN4 A;  1BR9 A;  1SNC A;  3T53 B;  1I4G A;  1PRT B;  2PI2 A;  1FGB D;  3R93 A;  1WI5 A;  3KOJ A;  4DV6 Q;  2OT2 A;  2IW3 A;  4A75 A;  4GN3 B;  1GVP A;  3CMA A;  4CDE C;  1EY4 A;  4H02 A;  4JI6 Q;  3U9O A;  4LF4 L;  3BYT B;  2VL6 A;  3VR6 A;  2GVB A;  2QEJ C;  2E74 C;  2DNE A;  4LAA A;  4L63 B;  4LF6 Q;  1OXV A;  1VQF A;  2LXJ A;  4A3J H;  4K5W A;  5CC4 A;  1IXR A;  3FEW X;  2NZH A;  4A3M G;  2EYP A;  3E0J A;  3CPF A;  3HS0 C;  1PH9 A;  2E2I H;  4IFD I;  5I6Y A;  3WOE A;  3QOJ A;  1F2L A;  2A74 C;  1C9O A;  4C56 C;  1VQD A;  3I70 A;  4L5R C;  3MXN B;  2RCF A;  4K0K L;  1RJT A;  4PMC A;  3FDT A;  4BBS H;  3N52 A;  1Y1V G;  2L4N A;  5J3B A;  4B3S Q;  4KD3 A;  4KLK A;  4EGV A;  4ILW A;  3FKI G;  2SNM A;  4A76 A;  3T56 B;  5FO8 B;  3RZO B;  4XIG S;  1QNK A;  4A3K H;  1IYV A;  5C3E H;  1NMF A;  2WP8 J;  1QOH A;  4DR7 Q;  2F0S A;  1RTN A;  3QIA A;  2YYZ A;  2NVQ H;  3KDF B;  5CV6 A;  2HIV A;  1VF7 A;  4EQP A;  4NDX A;  1VMP A;  1ICW A;  3EN2 A;  1NNX A;  1SXT A;  1IBM Q;  2DGY A;  1I6V C;  2YV5 A;  3CCU A;  4J8Q A;  2BE5 C;  4ALP A;  1QVF A;  5I6W A;  2KCT A;  4L8J A;  1TVX A;  1CKN A;  3ER0 A;  3PO3 B;  4ZLT F;  4JV5 L;  1XTD A;  2HCC A;  1LTB D;  4EX5 A;  1PFM A;  1TS3 A;  1K8O A;  5T1I A;  1VQA A;  1Z9F A;  3H3V H;  4QIW E;  2BDO A;  1TWG H;  1QJO A;  5KYL A;  3MXG A;  5M5Y H;  1EY5 A;  4UP8 A;  2JA7 B;  4HMJ A;  1LTR D;  4KI0 A;  4JI3 Q;  2CFM A;  1TT2 A;  3I4N G;  3H0G H;  1XJV A;  1N33 L;  3Q0A A;  1XWE A;  3A5Z B;  5KND A;  1LV9 A;  1EWI A;  4DV5 L;  1CZW A;  2D0O A;  4DAP A;  3HOZ B;  3T1H L;  3HOU G;  3BU2 A;  2HHH Q;  1KRT A;  4I7Z C;  3TZU A;  4ZUJ A;  1F9P A;  2DNC A;  3NQT A;  2R6G A;  4POG A;  4M1U B;  4ZKB B;  1E2W A;  2B2U C;  1A8V A;  4V19 0;  3I90 A;  4OIK A;  2R61 A;  4POF A;  2BOS A;  3DXJ C;  1C7Y A;  4OIJ A;  2GVA A;  1MGS A;  2RA4 A;  2UU9 L;  1VQH A;  2M9V A;  4FVM A;  1STE A;  2F0E A;  1VF5 C;  5GAE C;  3GTP B;  2J0T D;  4A3E B;  5FK9 C;  4Y7N H;  4A3I H;  3DUZ A;  4LF4 Q;  1B4O A;  3MXN A;  4XYO A;  2E75 C;  4R8I A;  4K6D A;  4CBV A;  3BZC A;  4LK1 C;  2A68 D;  2NZO A;  2JA5 H;  2Z1C A;  2SDF A;  4C1N K;  4JVZ A;  2F3V A;  1XNR L;  3P75 A;  4HED A;  1DD2 A;  2EOT A;  1WCM B;  5ELC A;  3MA2 B;  2NUC A;  5COY A;  4GKK Q;  1SFO B;  1XPR A;  1W6K A;  1F77 A;  1TU2 B;  3KDF A;  2ID0 A;  4HID A;  1A3T A;  5TSS A;  4S3S A;  4FP5 D;  2C9O A;  3NBH B;  4LUZ A;  5C4X H;  3HOX H;  1S40 A;  3TME A;  1Y1W G;  2HCI A;  5H1S E;  5KGU A;  3URY A;  1YNN D;  3T1Y L;  1S5F D;  3EA6 A;  4R4O A;  2CHB D;  3A8J E;  3RUZ A;  3I73 A;  3MXU A;  2WAQ B;  5EKL A;  3I56 A;  1B3Q A;  2F0O A;  4H0L C;  3GTM B;  1I50 B;  1SE2 A;  4PMB A;  1EY0 A;  2OCE A;  3ULJ A;  2EJG C;  3GV6 A;  4A3G H;  1XNQ L;  2F0U A;  4EQO A;  3SK8 A;  1BCP B;  2D9U A;  5I4D A;  5CV4 A;  3I91 A;  2MP1 A;  2VNU D;  1I3Q H;  4IUU A;  1JJC B;  4LF8 L;  1SNP A;  3BDC A;  2EYO A;  1K8G A;  4AH6 A;  4LFA L;  1O7I A;  2Z8L A;  1B9M A;  1JWM D;  4JV5 Q;  4NMZ A;  4A93 G;  1BQQ T;  4IJH A;  4J15 A;  1KHI A;  3NEL A;  1I4P A;  4AYB E;  1Y14 B;  2ICE C;  4Q5V A;  1TWH H;  5JOB A;  2R3Z A;  2GA4 B;  2E2J B;  3BVM A;  5C4J H;  5IGE A;  2IPK D;  5C6A A;  1C4Q A;  4OX9 L;  2R93 H;  3HKZ E;  4RGM A;  2PI2 E;  3CCJ A;  1DJR D;  3PUY A;  1T5E A;  3RLN A;  1N33 Q;  4KKS A;  4DV5 Q;  5JPN C;  4X3T A;  3J7Y W;  2VQF Q;  1RDP D;  3U50 C;  3TQY A;  4HJA A;  3MHB A;  3UDG A;  2J4X A;  3J81 E;  4YWM A;  4RHR A;  1B53 A;  4K5X A;  1PZK D;  3HKS A;  3J81 L;  3GTQ B;  1IYU A;  1ASZ A;  3GDE A;  3CRK C;  5FJ8 H;  1ZKO A;  5GQO A;  2UU9 Q;  4O1N A;  1JC7 A;  1IBL L;  3HFZ B;  4OL7 A;  1KNE A;  4RHS A;  4FXD A;  1YZ6 A;  1JJ2 A;  3LWU A;  1AP0 A;  1U9R A;  2BA0 A;  2WKC A;  1AFP A;  1LO5 D;  1EFW A;  2A69 D;  3R8B A;  1D8L A;  1CUK A;  3JAM i;  1O78 A;  1VQE A;  2E2I B;  4DUZ L;  3NBH A;  5E1F A;  4KY7 A;  2F0L A;  4KY5 A;  4A3J G;  5AFW A;  3F8T A;  3RD4 A;  1UE7 A;  4BY7 H;  4IUQ A;  4YHH L;  2HIX A;  1FR3 A;  4MTN A;  3RZD H;  5HY6 A;  2K6A A;  1LUZ A;  3NBI A;  2VUM B;  1FGU A;  4DR1 L;  2F0N A;  2H4O A;  1E3P A;  4RWS C;  2I0Q A;  1YNJ D;  5CV7 A;  3VYT A;  3F2D A;  2NN6 G;  4DN4 M;  4NPS A;  2VZA A;  3T16 A;  1BXT A;  4U68 A;  1BOS A;  2K5W A;  5C4H A;  1WTP A;  1L2F A;  4BBS G;  4LFB L;  4RGN A;  4A4I A;  4IN3 A;  4MIU A;  2NVQ B;  3AMU A;  3T1Y Q;  3CD6 A;  2SOB A;  4YCW A;  4A3K G;  2UUC L;  4XQJ A;  5IY0 A;  2IY5 B;  1JIC A;  5C3E G;  4IPH A;  1N36 Q;  1MBY A;  1JOR A;  4KN7 C;  2XWJ B;  1CA5 A;  1XXG A;  1C8C A;  4DA2 A;  2UXB L;  2ICI A;  2A68 C;  4F8M A;  1JCK B;  1HUN A;  1PH6 A;  4I65 A;  5DAU A;  1XNQ Q;  1WTH A;  1XYI A;  4TQU S;  5FLX c;  4HTH A;  1IBK L;  4ZRZ A;  4DNR B;  1JB3 A;  5NUC A;  3UE1 A;  3W1B A;  3A7A B;  2NN6 I;  1I4R A;  1TWG B;  5M3M H;  3Q24 A;  4LFA Q;  3L7Z C;  1NE3 A;  2R92 G;  4KKT A;  2B8G A;  4HJ5 A;  5E7N A;  3HOW H;  3S2D B;  3NK9 A;  3F2U A;  3JAM c;  2E2D C;  5C3W A;  1KRS A;  3CCV A;  2JA7 H;  3I4O A;  1G91 A;  2LY7 A;  1ZXT A;  2V4D A;  3OYY A;  2MQH A;  3S1R H;  3CHB D;  4DXG A;  1YNN C;  1X56 A;  2F0H A;  3TZD A;  4GKJ L;  2ZTE A;  2EJM A;  4PZ6 A;  3M4O B;  3EFX D;  3TP8 A;  4OX9 Q;  3A54 A;  5J1Z A;  3HOZ H;  1Y8N B;  4CJ1 B;  3H0G G;  2HDM A;  4KV6 A;  2PW7 A;  3JAM E;  3K57 A;  1LAB A;  1S4Z A;  3GTG H;  1X6O A;  3TN2 A;  2ZJP A;  1LT6 D;  1WTR A;  2N78 A;  3MEH A;  3JAM L;  4C3H B;  1MI2 A;  4G7Z C;  3E0E A;  4P2C B;  4MTK A;  1NTG A;  4JI6 L;  2O5J C;  4LWC A;  4GOP B;  4O0A A;  1PZI D;  4CDD C;  3SDZ A;  2BDN A;  4DAV A;  3DMU A;  1WD0 A;  2JE6 I;  4YIJ A;  4Y7N B;  3GTP H;  3NQI A;  4AYB G;  4A3B G;  4A3I B;  4LF6 L;  2IWH A;  4HJ8 A;  4UDU C;  1OXX K;  1WYD A;  5AJ3 L;  3OW2 A;  2F0W A;  1JOQ A;  1IBL Q;  2D62 A;  3FHW A;  2SNS A;  4UHV A;  1A2U A;  2XRS D;  4HCE A;  3HKZ G;  1EQV A;  2JA5 B;  1YEZ A;  5M9O A;  3TS2 A;  3ITP A;  1FNU A;  2OEO A;  1H9M A;  1HH2 P;  2JEB I;  2EDG A;  1ENC A;  4DV0 L;  2OWO A;  1S5D D;  2R7Z G;  1A62 A;  3OWF A;  1BF4 A;  1SFO H;  4HR7 B;  1HR0 W;  2PZW A;  1ILQ A;  2JJQ A;  4Z9C B;  1GUG A;  3LX0 A;  2X6L A;  3W5O A;  1C0A A;  1I4H A;  1X9N A;  4QB4 A;  1HTP A;  3LGJ A;  2G5D A;  4JCV E;  2C5C A;  4DR1 Q;  5JVH 3;  3UDI A;  2AUK A;  4BS9 A;  4X3S A;  1KDB A;  2VS1 A;  4DR7 L;  1K28 A;  3STB D;  4IZ8 A;  2CH4 A;  4XXE A;  3F1Z A;  4BXX H;  2AQ1 B;  5ELN A;  3ULP A;  2F0M A;  4NP5 A;  3SGI A;  5C4X G;  3E5S A;  4YCV A;  2AUJ D;  1YHA A;  3HOX G;  2F0D A;  3E3X A;  4LFB Q;  2NVY B;  1EIY B;  3K59 A;  1PRT D;  5T1G A;  1SNO A;  4JI4 L;  1HNW Q;  1MHW C;  1B8A A;  3ULL A;  1O7Z A;  2UUC Q;  4L5S A;  1V43 A;  1KC8 C;  3MZ5 A;  1H9J A;  2K5D A;  4ME5 A;  4A3G B;  4OWX B;  1TY2 A;  3K80 C;  1PA6 A;  1PH2 A;  1A0I A;  5JJZ A;  1SYD A;  1ET6 A;  3G6J B;  1PRT F;  4FYD A;  4QCL A;  4J1M A;  1IBK Q;  1HUM A;  1KLG D;  4FO2 A;  3A5U A;  5M3F B;  1YNJ C;  5DM6 3;  1K3R A;  3L2P A;  3D4D A;  4JI3 L;  5A2Q E;  3R2I A;  2RF4 A;  2WII B;  3SHL A;  2EE1 A;  2KJX A;  2A6E D;  1TWH B;  4IUV A;  3BZK A;  1U4R A;  4P72 A;  3CF5 A;  5A2Q L;  5BN4 A;  3NTK A;  1H9S A;  4P71 A;  5C4J B;  1NR2 A;  3AYH B;  2OTL A;  5IE8 A;  1D5X C;  2Q2T A;  4GOP A;  3D3R A;  1UWV A;  4CKB A;  2CW0 D;  3E9H A;  4GKJ Q;  1GM5 A;  1AZP A;  4BY1 H;  3F2C A;  2IHE A;  2NTS A;  1WFQ A;  5IYB G;  1I4X A;  3CQZ H;  2KCC A;  4GNX B;  5KNC A;  2R93 G;  2F0V A;  2PQE A;  2ZXR A;  4HN7 A;  4CKE A;  3QWN A;  4DF7 A;  3HOY B;  4A3C H;  1VQO A;  5JEA G;  3GD7 A;  1F9Q A;  5D3I B;  4YCU A;  2EY1 A;  2MFI A;  3NWT A;  4DR2 L;  1EU3 A;  2LSS A;  4R4I A;  2KEE A;  3GTQ H;  2MGS A;  5DLQ E;  3U4V A;  2OF1 A;  2DN8 A;  4HIK A;  1EYD A;  2VXW A;  4IO9 A;  1LT3 D;  5E3F A;  2LXK A;  5FJ8 G;  3C2P A;  4DFA A;  1WTV A;  5KNB A;  5AJ3 Q;  4PZ8 A;  4DXF A;  1FJG Q;  3PIO A;  1X3Q A;  3PV0 A;  4N9P A;  5LMN L;  5JJL A;  3PUZ A;  1BDO A;  2IX1 A;  4DGZ A;  4U67 3;  4GKK L;  4C3J B;  3HOV H;  1Z6H A;  1VS0 A;  1TWF H;  4BY7 B;  5FKA C;  2WAQ E;  1S3O A;  4DV0 Q;  1VQ7 A;  4TKO B;  4QY7 A;  3RZD B;  1NMG A;  4N8X 1;  1G29 1;  2VUM H;  1LTT D;  5EBD A;  2B2Y A;  4FF3 A;  1XMO L;  1G2S A;  1HA6 A;  1KAW A;  2HQE A;  2PW5 A;  5GRO A;  3ZJY C;  1SN8 A;  3CCM A;  1HNZ Q;  4QMG A;  1G51 A;  1H95 A;  2YU9 B;  2B3G A;  4DPG A;  5K36 H;  3IRB A;  3QG1 A;  3VR5 A;  1EQT A;  1L0Y B;  3DM3 A;  1CM9 A;  4Q0F A;  5JPM C;  2CCZ A;  3RR5 A;  3L3O C;  2KEN A;  3T13 A;  1EYG A;  1LYL A;  2WV6 D;  2EYH A;  3UE0 A;  1A2T A;  3BVG A;  4F88 A;  4B3T L;  2QDB A;  2I5H A;  4IJL A;  4DV2 L;  1MSG A;  1J6Q A;  2XVS A;  5COR A;  1STH A;  5IGF A;  3ZYY X;  3S15 H;  3A7L A;  2F0I A;  1VQP A;  1SBB B;  3CME A;  4JI4 Q;  3HZX A;  3A0J A;  1GUW A;  1RL2 A;  2MO1 A;  3H09 A;  5EGT A;  2X6G A;  3U58 A;  2PZT A;  4K2L A;  1EUJ A;  2C35 B;  1X55 A;  1SYG A;  2CVR A;  2AQ2 B;  3A56 A;  4G4K A;  4CDC C;  4RH6 A;  3PQI A;  1IZ6 A;  1SMX A;  3CXC A;  2A1A A;  2OQK A;  4IOA A;  1LM0 A;  5M5W H;  2PPB C;  5M3M B;  1XTC D;  1TKW B;  1PFB A;  3PO3 G;  3HOW B;  5KYI A;  4GNX A;  2B8F A;  3S2D H;  1E0B A;  5IYD G;  2NBF A;  2D5D A;  3S1R B;  2KHI A;  3G71 A;  1AE2 A;  2NYZ D;  1AW7 A;  4O42 A;  3MFG A;  2AWO A;  3VYR A;  1UE6 A;  2ALY B;  1BUV T;  2JA7 G;  4ZKC B;  1X32 A;  1KAB A;  3M4O H;  1FVI A;  4GNX C;  3U4Z A;  1NJI C;  1OXS C;  1PRT C;  1PH7 A;  4ZUI A;  4M8A A;  1FL0 A;  1M4V A;  1QWY A;  2VQF L;  1O80 A;  5EJW A;  4PZ7 A;  2MNA A;  1IW7 D;  3G4S A;  1K8M A;  3PIO 3;  1PTO H;  1GO3 E;  1WTQ A;  3GTG B;  2I07 B;  2O4X A;  3V2T A;  2LS0 1;  1J9O A;  1R4P B;  2UUB L;  1HQR D;  5FO9 B;  1UE1 A;  1B2T A;  3HOZ G;  1B1Z A;  1HXY D;  5EQ0 A;  4C3H H;  3WDN A;  3H91 A;  3K6O A;  5IP9 H;  3IKJ A;  4TSS A;  4TVA B;  1EYC A;  3PCO B;  2L5T A;  2Z6K A;  3E9I A;  5M5X H;  4DR2 Q;  3P7J A;  5J22 A;  4HCS A;  2A6H D;  3LNN A;  2JA8 B;  4G7H C;  1CSQ A;  3CP0 A;  3NP8 A;  1STY A;  5CV5 A;  5DEH A;  3T4A C;  3S14 B;  1FYC A;  4JI7 L;  4APV A;  2A6E C;  1ZYR D;  2WFW A;  3CC7 A;  4A3L H;  3FPP A;  1EIH A;  4A3E G;  2KBN A;  1BCP D;  3K7U C;  1QZG A;  4PV1 C;  4UPA A;  3J81 i;  5C44 B;  3ICE A;  4FF1 A;  5LMN Q;  2CW0 C;  1Q1B A;  2PQA B;  4G7O C;  2KOL A;  3GTO H;  4WJ3 M;  2M2L A;  2KED A;  1KDC A;  1MIU A;  4R4T A;  3VR2 A;  4IAL A;  3Q22 A;  1BCP F;  3K8A A;  5E4W C;  2EPB A;  1WCM G;  1M1K C;  4L5Q A;  4P75 A;  2JEA I;  1XMO Q;  3M4Y A;  2JA6 H;  1LAC A;  1Q12 A;  5G3L D;  2ZTD A;  4K14 A;  1TWA B;  5D65 A;  5I2X A;  5EPJ A;  1EQR A;  2Z4I A;  1BBU A;  1K83 H;  1CI3 M;  1S5C D;  2LFN A;  1N36 L;  3MEF A;  3IAY A;  4DR6 L;  1ML0 D;  2EYF A;  4QGU A;  5IWA Q;  1W2B A;  1GOZ A;  2NVY H;  4DK0 A;  3GQB A;  1MJE A;  5G3L F;  1TWC H;  1D1I A;  4GS3 A;  4ULL A;  2JP1 A;  2EXZ A;  4B3T Q;  4DV2 Q;  1TXY A;  3V96 A;  5IYC G;  4LNQ A;  4KHZ A;  1K0S A;  1Z47 A;  3Q8D A;  2WAQ G;  5I9O A;  2B63 H;  1PDQ A;  2LKV A;  5EAY A;  4HIM A;  1SYB A;  4F7X A;  2ES2 A;  3RNU A;  3J80 i;  4X65 L;  4DUY L;  1PH5 A;  1VQ5 A;  3B6Y A;  2N49 A;  2EXD A;  3PMF A;  4Y52 H;  1E24 A;  3KK7 A;  1TS4 A;  4BBR H;  5CR3 A;  1IL8 A;  1N8R C;  5M3F H;  5JJI A;  2L15 A;  4OON A;  4KJO A;  3H6M A;  5LHY 1;  2G9D A;  2JK8 A;  4OEM B;  4LFC L;  2YTY A;  4CKC A;  1AN8 A;  4C3I H;  3J81 c;  4LUV A;  3N6R A;  4OXP A;  2QEX A;  3BS1 A;  1QUQ B;  1YIJ A;  3KBG A;  1VQN A;  2R7D A;  4R4Q A;  1A3V A;  1PH4 A;  4A3F H;  4X6A H;  4KKU A;  3ERQ A;  1AE3 A;  4BY1 B;  2Z9H A;  2TSS A;  4A3D B;  2E2H H;  5JVG 3;  3CQZ B;  1LTA D;  1CQF A;  4GLA C;  2L11 A;  1A3U A;  1X3F A;  3MTS A;  4RGO S;  2EQS A;  4LF9 L;  1YNX A;  3KFU A;  2EY5 A;  1OTC A;  2HDL A;  1X54 A;  1XMQ Q;  3HOY H;  1VQ8 A;  1EOV A;  2UUB Q;  4DR3 L;  1EIG A;  4JPB W;  1EZ6 A;  2K5V A;  2NVT H;  1HNX Q;  1STG A;  4A3C G;  2DJG C;  2I5L X;  5ELO A;  2BCO A;  2IHF A;  3TRE A;  2B2W A;  2PQA A;  3S16 H;  2VW9 A;  4X66 Q;  1Y8P B;  1K9M C;  3LWE A;  1KTK A;  2H1E A;  4HAE A;  3A8K E;  2F0K A;  3ND9 A;  3IFD A;  1IKL A;  4BA1 I;  2UXC L;  1CKO A;  4JI7 Q;  4YY3 L;  4NB3 A;  1DM0 B;  1QIL A;  3MWY W;  3HOV B;  1E2V A;  1B50 A;  4MZ9 A;  3GO5 A;  4C3J H;  2UUA L;  1EIF A;  1TWF B;  1P16 A;  1SJH D;  4A3M H;  4NXM L;  1PMR A;  5IGB A;  4XDX A;  4DAY B;  5CV8 A;  1IW7 C;  5C0X J;  1KAA A;  4ME3 A;  3G48 A;  5IIF A;  1YIT A;  2RHS B;  3WOF A;  1I4Q A;  2DY7 A;  3PIP 3;  1IHZ A;  2JA9 A;  1MSH A;  2F3W A;  2VUM G;  2YU9 H;  4EQN A;  1VQI A;  3FVQ A;  5FLM H;  3J80 E;  2XGT A;  3CW2 C;  4XYQ A;  1Y1V H;  4HJ7 A;  5IOD A;  4AIM A;  1JT8 A;  3S9W A;  3J80 L;  5K5P A;  2A6H C;  1HNW L;  4ZAI A;  1V8Q A;  3PGZ A;  1PTO D;  3GV3 A;  1V1P B;  2CKZ B;  5CBE E;  3MXP A;  4DR6 Q;  3SR1 A;  1L1O B;  3S15 B;  1BCP C;  2TMP A;  1FNV A;  1K3B C;  2PYK A;  4IPG A;  2RBM A;  3TS0 A;  3AQQ A;  2B2V A;  2BA1 A;  2F0J A;  1Q90 A;  1F2Z A;  4C1N I;  3S2H B;  1PTO F;  3I8Z A;  2G9H D;  3CAM A;  4NKL A;  5IP7 H;  1QUQ A;  1UE5 A;  1U4P A;  1OO9 B;  2FMC A;  3ONA B;  5M5W B;  1PYW D;  2IJ0 A;  4X65 Q;  1OXT A;  4MNO A;  4DUY Q;  4DV4 Q;  3TBI B;  3GTL H;  2RVL A;  2CH4 W;  4PMW A;  1ICF B;  4WOR A;  1KXL A;  1NSN S;  4QJF A;  3D4R A;  3PF4 A;  2K4K A;  4WRD A;  2CQA A;  3S17 H;  3BDO A;  4IUT A;  2AWN A;  2Y0S B;  4LFC Q;  3D6C A;  1HZC A;  2K28 A;  1SJE D;  2KHS A;  4TRD A;  3D8G A;  2K75 A;  2ZXP A;  1PVO A;  3I4N H;  2KA7 A;  1PTO B;  2CWA A;  2B39 A;  2QIL A;  4K8J A;  5JAV A;  1WD1 A;  3DLL A;  3HP3 A;  4QL5 A;  4LF9 Q;  4DNI A;  3HOU H;  2QDL A;  1BBW A;  3M3Y B;  1XPO A;  5C0X H;  3VA7 A;  4RG1 A;  1R4Q B;  4IUR A;  4E6I A;  4QUF A;  3I7F A;  4ODG A;  1JWU D;  1LTI D;  4DR3 Q;  2M00 A;  5M5X B;  1J5E Q;  3M7G A;  3MAQ A;  4C3H G;  4R1J A;  1D6E C;  1KL9 A;  2Q2H A;  5BN5 A;  2JA8 H;  4X62 L;  2F4V Q;  5ELB A;  2QF7 A;  5IGD A;  2WB1 B;  5IT9 c;  4DAY A;  1FJG L;  3H3V I;  1DGS A;  2WAC A;  1PZJ D;  3S14 H;  3VYS A;  4HJ9 A;  1ONL A;  2E5L L;  3I4M B;  4LMQ D;  3TP5 A;  2HT1 A;  2DY8 A;  1YJW A;  4A3I G;  3M4P A;  3Q23 A;  4JI8 Q;  1O7L A;  4JYA Q;  5IGG A;  3R3O A;  3H15 A;  5C44 H;  2UXC Q;  4A3L G;  4OWW B;  4YY3 Q;  2Q2U A;  2E76 C;  3GTO B;  2JA5 G;  1SAP A;  2UUA Q;  4CHT B;  5IT9 E;  1W3S A;  4ZCK A;  1PLF A;  2N3S A;  1MKH A;  2F0Q A;  1IYJ B;  4NXM Q;  5I2Y A;  2PNH A;  3D0F A;  2EVB A;  1HNZ L;  3D4W A;  2IL8 A;  5IT9 L;  3DHQ A;  1V1P A;  4JI1 L;  4H7B A;  3U9S A;  1X3P A;  5BN3 A;  2MJ8 A;  2JA6 B;  4K8I A;  2AHO B;  1GXD C;  2Q8R E;  3CCQ A;  4G57 A;  1B70 B;  1E1O A;  2KHJ A;  4LF7 L;  1JOK A;  1LT5 D;  3SK4 A;  1TWA H;  4MHE A;  1EZ8 A;  3K5N A;  3C46 A;  3ERO A;  1CHQ D;  1QB5 D;  1K83 B;  2K03 A;  2FXQ A; 
#chains in the Genus database with same CATH homology
 4V0B A;  4HMI A;  2K32 A;  1TWC B;  3J7A V;  3C3L A;  3TP6 A;  1EY7 A;  2A69 C;  4BWG B;  1NR4 A;  3KLS X;  5DM7 3;  5FOB B;  2B63 B;  1BBX C;  4NW2 A;  3OSO A;  1TY0 A;  2XNA C;  4FF4 A;  3H3V C;  1CT1 D;  1EYA A;  4BBR B;  4KJN A;  1Q8I A;  3I3C A;  1GUS A;  3RLF A;  4CJ2 C;  3PUW A;  3TSS A;  2MPM A;  3O13 A;  4N9T A;  1RTO A;  4C3I B;  3I72 A;  3SVM A;  3MFY A;  3DWQ A;  5E4X A;  2RDF A;  4A3F B;  2RDH A;  1PTO C;  3HRZ C;  2E2H B;  2AQ3 B;  2RKS A;  4J6H A;  1STB A;  3NSW A;  2IT1 A;  2MUY A;  3AB9 A;  4RA8 A;  5EPK A;  1AEX A;  3HGB A;  3SK5 A;  2KUM A;  2NVT B;  1SYE A;  3KUP A;  5IOC A;  2K05 A;  1WTO A;  3S16 B;  1B3A A;  5J39 A;  2PCF B;  5EKK A;  3P1H A;  2K1B A;  3BVZ A;  5C3X A;  3C1F A;  4GZY C;  4F87 A;  1BO0 A;  1LT4 D;  4A3M B;  2F03 A;  4WJW A;  4B08 A;  1BNZ A;  1D2B A;  1EFI D;  4C3J G;  5D3D A;  1GHK A;  2XSC A;  1Q3L A;  3K5O A;  3NUC A;  1EWC A;  2A73 B;  5EBC A;  5ELE A;  2K04 A;  1HQM C;  1Y1V B;  2B2Y C;  1A15 A;  2NN6 H;  3FKI B;  1STA A;  3CKI B;  1G6Z A;  2EZV A;  1T5X D;  2J7Z A;  1QNU A;  4HSV A;  2PMZ B;  4IUN A;  4RKB A;  1B44 D;  3DWA A;  3VA5 A;  4ZK9 B;  1TS5 A;  1SMY D;  4OO1 H;  1QCB D;  1WTX A;  1LLR D;  4K2K A;  4DNT B;  1QE6 A;  1EY8 A;  4FNF A;  1EEF D;  1LTS D;  3TDQ A;  3D6W A;  5C5L A;  3M7N A;  2F0T A;  3K5M A;  3GTL B;  2L1B A;  4KY6 A;  3HEJ A;  3QOL A;  1ZEQ X;  3C1E A;  3W2D A;  3S1N B;  3H94 A;  3S17 B;  3K5L A;  3I4L A;  4WFN 3;  2L9H A;  2NVX B;  1HFN A;  3DWP A;  1Q1E A;  3X3M A;  3X3N A;  3I4N B;  2HUG A;  1TQO A;  1DOK A;  2LMC B;  1SDF A;  3KBX A;  3K7A B;  4KN4 C;  1NCV A;  4FF2 A;  1FD7 D;  2EY6 A;  4CGY B;  2FIN B;  3KF8 A;  1NUC A;  3HOU B;  3K58 A;  1G8Z D;  2B2U A;  2K5Q A;  3S1Q B;  3Q6S A;  1WVL A;  4OHJ A;  2NTT A;  1CTM A;  1HPC A;  4IUP A;  5C0X G;  2ENB A;  2JSO A;  2ZXO A;  5I9P A;  3T51 B;  3DEO A;  4H13 C;  4ABN A;  1CA6 A;  4JBW A;  4QUC A;  4OGQ C;  2PNR C;  1HCZ A;  3HG9 A;  4IFD J;  2D2C C;  1TR5 A;  5LL6 S;  2B2T A;  3G7L A;  5KIX A;  1DOM A;  4XT3 B;  4X3U A;  3BDL A;  4XTC S;  1VMC A;  1EU4 A;  3R2T A;  5JEA J;  1CHP D;  1D5Z C;  1G2T A;  5C5M A;  2B2T C;  5CMD A;  3GP7 A;  4LJZ C;  2IX3 A;  3KLS A;  1EL0 A;  2RSN A;  1R9T B;  5A35 A;  5LL6 X;  1JQY D;  2F4I A;  1GJX A;  5C0X I;  2RQX A;  3CRL C;  5KRU A;  1Y1W B;  2RDG A;  1STN A;  1CFM A;  1GUO A;  3SE0 A;  4RAU C;  4RKL A;  3SXH A;  4FXK C;  3FPU B;  1CK1 A;  1H9R A;  1DZ1 A;  4K5V A;  1ILP A;  1HFG A;  3NHH A;  4MN3 A;  4BA2 I;  4B9W A;  1CZG A;  4R8N A;  1RD9 D;  2FJ2 A;  1LTG D;  1GHJ A;  2FFK B;  4A93 B;  1PFN A;  3QJY A;  1E2Z A;  3CU7 A;  1IKM A;  3TP7 A;  1ENF A;  2A5H A;  1B9N A;  1EY9 A;  3GTK B;  4IFD H;  1SMY C;  3W3A A;  2QKI C;  1DCZ A;  1ESF A;  2JYO A;  3FMC A;  4XQN A;  3P20 A;  1M8A A;  3L9A X;  1C48 A;  1UEA B;  3QO2 A;  4FXG C;  1RHP A;  2MHV A;  1JWS D;  5JEA H;  2FHT A;  3EVQ A;  3A55 A;  2KQ3 A;  3KLR A;  1SE3 A;  1EEI D;  5FO7 B;  2XN9 C;  4QIW B;  3OPO A;  2NZ1 D;  1SEB D;  2N88 A;  3BZD B;  2XRQ D;  5C4Z A;  2F0F A;  4PQX A;  2B2W C;  2Q8I B;  2QCP X;  3RMH A;  2EY2 A;  3PUX A;  3VYU A;  1F2M A;  2KCN A;  5CV9 A;  4QF4 A;  1RKN A;  1L0X B;  4EVO A;  1F9R A;  2F1M A;  1DXM A;  3AU7 A;  1DOL A;  2K33 A;  3OW7 A;  4A3J B;  3PO2 B;  1MD2 D;  3NE5 B;  3OWE B;  5ELF A;  1JE4 A;  1EY6 A;  3NXW A;  2I46 A;  3BG3 A;  4DU9 A;  2EYL A;  3OMC A;  4UAI A;  3OHX C;  1DON A;  1AZQ A;  5K36 G;  5F2D A;  2PO4 A;  4BBS B;  1SE4 A;  1KNA A;  1VDZ A;  4B9X A;  1ZYR C;  1TS2 A;  4RCN A;  2O2L D;  4A3K B;  3GTJ B;  5C3E B;  5CYU A;  3VR4 A;  4OO1 G;  1GUN A;  4ZQ3 A;  2B2V C;  2EJF C;  2L0C A;  4CJ0 B;  5DNF A;  1O7Y A;  4R9W A;  1EOT A;  2R92 B;  1WTW A;  5CGK A;  1Y8O B;  2F0P A;  3NWS A;  1QG7 A;  1HRJ A;  2PZU A;  3NTI A;  2NB0 A;  1U4M A;  1SYF A;  3E6Z X;  5M5Y B;  2O5I C;  1ENA A;  5HUR A;  2Z4H A;  4KMU C;  5FLX E;  2NWG A;  1ROD A;  3H0G B;  4OO1 I;  5FLX L;  1SYC A;  2KVM A;  3DM1 A;  4K6L A;  3BYY B;  3VR3 A;  2XWB B;  3DEP A;  3D31 A;  1NAP A;  1FNW A;  4H44 C;  3V05 A;  4RFB A;  5EKI A;  1VCI A;  5ISR A;  3NPP A;  1H9S B;  1W6J A;  3MC0 B;  4AYB B;  4A3B B;  1F2Y A;  3OIQ A;  3M85 A;  3PUV A;  1KDA A;  2SEB D;  1Z7T A;  3MVV A;  5ELD A;  1U4L A;  3EJI A;  1J8I A;  4JK1 C;  1SND A;  1PXU A;  3HKZ B;  1H9K A;  4XQQ A;  1S5B D;  3J7A F;  4KTA A;  2X69 A;  2R7Z B;  5D14 A;  4DK1 A;  3K0Y A;  2EYM A;  5KEE A;  2RSO A;  1OXU A;  2BE5 D;  3IL8 A;  1SNQ A;  2L12 A;  4ID6 A;  4L6T B;  3SEB A;  1ESR A;  2FMM A;  4X3K A;  1HTL D;  1I6H B;  4RCO A;  1RF2 D;  4XT1 B;  1UAP A;  2K7V A;  1JR0 D;  1EWH A;  1DYQ A;  1D1K A;  4C2M B;  1V1O A;  2JXM B;  5C4X B;  3HOX B;  2Q8T A;  3NTH A;  1F9S A;  1II3 A;  2N55 A;  2WIN B;  2OXP A;  3OMG A;  1GUT A;  1D5M C;  1SNM A;  3ND8 A;  2ZT9 C;  1UNS A;  1TII D;  5CBA E;  2VB3 X;  3OIP A;  3EQL C;  4KD4 A;  2K01 A;  1S5E D;  3FRP B;  1CQV A;  2L55 A;  4KHV A;  1Y69 U;  3A8I E;  1I3Q B;  2XIW A;  1JOO A;  1UUP A;  3IFT A;  1A6X A;  4KK7 A;  4C3I G;  5IGC A;  1HA5 A;  3S1M B;  1HHV A;  4PNY A;  1XX8 A;  2VB2 X;  4HSP A;  3UI2 A;  3OOC A;  4ZYS A;  4RGT A;  2F0G A;  3QB3 A;  1KLU D;  2EYJ A;  5HGT A;  2R93 B;  2WKD A;  4IFD G;  3SK6 A;  1ET9 A;  2KEC A;  4IQZ A;  1RCV D;  5EPL A;  1SSO A;  2IX0 A;  1BR9 A;  1SNC A;  3T53 B;  1I4G A;  1PRT B;  1FGB D;  3R93 A;  2OT2 A;  2IW3 A;  1EY4 A;  3U9O A;  3BYT B;  3VR6 A;  2QEJ C;  2E74 C;  4LAA A;  2DNE A;  4L63 B;  1OXV A;  4K5W A;  5CC4 A;  3FEW X;  2EYP A;  3E0J A;  3HS0 C;  4IFD I;  5I6Y A;  3WOE A;  3QOJ A;  1F2L A;  2A74 C;  4C56 C;  3I70 A;  1RJT A;  4PMC A;  3FDT A;  3N52 A;  2L4N A;  4KD3 A;  4EGV A;  4ILW A;  2SNM A;  3RZO B;  3T56 B;  5FO8 B;  4XIG S;  1QNK A;  1IYV A;  2WP8 J;  1QOH A;  2F0S A;  1RTN A;  3QIA A;  2YYZ A;  5CV6 A;  1VF7 A;  4EQP A;  4NDX A;  1VMP A;  1ICW A;  1SXT A;  1I6V C;  4J8Q A;  2BE5 C;  5I6W A;  4L8J A;  1TVX A;  3PO3 B;  4ZLT F;  2HCC A;  1LTB D;  1PFM A;  1TS3 A;  1K8O A;  5T1I A;  2BDO A;  1QJO A;  5KYL A;  3MXG A;  1EY5 A;  2JA7 B;  4HMJ A;  1LTR D;  4KI0 A;  1TT2 A;  3Q0A A;  1XWE A;  5KND A;  1LV9 A;  1CZW A;  4DAP A;  3HOZ B;  4I7Z C;  3TZU A;  4ZUJ A;  1F9P A;  2DNC A;  3NQT A;  2R6G A;  4M1U B;  4ZKB B;  1E2W A;  2B2U C;  4V19 0;  3I90 A;  4OIK A;  2R61 A;  2BOS A;  3DXJ C;  4OIJ A;  1MGS A;  2RA4 A;  2M9V A;  4FVM A;  1STE A;  2F0E A;  1VF5 C;  3GTP B;  2J0T D;  4A3E B;  5FK9 C;  3DUZ A;  1B4O A;  3MXN A;  4XYO A;  2E75 C;  4R8I A;  4K6D A;  4CBV A;  4LK1 C;  2A68 D;  2Z1C A;  2SDF A;  4C1N K;  2F3V A;  3P75 A;  4HED A;  1DD2 A;  2EOT A;  1WCM B;  5ELC A;  3MA2 B;  2NUC A;  5COY A;  1SFO B;  1W6K A;  1F77 A;  1TU2 B;  2ID0 A;  1A3T A;  5TSS A;  4S3S A;  4FP5 D;  2C9O A;  3TME A;  2HCI A;  5KGU A;  3URY A;  1YNN D;  1S5F D;  3EA6 A;  2CHB D;  3A8J E;  3RUZ A;  3I73 A;  3MXU A;  2WAQ B;  5EKL A;  2F0O A;  4H0L C;  3GTM B;  1I50 B;  1SE2 A;  4PMB A;  1EY0 A;  2EJG C;  3GV6 A;  2F0U A;  4EQO A;  3SK8 A;  1BCP B;  2D9U A;  5I4D A;  5CV4 A;  3I91 A;  2MP1 A;  2VNU D;  4IUU A;  1SNP A;  3BDC A;  2EYO A;  2Z8L A;  1B9M A;  1JWM D;  4NMZ A;  1BQQ T;  1I4P A;  2ICE C;  4Q5V A;  5JOB A;  2R3Z A;  2GA4 B;  2E2J B;  3BVM A;  5IGE A;  2IPK D;  5C6A A;  1C4Q A;  4RGM A;  1DJR D;  3PUY A;  1T5E A;  4KKS A;  5JPN C;  4X3T A;  3J7Y W;  1RDP D;  3MHB A;  2J4X A;  3J81 E;  4RHR A;  1B53 A;  4K5X A;  1PZK D;  3J81 L;  3GTQ B;  1IYU A;  3CRK C;  1ZKO A;  4O1N A;  1JC7 A;  4OL7 A;  1KNE A;  4RHS A;  4FXD A;  3LWU A;  1AP0 A;  1U9R A;  2BA0 A;  2WKC A;  1AFP A;  1LO5 D;  2A69 D;  3R8B A;  1O78 A;  2E2I B;  3NBH A;  5E1F A;  4KY7 A;  2F0L A;  4KY5 A;  5AFW A;  3RD4 A;  4IUQ A;  1FR3 A;  2K6A A;  3NBI A;  2VUM B;  2F0N A;  2H4O A;  4RWS C;  1YNJ D;  3VYT A;  5CV7 A;  2NN6 G;  4DN4 M;  3T16 A;  1BXT A;  4U68 A;  1BOS A;  2K5W A;  5C4H A;  1WTP A;  4RGN A;  4IN3 A;  4MIU A;  2NVQ B;  3AMU A;  2SOB A;  4XQJ A;  1JIC A;  1MBY A;  1JOR A;  4KN7 C;  2XWJ B;  1CA5 A;  1XXG A;  1C8C A;  4DA2 A;  2ICI A;  2A68 C;  4F8M A;  1JCK B;  1HUN A;  4I65 A;  5DAU A;  1XYI A;  4TQU S;  4HTH A;  4ZRZ A;  4DNR B;  1JB3 A;  5NUC A;  3A7A B;  2NN6 I;  1I4R A;  1TWG B;  3Q24 A;  3L7Z C;  4KKT A;  2B8G A;  3S2D B;  3NK9 A;  3F2U A;  2E2D C;  5C3W A;  1G91 A;  2LY7 A;  1ZXT A;  2V4D A;  4DXG A;  3CHB D;  1YNN C;  2F0H A;  3TZD A;  2EJM A;  3M4O B;  3EFX D;  3TP8 A;  3A54 A;  5J1Z A;  1Y8N B;  4CJ1 B;  2HDM A;  4KV6 A;  2PW7 A;  3JAM E;  3K57 A;  1LAB A;  1S4Z A;  3TN2 A;  1LT6 D;  1WTR A;  3MEH A;  3JAM L;  4C3H B;  1MI2 A;  4G7Z C;  4P2C B;  2O5J C;  1PZI D;  4DAV A;  3SDZ A;  2BDN A;  3DMU A;  1WD0 A;  2JE6 I;  4YIJ A;  4Y7N B;  3NQI A;  4A3I B;  2IWH A;  4UDU C;  1OXX K;  2F0W A;  1JOQ A;  2D62 A;  2SNS A;  1A2U A;  2XRS D;  4HCE A;  1EQV A;  2JA5 B;  5M9O A;  3ITP A;  1FNU A;  2OEO A;  1H9M A;  2JEB I;  2EDG A;  1ENC A;  1S5D D;  3OWF A;  1BF4 A;  4HR7 B;  2PZW A;  1ILQ A;  4Z9C B;  1GUG A;  3LX0 A;  2X6L A;  1I4H A;  4QB4 A;  1HTP A;  2C5C A;  5JVH 3;  2AUK A;  4BS9 A;  4X3S A;  1KDB A;  4IZ8 A;  4XXE A;  2AQ1 B;  2F0M A;  4NP5 A;  3E5S A;  2AUJ D;  2F0D A;  2NVY B;  3K59 A;  1PRT D;  5T1G A;  1SNO A;  1O7Z A;  1V43 A;  3MZ5 A;  1H9J A;  2K5D A;  4ME5 A;  4A3G B;  1TY2 A;  5JJZ A;  1SYD A;  1ET6 A;  3G6J B;  1PRT F;  4FYD A;  4QCL A;  4J1M A;  1HUM A;  1KLG D;  4FO2 A;  5M3F B;  1YNJ C;  5DM6 3;  3D4D A;  5A2Q E;  3R2I A;  2WII B;  3SHL A;  2EE1 A;  2KJX A;  2A6E D;  1TWH B;  4IUV A;  1U4R A;  5A2Q L;  5BN4 A;  3NTK A;  1H9S A;  5C4J B;  1NR2 A;  1D5X C;  3D3R A;  4CKB A;  2CW0 D;  1AZP A;  2NTS A;  1I4X A;  2KCC A;  5KNC A;  2F0V A;  2PQE A;  2ZXR A;  4HN7 A;  4CKE A;  3QWN A;  4DF7 A;  3HOY B;  5JEA G;  3GD7 A;  1F9Q A;  5D3I B;  2EY1 A;  3NWT A;  1EU3 A;  2KEE A;  2MGS A;  2OF1 A;  2DN8 A;  1EYD A;  2VXW A;  1LT3 D;  5E3F A;  3C2P A;  4DFA A;  1WTV A;  5KNB A;  4DXF A;  1X3Q A;  3PV0 A;  4N9P A;  3PUZ A;  1BDO A;  2IX1 A;  4DGZ A;  4U67 3;  4C3J B;  1Z6H A;  4BY7 B;  5FKA C;  4TKO B;  3RZD B;  1G29 1;  1LTT D;  5EBD A;  2B2Y A;  4FF3 A;  1G2S A;  1HA6 A;  2HQE A;  2PW5 A;  4QMG A;  2YU9 B;  5K36 H;  3QG1 A;  3VR5 A;  1EQT A;  1L0Y B;  1CM9 A;  4Q0F A;  5JPM C;  3L3O C;  3T13 A;  2WV6 D;  2EYH A;  1A2T A;  3BVG A;  4F88 A;  2QDB A;  1MSG A;  2XVS A;  5COR A;  1STH A;  5IGF A;  3ZYY X;  3A7L A;  2F0I A;  1SBB B;  3HZX A;  1GUW A;  3H09 A;  5EGT A;  2X6G A;  2PZT A;  4K2L A;  1SYG A;  2CVR A;  2AQ2 B;  3A56 A;  4G4K A;  4RH6 A;  2PPB C;  5M3M B;  1XTC D;  1TKW B;  1PFB A;  3HOW B;  5KYI A;  2B8F A;  1E0B A;  2NBF A;  2D5D A;  3S1R B;  2NYZ D;  1AW7 A;  4O42 A;  3MFG A;  2AWO A;  3VYR A;  1BUV T;  4ZKC B;  1X32 A;  1KAB A;  1OXS C;  1PRT C;  4ZUI A;  4M8A A;  1M4V A;  1QWY A;  1O80 A;  5EJW A;  1IW7 D;  1K8M A;  3PIO 3;  1PTO H;  1WTQ A;  3GTG B;  2I07 B;  2O4X A;  3V2T A;  2LS0 1;  1J9O A;  1R4P B;  1HQR D;  5FO9 B;  1B2T A;  1B1Z A;  1HXY D;  5EQ0 A;  3WDN A;  3H91 A;  3K6O A;  3IKJ A;  4TSS A;  1EYC A;  2L5T A;  3P7J A;  5J22 A;  4HCS A;  2A6H D;  3LNN A;  2JA8 B;  4G7H C;  3NP8 A;  1STY A;  5CV5 A;  5DEH A;  3T4A C;  3S14 B;  1FYC A;  2A6E C;  1ZYR D;  1EIH A;  3FPP A;  1BCP D;  4PV1 C;  5C44 B;  4FF1 A;  2CW0 C;  1Q1B A;  4G7O C;  2KOL A;  2M2L A;  2KED A;  1KDC A;  3VR2 A;  4IAL A;  3Q22 A;  1BCP F;  5E4W C;  2EPB A;  2JEA I;  3M4Y A;  1LAC A;  1Q12 A;  5G3L D;  4K14 A;  1TWA B;  5D65 A;  5I2X A;  5EPJ A;  2Z4I A;  1CI3 M;  1S5C D;  2LFN A;  3IAY A;  1ML0 D;  2EYF A;  1GOZ A;  4DK0 A;  3GQB A;  5G3L F;  1D1I A;  4ULL A;  2JP1 A;  2EXZ A;  3V96 A;  4KHZ A;  1Z47 A;  5I9O A;  1PDQ A;  2LKV A;  1SYB A;  4F7X A;  3PMF A;  3KK7 A;  1TS4 A;  5CR3 A;  1IL8 A;  4KJO A;  3H6M A;  5LHY 1;  2G9D A;  4CKC A;  1AN8 A;  3N6R A;  3BS1 A;  3KBG A;  1A3V A;  4KKU A;  3ERQ A;  4BY1 B;  2TSS A;  4A3D B;  5JVG 3;  3CQZ B;  1LTA D;  1CQF A;  2L11 A;  1A3U A;  3MTS A;  4RGO S;  2EY5 A;  2HDL A;  1EIG A;  1EZ6 A;  1STG A;  2BCO A;  2B2W A;  1Y8P B;  3LWE A;  1KTK A;  2H1E A;  4HAE A;  3A8K E;  2F0K A;  3ND9 A;  3IFD A;  1IKL A;  4BA1 I;  1DM0 B;  1QIL A;  3MWY W;  3HOV B;  1E2V A;  1B50 A;  3GO5 A;  1TWF B;  1SJH D;  1PMR A;  5IGB A;  4XDX A;  5CV8 A;  1IW7 C;  5C0X J;  1KAA A;  5IIF A;  3WOF A;  1I4Q A;  2DY7 A;  3PIP 3;  1IHZ A;  1MSH A;  2F3W A;  4EQN A;  3FVQ A;  3J80 E;  4XYQ A;  5IOD A;  3S9W A;  3J80 L;  5K5P A;  2A6H C;  4ZAI A;  1V8Q A;  1PTO D;  3GV3 A;  1V1P B;  5CBE E;  3MXP A;  3SR1 A;  3S15 B;  1BCP C;  2TMP A;  1FNV A;  2PYK A;  2RBM A;  2B2V A;  2BA1 A;  2F0J A;  1Q90 A;  1F2Z A;  4C1N I;  3S2H B;  1PTO F;  3I8Z A;  2G9H D;  4NKL A;  1U4P A;  1OO9 B;  2FMC A;  3ONA B;  5M5W B;  1PYW D;  2IJ0 A;  1OXT A;  3TBI B;  2RVL A;  4PMW A;  4WOR A;  1NSN S;  3D4R A;  4WRD A;  2CQA A;  3BDO A;  4IUT A;  2AWN A;  2Y0S B;  3D6C A;  2K28 A;  1SJE D;  2KHS A;  4TRD A;  3D8G A;  2ZXP A;  2KA7 A;  1PTO B;  2B39 A;  2QIL A;  4K8J A;  5JAV A;  1WD1 A;  3HP3 A;  3M3Y B;  5C0X H;  3VA7 A;  1R4Q B;  4IUR A;  4E6I A;  4QUF A;  4ODG A;  1JWU D;  1LTI D;  2M00 A;  5M5X B;  3M7G A;  3MAQ A;  4C3H G;  1D6E C;  5BN5 A;  5ELB A;  2QF7 A;  5IGD A;  2WB1 B;  4DAY A;  2WAC A;  1PZJ D;  3VYS A;  1ONL A;  3I4M B;  4LMQ D;  3TP5 A;  2DY8 A;  3Q23 A;  1O7L A;  5IGG A;  3R3O A;  2E76 C;  3GTO B;  1SAP A;  4CHT B;  5IT9 E;  1PLF A;  2F0Q A;  5I2Y A;  2EVB A;  3D4W A;  2IL8 A;  5IT9 L;  3DHQ A;  3U9S A;  1V1P A;  4H7B A;  1X3P A;  5BN3 A;  2MJ8 A;  2JA6 B;  4K8I A;  1GXD C;  2Q8R E;  4G57 A;  1JOK A;  1LT5 D;  3SK4 A;  4MHE A;  3K5N A;  1EZ8 A;  3C46 A;  3ERO A;  1CHQ D;  1QB5 D;  1K83 B;  2K03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...