4CJ2C

Crystal structure of hewl in complex with affitin h4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'VKVKFFWNGEEKEVDTSKIVWVKRAGKSVLFIYDDNGKNGYGDVTEKDAPKELLDMLARAER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOZYME C
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase/de novo protein
total genus 13
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj2C00
2B2TC 5T1GA 1ILQA 1SAPA 2EOTA 2SDFA 3ONAB 2JP1A 4MN3A 1XYIA 1ZXTA 1WTPA 3IFDA 1HFNA 4LMQD 1CM9A 2N88A 1PFMA 2Q8TA 2MP1A 1HHVA 1IL8A 2B2VC 1JICA 1BF4A 3KBXA 1O7YA 1HUMA 4ZLTF 3QO2A 4ZKBB 1U4RA 3Q6SA 1U4LA 4IUUA 1J9OA 4HSVA 5EPJA 1ICWA 1A15A 2HDMA 1DOLA 3SVMA 1EL0A 1U4PA 1VMPA 1F9SA 4XT1B 1DONA 1NAPA 2VXWA 1E0BA 1HA6A 1BBXC 5E4XA 1AP0A 1B50A 1BNZA 2KECA 2N55A 4ZAIA 1EQTA 1QNKA 1RTOA 3LWEA 1BO0A 4DN4M 2RA4A 1X32A 3P7JA 1KNAA 2CVRA 2NWGA 3GV6A 1G2SA 2RSNA 3I8ZA 1CA6A 1WD1A 1X3PA 1SSOA 4R9WA 4RA8A 2B2UA 1QG7A 1WD0A 1CA5A 1TVXA 2MPMA 4NW2A 4CJ0B 2X6LA 5EPKA 1DOMA 2NZ1D 1MSHA 2MJ8A 2B2YC 1WTOA 1WTVA 5EJWA 1KNEA 1ILPA 1EIHA 1ESRA 1G2TA 3G7LA 1G6ZA 1U4MA 5AFWA 1F2LA 2FJ2A 2FHTA 3I3CA 2B2TA 2H1EA 3KUPA 4X3TA 2DY7A 4RAUC 1ML0D 2EE1A 1B53A 4IURA 3I91A 3UI2A 5CBAE 1WTQA 1RHPA 1DZ1A 2HCIA 4U68A 2L9HA 1JE4A 2BDNA 4UAIA 5E4WC 4X3SA 2B2VA 1G91A 1O80A 2KOLA 2K28A 5JJZA 4HAEA 2RVLA 1GUWA 3GV3A 1HRJA 1WVLA 5EQ0A 3DEPA 1DOKA 4OIJA 1WTWA 1WTRA 2D9UA 5CMDA 4IUTA 4O42A 2EPBA 2B2WC 2DY8A 1IKMA 2NYZD 2JYOA 5EKIA 1EIGA 2Q8RE 3MTSA 4X3KA 1SDFA 2MGSA 1LV9A 1F9QA 1MSGA 3FDTA 5D14A 1EOTA 2KEEA 3TZDA 2IL8A 2M2LA 1VMCA 1O7ZA 2X69A 1RODA 1PLFA 1IKLA 3HP3A 3TN2A 2KVMA 5DNFA 1MI2A 5COYA 2HCCA 1S4ZA 2X6GA 2K03A 1F9PA 2K1BA 2K04A 2L12A 2RSOA 5CBEE 3MWYW 1HUNA 4ZKCB 4IUPA 4QUCA 4XT3B 3FPUB 2B2YA 2HUGA 1X3QA 2FINB 2L1BA 4IUVA 1F9RA 5CORA 1RTNA 1WTXA 2HDLA 3I90A 1MGSA 1B4OA 2XIWA 1C8CA 4OIKA 4ZK9B 2KUMA 2R3ZA 2L4NA 1PDQA 4IUQA 5D65A 3F2UA 1XX8A 4CJ1B 3DEOA 1AZPA 2J7ZA 3N52A 4X3UA 2FFKB 3DM1A 3IL8A 3R93A 1PFBA 2FMMA 1NR4A 5EPLA 5T1IA 3H91A 4MHEA 1AZQA 2B2UC 1RJTA 1B2TA 2K05A 4QUFA 4CJ2C 1NCVA 4XDXA 4RWSC 1QE6A 2K01A 1PFNA 2KEDA 4HEDA 1M8AA 1NR2A 2B2WA 4HCSA 1B3AA 1HFGA 4R8IA 1J8IA 1Q3LA 2L11A 3D6WA
chains in the Genus database with same CATH superfamily
4QGUA 1VQHA 4PMBA 2EOTA 5CV5A 4ME3A 3JC66 4EQPA 1XYIA 3M7GA 2Z6KA 5DEHA 4Q0FA 4HIKA 3PMFA 2R7FA 4DR7L 3DLLA 2ZJRA 2E2IB 3HOVH 1A15A 2WB1G 1CUKA 1CSQA 1DOLA 3LNNA 5J22A 5M5XH 1TWHB 4GLXA 2QDBA 5EBCA 1L0XB 4IOCA 4DK0A 3T1HQ 3GTMB 1X65A 2AQ3B 1SFOH 1CQVA 2K6AA 2B63B 3D6CA 4X66L 5M5YB 1D8LA 3L3OC 5FLMG 2CH4W 2LFNA 1KTKA 5A35A 4C3IB 2KCNA 2WP8J 1H9KA 1HPCA 2ASBA 1WTVA 4GOPB 3H3VI 1DD2A 3CCSA 4H7BA 2K5WA 1WI5A 3KUPA 2F4VQ 3KF8A 4MIUA 3LWUA 2R7DA 1MD2D 1VQ8A 4DV5Q 1BR9A 1W6KA 4PZ6A 2RHQB 4C3JG 1JWUD 3GTPB 1JQYD 4GOPC 1K28A 1GUWA 3IAYA 2K5DA 3ULPA 1HXYD 2XVSA 5KNCA 5KEEA 3MFGA 1UUPA 4BA2I 4CDDC 4X3KA 2E2HH 3J80L 3AU7A 3CMEA 5JPMC 1V8QA 1AE2A 4BBRG 1EY4A 4B9WA 1LT4D 2Z6KC 1K9MC 1D6EC 3RUZA 4DXFA 3OOCA 2HD3A 5IGBA 4KMUC 4ZKCB 4IUPA 4YCWA 2FINB 4QQBX 1WTXA 5EGTA 1MIUA 3VYSA 3AFQA 3ITPA 1DGSA 1E24A 4DAPA 5LMUQ 2VS1A 4ALPA 1LABA 2JA6G 4DKAC 3CRKC 4B3RQ 2IHFA 3SGIA 5ELDA 3T56B 2K5HA 3PUZA 2F1MA 1EY6A 1STHA 1ENCA 3MA2B 3I4NB 5IYBH 1PH9A 1VQ7A 4K2KA 3NENA 2SDFA 1ZEQX 1TQOA 1S5FD 2A8VA 3T1HL 1WTHA 3G6EA 1FJGQ 2F0EA 1K8OA 1PH5A 4JI3Q 5KGUA 4BY7B 2QILA 3NXWA 1ENFA 3QB3A 2AUKA 2KQ3A 5C4JH 4A3GB 1U4PA 1XPOA 3K57A 3RNUA 3K5NA 5C4XB 1B7YB 1QNKA 1B44D 2M9VA 5E1FA 3J81E 2K5VA 2F4VL 1I50H 3A7LA 4DR1Q 1PTOD 1SJHD 4R9WA 3RN5A 4HCEA 4DV5L 2XWBB 4RFBA 1TVXA 3RN2A 4Y7NH 2F0FA 3GTLH 5LL6S 2M00A 4FYDA 4X62Q 1IBMQ 2FHTA 1EYAA 3HS0C 4RGTA 1A3TA 1KIXA 4XYQA 1XNRQ 1G91A 1Q81C 2F0UA 3HOZH 1EEFD 4HAEA 1ONLA 5IT9E 2ZJQA 3G4SA 4JK1C 2VUMH 1B70B 2JYOA 4IPHA 3MTSA 3J81j 1ZYRC 1I4GA 1MSGA 4KD4A 2EQSA 2VY3A 5LMUL 1QUQB 2R92G 1I5FA 1IKLA 1RDPD 3TBIB 5COYA 3F2CA 2PI2E 4B3RL 3PCOB 1BUVT 1I4RA 2BE5C 4ZYSA 1QVGA 2HDLA 4MTKA 4P75A 1VQNA 1BDOA 2Z4IA 3HOXH 1SR3A 1LLRD 3RLNA 1TWFH 3W2DA 4DAVA 5KRUA 2E5LL 3TEHB 3RZDB 1SE3A 4IUQA 2F0IA 1EFID 3O13A 1A63A 3GTOH 3DM1A 1OO9B 3R93A 3J7YW 4DR4Q 1G291 3OTOL 1FJGL 1SNCA 1BCPC 2Q8IB 2KJXA 2E2JH 2ICEC 4JI3L 3DWQA 4A3BB 2KEDA 2QDLA 2B2WA 3J81L 4HCSA 1HR0Q 1WYDA 2FMCA 5T1GA 3HOYG 4JI4Q 3ONAB 2KHSA 3J81c 4OL7A 4R4TA 4PQXA 5IGDA 1SEBD 1YNJC 1JICA 2PQAA 2Q2UA 3PIOA 1CFMA 3AEVA 4IUUA 1D5ZC 1E0BA 4YCVA 2D0OA 4X62L 4ZAIA 1VQFA 1E22A 5M5WH 1IBML 3U9OA 3LWEA 3K5OA 1PZID 5IT9L 2WINB 3K7UC 4NB3A 1DXMA 2RSNA 2NVTH 1I4QA 2UXBQ 3J7A5 1QG7A 1WD0A 1MHWC 2QF7A 3VYTA 1MSHA 1XMQQ 3NTHA 2I0QA 1LT3D 2RHSB 4FXGC 4RGNA 2ENBA 3STBD 2WKCA 1MJEA 2YTYA 1SLJA 5C3WA 1JE4A 2BDNA 1HJPA 1YEZA 4AYBG 2B2VA 4QCLA 5C44H 1ESFA 4DFAA 2RVLA 3J80i 2PZTA 1KABA 1EWIA 3U9SA 1EU3A 1WTWA 4O0AA 3C1FA 2B2WC 3CPFA 1EIGA 4A3CG 4G4KA 4OWTB 3CC7A 3DM3A 3QJYA 4XYOA 4C56C 2N8NA 4DU9A 3PO2H 2EYHA 3GTKB 4WJ3M 3J7ZC 3QOLA 3CHBD 3GTJH 1VQJA 2OF1A 1OXTA 4L8JA 1SE8A 3NTIA 5JEAH 4DR4L 3KDFA 3V05A 3K0XA 5M3MG 2HT1A 4CDFC 3KLRA 4A3LG 2RKSA 3X3MA 4HJAA 1EZ6A 1HR0L 2WB1E 3H0GG 1QZGA 1DCZA 4EQ5A 1GJXA 1WCMH 3CPWA 5M9OA 4JI4L 4WRDA 2Z4HA 3Q0AA 1BXTA 2NZHA 3AYHB 1R4QB 1JOQA 1VF7A 5I9OA 1IYVA 4HEDA 3S16B 3SEBA 2JA8G 3CRLC 3M3YB 2HHHQ 3P20A 1GUTA 2A6EC 2EY2A 5C0XG 4MN3A 1VQCA 1A0IA 3JAMc 3S1NH 3KJPA 2B2VC 4Y52H 3LGJA 5C3EG 2UXBL 4DV4Q 4G57A 4GLAC 1JORA 1HR0W 4RH6A 1G6PA 2MO0A 2YTVA 4R1JA 1VMPA 1X55A 1Y1VB 1NAPA 1UNSA 1OXSC 1XMQL 3M4OB 3ERQA 3J7AF 4OXPA 4L5RC 3BZKA 3NBIA 1Q1EA 1OXUA 2CH4A 3EIVA 4K5WA 4QF4A 1PA6A 5IP7H 2MPMA 4UDUC 2EYMA 3S1QH 2R92B 1VDZA 2J0TD 3IFTA 4DA2A 3S2DB 2CQOA 4IFDI 1U4MA 1JOKA 4JC0A 2R7ZB 1UEBA 3SHLA 3I3CA 1WOCA 4POFA 3IRBA 2SEBD 1KDAA 3MXNB 4JVZA 3NWSA 4BA1I 2G9HD 5ISRA 2NUCA 3FPPA 4J6HA 4B08A 5IWAQ 1CK1A 1HRJA 3UDIA 1YNNC 3SK5A 4C2MB 3KBGA 3HOWH 4LFAQ 1E3PA 2R93H 1EY9A 4LFBL 4IQZA 4BBSB 4FP5D 1PRTD 3D8GA 5D14A 3TZDA 5FK9C 2DNEA 4JG2A 3TN2A 1MI2A 4C1NK 1SXTA 3A8JE 5CBEE 5AJ3Q 2NVXB 2F0HA 1GKHA 4UY8C 3E5SA 2PCFB 2VL6A 1I6VC 3I90A 4NP5A 1HZ9A 1TWGH 1RD9D 4OIKA 4FVMA 2AQ2B 1EZ8A 4ZK9B 1Z47A 1ICFB 1XPUA 1SYBA 3F2UA 2B63G 1IW7C 3HGBA 1IYJB 2PMZB 2HHHL 3NE5B 3TS0A 3BZCA 2GVBA 4LF4Q 2EJFC 4C3IG 2BH8A 4HJ9A 4DV4L 1UE5A 4KI0A 2RBMA 1PTOH 3HKZG 2L11A 3D6WA 4KY5A 4ZUJA 4K6LA 1X6OA 4IPCA 4XIGS 4KN4C 2EY5A 2RDFA 4H0LC 2MFIA 2XNAC 5M3FH 4ZCKA 4ZLTF 1CKNB 1K3BC 3QO2A 3WWVA 3NQTA 3UDXA 4DUZQ 4A3IB 1IHZA 2LMCB 4RGOS 4WJWA 1HCZA 3RZOB 1AP0A 1KLGD 2RF4A 3T1YQ 3FP9A 1JB3A 4J1MA 1NUCA 4DUYL 1N33Q 1YIJA 3BVGA 2DUDA 2WAQB 1CA5A 3K8AA 2IW3A 1U9RA 4J15A 4CJ0B 4DNTB 2NBFA 3MEFA 2F0LA 4H13C 5EPKA 4BY1H 5GAEC 1PYBA 5JJIA 5IWAL 1GUSA 2K7VA 4RAUC 1B53A 3CCUA 2UXCL 3PO3H 1R9TB 4A3KH 3HOUH 3CU7A 3H0GB 3SK4A 4A3EB 1D5MC 3BVMA 3DWAA 1U5KA 4A3MH 4YWKA 5AJ3L 2YYZA 5ELEA 1SYCA 3GO5A 4O42A 1QCBD 3M9BA 2SNSA 4ID6A 3MAQA 3I4NG 3IKJA 4HMJA 5IOCA 1G8ZD 1LM0A 4A3DH 3D4WA 2I5LX 2VQFL 3KF6A 2KA7A 1JT8A 4BY7G 2L12A 3TP7A 2TSSA 4TRDA 4KN7C 1EUJA 4XT3B 3K7AB 4LFCL 4DGZA 1GM5A 4LF4L 4A3GG 2HIXA 2E2DC 2YU9B 1N32Q 3NHHA 1AEXA 1B4OA 5HY6A 5JJKA 5C3EB 4L63B 5HURA 5C4XG 1EY5A 1Y1WB 1TS5A 2PMZE 4LWCA 1IYUA 4IFDJ 4UHVA 1YHAA 2FFKB 2NVQB 1YITA 2OQKA 5CR3A 1AZQA 1GOZA 3MXPA 3GTGB 1NCVA 3BU2A 4LF8Q 4NDXA 4TKOB 4R8IA 4JI1Q 4DUZL 1EOTA 4JI7Q 4PZ8A 1ILQA 1Q8IA 1KD1C 2CW0D 2ZT9C 5DM63 3T1YL 2EXZA 1AE3A 1D2BA 5LMNL 2Z9HA 1BCPF 2AHOB 4BXXG 1FD7D 1N33L 4K0KQ 2ZM6L 3S1MB 1RCVD 2NVYH 4AYBE 1D1IA 3Q22A 2XRQD 3T13A 2VXWA 1STYA 1B50A 3EBEA 1TWCH 2D62A 4DN4M 3NELA 4OONA 5G3LD 3SE0A 3UDFA 4U673 2DJFC 3I8ZA 3S1RH 3CCJA 1CA6A 2C35B 3F2DA 3VR3A 3C46A 3CQZB 1GUGA 4IPGA 4RKLA 1PH3A 5I4DA 5FOBB 4A3FB 1DOMA 5IYDG 1KC8C 3A0JA 4K5VA 1TKWB 2F3WA 4C3HB 3DXJC 5EBDA 1RL2A 3I70A 4K14A 3FMCA 5LMNW 4IUNA 3OWEB 5CBAE 3FKIB 2I5HA 1KLUD 5FLMH 1EWCA 2AWOA 2IT1A 1CTMA 3V96A 3S2HH 1SNOA 4A3JB 1CZGA 2KOLA 4LF5Q 3M4YA 2BOSA 1XMOL 1QZHA 4A93G 1LTID 1V1PB 5EQ0A 3U4VA 4A3BG 1EU4A 4I7AA 2ID0A 1N32L 3KYHC 2MGSA 5C5MA 2MHVA 2K33A 4C3JH 3KJOA 3HKZB 1Z7TA 4GZYC 4DV0Q 1X56A 1F9PA 2VNUD 2A74C 3BG3A 2XRSD 3FPUB 2G9DA 2HUGA 2IX0A 3OYYA 2IPKD 4C1NI 1EOVA 3RLFA 2F0JA 4LF8L 4KKTA 1C8CA 4DR6Q 1I4XA 4BBRH 5J3BA 2L4NA 4JI1L 4GKJQ 1CKMA 3CMAA 4JI7L 3CCVA 3DUZA 1YZ6A 2IJ0A 3A54A 1YNXA 3SR1A 3T51B 4FXKC 4JPBW 1DYQA 2F0DA 5J39A 3H3VC 4K0KL 1E1OA 3J80c 1K83H 2N49A 3BDLA 2JA6H 3I4MH 5KNDA 5JEAJ 4FF4A 1Q12A 4O2DA 1B8AA 3D4DA 1K73C 2JK8A 1HHVA 2UUAL 4ODGA 2D5DA 3EA6A 1I6HB 1O7YA 1PTOC 3KF8B 2P5ZX 4YWLA 3L9AX 4JOIA 2JJQA 3SVMA 4B3SQ 3S14B 1DONA 4OWXB 2EVBA 2LSSA 4HJ8A 1S3OA 3L2PA 3E0JA 2V4DA 2QGQA 5LHY1 1DJRD 1WD1A 3TP6A 4RHSA 3ND9A 5HGQA 3S15B 1TY0A 2MQHA 4LF5L 3A5ZB 4QY7A 1ILPA 4MTNA 4Q5VA 1H95A 1SMYD 2O2LD 4MNOA 1HNXQ 3QIAA 4CKEA 5E4WC 1FNUA 3G71A 2K28A 1RIPA 2F03A 4KK7A 4DV0L 1WVLA 1E2VA 4I65A 4G7OC 3NQIA 4E6IA 4IUTA 2UXDQ 1IKMA 1EIFA 4RCNA 2CKZB 3H09A 1QOHA 4DR6L 2A6HD 4CHTB 4DNIA 3HKZE 4TVAB 3S17B 4GKJL 1N34Q 4FXDA 1RODA 2PQEA 5I2YA 3PGZA 5FLXE 2JA7G 2XGTA 4H44C 5GAHC 1E2ZA 4QUCA 1AH9A 4IUVA 4DV6Q 1Y1VG 1FYCA 4JOIC 2XIWA 4B9XA 4IFDH 4KY7A 4CDEC 4HIOA 1KQSA 3M7NA 1GHKA 3NEMA 1A3UA 4HR7B 1F2MA 4IPDA 2ATWA 3D4RA 4DPGA 2L0CA 1PH8A 5L37A 1BOSA 5JJLA 4LF6Q 4EGVA 2NTTA 4JI5Q 3I2ZA 1I4PA 4RCOA 2R7ZG 3I72A 1TS2A 4B3SL 2Z6BA 1D5XC 2IY5B 5IYCH 1BCPB 3IFDA 2HIVA 4JCVE 4TQUS 1B9NA 1S5DD 2JA5B 3E3XA 1TWAH 3ULJA 1PVOA 1HUMA 2KHIA 2OWOA 1KXLA 2A68D 2KCMA 4A93B 2DN8A 3HOYH 4BBSG 2G5DA 3WOEA 3OW7A 2N55A 1EQTA 1RTOA 4QL5A 1HA5A 1TS4A 4R4OA 4OEMB 3STBC 3UE0A 1JR0D 1QWYA 1K8GA 3S24A 1CQFA 4DR1L 1K0SA 2OTJA 4IZ8A 3CC2A 3HOVB 3PQIA 5FLXL 5M5XB 1ASZA 5ELOA 2UXDL 1P8LA 3HKSA 2PYKA 4LF7Q 2EDGA 4M8AA 5JVG3 1SFOB 1N34L 4O1NA 4IJLA 1CI3M 2J4XA 1I3QH 2RDGA 3GDEA 3S9WA 4UP7A 2A1AA 5IT9c 2F0GA 3PUYA 1XNRL 1PMRA 1VS0A 3SK6A 4DV6L 3MC0B 1KRTA 1X3GA 1EY7A 5ELNA 3PSIA 1HQMC 1XNQQ 1JE5A 4AIMA 1BVSA 3C3LA 1O7ZA 5JVH3 4G7HC 3TRZA 3NSWA 3R3OA 3DWPA 2JSOA 2K04A 1LTRD 2B2YA 4A3IG 4R4IA 4IALA 1F9RA 4A3CH 1K8AC 1SYEA 2KHJA 1O7LA 4LF6L 1MGSA 1Q46A 4KHPQ 1E1TA 3M4QA 3OSOA 4JI5L 1IXRA 1QNUA 4APVA 1FL0A 1RKNA 1UE1A 2R3ZA 1PDQA 2PQAB 1FGBD 2CWAA 1VQMA 2PO4A 4K2LA 2E2HB 3M85A 2WAQG 5M3MH 5CC4A 3V2TA 2ICIA 4ZRZA 4A3LH 1KHIA 1K8MA 1B1ZA 3HEJA 4N9PA 2TMPA 3K81C 1SJED 4JI2Q 5GAGC 3X3NA 1CM9A 4JW0A 2MP1A 5IGCA 4JV5Q 1BF4A 4A3EG 1YJWA 2B39A 2Q2IA 4ZKBB 1JJ2A 5IGEA 3Q6SA 2A5HA 2JA8H 1J9OA 2A69D 1SBBB 1HZBA 1Q82C 5C0XH 4QB4A 1ENAA 4F8MA 3PO2G 4LUVA 3PUVA 5GADC 1EQVA 2MNAA 3CCEA 2B8GA 5EKKA 1VQBA 1V43A 4LF7L 3VA5A 1PRTB 4B3TQ 2H5XA 2F3VA 4A76A 2B2YC 2JA7B 3TZUA 3MVVA 2JE6I 1F2LA 4XQQA 4NMZA 2B2TA 2OEOA 5C4JB 1EQQA 1VQ4A 1Y1WG 3VR5A 2EE1A 1AW7A 1CSPA 1WCMG 2O5JC 3KDFB 2AWNA 3NWTA 1PRTC 1XNQL 3CP0A 4OO1H 1I50B 1KL9A 4GS3A 1E7ZA 1YHQA 1JC7A 1L2FA 4Y7NB 3GTQH 3UE1A 3GTLB 1TR5A 4KHPL 2R61A 1LV9A 3TS2A 3SXHA 3EROA 2IL8A 2NN6G 3BDOA 2M2LA 4OX9Q 1OXXK 4JBKA 5CYUA 4EX5A 4HN7A 2PNRC 1OXVA 2NTSA 2EYJA 2PW5A 1HUNA 2F4IA 2BDOA 2L1BA 3HOZB 4P71A 1Y8PB 4DR5Q 1I94Q 1PH6A 2L15A 3TDQA 1KAAA 2ZTCA 5D65A 2VUMB 1FR3A 1LUZA 4XQJA 1IZ6A 3A56A 2E2IH 4JI2L 3T4AC 2QW7A 4A3FG 1TWHH 4JV5L 2O4XA 2WIIB 1NSNS 3I4OA 5I6YA 1A2UA 3GTMH 3A74A 4C3HG 5FJ8G 4YCUA 4JI0Q 3K80C 4CDCC 2B63H 5CV8A 2AQ1B 2B2TC 5M5YH 4HIDA 3FKIG 5BN3A 3HOXB 1TWFB 1D1KA 4NPSA 2ZXRA 1WFQA 4A3JG 1SYDA 4P2CB 4C3IH 4CKBA 3GTOB 3HOWG 5EKLA 3NTKA 1ICWA 1HA6A 5KYLA 4B3TL 1Q7YC 2E2JB 1YHBA 1HNZQ 2RCNA 3K5MA 3OIPA 1BO0A 3BS1A 2EYOA 5E7NA 3P7JA 3GTPH 2CVRA 1X3EA 1SSOA 1PTOF 4BS9A 3G48A 2B2UA 4IN3A 3ICEA 4NW2A 1QVCA 4L5QA 4WORA 2X6LA 2WFWA 4G7ZC 4F7XA 3P75A 1AFPA 1Z9FA 1KNEA 4HMIA 2ZJPA 1EY0A 5AFWA 1WJJA 1X3FA 4HJ5A 4IJHA 2I07B 2DY7A 1SNDA 1U0LA 1D7QA 1JWSD 1EIHA 1RHPA 2HCIA 1QJOA 3PIP3 1UE7A 5M5WB 4OX9L 4EQNA 1F77A 2XTIA 2NVTB 4P74A 4K5XA 3E9HA 2D9UA 5BN5A 1YJ9A 2PZUA 3PF5A 5I9PA 5EKIA 1SDFA 4DR5L 1VQ5A 1I94L 3EFXD 3FDTA 3VR6A 1V1QA 1LTTD 4KHVA 5ELFA 4LFAL 3G6JB 3FRPB 1BBUA 5EAYA 2DJGC 3H6MA 5C44B 3I4NH 4KTAA 2C9OA 1A6XA 3AQQA 4JI0L 4P73A 4ABNA 1MKHA 4BY7H 1PZJD 4PMWA 1II3A 1PFBA 3GQBA 4K6DA 3PO2B 4A3GH 2B2UC 4BY1G 2CW0C 1IBKQ 1EEID 4DXGA 4XDXA 4RWSC 2WKDA 5K36H 3GTJB 4NKLA 2F0PA 5C4XH 3QG1A 4L6TB 2VZAA 4JBMA 2N78A 4JBWA 5C0XI 3MXGA 1DM0B 1OTCA 1Y69U 3NP8A 1HNZL 1G51A 1STBA 1VQOA 2Q8TA 3HOUG 2K5NA 5J1ZA 3H94A 1IL8A 1WCMB 2QA4A 2DNCA 1Y8NB 3KBXA 4A3MG 1GUNA 1PH7A 1U4RA 1EFWA 4LNQA 2K14A 5IP9G 4N8FA 2QKIC 3OMCA 1FNVA 3RR5A 4DNRB 1GHJA 2PPBC 2E74C 2JQOA 1YI2A 2XSCA 2C5CA 4GN3B 4ULLA 5CV9A 2OTLA 4OO1I 3KFUA 5C4ZA 1M90C 4HTHA 3S1NB 2D0PA 3ULLA 1F2YA 1TY2A 4LJZC 1BQQT 1HFNA 4R4CA 3P1HA 2QCPX 4KJNA 3KF6B 3I91A 4NXNQ 2HQEA 1LTAD 1DZ1A 3OPOA 4U68A 2VW9A 4AQYQ 1L0WA 5BN4A 1O80A 1SYFA 5IYDH 5JJZA 1LTBD 3AMUA 1E2WA 4DAYA 2UU9Q 3DEPA 2WAQE 3RZDH 2LY7A 1STNA 1EQRA 1S5ED 1LTGD 2YTXA 3C2PA 2PZWA 2IX1A 3S1QB 1KRSA 1NTGA 2LKVA 3Q8DA 1QB5D 4BWGB 1HNWQ 2LS01 4NXMQ 2E76C 3K0YA 4DV7Q 4KV6A 3BZDB 2B3GA 4HSPA 2JA5G 3HP3A 3I4LA 4A3BH 5BR8Q 1EYCA 4DV1Q 1VQAA 1HZAA 3MXUA 4A4IA 1IBKL 4OHJA 3ERSX 1LT6D 3U4ZA 5KYIA 2CHBD 3HOWB 1HTPA 2KUMA 2KCTA 1VQIA 2R93B 1XX8A 3DEOA 1UWVA 3C1EA 3Q24A 3KLWA 5DLQE 4DK1A 1SYGA 2DGYA 1H9JA 1NR4A 1IBLQ 3KLSA 1K0RA 2Z8LA 5IY0A 3A55A 2JEAI 1PH2A 2WACA 4FF3A 1VQGA 4GKKQ 1FNWA 2E8GA 2PI2A 3HOVG 2ZTDA 4DAYB 1C0AA 1VQPA 1JOOA 1TWGB 2K52A 3ER0A 1V9PA 2K75A 5NUCA 1IL2A 5FO9B 3F1ZA 4KKSA 5I2XA 1S5BD 1JJGA 2SNMA 2IHEA 2RCFA 2K4KA 1SNPA 4IO9A 3L0OA 4CGYB 4RMFA 2F0SA 1PTOB 3NK9A 3L7ZC 2EIFA 4NXNL 4AQYL 1SMYC 4UP8A 1XTCD 3AB9A 3OIQA 4QJFA 1HH2P 3EQLC 2XN9C 1KDCA 5M3FB 2Q2TA 1KDBA 3G7LA 2Q2HA 2UU9L 3D0FA 3GTKH 2H1EA 1C48A 2EY6A 3VYUA 3PUXA 5D3IB 1MJCA 2RDHA 3HG9A 4P72A 1HNWL 5CV7A 4NXML 4DV7L 4DR2Q 5C0XJ 3E6ZX 1CKOA 1C4QA 2A6HC 4CKCA 5IIFA 1W3SA 4OIJA 4XXEA 5BR8L 1WTRA 4DV1L 1X54A 1PHJA 3I4MG 5CMDA 1Q8KA 5F2DA 3GD7A 4BY1B 4JYAQ 2BH2A 3RD4A 1ET6A 3T53B 1PRTF 3RLOA 4POGA 3MEHA 1QILA 1JWMD 4L5SA 1PLFA 4MZ9A 3KK7A 2E5LQ 1XPRA 3FHWA 1TIID 3PO3B 2JA9A 2X6GA 1VQ6A 3S16H 3W1GA 2EYLA 3BVZA 2F0TA 4A3KB 3HOUB 1IBLL 2VB2X 4LW1A 3M3YH 3I7FA 1RTNA 4H02A 4WJ4A 4A3MB 3NPPA 4YIJA 3OTOQ 4GKKL 3WOFA 3U58A 2F0QA 3R2TA 5CV4A 3NBHA 1ASYA 1N36Q 2JA7H 5IYBG 4X3UA 3BYTB 4F87A 1B9MA 5KIXA 1BKBA 3H91A 4A3DB 1B2TA 1C9OA 3Q23A 1QUQA 1Y1VH 4UPAA 3M4OH 5H1SE 5IE8A 1PXUA 2GVAA 1J8IA 2KENA 1Q3LA 2FXQA 2A68C 1TU2B 1WTPA 2CFMA 3D31A 2R92H 1J6QA 3S2DH 1L1OA 1ZKOA 2R7ZH 1U4LA 5DAUA 3KOJA 4JI6Q 2O5IC 1R4PB 3EN2A 1T5EA 2D2CC 1XWEA 1EWHA 3SDZA 4PG3A 2MO1A 1M1KC 2EYPA 1STAA 1X32A 3LX0A 1GD7A 2KCCA 2NWGA 1G2SA 4KHZA 1GO3E 1X3PA 4C2MH 3NBHB 4N8X1 1W2BA 3W3AA 2K32A 3I55A 4DR2L 4BBSH 4KKUA 3HOZG 1SNMA 1H9MA 3TSSA 4TSSA 2Y0SG 1P16A 2NVYB 1YJNA 4IFDG 4PNYA 1XTDA 3OW2A 2VUMG 4JYAL 3UI2A 4ME5A 4DV3Q 1TWCB 1NMGA 2QEJC 2NVXH 3R2IA 1PFSA 2EZVA 1VQDA 3QWNA 3S1RB 1TXYA 3GV3A 1VF5C 3QR8A 1HNXL 3VR4A 4PZ7A 2WB1B 1H9SA 1VQLA 1L1OB 1GUOA 1SE4A 5IYCG 1S5CD 5I6WA 3HOXG 1EIYB 3CXCA 3GP7A 1VMCA 5K5PA 2WV6D 2IWHA 2V1CC 1N36L 5DNFA 1S4ZA 2PNHA 2K1BA 2BA1A 2GN5A 5A2QE 1S72A 3S2HB 1ZYRD 5DM73 5FLXc 1L1OC 1NY4A 3VR2A 1VQKA 3CCLA 1SMXA 1HZCA 1W6JA 3TP8A 4YY3Q 4DR3Q 4DK3C 1TT2A 2JXMB 1LTSD 2UUBQ 3CF5A 5ELCA 5LL6X 2F52A 2BE5D 5FKAC 3U50C 1B3QA 3HFZB 5T1IA 2OCEA 4A3IH 2LXKA 4C3JB 4MHEA 1H9RA 3BYYB 3F2BA 4M1UB 4ZQ3A 3RZOH 5JOBA 1C7YA 1EY8A 1M8AA 1B3AA 1HFGA 2ZXOA 4JI6L 1BBWA 3JAME 2A69C 4HIMA 2F0MA 2JP1A 4XTCS 1H9SB 1TS3A 4CBVA 1BCPD 1Q1BA 2F0KA 4LMQD 4BBRB 2N88A 1PFMA 4KY6A 3R8BA 3MFYA 3CCQA 4HSVA 2OT2A 1S40A 1SROA 4GNXA 1R9TH 4LF9Q 1YNJD 2OXPA 1K83B 2NZOA 1NMFA 4X64Q 2JA6B 3I4MB 3H0GH 4X65Q 2JEBI 1LYLA 4K8JA 1VCIA 5G3LF 4A3EH 5IGFA 4PMCA 4DV3L 3QOJA 3TP5A 4KD3A 1STGA 2ALYB 2NZ1D 4EVOA 5C44G 1RF2D 1ESRA 2FJ2A 5CGKA 3J7AV 3ND8A 1ML0D 3M4PA 4IURA 1NNXA 5A2QL 3SK8A 3NUCA 1JJCB 1T5XD 5C4HA 3N6RA 4LFBQ 3K7AH 4S3SA 3PF4A 1FGUA 2YU9H 2CCZA 5C3EH 4R4QA 4OWWB 5JEAG 1Y1WH 4V0BA 4ILWA 2B8FA 2UUCQ 3CW2C 5JAVA 4OGQC 1F9QA 2NVQH 3CCMA 2KEEA 1M4VA 1Z6HA 3HZXA 3VA7A 4YY3L 4DR3L 4JI8Q 4RKBA 3AFPA 3GTGH 3PIO3 1Y14B 4GNXB 2UUBL 3MXNA 4WFN3 2HCCA 1LTLA 3H15A 2K03A 1T9HA 1SNQA 3JAML 5CORA 1HTLD 2EYFA 2NN6H 3OHXC 1NBWA 1A3VA 1PYWD 4KLKA 1PH1A 4GNXC 2JN4A 1PH4A 3RMHA 1AZPA 2J7ZA 3S1MH 5C5LA 5EPLA 2MUYA 3PIPA 1RJTA 2K05A 3K59A 2K01A 1QVFA 1PFNA 2ZXPA 3K5LA 1XXGA 1NR2A 2I5MX 2L5TA 3CQZH 1UE6A 4ZUIA 2Y0SB 5IODA 4LF9L 4OO1G 4A3FH 4X64L 3TMEA 4X65L 2R6GA 4B3MQ 2F3IA 5FJ8H 4C3HH 2HQLA 5IP7G 4R8NA 2AUJD 4DUYQ 2A6ED 3OMGA 3FKIH 3CD6A 5E4XA 4HJ7A 4V190 1A8VA 2KECA 4QMGA 4GN4B 2F0OA 4J8QA 3W5OA 4A3JH 3UDGA 2RA4A 1JCKB 1KNAA 1AN8A 4RA8A 1F2ZA 4UP9A 1JMCA 2Z1CA 3PV0A 4GLVB 3CAMA 5E3FA 1EYDA 2UXCQ 2SOBA 1TWAB 2L55A 5EJWA 1G2TA 2PW7A 1CKNA 4X3TA 2EY1A 2R93G 1ET9A 2H4OA 3HOYB 1PZKD 2UUCL 1V1OA 1LACA 3K6OA 4UAIA 4X3SA 3BDCA 4JI8L 4QIWB 5FO7B 3H3VH 2NB0A 1DOKA 4X6AH 3URYA 3MHBA 2EPBA 2VQFQ 2XWJB 3J81i 2F0NA 5C3XA 2ZTEA 4LFCQ 2BCOA 1J5EQ 4A75A 1LO5D 2RQXA 2Z0SA 1CHQD 1YNND 4F88A 4I7ZC 5ELBA 4FDBA 1HQRD 2RSOA 2LXJA 4YWMA 3MWYW 4DV2Q 1O78A 3BJUA 2QEXA 2GA4B 3EJIA 1I3QB 2K5QA 3TQYA 2KBNA 1N8RC 1UAPA 1VQ9A 4FNFA 3B6YA 4LUOA 3N52A 2I46A 1I6HH 3IL8A 4EQOA 4AYBB 3VDYA 1YVCA 3I73A 3OWFA 3S14H 4QUFA 4CJ2C 4DK6C 5CV6A 1X9NA 4B3ML 4N9TA 3PUWA 5M3FG 1IW7D 5LMNQ 1N9WA 2AMCB 5HGTA 2VQEQ 3KLSX 4PV1C 2ZM6Q 2EXDA 1SAPA 1LT5D 2BA0A 1JB7A 1ZXTA 2Y0SE 3TREA 3E0EA 1NJIC 3S15H 2AKWB 4OELB 4YHHQ 2CWPA 3ZJYC 1A2TA 3FVQA 3DMUA 4FF1A 3DHQA 4RGMA 4DAMA 4LK1C 5M3MB 5EPJA 2HDMA 1EL0A 4XT1B 1F9SA 1BBXC 1CT1D 1K3RA 1BNZA 1CHPD 2E75C 3CKIB 4XQNA 3GV6A 2ES2A 1GXDC 5IGGA 4DR7Q 5D3DA 4LAAA 1XJVA 2B29A 4RG1A 3PO3G 5IP9H 1A62A 1Q86C 1SRUA 4A3KG 2MJ8A 1WTOA 5GQOA 1SN8A 4RHRA 5TSSA 3W1BA 1G6ZA 4DF7A 1XMOQ 3A7AB 2JA8B 4LUZA 3S17H 4KJOA 3K58A 1WTQA 4X66Q 1MBYA 1Q90A 3I56A 2L9HA 3D3RA 1J5EL 4QIWE 2CQAA 3MZ5A 3ZYYX 4BXXH 5GROA 3T16A 4A3DG 1YBYA 2N3SA 5K36G 2F0WA 1EYGA 4K8IA 1STEA 2F0VA 2OQ0A 4DV2L 2IX3A 2A19A 2K50A 1Y8OB 2DY8A 3CC4A 2NYZD 1FVIA 1L0YB 2Q8RE 3FEWX 1UEAB 1VQEA 2NN6I 4GN5A 3A8KE 2EJMA 3JAMi 4Z9CB 1KAWA 2X69A 5FO8B 4AH6A 3EVQA 2KVMA 5KNBA 5JPNC 1SE2A 1NE3A 4IOAA 2A73B 1X3QA 4L5TA 4JBJA 3VYRA 1V1PA 1I4HA 1O7IA 3WDNA 3A5UA 4FF2A 3GTQB 4CJ1B 2JA5H 3E9IA 2YV5A 2VQEL 1PYSB 4FO2A 1PV4A 3CCRA 2FMMA 4GOPA 1CZWA 3J80E 2EJGC 4A93H 3HRZC 2VB3X 4YHHL 1QE6A 3F8TA 5C6AA 1GVPA 3A8IE 2UUAQ
chains in the Genus database with same CATH topology
4PMBA 2EOTA 5CV5A 4EQPA 1XYIA 3M7GA 5DEHA 4Q0FA 3PMFA 2E2IB 1A15A 3LNNA 1DOLA 5J22A 1TWHB 2QDBA 5EBCA 1L0XB 4DK0A 3GTMB 2AQ3B 2B63B 1CQVA 2K6AA 3D6CA 5M5YB 3L3OC 2LFNA 1KTKA 5A35A 4C3IB 2KCNA 2WP8J 1H9KA 1HPCA 1WTVA 1DD2A 4H7BA 2K5WA 3KUPA 3KF8A 4MIUA 3LWUA 1MD2D 1BR9A 1W6KA 4C3JG 3GTPB 1JWUD 1JQYD 1GUWA 3IAYA 2K5DA 1HXYD 2XVSA 5KNCA 5KEEA 3MFGA 1UUPA 4BA2I 4X3KA 3J80L 3AU7A 5JPMC 1V8QA 1EY4A 4B9WA 1LT4D 1D6EC 3RUZA 4DXFA 3OOCA 5IGBA 4KMUC 4ZKCB 4IUPA 2FINB 1WTXA 5EGTA 3VYSA 3ITPA 4DAPA 1LABA 3CRKC 5ELDA 3T56B 3PUZA 2F1MA 1EY6A 1STHA 1ENCA 3MA2B 3I4NB 4K2KA 2SDFA 1ZEQX 1TQOA 1S5FD 2F0EA 1K8OA 5KGUA 4BY7B 2QILA 3NXWA 1ENFA 3QB3A 2AUKA 2KQ3A 4A3GB 1U4PA 3K57A 3K5NA 5C4XB 1QNKA 1B44D 2M9VA 5E1FA 3J81E 3A7LA 1PTOD 1SJHD 4R9WA 4HCEA 2XWBB 4RFBA 1TVXA 2F0FA 5LL6S 2M00A 4FYDA 2FHTA 1EYAA 3HS0C 4RGTA 1A3TA 4XYQA 1G91A 2F0UA 1EEFD 4HAEA 1ONLA 5IT9E 4JK1C 2JYOA 3MTSA 1ZYRC 1I4GA 1MSGA 4KD4A 1IKLA 1RDPD 3TBIB 5COYA 1BUVT 1I4RA 2BE5C 4ZYSA 2HDLA 1BDOA 2Z4IA 1LLRD 3W2DA 4DAVA 5KRUA 3RZDB 1SE3A 4IUQA 2F0IA 1EFID 3O13A 3DM1A 1OO9B 3R93A 3J7YW 1G291 1SNCA 1BCPC 2Q8IB 2KJXA 2ICEC 3DWQA 4A3BB 2KEDA 2B2WA 3J81L 4HCSA 2FMCA 5T1GA 3ONAB 2KHSA 4OL7A 4PQXA 5IGDA 1SEBD 1YNJC 1JICA 1CFMA 4IUUA 1D5ZC 1E0BA 4ZAIA 3U9OA 3LWEA 3K5OA 1PZID 5IT9L 2WINB 1DXMA 2RSNA 1I4QA 1QG7A 1WD0A 2QF7A 3VYTA 1MSHA 3NTHA 1LT3D 4FXGC 4RGNA 2ENBA 2WKCA 5C3WA 1JE4A 2BDNA 4QCLA 2B2VA 1ESFA 4DFAA 2RVLA 2PZTA 1KABA 3U9SA 1EU3A 1WTWA 3C1FA 2B2WC 1EIGA 4G4KA 3QJYA 4XYOA 4C56C 3GTKB 4DU9A 2EYHA 3QOLA 3CHBD 2OF1A 1OXTA 4L8JA 5JEAH 3NTIA 3V05A 3KLRA 2RKSA 3X3MA 1EZ6A 1DCZA 1GJXA 5M9OA 4WRDA 2Z4HA 3Q0AA 1BXTA 1R4QB 1JOQA 1VF7A 5I9OA 1IYVA 4HEDA 3S16B 3SEBA 3CRLC 3M3YB 1GUTA 2A6EC 2EY2A 3P20A 5C0XG 4MN3A 2B2VC 4G57A 1JORA 4RH6A 1VMPA 1Y1VB 1NAPA 1UNSA 1OXSC 3M4OB 3ERQA 3J7AF 3NBIA 1Q1EA 1OXUA 4K5WA 4QF4A 2MPMA 4UDUC 2EYMA 2R92B 1VDZA 2J0TD 3IFTA 4DA2A 3S2DB 4IFDI 1U4MA 1JOKA 2R7ZB 3SHLA 3I3CA 2SEBD 1KDAA 3NWSA 4BA1I 2G9HD 5ISRA 2NUCA 3FPPA 4J6HA 4B08A 1CK1A 1HRJA 4C2MB 1YNNC 3SK5A 3KBGA 1EY9A 4IQZA 4BBSB 4FP5D 1PRTD 3D8GA 5D14A 3TZDA 5FK9C 2DNEA 3TN2A 1MI2A 4C1NK 1SXTA 3A8JE 5CBEE 2NVXB 2F0HA 3E5SA 2PCFB 4NP5A 1I6VC 3I90A 1RD9D 4OIKA 2AQ2B 4FVMA 1EZ8A 4ZK9B 1Z47A 1SYBA 3F2UA 1IW7C 3HGBA 2PMZB 3NE5B 2EJFC 4C3IG 4KI0A 2RBMA 1PTOH 2L11A 4KY5A 3D6WA 4ZUJA 4K6LA 4XIGS 4KN4C 2EY5A 2RDFA 4H0LC 2XNAC 4ZLTF 3QO2A 3NQTA 4A3IB 1IHZA 2LMCB 4RGOS 4WJWA 1HCZA 3RZOB 1AP0A 1KLGD 1JB3A 4J1MA 1NUCA 3BVGA 2WAQB 1CA5A 2IW3A 1U9RA 4CJ0B 4DNTB 2NBFA 2F0LA 4H13C 5EPKA 1GUSA 2K7VA 4RAUC 1B53A 1R9TB 3CU7A 3H0GB 3SK4A 4A3EB 1D5MC 3BVMA 3DWAA 2YYZA 5ELEA 1SYCA 3GO5A 4O42A 1QCBD 2SNSA 4ID6A 3MAQA 3IKJA 4HMJA 5IOCA 1G8ZD 3D4WA 2KA7A 2L12A 3TP7A 2TSSA 4TRDA 4KN7C 4XT3B 3K7AB 4DGZA 2E2DC 2YU9B 3NHHA 1AEXA 1B4OA 5C3EB 4L63B 5HURA 1EY5A 1Y1WB 1TS5A 1IYUA 4IFDJ 2FFKB 2NVQB 5CR3A 1AZQA 1GOZA 3MXPA 3GTGB 1NCVA 4NDXA 4TKOB 4R8IA 1EOTA 1ILQA 1Q8IA 2CW0D 2ZT9C 5DM63 2EXZA 1D2BA 1BCPF 1FD7D 3S1MB 1RCVD 1D1IA 3Q22A 2XRQD 3T13A 2VXWA 1STYA 1B50A 2D62A 4DN4M 5G3LD 3SE0A 1CA6A 4U673 3I8ZA 3VR3A 3C46A 3CQZB 1GUGA 4RKLA 5I4DA 5FOBB 4A3FB 1DOMA 4K5VA 1TKWB 2F3WA 4C3HB 3DXJC 5EBDA 3I70A 4K14A 3FMCA 4IUNA 3OWEB 5CBAE 3FKIB 1KLUD 1EWCA 2AWOA 2IT1A 1CTMA 3V96A 1SNOA 4A3JB 1CZGA 2KOLA 3M4YA 2BOSA 1LTID 1V1PB 5EQ0A 1EU4A 2ID0A 2MGSA 5C5MA 2MHVA 2K33A 3HKZB 1Z7TA 4GZYC 1F9PA 2VNUD 2A74C 3BG3A 2XRSD 3FPUB 2G9DA 2HUGA 2IX0A 4C1NI 2IPKD 3RLFA 2F0JA 4KKTA 1C8CA 1I4XA 2L4NA 3DUZA 2IJ0A 3A54A 3SR1A 3T51B 4FXKC 1DYQA 2F0DA 5J39A 3H3VC 3BDLA 5KNDA 5JEAJ 4FF4A 1Q12A 3D4DA 1HHVA 4ODGA 2D5DA 3EA6A 1I6HB 1O7YA 1PTOC 3L9AX 3S14B 3SVMA 1DONA 2EVBA 3E0JA 2V4DA 5LHY1 1DJRD 1WD1A 3TP6A 4RHSA 3ND9A 3S15B 1TY0A 1ILPA 4Q5VA 1SMYD 2O2LD 3QIAA 4CKEA 5E4WC 1FNUA 2K28A 2F03A 4KK7A 1WVLA 1E2VA 4I65A 4G7OC 3NQIA 4E6IA 4IUTA 1IKMA 4RCNA 3H09A 1QOHA 2A6HD 4CHTB 3S17B 4FXDA 1RODA 2PQEA 5I2YA 5FLXE 4H44C 1E2ZA 4QUCA 4IUVA 1FYCA 2XIWA 4B9XA 4IFDH 4KY7A 3M7NA 1GHKA 1A3UA 4HR7B 1F2MA 3D4RA 2L0CA 1BOSA 4EGVA 2NTTA 1I4PA 4RCOA 3I72A 1TS2A 1D5XC 1BCPB 3IFDA 4TQUS 1B9NA 1S5DD 2JA5B 1HUMA 2A68D 4A93B 2DN8A 3WOEA 3OW7A 2N55A 1EQTA 1RTOA 1HA5A 1TS4A 1JR0D 1QWYA 1CQFA 4IZ8A 3HOVB 5FLXL 5M5XB 2PYKA 2EDGA 4M8AA 5JVG3 1SFOB 4O1NA 1CI3M 2J4XA 2RDGA 3S9WA 2F0GA 3PUYA 1PMRA 3SK6A 3MC0B 1EY7A 1HQMC 3C3LA 1O7ZA 5JVH3 4G7HC 3NSWA 3R3OA 3DWPA 2JSOA 2K04A 1LTRD 2B2YA 4IALA 1F9RA 1SYEA 1O7LA 1MGSA 3OSOA 1QNUA 1RKNA 2R3ZA 1PDQA 1FGBD 2PO4A 4K2LA 2E2HB 3M85A 5CC4A 3V2TA 2ICIA 4ZRZA 1K8MA 1B1ZA 3HEJA 4N9PA 2TMPA 1SJED 3X3NA 1CM9A 2MP1A 5IGCA 1BF4A 2B39A 4ZKBB 5IGEA 3Q6SA 2A5HA 1J9OA 2A69D 1SBBB 5C0XH 4QB4A 1ENAA 4F8MA 3PUVA 1EQVA 2B8GA 5EKKA 1V43A 3VA5A 1PRTB 2F3VA 2B2YC 2JA7B 3TZUA 3MVVA 2JE6I 1F2LA 4XQQA 4NMZA 2B2TA 2OEOA 5C4JB 3VR5A 2EE1A 1AW7A 2O5JC 2AWNA 3NWTA 1PRTC 4OO1H 1I50B 1JC7A 4Y7NB 3GTLB 1TR5A 2R61A 1LV9A 3SXHA 3EROA 2IL8A 2NN6G 3BDOA 2M2LA 1OXXK 5CYUA 4HN7A 2PNRC 1OXVA 2NTSA 2EYJA 2PW5A 1HUNA 2F4IA 2BDOA 2L1BA 3HOZB 1Y8PB 3TDQA 1KAAA 5D65A 2VUMB 1FR3A 4XQJA 3A56A 3T4AC 2O4XA 2WIIB 1NSNS 5I6YA 1A2UA 4C3HG 5CV8A 2AQ1B 2B2TC 5BN3A 3HOXB 1TWFB 1D1KA 2ZXRA 1SYDA 4P2CB 4CKBA 3GTOB 5EKLA 3NTKA 1ICWA 1HA6A 5KYLA 2E2JB 3K5MA 3OIPA 1BO0A 3BS1A 2EYOA 3P7JA 2CVRA 1SSOA 1PTOF 4BS9A 2B2UA 4IN3A 4NW2A 4WORA 2X6LA 4G7ZC 4F7XA 3P75A 1AFPA 1KNEA 4HMIA 1EY0A 5AFWA 2I07B 2DY7A 1SNDA 1EIHA 1JWSD 1RHPA 2HCIA 1QJOA 3PIP3 5M5WB 4EQNA 1F77A 2NVTB 4K5XA 2D9UA 5BN5A 2PZUA 5I9PA 5EKIA 1SDFA 3EFXD 3FDTA 3VR6A 5ELFA 1LTTD 4KHVA 3G6JB 3FRPB 3H6MA 5C44B 4KTAA 2C9OA 1A6XA 4ABNA 1PZJD 4PMWA 1II3A 1PFBA 3GQBA 4K6DA 3PO2B 2B2UC 2CW0C 4DXGA 1EEID 4XDXA 4RWSC 2WKDA 5K36H 3GTJB 4NKLA 2F0PA 3QG1A 4L6TB 4JBWA 5C0XI 3MXGA 1DM0B 1Y69U 3NP8A 1STBA 2Q8TA 5J1ZA 3H94A 1IL8A 1WCMB 2DNCA 1Y8NB 3KBXA 1GUNA 1U4RA 2QKIC 3OMCA 1FNVA 4DNRB 1GHJA 2PPBC 2E74C 2XSCA 2C5CA 4ULLA 5CV9A 4OO1I 5C4ZA 4HTHA 3S1NB 1F2YA 1TY2A 4LJZC 1BQQT 1HFNA 3P1HA 2QCPX 4KJNA 3I91A 2HQEA 1LTAD 1DZ1A 3OPOA 4U68A 5BN4A 1O80A 1SYFA 5JJZA 1LTBD 3AMUA 1E2WA 4DAYA 3DEPA 2LY7A 1STNA 1S5ED 1LTGD 3C2PA 2IX1A 2PZWA 3S1QB 2LKVA 1QB5D 4BWGB 2LS01 2E76C 3K0YA 4KV6A 3BZDB 4HSPA 3HP3A 3I4LA 1EYCA 3MXUA 4OHJA 1LT6D 5KYIA 2CHBD 3HOWB 1HTPA 2KUMA 2R93B 1XX8A 3DEOA 3C1EA 3Q24A 4DK1A 1SYGA 1H9JA 1NR4A 3KLSA 2Z8LA 3A55A 2JEAI 2WACA 4FF3A 1FNWA 1JOOA 1TWGB 5NUCA 5FO9B 4KKSA 5I2XA 1S5BD 2SNMA 1SNPA 4CGYB 2F0SA 1PTOB 3NK9A 3L7ZC 1SMYC 1XTCD 3AB9A 3OIQA 3EQLC 2XN9C 1KDCA 5M3FB 1KDBA 3G7LA 2H1EA 1C48A 2EY6A 3VYUA 3PUXA 5D3IB 2RDHA 3HG9A 5CV7A 5C0XJ 3E6ZX 1C4QA 2A6HC 4CKCA 5IIFA 4OIJA 4XXEA 1WTRA 5CMDA 5F2DA 4BY1B 3GD7A 3RD4A 1ET6A 3T53B 1PRTF 3MEHA 1QILA 1JWMD 1PLFA 3KK7A 1TIID 3PO3B 2X6GA 2EYLA 3BVZA 2F0TA 4A3KB 3HOUB 2VB2X 1RTNA 4A3MB 3NPPA 4YIJA 3WOFA 2F0QA 3R2TA 5CV4A 3NBHA 4X3UA 3BYTB 4F87A 1B9MA 5KIXA 3H91A 4A3DB 1B2TA 3Q23A 1PXUA 1J8IA 1Q3LA 2A68C 1TU2B 1WTPA 3D31A 1ZKOA 1U4LA 5DAUA 2O5IC 1R4PB 1T5EA 2D2CC 1XWEA 1EWHA 3SDZA 2EYPA 1STAA 1X32A 3LX0A 2KCCA 2NWGA 4KHZA 1G2SA 1X3PA 3W3AA 2K32A 4KKUA 1SNMA 1H9MA 3TSSA 4TSSA 2NVYB 4IFDG 4PNYA 3UI2A 4ME5A 1TWCB 2QEJC 3R2IA 2EZVA 3QWNA 3S1RB 3GV3A 1VF5C 3VR4A 2WB1B 1H9SA 1GUOA 1SE4A 1S5CD 5I6WA 3GP7A 1VMCA 5K5PA 2WV6D 2IWHA 5DNFA 1S4ZA 2K1BA 2BA1A 5A2QE 3S2HB 1ZYRD 5DM73 3VR2A 1W6JA 3TP8A 1TT2A 2JXMB 1LTSD 5ELCA 5LL6X 2BE5D 5FKAC 5T1IA 4C3JB 4MHEA 1H9RA 3BYYB 4M1UB 4ZQ3A 5JOBA 1EY8A 1M8AA 1B3AA 1HFGA 2ZXOA 3JAME 2A69C 2F0MA 4CBVA 2JP1A 1H9SB 1TS3A 4XTCS 1BCPD 1Q1BA 2F0KA 4LMQD 4BBRB 2N88A 1PFMA 4KY6A 3R8BA 3MFYA 4HSVA 2OT2A 1YNJD 1K83B 2OXPA 2JA6B 3I4MB 2JEBI 4K8JA 1VCIA 5G3LF 5IGFA 4PMCA 3QOJA 3TP5A 4KD3A 1STGA 2NZ1D 4EVOA 1RF2D 1ESRA 2FJ2A 5CGKA 3J7AV 3ND8A 1ML0D 4IURA 5A2QL 3SK8A 3NUCA 5C4HA 1T5XD 3N6RA 4S3SA 5JEAG 4V0BA 4ILWA 2B8FA 5JAVA 4OGQC 1F9QA 2KEEA 1M4VA 1Z6HA 3HZXA 3VA7A 4RKBA 3PIO3 3MXNA 4WFN3 2HCCA 2K03A 1SNQA 3JAML 5CORA 1HTLD 2EYFA 2NN6H 3OHXC 1A3VA 1PYWD 3RMHA 1AZPA 2J7ZA 5C5LA 5EPLA 2MUYA 1RJTA 2K05A 3K59A 2K01A 1PFNA 2ZXPA 3K5LA 1XXGA 1NR2A 2L5TA 4ZUIA 2Y0SB 5IODA 4OO1G 3TMEA 2R6GA 4R8NA 2AUJD 2A6ED 3OMGA 5E4XA 4V190 2KECA 4QMGA 2F0OA 4J8QA 2RA4A 1JCKB 1KNAA 1AN8A 4RA8A 1F2ZA 2Z1CA 3PV0A 5E3FA 1EYDA 2SOBA 1TWAB 2L55A 5EJWA 1G2TA 2PW7A 4X3TA 2EY1A 1ET9A 2H4OA 3HOYB 1PZKD 1V1OA 1LACA 3K6OA 4UAIA 4X3SA 3BDCA 4QIWB 5FO7B 2NB0A 1DOKA 3URYA 3MHBA 2EPBA 2XWJB 2F0NA 5C3XA 2BCOA 1LO5D 2RQXA 1CHQD 1YNND 4F88A 4I7ZC 5ELBA 1HQRD 2RSOA 3MWYW 1O78A 2GA4B 3EJIA 1I3QB 2K5QA 1UAPA 4FNFA 3N52A 2I46A 3IL8A 4EQOA 4AYBB 3I73A 3OWFA 4QUFA 4CJ2C 5CV6A 4N9TA 3PUWA 1IW7D 5HGTA 3KLSX 4PV1C 1SAPA 1LT5D 2BA0A 1ZXTA 1A2TA 3FVQA 3DMUA 4FF1A 3DHQA 4RGMA 4LK1C 5M3MB 5EPJA 2HDMA 1EL0A 4XT1B 1F9SA 1BBXC 1CT1D 1BNZA 1CHPD 2E75C 3CKIB 4XQNA 3GV6A 1GXDC 5IGGA 5D3DA 4LAAA 2MJ8A 1WTOA 4RHRA 5TSSA 1G6ZA 4DF7A 3A7AB 2JA8B 4KJOA 3K58A 1WTQA 1MBYA 1Q90A 2L9HA 3D3RA 2CQAA 3MZ5A 3ZYYX 3T16A 5K36G 2F0WA 4K8IA 1STEA 2F0VA 2IX3A 1Y8OB 2DY8A 2NYZD 1L0YB 2Q8RE 3FEWX 1UEAB 2NN6I 3A8KE 2EJMA 4Z9CB 2X69A 5FO8B 3EVQA 2KVMA 5KNBA 5JPNC 1SE2A 2A73B 1X3QA 3VYRA 1V1PA 1I4HA 3WDNA 4FF2A 3GTQB 4CJ1B 4FO2A 2FMMA 1CZWA 3J80E 2EJGC 3HRZC 2VB3X 1QE6A 5C6AA 3A8IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2T C;  5T1G A;  1ILQ A;  1SAP A;  2EOT A;  2SDF A;  3ONA B;  2JP1 A;  4MN3 A;  1XYI A;  1ZXT A;  1WTP A;  3IFD A;  1HFN A;  4LMQ D;  1CM9 A;  2N88 A;  1PFM A;  2Q8T A;  2MP1 A;  1HHV A;  1IL8 A;  2B2V C;  1JIC A;  1BF4 A;  3KBX A;  1O7Y A;  1HUM A;  4ZLT F;  3QO2 A;  4ZKB B;  1U4R A;  3Q6S A;  1U4L A;  4IUU A;  1J9O A;  4HSV A;  5EPJ A;  1ICW A;  1A15 A;  2HDM A;  1DOL A;  3SVM A;  1EL0 A;  1U4P A;  1VMP A;  1F9S A;  4XT1 B;  1DON A;  1NAP A;  2VXW A;  1E0B A;  1HA6 A;  1BBX C;  5E4X A;  1AP0 A;  1B50 A;  1BNZ A;  2KEC A;  2N55 A;  4ZAI A;  1EQT A;  1QNK A;  1RTO A;  3LWE A;  1BO0 A;  4DN4 M;  2RA4 A;  1X32 A;  3P7J A;  1KNA A;  2CVR A;  2NWG A;  3GV6 A;  1G2S A;  2RSN A;  3I8Z A;  1CA6 A;  1WD1 A;  1X3P A;  1SSO A;  4R9W A;  4RA8 A;  2B2U A;  1QG7 A;  1WD0 A;  1CA5 A;  1TVX A;  2MPM A;  4NW2 A;  4CJ0 B;  2X6L A;  5EPK A;  1DOM A;  2NZ1 D;  1MSH A;  2MJ8 A;  2B2Y C;  1WTO A;  1WTV A;  5EJW A;  1KNE A;  1ILP A;  1EIH A;  1ESR A;  1G2T A;  3G7L A;  1G6Z A;  1U4M A;  5AFW A;  1F2L A;  2FJ2 A;  2FHT A;  3I3C A;  2B2T A;  2H1E A;  3KUP A;  4X3T A;  2DY7 A;  4RAU C;  1ML0 D;  2EE1 A;  1B53 A;  4IUR A;  3I91 A;  3UI2 A;  5CBA E;  1WTQ A;  1RHP A;  1DZ1 A;  2HCI A;  4U68 A;  2L9H A;  1JE4 A;  2BDN A;  4UAI A;  5E4W C;  4X3S A;  2B2V A;  1G91 A;  1O80 A;  2KOL A;  2K28 A;  5JJZ A;  4HAE A;  2RVL A;  1GUW A;  3GV3 A;  1HRJ A;  1WVL A;  5EQ0 A;  3DEP A;  1DOK A;  4OIJ A;  1WTW A;  1WTR A;  2D9U A;  5CMD A;  4IUT A;  4O42 A;  2EPB A;  2B2W C;  2DY8 A;  1IKM A;  2NYZ D;  2JYO A;  5EKI A;  1EIG A;  2Q8R E;  3MTS A;  4X3K A;  1SDF A;  2MGS A;  1LV9 A;  1F9Q A;  1MSG A;  3FDT A;  5D14 A;  1EOT A;  2KEE A;  3TZD A;  2IL8 A;  2M2L A;  1VMC A;  1O7Z A;  2X69 A;  1ROD A;  1PLF A;  1IKL A;  3HP3 A;  3TN2 A;  2KVM A;  5DNF A;  1MI2 A;  5COY A;  2HCC A;  1S4Z A;  2X6G A;  2K03 A;  1F9P A;  2K1B A;  2K04 A;  2L12 A;  2RSO A;  5CBE E;  3MWY W;  1HUN A;  4ZKC B;  4IUP A;  4QUC A;  4XT3 B;  3FPU B;  2B2Y A;  2HUG A;  1X3Q A;  2FIN B;  2L1B A;  4IUV A;  1F9R A;  5COR A;  1RTN A;  1WTX A;  2HDL A;  3I90 A;  1MGS A;  1B4O A;  2XIW A;  1C8C A;  4OIK A;  4ZK9 B;  2KUM A;  2R3Z A;  2L4N A;  1PDQ A;  4IUQ A;  5D65 A;  3F2U A;  1XX8 A;  4CJ1 B;  3DEO A;  1AZP A;  2J7Z A;  3N52 A;  4X3U A;  2FFK B;  3DM1 A;  3IL8 A;  3R93 A;  1PFB A;  2FMM A;  1NR4 A;  5EPL A;  5T1I A;  3H91 A;  4MHE A;  1AZQ A;  2B2U C;  1RJT A;  1B2T A;  2K05 A;  4QUF A;  4CJ2 C;  1NCV A;  4XDX A;  4RWS C;  1QE6 A;  2K01 A;  1PFN A;  2KED A;  4HED A;  1M8A A;  1NR2 A;  2B2W A;  4HCS A;  1B3A A;  1HFG A;  4R8I A;  1J8I A;  1Q3L A;  2L11 A;  3D6W A; 
#chains in the Genus database with same CATH topology
 4QGU A;  1VQH A;  4PMB A;  2EOT A;  5CV5 A;  4ME3 A;  3JC6 6;  4EQP A;  1XYI A;  3M7G A;  2Z6K A;  5DEH A;  4Q0F A;  4HIK A;  3PMF A;  2R7F A;  4DR7 L;  3DLL A;  2ZJR A;  2E2I B;  3HOV H;  1A15 A;  2WB1 G;  1CUK A;  1CSQ A;  1DOL A;  3LNN A;  5J22 A;  5M5X H;  1TWH B;  4GLX A;  2QDB A;  5EBC A;  1L0X B;  4IOC A;  4DK0 A;  3T1H Q;  3GTM B;  1X65 A;  2AQ3 B;  1SFO H;  1CQV A;  2K6A A;  2B63 B;  3D6C A;  4X66 L;  5M5Y B;  1D8L A;  3L3O C;  5FLM G;  2CH4 W;  2LFN A;  1KTK A;  5A35 A;  4C3I B;  2KCN A;  2WP8 J;  1H9K A;  1HPC A;  2ASB A;  1WTV A;  4GOP B;  3H3V I;  1DD2 A;  3CCS A;  4H7B A;  2K5W A;  1WI5 A;  3KUP A;  2F4V Q;  3KF8 A;  4MIU A;  3LWU A;  2R7D A;  1MD2 D;  1VQ8 A;  4DV5 Q;  1BR9 A;  1W6K A;  4PZ6 A;  2RHQ B;  4C3J G;  1JWU D;  3GTP B;  1JQY D;  4GOP C;  1K28 A;  1GUW A;  3IAY A;  2K5D A;  3ULP A;  1HXY D;  2XVS A;  5KNC A;  5KEE A;  3MFG A;  1UUP A;  4BA2 I;  4CDD C;  4X3K A;  2E2H H;  3J80 L;  3AU7 A;  3CME A;  5JPM C;  1V8Q A;  1AE2 A;  4BBR G;  1EY4 A;  4B9W A;  1LT4 D;  2Z6K C;  1K9M C;  1D6E C;  3RUZ A;  4DXF A;  3OOC A;  2HD3 A;  5IGB A;  4KMU C;  4ZKC B;  4IUP A;  4YCW A;  2FIN B;  4QQB X;  1WTX A;  5EGT A;  1MIU A;  3VYS A;  3AFQ A;  3ITP A;  1DGS A;  1E24 A;  4DAP A;  5LMU Q;  2VS1 A;  4ALP A;  1LAB A;  2JA6 G;  4DKA C;  3CRK C;  4B3R Q;  2IHF A;  3SGI A;  5ELD A;  3T56 B;  2K5H A;  3PUZ A;  2F1M A;  1EY6 A;  1STH A;  1ENC A;  3MA2 B;  3I4N B;  5IYB H;  1PH9 A;  1VQ7 A;  4K2K A;  3NEN A;  2SDF A;  1ZEQ X;  1TQO A;  1S5F D;  2A8V A;  3T1H L;  1WTH A;  3G6E A;  1FJG Q;  2F0E A;  1K8O A;  1PH5 A;  4JI3 Q;  5KGU A;  4BY7 B;  2QIL A;  3NXW A;  1ENF A;  3QB3 A;  2AUK A;  2KQ3 A;  5C4J H;  4A3G B;  1U4P A;  1XPO A;  3K57 A;  3RNU A;  3K5N A;  5C4X B;  1B7Y B;  1QNK A;  1B44 D;  2M9V A;  5E1F A;  3J81 E;  2K5V A;  2F4V L;  1I50 H;  3A7L A;  4DR1 Q;  1PTO D;  1SJH D;  4R9W A;  3RN5 A;  4HCE A;  4DV5 L;  2XWB B;  4RFB A;  1TVX A;  3RN2 A;  4Y7N H;  2F0F A;  3GTL H;  5LL6 S;  2M00 A;  4FYD A;  4X62 Q;  1IBM Q;  2FHT A;  1EYA A;  3HS0 C;  4RGT A;  1A3T A;  1KIX A;  4XYQ A;  1XNR Q;  1G91 A;  1Q81 C;  2F0U A;  3HOZ H;  1EEF D;  4HAE A;  1ONL A;  5IT9 E;  2ZJQ A;  3G4S A;  4JK1 C;  2VUM H;  1B70 B;  2JYO A;  4IPH A;  3MTS A;  3J81 j;  1ZYR C;  1I4G A;  1MSG A;  4KD4 A;  2EQS A;  2VY3 A;  5LMU L;  1QUQ B;  2R92 G;  1I5F A;  1IKL A;  1RDP D;  3TBI B;  5COY A;  3F2C A;  2PI2 E;  4B3R L;  3PCO B;  1BUV T;  1I4R A;  2BE5 C;  4ZYS A;  1QVG A;  2HDL A;  4MTK A;  4P75 A;  1VQN A;  1BDO A;  2Z4I A;  3HOX H;  1SR3 A;  1LLR D;  3RLN A;  1TWF H;  3W2D A;  4DAV A;  5KRU A;  2E5L L;  3TEH B;  3RZD B;  1SE3 A;  4IUQ A;  2F0I A;  1EFI D;  3O13 A;  1A63 A;  3GTO H;  3DM1 A;  1OO9 B;  3R93 A;  3J7Y W;  4DR4 Q;  1G29 1;  3OTO L;  1FJG L;  1SNC A;  1BCP C;  2Q8I B;  2KJX A;  2E2J H;  2ICE C;  4JI3 L;  3DWQ A;  4A3B B;  2KED A;  2QDL A;  2B2W A;  3J81 L;  4HCS A;  1HR0 Q;  1WYD A;  2FMC A;  5T1G A;  3HOY G;  4JI4 Q;  3ONA B;  2KHS A;  3J81 c;  4OL7 A;  4R4T A;  4PQX A;  5IGD A;  1SEB D;  1YNJ C;  1JIC A;  2PQA A;  2Q2U A;  3PIO A;  1CFM A;  3AEV A;  4IUU A;  1D5Z C;  1E0B A;  4YCV A;  2D0O A;  4X62 L;  4ZAI A;  1VQF A;  1E22 A;  5M5W H;  1IBM L;  3U9O A;  3LWE A;  3K5O A;  1PZI D;  5IT9 L;  2WIN B;  3K7U C;  4NB3 A;  1DXM A;  2RSN A;  2NVT H;  1I4Q A;  2UXB Q;  3J7A 5;  1QG7 A;  1WD0 A;  1MHW C;  2QF7 A;  3VYT A;  1MSH A;  1XMQ Q;  3NTH A;  2I0Q A;  1LT3 D;  2RHS B;  4FXG C;  4RGN A;  2ENB A;  3STB D;  2WKC A;  1MJE A;  2YTY A;  1SLJ A;  5C3W A;  1JE4 A;  2BDN A;  1HJP A;  1YEZ A;  4AYB G;  2B2V A;  4QCL A;  5C44 H;  1ESF A;  4DFA A;  2RVL A;  3J80 i;  2PZT A;  1KAB A;  1EWI A;  3U9S A;  1EU3 A;  1WTW A;  4O0A A;  3C1F A;  2B2W C;  3CPF A;  1EIG A;  4A3C G;  4G4K A;  4OWT B;  3CC7 A;  3DM3 A;  3QJY A;  4XYO A;  4C56 C;  2N8N A;  4DU9 A;  3PO2 H;  2EYH A;  3GTK B;  4WJ3 M;  3J7Z C;  3QOL A;  3CHB D;  3GTJ H;  1VQJ A;  2OF1 A;  1OXT A;  4L8J A;  1SE8 A;  3NTI A;  5JEA H;  4DR4 L;  3KDF A;  3V05 A;  3K0X A;  5M3M G;  2HT1 A;  4CDF C;  3KLR A;  4A3L G;  2RKS A;  3X3M A;  4HJA A;  1EZ6 A;  1HR0 L;  2WB1 E;  3H0G G;  1QZG A;  1DCZ A;  4EQ5 A;  1GJX A;  1WCM H;  3CPW A;  5M9O A;  4JI4 L;  4WRD A;  2Z4H A;  3Q0A A;  1BXT A;  2NZH A;  3AYH B;  1R4Q B;  1JOQ A;  1VF7 A;  5I9O A;  1IYV A;  4HED A;  3S16 B;  3SEB A;  2JA8 G;  3CRL C;  3M3Y B;  2HHH Q;  3P20 A;  1GUT A;  2A6E C;  2EY2 A;  5C0X G;  4MN3 A;  1VQC A;  1A0I A;  3JAM c;  3S1N H;  3KJP A;  2B2V C;  4Y52 H;  3LGJ A;  5C3E G;  2UXB L;  4DV4 Q;  4G57 A;  4GLA C;  1JOR A;  1HR0 W;  4RH6 A;  1G6P A;  2MO0 A;  2YTV A;  4R1J A;  1VMP A;  1X55 A;  1Y1V B;  1NAP A;  1UNS A;  1OXS C;  1XMQ L;  3M4O B;  3ERQ A;  3J7A F;  4OXP A;  4L5R C;  3BZK A;  3NBI A;  1Q1E A;  1OXU A;  2CH4 A;  3EIV A;  4K5W A;  4QF4 A;  1PA6 A;  5IP7 H;  2MPM A;  4UDU C;  2EYM A;  3S1Q H;  2R92 B;  1VDZ A;  2J0T D;  3IFT A;  4DA2 A;  3S2D B;  2CQO A;  4IFD I;  1U4M A;  1JOK A;  4JC0 A;  2R7Z B;  1UEB A;  3SHL A;  3I3C A;  1WOC A;  4POF A;  3IRB A;  2SEB D;  1KDA A;  3MXN B;  4JVZ A;  3NWS A;  4BA1 I;  2G9H D;  5ISR A;  2NUC A;  3FPP A;  4J6H A;  4B08 A;  5IWA Q;  1CK1 A;  1HRJ A;  3UDI A;  1YNN C;  3SK5 A;  4C2M B;  3KBG A;  3HOW H;  4LFA Q;  1E3P A;  2R93 H;  1EY9 A;  4LFB L;  4IQZ A;  4BBS B;  4FP5 D;  1PRT D;  3D8G A;  5D14 A;  3TZD A;  5FK9 C;  2DNE A;  4JG2 A;  3TN2 A;  1MI2 A;  4C1N K;  1SXT A;  3A8J E;  5CBE E;  5AJ3 Q;  2NVX B;  2F0H A;  1GKH A;  4UY8 C;  3E5S A;  2PCF B;  2VL6 A;  1I6V C;  3I90 A;  4NP5 A;  1HZ9 A;  1TWG H;  1RD9 D;  4OIK A;  4FVM A;  2AQ2 B;  1EZ8 A;  4ZK9 B;  1Z47 A;  1ICF B;  1XPU A;  1SYB A;  3F2U A;  2B63 G;  1IW7 C;  3HGB A;  1IYJ B;  2PMZ B;  2HHH L;  3NE5 B;  3TS0 A;  3BZC A;  2GVB A;  4LF4 Q;  2EJF C;  4C3I G;  2BH8 A;  4HJ9 A;  4DV4 L;  1UE5 A;  4KI0 A;  2RBM A;  1PTO H;  3HKZ G;  2L11 A;  3D6W A;  4KY5 A;  4ZUJ A;  4K6L A;  1X6O A;  4IPC A;  4XIG S;  4KN4 C;  2EY5 A;  2RDF A;  4H0L C;  2MFI A;  2XNA C;  5M3F H;  4ZCK A;  4ZLT F;  1CKN B;  1K3B C;  3QO2 A;  3WWV A;  3NQT A;  3UDX A;  4DUZ Q;  4A3I B;  1IHZ A;  2LMC B;  4RGO S;  4WJW A;  1HCZ A;  3RZO B;  1AP0 A;  1KLG D;  2RF4 A;  3T1Y Q;  3FP9 A;  1JB3 A;  4J1M A;  1NUC A;  4DUY L;  1N33 Q;  1YIJ A;  3BVG A;  2DUD A;  2WAQ B;  1CA5 A;  3K8A A;  2IW3 A;  1U9R A;  4J15 A;  4CJ0 B;  4DNT B;  2NBF A;  3MEF A;  2F0L A;  4H13 C;  5EPK A;  4BY1 H;  5GAE C;  1PYB A;  5JJI A;  5IWA L;  1GUS A;  2K7V A;  4RAU C;  1B53 A;  3CCU A;  2UXC L;  3PO3 H;  1R9T B;  4A3K H;  3HOU H;  3CU7 A;  3H0G B;  3SK4 A;  4A3E B;  1D5M C;  3BVM A;  3DWA A;  1U5K A;  4A3M H;  4YWK A;  5AJ3 L;  2YYZ A;  5ELE A;  1SYC A;  3GO5 A;  4O42 A;  1QCB D;  3M9B A;  2SNS A;  4ID6 A;  3MAQ A;  3I4N G;  3IKJ A;  4HMJ A;  5IOC A;  1G8Z D;  1LM0 A;  4A3D H;  3D4W A;  2I5L X;  2VQF L;  3KF6 A;  2KA7 A;  1JT8 A;  4BY7 G;  2L12 A;  3TP7 A;  2TSS A;  4TRD A;  4KN7 C;  1EUJ A;  4XT3 B;  3K7A B;  4LFC L;  4DGZ A;  1GM5 A;  4LF4 L;  4A3G G;  2HIX A;  2E2D C;  2YU9 B;  1N32 Q;  3NHH A;  1AEX A;  1B4O A;  5HY6 A;  5JJK A;  5C3E B;  4L63 B;  5HUR A;  5C4X G;  1EY5 A;  1Y1W B;  1TS5 A;  2PMZ E;  4LWC A;  1IYU A;  4IFD J;  4UHV A;  1YHA A;  2FFK B;  2NVQ B;  1YIT A;  2OQK A;  5CR3 A;  1AZQ A;  1GOZ A;  3MXP A;  3GTG B;  1NCV A;  3BU2 A;  4LF8 Q;  4NDX A;  4TKO B;  4R8I A;  4JI1 Q;  4DUZ L;  1EOT A;  4JI7 Q;  4PZ8 A;  1ILQ A;  1Q8I A;  1KD1 C;  2CW0 D;  2ZT9 C;  5DM6 3;  3T1Y L;  2EXZ A;  1AE3 A;  1D2B A;  5LMN L;  2Z9H A;  1BCP F;  2AHO B;  4BXX G;  1FD7 D;  1N33 L;  4K0K Q;  2ZM6 L;  3S1M B;  1RCV D;  2NVY H;  4AYB E;  1D1I A;  3Q22 A;  2XRQ D;  3T13 A;  2VXW A;  1STY A;  1B50 A;  3EBE A;  1TWC H;  2D62 A;  4DN4 M;  3NEL A;  4OON A;  5G3L D;  3SE0 A;  3UDF A;  4U67 3;  2DJF C;  3I8Z A;  3S1R H;  3CCJ A;  1CA6 A;  2C35 B;  3F2D A;  3VR3 A;  3C46 A;  3CQZ B;  1GUG A;  4IPG A;  4RKL A;  1PH3 A;  5I4D A;  5FOB B;  4A3F B;  1DOM A;  5IYD G;  1KC8 C;  3A0J A;  4K5V A;  1TKW B;  2F3W A;  4C3H B;  3DXJ C;  5EBD A;  1RL2 A;  3I70 A;  4K14 A;  3FMC A;  5LMN W;  4IUN A;  3OWE B;  5CBA E;  3FKI B;  2I5H A;  1KLU D;  5FLM H;  1EWC A;  2AWO A;  2IT1 A;  1CTM A;  3V96 A;  3S2H H;  1SNO A;  4A3J B;  1CZG A;  2KOL A;  4LF5 Q;  3M4Y A;  2BOS A;  1XMO L;  1QZH A;  4A93 G;  1LTI D;  1V1P B;  5EQ0 A;  3U4V A;  4A3B G;  1EU4 A;  4I7A A;  2ID0 A;  1N32 L;  3KYH C;  2MGS A;  5C5M A;  2MHV A;  2K33 A;  4C3J H;  3KJO A;  3HKZ B;  1Z7T A;  4GZY C;  4DV0 Q;  1X56 A;  1F9P A;  2VNU D;  2A74 C;  3BG3 A;  2XRS D;  3FPU B;  2G9D A;  2HUG A;  2IX0 A;  3OYY A;  2IPK D;  4C1N I;  1EOV A;  3RLF A;  2F0J A;  4LF8 L;  4KKT A;  1C8C A;  4DR6 Q;  1I4X A;  4BBR H;  5J3B A;  2L4N A;  4JI1 L;  4GKJ Q;  1CKM A;  3CMA A;  4JI7 L;  3CCV A;  3DUZ A;  1YZ6 A;  2IJ0 A;  3A54 A;  1YNX A;  3SR1 A;  3T51 B;  4FXK C;  4JPB W;  1DYQ A;  2F0D A;  5J39 A;  3H3V C;  4K0K L;  1E1O A;  3J80 c;  1K83 H;  2N49 A;  3BDL A;  2JA6 H;  3I4M H;  5KND A;  5JEA J;  4FF4 A;  1Q12 A;  4O2D A;  1B8A A;  3D4D A;  1K73 C;  2JK8 A;  1HHV A;  2UUA L;  4ODG A;  2D5D A;  3EA6 A;  1I6H B;  1O7Y A;  1PTO C;  3KF8 B;  2P5Z X;  4YWL A;  3L9A X;  4JOI A;  2JJQ A;  3SVM A;  4B3S Q;  3S14 B;  1DON A;  4OWX B;  2EVB A;  2LSS A;  4HJ8 A;  1S3O A;  3L2P A;  3E0J A;  2V4D A;  2QGQ A;  5LHY 1;  1DJR D;  1WD1 A;  3TP6 A;  4RHS A;  3ND9 A;  5HGQ A;  3S15 B;  1TY0 A;  2MQH A;  4LF5 L;  3A5Z B;  4QY7 A;  1ILP A;  4MTN A;  4Q5V A;  1H95 A;  1SMY D;  2O2L D;  4MNO A;  1HNX Q;  3QIA A;  4CKE A;  5E4W C;  1FNU A;  3G71 A;  2K28 A;  1RIP A;  2F03 A;  4KK7 A;  4DV0 L;  1WVL A;  1E2V A;  4I65 A;  4G7O C;  3NQI A;  4E6I A;  4IUT A;  2UXD Q;  1IKM A;  1EIF A;  4RCN A;  2CKZ B;  3H09 A;  1QOH A;  4DR6 L;  2A6H D;  4CHT B;  4DNI A;  3HKZ E;  4TVA B;  3S17 B;  4GKJ L;  1N34 Q;  4FXD A;  1ROD A;  2PQE A;  5I2Y A;  3PGZ A;  5FLX E;  2JA7 G;  2XGT A;  4H44 C;  5GAH C;  1E2Z A;  4QUC A;  1AH9 A;  4IUV A;  4DV6 Q;  1Y1V G;  1FYC A;  4JOI C;  2XIW A;  4B9X A;  4IFD H;  4KY7 A;  4CDE C;  4HIO A;  1KQS A;  3M7N A;  1GHK A;  3NEM A;  1A3U A;  4HR7 B;  1F2M A;  4IPD A;  2ATW A;  3D4R A;  4DPG A;  2L0C A;  1PH8 A;  5L37 A;  1BOS A;  5JJL A;  4LF6 Q;  4EGV A;  2NTT A;  4JI5 Q;  3I2Z A;  1I4P A;  4RCO A;  2R7Z G;  3I72 A;  1TS2 A;  4B3S L;  2Z6B A;  1D5X C;  2IY5 B;  5IYC H;  1BCP B;  3IFD A;  2HIV A;  4JCV E;  4TQU S;  1B9N A;  1S5D D;  2JA5 B;  3E3X A;  1TWA H;  3ULJ A;  1PVO A;  1HUM A;  2KHI A;  2OWO A;  1KXL A;  2A68 D;  2KCM A;  4A93 B;  2DN8 A;  3HOY H;  4BBS G;  2G5D A;  3WOE A;  3OW7 A;  2N55 A;  1EQT A;  1RTO A;  4QL5 A;  1HA5 A;  1TS4 A;  4R4O A;  4OEM B;  3STB C;  3UE0 A;  1JR0 D;  1QWY A;  1K8G A;  3S24 A;  1CQF A;  4DR1 L;  1K0S A;  2OTJ A;  4IZ8 A;  3CC2 A;  3HOV B;  3PQI A;  5FLX L;  5M5X B;  1ASZ A;  5ELO A;  2UXD L;  1P8L A;  3HKS A;  2PYK A;  4LF7 Q;  2EDG A;  4M8A A;  5JVG 3;  1SFO B;  1N34 L;  4O1N A;  4IJL A;  1CI3 M;  2J4X A;  1I3Q H;  2RDG A;  3GDE A;  3S9W A;  4UP7 A;  2A1A A;  5IT9 c;  2F0G A;  3PUY A;  1XNR L;  1PMR A;  1VS0 A;  3SK6 A;  4DV6 L;  3MC0 B;  1KRT A;  1X3G A;  1EY7 A;  5ELN A;  3PSI A;  1HQM C;  1XNQ Q;  1JE5 A;  4AIM A;  1BVS A;  3C3L A;  1O7Z A;  5JVH 3;  4G7H C;  3TRZ A;  3NSW A;  3R3O A;  3DWP A;  2JSO A;  2K04 A;  1LTR D;  2B2Y A;  4A3I G;  4R4I A;  4IAL A;  1F9R A;  4A3C H;  1K8A C;  1SYE A;  2KHJ A;  1O7L A;  4LF6 L;  1MGS A;  1Q46 A;  4KHP Q;  1E1T A;  3M4Q A;  3OSO A;  4JI5 L;  1IXR A;  1QNU A;  4APV A;  1FL0 A;  1RKN A;  1UE1 A;  2R3Z A;  1PDQ A;  2PQA B;  1FGB D;  2CWA A;  1VQM A;  2PO4 A;  4K2L A;  2E2H B;  3M85 A;  2WAQ G;  5M3M H;  5CC4 A;  3V2T A;  2ICI A;  4ZRZ A;  4A3L H;  1KHI A;  1K8M A;  1B1Z A;  3HEJ A;  4N9P A;  2TMP A;  3K81 C;  1SJE D;  4JI2 Q;  5GAG C;  3X3N A;  1CM9 A;  4JW0 A;  2MP1 A;  5IGC A;  4JV5 Q;  1BF4 A;  4A3E G;  1YJW A;  2B39 A;  2Q2I A;  4ZKB B;  1JJ2 A;  5IGE A;  3Q6S A;  2A5H A;  2JA8 H;  1J9O A;  2A69 D;  1SBB B;  1HZB A;  1Q82 C;  5C0X H;  4QB4 A;  1ENA A;  4F8M A;  3PO2 G;  4LUV A;  3PUV A;  5GAD C;  1EQV A;  2MNA A;  3CCE A;  2B8G A;  5EKK A;  1VQB A;  1V43 A;  4LF7 L;  3VA5 A;  1PRT B;  4B3T Q;  2H5X A;  2F3V A;  4A76 A;  2B2Y C;  2JA7 B;  3TZU A;  3MVV A;  2JE6 I;  1F2L A;  4XQQ A;  4NMZ A;  2B2T A;  2OEO A;  5C4J B;  1EQQ A;  1VQ4 A;  1Y1W G;  3VR5 A;  2EE1 A;  1AW7 A;  1CSP A;  1WCM G;  2O5J C;  3KDF B;  2AWN A;  3NWT A;  1PRT C;  1XNQ L;  3CP0 A;  4OO1 H;  1I50 B;  1KL9 A;  4GS3 A;  1E7Z A;  1YHQ A;  1JC7 A;  1L2F A;  4Y7N B;  3GTQ H;  3UE1 A;  3GTL B;  1TR5 A;  4KHP L;  2R61 A;  1LV9 A;  3TS2 A;  3SXH A;  3ERO A;  2IL8 A;  2NN6 G;  3BDO A;  2M2L A;  4OX9 Q;  1OXX K;  4JBK A;  5CYU A;  4EX5 A;  4HN7 A;  2PNR C;  1OXV A;  2NTS A;  2EYJ A;  2PW5 A;  1HUN A;  2F4I A;  2BDO A;  2L1B A;  3HOZ B;  4P71 A;  1Y8P B;  4DR5 Q;  1I94 Q;  1PH6 A;  2L15 A;  3TDQ A;  1KAA A;  2ZTC A;  5D65 A;  2VUM B;  1FR3 A;  1LUZ A;  4XQJ A;  1IZ6 A;  3A56 A;  2E2I H;  4JI2 L;  3T4A C;  2QW7 A;  4A3F G;  1TWH H;  4JV5 L;  2O4X A;  2WII B;  1NSN S;  3I4O A;  5I6Y A;  1A2U A;  3GTM H;  3A74 A;  4C3H G;  5FJ8 G;  4YCU A;  4JI0 Q;  3K80 C;  4CDC C;  2B63 H;  5CV8 A;  2AQ1 B;  2B2T C;  5M5Y H;  4HID A;  3FKI G;  5BN3 A;  3HOX B;  1TWF B;  1D1K A;  4NPS A;  2ZXR A;  1WFQ A;  4A3J G;  1SYD A;  4P2C B;  4C3I H;  4CKB A;  3GTO B;  3HOW G;  5EKL A;  3NTK A;  1ICW A;  1HA6 A;  5KYL A;  4B3T L;  1Q7Y C;  2E2J B;  1YHB A;  1HNZ Q;  2RCN A;  3K5M A;  3OIP A;  1BO0 A;  3BS1 A;  2EYO A;  5E7N A;  3P7J A;  3GTP H;  2CVR A;  1X3E A;  1SSO A;  1PTO F;  4BS9 A;  3G48 A;  2B2U A;  4IN3 A;  3ICE A;  4NW2 A;  1QVC A;  4L5Q A;  4WOR A;  2X6L A;  2WFW A;  4G7Z C;  4F7X A;  3P75 A;  1AFP A;  1Z9F A;  1KNE A;  4HMI A;  2ZJP A;  1EY0 A;  5AFW A;  1WJJ A;  1X3F A;  4HJ5 A;  4IJH A;  2I07 B;  2DY7 A;  1SND A;  1U0L A;  1D7Q A;  1JWS D;  1EIH A;  1RHP A;  2HCI A;  1QJO A;  3PIP 3;  1UE7 A;  5M5W B;  4OX9 L;  4EQN A;  1F77 A;  2XTI A;  2NVT B;  4P74 A;  4K5X A;  3E9H A;  2D9U A;  5BN5 A;  1YJ9 A;  2PZU A;  3PF5 A;  5I9P A;  5EKI A;  1SDF A;  4DR5 L;  1VQ5 A;  1I94 L;  3EFX D;  3FDT A;  3VR6 A;  1V1Q A;  1LTT D;  4KHV A;  5ELF A;  4LFA L;  3G6J B;  3FRP B;  1BBU A;  5EAY A;  2DJG C;  3H6M A;  5C44 B;  3I4N H;  4KTA A;  2C9O A;  1A6X A;  3AQQ A;  4JI0 L;  4P73 A;  4ABN A;  1MKH A;  4BY7 H;  1PZJ D;  4PMW A;  1II3 A;  1PFB A;  3GQB A;  4K6D A;  3PO2 B;  4A3G H;  2B2U C;  4BY1 G;  2CW0 C;  1IBK Q;  1EEI D;  4DXG A;  4XDX A;  4RWS C;  2WKD A;  5K36 H;  3GTJ B;  4NKL A;  2F0P A;  5C4X H;  3QG1 A;  4L6T B;  2VZA A;  4JBM A;  2N78 A;  4JBW A;  5C0X I;  3MXG A;  1DM0 B;  1OTC A;  1Y69 U;  3NP8 A;  1HNZ L;  1G51 A;  1STB A;  1VQO A;  2Q8T A;  3HOU G;  2K5N A;  5J1Z A;  3H94 A;  1IL8 A;  1WCM B;  2QA4 A;  2DNC A;  1Y8N B;  3KBX A;  4A3M G;  1GUN A;  1PH7 A;  1U4R A;  1EFW A;  4LNQ A;  2K14 A;  5IP9 G;  4N8F A;  2QKI C;  3OMC A;  1FNV A;  3RR5 A;  4DNR B;  1GHJ A;  2PPB C;  2E74 C;  2JQO A;  1YI2 A;  2XSC A;  2C5C A;  4GN3 B;  4ULL A;  5CV9 A;  2OTL A;  4OO1 I;  3KFU A;  5C4Z A;  1M90 C;  4HTH A;  3S1N B;  2D0P A;  3ULL A;  1F2Y A;  1TY2 A;  4LJZ C;  1BQQ T;  1HFN A;  4R4C A;  3P1H A;  2QCP X;  4KJN A;  3KF6 B;  3I91 A;  4NXN Q;  2HQE A;  1LTA D;  1DZ1 A;  3OPO A;  4U68 A;  2VW9 A;  4AQY Q;  1L0W A;  5BN4 A;  1O80 A;  1SYF A;  5IYD H;  5JJZ A;  1LTB D;  3AMU A;  1E2W A;  4DAY A;  2UU9 Q;  3DEP A;  2WAQ E;  3RZD H;  2LY7 A;  1STN A;  1EQR A;  1S5E D;  1LTG D;  2YTX A;  3C2P A;  2PZW A;  2IX1 A;  3S1Q B;  1KRS A;  1NTG A;  2LKV A;  3Q8D A;  1QB5 D;  4BWG B;  1HNW Q;  2LS0 1;  4NXM Q;  2E76 C;  3K0Y A;  4DV7 Q;  4KV6 A;  3BZD B;  2B3G A;  4HSP A;  2JA5 G;  3HP3 A;  3I4L A;  4A3B H;  5BR8 Q;  1EYC A;  4DV1 Q;  1VQA A;  1HZA A;  3MXU A;  4A4I A;  1IBK L;  4OHJ A;  3ERS X;  1LT6 D;  3U4Z A;  5KYI A;  2CHB D;  3HOW B;  1HTP A;  2KUM A;  2KCT A;  1VQI A;  2R93 B;  1XX8 A;  3DEO A;  1UWV A;  3C1E A;  3Q24 A;  3KLW A;  5DLQ E;  4DK1 A;  1SYG A;  2DGY A;  1H9J A;  1NR4 A;  1IBL Q;  3KLS A;  1K0R A;  2Z8L A;  5IY0 A;  3A55 A;  2JEA I;  1PH2 A;  2WAC A;  4FF3 A;  1VQG A;  4GKK Q;  1FNW A;  2E8G A;  2PI2 A;  3HOV G;  2ZTD A;  4DAY B;  1C0A A;  1VQP A;  1JOO A;  1TWG B;  2K52 A;  3ER0 A;  1V9P A;  2K75 A;  5NUC A;  1IL2 A;  5FO9 B;  3F1Z A;  4KKS A;  5I2X A;  1S5B D;  1JJG A;  2SNM A;  2IHE A;  2RCF A;  2K4K A;  1SNP A;  4IO9 A;  3L0O A;  4CGY B;  4RMF A;  2F0S A;  1PTO B;  3NK9 A;  3L7Z C;  2EIF A;  4NXN L;  4AQY L;  1SMY C;  4UP8 A;  1XTC D;  3AB9 A;  3OIQ A;  4QJF A;  1HH2 P;  3EQL C;  2XN9 C;  1KDC A;  5M3F B;  2Q2T A;  1KDB A;  3G7L A;  2Q2H A;  2UU9 L;  3D0F A;  3GTK H;  2H1E A;  1C48 A;  2EY6 A;  3VYU A;  3PUX A;  5D3I B;  1MJC A;  2RDH A;  3HG9 A;  4P72 A;  1HNW L;  5CV7 A;  4NXM L;  4DV7 L;  4DR2 Q;  5C0X J;  3E6Z X;  1CKO A;  1C4Q A;  2A6H C;  4CKC A;  5IIF A;  1W3S A;  4OIJ A;  4XXE A;  5BR8 L;  1WTR A;  4DV1 L;  1X54 A;  1PHJ A;  3I4M G;  5CMD A;  1Q8K A;  5F2D A;  3GD7 A;  4BY1 B;  4JYA Q;  2BH2 A;  3RD4 A;  1ET6 A;  3T53 B;  1PRT F;  3RLO A;  4POG A;  3MEH A;  1QIL A;  1JWM D;  4L5S A;  1PLF A;  4MZ9 A;  3KK7 A;  2E5L Q;  1XPR A;  3FHW A;  1TII D;  3PO3 B;  2JA9 A;  2X6G A;  1VQ6 A;  3S16 H;  3W1G A;  2EYL A;  3BVZ A;  2F0T A;  4A3K B;  3HOU B;  1IBL L;  2VB2 X;  4LW1 A;  3M3Y H;  3I7F A;  1RTN A;  4H02 A;  4WJ4 A;  4A3M B;  3NPP A;  4YIJ A;  3OTO Q;  4GKK L;  3WOF A;  3U58 A;  2F0Q A;  3R2T A;  5CV4 A;  3NBH A;  1ASY A;  1N36 Q;  2JA7 H;  5IYB G;  4X3U A;  3BYT B;  4F87 A;  1B9M A;  5KIX A;  1BKB A;  3H91 A;  4A3D B;  1B2T A;  1C9O A;  3Q23 A;  1QUQ A;  1Y1V H;  4UPA A;  3M4O H;  5H1S E;  5IE8 A;  1PXU A;  2GVA A;  1J8I A;  2KEN A;  1Q3L A;  2FXQ A;  2A68 C;  1TU2 B;  1WTP A;  2CFM A;  3D31 A;  2R92 H;  1J6Q A;  3S2D H;  1L1O A;  1ZKO A;  2R7Z H;  1U4L A;  5DAU A;  3KOJ A;  4JI6 Q;  2O5I C;  1R4P B;  3EN2 A;  1T5E A;  2D2C C;  1XWE A;  1EWH A;  3SDZ A;  4PG3 A;  2MO1 A;  1M1K C;  2EYP A;  1STA A;  1X32 A;  3LX0 A;  1GD7 A;  2KCC A;  2NWG A;  1G2S A;  4KHZ A;  1GO3 E;  1X3P A;  4C2M H;  3NBH B;  4N8X 1;  1W2B A;  3W3A A;  2K32 A;  3I55 A;  4DR2 L;  4BBS H;  4KKU A;  3HOZ G;  1SNM A;  1H9M A;  3TSS A;  4TSS A;  2Y0S G;  1P16 A;  2NVY B;  1YJN A;  4IFD G;  4PNY A;  1XTD A;  3OW2 A;  2VUM G;  4JYA L;  3UI2 A;  4ME5 A;  4DV3 Q;  1TWC B;  1NMG A;  2QEJ C;  2NVX H;  3R2I A;  1PFS A;  2EZV A;  1VQD A;  3QWN A;  3S1R B;  1TXY A;  3GV3 A;  1VF5 C;  3QR8 A;  1HNX L;  3VR4 A;  4PZ7 A;  2WB1 B;  1H9S A;  1VQL A;  1L1O B;  1GUO A;  1SE4 A;  5IYC G;  1S5C D;  5I6W A;  3HOX G;  1EIY B;  3CXC A;  3GP7 A;  1VMC A;  5K5P A;  2WV6 D;  2IWH A;  2V1C C;  1N36 L;  5DNF A;  1S4Z A;  2PNH A;  2K1B A;  2BA1 A;  2GN5 A;  5A2Q E;  1S72 A;  3S2H B;  1ZYR D;  5DM7 3;  5FLX c;  1L1O C;  1NY4 A;  3VR2 A;  1VQK A;  3CCL A;  1SMX A;  1HZC A;  1W6J A;  3TP8 A;  4YY3 Q;  4DR3 Q;  4DK3 C;  1TT2 A;  2JXM B;  1LTS D;  2UUB Q;  3CF5 A;  5ELC A;  5LL6 X;  2F52 A;  2BE5 D;  5FKA C;  3U50 C;  1B3Q A;  3HFZ B;  5T1I A;  2OCE A;  4A3I H;  2LXK A;  4C3J B;  4MHE A;  1H9R A;  3BYY B;  3F2B A;  4M1U B;  4ZQ3 A;  3RZO H;  5JOB A;  1C7Y A;  1EY8 A;  1M8A A;  1B3A A;  1HFG A;  2ZXO A;  4JI6 L;  1BBW A;  3JAM E;  2A69 C;  4HIM A;  2F0M A;  2JP1 A;  4XTC S;  1H9S B;  1TS3 A;  4CBV A;  1BCP D;  1Q1B A;  2F0K A;  4LMQ D;  4BBR B;  2N88 A;  1PFM A;  4KY6 A;  3R8B A;  3MFY A;  3CCQ A;  4HSV A;  2OT2 A;  1S40 A;  1SRO A;  4GNX A;  1R9T H;  4LF9 Q;  1YNJ D;  2OXP A;  1K83 B;  2NZO A;  1NMF A;  4X64 Q;  2JA6 B;  3I4M B;  3H0G H;  4X65 Q;  2JEB I;  1LYL A;  4K8J A;  1VCI A;  5G3L F;  4A3E H;  5IGF A;  4PMC A;  4DV3 L;  3QOJ A;  3TP5 A;  4KD3 A;  1STG A;  2ALY B;  2NZ1 D;  4EVO A;  5C44 G;  1RF2 D;  1ESR A;  2FJ2 A;  5CGK A;  3J7A V;  3ND8 A;  1ML0 D;  3M4P A;  4IUR A;  1NNX A;  5A2Q L;  3SK8 A;  3NUC A;  1JJC B;  1T5X D;  5C4H A;  3N6R A;  4LFB Q;  3K7A H;  4S3S A;  3PF4 A;  1FGU A;  2YU9 H;  2CCZ A;  5C3E H;  4R4Q A;  4OWW B;  5JEA G;  1Y1W H;  4V0B A;  4ILW A;  2B8F A;  2UUC Q;  3CW2 C;  5JAV A;  4OGQ C;  1F9Q A;  2NVQ H;  3CCM A;  2KEE A;  1M4V A;  1Z6H A;  3HZX A;  3VA7 A;  4YY3 L;  4DR3 L;  4JI8 Q;  4RKB A;  3AFP A;  3GTG H;  3PIO 3;  1Y14 B;  4GNX B;  2UUB L;  3MXN A;  4WFN 3;  2HCC A;  1LTL A;  3H15 A;  2K03 A;  1T9H A;  1SNQ A;  3JAM L;  5COR A;  1HTL D;  2EYF A;  2NN6 H;  3OHX C;  1NBW A;  1A3V A;  1PYW D;  4KLK A;  1PH1 A;  4GNX C;  2JN4 A;  1PH4 A;  3RMH A;  1AZP A;  2J7Z A;  3S1M H;  5C5L A;  5EPL A;  2MUY A;  3PIP A;  1RJT A;  2K05 A;  3K59 A;  2K01 A;  1QVF A;  1PFN A;  2ZXP A;  3K5L A;  1XXG A;  1NR2 A;  2I5M X;  2L5T A;  3CQZ H;  1UE6 A;  4ZUI A;  2Y0S B;  5IOD A;  4LF9 L;  4OO1 G;  4A3F H;  4X64 L;  3TME A;  4X65 L;  2R6G A;  4B3M Q;  2F3I A;  5FJ8 H;  4C3H H;  2HQL A;  5IP7 G;  4R8N A;  2AUJ D;  4DUY Q;  2A6E D;  3OMG A;  3FKI H;  3CD6 A;  5E4X A;  4HJ7 A;  4V19 0;  1A8V A;  2KEC A;  4QMG A;  4GN4 B;  2F0O A;  4J8Q A;  3W5O A;  4A3J H;  3UDG A;  2RA4 A;  1JCK B;  1KNA A;  1AN8 A;  4RA8 A;  1F2Z A;  4UP9 A;  1JMC A;  2Z1C A;  3PV0 A;  4GLV B;  3CAM A;  5E3F A;  1EYD A;  2UXC Q;  2SOB A;  1TWA B;  2L55 A;  5EJW A;  1G2T A;  2PW7 A;  1CKN A;  4X3T A;  2EY1 A;  2R93 G;  1ET9 A;  2H4O A;  3HOY B;  1PZK D;  2UUC L;  1V1O A;  1LAC A;  3K6O A;  4UAI A;  4X3S A;  3BDC A;  4JI8 L;  4QIW B;  5FO7 B;  3H3V H;  2NB0 A;  1DOK A;  4X6A H;  3URY A;  3MHB A;  2EPB A;  2VQF Q;  2XWJ B;  3J81 i;  2F0N A;  5C3X A;  2ZTE A;  4LFC Q;  2BCO A;  1J5E Q;  4A75 A;  1LO5 D;  2RQX A;  2Z0S A;  1CHQ D;  1YNN D;  4F88 A;  4I7Z C;  5ELB A;  4FDB A;  1HQR D;  2RSO A;  2LXJ A;  4YWM A;  3MWY W;  4DV2 Q;  1O78 A;  3BJU A;  2QEX A;  2GA4 B;  3EJI A;  1I3Q B;  2K5Q A;  3TQY A;  2KBN A;  1N8R C;  1UAP A;  1VQ9 A;  4FNF A;  3B6Y A;  4LUO A;  3N52 A;  2I46 A;  1I6H H;  3IL8 A;  4EQO A;  4AYB B;  3VDY A;  1YVC A;  3I73 A;  3OWF A;  3S14 H;  4QUF A;  4CJ2 C;  4DK6 C;  5CV6 A;  1X9N A;  4B3M L;  4N9T A;  3PUW A;  5M3F G;  1IW7 D;  5LMN Q;  1N9W A;  2AMC B;  5HGT A;  2VQE Q;  3KLS X;  4PV1 C;  2ZM6 Q;  2EXD A;  1SAP A;  1LT5 D;  2BA0 A;  1JB7 A;  1ZXT A;  2Y0S E;  3TRE A;  3E0E A;  1NJI C;  3S15 H;  2AKW B;  4OEL B;  4YHH Q;  2CWP A;  3ZJY C;  1A2T A;  3FVQ A;  3DMU A;  4FF1 A;  3DHQ A;  4RGM A;  4DAM A;  4LK1 C;  5M3M B;  5EPJ A;  2HDM A;  1EL0 A;  4XT1 B;  1F9S A;  1BBX C;  1CT1 D;  1K3R A;  1BNZ A;  1CHP D;  2E75 C;  3CKI B;  4XQN A;  3GV6 A;  2ES2 A;  1GXD C;  5IGG A;  4DR7 Q;  5D3D A;  4LAA A;  1XJV A;  2B29 A;  4RG1 A;  3PO3 G;  5IP9 H;  1A62 A;  1Q86 C;  1SRU A;  4A3K G;  2MJ8 A;  1WTO A;  5GQO A;  1SN8 A;  4RHR A;  5TSS A;  3W1B A;  1G6Z A;  4DF7 A;  1XMO Q;  3A7A B;  2JA8 B;  4LUZ A;  3S17 H;  4KJO A;  3K58 A;  1WTQ A;  4X66 Q;  1MBY A;  1Q90 A;  3I56 A;  2L9H A;  3D3R A;  1J5E L;  4QIW E;  2CQA A;  3MZ5 A;  3ZYY X;  4BXX H;  5GRO A;  3T16 A;  4A3D G;  1YBY A;  2N3S A;  5K36 G;  2F0W A;  1EYG A;  4K8I A;  1STE A;  2F0V A;  2OQ0 A;  4DV2 L;  2IX3 A;  2A19 A;  2K50 A;  1Y8O B;  2DY8 A;  3CC4 A;  2NYZ D;  1FVI A;  1L0Y B;  2Q8R E;  3FEW X;  1UEA B;  1VQE A;  2NN6 I;  4GN5 A;  3A8K E;  2EJM A;  3JAM i;  4Z9C B;  1KAW A;  2X69 A;  5FO8 B;  4AH6 A;  3EVQ A;  2KVM A;  5KNB A;  5JPN C;  1SE2 A;  1NE3 A;  4IOA A;  2A73 B;  1X3Q A;  4L5T A;  4JBJ A;  3VYR A;  1V1P A;  1I4H A;  1O7I A;  3WDN A;  3A5U A;  4FF2 A;  3GTQ B;  4CJ1 B;  2JA5 H;  3E9I A;  2YV5 A;  2VQE L;  1PYS B;  4FO2 A;  1PV4 A;  3CCR A;  2FMM A;  4GOP A;  1CZW A;  3J80 E;  2EJG C;  4A93 H;  3HRZ C;  2VB3 X;  4YHH L;  1QE6 A;  3F8T A;  5C6A A;  1GVP A;  3A8I E;  2UUA Q; 
#chains in the Genus database with same CATH homology
 4PMB A;  2EOT A;  5CV5 A;  4EQP A;  1XYI A;  3M7G A;  5DEH A;  4Q0F A;  3PMF A;  2E2I B;  1A15 A;  3LNN A;  1DOL A;  5J22 A;  1TWH B;  2QDB A;  5EBC A;  1L0X B;  4DK0 A;  3GTM B;  2AQ3 B;  2B63 B;  1CQV A;  2K6A A;  3D6C A;  5M5Y B;  3L3O C;  2LFN A;  1KTK A;  5A35 A;  4C3I B;  2KCN A;  2WP8 J;  1H9K A;  1HPC A;  1WTV A;  1DD2 A;  4H7B A;  2K5W A;  3KUP A;  3KF8 A;  4MIU A;  3LWU A;  1MD2 D;  1BR9 A;  1W6K A;  4C3J G;  3GTP B;  1JWU D;  1JQY D;  1GUW A;  3IAY A;  2K5D A;  1HXY D;  2XVS A;  5KNC A;  5KEE A;  3MFG A;  1UUP A;  4BA2 I;  4X3K A;  3J80 L;  3AU7 A;  5JPM C;  1V8Q A;  1EY4 A;  4B9W A;  1LT4 D;  1D6E C;  3RUZ A;  4DXF A;  3OOC A;  5IGB A;  4KMU C;  4ZKC B;  4IUP A;  2FIN B;  1WTX A;  5EGT A;  3VYS A;  3ITP A;  4DAP A;  1LAB A;  3CRK C;  5ELD A;  3T56 B;  3PUZ A;  2F1M A;  1EY6 A;  1STH A;  1ENC A;  3MA2 B;  3I4N B;  4K2K A;  2SDF A;  1ZEQ X;  1TQO A;  1S5F D;  2F0E A;  1K8O A;  5KGU A;  4BY7 B;  2QIL A;  3NXW A;  1ENF A;  3QB3 A;  2AUK A;  2KQ3 A;  4A3G B;  1U4P A;  3K57 A;  3K5N A;  5C4X B;  1QNK A;  1B44 D;  2M9V A;  5E1F A;  3J81 E;  3A7L A;  1PTO D;  1SJH D;  4R9W A;  4HCE A;  2XWB B;  4RFB A;  1TVX A;  2F0F A;  5LL6 S;  2M00 A;  4FYD A;  2FHT A;  1EYA A;  3HS0 C;  4RGT A;  1A3T A;  4XYQ A;  1G91 A;  2F0U A;  1EEF D;  4HAE A;  1ONL A;  5IT9 E;  4JK1 C;  2JYO A;  3MTS A;  1ZYR C;  1I4G A;  1MSG A;  4KD4 A;  1IKL A;  1RDP D;  3TBI B;  5COY A;  1BUV T;  1I4R A;  2BE5 C;  4ZYS A;  2HDL A;  1BDO A;  2Z4I A;  1LLR D;  3W2D A;  4DAV A;  5KRU A;  3RZD B;  1SE3 A;  4IUQ A;  2F0I A;  1EFI D;  3O13 A;  3DM1 A;  1OO9 B;  3R93 A;  3J7Y W;  1G29 1;  1SNC A;  1BCP C;  2Q8I B;  2KJX A;  2ICE C;  3DWQ A;  4A3B B;  2KED A;  2B2W A;  3J81 L;  4HCS A;  2FMC A;  5T1G A;  3ONA B;  2KHS A;  4OL7 A;  4PQX A;  5IGD A;  1SEB D;  1YNJ C;  1JIC A;  1CFM A;  4IUU A;  1D5Z C;  1E0B A;  4ZAI A;  3U9O A;  3LWE A;  3K5O A;  1PZI D;  5IT9 L;  2WIN B;  1DXM A;  2RSN A;  1I4Q A;  1QG7 A;  1WD0 A;  2QF7 A;  3VYT A;  1MSH A;  3NTH A;  1LT3 D;  4FXG C;  4RGN A;  2ENB A;  2WKC A;  5C3W A;  1JE4 A;  2BDN A;  4QCL A;  2B2V A;  1ESF A;  4DFA A;  2RVL A;  2PZT A;  1KAB A;  3U9S A;  1EU3 A;  1WTW A;  3C1F A;  2B2W C;  1EIG A;  4G4K A;  3QJY A;  4XYO A;  4C56 C;  3GTK B;  4DU9 A;  2EYH A;  3QOL A;  3CHB D;  2OF1 A;  1OXT A;  4L8J A;  5JEA H;  3NTI A;  3V05 A;  3KLR A;  2RKS A;  3X3M A;  1EZ6 A;  1DCZ A;  1GJX A;  5M9O A;  4WRD A;  2Z4H A;  3Q0A A;  1BXT A;  1R4Q B;  1JOQ A;  1VF7 A;  5I9O A;  1IYV A;  4HED A;  3S16 B;  3SEB A;  3CRL C;  3M3Y B;  1GUT A;  2A6E C;  2EY2 A;  3P20 A;  5C0X G;  4MN3 A;  2B2V C;  4G57 A;  1JOR A;  4RH6 A;  1VMP A;  1Y1V B;  1NAP A;  1UNS A;  1OXS C;  3M4O B;  3ERQ A;  3J7A F;  3NBI A;  1Q1E A;  1OXU A;  4K5W A;  4QF4 A;  2MPM A;  4UDU C;  2EYM A;  2R92 B;  1VDZ A;  2J0T D;  3IFT A;  4DA2 A;  3S2D B;  4IFD I;  1U4M A;  1JOK A;  2R7Z B;  3SHL A;  3I3C A;  2SEB D;  1KDA A;  3NWS A;  4BA1 I;  2G9H D;  5ISR A;  2NUC A;  3FPP A;  4J6H A;  4B08 A;  1CK1 A;  1HRJ A;  4C2M B;  1YNN C;  3SK5 A;  3KBG A;  1EY9 A;  4IQZ A;  4BBS B;  4FP5 D;  1PRT D;  3D8G A;  5D14 A;  3TZD A;  5FK9 C;  2DNE A;  3TN2 A;  1MI2 A;  4C1N K;  1SXT A;  3A8J E;  5CBE E;  2NVX B;  2F0H A;  3E5S A;  2PCF B;  4NP5 A;  1I6V C;  3I90 A;  1RD9 D;  4OIK A;  2AQ2 B;  4FVM A;  1EZ8 A;  4ZK9 B;  1Z47 A;  1SYB A;  3F2U A;  1IW7 C;  3HGB A;  2PMZ B;  3NE5 B;  2EJF C;  4C3I G;  4KI0 A;  2RBM A;  1PTO H;  2L11 A;  4KY5 A;  3D6W A;  4ZUJ A;  4K6L A;  4XIG S;  4KN4 C;  2EY5 A;  2RDF A;  4H0L C;  2XNA C;  4ZLT F;  3QO2 A;  3NQT A;  4A3I B;  1IHZ A;  2LMC B;  4RGO S;  4WJW A;  1HCZ A;  3RZO B;  1AP0 A;  1KLG D;  1JB3 A;  4J1M A;  1NUC A;  3BVG A;  2WAQ B;  1CA5 A;  2IW3 A;  1U9R A;  4CJ0 B;  4DNT B;  2NBF A;  2F0L A;  4H13 C;  5EPK A;  1GUS A;  2K7V A;  4RAU C;  1B53 A;  1R9T B;  3CU7 A;  3H0G B;  3SK4 A;  4A3E B;  1D5M C;  3BVM A;  3DWA A;  2YYZ A;  5ELE A;  1SYC A;  3GO5 A;  4O42 A;  1QCB D;  2SNS A;  4ID6 A;  3MAQ A;  3IKJ A;  4HMJ A;  5IOC A;  1G8Z D;  3D4W A;  2KA7 A;  2L12 A;  3TP7 A;  2TSS A;  4TRD A;  4KN7 C;  4XT3 B;  3K7A B;  4DGZ A;  2E2D C;  2YU9 B;  3NHH A;  1AEX A;  1B4O A;  5C3E B;  4L63 B;  5HUR A;  1EY5 A;  1Y1W B;  1TS5 A;  1IYU A;  4IFD J;  2FFK B;  2NVQ B;  5CR3 A;  1AZQ A;  1GOZ A;  3MXP A;  3GTG B;  1NCV A;  4NDX A;  4TKO B;  4R8I A;  1EOT A;  1ILQ A;  1Q8I A;  2CW0 D;  2ZT9 C;  5DM6 3;  2EXZ A;  1D2B A;  1BCP F;  1FD7 D;  3S1M B;  1RCV D;  1D1I A;  3Q22 A;  2XRQ D;  3T13 A;  2VXW A;  1STY A;  1B50 A;  2D62 A;  4DN4 M;  5G3L D;  3SE0 A;  1CA6 A;  4U67 3;  3I8Z A;  3VR3 A;  3C46 A;  3CQZ B;  1GUG A;  4RKL A;  5I4D A;  5FOB B;  4A3F B;  1DOM A;  4K5V A;  1TKW B;  2F3W A;  4C3H B;  3DXJ C;  5EBD A;  3I70 A;  4K14 A;  3FMC A;  4IUN A;  3OWE B;  5CBA E;  3FKI B;  1KLU D;  1EWC A;  2AWO A;  2IT1 A;  1CTM A;  3V96 A;  1SNO A;  4A3J B;  1CZG A;  2KOL A;  3M4Y A;  2BOS A;  1LTI D;  1V1P B;  5EQ0 A;  1EU4 A;  2ID0 A;  2MGS A;  5C5M A;  2MHV A;  2K33 A;  3HKZ B;  1Z7T A;  4GZY C;  1F9P A;  2VNU D;  2A74 C;  3BG3 A;  2XRS D;  3FPU B;  2G9D A;  2HUG A;  2IX0 A;  4C1N I;  2IPK D;  3RLF A;  2F0J A;  4KKT A;  1C8C A;  1I4X A;  2L4N A;  3DUZ A;  2IJ0 A;  3A54 A;  3SR1 A;  3T51 B;  4FXK C;  1DYQ A;  2F0D A;  5J39 A;  3H3V C;  3BDL A;  5KND A;  5JEA J;  4FF4 A;  1Q12 A;  3D4D A;  1HHV A;  4ODG A;  2D5D A;  3EA6 A;  1I6H B;  1O7Y A;  1PTO C;  3L9A X;  3S14 B;  3SVM A;  1DON A;  2EVB A;  3E0J A;  2V4D A;  5LHY 1;  1DJR D;  1WD1 A;  3TP6 A;  4RHS A;  3ND9 A;  3S15 B;  1TY0 A;  1ILP A;  4Q5V A;  1SMY D;  2O2L D;  3QIA A;  4CKE A;  5E4W C;  1FNU A;  2K28 A;  2F03 A;  4KK7 A;  1WVL A;  1E2V A;  4I65 A;  4G7O C;  3NQI A;  4E6I A;  4IUT A;  1IKM A;  4RCN A;  3H09 A;  1QOH A;  2A6H D;  4CHT B;  3S17 B;  4FXD A;  1ROD A;  2PQE A;  5I2Y A;  5FLX E;  4H44 C;  1E2Z A;  4QUC A;  4IUV A;  1FYC A;  2XIW A;  4B9X A;  4IFD H;  4KY7 A;  3M7N A;  1GHK A;  1A3U A;  4HR7 B;  1F2M A;  3D4R A;  2L0C A;  1BOS A;  4EGV A;  2NTT A;  1I4P A;  4RCO A;  3I72 A;  1TS2 A;  1D5X C;  1BCP B;  3IFD A;  4TQU S;  1B9N A;  1S5D D;  2JA5 B;  1HUM A;  2A68 D;  4A93 B;  2DN8 A;  3WOE A;  3OW7 A;  2N55 A;  1EQT A;  1RTO A;  1HA5 A;  1TS4 A;  1JR0 D;  1QWY A;  1CQF A;  4IZ8 A;  3HOV B;  5FLX L;  5M5X B;  2PYK A;  2EDG A;  4M8A A;  5JVG 3;  1SFO B;  4O1N A;  1CI3 M;  2J4X A;  2RDG A;  3S9W A;  2F0G A;  3PUY A;  1PMR A;  3SK6 A;  3MC0 B;  1EY7 A;  1HQM C;  3C3L A;  1O7Z A;  5JVH 3;  4G7H C;  3NSW A;  3R3O A;  3DWP A;  2JSO A;  2K04 A;  1LTR D;  2B2Y A;  4IAL A;  1F9R A;  1SYE A;  1O7L A;  1MGS A;  3OSO A;  1QNU A;  1RKN A;  2R3Z A;  1PDQ A;  1FGB D;  2PO4 A;  4K2L A;  2E2H B;  3M85 A;  5CC4 A;  3V2T A;  2ICI A;  4ZRZ A;  1K8M A;  1B1Z A;  3HEJ A;  4N9P A;  2TMP A;  1SJE D;  3X3N A;  1CM9 A;  2MP1 A;  5IGC A;  1BF4 A;  2B39 A;  4ZKB B;  5IGE A;  3Q6S A;  2A5H A;  1J9O A;  2A69 D;  1SBB B;  5C0X H;  4QB4 A;  1ENA A;  4F8M A;  3PUV A;  1EQV A;  2B8G A;  5EKK A;  1V43 A;  3VA5 A;  1PRT B;  2F3V A;  2B2Y C;  2JA7 B;  3TZU A;  3MVV A;  2JE6 I;  1F2L A;  4XQQ A;  4NMZ A;  2B2T A;  2OEO A;  5C4J B;  3VR5 A;  2EE1 A;  1AW7 A;  2O5J C;  2AWN A;  3NWT A;  1PRT C;  4OO1 H;  1I50 B;  1JC7 A;  4Y7N B;  3GTL B;  1TR5 A;  2R61 A;  1LV9 A;  3SXH A;  3ERO A;  2IL8 A;  2NN6 G;  3BDO A;  2M2L A;  1OXX K;  5CYU A;  4HN7 A;  2PNR C;  1OXV A;  2NTS A;  2EYJ A;  2PW5 A;  1HUN A;  2F4I A;  2BDO A;  2L1B A;  3HOZ B;  1Y8P B;  3TDQ A;  1KAA A;  5D65 A;  2VUM B;  1FR3 A;  4XQJ A;  3A56 A;  3T4A C;  2O4X A;  2WII B;  1NSN S;  5I6Y A;  1A2U A;  4C3H G;  5CV8 A;  2AQ1 B;  2B2T C;  5BN3 A;  3HOX B;  1TWF B;  1D1K A;  2ZXR A;  1SYD A;  4P2C B;  4CKB A;  3GTO B;  5EKL A;  3NTK A;  1ICW A;  1HA6 A;  5KYL A;  2E2J B;  3K5M A;  3OIP A;  1BO0 A;  3BS1 A;  2EYO A;  3P7J A;  2CVR A;  1SSO A;  1PTO F;  4BS9 A;  2B2U A;  4IN3 A;  4NW2 A;  4WOR A;  2X6L A;  4G7Z C;  4F7X A;  3P75 A;  1AFP A;  1KNE A;  4HMI A;  1EY0 A;  5AFW A;  2I07 B;  2DY7 A;  1SND A;  1EIH A;  1JWS D;  1RHP A;  2HCI A;  1QJO A;  3PIP 3;  5M5W B;  4EQN A;  1F77 A;  2NVT B;  4K5X A;  2D9U A;  5BN5 A;  2PZU A;  5I9P A;  5EKI A;  1SDF A;  3EFX D;  3FDT A;  3VR6 A;  5ELF A;  1LTT D;  4KHV A;  3G6J B;  3FRP B;  3H6M A;  5C44 B;  4KTA A;  2C9O A;  1A6X A;  4ABN A;  1PZJ D;  4PMW A;  1II3 A;  1PFB A;  3GQB A;  4K6D A;  3PO2 B;  2B2U C;  2CW0 C;  4DXG A;  1EEI D;  4XDX A;  4RWS C;  2WKD A;  5K36 H;  3GTJ B;  4NKL A;  2F0P A;  3QG1 A;  4L6T B;  4JBW A;  5C0X I;  3MXG A;  1DM0 B;  1Y69 U;  3NP8 A;  1STB A;  2Q8T A;  5J1Z A;  3H94 A;  1IL8 A;  1WCM B;  2DNC A;  1Y8N B;  3KBX A;  1GUN A;  1U4R A;  2QKI C;  3OMC A;  1FNV A;  4DNR B;  1GHJ A;  2PPB C;  2E74 C;  2XSC A;  2C5C A;  4ULL A;  5CV9 A;  4OO1 I;  5C4Z A;  4HTH A;  3S1N B;  1F2Y A;  1TY2 A;  4LJZ C;  1BQQ T;  1HFN A;  3P1H A;  2QCP X;  4KJN A;  3I91 A;  2HQE A;  1LTA D;  1DZ1 A;  3OPO A;  4U68 A;  5BN4 A;  1O80 A;  1SYF A;  5JJZ A;  1LTB D;  3AMU A;  1E2W A;  4DAY A;  3DEP A;  2LY7 A;  1STN A;  1S5E D;  1LTG D;  3C2P A;  2IX1 A;  2PZW A;  3S1Q B;  2LKV A;  1QB5 D;  4BWG B;  2LS0 1;  2E76 C;  3K0Y A;  4KV6 A;  3BZD B;  4HSP A;  3HP3 A;  3I4L A;  1EYC A;  3MXU A;  4OHJ A;  1LT6 D;  5KYI A;  2CHB D;  3HOW B;  1HTP A;  2KUM A;  2R93 B;  1XX8 A;  3DEO A;  3C1E A;  3Q24 A;  4DK1 A;  1SYG A;  1H9J A;  1NR4 A;  3KLS A;  2Z8L A;  3A55 A;  2JEA I;  2WAC A;  4FF3 A;  1FNW A;  1JOO A;  1TWG B;  5NUC A;  5FO9 B;  4KKS A;  5I2X A;  1S5B D;  2SNM A;  1SNP A;  4CGY B;  2F0S A;  1PTO B;  3NK9 A;  3L7Z C;  1SMY C;  1XTC D;  3AB9 A;  3OIQ A;  3EQL C;  2XN9 C;  1KDC A;  5M3F B;  1KDB A;  3G7L A;  2H1E A;  1C48 A;  2EY6 A;  3VYU A;  3PUX A;  5D3I B;  2RDH A;  3HG9 A;  5CV7 A;  5C0X J;  3E6Z X;  1C4Q A;  2A6H C;  4CKC A;  5IIF A;  4OIJ A;  4XXE A;  1WTR A;  5CMD A;  5F2D A;  4BY1 B;  3GD7 A;  3RD4 A;  1ET6 A;  3T53 B;  1PRT F;  3MEH A;  1QIL A;  1JWM D;  1PLF A;  3KK7 A;  1TII D;  3PO3 B;  2X6G A;  2EYL A;  3BVZ A;  2F0T A;  4A3K B;  3HOU B;  2VB2 X;  1RTN A;  4A3M B;  3NPP A;  4YIJ A;  3WOF A;  2F0Q A;  3R2T A;  5CV4 A;  3NBH A;  4X3U A;  3BYT B;  4F87 A;  1B9M A;  5KIX A;  3H91 A;  4A3D B;  1B2T A;  3Q23 A;  1PXU A;  1J8I A;  1Q3L A;  2A68 C;  1TU2 B;  1WTP A;  3D31 A;  1ZKO A;  1U4L A;  5DAU A;  2O5I C;  1R4P B;  1T5E A;  2D2C C;  1XWE A;  1EWH A;  3SDZ A;  2EYP A;  1STA A;  1X32 A;  3LX0 A;  2KCC A;  2NWG A;  4KHZ A;  1G2S A;  1X3P A;  3W3A A;  2K32 A;  4KKU A;  1SNM A;  1H9M A;  3TSS A;  4TSS A;  2NVY B;  4IFD G;  4PNY A;  3UI2 A;  4ME5 A;  1TWC B;  2QEJ C;  3R2I A;  2EZV A;  3QWN A;  3S1R B;  3GV3 A;  1VF5 C;  3VR4 A;  2WB1 B;  1H9S A;  1GUO A;  1SE4 A;  1S5C D;  5I6W A;  3GP7 A;  1VMC A;  5K5P A;  2WV6 D;  2IWH A;  5DNF A;  1S4Z A;  2K1B A;  2BA1 A;  5A2Q E;  3S2H B;  1ZYR D;  5DM7 3;  3VR2 A;  1W6J A;  3TP8 A;  1TT2 A;  2JXM B;  1LTS D;  5ELC A;  5LL6 X;  2BE5 D;  5FKA C;  5T1I A;  4C3J B;  4MHE A;  1H9R A;  3BYY B;  4M1U B;  4ZQ3 A;  5JOB A;  1EY8 A;  1M8A A;  1B3A A;  1HFG A;  2ZXO A;  3JAM E;  2A69 C;  2F0M A;  4CBV A;  2JP1 A;  1H9S B;  1TS3 A;  4XTC S;  1BCP D;  1Q1B A;  2F0K A;  4LMQ D;  4BBR B;  2N88 A;  1PFM A;  4KY6 A;  3R8B A;  3MFY A;  4HSV A;  2OT2 A;  1YNJ D;  1K83 B;  2OXP A;  2JA6 B;  3I4M B;  2JEB I;  4K8J A;  1VCI A;  5G3L F;  5IGF A;  4PMC A;  3QOJ A;  3TP5 A;  4KD3 A;  1STG A;  2NZ1 D;  4EVO A;  1RF2 D;  1ESR A;  2FJ2 A;  5CGK A;  3J7A V;  3ND8 A;  1ML0 D;  4IUR A;  5A2Q L;  3SK8 A;  3NUC A;  5C4H A;  1T5X D;  3N6R A;  4S3S A;  5JEA G;  4V0B A;  4ILW A;  2B8F A;  5JAV A;  4OGQ C;  1F9Q A;  2KEE A;  1M4V A;  1Z6H A;  3HZX A;  3VA7 A;  4RKB A;  3PIO 3;  3MXN A;  4WFN 3;  2HCC A;  2K03 A;  1SNQ A;  3JAM L;  5COR A;  1HTL D;  2EYF A;  2NN6 H;  3OHX C;  1A3V A;  1PYW D;  3RMH A;  1AZP A;  2J7Z A;  5C5L A;  5EPL A;  2MUY A;  1RJT A;  2K05 A;  3K59 A;  2K01 A;  1PFN A;  2ZXP A;  3K5L A;  1XXG A;  1NR2 A;  2L5T A;  4ZUI A;  2Y0S B;  5IOD A;  4OO1 G;  3TME A;  2R6G A;  4R8N A;  2AUJ D;  2A6E D;  3OMG A;  5E4X A;  4V19 0;  2KEC A;  4QMG A;  2F0O A;  4J8Q A;  2RA4 A;  1JCK B;  1KNA A;  1AN8 A;  4RA8 A;  1F2Z A;  2Z1C A;  3PV0 A;  5E3F A;  1EYD A;  2SOB A;  1TWA B;  2L55 A;  5EJW A;  1G2T A;  2PW7 A;  4X3T A;  2EY1 A;  1ET9 A;  2H4O A;  3HOY B;  1PZK D;  1V1O A;  1LAC A;  3K6O A;  4UAI A;  4X3S A;  3BDC A;  4QIW B;  5FO7 B;  2NB0 A;  1DOK A;  3URY A;  3MHB A;  2EPB A;  2XWJ B;  2F0N A;  5C3X A;  2BCO A;  1LO5 D;  2RQX A;  1CHQ D;  1YNN D;  4F88 A;  4I7Z C;  5ELB A;  1HQR D;  2RSO A;  3MWY W;  1O78 A;  2GA4 B;  3EJI A;  1I3Q B;  2K5Q A;  1UAP A;  4FNF A;  3N52 A;  2I46 A;  3IL8 A;  4EQO A;  4AYB B;  3I73 A;  3OWF A;  4QUF A;  4CJ2 C;  5CV6 A;  4N9T A;  3PUW A;  1IW7 D;  5HGT A;  3KLS X;  4PV1 C;  1SAP A;  1LT5 D;  2BA0 A;  1ZXT A;  1A2T A;  3FVQ A;  3DMU A;  4FF1 A;  3DHQ A;  4RGM A;  4LK1 C;  5M3M B;  5EPJ A;  2HDM A;  1EL0 A;  4XT1 B;  1F9S A;  1BBX C;  1CT1 D;  1BNZ A;  1CHP D;  2E75 C;  3CKI B;  4XQN A;  3GV6 A;  1GXD C;  5IGG A;  5D3D A;  4LAA A;  2MJ8 A;  1WTO A;  4RHR A;  5TSS A;  1G6Z A;  4DF7 A;  3A7A B;  2JA8 B;  4KJO A;  3K58 A;  1WTQ A;  1MBY A;  1Q90 A;  2L9H A;  3D3R A;  2CQA A;  3MZ5 A;  3ZYY X;  3T16 A;  5K36 G;  2F0W A;  4K8I A;  1STE A;  2F0V A;  2IX3 A;  1Y8O B;  2DY8 A;  2NYZ D;  1L0Y B;  2Q8R E;  3FEW X;  1UEA B;  2NN6 I;  3A8K E;  2EJM A;  4Z9C B;  2X69 A;  5FO8 B;  3EVQ A;  2KVM A;  5KNB A;  5JPN C;  1SE2 A;  2A73 B;  1X3Q A;  3VYR A;  1V1P A;  1I4H A;  3WDN A;  4FF2 A;  3GTQ B;  4CJ1 B;  4FO2 A;  2FMM A;  1CZW A;  3J80 E;  2EJG C;  3HRZ C;  2VB3 X;  1QE6 A;  5C6A A;  3A8I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...