4CJ2C

Crystal structure of hewl in complex with affitin h4
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
VKVKFFWNGEEKEVDTSKIVWVKRAGKSVLFIYDDNGKNGYGDVTEKDAPKELLDMLARAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords LYSOZYME C
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 13
structure length 62
sequence length 62
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj2C00
1MSGA 2HDLA 2L11A 1EL0A 5EPLA 1DONA 1B53A 2RVLA 4QUFA 1WTOA 5D65A 1JE4A 2NWGA 4QUCA 4X3SA 1B50A 4CJ1B 2L12A 2HCIA 1G6ZA 1RTOA 2KECA 3DEOA 2D9UA 2L4NA 2H1EA 1E0BA 1QG7A 1RODA 1SAPA 1X32A 2FFKB 2XIWA 1DOMA 3HP3A 4IUVA 2SDFA 2RSNA 1VMPA 3FPUB 4ZKCB 1HA6A 3R93A 1WD1A 2HUGA 4R9WA 4ZAIA 1F2LA 1QNKA 4HAEA 1WTQA 1J9OA 1Q3LA 2RA4A 2L9HA 4LMQD 1BO0A 1ILPA 1O80A 3DEPA 2J7ZA 3I91A 1VMCA 3G7LA 1BNZA 1PFNA 4XDXA 5CBEE 1AZPA 2MPMA 2FHTA 2B2UA 3DM1A 1HUNA 3GV3A 5T1GA 1F9PA 2K04A 5AFWA 2B2TA 2B2VC 2JP1A 3KUPA 5D14A 1WTWA 4OIKA 1CM9A 1KNEA 1M8AA 1U4LA 1U4PA 1CA5A 2FINB 1DOKA 1LV9A 1PFBA 5CBAE 1WTVA 1AP0A 3F2UA 4X3KA 2JYOA 2Q8RE 1WVLA 1HRJA 2HCCA 2K28A 4HEDA 4IUTA 4OIJA 3H91A 2KEDA 4RA8A 2K1BA 3IL8A 1B3AA 4U68A 2N55A 1MGSA 1PFMA 5DNFA 5EJWA 1AZQA 1ILQA 2K03A 2KEEA 1PDQA 1SSOA 4ZLTF 1BF4A 1F9RA 1J8IA 3MTSA 4O42A 4HCSA 1JICA 1IKMA 2IL8A 3TN2A 2NYZD 4R8IA 1XX8A 5EPKA 1EIGA 3Q6SA 5COYA 4UAIA 2MGSA 2B2YC 4IUPA 1IKLA 1F9SA 1QE6A 1B2TA 1HFNA 5E4WC 1O7ZA 2MP1A 1PLFA 1DZ1A 2N88A 1WTPA 5JJZA 2MJ8A 3QO2A 1A15A 1RHPA 1ZXTA 2BDNA 1EQTA 4X3TA 2R3ZA 1XYIA 2B2WC 2EPBA 1CA6A 1NAPA 1X3PA 4MHEA 2FMMA 1NR4A 1SDFA 2VXWA 4NW2A 1WTXA 1ICWA 2NZ1D 3I3CA 2DY8A 1X3QA 3KBXA 3FDTA 1G2TA 2X6GA 2EE1A 2RSOA 2B2VA 1ESRA 2DY7A 2X6LA 3IFDA 3GV6A 4XT1B 3UI2A 4XT3B 4CJ2C 1KNAA 1ML0D 4IURA 1U4RA 1G91A 1U4MA 3P7JA 1C8CA 5EPJA 2B2WA 1HUMA 1MI2A 2L1BA 2K01A 4DN4M 3I8ZA 1IL8A 3TZDA 4ZKBB 1HHVA 2KOLA 2FJ2A 2B2UC 4MN3A 2Q8TA 3SVMA 1WTRA 2HDMA 1DOLA 4CJ0B 1NR2A 3D6WA 2B2TC 3I90A 5T1IA 5E4XA 2EOTA 3N52A 4IUUA 2KUMA 4IUQA 1O7YA 1WD0A 1HFGA 1GUWA 1G2SA 2X69A 1RJTA 4RAUC 1EIHA 1S4ZA 2B2YA 2KVMA 1EOTA 2M2LA 3MWYW 1NCVA 1BBXC 4X3UA 5CORA 5EKIA 4ZK9B 4HSVA 1MSHA 3LWEA 1TVXA 3ONAB 5CMDA 1B4OA 2K05A 1RTNA 1F9QA 4RWSC 5EQ0A 2CVRA
chains in the Genus database with same CATH superfamily
2K14A 3G6EA 2D0PA 4F8MA 1DONA 5BN4A 1KABA 3E6ZX 2NTSA 3M4QA 4LF7L 2DJFC 2UXBQ 2H1EA 1SAPA 3AEVA 5BR8Q 3FPUB 4LFBQ 3WOFA 2ZM6Q 1TXYA 4KV6A 2IWHA 2Z0SA 5M3FB 1K83B 1VQEA 3ITPA 3UDXA 3DEPA 4YCWA 5IYBH 1TWFH 4BBRB 5IT9c 2F0DA 4HTHA 3GDEA 1XNRL 4AYBG 4QIWE 3A5ZB 3PUWA 3T53B 4OIKA 1XPRA 1JB7A 3BDCA 3VYUA 2EYOA 3QR8A 4X3KA 1EY4A 3CRLC 1EIYB 2NZOA 3QOJA 2Y0SE 2RHSB 3GTOB 4KD3A 1ESFA 1JOKA 1SNQA 2AQ1B 4CBVA 1H9JA 4CKBA 1TWGB 2JQOA 5C3WA 2PMZE 5IODA 4HCEA 1HZ9A 3V05A 2JEAI 1O7ZA 1EEID 2LFNA 2N88A 1EUJA 2MJ8A 3BZKA 2LKVA 3QO2A 4DUZQ 2QDBA 3OWFA 1LTTD 2UXBL 1E7ZA 3O13A 2VXWA 1QUQA 4BY1B 2DY8A 4F7XA 2KCCA 4LFBL 2ZM6L 3A7AB 4DXFA 1CFMA 4DAMA 3PQIA 4X64Q 4IO9A 1EQVA 3IAYA 5C44B 2CKZB 1WTHA 3TZDA 3CPWA 4IQZA 1LTSD 1SBBB 2XSCA 1SRUA 1QWYA 3H6MA 5I2YA 1I4XA 3GTGH 1LTRD 2A6HD 1SFOH 1KRSA 4HIDA 1XMQQ 2K7VA 3CD6A 4BXXH 2UXDQ 4K5XA 1VQ6A 2B2YA 2JA6H 4BY7B 1STEA 3W3AA 3HOWB 1I6VC 4RCOA 4IJHA 5EQ0A 5I9PA 1UAPA 5CR3A 1YJNA 4QUFA 1WTOA 3ULLA 2JA5G 3HOYG 1Q46A 2XWJB 1XJVA 1FGBD 3DEOA 4DR3Q 2RHQB 3S1MH 1H9MA 1CZWA 3R93A 5BN5A 4G7HC 1CKNB 1WTQA 5L37A 4Z9CB 1CQFA 5KRUA 2SNSA 4DF7A 4HMJA 2OTLA 5JJIA 4OHJA 5JEAH 2EJFC 3FRPB 4A3MB 3I70A 1TS5A 4IPCA 2UUAQ 1V1QA 4DAVA 1X3FA 4A3IH 2AQ2B 2B2VC 2E74C 1VQ7A 2FMCA 3T1HQ 3ULJA 2WV6D 2J0TD 1GUSA 2F4IA 5CBAE 1IBML 2KENA 3T16A 4DXGA 5K36G 3GTMB 3SK6A 4RA8A 3MFYA 3S2HB 4A76A 1HNXL 1MBYA 1PFMA 1P8LA 4C1NK 1AZQA 2PPBC 4BBSB 4A3BB 1XMQL 3GTJH 4MZ9A 4QB4A 2UXDL 1KXLA 1N9WA 1Q1BA 2JEBI 4OONA 3PO2H 2EJGC 4JI4L 3NPPA 2KCTA 1N36Q 1D5MC 1MJEA 2RKSA 1UE6A 1YVCA 4UPAA 4Q0FA 3W1BA 2LS01 4C2MB 3CCRA 4RMFA 5IWAQ 1K8MA 1IYJB 3G48A 2R7ZG 1NAPA 2Q2IA 2PI2A 4DR3L 3HOXB 2ASBA 2B39A 2VUMG 4N9TA 4IFDH 1NMFA 2BE5C 3E0JA 1G2TA 2XWBB 4JI7L 1TKWB 1UNSA 1CTMA 1QZHA 1VQBA 3PUYA 1F2MA 5AJ3Q 1NJIC 4WJ3M 2PNRC 5FLMG 3T1HL 4POFA 3HOVH 3DHQA 2A5HA 5IY0A 2R6GA 4KLKA 3JAMc 1HFGA 2KCNA 4RHSA 2YYZA 3K0YA 5FO8B 4OEMB 3TP7A 1OXUA 5FO7B 1MSHA 3TRZA 4XQQA 1I4PA 1D7QA 3P1HA 4YWLA 2HDLA 1A0IA 2QCPX 2LMCB 1Y1WH 4DK1A 1EYAA 2NWGA 1N36L 3MC0B 4LK1C 4LF4Q 2NN6H 3VYSA 1N32Q 2XIWA 1QG7A 2MO0A 2A74C 1C7YA 5IWAL 3UE0A 5C3EH 2NVTH 1JT8A 2B8FA 4A3JH 1BO0A 4TQUS 2SEBD 4HIKA 1MD2D 2DNCA 2EYMA 3MXNB 3G7LA 3D31A 2F0SA 3DM1A 1ICFB 3IKJA 5FJ8H 4QIWB 3QJYA 4A93G 1KQSA 1EYDA 2DUDA 3RZDB 1AFPA 2F3VA 2F3IA 1CK1A 3PF4A 2G5DA 4DV3Q 3KLWA 3Q8DA 4P73A 4KK7A 2Q8RE 5AJ3L 4JI3Q 2UXCL 4X62Q 4K2KA 4ZUIA 3I4OA 2Y0SB 5EKKA 1JWUD 1L1OB 4HJ7A 2IX1A 4E6IA 4DFAA 4GKKQ 2PMZB 4C3JH 2IPKD 2Z6BA 3HKZE 1XX8A 3L9AX 3OIQA 3I55A 3D0FA 4UY8C 4IUPA 3EIVA 4ZCKA 4YHHQ 4LW1A 2I0QA 3RLOA 3TREA 1F2YA 4FF1A 1PTOD 2R7FA 3R2TA 2AWNA 1ZXTA 2K4KA 2WP8J 3BDOA 4LF9L 2R3ZA 5I2XA 2TSSA 1XYIA 5JJLA 1N32L 4B3RQ 3T4AC 1JJCB 3B6YA 3TQYA 5J22A 3NEMA 1WTXA 4RH6A 1VQCA 4DU9A 2EE1A 5KYLA 2B2VA 3SDZA 3IFDA 1ML0D 3VR2A 1C8CA 3T56B 3RZOH 2RDHA 5IYCG 2L1BA 4DV0L 3KLSA 3W5OA 3S15H 4L63B 3K5NA 1L1OC 1STNA 3NENA 3H15A 4DR2L 3SXHA 2F1MA 2HDMA 1IYUA 3KLRA 1KLGD 5EKLA 2NVYB 4TSSA 1E2ZA 3M85A 4DV3L 3NHHA 4B3TQ 4X62L 4J8QA 2K33A 3NE5B 3S2HH 2NVQB 1PZID 2EXZA 5EBDA 3GTKB 2V4DA 4NKLA 1F9QA 4GKKL 2G9HD 1XNQQ 1E24A 3FVQA 5IP9G 2RVLA 1GUGA 4MTKA 4YHHL 4OWTB 2JA7B 1RODA 2PI2E 2FFKB 3CQZB 1HA6A 2SDFA 3SR1A 1VMPA 3ND8A 5DLQE 3CCLA 3QG1A 1Q3LA 3S16B 4I65A 2F0EA 1K8GA 2R92B 1YJ9A 3GTLH 2HT1A 4XDXA 5CBEE 1FYCA 3M3YB 5M5WH 5LMNQ 1SNMA 2F0MA 3EN2A 3A8IE 3VDYA 1VQLA 1F2ZA 1CM9A 3CCMA 1KDCA 4FXDA 3OWEB 3EBEA 2JN4A 5IP7G 3I2ZA 3NQIA 4ME3A 2BA0A 4NXNL 1U5KA 1B8AA 2F0PA 2VB2X 4UDUC 4RGTA 3PIO3 1VQ9A 1SROA 3NBIA 3K5MA 5CV6A 2E76C 3A7LA 3OPOA 4B3TL 1FNVA 1ASYA 2A68C 3DXJC 4A3KG 1ET9A 1DYQA 2E2HB 2F0HA 1I50H 5COYA 1XNQL 4R4IA 4B3SQ 1TWHB 3VYRA 3U4VA 1XPOA 4JG2A 2VL6A 4IPHA 4A3LG 4DUYQ 4BWGB 2A6EC 3M4OB 2X6GA 1HH2P 4J6HA 5IIFA 2DY7A 3UI2A 3S2DH 5ISRA 3OIPA 4GLVB 1TWAH 4KD4A 3EJIA 2B2WA 1ENAA 1SJHD 3I8ZA 1JWMD 4LWCA 4C56C 2KOLA 1I94Q 2EQSA 3RZDH 1WTRA 4CDEC 2CCZA 5M3FG 1AH9A 1GOZA 3ERQA 4EQOA 1FNUA 4KKSA 5KYIA 3RN2A 2N49A 1RIPA 2C5CA 4GS3A 4NPSA 4H02A 4BBRG 1FJGQ 3MWYW 1A3UA 3DLLA 2KQ3A 4LUVA 1B4OA 4PZ7A 3MXNA 4O1NA 2QDLA 5NUCA 5LMNW 1V9PA 1S5ED 4BA1I 3MA2B 1SE4A 4B3SL 4JV5Q 2HQEA 1QUQB 3HOYH 2D5DA 3K7UC 2JA5H 2F4VQ 4LF6Q 4DUYL 3PSIA 2ZTCA 1BNZA 1L1OA 3MVVA 2MPMA 2FHTA 5M3MB 3QB3A 4R4OA 5AFWA 1K0SA 1II3A 1CKOA 3KUPA 3LX0A 3RMHA 3C1EA 2UUCQ 3E0EA 4OWXB 4IJLA 1I6HH 4BY1G 1I94L 2PZUA 4QGUA 3IL8A 4GKJQ 1V1OA 1HR0L 3PCOB 2K03A 3CU7A 1L0WA 4IUNA 4NXMQ 1NUCA 2IL8A 2ZXRA 4Y52H 5K36H 3HKZB 5C44G 1Q86C 4L5RC 1QJOA 3L2PA 3FPPA 1IYVA 4LUOA 3SK8A 4YCVA 4DGZA 4DV6Q 3S9WA 1NY4A 2ZJPA 3I4MB 1BUVT 2JA8B 5JOBA 1B3QA 4K14A 4HJAA 4HIOA 2EYPA 4BY7G 4OGQC 3MEHA 4LF5Q 4JV5L 4JPBW 3HOWG 2FMMA 2H4OA 1STGA 3J7YW 5C4XB 3PUVA 2B29A 2CW0C 3TP6A 1AEXA 1J5EQ 2R7ZH 4LF6L 1VS0A 5G3LF 1G91A 2VUMH 1JMCA 2Z8LA 4DN4M 1VF5C 1VQ5A 2C9OA 3IFTA 4HSPA 4C3HB 4DPGA 2UUCL 1C4QA 1I4HA 4CGYB 1VQAA 1N33Q 2WKDA 5JPMC 4A3MG 1M1KC 1O7LA 5FLMH 1YHQA 1PRTF 4HN7A 4JYAQ 4HSVA 4GKJL 2WAQE 2RDGA 4EQ5A 1TT2A 3RN5A 1B53A 5KNBA 1CUKA 4YCUA 4QUCA 4OX9Q 2L12A 5M5XH 1RTOA 3ZYYX 4DV6L 2R61A 1Y8PB 3C3LA 4BBSG 5IT9L 1HNZL 3V2TA 4A3BG 2F0UA 4LF5L 1ILPA 2CHBD 3I91A 4EQPA 5FOBB 1PRTB 1UEAB 2F52A 3HG9A 1RCVD 1PMRA 1J5EL 1VQJA 1UUPA 4WRDA 4K2LA 3CPFA 1HJPA 1DGSA 2Z6KC 3H3VH 1MHWC 4PQXA 5DM73 1Y1VB 2FXQA 4HJ8A 3HOXG 2M9VA 2B63B 2JYOA 3TSSA 3S1RB 4A93H 4QJFA 2K1BA 1MGSA 1ILQA 1QVGA 2BE5D 1PXUA 1BF4A 1N33L 1SE3A 2PYKA 4HCSA 3P20A 1HTLD 2WACA 1Q8IA 1SXTA 4JBWA 1EIGA 1KDAA 4JYAL 2QW7A 1WYDA 2QILA 5KIXA 3FP9A 2MO1A 1D6EC 4UP8A 2E8GA 2LY7A 2BA1A 1EQTA 4NDXA 4OX9L 4HMIA 1PRTC 1TY2A 1D5ZC 1EY6A 1JB3A 1CZGA 1PH3A 4TKOB 3TDQA 5HGQA 1A63A 2F0VA 2P5ZX 3GQBA 4L5QA 3HKSA 2E5LQ 2R7DA 4FDBA 4DR7L 4APVA 4PG3A 2EXDA 5M5YB 1SMYC 2BH2A 3GTQH 5IYCH 1GVPA 3N52A 5JJKA 1G2SA 5BR8L 4MIUA 3DUZA 4ZK9B 1VQIA 1H95A 5CMDA 3ONAB 2L0CA 5KNCA 4FF4A 2RQXA 3PMFA 3C1FA 3FHWA 1H9RA 1TY0A 2EYFA 5M9OA 1VQNA 5FLXE 2A19A 3PV0A 2Y0SG 5KNDA 1YHAA 2QEJC 4GNXB 5IP9H 4R9WA 1VQFA 2YU9H 2EYLA 3PO3B 1JOOA 2F3WA 2RA4A 1PV4A 1SMXA 3E9IA 1S5DD 4Y7NB 1PH8A 2C35B 4DV1Q 5CV8A 1F9PA 2EVBA 3HOUB 5IGGA 2MUYA 2JP1A 2J4XA 1M8AA 1K3BC 1W3SA 2E5LL 1YNXA 1EWCA 2GVAA 1EYCA 4AQYQ 3SGIA 4JI8Q 1YZ6A 1HRJA 4S3SA 3AFQA 2UUBQ 2E2IB 3K5OA 2K5DA 5DNFA 2K5QA 4DUZL 1F9RA 4YIJA 3H0GB 5IP7H 2DNEA 1HZAA 2KBNA 2NYZD 4UP9A 5EBCA 1F9SA 5IGDA 4GNXC 1OXVA 1NTGA 2CQAA 4X64L 2BCOA 4IALA 1DZ1A 4A3KH 3LNNA 4KY5A 4KN7C 1ONLA 4X3TA 2AHOB 1PH4A 2EIFA 2XVSA 3OYYA 1LT5D 2KHJA 4K5WA 5C4JB 1ICWA 4LAAA 1N34Q 3GTPB 3VR5A 3I4NB 4ABNA 2Z6KA 4A3LH 1L0XB 4DV4Q 4OWWB 3NTKA 3CXCA 2D0OA 4P71A 1MJCA 3FKIB 4LFCQ 4FVMA 2JXMB 4R1JA 2JA7G 3JAML 5C0XI 4A3CG 4DAPA 2YTVA 4MNOA 1K9MC 2F0IA 1VQMA 1OTCA 1PH9A 1G6PA 2FJ2A 4RCNA 1GD7A 2ZTEA 1S5CD 2XN9C 1PHJA 3PUZA 1O7IA 3H94A 5BN3A 5LHY1 4JI8L 2R92G 1TS3A 3X3NA 1EWHA 2AQ3B 2UUBL 5CORA 2WAQB 2L15A 5M3FH 2PZWA 1K83H 1QB5D 1LTGD 4RWSC 3J81i 2PCFB 1Q7YC 4LUZA 4FXGC 4BBRH 4PZ6A 1STYA 2UUAL 2ZXOA 4FF2A 4CDCC 3M7GA 4ZQ3A 5E1FA 2KECA 2L4NA 3HOZB 1OO9B 1A3TA 3K5LA 4IUVA 2RSNA 3J80i 3DWPA 1FL0A 1BCPF 1Y14B 1QNKA 1E2VA 4N9PA 2UU9Q 3J81j 3I72A 1LTBD 2E75C 1O80A 3S1NB 2A68D 4DR6Q 2F0TA 2Z4IA 3GTOH 1LM0A 4DR1Q 4DV4L 1TWGH 3CF5A 4DKAC 4UP7A 2RCFA 4J15A 1CA5A 4LFCL 5HURA 1DOKA 1PFBA 2OWOA 4ZRZA 4IPDA 5CGKA 3DM3A 3J81E 4IUTA 1S72A 4JC0A 3TP8A 4QCLA 2WKCA 1BCPB 4JW0A 4TVAB 1DJRD 3Q0AA 3WOEA 4XIGS 4CHTB 4BY1H 3CRKC 3TN2A 3J80E 2B8GA 4DAYB 1SR3A 1HFNA 1X3EA 3I73A 1QCBD 1HPCA 4KJOA 5DEHA 1SYGA 2VNUD 5C44H 1RHPA 1RL2A 2B2WC 3I56A 1RF2D 1IBLQ 2H5XA 3BZCA 3KFUA 4XQNA 3DWAA 3MXGA 2A1AA 4C3IB 2SOBA 4QY7A 1D1IA 1ESRA 2UU9L 4BY7H 1UEBA 3HOWH 1GXDC 1U4MA 3NWTA 3R2IA 4DR6L 4A3FB 1BBUA 1QOHA 4TRDA 3TBIB 3A55A 3BU2A 1I3QB 2MNAA 1BCPC 3K59A 3EQLC 4BA2I 3T1YQ 3BVZA 3STBC 1VQKA 4KHPQ 1KAWA 2MQHA 2B2TC 3DMUA 4LF4L 1VQHA 2Z4HA 5CC4A 2X69A 1S4ZA 2JE6I 5DM63 1JWSD 4GNXA 1D8LA 3KBGA 5M3MG 5H1SE 3KJPA 1TVXA 4KI0A 3S1QB 2IJ0A 4A3MH 1X54A 1DCZA 1MIUA 4OO1I 2WB1E 5I9OA 2NVXB 2HCIA 1V1PB 4JBJA 3BDLA 1UWVA 1G8ZD 4NB3A 3H09A 3M4YA 3NBHB 3OMGA 4CKCA 1J9OA 4B3MQ 4LMQD 4JI3L 3GTMH 3HKZG 3LGJA 1IBLL 3BG3A 3E5SA 4BBSH 1HZCA 2VQEQ 4A3BH 1BBWA 4GOPA 3ERSX 5FLXc 1ZKOA 3VR4A 3I4MG 4I7AA 4A3DB 2JA8G 3VYTA 5IOCA 4DNIA 4YWKA 4YY3Q 4B9WA 3L0OA 4QQBX 3R8BA 1FVIA 5I6WA 4DK0A 3ZJYC 3GO5A 1BQQT 3F2UA 4C2MH 3J7A5 1XMOQ 5C0XG 4A3EB 3T1YL 2K28A 4JI6Q 3OTOQ 5C4XG 3LWUA 1Q90A 1EWIA 2D62A 2ENBA 2N3SA 1PDQA 4B3RL 2ICIA 2CW0D 1SJED 4O42A 3HOXH 2A73B 1Y69U 4EX5A 3Q22A 2ICEC 3Q6SA 2A8VA 3K57A 1EU4A 1IKLA 4F88A 4C3HG 2AUJD 3NUCA 2AKWB 3EROA 1G291 2OQKA 3J7AV 1A15A 2OEOA 3D8GA 1KIXA 3KJOA 2K50A 3UDIA 1AE2A 4KY6A 4NW2A 1R9TB 5I6YA 4ALPA 4GN5A 2EY1A 4KMUC 4B3ML 4CDFC 4IURA 2R93B 4A3GB 2Z9HA 2VQEL 4ME5A 1LLRD 5JVH3 2VQFQ 2I07B 1EFID 5F2DA 3W2DA 2ZJRA 1GKHA 2Q8TA 1YJWA 2XRSD 1DOLA 5KEEA 1NR2A 3A8KE 2EOTA 1JJGA 4EQNA 1PYSB 1WD0A 1X55A 1GUOA 1XMOL 1JCKB 1RJTA 1BVSA 4JI6L 3OTOL 1NCVA 2GVBA 3U4ZA 2E2JB 1K3RA 5J3BA 1TWCB 4RKLA 3NTIA 3S17B 1EZ6A 3L3OC 3T13A 1EL0A 5CYUA 1Y1VG 2BH8A 1Z9FA 5JAVA 1B1ZA 1BKBA 1NE3A 1CT1D 2ZTDA 5LMNL 2B63G 1S5FD 2WFWA 3NP8A 4JI1Q 1F77A 2I5MX 1PTOB 1U9RA 1H9KA 2PQEA 3AMUA 3CCJA 3K7AB 3PIP3 5G3LD 2O4XA 5JVG3 5K5PA 1EY8A 2RDFA 5EAYA 3VR6A 2EJMA 2B2TA 4DAYA 1STBA 4F87A 1D1KA 2DJGC 3ER0A 3MXPA 4OL7A 1D5XC 1SEBD 1PRTD 1YNJC 1TWFB 1AW7A 1LT6D 4ZLTF 3R3OA 1B9MA 1L2FA 2ZJQA 5D3DA 1XWEA 1TU2B 1YHBA 4IPGA 1LACA 3J81c 3GP7A 4RFBA 1PTOC 3GD7A 4EVOA 2ZXPA 4LF8Q 1SNCA 1EEFD 3FMCA 4DNRB 1K28A 2EYHA 3U50C 1SMYD 4L5TA 1CA6A 3PIOA 1X3PA 3KK7A 4OO1G 3BVMA 5GQOA 1XTCD 1K8AC 2JA9A 1D2BA 3J80c 2WIIB 4JI1L 4DR5Q 3PUXA 2N78A 4UHVA 5C4ZA 2NVYH 1TS2A 2IT1A 1GHJA 2D2CC 3GV6A 1FJGL 1O78A 2NVQH 1G51A 4H0LC 1J6QA 1UE1A 3GTKH 1SYBA 1HUMA 1NSNS 2F0NA 1KHIA 4N8FA 4XTCS 4Q5VA 1K73C 4PMWA 2B2UC 1R4PB 4DR4Q 3G4SA 4R4TA 4H44C 1WCMB 3PO3G 3OSOA 1TIID 5E4XA 2IHEA 3M9BA 1IW7C 2ATWA 2JA7H 4A3CH 1GUWA 1V1PA 3CQZH 1STHA 1HZBA 3BYTB 3CKIB 1GO3E 4X3UA 1ZEQX 2F4VL 3NBHA 3HOUG 1M90C 3S16H 2K05A 5DAUA 4RHRA 2R92H 1MSGA 1EQQA 1C48A 4RG1A 3M3YH 2WB1B 4ODGA 2YV5A 5CV4A 2EY6A 3JAMi 3GTGB 1KD1C 3HP3A 5D14A 1SFOB 4LF8L 3CHBD 1DOMA 5HY6A 2QA4A 2JA6B 3IRBA 1F2LA 3SHLA 4O0AA 3D6CA 3H0GG 1AN8A 3HGBA 3AYHB 3K80C 4IN3A 4HIMA 3HFZB 4P72A 2F0LA 2PZTA 5LL6S 1QZGA 1L0YB 3MXUA 4LF7Q 3MFGA 1K0RA 1HXYD 1Y8NB 4NXML 3U9SA 2E2HH 3CCUA 1WTWA 1Z7TA 3L7ZC 2CWAA 4GZYC 1JOQA 2CQOA 1TWHH 2SNMA 2HCCA 1QVFA 5ELOA 4X65Q 3I4NG 4OIJA 4DR4L 2NTTA 3H91A 5GAEC 3RUZA 1UE7A 1PFSA 3EVQA 3MTSA 3JAME 1V43A 3FKIG 5J39A 2XTIA 4A3IB 3M4OH 1OXTA 4NP5A 1GUTA 1PLFA 5IGBA 4V0BA 1HNWQ 3NK9A 4AYBE 2HD3A 1SYCA 2GA4B 3BJUA 3KDFA 3GTJB 3KLSX 1EQRA 1NR4A 2WAQG 2WINB 5ELBA 2K5NA 2DGYA 2OT2A 2NZ1D 4A4IA 1CI3M 4RGNA 4B9XA 4XT1B 4A75A 2Q2TA 3OOCA 4QF4A 1FD7D 1FR3A 3AQQA 5JPNC 1IL8A 2V1CC 3HOZG 1Q8KA 4PZ8A 1HTPA 3QIAA 4JCVE 5ELDA 1PH6A 2MHVA 1NBWA 1IBKQ 3VA7A 3C2PA 3VR3A 5GADC 4X65L 2YTXA 3LWEA 5D3IB 5E3FA 1E3PA 3CC7A 3JC66 1EY5A 1EY9A 2A69C 1WJJA 4LFAQ 5M3MH 3HOVB 4DV7Q 5GAGC 2TMPA 2D9UA 4GLAC 1E0BA 4JI5Q 3D4DA 1HNWL 2M00A 3NSWA 3MAQA 1DXMA 4ZAIA 1EIFA 2NB0A 4JBKA 5IYDG 4H13C 1DM0B 4KTAA 3I4LA 2J7ZA 3NTHA 4XYOA 1PFNA 2Z1CA 4RKBA 1Y1WB 2B2UA 1QVCA 5ELFA 2PO4A 3UDFA 1JR0D 1LT3D 1YIJA 2KHIA 5C3XA 4ULLA 2I46A 1EU3A 2K32A 2NVTB 5C3EB 3H3VI 1T5XD 3Q24A 3I4MH 4A3JB 2JA8H 4C3IG 2XNAC 4P75A 1VQGA 1WCMH 1PH1A 1Q1EA 1KC8C 1S5BD 2PQAB 5EJWA 3OW2A 1IBKL 1J8IA 4JK1C 2EY5A 5C0XH 2IHFA 1TR5A 4A3FG 5C4XH 4PMBA 3CMAA 2VB3X 1KDBA 1M4VA 5LMUQ 2O5IC 1IBMQ 3A0JA 2MP1A 5I4DA 4K6DA 5FKAC 1BCPD 4LFAL 3STBD 1HNXQ 5E7NA 4DV7L 5IE8A 1B9NA 2EPBA 2HQLA 3URYA 4C3HH 4JI5L 1SDFA 1KAAA 4C3JB 3I3CA 3ICEA 5C5LA 4GOPB 4JI4Q 2BDOA 4PV1C 2L55A 1VQPA 3NELA 1N8RC 3NWSA 3K8AA 3U58A 4EGVA 3MZ5A 2GN5A 3P7JA 5EPJA 1CSQA 4IZ8A 1IHZA 4DV2Q 2K01A 2KHSA 4ZKBB 5A2QL 3HZXA 4CKEA 4JVZA 2LSSA 2I5LX 4PMCA 1O7YA 1B7YB 3U9OA 3NXWA 1SNOA 1EOTA 4JI7Q 1LYLA 4ZUJA 3Q23A 3RZOB 4A3DG 1HA5A 2OF1A 3S15B 1YITA 2DN8A 1ZYRC 2F0QA 4WFN3 5D65A 5LMUL 4MTNA 1SYDA 1STAA 2IX0A 1PH2A 4CJ1B 4DV1L 3CCVA 3F2CA 4A3EG 4GOPC 3TS0A 1V8QA 2F03A 3TP5A 1CKMA 2RF4A 1CSPA 1Y1VH 2XRQD 4AQYL 2KA7A 5CV7A 3C46A 2B63H 3S1RH 4OXPA 1YNNC 3D4WA 1BXTA 1VMCA 4P2CB 4AIMA 3I7FA 3S14B 1QNUA 2RCNA 3UDGA 2K04A 1H9SB 2O2LD 1KNEA 1U4PA 2FINB 1LV9A 5EGTA 5KGUA 4DV2L 5HGTA 1VQ8A 1PZKD 1Q82C 1VCIA 2E2DC 3CCEA 2OQ0A 4ID6A 4POGA 1I4GA 4U68A 4FO2A 3GTLB 1A8VA 3TZUA 2R93G 4A3GG 4M1UB 5M5WB 4AH6A 4HJ9A 2F0GA 4KHVA 4OELB 2VZAA 2Q8IB 4PNYA 1N34L 1JQYD 1I5FA 2N8NA 1QE6A 5E4WC 1Z47A 2IX3A 2UXCQ 4AYBB 1AE3A 3NQTA 3K81C 2F0JA 3CP0A 2HHHQ 1E1TA 4KY7A 5CV5A 5M5YH 1W2BA 1JE5A 2A6ED 1X3QA 4WORA 1LO5D 3A5UA 2RSOA 1I50B 1MKHA 5C0XJ 4OO1H 1SE8A 1KNAA 4JI0Q 3EA6A 1SN8A 1PYBA 2MFIA 2KCMA 4LF9Q 1K8OA 4DV5Q 1PH5A 3SVMA 5ELCA 2LXJA 2EY2A 4CJ0B 1VQ4A 5T1IA 1PZJD 3S2DB 3DWQA 2K75A 3AB9A 1XPUA 2M2LA 5IGFA 1BBXC 1A2UA 1TWAB 1HCZA 4L8JA 4DV0Q 3PO3H 4JI2Q 1Y8OB 3SK5A 4IFDI 3D3RA 4DR2Q 3M7NA 4KKUA 5EPLA 4Y7NH 1KL9A 1VDZA 3ULPA 1JE4A 4DR1L 4X3SA 3HOUH 1B50A 3KF8B 1JJ2A 5IYBG 1X32A 3M4PA 2EYJA 2A6HC 2CWPA 5ELEA 1YNJD 5FLXL 2HHHL 2K5VA 3PF5A 4J1MA 5JEAJ 2E2IH 5TSSA 3G6JB 1SNDA 1VF7A 1WOCA 3AU7A 3WDNA 2PQAA 1AZPA 5ELNA 3H0GH 4FNFA 5T1GA 4JI0L 3BYYB 3HS0C 4WJ4A 4QL5A 1IZ6A 2KJXA 3K58A 2HIVA 3HOYB 1WTVA 2JA5B 2EZVA 1AP0A 4DV5L 2CFMA 2JK8A 4XYQA 2CH4W 2KEDA 3CCQA 2NN6I 3CMEA 1BOSA 1SSOA 1I4RA 2JJQA 5C4JH 1IKMA 3SEBA 2HIXA 3GTPH 3I4NH 1B44D 5C6AA 4UAIA 3N6RA 4JI2L 1NMGA 4KN4C 3FKIH 1I6HB 1WCMG 1GM5A 4NXNQ 1ASZA 3FEWX 1IW7D 3EFXD 2RBMA 4IFDJ 4KHPL 4G4KA 1JORA 4G57A 4K6LA 4RGOS 2X6LA 2K6AA 5A35A 1IXRA 1CKNA 5IGCA 2I5HA 4XT3B 3G71A 1C9OA 1Z6HA 2WB1G 1TQOA 3KF6B 3S14H 1LTLA 3CCSA 4K0KQ 1LUZA 4ZYSA 4BXXG 1Q81C 1U0LA 4MN3A 2JA6G 1QILA 2VW9A 3I90A 1KTKA 1PH7A 3HOZH 2BOSA 3CW2C 2R7ZB 3T51B 3QWNA 1EIHA 2F0KA 1A2TA 1E22A 4R4QA 3V96A 2VUMB 3RLNA 4IOCA 2ES2A 2CVRA 3S1NH 3S24A 1C0AA 1UE5A 5IT9E 3MEFA 5J1ZA 3KDFB 1DD2A 1PA6A 3AFPA 1G6ZA 2LXKA 2PNHA 1P16A 4GLXA 1X9NA 1HQRD 4YY3L 1H9SA 1X56A 2Q2HA 5JEAG 1PVOA 1WD1A 4LNQA 1PTOF 3K0XA 1X65A 1EOVA 4HAEA 3TMEA 2OXPA 4DK6C 4A3IG 1WFQA 4WJWA 5GROA 1T5EA 2NUCA 5IGEA 4RGMA 4GN4B 4XXEA 1W6JA 1NNXA 3GV3A 5IYDH 2QEXA 5M5XB 1RKNA 4H7BA 2Q2UA 1YEZA 3BZDB 4U673 1Q12A 4JOIC 4CDDC 1KLUD 3RR5A 3VA5A 4K0KL 5FO9B 5GAHC 1SLJA 4I7ZC 4ILWA 1YI2A 1SYEA 4NMZA 1WVLA 4FYDA 4HR7B 3PO2G 1B3AA 2N55A 3HRZC 2B3GA 2QKIC 3SK4A 2KEEA 2AUKA 2K52A 3J81L 1VQDA 2QGQA 4C3IH 5EPKA 1JC7A 2IW3A 2MGSA 1B2TA 1LT4D 3E3XA 3J80L 2L5TA 1WTPA 2EDGA 4IFDG 4A93B 1RDPD 4A3FH 4FP5D 1T9HA 2BDNA 1GHKA 1HR0Q 1I3QH 2VQFL 2ALYB 2PW7A 2OCEA 1ET6A 4N8X1 2F0OA 3F8TA 3BVGA 3KBXA 1RD9D 4JBMA 2QF7A 4CJ2C 1FGUA 1ENCA 4O2DA 2NBFA 3HOVG 2YTYA 2A69D 4V190 3S1QH 3W1GA 1CHQD 1LTAD 3A8JE 2F0WA 1LABA 3OHXC 4M8AA 1FNWA 2NVXH 2XGTA 3KF8A 2KUMA 3OMCA 4IUUA 4IUQA 3H3VC 2AWOA 5FK9C 2NZHA 4XQJA 2KVMA 1Y1WG 5C5MA 1SNPA 1GUNA 3A74A 4B08A 3KYHC 4KHZA 3UE1A 1BDOA 1OXSC 2NN6G 1RTNA 4DK3C 3CAMA 2G9DA 2L11A 4KKTA 3TEHB 1E2WA 1TS4A 1BR9A 5C3EG 1OXXK 1CQVA 4LJZC 1GJXA 4FXKC 3GTQB 2K5WA 2PW5A 3HEJA 4A3JG 4A3DH 3ND9A 4ZKCB 2K5HA 5LL6X 4G7OC 2HUGA 2CH4A 3K6OA 3X3MA 1IL2A 5FJ8G 3F2DA 1E1OA 2L9HA 4A3EH 4YWMA 1A6XA 1EFWA 3CC4A 4IOAA 1EY7A 1B70B 1YBYA 3F2BA 1HUNA 3PGZA 1EYGA 4DA2A 4R4CA 3P75A 2IY5B 1A62A 3WWVA 4P74A 4R8NA 1U4LA 1HNZQ 4KJNA 2ZT9C 3BS1A 5CV9A 2YU9B 1W6KA 4C3JG 1EY0A 4HEDA 3PIPA 2O5JC 4FF3A 3RD4A 1HR0W 4C1NI 4X66Q 2JSOA 1WI5A 4QMGA 2AMCB 2VS1A 1JICA 2OTJA 1R9TH 5A2QE 4DR5L 4R8IA 5C4HA 1XXGA 1X3GA 2B2YC 3A56A 2R93H 4A3GH 1PYWD 1A3VA 1X6OA 1KRTA 3MHBA 1VQOA 1SE2A 5JJZA 3S1MB 3TS2A 3KF6A 3E9HA 4L5SA 3CC2A 3OW7A 4K5VA 3RNUA 2VY3A 4MHEA 3RLFA 4X6AH 1I4QA 4BS9A 2F0FA 3FDTA 1EZ8A 4GN3B 3A54A 1XNRQ 4HJ5A 4JOIA 1U4RA 2E2JH 1ZYRD 1MI2A 4A3KB 1TWCH 1S3OA 3S17H 3D4RA 3QOLA 1HQMC 3J7AF 1HHVA 2ID0A 1S40A 4L6TB 3D6WA 1LTID 1ENFA 1R4QB 4DNTB 3J7ZC 4K8JA 1CHPD 4RAUC 1SYFA 3PO2B 3SE0A 1PTOH 1YNND 5EKIA 1XTDA 3F1ZA 4X66L 3K7AH 4K8IA 4G7ZC 4DR7Q 3KOJA
chains in the Genus database with same CATH topology
4F8MA 1DONA 5BN4A 1KABA 3E6ZX 2NTSA 2H1EA 1SAPA 3FPUB 3WOFA 4KV6A 2IWHA 5M3FB 1K83B 3ITPA 3DEPA 4BBRB 2F0DA 4HTHA 3T53B 3PUWA 4OIKA 3BDCA 3VYUA 2EYOA 4X3KA 1EY4A 3CRLC 3QOJA 3GTOB 4KD3A 1ESFA 1JOKA 1SNQA 2AQ1B 4CBVA 1H9JA 4CKBA 1TWGB 5C3WA 5IODA 4HCEA 3V05A 2JEAI 1O7ZA 1EEID 2LFNA 2N88A 2MJ8A 3QO2A 2LKVA 2QDBA 3OWFA 1LTTD 3O13A 2VXWA 4BY1B 2DY8A 4F7XA 2KCCA 3A7AB 4DXFA 1CFMA 1EQVA 3IAYA 5C44B 3TZDA 4IQZA 1LTSD 1SBBB 2XSCA 1QWYA 3H6MA 5I2YA 1I4XA 1LTRD 2A6HD 2K7VA 4K5XA 2B2YA 4BY7B 1STEA 3W3AA 3HOWB 1I6VC 4RCOA 5EQ0A 5I9PA 1UAPA 5CR3A 4QUFA 1WTOA 2XWJB 1FGBD 3DEOA 1H9MA 1CZWA 3R93A 5BN5A 4G7HC 1WTQA 4Z9CB 1CQFA 5KRUA 2SNSA 4DF7A 4HMJA 4OHJA 5JEAH 2EJFC 3FRPB 4A3MB 3I70A 1TS5A 4DAVA 2AQ2B 2B2VC 2E74C 2FMCA 2WV6D 2J0TD 1GUSA 2F4IA 5CBAE 3T16A 4DXGA 5K36G 3GTMB 3SK6A 4RA8A 3MFYA 3S2HB 4BBSB 1MBYA 1PFMA 1AZQA 4C1NK 2PPBC 4A3BB 4QB4A 1Q1BA 2JEBI 2EJGC 3NPPA 1D5MC 2RKSA 4Q0FA 2LS01 4C2MB 1K8MA 1NAPA 3HOXB 2B39A 4N9TA 4IFDH 2BE5C 3E0JA 1G2TA 2XWBB 1TKWB 1UNSA 1CTMA 3PUYA 1F2MA 2PNRC 3DHQA 2A5HA 2R6GA 1HFGA 2KCNA 4RHSA 2YYZA 3K0YA 5FO8B 3TP7A 1OXUA 5FO7B 1MSHA 4XQQA 1I4PA 3P1HA 2HDLA 2QCPX 2LMCB 4DK1A 1EYAA 2NWGA 3MC0B 4LK1C 2NN6H 3VYSA 2XIWA 1QG7A 2A74C 2B8FA 1BO0A 4TQUS 2SEBD 1MD2D 2DNCA 2EYMA 3G7LA 3D31A 2F0SA 3DM1A 3IKJA 4QIWB 3QJYA 1EYDA 3RZDB 1AFPA 2F3VA 1CK1A 4KK7A 2Q8RE 4K2KA 4ZUIA 2Y0SB 5EKKA 1JWUD 2IX1A 4E6IA 4DFAA 2PMZB 2IPKD 1XX8A 3L9AX 3OIQA 4IUPA 1F2YA 4FF1A 1PTOD 3R2TA 2AWNA 1ZXTA 2WP8J 3BDOA 2R3ZA 5I2XA 2TSSA 1XYIA 3T4AC 5J22A 1WTXA 4RH6A 4DU9A 5KYLA 2EE1A 2B2VA 3SDZA 3IFDA 1ML0D 3VR2A 1C8CA 3T56B 2RDHA 2L1BA 3KLSA 4L63B 3K5NA 1STNA 3SXHA 2F1MA 2HDMA 1IYUA 3KLRA 1KLGD 5EKLA 2NVYB 4TSSA 1E2ZA 3M85A 3NHHA 4J8QA 2K33A 3NE5B 2NVQB 1PZID 2EXZA 5EBDA 3GTKB 2V4DA 4NKLA 1F9QA 2G9HD 3FVQA 2RVLA 1GUGA 2JA7B 1RODA 2FFKB 3CQZB 1HA6A 2SDFA 3SR1A 1VMPA 3ND8A 3QG1A 1Q3LA 3S16B 4I65A 2F0EA 2R92B 4XDXA 5CBEE 1FYCA 3M3YB 1SNMA 2F0MA 3A8IE 1F2ZA 1CM9A 1KDCA 4FXDA 3OWEB 3NQIA 2BA0A 2F0PA 2VB2X 4UDUC 4RGTA 3PIO3 3NBIA 3K5MA 5CV6A 2E76C 3A7LA 3OPOA 1FNVA 2A68C 3DXJC 2E2HB 1ET9A 1DYQA 2F0HA 5COYA 1TWHB 3VYRA 4BWGB 2A6EC 3M4OB 2X6GA 4J6HA 5IIFA 2DY7A 3UI2A 5ISRA 3OIPA 4KD4A 3EJIA 2B2WA 1ENAA 1SJHD 3I8ZA 1JWMD 4C56C 2KOLA 1WTRA 1GOZA 3ERQA 4EQOA 1FNUA 4KKSA 5KYIA 2C5CA 3MWYW 1A3UA 2KQ3A 1B4OA 3MXNA 4O1NA 5NUCA 1S5ED 4BA1I 3MA2B 1SE4A 2HQEA 2D5DA 1BNZA 3MVVA 2MPMA 2FHTA 5M3MB 3QB3A 5AFWA 1II3A 3KUPA 3LX0A 3RMHA 3C1EA 2PZUA 3IL8A 1V1OA 2K03A 3CU7A 4IUNA 1NUCA 2IL8A 2ZXRA 5K36H 3HKZB 1QJOA 3FPPA 1IYVA 3SK8A 4DGZA 3S9WA 3I4MB 1BUVT 2JA8B 5JOBA 4K14A 2EYPA 4OGQC 3MEHA 2FMMA 2H4OA 1STGA 3J7YW 5C4XB 3PUVA 2CW0C 3TP6A 1AEXA 5G3LF 1G91A 2Z8LA 4DN4M 1VF5C 2C9OA 3IFTA 4HSPA 4C3HB 1C4QA 1I4HA 4CGYB 2WKDA 5JPMC 1O7LA 1PRTF 4HN7A 4HSVA 2RDGA 1TT2A 1B53A 5KNBA 4QUCA 2L12A 1RTOA 3ZYYX 2R61A 1Y8PB 3C3LA 5IT9L 3V2TA 2F0UA 1ILPA 2CHBD 3I91A 4EQPA 5FOBB 1PRTB 1UEAB 3HG9A 1RCVD 1PMRA 1UUPA 4WRDA 4K2LA 4PQXA 5DM73 1Y1VB 2M9VA 2B63B 2JYOA 3TSSA 3S1RB 2K1BA 1MGSA 1ILQA 2BE5D 1PXUA 1BF4A 1SE3A 2PYKA 4HCSA 3P20A 1HTLD 2WACA 1Q8IA 1SXTA 4JBWA 1EIGA 1KDAA 2QILA 5KIXA 1D6EC 2LY7A 2BA1A 1EQTA 4NDXA 4HMIA 1PRTC 1TY2A 1D5ZC 1EY6A 1JB3A 1CZGA 4TKOB 3TDQA 2F0VA 3GQBA 5M5YB 1SMYC 3N52A 1G2SA 4MIUA 3DUZA 4ZK9B 5CMDA 3ONAB 2L0CA 5KNCA 4FF4A 2RQXA 3PMFA 3C1FA 1H9RA 1TY0A 2EYFA 5M9OA 5FLXE 3PV0A 5KNDA 2QEJC 4R9WA 2EYLA 3PO3B 1JOOA 2F3WA 2RA4A 1S5DD 4Y7NB 5CV8A 1F9PA 2EVBA 3HOUB 5IGGA 2MUYA 2JP1A 2J4XA 1M8AA 1EWCA 1EYCA 1HRJA 4S3SA 2E2IB 3K5OA 2K5DA 5DNFA 2K5QA 1F9RA 4YIJA 3H0GB 2DNEA 2NYZD 5EBCA 1F9SA 5IGDA 1OXVA 2CQAA 2BCOA 4IALA 1DZ1A 3LNNA 4KY5A 4KN7C 1ONLA 4X3TA 2XVSA 1LT5D 4K5WA 5C4JB 1ICWA 4LAAA 3GTPB 3VR5A 3I4NB 4ABNA 1L0XB 3NTKA 3FKIB 4FVMA 2JXMB 3JAML 5C0XI 4DAPA 2F0IA 2FJ2A 4RCNA 1S5CD 2XN9C 3PUZA 3H94A 5BN3A 5LHY1 1TS3A 3X3NA 1EWHA 2AQ3B 5CORA 2WAQB 2PZWA 1QB5D 1LTGD 4RWSC 2PCFB 4FXGC 1STYA 4FF2A 2ZXOA 3M7GA 4ZQ3A 5E1FA 2KECA 2L4NA 3HOZB 1OO9B 1A3TA 3K5LA 4IUVA 2RSNA 3DWPA 1BCPF 1QNKA 1E2VA 4N9PA 3I72A 1LTBD 2E75C 1O80A 3S1NB 2A68D 2F0TA 2Z4IA 1CA5A 5HURA 1DOKA 1PFBA 4ZRZA 5CGKA 3J81E 4IUTA 3TP8A 4QCLA 2WKCA 1BCPB 3Q0AA 1DJRD 3WOEA 4XIGS 4CHTB 3CRKC 3TN2A 3J80E 2B8GA 1HFNA 3I73A 1QCBD 1HPCA 4KJOA 5DEHA 1SYGA 2VNUD 1RHPA 2B2WC 1RF2D 4XQNA 3DWAA 3MXGA 4C3IB 2SOBA 1D1IA 1ESRA 1GXDC 1U4MA 3NWTA 3R2IA 4A3FB 1QOHA 4TRDA 3TBIB 3A55A 1I3QB 3K59A 1BCPC 4BA2I 3EQLC 3BVZA 2B2TC 3DMUA 2Z4HA 5CC4A 2X69A 1S4ZA 2JE6I 5DM63 1JWSD 3KBGA 1TVXA 4KI0A 3S1QB 2IJ0A 1DCZA 4OO1I 5I9OA 2NVXB 2HCIA 1V1PB 3BDLA 1G8ZD 3H09A 3M4YA 3OMGA 4CKCA 1J9OA 4LMQD 3BG3A 3E5SA 1ZKOA 3VR4A 4A3DB 3VYTA 5IOCA 4B9WA 3R8BA 5I6WA 4DK0A 3GO5A 1BQQT 3F2UA 5C0XG 4A3EB 2K28A 3LWUA 1Q90A 2D62A 2ENBA 1PDQA 2ICIA 2CW0D 1SJED 4O42A 2A73B 1Y69U 3Q22A 2ICEC 3Q6SA 3K57A 1EU4A 1IKLA 4F88A 4C3HG 2AUJD 3NUCA 3EROA 1G291 3J7AV 1A15A 2OEOA 3D8GA 4KY6A 4NW2A 1R9TB 5I6YA 2EY1A 4KMUC 4IURA 2R93B 4A3GB 4ME5A 1LLRD 5JVH3 2I07B 1EFID 5F2DA 3W2DA 2Q8TA 2XRSD 1DOLA 5KEEA 1NR2A 3A8KE 2EOTA 4EQNA 1WD0A 1GUOA 1JCKB 1RJTA 1NCVA 2E2JB 1TWCB 4RKLA 3NTIA 3S17B 1EZ6A 3L3OC 3T13A 1EL0A 5CYUA 5JAVA 1B1ZA 1CT1D 1S5FD 3NP8A 1F77A 1PTOB 1U9RA 1H9KA 2PQEA 3AMUA 3K7AB 3PIP3 5G3LD 2O4XA 5JVG3 5K5PA 1EY8A 2RDFA 3VR6A 2EJMA 2B2TA 4DAYA 1STBA 4F87A 1D1KA 3MXPA 4OL7A 1D5XC 1SEBD 1PRTD 1YNJC 1TWFB 1AW7A 1LT6D 4ZLTF 3R3OA 1B9MA 5D3DA 1XWEA 1TU2B 1LACA 3GP7A 4RFBA 1PTOC 3GD7A 4EVOA 2ZXPA 1SNCA 1EEFD 3FMCA 4DNRB 2EYHA 1SMYD 1CA6A 1X3PA 3KK7A 4OO1G 3BVMA 1XTCD 1D2BA 2WIIB 3PUXA 5C4ZA 1TS2A 2IT1A 1GHJA 2D2CC 3GV6A 1O78A 4H0LC 1SYBA 1HUMA 1NSNS 2F0NA 4Q5VA 4XTCS 4PMWA 2B2UC 1R4PB 4H44C 1WCMB 3OSOA 1TIID 5E4XA 1IW7C 1GUWA 1V1PA 1STHA 3BYTB 3CKIB 4X3UA 1ZEQX 3NBHA 2K05A 5DAUA 4RHRA 1MSGA 1C48A 2WB1B 4ODGA 5CV4A 2EY6A 3GTGB 3HP3A 5D14A 1SFOB 3CHBD 1DOMA 2JA6B 1F2LA 3SHLA 3D6CA 1AN8A 3HGBA 4IN3A 2F0LA 2PZTA 5LL6S 1L0YB 3MXUA 3MFGA 1HXYD 1Y8NB 3U9SA 1WTWA 1Z7TA 3L7ZC 4GZYC 1JOQA 2SNMA 2HCCA 4OIJA 2NTTA 3H91A 3RUZA 3EVQA 3MTSA 3JAME 1V43A 5J39A 4A3IB 1OXTA 4NP5A 1GUTA 1PLFA 5IGBA 4V0BA 3NK9A 1SYCA 2GA4B 3GTJB 3KLSX 1NR4A 2WINB 5ELBA 2OT2A 2NZ1D 1CI3M 4RGNA 4B9XA 4XT1B 3OOCA 4QF4A 1FD7D 1FR3A 5JPNC 1IL8A 1HTPA 3QIAA 5ELDA 2MHVA 3VA7A 3C2PA 3VR3A 3LWEA 5D3IB 5E3FA 1EY5A 1EY9A 2A69C 3HOVB 2TMPA 2D9UA 1E0BA 3D4DA 2M00A 3NSWA 3MAQA 1DXMA 4ZAIA 2NB0A 4H13C 1DM0B 4KTAA 3I4LA 2J7ZA 3NTHA 4XYOA 1PFNA 2Z1CA 4RKBA 1Y1WB 2B2UA 5ELFA 2PO4A 1JR0D 1LT3D 5C3XA 4ULLA 2I46A 1EU3A 2K32A 2NVTB 5C3EB 1T5XD 3Q24A 4A3JB 4C3IG 2XNAC 1Q1EA 1S5BD 5EJWA 1J8IA 4JK1C 2EY5A 5C0XH 1TR5A 4PMBA 2VB3X 1KDBA 1M4VA 2O5IC 2MP1A 5I4DA 4K6DA 5FKAC 1BCPD 1B9NA 2EPBA 3URYA 1SDFA 1KAAA 4C3JB 3I3CA 5C5LA 2BDOA 4PV1C 2L55A 3NWSA 4EGVA 3MZ5A 3P7JA 5EPJA 4IZ8A 1IHZA 2K01A 2KHSA 4ZKBB 5A2QL 3HZXA 4CKEA 4PMCA 1O7YA 3U9OA 3NXWA 1SNOA 1EOTA 4ZUJA 3Q23A 3RZOB 1HA5A 2OF1A 3S15B 2DN8A 1ZYRC 2F0QA 4WFN3 5D65A 1SYDA 1STAA 2IX0A 4CJ1B 1V8QA 2F03A 3TP5A 2XRQD 2KA7A 5CV7A 3C46A 1YNNC 3D4WA 1BXTA 1VMCA 4P2CB 3S14B 1QNUA 2K04A 1H9SB 2O2LD 1KNEA 1U4PA 2FINB 1LV9A 5EGTA 5KGUA 5HGTA 1PZKD 1VCIA 2E2DC 4ID6A 1I4GA 4U68A 4FO2A 3GTLB 3TZUA 4M1UB 5M5WB 2F0GA 4KHVA 2Q8IB 4PNYA 1JQYD 1QE6A 5E4WC 1Z47A 2IX3A 4AYBB 3NQTA 2F0JA 4KY7A 5CV5A 2A6ED 1X3QA 4WORA 1LO5D 2RSOA 1I50B 5C0XJ 4OO1H 1KNAA 3EA6A 1K8OA 3SVMA 5ELCA 2EY2A 4CJ0B 5T1IA 1PZJD 3S2DB 3DWQA 3AB9A 2M2LA 5IGFA 1BBXC 1A2UA 1TWAB 1HCZA 4L8JA 1Y8OB 3SK5A 4IFDI 3D3RA 3M7NA 4KKUA 5EPLA 1VDZA 1JE4A 4X3SA 1B50A 1X32A 2EYJA 2A6HC 5ELEA 1YNJD 5FLXL 4J1MA 5JEAJ 5TSSA 3G6JB 1SNDA 1VF7A 3AU7A 3WDNA 1AZPA 4FNFA 5T1GA 3BYYB 3HS0C 2KJXA 3K58A 3HOYB 1WTVA 2JA5B 2EZVA 1AP0A 4XYQA 2KEDA 2NN6I 1BOSA 1SSOA 1I4RA 1IKMA 3SEBA 1B44D 5C6AA 4UAIA 3N6RA 4KN4C 1I6HB 3FEWX 1IW7D 3EFXD 2RBMA 4IFDJ 4G4KA 1JORA 4G57A 4K6LA 4RGOS 2X6LA 2K6AA 5A35A 5IGCA 4XT3B 1Z6HA 1TQOA 4ZYSA 4MN3A 1QILA 3I90A 1KTKA 2BOSA 2R7ZB 3T51B 3QWNA 1EIHA 2F0KA 1A2TA 3V96A 2VUMB 2CVRA 5IT9E 5J1ZA 1DD2A 1G6ZA 1HQRD 1H9SA 5JEAG 1WD1A 1PTOF 4HAEA 3TMEA 2OXPA 4WJWA 1T5EA 2NUCA 5IGEA 4RGMA 4XXEA 1W6JA 3GV3A 5M5XB 1RKNA 4H7BA 3BZDB 4U673 1Q12A 1KLUD 3VA5A 5FO9B 4I7ZC 4ILWA 1SYEA 4NMZA 1WVLA 4FYDA 4HR7B 1B3AA 2N55A 3HRZC 2QKIC 3SK4A 2KEEA 2AUKA 3J81L 5EPKA 1JC7A 2IW3A 2MGSA 1B2TA 1LT4D 3J80L 2L5TA 1WTPA 2EDGA 4IFDG 4A93B 1RDPD 4FP5D 2BDNA 1GHKA 2PW7A 1ET6A 2F0OA 3BVGA 3KBXA 1RD9D 2QF7A 4CJ2C 1ENCA 2NBFA 2A69D 4V190 1CHQD 1LTAD 3A8JE 2F0WA 1LABA 3OHXC 4M8AA 1FNWA 3KF8A 2KUMA 3OMCA 4IUUA 4IUQA 3H3VC 2AWOA 5FK9C 4XQJA 2KVMA 5C5MA 1SNPA 1GUNA 4B08A 4KHZA 1BDOA 1OXSC 2NN6G 1RTNA 2G9DA 2L11A 4KKTA 1E2WA 1TS4A 1BR9A 1OXXK 1CQVA 4LJZC 1GJXA 4FXKC 3GTQB 2K5WA 2PW5A 3HEJA 3ND9A 4ZKCB 5LL6X 4G7OC 2HUGA 3K6OA 3X3MA 2L9HA 1A6XA 1EY7A 1HUNA 4DA2A 3P75A 4R8NA 1U4LA 4KJNA 2ZT9C 3BS1A 5CV9A 2YU9B 1W6KA 4C3JG 1EY0A 4HEDA 2O5JC 4FF3A 3RD4A 4C1NI 2JSOA 4QMGA 1JICA 5A2QE 4R8IA 5C4HA 1XXGA 2B2YC 3A56A 1PYWD 1A3VA 3MHBA 1SE2A 5JJZA 3S1MB 3OW7A 4K5VA 4MHEA 3RLFA 1I4QA 4BS9A 2F0FA 3FDTA 1EZ8A 3A54A 1U4RA 1ZYRD 1MI2A 4A3KB 3D4RA 3QOLA 1HQMC 3J7AF 1HHVA 2ID0A 4L6TB 3D6WA 1LTID 1ENFA 1R4QB 4DNTB 4K8JA 1CHPD 4RAUC 1SYFA 3PO2B 3SE0A 1PTOH 1YNND 5EKIA 4K8IA 4G7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  2HDL A;  2L11 A;  1EL0 A;  5EPL A;  1DON A;  1B53 A;  2RVL A;  4QUF A;  1WTO A;  5D65 A;  1JE4 A;  2NWG A;  4QUC A;  4X3S A;  1B50 A;  4CJ1 B;  2L12 A;  2HCI A;  1G6Z A;  1RTO A;  2KEC A;  3DEO A;  2D9U A;  2L4N A;  2H1E A;  1E0B A;  1QG7 A;  1ROD A;  1SAP A;  1X32 A;  2FFK B;  2XIW A;  1DOM A;  3HP3 A;  4IUV A;  2SDF A;  2RSN A;  1VMP A;  3FPU B;  4ZKC B;  1HA6 A;  3R93 A;  1WD1 A;  2HUG A;  4R9W A;  4ZAI A;  1F2L A;  1QNK A;  4HAE A;  1WTQ A;  1J9O A;  1Q3L A;  2RA4 A;  2L9H A;  4LMQ D;  1BO0 A;  1ILP A;  1O80 A;  3DEP A;  2J7Z A;  3I91 A;  1VMC A;  3G7L A;  1BNZ A;  1PFN A;  4XDX A;  5CBE E;  1AZP A;  2MPM A;  2FHT A;  2B2U A;  3DM1 A;  1HUN A;  3GV3 A;  5T1G A;  1F9P A;  2K04 A;  5AFW A;  2B2T A;  2B2V C;  2JP1 A;  3KUP A;  5D14 A;  1WTW A;  4OIK A;  1CM9 A;  1KNE A;  1M8A A;  1U4L A;  1U4P A;  1CA5 A;  2FIN B;  1DOK A;  1LV9 A;  1PFB A;  5CBA E;  1WTV A;  1AP0 A;  3F2U A;  4X3K A;  2JYO A;  2Q8R E;  1WVL A;  1HRJ A;  2HCC A;  2K28 A;  4HED A;  4IUT A;  4OIJ A;  3H91 A;  2KED A;  4RA8 A;  2K1B A;  3IL8 A;  1B3A A;  4U68 A;  2N55 A;  1MGS A;  1PFM A;  5DNF A;  5EJW A;  1AZQ A;  1ILQ A;  2K03 A;  2KEE A;  1PDQ A;  1SSO A;  4ZLT F;  1BF4 A;  1F9R A;  1J8I A;  3MTS A;  4O42 A;  4HCS A;  1JIC A;  1IKM A;  2IL8 A;  3TN2 A;  2NYZ D;  4R8I A;  1XX8 A;  5EPK A;  1EIG A;  3Q6S A;  5COY A;  4UAI A;  2MGS A;  2B2Y C;  4IUP A;  1IKL A;  1F9S A;  1QE6 A;  1B2T A;  1HFN A;  5E4W C;  1O7Z A;  2MP1 A;  1PLF A;  1DZ1 A;  2N88 A;  1WTP A;  5JJZ A;  2MJ8 A;  3QO2 A;  1A15 A;  1RHP A;  1ZXT A;  2BDN A;  1EQT A;  4X3T A;  2R3Z A;  1XYI A;  2B2W C;  2EPB A;  1CA6 A;  1NAP A;  1X3P A;  4MHE A;  2FMM A;  1NR4 A;  1SDF A;  2VXW A;  4NW2 A;  1WTX A;  1ICW A;  2NZ1 D;  3I3C A;  2DY8 A;  1X3Q A;  3KBX A;  3FDT A;  1G2T A;  2X6G A;  2EE1 A;  2RSO A;  2B2V A;  1ESR A;  2DY7 A;  2X6L A;  3IFD A;  3GV6 A;  4XT1 B;  3UI2 A;  4XT3 B;  4CJ2 C;  1KNA A;  1ML0 D;  4IUR A;  1U4R A;  1G91 A;  1U4M A;  3P7J A;  1C8C A;  5EPJ A;  2B2W A;  1HUM A;  1MI2 A;  2L1B A;  2K01 A;  4DN4 M;  3I8Z A;  1IL8 A;  3TZD A;  4ZKB B;  1HHV A;  2KOL A;  2FJ2 A;  2B2U C;  4MN3 A;  2Q8T A;  3SVM A;  1WTR A;  2HDM A;  1DOL A;  4CJ0 B;  1NR2 A;  3D6W A;  2B2T C;  3I90 A;  5T1I A;  5E4X A;  2EOT A;  3N52 A;  4IUU A;  2KUM A;  4IUQ A;  1O7Y A;  1WD0 A;  1HFG A;  1GUW A;  1G2S A;  2X69 A;  1RJT A;  4RAU C;  1EIH A;  1S4Z A;  2B2Y A;  2KVM A;  1EOT A;  2M2L A;  3MWY W;  1NCV A;  1BBX C;  4X3U A;  5COR A;  5EKI A;  4ZK9 B;  4HSV A;  1MSH A;  3LWE A;  1TVX A;  3ONA B;  5CMD A;  1B4O A;  2K05 A;  1RTN A;  1F9Q A;  4RWS C;  5EQ0 A;  2CVR A; 
#chains in the Genus database with same CATH topology
 2K14 A;  3G6E A;  2D0P A;  4F8M A;  1DON A;  5BN4 A;  1KAB A;  3E6Z X;  2NTS A;  3M4Q A;  4LF7 L;  2DJF C;  2UXB Q;  2H1E A;  1SAP A;  3AEV A;  5BR8 Q;  3FPU B;  4LFB Q;  3WOF A;  2ZM6 Q;  1TXY A;  4KV6 A;  2IWH A;  2Z0S A;  5M3F B;  1K83 B;  1VQE A;  3ITP A;  3UDX A;  3DEP A;  4YCW A;  5IYB H;  1TWF H;  4BBR B;  5IT9 c;  2F0D A;  4HTH A;  3GDE A;  1XNR L;  4AYB G;  4QIW E;  3A5Z B;  3PUW A;  3T53 B;  4OIK A;  1XPR A;  1JB7 A;  3BDC A;  3VYU A;  2EYO A;  3QR8 A;  4X3K A;  1EY4 A;  3CRL C;  1EIY B;  2NZO A;  3QOJ A;  2Y0S E;  2RHS B;  3GTO B;  4KD3 A;  1ESF A;  1JOK A;  1SNQ A;  2AQ1 B;  4CBV A;  1H9J A;  4CKB A;  1TWG B;  2JQO A;  5C3W A;  2PMZ E;  5IOD A;  4HCE A;  1HZ9 A;  3V05 A;  2JEA I;  1O7Z A;  1EEI D;  2LFN A;  2N88 A;  1EUJ A;  2MJ8 A;  3BZK A;  2LKV A;  3QO2 A;  4DUZ Q;  2QDB A;  3OWF A;  1LTT D;  2UXB L;  1E7Z A;  3O13 A;  2VXW A;  1QUQ A;  4BY1 B;  2DY8 A;  4F7X A;  2KCC A;  4LFB L;  2ZM6 L;  3A7A B;  4DXF A;  1CFM A;  4DAM A;  3PQI A;  4X64 Q;  4IO9 A;  1EQV A;  3IAY A;  5C44 B;  2CKZ B;  1WTH A;  3TZD A;  3CPW A;  4IQZ A;  1LTS D;  1SBB B;  2XSC A;  1SRU A;  1QWY A;  3H6M A;  5I2Y A;  1I4X A;  3GTG H;  1LTR D;  2A6H D;  1SFO H;  1KRS A;  4HID A;  1XMQ Q;  2K7V A;  3CD6 A;  4BXX H;  2UXD Q;  4K5X A;  1VQ6 A;  2B2Y A;  2JA6 H;  4BY7 B;  1STE A;  3W3A A;  3HOW B;  1I6V C;  4RCO A;  4IJH A;  5EQ0 A;  5I9P A;  1UAP A;  5CR3 A;  1YJN A;  4QUF A;  1WTO A;  3ULL A;  2JA5 G;  3HOY G;  1Q46 A;  2XWJ B;  1XJV A;  1FGB D;  3DEO A;  4DR3 Q;  2RHQ B;  3S1M H;  1H9M A;  1CZW A;  3R93 A;  5BN5 A;  4G7H C;  1CKN B;  1WTQ A;  5L37 A;  4Z9C B;  1CQF A;  5KRU A;  2SNS A;  4DF7 A;  4HMJ A;  2OTL A;  5JJI A;  4OHJ A;  5JEA H;  2EJF C;  3FRP B;  4A3M B;  3I70 A;  1TS5 A;  4IPC A;  2UUA Q;  1V1Q A;  4DAV A;  1X3F A;  4A3I H;  2AQ2 B;  2B2V C;  2E74 C;  1VQ7 A;  2FMC A;  3T1H Q;  3ULJ A;  2WV6 D;  2J0T D;  1GUS A;  2F4I A;  5CBA E;  1IBM L;  2KEN A;  3T16 A;  4DXG A;  5K36 G;  3GTM B;  3SK6 A;  4RA8 A;  3MFY A;  3S2H B;  4A76 A;  1HNX L;  1MBY A;  1PFM A;  1P8L A;  4C1N K;  1AZQ A;  2PPB C;  4BBS B;  4A3B B;  1XMQ L;  3GTJ H;  4MZ9 A;  4QB4 A;  2UXD L;  1KXL A;  1N9W A;  1Q1B A;  2JEB I;  4OON A;  3PO2 H;  2EJG C;  4JI4 L;  3NPP A;  2KCT A;  1N36 Q;  1D5M C;  1MJE A;  2RKS A;  1UE6 A;  1YVC A;  4UPA A;  4Q0F A;  3W1B A;  2LS0 1;  4C2M B;  3CCR A;  4RMF A;  5IWA Q;  1K8M A;  1IYJ B;  3G48 A;  2R7Z G;  1NAP A;  2Q2I A;  2PI2 A;  4DR3 L;  3HOX B;  2ASB A;  2B39 A;  2VUM G;  4N9T A;  4IFD H;  1NMF A;  2BE5 C;  3E0J A;  1G2T A;  2XWB B;  4JI7 L;  1TKW B;  1UNS A;  1CTM A;  1QZH A;  1VQB A;  3PUY A;  1F2M A;  5AJ3 Q;  1NJI C;  4WJ3 M;  2PNR C;  5FLM G;  3T1H L;  4POF A;  3HOV H;  3DHQ A;  2A5H A;  5IY0 A;  2R6G A;  4KLK A;  3JAM c;  1HFG A;  2KCN A;  4RHS A;  2YYZ A;  3K0Y A;  5FO8 B;  4OEM B;  3TP7 A;  1OXU A;  5FO7 B;  1MSH A;  3TRZ A;  4XQQ A;  1I4P A;  1D7Q A;  3P1H A;  4YWL A;  2HDL A;  1A0I A;  2QCP X;  2LMC B;  1Y1W H;  4DK1 A;  1EYA A;  2NWG A;  1N36 L;  3MC0 B;  4LK1 C;  4LF4 Q;  2NN6 H;  3VYS A;  1N32 Q;  2XIW A;  1QG7 A;  2MO0 A;  2A74 C;  1C7Y A;  5IWA L;  3UE0 A;  5C3E H;  2NVT H;  1JT8 A;  2B8F A;  4A3J H;  1BO0 A;  4TQU S;  2SEB D;  4HIK A;  1MD2 D;  2DNC A;  2EYM A;  3MXN B;  3G7L A;  3D31 A;  2F0S A;  3DM1 A;  1ICF B;  3IKJ A;  5FJ8 H;  4QIW B;  3QJY A;  4A93 G;  1KQS A;  1EYD A;  2DUD A;  3RZD B;  1AFP A;  2F3V A;  2F3I A;  1CK1 A;  3PF4 A;  2G5D A;  4DV3 Q;  3KLW A;  3Q8D A;  4P73 A;  4KK7 A;  2Q8R E;  5AJ3 L;  4JI3 Q;  2UXC L;  4X62 Q;  4K2K A;  4ZUI A;  3I4O A;  2Y0S B;  5EKK A;  1JWU D;  1L1O B;  4HJ7 A;  2IX1 A;  4E6I A;  4DFA A;  4GKK Q;  2PMZ B;  4C3J H;  2IPK D;  2Z6B A;  3HKZ E;  1XX8 A;  3L9A X;  3OIQ A;  3I55 A;  3D0F A;  4UY8 C;  4IUP A;  3EIV A;  4ZCK A;  4YHH Q;  4LW1 A;  2I0Q A;  3RLO A;  3TRE A;  1F2Y A;  4FF1 A;  1PTO D;  2R7F A;  3R2T A;  2AWN A;  1ZXT A;  2K4K A;  2WP8 J;  3BDO A;  4LF9 L;  2R3Z A;  5I2X A;  2TSS A;  1XYI A;  5JJL A;  1N32 L;  4B3R Q;  3T4A C;  1JJC B;  3B6Y A;  3TQY A;  5J22 A;  3NEM A;  1WTX A;  4RH6 A;  1VQC A;  4DU9 A;  2EE1 A;  5KYL A;  2B2V A;  3SDZ A;  3IFD A;  1ML0 D;  3VR2 A;  1C8C A;  3T56 B;  3RZO H;  2RDH A;  5IYC G;  2L1B A;  4DV0 L;  3KLS A;  3W5O A;  3S15 H;  4L63 B;  3K5N A;  1L1O C;  1STN A;  3NEN A;  3H15 A;  4DR2 L;  3SXH A;  2F1M A;  2HDM A;  1IYU A;  3KLR A;  1KLG D;  5EKL A;  2NVY B;  4TSS A;  1E2Z A;  3M85 A;  4DV3 L;  3NHH A;  4B3T Q;  4X62 L;  4J8Q A;  2K33 A;  3NE5 B;  3S2H H;  2NVQ B;  1PZI D;  2EXZ A;  5EBD A;  3GTK B;  2V4D A;  4NKL A;  1F9Q A;  4GKK L;  2G9H D;  1XNQ Q;  1E24 A;  3FVQ A;  5IP9 G;  2RVL A;  1GUG A;  4MTK A;  4YHH L;  4OWT B;  2JA7 B;  1ROD A;  2PI2 E;  2FFK B;  3CQZ B;  1HA6 A;  2SDF A;  3SR1 A;  1VMP A;  3ND8 A;  5DLQ E;  3CCL A;  3QG1 A;  1Q3L A;  3S16 B;  4I65 A;  2F0E A;  1K8G A;  2R92 B;  1YJ9 A;  3GTL H;  2HT1 A;  4XDX A;  5CBE E;  1FYC A;  3M3Y B;  5M5W H;  5LMN Q;  1SNM A;  2F0M A;  3EN2 A;  3A8I E;  3VDY A;  1VQL A;  1F2Z A;  1CM9 A;  3CCM A;  1KDC A;  4FXD A;  3OWE B;  3EBE A;  2JN4 A;  5IP7 G;  3I2Z A;  3NQI A;  4ME3 A;  2BA0 A;  4NXN L;  1U5K A;  1B8A A;  2F0P A;  2VB2 X;  4UDU C;  4RGT A;  3PIO 3;  1VQ9 A;  1SRO A;  3NBI A;  3K5M A;  5CV6 A;  2E76 C;  3A7L A;  3OPO A;  4B3T L;  1FNV A;  1ASY A;  2A68 C;  3DXJ C;  4A3K G;  1ET9 A;  1DYQ A;  2E2H B;  2F0H A;  1I50 H;  5COY A;  1XNQ L;  4R4I A;  4B3S Q;  1TWH B;  3VYR A;  3U4V A;  1XPO A;  4JG2 A;  2VL6 A;  4IPH A;  4A3L G;  4DUY Q;  4BWG B;  2A6E C;  3M4O B;  2X6G A;  1HH2 P;  4J6H A;  5IIF A;  2DY7 A;  3UI2 A;  3S2D H;  5ISR A;  3OIP A;  4GLV B;  1TWA H;  4KD4 A;  3EJI A;  2B2W A;  1ENA A;  1SJH D;  3I8Z A;  1JWM D;  4LWC A;  4C56 C;  2KOL A;  1I94 Q;  2EQS A;  3RZD H;  1WTR A;  4CDE C;  2CCZ A;  5M3F G;  1AH9 A;  1GOZ A;  3ERQ A;  4EQO A;  1FNU A;  4KKS A;  5KYI A;  3RN2 A;  2N49 A;  1RIP A;  2C5C A;  4GS3 A;  4NPS A;  4H02 A;  4BBR G;  1FJG Q;  3MWY W;  1A3U A;  3DLL A;  2KQ3 A;  4LUV A;  1B4O A;  4PZ7 A;  3MXN A;  4O1N A;  2QDL A;  5NUC A;  5LMN W;  1V9P A;  1S5E D;  4BA1 I;  3MA2 B;  1SE4 A;  4B3S L;  4JV5 Q;  2HQE A;  1QUQ B;  3HOY H;  2D5D A;  3K7U C;  2JA5 H;  2F4V Q;  4LF6 Q;  4DUY L;  3PSI A;  2ZTC A;  1BNZ A;  1L1O A;  3MVV A;  2MPM A;  2FHT A;  5M3M B;  3QB3 A;  4R4O A;  5AFW A;  1K0S A;  1II3 A;  1CKO A;  3KUP A;  3LX0 A;  3RMH A;  3C1E A;  2UUC Q;  3E0E A;  4OWX B;  4IJL A;  1I6H H;  4BY1 G;  1I94 L;  2PZU A;  4QGU A;  3IL8 A;  4GKJ Q;  1V1O A;  1HR0 L;  3PCO B;  2K03 A;  3CU7 A;  1L0W A;  4IUN A;  4NXM Q;  1NUC A;  2IL8 A;  2ZXR A;  4Y52 H;  5K36 H;  3HKZ B;  5C44 G;  1Q86 C;  4L5R C;  1QJO A;  3L2P A;  3FPP A;  1IYV A;  4LUO A;  3SK8 A;  4YCV A;  4DGZ A;  4DV6 Q;  3S9W A;  1NY4 A;  2ZJP A;  3I4M B;  1BUV T;  2JA8 B;  5JOB A;  1B3Q A;  4K14 A;  4HJA A;  4HIO A;  2EYP A;  4BY7 G;  4OGQ C;  3MEH A;  4LF5 Q;  4JV5 L;  4JPB W;  3HOW G;  2FMM A;  2H4O A;  1STG A;  3J7Y W;  5C4X B;  3PUV A;  2B29 A;  2CW0 C;  3TP6 A;  1AEX A;  1J5E Q;  2R7Z H;  4LF6 L;  1VS0 A;  5G3L F;  1G91 A;  2VUM H;  1JMC A;  2Z8L A;  4DN4 M;  1VF5 C;  1VQ5 A;  2C9O A;  3IFT A;  4HSP A;  4C3H B;  4DPG A;  2UUC L;  1C4Q A;  1I4H A;  4CGY B;  1VQA A;  1N33 Q;  2WKD A;  5JPM C;  4A3M G;  1M1K C;  1O7L A;  5FLM H;  1YHQ A;  1PRT F;  4HN7 A;  4JYA Q;  4HSV A;  4GKJ L;  2WAQ E;  2RDG A;  4EQ5 A;  1TT2 A;  3RN5 A;  1B53 A;  5KNB A;  1CUK A;  4YCU A;  4QUC A;  4OX9 Q;  2L12 A;  5M5X H;  1RTO A;  3ZYY X;  4DV6 L;  2R61 A;  1Y8P B;  3C3L A;  4BBS G;  5IT9 L;  1HNZ L;  3V2T A;  4A3B G;  2F0U A;  4LF5 L;  1ILP A;  2CHB D;  3I91 A;  4EQP A;  5FOB B;  1PRT B;  1UEA B;  2F52 A;  3HG9 A;  1RCV D;  1PMR A;  1J5E L;  1VQJ A;  1UUP A;  4WRD A;  4K2L A;  3CPF A;  1HJP A;  1DGS A;  2Z6K C;  3H3V H;  1MHW C;  4PQX A;  5DM7 3;  1Y1V B;  2FXQ A;  4HJ8 A;  3HOX G;  2M9V A;  2B63 B;  2JYO A;  3TSS A;  3S1R B;  4A93 H;  4QJF A;  2K1B A;  1MGS A;  1ILQ A;  1QVG A;  2BE5 D;  1PXU A;  1BF4 A;  1N33 L;  1SE3 A;  2PYK A;  4HCS A;  3P20 A;  1HTL D;  2WAC A;  1Q8I A;  1SXT A;  4JBW A;  1EIG A;  1KDA A;  4JYA L;  2QW7 A;  1WYD A;  2QIL A;  5KIX A;  3FP9 A;  2MO1 A;  1D6E C;  4UP8 A;  2E8G A;  2LY7 A;  2BA1 A;  1EQT A;  4NDX A;  4OX9 L;  4HMI A;  1PRT C;  1TY2 A;  1D5Z C;  1EY6 A;  1JB3 A;  1CZG A;  1PH3 A;  4TKO B;  3TDQ A;  5HGQ A;  1A63 A;  2F0V A;  2P5Z X;  3GQB A;  4L5Q A;  3HKS A;  2E5L Q;  2R7D A;  4FDB A;  4DR7 L;  4APV A;  4PG3 A;  2EXD A;  5M5Y B;  1SMY C;  2BH2 A;  3GTQ H;  5IYC H;  1GVP A;  3N52 A;  5JJK A;  1G2S A;  5BR8 L;  4MIU A;  3DUZ A;  4ZK9 B;  1VQI A;  1H95 A;  5CMD A;  3ONA B;  2L0C A;  5KNC A;  4FF4 A;  2RQX A;  3PMF A;  3C1F A;  3FHW A;  1H9R A;  1TY0 A;  2EYF A;  5M9O A;  1VQN A;  5FLX E;  2A19 A;  3PV0 A;  2Y0S G;  5KND A;  1YHA A;  2QEJ C;  4GNX B;  5IP9 H;  4R9W A;  1VQF A;  2YU9 H;  2EYL A;  3PO3 B;  1JOO A;  2F3W A;  2RA4 A;  1PV4 A;  1SMX A;  3E9I A;  1S5D D;  4Y7N B;  1PH8 A;  2C35 B;  4DV1 Q;  5CV8 A;  1F9P A;  2EVB A;  3HOU B;  5IGG A;  2MUY A;  2JP1 A;  2J4X A;  1M8A A;  1K3B C;  1W3S A;  2E5L L;  1YNX A;  1EWC A;  2GVA A;  1EYC A;  4AQY Q;  3SGI A;  4JI8 Q;  1YZ6 A;  1HRJ A;  4S3S A;  3AFQ A;  2UUB Q;  2E2I B;  3K5O A;  2K5D A;  5DNF A;  2K5Q A;  4DUZ L;  1F9R A;  4YIJ A;  3H0G B;  5IP7 H;  2DNE A;  1HZA A;  2KBN A;  2NYZ D;  4UP9 A;  5EBC A;  1F9S A;  5IGD A;  4GNX C;  1OXV A;  1NTG A;  2CQA A;  4X64 L;  2BCO A;  4IAL A;  1DZ1 A;  4A3K H;  3LNN A;  4KY5 A;  4KN7 C;  1ONL A;  4X3T A;  2AHO B;  1PH4 A;  2EIF A;  2XVS A;  3OYY A;  1LT5 D;  2KHJ A;  4K5W A;  5C4J B;  1ICW A;  4LAA A;  1N34 Q;  3GTP B;  3VR5 A;  3I4N B;  4ABN A;  2Z6K A;  4A3L H;  1L0X B;  4DV4 Q;  4OWW B;  3NTK A;  3CXC A;  2D0O A;  4P71 A;  1MJC A;  3FKI B;  4LFC Q;  4FVM A;  2JXM B;  4R1J A;  2JA7 G;  3JAM L;  5C0X I;  4A3C G;  4DAP A;  2YTV A;  4MNO A;  1K9M C;  2F0I A;  1VQM A;  1OTC A;  1PH9 A;  1G6P A;  2FJ2 A;  4RCN A;  1GD7 A;  2ZTE A;  1S5C D;  2XN9 C;  1PHJ A;  3PUZ A;  1O7I A;  3H94 A;  5BN3 A;  5LHY 1;  4JI8 L;  2R92 G;  1TS3 A;  3X3N A;  1EWH A;  2AQ3 B;  2UUB L;  5COR A;  2WAQ B;  2L15 A;  5M3F H;  2PZW A;  1K83 H;  1QB5 D;  1LTG D;  4RWS C;  3J81 i;  2PCF B;  1Q7Y C;  4LUZ A;  4FXG C;  4BBR H;  4PZ6 A;  1STY A;  2UUA L;  2ZXO A;  4FF2 A;  4CDC C;  3M7G A;  4ZQ3 A;  5E1F A;  2KEC A;  2L4N A;  3HOZ B;  1OO9 B;  1A3T A;  3K5L A;  4IUV A;  2RSN A;  3J80 i;  3DWP A;  1FL0 A;  1BCP F;  1Y14 B;  1QNK A;  1E2V A;  4N9P A;  2UU9 Q;  3J81 j;  3I72 A;  1LTB D;  2E75 C;  1O80 A;  3S1N B;  2A68 D;  4DR6 Q;  2F0T A;  2Z4I A;  3GTO H;  1LM0 A;  4DR1 Q;  4DV4 L;  1TWG H;  3CF5 A;  4DKA C;  4UP7 A;  2RCF A;  4J15 A;  1CA5 A;  4LFC L;  5HUR A;  1DOK A;  1PFB A;  2OWO A;  4ZRZ A;  4IPD A;  5CGK A;  3DM3 A;  3J81 E;  4IUT A;  1S72 A;  4JC0 A;  3TP8 A;  4QCL A;  2WKC A;  1BCP B;  4JW0 A;  4TVA B;  1DJR D;  3Q0A A;  3WOE A;  4XIG S;  4CHT B;  4BY1 H;  3CRK C;  3TN2 A;  3J80 E;  2B8G A;  4DAY B;  1SR3 A;  1HFN A;  1X3E A;  3I73 A;  1QCB D;  1HPC A;  4KJO A;  5DEH A;  1SYG A;  2VNU D;  5C44 H;  1RHP A;  1RL2 A;  2B2W C;  3I56 A;  1RF2 D;  1IBL Q;  2H5X A;  3BZC A;  3KFU A;  4XQN A;  3DWA A;  3MXG A;  2A1A A;  4C3I B;  2SOB A;  4QY7 A;  1D1I A;  1ESR A;  2UU9 L;  4BY7 H;  1UEB A;  3HOW H;  1GXD C;  1U4M A;  3NWT A;  3R2I A;  4DR6 L;  4A3F B;  1BBU A;  1QOH A;  4TRD A;  3TBI B;  3A55 A;  3BU2 A;  1I3Q B;  2MNA A;  1BCP C;  3K59 A;  3EQL C;  4BA2 I;  3T1Y Q;  3BVZ A;  3STB C;  1VQK A;  4KHP Q;  1KAW A;  2MQH A;  2B2T C;  3DMU A;  4LF4 L;  1VQH A;  2Z4H A;  5CC4 A;  2X69 A;  1S4Z A;  2JE6 I;  5DM6 3;  1JWS D;  4GNX A;  1D8L A;  3KBG A;  5M3M G;  5H1S E;  3KJP A;  1TVX A;  4KI0 A;  3S1Q B;  2IJ0 A;  4A3M H;  1X54 A;  1DCZ A;  1MIU A;  4OO1 I;  2WB1 E;  5I9O A;  2NVX B;  2HCI A;  1V1P B;  4JBJ A;  3BDL A;  1UWV A;  1G8Z D;  4NB3 A;  3H09 A;  3M4Y A;  3NBH B;  3OMG A;  4CKC A;  1J9O A;  4B3M Q;  4LMQ D;  4JI3 L;  3GTM H;  3HKZ G;  3LGJ A;  1IBL L;  3BG3 A;  3E5S A;  4BBS H;  1HZC A;  2VQE Q;  4A3B H;  1BBW A;  4GOP A;  3ERS X;  5FLX c;  1ZKO A;  3VR4 A;  3I4M G;  4I7A A;  4A3D B;  2JA8 G;  3VYT A;  5IOC A;  4DNI A;  4YWK A;  4YY3 Q;  4B9W A;  3L0O A;  4QQB X;  3R8B A;  1FVI A;  5I6W A;  4DK0 A;  3ZJY C;  3GO5 A;  1BQQ T;  3F2U A;  4C2M H;  3J7A 5;  1XMO Q;  5C0X G;  4A3E B;  3T1Y L;  2K28 A;  4JI6 Q;  3OTO Q;  5C4X G;  3LWU A;  1Q90 A;  1EWI A;  2D62 A;  2ENB A;  2N3S A;  1PDQ A;  4B3R L;  2ICI A;  2CW0 D;  1SJE D;  4O42 A;  3HOX H;  2A73 B;  1Y69 U;  4EX5 A;  3Q22 A;  2ICE C;  3Q6S A;  2A8V A;  3K57 A;  1EU4 A;  1IKL A;  4F88 A;  4C3H G;  2AUJ D;  3NUC A;  2AKW B;  3ERO A;  1G29 1;  2OQK A;  3J7A V;  1A15 A;  2OEO A;  3D8G A;  1KIX A;  3KJO A;  2K50 A;  3UDI A;  1AE2 A;  4KY6 A;  4NW2 A;  1R9T B;  5I6Y A;  4ALP A;  4GN5 A;  2EY1 A;  4KMU C;  4B3M L;  4CDF C;  4IUR A;  2R93 B;  4A3G B;  2Z9H A;  2VQE L;  4ME5 A;  1LLR D;  5JVH 3;  2VQF Q;  2I07 B;  1EFI D;  5F2D A;  3W2D A;  2ZJR A;  1GKH A;  2Q8T A;  1YJW A;  2XRS D;  1DOL A;  5KEE A;  1NR2 A;  3A8K E;  2EOT A;  1JJG A;  4EQN A;  1PYS B;  1WD0 A;  1X55 A;  1GUO A;  1XMO L;  1JCK B;  1RJT A;  1BVS A;  4JI6 L;  3OTO L;  1NCV A;  2GVB A;  3U4Z A;  2E2J B;  1K3R A;  5J3B A;  1TWC B;  4RKL A;  3NTI A;  3S17 B;  1EZ6 A;  3L3O C;  3T13 A;  1EL0 A;  5CYU A;  1Y1V G;  2BH8 A;  1Z9F A;  5JAV A;  1B1Z A;  1BKB A;  1NE3 A;  1CT1 D;  2ZTD A;  5LMN L;  2B63 G;  1S5F D;  2WFW A;  3NP8 A;  4JI1 Q;  1F77 A;  2I5M X;  1PTO B;  1U9R A;  1H9K A;  2PQE A;  3AMU A;  3CCJ A;  3K7A B;  3PIP 3;  5G3L D;  2O4X A;  5JVG 3;  5K5P A;  1EY8 A;  2RDF A;  5EAY A;  3VR6 A;  2EJM A;  2B2T A;  4DAY A;  1STB A;  4F87 A;  1D1K A;  2DJG C;  3ER0 A;  3MXP A;  4OL7 A;  1D5X C;  1SEB D;  1PRT D;  1YNJ C;  1TWF B;  1AW7 A;  1LT6 D;  4ZLT F;  3R3O A;  1B9M A;  1L2F A;  2ZJQ A;  5D3D A;  1XWE A;  1TU2 B;  1YHB A;  4IPG A;  1LAC A;  3J81 c;  3GP7 A;  4RFB A;  1PTO C;  3GD7 A;  4EVO A;  2ZXP A;  4LF8 Q;  1SNC A;  1EEF D;  3FMC A;  4DNR B;  1K28 A;  2EYH A;  3U50 C;  1SMY D;  4L5T A;  1CA6 A;  3PIO A;  1X3P A;  3KK7 A;  4OO1 G;  3BVM A;  5GQO A;  1XTC D;  1K8A C;  2JA9 A;  1D2B A;  3J80 c;  2WII B;  4JI1 L;  4DR5 Q;  3PUX A;  2N78 A;  4UHV A;  5C4Z A;  2NVY H;  1TS2 A;  2IT1 A;  1GHJ A;  2D2C C;  3GV6 A;  1FJG L;  1O78 A;  2NVQ H;  1G51 A;  4H0L C;  1J6Q A;  1UE1 A;  3GTK H;  1SYB A;  1HUM A;  1NSN S;  2F0N A;  1KHI A;  4N8F A;  4XTC S;  4Q5V A;  1K73 C;  4PMW A;  2B2U C;  1R4P B;  4DR4 Q;  3G4S A;  4R4T A;  4H44 C;  1WCM B;  3PO3 G;  3OSO A;  1TII D;  5E4X A;  2IHE A;  3M9B A;  1IW7 C;  2ATW A;  2JA7 H;  4A3C H;  1GUW A;  1V1P A;  3CQZ H;  1STH A;  1HZB A;  3BYT B;  3CKI B;  1GO3 E;  4X3U A;  1ZEQ X;  2F4V L;  3NBH A;  3HOU G;  1M90 C;  3S16 H;  2K05 A;  5DAU A;  4RHR A;  2R92 H;  1MSG A;  1EQQ A;  1C48 A;  4RG1 A;  3M3Y H;  2WB1 B;  4ODG A;  2YV5 A;  5CV4 A;  2EY6 A;  3JAM i;  3GTG B;  1KD1 C;  3HP3 A;  5D14 A;  1SFO B;  4LF8 L;  3CHB D;  1DOM A;  5HY6 A;  2QA4 A;  2JA6 B;  3IRB A;  1F2L A;  3SHL A;  4O0A A;  3D6C A;  3H0G G;  1AN8 A;  3HGB A;  3AYH B;  3K80 C;  4IN3 A;  4HIM A;  3HFZ B;  4P72 A;  2F0L A;  2PZT A;  5LL6 S;  1QZG A;  1L0Y B;  3MXU A;  4LF7 Q;  3MFG A;  1K0R A;  1HXY D;  1Y8N B;  4NXM L;  3U9S A;  2E2H H;  3CCU A;  1WTW A;  1Z7T A;  3L7Z C;  2CWA A;  4GZY C;  1JOQ A;  2CQO A;  1TWH H;  2SNM A;  2HCC A;  1QVF A;  5ELO A;  4X65 Q;  3I4N G;  4OIJ A;  4DR4 L;  2NTT A;  3H91 A;  5GAE C;  3RUZ A;  1UE7 A;  1PFS A;  3EVQ A;  3MTS A;  3JAM E;  1V43 A;  3FKI G;  5J39 A;  2XTI A;  4A3I B;  3M4O H;  1OXT A;  4NP5 A;  1GUT A;  1PLF A;  5IGB A;  4V0B A;  1HNW Q;  3NK9 A;  4AYB E;  2HD3 A;  1SYC A;  2GA4 B;  3BJU A;  3KDF A;  3GTJ B;  3KLS X;  1EQR A;  1NR4 A;  2WAQ G;  2WIN B;  5ELB A;  2K5N A;  2DGY A;  2OT2 A;  2NZ1 D;  4A4I A;  1CI3 M;  4RGN A;  4B9X A;  4XT1 B;  4A75 A;  2Q2T A;  3OOC A;  4QF4 A;  1FD7 D;  1FR3 A;  3AQQ A;  5JPN C;  1IL8 A;  2V1C C;  3HOZ G;  1Q8K A;  4PZ8 A;  1HTP A;  3QIA A;  4JCV E;  5ELD A;  1PH6 A;  2MHV A;  1NBW A;  1IBK Q;  3VA7 A;  3C2P A;  3VR3 A;  5GAD C;  4X65 L;  2YTX A;  3LWE A;  5D3I B;  5E3F A;  1E3P A;  3CC7 A;  3JC6 6;  1EY5 A;  1EY9 A;  2A69 C;  1WJJ A;  4LFA Q;  5M3M H;  3HOV B;  4DV7 Q;  5GAG C;  2TMP A;  2D9U A;  4GLA C;  1E0B A;  4JI5 Q;  3D4D A;  1HNW L;  2M00 A;  3NSW A;  3MAQ A;  1DXM A;  4ZAI A;  1EIF A;  2NB0 A;  4JBK A;  5IYD G;  4H13 C;  1DM0 B;  4KTA A;  3I4L A;  2J7Z A;  3NTH A;  4XYO A;  1PFN A;  2Z1C A;  4RKB A;  1Y1W B;  2B2U A;  1QVC A;  5ELF A;  2PO4 A;  3UDF A;  1JR0 D;  1LT3 D;  1YIJ A;  2KHI A;  5C3X A;  4ULL A;  2I46 A;  1EU3 A;  2K32 A;  2NVT B;  5C3E B;  3H3V I;  1T5X D;  3Q24 A;  3I4M H;  4A3J B;  2JA8 H;  4C3I G;  2XNA C;  4P75 A;  1VQG A;  1WCM H;  1PH1 A;  1Q1E A;  1KC8 C;  1S5B D;  2PQA B;  5EJW A;  3OW2 A;  1IBK L;  1J8I A;  4JK1 C;  2EY5 A;  5C0X H;  2IHF A;  1TR5 A;  4A3F G;  5C4X H;  4PMB A;  3CMA A;  2VB3 X;  1KDB A;  1M4V A;  5LMU Q;  2O5I C;  1IBM Q;  3A0J A;  2MP1 A;  5I4D A;  4K6D A;  5FKA C;  1BCP D;  4LFA L;  3STB D;  1HNX Q;  5E7N A;  4DV7 L;  5IE8 A;  1B9N A;  2EPB A;  2HQL A;  3URY A;  4C3H H;  4JI5 L;  1SDF A;  1KAA A;  4C3J B;  3I3C A;  3ICE A;  5C5L A;  4GOP B;  4JI4 Q;  2BDO A;  4PV1 C;  2L55 A;  1VQP A;  3NEL A;  1N8R C;  3NWS A;  3K8A A;  3U58 A;  4EGV A;  3MZ5 A;  2GN5 A;  3P7J A;  5EPJ A;  1CSQ A;  4IZ8 A;  1IHZ A;  4DV2 Q;  2K01 A;  2KHS A;  4ZKB B;  5A2Q L;  3HZX A;  4CKE A;  4JVZ A;  2LSS A;  2I5L X;  4PMC A;  1O7Y A;  1B7Y B;  3U9O A;  3NXW A;  1SNO A;  1EOT A;  4JI7 Q;  1LYL A;  4ZUJ A;  3Q23 A;  3RZO B;  4A3D G;  1HA5 A;  2OF1 A;  3S15 B;  1YIT A;  2DN8 A;  1ZYR C;  2F0Q A;  4WFN 3;  5D65 A;  5LMU L;  4MTN A;  1SYD A;  1STA A;  2IX0 A;  1PH2 A;  4CJ1 B;  4DV1 L;  3CCV A;  3F2C A;  4A3E G;  4GOP C;  3TS0 A;  1V8Q A;  2F03 A;  3TP5 A;  1CKM A;  2RF4 A;  1CSP A;  1Y1V H;  2XRQ D;  4AQY L;  2KA7 A;  5CV7 A;  3C46 A;  2B63 H;  3S1R H;  4OXP A;  1YNN C;  3D4W A;  1BXT A;  1VMC A;  4P2C B;  4AIM A;  3I7F A;  3S14 B;  1QNU A;  2RCN A;  3UDG A;  2K04 A;  1H9S B;  2O2L D;  1KNE A;  1U4P A;  2FIN B;  1LV9 A;  5EGT A;  5KGU A;  4DV2 L;  5HGT A;  1VQ8 A;  1PZK D;  1Q82 C;  1VCI A;  2E2D C;  3CCE A;  2OQ0 A;  4ID6 A;  4POG A;  1I4G A;  4U68 A;  4FO2 A;  3GTL B;  1A8V A;  3TZU A;  2R93 G;  4A3G G;  4M1U B;  5M5W B;  4AH6 A;  4HJ9 A;  2F0G A;  4KHV A;  4OEL B;  2VZA A;  2Q8I B;  4PNY A;  1N34 L;  1JQY D;  1I5F A;  2N8N A;  1QE6 A;  5E4W C;  1Z47 A;  2IX3 A;  2UXC Q;  4AYB B;  1AE3 A;  3NQT A;  3K81 C;  2F0J A;  3CP0 A;  2HHH Q;  1E1T A;  4KY7 A;  5CV5 A;  5M5Y H;  1W2B A;  1JE5 A;  2A6E D;  1X3Q A;  4WOR A;  1LO5 D;  3A5U A;  2RSO A;  1I50 B;  1MKH A;  5C0X J;  4OO1 H;  1SE8 A;  1KNA A;  4JI0 Q;  3EA6 A;  1SN8 A;  1PYB A;  2MFI A;  2KCM A;  4LF9 Q;  1K8O A;  4DV5 Q;  1PH5 A;  3SVM A;  5ELC A;  2LXJ A;  2EY2 A;  4CJ0 B;  1VQ4 A;  5T1I A;  1PZJ D;  3S2D B;  3DWQ A;  2K75 A;  3AB9 A;  1XPU A;  2M2L A;  5IGF A;  1BBX C;  1A2U A;  1TWA B;  1HCZ A;  4L8J A;  4DV0 Q;  3PO3 H;  4JI2 Q;  1Y8O B;  3SK5 A;  4IFD I;  3D3R A;  4DR2 Q;  3M7N A;  4KKU A;  5EPL A;  4Y7N H;  1KL9 A;  1VDZ A;  3ULP A;  1JE4 A;  4DR1 L;  4X3S A;  3HOU H;  1B50 A;  3KF8 B;  1JJ2 A;  5IYB G;  1X32 A;  3M4P A;  2EYJ A;  2A6H C;  2CWP A;  5ELE A;  1YNJ D;  5FLX L;  2HHH L;  2K5V A;  3PF5 A;  4J1M A;  5JEA J;  2E2I H;  5TSS A;  3G6J B;  1SND A;  1VF7 A;  1WOC A;  3AU7 A;  3WDN A;  2PQA A;  1AZP A;  5ELN A;  3H0G H;  4FNF A;  5T1G A;  4JI0 L;  3BYY B;  3HS0 C;  4WJ4 A;  4QL5 A;  1IZ6 A;  2KJX A;  3K58 A;  2HIV A;  3HOY B;  1WTV A;  2JA5 B;  2EZV A;  1AP0 A;  4DV5 L;  2CFM A;  2JK8 A;  4XYQ A;  2CH4 W;  2KED A;  3CCQ A;  2NN6 I;  3CME A;  1BOS A;  1SSO A;  1I4R A;  2JJQ A;  5C4J H;  1IKM A;  3SEB A;  2HIX A;  3GTP H;  3I4N H;  1B44 D;  5C6A A;  4UAI A;  3N6R A;  4JI2 L;  1NMG A;  4KN4 C;  3FKI H;  1I6H B;  1WCM G;  1GM5 A;  4NXN Q;  1ASZ A;  3FEW X;  1IW7 D;  3EFX D;  2RBM A;  4IFD J;  4KHP L;  4G4K A;  1JOR A;  4G57 A;  4K6L A;  4RGO S;  2X6L A;  2K6A A;  5A35 A;  1IXR A;  1CKN A;  5IGC A;  2I5H A;  4XT3 B;  3G71 A;  1C9O A;  1Z6H A;  2WB1 G;  1TQO A;  3KF6 B;  3S14 H;  1LTL A;  3CCS A;  4K0K Q;  1LUZ A;  4ZYS A;  4BXX G;  1Q81 C;  1U0L A;  4MN3 A;  2JA6 G;  1QIL A;  2VW9 A;  3I90 A;  1KTK A;  1PH7 A;  3HOZ H;  2BOS A;  3CW2 C;  2R7Z B;  3T51 B;  3QWN A;  1EIH A;  2F0K A;  1A2T A;  1E22 A;  4R4Q A;  3V96 A;  2VUM B;  3RLN A;  4IOC A;  2ES2 A;  2CVR A;  3S1N H;  3S24 A;  1C0A A;  1UE5 A;  5IT9 E;  3MEF A;  5J1Z A;  3KDF B;  1DD2 A;  1PA6 A;  3AFP A;  1G6Z A;  2LXK A;  2PNH A;  1P16 A;  4GLX A;  1X9N A;  1HQR D;  4YY3 L;  1H9S A;  1X56 A;  2Q2H A;  5JEA G;  1PVO A;  1WD1 A;  4LNQ A;  1PTO F;  3K0X A;  1X65 A;  1EOV A;  4HAE A;  3TME A;  2OXP A;  4DK6 C;  4A3I G;  1WFQ A;  4WJW A;  5GRO A;  1T5E A;  2NUC A;  5IGE A;  4RGM A;  4GN4 B;  4XXE A;  1W6J A;  1NNX A;  3GV3 A;  5IYD H;  2QEX A;  5M5X B;  1RKN A;  4H7B A;  2Q2U A;  1YEZ A;  3BZD B;  4U67 3;  1Q12 A;  4JOI C;  4CDD C;  1KLU D;  3RR5 A;  3VA5 A;  4K0K L;  5FO9 B;  5GAH C;  1SLJ A;  4I7Z C;  4ILW A;  1YI2 A;  1SYE A;  4NMZ A;  1WVL A;  4FYD A;  4HR7 B;  3PO2 G;  1B3A A;  2N55 A;  3HRZ C;  2B3G A;  2QKI C;  3SK4 A;  2KEE A;  2AUK A;  2K52 A;  3J81 L;  1VQD A;  2QGQ A;  4C3I H;  5EPK A;  1JC7 A;  2IW3 A;  2MGS A;  1B2T A;  1LT4 D;  3E3X A;  3J80 L;  2L5T A;  1WTP A;  2EDG A;  4IFD G;  4A93 B;  1RDP D;  4A3F H;  4FP5 D;  1T9H A;  2BDN A;  1GHK A;  1HR0 Q;  1I3Q H;  2VQF L;  2ALY B;  2PW7 A;  2OCE A;  1ET6 A;  4N8X 1;  2F0O A;  3F8T A;  3BVG A;  3KBX A;  1RD9 D;  4JBM A;  2QF7 A;  4CJ2 C;  1FGU A;  1ENC A;  4O2D A;  2NBF A;  3HOV G;  2YTY A;  2A69 D;  4V19 0;  3S1Q H;  3W1G A;  1CHQ D;  1LTA D;  3A8J E;  2F0W A;  1LAB A;  3OHX C;  4M8A A;  1FNW A;  2NVX H;  2XGT A;  3KF8 A;  2KUM A;  3OMC A;  4IUU A;  4IUQ A;  3H3V C;  2AWO A;  5FK9 C;  2NZH A;  4XQJ A;  2KVM A;  1Y1W G;  5C5M A;  1SNP A;  1GUN A;  3A74 A;  4B08 A;  3KYH C;  4KHZ A;  3UE1 A;  1BDO A;  1OXS C;  2NN6 G;  1RTN A;  4DK3 C;  3CAM A;  2G9D A;  2L11 A;  4KKT A;  3TEH B;  1E2W A;  1TS4 A;  1BR9 A;  5C3E G;  1OXX K;  1CQV A;  4LJZ C;  1GJX A;  4FXK C;  3GTQ B;  2K5W A;  2PW5 A;  3HEJ A;  4A3J G;  4A3D H;  3ND9 A;  4ZKC B;  2K5H A;  5LL6 X;  4G7O C;  2HUG A;  2CH4 A;  3K6O A;  3X3M A;  1IL2 A;  5FJ8 G;  3F2D A;  1E1O A;  2L9H A;  4A3E H;  4YWM A;  1A6X A;  1EFW A;  3CC4 A;  4IOA A;  1EY7 A;  1B70 B;  1YBY A;  3F2B A;  1HUN A;  3PGZ A;  1EYG A;  4DA2 A;  4R4C A;  3P75 A;  2IY5 B;  1A62 A;  3WWV A;  4P74 A;  4R8N A;  1U4L A;  1HNZ Q;  4KJN A;  2ZT9 C;  3BS1 A;  5CV9 A;  2YU9 B;  1W6K A;  4C3J G;  1EY0 A;  4HED A;  3PIP A;  2O5J C;  4FF3 A;  3RD4 A;  1HR0 W;  4C1N I;  4X66 Q;  2JSO A;  1WI5 A;  4QMG A;  2AMC B;  2VS1 A;  1JIC A;  2OTJ A;  1R9T H;  5A2Q E;  4DR5 L;  4R8I A;  5C4H A;  1XXG A;  1X3G A;  2B2Y C;  3A56 A;  2R93 H;  4A3G H;  1PYW D;  1A3V A;  1X6O A;  1KRT A;  3MHB A;  1VQO A;  1SE2 A;  5JJZ A;  3S1M B;  3TS2 A;  3KF6 A;  3E9H A;  4L5S A;  3CC2 A;  3OW7 A;  4K5V A;  3RNU A;  2VY3 A;  4MHE A;  3RLF A;  4X6A H;  1I4Q A;  4BS9 A;  2F0F A;  3FDT A;  1EZ8 A;  4GN3 B;  3A54 A;  1XNR Q;  4HJ5 A;  4JOI A;  1U4R A;  2E2J H;  1ZYR D;  1MI2 A;  4A3K B;  1TWC H;  1S3O A;  3S17 H;  3D4R A;  3QOL A;  1HQM C;  3J7A F;  1HHV A;  2ID0 A;  1S40 A;  4L6T B;  3D6W A;  1LTI D;  1ENF A;  1R4Q B;  4DNT B;  3J7Z C;  4K8J A;  1CHP D;  4RAU C;  1SYF A;  3PO2 B;  3SE0 A;  1PTO H;  1YNN D;  5EKI A;  1XTD A;  3F1Z A;  4X66 L;  3K7A H;  4K8I A;  4G7Z C;  4DR7 Q;  3KOJ A; 
#chains in the Genus database with same CATH homology
 4F8M A;  1DON A;  5BN4 A;  1KAB A;  3E6Z X;  2NTS A;  2H1E A;  1SAP A;  3FPU B;  3WOF A;  4KV6 A;  2IWH A;  5M3F B;  1K83 B;  3ITP A;  3DEP A;  4BBR B;  2F0D A;  4HTH A;  3T53 B;  3PUW A;  4OIK A;  3BDC A;  3VYU A;  2EYO A;  4X3K A;  1EY4 A;  3CRL C;  3QOJ A;  3GTO B;  4KD3 A;  1ESF A;  1JOK A;  1SNQ A;  2AQ1 B;  4CBV A;  1H9J A;  4CKB A;  1TWG B;  5C3W A;  5IOD A;  4HCE A;  3V05 A;  2JEA I;  1O7Z A;  1EEI D;  2LFN A;  2N88 A;  2MJ8 A;  3QO2 A;  2LKV A;  2QDB A;  3OWF A;  1LTT D;  3O13 A;  2VXW A;  4BY1 B;  2DY8 A;  4F7X A;  2KCC A;  3A7A B;  4DXF A;  1CFM A;  1EQV A;  3IAY A;  5C44 B;  3TZD A;  4IQZ A;  1LTS D;  1SBB B;  2XSC A;  1QWY A;  3H6M A;  5I2Y A;  1I4X A;  1LTR D;  2A6H D;  2K7V A;  4K5X A;  2B2Y A;  4BY7 B;  1STE A;  3W3A A;  3HOW B;  1I6V C;  4RCO A;  5EQ0 A;  5I9P A;  1UAP A;  5CR3 A;  4QUF A;  1WTO A;  2XWJ B;  1FGB D;  3DEO A;  1H9M A;  1CZW A;  3R93 A;  5BN5 A;  4G7H C;  1WTQ A;  4Z9C B;  1CQF A;  5KRU A;  2SNS A;  4DF7 A;  4HMJ A;  4OHJ A;  5JEA H;  2EJF C;  3FRP B;  4A3M B;  3I70 A;  1TS5 A;  4DAV A;  2AQ2 B;  2B2V C;  2E74 C;  2FMC A;  2WV6 D;  2J0T D;  1GUS A;  2F4I A;  5CBA E;  3T16 A;  4DXG A;  5K36 G;  3GTM B;  3SK6 A;  4RA8 A;  3MFY A;  3S2H B;  4BBS B;  1MBY A;  1PFM A;  1AZQ A;  4C1N K;  2PPB C;  4A3B B;  4QB4 A;  1Q1B A;  2JEB I;  2EJG C;  3NPP A;  1D5M C;  2RKS A;  4Q0F A;  2LS0 1;  4C2M B;  1K8M A;  1NAP A;  3HOX B;  2B39 A;  4N9T A;  4IFD H;  2BE5 C;  3E0J A;  1G2T A;  2XWB B;  1TKW B;  1UNS A;  1CTM A;  3PUY A;  1F2M A;  2PNR C;  3DHQ A;  2A5H A;  2R6G A;  1HFG A;  2KCN A;  4RHS A;  2YYZ A;  3K0Y A;  5FO8 B;  3TP7 A;  1OXU A;  5FO7 B;  1MSH A;  4XQQ A;  1I4P A;  3P1H A;  2HDL A;  2QCP X;  2LMC B;  4DK1 A;  1EYA A;  2NWG A;  3MC0 B;  4LK1 C;  2NN6 H;  3VYS A;  2XIW A;  1QG7 A;  2A74 C;  2B8F A;  1BO0 A;  4TQU S;  2SEB D;  1MD2 D;  2DNC A;  2EYM A;  3G7L A;  3D31 A;  2F0S A;  3DM1 A;  3IKJ A;  4QIW B;  3QJY A;  1EYD A;  3RZD B;  1AFP A;  2F3V A;  1CK1 A;  4KK7 A;  2Q8R E;  4K2K A;  4ZUI A;  2Y0S B;  5EKK A;  1JWU D;  2IX1 A;  4E6I A;  4DFA A;  2PMZ B;  2IPK D;  1XX8 A;  3L9A X;  3OIQ A;  4IUP A;  1F2Y A;  4FF1 A;  1PTO D;  3R2T A;  2AWN A;  1ZXT A;  2WP8 J;  3BDO A;  2R3Z A;  5I2X A;  2TSS A;  1XYI A;  3T4A C;  5J22 A;  1WTX A;  4RH6 A;  4DU9 A;  5KYL A;  2EE1 A;  2B2V A;  3SDZ A;  3IFD A;  1ML0 D;  3VR2 A;  1C8C A;  3T56 B;  2RDH A;  2L1B A;  3KLS A;  4L63 B;  3K5N A;  1STN A;  3SXH A;  2F1M A;  2HDM A;  1IYU A;  3KLR A;  1KLG D;  5EKL A;  2NVY B;  4TSS A;  1E2Z A;  3M85 A;  3NHH A;  4J8Q A;  2K33 A;  3NE5 B;  2NVQ B;  1PZI D;  2EXZ A;  5EBD A;  3GTK B;  2V4D A;  4NKL A;  1F9Q A;  2G9H D;  3FVQ A;  2RVL A;  1GUG A;  2JA7 B;  1ROD A;  2FFK B;  3CQZ B;  1HA6 A;  2SDF A;  3SR1 A;  1VMP A;  3ND8 A;  3QG1 A;  1Q3L A;  3S16 B;  4I65 A;  2F0E A;  2R92 B;  4XDX A;  5CBE E;  1FYC A;  3M3Y B;  1SNM A;  2F0M A;  3A8I E;  1F2Z A;  1CM9 A;  1KDC A;  4FXD A;  3OWE B;  3NQI A;  2BA0 A;  2F0P A;  2VB2 X;  4UDU C;  4RGT A;  3PIO 3;  3NBI A;  3K5M A;  5CV6 A;  2E76 C;  3A7L A;  3OPO A;  1FNV A;  2A68 C;  3DXJ C;  2E2H B;  1ET9 A;  1DYQ A;  2F0H A;  5COY A;  1TWH B;  3VYR A;  4BWG B;  2A6E C;  3M4O B;  2X6G A;  4J6H A;  5IIF A;  2DY7 A;  3UI2 A;  5ISR A;  3OIP A;  4KD4 A;  3EJI A;  2B2W A;  1ENA A;  1SJH D;  3I8Z A;  1JWM D;  4C56 C;  2KOL A;  1WTR A;  1GOZ A;  3ERQ A;  4EQO A;  1FNU A;  4KKS A;  5KYI A;  2C5C A;  3MWY W;  1A3U A;  2KQ3 A;  1B4O A;  3MXN A;  4O1N A;  5NUC A;  1S5E D;  4BA1 I;  3MA2 B;  1SE4 A;  2HQE A;  2D5D A;  1BNZ A;  3MVV A;  2MPM A;  2FHT A;  5M3M B;  3QB3 A;  5AFW A;  1II3 A;  3KUP A;  3LX0 A;  3RMH A;  3C1E A;  2PZU A;  3IL8 A;  1V1O A;  2K03 A;  3CU7 A;  4IUN A;  1NUC A;  2IL8 A;  2ZXR A;  5K36 H;  3HKZ B;  1QJO A;  3FPP A;  1IYV A;  3SK8 A;  4DGZ A;  3S9W A;  3I4M B;  1BUV T;  2JA8 B;  5JOB A;  4K14 A;  2EYP A;  4OGQ C;  3MEH A;  2FMM A;  2H4O A;  1STG A;  3J7Y W;  5C4X B;  3PUV A;  2CW0 C;  3TP6 A;  1AEX A;  5G3L F;  1G91 A;  2Z8L A;  4DN4 M;  1VF5 C;  2C9O A;  3IFT A;  4HSP A;  4C3H B;  1C4Q A;  1I4H A;  4CGY B;  2WKD A;  5JPM C;  1O7L A;  1PRT F;  4HN7 A;  4HSV A;  2RDG A;  1TT2 A;  1B53 A;  5KNB A;  4QUC A;  2L12 A;  1RTO A;  3ZYY X;  2R61 A;  1Y8P B;  3C3L A;  5IT9 L;  3V2T A;  2F0U A;  1ILP A;  2CHB D;  3I91 A;  4EQP A;  5FOB B;  1PRT B;  1UEA B;  3HG9 A;  1RCV D;  1PMR A;  1UUP A;  4WRD A;  4K2L A;  4PQX A;  5DM7 3;  1Y1V B;  2M9V A;  2B63 B;  2JYO A;  3TSS A;  3S1R B;  2K1B A;  1MGS A;  1ILQ A;  2BE5 D;  1PXU A;  1BF4 A;  1SE3 A;  2PYK A;  4HCS A;  3P20 A;  1HTL D;  2WAC A;  1Q8I A;  1SXT A;  4JBW A;  1EIG A;  1KDA A;  2QIL A;  5KIX A;  1D6E C;  2LY7 A;  2BA1 A;  1EQT A;  4NDX A;  4HMI A;  1PRT C;  1TY2 A;  1D5Z C;  1EY6 A;  1JB3 A;  1CZG A;  4TKO B;  3TDQ A;  2F0V A;  3GQB A;  5M5Y B;  1SMY C;  3N52 A;  1G2S A;  4MIU A;  3DUZ A;  4ZK9 B;  5CMD A;  3ONA B;  2L0C A;  5KNC A;  4FF4 A;  2RQX A;  3PMF A;  3C1F A;  1H9R A;  1TY0 A;  2EYF A;  5M9O A;  5FLX E;  3PV0 A;  5KND A;  2QEJ C;  4R9W A;  2EYL A;  3PO3 B;  1JOO A;  2F3W A;  2RA4 A;  1S5D D;  4Y7N B;  5CV8 A;  1F9P A;  2EVB A;  3HOU B;  5IGG A;  2MUY A;  2JP1 A;  2J4X A;  1M8A A;  1EWC A;  1EYC A;  1HRJ A;  4S3S A;  2E2I B;  3K5O A;  2K5D A;  5DNF A;  2K5Q A;  1F9R A;  4YIJ A;  3H0G B;  2DNE A;  2NYZ D;  5EBC A;  1F9S A;  5IGD A;  1OXV A;  2CQA A;  2BCO A;  4IAL A;  1DZ1 A;  3LNN A;  4KY5 A;  4KN7 C;  1ONL A;  4X3T A;  2XVS A;  1LT5 D;  4K5W A;  5C4J B;  1ICW A;  4LAA A;  3GTP B;  3VR5 A;  3I4N B;  4ABN A;  1L0X B;  3NTK A;  3FKI B;  4FVM A;  2JXM B;  3JAM L;  5C0X I;  4DAP A;  2F0I A;  2FJ2 A;  4RCN A;  1S5C D;  2XN9 C;  3PUZ A;  3H94 A;  5BN3 A;  5LHY 1;  1TS3 A;  3X3N A;  1EWH A;  2AQ3 B;  5COR A;  2WAQ B;  2PZW A;  1QB5 D;  1LTG D;  4RWS C;  2PCF B;  4FXG C;  1STY A;  4FF2 A;  2ZXO A;  3M7G A;  4ZQ3 A;  5E1F A;  2KEC A;  2L4N A;  3HOZ B;  1OO9 B;  1A3T A;  3K5L A;  4IUV A;  2RSN A;  3DWP A;  1BCP F;  1QNK A;  1E2V A;  4N9P A;  3I72 A;  1LTB D;  2E75 C;  1O80 A;  3S1N B;  2A68 D;  2F0T A;  2Z4I A;  1CA5 A;  5HUR A;  1DOK A;  1PFB A;  4ZRZ A;  5CGK A;  3J81 E;  4IUT A;  3TP8 A;  4QCL A;  2WKC A;  1BCP B;  3Q0A A;  1DJR D;  3WOE A;  4XIG S;  4CHT B;  3CRK C;  3TN2 A;  3J80 E;  2B8G A;  1HFN A;  3I73 A;  1QCB D;  1HPC A;  4KJO A;  5DEH A;  1SYG A;  2VNU D;  1RHP A;  2B2W C;  1RF2 D;  4XQN A;  3DWA A;  3MXG A;  4C3I B;  2SOB A;  1D1I A;  1ESR A;  1GXD C;  1U4M A;  3NWT A;  3R2I A;  4A3F B;  1QOH A;  4TRD A;  3TBI B;  3A55 A;  1I3Q B;  3K59 A;  1BCP C;  4BA2 I;  3EQL C;  3BVZ A;  2B2T C;  3DMU A;  2Z4H A;  5CC4 A;  2X69 A;  1S4Z A;  2JE6 I;  5DM6 3;  1JWS D;  3KBG A;  1TVX A;  4KI0 A;  3S1Q B;  2IJ0 A;  1DCZ A;  4OO1 I;  5I9O A;  2NVX B;  2HCI A;  1V1P B;  3BDL A;  1G8Z D;  3H09 A;  3M4Y A;  3OMG A;  4CKC A;  1J9O A;  4LMQ D;  3BG3 A;  3E5S A;  1ZKO A;  3VR4 A;  4A3D B;  3VYT A;  5IOC A;  4B9W A;  3R8B A;  5I6W A;  4DK0 A;  3GO5 A;  1BQQ T;  3F2U A;  5C0X G;  4A3E B;  2K28 A;  3LWU A;  1Q90 A;  2D62 A;  2ENB A;  1PDQ A;  2ICI A;  2CW0 D;  1SJE D;  4O42 A;  2A73 B;  1Y69 U;  3Q22 A;  2ICE C;  3Q6S A;  3K57 A;  1EU4 A;  1IKL A;  4F88 A;  4C3H G;  2AUJ D;  3NUC A;  3ERO A;  1G29 1;  3J7A V;  1A15 A;  2OEO A;  3D8G A;  4KY6 A;  4NW2 A;  1R9T B;  5I6Y A;  2EY1 A;  4KMU C;  4IUR A;  2R93 B;  4A3G B;  4ME5 A;  1LLR D;  5JVH 3;  2I07 B;  1EFI D;  5F2D A;  3W2D A;  2Q8T A;  2XRS D;  1DOL A;  5KEE A;  1NR2 A;  3A8K E;  2EOT A;  4EQN A;  1WD0 A;  1GUO A;  1JCK B;  1RJT A;  1NCV A;  2E2J B;  1TWC B;  4RKL A;  3NTI A;  3S17 B;  1EZ6 A;  3L3O C;  3T13 A;  1EL0 A;  5CYU A;  5JAV A;  1B1Z A;  1CT1 D;  1S5F D;  3NP8 A;  1F77 A;  1PTO B;  1U9R A;  1H9K A;  2PQE A;  3AMU A;  3K7A B;  3PIP 3;  5G3L D;  2O4X A;  5JVG 3;  5K5P A;  1EY8 A;  2RDF A;  3VR6 A;  2EJM A;  2B2T A;  4DAY A;  1STB A;  4F87 A;  1D1K A;  3MXP A;  4OL7 A;  1D5X C;  1SEB D;  1PRT D;  1YNJ C;  1TWF B;  1AW7 A;  1LT6 D;  4ZLT F;  3R3O A;  1B9M A;  5D3D A;  1XWE A;  1TU2 B;  1LAC A;  3GP7 A;  4RFB A;  1PTO C;  3GD7 A;  4EVO A;  2ZXP A;  1SNC A;  1EEF D;  3FMC A;  4DNR B;  2EYH A;  1SMY D;  1CA6 A;  1X3P A;  3KK7 A;  4OO1 G;  3BVM A;  1XTC D;  1D2B A;  2WII B;  3PUX A;  5C4Z A;  1TS2 A;  2IT1 A;  1GHJ A;  2D2C C;  3GV6 A;  1O78 A;  4H0L C;  1SYB A;  1HUM A;  1NSN S;  2F0N A;  4Q5V A;  4XTC S;  4PMW A;  2B2U C;  1R4P B;  4H44 C;  1WCM B;  3OSO A;  1TII D;  5E4X A;  1IW7 C;  1GUW A;  1V1P A;  1STH A;  3BYT B;  3CKI B;  4X3U A;  1ZEQ X;  3NBH A;  2K05 A;  5DAU A;  4RHR A;  1MSG A;  1C48 A;  2WB1 B;  4ODG A;  5CV4 A;  2EY6 A;  3GTG B;  3HP3 A;  5D14 A;  1SFO B;  3CHB D;  1DOM A;  2JA6 B;  1F2L A;  3SHL A;  3D6C A;  1AN8 A;  3HGB A;  4IN3 A;  2F0L A;  2PZT A;  5LL6 S;  1L0Y B;  3MXU A;  3MFG A;  1HXY D;  1Y8N B;  3U9S A;  1WTW A;  1Z7T A;  3L7Z C;  4GZY C;  1JOQ A;  2SNM A;  2HCC A;  4OIJ A;  2NTT A;  3H91 A;  3RUZ A;  3EVQ A;  3MTS A;  3JAM E;  1V43 A;  5J39 A;  4A3I B;  1OXT A;  4NP5 A;  1GUT A;  1PLF A;  5IGB A;  4V0B A;  3NK9 A;  1SYC A;  2GA4 B;  3GTJ B;  3KLS X;  1NR4 A;  2WIN B;  5ELB A;  2OT2 A;  2NZ1 D;  1CI3 M;  4RGN A;  4B9X A;  4XT1 B;  3OOC A;  4QF4 A;  1FD7 D;  1FR3 A;  5JPN C;  1IL8 A;  1HTP A;  3QIA A;  5ELD A;  2MHV A;  3VA7 A;  3C2P A;  3VR3 A;  3LWE A;  5D3I B;  5E3F A;  1EY5 A;  1EY9 A;  2A69 C;  3HOV B;  2TMP A;  2D9U A;  1E0B A;  3D4D A;  2M00 A;  3NSW A;  3MAQ A;  1DXM A;  4ZAI A;  2NB0 A;  4H13 C;  1DM0 B;  4KTA A;  3I4L A;  2J7Z A;  3NTH A;  4XYO A;  1PFN A;  2Z1C A;  4RKB A;  1Y1W B;  2B2U A;  5ELF A;  2PO4 A;  1JR0 D;  1LT3 D;  5C3X A;  4ULL A;  2I46 A;  1EU3 A;  2K32 A;  2NVT B;  5C3E B;  1T5X D;  3Q24 A;  4A3J B;  4C3I G;  2XNA C;  1Q1E A;  1S5B D;  5EJW A;  1J8I A;  4JK1 C;  2EY5 A;  5C0X H;  1TR5 A;  4PMB A;  2VB3 X;  1KDB A;  1M4V A;  2O5I C;  2MP1 A;  5I4D A;  4K6D A;  5FKA C;  1BCP D;  1B9N A;  2EPB A;  3URY A;  1SDF A;  1KAA A;  4C3J B;  3I3C A;  5C5L A;  2BDO A;  4PV1 C;  2L55 A;  3NWS A;  4EGV A;  3MZ5 A;  3P7J A;  5EPJ A;  4IZ8 A;  1IHZ A;  2K01 A;  2KHS A;  4ZKB B;  5A2Q L;  3HZX A;  4CKE A;  4PMC A;  1O7Y A;  3U9O A;  3NXW A;  1SNO A;  1EOT A;  4ZUJ A;  3Q23 A;  3RZO B;  1HA5 A;  2OF1 A;  3S15 B;  2DN8 A;  1ZYR C;  2F0Q A;  4WFN 3;  5D65 A;  1SYD A;  1STA A;  2IX0 A;  4CJ1 B;  1V8Q A;  2F03 A;  3TP5 A;  2XRQ D;  2KA7 A;  5CV7 A;  3C46 A;  1YNN C;  3D4W A;  1BXT A;  1VMC A;  4P2C B;  3S14 B;  1QNU A;  2K04 A;  1H9S B;  2O2L D;  1KNE A;  1U4P A;  2FIN B;  1LV9 A;  5EGT A;  5KGU A;  5HGT A;  1PZK D;  1VCI A;  2E2D C;  4ID6 A;  1I4G A;  4U68 A;  4FO2 A;  3GTL B;  3TZU A;  4M1U B;  5M5W B;  2F0G A;  4KHV A;  2Q8I B;  4PNY A;  1JQY D;  1QE6 A;  5E4W C;  1Z47 A;  2IX3 A;  4AYB B;  3NQT A;  2F0J A;  4KY7 A;  5CV5 A;  2A6E D;  1X3Q A;  4WOR A;  1LO5 D;  2RSO A;  1I50 B;  5C0X J;  4OO1 H;  1KNA A;  3EA6 A;  1K8O A;  3SVM A;  5ELC A;  2EY2 A;  4CJ0 B;  5T1I A;  1PZJ D;  3S2D B;  3DWQ A;  3AB9 A;  2M2L A;  5IGF A;  1BBX C;  1A2U A;  1TWA B;  1HCZ A;  4L8J A;  1Y8O B;  3SK5 A;  4IFD I;  3D3R A;  3M7N A;  4KKU A;  5EPL A;  1VDZ A;  1JE4 A;  4X3S A;  1B50 A;  1X32 A;  2EYJ A;  2A6H C;  5ELE A;  1YNJ D;  5FLX L;  4J1M A;  5JEA J;  5TSS A;  3G6J B;  1SND A;  1VF7 A;  3AU7 A;  3WDN A;  1AZP A;  4FNF A;  5T1G A;  3BYY B;  3HS0 C;  2KJX A;  3K58 A;  3HOY B;  1WTV A;  2JA5 B;  2EZV A;  1AP0 A;  4XYQ A;  2KED A;  2NN6 I;  1BOS A;  1SSO A;  1I4R A;  1IKM A;  3SEB A;  1B44 D;  5C6A A;  4UAI A;  3N6R A;  4KN4 C;  1I6H B;  3FEW X;  1IW7 D;  3EFX D;  2RBM A;  4IFD J;  4G4K A;  1JOR A;  4G57 A;  4K6L A;  4RGO S;  2X6L A;  2K6A A;  5A35 A;  5IGC A;  4XT3 B;  1Z6H A;  1TQO A;  4ZYS A;  4MN3 A;  1QIL A;  3I90 A;  1KTK A;  2BOS A;  2R7Z B;  3T51 B;  3QWN A;  1EIH A;  2F0K A;  1A2T A;  3V96 A;  2VUM B;  2CVR A;  5IT9 E;  5J1Z A;  1DD2 A;  1G6Z A;  1HQR D;  1H9S A;  5JEA G;  1WD1 A;  1PTO F;  4HAE A;  3TME A;  2OXP A;  4WJW A;  1T5E A;  2NUC A;  5IGE A;  4RGM A;  4XXE A;  1W6J A;  3GV3 A;  5M5X B;  1RKN A;  4H7B A;  3BZD B;  4U67 3;  1Q12 A;  1KLU D;  3VA5 A;  5FO9 B;  4I7Z C;  4ILW A;  1SYE A;  4NMZ A;  1WVL A;  4FYD A;  4HR7 B;  1B3A A;  2N55 A;  3HRZ C;  2QKI C;  3SK4 A;  2KEE A;  2AUK A;  3J81 L;  5EPK A;  1JC7 A;  2IW3 A;  2MGS A;  1B2T A;  1LT4 D;  3J80 L;  2L5T A;  1WTP A;  2EDG A;  4IFD G;  4A93 B;  1RDP D;  4FP5 D;  2BDN A;  1GHK A;  2PW7 A;  1ET6 A;  2F0O A;  3BVG A;  3KBX A;  1RD9 D;  2QF7 A;  4CJ2 C;  1ENC A;  2NBF A;  2A69 D;  4V19 0;  1CHQ D;  1LTA D;  3A8J E;  2F0W A;  1LAB A;  3OHX C;  4M8A A;  1FNW A;  3KF8 A;  2KUM A;  3OMC A;  4IUU A;  4IUQ A;  3H3V C;  2AWO A;  5FK9 C;  4XQJ A;  2KVM A;  5C5M A;  1SNP A;  1GUN A;  4B08 A;  4KHZ A;  1BDO A;  1OXS C;  2NN6 G;  1RTN A;  2G9D A;  2L11 A;  4KKT A;  1E2W A;  1TS4 A;  1BR9 A;  1OXX K;  1CQV A;  4LJZ C;  1GJX A;  4FXK C;  3GTQ B;  2K5W A;  2PW5 A;  3HEJ A;  3ND9 A;  4ZKC B;  5LL6 X;  4G7O C;  2HUG A;  3K6O A;  3X3M A;  2L9H A;  1A6X A;  1EY7 A;  1HUN A;  4DA2 A;  3P75 A;  4R8N A;  1U4L A;  4KJN A;  2ZT9 C;  3BS1 A;  5CV9 A;  2YU9 B;  1W6K A;  4C3J G;  1EY0 A;  4HED A;  2O5J C;  4FF3 A;  3RD4 A;  4C1N I;  2JSO A;  4QMG A;  1JIC A;  5A2Q E;  4R8I A;  5C4H A;  1XXG A;  2B2Y C;  3A56 A;  1PYW D;  1A3V A;  3MHB A;  1SE2 A;  5JJZ A;  3S1M B;  3OW7 A;  4K5V A;  4MHE A;  3RLF A;  1I4Q A;  4BS9 A;  2F0F A;  3FDT A;  1EZ8 A;  3A54 A;  1U4R A;  1ZYR D;  1MI2 A;  4A3K B;  3D4R A;  3QOL A;  1HQM C;  3J7A F;  1HHV A;  2ID0 A;  4L6T B;  3D6W A;  1LTI D;  1ENF A;  1R4Q B;  4DNT B;  4K8J A;  1CHP D;  4RAU C;  1SYF A;  3PO2 B;  3SE0 A;  1PTO H;  1YNN D;  5EKI A;  4K8I A;  4G7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...