2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
4ME3A 1EYGA 4C3JH 4KLKA 1X6OA 3K7AH 2E2JH 2A19A 2HIXA 4JOIC 4JBKA 4A3BH 4GKJQ 4A76A 1I6HH 2WP8J 5LMNQ 2VQEQ 2ATWA 1YJWA 4AYBG 4DUYL 1HNWL 3F2DA 1V1QA 2Q2UA 2OWOA 2ZM6Q 1CSQA 4DV4Q 1A0IA 3J81i 2AKWB 3HOXG 1JJ2A 4BXXH 2K5NA 2LXJA 3RNUA 4LFAQ 3PIOA 1S40A 2XGTA 1SFOH 2B29A 1BKBA 1G291 4DV7Q 3E0EA 4NPSA 2UU9Q 1JE5A 4K0KQ 4PMWA 2MNAA 1X54A 3ICEA 2R7ZH 1K0RA 5C3EH 1WOCA 5IYCG 1K8GA 1YJ9A 4A3LH 1E7ZA 1GO3E 4HJ7A 2HQLA 4X62Q 4FDBA 4X64Q 1Q82C 1JMCA 1K83H 5ELNA 2F4VQ 4IO9A 2B63G 1HNZL 4LFBQ 5H1SE 1GKHA 2RCNA 4JI2L 1D8LA 1HZAA 1HNXL 1P8LA 2AWOA 3KJPA 1XJVA 4DR2L 3I4NH 3J7A5 1J6QA 2JA6H 2BA1A 4XIGS 3PO2H 3UDIA 4A3MG 4B3TL 1HZ9A 4P75A 1NMGA 4JYAL 1AE2A 3CCEA 4DAMA 1G6PA 4A3EH 4DV0L 4R1JA 3HOYH 4L5TA 1VQAA 3K7UC 3CCMA 5GAHC 3TREA 3CAMA 2R7DA 3OTOQ 3M7NA 2C35B 3I4MH 4J15A 1I50H 3CF5A 3RZOH 3ULJA 2JA7G 3CPFA 4JI8L 4HJ8A 3PF5A 2GVAA 3J7ZC 4DR1L 4LF4Q 3CCUA 2E5LQ 1CKMA 1VQDA 2EXDA 3KJOA 4BBSG 1B7YB 3E9HA 2UUBQ 4A3FG 2IY5B 3M4QA 4JI5L 4DR4Q 1VQCA 3G48A 1EOVA 3NELA 1EQQA 1K73C 1B8AA 2A8VA 1EWIA 1OXVA 4P73A 1EQRA 1PH6A 4AYBE 4BA1I 5FJ8G 3TS0A 2ZTCA 1S3OA 4IPGA 3PGZA 4AQYQ 2VUMH 4IJLA 3UDGA 3EBEA 3H3VH 4MZ9A 3U4ZA 1PH8A 2BH8A 1KXLA 5IT9c 4BA2I 4DK3C 3AQQA 1X56A 1K9MC 5GAEC 3WWVA 1CSPA 1PH1A 2IHFA 1XMOL 1FJGQ 3HOUG 3A5ZB 2D62A 5M3FG 3D0FA 1HR0L 3U50C 4A3DH 3HKSA 1FVIA 4A3KG 1J5EL 2ZJRA 4TVAB 1X3EA 4O2DA 4LF6L 4A93G 2UXBL 4LF9L 1IXRA 3PV0A 1X3GA 1AE3A 4GLAC 4QQBX 4GS3A 3L0OA 2KCMA 5IP9G 1EFWA 2UUAL 1RIPA 4P74A 2KENA 4RG1A 1A63A 3EN2A 4JI3L 1VQPA 4LNQA 3CC7A 2NVXH 5EAYA 1KRTA 2N8NA 4POFA 5GADC 2I5HA 4IPHA 4DPGA 3K81C 4UY8C 2R93G 5LMUQ 1Q12A 4DR7L 2F3IA 3K0XA 3AFQA 1SMXA 2PMZE 1Q81C 2UUCL 1CKNB 3CD6A 3AYHB 4C3IH 4HJ9A 1PHJA 1T9HA 2PNHA 4BY7H 2KHJA 2IX1A 2WFWA 2KHIA 4LF5L 4IFDG 1XPRA 4A75A 1G51A 1CKOA 2E8GA 2K50A 4HIDA 4HJ5A 2R92H 4YCWA 4APVA 1JB7A 3KDFA 2NVTH 1N36Q 1OXSC 1UE1A 1YHBA 2HHHL 1L2FA 4QGUA 3T1HL 2OCEA 1I94Q 3GTPH 2NN6G 3S17H 3MXNB 1PH7A 2K52A 2YTVA 4GKKQ 1VQIA 1O7IA 2CFMA 3CC2A 3PUYA 3I55A 4B3MQ 1CKNA 1U0LA 1VQGA 4DV3L 1XNQL 2NN6I 4NB3A 4KHZA 4XTCS 4NXML 5BR8L 4X65L 3A0JA 3W5OA 3HOVG 4L5QA 4POGA 1GD7A 2E2HH 1TWFH 3HFZB 5IWAQ 2LSSA 3CCQA 1XNRQ 1WI5A 4JI1L 3AEVA 2DGYA 3S1NH 2YTXA 4A3EG 1VQMA 4DV6L 2Z6KC 3L7ZC 3ZJYC 1L0WA 2OQKA 4GNXC 5GQOA 4A3IH 1KRSA 2PQAB 2YTYA 2E2IH 5HGQA 4JI4Q 1A62A 1KL9A 4OX9L 3D31A 1Q46A 1WFQA 3PF4A 4DUZQ 4JV5L 1NE3A 5FLMH 3GTQH 5IYDG 1SN8A 1VQ7A 4IFDJ 4JI6L 2JA8H 2MO0A 1IBKQ 2D0OA 2JE6I 3HOWG 1PVOA 3KYHC 3UE1A 5M5WH 5M5YH 1MKHA 3FP9A 4DR5L 2K4KA 4DV2Q 1N33Q 1LYLA 5HY6A 4QIWE 4GKJL 1YIJA 1JT8A 3EIVA 1YVCA 1HZCA 4DV1Q 1Y1WH 4A4IA 3H0GH 4YWMA 2VW9A 2VQEL 2K5HA 4DR3Q 3ULPA 4LFCQ 3CMAA 1E3PA 1VQEA 2PI2A 3L2PA 2VUMG 2ZM6L 4P71A 3ULLA 3KOJA 2PQAA 1HR0W 3HOZG 4IOCA 3S1QH 1WJJA 2MQHA 1HNZQ 1I5FA 3F8TA 2JQOA 3LGJA 4BY1G 4JI2Q 2ZJPA 3J81j 4DV7L 1IBML 4OXPA 4JBMA 3GTMH 2UXDL 1HH2P 4RMFA 4LF8L 2OTLA 4GOPC 4DR2Q 1NMFA 3STBC 3H3VI 4A3GG 5IP7H 3STBD 4C2MH 4B3TQ 2Y0SG 2ALYB 3FKIG 3KLWA 2HIVA 4DV5L 1NTGA 4HJAA 2VQFL 1VQNA 4IPDA 1NJIC 1HZBA 1Q8KA 2XTIA 4DV0Q 4O0AA 4B3RQ 4GN5A 3S14H 1QVGA 1TWAH 2RHSB 3RN2A 1YHQA 1N34L 1M1KC 3S2HH 1GVPA 2WB1G 4OWWB 2DUDA 1YEZA 4A3JG 1EIYB 4L5RC 3PIPA 4GLVB 1BBUA 3TS2A 5C4XG 1FGUA 4JI8Q 1KIXA 1L1OB 1IYJB 1BBWA 4GN3B 4JG2A 3S24A 1PV4A 1OXUA 4YY3Q 3JC66 3CCSA 1QZHA 1C0AA 1KC8C 4PZ8A 3W1GA 1PA6A 1Z9FA 3KF8B 2YYZA 1DGSA 4BBRH 5IYBH 4AH6A 3CCJA 3OTOL 4JI5Q 1Y1VH 1XPUA 2IT1A 2EIFA 1MJCA 5C44H 4UP8A 1XMQL 1IBLL 4B3SQ 1W2BA 1ASYA 1W3SA 4C3HH 4LWCA 1Y14B 4GN4B 2E5LL 4YWLA 3S15H 1N9WA 4PG3A 1LUZA 1N32Q 4HIOA 2HT1A 5C0XG 4A3CG 4IPCA 1XMOQ 2I0QA 4LF7L 1KD1C 2GN5A 3M9BA 1L1OA 3Q8DA 5M3MH 5JJKA 2VY3A 2A1AA 2Z0SA 3T1YL 2JA5G 1WCMG 5IYCH 4UP7A 1K3RA 2ZTDA 5FLXc 4AQYL 1VQ9A 4JI0Q 2V1CC 2BA0A 1UEBA 3KDFB 4MTNA 5C0XI 4LF9Q 2KCTA 2JEAI 3U4VA 2UXBQ 1SE8A 3UDFA 4X66L 2B63H 3CCVA 4JI3Q 1SR3A 1FJGL 1IL2A 2JEBI 4A3BG 3G6EA 3OW2A 2WAQG 4A3MH 1AH9A 4JI7L 2Y0SE 4DR7Q 4NXNL 3F2BA 5ELOA 2UXCQ 2NVYH 2MFIA 3I56A 2ES2A 3PUWA 1LM0A 4BXXG 1PH2A 5GROA 3J80c 3DLLA 2K75A 3I7FA 1VQFA 4EQ5A 2R7ZG 2RHQB 3TEHB 5C3EG 2WB1E 2JA7H 4KHPQ 1Y1WG 4HIKA 4A3LG 1H95A 2VNUD 5C0XJ 2NVQH 3PUZA 4GNXA 4JOIA 5JEAJ 3DM3A 3CCLA 2CWAA 1VQKA 3E9IA 4BBSH 1YJNA 3CQZH 4PZ6A 3I4NG 2JA6G 1V43A 3PO2G 2AWNA 1XNQQ 5AJ3Q 4GOPB 4QJFA 5FJ8H 4QL5A 5BR8Q 4YHHL 1TWGH 1X55A 3RLOA 4X65Q 5C4JH 4LUVA 3S1MH 3TRZA 3UDXA 1TXYA 3CMEA 3U58A 3RZDH 1E22A 1VQHA 3HOYG 3BZKA 4GKKL 4DR6L 4R4TA 1NY4A 3B6YA 3GO5A 4DV6Q 2YU9H 4B3ML 5M3FH 3I4MG 2OQ0A 3F1ZA 3GTOH 1VQLA 3IRBA 2CWPA 3NENA 4OX9Q 1VS0A 4DUYQ 4A3KH 1HNWQ 1RL2A 5E7NA 1A8VA 1P16A 2I5MX 4A93H 3PO3H 4LUZA 1MIUA 2VL6A 1QZGA 3GDEA 4P72A 5JJLA 3J80i 3BJUA 5IWAL 4JI6Q 1XNRL 2VZAA 5K36G 4GOPA 4LUOA 2D0PA 1Z47A 2KBNA 3PUVA 4DR5Q 3M4OH 2IHEA 1EIFA 1D7QA 2Q2HA 2QA4A 1U5KA 1UE5A 4OONA 4YWKA 5LMNL 4Y52H 2WAQE 2EQSA 2YV5A 1M90C 4JI4L 2BH2A 4DAYB 1Y1VG 1PH9A 1V9PA 2FXQA 2R93H 4DUZL 5C44G 4DV4L 1E1TA 4JC0A 4H02A 1IBKL 3SGIA 4LFAL 2N49A 1C9OA 2UU9L 1HNXQ 1PH3A 4K0KL 4DV2L 2I5LX 2N78A 5DLQE 1PH4A 1IBMQ 1N33L 1Q1BA 3CP0A 4A3DG 1E24A 2UXDQ 4DV1L 4LF8Q 2L15A 4LFCL 5M3MG 3I4OA 3G4SA 4DR3L 4OO1G 4JYAQ 5GAGC 4X62L 1YNXA 4X64L 2CQOA 3H15A 2VS1A 1S72A 1CUKA 2F4VL 3HKZG 4LFBL 2NZHA 4DV5Q 1YI2A 2VQFQ 2K14A 5IY0A 4OO1I 1UE7A 1QVCA 1VQJA 2LXKA 1KAWA 1OTCA 1N34Q 3ERSX 3ER0A 4JBWA 3PCOB 3M85A 2F52A 2JK8A 4DR1Q 1KHIA 4GLXA 4KI0A 3M3YH 2R6GA 3MEFA 3GTLH 3HOVH 4WJ4A 2K5VA 3GD7A 4BY7G 4PZ7A 3W1BA 2QEXA 3KFUA 1X9NA 1WYDA 4YCUA 3RLNA 4B3RL 1NBWA 2JJQA 2R92G 4QY7A 1ASZA 3M4PA 1PFSA 1KQSA 1XPOA 1GM5A 4LF4L 1XMQQ 1IBLQ 3GTKH 3UE0A 5JJIA 4IJHA 1I3QH 5IYDH 2Q2IA 3HOXH 2ZTEA 2UUBL 3HOWH 4YY3L 4R4QA 4OWTB 4DR4L 5JEAG 3CXCA 1HR0Q 3AFPA 4AIMA 3TQYA 2CKZB 4LF7Q 1PYBA 1N8RC 1SLJA 1J5EQ 4DNIA 4LF6Q 4B3SL 3GTGH 4R4IA 3T1YQ 2QGQA 1BVSA 2GVBA 4R4OA 2IX0A 4IOAA 4YCVA 3F2CA 2UUAQ 4TQUS 1XTDA 3RN5A 3HOZH 1X3FA 4GNXB 1N32L 1SRUA 4X66Q 1TWCH 2PI2E 4BY1H 4DK6C 1OXTA 2R7FA 4A3IG 1PH5A 1VQ8A 2CCZA 4A3GH 1YBYA 2ID0A 3RR5A 3BU2A 4Y7NH 5FLMG 2UUCQ 4JI0L 4JI7Q 4NXNQ 3FKIH 3GTJH 2ZJQA 1VQBA 2OTJA 3JAMc 3A5UA 2JA8G 3KF6B 1QVFA 3HKZE 3PO3G 3VDYA 4JCVE 3PSIA 2B3GA 5LMNW 3CPWA 1YZ6A 1MJEA 4LF5Q 1IZ6A 1PYSB 1VCIA 2MO1A 3CW2C 1Q1EA 1YHAA 5LMUL 3I2ZA 4HIMA 3H0GG 1VQ6A 2H5XA 5M5XH 2HHHQ 3S16H 4L5SA 2Z6KA 4A3JH 3T1HQ 5C4XH 2UXCL 3FHWA 2N3SA 1HJPA 1YITA 4WJ3M 1B70B 1L1OC 4JBJA 1QUQB 4R4CA 4A3FH 2Q2TA 4X6AH 3NBHB 3NEMA 3OYYA 4LW1A 3J81c 3S1RH 5IE8A 1UWVA 3PUXA 4DV3Q 3G71A 1JJCB 1Q86C 1EUJA 4ALPA 3KF6A 1VQ4A 1N36L 4NXMQ 5IP7G 4KHPL 2AMCB 4UP9A 4DKAC 1I94L 1Q7YC 1C7YA 4YHHQ 1FL0A 5J3BA 4JI1Q 4MNOA 1TWHH 2AHOB 4IFDI 2JA9A 2NZOA 3HOUH 1OXXK 2ASBA 1LTLA 3S2DH 4A3CH 4DR6Q 3K8AA 3CC4A 1VQ5A 1QUQA 4OWXB 4EX5A 5AJ3L 4JV5Q 3JAMi 1WCMH 3RLFA 2JA5H 3K80C 3CCRA 1R9TH 1VQOA 5IP9H 3BZCA 1K8AC 1X65A 1E1OA 1UE6A 4UPAA 3A74A 1JJGA 1SROA 2RF4A 5IYBG 4BBRG
chains in the Genus database with same CATH superfamily
4GZYC 2E2JH 4GKJQ 4JOIC 2JN4A 4A3DB 1KABA 4K5XA 5LMNQ 2X6GA 3ERQA 3H09A 1YJWA 1HNWL 2G9HD 2O5JC 2NWGA 2RCFA 3SK4A 3VYRA 4FXDA 2LXJA 4V0BA 2B29A 3AMUA 4DV7Q 1JE5A 4PMWA 1X54A 4BS9A 3VA7A 3ICEA 2K33A 1WOCA 4X3SA 1CM9A 5IYCG 1K8GA 1YJ9A 2B2TC 1B53A 4OHJA 3X3NA 1PRTF 4X64Q 1Q82C 3IAYA 3W2DA 2LY7A 2B63G 3EJIA 4QCLA 4P2CB 3IFDA 3KJPA 1J6QA 2BA1A 3UDIA 4NMZA 2NVTB 1K8OA 1NMGA 1AFPA 3CCEA 3VYTA 2KCCA 3S17B 1STAA 4A3EH 2Z1CA 1VQAA 1TQOA 2F0IA 1YNJD 3TREA 3N52A 3VYSA 3OTOQ 1I50H 2IJ0A 3HS0C 2JA7G 1R9TB 3NP8A 2GVAA 4LF4Q 2E5LQ 2EXDA 3E9HA 1JWUD 1X32A 1VQCA 3G48A 1EOVA 3NELA 4J1MA 1B1ZA 1EQQA 2A8VA 1PRTB 3DEOA 4IPGA 1S3OA 3PGZA 4AQYQ 2VUMH 2E76C 5I2XA 3AU7A 1K9MC 1BCPF 1W6JA 2D62A 1ZYRD 4ILWA 1NSNS 2Q8IB 4O2DA 3JAME 4LF6L 1EWCA 4LF9L 1K83B 4GS3A 3L0OA 1PFMA 3EVQA 4MN3A 1HXYD 3EN2A 1VQPA 3LX0A 3DUZA 4PMCA 3GTMB 3QR8A 4DPGA 2Z4IA 2R93G 4ZQ3A 1Q12A 4DR7L 3K0XA 4WFN3 1SMXA 2UUCL 4RKLA 2F0VA 4C3IH 1H9JA 4X3KA 4ULLA 2PCFB 4F8MA 2IX1A 2E75C 3OMCA 2KHIA 1XPRA 4A75A 1CQFA 4B9WA 1CKOA 3S2HB 3MTSA 3VR5A 2HHHL 1ESFA 1BCPB 1I4PA 3TSSA 2SOBA 3TMEA 1EY0A 2EYHA 4UDUC 4EVOA 3MXNB 1RTOA 1V1OA 3L9AX 4GKKQ 2B8FA 2R61A 3PUYA 3FDTA 4JK1C 4NXML 1U9RA 3A0JA 4FP5D 1GD7A 3HFZB 5EKIA 2LSSA 1XNRQ 3S1NH 4XXEA 1VQMA 1U4MA 2Z6KC 3L7ZC 2F0FA 4OX9L 3IL8A 2RSNA 5IGEA 3D31A 3R2TA 4DUZQ 4JV5L 1NE3A 3A8IE 1H9RA 2K4KA 5A35A 1LYLA 4MTKA 3E5SA 3K59A 1YIJA 1Y1WH 2QEJC 3H0GH 4YWMA 1LTRD 3TP5A 2K5HA 3QIAA 3CMAA 3OOCA 1VQEA 2PI2A 3BVGA 3HOZG 3Q0AA 1IBML 1JWSD 2JQOA 4N8X1 3VYUA 1VMCA 3J81j 4OXPA 1BF4A 1HH2P 4RMFA 4LF8L 4V190 3STBC 1R4QB 4C2MH 5JPNC 3BVZA 1JOKA 2HIVA 3SK6A 4EGVA 4DV5L 1YNJC 1WD1A 1EWHA 2F0GA 1HZBA 1Q8KA 2F0EA 5KGUA 3MWYW 4B3RQ 1TWAH 2EYPA 3QO2A 3DWQA 3T51B 1GVPA 2DUDA 5FO9B 5A2QL 4GLVB 3TS2A 2KA7A 1KIXA 1IYJB 3RZDB 2PYKA 2EYJA 2WV6D 1DGSA 4A3IB 3CCJA 1B44D 1SMYC 1WTHA 1XPUA 1A3VA 2EIFA 1UEAB 2KEEA 5C44H 4UP8A 4A3KB 3C3LA 3PO3B 4C3HH 2B2VA 3S15H 4PG3A 2RDFA 1N32Q 1CT1D 5C0XG 4EQPA 4A3CG 3Q8DA 1RD9D 2VY3A 1WCMG 1K3RA 5FLXc 3W3AA 3J7YW 4ODGA 4LF9Q 4Q0FA 3PIP3 3CCVA 1DJRD 1FJGL 1IL2A 4C3JG 2JEBI 4A3BG 3Q6SA 2G5DA 4A3MH 1AH9A 4ID6A 4DR7Q 3F2BA 2B2YA 3J81E 3PUWA 4BXXG 5D3DA 4DXGA 5E4XA 3DLLA 1TKWB 2K75A 1LTTD 2TSSA 4RWSC 3TEHB 4RGOS 1LTGD 2K04A 2OEOA 2Z6BA 1GOZA 2BDOA 3A7AB 1H95A 3M3YB 2VNUD 3PUZA 4GNXA 2FMMA 3PMFA 1VQKA 3QB3A 4BBRB 5E3FA 4PZ6A 2GA4B 2JA6G 1V43A 3PO2G 1EYAA 4OEMB 1EY7A 5LL6S 2H4OA 5FJ8H 3Q22A 4YHHL 3NTHA 1AZPA 4HSVA 5C4JH 4LUVA 2BCOA 3UDXA 1TXYA 2KECA 3MXGA 1VQHA 3HOYG 2HCIA 3B6YA 4KD3A 3BDOA 3F1ZA 3ND9A 5EKKA 1VQLA 5F2DA 4OX9Q 1VS0A 1NCVA 4DUYQ 1RL2A 4A93H 2CVRA 1EQVA 1GUTA 5IWAL 5TSSA 2VZAA 2K5DA 5K36G 3H94A 1TWCB 1EIFA 4BY1B 2HDMA 1EYDA 4A3GB 4DAYB 1Y1VG 2XNAC 1V9PA 2XVSA 3FKIB 3GTJB 1KDCA 4DF7A 3C46A 2A6HC 2P5ZX 4QB4A 2UU9L 1HNXQ 1PH3A 4DV2L 5DLQE 4IFDH 1PH4A 1N33L 1IBMQ 1BQQT 4A3DG 1GJXA 4HMIA 3VR2A 4H44C 4LF8Q 2L15A 3I4OA 4JYAQ 5GAGC 1S72A 1CUKA 2K5WA 4HSPA 2NZHA 4DV5Q 1YI2A 2DJFC 1ET6A 1RJTA 4OO1I 1UE7A 1SYGA 1H9SA 1VQJA 1KAWA 1OTCA 1QNUA 3ERSX 4RAUC 3PCOB 1HA5A 1WTWA 1JOOA 1PTOD 4DR1Q 4WJ4A 4KI0A 3HOVH 3GD7A 4PZ7A 4KN7C 1X9NA 1WYDA 3S2DB 1ET9A 2JJQA 4HN7A 4IURA 3DXJC 4WJWA 3M4PA 1PFSA 2K5QA 1WTOA 5CBAE 1XPOA 2F0WA 2IPKD 5IYDH 1OO9B 1F2YA 4OWTB 5JEAG 4WRDA 3CXCA 1HR0Q 5G3LD 4DNIA 4JVZA 4I7ZC 1PZJD 2IX0A 3OSOA 3F2CA 5HGTA 4TQUS 5C5LA 4GNXB 1SRUA 5EGTA 1LLRD 1LT3D 1WTPA 3BU2A 4KY5A 4JI0L 2ZJQA 1CZWA 1FGBD 1RKNA 3HKZE 1KAAA 1QVFA 2F0NA 3PSIA 1MJEA 4LF5Q 1IZ6A 1VCIA 3CW2C 5LMUL 1VQ6A 3T1HQ 2N55A 2RVLA 1L1OC 3A7LA 4X6AH 3I70A 3OYYA 3J81c 4NP5A 1UWVA 3G7LA 5CV9A 3RZOB 4XQJA 1ML0D 1O78A 1I3QB 2L55A 2MJ8A 2AMCB 1J8IA 1Q7YC 4YHHQ 1FL0A 4K6LA 1TY0A 5J3BA 1DOLA 4MNOA 1JR0D 2QKIC 4IFDI 2JA9A 4G4KA 2AQ3B 1OXXK 2ASBA 1JQYD 1TT2A 2SNMA 3NBIA 4OWXB 4EX5A 3RLFA 1SAPA 5EPKA 1TS2A 1EYCA 1R9TH 3UI2A 3HOZB 1UE6A 1QE6A 3A74A 4RCOA 1I5FA 4ME3A 3K7AH 3SDZA 4A76A 1I6HH 2WP8J 3KLSA 5FO8B 2VQEQ 1H9SB 2F0PA 1II3A 2OWOA 2D2CC 2ZM6Q 3HOXG 1JJ2A 2R3ZA 3PIOA 1S40A 1SFOH 1G291 2UU9Q 2CW0C 1CHQD 1WTVA 1NNXA 5HURA 1K83H 4IO9A 1HNZL 5H1SE 1GUWA 2RCNA 1RTNA 2AWOA 2RBMA 3I4NH 1AE2A 4DAMA 3GTPB 4R1JA 3T53B 3CRKC 4QUFA 5GAHC 3BG3A 3M7NA 3MFYA 3Q23A 3CF5A 1AZQA 3CPFA 1J9OA 1CA5A 1GUOA 3WOFA 2EOTA 4JI8L 4HJ8A 1LT5D 4C1NI 2XSCA 1VQDA 5A2QE 4A3FG 3M4QA 4A3BB 4G7ZC 1SE2A 4CJ2C 2E2IB 1FNUA 4FXKC 2VB3X 2ZTCA 4EQOA 4MZ9A 5COYA 2JA8B 4BA2I 3AQQA 5M5WB 5M5YB 2IHFA 1XMOL 2MUYA 3A5ZB 1O7ZA 3U50C 4C1NK 3HKSA 5IGGA 4LMQD 3C1FA 4A3KG 2ZJRA 4TVAB 1J5EL 1WTQA 1H9MA 1QILA 3PV0A 1X3GA 1AE3A 3MAQA 4QQBX 2KCMA 3HGBA 5IP9G 3P7JA 1EFWA 3NTKA 1PTOF 3NTIA 3S9WA 2IX3A 2EPBA 2J7ZA 1KRTA 2N8NA 2D9UA 2JA6B 3PO2B 1HQMC 2FMCA 5CORA 5LMUQ 4HCEA 1K28A 4ZYSA 4RCNA 2PMZE 1FD7D 1SYCA 3AYHB 2O4XA 2EVBA 4KKUA 3TP8A 3HOYB 1PHJA 3DHQA 4BY7H 2KHJA 2WFWA 1A3UA 4ZK9B 3FPPA 2E8GA 4HJ5A 2R92H 4DAVA 2B39A 4YCWA 4APVA 1OXSC 4DK0A 1YHBA 1MD2D 4QGUA 1Q90A 5ELFA 5G3LF 4DAPA 1D2BA 3I55A 4B3MQ 3U9OA 1VQGA 1XNQL 1Y1VB 2NN6I 4NB3A 4KHZA 1PTOB 1CZGA 2XRQD 3BVMA 1D5MC 1Z6HA 2E2HH 1TWFH 3CCQA 2DNEA 4A3EG 5IGFA 5GQOA 2B2TA 3R3OA 4A3IH 2YTYA 3LNNA 3WOEA 3MXNA 4CHTB 1I4QA 5FLMH 1MI2A 3GTQH 1SN8A 1HHVA 2NUCA 1PYWD 1S4ZA 2RSOA 4JI6L 1IBKQ 2NVXB 3FMCA 3F2UA 1ICFB 4DR5L 1SNOA 1AW7A 5HY6A 3EIVA 4DV1Q 1HZCA 4A4IA 5IYBG 2VW9A 4LFCQ 3ULPA 1SE4A 3OHXC 2NVYB 1E3PA 2PMZB 2VUMG 4F88A 3ULLA 1U4RA 4DN4M 3S1QH 1DD2A 2MQHA 1HNZQ 4BY1G 2ZJPA 1B2TA 2SNSA 4A3GG 3WDNA 3DEPA 3K6OA 2I07B 3STBD 3M7GA 2ALYB 3FKIG 2K7VA 2NVQB 5EBDA 4I65A 2XTIA 1IW7D 3CQZB 2RHSB 3PIO3 4RGTA 2TMPA 1LT6D 5LL6X 3N6RA 4OWWB 4IQZA 3PIPA 1TWGB 4JI8Q 3X3MA 3S1MB 4JG2A 4GN3B 3S24A 4YY3Q 4IUTA 1ILPA 5IYBH 3KF8B 2YYZA 4BBRH 3OPOA 5D14A 5M3FB 3H91A 1V8QA 1SMYD 3D3RA 5IOCA 1XMQL 1IBLL 4B3SQ 1W2BA 4MIUA 4CDCC 1W3SA 5IT9E 1PMRA 1Y14B 4LWCA 2L1BA 1I4RA 3M4YA 4YWLA 1N9WA 1M4VA 4FYDA 4KN4C 3IKJA 3A8JE 1XMOQ 4J6HA 1E2ZA 3K5MA 2QDBA 5M3MH 5JJKA 3C1EA 3MZ5A 3URYA 3BS1A 3K5OA 5IYCH 1VQ9A 2ZTDA 1D5XC 5CGKA 2BA0A 4FO2A 2F0MA 2KCTA 1VDZA 3UDFA 1LTBD 4TKOB 2B63H 5CMDA 1FNVA 4QF4A 5J1ZA 2A69D 2Y0SE 2KEDA 2UXCQ 3A55A 1RDPD 3I56A 1O7LA 1PH2A 1SEBD 1DONA 1PXUA 3J80c 1DM0B 4K5WA 5CC4A 3I7FA 4ZKCB 4FF4A 1VQFA 4FNFA 2IL8A 2R7ZG 1GHKA 4XQNA 3HRZC 3RD4A 2WB1E 3SVMA 5C3EG 2JA7H 1E2VA 1Y1WG 3CHBD 3MC0B 5K5PA 3R8BA 4A3LG 4CJ1B 4MHEA 3I91A 3CCLA 3E9IA 1EOTA 3RUZA 1STBA 2KQ3A 1SBBB 1JB3A 1LTSD 1XNQQ 4E6IA 2B8GA 3HOXB 3CMEA 3HOWB 5EBCA 5DM73 4R4TA 2AUKA 3I4MG 2OQ0A 3KK7A 3GTOH 2CWPA 3NENA 2Z9HA 1HNWQ 3NPPA 2OF1A 1DCZA 4R8NA 2EYMA 5JJLA 3BYYB 4JI6Q 3E6ZX 1Z47A 4DR5Q 2IHEA 5I2YA 1D7QA 2Q2HA 1U5KA 4OL7A 4Y52H 2WAQE 2YV5A 2R93H 4JI4L 2B2WC 1PH9A 2NTTA 2FXQA 5C44G 2Y0SB 1V1PB 4XQQA 3K58A 4DU9A 4LFAL 3NQIA 2A6HD 2I5LX 2N78A 2EY5A 3NQTA 4OO1G 4XT3B 2F3VA 4DR3L 3S16B 1HUMA 2RDHA 4X62L 5C4XB 1VF5C 1IW7C 2EXZA 2F4VL 2PZUA 4A3FB 3HKZG 2N88A 4LFBL 2EJFC 2K14A 4DAYA 4H0LC 5ELEA 2FJ2A 3ER0A 5CV5A 1KHIA 5FK9C 2M2LA 4GLXA 4BWGB 1IYUA 2K5VA 1TWHB 3D6WA 4CKEA 1XYIA 2YU9B 4YCUA 1NBWA 1CTMA 3OWEB 4R9WA 1GM5A 4ME5A 1XMQQ 2QDLA 5LHY1 3UE0A 1IBLQ 3GTKH 1I3QH 3ONAB 2ZTEA 4DR4L 3IFTA 4N9PA 1W6KA 4RHSA 1QB5D 2E2JB 4AIMA 1PYBA 1N8RC 2WAQB 4LF6Q 4ZLTF 1BVSA 2VB2X 4R4OA 4YCVA 2K1BA 3NWSA 3RN5A 3HOZH 2A69C 1X3FA 2PO4A 3OMGA 2KCNA 1SNDA 1EFID 2PI2E 1OXTA 1ZKOA 5DNFA 1YBYA 4LJZC 3RR5A 3MEHA 2UUCQ 3CRLC 3HG9A 3JAMc 2JA8G 3KF6B 3GP7A 3PQIA 3CPWA 1YZ6A 2HDLA 2MO1A 4B9XA 1YHAA 2B2VC 1WTXA 4RGNA 1BBXC 2HHHQ 4DXFA 1XXGA 1G2SA 1B70B 4A3EB 1QUQB 1JC7A 3NEMA 3H6MA 3PUXA 1G91A 3G71A 1Q86C 4ABNA 5BN4A 1VQ4A 1CI3M 4ZRZA 5IP7G 4NXMQ 4KHPL 1I94L 3P20A 1RF2D 2AHOB 3HOUH 2NZOA 2NZ1D 1HUNA 4CDFC 4L8JA 1LTLA 2NB0A 4A3CH 3OIQA 4PNYA 3NK9A 2B2YC 2LMCB 5AJ3L 3VR3A 4JV5Q 1WCMH 2VUMB 3K80C 2ZT9C 3SR1A 1VQOA 3BZCA 5FO7B 5C4HA 3A56A 5C3XA 2G9DA 2RF4A 3D6CA 3M4OH 4C3JH 4KLKA 5JJZA 3K5LA 1EZ6A 2HIXA 4CKBA 5M9OA 4A3BH 4Y7NB 2XIWA 3F2DA 1NR4A 1V1QA 2F0SA 5I4DA 1IKLA 3TZUA 1GUGA 1CSQA 2A68C 1A0IA 4BXXH 2K32A 2K5NA 4LFAQ 1JCKB 1EEID 3E0EA 4NPSA 1HA6A 2MNAA 5CV8A 1K0RA 2CW0D 5DM63 1TVXA 1E7ZA 4HJ7A 2HQLA 4X62Q 4KV6A 4RFBA 5ELNA 2F4VQ 5JVH3 4LFBQ 4JI2L 1GKHA 2B2UA 1P8LA 1XJVA 2F0JA 4DR2L 1TS5A 4FF3A 2JA6H 3PO2H 1FNWA 1UAPA 1B3AA 1G6PA 4DV0L 3V96A 4IZ8A 3HOYH 4L5TA 3CCMA 1F9SA 2C35B 4K2LA 4C56C 2F03A 5IIFA 4DNTB 4KMUC 3J7ZC 4IUPA 1DOMA 3KJOA 4BBSG 1B7YB 1PLFA 2ICIA 3MHBA 4KKSA 5FLXL 2C5CA 2PPBC 5K36H 4JI5L 4DR4Q 1K73C 1EWIA 1OXVA 4P73A 1PH6A 2WKDA 4HTHA 4AYBE 4BA1I 3TS0A 1SNPA 1LABA 3I72A 1JE4A 4H7BA 4FVMA 4QMGA 3UDGA 5IODA 3H3VH 2WINB 5JVG3 3G6JB 4DK3C 1X56A 5GAEC 1CSPA 1PH1A 2FHTA 1FJGQ 2DY8A 1HRJA 1EEFD 1QCBD 5M3FG 2R7ZB 5C3EB 2F0UA 2A5HA 2F0KA 4A3DH 1EY5A 1Y1WB 2ICEC 1IXRA 2CH4A 1A3TA 1A63A 2UUAL 2KENA 4JI3L 4LNQA 3CC7A 5I6WA 4B08A 1MBYA 5EAYA 2MHVA 2NVXH 2K01A 3T4AC 5BN5A 2I46A 3EROA 5GADC 2I5HA 4KY7A 3ZYYX 3K81C 4UY8C 1B3QA 1C8CA 1BDOA 4C2MB 1Q81C 1CKNB 3CD6A 1F2LA 5CV7A 2PNHA 2QCPX 2RKSA 1Y8OB 3I4MB 3KLRA 1TWAB 1SYEA 1G51A 2K50A 4HIDA 4KHVA 1JB7A 2NVTH 2EZVA 1F2ZA 2MP1A 4IN3A 1KNEA 1I94Q 2NN6G 3S17H 2XWBB 2K52A 2YTVA 3HEJA 4L63B 1VQIA 5T1IA 5JEAH 4L6TB 4XT1B 4DV3L 3LWUA 2AUJD 4XTCS 3SEBA 5C44B 2IWHA 5BR8L 1PRTD 4C3HB 4L5QA 4POGA 5IWAQ 1WI5A 4JI1L 2Q8TA 3AEVA 3ZJYC 1L0WA 1KDBA 5ELDA 1ZEQX 1KRSA 2D5DA 2PQAB 2F0QA 3TZDA 5KRUA 1KL9A 1L0YB 4G57A 4IUVA 2A6ED 1I6VC 2J4XA 1VQ7A 1C4QA 4IFDJ 3HKZB 2F0DA 2MO0A 1LT4D 5JPMC 3HOWG 2JE6I 1IYVA 2F3WA 3UE1A 3SE0A 1EU4A 1MKHA 3L3OC 1D6EC 5C5MA 4DV2Q 1N33Q 4QIWE 4GKJL 1G2TA 1BNZA 1JT8A 1K3BC 1YVCA 4X3UA 3I8ZA 4A3MB 4DGZA 2FINB 3L2PA 2RA4A 5IGCA 4P71A 3KOJA 3VR4A 1EL0A 2X6LA 4IOCA 2SEBD 1WJJA 3LGJA 4JI2Q 1GUSA 4JBMA 4DV7L 3GTMH 2PW7A 5C4ZA 2UXDL 4GOPC 4DR2Q 3H3VI 4KJOA 1HCZA 2Y0SG 4FXGC 3KLWA 2E2DC 3BDLA 2BE5D 1NTGA 4HJAA 1R4PB 3TP7A 4IPDA 1NJIC 4DV0Q 3NWTA 4O0AA 1YHQA 3SXHA 1N34L 4O42A 3OIPA 1M1KC 1VF7A 3S2HH 1JWMD 3P1HA 2WB1G 4A3JG 5ELBA 5C4XG 1BBUA 3K0YA 1FGUA 2EY6A 5C4JB 1L1OB 1BBWA 1STGA 1PV4A 3SK8A 4F7XA 1C0AA 3W1GA 1B4OA 4HEDA 3A8KE 4AH6A 1UNSA 3V05A 3OTOL 4JI5Q 1MJCA 2PW5A 3I3CA 2Q8RE 4A93B 1ASYA 1WVLA 4GN4B 1EY6A 2E5LL 1B50A 4CJ0B 1AN8A 3K57A 4HIOA 5L37A 4LF7L 1KD1C 3M9BA 1PDQA 2Z0SA 3T1YL 2JA5G 4JI0Q 3A54A 4AQYL 2V1CC 1MHWC 3KF8A 1UEBA 4ZCKA 2F4IA 2JEAI 1SE8A 4RA8A 1GXDC 1TR5A 4X66L 4IUUA 1HFNA 4JI3Q 1SR3A 1ENCA 3G6EA 3OW2A 2WAQG 5E4WC 4JI7L 4DNRB 3J81L 3BYTB 1LTAD 3TP6A 5D3IB 5KNBA 1K8MA 1LM0A 2AQ2B 3S14B 4RHRA 4EQ5A 1EIGA 3OW7A 2RHQB 2DN8A 1IL8A 4CBVA 1VMPA 2EDGA 4JOIA 5JEAJ 3DM3A 2CWAA 1SYDA 1YJNA 2H1EA 4FF1A 1PRTC 1Y69U 4GOPB 2XN9C 2EY1A 1QOHA 2HUGA 4QJFA 5KEEA 1BO0A 4X3TA 5BR8Q 5BN3A 3RLOA 3D8GA 3TRZA 1MSHA 3U58A 3RZDH 4GKKL 4DR6L 4PQXA 1NY4A 1XWEA 3GO5A 2YU9H 2EE1A 4M1UB 2A6EC 4Z9CB 5NUCA 5KNCA 4A3KH 5E7NA 2I5MX 3PO3H 1QZGA 3GDEA 3BJUA 4DA2A 1XNRL 2F0HA 5CBEE 4IALA 4LUOA 2D0PA 3PUVA 2KBNA 4J8QA 5CV4A 4S3SA 4YWKA 2BH2A 2EQSA 2MPMA 4DUZL 4DV4L 1E1TA 1O80A 4LK1C 4H02A 1SSOA 3C2PA 2N49A 1C9OA 2F0OA 4K0KL 5EKLA 2HQEA 3CP0A 1E24A 2UXDQ 1T5XD 5M3MG 3G4SA 2BE5C 3O13A 3SHLA 1YNXA 1BCPC 2CQOA 2JSOA 2VS1A 4BBSB 2K6AA 5FOBB 5IY0A 1QVCA 1V1PA 1N34Q 1KNAA 3M85A 1UUPA 2JK8A 3M3YH 1TS3A 2R6GA 4C3IG 5ELCA 1ICWA 2ZXPA 3KFUA 4KY6A 4B3RL 5KNDA 1RODA 4N9TA 4QY7A 1ASZA 1KQSA 2RDGA 5JJIA 1STHA 2Q2IA 2UUBL 4IUQA 5EQ0A 4R4QA 3MXUA 1K0SA 2CHBD 3K5NA 3AFPA 3K7AB 2QF7A 4LF7Q 5IGBA 1I6HB 5FLXE 1J5EQ 3OWFA 1Y8PB 3T1YQ 2PZWA 5IGDA 4IOAA 3V2TA 1IKMA 3MA2B 3T16A 1N32L 4X66Q 1SFOB 1TWCH 4BY1H 4DK6C 2R7FA 2XWJB 1VQ8A 4A3GH 1Z7TA 1ZXTA 4Y7NH 4JI7Q 3FKIH 3E0JA 3GTJH 1VQBA 2FFKB 4HCSA 4JCVE 1PYSB 1SYFA 2A73B 1Q1EA 3I4NB 3I2ZA 4HIMA 3H0GG 3QJYA 4L5SA 3GTLB 2Z6KA 3GV3A 1WTRA 1F9PA 4CGYB 3FHWA 2N3SA 2NYZD 4JBJA 2Q2TA 2NBFA 3NBHB 5IE8A 2Z8LA 1EUJA 1RHPA 3KF6A 1N36L 2L0CA 5KYLA 3DWAA 4UP9A 1SE3A 4K8IA 1BOSA 2V4DA 5I9OA 2B2WA 1FR3A 4XDXA 3S2DH 3HZXA 4DR6Q 4KJNA 1SJED 1I4XA 3GTGB 1VQ5A 1S5DD 1QUQA 1NR2A 1Y8NB 5DEHA 3CCRA 2QILA 1K8AC 1X65A 3J7AV 3VR6A 1I4HA 2QW7A 1ILQA 5I6YA 5FKAC 1S5FD 1EYGA 1X6OA 3AB9A 1EQTA 2A19A 4JBKA 2ZXRA 3KUPA 2ATWA 3D4WA 4AYBG 4ZKBB 4R8IA 4DUYL 3KBXA 4C3HG 1FYCA 5C6AA 2Q2UA 4DV4Q 2A68D 3J81i 2AKWB 3RNUA 2XGTA 1BKBA 4KD4A 3D4RA 4K0KQ 1HQRD 2HD3A 5JOBA 5M5XB 2WB1B 2R7ZH 5C3EH 5EJWA 4A3JB 4A3LH 1GO3E 1JMCA 4FDBA 1HFGA 1I4GA 2OXPA 4BY7B 2A74C 1B9NA 4UHVA 3S1RB 3MFGA 1D8LA 1HZAA 4WORA 1HNXL 3P75A 2L9HA 5CR3A 1CQVA 3D4DA 3J7A5 2R92B 4XIGS 4A3MG 4B3TL 1HZ9A 1RCVD 3NE5B 4P75A 2ZXOA 4FF2A 4JYAL 2EJGC 5EPJA 1HPCA 2EY2A 1SYBA 3K7UC 3CAMA 2R7DA 3EFXD 2O2LD 3I4MH 1DOKA 4J15A 3RZOH 3BDCA 3ULJA 2JA5B 2K03A 3PF5A 4DR1L 3CCUA 2E2HB 5ISRA 1TWFB 1CKMA 1D1KA 1S5CD 4KK7A 2UUBQ 4H13C 2IY5B 1Q3LA 1DZ1A 2HCCA 1B8AA 4JW0A 2WKCA 1EQRA 5FJ8G 1TU2B 1TIID 3GTQB 4IJLA 3EBEA 3U4ZA 1PH8A 3LWEA 2BH8A 1KXLA 5IT9c 4OIKA 3WWVA 3HOUG 1ZYRC 1HR0L 3D0FA 4EQNA 4CKCA 1EU3A 1FVIA 5CV6A 2M9VA 3J80L 4OO1H 1X3EA 2CH4W 4A93G 2UXBL 4GLAC 1STNA 1KLGD 4G7HC 1F2MA 1DXMA 1RIPA 4P74A 4RG1A 3S1QB 4NDXA 3GV6A 4POFA 4IPHA 1SNQA 1LV9A 2F3IA 2L12A 3AFQA 4CDDC 3RMHA 4JPBW 3I73A 4HJ9A 1T9HA 4ZUIA 1A15A 1QNKA 3GQBA 1H9KA 2M00A 1I50B 4LF5L 4IFDG 1PFNA 1GHJA 1EY9A 3KDFA 1N36Q 1UE1A 3E3XA 1L2FA 3T1HL 2OCEA 3U9SA 3GTPH 1CFMA 1SXTA 1NUCA 1PH7A 5C0XH 2IW3A 2DY7A 1O7IA 2CFMA 3CC2A 1HTPA 1SNMA 5T1GA 1CKNA 1U0LA 1IHZA 4K14A 1G6ZA 5AFWA 4X65L 3W5OA 3HOVG 2KOLA 4NW2A 1LO5D 1KTKA 4I7AA 4K2KA 4OELB 2F1MA 2DGYA 1G8ZD 2YTXA 4DV6L 2PZTA 4GNXC 1X3PA 2JYOA 2OQKA 2C9OA 5M3MB 2E2IH 4JI4Q 5HGQA 3PF4A 1A62A 4F87A 2K28A 1Q46A 1WFQA 4K5VA 4TSSA 5IYDG 1AP0A 2JA8H 1F9RA 2D0OA 1PVOA 3TBIB 3KYHC 2LFNA 5M5WH 5M5YH 3FP9A 2B63B 2F0TA 5D65A 1SNCA 2VQEL 4DR3Q 1E2WA 4C3IB 4Q5VA 4OGQC 2ZM6L 1SDFA 2PQAA 1HR0W 1STEA 1A2UA 1JORA 3F8TA 1F9QA 3CU7A 4N8FA 2OTLA 1NMFA 2JA7B 5IP7H 1CK1A 1ENFA 4B3TQ 2KVMA 3FRPB 1S5ED 2VQFL 1VQNA 3TDQA 1D5ZC 1XTCD 4NKLA 3EQLC 4GN5A 3S14H 1QVGA 1C48A 3RN2A 1QG7A 1T5EA 3MVVA 1HTLD 4L5RC 1YEZA 1EIYB 3MXPA 1S5BD 4U68A 1ONLA 3S1NB 2KHSA 1OXUA 1QZHA 3JC66 3CCSA 2AQ1B 1QWYA 4HMJA 1KC8C 4PZ8A 1PA6A 1Z9FA 4XYQA 1Y1VH 3GTOB 2IT1A 4DK1A 2E74C 5IT9L 2EJMA 1PTOH 1WD0A 2EYFA 2B2UC 1PZID 3TN2A 3DMUA 1LUZA 1PZKD 2L4NA 4BBRG 2HT1A 4IPCA 2I0QA 3JAML 2SDFA 2WIIB 2GN5A 3H0GB 1L1OA 2R93B 2A1AA 1U4LA 4UP7A 4YIJA 2DJGC 2PQEA 3KDFB 4MTNA 1AEXA 5C0XI 2UXBQ 3U4VA 1E0BA 1PFBA 1SJHD 4NXNL 5E1FA 5ELOA 4RGMA 2NVYH 2MFIA 3DM1A 3I90A 3NUCA 2ES2A 2F0LA 1A6XA 1M8AA 2RQXA 5KIXA 1L0XB 5GROA 2KUMA 2OT2A 1B9MA 1BUVT 4KHPQ 3NSWA 4HIKA 5C0XJ 3I4LA 2NVQH 1O7YA 4BBSH 3CQZH 5I9PA 1D1IA 5DAUA 3I4NG 2AWNA 2MGSA 4AYBB 5AJ3Q 1STYA 1YNND 1X3QA 2EYLA 2VXWA 4QL5A 3GTKB 1TWGH 1X55A 4X65Q 3S1MH 3S15B 1E22A 3ND8A 3BZKA 4DV6Q 4RH6A 5M3FH 1CA6A 4B3ML 1XX8A 3IRBA 3R93A 5CYUA 4KKTA 4LAAA 4PMBA 1A8VA 1P16A 5JAVA 1EIHA 4LUZA 1EY8A 1MIUA 2VL6A 4P72A 4QUCA 3J80i 4O1NA 2DNCA 4GOPA 1BR9A 2QA4A 1UE5A 2EYOA 4OONA 4K6DA 5LMNL 1M90C 2ENBA 4JC0A 1IBKL 3SGIA 3FPUB 3FEWX 1LTID 1Q1BA 2L5TA 4DV1L 2O5IC 4LFCL 4X64L 3H15A 4TRDA 1BCPD 3T56B 2NN6H 4RKBA 2VQFQ 1A2TA 1NAPA 3BZDB 2LXKA 4JBWA 3ITPA 1PTOC 2F52A 4XYOA 1ESRA 3Q24A 3H3VC 3R2IA 3MEFA 3GTLH 2KJXA 1F77A 4BY7G 3W1BA 3HOUB 2QEXA 4PV1C 3RLNA 5J39A 2R92G 3DWPA 1WCMB 4LF4L 4IJHA 3HOXH 1EZ8A 4HAEA 3HOWH 4YY3L 3KLSX 3M4OB 2JXMB 1KLUD 1TS4A 2X69A 4C3JB 4QIWB 5EPLA 4G7OC 3TQYA 2CKZB 1SLJA 3FVQA 4ZAIA 1GUNA 4B3SL 3GTGH 4R4IA 2QGQA 3QOJA 2LKVA 2GVBA 4DFAA 2UUAQ 4M8AA 1DYQA 1XTDA 4IUNA 3QWNA 1JICA 2CCZA 4A3IG 1PH5A 3NXWA 4UAIA 2ID0A 5J22A 5FLMG 3EA6A 4NXNQ 2OTJA 3A5UA 3PO3G 4U673 2XRSD 2CQAA 3J80E 1MGSA 3VDYA 1U4PA 2B3GA 5LMNW 1KDAA 2BDNA 1BXTA 1CHPD 4KTAA 2H5XA 5M5XH 1EY4A 3S16H 3HOVB 3QG1A 3KBGA 4A3JH 5C4XH 4K8JA 2UXCL 1YITA 3CKIB 1HJPA 1MSGA 4WJ3M 3QOLA 4R4CA 4A3FH 3J7AF 3VA5A 2L11A 3HP3A 5C3WA 4LW1A 3S1RH 3SK5A 3NHHA 4DV3Q 1JJCB 1YNNC 4ALPA 5KYIA 3T13A 4DKAC 2Z4HA 4CDEC 4ZUJA 1C7YA 1JOQA 1Q8IA 4JI1Q 1TWHH 2K05A 1TY2A 2WACA 3K8AA 3CC4A 3JAMi 3NBHA 2JA5H 2JP1A 2BOSA 1ENAA 5IP9H 2J0TD 1E1OA 1QJOA 2LS01 4UPAA 1JJGA 2PNRC 2NTSA 1LACA 1SROA 4HR7B 4OIJA
chains in the Genus database with same CATH topology
4ME3A 1EYGA 4C3JH 4KLKA 1X6OA 3K7AH 2E2JH 2A19A 2HIXA 4JOIC 4JBKA 4A3BH 4GKJQ 4A76A 1I6HH 2WP8J 5LMNQ 2VQEQ 2ATWA 1YJWA 4AYBG 4DUYL 1HNWL 3F2DA 1V1QA 2Q2UA 2OWOA 2ZM6Q 1CSQA 4DV4Q 1A0IA 3J81i 2AKWB 3HOXG 1JJ2A 4BXXH 2K5NA 2LXJA 3RNUA 4LFAQ 3PIOA 1S40A 2XGTA 1SFOH 2B29A 1BKBA 1G291 4DV7Q 3E0EA 4NPSA 2UU9Q 1JE5A 4K0KQ 4PMWA 2MNAA 1X54A 3ICEA 2R7ZH 1K0RA 5C3EH 1WOCA 5IYCG 1K8GA 1YJ9A 4A3LH 1E7ZA 1GO3E 4HJ7A 2HQLA 4X62Q 4FDBA 4X64Q 1Q82C 1JMCA 1K83H 5ELNA 2F4VQ 4IO9A 2B63G 1HNZL 4LFBQ 5H1SE 1GKHA 2RCNA 4JI2L 1D8LA 1HZAA 1HNXL 1P8LA 2AWOA 3KJPA 1XJVA 4DR2L 3I4NH 3J7A5 1J6QA 2JA6H 2BA1A 4XIGS 3PO2H 3UDIA 4A3MG 4B3TL 1HZ9A 4P75A 1NMGA 4JYAL 1AE2A 3CCEA 4DAMA 1G6PA 4A3EH 4DV0L 4R1JA 3HOYH 4L5TA 1VQAA 3K7UC 3CCMA 5GAHC 3TREA 3CAMA 2R7DA 3OTOQ 3M7NA 2C35B 3I4MH 4J15A 1I50H 3CF5A 3RZOH 3ULJA 2JA7G 3CPFA 4JI8L 4HJ8A 3PF5A 2GVAA 3J7ZC 4DR1L 4LF4Q 3CCUA 2E5LQ 1CKMA 1VQDA 2EXDA 3KJOA 4BBSG 1B7YB 3E9HA 2UUBQ 4A3FG 2IY5B 3M4QA 4JI5L 4DR4Q 1VQCA 3G48A 1EOVA 3NELA 1EQQA 1K73C 1B8AA 2A8VA 1EWIA 1OXVA 4P73A 1EQRA 1PH6A 4AYBE 4BA1I 5FJ8G 3TS0A 2ZTCA 1S3OA 4IPGA 3PGZA 4AQYQ 2VUMH 4IJLA 3UDGA 3EBEA 3H3VH 4MZ9A 3U4ZA 1PH8A 2BH8A 1KXLA 5IT9c 4BA2I 4DK3C 3AQQA 1X56A 1K9MC 5GAEC 3WWVA 1CSPA 1PH1A 2IHFA 1XMOL 1FJGQ 3HOUG 3A5ZB 2D62A 5M3FG 3D0FA 1HR0L 3U50C 4A3DH 3HKSA 1FVIA 4A3KG 1J5EL 2ZJRA 4TVAB 1X3EA 4O2DA 4LF6L 4A93G 2UXBL 4LF9L 1IXRA 3PV0A 1X3GA 1AE3A 4GLAC 4QQBX 4GS3A 3L0OA 2KCMA 5IP9G 1EFWA 2UUAL 1RIPA 4P74A 2KENA 4RG1A 1A63A 3EN2A 4JI3L 1VQPA 4LNQA 3CC7A 2NVXH 5EAYA 1KRTA 2N8NA 4POFA 5GADC 2I5HA 4IPHA 4DPGA 3K81C 4UY8C 2R93G 5LMUQ 1Q12A 4DR7L 2F3IA 3K0XA 3AFQA 1SMXA 2PMZE 1Q81C 2UUCL 1CKNB 3CD6A 3AYHB 4C3IH 4HJ9A 1PHJA 1T9HA 2PNHA 4BY7H 2KHJA 2IX1A 2WFWA 2KHIA 4LF5L 4IFDG 1XPRA 4A75A 1G51A 1CKOA 2E8GA 2K50A 4HIDA 4HJ5A 2R92H 4YCWA 4APVA 1JB7A 3KDFA 2NVTH 1N36Q 1OXSC 1UE1A 1YHBA 2HHHL 1L2FA 4QGUA 3T1HL 2OCEA 1I94Q 3GTPH 2NN6G 3S17H 3MXNB 1PH7A 2K52A 2YTVA 4GKKQ 1VQIA 1O7IA 2CFMA 3CC2A 3PUYA 3I55A 4B3MQ 1CKNA 1U0LA 1VQGA 4DV3L 1XNQL 2NN6I 4NB3A 4KHZA 4XTCS 4NXML 5BR8L 4X65L 3A0JA 3W5OA 3HOVG 4L5QA 4POGA 1GD7A 2E2HH 1TWFH 3HFZB 5IWAQ 2LSSA 3CCQA 1XNRQ 1WI5A 4JI1L 3AEVA 2DGYA 3S1NH 2YTXA 4A3EG 1VQMA 4DV6L 2Z6KC 3L7ZC 3ZJYC 1L0WA 2OQKA 4GNXC 5GQOA 4A3IH 1KRSA 2PQAB 2YTYA 2E2IH 5HGQA 4JI4Q 1A62A 1KL9A 4OX9L 3D31A 1Q46A 1WFQA 3PF4A 4DUZQ 4JV5L 1NE3A 5FLMH 3GTQH 5IYDG 1SN8A 1VQ7A 4IFDJ 4JI6L 2JA8H 2MO0A 1IBKQ 2D0OA 2JE6I 3HOWG 1PVOA 3KYHC 3UE1A 5M5WH 5M5YH 1MKHA 3FP9A 4DR5L 2K4KA 4DV2Q 1N33Q 1LYLA 5HY6A 4QIWE 4GKJL 1YIJA 1JT8A 3EIVA 1YVCA 1HZCA 4DV1Q 1Y1WH 4A4IA 3H0GH 4YWMA 2VW9A 2VQEL 2K5HA 4DR3Q 3ULPA 4LFCQ 3CMAA 1E3PA 1VQEA 2PI2A 3L2PA 2VUMG 2ZM6L 4P71A 3ULLA 3KOJA 2PQAA 1HR0W 3HOZG 4IOCA 3S1QH 1WJJA 2MQHA 1HNZQ 1I5FA 3F8TA 2JQOA 3LGJA 4BY1G 4JI2Q 2ZJPA 3J81j 4DV7L 1IBML 4OXPA 4JBMA 3GTMH 2UXDL 1HH2P 4RMFA 4LF8L 2OTLA 4GOPC 4DR2Q 1NMFA 3STBC 3H3VI 4A3GG 5IP7H 3STBD 4C2MH 4B3TQ 2Y0SG 2ALYB 3FKIG 3KLWA 2HIVA 4DV5L 1NTGA 4HJAA 2VQFL 1VQNA 4IPDA 1NJIC 1HZBA 1Q8KA 2XTIA 4DV0Q 4O0AA 4B3RQ 4GN5A 3S14H 1QVGA 1TWAH 2RHSB 3RN2A 1YHQA 1N34L 1M1KC 3S2HH 1GVPA 2WB1G 4OWWB 2DUDA 1YEZA 4A3JG 1EIYB 4L5RC 3PIPA 4GLVB 1BBUA 3TS2A 5C4XG 1FGUA 4JI8Q 1KIXA 1L1OB 1IYJB 1BBWA 4GN3B 4JG2A 3S24A 1PV4A 1OXUA 4YY3Q 3JC66 3CCSA 1QZHA 1C0AA 1KC8C 4PZ8A 3W1GA 1PA6A 1Z9FA 3KF8B 2YYZA 1DGSA 4BBRH 5IYBH 4AH6A 3CCJA 3OTOL 4JI5Q 1Y1VH 1XPUA 2IT1A 2EIFA 1MJCA 5C44H 4UP8A 1XMQL 1IBLL 4B3SQ 1W2BA 1ASYA 1W3SA 4C3HH 4LWCA 1Y14B 4GN4B 2E5LL 4YWLA 3S15H 1N9WA 4PG3A 1LUZA 1N32Q 4HIOA 2HT1A 5C0XG 4A3CG 4IPCA 1XMOQ 2I0QA 4LF7L 1KD1C 2GN5A 3M9BA 1L1OA 3Q8DA 5M3MH 5JJKA 2VY3A 2A1AA 2Z0SA 3T1YL 2JA5G 1WCMG 5IYCH 4UP7A 1K3RA 2ZTDA 5FLXc 4AQYL 1VQ9A 4JI0Q 2V1CC 2BA0A 1UEBA 3KDFB 4MTNA 5C0XI 4LF9Q 2KCTA 2JEAI 3U4VA 2UXBQ 1SE8A 3UDFA 4X66L 2B63H 3CCVA 4JI3Q 1SR3A 1FJGL 1IL2A 2JEBI 4A3BG 3G6EA 3OW2A 2WAQG 4A3MH 1AH9A 4JI7L 2Y0SE 4DR7Q 4NXNL 3F2BA 5ELOA 2UXCQ 2NVYH 2MFIA 3I56A 2ES2A 3PUWA 1LM0A 4BXXG 1PH2A 5GROA 3J80c 3DLLA 2K75A 3I7FA 1VQFA 4EQ5A 2R7ZG 2RHQB 3TEHB 5C3EG 2WB1E 2JA7H 4KHPQ 1Y1WG 4HIKA 4A3LG 1H95A 2VNUD 5C0XJ 2NVQH 3PUZA 4GNXA 4JOIA 5JEAJ 3DM3A 3CCLA 2CWAA 1VQKA 3E9IA 4BBSH 1YJNA 3CQZH 4PZ6A 3I4NG 2JA6G 1V43A 3PO2G 2AWNA 1XNQQ 5AJ3Q 4GOPB 4QJFA 5FJ8H 4QL5A 5BR8Q 4YHHL 1TWGH 1X55A 3RLOA 4X65Q 5C4JH 4LUVA 3S1MH 3TRZA 3UDXA 1TXYA 3CMEA 3U58A 3RZDH 1E22A 1VQHA 3HOYG 3BZKA 4GKKL 4DR6L 4R4TA 1NY4A 3B6YA 3GO5A 4DV6Q 2YU9H 4B3ML 5M3FH 3I4MG 2OQ0A 3F1ZA 3GTOH 1VQLA 3IRBA 2CWPA 3NENA 4OX9Q 1VS0A 4DUYQ 4A3KH 1HNWQ 1RL2A 5E7NA 1A8VA 1P16A 2I5MX 4A93H 3PO3H 4LUZA 1MIUA 2VL6A 1QZGA 3GDEA 4P72A 5JJLA 3J80i 3BJUA 5IWAL 4JI6Q 1XNRL 2VZAA 5K36G 4GOPA 4LUOA 2D0PA 1Z47A 2KBNA 3PUVA 4DR5Q 3M4OH 2IHEA 1EIFA 1D7QA 2Q2HA 2QA4A 1U5KA 1UE5A 4OONA 4YWKA 5LMNL 4Y52H 2WAQE 2EQSA 2YV5A 1M90C 4JI4L 2BH2A 4DAYB 1Y1VG 1PH9A 1V9PA 2FXQA 2R93H 4DUZL 5C44G 4DV4L 1E1TA 4JC0A 4H02A 1IBKL 3SGIA 4LFAL 2N49A 1C9OA 2UU9L 1HNXQ 1PH3A 4K0KL 4DV2L 2I5LX 2N78A 5DLQE 1PH4A 1IBMQ 1N33L 1Q1BA 3CP0A 4A3DG 1E24A 2UXDQ 4DV1L 4LF8Q 2L15A 4LFCL 5M3MG 3I4OA 3G4SA 4DR3L 4OO1G 4JYAQ 5GAGC 4X62L 1YNXA 4X64L 2CQOA 3H15A 2VS1A 1S72A 1CUKA 2F4VL 3HKZG 4LFBL 2NZHA 4DV5Q 1YI2A 2VQFQ 2K14A 5IY0A 4OO1I 1UE7A 1QVCA 1VQJA 2LXKA 1KAWA 1OTCA 1N34Q 3ERSX 3ER0A 4JBWA 3PCOB 3M85A 2F52A 2JK8A 4DR1Q 1KHIA 4GLXA 4KI0A 3M3YH 2R6GA 3MEFA 3GTLH 3HOVH 4WJ4A 2K5VA 3GD7A 4BY7G 4PZ7A 3W1BA 2QEXA 3KFUA 1X9NA 1WYDA 4YCUA 3RLNA 4B3RL 1NBWA 2JJQA 2R92G 4QY7A 1ASZA 3M4PA 1PFSA 1KQSA 1XPOA 1GM5A 4LF4L 1XMQQ 1IBLQ 3GTKH 3UE0A 5JJIA 4IJHA 1I3QH 5IYDH 2Q2IA 3HOXH 2ZTEA 2UUBL 3HOWH 4YY3L 4R4QA 4OWTB 4DR4L 5JEAG 3CXCA 1HR0Q 3AFPA 4AIMA 3TQYA 2CKZB 4LF7Q 1PYBA 1N8RC 1SLJA 1J5EQ 4DNIA 4LF6Q 4B3SL 3GTGH 4R4IA 3T1YQ 2QGQA 1BVSA 2GVBA 4R4OA 2IX0A 4IOAA 4YCVA 3F2CA 2UUAQ 4TQUS 1XTDA 3RN5A 3HOZH 1X3FA 4GNXB 1N32L 1SRUA 4X66Q 1TWCH 2PI2E 4BY1H 4DK6C 1OXTA 2R7FA 4A3IG 1PH5A 1VQ8A 2CCZA 4A3GH 1YBYA 2ID0A 3RR5A 3BU2A 4Y7NH 5FLMG 2UUCQ 4JI0L 4JI7Q 4NXNQ 3FKIH 3GTJH 2ZJQA 1VQBA 2OTJA 3JAMc 3A5UA 2JA8G 3KF6B 1QVFA 3HKZE 3PO3G 3VDYA 4JCVE 3PSIA 2B3GA 5LMNW 3CPWA 1YZ6A 1MJEA 4LF5Q 1IZ6A 1PYSB 1VCIA 2MO1A 3CW2C 1Q1EA 1YHAA 5LMUL 3I2ZA 4HIMA 3H0GG 1VQ6A 2H5XA 5M5XH 2HHHQ 3S16H 4L5SA 2Z6KA 4A3JH 3T1HQ 5C4XH 2UXCL 3FHWA 2N3SA 1HJPA 1YITA 4WJ3M 1B70B 1L1OC 4JBJA 1QUQB 4R4CA 4A3FH 2Q2TA 4X6AH 3NBHB 3NEMA 3OYYA 4LW1A 3J81c 3S1RH 5IE8A 1UWVA 3PUXA 4DV3Q 3G71A 1JJCB 1Q86C 1EUJA 4ALPA 3KF6A 1VQ4A 1N36L 4NXMQ 5IP7G 4KHPL 2AMCB 4UP9A 4DKAC 1I94L 1Q7YC 1C7YA 4YHHQ 1FL0A 5J3BA 4JI1Q 4MNOA 1TWHH 2AHOB 4IFDI 2JA9A 2NZOA 3HOUH 1OXXK 2ASBA 1LTLA 3S2DH 4A3CH 4DR6Q 3K8AA 3CC4A 1VQ5A 1QUQA 4OWXB 4EX5A 5AJ3L 4JV5Q 3JAMi 1WCMH 3RLFA 2JA5H 3K80C 3CCRA 1R9TH 1VQOA 5IP9H 3BZCA 1K8AC 1X65A 1E1OA 1UE6A 4UPAA 3A74A 1JJGA 1SROA 2RF4A 5IYBG 4BBRG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME3 A;  1EYG A;  4C3J H;  4KLK A;  1X6O A;  3K7A H;  2E2J H;  2A19 A;  2HIX A;  4JOI C;  4JBK A;  4A3B H;  4GKJ Q;  4A76 A;  1I6H H;  2WP8 J;  5LMN Q;  2VQE Q;  2ATW A;  1YJW A;  4AYB G;  4DUY L;  1HNW L;  3F2D A;  1V1Q A;  2Q2U A;  2OWO A;  2ZM6 Q;  1CSQ A;  4DV4 Q;  1A0I A;  3J81 i;  2AKW B;  3HOX G;  1JJ2 A;  4BXX H;  2K5N A;  2LXJ A;  3RNU A;  4LFA Q;  3PIO A;  1S40 A;  2XGT A;  1SFO H;  2B29 A;  1BKB A;  1G29 1;  4DV7 Q;  3E0E A;  4NPS A;  2UU9 Q;  1JE5 A;  4K0K Q;  4PMW A;  2MNA A;  1X54 A;  3ICE A;  2R7Z H;  1K0R A;  5C3E H;  1WOC A;  5IYC G;  1K8G A;  1YJ9 A;  4A3L H;  1E7Z A;  1GO3 E;  4HJ7 A;  2HQL A;  4X62 Q;  4FDB A;  4X64 Q;  1Q82 C;  1JMC A;  1K83 H;  5ELN A;  2F4V Q;  4IO9 A;  2B63 G;  1HNZ L;  4LFB Q;  5H1S E;  1GKH A;  2RCN A;  4JI2 L;  1D8L A;  1HZA A;  1HNX L;  1P8L A;  2AWO A;  3KJP A;  1XJV A;  4DR2 L;  3I4N H;  3J7A 5;  1J6Q A;  2JA6 H;  2BA1 A;  4XIG S;  3PO2 H;  3UDI A;  4A3M G;  4B3T L;  1HZ9 A;  4P75 A;  1NMG A;  4JYA L;  1AE2 A;  3CCE A;  4DAM A;  1G6P A;  4A3E H;  4DV0 L;  4R1J A;  3HOY H;  4L5T A;  1VQA A;  3K7U C;  3CCM A;  5GAH C;  3TRE A;  3CAM A;  2R7D A;  3OTO Q;  3M7N A;  2C35 B;  3I4M H;  4J15 A;  1I50 H;  3CF5 A;  3RZO H;  3ULJ A;  2JA7 G;  3CPF A;  4JI8 L;  4HJ8 A;  3PF5 A;  2GVA A;  3J7Z C;  4DR1 L;  4LF4 Q;  3CCU A;  2E5L Q;  1CKM A;  1VQD A;  2EXD A;  3KJO A;  4BBS G;  1B7Y B;  3E9H A;  2UUB Q;  4A3F G;  2IY5 B;  3M4Q A;  4JI5 L;  4DR4 Q;  1VQC A;  3G48 A;  1EOV A;  3NEL A;  1EQQ A;  1K73 C;  1B8A A;  2A8V A;  1EWI A;  1OXV A;  4P73 A;  1EQR A;  1PH6 A;  4AYB E;  4BA1 I;  5FJ8 G;  3TS0 A;  2ZTC A;  1S3O A;  4IPG A;  3PGZ A;  4AQY Q;  2VUM H;  4IJL A;  3UDG A;  3EBE A;  3H3V H;  4MZ9 A;  3U4Z A;  1PH8 A;  2BH8 A;  1KXL A;  5IT9 c;  4BA2 I;  4DK3 C;  3AQQ A;  1X56 A;  1K9M C;  5GAE C;  3WWV A;  1CSP A;  1PH1 A;  2IHF A;  1XMO L;  1FJG Q;  3HOU G;  3A5Z B;  2D62 A;  5M3F G;  3D0F A;  1HR0 L;  3U50 C;  4A3D H;  3HKS A;  1FVI A;  4A3K G;  1J5E L;  2ZJR A;  4TVA B;  1X3E A;  4O2D A;  4LF6 L;  4A93 G;  2UXB L;  4LF9 L;  1IXR A;  3PV0 A;  1X3G A;  1AE3 A;  4GLA C;  4QQB X;  4GS3 A;  3L0O A;  2KCM A;  5IP9 G;  1EFW A;  2UUA L;  1RIP A;  4P74 A;  2KEN A;  4RG1 A;  1A63 A;  3EN2 A;  4JI3 L;  1VQP A;  4LNQ A;  3CC7 A;  2NVX H;  5EAY A;  1KRT A;  2N8N A;  4POF A;  5GAD C;  2I5H A;  4IPH A;  4DPG A;  3K81 C;  4UY8 C;  2R93 G;  5LMU Q;  1Q12 A;  4DR7 L;  2F3I A;  3K0X A;  3AFQ A;  1SMX A;  2PMZ E;  1Q81 C;  2UUC L;  1CKN B;  3CD6 A;  3AYH B;  4C3I H;  4HJ9 A;  1PHJ A;  1T9H A;  2PNH A;  4BY7 H;  2KHJ A;  2IX1 A;  2WFW A;  2KHI A;  4LF5 L;  4IFD G;  1XPR A;  4A75 A;  1G51 A;  1CKO A;  2E8G A;  2K50 A;  4HID A;  4HJ5 A;  2R92 H;  4YCW A;  4APV A;  1JB7 A;  3KDF A;  2NVT H;  1N36 Q;  1OXS C;  1UE1 A;  1YHB A;  2HHH L;  1L2F A;  4QGU A;  3T1H L;  2OCE A;  1I94 Q;  3GTP H;  2NN6 G;  3S17 H;  3MXN B;  1PH7 A;  2K52 A;  2YTV A;  4GKK Q;  1VQI A;  1O7I A;  2CFM A;  3CC2 A;  3PUY A;  3I55 A;  4B3M Q;  1CKN A;  1U0L A;  1VQG A;  4DV3 L;  1XNQ L;  2NN6 I;  4NB3 A;  4KHZ A;  4XTC S;  4NXM L;  5BR8 L;  4X65 L;  3A0J A;  3W5O A;  3HOV G;  4L5Q A;  4POG A;  1GD7 A;  2E2H H;  1TWF H;  3HFZ B;  5IWA Q;  2LSS A;  3CCQ A;  1XNR Q;  1WI5 A;  4JI1 L;  3AEV A;  2DGY A;  3S1N H;  2YTX A;  4A3E G;  1VQM A;  4DV6 L;  2Z6K C;  3L7Z C;  3ZJY C;  1L0W A;  2OQK A;  4GNX C;  5GQO A;  4A3I H;  1KRS A;  2PQA B;  2YTY A;  2E2I H;  5HGQ A;  4JI4 Q;  1A62 A;  1KL9 A;  4OX9 L;  3D31 A;  1Q46 A;  1WFQ A;  3PF4 A;  4DUZ Q;  4JV5 L;  1NE3 A;  5FLM H;  3GTQ H;  5IYD G;  1SN8 A;  1VQ7 A;  4IFD J;  4JI6 L;  2JA8 H;  2MO0 A;  1IBK Q;  2D0O A;  2JE6 I;  3HOW G;  1PVO A;  3KYH C;  3UE1 A;  5M5W H;  5M5Y H;  1MKH A;  3FP9 A;  4DR5 L;  2K4K A;  4DV2 Q;  1N33 Q;  1LYL A;  5HY6 A;  4QIW E;  4GKJ L;  1YIJ A;  1JT8 A;  3EIV A;  1YVC A;  1HZC A;  4DV1 Q;  1Y1W H;  4A4I A;  3H0G H;  4YWM A;  2VW9 A;  2VQE L;  2K5H A;  4DR3 Q;  3ULP A;  4LFC Q;  3CMA A;  1E3P A;  1VQE A;  2PI2 A;  3L2P A;  2VUM G;  2ZM6 L;  4P71 A;  3ULL A;  3KOJ A;  2PQA A;  1HR0 W;  3HOZ G;  4IOC A;  3S1Q H;  1WJJ A;  2MQH A;  1HNZ Q;  1I5F A;  3F8T A;  2JQO A;  3LGJ A;  4BY1 G;  4JI2 Q;  2ZJP A;  3J81 j;  4DV7 L;  1IBM L;  4OXP A;  4JBM A;  3GTM H;  2UXD L;  1HH2 P;  4RMF A;  4LF8 L;  2OTL A;  4GOP C;  4DR2 Q;  1NMF A;  3STB C;  3H3V I;  4A3G G;  5IP7 H;  3STB D;  4C2M H;  4B3T Q;  2Y0S G;  2ALY B;  3FKI G;  3KLW A;  2HIV A;  4DV5 L;  1NTG A;  4HJA A;  2VQF L;  1VQN A;  4IPD A;  1NJI C;  1HZB A;  1Q8K A;  2XTI A;  4DV0 Q;  4O0A A;  4B3R Q;  4GN5 A;  3S14 H;  1QVG A;  1TWA H;  2RHS B;  3RN2 A;  1YHQ A;  1N34 L;  1M1K C;  3S2H H;  1GVP A;  2WB1 G;  4OWW B;  2DUD A;  1YEZ A;  4A3J G;  1EIY B;  4L5R C;  3PIP A;  4GLV B;  1BBU A;  3TS2 A;  5C4X G;  1FGU A;  4JI8 Q;  1KIX A;  1L1O B;  1IYJ B;  1BBW A;  4GN3 B;  4JG2 A;  3S24 A;  1PV4 A;  1OXU A;  4YY3 Q;  3JC6 6;  3CCS A;  1QZH A;  1C0A A;  1KC8 C;  4PZ8 A;  3W1G A;  1PA6 A;  1Z9F A;  3KF8 B;  2YYZ A;  1DGS A;  4BBR H;  5IYB H;  4AH6 A;  3CCJ A;  3OTO L;  4JI5 Q;  1Y1V H;  1XPU A;  2IT1 A;  2EIF A;  1MJC A;  5C44 H;  4UP8 A;  1XMQ L;  1IBL L;  4B3S Q;  1W2B A;  1ASY A;  1W3S A;  4C3H H;  4LWC A;  1Y14 B;  4GN4 B;  2E5L L;  4YWL A;  3S15 H;  1N9W A;  4PG3 A;  1LUZ A;  1N32 Q;  4HIO A;  2HT1 A;  5C0X G;  4A3C G;  4IPC A;  1XMO Q;  2I0Q A;  4LF7 L;  1KD1 C;  2GN5 A;  3M9B A;  1L1O A;  3Q8D A;  5M3M H;  5JJK A;  2VY3 A;  2A1A A;  2Z0S A;  3T1Y L;  2JA5 G;  1WCM G;  5IYC H;  4UP7 A;  1K3R A;  2ZTD A;  5FLX c;  4AQY L;  1VQ9 A;  4JI0 Q;  2V1C C;  2BA0 A;  1UEB A;  3KDF B;  4MTN A;  5C0X I;  4LF9 Q;  2KCT A;  2JEA I;  3U4V A;  2UXB Q;  1SE8 A;  3UDF A;  4X66 L;  2B63 H;  3CCV A;  4JI3 Q;  1SR3 A;  1FJG L;  1IL2 A;  2JEB I;  4A3B G;  3G6E A;  3OW2 A;  2WAQ G;  4A3M H;  1AH9 A;  4JI7 L;  2Y0S E;  4DR7 Q;  4NXN L;  3F2B A;  5ELO A;  2UXC Q;  2NVY H;  2MFI A;  3I56 A;  2ES2 A;  3PUW A;  1LM0 A;  4BXX G;  1PH2 A;  5GRO A;  3J80 c;  3DLL A;  2K75 A;  3I7F A;  1VQF A;  4EQ5 A;  2R7Z G;  2RHQ B;  3TEH B;  5C3E G;  2WB1 E;  2JA7 H;  4KHP Q;  1Y1W G;  4HIK A;  4A3L G;  1H95 A;  2VNU D;  5C0X J;  2NVQ H;  3PUZ A;  4GNX A;  4JOI A;  5JEA J;  3DM3 A;  3CCL A;  2CWA A;  1VQK A;  3E9I A;  4BBS H;  1YJN A;  3CQZ H;  4PZ6 A;  3I4N G;  2JA6 G;  1V43 A;  3PO2 G;  2AWN A;  1XNQ Q;  5AJ3 Q;  4GOP B;  4QJF A;  5FJ8 H;  4QL5 A;  5BR8 Q;  4YHH L;  1TWG H;  1X55 A;  3RLO A;  4X65 Q;  5C4J H;  4LUV A;  3S1M H;  3TRZ A;  3UDX A;  1TXY A;  3CME A;  3U58 A;  3RZD H;  1E22 A;  1VQH A;  3HOY G;  3BZK A;  4GKK L;  4DR6 L;  4R4T A;  1NY4 A;  3B6Y A;  3GO5 A;  4DV6 Q;  2YU9 H;  4B3M L;  5M3F H;  3I4M G;  2OQ0 A;  3F1Z A;  3GTO H;  1VQL A;  3IRB A;  2CWP A;  3NEN A;  4OX9 Q;  1VS0 A;  4DUY Q;  4A3K H;  1HNW Q;  1RL2 A;  5E7N A;  1A8V A;  1P16 A;  2I5M X;  4A93 H;  3PO3 H;  4LUZ A;  1MIU A;  2VL6 A;  1QZG A;  3GDE A;  4P72 A;  5JJL A;  3J80 i;  3BJU A;  5IWA L;  4JI6 Q;  1XNR L;  2VZA A;  5K36 G;  4GOP A;  4LUO A;  2D0P A;  1Z47 A;  2KBN A;  3PUV A;  4DR5 Q;  3M4O H;  2IHE A;  1EIF A;  1D7Q A;  2Q2H A;  2QA4 A;  1U5K A;  1UE5 A;  4OON A;  4YWK A;  5LMN L;  4Y52 H;  2WAQ E;  2EQS A;  2YV5 A;  1M90 C;  4JI4 L;  2BH2 A;  4DAY B;  1Y1V G;  1PH9 A;  1V9P A;  2FXQ A;  2R93 H;  4DUZ L;  5C44 G;  4DV4 L;  1E1T A;  4JC0 A;  4H02 A;  1IBK L;  3SGI A;  4LFA L;  2N49 A;  1C9O A;  2UU9 L;  1HNX Q;  1PH3 A;  4K0K L;  4DV2 L;  2I5L X;  2N78 A;  5DLQ E;  1PH4 A;  1IBM Q;  1N33 L;  1Q1B A;  3CP0 A;  4A3D G;  1E24 A;  2UXD Q;  4DV1 L;  4LF8 Q;  2L15 A;  4LFC L;  5M3M G;  3I4O A;  3G4S A;  4DR3 L;  4OO1 G;  4JYA Q;  5GAG C;  4X62 L;  1YNX A;  4X64 L;  2CQO A;  3H15 A;  2VS1 A;  1S72 A;  1CUK A;  2F4V L;  3HKZ G;  4LFB L;  2NZH A;  4DV5 Q;  1YI2 A;  2VQF Q;  2K14 A;  5IY0 A;  4OO1 I;  1UE7 A;  1QVC A;  1VQJ A;  2LXK A;  1KAW A;  1OTC A;  1N34 Q;  3ERS X;  3ER0 A;  4JBW A;  3PCO B;  3M85 A;  2F52 A;  2JK8 A;  4DR1 Q;  1KHI A;  4GLX A;  4KI0 A;  3M3Y H;  2R6G A;  3MEF A;  3GTL H;  3HOV H;  4WJ4 A;  2K5V A;  3GD7 A;  4BY7 G;  4PZ7 A;  3W1B A;  2QEX A;  3KFU A;  1X9N A;  1WYD A;  4YCU A;  3RLN A;  4B3R L;  1NBW A;  2JJQ A;  2R92 G;  4QY7 A;  1ASZ A;  3M4P A;  1PFS A;  1KQS A;  1XPO A;  1GM5 A;  4LF4 L;  1XMQ Q;  1IBL Q;  3GTK H;  3UE0 A;  5JJI A;  4IJH A;  1I3Q H;  5IYD H;  2Q2I A;  3HOX H;  2ZTE A;  2UUB L;  3HOW H;  4YY3 L;  4R4Q A;  4OWT B;  4DR4 L;  5JEA G;  3CXC A;  1HR0 Q;  3AFP A;  4AIM A;  3TQY A;  2CKZ B;  4LF7 Q;  1PYB A;  1N8R C;  1SLJ A;  1J5E Q;  4DNI A;  4LF6 Q;  4B3S L;  3GTG H;  4R4I A;  3T1Y Q;  2QGQ A;  1BVS A;  2GVB A;  4R4O A;  2IX0 A;  4IOA A;  4YCV A;  3F2C A;  2UUA Q;  4TQU S;  1XTD A;  3RN5 A;  3HOZ H;  1X3F A;  4GNX B;  1N32 L;  1SRU A;  4X66 Q;  1TWC H;  2PI2 E;  4BY1 H;  4DK6 C;  1OXT A;  2R7F A;  4A3I G;  1PH5 A;  1VQ8 A;  2CCZ A;  4A3G H;  1YBY A;  2ID0 A;  3RR5 A;  3BU2 A;  4Y7N H;  5FLM G;  2UUC Q;  4JI0 L;  4JI7 Q;  4NXN Q;  3FKI H;  3GTJ H;  2ZJQ A;  1VQB A;  2OTJ A;  3JAM c;  3A5U A;  2JA8 G;  3KF6 B;  1QVF A;  3HKZ E;  3PO3 G;  3VDY A;  4JCV E;  3PSI A;  2B3G A;  5LMN W;  3CPW A;  1YZ6 A;  1MJE A;  4LF5 Q;  1IZ6 A;  1PYS B;  1VCI A;  2MO1 A;  3CW2 C;  1Q1E A;  1YHA A;  5LMU L;  3I2Z A;  4HIM A;  3H0G G;  1VQ6 A;  2H5X A;  5M5X H;  2HHH Q;  3S16 H;  4L5S A;  2Z6K A;  4A3J H;  3T1H Q;  5C4X H;  2UXC L;  3FHW A;  2N3S A;  1HJP A;  1YIT A;  4WJ3 M;  1B70 B;  1L1O C;  4JBJ A;  1QUQ B;  4R4C A;  4A3F H;  2Q2T A;  4X6A H;  3NBH B;  3NEM A;  3OYY A;  4LW1 A;  3J81 c;  3S1R H;  5IE8 A;  1UWV A;  3PUX A;  4DV3 Q;  3G71 A;  1JJC B;  1Q86 C;  1EUJ A;  4ALP A;  3KF6 A;  1VQ4 A;  1N36 L;  4NXM Q;  5IP7 G;  4KHP L;  2AMC B;  4UP9 A;  4DKA C;  1I94 L;  1Q7Y C;  1C7Y A;  4YHH Q;  1FL0 A;  5J3B A;  4JI1 Q;  4MNO A;  1TWH H;  2AHO B;  4IFD I;  2JA9 A;  2NZO A;  3HOU H;  1OXX K;  2ASB A;  1LTL A;  3S2D H;  4A3C H;  4DR6 Q;  3K8A A;  3CC4 A;  1VQ5 A;  1QUQ A;  4OWX B;  4EX5 A;  5AJ3 L;  4JV5 Q;  3JAM i;  1WCM H;  3RLF A;  2JA5 H;  3K80 C;  3CCR A;  1R9T H;  1VQO A;  5IP9 H;  3BZC A;  1K8A C;  1X65 A;  1E1O A;  1UE6 A;  4UPA A;  3A74 A;  1JJG A;  1SRO A;  2RF4 A;  5IYB G;  4BBR G; 
#chains in the Genus database with same CATH topology
 4GZY C;  2E2J H;  4GKJ Q;  4JOI C;  2JN4 A;  4A3D B;  1KAB A;  4K5X A;  5LMN Q;  2X6G A;  3ERQ A;  3H09 A;  1YJW A;  1HNW L;  2G9H D;  2O5J C;  2NWG A;  2RCF A;  3SK4 A;  3VYR A;  4FXD A;  2LXJ A;  4V0B A;  2B29 A;  3AMU A;  4DV7 Q;  1JE5 A;  4PMW A;  1X54 A;  4BS9 A;  3VA7 A;  3ICE A;  2K33 A;  1WOC A;  4X3S A;  1CM9 A;  5IYC G;  1K8G A;  1YJ9 A;  2B2T C;  1B53 A;  4OHJ A;  3X3N A;  1PRT F;  4X64 Q;  1Q82 C;  3IAY A;  3W2D A;  2LY7 A;  2B63 G;  3EJI A;  4QCL A;  4P2C B;  3IFD A;  3KJP A;  1J6Q A;  2BA1 A;  3UDI A;  4NMZ A;  2NVT B;  1K8O A;  1NMG A;  1AFP A;  3CCE A;  3VYT A;  2KCC A;  3S17 B;  1STA A;  4A3E H;  2Z1C A;  1VQA A;  1TQO A;  2F0I A;  1YNJ D;  3TRE A;  3N52 A;  3VYS A;  3OTO Q;  1I50 H;  2IJ0 A;  3HS0 C;  2JA7 G;  1R9T B;  3NP8 A;  2GVA A;  4LF4 Q;  2E5L Q;  2EXD A;  3E9H A;  1JWU D;  1X32 A;  1VQC A;  3G48 A;  1EOV A;  3NEL A;  4J1M A;  1B1Z A;  1EQQ A;  2A8V A;  1PRT B;  3DEO A;  4IPG A;  1S3O A;  3PGZ A;  4AQY Q;  2VUM H;  2E76 C;  5I2X A;  3AU7 A;  1K9M C;  1BCP F;  1W6J A;  2D62 A;  1ZYR D;  4ILW A;  1NSN S;  2Q8I B;  4O2D A;  3JAM E;  4LF6 L;  1EWC A;  4LF9 L;  1K83 B;  4GS3 A;  3L0O A;  1PFM A;  3EVQ A;  4MN3 A;  1HXY D;  3EN2 A;  1VQP A;  3LX0 A;  3DUZ A;  4PMC A;  3GTM B;  3QR8 A;  4DPG A;  2Z4I A;  2R93 G;  4ZQ3 A;  1Q12 A;  4DR7 L;  3K0X A;  4WFN 3;  1SMX A;  2UUC L;  4RKL A;  2F0V A;  4C3I H;  1H9J A;  4X3K A;  4ULL A;  2PCF B;  4F8M A;  2IX1 A;  2E75 C;  3OMC A;  2KHI A;  1XPR A;  4A75 A;  1CQF A;  4B9W A;  1CKO A;  3S2H B;  3MTS A;  3VR5 A;  2HHH L;  1ESF A;  1BCP B;  1I4P A;  3TSS A;  2SOB A;  3TME A;  1EY0 A;  2EYH A;  4UDU C;  4EVO A;  3MXN B;  1RTO A;  1V1O A;  3L9A X;  4GKK Q;  2B8F A;  2R61 A;  3PUY A;  3FDT A;  4JK1 C;  4NXM L;  1U9R A;  3A0J A;  4FP5 D;  1GD7 A;  3HFZ B;  5EKI A;  2LSS A;  1XNR Q;  3S1N H;  4XXE A;  1VQM A;  1U4M A;  2Z6K C;  3L7Z C;  2F0F A;  4OX9 L;  3IL8 A;  2RSN A;  5IGE A;  3D31 A;  3R2T A;  4DUZ Q;  4JV5 L;  1NE3 A;  3A8I E;  1H9R A;  2K4K A;  5A35 A;  1LYL A;  4MTK A;  3E5S A;  3K59 A;  1YIJ A;  1Y1W H;  2QEJ C;  3H0G H;  4YWM A;  1LTR D;  3TP5 A;  2K5H A;  3QIA A;  3CMA A;  3OOC A;  1VQE A;  2PI2 A;  3BVG A;  3HOZ G;  3Q0A A;  1IBM L;  1JWS D;  2JQO A;  4N8X 1;  3VYU A;  1VMC A;  3J81 j;  4OXP A;  1BF4 A;  1HH2 P;  4RMF A;  4LF8 L;  4V19 0;  3STB C;  1R4Q B;  4C2M H;  5JPN C;  3BVZ A;  1JOK A;  2HIV A;  3SK6 A;  4EGV A;  4DV5 L;  1YNJ C;  1WD1 A;  1EWH A;  2F0G A;  1HZB A;  1Q8K A;  2F0E A;  5KGU A;  3MWY W;  4B3R Q;  1TWA H;  2EYP A;  3QO2 A;  3DWQ A;  3T51 B;  1GVP A;  2DUD A;  5FO9 B;  5A2Q L;  4GLV B;  3TS2 A;  2KA7 A;  1KIX A;  1IYJ B;  3RZD B;  2PYK A;  2EYJ A;  2WV6 D;  1DGS A;  4A3I B;  3CCJ A;  1B44 D;  1SMY C;  1WTH A;  1XPU A;  1A3V A;  2EIF A;  1UEA B;  2KEE A;  5C44 H;  4UP8 A;  4A3K B;  3C3L A;  3PO3 B;  4C3H H;  2B2V A;  3S15 H;  4PG3 A;  2RDF A;  1N32 Q;  1CT1 D;  5C0X G;  4EQP A;  4A3C G;  3Q8D A;  1RD9 D;  2VY3 A;  1WCM G;  1K3R A;  5FLX c;  3W3A A;  3J7Y W;  4ODG A;  4LF9 Q;  4Q0F A;  3PIP 3;  3CCV A;  1DJR D;  1FJG L;  1IL2 A;  4C3J G;  2JEB I;  4A3B G;  3Q6S A;  2G5D A;  4A3M H;  1AH9 A;  4ID6 A;  4DR7 Q;  3F2B A;  2B2Y A;  3J81 E;  3PUW A;  4BXX G;  5D3D A;  4DXG A;  5E4X A;  3DLL A;  1TKW B;  2K75 A;  1LTT D;  2TSS A;  4RWS C;  3TEH B;  4RGO S;  1LTG D;  2K04 A;  2OEO A;  2Z6B A;  1GOZ A;  2BDO A;  3A7A B;  1H95 A;  3M3Y B;  2VNU D;  3PUZ A;  4GNX A;  2FMM A;  3PMF A;  1VQK A;  3QB3 A;  4BBR B;  5E3F A;  4PZ6 A;  2GA4 B;  2JA6 G;  1V43 A;  3PO2 G;  1EYA A;  4OEM B;  1EY7 A;  5LL6 S;  2H4O A;  5FJ8 H;  3Q22 A;  4YHH L;  3NTH A;  1AZP A;  4HSV A;  5C4J H;  4LUV A;  2BCO A;  3UDX A;  1TXY A;  2KEC A;  3MXG A;  1VQH A;  3HOY G;  2HCI A;  3B6Y A;  4KD3 A;  3BDO A;  3F1Z A;  3ND9 A;  5EKK A;  1VQL A;  5F2D A;  4OX9 Q;  1VS0 A;  1NCV A;  4DUY Q;  1RL2 A;  4A93 H;  2CVR A;  1EQV A;  1GUT A;  5IWA L;  5TSS A;  2VZA A;  2K5D A;  5K36 G;  3H94 A;  1TWC B;  1EIF A;  4BY1 B;  2HDM A;  1EYD A;  4A3G B;  4DAY B;  1Y1V G;  2XNA C;  1V9P A;  2XVS A;  3FKI B;  3GTJ B;  1KDC A;  4DF7 A;  3C46 A;  2A6H C;  2P5Z X;  4QB4 A;  2UU9 L;  1HNX Q;  1PH3 A;  4DV2 L;  5DLQ E;  4IFD H;  1PH4 A;  1N33 L;  1IBM Q;  1BQQ T;  4A3D G;  1GJX A;  4HMI A;  3VR2 A;  4H44 C;  4LF8 Q;  2L15 A;  3I4O A;  4JYA Q;  5GAG C;  1S72 A;  1CUK A;  2K5W A;  4HSP A;  2NZH A;  4DV5 Q;  1YI2 A;  2DJF C;  1ET6 A;  1RJT A;  4OO1 I;  1UE7 A;  1SYG A;  1H9S A;  1VQJ A;  1KAW A;  1OTC A;  1QNU A;  3ERS X;  4RAU C;  3PCO B;  1HA5 A;  1WTW A;  1JOO A;  1PTO D;  4DR1 Q;  4WJ4 A;  4KI0 A;  3HOV H;  3GD7 A;  4PZ7 A;  4KN7 C;  1X9N A;  1WYD A;  3S2D B;  1ET9 A;  2JJQ A;  4HN7 A;  4IUR A;  3DXJ C;  4WJW A;  3M4P A;  1PFS A;  2K5Q A;  1WTO A;  5CBA E;  1XPO A;  2F0W A;  2IPK D;  5IYD H;  1OO9 B;  1F2Y A;  4OWT B;  5JEA G;  4WRD A;  3CXC A;  1HR0 Q;  5G3L D;  4DNI A;  4JVZ A;  4I7Z C;  1PZJ D;  2IX0 A;  3OSO A;  3F2C A;  5HGT A;  4TQU S;  5C5L A;  4GNX B;  1SRU A;  5EGT A;  1LLR D;  1LT3 D;  1WTP A;  3BU2 A;  4KY5 A;  4JI0 L;  2ZJQ A;  1CZW A;  1FGB D;  1RKN A;  3HKZ E;  1KAA A;  1QVF A;  2F0N A;  3PSI A;  1MJE A;  4LF5 Q;  1IZ6 A;  1VCI A;  3CW2 C;  5LMU L;  1VQ6 A;  3T1H Q;  2N55 A;  2RVL A;  1L1O C;  3A7L A;  4X6A H;  3I70 A;  3OYY A;  3J81 c;  4NP5 A;  1UWV A;  3G7L A;  5CV9 A;  3RZO B;  4XQJ A;  1ML0 D;  1O78 A;  1I3Q B;  2L55 A;  2MJ8 A;  2AMC B;  1J8I A;  1Q7Y C;  4YHH Q;  1FL0 A;  4K6L A;  1TY0 A;  5J3B A;  1DOL A;  4MNO A;  1JR0 D;  2QKI C;  4IFD I;  2JA9 A;  4G4K A;  2AQ3 B;  1OXX K;  2ASB A;  1JQY D;  1TT2 A;  2SNM A;  3NBI A;  4OWX B;  4EX5 A;  3RLF A;  1SAP A;  5EPK A;  1TS2 A;  1EYC A;  1R9T H;  3UI2 A;  3HOZ B;  1UE6 A;  1QE6 A;  3A74 A;  4RCO A;  1I5F A;  4ME3 A;  3K7A H;  3SDZ A;  4A76 A;  1I6H H;  2WP8 J;  3KLS A;  5FO8 B;  2VQE Q;  1H9S B;  2F0P A;  1II3 A;  2OWO A;  2D2C C;  2ZM6 Q;  3HOX G;  1JJ2 A;  2R3Z A;  3PIO A;  1S40 A;  1SFO H;  1G29 1;  2UU9 Q;  2CW0 C;  1CHQ D;  1WTV A;  1NNX A;  5HUR A;  1K83 H;  4IO9 A;  1HNZ L;  5H1S E;  1GUW A;  2RCN A;  1RTN A;  2AWO A;  2RBM A;  3I4N H;  1AE2 A;  4DAM A;  3GTP B;  4R1J A;  3T53 B;  3CRK C;  4QUF A;  5GAH C;  3BG3 A;  3M7N A;  3MFY A;  3Q23 A;  3CF5 A;  1AZQ A;  3CPF A;  1J9O A;  1CA5 A;  1GUO A;  3WOF A;  2EOT A;  4JI8 L;  4HJ8 A;  1LT5 D;  4C1N I;  2XSC A;  1VQD A;  5A2Q E;  4A3F G;  3M4Q A;  4A3B B;  4G7Z C;  1SE2 A;  4CJ2 C;  2E2I B;  1FNU A;  4FXK C;  2VB3 X;  2ZTC A;  4EQO A;  4MZ9 A;  5COY A;  2JA8 B;  4BA2 I;  3AQQ A;  5M5W B;  5M5Y B;  2IHF A;  1XMO L;  2MUY A;  3A5Z B;  1O7Z A;  3U50 C;  4C1N K;  3HKS A;  5IGG A;  4LMQ D;  3C1F A;  4A3K G;  2ZJR A;  4TVA B;  1J5E L;  1WTQ A;  1H9M A;  1QIL A;  3PV0 A;  1X3G A;  1AE3 A;  3MAQ A;  4QQB X;  2KCM A;  3HGB A;  5IP9 G;  3P7J A;  1EFW A;  3NTK A;  1PTO F;  3NTI A;  3S9W A;  2IX3 A;  2EPB A;  2J7Z A;  1KRT A;  2N8N A;  2D9U A;  2JA6 B;  3PO2 B;  1HQM C;  2FMC A;  5COR A;  5LMU Q;  4HCE A;  1K28 A;  4ZYS A;  4RCN A;  2PMZ E;  1FD7 D;  1SYC A;  3AYH B;  2O4X A;  2EVB A;  4KKU A;  3TP8 A;  3HOY B;  1PHJ A;  3DHQ A;  4BY7 H;  2KHJ A;  2WFW A;  1A3U A;  4ZK9 B;  3FPP A;  2E8G A;  4HJ5 A;  2R92 H;  4DAV A;  2B39 A;  4YCW A;  4APV A;  1OXS C;  4DK0 A;  1YHB A;  1MD2 D;  4QGU A;  1Q90 A;  5ELF A;  5G3L F;  4DAP A;  1D2B A;  3I55 A;  4B3M Q;  3U9O A;  1VQG A;  1XNQ L;  1Y1V B;  2NN6 I;  4NB3 A;  4KHZ A;  1PTO B;  1CZG A;  2XRQ D;  3BVM A;  1D5M C;  1Z6H A;  2E2H H;  1TWF H;  3CCQ A;  2DNE A;  4A3E G;  5IGF A;  5GQO A;  2B2T A;  3R3O A;  4A3I H;  2YTY A;  3LNN A;  3WOE A;  3MXN A;  4CHT B;  1I4Q A;  5FLM H;  1MI2 A;  3GTQ H;  1SN8 A;  1HHV A;  2NUC A;  1PYW D;  1S4Z A;  2RSO A;  4JI6 L;  1IBK Q;  2NVX B;  3FMC A;  3F2U A;  1ICF B;  4DR5 L;  1SNO A;  1AW7 A;  5HY6 A;  3EIV A;  4DV1 Q;  1HZC A;  4A4I A;  5IYB G;  2VW9 A;  4LFC Q;  3ULP A;  1SE4 A;  3OHX C;  2NVY B;  1E3P A;  2PMZ B;  2VUM G;  4F88 A;  3ULL A;  1U4R A;  4DN4 M;  3S1Q H;  1DD2 A;  2MQH A;  1HNZ Q;  4BY1 G;  2ZJP A;  1B2T A;  2SNS A;  4A3G G;  3WDN A;  3DEP A;  3K6O A;  2I07 B;  3STB D;  3M7G A;  2ALY B;  3FKI G;  2K7V A;  2NVQ B;  5EBD A;  4I65 A;  2XTI A;  1IW7 D;  3CQZ B;  2RHS B;  3PIO 3;  4RGT A;  2TMP A;  1LT6 D;  5LL6 X;  3N6R A;  4OWW B;  4IQZ A;  3PIP A;  1TWG B;  4JI8 Q;  3X3M A;  3S1M B;  4JG2 A;  4GN3 B;  3S24 A;  4YY3 Q;  4IUT A;  1ILP A;  5IYB H;  3KF8 B;  2YYZ A;  4BBR H;  3OPO A;  5D14 A;  5M3F B;  3H91 A;  1V8Q A;  1SMY D;  3D3R A;  5IOC A;  1XMQ L;  1IBL L;  4B3S Q;  1W2B A;  4MIU A;  4CDC C;  1W3S A;  5IT9 E;  1PMR A;  1Y14 B;  4LWC A;  2L1B A;  1I4R A;  3M4Y A;  4YWL A;  1N9W A;  1M4V A;  4FYD A;  4KN4 C;  3IKJ A;  3A8J E;  1XMO Q;  4J6H A;  1E2Z A;  3K5M A;  2QDB A;  5M3M H;  5JJK A;  3C1E A;  3MZ5 A;  3URY A;  3BS1 A;  3K5O A;  5IYC H;  1VQ9 A;  2ZTD A;  1D5X C;  5CGK A;  2BA0 A;  4FO2 A;  2F0M A;  2KCT A;  1VDZ A;  3UDF A;  1LTB D;  4TKO B;  2B63 H;  5CMD A;  1FNV A;  4QF4 A;  5J1Z A;  2A69 D;  2Y0S E;  2KED A;  2UXC Q;  3A55 A;  1RDP D;  3I56 A;  1O7L A;  1PH2 A;  1SEB D;  1DON A;  1PXU A;  3J80 c;  1DM0 B;  4K5W A;  5CC4 A;  3I7F A;  4ZKC B;  4FF4 A;  1VQF A;  4FNF A;  2IL8 A;  2R7Z G;  1GHK A;  4XQN A;  3HRZ C;  3RD4 A;  2WB1 E;  3SVM A;  5C3E G;  2JA7 H;  1E2V A;  1Y1W G;  3CHB D;  3MC0 B;  5K5P A;  3R8B A;  4A3L G;  4CJ1 B;  4MHE A;  3I91 A;  3CCL A;  3E9I A;  1EOT A;  3RUZ A;  1STB A;  2KQ3 A;  1SBB B;  1JB3 A;  1LTS D;  1XNQ Q;  4E6I A;  2B8G A;  3HOX B;  3CME A;  3HOW B;  5EBC A;  5DM7 3;  4R4T A;  2AUK A;  3I4M G;  2OQ0 A;  3KK7 A;  3GTO H;  2CWP A;  3NEN A;  2Z9H A;  1HNW Q;  3NPP A;  2OF1 A;  1DCZ A;  4R8N A;  2EYM A;  5JJL A;  3BYY B;  4JI6 Q;  3E6Z X;  1Z47 A;  4DR5 Q;  2IHE A;  5I2Y A;  1D7Q A;  2Q2H A;  1U5K A;  4OL7 A;  4Y52 H;  2WAQ E;  2YV5 A;  2R93 H;  4JI4 L;  2B2W C;  1PH9 A;  2NTT A;  2FXQ A;  5C44 G;  2Y0S B;  1V1P B;  4XQQ A;  3K58 A;  4DU9 A;  4LFA L;  3NQI A;  2A6H D;  2I5L X;  2N78 A;  2EY5 A;  3NQT A;  4OO1 G;  4XT3 B;  2F3V A;  4DR3 L;  3S16 B;  1HUM A;  2RDH A;  4X62 L;  5C4X B;  1VF5 C;  1IW7 C;  2EXZ A;  2F4V L;  2PZU A;  4A3F B;  3HKZ G;  2N88 A;  4LFB L;  2EJF C;  2K14 A;  4DAY A;  4H0L C;  5ELE A;  2FJ2 A;  3ER0 A;  5CV5 A;  1KHI A;  5FK9 C;  2M2L A;  4GLX A;  4BWG B;  1IYU A;  2K5V A;  1TWH B;  3D6W A;  4CKE A;  1XYI A;  2YU9 B;  4YCU A;  1NBW A;  1CTM A;  3OWE B;  4R9W A;  1GM5 A;  4ME5 A;  1XMQ Q;  2QDL A;  5LHY 1;  3UE0 A;  1IBL Q;  3GTK H;  1I3Q H;  3ONA B;  2ZTE A;  4DR4 L;  3IFT A;  4N9P A;  1W6K A;  4RHS A;  1QB5 D;  2E2J B;  4AIM A;  1PYB A;  1N8R C;  2WAQ B;  4LF6 Q;  4ZLT F;  1BVS A;  2VB2 X;  4R4O A;  4YCV A;  2K1B A;  3NWS A;  3RN5 A;  3HOZ H;  2A69 C;  1X3F A;  2PO4 A;  3OMG A;  2KCN A;  1SND A;  1EFI D;  2PI2 E;  1OXT A;  1ZKO A;  5DNF A;  1YBY A;  4LJZ C;  3RR5 A;  3MEH A;  2UUC Q;  3CRL C;  3HG9 A;  3JAM c;  2JA8 G;  3KF6 B;  3GP7 A;  3PQI A;  3CPW A;  1YZ6 A;  2HDL A;  2MO1 A;  4B9X A;  1YHA A;  2B2V C;  1WTX A;  4RGN A;  1BBX C;  2HHH Q;  4DXF A;  1XXG A;  1G2S A;  1B70 B;  4A3E B;  1QUQ B;  1JC7 A;  3NEM A;  3H6M A;  3PUX A;  1G91 A;  3G71 A;  1Q86 C;  4ABN A;  5BN4 A;  1VQ4 A;  1CI3 M;  4ZRZ A;  5IP7 G;  4NXM Q;  4KHP L;  1I94 L;  3P20 A;  1RF2 D;  2AHO B;  3HOU H;  2NZO A;  2NZ1 D;  1HUN A;  4CDF C;  4L8J A;  1LTL A;  2NB0 A;  4A3C H;  3OIQ A;  4PNY A;  3NK9 A;  2B2Y C;  2LMC B;  5AJ3 L;  3VR3 A;  4JV5 Q;  1WCM H;  2VUM B;  3K80 C;  2ZT9 C;  3SR1 A;  1VQO A;  3BZC A;  5FO7 B;  5C4H A;  3A56 A;  5C3X A;  2G9D A;  2RF4 A;  3D6C A;  3M4O H;  4C3J H;  4KLK A;  5JJZ A;  3K5L A;  1EZ6 A;  2HIX A;  4CKB A;  5M9O A;  4A3B H;  4Y7N B;  2XIW A;  3F2D A;  1NR4 A;  1V1Q A;  2F0S A;  5I4D A;  1IKL A;  3TZU A;  1GUG A;  1CSQ A;  2A68 C;  1A0I A;  4BXX H;  2K32 A;  2K5N A;  4LFA Q;  1JCK B;  1EEI D;  3E0E A;  4NPS A;  1HA6 A;  2MNA A;  5CV8 A;  1K0R A;  2CW0 D;  5DM6 3;  1TVX A;  1E7Z A;  4HJ7 A;  2HQL A;  4X62 Q;  4KV6 A;  4RFB A;  5ELN A;  2F4V Q;  5JVH 3;  4LFB Q;  4JI2 L;  1GKH A;  2B2U A;  1P8L A;  1XJV A;  2F0J A;  4DR2 L;  1TS5 A;  4FF3 A;  2JA6 H;  3PO2 H;  1FNW A;  1UAP A;  1B3A A;  1G6P A;  4DV0 L;  3V96 A;  4IZ8 A;  3HOY H;  4L5T A;  3CCM A;  1F9S A;  2C35 B;  4K2L A;  4C56 C;  2F03 A;  5IIF A;  4DNT B;  4KMU C;  3J7Z C;  4IUP A;  1DOM A;  3KJO A;  4BBS G;  1B7Y B;  1PLF A;  2ICI A;  3MHB A;  4KKS A;  5FLX L;  2C5C A;  2PPB C;  5K36 H;  4JI5 L;  4DR4 Q;  1K73 C;  1EWI A;  1OXV A;  4P73 A;  1PH6 A;  2WKD A;  4HTH A;  4AYB E;  4BA1 I;  3TS0 A;  1SNP A;  1LAB A;  3I72 A;  1JE4 A;  4H7B A;  4FVM A;  4QMG A;  3UDG A;  5IOD A;  3H3V H;  2WIN B;  5JVG 3;  3G6J B;  4DK3 C;  1X56 A;  5GAE C;  1CSP A;  1PH1 A;  2FHT A;  1FJG Q;  2DY8 A;  1HRJ A;  1EEF D;  1QCB D;  5M3F G;  2R7Z B;  5C3E B;  2F0U A;  2A5H A;  2F0K A;  4A3D H;  1EY5 A;  1Y1W B;  2ICE C;  1IXR A;  2CH4 A;  1A3T A;  1A63 A;  2UUA L;  2KEN A;  4JI3 L;  4LNQ A;  3CC7 A;  5I6W A;  4B08 A;  1MBY A;  5EAY A;  2MHV A;  2NVX H;  2K01 A;  3T4A C;  5BN5 A;  2I46 A;  3ERO A;  5GAD C;  2I5H A;  4KY7 A;  3ZYY X;  3K81 C;  4UY8 C;  1B3Q A;  1C8C A;  1BDO A;  4C2M B;  1Q81 C;  1CKN B;  3CD6 A;  1F2L A;  5CV7 A;  2PNH A;  2QCP X;  2RKS A;  1Y8O B;  3I4M B;  3KLR A;  1TWA B;  1SYE A;  1G51 A;  2K50 A;  4HID A;  4KHV A;  1JB7 A;  2NVT H;  2EZV A;  1F2Z A;  2MP1 A;  4IN3 A;  1KNE A;  1I94 Q;  2NN6 G;  3S17 H;  2XWB B;  2K52 A;  2YTV A;  3HEJ A;  4L63 B;  1VQI A;  5T1I A;  5JEA H;  4L6T B;  4XT1 B;  4DV3 L;  3LWU A;  2AUJ D;  4XTC S;  3SEB A;  5C44 B;  2IWH A;  5BR8 L;  1PRT D;  4C3H B;  4L5Q A;  4POG A;  5IWA Q;  1WI5 A;  4JI1 L;  2Q8T A;  3AEV A;  3ZJY C;  1L0W A;  1KDB A;  5ELD A;  1ZEQ X;  1KRS A;  2D5D A;  2PQA B;  2F0Q A;  3TZD A;  5KRU A;  1KL9 A;  1L0Y B;  4G57 A;  4IUV A;  2A6E D;  1I6V C;  2J4X A;  1VQ7 A;  1C4Q A;  4IFD J;  3HKZ B;  2F0D A;  2MO0 A;  1LT4 D;  5JPM C;  3HOW G;  2JE6 I;  1IYV A;  2F3W A;  3UE1 A;  3SE0 A;  1EU4 A;  1MKH A;  3L3O C;  1D6E C;  5C5M A;  4DV2 Q;  1N33 Q;  4QIW E;  4GKJ L;  1G2T A;  1BNZ A;  1JT8 A;  1K3B C;  1YVC A;  4X3U A;  3I8Z A;  4A3M B;  4DGZ A;  2FIN B;  3L2P A;  2RA4 A;  5IGC A;  4P71 A;  3KOJ A;  3VR4 A;  1EL0 A;  2X6L A;  4IOC A;  2SEB D;  1WJJ A;  3LGJ A;  4JI2 Q;  1GUS A;  4JBM A;  4DV7 L;  3GTM H;  2PW7 A;  5C4Z A;  2UXD L;  4GOP C;  4DR2 Q;  3H3V I;  4KJO A;  1HCZ A;  2Y0S G;  4FXG C;  3KLW A;  2E2D C;  3BDL A;  2BE5 D;  1NTG A;  4HJA A;  1R4P B;  3TP7 A;  4IPD A;  1NJI C;  4DV0 Q;  3NWT A;  4O0A A;  1YHQ A;  3SXH A;  1N34 L;  4O42 A;  3OIP A;  1M1K C;  1VF7 A;  3S2H H;  1JWM D;  3P1H A;  2WB1 G;  4A3J G;  5ELB A;  5C4X G;  1BBU A;  3K0Y A;  1FGU A;  2EY6 A;  5C4J B;  1L1O B;  1BBW A;  1STG A;  1PV4 A;  3SK8 A;  4F7X A;  1C0A A;  3W1G A;  1B4O A;  4HED A;  3A8K E;  4AH6 A;  1UNS A;  3V05 A;  3OTO L;  4JI5 Q;  1MJC A;  2PW5 A;  3I3C A;  2Q8R E;  4A93 B;  1ASY A;  1WVL A;  4GN4 B;  1EY6 A;  2E5L L;  1B50 A;  4CJ0 B;  1AN8 A;  3K57 A;  4HIO A;  5L37 A;  4LF7 L;  1KD1 C;  3M9B A;  1PDQ A;  2Z0S A;  3T1Y L;  2JA5 G;  4JI0 Q;  3A54 A;  4AQY L;  2V1C C;  1MHW C;  3KF8 A;  1UEB A;  4ZCK A;  2F4I A;  2JEA I;  1SE8 A;  4RA8 A;  1GXD C;  1TR5 A;  4X66 L;  4IUU A;  1HFN A;  4JI3 Q;  1SR3 A;  1ENC A;  3G6E A;  3OW2 A;  2WAQ G;  5E4W C;  4JI7 L;  4DNR B;  3J81 L;  3BYT B;  1LTA D;  3TP6 A;  5D3I B;  5KNB A;  1K8M A;  1LM0 A;  2AQ2 B;  3S14 B;  4RHR A;  4EQ5 A;  1EIG A;  3OW7 A;  2RHQ B;  2DN8 A;  1IL8 A;  4CBV A;  1VMP A;  2EDG A;  4JOI A;  5JEA J;  3DM3 A;  2CWA A;  1SYD A;  1YJN A;  2H1E A;  4FF1 A;  1PRT C;  1Y69 U;  4GOP B;  2XN9 C;  2EY1 A;  1QOH A;  2HUG A;  4QJF A;  5KEE A;  1BO0 A;  4X3T A;  5BR8 Q;  5BN3 A;  3RLO A;  3D8G A;  3TRZ A;  1MSH A;  3U58 A;  3RZD H;  4GKK L;  4DR6 L;  4PQX A;  1NY4 A;  1XWE A;  3GO5 A;  2YU9 H;  2EE1 A;  4M1U B;  2A6E C;  4Z9C B;  5NUC A;  5KNC A;  4A3K H;  5E7N A;  2I5M X;  3PO3 H;  1QZG A;  3GDE A;  3BJU A;  4DA2 A;  1XNR L;  2F0H A;  5CBE E;  4IAL A;  4LUO A;  2D0P A;  3PUV A;  2KBN A;  4J8Q A;  5CV4 A;  4S3S A;  4YWK A;  2BH2 A;  2EQS A;  2MPM A;  4DUZ L;  4DV4 L;  1E1T A;  1O80 A;  4LK1 C;  4H02 A;  1SSO A;  3C2P A;  2N49 A;  1C9O A;  2F0O A;  4K0K L;  5EKL A;  2HQE A;  3CP0 A;  1E24 A;  2UXD Q;  1T5X D;  5M3M G;  3G4S A;  2BE5 C;  3O13 A;  3SHL A;  1YNX A;  1BCP C;  2CQO A;  2JSO A;  2VS1 A;  4BBS B;  2K6A A;  5FOB B;  5IY0 A;  1QVC A;  1V1P A;  1N34 Q;  1KNA A;  3M85 A;  1UUP A;  2JK8 A;  3M3Y H;  1TS3 A;  2R6G A;  4C3I G;  5ELC A;  1ICW A;  2ZXP A;  3KFU A;  4KY6 A;  4B3R L;  5KND A;  1ROD A;  4N9T A;  4QY7 A;  1ASZ A;  1KQS A;  2RDG A;  5JJI A;  1STH A;  2Q2I A;  2UUB L;  4IUQ A;  5EQ0 A;  4R4Q A;  3MXU A;  1K0S A;  2CHB D;  3K5N A;  3AFP A;  3K7A B;  2QF7 A;  4LF7 Q;  5IGB A;  1I6H B;  5FLX E;  1J5E Q;  3OWF A;  1Y8P B;  3T1Y Q;  2PZW A;  5IGD A;  4IOA A;  3V2T A;  1IKM A;  3MA2 B;  3T16 A;  1N32 L;  4X66 Q;  1SFO B;  1TWC H;  4BY1 H;  4DK6 C;  2R7F A;  2XWJ B;  1VQ8 A;  4A3G H;  1Z7T A;  1ZXT A;  4Y7N H;  4JI7 Q;  3FKI H;  3E0J A;  3GTJ H;  1VQB A;  2FFK B;  4HCS A;  4JCV E;  1PYS B;  1SYF A;  2A73 B;  1Q1E A;  3I4N B;  3I2Z A;  4HIM A;  3H0G G;  3QJY A;  4L5S A;  3GTL B;  2Z6K A;  3GV3 A;  1WTR A;  1F9P A;  4CGY B;  3FHW A;  2N3S A;  2NYZ D;  4JBJ A;  2Q2T A;  2NBF A;  3NBH B;  5IE8 A;  2Z8L A;  1EUJ A;  1RHP A;  3KF6 A;  1N36 L;  2L0C A;  5KYL A;  3DWA A;  4UP9 A;  1SE3 A;  4K8I A;  1BOS A;  2V4D A;  5I9O A;  2B2W A;  1FR3 A;  4XDX A;  3S2D H;  3HZX A;  4DR6 Q;  4KJN A;  1SJE D;  1I4X A;  3GTG B;  1VQ5 A;  1S5D D;  1QUQ A;  1NR2 A;  1Y8N B;  5DEH A;  3CCR A;  2QIL A;  1K8A C;  1X65 A;  3J7A V;  3VR6 A;  1I4H A;  2QW7 A;  1ILQ A;  5I6Y A;  5FKA C;  1S5F D;  1EYG A;  1X6O A;  3AB9 A;  1EQT A;  2A19 A;  4JBK A;  2ZXR A;  3KUP A;  2ATW A;  3D4W A;  4AYB G;  4ZKB B;  4R8I A;  4DUY L;  3KBX A;  4C3H G;  1FYC A;  5C6A A;  2Q2U A;  4DV4 Q;  2A68 D;  3J81 i;  2AKW B;  3RNU A;  2XGT A;  1BKB A;  4KD4 A;  3D4R A;  4K0K Q;  1HQR D;  2HD3 A;  5JOB A;  5M5X B;  2WB1 B;  2R7Z H;  5C3E H;  5EJW A;  4A3J B;  4A3L H;  1GO3 E;  1JMC A;  4FDB A;  1HFG A;  1I4G A;  2OXP A;  4BY7 B;  2A74 C;  1B9N A;  4UHV A;  3S1R B;  3MFG A;  1D8L A;  1HZA A;  4WOR A;  1HNX L;  3P75 A;  2L9H A;  5CR3 A;  1CQV A;  3D4D A;  3J7A 5;  2R92 B;  4XIG S;  4A3M G;  4B3T L;  1HZ9 A;  1RCV D;  3NE5 B;  4P75 A;  2ZXO A;  4FF2 A;  4JYA L;  2EJG C;  5EPJ A;  1HPC A;  2EY2 A;  1SYB A;  3K7U C;  3CAM A;  2R7D A;  3EFX D;  2O2L D;  3I4M H;  1DOK A;  4J15 A;  3RZO H;  3BDC A;  3ULJ A;  2JA5 B;  2K03 A;  3PF5 A;  4DR1 L;  3CCU A;  2E2H B;  5ISR A;  1TWF B;  1CKM A;  1D1K A;  1S5C D;  4KK7 A;  2UUB Q;  4H13 C;  2IY5 B;  1Q3L A;  1DZ1 A;  2HCC A;  1B8A A;  4JW0 A;  2WKC A;  1EQR A;  5FJ8 G;  1TU2 B;  1TII D;  3GTQ B;  4IJL A;  3EBE A;  3U4Z A;  1PH8 A;  3LWE A;  2BH8 A;  1KXL A;  5IT9 c;  4OIK A;  3WWV A;  3HOU G;  1ZYR C;  1HR0 L;  3D0F A;  4EQN A;  4CKC A;  1EU3 A;  1FVI A;  5CV6 A;  2M9V A;  3J80 L;  4OO1 H;  1X3E A;  2CH4 W;  4A93 G;  2UXB L;  4GLA C;  1STN A;  1KLG D;  4G7H C;  1F2M A;  1DXM A;  1RIP A;  4P74 A;  4RG1 A;  3S1Q B;  4NDX A;  3GV6 A;  4POF A;  4IPH A;  1SNQ A;  1LV9 A;  2F3I A;  2L12 A;  3AFQ A;  4CDD C;  3RMH A;  4JPB W;  3I73 A;  4HJ9 A;  1T9H A;  4ZUI A;  1A15 A;  1QNK A;  3GQB A;  1H9K A;  2M00 A;  1I50 B;  4LF5 L;  4IFD G;  1PFN A;  1GHJ A;  1EY9 A;  3KDF A;  1N36 Q;  1UE1 A;  3E3X A;  1L2F A;  3T1H L;  2OCE A;  3U9S A;  3GTP H;  1CFM A;  1SXT A;  1NUC A;  1PH7 A;  5C0X H;  2IW3 A;  2DY7 A;  1O7I A;  2CFM A;  3CC2 A;  1HTP A;  1SNM A;  5T1G A;  1CKN A;  1U0L A;  1IHZ A;  4K14 A;  1G6Z A;  5AFW A;  4X65 L;  3W5O A;  3HOV G;  2KOL A;  4NW2 A;  1LO5 D;  1KTK A;  4I7A A;  4K2K A;  4OEL B;  2F1M A;  2DGY A;  1G8Z D;  2YTX A;  4DV6 L;  2PZT A;  4GNX C;  1X3P A;  2JYO A;  2OQK A;  2C9O A;  5M3M B;  2E2I H;  4JI4 Q;  5HGQ A;  3PF4 A;  1A62 A;  4F87 A;  2K28 A;  1Q46 A;  1WFQ A;  4K5V A;  4TSS A;  5IYD G;  1AP0 A;  2JA8 H;  1F9R A;  2D0O A;  1PVO A;  3TBI B;  3KYH C;  2LFN A;  5M5W H;  5M5Y H;  3FP9 A;  2B63 B;  2F0T A;  5D65 A;  1SNC A;  2VQE L;  4DR3 Q;  1E2W A;  4C3I B;  4Q5V A;  4OGQ C;  2ZM6 L;  1SDF A;  2PQA A;  1HR0 W;  1STE A;  1A2U A;  1JOR A;  3F8T A;  1F9Q A;  3CU7 A;  4N8F A;  2OTL A;  1NMF A;  2JA7 B;  5IP7 H;  1CK1 A;  1ENF A;  4B3T Q;  2KVM A;  3FRP B;  1S5E D;  2VQF L;  1VQN A;  3TDQ A;  1D5Z C;  1XTC D;  4NKL A;  3EQL C;  4GN5 A;  3S14 H;  1QVG A;  1C48 A;  3RN2 A;  1QG7 A;  1T5E A;  3MVV A;  1HTL D;  4L5R C;  1YEZ A;  1EIY B;  3MXP A;  1S5B D;  4U68 A;  1ONL A;  3S1N B;  2KHS A;  1OXU A;  1QZH A;  3JC6 6;  3CCS A;  2AQ1 B;  1QWY A;  4HMJ A;  1KC8 C;  4PZ8 A;  1PA6 A;  1Z9F A;  4XYQ A;  1Y1V H;  3GTO B;  2IT1 A;  4DK1 A;  2E74 C;  5IT9 L;  2EJM A;  1PTO H;  1WD0 A;  2EYF A;  2B2U C;  1PZI D;  3TN2 A;  3DMU A;  1LUZ A;  1PZK D;  2L4N A;  4BBR G;  2HT1 A;  4IPC A;  2I0Q A;  3JAM L;  2SDF A;  2WII B;  2GN5 A;  3H0G B;  1L1O A;  2R93 B;  2A1A A;  1U4L A;  4UP7 A;  4YIJ A;  2DJG C;  2PQE A;  3KDF B;  4MTN A;  1AEX A;  5C0X I;  2UXB Q;  3U4V A;  1E0B A;  1PFB A;  1SJH D;  4NXN L;  5E1F A;  5ELO A;  4RGM A;  2NVY H;  2MFI A;  3DM1 A;  3I90 A;  3NUC A;  2ES2 A;  2F0L A;  1A6X A;  1M8A A;  2RQX A;  5KIX A;  1L0X B;  5GRO A;  2KUM A;  2OT2 A;  1B9M A;  1BUV T;  4KHP Q;  3NSW A;  4HIK A;  5C0X J;  3I4L A;  2NVQ H;  1O7Y A;  4BBS H;  3CQZ H;  5I9P A;  1D1I A;  5DAU A;  3I4N G;  2AWN A;  2MGS A;  4AYB B;  5AJ3 Q;  1STY A;  1YNN D;  1X3Q A;  2EYL A;  2VXW A;  4QL5 A;  3GTK B;  1TWG H;  1X55 A;  4X65 Q;  3S1M H;  3S15 B;  1E22 A;  3ND8 A;  3BZK A;  4DV6 Q;  4RH6 A;  5M3F H;  1CA6 A;  4B3M L;  1XX8 A;  3IRB A;  3R93 A;  5CYU A;  4KKT A;  4LAA A;  4PMB A;  1A8V A;  1P16 A;  5JAV A;  1EIH A;  4LUZ A;  1EY8 A;  1MIU A;  2VL6 A;  4P72 A;  4QUC A;  3J80 i;  4O1N A;  2DNC A;  4GOP A;  1BR9 A;  2QA4 A;  1UE5 A;  2EYO A;  4OON A;  4K6D A;  5LMN L;  1M90 C;  2ENB A;  4JC0 A;  1IBK L;  3SGI A;  3FPU B;  3FEW X;  1LTI D;  1Q1B A;  2L5T A;  4DV1 L;  2O5I C;  4LFC L;  4X64 L;  3H15 A;  4TRD A;  1BCP D;  3T56 B;  2NN6 H;  4RKB A;  2VQF Q;  1A2T A;  1NAP A;  3BZD B;  2LXK A;  4JBW A;  3ITP A;  1PTO C;  2F52 A;  4XYO A;  1ESR A;  3Q24 A;  3H3V C;  3R2I A;  3MEF A;  3GTL H;  2KJX A;  1F77 A;  4BY7 G;  3W1B A;  3HOU B;  2QEX A;  4PV1 C;  3RLN A;  5J39 A;  2R92 G;  3DWP A;  1WCM B;  4LF4 L;  4IJH A;  3HOX H;  1EZ8 A;  4HAE A;  3HOW H;  4YY3 L;  3KLS X;  3M4O B;  2JXM B;  1KLU D;  1TS4 A;  2X69 A;  4C3J B;  4QIW B;  5EPL A;  4G7O C;  3TQY A;  2CKZ B;  1SLJ A;  3FVQ A;  4ZAI A;  1GUN A;  4B3S L;  3GTG H;  4R4I A;  2QGQ A;  3QOJ A;  2LKV A;  2GVB A;  4DFA A;  2UUA Q;  4M8A A;  1DYQ A;  1XTD A;  4IUN A;  3QWN A;  1JIC A;  2CCZ A;  4A3I G;  1PH5 A;  3NXW A;  4UAI A;  2ID0 A;  5J22 A;  5FLM G;  3EA6 A;  4NXN Q;  2OTJ A;  3A5U A;  3PO3 G;  4U67 3;  2XRS D;  2CQA A;  3J80 E;  1MGS A;  3VDY A;  1U4P A;  2B3G A;  5LMN W;  1KDA A;  2BDN A;  1BXT A;  1CHP D;  4KTA A;  2H5X A;  5M5X H;  1EY4 A;  3S16 H;  3HOV B;  3QG1 A;  3KBG A;  4A3J H;  5C4X H;  4K8J A;  2UXC L;  1YIT A;  3CKI B;  1HJP A;  1MSG A;  4WJ3 M;  3QOL A;  4R4C A;  4A3F H;  3J7A F;  3VA5 A;  2L11 A;  3HP3 A;  5C3W A;  4LW1 A;  3S1R H;  3SK5 A;  3NHH A;  4DV3 Q;  1JJC B;  1YNN C;  4ALP A;  5KYI A;  3T13 A;  4DKA C;  2Z4H A;  4CDE C;  4ZUJ A;  1C7Y A;  1JOQ A;  1Q8I A;  4JI1 Q;  1TWH H;  2K05 A;  1TY2 A;  2WAC A;  3K8A A;  3CC4 A;  3JAM i;  3NBH A;  2JA5 H;  2JP1 A;  2BOS A;  1ENA A;  5IP9 H;  2J0T D;  1E1O A;  1QJO A;  2LS0 1;  4UPA A;  1JJG A;  2PNR C;  2NTS A;  1LAC A;  1SRO A;  4HR7 B;  4OIJ A; 
#chains in the Genus database with same CATH homology
 4ME3 A;  1EYG A;  4C3J H;  4KLK A;  1X6O A;  3K7A H;  2E2J H;  2A19 A;  2HIX A;  4JOI C;  4JBK A;  4A3B H;  4GKJ Q;  4A76 A;  1I6H H;  2WP8 J;  5LMN Q;  2VQE Q;  2ATW A;  1YJW A;  4AYB G;  4DUY L;  1HNW L;  3F2D A;  1V1Q A;  2Q2U A;  2OWO A;  2ZM6 Q;  1CSQ A;  4DV4 Q;  1A0I A;  3J81 i;  2AKW B;  3HOX G;  1JJ2 A;  4BXX H;  2K5N A;  2LXJ A;  3RNU A;  4LFA Q;  3PIO A;  1S40 A;  2XGT A;  1SFO H;  2B29 A;  1BKB A;  1G29 1;  4DV7 Q;  3E0E A;  4NPS A;  2UU9 Q;  1JE5 A;  4K0K Q;  4PMW A;  2MNA A;  1X54 A;  3ICE A;  2R7Z H;  1K0R A;  5C3E H;  1WOC A;  5IYC G;  1K8G A;  1YJ9 A;  4A3L H;  1E7Z A;  1GO3 E;  4HJ7 A;  2HQL A;  4X62 Q;  4FDB A;  4X64 Q;  1Q82 C;  1JMC A;  1K83 H;  5ELN A;  2F4V Q;  4IO9 A;  2B63 G;  1HNZ L;  4LFB Q;  5H1S E;  1GKH A;  2RCN A;  4JI2 L;  1D8L A;  1HZA A;  1HNX L;  1P8L A;  2AWO A;  3KJP A;  1XJV A;  4DR2 L;  3I4N H;  3J7A 5;  1J6Q A;  2JA6 H;  2BA1 A;  4XIG S;  3PO2 H;  3UDI A;  4A3M G;  4B3T L;  1HZ9 A;  4P75 A;  1NMG A;  4JYA L;  1AE2 A;  3CCE A;  4DAM A;  1G6P A;  4A3E H;  4DV0 L;  4R1J A;  3HOY H;  4L5T A;  1VQA A;  3K7U C;  3CCM A;  5GAH C;  3TRE A;  3CAM A;  2R7D A;  3OTO Q;  3M7N A;  2C35 B;  3I4M H;  4J15 A;  1I50 H;  3CF5 A;  3RZO H;  3ULJ A;  2JA7 G;  3CPF A;  4JI8 L;  4HJ8 A;  3PF5 A;  2GVA A;  3J7Z C;  4DR1 L;  4LF4 Q;  3CCU A;  2E5L Q;  1CKM A;  1VQD A;  2EXD A;  3KJO A;  4BBS G;  1B7Y B;  3E9H A;  2UUB Q;  4A3F G;  2IY5 B;  3M4Q A;  4JI5 L;  4DR4 Q;  1VQC A;  3G48 A;  1EOV A;  3NEL A;  1EQQ A;  1K73 C;  1B8A A;  2A8V A;  1EWI A;  1OXV A;  4P73 A;  1EQR A;  1PH6 A;  4AYB E;  4BA1 I;  5FJ8 G;  3TS0 A;  2ZTC A;  1S3O A;  4IPG A;  3PGZ A;  4AQY Q;  2VUM H;  4IJL A;  3UDG A;  3EBE A;  3H3V H;  4MZ9 A;  3U4Z A;  1PH8 A;  2BH8 A;  1KXL A;  5IT9 c;  4BA2 I;  4DK3 C;  3AQQ A;  1X56 A;  1K9M C;  5GAE C;  3WWV A;  1CSP A;  1PH1 A;  2IHF A;  1XMO L;  1FJG Q;  3HOU G;  3A5Z B;  2D62 A;  5M3F G;  3D0F A;  1HR0 L;  3U50 C;  4A3D H;  3HKS A;  1FVI A;  4A3K G;  1J5E L;  2ZJR A;  4TVA B;  1X3E A;  4O2D A;  4LF6 L;  4A93 G;  2UXB L;  4LF9 L;  1IXR A;  3PV0 A;  1X3G A;  1AE3 A;  4GLA C;  4QQB X;  4GS3 A;  3L0O A;  2KCM A;  5IP9 G;  1EFW A;  2UUA L;  1RIP A;  4P74 A;  2KEN A;  4RG1 A;  1A63 A;  3EN2 A;  4JI3 L;  1VQP A;  4LNQ A;  3CC7 A;  2NVX H;  5EAY A;  1KRT A;  2N8N A;  4POF A;  5GAD C;  2I5H A;  4IPH A;  4DPG A;  3K81 C;  4UY8 C;  2R93 G;  5LMU Q;  1Q12 A;  4DR7 L;  2F3I A;  3K0X A;  3AFQ A;  1SMX A;  2PMZ E;  1Q81 C;  2UUC L;  1CKN B;  3CD6 A;  3AYH B;  4C3I H;  4HJ9 A;  1PHJ A;  1T9H A;  2PNH A;  4BY7 H;  2KHJ A;  2IX1 A;  2WFW A;  2KHI A;  4LF5 L;  4IFD G;  1XPR A;  4A75 A;  1G51 A;  1CKO A;  2E8G A;  2K50 A;  4HID A;  4HJ5 A;  2R92 H;  4YCW A;  4APV A;  1JB7 A;  3KDF A;  2NVT H;  1N36 Q;  1OXS C;  1UE1 A;  1YHB A;  2HHH L;  1L2F A;  4QGU A;  3T1H L;  2OCE A;  1I94 Q;  3GTP H;  2NN6 G;  3S17 H;  3MXN B;  1PH7 A;  2K52 A;  2YTV A;  4GKK Q;  1VQI A;  1O7I A;  2CFM A;  3CC2 A;  3PUY A;  3I55 A;  4B3M Q;  1CKN A;  1U0L A;  1VQG A;  4DV3 L;  1XNQ L;  2NN6 I;  4NB3 A;  4KHZ A;  4XTC S;  4NXM L;  5BR8 L;  4X65 L;  3A0J A;  3W5O A;  3HOV G;  4L5Q A;  4POG A;  1GD7 A;  2E2H H;  1TWF H;  3HFZ B;  5IWA Q;  2LSS A;  3CCQ A;  1XNR Q;  1WI5 A;  4JI1 L;  3AEV A;  2DGY A;  3S1N H;  2YTX A;  4A3E G;  1VQM A;  4DV6 L;  2Z6K C;  3L7Z C;  3ZJY C;  1L0W A;  2OQK A;  4GNX C;  5GQO A;  4A3I H;  1KRS A;  2PQA B;  2YTY A;  2E2I H;  5HGQ A;  4JI4 Q;  1A62 A;  1KL9 A;  4OX9 L;  3D31 A;  1Q46 A;  1WFQ A;  3PF4 A;  4DUZ Q;  4JV5 L;  1NE3 A;  5FLM H;  3GTQ H;  5IYD G;  1SN8 A;  1VQ7 A;  4IFD J;  4JI6 L;  2JA8 H;  2MO0 A;  1IBK Q;  2D0O A;  2JE6 I;  3HOW G;  1PVO A;  3KYH C;  3UE1 A;  5M5W H;  5M5Y H;  1MKH A;  3FP9 A;  4DR5 L;  2K4K A;  4DV2 Q;  1N33 Q;  1LYL A;  5HY6 A;  4QIW E;  4GKJ L;  1YIJ A;  1JT8 A;  3EIV A;  1YVC A;  1HZC A;  4DV1 Q;  1Y1W H;  4A4I A;  3H0G H;  4YWM A;  2VW9 A;  2VQE L;  2K5H A;  4DR3 Q;  3ULP A;  4LFC Q;  3CMA A;  1E3P A;  1VQE A;  2PI2 A;  3L2P A;  2VUM G;  2ZM6 L;  4P71 A;  3ULL A;  3KOJ A;  2PQA A;  1HR0 W;  3HOZ G;  4IOC A;  3S1Q H;  1WJJ A;  2MQH A;  1HNZ Q;  1I5F A;  3F8T A;  2JQO A;  3LGJ A;  4BY1 G;  4JI2 Q;  2ZJP A;  3J81 j;  4DV7 L;  1IBM L;  4OXP A;  4JBM A;  3GTM H;  2UXD L;  1HH2 P;  4RMF A;  4LF8 L;  2OTL A;  4GOP C;  4DR2 Q;  1NMF A;  3STB C;  3H3V I;  4A3G G;  5IP7 H;  3STB D;  4C2M H;  4B3T Q;  2Y0S G;  2ALY B;  3FKI G;  3KLW A;  2HIV A;  4DV5 L;  1NTG A;  4HJA A;  2VQF L;  1VQN A;  4IPD A;  1NJI C;  1HZB A;  1Q8K A;  2XTI A;  4DV0 Q;  4O0A A;  4B3R Q;  4GN5 A;  3S14 H;  1QVG A;  1TWA H;  2RHS B;  3RN2 A;  1YHQ A;  1N34 L;  1M1K C;  3S2H H;  1GVP A;  2WB1 G;  4OWW B;  2DUD A;  1YEZ A;  4A3J G;  1EIY B;  4L5R C;  3PIP A;  4GLV B;  1BBU A;  3TS2 A;  5C4X G;  1FGU A;  4JI8 Q;  1KIX A;  1L1O B;  1IYJ B;  1BBW A;  4GN3 B;  4JG2 A;  3S24 A;  1PV4 A;  1OXU A;  4YY3 Q;  3JC6 6;  3CCS A;  1QZH A;  1C0A A;  1KC8 C;  4PZ8 A;  3W1G A;  1PA6 A;  1Z9F A;  3KF8 B;  2YYZ A;  1DGS A;  4BBR H;  5IYB H;  4AH6 A;  3CCJ A;  3OTO L;  4JI5 Q;  1Y1V H;  1XPU A;  2IT1 A;  2EIF A;  1MJC A;  5C44 H;  4UP8 A;  1XMQ L;  1IBL L;  4B3S Q;  1W2B A;  1ASY A;  1W3S A;  4C3H H;  4LWC A;  1Y14 B;  4GN4 B;  2E5L L;  4YWL A;  3S15 H;  1N9W A;  4PG3 A;  1LUZ A;  1N32 Q;  4HIO A;  2HT1 A;  5C0X G;  4A3C G;  4IPC A;  1XMO Q;  2I0Q A;  4LF7 L;  1KD1 C;  2GN5 A;  3M9B A;  1L1O A;  3Q8D A;  5M3M H;  5JJK A;  2VY3 A;  2A1A A;  2Z0S A;  3T1Y L;  2JA5 G;  1WCM G;  5IYC H;  4UP7 A;  1K3R A;  2ZTD A;  5FLX c;  4AQY L;  1VQ9 A;  4JI0 Q;  2V1C C;  2BA0 A;  1UEB A;  3KDF B;  4MTN A;  5C0X I;  4LF9 Q;  2KCT A;  2JEA I;  3U4V A;  2UXB Q;  1SE8 A;  3UDF A;  4X66 L;  2B63 H;  3CCV A;  4JI3 Q;  1SR3 A;  1FJG L;  1IL2 A;  2JEB I;  4A3B G;  3G6E A;  3OW2 A;  2WAQ G;  4A3M H;  1AH9 A;  4JI7 L;  2Y0S E;  4DR7 Q;  4NXN L;  3F2B A;  5ELO A;  2UXC Q;  2NVY H;  2MFI A;  3I56 A;  2ES2 A;  3PUW A;  1LM0 A;  4BXX G;  1PH2 A;  5GRO A;  3J80 c;  3DLL A;  2K75 A;  3I7F A;  1VQF A;  4EQ5 A;  2R7Z G;  2RHQ B;  3TEH B;  5C3E G;  2WB1 E;  2JA7 H;  4KHP Q;  1Y1W G;  4HIK A;  4A3L G;  1H95 A;  2VNU D;  5C0X J;  2NVQ H;  3PUZ A;  4GNX A;  4JOI A;  5JEA J;  3DM3 A;  3CCL A;  2CWA A;  1VQK A;  3E9I A;  4BBS H;  1YJN A;  3CQZ H;  4PZ6 A;  3I4N G;  2JA6 G;  1V43 A;  3PO2 G;  2AWN A;  1XNQ Q;  5AJ3 Q;  4GOP B;  4QJF A;  5FJ8 H;  4QL5 A;  5BR8 Q;  4YHH L;  1TWG H;  1X55 A;  3RLO A;  4X65 Q;  5C4J H;  4LUV A;  3S1M H;  3TRZ A;  3UDX A;  1TXY A;  3CME A;  3U58 A;  3RZD H;  1E22 A;  1VQH A;  3HOY G;  3BZK A;  4GKK L;  4DR6 L;  4R4T A;  1NY4 A;  3B6Y A;  3GO5 A;  4DV6 Q;  2YU9 H;  4B3M L;  5M3F H;  3I4M G;  2OQ0 A;  3F1Z A;  3GTO H;  1VQL A;  3IRB A;  2CWP A;  3NEN A;  4OX9 Q;  1VS0 A;  4DUY Q;  4A3K H;  1HNW Q;  1RL2 A;  5E7N A;  1A8V A;  1P16 A;  2I5M X;  4A93 H;  3PO3 H;  4LUZ A;  1MIU A;  2VL6 A;  1QZG A;  3GDE A;  4P72 A;  5JJL A;  3J80 i;  3BJU A;  5IWA L;  4JI6 Q;  1XNR L;  2VZA A;  5K36 G;  4GOP A;  4LUO A;  2D0P A;  1Z47 A;  2KBN A;  3PUV A;  4DR5 Q;  3M4O H;  2IHE A;  1EIF A;  1D7Q A;  2Q2H A;  2QA4 A;  1U5K A;  1UE5 A;  4OON A;  4YWK A;  5LMN L;  4Y52 H;  2WAQ E;  2EQS A;  2YV5 A;  1M90 C;  4JI4 L;  2BH2 A;  4DAY B;  1Y1V G;  1PH9 A;  1V9P A;  2FXQ A;  2R93 H;  4DUZ L;  5C44 G;  4DV4 L;  1E1T A;  4JC0 A;  4H02 A;  1IBK L;  3SGI A;  4LFA L;  2N49 A;  1C9O A;  2UU9 L;  1HNX Q;  1PH3 A;  4K0K L;  4DV2 L;  2I5L X;  2N78 A;  5DLQ E;  1PH4 A;  1IBM Q;  1N33 L;  1Q1B A;  3CP0 A;  4A3D G;  1E24 A;  2UXD Q;  4DV1 L;  4LF8 Q;  2L15 A;  4LFC L;  5M3M G;  3I4O A;  3G4S A;  4DR3 L;  4OO1 G;  4JYA Q;  5GAG C;  4X62 L;  1YNX A;  4X64 L;  2CQO A;  3H15 A;  2VS1 A;  1S72 A;  1CUK A;  2F4V L;  3HKZ G;  4LFB L;  2NZH A;  4DV5 Q;  1YI2 A;  2VQF Q;  2K14 A;  5IY0 A;  4OO1 I;  1UE7 A;  1QVC A;  1VQJ A;  2LXK A;  1KAW A;  1OTC A;  1N34 Q;  3ERS X;  3ER0 A;  4JBW A;  3PCO B;  3M85 A;  2F52 A;  2JK8 A;  4DR1 Q;  1KHI A;  4GLX A;  4KI0 A;  3M3Y H;  2R6G A;  3MEF A;  3GTL H;  3HOV H;  4WJ4 A;  2K5V A;  3GD7 A;  4BY7 G;  4PZ7 A;  3W1B A;  2QEX A;  3KFU A;  1X9N A;  1WYD A;  4YCU A;  3RLN A;  4B3R L;  1NBW A;  2JJQ A;  2R92 G;  4QY7 A;  1ASZ A;  3M4P A;  1PFS A;  1KQS A;  1XPO A;  1GM5 A;  4LF4 L;  1XMQ Q;  1IBL Q;  3GTK H;  3UE0 A;  5JJI A;  4IJH A;  1I3Q H;  5IYD H;  2Q2I A;  3HOX H;  2ZTE A;  2UUB L;  3HOW H;  4YY3 L;  4R4Q A;  4OWT B;  4DR4 L;  5JEA G;  3CXC A;  1HR0 Q;  3AFP A;  4AIM A;  3TQY A;  2CKZ B;  4LF7 Q;  1PYB A;  1N8R C;  1SLJ A;  1J5E Q;  4DNI A;  4LF6 Q;  4B3S L;  3GTG H;  4R4I A;  3T1Y Q;  2QGQ A;  1BVS A;  2GVB A;  4R4O A;  2IX0 A;  4IOA A;  4YCV A;  3F2C A;  2UUA Q;  4TQU S;  1XTD A;  3RN5 A;  3HOZ H;  1X3F A;  4GNX B;  1N32 L;  1SRU A;  4X66 Q;  1TWC H;  2PI2 E;  4BY1 H;  4DK6 C;  1OXT A;  2R7F A;  4A3I G;  1PH5 A;  1VQ8 A;  2CCZ A;  4A3G H;  1YBY A;  2ID0 A;  3RR5 A;  3BU2 A;  4Y7N H;  5FLM G;  2UUC Q;  4JI0 L;  4JI7 Q;  4NXN Q;  3FKI H;  3GTJ H;  2ZJQ A;  1VQB A;  2OTJ A;  3JAM c;  3A5U A;  2JA8 G;  3KF6 B;  1QVF A;  3HKZ E;  3PO3 G;  3VDY A;  4JCV E;  3PSI A;  2B3G A;  5LMN W;  3CPW A;  1YZ6 A;  1MJE A;  4LF5 Q;  1IZ6 A;  1PYS B;  1VCI A;  2MO1 A;  3CW2 C;  1Q1E A;  1YHA A;  5LMU L;  3I2Z A;  4HIM A;  3H0G G;  1VQ6 A;  2H5X A;  5M5X H;  2HHH Q;  3S16 H;  4L5S A;  2Z6K A;  4A3J H;  3T1H Q;  5C4X H;  2UXC L;  3FHW A;  2N3S A;  1HJP A;  1YIT A;  4WJ3 M;  1B70 B;  1L1O C;  4JBJ A;  1QUQ B;  4R4C A;  4A3F H;  2Q2T A;  4X6A H;  3NBH B;  3NEM A;  3OYY A;  4LW1 A;  3J81 c;  3S1R H;  5IE8 A;  1UWV A;  3PUX A;  4DV3 Q;  3G71 A;  1JJC B;  1Q86 C;  1EUJ A;  4ALP A;  3KF6 A;  1VQ4 A;  1N36 L;  4NXM Q;  5IP7 G;  4KHP L;  2AMC B;  4UP9 A;  4DKA C;  1I94 L;  1Q7Y C;  1C7Y A;  4YHH Q;  1FL0 A;  5J3B A;  4JI1 Q;  4MNO A;  1TWH H;  2AHO B;  4IFD I;  2JA9 A;  2NZO A;  3HOU H;  1OXX K;  2ASB A;  1LTL A;  3S2D H;  4A3C H;  4DR6 Q;  3K8A A;  3CC4 A;  1VQ5 A;  1QUQ A;  4OWX B;  4EX5 A;  5AJ3 L;  4JV5 Q;  3JAM i;  1WCM H;  3RLF A;  2JA5 H;  3K80 C;  3CCR A;  1R9T H;  1VQO A;  5IP9 H;  3BZC A;  1K8A C;  1X65 A;  1E1O A;  1UE6 A;  4UPA A;  3A74 A;  1JJG A;  1SRO A;  2RF4 A;  5IYB G;  4BBR G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...