2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
1WFQA 4IO9A 1YJNA 1XJVA 1N34L 3PO2G 3M4QA 4DV1L 4YWKA 1YJWA 2ATWA 1PH7A 4L5SA 4YHHL 4LUZA 4MZ9A 2JA9A 1VQDA 4QQBX 5C44H 2Z0SA 1KAWA 1TWGH 2CWAA 1WOCA 5ELNA 1X56A 5IP7H 1HNXL 4A3IH 2I5HA 1SE8A 4JBMA 4GOPA 4GS3A 2RF4A 1YHQA 1JMCA 1XMQQ 2HQLA 1KRSA 1L1OB 1OXSC 4JI8Q 2ZM6Q 4LF4Q 1VQBA 2WB1E 3STBC 3AFQA 2B63G 1Q1BA 1UEBA 4A3GH 1MJEA 3NENA 5J3BA 3GTOH 4LFBQ 1Y1WG 2OWOA 4IOCA 4DR6Q 4PMWA 3CCQA 1JJ2A 2H5XA 2WP8J 2WFWA 4NB3A 1N8RC 3UE0A 2D0PA 1YJ9A 2JEBI 3KLWA 3HKSA 2A1AA 4JV5L 4OONA 3CD6A 5ELOA 2HHHL 1NMGA 3UE1A 4B3MQ 1T9HA 1SN8A 1QUQA 4LF9L 4GKJL 1GM5A 3ULLA 4NXNQ 1NBWA 1I94L 1KXLA 4K0KL 4OO1G 2IY5B 2BA1A 1X6OA 1GVPA 4JI4Q 1L2FA 2I5MX 4FDBA 3ULPA 2L15A 3MEFA 1I50H 3T1HL 4LF8L 2JA6G 2JA7G 4A3LG 4R4TA 2UXDL 2KHJA 2QGQA 4A3GG 1KIXA 4DUZQ 1FJGQ 2PNHA 2JA6H 2JQOA 3W1BA 3KJPA 1PH5A 1X3FA 1LYLA 3U4ZA 2NVTH 4BA1I 4DV4L 1PHJA 2I0QA 4A3JG 3NBHB 4B3SL 3AQQA 3HOXH 1XPUA 4IPHA 1OXXK 1K73C 3S1RH 3EBEA 2ES2A 3K80C 1XNRL 3S1NH 4A3IG 4KI0A 2MO0A 4X65Q 4LF6Q 1FVIA 3S17H 4POGA 3OW2A 3CAMA 1HZCA 1PH2A 1UE1A 3M85A 3M3YH 5GAHC 1PH1A 1VQJA 5C0XJ 1A63A 1Y1WH 4BY1H 2ZTEA 4UPAA 2EQSA 2RHSB 2R92G 1BBWA 3CW2C 2R93H 2N3SA 1IXRA 1ASZA 1HNZL 3SGIA 1G51A 1NY4A 2OQ0A 1QZHA 1EFWA 4LF7L 1CUKA 3DLLA 2PI2E 4B3TL 1TWHH 2UUAQ 2AWOA 1IL2A 4RMFA 4XIGS 2NVQH 4R4QA 5M3FG 4LW1A 2E2JH 1AH9A 2PQAB 4BY1G 3CP0A 1J5EL 3TREA 1Q82C 3S2DH 2GVBA 2MFIA 5M5YH 1S3OA 2AKWB 3S1QH 1N33L 3T1HQ 4LWCA 5GADC 3H15A 5E7NA 1IBLQ 4JYAQ 4HIMA 1PH9A 1LUZA 1VQKA 3M7NA 2UXCQ 3GTQH 2N78A 3D31A 4QY7A 2CCZA 4LF9Q 4GKJQ 4APVA 4C2MH 3I55A 2QEXA 2OTLA 3RZDH 4JBJA 1HNZQ 1K3RA 1IBKL 4A3LH 3G6EA 4YWMA 2JA8H 3D0FA 4AH6A 2AMCB 3G71A 1HR0Q 3HOVG 4A93G 3Q8DA 1GD7A 1W3SA 1KHIA 3TEHB 4A3EH 3S2HH 4IJLA 1E7ZA 1B8AA 3CC4A 4LFBL 3I4MG 3U50C 1WYDA 3HOUH 3A74A 3GTGH 4GLVB 4LF4L 3GTPH 1NTGA 5C0XG 1XMQL 1D7QA 4QIWE 4GNXB 5GAGC 1YI2A 3T1YL 2PMZE 4RG1A 4JOIA 4BA2I 2AWNA 1PVOA 4LF5L 1HNXQ 3HOZH 1Q1EA 4GLAC 1PH4A 2B63H 4LUVA 4DNIA 3PO3G 5LMNL 1JJCB 4PZ7A 1QVGA 1M1KC 4IPDA 3TQYA 2NVYH 2R7ZG 3GTMH 3NEMA 1Q7YC 3G48A 1CSPA 5M3MH 5FLXc 3M4OH 3H0GH 4EQ5A 1QVCA 3UDGA 5JJIA 1I94Q 1S72A 4Y52H 4DR4L 1BBUA 3RLOA 2JK8A 1GO3E 4PZ6A 4QJFA 4DV2L 1LTLA 4DV2Q 5IT9c 1HH2P 5IWAL 2LXJA 3UDXA 3OTOQ 3PO2H 2HHHQ 5LMUQ 1PH3A 5HGQA 1K83H 4X66Q 1VQ8A 4C3IH 4DR2Q 4GKKL 2R7DA 4P74A 3HOVH 4MNOA 4ALPA 3E0EA 4JBWA 3CCSA 4LFAL 4KHPQ 5IYCH 3RLFA 2DGYA 4LFAQ 4KHPL 2R7FA 4X62Q 1W2BA 3J81c 4DV3Q 4A3BH 1KRTA 1VQNA 1VS0A 4GOPC 2K14A 4DV0Q 5GAEC 3CF5A 1H95A 2IX0A 4NXMQ 2UXBQ 1N36Q 2MO1A 5IWAQ 3OTOL 4TQUS 3CMEA 4GN4B 1IYJB 1VCIA 2YYZA 2YV5A 3I2ZA 3RR5A 4DR4Q 1CKNA 1U0LA 1IBML 1UE7A 1ASYA 1HZAA 1TXYA 2RHQB 3JC66 3M4PA 2WAQG 4OO1I 1YNXA 4OXPA 1EYGA 4YCVA 4IOAA 1K8GA 1OXUA 1NE3A 3BZKA 1YVCA 5IY0A 5M3FH 4AYBE 4JI7Q 3F2CA 4A3BG 2E2HH 4LF5Q 1E1TA 2PQAA 1O7IA 4TVAB 5M5WH 3RN5A 1KC8C 2JJQA 4JI6L 4DV5L 3G4SA 2F52A 2R93G 4DR1Q 4JI0Q 3J7A5 4X65L 1XMOL 1P16A 4DV3L 5IP9H 1VQ7A 3EN2A 4X62L 4WJ4A 1PH6A 1N33Q 4BY7G 2B3GA 2K75A 2E5LL 3M9BA 4UP8A 2CFMA 3BU2A 3BZCA 4BBRH 4A3FH 4X66L 5FJ8H 1HR0L 3CC7A 2ASBA 1JJGA 4DUZL 1SRUA 2WB1G 1FJGL 2YTXA 2UXDQ 4R1JA 2KCMA 1L1OC 2VQEQ 4A3CG 4P71A 2ZJPA 3KDFB 4JI4L 2GVAA 1YEZA 4DV6Q 2UU9L 4IPGA 1X54A 1CKOA 4JI2Q 3HOXG 4A3KG 1VQPA 1I3QH 1WJJA 1Q81C 4A3DG 4A3DH 2JA5H 3GD7A 5EAYA 4YY3L 1C9OA 4J15A 2K52A 4B3TQ 2OQKA 2VY3A 4OWXB 3J81i 1K0RA 1C7YA 5GQOA 1WCMG 3JAMc 4DR3L 3L0OA 2YU9H 4LF7Q 3I4NG 1N32Q 3F1ZA 1DGSA 4KHZA 1HR0W 5LMNQ 4R4IA 2E2IH 1Z47A 1HJPA 4GN5A 4DR5Q 1KD1C 4LFCQ 3TS2A 5FLMH 3L7ZC 3T1YQ 1EIFA 3W5OA 4DAMA 1XMOQ 2NN6I 2CKZB 3EIVA 1X3GA 4DR1L 3AYHB 1PFSA 3B6YA 2K5VA 3PUWA 2UUAL 4GN3B 2Q2TA 3CC2A 2JA8G 4DV5Q 4LF6L 4JI6Q 1CKNB 3GTKH 1VQLA 3J80i 3K81C 3KDFA 4JBKA 3HOWH 1VQEA 1RIPA 2NZOA 3A0JA 4P72A 4LFCL 2GN5A 3S14H 2LSSA 4DV4Q 4A3KH 4B3SQ 5C3EG 4BXXH 3S16H 1G6PA 1EOVA 4YHHQ 4UP9A 1IBKQ 1VQIA 1N32L 1A0IA 1SLJA 4HIOA 4EX5A 4OX9L 3PUXA 5M5XH 4LNQA 1IBMQ 1UWVA 2E8GA 1X3EA 4O2DA 5C44G 2ZTCA 4DV6L 2UU9Q 4BY7H 4JYAL 4B3RQ 1N9WA 4B3ML 2VQEL 2VNUD 1XNQQ 1VQAA 1EQQA 2B29A 1QVFA 4QL5A 4DV0L 4A3MG 4B3RL 1V9PA 1UE5A 2E5LQ 3GDEA 3WWVA 2K5HA 3AEVA 2XGTA 4JG2A 4JI1Q 4P73A 4DR2L 4BXXG 1U5KA 1TWCH 2IHEA 3FKIG 3KJOA 2N49A 4C3HH 2IX1A 3H3VH 1L0WA 1EWIA 1OXVA 3U4VA 4OWWB 1R9TH 1VQGA 2VQFL 3CMAA 3L2PA 4HIDA 4HIKA 3PUZA 4A3EG 1X55A 2R6GA 3A5ZB 1HNWQ 4GNXA 2VS1A 4DK3C 1VQOA 3PUYA 5M3MG 2ZJRA 2BH2A 2ALYB 4DR6L 5JEAJ 2MNAA 3ERSX 2Q2UA 1EQRA 3I56A 3HKZG 2IT1A 3GO5A 4AIMA 4A4IA 1L1OA 4DUYQ 4HJ5A 5K36G 4JI8L 2ZM6L 1VQFA 2LXKA 2KHIA 3GTJH 3HOZG 5AJ3Q 3J81j 2OCEA 3I4NH 1Y1VH 2EXDA 3ER0A 3HOWG 4DR7L 5IYDH 2JA7H 1YZ6A 1RL2A 2FXQA 2KCTA 2D0OA 1Y1VG 2N8NA 5IYDG 1N36L 2A19A 4UP7A 4JOIC 4P75A 4NXML 4IFDG 1Q86C 1EIYB 1M90C 3ICEA 1E24A 5GROA 2ID0A 3TRZA 4PG3A 4X64Q 2DUDA 1VQCA 4L5TA 2Z6KC 4LUOA 1YITA 3HOUG 3I4MH 2K50A 3K7UC 5DLQE 1VQ9A 4LF8Q 2F4VQ 4BBSH 1KQSA 1Q46A 4GKKQ 3BJUA 2UUBL 4A93H 4K0KQ 1XPRA 3KYHC 1VQ5A 4L5QA 3CPWA 5LMUL 2ZJQA 1I6HH 1E22A 1VQHA 1HZBA 1Q8KA 2CQOA 3IRBA 1XPOA 3CXCA 1B70B 1IBLL 4YWLA 4IJHA 1XNQL 3KF6B 1LM0A 2C35B 1PYSB 1Q12A 3CCVA 2AHOB 2MQHA 3E9HA 4MTNA 3OYYA 5IP7G 1SFOH 5FJ8G 4OX9Q 4DV7L 4A3FG 5BR8Q 3KFUA 4HJ9A 2HT1A 3U58A 4GNXC 1VQMA 2VZAA 1SROA 1JE5A 4QGUA 3K8AA 3CCUA 4NPSA 4JI5L 3HOYG 3PIOA 1OTCA 3A5UA 5C4XH 4PZ8A 1V43A 3ZJYC 1HNWL 4R4CA 4JI3L 4AQYQ 2HIVA 2K4KA 2VL6A 1Y14B 4AQYL 4JI3Q 3I4OA 1N34Q 2BH8A 3PSIA 3FKIH 3H3VI 2IHFA 3HKZE 1I5FA 2EIFA 5C3EH 3CCEA 3RN2A 3VDYA 2Q2IA 4A75A 1JT8A 3DM3A 1A8VA 4A76A 3PIPA 3J80c 1YHAA 2V1CC 2CWPA 1MKHA 4HJ8A 4A3MH 2K5NA 5C4XG 3PV0A 1PH8A 1CSQA 2RCNA 2VUMH 2Y0SG 4AYBG 2UXCL 3W1GA 1QUQB 1TWAH 1G291 2Q2HA 3K7AH 5H1SE 1XNRQ 2NZHA 1HZ9A 5IE8A 2BA0A 1KL9A 5FLMG 4A3JH 1S40A 2WAQE 2QA4A 1YIJA 3CPFA 1MJCA 4YCUA 4L5RC 2ZTDA 4R4OA 1PA6A 1J5EQ 3KOJA 3PO3H 1WCMH 3JAMi 5IYBG 4C3JH 2R92H 4GLXA 1P8LA 4DAYB 1E3PA 2UUBQ 4X6AH 2JE6I 4NXNL 1X65A 3I7FA 4DK6C 1K9MC 2OTJA 1C0AA 1IZ6A 1XTDA 4JCVE 5JJKA 3GTLH 1A62A 4GOPB 4JV5Q 1QZGA 1GKHA 4IFDJ 3F2BA 1D8LA 5HY6A 4XTCS 5C0XI 4JI5Q 3PF4A 3H0GG 1NJIC 4Y7NH 1EUJA 2KENA 3KF8B 3LGJA 4BBSG 3F8TA 3S1MH 1X9NA 4DPGA 4DKAC 5AJ3L 2VW9A 1UE6A 1PV4A 1CKMA 1JB7A 2R7ZH 4DR7Q 1BVSA 4DR5L 3CCLA 4IPCA 4DV7Q 2A8VA 4JI7L 2NN6G 5IYBH 5JEAG 1PYBA 1B7YB 5C4JH 1VQ4A 3S24A 3HFZB 4IFDI 3FHWA 4DR3Q 2YTYA 3PCOB 2JA5G 1FL0A 2Z6KA 1AE2A 1AE3A 1YHBA 4YY3Q 1K8AC 4OWTB 1WI5A 4JI2L 3UDFA 4HJ7A 3ULJA 2VQFQ 4KLKA 4A3CH 3NELA 2HIXA 4DV1Q 4HJAA 2XTIA 2KBNA 4WJ3M 2PI2A 1SR3A 2VUMG 5BR8L 2UXBL 2UUCL 3S15H 3UDIA 1SMXA 1YBYA 4BBRG 2D62A 2JEAI 3MXNB 3CQZH 1J6QA 4JI1L 3RNUA 2F4VL 1FGUA 4H02A 5IP9G 5LMNW 3KF6A 1NMFA 2YTVA 4X64L 3RLNA 3TS0A 4O0AA 4JI0L 2F3IA 1OXTA 4JC0A 5JJLA 3STBD 1VQ6A 3RZOH 4ME3A 1V1QA 3F2DA 1TWFH 2Y0SE 3CCRA 1E1OA 1MIUA 2I5LX 3PGZA 3J7ZC 3CCMA 5IYCG 1BKBA 3HOYH 4YCWA 3CCJA 3PUVA 4POFA 2NVXH 4UY8C 3PF5A 3AFPA 3E9IA 3K0XA 2UUCQ 1Z9FA 3FP9A 4DUYL
chains in the Genus database with same CATH superfamily
1WFQA 4IO9A 3M4QA 4DV1L 1PH7A 4YHHL 4MZ9A 4QQBX 1VQDA 1GUWA 3OIQA 1KAWA 1WOCA 1HNXL 5IP7H 1TS5A 2A69D 1SNOA 4JBMA 2RF4A 1XMQQ 1PFNA 1YNJC 1VQBA 1LLRD 3AFQA 1Q1BA 4JK1C 4HMJA 4DAYA 3NENA 5J3BA 2K5DA 1F9SA 5K5PA 1MJEA 2JSOA 5DM63 1F9PA 4LK1C 2K5QA 1ESFA 2D0PA 1YJ9A 4XQJA 4PQXA 2F0NA 4PNYA 1ZYRC 3CD6A 2HHHL 4V190 1NMGA 4B3MQ 4EQOA 1LV9A 3S2HB 4DU9A 4Q5VA 1GM5A 3ULLA 4NXNQ 1KXLA 4RHSA 1JE4A 4Y7NB 4FDBA 2PW7A 2L15A 4A3LG 3CQZB 3S2DB 4DUZQ 2JA6H 2JA6B 2F0UA 2JQOA 3KJPA 1PH5A 1X3FA 3GV6A 4WORA 1PHJA 4B3SL 1XPUA 3NBHB 3AQQA 3HOXH 1A3VA 1KTKA 3T4AC 1XYIA 1XNRL 3J81E 3S1NH 1B1ZA 4DK0A 5FO7B 4A3IG 4LF6Q 1NR4A 4POGA 2MHVA 1D1IA 1PH2A 5LHY1 2XIWA 1VQJA 1UUPA 5C0XJ 2BE5C 4BY1H 5KNBA 2ZTEA 5IGEA 2RHSB 2B8FA 4C3JG 1SYFA 1BBWA 2F0SA 2N3SA 2ZT9C 1G51A 3H0GB 1EFWA 4LF7L 1B3AA 1CUKA 1LACA 2PI2E 3MA2B 2SDFA 3MZ5A 4XIGS 2JN4A 5M3FG 1BCPD 2E2JH 2N55A 1F9QA 4ZK9B 2J7ZA 2JXMB 1J5EL 1Q82C 5EKIA 5D14A 2PCFB 4MIUA 1U4RA 1S5FD 2L9HA 3GTMB 3NTKA 4B3RL 2UXCQ 1HHVA 1IBLQ 1PH9A 1LUZA 3GTQH 4QY7A 2CCZA 4LF9Q 4APVA 3RD4A 2OTLA 4X3SA 1IBKL 3MFGA 4ZCKA 1WTVA 2JA8H 5IODA 3HOVG 4IUPA 2WINB 4B9WA 3T56B 1DD2A 4N8FA 1A2TA 3U50C 1WYDA 3A74A 3VR3A 1SE4A 1TS2A 3GTGH 3FMCA 2IPKD 4BWGB 5CV6A 2OT2A 1D7QA 1WTQA 1YI2A 3FVQA 1BBXC 1PMRA 1DZ1A 5CBAE 1PVOA 2Y0SB 4LF5L 1TY0A 4GLAC 4LUVA 5LMNL 1JJCB 2OF1A 3KLSX 1GHKA 4RWSC 5A35A 3H0GH 1V1OA 1ET9A 5EKKA 2F1MA 1BBUA 3RLOA 1GO3E 1IL8A 4PZ6A 4DV2Q 4A3EH 4AYBB 1HH2P 3OTOQ 1PH3A 1VQ8A 1WTPA 3E6ZX 4GKKL 1KLGD 3E0EA 2YU9B 1W2BA 2H1EA 2QDBA 1KRTA 3I4NB 1VS0A 1SMYC 2EYHA 5GAEC 1H95A 1N36Q 1I4HA 3VR4A 3OTOL 2NVXB 4C56C 1IYJB 3RR5A 1NR2A 4KY5A 2WAQG 3T13A 4HSPA 2PPBC 5I6WA 4YCVA 1PLFA 1PRTD 1PXUA 4IUVA 2A68C 4X3TA 2PQAA 3KBGA 4TVAB 1D5ZC 1EYAA 4UHVA 1IYVA 3G4SA 2EYLA 4I65A 2AQ3B 2NN6H 4X65L 2LS01 5IP9H 1VQ7A 3NTHA 4WJ4A 3MXGA 1XTCD 3S16B 2EOTA 1LABA 3R2TA 3M9BA 4UP8A 3BZCA 3AU7A 1HR0L 4X66L 4C1NK 1IYUA 3X3MA 2WB1G 1EYCA 3J7AF 3VYSA 2ZJPA 5EPKA 4JI4L 4IPGA 1X54A 2KQ3A 3QJYA 3QOLA 1I3QH 1SNQA 4A3DG 1D1KA 1WD0A 5JOBA 4YY3L 1C9OA 4B3TQ 2VY3A 4LF7Q 1WCMG 3L0OA 3MXNA 4KHZA 5JEAH 1HR0W 3FEWX 3E0JA 2E2IH 4GN5A 4MN3A 4LFCQ 5CGKA 3L7ZC 1XMOQ 4FF3A 4H13C 2NN6I 2CKZB 3P20A 3QB3A 1X3GA 3I70A 2JA8G 4GN3B 2Q2TA 3CC2A 1U4LA 4DF7A 3GTKH 5CBEE 1XXGA 4JBKA 1EWCA 2F0JA 4CJ0B 3S14H 4B3SQ 3H6MA 3NBHA 4BXXH 4R8NA 2JA5B 4ZQ3A 1EOVA 2QF7A 5DNFA 4YHHQ 3A56A 1IBKQ 1A0IA 1SLJA 4HIOA 3D6CA 1SE3A 2K28A 3PUXA 1QNKA 1IBMQ 2E8GA 1X3EA 4O2DA 3A55A 4DV6L 2UU9Q 3KK7A 5IGBA 1N9WA 4B3ML 4A3DB 1EY0A 1EQQA 2FINB 4ZKBB 3JAML 2CQAA 5BN3A 4A3GB 3VR5A 3AEVA 5KRUA 4O1NA 5JJZA 4BXXG 3KJOA 4C3HH 2TMPA 1RTNA 4HR7B 3U4VA 4HIKA 2EYFA 1HFNA 1X55A 2F0LA 3NXWA 4N9TA 2ZJRA 1CQFA 2ALYB 4DR6L 1TQOA 1F77A 4IUTA 2NVQB 1SNPA 5CR3A 5K36G 1SYBA 3C46A 5CV7A 1TWAB 2R7ZB 2EXDA 2R3ZA 1Y8OB 2NB0A 1U9RA 2D0OA 1Y1VG 2FXQA 3OOCA 4UP7A 4JOIC 4NXML 1M90C 3EFXD 3GP7A 3TRZA 4PG3A 1FD7D 5NUCA 2F0EA 3HS0C 4PMCA 3K7UC 1VQ9A 3BJUA 4L5QA 3CPWA 5LMUL 2G5DA 4CJ2C 1AP0A 2R61A 1CFMA 2EPBA 1XPOA 3CXCA 1IBLL 4IJHA 3URYA 3TMEA 1JWUD 1LTID 2AHOB 5IP7G 4OHJA 3S1NB 4IZ8A 5FJ8G 4OX9Q 4DV7L 4A3FG 2MP1A 4IQZA 5BR8Q 2LKVA 1ENFA 2K1BA 2VB2X 2DY8A 4GNXC 4MTKA 4RKLA 3HOYG 1EL0A 1BQQT 2K6AA 4KV6A 4PZ8A 4JI3L 4AQYQ 4A93B 2VL6A 5L37A 3TBIB 3AMUA 1J8IA 3OW7A 4QF4A 2EIFA 3HOUB 4LAAA 1X32A 3DM3A 1A8VA 3A7LA 2V1CC 2CWPA 4MHEA 2A5HA 4J6HA 1R4QB 2F3WA 3P75A 4R9WA 1PH8A 3S1MB 2F0KA 2ZXRA 1QUQB 5H1SE 1HZ9A 2HCIA 2QA4A 3CPFA 4L5RC 3I90A 4R4OA 1BUVT 2E2DC 3JAMi 5IYBG 1TIID 4C3JH 1P8LA 4IUNA 3SDZA 1SJHD 4DK6C 2OTJA 1C0AA 1IZ6A 2K05A 3D8GA 5JJKA 1HTLD 2F4IA 2EXZA 3I91A 4XTCS 4DA2A 3EA6A 3H0GG 1NJIC 1H9KA 1PFBA 3S1MH 3NBIA 4DPGA 1X9NA 4DKAC 4EVOA 4DR7Q 4L63B 1Y1WB 2KVMA 1JR0D 1PYBA 3HKZB 1VQ4A 3S24A 1T5EA 2B63B 3GTQB 4IALA 4BBRB 1SXTA 2PW5A 3PCOB 1CA6A 2JA5G 2Z6KA 3A8KE 3UDFA 2HDLA 3ULJA 4A3CH 4DV1Q 2KBNA 5ELBA 4EGVA 4F88A 1Y69U 2UUCL 1TVXA 3UDIA 1AN8A 3MXNB 1ILPA 4H02A 1MD2D 5IP9G 4X64L 3RLNA 1EY7A 3HP3A 4JC0A 5JJLA 3BDOA 3K59A 3QO2A 1V1QA 3F2DA 1A3UA 2Y0SE 3PGZA 4CDFC 4YCWA 3CCJA 3PUVA 4FF4A 4J8QA 2PZWA 4P2CB 1FNVA 3FP9A 2KCCA 2KJXA 4DUYL 1XJVA 3QG1A 3LX0A 3WOFA 2F03A 3EROA 2B8GA 5FKAC 1FNWA 5C44H 1D2BA 1SBBB 2IJ0A 4FVMA 5ELNA 1K8MA 1B44D 4I7AA 1UEAB 3D4DA 2PZUA 1LT5D 4RGNA 1JWSD 2HQLA 2CH4A 4NP5A 2ZM6Q 5IGCA 1PZJD 2B63G 1UEBA 2EZVA 2AQ1B 3BVZA 3T53B 1Y1WG 2OWOA 4DR6Q 4DNTB 3IL8A 2H5XA 2WP8J 1AZPA 1N8RC 1STGA 4C3IG 5KIXA 2HQEA 4EQPA 3TZDA 1I6HB 1NBWA 4K0KL 2IY5B 2DNCA 1X6OA 1GVPA 3PQIA 2I5MX 4KD3A 3CRLC 4JI4Q 2JA6G 3GTPB 2UXDL 4A3GG 4OELB 2KEDA 1X3PA 2XNAC 4ABNA 3SK4A 3W1BA 2NVTH 3SR1A 4BA1I 2RQXA 1K73C 3K80C 2WACA 3BVGA 4X65Q 2MO0A 1RKNA 3SK8A 3M85A 1PH1A 1CT1D 3HG9A 4UPAA 1HTPA 4FNFA 3MXUA 4M1UB 1M8AA 2M2LA 4QIWB 1ASZA 4ID6A 4C3JB 2Q8RE 1H9RA 1FNUA 2UUAQ 2LFNA 4RMFA 2NVQH 3GTLB 2PQAB 4I7ZC 4BY1G 3CP0A 2B2UC 1QE6A 3DM1A 2GVBA 3M4OB 2F0PA 4TSSA 1STBA 1TS4A 2Z4HA 1Z7TA 2HDMA 2KHSA 4LWCA 4N8X1 5GADC 3H15A 4JYAQ 1PTOH 1PYWD 3ND9A 1VQKA 3M7NA 3D31A 4C2MH 4DAPA 1I3QB 1K3RA 2WB1B 3QOJA 2AMCB 4XQQA 1HR0Q 1KNAA 3TEHB 1U4PA 1DJRD 3GV3A 1B8AA 3I4MG 1YNND 3PIO3 4ILWA 4GLVB 1CQVA 3GTPH 2OXPA 1JOOA 3VYRA 4CKBA 4ZLTF 2D2CC 4G57A 4CDCC 4RG1A 3WDNA 5I4DA 1K3BC 1PH4A 4OL7A 4L6TB 4KJNA 4DAVA 5C4JB 1SJED 1M1KC 2R7ZG 3NEMA 4XQNA 3X3NA 3UDGA 3DEOA 1I94Q 2R93B 4DR4L 3ONAB 4RCOA 3BDCA 1SYDA 4K6DA 2AQ2B 2HHHQ 2L1BA 1K83H 4C3IH 2R7DA 4MNOA 2FMCA 4ALPA 3CCSA 4DGZA 5IYCH 2DGYA 2R7FA 3J81c 1BXTA 4DV3Q 2K14A 3MHBA 4DV0Q 2F0QA 1VF7A 3BG3A 4KKSA 3CF5A 2EYOA 3K5OA 3I2ZA 3JC66 1EIGA 3M4PA 2NWGA 2DJGC 4OXPA 4RAUC 1EYGA 4CGYB 5M3FH 3IAYA 4JI7Q 3MVVA 2E2HH 4LF5Q 4A3BG 1E1TA 5F2DA 1O7IA 2L0CA 2JJQA 1TR5A 4DV5L 2F52A 2R93G 1I4PA 4DR1Q 4G4KA 4JI0Q 3J7A5 3EN2A 4X62L 2B39A 4R8IA 4BY7G 2K75A 4IN3A 4BBRH 3BU2A 4A3FH 4KY7A 5E4WC 3CC7A 4DUZL 1SRUA 4CDEC 2A69C 5FLXL 1L1OC 4A3CG 1CKOA 3MEHA 1VQPA 1F2MA 1WCMB 2JA5H 4LJZC 2OQKA 2YU9H 3J81i 3H91A 5GQOA 3JAMc 4DR3L 3I4NG 3F1ZA 1DGSA 1GUGA 4U68A 4HCSA 2KCNA 5K36H 4HCEA 1HJPA 4DR5Q 2Z1CA 4DAMA 4E6IA 1O7YA 3AYHB 1EY6A 1STEA 4JI6Q 1CKNB 2KA7A 1LT6D 1BR9A 3K81C 4WFN3 3Q6SA 1L0YB 4DV4Q 1G6PA 1KDCA 1LTSD 1EY9A 3FPUB 1N32L 5C4ZA 4EX5A 4BY1B 4OX9L 5BN4A 1DOMA 5C44G 2ZTCA 4BY7B 1TWFB 1EIHA 5ELDA 2I07B 2QILA 3U9OA 5E3FA 5D3IB 2VQEL 1DCZA 1VQAA 2B29A 2NZ1D 1QVFA 2BOSA 4XYOA 3GDEA 2H4OA 2K5HA 1TWCB 4ZUJA 4DR2L 2O4XA 4H44C 3R2IA 2F0MA 2FJ2A 1A2UA 4HIDA 4GNXA 2VS1A 4FYDA 1VQOA 3PUYA 5M3MG 5A2QE 1K83B 4QUFA 2E2HB 5KGUA 2Q2UA 2EYMA 4AIMA 3GO5A 2IX3A 1L1OA 3VR2A 3S1QB 3GTJH 3HOZG 5AJ3Q 1Y1VB 3I4NH 1Y1VH 3ND8A 2A19A 5C0XH 4IFDG 1Q86C 1E24A 2ID0A 1PZKD 4RHRA 1YITA 4L5TA 3HOUG 3OMGA 1PRTC 4LF8Q 4BBSH 1KQSA 2UUBL 2Z6BA 3VR6A 3KYHC 1VQ5A 4A3MB 4HSVA 4BS9A 1KDAA 1VQHA 2D9UA 1Q8KA 1JC7A 1EQVA 1PZID 3M3YB 1XNQL 1LM0A 2C35B 1PYSB 1BOSA 3D3RA 5CORA 2MQHA 3E9HA 1BF4A 3OYYA 3GTOB 4IURA 1GUOA 4OEMB 4G7OC 1NUCA 2VZAA 5HURA 1SROA 3NTIA 1JE5A 3CCUA 4OIJA 1LTBD 1H9SA 4FXGC 1OTCA 1V43A 3ZJYC 3BS1A 1N34Q 3TSSA 2MGSA 2MUYA 5D3DA 3H3VI 3CCEA 3VDYA 1JT8A 1G2SA 3PIPA 3R3OA 4HAEA 2A6HD 2DNEA 2PNRC 4A3MH 1CSQA 2RCNA 2Y0SG 1RD9D 3V05A 2CW0D 1I4QA 5FLMG 2B2TA 1KL9A 4A3JH 2WAQE 3K0YA 2J0TD 1ONLA 3V96A 4ULLA 3K5MA 1XX8A 5KNCA 1EY8A 3KOJA 1BNZA 1WCMH 4RCNA 1E3PA 1HRJA 3I4MB 1TS3A 3IKJA 2PO4A 4JCVE 2E2IB 3GTLH 1A62A 3HRZC 5J1ZA 3F2UA 4GOPB 5CV5A 3PO2B 1WTHA 4JV5Q 2IL8A 4IFDJ 3F2BA 2O5IC 4JI5Q 2RA4A 3W2DA 1RODA 4CKEA 2M00A 1STYA 2KENA 1CKMA 3P7JA 3SHLA 5DM73 1B7YB 3HFZB 1SYEA 3J80E 4K8JA 5M3FB 1AE3A 1WI5A 4HJ7A 1PTOC 2VQFQ 4DK1A 3VA7A 1SR3A 3PMFA 4JPBW 2VUMG 2UXBL 1S5CD 4BBRG 1SMXA 2BE5D 3SEBA 4XT3B 4JI1L 3RNUA 2F4VL 2CW0C 3KF6A 3J80L 1NMFA 4PV1C 3TS0A 2F3IA 3STBD 4G7HC 1VQ6A 4CBVA 2VUMB 1EEID 4ME3A 1STNA 3TDQA 5KYLA 1YNJD 1BCPC 3HOYH 1FR3A 2NVXH 4UY8C 3AFPA 1E2ZA 4HN7A 3K7AB 1STAA 4Z9CB 1N34L 3PO2G 2MPMA 5FO8B 4YWKA 2PYKA 2AUJD 2Z0SA 1TWGH 3Q0AA 2NTTA 3NK9A 4A3IH 2I5HA 4GOPA 1B3QA 4GS3A 1YHQA 1JMCA 5C3EB 2L11A 1QCBD 4XYQA 1I4GA 1OXSC 4JI8Q 5C4HA 2QEJC 2WB1E 1EQTA 4K5XA 1LTTD 4LFBQ 1RTOA 3DUZA 4IOCA 1O7ZA 5BN5A 4PMWA 1JJ2A 4NB3A 1W6JA 3UE0A 3IFDA 3KLWA 2XVSA 4OONA 2HCCA 5ELOA 1SN8A 3FRPB 4LF9L 3BZDB 4G7ZC 3TP5A 2RDHA 2JA7G 3KLSA 2G9HD 4X3UA 4DFAA 4R4TA 3OMCA 2ZXPA 1TU2B 1KDBA 2HUGA 2PNHA 4EQNA 1RHPA 1M4VA 2EJGC 1LYLA 3U4ZA 1QG7A 2I0QA 4A3JG 3EVQA 4IPHA 2B2VC 3S1RH 3EBEA 1LT3D 5IGFA 4KI0A 3S17H 1K8OA 2SEBD 3OW2A 1L0XB 1HZCA 4RGTA 1MSHA 5GAHC 1HQMC 3TP7A 1Y1WH 2B2YC 4HMIA 1Y8PB 1G91A 4RGOS 3NQIA 1Q8IA 2R92B 2RSNA 3SGIA 1NY4A 2OQ0A 3PO3B 1C4QA 4ZUIA 2OEOA 2AWOA 1IL2A 5J22A 4C3IB 2E2JB 3PIP3 1CHQD 1CK1A 5FK9C 3S2DH 1CA5A 2JA7B 2MFIA 3NQTA 5M5YH 2DJFC 5FO9B 2AKWB 1ESRA 5FOBB 3TN2A 1N33L 3T1HQ 2NVTB 5E7NA 4HIMA 1PRTF 1C48A 2EYJA 1BO0A 4YIJA 2N78A 2LMCB 3GQBA 3I55A 4NDXA 1HNZQ 4DXGA 4A3LH 3G6EA 4AH6A 5M3MB 2C9OA 1R9TB 2N88A 3Q8DA 1GD7A 3I73A 1GJXA 3OHXC 4IJLA 5CV8A 2D5DA 3HOUH 3J81L 3BDLA 1NTGA 5C0XG 1XMQL 4QIWE 4GNXB 2QKIC 2Z4IA 3T1YL 5M5YB 1O7LA 2PMZE 4BA2I 1SEBD 1KLUD 1HNXQ 3HOZH 3MWYW 3HOWB 5I9OA 5T1GA 3TZUA 3ZYYX 1PTOB 1J9OA 5C6AA 4PZ7A 4KY6A 2NVYH 2KEEA 3A8IE 4ZRZA 1RDPD 3G48A 1CSPA 1LO5D 5M3MH 5C44B 3M4OH 1F2LA 4XDXA 3DXJC 3DWAA 2K03A 1PTOF 1LTLA 5IWAL 2C5CA 3UDXA 3PO2H 4DR2Q 4P74A 1HA5A 4JBWA 4LFAL 4KHPQ 3MXPA 3RLFA 5JVG3 1SMYD 1IW7C 4A3BH 4GOPC 1X3QA 2IX0A 2CVRA 5IWAQ 4TQUS 3CMEA 1RF2D 1VCIA 2YV5A 1CKNA 1U0LA 4KJOA 3SK6A 3SE0A 3Q22A 3G7LA 1YNXA 4CJ1B 3RUZA 3HZXA 1PTOD 1K8GA 4LMQD 1DXMA 5IY0A 1YVCA 3F2CA 1E0BA 3NWSA 3RN5A 1KC8C 5TSSA 3S17B 5LL6X 2A74C 1EY5A 1Q3LA 1S4ZA 1TT2A 1N33Q 2B3GA 3JAME 1B53A 2F0TA 2CFMA 4KKTA 2ASBA 2SNMA 1FJGL 3DHQA 2YTXA 2VQEQ 2KCMA 2F0DA 4P71A 1G2TA 2GVAA 1V1PA 4JI2Q 3T16A 4A3KG 2P5ZX 4KD4A 4A3DH 5EAYA 4J15A 2K52A 4OWXB 1C7YA 2L4NA 1K0RA 1MHWC 1N32Q 5ISRA 1S5BD 2PZTA 4R4IA 5G3LF 2K04A 1Z47A 3TS2A 1ML0D 5FLMH 3T1YQ 1EIFA 3W5OA 3K5LA 2V4DA 4A3BB 5EGTA 3B6YA 1PFSA 3NSWA 3PUWA 4DV5Q 3J80i 2NZOA 3TP8A 3A0JA 4P72A 2WKDA 4LFCL 5FLXE 2GN5A 1BCPF 1HUMA 4K2LA 5KNDA 4A3KH 3S16H 3CKIB 3BYTB 1VQIA 3MTSA 2ICEC 3C2PA 3OIPA 4JYAL 1ICFB 2RDFA 1ICWA 4A3MG 1AZQA 1JORA 1V9PA 1UE5A 1SNCA 4JI1Q 4P73A 3D4RA 1TWCH 2IHEA 3FKIG 4K2KA 2Q8TA 1TKWB 5LL6S 2IX1A 3H3VH 1KABA 3BVMA 4OGQC 1EWIA 1OXVA 2F0WA 1R9TH 1VQGA 2VQFL 3L2PA 2EE1A 5IGGA 2R6GA 1HNWQ 2B2TC 1SAPA 1MSGA 5DEHA 2K01A 5CMDA 2EDGA 1GUTA 4F87A 2MNAA 3ERSX 1EQRA 3I56A 4A4IA 4K5VA 1TWHB 4JI8L 5COYA 2LXKA 4J1MA 1LTAD 3J81j 1Y8NB 1F2ZA 4QB4A 2JA7H 4S3SA 1YZ6A 5IT9L 4FXDA 2KCTA 1RL2A 1VMCA 2N8NA 5IYDG 1S5ED 2A6EC 2K5WA 1QOHA 2F3VA 2DUDA 1VQCA 3I4MH 3EQLC 4IUUA 5DLQE 3TP6A 2F4VQ 2ICIA 2B2WC 3N52A 4U673 1Q46A 4GKKQ 1XPRA 2ZJQA 1CZGA 2J4XA 4RFBA 4KK7A 5KEEA 1HZBA 3IRBA 4IFDH 1FGBD 1HUNA 1B70B 4UDUC 3KF6B 1Q12A 4B9XA 1NCVA 4NW2A 4MTNA 3C3LA 2E74C 1GUNA 3U58A 1BDOA 4A3FB 1VQMA 3DWPA 4FP5D 4NPSA 4JI5L 2QW7A 5CV4A 3PIOA 5E1FA 2WKCA 3A5UA 5C4XH 1HNWL 4R4CA 2HIVA 1WTXA 1Y14B 1MI2A 3RZDB 4C3HG 3GTGB 2BH8A 3PSIA 3ITPA 2E76C 3FKIH 1STHA 2BDNA 3HKZE 3RN2A 2Q2IA 4A75A 4CDDC 1LTRD 4A76A 1IKMA 3J80c 3DWQA 3KBXA 2A6ED 1IHZA 1MKHA 2AUKA 1Z6HA 4QMGA 1F9RA 3L9AX 3H09A 4H7BA 1O78A 1WD1A 2VUMH 2UXCL 3IFTA 4PMBA 3GTJB 3W1GA 4C1NI 5T1IA 1G291 2NBFA 2NZHA 5IE8A 2BA0A 4QCLA 3C1FA 2NVYB 1S40A 2JYOA 1MJCA 2B2VA 1I6VC 1B2TA 1TWGB 1PA6A 1HQRD 4GLXA 2O2LD 4BBSB 4X6AH 1EU4A 2JE6I 1X65A 3HOXB 2KOLA 4ZAIA 1XTDA 1GKHA 1EOTA 5HY6A 1CTMA 1IKLA 1EUJA 4Y7NH 3KF8B 3F8TA 5AJ3L 2VW9A 1PV4A 4N9PA 1BVSA 4DR5L 2A8VA 4DV7Q 3I8ZA 2X6LA 4C3HB 2NTSA 5IYBH 5C4JH 3SXHA 3FHWA 1JICA 2B2WA 1EWHA 1EFID 2YTYA 3OWFA 2KUMA 5C3XA 1JB3A 1QB5D 1I50B 3V2TA 1YHBA 4JI2L 4NKLA 1CHPD 4NMZA 5C4XB 1EEFD 2NYZD 2HIXA 3NELA 4HJAA 2XTIA 4WJ3M 1GOZA 1G8ZD 1SNMA 3NHHA 1YBYA 2D62A 1NNXA 1WVLA 3CQZH 1J6QA 2VB3X 5M9OA 1E2WA 1AEXA 4IUQA 3LNNA 4O0AA 4JI0L 1V1PB 1DONA 3I3CA 3RZOH 3FPPA 5I6YA 5C5LA 3S14B 1TWFH 3WOEA 3CCRA 2I5LX 3CCMA 1AFPA 4DXFA 3GTKB 3SK5A 4POFA 1KAAA 3PF5A 3E9IA 2UUCQ 1Z9FA 3M4YA 2L5TA 1YJNA 1Q90A 1AW7A 2ATWA 1YJWA 4L5SA 4LUZA 5HGTA 2JA9A 4TKOB 2CWAA 1X56A 4HEDA 1SE8A 3LWEA 1B9NA 1KRSA 1L1OB 4LF4Q 2VXWA 3STBC 3RZOB 4A3GH 2FHTA 3GTOH 5D65A 3CCQA 2WFWA 3KUPA 4UAIA 5EPJA 2JEBI 4JW0A 1ZXTA 3HKSA 2A1AA 4JV5L 5ELEA 3UE1A 1T9HA 1QUQA 4WJWA 4GKJL 1WTOA 1I94L 4OO1G 2BA1A 1L2FA 3ULPA 4LF8L 3MEFA 3T1HL 1I50H 2KHJA 2QGQA 1KIXA 3LWUA 1FJGQ 1ZYRD 3AB9A 1ENCA 1DM0B 4DV4L 2JP1A 1NSNS 3L3OC 4A3IB 1OXXK 2EY5A 2ES2A 2XRQD 1BCPB 2XN9C 5JAVA 1FVIA 3H94A 1ZKOA 2F0HA 3CAMA 3K57A 1DYQA 1UE1A 3M3YH 2L12A 1A63A 3VYUA 3HOYB 2EQSA 2EY6A 1CM9A 1PRTB 2R92G 4XT1B 2E75C 1S5DD 3CW2C 2R93H 1IXRA 3QIAA 4RGMA 1HNZL 1QZHA 2PMZB 3DLLA 4B3TL 1TWHH 3C1EA 3A7AB 4R4QA 5J39A 4LW1A 3T51B 1AH9A 3TREA 1EU3A 2B2UA 1MGSA 4ZYSA 1S3OA 1IW7D 3MFYA 4HTHA 2K7VA 3NP8A 2I46A 3S1QH 5I2YA 2M9VA 3OWEB 3KLRA 1EY4A 3EJIA 4CKCA 4X3KA 4GKJQ 3RMHA 3FKIB 2QEXA 3RZDH 4JBJA 2MJ8A 2XRSD 4YWMA 3D0FA 3G71A 2O5JC 1UAPA 4A93G 5C3WA 3P1HA 1KHIA 1W3SA 1ZEQX 3S2HH 2RSOA 1E7ZA 3G6JB 4FXKC 3CC4A 4LFBL 4LF4L 5GAGC 3N6RA 1KNEA 4JOIA 2AWNA 4O42A 5EPLA 1Q1EA 4DN4M 2B63H 5CYUA 4DNIA 3U9SA 3PO3G 2X6GA 1QVGA 4IPDA 3TQYA 2G9DA 4K8IA 3GTMH 3QWNA 1HXYD 1Q7YC 2XSCA 1UNSA 5FLXc 2RVLA 4EQ5A 5EKLA 1QVCA 5JJIA 4Y52H 1S72A 3DEPA 2BCOA 2EJFC 1JCKB 4C2MB 2JK8A 4QJFA 4DV2L 5IT9c 3H3VC 2LXJA 1EZ6A 5LMUQ 2Z9HA 5HGQA 3CU7A 4X66Q 5IGDA 5EBDA 1A6XA 3HOVH 1W6KA 4LFAQ 4KHPL 3NE5B 4X62Q 2TSSA 1VDZA 1VQNA 4TRDA 3O13A 5EQ0A 4NXMQ 2UXBQ 2MO1A 4GN4B 1E2VA 2Q8IB 1O80A 4DR4Q 2YYZA 4JVZA 2XWJB 3ERQA 4F8MA 2DY7A 5CV9A 1IBML 3W3AA 1UE7A 1ASYA 1GUSA 1HZAA 1TXYA 1H9MA 2RHQB 5G3LD 1PDQA 4OO1I 1B9MA 4IOAA 1D6EC 2JA8B 1F2YA 1OXUA 1NE3A 2F0GA 3BZKA 4AYBE 5A2QL 4FF2A 3S9WA 5C5MA 5M5WH 5M5XB 4JI6L 4ME5A 2ZXOA 2CHBD 4K14A 4FF1A 4CHTB 1XMOL 1P16A 4RKBA 4DV3L 1ET6A 1PH6A 1A3TA 2E5LL 1JJGA 5FJ8H 4H0LC 2KECA 3KF8A 2UXDQ 1GXDC 4R1JA 3KDFB 1YEZA 4DV6Q 2UU9L 3HOXG 4XXEA 1Q81C 1WJJA 2WV6D 2F0VA 3GD7A 1TY2A 1SNDA 2QDLA 1B4OA 5LMNQ 2ENBA 1JWMD 1KD1C 1T5XD 1H9JA 2FMMA 2SNSA 2HD3A 1HPCA 3EIVA 4DR1L 1WTRA 2CH4W 2K5VA 1SYCA 2UUAL 2PQEA 4LF6L 1LTGD 5I2XA 1VQLA 1SYGA 2K33A 1VMPA 3KDFA 3HOWH 1VQEA 1RIPA 3NWTA 2NUCA 3HOZB 2LSSA 5C3EG 1PFMA 5IOCA 4B08A 4UP9A 1B50A 3UI2A 3VYTA 1SE2A 4KTAA 5M5XH 5M5WB 4LNQA 3Q24A 1UWVA 2QCPX 5CC4A 4BY7H 4B3RQ 3S15B 1RJTA 3D6WA 3D4WA 3NUCA 2RDGA 2VNUD 1XNQQ 3OPOA 1SFOB 3I72A 2B2YA 4QL5A 3E5SA 4DV0L 3S1RB 3M7GA 1A15A 1D5XC 2E5LQ 3K6OA 2X69A 3WWVA 2XGTA 1ENAA 4JG2A 1U5KA 2N49A 1JOQA 1L0WA 4OWWB 2F0FA 3CMAA 4A3EG 3HGBA 1K0SA 3PUZA 4KMUC 3A5ZB 1K28A 4DK3C 3HOVB 2WIIB 2BH2A 3J7YW 5JEAJ 1GHJA 4DUYQ 2IT1A 3HKZG 4HJ5A 4FO2A 2ZM6L 1VQFA 1JQYD 2F0IA 2KHIA 4KN7C 5EJWA 1C8CA 4DR7L 2OCEA 5IYDH 3ER0A 3BYYB 3CHBD 5ELCA 3HOWG 3E3XA 1SSOA 1H9SB 2SOBA 2GA4B 2RKSA 1N36L 4P75A 1EIYB 2K32A 3ICEA 5GROA 1QILA 4X64Q 3R93A 2Z6KC 4LUOA 2K50A 3HEJA 2EJMA 4A93H 4V0BA 4K0KQ 1FYCA 5EBCA 5KYIA 1I6HH 1I4RA 3NPPA 4Q0FA 1E22A 2CQOA 4YWLA 4QUCA 1CI3M 4OIKA 1DOLA 5AFWA 5ELFA 3CCVA 4GZYC 3K5NA 1EYDA 1SFOH 1DOKA 4ODGA 5IT9E 4KN4C 2A6HC 3KFUA 4HJ9A 4A3KB 2HT1A 1YNNC 2WAQB 1CZWA 4QGUA 3K8AA 3FDTA 1SDFA 3DMUA 4F7XA 3SVMA 5E4XA 3OSOA 2K4KA 5JPMC 2Z8LA 4AQYL 4JI3Q 3I4OA 4K6LA 3J7AV 4ZKCB 4RH6A 3Q23A 5JPNC 2IHFA 1I5FA 5C3EH 4WRDA 1QJOA 5I9PA 3K58A 1HCZA 1HFGA 1YHAA 4HJ8A 3MC0B 2K5NA 5C4XG 3PV0A 3MAQA 1G6ZA 4AYBG 1QWYA 1TWAH 1XNRQ 2Q2HA 3K7AH 2FFKB 1YIJA 4YCUA 1WTWA 4K5WA 2ZTDA 2EVBA 1NAPA 1J5EQ 3I4LA 3PO3H 1RCVD 2R92H 4DAYB 2UUBQ 3R8BA 4OO1H 4NXNL 3I7FA 1EZ8A 4RA8A 1K9MC 2BDOA 3CRKC 1R4PB 1QZGA 1D8LA 5C0XI 4A3EB 3PF4A 1I4XA 2EY1A 4BBSG 3LGJA 1HA6A 2IW3A 1ILQA 1JB7A 2R7ZH 1UE6A 3CCLA 2EYPA 4IPCA 3QR8A 4JI7L 2NN6G 5JEAG 1MBYA 4IFDI 2RCFA 3VA5A 5DAUA 4DR3Q 1XWEA 1FL0A 2IWHA 1AE2A 1VF5C 4YY3Q 3A8JE 1K8AC 4DNRB 4OWTB 1D5MC 4KLKA 1QNUA 2PI2A 5BR8L 3A54A 2LY7A 1OO9B 3S15H 1JOKA 1LT4D 2JEAI 4KKUA 2A73B 1U4MA 1FGUA 4KHVA 5LMNW 2RBMA 5IIFA 2YTVA 2XWBB 1OXTA 4M8AA 1II3A 2L55A 1V8QA 5JVH3 1E1OA 1MIUA 2F0OA 3J7ZC 2DN8A 5IYCG 1BKBA 4A3JB 2A68D 4L8JA 3K0XA 2EY2A
chains in the Genus database with same CATH topology
1WFQA 4IO9A 1YJNA 1XJVA 1N34L 3PO2G 3M4QA 4DV1L 4YWKA 1YJWA 2ATWA 1PH7A 4L5SA 4YHHL 4LUZA 4MZ9A 2JA9A 1VQDA 4QQBX 5C44H 2Z0SA 1KAWA 1TWGH 2CWAA 1WOCA 5ELNA 1X56A 5IP7H 1HNXL 4A3IH 2I5HA 1SE8A 4JBMA 4GOPA 4GS3A 2RF4A 1YHQA 1JMCA 1XMQQ 2HQLA 1KRSA 1L1OB 1OXSC 4JI8Q 2ZM6Q 4LF4Q 1VQBA 2WB1E 3STBC 3AFQA 2B63G 1Q1BA 1UEBA 4A3GH 1MJEA 3NENA 5J3BA 3GTOH 4LFBQ 1Y1WG 2OWOA 4IOCA 4DR6Q 4PMWA 3CCQA 1JJ2A 2H5XA 2WP8J 2WFWA 4NB3A 1N8RC 3UE0A 2D0PA 1YJ9A 2JEBI 3KLWA 3HKSA 2A1AA 4JV5L 4OONA 3CD6A 5ELOA 2HHHL 1NMGA 3UE1A 4B3MQ 1T9HA 1SN8A 1QUQA 4LF9L 4GKJL 1GM5A 3ULLA 4NXNQ 1NBWA 1I94L 1KXLA 4K0KL 4OO1G 2IY5B 2BA1A 1X6OA 1GVPA 4JI4Q 1L2FA 2I5MX 4FDBA 3ULPA 2L15A 3MEFA 1I50H 3T1HL 4LF8L 2JA6G 2JA7G 4A3LG 4R4TA 2UXDL 2KHJA 2QGQA 4A3GG 1KIXA 4DUZQ 1FJGQ 2PNHA 2JA6H 2JQOA 3W1BA 3KJPA 1PH5A 1X3FA 1LYLA 3U4ZA 2NVTH 4BA1I 4DV4L 1PHJA 2I0QA 4A3JG 3NBHB 4B3SL 3AQQA 3HOXH 1XPUA 4IPHA 1OXXK 1K73C 3S1RH 3EBEA 2ES2A 3K80C 1XNRL 3S1NH 4A3IG 4KI0A 2MO0A 4X65Q 4LF6Q 1FVIA 3S17H 4POGA 3OW2A 3CAMA 1HZCA 1PH2A 1UE1A 3M85A 3M3YH 5GAHC 1PH1A 1VQJA 5C0XJ 1A63A 1Y1WH 4BY1H 2ZTEA 4UPAA 2EQSA 2RHSB 2R92G 1BBWA 3CW2C 2R93H 2N3SA 1IXRA 1ASZA 1HNZL 3SGIA 1G51A 1NY4A 2OQ0A 1QZHA 1EFWA 4LF7L 1CUKA 3DLLA 2PI2E 4B3TL 1TWHH 2UUAQ 2AWOA 1IL2A 4RMFA 4XIGS 2NVQH 4R4QA 5M3FG 4LW1A 2E2JH 1AH9A 2PQAB 4BY1G 3CP0A 1J5EL 3TREA 1Q82C 3S2DH 2GVBA 2MFIA 5M5YH 1S3OA 2AKWB 3S1QH 1N33L 3T1HQ 4LWCA 5GADC 3H15A 5E7NA 1IBLQ 4JYAQ 4HIMA 1PH9A 1LUZA 1VQKA 3M7NA 2UXCQ 3GTQH 2N78A 3D31A 4QY7A 2CCZA 4LF9Q 4GKJQ 4APVA 4C2MH 3I55A 2QEXA 2OTLA 3RZDH 4JBJA 1HNZQ 1K3RA 1IBKL 4A3LH 3G6EA 4YWMA 2JA8H 3D0FA 4AH6A 2AMCB 3G71A 1HR0Q 3HOVG 4A93G 3Q8DA 1GD7A 1W3SA 1KHIA 3TEHB 4A3EH 3S2HH 4IJLA 1E7ZA 1B8AA 3CC4A 4LFBL 3I4MG 3U50C 1WYDA 3HOUH 3A74A 3GTGH 4GLVB 4LF4L 3GTPH 1NTGA 5C0XG 1XMQL 1D7QA 4QIWE 4GNXB 5GAGC 1YI2A 3T1YL 2PMZE 4RG1A 4JOIA 4BA2I 2AWNA 1PVOA 4LF5L 1HNXQ 3HOZH 1Q1EA 4GLAC 1PH4A 2B63H 4LUVA 4DNIA 3PO3G 5LMNL 1JJCB 4PZ7A 1QVGA 1M1KC 4IPDA 3TQYA 2NVYH 2R7ZG 3GTMH 3NEMA 1Q7YC 3G48A 1CSPA 5M3MH 5FLXc 3M4OH 3H0GH 4EQ5A 1QVCA 3UDGA 5JJIA 1I94Q 1S72A 4Y52H 4DR4L 1BBUA 3RLOA 2JK8A 1GO3E 4PZ6A 4QJFA 4DV2L 1LTLA 4DV2Q 5IT9c 1HH2P 5IWAL 2LXJA 3UDXA 3OTOQ 3PO2H 2HHHQ 5LMUQ 1PH3A 5HGQA 1K83H 4X66Q 1VQ8A 4C3IH 4DR2Q 4GKKL 2R7DA 4P74A 3HOVH 4MNOA 4ALPA 3E0EA 4JBWA 3CCSA 4LFAL 4KHPQ 5IYCH 3RLFA 2DGYA 4LFAQ 4KHPL 2R7FA 4X62Q 1W2BA 3J81c 4DV3Q 4A3BH 1KRTA 1VQNA 1VS0A 4GOPC 2K14A 4DV0Q 5GAEC 3CF5A 1H95A 2IX0A 4NXMQ 2UXBQ 1N36Q 2MO1A 5IWAQ 3OTOL 4TQUS 3CMEA 4GN4B 1IYJB 1VCIA 2YYZA 2YV5A 3I2ZA 3RR5A 4DR4Q 1CKNA 1U0LA 1IBML 1UE7A 1ASYA 1HZAA 1TXYA 2RHQB 3JC66 3M4PA 2WAQG 4OO1I 1YNXA 4OXPA 1EYGA 4YCVA 4IOAA 1K8GA 1OXUA 1NE3A 3BZKA 1YVCA 5IY0A 5M3FH 4AYBE 4JI7Q 3F2CA 4A3BG 2E2HH 4LF5Q 1E1TA 2PQAA 1O7IA 4TVAB 5M5WH 3RN5A 1KC8C 2JJQA 4JI6L 4DV5L 3G4SA 2F52A 2R93G 4DR1Q 4JI0Q 3J7A5 4X65L 1XMOL 1P16A 4DV3L 5IP9H 1VQ7A 3EN2A 4X62L 4WJ4A 1PH6A 1N33Q 4BY7G 2B3GA 2K75A 2E5LL 3M9BA 4UP8A 2CFMA 3BU2A 3BZCA 4BBRH 4A3FH 4X66L 5FJ8H 1HR0L 3CC7A 2ASBA 1JJGA 4DUZL 1SRUA 2WB1G 1FJGL 2YTXA 2UXDQ 4R1JA 2KCMA 1L1OC 2VQEQ 4A3CG 4P71A 2ZJPA 3KDFB 4JI4L 2GVAA 1YEZA 4DV6Q 2UU9L 4IPGA 1X54A 1CKOA 4JI2Q 3HOXG 4A3KG 1VQPA 1I3QH 1WJJA 1Q81C 4A3DG 4A3DH 2JA5H 3GD7A 5EAYA 4YY3L 1C9OA 4J15A 2K52A 4B3TQ 2OQKA 2VY3A 4OWXB 3J81i 1K0RA 1C7YA 5GQOA 1WCMG 3JAMc 4DR3L 3L0OA 2YU9H 4LF7Q 3I4NG 1N32Q 3F1ZA 1DGSA 4KHZA 1HR0W 5LMNQ 4R4IA 2E2IH 1Z47A 1HJPA 4GN5A 4DR5Q 1KD1C 4LFCQ 3TS2A 5FLMH 3L7ZC 3T1YQ 1EIFA 3W5OA 4DAMA 1XMOQ 2NN6I 2CKZB 3EIVA 1X3GA 4DR1L 3AYHB 1PFSA 3B6YA 2K5VA 3PUWA 2UUAL 4GN3B 2Q2TA 3CC2A 2JA8G 4DV5Q 4LF6L 4JI6Q 1CKNB 3GTKH 1VQLA 3J80i 3K81C 3KDFA 4JBKA 3HOWH 1VQEA 1RIPA 2NZOA 3A0JA 4P72A 4LFCL 2GN5A 3S14H 2LSSA 4DV4Q 4A3KH 4B3SQ 5C3EG 4BXXH 3S16H 1G6PA 1EOVA 4YHHQ 4UP9A 1IBKQ 1VQIA 1N32L 1A0IA 1SLJA 4HIOA 4EX5A 4OX9L 3PUXA 5M5XH 4LNQA 1IBMQ 1UWVA 2E8GA 1X3EA 4O2DA 5C44G 2ZTCA 4DV6L 2UU9Q 4BY7H 4JYAL 4B3RQ 1N9WA 4B3ML 2VQEL 2VNUD 1XNQQ 1VQAA 1EQQA 2B29A 1QVFA 4QL5A 4DV0L 4A3MG 4B3RL 1V9PA 1UE5A 2E5LQ 3GDEA 3WWVA 2K5HA 3AEVA 2XGTA 4JG2A 4JI1Q 4P73A 4DR2L 4BXXG 1U5KA 1TWCH 2IHEA 3FKIG 3KJOA 2N49A 4C3HH 2IX1A 3H3VH 1L0WA 1EWIA 1OXVA 3U4VA 4OWWB 1R9TH 1VQGA 2VQFL 3CMAA 3L2PA 4HIDA 4HIKA 3PUZA 4A3EG 1X55A 2R6GA 3A5ZB 1HNWQ 4GNXA 2VS1A 4DK3C 1VQOA 3PUYA 5M3MG 2ZJRA 2BH2A 2ALYB 4DR6L 5JEAJ 2MNAA 3ERSX 2Q2UA 1EQRA 3I56A 3HKZG 2IT1A 3GO5A 4AIMA 4A4IA 1L1OA 4DUYQ 4HJ5A 5K36G 4JI8L 2ZM6L 1VQFA 2LXKA 2KHIA 3GTJH 3HOZG 5AJ3Q 3J81j 2OCEA 3I4NH 1Y1VH 2EXDA 3ER0A 3HOWG 4DR7L 5IYDH 2JA7H 1YZ6A 1RL2A 2FXQA 2KCTA 2D0OA 1Y1VG 2N8NA 5IYDG 1N36L 2A19A 4UP7A 4JOIC 4P75A 4NXML 4IFDG 1Q86C 1EIYB 1M90C 3ICEA 1E24A 5GROA 2ID0A 3TRZA 4PG3A 4X64Q 2DUDA 1VQCA 4L5TA 2Z6KC 4LUOA 1YITA 3HOUG 3I4MH 2K50A 3K7UC 5DLQE 1VQ9A 4LF8Q 2F4VQ 4BBSH 1KQSA 1Q46A 4GKKQ 3BJUA 2UUBL 4A93H 4K0KQ 1XPRA 3KYHC 1VQ5A 4L5QA 3CPWA 5LMUL 2ZJQA 1I6HH 1E22A 1VQHA 1HZBA 1Q8KA 2CQOA 3IRBA 1XPOA 3CXCA 1B70B 1IBLL 4YWLA 4IJHA 1XNQL 3KF6B 1LM0A 2C35B 1PYSB 1Q12A 3CCVA 2AHOB 2MQHA 3E9HA 4MTNA 3OYYA 5IP7G 1SFOH 5FJ8G 4OX9Q 4DV7L 4A3FG 5BR8Q 3KFUA 4HJ9A 2HT1A 3U58A 4GNXC 1VQMA 2VZAA 1SROA 1JE5A 4QGUA 3K8AA 3CCUA 4NPSA 4JI5L 3HOYG 3PIOA 1OTCA 3A5UA 5C4XH 4PZ8A 1V43A 3ZJYC 1HNWL 4R4CA 4JI3L 4AQYQ 2HIVA 2K4KA 2VL6A 1Y14B 4AQYL 4JI3Q 3I4OA 1N34Q 2BH8A 3PSIA 3FKIH 3H3VI 2IHFA 3HKZE 1I5FA 2EIFA 5C3EH 3CCEA 3RN2A 3VDYA 2Q2IA 4A75A 1JT8A 3DM3A 1A8VA 4A76A 3PIPA 3J80c 1YHAA 2V1CC 2CWPA 1MKHA 4HJ8A 4A3MH 2K5NA 5C4XG 3PV0A 1PH8A 1CSQA 2RCNA 2VUMH 2Y0SG 4AYBG 2UXCL 3W1GA 1QUQB 1TWAH 1G291 2Q2HA 3K7AH 5H1SE 1XNRQ 2NZHA 1HZ9A 5IE8A 2BA0A 1KL9A 5FLMG 4A3JH 1S40A 2WAQE 2QA4A 1YIJA 3CPFA 1MJCA 4YCUA 4L5RC 2ZTDA 4R4OA 1PA6A 1J5EQ 3KOJA 3PO3H 1WCMH 3JAMi 5IYBG 4C3JH 2R92H 4GLXA 1P8LA 4DAYB 1E3PA 2UUBQ 4X6AH 2JE6I 4NXNL 1X65A 3I7FA 4DK6C 1K9MC 2OTJA 1C0AA 1IZ6A 1XTDA 4JCVE 5JJKA 3GTLH 1A62A 4GOPB 4JV5Q 1QZGA 1GKHA 4IFDJ 3F2BA 1D8LA 5HY6A 4XTCS 5C0XI 4JI5Q 3PF4A 3H0GG 1NJIC 4Y7NH 1EUJA 2KENA 3KF8B 3LGJA 4BBSG 3F8TA 3S1MH 1X9NA 4DPGA 4DKAC 5AJ3L 2VW9A 1UE6A 1PV4A 1CKMA 1JB7A 2R7ZH 4DR7Q 1BVSA 4DR5L 3CCLA 4IPCA 4DV7Q 2A8VA 4JI7L 2NN6G 5IYBH 5JEAG 1PYBA 1B7YB 5C4JH 1VQ4A 3S24A 3HFZB 4IFDI 3FHWA 4DR3Q 2YTYA 3PCOB 2JA5G 1FL0A 2Z6KA 1AE2A 1AE3A 1YHBA 4YY3Q 1K8AC 4OWTB 1WI5A 4JI2L 3UDFA 4HJ7A 3ULJA 2VQFQ 4KLKA 4A3CH 3NELA 2HIXA 4DV1Q 4HJAA 2XTIA 2KBNA 4WJ3M 2PI2A 1SR3A 2VUMG 5BR8L 2UXBL 2UUCL 3S15H 3UDIA 1SMXA 1YBYA 4BBRG 2D62A 2JEAI 3MXNB 3CQZH 1J6QA 4JI1L 3RNUA 2F4VL 1FGUA 4H02A 5IP9G 5LMNW 3KF6A 1NMFA 2YTVA 4X64L 3RLNA 3TS0A 4O0AA 4JI0L 2F3IA 1OXTA 4JC0A 5JJLA 3STBD 1VQ6A 3RZOH 4ME3A 1V1QA 3F2DA 1TWFH 2Y0SE 3CCRA 1E1OA 1MIUA 2I5LX 3PGZA 3J7ZC 3CCMA 5IYCG 1BKBA 3HOYH 4YCWA 3CCJA 3PUVA 4POFA 2NVXH 4UY8C 3PF5A 3AFPA 3E9IA 3K0XA 2UUCQ 1Z9FA 3FP9A 4DUYL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFQ A;  4IO9 A;  1YJN A;  1XJV A;  1N34 L;  3PO2 G;  3M4Q A;  4DV1 L;  4YWK A;  1YJW A;  2ATW A;  1PH7 A;  4L5S A;  4YHH L;  4LUZ A;  4MZ9 A;  2JA9 A;  1VQD A;  4QQB X;  5C44 H;  2Z0S A;  1KAW A;  1TWG H;  2CWA A;  1WOC A;  5ELN A;  1X56 A;  5IP7 H;  1HNX L;  4A3I H;  2I5H A;  1SE8 A;  4JBM A;  4GOP A;  4GS3 A;  2RF4 A;  1YHQ A;  1JMC A;  1XMQ Q;  2HQL A;  1KRS A;  1L1O B;  1OXS C;  4JI8 Q;  2ZM6 Q;  4LF4 Q;  1VQB A;  2WB1 E;  3STB C;  3AFQ A;  2B63 G;  1Q1B A;  1UEB A;  4A3G H;  1MJE A;  3NEN A;  5J3B A;  3GTO H;  4LFB Q;  1Y1W G;  2OWO A;  4IOC A;  4DR6 Q;  4PMW A;  3CCQ A;  1JJ2 A;  2H5X A;  2WP8 J;  2WFW A;  4NB3 A;  1N8R C;  3UE0 A;  2D0P A;  1YJ9 A;  2JEB I;  3KLW A;  3HKS A;  2A1A A;  4JV5 L;  4OON A;  3CD6 A;  5ELO A;  2HHH L;  1NMG A;  3UE1 A;  4B3M Q;  1T9H A;  1SN8 A;  1QUQ A;  4LF9 L;  4GKJ L;  1GM5 A;  3ULL A;  4NXN Q;  1NBW A;  1I94 L;  1KXL A;  4K0K L;  4OO1 G;  2IY5 B;  2BA1 A;  1X6O A;  1GVP A;  4JI4 Q;  1L2F A;  2I5M X;  4FDB A;  3ULP A;  2L15 A;  3MEF A;  1I50 H;  3T1H L;  4LF8 L;  2JA6 G;  2JA7 G;  4A3L G;  4R4T A;  2UXD L;  2KHJ A;  2QGQ A;  4A3G G;  1KIX A;  4DUZ Q;  1FJG Q;  2PNH A;  2JA6 H;  2JQO A;  3W1B A;  3KJP A;  1PH5 A;  1X3F A;  1LYL A;  3U4Z A;  2NVT H;  4BA1 I;  4DV4 L;  1PHJ A;  2I0Q A;  4A3J G;  3NBH B;  4B3S L;  3AQQ A;  3HOX H;  1XPU A;  4IPH A;  1OXX K;  1K73 C;  3S1R H;  3EBE A;  2ES2 A;  3K80 C;  1XNR L;  3S1N H;  4A3I G;  4KI0 A;  2MO0 A;  4X65 Q;  4LF6 Q;  1FVI A;  3S17 H;  4POG A;  3OW2 A;  3CAM A;  1HZC A;  1PH2 A;  1UE1 A;  3M85 A;  3M3Y H;  5GAH C;  1PH1 A;  1VQJ A;  5C0X J;  1A63 A;  1Y1W H;  4BY1 H;  2ZTE A;  4UPA A;  2EQS A;  2RHS B;  2R92 G;  1BBW A;  3CW2 C;  2R93 H;  2N3S A;  1IXR A;  1ASZ A;  1HNZ L;  3SGI A;  1G51 A;  1NY4 A;  2OQ0 A;  1QZH A;  1EFW A;  4LF7 L;  1CUK A;  3DLL A;  2PI2 E;  4B3T L;  1TWH H;  2UUA Q;  2AWO A;  1IL2 A;  4RMF A;  4XIG S;  2NVQ H;  4R4Q A;  5M3F G;  4LW1 A;  2E2J H;  1AH9 A;  2PQA B;  4BY1 G;  3CP0 A;  1J5E L;  3TRE A;  1Q82 C;  3S2D H;  2GVB A;  2MFI A;  5M5Y H;  1S3O A;  2AKW B;  3S1Q H;  1N33 L;  3T1H Q;  4LWC A;  5GAD C;  3H15 A;  5E7N A;  1IBL Q;  4JYA Q;  4HIM A;  1PH9 A;  1LUZ A;  1VQK A;  3M7N A;  2UXC Q;  3GTQ H;  2N78 A;  3D31 A;  4QY7 A;  2CCZ A;  4LF9 Q;  4GKJ Q;  4APV A;  4C2M H;  3I55 A;  2QEX A;  2OTL A;  3RZD H;  4JBJ A;  1HNZ Q;  1K3R A;  1IBK L;  4A3L H;  3G6E A;  4YWM A;  2JA8 H;  3D0F A;  4AH6 A;  2AMC B;  3G71 A;  1HR0 Q;  3HOV G;  4A93 G;  3Q8D A;  1GD7 A;  1W3S A;  1KHI A;  3TEH B;  4A3E H;  3S2H H;  4IJL A;  1E7Z A;  1B8A A;  3CC4 A;  4LFB L;  3I4M G;  3U50 C;  1WYD A;  3HOU H;  3A74 A;  3GTG H;  4GLV B;  4LF4 L;  3GTP H;  1NTG A;  5C0X G;  1XMQ L;  1D7Q A;  4QIW E;  4GNX B;  5GAG C;  1YI2 A;  3T1Y L;  2PMZ E;  4RG1 A;  4JOI A;  4BA2 I;  2AWN A;  1PVO A;  4LF5 L;  1HNX Q;  3HOZ H;  1Q1E A;  4GLA C;  1PH4 A;  2B63 H;  4LUV A;  4DNI A;  3PO3 G;  5LMN L;  1JJC B;  4PZ7 A;  1QVG A;  1M1K C;  4IPD A;  3TQY A;  2NVY H;  2R7Z G;  3GTM H;  3NEM A;  1Q7Y C;  3G48 A;  1CSP A;  5M3M H;  5FLX c;  3M4O H;  3H0G H;  4EQ5 A;  1QVC A;  3UDG A;  5JJI A;  1I94 Q;  1S72 A;  4Y52 H;  4DR4 L;  1BBU A;  3RLO A;  2JK8 A;  1GO3 E;  4PZ6 A;  4QJF A;  4DV2 L;  1LTL A;  4DV2 Q;  5IT9 c;  1HH2 P;  5IWA L;  2LXJ A;  3UDX A;  3OTO Q;  3PO2 H;  2HHH Q;  5LMU Q;  1PH3 A;  5HGQ A;  1K83 H;  4X66 Q;  1VQ8 A;  4C3I H;  4DR2 Q;  4GKK L;  2R7D A;  4P74 A;  3HOV H;  4MNO A;  4ALP A;  3E0E A;  4JBW A;  3CCS A;  4LFA L;  4KHP Q;  5IYC H;  3RLF A;  2DGY A;  4LFA Q;  4KHP L;  2R7F A;  4X62 Q;  1W2B A;  3J81 c;  4DV3 Q;  4A3B H;  1KRT A;  1VQN A;  1VS0 A;  4GOP C;  2K14 A;  4DV0 Q;  5GAE C;  3CF5 A;  1H95 A;  2IX0 A;  4NXM Q;  2UXB Q;  1N36 Q;  2MO1 A;  5IWA Q;  3OTO L;  4TQU S;  3CME A;  4GN4 B;  1IYJ B;  1VCI A;  2YYZ A;  2YV5 A;  3I2Z A;  3RR5 A;  4DR4 Q;  1CKN A;  1U0L A;  1IBM L;  1UE7 A;  1ASY A;  1HZA A;  1TXY A;  2RHQ B;  3JC6 6;  3M4P A;  2WAQ G;  4OO1 I;  1YNX A;  4OXP A;  1EYG A;  4YCV A;  4IOA A;  1K8G A;  1OXU A;  1NE3 A;  3BZK A;  1YVC A;  5IY0 A;  5M3F H;  4AYB E;  4JI7 Q;  3F2C A;  4A3B G;  2E2H H;  4LF5 Q;  1E1T A;  2PQA A;  1O7I A;  4TVA B;  5M5W H;  3RN5 A;  1KC8 C;  2JJQ A;  4JI6 L;  4DV5 L;  3G4S A;  2F52 A;  2R93 G;  4DR1 Q;  4JI0 Q;  3J7A 5;  4X65 L;  1XMO L;  1P16 A;  4DV3 L;  5IP9 H;  1VQ7 A;  3EN2 A;  4X62 L;  4WJ4 A;  1PH6 A;  1N33 Q;  4BY7 G;  2B3G A;  2K75 A;  2E5L L;  3M9B A;  4UP8 A;  2CFM A;  3BU2 A;  3BZC A;  4BBR H;  4A3F H;  4X66 L;  5FJ8 H;  1HR0 L;  3CC7 A;  2ASB A;  1JJG A;  4DUZ L;  1SRU A;  2WB1 G;  1FJG L;  2YTX A;  2UXD Q;  4R1J A;  2KCM A;  1L1O C;  2VQE Q;  4A3C G;  4P71 A;  2ZJP A;  3KDF B;  4JI4 L;  2GVA A;  1YEZ A;  4DV6 Q;  2UU9 L;  4IPG A;  1X54 A;  1CKO A;  4JI2 Q;  3HOX G;  4A3K G;  1VQP A;  1I3Q H;  1WJJ A;  1Q81 C;  4A3D G;  4A3D H;  2JA5 H;  3GD7 A;  5EAY A;  4YY3 L;  1C9O A;  4J15 A;  2K52 A;  4B3T Q;  2OQK A;  2VY3 A;  4OWX B;  3J81 i;  1K0R A;  1C7Y A;  5GQO A;  1WCM G;  3JAM c;  4DR3 L;  3L0O A;  2YU9 H;  4LF7 Q;  3I4N G;  1N32 Q;  3F1Z A;  1DGS A;  4KHZ A;  1HR0 W;  5LMN Q;  4R4I A;  2E2I H;  1Z47 A;  1HJP A;  4GN5 A;  4DR5 Q;  1KD1 C;  4LFC Q;  3TS2 A;  5FLM H;  3L7Z C;  3T1Y Q;  1EIF A;  3W5O A;  4DAM A;  1XMO Q;  2NN6 I;  2CKZ B;  3EIV A;  1X3G A;  4DR1 L;  3AYH B;  1PFS A;  3B6Y A;  2K5V A;  3PUW A;  2UUA L;  4GN3 B;  2Q2T A;  3CC2 A;  2JA8 G;  4DV5 Q;  4LF6 L;  4JI6 Q;  1CKN B;  3GTK H;  1VQL A;  3J80 i;  3K81 C;  3KDF A;  4JBK A;  3HOW H;  1VQE A;  1RIP A;  2NZO A;  3A0J A;  4P72 A;  4LFC L;  2GN5 A;  3S14 H;  2LSS A;  4DV4 Q;  4A3K H;  4B3S Q;  5C3E G;  4BXX H;  3S16 H;  1G6P A;  1EOV A;  4YHH Q;  4UP9 A;  1IBK Q;  1VQI A;  1N32 L;  1A0I A;  1SLJ A;  4HIO A;  4EX5 A;  4OX9 L;  3PUX A;  5M5X H;  4LNQ A;  1IBM Q;  1UWV A;  2E8G A;  1X3E A;  4O2D A;  5C44 G;  2ZTC A;  4DV6 L;  2UU9 Q;  4BY7 H;  4JYA L;  4B3R Q;  1N9W A;  4B3M L;  2VQE L;  2VNU D;  1XNQ Q;  1VQA A;  1EQQ A;  2B29 A;  1QVF A;  4QL5 A;  4DV0 L;  4A3M G;  4B3R L;  1V9P A;  1UE5 A;  2E5L Q;  3GDE A;  3WWV A;  2K5H A;  3AEV A;  2XGT A;  4JG2 A;  4JI1 Q;  4P73 A;  4DR2 L;  4BXX G;  1U5K A;  1TWC H;  2IHE A;  3FKI G;  3KJO A;  2N49 A;  4C3H H;  2IX1 A;  3H3V H;  1L0W A;  1EWI A;  1OXV A;  3U4V A;  4OWW B;  1R9T H;  1VQG A;  2VQF L;  3CMA A;  3L2P A;  4HID A;  4HIK A;  3PUZ A;  4A3E G;  1X55 A;  2R6G A;  3A5Z B;  1HNW Q;  4GNX A;  2VS1 A;  4DK3 C;  1VQO A;  3PUY A;  5M3M G;  2ZJR A;  2BH2 A;  2ALY B;  4DR6 L;  5JEA J;  2MNA A;  3ERS X;  2Q2U A;  1EQR A;  3I56 A;  3HKZ G;  2IT1 A;  3GO5 A;  4AIM A;  4A4I A;  1L1O A;  4DUY Q;  4HJ5 A;  5K36 G;  4JI8 L;  2ZM6 L;  1VQF A;  2LXK A;  2KHI A;  3GTJ H;  3HOZ G;  5AJ3 Q;  3J81 j;  2OCE A;  3I4N H;  1Y1V H;  2EXD A;  3ER0 A;  3HOW G;  4DR7 L;  5IYD H;  2JA7 H;  1YZ6 A;  1RL2 A;  2FXQ A;  2KCT A;  2D0O A;  1Y1V G;  2N8N A;  5IYD G;  1N36 L;  2A19 A;  4UP7 A;  4JOI C;  4P75 A;  4NXM L;  4IFD G;  1Q86 C;  1EIY B;  1M90 C;  3ICE A;  1E24 A;  5GRO A;  2ID0 A;  3TRZ A;  4PG3 A;  4X64 Q;  2DUD A;  1VQC A;  4L5T A;  2Z6K C;  4LUO A;  1YIT A;  3HOU G;  3I4M H;  2K50 A;  3K7U C;  5DLQ E;  1VQ9 A;  4LF8 Q;  2F4V Q;  4BBS H;  1KQS A;  1Q46 A;  4GKK Q;  3BJU A;  2UUB L;  4A93 H;  4K0K Q;  1XPR A;  3KYH C;  1VQ5 A;  4L5Q A;  3CPW A;  5LMU L;  2ZJQ A;  1I6H H;  1E22 A;  1VQH A;  1HZB A;  1Q8K A;  2CQO A;  3IRB A;  1XPO A;  3CXC A;  1B70 B;  1IBL L;  4YWL A;  4IJH A;  1XNQ L;  3KF6 B;  1LM0 A;  2C35 B;  1PYS B;  1Q12 A;  3CCV A;  2AHO B;  2MQH A;  3E9H A;  4MTN A;  3OYY A;  5IP7 G;  1SFO H;  5FJ8 G;  4OX9 Q;  4DV7 L;  4A3F G;  5BR8 Q;  3KFU A;  4HJ9 A;  2HT1 A;  3U58 A;  4GNX C;  1VQM A;  2VZA A;  1SRO A;  1JE5 A;  4QGU A;  3K8A A;  3CCU A;  4NPS A;  4JI5 L;  3HOY G;  3PIO A;  1OTC A;  3A5U A;  5C4X H;  4PZ8 A;  1V43 A;  3ZJY C;  1HNW L;  4R4C A;  4JI3 L;  4AQY Q;  2HIV A;  2K4K A;  2VL6 A;  1Y14 B;  4AQY L;  4JI3 Q;  3I4O A;  1N34 Q;  2BH8 A;  3PSI A;  3FKI H;  3H3V I;  2IHF A;  3HKZ E;  1I5F A;  2EIF A;  5C3E H;  3CCE A;  3RN2 A;  3VDY A;  2Q2I A;  4A75 A;  1JT8 A;  3DM3 A;  1A8V A;  4A76 A;  3PIP A;  3J80 c;  1YHA A;  2V1C C;  2CWP A;  1MKH A;  4HJ8 A;  4A3M H;  2K5N A;  5C4X G;  3PV0 A;  1PH8 A;  1CSQ A;  2RCN A;  2VUM H;  2Y0S G;  4AYB G;  2UXC L;  3W1G A;  1QUQ B;  1TWA H;  1G29 1;  2Q2H A;  3K7A H;  5H1S E;  1XNR Q;  2NZH A;  1HZ9 A;  5IE8 A;  2BA0 A;  1KL9 A;  5FLM G;  4A3J H;  1S40 A;  2WAQ E;  2QA4 A;  1YIJ A;  3CPF A;  1MJC A;  4YCU A;  4L5R C;  2ZTD A;  4R4O A;  1PA6 A;  1J5E Q;  3KOJ A;  3PO3 H;  1WCM H;  3JAM i;  5IYB G;  4C3J H;  2R92 H;  4GLX A;  1P8L A;  4DAY B;  1E3P A;  2UUB Q;  4X6A H;  2JE6 I;  4NXN L;  1X65 A;  3I7F A;  4DK6 C;  1K9M C;  2OTJ A;  1C0A A;  1IZ6 A;  1XTD A;  4JCV E;  5JJK A;  3GTL H;  1A62 A;  4GOP B;  4JV5 Q;  1QZG A;  1GKH A;  4IFD J;  3F2B A;  1D8L A;  5HY6 A;  4XTC S;  5C0X I;  4JI5 Q;  3PF4 A;  3H0G G;  1NJI C;  4Y7N H;  1EUJ A;  2KEN A;  3KF8 B;  3LGJ A;  4BBS G;  3F8T A;  3S1M H;  1X9N A;  4DPG A;  4DKA C;  5AJ3 L;  2VW9 A;  1UE6 A;  1PV4 A;  1CKM A;  1JB7 A;  2R7Z H;  4DR7 Q;  1BVS A;  4DR5 L;  3CCL A;  4IPC A;  4DV7 Q;  2A8V A;  4JI7 L;  2NN6 G;  5IYB H;  5JEA G;  1PYB A;  1B7Y B;  5C4J H;  1VQ4 A;  3S24 A;  3HFZ B;  4IFD I;  3FHW A;  4DR3 Q;  2YTY A;  3PCO B;  2JA5 G;  1FL0 A;  2Z6K A;  1AE2 A;  1AE3 A;  1YHB A;  4YY3 Q;  1K8A C;  4OWT B;  1WI5 A;  4JI2 L;  3UDF A;  4HJ7 A;  3ULJ A;  2VQF Q;  4KLK A;  4A3C H;  3NEL A;  2HIX A;  4DV1 Q;  4HJA A;  2XTI A;  2KBN A;  4WJ3 M;  2PI2 A;  1SR3 A;  2VUM G;  5BR8 L;  2UXB L;  2UUC L;  3S15 H;  3UDI A;  1SMX A;  1YBY A;  4BBR G;  2D62 A;  2JEA I;  3MXN B;  3CQZ H;  1J6Q A;  4JI1 L;  3RNU A;  2F4V L;  1FGU A;  4H02 A;  5IP9 G;  5LMN W;  3KF6 A;  1NMF A;  2YTV A;  4X64 L;  3RLN A;  3TS0 A;  4O0A A;  4JI0 L;  2F3I A;  1OXT A;  4JC0 A;  5JJL A;  3STB D;  1VQ6 A;  3RZO H;  4ME3 A;  1V1Q A;  3F2D A;  1TWF H;  2Y0S E;  3CCR A;  1E1O A;  1MIU A;  2I5L X;  3PGZ A;  3J7Z C;  3CCM A;  5IYC G;  1BKB A;  3HOY H;  4YCW A;  3CCJ A;  3PUV A;  4POF A;  2NVX H;  4UY8 C;  3PF5 A;  3AFP A;  3E9I A;  3K0X A;  2UUC Q;  1Z9F A;  3FP9 A;  4DUY L; 
#chains in the Genus database with same CATH topology
 1WFQ A;  4IO9 A;  3M4Q A;  4DV1 L;  1PH7 A;  4YHH L;  4MZ9 A;  4QQB X;  1VQD A;  1GUW A;  3OIQ A;  1KAW A;  1WOC A;  1HNX L;  5IP7 H;  1TS5 A;  2A69 D;  1SNO A;  4JBM A;  2RF4 A;  1XMQ Q;  1PFN A;  1YNJ C;  1VQB A;  1LLR D;  3AFQ A;  1Q1B A;  4JK1 C;  4HMJ A;  4DAY A;  3NEN A;  5J3B A;  2K5D A;  1F9S A;  5K5P A;  1MJE A;  2JSO A;  5DM6 3;  1F9P A;  4LK1 C;  2K5Q A;  1ESF A;  2D0P A;  1YJ9 A;  4XQJ A;  4PQX A;  2F0N A;  4PNY A;  1ZYR C;  3CD6 A;  2HHH L;  4V19 0;  1NMG A;  4B3M Q;  4EQO A;  1LV9 A;  3S2H B;  4DU9 A;  4Q5V A;  1GM5 A;  3ULL A;  4NXN Q;  1KXL A;  4RHS A;  1JE4 A;  4Y7N B;  4FDB A;  2PW7 A;  2L15 A;  4A3L G;  3CQZ B;  3S2D B;  4DUZ Q;  2JA6 H;  2JA6 B;  2F0U A;  2JQO A;  3KJP A;  1PH5 A;  1X3F A;  3GV6 A;  4WOR A;  1PHJ A;  4B3S L;  1XPU A;  3NBH B;  3AQQ A;  3HOX H;  1A3V A;  1KTK A;  3T4A C;  1XYI A;  1XNR L;  3J81 E;  3S1N H;  1B1Z A;  4DK0 A;  5FO7 B;  4A3I G;  4LF6 Q;  1NR4 A;  4POG A;  2MHV A;  1D1I A;  1PH2 A;  5LHY 1;  2XIW A;  1VQJ A;  1UUP A;  5C0X J;  2BE5 C;  4BY1 H;  5KNB A;  2ZTE A;  5IGE A;  2RHS B;  2B8F A;  4C3J G;  1SYF A;  1BBW A;  2F0S A;  2N3S A;  2ZT9 C;  1G51 A;  3H0G B;  1EFW A;  4LF7 L;  1B3A A;  1CUK A;  1LAC A;  2PI2 E;  3MA2 B;  2SDF A;  3MZ5 A;  4XIG S;  2JN4 A;  5M3F G;  1BCP D;  2E2J H;  2N55 A;  1F9Q A;  4ZK9 B;  2J7Z A;  2JXM B;  1J5E L;  1Q82 C;  5EKI A;  5D14 A;  2PCF B;  4MIU A;  1U4R A;  1S5F D;  2L9H A;  3GTM B;  3NTK A;  4B3R L;  2UXC Q;  1HHV A;  1IBL Q;  1PH9 A;  1LUZ A;  3GTQ H;  4QY7 A;  2CCZ A;  4LF9 Q;  4APV A;  3RD4 A;  2OTL A;  4X3S A;  1IBK L;  3MFG A;  4ZCK A;  1WTV A;  2JA8 H;  5IOD A;  3HOV G;  4IUP A;  2WIN B;  4B9W A;  3T56 B;  1DD2 A;  4N8F A;  1A2T A;  3U50 C;  1WYD A;  3A74 A;  3VR3 A;  1SE4 A;  1TS2 A;  3GTG H;  3FMC A;  2IPK D;  4BWG B;  5CV6 A;  2OT2 A;  1D7Q A;  1WTQ A;  1YI2 A;  3FVQ A;  1BBX C;  1PMR A;  1DZ1 A;  5CBA E;  1PVO A;  2Y0S B;  4LF5 L;  1TY0 A;  4GLA C;  4LUV A;  5LMN L;  1JJC B;  2OF1 A;  3KLS X;  1GHK A;  4RWS C;  5A35 A;  3H0G H;  1V1O A;  1ET9 A;  5EKK A;  2F1M A;  1BBU A;  3RLO A;  1GO3 E;  1IL8 A;  4PZ6 A;  4DV2 Q;  4A3E H;  4AYB B;  1HH2 P;  3OTO Q;  1PH3 A;  1VQ8 A;  1WTP A;  3E6Z X;  4GKK L;  1KLG D;  3E0E A;  2YU9 B;  1W2B A;  2H1E A;  2QDB A;  1KRT A;  3I4N B;  1VS0 A;  1SMY C;  2EYH A;  5GAE C;  1H95 A;  1N36 Q;  1I4H A;  3VR4 A;  3OTO L;  2NVX B;  4C56 C;  1IYJ B;  3RR5 A;  1NR2 A;  4KY5 A;  2WAQ G;  3T13 A;  4HSP A;  2PPB C;  5I6W A;  4YCV A;  1PLF A;  1PRT D;  1PXU A;  4IUV A;  2A68 C;  4X3T A;  2PQA A;  3KBG A;  4TVA B;  1D5Z C;  1EYA A;  4UHV A;  1IYV A;  3G4S A;  2EYL A;  4I65 A;  2AQ3 B;  2NN6 H;  4X65 L;  2LS0 1;  5IP9 H;  1VQ7 A;  3NTH A;  4WJ4 A;  3MXG A;  1XTC D;  3S16 B;  2EOT A;  1LAB A;  3R2T A;  3M9B A;  4UP8 A;  3BZC A;  3AU7 A;  1HR0 L;  4X66 L;  4C1N K;  1IYU A;  3X3M A;  2WB1 G;  1EYC A;  3J7A F;  3VYS A;  2ZJP A;  5EPK A;  4JI4 L;  4IPG A;  1X54 A;  2KQ3 A;  3QJY A;  3QOL A;  1I3Q H;  1SNQ A;  4A3D G;  1D1K A;  1WD0 A;  5JOB A;  4YY3 L;  1C9O A;  4B3T Q;  2VY3 A;  4LF7 Q;  1WCM G;  3L0O A;  3MXN A;  4KHZ A;  5JEA H;  1HR0 W;  3FEW X;  3E0J A;  2E2I H;  4GN5 A;  4MN3 A;  4LFC Q;  5CGK A;  3L7Z C;  1XMO Q;  4FF3 A;  4H13 C;  2NN6 I;  2CKZ B;  3P20 A;  3QB3 A;  1X3G A;  3I70 A;  2JA8 G;  4GN3 B;  2Q2T A;  3CC2 A;  1U4L A;  4DF7 A;  3GTK H;  5CBE E;  1XXG A;  4JBK A;  1EWC A;  2F0J A;  4CJ0 B;  3S14 H;  4B3S Q;  3H6M A;  3NBH A;  4BXX H;  4R8N A;  2JA5 B;  4ZQ3 A;  1EOV A;  2QF7 A;  5DNF A;  4YHH Q;  3A56 A;  1IBK Q;  1A0I A;  1SLJ A;  4HIO A;  3D6C A;  1SE3 A;  2K28 A;  3PUX A;  1QNK A;  1IBM Q;  2E8G A;  1X3E A;  4O2D A;  3A55 A;  4DV6 L;  2UU9 Q;  3KK7 A;  5IGB A;  1N9W A;  4B3M L;  4A3D B;  1EY0 A;  1EQQ A;  2FIN B;  4ZKB B;  3JAM L;  2CQA A;  5BN3 A;  4A3G B;  3VR5 A;  3AEV A;  5KRU A;  4O1N A;  5JJZ A;  4BXX G;  3KJO A;  4C3H H;  2TMP A;  1RTN A;  4HR7 B;  3U4V A;  4HIK A;  2EYF A;  1HFN A;  1X55 A;  2F0L A;  3NXW A;  4N9T A;  2ZJR A;  1CQF A;  2ALY B;  4DR6 L;  1TQO A;  1F77 A;  4IUT A;  2NVQ B;  1SNP A;  5CR3 A;  5K36 G;  1SYB A;  3C46 A;  5CV7 A;  1TWA B;  2R7Z B;  2EXD A;  2R3Z A;  1Y8O B;  2NB0 A;  1U9R A;  2D0O A;  1Y1V G;  2FXQ A;  3OOC A;  4UP7 A;  4JOI C;  4NXM L;  1M90 C;  3EFX D;  3GP7 A;  3TRZ A;  4PG3 A;  1FD7 D;  5NUC A;  2F0E A;  3HS0 C;  4PMC A;  3K7U C;  1VQ9 A;  3BJU A;  4L5Q A;  3CPW A;  5LMU L;  2G5D A;  4CJ2 C;  1AP0 A;  2R61 A;  1CFM A;  2EPB A;  1XPO A;  3CXC A;  1IBL L;  4IJH A;  3URY A;  3TME A;  1JWU D;  1LTI D;  2AHO B;  5IP7 G;  4OHJ A;  3S1N B;  4IZ8 A;  5FJ8 G;  4OX9 Q;  4DV7 L;  4A3F G;  2MP1 A;  4IQZ A;  5BR8 Q;  2LKV A;  1ENF A;  2K1B A;  2VB2 X;  2DY8 A;  4GNX C;  4MTK A;  4RKL A;  3HOY G;  1EL0 A;  1BQQ T;  2K6A A;  4KV6 A;  4PZ8 A;  4JI3 L;  4AQY Q;  4A93 B;  2VL6 A;  5L37 A;  3TBI B;  3AMU A;  1J8I A;  3OW7 A;  4QF4 A;  2EIF A;  3HOU B;  4LAA A;  1X32 A;  3DM3 A;  1A8V A;  3A7L A;  2V1C C;  2CWP A;  4MHE A;  2A5H A;  4J6H A;  1R4Q B;  2F3W A;  3P75 A;  4R9W A;  1PH8 A;  3S1M B;  2F0K A;  2ZXR A;  1QUQ B;  5H1S E;  1HZ9 A;  2HCI A;  2QA4 A;  3CPF A;  4L5R C;  3I90 A;  4R4O A;  1BUV T;  2E2D C;  3JAM i;  5IYB G;  1TII D;  4C3J H;  1P8L A;  4IUN A;  3SDZ A;  1SJH D;  4DK6 C;  2OTJ A;  1C0A A;  1IZ6 A;  2K05 A;  3D8G A;  5JJK A;  1HTL D;  2F4I A;  2EXZ A;  3I91 A;  4XTC S;  4DA2 A;  3EA6 A;  3H0G G;  1NJI C;  1H9K A;  1PFB A;  3S1M H;  3NBI A;  4DPG A;  1X9N A;  4DKA C;  4EVO A;  4DR7 Q;  4L63 B;  1Y1W B;  2KVM A;  1JR0 D;  1PYB A;  3HKZ B;  1VQ4 A;  3S24 A;  1T5E A;  2B63 B;  3GTQ B;  4IAL A;  4BBR B;  1SXT A;  2PW5 A;  3PCO B;  1CA6 A;  2JA5 G;  2Z6K A;  3A8K E;  3UDF A;  2HDL A;  3ULJ A;  4A3C H;  4DV1 Q;  2KBN A;  5ELB A;  4EGV A;  4F88 A;  1Y69 U;  2UUC L;  1TVX A;  3UDI A;  1AN8 A;  3MXN B;  1ILP A;  4H02 A;  1MD2 D;  5IP9 G;  4X64 L;  3RLN A;  1EY7 A;  3HP3 A;  4JC0 A;  5JJL A;  3BDO A;  3K59 A;  3QO2 A;  1V1Q A;  3F2D A;  1A3U A;  2Y0S E;  3PGZ A;  4CDF C;  4YCW A;  3CCJ A;  3PUV A;  4FF4 A;  4J8Q A;  2PZW A;  4P2C B;  1FNV A;  3FP9 A;  2KCC A;  2KJX A;  4DUY L;  1XJV A;  3QG1 A;  3LX0 A;  3WOF A;  2F03 A;  3ERO A;  2B8G A;  5FKA C;  1FNW A;  5C44 H;  1D2B A;  1SBB B;  2IJ0 A;  4FVM A;  5ELN A;  1K8M A;  1B44 D;  4I7A A;  1UEA B;  3D4D A;  2PZU A;  1LT5 D;  4RGN A;  1JWS D;  2HQL A;  2CH4 A;  4NP5 A;  2ZM6 Q;  5IGC A;  1PZJ D;  2B63 G;  1UEB A;  2EZV A;  2AQ1 B;  3BVZ A;  3T53 B;  1Y1W G;  2OWO A;  4DR6 Q;  4DNT B;  3IL8 A;  2H5X A;  2WP8 J;  1AZP A;  1N8R C;  1STG A;  4C3I G;  5KIX A;  2HQE A;  4EQP A;  3TZD A;  1I6H B;  1NBW A;  4K0K L;  2IY5 B;  2DNC A;  1X6O A;  1GVP A;  3PQI A;  2I5M X;  4KD3 A;  3CRL C;  4JI4 Q;  2JA6 G;  3GTP B;  2UXD L;  4A3G G;  4OEL B;  2KED A;  1X3P A;  2XNA C;  4ABN A;  3SK4 A;  3W1B A;  2NVT H;  3SR1 A;  4BA1 I;  2RQX A;  1K73 C;  3K80 C;  2WAC A;  3BVG A;  4X65 Q;  2MO0 A;  1RKN A;  3SK8 A;  3M85 A;  1PH1 A;  1CT1 D;  3HG9 A;  4UPA A;  1HTP A;  4FNF A;  3MXU A;  4M1U B;  1M8A A;  2M2L A;  4QIW B;  1ASZ A;  4ID6 A;  4C3J B;  2Q8R E;  1H9R A;  1FNU A;  2UUA Q;  2LFN A;  4RMF A;  2NVQ H;  3GTL B;  2PQA B;  4I7Z C;  4BY1 G;  3CP0 A;  2B2U C;  1QE6 A;  3DM1 A;  2GVB A;  3M4O B;  2F0P A;  4TSS A;  1STB A;  1TS4 A;  2Z4H A;  1Z7T A;  2HDM A;  2KHS A;  4LWC A;  4N8X 1;  5GAD C;  3H15 A;  4JYA Q;  1PTO H;  1PYW D;  3ND9 A;  1VQK A;  3M7N A;  3D31 A;  4C2M H;  4DAP A;  1I3Q B;  1K3R A;  2WB1 B;  3QOJ A;  2AMC B;  4XQQ A;  1HR0 Q;  1KNA A;  3TEH B;  1U4P A;  1DJR D;  3GV3 A;  1B8A A;  3I4M G;  1YNN D;  3PIO 3;  4ILW A;  4GLV B;  1CQV A;  3GTP H;  2OXP A;  1JOO A;  3VYR A;  4CKB A;  4ZLT F;  2D2C C;  4G57 A;  4CDC C;  4RG1 A;  3WDN A;  5I4D A;  1K3B C;  1PH4 A;  4OL7 A;  4L6T B;  4KJN A;  4DAV A;  5C4J B;  1SJE D;  1M1K C;  2R7Z G;  3NEM A;  4XQN A;  3X3N A;  3UDG A;  3DEO A;  1I94 Q;  2R93 B;  4DR4 L;  3ONA B;  4RCO A;  3BDC A;  1SYD A;  4K6D A;  2AQ2 B;  2HHH Q;  2L1B A;  1K83 H;  4C3I H;  2R7D A;  4MNO A;  2FMC A;  4ALP A;  3CCS A;  4DGZ A;  5IYC H;  2DGY A;  2R7F A;  3J81 c;  1BXT A;  4DV3 Q;  2K14 A;  3MHB A;  4DV0 Q;  2F0Q A;  1VF7 A;  3BG3 A;  4KKS A;  3CF5 A;  2EYO A;  3K5O A;  3I2Z A;  3JC6 6;  1EIG A;  3M4P A;  2NWG A;  2DJG C;  4OXP A;  4RAU C;  1EYG A;  4CGY B;  5M3F H;  3IAY A;  4JI7 Q;  3MVV A;  2E2H H;  4LF5 Q;  4A3B G;  1E1T A;  5F2D A;  1O7I A;  2L0C A;  2JJQ A;  1TR5 A;  4DV5 L;  2F52 A;  2R93 G;  1I4P A;  4DR1 Q;  4G4K A;  4JI0 Q;  3J7A 5;  3EN2 A;  4X62 L;  2B39 A;  4R8I A;  4BY7 G;  2K75 A;  4IN3 A;  4BBR H;  3BU2 A;  4A3F H;  4KY7 A;  5E4W C;  3CC7 A;  4DUZ L;  1SRU A;  4CDE C;  2A69 C;  5FLX L;  1L1O C;  4A3C G;  1CKO A;  3MEH A;  1VQP A;  1F2M A;  1WCM B;  2JA5 H;  4LJZ C;  2OQK A;  2YU9 H;  3J81 i;  3H91 A;  5GQO A;  3JAM c;  4DR3 L;  3I4N G;  3F1Z A;  1DGS A;  1GUG A;  4U68 A;  4HCS A;  2KCN A;  5K36 H;  4HCE A;  1HJP A;  4DR5 Q;  2Z1C A;  4DAM A;  4E6I A;  1O7Y A;  3AYH B;  1EY6 A;  1STE A;  4JI6 Q;  1CKN B;  2KA7 A;  1LT6 D;  1BR9 A;  3K81 C;  4WFN 3;  3Q6S A;  1L0Y B;  4DV4 Q;  1G6P A;  1KDC A;  1LTS D;  1EY9 A;  3FPU B;  1N32 L;  5C4Z A;  4EX5 A;  4BY1 B;  4OX9 L;  5BN4 A;  1DOM A;  5C44 G;  2ZTC A;  4BY7 B;  1TWF B;  1EIH A;  5ELD A;  2I07 B;  2QIL A;  3U9O A;  5E3F A;  5D3I B;  2VQE L;  1DCZ A;  1VQA A;  2B29 A;  2NZ1 D;  1QVF A;  2BOS A;  4XYO A;  3GDE A;  2H4O A;  2K5H A;  1TWC B;  4ZUJ A;  4DR2 L;  2O4X A;  4H44 C;  3R2I A;  2F0M A;  2FJ2 A;  1A2U A;  4HID A;  4GNX A;  2VS1 A;  4FYD A;  1VQO A;  3PUY A;  5M3M G;  5A2Q E;  1K83 B;  4QUF A;  2E2H B;  5KGU A;  2Q2U A;  2EYM A;  4AIM A;  3GO5 A;  2IX3 A;  1L1O A;  3VR2 A;  3S1Q B;  3GTJ H;  3HOZ G;  5AJ3 Q;  1Y1V B;  3I4N H;  1Y1V H;  3ND8 A;  2A19 A;  5C0X H;  4IFD G;  1Q86 C;  1E24 A;  2ID0 A;  1PZK D;  4RHR A;  1YIT A;  4L5T A;  3HOU G;  3OMG A;  1PRT C;  4LF8 Q;  4BBS H;  1KQS A;  2UUB L;  2Z6B A;  3VR6 A;  3KYH C;  1VQ5 A;  4A3M B;  4HSV A;  4BS9 A;  1KDA A;  1VQH A;  2D9U A;  1Q8K A;  1JC7 A;  1EQV A;  1PZI D;  3M3Y B;  1XNQ L;  1LM0 A;  2C35 B;  1PYS B;  1BOS A;  3D3R A;  5COR A;  2MQH A;  3E9H A;  1BF4 A;  3OYY A;  3GTO B;  4IUR A;  1GUO A;  4OEM B;  4G7O C;  1NUC A;  2VZA A;  5HUR A;  1SRO A;  3NTI A;  1JE5 A;  3CCU A;  4OIJ A;  1LTB D;  1H9S A;  4FXG C;  1OTC A;  1V43 A;  3ZJY C;  3BS1 A;  1N34 Q;  3TSS A;  2MGS A;  2MUY A;  5D3D A;  3H3V I;  3CCE A;  3VDY A;  1JT8 A;  1G2S A;  3PIP A;  3R3O A;  4HAE A;  2A6H D;  2DNE A;  2PNR C;  4A3M H;  1CSQ A;  2RCN A;  2Y0S G;  1RD9 D;  3V05 A;  2CW0 D;  1I4Q A;  5FLM G;  2B2T A;  1KL9 A;  4A3J H;  2WAQ E;  3K0Y A;  2J0T D;  1ONL A;  3V96 A;  4ULL A;  3K5M A;  1XX8 A;  5KNC A;  1EY8 A;  3KOJ A;  1BNZ A;  1WCM H;  4RCN A;  1E3P A;  1HRJ A;  3I4M B;  1TS3 A;  3IKJ A;  2PO4 A;  4JCV E;  2E2I B;  3GTL H;  1A62 A;  3HRZ C;  5J1Z A;  3F2U A;  4GOP B;  5CV5 A;  3PO2 B;  1WTH A;  4JV5 Q;  2IL8 A;  4IFD J;  3F2B A;  2O5I C;  4JI5 Q;  2RA4 A;  3W2D A;  1ROD A;  4CKE A;  2M00 A;  1STY A;  2KEN A;  1CKM A;  3P7J A;  3SHL A;  5DM7 3;  1B7Y B;  3HFZ B;  1SYE A;  3J80 E;  4K8J A;  5M3F B;  1AE3 A;  1WI5 A;  4HJ7 A;  1PTO C;  2VQF Q;  4DK1 A;  3VA7 A;  1SR3 A;  3PMF A;  4JPB W;  2VUM G;  2UXB L;  1S5C D;  4BBR G;  1SMX A;  2BE5 D;  3SEB A;  4XT3 B;  4JI1 L;  3RNU A;  2F4V L;  2CW0 C;  3KF6 A;  3J80 L;  1NMF A;  4PV1 C;  3TS0 A;  2F3I A;  3STB D;  4G7H C;  1VQ6 A;  4CBV A;  2VUM B;  1EEI D;  4ME3 A;  1STN A;  3TDQ A;  5KYL A;  1YNJ D;  1BCP C;  3HOY H;  1FR3 A;  2NVX H;  4UY8 C;  3AFP A;  1E2Z A;  4HN7 A;  3K7A B;  1STA A;  4Z9C B;  1N34 L;  3PO2 G;  2MPM A;  5FO8 B;  4YWK A;  2PYK A;  2AUJ D;  2Z0S A;  1TWG H;  3Q0A A;  2NTT A;  3NK9 A;  4A3I H;  2I5H A;  4GOP A;  1B3Q A;  4GS3 A;  1YHQ A;  1JMC A;  5C3E B;  2L11 A;  1QCB D;  4XYQ A;  1I4G A;  1OXS C;  4JI8 Q;  5C4H A;  2QEJ C;  2WB1 E;  1EQT A;  4K5X A;  1LTT D;  4LFB Q;  1RTO A;  3DUZ A;  4IOC A;  1O7Z A;  5BN5 A;  4PMW A;  1JJ2 A;  4NB3 A;  1W6J A;  3UE0 A;  3IFD A;  3KLW A;  2XVS A;  4OON A;  2HCC A;  5ELO A;  1SN8 A;  3FRP B;  4LF9 L;  3BZD B;  4G7Z C;  3TP5 A;  2RDH A;  2JA7 G;  3KLS A;  2G9H D;  4X3U A;  4DFA A;  4R4T A;  3OMC A;  2ZXP A;  1TU2 B;  1KDB A;  2HUG A;  2PNH A;  4EQN A;  1RHP A;  1M4V A;  2EJG C;  1LYL A;  3U4Z A;  1QG7 A;  2I0Q A;  4A3J G;  3EVQ A;  4IPH A;  2B2V C;  3S1R H;  3EBE A;  1LT3 D;  5IGF A;  4KI0 A;  3S17 H;  1K8O A;  2SEB D;  3OW2 A;  1L0X B;  1HZC A;  4RGT A;  1MSH A;  5GAH C;  1HQM C;  3TP7 A;  1Y1W H;  2B2Y C;  4HMI A;  1Y8P B;  1G91 A;  4RGO S;  3NQI A;  1Q8I A;  2R92 B;  2RSN A;  3SGI A;  1NY4 A;  2OQ0 A;  3PO3 B;  1C4Q A;  4ZUI A;  2OEO A;  2AWO A;  1IL2 A;  5J22 A;  4C3I B;  2E2J B;  3PIP 3;  1CHQ D;  1CK1 A;  5FK9 C;  3S2D H;  1CA5 A;  2JA7 B;  2MFI A;  3NQT A;  5M5Y H;  2DJF C;  5FO9 B;  2AKW B;  1ESR A;  5FOB B;  3TN2 A;  1N33 L;  3T1H Q;  2NVT B;  5E7N A;  4HIM A;  1PRT F;  1C48 A;  2EYJ A;  1BO0 A;  4YIJ A;  2N78 A;  2LMC B;  3GQB A;  3I55 A;  4NDX A;  1HNZ Q;  4DXG A;  4A3L H;  3G6E A;  4AH6 A;  5M3M B;  2C9O A;  1R9T B;  2N88 A;  3Q8D A;  1GD7 A;  3I73 A;  1GJX A;  3OHX C;  4IJL A;  5CV8 A;  2D5D A;  3HOU H;  3J81 L;  3BDL A;  1NTG A;  5C0X G;  1XMQ L;  4QIW E;  4GNX B;  2QKI C;  2Z4I A;  3T1Y L;  5M5Y B;  1O7L A;  2PMZ E;  4BA2 I;  1SEB D;  1KLU D;  1HNX Q;  3HOZ H;  3MWY W;  3HOW B;  5I9O A;  5T1G A;  3TZU A;  3ZYY X;  1PTO B;  1J9O A;  5C6A A;  4PZ7 A;  4KY6 A;  2NVY H;  2KEE A;  3A8I E;  4ZRZ A;  1RDP D;  3G48 A;  1CSP A;  1LO5 D;  5M3M H;  5C44 B;  3M4O H;  1F2L A;  4XDX A;  3DXJ C;  3DWA A;  2K03 A;  1PTO F;  1LTL A;  5IWA L;  2C5C A;  3UDX A;  3PO2 H;  4DR2 Q;  4P74 A;  1HA5 A;  4JBW A;  4LFA L;  4KHP Q;  3MXP A;  3RLF A;  5JVG 3;  1SMY D;  1IW7 C;  4A3B H;  4GOP C;  1X3Q A;  2IX0 A;  2CVR A;  5IWA Q;  4TQU S;  3CME A;  1RF2 D;  1VCI A;  2YV5 A;  1CKN A;  1U0L A;  4KJO A;  3SK6 A;  3SE0 A;  3Q22 A;  3G7L A;  1YNX A;  4CJ1 B;  3RUZ A;  3HZX A;  1PTO D;  1K8G A;  4LMQ D;  1DXM A;  5IY0 A;  1YVC A;  3F2C A;  1E0B A;  3NWS A;  3RN5 A;  1KC8 C;  5TSS A;  3S17 B;  5LL6 X;  2A74 C;  1EY5 A;  1Q3L A;  1S4Z A;  1TT2 A;  1N33 Q;  2B3G A;  3JAM E;  1B53 A;  2F0T A;  2CFM A;  4KKT A;  2ASB A;  2SNM A;  1FJG L;  3DHQ A;  2YTX A;  2VQE Q;  2KCM A;  2F0D A;  4P71 A;  1G2T A;  2GVA A;  1V1P A;  4JI2 Q;  3T16 A;  4A3K G;  2P5Z X;  4KD4 A;  4A3D H;  5EAY A;  4J15 A;  2K52 A;  4OWX B;  1C7Y A;  2L4N A;  1K0R A;  1MHW C;  1N32 Q;  5ISR A;  1S5B D;  2PZT A;  4R4I A;  5G3L F;  2K04 A;  1Z47 A;  3TS2 A;  1ML0 D;  5FLM H;  3T1Y Q;  1EIF A;  3W5O A;  3K5L A;  2V4D A;  4A3B B;  5EGT A;  3B6Y A;  1PFS A;  3NSW A;  3PUW A;  4DV5 Q;  3J80 i;  2NZO A;  3TP8 A;  3A0J A;  4P72 A;  2WKD A;  4LFC L;  5FLX E;  2GN5 A;  1BCP F;  1HUM A;  4K2L A;  5KND A;  4A3K H;  3S16 H;  3CKI B;  3BYT B;  1VQI A;  3MTS A;  2ICE C;  3C2P A;  3OIP A;  4JYA L;  1ICF B;  2RDF A;  1ICW A;  4A3M G;  1AZQ A;  1JOR A;  1V9P A;  1UE5 A;  1SNC A;  4JI1 Q;  4P73 A;  3D4R A;  1TWC H;  2IHE A;  3FKI G;  4K2K A;  2Q8T A;  1TKW B;  5LL6 S;  2IX1 A;  3H3V H;  1KAB A;  3BVM A;  4OGQ C;  1EWI A;  1OXV A;  2F0W A;  1R9T H;  1VQG A;  2VQF L;  3L2P A;  2EE1 A;  5IGG A;  2R6G A;  1HNW Q;  2B2T C;  1SAP A;  1MSG A;  5DEH A;  2K01 A;  5CMD A;  2EDG A;  1GUT A;  4F87 A;  2MNA A;  3ERS X;  1EQR A;  3I56 A;  4A4I A;  4K5V A;  1TWH B;  4JI8 L;  5COY A;  2LXK A;  4J1M A;  1LTA D;  3J81 j;  1Y8N B;  1F2Z A;  4QB4 A;  2JA7 H;  4S3S A;  1YZ6 A;  5IT9 L;  4FXD A;  2KCT A;  1RL2 A;  1VMC A;  2N8N A;  5IYD G;  1S5E D;  2A6E C;  2K5W A;  1QOH A;  2F3V A;  2DUD A;  1VQC A;  3I4M H;  3EQL C;  4IUU A;  5DLQ E;  3TP6 A;  2F4V Q;  2ICI A;  2B2W C;  3N52 A;  4U67 3;  1Q46 A;  4GKK Q;  1XPR A;  2ZJQ A;  1CZG A;  2J4X A;  4RFB A;  4KK7 A;  5KEE A;  1HZB A;  3IRB A;  4IFD H;  1FGB D;  1HUN A;  1B70 B;  4UDU C;  3KF6 B;  1Q12 A;  4B9X A;  1NCV A;  4NW2 A;  4MTN A;  3C3L A;  2E74 C;  1GUN A;  3U58 A;  1BDO A;  4A3F B;  1VQM A;  3DWP A;  4FP5 D;  4NPS A;  4JI5 L;  2QW7 A;  5CV4 A;  3PIO A;  5E1F A;  2WKC A;  3A5U A;  5C4X H;  1HNW L;  4R4C A;  2HIV A;  1WTX A;  1Y14 B;  1MI2 A;  3RZD B;  4C3H G;  3GTG B;  2BH8 A;  3PSI A;  3ITP A;  2E76 C;  3FKI H;  1STH A;  2BDN A;  3HKZ E;  3RN2 A;  2Q2I A;  4A75 A;  4CDD C;  1LTR D;  4A76 A;  1IKM A;  3J80 c;  3DWQ A;  3KBX A;  2A6E D;  1IHZ A;  1MKH A;  2AUK A;  1Z6H A;  4QMG A;  1F9R A;  3L9A X;  3H09 A;  4H7B A;  1O78 A;  1WD1 A;  2VUM H;  2UXC L;  3IFT A;  4PMB A;  3GTJ B;  3W1G A;  4C1N I;  5T1I A;  1G29 1;  2NBF A;  2NZH A;  5IE8 A;  2BA0 A;  4QCL A;  3C1F A;  2NVY B;  1S40 A;  2JYO A;  1MJC A;  2B2V A;  1I6V C;  1B2T A;  1TWG B;  1PA6 A;  1HQR D;  4GLX A;  2O2L D;  4BBS B;  4X6A H;  1EU4 A;  2JE6 I;  1X65 A;  3HOX B;  2KOL A;  4ZAI A;  1XTD A;  1GKH A;  1EOT A;  5HY6 A;  1CTM A;  1IKL A;  1EUJ A;  4Y7N H;  3KF8 B;  3F8T A;  5AJ3 L;  2VW9 A;  1PV4 A;  4N9P A;  1BVS A;  4DR5 L;  2A8V A;  4DV7 Q;  3I8Z A;  2X6L A;  4C3H B;  2NTS A;  5IYB H;  5C4J H;  3SXH A;  3FHW A;  1JIC A;  2B2W A;  1EWH A;  1EFI D;  2YTY A;  3OWF A;  2KUM A;  5C3X A;  1JB3 A;  1QB5 D;  1I50 B;  3V2T A;  1YHB A;  4JI2 L;  4NKL A;  1CHP D;  4NMZ A;  5C4X B;  1EEF D;  2NYZ D;  2HIX A;  3NEL A;  4HJA A;  2XTI A;  4WJ3 M;  1GOZ A;  1G8Z D;  1SNM A;  3NHH A;  1YBY A;  2D62 A;  1NNX A;  1WVL A;  3CQZ H;  1J6Q A;  2VB3 X;  5M9O A;  1E2W A;  1AEX A;  4IUQ A;  3LNN A;  4O0A A;  4JI0 L;  1V1P B;  1DON A;  3I3C A;  3RZO H;  3FPP A;  5I6Y A;  5C5L A;  3S14 B;  1TWF H;  3WOE A;  3CCR A;  2I5L X;  3CCM A;  1AFP A;  4DXF A;  3GTK B;  3SK5 A;  4POF A;  1KAA A;  3PF5 A;  3E9I A;  2UUC Q;  1Z9F A;  3M4Y A;  2L5T A;  1YJN A;  1Q90 A;  1AW7 A;  2ATW A;  1YJW A;  4L5S A;  4LUZ A;  5HGT A;  2JA9 A;  4TKO B;  2CWA A;  1X56 A;  4HED A;  1SE8 A;  3LWE A;  1B9N A;  1KRS A;  1L1O B;  4LF4 Q;  2VXW A;  3STB C;  3RZO B;  4A3G H;  2FHT A;  3GTO H;  5D65 A;  3CCQ A;  2WFW A;  3KUP A;  4UAI A;  5EPJ A;  2JEB I;  4JW0 A;  1ZXT A;  3HKS A;  2A1A A;  4JV5 L;  5ELE A;  3UE1 A;  1T9H A;  1QUQ A;  4WJW A;  4GKJ L;  1WTO A;  1I94 L;  4OO1 G;  2BA1 A;  1L2F A;  3ULP A;  4LF8 L;  3MEF A;  3T1H L;  1I50 H;  2KHJ A;  2QGQ A;  1KIX A;  3LWU A;  1FJG Q;  1ZYR D;  3AB9 A;  1ENC A;  1DM0 B;  4DV4 L;  2JP1 A;  1NSN S;  3L3O C;  4A3I B;  1OXX K;  2EY5 A;  2ES2 A;  2XRQ D;  1BCP B;  2XN9 C;  5JAV A;  1FVI A;  3H94 A;  1ZKO A;  2F0H A;  3CAM A;  3K57 A;  1DYQ A;  1UE1 A;  3M3Y H;  2L12 A;  1A63 A;  3VYU A;  3HOY B;  2EQS A;  2EY6 A;  1CM9 A;  1PRT B;  2R92 G;  4XT1 B;  2E75 C;  1S5D D;  3CW2 C;  2R93 H;  1IXR A;  3QIA A;  4RGM A;  1HNZ L;  1QZH A;  2PMZ B;  3DLL A;  4B3T L;  1TWH H;  3C1E A;  3A7A B;  4R4Q A;  5J39 A;  4LW1 A;  3T51 B;  1AH9 A;  3TRE A;  1EU3 A;  2B2U A;  1MGS A;  4ZYS A;  1S3O A;  1IW7 D;  3MFY A;  4HTH A;  2K7V A;  3NP8 A;  2I46 A;  3S1Q H;  5I2Y A;  2M9V A;  3OWE B;  3KLR A;  1EY4 A;  3EJI A;  4CKC A;  4X3K A;  4GKJ Q;  3RMH A;  3FKI B;  2QEX A;  3RZD H;  4JBJ A;  2MJ8 A;  2XRS D;  4YWM A;  3D0F A;  3G71 A;  2O5J C;  1UAP A;  4A93 G;  5C3W A;  3P1H A;  1KHI A;  1W3S A;  1ZEQ X;  3S2H H;  2RSO A;  1E7Z A;  3G6J B;  4FXK C;  3CC4 A;  4LFB L;  4LF4 L;  5GAG C;  3N6R A;  1KNE A;  4JOI A;  2AWN A;  4O42 A;  5EPL A;  1Q1E A;  4DN4 M;  2B63 H;  5CYU A;  4DNI A;  3U9S A;  3PO3 G;  2X6G A;  1QVG A;  4IPD A;  3TQY A;  2G9D A;  4K8I A;  3GTM H;  3QWN A;  1HXY D;  1Q7Y C;  2XSC A;  1UNS A;  5FLX c;  2RVL A;  4EQ5 A;  5EKL A;  1QVC A;  5JJI A;  4Y52 H;  1S72 A;  3DEP A;  2BCO A;  2EJF C;  1JCK B;  4C2M B;  2JK8 A;  4QJF A;  4DV2 L;  5IT9 c;  3H3V C;  2LXJ A;  1EZ6 A;  5LMU Q;  2Z9H A;  5HGQ A;  3CU7 A;  4X66 Q;  5IGD A;  5EBD A;  1A6X A;  3HOV H;  1W6K A;  4LFA Q;  4KHP L;  3NE5 B;  4X62 Q;  2TSS A;  1VDZ A;  1VQN A;  4TRD A;  3O13 A;  5EQ0 A;  4NXM Q;  2UXB Q;  2MO1 A;  4GN4 B;  1E2V A;  2Q8I B;  1O80 A;  4DR4 Q;  2YYZ A;  4JVZ A;  2XWJ B;  3ERQ A;  4F8M A;  2DY7 A;  5CV9 A;  1IBM L;  3W3A A;  1UE7 A;  1ASY A;  1GUS A;  1HZA A;  1TXY A;  1H9M A;  2RHQ B;  5G3L D;  1PDQ A;  4OO1 I;  1B9M A;  4IOA A;  1D6E C;  2JA8 B;  1F2Y A;  1OXU A;  1NE3 A;  2F0G A;  3BZK A;  4AYB E;  5A2Q L;  4FF2 A;  3S9W A;  5C5M A;  5M5W H;  5M5X B;  4JI6 L;  4ME5 A;  2ZXO A;  2CHB D;  4K14 A;  4FF1 A;  4CHT B;  1XMO L;  1P16 A;  4RKB A;  4DV3 L;  1ET6 A;  1PH6 A;  1A3T A;  2E5L L;  1JJG A;  5FJ8 H;  4H0L C;  2KEC A;  3KF8 A;  2UXD Q;  1GXD C;  4R1J A;  3KDF B;  1YEZ A;  4DV6 Q;  2UU9 L;  3HOX G;  4XXE A;  1Q81 C;  1WJJ A;  2WV6 D;  2F0V A;  3GD7 A;  1TY2 A;  1SND A;  2QDL A;  1B4O A;  5LMN Q;  2ENB A;  1JWM D;  1KD1 C;  1T5X D;  1H9J A;  2FMM A;  2SNS A;  2HD3 A;  1HPC A;  3EIV A;  4DR1 L;  1WTR A;  2CH4 W;  2K5V A;  1SYC A;  2UUA L;  2PQE A;  4LF6 L;  1LTG D;  5I2X A;  1VQL A;  1SYG A;  2K33 A;  1VMP A;  3KDF A;  3HOW H;  1VQE A;  1RIP A;  3NWT A;  2NUC A;  3HOZ B;  2LSS A;  5C3E G;  1PFM A;  5IOC A;  4B08 A;  4UP9 A;  1B50 A;  3UI2 A;  3VYT A;  1SE2 A;  4KTA A;  5M5X H;  5M5W B;  4LNQ A;  3Q24 A;  1UWV A;  2QCP X;  5CC4 A;  4BY7 H;  4B3R Q;  3S15 B;  1RJT A;  3D6W A;  3D4W A;  3NUC A;  2RDG A;  2VNU D;  1XNQ Q;  3OPO A;  1SFO B;  3I72 A;  2B2Y A;  4QL5 A;  3E5S A;  4DV0 L;  3S1R B;  3M7G A;  1A15 A;  1D5X C;  2E5L Q;  3K6O A;  2X69 A;  3WWV A;  2XGT A;  1ENA A;  4JG2 A;  1U5K A;  2N49 A;  1JOQ A;  1L0W A;  4OWW B;  2F0F A;  3CMA A;  4A3E G;  3HGB A;  1K0S A;  3PUZ A;  4KMU C;  3A5Z B;  1K28 A;  4DK3 C;  3HOV B;  2WII B;  2BH2 A;  3J7Y W;  5JEA J;  1GHJ A;  4DUY Q;  2IT1 A;  3HKZ G;  4HJ5 A;  4FO2 A;  2ZM6 L;  1VQF A;  1JQY D;  2F0I A;  2KHI A;  4KN7 C;  5EJW A;  1C8C A;  4DR7 L;  2OCE A;  5IYD H;  3ER0 A;  3BYY B;  3CHB D;  5ELC A;  3HOW G;  3E3X A;  1SSO A;  1H9S B;  2SOB A;  2GA4 B;  2RKS A;  1N36 L;  4P75 A;  1EIY B;  2K32 A;  3ICE A;  5GRO A;  1QIL A;  4X64 Q;  3R93 A;  2Z6K C;  4LUO A;  2K50 A;  3HEJ A;  2EJM A;  4A93 H;  4V0B A;  4K0K Q;  1FYC A;  5EBC A;  5KYI A;  1I6H H;  1I4R A;  3NPP A;  4Q0F A;  1E22 A;  2CQO A;  4YWL A;  4QUC A;  1CI3 M;  4OIK A;  1DOL A;  5AFW A;  5ELF A;  3CCV A;  4GZY C;  3K5N A;  1EYD A;  1SFO H;  1DOK A;  4ODG A;  5IT9 E;  4KN4 C;  2A6H C;  3KFU A;  4HJ9 A;  4A3K B;  2HT1 A;  1YNN C;  2WAQ B;  1CZW A;  4QGU A;  3K8A A;  3FDT A;  1SDF A;  3DMU A;  4F7X A;  3SVM A;  5E4X A;  3OSO A;  2K4K A;  5JPM C;  2Z8L A;  4AQY L;  4JI3 Q;  3I4O A;  4K6L A;  3J7A V;  4ZKC B;  4RH6 A;  3Q23 A;  5JPN C;  2IHF A;  1I5F A;  5C3E H;  4WRD A;  1QJO A;  5I9P A;  3K58 A;  1HCZ A;  1HFG A;  1YHA A;  4HJ8 A;  3MC0 B;  2K5N A;  5C4X G;  3PV0 A;  3MAQ A;  1G6Z A;  4AYB G;  1QWY A;  1TWA H;  1XNR Q;  2Q2H A;  3K7A H;  2FFK B;  1YIJ A;  4YCU A;  1WTW A;  4K5W A;  2ZTD A;  2EVB A;  1NAP A;  1J5E Q;  3I4L A;  3PO3 H;  1RCV D;  2R92 H;  4DAY B;  2UUB Q;  3R8B A;  4OO1 H;  4NXN L;  3I7F A;  1EZ8 A;  4RA8 A;  1K9M C;  2BDO A;  3CRK C;  1R4P B;  1QZG A;  1D8L A;  5C0X I;  4A3E B;  3PF4 A;  1I4X A;  2EY1 A;  4BBS G;  3LGJ A;  1HA6 A;  2IW3 A;  1ILQ A;  1JB7 A;  2R7Z H;  1UE6 A;  3CCL A;  2EYP A;  4IPC A;  3QR8 A;  4JI7 L;  2NN6 G;  5JEA G;  1MBY A;  4IFD I;  2RCF A;  3VA5 A;  5DAU A;  4DR3 Q;  1XWE A;  1FL0 A;  2IWH A;  1AE2 A;  1VF5 C;  4YY3 Q;  3A8J E;  1K8A C;  4DNR B;  4OWT B;  1D5M C;  4KLK A;  1QNU A;  2PI2 A;  5BR8 L;  3A54 A;  2LY7 A;  1OO9 B;  3S15 H;  1JOK A;  1LT4 D;  2JEA I;  4KKU A;  2A73 B;  1U4M A;  1FGU A;  4KHV A;  5LMN W;  2RBM A;  5IIF A;  2YTV A;  2XWB B;  1OXT A;  4M8A A;  1II3 A;  2L55 A;  1V8Q A;  5JVH 3;  1E1O A;  1MIU A;  2F0O A;  3J7Z C;  2DN8 A;  5IYC G;  1BKB A;  4A3J B;  2A68 D;  4L8J A;  3K0X A;  2EY2 A; 
#chains in the Genus database with same CATH homology
 1WFQ A;  4IO9 A;  1YJN A;  1XJV A;  1N34 L;  3PO2 G;  3M4Q A;  4DV1 L;  4YWK A;  1YJW A;  2ATW A;  1PH7 A;  4L5S A;  4YHH L;  4LUZ A;  4MZ9 A;  2JA9 A;  1VQD A;  4QQB X;  5C44 H;  2Z0S A;  1KAW A;  1TWG H;  2CWA A;  1WOC A;  5ELN A;  1X56 A;  5IP7 H;  1HNX L;  4A3I H;  2I5H A;  1SE8 A;  4JBM A;  4GOP A;  4GS3 A;  2RF4 A;  1YHQ A;  1JMC A;  1XMQ Q;  2HQL A;  1KRS A;  1L1O B;  1OXS C;  4JI8 Q;  2ZM6 Q;  4LF4 Q;  1VQB A;  2WB1 E;  3STB C;  3AFQ A;  2B63 G;  1Q1B A;  1UEB A;  4A3G H;  1MJE A;  3NEN A;  5J3B A;  3GTO H;  4LFB Q;  1Y1W G;  2OWO A;  4IOC A;  4DR6 Q;  4PMW A;  3CCQ A;  1JJ2 A;  2H5X A;  2WP8 J;  2WFW A;  4NB3 A;  1N8R C;  3UE0 A;  2D0P A;  1YJ9 A;  2JEB I;  3KLW A;  3HKS A;  2A1A A;  4JV5 L;  4OON A;  3CD6 A;  5ELO A;  2HHH L;  1NMG A;  3UE1 A;  4B3M Q;  1T9H A;  1SN8 A;  1QUQ A;  4LF9 L;  4GKJ L;  1GM5 A;  3ULL A;  4NXN Q;  1NBW A;  1I94 L;  1KXL A;  4K0K L;  4OO1 G;  2IY5 B;  2BA1 A;  1X6O A;  1GVP A;  4JI4 Q;  1L2F A;  2I5M X;  4FDB A;  3ULP A;  2L15 A;  3MEF A;  1I50 H;  3T1H L;  4LF8 L;  2JA6 G;  2JA7 G;  4A3L G;  4R4T A;  2UXD L;  2KHJ A;  2QGQ A;  4A3G G;  1KIX A;  4DUZ Q;  1FJG Q;  2PNH A;  2JA6 H;  2JQO A;  3W1B A;  3KJP A;  1PH5 A;  1X3F A;  1LYL A;  3U4Z A;  2NVT H;  4BA1 I;  4DV4 L;  1PHJ A;  2I0Q A;  4A3J G;  3NBH B;  4B3S L;  3AQQ A;  3HOX H;  1XPU A;  4IPH A;  1OXX K;  1K73 C;  3S1R H;  3EBE A;  2ES2 A;  3K80 C;  1XNR L;  3S1N H;  4A3I G;  4KI0 A;  2MO0 A;  4X65 Q;  4LF6 Q;  1FVI A;  3S17 H;  4POG A;  3OW2 A;  3CAM A;  1HZC A;  1PH2 A;  1UE1 A;  3M85 A;  3M3Y H;  5GAH C;  1PH1 A;  1VQJ A;  5C0X J;  1A63 A;  1Y1W H;  4BY1 H;  2ZTE A;  4UPA A;  2EQS A;  2RHS B;  2R92 G;  1BBW A;  3CW2 C;  2R93 H;  2N3S A;  1IXR A;  1ASZ A;  1HNZ L;  3SGI A;  1G51 A;  1NY4 A;  2OQ0 A;  1QZH A;  1EFW A;  4LF7 L;  1CUK A;  3DLL A;  2PI2 E;  4B3T L;  1TWH H;  2UUA Q;  2AWO A;  1IL2 A;  4RMF A;  4XIG S;  2NVQ H;  4R4Q A;  5M3F G;  4LW1 A;  2E2J H;  1AH9 A;  2PQA B;  4BY1 G;  3CP0 A;  1J5E L;  3TRE A;  1Q82 C;  3S2D H;  2GVB A;  2MFI A;  5M5Y H;  1S3O A;  2AKW B;  3S1Q H;  1N33 L;  3T1H Q;  4LWC A;  5GAD C;  3H15 A;  5E7N A;  1IBL Q;  4JYA Q;  4HIM A;  1PH9 A;  1LUZ A;  1VQK A;  3M7N A;  2UXC Q;  3GTQ H;  2N78 A;  3D31 A;  4QY7 A;  2CCZ A;  4LF9 Q;  4GKJ Q;  4APV A;  4C2M H;  3I55 A;  2QEX A;  2OTL A;  3RZD H;  4JBJ A;  1HNZ Q;  1K3R A;  1IBK L;  4A3L H;  3G6E A;  4YWM A;  2JA8 H;  3D0F A;  4AH6 A;  2AMC B;  3G71 A;  1HR0 Q;  3HOV G;  4A93 G;  3Q8D A;  1GD7 A;  1W3S A;  1KHI A;  3TEH B;  4A3E H;  3S2H H;  4IJL A;  1E7Z A;  1B8A A;  3CC4 A;  4LFB L;  3I4M G;  3U50 C;  1WYD A;  3HOU H;  3A74 A;  3GTG H;  4GLV B;  4LF4 L;  3GTP H;  1NTG A;  5C0X G;  1XMQ L;  1D7Q A;  4QIW E;  4GNX B;  5GAG C;  1YI2 A;  3T1Y L;  2PMZ E;  4RG1 A;  4JOI A;  4BA2 I;  2AWN A;  1PVO A;  4LF5 L;  1HNX Q;  3HOZ H;  1Q1E A;  4GLA C;  1PH4 A;  2B63 H;  4LUV A;  4DNI A;  3PO3 G;  5LMN L;  1JJC B;  4PZ7 A;  1QVG A;  1M1K C;  4IPD A;  3TQY A;  2NVY H;  2R7Z G;  3GTM H;  3NEM A;  1Q7Y C;  3G48 A;  1CSP A;  5M3M H;  5FLX c;  3M4O H;  3H0G H;  4EQ5 A;  1QVC A;  3UDG A;  5JJI A;  1I94 Q;  1S72 A;  4Y52 H;  4DR4 L;  1BBU A;  3RLO A;  2JK8 A;  1GO3 E;  4PZ6 A;  4QJF A;  4DV2 L;  1LTL A;  4DV2 Q;  5IT9 c;  1HH2 P;  5IWA L;  2LXJ A;  3UDX A;  3OTO Q;  3PO2 H;  2HHH Q;  5LMU Q;  1PH3 A;  5HGQ A;  1K83 H;  4X66 Q;  1VQ8 A;  4C3I H;  4DR2 Q;  4GKK L;  2R7D A;  4P74 A;  3HOV H;  4MNO A;  4ALP A;  3E0E A;  4JBW A;  3CCS A;  4LFA L;  4KHP Q;  5IYC H;  3RLF A;  2DGY A;  4LFA Q;  4KHP L;  2R7F A;  4X62 Q;  1W2B A;  3J81 c;  4DV3 Q;  4A3B H;  1KRT A;  1VQN A;  1VS0 A;  4GOP C;  2K14 A;  4DV0 Q;  5GAE C;  3CF5 A;  1H95 A;  2IX0 A;  4NXM Q;  2UXB Q;  1N36 Q;  2MO1 A;  5IWA Q;  3OTO L;  4TQU S;  3CME A;  4GN4 B;  1IYJ B;  1VCI A;  2YYZ A;  2YV5 A;  3I2Z A;  3RR5 A;  4DR4 Q;  1CKN A;  1U0L A;  1IBM L;  1UE7 A;  1ASY A;  1HZA A;  1TXY A;  2RHQ B;  3JC6 6;  3M4P A;  2WAQ G;  4OO1 I;  1YNX A;  4OXP A;  1EYG A;  4YCV A;  4IOA A;  1K8G A;  1OXU A;  1NE3 A;  3BZK A;  1YVC A;  5IY0 A;  5M3F H;  4AYB E;  4JI7 Q;  3F2C A;  4A3B G;  2E2H H;  4LF5 Q;  1E1T A;  2PQA A;  1O7I A;  4TVA B;  5M5W H;  3RN5 A;  1KC8 C;  2JJQ A;  4JI6 L;  4DV5 L;  3G4S A;  2F52 A;  2R93 G;  4DR1 Q;  4JI0 Q;  3J7A 5;  4X65 L;  1XMO L;  1P16 A;  4DV3 L;  5IP9 H;  1VQ7 A;  3EN2 A;  4X62 L;  4WJ4 A;  1PH6 A;  1N33 Q;  4BY7 G;  2B3G A;  2K75 A;  2E5L L;  3M9B A;  4UP8 A;  2CFM A;  3BU2 A;  3BZC A;  4BBR H;  4A3F H;  4X66 L;  5FJ8 H;  1HR0 L;  3CC7 A;  2ASB A;  1JJG A;  4DUZ L;  1SRU A;  2WB1 G;  1FJG L;  2YTX A;  2UXD Q;  4R1J A;  2KCM A;  1L1O C;  2VQE Q;  4A3C G;  4P71 A;  2ZJP A;  3KDF B;  4JI4 L;  2GVA A;  1YEZ A;  4DV6 Q;  2UU9 L;  4IPG A;  1X54 A;  1CKO A;  4JI2 Q;  3HOX G;  4A3K G;  1VQP A;  1I3Q H;  1WJJ A;  1Q81 C;  4A3D G;  4A3D H;  2JA5 H;  3GD7 A;  5EAY A;  4YY3 L;  1C9O A;  4J15 A;  2K52 A;  4B3T Q;  2OQK A;  2VY3 A;  4OWX B;  3J81 i;  1K0R A;  1C7Y A;  5GQO A;  1WCM G;  3JAM c;  4DR3 L;  3L0O A;  2YU9 H;  4LF7 Q;  3I4N G;  1N32 Q;  3F1Z A;  1DGS A;  4KHZ A;  1HR0 W;  5LMN Q;  4R4I A;  2E2I H;  1Z47 A;  1HJP A;  4GN5 A;  4DR5 Q;  1KD1 C;  4LFC Q;  3TS2 A;  5FLM H;  3L7Z C;  3T1Y Q;  1EIF A;  3W5O A;  4DAM A;  1XMO Q;  2NN6 I;  2CKZ B;  3EIV A;  1X3G A;  4DR1 L;  3AYH B;  1PFS A;  3B6Y A;  2K5V A;  3PUW A;  2UUA L;  4GN3 B;  2Q2T A;  3CC2 A;  2JA8 G;  4DV5 Q;  4LF6 L;  4JI6 Q;  1CKN B;  3GTK H;  1VQL A;  3J80 i;  3K81 C;  3KDF A;  4JBK A;  3HOW H;  1VQE A;  1RIP A;  2NZO A;  3A0J A;  4P72 A;  4LFC L;  2GN5 A;  3S14 H;  2LSS A;  4DV4 Q;  4A3K H;  4B3S Q;  5C3E G;  4BXX H;  3S16 H;  1G6P A;  1EOV A;  4YHH Q;  4UP9 A;  1IBK Q;  1VQI A;  1N32 L;  1A0I A;  1SLJ A;  4HIO A;  4EX5 A;  4OX9 L;  3PUX A;  5M5X H;  4LNQ A;  1IBM Q;  1UWV A;  2E8G A;  1X3E A;  4O2D A;  5C44 G;  2ZTC A;  4DV6 L;  2UU9 Q;  4BY7 H;  4JYA L;  4B3R Q;  1N9W A;  4B3M L;  2VQE L;  2VNU D;  1XNQ Q;  1VQA A;  1EQQ A;  2B29 A;  1QVF A;  4QL5 A;  4DV0 L;  4A3M G;  4B3R L;  1V9P A;  1UE5 A;  2E5L Q;  3GDE A;  3WWV A;  2K5H A;  3AEV A;  2XGT A;  4JG2 A;  4JI1 Q;  4P73 A;  4DR2 L;  4BXX G;  1U5K A;  1TWC H;  2IHE A;  3FKI G;  3KJO A;  2N49 A;  4C3H H;  2IX1 A;  3H3V H;  1L0W A;  1EWI A;  1OXV A;  3U4V A;  4OWW B;  1R9T H;  1VQG A;  2VQF L;  3CMA A;  3L2P A;  4HID A;  4HIK A;  3PUZ A;  4A3E G;  1X55 A;  2R6G A;  3A5Z B;  1HNW Q;  4GNX A;  2VS1 A;  4DK3 C;  1VQO A;  3PUY A;  5M3M G;  2ZJR A;  2BH2 A;  2ALY B;  4DR6 L;  5JEA J;  2MNA A;  3ERS X;  2Q2U A;  1EQR A;  3I56 A;  3HKZ G;  2IT1 A;  3GO5 A;  4AIM A;  4A4I A;  1L1O A;  4DUY Q;  4HJ5 A;  5K36 G;  4JI8 L;  2ZM6 L;  1VQF A;  2LXK A;  2KHI A;  3GTJ H;  3HOZ G;  5AJ3 Q;  3J81 j;  2OCE A;  3I4N H;  1Y1V H;  2EXD A;  3ER0 A;  3HOW G;  4DR7 L;  5IYD H;  2JA7 H;  1YZ6 A;  1RL2 A;  2FXQ A;  2KCT A;  2D0O A;  1Y1V G;  2N8N A;  5IYD G;  1N36 L;  2A19 A;  4UP7 A;  4JOI C;  4P75 A;  4NXM L;  4IFD G;  1Q86 C;  1EIY B;  1M90 C;  3ICE A;  1E24 A;  5GRO A;  2ID0 A;  3TRZ A;  4PG3 A;  4X64 Q;  2DUD A;  1VQC A;  4L5T A;  2Z6K C;  4LUO A;  1YIT A;  3HOU G;  3I4M H;  2K50 A;  3K7U C;  5DLQ E;  1VQ9 A;  4LF8 Q;  2F4V Q;  4BBS H;  1KQS A;  1Q46 A;  4GKK Q;  3BJU A;  2UUB L;  4A93 H;  4K0K Q;  1XPR A;  3KYH C;  1VQ5 A;  4L5Q A;  3CPW A;  5LMU L;  2ZJQ A;  1I6H H;  1E22 A;  1VQH A;  1HZB A;  1Q8K A;  2CQO A;  3IRB A;  1XPO A;  3CXC A;  1B70 B;  1IBL L;  4YWL A;  4IJH A;  1XNQ L;  3KF6 B;  1LM0 A;  2C35 B;  1PYS B;  1Q12 A;  3CCV A;  2AHO B;  2MQH A;  3E9H A;  4MTN A;  3OYY A;  5IP7 G;  1SFO H;  5FJ8 G;  4OX9 Q;  4DV7 L;  4A3F G;  5BR8 Q;  3KFU A;  4HJ9 A;  2HT1 A;  3U58 A;  4GNX C;  1VQM A;  2VZA A;  1SRO A;  1JE5 A;  4QGU A;  3K8A A;  3CCU A;  4NPS A;  4JI5 L;  3HOY G;  3PIO A;  1OTC A;  3A5U A;  5C4X H;  4PZ8 A;  1V43 A;  3ZJY C;  1HNW L;  4R4C A;  4JI3 L;  4AQY Q;  2HIV A;  2K4K A;  2VL6 A;  1Y14 B;  4AQY L;  4JI3 Q;  3I4O A;  1N34 Q;  2BH8 A;  3PSI A;  3FKI H;  3H3V I;  2IHF A;  3HKZ E;  1I5F A;  2EIF A;  5C3E H;  3CCE A;  3RN2 A;  3VDY A;  2Q2I A;  4A75 A;  1JT8 A;  3DM3 A;  1A8V A;  4A76 A;  3PIP A;  3J80 c;  1YHA A;  2V1C C;  2CWP A;  1MKH A;  4HJ8 A;  4A3M H;  2K5N A;  5C4X G;  3PV0 A;  1PH8 A;  1CSQ A;  2RCN A;  2VUM H;  2Y0S G;  4AYB G;  2UXC L;  3W1G A;  1QUQ B;  1TWA H;  1G29 1;  2Q2H A;  3K7A H;  5H1S E;  1XNR Q;  2NZH A;  1HZ9 A;  5IE8 A;  2BA0 A;  1KL9 A;  5FLM G;  4A3J H;  1S40 A;  2WAQ E;  2QA4 A;  1YIJ A;  3CPF A;  1MJC A;  4YCU A;  4L5R C;  2ZTD A;  4R4O A;  1PA6 A;  1J5E Q;  3KOJ A;  3PO3 H;  1WCM H;  3JAM i;  5IYB G;  4C3J H;  2R92 H;  4GLX A;  1P8L A;  4DAY B;  1E3P A;  2UUB Q;  4X6A H;  2JE6 I;  4NXN L;  1X65 A;  3I7F A;  4DK6 C;  1K9M C;  2OTJ A;  1C0A A;  1IZ6 A;  1XTD A;  4JCV E;  5JJK A;  3GTL H;  1A62 A;  4GOP B;  4JV5 Q;  1QZG A;  1GKH A;  4IFD J;  3F2B A;  1D8L A;  5HY6 A;  4XTC S;  5C0X I;  4JI5 Q;  3PF4 A;  3H0G G;  1NJI C;  4Y7N H;  1EUJ A;  2KEN A;  3KF8 B;  3LGJ A;  4BBS G;  3F8T A;  3S1M H;  1X9N A;  4DPG A;  4DKA C;  5AJ3 L;  2VW9 A;  1UE6 A;  1PV4 A;  1CKM A;  1JB7 A;  2R7Z H;  4DR7 Q;  1BVS A;  4DR5 L;  3CCL A;  4IPC A;  4DV7 Q;  2A8V A;  4JI7 L;  2NN6 G;  5IYB H;  5JEA G;  1PYB A;  1B7Y B;  5C4J H;  1VQ4 A;  3S24 A;  3HFZ B;  4IFD I;  3FHW A;  4DR3 Q;  2YTY A;  3PCO B;  2JA5 G;  1FL0 A;  2Z6K A;  1AE2 A;  1AE3 A;  1YHB A;  4YY3 Q;  1K8A C;  4OWT B;  1WI5 A;  4JI2 L;  3UDF A;  4HJ7 A;  3ULJ A;  2VQF Q;  4KLK A;  4A3C H;  3NEL A;  2HIX A;  4DV1 Q;  4HJA A;  2XTI A;  2KBN A;  4WJ3 M;  2PI2 A;  1SR3 A;  2VUM G;  5BR8 L;  2UXB L;  2UUC L;  3S15 H;  3UDI A;  1SMX A;  1YBY A;  4BBR G;  2D62 A;  2JEA I;  3MXN B;  3CQZ H;  1J6Q A;  4JI1 L;  3RNU A;  2F4V L;  1FGU A;  4H02 A;  5IP9 G;  5LMN W;  3KF6 A;  1NMF A;  2YTV A;  4X64 L;  3RLN A;  3TS0 A;  4O0A A;  4JI0 L;  2F3I A;  1OXT A;  4JC0 A;  5JJL A;  3STB D;  1VQ6 A;  3RZO H;  4ME3 A;  1V1Q A;  3F2D A;  1TWF H;  2Y0S E;  3CCR A;  1E1O A;  1MIU A;  2I5L X;  3PGZ A;  3J7Z C;  3CCM A;  5IYC G;  1BKB A;  3HOY H;  4YCW A;  3CCJ A;  3PUV A;  4POF A;  2NVX H;  4UY8 C;  3PF5 A;  3AFP A;  3E9I A;  3K0X A;  2UUC Q;  1Z9F A;  3FP9 A;  4DUY L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...