2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
1B7YB 1LUZA 3STBD 3M4PA 1PFSA 2RHQB 5IWAQ 4BY7H 3L7ZC 1PH5A 2JA9A 5GQOA 4KLKA 3K81C 4BY1H 5EAYA 3GTKH 2UXDL 4XTCS 4X66L 1B70B 4IPHA 5C44H 1L1OC 1CKNB 1TWHH 4NPSA 4YCWA 4X65Q 2K52A 3J81i 3PV0A 2CQOA 2GVBA 1P16A 4DR2Q 4DV7Q 3J81j 1TWCH 4KHPQ 4A75A 3I4NG 1NJIC 3I2ZA 2K75A 1Z47A 2VW9A 1XMOL 3CCLA 1VQCA 3G48A 2L15A 2EIFA 3S1QH 3CCRA 1WOCA 1A0IA 3STBC 4DAYB 2UUBL 4OX9Q 3PO2H 4A3MG 1VQ5A 1VQNA 3M9BA 2ZJRA 1YJNA 2MNAA 5LMUL 1UE5A 4HJAA 2WB1G 1JE5A 3S2DH 1G6PA 3A5UA 2Q2TA 1QVFA 1WJJA 1IZ6A 2BA1A 4DR4L 3MEFA 1E1OA 4FDBA 1PH6A 1TWAH 1D8LA 1WCMG 2D0OA 3CPWA 1IBLQ 5BR8L 2ZM6Q 2IHFA 3OYYA 3ULJA 4MNOA 4APVA 4POGA 4JI1L 2HT1A 1GO3E 4BBSH 5LMUQ 4C3HH 4YHHL 2UUAL 2B63H 1A62A 3S1NH 4DR6L 1Q7YC 2OQ0A 3K7UC 4BA1I 3JAMi 5ELOA 3NBHB 3HOVH 1XTDA 1OXVA 1X3FA 2UXBQ 3CQZH 2BH8A 2NN6I 4JI2L 4BA2I 2NZOA 5M3MH 2UXDQ 1RIPA 3RR5A 4EQ5A 4LFBL 2R7DA 3S16H 5C3EG 2MQHA 4IFDJ 2F3IA 4L5TA 3PIOA 2VQFL 2UXCQ 3RNUA 3PO2G 1SFOH 5C44G 4DV5Q 1I6HH 4AIMA 1VQ4A 5DLQE 1QVGA 1EWIA 4LFBQ 2HIXA 3HFZB 3ULLA 4JI2Q 3KLWA 4X62Q 4A3IH 4BBSG 4JI0Q 1HNXQ 1B8AA 5FJ8H 1LYLA 1X3EA 4LUZA 4HJ8A 4IJHA 4JBMA 1E3PA 2RHSB 3EN2A 1HR0L 3HOYH 3S17H 5GROA 3I56A 2H5XA 2ZJQA 3NENA 2E5LQ 1OXTA 2IX0A 4A3MH 3KDFA 1W3SA 4HIKA 1E1TA 3PUXA 1K83H 4GOPB 2K5NA 1OTCA 4LF8L 2JA6H 4JV5L 4GLXA 2WP8J 3F2CA 3AQQA 3EIVA 4JBJA 2EQSA 1VQLA 4R1JA 4JI8L 5IT9c 2E5LL 1BBWA 4DKAC 2NVQH 3I4NH 1IXRA 5LMNQ 1R9TH 5M5XH 1JJGA 3RLOA 1NMFA 2E8GA 3EBEA 3KJPA 3CCSA 3TREA 5M3FH 4DV1L 4DV3L 3FHWA 2QA4A 4HIDA 1FGUA 1PV4A 1VQ8A 1XNQQ 3JC66 1L2FA 2Y0SE 4JI0L 4C2MH 4DR7Q 1J5EL 2N8NA 1N32L 3U4ZA 1PVOA 5GAGC 1FL0A 2JA7G 2RF4A 1IYJB 2JA7H 4LW1A 3J81c 3VDYA 4X6AH 4JBKA 4JCVE 4B3TQ 1I5FA 1L0WA 4JG2A 4DV7L 4DR2L 5ELNA 1KQSA 1JB7A 5HY6A 4RG1A 2R7ZG 1EIFA 3AFQA 5C3EH 3SGIA 1FVIA 5E7NA 2E2IH 2Y0SG 2HHHQ 3GTPH 1H95A 4DV5L 4AYBE 1AE2A 3T1HL 2ID0A 1VS0A 3CCMA 2CFMA 4QGUA 1WI5A 2GN5A 3GTGH 4KHZA 3UE0A 2D62A 1HNWL 3CC2A 1OXSC 2YTYA 3BJUA 2B63G 2OQKA 1K8GA 3H15A 1PH8A 4GN4B 1KAWA 2KENA 1VQFA 1CUKA 1NTGA 3H0GH 1QZHA 3S1MH 4A3CG 2LXKA 4LF9L 1VQAA 1HZAA 4DUYQ 3UDGA 2F4VQ 3DLLA 1U0LA 2ZM6L 1TXYA 1V9PA 1IBLL 2OTLA 5FLMH 4LF6Q 1E24A 1VQIA 4KI0A 1VQMA 5C0XG 3J80i 1LM0A 4K0KQ 2GVAA 4GNXC 3G6EA 4A4IA 4JI3Q 3HOWH 2QGQA 4P72A 3GDEA 1VQHA 2N49A 4C3IH 3S15H 3M4OH 4OONA 2NVXH 2YYZA 4DV2L 3KYHC 4JC0A 1YHBA 4YWLA 3PO3H 1GKHA 4A3JG 1EQQA 2QEXA 1AE3A 4JI3L 5H1SE 1EUJA 3I4MH 3G71A 1UE6A 4GN5A 2ZJPA 1PH3A 1KL9A 1VQDA 2B3GA 3U4VA 2BA0A 1HNZL 4PZ7A 1CSPA 1SLJA 2Q2UA 2VUMG 5K36G 2R93H 4LF5L 4QIWE 5LMNW 2PQAB 4IOCA 3RN2A 3TQYA 1EQRA 1UWVA 3L0OA 2IHEA 4UPAA 4NB3A 1A8VA 3PUYA 2KHJA 3HOUG 4A3DG 4GKJL 1Y1VH 5IYCH 3GTQH 4BY7G 2IY5B 1X6OA 2NN6G 4HIMA 2R92H 3A0JA 3ICEA 1VQKA 5IYBG 4GKKQ 1Q12A 4TVAB 4GOPA 1XMQQ 1YHAA 1JMCA 2A8VA 2CKZB 3RLNA 3W1BA 1UEBA 1X3GA 2YV5A 1I3QH 4IPGA 3I55A 4HIOA 1XNRQ 1Q46A 1C7YA 5AJ3L 4DR3Q 4UP7A 2JA8G 3K0XA 1S3OA 3H3VI 5M5YH 3J7A5 1KHIA 3M7NA 4A3LH 5C4XG 1M1KC 4PZ8A 3WWVA 1PH2A 1N34Q 4A3KG 1Y1VG 1WYDA 2KCTA 4OO1G 1V43A 4PG3A 4DV3Q 4LF7Q 4B3MQ 5IP9G 1Y14B 3M4QA 1HR0W 4P73A 2ZTEA 3S24A 1HR0Q 3FKIH 5JEAG 5IYDG 1VQ9A 1K3RA 2CCZA 4DV6Q 4GNXB 4A93H 1Q1BA 1GVPA 4BBRH 1CSQA 1PH4A 1KD1C 1XMOQ 1EOVA 1IBML 3TS0A 4IPCA 3I4MG 3GTJH 3CMEA 1TWGH 3PF5A 2HIVA 1XNRL 3MXNB 4JI5Q 1YBYA 3KF6B 4MTNA 4DUYL 4LF9Q 2F4VL 3PUVA 3M3YH 4OO1I 4LF6L 2R6GA 1Y1WG 1PYBA 4A3GG 3BZKA 2JA8H 3Q8DA 4JOIA 4YY3Q 4HJ5A 1JJ2A 4LF4Q 1K9MC 4B3RQ 4X65L 2JQOA 1S40A 3H3VH 4JI4Q 5M5WH 3HOXH 1ASYA 1YHQA 2PNHA 2R7FA 4GNXA 4IO9A 4A3EH 1EYGA 1DGSA 3S2HH 3CCVA 3GTLH 2K50A 5IWAL 3F2DA 4OWWB 4L5SA 1Z9FA 3TS2A 1KC8C 4LWCA 4B3RL 4H02A 1M90C 2E2HH 2ES2A 4GN3B 2Z6KA 2F52A 5GAEC 1Q86C 1SR3A 1VQGA 1L1OB 1Q1EA 2HHHL 3B6YA 4R4IA 4O2DA 3CMAA 1YJ9A 4A3BH 1N36Q 3GO5A 4YWKA 3HOZG 3GD7A 1I94Q 2UU9Q 4LF5Q 1PH7A 2NVYH 4LFCQ 1X9NA 4HJ7A 4LFAQ 4A3FG 1C9OA 1CKMA 2IT1A 1FJGL 2VUMH 2JJQA 3S14H 1XNQL 1UE7A 2N3SA 5J3BA 1KRTA 4DV1Q 2OCEA 4A3FH 5C4JH 1Q82C 2WAQE 1YVCA 4QJFA 2ZTCA 2IX1A 4DR6Q 4DNIA 4GLVB 4GS3A 4DUZL 2K5HA 2UUBQ 1OXXK 4JI8Q 2MO0A 4JI1Q 4NXNL 5GADC 3OW2A 1SROA 2I0QA 4JI6Q 4LF7L 1FJGQ 2NZHA 4DR1Q 2WFWA 3A5ZB 5C0XI 1OXUA 1VCIA 2AWNA 3CP0A 2PI2A 3NEMA 4DK3C 3CCJA 4K0KL 3IRBA 3CF5A 3K7AH 4B3SL 4BXXH 1J6QA 3CAMA 4AQYQ 2PQAA 1BKBA 3E9HA 1VQBA 3HKZG 2WAQG 3CD6A 1VQEA 2AWOA 4IFDG 4A3GH 4O0AA 5C4XH 3F2BA 4R4TA 1BBUA 1XMQL 1W2BA 3HOZH 3UDFA 4X62L 1GM5A 2RCNA 3GTMH 4LFCL 4JI4L 2K5VA 4DV0Q 1HNXL 3HOUH 5JEAJ 4A3DH 3J80c 4QL5A 4R4OA 4X64L 3F8TA 4ME3A 1EIYB 2ZTDA 4NXML 4YCUA 4QQBX 4A93G 2EXDA 1MKHA 1T9HA 5IP7G 2PMZE 1YITA 5JJLA 3UDIA 3FKIG 1QVCA 5IYBH 3E9IA 1BVSA 3D31A 2CWPA 3AFPA 2K14A 3HOWG 4DV0L 1D7QA 2JEBI 2N78A 4JI5L 3KFUA 2VQFQ 3D0FA 1N32Q 4GLAC 4A3IG 1PH1A 4DR5L 1J5EQ 4OWXB 1YJWA 3CC7A 2LSSA 1HZ9A 3ZJYC 1QZGA 1K8AC 2B29A 3I4OA 1HZBA 2AKWB 3KF6A 3H0GG 1PH9A 1IBKL 4DPGA 1SMXA 1CKNA 1XJVA 1K73C 4AQYL 2KBNA 2A1AA 5M3MG 4ALPA 1IBMQ 1MJEA 5BR8Q 5IYDH 2C35B 2I5LX 4YWMA 5GAHC 2I5MX 4DR1L 4Y7NH 3J7ZC 4DR4Q 1YZ6A 3BZCA 1MJCA 3E0EA 3TEHB 5JJIA 1YIJA 2VZAA 3KOJA 3CCQA 1VQPA 3FP9A 4A3BG 2KHIA 1NMGA 4B3ML 4IOAA 3AYHB 3CPFA 1PA6A 3UE1A 4P71A 2VY3A 3JAMc 4GKKL 3HOYG 5IE8A 2R93G 1LTLA 2VL6A 3K80C 5C0XJ 1HNWQ 3NELA 4IJLA 3S1RH 3OTOQ 5AJ3Q 4DR3L 3LGJA 1Y1WH 1EFWA 1PHJA 2YU9H 2Z0SA 1YNXA 3T1HQ 2R7ZH 2MFIA 2VNUD 5IYCG 1GD7A 3PSIA 1SRUA 4HJ9A 4NXMQ 2R92G 4OXPA 2UXCL 2LXJA 3OTOL 1KIXA 4C3JH 4XIGS 1HNZQ 2JA6G 4WJ4A 4P74A 3KDFB 4X66Q 1XPOA 2DGYA 4PZ6A 2VQEQ 1A63A 2OTJA 1MIUA 2Q2IA 1G291 5LMNL 4BXXG 3PIPA 2BH2A 4YY3L 4LF4L 3CXCA 4YCVA 5FJ8G 4A3CH 3L2PA 4B3SQ 3ERSX 4LF8Q 1L1OA 4BY1G 2HQLA 3CW2C 3ULPA 4R4CA 1V1QA 1AH9A 1XPUA 3HKZE 1NE3A 3GTOH 4QY7A 4BBRG 4GOPC 4L5RC 5IP7H 4Y52H 2ALYB 2AHOB 1VQ6A 4IFDI 3KF8B 1KXLA 4OX9L 2VQEL 2Q2HA 4J15A 1E22A 1G51A 1QUQB 1X65A 1ASZA 1K0RA 2XTIA 4P75A 4UP8A 2VS1A 1HH2P 1VQOA 3HOVG 4A3LG 2NVTH 4AYBG 1XPRA 4LUOA 2DUDA 4DV4L 3T1YQ 1E7ZA 4X64Q 1N36L 4JYAL 4AH6A 3AEVA 3KJOA 4UY8C 1YI2A 5IP9H 1O7IA 1YEZA 3HOXG 2CWAA 4OWTB 2WB1E 2XGTA 3G4SA 4WJ3M 2UXBL 1HZCA 4POFA 3ER0A 1SE8A 1HJPA 3U50C 1U5KA 1Q81C 1N8RC 3W1GA 3CCUA 4DR7L 2A19A 4GKJQ 4L5QA 4MZ9A 4A76A 1VQJA 2UUCQ 2JEAI 3F1ZA 5JJKA 2AMCB 3A74A 4LUVA 2JA5G 4A3JH 2JA5H 1JT8A 4LNQA 3RLFA 3UDXA 2MO1A 4RMFA 3RN5A 3RZDH 3RZOH 1QUQA 2K4KA 4UP9A 4JI7Q 2UUAQ 2ASBA 3U58A 4YHHQ 4B3TL 1C0AA 1X55A 2I5HA 3PCOB 5HGQA 3CCEA 4DV4Q 3T1YL 3W5OA 4JYAQ 2OWOA 2ATWA 3TRZA 1I50H 1N33L 1Q8KA 1KRSA 1P8LA 5IY0A 3HKSA 1RL2A 4DV6L 3PUWA 4R4QA 4PMWA 3BU2A 4EX5A 4JI6L 4NXNQ 5FLMG 1SN8A 4A3KH 1N9WA 1CKOA 3PGZA 2KCMA 4DUZQ 1IBKQ 1TWFH 3PO3G 4DV2Q 3I7FA 3CC4A 2PI2E 2Z6KC 1N33Q 1WCMH 1X54A 1PYSB 2V1CC 1X56A 2FXQA 1I94L 1NBWA 4A3EG 2E2JH 4DAMA 1JJCB 4IPDA 1WFQA 2UU9L 4DR5Q 3PF4A 1N34L 4KHPL 2YTVA 4JV5Q 1S72A 4LFAL 1UE1A 5M3FG 5FLXc 4TQUS 1VQ7A 3PUZA 4JBWA 2JE6I 4JOIC 3DM3A 4DK6C 2D0PA 1IL2A 1NY4A 2JK8A 4JI7L 2YTXA 3K8AA 2UUCL 3M85A
chains in the Genus database with same CATH superfamily
1VDZA 3CHBD 3M4PA 3MEHA 1PFSA 2RHQB 4FP5D 2JA9A 5IT9L 1B70B 4I65A 5C44H 3PIP3 4NPSA 1H9KA 3PV0A 1ET6A 1EQVA 1X3QA 4BWGB 1HUNA 2GVBA 2L4NA 1ILPA 3A8KE 4CJ1B 2X69A 4A75A 3I4NG 4KJNA 1NJIC 2VW9A 1RD9D 3G48A 4KN4C 4G7ZC 1CHQD 1A0IA 2EJGC 4DAYB 3PO2H 1AW7A 4A3MG 5D65A 2ZJRA 3IKJA 4HJAA 1AN8A 1JE5A 5CV9A 3A5UA 1QVFA 1TKWB 4QUFA 3KBGA 2QKIC 3MXPA 3Q6SA 3CPWA 4CJ2C 5KEEA 2WKCA 4CDEC 3VYUA 4IUUA 1I4XA 4YHHL 2UUAL 4U68A 4DR6L 1Q7YC 2OQ0A 3T56B 2I07B 3HS0C 3SK8A 2DNEA 3GTOB 1STEA 1VMCA 1RIPA 1GUGA 4LFBL 1D1KA 1SJED 2AQ3B 4DXGA 3PIOA 2CH4W 4HSVA 2VQFL 3PO2G 1SFOH 1W6JA 4DV5Q 1I6HH 1JWSD 4K6LA 3FVQA 1QVGA 4DNTB 4JI2Q 1SYFA 2WINB 1YNJC 5FJ8H 4QCLA 3FDTA 4JBMA 1QE6A 2H5XA 3GTJB 3HOXB 1AEXA 4A3GB 1ENAA 4G4KA 4A3MH 1K83H 2F0DA 4JV5L 1OTCA 2JA6H 4GLXA 3F2CA 2NTSA 3EIVA 2EQSA 1BBWA 4WFN3 3I4NH 3NWTA 1IXRA 1HA6A 3QOLA 3KJPA 4UAIA 2G5DA 4HIDA 2Y0SE 4KJOA 4FVMA 4C2MH 2N8NA 4K8JA 3U4ZA 3OPOA 5EJWA 1FL0A 1SYBA 1IYJB 4LW1A 3VDYA 5HGTA 4JCVE 1I5FA 4JG2A 3H91A 3SVMA 1FVIA 2Y0SG 4K8IA 1AE2A 1U9RA 3T1HL 2K7VA 3CCMA 2CFMA 4CDDC 4KHZA 3CKIB 3DWAA 1LT5D 1A3VA 3J81L 1K8GA 3H15A 1C4QA 1CUKA 4A3CG 4BY1B 4KKUA 4HCEA 4XYQA 1HZAA 4DUYQ 3EFXD 3DLLA 1BXTA 1V9PA 3MXUA 5EQ0A 1E24A 1RTOA 5CORA 1IL8A 1LABA 1VQMA 5C0XG 2WB1B 3J80i 2F0NA 4CKBA 3G6EA 1EU3A 3HOWH 2QGQA 4P72A 2DY8A 1VQHA 2N49A 3GDEA 4C3IH 3S15H 2RDGA 2PMZB 2EPBA 2LMCB 4C3JB 4QB4A 4RAUC 3TSSA 2YYZA 4JC0A 3VR4A 3I4MH 3G71A 2SOBA 1KL9A 2RSOA 1KNAA 5CC4A 2R93H 5LMNW 4IOCA 4C3IB 4RA8A 1EQRA 1A8VA 1HCZA 1Y1VH 3I4LA 3GTQH 4BY7G 1Z7TA 1PYWD 5KNBA 4GKKQ 4DGZA 1JOKA 4GOPA 1A3UA 3NBIA 4XT1B 1BUVT 2XRQD 2F3VA 2JP1A 3I55A 3C1EA 1EIGA 1Y1VB 2X6LA 2E76C 4FF1A 2KEDA 3M7GA 5C4XG 1M1KC 5C44B 1N34Q 1HPCA 4RGMA 1MSGA 3AMUA 4OO1G 2KCTA 4HN7A 3KLSX 4PG3A 1ESFA 1SNQA 4DV3Q 4LF7Q 3EQLC 1AZQA 2O2LD 3M4QA 3BS1A 1AFPA 4FF3A 1HR0Q 1JOOA 2CCZA 1Q1BA 1GVPA 5CBEE 1CSQA 3K0YA 5JJZA 5DM63 1XMOQ 1PH4A 1PRTD 4CDCC 1ET9A 2WKDA 3S2HB 4JI5Q 1QWYA 4DUYL 1JCKB 4OO1I 5L37A 3ND9A 3Q8DA 4LF4Q 2HCCA 4TKOB 1STYA 1JQYD 4WJWA 4JI4Q 2PNHA 4GNXA 1EYGA 1MGSA 3S2HH 3CCVA 5IWAL 4CGYB 3F2DA 4R9WA 1KC8C 3S15B 2F52A 3MAQA 4PQXA 2ICIA 1PTOF 2D5DA 5C5MA 3MTSA 1PH7A 2NVYH 1CA5A 1CKMA 2VUMH 2JJQA 3S14H 3NUCA 1GHKA 2J0TD 5C4JH 4QJFA 3G6JB 1SNMA 2O4XA 2IX1A 4DR6Q 2SEBD 4DNIA 1JB3A 2K5HA 2PZTA 2UUBQ 1EWCA 1T5EA 3A5ZB 2NVTB 1VCIA 2AWNA 2GA4B 1G2SA 2PW5A 4KY7A 4PMCA 3CCJA 2L9HA 4BXXH 1XXGA 1CA6A 4IN3A 1KNEA 1EY7A 2NZ1D 1ENFA 3E9HA 2N88A 1VQEA 2JA6B 3VR5A 3UDFA 1Q3LA 1GM5A 2K01A 3GTMH 2F0JA 5JEAJ 3J80c 4QL5A 1SXTA 4X64L 4ME3A 1TS3A 3O13A 5CYUA 5JAVA 2CWPA 3AFPA 2K14A 3E3XA 3QG1A 3HZXA 4JI5L 4DFAA 1J5EQ 4DR5L 3MFGA 3CC7A 2LSSA 1D5ZC 4X3KA 2A68C 2EYPA 3VYTA 1K8AC 2IJ0A 3I4OA 5KGUA 1HTPA 4DPGA 1SMXA 1U4LA 1CKNA 1XJVA 1K73C 4N9PA 5FO9B 2MUYA 2A1AA 1KABA 1GHJA 2PNRC 2WACA 2KQ3A 4ZYSA 2C35B 5TSSA 5EBCA 4A3BG 4J1MA 4IOAA 4B3ML 1EY0A 3K5LA 3FPUB 1ZXTA 5HURA 1RDPD 4GKKL 2EY5A 3HOYG 4QF4A 1Y69U 3K80C 5C0XJ 1JR0D 2VUMB 4MN3A 2XRSD 4FNFA 5IGEA 3S9WA 1V1PB 1GD7A 1TWCB 3G7LA 4A3MB 1LTAD 1SRUA 4HJ9A 4NXMQ 4DU9A 1A15A 2RDFA 4XIGS 2I46A 2JA6G 4WJ4A 2Z8LA 3OWFA 3I4NB 2DGYA 2OTJA 1MIUA 1G291 1FYCA 4KKSA 1EFID 5I6WA 4MIUA 3K57A 4YY3L 3CXCA 5EKKA 5FJ8G 3L2PA 2CQAA 3ERSX 3OOCA 1LTID 1QJOA 1PFBA 1QILA 1XTCD 5E4WC 3UI2A 3GTOH 4QY7A 4BBRG 4GOPC 4QIWB 4KK7A 2ZT9C 3KF8B 2IWHA 4J15A 1ICWA 1QUQB 1X65A 4EQOA 3R8BA 1I6HB 4OGQC 3HGBA 5C4HA 1O7ZA 1HH2P 4RCNA 1PZID 2NVTH 4LUOA 4KN7C 1I50B 3J7YW 1N36L 2K5QA 4UY8C 3SE0A 3HOXG 2CWAA 2WB1E 2XGTA 2UXBL 3L3OC 4J8QA 1N8RC 3U50C 2A74C 5AFWA 3CCUA 4L5QA 1VQJA 2JEAI 5JJKA 5IOCA 2AMCB 4A3JH 4LNQA 3UDXA 3RZOH 3RN5A 2UUAQ 5D3DA 5ELFA 3PO3B 3PCOB 3J81E 2OWOA 4K2LA 1WTPA 2F0KA 1K28A 1TVXA 4RHRA 3TP5A 3PUWA 4R4QA 1SJHD 4FXDA 4EX5A 4JI6L 4NXNQ 2L11A 5D14A 1CKOA 3PGZA 2KCMA 1IBKQ 2C9OA 3EROA 2PI2E 3GTQB 2NVYB 1PYSB 2HQEA 2V1CC 3NTHA 4UHVA 3I8ZA 1F9RA 2BDOA 1JJCB 3ERQA 1S72A 4LFAL 2EDGA 3PUZA 4DK6C 2D0PA 2F3WA 2MGSA 2YTXA 2UUCL 2LFNA 2EZVA 3IFDA 4TRDA 3STBD 4KY6A 5IWAQ 1CM9A 4F87A 4A3KB 3I4MB 1PH5A 4BY1H 3K81C 4XTCS 4IPHA 1L1OC 1Y8PB 3J81i 2VB2X 4YCWA 4X65Q 3K59A 2L55A 3P75A 1SDFA 3VYRA 1B4OA 4DV7Q 1TWCH 5M3FB 4O1NA 1HQMC 3I2ZA 2K75A 1XMOL 3NXWA 1VQCA 3QWNA 5I2YA 4GZYC 1WOCA 2F1MA 1TY2A 3M9BA 2XNAC 1UE5A 2Q8IB 2FFKB 2A73B 1VF7A 1WJJA 2K33A 2BA1A 4EQNA 4DR4L 1E1OA 1HTLD 1PH6A 1IBLQ 1CHPD 5BR8L 2ZM6Q 3OYYA 4POGA 1RJTA 4MNOA 4BBSH 2HT1A 1LV9A 1PZJD 1Y8NB 5LMUQ 1ENCA 2B63H 1B50A 1D6EC 3K58A 2F0WA 3JAMi 5ELOA 3NBHB 3HOVH 4ODGA 1F9QA 4JI2L 1Q90A 2UXDQ 4EQ5A 2R7DA 3U9SA 3T16A 4IQZA 1VQ4A 2HIXA 2JSOA 3HFZB 3ULLA 1CQFA 4X62Q 4BBSG 1SNPA 1SEBD 1SFOB 1X3EA 2R93B 3CQZB 2RHSB 2A69D 5DM73 3I56A 4DAVA 1I4HA 4BY7B 4HIKA 4U673 5JVG3 4LF8L 2RDHA 3WOEA 2JA5B 1G8ZD 4JI8L 3SHLA 2EYOA 2NVQH 4RH6A 1GUOA 1QG7A 5M5XH 3OHXC 4DV1L 3FHWA 2QA4A 3C1FA 1I3QB 3JC66 1L2FA 5LL6X 4X3UA 4DR7Q 1J5EL 1N32L 2JA7G 2D2CC 3EA6A 3GP7A 1JB7A 1KQSA 4EGVA 5ELNA 1S5CD 4PMBA 2L5TA 3AFQA 4YIJA 3SGIA 1B53A 3GTPH 1H95A 2NWGA 4AYBE 3D4RA 2ID0A 1PRTB 1VS0A 1WI5A 3DM1A 5A2QE 5EKIA 1HNWL 3OW7A 1JOQA 1CI3M 3V2TA 5J1ZA 2F0MA 3IL8A 4GN4B 4KD4A 2E74C 5I4DA 1VQFA 1QZHA 1CT1D 2R92B 2LXKA 2JN4A 1O7LA 2F4VQ 2XSCA 2ZM6L 2B2VA 4N9TA 5CR3A 1TS5A 1B44D 4KI0A 4L8JA 3NP8A 4GNXC 3V96A 4Z9CB 3LWEA 1QOHA 3M4OH 1H9SB 5C3WA 4DV2L 3KYHC 3PO3H 1YHBA 4A3JG 1AE3A 2B2YA 4JI3L 1PFMA 3N6RA 2LKVA 1W6KA 2B3GA 3U4VA 2BA0A 5K36G 4X3TA 1GUNA 1EY5A 3TQYA 1U4RA 3L0OA 2IHEA 2EVBA 4UPAA 3PUYA 2KHJA 4A3DG 2XWBB 3FKIB 5G3LD 3HOVB 1X6OA 2R92H 4V190 3K7AB 3ICEA 5IYBG 3ZYYX 5E1FA 1KDAA 3TBIB 1XNRQ 1BF4A 3S2DB 2A68D 5AJ3L 2JA8G 3MWYW 1S3OA 3H3VI 3J7A5 3KLSA 3M7NA 4ULLA 1EU4A 2BDNA 4PZ8A 3WWVA 1Y1VG 1WYDA 2R61A 1HR0W 3I91A 2ZTEA 1VQ9A 4ZK9B 1NNXA 1SSOA 4DV6Q 4A93H 3KBXA 5ELCA 2DJGC 5J22A 1KD1C 5KNDA 1EOVA 3QOJA 1XNRL 3MXNB 3K5NA 4MTNA 1EYAA 2K32A 2F4VL 3BZDB 3M3YH 4A3EB 2MHVA 1NSNS 1PYBA 2F4IA 3BZKA 2JA8H 4YY3Q 4ZCKA 1K9MC 3HKZB 3C2PA 3H3VH 1UEAB 5G3LF 3HOXH 1YHQA 2R7FA 5EPKA 3FMCA 4IO9A 1DGSA 1STHA 3RD4A 3TMEA 3TS2A 1Z9FA 3R2IA 4B3RL 4GN3B 5GAEC 1Q86C 1K8OA 1VQGA 5LL6S 1Q1EA 2HHHL 1YJ9A 4A3BH 3GO5A 4YWKA 2F0TA 3GD7A 5IGCA 3E0JA 1GOZA 4LFAQ 1C9OA 2B2TC 2IT1A 1FJGL 2YU9B 4A3FH 5J3BA 1ILQA 2MJ8A 3MFYA 2WAQE 3BDCA 2ZTCA 2IX3A 4DUZL 1DOKA 1E2WA 2MO0A 5GADC 2Z4HA 3FEWX 4DR1Q 3J80L 5C0XI 1V1PA 2F0PA 3KUPA 1M8AA 3K7AH 1II3A 5IGFA 1PMRA 1BKBA 5CV7A 2HUGA 1VQBA 3HKZG 2SNSA 3W2DA 5ELDA 1W2BA 4X62L 1BNZA 3T4AC 2RCNA 3A55A 4JI4L 3J7AV 2JYOA 4R4OA 1B2TA 1EIYB 2WAQB 4YCUA 2EXDA 5IP7G 1STNA 3FKIG 1QVCA 3E9IA 1F2MA 1BVSA 3CU7A 4DV0L 4ABNA 1LT4D 1N32Q 1PH1A 1D2BA 5EGTA 5BN4A 4PV1C 1HZBA 3H0GG 1PH9A 4HMIA 1IBKL 4IUTA 2KBNA 5C0XH 4ALPA 5C3EB 2PZWA 1SYEA 1SBBB 2K03A 1MJEA 2QW7A 5GAHC 3J7ZC 1JWUD 1YZ6A 2SDFA 5JJIA 1YIJA 3FP9A 1R4QB 3AYHB 2B2VC 3CPFA 2QF7A 2CHBD 2VY3A 2B2UC 1SYDA 5IE8A 3PIO3 2VL6A 1HNWQ 5DAUA 1CZGA 5C4JB 5AJ3Q 3LGJA 1EFWA 2F0VA 2YU9H 2Z0SA 3T1HQ 2R7ZH 1K83B 5IYCG 1TS4A 4KMUC 2OF1A 4OXPA 1EEFD 2QEJC 2LXJA 3OTOL 1HNZQ 4P74A 3P20A 4X66Q 5C4ZA 5M9OA 2NVQB 2FJ2A 2VQEQ 4BXXG 1IHZA 3PIPA 1FNUA 2R3ZA 1FGBD 5M5WB 1FR3A 2RVLA 2TSSA 5C3XA 4N8X1 4EQPA 3JAME 5ISRA 1RCVD 3ULPA 4KD3A 1HRJA 2M00A 5CGKA 3CRKC 3KK7A 2PQEA 1DYQA 2K5WA 4L5RC 4ZKBB 4K2KA 2AHOB 5I2XA 3W3AA 4OX9L 2VQEL 1KXLA 2MPMA 3RZDB 1E22A 1WTRA 1WVLA 4CBVA 1PTOH 2XTIA 4P75A 4UP8A 2OXPA 2HCIA 3D6CA 4IZ8A 4JYAL 2DUDA 3HG9A 1SNCA 1QNKA 1IW7D 4X64Q 4AH6A 3AEVA 1YI2A 2NB0A 1O7IA 1YEZA 2A5HA 2QCPX 1RTNA 4WJ3M 2RSNA 1LT3D 1X32A 4M1UB 1ICFB 2A19A 4GKJQ 4BBSB 1QCBD 3F1ZA 1WTVA 3BDLA 1BBXC 2JA5H 1JT8A 4H44C 3RLFA 2MO1A 4RMFA 2ASBA 1HHVA 4B3TL 2I5HA 4JYAQ 2J4XA 3BDOA 2ATWA 3MZ5A 3TRZA 5IY0A 2WV6D 1O80A 2LY7A 1A2TA 2KHSA 4LK1C 1MD2D 1IYVA 4XDXA 1PTOB 4A3KH 1NR4A 1IKMA 1NAPA 3I7FA 1EY6A 2Z6KC 1N33Q 4DK0A 1WTQA 1X56A 2F0LA 1RKNA 1NBWA 1EIHA 4RFBA 1WTWA 1STAA 2EYMA 2B8FA 1IL2A 3QR8A 1EY8A 1NY4A 1AP0A 3K8AA 5EBDA 3M85A 2QILA 1XX8A 4IUNA 1H9SA 1GUWA 4RHSA 4BY7H 3L7ZC 1KTKA 1LTBD 5EAYA 4K6DA 1TIID 3ITPA 2K52A 2CQOA 2L0CA 4BS9A 2F0IA 4A93B 3J81j 2EOTA 5C4XB 4BBRB 1Z47A 1SMYD 2L15A 4XQQA 3M3YB 1L0XB 2LS01 3STBC 2UUBL 3MA2B 4OX9Q 2Z4IA 4F7XA 1VQ5A 4KHVA 1YJNA 5LMUL 1OO9B 3S2DH 2F0QA 2Q2TA 4FDBA 5CV4A 5DNFA 2IHFA 4XXEA 3ULJA 4APVA 1HUMA 1GO3E 4RGTA 1LTSD 1E0BA 2N55A 4HTHA 4XQJA 5FOBB 2F0UA 1UAPA 1IKLA 4A3BB 1XTDA 2Q8TA 2UXBQ 3E5SA 1Y8OB 3CQZH 2BH8A 1S5BD 2NZOA 3RR5A 1HA5A 3BVMA 2MQHA 2WIIB 4ID6A 2F3IA 4L5TA 3SEBA 2UXCQ 3RNUA 4C3JG 1L0YB 2BOSA 1E2VA 4RCOA 1MHWC 1DOLA 1B3QA 5DLQE 1X3PA 2EY1A 3DEPA 5FKAC 1GJXA 3AU7A 3NK9A 1WTHA 1TT2A 3BG3A 3NQTA 2HD3A 4LUZA 4HJ8A 1F2YA 1E3PA 3HOYH 3S17H 1HR0L 1JORA 3GTMB 2IX0A 4MTKA 5CBAE 1DJRD 1TS2A 1W3SA 5A35A 1E1TA 2K5NA 2K6AA 1SE4A 2WP8J 1A2UA 4JBJA 1V1OA 1VQLA 4R1JA 5IT9c 2E5LL 1K3BC 5C5LA 4XYOA 1TY0A 5LMNQ 1WTXA 1JJGA 3RLOA 2E8GA 3EBEA 3TREA 5BN5A 5M3FH 1VQ8A 1XNQQ 3HP3A 3JAML 1BCPD 3BYYB 4A3JB 3NPPA 2RF4A 2JA7H 3J81c 3NQIA 4JBKA 4B3TQ 4DV7L 2Z9HA 4XT3B 2R7ZG 1D5MC 1EIFA 5E7NA 2FMCA 5KYLA 4DV5L 1AZPA 3K5OA 3BYTB 2F0SA 5D3IB 2GN5A 1NCVA 2DN8A 3S17B 4MHEA 1KAAA 3GTGH 3M4OB 3CC2A 3F2UA 2BE5D 3SK6A 1PH8A 1KAWA 2KENA 1NTGA 5T1GA 3D8GA 2JXMB 1LO5D 3KF8A 3TDQA 1VQAA 2K04A 3UDGA 3I72A 1PRTF 1TXYA 4LF6Q 1IBLL 3I90A 5FLMH 1VQIA 1YNND 2IW3A 4ZQ3A 4JI3Q 2E2HB 3GV6A 4F88A 4C1NI 4OONA 2NVXH 3TP7A 4AYBB 1J8IA 4N8FA 1GKHA 1BCPB 5H1SE 3X3MA 3S1MB 2ZJPA 1PH3A 1ESRA 4L6TB 1BO0A 3Q23A 1HNZL 4PZ7A 2VUMG 4QIWE 3RN2A 1BQQT 1PLFA 1PTOD 3HOUG 1BR9A 2F0FA 3H6MA 5IYCH 5EPJA 5IGGA 2IY5B 1C48A 2NN6G 3S1NB 2B2UA 4P2CB 1XMQQ 2A8VA 3LNNA 2CKZB 2FMMA 3RLNA 4G57A 3S1RB 2PPBC 1X3GA 1DM0B 1I3QH 2YV5A 1H9JA 4B9WA 1Q46A 3NWSA 5E3FA 1B9MA 5M5YH 1KHIA 5IIFA 4ME5A 5CMDA 4A3KG 5A2QL 4EVOA 1EEID 4B3MQ 5IP9G 1Y14B 1H9MA 2RA4A 1SMYC 4A3IB 2IPKD 3S24A 1YNJD 1K3RA 4BBRH 5C6AA 1IBML 3TS0A 4IPCA 2K05A 3KF6B 3HRZC 3H09A 3PUVA 4LF9Q 3D4DA 2K28A 3NBHA 4LF6L 1Y1WG 1Q8IA 3MXGA 4OELB 1JJ2A 2EJMA 3PQIA 4B3RQ 4X65L 1J9OA 2JQOA 3A8IE 5M5WH 1ASYA 3A7LA 4A3EH 1LTGD 2K50A 4OWWB 4Y52H 2BCOA 4L5SA 4CKEA 5M5YB 2E2HH 3HOZB 5KNCA 1GXDC 1L1OB 1FD7D 3B6YA 4R4IA 3CMAA 3HOZG 2UU9Q 4LFCQ 5KRUA 4RKLA 2Q8RE 2G9HD 1G6ZA 1Y1WB 1I4PA 1UE7A 2N3SA 2DY7A 1KRTA 4DV1Q 2OCEA 2EY2A 1YVCA 3P7JA 4FXKC 4I7AA 4R8NA 1WD1A 4GLVB 4GS3A 5IODA 4OHJA 1OXXK 3OW2A 4LF7L 2B2WA 2NZHA 2WFWA 5FK9C 4DK3C 2PI2A 4K0KL 4WORA 3SR1A 3CF5A 3Q24A 1C8CA 4B3SL 3QJYA 4AQYQ 2B8GA 2PQAA 3T53B 3CD6A 2AWOA 4J6HA 4O0AA 5C4XH 3F2BA 1BBUA 1XMQL 3HOZH 4ZUJA 3VR3A 2K5VA 4DV0Q 4A3DH 5JVH3 2QDLA 4IURA 2ICEC 4NMZA 2OT2A 4NXML 2ZTDA 4QQBX 1MKHA 3FRPB 1EYCA 3D31A 3HOWG 1D7QA 2NN6H 2JEBI 2N78A 3KFUA 2VQFQ 3BVGA 4A3IG 5JOBA 4OWXB 1YJWA 3K6OA 3RMHA 3SDZA 1HZ9A 4ZAIA 2B29A 2AKWB 1WD0A 4RKBA 1DCZA 2M2LA 2Z6BA 2K5DA 4H0LC 4CJ0B 2BE5C 5M3MG 2HDMA 1ONLA 5BR8Q 3NSWA 2I5LX 2EYHA 5ELBA 5K5PA 2ENBA 3BZCA 4DR4Q 2DJFC 2VZAA 3TN2A 2AUKA 4ZUIA 1VQPA 2KHIA 1NMGA 4NDXA 3J80E 1PA6A 3UE1A 3NTKA 4KKTA 2R93G 1LTLA 4A3FB 3N52A 3NELA 3VYSA 3S1RH 1Y1WH 1DXMA 4OIJA 1I6VC 2DNCA 1YNXA 4IALA 2MFIA 2F0OA 2H1EA 5CV6A 2CW0D 3PSIA 1Z6HA 4IUPA 2KCCA 1KIXA 4C3JH 4HAEA 1CK1A 3KDFB 3OMCA 1F2LA 4KY5A 4L63B 1DD2A 3WDNA 3URYA 2R7ZB 1A63A 2Q2IA 5LMNL 2BH2A 5COYA 5ELEA 1S5ED 3OWEB 4A3CH 3SK5A 1SAPA 4LF8Q 2JA8B 4BY1G 1TU2B 2SNMA 1EWHA 1SYGA 1GUSA 1V1QA 3L9AX 1AH9A 1XPUA 1F2ZA 4DA2A 2E2DC 2EXZA 1PFNA 4C3IG 1K0RA 4JW0A 2VS1A 1VQOA 4G7HC 5CV8A 1NUCA 1M4VA 4DN4M 4AYBG 4DV4L 1YNNC 1QB5D 2RQXA 1CTMA 1JICA 1EL0A 4PNYA 3KJOA 4UDUC 4OWTB 3G4SA 4OIKA 1U4PA 3ER0A 1HJPA 4R8IA 1U5KA 3W1GA 5KIXA 4MZ9A 4A76A 1PRTC 4A3DB 3A74A 4LUVA 2A6HC 1F9SA 4M8AA 4C1NK 4JI7Q 3U58A 1F9PA 1X55A 3MC0B 5HGQA 3CCEA 4DV4Q 2EJFC 3W5OA 1STBA 1T5XD 3A8JE 2NYZD 1I50H 1N33L 1P8LA 4DV6L 3HKSA 1RL2A 1R9TB 3GQBA 2JA7B 4DV2Q 3SK4A 2FINB 2ZXRA 2QDBA 1X54A 3DHQA 2ZXOA 2FXQA 5JPMC 2E2JH 2UU9L 4A3EG 4DAMA 4IPDA 4KHPL 1HQRD 4DNRB 2YTVA 4JV5Q 1UE1A 1VQ7A 4TQUS 1VF5C 1MI2A 4JBWA 2JE6I 2O5IC 1LLRD 4NW2A 1A6XA 3A7AB 2JK8A 3A56A 4JI7L 4S3SA 1B7YB 4OEMB 1LUZA 3PMFA 4V0BA 1G2TA 5GQOA 4KLKA 4ZLTF 2UXDL 3GTKH 1K8MA 4X66L 3I70A 1R4PB 1EY4A 3EVQA 1TWHH 1CKNB 1HFGA 4IUQA 5I9PA 5M3MB 2PCFB 1P16A 3X3NA 4DR2Q 4KHPQ 4C3HG 2B39A 3CCLA 1WTOA 1GUTA 1S4ZA 2EIFA 3S1QH 3CCRA 1MSHA 4C3HB 4F8MA 1ZYRC 1VQNA 3QO2A 1I4QA 2AUJD 2MNAA 2XVSA 1QNUA 2WB1G 1RODA 1G6PA 1IZ6A 1CZWA 4LJZC 3MEFA 1TWAH 3MHBA 1D8LA 1WCMG 2D0OA 3OMGA 4JI1L 4RGNA 4B9XA 4C3HH 4RWSC 1KLGD 1A62A 3S1NH 1FNVA 3K7UC 4BA1I 4ZKCB 2L12A 1OXVA 2VXWA 1X3FA 2F0EA 4BA2I 2NN6I 1KDCA 3HOYB 5M3MH 3S16H 5C3EG 2RCFA 4IFDJ 3WOFA 1K0SA 1EYDA 4CKCA 5C44G 4AIMA 5IT9E 1WCMB 1EWIA 4LFBQ 2CVRA 1SE3A 4DAPA 3KLWA 4A3IH 4Q0FA 2AQ1B 4JI0Q 3NHHA 1G91A 1HNXQ 1B8AA 3CRLC 1LYLA 2PZUA 3S16B 4IJHA 4K5WA 3EN2A 3IFTA 5GROA 2ZJQA 1CQVA 3NENA 2E5LQ 1OXTA 4I7ZC 1F77A 4TSSA 3KDFA 3GTPB 3PUXA 5FLXE 4GOPB 4CDFC 3ND8A 3J7AF 3AQQA 3M4YA 1EQTA 4K5VA 4FYDA 1SNOA 4DKAC 1R9TH 3TZUA 2B2YC 1NMFA 3GTGB 4DV3L 3CCSA 1PV4A 1FGUA 2NUCA 2F0GA 4JI0L 1RHPA 5BN3A 1PVOA 5GAGC 4X6AH 4LMQD 1D5XC 1L0WA 4DR2L 3PO2B 5HY6A 4RG1A 3KLRA 5C3EH 2E2IH 2HHHQ 4ZRZA 2XWJB 4FF2A 2PO4A 1EY9A 1A3TA 3P1HA 4QGUA 3C46A 1B3AA 3UE0A 2D62A 3H94A 2EY6A 1OXSC 2YTYA 5M5XB 3BJUA 2B63G 2OQKA 1S5DD 3GTKB 1PDQA 3H0GH 3S1MH 1O78A 4IUVA 4LF9L 2B2WC 1U0LA 1SYCA 2O5JC 2OTLA 1D1IA 2C5CA 5I6YA 1LM0A 4K0KQ 2GVAA 3T13A 4A4IA 1STGA 1KDBA 5IGBA 1IYUA 5LHY1 4O42A 4YWLA 1LTRD 1PZKD 2KUMA 1EQQA 2QEXA 1EUJA 1UE6A 2A6ED 4GN5A 3I3CA 1VQDA 3NTIA 2CW0C 1CSPA 1SLJA 3D6WA 2Q2UA 3DEOA 3AB9A 4LF5L 2PQAB 2Y0SB 4HEDA 3DMUA 3C3LA 1UWVA 1XWEA 2KJXA 4NB3A 4GKJL 3TZDA 4OL7A 4QUCA 4HIMA 3A0JA 2A69C 1VQKA 4H13C 1Q12A 3GV3A 4TVAB 4HSPA 1I4GA 1YHAA 1JMCA 3VA7A 3W1BA 1UEBA 4IPGA 2V4DA 4XQNA 4HIOA 1TWAB 1C7YA 4DR3Q 4UP7A 3K0XA 2F03A 4A3LH 5KYIA 4Y7NB 2EE1A 1PH2A 3IAYA 2F0HA 4HMJA 1V43A 5EKLA 3VR2A 5E4XA 1UUPA 4P73A 3FKIH 5JEAG 5IYDG 1I4RA 4HR7B 5DEHA 4GNXB 1ZKOA 1EZ6A 1MBYA 2A6HD 3I4MG 3GTJH 3CMEA 1TWGH 2TMPA 3PF5A 2HIVA 1YBYA 2KVMA 4E6IA 2K1BA 1V8QA 3V05A 3MVVA 2R6GA 4LAAA 1FNWA 2FHTA 4A3GG 4JOIA 4HJ5A 3R2TA 2H4OA 2XN9C 4B08A 1S40A 3SXHA 1H9RA 1TWGB 2KCNA 3GTLH 1SNDA 3A54A 4LWCA 2HDLA 4H02A 1M90C 2ES2A 2Z6KA 5EPLA 1SR3A 3HEJA 4O2DA 3Q0AA 1TWFB 1N36Q 2E2JB 1I94Q 2B63B 4LF5Q 4KTAA 1X9NA 4HJ7A 4A3FG 1LT6D 1XNQL 3BVZA 4JK1C 1Q82C 1TQOA 4DK1A 2MP1A 2EYFA 4K14A 4JI8Q 4JI1Q 2I0QA 4NXNL 4JI6Q 1SROA 4C2MB 1BDOA 1DOMA 1IW7C 4C56C 1FJGQ 4QMGA 1OXUA 3CP0A 3NEMA 1PTOC 2VB3X 1TWHB 3IRBA 2E2IB 3OIPA 1J6QA 5NUCA 4DF7A 1SE2A 3CAMA 2WAQG 5K36H 4A3GH 4IFDG 4R4TA 4FO2A 3TP8A 4LFCL 4NP5A 1DZ1A 1HNXL 3HOUH 1ML0D 2PW7A 3R93A 3F8TA 4A93G 1YITA 1T9HA 2PMZE 5JJLA 1CFMA 3UDIA 4DAYA 5IYBH 4JVZA 2NVXB 2NTTA 3D0FA 3K5MA 4GLAC 1ZYRD 1RF2D 4H7BA 3DUZA 3HOUB 3ZJYC 1QZGA 3DWPA 2CH4A 3KF6A 5J39A 4IFDH 3DXJC 4AQYL 4NKLA 2RKSA 1IBMQ 5JEAH 5IYDH 1NR2A 4YWMA 1U4MA 3S1QB 3H0GB 2I5MX 2EYJA 4DR1L 4Y7NH 3E0EA 3TEHB 1MJCA 2D9UA 2IL8A 3KOJA 3CCQA 3QB3A 4P71A 3T51B 1JWMD 2B2TA 3JAMc 5CV5A 1JE4A 4FF4A 1EOTA 4CHTB 4IJLA 3S14B 3OTOQ 4DR3L 1PXUA 2KECA 1PHJA 2VNUD 1TR5A 3RUZA 1BCPF 3OIQA 2L1BA 3ONAB 2R92G 2UXCL 5FO8B 4WRDA 1XPOA 1JC7A 3LX0A 1ZEQX 4PZ6A 2XIWA 3H3VC 1XYIA 3Q22A 4X3SA 4LF4L 4RGOS 4YCVA 3LWUA 3U9OA 3VR6A 4B3SQ 1L1OA 2J7ZA 2HQLA 3CW2C 5FO7B 1O7YA 4R4CA 1DONA 3HKZE 1NE3A 2A6EC 2M9VA 5IGDA 2OEOA 5IP7H 2P5ZX 2ALYB 1VQ6A 4IFDI 4JPBW 1KLUD 2Q2HA 1G51A 5I9OA 1ASZA 2EYLA 3FPPA 1S5FD 1LACA 5FLXL 1BCPC 3HOVG 1LTTD 4A3LG 1VMPA 3R3OA 1BOSA 3QIAA 3T1YQ 1XPRA 1E7ZA 3E6ZX 2RBMA 5IP9H 3RZOB 4K5XA 2KA7A 3DWQA 1HZCA 3D4WA 4POFA 5JPNC 4KV6A 1SE8A 1Q81C 3OSOA 1UNSA 2Z1CA 2ZXPA 4DR7L 2KEEA 2UUCQ 1B9NA 2AQ2B 2JA5G 1HFNA 3RZDH 2X6GA 1QUQA 2K4KA 3D3RA 4UP9A 1HXYD 5T1IA 4YHHQ 1C0AA 3T1YL 4HCSA 4ILWA 3TP6A 3NE5B 2NBFA 2PYKA 3MXNA 2G9DA 3GTLB 1Q8KA 1KRSA 4G7OC 4PMWA 3I73A 3BU2A 5F2DA 1E2ZA 5FLMG 1SN8A 4DXFA 4OO1H 1N9WA 4Q5VA 4FXGC 4DUZQ 1TWFH 3VA5A 3PO3G 2E75C 3CC4A 1WCMH 3EJIA 1I94L 3PF4A 1WFQA 4DR5Q 1N34L 5M3FG 5FLXc 1EZ8A 4JOIC 3DM3A 1B1ZA 2KOLA 3HOWB
chains in the Genus database with same CATH topology
1B7YB 1LUZA 3STBD 3M4PA 1PFSA 2RHQB 5IWAQ 4BY7H 3L7ZC 1PH5A 2JA9A 5GQOA 4KLKA 3K81C 4BY1H 5EAYA 3GTKH 2UXDL 4XTCS 4X66L 1B70B 4IPHA 5C44H 1L1OC 1CKNB 1TWHH 4NPSA 4YCWA 4X65Q 2K52A 3J81i 3PV0A 2CQOA 2GVBA 1P16A 4DR2Q 4DV7Q 3J81j 1TWCH 4KHPQ 4A75A 3I4NG 1NJIC 3I2ZA 2K75A 1Z47A 2VW9A 1XMOL 3CCLA 1VQCA 3G48A 2L15A 2EIFA 3S1QH 3CCRA 1WOCA 1A0IA 3STBC 4DAYB 2UUBL 4OX9Q 3PO2H 4A3MG 1VQ5A 1VQNA 3M9BA 2ZJRA 1YJNA 2MNAA 5LMUL 1UE5A 4HJAA 2WB1G 1JE5A 3S2DH 1G6PA 3A5UA 2Q2TA 1QVFA 1WJJA 1IZ6A 2BA1A 4DR4L 3MEFA 1E1OA 4FDBA 1PH6A 1TWAH 1D8LA 1WCMG 2D0OA 3CPWA 1IBLQ 5BR8L 2ZM6Q 2IHFA 3OYYA 3ULJA 4MNOA 4APVA 4POGA 4JI1L 2HT1A 1GO3E 4BBSH 5LMUQ 4C3HH 4YHHL 2UUAL 2B63H 1A62A 3S1NH 4DR6L 1Q7YC 2OQ0A 3K7UC 4BA1I 3JAMi 5ELOA 3NBHB 3HOVH 1XTDA 1OXVA 1X3FA 2UXBQ 3CQZH 2BH8A 2NN6I 4JI2L 4BA2I 2NZOA 5M3MH 2UXDQ 1RIPA 3RR5A 4EQ5A 4LFBL 2R7DA 3S16H 5C3EG 2MQHA 4IFDJ 2F3IA 4L5TA 3PIOA 2VQFL 2UXCQ 3RNUA 3PO2G 1SFOH 5C44G 4DV5Q 1I6HH 4AIMA 1VQ4A 5DLQE 1QVGA 1EWIA 4LFBQ 2HIXA 3HFZB 3ULLA 4JI2Q 3KLWA 4X62Q 4A3IH 4BBSG 4JI0Q 1HNXQ 1B8AA 5FJ8H 1LYLA 1X3EA 4LUZA 4HJ8A 4IJHA 4JBMA 1E3PA 2RHSB 3EN2A 1HR0L 3HOYH 3S17H 5GROA 3I56A 2H5XA 2ZJQA 3NENA 2E5LQ 1OXTA 2IX0A 4A3MH 3KDFA 1W3SA 4HIKA 1E1TA 3PUXA 1K83H 4GOPB 2K5NA 1OTCA 4LF8L 2JA6H 4JV5L 4GLXA 2WP8J 3F2CA 3AQQA 3EIVA 4JBJA 2EQSA 1VQLA 4R1JA 4JI8L 5IT9c 2E5LL 1BBWA 4DKAC 2NVQH 3I4NH 1IXRA 5LMNQ 1R9TH 5M5XH 1JJGA 3RLOA 1NMFA 2E8GA 3EBEA 3KJPA 3CCSA 3TREA 5M3FH 4DV1L 4DV3L 3FHWA 2QA4A 4HIDA 1FGUA 1PV4A 1VQ8A 1XNQQ 3JC66 1L2FA 2Y0SE 4JI0L 4C2MH 4DR7Q 1J5EL 2N8NA 1N32L 3U4ZA 1PVOA 5GAGC 1FL0A 2JA7G 2RF4A 1IYJB 2JA7H 4LW1A 3J81c 3VDYA 4X6AH 4JBKA 4JCVE 4B3TQ 1I5FA 1L0WA 4JG2A 4DV7L 4DR2L 5ELNA 1KQSA 1JB7A 5HY6A 4RG1A 2R7ZG 1EIFA 3AFQA 5C3EH 3SGIA 1FVIA 5E7NA 2E2IH 2Y0SG 2HHHQ 3GTPH 1H95A 4DV5L 4AYBE 1AE2A 3T1HL 2ID0A 1VS0A 3CCMA 2CFMA 4QGUA 1WI5A 2GN5A 3GTGH 4KHZA 3UE0A 2D62A 1HNWL 3CC2A 1OXSC 2YTYA 3BJUA 2B63G 2OQKA 1K8GA 3H15A 1PH8A 4GN4B 1KAWA 2KENA 1VQFA 1CUKA 1NTGA 3H0GH 1QZHA 3S1MH 4A3CG 2LXKA 4LF9L 1VQAA 1HZAA 4DUYQ 3UDGA 2F4VQ 3DLLA 1U0LA 2ZM6L 1TXYA 1V9PA 1IBLL 2OTLA 5FLMH 4LF6Q 1E24A 1VQIA 4KI0A 1VQMA 5C0XG 3J80i 1LM0A 4K0KQ 2GVAA 4GNXC 3G6EA 4A4IA 4JI3Q 3HOWH 2QGQA 4P72A 3GDEA 1VQHA 2N49A 4C3IH 3S15H 3M4OH 4OONA 2NVXH 2YYZA 4DV2L 3KYHC 4JC0A 1YHBA 4YWLA 3PO3H 1GKHA 4A3JG 1EQQA 2QEXA 1AE3A 4JI3L 5H1SE 1EUJA 3I4MH 3G71A 1UE6A 4GN5A 2ZJPA 1PH3A 1KL9A 1VQDA 2B3GA 3U4VA 2BA0A 1HNZL 4PZ7A 1CSPA 1SLJA 2Q2UA 2VUMG 5K36G 2R93H 4LF5L 4QIWE 5LMNW 2PQAB 4IOCA 3RN2A 3TQYA 1EQRA 1UWVA 3L0OA 2IHEA 4UPAA 4NB3A 1A8VA 3PUYA 2KHJA 3HOUG 4A3DG 4GKJL 1Y1VH 5IYCH 3GTQH 4BY7G 2IY5B 1X6OA 2NN6G 4HIMA 2R92H 3A0JA 3ICEA 1VQKA 5IYBG 4GKKQ 1Q12A 4TVAB 4GOPA 1XMQQ 1YHAA 1JMCA 2A8VA 2CKZB 3RLNA 3W1BA 1UEBA 1X3GA 2YV5A 1I3QH 4IPGA 3I55A 4HIOA 1XNRQ 1Q46A 1C7YA 5AJ3L 4DR3Q 4UP7A 2JA8G 3K0XA 1S3OA 3H3VI 5M5YH 3J7A5 1KHIA 3M7NA 4A3LH 5C4XG 1M1KC 4PZ8A 3WWVA 1PH2A 1N34Q 4A3KG 1Y1VG 1WYDA 2KCTA 4OO1G 1V43A 4PG3A 4DV3Q 4LF7Q 4B3MQ 5IP9G 1Y14B 3M4QA 1HR0W 4P73A 2ZTEA 3S24A 1HR0Q 3FKIH 5JEAG 5IYDG 1VQ9A 1K3RA 2CCZA 4DV6Q 4GNXB 4A93H 1Q1BA 1GVPA 4BBRH 1CSQA 1PH4A 1KD1C 1XMOQ 1EOVA 1IBML 3TS0A 4IPCA 3I4MG 3GTJH 3CMEA 1TWGH 3PF5A 2HIVA 1XNRL 3MXNB 4JI5Q 1YBYA 3KF6B 4MTNA 4DUYL 4LF9Q 2F4VL 3PUVA 3M3YH 4OO1I 4LF6L 2R6GA 1Y1WG 1PYBA 4A3GG 3BZKA 2JA8H 3Q8DA 4JOIA 4YY3Q 4HJ5A 1JJ2A 4LF4Q 1K9MC 4B3RQ 4X65L 2JQOA 1S40A 3H3VH 4JI4Q 5M5WH 3HOXH 1ASYA 1YHQA 2PNHA 2R7FA 4GNXA 4IO9A 4A3EH 1EYGA 1DGSA 3S2HH 3CCVA 3GTLH 2K50A 5IWAL 3F2DA 4OWWB 4L5SA 1Z9FA 3TS2A 1KC8C 4LWCA 4B3RL 4H02A 1M90C 2E2HH 2ES2A 4GN3B 2Z6KA 2F52A 5GAEC 1Q86C 1SR3A 1VQGA 1L1OB 1Q1EA 2HHHL 3B6YA 4R4IA 4O2DA 3CMAA 1YJ9A 4A3BH 1N36Q 3GO5A 4YWKA 3HOZG 3GD7A 1I94Q 2UU9Q 4LF5Q 1PH7A 2NVYH 4LFCQ 1X9NA 4HJ7A 4LFAQ 4A3FG 1C9OA 1CKMA 2IT1A 1FJGL 2VUMH 2JJQA 3S14H 1XNQL 1UE7A 2N3SA 5J3BA 1KRTA 4DV1Q 2OCEA 4A3FH 5C4JH 1Q82C 2WAQE 1YVCA 4QJFA 2ZTCA 2IX1A 4DR6Q 4DNIA 4GLVB 4GS3A 4DUZL 2K5HA 2UUBQ 1OXXK 4JI8Q 2MO0A 4JI1Q 4NXNL 5GADC 3OW2A 1SROA 2I0QA 4JI6Q 4LF7L 1FJGQ 2NZHA 4DR1Q 2WFWA 3A5ZB 5C0XI 1OXUA 1VCIA 2AWNA 3CP0A 2PI2A 3NEMA 4DK3C 3CCJA 4K0KL 3IRBA 3CF5A 3K7AH 4B3SL 4BXXH 1J6QA 3CAMA 4AQYQ 2PQAA 1BKBA 3E9HA 1VQBA 3HKZG 2WAQG 3CD6A 1VQEA 2AWOA 4IFDG 4A3GH 4O0AA 5C4XH 3F2BA 4R4TA 1BBUA 1XMQL 1W2BA 3HOZH 3UDFA 4X62L 1GM5A 2RCNA 3GTMH 4LFCL 4JI4L 2K5VA 4DV0Q 1HNXL 3HOUH 5JEAJ 4A3DH 3J80c 4QL5A 4R4OA 4X64L 3F8TA 4ME3A 1EIYB 2ZTDA 4NXML 4YCUA 4QQBX 4A93G 2EXDA 1MKHA 1T9HA 5IP7G 2PMZE 1YITA 5JJLA 3UDIA 3FKIG 1QVCA 5IYBH 3E9IA 1BVSA 3D31A 2CWPA 3AFPA 2K14A 3HOWG 4DV0L 1D7QA 2JEBI 2N78A 4JI5L 3KFUA 2VQFQ 3D0FA 1N32Q 4GLAC 4A3IG 1PH1A 4DR5L 1J5EQ 4OWXB 1YJWA 3CC7A 2LSSA 1HZ9A 3ZJYC 1QZGA 1K8AC 2B29A 3I4OA 1HZBA 2AKWB 3KF6A 3H0GG 1PH9A 1IBKL 4DPGA 1SMXA 1CKNA 1XJVA 1K73C 4AQYL 2KBNA 2A1AA 5M3MG 4ALPA 1IBMQ 1MJEA 5BR8Q 5IYDH 2C35B 2I5LX 4YWMA 5GAHC 2I5MX 4DR1L 4Y7NH 3J7ZC 4DR4Q 1YZ6A 3BZCA 1MJCA 3E0EA 3TEHB 5JJIA 1YIJA 2VZAA 3KOJA 3CCQA 1VQPA 3FP9A 4A3BG 2KHIA 1NMGA 4B3ML 4IOAA 3AYHB 3CPFA 1PA6A 3UE1A 4P71A 2VY3A 3JAMc 4GKKL 3HOYG 5IE8A 2R93G 1LTLA 2VL6A 3K80C 5C0XJ 1HNWQ 3NELA 4IJLA 3S1RH 3OTOQ 5AJ3Q 4DR3L 3LGJA 1Y1WH 1EFWA 1PHJA 2YU9H 2Z0SA 1YNXA 3T1HQ 2R7ZH 2MFIA 2VNUD 5IYCG 1GD7A 3PSIA 1SRUA 4HJ9A 4NXMQ 2R92G 4OXPA 2UXCL 2LXJA 3OTOL 1KIXA 4C3JH 4XIGS 1HNZQ 2JA6G 4WJ4A 4P74A 3KDFB 4X66Q 1XPOA 2DGYA 4PZ6A 2VQEQ 1A63A 2OTJA 1MIUA 2Q2IA 1G291 5LMNL 4BXXG 3PIPA 2BH2A 4YY3L 4LF4L 3CXCA 4YCVA 5FJ8G 4A3CH 3L2PA 4B3SQ 3ERSX 4LF8Q 1L1OA 4BY1G 2HQLA 3CW2C 3ULPA 4R4CA 1V1QA 1AH9A 1XPUA 3HKZE 1NE3A 3GTOH 4QY7A 4BBRG 4GOPC 4L5RC 5IP7H 4Y52H 2ALYB 2AHOB 1VQ6A 4IFDI 3KF8B 1KXLA 4OX9L 2VQEL 2Q2HA 4J15A 1E22A 1G51A 1QUQB 1X65A 1ASZA 1K0RA 2XTIA 4P75A 4UP8A 2VS1A 1HH2P 1VQOA 3HOVG 4A3LG 2NVTH 4AYBG 1XPRA 4LUOA 2DUDA 4DV4L 3T1YQ 1E7ZA 4X64Q 1N36L 4JYAL 4AH6A 3AEVA 3KJOA 4UY8C 1YI2A 5IP9H 1O7IA 1YEZA 3HOXG 2CWAA 4OWTB 2WB1E 2XGTA 3G4SA 4WJ3M 2UXBL 1HZCA 4POFA 3ER0A 1SE8A 1HJPA 3U50C 1U5KA 1Q81C 1N8RC 3W1GA 3CCUA 4DR7L 2A19A 4GKJQ 4L5QA 4MZ9A 4A76A 1VQJA 2UUCQ 2JEAI 3F1ZA 5JJKA 2AMCB 3A74A 4LUVA 2JA5G 4A3JH 2JA5H 1JT8A 4LNQA 3RLFA 3UDXA 2MO1A 4RMFA 3RN5A 3RZDH 3RZOH 1QUQA 2K4KA 4UP9A 4JI7Q 2UUAQ 2ASBA 3U58A 4YHHQ 4B3TL 1C0AA 1X55A 2I5HA 3PCOB 5HGQA 3CCEA 4DV4Q 3T1YL 3W5OA 4JYAQ 2OWOA 2ATWA 3TRZA 1I50H 1N33L 1Q8KA 1KRSA 1P8LA 5IY0A 3HKSA 1RL2A 4DV6L 3PUWA 4R4QA 4PMWA 3BU2A 4EX5A 4JI6L 4NXNQ 5FLMG 1SN8A 4A3KH 1N9WA 1CKOA 3PGZA 2KCMA 4DUZQ 1IBKQ 1TWFH 3PO3G 4DV2Q 3I7FA 3CC4A 2PI2E 2Z6KC 1N33Q 1WCMH 1X54A 1PYSB 2V1CC 1X56A 2FXQA 1I94L 1NBWA 4A3EG 2E2JH 4DAMA 1JJCB 4IPDA 1WFQA 2UU9L 4DR5Q 3PF4A 1N34L 4KHPL 2YTVA 4JV5Q 1S72A 4LFAL 1UE1A 5M3FG 5FLXc 4TQUS 1VQ7A 3PUZA 4JBWA 2JE6I 4JOIC 3DM3A 4DK6C 2D0PA 1IL2A 1NY4A 2JK8A 4JI7L 2YTXA 3K8AA 2UUCL 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Y B;  1LUZ A;  3STB D;  3M4P A;  1PFS A;  2RHQ B;  5IWA Q;  4BY7 H;  3L7Z C;  1PH5 A;  2JA9 A;  5GQO A;  4KLK A;  3K81 C;  4BY1 H;  5EAY A;  3GTK H;  2UXD L;  4XTC S;  4X66 L;  1B70 B;  4IPH A;  5C44 H;  1L1O C;  1CKN B;  1TWH H;  4NPS A;  4YCW A;  4X65 Q;  2K52 A;  3J81 i;  3PV0 A;  2CQO A;  2GVB A;  1P16 A;  4DR2 Q;  4DV7 Q;  3J81 j;  1TWC H;  4KHP Q;  4A75 A;  3I4N G;  1NJI C;  3I2Z A;  2K75 A;  1Z47 A;  2VW9 A;  1XMO L;  3CCL A;  1VQC A;  3G48 A;  2L15 A;  2EIF A;  3S1Q H;  3CCR A;  1WOC A;  1A0I A;  3STB C;  4DAY B;  2UUB L;  4OX9 Q;  3PO2 H;  4A3M G;  1VQ5 A;  1VQN A;  3M9B A;  2ZJR A;  1YJN A;  2MNA A;  5LMU L;  1UE5 A;  4HJA A;  2WB1 G;  1JE5 A;  3S2D H;  1G6P A;  3A5U A;  2Q2T A;  1QVF A;  1WJJ A;  1IZ6 A;  2BA1 A;  4DR4 L;  3MEF A;  1E1O A;  4FDB A;  1PH6 A;  1TWA H;  1D8L A;  1WCM G;  2D0O A;  3CPW A;  1IBL Q;  5BR8 L;  2ZM6 Q;  2IHF A;  3OYY A;  3ULJ A;  4MNO A;  4APV A;  4POG A;  4JI1 L;  2HT1 A;  1GO3 E;  4BBS H;  5LMU Q;  4C3H H;  4YHH L;  2UUA L;  2B63 H;  1A62 A;  3S1N H;  4DR6 L;  1Q7Y C;  2OQ0 A;  3K7U C;  4BA1 I;  3JAM i;  5ELO A;  3NBH B;  3HOV H;  1XTD A;  1OXV A;  1X3F A;  2UXB Q;  3CQZ H;  2BH8 A;  2NN6 I;  4JI2 L;  4BA2 I;  2NZO A;  5M3M H;  2UXD Q;  1RIP A;  3RR5 A;  4EQ5 A;  4LFB L;  2R7D A;  3S16 H;  5C3E G;  2MQH A;  4IFD J;  2F3I A;  4L5T A;  3PIO A;  2VQF L;  2UXC Q;  3RNU A;  3PO2 G;  1SFO H;  5C44 G;  4DV5 Q;  1I6H H;  4AIM A;  1VQ4 A;  5DLQ E;  1QVG A;  1EWI A;  4LFB Q;  2HIX A;  3HFZ B;  3ULL A;  4JI2 Q;  3KLW A;  4X62 Q;  4A3I H;  4BBS G;  4JI0 Q;  1HNX Q;  1B8A A;  5FJ8 H;  1LYL A;  1X3E A;  4LUZ A;  4HJ8 A;  4IJH A;  4JBM A;  1E3P A;  2RHS B;  3EN2 A;  1HR0 L;  3HOY H;  3S17 H;  5GRO A;  3I56 A;  2H5X A;  2ZJQ A;  3NEN A;  2E5L Q;  1OXT A;  2IX0 A;  4A3M H;  3KDF A;  1W3S A;  4HIK A;  1E1T A;  3PUX A;  1K83 H;  4GOP B;  2K5N A;  1OTC A;  4LF8 L;  2JA6 H;  4JV5 L;  4GLX A;  2WP8 J;  3F2C A;  3AQQ A;  3EIV A;  4JBJ A;  2EQS A;  1VQL A;  4R1J A;  4JI8 L;  5IT9 c;  2E5L L;  1BBW A;  4DKA C;  2NVQ H;  3I4N H;  1IXR A;  5LMN Q;  1R9T H;  5M5X H;  1JJG A;  3RLO A;  1NMF A;  2E8G A;  3EBE A;  3KJP A;  3CCS A;  3TRE A;  5M3F H;  4DV1 L;  4DV3 L;  3FHW A;  2QA4 A;  4HID A;  1FGU A;  1PV4 A;  1VQ8 A;  1XNQ Q;  3JC6 6;  1L2F A;  2Y0S E;  4JI0 L;  4C2M H;  4DR7 Q;  1J5E L;  2N8N A;  1N32 L;  3U4Z A;  1PVO A;  5GAG C;  1FL0 A;  2JA7 G;  2RF4 A;  1IYJ B;  2JA7 H;  4LW1 A;  3J81 c;  3VDY A;  4X6A H;  4JBK A;  4JCV E;  4B3T Q;  1I5F A;  1L0W A;  4JG2 A;  4DV7 L;  4DR2 L;  5ELN A;  1KQS A;  1JB7 A;  5HY6 A;  4RG1 A;  2R7Z G;  1EIF A;  3AFQ A;  5C3E H;  3SGI A;  1FVI A;  5E7N A;  2E2I H;  2Y0S G;  2HHH Q;  3GTP H;  1H95 A;  4DV5 L;  4AYB E;  1AE2 A;  3T1H L;  2ID0 A;  1VS0 A;  3CCM A;  2CFM A;  4QGU A;  1WI5 A;  2GN5 A;  3GTG H;  4KHZ A;  3UE0 A;  2D62 A;  1HNW L;  3CC2 A;  1OXS C;  2YTY A;  3BJU A;  2B63 G;  2OQK A;  1K8G A;  3H15 A;  1PH8 A;  4GN4 B;  1KAW A;  2KEN A;  1VQF A;  1CUK A;  1NTG A;  3H0G H;  1QZH A;  3S1M H;  4A3C G;  2LXK A;  4LF9 L;  1VQA A;  1HZA A;  4DUY Q;  3UDG A;  2F4V Q;  3DLL A;  1U0L A;  2ZM6 L;  1TXY A;  1V9P A;  1IBL L;  2OTL A;  5FLM H;  4LF6 Q;  1E24 A;  1VQI A;  4KI0 A;  1VQM A;  5C0X G;  3J80 i;  1LM0 A;  4K0K Q;  2GVA A;  4GNX C;  3G6E A;  4A4I A;  4JI3 Q;  3HOW H;  2QGQ A;  4P72 A;  3GDE A;  1VQH A;  2N49 A;  4C3I H;  3S15 H;  3M4O H;  4OON A;  2NVX H;  2YYZ A;  4DV2 L;  3KYH C;  4JC0 A;  1YHB A;  4YWL A;  3PO3 H;  1GKH A;  4A3J G;  1EQQ A;  2QEX A;  1AE3 A;  4JI3 L;  5H1S E;  1EUJ A;  3I4M H;  3G71 A;  1UE6 A;  4GN5 A;  2ZJP A;  1PH3 A;  1KL9 A;  1VQD A;  2B3G A;  3U4V A;  2BA0 A;  1HNZ L;  4PZ7 A;  1CSP A;  1SLJ A;  2Q2U A;  2VUM G;  5K36 G;  2R93 H;  4LF5 L;  4QIW E;  5LMN W;  2PQA B;  4IOC A;  3RN2 A;  3TQY A;  1EQR A;  1UWV A;  3L0O A;  2IHE A;  4UPA A;  4NB3 A;  1A8V A;  3PUY A;  2KHJ A;  3HOU G;  4A3D G;  4GKJ L;  1Y1V H;  5IYC H;  3GTQ H;  4BY7 G;  2IY5 B;  1X6O A;  2NN6 G;  4HIM A;  2R92 H;  3A0J A;  3ICE A;  1VQK A;  5IYB G;  4GKK Q;  1Q12 A;  4TVA B;  4GOP A;  1XMQ Q;  1YHA A;  1JMC A;  2A8V A;  2CKZ B;  3RLN A;  3W1B A;  1UEB A;  1X3G A;  2YV5 A;  1I3Q H;  4IPG A;  3I55 A;  4HIO A;  1XNR Q;  1Q46 A;  1C7Y A;  5AJ3 L;  4DR3 Q;  4UP7 A;  2JA8 G;  3K0X A;  1S3O A;  3H3V I;  5M5Y H;  3J7A 5;  1KHI A;  3M7N A;  4A3L H;  5C4X G;  1M1K C;  4PZ8 A;  3WWV A;  1PH2 A;  1N34 Q;  4A3K G;  1Y1V G;  1WYD A;  2KCT A;  4OO1 G;  1V43 A;  4PG3 A;  4DV3 Q;  4LF7 Q;  4B3M Q;  5IP9 G;  1Y14 B;  3M4Q A;  1HR0 W;  4P73 A;  2ZTE A;  3S24 A;  1HR0 Q;  3FKI H;  5JEA G;  5IYD G;  1VQ9 A;  1K3R A;  2CCZ A;  4DV6 Q;  4GNX B;  4A93 H;  1Q1B A;  1GVP A;  4BBR H;  1CSQ A;  1PH4 A;  1KD1 C;  1XMO Q;  1EOV A;  1IBM L;  3TS0 A;  4IPC A;  3I4M G;  3GTJ H;  3CME A;  1TWG H;  3PF5 A;  2HIV A;  1XNR L;  3MXN B;  4JI5 Q;  1YBY A;  3KF6 B;  4MTN A;  4DUY L;  4LF9 Q;  2F4V L;  3PUV A;  3M3Y H;  4OO1 I;  4LF6 L;  2R6G A;  1Y1W G;  1PYB A;  4A3G G;  3BZK A;  2JA8 H;  3Q8D A;  4JOI A;  4YY3 Q;  4HJ5 A;  1JJ2 A;  4LF4 Q;  1K9M C;  4B3R Q;  4X65 L;  2JQO A;  1S40 A;  3H3V H;  4JI4 Q;  5M5W H;  3HOX H;  1ASY A;  1YHQ A;  2PNH A;  2R7F A;  4GNX A;  4IO9 A;  4A3E H;  1EYG A;  1DGS A;  3S2H H;  3CCV A;  3GTL H;  2K50 A;  5IWA L;  3F2D A;  4OWW B;  4L5S A;  1Z9F A;  3TS2 A;  1KC8 C;  4LWC A;  4B3R L;  4H02 A;  1M90 C;  2E2H H;  2ES2 A;  4GN3 B;  2Z6K A;  2F52 A;  5GAE C;  1Q86 C;  1SR3 A;  1VQG A;  1L1O B;  1Q1E A;  2HHH L;  3B6Y A;  4R4I A;  4O2D A;  3CMA A;  1YJ9 A;  4A3B H;  1N36 Q;  3GO5 A;  4YWK A;  3HOZ G;  3GD7 A;  1I94 Q;  2UU9 Q;  4LF5 Q;  1PH7 A;  2NVY H;  4LFC Q;  1X9N A;  4HJ7 A;  4LFA Q;  4A3F G;  1C9O A;  1CKM A;  2IT1 A;  1FJG L;  2VUM H;  2JJQ A;  3S14 H;  1XNQ L;  1UE7 A;  2N3S A;  5J3B A;  1KRT A;  4DV1 Q;  2OCE A;  4A3F H;  5C4J H;  1Q82 C;  2WAQ E;  1YVC A;  4QJF A;  2ZTC A;  2IX1 A;  4DR6 Q;  4DNI A;  4GLV B;  4GS3 A;  4DUZ L;  2K5H A;  2UUB Q;  1OXX K;  4JI8 Q;  2MO0 A;  4JI1 Q;  4NXN L;  5GAD C;  3OW2 A;  1SRO A;  2I0Q A;  4JI6 Q;  4LF7 L;  1FJG Q;  2NZH A;  4DR1 Q;  2WFW A;  3A5Z B;  5C0X I;  1OXU A;  1VCI A;  2AWN A;  3CP0 A;  2PI2 A;  3NEM A;  4DK3 C;  3CCJ A;  4K0K L;  3IRB A;  3CF5 A;  3K7A H;  4B3S L;  4BXX H;  1J6Q A;  3CAM A;  4AQY Q;  2PQA A;  1BKB A;  3E9H A;  1VQB A;  3HKZ G;  2WAQ G;  3CD6 A;  1VQE A;  2AWO A;  4IFD G;  4A3G H;  4O0A A;  5C4X H;  3F2B A;  4R4T A;  1BBU A;  1XMQ L;  1W2B A;  3HOZ H;  3UDF A;  4X62 L;  1GM5 A;  2RCN A;  3GTM H;  4LFC L;  4JI4 L;  2K5V A;  4DV0 Q;  1HNX L;  3HOU H;  5JEA J;  4A3D H;  3J80 c;  4QL5 A;  4R4O A;  4X64 L;  3F8T A;  4ME3 A;  1EIY B;  2ZTD A;  4NXM L;  4YCU A;  4QQB X;  4A93 G;  2EXD A;  1MKH A;  1T9H A;  5IP7 G;  2PMZ E;  1YIT A;  5JJL A;  3UDI A;  3FKI G;  1QVC A;  5IYB H;  3E9I A;  1BVS A;  3D31 A;  2CWP A;  3AFP A;  2K14 A;  3HOW G;  4DV0 L;  1D7Q A;  2JEB I;  2N78 A;  4JI5 L;  3KFU A;  2VQF Q;  3D0F A;  1N32 Q;  4GLA C;  4A3I G;  1PH1 A;  4DR5 L;  1J5E Q;  4OWX B;  1YJW A;  3CC7 A;  2LSS A;  1HZ9 A;  3ZJY C;  1QZG A;  1K8A C;  2B29 A;  3I4O A;  1HZB A;  2AKW B;  3KF6 A;  3H0G G;  1PH9 A;  1IBK L;  4DPG A;  1SMX A;  1CKN A;  1XJV A;  1K73 C;  4AQY L;  2KBN A;  2A1A A;  5M3M G;  4ALP A;  1IBM Q;  1MJE A;  5BR8 Q;  5IYD H;  2C35 B;  2I5L X;  4YWM A;  5GAH C;  2I5M X;  4DR1 L;  4Y7N H;  3J7Z C;  4DR4 Q;  1YZ6 A;  3BZC A;  1MJC A;  3E0E A;  3TEH B;  5JJI A;  1YIJ A;  2VZA A;  3KOJ A;  3CCQ A;  1VQP A;  3FP9 A;  4A3B G;  2KHI A;  1NMG A;  4B3M L;  4IOA A;  3AYH B;  3CPF A;  1PA6 A;  3UE1 A;  4P71 A;  2VY3 A;  3JAM c;  4GKK L;  3HOY G;  5IE8 A;  2R93 G;  1LTL A;  2VL6 A;  3K80 C;  5C0X J;  1HNW Q;  3NEL A;  4IJL A;  3S1R H;  3OTO Q;  5AJ3 Q;  4DR3 L;  3LGJ A;  1Y1W H;  1EFW A;  1PHJ A;  2YU9 H;  2Z0S A;  1YNX A;  3T1H Q;  2R7Z H;  2MFI A;  2VNU D;  5IYC G;  1GD7 A;  3PSI A;  1SRU A;  4HJ9 A;  4NXM Q;  2R92 G;  4OXP A;  2UXC L;  2LXJ A;  3OTO L;  1KIX A;  4C3J H;  4XIG S;  1HNZ Q;  2JA6 G;  4WJ4 A;  4P74 A;  3KDF B;  4X66 Q;  1XPO A;  2DGY A;  4PZ6 A;  2VQE Q;  1A63 A;  2OTJ A;  1MIU A;  2Q2I A;  1G29 1;  5LMN L;  4BXX G;  3PIP A;  2BH2 A;  4YY3 L;  4LF4 L;  3CXC A;  4YCV A;  5FJ8 G;  4A3C H;  3L2P A;  4B3S Q;  3ERS X;  4LF8 Q;  1L1O A;  4BY1 G;  2HQL A;  3CW2 C;  3ULP A;  4R4C A;  1V1Q A;  1AH9 A;  1XPU A;  3HKZ E;  1NE3 A;  3GTO H;  4QY7 A;  4BBR G;  4GOP C;  4L5R C;  5IP7 H;  4Y52 H;  2ALY B;  2AHO B;  1VQ6 A;  4IFD I;  3KF8 B;  1KXL A;  4OX9 L;  2VQE L;  2Q2H A;  4J15 A;  1E22 A;  1G51 A;  1QUQ B;  1X65 A;  1ASZ A;  1K0R A;  2XTI A;  4P75 A;  4UP8 A;  2VS1 A;  1HH2 P;  1VQO A;  3HOV G;  4A3L G;  2NVT H;  4AYB G;  1XPR A;  4LUO A;  2DUD A;  4DV4 L;  3T1Y Q;  1E7Z A;  4X64 Q;  1N36 L;  4JYA L;  4AH6 A;  3AEV A;  3KJO A;  4UY8 C;  1YI2 A;  5IP9 H;  1O7I A;  1YEZ A;  3HOX G;  2CWA A;  4OWT B;  2WB1 E;  2XGT A;  3G4S A;  4WJ3 M;  2UXB L;  1HZC A;  4POF A;  3ER0 A;  1SE8 A;  1HJP A;  3U50 C;  1U5K A;  1Q81 C;  1N8R C;  3W1G A;  3CCU A;  4DR7 L;  2A19 A;  4GKJ Q;  4L5Q A;  4MZ9 A;  4A76 A;  1VQJ A;  2UUC Q;  2JEA I;  3F1Z A;  5JJK A;  2AMC B;  3A74 A;  4LUV A;  2JA5 G;  4A3J H;  2JA5 H;  1JT8 A;  4LNQ A;  3RLF A;  3UDX A;  2MO1 A;  4RMF A;  3RN5 A;  3RZD H;  3RZO H;  1QUQ A;  2K4K A;  4UP9 A;  4JI7 Q;  2UUA Q;  2ASB A;  3U58 A;  4YHH Q;  4B3T L;  1C0A A;  1X55 A;  2I5H A;  3PCO B;  5HGQ A;  3CCE A;  4DV4 Q;  3T1Y L;  3W5O A;  4JYA Q;  2OWO A;  2ATW A;  3TRZ A;  1I50 H;  1N33 L;  1Q8K A;  1KRS A;  1P8L A;  5IY0 A;  3HKS A;  1RL2 A;  4DV6 L;  3PUW A;  4R4Q A;  4PMW A;  3BU2 A;  4EX5 A;  4JI6 L;  4NXN Q;  5FLM G;  1SN8 A;  4A3K H;  1N9W A;  1CKO A;  3PGZ A;  2KCM A;  4DUZ Q;  1IBK Q;  1TWF H;  3PO3 G;  4DV2 Q;  3I7F A;  3CC4 A;  2PI2 E;  2Z6K C;  1N33 Q;  1WCM H;  1X54 A;  1PYS B;  2V1C C;  1X56 A;  2FXQ A;  1I94 L;  1NBW A;  4A3E G;  2E2J H;  4DAM A;  1JJC B;  4IPD A;  1WFQ A;  2UU9 L;  4DR5 Q;  3PF4 A;  1N34 L;  4KHP L;  2YTV A;  4JV5 Q;  1S72 A;  4LFA L;  1UE1 A;  5M3F G;  5FLX c;  4TQU S;  1VQ7 A;  3PUZ A;  4JBW A;  2JE6 I;  4JOI C;  3DM3 A;  4DK6 C;  2D0P A;  1IL2 A;  1NY4 A;  2JK8 A;  4JI7 L;  2YTX A;  3K8A A;  2UUC L;  3M85 A; 
#chains in the Genus database with same CATH topology
 1VDZ A;  3CHB D;  3M4P A;  3MEH A;  1PFS A;  2RHQ B;  4FP5 D;  2JA9 A;  5IT9 L;  1B70 B;  4I65 A;  5C44 H;  3PIP 3;  4NPS A;  1H9K A;  3PV0 A;  1ET6 A;  1EQV A;  1X3Q A;  4BWG B;  1HUN A;  2GVB A;  2L4N A;  1ILP A;  3A8K E;  4CJ1 B;  2X69 A;  4A75 A;  3I4N G;  4KJN A;  1NJI C;  2VW9 A;  1RD9 D;  3G48 A;  4KN4 C;  4G7Z C;  1CHQ D;  1A0I A;  2EJG C;  4DAY B;  3PO2 H;  1AW7 A;  4A3M G;  5D65 A;  2ZJR A;  3IKJ A;  4HJA A;  1AN8 A;  1JE5 A;  5CV9 A;  3A5U A;  1QVF A;  1TKW B;  4QUF A;  3KBG A;  2QKI C;  3MXP A;  3Q6S A;  3CPW A;  4CJ2 C;  5KEE A;  2WKC A;  4CDE C;  3VYU A;  4IUU A;  1I4X A;  4YHH L;  2UUA L;  4U68 A;  4DR6 L;  1Q7Y C;  2OQ0 A;  3T56 B;  2I07 B;  3HS0 C;  3SK8 A;  2DNE A;  3GTO B;  1STE A;  1VMC A;  1RIP A;  1GUG A;  4LFB L;  1D1K A;  1SJE D;  2AQ3 B;  4DXG A;  3PIO A;  2CH4 W;  4HSV A;  2VQF L;  3PO2 G;  1SFO H;  1W6J A;  4DV5 Q;  1I6H H;  1JWS D;  4K6L A;  3FVQ A;  1QVG A;  4DNT B;  4JI2 Q;  1SYF A;  2WIN B;  1YNJ C;  5FJ8 H;  4QCL A;  3FDT A;  4JBM A;  1QE6 A;  2H5X A;  3GTJ B;  3HOX B;  1AEX A;  4A3G B;  1ENA A;  4G4K A;  4A3M H;  1K83 H;  2F0D A;  4JV5 L;  1OTC A;  2JA6 H;  4GLX A;  3F2C A;  2NTS A;  3EIV A;  2EQS A;  1BBW A;  4WFN 3;  3I4N H;  3NWT A;  1IXR A;  1HA6 A;  3QOL A;  3KJP A;  4UAI A;  2G5D A;  4HID A;  2Y0S E;  4KJO A;  4FVM A;  4C2M H;  2N8N A;  4K8J A;  3U4Z A;  3OPO A;  5EJW A;  1FL0 A;  1SYB A;  1IYJ B;  4LW1 A;  3VDY A;  5HGT A;  4JCV E;  1I5F A;  4JG2 A;  3H91 A;  3SVM A;  1FVI A;  2Y0S G;  4K8I A;  1AE2 A;  1U9R A;  3T1H L;  2K7V A;  3CCM A;  2CFM A;  4CDD C;  4KHZ A;  3CKI B;  3DWA A;  1LT5 D;  1A3V A;  3J81 L;  1K8G A;  3H15 A;  1C4Q A;  1CUK A;  4A3C G;  4BY1 B;  4KKU A;  4HCE A;  4XYQ A;  1HZA A;  4DUY Q;  3EFX D;  3DLL A;  1BXT A;  1V9P A;  3MXU A;  5EQ0 A;  1E24 A;  1RTO A;  5COR A;  1IL8 A;  1LAB A;  1VQM A;  5C0X G;  2WB1 B;  3J80 i;  2F0N A;  4CKB A;  3G6E A;  1EU3 A;  3HOW H;  2QGQ A;  4P72 A;  2DY8 A;  1VQH A;  2N49 A;  3GDE A;  4C3I H;  3S15 H;  2RDG A;  2PMZ B;  2EPB A;  2LMC B;  4C3J B;  4QB4 A;  4RAU C;  3TSS A;  2YYZ A;  4JC0 A;  3VR4 A;  3I4M H;  3G71 A;  2SOB A;  1KL9 A;  2RSO A;  1KNA A;  5CC4 A;  2R93 H;  5LMN W;  4IOC A;  4C3I B;  4RA8 A;  1EQR A;  1A8V A;  1HCZ A;  1Y1V H;  3I4L A;  3GTQ H;  4BY7 G;  1Z7T A;  1PYW D;  5KNB A;  4GKK Q;  4DGZ A;  1JOK A;  4GOP A;  1A3U A;  3NBI A;  4XT1 B;  1BUV T;  2XRQ D;  2F3V A;  2JP1 A;  3I55 A;  3C1E A;  1EIG A;  1Y1V B;  2X6L A;  2E76 C;  4FF1 A;  2KED A;  3M7G A;  5C4X G;  1M1K C;  5C44 B;  1N34 Q;  1HPC A;  4RGM A;  1MSG A;  3AMU A;  4OO1 G;  2KCT A;  4HN7 A;  3KLS X;  4PG3 A;  1ESF A;  1SNQ A;  4DV3 Q;  4LF7 Q;  3EQL C;  1AZQ A;  2O2L D;  3M4Q A;  3BS1 A;  1AFP A;  4FF3 A;  1HR0 Q;  1JOO A;  2CCZ A;  1Q1B A;  1GVP A;  5CBE E;  1CSQ A;  3K0Y A;  5JJZ A;  5DM6 3;  1XMO Q;  1PH4 A;  1PRT D;  4CDC C;  1ET9 A;  2WKD A;  3S2H B;  4JI5 Q;  1QWY A;  4DUY L;  1JCK B;  4OO1 I;  5L37 A;  3ND9 A;  3Q8D A;  4LF4 Q;  2HCC A;  4TKO B;  1STY A;  1JQY D;  4WJW A;  4JI4 Q;  2PNH A;  4GNX A;  1EYG A;  1MGS A;  3S2H H;  3CCV A;  5IWA L;  4CGY B;  3F2D A;  4R9W A;  1KC8 C;  3S15 B;  2F52 A;  3MAQ A;  4PQX A;  2ICI A;  1PTO F;  2D5D A;  5C5M A;  3MTS A;  1PH7 A;  2NVY H;  1CA5 A;  1CKM A;  2VUM H;  2JJQ A;  3S14 H;  3NUC A;  1GHK A;  2J0T D;  5C4J H;  4QJF A;  3G6J B;  1SNM A;  2O4X A;  2IX1 A;  4DR6 Q;  2SEB D;  4DNI A;  1JB3 A;  2K5H A;  2PZT A;  2UUB Q;  1EWC A;  1T5E A;  3A5Z B;  2NVT B;  1VCI A;  2AWN A;  2GA4 B;  1G2S A;  2PW5 A;  4KY7 A;  4PMC A;  3CCJ A;  2L9H A;  4BXX H;  1XXG A;  1CA6 A;  4IN3 A;  1KNE A;  1EY7 A;  2NZ1 D;  1ENF A;  3E9H A;  2N88 A;  1VQE A;  2JA6 B;  3VR5 A;  3UDF A;  1Q3L A;  1GM5 A;  2K01 A;  3GTM H;  2F0J A;  5JEA J;  3J80 c;  4QL5 A;  1SXT A;  4X64 L;  4ME3 A;  1TS3 A;  3O13 A;  5CYU A;  5JAV A;  2CWP A;  3AFP A;  2K14 A;  3E3X A;  3QG1 A;  3HZX A;  4JI5 L;  4DFA A;  1J5E Q;  4DR5 L;  3MFG A;  3CC7 A;  2LSS A;  1D5Z C;  4X3K A;  2A68 C;  2EYP A;  3VYT A;  1K8A C;  2IJ0 A;  3I4O A;  5KGU A;  1HTP A;  4DPG A;  1SMX A;  1U4L A;  1CKN A;  1XJV A;  1K73 C;  4N9P A;  5FO9 B;  2MUY A;  2A1A A;  1KAB A;  1GHJ A;  2PNR C;  2WAC A;  2KQ3 A;  4ZYS A;  2C35 B;  5TSS A;  5EBC A;  4A3B G;  4J1M A;  4IOA A;  4B3M L;  1EY0 A;  3K5L A;  3FPU B;  1ZXT A;  5HUR A;  1RDP D;  4GKK L;  2EY5 A;  3HOY G;  4QF4 A;  1Y69 U;  3K80 C;  5C0X J;  1JR0 D;  2VUM B;  4MN3 A;  2XRS D;  4FNF A;  5IGE A;  3S9W A;  1V1P B;  1GD7 A;  1TWC B;  3G7L A;  4A3M B;  1LTA D;  1SRU A;  4HJ9 A;  4NXM Q;  4DU9 A;  1A15 A;  2RDF A;  4XIG S;  2I46 A;  2JA6 G;  4WJ4 A;  2Z8L A;  3OWF A;  3I4N B;  2DGY A;  2OTJ A;  1MIU A;  1G29 1;  1FYC A;  4KKS A;  1EFI D;  5I6W A;  4MIU A;  3K57 A;  4YY3 L;  3CXC A;  5EKK A;  5FJ8 G;  3L2P A;  2CQA A;  3ERS X;  3OOC A;  1LTI D;  1QJO A;  1PFB A;  1QIL A;  1XTC D;  5E4W C;  3UI2 A;  3GTO H;  4QY7 A;  4BBR G;  4GOP C;  4QIW B;  4KK7 A;  2ZT9 C;  3KF8 B;  2IWH A;  4J15 A;  1ICW A;  1QUQ B;  1X65 A;  4EQO A;  3R8B A;  1I6H B;  4OGQ C;  3HGB A;  5C4H A;  1O7Z A;  1HH2 P;  4RCN A;  1PZI D;  2NVT H;  4LUO A;  4KN7 C;  1I50 B;  3J7Y W;  1N36 L;  2K5Q A;  4UY8 C;  3SE0 A;  3HOX G;  2CWA A;  2WB1 E;  2XGT A;  2UXB L;  3L3O C;  4J8Q A;  1N8R C;  3U50 C;  2A74 C;  5AFW A;  3CCU A;  4L5Q A;  1VQJ A;  2JEA I;  5JJK A;  5IOC A;  2AMC B;  4A3J H;  4LNQ A;  3UDX A;  3RZO H;  3RN5 A;  2UUA Q;  5D3D A;  5ELF A;  3PO3 B;  3PCO B;  3J81 E;  2OWO A;  4K2L A;  1WTP A;  2F0K A;  1K28 A;  1TVX A;  4RHR A;  3TP5 A;  3PUW A;  4R4Q A;  1SJH D;  4FXD A;  4EX5 A;  4JI6 L;  4NXN Q;  2L11 A;  5D14 A;  1CKO A;  3PGZ A;  2KCM A;  1IBK Q;  2C9O A;  3ERO A;  2PI2 E;  3GTQ B;  2NVY B;  1PYS B;  2HQE A;  2V1C C;  3NTH A;  4UHV A;  3I8Z A;  1F9R A;  2BDO A;  1JJC B;  3ERQ A;  1S72 A;  4LFA L;  2EDG A;  3PUZ A;  4DK6 C;  2D0P A;  2F3W A;  2MGS A;  2YTX A;  2UUC L;  2LFN A;  2EZV A;  3IFD A;  4TRD A;  3STB D;  4KY6 A;  5IWA Q;  1CM9 A;  4F87 A;  4A3K B;  3I4M B;  1PH5 A;  4BY1 H;  3K81 C;  4XTC S;  4IPH A;  1L1O C;  1Y8P B;  3J81 i;  2VB2 X;  4YCW A;  4X65 Q;  3K59 A;  2L55 A;  3P75 A;  1SDF A;  3VYR A;  1B4O A;  4DV7 Q;  1TWC H;  5M3F B;  4O1N A;  1HQM C;  3I2Z A;  2K75 A;  1XMO L;  3NXW A;  1VQC A;  3QWN A;  5I2Y A;  4GZY C;  1WOC A;  2F1M A;  1TY2 A;  3M9B A;  2XNA C;  1UE5 A;  2Q8I B;  2FFK B;  2A73 B;  1VF7 A;  1WJJ A;  2K33 A;  2BA1 A;  4EQN A;  4DR4 L;  1E1O A;  1HTL D;  1PH6 A;  1IBL Q;  1CHP D;  5BR8 L;  2ZM6 Q;  3OYY A;  4POG A;  1RJT A;  4MNO A;  4BBS H;  2HT1 A;  1LV9 A;  1PZJ D;  1Y8N B;  5LMU Q;  1ENC A;  2B63 H;  1B50 A;  1D6E C;  3K58 A;  2F0W A;  3JAM i;  5ELO A;  3NBH B;  3HOV H;  4ODG A;  1F9Q A;  4JI2 L;  1Q90 A;  2UXD Q;  4EQ5 A;  2R7D A;  3U9S A;  3T16 A;  4IQZ A;  1VQ4 A;  2HIX A;  2JSO A;  3HFZ B;  3ULL A;  1CQF A;  4X62 Q;  4BBS G;  1SNP A;  1SEB D;  1SFO B;  1X3E A;  2R93 B;  3CQZ B;  2RHS B;  2A69 D;  5DM7 3;  3I56 A;  4DAV A;  1I4H A;  4BY7 B;  4HIK A;  4U67 3;  5JVG 3;  4LF8 L;  2RDH A;  3WOE A;  2JA5 B;  1G8Z D;  4JI8 L;  3SHL A;  2EYO A;  2NVQ H;  4RH6 A;  1GUO A;  1QG7 A;  5M5X H;  3OHX C;  4DV1 L;  3FHW A;  2QA4 A;  3C1F A;  1I3Q B;  3JC6 6;  1L2F A;  5LL6 X;  4X3U A;  4DR7 Q;  1J5E L;  1N32 L;  2JA7 G;  2D2C C;  3EA6 A;  3GP7 A;  1JB7 A;  1KQS A;  4EGV A;  5ELN A;  1S5C D;  4PMB A;  2L5T A;  3AFQ A;  4YIJ A;  3SGI A;  1B53 A;  3GTP H;  1H95 A;  2NWG A;  4AYB E;  3D4R A;  2ID0 A;  1PRT B;  1VS0 A;  1WI5 A;  3DM1 A;  5A2Q E;  5EKI A;  1HNW L;  3OW7 A;  1JOQ A;  1CI3 M;  3V2T A;  5J1Z A;  2F0M A;  3IL8 A;  4GN4 B;  4KD4 A;  2E74 C;  5I4D A;  1VQF A;  1QZH A;  1CT1 D;  2R92 B;  2LXK A;  2JN4 A;  1O7L A;  2F4V Q;  2XSC A;  2ZM6 L;  2B2V A;  4N9T A;  5CR3 A;  1TS5 A;  1B44 D;  4KI0 A;  4L8J A;  3NP8 A;  4GNX C;  3V96 A;  4Z9C B;  3LWE A;  1QOH A;  3M4O H;  1H9S B;  5C3W A;  4DV2 L;  3KYH C;  3PO3 H;  1YHB A;  4A3J G;  1AE3 A;  2B2Y A;  4JI3 L;  1PFM A;  3N6R A;  2LKV A;  1W6K A;  2B3G A;  3U4V A;  2BA0 A;  5K36 G;  4X3T A;  1GUN A;  1EY5 A;  3TQY A;  1U4R A;  3L0O A;  2IHE A;  2EVB A;  4UPA A;  3PUY A;  2KHJ A;  4A3D G;  2XWB B;  3FKI B;  5G3L D;  3HOV B;  1X6O A;  2R92 H;  4V19 0;  3K7A B;  3ICE A;  5IYB G;  3ZYY X;  5E1F A;  1KDA A;  3TBI B;  1XNR Q;  1BF4 A;  3S2D B;  2A68 D;  5AJ3 L;  2JA8 G;  3MWY W;  1S3O A;  3H3V I;  3J7A 5;  3KLS A;  3M7N A;  4ULL A;  1EU4 A;  2BDN A;  4PZ8 A;  3WWV A;  1Y1V G;  1WYD A;  2R61 A;  1HR0 W;  3I91 A;  2ZTE A;  1VQ9 A;  4ZK9 B;  1NNX A;  1SSO A;  4DV6 Q;  4A93 H;  3KBX A;  5ELC A;  2DJG C;  5J22 A;  1KD1 C;  5KND A;  1EOV A;  3QOJ A;  1XNR L;  3MXN B;  3K5N A;  4MTN A;  1EYA A;  2K32 A;  2F4V L;  3BZD B;  3M3Y H;  4A3E B;  2MHV A;  1NSN S;  1PYB A;  2F4I A;  3BZK A;  2JA8 H;  4YY3 Q;  4ZCK A;  1K9M C;  3HKZ B;  3C2P A;  3H3V H;  1UEA B;  5G3L F;  3HOX H;  1YHQ A;  2R7F A;  5EPK A;  3FMC A;  4IO9 A;  1DGS A;  1STH A;  3RD4 A;  3TME A;  3TS2 A;  1Z9F A;  3R2I A;  4B3R L;  4GN3 B;  5GAE C;  1Q86 C;  1K8O A;  1VQG A;  5LL6 S;  1Q1E A;  2HHH L;  1YJ9 A;  4A3B H;  3GO5 A;  4YWK A;  2F0T A;  3GD7 A;  5IGC A;  3E0J A;  1GOZ A;  4LFA Q;  1C9O A;  2B2T C;  2IT1 A;  1FJG L;  2YU9 B;  4A3F H;  5J3B A;  1ILQ A;  2MJ8 A;  3MFY A;  2WAQ E;  3BDC A;  2ZTC A;  2IX3 A;  4DUZ L;  1DOK A;  1E2W A;  2MO0 A;  5GAD C;  2Z4H A;  3FEW X;  4DR1 Q;  3J80 L;  5C0X I;  1V1P A;  2F0P A;  3KUP A;  1M8A A;  3K7A H;  1II3 A;  5IGF A;  1PMR A;  1BKB A;  5CV7 A;  2HUG A;  1VQB A;  3HKZ G;  2SNS A;  3W2D A;  5ELD A;  1W2B A;  4X62 L;  1BNZ A;  3T4A C;  2RCN A;  3A55 A;  4JI4 L;  3J7A V;  2JYO A;  4R4O A;  1B2T A;  1EIY B;  2WAQ B;  4YCU A;  2EXD A;  5IP7 G;  1STN A;  3FKI G;  1QVC A;  3E9I A;  1F2M A;  1BVS A;  3CU7 A;  4DV0 L;  4ABN A;  1LT4 D;  1N32 Q;  1PH1 A;  1D2B A;  5EGT A;  5BN4 A;  4PV1 C;  1HZB A;  3H0G G;  1PH9 A;  4HMI A;  1IBK L;  4IUT A;  2KBN A;  5C0X H;  4ALP A;  5C3E B;  2PZW A;  1SYE A;  1SBB B;  2K03 A;  1MJE A;  2QW7 A;  5GAH C;  3J7Z C;  1JWU D;  1YZ6 A;  2SDF A;  5JJI A;  1YIJ A;  3FP9 A;  1R4Q B;  3AYH B;  2B2V C;  3CPF A;  2QF7 A;  2CHB D;  2VY3 A;  2B2U C;  1SYD A;  5IE8 A;  3PIO 3;  2VL6 A;  1HNW Q;  5DAU A;  1CZG A;  5C4J B;  5AJ3 Q;  3LGJ A;  1EFW A;  2F0V A;  2YU9 H;  2Z0S A;  3T1H Q;  2R7Z H;  1K83 B;  5IYC G;  1TS4 A;  4KMU C;  2OF1 A;  4OXP A;  1EEF D;  2QEJ C;  2LXJ A;  3OTO L;  1HNZ Q;  4P74 A;  3P20 A;  4X66 Q;  5C4Z A;  5M9O A;  2NVQ B;  2FJ2 A;  2VQE Q;  4BXX G;  1IHZ A;  3PIP A;  1FNU A;  2R3Z A;  1FGB D;  5M5W B;  1FR3 A;  2RVL A;  2TSS A;  5C3X A;  4N8X 1;  4EQP A;  3JAM E;  5ISR A;  1RCV D;  3ULP A;  4KD3 A;  1HRJ A;  2M00 A;  5CGK A;  3CRK C;  3KK7 A;  2PQE A;  1DYQ A;  2K5W A;  4L5R C;  4ZKB B;  4K2K A;  2AHO B;  5I2X A;  3W3A A;  4OX9 L;  2VQE L;  1KXL A;  2MPM A;  3RZD B;  1E22 A;  1WTR A;  1WVL A;  4CBV A;  1PTO H;  2XTI A;  4P75 A;  4UP8 A;  2OXP A;  2HCI A;  3D6C A;  4IZ8 A;  4JYA L;  2DUD A;  3HG9 A;  1SNC A;  1QNK A;  1IW7 D;  4X64 Q;  4AH6 A;  3AEV A;  1YI2 A;  2NB0 A;  1O7I A;  1YEZ A;  2A5H A;  2QCP X;  1RTN A;  4WJ3 M;  2RSN A;  1LT3 D;  1X32 A;  4M1U B;  1ICF B;  2A19 A;  4GKJ Q;  4BBS B;  1QCB D;  3F1Z A;  1WTV A;  3BDL A;  1BBX C;  2JA5 H;  1JT8 A;  4H44 C;  3RLF A;  2MO1 A;  4RMF A;  2ASB A;  1HHV A;  4B3T L;  2I5H A;  4JYA Q;  2J4X A;  3BDO A;  2ATW A;  3MZ5 A;  3TRZ A;  5IY0 A;  2WV6 D;  1O80 A;  2LY7 A;  1A2T A;  2KHS A;  4LK1 C;  1MD2 D;  1IYV A;  4XDX A;  1PTO B;  4A3K H;  1NR4 A;  1IKM A;  1NAP A;  3I7F A;  1EY6 A;  2Z6K C;  1N33 Q;  4DK0 A;  1WTQ A;  1X56 A;  2F0L A;  1RKN A;  1NBW A;  1EIH A;  4RFB A;  1WTW A;  1STA A;  2EYM A;  2B8F A;  1IL2 A;  3QR8 A;  1EY8 A;  1NY4 A;  1AP0 A;  3K8A A;  5EBD A;  3M85 A;  2QIL A;  1XX8 A;  4IUN A;  1H9S A;  1GUW A;  4RHS A;  4BY7 H;  3L7Z C;  1KTK A;  1LTB D;  5EAY A;  4K6D A;  1TII D;  3ITP A;  2K52 A;  2CQO A;  2L0C A;  4BS9 A;  2F0I A;  4A93 B;  3J81 j;  2EOT A;  5C4X B;  4BBR B;  1Z47 A;  1SMY D;  2L15 A;  4XQQ A;  3M3Y B;  1L0X B;  2LS0 1;  3STB C;  2UUB L;  3MA2 B;  4OX9 Q;  2Z4I A;  4F7X A;  1VQ5 A;  4KHV A;  1YJN A;  5LMU L;  1OO9 B;  3S2D H;  2F0Q A;  2Q2T A;  4FDB A;  5CV4 A;  5DNF A;  2IHF A;  4XXE A;  3ULJ A;  4APV A;  1HUM A;  1GO3 E;  4RGT A;  1LTS D;  1E0B A;  2N55 A;  4HTH A;  4XQJ A;  5FOB B;  2F0U A;  1UAP A;  1IKL A;  4A3B B;  1XTD A;  2Q8T A;  2UXB Q;  3E5S A;  1Y8O B;  3CQZ H;  2BH8 A;  1S5B D;  2NZO A;  3RR5 A;  1HA5 A;  3BVM A;  2MQH A;  2WII B;  4ID6 A;  2F3I A;  4L5T A;  3SEB A;  2UXC Q;  3RNU A;  4C3J G;  1L0Y B;  2BOS A;  1E2V A;  4RCO A;  1MHW C;  1DOL A;  1B3Q A;  5DLQ E;  1X3P A;  2EY1 A;  3DEP A;  5FKA C;  1GJX A;  3AU7 A;  3NK9 A;  1WTH A;  1TT2 A;  3BG3 A;  3NQT A;  2HD3 A;  4LUZ A;  4HJ8 A;  1F2Y A;  1E3P A;  3HOY H;  3S17 H;  1HR0 L;  1JOR A;  3GTM B;  2IX0 A;  4MTK A;  5CBA E;  1DJR D;  1TS2 A;  1W3S A;  5A35 A;  1E1T A;  2K5N A;  2K6A A;  1SE4 A;  2WP8 J;  1A2U A;  4JBJ A;  1V1O A;  1VQL A;  4R1J A;  5IT9 c;  2E5L L;  1K3B C;  5C5L A;  4XYO A;  1TY0 A;  5LMN Q;  1WTX A;  1JJG A;  3RLO A;  2E8G A;  3EBE A;  3TRE A;  5BN5 A;  5M3F H;  1VQ8 A;  1XNQ Q;  3HP3 A;  3JAM L;  1BCP D;  3BYY B;  4A3J B;  3NPP A;  2RF4 A;  2JA7 H;  3J81 c;  3NQI A;  4JBK A;  4B3T Q;  4DV7 L;  2Z9H A;  4XT3 B;  2R7Z G;  1D5M C;  1EIF A;  5E7N A;  2FMC A;  5KYL A;  4DV5 L;  1AZP A;  3K5O A;  3BYT B;  2F0S A;  5D3I B;  2GN5 A;  1NCV A;  2DN8 A;  3S17 B;  4MHE A;  1KAA A;  3GTG H;  3M4O B;  3CC2 A;  3F2U A;  2BE5 D;  3SK6 A;  1PH8 A;  1KAW A;  2KEN A;  1NTG A;  5T1G A;  3D8G A;  2JXM B;  1LO5 D;  3KF8 A;  3TDQ A;  1VQA A;  2K04 A;  3UDG A;  3I72 A;  1PRT F;  1TXY A;  4LF6 Q;  1IBL L;  3I90 A;  5FLM H;  1VQI A;  1YNN D;  2IW3 A;  4ZQ3 A;  4JI3 Q;  2E2H B;  3GV6 A;  4F88 A;  4C1N I;  4OON A;  2NVX H;  3TP7 A;  4AYB B;  1J8I A;  4N8F A;  1GKH A;  1BCP B;  5H1S E;  3X3M A;  3S1M B;  2ZJP A;  1PH3 A;  1ESR A;  4L6T B;  1BO0 A;  3Q23 A;  1HNZ L;  4PZ7 A;  2VUM G;  4QIW E;  3RN2 A;  1BQQ T;  1PLF A;  1PTO D;  3HOU G;  1BR9 A;  2F0F A;  3H6M A;  5IYC H;  5EPJ A;  5IGG A;  2IY5 B;  1C48 A;  2NN6 G;  3S1N B;  2B2U A;  4P2C B;  1XMQ Q;  2A8V A;  3LNN A;  2CKZ B;  2FMM A;  3RLN A;  4G57 A;  3S1R B;  2PPB C;  1X3G A;  1DM0 B;  1I3Q H;  2YV5 A;  1H9J A;  4B9W A;  1Q46 A;  3NWS A;  5E3F A;  1B9M A;  5M5Y H;  1KHI A;  5IIF A;  4ME5 A;  5CMD A;  4A3K G;  5A2Q L;  4EVO A;  1EEI D;  4B3M Q;  5IP9 G;  1Y14 B;  1H9M A;  2RA4 A;  1SMY C;  4A3I B;  2IPK D;  3S24 A;  1YNJ D;  1K3R A;  4BBR H;  5C6A A;  1IBM L;  3TS0 A;  4IPC A;  2K05 A;  3KF6 B;  3HRZ C;  3H09 A;  3PUV A;  4LF9 Q;  3D4D A;  2K28 A;  3NBH A;  4LF6 L;  1Y1W G;  1Q8I A;  3MXG A;  4OEL B;  1JJ2 A;  2EJM A;  3PQI A;  4B3R Q;  4X65 L;  1J9O A;  2JQO A;  3A8I E;  5M5W H;  1ASY A;  3A7L A;  4A3E H;  1LTG D;  2K50 A;  4OWW B;  4Y52 H;  2BCO A;  4L5S A;  4CKE A;  5M5Y B;  2E2H H;  3HOZ B;  5KNC A;  1GXD C;  1L1O B;  1FD7 D;  3B6Y A;  4R4I A;  3CMA A;  3HOZ G;  2UU9 Q;  4LFC Q;  5KRU A;  4RKL A;  2Q8R E;  2G9H D;  1G6Z A;  1Y1W B;  1I4P A;  1UE7 A;  2N3S A;  2DY7 A;  1KRT A;  4DV1 Q;  2OCE A;  2EY2 A;  1YVC A;  3P7J A;  4FXK C;  4I7A A;  4R8N A;  1WD1 A;  4GLV B;  4GS3 A;  5IOD A;  4OHJ A;  1OXX K;  3OW2 A;  4LF7 L;  2B2W A;  2NZH A;  2WFW A;  5FK9 C;  4DK3 C;  2PI2 A;  4K0K L;  4WOR A;  3SR1 A;  3CF5 A;  3Q24 A;  1C8C A;  4B3S L;  3QJY A;  4AQY Q;  2B8G A;  2PQA A;  3T53 B;  3CD6 A;  2AWO A;  4J6H A;  4O0A A;  5C4X H;  3F2B A;  1BBU A;  1XMQ L;  3HOZ H;  4ZUJ A;  3VR3 A;  2K5V A;  4DV0 Q;  4A3D H;  5JVH 3;  2QDL A;  4IUR A;  2ICE C;  4NMZ A;  2OT2 A;  4NXM L;  2ZTD A;  4QQB X;  1MKH A;  3FRP B;  1EYC A;  3D31 A;  3HOW G;  1D7Q A;  2NN6 H;  2JEB I;  2N78 A;  3KFU A;  2VQF Q;  3BVG A;  4A3I G;  5JOB A;  4OWX B;  1YJW A;  3K6O A;  3RMH A;  3SDZ A;  1HZ9 A;  4ZAI A;  2B29 A;  2AKW B;  1WD0 A;  4RKB A;  1DCZ A;  2M2L A;  2Z6B A;  2K5D A;  4H0L C;  4CJ0 B;  2BE5 C;  5M3M G;  2HDM A;  1ONL A;  5BR8 Q;  3NSW A;  2I5L X;  2EYH A;  5ELB A;  5K5P A;  2ENB A;  3BZC A;  4DR4 Q;  2DJF C;  2VZA A;  3TN2 A;  2AUK A;  4ZUI A;  1VQP A;  2KHI A;  1NMG A;  4NDX A;  3J80 E;  1PA6 A;  3UE1 A;  3NTK A;  4KKT A;  2R93 G;  1LTL A;  4A3F B;  3N52 A;  3NEL A;  3VYS A;  3S1R H;  1Y1W H;  1DXM A;  4OIJ A;  1I6V C;  2DNC A;  1YNX A;  4IAL A;  2MFI A;  2F0O A;  2H1E A;  5CV6 A;  2CW0 D;  3PSI A;  1Z6H A;  4IUP A;  2KCC A;  1KIX A;  4C3J H;  4HAE A;  1CK1 A;  3KDF B;  3OMC A;  1F2L A;  4KY5 A;  4L63 B;  1DD2 A;  3WDN A;  3URY A;  2R7Z B;  1A63 A;  2Q2I A;  5LMN L;  2BH2 A;  5COY A;  5ELE A;  1S5E D;  3OWE B;  4A3C H;  3SK5 A;  1SAP A;  4LF8 Q;  2JA8 B;  4BY1 G;  1TU2 B;  2SNM A;  1EWH A;  1SYG A;  1GUS A;  1V1Q A;  3L9A X;  1AH9 A;  1XPU A;  1F2Z A;  4DA2 A;  2E2D C;  2EXZ A;  1PFN A;  4C3I G;  1K0R A;  4JW0 A;  2VS1 A;  1VQO A;  4G7H C;  5CV8 A;  1NUC A;  1M4V A;  4DN4 M;  4AYB G;  4DV4 L;  1YNN C;  1QB5 D;  2RQX A;  1CTM A;  1JIC A;  1EL0 A;  4PNY A;  3KJO A;  4UDU C;  4OWT B;  3G4S A;  4OIK A;  1U4P A;  3ER0 A;  1HJP A;  4R8I A;  1U5K A;  3W1G A;  5KIX A;  4MZ9 A;  4A76 A;  1PRT C;  4A3D B;  3A74 A;  4LUV A;  2A6H C;  1F9S A;  4M8A A;  4C1N K;  4JI7 Q;  3U58 A;  1F9P A;  1X55 A;  3MC0 B;  5HGQ A;  3CCE A;  4DV4 Q;  2EJF C;  3W5O A;  1STB A;  1T5X D;  3A8J E;  2NYZ D;  1I50 H;  1N33 L;  1P8L A;  4DV6 L;  3HKS A;  1RL2 A;  1R9T B;  3GQB A;  2JA7 B;  4DV2 Q;  3SK4 A;  2FIN B;  2ZXR A;  2QDB A;  1X54 A;  3DHQ A;  2ZXO A;  2FXQ A;  5JPM C;  2E2J H;  2UU9 L;  4A3E G;  4DAM A;  4IPD A;  4KHP L;  1HQR D;  4DNR B;  2YTV A;  4JV5 Q;  1UE1 A;  1VQ7 A;  4TQU S;  1VF5 C;  1MI2 A;  4JBW A;  2JE6 I;  2O5I C;  1LLR D;  4NW2 A;  1A6X A;  3A7A B;  2JK8 A;  3A56 A;  4JI7 L;  4S3S A;  1B7Y B;  4OEM B;  1LUZ A;  3PMF A;  4V0B A;  1G2T A;  5GQO A;  4KLK A;  4ZLT F;  2UXD L;  3GTK H;  1K8M A;  4X66 L;  3I70 A;  1R4P B;  1EY4 A;  3EVQ A;  1TWH H;  1CKN B;  1HFG A;  4IUQ A;  5I9P A;  5M3M B;  2PCF B;  1P16 A;  3X3N A;  4DR2 Q;  4KHP Q;  4C3H G;  2B39 A;  3CCL A;  1WTO A;  1GUT A;  1S4Z A;  2EIF A;  3S1Q H;  3CCR A;  1MSH A;  4C3H B;  4F8M A;  1ZYR C;  1VQN A;  3QO2 A;  1I4Q A;  2AUJ D;  2MNA A;  2XVS A;  1QNU A;  2WB1 G;  1ROD A;  1G6P A;  1IZ6 A;  1CZW A;  4LJZ C;  3MEF A;  1TWA H;  3MHB A;  1D8L A;  1WCM G;  2D0O A;  3OMG A;  4JI1 L;  4RGN A;  4B9X A;  4C3H H;  4RWS C;  1KLG D;  1A62 A;  3S1N H;  1FNV A;  3K7U C;  4BA1 I;  4ZKC B;  2L12 A;  1OXV A;  2VXW A;  1X3F A;  2F0E A;  4BA2 I;  2NN6 I;  1KDC A;  3HOY B;  5M3M H;  3S16 H;  5C3E G;  2RCF A;  4IFD J;  3WOF A;  1K0S A;  1EYD A;  4CKC A;  5C44 G;  4AIM A;  5IT9 E;  1WCM B;  1EWI A;  4LFB Q;  2CVR A;  1SE3 A;  4DAP A;  3KLW A;  4A3I H;  4Q0F A;  2AQ1 B;  4JI0 Q;  3NHH A;  1G91 A;  1HNX Q;  1B8A A;  3CRL C;  1LYL A;  2PZU A;  3S16 B;  4IJH A;  4K5W A;  3EN2 A;  3IFT A;  5GRO A;  2ZJQ A;  1CQV A;  3NEN A;  2E5L Q;  1OXT A;  4I7Z C;  1F77 A;  4TSS A;  3KDF A;  3GTP B;  3PUX A;  5FLX E;  4GOP B;  4CDF C;  3ND8 A;  3J7A F;  3AQQ A;  3M4Y A;  1EQT A;  4K5V A;  4FYD A;  1SNO A;  4DKA C;  1R9T H;  3TZU A;  2B2Y C;  1NMF A;  3GTG B;  4DV3 L;  3CCS A;  1PV4 A;  1FGU A;  2NUC A;  2F0G A;  4JI0 L;  1RHP A;  5BN3 A;  1PVO A;  5GAG C;  4X6A H;  4LMQ D;  1D5X C;  1L0W A;  4DR2 L;  3PO2 B;  5HY6 A;  4RG1 A;  3KLR A;  5C3E H;  2E2I H;  2HHH Q;  4ZRZ A;  2XWJ B;  4FF2 A;  2PO4 A;  1EY9 A;  1A3T A;  3P1H A;  4QGU A;  3C46 A;  1B3A A;  3UE0 A;  2D62 A;  3H94 A;  2EY6 A;  1OXS C;  2YTY A;  5M5X B;  3BJU A;  2B63 G;  2OQK A;  1S5D D;  3GTK B;  1PDQ A;  3H0G H;  3S1M H;  1O78 A;  4IUV A;  4LF9 L;  2B2W C;  1U0L A;  1SYC A;  2O5J C;  2OTL A;  1D1I A;  2C5C A;  5I6Y A;  1LM0 A;  4K0K Q;  2GVA A;  3T13 A;  4A4I A;  1STG A;  1KDB A;  5IGB A;  1IYU A;  5LHY 1;  4O42 A;  4YWL A;  1LTR D;  1PZK D;  2KUM A;  1EQQ A;  2QEX A;  1EUJ A;  1UE6 A;  2A6E D;  4GN5 A;  3I3C A;  1VQD A;  3NTI A;  2CW0 C;  1CSP A;  1SLJ A;  3D6W A;  2Q2U A;  3DEO A;  3AB9 A;  4LF5 L;  2PQA B;  2Y0S B;  4HED A;  3DMU A;  3C3L A;  1UWV A;  1XWE A;  2KJX A;  4NB3 A;  4GKJ L;  3TZD A;  4OL7 A;  4QUC A;  4HIM A;  3A0J A;  2A69 C;  1VQK A;  4H13 C;  1Q12 A;  3GV3 A;  4TVA B;  4HSP A;  1I4G A;  1YHA A;  1JMC A;  3VA7 A;  3W1B A;  1UEB A;  4IPG A;  2V4D A;  4XQN A;  4HIO A;  1TWA B;  1C7Y A;  4DR3 Q;  4UP7 A;  3K0X A;  2F03 A;  4A3L H;  5KYI A;  4Y7N B;  2EE1 A;  1PH2 A;  3IAY A;  2F0H A;  4HMJ A;  1V43 A;  5EKL A;  3VR2 A;  5E4X A;  1UUP A;  4P73 A;  3FKI H;  5JEA G;  5IYD G;  1I4R A;  4HR7 B;  5DEH A;  4GNX B;  1ZKO A;  1EZ6 A;  1MBY A;  2A6H D;  3I4M G;  3GTJ H;  3CME A;  1TWG H;  2TMP A;  3PF5 A;  2HIV A;  1YBY A;  2KVM A;  4E6I A;  2K1B A;  1V8Q A;  3V05 A;  3MVV A;  2R6G A;  4LAA A;  1FNW A;  2FHT A;  4A3G G;  4JOI A;  4HJ5 A;  3R2T A;  2H4O A;  2XN9 C;  4B08 A;  1S40 A;  3SXH A;  1H9R A;  1TWG B;  2KCN A;  3GTL H;  1SND A;  3A54 A;  4LWC A;  2HDL A;  4H02 A;  1M90 C;  2ES2 A;  2Z6K A;  5EPL A;  1SR3 A;  3HEJ A;  4O2D A;  3Q0A A;  1TWF B;  1N36 Q;  2E2J B;  1I94 Q;  2B63 B;  4LF5 Q;  4KTA A;  1X9N A;  4HJ7 A;  4A3F G;  1LT6 D;  1XNQ L;  3BVZ A;  4JK1 C;  1Q82 C;  1TQO A;  4DK1 A;  2MP1 A;  2EYF A;  4K14 A;  4JI8 Q;  4JI1 Q;  2I0Q A;  4NXN L;  4JI6 Q;  1SRO A;  4C2M B;  1BDO A;  1DOM A;  1IW7 C;  4C56 C;  1FJG Q;  4QMG A;  1OXU A;  3CP0 A;  3NEM A;  1PTO C;  2VB3 X;  1TWH B;  3IRB A;  2E2I B;  3OIP A;  1J6Q A;  5NUC A;  4DF7 A;  1SE2 A;  3CAM A;  2WAQ G;  5K36 H;  4A3G H;  4IFD G;  4R4T A;  4FO2 A;  3TP8 A;  4LFC L;  4NP5 A;  1DZ1 A;  1HNX L;  3HOU H;  1ML0 D;  2PW7 A;  3R93 A;  3F8T A;  4A93 G;  1YIT A;  1T9H A;  2PMZ E;  5JJL A;  1CFM A;  3UDI A;  4DAY A;  5IYB H;  4JVZ A;  2NVX B;  2NTT A;  3D0F A;  3K5M A;  4GLA C;  1ZYR D;  1RF2 D;  4H7B A;  3DUZ A;  3HOU B;  3ZJY C;  1QZG A;  3DWP A;  2CH4 A;  3KF6 A;  5J39 A;  4IFD H;  3DXJ C;  4AQY L;  4NKL A;  2RKS A;  1IBM Q;  5JEA H;  5IYD H;  1NR2 A;  4YWM A;  1U4M A;  3S1Q B;  3H0G B;  2I5M X;  2EYJ A;  4DR1 L;  4Y7N H;  3E0E A;  3TEH B;  1MJC A;  2D9U A;  2IL8 A;  3KOJ A;  3CCQ A;  3QB3 A;  4P71 A;  3T51 B;  1JWM D;  2B2T A;  3JAM c;  5CV5 A;  1JE4 A;  4FF4 A;  1EOT A;  4CHT B;  4IJL A;  3S14 B;  3OTO Q;  4DR3 L;  1PXU A;  2KEC A;  1PHJ A;  2VNU D;  1TR5 A;  3RUZ A;  1BCP F;  3OIQ A;  2L1B A;  3ONA B;  2R92 G;  2UXC L;  5FO8 B;  4WRD A;  1XPO A;  1JC7 A;  3LX0 A;  1ZEQ X;  4PZ6 A;  2XIW A;  3H3V C;  1XYI A;  3Q22 A;  4X3S A;  4LF4 L;  4RGO S;  4YCV A;  3LWU A;  3U9O A;  3VR6 A;  4B3S Q;  1L1O A;  2J7Z A;  2HQL A;  3CW2 C;  5FO7 B;  1O7Y A;  4R4C A;  1DON A;  3HKZ E;  1NE3 A;  2A6E C;  2M9V A;  5IGD A;  2OEO A;  5IP7 H;  2P5Z X;  2ALY B;  1VQ6 A;  4IFD I;  4JPB W;  1KLU D;  2Q2H A;  1G51 A;  5I9O A;  1ASZ A;  2EYL A;  3FPP A;  1S5F D;  1LAC A;  5FLX L;  1BCP C;  3HOV G;  1LTT D;  4A3L G;  1VMP A;  3R3O A;  1BOS A;  3QIA A;  3T1Y Q;  1XPR A;  1E7Z A;  3E6Z X;  2RBM A;  5IP9 H;  3RZO B;  4K5X A;  2KA7 A;  3DWQ A;  1HZC A;  3D4W A;  4POF A;  5JPN C;  4KV6 A;  1SE8 A;  1Q81 C;  3OSO A;  1UNS A;  2Z1C A;  2ZXP A;  4DR7 L;  2KEE A;  2UUC Q;  1B9N A;  2AQ2 B;  2JA5 G;  1HFN A;  3RZD H;  2X6G A;  1QUQ A;  2K4K A;  3D3R A;  4UP9 A;  1HXY D;  5T1I A;  4YHH Q;  1C0A A;  3T1Y L;  4HCS A;  4ILW A;  3TP6 A;  3NE5 B;  2NBF A;  2PYK A;  3MXN A;  2G9D A;  3GTL B;  1Q8K A;  1KRS A;  4G7O C;  4PMW A;  3I73 A;  3BU2 A;  5F2D A;  1E2Z A;  5FLM G;  1SN8 A;  4DXF A;  4OO1 H;  1N9W A;  4Q5V A;  4FXG C;  4DUZ Q;  1TWF H;  3VA5 A;  3PO3 G;  2E75 C;  3CC4 A;  1WCM H;  3EJI A;  1I94 L;  3PF4 A;  1WFQ A;  4DR5 Q;  1N34 L;  5M3F G;  5FLX c;  1EZ8 A;  4JOI C;  3DM3 A;  1B1Z A;  2KOL A;  3HOW B; 
#chains in the Genus database with same CATH homology
 1B7Y B;  1LUZ A;  3STB D;  3M4P A;  1PFS A;  2RHQ B;  5IWA Q;  4BY7 H;  3L7Z C;  1PH5 A;  2JA9 A;  5GQO A;  4KLK A;  3K81 C;  4BY1 H;  5EAY A;  3GTK H;  2UXD L;  4XTC S;  4X66 L;  1B70 B;  4IPH A;  5C44 H;  1L1O C;  1CKN B;  1TWH H;  4NPS A;  4YCW A;  4X65 Q;  2K52 A;  3J81 i;  3PV0 A;  2CQO A;  2GVB A;  1P16 A;  4DR2 Q;  4DV7 Q;  3J81 j;  1TWC H;  4KHP Q;  4A75 A;  3I4N G;  1NJI C;  3I2Z A;  2K75 A;  1Z47 A;  2VW9 A;  1XMO L;  3CCL A;  1VQC A;  3G48 A;  2L15 A;  2EIF A;  3S1Q H;  3CCR A;  1WOC A;  1A0I A;  3STB C;  4DAY B;  2UUB L;  4OX9 Q;  3PO2 H;  4A3M G;  1VQ5 A;  1VQN A;  3M9B A;  2ZJR A;  1YJN A;  2MNA A;  5LMU L;  1UE5 A;  4HJA A;  2WB1 G;  1JE5 A;  3S2D H;  1G6P A;  3A5U A;  2Q2T A;  1QVF A;  1WJJ A;  1IZ6 A;  2BA1 A;  4DR4 L;  3MEF A;  1E1O A;  4FDB A;  1PH6 A;  1TWA H;  1D8L A;  1WCM G;  2D0O A;  3CPW A;  1IBL Q;  5BR8 L;  2ZM6 Q;  2IHF A;  3OYY A;  3ULJ A;  4MNO A;  4APV A;  4POG A;  4JI1 L;  2HT1 A;  1GO3 E;  4BBS H;  5LMU Q;  4C3H H;  4YHH L;  2UUA L;  2B63 H;  1A62 A;  3S1N H;  4DR6 L;  1Q7Y C;  2OQ0 A;  3K7U C;  4BA1 I;  3JAM i;  5ELO A;  3NBH B;  3HOV H;  1XTD A;  1OXV A;  1X3F A;  2UXB Q;  3CQZ H;  2BH8 A;  2NN6 I;  4JI2 L;  4BA2 I;  2NZO A;  5M3M H;  2UXD Q;  1RIP A;  3RR5 A;  4EQ5 A;  4LFB L;  2R7D A;  3S16 H;  5C3E G;  2MQH A;  4IFD J;  2F3I A;  4L5T A;  3PIO A;  2VQF L;  2UXC Q;  3RNU A;  3PO2 G;  1SFO H;  5C44 G;  4DV5 Q;  1I6H H;  4AIM A;  1VQ4 A;  5DLQ E;  1QVG A;  1EWI A;  4LFB Q;  2HIX A;  3HFZ B;  3ULL A;  4JI2 Q;  3KLW A;  4X62 Q;  4A3I H;  4BBS G;  4JI0 Q;  1HNX Q;  1B8A A;  5FJ8 H;  1LYL A;  1X3E A;  4LUZ A;  4HJ8 A;  4IJH A;  4JBM A;  1E3P A;  2RHS B;  3EN2 A;  1HR0 L;  3HOY H;  3S17 H;  5GRO A;  3I56 A;  2H5X A;  2ZJQ A;  3NEN A;  2E5L Q;  1OXT A;  2IX0 A;  4A3M H;  3KDF A;  1W3S A;  4HIK A;  1E1T A;  3PUX A;  1K83 H;  4GOP B;  2K5N A;  1OTC A;  4LF8 L;  2JA6 H;  4JV5 L;  4GLX A;  2WP8 J;  3F2C A;  3AQQ A;  3EIV A;  4JBJ A;  2EQS A;  1VQL A;  4R1J A;  4JI8 L;  5IT9 c;  2E5L L;  1BBW A;  4DKA C;  2NVQ H;  3I4N H;  1IXR A;  5LMN Q;  1R9T H;  5M5X H;  1JJG A;  3RLO A;  1NMF A;  2E8G A;  3EBE A;  3KJP A;  3CCS A;  3TRE A;  5M3F H;  4DV1 L;  4DV3 L;  3FHW A;  2QA4 A;  4HID A;  1FGU A;  1PV4 A;  1VQ8 A;  1XNQ Q;  3JC6 6;  1L2F A;  2Y0S E;  4JI0 L;  4C2M H;  4DR7 Q;  1J5E L;  2N8N A;  1N32 L;  3U4Z A;  1PVO A;  5GAG C;  1FL0 A;  2JA7 G;  2RF4 A;  1IYJ B;  2JA7 H;  4LW1 A;  3J81 c;  3VDY A;  4X6A H;  4JBK A;  4JCV E;  4B3T Q;  1I5F A;  1L0W A;  4JG2 A;  4DV7 L;  4DR2 L;  5ELN A;  1KQS A;  1JB7 A;  5HY6 A;  4RG1 A;  2R7Z G;  1EIF A;  3AFQ A;  5C3E H;  3SGI A;  1FVI A;  5E7N A;  2E2I H;  2Y0S G;  2HHH Q;  3GTP H;  1H95 A;  4DV5 L;  4AYB E;  1AE2 A;  3T1H L;  2ID0 A;  1VS0 A;  3CCM A;  2CFM A;  4QGU A;  1WI5 A;  2GN5 A;  3GTG H;  4KHZ A;  3UE0 A;  2D62 A;  1HNW L;  3CC2 A;  1OXS C;  2YTY A;  3BJU A;  2B63 G;  2OQK A;  1K8G A;  3H15 A;  1PH8 A;  4GN4 B;  1KAW A;  2KEN A;  1VQF A;  1CUK A;  1NTG A;  3H0G H;  1QZH A;  3S1M H;  4A3C G;  2LXK A;  4LF9 L;  1VQA A;  1HZA A;  4DUY Q;  3UDG A;  2F4V Q;  3DLL A;  1U0L A;  2ZM6 L;  1TXY A;  1V9P A;  1IBL L;  2OTL A;  5FLM H;  4LF6 Q;  1E24 A;  1VQI A;  4KI0 A;  1VQM A;  5C0X G;  3J80 i;  1LM0 A;  4K0K Q;  2GVA A;  4GNX C;  3G6E A;  4A4I A;  4JI3 Q;  3HOW H;  2QGQ A;  4P72 A;  3GDE A;  1VQH A;  2N49 A;  4C3I H;  3S15 H;  3M4O H;  4OON A;  2NVX H;  2YYZ A;  4DV2 L;  3KYH C;  4JC0 A;  1YHB A;  4YWL A;  3PO3 H;  1GKH A;  4A3J G;  1EQQ A;  2QEX A;  1AE3 A;  4JI3 L;  5H1S E;  1EUJ A;  3I4M H;  3G71 A;  1UE6 A;  4GN5 A;  2ZJP A;  1PH3 A;  1KL9 A;  1VQD A;  2B3G A;  3U4V A;  2BA0 A;  1HNZ L;  4PZ7 A;  1CSP A;  1SLJ A;  2Q2U A;  2VUM G;  5K36 G;  2R93 H;  4LF5 L;  4QIW E;  5LMN W;  2PQA B;  4IOC A;  3RN2 A;  3TQY A;  1EQR A;  1UWV A;  3L0O A;  2IHE A;  4UPA A;  4NB3 A;  1A8V A;  3PUY A;  2KHJ A;  3HOU G;  4A3D G;  4GKJ L;  1Y1V H;  5IYC H;  3GTQ H;  4BY7 G;  2IY5 B;  1X6O A;  2NN6 G;  4HIM A;  2R92 H;  3A0J A;  3ICE A;  1VQK A;  5IYB G;  4GKK Q;  1Q12 A;  4TVA B;  4GOP A;  1XMQ Q;  1YHA A;  1JMC A;  2A8V A;  2CKZ B;  3RLN A;  3W1B A;  1UEB A;  1X3G A;  2YV5 A;  1I3Q H;  4IPG A;  3I55 A;  4HIO A;  1XNR Q;  1Q46 A;  1C7Y A;  5AJ3 L;  4DR3 Q;  4UP7 A;  2JA8 G;  3K0X A;  1S3O A;  3H3V I;  5M5Y H;  3J7A 5;  1KHI A;  3M7N A;  4A3L H;  5C4X G;  1M1K C;  4PZ8 A;  3WWV A;  1PH2 A;  1N34 Q;  4A3K G;  1Y1V G;  1WYD A;  2KCT A;  4OO1 G;  1V43 A;  4PG3 A;  4DV3 Q;  4LF7 Q;  4B3M Q;  5IP9 G;  1Y14 B;  3M4Q A;  1HR0 W;  4P73 A;  2ZTE A;  3S24 A;  1HR0 Q;  3FKI H;  5JEA G;  5IYD G;  1VQ9 A;  1K3R A;  2CCZ A;  4DV6 Q;  4GNX B;  4A93 H;  1Q1B A;  1GVP A;  4BBR H;  1CSQ A;  1PH4 A;  1KD1 C;  1XMO Q;  1EOV A;  1IBM L;  3TS0 A;  4IPC A;  3I4M G;  3GTJ H;  3CME A;  1TWG H;  3PF5 A;  2HIV A;  1XNR L;  3MXN B;  4JI5 Q;  1YBY A;  3KF6 B;  4MTN A;  4DUY L;  4LF9 Q;  2F4V L;  3PUV A;  3M3Y H;  4OO1 I;  4LF6 L;  2R6G A;  1Y1W G;  1PYB A;  4A3G G;  3BZK A;  2JA8 H;  3Q8D A;  4JOI A;  4YY3 Q;  4HJ5 A;  1JJ2 A;  4LF4 Q;  1K9M C;  4B3R Q;  4X65 L;  2JQO A;  1S40 A;  3H3V H;  4JI4 Q;  5M5W H;  3HOX H;  1ASY A;  1YHQ A;  2PNH A;  2R7F A;  4GNX A;  4IO9 A;  4A3E H;  1EYG A;  1DGS A;  3S2H H;  3CCV A;  3GTL H;  2K50 A;  5IWA L;  3F2D A;  4OWW B;  4L5S A;  1Z9F A;  3TS2 A;  1KC8 C;  4LWC A;  4B3R L;  4H02 A;  1M90 C;  2E2H H;  2ES2 A;  4GN3 B;  2Z6K A;  2F52 A;  5GAE C;  1Q86 C;  1SR3 A;  1VQG A;  1L1O B;  1Q1E A;  2HHH L;  3B6Y A;  4R4I A;  4O2D A;  3CMA A;  1YJ9 A;  4A3B H;  1N36 Q;  3GO5 A;  4YWK A;  3HOZ G;  3GD7 A;  1I94 Q;  2UU9 Q;  4LF5 Q;  1PH7 A;  2NVY H;  4LFC Q;  1X9N A;  4HJ7 A;  4LFA Q;  4A3F G;  1C9O A;  1CKM A;  2IT1 A;  1FJG L;  2VUM H;  2JJQ A;  3S14 H;  1XNQ L;  1UE7 A;  2N3S A;  5J3B A;  1KRT A;  4DV1 Q;  2OCE A;  4A3F H;  5C4J H;  1Q82 C;  2WAQ E;  1YVC A;  4QJF A;  2ZTC A;  2IX1 A;  4DR6 Q;  4DNI A;  4GLV B;  4GS3 A;  4DUZ L;  2K5H A;  2UUB Q;  1OXX K;  4JI8 Q;  2MO0 A;  4JI1 Q;  4NXN L;  5GAD C;  3OW2 A;  1SRO A;  2I0Q A;  4JI6 Q;  4LF7 L;  1FJG Q;  2NZH A;  4DR1 Q;  2WFW A;  3A5Z B;  5C0X I;  1OXU A;  1VCI A;  2AWN A;  3CP0 A;  2PI2 A;  3NEM A;  4DK3 C;  3CCJ A;  4K0K L;  3IRB A;  3CF5 A;  3K7A H;  4B3S L;  4BXX H;  1J6Q A;  3CAM A;  4AQY Q;  2PQA A;  1BKB A;  3E9H A;  1VQB A;  3HKZ G;  2WAQ G;  3CD6 A;  1VQE A;  2AWO A;  4IFD G;  4A3G H;  4O0A A;  5C4X H;  3F2B A;  4R4T A;  1BBU A;  1XMQ L;  1W2B A;  3HOZ H;  3UDF A;  4X62 L;  1GM5 A;  2RCN A;  3GTM H;  4LFC L;  4JI4 L;  2K5V A;  4DV0 Q;  1HNX L;  3HOU H;  5JEA J;  4A3D H;  3J80 c;  4QL5 A;  4R4O A;  4X64 L;  3F8T A;  4ME3 A;  1EIY B;  2ZTD A;  4NXM L;  4YCU A;  4QQB X;  4A93 G;  2EXD A;  1MKH A;  1T9H A;  5IP7 G;  2PMZ E;  1YIT A;  5JJL A;  3UDI A;  3FKI G;  1QVC A;  5IYB H;  3E9I A;  1BVS A;  3D31 A;  2CWP A;  3AFP A;  2K14 A;  3HOW G;  4DV0 L;  1D7Q A;  2JEB I;  2N78 A;  4JI5 L;  3KFU A;  2VQF Q;  3D0F A;  1N32 Q;  4GLA C;  4A3I G;  1PH1 A;  4DR5 L;  1J5E Q;  4OWX B;  1YJW A;  3CC7 A;  2LSS A;  1HZ9 A;  3ZJY C;  1QZG A;  1K8A C;  2B29 A;  3I4O A;  1HZB A;  2AKW B;  3KF6 A;  3H0G G;  1PH9 A;  1IBK L;  4DPG A;  1SMX A;  1CKN A;  1XJV A;  1K73 C;  4AQY L;  2KBN A;  2A1A A;  5M3M G;  4ALP A;  1IBM Q;  1MJE A;  5BR8 Q;  5IYD H;  2C35 B;  2I5L X;  4YWM A;  5GAH C;  2I5M X;  4DR1 L;  4Y7N H;  3J7Z C;  4DR4 Q;  1YZ6 A;  3BZC A;  1MJC A;  3E0E A;  3TEH B;  5JJI A;  1YIJ A;  2VZA A;  3KOJ A;  3CCQ A;  1VQP A;  3FP9 A;  4A3B G;  2KHI A;  1NMG A;  4B3M L;  4IOA A;  3AYH B;  3CPF A;  1PA6 A;  3UE1 A;  4P71 A;  2VY3 A;  3JAM c;  4GKK L;  3HOY G;  5IE8 A;  2R93 G;  1LTL A;  2VL6 A;  3K80 C;  5C0X J;  1HNW Q;  3NEL A;  4IJL A;  3S1R H;  3OTO Q;  5AJ3 Q;  4DR3 L;  3LGJ A;  1Y1W H;  1EFW A;  1PHJ A;  2YU9 H;  2Z0S A;  1YNX A;  3T1H Q;  2R7Z H;  2MFI A;  2VNU D;  5IYC G;  1GD7 A;  3PSI A;  1SRU A;  4HJ9 A;  4NXM Q;  2R92 G;  4OXP A;  2UXC L;  2LXJ A;  3OTO L;  1KIX A;  4C3J H;  4XIG S;  1HNZ Q;  2JA6 G;  4WJ4 A;  4P74 A;  3KDF B;  4X66 Q;  1XPO A;  2DGY A;  4PZ6 A;  2VQE Q;  1A63 A;  2OTJ A;  1MIU A;  2Q2I A;  1G29 1;  5LMN L;  4BXX G;  3PIP A;  2BH2 A;  4YY3 L;  4LF4 L;  3CXC A;  4YCV A;  5FJ8 G;  4A3C H;  3L2P A;  4B3S Q;  3ERS X;  4LF8 Q;  1L1O A;  4BY1 G;  2HQL A;  3CW2 C;  3ULP A;  4R4C A;  1V1Q A;  1AH9 A;  1XPU A;  3HKZ E;  1NE3 A;  3GTO H;  4QY7 A;  4BBR G;  4GOP C;  4L5R C;  5IP7 H;  4Y52 H;  2ALY B;  2AHO B;  1VQ6 A;  4IFD I;  3KF8 B;  1KXL A;  4OX9 L;  2VQE L;  2Q2H A;  4J15 A;  1E22 A;  1G51 A;  1QUQ B;  1X65 A;  1ASZ A;  1K0R A;  2XTI A;  4P75 A;  4UP8 A;  2VS1 A;  1HH2 P;  1VQO A;  3HOV G;  4A3L G;  2NVT H;  4AYB G;  1XPR A;  4LUO A;  2DUD A;  4DV4 L;  3T1Y Q;  1E7Z A;  4X64 Q;  1N36 L;  4JYA L;  4AH6 A;  3AEV A;  3KJO A;  4UY8 C;  1YI2 A;  5IP9 H;  1O7I A;  1YEZ A;  3HOX G;  2CWA A;  4OWT B;  2WB1 E;  2XGT A;  3G4S A;  4WJ3 M;  2UXB L;  1HZC A;  4POF A;  3ER0 A;  1SE8 A;  1HJP A;  3U50 C;  1U5K A;  1Q81 C;  1N8R C;  3W1G A;  3CCU A;  4DR7 L;  2A19 A;  4GKJ Q;  4L5Q A;  4MZ9 A;  4A76 A;  1VQJ A;  2UUC Q;  2JEA I;  3F1Z A;  5JJK A;  2AMC B;  3A74 A;  4LUV A;  2JA5 G;  4A3J H;  2JA5 H;  1JT8 A;  4LNQ A;  3RLF A;  3UDX A;  2MO1 A;  4RMF A;  3RN5 A;  3RZD H;  3RZO H;  1QUQ A;  2K4K A;  4UP9 A;  4JI7 Q;  2UUA Q;  2ASB A;  3U58 A;  4YHH Q;  4B3T L;  1C0A A;  1X55 A;  2I5H A;  3PCO B;  5HGQ A;  3CCE A;  4DV4 Q;  3T1Y L;  3W5O A;  4JYA Q;  2OWO A;  2ATW A;  3TRZ A;  1I50 H;  1N33 L;  1Q8K A;  1KRS A;  1P8L A;  5IY0 A;  3HKS A;  1RL2 A;  4DV6 L;  3PUW A;  4R4Q A;  4PMW A;  3BU2 A;  4EX5 A;  4JI6 L;  4NXN Q;  5FLM G;  1SN8 A;  4A3K H;  1N9W A;  1CKO A;  3PGZ A;  2KCM A;  4DUZ Q;  1IBK Q;  1TWF H;  3PO3 G;  4DV2 Q;  3I7F A;  3CC4 A;  2PI2 E;  2Z6K C;  1N33 Q;  1WCM H;  1X54 A;  1PYS B;  2V1C C;  1X56 A;  2FXQ A;  1I94 L;  1NBW A;  4A3E G;  2E2J H;  4DAM A;  1JJC B;  4IPD A;  1WFQ A;  2UU9 L;  4DR5 Q;  3PF4 A;  1N34 L;  4KHP L;  2YTV A;  4JV5 Q;  1S72 A;  4LFA L;  1UE1 A;  5M3F G;  5FLX c;  4TQU S;  1VQ7 A;  3PUZ A;  4JBW A;  2JE6 I;  4JOI C;  3DM3 A;  4DK6 C;  2D0P A;  1IL2 A;  1NY4 A;  2JK8 A;  4JI7 L;  2YTX A;  3K8A A;  2UUC L;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...