2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
molecule tags Transcription,transferase/dna-rna hybrid
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
3JAMi 3PF4A 3W1GA 5LMUQ 1FVIA 2ID0A 3PCOB 1ASYA 2OQKA 3I7FA 4YHHQ 2CFMA 4HIKA 1FJGL 1NE3A 3J80i 2XTIA 3PUXA 1CSPA 1VQ5A 1XPUA 1WCMG 3H0GH 2QEXA 3S1RH 4DR7L 2NVQH 3KYHC 3RLFA 3U50C 4R4IA 5LMNW 4A3FG 2CKZB 4PZ6A 1E7ZA 4POFA 4X65Q 2PQAA 4DUZQ 1KIXA 2R93G 2ZJQA 3CMAA 1PVOA 3STBD 4GOPC 4B3TL 3ULJA 2VL6A 4LF8Q 1VQIA 3S1QH 5EAYA 3M4QA 4DV4Q 1PH8A 4KI0A 3VDYA 3Q8DA 4A3MH 3CCRA 4DUYQ 3I4MG 5ELNA 2WP8J 3L7ZC 2Y0SE 2R92G 4JBKA 3OTOQ 4JG2A 4IOAA 1L1OA 4AYBG 1GVPA 4L5SA 2KBNA 3T1HQ 5FLMG 1JJGA 2BA0A 4R4CA 5IP7H 4RMFA 1EYGA 3TQYA 4L5RC 4AYBE 4B3MQ 2I5HA 4XIGS 4DR2Q 4BXXG 2R93H 3MEFA 3OYYA 2GN5A 4JC0A 3CMEA 2NN6G 5IYBH 2JA8G 5BR8L 3GTKH 2ZTEA 1GD7A 2PI2E 4OWXB 1N34Q 5JJKA 5IP9G 4A93G 3PGZA 1LM0A 3A5ZB 3KJPA 4MTNA 3HOYG 2C35B 4DV7Q 3B6YA 5C4JH 4A3GG 2Y0SG 3KF8B 1PH3A 1WI5A 1FL0A 2YV5A 3GTGH 3ICEA 3AQQA 1X3GA 4JI5L 2OCEA 3U4VA 4LFCL 4C3JH 1JT8A 2A1AA 1QUQB 4UP9A 5HGQA 1PFSA 2CWAA 4GLXA 3KJOA 1FJGQ 4KHPL 1S3OA 1J5EQ 1L1OB 4NB3A 2JA7G 2B63G 3J81i 4X62L 2E2IH 1OXVA 4GLAC 5C44H 1MJEA 2B29A 2MO0A 3EN2A 4DUZL 1PH4A 4BA2I 4JI4L 2WAQG 3KF6B 4IOCA 2VQFQ 1XNRQ 1AH9A 3HOZG 4LF8L 2BA1A 1LTLA 4DV4L 2H5XA 4GS3A 2ZM6Q 2PQAB 1YHQA 1XNQQ 2K5NA 4IFDI 3GTQH 4GOPA 4DUYL 2ES2A 4GN3B 4A3DG 2F3IA 4IPGA 5AJ3Q 4RG1A 4LF4Q 1PH6A 1X3FA 2JEAI 3GD7A 4NPSA 2ZTCA 4WJ4A 1V9PA 2UXCQ 4R4QA 4B3SL 5IYCH 1X54A 3NELA 4C3IH 1UE7A 1N9WA 3K81C 4OO1I 2UXDL 4UP7A 4LF6L 3RN2A 4K0KQ 4A3JH 1YJ9A 1OTCA 5C0XI 3CCLA 1K73C 1N32L 2CQOA 5BR8Q 3ULPA 2E8GA 3S16H 2CWPA 1YHBA 4DNIA 3G4SA 3PSIA 4C2MH 1I5FA 3T1YQ 1P8LA 2NN6I 1OXUA 2E2JH 1GM5A 4DR6L 1AE3A 4A3EH 1VQCA 3NEMA 2NVTH 4A3LG 1YNXA 4JI1L 4GKJL 3CPFA 4JYAL 4JI5Q 1QUQA 1SMXA 4P71A 3CW2C 3PUVA 4BBSG 4JI3Q 4A3JG 2EXDA 1XTDA 2JA7H 3FKIG 2YTXA 1BVSA 1EWIA 1Q1EA 4R4OA 3UE0A 3I4NH 1JJ2A 1QVFA 1TXYA 2WB1G 3WWVA 1Q12A 2Z6KA 4AIMA 1YITA 2UUAQ 4PMWA 3RN5A 1EQQA 1Q1BA 2VQEL 1VQFA 5C44G 2F4VL 4GLVB 2L15A 3U58A 1EQRA 3J7A5 4HJ7A 4LF5L 4KLKA 4GNXB 1SROA 2UUBL 3TS2A 1X6OA 4JI2Q 2ZM6L 1NJIC 1VQ9A 2R7ZH 5C3EH 3KF6A 1HNXL 3ZJYC 4DK3C 1KHIA 2NZHA 4DR1L 3F2BA 1PHJA 5AJ3L 4JI6Q 4A3KG 4LF4L 4OXPA 4JI0Q 3S2HH 1SFOH 2Q2HA 1A62A 4IPHA 4OX9Q 4HIDA 4LF9L 4JV5Q 2UXDQ 4K0KL 4JBJA 2Q2UA 4NXMQ 3PV0A 3FP9A 1VS0A 5LMNL 3BU2A 2N3SA 1VQHA 5K36G 3CPWA 2GVAA 4O0AA 3TRZA 3RLNA 4BY1H 1VQLA 2HQLA 4JI1Q 2JE6I 1QVCA 3RLOA 1M90C 4A3IG 4JYAQ 4WJ3M 2VW9A 4X66Q 3HOVG 4A93H 2HT1A 1SRUA 4BBSH 3CCQA 3CCVA 1VQ7A 4DR4L 1FGUA 4JI3L 2N8NA 3PUZA 5GROA 4TQUS 5FJ8G 1B7YB 1I94L 4GKKL 2B3GA 1HZCA 4KHZA 3W5OA 3G6EA 2YYZA 2LXKA 2PMZE 2K52A 4QQBX 2OTJA 2UUAL 5GQOA 3K8AA 3K80C 4YCWA 4BY1G 1BKBA 3HKZG 4Y7NH 2VQEQ 1R9TH 1WOCA 4NXNQ 1OXSC 2LSSA 1PH9A 2ATWA 2F4VQ 1W3SA 4HJ5A 2DGYA 3HOXH 1EIFA 4YCVA 3E9HA 1VQ4A 2B63H 3NBHB 1TWFH 5IT9c 4DR3L 1PH1A 1RL2A 2R7ZG 2UUBQ 2OTLA 3IRBA 1UWVA 4Y52H 1VQOA 5JEAG 2I0QA 2AHOB 4DV1L 1K0RA 4P73A 3I4OA 2BH8A 5LMUL 4DV2Q 3H3VH 4OO1G 5GAHC 4DV0Q 2BH2A 3EBEA 1HNWQ 3K0XA 4BY7G 1IBLQ 2AWOA 2RCNA 3CCSA 1IYJB 4GN4B 1ASZA 4A3DH 1UE6A 1C0AA 1KXLA 3AFPA 4LWCA 3CF5A 3M85A 4DR7Q 2MQHA 4A4IA 1YBYA 3G48A 5M5WH 4X64L 3UDGA 2ZJRA 3UDFA 1JMCA 2JJQA 1G6PA 2Z6KC 4X65L 4J15A 1HNZQ 3TEHB 2HHHQ 3H3VI 3S15H 1CSQA 3HOWH 4LNQA 4AQYQ 3HKSA 1AE2A 1HZ9A 2K50A 4C3HH 5M3MH 1N33L 5M3FG 3D31A 3M4PA 4AH6A 5IWAQ 4HIMA 5C4XH 5FJ8H 4A3EG 4DR4Q 1G51A 2I5LX 1X55A 2Z0SA 1KL9A 1CKNB 1K8GA 4JI7L 4QL5A 4BA1I 1IZ6A 2VS1A 1TWCH 1NY4A 1YJWA 3ULLA 3M3YH 4B3ML 4YY3L 3BZCA 1B8AA 4FDBA 3OW2A 2QA4A 1Q81C 1PH7A 4B3RQ 1XPRA 1SE8A 4YCUA 4L5QA 4LUVA 2KCMA 2YTVA 4DV5L 4HJ8A 4GNXC 1D8LA 1L1OC 2WB1E 2RF4A 4DV3L 4GOPB 4DV6Q 1IBKQ 2AWNA 4LFBL 4DV7L 1N36L 1YVCA 2IX0A 1K3RA 1YZ6A 3F1ZA 3CCUA 1JE5A 4A3BH 1A8VA 5ELOA 5JEAJ 5J3BA 1X3EA 4MZ9A 1VQGA 3G71A 2E5LL 4LFAQ 4LFCQ 4LUZA 2UUCQ 3S17H 1H95A 4DV0L 1HNWL 3PIOA 1IBLL 5FLXc 4IO9A 3I4MH 2YTYA 3PUYA 1A0IA 3ERSX 1J5EL 1Y1VH 2JA9A 3PIPA 1VQEA 1KRSA 2JQOA 4L5TA 4EX5A 1E1OA 1PYBA 2N49A 4YHHL 1O7IA 4GNXA 3JC66 1XMOQ 4PG3A 3A74A 3HOUH 1VQ8A 4JI4Q 1HNZL 2YU9H 2HIVA 1OXTA 1XNRL 3GTOH 1WCMH 3H0GG 3FHWA 1E1TA 1CUKA 1MKHA 3M7NA 1QVGA 3F8TA 5IY0A 1HH2P 1YHAA 1N33Q 1PH5A 2K5VA 4YWLA 4JOIC 1E3PA 1U0LA 2K4KA 3UDIA 4O2DA 4BBRH 1KD1C 4A3GH 3J81j 1WFQA 1IL2A 1KC8C 1NBWA 1CKMA 2A8VA 2VUMH 4JI7Q 2N78A 3CXCA 5IYDG 3I55A 3HOUG 4MNOA 4LF6Q 1HZAA 1J6QA 4YY3Q 3E9IA 4A3MG 3DLLA 1YJNA 1W2BA 1Q82C 3AEVA 3GTPH 1VQAA 1XMQL 1EIYB 2NVXH 2K5HA 2JK8A 4DV5Q 1K9MC 2RHSB 3HFZB 1VQKA 4X6AH 3T1YL 4XTCS 3T1HL 2KENA 4DV3Q 4LFBQ 1A63A 4IJHA 4ME3A 3BZKA 1N36Q 1VQNA 1L0WA 2D0OA 3GO5A 1K83H 1IXRA 4DR2L 2FXQA 3F2DA 2IT1A 3H15A 2K14A 4GKJQ 1MIUA 3K7AH 1JB7A 2ZJPA 1HZBA 2KHJA 4OONA 3PO3G 5M5YH 1T9HA 2PNHA 2Q2TA 2ASBA 3HOYH 3RZDH 4EQ5A 5IP9H 3M9BA 4POGA 1NMFA 2WFWA 3STBC 2JA5H 5C0XJ 3S14H 4UPAA 3CC4A 1DGSA 2VNUD 3RR5A 2VZAA 1Q46A 2MFIA 3KLWA 3MXNB 1PA6A 2IY5B 2Q2IA 2VY3A 1EUJA 4JBWA 5IYCG 1VCIA 3A5UA 2K75A 1XMOL 1HR0W 4KHPQ 1L2FA 1HR0L 3J80c 4LUOA 2JEBI 4LF5Q 1C7YA 1VQ6A 1BBWA 2IHEA 2XGTA 5HY6A 3GTLH 4JI2L 1C9OA 1OXXK 4X62Q 1KQSA 3SGIA 1HNXQ 3CC2A 1NTGA 1KRTA 3K7UC 3PUWA 3JAMc 1UE1A 1VQJA 5JJLA 5C3EG 4JI6L 3HOZH 4BBRG 4A3LH 4A3BG 3HOWG 2VQFL 4JI0L 1NMGA 3L2PA 3J7ZC 3RZOH 5IYDH 1I6HH 1BBUA 3S24A 2VUMG 4OX9L 2E2HH 1XNQL 1TWHH 5H1SE 1X9NA 3CP0A 1V43A 4R4TA 4A75A 1WJJA 2AKWB 4NXML 1XMQQ 1Y14B 1B70B 2A19A 3UDXA 1TWAH 2R7FA 3ER0A 1K8AC 4OWTB 3E0EA 3I4NG 2UXCL 2RHQB 4P74A 4DAYB 4B3SQ 4A3FH 3CCJA 4QY7A 3GDEA 4DAMA 1IBMQ 3HKZE 2UXBL 2PI2A 2JA6G 1E22A 3UE1A 5DLQE 1X65A 3L0OA 4TVAB 3NENA 1YEZA 4QIWE 5E7NA 4HJ9A 4DR6Q 4APVA 1GO3E 4A76A 2KHIA 4A3KH 2R92H 5C0XG 1N32Q 1HJPA 1M1KC 1I3QH 4LF7L 4OWWB 2D62A 4LW1A 1SR3A 3S2DH 2HIXA 5IE8A 1PYSB 4NXNL 4DR5Q 1CKNA 1Y1VG 2I5MX 2WAQE 1HR0Q 3PF5A 2EIFA 2ZTDA 2UU9L 2JA6H 3FKIH 4IPCA 5GAEC 1RIPA 3HOXG 3F2CA 1S40A 1VQDA 4UY8C 2EQSA 4PZ8A 4ALPA 2MO1A 1QZGA 3TREA 2V1CC 1JJCB 4QJFA 4DPGA 4HIOA 1QZHA 3AYHB 3AFQA 3BJUA 4JCVE 4DV2L 1EFWA 2GVBA 3RNUA 4A3CG 2CCZA 2NZOA 3PO3H 1KAWA 1Y1WG 4IFDJ 4P72A 3KOJA 1PH2A 1PV4A 3GTMH 3S1NH 4JI8Q 3PO2G 2ALYB 5IWAL 2IHFA 4DR1Q 3M4OH 3KFUA 2QGQA 5M5XH 4X64Q 1VQPA 1XPOA 3CAMA 5IP7G 1CKOA 4LF9Q 4UP8A 2HHHL 4DK6C 1E24A 1P16A 4JV5L 5JJIA 1G291 3S1MH 5IYBG 2JA8H 1IBML 1Q7YC 2UXBQ 3CCEA 4AQYL 5LMNQ 5C4XG 3KDFA 1UE5A 1Y1WH 1MJCA 5M3MG 3I56A 2MNAA 1Q8KA 2AMCB 2IX1A 1YIJA 4A3IH 4B3TQ 2DUDA 1I50H 1XJVA 1VQBA 1LYLA 2LXJA 2NVYH 3CQZH 1Q86C 1SN8A 4DKAC 4X66L 2OWOA 4LF7Q 2D0PA 4BY7H 4R1JA 3CC7A 3HOVH 4B3RL 2OQ0A 2JA5G 3CD6A 1VQMA 4DR5L 3CCMA 3OTOL 3I2ZA 3D0FA 3LGJA 2F52A 1I94Q 4GKKQ 5FLMH 1YI2A 1N8RC 1WYDA 2UU9Q 3J81c 4QGUA 3W1BA 4DV6L 4IJLA 3U4ZA 3KDFB 4HJAA 1IBKL 1Z9FA 4GN5A 1V1QA 1D7QA 2R6GA 4YWMA 1TWGH 4BXXH 1S72A 4YWKA 1N34L 1EOVA 3A0JA 4PZ7A 2E5LQ 1U5KA 5GADC 4JBMA 4H02A 2UUCL 1GKHA 4LFAL 1UEBA 1X56A 4IPDA 4DR3Q 3TS0A 2KCTA 3GTJH 1Z47A 5M3FH 4A3CH 3PO2H 5GAGC 3EIVA 3DM3A 1LUZA 4JOIA 4P75A 4JI8L 4IFDG 2R7DA 4DV1Q 1SLJA
chains in the Genus database with same CATH superfamily
4C3JG 3W1GA 5LMUQ 4A3JB 2ID0A 3I7FA 1BBXC 1ZEQX 4HMIA 4QUCA 2PW5A 4K8IA 5I9OA 3H0GH 1EU3A 2QEXA 3S1RH 2NVQH 3RLFA 3VA5A 4POFA 4X65Q 1DD2A 4DUZQ 1KIXA 1SNPA 4WRDA 1SSOA 2VL6A 3ULJA 4LF8Q 1VQIA 4KY5A 3OSOA 3VDYA 4HSVA 4XXEA 2L0CA 3CCRA 3I4MG 2WP8J 3L7ZC 3S1NB 2PZTA 2Y0SE 3BZDB 4P2CB 3OTOQ 3FEWX 4K6DA 4AYBG 4CJ2C 1WTHA 3NE5B 1KLGD 4R4CA 1EYGA 3NBIA 2R93H 1GUWA 4XIGS 5IYBH 2JA8G 3HRZC 3GTKH 5JJKA 1GD7A 1B53A 4OWXB 1D6EC 3JAME 1JOKA 4A93G 3FKIB 3A5ZB 3Q6SA 1WTQA 5BN4A 5FO8B 4MTNA 1YNND 2F0MA 3B6YA 4A3GG 2MHVA 3NUCA 4KMUC 1FL0A 3P20A 1B44D 2EYMA 4CHTB 3GTGH 2DY8A 1PZID 1JWUD 1JT8A 2NZ1D 1JE4A 2IWHA 5HGQA 4QF4A 3KJOA 4KY6A 2I46A 4JPBW 3DHQA 3J81i 3AU7A 5EJWA 4F8MA 2KCNA 5C44H 2MO0A 4J1MA 3A8KE 2E74C 5A2QE 2WAQB 2EDGA 4IOCA 2VQFQ 1LTLA 2A68D 2BOSA 2ZM6Q 4CDDC 4GOPA 4A3DB 2ES2A 4PNYA 1AEXA 2F3IA 4IPGA 4LF4Q 2AUJD 1X3FA 4U673 2JEAI 5IGEA 2ZTCA 4WJ4A 1V9PA 4R4QA 4IUUA 5IYCH 3NELA 1UE7A 3K81C 4UP7A 2Y0SB 1OTCA 3IKJA 3AB9A 3PMFA 1N32L 5BR8Q 3S16H 2CWPA 4DNIA 2PMZB 1A2TA 2E2JH 4C3HB 4Y7NB 1VQCA 2NVTH 2B2WA 4JI1L 1NSNS 3CPFA 4JYAL 4JI5Q 2JA8B 1MI2A 4L63B 1SMXA 4P71A 2XSCA 3EA6A 2K6AA 2ZXOA 1K0SA 2L1BA 5JAVA 4A3JG 4DN4M 1EWIA 1Q1EA 1TXYA 4PMCA 5J1ZA 3K5NA 2WB1G 4PMWA 5ELBA 4TSSA 4LMQD 2A5HA 3EJIA 4ZQ3A 4CJ1B 3MXPA 3J7A5 4HJ7A 3G7LA 5FKAC 1X6OA 1NJIC 1VQ9A 1F2MA 1Z7TA 2D9UA 3OWEB 1VF5C 3ZJYC 2B2YA 2YU9B 1JORA 5KRUA 1EWCA 4IPHA 4LF9L 4RGMA 2UXDQ 4IURA 5LL6S 4JBJA 1I4XA 3MTSA 2F0LA 1GJXA 3P75A 1DONA 4ZUIA 5CGKA 4L6TB 2GVAA 3I4LA 2WV6D 2HQLA 4X3TA 4YIJA 4A3IG 2SNMA 4WJ3M 2VW9A 4X66Q 4A93H 1C4QA 2QEJC 3H3VC 4GKKL 2IL8A 2B3GA 1HZCA 4KHZA 1TIID 1I4RA 3W5OA 2YYZA 3S1QB 4XT1B 2DJFC 4O42A 3SHLA 3K8AA 4YCWA 2VQEQ 1WOCA 4MTKA 2ATWA 1PH9A 3NBHB 1TWFH 4DR3L 3IRBA 1UWVA 4ZCKA 5DEHA 5IT9L 2I0QA 4UHVA 2EYHA 3R93A 5LMUL 4DV2Q 2PZWA 5GAHC 5ISRA 3K0XA 3CCSA 3GTQB 1CM9A 4HAEA 3G48A 1G6PA 2ZJRA 1ENFA 2M9VA 4RAUC 3UDFA 2E2HB 1E0BA 3CU7A 1Y8OB 3S15H 1TWGB 3QOJA 1CSQA 3HOWH 1B1ZA 4RKLA 4ZK9B 4FXKC 4AH6A 3HKZB 4XYOA 2I5LX 3NTIA 2G9HD 4QMGA 1K8GA 1KDAA 4JI7L 1STNA 2NBFA 4A3IB 4YY3L 1PH7A 4B3RQ 3OW2A 1BCPF 1LTBD 2L11A 1CQVA 1XPRA 4HTHA 5DNFA 4LUVA 2KCMA 1A2UA 4GNXC 2O5IC 1G2TA 4OIKA 4DV6Q 4DV7L 1YVCA 3KLRA 1K3RA 2F0WA 5FLXL 1VQGA 3S17H 1ENAA 4LFAQ 4LFCQ 2UUCQ 1H95A 5L37A 4WJWA 3PIOA 3HGBA 2K05A 1AFPA 4IO9A 3I4MH 2K1BA 4TKOB 5JVG3 2JA9A 3T16A 1G91A 3X3MA 2QDLA 3E3XA 3PO3B 2E76C 4L5TA 4RHRA 4TRDA 1SDFA 4A3BB 3S2HB 4JI4Q 1CUKA 1QVGA 5IY0A 1YHAA 3PQIA 4OEMB 2H1EA 1PH5A 3J80E 2K4KA 4A3GH 4G7ZC 1K8MA 3D8GA 1CKMA 3SVMA 1EZ6A 2EY1A 2N78A 3CXCA 1PRTC 2EJGC 3HOUG 1CTMA 4LF6Q 1HZAA 1YJNA 1Q82C 3SK4A 3DLLA 2J0TD 2EXZA 2NVXH 1IKMA 3GTJB 2K5HA 4G4KA 4XTCS 3W3AA 4DV3Q 1A63A 4IJHA 4ME3A 3BZKA 1SBBB 3GO5A 4DR2L 2IT1A 3H15A 3NBHA 4OONA 3QOLA 3PO3G 3KK7A 1F9PA 1T9HA 2PNHA 1QNKA 3RZDH 1JOQA 4ZAIA 5C0XJ 4FF3A 1SYGA 2BE5D 1DCZA 2Q2IA 4C3IB 4C3IG 3A5UA 3M3YB 3H6MA 3I90A 4CGYB 4KHPQ 3BDLA 3C1EA 1VQ6A 1C7YA 2WKDA 5HY6A 2CW0C 5C6AA 5TSSA 3S16B 3MWYW 1HNXQ 3K7UC 3NQIA 3JAMc 5C3EG 3KLSA 4JI6L 4A3BG 2Z4IA 3A8JE 3HOWG 4JI0L 4ID6A 3DWQA 3J7ZC 2CQAA 1I6HH 1BBUA 1CHPD 4K5WA 3SDZA 2E2IB 5H1SE 4R4TA 4A75A 2XWJB 1WJJA 3I70A 3I4NG 2RHQB 4B3SQ 3K7AB 3D3RA 4DAMA 1E2VA 1IBMQ 3SEBA 1LTTD 1B9NA 3UE1A 1EQTA 1X65A 2WACA 1XYIA 4HJ9A 1QILA 2MJ8A 2MP1A 2SNSA 4H44C 2KHIA 4A3KH 2XVSA 1TQOA 1HJPA 3ND8A 4LW1A 3CRKC 1PYSB 3C1FA 1EY0A 2F0PA 2I5MX 1IYUA 1BQQT 3FKIH 1A3VA 4IPCA 5GAEC 3HOXG 3F2CA 2EQSA 4PZ8A 1QZGA 1DOMA 3V96A 1F2ZA 2PO4A 1JJCB 4DPGA 4B08A 3RNUA 4F87A 1KAWA 4ZRZA 4IFDJ 3KOJA 2F0SA 1PV4A 3S1NH 3N6RA 1QG7A 2IJ0A 4JI8Q 3J7AF 1H9RA 3KFUA 4ZKBB 1I6HB 4KHVA 1HUMA 3CAMA 4RCOA 5NUCA 1SFOB 4JV5L 5JJIA 4OELB 4OL7A 1IBML 4RWSC 3CCEA 5LMNQ 5J22A 5C4XG 3S1RB 1UE5A 1BCPD 3I56A 2MNAA 2AMCB 5G3LD 1GUOA 2F0DA 4B3TQ 1PDQA 3NXWA 1Q86C 1XJVA 2NVYH 1U4PA 1ICFB 2A73B 1SN8A 2D5DA 5CYUA 1WTPA 1IHZA 4R1JA 4A3FB 2E75C 2QW7A 2OQ0A 3CD6A 1ML0D 3CCMA 4HSPA 2F52A 3C46A 1YI2A 1WYDA 4DV6L 3KDFB 1KDBA 1D7QA 3E5SA 2B2VC 1F9QA 3PIO3 1GXDC 1RHPA 1U5KA 4LFAL 2ZXPA 1UEBA 4IPDA 3GTJH 4J6HA 2NVXB 2H4OA 5CMDA 1LTAD 5J39A 3EIVA 1PMRA 5KEEA 3HOXB 4P75A 2A6ED 4WFN3 1EIGA 3BVMA 2OQKA 2FINB 3K5LA 1WTXA 4A3GB 4K14A 2XTIA 1CSPA 1XPUA 4DR7L 1HTLD 3EROA 2ZJQA 5KYIA 4GOPC 1FNVA 4DV4Q 2L4NA 3MVVA 4KI0A 4A3MH 1GUNA 4JW0A 1L0YB 1SYEA 1SE2A 4DUYQ 5ELNA 4NW2A 3I4MB 2A6HC 1KAAA 3L3OC 4AYBB 4IOAA 1WTOA 5EKKA 4L5SA 1I4HA 2KBNA 5FLMG 5IP7H 4RMFA 1TY2A 2I5HA 2K7VA 1JICA 3OYYA 2GN5A 2DNCA 4JC0A 4V0BA 3CMEA 1O7YA 5BR8L 2RDGA 2PI2E 2ZTEA 4JVZA 1EEID 4KKTA 3MXGA 5IP9G 3PGZA 1LM0A 2LFNA 2Y0SG 3U9OA 3ICEA 1X3GA 3VA7A 3NTKA 4LFCL 3MZ5A 2RA4A 1LT4D 4UP9A 4KHPL 1FJGQ 1GUTA 1XXGA 4NB3A 1ILQA 4DF7A 2JA7B 3LX0A 2B63G 1J8IA 3KBXA 2E2IH 3L9AX 1OXVA 4GLAC 1K3BC 1MJEA 1CFMA 1U9RA 1PH4A 3KF6B 1XNRQ 1AH9A 3HOZG 2LKVA 2KQ3A 1F77A 4LF8L 2BA1A 4DV4L 2H5XA 4MHEA 3GTQH 4FO2A 2B8FA 4DUYL 1NCVA 4A3DG 1H9JA 4BY7B 1I4GA 3GD7A 5KYLA 5CV5A 2UXCQ 4I7ZC 4B3SL 4C3IH 1N9WA 2AQ1B 5EPLA 1LTRD 1QWYA 1GUGA 2Q8RE 2A69D 1RTNA 1V1PB 3BDCA 1DYQA 4KN4C 1SAPA 1QUQA 3DWPA 2KEDA 1CA6A 1CZWA 3J7YW 1PZJD 1BVSA 3I4NH 2F0TA 1FD7D 1PTOC 3K0YA 1WVLA 3WWVA 2UUAQ 2L12A 1Q1BA 5EGTA 2VQEL 2NVYB 4ZKCB 4X3UA 1S5DD 4GLVB 1B4OA 1R4QB 2WKCA 3U58A 4GNXB 3TS2A 2R7ZH 3ITPA 1RTOA 3BDOA 1KHIA 1PHJA 4LF4L 1KTKA 4A3KG 5ELEA 4OXPA 4JI0Q 3S2HH 4OO1H 1KNAA 2A6HD 1SFOH 2R92B 1A62A 4OX9Q 4OHJA 4JV5Q 1BXTA 4PMBA 3NWSA 4NXMQ 3HEJA 1Z6HA 1LLRD 3PV0A 5LMNL 2GA4B 4HCSA 3BU2A 2N3SA 3OPOA 4XQQA 3CPWA 5K36G 4BBSB 3RLNA 3S17B 1LTID 5IGBA 3RLOA 1M90C 1W6KA 3HOVG 2AQ3B 1SRUA 4CDCC 1ET9A 4JI3L 2N8NA 3PUZA 1B7YB 1I94L 4MN3A 4RGNA 2A6EC 3G6EA 2OTJA 2KJXA 4BY1G 1BKBA 3HKZG 4Y7NH 4ZLTF 1V1PA 4A3KB 5LHY1 2XRQD 2B63H 5IT9c 2LY7A 1STAA 1PH1A 1AZPA 2R7ZG 2UUBQ 4X3SA 3MFYA 4Y52H 4CBVA 2Z8LA 1VQOA 4KK7A 3OHXC 1EL0A 4M1UB 4KJNA 4OO1G 3S15B 1CI3M 4DV0Q 1HNWQ 3EBEA 4BY7G 3Q0AA 4LJZC 2RCNA 4DAYA 1IYJB 1ASZA 2NTTA 4CKBA 4A3DH 1KXLA 3CF5A 1JB3A 1YBYA 1O7LA 3HOVB 1D2BA 5K36H 2Z6KC 1TS4A 2HHHQ 4S3SA 4LK1C 2A74C 1NAPA 4QUFA 3HKSA 2K50A 3N52A 5M3MH 5IGGA 3M4PA 5M3FG 1SNDA 4DR4Q 4KD3A 4NKLA 1I4QA 1HUNA 1U4MA 1X55A 1CKNB 2L9HA 4BA1I 1IZ6A 2VS1A 5CV7A 4XDXA 1YJWA 1MBYA 3M3YH 1SYFA 2EOTA 4B3ML 3BZCA 2WB1B 1TVXA 3MFGA 5IGCA 4L5QA 4DV5L 1D5ZC 3SK6A 3GTMB 1D8LA 4LFBL 1DXMA 2AWNA 2RDFA 3S1MB 2RVLA 3F1ZA 4NP5A 3CCUA 1BCPC 5F2DA 5ELOA 3G71A 2B8GA 2Q8IB 5C4ZA 4M8AA 5FLXc 1QCBD 4XQJA 2YTYA 3PUYA 3PIPA 2ZXRA 1BO0A 1FGBD 2JXMB 1Q3LA 2JQOA 1HPCA 2G9DA 2JN4A 1K28A 1XMOQ 3JC66 2EE1A 1VQ8A 1HNZL 2YU9H 1E2ZA 1XNRL 1QNUA 1WCMH 2NN6H 1MKHA 2NVQB 3K59A 3M7NA 2Z1CA 4KKUA 3F8TA 2F0JA 1N33Q 2K5VA 1U0LA 1EY4A 3BYTB 4O2DA 5CV8A 3UDIA 1KD1C 3J81j 4DU9A 4K5VA 1I6VC 1V8QA 2EYFA 3GTPH 2KVMA 3AEVA 5C3EB 3OW7A 1AW7A 1H9KA 4G57A 1K9MC 2XRSD 4X6AH 3T1YL 2K5DA 1MSHA 2F3WA 4J8QA 2KENA 3T1HL 4LFBQ 1VQNA 1N36Q 1L0WA 4B9XA 1YNJC 3A7LA 2KHJA 2F3VA 5M5YH 2Q2TA 3HOYH 1S5BD 3M9BA 4POGA 3GTLB 1NMFA 2WFWA 2F03A 2JA5H 3I73A 3S14H 3CC4A 3RR5A 2VZAA 1Q46A 2MFIA 3KLWA 4ULLA 2F0EA 3S9WA 2IY5B 4QIWB 2K75A 5C3XA 1XMOL 1HR0W 1HR0L 3NPPA 4ZUJA 3J80c 2JEBI 4HCEA 4JI2L 1C9OA 1OXXK 4X62Q 3CC2A 5JJLA 1VQJA 2KA7A 3HOWB 4A3LH 3L2PA 3T51B 2VUMG 4OX9L 2E2HH 1XNQL 5IOCA 4H0LC 1X9NA 1V43A 5D65A 1B2TA 3HG9A 1TWAH 1HHVA 3BVZA 3E0EA 2F1MA 2UXCL 1STBA 4P74A 2Z9HA 3H94A 3CCJA 2BCOA 3GDEA 3GTGB 2PI2A 2JA6G 1PTOF 5KNDA 2JA6B 3L0OA 1SXTA 4TVAB 1JWSD 5E7NA 4RHSA 4APVA 2R92H 5C0XG 2D62A 2RSNA 2QDBA 2X6GA 4NXNL 1CKNA 1Y1VB 4KV6A 2QCPX 2UU9L 4K8JA 1S40A 3VR6A 4F7XA 2K5WA 1VQDA 1F2LA 1CZGA 5A35A 3TREA 4V190 1QZHA 4HIOA 3AYHB 3FDTA 1EFWA 3I4NB 1TT2A 1TU2B 1JCKB 3QIAA 4B9WA 5EPKA 1TWHB 2ALYB 1ET6A 4DR1Q 1HXYD 2QGQA 3TBIB 2JSOA 4KY7A 4X64Q 1XPOA 2O5JC 5CV6A 2Z6BA 1CKOA 4LF9Q 1D5XC 4Q0FA 5FO9B 1LV9A 1G291 2EY6A 5IYBG 2JA8H 4OGQC 3S1MH 2UXBQ 4AQYL 1SEBD 4XQNA 5C4XB 1UAPA 1Y1WH 1MJCA 3GP7A 1UEAB 1YIJA 2J7ZA 4R9WA 2LXJA 1LYLA 5EBDA 1B3QA 3SK8A 4X66L 4BY7H 3CC7A 5BN5A 2JA5G 4C1NK 3E0JA 3T13A 1EYAA 2M2LA 1I94Q 5FLMH 2UU9Q 2PNRC 4IQZA 1SNCA 5E4XA 3R8BA 3W1BA 1IBKL 4GN5A 1KDCA 2R6GA 1EU4A 4YWMA 1UNSA 1D5MC 4BXXH 1EOVA 3A0JA 4PZ7A 2NVTB 5HURA 5EKIA 4A3CH 2KCTA 5M3FH 1Z47A 4EQPA 3DM3A 4RA8A 4C56C 1EOTA 2K5QA 1FVIA 1LT6D 1FYCA 1VMCA 3PCOB 1ESRA 1A15A 1FJGL 4EQOA 3J80i 1VDZA 1VQ5A 1D1IA 2R3ZA 2Q8TA 1HQRD 3DMUA 4R4IA 1WD1A 1E7ZA 2WIIB 2R93G 3CMAA 1PVOA 5IIFA 3M4QA 3MA2B 4IZ8A 5CV4A 1PH8A 4DXGA 3CKIB 2MUYA 1C48A 4ZYSA 1PYWD 2R92G 4JG2A 1L1OA 1GVPA 3T1HQ 2F0NA 2BA0A 2C9OA 2F0IA 3TQYA 4AYBE 4CKCA 3J80L 4DR2Q 4B3MQ 4BXXG 3MEFA 1VF7A 2NN6G 1HA6A 1N34Q 4KJOA 3FVQA 4IN3A 1PRTF 3KJPA 1A3TA 4CJ0B 2C35B 4DV7Q 2KUMA 3KF8B 1PH3A 1WI5A 2YV5A 3S2DB 3MHBA 3AQQA 1WCMB 4IALA 1CQFA 2OCEA 3U4VA 4HN7A 3HZXA 2A1AA 3M4YA 1QUQB 1F9RA 4GLXA 2EJFC 1H9MA 2CWAA 3GQBA 1J5EQ 3CHBD 3IFDA 4EGVA 4NDXA 4X62L 2KOLA 2ZT9C 5JPMC 3MAQA 2B29A 3QWNA 1QB5D 4BA2I 4JI4L 5EBCA 3HOZB 2RBMA 1LT3D 1EEFD 4GS3A 4IUNA 2PQAB 4IFDI 3MXNA 1HTPA 3P7JA 1HA5A 3GV6A 4ODGA 1SNOA 4RG1A 2FMCA 1EY6A 2N55A 1PFNA 4NPSA 2BDNA 1X54A 2DNEA 1WTRA 3R2TA 4LF6L 4K0KQ 4A3JH 1YJ9A 3VR3A 5C0XI 3CCLA 2MGSA 2NUCA 1WD0A 2CQOA 3ULPA 4FF2A 2E8GA 1VMPA 1YHBA 3PSIA 4C2MH 3A7AB 1I5FA 4FYDA 3T1YQ 3CRLC 1GM5A 1AE3A 3NK9A 2RQXA 4A3LG 4GKJL 2QKIC 2NB0A 3TP6A 4DXFA 1IW7D 3CW2C 3OIQA 4BBSG 4JI3Q 2B2YC 5AFWA 1XTDA 5C3WA 3FPPA 3DM1A 4L8JA 3I8ZA 5T1GA 3UE0A 1QVFA 4FF1A 1PTOD 1L0XB 4AIMA 2Z6KA 3RN5A 1EQQA 1BCPB 3CQZB 1ILPA 1EFID 2F4VL 1II3A 1S5FD 3P1HA 1RD9D 1PRTB 5LL6X 4LF5L 4KLKA 1AN8A 1SROA 2UUBL 2HUGA 3R2IA 1DOLA 2B63B 4DR1L 1QOHA 3NQTA 5AJ3L 4JI6Q 2CH4W 2EYOA 2LS01 1EQVA 4K0KL 3BYYB 2B2WC 1IKLA 3J81L 2Q2UA 1A6XA 3LWUA 1VS0A 4K2KA 5EPJA 5E4WC 4O1NA 5ELDA 1JR0D 2J4XA 4O0AA 5C5LA 2XIWA 4JI1Q 3DEOA 2EY2A 2PYKA 2HT1A 4DAVA 4BBSH 3CCQA 3CCVA 1FGUA 3RUZA 5GROA 2D2CC 3K6OA 2K33A 4DGZA 2LXKA 2PMZE 4QQBX 2UUAL 4KTAA 5ELFA 2HD3A 3IL8A 4A3EB 2LSSA 4XYQA 1W3SA 4HJ5A 1GHJA 1PTOB 1EIFA 2R7ZB 5E3FA 1JOOA 1DZ1A 1K0RA 2F0GA 4FXDA 4P73A 3I4OA 4BWGB 1WTWA 2BH2A 3A56A 4EVOA 2AWOA 4GN4B 3Q22A 1UE6A 4LWCA 2F0VA 1NUCA 5M5WH 4ABNA 4X64L 5KNCA 5KGUA 2L5TA 5ELCA 4K5XA 4X65L 4J15A 2F0OA 1HNZQ 1O78A 3A8IE 1SMYD 4LNQA 1SE4A 1AE2A 1N33L 1STHA 3NHHA 4ME5A 1STYA 3BS1A 5C4XH 3IFTA 4IUQA 4XT3B 5I2YA 4QL5A 1TWCH 3ULLA 5C4JB 2QA4A 2RCFA 1X3PA 2YTVA 4G7OC 1G8ZD 2VXWA 2WB1E 3DWAA 1PTOH 4DV3L 4GOPB 1GOZA 1N36L 1YZ6A 1E2WA 4A3BH 4RFBA 3RD4A 4IUVA 5J3BA 1X3EA 5JEAH 4BY1B 4LUZA 1LT5D 1IBLL 3D6WA 1J5EL 1A0IA 3ERSX 5KNBA 2ENBA 3DUZA 1Y1VH 4U68A 3Q24A 2F4IA 3SXHA 4EX5A 1PYBA 2N49A 2PCFB 3HOUH 4PG3A 2HIVA 1OXTA 3H0GG 2FJ2A 3FHWA 1E1TA 3E6ZX 3SR1A 4NMZA 2DN8A 1HH2P 5FK9C 1EY5A 2BE5C 2VB3X 4YWLA 4JOIC 5CV9A 2OEOA 1WFQA 1KC8C 1LTSD 1NBWA 2A8VA 2VUMH 3GTOB 4JI7Q 2IX3A 5IYDG 3T56B 3I55A 5D3DA 4A3MG 4YY3Q 1TWAB 2OT2A 1U4RA 4MIUA 3J7AV 2EY5A 1DOKA 2JK8A 1VQKA 2RHSB 3HFZB 2EYLA 1KABA 1YNNC 1CK1A 1BDOA 1ICWA 2D0OA 1K83H 3F2DA 3BVGA 3K7AH 3R3OA 3MC0B 2RSOA 4C1NI 2ASBA 3A54A 5IP9H 3STBC 5C0XH 4UPAA 4N9PA 1TS2A 3MXNB 5IODA 2VY3A 1XTCD 3SE0A 1S5CD 1ONLA 3S14B 5CC4A 1BBWA 4C2MB 3GTLH 2XN9C 2B2UA 1C8CA 1BF4A 3PUWA 3PIP3 1LACA 1RODA 2IW3A 4BBRG 2VQFL 5IYDH 4KD4A 1HFGA 1T5EA 3TSSA 5JVH3 1MGSA 3HP3A 3I3CA 4EQNA 1MHWC 1XMQQ 2IPKD 3LNNA 2PW7A 4A3FH 2HDMA 4QY7A 2UXBL 4E6IA 1E22A 3K5MA 2SOBA 4UAIA 4GZYC 4DNTB 4DR6Q 3VR4A 4A76A 1M1KC 1I3QH 2CW0D 1R9TB 3QB3A 2EVBA 4CDEC 3QG1A 2K28A 3S2DH 5IE8A 1ZKOA 1Y1VG 2EIFA 2ZTDA 1RIPA 4UY8C 1PXUA 2E2DC 2VB2X 5JJZA 1TS3A 2JYOA 2V1CC 4QJFA 1WTVA 3TP8A 4DV2L 2GVBA 4A3CG 3PO3H 1LTGD 4K6LA 3GTMH 2B2UC 5IWAL 2IHFA 2QF7A 1A3UA 3G6JB 1VQPA 1ENCA 5IP7G 2N88A 1EZ8A 4UP8A 4DK6C 1P16A 1PFMA 2E2JB 3O13A 2XNAC 1SJHD 5M3MG 5M3MB 1PZKD 4A3IH 1QJOA 2DUDA 1I50H 2FMMA 1VQBA 4LF7Q 2RKSA 2OWOA 3BG3A 3WOEA 4RGOS 1ZXTA 3HOVH 3IAYA 1BNZA 2K01A 1VQMA 4DR5L 3MXUA 2NYZD 3D0FA 3I2ZA 4GKKQ 3D4RA 4QGUA 1SNQA 3U4ZA 2CVRA 2PZUA 1O7ZA 2X6LA 1TWGH 1I50B 3WDNA 2K32A 4YWKA 1N34L 2E5LQ 4JBMA 4H02A 1GKHA 2WINB 1H9SB 1KLUD 2F0QA 4JOIA 4JI8L 5CORA 5BN3A 4IFDG 2R7DA 5I9PA 1RKNA 1JQYD 1SLJA 3JAMi 3PF4A 3OWFA 4H13C 1ASYA 4YHHQ 1JWMD 2CFMA 4HIKA 1PLFA 1NE3A 3PUXA 4KKSA 3FMCA 1Y1WB 1WCMG 3K57A 2CHBD 3KYHC 5E1FA 3U50C 3W2DA 5LMNW 4A3FG 3RZDB 2CKZB 4PZ6A 2PQAA 1BR9A 1NR4A 2R93B 3I72A 3VYTA 3STBD 2M00A 4RCNA 4B3TL 3S1QH 5EAYA 4FXGC 3Q8DA 3GV3A 3HS0C 1BUVT 1EY7A 2B39A 4JBKA 2HCCA 3H91A 4HEDA 1JJGA 2QILA 4L5RC 1SYDA 1N32Q 4DNRB 3I91A 1RCVD 3NP8A 3OMGA 3KF8A 3VYSA 3HOYG 1Y8NB 4RH6A 5C4JH 2O2LD 2C5CA 3OOCA 4X3KA 5CR3A 4JI5L 1UUPA 1IL8A 4C3JH 4FNFA 5G3LF 1SMYC 1EY9A 1PFSA 1EIHA 1IW7C 1S3OA 1TY0A 1L1OB 5C4HA 5A2QL 2JA7G 2NTSA 3OIPA 5EQ0A 1T5XD 2AUKA 4R8IA 3EN2A 4DUZL 2WAQG 4DK0A 3D6CA 3VR2A 5HGTA 4RKBA 2KECA 1YHQA 1XNQQ 2K5NA 4UDUC 3H09A 3LWEA 4GN3B 1NR2A 1K8OA 5AJ3Q 1GUSA 1PH6A 4FP5D 5IGDA 1TR5A 4OO1I 2UXDL 3RN2A 3A55A 2AQ2B 1K73C 3G4SA 1YNJD 1P8LA 3AMUA 1I4PA 2NN6I 1OXUA 2OXPA 4DR6L 4A3EH 1DJRD 3NEMA 1B9MA 1YNXA 3U9SA 1K83B 3TP5A 1V1OA 4QCLA 3PUVA 2EXDA 2JA7H 3FKIG 2YTXA 2RDHA 4N8FA 4OIJA 3KUPA 4R4OA 3HOYB 1JJ2A 5M5YB 1DM0B 1STEA 1YITA 1Q12A 4DA2A 5DM63 5C5MA 1VQFA 2A68C 5C44G 5C44B 2L15A 1EQRA 1FNWA 2ZM6L 4JI2Q 5JOBA 4KN7C 5C3EH 1ESFA 1TWFB 3KF6A 5IT9E 1HNXL 4DK3C 2FFKB 2NZHA 3GTPB 3F2BA 1OO9B 2Q2HA 2F0HA 4F88A 4HIDA 1PRTD 3TP7A 2EJMA 3FP9A 1AZQA 1Y69U 1CT1D 1AP0A 1VQHA 3GTKB 1S4ZA 3TRZA 4BY1H 4A93B 1G6ZA 4HR7B 2JE6I 1EYDA 1QVCA 4R8NA 4JYAQ 5IGFA 3T53B 1CA5A 1VQ7A 4DR4L 4FVMA 4WORA 4TQUS 3TN2A 5FJ8G 1KNEA 1LABA 2X69A 2K52A 4BS9A 4G7HC 5GQOA 3K80C 1TWCB 1I3QB 1R9TH 2R61A 4NXNQ 1OXSC 2F0UA 2F4VQ 1RJTA 2DGYA 3HOXH 4YCVA 3E9HA 2B2VA 1VQ4A 1RL2A 3TDQA 2OTLA 3ONAB 3RMHA 5JEAG 2AHOB 4DV1L 3NWTA 2BH8A 3H3VH 1PFBA 3Q23A 1EY8A 1IBLQ 3ERQA 1O80A 1R4PB 5M5WB 1C0AA 3AFPA 5COYA 3M85A 4DR7Q 2MQHA 1W6JA 4A4IA 3UDGA 1JMCA 2JJQA 1NNXA 3D4WA 3TEHB 3H3VI 4N8X1 4CKEA 5I4DA 1Y8PB 4AQYQ 1HZ9A 3NSWA 4C3HH 3D31A 4HIMA 5FJ8H 4DFAA 4A3EG 1G51A 3WOFA 1KL9A 2Z0SA 1TS5A 5EKLA 4N9TA 1NY4A 2TSSA 1HFNA 4FDBA 1B8AA 1Q81C 1SE8A 4YCUA 2KHSA 2B2TC 4HJ8A 2EPBA 1L1OC 1ZYRD 2RF4A 1IBKQ 2OF1A 2IX0A 2Z4HA 1JC7A 1JE5A 5D14A 1ZYRC 1A8VA 5JEAJ 4MZ9A 2DJGC 2E5LL 4DV0L 1HNWL 5M5XB 1CHQD 1FR3A 1XWEA 3SK5A 1VQEA 1KRSA 2NWGA 2XWBB 3DXJC 1E1OA 1U4LA 4YHHL 1O7IA 4GNXA 2HQEA 3A74A 3V05A 3GTOH 2VUMB 1H9SA 3NTHA 1F2YA 3QR8A 5K5PA 4BBRH 1E3PA 1G2SA 2ICEC 1IL2A 2P5ZX 4Q5VA 2B2TA 2HCIA 1SYBA 2SEBD 3HOUB 4MNOA 1D1KA 3M7GA 1HRJA 1J6QA 1TKWB 2K04A 3E9IA 3KLSX 1W2BA 3UI2A 1VQAA 1XMQL 1SE3A 5M3FB 1EIYB 1RDPD 3KBGA 4DV5Q 4FF4A 4K2LA 2MPMA 1MD2D 4CDFC 3QJYA 2A69C 1IXRA 3OMCA 2FXQA 2K14A 4GKJQ 1HCZA 1MIUA 1JB7A 2ZJPA 1HZBA 1RF2D 1EWHA 4EQ5A 4H7BA 2EYJA 3DEPA 1QE6A 3H0GB 1DGSA 2VNUD 3F2UA 3X3NA 1PA6A 3RZOB 5IYCG 1EUJA 4JBWA 1VCIA 3J81E 5FO7B 1L2FA 3VYRA 3K58A 5FOBB 3EFXD 4LUOA 4LF5Q 1F9SA 2IHEA 2XGTA 5KIXA 3PO2B 2F0KA 1J9OA 1KQSA 3SGIA 1NTGA 1KRTA 5DM73 1UE1A 3HOZH 1NMGA 3RZOH 5I2XA 3JAML 3S24A 1TWHH 3CP0A 2L55A 3TZDA 2AKWB 4NXML 1X32A 2KEEA 1Y14B 1B70B 2A19A 3UDXA 2R7FA 3ER0A 5JPNC 4OWTB 1K8AC 3C2PA 2SDFA 2EZVA 4DAYB 1FNUA 2JP1A 4LAAA 2EYPA 3FRPB 3K5OA 2TMPA 3HKZE 3URYA 1LO5D 5DAUA 1XX8A 5DLQE 5FLXE 3NENA 1YEZA 4QIWE 5I6YA 5CBAE 1GO3E 2K03A 4LF7L 5T1IA 4OWWB 3T4AC 4IUPA 2KCCA 4ILWA 1SR3A 4HMJA 2HIXA 4DR5Q 4DK1A 1M8AA 2DY7A 2WAQE 4BBRB 3PF5A 1HR0Q 3M4OB 1STGA 3EVQA 2JA6H 2HDLA 1B50A 2ICIA 2LMCB 4Z9CB 4ALPA 2MO1A 4JK1C 2V4DA 1SNMA 3AFQA 3BJUA 4JCVE 3MEHA 3VYUA 4PQXA 2CCZA 2O4XA 2NZOA 1EYCA 2PQEA 3EQLC 1Y1WG 5M9OA 2CH4A 4IFDH 4P72A 1PH2A 5D3IB 3QO2A 3PO2G 3M4OH 1M4VA 1SJED 1SYCA 5M5XH 4A3MB 3C3LA 4RGTA 4I65A 4PV1C 2G5DA 5I6WA 2HHHL 1E24A 1Q7YC 2FHTA 1BOSA 3TZUA 1X3QA 2BDOA 3D4DA 3KDFA 1Q90A 3V2TA 1Q8KA 1Q8IA 2IX1A 3ND9A 1IYVA 3CQZH 4DKAC 2D0PA 1S5ED 1GHKA 5CBEE 4B3RL 2JA5B 3ZYYX 4I7AA 3OTOL 3FPUB 3LGJA 4QB4A 2F0FA 1N8RC 1MSGA 3J81c 2PPBC 4IJLA 4HJAA 1Z9FA 1HQMC 1V1QA 1B3AA 3VR5A 4DAPA 1S72A 5GADC 2UUCL 4C3HG 1X56A 4DR3Q 3TS0A 3TMEA 2I07B 3PO2H 5GAGC 4IUTA 1LUZA 1VQLA 5IWAQ 4DV1Q 4C3JB
chains in the Genus database with same CATH topology
3JAMi 3PF4A 3W1GA 5LMUQ 1FVIA 2ID0A 3PCOB 1ASYA 2OQKA 3I7FA 4YHHQ 2CFMA 4HIKA 1FJGL 1NE3A 3J80i 2XTIA 3PUXA 1CSPA 1VQ5A 1XPUA 1WCMG 3H0GH 2QEXA 3S1RH 4DR7L 2NVQH 3KYHC 3RLFA 3U50C 4R4IA 5LMNW 4A3FG 2CKZB 4PZ6A 1E7ZA 4POFA 4X65Q 2PQAA 4DUZQ 1KIXA 2R93G 2ZJQA 3CMAA 1PVOA 3STBD 4GOPC 4B3TL 3ULJA 2VL6A 4LF8Q 1VQIA 3S1QH 5EAYA 3M4QA 4DV4Q 1PH8A 4KI0A 3VDYA 3Q8DA 4A3MH 3CCRA 4DUYQ 3I4MG 5ELNA 2WP8J 3L7ZC 2Y0SE 2R92G 4JBKA 3OTOQ 4JG2A 4IOAA 1L1OA 4AYBG 1GVPA 4L5SA 2KBNA 3T1HQ 5FLMG 1JJGA 2BA0A 4R4CA 5IP7H 4RMFA 1EYGA 3TQYA 4L5RC 4AYBE 4B3MQ 2I5HA 4XIGS 4DR2Q 4BXXG 2R93H 3MEFA 3OYYA 2GN5A 4JC0A 3CMEA 2NN6G 5IYBH 2JA8G 5BR8L 3GTKH 2ZTEA 1GD7A 2PI2E 4OWXB 1N34Q 5JJKA 5IP9G 4A93G 3PGZA 1LM0A 3A5ZB 3KJPA 4MTNA 3HOYG 2C35B 4DV7Q 3B6YA 5C4JH 4A3GG 2Y0SG 3KF8B 1PH3A 1WI5A 1FL0A 2YV5A 3GTGH 3ICEA 3AQQA 1X3GA 4JI5L 2OCEA 3U4VA 4LFCL 4C3JH 1JT8A 2A1AA 1QUQB 4UP9A 5HGQA 1PFSA 2CWAA 4GLXA 3KJOA 1FJGQ 4KHPL 1S3OA 1J5EQ 1L1OB 4NB3A 2JA7G 2B63G 3J81i 4X62L 2E2IH 1OXVA 4GLAC 5C44H 1MJEA 2B29A 2MO0A 3EN2A 4DUZL 1PH4A 4BA2I 4JI4L 2WAQG 3KF6B 4IOCA 2VQFQ 1XNRQ 1AH9A 3HOZG 4LF8L 2BA1A 1LTLA 4DV4L 2H5XA 4GS3A 2ZM6Q 2PQAB 1YHQA 1XNQQ 2K5NA 4IFDI 3GTQH 4GOPA 4DUYL 2ES2A 4GN3B 4A3DG 2F3IA 4IPGA 5AJ3Q 4RG1A 4LF4Q 1PH6A 1X3FA 2JEAI 3GD7A 4NPSA 2ZTCA 4WJ4A 1V9PA 2UXCQ 4R4QA 4B3SL 5IYCH 1X54A 3NELA 4C3IH 1UE7A 1N9WA 3K81C 4OO1I 2UXDL 4UP7A 4LF6L 3RN2A 4K0KQ 4A3JH 1YJ9A 1OTCA 5C0XI 3CCLA 1K73C 1N32L 2CQOA 5BR8Q 3ULPA 2E8GA 3S16H 2CWPA 1YHBA 4DNIA 3G4SA 3PSIA 4C2MH 1I5FA 3T1YQ 1P8LA 2NN6I 1OXUA 2E2JH 1GM5A 4DR6L 1AE3A 4A3EH 1VQCA 3NEMA 2NVTH 4A3LG 1YNXA 4JI1L 4GKJL 3CPFA 4JYAL 4JI5Q 1QUQA 1SMXA 4P71A 3CW2C 3PUVA 4BBSG 4JI3Q 4A3JG 2EXDA 1XTDA 2JA7H 3FKIG 2YTXA 1BVSA 1EWIA 1Q1EA 4R4OA 3UE0A 3I4NH 1JJ2A 1QVFA 1TXYA 2WB1G 3WWVA 1Q12A 2Z6KA 4AIMA 1YITA 2UUAQ 4PMWA 3RN5A 1EQQA 1Q1BA 2VQEL 1VQFA 5C44G 2F4VL 4GLVB 2L15A 3U58A 1EQRA 3J7A5 4HJ7A 4LF5L 4KLKA 4GNXB 1SROA 2UUBL 3TS2A 1X6OA 4JI2Q 2ZM6L 1NJIC 1VQ9A 2R7ZH 5C3EH 3KF6A 1HNXL 3ZJYC 4DK3C 1KHIA 2NZHA 4DR1L 3F2BA 1PHJA 5AJ3L 4JI6Q 4A3KG 4LF4L 4OXPA 4JI0Q 3S2HH 1SFOH 2Q2HA 1A62A 4IPHA 4OX9Q 4HIDA 4LF9L 4JV5Q 2UXDQ 4K0KL 4JBJA 2Q2UA 4NXMQ 3PV0A 3FP9A 1VS0A 5LMNL 3BU2A 2N3SA 1VQHA 5K36G 3CPWA 2GVAA 4O0AA 3TRZA 3RLNA 4BY1H 1VQLA 2HQLA 4JI1Q 2JE6I 1QVCA 3RLOA 1M90C 4A3IG 4JYAQ 4WJ3M 2VW9A 4X66Q 3HOVG 4A93H 2HT1A 1SRUA 4BBSH 3CCQA 3CCVA 1VQ7A 4DR4L 1FGUA 4JI3L 2N8NA 3PUZA 5GROA 4TQUS 5FJ8G 1B7YB 1I94L 4GKKL 2B3GA 1HZCA 4KHZA 3W5OA 3G6EA 2YYZA 2LXKA 2PMZE 2K52A 4QQBX 2OTJA 2UUAL 5GQOA 3K8AA 3K80C 4YCWA 4BY1G 1BKBA 3HKZG 4Y7NH 2VQEQ 1R9TH 1WOCA 4NXNQ 1OXSC 2LSSA 1PH9A 2ATWA 2F4VQ 1W3SA 4HJ5A 2DGYA 3HOXH 1EIFA 4YCVA 3E9HA 1VQ4A 2B63H 3NBHB 1TWFH 5IT9c 4DR3L 1PH1A 1RL2A 2R7ZG 2UUBQ 2OTLA 3IRBA 1UWVA 4Y52H 1VQOA 5JEAG 2I0QA 2AHOB 4DV1L 1K0RA 4P73A 3I4OA 2BH8A 5LMUL 4DV2Q 3H3VH 4OO1G 5GAHC 4DV0Q 2BH2A 3EBEA 1HNWQ 3K0XA 4BY7G 1IBLQ 2AWOA 2RCNA 3CCSA 1IYJB 4GN4B 1ASZA 4A3DH 1UE6A 1C0AA 1KXLA 3AFPA 4LWCA 3CF5A 3M85A 4DR7Q 2MQHA 4A4IA 1YBYA 3G48A 5M5WH 4X64L 3UDGA 2ZJRA 3UDFA 1JMCA 2JJQA 1G6PA 2Z6KC 4X65L 4J15A 1HNZQ 3TEHB 2HHHQ 3H3VI 3S15H 1CSQA 3HOWH 4LNQA 4AQYQ 3HKSA 1AE2A 1HZ9A 2K50A 4C3HH 5M3MH 1N33L 5M3FG 3D31A 3M4PA 4AH6A 5IWAQ 4HIMA 5C4XH 5FJ8H 4A3EG 4DR4Q 1G51A 2I5LX 1X55A 2Z0SA 1KL9A 1CKNB 1K8GA 4JI7L 4QL5A 4BA1I 1IZ6A 2VS1A 1TWCH 1NY4A 1YJWA 3ULLA 3M3YH 4B3ML 4YY3L 3BZCA 1B8AA 4FDBA 3OW2A 2QA4A 1Q81C 1PH7A 4B3RQ 1XPRA 1SE8A 4YCUA 4L5QA 4LUVA 2KCMA 2YTVA 4DV5L 4HJ8A 4GNXC 1D8LA 1L1OC 2WB1E 2RF4A 4DV3L 4GOPB 4DV6Q 1IBKQ 2AWNA 4LFBL 4DV7L 1N36L 1YVCA 2IX0A 1K3RA 1YZ6A 3F1ZA 3CCUA 1JE5A 4A3BH 1A8VA 5ELOA 5JEAJ 5J3BA 1X3EA 4MZ9A 1VQGA 3G71A 2E5LL 4LFAQ 4LFCQ 4LUZA 2UUCQ 3S17H 1H95A 4DV0L 1HNWL 3PIOA 1IBLL 5FLXc 4IO9A 3I4MH 2YTYA 3PUYA 1A0IA 3ERSX 1J5EL 1Y1VH 2JA9A 3PIPA 1VQEA 1KRSA 2JQOA 4L5TA 4EX5A 1E1OA 1PYBA 2N49A 4YHHL 1O7IA 4GNXA 3JC66 1XMOQ 4PG3A 3A74A 3HOUH 1VQ8A 4JI4Q 1HNZL 2YU9H 2HIVA 1OXTA 1XNRL 3GTOH 1WCMH 3H0GG 3FHWA 1E1TA 1CUKA 1MKHA 3M7NA 1QVGA 3F8TA 5IY0A 1HH2P 1YHAA 1N33Q 1PH5A 2K5VA 4YWLA 4JOIC 1E3PA 1U0LA 2K4KA 3UDIA 4O2DA 4BBRH 1KD1C 4A3GH 3J81j 1WFQA 1IL2A 1KC8C 1NBWA 1CKMA 2A8VA 2VUMH 4JI7Q 2N78A 3CXCA 5IYDG 3I55A 3HOUG 4MNOA 4LF6Q 1HZAA 1J6QA 4YY3Q 3E9IA 4A3MG 3DLLA 1YJNA 1W2BA 1Q82C 3AEVA 3GTPH 1VQAA 1XMQL 1EIYB 2NVXH 2K5HA 2JK8A 4DV5Q 1K9MC 2RHSB 3HFZB 1VQKA 4X6AH 3T1YL 4XTCS 3T1HL 2KENA 4DV3Q 4LFBQ 1A63A 4IJHA 4ME3A 3BZKA 1N36Q 1VQNA 1L0WA 2D0OA 3GO5A 1K83H 1IXRA 4DR2L 2FXQA 3F2DA 2IT1A 3H15A 2K14A 4GKJQ 1MIUA 3K7AH 1JB7A 2ZJPA 1HZBA 2KHJA 4OONA 3PO3G 5M5YH 1T9HA 2PNHA 2Q2TA 2ASBA 3HOYH 3RZDH 4EQ5A 5IP9H 3M9BA 4POGA 1NMFA 2WFWA 3STBC 2JA5H 5C0XJ 3S14H 4UPAA 3CC4A 1DGSA 2VNUD 3RR5A 2VZAA 1Q46A 2MFIA 3KLWA 3MXNB 1PA6A 2IY5B 2Q2IA 2VY3A 1EUJA 4JBWA 5IYCG 1VCIA 3A5UA 2K75A 1XMOL 1HR0W 4KHPQ 1L2FA 1HR0L 3J80c 4LUOA 2JEBI 4LF5Q 1C7YA 1VQ6A 1BBWA 2IHEA 2XGTA 5HY6A 3GTLH 4JI2L 1C9OA 1OXXK 4X62Q 1KQSA 3SGIA 1HNXQ 3CC2A 1NTGA 1KRTA 3K7UC 3PUWA 3JAMc 1UE1A 1VQJA 5JJLA 5C3EG 4JI6L 3HOZH 4BBRG 4A3LH 4A3BG 3HOWG 2VQFL 4JI0L 1NMGA 3L2PA 3J7ZC 3RZOH 5IYDH 1I6HH 1BBUA 3S24A 2VUMG 4OX9L 2E2HH 1XNQL 1TWHH 5H1SE 1X9NA 3CP0A 1V43A 4R4TA 4A75A 1WJJA 2AKWB 4NXML 1XMQQ 1Y14B 1B70B 2A19A 3UDXA 1TWAH 2R7FA 3ER0A 1K8AC 4OWTB 3E0EA 3I4NG 2UXCL 2RHQB 4P74A 4DAYB 4B3SQ 4A3FH 3CCJA 4QY7A 3GDEA 4DAMA 1IBMQ 3HKZE 2UXBL 2PI2A 2JA6G 1E22A 3UE1A 5DLQE 1X65A 3L0OA 4TVAB 3NENA 1YEZA 4QIWE 5E7NA 4HJ9A 4DR6Q 4APVA 1GO3E 4A76A 2KHIA 4A3KH 2R92H 5C0XG 1N32Q 1HJPA 1M1KC 1I3QH 4LF7L 4OWWB 2D62A 4LW1A 1SR3A 3S2DH 2HIXA 5IE8A 1PYSB 4NXNL 4DR5Q 1CKNA 1Y1VG 2I5MX 2WAQE 1HR0Q 3PF5A 2EIFA 2ZTDA 2UU9L 2JA6H 3FKIH 4IPCA 5GAEC 1RIPA 3HOXG 3F2CA 1S40A 1VQDA 4UY8C 2EQSA 4PZ8A 4ALPA 2MO1A 1QZGA 3TREA 2V1CC 1JJCB 4QJFA 4DPGA 4HIOA 1QZHA 3AYHB 3AFQA 3BJUA 4JCVE 4DV2L 1EFWA 2GVBA 3RNUA 4A3CG 2CCZA 2NZOA 3PO3H 1KAWA 1Y1WG 4IFDJ 4P72A 3KOJA 1PH2A 1PV4A 3GTMH 3S1NH 4JI8Q 3PO2G 2ALYB 5IWAL 2IHFA 4DR1Q 3M4OH 3KFUA 2QGQA 5M5XH 4X64Q 1VQPA 1XPOA 3CAMA 5IP7G 1CKOA 4LF9Q 4UP8A 2HHHL 4DK6C 1E24A 1P16A 4JV5L 5JJIA 1G291 3S1MH 5IYBG 2JA8H 1IBML 1Q7YC 2UXBQ 3CCEA 4AQYL 5LMNQ 5C4XG 3KDFA 1UE5A 1Y1WH 1MJCA 5M3MG 3I56A 2MNAA 1Q8KA 2AMCB 2IX1A 1YIJA 4A3IH 4B3TQ 2DUDA 1I50H 1XJVA 1VQBA 1LYLA 2LXJA 2NVYH 3CQZH 1Q86C 1SN8A 4DKAC 4X66L 2OWOA 4LF7Q 2D0PA 4BY7H 4R1JA 3CC7A 3HOVH 4B3RL 2OQ0A 2JA5G 3CD6A 1VQMA 4DR5L 3CCMA 3OTOL 3I2ZA 3D0FA 3LGJA 2F52A 1I94Q 4GKKQ 5FLMH 1YI2A 1N8RC 1WYDA 2UU9Q 3J81c 4QGUA 3W1BA 4DV6L 4IJLA 3U4ZA 3KDFB 4HJAA 1IBKL 1Z9FA 4GN5A 1V1QA 1D7QA 2R6GA 4YWMA 1TWGH 4BXXH 1S72A 4YWKA 1N34L 1EOVA 3A0JA 4PZ7A 2E5LQ 1U5KA 5GADC 4JBMA 4H02A 2UUCL 1GKHA 4LFAL 1UEBA 1X56A 4IPDA 4DR3Q 3TS0A 2KCTA 3GTJH 1Z47A 5M3FH 4A3CH 3PO2H 5GAGC 3EIVA 3DM3A 1LUZA 4JOIA 4P75A 4JI8L 4IFDG 2R7DA 4DV1Q 1SLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM i;  3PF4 A;  3W1G A;  5LMU Q;  1FVI A;  2ID0 A;  3PCO B;  1ASY A;  2OQK A;  3I7F A;  4YHH Q;  2CFM A;  4HIK A;  1FJG L;  1NE3 A;  3J80 i;  2XTI A;  3PUX A;  1CSP A;  1VQ5 A;  1XPU A;  1WCM G;  3H0G H;  2QEX A;  3S1R H;  4DR7 L;  2NVQ H;  3KYH C;  3RLF A;  3U50 C;  4R4I A;  5LMN W;  4A3F G;  2CKZ B;  4PZ6 A;  1E7Z A;  4POF A;  4X65 Q;  2PQA A;  4DUZ Q;  1KIX A;  2R93 G;  2ZJQ A;  3CMA A;  1PVO A;  3STB D;  4GOP C;  4B3T L;  3ULJ A;  2VL6 A;  4LF8 Q;  1VQI A;  3S1Q H;  5EAY A;  3M4Q A;  4DV4 Q;  1PH8 A;  4KI0 A;  3VDY A;  3Q8D A;  4A3M H;  3CCR A;  4DUY Q;  3I4M G;  5ELN A;  2WP8 J;  3L7Z C;  2Y0S E;  2R92 G;  4JBK A;  3OTO Q;  4JG2 A;  4IOA A;  1L1O A;  4AYB G;  1GVP A;  4L5S A;  2KBN A;  3T1H Q;  5FLM G;  1JJG A;  2BA0 A;  4R4C A;  5IP7 H;  4RMF A;  1EYG A;  3TQY A;  4L5R C;  4AYB E;  4B3M Q;  2I5H A;  4XIG S;  4DR2 Q;  4BXX G;  2R93 H;  3MEF A;  3OYY A;  2GN5 A;  4JC0 A;  3CME A;  2NN6 G;  5IYB H;  2JA8 G;  5BR8 L;  3GTK H;  2ZTE A;  1GD7 A;  2PI2 E;  4OWX B;  1N34 Q;  5JJK A;  5IP9 G;  4A93 G;  3PGZ A;  1LM0 A;  3A5Z B;  3KJP A;  4MTN A;  3HOY G;  2C35 B;  4DV7 Q;  3B6Y A;  5C4J H;  4A3G G;  2Y0S G;  3KF8 B;  1PH3 A;  1WI5 A;  1FL0 A;  2YV5 A;  3GTG H;  3ICE A;  3AQQ A;  1X3G A;  4JI5 L;  2OCE A;  3U4V A;  4LFC L;  4C3J H;  1JT8 A;  2A1A A;  1QUQ B;  4UP9 A;  5HGQ A;  1PFS A;  2CWA A;  4GLX A;  3KJO A;  1FJG Q;  4KHP L;  1S3O A;  1J5E Q;  1L1O B;  4NB3 A;  2JA7 G;  2B63 G;  3J81 i;  4X62 L;  2E2I H;  1OXV A;  4GLA C;  5C44 H;  1MJE A;  2B29 A;  2MO0 A;  3EN2 A;  4DUZ L;  1PH4 A;  4BA2 I;  4JI4 L;  2WAQ G;  3KF6 B;  4IOC A;  2VQF Q;  1XNR Q;  1AH9 A;  3HOZ G;  4LF8 L;  2BA1 A;  1LTL A;  4DV4 L;  2H5X A;  4GS3 A;  2ZM6 Q;  2PQA B;  1YHQ A;  1XNQ Q;  2K5N A;  4IFD I;  3GTQ H;  4GOP A;  4DUY L;  2ES2 A;  4GN3 B;  4A3D G;  2F3I A;  4IPG A;  5AJ3 Q;  4RG1 A;  4LF4 Q;  1PH6 A;  1X3F A;  2JEA I;  3GD7 A;  4NPS A;  2ZTC A;  4WJ4 A;  1V9P A;  2UXC Q;  4R4Q A;  4B3S L;  5IYC H;  1X54 A;  3NEL A;  4C3I H;  1UE7 A;  1N9W A;  3K81 C;  4OO1 I;  2UXD L;  4UP7 A;  4LF6 L;  3RN2 A;  4K0K Q;  4A3J H;  1YJ9 A;  1OTC A;  5C0X I;  3CCL A;  1K73 C;  1N32 L;  2CQO A;  5BR8 Q;  3ULP A;  2E8G A;  3S16 H;  2CWP A;  1YHB A;  4DNI A;  3G4S A;  3PSI A;  4C2M H;  1I5F A;  3T1Y Q;  1P8L A;  2NN6 I;  1OXU A;  2E2J H;  1GM5 A;  4DR6 L;  1AE3 A;  4A3E H;  1VQC A;  3NEM A;  2NVT H;  4A3L G;  1YNX A;  4JI1 L;  4GKJ L;  3CPF A;  4JYA L;  4JI5 Q;  1QUQ A;  1SMX A;  4P71 A;  3CW2 C;  3PUV A;  4BBS G;  4JI3 Q;  4A3J G;  2EXD A;  1XTD A;  2JA7 H;  3FKI G;  2YTX A;  1BVS A;  1EWI A;  1Q1E A;  4R4O A;  3UE0 A;  3I4N H;  1JJ2 A;  1QVF A;  1TXY A;  2WB1 G;  3WWV A;  1Q12 A;  2Z6K A;  4AIM A;  1YIT A;  2UUA Q;  4PMW A;  3RN5 A;  1EQQ A;  1Q1B A;  2VQE L;  1VQF A;  5C44 G;  2F4V L;  4GLV B;  2L15 A;  3U58 A;  1EQR A;  3J7A 5;  4HJ7 A;  4LF5 L;  4KLK A;  4GNX B;  1SRO A;  2UUB L;  3TS2 A;  1X6O A;  4JI2 Q;  2ZM6 L;  1NJI C;  1VQ9 A;  2R7Z H;  5C3E H;  3KF6 A;  1HNX L;  3ZJY C;  4DK3 C;  1KHI A;  2NZH A;  4DR1 L;  3F2B A;  1PHJ A;  5AJ3 L;  4JI6 Q;  4A3K G;  4LF4 L;  4OXP A;  4JI0 Q;  3S2H H;  1SFO H;  2Q2H A;  1A62 A;  4IPH A;  4OX9 Q;  4HID A;  4LF9 L;  4JV5 Q;  2UXD Q;  4K0K L;  4JBJ A;  2Q2U A;  4NXM Q;  3PV0 A;  3FP9 A;  1VS0 A;  5LMN L;  3BU2 A;  2N3S A;  1VQH A;  5K36 G;  3CPW A;  2GVA A;  4O0A A;  3TRZ A;  3RLN A;  4BY1 H;  1VQL A;  2HQL A;  4JI1 Q;  2JE6 I;  1QVC A;  3RLO A;  1M90 C;  4A3I G;  4JYA Q;  4WJ3 M;  2VW9 A;  4X66 Q;  3HOV G;  4A93 H;  2HT1 A;  1SRU A;  4BBS H;  3CCQ A;  3CCV A;  1VQ7 A;  4DR4 L;  1FGU A;  4JI3 L;  2N8N A;  3PUZ A;  5GRO A;  4TQU S;  5FJ8 G;  1B7Y B;  1I94 L;  4GKK L;  2B3G A;  1HZC A;  4KHZ A;  3W5O A;  3G6E A;  2YYZ A;  2LXK A;  2PMZ E;  2K52 A;  4QQB X;  2OTJ A;  2UUA L;  5GQO A;  3K8A A;  3K80 C;  4YCW A;  4BY1 G;  1BKB A;  3HKZ G;  4Y7N H;  2VQE Q;  1R9T H;  1WOC A;  4NXN Q;  1OXS C;  2LSS A;  1PH9 A;  2ATW A;  2F4V Q;  1W3S A;  4HJ5 A;  2DGY A;  3HOX H;  1EIF A;  4YCV A;  3E9H A;  1VQ4 A;  2B63 H;  3NBH B;  1TWF H;  5IT9 c;  4DR3 L;  1PH1 A;  1RL2 A;  2R7Z G;  2UUB Q;  2OTL A;  3IRB A;  1UWV A;  4Y52 H;  1VQO A;  5JEA G;  2I0Q A;  2AHO B;  4DV1 L;  1K0R A;  4P73 A;  3I4O A;  2BH8 A;  5LMU L;  4DV2 Q;  3H3V H;  4OO1 G;  5GAH C;  4DV0 Q;  2BH2 A;  3EBE A;  1HNW Q;  3K0X A;  4BY7 G;  1IBL Q;  2AWO A;  2RCN A;  3CCS A;  1IYJ B;  4GN4 B;  1ASZ A;  4A3D H;  1UE6 A;  1C0A A;  1KXL A;  3AFP A;  4LWC A;  3CF5 A;  3M85 A;  4DR7 Q;  2MQH A;  4A4I A;  1YBY A;  3G48 A;  5M5W H;  4X64 L;  3UDG A;  2ZJR A;  3UDF A;  1JMC A;  2JJQ A;  1G6P A;  2Z6K C;  4X65 L;  4J15 A;  1HNZ Q;  3TEH B;  2HHH Q;  3H3V I;  3S15 H;  1CSQ A;  3HOW H;  4LNQ A;  4AQY Q;  3HKS A;  1AE2 A;  1HZ9 A;  2K50 A;  4C3H H;  5M3M H;  1N33 L;  5M3F G;  3D31 A;  3M4P A;  4AH6 A;  5IWA Q;  4HIM A;  5C4X H;  5FJ8 H;  4A3E G;  4DR4 Q;  1G51 A;  2I5L X;  1X55 A;  2Z0S A;  1KL9 A;  1CKN B;  1K8G A;  4JI7 L;  4QL5 A;  4BA1 I;  1IZ6 A;  2VS1 A;  1TWC H;  1NY4 A;  1YJW A;  3ULL A;  3M3Y H;  4B3M L;  4YY3 L;  3BZC A;  1B8A A;  4FDB A;  3OW2 A;  2QA4 A;  1Q81 C;  1PH7 A;  4B3R Q;  1XPR A;  1SE8 A;  4YCU A;  4L5Q A;  4LUV A;  2KCM A;  2YTV A;  4DV5 L;  4HJ8 A;  4GNX C;  1D8L A;  1L1O C;  2WB1 E;  2RF4 A;  4DV3 L;  4GOP B;  4DV6 Q;  1IBK Q;  2AWN A;  4LFB L;  4DV7 L;  1N36 L;  1YVC A;  2IX0 A;  1K3R A;  1YZ6 A;  3F1Z A;  3CCU A;  1JE5 A;  4A3B H;  1A8V A;  5ELO A;  5JEA J;  5J3B A;  1X3E A;  4MZ9 A;  1VQG A;  3G71 A;  2E5L L;  4LFA Q;  4LFC Q;  4LUZ A;  2UUC Q;  3S17 H;  1H95 A;  4DV0 L;  1HNW L;  3PIO A;  1IBL L;  5FLX c;  4IO9 A;  3I4M H;  2YTY A;  3PUY A;  1A0I A;  3ERS X;  1J5E L;  1Y1V H;  2JA9 A;  3PIP A;  1VQE A;  1KRS A;  2JQO A;  4L5T A;  4EX5 A;  1E1O A;  1PYB A;  2N49 A;  4YHH L;  1O7I A;  4GNX A;  3JC6 6;  1XMO Q;  4PG3 A;  3A74 A;  3HOU H;  1VQ8 A;  4JI4 Q;  1HNZ L;  2YU9 H;  2HIV A;  1OXT A;  1XNR L;  3GTO H;  1WCM H;  3H0G G;  3FHW A;  1E1T A;  1CUK A;  1MKH A;  3M7N A;  1QVG A;  3F8T A;  5IY0 A;  1HH2 P;  1YHA A;  1N33 Q;  1PH5 A;  2K5V A;  4YWL A;  4JOI C;  1E3P A;  1U0L A;  2K4K A;  3UDI A;  4O2D A;  4BBR H;  1KD1 C;  4A3G H;  3J81 j;  1WFQ A;  1IL2 A;  1KC8 C;  1NBW A;  1CKM A;  2A8V A;  2VUM H;  4JI7 Q;  2N78 A;  3CXC A;  5IYD G;  3I55 A;  3HOU G;  4MNO A;  4LF6 Q;  1HZA A;  1J6Q A;  4YY3 Q;  3E9I A;  4A3M G;  3DLL A;  1YJN A;  1W2B A;  1Q82 C;  3AEV A;  3GTP H;  1VQA A;  1XMQ L;  1EIY B;  2NVX H;  2K5H A;  2JK8 A;  4DV5 Q;  1K9M C;  2RHS B;  3HFZ B;  1VQK A;  4X6A H;  3T1Y L;  4XTC S;  3T1H L;  2KEN A;  4DV3 Q;  4LFB Q;  1A63 A;  4IJH A;  4ME3 A;  3BZK A;  1N36 Q;  1VQN A;  1L0W A;  2D0O A;  3GO5 A;  1K83 H;  1IXR A;  4DR2 L;  2FXQ A;  3F2D A;  2IT1 A;  3H15 A;  2K14 A;  4GKJ Q;  1MIU A;  3K7A H;  1JB7 A;  2ZJP A;  1HZB A;  2KHJ A;  4OON A;  3PO3 G;  5M5Y H;  1T9H A;  2PNH A;  2Q2T A;  2ASB A;  3HOY H;  3RZD H;  4EQ5 A;  5IP9 H;  3M9B A;  4POG A;  1NMF A;  2WFW A;  3STB C;  2JA5 H;  5C0X J;  3S14 H;  4UPA A;  3CC4 A;  1DGS A;  2VNU D;  3RR5 A;  2VZA A;  1Q46 A;  2MFI A;  3KLW A;  3MXN B;  1PA6 A;  2IY5 B;  2Q2I A;  2VY3 A;  1EUJ A;  4JBW A;  5IYC G;  1VCI A;  3A5U A;  2K75 A;  1XMO L;  1HR0 W;  4KHP Q;  1L2F A;  1HR0 L;  3J80 c;  4LUO A;  2JEB I;  4LF5 Q;  1C7Y A;  1VQ6 A;  1BBW A;  2IHE A;  2XGT A;  5HY6 A;  3GTL H;  4JI2 L;  1C9O A;  1OXX K;  4X62 Q;  1KQS A;  3SGI A;  1HNX Q;  3CC2 A;  1NTG A;  1KRT A;  3K7U C;  3PUW A;  3JAM c;  1UE1 A;  1VQJ A;  5JJL A;  5C3E G;  4JI6 L;  3HOZ H;  4BBR G;  4A3L H;  4A3B G;  3HOW G;  2VQF L;  4JI0 L;  1NMG A;  3L2P A;  3J7Z C;  3RZO H;  5IYD H;  1I6H H;  1BBU A;  3S24 A;  2VUM G;  4OX9 L;  2E2H H;  1XNQ L;  1TWH H;  5H1S E;  1X9N A;  3CP0 A;  1V43 A;  4R4T A;  4A75 A;  1WJJ A;  2AKW B;  4NXM L;  1XMQ Q;  1Y14 B;  1B70 B;  2A19 A;  3UDX A;  1TWA H;  2R7F A;  3ER0 A;  1K8A C;  4OWT B;  3E0E A;  3I4N G;  2UXC L;  2RHQ B;  4P74 A;  4DAY B;  4B3S Q;  4A3F H;  3CCJ A;  4QY7 A;  3GDE A;  4DAM A;  1IBM Q;  3HKZ E;  2UXB L;  2PI2 A;  2JA6 G;  1E22 A;  3UE1 A;  5DLQ E;  1X65 A;  3L0O A;  4TVA B;  3NEN A;  1YEZ A;  4QIW E;  5E7N A;  4HJ9 A;  4DR6 Q;  4APV A;  1GO3 E;  4A76 A;  2KHI A;  4A3K H;  2R92 H;  5C0X G;  1N32 Q;  1HJP A;  1M1K C;  1I3Q H;  4LF7 L;  4OWW B;  2D62 A;  4LW1 A;  1SR3 A;  3S2D H;  2HIX A;  5IE8 A;  1PYS B;  4NXN L;  4DR5 Q;  1CKN A;  1Y1V G;  2I5M X;  2WAQ E;  1HR0 Q;  3PF5 A;  2EIF A;  2ZTD A;  2UU9 L;  2JA6 H;  3FKI H;  4IPC A;  5GAE C;  1RIP A;  3HOX G;  3F2C A;  1S40 A;  1VQD A;  4UY8 C;  2EQS A;  4PZ8 A;  4ALP A;  2MO1 A;  1QZG A;  3TRE A;  2V1C C;  1JJC B;  4QJF A;  4DPG A;  4HIO A;  1QZH A;  3AYH B;  3AFQ A;  3BJU A;  4JCV E;  4DV2 L;  1EFW A;  2GVB A;  3RNU A;  4A3C G;  2CCZ A;  2NZO A;  3PO3 H;  1KAW A;  1Y1W G;  4IFD J;  4P72 A;  3KOJ A;  1PH2 A;  1PV4 A;  3GTM H;  3S1N H;  4JI8 Q;  3PO2 G;  2ALY B;  5IWA L;  2IHF A;  4DR1 Q;  3M4O H;  3KFU A;  2QGQ A;  5M5X H;  4X64 Q;  1VQP A;  1XPO A;  3CAM A;  5IP7 G;  1CKO A;  4LF9 Q;  4UP8 A;  2HHH L;  4DK6 C;  1E24 A;  1P16 A;  4JV5 L;  5JJI A;  1G29 1;  3S1M H;  5IYB G;  2JA8 H;  1IBM L;  1Q7Y C;  2UXB Q;  3CCE A;  4AQY L;  5LMN Q;  5C4X G;  3KDF A;  1UE5 A;  1Y1W H;  1MJC A;  5M3M G;  3I56 A;  2MNA A;  1Q8K A;  2AMC B;  2IX1 A;  1YIJ A;  4A3I H;  4B3T Q;  2DUD A;  1I50 H;  1XJV A;  1VQB A;  1LYL A;  2LXJ A;  2NVY H;  3CQZ H;  1Q86 C;  1SN8 A;  4DKA C;  4X66 L;  2OWO A;  4LF7 Q;  2D0P A;  4BY7 H;  4R1J A;  3CC7 A;  3HOV H;  4B3R L;  2OQ0 A;  2JA5 G;  3CD6 A;  1VQM A;  4DR5 L;  3CCM A;  3OTO L;  3I2Z A;  3D0F A;  3LGJ A;  2F52 A;  1I94 Q;  4GKK Q;  5FLM H;  1YI2 A;  1N8R C;  1WYD A;  2UU9 Q;  3J81 c;  4QGU A;  3W1B A;  4DV6 L;  4IJL A;  3U4Z A;  3KDF B;  4HJA A;  1IBK L;  1Z9F A;  4GN5 A;  1V1Q A;  1D7Q A;  2R6G A;  4YWM A;  1TWG H;  4BXX H;  1S72 A;  4YWK A;  1N34 L;  1EOV A;  3A0J A;  4PZ7 A;  2E5L Q;  1U5K A;  5GAD C;  4JBM A;  4H02 A;  2UUC L;  1GKH A;  4LFA L;  1UEB A;  1X56 A;  4IPD A;  4DR3 Q;  3TS0 A;  2KCT A;  3GTJ H;  1Z47 A;  5M3F H;  4A3C H;  3PO2 H;  5GAG C;  3EIV A;  3DM3 A;  1LUZ A;  4JOI A;  4P75 A;  4JI8 L;  4IFD G;  2R7D A;  4DV1 Q;  1SLJ A; 
#chains in the Genus database with same CATH topology
 4C3J G;  3W1G A;  5LMU Q;  4A3J B;  2ID0 A;  3I7F A;  1BBX C;  1ZEQ X;  4HMI A;  4QUC A;  2PW5 A;  4K8I A;  5I9O A;  3H0G H;  1EU3 A;  2QEX A;  3S1R H;  2NVQ H;  3RLF A;  3VA5 A;  4POF A;  4X65 Q;  1DD2 A;  4DUZ Q;  1KIX A;  1SNP A;  4WRD A;  1SSO A;  2VL6 A;  3ULJ A;  4LF8 Q;  1VQI A;  4KY5 A;  3OSO A;  3VDY A;  4HSV A;  4XXE A;  2L0C A;  3CCR A;  3I4M G;  2WP8 J;  3L7Z C;  3S1N B;  2PZT A;  2Y0S E;  3BZD B;  4P2C B;  3OTO Q;  3FEW X;  4K6D A;  4AYB G;  4CJ2 C;  1WTH A;  3NE5 B;  1KLG D;  4R4C A;  1EYG A;  3NBI A;  2R93 H;  1GUW A;  4XIG S;  5IYB H;  2JA8 G;  3HRZ C;  3GTK H;  5JJK A;  1GD7 A;  1B53 A;  4OWX B;  1D6E C;  3JAM E;  1JOK A;  4A93 G;  3FKI B;  3A5Z B;  3Q6S A;  1WTQ A;  5BN4 A;  5FO8 B;  4MTN A;  1YNN D;  2F0M A;  3B6Y A;  4A3G G;  2MHV A;  3NUC A;  4KMU C;  1FL0 A;  3P20 A;  1B44 D;  2EYM A;  4CHT B;  3GTG H;  2DY8 A;  1PZI D;  1JWU D;  1JT8 A;  2NZ1 D;  1JE4 A;  2IWH A;  5HGQ A;  4QF4 A;  3KJO A;  4KY6 A;  2I46 A;  4JPB W;  3DHQ A;  3J81 i;  3AU7 A;  5EJW A;  4F8M A;  2KCN A;  5C44 H;  2MO0 A;  4J1M A;  3A8K E;  2E74 C;  5A2Q E;  2WAQ B;  2EDG A;  4IOC A;  2VQF Q;  1LTL A;  2A68 D;  2BOS A;  2ZM6 Q;  4CDD C;  4GOP A;  4A3D B;  2ES2 A;  4PNY A;  1AEX A;  2F3I A;  4IPG A;  4LF4 Q;  2AUJ D;  1X3F A;  4U67 3;  2JEA I;  5IGE A;  2ZTC A;  4WJ4 A;  1V9P A;  4R4Q A;  4IUU A;  5IYC H;  3NEL A;  1UE7 A;  3K81 C;  4UP7 A;  2Y0S B;  1OTC A;  3IKJ A;  3AB9 A;  3PMF A;  1N32 L;  5BR8 Q;  3S16 H;  2CWP A;  4DNI A;  2PMZ B;  1A2T A;  2E2J H;  4C3H B;  4Y7N B;  1VQC A;  2NVT H;  2B2W A;  4JI1 L;  1NSN S;  3CPF A;  4JYA L;  4JI5 Q;  2JA8 B;  1MI2 A;  4L63 B;  1SMX A;  4P71 A;  2XSC A;  3EA6 A;  2K6A A;  2ZXO A;  1K0S A;  2L1B A;  5JAV A;  4A3J G;  4DN4 M;  1EWI A;  1Q1E A;  1TXY A;  4PMC A;  5J1Z A;  3K5N A;  2WB1 G;  4PMW A;  5ELB A;  4TSS A;  4LMQ D;  2A5H A;  3EJI A;  4ZQ3 A;  4CJ1 B;  3MXP A;  3J7A 5;  4HJ7 A;  3G7L A;  5FKA C;  1X6O A;  1NJI C;  1VQ9 A;  1F2M A;  1Z7T A;  2D9U A;  3OWE B;  1VF5 C;  3ZJY C;  2B2Y A;  2YU9 B;  1JOR A;  5KRU A;  1EWC A;  4IPH A;  4LF9 L;  4RGM A;  2UXD Q;  4IUR A;  5LL6 S;  4JBJ A;  1I4X A;  3MTS A;  2F0L A;  1GJX A;  3P75 A;  1DON A;  4ZUI A;  5CGK A;  4L6T B;  2GVA A;  3I4L A;  2WV6 D;  2HQL A;  4X3T A;  4YIJ A;  4A3I G;  2SNM A;  4WJ3 M;  2VW9 A;  4X66 Q;  4A93 H;  1C4Q A;  2QEJ C;  3H3V C;  4GKK L;  2IL8 A;  2B3G A;  1HZC A;  4KHZ A;  1TII D;  1I4R A;  3W5O A;  2YYZ A;  3S1Q B;  4XT1 B;  2DJF C;  4O42 A;  3SHL A;  3K8A A;  4YCW A;  2VQE Q;  1WOC A;  4MTK A;  2ATW A;  1PH9 A;  3NBH B;  1TWF H;  4DR3 L;  3IRB A;  1UWV A;  4ZCK A;  5DEH A;  5IT9 L;  2I0Q A;  4UHV A;  2EYH A;  3R93 A;  5LMU L;  4DV2 Q;  2PZW A;  5GAH C;  5ISR A;  3K0X A;  3CCS A;  3GTQ B;  1CM9 A;  4HAE A;  3G48 A;  1G6P A;  2ZJR A;  1ENF A;  2M9V A;  4RAU C;  3UDF A;  2E2H B;  1E0B A;  3CU7 A;  1Y8O B;  3S15 H;  1TWG B;  3QOJ A;  1CSQ A;  3HOW H;  1B1Z A;  4RKL A;  4ZK9 B;  4FXK C;  4AH6 A;  3HKZ B;  4XYO A;  2I5L X;  3NTI A;  2G9H D;  4QMG A;  1K8G A;  1KDA A;  4JI7 L;  1STN A;  2NBF A;  4A3I B;  4YY3 L;  1PH7 A;  4B3R Q;  3OW2 A;  1BCP F;  1LTB D;  2L11 A;  1CQV A;  1XPR A;  4HTH A;  5DNF A;  4LUV A;  2KCM A;  1A2U A;  4GNX C;  2O5I C;  1G2T A;  4OIK A;  4DV6 Q;  4DV7 L;  1YVC A;  3KLR A;  1K3R A;  2F0W A;  5FLX L;  1VQG A;  3S17 H;  1ENA A;  4LFA Q;  4LFC Q;  2UUC Q;  1H95 A;  5L37 A;  4WJW A;  3PIO A;  3HGB A;  2K05 A;  1AFP A;  4IO9 A;  3I4M H;  2K1B A;  4TKO B;  5JVG 3;  2JA9 A;  3T16 A;  1G91 A;  3X3M A;  2QDL A;  3E3X A;  3PO3 B;  2E76 C;  4L5T A;  4RHR A;  4TRD A;  1SDF A;  4A3B B;  3S2H B;  4JI4 Q;  1CUK A;  1QVG A;  5IY0 A;  1YHA A;  3PQI A;  4OEM B;  2H1E A;  1PH5 A;  3J80 E;  2K4K A;  4A3G H;  4G7Z C;  1K8M A;  3D8G A;  1CKM A;  3SVM A;  1EZ6 A;  2EY1 A;  2N78 A;  3CXC A;  1PRT C;  2EJG C;  3HOU G;  1CTM A;  4LF6 Q;  1HZA A;  1YJN A;  1Q82 C;  3SK4 A;  3DLL A;  2J0T D;  2EXZ A;  2NVX H;  1IKM A;  3GTJ B;  2K5H A;  4G4K A;  4XTC S;  3W3A A;  4DV3 Q;  1A63 A;  4IJH A;  4ME3 A;  3BZK A;  1SBB B;  3GO5 A;  4DR2 L;  2IT1 A;  3H15 A;  3NBH A;  4OON A;  3QOL A;  3PO3 G;  3KK7 A;  1F9P A;  1T9H A;  2PNH A;  1QNK A;  3RZD H;  1JOQ A;  4ZAI A;  5C0X J;  4FF3 A;  1SYG A;  2BE5 D;  1DCZ A;  2Q2I A;  4C3I B;  4C3I G;  3A5U A;  3M3Y B;  3H6M A;  3I90 A;  4CGY B;  4KHP Q;  3BDL A;  3C1E A;  1VQ6 A;  1C7Y A;  2WKD A;  5HY6 A;  2CW0 C;  5C6A A;  5TSS A;  3S16 B;  3MWY W;  1HNX Q;  3K7U C;  3NQI A;  3JAM c;  5C3E G;  3KLS A;  4JI6 L;  4A3B G;  2Z4I A;  3A8J E;  3HOW G;  4JI0 L;  4ID6 A;  3DWQ A;  3J7Z C;  2CQA A;  1I6H H;  1BBU A;  1CHP D;  4K5W A;  3SDZ A;  2E2I B;  5H1S E;  4R4T A;  4A75 A;  2XWJ B;  1WJJ A;  3I70 A;  3I4N G;  2RHQ B;  4B3S Q;  3K7A B;  3D3R A;  4DAM A;  1E2V A;  1IBM Q;  3SEB A;  1LTT D;  1B9N A;  3UE1 A;  1EQT A;  1X65 A;  2WAC A;  1XYI A;  4HJ9 A;  1QIL A;  2MJ8 A;  2MP1 A;  2SNS A;  4H44 C;  2KHI A;  4A3K H;  2XVS A;  1TQO A;  1HJP A;  3ND8 A;  4LW1 A;  3CRK C;  1PYS B;  3C1F A;  1EY0 A;  2F0P A;  2I5M X;  1IYU A;  1BQQ T;  3FKI H;  1A3V A;  4IPC A;  5GAE C;  3HOX G;  3F2C A;  2EQS A;  4PZ8 A;  1QZG A;  1DOM A;  3V96 A;  1F2Z A;  2PO4 A;  1JJC B;  4DPG A;  4B08 A;  3RNU A;  4F87 A;  1KAW A;  4ZRZ A;  4IFD J;  3KOJ A;  2F0S A;  1PV4 A;  3S1N H;  3N6R A;  1QG7 A;  2IJ0 A;  4JI8 Q;  3J7A F;  1H9R A;  3KFU A;  4ZKB B;  1I6H B;  4KHV A;  1HUM A;  3CAM A;  4RCO A;  5NUC A;  1SFO B;  4JV5 L;  5JJI A;  4OEL B;  4OL7 A;  1IBM L;  4RWS C;  3CCE A;  5LMN Q;  5J22 A;  5C4X G;  3S1R B;  1UE5 A;  1BCP D;  3I56 A;  2MNA A;  2AMC B;  5G3L D;  1GUO A;  2F0D A;  4B3T Q;  1PDQ A;  3NXW A;  1Q86 C;  1XJV A;  2NVY H;  1U4P A;  1ICF B;  2A73 B;  1SN8 A;  2D5D A;  5CYU A;  1WTP A;  1IHZ A;  4R1J A;  4A3F B;  2E75 C;  2QW7 A;  2OQ0 A;  3CD6 A;  1ML0 D;  3CCM A;  4HSP A;  2F52 A;  3C46 A;  1YI2 A;  1WYD A;  4DV6 L;  3KDF B;  1KDB A;  1D7Q A;  3E5S A;  2B2V C;  1F9Q A;  3PIO 3;  1GXD C;  1RHP A;  1U5K A;  4LFA L;  2ZXP A;  1UEB A;  4IPD A;  3GTJ H;  4J6H A;  2NVX B;  2H4O A;  5CMD A;  1LTA D;  5J39 A;  3EIV A;  1PMR A;  5KEE A;  3HOX B;  4P75 A;  2A6E D;  4WFN 3;  1EIG A;  3BVM A;  2OQK A;  2FIN B;  3K5L A;  1WTX A;  4A3G B;  4K14 A;  2XTI A;  1CSP A;  1XPU A;  4DR7 L;  1HTL D;  3ERO A;  2ZJQ A;  5KYI A;  4GOP C;  1FNV A;  4DV4 Q;  2L4N A;  3MVV A;  4KI0 A;  4A3M H;  1GUN A;  4JW0 A;  1L0Y B;  1SYE A;  1SE2 A;  4DUY Q;  5ELN A;  4NW2 A;  3I4M B;  2A6H C;  1KAA A;  3L3O C;  4AYB B;  4IOA A;  1WTO A;  5EKK A;  4L5S A;  1I4H A;  2KBN A;  5FLM G;  5IP7 H;  4RMF A;  1TY2 A;  2I5H A;  2K7V A;  1JIC A;  3OYY A;  2GN5 A;  2DNC A;  4JC0 A;  4V0B A;  3CME A;  1O7Y A;  5BR8 L;  2RDG A;  2PI2 E;  2ZTE A;  4JVZ A;  1EEI D;  4KKT A;  3MXG A;  5IP9 G;  3PGZ A;  1LM0 A;  2LFN A;  2Y0S G;  3U9O A;  3ICE A;  1X3G A;  3VA7 A;  3NTK A;  4LFC L;  3MZ5 A;  2RA4 A;  1LT4 D;  4UP9 A;  4KHP L;  1FJG Q;  1GUT A;  1XXG A;  4NB3 A;  1ILQ A;  4DF7 A;  2JA7 B;  3LX0 A;  2B63 G;  1J8I A;  3KBX A;  2E2I H;  3L9A X;  1OXV A;  4GLA C;  1K3B C;  1MJE A;  1CFM A;  1U9R A;  1PH4 A;  3KF6 B;  1XNR Q;  1AH9 A;  3HOZ G;  2LKV A;  2KQ3 A;  1F77 A;  4LF8 L;  2BA1 A;  4DV4 L;  2H5X A;  4MHE A;  3GTQ H;  4FO2 A;  2B8F A;  4DUY L;  1NCV A;  4A3D G;  1H9J A;  4BY7 B;  1I4G A;  3GD7 A;  5KYL A;  5CV5 A;  2UXC Q;  4I7Z C;  4B3S L;  4C3I H;  1N9W A;  2AQ1 B;  5EPL A;  1LTR D;  1QWY A;  1GUG A;  2Q8R E;  2A69 D;  1RTN A;  1V1P B;  3BDC A;  1DYQ A;  4KN4 C;  1SAP A;  1QUQ A;  3DWP A;  2KED A;  1CA6 A;  1CZW A;  3J7Y W;  1PZJ D;  1BVS A;  3I4N H;  2F0T A;  1FD7 D;  1PTO C;  3K0Y A;  1WVL A;  3WWV A;  2UUA Q;  2L12 A;  1Q1B A;  5EGT A;  2VQE L;  2NVY B;  4ZKC B;  4X3U A;  1S5D D;  4GLV B;  1B4O A;  1R4Q B;  2WKC A;  3U58 A;  4GNX B;  3TS2 A;  2R7Z H;  3ITP A;  1RTO A;  3BDO A;  1KHI A;  1PHJ A;  4LF4 L;  1KTK A;  4A3K G;  5ELE A;  4OXP A;  4JI0 Q;  3S2H H;  4OO1 H;  1KNA A;  2A6H D;  1SFO H;  2R92 B;  1A62 A;  4OX9 Q;  4OHJ A;  4JV5 Q;  1BXT A;  4PMB A;  3NWS A;  4NXM Q;  3HEJ A;  1Z6H A;  1LLR D;  3PV0 A;  5LMN L;  2GA4 B;  4HCS A;  3BU2 A;  2N3S A;  3OPO A;  4XQQ A;  3CPW A;  5K36 G;  4BBS B;  3RLN A;  3S17 B;  1LTI D;  5IGB A;  3RLO A;  1M90 C;  1W6K A;  3HOV G;  2AQ3 B;  1SRU A;  4CDC C;  1ET9 A;  4JI3 L;  2N8N A;  3PUZ A;  1B7Y B;  1I94 L;  4MN3 A;  4RGN A;  2A6E C;  3G6E A;  2OTJ A;  2KJX A;  4BY1 G;  1BKB A;  3HKZ G;  4Y7N H;  4ZLT F;  1V1P A;  4A3K B;  5LHY 1;  2XRQ D;  2B63 H;  5IT9 c;  2LY7 A;  1STA A;  1PH1 A;  1AZP A;  2R7Z G;  2UUB Q;  4X3S A;  3MFY A;  4Y52 H;  4CBV A;  2Z8L A;  1VQO A;  4KK7 A;  3OHX C;  1EL0 A;  4M1U B;  4KJN A;  4OO1 G;  3S15 B;  1CI3 M;  4DV0 Q;  1HNW Q;  3EBE A;  4BY7 G;  3Q0A A;  4LJZ C;  2RCN A;  4DAY A;  1IYJ B;  1ASZ A;  2NTT A;  4CKB A;  4A3D H;  1KXL A;  3CF5 A;  1JB3 A;  1YBY A;  1O7L A;  3HOV B;  1D2B A;  5K36 H;  2Z6K C;  1TS4 A;  2HHH Q;  4S3S A;  4LK1 C;  2A74 C;  1NAP A;  4QUF A;  3HKS A;  2K50 A;  3N52 A;  5M3M H;  5IGG A;  3M4P A;  5M3F G;  1SND A;  4DR4 Q;  4KD3 A;  4NKL A;  1I4Q A;  1HUN A;  1U4M A;  1X55 A;  1CKN B;  2L9H A;  4BA1 I;  1IZ6 A;  2VS1 A;  5CV7 A;  4XDX A;  1YJW A;  1MBY A;  3M3Y H;  1SYF A;  2EOT A;  4B3M L;  3BZC A;  2WB1 B;  1TVX A;  3MFG A;  5IGC A;  4L5Q A;  4DV5 L;  1D5Z C;  3SK6 A;  3GTM B;  1D8L A;  4LFB L;  1DXM A;  2AWN A;  2RDF A;  3S1M B;  2RVL A;  3F1Z A;  4NP5 A;  3CCU A;  1BCP C;  5F2D A;  5ELO A;  3G71 A;  2B8G A;  2Q8I B;  5C4Z A;  4M8A A;  5FLX c;  1QCB D;  4XQJ A;  2YTY A;  3PUY A;  3PIP A;  2ZXR A;  1BO0 A;  1FGB D;  2JXM B;  1Q3L A;  2JQO A;  1HPC A;  2G9D A;  2JN4 A;  1K28 A;  1XMO Q;  3JC6 6;  2EE1 A;  1VQ8 A;  1HNZ L;  2YU9 H;  1E2Z A;  1XNR L;  1QNU A;  1WCM H;  2NN6 H;  1MKH A;  2NVQ B;  3K59 A;  3M7N A;  2Z1C A;  4KKU A;  3F8T A;  2F0J A;  1N33 Q;  2K5V A;  1U0L A;  1EY4 A;  3BYT B;  4O2D A;  5CV8 A;  3UDI A;  1KD1 C;  3J81 j;  4DU9 A;  4K5V A;  1I6V C;  1V8Q A;  2EYF A;  3GTP H;  2KVM A;  3AEV A;  5C3E B;  3OW7 A;  1AW7 A;  1H9K A;  4G57 A;  1K9M C;  2XRS D;  4X6A H;  3T1Y L;  2K5D A;  1MSH A;  2F3W A;  4J8Q A;  2KEN A;  3T1H L;  4LFB Q;  1VQN A;  1N36 Q;  1L0W A;  4B9X A;  1YNJ C;  3A7L A;  2KHJ A;  2F3V A;  5M5Y H;  2Q2T A;  3HOY H;  1S5B D;  3M9B A;  4POG A;  3GTL B;  1NMF A;  2WFW A;  2F03 A;  2JA5 H;  3I73 A;  3S14 H;  3CC4 A;  3RR5 A;  2VZA A;  1Q46 A;  2MFI A;  3KLW A;  4ULL A;  2F0E A;  3S9W A;  2IY5 B;  4QIW B;  2K75 A;  5C3X A;  1XMO L;  1HR0 W;  1HR0 L;  3NPP A;  4ZUJ A;  3J80 c;  2JEB I;  4HCE A;  4JI2 L;  1C9O A;  1OXX K;  4X62 Q;  3CC2 A;  5JJL A;  1VQJ A;  2KA7 A;  3HOW B;  4A3L H;  3L2P A;  3T51 B;  2VUM G;  4OX9 L;  2E2H H;  1XNQ L;  5IOC A;  4H0L C;  1X9N A;  1V43 A;  5D65 A;  1B2T A;  3HG9 A;  1TWA H;  1HHV A;  3BVZ A;  3E0E A;  2F1M A;  2UXC L;  1STB A;  4P74 A;  2Z9H A;  3H94 A;  3CCJ A;  2BCO A;  3GDE A;  3GTG B;  2PI2 A;  2JA6 G;  1PTO F;  5KND A;  2JA6 B;  3L0O A;  1SXT A;  4TVA B;  1JWS D;  5E7N A;  4RHS A;  4APV A;  2R92 H;  5C0X G;  2D62 A;  2RSN A;  2QDB A;  2X6G A;  4NXN L;  1CKN A;  1Y1V B;  4KV6 A;  2QCP X;  2UU9 L;  4K8J A;  1S40 A;  3VR6 A;  4F7X A;  2K5W A;  1VQD A;  1F2L A;  1CZG A;  5A35 A;  3TRE A;  4V19 0;  1QZH A;  4HIO A;  3AYH B;  3FDT A;  1EFW A;  3I4N B;  1TT2 A;  1TU2 B;  1JCK B;  3QIA A;  4B9W A;  5EPK A;  1TWH B;  2ALY B;  1ET6 A;  4DR1 Q;  1HXY D;  2QGQ A;  3TBI B;  2JSO A;  4KY7 A;  4X64 Q;  1XPO A;  2O5J C;  5CV6 A;  2Z6B A;  1CKO A;  4LF9 Q;  1D5X C;  4Q0F A;  5FO9 B;  1LV9 A;  1G29 1;  2EY6 A;  5IYB G;  2JA8 H;  4OGQ C;  3S1M H;  2UXB Q;  4AQY L;  1SEB D;  4XQN A;  5C4X B;  1UAP A;  1Y1W H;  1MJC A;  3GP7 A;  1UEA B;  1YIJ A;  2J7Z A;  4R9W A;  2LXJ A;  1LYL A;  5EBD A;  1B3Q A;  3SK8 A;  4X66 L;  4BY7 H;  3CC7 A;  5BN5 A;  2JA5 G;  4C1N K;  3E0J A;  3T13 A;  1EYA A;  2M2L A;  1I94 Q;  5FLM H;  2UU9 Q;  2PNR C;  4IQZ A;  1SNC A;  5E4X A;  3R8B A;  3W1B A;  1IBK L;  4GN5 A;  1KDC A;  2R6G A;  1EU4 A;  4YWM A;  1UNS A;  1D5M C;  4BXX H;  1EOV A;  3A0J A;  4PZ7 A;  2NVT B;  5HUR A;  5EKI A;  4A3C H;  2KCT A;  5M3F H;  1Z47 A;  4EQP A;  3DM3 A;  4RA8 A;  4C56 C;  1EOT A;  2K5Q A;  1FVI A;  1LT6 D;  1FYC A;  1VMC A;  3PCO B;  1ESR A;  1A15 A;  1FJG L;  4EQO A;  3J80 i;  1VDZ A;  1VQ5 A;  1D1I A;  2R3Z A;  2Q8T A;  1HQR D;  3DMU A;  4R4I A;  1WD1 A;  1E7Z A;  2WII B;  2R93 G;  3CMA A;  1PVO A;  5IIF A;  3M4Q A;  3MA2 B;  4IZ8 A;  5CV4 A;  1PH8 A;  4DXG A;  3CKI B;  2MUY A;  1C48 A;  4ZYS A;  1PYW D;  2R92 G;  4JG2 A;  1L1O A;  1GVP A;  3T1H Q;  2F0N A;  2BA0 A;  2C9O A;  2F0I A;  3TQY A;  4AYB E;  4CKC A;  3J80 L;  4DR2 Q;  4B3M Q;  4BXX G;  3MEF A;  1VF7 A;  2NN6 G;  1HA6 A;  1N34 Q;  4KJO A;  3FVQ A;  4IN3 A;  1PRT F;  3KJP A;  1A3T A;  4CJ0 B;  2C35 B;  4DV7 Q;  2KUM A;  3KF8 B;  1PH3 A;  1WI5 A;  2YV5 A;  3S2D B;  3MHB A;  3AQQ A;  1WCM B;  4IAL A;  1CQF A;  2OCE A;  3U4V A;  4HN7 A;  3HZX A;  2A1A A;  3M4Y A;  1QUQ B;  1F9R A;  4GLX A;  2EJF C;  1H9M A;  2CWA A;  3GQB A;  1J5E Q;  3CHB D;  3IFD A;  4EGV A;  4NDX A;  4X62 L;  2KOL A;  2ZT9 C;  5JPM C;  3MAQ A;  2B29 A;  3QWN A;  1QB5 D;  4BA2 I;  4JI4 L;  5EBC A;  3HOZ B;  2RBM A;  1LT3 D;  1EEF D;  4GS3 A;  4IUN A;  2PQA B;  4IFD I;  3MXN A;  1HTP A;  3P7J A;  1HA5 A;  3GV6 A;  4ODG A;  1SNO A;  4RG1 A;  2FMC A;  1EY6 A;  2N55 A;  1PFN A;  4NPS A;  2BDN A;  1X54 A;  2DNE A;  1WTR A;  3R2T A;  4LF6 L;  4K0K Q;  4A3J H;  1YJ9 A;  3VR3 A;  5C0X I;  3CCL A;  2MGS A;  2NUC A;  1WD0 A;  2CQO A;  3ULP A;  4FF2 A;  2E8G A;  1VMP A;  1YHB A;  3PSI A;  4C2M H;  3A7A B;  1I5F A;  4FYD A;  3T1Y Q;  3CRL C;  1GM5 A;  1AE3 A;  3NK9 A;  2RQX A;  4A3L G;  4GKJ L;  2QKI C;  2NB0 A;  3TP6 A;  4DXF A;  1IW7 D;  3CW2 C;  3OIQ A;  4BBS G;  4JI3 Q;  2B2Y C;  5AFW A;  1XTD A;  5C3W A;  3FPP A;  3DM1 A;  4L8J A;  3I8Z A;  5T1G A;  3UE0 A;  1QVF A;  4FF1 A;  1PTO D;  1L0X B;  4AIM A;  2Z6K A;  3RN5 A;  1EQQ A;  1BCP B;  3CQZ B;  1ILP A;  1EFI D;  2F4V L;  1II3 A;  1S5F D;  3P1H A;  1RD9 D;  1PRT B;  5LL6 X;  4LF5 L;  4KLK A;  1AN8 A;  1SRO A;  2UUB L;  2HUG A;  3R2I A;  1DOL A;  2B63 B;  4DR1 L;  1QOH A;  3NQT A;  5AJ3 L;  4JI6 Q;  2CH4 W;  2EYO A;  2LS0 1;  1EQV A;  4K0K L;  3BYY B;  2B2W C;  1IKL A;  3J81 L;  2Q2U A;  1A6X A;  3LWU A;  1VS0 A;  4K2K A;  5EPJ A;  5E4W C;  4O1N A;  5ELD A;  1JR0 D;  2J4X A;  4O0A A;  5C5L A;  2XIW A;  4JI1 Q;  3DEO A;  2EY2 A;  2PYK A;  2HT1 A;  4DAV A;  4BBS H;  3CCQ A;  3CCV A;  1FGU A;  3RUZ A;  5GRO A;  2D2C C;  3K6O A;  2K33 A;  4DGZ A;  2LXK A;  2PMZ E;  4QQB X;  2UUA L;  4KTA A;  5ELF A;  2HD3 A;  3IL8 A;  4A3E B;  2LSS A;  4XYQ A;  1W3S A;  4HJ5 A;  1GHJ A;  1PTO B;  1EIF A;  2R7Z B;  5E3F A;  1JOO A;  1DZ1 A;  1K0R A;  2F0G A;  4FXD A;  4P73 A;  3I4O A;  4BWG B;  1WTW A;  2BH2 A;  3A56 A;  4EVO A;  2AWO A;  4GN4 B;  3Q22 A;  1UE6 A;  4LWC A;  2F0V A;  1NUC A;  5M5W H;  4ABN A;  4X64 L;  5KNC A;  5KGU A;  2L5T A;  5ELC A;  4K5X A;  4X65 L;  4J15 A;  2F0O A;  1HNZ Q;  1O78 A;  3A8I E;  1SMY D;  4LNQ A;  1SE4 A;  1AE2 A;  1N33 L;  1STH A;  3NHH A;  4ME5 A;  1STY A;  3BS1 A;  5C4X H;  3IFT A;  4IUQ A;  4XT3 B;  5I2Y A;  4QL5 A;  1TWC H;  3ULL A;  5C4J B;  2QA4 A;  2RCF A;  1X3P A;  2YTV A;  4G7O C;  1G8Z D;  2VXW A;  2WB1 E;  3DWA A;  1PTO H;  4DV3 L;  4GOP B;  1GOZ A;  1N36 L;  1YZ6 A;  1E2W A;  4A3B H;  4RFB A;  3RD4 A;  4IUV A;  5J3B A;  1X3E A;  5JEA H;  4BY1 B;  4LUZ A;  1LT5 D;  1IBL L;  3D6W A;  1J5E L;  1A0I A;  3ERS X;  5KNB A;  2ENB A;  3DUZ A;  1Y1V H;  4U68 A;  3Q24 A;  2F4I A;  3SXH A;  4EX5 A;  1PYB A;  2N49 A;  2PCF B;  3HOU H;  4PG3 A;  2HIV A;  1OXT A;  3H0G G;  2FJ2 A;  3FHW A;  1E1T A;  3E6Z X;  3SR1 A;  4NMZ A;  2DN8 A;  1HH2 P;  5FK9 C;  1EY5 A;  2BE5 C;  2VB3 X;  4YWL A;  4JOI C;  5CV9 A;  2OEO A;  1WFQ A;  1KC8 C;  1LTS D;  1NBW A;  2A8V A;  2VUM H;  3GTO B;  4JI7 Q;  2IX3 A;  5IYD G;  3T56 B;  3I55 A;  5D3D A;  4A3M G;  4YY3 Q;  1TWA B;  2OT2 A;  1U4R A;  4MIU A;  3J7A V;  2EY5 A;  1DOK A;  2JK8 A;  1VQK A;  2RHS B;  3HFZ B;  2EYL A;  1KAB A;  1YNN C;  1CK1 A;  1BDO A;  1ICW A;  2D0O A;  1K83 H;  3F2D A;  3BVG A;  3K7A H;  3R3O A;  3MC0 B;  2RSO A;  4C1N I;  2ASB A;  3A54 A;  5IP9 H;  3STB C;  5C0X H;  4UPA A;  4N9P A;  1TS2 A;  3MXN B;  5IOD A;  2VY3 A;  1XTC D;  3SE0 A;  1S5C D;  1ONL A;  3S14 B;  5CC4 A;  1BBW A;  4C2M B;  3GTL H;  2XN9 C;  2B2U A;  1C8C A;  1BF4 A;  3PUW A;  3PIP 3;  1LAC A;  1ROD A;  2IW3 A;  4BBR G;  2VQF L;  5IYD H;  4KD4 A;  1HFG A;  1T5E A;  3TSS A;  5JVH 3;  1MGS A;  3HP3 A;  3I3C A;  4EQN A;  1MHW C;  1XMQ Q;  2IPK D;  3LNN A;  2PW7 A;  4A3F H;  2HDM A;  4QY7 A;  2UXB L;  4E6I A;  1E22 A;  3K5M A;  2SOB A;  4UAI A;  4GZY C;  4DNT B;  4DR6 Q;  3VR4 A;  4A76 A;  1M1K C;  1I3Q H;  2CW0 D;  1R9T B;  3QB3 A;  2EVB A;  4CDE C;  3QG1 A;  2K28 A;  3S2D H;  5IE8 A;  1ZKO A;  1Y1V G;  2EIF A;  2ZTD A;  1RIP A;  4UY8 C;  1PXU A;  2E2D C;  2VB2 X;  5JJZ A;  1TS3 A;  2JYO A;  2V1C C;  4QJF A;  1WTV A;  3TP8 A;  4DV2 L;  2GVB A;  4A3C G;  3PO3 H;  1LTG D;  4K6L A;  3GTM H;  2B2U C;  5IWA L;  2IHF A;  2QF7 A;  1A3U A;  3G6J B;  1VQP A;  1ENC A;  5IP7 G;  2N88 A;  1EZ8 A;  4UP8 A;  4DK6 C;  1P16 A;  1PFM A;  2E2J B;  3O13 A;  2XNA C;  1SJH D;  5M3M G;  5M3M B;  1PZK D;  4A3I H;  1QJO A;  2DUD A;  1I50 H;  2FMM A;  1VQB A;  4LF7 Q;  2RKS A;  2OWO A;  3BG3 A;  3WOE A;  4RGO S;  1ZXT A;  3HOV H;  3IAY A;  1BNZ A;  2K01 A;  1VQM A;  4DR5 L;  3MXU A;  2NYZ D;  3D0F A;  3I2Z A;  4GKK Q;  3D4R A;  4QGU A;  1SNQ A;  3U4Z A;  2CVR A;  2PZU A;  1O7Z A;  2X6L A;  1TWG H;  1I50 B;  3WDN A;  2K32 A;  4YWK A;  1N34 L;  2E5L Q;  4JBM A;  4H02 A;  1GKH A;  2WIN B;  1H9S B;  1KLU D;  2F0Q A;  4JOI A;  4JI8 L;  5COR A;  5BN3 A;  4IFD G;  2R7D A;  5I9P A;  1RKN A;  1JQY D;  1SLJ A;  3JAM i;  3PF4 A;  3OWF A;  4H13 C;  1ASY A;  4YHH Q;  1JWM D;  2CFM A;  4HIK A;  1PLF A;  1NE3 A;  3PUX A;  4KKS A;  3FMC A;  1Y1W B;  1WCM G;  3K57 A;  2CHB D;  3KYH C;  5E1F A;  3U50 C;  3W2D A;  5LMN W;  4A3F G;  3RZD B;  2CKZ B;  4PZ6 A;  2PQA A;  1BR9 A;  1NR4 A;  2R93 B;  3I72 A;  3VYT A;  3STB D;  2M00 A;  4RCN A;  4B3T L;  3S1Q H;  5EAY A;  4FXG C;  3Q8D A;  3GV3 A;  3HS0 C;  1BUV T;  1EY7 A;  2B39 A;  4JBK A;  2HCC A;  3H91 A;  4HED A;  1JJG A;  2QIL A;  4L5R C;  1SYD A;  1N32 Q;  4DNR B;  3I91 A;  1RCV D;  3NP8 A;  3OMG A;  3KF8 A;  3VYS A;  3HOY G;  1Y8N B;  4RH6 A;  5C4J H;  2O2L D;  2C5C A;  3OOC A;  4X3K A;  5CR3 A;  4JI5 L;  1UUP A;  1IL8 A;  4C3J H;  4FNF A;  5G3L F;  1SMY C;  1EY9 A;  1PFS A;  1EIH A;  1IW7 C;  1S3O A;  1TY0 A;  1L1O B;  5C4H A;  5A2Q L;  2JA7 G;  2NTS A;  3OIP A;  5EQ0 A;  1T5X D;  2AUK A;  4R8I A;  3EN2 A;  4DUZ L;  2WAQ G;  4DK0 A;  3D6C A;  3VR2 A;  5HGT A;  4RKB A;  2KEC A;  1YHQ A;  1XNQ Q;  2K5N A;  4UDU C;  3H09 A;  3LWE A;  4GN3 B;  1NR2 A;  1K8O A;  5AJ3 Q;  1GUS A;  1PH6 A;  4FP5 D;  5IGD A;  1TR5 A;  4OO1 I;  2UXD L;  3RN2 A;  3A55 A;  2AQ2 B;  1K73 C;  3G4S A;  1YNJ D;  1P8L A;  3AMU A;  1I4P A;  2NN6 I;  1OXU A;  2OXP A;  4DR6 L;  4A3E H;  1DJR D;  3NEM A;  1B9M A;  1YNX A;  3U9S A;  1K83 B;  3TP5 A;  1V1O A;  4QCL A;  3PUV A;  2EXD A;  2JA7 H;  3FKI G;  2YTX A;  2RDH A;  4N8F A;  4OIJ A;  3KUP A;  4R4O A;  3HOY B;  1JJ2 A;  5M5Y B;  1DM0 B;  1STE A;  1YIT A;  1Q12 A;  4DA2 A;  5DM6 3;  5C5M A;  1VQF A;  2A68 C;  5C44 G;  5C44 B;  2L15 A;  1EQR A;  1FNW A;  2ZM6 L;  4JI2 Q;  5JOB A;  4KN7 C;  5C3E H;  1ESF A;  1TWF B;  3KF6 A;  5IT9 E;  1HNX L;  4DK3 C;  2FFK B;  2NZH A;  3GTP B;  3F2B A;  1OO9 B;  2Q2H A;  2F0H A;  4F88 A;  4HID A;  1PRT D;  3TP7 A;  2EJM A;  3FP9 A;  1AZQ A;  1Y69 U;  1CT1 D;  1AP0 A;  1VQH A;  3GTK B;  1S4Z A;  3TRZ A;  4BY1 H;  4A93 B;  1G6Z A;  4HR7 B;  2JE6 I;  1EYD A;  1QVC A;  4R8N A;  4JYA Q;  5IGF A;  3T53 B;  1CA5 A;  1VQ7 A;  4DR4 L;  4FVM A;  4WOR A;  4TQU S;  3TN2 A;  5FJ8 G;  1KNE A;  1LAB A;  2X69 A;  2K52 A;  4BS9 A;  4G7H C;  5GQO A;  3K80 C;  1TWC B;  1I3Q B;  1R9T H;  2R61 A;  4NXN Q;  1OXS C;  2F0U A;  2F4V Q;  1RJT A;  2DGY A;  3HOX H;  4YCV A;  3E9H A;  2B2V A;  1VQ4 A;  1RL2 A;  3TDQ A;  2OTL A;  3ONA B;  3RMH A;  5JEA G;  2AHO B;  4DV1 L;  3NWT A;  2BH8 A;  3H3V H;  1PFB A;  3Q23 A;  1EY8 A;  1IBL Q;  3ERQ A;  1O80 A;  1R4P B;  5M5W B;  1C0A A;  3AFP A;  5COY A;  3M85 A;  4DR7 Q;  2MQH A;  1W6J A;  4A4I A;  3UDG A;  1JMC A;  2JJQ A;  1NNX A;  3D4W A;  3TEH B;  3H3V I;  4N8X 1;  4CKE A;  5I4D A;  1Y8P B;  4AQY Q;  1HZ9 A;  3NSW A;  4C3H H;  3D31 A;  4HIM A;  5FJ8 H;  4DFA A;  4A3E G;  1G51 A;  3WOF A;  1KL9 A;  2Z0S A;  1TS5 A;  5EKL A;  4N9T A;  1NY4 A;  2TSS A;  1HFN A;  4FDB A;  1B8A A;  1Q81 C;  1SE8 A;  4YCU A;  2KHS A;  2B2T C;  4HJ8 A;  2EPB A;  1L1O C;  1ZYR D;  2RF4 A;  1IBK Q;  2OF1 A;  2IX0 A;  2Z4H A;  1JC7 A;  1JE5 A;  5D14 A;  1ZYR C;  1A8V A;  5JEA J;  4MZ9 A;  2DJG C;  2E5L L;  4DV0 L;  1HNW L;  5M5X B;  1CHQ D;  1FR3 A;  1XWE A;  3SK5 A;  1VQE A;  1KRS A;  2NWG A;  2XWB B;  3DXJ C;  1E1O A;  1U4L A;  4YHH L;  1O7I A;  4GNX A;  2HQE A;  3A74 A;  3V05 A;  3GTO H;  2VUM B;  1H9S A;  3NTH A;  1F2Y A;  3QR8 A;  5K5P A;  4BBR H;  1E3P A;  1G2S A;  2ICE C;  1IL2 A;  2P5Z X;  4Q5V A;  2B2T A;  2HCI A;  1SYB A;  2SEB D;  3HOU B;  4MNO A;  1D1K A;  3M7G A;  1HRJ A;  1J6Q A;  1TKW B;  2K04 A;  3E9I A;  3KLS X;  1W2B A;  3UI2 A;  1VQA A;  1XMQ L;  1SE3 A;  5M3F B;  1EIY B;  1RDP D;  3KBG A;  4DV5 Q;  4FF4 A;  4K2L A;  2MPM A;  1MD2 D;  4CDF C;  3QJY A;  2A69 C;  1IXR A;  3OMC A;  2FXQ A;  2K14 A;  4GKJ Q;  1HCZ A;  1MIU A;  1JB7 A;  2ZJP A;  1HZB A;  1RF2 D;  1EWH A;  4EQ5 A;  4H7B A;  2EYJ A;  3DEP A;  1QE6 A;  3H0G B;  1DGS A;  2VNU D;  3F2U A;  3X3N A;  1PA6 A;  3RZO B;  5IYC G;  1EUJ A;  4JBW A;  1VCI A;  3J81 E;  5FO7 B;  1L2F A;  3VYR A;  3K58 A;  5FOB B;  3EFX D;  4LUO A;  4LF5 Q;  1F9S A;  2IHE A;  2XGT A;  5KIX A;  3PO2 B;  2F0K A;  1J9O A;  1KQS A;  3SGI A;  1NTG A;  1KRT A;  5DM7 3;  1UE1 A;  3HOZ H;  1NMG A;  3RZO H;  5I2X A;  3JAM L;  3S24 A;  1TWH H;  3CP0 A;  2L55 A;  3TZD A;  2AKW B;  4NXM L;  1X32 A;  2KEE A;  1Y14 B;  1B70 B;  2A19 A;  3UDX A;  2R7F A;  3ER0 A;  5JPN C;  4OWT B;  1K8A C;  3C2P A;  2SDF A;  2EZV A;  4DAY B;  1FNU A;  2JP1 A;  4LAA A;  2EYP A;  3FRP B;  3K5O A;  2TMP A;  3HKZ E;  3URY A;  1LO5 D;  5DAU A;  1XX8 A;  5DLQ E;  5FLX E;  3NEN A;  1YEZ A;  4QIW E;  5I6Y A;  5CBA E;  1GO3 E;  2K03 A;  4LF7 L;  5T1I A;  4OWW B;  3T4A C;  4IUP A;  2KCC A;  4ILW A;  1SR3 A;  4HMJ A;  2HIX A;  4DR5 Q;  4DK1 A;  1M8A A;  2DY7 A;  2WAQ E;  4BBR B;  3PF5 A;  1HR0 Q;  3M4O B;  1STG A;  3EVQ A;  2JA6 H;  2HDL A;  1B50 A;  2ICI A;  2LMC B;  4Z9C B;  4ALP A;  2MO1 A;  4JK1 C;  2V4D A;  1SNM A;  3AFQ A;  3BJU A;  4JCV E;  3MEH A;  3VYU A;  4PQX A;  2CCZ A;  2O4X A;  2NZO A;  1EYC A;  2PQE A;  3EQL C;  1Y1W G;  5M9O A;  2CH4 A;  4IFD H;  4P72 A;  1PH2 A;  5D3I B;  3QO2 A;  3PO2 G;  3M4O H;  1M4V A;  1SJE D;  1SYC A;  5M5X H;  4A3M B;  3C3L A;  4RGT A;  4I65 A;  4PV1 C;  2G5D A;  5I6W A;  2HHH L;  1E24 A;  1Q7Y C;  2FHT A;  1BOS A;  3TZU A;  1X3Q A;  2BDO A;  3D4D A;  3KDF A;  1Q90 A;  3V2T A;  1Q8K A;  1Q8I A;  2IX1 A;  3ND9 A;  1IYV A;  3CQZ H;  4DKA C;  2D0P A;  1S5E D;  1GHK A;  5CBE E;  4B3R L;  2JA5 B;  3ZYY X;  4I7A A;  3OTO L;  3FPU B;  3LGJ A;  4QB4 A;  2F0F A;  1N8R C;  1MSG A;  3J81 c;  2PPB C;  4IJL A;  4HJA A;  1Z9F A;  1HQM C;  1V1Q A;  1B3A A;  3VR5 A;  4DAP A;  1S72 A;  5GAD C;  2UUC L;  4C3H G;  1X56 A;  4DR3 Q;  3TS0 A;  3TME A;  2I07 B;  3PO2 H;  5GAG C;  4IUT A;  1LUZ A;  1VQL A;  5IWA Q;  4DV1 Q;  4C3J B; 
#chains in the Genus database with same CATH homology
 3JAM i;  3PF4 A;  3W1G A;  5LMU Q;  1FVI A;  2ID0 A;  3PCO B;  1ASY A;  2OQK A;  3I7F A;  4YHH Q;  2CFM A;  4HIK A;  1FJG L;  1NE3 A;  3J80 i;  2XTI A;  3PUX A;  1CSP A;  1VQ5 A;  1XPU A;  1WCM G;  3H0G H;  2QEX A;  3S1R H;  4DR7 L;  2NVQ H;  3KYH C;  3RLF A;  3U50 C;  4R4I A;  5LMN W;  4A3F G;  2CKZ B;  4PZ6 A;  1E7Z A;  4POF A;  4X65 Q;  2PQA A;  4DUZ Q;  1KIX A;  2R93 G;  2ZJQ A;  3CMA A;  1PVO A;  3STB D;  4GOP C;  4B3T L;  3ULJ A;  2VL6 A;  4LF8 Q;  1VQI A;  3S1Q H;  5EAY A;  3M4Q A;  4DV4 Q;  1PH8 A;  4KI0 A;  3VDY A;  3Q8D A;  4A3M H;  3CCR A;  4DUY Q;  3I4M G;  5ELN A;  2WP8 J;  3L7Z C;  2Y0S E;  2R92 G;  4JBK A;  3OTO Q;  4JG2 A;  4IOA A;  1L1O A;  4AYB G;  1GVP A;  4L5S A;  2KBN A;  3T1H Q;  5FLM G;  1JJG A;  2BA0 A;  4R4C A;  5IP7 H;  4RMF A;  1EYG A;  3TQY A;  4L5R C;  4AYB E;  4B3M Q;  2I5H A;  4XIG S;  4DR2 Q;  4BXX G;  2R93 H;  3MEF A;  3OYY A;  2GN5 A;  4JC0 A;  3CME A;  2NN6 G;  5IYB H;  2JA8 G;  5BR8 L;  3GTK H;  2ZTE A;  1GD7 A;  2PI2 E;  4OWX B;  1N34 Q;  5JJK A;  5IP9 G;  4A93 G;  3PGZ A;  1LM0 A;  3A5Z B;  3KJP A;  4MTN A;  3HOY G;  2C35 B;  4DV7 Q;  3B6Y A;  5C4J H;  4A3G G;  2Y0S G;  3KF8 B;  1PH3 A;  1WI5 A;  1FL0 A;  2YV5 A;  3GTG H;  3ICE A;  3AQQ A;  1X3G A;  4JI5 L;  2OCE A;  3U4V A;  4LFC L;  4C3J H;  1JT8 A;  2A1A A;  1QUQ B;  4UP9 A;  5HGQ A;  1PFS A;  2CWA A;  4GLX A;  3KJO A;  1FJG Q;  4KHP L;  1S3O A;  1J5E Q;  1L1O B;  4NB3 A;  2JA7 G;  2B63 G;  3J81 i;  4X62 L;  2E2I H;  1OXV A;  4GLA C;  5C44 H;  1MJE A;  2B29 A;  2MO0 A;  3EN2 A;  4DUZ L;  1PH4 A;  4BA2 I;  4JI4 L;  2WAQ G;  3KF6 B;  4IOC A;  2VQF Q;  1XNR Q;  1AH9 A;  3HOZ G;  4LF8 L;  2BA1 A;  1LTL A;  4DV4 L;  2H5X A;  4GS3 A;  2ZM6 Q;  2PQA B;  1YHQ A;  1XNQ Q;  2K5N A;  4IFD I;  3GTQ H;  4GOP A;  4DUY L;  2ES2 A;  4GN3 B;  4A3D G;  2F3I A;  4IPG A;  5AJ3 Q;  4RG1 A;  4LF4 Q;  1PH6 A;  1X3F A;  2JEA I;  3GD7 A;  4NPS A;  2ZTC A;  4WJ4 A;  1V9P A;  2UXC Q;  4R4Q A;  4B3S L;  5IYC H;  1X54 A;  3NEL A;  4C3I H;  1UE7 A;  1N9W A;  3K81 C;  4OO1 I;  2UXD L;  4UP7 A;  4LF6 L;  3RN2 A;  4K0K Q;  4A3J H;  1YJ9 A;  1OTC A;  5C0X I;  3CCL A;  1K73 C;  1N32 L;  2CQO A;  5BR8 Q;  3ULP A;  2E8G A;  3S16 H;  2CWP A;  1YHB A;  4DNI A;  3G4S A;  3PSI A;  4C2M H;  1I5F A;  3T1Y Q;  1P8L A;  2NN6 I;  1OXU A;  2E2J H;  1GM5 A;  4DR6 L;  1AE3 A;  4A3E H;  1VQC A;  3NEM A;  2NVT H;  4A3L G;  1YNX A;  4JI1 L;  4GKJ L;  3CPF A;  4JYA L;  4JI5 Q;  1QUQ A;  1SMX A;  4P71 A;  3CW2 C;  3PUV A;  4BBS G;  4JI3 Q;  4A3J G;  2EXD A;  1XTD A;  2JA7 H;  3FKI G;  2YTX A;  1BVS A;  1EWI A;  1Q1E A;  4R4O A;  3UE0 A;  3I4N H;  1JJ2 A;  1QVF A;  1TXY A;  2WB1 G;  3WWV A;  1Q12 A;  2Z6K A;  4AIM A;  1YIT A;  2UUA Q;  4PMW A;  3RN5 A;  1EQQ A;  1Q1B A;  2VQE L;  1VQF A;  5C44 G;  2F4V L;  4GLV B;  2L15 A;  3U58 A;  1EQR A;  3J7A 5;  4HJ7 A;  4LF5 L;  4KLK A;  4GNX B;  1SRO A;  2UUB L;  3TS2 A;  1X6O A;  4JI2 Q;  2ZM6 L;  1NJI C;  1VQ9 A;  2R7Z H;  5C3E H;  3KF6 A;  1HNX L;  3ZJY C;  4DK3 C;  1KHI A;  2NZH A;  4DR1 L;  3F2B A;  1PHJ A;  5AJ3 L;  4JI6 Q;  4A3K G;  4LF4 L;  4OXP A;  4JI0 Q;  3S2H H;  1SFO H;  2Q2H A;  1A62 A;  4IPH A;  4OX9 Q;  4HID A;  4LF9 L;  4JV5 Q;  2UXD Q;  4K0K L;  4JBJ A;  2Q2U A;  4NXM Q;  3PV0 A;  3FP9 A;  1VS0 A;  5LMN L;  3BU2 A;  2N3S A;  1VQH A;  5K36 G;  3CPW A;  2GVA A;  4O0A A;  3TRZ A;  3RLN A;  4BY1 H;  1VQL A;  2HQL A;  4JI1 Q;  2JE6 I;  1QVC A;  3RLO A;  1M90 C;  4A3I G;  4JYA Q;  4WJ3 M;  2VW9 A;  4X66 Q;  3HOV G;  4A93 H;  2HT1 A;  1SRU A;  4BBS H;  3CCQ A;  3CCV A;  1VQ7 A;  4DR4 L;  1FGU A;  4JI3 L;  2N8N A;  3PUZ A;  5GRO A;  4TQU S;  5FJ8 G;  1B7Y B;  1I94 L;  4GKK L;  2B3G A;  1HZC A;  4KHZ A;  3W5O A;  3G6E A;  2YYZ A;  2LXK A;  2PMZ E;  2K52 A;  4QQB X;  2OTJ A;  2UUA L;  5GQO A;  3K8A A;  3K80 C;  4YCW A;  4BY1 G;  1BKB A;  3HKZ G;  4Y7N H;  2VQE Q;  1R9T H;  1WOC A;  4NXN Q;  1OXS C;  2LSS A;  1PH9 A;  2ATW A;  2F4V Q;  1W3S A;  4HJ5 A;  2DGY A;  3HOX H;  1EIF A;  4YCV A;  3E9H A;  1VQ4 A;  2B63 H;  3NBH B;  1TWF H;  5IT9 c;  4DR3 L;  1PH1 A;  1RL2 A;  2R7Z G;  2UUB Q;  2OTL A;  3IRB A;  1UWV A;  4Y52 H;  1VQO A;  5JEA G;  2I0Q A;  2AHO B;  4DV1 L;  1K0R A;  4P73 A;  3I4O A;  2BH8 A;  5LMU L;  4DV2 Q;  3H3V H;  4OO1 G;  5GAH C;  4DV0 Q;  2BH2 A;  3EBE A;  1HNW Q;  3K0X A;  4BY7 G;  1IBL Q;  2AWO A;  2RCN A;  3CCS A;  1IYJ B;  4GN4 B;  1ASZ A;  4A3D H;  1UE6 A;  1C0A A;  1KXL A;  3AFP A;  4LWC A;  3CF5 A;  3M85 A;  4DR7 Q;  2MQH A;  4A4I A;  1YBY A;  3G48 A;  5M5W H;  4X64 L;  3UDG A;  2ZJR A;  3UDF A;  1JMC A;  2JJQ A;  1G6P A;  2Z6K C;  4X65 L;  4J15 A;  1HNZ Q;  3TEH B;  2HHH Q;  3H3V I;  3S15 H;  1CSQ A;  3HOW H;  4LNQ A;  4AQY Q;  3HKS A;  1AE2 A;  1HZ9 A;  2K50 A;  4C3H H;  5M3M H;  1N33 L;  5M3F G;  3D31 A;  3M4P A;  4AH6 A;  5IWA Q;  4HIM A;  5C4X H;  5FJ8 H;  4A3E G;  4DR4 Q;  1G51 A;  2I5L X;  1X55 A;  2Z0S A;  1KL9 A;  1CKN B;  1K8G A;  4JI7 L;  4QL5 A;  4BA1 I;  1IZ6 A;  2VS1 A;  1TWC H;  1NY4 A;  1YJW A;  3ULL A;  3M3Y H;  4B3M L;  4YY3 L;  3BZC A;  1B8A A;  4FDB A;  3OW2 A;  2QA4 A;  1Q81 C;  1PH7 A;  4B3R Q;  1XPR A;  1SE8 A;  4YCU A;  4L5Q A;  4LUV A;  2KCM A;  2YTV A;  4DV5 L;  4HJ8 A;  4GNX C;  1D8L A;  1L1O C;  2WB1 E;  2RF4 A;  4DV3 L;  4GOP B;  4DV6 Q;  1IBK Q;  2AWN A;  4LFB L;  4DV7 L;  1N36 L;  1YVC A;  2IX0 A;  1K3R A;  1YZ6 A;  3F1Z A;  3CCU A;  1JE5 A;  4A3B H;  1A8V A;  5ELO A;  5JEA J;  5J3B A;  1X3E A;  4MZ9 A;  1VQG A;  3G71 A;  2E5L L;  4LFA Q;  4LFC Q;  4LUZ A;  2UUC Q;  3S17 H;  1H95 A;  4DV0 L;  1HNW L;  3PIO A;  1IBL L;  5FLX c;  4IO9 A;  3I4M H;  2YTY A;  3PUY A;  1A0I A;  3ERS X;  1J5E L;  1Y1V H;  2JA9 A;  3PIP A;  1VQE A;  1KRS A;  2JQO A;  4L5T A;  4EX5 A;  1E1O A;  1PYB A;  2N49 A;  4YHH L;  1O7I A;  4GNX A;  3JC6 6;  1XMO Q;  4PG3 A;  3A74 A;  3HOU H;  1VQ8 A;  4JI4 Q;  1HNZ L;  2YU9 H;  2HIV A;  1OXT A;  1XNR L;  3GTO H;  1WCM H;  3H0G G;  3FHW A;  1E1T A;  1CUK A;  1MKH A;  3M7N A;  1QVG A;  3F8T A;  5IY0 A;  1HH2 P;  1YHA A;  1N33 Q;  1PH5 A;  2K5V A;  4YWL A;  4JOI C;  1E3P A;  1U0L A;  2K4K A;  3UDI A;  4O2D A;  4BBR H;  1KD1 C;  4A3G H;  3J81 j;  1WFQ A;  1IL2 A;  1KC8 C;  1NBW A;  1CKM A;  2A8V A;  2VUM H;  4JI7 Q;  2N78 A;  3CXC A;  5IYD G;  3I55 A;  3HOU G;  4MNO A;  4LF6 Q;  1HZA A;  1J6Q A;  4YY3 Q;  3E9I A;  4A3M G;  3DLL A;  1YJN A;  1W2B A;  1Q82 C;  3AEV A;  3GTP H;  1VQA A;  1XMQ L;  1EIY B;  2NVX H;  2K5H A;  2JK8 A;  4DV5 Q;  1K9M C;  2RHS B;  3HFZ B;  1VQK A;  4X6A H;  3T1Y L;  4XTC S;  3T1H L;  2KEN A;  4DV3 Q;  4LFB Q;  1A63 A;  4IJH A;  4ME3 A;  3BZK A;  1N36 Q;  1VQN A;  1L0W A;  2D0O A;  3GO5 A;  1K83 H;  1IXR A;  4DR2 L;  2FXQ A;  3F2D A;  2IT1 A;  3H15 A;  2K14 A;  4GKJ Q;  1MIU A;  3K7A H;  1JB7 A;  2ZJP A;  1HZB A;  2KHJ A;  4OON A;  3PO3 G;  5M5Y H;  1T9H A;  2PNH A;  2Q2T A;  2ASB A;  3HOY H;  3RZD H;  4EQ5 A;  5IP9 H;  3M9B A;  4POG A;  1NMF A;  2WFW A;  3STB C;  2JA5 H;  5C0X J;  3S14 H;  4UPA A;  3CC4 A;  1DGS A;  2VNU D;  3RR5 A;  2VZA A;  1Q46 A;  2MFI A;  3KLW A;  3MXN B;  1PA6 A;  2IY5 B;  2Q2I A;  2VY3 A;  1EUJ A;  4JBW A;  5IYC G;  1VCI A;  3A5U A;  2K75 A;  1XMO L;  1HR0 W;  4KHP Q;  1L2F A;  1HR0 L;  3J80 c;  4LUO A;  2JEB I;  4LF5 Q;  1C7Y A;  1VQ6 A;  1BBW A;  2IHE A;  2XGT A;  5HY6 A;  3GTL H;  4JI2 L;  1C9O A;  1OXX K;  4X62 Q;  1KQS A;  3SGI A;  1HNX Q;  3CC2 A;  1NTG A;  1KRT A;  3K7U C;  3PUW A;  3JAM c;  1UE1 A;  1VQJ A;  5JJL A;  5C3E G;  4JI6 L;  3HOZ H;  4BBR G;  4A3L H;  4A3B G;  3HOW G;  2VQF L;  4JI0 L;  1NMG A;  3L2P A;  3J7Z C;  3RZO H;  5IYD H;  1I6H H;  1BBU A;  3S24 A;  2VUM G;  4OX9 L;  2E2H H;  1XNQ L;  1TWH H;  5H1S E;  1X9N A;  3CP0 A;  1V43 A;  4R4T A;  4A75 A;  1WJJ A;  2AKW B;  4NXM L;  1XMQ Q;  1Y14 B;  1B70 B;  2A19 A;  3UDX A;  1TWA H;  2R7F A;  3ER0 A;  1K8A C;  4OWT B;  3E0E A;  3I4N G;  2UXC L;  2RHQ B;  4P74 A;  4DAY B;  4B3S Q;  4A3F H;  3CCJ A;  4QY7 A;  3GDE A;  4DAM A;  1IBM Q;  3HKZ E;  2UXB L;  2PI2 A;  2JA6 G;  1E22 A;  3UE1 A;  5DLQ E;  1X65 A;  3L0O A;  4TVA B;  3NEN A;  1YEZ A;  4QIW E;  5E7N A;  4HJ9 A;  4DR6 Q;  4APV A;  1GO3 E;  4A76 A;  2KHI A;  4A3K H;  2R92 H;  5C0X G;  1N32 Q;  1HJP A;  1M1K C;  1I3Q H;  4LF7 L;  4OWW B;  2D62 A;  4LW1 A;  1SR3 A;  3S2D H;  2HIX A;  5IE8 A;  1PYS B;  4NXN L;  4DR5 Q;  1CKN A;  1Y1V G;  2I5M X;  2WAQ E;  1HR0 Q;  3PF5 A;  2EIF A;  2ZTD A;  2UU9 L;  2JA6 H;  3FKI H;  4IPC A;  5GAE C;  1RIP A;  3HOX G;  3F2C A;  1S40 A;  1VQD A;  4UY8 C;  2EQS A;  4PZ8 A;  4ALP A;  2MO1 A;  1QZG A;  3TRE A;  2V1C C;  1JJC B;  4QJF A;  4DPG A;  4HIO A;  1QZH A;  3AYH B;  3AFQ A;  3BJU A;  4JCV E;  4DV2 L;  1EFW A;  2GVB A;  3RNU A;  4A3C G;  2CCZ A;  2NZO A;  3PO3 H;  1KAW A;  1Y1W G;  4IFD J;  4P72 A;  3KOJ A;  1PH2 A;  1PV4 A;  3GTM H;  3S1N H;  4JI8 Q;  3PO2 G;  2ALY B;  5IWA L;  2IHF A;  4DR1 Q;  3M4O H;  3KFU A;  2QGQ A;  5M5X H;  4X64 Q;  1VQP A;  1XPO A;  3CAM A;  5IP7 G;  1CKO A;  4LF9 Q;  4UP8 A;  2HHH L;  4DK6 C;  1E24 A;  1P16 A;  4JV5 L;  5JJI A;  1G29 1;  3S1M H;  5IYB G;  2JA8 H;  1IBM L;  1Q7Y C;  2UXB Q;  3CCE A;  4AQY L;  5LMN Q;  5C4X G;  3KDF A;  1UE5 A;  1Y1W H;  1MJC A;  5M3M G;  3I56 A;  2MNA A;  1Q8K A;  2AMC B;  2IX1 A;  1YIJ A;  4A3I H;  4B3T Q;  2DUD A;  1I50 H;  1XJV A;  1VQB A;  1LYL A;  2LXJ A;  2NVY H;  3CQZ H;  1Q86 C;  1SN8 A;  4DKA C;  4X66 L;  2OWO A;  4LF7 Q;  2D0P A;  4BY7 H;  4R1J A;  3CC7 A;  3HOV H;  4B3R L;  2OQ0 A;  2JA5 G;  3CD6 A;  1VQM A;  4DR5 L;  3CCM A;  3OTO L;  3I2Z A;  3D0F A;  3LGJ A;  2F52 A;  1I94 Q;  4GKK Q;  5FLM H;  1YI2 A;  1N8R C;  1WYD A;  2UU9 Q;  3J81 c;  4QGU A;  3W1B A;  4DV6 L;  4IJL A;  3U4Z A;  3KDF B;  4HJA A;  1IBK L;  1Z9F A;  4GN5 A;  1V1Q A;  1D7Q A;  2R6G A;  4YWM A;  1TWG H;  4BXX H;  1S72 A;  4YWK A;  1N34 L;  1EOV A;  3A0J A;  4PZ7 A;  2E5L Q;  1U5K A;  5GAD C;  4JBM A;  4H02 A;  2UUC L;  1GKH A;  4LFA L;  1UEB A;  1X56 A;  4IPD A;  4DR3 Q;  3TS0 A;  2KCT A;  3GTJ H;  1Z47 A;  5M3F H;  4A3C H;  3PO2 H;  5GAG C;  3EIV A;  3DM3 A;  1LUZ A;  4JOI A;  4P75 A;  4JI8 L;  4IFD G;  2R7D A;  4DV1 Q;  1SLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...