2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
2R7DA 1CSPA 1G51A 4X62L 4O2DA 3CMAA 4IOAA 2VNUD 2NZHA 1I3QH 2I5LX 4KI0A 4GNXB 3HOZG 4DR4L 3L7ZC 1MKHA 1E22A 3UDXA 4POGA 1SN8A 1HZCA 2H5XA 2BA1A 1N34L 4A3LG 2JA8H 3K0XA 4AQYL 5LMUQ 1I94Q 3G4SA 1PA6A 2K52A 1MJCA 3E9IA 1K0RA 3NELA 5LMNL 1HNWL 1VQ6A 4EQ5A 5M5YH 3U4VA 3GTLH 2ATWA 1FGUA 1VQGA 3HFZB 5GAGC 3S17H 1NBWA 1KD1C 1CKOA 5IWAL 5IYCH 1IXRA 1PH6A 4DUYL 1XPRA 4JI5L 2RHSB 4DAYB 5IYBG 2JA7H 5ELNA 4LUOA 1QZHA 2WP8J 4JI0Q 1FJGL 3PO2H 3J7ZC 2UXBL 4QL5A 1EIFA 2CWPA 1PFSA 4YWLA 5AJ3Q 1K73C 3CD6A 3HOYG 4X62Q 1MIUA 4LF4L 4DR4Q 4GN5A 2WB1E 3A5ZB 4MTNA 1FL0A 3K81C 4AH6A 4IPCA 4DR2L 1YI2A 4DR1Q 1GO3E 3JAMc 3UDIA 1QVCA 2R6GA 3GTQH 4UPAA 2VZAA 5IP7G 5C3EH 2I5HA 1VQ7A 3PO3G 2MO0A 5H1SE 1KHIA 2ZJQA 5LMNQ 1HNWQ 3RNUA 1I50H 1I5FA 1L2FA 3EIVA 3ULLA 4JI1L 1OXVA 1X56A 1UE1A 4R4IA 3CC7A 1XMOL 4DV5Q 1BBWA 1EWIA 4DUYQ 1TWCH 2JA9A 1K8AC 4DV4Q 3FKIH 3GTJH 3GTOH 2KHJA 4A3DG 2OCEA 2CCZA 1A62A 3HOVH 2Z6KA 4HJ7A 3KF6A 2UXBQ 3E0EA 1QUQB 4C3JH 5IY0A 3ICEA 2E2JH 4A3BH 3U50C 2A19A 2HHHL 2NZOA 2D0PA 3KDFB 3U4ZA 4X66Q 1YJNA 2VUMG 1KXLA 1PH3A 2DGYA 3GO5A 1Q8KA 1C7YA 5JJLA 1C9OA 4DR3L 4HIMA 4B3ML 4LF9Q 3CPFA 4XTCS 4HJ5A 2KBNA 2VS1A 3W1GA 2V1CC 5C4XH 3S16H 3GTKH 4JI4L 1JT8A 5IT9c 1YNXA 4YY3Q 1R9TH 1EFWA 3J80c 5EAYA 3T1YL 4JBWA 3I4NG 4JI1Q 1Y1WG 3HOUG 1A0IA 4DPGA 4AIMA 4IPDA 2ZJRA 1OXXK 3JAMi 1HR0W 1Q1BA 4O0AA 3OTOL 1S40A 4K0KL 2B29A 4A75A 3ULPA 4UP9A 2JA5G 1XPOA 4QQBX 1HNXL 2RF4A 3HOZH 4DV6Q 1YBYA 1IBLL 1QVFA 2D0OA 4NB3A 5GROA 1VQAA 1E1OA 1YHAA 4A3LH 1N36Q 1M90C 4LUZA 2HHHQ 4DK3C 2OWOA 1N8RC 4NXML 3PUWA 3HKZG 4RMFA 4BBSG 2C35B 4R1JA 1IZ6A 1CKMA 4YWMA 1KRSA 2VY3A 1U5KA 2R93G 5C3EG 4B3MQ 2Z0SA 4LF7L 1VQ4A 2ID0A 1L0WA 4PMWA 2JE6I 2OQ0A 5GADC 3CCMA 4HIDA 4JI4Q 2R92G 1LM0A 2Q2HA 1J5EQ 5IYBH 2IX1A 4A3BG 2E2IH 4NXNL 2PI2A 3G6EA 4DV7Q 2OQKA 4JC0A 2K75A 1G291 3PIPA 4GS3A 3OTOQ 3HOYH 4K0KQ 3I2ZA 3HOVG 1ASZA 3RLNA 3U58A 1HNXQ 1IBML 1YEZA 3BU2A 5J3BA 3TQYA 4DV2L 2EQSA 1Q81C 1L1OC 1IBLQ 1JMCA 3J80i 3TREA 1SROA 4A3FG 5LMUL 4DUZL 4DV0L 3KF6B 4BBRG 4LFBL 5JJIA 2GVAA 2GN5A 4HJ9A 4NXMQ 5FJ8G 3PO3H 3EBEA 1SR3A 3RZOH 3HOXG 4WJ3M 1HZBA 3BZKA 4PZ7A 4A93G 1N32L 4LF7Q 3RR5A 3H0GG 2WAQG 3EN2A 2MNAA 4GLXA 3GD7A 1ASYA 1QUQA 1HJPA 2NVXH 1AE2A 3DLLA 1PVOA 5IYDG 3CCEA 3CCLA 1IL2A 4A3DH 2LSSA 3JC66 5AJ3L 2K14A 2UU9Q 1TWGH 1NMFA 1S3OA 4FDBA 3KDFA 3OW2A 1X65A 2HIXA 4JI7L 3K7AH 4DR1L 4R4QA 1IBMQ 3CC4A 3D31A 4DV2Q 1YHBA 2VUMH 5HY6A 4LF6L 3AFQA 4DUZQ 1Q82C 4DV0Q 4LFBQ 3M85A 4KHPL 1X55A 1N9WA 2L15A 3RLFA 3RN2A 3I4MG 1K9MC 3TS0A 3M4OH 1Z47A 3CP0A 4JI3L 1PYSB 3F1ZA 5M5WH 4DV5L 1E24A 1VQNA 3PUVA 5M3MG 3I4NH 1Y1WH 3HOUH 1N32Q 1SMXA 1PH8A 2IY5B 1UWVA 4DV4L 1T9HA 3NBHB 3S24A 1CSQA 2N78A 4QIWE 5C0XJ 2I0QA 1VQHA 3CCSA 1N33Q 1VQCA 2NVYH 2JA5H 4Y52H 2R7FA 2Q2UA 3S1RH 1VQLA 1HR0L 1Q46A 1WJJA 3CQZH 1KIXA 4X66L 4JI7Q 4C2MH 4TQUS 5GAEC 3PCOB 5GQOA 1JJ2A 1A63A 2A1AA 3F8TA 4LF9L 1PH9A 4BBSH 3PUZA 1XNRL 3I55A 4LF6Q 1L1OB 3T1HL 3S2DH 4IO9A 2R93H 3KJOA 4YY3L 4KHPQ 3RLOA 3ULJA 2PQAA 3K8AA 4BA2I 2R92H 4JI3Q 3GDEA 1TXYA 1B8AA 1KQSA 4AYBG 2JEAI 3CW2C 3B6YA 2Y0SE 4P71A 4R4TA 1PH1A 3LGJA 3KFUA 1JJCB 4DV6L 4IJLA 3WWVA 1WCMG 5IP9G 5M3FG 2R7ZG 4A3GG 4GKKL 5FLMG 1GD7A 1V1QA 1TWHH 1N36L 1HR0Q 4A3MG 2LXKA 4A3FH 2GVBA 3A5UA 4JBMA 4R4CA 4BY7G 4BBRH 1E3PA 3UE0A 1IYJB 4JBJA 4PZ6A 3M4QA 4MNOA 1LTLA 2IT1A 1VQ9A 2OTLA 2N49A 2HIVA 4IPHA 5FJ8H 3ERSX 3PGZA 4A3KG 3HOXH 1DGSA 1P16A 1XNRQ 2AHOB 3GTPH 3T1HQ 2B63G 2F4VQ 4A93H 3H0GH 1J5EL 4LF8L 4L5TA 1LUZA 2HQLA 3A74A 2VQEL 2QEXA 4DV7L 4A3JG 2PNHA 1AE3A 1SE8A 1PH5A 5IYDH 2JA6G 2OTJA 3PF4A 4B3SL 4P75A 1H95A 2RHQB 4R4OA 1Q7YC 1PH7A 5GAHC 3PUYA 4GKKQ 2LXJA 4HIKA 5JEAJ 1WOCA 1YITA 2QA4A 1E1TA 1VQMA 2NN6G 1KL9A 2F3IA 4P72A 3I4MH 1YIJA 3HOWG 1EYGA 3F2BA 4DV1L 4YCWA 4KHZA 4GNXC 1UEBA 4DR5L 1PV4A 5M3MH 4H02A 3HKSA 3F2CA 1D8LA 1YHQA 4LF8Q 4GLAC 2VQEQ 2CKZB 2PQAB 3STBC 3J81c 3AEVA 2UU9L 4IJHA 1UE7A 1EQRA 3MEFA 4GN3B 4A3IG 1KC8C 4L5SA 4OWWB 2ASBA 1HH2P 4B3SQ 1AH9A 1OTCA 1W2BA 3GTMH 2MQHA 2YTYA 4OXPA 5HGQA 2ZM6L 4DV3L 3CAMA 3OYYA 1L1OA 1SRUA 4B3RL 1Q86C 4LF5Q 3I56A 4JG2A 5C0XG 4IFDJ 4OWTB 5E7NA 2EIFA 4P73A 2E8GA 2JQOA 1PH4A 2UXCL 2B3GA 3VDYA 2K5VA 3PUXA 3UDFA 2ZTDA 4B3TL 4GKJQ 3PSIA 4DV1Q 4ME3A 4DR6L 1BBUA 4DR5Q 4A3EG 1N33L 5BR8L 3H15A 4GOPC 1BVSA 2RCNA 1NY4A 4YHHL 1NE3A 1VQJA 3M7NA 1WCMH 5IP9H 5M3FH 2BH2A 2R7ZH 4A3GH 4LNQA 5FLMH 2NVTH 4X64Q 3CCQA 3H3VH 4A3MH 1YJ9A 2Q2IA 1QVGA 2HT1A 4BY7H 1Z9FA 2ZM6Q 4DV3Q 4P74A 1GM5A 3S2HH 2UXDL 1PHJA 4B3RQ 5C4JH 3W5OA 3J81i 1Y1VG 2PI2E 3DM3A 4APVA 3HKZE 2NN6I 4A3KH 1VQOA 1XNQL 2MFIA 1KAWA 1TWFH 2JJQA 4NPSA 2B63H 1CKNA 4YCVA 3S15H 2UUBQ 3A0JA 4JBKA 2UXCQ 1OXTA 1C0AA 2E5LL 4LFAQ 1X9NA 3IRBA 4PZ8A 1X6OA 3CPWA 4A3JH 4B3TQ 3KF8B 4OX9Q 3AFPA 1YZ6A 2K50A 3M3YH 4DR6Q 1GVPA 4RG1A 2ES2A 5BR8Q 2JA6H 1Y14B 3S1QH 4Y7NH 3I7FA 4KLKA 4YHHQ 4BXXG 2UUCL 1NTGA 1EOVA 1O7IA 3CXCA 4OO1G 1GKHA 3KYHC 2JEBI 3J81j 4BY1G 4LUVA 2ZTEA 4JI2Q 2NVQH 2UXDQ 4BA1I 3BJUA 5C0XI 1BKBA 1Q1EA 1V43A 2F4VL 3HOWH 2VW9A 3CC2A 4A3CG 1MJEA 1XNQQ 3K7UC 3L0OA 1HZ9A 3Q8DA 2YV5A 2E5LQ 2WAQE 4JCVE 5JEAG 1NMGA 2KCTA 1VQPA 1K8GA 3NENA 1V9PA 4JYAL 3RZDH 2YTXA 2BH8A 3CMEA 4A3IH 5C44G 5FLXc 1EIYB 2JK8A 1VS0A 4DAMA 1VQ5A 4GOPB 1NJIC 2UUCQ 2YU9H 3D0FA 2CFMA 1S72A 3I4OA 3STBD 1VQEA 1N34Q 2WFWA 1PYBA 3MXNB 1XJVA 4UP8A 1K83H 1Q12A 4AQYQ 3KLWA 4OWXB 2BA0A 1VQKA 1XPUA 4TVAB 2CQOA 4JI8L 1CUKA 4HJ8A 1XTDA 4DNIA 4POFA 1X3FA 2KENA 1VQIA 1W3SA 4JOIA 4JOIC 5IWAQ 3CCRA 2Q2TA 4DR7L 4JI5Q 1I6HH 1LYLA 2XTIA 3F2DA 1VCIA 1P8LA 4C3IH 4A3EH 4A76A 5K36G 3W1BA 4WJ4A 1FJGQ 4QJFA 1CKNB 2F52A 3K80C 1WI5A 4HJAA 1X3GA 3FHWA 2Z6KC 3PIOA 4IFDG 1WYDA 3ZJYC 3KJPA 2N3SA 1E7ZA 3CCUA 2UUAL 3BZCA 4LFCL 1JE5A 4JYAQ 3G48A 2AKWB 5JJKA 3NEMA 2CWAA 4LF4Q 1RIPA 2KHIA 5LMNW 2K5HA 2JA8G 2IX0A 4LF5L 4OO1I 1VQFA 4DR2Q 2MO1A 1YJWA 2YTVA 3KOJA 1K3RA 2EXDA 1Y1VH 4QY7A 1JJGA 2E2HH 2XGTA 5IYCG 3CCJA 5IE8A 4GKJL 4JI8Q 4X65L 1J6QA 1WFQA 2ALYB 2KCMA 1OXSC 4GNXA 3RN5A 1XMQL 2JA7G 2A8VA 1XMOQ 4GLVB 2ZJPA 4YWKA 1QZGA 1VQBA 3M4PA 3TRZA 1UE6A 3SGIA 4DR7Q 3PO2G 1EQQA 4L5QA 1A8VA 4AYBE 1HZAA 3S1MH 3M9BA 3PV0A 4X64L 4BXXH 4X6AH 1KRTA 2D62A 3UE1A 3J7A5 2UUAQ 4LFCQ 4YCUA 4J15A 1HNZL 3PF5A 4QGUA 3ER0A 1IBKL 3H3VI 4EX5A 4IPGA 3CF5A 4BY1H 1X54A 3AQQA 2K5NA 4MZ9A 1SLJA 2ZTCA 1EUJA 2IHFA 3AYHB 2VQFL 2DUDA 4XIGS 2K4KA 4DR3Q 1SFOH 1PH2A 1B70B 2VL6A 1G6PA 2IHEA 3G71A 4UY8C 4A3CH 4JV5L 2UUBL 4UP7A 1FVIA 1TWAH 2QGQA 4LFAL 4JI6L 4PG3A 1B7YB 4DKAC 3T1YQ 4X65Q 3UDGA 4OX9L 1VQ8A 4HIOA 1U0LA 1XMQQ 1UE5A 3FKIG 4GOPA 4GN4B 2N8NA 5C44H 4IFDI 3L2PA 2WB1G 5DLQE 3CCVA 1X3EA 2AWOA 4OONA 1VQDA 4A4IA 2PMZE 3TEHB 1YVCA 1M1KC 1I94L 3FP9A 1HNZQ 5ELOA 4C3HH 1IBKQ 4JI2L 4LWCA 5IP7H 2YYZA 4ALPA 1D7QA 4IOCA 4DK6C 1JB7A 5C4XG 2VQFQ 4L5RC 1RL2A 5M5XH 3TS2A 4LW1A 4JV5Q 2I5MX 1OXUA 4JI0L 2Y0SG 3E9HA 3S1NH 2AMCB 4JI6Q 2FXQA 4NXNQ 2AWNA 3GTGH 3S14H
chains in the Genus database with same CATH superfamily
3DHQA 4IFDH 1G51A 1SEBD 3CMAA 3KLSA 2NZHA 1STNA 2PNRC 1MKHA 3W3AA 2WKDA 3UDXA 3P75A 3WOFA 1GUSA 2H5XA 4A3LG 2F0SA 2X6LA 1JWUD 1EIHA 1T5XD 1V1OA 2D5DA 3TP7A 1K0RA 2F0UA 2ATWA 1VQGA 2H4OA 1KD1C 5IWAL 3T53B 2RHSB 2JA7H 4K6LA 4LUOA 5D65A 5KYIA 2WP8J 4JI0Q 1GUGA 1K28A 3A7LA 4OIKA 1WTVA 3HOYG 3D8GA 4X62Q 3GTQB 2Q8TA 2WB1E 3K81C 2J7ZA 3L3OC 4DR2L 1YI2A 3JAMc 3SR1A 5CYUA 1S5CD 2R92B 2EJFC 3QOLA 2KVMA 2VZAA 1B3QA 3PO3G 4DNTB 1I50H 1G8ZD 4JI1L 1OXVA 1JWSD 2OEOA 1Z6HA 3HOVB 4DV5Q 1BBWA 3H6MA 4DUYQ 1B9NA 2JA9A 1K8AC 3TSSA 3GTOH 1ZYRD 4HSPA 2IX3A 1BNZA 4HJ7A 2A68C 2PO4A 5BN3A 4A3BH 4ZLTF 2HHHL 2B2WC 1PH3A 2DGYA 3GO5A 4KY5A 4XT3B 4R8IA 2KBNA 2Y0SB 1JT8A 1YNXA 2PZWA 3J80c 5EAYA 4JBWA 3I4NG 2BE5D 4UP9A 4GZYC 4DV6Q 1IBLL 1WTXA 1LT3D 1RD9D 2AUJD 3DEPA 1U9RA 4A3LH 1M90C 1M8AA 1RODA 2EJMA 3HKZG 4RMFA 4RWSC 2C35B 4BBSG 1IZ6A 1CKMA 3DUZA 3DXJC 2VY3A 2R93G 5C3EG 1BOSA 3T56B 2PYKA 5C5MA 4HIDA 4JI4Q 3EFXD 3KLRA 1LM0A 2E2IH 3G6EA 1HTPA 2K75A 2K33A 3EJIA 3HOYH 4TSSA 1HNXQ 3RD4A 3PIO3 1UEAB 4DV2L 3TREA 1TT2A 3OWEB 4BBRG 4LFBL 2RDGA 2GVAA 2GN5A 4AYBB 3PO3H 3RZOH 1HZBA 3BZKA 3OW7A 4A93G 2SEBD 1XWEA 4LF7Q 3BS1A 3GD7A 4ZUIA 2NVXH 1PVOA 5EJWA 3CCLA 2LSSA 5AJ3L 2QCPX 5K5PA 4G7HC 2O5IC 1SNDA 3S2HB 4H13C 3C2PA 1X65A 4A3KB 3R2TA 3JAML 4V0BA 4ODGA 1IBMQ 3CC4A 1ICWA 1YHBA 3BYYB 4ZCKA 5IGFA 5HY6A 3NBIA 3QIAA 4A3JB 1N9WA 3RN2A 3I4MG 1K9MC 3CP0A 1PYSB 2HDMA 1NNXA 3PUVA 1IKLA 5M3MG 3I4NH 1PH8A 2IY5B 4QIWE 1ZKOA 4Y52H 2R7FA 1II3A 1A3TA 3S1RH 1VQLA 1ET9A 4XYQA 3CQZH 2JXMB 4JW0A 4FXDA 3S2DB 4X66L 4C2MH 4TQUS 1A63A 5GQOA 2EY1A 3F8TA 4BBSH 4IUQA 5JPMC 3K58A 3PUZA 2IWHA 4ID6A 2R93H 1PZKD 4YY3L 3K8AA 3J80L 4A3IB 1RF2D 4JI3Q 3GDEA 3VYUA 3QOJA 2JEAI 1EEFD 1A3UA 3B6YA 1TWHB 4P71A 5IODA 5FLXE 4A3FB 1WCMG 5M3FG 4ZAIA 1GD7A 3BYTB 2NBFA 1HR0Q 2F0GA 2B2TA 2B2TC 2CW0C 2A6HC 4JBMA 2F0NA 1PTOB 1EY5A 4BBRH 1EY8A 1GJXA 1GUWA 4MNOA 2WAQB 1VQ9A 3PGZA 1STBA 3MTSA 3GTPH 1F9QA 3T1HQ 4A93H 3A8JE 1J5EL 3MVVA 4DV7L 1EYDA 1SE2A 1KNEA 2OTJA 4P75A 1Y8PB 1H95A 2F0FA 1Q7YC 1BCPC 4FP5D 5J1ZA 5FOBB 2K28A 5JEAJ 1CT1D 1YITA 1E1TA 4NW2A 3I4MH 3HOWG 2EOTA 1EYGA 4YCWA 4KHZA 5M3MH 1YHQA 2JN4A 2VQEQ 2ICIA 2PQAB 3J81c 4OGQC 3AEVA 2UU9L 3MEFA 4GN3B 1KC8C 3FEWX 5HURA 4J1MA 3GTMH 3L9AX 4QCLA 2MQHA 3Q0AA 2ZM6L 4CDFC 3D4WA 1SRUA 4F8MA 5BN5A 4WORA 4JG2A 1G91A 2E8GA 1PH4A 4XQQA 2FMMA 1O7ZA 2ZTDA 4B3TL 3PSIA 4GKJQ 4DV1Q 1EWCA 2NVTB 4LMQD 2Z9HA 4O1NA 3VYTA 3I91A 1HXYD 1WCMH 5M3FH 1ENFA 3J7YW 4LNQA 4CGYB 1MGSA 2LY7A 3FRPB 4KJNA 2PZUA 5I6WA 1KTKA 2IPKD 2HT1A 4DV3Q 4NKLA 1PHJA 3LWUA 2RBMA 3DM3A 4APVA 2MFIA 3S14B 4NPSA 4QB4A 1CKNA 3NHHA 3IRBA 4I65A 3CPWA 2PMZB 4IUPA 3IL8A 4IURA 2K50A 1SYFA 2B2VA 2L11A 3S1QH 4WFN3 3I7FA 2Q8RE 1PLFA 4BXXG 1EOVA 1ENCA 2JP1A 1CA5A 2QW7A 2F0PA 1B9MA 1F9RA 1GKHA 1WD1A 2JEBI 2WV6D 4DF7A 2NVQH 1E2WA 1BCPD 3V05A 1V43A 4RCNA 3HOWH 3CC2A 4A3CG 1XNQQ 2D2CC 3NSWA 3GV3A 3L0OA 3AB9A 2FJ2A 1RJTA 5JAVA 5FK9C 2E5LQ 4JCVE 1VQPA 5JEAG 3MFGA 4RKBA 1F77A 1SBBB 3CMEA 3K57A 1O78A 5C44G 2JK8A 3GP7A 4GOPB 3IFTA 2A74C 3D0FA 2XN9C 2CFMA 3I4OA 3BDCA 1I50B 2K01A 2CQAA 3VR6A 1K83H 3Q23A 1XYIA 4OWXB 3NTHA 4TVAB 4C1NI 2XRQD 3CHBD 4DNIA 1EYCA 2KENA 1W3SA 4IUVA 4JI5Q 2WB1B 3J81L 1EZ6A 2JSOA 2KEEA 4MN3A 2PW5A 4XDXA 3PIOA 1E7ZA 1V8QA 3CCUA 3URYA 5I2XA 4LF4Q 3DM1A 2EYOA 4K2LA 1PRTD 2K5HA 2IX0A 2YTVA 2ZXPA 1S4ZA 2EXDA 1PXUA 4PQXA 1EY7A 5E4XA 5IT9E 2E2HH 3MXPA 5IYCG 3CCJA 4JI8Q 2ENBA 1WFQA 3S1MB 4GNXA 3NTKA 2O2LD 2MJ8A 4GLVB 2ZJPA 3V2TA 3TRZA 4G7OC 4DA2A 1EQQA 3PO2G 3CU7A 4AYBE 1D5XC 2EYMA 4BXXH 1KRTA 4KHVA 4LFCQ 1HNZL 3CF5A 4FXKC 3AQQA 2K5NA 4HMIA 3HZXA 2F0LA 1SLJA 2IHFA 1LTRD 2DNEA 2VQFL 2E2IB 1PZJD 1PH2A 1JB3A 2VL6A 5KYLA 4BS9A 1JICA 4A3CH 1TWAH 2L9HA 3H09A 2K6AA 4KKTA 1EY4A 3HOYB 1B7YB 4DKAC 4OX9L 5JEAH 1UE5A 3FKIG 1EEID 4OHJA 4GOPA 4GN4B 5CR3A 5C44H 1HCZA 2F0DA 4NMZA 1IBKQ 4LWCA 4NDXA 1E2VA 4L63B 4EVOA 1D7QA 5C4XG 1JB7A 1D1KA 1HFGA 3D4DA 5M5XH 2FMCA 1ET6A 4JV5Q 4JI0L 3D6WA 3S1NH 4NXNQ 3BVMA 4MHEA 1MSGA 2YU9H 3DWQA 4X62L 4O2DA 2JA8B 3IKJA 4KI0A 1I3QH 1TIID 5CV4A 3K5MA 3OSOA 1SN8A 5IIFA 3GTLB 3S17B 1IL8A 3BVGA 5LMUQ 4U673 1I94Q 1PA6A 1MJCA 4EQ5A 5M5YH 2G9DA 2WACA 3HFZB 4F87A 1CKOA 5IYCH 1PH6A 1IXRA 2KQ3A 4DUYL 1LABA 3KBGA 2ZT9C 4DAYB 3S1RB 1Y8NB 1LTSD 5EBCA 5ELNA 1FJGL 3PO2H 3J7ZC 2EZVA 4QL5A 4C2MB 2CWPA 4YWLA 1PFSA 3TMEA 1U4LA 3HKZB 2J0TD 4BBSB 4IUNA 4DR4Q 4MTNA 5CV8A 5C3EB 3N52A 4IUTA 3MEHA 3UDIA 1QVCA 1LO5D 1PFNA 4DK0A 4XT1B 2I5HA 2EVBA 2MO0A 5H1SE 1KHIA 2EY6A 5LMNQ 1I5FA 3EIVA 3ULLA 4DK1A 1UE1A 1XMOL 1EWIA 1JE4A 1TWCH 4DV4Q 1D2BA 3FKIH 3GTJH 1A62A 2PQEA 4PMCA 2Z6KA 3KF6A 3E0EA 5IY0A 3ICEA 1I4PA 3H91A 3U4ZA 1YJNA 1QE6A 1KXLA 1SYBA 1K0SA 4HIMA 4XTCS 3VR2A 4HJ5A 2VS1A 3X3MA 5C4XH 3A8KE 1CZWA 3GTKH 4JI4L 1HQRD 1B53A 3T1YL 4IPDA 1OXXK 3JAMi 1HR0W 1Q1BA 3I90A 2K5WA 1S40A 3ULPA 2JA5G 1XPOA 3OMCA 1HNXL 1YBYA 3G6JB 1QVFA 4NB3A 2XWBB 1E1OA 3I4MB 4LUZA 4R1JA 5LHY1 4DAYA 1QJOA 5JOBA 1BCPF 1YNNC 2Z0SA 3NBHA 2ID0A 1L0WA 4PMWA 2JE6I 2OQ0A 2DY7A 3P7JA 2Q2HA 4PNYA 4K8IA 2K1BA 2XVSA 3OTOQ 4K0KQ 5EKKA 3RUZA 4H0LC 3BU2A 3TQYA 4FXGC 5J3BA 1IBML 2A8VA 4A3BG 1L1OC 3J80i 1SROA 1WTQA 1HQMC 3HG9A 4QF4A 1SAPA 1BBXC 5EKLA 1ML0D 3HOXG 4WJ3M 4A3DB 2MNAA 4B08A 1RTNA 4H7BA 2QKIC 3DLLA 2NUCA 1DM0B 5IYDG 1IL2A 3JC66 1CHQD 2K14A 2Q8IB 1TWGH 2VUMB 3LNNA 1ILQA 2HIXA 3K7AH 4U68A 4YIJA 4DR1L 3D31A 2RA4A 2E75C 4DUZQ 3M85A 5LL6S 2L15A 3W2DA 3TS0A 3M4OH 1Z47A 4JI3L 2BOSA 1E24A 1N32Q 5DM63 1SMXA 3R8BA 1KAAA 1N33Q 2I0QA 3CCSA 2JA5H 4DU9A 2G9HD 3C1EA 1HR0L 2NVQB 4UAIA 2SDFA 5A2QL 1KIXA 2DN8A 1JJ2A 4LF9L 1PH9A 1LT5D 4LF6Q 3NWTA 3T1HL 3DEOA 4KHPQ 3SE0A 4KY7A 3CW2C 3EA6A 3Q22A 4ZQ3A 1YNND 2L5TA 5IP9G 2R7ZG 1OO9B 1K83B 4A3GG 4RFBA 3DWPA 1N36L 4A3MG 2B2WA 3SHLA 2GVBA 2F0HA 4RHSA 5C0XH 2F1MA 3AU7A 5C3WA 5EPJA 3P20A 3HOXH 1DGSA 2K05A 3OMGA 1WTPA 2H1EA 2B63G 2F4VQ 2X69A 5CV5A 1KLGD 2QF7A 5E1FA 2OXPA 2VQEL 3A74A 2QEXA 1STAA 2KJXA 2PNHA 2RSNA 1AE3A 2V4DA 1SE8A 1PH5A 5IYDH 1CK1A 1I4GA 3TN2A 5GAHC 3PUYA 4HIKA 2E2HB 4WRDA 4CHTB 1KL9A 2F3IA 4P72A 3KF8A 2L12A 4DV1L 1SE4A 1A2UA 3F2CA 1D8LA 4HR7B 1BXTA 2CKZB 4RKLA 4FVMA 3STBC 1UE7A 1EQRA 4L5SA 4OWWB 1HH2P 1DYQA 1BUVT 1OTCA 4M1UB 2YTYA 5HGQA 4DV3L 3HGBA 1TWAB 4LF5Q 3I56A 4OWTB 5E7NA 2EIFA 4P73A 3SK6A 1SYCA 1ICFB 3M4YA 3UDFA 2XSCA 4NP5A 4ME3A 4DR5Q 2ZXRA 3NK9A 2KCCA 1STHA 3M7NA 5IP9H 2BH2A 2R7ZH 4A3GH 4N8X1 2DNCA 3CCQA 1ZEQX 4V190 1BR9A 2PW7A 4A3MH 2N55A 1QVGA 1TWFB 5EQ0A 1AP0A 2MGSA 3T51B 5C4JH 1SE3A 2KUMA 3J81i 1Y69U 1XNQL 3HKZE 1KLUD 1AN8A 1KAWA 2B63H 4YCVA 3S15H 2UUBQ 1C0AA 4JBKA 4RCOA 1I3QB 1QOHA 2E5LL 3A56A 4PZ8A 1X6OA 1T5EA 2K32A 2CH4A 3AFPA 1WTRA 1YZ6A 1GVPA 4RG1A 2ES2A 5BR8Q 1IYVA 2B2YC 1Y14B 4Y7NH 1H9SB 1NTGA 1QCBD 5M5YB 4UDUC 4P2CB 4QUFA 1S5BD 1SNCA 3KLSX 4LUVA 5IGCA 2FINB 4IN3A 5KGUA 3E6ZX 4JI2Q 1PDQA 4BA1I 1EY6A 3BJUA 5KNDA 2I46A 4ZRZA 3PO2B 1SMYD 1BF4A 4X3SA 4ULLA 1MI2A 4ME5A 1CQVA 4K8JA 3RZDB 1DOLA 1HZ9A 3Q8DA 4ABNA 1V9PA 3K5NA 1E2ZA 1VS0A 1A15A 2UUCQ 2R3ZA 4H44C 2K7VA 3JAME 1S72A 3STBD 5M9OA 1PYBA 3I4LA 1Q12A 3KLWA 3TP6A 5HGTA 1TWCB 4C3IB 4JI8L 1X3FA 1LTGD 1ZXTA 4JOIA 4JOIC 5IWAQ 3MZ5A 1I6HH 1VCIA 5CBEE 2EPBA 3R2IA 4QJFA 1CKNB 1VF5C 3K80C 1WI5A 1RDPD 4J6HA 1WYDA 3ZJYC 3KJPA 1TQOA 4LFCL 3C46A 2XNAC 4JYAQ 4ZKCB 4S3SA 3VA7A 1O7LA 4K2KA 5LMNW 2F0IA 4DR2Q 2HUGA 2XWJB 2M2LA 3Q6SA 1X3PA 3KOJA 3NE5B 2D9UA 4L8JA 1H9JA 1JWMD 3J80E 2C5CA 1G6ZA 3SDZA 1OXSC 1H9SA 2KHSA 1MBYA 1VQBA 3SGIA 1YNJC 4L5QA 2NWGA 1BQQT 3PV0A 4N8FA 4X64L 1F2ZA 1RTOA 1STEA 2XIWA 3UE1A 3NUCA 2UUAQ 4YCUA 4J15A 3PF5A 4QGUA 1IBKL 4EX5A 4OELB 1SFOB 4MZ9A 2ZTCA 1EUJA 2DUDA 4XIGS 2K4KA 5I4DA 2DY8A 2IHEA 4UY8C 4JV5L 5CMDA 1JOOA 4UP7A 5CV6A 4LFAL 2F0MA 3VR5A 3UDGA 1VQ8A 1I4QA 1V1PA 3FPPA 4R8NA 1PRTC 1W6JA 1HFNA 1WVLA 2N8NA 3HS0C 2BCOA 1SYDA 5ELEA 5T1GA 1X32A 4C3JG 3L2PA 2WINB 3FMCA 1X3EA 1A6XA 3TEHB 1YVCA 1I94L 1PYWD 5ELOA 5IP7H 4DK6C 3BDOA 2SNSA 1U4PA 3SEBA 2I5MX 1F2YA 2Y0SG 3MAQA 2FXQA 1CTMA 1PZID 5JVH3 1CSPA 3WOEA 1PTOC 4GNXB 3HOZG 4DR4L 1EWHA 5G3LD 1IHZA 4POGA 4CBVA 1N34L 1NR4A 3K0XA 4AQYL 3G4SA 1QILA 2K52A 3E9IA 1Q3LA 5LMNL 5CORA 1VQ6A 2JA7B 3U4VA 1FGUA 1S5ED 5GAGC 5KIXA 3OOCA 2RQXA 3HRZC 1XPRA 1EFID 4KK7A 2EJGC 1WD0A 2M00A 2VB2X 5EPLA 1EIFA 3CD6A 5AJ3Q 3WDNA 4ZKBB 1LTTD 4AH6A 1YNJD 4IPCA 1S5DD 2R6GA 1AEXA 2EY5A 3GTQH 3TP5A 2O5JC 4JK1C 2F4IA 3E5SA 1G2TA 1HNWQ 3RNUA 1FD7D 1L2FA 2L0CA 3GTOB 1TY2A 2FFKB 1CFMA 1X56A 3CC7A 1I6VC 1ESRA 1XX8A 3OIQA 5CGKA 4A3BB 1SXTA 2KHJA 4XXEA 3NQIA 3HOVH 2UXBQ 4C3JH 1Q90A 1I4XA 2NZOA 3HOXB 4ZK9B 5ISRA 1B44D 3KDFB 2A6EC 4X66Q 3VYRA 1Q8KA 2XRSD 1DZ1A 4DR3L 3H3VC 1FNWA 3W1GA 2V1CC 4PV1C 4YY3Q 4CKCA 1Y1WG 3HOUG 1A0IA 3Q24A 4DPGA 1EOTA 4O0AA 3OTOL 4K0KL 4A75A 1KNAA 2DJFC 4K5XA 5I9OA 2RF4A 3HOZH 2D0OA 3C1FA 5GROA 1SNPA 3UI2A 1YHAA 1A2TA 3VR4A 4BWGB 2PCFB 2RDHA 1PTOD 1N8RC 3PUWA 4YWMA 1KRSA 5DAUA 1DCZA 2PPBC 4B3MQ 2B8GA 4E6IA 1VMPA 2E74C 1J5EQ 1XTCD 5JJZA 3J81E 4DV7Q 2OQKA 4JC0A 2QILA 3I2ZA 4DAVA 1ASZA 1SNMA 3PO3B 5F2DA 4A3FG 4DUZL 3RZOB 3KF6B 1ONLA 2E2DC 5JJIA 3F2UA 1R4QB 4NXMQ 4EGVA 1JORA 5FJ8G 1SR3A 2NVXB 1N32L 3H0GG 2WAQG 4GLXA 4PMBA 1SNQA 1AE2A 4A3MB 2M9VA 1A3VA 2UU9Q 1NMFA 4FDBA 4CDEC 3KDFA 2B2UC 5EBDA 2Z8LA 3KUPA 1Y8OB 4LF6L 3AFQA 4DV0Q 3I4NB 4G57A 4KHPL 4DFAA 2F0VA 3RLFA 1C4QA 4LK1C 1UAPA 4C56C 2J4XA 2A6ED 5M5WH 4DV5L 1Y1WH 3HOUH 1GHJA 1UWVA 1T9HA 3DMUA 3NBHB 1CSQA 2N78A 5C0XJ 3J7AF 3CQZB 2NVYH 4FYDA 2Q2UA 1JR0D 1Q46A 2LS01 3TDQA 1EYAA 1WJJA 4OIJA 2R93B 1D6EC 4JI7Q 3PCOB 3I55A 1L1OB 3S2DH 3ULJA 4CJ2C 3QJYA 1TXYA 1B8AA 1SJHD 2MHVA 1S5FD 1KQSA 2NTTA 2EE1A 2KEDA 4R4TA 1DOKA 4J8QA 1PH1A 4DV6L 4IJLA 2F3WA 5FLMG 4BBRB 1V1QA 4RH6A 1TWHH 1BDOA 2LXKA 4A3FH 3T4AC 3GTPB 2K5QA 3A5UA 4BY7G 1RHPA 1E3PA 3UE0A 4A93B 1MSHA 4JBJA 1I6HB 1LTLA 2OTLA 2N49A 2HIVA 2PZTA 4IPHA 5FJ8H 5C6AA 1P16A 1XNRQ 1PTOH 4G4KA 2B8FA 3H0GH 1B4OA 1DJRD 2IW3A 4L5TA 1LUZA 2HQLA 4DNRB 4F7XA 4G7ZC 2Z1CA 2JA6G 1JQYD 4UHVA 1L0XB 3BVZA 3NXWA 2F3VA 4FO2A 4GKKQ 2LXJA 3CKIB 1JOQA 2LMCB 1F9PA 1FNVA 1STGA 3GQBA 1WOCA 2QDLA 3VR3A 1VQMA 3HP3A 2NN6G 3LWEA 5M3MB 1SNOA 2Z6BA 1YIJA 1KABA 3F2BA 3R93A 5CV7A 4DR5L 4H02A 4LF8Q 4GLAC 3GTMB 1LACA 2KCNA 4IJHA 3E0JA 5D3DA 2ASBA 4B3SQ 1AH9A 1W2BA 4OXPA 3CAMA 3OYYA 1H9RA 1L1OA 2F0OA 2LFNA 4M8AA 1Q86C 5D3IB 5C0XG 3BG3A 4FF1A 3QO2A 1EU4A 2B3GA 3VDYA 3D4RA 4FF4A 1FGBD 1J8IA 3BZDB 1MHWC 1PFMA 2AUKA 1ENAA 1C8CA 1WCMB 5M3FB 1QG7A 4A3EG 5BR8L 3QB3A 3H15A 1BVSA 2RCNA 2DJGC 4EQPA 1VQJA 3MXNA 3H3VH 5FLMH 2NVTH 1WTHA 2X6GA 4DGZA 4DXGA 3M7GA 3O13A 2Q2IA 1BO0A 1QWYA 3K59A 1Z9FA 1GM5A 4BY7H 1AFPA 1PRTF 4B3RQ 1Y1VG 2F0WA 3SK4A 2NN6I 4QUCA 2JJQA 4BA2I 2UXCQ 1I4RA 1OXTA 1X9NA 4I7ZC 3S1QB 1K8OA 3KF8B 1CHPD 3KK7A 4OX9Q 3M3YH 4DR6Q 2JA6H 2AQ2B 1UUPA 4KLKA 4YHHQ 2UUCL 3X3NA 1B50A 3PIP3 3CXCA 5C4ZA 1TKWB 3KYHC 4BY1G 3HOWB 1VMCA 1K3BC 2NN6H 5C4HA 2UXDQ 1PTOF 5C0XI 1Q1EA 4WJWA 1EL0A 1O80A 2VW9A 3E3XA 1MJEA 2O4XA 1PFBA 3K7UC 1D5MC 4X3KA 4K5VA 2YV5A 4C1NK 2KCTA 4CKBA 3NENA 2F03A 4JYAL 1LLRD 2YTXA 3D3RA 2NB0A 3QR8A 5FLXc 2TSSA 4DAMA 4C3HG 1ESFA 4UP8A 1VQKA 3GV6A 1NAPA 1QNKA 2CQOA 3K5OA 3G7LA 1G2SA 4LF7L 1CUKA 4POFA 1AW7A 4B9XA 1VQIA 4C3JB 1LYLA 2CVRA 2EXZA 3A7AB 1P8LA 4A3EH 5JPNC 3W1BA 4WJ4A 1FJGQ 2F52A 4HJAA 1X3GA 3FHWA 2N3SA 4KY6A 2UUAL 1IW7C 1JE5A 3MWYW 2CWAA 2KHIA 5IGEA 5A2QE 4X3UA 2JA8G 1U4MA 1SMYC 3TP8A 2MO1A 1K3RA 1Y1VH 4HEDA 5C5LA 2XGTA 1HUMA 2ICEC 5IE8A 4GKJL 3MHBA 1J6QA 3HOZB 1TS4A 2ALYB 3PQIA 3RN5A 5NUCA 5IGGA 1XMOQ 4DR7Q 4YWKA 4JVZA 3M4PA 3IFDA 3S1MH 3M9BA 3MFYA 1Z7TA 1SYGA 3I3CA 1VDZA 2D62A 3ER0A 1FR3A 5KEEA 4BY1H 4ILWA 3FDTA 5L37A 3ERQA 4DXFA 5TSSA 3AYHB 2KECA 4KD3A 3J7AV 3DWAA 1G6PA 3P1HA 2Z4IA 2QGQA 2K04A 1CZGA 1XXGA 3R3OA 3U9OA 4X65Q 5C44B 3T1YQ 4HIOA 2MP1A 1XMQQ 1EQVA 4KD4A 3D6CA 2AQ3B 3V96A 5DLQE 2OF1A 2AWOA 4OONA 4KN4C 4A4IA 4C3HH 1J9OA 2F0KA 5M5XB 1DD2A 5IGDA 1BCPB 3U9SA 4ALPA 3S1NB 4L5RC 3OIPA 1RL2A 1TS5A 2YU9B 3VA5A 1LV9A 4FF3A 1GUTA 2AMCB 3I73A 2F0EA 4JI6Q 1FYCA 3GTGH 2R7DA 5A35A 5FLXL 4IOAA 2VNUD 3EVQA 2B2YA 2I5LX 3L7ZC 1E22A 5IOCA 1HZCA 4XYOA 3T16A 2BA1A 2JA8H 1E0BA 2A68D 5M5WB 1IW7D 3EROA 3NELA 1Y1WB 3HOUB 1HNWL 3GTLH 5J22A 3S17H 1NBWA 2NVYB 4F88A 4JI5L 5IYBG 1D1IA 1QZHA 2RVLA 3NPPA 4ZYSA 2AQ1B 2UXBL 1K73C 1KDCA 1MIUA 4LF4L 1V1PB 4GN5A 3A5ZB 1FL0A 1PRTB 1F2LA 4DR1Q 1GO3E 4UPAA 4FF2A 5IP7G 5C3EH 1VQ7A 2ZJQA 2HQEA 3FKIB 1MD2D 2IL8A 3GTJB 1TU2B 4R4IA 3IAYA 3MXGA 1PMRA 1Q8IA 4A3DG 2OCEA 2CCZA 1CA6A 1HA5A 4K5WA 1QUQB 4O42A 2E2JH 4IALA 2CH4W 3U50C 2A19A 5C4XB 3N6RA 3GTKB 2D0PA 2VXWA 2VUMG 3H0GB 1C7YA 5JJLA 1C9OA 4B3ML 4LF9Q 3CPFA 3S16H 1GOZA 4HMJA 2MPMA 5IT9c 1R9TH 1EFWA 4JI1Q 1HTLD 2JYOA 4AIMA 2ZJRA 4ZUJA 2B29A 4QQBX 4X3TA 1VQAA 1N36Q 4HCSA 2SOBA 2HHHQ 4DK3C 2OWOA 4NXML 1B2TA 4LJZC 1HRJA 1U5KA 2L55A 1VQ4A 5GADC 3CCMA 2R92G 2A73B 5IYBH 2IX1A 4NXNL 2PI2A 2A69C 2L4NA 1CM9A 1G291 3PIPA 2BDOA 4GS3A 4KJOA 4L6TB 3HOVG 1EZ8A 3RLNA 2QEJC 3U58A 1YEZA 1EQTA 1JMCA 1Q81C 2EQSA 1IBLQ 3SK8A 2EYLA 5LMUL 4DV0L 3FPUB 4HJ9A 4MTKA 5E3FA 3EBEA 4K14A 1K8MA 4IZ8A 3ITPA 4PZ7A 4HN7A 3RR5A 2MUYA 5KNCA 1ILPA 3EN2A 1ASYA 1TWGB 1C48A 1QUQA 1HJPA 1NR2A 2TMPA 3QG1A 3CCEA 4A3DH 3K7AB 5EPKA 3T13A 4OEMB 4BY7B 3FVQA 1S3OA 3OW2A 1EIGA 5J39A 4XQNA 3C3LA 4JI7L 4FNFA 4R4QA 4RGTA 4DV2Q 2VUMH 3M4OB 1Q82C 3ND8A 4LFBQ 1LTBD 1X55A 5EKIA 3ONAB 2CW0D 2A6HD 3M3YB 2JA6B 3F1ZA 3NP8A 2JA5B 1VQNA 5CV9A 5LL6X 4HSVA 4DV4L 1SYEA 1WTWA 3S24A 5I9PA 1JC7A 1VQHA 1AZQA 1VQCA 2B2VC 1RCVD 5ELFA 1VF7A 3LX0A 2KA7A 4EQNA 2KOLA 2EYFA 4RHRA 4TRDA 2RCFA 5GAEC 3I8ZA 2A1AA 3I72A 1XNRL 3A8IE 2EYPA 5KNBA 3K5LA 5IT9L 4IO9A 3KJOA 1JOKA 3RLOA 2PQAA 1H9KA 5D14A 3HEJA 2R92H 1DONA 1U4RA 5DNFA 2NYZD 4AYBG 4HCEA 2Y0SE 4CJ1B 3LGJA 1RKNA 3KFUA 1JJCB 3WWVA 4GKKL 4DAPA 4KV6A 3VYSA 2A69D 4TKOB 2SNMA 1GUOA 4R4CA 1IYJB 2G5DA 4PZ6A 3M4QA 2IT1A 1IYUA 4A3KG 4A3EB 3ERSX 1EY0A 2AHOB 2IJ0A 4CKEA 5ELBA 1WTOA 4LF8L 4Z9CB 5IGBA 4A3JG 5EGTA 4DN4M 2NTSA 4Q5VA 1TR5A 3PF4A 4B3SL 1NUCA 2RHQB 4R4OA 4KTAA 1PH7A 1Y1VB 1SDFA 2K03A 1LTAD 5AFWA 3SK5A 1CI3M 2L1BA 2EDGA 2QDBA 2QA4A 1F9SA 1QNUA 4LAAA 2HD3A 5FKAC 5I2YA 5JVG3 3MXUA 1TVXA 4GNXC 1UEBA 1PV4A 3HKSA 1B3AA 4KN7C 2A5HA 4BY1B 4A3IG 3A54A 2EYJA 4B3RL 1GXDC 2C9OA 4IFDJ 2P5ZX 2JQOA 2RKSA 2UXCL 2K5VA 3PUXA 4XQJA 2CHBD 4A3GB 2R7ZB 4DR6L 1BBUA 4C3IG 1N33L 1FNUA 4GOPC 1KDBA 5FO7B 1HUNA 1NY4A 4YHHL 1NE3A 4C3HB 1JCKB 4QMGA 1AZPA 4X64Q 1NCVA 5C4JB 4K6DA 2B2UA 2EYHA 1YJ9A 2UXDL 2ZM6Q 2B63B 4P74A 3S2HH 3S15B 3W5OA 1O7YA 2PI2E 4A3KH 1VQOA 3AMUA 3GTGB 2FHTA 1TWFH 2WKCA 3OHXC 4RAUC 4Q0FA 3A0JA 1HPCA 4RGNA 4LFAQ 4Y7NB 2HCCA 4A3JH 4B3TQ 4CJ0B 2NZ1D 1QB5D 3QWNA 2F0QA 3PMFA 1H9MA 2R61A 3EQLC 1O7IA 3CRLC 4RGMA 4OO1G 2F0JA 3J81j 2ZTEA 4CDCC 4HAEA 4RGOS 3H94A 1BKBA 4IQZA 2F4VL 5CC4A 3MC0B 3NWSA 4R9WA 3RMHA 1L0YB 2WAQE 1NMGA 1K8GA 2WIIB 3RZDH 2BH8A 3TBIB 4A3IH 1EIYB 3KBXA 1VQ5A 1NJIC 3OPOA 1STYA 1B1ZA 1I4HA 2K5DA 1VQEA 1N34Q 2WFWA 3MXNB 2E76C 1XJVA 2B39A 4AQYQ 1XPUA 4QIWB 2BA0A 1X3QA 4JPBW 4MIUA 5DM73 2ZXOA 1D5ZC 3S9WA 4HJ8A 4B9WA 1XTDA 2RSOA 1KDAA 2RDFA 2Q2TA 1IKMA 4DR7L 1DOMA 3CCRA 3F2DA 2XTIA 4I7AA 2E2JB 4C3IH 1SSOA 4A76A 5K36G 3NTIA 3TZDA 5BN4A 4IFDG 4N9TA 2Z6KC 4HTHA 3BZCA 3G48A 2AKWB 4IUUA 5JJKA 3NEMA 3S16B 2N88A 1RIPA 4OL7A 5G3LF 3OWFA 5I6YA 4LF5L 4OO1I 1VQFA 1R9TB 1YJWA 2LKVA 3ZYYX 4QY7A 1TS3A 1JJGA 5ELDA 1W6KA 4EQOA 4N9PA 4X65L 2KCMA 2JA7G 1XMQL 1QZGA 3NQTA 1UE6A 5COYA 5E4WC 5FO9B 1A8VA 3K0YA 1HZAA 4X6AH 1TS2A 1TY0A 1GHKA 3J7A5 2EY2A 4KKSA 4OO1H 3H3VI 4IPGA 1EY9A 1X54A 3ND9A 1UNSA 4RA8A 1R4PB 4KKUA 4CDDC 4DR3Q 5CBAE 1F2MA 1SFOH 1B70B 3BDLA 3G71A 1HHVA 1ZYRC 2UUBL 1FVIA 2BDNA 1LT6D 1EU3A 4PG3A 4JI6L 3SVMA 3MA2B 1U0LA 5FO8B 1LTID 1LT4D 2GA4B 3A55A 2F0TA 4IFDI 1GUNA 1NSNS 2HCIA 5DEHA 2WB1G 1DXMA 3CCVA 1M4VA 1VQDA 2PMZE 1M1KC 3FP9A 1HNZQ 5ELCA 5KRUA 2I07B 1HA6A 2OT2A 4JI2L 1CQFA 3I70A 2YYZA 4IOCA 2HDLA 2BE5C 2VQFQ 3CRKC 3TS2A 5C3XA 1SJED 2Z4HA 4KMUC 3TZUA 4LW1A 5T1IA 1OXUA 3SXHA 3E9HA 3K6OA 5K36H 2VB3X 2AWNA 3S14H
chains in the Genus database with same CATH topology
2R7DA 1CSPA 1G51A 4X62L 4O2DA 3CMAA 4IOAA 2VNUD 2NZHA 1I3QH 2I5LX 4KI0A 4GNXB 3HOZG 4DR4L 3L7ZC 1MKHA 1E22A 3UDXA 4POGA 1SN8A 1HZCA 2H5XA 2BA1A 1N34L 4A3LG 2JA8H 3K0XA 4AQYL 5LMUQ 1I94Q 3G4SA 1PA6A 2K52A 1MJCA 3E9IA 1K0RA 3NELA 5LMNL 1HNWL 1VQ6A 4EQ5A 5M5YH 3U4VA 3GTLH 2ATWA 1FGUA 1VQGA 3HFZB 5GAGC 3S17H 1NBWA 1KD1C 1CKOA 5IWAL 5IYCH 1IXRA 1PH6A 4DUYL 1XPRA 4JI5L 2RHSB 4DAYB 5IYBG 2JA7H 5ELNA 4LUOA 1QZHA 2WP8J 4JI0Q 1FJGL 3PO2H 3J7ZC 2UXBL 4QL5A 1EIFA 2CWPA 1PFSA 4YWLA 5AJ3Q 1K73C 3CD6A 3HOYG 4X62Q 1MIUA 4LF4L 4DR4Q 4GN5A 2WB1E 3A5ZB 4MTNA 1FL0A 3K81C 4AH6A 4IPCA 4DR2L 1YI2A 4DR1Q 1GO3E 3JAMc 3UDIA 1QVCA 2R6GA 3GTQH 4UPAA 2VZAA 5IP7G 5C3EH 2I5HA 1VQ7A 3PO3G 2MO0A 5H1SE 1KHIA 2ZJQA 5LMNQ 1HNWQ 3RNUA 1I50H 1I5FA 1L2FA 3EIVA 3ULLA 4JI1L 1OXVA 1X56A 1UE1A 4R4IA 3CC7A 1XMOL 4DV5Q 1BBWA 1EWIA 4DUYQ 1TWCH 2JA9A 1K8AC 4DV4Q 3FKIH 3GTJH 3GTOH 2KHJA 4A3DG 2OCEA 2CCZA 1A62A 3HOVH 2Z6KA 4HJ7A 3KF6A 2UXBQ 3E0EA 1QUQB 4C3JH 5IY0A 3ICEA 2E2JH 4A3BH 3U50C 2A19A 2HHHL 2NZOA 2D0PA 3KDFB 3U4ZA 4X66Q 1YJNA 2VUMG 1KXLA 1PH3A 2DGYA 3GO5A 1Q8KA 1C7YA 5JJLA 1C9OA 4DR3L 4HIMA 4B3ML 4LF9Q 3CPFA 4XTCS 4HJ5A 2KBNA 2VS1A 3W1GA 2V1CC 5C4XH 3S16H 3GTKH 4JI4L 1JT8A 5IT9c 1YNXA 4YY3Q 1R9TH 1EFWA 3J80c 5EAYA 3T1YL 4JBWA 3I4NG 4JI1Q 1Y1WG 3HOUG 1A0IA 4DPGA 4AIMA 4IPDA 2ZJRA 1OXXK 3JAMi 1HR0W 1Q1BA 4O0AA 3OTOL 1S40A 4K0KL 2B29A 4A75A 3ULPA 4UP9A 2JA5G 1XPOA 4QQBX 1HNXL 2RF4A 3HOZH 4DV6Q 1YBYA 1IBLL 1QVFA 2D0OA 4NB3A 5GROA 1VQAA 1E1OA 1YHAA 4A3LH 1N36Q 1M90C 4LUZA 2HHHQ 4DK3C 2OWOA 1N8RC 4NXML 3PUWA 3HKZG 4RMFA 4BBSG 2C35B 4R1JA 1IZ6A 1CKMA 4YWMA 1KRSA 2VY3A 1U5KA 2R93G 5C3EG 4B3MQ 2Z0SA 4LF7L 1VQ4A 2ID0A 1L0WA 4PMWA 2JE6I 2OQ0A 5GADC 3CCMA 4HIDA 4JI4Q 2R92G 1LM0A 2Q2HA 1J5EQ 5IYBH 2IX1A 4A3BG 2E2IH 4NXNL 2PI2A 3G6EA 4DV7Q 2OQKA 4JC0A 2K75A 1G291 3PIPA 4GS3A 3OTOQ 3HOYH 4K0KQ 3I2ZA 3HOVG 1ASZA 3RLNA 3U58A 1HNXQ 1IBML 1YEZA 3BU2A 5J3BA 3TQYA 4DV2L 2EQSA 1Q81C 1L1OC 1IBLQ 1JMCA 3J80i 3TREA 1SROA 4A3FG 5LMUL 4DUZL 4DV0L 3KF6B 4BBRG 4LFBL 5JJIA 2GVAA 2GN5A 4HJ9A 4NXMQ 5FJ8G 3PO3H 3EBEA 1SR3A 3RZOH 3HOXG 4WJ3M 1HZBA 3BZKA 4PZ7A 4A93G 1N32L 4LF7Q 3RR5A 3H0GG 2WAQG 3EN2A 2MNAA 4GLXA 3GD7A 1ASYA 1QUQA 1HJPA 2NVXH 1AE2A 3DLLA 1PVOA 5IYDG 3CCEA 3CCLA 1IL2A 4A3DH 2LSSA 3JC66 5AJ3L 2K14A 2UU9Q 1TWGH 1NMFA 1S3OA 4FDBA 3KDFA 3OW2A 1X65A 2HIXA 4JI7L 3K7AH 4DR1L 4R4QA 1IBMQ 3CC4A 3D31A 4DV2Q 1YHBA 2VUMH 5HY6A 4LF6L 3AFQA 4DUZQ 1Q82C 4DV0Q 4LFBQ 3M85A 4KHPL 1X55A 1N9WA 2L15A 3RLFA 3RN2A 3I4MG 1K9MC 3TS0A 3M4OH 1Z47A 3CP0A 4JI3L 1PYSB 3F1ZA 5M5WH 4DV5L 1E24A 1VQNA 3PUVA 5M3MG 3I4NH 1Y1WH 3HOUH 1N32Q 1SMXA 1PH8A 2IY5B 1UWVA 4DV4L 1T9HA 3NBHB 3S24A 1CSQA 2N78A 4QIWE 5C0XJ 2I0QA 1VQHA 3CCSA 1N33Q 1VQCA 2NVYH 2JA5H 4Y52H 2R7FA 2Q2UA 3S1RH 1VQLA 1HR0L 1Q46A 1WJJA 3CQZH 1KIXA 4X66L 4JI7Q 4C2MH 4TQUS 5GAEC 3PCOB 5GQOA 1JJ2A 1A63A 2A1AA 3F8TA 4LF9L 1PH9A 4BBSH 3PUZA 1XNRL 3I55A 4LF6Q 1L1OB 3T1HL 3S2DH 4IO9A 2R93H 3KJOA 4YY3L 4KHPQ 3RLOA 3ULJA 2PQAA 3K8AA 4BA2I 2R92H 4JI3Q 3GDEA 1TXYA 1B8AA 1KQSA 4AYBG 2JEAI 3CW2C 3B6YA 2Y0SE 4P71A 4R4TA 1PH1A 3LGJA 3KFUA 1JJCB 4DV6L 4IJLA 3WWVA 1WCMG 5IP9G 5M3FG 2R7ZG 4A3GG 4GKKL 5FLMG 1GD7A 1V1QA 1TWHH 1N36L 1HR0Q 4A3MG 2LXKA 4A3FH 2GVBA 3A5UA 4JBMA 4R4CA 4BY7G 4BBRH 1E3PA 3UE0A 1IYJB 4JBJA 4PZ6A 3M4QA 4MNOA 1LTLA 2IT1A 1VQ9A 2OTLA 2N49A 2HIVA 4IPHA 5FJ8H 3ERSX 3PGZA 4A3KG 3HOXH 1DGSA 1P16A 1XNRQ 2AHOB 3GTPH 3T1HQ 2B63G 2F4VQ 4A93H 3H0GH 1J5EL 4LF8L 4L5TA 1LUZA 2HQLA 3A74A 2VQEL 2QEXA 4DV7L 4A3JG 2PNHA 1AE3A 1SE8A 1PH5A 5IYDH 2JA6G 2OTJA 3PF4A 4B3SL 4P75A 1H95A 2RHQB 4R4OA 1Q7YC 1PH7A 5GAHC 3PUYA 4GKKQ 2LXJA 4HIKA 5JEAJ 1WOCA 1YITA 2QA4A 1E1TA 1VQMA 2NN6G 1KL9A 2F3IA 4P72A 3I4MH 1YIJA 3HOWG 1EYGA 3F2BA 4DV1L 4YCWA 4KHZA 4GNXC 1UEBA 4DR5L 1PV4A 5M3MH 4H02A 3HKSA 3F2CA 1D8LA 1YHQA 4LF8Q 4GLAC 2VQEQ 2CKZB 2PQAB 3STBC 3J81c 3AEVA 2UU9L 4IJHA 1UE7A 1EQRA 3MEFA 4GN3B 4A3IG 1KC8C 4L5SA 4OWWB 2ASBA 1HH2P 4B3SQ 1AH9A 1OTCA 1W2BA 3GTMH 2MQHA 2YTYA 4OXPA 5HGQA 2ZM6L 4DV3L 3CAMA 3OYYA 1L1OA 1SRUA 4B3RL 1Q86C 4LF5Q 3I56A 4JG2A 5C0XG 4IFDJ 4OWTB 5E7NA 2EIFA 4P73A 2E8GA 2JQOA 1PH4A 2UXCL 2B3GA 3VDYA 2K5VA 3PUXA 3UDFA 2ZTDA 4B3TL 4GKJQ 3PSIA 4DV1Q 4ME3A 4DR6L 1BBUA 4DR5Q 4A3EG 1N33L 5BR8L 3H15A 4GOPC 1BVSA 2RCNA 1NY4A 4YHHL 1NE3A 1VQJA 3M7NA 1WCMH 5IP9H 5M3FH 2BH2A 2R7ZH 4A3GH 4LNQA 5FLMH 2NVTH 4X64Q 3CCQA 3H3VH 4A3MH 1YJ9A 2Q2IA 1QVGA 2HT1A 4BY7H 1Z9FA 2ZM6Q 4DV3Q 4P74A 1GM5A 3S2HH 2UXDL 1PHJA 4B3RQ 5C4JH 3W5OA 3J81i 1Y1VG 2PI2E 3DM3A 4APVA 3HKZE 2NN6I 4A3KH 1VQOA 1XNQL 2MFIA 1KAWA 1TWFH 2JJQA 4NPSA 2B63H 1CKNA 4YCVA 3S15H 2UUBQ 3A0JA 4JBKA 2UXCQ 1OXTA 1C0AA 2E5LL 4LFAQ 1X9NA 3IRBA 4PZ8A 1X6OA 3CPWA 4A3JH 4B3TQ 3KF8B 4OX9Q 3AFPA 1YZ6A 2K50A 3M3YH 4DR6Q 1GVPA 4RG1A 2ES2A 5BR8Q 2JA6H 1Y14B 3S1QH 4Y7NH 3I7FA 4KLKA 4YHHQ 4BXXG 2UUCL 1NTGA 1EOVA 1O7IA 3CXCA 4OO1G 1GKHA 3KYHC 2JEBI 3J81j 4BY1G 4LUVA 2ZTEA 4JI2Q 2NVQH 2UXDQ 4BA1I 3BJUA 5C0XI 1BKBA 1Q1EA 1V43A 2F4VL 3HOWH 2VW9A 3CC2A 4A3CG 1MJEA 1XNQQ 3K7UC 3L0OA 1HZ9A 3Q8DA 2YV5A 2E5LQ 2WAQE 4JCVE 5JEAG 1NMGA 2KCTA 1VQPA 1K8GA 3NENA 1V9PA 4JYAL 3RZDH 2YTXA 2BH8A 3CMEA 4A3IH 5C44G 5FLXc 1EIYB 2JK8A 1VS0A 4DAMA 1VQ5A 4GOPB 1NJIC 2UUCQ 2YU9H 3D0FA 2CFMA 1S72A 3I4OA 3STBD 1VQEA 1N34Q 2WFWA 1PYBA 3MXNB 1XJVA 4UP8A 1K83H 1Q12A 4AQYQ 3KLWA 4OWXB 2BA0A 1VQKA 1XPUA 4TVAB 2CQOA 4JI8L 1CUKA 4HJ8A 1XTDA 4DNIA 4POFA 1X3FA 2KENA 1VQIA 1W3SA 4JOIA 4JOIC 5IWAQ 3CCRA 2Q2TA 4DR7L 4JI5Q 1I6HH 1LYLA 2XTIA 3F2DA 1VCIA 1P8LA 4C3IH 4A3EH 4A76A 5K36G 3W1BA 4WJ4A 1FJGQ 4QJFA 1CKNB 2F52A 3K80C 1WI5A 4HJAA 1X3GA 3FHWA 2Z6KC 3PIOA 4IFDG 1WYDA 3ZJYC 3KJPA 2N3SA 1E7ZA 3CCUA 2UUAL 3BZCA 4LFCL 1JE5A 4JYAQ 3G48A 2AKWB 5JJKA 3NEMA 2CWAA 4LF4Q 1RIPA 2KHIA 5LMNW 2K5HA 2JA8G 2IX0A 4LF5L 4OO1I 1VQFA 4DR2Q 2MO1A 1YJWA 2YTVA 3KOJA 1K3RA 2EXDA 1Y1VH 4QY7A 1JJGA 2E2HH 2XGTA 5IYCG 3CCJA 5IE8A 4GKJL 4JI8Q 4X65L 1J6QA 1WFQA 2ALYB 2KCMA 1OXSC 4GNXA 3RN5A 1XMQL 2JA7G 2A8VA 1XMOQ 4GLVB 2ZJPA 4YWKA 1QZGA 1VQBA 3M4PA 3TRZA 1UE6A 3SGIA 4DR7Q 3PO2G 1EQQA 4L5QA 1A8VA 4AYBE 1HZAA 3S1MH 3M9BA 3PV0A 4X64L 4BXXH 4X6AH 1KRTA 2D62A 3UE1A 3J7A5 2UUAQ 4LFCQ 4YCUA 4J15A 1HNZL 3PF5A 4QGUA 3ER0A 1IBKL 3H3VI 4EX5A 4IPGA 3CF5A 4BY1H 1X54A 3AQQA 2K5NA 4MZ9A 1SLJA 2ZTCA 1EUJA 2IHFA 3AYHB 2VQFL 2DUDA 4XIGS 2K4KA 4DR3Q 1SFOH 1PH2A 1B70B 2VL6A 1G6PA 2IHEA 3G71A 4UY8C 4A3CH 4JV5L 2UUBL 4UP7A 1FVIA 1TWAH 2QGQA 4LFAL 4JI6L 4PG3A 1B7YB 4DKAC 3T1YQ 4X65Q 3UDGA 4OX9L 1VQ8A 4HIOA 1U0LA 1XMQQ 1UE5A 3FKIG 4GOPA 4GN4B 2N8NA 5C44H 4IFDI 3L2PA 2WB1G 5DLQE 3CCVA 1X3EA 2AWOA 4OONA 1VQDA 4A4IA 2PMZE 3TEHB 1YVCA 1M1KC 1I94L 3FP9A 1HNZQ 5ELOA 4C3HH 1IBKQ 4JI2L 4LWCA 5IP7H 2YYZA 4ALPA 1D7QA 4IOCA 4DK6C 1JB7A 5C4XG 2VQFQ 4L5RC 1RL2A 5M5XH 3TS2A 4LW1A 4JV5Q 2I5MX 1OXUA 4JI0L 2Y0SG 3E9HA 3S1NH 2AMCB 4JI6Q 2FXQA 4NXNQ 2AWNA 3GTGH 3S14H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  1CSP A;  1G51 A;  4X62 L;  4O2D A;  3CMA A;  4IOA A;  2VNU D;  2NZH A;  1I3Q H;  2I5L X;  4KI0 A;  4GNX B;  3HOZ G;  4DR4 L;  3L7Z C;  1MKH A;  1E22 A;  3UDX A;  4POG A;  1SN8 A;  1HZC A;  2H5X A;  2BA1 A;  1N34 L;  4A3L G;  2JA8 H;  3K0X A;  4AQY L;  5LMU Q;  1I94 Q;  3G4S A;  1PA6 A;  2K52 A;  1MJC A;  3E9I A;  1K0R A;  3NEL A;  5LMN L;  1HNW L;  1VQ6 A;  4EQ5 A;  5M5Y H;  3U4V A;  3GTL H;  2ATW A;  1FGU A;  1VQG A;  3HFZ B;  5GAG C;  3S17 H;  1NBW A;  1KD1 C;  1CKO A;  5IWA L;  5IYC H;  1IXR A;  1PH6 A;  4DUY L;  1XPR A;  4JI5 L;  2RHS B;  4DAY B;  5IYB G;  2JA7 H;  5ELN A;  4LUO A;  1QZH A;  2WP8 J;  4JI0 Q;  1FJG L;  3PO2 H;  3J7Z C;  2UXB L;  4QL5 A;  1EIF A;  2CWP A;  1PFS A;  4YWL A;  5AJ3 Q;  1K73 C;  3CD6 A;  3HOY G;  4X62 Q;  1MIU A;  4LF4 L;  4DR4 Q;  4GN5 A;  2WB1 E;  3A5Z B;  4MTN A;  1FL0 A;  3K81 C;  4AH6 A;  4IPC A;  4DR2 L;  1YI2 A;  4DR1 Q;  1GO3 E;  3JAM c;  3UDI A;  1QVC A;  2R6G A;  3GTQ H;  4UPA A;  2VZA A;  5IP7 G;  5C3E H;  2I5H A;  1VQ7 A;  3PO3 G;  2MO0 A;  5H1S E;  1KHI A;  2ZJQ A;  5LMN Q;  1HNW Q;  3RNU A;  1I50 H;  1I5F A;  1L2F A;  3EIV A;  3ULL A;  4JI1 L;  1OXV A;  1X56 A;  1UE1 A;  4R4I A;  3CC7 A;  1XMO L;  4DV5 Q;  1BBW A;  1EWI A;  4DUY Q;  1TWC H;  2JA9 A;  1K8A C;  4DV4 Q;  3FKI H;  3GTJ H;  3GTO H;  2KHJ A;  4A3D G;  2OCE A;  2CCZ A;  1A62 A;  3HOV H;  2Z6K A;  4HJ7 A;  3KF6 A;  2UXB Q;  3E0E A;  1QUQ B;  4C3J H;  5IY0 A;  3ICE A;  2E2J H;  4A3B H;  3U50 C;  2A19 A;  2HHH L;  2NZO A;  2D0P A;  3KDF B;  3U4Z A;  4X66 Q;  1YJN A;  2VUM G;  1KXL A;  1PH3 A;  2DGY A;  3GO5 A;  1Q8K A;  1C7Y A;  5JJL A;  1C9O A;  4DR3 L;  4HIM A;  4B3M L;  4LF9 Q;  3CPF A;  4XTC S;  4HJ5 A;  2KBN A;  2VS1 A;  3W1G A;  2V1C C;  5C4X H;  3S16 H;  3GTK H;  4JI4 L;  1JT8 A;  5IT9 c;  1YNX A;  4YY3 Q;  1R9T H;  1EFW A;  3J80 c;  5EAY A;  3T1Y L;  4JBW A;  3I4N G;  4JI1 Q;  1Y1W G;  3HOU G;  1A0I A;  4DPG A;  4AIM A;  4IPD A;  2ZJR A;  1OXX K;  3JAM i;  1HR0 W;  1Q1B A;  4O0A A;  3OTO L;  1S40 A;  4K0K L;  2B29 A;  4A75 A;  3ULP A;  4UP9 A;  2JA5 G;  1XPO A;  4QQB X;  1HNX L;  2RF4 A;  3HOZ H;  4DV6 Q;  1YBY A;  1IBL L;  1QVF A;  2D0O A;  4NB3 A;  5GRO A;  1VQA A;  1E1O A;  1YHA A;  4A3L H;  1N36 Q;  1M90 C;  4LUZ A;  2HHH Q;  4DK3 C;  2OWO A;  1N8R C;  4NXM L;  3PUW A;  3HKZ G;  4RMF A;  4BBS G;  2C35 B;  4R1J A;  1IZ6 A;  1CKM A;  4YWM A;  1KRS A;  2VY3 A;  1U5K A;  2R93 G;  5C3E G;  4B3M Q;  2Z0S A;  4LF7 L;  1VQ4 A;  2ID0 A;  1L0W A;  4PMW A;  2JE6 I;  2OQ0 A;  5GAD C;  3CCM A;  4HID A;  4JI4 Q;  2R92 G;  1LM0 A;  2Q2H A;  1J5E Q;  5IYB H;  2IX1 A;  4A3B G;  2E2I H;  4NXN L;  2PI2 A;  3G6E A;  4DV7 Q;  2OQK A;  4JC0 A;  2K75 A;  1G29 1;  3PIP A;  4GS3 A;  3OTO Q;  3HOY H;  4K0K Q;  3I2Z A;  3HOV G;  1ASZ A;  3RLN A;  3U58 A;  1HNX Q;  1IBM L;  1YEZ A;  3BU2 A;  5J3B A;  3TQY A;  4DV2 L;  2EQS A;  1Q81 C;  1L1O C;  1IBL Q;  1JMC A;  3J80 i;  3TRE A;  1SRO A;  4A3F G;  5LMU L;  4DUZ L;  4DV0 L;  3KF6 B;  4BBR G;  4LFB L;  5JJI A;  2GVA A;  2GN5 A;  4HJ9 A;  4NXM Q;  5FJ8 G;  3PO3 H;  3EBE A;  1SR3 A;  3RZO H;  3HOX G;  4WJ3 M;  1HZB A;  3BZK A;  4PZ7 A;  4A93 G;  1N32 L;  4LF7 Q;  3RR5 A;  3H0G G;  2WAQ G;  3EN2 A;  2MNA A;  4GLX A;  3GD7 A;  1ASY A;  1QUQ A;  1HJP A;  2NVX H;  1AE2 A;  3DLL A;  1PVO A;  5IYD G;  3CCE A;  3CCL A;  1IL2 A;  4A3D H;  2LSS A;  3JC6 6;  5AJ3 L;  2K14 A;  2UU9 Q;  1TWG H;  1NMF A;  1S3O A;  4FDB A;  3KDF A;  3OW2 A;  1X65 A;  2HIX A;  4JI7 L;  3K7A H;  4DR1 L;  4R4Q A;  1IBM Q;  3CC4 A;  3D31 A;  4DV2 Q;  1YHB A;  2VUM H;  5HY6 A;  4LF6 L;  3AFQ A;  4DUZ Q;  1Q82 C;  4DV0 Q;  4LFB Q;  3M85 A;  4KHP L;  1X55 A;  1N9W A;  2L15 A;  3RLF A;  3RN2 A;  3I4M G;  1K9M C;  3TS0 A;  3M4O H;  1Z47 A;  3CP0 A;  4JI3 L;  1PYS B;  3F1Z A;  5M5W H;  4DV5 L;  1E24 A;  1VQN A;  3PUV A;  5M3M G;  3I4N H;  1Y1W H;  3HOU H;  1N32 Q;  1SMX A;  1PH8 A;  2IY5 B;  1UWV A;  4DV4 L;  1T9H A;  3NBH B;  3S24 A;  1CSQ A;  2N78 A;  4QIW E;  5C0X J;  2I0Q A;  1VQH A;  3CCS A;  1N33 Q;  1VQC A;  2NVY H;  2JA5 H;  4Y52 H;  2R7F A;  2Q2U A;  3S1R H;  1VQL A;  1HR0 L;  1Q46 A;  1WJJ A;  3CQZ H;  1KIX A;  4X66 L;  4JI7 Q;  4C2M H;  4TQU S;  5GAE C;  3PCO B;  5GQO A;  1JJ2 A;  1A63 A;  2A1A A;  3F8T A;  4LF9 L;  1PH9 A;  4BBS H;  3PUZ A;  1XNR L;  3I55 A;  4LF6 Q;  1L1O B;  3T1H L;  3S2D H;  4IO9 A;  2R93 H;  3KJO A;  4YY3 L;  4KHP Q;  3RLO A;  3ULJ A;  2PQA A;  3K8A A;  4BA2 I;  2R92 H;  4JI3 Q;  3GDE A;  1TXY A;  1B8A A;  1KQS A;  4AYB G;  2JEA I;  3CW2 C;  3B6Y A;  2Y0S E;  4P71 A;  4R4T A;  1PH1 A;  3LGJ A;  3KFU A;  1JJC B;  4DV6 L;  4IJL A;  3WWV A;  1WCM G;  5IP9 G;  5M3F G;  2R7Z G;  4A3G G;  4GKK L;  5FLM G;  1GD7 A;  1V1Q A;  1TWH H;  1N36 L;  1HR0 Q;  4A3M G;  2LXK A;  4A3F H;  2GVB A;  3A5U A;  4JBM A;  4R4C A;  4BY7 G;  4BBR H;  1E3P A;  3UE0 A;  1IYJ B;  4JBJ A;  4PZ6 A;  3M4Q A;  4MNO A;  1LTL A;  2IT1 A;  1VQ9 A;  2OTL A;  2N49 A;  2HIV A;  4IPH A;  5FJ8 H;  3ERS X;  3PGZ A;  4A3K G;  3HOX H;  1DGS A;  1P16 A;  1XNR Q;  2AHO B;  3GTP H;  3T1H Q;  2B63 G;  2F4V Q;  4A93 H;  3H0G H;  1J5E L;  4LF8 L;  4L5T A;  1LUZ A;  2HQL A;  3A74 A;  2VQE L;  2QEX A;  4DV7 L;  4A3J G;  2PNH A;  1AE3 A;  1SE8 A;  1PH5 A;  5IYD H;  2JA6 G;  2OTJ A;  3PF4 A;  4B3S L;  4P75 A;  1H95 A;  2RHQ B;  4R4O A;  1Q7Y C;  1PH7 A;  5GAH C;  3PUY A;  4GKK Q;  2LXJ A;  4HIK A;  5JEA J;  1WOC A;  1YIT A;  2QA4 A;  1E1T A;  1VQM A;  2NN6 G;  1KL9 A;  2F3I A;  4P72 A;  3I4M H;  1YIJ A;  3HOW G;  1EYG A;  3F2B A;  4DV1 L;  4YCW A;  4KHZ A;  4GNX C;  1UEB A;  4DR5 L;  1PV4 A;  5M3M H;  4H02 A;  3HKS A;  3F2C A;  1D8L A;  1YHQ A;  4LF8 Q;  4GLA C;  2VQE Q;  2CKZ B;  2PQA B;  3STB C;  3J81 c;  3AEV A;  2UU9 L;  4IJH A;  1UE7 A;  1EQR A;  3MEF A;  4GN3 B;  4A3I G;  1KC8 C;  4L5S A;  4OWW B;  2ASB A;  1HH2 P;  4B3S Q;  1AH9 A;  1OTC A;  1W2B A;  3GTM H;  2MQH A;  2YTY A;  4OXP A;  5HGQ A;  2ZM6 L;  4DV3 L;  3CAM A;  3OYY A;  1L1O A;  1SRU A;  4B3R L;  1Q86 C;  4LF5 Q;  3I56 A;  4JG2 A;  5C0X G;  4IFD J;  4OWT B;  5E7N A;  2EIF A;  4P73 A;  2E8G A;  2JQO A;  1PH4 A;  2UXC L;  2B3G A;  3VDY A;  2K5V A;  3PUX A;  3UDF A;  2ZTD A;  4B3T L;  4GKJ Q;  3PSI A;  4DV1 Q;  4ME3 A;  4DR6 L;  1BBU A;  4DR5 Q;  4A3E G;  1N33 L;  5BR8 L;  3H15 A;  4GOP C;  1BVS A;  2RCN A;  1NY4 A;  4YHH L;  1NE3 A;  1VQJ A;  3M7N A;  1WCM H;  5IP9 H;  5M3F H;  2BH2 A;  2R7Z H;  4A3G H;  4LNQ A;  5FLM H;  2NVT H;  4X64 Q;  3CCQ A;  3H3V H;  4A3M H;  1YJ9 A;  2Q2I A;  1QVG A;  2HT1 A;  4BY7 H;  1Z9F A;  2ZM6 Q;  4DV3 Q;  4P74 A;  1GM5 A;  3S2H H;  2UXD L;  1PHJ A;  4B3R Q;  5C4J H;  3W5O A;  3J81 i;  1Y1V G;  2PI2 E;  3DM3 A;  4APV A;  3HKZ E;  2NN6 I;  4A3K H;  1VQO A;  1XNQ L;  2MFI A;  1KAW A;  1TWF H;  2JJQ A;  4NPS A;  2B63 H;  1CKN A;  4YCV A;  3S15 H;  2UUB Q;  3A0J A;  4JBK A;  2UXC Q;  1OXT A;  1C0A A;  2E5L L;  4LFA Q;  1X9N A;  3IRB A;  4PZ8 A;  1X6O A;  3CPW A;  4A3J H;  4B3T Q;  3KF8 B;  4OX9 Q;  3AFP A;  1YZ6 A;  2K50 A;  3M3Y H;  4DR6 Q;  1GVP A;  4RG1 A;  2ES2 A;  5BR8 Q;  2JA6 H;  1Y14 B;  3S1Q H;  4Y7N H;  3I7F A;  4KLK A;  4YHH Q;  4BXX G;  2UUC L;  1NTG A;  1EOV A;  1O7I A;  3CXC A;  4OO1 G;  1GKH A;  3KYH C;  2JEB I;  3J81 j;  4BY1 G;  4LUV A;  2ZTE A;  4JI2 Q;  2NVQ H;  2UXD Q;  4BA1 I;  3BJU A;  5C0X I;  1BKB A;  1Q1E A;  1V43 A;  2F4V L;  3HOW H;  2VW9 A;  3CC2 A;  4A3C G;  1MJE A;  1XNQ Q;  3K7U C;  3L0O A;  1HZ9 A;  3Q8D A;  2YV5 A;  2E5L Q;  2WAQ E;  4JCV E;  5JEA G;  1NMG A;  2KCT A;  1VQP A;  1K8G A;  3NEN A;  1V9P A;  4JYA L;  3RZD H;  2YTX A;  2BH8 A;  3CME A;  4A3I H;  5C44 G;  5FLX c;  1EIY B;  2JK8 A;  1VS0 A;  4DAM A;  1VQ5 A;  4GOP B;  1NJI C;  2UUC Q;  2YU9 H;  3D0F A;  2CFM A;  1S72 A;  3I4O A;  3STB D;  1VQE A;  1N34 Q;  2WFW A;  1PYB A;  3MXN B;  1XJV A;  4UP8 A;  1K83 H;  1Q12 A;  4AQY Q;  3KLW A;  4OWX B;  2BA0 A;  1VQK A;  1XPU A;  4TVA B;  2CQO A;  4JI8 L;  1CUK A;  4HJ8 A;  1XTD A;  4DNI A;  4POF A;  1X3F A;  2KEN A;  1VQI A;  1W3S A;  4JOI A;  4JOI C;  5IWA Q;  3CCR A;  2Q2T A;  4DR7 L;  4JI5 Q;  1I6H H;  1LYL A;  2XTI A;  3F2D A;  1VCI A;  1P8L A;  4C3I H;  4A3E H;  4A76 A;  5K36 G;  3W1B A;  4WJ4 A;  1FJG Q;  4QJF A;  1CKN B;  2F52 A;  3K80 C;  1WI5 A;  4HJA A;  1X3G A;  3FHW A;  2Z6K C;  3PIO A;  4IFD G;  1WYD A;  3ZJY C;  3KJP A;  2N3S A;  1E7Z A;  3CCU A;  2UUA L;  3BZC A;  4LFC L;  1JE5 A;  4JYA Q;  3G48 A;  2AKW B;  5JJK A;  3NEM A;  2CWA A;  4LF4 Q;  1RIP A;  2KHI A;  5LMN W;  2K5H A;  2JA8 G;  2IX0 A;  4LF5 L;  4OO1 I;  1VQF A;  4DR2 Q;  2MO1 A;  1YJW A;  2YTV A;  3KOJ A;  1K3R A;  2EXD A;  1Y1V H;  4QY7 A;  1JJG A;  2E2H H;  2XGT A;  5IYC G;  3CCJ A;  5IE8 A;  4GKJ L;  4JI8 Q;  4X65 L;  1J6Q A;  1WFQ A;  2ALY B;  2KCM A;  1OXS C;  4GNX A;  3RN5 A;  1XMQ L;  2JA7 G;  2A8V A;  1XMO Q;  4GLV B;  2ZJP A;  4YWK A;  1QZG A;  1VQB A;  3M4P A;  3TRZ A;  1UE6 A;  3SGI A;  4DR7 Q;  3PO2 G;  1EQQ A;  4L5Q A;  1A8V A;  4AYB E;  1HZA A;  3S1M H;  3M9B A;  3PV0 A;  4X64 L;  4BXX H;  4X6A H;  1KRT A;  2D62 A;  3UE1 A;  3J7A 5;  2UUA Q;  4LFC Q;  4YCU A;  4J15 A;  1HNZ L;  3PF5 A;  4QGU A;  3ER0 A;  1IBK L;  3H3V I;  4EX5 A;  4IPG A;  3CF5 A;  4BY1 H;  1X54 A;  3AQQ A;  2K5N A;  4MZ9 A;  1SLJ A;  2ZTC A;  1EUJ A;  2IHF A;  3AYH B;  2VQF L;  2DUD A;  4XIG S;  2K4K A;  4DR3 Q;  1SFO H;  1PH2 A;  1B70 B;  2VL6 A;  1G6P A;  2IHE A;  3G71 A;  4UY8 C;  4A3C H;  4JV5 L;  2UUB L;  4UP7 A;  1FVI A;  1TWA H;  2QGQ A;  4LFA L;  4JI6 L;  4PG3 A;  1B7Y B;  4DKA C;  3T1Y Q;  4X65 Q;  3UDG A;  4OX9 L;  1VQ8 A;  4HIO A;  1U0L A;  1XMQ Q;  1UE5 A;  3FKI G;  4GOP A;  4GN4 B;  2N8N A;  5C44 H;  4IFD I;  3L2P A;  2WB1 G;  5DLQ E;  3CCV A;  1X3E A;  2AWO A;  4OON A;  1VQD A;  4A4I A;  2PMZ E;  3TEH B;  1YVC A;  1M1K C;  1I94 L;  3FP9 A;  1HNZ Q;  5ELO A;  4C3H H;  1IBK Q;  4JI2 L;  4LWC A;  5IP7 H;  2YYZ A;  4ALP A;  1D7Q A;  4IOC A;  4DK6 C;  1JB7 A;  5C4X G;  2VQF Q;  4L5R C;  1RL2 A;  5M5X H;  3TS2 A;  4LW1 A;  4JV5 Q;  2I5M X;  1OXU A;  4JI0 L;  2Y0S G;  3E9H A;  3S1N H;  2AMC B;  4JI6 Q;  2FXQ A;  4NXN Q;  2AWN A;  3GTG H;  3S14 H; 
#chains in the Genus database with same CATH topology
 3DHQ A;  4IFD H;  1G51 A;  1SEB D;  3CMA A;  3KLS A;  2NZH A;  1STN A;  2PNR C;  1MKH A;  3W3A A;  2WKD A;  3UDX A;  3P75 A;  3WOF A;  1GUS A;  2H5X A;  4A3L G;  2F0S A;  2X6L A;  1JWU D;  1EIH A;  1T5X D;  1V1O A;  2D5D A;  3TP7 A;  1K0R A;  2F0U A;  2ATW A;  1VQG A;  2H4O A;  1KD1 C;  5IWA L;  3T53 B;  2RHS B;  2JA7 H;  4K6L A;  4LUO A;  5D65 A;  5KYI A;  2WP8 J;  4JI0 Q;  1GUG A;  1K28 A;  3A7L A;  4OIK A;  1WTV A;  3HOY G;  3D8G A;  4X62 Q;  3GTQ B;  2Q8T A;  2WB1 E;  3K81 C;  2J7Z A;  3L3O C;  4DR2 L;  1YI2 A;  3JAM c;  3SR1 A;  5CYU A;  1S5C D;  2R92 B;  2EJF C;  3QOL A;  2KVM A;  2VZA A;  1B3Q A;  3PO3 G;  4DNT B;  1I50 H;  1G8Z D;  4JI1 L;  1OXV A;  1JWS D;  2OEO A;  1Z6H A;  3HOV B;  4DV5 Q;  1BBW A;  3H6M A;  4DUY Q;  1B9N A;  2JA9 A;  1K8A C;  3TSS A;  3GTO H;  1ZYR D;  4HSP A;  2IX3 A;  1BNZ A;  4HJ7 A;  2A68 C;  2PO4 A;  5BN3 A;  4A3B H;  4ZLT F;  2HHH L;  2B2W C;  1PH3 A;  2DGY A;  3GO5 A;  4KY5 A;  4XT3 B;  4R8I A;  2KBN A;  2Y0S B;  1JT8 A;  1YNX A;  2PZW A;  3J80 c;  5EAY A;  4JBW A;  3I4N G;  2BE5 D;  4UP9 A;  4GZY C;  4DV6 Q;  1IBL L;  1WTX A;  1LT3 D;  1RD9 D;  2AUJ D;  3DEP A;  1U9R A;  4A3L H;  1M90 C;  1M8A A;  1ROD A;  2EJM A;  3HKZ G;  4RMF A;  4RWS C;  2C35 B;  4BBS G;  1IZ6 A;  1CKM A;  3DUZ A;  3DXJ C;  2VY3 A;  2R93 G;  5C3E G;  1BOS A;  3T56 B;  2PYK A;  5C5M A;  4HID A;  4JI4 Q;  3EFX D;  3KLR A;  1LM0 A;  2E2I H;  3G6E A;  1HTP A;  2K75 A;  2K33 A;  3EJI A;  3HOY H;  4TSS A;  1HNX Q;  3RD4 A;  3PIO 3;  1UEA B;  4DV2 L;  3TRE A;  1TT2 A;  3OWE B;  4BBR G;  4LFB L;  2RDG A;  2GVA A;  2GN5 A;  4AYB B;  3PO3 H;  3RZO H;  1HZB A;  3BZK A;  3OW7 A;  4A93 G;  2SEB D;  1XWE A;  4LF7 Q;  3BS1 A;  3GD7 A;  4ZUI A;  2NVX H;  1PVO A;  5EJW A;  3CCL A;  2LSS A;  5AJ3 L;  2QCP X;  5K5P A;  4G7H C;  2O5I C;  1SND A;  3S2H B;  4H13 C;  3C2P A;  1X65 A;  4A3K B;  3R2T A;  3JAM L;  4V0B A;  4ODG A;  1IBM Q;  3CC4 A;  1ICW A;  1YHB A;  3BYY B;  4ZCK A;  5IGF A;  5HY6 A;  3NBI A;  3QIA A;  4A3J B;  1N9W A;  3RN2 A;  3I4M G;  1K9M C;  3CP0 A;  1PYS B;  2HDM A;  1NNX A;  3PUV A;  1IKL A;  5M3M G;  3I4N H;  1PH8 A;  2IY5 B;  4QIW E;  1ZKO A;  4Y52 H;  2R7F A;  1II3 A;  1A3T A;  3S1R H;  1VQL A;  1ET9 A;  4XYQ A;  3CQZ H;  2JXM B;  4JW0 A;  4FXD A;  3S2D B;  4X66 L;  4C2M H;  4TQU S;  1A63 A;  5GQO A;  2EY1 A;  3F8T A;  4BBS H;  4IUQ A;  5JPM C;  3K58 A;  3PUZ A;  2IWH A;  4ID6 A;  2R93 H;  1PZK D;  4YY3 L;  3K8A A;  3J80 L;  4A3I B;  1RF2 D;  4JI3 Q;  3GDE A;  3VYU A;  3QOJ A;  2JEA I;  1EEF D;  1A3U A;  3B6Y A;  1TWH B;  4P71 A;  5IOD A;  5FLX E;  4A3F B;  1WCM G;  5M3F G;  4ZAI A;  1GD7 A;  3BYT B;  2NBF A;  1HR0 Q;  2F0G A;  2B2T A;  2B2T C;  2CW0 C;  2A6H C;  4JBM A;  2F0N A;  1PTO B;  1EY5 A;  4BBR H;  1EY8 A;  1GJX A;  1GUW A;  4MNO A;  2WAQ B;  1VQ9 A;  3PGZ A;  1STB A;  3MTS A;  3GTP H;  1F9Q A;  3T1H Q;  4A93 H;  3A8J E;  1J5E L;  3MVV A;  4DV7 L;  1EYD A;  1SE2 A;  1KNE A;  2OTJ A;  4P75 A;  1Y8P B;  1H95 A;  2F0F A;  1Q7Y C;  1BCP C;  4FP5 D;  5J1Z A;  5FOB B;  2K28 A;  5JEA J;  1CT1 D;  1YIT A;  1E1T A;  4NW2 A;  3I4M H;  3HOW G;  2EOT A;  1EYG A;  4YCW A;  4KHZ A;  5M3M H;  1YHQ A;  2JN4 A;  2VQE Q;  2ICI A;  2PQA B;  3J81 c;  4OGQ C;  3AEV A;  2UU9 L;  3MEF A;  4GN3 B;  1KC8 C;  3FEW X;  5HUR A;  4J1M A;  3GTM H;  3L9A X;  4QCL A;  2MQH A;  3Q0A A;  2ZM6 L;  4CDF C;  3D4W A;  1SRU A;  4F8M A;  5BN5 A;  4WOR A;  4JG2 A;  1G91 A;  2E8G A;  1PH4 A;  4XQQ A;  2FMM A;  1O7Z A;  2ZTD A;  4B3T L;  3PSI A;  4GKJ Q;  4DV1 Q;  1EWC A;  2NVT B;  4LMQ D;  2Z9H A;  4O1N A;  3VYT A;  3I91 A;  1HXY D;  1WCM H;  5M3F H;  1ENF A;  3J7Y W;  4LNQ A;  4CGY B;  1MGS A;  2LY7 A;  3FRP B;  4KJN A;  2PZU A;  5I6W A;  1KTK A;  2IPK D;  2HT1 A;  4DV3 Q;  4NKL A;  1PHJ A;  3LWU A;  2RBM A;  3DM3 A;  4APV A;  2MFI A;  3S14 B;  4NPS A;  4QB4 A;  1CKN A;  3NHH A;  3IRB A;  4I65 A;  3CPW A;  2PMZ B;  4IUP A;  3IL8 A;  4IUR A;  2K50 A;  1SYF A;  2B2V A;  2L11 A;  3S1Q H;  4WFN 3;  3I7F A;  2Q8R E;  1PLF A;  4BXX G;  1EOV A;  1ENC A;  2JP1 A;  1CA5 A;  2QW7 A;  2F0P A;  1B9M A;  1F9R A;  1GKH A;  1WD1 A;  2JEB I;  2WV6 D;  4DF7 A;  2NVQ H;  1E2W A;  1BCP D;  3V05 A;  1V43 A;  4RCN A;  3HOW H;  3CC2 A;  4A3C G;  1XNQ Q;  2D2C C;  3NSW A;  3GV3 A;  3L0O A;  3AB9 A;  2FJ2 A;  1RJT A;  5JAV A;  5FK9 C;  2E5L Q;  4JCV E;  1VQP A;  5JEA G;  3MFG A;  4RKB A;  1F77 A;  1SBB B;  3CME A;  3K57 A;  1O78 A;  5C44 G;  2JK8 A;  3GP7 A;  4GOP B;  3IFT A;  2A74 C;  3D0F A;  2XN9 C;  2CFM A;  3I4O A;  3BDC A;  1I50 B;  2K01 A;  2CQA A;  3VR6 A;  1K83 H;  3Q23 A;  1XYI A;  4OWX B;  3NTH A;  4TVA B;  4C1N I;  2XRQ D;  3CHB D;  4DNI A;  1EYC A;  2KEN A;  1W3S A;  4IUV A;  4JI5 Q;  2WB1 B;  3J81 L;  1EZ6 A;  2JSO A;  2KEE A;  4MN3 A;  2PW5 A;  4XDX A;  3PIO A;  1E7Z A;  1V8Q A;  3CCU A;  3URY A;  5I2X A;  4LF4 Q;  3DM1 A;  2EYO A;  4K2L A;  1PRT D;  2K5H A;  2IX0 A;  2YTV A;  2ZXP A;  1S4Z A;  2EXD A;  1PXU A;  4PQX A;  1EY7 A;  5E4X A;  5IT9 E;  2E2H H;  3MXP A;  5IYC G;  3CCJ A;  4JI8 Q;  2ENB A;  1WFQ A;  3S1M B;  4GNX A;  3NTK A;  2O2L D;  2MJ8 A;  4GLV B;  2ZJP A;  3V2T A;  3TRZ A;  4G7O C;  4DA2 A;  1EQQ A;  3PO2 G;  3CU7 A;  4AYB E;  1D5X C;  2EYM A;  4BXX H;  1KRT A;  4KHV A;  4LFC Q;  1HNZ L;  3CF5 A;  4FXK C;  3AQQ A;  2K5N A;  4HMI A;  3HZX A;  2F0L A;  1SLJ A;  2IHF A;  1LTR D;  2DNE A;  2VQF L;  2E2I B;  1PZJ D;  1PH2 A;  1JB3 A;  2VL6 A;  5KYL A;  4BS9 A;  1JIC A;  4A3C H;  1TWA H;  2L9H A;  3H09 A;  2K6A A;  4KKT A;  1EY4 A;  3HOY B;  1B7Y B;  4DKA C;  4OX9 L;  5JEA H;  1UE5 A;  3FKI G;  1EEI D;  4OHJ A;  4GOP A;  4GN4 B;  5CR3 A;  5C44 H;  1HCZ A;  2F0D A;  4NMZ A;  1IBK Q;  4LWC A;  4NDX A;  1E2V A;  4L63 B;  4EVO A;  1D7Q A;  5C4X G;  1JB7 A;  1D1K A;  1HFG A;  3D4D A;  5M5X H;  2FMC A;  1ET6 A;  4JV5 Q;  4JI0 L;  3D6W A;  3S1N H;  4NXN Q;  3BVM A;  4MHE A;  1MSG A;  2YU9 H;  3DWQ A;  4X62 L;  4O2D A;  2JA8 B;  3IKJ A;  4KI0 A;  1I3Q H;  1TII D;  5CV4 A;  3K5M A;  3OSO A;  1SN8 A;  5IIF A;  3GTL B;  3S17 B;  1IL8 A;  3BVG A;  5LMU Q;  4U67 3;  1I94 Q;  1PA6 A;  1MJC A;  4EQ5 A;  5M5Y H;  2G9D A;  2WAC A;  3HFZ B;  4F87 A;  1CKO A;  5IYC H;  1PH6 A;  1IXR A;  2KQ3 A;  4DUY L;  1LAB A;  3KBG A;  2ZT9 C;  4DAY B;  3S1R B;  1Y8N B;  1LTS D;  5EBC A;  5ELN A;  1FJG L;  3PO2 H;  3J7Z C;  2EZV A;  4QL5 A;  4C2M B;  2CWP A;  4YWL A;  1PFS A;  3TME A;  1U4L A;  3HKZ B;  2J0T D;  4BBS B;  4IUN A;  4DR4 Q;  4MTN A;  5CV8 A;  5C3E B;  3N52 A;  4IUT A;  3MEH A;  3UDI A;  1QVC A;  1LO5 D;  1PFN A;  4DK0 A;  4XT1 B;  2I5H A;  2EVB A;  2MO0 A;  5H1S E;  1KHI A;  2EY6 A;  5LMN Q;  1I5F A;  3EIV A;  3ULL A;  4DK1 A;  1UE1 A;  1XMO L;  1EWI A;  1JE4 A;  1TWC H;  4DV4 Q;  1D2B A;  3FKI H;  3GTJ H;  1A62 A;  2PQE A;  4PMC A;  2Z6K A;  3KF6 A;  3E0E A;  5IY0 A;  3ICE A;  1I4P A;  3H91 A;  3U4Z A;  1YJN A;  1QE6 A;  1KXL A;  1SYB A;  1K0S A;  4HIM A;  4XTC S;  3VR2 A;  4HJ5 A;  2VS1 A;  3X3M A;  5C4X H;  3A8K E;  1CZW A;  3GTK H;  4JI4 L;  1HQR D;  1B53 A;  3T1Y L;  4IPD A;  1OXX K;  3JAM i;  1HR0 W;  1Q1B A;  3I90 A;  2K5W A;  1S40 A;  3ULP A;  2JA5 G;  1XPO A;  3OMC A;  1HNX L;  1YBY A;  3G6J B;  1QVF A;  4NB3 A;  2XWB B;  1E1O A;  3I4M B;  4LUZ A;  4R1J A;  5LHY 1;  4DAY A;  1QJO A;  5JOB A;  1BCP F;  1YNN C;  2Z0S A;  3NBH A;  2ID0 A;  1L0W A;  4PMW A;  2JE6 I;  2OQ0 A;  2DY7 A;  3P7J A;  2Q2H A;  4PNY A;  4K8I A;  2K1B A;  2XVS A;  3OTO Q;  4K0K Q;  5EKK A;  3RUZ A;  4H0L C;  3BU2 A;  3TQY A;  4FXG C;  5J3B A;  1IBM L;  2A8V A;  4A3B G;  1L1O C;  3J80 i;  1SRO A;  1WTQ A;  1HQM C;  3HG9 A;  4QF4 A;  1SAP A;  1BBX C;  5EKL A;  1ML0 D;  3HOX G;  4WJ3 M;  4A3D B;  2MNA A;  4B08 A;  1RTN A;  4H7B A;  2QKI C;  3DLL A;  2NUC A;  1DM0 B;  5IYD G;  1IL2 A;  3JC6 6;  1CHQ D;  2K14 A;  2Q8I B;  1TWG H;  2VUM B;  3LNN A;  1ILQ A;  2HIX A;  3K7A H;  4U68 A;  4YIJ A;  4DR1 L;  3D31 A;  2RA4 A;  2E75 C;  4DUZ Q;  3M85 A;  5LL6 S;  2L15 A;  3W2D A;  3TS0 A;  3M4O H;  1Z47 A;  4JI3 L;  2BOS A;  1E24 A;  1N32 Q;  5DM6 3;  1SMX A;  3R8B A;  1KAA A;  1N33 Q;  2I0Q A;  3CCS A;  2JA5 H;  4DU9 A;  2G9H D;  3C1E A;  1HR0 L;  2NVQ B;  4UAI A;  2SDF A;  5A2Q L;  1KIX A;  2DN8 A;  1JJ2 A;  4LF9 L;  1PH9 A;  1LT5 D;  4LF6 Q;  3NWT A;  3T1H L;  3DEO A;  4KHP Q;  3SE0 A;  4KY7 A;  3CW2 C;  3EA6 A;  3Q22 A;  4ZQ3 A;  1YNN D;  2L5T A;  5IP9 G;  2R7Z G;  1OO9 B;  1K83 B;  4A3G G;  4RFB A;  3DWP A;  1N36 L;  4A3M G;  2B2W A;  3SHL A;  2GVB A;  2F0H A;  4RHS A;  5C0X H;  2F1M A;  3AU7 A;  5C3W A;  5EPJ A;  3P20 A;  3HOX H;  1DGS A;  2K05 A;  3OMG A;  1WTP A;  2H1E A;  2B63 G;  2F4V Q;  2X69 A;  5CV5 A;  1KLG D;  2QF7 A;  5E1F A;  2OXP A;  2VQE L;  3A74 A;  2QEX A;  1STA A;  2KJX A;  2PNH A;  2RSN A;  1AE3 A;  2V4D A;  1SE8 A;  1PH5 A;  5IYD H;  1CK1 A;  1I4G A;  3TN2 A;  5GAH C;  3PUY A;  4HIK A;  2E2H B;  4WRD A;  4CHT B;  1KL9 A;  2F3I A;  4P72 A;  3KF8 A;  2L12 A;  4DV1 L;  1SE4 A;  1A2U A;  3F2C A;  1D8L A;  4HR7 B;  1BXT A;  2CKZ B;  4RKL A;  4FVM A;  3STB C;  1UE7 A;  1EQR A;  4L5S A;  4OWW B;  1HH2 P;  1DYQ A;  1BUV T;  1OTC A;  4M1U B;  2YTY A;  5HGQ A;  4DV3 L;  3HGB A;  1TWA B;  4LF5 Q;  3I56 A;  4OWT B;  5E7N A;  2EIF A;  4P73 A;  3SK6 A;  1SYC A;  1ICF B;  3M4Y A;  3UDF A;  2XSC A;  4NP5 A;  4ME3 A;  4DR5 Q;  2ZXR A;  3NK9 A;  2KCC A;  1STH A;  3M7N A;  5IP9 H;  2BH2 A;  2R7Z H;  4A3G H;  4N8X 1;  2DNC A;  3CCQ A;  1ZEQ X;  4V19 0;  1BR9 A;  2PW7 A;  4A3M H;  2N55 A;  1QVG A;  1TWF B;  5EQ0 A;  1AP0 A;  2MGS A;  3T51 B;  5C4J H;  1SE3 A;  2KUM A;  3J81 i;  1Y69 U;  1XNQ L;  3HKZ E;  1KLU D;  1AN8 A;  1KAW A;  2B63 H;  4YCV A;  3S15 H;  2UUB Q;  1C0A A;  4JBK A;  4RCO A;  1I3Q B;  1QOH A;  2E5L L;  3A56 A;  4PZ8 A;  1X6O A;  1T5E A;  2K32 A;  2CH4 A;  3AFP A;  1WTR A;  1YZ6 A;  1GVP A;  4RG1 A;  2ES2 A;  5BR8 Q;  1IYV A;  2B2Y C;  1Y14 B;  4Y7N H;  1H9S B;  1NTG A;  1QCB D;  5M5Y B;  4UDU C;  4P2C B;  4QUF A;  1S5B D;  1SNC A;  3KLS X;  4LUV A;  5IGC A;  2FIN B;  4IN3 A;  5KGU A;  3E6Z X;  4JI2 Q;  1PDQ A;  4BA1 I;  1EY6 A;  3BJU A;  5KND A;  2I46 A;  4ZRZ A;  3PO2 B;  1SMY D;  1BF4 A;  4X3S A;  4ULL A;  1MI2 A;  4ME5 A;  1CQV A;  4K8J A;  3RZD B;  1DOL A;  1HZ9 A;  3Q8D A;  4ABN A;  1V9P A;  3K5N A;  1E2Z A;  1VS0 A;  1A15 A;  2UUC Q;  2R3Z A;  4H44 C;  2K7V A;  3JAM E;  1S72 A;  3STB D;  5M9O A;  1PYB A;  3I4L A;  1Q12 A;  3KLW A;  3TP6 A;  5HGT A;  1TWC B;  4C3I B;  4JI8 L;  1X3F A;  1LTG D;  1ZXT A;  4JOI A;  4JOI C;  5IWA Q;  3MZ5 A;  1I6H H;  1VCI A;  5CBE E;  2EPB A;  3R2I A;  4QJF A;  1CKN B;  1VF5 C;  3K80 C;  1WI5 A;  1RDP D;  4J6H A;  1WYD A;  3ZJY C;  3KJP A;  1TQO A;  4LFC L;  3C46 A;  2XNA C;  4JYA Q;  4ZKC B;  4S3S A;  3VA7 A;  1O7L A;  4K2K A;  5LMN W;  2F0I A;  4DR2 Q;  2HUG A;  2XWJ B;  2M2L A;  3Q6S A;  1X3P A;  3KOJ A;  3NE5 B;  2D9U A;  4L8J A;  1H9J A;  1JWM D;  3J80 E;  2C5C A;  1G6Z A;  3SDZ A;  1OXS C;  1H9S A;  2KHS A;  1MBY A;  1VQB A;  3SGI A;  1YNJ C;  4L5Q A;  2NWG A;  1BQQ T;  3PV0 A;  4N8F A;  4X64 L;  1F2Z A;  1RTO A;  1STE A;  2XIW A;  3UE1 A;  3NUC A;  2UUA Q;  4YCU A;  4J15 A;  3PF5 A;  4QGU A;  1IBK L;  4EX5 A;  4OEL B;  1SFO B;  4MZ9 A;  2ZTC A;  1EUJ A;  2DUD A;  4XIG S;  2K4K A;  5I4D A;  2DY8 A;  2IHE A;  4UY8 C;  4JV5 L;  5CMD A;  1JOO A;  4UP7 A;  5CV6 A;  4LFA L;  2F0M A;  3VR5 A;  3UDG A;  1VQ8 A;  1I4Q A;  1V1P A;  3FPP A;  4R8N A;  1PRT C;  1W6J A;  1HFN A;  1WVL A;  2N8N A;  3HS0 C;  2BCO A;  1SYD A;  5ELE A;  5T1G A;  1X32 A;  4C3J G;  3L2P A;  2WIN B;  3FMC A;  1X3E A;  1A6X A;  3TEH B;  1YVC A;  1I94 L;  1PYW D;  5ELO A;  5IP7 H;  4DK6 C;  3BDO A;  2SNS A;  1U4P A;  3SEB A;  2I5M X;  1F2Y A;  2Y0S G;  3MAQ A;  2FXQ A;  1CTM A;  1PZI D;  5JVH 3;  1CSP A;  3WOE A;  1PTO C;  4GNX B;  3HOZ G;  4DR4 L;  1EWH A;  5G3L D;  1IHZ A;  4POG A;  4CBV A;  1N34 L;  1NR4 A;  3K0X A;  4AQY L;  3G4S A;  1QIL A;  2K52 A;  3E9I A;  1Q3L A;  5LMN L;  5COR A;  1VQ6 A;  2JA7 B;  3U4V A;  1FGU A;  1S5E D;  5GAG C;  5KIX A;  3OOC A;  2RQX A;  3HRZ C;  1XPR A;  1EFI D;  4KK7 A;  2EJG C;  1WD0 A;  2M00 A;  2VB2 X;  5EPL A;  1EIF A;  3CD6 A;  5AJ3 Q;  3WDN A;  4ZKB B;  1LTT D;  4AH6 A;  1YNJ D;  4IPC A;  1S5D D;  2R6G A;  1AEX A;  2EY5 A;  3GTQ H;  3TP5 A;  2O5J C;  4JK1 C;  2F4I A;  3E5S A;  1G2T A;  1HNW Q;  3RNU A;  1FD7 D;  1L2F A;  2L0C A;  3GTO B;  1TY2 A;  2FFK B;  1CFM A;  1X56 A;  3CC7 A;  1I6V C;  1ESR A;  1XX8 A;  3OIQ A;  5CGK A;  4A3B B;  1SXT A;  2KHJ A;  4XXE A;  3NQI A;  3HOV H;  2UXB Q;  4C3J H;  1Q90 A;  1I4X A;  2NZO A;  3HOX B;  4ZK9 B;  5ISR A;  1B44 D;  3KDF B;  2A6E C;  4X66 Q;  3VYR A;  1Q8K A;  2XRS D;  1DZ1 A;  4DR3 L;  3H3V C;  1FNW A;  3W1G A;  2V1C C;  4PV1 C;  4YY3 Q;  4CKC A;  1Y1W G;  3HOU G;  1A0I A;  3Q24 A;  4DPG A;  1EOT A;  4O0A A;  3OTO L;  4K0K L;  4A75 A;  1KNA A;  2DJF C;  4K5X A;  5I9O A;  2RF4 A;  3HOZ H;  2D0O A;  3C1F A;  5GRO A;  1SNP A;  3UI2 A;  1YHA A;  1A2T A;  3VR4 A;  4BWG B;  2PCF B;  2RDH A;  1PTO D;  1N8R C;  3PUW A;  4YWM A;  1KRS A;  5DAU A;  1DCZ A;  2PPB C;  4B3M Q;  2B8G A;  4E6I A;  1VMP A;  2E74 C;  1J5E Q;  1XTC D;  5JJZ A;  3J81 E;  4DV7 Q;  2OQK A;  4JC0 A;  2QIL A;  3I2Z A;  4DAV A;  1ASZ A;  1SNM A;  3PO3 B;  5F2D A;  4A3F G;  4DUZ L;  3RZO B;  3KF6 B;  1ONL A;  2E2D C;  5JJI A;  3F2U A;  1R4Q B;  4NXM Q;  4EGV A;  1JOR A;  5FJ8 G;  1SR3 A;  2NVX B;  1N32 L;  3H0G G;  2WAQ G;  4GLX A;  4PMB A;  1SNQ A;  1AE2 A;  4A3M B;  2M9V A;  1A3V A;  2UU9 Q;  1NMF A;  4FDB A;  4CDE C;  3KDF A;  2B2U C;  5EBD A;  2Z8L A;  3KUP A;  1Y8O B;  4LF6 L;  3AFQ A;  4DV0 Q;  3I4N B;  4G57 A;  4KHP L;  4DFA A;  2F0V A;  3RLF A;  1C4Q A;  4LK1 C;  1UAP A;  4C56 C;  2J4X A;  2A6E D;  5M5W H;  4DV5 L;  1Y1W H;  3HOU H;  1GHJ A;  1UWV A;  1T9H A;  3DMU A;  3NBH B;  1CSQ A;  2N78 A;  5C0X J;  3J7A F;  3CQZ B;  2NVY H;  4FYD A;  2Q2U A;  1JR0 D;  1Q46 A;  2LS0 1;  3TDQ A;  1EYA A;  1WJJ A;  4OIJ A;  2R93 B;  1D6E C;  4JI7 Q;  3PCO B;  3I55 A;  1L1O B;  3S2D H;  3ULJ A;  4CJ2 C;  3QJY A;  1TXY A;  1B8A A;  1SJH D;  2MHV A;  1S5F D;  1KQS A;  2NTT A;  2EE1 A;  2KED A;  4R4T A;  1DOK A;  4J8Q A;  1PH1 A;  4DV6 L;  4IJL A;  2F3W A;  5FLM G;  4BBR B;  1V1Q A;  4RH6 A;  1TWH H;  1BDO A;  2LXK A;  4A3F H;  3T4A C;  3GTP B;  2K5Q A;  3A5U A;  4BY7 G;  1RHP A;  1E3P A;  3UE0 A;  4A93 B;  1MSH A;  4JBJ A;  1I6H B;  1LTL A;  2OTL A;  2N49 A;  2HIV A;  2PZT A;  4IPH A;  5FJ8 H;  5C6A A;  1P16 A;  1XNR Q;  1PTO H;  4G4K A;  2B8F A;  3H0G H;  1B4O A;  1DJR D;  2IW3 A;  4L5T A;  1LUZ A;  2HQL A;  4DNR B;  4F7X A;  4G7Z C;  2Z1C A;  2JA6 G;  1JQY D;  4UHV A;  1L0X B;  3BVZ A;  3NXW A;  2F3V A;  4FO2 A;  4GKK Q;  2LXJ A;  3CKI B;  1JOQ A;  2LMC B;  1F9P A;  1FNV A;  1STG A;  3GQB A;  1WOC A;  2QDL A;  3VR3 A;  1VQM A;  3HP3 A;  2NN6 G;  3LWE A;  5M3M B;  1SNO A;  2Z6B A;  1YIJ A;  1KAB A;  3F2B A;  3R93 A;  5CV7 A;  4DR5 L;  4H02 A;  4LF8 Q;  4GLA C;  3GTM B;  1LAC A;  2KCN A;  4IJH A;  3E0J A;  5D3D A;  2ASB A;  4B3S Q;  1AH9 A;  1W2B A;  4OXP A;  3CAM A;  3OYY A;  1H9R A;  1L1O A;  2F0O A;  2LFN A;  4M8A A;  1Q86 C;  5D3I B;  5C0X G;  3BG3 A;  4FF1 A;  3QO2 A;  1EU4 A;  2B3G A;  3VDY A;  3D4R A;  4FF4 A;  1FGB D;  1J8I A;  3BZD B;  1MHW C;  1PFM A;  2AUK A;  1ENA A;  1C8C A;  1WCM B;  5M3F B;  1QG7 A;  4A3E G;  5BR8 L;  3QB3 A;  3H15 A;  1BVS A;  2RCN A;  2DJG C;  4EQP A;  1VQJ A;  3MXN A;  3H3V H;  5FLM H;  2NVT H;  1WTH A;  2X6G A;  4DGZ A;  4DXG A;  3M7G A;  3O13 A;  2Q2I A;  1BO0 A;  1QWY A;  3K59 A;  1Z9F A;  1GM5 A;  4BY7 H;  1AFP A;  1PRT F;  4B3R Q;  1Y1V G;  2F0W A;  3SK4 A;  2NN6 I;  4QUC A;  2JJQ A;  4BA2 I;  2UXC Q;  1I4R A;  1OXT A;  1X9N A;  4I7Z C;  3S1Q B;  1K8O A;  3KF8 B;  1CHP D;  3KK7 A;  4OX9 Q;  3M3Y H;  4DR6 Q;  2JA6 H;  2AQ2 B;  1UUP A;  4KLK A;  4YHH Q;  2UUC L;  3X3N A;  1B50 A;  3PIP 3;  3CXC A;  5C4Z A;  1TKW B;  3KYH C;  4BY1 G;  3HOW B;  1VMC A;  1K3B C;  2NN6 H;  5C4H A;  2UXD Q;  1PTO F;  5C0X I;  1Q1E A;  4WJW A;  1EL0 A;  1O80 A;  2VW9 A;  3E3X A;  1MJE A;  2O4X A;  1PFB A;  3K7U C;  1D5M C;  4X3K A;  4K5V A;  2YV5 A;  4C1N K;  2KCT A;  4CKB A;  3NEN A;  2F03 A;  4JYA L;  1LLR D;  2YTX A;  3D3R A;  2NB0 A;  3QR8 A;  5FLX c;  2TSS A;  4DAM A;  4C3H G;  1ESF A;  4UP8 A;  1VQK A;  3GV6 A;  1NAP A;  1QNK A;  2CQO A;  3K5O A;  3G7L A;  1G2S A;  4LF7 L;  1CUK A;  4POF A;  1AW7 A;  4B9X A;  1VQI A;  4C3J B;  1LYL A;  2CVR A;  2EXZ A;  3A7A B;  1P8L A;  4A3E H;  5JPN C;  3W1B A;  4WJ4 A;  1FJG Q;  2F52 A;  4HJA A;  1X3G A;  3FHW A;  2N3S A;  4KY6 A;  2UUA L;  1IW7 C;  1JE5 A;  3MWY W;  2CWA A;  2KHI A;  5IGE A;  5A2Q E;  4X3U A;  2JA8 G;  1U4M A;  1SMY C;  3TP8 A;  2MO1 A;  1K3R A;  1Y1V H;  4HED A;  5C5L A;  2XGT A;  1HUM A;  2ICE C;  5IE8 A;  4GKJ L;  3MHB A;  1J6Q A;  3HOZ B;  1TS4 A;  2ALY B;  3PQI A;  3RN5 A;  5NUC A;  5IGG A;  1XMO Q;  4DR7 Q;  4YWK A;  4JVZ A;  3M4P A;  3IFD A;  3S1M H;  3M9B A;  3MFY A;  1Z7T A;  1SYG A;  3I3C A;  1VDZ A;  2D62 A;  3ER0 A;  1FR3 A;  5KEE A;  4BY1 H;  4ILW A;  3FDT A;  5L37 A;  3ERQ A;  4DXF A;  5TSS A;  3AYH B;  2KEC A;  4KD3 A;  3J7A V;  3DWA A;  1G6P A;  3P1H A;  2Z4I A;  2QGQ A;  2K04 A;  1CZG A;  1XXG A;  3R3O A;  3U9O A;  4X65 Q;  5C44 B;  3T1Y Q;  4HIO A;  2MP1 A;  1XMQ Q;  1EQV A;  4KD4 A;  3D6C A;  2AQ3 B;  3V96 A;  5DLQ E;  2OF1 A;  2AWO A;  4OON A;  4KN4 C;  4A4I A;  4C3H H;  1J9O A;  2F0K A;  5M5X B;  1DD2 A;  5IGD A;  1BCP B;  3U9S A;  4ALP A;  3S1N B;  4L5R C;  3OIP A;  1RL2 A;  1TS5 A;  2YU9 B;  3VA5 A;  1LV9 A;  4FF3 A;  1GUT A;  2AMC B;  3I73 A;  2F0E A;  4JI6 Q;  1FYC A;  3GTG H;  2R7D A;  5A35 A;  5FLX L;  4IOA A;  2VNU D;  3EVQ A;  2B2Y A;  2I5L X;  3L7Z C;  1E22 A;  5IOC A;  1HZC A;  4XYO A;  3T16 A;  2BA1 A;  2JA8 H;  1E0B A;  2A68 D;  5M5W B;  1IW7 D;  3ERO A;  3NEL A;  1Y1W B;  3HOU B;  1HNW L;  3GTL H;  5J22 A;  3S17 H;  1NBW A;  2NVY B;  4F88 A;  4JI5 L;  5IYB G;  1D1I A;  1QZH A;  2RVL A;  3NPP A;  4ZYS A;  2AQ1 B;  2UXB L;  1K73 C;  1KDC A;  1MIU A;  4LF4 L;  1V1P B;  4GN5 A;  3A5Z B;  1FL0 A;  1PRT B;  1F2L A;  4DR1 Q;  1GO3 E;  4UPA A;  4FF2 A;  5IP7 G;  5C3E H;  1VQ7 A;  2ZJQ A;  2HQE A;  3FKI B;  1MD2 D;  2IL8 A;  3GTJ B;  1TU2 B;  4R4I A;  3IAY A;  3MXG A;  1PMR A;  1Q8I A;  4A3D G;  2OCE A;  2CCZ A;  1CA6 A;  1HA5 A;  4K5W A;  1QUQ B;  4O42 A;  2E2J H;  4IAL A;  2CH4 W;  3U50 C;  2A19 A;  5C4X B;  3N6R A;  3GTK B;  2D0P A;  2VXW A;  2VUM G;  3H0G B;  1C7Y A;  5JJL A;  1C9O A;  4B3M L;  4LF9 Q;  3CPF A;  3S16 H;  1GOZ A;  4HMJ A;  2MPM A;  5IT9 c;  1R9T H;  1EFW A;  4JI1 Q;  1HTL D;  2JYO A;  4AIM A;  2ZJR A;  4ZUJ A;  2B29 A;  4QQB X;  4X3T A;  1VQA A;  1N36 Q;  4HCS A;  2SOB A;  2HHH Q;  4DK3 C;  2OWO A;  4NXM L;  1B2T A;  4LJZ C;  1HRJ A;  1U5K A;  2L55 A;  1VQ4 A;  5GAD C;  3CCM A;  2R92 G;  2A73 B;  5IYB H;  2IX1 A;  4NXN L;  2PI2 A;  2A69 C;  2L4N A;  1CM9 A;  1G29 1;  3PIP A;  2BDO A;  4GS3 A;  4KJO A;  4L6T B;  3HOV G;  1EZ8 A;  3RLN A;  2QEJ C;  3U58 A;  1YEZ A;  1EQT A;  1JMC A;  1Q81 C;  2EQS A;  1IBL Q;  3SK8 A;  2EYL A;  5LMU L;  4DV0 L;  3FPU B;  4HJ9 A;  4MTK A;  5E3F A;  3EBE A;  4K14 A;  1K8M A;  4IZ8 A;  3ITP A;  4PZ7 A;  4HN7 A;  3RR5 A;  2MUY A;  5KNC A;  1ILP A;  3EN2 A;  1ASY A;  1TWG B;  1C48 A;  1QUQ A;  1HJP A;  1NR2 A;  2TMP A;  3QG1 A;  3CCE A;  4A3D H;  3K7A B;  5EPK A;  3T13 A;  4OEM B;  4BY7 B;  3FVQ A;  1S3O A;  3OW2 A;  1EIG A;  5J39 A;  4XQN A;  3C3L A;  4JI7 L;  4FNF A;  4R4Q A;  4RGT A;  4DV2 Q;  2VUM H;  3M4O B;  1Q82 C;  3ND8 A;  4LFB Q;  1LTB D;  1X55 A;  5EKI A;  3ONA B;  2CW0 D;  2A6H D;  3M3Y B;  2JA6 B;  3F1Z A;  3NP8 A;  2JA5 B;  1VQN A;  5CV9 A;  5LL6 X;  4HSV A;  4DV4 L;  1SYE A;  1WTW A;  3S24 A;  5I9P A;  1JC7 A;  1VQH A;  1AZQ A;  1VQC A;  2B2V C;  1RCV D;  5ELF A;  1VF7 A;  3LX0 A;  2KA7 A;  4EQN A;  2KOL A;  2EYF A;  4RHR A;  4TRD A;  2RCF A;  5GAE C;  3I8Z A;  2A1A A;  3I72 A;  1XNR L;  3A8I E;  2EYP A;  5KNB A;  3K5L A;  5IT9 L;  4IO9 A;  3KJO A;  1JOK A;  3RLO A;  2PQA A;  1H9K A;  5D14 A;  3HEJ A;  2R92 H;  1DON A;  1U4R A;  5DNF A;  2NYZ D;  4AYB G;  4HCE A;  2Y0S E;  4CJ1 B;  3LGJ A;  1RKN A;  3KFU A;  1JJC B;  3WWV A;  4GKK L;  4DAP A;  4KV6 A;  3VYS A;  2A69 D;  4TKO B;  2SNM A;  1GUO A;  4R4C A;  1IYJ B;  2G5D A;  4PZ6 A;  3M4Q A;  2IT1 A;  1IYU A;  4A3K G;  4A3E B;  3ERS X;  1EY0 A;  2AHO B;  2IJ0 A;  4CKE A;  5ELB A;  1WTO A;  4LF8 L;  4Z9C B;  5IGB A;  4A3J G;  5EGT A;  4DN4 M;  2NTS A;  4Q5V A;  1TR5 A;  3PF4 A;  4B3S L;  1NUC A;  2RHQ B;  4R4O A;  4KTA A;  1PH7 A;  1Y1V B;  1SDF A;  2K03 A;  1LTA D;  5AFW A;  3SK5 A;  1CI3 M;  2L1B A;  2EDG A;  2QDB A;  2QA4 A;  1F9S A;  1QNU A;  4LAA A;  2HD3 A;  5FKA C;  5I2Y A;  5JVG 3;  3MXU A;  1TVX A;  4GNX C;  1UEB A;  1PV4 A;  3HKS A;  1B3A A;  4KN7 C;  2A5H A;  4BY1 B;  4A3I G;  3A54 A;  2EYJ A;  4B3R L;  1GXD C;  2C9O A;  4IFD J;  2P5Z X;  2JQO A;  2RKS A;  2UXC L;  2K5V A;  3PUX A;  4XQJ A;  2CHB D;  4A3G B;  2R7Z B;  4DR6 L;  1BBU A;  4C3I G;  1N33 L;  1FNU A;  4GOP C;  1KDB A;  5FO7 B;  1HUN A;  1NY4 A;  4YHH L;  1NE3 A;  4C3H B;  1JCK B;  4QMG A;  1AZP A;  4X64 Q;  1NCV A;  5C4J B;  4K6D A;  2B2U A;  2EYH A;  1YJ9 A;  2UXD L;  2ZM6 Q;  2B63 B;  4P74 A;  3S2H H;  3S15 B;  3W5O A;  1O7Y A;  2PI2 E;  4A3K H;  1VQO A;  3AMU A;  3GTG B;  2FHT A;  1TWF H;  2WKC A;  3OHX C;  4RAU C;  4Q0F A;  3A0J A;  1HPC A;  4RGN A;  4LFA Q;  4Y7N B;  2HCC A;  4A3J H;  4B3T Q;  4CJ0 B;  2NZ1 D;  1QB5 D;  3QWN A;  2F0Q A;  3PMF A;  1H9M A;  2R61 A;  3EQL C;  1O7I A;  3CRL C;  4RGM A;  4OO1 G;  2F0J A;  3J81 j;  2ZTE A;  4CDC C;  4HAE A;  4RGO S;  3H94 A;  1BKB A;  4IQZ A;  2F4V L;  5CC4 A;  3MC0 B;  3NWS A;  4R9W A;  3RMH A;  1L0Y B;  2WAQ E;  1NMG A;  1K8G A;  2WII B;  3RZD H;  2BH8 A;  3TBI B;  4A3I H;  1EIY B;  3KBX A;  1VQ5 A;  1NJI C;  3OPO A;  1STY A;  1B1Z A;  1I4H A;  2K5D A;  1VQE A;  1N34 Q;  2WFW A;  3MXN B;  2E76 C;  1XJV A;  2B39 A;  4AQY Q;  1XPU A;  4QIW B;  2BA0 A;  1X3Q A;  4JPB W;  4MIU A;  5DM7 3;  2ZXO A;  1D5Z C;  3S9W A;  4HJ8 A;  4B9W A;  1XTD A;  2RSO A;  1KDA A;  2RDF A;  2Q2T A;  1IKM A;  4DR7 L;  1DOM A;  3CCR A;  3F2D A;  2XTI A;  4I7A A;  2E2J B;  4C3I H;  1SSO A;  4A76 A;  5K36 G;  3NTI A;  3TZD A;  5BN4 A;  4IFD G;  4N9T A;  2Z6K C;  4HTH A;  3BZC A;  3G48 A;  2AKW B;  4IUU A;  5JJK A;  3NEM A;  3S16 B;  2N88 A;  1RIP A;  4OL7 A;  5G3L F;  3OWF A;  5I6Y A;  4LF5 L;  4OO1 I;  1VQF A;  1R9T B;  1YJW A;  2LKV A;  3ZYY X;  4QY7 A;  1TS3 A;  1JJG A;  5ELD A;  1W6K A;  4EQO A;  4N9P A;  4X65 L;  2KCM A;  2JA7 G;  1XMQ L;  1QZG A;  3NQT A;  1UE6 A;  5COY A;  5E4W C;  5FO9 B;  1A8V A;  3K0Y A;  1HZA A;  4X6A H;  1TS2 A;  1TY0 A;  1GHK A;  3J7A 5;  2EY2 A;  4KKS A;  4OO1 H;  3H3V I;  4IPG A;  1EY9 A;  1X54 A;  3ND9 A;  1UNS A;  4RA8 A;  1R4P B;  4KKU A;  4CDD C;  4DR3 Q;  5CBA E;  1F2M A;  1SFO H;  1B70 B;  3BDL A;  3G71 A;  1HHV A;  1ZYR C;  2UUB L;  1FVI A;  2BDN A;  1LT6 D;  1EU3 A;  4PG3 A;  4JI6 L;  3SVM A;  3MA2 B;  1U0L A;  5FO8 B;  1LTI D;  1LT4 D;  2GA4 B;  3A55 A;  2F0T A;  4IFD I;  1GUN A;  1NSN S;  2HCI A;  5DEH A;  2WB1 G;  1DXM A;  3CCV A;  1M4V A;  1VQD A;  2PMZ E;  1M1K C;  3FP9 A;  1HNZ Q;  5ELC A;  5KRU A;  2I07 B;  1HA6 A;  2OT2 A;  4JI2 L;  1CQF A;  3I70 A;  2YYZ A;  4IOC A;  2HDL A;  2BE5 C;  2VQF Q;  3CRK C;  3TS2 A;  5C3X A;  1SJE D;  2Z4H A;  4KMU C;  3TZU A;  4LW1 A;  5T1I A;  1OXU A;  3SXH A;  3E9H A;  3K6O A;  5K36 H;  2VB3 X;  2AWN A;  3S14 H; 
#chains in the Genus database with same CATH homology
 2R7D A;  1CSP A;  1G51 A;  4X62 L;  4O2D A;  3CMA A;  4IOA A;  2VNU D;  2NZH A;  1I3Q H;  2I5L X;  4KI0 A;  4GNX B;  3HOZ G;  4DR4 L;  3L7Z C;  1MKH A;  1E22 A;  3UDX A;  4POG A;  1SN8 A;  1HZC A;  2H5X A;  2BA1 A;  1N34 L;  4A3L G;  2JA8 H;  3K0X A;  4AQY L;  5LMU Q;  1I94 Q;  3G4S A;  1PA6 A;  2K52 A;  1MJC A;  3E9I A;  1K0R A;  3NEL A;  5LMN L;  1HNW L;  1VQ6 A;  4EQ5 A;  5M5Y H;  3U4V A;  3GTL H;  2ATW A;  1FGU A;  1VQG A;  3HFZ B;  5GAG C;  3S17 H;  1NBW A;  1KD1 C;  1CKO A;  5IWA L;  5IYC H;  1IXR A;  1PH6 A;  4DUY L;  1XPR A;  4JI5 L;  2RHS B;  4DAY B;  5IYB G;  2JA7 H;  5ELN A;  4LUO A;  1QZH A;  2WP8 J;  4JI0 Q;  1FJG L;  3PO2 H;  3J7Z C;  2UXB L;  4QL5 A;  1EIF A;  2CWP A;  1PFS A;  4YWL A;  5AJ3 Q;  1K73 C;  3CD6 A;  3HOY G;  4X62 Q;  1MIU A;  4LF4 L;  4DR4 Q;  4GN5 A;  2WB1 E;  3A5Z B;  4MTN A;  1FL0 A;  3K81 C;  4AH6 A;  4IPC A;  4DR2 L;  1YI2 A;  4DR1 Q;  1GO3 E;  3JAM c;  3UDI A;  1QVC A;  2R6G A;  3GTQ H;  4UPA A;  2VZA A;  5IP7 G;  5C3E H;  2I5H A;  1VQ7 A;  3PO3 G;  2MO0 A;  5H1S E;  1KHI A;  2ZJQ A;  5LMN Q;  1HNW Q;  3RNU A;  1I50 H;  1I5F A;  1L2F A;  3EIV A;  3ULL A;  4JI1 L;  1OXV A;  1X56 A;  1UE1 A;  4R4I A;  3CC7 A;  1XMO L;  4DV5 Q;  1BBW A;  1EWI A;  4DUY Q;  1TWC H;  2JA9 A;  1K8A C;  4DV4 Q;  3FKI H;  3GTJ H;  3GTO H;  2KHJ A;  4A3D G;  2OCE A;  2CCZ A;  1A62 A;  3HOV H;  2Z6K A;  4HJ7 A;  3KF6 A;  2UXB Q;  3E0E A;  1QUQ B;  4C3J H;  5IY0 A;  3ICE A;  2E2J H;  4A3B H;  3U50 C;  2A19 A;  2HHH L;  2NZO A;  2D0P A;  3KDF B;  3U4Z A;  4X66 Q;  1YJN A;  2VUM G;  1KXL A;  1PH3 A;  2DGY A;  3GO5 A;  1Q8K A;  1C7Y A;  5JJL A;  1C9O A;  4DR3 L;  4HIM A;  4B3M L;  4LF9 Q;  3CPF A;  4XTC S;  4HJ5 A;  2KBN A;  2VS1 A;  3W1G A;  2V1C C;  5C4X H;  3S16 H;  3GTK H;  4JI4 L;  1JT8 A;  5IT9 c;  1YNX A;  4YY3 Q;  1R9T H;  1EFW A;  3J80 c;  5EAY A;  3T1Y L;  4JBW A;  3I4N G;  4JI1 Q;  1Y1W G;  3HOU G;  1A0I A;  4DPG A;  4AIM A;  4IPD A;  2ZJR A;  1OXX K;  3JAM i;  1HR0 W;  1Q1B A;  4O0A A;  3OTO L;  1S40 A;  4K0K L;  2B29 A;  4A75 A;  3ULP A;  4UP9 A;  2JA5 G;  1XPO A;  4QQB X;  1HNX L;  2RF4 A;  3HOZ H;  4DV6 Q;  1YBY A;  1IBL L;  1QVF A;  2D0O A;  4NB3 A;  5GRO A;  1VQA A;  1E1O A;  1YHA A;  4A3L H;  1N36 Q;  1M90 C;  4LUZ A;  2HHH Q;  4DK3 C;  2OWO A;  1N8R C;  4NXM L;  3PUW A;  3HKZ G;  4RMF A;  4BBS G;  2C35 B;  4R1J A;  1IZ6 A;  1CKM A;  4YWM A;  1KRS A;  2VY3 A;  1U5K A;  2R93 G;  5C3E G;  4B3M Q;  2Z0S A;  4LF7 L;  1VQ4 A;  2ID0 A;  1L0W A;  4PMW A;  2JE6 I;  2OQ0 A;  5GAD C;  3CCM A;  4HID A;  4JI4 Q;  2R92 G;  1LM0 A;  2Q2H A;  1J5E Q;  5IYB H;  2IX1 A;  4A3B G;  2E2I H;  4NXN L;  2PI2 A;  3G6E A;  4DV7 Q;  2OQK A;  4JC0 A;  2K75 A;  1G29 1;  3PIP A;  4GS3 A;  3OTO Q;  3HOY H;  4K0K Q;  3I2Z A;  3HOV G;  1ASZ A;  3RLN A;  3U58 A;  1HNX Q;  1IBM L;  1YEZ A;  3BU2 A;  5J3B A;  3TQY A;  4DV2 L;  2EQS A;  1Q81 C;  1L1O C;  1IBL Q;  1JMC A;  3J80 i;  3TRE A;  1SRO A;  4A3F G;  5LMU L;  4DUZ L;  4DV0 L;  3KF6 B;  4BBR G;  4LFB L;  5JJI A;  2GVA A;  2GN5 A;  4HJ9 A;  4NXM Q;  5FJ8 G;  3PO3 H;  3EBE A;  1SR3 A;  3RZO H;  3HOX G;  4WJ3 M;  1HZB A;  3BZK A;  4PZ7 A;  4A93 G;  1N32 L;  4LF7 Q;  3RR5 A;  3H0G G;  2WAQ G;  3EN2 A;  2MNA A;  4GLX A;  3GD7 A;  1ASY A;  1QUQ A;  1HJP A;  2NVX H;  1AE2 A;  3DLL A;  1PVO A;  5IYD G;  3CCE A;  3CCL A;  1IL2 A;  4A3D H;  2LSS A;  3JC6 6;  5AJ3 L;  2K14 A;  2UU9 Q;  1TWG H;  1NMF A;  1S3O A;  4FDB A;  3KDF A;  3OW2 A;  1X65 A;  2HIX A;  4JI7 L;  3K7A H;  4DR1 L;  4R4Q A;  1IBM Q;  3CC4 A;  3D31 A;  4DV2 Q;  1YHB A;  2VUM H;  5HY6 A;  4LF6 L;  3AFQ A;  4DUZ Q;  1Q82 C;  4DV0 Q;  4LFB Q;  3M85 A;  4KHP L;  1X55 A;  1N9W A;  2L15 A;  3RLF A;  3RN2 A;  3I4M G;  1K9M C;  3TS0 A;  3M4O H;  1Z47 A;  3CP0 A;  4JI3 L;  1PYS B;  3F1Z A;  5M5W H;  4DV5 L;  1E24 A;  1VQN A;  3PUV A;  5M3M G;  3I4N H;  1Y1W H;  3HOU H;  1N32 Q;  1SMX A;  1PH8 A;  2IY5 B;  1UWV A;  4DV4 L;  1T9H A;  3NBH B;  3S24 A;  1CSQ A;  2N78 A;  4QIW E;  5C0X J;  2I0Q A;  1VQH A;  3CCS A;  1N33 Q;  1VQC A;  2NVY H;  2JA5 H;  4Y52 H;  2R7F A;  2Q2U A;  3S1R H;  1VQL A;  1HR0 L;  1Q46 A;  1WJJ A;  3CQZ H;  1KIX A;  4X66 L;  4JI7 Q;  4C2M H;  4TQU S;  5GAE C;  3PCO B;  5GQO A;  1JJ2 A;  1A63 A;  2A1A A;  3F8T A;  4LF9 L;  1PH9 A;  4BBS H;  3PUZ A;  1XNR L;  3I55 A;  4LF6 Q;  1L1O B;  3T1H L;  3S2D H;  4IO9 A;  2R93 H;  3KJO A;  4YY3 L;  4KHP Q;  3RLO A;  3ULJ A;  2PQA A;  3K8A A;  4BA2 I;  2R92 H;  4JI3 Q;  3GDE A;  1TXY A;  1B8A A;  1KQS A;  4AYB G;  2JEA I;  3CW2 C;  3B6Y A;  2Y0S E;  4P71 A;  4R4T A;  1PH1 A;  3LGJ A;  3KFU A;  1JJC B;  4DV6 L;  4IJL A;  3WWV A;  1WCM G;  5IP9 G;  5M3F G;  2R7Z G;  4A3G G;  4GKK L;  5FLM G;  1GD7 A;  1V1Q A;  1TWH H;  1N36 L;  1HR0 Q;  4A3M G;  2LXK A;  4A3F H;  2GVB A;  3A5U A;  4JBM A;  4R4C A;  4BY7 G;  4BBR H;  1E3P A;  3UE0 A;  1IYJ B;  4JBJ A;  4PZ6 A;  3M4Q A;  4MNO A;  1LTL A;  2IT1 A;  1VQ9 A;  2OTL A;  2N49 A;  2HIV A;  4IPH A;  5FJ8 H;  3ERS X;  3PGZ A;  4A3K G;  3HOX H;  1DGS A;  1P16 A;  1XNR Q;  2AHO B;  3GTP H;  3T1H Q;  2B63 G;  2F4V Q;  4A93 H;  3H0G H;  1J5E L;  4LF8 L;  4L5T A;  1LUZ A;  2HQL A;  3A74 A;  2VQE L;  2QEX A;  4DV7 L;  4A3J G;  2PNH A;  1AE3 A;  1SE8 A;  1PH5 A;  5IYD H;  2JA6 G;  2OTJ A;  3PF4 A;  4B3S L;  4P75 A;  1H95 A;  2RHQ B;  4R4O A;  1Q7Y C;  1PH7 A;  5GAH C;  3PUY A;  4GKK Q;  2LXJ A;  4HIK A;  5JEA J;  1WOC A;  1YIT A;  2QA4 A;  1E1T A;  1VQM A;  2NN6 G;  1KL9 A;  2F3I A;  4P72 A;  3I4M H;  1YIJ A;  3HOW G;  1EYG A;  3F2B A;  4DV1 L;  4YCW A;  4KHZ A;  4GNX C;  1UEB A;  4DR5 L;  1PV4 A;  5M3M H;  4H02 A;  3HKS A;  3F2C A;  1D8L A;  1YHQ A;  4LF8 Q;  4GLA C;  2VQE Q;  2CKZ B;  2PQA B;  3STB C;  3J81 c;  3AEV A;  2UU9 L;  4IJH A;  1UE7 A;  1EQR A;  3MEF A;  4GN3 B;  4A3I G;  1KC8 C;  4L5S A;  4OWW B;  2ASB A;  1HH2 P;  4B3S Q;  1AH9 A;  1OTC A;  1W2B A;  3GTM H;  2MQH A;  2YTY A;  4OXP A;  5HGQ A;  2ZM6 L;  4DV3 L;  3CAM A;  3OYY A;  1L1O A;  1SRU A;  4B3R L;  1Q86 C;  4LF5 Q;  3I56 A;  4JG2 A;  5C0X G;  4IFD J;  4OWT B;  5E7N A;  2EIF A;  4P73 A;  2E8G A;  2JQO A;  1PH4 A;  2UXC L;  2B3G A;  3VDY A;  2K5V A;  3PUX A;  3UDF A;  2ZTD A;  4B3T L;  4GKJ Q;  3PSI A;  4DV1 Q;  4ME3 A;  4DR6 L;  1BBU A;  4DR5 Q;  4A3E G;  1N33 L;  5BR8 L;  3H15 A;  4GOP C;  1BVS A;  2RCN A;  1NY4 A;  4YHH L;  1NE3 A;  1VQJ A;  3M7N A;  1WCM H;  5IP9 H;  5M3F H;  2BH2 A;  2R7Z H;  4A3G H;  4LNQ A;  5FLM H;  2NVT H;  4X64 Q;  3CCQ A;  3H3V H;  4A3M H;  1YJ9 A;  2Q2I A;  1QVG A;  2HT1 A;  4BY7 H;  1Z9F A;  2ZM6 Q;  4DV3 Q;  4P74 A;  1GM5 A;  3S2H H;  2UXD L;  1PHJ A;  4B3R Q;  5C4J H;  3W5O A;  3J81 i;  1Y1V G;  2PI2 E;  3DM3 A;  4APV A;  3HKZ E;  2NN6 I;  4A3K H;  1VQO A;  1XNQ L;  2MFI A;  1KAW A;  1TWF H;  2JJQ A;  4NPS A;  2B63 H;  1CKN A;  4YCV A;  3S15 H;  2UUB Q;  3A0J A;  4JBK A;  2UXC Q;  1OXT A;  1C0A A;  2E5L L;  4LFA Q;  1X9N A;  3IRB A;  4PZ8 A;  1X6O A;  3CPW A;  4A3J H;  4B3T Q;  3KF8 B;  4OX9 Q;  3AFP A;  1YZ6 A;  2K50 A;  3M3Y H;  4DR6 Q;  1GVP A;  4RG1 A;  2ES2 A;  5BR8 Q;  2JA6 H;  1Y14 B;  3S1Q H;  4Y7N H;  3I7F A;  4KLK A;  4YHH Q;  4BXX G;  2UUC L;  1NTG A;  1EOV A;  1O7I A;  3CXC A;  4OO1 G;  1GKH A;  3KYH C;  2JEB I;  3J81 j;  4BY1 G;  4LUV A;  2ZTE A;  4JI2 Q;  2NVQ H;  2UXD Q;  4BA1 I;  3BJU A;  5C0X I;  1BKB A;  1Q1E A;  1V43 A;  2F4V L;  3HOW H;  2VW9 A;  3CC2 A;  4A3C G;  1MJE A;  1XNQ Q;  3K7U C;  3L0O A;  1HZ9 A;  3Q8D A;  2YV5 A;  2E5L Q;  2WAQ E;  4JCV E;  5JEA G;  1NMG A;  2KCT A;  1VQP A;  1K8G A;  3NEN A;  1V9P A;  4JYA L;  3RZD H;  2YTX A;  2BH8 A;  3CME A;  4A3I H;  5C44 G;  5FLX c;  1EIY B;  2JK8 A;  1VS0 A;  4DAM A;  1VQ5 A;  4GOP B;  1NJI C;  2UUC Q;  2YU9 H;  3D0F A;  2CFM A;  1S72 A;  3I4O A;  3STB D;  1VQE A;  1N34 Q;  2WFW A;  1PYB A;  3MXN B;  1XJV A;  4UP8 A;  1K83 H;  1Q12 A;  4AQY Q;  3KLW A;  4OWX B;  2BA0 A;  1VQK A;  1XPU A;  4TVA B;  2CQO A;  4JI8 L;  1CUK A;  4HJ8 A;  1XTD A;  4DNI A;  4POF A;  1X3F A;  2KEN A;  1VQI A;  1W3S A;  4JOI A;  4JOI C;  5IWA Q;  3CCR A;  2Q2T A;  4DR7 L;  4JI5 Q;  1I6H H;  1LYL A;  2XTI A;  3F2D A;  1VCI A;  1P8L A;  4C3I H;  4A3E H;  4A76 A;  5K36 G;  3W1B A;  4WJ4 A;  1FJG Q;  4QJF A;  1CKN B;  2F52 A;  3K80 C;  1WI5 A;  4HJA A;  1X3G A;  3FHW A;  2Z6K C;  3PIO A;  4IFD G;  1WYD A;  3ZJY C;  3KJP A;  2N3S A;  1E7Z A;  3CCU A;  2UUA L;  3BZC A;  4LFC L;  1JE5 A;  4JYA Q;  3G48 A;  2AKW B;  5JJK A;  3NEM A;  2CWA A;  4LF4 Q;  1RIP A;  2KHI A;  5LMN W;  2K5H A;  2JA8 G;  2IX0 A;  4LF5 L;  4OO1 I;  1VQF A;  4DR2 Q;  2MO1 A;  1YJW A;  2YTV A;  3KOJ A;  1K3R A;  2EXD A;  1Y1V H;  4QY7 A;  1JJG A;  2E2H H;  2XGT A;  5IYC G;  3CCJ A;  5IE8 A;  4GKJ L;  4JI8 Q;  4X65 L;  1J6Q A;  1WFQ A;  2ALY B;  2KCM A;  1OXS C;  4GNX A;  3RN5 A;  1XMQ L;  2JA7 G;  2A8V A;  1XMO Q;  4GLV B;  2ZJP A;  4YWK A;  1QZG A;  1VQB A;  3M4P A;  3TRZ A;  1UE6 A;  3SGI A;  4DR7 Q;  3PO2 G;  1EQQ A;  4L5Q A;  1A8V A;  4AYB E;  1HZA A;  3S1M H;  3M9B A;  3PV0 A;  4X64 L;  4BXX H;  4X6A H;  1KRT A;  2D62 A;  3UE1 A;  3J7A 5;  2UUA Q;  4LFC Q;  4YCU A;  4J15 A;  1HNZ L;  3PF5 A;  4QGU A;  3ER0 A;  1IBK L;  3H3V I;  4EX5 A;  4IPG A;  3CF5 A;  4BY1 H;  1X54 A;  3AQQ A;  2K5N A;  4MZ9 A;  1SLJ A;  2ZTC A;  1EUJ A;  2IHF A;  3AYH B;  2VQF L;  2DUD A;  4XIG S;  2K4K A;  4DR3 Q;  1SFO H;  1PH2 A;  1B70 B;  2VL6 A;  1G6P A;  2IHE A;  3G71 A;  4UY8 C;  4A3C H;  4JV5 L;  2UUB L;  4UP7 A;  1FVI A;  1TWA H;  2QGQ A;  4LFA L;  4JI6 L;  4PG3 A;  1B7Y B;  4DKA C;  3T1Y Q;  4X65 Q;  3UDG A;  4OX9 L;  1VQ8 A;  4HIO A;  1U0L A;  1XMQ Q;  1UE5 A;  3FKI G;  4GOP A;  4GN4 B;  2N8N A;  5C44 H;  4IFD I;  3L2P A;  2WB1 G;  5DLQ E;  3CCV A;  1X3E A;  2AWO A;  4OON A;  1VQD A;  4A4I A;  2PMZ E;  3TEH B;  1YVC A;  1M1K C;  1I94 L;  3FP9 A;  1HNZ Q;  5ELO A;  4C3H H;  1IBK Q;  4JI2 L;  4LWC A;  5IP7 H;  2YYZ A;  4ALP A;  1D7Q A;  4IOC A;  4DK6 C;  1JB7 A;  5C4X G;  2VQF Q;  4L5R C;  1RL2 A;  5M5X H;  3TS2 A;  4LW1 A;  4JV5 Q;  2I5M X;  1OXU A;  4JI0 L;  2Y0S G;  3E9H A;  3S1N H;  2AMC B;  4JI6 Q;  2FXQ A;  4NXN Q;  2AWN A;  3GTG H;  3S14 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...