2NVQH

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvqH00
3CCVA 1NMFA 1VQFA 1N36Q 2ASBA 1Y14B 4JI1Q 4JYAQ 1ASZA 3OTOL 4A3BH 1AH9A 1Q86C 2VY3A 2UXDL 4DV5L 4WJ4A 3PO3H 1MIUA 3S14H 2Q2IA 3M4PA 4O0AA 4NXMQ 3A74A 5IT9c 1PYSB 1YITA 4A93G 3GTQH 4HJ8A 3W5OA 2JQOA 1GVPA 2RF4A 4FDBA 3H15A 4DR5L 4A3EG 3OTOQ 5C4XH 2UXDQ 1K3RA 2B29A 5IYCH 1PH9A 1TXYA 4DUYL 5IYDG 2NVQH 4GS3A 2B3GA 4HJ9A 3U50C 4A3DG 4NB3A 1SRUA 2PQAB 4DR5Q 3HOXG 4A75A 2HHHQ 4KLKA 1GO3E 4POFA 4JC0A 5BR8L 3RZOH 1N32L 5C44G 2JK8A 4DUYQ 3F2BA 1CKNA 3KDFA 3CXCA 4GNXA 3PUWA 1GKHA 1FL0A 2RHQB 4BA2I 2I5HA 1LYLA 4A3FH 4LF7Q 5LMNQ 5M3MH 1X54A 4LFAQ 3PIOA 4WJ3M 1VQDA 4QL5A 4C3JH 3K8AA 2DUDA 2YTYA 3S1RH 3HOZH 2YYZA 3E9IA 4UPAA 4BBSH 1U5KA 2KCMA 2NN6I 3PSIA 4GN3B 4C2MH 1U0LA 1VQ6A 1VQIA 4DAMA 2WP8J 3HOYH 3BZKA 3L0OA 4B3SL 1YBYA 3HOVG 4X62Q 2KHIA 1YHAA 3GTJH 1D8LA 3H0GG 1IBMQ 4GN4B 3JAMi 3RNUA 2GVBA 2JA8G 4IPGA 2I0QA 3WWVA 3UDXA 2NZHA 5IE8A 3KJPA 1NTGA 3PV0A 1D7QA 1YIJA 2AWOA 3A0JA 3CMAA 4TQUS 1XNQL 4HIMA 3D0FA 3J81j 4LUZA 1CKOA 4BBRG 1IXRA 5JJIA 2K5HA 2K4KA 1MJEA 2UU9L 3G48A 2WB1G 4BA1I 4BY7G 1WYDA 3STBD 1VQNA 2Q2TA 3I4NH 4IFDJ 3HKZG 2PQAA 3S1NH 1UE5A 3E9HA 5IP9H 1IYJB 2Z6KA 3J80i 3GTPH 3B6YA 4IPHA 4IO9A 3UE0A 2E2JH 1XTDA 2PI2E 1L1OA 1WCMG 2YTVA 2JA5G 3CCQA 3CMEA 4LF9L 2F4VL 3I4OA 5ELOA 4JBWA 3CC7A 4LW1A 4JI5Q 2OTLA 3HOUG 1H95A 2JA9A 2JA7H 1XPOA 3PGZA 5HY6A 3L2PA 1KAWA 4DUZL 2VUMH 1K8AC 2CWPA 4PMWA 2ZJQA 2VQFQ 3RN5A 2F52A 1LM0A 4KHZA 3M4OH 2CKZB 1SROA 5IP7H 1I6HH 1BKBA 4LF9Q 1JJGA 2CQOA 2CCZA 3ICEA 2UUCL 5FLMG 1EIYB 1BVSA 3TREA 3GTLH 1L2FA 4HIOA 5AJ3L 3M4QA 4YHHL 1VQEA 3PF5A 4DV4L 3HOWH 1KRSA 2E8GA 3F2CA 4DUZQ 4QY7A 4RMFA 1KXLA 1JJCB 1VQGA 3UDFA 1NY4A 2VW9A 2ZTCA 3GTKH 2KENA 2Q2HA 4IPCA 2HIVA 2K14A 1PH6A 2BA1A 3FKIG 1Y1WG 4LWCA 4IFDI 3J7A5 1XPRA 1VS0A 4JI2L 3PO2G 4AQYL 1PFSA 2ZTDA 5AJ3Q 3L7ZC 1VQPA 1HR0Q 4DK6C 4K0KL 1C7YA 4DR7L 5JJLA 2JEBI 4OWXB 3RLFA 1Q12A 3A5ZB 3EN2A 3GD7A 1K9MC 2UUBQ 2JA6G 4JI8Q 3PCOB 3RLNA 1HZBA 4A3GG 4DR3L 4JI4Q 4JI2Q 2D62A 1PVOA 4EQ5A 4A3EH 4PZ6A 1JB7A 3PUVA 2AKWB 4PZ8A 1I50H 4JI3Q 3GO5A 1BBUA 1R9TH 1OXSC 2A8VA 4GN5A 3K80C 1HJPA 4GOPC 2C35B 1HZAA 2WFWA 4LFCL 3I55A 1XMQL 4A3MH 1QZGA 4LF4L 1UE1A 5FJ8G 1T9HA 4JG2A 2MO0A 4DR3Q 3D31A 4EX5A 1VQ5A 2E2HH 4MTNA 4UP8A 1PHJA 2GVAA 3HOXH 1SE8A 4YCUA 1JJ2A 2NZOA 1PV4A 3PF4A 4QQBX 4IOAA 3I4MG 5C3EH 5IY0A 4DR6L 3M7NA 1EQRA 1X3FA 3KF8B 4JV5Q 2XGTA 1YZ6A 3FHWA 1Z47A 3AQQA 1XMQQ 4LFCQ 4LF4Q 3MXNB 3RLOA 4BXXG 3S24A 1XMOL 4DV5Q 3K7UC 2WAQE 3T1YL 1E7ZA 1SN8A 1HZ9A 1IBKL 3DM3A 1HNXL 1E24A 1OXTA 2EQSA 4Y7NH 4HJAA 4DR6Q 4RG1A 3KF6B 1OXUA 1QZHA 3SGIA 1L0WA 4A4IA 4HJ5A 2Z0SA 5LMUL 2ZJPA 3RN2A 4A3KG 1IZ6A 2R6GA 2ZM6L 4BY1G 4HJ7A 1B8AA 2HT1A 3T1YQ 1B7YB 2HIXA 2D0PA 2AMCB 3CC4A 2N78A 2LXJA 2YV5A 5DLQE 4DV6L 5IWAL 2JEAI 1P8LA 2K52A 4JBJA 1WOCA 1IBKQ 1HNXQ 4NPSA 3S17H 1Y1VG 4MNOA 1N34L 4OWWB 2JA8H 4DR2L 4GLAC 4DAYB 3HKSA 3ZJYC 2JJQA 4AIMA 2ZM6Q 1S72A 5C4JH 1QUQA 4IJLA 4X64L 4LF6L 5BR8Q 1N32Q 1RL2A 4ALPA 5IWAQ 2Y0SG 1JMCA 4LFBL 4YWMA 4HIKA 4ME3A 2VNUD 3PO3G 4GLVB 4DV2L 1N34Q 5C0XI 4BY7H 3S2HH 4DKAC 4GOPB 1SLJA 1YEZA 1XPUA 4X6AH 4LF6Q 2GN5A 4PZ7A 1VQKA 1X6OA 2K5VA 3RZDH 1S40A 3JC66 1PH2A 3OYYA 1K8GA 1WCMH 4XIGS 2D0OA 4L5QA 4C3HH 2JA5H 3ER0A 1VQOA 3HOUH 2UXBL 1Z9FA 3KFUA 4L5SA 3CCJA 4B3SQ 1GD7A 3A5UA 4Y52H 3NBHB 3CCLA 3KYHC 4DR4L 1A62A 1VQ8A 4NXNL 2NN6G 5M3FH 3U58A 2UXCL 1YJ9A 1X55A 1YVCA 3KF6A 3TS2A 5FLMH 2QGQA 3K81C 1VQ4A 1XNQQ 1X56A 4DR4Q 3UDGA 4A3IG 2UU9Q 1E1OA 4NXNQ 2N49A 1LTLA 1HZCA 1KC8C 2R7DA 2R7FA 1N9WA 4TVAB 3NEMA 3FKIH 4JOIC 2K75A 4BBSG 4JV5L 3F1ZA 1X3EA 3M9BA 4O2DA 1VQLA 2B63G 3PO2H 1NBWA 1YHBA 4A3LG 4R4OA 1X9NA 3S16H 2F4VQ 1CSPA 4A76A 1EQQA 1PH7A 1VCIA 3CC2A 2R7ZH 4OO1I 3W1GA 1Q8KA 1SMXA 1QVGA 4YY3L 1VQAA 2R93G 5K36G 3T1HL 1XNRL 4A3GH 1BBWA 4GOPA 3CCUA 5H1SE 4GKKL 2OCEA 4X65L 5M5YH 3I7FA 3K7AH 3BZCA 3KJOA 2AHOB 3DLLA 5IYBG 2VQEL 5EAYA 2UUCQ 1IBLL 1UE6A 1KIXA 1QVCA 2I5LX 1Q81C 1YI2A 1PH3A 4YY3Q 3CAMA 4YHHQ 3T1HQ 2Q2UA 1XNRQ 2N8NA 4X66L 4DV1L 4L5TA 4DV4Q 3EBEA 4DR1L 5JEAJ 4DV7L 4UY8C 3I4NG 1FVIA 3S1QH 1NMGA 1KQSA 4GKKQ 4C3IH 4DNIA 3TQYA 1PYBA 1IL2A 3I4MH 4A93H 1HH2P 5GAEC 2VQEQ 4AQYQ 1IBLQ 2LSSA 1C0AA 4J15A 1HNWQ 2I5MX 3BU2A 5GROA 4X66Q 4K0KQ 1WFQA 4DR1Q 4DR7Q 1I3QH 1OXXK 4DV7Q 5M5WH 2KCTA 2IX0A 4R4IA 2DGYA 3GTMH 2EXDA 3KOJA 4IFDG 2RHSB 1K83H 4B3RL 5IYDH 4YCWA 4DK3C 3ERSX 3G71A 1PH8A 4A3DH 1SFOH 5IP7G 2KBNA 2BH8A 2N3SA 2K5NA 2MQHA 3CPFA 5HGQA 1CKNB 1KHIA 3KDFB 4GNXB 4AYBE 4A3KH 2IX1A 1TWFH 1VQBA 1N36L 4JI6L 4JI1L 2ID0A 5C44H 2WB1E 2H5XA 1VQ7A 3CCRA 2OWOA 3AFQA 4B3RQ 1TWGH 1Y1VH 3HKZE 4JI0L 2PNHA 5C0XJ 3GDEA 1TWAH 4DPGA 3S1MH 2OTJA 3EIVA 5J3BA 1K0RA 1KL9A 1G51A 1KRTA 4A3CG 1UWVA 4JI6Q 2IY5B 2CFMA 3S15H 1Q1EA 1AE3A 3I56A 1SR3A 5FLXc 2KHJA 4A3JG 1K73C 2NVXH 2R92G 2OQKA 2ALYB 3W1BA 1OTCA 1TWHH 2MNAA 1XMOQ 3RR5A 3UDIA 4JI0Q 1EIFA 3ULJA 4GLXA 1X65A 2V1CC 3AFPA 4YWLA 2QA4A 1S3OA 3HOVH 4PG3A 4QIWE 4P74A 2FXQA 3H0GH 1PA6A 2HHHL 1CUKA 1B70B 3STBC 5LMNW 5GADC 3BJUA 5LMUQ 1E3PA 5JEAG 4B3TL 2CWAA 3M3YH 2ES2A 4XTCS 5ELNA 4A3MG 3GTGH 4A3BG 1CKMA 2PMZE 4DV6Q 4LF7L 2MO1A 1VQJA 3MEFA 5LMNL 4BBRH 1PH5A 2A19A 3PUYA 3Q8DA 4OXPA 3U4VA 2ZJRA 4LFAL 1Q46A 5C3EG 1L1OB 1C9OA 4P71A 4DR2Q 4LF5L 3CQZH 3M85A 4B3TQ 3G4SA 1ASYA 4JBKA 3CW2C 4X64Q 1YJWA 4JOIA 5C4XG 1MKHA 3IRBA 5IYCG 4LFBQ 4A3IH 2NVTH 3TEHB 1VQHA 2E2IH 4X62L 1I5FA 4DV2Q 2HQLA 3JAMc 1IBML 4R4TA 1G291 1YNXA 4L5RC 4LF5Q 3PUXA 1A8VA 5GQOA 4LF8L 2MFIA 4R4QA 3I2ZA 1X3GA 2IHFA 1N8RC 3FP9A 5GAHC 1YJNA 2F3IA 3ULPA 2B63H 1HNZL 3LGJA 1NE3A 4OX9L 1HNWL 4A3LH 3F8TA 1PH1A 5C0XG 1CSQA 2QEXA 1E22A 1GM5A 1E1TA 4APVA 3ULLA 2UXBQ 5JJKA 2E5LL 1NJIC 3TRZA 2R93H 1TWCH 2IHEA 4LF8Q 1VQMA 2BH2A 4A3FG 4IJHA 1YHQA 1V1QA 4UP7A 5M3MG 3H3VI 2IT1A 2OQ0A 4MZ9A 1HNZQ 4OX9Q 3NENA 4POGA 3CD6A 2UXCQ 3TS0A 1OXVA 1O7IA 2VL6A 3J80c 4GNXC 3HOZG 3J7ZC 1Y1WH 1DGSA 3S2DH 4AYBG 5IYBH 1Q82C 4P72A 1I94L 1EYGA 2E5LQ 4DV0L 1G6PA 1KD1C 1VQ9A 4JI5L 1WJJA 3HOYG 1EFWA 3NELA 2A1AA 2UUAL 1W3SA 2NVYH 3AYHB 2AWNA 4OWTB 4KI0A 1JT8A 4HIDA 2BA0A 4B3ML 2WAQG 2JA6H 2VQFL 4DV3L 4KHPL 4GKJL 3CCEA 2VZAA 3F2DA 1I94Q 1V9PA 4DV0Q 2XTIA 3HFZB 5M5XH 3H3VH 2UUAQ 3CP0A 4IOCA 1JE5A 2LXKA 4QJFA 4LNQA 4P73A 4B3MQ 1J6QA 3CPWA 1Q1BA 1XJVA 1V43A 1PH4A 1HR0W 2JE6I 4AH6A 4DV3Q 1M1KC 4KHPQ 5FJ8H 5M3FG 1J5EL 4GKJQ 1WI5A 3E0EA 4JCVE 4QGUA 4X65Q 4R1JA 1W2BA 3K0XA 5IP9G 3U4ZA 1FGUA 2Y0SE 4OO1G 1UE7A 1HR0L 1RIPA 4UP9A 3OW2A 4P75A 1A0IA 1N33L 3G6EA 1EOVA 5GAGC 4JBMA 2RCNA 2ZTEA 3CF5A 1EWIA 1J5EQ 2UUBL 4DV1Q 1QVFA 1AE2A 2JA7G 4JI8L 2PI2A 2Z6KC 3J81c 3VDYA 4BXXH 1EUJA 4LUOA 1P16A 4IPDA 2YTXA 4H02A 5E7NA 4JI4L 1FJGL 2VUMG 1L1OC 2VS1A 4JI7L 4A3CH 2L15A 3AEVA 4JI3L 4A3JH 1N33Q 4YCVA 2R7ZG 4OONA 4BY1H 4YWKA 1VQCA 2R92H 1MJCA 4JYAL 1UEBA 2K50A 3J81i 2EIFA 3PUZA 3UE1A 2YU9H 3KLWA 1FJGQ 3HOWG 1A63A 4JI7Q 3GTOH 1QUQB 4NXML 1M90C 3CCMA 2ATWA 3CCSA 3PIPA 4R4CA 4LUVA 1Q7YC 1LUZA
chains in the Genus database with same CATH superfamily
4N9PA 1NMFA 2ASBA 2QDBA 3QIAA 4JYAQ 1ASZA 2UXDL 3IKJA 3S14H 3NTHA 2D5DA 5IT9c 1PYSB 2K32A 3H15A 4A3EG 4DR5L 4OELB 1RTNA 2PW5A 3HEJA 4TKOB 1KNEA 1H9MA 2M00A 1LLRD 1IL8A 3K5MA 2K6AA 1QE6A 1SSOA 1GOZA 5IYDG 1Y8OB 2GA4B 3VYRA 1SRUA 3GQBA 4FXKC 2X6GA 4A75A 3L9AX 4WJWA 3HG9A 4POFA 1IW7C 4C1NI 5FLXL 1N32L 5C0XH 4DUYQ 1V8QA 3F2BA 3OWEB 4BA2I 4LF7Q 4QUCA 2NUCA 3C46A 4Q5VA 2R61A 4C3JH 5M5YB 3V96A 1JC7A 3K7AB 4X3UA 3E9IA 3P75A 1ESRA 2NN6I 4C2MH 2F3VA 1VQ6A 3QOJA 1EY8A 5JVG3 1X3QA 3P1HA 3HOVG 2KHIA 1BCPF 4KKTA 4IALA 4C3IB 5BN5A 2LMCB 4IPGA 3I4MB 2NZHA 4Z9CB 3BYTB 1GUOA 1Y69U 1GHKA 4H7BA 1G2SA 1I3QB 2JXMB 1XNQL 5KNCA 2F0KA 2PZUA 1CKOA 4BBRG 1BCPC 5KYLA 1MJEA 3Q6SA 1D1IA 4A3DB 2EJGC 4IFDJ 5IP9H 1IYJB 3EROA 3GTPH 4XQNA 3BS1A 2RBMA 3TDQA 3UE0A 5IGCA 2PI2E 1W6JA 3T53B 1TU2B 2WV6D 1T5EA 4NDXA 2F03A 2XVSA 1PRTC 3L2PA 4RA8A 3X3NA 2ZJQA 3J80L 1LM0A 1SROA 1FYCA 4K8JA 5IP7H 4RWSC 4LF9Q 2NVXB 2CQOA 1LT5D 2CCZA 3ICEA 2UUCL 5M9OA 3GTLH 2B2VC 2HCCA 4XQQA 2E8GA 4QY7A 1KXLA 2I07B 5ISRA 1CQFA 1VQGA 1NY4A 2ZTCA 3MFYA 1Y1WG 1HHVA 4LWCA 5ELBA 4AQYL 1S5DD 3L7ZC 1VQPA 5JJLA 2XRSD 3MA2B 1Q12A 4LMQD 3UI2A 1HZBA 2NBFA 4EQ5A 4PZ6A 1JB7A 3VR2A 1I50H 1R9TH 1OXSC 2A8VA 3I90A 2JA5B 2WACA 1V1PB 3K80C 4GOPC 2C35B 1HZAA 4LFCL 4A3MH 1QZGA 1T9HA 4DR3Q 1DOMA 2Z4IA 1B2TA 4ZRZA 1WTHA 5EBCA 3I8ZA 3HOXH 4YCUA 2PZTA 5C3EH 1E2VA 5IY0A 2QKIC 1EQRA 2RSOA 4JV5Q 1O80A 5IGBA 1YZ6A 1Z47A 5COYA 5IGDA 3RLOA 3S24A 2I46A 1PFBA 2JN4A 5CYUA 1SN8A 2A6EC 2XWJB 1OXUA 5LL6S 3WOEA 1TY0A 5DM73 3S2DB 4XT1B 5LMUL 3PO2B 1IZ6A 2HT1A 3HZXA 4BY1G 1B7YB 3A8IE 1IKLA 3MWYW 1Y8NB 4L6TB 1WOCA 1JOOA 1O7YA 3T13A 2EYOA 2JA8H 5CBEE 5G3LD 1HFGA 5D3IB 4J1MA 2ZM6Q 5C4JH 1WTWA 4HR7B 5M5XB 1WTVA 4MTKA 1DCZA 1JQYD 2BCOA 2WKDA 4LAAA 4ME3A 3NQIA 4H44C 4KJOA 4DV2L 4BY7H 5C0XI 1SLJA 4FYDA 1XPUA 4X6AH 3K5NA 4LF6Q 1MSGA 3RZDH 4K6DA 3IFDA 2F0WA 3JC66 1PH2A 3TZUA 5A35A 3OYYA 1J8IA 1WCMH 4L5QA 1VQOA 5KYIA 1K0SA 4L5SA 5FOBB 4B3SQ 3NBHB 3KLRA 1VQ8A 1LT4D 3DEOA 1YJ9A 1KLUD 1RF2D 2E75C 3EJIA 4KKUA 4RKLA 2DNCA 1QNKA 4A3KB 1LTBD 2L5TA 4CDEC 4HAEA 1STGA 5C5MA 2L1BA 1A2TA 5CV7A 4NXNQ 1TWGB 3E0JA 3FKIH 4PQXA 3S1MB 3OW7A 2E2DC 1VQLA 4A3LG 1KABA 1X9NA 3S16H 3KLSX 2TSSA 2Y0SB 3CC2A 4GZYC 3W1GA 5K36G 1TWHB 1QVGA 4A3GH 2AUKA 4GKKL 2OCEA 3CU7A 2AHOB 3KBGA 5IYBG 3DWQA 1UE6A 1KIXA 4P2CB 3M3YB 5D14A 1EWCA 1WVLA 3GTGB 4L5TA 4DV7L 3S1QH 1NMGA 2B2UA 3NBHA 1BF4A 3KLSA 5G3LF 1IL2A 4A93H 4FF4A 1HH2P 1KDAA 1AZQA 1IBLQ 3U9OA 4J15A 2NTTA 4X66Q 1WFQA 4DR7Q 1RHPA 4HEDA 2IX0A 4R4IA 3NP8A 2H4OA 2EXDA 4B3RL 2RHSB 1ZYRC 4C3JB 3ERSX 1I4HA 1PH8A 2BH8A 2K5NA 1JORA 1JWMD 1KHIA 1JE4A 4C2MB 1TWFH 1VQBA 3BG3A 3O13A 2H5XA 1VQ7A 3CCRA 2OWOA 2MJ8A 4K5WA 2EY1A 1I4RA 3HKZE 2R93B 2PNHA 3GDEA 2EYFA 3EIVA 3T56B 4HCSA 2CFMA 2K03A 3EA6A 1AE3A 5ELDA 4A3JG 5FLXc 1VMPA 5J39A 1O7ZA 2XIWA 1XTCD 2ALYB 2MNAA 4JI0Q 1EIFA 2QA4A 2IX3A 4PG3A 2IW3A 3H0GH 3GTPB 4YIJA 1TKWB 3D4DA 1E3PA 2KHSA 1SNPA 1DZ1A 4A3BG 2PMZE 3C1FA 4DV6Q 1HRJA 1CHPD 4LF7L 1VQJA 2A19A 2ZJRA 1KNAA 5FO8B 1HPCA 4NW2A 3U9SA 4E6IA 1L1OB 1FNVA 3G4SA 1U4LA 3CW2C 3A7LA 4KHVA 3GV3A 4X64Q 4I65A 1B3QA 2PYKA 3GTLB 1SYBA 4LFBQ 5BN3A 4A3IH 4FNFA 3NXWA 2E2IH 1SE2A 4PNYA 1G291 4R4TA 3FEWX 4LF5Q 3I2ZA 1SXTA 3E3XA 1NE3A 1HFNA 5DM63 1GM5A 4KK7A 4APVA 3ULLA 1EY9A 2SDFA 1NJIC 1BQQT 2SNSA 2R92B 1TWCH 3VR3A 2IHEA 2Z8LA 3K57A 4MZ9A 1HNZQ 3TP7A 5A2QE 1G6ZA 5C4HA 4DA2A 3J80c 1I50B 3QWNA 4GNXC 3HOZG 3J7ZC 2VXWA 1R9TB 4F8MA 4AYBG 3VR4A 4P72A 4DV0L 1KD1C 1VQ9A 3HOYG 4A3MB 3R3OA 2UUAL 2NVYH 3AYHB 4OWTB 1JT8A 3QO2A 4HIDA 2BA0A 3D4WA 3HOXB 1NSNS 1MBYA 1STNA 1KTKA 5C3EB 2EXZA 1HTLD 5IOCA 1FGBD 1D2BA 1DXMA 3CP0A 3G7LA 1JE5A 4QJFA 1SMYD 3CPWA 2MHVA 4AH6A 1BDOA 2F0OA 4DV3Q 1M1KC 4KHPQ 5FJ8H 2NZ1D 4RAUC 4CKEA 1CHQD 2AQ1B 1ONLA 1E2WA 2K01A 2OF1A 4R1JA 3K0XA 2Y0SE 4UP9A 3SE0A 3DXJC 5CGKA 3G6EA 2B2YC 2RCNA 1BBXC 1QVFA 3H3VI 4DV1Q 5E7NA 1RDPD 3MHBA 2L15A 1ET9A 1F9QA 1LTSD 1G2TA 1CM9A 2MP1A 2BE5C 4CJ1B 3A7AB 4CJ0B 2D2CC 1MJCA 4PMBA 5IIFA 1CI3M 2F0TA 2Z9HA 5T1IA 2WAQB 1IYVA 3RZDB 1NAPA 3PIPA 2XWBB 3RMHA 1KAAA 5JEAH 1Q7YC 4JV5L 3SR1A 1N36Q 1Y14B 3J81L 1WD0A 2VY3A 1II3A 4JVZA 3MXPA 2ENBA 1FNUA 4NXMQ 4C3IG 3I70A 1PRTB 3I3CA 1YITA 5BN4A 2JSOA 3BDOA 4HJ8A 4CDDC 3S1NB 3OTOQ 5C4XH 5IT9E 5IYCH 1PH9A 1TXYA 1J9OA 4GS3A 1WTPA 3T16A 1B4OA 2JA7B 4A3DG 2RDGA 1NR4A 2Z6BA 2HHHQ 3I91A 4J6HA 1GO3E 4KD4A 4JC0A 4N9TA 4DXFA 1IKMA 2JK8A 1I4QA 1CKNA 1EU3A 1SE3A 1F2ZA 1FL0A 4RHSA 2I5HA 4A3FH 4A3GB 4KV6A 5LMNQ 3G6JB 2DJFC 4LFAQ 3PIOA 4FO2A 3LNNA 4XYQA 3GTKB 3K8AA 5I9PA 2DUDA 2O2LD 2YTYA 3PQIA 4IUPA 2F0GA 2KCMA 1VQIA 1STAA 3BZKA 3L0OA 2DNEA 4B3SL 3GV6A 1C48A 1D8LA 3RNUA 4A93B 4N8FA 5IE8A 3PV0A 5CV6A 1SYDA 1EY5A 3A0JA 3BYYB 2TMPA 5JJIA 5CR3A 3JAML 2N55A 1WYDA 2FMCA 2F3WA 3I4NH 2CW0C 3HKZG 5L37A 3E9HA 1TWFB 1XTDA 1X32A 2JA5G 3CMEA 3ND9A 5ELOA 4JBWA 4JI5Q 4LW1A 1KAWA 1TS5A 4DUZL 1D6EC 3TP6A 4DU9A 2F52A 4KHZA 1K28A 4Y7NB 5IGEA 3VA7A 1BKBA 1JJGA 2F0PA 3TREA 4ZUIA 2F0IA 4HIOA 5AJ3L 1VQEA 2XSCA 3PF5A 1I4PA 3HOWH 4RKBA 1XXGA 4RMFA 4IUUA 1JJCB 3UDFA 3H0GB 2KENA 1EQTA 1GJXA 2HIVA 2QCPX 1PH6A 3HGBA 1U9RA 4O1NA 3PO2G 1PFSA 2Q8RE 1HR0Q 4WFN3 3VYUA 1CA6A 2WIIB 1C7YA 4DR7L 4OWXB 3RLFA 2UUBQ 2WB1B 3K5OA 3PCOB 5JOBA 4JI2Q 2D62A 4A3EH 1ENAA 2P5ZX 3Q24A 4NMZA 4X3TA 2ZT9C 3NTKA 2EDGA 4ZAIA 5HGTA 2HQEA 4C3HB 4ZKBB 4A3IB 3HOUB 2QF7A 3I55A 1XMQL 2MO0A 3VYTA 4EX5A 3NQTA 4UP8A 1V1OA 1STYA 2GVAA 1PHJA 1JWSD 1EY4A 1WTXA 1DOKA 1JJ2A 4ABNA 1SNMA 3LX0A 1NR2A 1TS3A 3TP5A 3LWEA 3FHWA 1EIGA 3I4LA 3R93A 4LF4Q 4DV5Q 2WAQE 3T1YL 1KLGD 2F0EA 1IBKL 5E1FA 3DM3A 1E24A 1OXTA 4DR6Q 4HJAA 3KF6B 3SGIA 4A4IA 4HJ5A 1A3TA 2ZJPA 4A3KG 1O78A 4HJ7A 1CQVA 1HQMC 1MHWC 2D0PA 1LV9A 2NYZD 2NVYB 2SEBD 2N78A 2WKCA 2YV5A 4DV6L 4F87A 1HNXQ 5EQ0A 5E4WC 3S17H 1Y1VG 1N34L 2M2LA 2PO4A 1PTOD 4DAYB 4U68A 1QUQA 4X64L 5BR8Q 1SJED 3J7AF 5IWAQ 2Y0SG 1JMCA 4LFBL 4YWMA 2BOSA 4UDUC 4GLVB 1YEZA 4KN7C 4O42A 4PZ7A 2K5VA 5D3DA 4XIGS 2D0OA 3ER0A 3N52A 3FPPA 4EQPA 1Z9FA 3KFUA 3MZ5A 1K8OA 5ELFA 3C3LA 3EVQA 3OHXC 2A68C 1JCKB 5M3FH 1X55A 3NTIA 1YVCA 3KF6A 2PPBC 2A73B 1ILQA 3GP7A 2QW7A 3K81C 2OXPA 1X56A 4DR4Q 1E1OA 1LTLA 1KC8C 5CMDA 2R7DA 4C3JG 1N9WA 3C1EA 4JOIC 1EYAA 2K75A 2B63G 1HQRD 1CA5A 2F4VQ 3DHQA 3NPPA 1PH7A 4OO1I 2R7ZH 1H9JA 5KRUA 3PO3B 2R93G 4YY3L 3T1HL 1AEXA 2RSNA 4FF3A 1EZ6A 3I7FA 3BZCA 1ICFB 2VQEL 5EAYA 3RUZA 1S5FD 1QVCA 2A74C 1YI2A 1PH3A 3CAMA 1CZGA 4YHHQ 1XNRQ 2N8NA 4DV1L 1LO5D 4DR1L 2SOBA 1ZEQX 4J8QA 5I4DA 1B53A 1KQSA 2MUYA 4DNIA 1PYBA 4IUQA 2IJ0A 3CRLC 1PTOF 3CQZB 5DAUA 3H3VC 4OIJA 1HNWQ 3BU2A 3NSWA 5M5WH 4A3FB 2L12A 5IGFA 3GTMH 4IFDG 3G71A 1SFOH 5IP7G 2KBNA 2A5HA 1PMRA 2K28A 5I2YA 3KDFB 4GNXB 4AYBE 3MFGA 1DYQA 1N36L 4JI6L 1YNND 3IAYA 1HTPA 2ID0A 5C44H 2WB1E 4HSVA 3BVZA 2RKSA 3AFQA 3WOFA 4DPGA 4L8JA 1MI2A 1GUTA 1ENFA 4A3CG 5I6WA 5I9OA 1UWVA 2IY5B 3S15H 3SXHA 1JB3A 2KUMA 1Q1EA 3S9WA 4DXGA 3E6ZX 1XMOQ 2R92G 3RR5A 2Z4HA 4GLXA 1NCVA 1S3OA 1VF7A 5FLXE 3I4NB 4P74A 2FXQA 3R2TA 2HHHL 3BJUA 4X3KA 4B3TL 4XTCS 4A3MG 1B9MA 4FF2A 3MEFA 5LMNL 1PH5A 4OXPA 1V1PA 3PUYA 4LJZC 3U4VA 4LFAL 3H6MA 5C3EG 1C9OA 4JW0A 2B8FA 4DR2Q 4JBKA 2FINB 1LT3D 1EFID 3IRBA 5CV4A 2EYJA 4C1NK 2HQLA 3JAMc 1LACA 1YNXA 3PUXA 2MFIA 2IHFA 5JVH3 1YJNA 2F3IA 2EY5A 3TP8A 4OX9L 4A3LH 3DEPA 1T5XD 4EGVA 3W3AA 5JPMC 5JJKA 2E5LL 3TRZA 5K36H 1CTMA 4LF8Q 4IJHA 1V1QA 5EPKA 5M3MG 2YU9B 2IT1A 2OQ0A 2UXCQ 2AUJD 1QNUA 3TS0A 1EY0A 1TS2A 5IYBH 1Q82C 2ICIA 1EYGA 1XYIA 1G6PA 4JI5L 3OMCA 1EFWA 3J80E 2A1AA 4K2LA 1TQOA 2AWNA 3L3OC 2B2YA 4B3ML 1ML0D 3S14B 5LL6X 2WAQG 2JA6H 1EY7A 2KOLA 3F2DA 3A54A 2L4NA 5A2QL 1I94Q 1VF5C 1V9PA 1QG7A 2XTIA 3M7GA 2XN9C 4UAIA 3H3VH 1HUMA 4IOCA 1SYCA 2J7ZA 1QB5D 3OMGA 4P73A 3URYA 1XJVA 1V43A 1XX8A 1ILPA 4NKLA 4GKJQ 3D4RA 1J5EL 2FJ2A 4G7OC 1WI5A 3D8GA 4X65Q 4KY5A 1UE7A 1HR0L 5FK9C 3CHBD 3ITPA 4CKBA 4TSSA 1N33L 1EOVA 2A69D 1A6XA 5GAGC 2ZTEA 1HA5A 2UUBL 4BXXH 1AH9A 2JA7G 3S17B 4DNTB 4LUOA 3HRZC 4IPDA 3DWAA 1FJGL 2VUMG 4JI7L 1I4GA 1SJHD 1G8ZD 4KJNA 1EQVA 4A3JH 5DNFA 2O4XA 2DJGC 1VQCA 4IUVA 4JYAL 3PUZA 4K2KA 3GTOH 1QOHA 3CCMA 2ATWA 1JR0D 1LUZA 1LTID 4XDXA 3CCVA 1VQFA 4JI1Q 1PDQA 4A3BH 1AFPA 3KBXA 4DV5L 2RDHA 4IQZA 4WJ4A 4HN7A 1MIUA 2K33A 1SE4A 2DN8A 2MGSA 3M4PA 3MEHA 4ID6A 2RQXA 5M3FB 2PZWA 4A93G 3MC0B 2RF4A 1GVPA 1CT1D 2UXDQ 2B29A 4G4KA 4DUYL 2NVQH 2RVLA 2B3GA 4HJ9A 4NB3A 1RCVD 4DR5Q 4KLKA 1BNZA 4MN3A 5BR8L 3RZOH 4H0LC 1M8AA 1U4MA 2R7ZB 1GKHA 2K5DA 4QB4A 2RHQB 2QDLA 5E3FA 1IYUA 3S1RH 3HOZH 1RTOA 2C5CA 2YYZA 4UPAA 5ELCA 4BBSH 2PQEA 1BO0A 3PSIA 3TBIB 4IN3A 2KA7A 4DAMA 3HOYH 4UHVA 4K14A 3ZYYX 3GTJH 3H0GG 1IBMQ 4GN4B 3AMUA 2SNMA 3KJPA 4ZQ3A 2B2TA 1UEAB 3VA5A 2Q8TA 4TQUS 3P7JA 3D0FA 5M5WB 3J81j 1IXRA 2K5HA 2K4KA 1H9SB 1B9NA 3GTMB 2WB1G 4BA1I 2L9HA 4R8IA 3STBD 1SFOB 2Q2TA 4MIUA 1LABA 1UE5A 2Z6KA 3J80i 3K59A 4X3SA 1HCZA 4IO9A 2F4VL 1L1OA 5C44B 4ME5A 4C3HG 3CCQA 1FR3A 4LF9L 2NWGA 3CC7A 3HOUG 2OTLA 2WINB 1H95A 4DN4M 5HY6A 4CDCC 4XXEA 5KIXA 4PMWA 3RN5A 3M4OH 3S15B 3QR8A 1A3UA 1I6HH 2EY2A 4G7HC 1Z6HA 1LTAD 1IHZA 1LT6D 5FLMG 1EIYB 1BVSA 1GHJA 3H94A 3M4QA 4YHHL 3NBIA 5LHY1 3F2CA 2EJFC 2Q2HA 4IPCA 2K14A 2KJXA 1S5ED 2BA1A 2JA8B 5IODA 3J7A5 1VS0A 4KD3A 3R2IA 1EWHA 2ZTDA 4QF4A 5C4JB 1EY6A 3SK4A 2RA4A 4RCNA 1XWEA 3A5ZB 1K9MC 1ZKOA 4BY7B 1PZID 4DR3L 1BCPB 4JI4Q 3SEBA 4HTHA 1YNJD 3PUVA 2O5IC 4PZ8A 3HP3A 4JI3Q 1TR5A 1BBUA 4B9XA 1WCMB 2KCCA 5NUCA 1HJPA 1PFMA 3ONAB 1H9RA 2WFWA 4TRDA 5FJ8G 1RD9D 4I7ZC 1VQ5A 5CBAE 2J0TD 3K58A 3M4YA 3PF4A 4IOAA 3I4MG 3VYSA 4QIWB 3KF8B 4I7AA 2XGTA 3AQQA 4LFCQ 2B2UC 1XMOL 3K7UC 2EZVA 5EKKA 4KY7A 2EQSA 2ZXRA 2B2WC 3FKIB 2Z0SA 1A3VA 2R6GA 3R8BA 2ZM6L 3S16B 2HIXA 2EOTA 2AMCB 2LXJA 5DLQE 1G91A 2JEAI 1ENCA 1P8LA 2K52A 3ERQA 2JA6B 4NPSA 1ESFA 4OWWB 4N8X1 1H9KA 1UAPA 4DR2L 3BZDB 4GLAC 4B9WA 3HKSA 1S72A 2JJQA 4LF6L 3T51B 3F2UA 4IJLA 4QCLA 3TMEA 1RL2A 4ALPA 1DJRD 3BDCA 3P20A 4HIKA 4CKCA 5J1ZA 3PO3G 2A6HD 2VNUD 1SMYC 4DKAC 4GOPB 2HUGA 3SHLA 3S1QB 1NNXA 1FNWA 1K8MA 2JA5H 4NP5A 3Q0AA 3X3MA 3J7AV 3CCJA 4Y52H 1TIID 3QB3A 5FO7B 2HD3A 4NXNL 2NN6G 4RGTA 2B2VA 4RH6A 3U58A 1AZPA 2UXCL 4OHJA 1HUNA 1F9SA 3TS2A 2QGQA 5HURA 1SNQA 2QEJC 1VQ4A 4OO1H 3UDGA 1ZXTA 1PZKD 2UU9Q 3GTOB 4TVAB 3NEMA 2FMMA 1IW7D 1NUCA 3PO2H 4WORA 4R4OA 2QILA 4A3BB 1CSPA 3SDZA 1EQQA 1VCIA 1D5XC 5CC4A 3QJYA 1SMXA 3RD4A 2PNRC 1BBWA 1TVXA 4IUTA 2KVMA 4GOPA 5H1SE 1C8CA 1SYFA 4X65L 3AU7A 4LK1C 3MAQA 2F0FA 4DNRB 4ZCKA 1IBLL 2I5LX 3Q22A 2Q2UA 1DD2A 4B08A 4X66L 4DV4Q 4UY8C 3I4NG 4GKKQ 1LTTD 4EQOA 1RODA 2JYOA 2X69A 2IWHA 3TQYA 4DGZA 2X6LA 3A55A 1C0AA 2I5MX 1BCPD 4K0KQ 1OXXK 4HSPA 4DV7Q 2FHTA 2KCTA 2E2IB 3KOJA 4FXDA 5IYDH 1K83H 4DK3C 3A8KE 1GUSA 2N3SA 3J81E 2MQHA 4BBSB 5HGQA 1EYCA 1KDCA 4A3KH 4JI1L 1DONA 1PRTD 1SNDA 1SNOA 4B3RQ 2ZXOA 3GTJB 2F0NA 1TWGH 5CV5A 1TY2A 3MTSA 1Y1VH 4JI0L 1TWCB 5C0XJ 1TWAH 2OTJA 3S1MH 2K5WA 5J3BA 4V0BA 1KL9A 1G51A 1W6KA 1KRTA 3EQLC 2MPMA 2B8GA 2KHJA 4K5VA 1MGSA 1JOKA 2OQKA 1OTCA 1TWHH 3UDIA 1PXUA 1X65A 4YWLA 3V2TA 4DAVA 3HOVH 4QIWE 5FO9B 1CUKA 2Q8IB 3MXGA 2EYHA 3FMCA 3KUPA 2K5QA 3M3YH 5ELNA 3NUCA 3GTGH 4M8AA 4DK1A 4BBRH 3M4OB 4P71A 1UUPA 2NTSA 1I6HB 4LF5L 4F88A 1ASYA 4IUNA 1MKHA 4XT3B 1R4QB 2NVTH 2LS01 1VQHA 3TEHB 4ODGA 5C5LA 4CJ2C 3IL8A 1IBML 1O7LA 1WTQA 1X3GA 3FP9A 2B63H 1HNZL 1F2LA 5T1GA 3F8TA 3JAME 3MXUA 3NWTA 4OEMB 5C0XG 1CSQA 2UXBQ 1E1TA 1CZWA 3QG1A 2A6ED 2R93H 1CK1A 1GUNA 3VR6A 1YHQA 4UP7A 2LFNA 1SEBD 4POGA 1OXVA 2VL6A 2BDNA 1MSHA 1Y1WH 3MVVA 1DGSA 2RDFA 1WD1A 4DAYA 1WJJA 5C3XA 3NELA 1B3AA 3CKIB 1W3SA 1PRTF 4KI0A 3I72A 2K05A 4DV3L 4KHPL 1E2ZA 1D1KA 4DV0Q 2F0SA 5EJWA 3HFZB 1E0BA 4XQJA 4DFAA 5C4XB 2UUAQ 1I4XA 2LXKA 1J6QA 1Q1BA 1PH4A 3FPUB 4IFDH 2DY8A 2EE1A 5M3FG 1EL0A 1BUVT 3E0EA 4QGUA 3OSOA 5IP9G 3U4ZA 1L0XB 1FGUA 5C3WA 1L0YB 1F9RA 1TT2A 1A0IA 1EYDA 3C2PA 4JBMA 3CF5A 1EWIA 1RKNA 3J81c 3ND8A 1EUJA 1P16A 4JI4L 2YTXA 4H02A 3DUZA 4A3CH 1F2MA 3AEVA 4JI3L 3D3RA 1PTOC 1SDFA 2J4XA 3TZDA 1DM0B 2F0QA 2R7ZG 4BY1H 2R92H 3J81i 2K50A 2EIFA 3UE1A 1A63A 3KLWA 1KDBA 3HKZB 3DWPA 2F0DA 2G9HD 4NXML 1M4VA 3CCSA 1K3BC 4G57A 2HCIA 4QUFA 2IL8A 2EYMA 4ZUJA 3OTOL 1STHA 1Q86C 1A15A 2Q2IA 4O0AA 3A74A 2CH4W 4BS9A 1U4PA 3GTQH 4FF1A 3AB9A 3W5OA 2JQOA 4FDBA 5KNDA 3E5SA 3OWFA 2PCFB 3BVGA 1K3RA 1S4ZA 3VR5A 2C9OA 2PMZB 3U50C 3CRKC 2PQAB 3TSSA 3HOXG 1ICWA 2KQ3A 3Q23A 4ZLTF 2JP1A 5C44G 1JWUD 4FP5D 3KDFA 4DF7A 3CXCA 4GNXA 2AQ2B 3PUWA 1ZYRD 1LYLA 5TSSA 3HOWB 5M3MH 4JPBW 1X54A 4WJ3M 1VQDA 4QL5A 3SVMA 4PMCA 2VB3X 5CORA 1U5KA 4GN3B 4ILWA 1U0LA 2EY6A 2EYPA 2L55A 2WP8J 1D5MC 4ZK9B 1YBYA 2RCFA 4X62Q 1YHAA 3SK8A 3JAMi 4ZYSA 2GVBA 2JA8G 2I0QA 3WWVA 3UDXA 1NTGA 1S5BD 1D7QA 4A3EB 1YIJA 2AWOA 3CMAA 1F9PA 3SK5A 4HIMA 4K6LA 4LUZA 2UU9L 5D65A 3G48A 4RGOS 1K83B 4BY7G 4DAPA 1VQNA 1EIHA 3K0YA 4MHEA 5CV8A 5C6AA 2PQAA 2V4DA 3S1NH 3B6YA 4IPHA 2E2JH 4R9WA 1WCMG 2YTVA 2CVRA 1CFMA 3I4OA 5ELEA 1YNNC 2JA9A 2JA7H 1Y1VB 1XPOA 3PGZA 1TWAB 2VUMH 1K8AC 2CWPA 3A8JE 2VQFQ 2CKZB 1U4RA 1R4PB 4CHTB 1PTOH 1L2FA 1GXDC 3PMFA 5I6YA 4DV4L 1KRSA 4DUZQ 1GUWA 3HOVB 2VW9A 3GTKH 3A56A 4EQNA 3FKIG 4IFDI 3FVQA 1XPRA 4JI2L 1B1ZA 5E4XA 5AJ3Q 4DK6C 4K0KL 1B44D 2JEBI 1AN8A 3EN2A 3GD7A 4BBRB 3HS0C 2JA6G 4JI8Q 5KGUA 3EFXD 3RLNA 4A3GG 3OOCA 4H13C 1PVOA 3D6CA 1EEID 5AFWA 2AKWB 2B2WA 1B50A 2OEOA 3GO5A 4KTAA 4QMGA 4GN5A 2NVTB 2BH2A 4LF4L 1UE1A 2KEDA 4JG2A 4PV1C 3D31A 2E2HH 1QCBD 4MTNA 2L11A 1SE8A 2B63B 2NZOA 2Z1CA 1PV4A 4QQBX 1AW7A 4DR6L 3M7NA 1X3FA 1GUGA 4KY6A 4M1UB 1XMQQ 3MXNB 1HA6A 1SYEA 4BXXG 5F2DA 1TS4A 2BDOA 1E7ZA 3H91A 1HZ9A 1HNXL 2F0HA 4Y7NH 4RG1A 1EOTA 1QZHA 1Y1WB 1L0WA 2D9UA 3RN2A 1B8AA 3T1YQ 3OIPA 2K04A 4OGQC 3CC4A 4HMJA 1I6VC 5IWAL 1IBKQ 4JBJA 5IT9L 5EKLA 4MNOA 1A2UA 3H09A 4IZ8A 4KN4C 2AQ3B 1SNCA 3ZJYC 4AIMA 1VMCA 2BE5D 2E74C 4ZKCB 1N32Q 5JAVA 3QOLA 1UNSA 1N34Q 3S2HH 2F0LA 4KKSA 4U673 2GN5A 1VQKA 1X6OA 5IGGA 1S40A 1K8GA 1BXTA 4C3HH 3HOUH 4G7ZC 2UXBL 2EYLA 1QWYA 5CV9A 4CDFC 3MXNA 3K5LA 2O5JC 1GD7A 3A5UA 2LKVA 2CHBD 4DR4L 2A69C 3KYHC 3CCLA 1A62A 4L63B 5KNBA 2LY7A 2XRQD 5EKIA 1AP0A 1QILA 1F77A 3FDTA 2L0CA 5FLMH 1RJTA 2R3ZA 5EBDA 4BY1B 1XNQQ 4A3IG 2N49A 2XNAC 1HZCA 1Y8PB 2R7FA 1EEFD 2F0VA 4RHRA 4BBSG 3F1ZA 1X3EA 3M9BA 4O2DA 5K5PA 1NBWA 1YHBA 3K6OA 2E76C 4A76A 4C56C 1Q8KA 1Q90A 1VQAA 1XNRL 1BOSA 2EJMA 3GTQB 1PZJD 3CCUA 2N88A 5M5YH 3K7AH 1MD2D 1Z7TA 5DEHA 3KJOA 4RCOA 3DLLA 2EVBA 2UUCQ 1Q81C 4YY3Q 1HNWL 3T1HQ 3EBEA 3OPOA 5JEAJ 1FVIA 4C3IH 2G5DA 1PFNA 4R8NA 1H9SA 3I4MH 1F2YA 5GAEC 2PW7A 2VQEQ 4AQYQ 2LSSA 1STBA 2EPBA 1LTGD 5GROA 3KK7A 4F7XA 4DR1Q 2FFKB 1I3QH 4OL7A 3WDNA 5M3MB 2KEEA 2DGYA 2CW0D 4S3SA 4YCWA 5FKAC 4A3DH 5EPLA 3CPFA 2HDLA 1CKNB 5J22A 2B39A 1SYGA 2IX1A 1PYWD 3V05A 4V190 3BVMA 4IURA 3NE5B 4CBVA 2ICEC 4RGNA 4K8IA 3NK9A 4KMUC 1K0RA 4DK0A 5JJZA 2NB0A 2K7VA 3NWSA 4JI6Q 2DY7A 1HXYD 1JICA 2NVXH 3I56A 1SR3A 1K73C 2IPKD 1OO9B 1FD7D 2VB2X 4K5XA 3W1BA 3PO3H 2K1BA 3ULJA 2V1CC 3AFPA 4WRDA 4OIKA 4BWGB 1Q8IA 1PA6A 1B70B 3STBC 5LMNW 3W2DA 5GADC 2E2JB 3I73A 5LMUQ 5JEAG 1EZ8A 2CWAA 2ES2A 1ET6A 1CKMA 1WTRA 2CH4A 3D6WA 5EPJA 2MO1A 1Q3LA 2F1MA 2VUMB 1X3PA 3Q8DA 3PIP3 2NN6H 5JPNC 1Q46A 2HDMA 3FRPB 3CQZH 3M85A 4HCEA 4B3TQ 1YJWA 2CQAA 1PTOB 4JOIA 4RGMA 2F0MA 5C4XG 5IYCG 3KF8A 4X62L 1I5FA 4DV2Q 4L5RC 4LF8L 5GQOA 1A8VA 4R4QA 2KCNA 1N8RC 5GAHC 3ULPA 3LGJA 1PH1A 3IFTA 5I2XA 4A3JB 2QEXA 1E22A 4ULLA 2OT2A 3TN2A 4RFBA 4A3FG 1VQMA 5C4ZA 4OX9Q 3NENA 3CD6A 1O7IA 3S2DH 1YNJC 3DMUA 1I94L 2E5LQ 2F4IA 2G9DA 1QJOA 3PIO3 1STEA 3NHHA 2E2HB 1JOQA 2VQFL 2M9VA 4GKJL 5KEEA 2VZAA 3CCEA 5M5XH 4FXGC 3SK6A 3DM1A 1WTOA 4LNQA 4B3MQ 1HR0W 2JE6I 2B2TC 2NVQB 4JK1C 5EGTA 3J7YW 3OIQA 4JCVE 1EU4A 1D5ZC 1W2BA 4Q0FA 4OO1G 1SAPA 1RIPA 3RZOB 1BR9A 2H1EA 2ZXPA 3OW2A 1LTRD 4P75A 1J5EQ 2A68D 1AE2A 1VDZA 2PI2A 2Z6KC 4JI8L 4EVOA 3VDYA 3LWUA 1L1OC 2VS1A 3BDLA 3S1RB 3HOZB 4XYOA 2F0JA 1N33Q 4AYBB 4FVMA 4YCVA 4HMIA 4OONA 3N6RA 4YWKA 3T4AC 1S5CD 3HOYB 1UEBA 3S2HB 2YU9H 1SBBB 1FJGQ 3HOWG 2KECA 4JI7Q 4CGYB 2A6HC 1QUQB 1C4QA 1M90C 1DOLA 4R4CA 4LUVA 2F0UA 1PLFA
chains in the Genus database with same CATH topology
3CCVA 1NMFA 1VQFA 1N36Q 2ASBA 1Y14B 4JI1Q 4JYAQ 1ASZA 3OTOL 4A3BH 1AH9A 1Q86C 2VY3A 2UXDL 4DV5L 4WJ4A 3PO3H 1MIUA 3S14H 2Q2IA 3M4PA 4O0AA 4NXMQ 3A74A 5IT9c 1PYSB 1YITA 4A93G 3GTQH 4HJ8A 3W5OA 2JQOA 1GVPA 2RF4A 4FDBA 3H15A 4DR5L 4A3EG 3OTOQ 5C4XH 2UXDQ 1K3RA 2B29A 5IYCH 1PH9A 1TXYA 4DUYL 5IYDG 2NVQH 4GS3A 2B3GA 4HJ9A 3U50C 4A3DG 4NB3A 1SRUA 2PQAB 4DR5Q 3HOXG 4A75A 2HHHQ 4KLKA 1GO3E 4POFA 4JC0A 5BR8L 3RZOH 1N32L 5C44G 2JK8A 4DUYQ 3F2BA 1CKNA 3KDFA 3CXCA 4GNXA 3PUWA 1GKHA 1FL0A 2RHQB 4BA2I 2I5HA 1LYLA 4A3FH 4LF7Q 5LMNQ 5M3MH 1X54A 4LFAQ 3PIOA 4WJ3M 1VQDA 4QL5A 4C3JH 3K8AA 2DUDA 2YTYA 3S1RH 3HOZH 2YYZA 3E9IA 4UPAA 4BBSH 1U5KA 2KCMA 2NN6I 3PSIA 4GN3B 4C2MH 1U0LA 1VQ6A 1VQIA 4DAMA 2WP8J 3HOYH 3BZKA 3L0OA 4B3SL 1YBYA 3HOVG 4X62Q 2KHIA 1YHAA 3GTJH 1D8LA 3H0GG 1IBMQ 4GN4B 3JAMi 3RNUA 2GVBA 2JA8G 4IPGA 2I0QA 3WWVA 3UDXA 2NZHA 5IE8A 3KJPA 1NTGA 3PV0A 1D7QA 1YIJA 2AWOA 3A0JA 3CMAA 4TQUS 1XNQL 4HIMA 3D0FA 3J81j 4LUZA 1CKOA 4BBRG 1IXRA 5JJIA 2K5HA 2K4KA 1MJEA 2UU9L 3G48A 2WB1G 4BA1I 4BY7G 1WYDA 3STBD 1VQNA 2Q2TA 3I4NH 4IFDJ 3HKZG 2PQAA 3S1NH 1UE5A 3E9HA 5IP9H 1IYJB 2Z6KA 3J80i 3GTPH 3B6YA 4IPHA 4IO9A 3UE0A 2E2JH 1XTDA 2PI2E 1L1OA 1WCMG 2YTVA 2JA5G 3CCQA 3CMEA 4LF9L 2F4VL 3I4OA 5ELOA 4JBWA 3CC7A 4LW1A 4JI5Q 2OTLA 3HOUG 1H95A 2JA9A 2JA7H 1XPOA 3PGZA 5HY6A 3L2PA 1KAWA 4DUZL 2VUMH 1K8AC 2CWPA 4PMWA 2ZJQA 2VQFQ 3RN5A 2F52A 1LM0A 4KHZA 3M4OH 2CKZB 1SROA 5IP7H 1I6HH 1BKBA 4LF9Q 1JJGA 2CQOA 2CCZA 3ICEA 2UUCL 5FLMG 1EIYB 1BVSA 3TREA 3GTLH 1L2FA 4HIOA 5AJ3L 3M4QA 4YHHL 1VQEA 3PF5A 4DV4L 3HOWH 1KRSA 2E8GA 3F2CA 4DUZQ 4QY7A 4RMFA 1KXLA 1JJCB 1VQGA 3UDFA 1NY4A 2VW9A 2ZTCA 3GTKH 2KENA 2Q2HA 4IPCA 2HIVA 2K14A 1PH6A 2BA1A 3FKIG 1Y1WG 4LWCA 4IFDI 3J7A5 1XPRA 1VS0A 4JI2L 3PO2G 4AQYL 1PFSA 2ZTDA 5AJ3Q 3L7ZC 1VQPA 1HR0Q 4DK6C 4K0KL 1C7YA 4DR7L 5JJLA 2JEBI 4OWXB 3RLFA 1Q12A 3A5ZB 3EN2A 3GD7A 1K9MC 2UUBQ 2JA6G 4JI8Q 3PCOB 3RLNA 1HZBA 4A3GG 4DR3L 4JI4Q 4JI2Q 2D62A 1PVOA 4EQ5A 4A3EH 4PZ6A 1JB7A 3PUVA 2AKWB 4PZ8A 1I50H 4JI3Q 3GO5A 1BBUA 1R9TH 1OXSC 2A8VA 4GN5A 3K80C 1HJPA 4GOPC 2C35B 1HZAA 2WFWA 4LFCL 3I55A 1XMQL 4A3MH 1QZGA 4LF4L 1UE1A 5FJ8G 1T9HA 4JG2A 2MO0A 4DR3Q 3D31A 4EX5A 1VQ5A 2E2HH 4MTNA 4UP8A 1PHJA 2GVAA 3HOXH 1SE8A 4YCUA 1JJ2A 2NZOA 1PV4A 3PF4A 4QQBX 4IOAA 3I4MG 5C3EH 5IY0A 4DR6L 3M7NA 1EQRA 1X3FA 3KF8B 4JV5Q 2XGTA 1YZ6A 3FHWA 1Z47A 3AQQA 1XMQQ 4LFCQ 4LF4Q 3MXNB 3RLOA 4BXXG 3S24A 1XMOL 4DV5Q 3K7UC 2WAQE 3T1YL 1E7ZA 1SN8A 1HZ9A 1IBKL 3DM3A 1HNXL 1E24A 1OXTA 2EQSA 4Y7NH 4HJAA 4DR6Q 4RG1A 3KF6B 1OXUA 1QZHA 3SGIA 1L0WA 4A4IA 4HJ5A 2Z0SA 5LMUL 2ZJPA 3RN2A 4A3KG 1IZ6A 2R6GA 2ZM6L 4BY1G 4HJ7A 1B8AA 2HT1A 3T1YQ 1B7YB 2HIXA 2D0PA 2AMCB 3CC4A 2N78A 2LXJA 2YV5A 5DLQE 4DV6L 5IWAL 2JEAI 1P8LA 2K52A 4JBJA 1WOCA 1IBKQ 1HNXQ 4NPSA 3S17H 1Y1VG 4MNOA 1N34L 4OWWB 2JA8H 4DR2L 4GLAC 4DAYB 3HKSA 3ZJYC 2JJQA 4AIMA 2ZM6Q 1S72A 5C4JH 1QUQA 4IJLA 4X64L 4LF6L 5BR8Q 1N32Q 1RL2A 4ALPA 5IWAQ 2Y0SG 1JMCA 4LFBL 4YWMA 4HIKA 4ME3A 2VNUD 3PO3G 4GLVB 4DV2L 1N34Q 5C0XI 4BY7H 3S2HH 4DKAC 4GOPB 1SLJA 1YEZA 1XPUA 4X6AH 4LF6Q 2GN5A 4PZ7A 1VQKA 1X6OA 2K5VA 3RZDH 1S40A 3JC66 1PH2A 3OYYA 1K8GA 1WCMH 4XIGS 2D0OA 4L5QA 4C3HH 2JA5H 3ER0A 1VQOA 3HOUH 2UXBL 1Z9FA 3KFUA 4L5SA 3CCJA 4B3SQ 1GD7A 3A5UA 4Y52H 3NBHB 3CCLA 3KYHC 4DR4L 1A62A 1VQ8A 4NXNL 2NN6G 5M3FH 3U58A 2UXCL 1YJ9A 1X55A 1YVCA 3KF6A 3TS2A 5FLMH 2QGQA 3K81C 1VQ4A 1XNQQ 1X56A 4DR4Q 3UDGA 4A3IG 2UU9Q 1E1OA 4NXNQ 2N49A 1LTLA 1HZCA 1KC8C 2R7DA 2R7FA 1N9WA 4TVAB 3NEMA 3FKIH 4JOIC 2K75A 4BBSG 4JV5L 3F1ZA 1X3EA 3M9BA 4O2DA 1VQLA 2B63G 3PO2H 1NBWA 1YHBA 4A3LG 4R4OA 1X9NA 3S16H 2F4VQ 1CSPA 4A76A 1EQQA 1PH7A 1VCIA 3CC2A 2R7ZH 4OO1I 3W1GA 1Q8KA 1SMXA 1QVGA 4YY3L 1VQAA 2R93G 5K36G 3T1HL 1XNRL 4A3GH 1BBWA 4GOPA 3CCUA 5H1SE 4GKKL 2OCEA 4X65L 5M5YH 3I7FA 3K7AH 3BZCA 3KJOA 2AHOB 3DLLA 5IYBG 2VQEL 5EAYA 2UUCQ 1IBLL 1UE6A 1KIXA 1QVCA 2I5LX 1Q81C 1YI2A 1PH3A 4YY3Q 3CAMA 4YHHQ 3T1HQ 2Q2UA 1XNRQ 2N8NA 4X66L 4DV1L 4L5TA 4DV4Q 3EBEA 4DR1L 5JEAJ 4DV7L 4UY8C 3I4NG 1FVIA 3S1QH 1NMGA 1KQSA 4GKKQ 4C3IH 4DNIA 3TQYA 1PYBA 1IL2A 3I4MH 4A93H 1HH2P 5GAEC 2VQEQ 4AQYQ 1IBLQ 2LSSA 1C0AA 4J15A 1HNWQ 2I5MX 3BU2A 5GROA 4X66Q 4K0KQ 1WFQA 4DR1Q 4DR7Q 1I3QH 1OXXK 4DV7Q 5M5WH 2KCTA 2IX0A 4R4IA 2DGYA 3GTMH 2EXDA 3KOJA 4IFDG 2RHSB 1K83H 4B3RL 5IYDH 4YCWA 4DK3C 3ERSX 3G71A 1PH8A 4A3DH 1SFOH 5IP7G 2KBNA 2BH8A 2N3SA 2K5NA 2MQHA 3CPFA 5HGQA 1CKNB 1KHIA 3KDFB 4GNXB 4AYBE 4A3KH 2IX1A 1TWFH 1VQBA 1N36L 4JI6L 4JI1L 2ID0A 5C44H 2WB1E 2H5XA 1VQ7A 3CCRA 2OWOA 3AFQA 4B3RQ 1TWGH 1Y1VH 3HKZE 4JI0L 2PNHA 5C0XJ 3GDEA 1TWAH 4DPGA 3S1MH 2OTJA 3EIVA 5J3BA 1K0RA 1KL9A 1G51A 1KRTA 4A3CG 1UWVA 4JI6Q 2IY5B 2CFMA 3S15H 1Q1EA 1AE3A 3I56A 1SR3A 5FLXc 2KHJA 4A3JG 1K73C 2NVXH 2R92G 2OQKA 2ALYB 3W1BA 1OTCA 1TWHH 2MNAA 1XMOQ 3RR5A 3UDIA 4JI0Q 1EIFA 3ULJA 4GLXA 1X65A 2V1CC 3AFPA 4YWLA 2QA4A 1S3OA 3HOVH 4PG3A 4QIWE 4P74A 2FXQA 3H0GH 1PA6A 2HHHL 1CUKA 1B70B 3STBC 5LMNW 5GADC 3BJUA 5LMUQ 1E3PA 5JEAG 4B3TL 2CWAA 3M3YH 2ES2A 4XTCS 5ELNA 4A3MG 3GTGH 4A3BG 1CKMA 2PMZE 4DV6Q 4LF7L 2MO1A 1VQJA 3MEFA 5LMNL 4BBRH 1PH5A 2A19A 3PUYA 3Q8DA 4OXPA 3U4VA 2ZJRA 4LFAL 1Q46A 5C3EG 1L1OB 1C9OA 4P71A 4DR2Q 4LF5L 3CQZH 3M85A 4B3TQ 3G4SA 1ASYA 4JBKA 3CW2C 4X64Q 1YJWA 4JOIA 5C4XG 1MKHA 3IRBA 5IYCG 4LFBQ 4A3IH 2NVTH 3TEHB 1VQHA 2E2IH 4X62L 1I5FA 4DV2Q 2HQLA 3JAMc 1IBML 4R4TA 1G291 1YNXA 4L5RC 4LF5Q 3PUXA 1A8VA 5GQOA 4LF8L 2MFIA 4R4QA 3I2ZA 1X3GA 2IHFA 1N8RC 3FP9A 5GAHC 1YJNA 2F3IA 3ULPA 2B63H 1HNZL 3LGJA 1NE3A 4OX9L 1HNWL 4A3LH 3F8TA 1PH1A 5C0XG 1CSQA 2QEXA 1E22A 1GM5A 1E1TA 4APVA 3ULLA 2UXBQ 5JJKA 2E5LL 1NJIC 3TRZA 2R93H 1TWCH 2IHEA 4LF8Q 1VQMA 2BH2A 4A3FG 4IJHA 1YHQA 1V1QA 4UP7A 5M3MG 3H3VI 2IT1A 2OQ0A 4MZ9A 1HNZQ 4OX9Q 3NENA 4POGA 3CD6A 2UXCQ 3TS0A 1OXVA 1O7IA 2VL6A 3J80c 4GNXC 3HOZG 3J7ZC 1Y1WH 1DGSA 3S2DH 4AYBG 5IYBH 1Q82C 4P72A 1I94L 1EYGA 2E5LQ 4DV0L 1G6PA 1KD1C 1VQ9A 4JI5L 1WJJA 3HOYG 1EFWA 3NELA 2A1AA 2UUAL 1W3SA 2NVYH 3AYHB 2AWNA 4OWTB 4KI0A 1JT8A 4HIDA 2BA0A 4B3ML 2WAQG 2JA6H 2VQFL 4DV3L 4KHPL 4GKJL 3CCEA 2VZAA 3F2DA 1I94Q 1V9PA 4DV0Q 2XTIA 3HFZB 5M5XH 3H3VH 2UUAQ 3CP0A 4IOCA 1JE5A 2LXKA 4QJFA 4LNQA 4P73A 4B3MQ 1J6QA 3CPWA 1Q1BA 1XJVA 1V43A 1PH4A 1HR0W 2JE6I 4AH6A 4DV3Q 1M1KC 4KHPQ 5FJ8H 5M3FG 1J5EL 4GKJQ 1WI5A 3E0EA 4JCVE 4QGUA 4X65Q 4R1JA 1W2BA 3K0XA 5IP9G 3U4ZA 1FGUA 2Y0SE 4OO1G 1UE7A 1HR0L 1RIPA 4UP9A 3OW2A 4P75A 1A0IA 1N33L 3G6EA 1EOVA 5GAGC 4JBMA 2RCNA 2ZTEA 3CF5A 1EWIA 1J5EQ 2UUBL 4DV1Q 1QVFA 1AE2A 2JA7G 4JI8L 2PI2A 2Z6KC 3J81c 3VDYA 4BXXH 1EUJA 4LUOA 1P16A 4IPDA 2YTXA 4H02A 5E7NA 4JI4L 1FJGL 2VUMG 1L1OC 2VS1A 4JI7L 4A3CH 2L15A 3AEVA 4JI3L 4A3JH 1N33Q 4YCVA 2R7ZG 4OONA 4BY1H 4YWKA 1VQCA 2R92H 1MJCA 4JYAL 1UEBA 2K50A 3J81i 2EIFA 3PUZA 3UE1A 2YU9H 3KLWA 1FJGQ 3HOWG 1A63A 4JI7Q 3GTOH 1QUQB 4NXML 1M90C 3CCMA 2ATWA 3CCSA 3PIPA 4R4CA 4LUVA 1Q7YC 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV A;  1NMF A;  1VQF A;  1N36 Q;  2ASB A;  1Y14 B;  4JI1 Q;  4JYA Q;  1ASZ A;  3OTO L;  4A3B H;  1AH9 A;  1Q86 C;  2VY3 A;  2UXD L;  4DV5 L;  4WJ4 A;  3PO3 H;  1MIU A;  3S14 H;  2Q2I A;  3M4P A;  4O0A A;  4NXM Q;  3A74 A;  5IT9 c;  1PYS B;  1YIT A;  4A93 G;  3GTQ H;  4HJ8 A;  3W5O A;  2JQO A;  1GVP A;  2RF4 A;  4FDB A;  3H15 A;  4DR5 L;  4A3E G;  3OTO Q;  5C4X H;  2UXD Q;  1K3R A;  2B29 A;  5IYC H;  1PH9 A;  1TXY A;  4DUY L;  5IYD G;  2NVQ H;  4GS3 A;  2B3G A;  4HJ9 A;  3U50 C;  4A3D G;  4NB3 A;  1SRU A;  2PQA B;  4DR5 Q;  3HOX G;  4A75 A;  2HHH Q;  4KLK A;  1GO3 E;  4POF A;  4JC0 A;  5BR8 L;  3RZO H;  1N32 L;  5C44 G;  2JK8 A;  4DUY Q;  3F2B A;  1CKN A;  3KDF A;  3CXC A;  4GNX A;  3PUW A;  1GKH A;  1FL0 A;  2RHQ B;  4BA2 I;  2I5H A;  1LYL A;  4A3F H;  4LF7 Q;  5LMN Q;  5M3M H;  1X54 A;  4LFA Q;  3PIO A;  4WJ3 M;  1VQD A;  4QL5 A;  4C3J H;  3K8A A;  2DUD A;  2YTY A;  3S1R H;  3HOZ H;  2YYZ A;  3E9I A;  4UPA A;  4BBS H;  1U5K A;  2KCM A;  2NN6 I;  3PSI A;  4GN3 B;  4C2M H;  1U0L A;  1VQ6 A;  1VQI A;  4DAM A;  2WP8 J;  3HOY H;  3BZK A;  3L0O A;  4B3S L;  1YBY A;  3HOV G;  4X62 Q;  2KHI A;  1YHA A;  3GTJ H;  1D8L A;  3H0G G;  1IBM Q;  4GN4 B;  3JAM i;  3RNU A;  2GVB A;  2JA8 G;  4IPG A;  2I0Q A;  3WWV A;  3UDX A;  2NZH A;  5IE8 A;  3KJP A;  1NTG A;  3PV0 A;  1D7Q A;  1YIJ A;  2AWO A;  3A0J A;  3CMA A;  4TQU S;  1XNQ L;  4HIM A;  3D0F A;  3J81 j;  4LUZ A;  1CKO A;  4BBR G;  1IXR A;  5JJI A;  2K5H A;  2K4K A;  1MJE A;  2UU9 L;  3G48 A;  2WB1 G;  4BA1 I;  4BY7 G;  1WYD A;  3STB D;  1VQN A;  2Q2T A;  3I4N H;  4IFD J;  3HKZ G;  2PQA A;  3S1N H;  1UE5 A;  3E9H A;  5IP9 H;  1IYJ B;  2Z6K A;  3J80 i;  3GTP H;  3B6Y A;  4IPH A;  4IO9 A;  3UE0 A;  2E2J H;  1XTD A;  2PI2 E;  1L1O A;  1WCM G;  2YTV A;  2JA5 G;  3CCQ A;  3CME A;  4LF9 L;  2F4V L;  3I4O A;  5ELO A;  4JBW A;  3CC7 A;  4LW1 A;  4JI5 Q;  2OTL A;  3HOU G;  1H95 A;  2JA9 A;  2JA7 H;  1XPO A;  3PGZ A;  5HY6 A;  3L2P A;  1KAW A;  4DUZ L;  2VUM H;  1K8A C;  2CWP A;  4PMW A;  2ZJQ A;  2VQF Q;  3RN5 A;  2F52 A;  1LM0 A;  4KHZ A;  3M4O H;  2CKZ B;  1SRO A;  5IP7 H;  1I6H H;  1BKB A;  4LF9 Q;  1JJG A;  2CQO A;  2CCZ A;  3ICE A;  2UUC L;  5FLM G;  1EIY B;  1BVS A;  3TRE A;  3GTL H;  1L2F A;  4HIO A;  5AJ3 L;  3M4Q A;  4YHH L;  1VQE A;  3PF5 A;  4DV4 L;  3HOW H;  1KRS A;  2E8G A;  3F2C A;  4DUZ Q;  4QY7 A;  4RMF A;  1KXL A;  1JJC B;  1VQG A;  3UDF A;  1NY4 A;  2VW9 A;  2ZTC A;  3GTK H;  2KEN A;  2Q2H A;  4IPC A;  2HIV A;  2K14 A;  1PH6 A;  2BA1 A;  3FKI G;  1Y1W G;  4LWC A;  4IFD I;  3J7A 5;  1XPR A;  1VS0 A;  4JI2 L;  3PO2 G;  4AQY L;  1PFS A;  2ZTD A;  5AJ3 Q;  3L7Z C;  1VQP A;  1HR0 Q;  4DK6 C;  4K0K L;  1C7Y A;  4DR7 L;  5JJL A;  2JEB I;  4OWX B;  3RLF A;  1Q12 A;  3A5Z B;  3EN2 A;  3GD7 A;  1K9M C;  2UUB Q;  2JA6 G;  4JI8 Q;  3PCO B;  3RLN A;  1HZB A;  4A3G G;  4DR3 L;  4JI4 Q;  4JI2 Q;  2D62 A;  1PVO A;  4EQ5 A;  4A3E H;  4PZ6 A;  1JB7 A;  3PUV A;  2AKW B;  4PZ8 A;  1I50 H;  4JI3 Q;  3GO5 A;  1BBU A;  1R9T H;  1OXS C;  2A8V A;  4GN5 A;  3K80 C;  1HJP A;  4GOP C;  2C35 B;  1HZA A;  2WFW A;  4LFC L;  3I55 A;  1XMQ L;  4A3M H;  1QZG A;  4LF4 L;  1UE1 A;  5FJ8 G;  1T9H A;  4JG2 A;  2MO0 A;  4DR3 Q;  3D31 A;  4EX5 A;  1VQ5 A;  2E2H H;  4MTN A;  4UP8 A;  1PHJ A;  2GVA A;  3HOX H;  1SE8 A;  4YCU A;  1JJ2 A;  2NZO A;  1PV4 A;  3PF4 A;  4QQB X;  4IOA A;  3I4M G;  5C3E H;  5IY0 A;  4DR6 L;  3M7N A;  1EQR A;  1X3F A;  3KF8 B;  4JV5 Q;  2XGT A;  1YZ6 A;  3FHW A;  1Z47 A;  3AQQ A;  1XMQ Q;  4LFC Q;  4LF4 Q;  3MXN B;  3RLO A;  4BXX G;  3S24 A;  1XMO L;  4DV5 Q;  3K7U C;  2WAQ E;  3T1Y L;  1E7Z A;  1SN8 A;  1HZ9 A;  1IBK L;  3DM3 A;  1HNX L;  1E24 A;  1OXT A;  2EQS A;  4Y7N H;  4HJA A;  4DR6 Q;  4RG1 A;  3KF6 B;  1OXU A;  1QZH A;  3SGI A;  1L0W A;  4A4I A;  4HJ5 A;  2Z0S A;  5LMU L;  2ZJP A;  3RN2 A;  4A3K G;  1IZ6 A;  2R6G A;  2ZM6 L;  4BY1 G;  4HJ7 A;  1B8A A;  2HT1 A;  3T1Y Q;  1B7Y B;  2HIX A;  2D0P A;  2AMC B;  3CC4 A;  2N78 A;  2LXJ A;  2YV5 A;  5DLQ E;  4DV6 L;  5IWA L;  2JEA I;  1P8L A;  2K52 A;  4JBJ A;  1WOC A;  1IBK Q;  1HNX Q;  4NPS A;  3S17 H;  1Y1V G;  4MNO A;  1N34 L;  4OWW B;  2JA8 H;  4DR2 L;  4GLA C;  4DAY B;  3HKS A;  3ZJY C;  2JJQ A;  4AIM A;  2ZM6 Q;  1S72 A;  5C4J H;  1QUQ A;  4IJL A;  4X64 L;  4LF6 L;  5BR8 Q;  1N32 Q;  1RL2 A;  4ALP A;  5IWA Q;  2Y0S G;  1JMC A;  4LFB L;  4YWM A;  4HIK A;  4ME3 A;  2VNU D;  3PO3 G;  4GLV B;  4DV2 L;  1N34 Q;  5C0X I;  4BY7 H;  3S2H H;  4DKA C;  4GOP B;  1SLJ A;  1YEZ A;  1XPU A;  4X6A H;  4LF6 Q;  2GN5 A;  4PZ7 A;  1VQK A;  1X6O A;  2K5V A;  3RZD H;  1S40 A;  3JC6 6;  1PH2 A;  3OYY A;  1K8G A;  1WCM H;  4XIG S;  2D0O A;  4L5Q A;  4C3H H;  2JA5 H;  3ER0 A;  1VQO A;  3HOU H;  2UXB L;  1Z9F A;  3KFU A;  4L5S A;  3CCJ A;  4B3S Q;  1GD7 A;  3A5U A;  4Y52 H;  3NBH B;  3CCL A;  3KYH C;  4DR4 L;  1A62 A;  1VQ8 A;  4NXN L;  2NN6 G;  5M3F H;  3U58 A;  2UXC L;  1YJ9 A;  1X55 A;  1YVC A;  3KF6 A;  3TS2 A;  5FLM H;  2QGQ A;  3K81 C;  1VQ4 A;  1XNQ Q;  1X56 A;  4DR4 Q;  3UDG A;  4A3I G;  2UU9 Q;  1E1O A;  4NXN Q;  2N49 A;  1LTL A;  1HZC A;  1KC8 C;  2R7D A;  2R7F A;  1N9W A;  4TVA B;  3NEM A;  3FKI H;  4JOI C;  2K75 A;  4BBS G;  4JV5 L;  3F1Z A;  1X3E A;  3M9B A;  4O2D A;  1VQL A;  2B63 G;  3PO2 H;  1NBW A;  1YHB A;  4A3L G;  4R4O A;  1X9N A;  3S16 H;  2F4V Q;  1CSP A;  4A76 A;  1EQQ A;  1PH7 A;  1VCI A;  3CC2 A;  2R7Z H;  4OO1 I;  3W1G A;  1Q8K A;  1SMX A;  1QVG A;  4YY3 L;  1VQA A;  2R93 G;  5K36 G;  3T1H L;  1XNR L;  4A3G H;  1BBW A;  4GOP A;  3CCU A;  5H1S E;  4GKK L;  2OCE A;  4X65 L;  5M5Y H;  3I7F A;  3K7A H;  3BZC A;  3KJO A;  2AHO B;  3DLL A;  5IYB G;  2VQE L;  5EAY A;  2UUC Q;  1IBL L;  1UE6 A;  1KIX A;  1QVC A;  2I5L X;  1Q81 C;  1YI2 A;  1PH3 A;  4YY3 Q;  3CAM A;  4YHH Q;  3T1H Q;  2Q2U A;  1XNR Q;  2N8N A;  4X66 L;  4DV1 L;  4L5T A;  4DV4 Q;  3EBE A;  4DR1 L;  5JEA J;  4DV7 L;  4UY8 C;  3I4N G;  1FVI A;  3S1Q H;  1NMG A;  1KQS A;  4GKK Q;  4C3I H;  4DNI A;  3TQY A;  1PYB A;  1IL2 A;  3I4M H;  4A93 H;  1HH2 P;  5GAE C;  2VQE Q;  4AQY Q;  1IBL Q;  2LSS A;  1C0A A;  4J15 A;  1HNW Q;  2I5M X;  3BU2 A;  5GRO A;  4X66 Q;  4K0K Q;  1WFQ A;  4DR1 Q;  4DR7 Q;  1I3Q H;  1OXX K;  4DV7 Q;  5M5W H;  2KCT A;  2IX0 A;  4R4I A;  2DGY A;  3GTM H;  2EXD A;  3KOJ A;  4IFD G;  2RHS B;  1K83 H;  4B3R L;  5IYD H;  4YCW A;  4DK3 C;  3ERS X;  3G71 A;  1PH8 A;  4A3D H;  1SFO H;  5IP7 G;  2KBN A;  2BH8 A;  2N3S A;  2K5N A;  2MQH A;  3CPF A;  5HGQ A;  1CKN B;  1KHI A;  3KDF B;  4GNX B;  4AYB E;  4A3K H;  2IX1 A;  1TWF H;  1VQB A;  1N36 L;  4JI6 L;  4JI1 L;  2ID0 A;  5C44 H;  2WB1 E;  2H5X A;  1VQ7 A;  3CCR A;  2OWO A;  3AFQ A;  4B3R Q;  1TWG H;  1Y1V H;  3HKZ E;  4JI0 L;  2PNH A;  5C0X J;  3GDE A;  1TWA H;  4DPG A;  3S1M H;  2OTJ A;  3EIV A;  5J3B A;  1K0R A;  1KL9 A;  1G51 A;  1KRT A;  4A3C G;  1UWV A;  4JI6 Q;  2IY5 B;  2CFM A;  3S15 H;  1Q1E A;  1AE3 A;  3I56 A;  1SR3 A;  5FLX c;  2KHJ A;  4A3J G;  1K73 C;  2NVX H;  2R92 G;  2OQK A;  2ALY B;  3W1B A;  1OTC A;  1TWH H;  2MNA A;  1XMO Q;  3RR5 A;  3UDI A;  4JI0 Q;  1EIF A;  3ULJ A;  4GLX A;  1X65 A;  2V1C C;  3AFP A;  4YWL A;  2QA4 A;  1S3O A;  3HOV H;  4PG3 A;  4QIW E;  4P74 A;  2FXQ A;  3H0G H;  1PA6 A;  2HHH L;  1CUK A;  1B70 B;  3STB C;  5LMN W;  5GAD C;  3BJU A;  5LMU Q;  1E3P A;  5JEA G;  4B3T L;  2CWA A;  3M3Y H;  2ES2 A;  4XTC S;  5ELN A;  4A3M G;  3GTG H;  4A3B G;  1CKM A;  2PMZ E;  4DV6 Q;  4LF7 L;  2MO1 A;  1VQJ A;  3MEF A;  5LMN L;  4BBR H;  1PH5 A;  2A19 A;  3PUY A;  3Q8D A;  4OXP A;  3U4V A;  2ZJR A;  4LFA L;  1Q46 A;  5C3E G;  1L1O B;  1C9O A;  4P71 A;  4DR2 Q;  4LF5 L;  3CQZ H;  3M85 A;  4B3T Q;  3G4S A;  1ASY A;  4JBK A;  3CW2 C;  4X64 Q;  1YJW A;  4JOI A;  5C4X G;  1MKH A;  3IRB A;  5IYC G;  4LFB Q;  4A3I H;  2NVT H;  3TEH B;  1VQH A;  2E2I H;  4X62 L;  1I5F A;  4DV2 Q;  2HQL A;  3JAM c;  1IBM L;  4R4T A;  1G29 1;  1YNX A;  4L5R C;  4LF5 Q;  3PUX A;  1A8V A;  5GQO A;  4LF8 L;  2MFI A;  4R4Q A;  3I2Z A;  1X3G A;  2IHF A;  1N8R C;  3FP9 A;  5GAH C;  1YJN A;  2F3I A;  3ULP A;  2B63 H;  1HNZ L;  3LGJ A;  1NE3 A;  4OX9 L;  1HNW L;  4A3L H;  3F8T A;  1PH1 A;  5C0X G;  1CSQ A;  2QEX A;  1E22 A;  1GM5 A;  1E1T A;  4APV A;  3ULL A;  2UXB Q;  5JJK A;  2E5L L;  1NJI C;  3TRZ A;  2R93 H;  1TWC H;  2IHE A;  4LF8 Q;  1VQM A;  2BH2 A;  4A3F G;  4IJH A;  1YHQ A;  1V1Q A;  4UP7 A;  5M3M G;  3H3V I;  2IT1 A;  2OQ0 A;  4MZ9 A;  1HNZ Q;  4OX9 Q;  3NEN A;  4POG A;  3CD6 A;  2UXC Q;  3TS0 A;  1OXV A;  1O7I A;  2VL6 A;  3J80 c;  4GNX C;  3HOZ G;  3J7Z C;  1Y1W H;  1DGS A;  3S2D H;  4AYB G;  5IYB H;  1Q82 C;  4P72 A;  1I94 L;  1EYG A;  2E5L Q;  4DV0 L;  1G6P A;  1KD1 C;  1VQ9 A;  4JI5 L;  1WJJ A;  3HOY G;  1EFW A;  3NEL A;  2A1A A;  2UUA L;  1W3S A;  2NVY H;  3AYH B;  2AWN A;  4OWT B;  4KI0 A;  1JT8 A;  4HID A;  2BA0 A;  4B3M L;  2WAQ G;  2JA6 H;  2VQF L;  4DV3 L;  4KHP L;  4GKJ L;  3CCE A;  2VZA A;  3F2D A;  1I94 Q;  1V9P A;  4DV0 Q;  2XTI A;  3HFZ B;  5M5X H;  3H3V H;  2UUA Q;  3CP0 A;  4IOC A;  1JE5 A;  2LXK A;  4QJF A;  4LNQ A;  4P73 A;  4B3M Q;  1J6Q A;  3CPW A;  1Q1B A;  1XJV A;  1V43 A;  1PH4 A;  1HR0 W;  2JE6 I;  4AH6 A;  4DV3 Q;  1M1K C;  4KHP Q;  5FJ8 H;  5M3F G;  1J5E L;  4GKJ Q;  1WI5 A;  3E0E A;  4JCV E;  4QGU A;  4X65 Q;  4R1J A;  1W2B A;  3K0X A;  5IP9 G;  3U4Z A;  1FGU A;  2Y0S E;  4OO1 G;  1UE7 A;  1HR0 L;  1RIP A;  4UP9 A;  3OW2 A;  4P75 A;  1A0I A;  1N33 L;  3G6E A;  1EOV A;  5GAG C;  4JBM A;  2RCN A;  2ZTE A;  3CF5 A;  1EWI A;  1J5E Q;  2UUB L;  4DV1 Q;  1QVF A;  1AE2 A;  2JA7 G;  4JI8 L;  2PI2 A;  2Z6K C;  3J81 c;  3VDY A;  4BXX H;  1EUJ A;  4LUO A;  1P16 A;  4IPD A;  2YTX A;  4H02 A;  5E7N A;  4JI4 L;  1FJG L;  2VUM G;  1L1O C;  2VS1 A;  4JI7 L;  4A3C H;  2L15 A;  3AEV A;  4JI3 L;  4A3J H;  1N33 Q;  4YCV A;  2R7Z G;  4OON A;  4BY1 H;  4YWK A;  1VQC A;  2R92 H;  1MJC A;  4JYA L;  1UEB A;  2K50 A;  3J81 i;  2EIF A;  3PUZ A;  3UE1 A;  2YU9 H;  3KLW A;  1FJG Q;  3HOW G;  1A63 A;  4JI7 Q;  3GTO H;  1QUQ B;  4NXM L;  1M90 C;  3CCM A;  2ATW A;  3CCS A;  3PIP A;  4R4C A;  4LUV A;  1Q7Y C;  1LUZ A; 
#chains in the Genus database with same CATH topology
 4N9P A;  1NMF A;  2ASB A;  2QDB A;  3QIA A;  4JYA Q;  1ASZ A;  2UXD L;  3IKJ A;  3S14 H;  3NTH A;  2D5D A;  5IT9 c;  1PYS B;  2K32 A;  3H15 A;  4A3E G;  4DR5 L;  4OEL B;  1RTN A;  2PW5 A;  3HEJ A;  4TKO B;  1KNE A;  1H9M A;  2M00 A;  1LLR D;  1IL8 A;  3K5M A;  2K6A A;  1QE6 A;  1SSO A;  1GOZ A;  5IYD G;  1Y8O B;  2GA4 B;  3VYR A;  1SRU A;  3GQB A;  4FXK C;  2X6G A;  4A75 A;  3L9A X;  4WJW A;  3HG9 A;  4POF A;  1IW7 C;  4C1N I;  5FLX L;  1N32 L;  5C0X H;  4DUY Q;  1V8Q A;  3F2B A;  3OWE B;  4BA2 I;  4LF7 Q;  4QUC A;  2NUC A;  3C46 A;  4Q5V A;  2R61 A;  4C3J H;  5M5Y B;  3V96 A;  1JC7 A;  3K7A B;  4X3U A;  3E9I A;  3P75 A;  1ESR A;  2NN6 I;  4C2M H;  2F3V A;  1VQ6 A;  3QOJ A;  1EY8 A;  5JVG 3;  1X3Q A;  3P1H A;  3HOV G;  2KHI A;  1BCP F;  4KKT A;  4IAL A;  4C3I B;  5BN5 A;  2LMC B;  4IPG A;  3I4M B;  2NZH A;  4Z9C B;  3BYT B;  1GUO A;  1Y69 U;  1GHK A;  4H7B A;  1G2S A;  1I3Q B;  2JXM B;  1XNQ L;  5KNC A;  2F0K A;  2PZU A;  1CKO A;  4BBR G;  1BCP C;  5KYL A;  1MJE A;  3Q6S A;  1D1I A;  4A3D B;  2EJG C;  4IFD J;  5IP9 H;  1IYJ B;  3ERO A;  3GTP H;  4XQN A;  3BS1 A;  2RBM A;  3TDQ A;  3UE0 A;  5IGC A;  2PI2 E;  1W6J A;  3T53 B;  1TU2 B;  2WV6 D;  1T5E A;  4NDX A;  2F03 A;  2XVS A;  1PRT C;  3L2P A;  4RA8 A;  3X3N A;  2ZJQ A;  3J80 L;  1LM0 A;  1SRO A;  1FYC A;  4K8J A;  5IP7 H;  4RWS C;  4LF9 Q;  2NVX B;  2CQO A;  1LT5 D;  2CCZ A;  3ICE A;  2UUC L;  5M9O A;  3GTL H;  2B2V C;  2HCC A;  4XQQ A;  2E8G A;  4QY7 A;  1KXL A;  2I07 B;  5ISR A;  1CQF A;  1VQG A;  1NY4 A;  2ZTC A;  3MFY A;  1Y1W G;  1HHV A;  4LWC A;  5ELB A;  4AQY L;  1S5D D;  3L7Z C;  1VQP A;  5JJL A;  2XRS D;  3MA2 B;  1Q12 A;  4LMQ D;  3UI2 A;  1HZB A;  2NBF A;  4EQ5 A;  4PZ6 A;  1JB7 A;  3VR2 A;  1I50 H;  1R9T H;  1OXS C;  2A8V A;  3I90 A;  2JA5 B;  2WAC A;  1V1P B;  3K80 C;  4GOP C;  2C35 B;  1HZA A;  4LFC L;  4A3M H;  1QZG A;  1T9H A;  4DR3 Q;  1DOM A;  2Z4I A;  1B2T A;  4ZRZ A;  1WTH A;  5EBC A;  3I8Z A;  3HOX H;  4YCU A;  2PZT A;  5C3E H;  1E2V A;  5IY0 A;  2QKI C;  1EQR A;  2RSO A;  4JV5 Q;  1O80 A;  5IGB A;  1YZ6 A;  1Z47 A;  5COY A;  5IGD A;  3RLO A;  3S24 A;  2I46 A;  1PFB A;  2JN4 A;  5CYU A;  1SN8 A;  2A6E C;  2XWJ B;  1OXU A;  5LL6 S;  3WOE A;  1TY0 A;  5DM7 3;  3S2D B;  4XT1 B;  5LMU L;  3PO2 B;  1IZ6 A;  2HT1 A;  3HZX A;  4BY1 G;  1B7Y B;  3A8I E;  1IKL A;  3MWY W;  1Y8N B;  4L6T B;  1WOC A;  1JOO A;  1O7Y A;  3T13 A;  2EYO A;  2JA8 H;  5CBE E;  5G3L D;  1HFG A;  5D3I B;  4J1M A;  2ZM6 Q;  5C4J H;  1WTW A;  4HR7 B;  5M5X B;  1WTV A;  4MTK A;  1DCZ A;  1JQY D;  2BCO A;  2WKD A;  4LAA A;  4ME3 A;  3NQI A;  4H44 C;  4KJO A;  4DV2 L;  4BY7 H;  5C0X I;  1SLJ A;  4FYD A;  1XPU A;  4X6A H;  3K5N A;  4LF6 Q;  1MSG A;  3RZD H;  4K6D A;  3IFD A;  2F0W A;  3JC6 6;  1PH2 A;  3TZU A;  5A35 A;  3OYY A;  1J8I A;  1WCM H;  4L5Q A;  1VQO A;  5KYI A;  1K0S A;  4L5S A;  5FOB B;  4B3S Q;  3NBH B;  3KLR A;  1VQ8 A;  1LT4 D;  3DEO A;  1YJ9 A;  1KLU D;  1RF2 D;  2E75 C;  3EJI A;  4KKU A;  4RKL A;  2DNC A;  1QNK A;  4A3K B;  1LTB D;  2L5T A;  4CDE C;  4HAE A;  1STG A;  5C5M A;  2L1B A;  1A2T A;  5CV7 A;  4NXN Q;  1TWG B;  3E0J A;  3FKI H;  4PQX A;  3S1M B;  3OW7 A;  2E2D C;  1VQL A;  4A3L G;  1KAB A;  1X9N A;  3S16 H;  3KLS X;  2TSS A;  2Y0S B;  3CC2 A;  4GZY C;  3W1G A;  5K36 G;  1TWH B;  1QVG A;  4A3G H;  2AUK A;  4GKK L;  2OCE A;  3CU7 A;  2AHO B;  3KBG A;  5IYB G;  3DWQ A;  1UE6 A;  1KIX A;  4P2C B;  3M3Y B;  5D14 A;  1EWC A;  1WVL A;  3GTG B;  4L5T A;  4DV7 L;  3S1Q H;  1NMG A;  2B2U A;  3NBH A;  1BF4 A;  3KLS A;  5G3L F;  1IL2 A;  4A93 H;  4FF4 A;  1HH2 P;  1KDA A;  1AZQ A;  1IBL Q;  3U9O A;  4J15 A;  2NTT A;  4X66 Q;  1WFQ A;  4DR7 Q;  1RHP A;  4HED A;  2IX0 A;  4R4I A;  3NP8 A;  2H4O A;  2EXD A;  4B3R L;  2RHS B;  1ZYR C;  4C3J B;  3ERS X;  1I4H A;  1PH8 A;  2BH8 A;  2K5N A;  1JOR A;  1JWM D;  1KHI A;  1JE4 A;  4C2M B;  1TWF H;  1VQB A;  3BG3 A;  3O13 A;  2H5X A;  1VQ7 A;  3CCR A;  2OWO A;  2MJ8 A;  4K5W A;  2EY1 A;  1I4R A;  3HKZ E;  2R93 B;  2PNH A;  3GDE A;  2EYF A;  3EIV A;  3T56 B;  4HCS A;  2CFM A;  2K03 A;  3EA6 A;  1AE3 A;  5ELD A;  4A3J G;  5FLX c;  1VMP A;  5J39 A;  1O7Z A;  2XIW A;  1XTC D;  2ALY B;  2MNA A;  4JI0 Q;  1EIF A;  2QA4 A;  2IX3 A;  4PG3 A;  2IW3 A;  3H0G H;  3GTP B;  4YIJ A;  1TKW B;  3D4D A;  1E3P A;  2KHS A;  1SNP A;  1DZ1 A;  4A3B G;  2PMZ E;  3C1F A;  4DV6 Q;  1HRJ A;  1CHP D;  4LF7 L;  1VQJ A;  2A19 A;  2ZJR A;  1KNA A;  5FO8 B;  1HPC A;  4NW2 A;  3U9S A;  4E6I A;  1L1O B;  1FNV A;  3G4S A;  1U4L A;  3CW2 C;  3A7L A;  4KHV A;  3GV3 A;  4X64 Q;  4I65 A;  1B3Q A;  2PYK A;  3GTL B;  1SYB A;  4LFB Q;  5BN3 A;  4A3I H;  4FNF A;  3NXW A;  2E2I H;  1SE2 A;  4PNY A;  1G29 1;  4R4T A;  3FEW X;  4LF5 Q;  3I2Z A;  1SXT A;  3E3X A;  1NE3 A;  1HFN A;  5DM6 3;  1GM5 A;  4KK7 A;  4APV A;  3ULL A;  1EY9 A;  2SDF A;  1NJI C;  1BQQ T;  2SNS A;  2R92 B;  1TWC H;  3VR3 A;  2IHE A;  2Z8L A;  3K57 A;  4MZ9 A;  1HNZ Q;  3TP7 A;  5A2Q E;  1G6Z A;  5C4H A;  4DA2 A;  3J80 c;  1I50 B;  3QWN A;  4GNX C;  3HOZ G;  3J7Z C;  2VXW A;  1R9T B;  4F8M A;  4AYB G;  3VR4 A;  4P72 A;  4DV0 L;  1KD1 C;  1VQ9 A;  3HOY G;  4A3M B;  3R3O A;  2UUA L;  2NVY H;  3AYH B;  4OWT B;  1JT8 A;  3QO2 A;  4HID A;  2BA0 A;  3D4W A;  3HOX B;  1NSN S;  1MBY A;  1STN A;  1KTK A;  5C3E B;  2EXZ A;  1HTL D;  5IOC A;  1FGB D;  1D2B A;  1DXM A;  3CP0 A;  3G7L A;  1JE5 A;  4QJF A;  1SMY D;  3CPW A;  2MHV A;  4AH6 A;  1BDO A;  2F0O A;  4DV3 Q;  1M1K C;  4KHP Q;  5FJ8 H;  2NZ1 D;  4RAU C;  4CKE A;  1CHQ D;  2AQ1 B;  1ONL A;  1E2W A;  2K01 A;  2OF1 A;  4R1J A;  3K0X A;  2Y0S E;  4UP9 A;  3SE0 A;  3DXJ C;  5CGK A;  3G6E A;  2B2Y C;  2RCN A;  1BBX C;  1QVF A;  3H3V I;  4DV1 Q;  5E7N A;  1RDP D;  3MHB A;  2L15 A;  1ET9 A;  1F9Q A;  1LTS D;  1G2T A;  1CM9 A;  2MP1 A;  2BE5 C;  4CJ1 B;  3A7A B;  4CJ0 B;  2D2C C;  1MJC A;  4PMB A;  5IIF A;  1CI3 M;  2F0T A;  2Z9H A;  5T1I A;  2WAQ B;  1IYV A;  3RZD B;  1NAP A;  3PIP A;  2XWB B;  3RMH A;  1KAA A;  5JEA H;  1Q7Y C;  4JV5 L;  3SR1 A;  1N36 Q;  1Y14 B;  3J81 L;  1WD0 A;  2VY3 A;  1II3 A;  4JVZ A;  3MXP A;  2ENB A;  1FNU A;  4NXM Q;  4C3I G;  3I70 A;  1PRT B;  3I3C A;  1YIT A;  5BN4 A;  2JSO A;  3BDO A;  4HJ8 A;  4CDD C;  3S1N B;  3OTO Q;  5C4X H;  5IT9 E;  5IYC H;  1PH9 A;  1TXY A;  1J9O A;  4GS3 A;  1WTP A;  3T16 A;  1B4O A;  2JA7 B;  4A3D G;  2RDG A;  1NR4 A;  2Z6B A;  2HHH Q;  3I91 A;  4J6H A;  1GO3 E;  4KD4 A;  4JC0 A;  4N9T A;  4DXF A;  1IKM A;  2JK8 A;  1I4Q A;  1CKN A;  1EU3 A;  1SE3 A;  1F2Z A;  1FL0 A;  4RHS A;  2I5H A;  4A3F H;  4A3G B;  4KV6 A;  5LMN Q;  3G6J B;  2DJF C;  4LFA Q;  3PIO A;  4FO2 A;  3LNN A;  4XYQ A;  3GTK B;  3K8A A;  5I9P A;  2DUD A;  2O2L D;  2YTY A;  3PQI A;  4IUP A;  2F0G A;  2KCM A;  1VQI A;  1STA A;  3BZK A;  3L0O A;  2DNE A;  4B3S L;  3GV6 A;  1C48 A;  1D8L A;  3RNU A;  4A93 B;  4N8F A;  5IE8 A;  3PV0 A;  5CV6 A;  1SYD A;  1EY5 A;  3A0J A;  3BYY B;  2TMP A;  5JJI A;  5CR3 A;  3JAM L;  2N55 A;  1WYD A;  2FMC A;  2F3W A;  3I4N H;  2CW0 C;  3HKZ G;  5L37 A;  3E9H A;  1TWF B;  1XTD A;  1X32 A;  2JA5 G;  3CME A;  3ND9 A;  5ELO A;  4JBW A;  4JI5 Q;  4LW1 A;  1KAW A;  1TS5 A;  4DUZ L;  1D6E C;  3TP6 A;  4DU9 A;  2F52 A;  4KHZ A;  1K28 A;  4Y7N B;  5IGE A;  3VA7 A;  1BKB A;  1JJG A;  2F0P A;  3TRE A;  4ZUI A;  2F0I A;  4HIO A;  5AJ3 L;  1VQE A;  2XSC A;  3PF5 A;  1I4P A;  3HOW H;  4RKB A;  1XXG A;  4RMF A;  4IUU A;  1JJC B;  3UDF A;  3H0G B;  2KEN A;  1EQT A;  1GJX A;  2HIV A;  2QCP X;  1PH6 A;  3HGB A;  1U9R A;  4O1N A;  3PO2 G;  1PFS A;  2Q8R E;  1HR0 Q;  4WFN 3;  3VYU A;  1CA6 A;  2WII B;  1C7Y A;  4DR7 L;  4OWX B;  3RLF A;  2UUB Q;  2WB1 B;  3K5O A;  3PCO B;  5JOB A;  4JI2 Q;  2D62 A;  4A3E H;  1ENA A;  2P5Z X;  3Q24 A;  4NMZ A;  4X3T A;  2ZT9 C;  3NTK A;  2EDG A;  4ZAI A;  5HGT A;  2HQE A;  4C3H B;  4ZKB B;  4A3I B;  3HOU B;  2QF7 A;  3I55 A;  1XMQ L;  2MO0 A;  3VYT A;  4EX5 A;  3NQT A;  4UP8 A;  1V1O A;  1STY A;  2GVA A;  1PHJ A;  1JWS D;  1EY4 A;  1WTX A;  1DOK A;  1JJ2 A;  4ABN A;  1SNM A;  3LX0 A;  1NR2 A;  1TS3 A;  3TP5 A;  3LWE A;  3FHW A;  1EIG A;  3I4L A;  3R93 A;  4LF4 Q;  4DV5 Q;  2WAQ E;  3T1Y L;  1KLG D;  2F0E A;  1IBK L;  5E1F A;  3DM3 A;  1E24 A;  1OXT A;  4DR6 Q;  4HJA A;  3KF6 B;  3SGI A;  4A4I A;  4HJ5 A;  1A3T A;  2ZJP A;  4A3K G;  1O78 A;  4HJ7 A;  1CQV A;  1HQM C;  1MHW C;  2D0P A;  1LV9 A;  2NYZ D;  2NVY B;  2SEB D;  2N78 A;  2WKC A;  2YV5 A;  4DV6 L;  4F87 A;  1HNX Q;  5EQ0 A;  5E4W C;  3S17 H;  1Y1V G;  1N34 L;  2M2L A;  2PO4 A;  1PTO D;  4DAY B;  4U68 A;  1QUQ A;  4X64 L;  5BR8 Q;  1SJE D;  3J7A F;  5IWA Q;  2Y0S G;  1JMC A;  4LFB L;  4YWM A;  2BOS A;  4UDU C;  4GLV B;  1YEZ A;  4KN7 C;  4O42 A;  4PZ7 A;  2K5V A;  5D3D A;  4XIG S;  2D0O A;  3ER0 A;  3N52 A;  3FPP A;  4EQP A;  1Z9F A;  3KFU A;  3MZ5 A;  1K8O A;  5ELF A;  3C3L A;  3EVQ A;  3OHX C;  2A68 C;  1JCK B;  5M3F H;  1X55 A;  3NTI A;  1YVC A;  3KF6 A;  2PPB C;  2A73 B;  1ILQ A;  3GP7 A;  2QW7 A;  3K81 C;  2OXP A;  1X56 A;  4DR4 Q;  1E1O A;  1LTL A;  1KC8 C;  5CMD A;  2R7D A;  4C3J G;  1N9W A;  3C1E A;  4JOI C;  1EYA A;  2K75 A;  2B63 G;  1HQR D;  1CA5 A;  2F4V Q;  3DHQ A;  3NPP A;  1PH7 A;  4OO1 I;  2R7Z H;  1H9J A;  5KRU A;  3PO3 B;  2R93 G;  4YY3 L;  3T1H L;  1AEX A;  2RSN A;  4FF3 A;  1EZ6 A;  3I7F A;  3BZC A;  1ICF B;  2VQE L;  5EAY A;  3RUZ A;  1S5F D;  1QVC A;  2A74 C;  1YI2 A;  1PH3 A;  3CAM A;  1CZG A;  4YHH Q;  1XNR Q;  2N8N A;  4DV1 L;  1LO5 D;  4DR1 L;  2SOB A;  1ZEQ X;  4J8Q A;  5I4D A;  1B53 A;  1KQS A;  2MUY A;  4DNI A;  1PYB A;  4IUQ A;  2IJ0 A;  3CRL C;  1PTO F;  3CQZ B;  5DAU A;  3H3V C;  4OIJ A;  1HNW Q;  3BU2 A;  3NSW A;  5M5W H;  4A3F B;  2L12 A;  5IGF A;  3GTM H;  4IFD G;  3G71 A;  1SFO H;  5IP7 G;  2KBN A;  2A5H A;  1PMR A;  2K28 A;  5I2Y A;  3KDF B;  4GNX B;  4AYB E;  3MFG A;  1DYQ A;  1N36 L;  4JI6 L;  1YNN D;  3IAY A;  1HTP A;  2ID0 A;  5C44 H;  2WB1 E;  4HSV A;  3BVZ A;  2RKS A;  3AFQ A;  3WOF A;  4DPG A;  4L8J A;  1MI2 A;  1GUT A;  1ENF A;  4A3C G;  5I6W A;  5I9O A;  1UWV A;  2IY5 B;  3S15 H;  3SXH A;  1JB3 A;  2KUM A;  1Q1E A;  3S9W A;  4DXG A;  3E6Z X;  1XMO Q;  2R92 G;  3RR5 A;  2Z4H A;  4GLX A;  1NCV A;  1S3O A;  1VF7 A;  5FLX E;  3I4N B;  4P74 A;  2FXQ A;  3R2T A;  2HHH L;  3BJU A;  4X3K A;  4B3T L;  4XTC S;  4A3M G;  1B9M A;  4FF2 A;  3MEF A;  5LMN L;  1PH5 A;  4OXP A;  1V1P A;  3PUY A;  4LJZ C;  3U4V A;  4LFA L;  3H6M A;  5C3E G;  1C9O A;  4JW0 A;  2B8F A;  4DR2 Q;  4JBK A;  2FIN B;  1LT3 D;  1EFI D;  3IRB A;  5CV4 A;  2EYJ A;  4C1N K;  2HQL A;  3JAM c;  1LAC A;  1YNX A;  3PUX A;  2MFI A;  2IHF A;  5JVH 3;  1YJN A;  2F3I A;  2EY5 A;  3TP8 A;  4OX9 L;  4A3L H;  3DEP A;  1T5X D;  4EGV A;  3W3A A;  5JPM C;  5JJK A;  2E5L L;  3TRZ A;  5K36 H;  1CTM A;  4LF8 Q;  4IJH A;  1V1Q A;  5EPK A;  5M3M G;  2YU9 B;  2IT1 A;  2OQ0 A;  2UXC Q;  2AUJ D;  1QNU A;  3TS0 A;  1EY0 A;  1TS2 A;  5IYB H;  1Q82 C;  2ICI A;  1EYG A;  1XYI A;  1G6P A;  4JI5 L;  3OMC A;  1EFW A;  3J80 E;  2A1A A;  4K2L A;  1TQO A;  2AWN A;  3L3O C;  2B2Y A;  4B3M L;  1ML0 D;  3S14 B;  5LL6 X;  2WAQ G;  2JA6 H;  1EY7 A;  2KOL A;  3F2D A;  3A54 A;  2L4N A;  5A2Q L;  1I94 Q;  1VF5 C;  1V9P A;  1QG7 A;  2XTI A;  3M7G A;  2XN9 C;  4UAI A;  3H3V H;  1HUM A;  4IOC A;  1SYC A;  2J7Z A;  1QB5 D;  3OMG A;  4P73 A;  3URY A;  1XJV A;  1V43 A;  1XX8 A;  1ILP A;  4NKL A;  4GKJ Q;  3D4R A;  1J5E L;  2FJ2 A;  4G7O C;  1WI5 A;  3D8G A;  4X65 Q;  4KY5 A;  1UE7 A;  1HR0 L;  5FK9 C;  3CHB D;  3ITP A;  4CKB A;  4TSS A;  1N33 L;  1EOV A;  2A69 D;  1A6X A;  5GAG C;  2ZTE A;  1HA5 A;  2UUB L;  4BXX H;  1AH9 A;  2JA7 G;  3S17 B;  4DNT B;  4LUO A;  3HRZ C;  4IPD A;  3DWA A;  1FJG L;  2VUM G;  4JI7 L;  1I4G A;  1SJH D;  1G8Z D;  4KJN A;  1EQV A;  4A3J H;  5DNF A;  2O4X A;  2DJG C;  1VQC A;  4IUV A;  4JYA L;  3PUZ A;  4K2K A;  3GTO H;  1QOH A;  3CCM A;  2ATW A;  1JR0 D;  1LUZ A;  1LTI D;  4XDX A;  3CCV A;  1VQF A;  4JI1 Q;  1PDQ A;  4A3B H;  1AFP A;  3KBX A;  4DV5 L;  2RDH A;  4IQZ A;  4WJ4 A;  4HN7 A;  1MIU A;  2K33 A;  1SE4 A;  2DN8 A;  2MGS A;  3M4P A;  3MEH A;  4ID6 A;  2RQX A;  5M3F B;  2PZW A;  4A93 G;  3MC0 B;  2RF4 A;  1GVP A;  1CT1 D;  2UXD Q;  2B29 A;  4G4K A;  4DUY L;  2NVQ H;  2RVL A;  2B3G A;  4HJ9 A;  4NB3 A;  1RCV D;  4DR5 Q;  4KLK A;  1BNZ A;  4MN3 A;  5BR8 L;  3RZO H;  4H0L C;  1M8A A;  1U4M A;  2R7Z B;  1GKH A;  2K5D A;  4QB4 A;  2RHQ B;  2QDL A;  5E3F A;  1IYU A;  3S1R H;  3HOZ H;  1RTO A;  2C5C A;  2YYZ A;  4UPA A;  5ELC A;  4BBS H;  2PQE A;  1BO0 A;  3PSI A;  3TBI B;  4IN3 A;  2KA7 A;  4DAM A;  3HOY H;  4UHV A;  4K14 A;  3ZYY X;  3GTJ H;  3H0G G;  1IBM Q;  4GN4 B;  3AMU A;  2SNM A;  3KJP A;  4ZQ3 A;  2B2T A;  1UEA B;  3VA5 A;  2Q8T A;  4TQU S;  3P7J A;  3D0F A;  5M5W B;  3J81 j;  1IXR A;  2K5H A;  2K4K A;  1H9S B;  1B9N A;  3GTM B;  2WB1 G;  4BA1 I;  2L9H A;  4R8I A;  3STB D;  1SFO B;  2Q2T A;  4MIU A;  1LAB A;  1UE5 A;  2Z6K A;  3J80 i;  3K59 A;  4X3S A;  1HCZ A;  4IO9 A;  2F4V L;  1L1O A;  5C44 B;  4ME5 A;  4C3H G;  3CCQ A;  1FR3 A;  4LF9 L;  2NWG A;  3CC7 A;  3HOU G;  2OTL A;  2WIN B;  1H95 A;  4DN4 M;  5HY6 A;  4CDC C;  4XXE A;  5KIX A;  4PMW A;  3RN5 A;  3M4O H;  3S15 B;  3QR8 A;  1A3U A;  1I6H H;  2EY2 A;  4G7H C;  1Z6H A;  1LTA D;  1IHZ A;  1LT6 D;  5FLM G;  1EIY B;  1BVS A;  1GHJ A;  3H94 A;  3M4Q A;  4YHH L;  3NBI A;  5LHY 1;  3F2C A;  2EJF C;  2Q2H A;  4IPC A;  2K14 A;  2KJX A;  1S5E D;  2BA1 A;  2JA8 B;  5IOD A;  3J7A 5;  1VS0 A;  4KD3 A;  3R2I A;  1EWH A;  2ZTD A;  4QF4 A;  5C4J B;  1EY6 A;  3SK4 A;  2RA4 A;  4RCN A;  1XWE A;  3A5Z B;  1K9M C;  1ZKO A;  4BY7 B;  1PZI D;  4DR3 L;  1BCP B;  4JI4 Q;  3SEB A;  4HTH A;  1YNJ D;  3PUV A;  2O5I C;  4PZ8 A;  3HP3 A;  4JI3 Q;  1TR5 A;  1BBU A;  4B9X A;  1WCM B;  2KCC A;  5NUC A;  1HJP A;  1PFM A;  3ONA B;  1H9R A;  2WFW A;  4TRD A;  5FJ8 G;  1RD9 D;  4I7Z C;  1VQ5 A;  5CBA E;  2J0T D;  3K58 A;  3M4Y A;  3PF4 A;  4IOA A;  3I4M G;  3VYS A;  4QIW B;  3KF8 B;  4I7A A;  2XGT A;  3AQQ A;  4LFC Q;  2B2U C;  1XMO L;  3K7U C;  2EZV A;  5EKK A;  4KY7 A;  2EQS A;  2ZXR A;  2B2W C;  3FKI B;  2Z0S A;  1A3V A;  2R6G A;  3R8B A;  2ZM6 L;  3S16 B;  2HIX A;  2EOT A;  2AMC B;  2LXJ A;  5DLQ E;  1G91 A;  2JEA I;  1ENC A;  1P8L A;  2K52 A;  3ERQ A;  2JA6 B;  4NPS A;  1ESF A;  4OWW B;  4N8X 1;  1H9K A;  1UAP A;  4DR2 L;  3BZD B;  4GLA C;  4B9W A;  3HKS A;  1S72 A;  2JJQ A;  4LF6 L;  3T51 B;  3F2U A;  4IJL A;  4QCL A;  3TME A;  1RL2 A;  4ALP A;  1DJR D;  3BDC A;  3P20 A;  4HIK A;  4CKC A;  5J1Z A;  3PO3 G;  2A6H D;  2VNU D;  1SMY C;  4DKA C;  4GOP B;  2HUG A;  3SHL A;  3S1Q B;  1NNX A;  1FNW A;  1K8M A;  2JA5 H;  4NP5 A;  3Q0A A;  3X3M A;  3J7A V;  3CCJ A;  4Y52 H;  1TII D;  3QB3 A;  5FO7 B;  2HD3 A;  4NXN L;  2NN6 G;  4RGT A;  2B2V A;  4RH6 A;  3U58 A;  1AZP A;  2UXC L;  4OHJ A;  1HUN A;  1F9S A;  3TS2 A;  2QGQ A;  5HUR A;  1SNQ A;  2QEJ C;  1VQ4 A;  4OO1 H;  3UDG A;  1ZXT A;  1PZK D;  2UU9 Q;  3GTO B;  4TVA B;  3NEM A;  2FMM A;  1IW7 D;  1NUC A;  3PO2 H;  4WOR A;  4R4O A;  2QIL A;  4A3B B;  1CSP A;  3SDZ A;  1EQQ A;  1VCI A;  1D5X C;  5CC4 A;  3QJY A;  1SMX A;  3RD4 A;  2PNR C;  1BBW A;  1TVX A;  4IUT A;  2KVM A;  4GOP A;  5H1S E;  1C8C A;  1SYF A;  4X65 L;  3AU7 A;  4LK1 C;  3MAQ A;  2F0F A;  4DNR B;  4ZCK A;  1IBL L;  2I5L X;  3Q22 A;  2Q2U A;  1DD2 A;  4B08 A;  4X66 L;  4DV4 Q;  4UY8 C;  3I4N G;  4GKK Q;  1LTT D;  4EQO A;  1ROD A;  2JYO A;  2X69 A;  2IWH A;  3TQY A;  4DGZ A;  2X6L A;  3A55 A;  1C0A A;  2I5M X;  1BCP D;  4K0K Q;  1OXX K;  4HSP A;  4DV7 Q;  2FHT A;  2KCT A;  2E2I B;  3KOJ A;  4FXD A;  5IYD H;  1K83 H;  4DK3 C;  3A8K E;  1GUS A;  2N3S A;  3J81 E;  2MQH A;  4BBS B;  5HGQ A;  1EYC A;  1KDC A;  4A3K H;  4JI1 L;  1DON A;  1PRT D;  1SND A;  1SNO A;  4B3R Q;  2ZXO A;  3GTJ B;  2F0N A;  1TWG H;  5CV5 A;  1TY2 A;  3MTS A;  1Y1V H;  4JI0 L;  1TWC B;  5C0X J;  1TWA H;  2OTJ A;  3S1M H;  2K5W A;  5J3B A;  4V0B A;  1KL9 A;  1G51 A;  1W6K A;  1KRT A;  3EQL C;  2MPM A;  2B8G A;  2KHJ A;  4K5V A;  1MGS A;  1JOK A;  2OQK A;  1OTC A;  1TWH H;  3UDI A;  1PXU A;  1X65 A;  4YWL A;  3V2T A;  4DAV A;  3HOV H;  4QIW E;  5FO9 B;  1CUK A;  2Q8I B;  3MXG A;  2EYH A;  3FMC A;  3KUP A;  2K5Q A;  3M3Y H;  5ELN A;  3NUC A;  3GTG H;  4M8A A;  4DK1 A;  4BBR H;  3M4O B;  4P71 A;  1UUP A;  2NTS A;  1I6H B;  4LF5 L;  4F88 A;  1ASY A;  4IUN A;  1MKH A;  4XT3 B;  1R4Q B;  2NVT H;  2LS0 1;  1VQH A;  3TEH B;  4ODG A;  5C5L A;  4CJ2 C;  3IL8 A;  1IBM L;  1O7L A;  1WTQ A;  1X3G A;  3FP9 A;  2B63 H;  1HNZ L;  1F2L A;  5T1G A;  3F8T A;  3JAM E;  3MXU A;  3NWT A;  4OEM B;  5C0X G;  1CSQ A;  2UXB Q;  1E1T A;  1CZW A;  3QG1 A;  2A6E D;  2R93 H;  1CK1 A;  1GUN A;  3VR6 A;  1YHQ A;  4UP7 A;  2LFN A;  1SEB D;  4POG A;  1OXV A;  2VL6 A;  2BDN A;  1MSH A;  1Y1W H;  3MVV A;  1DGS A;  2RDF A;  1WD1 A;  4DAY A;  1WJJ A;  5C3X A;  3NEL A;  1B3A A;  3CKI B;  1W3S A;  1PRT F;  4KI0 A;  3I72 A;  2K05 A;  4DV3 L;  4KHP L;  1E2Z A;  1D1K A;  4DV0 Q;  2F0S A;  5EJW A;  3HFZ B;  1E0B A;  4XQJ A;  4DFA A;  5C4X B;  2UUA Q;  1I4X A;  2LXK A;  1J6Q A;  1Q1B A;  1PH4 A;  3FPU B;  4IFD H;  2DY8 A;  2EE1 A;  5M3F G;  1EL0 A;  1BUV T;  3E0E A;  4QGU A;  3OSO A;  5IP9 G;  3U4Z A;  1L0X B;  1FGU A;  5C3W A;  1L0Y B;  1F9R A;  1TT2 A;  1A0I A;  1EYD A;  3C2P A;  4JBM A;  3CF5 A;  1EWI A;  1RKN A;  3J81 c;  3ND8 A;  1EUJ A;  1P16 A;  4JI4 L;  2YTX A;  4H02 A;  3DUZ A;  4A3C H;  1F2M A;  3AEV A;  4JI3 L;  3D3R A;  1PTO C;  1SDF A;  2J4X A;  3TZD A;  1DM0 B;  2F0Q A;  2R7Z G;  4BY1 H;  2R92 H;  3J81 i;  2K50 A;  2EIF A;  3UE1 A;  1A63 A;  3KLW A;  1KDB A;  3HKZ B;  3DWP A;  2F0D A;  2G9H D;  4NXM L;  1M4V A;  3CCS A;  1K3B C;  4G57 A;  2HCI A;  4QUF A;  2IL8 A;  2EYM A;  4ZUJ A;  3OTO L;  1STH A;  1Q86 C;  1A15 A;  2Q2I A;  4O0A A;  3A74 A;  2CH4 W;  4BS9 A;  1U4P A;  3GTQ H;  4FF1 A;  3AB9 A;  3W5O A;  2JQO A;  4FDB A;  5KND A;  3E5S A;  3OWF A;  2PCF B;  3BVG A;  1K3R A;  1S4Z A;  3VR5 A;  2C9O A;  2PMZ B;  3U50 C;  3CRK C;  2PQA B;  3TSS A;  3HOX G;  1ICW A;  2KQ3 A;  3Q23 A;  4ZLT F;  2JP1 A;  5C44 G;  1JWU D;  4FP5 D;  3KDF A;  4DF7 A;  3CXC A;  4GNX A;  2AQ2 B;  3PUW A;  1ZYR D;  1LYL A;  5TSS A;  3HOW B;  5M3M H;  4JPB W;  1X54 A;  4WJ3 M;  1VQD A;  4QL5 A;  3SVM A;  4PMC A;  2VB3 X;  5COR A;  1U5K A;  4GN3 B;  4ILW A;  1U0L A;  2EY6 A;  2EYP A;  2L55 A;  2WP8 J;  1D5M C;  4ZK9 B;  1YBY A;  2RCF A;  4X62 Q;  1YHA A;  3SK8 A;  3JAM i;  4ZYS A;  2GVB A;  2JA8 G;  2I0Q A;  3WWV A;  3UDX A;  1NTG A;  1S5B D;  1D7Q A;  4A3E B;  1YIJ A;  2AWO A;  3CMA A;  1F9P A;  3SK5 A;  4HIM A;  4K6L A;  4LUZ A;  2UU9 L;  5D65 A;  3G48 A;  4RGO S;  1K83 B;  4BY7 G;  4DAP A;  1VQN A;  1EIH A;  3K0Y A;  4MHE A;  5CV8 A;  5C6A A;  2PQA A;  2V4D A;  3S1N H;  3B6Y A;  4IPH A;  2E2J H;  4R9W A;  1WCM G;  2YTV A;  2CVR A;  1CFM A;  3I4O A;  5ELE A;  1YNN C;  2JA9 A;  2JA7 H;  1Y1V B;  1XPO A;  3PGZ A;  1TWA B;  2VUM H;  1K8A C;  2CWP A;  3A8J E;  2VQF Q;  2CKZ B;  1U4R A;  1R4P B;  4CHT B;  1PTO H;  1L2F A;  1GXD C;  3PMF A;  5I6Y A;  4DV4 L;  1KRS A;  4DUZ Q;  1GUW A;  3HOV B;  2VW9 A;  3GTK H;  3A56 A;  4EQN A;  3FKI G;  4IFD I;  3FVQ A;  1XPR A;  4JI2 L;  1B1Z A;  5E4X A;  5AJ3 Q;  4DK6 C;  4K0K L;  1B44 D;  2JEB I;  1AN8 A;  3EN2 A;  3GD7 A;  4BBR B;  3HS0 C;  2JA6 G;  4JI8 Q;  5KGU A;  3EFX D;  3RLN A;  4A3G G;  3OOC A;  4H13 C;  1PVO A;  3D6C A;  1EEI D;  5AFW A;  2AKW B;  2B2W A;  1B50 A;  2OEO A;  3GO5 A;  4KTA A;  4QMG A;  4GN5 A;  2NVT B;  2BH2 A;  4LF4 L;  1UE1 A;  2KED A;  4JG2 A;  4PV1 C;  3D31 A;  2E2H H;  1QCB D;  4MTN A;  2L11 A;  1SE8 A;  2B63 B;  2NZO A;  2Z1C A;  1PV4 A;  4QQB X;  1AW7 A;  4DR6 L;  3M7N A;  1X3F A;  1GUG A;  4KY6 A;  4M1U B;  1XMQ Q;  3MXN B;  1HA6 A;  1SYE A;  4BXX G;  5F2D A;  1TS4 A;  2BDO A;  1E7Z A;  3H91 A;  1HZ9 A;  1HNX L;  2F0H A;  4Y7N H;  4RG1 A;  1EOT A;  1QZH A;  1Y1W B;  1L0W A;  2D9U A;  3RN2 A;  1B8A A;  3T1Y Q;  3OIP A;  2K04 A;  4OGQ C;  3CC4 A;  4HMJ A;  1I6V C;  5IWA L;  1IBK Q;  4JBJ A;  5IT9 L;  5EKL A;  4MNO A;  1A2U A;  3H09 A;  4IZ8 A;  4KN4 C;  2AQ3 B;  1SNC A;  3ZJY C;  4AIM A;  1VMC A;  2BE5 D;  2E74 C;  4ZKC B;  1N32 Q;  5JAV A;  3QOL A;  1UNS A;  1N34 Q;  3S2H H;  2F0L A;  4KKS A;  4U67 3;  2GN5 A;  1VQK A;  1X6O A;  5IGG A;  1S40 A;  1K8G A;  1BXT A;  4C3H H;  3HOU H;  4G7Z C;  2UXB L;  2EYL A;  1QWY A;  5CV9 A;  4CDF C;  3MXN A;  3K5L A;  2O5J C;  1GD7 A;  3A5U A;  2LKV A;  2CHB D;  4DR4 L;  2A69 C;  3KYH C;  3CCL A;  1A62 A;  4L63 B;  5KNB A;  2LY7 A;  2XRQ D;  5EKI A;  1AP0 A;  1QIL A;  1F77 A;  3FDT A;  2L0C A;  5FLM H;  1RJT A;  2R3Z A;  5EBD A;  4BY1 B;  1XNQ Q;  4A3I G;  2N49 A;  2XNA C;  1HZC A;  1Y8P B;  2R7F A;  1EEF D;  2F0V A;  4RHR A;  4BBS G;  3F1Z A;  1X3E A;  3M9B A;  4O2D A;  5K5P A;  1NBW A;  1YHB A;  3K6O A;  2E76 C;  4A76 A;  4C56 C;  1Q8K A;  1Q90 A;  1VQA A;  1XNR L;  1BOS A;  2EJM A;  3GTQ B;  1PZJ D;  3CCU A;  2N88 A;  5M5Y H;  3K7A H;  1MD2 D;  1Z7T A;  5DEH A;  3KJO A;  4RCO A;  3DLL A;  2EVB A;  2UUC Q;  1Q81 C;  4YY3 Q;  1HNW L;  3T1H Q;  3EBE A;  3OPO A;  5JEA J;  1FVI A;  4C3I H;  2G5D A;  1PFN A;  4R8N A;  1H9S A;  3I4M H;  1F2Y A;  5GAE C;  2PW7 A;  2VQE Q;  4AQY Q;  2LSS A;  1STB A;  2EPB A;  1LTG D;  5GRO A;  3KK7 A;  4F7X A;  4DR1 Q;  2FFK B;  1I3Q H;  4OL7 A;  3WDN A;  5M3M B;  2KEE A;  2DGY A;  2CW0 D;  4S3S A;  4YCW A;  5FKA C;  4A3D H;  5EPL A;  3CPF A;  2HDL A;  1CKN B;  5J22 A;  2B39 A;  1SYG A;  2IX1 A;  1PYW D;  3V05 A;  4V19 0;  3BVM A;  4IUR A;  3NE5 B;  4CBV A;  2ICE C;  4RGN A;  4K8I A;  3NK9 A;  4KMU C;  1K0R A;  4DK0 A;  5JJZ A;  2NB0 A;  2K7V A;  3NWS A;  4JI6 Q;  2DY7 A;  1HXY D;  1JIC A;  2NVX H;  3I56 A;  1SR3 A;  1K73 C;  2IPK D;  1OO9 B;  1FD7 D;  2VB2 X;  4K5X A;  3W1B A;  3PO3 H;  2K1B A;  3ULJ A;  2V1C C;  3AFP A;  4WRD A;  4OIK A;  4BWG B;  1Q8I A;  1PA6 A;  1B70 B;  3STB C;  5LMN W;  3W2D A;  5GAD C;  2E2J B;  3I73 A;  5LMU Q;  5JEA G;  1EZ8 A;  2CWA A;  2ES2 A;  1ET6 A;  1CKM A;  1WTR A;  2CH4 A;  3D6W A;  5EPJ A;  2MO1 A;  1Q3L A;  2F1M A;  2VUM B;  1X3P A;  3Q8D A;  3PIP 3;  2NN6 H;  5JPN C;  1Q46 A;  2HDM A;  3FRP B;  3CQZ H;  3M85 A;  4HCE A;  4B3T Q;  1YJW A;  2CQA A;  1PTO B;  4JOI A;  4RGM A;  2F0M A;  5C4X G;  5IYC G;  3KF8 A;  4X62 L;  1I5F A;  4DV2 Q;  4L5R C;  4LF8 L;  5GQO A;  1A8V A;  4R4Q A;  2KCN A;  1N8R C;  5GAH C;  3ULP A;  3LGJ A;  1PH1 A;  3IFT A;  5I2X A;  4A3J B;  2QEX A;  1E22 A;  4ULL A;  2OT2 A;  3TN2 A;  4RFB A;  4A3F G;  1VQM A;  5C4Z A;  4OX9 Q;  3NEN A;  3CD6 A;  1O7I A;  3S2D H;  1YNJ C;  3DMU A;  1I94 L;  2E5L Q;  2F4I A;  2G9D A;  1QJO A;  3PIO 3;  1STE A;  3NHH A;  2E2H B;  1JOQ A;  2VQF L;  2M9V A;  4GKJ L;  5KEE A;  2VZA A;  3CCE A;  5M5X H;  4FXG C;  3SK6 A;  3DM1 A;  1WTO A;  4LNQ A;  4B3M Q;  1HR0 W;  2JE6 I;  2B2T C;  2NVQ B;  4JK1 C;  5EGT A;  3J7Y W;  3OIQ A;  4JCV E;  1EU4 A;  1D5Z C;  1W2B A;  4Q0F A;  4OO1 G;  1SAP A;  1RIP A;  3RZO B;  1BR9 A;  2H1E A;  2ZXP A;  3OW2 A;  1LTR D;  4P75 A;  1J5E Q;  2A68 D;  1AE2 A;  1VDZ A;  2PI2 A;  2Z6K C;  4JI8 L;  4EVO A;  3VDY A;  3LWU A;  1L1O C;  2VS1 A;  3BDL A;  3S1R B;  3HOZ B;  4XYO A;  2F0J A;  1N33 Q;  4AYB B;  4FVM A;  4YCV A;  4HMI A;  4OON A;  3N6R A;  4YWK A;  3T4A C;  1S5C D;  3HOY B;  1UEB A;  3S2H B;  2YU9 H;  1SBB B;  1FJG Q;  3HOW G;  2KEC A;  4JI7 Q;  4CGY B;  2A6H C;  1QUQ B;  1C4Q A;  1M90 C;  1DOL A;  4R4C A;  4LUV A;  2F0U A;  1PLF A; 
#chains in the Genus database with same CATH homology
 3CCV A;  1NMF A;  1VQF A;  1N36 Q;  2ASB A;  1Y14 B;  4JI1 Q;  4JYA Q;  1ASZ A;  3OTO L;  4A3B H;  1AH9 A;  1Q86 C;  2VY3 A;  2UXD L;  4DV5 L;  4WJ4 A;  3PO3 H;  1MIU A;  3S14 H;  2Q2I A;  3M4P A;  4O0A A;  4NXM Q;  3A74 A;  5IT9 c;  1PYS B;  1YIT A;  4A93 G;  3GTQ H;  4HJ8 A;  3W5O A;  2JQO A;  1GVP A;  2RF4 A;  4FDB A;  3H15 A;  4DR5 L;  4A3E G;  3OTO Q;  5C4X H;  2UXD Q;  1K3R A;  2B29 A;  5IYC H;  1PH9 A;  1TXY A;  4DUY L;  5IYD G;  2NVQ H;  4GS3 A;  2B3G A;  4HJ9 A;  3U50 C;  4A3D G;  4NB3 A;  1SRU A;  2PQA B;  4DR5 Q;  3HOX G;  4A75 A;  2HHH Q;  4KLK A;  1GO3 E;  4POF A;  4JC0 A;  5BR8 L;  3RZO H;  1N32 L;  5C44 G;  2JK8 A;  4DUY Q;  3F2B A;  1CKN A;  3KDF A;  3CXC A;  4GNX A;  3PUW A;  1GKH A;  1FL0 A;  2RHQ B;  4BA2 I;  2I5H A;  1LYL A;  4A3F H;  4LF7 Q;  5LMN Q;  5M3M H;  1X54 A;  4LFA Q;  3PIO A;  4WJ3 M;  1VQD A;  4QL5 A;  4C3J H;  3K8A A;  2DUD A;  2YTY A;  3S1R H;  3HOZ H;  2YYZ A;  3E9I A;  4UPA A;  4BBS H;  1U5K A;  2KCM A;  2NN6 I;  3PSI A;  4GN3 B;  4C2M H;  1U0L A;  1VQ6 A;  1VQI A;  4DAM A;  2WP8 J;  3HOY H;  3BZK A;  3L0O A;  4B3S L;  1YBY A;  3HOV G;  4X62 Q;  2KHI A;  1YHA A;  3GTJ H;  1D8L A;  3H0G G;  1IBM Q;  4GN4 B;  3JAM i;  3RNU A;  2GVB A;  2JA8 G;  4IPG A;  2I0Q A;  3WWV A;  3UDX A;  2NZH A;  5IE8 A;  3KJP A;  1NTG A;  3PV0 A;  1D7Q A;  1YIJ A;  2AWO A;  3A0J A;  3CMA A;  4TQU S;  1XNQ L;  4HIM A;  3D0F A;  3J81 j;  4LUZ A;  1CKO A;  4BBR G;  1IXR A;  5JJI A;  2K5H A;  2K4K A;  1MJE A;  2UU9 L;  3G48 A;  2WB1 G;  4BA1 I;  4BY7 G;  1WYD A;  3STB D;  1VQN A;  2Q2T A;  3I4N H;  4IFD J;  3HKZ G;  2PQA A;  3S1N H;  1UE5 A;  3E9H A;  5IP9 H;  1IYJ B;  2Z6K A;  3J80 i;  3GTP H;  3B6Y A;  4IPH A;  4IO9 A;  3UE0 A;  2E2J H;  1XTD A;  2PI2 E;  1L1O A;  1WCM G;  2YTV A;  2JA5 G;  3CCQ A;  3CME A;  4LF9 L;  2F4V L;  3I4O A;  5ELO A;  4JBW A;  3CC7 A;  4LW1 A;  4JI5 Q;  2OTL A;  3HOU G;  1H95 A;  2JA9 A;  2JA7 H;  1XPO A;  3PGZ A;  5HY6 A;  3L2P A;  1KAW A;  4DUZ L;  2VUM H;  1K8A C;  2CWP A;  4PMW A;  2ZJQ A;  2VQF Q;  3RN5 A;  2F52 A;  1LM0 A;  4KHZ A;  3M4O H;  2CKZ B;  1SRO A;  5IP7 H;  1I6H H;  1BKB A;  4LF9 Q;  1JJG A;  2CQO A;  2CCZ A;  3ICE A;  2UUC L;  5FLM G;  1EIY B;  1BVS A;  3TRE A;  3GTL H;  1L2F A;  4HIO A;  5AJ3 L;  3M4Q A;  4YHH L;  1VQE A;  3PF5 A;  4DV4 L;  3HOW H;  1KRS A;  2E8G A;  3F2C A;  4DUZ Q;  4QY7 A;  4RMF A;  1KXL A;  1JJC B;  1VQG A;  3UDF A;  1NY4 A;  2VW9 A;  2ZTC A;  3GTK H;  2KEN A;  2Q2H A;  4IPC A;  2HIV A;  2K14 A;  1PH6 A;  2BA1 A;  3FKI G;  1Y1W G;  4LWC A;  4IFD I;  3J7A 5;  1XPR A;  1VS0 A;  4JI2 L;  3PO2 G;  4AQY L;  1PFS A;  2ZTD A;  5AJ3 Q;  3L7Z C;  1VQP A;  1HR0 Q;  4DK6 C;  4K0K L;  1C7Y A;  4DR7 L;  5JJL A;  2JEB I;  4OWX B;  3RLF A;  1Q12 A;  3A5Z B;  3EN2 A;  3GD7 A;  1K9M C;  2UUB Q;  2JA6 G;  4JI8 Q;  3PCO B;  3RLN A;  1HZB A;  4A3G G;  4DR3 L;  4JI4 Q;  4JI2 Q;  2D62 A;  1PVO A;  4EQ5 A;  4A3E H;  4PZ6 A;  1JB7 A;  3PUV A;  2AKW B;  4PZ8 A;  1I50 H;  4JI3 Q;  3GO5 A;  1BBU A;  1R9T H;  1OXS C;  2A8V A;  4GN5 A;  3K80 C;  1HJP A;  4GOP C;  2C35 B;  1HZA A;  2WFW A;  4LFC L;  3I55 A;  1XMQ L;  4A3M H;  1QZG A;  4LF4 L;  1UE1 A;  5FJ8 G;  1T9H A;  4JG2 A;  2MO0 A;  4DR3 Q;  3D31 A;  4EX5 A;  1VQ5 A;  2E2H H;  4MTN A;  4UP8 A;  1PHJ A;  2GVA A;  3HOX H;  1SE8 A;  4YCU A;  1JJ2 A;  2NZO A;  1PV4 A;  3PF4 A;  4QQB X;  4IOA A;  3I4M G;  5C3E H;  5IY0 A;  4DR6 L;  3M7N A;  1EQR A;  1X3F A;  3KF8 B;  4JV5 Q;  2XGT A;  1YZ6 A;  3FHW A;  1Z47 A;  3AQQ A;  1XMQ Q;  4LFC Q;  4LF4 Q;  3MXN B;  3RLO A;  4BXX G;  3S24 A;  1XMO L;  4DV5 Q;  3K7U C;  2WAQ E;  3T1Y L;  1E7Z A;  1SN8 A;  1HZ9 A;  1IBK L;  3DM3 A;  1HNX L;  1E24 A;  1OXT A;  2EQS A;  4Y7N H;  4HJA A;  4DR6 Q;  4RG1 A;  3KF6 B;  1OXU A;  1QZH A;  3SGI A;  1L0W A;  4A4I A;  4HJ5 A;  2Z0S A;  5LMU L;  2ZJP A;  3RN2 A;  4A3K G;  1IZ6 A;  2R6G A;  2ZM6 L;  4BY1 G;  4HJ7 A;  1B8A A;  2HT1 A;  3T1Y Q;  1B7Y B;  2HIX A;  2D0P A;  2AMC B;  3CC4 A;  2N78 A;  2LXJ A;  2YV5 A;  5DLQ E;  4DV6 L;  5IWA L;  2JEA I;  1P8L A;  2K52 A;  4JBJ A;  1WOC A;  1IBK Q;  1HNX Q;  4NPS A;  3S17 H;  1Y1V G;  4MNO A;  1N34 L;  4OWW B;  2JA8 H;  4DR2 L;  4GLA C;  4DAY B;  3HKS A;  3ZJY C;  2JJQ A;  4AIM A;  2ZM6 Q;  1S72 A;  5C4J H;  1QUQ A;  4IJL A;  4X64 L;  4LF6 L;  5BR8 Q;  1N32 Q;  1RL2 A;  4ALP A;  5IWA Q;  2Y0S G;  1JMC A;  4LFB L;  4YWM A;  4HIK A;  4ME3 A;  2VNU D;  3PO3 G;  4GLV B;  4DV2 L;  1N34 Q;  5C0X I;  4BY7 H;  3S2H H;  4DKA C;  4GOP B;  1SLJ A;  1YEZ A;  1XPU A;  4X6A H;  4LF6 Q;  2GN5 A;  4PZ7 A;  1VQK A;  1X6O A;  2K5V A;  3RZD H;  1S40 A;  3JC6 6;  1PH2 A;  3OYY A;  1K8G A;  1WCM H;  4XIG S;  2D0O A;  4L5Q A;  4C3H H;  2JA5 H;  3ER0 A;  1VQO A;  3HOU H;  2UXB L;  1Z9F A;  3KFU A;  4L5S A;  3CCJ A;  4B3S Q;  1GD7 A;  3A5U A;  4Y52 H;  3NBH B;  3CCL A;  3KYH C;  4DR4 L;  1A62 A;  1VQ8 A;  4NXN L;  2NN6 G;  5M3F H;  3U58 A;  2UXC L;  1YJ9 A;  1X55 A;  1YVC A;  3KF6 A;  3TS2 A;  5FLM H;  2QGQ A;  3K81 C;  1VQ4 A;  1XNQ Q;  1X56 A;  4DR4 Q;  3UDG A;  4A3I G;  2UU9 Q;  1E1O A;  4NXN Q;  2N49 A;  1LTL A;  1HZC A;  1KC8 C;  2R7D A;  2R7F A;  1N9W A;  4TVA B;  3NEM A;  3FKI H;  4JOI C;  2K75 A;  4BBS G;  4JV5 L;  3F1Z A;  1X3E A;  3M9B A;  4O2D A;  1VQL A;  2B63 G;  3PO2 H;  1NBW A;  1YHB A;  4A3L G;  4R4O A;  1X9N A;  3S16 H;  2F4V Q;  1CSP A;  4A76 A;  1EQQ A;  1PH7 A;  1VCI A;  3CC2 A;  2R7Z H;  4OO1 I;  3W1G A;  1Q8K A;  1SMX A;  1QVG A;  4YY3 L;  1VQA A;  2R93 G;  5K36 G;  3T1H L;  1XNR L;  4A3G H;  1BBW A;  4GOP A;  3CCU A;  5H1S E;  4GKK L;  2OCE A;  4X65 L;  5M5Y H;  3I7F A;  3K7A H;  3BZC A;  3KJO A;  2AHO B;  3DLL A;  5IYB G;  2VQE L;  5EAY A;  2UUC Q;  1IBL L;  1UE6 A;  1KIX A;  1QVC A;  2I5L X;  1Q81 C;  1YI2 A;  1PH3 A;  4YY3 Q;  3CAM A;  4YHH Q;  3T1H Q;  2Q2U A;  1XNR Q;  2N8N A;  4X66 L;  4DV1 L;  4L5T A;  4DV4 Q;  3EBE A;  4DR1 L;  5JEA J;  4DV7 L;  4UY8 C;  3I4N G;  1FVI A;  3S1Q H;  1NMG A;  1KQS A;  4GKK Q;  4C3I H;  4DNI A;  3TQY A;  1PYB A;  1IL2 A;  3I4M H;  4A93 H;  1HH2 P;  5GAE C;  2VQE Q;  4AQY Q;  1IBL Q;  2LSS A;  1C0A A;  4J15 A;  1HNW Q;  2I5M X;  3BU2 A;  5GRO A;  4X66 Q;  4K0K Q;  1WFQ A;  4DR1 Q;  4DR7 Q;  1I3Q H;  1OXX K;  4DV7 Q;  5M5W H;  2KCT A;  2IX0 A;  4R4I A;  2DGY A;  3GTM H;  2EXD A;  3KOJ A;  4IFD G;  2RHS B;  1K83 H;  4B3R L;  5IYD H;  4YCW A;  4DK3 C;  3ERS X;  3G71 A;  1PH8 A;  4A3D H;  1SFO H;  5IP7 G;  2KBN A;  2BH8 A;  2N3S A;  2K5N A;  2MQH A;  3CPF A;  5HGQ A;  1CKN B;  1KHI A;  3KDF B;  4GNX B;  4AYB E;  4A3K H;  2IX1 A;  1TWF H;  1VQB A;  1N36 L;  4JI6 L;  4JI1 L;  2ID0 A;  5C44 H;  2WB1 E;  2H5X A;  1VQ7 A;  3CCR A;  2OWO A;  3AFQ A;  4B3R Q;  1TWG H;  1Y1V H;  3HKZ E;  4JI0 L;  2PNH A;  5C0X J;  3GDE A;  1TWA H;  4DPG A;  3S1M H;  2OTJ A;  3EIV A;  5J3B A;  1K0R A;  1KL9 A;  1G51 A;  1KRT A;  4A3C G;  1UWV A;  4JI6 Q;  2IY5 B;  2CFM A;  3S15 H;  1Q1E A;  1AE3 A;  3I56 A;  1SR3 A;  5FLX c;  2KHJ A;  4A3J G;  1K73 C;  2NVX H;  2R92 G;  2OQK A;  2ALY B;  3W1B A;  1OTC A;  1TWH H;  2MNA A;  1XMO Q;  3RR5 A;  3UDI A;  4JI0 Q;  1EIF A;  3ULJ A;  4GLX A;  1X65 A;  2V1C C;  3AFP A;  4YWL A;  2QA4 A;  1S3O A;  3HOV H;  4PG3 A;  4QIW E;  4P74 A;  2FXQ A;  3H0G H;  1PA6 A;  2HHH L;  1CUK A;  1B70 B;  3STB C;  5LMN W;  5GAD C;  3BJU A;  5LMU Q;  1E3P A;  5JEA G;  4B3T L;  2CWA A;  3M3Y H;  2ES2 A;  4XTC S;  5ELN A;  4A3M G;  3GTG H;  4A3B G;  1CKM A;  2PMZ E;  4DV6 Q;  4LF7 L;  2MO1 A;  1VQJ A;  3MEF A;  5LMN L;  4BBR H;  1PH5 A;  2A19 A;  3PUY A;  3Q8D A;  4OXP A;  3U4V A;  2ZJR A;  4LFA L;  1Q46 A;  5C3E G;  1L1O B;  1C9O A;  4P71 A;  4DR2 Q;  4LF5 L;  3CQZ H;  3M85 A;  4B3T Q;  3G4S A;  1ASY A;  4JBK A;  3CW2 C;  4X64 Q;  1YJW A;  4JOI A;  5C4X G;  1MKH A;  3IRB A;  5IYC G;  4LFB Q;  4A3I H;  2NVT H;  3TEH B;  1VQH A;  2E2I H;  4X62 L;  1I5F A;  4DV2 Q;  2HQL A;  3JAM c;  1IBM L;  4R4T A;  1G29 1;  1YNX A;  4L5R C;  4LF5 Q;  3PUX A;  1A8V A;  5GQO A;  4LF8 L;  2MFI A;  4R4Q A;  3I2Z A;  1X3G A;  2IHF A;  1N8R C;  3FP9 A;  5GAH C;  1YJN A;  2F3I A;  3ULP A;  2B63 H;  1HNZ L;  3LGJ A;  1NE3 A;  4OX9 L;  1HNW L;  4A3L H;  3F8T A;  1PH1 A;  5C0X G;  1CSQ A;  2QEX A;  1E22 A;  1GM5 A;  1E1T A;  4APV A;  3ULL A;  2UXB Q;  5JJK A;  2E5L L;  1NJI C;  3TRZ A;  2R93 H;  1TWC H;  2IHE A;  4LF8 Q;  1VQM A;  2BH2 A;  4A3F G;  4IJH A;  1YHQ A;  1V1Q A;  4UP7 A;  5M3M G;  3H3V I;  2IT1 A;  2OQ0 A;  4MZ9 A;  1HNZ Q;  4OX9 Q;  3NEN A;  4POG A;  3CD6 A;  2UXC Q;  3TS0 A;  1OXV A;  1O7I A;  2VL6 A;  3J80 c;  4GNX C;  3HOZ G;  3J7Z C;  1Y1W H;  1DGS A;  3S2D H;  4AYB G;  5IYB H;  1Q82 C;  4P72 A;  1I94 L;  1EYG A;  2E5L Q;  4DV0 L;  1G6P A;  1KD1 C;  1VQ9 A;  4JI5 L;  1WJJ A;  3HOY G;  1EFW A;  3NEL A;  2A1A A;  2UUA L;  1W3S A;  2NVY H;  3AYH B;  2AWN A;  4OWT B;  4KI0 A;  1JT8 A;  4HID A;  2BA0 A;  4B3M L;  2WAQ G;  2JA6 H;  2VQF L;  4DV3 L;  4KHP L;  4GKJ L;  3CCE A;  2VZA A;  3F2D A;  1I94 Q;  1V9P A;  4DV0 Q;  2XTI A;  3HFZ B;  5M5X H;  3H3V H;  2UUA Q;  3CP0 A;  4IOC A;  1JE5 A;  2LXK A;  4QJF A;  4LNQ A;  4P73 A;  4B3M Q;  1J6Q A;  3CPW A;  1Q1B A;  1XJV A;  1V43 A;  1PH4 A;  1HR0 W;  2JE6 I;  4AH6 A;  4DV3 Q;  1M1K C;  4KHP Q;  5FJ8 H;  5M3F G;  1J5E L;  4GKJ Q;  1WI5 A;  3E0E A;  4JCV E;  4QGU A;  4X65 Q;  4R1J A;  1W2B A;  3K0X A;  5IP9 G;  3U4Z A;  1FGU A;  2Y0S E;  4OO1 G;  1UE7 A;  1HR0 L;  1RIP A;  4UP9 A;  3OW2 A;  4P75 A;  1A0I A;  1N33 L;  3G6E A;  1EOV A;  5GAG C;  4JBM A;  2RCN A;  2ZTE A;  3CF5 A;  1EWI A;  1J5E Q;  2UUB L;  4DV1 Q;  1QVF A;  1AE2 A;  2JA7 G;  4JI8 L;  2PI2 A;  2Z6K C;  3J81 c;  3VDY A;  4BXX H;  1EUJ A;  4LUO A;  1P16 A;  4IPD A;  2YTX A;  4H02 A;  5E7N A;  4JI4 L;  1FJG L;  2VUM G;  1L1O C;  2VS1 A;  4JI7 L;  4A3C H;  2L15 A;  3AEV A;  4JI3 L;  4A3J H;  1N33 Q;  4YCV A;  2R7Z G;  4OON A;  4BY1 H;  4YWK A;  1VQC A;  2R92 H;  1MJC A;  4JYA L;  1UEB A;  2K50 A;  3J81 i;  2EIF A;  3PUZ A;  3UE1 A;  2YU9 H;  3KLW A;  1FJG Q;  3HOW G;  1A63 A;  4JI7 Q;  3GTO H;  1QUQ B;  4NXM L;  1M90 C;  3CCM A;  2ATW A;  3CCS A;  3PIP A;  4R4C A;  4LUV A;  1Q7Y C;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...