4R4QA

Crystal structure of rpa70n in complex with 5-(3-((n-(4-(5-carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4qA00
4DR1L 4DR4Q 1B8AA 1PH8A 2E2JH 2HHHQ 4C2MH 3WWVA 3I4NH 4GKJL 1O7IA 1JJGA 3TEHB 5IWAL 3HOXG 2IY5B 5C0XI 4OX9Q 3AFPA 2KCMA 2WFWA 3M9BA 3ULPA 3HKZE 4A3FG 2UUCQ 1EWIA 2D62A 1HNZL 4B3MQ 4YWMA 1KAWA 3F2DA 3EBEA 4QL5A 4AQYL 2LXKA 3S24A 5GADC 1EIFA 5LMUL 3BZKA 3PIOA 3I55A 3CCVA 2E8GA 3CP0A 2KHIA 4DV0L 4DV4Q 4GOPC 1V43A 4LFAQ 1VQEA 3K7UC 3CC2A 3PCOB 2ASBA 2WAQG 4GLVB 2A8VA 4LF8L 5FJ8H 1UE5A 2R92G 3PGZA 2F4VL 1UEBA 2ZJRA 4A93G 1IYJB 3G48A 3F2CA 3RLFA 3A74A 1UE6A 2WP8J 5JEAJ 1N33Q 2F3IA 3FP9A 1YJWA 4BY7H 3OTOQ 4DR4L 2HHHL 4A3DH 2K14A 4YCUA 3A0JA 1VQJA 1XPOA 2YTYA 1YHQA 3SGIA 2YU9H 4JI6Q 2NVYH 1WCMG 4HJ8A 4OX9L 1VQNA 4J15A 1KQSA 2UUCL 2JA6H 2ZTEA 2OCEA 4UP7A 4DV3Q 1VQOA 3UDGA 4POFA 3RN2A 2MO1A 4FDBA 3L0OA 3HOXH 4DV4L 1Q1EA 4DV7L 1SE8A 4A3JG 3HKSA 1Y1WH 2A19A 4LFAL 1ASZA 1PFSA 2F52A 2Q2HA 4GOPA 4A3FH 4HIOA 1HNXL 3M4OH 3BJUA 3KF8B 2PQAA 2WB1G 1AE2A 1PH5A 2B63H 3HOUH 1LYLA 5M3MG 4APVA 4A3GH 4X65Q 2NN6I 4JI3L 2CWPA 4A3LG 1DGSA 1HJPA 3OTOL 1I5FA 4HJAA 4JI4Q 1L1OB 1YI2A 2UU9L 1XPUA 4IFDJ 4C3HH 5HY6A 1ASYA 1PV4A 1XMQQ 2UUBQ 5EAYA 4IJHA 1YJNA 4OO1I 4OWXB 4RMFA 3GTKH 5FLMH 3K7AH 2R93G 3S1NH 1TXYA 3ULLA 4GS3A 5J3BA 3G71A 4IPGA 5GAGC 1VQ8A 3TS2A 2JEBI 4HJ7A 3ICEA 2ZTDA 5ELOA 1PHJA 4DKAC 1OTCA 2I5HA 3FKIH 4DUZL 2QEXA 4B3TQ 4LF5Q 3I4MH 3PUWA 2RHQB 2K5NA 2FXQA 1VQDA 2ZTCA 1GO3E 3U4VA 3U58A 3NBHB 4JI7Q 4DR6Q 2I5LX 4LF6Q 2UXBQ 2ID0A 3CF5A 5LMNQ 1A63A 4IOCA 2XTIA 3T1YL 4LFBQ 4TQUS 2WB1E 3I4OA 4IO9A 3AQQA 1Q86C 3PUVA 1PH4A 1XNRQ 1RIPA 1Y14B 1OXXK 5M5YH 4X65L 2VY3A 2MFIA 3NENA 1JJCB 1YHAA 2UUAQ 4JI4L 2Q2UA 1UWVA 4DR3L 5C4XG 1XMQL 2VL6A 4DK6C 1L1OC 1EQRA 4UP8A 1YHBA 5IYDG 4A3CG 3CPWA 3EN2A 3HOZG 5C44G 1QZGA 1U5KA 1X6OA 4B3RQ 2VNUD 4YHHL 1WI5A 1KHIA 1K83H 3KDFA 1N36Q 4NXNQ 1PYBA 1NY4A 1L0WA 4B3TL 1X65A 4DV6L 1IXRA 4LF5L 1CSPA 4X62L 1G6PA 4BA1I 4JI7L 4DR6L 4JBWA 4A3MG 4GKJQ 2JQOA 4LW1A 3W5OA 3I56A 5IWAQ 3DLLA 5LMNL 4QGUA 1NJIC 4JCVE 1GVPA 4P72A 1E22A 4QIWE 3B6YA 4PG3A 4B3SL 4JBMA 4LFBL 2JJQA 4GLAC 1WOCA 3PUZA 1XNRL 3FHWA 1HNZQ 1IBML 1NBWA 1K73C 4JV5L 4GLXA 2UUAL 4H02A 1VS0A 2NVTH 5IT9c 1X3GA 5LMUQ 2DGYA 5M3FG 3RLOA 4DV0Q 4HJ5A 3J7A5 1Z47A 2E2IH 3JAMi 2JA5G 1EOVA 1KIXA 4BXXH 1RL2A 1X54A 3DM3A 1SR3A 3W1GA 3H0GG 4LF8Q 5JJLA 4X64Q 1VQAA 2VQEQ 1GD7A 1N36L 5IYCH 3PSIA 1QVCA 1E1OA 4R4CA 2VUMG 1CSQA 3ULJA 4DR7Q 2IHFA 4GN4B 4WJ4A 3OYYA 3RN5A 1J6QA 3CXCA 3CCEA 1Q7YC 4JOIA 1I6HH 2K50A 3E9HA 1WFQA 3CMEA 2CKZB 1NE3A 2Z0SA 1CUKA 1S40A 1JB7A 5E7NA 3PO3H 4GN5A 5C0XG 2KENA 1PYSB 3KLWA 1A62A 1YBYA 3J81j 3GD7A 2Y0SE 1Y1VG 4NB3A 4GNXB 2Q2IA 4P74A 1R9TH 1T9HA 4DV7Q 3PO2G 2JA8G 2JEAI 1KL9A 1V9PA 1A0IA 1XJVA 3STBD 4HJ9A 5IE8A 4BBSG 2OTLA 3CMAA 1HNXQ 3S2DH 4JYAQ 1QUQA 3HOWG 4X64L 2NVXH 4GN3B 1Q8KA 1QVFA 2VQEL 1OXTA 1XPRA 4P75A 1XNQL 2N49A 2E5LQ 2GN5A 4DR7L 4JI3Q 2PNHA 3KYHC 1N8RC 3KFUA 4YWLA 1CKNA 2UU9Q 2E2HH 2JA7G 2BH8A 3CCJA 4LF7L 3S15H 1M90C 2R7ZG 3D0FA 3K8AA 5C3EH 2C35B 4A3IG 3RZOH 5DLQE 4BBRH 4DNIA 2RCNA 4EX5A 3BZCA 4ME3A 3J80i 3F2BA 2HIVA 4DR2Q 3EIVA 1I3QH 1HZ9A 1VQFA 2D0PA 1SFOH 2YV5A 3J80c 2Q2TA 1VQBA 4DUZQ 3E9IA 4GNXC 1YNXA 2ALYB 1SN8A 2UXDL 2EXDA 4YCWA 3H15A 4JYAL 1Q82C 3HOVG 3GTOH 3TQYA 2WAQE 2OWOA 3TRZA 3ER0A 1NTGA 1Y1VH 3T1YQ 1FJGQ 1U0LA 3F1ZA 2VQFL 2JA8H 4K0KQ 4R4IA 3CW2C 5IY0A 2E5LL 2Z6KC 3MEFA 3ERSX 1VQPA 5IP7G 2CCZA 1KC8C 2IX1A 4KHZA 1IBKL 4IPDA 1VQIA 2R92H 1VQ5A 4DR3Q 2NN6G 1PH7A 1IBLL 1PH6A 3IRBA 1C7YA 4LNQA 4A93H 1Q12A 3G4SA 4IFDI 2RHSB 4DPGA 1Z9FA 1Q81C 4OO1G 4YHHQ 2YYZA 1KD1C 3CCRA 4PZ7A 4DR2L 3VDYA 4DV6Q 3KF6B 1KXLA 1WCMH 1UE1A 2N3SA 4X62Q 1VQKA 3GTGH 3AYHB 3CD6A 1PA6A 2CWAA 1YJ9A 1SRUA 1WYDA 5JJKA 1FJGL 1HZBA 4B3SQ 4DV5L 4A3JH 4DAYB 4K0KL 3HOYG 1B70B 1HZAA 3K0XA 1IBMQ 4HIDA 4JV5Q 1UE7A 1YVCA 4NPSA 1AE3A 2LXJA 3CCSA 5IYBG 4A3BG 4X6AH 1OXUA 3K81C 3PV0A 4L5TA 2ZM6Q 1L2FA 1VQGA 3TS0A 1PVOA 2K52A 4UPAA 1MIUA 3A5ZB 1YEZA 2EQSA 5M3MH 4KLKA 4AIMA 4A3LH 3NELA 3GTMH 2BA1A 2ES2A 4IJLA 3PF4A 4GKKQ 1TWAH 2HIXA 5K36G 2CQOA 1GM5A 3GTQH 1VCIA 1K3RA 4LF9L 2R93H 3UDFA 2AKWB 1D8LA 2JA9A 3CAMA 3J81i 5JJIA 1C0AA 1WJJA 5BR8Q 2K75A 3J81c 2JK8A 1LTLA 1VQMA 3LGJA 4IOAA 5IP9G 3CCQA 1SROA 3UE1A 3GDEA 4JI1Q 1N9WA 3GTLH 1X9NA 1YZ6A 1IL2A 3ZJYC 1TWCH 4R4TA 1HH2P 2ZM6L 1EYGA 4A3GG 2ZJPA 5FLXc 2N8NA 4MZ9A 2OQ0A 3S1RH 2YTVA 2K5HA 4LWCA 4DR5L 3HOYH 2GVAA 2UXCQ 3JAMc 4HIKA 1L1OA 1N32L 2AHOB 1AH9A 2N78A 3U50C 1PH3A 1S72A 4A3BH 4Y7NH 1XNQQ 4QY7A 3E0EA 5C4XH 1KRTA 4GKKL 5M5XH 4DUYQ 4LF6L 2AWNA 4A3CH 5IYDH 2MNAA 4LF4L 5C44H 1W3SA 3HOZH 2KBNA 1HNWQ 2I0QA 4LF7Q 3JC66 3KOJA 5BR8L 2VS1A 3UDXA 1J5EQ 4GOPB 4L5SA 4XIGS 4TVAB 2PQAB 1SMXA 5GROA 5ELNA 4JI1L 1E7ZA 1E3PA 1GKHA 3RR5A 4BY7G 1QVGA 1LUZA 5HGQA 4A3MH 1YITA 2LSSA 4BY1G 4A3DG 4QQBX 4R1JA 4NXMQ 5AJ3L 1V1QA 2UXDQ 1K8AC 2UXCL 4DV1L 1H95A 3CCMA 4POGA 2JA6G 1VQ6A 4R4QA 4O2DA 3PUYA 2AWOA 3M4PA 2D0OA 2VQFQ 5M3FH 2DUDA 2NZOA 3S14H 1BBUA 5GAHC 4DUYL 1JJ2A 2JA5H 1BVSA 4HIMA 3F8TA 1IBKQ 3L7ZC 1Y1WG 2JE6I 2NVQH 4DV2L 2CFMA 3H0GH 2RF4A 4OXPA 1HNWL 1IBLQ 3I2ZA 1J5EL 3CC7A 4OWWB 3TREA 2B63G 3PUXA 1I94Q 3HOUG 1N34Q 1NMGA 3S17H 2VUMH 3H3VH 4Y52H 1K0RA 2IX0A 5H1SE 5JEAG 1K8GA 4BA2I 4IPHA 3MXNB 4JI2Q 4KHPQ 4NXML 1PH1A 1VQ9A 4JI5Q 3W1BA 1HR0L 5FLMG 2K4KA 3GO5A 1X3EA 3CQZH 2HT1A 3HFZB 2IT1A 4R4OA 4KI0A 4BY1H 4L5RC 4DV5Q 4A3EG 3PO2H 2ATWA 1E24A 3K80C 3M4QA 2MO0A 4C3JH 3KDFB 3I4MG 4BBSH 3FKIG 1TWGH 1EUJA 3UE0A 4JI0Q 2YTXA 4L5QA 1A8VA 2B29A 3U4ZA 3HOWH 1P8LA 4YY3Q 1VQLA 2R6GA 4LUOA 4QJFA 4B3ML 1HR0W 2R7DA 3KJOA 1PH9A 1I94L 3RNUA 1N34L 4UP9A 3BU2A 2H5XA 3L2PA 3M85A 3PF5A 3S2HH 3M7NA 3M3YH 1XMOQ 1K9MC 3I7FA 1NMFA 4PZ8A 2JA7H 2OTJA 4IFDG 1JE5A 4ALPA 4XTCS 2R7ZH 4A4IA 1W2BA 4JI2L 4KHPL 4DK3C 4LF9Q 1KRSA 1G51A 4JI5L 4EQ5A 4A3IH 1PH2A 4UY8C 3G6EA 2BA0A 1TWFH 4GNXA 2V1CC 1JMCA 1N33L 1EQQA 1JT8A 2GVBA 2EIFA 4IPCA 3T1HQ 1E1TA 1I50H 1S3OA 5GQOA 1EFWA 3Q8DA 4JI6L 2PI2E 1TWHH 3CCUA 4JI0L 2Z6KA 4AH6A 1VQCA 3HOVH 1Q1BA 4WJ3M 2KCTA 4YWKA 4YY3L 1FL0A 5GAEC 3GTJH 2AMCB 2HQLA 4DV3L 1QZHA 4JG2A 4A3EH 3RZDH 4DR5Q 2ZJQA 4AYBG 4YCVA 5IP7H 1N32Q 4LUZA 3PIPA 1C9OA 3AEVA 1XMOL 1FVIA 4A75A 4JC0A 3D31A 3NEMA 1OXSC 4JI8Q 4LF4Q 1VQ4A 1D7QA 3STBC 4A3KG 5C4JH 1BKBA 4JBKA 4BXXG 3KJPA 4JBJA 2OQKA 2NZHA 3T1HL 4MNOA 1QUQB 1MJCA 5IYCG 2UUBL 2L15A 2QGQA 2BH2A 3S16H 2UXBL 1EIYB 1MKHA 1BBWA 2MQHA 3I4NG 3J7ZC 1CKNB 1X56A 5AJ3Q 4OWTB 4X66Q 4LFCQ 3A5UA 4DV1Q 1X55A 3PO3G 4JOIC 4RG1A 4AYBE 3S1MH 2PMZE 5IYBH 4DR1Q 1VQHA 1IZ6A 3OW2A 1CKMA 2PI2A 2VZAA 4A76A 2B3GA 4JI8L 3HKZG 1CKOA 2I5MX 2QA4A 2IHEA 4DV2Q 4OONA 1FGUA 1B7YB 1M1KC 3CC4A 1XTDA 2Y0SG 2R7FA 1X3FA 5FJ8G 4AQYQ 3CPFA 3KF6A 1VQ7A 1G291 1P16A 1YIJA 1LM0A 4MTNA 4PMWA 1MJEA 4LUVA 2A1AA 4A3KH 1OXVA 3RLNA 1SLJA 4P71A 5LMNW 1Q46A 3S1QH 4B3RL 4C3IH 3H3VI 3GTPH 2XGTA 4PZ6A 2F4VQ 4P73A 1HZCA 4NXNL 2K5VA 5IP9H 5M5WH 5C3EG 1HR0Q 3CCLA 4X66L 4LFCL 3UDIA 2VW9A 3AFQA 4O0AA 5C0XJ 2KHJA 4DAMA 4BBRG
chains in the Genus database with same CATH superfamily
4TRDA 4DR4Q 1AN8A 2H4OA 1MSGA 3WOFA 3HOXG 4IZ8A 2B2YC 4PQXA 3RZOB 2WFWA 2NZ1D 3OPOA 1GJXA 1J8IA 1KAWA 3EBEA 2LXKA 3NUCA 1EIFA 5LMUL 3BZKA 3I55A 4DV0L 1TS2A 2E76C 4R8NA 1VQEA 2D2CC 3K7UC 4DA2A 3Q22A 1EY9A 3T56B 4OHJA 1UEBA 1IW7C 3A54A 1IYJB 3C1EA 2RDFA 2ZJRA 3TMEA 2WACA 1PYWD 1N33Q 2F3IA 3FP9A 4BY7H 3OTOQ 2HHHL 2R92B 2F0QA 1XPOA 1VQJA 2HD3A 2NVYH 1R4QB 4B9XA 3HEJA 4JPBW 4POFA 5CV7A 3L0OA 4DV4L 1Q1EA 2PQEA 1SE8A 1Y1WH 4LFAL 2J7ZA 4A3FH 1KDCA 2A73B 3KF8B 4DAPA 1PXUA 2AQ2B 3OW7A 5M3MG 3Q0AA 3D8GA 2AUJD 4JI3L 4XQNA 1TT2A 4X65Q 3N52A 4A3LG 1HJPA 4IFDJ 1FNVA 5FO9B 1L1OB 1YI2A 1ASYA 2OT2A 4XYQA 1XMQQ 2Z8LA 2LS01 1YJNA 1BO0A 2D5DA 4RMFA 3GTKH 3K7AH 4KJNA 1STHA 3KLSA 4IPGA 5GAGC 2R3ZA 3TS2A 3I8ZA 2EYJA 1TWAB 3ICEA 5A2QE 4Q5VA 1PHJA 5DAUA 2I5HA 3FKIH 4OIJA 5A2QL 3PUWA 2F0NA 2FXQA 3U58A 4DR6Q 1A63A 2I5LX 4ZUIA 3T1YL 4LFBQ 2WB1E 1PH4A 1RIPA 2F0LA 5M5YH 3GTLB 4IUPA 5E4WC 2MFIA 1JJCB 2N88A 1S4ZA 3NQIA 1X32A 1Y8OB 1UWVA 1L1OC 4UP8A 4KKUA 1CT1D 3NQTA 3CPWA 1QZGA 1JCKB 2NWGA 5CBAE 1JR0D 4KN7C 5TSSA 5IT9E 4BA1I 1PZJD 5IT9L 5ELFA 4A3MG 4K6LA 3W5OA 2UXBL 4QF4A 5LMNL 3JAME 4PG3A 2KOLA 3JAML 1XNRL 1RCVD 2OEOA 3I3CA 1IBML 1EY8A 2Q8IB 2UUAL 1SEBD 1SJED 5LMUQ 4RCNA 5M3FG 3RLOA 4DV0Q 3JAMi 1C8CA 1EOVA 3NWTA 5CV4A 2SOBA 4OL7A 1Q8IA 4WFN3 1GD7A 4NMZA 4A3GB 3MHBA 1QVCA 5EPJA 5NUCA 1E1OA 4R4CA 3I72A 2V4DA 3H0GB 4WJ4A 1NCVA 1MD2D 1I6HH 4CKEA 1WFQA 2CKZB 1DM0B 5M9OA 2L9HA 2XN9C 1CHQD 1S40A 5AFWA 4GN5A 1A62A 5EBDA 1U4PA 1Y1VG 2F0MA 1R9TH 2JEAI 1RTOA 4KY6A 4HJ9A 3HOWG 1HA5A 4GN3B 1Q8KA 4P75A 3V2TA 2GN5A 4JI3Q 4BBSB 3GQBA 3R93A 4YWLA 2E2HH 5E1FA 2BH8A 4HSVA 4N9TA 1DZ1A 2R7ZG 3LX0A 2HUGA 4BBRH 4DNIA 3M3YB 3BZCA 3VR2A 3H3VC 1SFOH 3VR5A 2Q2TA 1SN8A 2F0JA 1D1IA 4QMGA 3TZDA 1Q82C 3GTOH 3TQYA 1NTGA 3K6OA 3T1YQ 4RHSA 1U0LA 2JA8H 4R4IA 1TS3A 3MEFA 1VQPA 4JW0A 5IP7G 4K5VA 2IX1A 3O13A 3HOVB 3NXWA 1PH7A 2NN6G 4CJ0B 3GTJB 1Y8PB 4RKLA 4I7ZC 3D4DA 2LKVA 4IFDI 3LWEA 4PZ7A 4F7XA 4L8JA 1WCMH 1UE1A 2QDBA 2Z9HA 3VA7A 1CM9A 4BWGB 4XQQA 1SRUA 3BVMA 1V1PB 1H9SB 1EOTA 3NTHA 1HZBA 4DV5L 4A3JH 1IBMQ 2X6LA 4NPSA 2LXJA 1RODA 3S16B 5IYBG 4A3BG 3K81C 3PV0A 2EY1A 2NTSA 1GUGA 2G9HD 1MIUA 2EQSA 1D6EC 4WJWA 4O1NA 2EPBA 3OOCA 1E0BA 5EQ0A 3S1MB 2F0GA 2A68D 2F0SA 4GKKQ 4H44C 2ICIA 3AU7A 4HCEA 4EQPA 1GM5A 2L11A 4LF9L 2R93H 3UDFA 3J7YW 4HR7B 1A3TA 2AKWB 3CAMA 2JA9A 5FLXE 1C0AA 5BR8Q 2M2LA 5FLXL 1EWHA 2N55A 4HAEA 5IP9G 3GP7A 5FKAC 3GDEA 3H09A 4JI1Q 1X9NA 3A8JE 1TWCH 3S1QB 4R4TA 4QCLA 5FO7B 4MZ9A 1WD0A 3HOYH 4KHVA 3JAMc 1X3PA 1WTWA 1VF5C 2N78A 3BS1A 3BZDB 2E2JB 3SK4A 3E0EA 5C4XH 2KEEA 2AWNA 3MFGA 4A3CH 5IYDH 1W3SA 5JJZA 5CORA 2KBNA 1B50A 4DK0A 1VMPA 2PYKA 2VS1A 5FK9C 1J5EQ 4L5SA 4R9WA 4XIGS 1BF4A 1LT4D 1EL0A 1O80A 1HA6A 5GROA 4BY7G 1PRTF 1LUZA 4ZKCB 2FMMA 2LSSA 4BY1G 4R1JA 3E0JA 5J1ZA 1D5MC 1D5ZC 2O4XA 3M4PA 2D0OA 1K8OA 3H91A 3ITPA 2NZOA 4EQNA 2JA5H 1JJ2A 2KVMA 2NVQH 1Y1WG 4DV2L 2JA6B 1SSOA 4OWWB 1EIGA 3HOXB 1N34Q 1CK1A 1PZID 1C4QA 1JORA 5H1SE 1K8GA 4BA2I 1DOKA 2WV6D 2B63B 1DD2A 4N9PA 2F0OA 2O2LD 1FNUA 5T1IA 2B2WA 3CQZH 2HT1A 1CA6A 2EVBA 2IT1A 3DWQA 4KI0A 4L5RC 4DV5Q 4A3EG 2VXWA 2M9VA 1E24A 4FNFA 1BCPB 3SK6A 4ZLTF 3QOLA 1OO9B 3FKIG 2KECA 4OGQC 1EUJA 1G8ZD 3D6WA 2RA4A 4YY3Q 2F0FA 1VQLA 2G9DA 2ZT9C 4ZQ3A 2R7DA 3VYTA 3I4MB 1MHWC 3M85A 3PF5A 3S2HH 3M7NA 1XMOQ 1K9MC 4PZ8A 2F0WA 1JE5A 1UNSA 3E6ZX 5IGEA 4X3UA 4DK3C 1KRSA 3K5LA 4LF9Q 4A3IH 1PH2A 4UY8C 3G6EA 1JMCA 5JEAH 3BDOA 2EIFA 1I50H 2JP1A 3KBGA 4JI0L 4KD3A 1VQCA 1Q1BA 2E2DC 2AMCB 1K83B 4DV3L 2ZJQA 3EJIA 4LUZA 1C9OA 4TSSA 2EY5A 4ME5A 2K33A 1DJRD 2BE5C 4JC0A 3D31A 3NEMA 5C4ZA 1VQ4A 4AYBB 2BOSA 4A3KG 4JBKA 2KJXA 4OO1H 3KJPA 2DY8A 3I73A 1I6VC 4YIJA 1EZ8A 2UUBL 2E2IB 2L15A 4CDCC 4IUTA 1H9RA 3KUPA 1LABA 1MKHA 3V96A 3I4NG 2EE1A 2E75C 2K04A 1HFNA 2FJ2A 4X66Q 3A5UA 2XNAC 1C48A 3OMGA 4FF1A 3SEBA 3M7GA 5ELCA 3VYRA 4A76A 2DY7A 2K5WA 3V05A 3ONAB 2QA4A 2IHEA 4DV2Q 4OONA 1FGUA 2LFNA 2Y0SG 3CPFA 3KF6A 1VQ7A 1D2BA 1LM0A 4PMWA 1BR9A 4G7HC 4RA8A 3QB3A 1OXVA 4OELB 1I4PA 4P71A 4B3RL 2NVXB 1SDFA 1JQYD 2SNSA 4WJ3M 3CCLA 1WTRA 3P7JA 4LFCL 2VW9A 2X69A 4BBRG 2QCPX 1F77A 3S15B 1JJGA 5IWAL 1TIID 4KMUC 2F0PA 2KCMA 3M9BA 3HKZE 2DNCA 2D62A 1HNZL 3F2DA 1I3QB 1JB3A 2EJFC 2A6EC 3CC2A 1XWEA 2O5IC 2DNEA 2FFKB 2ASBA 2WAQG 2A8VA 1GUOA 5FJ8H 1M8AA 1FNWA 1Y1VB 2C9OA 2F4VL 1SAPA 2K7VA 5E3FA 3G48A 3H94A 3RLFA 3A74A 1CQFA 2WP8J 1QWYA 1QJOA 3A8IE 1K3BC 3FPPA 4DXFA 4DR4L 4YCUA 4RAUC 5DNFA 1BBXC 4A93B 4HJ8A 1WCMG 1G2TA 4H7BA 2ENBA 1VQNA 2XRQD 4J15A 1KQSA 1BDOA 2ZTEA 2F0UA 1D1KA 4UP7A 4DV3Q 4NP5A 2G5DA 5DM73 4DV7L 4A3JG 2F0VA 3GTGB 1O7YA 1ASZA 1ENCA 2CH4W 2EYLA 4GOPA 1HNXL 3M4OH 2AUKA 1IHZA 4CBVA 4EQOA 1PH5A 3HOUH 1LYLA 4XYOA 2PZWA 4ZCKA 2NN6I 5IGBA 3OTOL 1F2LA 2UUBQ 2MP1A 1PTOB 3OIPA 5FLMH 2HDMA 2R93G 3ULLA 4GS3A 1ILQA 2F3VA 1CZGA 3GTMB 3T4AC 4HJ7A 5I6YA 5JVG3 1XX8A 3NTIA 2K5NA 1HTPA 4JI7Q 2EYMA 2ID0A 3CRKC 3CF5A 5C3XA 4IOCA 2ZXPA 1NR2A 3AQQA 1OXXK 2ICEC 4X65L 2VY3A 3NENA 1YHAA 2Q2UA 5C4XG 1TVXA 3S1RB 1XMQL 1BUVT 4KY5A 5JVH3 5IYDG 4A3CG 1TKWB 4ZRZA 4B3RQ 2VNUD 4YHHL 2CHBD 1XTCD 4KTAA 5EPLA 1JWSD 1KHIA 2RCFA 3KDFA 4Y7NB 2RVLA 4A3BB 4HMJA 1F9RA 4DV6L 1IXRA 3HOZB 5C44B 4J6HA 1G6PA 2RBMA 4XQJA 3MA2B 4DR6L 4DGZA 1L0YB 3OMCA 5IWAQ 4QGUA 4QIWE 3K57A 4LFBL 4GLAC 1JOOA 1WOCA 4CDDC 1HNZQ 2B2UA 1WTVA 4IALA 2L4NA 2DGYA 2JA5G 4MN3A 4CJ1B 4BXXH 1LLRD 4X64Q 4KN4C 1A3VA 3CHBD 2WKCA 3T16A 1JWMD 3S14B 1A2UA 4CDEC 4DR7Q 4MIUA 1SXTA 4GN4B 3RN5A 1FD7D 1J6QA 1TY2A 3CCEA 1Q7YC 3WOEA 3E9HA 1ZXTA 2WINB 3S17B 2DJGC 2Z0SA 2VUMB 4CKCA 2F4IA 3PO3H 5E7NA 3D4WA 5I9PA 1YBYA 2Z6BA 2Q2IA 4P74A 5G3LF 1ICFB 1DOLA 4DV7Q 1KL9A 1V9PA 2EJMA 5EPKA 2OTLA 3CMAA 1HNXQ 3S2DH 2VB3X 2QILA 3UI2A 4BY1B 3PO2B 2F03A 4C3JB 1TWGB 3KYHC 3NE5B 1NNXA 1CKNA 2KHSA 3D0FA 3K8AA 1SYFA 4K5WA 3MTSA 4A3IG 3RZOH 1PFMA 1PMRA 4EX5A 4PMBA 4I7AA 4DR2Q 2JA7B 1HZ9A 1VQFA 1VQBA 1EEFD 2E74C 3E9IA 1YNXA 2GA4B 1PDQA 1RJTA 2ALYB 2EXDA 3H15A 1DONA 1TWFB 1ZYRD 3H6MA 2NYZD 5JPMC 4U673 3TRZA 2OWOA 1MI2A 4LJZC 1ET6A 3F1ZA 1RHPA 1KC8C 1CHPD 1IBKL 1TWHB 1EQVA 1VQIA 2R92H 2F1MA 1QILA 1IBLL 1PH6A 2K32A 3IRBA 4A3EB 4LNQA 1ICWA 2RHSB 1Z9FA 1Q81C 4OO1G 4YHHQ 3P1HA 1EYDA 2CH4A 4DV6Q 3VDYA 3KF6B 1BNZA 3HS0C 1KXLA 3AB9A 1SMYD 1VQKA 2A74C 1B4OA 2CWAA 1YJ9A 1GUNA 2QEJC 3NSWA 4ABNA 5CYUA 1B70B 1HQRD 4JK1C 2L5TA 1UE7A 1YVCA 1AE3A 2K05A 4L5TA 1TU2B 3M4YA 1PVOA 4K6DA 2K52A 3A5ZB 3MC0B 1LTSD 4KLKA 4AIMA 5C3WA 5DEHA 3K58A 3X3NA 3PF4A 1TWAH 2CQOA 1VCIA 2O5JC 2MPMA 1D8LA 2PMZB 5ELEA 5JJIA 2NB0A 2K5QA 1WJJA 1ESRA 3LGJA 3MEHA 3CCQA 5C5LA 1B1ZA 4A3KB 3GTLH 1YZ6A 4C3IB 3GTPB 2CQAA 2YTVA 2K5HA 1ESFA 3IKJA 4DR5L 1KLUD 2GVAA 1TY0A 1N32L 2AHOB 1PH3A 1S72A 1S5DD 4C2MB 3I4NB 4GKKL 4DUYQ 1E2VA 2MNAA 1BCPD 1HPCA 4PMCA 4CGYB 1HNWQ 5BR8L 4GOPB 2SNMA 3TP5A 3DUZA 3NBHA 1E3PA 4JI1L 3RR5A 1QNUA 2Z4HA 3NPPA 1YITA 5FOBB 2BE5D 4QQBX 4NXMQ 5AJ3L 2FMCA 1K8AC 2C5CA 4DV1L 1I4HA 4POGA 4R4QA 4CJ2C 1SNCA 4A3DB 4A3GH 2KUMA 2DUDA 4HCSA 2YU9B 1TS5A 4HIMA 1IBKQ 2JE6I 2CFMA 3H0GH 5CR3A 1IBLQ 1J5EL 3HOUG 4ID6A 4K5XA 3H3VH 3D6CA 4X3KA 1SE2A 1K0RA 2IX0A 2M00A 1H9KA 5KEEA 2A6HD 2NTTA 4G57A 5CV8A 3TBIB 2L1BA 1B3AA 3DXJC 4JI5Q 1HR0L 5FLMG 3GO5A 5C0XH 3TP7A 1K28A 4ILWA 4C3HB 1SJHD 4CKBA 3M4QA 1HRJA 3KDFB 5D14A 4BBSH 1SE3A 3UE0A 3S1NB 2YTXA 2KCCA 3KLRA 1P8LA 2R6GA 4B3ML 1STAA 3T13A 1HR0W 2HCIA 3KJOA 1PH9A 2Z1CA 1N34L 4UP9A 2H5XA 3X3MA 1J9OA 4NDXA 1K0SA 3M3YH 2MUYA 3LWUA 4XTCS 4A4IA 1G51A 4EQ5A 3K5MA 2F0DA 2BA0A 3IL8A 5D3IB 1O7LA 1EQQA 5CV9A 4ZUJA 5KIXA 1E1TA 1S3OA 1I4QA 4OEMB 1EFWA 2A6ED 4ZK9B 2Z6KA 3HOVH 4YY3L 3GTJH 1QZHA 1NAPA 4JG2A 4ZKBB 4DR5Q 5BN3A 4HTHA 5KNDA 1N32Q 1SYDA 3PIPA 3AEVA 2PZTA 3A8KE 3T51B 1XMOL 1GUTA 3SK5A 4A75A 4ZAIA 4O42A 1OXSC 4JI8Q 1LTAD 2B2UC 1BKBA 4BXXG 1S5CD 1GHJA 2NZHA 3C46A 2XVSA 4MNOA 2NVTB 4IFDH 4R8IA 1QNKA 1KABA 3FEWX 3G6JB 3S16H 4CDFC 3J7ZC 1CKNB 5AJ3Q 4KY7A 1R4PB 4DV1Q 3PO3G 3S1MH 2PMZE 4DR1Q 2K01A 3NWSA 1VQHA 3OW2A 1A3UA 1HQMC 3P75A 1E2WA 5KRUA 5BN5A 2PO4A 1EU3A 5KGUA 1ZYRC 1X3FA 4DF7A 4AQYQ 2JYOA 1G291 1P16A 5K36H 1SNQA 1MJEA 3HKZB 2A1AA 3RLNA 1SYBA 1MBYA 3S1QH 1Q46A 3VR4A 4DAYA 3QJYA 1ONLA 3HZXA 4P73A 5CGKA 1HR0Q 4X66L 3UDIA 2KHJA 3OWFA 4IUQA 4X3SA 1PH8A 3Q24A 2E2JH 3WWVA 2BCOA 3TEHB 3VYSA 2IY5B 2B39A 5C3EB 4OX9Q 1SMYC 5HGTA 3ULPA 1PTOD 4A3FG 1K8MA 2UUCQ 2L12A 4B3MQ 1CFMA 3E3XA 4DXGA 3S24A 2QDLA 3PIOA 2E8GA 2KHIA 1O7ZA 1DXMA 3PCOB 2WIIB 4IQZA 2R92G 1UE5A 5LL6S 1B9NA 1ILPA 1U4MA 3F2CA 4Q0FA 4KD4A 1YJWA 4RGMA 2RSNA 1U4RA 2B2VA 2K14A 3SGIA 1EY4A 1AZPA 1ZEQX 3ND9A 2B2YA 4PNYA 2JA6H 1HFGA 2OCEA 1VQOA 1AZQA 2EYFA 2K28A 4FDBA 3HOXH 1IKMA 4RKBA 1PFSA 1STEA 2Q2HA 3SK8A 3BJUA 3Q23A 1L0XB 2PQAA 1AE2A 1GUSA 4U68A 2B63H 4C56C 1F9SA 5LHY1 2CWPA 1SBBB 3KBXA 4LK1C 3C2PA 1DGSA 1I5FA 4JI4Q 3SXHA 3VYUA 1EFID 4OO1I 4OWXB 1BCPC 5M3MB 1TXYA 2JEBI 3SVMA 1CA5A 4JVZA 2ZTDA 5ELOA 1OTCA 4B3TQ 3I4MH 5I2YA 4DUZL 3GTQB 2EXZA 4LF5Q 4RGTA 3U4VA 3NBHB 1STNA 3DMUA 4DAVA 4LF6Q 2XTIA 4TQUS 4IO9A 3PIP3 1Y14B 1SNDA 4B08A 4RGOS 4FF4A 4QIWB 4Z9CB 2VL6A 1U5KA 4IURA 3A55A 1K83H 1N36Q 1WTOA 1PYBA 5M5XB 1NY4A 1L0WA 1DCZA 1CSPA 1JWUD 1QG7A 4JI7L 4F88A 1I4GA 1WTQA 2JQOA 2LY7A 2A6HC 3I56A 3DLLA 1NJIC 4BS9A 4V190 4P72A 1GVPA 4QB4A 4B3SL 2JJQA 3BYYB 3FHWA 1NBWA 1K73C 4A3MB 1VS0A 3VR3A 4HJ5A 2E2IH 4RWSC 2XIWA 1PRTB 2Z4IA 5EKLA 1RL2A 3W1GA 1KDBA 1SR3A 1ENAA 2WKDA 3H0GG 3T53B 5IIFA 3HGBA 1IKLA 1VQAA 2EZVA 2VQEQ 2K1BA 5M3FB 3PSIA 1TS4A 1IL8A 1FR3A 1CSQA 3FDTA 1WVLA 3OYYA 4QUFA 2TSSA 5KNCA 1EU4A 4IUNA 3FMCA 2I46A 1RKNA 1CUKA 1JB7A 1BXTA 5C0XG 2KENA 1PYSB 3KLWA 2DJFC 3J81j 4FXKC 1WTPA 4NB3A 2IW3A 1A15A 5A35A 1T9HA 2JA8G 2IPKD 2EYPA 4L63B 3STBD 4BBSG 4JYAQ 5L37A 4X64L 2NVXH 1G91A 1XPRA 1OXTA 1XNQL 1LTID 3PIO3 2N49A 2E5LQ 1GHKA 4DR7L 3KFUA 2QF7A 3HOWB 3S15H 4LF7L 1M90C 3GV3A 2RKSA 3ND8A 2C35B 1F2YA 4LMQD 3NBIA 5C6AA 3CRLC 4ME3A 3F2BA 2HIVA 1I3QH 2D0PA 1X3QA 2YV5A 3J80c 2R7ZB 3A7AB 4DUZQ 1SNOA 4UDUC 2UXDL 5ELDA 3R8BA 3HOVG 2EDGA 1FJGQ 1Y1VH 4K0KQ 3CW2C 2Z6KC 3OSOA 3ERSX 2CCZA 4KK7A 2PZUA 4IPDA 1VQ5A 3RZDB 4A93H 3G4SA 3K5NA 4EGVA 3HRZC 2NUCA 4DPGA 2YYZA 1U4LA 1KD1C 3CCRA 4DR2L 4DFAA 1DYQA 2N3SA 3QWNA 4HN7A 3GTGH 5C4JB 3MFYA 2XSCA 2X6GA 1LTBD 1WYDA 4K2LA 4B3SQ 4DAYB 3HOYG 3K0XA 1OXUA 1M4VA 4J8QA 2ZM6Q 2J4XA 1VQGA 3TS0A 1E2ZA 1PTOH 3MAQA 1PTOC 1PFBA 3NELA 2XWJB 3GTMH 5KNBA 5CC4A 5K36G 1K3RA 1ZKOA 1S5BD 2ZXOA 1JE4A 2K75A 3J81c 4QUCA 1LTLA 1SE4A 1VQMA 4IOAA 3R2TA 1CZWA 1AEXA 1N9WA 2B2TA 2RDHA 1HH2P 1EYGA 3OWEB 2ZJPA 3S1RH 2N8NA 2OQ0A 5M5WB 3J7AF 4LWCA 1F2MA 3FPUB 1Y69U 2UXCQ 5IODA 4HIKA 1PFNA 2MJ8A 4N8FA 1AH9A 3R2IA 3U50C 1HTLD 4A3BH 3TSSA 4Y7NH 4QY7A 1XNQQ 2EOTA 4MHEA 1EWCA 4FF3A 3HOZH 5C44H 5I6WA 1JC7A 4LF7Q 1G2SA 1STGA 4WRDA 3SR1A 4TVAB 2PQAB 1B53A 1SMXA 1E7ZA 3ERQA 5I4DA 3PQIA 3A7LA 2B2WC 1HCZA 2UXDQ 3TP8A 1EEID 3RUZA 1H95A 2BDOA 2Q8RE 2HDLA 3CCMA 2NBFA 3K0YA 2JA6G 4BY7B 4IUUA 4O2DA 3SE0A 1KNAA 2AWOA 2JSOA 2JN4A 3S14H 1BBUA 4DUYL 1TR5A 1BVSA 5ELBA 2NVYB 5KYIA 3F8TA 3BDCA 4FXGC 1BQQT 1HNWL 3LNNA 3S9WA 3CC7A 3TREA 2B63G 1T5XD 3PUXA 1I94Q 3S17H 1NMGA 2VUMH 1Y1WB 5JEAG 4A3FB 1Q90A 4IPHA 2B8GA 4ODGA 4JI2Q 1XYIA 4NXML 1PH1A 4KHPQ 1VQ9A 3W1BA 1HUNA 2K4KA 1X3EA 2K03A 4UAIA 4R4OA 4BY1H 3PO2H 2MO0A 4C3JH 1EQTA 3I4MG 3GTKB 4X3TA 1TWGH 3K7AB 3D3RA 4RCOA 3U4ZA 1KLGD 4LUOA 4QJFA 1CQVA 3FKIB 3HG9A 3BU2A 3L2PA 3Q6SA 2Q8TA 4XT3B 4M1UB 3TZUA 2OTJA 2JA7H 1F9QA 1LT5D 1S5FD 4JI5L 2LMCB 5M5YB 2EY6A 1TWFH 4GNXA 4F8MA 1JT8A 1QE6A 2GVBA 4IPCA 3T1HQ 5GQOA 3QO2A 3Q8DA 1STBA 4RHRA 4JI6L 1TWHH 2KEDA 3CCUA 4G4KA 4AH6A 2KQ3A 5CV5A 4YWKA 1FL0A 2HQLA 4C1NI 4A3EH 4AYBG 5IGFA 1Z7TA 1FVIA 3CU7A 4XXEA 1HHVA 1D7QA 2B8FA 3STBC 2KCNA 4JBJA 4RH6A 2RDGA 5D3DA 4FF2A 1MJCA 2QGQA 1VMCA 4WORA 1EIYB 2F0KA 4F87A 4S3SA 5JAVA 1MGSA 3E5SA 1LACA 1X55A 4E6IA 1HXYD 3P20A 1IZ6A 1I6HB 1CKMA 2PI2A 4JI8L 1CKOA 1B7YB 1M1KC 3CC4A 3I91A 1LT6D 1O78A 1XTDA 2R7FA 5FJ8G 1R9TB 4I65A 4MTNA 4A3KH 4G7ZC 3TDQA 1SLJA 5LMNW 2Y0SB 4C3IH 3H3VI 1QB5D 3GTPH 5CBEE 1JOQA 1HZCA 4NXNL 2K5VA 2P5ZX 3AFQA 5IGGA 3BDLA 4K8JA 3AMUA 3VA5A 4DR1L 1B8AA 2HHHQ 2E2HB 4IUVA 4C2MH 4GKJL 3I4NH 1O7IA 5C0XI 3AFPA 1SYEA 4BBRB 1VF7A 1EWIA 1RDPD 1UAPA 4YWMA 4AQYL 4QL5A 1SFOB 5GADC 1VDZA 4EVOA 4DV4Q 3CCVA 4GOPC 1EZ6A 3CP0A 1V43A 4LFAQ 5FO8B 3HP3A 4HSPA 1XXGA 4GLVB 1G6ZA 4LF8L 4K8IA 3GTOB 3PGZA 1PZKD 1NUCA 3FRPB 1UUPA 2JA8B 4A93G 2F0IA 1UE6A 5JEAJ 2MHVA 3TN2A 2WAQB 3DM1A 4A3DH 4XT1B 3A0JA 4G7OC 5ISRA 3KK7A 2YTYA 1STYA 1YHQA 2YU9H 4JI6Q 4OX9L 1D5XC 1AW7A 5KYLA 2UUCL 5J39A 1IYVA 4KJOA 2RQXA 3UDGA 3NTKA 3RN2A 2MO1A 1HUMA 1WCMB 3HKSA 2A19A 2CVRA 2F52A 4HIOA 3MXGA 3SHLA 4DNTB 2WB1G 2CW0D 4A3JB 5IOCA 4APVA 3J7AV 1BCPF 1H9JA 4HJAA 1XPUA 2R61A 2UU9L 4C3HH 5HY6A 1PV4A 1U9RA 5EAYA 4IJHA 5IGDA 1SYGA 1V8QA 3DWAA 1ET9A 3S1NH 5J3BA 3G71A 1PRTD 3URYA 1VQ8A 5I9OA 3RD4A 4ULLA 4DKAC 1LTGD 2QEXA 2R93B 2RHQB 1JICA 2ZTCA 1VQDA 1GO3E 4FVMA 2RSOA 2UXBQ 3IFDA 5LMNQ 4K2KA 1GUWA 2B2TC 3I4OA 1DOMA 1Q86C 3PUVA 1XNRQ 2JXMB 5EJWA 3MXNA 4K14A 5BN4A 2D9UA 1TWCB 2UUAQ 3A56A 4JI4L 4MTKA 4DR3L 1I4XA 4DK6C 1ML0D 3MZ5A 1EQRA 1YHBA 3K5OA 3EN2A 3HOZG 5C44G 3HOYB 2DN8A 1X6OA 1EIHA 1WI5A 2SDFA 1V1OA 4NXNQ 5C4XB 1QOHA 1B44D 4B3TL 2PNRC 1X65A 3C1FA 4LF5L 1YNND 4X62L 3DWPA 1UEAB 4JBWA 3W2DA 5EKIA 4LF6L 4LW1A 1SNMA 4GKJQ 3QOJA 1SYCA 2PCFB 4JCVE 1E22A 3B6YA 3MVVA 1WD1A 4JBMA 3U9SA 1LTTD 3PUZA 5LL6X 4JV5L 4GLXA 4H02A 4RFBA 2NVTH 1IYUA 5IT9c 1X3GA 1YNJD 3J7A5 1Z47A 4ZYSA 1KIXA 1X54A 3DM3A 4LF8Q 5JJLA 2MGSA 4KKTA 1N36L 5IYCH 2JA5B 3DEOA 2VUMG 3ULJA 2NVQB 5F2DA 2IHFA 3IAYA 5HURA 3CXCA 5CV6A 4JOIA 2K50A 3CMEA 2SEBD 1NE3A 4LAAA 3BVZA 1SNPA 1KTKA 1Y8NB 3GD7A 2Y0SE 4GNXB 3PO2G 3ZYYX 4C3JG 1A0IA 1XJVA 4FXDA 5IE8A 3EROA 5EBCA 4DAMA 3CQZB 1QUQA 2IJ0A 3KLSX 3BVGA 5C5MA 1QVFA 2VQEL 1EY6A 3BG3A 2PNHA 1N8RC 3J80E 2UU9Q 2JA7G 3CCJA 3J80L 4FP5D 5C3EH 4FO2A 5DLQE 1WTXA 3NK9A 1GOZA 2RCNA 3S2HB 1S5ED 3J80i 3DEPA 3EIVA 3QR8A 2A69D 4GNXC 1EY5A 3I4LA 4A3IB 3MWYW 3EVQA 4YCWA 4JYAL 2XRSD 2WAQE 3ER0A 1EY0A 3D4RA 1ENFA 2VQFL 1NR4A 1I50B 2E5LL 2TMPA 5IY0A 5DM63 2L55A 4KHZA 3WDNA 4DR3Q 1C7YA 5D65A 1KAAA 1Q12A 3R3OA 1FYCA 2OXPA 3I90A 2I07B 5COYA 3OIQA 4X62Q 3AYHB 4NW2A 3CD6A 1PA6A 3CKIB 5JJKA 2QKIC 1FJGL 4DK1A 4K0KL 3EQLC 1HZAA 4XDXA 4HIDA 4JV5Q 1PTOF 3CCSA 4X6AH 1MSHA 5CMDA 1L2FA 2KA7A 2K6AA 5T1GA 1B9MA 1IW7D 4UPAA 5M3MH 1YEZA 3J81E 4A3LH 4DN4M 2BA1A 3J81L 3NP8A 2ES2A 4IJLA 2A5HA 1EYCA 4DNRB 2HIXA 1RD9D 3GTQH 2ZXRA 2VB2X 4J1MA 3J81i 2J0TD 3MXPA 4C3IG 2JK8A 4PV1C 2F3WA 1SROA 1II3A 3UE1A 3RMHA 3KF8A 1IL2A 3ZJYC 2IWHA 3FVQA 2ZM6L 4A3GG 1I4RA 3G7LA 5FLXc 2H1EA 2PW7A 4P2CB 4KKSA 1L1OA 2EYOA 1KRTA 5M5XH 3L9AX 2OF1A 4LF4L 3N6RA 4NKLA 2I0QA 3JC66 3KOJA 2IX3A 3UDXA 2CW0C 4H0LC 1TQOA 5ELNA 1GKHA 3OHXC 1EYAA 5E4XA 1QVGA 5HGQA 4A3MH 4IN3A 4A3DG 1B2TA 3DHQA 1CI3M 1GXDC 1V1QA 2AQ3B 2PW5A 2UXCL 1PRTC 1T5EA 1LTRD 4C1NK 3C3LA 1VQ6A 3PUYA 3QG1A 2VQFQ 5M3FH 1A2TA 4B9WA 5GAHC 4KV6A 4V0BA 3L7ZC 3QIAA 1KDAA 2RF4A 4OXPA 3SDZA 2EY2A 3I2ZA 1W6JA 1AFPA 4Y52H 2F0HA 4GZYC 3M4OB 3PMFA 1KNEA 3MXNB 4C3HG 1LV9A 3HOUB 1LO5D 2EYHA 1JOKA 4CHTB 5JOBA 3HFZB 5EGTA 2A68C 1AP0A 2ATWA 3K80C 1YNNC 5K5PA 5EKKA 4JI0Q 1FGBD 1LT3D 4L5QA 1A8VA 2B29A 1RF2D 3HOWH 1EY7A 4N8X1 3F2UA 3I70A 1I94L 3RNUA 2AQ1B 3K59A 3I7FA 4OIKA 1NMFA 4IFDG 2EJGC 4ALPA 2R7ZH 1YNJC 1W2BA 4JI2L 4KHPL 1A6XA 2L0CA 1QCBD 1Z6HA 2HCCA 2V1CC 3L3OC 1N33L 4FYDA 4HMIA 2F0EA 1B3QA 2WB1B 1BOSA 3IFTA 2F0TA 2PI2E 2QW7A 1Q3LA 2KCTA 5GAEC 5G3LD 4TKOB 3RZDH 5IP7H 4UHVA 4YCVA 1CTMA 5I2XA 2NN6H 3TP6A 4DU9A 4RGNA 4LF4Q 3MXUA 5C4JH 2XWBB 2OQKA 3T1HL 2IL8A 1QUQB 5IYCG 5IGCA 2BH2A 4H13C 1NSNS 2BDNA 3W3AA 2FINB 4L6TB 2MQHA 1BBWA 1X56A 2FHTA 3EFXD 4OWTB 2PPBC 1PLFA 4LFCQ 4JOIC 4RG1A 4AYBE 3BYTB 1W6KA 5IYBH 5J22A 2A69C 2VZAA 3NHHA 3U9OA 3VR6A 2B3GA 3HKZG 2I5MX 3PO3B 1RTNA 1YIJA 1H9MA 2K5DA 4LUVA 1F9PA 4M8AA 5C4HA 1V1PA 2HQEA 1H9SA 1WTHA 3S2DB 3EA6A 2XGTA 4PZ6A 2F4VQ 5M5WH 4HEDA 5IP9H 5C3EG 4O0AA 1F2ZA 3GV6A 5C0XJ 2B2VC 5JPNC
chains in the Genus database with same CATH topology
4DR1L 4DR4Q 1B8AA 1PH8A 2E2JH 2HHHQ 4C2MH 3WWVA 3I4NH 4GKJL 1O7IA 1JJGA 3TEHB 5IWAL 3HOXG 2IY5B 5C0XI 4OX9Q 3AFPA 2KCMA 2WFWA 3M9BA 3ULPA 3HKZE 4A3FG 2UUCQ 1EWIA 2D62A 1HNZL 4B3MQ 4YWMA 1KAWA 3F2DA 3EBEA 4QL5A 4AQYL 2LXKA 3S24A 5GADC 1EIFA 5LMUL 3BZKA 3PIOA 3I55A 3CCVA 2E8GA 3CP0A 2KHIA 4DV0L 4DV4Q 4GOPC 1V43A 4LFAQ 1VQEA 3K7UC 3CC2A 3PCOB 2ASBA 2WAQG 4GLVB 2A8VA 4LF8L 5FJ8H 1UE5A 2R92G 3PGZA 2F4VL 1UEBA 2ZJRA 4A93G 1IYJB 3G48A 3F2CA 3RLFA 3A74A 1UE6A 2WP8J 5JEAJ 1N33Q 2F3IA 3FP9A 1YJWA 4BY7H 3OTOQ 4DR4L 2HHHL 4A3DH 2K14A 4YCUA 3A0JA 1VQJA 1XPOA 2YTYA 1YHQA 3SGIA 2YU9H 4JI6Q 2NVYH 1WCMG 4HJ8A 4OX9L 1VQNA 4J15A 1KQSA 2UUCL 2JA6H 2ZTEA 2OCEA 4UP7A 4DV3Q 1VQOA 3UDGA 4POFA 3RN2A 2MO1A 4FDBA 3L0OA 3HOXH 4DV4L 1Q1EA 4DV7L 1SE8A 4A3JG 3HKSA 1Y1WH 2A19A 4LFAL 1ASZA 1PFSA 2F52A 2Q2HA 4GOPA 4A3FH 4HIOA 1HNXL 3M4OH 3BJUA 3KF8B 2PQAA 2WB1G 1AE2A 1PH5A 2B63H 3HOUH 1LYLA 5M3MG 4APVA 4A3GH 4X65Q 2NN6I 4JI3L 2CWPA 4A3LG 1DGSA 1HJPA 3OTOL 1I5FA 4HJAA 4JI4Q 1L1OB 1YI2A 2UU9L 1XPUA 4IFDJ 4C3HH 5HY6A 1ASYA 1PV4A 1XMQQ 2UUBQ 5EAYA 4IJHA 1YJNA 4OO1I 4OWXB 4RMFA 3GTKH 5FLMH 3K7AH 2R93G 3S1NH 1TXYA 3ULLA 4GS3A 5J3BA 3G71A 4IPGA 5GAGC 1VQ8A 3TS2A 2JEBI 4HJ7A 3ICEA 2ZTDA 5ELOA 1PHJA 4DKAC 1OTCA 2I5HA 3FKIH 4DUZL 2QEXA 4B3TQ 4LF5Q 3I4MH 3PUWA 2RHQB 2K5NA 2FXQA 1VQDA 2ZTCA 1GO3E 3U4VA 3U58A 3NBHB 4JI7Q 4DR6Q 2I5LX 4LF6Q 2UXBQ 2ID0A 3CF5A 5LMNQ 1A63A 4IOCA 2XTIA 3T1YL 4LFBQ 4TQUS 2WB1E 3I4OA 4IO9A 3AQQA 1Q86C 3PUVA 1PH4A 1XNRQ 1RIPA 1Y14B 1OXXK 5M5YH 4X65L 2VY3A 2MFIA 3NENA 1JJCB 1YHAA 2UUAQ 4JI4L 2Q2UA 1UWVA 4DR3L 5C4XG 1XMQL 2VL6A 4DK6C 1L1OC 1EQRA 4UP8A 1YHBA 5IYDG 4A3CG 3CPWA 3EN2A 3HOZG 5C44G 1QZGA 1U5KA 1X6OA 4B3RQ 2VNUD 4YHHL 1WI5A 1KHIA 1K83H 3KDFA 1N36Q 4NXNQ 1PYBA 1NY4A 1L0WA 4B3TL 1X65A 4DV6L 1IXRA 4LF5L 1CSPA 4X62L 1G6PA 4BA1I 4JI7L 4DR6L 4JBWA 4A3MG 4GKJQ 2JQOA 4LW1A 3W5OA 3I56A 5IWAQ 3DLLA 5LMNL 4QGUA 1NJIC 4JCVE 1GVPA 4P72A 1E22A 4QIWE 3B6YA 4PG3A 4B3SL 4JBMA 4LFBL 2JJQA 4GLAC 1WOCA 3PUZA 1XNRL 3FHWA 1HNZQ 1IBML 1NBWA 1K73C 4JV5L 4GLXA 2UUAL 4H02A 1VS0A 2NVTH 5IT9c 1X3GA 5LMUQ 2DGYA 5M3FG 3RLOA 4DV0Q 4HJ5A 3J7A5 1Z47A 2E2IH 3JAMi 2JA5G 1EOVA 1KIXA 4BXXH 1RL2A 1X54A 3DM3A 1SR3A 3W1GA 3H0GG 4LF8Q 5JJLA 4X64Q 1VQAA 2VQEQ 1GD7A 1N36L 5IYCH 3PSIA 1QVCA 1E1OA 4R4CA 2VUMG 1CSQA 3ULJA 4DR7Q 2IHFA 4GN4B 4WJ4A 3OYYA 3RN5A 1J6QA 3CXCA 3CCEA 1Q7YC 4JOIA 1I6HH 2K50A 3E9HA 1WFQA 3CMEA 2CKZB 1NE3A 2Z0SA 1CUKA 1S40A 1JB7A 5E7NA 3PO3H 4GN5A 5C0XG 2KENA 1PYSB 3KLWA 1A62A 1YBYA 3J81j 3GD7A 2Y0SE 1Y1VG 4NB3A 4GNXB 2Q2IA 4P74A 1R9TH 1T9HA 4DV7Q 3PO2G 2JA8G 2JEAI 1KL9A 1V9PA 1A0IA 1XJVA 3STBD 4HJ9A 5IE8A 4BBSG 2OTLA 3CMAA 1HNXQ 3S2DH 4JYAQ 1QUQA 3HOWG 4X64L 2NVXH 4GN3B 1Q8KA 1QVFA 2VQEL 1OXTA 1XPRA 4P75A 1XNQL 2N49A 2E5LQ 2GN5A 4DR7L 4JI3Q 2PNHA 3KYHC 1N8RC 3KFUA 4YWLA 1CKNA 2UU9Q 2E2HH 2JA7G 2BH8A 3CCJA 4LF7L 3S15H 1M90C 2R7ZG 3D0FA 3K8AA 5C3EH 2C35B 4A3IG 3RZOH 5DLQE 4BBRH 4DNIA 2RCNA 4EX5A 3BZCA 4ME3A 3J80i 3F2BA 2HIVA 4DR2Q 3EIVA 1I3QH 1HZ9A 1VQFA 2D0PA 1SFOH 2YV5A 3J80c 2Q2TA 1VQBA 4DUZQ 3E9IA 4GNXC 1YNXA 2ALYB 1SN8A 2UXDL 2EXDA 4YCWA 3H15A 4JYAL 1Q82C 3HOVG 3GTOH 3TQYA 2WAQE 2OWOA 3TRZA 3ER0A 1NTGA 1Y1VH 3T1YQ 1FJGQ 1U0LA 3F1ZA 2VQFL 2JA8H 4K0KQ 4R4IA 3CW2C 5IY0A 2E5LL 2Z6KC 3MEFA 3ERSX 1VQPA 5IP7G 2CCZA 1KC8C 2IX1A 4KHZA 1IBKL 4IPDA 1VQIA 2R92H 1VQ5A 4DR3Q 2NN6G 1PH7A 1IBLL 1PH6A 3IRBA 1C7YA 4LNQA 4A93H 1Q12A 3G4SA 4IFDI 2RHSB 4DPGA 1Z9FA 1Q81C 4OO1G 4YHHQ 2YYZA 1KD1C 3CCRA 4PZ7A 4DR2L 3VDYA 4DV6Q 3KF6B 1KXLA 1WCMH 1UE1A 2N3SA 4X62Q 1VQKA 3GTGH 3AYHB 3CD6A 1PA6A 2CWAA 1YJ9A 1SRUA 1WYDA 5JJKA 1FJGL 1HZBA 4B3SQ 4DV5L 4A3JH 4DAYB 4K0KL 3HOYG 1B70B 1HZAA 3K0XA 1IBMQ 4HIDA 4JV5Q 1UE7A 1YVCA 4NPSA 1AE3A 2LXJA 3CCSA 5IYBG 4A3BG 4X6AH 1OXUA 3K81C 3PV0A 4L5TA 2ZM6Q 1L2FA 1VQGA 3TS0A 1PVOA 2K52A 4UPAA 1MIUA 3A5ZB 1YEZA 2EQSA 5M3MH 4KLKA 4AIMA 4A3LH 3NELA 3GTMH 2BA1A 2ES2A 4IJLA 3PF4A 4GKKQ 1TWAH 2HIXA 5K36G 2CQOA 1GM5A 3GTQH 1VCIA 1K3RA 4LF9L 2R93H 3UDFA 2AKWB 1D8LA 2JA9A 3CAMA 3J81i 5JJIA 1C0AA 1WJJA 5BR8Q 2K75A 3J81c 2JK8A 1LTLA 1VQMA 3LGJA 4IOAA 5IP9G 3CCQA 1SROA 3UE1A 3GDEA 4JI1Q 1N9WA 3GTLH 1X9NA 1YZ6A 1IL2A 3ZJYC 1TWCH 4R4TA 1HH2P 2ZM6L 1EYGA 4A3GG 2ZJPA 5FLXc 2N8NA 4MZ9A 2OQ0A 3S1RH 2YTVA 2K5HA 4LWCA 4DR5L 3HOYH 2GVAA 2UXCQ 3JAMc 4HIKA 1L1OA 1N32L 2AHOB 1AH9A 2N78A 3U50C 1PH3A 1S72A 4A3BH 4Y7NH 1XNQQ 4QY7A 3E0EA 5C4XH 1KRTA 4GKKL 5M5XH 4DUYQ 4LF6L 2AWNA 4A3CH 5IYDH 2MNAA 4LF4L 5C44H 1W3SA 3HOZH 2KBNA 1HNWQ 2I0QA 4LF7Q 3JC66 3KOJA 5BR8L 2VS1A 3UDXA 1J5EQ 4GOPB 4L5SA 4XIGS 4TVAB 2PQAB 1SMXA 5GROA 5ELNA 4JI1L 1E7ZA 1E3PA 1GKHA 3RR5A 4BY7G 1QVGA 1LUZA 5HGQA 4A3MH 1YITA 2LSSA 4BY1G 4A3DG 4QQBX 4R1JA 4NXMQ 5AJ3L 1V1QA 2UXDQ 1K8AC 2UXCL 4DV1L 1H95A 3CCMA 4POGA 2JA6G 1VQ6A 4R4QA 4O2DA 3PUYA 2AWOA 3M4PA 2D0OA 2VQFQ 5M3FH 2DUDA 2NZOA 3S14H 1BBUA 5GAHC 4DUYL 1JJ2A 2JA5H 1BVSA 4HIMA 3F8TA 1IBKQ 3L7ZC 1Y1WG 2JE6I 2NVQH 4DV2L 2CFMA 3H0GH 2RF4A 4OXPA 1HNWL 1IBLQ 3I2ZA 1J5EL 3CC7A 4OWWB 3TREA 2B63G 3PUXA 1I94Q 3HOUG 1N34Q 1NMGA 3S17H 2VUMH 3H3VH 4Y52H 1K0RA 2IX0A 5H1SE 5JEAG 1K8GA 4BA2I 4IPHA 3MXNB 4JI2Q 4KHPQ 4NXML 1PH1A 1VQ9A 4JI5Q 3W1BA 1HR0L 5FLMG 2K4KA 3GO5A 1X3EA 3CQZH 2HT1A 3HFZB 2IT1A 4R4OA 4KI0A 4BY1H 4L5RC 4DV5Q 4A3EG 3PO2H 2ATWA 1E24A 3K80C 3M4QA 2MO0A 4C3JH 3KDFB 3I4MG 4BBSH 3FKIG 1TWGH 1EUJA 3UE0A 4JI0Q 2YTXA 4L5QA 1A8VA 2B29A 3U4ZA 3HOWH 1P8LA 4YY3Q 1VQLA 2R6GA 4LUOA 4QJFA 4B3ML 1HR0W 2R7DA 3KJOA 1PH9A 1I94L 3RNUA 1N34L 4UP9A 3BU2A 2H5XA 3L2PA 3M85A 3PF5A 3S2HH 3M7NA 3M3YH 1XMOQ 1K9MC 3I7FA 1NMFA 4PZ8A 2JA7H 2OTJA 4IFDG 1JE5A 4ALPA 4XTCS 2R7ZH 4A4IA 1W2BA 4JI2L 4KHPL 4DK3C 4LF9Q 1KRSA 1G51A 4JI5L 4EQ5A 4A3IH 1PH2A 4UY8C 3G6EA 2BA0A 1TWFH 4GNXA 2V1CC 1JMCA 1N33L 1EQQA 1JT8A 2GVBA 2EIFA 4IPCA 3T1HQ 1E1TA 1I50H 1S3OA 5GQOA 1EFWA 3Q8DA 4JI6L 2PI2E 1TWHH 3CCUA 4JI0L 2Z6KA 4AH6A 1VQCA 3HOVH 1Q1BA 4WJ3M 2KCTA 4YWKA 4YY3L 1FL0A 5GAEC 3GTJH 2AMCB 2HQLA 4DV3L 1QZHA 4JG2A 4A3EH 3RZDH 4DR5Q 2ZJQA 4AYBG 4YCVA 5IP7H 1N32Q 4LUZA 3PIPA 1C9OA 3AEVA 1XMOL 1FVIA 4A75A 4JC0A 3D31A 3NEMA 1OXSC 4JI8Q 4LF4Q 1VQ4A 1D7QA 3STBC 4A3KG 5C4JH 1BKBA 4JBKA 4BXXG 3KJPA 4JBJA 2OQKA 2NZHA 3T1HL 4MNOA 1QUQB 1MJCA 5IYCG 2UUBL 2L15A 2QGQA 2BH2A 3S16H 2UXBL 1EIYB 1MKHA 1BBWA 2MQHA 3I4NG 3J7ZC 1CKNB 1X56A 5AJ3Q 4OWTB 4X66Q 4LFCQ 3A5UA 4DV1Q 1X55A 3PO3G 4JOIC 4RG1A 4AYBE 3S1MH 2PMZE 5IYBH 4DR1Q 1VQHA 1IZ6A 3OW2A 1CKMA 2PI2A 2VZAA 4A76A 2B3GA 4JI8L 3HKZG 1CKOA 2I5MX 2QA4A 2IHEA 4DV2Q 4OONA 1FGUA 1B7YB 1M1KC 3CC4A 1XTDA 2Y0SG 2R7FA 1X3FA 5FJ8G 4AQYQ 3CPFA 3KF6A 1VQ7A 1G291 1P16A 1YIJA 1LM0A 4MTNA 4PMWA 1MJEA 4LUVA 2A1AA 4A3KH 1OXVA 3RLNA 1SLJA 4P71A 5LMNW 1Q46A 3S1QH 4B3RL 4C3IH 3H3VI 3GTPH 2XGTA 4PZ6A 2F4VQ 4P73A 1HZCA 4NXNL 2K5VA 5IP9H 5M5WH 5C3EG 1HR0Q 3CCLA 4X66L 4LFCL 3UDIA 2VW9A 3AFQA 4O0AA 5C0XJ 2KHJA 4DAMA 4BBRG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 L;  4DR4 Q;  1B8A A;  1PH8 A;  2E2J H;  2HHH Q;  4C2M H;  3WWV A;  3I4N H;  4GKJ L;  1O7I A;  1JJG A;  3TEH B;  5IWA L;  3HOX G;  2IY5 B;  5C0X I;  4OX9 Q;  3AFP A;  2KCM A;  2WFW A;  3M9B A;  3ULP A;  3HKZ E;  4A3F G;  2UUC Q;  1EWI A;  2D62 A;  1HNZ L;  4B3M Q;  4YWM A;  1KAW A;  3F2D A;  3EBE A;  4QL5 A;  4AQY L;  2LXK A;  3S24 A;  5GAD C;  1EIF A;  5LMU L;  3BZK A;  3PIO A;  3I55 A;  3CCV A;  2E8G A;  3CP0 A;  2KHI A;  4DV0 L;  4DV4 Q;  4GOP C;  1V43 A;  4LFA Q;  1VQE A;  3K7U C;  3CC2 A;  3PCO B;  2ASB A;  2WAQ G;  4GLV B;  2A8V A;  4LF8 L;  5FJ8 H;  1UE5 A;  2R92 G;  3PGZ A;  2F4V L;  1UEB A;  2ZJR A;  4A93 G;  1IYJ B;  3G48 A;  3F2C A;  3RLF A;  3A74 A;  1UE6 A;  2WP8 J;  5JEA J;  1N33 Q;  2F3I A;  3FP9 A;  1YJW A;  4BY7 H;  3OTO Q;  4DR4 L;  2HHH L;  4A3D H;  2K14 A;  4YCU A;  3A0J A;  1VQJ A;  1XPO A;  2YTY A;  1YHQ A;  3SGI A;  2YU9 H;  4JI6 Q;  2NVY H;  1WCM G;  4HJ8 A;  4OX9 L;  1VQN A;  4J15 A;  1KQS A;  2UUC L;  2JA6 H;  2ZTE A;  2OCE A;  4UP7 A;  4DV3 Q;  1VQO A;  3UDG A;  4POF A;  3RN2 A;  2MO1 A;  4FDB A;  3L0O A;  3HOX H;  4DV4 L;  1Q1E A;  4DV7 L;  1SE8 A;  4A3J G;  3HKS A;  1Y1W H;  2A19 A;  4LFA L;  1ASZ A;  1PFS A;  2F52 A;  2Q2H A;  4GOP A;  4A3F H;  4HIO A;  1HNX L;  3M4O H;  3BJU A;  3KF8 B;  2PQA A;  2WB1 G;  1AE2 A;  1PH5 A;  2B63 H;  3HOU H;  1LYL A;  5M3M G;  4APV A;  4A3G H;  4X65 Q;  2NN6 I;  4JI3 L;  2CWP A;  4A3L G;  1DGS A;  1HJP A;  3OTO L;  1I5F A;  4HJA A;  4JI4 Q;  1L1O B;  1YI2 A;  2UU9 L;  1XPU A;  4IFD J;  4C3H H;  5HY6 A;  1ASY A;  1PV4 A;  1XMQ Q;  2UUB Q;  5EAY A;  4IJH A;  1YJN A;  4OO1 I;  4OWX B;  4RMF A;  3GTK H;  5FLM H;  3K7A H;  2R93 G;  3S1N H;  1TXY A;  3ULL A;  4GS3 A;  5J3B A;  3G71 A;  4IPG A;  5GAG C;  1VQ8 A;  3TS2 A;  2JEB I;  4HJ7 A;  3ICE A;  2ZTD A;  5ELO A;  1PHJ A;  4DKA C;  1OTC A;  2I5H A;  3FKI H;  4DUZ L;  2QEX A;  4B3T Q;  4LF5 Q;  3I4M H;  3PUW A;  2RHQ B;  2K5N A;  2FXQ A;  1VQD A;  2ZTC A;  1GO3 E;  3U4V A;  3U58 A;  3NBH B;  4JI7 Q;  4DR6 Q;  2I5L X;  4LF6 Q;  2UXB Q;  2ID0 A;  3CF5 A;  5LMN Q;  1A63 A;  4IOC A;  2XTI A;  3T1Y L;  4LFB Q;  4TQU S;  2WB1 E;  3I4O A;  4IO9 A;  3AQQ A;  1Q86 C;  3PUV A;  1PH4 A;  1XNR Q;  1RIP A;  1Y14 B;  1OXX K;  5M5Y H;  4X65 L;  2VY3 A;  2MFI A;  3NEN A;  1JJC B;  1YHA A;  2UUA Q;  4JI4 L;  2Q2U A;  1UWV A;  4DR3 L;  5C4X G;  1XMQ L;  2VL6 A;  4DK6 C;  1L1O C;  1EQR A;  4UP8 A;  1YHB A;  5IYD G;  4A3C G;  3CPW A;  3EN2 A;  3HOZ G;  5C44 G;  1QZG A;  1U5K A;  1X6O A;  4B3R Q;  2VNU D;  4YHH L;  1WI5 A;  1KHI A;  1K83 H;  3KDF A;  1N36 Q;  4NXN Q;  1PYB A;  1NY4 A;  1L0W A;  4B3T L;  1X65 A;  4DV6 L;  1IXR A;  4LF5 L;  1CSP A;  4X62 L;  1G6P A;  4BA1 I;  4JI7 L;  4DR6 L;  4JBW A;  4A3M G;  4GKJ Q;  2JQO A;  4LW1 A;  3W5O A;  3I56 A;  5IWA Q;  3DLL A;  5LMN L;  4QGU A;  1NJI C;  4JCV E;  1GVP A;  4P72 A;  1E22 A;  4QIW E;  3B6Y A;  4PG3 A;  4B3S L;  4JBM A;  4LFB L;  2JJQ A;  4GLA C;  1WOC A;  3PUZ A;  1XNR L;  3FHW A;  1HNZ Q;  1IBM L;  1NBW A;  1K73 C;  4JV5 L;  4GLX A;  2UUA L;  4H02 A;  1VS0 A;  2NVT H;  5IT9 c;  1X3G A;  5LMU Q;  2DGY A;  5M3F G;  3RLO A;  4DV0 Q;  4HJ5 A;  3J7A 5;  1Z47 A;  2E2I H;  3JAM i;  2JA5 G;  1EOV A;  1KIX A;  4BXX H;  1RL2 A;  1X54 A;  3DM3 A;  1SR3 A;  3W1G A;  3H0G G;  4LF8 Q;  5JJL A;  4X64 Q;  1VQA A;  2VQE Q;  1GD7 A;  1N36 L;  5IYC H;  3PSI A;  1QVC A;  1E1O A;  4R4C A;  2VUM G;  1CSQ A;  3ULJ A;  4DR7 Q;  2IHF A;  4GN4 B;  4WJ4 A;  3OYY A;  3RN5 A;  1J6Q A;  3CXC A;  3CCE A;  1Q7Y C;  4JOI A;  1I6H H;  2K50 A;  3E9H A;  1WFQ A;  3CME A;  2CKZ B;  1NE3 A;  2Z0S A;  1CUK A;  1S40 A;  1JB7 A;  5E7N A;  3PO3 H;  4GN5 A;  5C0X G;  2KEN A;  1PYS B;  3KLW A;  1A62 A;  1YBY A;  3J81 j;  3GD7 A;  2Y0S E;  1Y1V G;  4NB3 A;  4GNX B;  2Q2I A;  4P74 A;  1R9T H;  1T9H A;  4DV7 Q;  3PO2 G;  2JA8 G;  2JEA I;  1KL9 A;  1V9P A;  1A0I A;  1XJV A;  3STB D;  4HJ9 A;  5IE8 A;  4BBS G;  2OTL A;  3CMA A;  1HNX Q;  3S2D H;  4JYA Q;  1QUQ A;  3HOW G;  4X64 L;  2NVX H;  4GN3 B;  1Q8K A;  1QVF A;  2VQE L;  1OXT A;  1XPR A;  4P75 A;  1XNQ L;  2N49 A;  2E5L Q;  2GN5 A;  4DR7 L;  4JI3 Q;  2PNH A;  3KYH C;  1N8R C;  3KFU A;  4YWL A;  1CKN A;  2UU9 Q;  2E2H H;  2JA7 G;  2BH8 A;  3CCJ A;  4LF7 L;  3S15 H;  1M90 C;  2R7Z G;  3D0F A;  3K8A A;  5C3E H;  2C35 B;  4A3I G;  3RZO H;  5DLQ E;  4BBR H;  4DNI A;  2RCN A;  4EX5 A;  3BZC A;  4ME3 A;  3J80 i;  3F2B A;  2HIV A;  4DR2 Q;  3EIV A;  1I3Q H;  1HZ9 A;  1VQF A;  2D0P A;  1SFO H;  2YV5 A;  3J80 c;  2Q2T A;  1VQB A;  4DUZ Q;  3E9I A;  4GNX C;  1YNX A;  2ALY B;  1SN8 A;  2UXD L;  2EXD A;  4YCW A;  3H15 A;  4JYA L;  1Q82 C;  3HOV G;  3GTO H;  3TQY A;  2WAQ E;  2OWO A;  3TRZ A;  3ER0 A;  1NTG A;  1Y1V H;  3T1Y Q;  1FJG Q;  1U0L A;  3F1Z A;  2VQF L;  2JA8 H;  4K0K Q;  4R4I A;  3CW2 C;  5IY0 A;  2E5L L;  2Z6K C;  3MEF A;  3ERS X;  1VQP A;  5IP7 G;  2CCZ A;  1KC8 C;  2IX1 A;  4KHZ A;  1IBK L;  4IPD A;  1VQI A;  2R92 H;  1VQ5 A;  4DR3 Q;  2NN6 G;  1PH7 A;  1IBL L;  1PH6 A;  3IRB A;  1C7Y A;  4LNQ A;  4A93 H;  1Q12 A;  3G4S A;  4IFD I;  2RHS B;  4DPG A;  1Z9F A;  1Q81 C;  4OO1 G;  4YHH Q;  2YYZ A;  1KD1 C;  3CCR A;  4PZ7 A;  4DR2 L;  3VDY A;  4DV6 Q;  3KF6 B;  1KXL A;  1WCM H;  1UE1 A;  2N3S A;  4X62 Q;  1VQK A;  3GTG H;  3AYH B;  3CD6 A;  1PA6 A;  2CWA A;  1YJ9 A;  1SRU A;  1WYD A;  5JJK A;  1FJG L;  1HZB A;  4B3S Q;  4DV5 L;  4A3J H;  4DAY B;  4K0K L;  3HOY G;  1B70 B;  1HZA A;  3K0X A;  1IBM Q;  4HID A;  4JV5 Q;  1UE7 A;  1YVC A;  4NPS A;  1AE3 A;  2LXJ A;  3CCS A;  5IYB G;  4A3B G;  4X6A H;  1OXU A;  3K81 C;  3PV0 A;  4L5T A;  2ZM6 Q;  1L2F A;  1VQG A;  3TS0 A;  1PVO A;  2K52 A;  4UPA A;  1MIU A;  3A5Z B;  1YEZ A;  2EQS A;  5M3M H;  4KLK A;  4AIM A;  4A3L H;  3NEL A;  3GTM H;  2BA1 A;  2ES2 A;  4IJL A;  3PF4 A;  4GKK Q;  1TWA H;  2HIX A;  5K36 G;  2CQO A;  1GM5 A;  3GTQ H;  1VCI A;  1K3R A;  4LF9 L;  2R93 H;  3UDF A;  2AKW B;  1D8L A;  2JA9 A;  3CAM A;  3J81 i;  5JJI A;  1C0A A;  1WJJ A;  5BR8 Q;  2K75 A;  3J81 c;  2JK8 A;  1LTL A;  1VQM A;  3LGJ A;  4IOA A;  5IP9 G;  3CCQ A;  1SRO A;  3UE1 A;  3GDE A;  4JI1 Q;  1N9W A;  3GTL H;  1X9N A;  1YZ6 A;  1IL2 A;  3ZJY C;  1TWC H;  4R4T A;  1HH2 P;  2ZM6 L;  1EYG A;  4A3G G;  2ZJP A;  5FLX c;  2N8N A;  4MZ9 A;  2OQ0 A;  3S1R H;  2YTV A;  2K5H A;  4LWC A;  4DR5 L;  3HOY H;  2GVA A;  2UXC Q;  3JAM c;  4HIK A;  1L1O A;  1N32 L;  2AHO B;  1AH9 A;  2N78 A;  3U50 C;  1PH3 A;  1S72 A;  4A3B H;  4Y7N H;  1XNQ Q;  4QY7 A;  3E0E A;  5C4X H;  1KRT A;  4GKK L;  5M5X H;  4DUY Q;  4LF6 L;  2AWN A;  4A3C H;  5IYD H;  2MNA A;  4LF4 L;  5C44 H;  1W3S A;  3HOZ H;  2KBN A;  1HNW Q;  2I0Q A;  4LF7 Q;  3JC6 6;  3KOJ A;  5BR8 L;  2VS1 A;  3UDX A;  1J5E Q;  4GOP B;  4L5S A;  4XIG S;  4TVA B;  2PQA B;  1SMX A;  5GRO A;  5ELN A;  4JI1 L;  1E7Z A;  1E3P A;  1GKH A;  3RR5 A;  4BY7 G;  1QVG A;  1LUZ A;  5HGQ A;  4A3M H;  1YIT A;  2LSS A;  4BY1 G;  4A3D G;  4QQB X;  4R1J A;  4NXM Q;  5AJ3 L;  1V1Q A;  2UXD Q;  1K8A C;  2UXC L;  4DV1 L;  1H95 A;  3CCM A;  4POG A;  2JA6 G;  1VQ6 A;  4R4Q A;  4O2D A;  3PUY A;  2AWO A;  3M4P A;  2D0O A;  2VQF Q;  5M3F H;  2DUD A;  2NZO A;  3S14 H;  1BBU A;  5GAH C;  4DUY L;  1JJ2 A;  2JA5 H;  1BVS A;  4HIM A;  3F8T A;  1IBK Q;  3L7Z C;  1Y1W G;  2JE6 I;  2NVQ H;  4DV2 L;  2CFM A;  3H0G H;  2RF4 A;  4OXP A;  1HNW L;  1IBL Q;  3I2Z A;  1J5E L;  3CC7 A;  4OWW B;  3TRE A;  2B63 G;  3PUX A;  1I94 Q;  3HOU G;  1N34 Q;  1NMG A;  3S17 H;  2VUM H;  3H3V H;  4Y52 H;  1K0R A;  2IX0 A;  5H1S E;  5JEA G;  1K8G A;  4BA2 I;  4IPH A;  3MXN B;  4JI2 Q;  4KHP Q;  4NXM L;  1PH1 A;  1VQ9 A;  4JI5 Q;  3W1B A;  1HR0 L;  5FLM G;  2K4K A;  3GO5 A;  1X3E A;  3CQZ H;  2HT1 A;  3HFZ B;  2IT1 A;  4R4O A;  4KI0 A;  4BY1 H;  4L5R C;  4DV5 Q;  4A3E G;  3PO2 H;  2ATW A;  1E24 A;  3K80 C;  3M4Q A;  2MO0 A;  4C3J H;  3KDF B;  3I4M G;  4BBS H;  3FKI G;  1TWG H;  1EUJ A;  3UE0 A;  4JI0 Q;  2YTX A;  4L5Q A;  1A8V A;  2B29 A;  3U4Z A;  3HOW H;  1P8L A;  4YY3 Q;  1VQL A;  2R6G A;  4LUO A;  4QJF A;  4B3M L;  1HR0 W;  2R7D A;  3KJO A;  1PH9 A;  1I94 L;  3RNU A;  1N34 L;  4UP9 A;  3BU2 A;  2H5X A;  3L2P A;  3M85 A;  3PF5 A;  3S2H H;  3M7N A;  3M3Y H;  1XMO Q;  1K9M C;  3I7F A;  1NMF A;  4PZ8 A;  2JA7 H;  2OTJ A;  4IFD G;  1JE5 A;  4ALP A;  4XTC S;  2R7Z H;  4A4I A;  1W2B A;  4JI2 L;  4KHP L;  4DK3 C;  4LF9 Q;  1KRS A;  1G51 A;  4JI5 L;  4EQ5 A;  4A3I H;  1PH2 A;  4UY8 C;  3G6E A;  2BA0 A;  1TWF H;  4GNX A;  2V1C C;  1JMC A;  1N33 L;  1EQQ A;  1JT8 A;  2GVB A;  2EIF A;  4IPC A;  3T1H Q;  1E1T A;  1I50 H;  1S3O A;  5GQO A;  1EFW A;  3Q8D A;  4JI6 L;  2PI2 E;  1TWH H;  3CCU A;  4JI0 L;  2Z6K A;  4AH6 A;  1VQC A;  3HOV H;  1Q1B A;  4WJ3 M;  2KCT A;  4YWK A;  4YY3 L;  1FL0 A;  5GAE C;  3GTJ H;  2AMC B;  2HQL A;  4DV3 L;  1QZH A;  4JG2 A;  4A3E H;  3RZD H;  4DR5 Q;  2ZJQ A;  4AYB G;  4YCV A;  5IP7 H;  1N32 Q;  4LUZ A;  3PIP A;  1C9O A;  3AEV A;  1XMO L;  1FVI A;  4A75 A;  4JC0 A;  3D31 A;  3NEM A;  1OXS C;  4JI8 Q;  4LF4 Q;  1VQ4 A;  1D7Q A;  3STB C;  4A3K G;  5C4J H;  1BKB A;  4JBK A;  4BXX G;  3KJP A;  4JBJ A;  2OQK A;  2NZH A;  3T1H L;  4MNO A;  1QUQ B;  1MJC A;  5IYC G;  2UUB L;  2L15 A;  2QGQ A;  2BH2 A;  3S16 H;  2UXB L;  1EIY B;  1MKH A;  1BBW A;  2MQH A;  3I4N G;  3J7Z C;  1CKN B;  1X56 A;  5AJ3 Q;  4OWT B;  4X66 Q;  4LFC Q;  3A5U A;  4DV1 Q;  1X55 A;  3PO3 G;  4JOI C;  4RG1 A;  4AYB E;  3S1M H;  2PMZ E;  5IYB H;  4DR1 Q;  1VQH A;  1IZ6 A;  3OW2 A;  1CKM A;  2PI2 A;  2VZA A;  4A76 A;  2B3G A;  4JI8 L;  3HKZ G;  1CKO A;  2I5M X;  2QA4 A;  2IHE A;  4DV2 Q;  4OON A;  1FGU A;  1B7Y B;  1M1K C;  3CC4 A;  1XTD A;  2Y0S G;  2R7F A;  1X3F A;  5FJ8 G;  4AQY Q;  3CPF A;  3KF6 A;  1VQ7 A;  1G29 1;  1P16 A;  1YIJ A;  1LM0 A;  4MTN A;  4PMW A;  1MJE A;  4LUV A;  2A1A A;  4A3K H;  1OXV A;  3RLN A;  1SLJ A;  4P71 A;  5LMN W;  1Q46 A;  3S1Q H;  4B3R L;  4C3I H;  3H3V I;  3GTP H;  2XGT A;  4PZ6 A;  2F4V Q;  4P73 A;  1HZC A;  4NXN L;  2K5V A;  5IP9 H;  5M5W H;  5C3E G;  1HR0 Q;  3CCL A;  4X66 L;  4LFC L;  3UDI A;  2VW9 A;  3AFQ A;  4O0A A;  5C0X J;  2KHJ A;  4DAM A;  4BBR G; 
#chains in the Genus database with same CATH topology
 4TRD A;  4DR4 Q;  1AN8 A;  2H4O A;  1MSG A;  3WOF A;  3HOX G;  4IZ8 A;  2B2Y C;  4PQX A;  3RZO B;  2WFW A;  2NZ1 D;  3OPO A;  1GJX A;  1J8I A;  1KAW A;  3EBE A;  2LXK A;  3NUC A;  1EIF A;  5LMU L;  3BZK A;  3I55 A;  4DV0 L;  1TS2 A;  2E76 C;  4R8N A;  1VQE A;  2D2C C;  3K7U C;  4DA2 A;  3Q22 A;  1EY9 A;  3T56 B;  4OHJ A;  1UEB A;  1IW7 C;  3A54 A;  1IYJ B;  3C1E A;  2RDF A;  2ZJR A;  3TME A;  2WAC A;  1PYW D;  1N33 Q;  2F3I A;  3FP9 A;  4BY7 H;  3OTO Q;  2HHH L;  2R92 B;  2F0Q A;  1XPO A;  1VQJ A;  2HD3 A;  2NVY H;  1R4Q B;  4B9X A;  3HEJ A;  4JPB W;  4POF A;  5CV7 A;  3L0O A;  4DV4 L;  1Q1E A;  2PQE A;  1SE8 A;  1Y1W H;  4LFA L;  2J7Z A;  4A3F H;  1KDC A;  2A73 B;  3KF8 B;  4DAP A;  1PXU A;  2AQ2 B;  3OW7 A;  5M3M G;  3Q0A A;  3D8G A;  2AUJ D;  4JI3 L;  4XQN A;  1TT2 A;  4X65 Q;  3N52 A;  4A3L G;  1HJP A;  4IFD J;  1FNV A;  5FO9 B;  1L1O B;  1YI2 A;  1ASY A;  2OT2 A;  4XYQ A;  1XMQ Q;  2Z8L A;  2LS0 1;  1YJN A;  1BO0 A;  2D5D A;  4RMF A;  3GTK H;  3K7A H;  4KJN A;  1STH A;  3KLS A;  4IPG A;  5GAG C;  2R3Z A;  3TS2 A;  3I8Z A;  2EYJ A;  1TWA B;  3ICE A;  5A2Q E;  4Q5V A;  1PHJ A;  5DAU A;  2I5H A;  3FKI H;  4OIJ A;  5A2Q L;  3PUW A;  2F0N A;  2FXQ A;  3U58 A;  4DR6 Q;  1A63 A;  2I5L X;  4ZUI A;  3T1Y L;  4LFB Q;  2WB1 E;  1PH4 A;  1RIP A;  2F0L A;  5M5Y H;  3GTL B;  4IUP A;  5E4W C;  2MFI A;  1JJC B;  2N88 A;  1S4Z A;  3NQI A;  1X32 A;  1Y8O B;  1UWV A;  1L1O C;  4UP8 A;  4KKU A;  1CT1 D;  3NQT A;  3CPW A;  1QZG A;  1JCK B;  2NWG A;  5CBA E;  1JR0 D;  4KN7 C;  5TSS A;  5IT9 E;  4BA1 I;  1PZJ D;  5IT9 L;  5ELF A;  4A3M G;  4K6L A;  3W5O A;  2UXB L;  4QF4 A;  5LMN L;  3JAM E;  4PG3 A;  2KOL A;  3JAM L;  1XNR L;  1RCV D;  2OEO A;  3I3C A;  1IBM L;  1EY8 A;  2Q8I B;  2UUA L;  1SEB D;  1SJE D;  5LMU Q;  4RCN A;  5M3F G;  3RLO A;  4DV0 Q;  3JAM i;  1C8C A;  1EOV A;  3NWT A;  5CV4 A;  2SOB A;  4OL7 A;  1Q8I A;  4WFN 3;  1GD7 A;  4NMZ A;  4A3G B;  3MHB A;  1QVC A;  5EPJ A;  5NUC A;  1E1O A;  4R4C A;  3I72 A;  2V4D A;  3H0G B;  4WJ4 A;  1NCV A;  1MD2 D;  1I6H H;  4CKE A;  1WFQ A;  2CKZ B;  1DM0 B;  5M9O A;  2L9H A;  2XN9 C;  1CHQ D;  1S40 A;  5AFW A;  4GN5 A;  1A62 A;  5EBD A;  1U4P A;  1Y1V G;  2F0M A;  1R9T H;  2JEA I;  1RTO A;  4KY6 A;  4HJ9 A;  3HOW G;  1HA5 A;  4GN3 B;  1Q8K A;  4P75 A;  3V2T A;  2GN5 A;  4JI3 Q;  4BBS B;  3GQB A;  3R93 A;  4YWL A;  2E2H H;  5E1F A;  2BH8 A;  4HSV A;  4N9T A;  1DZ1 A;  2R7Z G;  3LX0 A;  2HUG A;  4BBR H;  4DNI A;  3M3Y B;  3BZC A;  3VR2 A;  3H3V C;  1SFO H;  3VR5 A;  2Q2T A;  1SN8 A;  2F0J A;  1D1I A;  4QMG A;  3TZD A;  1Q82 C;  3GTO H;  3TQY A;  1NTG A;  3K6O A;  3T1Y Q;  4RHS A;  1U0L A;  2JA8 H;  4R4I A;  1TS3 A;  3MEF A;  1VQP A;  4JW0 A;  5IP7 G;  4K5V A;  2IX1 A;  3O13 A;  3HOV B;  3NXW A;  1PH7 A;  2NN6 G;  4CJ0 B;  3GTJ B;  1Y8P B;  4RKL A;  4I7Z C;  3D4D A;  2LKV A;  4IFD I;  3LWE A;  4PZ7 A;  4F7X A;  4L8J A;  1WCM H;  1UE1 A;  2QDB A;  2Z9H A;  3VA7 A;  1CM9 A;  4BWG B;  4XQQ A;  1SRU A;  3BVM A;  1V1P B;  1H9S B;  1EOT A;  3NTH A;  1HZB A;  4DV5 L;  4A3J H;  1IBM Q;  2X6L A;  4NPS A;  2LXJ A;  1ROD A;  3S16 B;  5IYB G;  4A3B G;  3K81 C;  3PV0 A;  2EY1 A;  2NTS A;  1GUG A;  2G9H D;  1MIU A;  2EQS A;  1D6E C;  4WJW A;  4O1N A;  2EPB A;  3OOC A;  1E0B A;  5EQ0 A;  3S1M B;  2F0G A;  2A68 D;  2F0S A;  4GKK Q;  4H44 C;  2ICI A;  3AU7 A;  4HCE A;  4EQP A;  1GM5 A;  2L11 A;  4LF9 L;  2R93 H;  3UDF A;  3J7Y W;  4HR7 B;  1A3T A;  2AKW B;  3CAM A;  2JA9 A;  5FLX E;  1C0A A;  5BR8 Q;  2M2L A;  5FLX L;  1EWH A;  2N55 A;  4HAE A;  5IP9 G;  3GP7 A;  5FKA C;  3GDE A;  3H09 A;  4JI1 Q;  1X9N A;  3A8J E;  1TWC H;  3S1Q B;  4R4T A;  4QCL A;  5FO7 B;  4MZ9 A;  1WD0 A;  3HOY H;  4KHV A;  3JAM c;  1X3P A;  1WTW A;  1VF5 C;  2N78 A;  3BS1 A;  3BZD B;  2E2J B;  3SK4 A;  3E0E A;  5C4X H;  2KEE A;  2AWN A;  3MFG A;  4A3C H;  5IYD H;  1W3S A;  5JJZ A;  5COR A;  2KBN A;  1B50 A;  4DK0 A;  1VMP A;  2PYK A;  2VS1 A;  5FK9 C;  1J5E Q;  4L5S A;  4R9W A;  4XIG S;  1BF4 A;  1LT4 D;  1EL0 A;  1O80 A;  1HA6 A;  5GRO A;  4BY7 G;  1PRT F;  1LUZ A;  4ZKC B;  2FMM A;  2LSS A;  4BY1 G;  4R1J A;  3E0J A;  5J1Z A;  1D5M C;  1D5Z C;  2O4X A;  3M4P A;  2D0O A;  1K8O A;  3H91 A;  3ITP A;  2NZO A;  4EQN A;  2JA5 H;  1JJ2 A;  2KVM A;  2NVQ H;  1Y1W G;  4DV2 L;  2JA6 B;  1SSO A;  4OWW B;  1EIG A;  3HOX B;  1N34 Q;  1CK1 A;  1PZI D;  1C4Q A;  1JOR A;  5H1S E;  1K8G A;  4BA2 I;  1DOK A;  2WV6 D;  2B63 B;  1DD2 A;  4N9P A;  2F0O A;  2O2L D;  1FNU A;  5T1I A;  2B2W A;  3CQZ H;  2HT1 A;  1CA6 A;  2EVB A;  2IT1 A;  3DWQ A;  4KI0 A;  4L5R C;  4DV5 Q;  4A3E G;  2VXW A;  2M9V A;  1E24 A;  4FNF A;  1BCP B;  3SK6 A;  4ZLT F;  3QOL A;  1OO9 B;  3FKI G;  2KEC A;  4OGQ C;  1EUJ A;  1G8Z D;  3D6W A;  2RA4 A;  4YY3 Q;  2F0F A;  1VQL A;  2G9D A;  2ZT9 C;  4ZQ3 A;  2R7D A;  3VYT A;  3I4M B;  1MHW C;  3M85 A;  3PF5 A;  3S2H H;  3M7N A;  1XMO Q;  1K9M C;  4PZ8 A;  2F0W A;  1JE5 A;  1UNS A;  3E6Z X;  5IGE A;  4X3U A;  4DK3 C;  1KRS A;  3K5L A;  4LF9 Q;  4A3I H;  1PH2 A;  4UY8 C;  3G6E A;  1JMC A;  5JEA H;  3BDO A;  2EIF A;  1I50 H;  2JP1 A;  3KBG A;  4JI0 L;  4KD3 A;  1VQC A;  1Q1B A;  2E2D C;  2AMC B;  1K83 B;  4DV3 L;  2ZJQ A;  3EJI A;  4LUZ A;  1C9O A;  4TSS A;  2EY5 A;  4ME5 A;  2K33 A;  1DJR D;  2BE5 C;  4JC0 A;  3D31 A;  3NEM A;  5C4Z A;  1VQ4 A;  4AYB B;  2BOS A;  4A3K G;  4JBK A;  2KJX A;  4OO1 H;  3KJP A;  2DY8 A;  3I73 A;  1I6V C;  4YIJ A;  1EZ8 A;  2UUB L;  2E2I B;  2L15 A;  4CDC C;  4IUT A;  1H9R A;  3KUP A;  1LAB A;  1MKH A;  3V96 A;  3I4N G;  2EE1 A;  2E75 C;  2K04 A;  1HFN A;  2FJ2 A;  4X66 Q;  3A5U A;  2XNA C;  1C48 A;  3OMG A;  4FF1 A;  3SEB A;  3M7G A;  5ELC A;  3VYR A;  4A76 A;  2DY7 A;  2K5W A;  3V05 A;  3ONA B;  2QA4 A;  2IHE A;  4DV2 Q;  4OON A;  1FGU A;  2LFN A;  2Y0S G;  3CPF A;  3KF6 A;  1VQ7 A;  1D2B A;  1LM0 A;  4PMW A;  1BR9 A;  4G7H C;  4RA8 A;  3QB3 A;  1OXV A;  4OEL B;  1I4P A;  4P71 A;  4B3R L;  2NVX B;  1SDF A;  1JQY D;  2SNS A;  4WJ3 M;  3CCL A;  1WTR A;  3P7J A;  4LFC L;  2VW9 A;  2X69 A;  4BBR G;  2QCP X;  1F77 A;  3S15 B;  1JJG A;  5IWA L;  1TII D;  4KMU C;  2F0P A;  2KCM A;  3M9B A;  3HKZ E;  2DNC A;  2D62 A;  1HNZ L;  3F2D A;  1I3Q B;  1JB3 A;  2EJF C;  2A6E C;  3CC2 A;  1XWE A;  2O5I C;  2DNE A;  2FFK B;  2ASB A;  2WAQ G;  2A8V A;  1GUO A;  5FJ8 H;  1M8A A;  1FNW A;  1Y1V B;  2C9O A;  2F4V L;  1SAP A;  2K7V A;  5E3F A;  3G48 A;  3H94 A;  3RLF A;  3A74 A;  1CQF A;  2WP8 J;  1QWY A;  1QJO A;  3A8I E;  1K3B C;  3FPP A;  4DXF A;  4DR4 L;  4YCU A;  4RAU C;  5DNF A;  1BBX C;  4A93 B;  4HJ8 A;  1WCM G;  1G2T A;  4H7B A;  2ENB A;  1VQN A;  2XRQ D;  4J15 A;  1KQS A;  1BDO A;  2ZTE A;  2F0U A;  1D1K A;  4UP7 A;  4DV3 Q;  4NP5 A;  2G5D A;  5DM7 3;  4DV7 L;  4A3J G;  2F0V A;  3GTG B;  1O7Y A;  1ASZ A;  1ENC A;  2CH4 W;  2EYL A;  4GOP A;  1HNX L;  3M4O H;  2AUK A;  1IHZ A;  4CBV A;  4EQO A;  1PH5 A;  3HOU H;  1LYL A;  4XYO A;  2PZW A;  4ZCK A;  2NN6 I;  5IGB A;  3OTO L;  1F2L A;  2UUB Q;  2MP1 A;  1PTO B;  3OIP A;  5FLM H;  2HDM A;  2R93 G;  3ULL A;  4GS3 A;  1ILQ A;  2F3V A;  1CZG A;  3GTM B;  3T4A C;  4HJ7 A;  5I6Y A;  5JVG 3;  1XX8 A;  3NTI A;  2K5N A;  1HTP A;  4JI7 Q;  2EYM A;  2ID0 A;  3CRK C;  3CF5 A;  5C3X A;  4IOC A;  2ZXP A;  1NR2 A;  3AQQ A;  1OXX K;  2ICE C;  4X65 L;  2VY3 A;  3NEN A;  1YHA A;  2Q2U A;  5C4X G;  1TVX A;  3S1R B;  1XMQ L;  1BUV T;  4KY5 A;  5JVH 3;  5IYD G;  4A3C G;  1TKW B;  4ZRZ A;  4B3R Q;  2VNU D;  4YHH L;  2CHB D;  1XTC D;  4KTA A;  5EPL A;  1JWS D;  1KHI A;  2RCF A;  3KDF A;  4Y7N B;  2RVL A;  4A3B B;  4HMJ A;  1F9R A;  4DV6 L;  1IXR A;  3HOZ B;  5C44 B;  4J6H A;  1G6P A;  2RBM A;  4XQJ A;  3MA2 B;  4DR6 L;  4DGZ A;  1L0Y B;  3OMC A;  5IWA Q;  4QGU A;  4QIW E;  3K57 A;  4LFB L;  4GLA C;  1JOO A;  1WOC A;  4CDD C;  1HNZ Q;  2B2U A;  1WTV A;  4IAL A;  2L4N A;  2DGY A;  2JA5 G;  4MN3 A;  4CJ1 B;  4BXX H;  1LLR D;  4X64 Q;  4KN4 C;  1A3V A;  3CHB D;  2WKC A;  3T16 A;  1JWM D;  3S14 B;  1A2U A;  4CDE C;  4DR7 Q;  4MIU A;  1SXT A;  4GN4 B;  3RN5 A;  1FD7 D;  1J6Q A;  1TY2 A;  3CCE A;  1Q7Y C;  3WOE A;  3E9H A;  1ZXT A;  2WIN B;  3S17 B;  2DJG C;  2Z0S A;  2VUM B;  4CKC A;  2F4I A;  3PO3 H;  5E7N A;  3D4W A;  5I9P A;  1YBY A;  2Z6B A;  2Q2I A;  4P74 A;  5G3L F;  1ICF B;  1DOL A;  4DV7 Q;  1KL9 A;  1V9P A;  2EJM A;  5EPK A;  2OTL A;  3CMA A;  1HNX Q;  3S2D H;  2VB3 X;  2QIL A;  3UI2 A;  4BY1 B;  3PO2 B;  2F03 A;  4C3J B;  1TWG B;  3KYH C;  3NE5 B;  1NNX A;  1CKN A;  2KHS A;  3D0F A;  3K8A A;  1SYF A;  4K5W A;  3MTS A;  4A3I G;  3RZO H;  1PFM A;  1PMR A;  4EX5 A;  4PMB A;  4I7A A;  4DR2 Q;  2JA7 B;  1HZ9 A;  1VQF A;  1VQB A;  1EEF D;  2E74 C;  3E9I A;  1YNX A;  2GA4 B;  1PDQ A;  1RJT A;  2ALY B;  2EXD A;  3H15 A;  1DON A;  1TWF B;  1ZYR D;  3H6M A;  2NYZ D;  5JPM C;  4U67 3;  3TRZ A;  2OWO A;  1MI2 A;  4LJZ C;  1ET6 A;  3F1Z A;  1RHP A;  1KC8 C;  1CHP D;  1IBK L;  1TWH B;  1EQV A;  1VQI A;  2R92 H;  2F1M A;  1QIL A;  1IBL L;  1PH6 A;  2K32 A;  3IRB A;  4A3E B;  4LNQ A;  1ICW A;  2RHS B;  1Z9F A;  1Q81 C;  4OO1 G;  4YHH Q;  3P1H A;  1EYD A;  2CH4 A;  4DV6 Q;  3VDY A;  3KF6 B;  1BNZ A;  3HS0 C;  1KXL A;  3AB9 A;  1SMY D;  1VQK A;  2A74 C;  1B4O A;  2CWA A;  1YJ9 A;  1GUN A;  2QEJ C;  3NSW A;  4ABN A;  5CYU A;  1B70 B;  1HQR D;  4JK1 C;  2L5T A;  1UE7 A;  1YVC A;  1AE3 A;  2K05 A;  4L5T A;  1TU2 B;  3M4Y A;  1PVO A;  4K6D A;  2K52 A;  3A5Z B;  3MC0 B;  1LTS D;  4KLK A;  4AIM A;  5C3W A;  5DEH A;  3K58 A;  3X3N A;  3PF4 A;  1TWA H;  2CQO A;  1VCI A;  2O5J C;  2MPM A;  1D8L A;  2PMZ B;  5ELE A;  5JJI A;  2NB0 A;  2K5Q A;  1WJJ A;  1ESR A;  3LGJ A;  3MEH A;  3CCQ A;  5C5L A;  1B1Z A;  4A3K B;  3GTL H;  1YZ6 A;  4C3I B;  3GTP B;  2CQA A;  2YTV A;  2K5H A;  1ESF A;  3IKJ A;  4DR5 L;  1KLU D;  2GVA A;  1TY0 A;  1N32 L;  2AHO B;  1PH3 A;  1S72 A;  1S5D D;  4C2M B;  3I4N B;  4GKK L;  4DUY Q;  1E2V A;  2MNA A;  1BCP D;  1HPC A;  4PMC A;  4CGY B;  1HNW Q;  5BR8 L;  4GOP B;  2SNM A;  3TP5 A;  3DUZ A;  3NBH A;  1E3P A;  4JI1 L;  3RR5 A;  1QNU A;  2Z4H A;  3NPP A;  1YIT A;  5FOB B;  2BE5 D;  4QQB X;  4NXM Q;  5AJ3 L;  2FMC A;  1K8A C;  2C5C A;  4DV1 L;  1I4H A;  4POG A;  4R4Q A;  4CJ2 C;  1SNC A;  4A3D B;  4A3G H;  2KUM A;  2DUD A;  4HCS A;  2YU9 B;  1TS5 A;  4HIM A;  1IBK Q;  2JE6 I;  2CFM A;  3H0G H;  5CR3 A;  1IBL Q;  1J5E L;  3HOU G;  4ID6 A;  4K5X A;  3H3V H;  3D6C A;  4X3K A;  1SE2 A;  1K0R A;  2IX0 A;  2M00 A;  1H9K A;  5KEE A;  2A6H D;  2NTT A;  4G57 A;  5CV8 A;  3TBI B;  2L1B A;  1B3A A;  3DXJ C;  4JI5 Q;  1HR0 L;  5FLM G;  3GO5 A;  5C0X H;  3TP7 A;  1K28 A;  4ILW A;  4C3H B;  1SJH D;  4CKB A;  3M4Q A;  1HRJ A;  3KDF B;  5D14 A;  4BBS H;  1SE3 A;  3UE0 A;  3S1N B;  2YTX A;  2KCC A;  3KLR A;  1P8L A;  2R6G A;  4B3M L;  1STA A;  3T13 A;  1HR0 W;  2HCI A;  3KJO A;  1PH9 A;  2Z1C A;  1N34 L;  4UP9 A;  2H5X A;  3X3M A;  1J9O A;  4NDX A;  1K0S A;  3M3Y H;  2MUY A;  3LWU A;  4XTC S;  4A4I A;  1G51 A;  4EQ5 A;  3K5M A;  2F0D A;  2BA0 A;  3IL8 A;  5D3I B;  1O7L A;  1EQQ A;  5CV9 A;  4ZUJ A;  5KIX A;  1E1T A;  1S3O A;  1I4Q A;  4OEM B;  1EFW A;  2A6E D;  4ZK9 B;  2Z6K A;  3HOV H;  4YY3 L;  3GTJ H;  1QZH A;  1NAP A;  4JG2 A;  4ZKB B;  4DR5 Q;  5BN3 A;  4HTH A;  5KND A;  1N32 Q;  1SYD A;  3PIP A;  3AEV A;  2PZT A;  3A8K E;  3T51 B;  1XMO L;  1GUT A;  3SK5 A;  4A75 A;  4ZAI A;  4O42 A;  1OXS C;  4JI8 Q;  1LTA D;  2B2U C;  1BKB A;  4BXX G;  1S5C D;  1GHJ A;  2NZH A;  3C46 A;  2XVS A;  4MNO A;  2NVT B;  4IFD H;  4R8I A;  1QNK A;  1KAB A;  3FEW X;  3G6J B;  3S16 H;  4CDF C;  3J7Z C;  1CKN B;  5AJ3 Q;  4KY7 A;  1R4P B;  4DV1 Q;  3PO3 G;  3S1M H;  2PMZ E;  4DR1 Q;  2K01 A;  3NWS A;  1VQH A;  3OW2 A;  1A3U A;  1HQM C;  3P75 A;  1E2W A;  5KRU A;  5BN5 A;  2PO4 A;  1EU3 A;  5KGU A;  1ZYR C;  1X3F A;  4DF7 A;  4AQY Q;  2JYO A;  1G29 1;  1P16 A;  5K36 H;  1SNQ A;  1MJE A;  3HKZ B;  2A1A A;  3RLN A;  1SYB A;  1MBY A;  3S1Q H;  1Q46 A;  3VR4 A;  4DAY A;  3QJY A;  1ONL A;  3HZX A;  4P73 A;  5CGK A;  1HR0 Q;  4X66 L;  3UDI A;  2KHJ A;  3OWF A;  4IUQ A;  4X3S A;  1PH8 A;  3Q24 A;  2E2J H;  3WWV A;  2BCO A;  3TEH B;  3VYS A;  2IY5 B;  2B39 A;  5C3E B;  4OX9 Q;  1SMY C;  5HGT A;  3ULP A;  1PTO D;  4A3F G;  1K8M A;  2UUC Q;  2L12 A;  4B3M Q;  1CFM A;  3E3X A;  4DXG A;  3S24 A;  2QDL A;  3PIO A;  2E8G A;  2KHI A;  1O7Z A;  1DXM A;  3PCO B;  2WII B;  4IQZ A;  2R92 G;  1UE5 A;  5LL6 S;  1B9N A;  1ILP A;  1U4M A;  3F2C A;  4Q0F A;  4KD4 A;  1YJW A;  4RGM A;  2RSN A;  1U4R A;  2B2V A;  2K14 A;  3SGI A;  1EY4 A;  1AZP A;  1ZEQ X;  3ND9 A;  2B2Y A;  4PNY A;  2JA6 H;  1HFG A;  2OCE A;  1VQO A;  1AZQ A;  2EYF A;  2K28 A;  4FDB A;  3HOX H;  1IKM A;  4RKB A;  1PFS A;  1STE A;  2Q2H A;  3SK8 A;  3BJU A;  3Q23 A;  1L0X B;  2PQA A;  1AE2 A;  1GUS A;  4U68 A;  2B63 H;  4C56 C;  1F9S A;  5LHY 1;  2CWP A;  1SBB B;  3KBX A;  4LK1 C;  3C2P A;  1DGS A;  1I5F A;  4JI4 Q;  3SXH A;  3VYU A;  1EFI D;  4OO1 I;  4OWX B;  1BCP C;  5M3M B;  1TXY A;  2JEB I;  3SVM A;  1CA5 A;  4JVZ A;  2ZTD A;  5ELO A;  1OTC A;  4B3T Q;  3I4M H;  5I2Y A;  4DUZ L;  3GTQ B;  2EXZ A;  4LF5 Q;  4RGT A;  3U4V A;  3NBH B;  1STN A;  3DMU A;  4DAV A;  4LF6 Q;  2XTI A;  4TQU S;  4IO9 A;  3PIP 3;  1Y14 B;  1SND A;  4B08 A;  4RGO S;  4FF4 A;  4QIW B;  4Z9C B;  2VL6 A;  1U5K A;  4IUR A;  3A55 A;  1K83 H;  1N36 Q;  1WTO A;  1PYB A;  5M5X B;  1NY4 A;  1L0W A;  1DCZ A;  1CSP A;  1JWU D;  1QG7 A;  4JI7 L;  4F88 A;  1I4G A;  1WTQ A;  2JQO A;  2LY7 A;  2A6H C;  3I56 A;  3DLL A;  1NJI C;  4BS9 A;  4V19 0;  4P72 A;  1GVP A;  4QB4 A;  4B3S L;  2JJQ A;  3BYY B;  3FHW A;  1NBW A;  1K73 C;  4A3M B;  1VS0 A;  3VR3 A;  4HJ5 A;  2E2I H;  4RWS C;  2XIW A;  1PRT B;  2Z4I A;  5EKL A;  1RL2 A;  3W1G A;  1KDB A;  1SR3 A;  1ENA A;  2WKD A;  3H0G G;  3T53 B;  5IIF A;  3HGB A;  1IKL A;  1VQA A;  2EZV A;  2VQE Q;  2K1B A;  5M3F B;  3PSI A;  1TS4 A;  1IL8 A;  1FR3 A;  1CSQ A;  3FDT A;  1WVL A;  3OYY A;  4QUF A;  2TSS A;  5KNC A;  1EU4 A;  4IUN A;  3FMC A;  2I46 A;  1RKN A;  1CUK A;  1JB7 A;  1BXT A;  5C0X G;  2KEN A;  1PYS B;  3KLW A;  2DJF C;  3J81 j;  4FXK C;  1WTP A;  4NB3 A;  2IW3 A;  1A15 A;  5A35 A;  1T9H A;  2JA8 G;  2IPK D;  2EYP A;  4L63 B;  3STB D;  4BBS G;  4JYA Q;  5L37 A;  4X64 L;  2NVX H;  1G91 A;  1XPR A;  1OXT A;  1XNQ L;  1LTI D;  3PIO 3;  2N49 A;  2E5L Q;  1GHK A;  4DR7 L;  3KFU A;  2QF7 A;  3HOW B;  3S15 H;  4LF7 L;  1M90 C;  3GV3 A;  2RKS A;  3ND8 A;  2C35 B;  1F2Y A;  4LMQ D;  3NBI A;  5C6A A;  3CRL C;  4ME3 A;  3F2B A;  2HIV A;  1I3Q H;  2D0P A;  1X3Q A;  2YV5 A;  3J80 c;  2R7Z B;  3A7A B;  4DUZ Q;  1SNO A;  4UDU C;  2UXD L;  5ELD A;  3R8B A;  3HOV G;  2EDG A;  1FJG Q;  1Y1V H;  4K0K Q;  3CW2 C;  2Z6K C;  3OSO A;  3ERS X;  2CCZ A;  4KK7 A;  2PZU A;  4IPD A;  1VQ5 A;  3RZD B;  4A93 H;  3G4S A;  3K5N A;  4EGV A;  3HRZ C;  2NUC A;  4DPG A;  2YYZ A;  1U4L A;  1KD1 C;  3CCR A;  4DR2 L;  4DFA A;  1DYQ A;  2N3S A;  3QWN A;  4HN7 A;  3GTG H;  5C4J B;  3MFY A;  2XSC A;  2X6G A;  1LTB D;  1WYD A;  4K2L A;  4B3S Q;  4DAY B;  3HOY G;  3K0X A;  1OXU A;  1M4V A;  4J8Q A;  2ZM6 Q;  2J4X A;  1VQG A;  3TS0 A;  1E2Z A;  1PTO H;  3MAQ A;  1PTO C;  1PFB A;  3NEL A;  2XWJ B;  3GTM H;  5KNB A;  5CC4 A;  5K36 G;  1K3R A;  1ZKO A;  1S5B D;  2ZXO A;  1JE4 A;  2K75 A;  3J81 c;  4QUC A;  1LTL A;  1SE4 A;  1VQM A;  4IOA A;  3R2T A;  1CZW A;  1AEX A;  1N9W A;  2B2T A;  2RDH A;  1HH2 P;  1EYG A;  3OWE B;  2ZJP A;  3S1R H;  2N8N A;  2OQ0 A;  5M5W B;  3J7A F;  4LWC A;  1F2M A;  3FPU B;  1Y69 U;  2UXC Q;  5IOD A;  4HIK A;  1PFN A;  2MJ8 A;  4N8F A;  1AH9 A;  3R2I A;  3U50 C;  1HTL D;  4A3B H;  3TSS A;  4Y7N H;  4QY7 A;  1XNQ Q;  2EOT A;  4MHE A;  1EWC A;  4FF3 A;  3HOZ H;  5C44 H;  5I6W A;  1JC7 A;  4LF7 Q;  1G2S A;  1STG A;  4WRD A;  3SR1 A;  4TVA B;  2PQA B;  1B53 A;  1SMX A;  1E7Z A;  3ERQ A;  5I4D A;  3PQI A;  3A7L A;  2B2W C;  1HCZ A;  2UXD Q;  3TP8 A;  1EEI D;  3RUZ A;  1H95 A;  2BDO A;  2Q8R E;  2HDL A;  3CCM A;  2NBF A;  3K0Y A;  2JA6 G;  4BY7 B;  4IUU A;  4O2D A;  3SE0 A;  1KNA A;  2AWO A;  2JSO A;  2JN4 A;  3S14 H;  1BBU A;  4DUY L;  1TR5 A;  1BVS A;  5ELB A;  2NVY B;  5KYI A;  3F8T A;  3BDC A;  4FXG C;  1BQQ T;  1HNW L;  3LNN A;  3S9W A;  3CC7 A;  3TRE A;  2B63 G;  1T5X D;  3PUX A;  1I94 Q;  3S17 H;  1NMG A;  2VUM H;  1Y1W B;  5JEA G;  4A3F B;  1Q90 A;  4IPH A;  2B8G A;  4ODG A;  4JI2 Q;  1XYI A;  4NXM L;  1PH1 A;  4KHP Q;  1VQ9 A;  3W1B A;  1HUN A;  2K4K A;  1X3E A;  2K03 A;  4UAI A;  4R4O A;  4BY1 H;  3PO2 H;  2MO0 A;  4C3J H;  1EQT A;  3I4M G;  3GTK B;  4X3T A;  1TWG H;  3K7A B;  3D3R A;  4RCO A;  3U4Z A;  1KLG D;  4LUO A;  4QJF A;  1CQV A;  3FKI B;  3HG9 A;  3BU2 A;  3L2P A;  3Q6S A;  2Q8T A;  4XT3 B;  4M1U B;  3TZU A;  2OTJ A;  2JA7 H;  1F9Q A;  1LT5 D;  1S5F D;  4JI5 L;  2LMC B;  5M5Y B;  2EY6 A;  1TWF H;  4GNX A;  4F8M A;  1JT8 A;  1QE6 A;  2GVB A;  4IPC A;  3T1H Q;  5GQO A;  3QO2 A;  3Q8D A;  1STB A;  4RHR A;  4JI6 L;  1TWH H;  2KED A;  3CCU A;  4G4K A;  4AH6 A;  2KQ3 A;  5CV5 A;  4YWK A;  1FL0 A;  2HQL A;  4C1N I;  4A3E H;  4AYB G;  5IGF A;  1Z7T A;  1FVI A;  3CU7 A;  4XXE A;  1HHV A;  1D7Q A;  2B8F A;  3STB C;  2KCN A;  4JBJ A;  4RH6 A;  2RDG A;  5D3D A;  4FF2 A;  1MJC A;  2QGQ A;  1VMC A;  4WOR A;  1EIY B;  2F0K A;  4F87 A;  4S3S A;  5JAV A;  1MGS A;  3E5S A;  1LAC A;  1X55 A;  4E6I A;  1HXY D;  3P20 A;  1IZ6 A;  1I6H B;  1CKM A;  2PI2 A;  4JI8 L;  1CKO A;  1B7Y B;  1M1K C;  3CC4 A;  3I91 A;  1LT6 D;  1O78 A;  1XTD A;  2R7F A;  5FJ8 G;  1R9T B;  4I65 A;  4MTN A;  4A3K H;  4G7Z C;  3TDQ A;  1SLJ A;  5LMN W;  2Y0S B;  4C3I H;  3H3V I;  1QB5 D;  3GTP H;  5CBE E;  1JOQ A;  1HZC A;  4NXN L;  2K5V A;  2P5Z X;  3AFQ A;  5IGG A;  3BDL A;  4K8J A;  3AMU A;  3VA5 A;  4DR1 L;  1B8A A;  2HHH Q;  2E2H B;  4IUV A;  4C2M H;  4GKJ L;  3I4N H;  1O7I A;  5C0X I;  3AFP A;  1SYE A;  4BBR B;  1VF7 A;  1EWI A;  1RDP D;  1UAP A;  4YWM A;  4AQY L;  4QL5 A;  1SFO B;  5GAD C;  1VDZ A;  4EVO A;  4DV4 Q;  3CCV A;  4GOP C;  1EZ6 A;  3CP0 A;  1V43 A;  4LFA Q;  5FO8 B;  3HP3 A;  4HSP A;  1XXG A;  4GLV B;  1G6Z A;  4LF8 L;  4K8I A;  3GTO B;  3PGZ A;  1PZK D;  1NUC A;  3FRP B;  1UUP A;  2JA8 B;  4A93 G;  2F0I A;  1UE6 A;  5JEA J;  2MHV A;  3TN2 A;  2WAQ B;  3DM1 A;  4A3D H;  4XT1 B;  3A0J A;  4G7O C;  5ISR A;  3KK7 A;  2YTY A;  1STY A;  1YHQ A;  2YU9 H;  4JI6 Q;  4OX9 L;  1D5X C;  1AW7 A;  5KYL A;  2UUC L;  5J39 A;  1IYV A;  4KJO A;  2RQX A;  3UDG A;  3NTK A;  3RN2 A;  2MO1 A;  1HUM A;  1WCM B;  3HKS A;  2A19 A;  2CVR A;  2F52 A;  4HIO A;  3MXG A;  3SHL A;  4DNT B;  2WB1 G;  2CW0 D;  4A3J B;  5IOC A;  4APV A;  3J7A V;  1BCP F;  1H9J A;  4HJA A;  1XPU A;  2R61 A;  2UU9 L;  4C3H H;  5HY6 A;  1PV4 A;  1U9R A;  5EAY A;  4IJH A;  5IGD A;  1SYG A;  1V8Q A;  3DWA A;  1ET9 A;  3S1N H;  5J3B A;  3G71 A;  1PRT D;  3URY A;  1VQ8 A;  5I9O A;  3RD4 A;  4ULL A;  4DKA C;  1LTG D;  2QEX A;  2R93 B;  2RHQ B;  1JIC A;  2ZTC A;  1VQD A;  1GO3 E;  4FVM A;  2RSO A;  2UXB Q;  3IFD A;  5LMN Q;  4K2K A;  1GUW A;  2B2T C;  3I4O A;  1DOM A;  1Q86 C;  3PUV A;  1XNR Q;  2JXM B;  5EJW A;  3MXN A;  4K14 A;  5BN4 A;  2D9U A;  1TWC B;  2UUA Q;  3A56 A;  4JI4 L;  4MTK A;  4DR3 L;  1I4X A;  4DK6 C;  1ML0 D;  3MZ5 A;  1EQR A;  1YHB A;  3K5O A;  3EN2 A;  3HOZ G;  5C44 G;  3HOY B;  2DN8 A;  1X6O A;  1EIH A;  1WI5 A;  2SDF A;  1V1O A;  4NXN Q;  5C4X B;  1QOH A;  1B44 D;  4B3T L;  2PNR C;  1X65 A;  3C1F A;  4LF5 L;  1YNN D;  4X62 L;  3DWP A;  1UEA B;  4JBW A;  3W2D A;  5EKI A;  4LF6 L;  4LW1 A;  1SNM A;  4GKJ Q;  3QOJ A;  1SYC A;  2PCF B;  4JCV E;  1E22 A;  3B6Y A;  3MVV A;  1WD1 A;  4JBM A;  3U9S A;  1LTT D;  3PUZ A;  5LL6 X;  4JV5 L;  4GLX A;  4H02 A;  4RFB A;  2NVT H;  1IYU A;  5IT9 c;  1X3G A;  1YNJ D;  3J7A 5;  1Z47 A;  4ZYS A;  1KIX A;  1X54 A;  3DM3 A;  4LF8 Q;  5JJL A;  2MGS A;  4KKT A;  1N36 L;  5IYC H;  2JA5 B;  3DEO A;  2VUM G;  3ULJ A;  2NVQ B;  5F2D A;  2IHF A;  3IAY A;  5HUR A;  3CXC A;  5CV6 A;  4JOI A;  2K50 A;  3CME A;  2SEB D;  1NE3 A;  4LAA A;  3BVZ A;  1SNP A;  1KTK A;  1Y8N B;  3GD7 A;  2Y0S E;  4GNX B;  3PO2 G;  3ZYY X;  4C3J G;  1A0I A;  1XJV A;  4FXD A;  5IE8 A;  3ERO A;  5EBC A;  4DAM A;  3CQZ B;  1QUQ A;  2IJ0 A;  3KLS X;  3BVG A;  5C5M A;  1QVF A;  2VQE L;  1EY6 A;  3BG3 A;  2PNH A;  1N8R C;  3J80 E;  2UU9 Q;  2JA7 G;  3CCJ A;  3J80 L;  4FP5 D;  5C3E H;  4FO2 A;  5DLQ E;  1WTX A;  3NK9 A;  1GOZ A;  2RCN A;  3S2H B;  1S5E D;  3J80 i;  3DEP A;  3EIV A;  3QR8 A;  2A69 D;  4GNX C;  1EY5 A;  3I4L A;  4A3I B;  3MWY W;  3EVQ A;  4YCW A;  4JYA L;  2XRS D;  2WAQ E;  3ER0 A;  1EY0 A;  3D4R A;  1ENF A;  2VQF L;  1NR4 A;  1I50 B;  2E5L L;  2TMP A;  5IY0 A;  5DM6 3;  2L55 A;  4KHZ A;  3WDN A;  4DR3 Q;  1C7Y A;  5D65 A;  1KAA A;  1Q12 A;  3R3O A;  1FYC A;  2OXP A;  3I90 A;  2I07 B;  5COY A;  3OIQ A;  4X62 Q;  3AYH B;  4NW2 A;  3CD6 A;  1PA6 A;  3CKI B;  5JJK A;  2QKI C;  1FJG L;  4DK1 A;  4K0K L;  3EQL C;  1HZA A;  4XDX A;  4HID A;  4JV5 Q;  1PTO F;  3CCS A;  4X6A H;  1MSH A;  5CMD A;  1L2F A;  2KA7 A;  2K6A A;  5T1G A;  1B9M A;  1IW7 D;  4UPA A;  5M3M H;  1YEZ A;  3J81 E;  4A3L H;  4DN4 M;  2BA1 A;  3J81 L;  3NP8 A;  2ES2 A;  4IJL A;  2A5H A;  1EYC A;  4DNR B;  2HIX A;  1RD9 D;  3GTQ H;  2ZXR A;  2VB2 X;  4J1M A;  3J81 i;  2J0T D;  3MXP A;  4C3I G;  2JK8 A;  4PV1 C;  2F3W A;  1SRO A;  1II3 A;  3UE1 A;  3RMH A;  3KF8 A;  1IL2 A;  3ZJY C;  2IWH A;  3FVQ A;  2ZM6 L;  4A3G G;  1I4R A;  3G7L A;  5FLX c;  2H1E A;  2PW7 A;  4P2C B;  4KKS A;  1L1O A;  2EYO A;  1KRT A;  5M5X H;  3L9A X;  2OF1 A;  4LF4 L;  3N6R A;  4NKL A;  2I0Q A;  3JC6 6;  3KOJ A;  2IX3 A;  3UDX A;  2CW0 C;  4H0L C;  1TQO A;  5ELN A;  1GKH A;  3OHX C;  1EYA A;  5E4X A;  1QVG A;  5HGQ A;  4A3M H;  4IN3 A;  4A3D G;  1B2T A;  3DHQ A;  1CI3 M;  1GXD C;  1V1Q A;  2AQ3 B;  2PW5 A;  2UXC L;  1PRT C;  1T5E A;  1LTR D;  4C1N K;  3C3L A;  1VQ6 A;  3PUY A;  3QG1 A;  2VQF Q;  5M3F H;  1A2T A;  4B9W A;  5GAH C;  4KV6 A;  4V0B A;  3L7Z C;  3QIA A;  1KDA A;  2RF4 A;  4OXP A;  3SDZ A;  2EY2 A;  3I2Z A;  1W6J A;  1AFP A;  4Y52 H;  2F0H A;  4GZY C;  3M4O B;  3PMF A;  1KNE A;  3MXN B;  4C3H G;  1LV9 A;  3HOU B;  1LO5 D;  2EYH A;  1JOK A;  4CHT B;  5JOB A;  3HFZ B;  5EGT A;  2A68 C;  1AP0 A;  2ATW A;  3K80 C;  1YNN C;  5K5P A;  5EKK A;  4JI0 Q;  1FGB D;  1LT3 D;  4L5Q A;  1A8V A;  2B29 A;  1RF2 D;  3HOW H;  1EY7 A;  4N8X 1;  3F2U A;  3I70 A;  1I94 L;  3RNU A;  2AQ1 B;  3K59 A;  3I7F A;  4OIK A;  1NMF A;  4IFD G;  2EJG C;  4ALP A;  2R7Z H;  1YNJ C;  1W2B A;  4JI2 L;  4KHP L;  1A6X A;  2L0C A;  1QCB D;  1Z6H A;  2HCC A;  2V1C C;  3L3O C;  1N33 L;  4FYD A;  4HMI A;  2F0E A;  1B3Q A;  2WB1 B;  1BOS A;  3IFT A;  2F0T A;  2PI2 E;  2QW7 A;  1Q3L A;  2KCT A;  5GAE C;  5G3L D;  4TKO B;  3RZD H;  5IP7 H;  4UHV A;  4YCV A;  1CTM A;  5I2X A;  2NN6 H;  3TP6 A;  4DU9 A;  4RGN A;  4LF4 Q;  3MXU A;  5C4J H;  2XWB B;  2OQK A;  3T1H L;  2IL8 A;  1QUQ B;  5IYC G;  5IGC A;  2BH2 A;  4H13 C;  1NSN S;  2BDN A;  3W3A A;  2FIN B;  4L6T B;  2MQH A;  1BBW A;  1X56 A;  2FHT A;  3EFX D;  4OWT B;  2PPB C;  1PLF A;  4LFC Q;  4JOI C;  4RG1 A;  4AYB E;  3BYT B;  1W6K A;  5IYB H;  5J22 A;  2A69 C;  2VZA A;  3NHH A;  3U9O A;  3VR6 A;  2B3G A;  3HKZ G;  2I5M X;  3PO3 B;  1RTN A;  1YIJ A;  1H9M A;  2K5D A;  4LUV A;  1F9P A;  4M8A A;  5C4H A;  1V1P A;  2HQE A;  1H9S A;  1WTH A;  3S2D B;  3EA6 A;  2XGT A;  4PZ6 A;  2F4V Q;  5M5W H;  4HED A;  5IP9 H;  5C3E G;  4O0A A;  1F2Z A;  3GV6 A;  5C0X J;  2B2V C;  5JPN C; 
#chains in the Genus database with same CATH homology
 4DR1 L;  4DR4 Q;  1B8A A;  1PH8 A;  2E2J H;  2HHH Q;  4C2M H;  3WWV A;  3I4N H;  4GKJ L;  1O7I A;  1JJG A;  3TEH B;  5IWA L;  3HOX G;  2IY5 B;  5C0X I;  4OX9 Q;  3AFP A;  2KCM A;  2WFW A;  3M9B A;  3ULP A;  3HKZ E;  4A3F G;  2UUC Q;  1EWI A;  2D62 A;  1HNZ L;  4B3M Q;  4YWM A;  1KAW A;  3F2D A;  3EBE A;  4QL5 A;  4AQY L;  2LXK A;  3S24 A;  5GAD C;  1EIF A;  5LMU L;  3BZK A;  3PIO A;  3I55 A;  3CCV A;  2E8G A;  3CP0 A;  2KHI A;  4DV0 L;  4DV4 Q;  4GOP C;  1V43 A;  4LFA Q;  1VQE A;  3K7U C;  3CC2 A;  3PCO B;  2ASB A;  2WAQ G;  4GLV B;  2A8V A;  4LF8 L;  5FJ8 H;  1UE5 A;  2R92 G;  3PGZ A;  2F4V L;  1UEB A;  2ZJR A;  4A93 G;  1IYJ B;  3G48 A;  3F2C A;  3RLF A;  3A74 A;  1UE6 A;  2WP8 J;  5JEA J;  1N33 Q;  2F3I A;  3FP9 A;  1YJW A;  4BY7 H;  3OTO Q;  4DR4 L;  2HHH L;  4A3D H;  2K14 A;  4YCU A;  3A0J A;  1VQJ A;  1XPO A;  2YTY A;  1YHQ A;  3SGI A;  2YU9 H;  4JI6 Q;  2NVY H;  1WCM G;  4HJ8 A;  4OX9 L;  1VQN A;  4J15 A;  1KQS A;  2UUC L;  2JA6 H;  2ZTE A;  2OCE A;  4UP7 A;  4DV3 Q;  1VQO A;  3UDG A;  4POF A;  3RN2 A;  2MO1 A;  4FDB A;  3L0O A;  3HOX H;  4DV4 L;  1Q1E A;  4DV7 L;  1SE8 A;  4A3J G;  3HKS A;  1Y1W H;  2A19 A;  4LFA L;  1ASZ A;  1PFS A;  2F52 A;  2Q2H A;  4GOP A;  4A3F H;  4HIO A;  1HNX L;  3M4O H;  3BJU A;  3KF8 B;  2PQA A;  2WB1 G;  1AE2 A;  1PH5 A;  2B63 H;  3HOU H;  1LYL A;  5M3M G;  4APV A;  4A3G H;  4X65 Q;  2NN6 I;  4JI3 L;  2CWP A;  4A3L G;  1DGS A;  1HJP A;  3OTO L;  1I5F A;  4HJA A;  4JI4 Q;  1L1O B;  1YI2 A;  2UU9 L;  1XPU A;  4IFD J;  4C3H H;  5HY6 A;  1ASY A;  1PV4 A;  1XMQ Q;  2UUB Q;  5EAY A;  4IJH A;  1YJN A;  4OO1 I;  4OWX B;  4RMF A;  3GTK H;  5FLM H;  3K7A H;  2R93 G;  3S1N H;  1TXY A;  3ULL A;  4GS3 A;  5J3B A;  3G71 A;  4IPG A;  5GAG C;  1VQ8 A;  3TS2 A;  2JEB I;  4HJ7 A;  3ICE A;  2ZTD A;  5ELO A;  1PHJ A;  4DKA C;  1OTC A;  2I5H A;  3FKI H;  4DUZ L;  2QEX A;  4B3T Q;  4LF5 Q;  3I4M H;  3PUW A;  2RHQ B;  2K5N A;  2FXQ A;  1VQD A;  2ZTC A;  1GO3 E;  3U4V A;  3U58 A;  3NBH B;  4JI7 Q;  4DR6 Q;  2I5L X;  4LF6 Q;  2UXB Q;  2ID0 A;  3CF5 A;  5LMN Q;  1A63 A;  4IOC A;  2XTI A;  3T1Y L;  4LFB Q;  4TQU S;  2WB1 E;  3I4O A;  4IO9 A;  3AQQ A;  1Q86 C;  3PUV A;  1PH4 A;  1XNR Q;  1RIP A;  1Y14 B;  1OXX K;  5M5Y H;  4X65 L;  2VY3 A;  2MFI A;  3NEN A;  1JJC B;  1YHA A;  2UUA Q;  4JI4 L;  2Q2U A;  1UWV A;  4DR3 L;  5C4X G;  1XMQ L;  2VL6 A;  4DK6 C;  1L1O C;  1EQR A;  4UP8 A;  1YHB A;  5IYD G;  4A3C G;  3CPW A;  3EN2 A;  3HOZ G;  5C44 G;  1QZG A;  1U5K A;  1X6O A;  4B3R Q;  2VNU D;  4YHH L;  1WI5 A;  1KHI A;  1K83 H;  3KDF A;  1N36 Q;  4NXN Q;  1PYB A;  1NY4 A;  1L0W A;  4B3T L;  1X65 A;  4DV6 L;  1IXR A;  4LF5 L;  1CSP A;  4X62 L;  1G6P A;  4BA1 I;  4JI7 L;  4DR6 L;  4JBW A;  4A3M G;  4GKJ Q;  2JQO A;  4LW1 A;  3W5O A;  3I56 A;  5IWA Q;  3DLL A;  5LMN L;  4QGU A;  1NJI C;  4JCV E;  1GVP A;  4P72 A;  1E22 A;  4QIW E;  3B6Y A;  4PG3 A;  4B3S L;  4JBM A;  4LFB L;  2JJQ A;  4GLA C;  1WOC A;  3PUZ A;  1XNR L;  3FHW A;  1HNZ Q;  1IBM L;  1NBW A;  1K73 C;  4JV5 L;  4GLX A;  2UUA L;  4H02 A;  1VS0 A;  2NVT H;  5IT9 c;  1X3G A;  5LMU Q;  2DGY A;  5M3F G;  3RLO A;  4DV0 Q;  4HJ5 A;  3J7A 5;  1Z47 A;  2E2I H;  3JAM i;  2JA5 G;  1EOV A;  1KIX A;  4BXX H;  1RL2 A;  1X54 A;  3DM3 A;  1SR3 A;  3W1G A;  3H0G G;  4LF8 Q;  5JJL A;  4X64 Q;  1VQA A;  2VQE Q;  1GD7 A;  1N36 L;  5IYC H;  3PSI A;  1QVC A;  1E1O A;  4R4C A;  2VUM G;  1CSQ A;  3ULJ A;  4DR7 Q;  2IHF A;  4GN4 B;  4WJ4 A;  3OYY A;  3RN5 A;  1J6Q A;  3CXC A;  3CCE A;  1Q7Y C;  4JOI A;  1I6H H;  2K50 A;  3E9H A;  1WFQ A;  3CME A;  2CKZ B;  1NE3 A;  2Z0S A;  1CUK A;  1S40 A;  1JB7 A;  5E7N A;  3PO3 H;  4GN5 A;  5C0X G;  2KEN A;  1PYS B;  3KLW A;  1A62 A;  1YBY A;  3J81 j;  3GD7 A;  2Y0S E;  1Y1V G;  4NB3 A;  4GNX B;  2Q2I A;  4P74 A;  1R9T H;  1T9H A;  4DV7 Q;  3PO2 G;  2JA8 G;  2JEA I;  1KL9 A;  1V9P A;  1A0I A;  1XJV A;  3STB D;  4HJ9 A;  5IE8 A;  4BBS G;  2OTL A;  3CMA A;  1HNX Q;  3S2D H;  4JYA Q;  1QUQ A;  3HOW G;  4X64 L;  2NVX H;  4GN3 B;  1Q8K A;  1QVF A;  2VQE L;  1OXT A;  1XPR A;  4P75 A;  1XNQ L;  2N49 A;  2E5L Q;  2GN5 A;  4DR7 L;  4JI3 Q;  2PNH A;  3KYH C;  1N8R C;  3KFU A;  4YWL A;  1CKN A;  2UU9 Q;  2E2H H;  2JA7 G;  2BH8 A;  3CCJ A;  4LF7 L;  3S15 H;  1M90 C;  2R7Z G;  3D0F A;  3K8A A;  5C3E H;  2C35 B;  4A3I G;  3RZO H;  5DLQ E;  4BBR H;  4DNI A;  2RCN A;  4EX5 A;  3BZC A;  4ME3 A;  3J80 i;  3F2B A;  2HIV A;  4DR2 Q;  3EIV A;  1I3Q H;  1HZ9 A;  1VQF A;  2D0P A;  1SFO H;  2YV5 A;  3J80 c;  2Q2T A;  1VQB A;  4DUZ Q;  3E9I A;  4GNX C;  1YNX A;  2ALY B;  1SN8 A;  2UXD L;  2EXD A;  4YCW A;  3H15 A;  4JYA L;  1Q82 C;  3HOV G;  3GTO H;  3TQY A;  2WAQ E;  2OWO A;  3TRZ A;  3ER0 A;  1NTG A;  1Y1V H;  3T1Y Q;  1FJG Q;  1U0L A;  3F1Z A;  2VQF L;  2JA8 H;  4K0K Q;  4R4I A;  3CW2 C;  5IY0 A;  2E5L L;  2Z6K C;  3MEF A;  3ERS X;  1VQP A;  5IP7 G;  2CCZ A;  1KC8 C;  2IX1 A;  4KHZ A;  1IBK L;  4IPD A;  1VQI A;  2R92 H;  1VQ5 A;  4DR3 Q;  2NN6 G;  1PH7 A;  1IBL L;  1PH6 A;  3IRB A;  1C7Y A;  4LNQ A;  4A93 H;  1Q12 A;  3G4S A;  4IFD I;  2RHS B;  4DPG A;  1Z9F A;  1Q81 C;  4OO1 G;  4YHH Q;  2YYZ A;  1KD1 C;  3CCR A;  4PZ7 A;  4DR2 L;  3VDY A;  4DV6 Q;  3KF6 B;  1KXL A;  1WCM H;  1UE1 A;  2N3S A;  4X62 Q;  1VQK A;  3GTG H;  3AYH B;  3CD6 A;  1PA6 A;  2CWA A;  1YJ9 A;  1SRU A;  1WYD A;  5JJK A;  1FJG L;  1HZB A;  4B3S Q;  4DV5 L;  4A3J H;  4DAY B;  4K0K L;  3HOY G;  1B70 B;  1HZA A;  3K0X A;  1IBM Q;  4HID A;  4JV5 Q;  1UE7 A;  1YVC A;  4NPS A;  1AE3 A;  2LXJ A;  3CCS A;  5IYB G;  4A3B G;  4X6A H;  1OXU A;  3K81 C;  3PV0 A;  4L5T A;  2ZM6 Q;  1L2F A;  1VQG A;  3TS0 A;  1PVO A;  2K52 A;  4UPA A;  1MIU A;  3A5Z B;  1YEZ A;  2EQS A;  5M3M H;  4KLK A;  4AIM A;  4A3L H;  3NEL A;  3GTM H;  2BA1 A;  2ES2 A;  4IJL A;  3PF4 A;  4GKK Q;  1TWA H;  2HIX A;  5K36 G;  2CQO A;  1GM5 A;  3GTQ H;  1VCI A;  1K3R A;  4LF9 L;  2R93 H;  3UDF A;  2AKW B;  1D8L A;  2JA9 A;  3CAM A;  3J81 i;  5JJI A;  1C0A A;  1WJJ A;  5BR8 Q;  2K75 A;  3J81 c;  2JK8 A;  1LTL A;  1VQM A;  3LGJ A;  4IOA A;  5IP9 G;  3CCQ A;  1SRO A;  3UE1 A;  3GDE A;  4JI1 Q;  1N9W A;  3GTL H;  1X9N A;  1YZ6 A;  1IL2 A;  3ZJY C;  1TWC H;  4R4T A;  1HH2 P;  2ZM6 L;  1EYG A;  4A3G G;  2ZJP A;  5FLX c;  2N8N A;  4MZ9 A;  2OQ0 A;  3S1R H;  2YTV A;  2K5H A;  4LWC A;  4DR5 L;  3HOY H;  2GVA A;  2UXC Q;  3JAM c;  4HIK A;  1L1O A;  1N32 L;  2AHO B;  1AH9 A;  2N78 A;  3U50 C;  1PH3 A;  1S72 A;  4A3B H;  4Y7N H;  1XNQ Q;  4QY7 A;  3E0E A;  5C4X H;  1KRT A;  4GKK L;  5M5X H;  4DUY Q;  4LF6 L;  2AWN A;  4A3C H;  5IYD H;  2MNA A;  4LF4 L;  5C44 H;  1W3S A;  3HOZ H;  2KBN A;  1HNW Q;  2I0Q A;  4LF7 Q;  3JC6 6;  3KOJ A;  5BR8 L;  2VS1 A;  3UDX A;  1J5E Q;  4GOP B;  4L5S A;  4XIG S;  4TVA B;  2PQA B;  1SMX A;  5GRO A;  5ELN A;  4JI1 L;  1E7Z A;  1E3P A;  1GKH A;  3RR5 A;  4BY7 G;  1QVG A;  1LUZ A;  5HGQ A;  4A3M H;  1YIT A;  2LSS A;  4BY1 G;  4A3D G;  4QQB X;  4R1J A;  4NXM Q;  5AJ3 L;  1V1Q A;  2UXD Q;  1K8A C;  2UXC L;  4DV1 L;  1H95 A;  3CCM A;  4POG A;  2JA6 G;  1VQ6 A;  4R4Q A;  4O2D A;  3PUY A;  2AWO A;  3M4P A;  2D0O A;  2VQF Q;  5M3F H;  2DUD A;  2NZO A;  3S14 H;  1BBU A;  5GAH C;  4DUY L;  1JJ2 A;  2JA5 H;  1BVS A;  4HIM A;  3F8T A;  1IBK Q;  3L7Z C;  1Y1W G;  2JE6 I;  2NVQ H;  4DV2 L;  2CFM A;  3H0G H;  2RF4 A;  4OXP A;  1HNW L;  1IBL Q;  3I2Z A;  1J5E L;  3CC7 A;  4OWW B;  3TRE A;  2B63 G;  3PUX A;  1I94 Q;  3HOU G;  1N34 Q;  1NMG A;  3S17 H;  2VUM H;  3H3V H;  4Y52 H;  1K0R A;  2IX0 A;  5H1S E;  5JEA G;  1K8G A;  4BA2 I;  4IPH A;  3MXN B;  4JI2 Q;  4KHP Q;  4NXM L;  1PH1 A;  1VQ9 A;  4JI5 Q;  3W1B A;  1HR0 L;  5FLM G;  2K4K A;  3GO5 A;  1X3E A;  3CQZ H;  2HT1 A;  3HFZ B;  2IT1 A;  4R4O A;  4KI0 A;  4BY1 H;  4L5R C;  4DV5 Q;  4A3E G;  3PO2 H;  2ATW A;  1E24 A;  3K80 C;  3M4Q A;  2MO0 A;  4C3J H;  3KDF B;  3I4M G;  4BBS H;  3FKI G;  1TWG H;  1EUJ A;  3UE0 A;  4JI0 Q;  2YTX A;  4L5Q A;  1A8V A;  2B29 A;  3U4Z A;  3HOW H;  1P8L A;  4YY3 Q;  1VQL A;  2R6G A;  4LUO A;  4QJF A;  4B3M L;  1HR0 W;  2R7D A;  3KJO A;  1PH9 A;  1I94 L;  3RNU A;  1N34 L;  4UP9 A;  3BU2 A;  2H5X A;  3L2P A;  3M85 A;  3PF5 A;  3S2H H;  3M7N A;  3M3Y H;  1XMO Q;  1K9M C;  3I7F A;  1NMF A;  4PZ8 A;  2JA7 H;  2OTJ A;  4IFD G;  1JE5 A;  4ALP A;  4XTC S;  2R7Z H;  4A4I A;  1W2B A;  4JI2 L;  4KHP L;  4DK3 C;  4LF9 Q;  1KRS A;  1G51 A;  4JI5 L;  4EQ5 A;  4A3I H;  1PH2 A;  4UY8 C;  3G6E A;  2BA0 A;  1TWF H;  4GNX A;  2V1C C;  1JMC A;  1N33 L;  1EQQ A;  1JT8 A;  2GVB A;  2EIF A;  4IPC A;  3T1H Q;  1E1T A;  1I50 H;  1S3O A;  5GQO A;  1EFW A;  3Q8D A;  4JI6 L;  2PI2 E;  1TWH H;  3CCU A;  4JI0 L;  2Z6K A;  4AH6 A;  1VQC A;  3HOV H;  1Q1B A;  4WJ3 M;  2KCT A;  4YWK A;  4YY3 L;  1FL0 A;  5GAE C;  3GTJ H;  2AMC B;  2HQL A;  4DV3 L;  1QZH A;  4JG2 A;  4A3E H;  3RZD H;  4DR5 Q;  2ZJQ A;  4AYB G;  4YCV A;  5IP7 H;  1N32 Q;  4LUZ A;  3PIP A;  1C9O A;  3AEV A;  1XMO L;  1FVI A;  4A75 A;  4JC0 A;  3D31 A;  3NEM A;  1OXS C;  4JI8 Q;  4LF4 Q;  1VQ4 A;  1D7Q A;  3STB C;  4A3K G;  5C4J H;  1BKB A;  4JBK A;  4BXX G;  3KJP A;  4JBJ A;  2OQK A;  2NZH A;  3T1H L;  4MNO A;  1QUQ B;  1MJC A;  5IYC G;  2UUB L;  2L15 A;  2QGQ A;  2BH2 A;  3S16 H;  2UXB L;  1EIY B;  1MKH A;  1BBW A;  2MQH A;  3I4N G;  3J7Z C;  1CKN B;  1X56 A;  5AJ3 Q;  4OWT B;  4X66 Q;  4LFC Q;  3A5U A;  4DV1 Q;  1X55 A;  3PO3 G;  4JOI C;  4RG1 A;  4AYB E;  3S1M H;  2PMZ E;  5IYB H;  4DR1 Q;  1VQH A;  1IZ6 A;  3OW2 A;  1CKM A;  2PI2 A;  2VZA A;  4A76 A;  2B3G A;  4JI8 L;  3HKZ G;  1CKO A;  2I5M X;  2QA4 A;  2IHE A;  4DV2 Q;  4OON A;  1FGU A;  1B7Y B;  1M1K C;  3CC4 A;  1XTD A;  2Y0S G;  2R7F A;  1X3F A;  5FJ8 G;  4AQY Q;  3CPF A;  3KF6 A;  1VQ7 A;  1G29 1;  1P16 A;  1YIJ A;  1LM0 A;  4MTN A;  4PMW A;  1MJE A;  4LUV A;  2A1A A;  4A3K H;  1OXV A;  3RLN A;  1SLJ A;  4P71 A;  5LMN W;  1Q46 A;  3S1Q H;  4B3R L;  4C3I H;  3H3V I;  3GTP H;  2XGT A;  4PZ6 A;  2F4V Q;  4P73 A;  1HZC A;  4NXN L;  2K5V A;  5IP9 H;  5M5W H;  5C3E G;  1HR0 Q;  3CCL A;  4X66 L;  4LFC L;  3UDI A;  2VW9 A;  3AFQ A;  4O0A A;  5C0X J;  2KHJ A;  4DAM A;  4BBR G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...