4R4QA

Crystal structure of rpa70n in complex with 5-(3-((n-(4-(5-carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
b'HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4qA00
4HIDA 3HOWH 2YYZA 4AIMA 1QVGA 3UDIA 4BBSH 4DK3C 4DR3Q 4GOPB 2UU9Q 5IP9H 3RZOH 2UXBL 2PQAA 3ERSX 1UE6A 2MO1A 4NPSA 3RLOA 2IX0A 2MO0A 1S3OA 3JC66 3KLWA 4LFCL 2NZOA 3FHWA 4HJ8A 2UUCL 4BA1I 1IZ6A 4FDBA 3PO3H 5C0XJ 3TQYA 4JCVE 4X64Q 3BU2A 5LMNQ 4DV0L 1LM0A 4DK6C 4A3FG 3PUXA 1YJ9A 2R92G 3B6YA 3I4MG 3H0GH 1OXXK 5M3MG 4A3BH 3Q8DA 4NXMQ 4AYBE 2MFIA 1MJEA 2NVQH 1HNWQ 1YJNA 2E5LL 3CCVA 2R93H 1T9HA 1N9WA 2KBNA 1L1OA 1QVCA 2N8NA 4MZ9A 2CWPA 3RLNA 1Z9FA 1XMQQ 1I94Q 4LF4L 4PMWA 4QJFA 4YCUA 4GLVB 1QVFA 1HZBA 1Q12A 4KI0A 3CQZH 4B3RL 1NE3A 4DR5Q 2D0PA 4DR2L 2K5NA 3S14H 1N33L 4O2DA 4HJAA 1NBWA 4IPGA 1HZAA 3UE0A 2VQEL 4IOCA 4A3EH 1XMOQ 1VQKA 3M3YH 2JEBI 2R7DA 4IPCA 2ALYB 1YITA 1PH7A 1YNXA 4A3IG 2AWOA 3F2DA 3UE1A 3U4ZA 3T1YQ 3RZDH 3UDFA 5IP7G 2GVBA 1VQOA 5C0XI 2YU9H 3PSIA 4AQYQ 3S2HH 3KDFA 1IBLQ 3E9HA 4JOIC 4UP9A 5IYDG 3F1ZA 4TQUS 2K14A 4X65Q 1J6QA 4A3LG 1VQ8A 1IBKL 4BA2I 3FP9A 3I7FA 2NN6I 2JA8H 2ID0A 4DV3L 1HR0Q 5FLXc 1DGSA 3CW2C 4JI2Q 1PVOA 4L5QA 2PI2A 2IX1A 4B3SQ 2OCEA 5FLMH 1PH4A 2YTVA 1PYBA 4GLAC 3FKIH 1SN8A 1X6OA 1QZHA 1VQAA 5EAYA 2D0OA 2XTIA 3I56A 1EFWA 1AE3A 2A1AA 4YWLA 2YV5A 1H95A 4DR3L 1XPRA 3CD6A 3HKSA 1K3RA 3EN2A 3CC2A 3M4OH 3AQQA 2HIXA 5JJKA 2Z6KA 1QZGA 2WAQG 1QUQB 3HOVH 1X3GA 1AH9A 3D31A 3RN5A 1X9NA 5K36G 2UXBQ 5LMNL 2QEXA 4A3MG 4YY3Q 2VS1A 2NVTH 3G4SA 1TWAH 1MIUA 4X62Q 4DAYB 5HGQA 1BBWA 2JK8A 4LFCQ 2Y0SE 4NXNQ 4OO1G 1SMXA 3HKZG 4BBRG 1N34Q 2UUCQ 4X66L 3CCUA 1SFOH 1L1OC 4IFDJ 4JI4L 1WI5A 4DV0Q 4OONA 4A93G 4UY8C 4JBMA 4LW1A 3A74A 3NENA 3S15H 2NVXH 4L5RC 4DR1Q 4A75A 5GADC 1TWFH 3RNUA 4O0AA 4P74A 3OYYA 2VNUD 3J80i 4QL5A 2K75A 4ME3A 5FJ8G 4DR5L 3S1MH 5M3FG 1BKBA 3AFPA 1A63A 5IT9c 1GM5A 2I0QA 2R7FA 1L1OB 4LF4Q 1VQGA 1BVSA 2AKWB 1E22A 3CC7A 4B3RQ 5IY0A 1CKOA 3HOXH 4JI8L 4DR2Q 5J3BA 4JI7L 5IYCH 1YJWA 3H15A 2VQEQ 1PH1A 1KAWA 4LUVA 1YVCA 2UXCL 3DM3A 1LTLA 4UPAA 1FL0A 2Z0SA 5JEAG 5HY6A 1HR0L 1EQQA 2AHOB 3G71A 2F3IA 1VCIA 4RG1A 3CP0A 3NELA 4IFDI 4GLXA 3PIOA 1UE1A 1Y1WG 2C35B 4JOIA 4L5TA 2CFMA 3AYHB 3IRBA 3KDFB 4GN3B 4HIMA 3AFQA 4EX5A 1IBML 3TEHB 2K4KA 1WCMH 2LXKA 3PUVA 2WB1G 3K0XA 4OWXB 1IYJB 1A62A 1HZCA 4A3GH 2VQFL 1QUQA 3S1QH 5LMUL 4Y52H 4QIWE 3RR5A 2IHFA 1KL9A 3G6EA 4JI6L 3GTMH 2JA6G 3PCOB 4BY7H 2B63G 1SLJA 3I4MH 4R4OA 1D7QA 4JYAQ 4H02A 1VQJA 4YY3L 3KJPA 4HJ7A 2KENA 1P8LA 4C3IH 4DAMA 4JI6Q 4X62L 4IJHA 3JAMc 4NXNL 4BXXG 3KF8B 3HOZG 1PHJA 1K83H 1X3EA 5C3EG 1N34L 3I4NH 3KFUA 3GTGH 4LUZA 3KOJA 3S16H 1CKNA 4BY1H 5JJIA 3F2CA 2CWAA 4LNQA 2KHJA 4OX9Q 2E2IH 4A3DG 2Q2TA 2EIFA 1D8LA 4DR1L 1CKMA 2VL6A 4DNIA 4R1JA 3J7ZC 3GO5A 3OTOL 1B8AA 1GO3E 2BA0A 4X66Q 4GN5A 3I55A 4JI4Q 1JB7A 4JBJA 2DUDA 3CPFA 3E9IA 1VQBA 1YZ6A 2VUMG 4JI3L 2OTJA 5C4XH 1YHAA 1X3FA 2JE6I 4Y7NH 3J81i 2EXDA 3L0OA 3UDXA 4A3JG 1M1KC 4LFBL 3PUWA 4DUZL 4A3KH 1SE8A 1Q7YC 4MNOA 3L7ZC 4DV7Q 3A0JA 2HHHL 3CMAA 1SROA 2N49A 3HOWG 1KRTA 4BBSG 1U0LA 5AJ3L 2JJQA 3GTPH 4DV5L 1UE7A 2AMCB 3CCRA 1EWIA 1J5EL 5IP9G 2WP8J 4HIOA 4JI8Q 2LSSA 4JI7Q 2UXCQ 3CCJA 4XTCS 1I6HH 2WFWA 2UUBQ 4JI0L 3S1RH 1VQ5A 2N78A 1PYSB 3PO3G 1AE2A 1EQRA 1XTDA 1XNQL 3H0GG 1K0RA 4DR4L 1ASZA 4DUYQ 3PO2H 4A3BG 1SR3A 4JI1L 3MEFA 1PA6A 1RIPA 1GD7A 1VQEA 3AEVA 4PG3A 4P73A 2R93G 1PH5A 1IBMQ 5JJLA 4B3ML 1EUJA 3H3VI 3J7A5 1WJJA 3W1BA 4OWWB 4JC0A 4LF5L 3W5OA 3RLFA 2JA7H 3G48A 1EOVA 4PZ8A 1VQHA 1FGUA 4DKAC 5C44H 1R9TH 2VQFQ 1A0IA 3UDGA 4JYAL 3F8TA 3OW2A 4GKJQ 2QA4A 2OTLA 1HH2P 5LMUQ 1EIYB 4HIKA 4KHPL 2WB1E 3CCMA 3J81c 2HQLA 1PFSA 1CSQA 1X55A 2F52A 2K50A 5GROA 5LMNW 4A3EG 1HNXQ 3ER0A 4GKKL 5H1SE 2RF4A 1FVIA 3PUZA 3GDEA 3GTLH 1CUKA 3K7AH 4PZ7A 5IWAQ 1VQ7A 2ZJRA 2E2HH 4YHHL 4OX9L 3STBC 4DR7L 1VQDA 4IPDA 5IYBH 3CCLA 1W2BA 4C2MH 2IHEA 3J81j 4LUOA 2ES2A 3I2ZA 1BBUA 1Y1VH 3KJOA 4C3JH 2JA8G 3H3VH 1Q8KA 3HOUG 3SGIA 1YBYA 2NZHA 2RHQB 1CKNB 3LGJA 2B3GA 2R7ZH 1JJGA 3ZJYC 2ZM6Q 3OTOQ 3EIVA 5FLMG 3S1NH 2GVAA 4DR6Q 3FKIG 4R4QA 4AYBG 1OXSC 4DV7L 3T1HL 1JMCA 2JA5H 3CCQA 4JI3Q 1XPUA 4A3CH 2PMZE 4KLKA 2IT1A 4POGA 1SRUA 3GD7A 2JQOA 1PH6A 1WYDA 3M4PA 2VY3A 5C4JH 4LFBQ 4AH6A 2ZTCA 1VQMA 5C0XG 4DUZQ 3M85A 1O7IA 1N36L 2HT1A 3TRZA 1LYLA 2YTXA 3HOVG 2HHHQ 2RHSB 3HOYH 1VQLA 3L2PA 3F2BA 2UUBL 5AJ3Q 1HR0W 4DV5Q 1NY4A 4GNXC 1J5EQ 1JE5A 4YCWA 1C0AA 2NN6G 1XNRL 1KRSA 5GQOA 1C9OA 4DUYL 3K8AA 4A4IA 3GTQH 4JI0Q 4PZ6A 4OXPA 1GKHA 3TS2A 3STBD 2RCNA 1XNQQ 4GNXB 3TS0A 4DR4Q 1JT8A 1HZ9A 1V43A 1VQ4A 1NMGA 4JI1Q 4ALPA 4J15A 1N32Q 4GKJL 4YWKA 4QGUA 4LF6L 4B3MQ 3J80c 2VW9A 1HNXL 5BR8L 4A3FH 2GN5A 4YCVA 4LF5Q 2D62A 3BZCA 3ULJA 1M90C 5M3MH 2R92H 1S72A 3PV0A 5IWAL 5GAEC 1VQIA 3TREA 3HOXG 4KHPQ 1YEZA 1U5KA 4JI5L 2KHIA 1TXYA 1VQNA 5IYCG 4WJ4A 1K8GA 1WOCA 2K5HA 4APVA 4GKKQ 2FXQA 4JBKA 2ZTDA 1HJPA 2I5LX 4TVAB 1G291 1KC8C 2WAQE 1A8VA 1UWVA 3D0FA 1PH9A 4YHHQ 1P16A 4DR7Q 3PIPA 4HJ9A 4IJLA 1E3PA 3E0EA 3KF6B 3K81C 1FJGQ 2ZM6L 1UEBA 1TWGH 3M7NA 2CCZA 3BZKA 3CCSA 3VDYA 2EQSA 2Y0SG 2YTYA 1VQFA 4DR6L 1Q1EA 4A3IH 3A5UA 3ICEA 5ELNA 1CSPA 1WCMG 4R4CA 3ULLA 4C3HH 3HKZE 2AWNA 5IP7H 4DV6L 4POFA 1Q81C 2VZAA 2BA1A 3M4QA 3S24A 1Q46A 4NB3A 5IYDH 4A3GG 1KIXA 4LF8L 1KHIA 4KHZA 4UP7A 5DLQE 4JV5L 4K0KL 4A3LH 1TWCH 2E2JH 3K80C 3T1HQ 2MQHA 1ASYA 4OWTB 1YHQA 1B70B 4R4IA 4P72A 4BY7G 2ZJPA 4LFAL 2CKZB 4OO1I 3CCEA 5E7NA 5JEAJ 1V9PA 1Q82C 3CC4A 4LF7L 2Q2HA 2N3SA 4DV2Q 1N36Q 4IFDG 1OXTA 3HFZB 1VQ9A 3WWVA 4IPHA 4LWCA 1HNZQ 3I4NG 1MJCA 4GN4B 1KD1C 3M9BA 4GNXA 1OTCA 4BY1G 4B3TL 1XNRQ 3S2DH 3DLLA 2UXDL 1L2FA 3CAMA 4X6AH 2ASBA 1E1TA 1UE5A 2QGQA 2R6GA 3CPWA 1X56A 3RN2A 1VQPA 1N32L 5M5WH 3PF5A 1C7YA 4DV4L 4JBWA 2BH8A 4IO9A 1VQCA 2PI2E 2UUAL 2V1CC 4L5SA 5GAGC 4A3MH 1VS0A 2OWOA 2XGTA 1VQ6A 5C4XG 4R4TA 4WJ3M 1I5FA 5M5YH 4DPGA 4BBRH 1YI2A 4LF6Q 4A3KG 3EBEA 3NBHB 2L15A 5BR8Q 4A93H 1LUZA 3HOUH 2K5VA 3NEMA 1Q86C 2PNHA 4LF9L 4QQBX 5ELOA 3KF6A 1E1OA 1S40A 4JI5Q 4DV1L 5FJ8H 1FJGL 2I5MX 2KCTA 1OXUA 4YWMA 1YIJA 2F4VQ 5M3FH 3K7UC 1NJIC 1JJCB 4GOPA 2IY5B 3CF5A 3PF4A 3GTKH 2I5HA 2UU9L 3I4OA 1Z47A 2B29A 3PO2G 4EQ5A 1V1QA 2CQOA 1GVPA 4RMFA 5IE8A 5M5XH 3CXCA 5GAHC 1Y14B 2E8GA 2ZTEA 4UP8A 4XIGS 1N8RC 4P75A 1X65A 3A5ZB 2DGYA 4X64L 3GTJH 1I50H 3PGZA 4DV6Q 1NMFA 1K9MC 2JA7G 1B7YB 2Q2IA 5C44G 4GS3A 2PQAB 1JJ2A 1Y1WH 2MNAA 2Q2UA 4NXML 4LF8Q 2JEAI 1HNWL 4JV5Q 4A76A 4K0KQ 4DV2L 1EIFA 1MKHA 2BH2A 2ATWA 4HJ5A 1HNZL 1XJVA 3U4VA 1XMQL 1YHBA 1I94L 1I3QH 4LFAQ 1K73C 4LF7Q 4P71A 3ULPA 2OQ0A 2E5LQ 2NVYH 3W1GA 2K52A 1NTGA 3KYHC 4JG2A 5IYBG 1Q1BA 1OXVA 1XMOL 1EYGA 2KCMA 1IXRA 1E24A 2B63H 2JA6H 1Y1VG 4B3TQ 1K8AC 2A8VA 3GTOH 4IOAA 1G51A 2UXDQ 3T1YL 3JAMi 2R7ZG 2JA9A 1L0WA 4AQYL 2A19A 4QY7A 1IBLL 1N33Q 4MTNA 4BXXH 1RL2A 1TWHH 1WFQA 4X65L 5C3EH 4DV4Q 1PH8A 1PH2A 3U58A 3HOZH 2OQKA 2UUAQ 1E7ZA 2JA5G 4A3CG 3S17H 2LXJA 2ZJQA 1IL2A 4A3DH 3PUYA 4JI2L 3CMEA 4B3SL 1IBKQ 1KXLA 1XPOA 3HOYG 3U50C 2F4VL 2H5XA 1X54A 3MXNB 4DV3Q 4GOPC 1PV4A 2VUMH 4LF9Q 1PH3A 1KQSA 3BJUA 2HIVA 4DV1Q 2Z6KC 4A3JH 1G6PA 1W3SA
chains in the Genus database with same CATH superfamily
3IKJA 3BG3A 2R61A 2AUKA 4AIMA 3OIQA 2XIWA 1RTOA 4DK0A 1HFNA 2TMPA 2F4IA 2F0DA 2PQAA 2WB1B 1G2TA 2MO1A 2MO0A 4LFCL 3FHWA 2RSNA 2NVYB 4K2LA 2F0SA 1Z7TA 3E6ZX 3D4RA 2F03A 1RHPA 3OIPA 3TQYA 4X64Q 5LMNQ 3GV6A 1SYFA 1ET6A 1YJ9A 3PUXA 3QOLA 3H0GH 5M3MG 2B2YA 3BDCA 2NVQH 4HSVA 4AYBE 2WACA 1EY6A 1NR2A 3CCVA 2R93H 1JICA 3EROA 4ZAIA 2A6HC 2KBNA 1QVCA 2B2TA 2E2DC 1I94Q 4YCUA 4N9PA 3H94A 4FP5D 1NE3A 3J80E 1LACA 2D0PA 4OELB 1N33L 1GUNA 3UE0A 1XMOQ 2NZ1D 4KKUA 1YNXA 1PRTC 3F2DA 3UE1A 3T1YQ 3MZ5A 5IP7G 4I65A 3BDOA 3KDFA 3AU7A 4RKLA 1G91A 5TSSA 1J6QA 2DN8A 2E74C 1TWGB 2QDLA 4KTAA 4A3IB 2EJGC 2PI2A 3F2UA 5FLMH 3DHQA 2YTVA 4GLAC 1QZHA 2L4NA 1SEBD 2L55A 1CA6A 1EFWA 1AE3A 2A1AA 2A69C 1D5XC 2EVBA 3CD6A 3MXPA 3S16B 3M4OH 3OHXC 1QUQB 4KN4C 1KLUD 3HOVH 2BCOA 2UXBQ 2NN6H 4A3MG 1PZKD 1MIUA 1RODA 2JK8A 4NXNQ 2K28A 4OO1G 3HKZG 4G7HC 2AQ2B 5IT9L 1SYBA 2RKSA 4ZQ3A 4A93G 1U4PA 4OONA 1SXTA 5EPLA 4UY8C 4LW1A 3G6JB 3NENA 1LT4D 1TVXA 2NVXH 4DR1Q 1K8OA 1S5FD 3S2HB 3J80i 5JAVA 3S1MH 4DR5L 1ONLA 2R3ZA 1A63A 5IT9c 1GM5A 1VQGA 1E22A 2PZWA 5IY0A 4ODGA 4OHJA 3HOXH 4IN3A 4DR2Q 2F0PA 4JI7L 1A3VA 5IYCH 3QB3A 1YJWA 2UXCL 1KAWA 1LTLA 1BUVT 5JEAG 2PW5A 2WV6D 2Z0SA 5HY6A 4IFDI 2AHOB 4HTHA 2F3IA 1VCIA 4RG1A 3CP0A 3NELA 4GLXA 3PIOA 1UE1A 5A2QE 4GN3B 4HIMA 4ZLTF 2RDFA 3TEHB 2K4KA 2NWGA 5FK9C 2RQXA 3AB9A 3TP6A 1WTPA 2WB1G 1PFNA 3K0XA 4TSSA 3OOCA 4C56C 1QUQA 1Y1WB 4QIWE 3A56A 1EWHA 2JA6G 2G9DA 2HCCA 4LJZC 1D7QA 4XQNA 4HJ7A 2KENA 4C3IH 4FO2A 1I3QB 4X62L 1S4ZA 4DNRB 4BXXG 3KF8B 4QB4A 5F2DA 1K83H 1PHJA 3HOZG 3I4NH 1PFMA 4LUZA 3F2CA 4OX9Q 3D6WA 4A3DG 1RF2D 2K04A 3GTOB 1D8LA 2F0WA 3J7ZC 3GO5A 1SNCA 2F0OA 1GO3E 2B2UC 4GN5A 1SYGA 3CPFA 1CHQD 2CH4W 3OWEB 1STAA 1EIGA 5JJZA 2FMMA 2EYMA 1D1IA 1EQVA 2EXDA 4LFBL 1TQOA 4DUZL 1JE4A 1SE8A 4DV7Q 2BOSA 2CW0C 2F0LA 1A2TA 1BR9A 3CMAA 1U0LA 3GTPH 1UE7A 2AMCB 5IP9G 2VUMB 2JP1A 4ZUIA 4R8NA 3P75A 4XTCS 4A3GB 1I6HH 2WFWA 2UUBQ 1DJRD 1PYSB 1AE2A 1STEA 1XNQL 1K0RA 1CT1D 4DUYQ 3PO2H 4A3BG 2HQEA 1PH5A 1IBMQ 4B3ML 1DOLA 1WJJA 1U9RA 4LF5L 2JA7H 1OTCA 1EOVA 1R9TH 5C44H 4DKAC 1SJHD 4JYAL 1CTMA 3H0GB 5G3LF 1EIYB 4HIKA 5A2QL 2NVQB 2HQLA 5IOCA 1PFSA 1CSQA 4JI6Q 5LMNW 3BDLA 3KBGA 4F87A 5H1SE 4O42A 3GDEA 3GTLH 4PZ7A 5IWAQ 4CDEC 2E2HH 1VQDA 3I90A 1EY7A 1W2BA 3J81j 2FJ2A 3E3XA 3TBIB 1EFID 1GHJA 1Y1VH 1HUMA 1S5DD 1LABA 2B3GA 3ZJYC 1AZPA 2ZM6Q 2RCFA 4DR6Q 4R4QA 4AYBG 3FMCA 1OXSC 3OPOA 1JMCA 1XPUA 2JA5H 3CCQA 4FXDA 2IT1A 1S5ED 1QNUA 2VY3A 5C4JH 4AH6A 2AQ3B 2F1MA 5C0XG 1EY4A 3SDZA 3M85A 2HT1A 1BCPC 5FLXE 1BBXC 2HHHQ 4K6LA 1VQLA 1F9RA 3HOYH 3L2PA 1GJXA 4HCEA 4YCWA 2DNEA 1C0AA 2ZXOA 1XNRL 1QOHA 3T4AC 1KRSA 1F2MA 1MSGA 3M4OB 1F2LA 1EEFD 2CH4A 2K6AA 3HOVB 2PO4A 2RCNA 3RUZA 4EQPA 3I4LA 4DR4Q 1V43A 2XNAC 4JI1Q 1QCBD 4C1NK 1N32Q 4GKJL 1BXTA 4EQNA 5T1GA 3GQBA 1TIID 4L63B 4CJ0B 2VW9A 1SE4A 2FFKB 4ID6A 3NHHA 1M90C 1U4LA 5M3MH 1C4QA 3PV0A 2F0NA 2NVXB 4I7ZC 3K5LA 3V05A 1TXYA 5CV9A 2OXPA 2DY7A 3S1MB 4JBKA 1KNAA 2I5LX 1D6EC 2WAQE 4BS9A 4YHHQ 1F9SA 1GUTA 3KF6B 3K81C 1W6KA 2D9UA 3M7NA 1B53A 3HOXB 1B44D 1VQFA 1Q1EA 3A5UA 5CV5A 1CSPA 4DV6L 5IP7H 2AWNA 5BN3A 4POFA 4FF3A 3M4QA 1ILPA 1Q46A 5CORA 4A3GG 1B50A 2WKDA 1KHIA 2E2JH 4JK1C 2Y0SB 5FKAC 1TT2A 1LV9A 2HDMA 1GUWA 5JEAJ 2K5DA 1LTGD 1N36Q 3HFZB 3A7AB 1VQ9A 1R4QB 4Z9CB 1TY0A 2KA7A 1HCZA 5FO9B 1SMYC 2A6EC 3A7LA 4BY1G 4HR7B 3S2DH 2R92B 3I3CA 2ASBA 1LTBD 1EYDA 1UE5A 2QGQA 4C3IB 1HRJA 1C7YA 1O7ZA 2BH8A 4IO9A 1VQCA 1K83B 3I4NB 2B39A 2V4DA 4A3MH 1VS0A 2XGTA 1VQ6A 1I5FA 5M5YH 4ZKCB 4OO1H 4IUPA 2PQEA 3NPPA 2JYOA 4A93H 2B2WC 1PXUA 1YNJC 1Q86C 3VYTA 1WVLA 4G57A 4LF9L 3VA5A 4QQBX 5ELOA 3KF6A 5LL6X 1S40A 3SEBA 1MGSA 2CHBD 1KDAA 2KCTA 2F4VQ 3DM1A 4YIJA 1GOZA 1V8QA 1CZWA 4B9WA 1V1QA 1YNND 1GVPA 5HGTA 1F9PA 1NAPA 5IE8A 5LHY1 3CXCA 1Y14B 2ZTEA 2F0QA 3T13A 1I6HB 2BDNA 5JEAH 3PGZA 1ZYRC 1NMFA 1B7YB 1JJ2A 4GS3A 3BVMA 2MNAA 1FNUA 3EFXD 5C4HA 1Q8IA 3PO2B 2AUJD 2BH2A 2ATWA 4IUNA 1HNZL 2F0MA 2K03A 3AMUA 3DUZA 4LFAQ 4LF7Q 2JA7B 2NVYH 3QJYA 1LTRD 3FEWX 5C44B 1R9TB 1NTGA 2X6GA 2JA6H 1IXRA 5FO7B 5FO8B 4B3TQ 3TN2A 1K8AC 4IOAA 1G51A 3JAMi 3GTLB 2JA9A 1L0WA 4AQYL 4QY7A 1N33Q 4F8MA 2VB2X 1B9MA 4BXXH 1PTOH 2E2HB 3HOZH 4X65L 2UUAQ 2EYOA 5J1ZA 4KHVA 2WIIB 4A3DH 1Y1VB 4JI2L 3P20A 4L6TB 1XPOA 5G3LD 1PV4A 1X3PA 3KLSA 2JA5B 3BVZA 3HGBA 1KQSA 1STGA 4NP5A 3JAML 5NUCA 5IGGA 2JSOA 5C4JB 5JVG3 4G7OC 2YYZA 4XXEA 1QVGA 3HOYB 2F3VA 1BOSA 4GOPB 2UU9Q 5IP9H 4CJ2C 4IZ8A 3A8JE 4IUTA 4NPSA 2IX0A 4HEDA 3TMEA 2EY1A 1IHZA 5C5LA 4I7AA 3IFTA 5C0XJ 3MWYW 4JCVE 4DV0L 4A3FG 3S16H 1LM0A 2VNUD 2R92G 5JJIA 1OXXK 4A3BH 1HNWQ 4NXMQ 2MFIA 1MJEA 1FGBD 5EBDA 1N9WA 1J9OA 1SNQA 2XVSA 4PMWA 4QJFA 5EKIA 3CQZH 5M3MB 2QKIC 4DR5Q 4HJAA 1SE2A 2VQEL 4IOCA 4IPCA 1YITA 2ALYB 1PH7A 4C3HG 3RZDH 1DZ1A 1VF5C 3S2HH 1HTPA 1IBLQ 4JOIC 4UP9A 2F0VA 3I8ZA 2WINB 2EYPA 4A3LG 4A3JB 1PFBA 1LTTD 3HOWB 4ZUJA 1PTOD 3CW2C 3NSWA 3WDNA 4B3SQ 1PLFA 3C46A 5I6YA 1B4OA 1X6OA 2D0OA 3FVQA 4YWLA 2E2JB 1U4RA 4DR3L 3HRZC 3CC2A 3AQQA 4B9XA 2Z6KA 5C0XH 1JR0D 2WAQG 4XYOA 1AH9A 3D31A 3RN5A 3U9SA 5K36G 1K3BC 2VS1A 2NVTH 1TWAH 4X62Q 2IL8A 4H44C 3S2DB 1K8MA 2F0JA 5E4WC 2UUCQ 1H9SA 3CCUA 1L1OC 3C1EA 3SE0A 1WI5A 1SYCA 2O4XA 4A3EB 4QMGA 5J39A 1SDFA 3BYTB 4L5RC 4A75A 5GADC 4A3MB 1TWFH 1RTNA 1EZ8A 4P74A 1QILA 2K75A 4ME3A 5M5YB 3HKZB 5M3FG 3HEJA 1SJED 4LF4Q 3QWNA 4A93B 1BVSA 2XSCA 4B3RQ 1CKOA 4JI8L 5J3BA 2EY6A 3H15A 1YVCA 2H4OA 3SK8A 1HR0L 3G71A 2C35B 1EZ6A 3AYHB 2EJMA 3KDFB 1SYDA 2K33A 1HPCA 2LXKA 2EJFC 5EGTA 1AFPA 2XRQD 2VXWA 3OMGA 1IYJB 4A3GH 2VQFL 3VYUA 4Y52H 2EOTA 3G6EA 2G9HD 1PDQA 1SLJA 1V1OA 3FDTA 4JYAQ 1ICWA 3CRLC 4DAMA 4PMCA 3BVGA 1N34L 3KFUA 1TS4A 5D14A 1ET9A 4ULLA 2JA6B 4BY1H 1H9JA 4DNIA 3OTOL 1B8AA 4X66Q 1TS3A 4JI4Q 1PTOB 3NE5B 1H9MA 3HOZB 4JI3L 3DMUA 3I72A 2OTJA 4MN3A 3I73A 4TRDA 3L0OA 4A3JG 4A3DB 3G7LA 1M1KC 1EY8A 3L7ZC 3HOWG 5KNDA 1KRTA 5AJ3L 2JJQA 4DV5L 3CCRA 1SBBB 1ZKOA 1J5EL 2WP8J 1JOKA 1WCMB 4FNFA 4HIOA 1DXMA 4R9WA 2LSSA 3CCJA 1TR5A 2D2CC 2CQAA 3S1RH 5ELFA 1VQ5A 1Z6HA 3PO3G 1EY9A 2KJXA 2XWJB 2XWBB 1B1ZA 1SR3A 1OO9B 5IGFA 3SK6A 1PA6A 1KDBA 1VQEA 4PG3A 4P73A 2C5CA 3QR8A 5C6AA 2F0IA 1EUJA 3W1BA 5EBCA 4OWWB 1TY2A 3GTGB 1XX8A 3G48A 4WJ3M 3UDGA 5JOBA 5A35A 4GKJQ 1WD1A 5LMUQ 4A3BB 4KHPL 4ZRZA 3CCMA 1X55A 2F52A 2K50A 5GROA 4A3EG 4GKKL 4FXGC 2RF4A 4DK1A 2BDOA 3QO2A 1VQ7A 3CQZB 4C2MH 1XTCD 3I2ZA 2JA8G 3H3VH 1HTLD 1JB3A 2KHSA 1YBYA 2NZHA 2M2LA 3NTIA 4HAEA 2LMCB 3RZDB 3S1NH 4KY5A 4DU9A 1EOTA 3PMFA 2PMZE 4KLKA 3GD7A 1PH6A 2ZTCA 5EPJA 1VQMA 2RHSB 4DXFA 3R8BA 4AYBB 4CKBA 1HQMC 5IIFA 2Q8IB 4A4IA 2B2VA 3J80L 4JI0Q 4OXPA 3STBD 4RHSA 3K0YA 3PIP3 2JN4A 1ML0D 4GNXB 3TS0A 1HZ9A 1VQ4A 3K7AB 2NVTB 1TWAB 2EXZA 4LF6L 1HA5A 1SSOA 3J80c 4A3FH 1ENAA 2R92H 2D62A 3BZCA 1S72A 1STBA 3M4YA 5I6WA 5GAEC 3ND8A 2R7ZB 1YEZA 4JI5L 2KHIA 1VQNA 1TWFB 4MIUA 4WJ4A 1WOCA 1FNWA 4K5WA 4TVAB 5FOBB 1KC8C 3NQTA 4GZYC 5KIXA 3ITPA 1P16A 4DR7Q 4IJLA 2F0UA 2EQSA 1D5MC 4KMUC 3TP7A 3SVMA 1WCMG 4C3HH 4K6DA 2VZAA 4NB3A 4KJOA 1KIXA 2OT2A 4LF8L 2N55A 2LFNA 4UP7A 5DLQE 4A3LH 4K0KL 1TWCH 3GTQB 2Q8TA 3K80C 4DGZA 3T1HQ 1BO0A 1AZQA 2ICEC 4BY7G 1B70B 4P72A 2ZJPA 3C2PA 2CKZB 5CV8A 5E7NA 4IFDG 1Q82C 1EIHA 3WWVA 4IPHA 5C3XA 1HNZQ 3A8IE 4GN4B 2BE5C 2IW3A 3K5MA 4GNXA 1YNNC 2RA4A 5JPNC 2UXDL 1IW7C 3CAMA 1GUSA 3NUCA 3CPWA 3RN2A 5M5WH 1IL8A 4DV4L 4U68A 5K36H 2V1CC 4L5SA 4DF7A 2OWOA 5C4XG 4BY1B 1DM0B 1L0YB 3MXUA 1YI2A 2EYFA 4A3KG 5BR8Q 3HOUH 1RJTA 4DNTB 1XWEA 5IODA 3CRKC 5CC4A 1M4VA 1CQVA 3K59A 3ZYYX 4KV6A 4DV1L 3R3OA 4RFBA 1YIJA 4YWMA 5M3FH 1NJIC 2IY5B 3PF4A 3I4OA 4QIWB 4K8IA 4H0LC 5K5PA 4RKBA 4RMFA 1KDCA 1K28A 1A6XA 1SE3A 4UP8A 5EQ0A 3NXWA 1N8RC 3S1RB 4JW0A 2K32A 1I50H 4X64L 1LTAD 3DXJC 2E75C 4DFAA 2B2YC 2NBFA 2Q2IA 3E5SA 3CU7A 2JEAI 3NTKA 4JV5Q 4A76A 1A2UA 3NTHA 5D3IB 3D8GA 4HJ5A 2B2TC 2SNMA 3K57A 4V190 1Q3LA 1I94L 4IURA 5CGKA 3QOJA 2K52A 4JG2A 4XT1B 1OXVA 1XMOL 1EYGA 2A74C 2PCFB 2A73B 4C3JG 2JXMB 3T1YL 3J81E 1QJOA 2C9OA 2R7ZG 3GP7A 4RCNA 1RL2A 1TWHH 2QF7A 2OQKA 4C2MB 1PTOF 4A3CG 3S17H 1VMCA 3PUYA 1J8IA 4PMBA 1Y8OB 5KYLA 3U50C 3FRPB 3S1NB 3MXNB 1PH3A 1A15A 4A3JH 1G6PA 2EYJA 3HOWH 3UDIA 4DK3C 3MEHA 1F9QA 5I4DA 3NWTA 4DR3Q 4DAYA 2UXBL 1UE6A 1EU4A 1S3OA 3JC66 2RDHA 5I9PA 1PTOC 3TZDA 4BA1I 1IZ6A 4FDBA 3PO3H 2PW7A 3BU2A 3B6YA 4J1MA 1PZID 3Q8DA 1G2SA 4RGMA 2E5LL 5T1IA 2RBMA 4F7XA 2CVRA 1L1OA 3RLNA 5C3EB 1Z9FA 1XMQQ 1D1KA 2ENBA 1V1PA 2EY2A 5BN4A 4A3FB 3I91A 4KI0A 4RCOA 2L1BA 5CMDA 2L0CA 2K5NA 4NDXA 4DR2L 3S14H 4O2DA 2EPBA 3CKIB 3TSSA 4A3EH 1VQKA 4BWGB 3M3YH 2R7DA 5FLXL 2ZXPA 2Q8RE 4UDUC 5ISRA 1F2ZA 1VQOA 2YU9H 3E9HA 4MTKA 3F1ZA 4ZKBB 3J7YW 1VQ8A 1IBKL 3MXNA 2SOBA 4J8QA 3FP9A 3I7FA 2EE1A 2NN6I 4DN4M 2JA8H 4DV3L 1HR0Q 5FLXc 4BBSB 2IX3A 1PRTB 3SK5A 1DGSA 1PVOA 1I4XA 2IX1A 4C3HB 2OCEA 1PH4A 1PYBA 3NBIA 1SN8A 1VQAA 2XTIA 3I56A 3P1HA 1TWCB 2YV5A 1H95A 3VA7A 1K3RA 3EN2A 2HIXA 1UEAB 4RA8A 5JJKA 1QG7A 3T56B 2I46A 1X3GA 5DAUA 5CR3A 4FF1A 4OIJA 1B3QA 1RKNA 1X9NA 2QEXA 3MFYA 3G4SA 4KJNA 2M9VA 4K14A 1BBWA 4LFCQ 3K6OA 4BBRG 1N34Q 1SFOH 4IFDJ 2WAQB 1RCVD 1E2ZA 3MA2B 5M5WB 4JBMA 4KD4A 1KABA 4QL5A 1GUOA 1EEID 3AFPA 2F3WA 2MJ8A 2I0QA 2R7FA 1II3A 4M8AA 2FHTA 3HOUB 4RHRA 1BF4A 3CC7A 4KD3A 3A55A 2F0TA 4LUVA 3T16A 5KYIA 1DYQA 4UPAA 2IJ0A 4K8JA 3URYA 5M3FB 5ELDA 2O5IC 4L5TA 2CFMA 3IRBA 1IBML 1WCMH 4RGOS 3PUVA 3R93A 1IYVA 1A62A 1I50B 1HZCA 5LL6S 3RR5A 1KL9A 2XN9C 4JI6L 3GTMH 4BY7H 1HFGA 2B63G 3I4MH 4HN7A 4YY3L 4IFDH 3S15B 4IJHA 1AP0A 1JOQA 4MHEA 3JAMc 4KN7C 1LTSD 1X3EA 1DCZA 3BZDB 5C3EG 2PNRC 3GTGH 3KOJA 1CKNA 1C8CA 2CWAA 3NK9A 4ZYSA 2E2IH 2A5HA 3EJIA 2VL6A 1H9KA 1JWUD 4LK1C 4CBVA 2BA0A 1LT5D 2B8GA 1H9SB 1JB7A 1PYWD 1TWHB 1G8ZD 2RSOA 1NCVA 2Z8LA 4S3SA 2IWHA 5C4XH 1YHAA 2PPBC 1X3FA 5C5MA 3S17B 2AQ1B 4A3KH 1Q7YC 3A0JA 2HHHL 2LY7A 2N49A 4ABNA 4BBSG 3QIAA 1EWCA 4CKEA 5I2XA 1HUNA 4K5VA 1X3QA 4RGTA 4JI7Q 4JVZA 2UXCQ 1KLGD 4HCSA 2QCPX 1HQRD 4H7BA 4IALA 3OWFA 2SNSA 4NW2A 1CFMA 1XTDA 2RDGA 2NYZD 4DR4L 1ASZA 1LT6D 4CHTB 4JI1L 3MEFA 5KGUA 2KVMA 1RIPA 3SK4A 1W6JA 5JJLA 1CA5A 1MHWC 2PZUA 3W5OA 3PO3B 4PZ8A 1FGUA 3MTSA 4XQJA 3F8TA 2QA4A 2OTLA 1HH2P 2WB1E 4XQQA 1FVIA 3PUZA 3FPUB 3K7AH 1Q90A 2ZJRA 1WTWA 2IPKD 4YHHL 5C3WA 3STBC 5CBEE 1L0XB 4WFN3 4K5XA 3VR3A 1Y8NB 3CCLA 2A68D 4Y7NB 2IHEA 3S14B 4RAUC 4LUOA 2ES2A 1BBUA 3KJOA 3HOUG 4C3JH 3M3YB 1DD2A 1MBYA 4ZK9B 3SGIA 2RHQB 3LGJA 2R7ZH 2HUGA 2YU9B 3VR5A 2KEDA 2B2UA 2MPMA 3FKIG 5CV7A 3X3MA 4A3CH 2ICIA 4NKLA 3A8KE 5CV4A 3NP8A 2JA8B 1SRUA 2JQOA 3DWPA 1WYDA 3M4PA 5IGCA 4LFBQ 4OIKA 4DUZQ 3SHLA 1N36L 4DA2A 3LX0A 3F2BA 1HR0W 3O13A 1JE5A 2KUMA 2F0FA 1Y8PB 2HD3A 2K1BA 2LS01 3GTQH 1BCPB 1GKHA 3TS2A 1QNKA 3H09A 3H3VC 2K05A 1XNQQ 1GUGA 5M9OA 1NMGA 1S5BD 4ALPA 3T53B 4YWKA 4QGUA 4V0BA 4B3MQ 1HNXL 4FYDA 2GN5A 1SFOB 4LF5Q 3ULJA 2Z1CA 3TREA 1GXDC 1U5KA 3LWUA 1K8GA 2K5HA 4APVA 1MD2D 2ZTDA 4CKCA 1G291 1DOMA 1VMPA 5EPKA 1EY5A 3D0FA 2L11A 3PIPA 4HJ9A 1E3PA 3E0EA 5IT9E 5CV6A 1UEBA 3LNNA 4EGVA 4G7ZC 1PRTF 2BA1A 3TP5A 3J7AV 4KHZA 1ENFA 2KCNA 1ASYA 1YHQA 4IUQA 3Q6SA 2D5DA 4LFAL 1EY0A 4OO1I 4QCLA 4LF7L 1V9PA 2Q2HA 4UHVA 2N88A 1AN8A 2DNCA 5EJWA 4WORA 3Q23A 1B3AA 3TP8A 3GTMB 4NMZA 4B3TL 4BY7B 1XNRQ 1T5EA 5EKLA 3DLLA 3I4MB 1L2FA 4X6AH 4RWSC 4FXKC 5DEHA 2OEOA 2R6GA 5C4ZA 1X56A 3W2DA 1VQPA 5EKKA 3S9WA 1SYEA 4CDFC 2UUAL 4G4KA 2K01A 4R4TA 1HHVA 1NNXA 2K7VA 4DPGA 4BBRH 2E2IB 3Q22A 4Q0FA 3MC0B 1A3UA 2L15A 1O78A 2K5VA 3NEMA 3N6RA 4CDDC 2NTSA 2J0TD 5C4XB 2M00A 1DONA 1FJGL 3IFDA 5ELCA 1I4PA 3K7UC 4A3KB 4J6HA 1I4QA 1CHPD 1F2YA 2I5HA 2UU9L 4EQ5A 1PZJD 3J7AF 3H91A 2P5ZX 2O2LD 1ICFB 5M5XH 2E76C 2E8GA 3D6CA 1XYIA 1IKLA 3A5ZB 4DV6Q 3GTJH 3ND9A 3KBXA 5KEEA 3WOEA 3OW7A 1HNWL 4NXML 1B9NA 5DM63 4N8FA 2K5WA 4DV2L 1MKHA 2XRSD 4WRDA 1SNOA 1XJVA 3VR4A 1K73C 1D2BA 2FINB 4P71A 2E5LQ 3GV3A 3W1GA 5IYBG 1BDOA 5I9OA 2B63H 4X3UA 2A8VA 4K2KA 4PV1C 1IBLL 4OL7A 4L8JA 2F0HA 4KK7A 1WFQA 5C3EH 3KUPA 1PH2A 3U58A 4UAIA 1EYCA 4RGNA 3GTKB 4C3JB 3MAQA 1G6ZA 1MSHA 2F0GA 4B3SL 1IBKQ 3HP3A 4FF4A 2H5XA 4DV3Q 4X3KA 4GOPC 2B2WA 4LF9Q 3L3OC 5ELBA 4XT3B 2HIVA 2Z6KC 3ONAB 4HIDA 1TS5A 3U9OA 4BBSH 5J22A 5E4XA 3RZOH 1ESFA 1AW7A 3ERSX 3RLOA 1MI2A 3KLWA 2NZOA 4P2CB 2I07B 1ZXTA 4HJ8A 1K0SA 2UUCL 4C1NI 2X6LA 5D3DA 3DWAA 3D4DA 2NTTA 1JJGA 3W3AA 4DK6C 3I4MG 3NWSA 2RVLA 3EVQA 1YJNA 1F77A 3RD4A 1UAPA 1T9HA 4QUFA 2N8NA 3BYYB 2CWPA 4MZ9A 4LAAA 4LF4L 4GLVB 1QVFA 1HZBA 1Q12A 3D3RA 4XYQA 4B3RL 2EYLA 4WJWA 1NBWA 2PMZB 4IPGA 1HZAA 1T5XD 5E1FA 2JEBI 4A3IG 1VF7A 2AWOA 2J4XA 3U4ZA 3UDFA 1WTHA 4U673 2GVBA 5C0XI 3PSIA 4AQYQ 4PQXA 5IYDG 4TQUS 5HURA 1SNMA 2K14A 4X65Q 1E2WA 2L9HA 1I4GA 4BA2I 3HS0C 2ID0A 5KNCA 1TS2A 1CZGA 4DAVA 4HSPA 4JI2Q 4L5QA 1E0BA 3ERQA 3FKIH 1B2TA 1IYUA 5EAYA 2HCIA 4QF4A 1C48A 1STYA 2A6HD 3HKSA 4HMJA 1XPRA 4CGYB 1U4MA 4JPBW 3KF8A 1QZGA 3BS1A 4M1UB 2R93B 1BCPF 2HDLA 2G5DA 2H1EA 1SNDA 5LMNL 4YY3Q 1NUCA 2OF1A 2TSSA 4DAYB 5HGQA 2Y0SE 1PRTD 1WD0A 1SMXA 2Z4IA 4X66L 2QILA 4JI4L 2K5QA 3PIO3 4DV0Q 3A74A 3EA6A 3S15H 3RNUA 4O0AA 3OYYA 5FJ8G 3IAYA 4N9TA 2Z4HA 1SNPA 4BBRB 1BKBA 1HXYD 1L1OB 2SEBD 2AKWB 1V1PB 1VDZA 2A69D 1KTKA 3K5NA 2VQEQ 1PH1A 3DM3A 1XXGA 4EQOA 1FL0A 2EYHA 1EQQA 3DEOA 3IL8A 5KRUA 3CHBD 3OSOA 4JOIA 1Y1WG 1S5CD 3AFQA 4EX5A 1CK1A 5M5XB 1DOKA 4OWXB 2ZT9C 3GTJB 5COYA 3S1QH 1FR3A 5LMUL 3K5OA 4XDXA 2DJFC 2IHFA 3PCOB 3A54A 4O1NA 4R4OA 4H02A 1VQJA 3KJPA 1P8LA 1WTQA 3MXGA 1KAAA 4NXNL 1QB5D 2KECA 2DY8A 2L12A 5E3FA 3I70A 3C1FA 4LNQA 1E2VA 2KHJA 2B63B 2Q2TA 2EIFA 4DR1L 1CKMA 1ZEQX 4R1JA 3VYRA 4H13C 5CBAE 1JORA 3I55A 2NUCA 2NB0A 4JBJA 2DUDA 4TKOB 3E9IA 1VQBA 1YZ6A 2VUMG 2VB3X 4EVOA 2JE6I 4X3SA 4Y7NH 1X32A 3J81i 3UDXA 2X69A 3PUWA 2F0EA 4MNOA 1SROA 1EWIA 1I4RA 2A68C 4JI8Q 1QE6A 4QUCA 2B2VC 4JI0L 2N78A 5AFWA 3D4WA 1EQRA 1SAPA 3H0GG 3WOFA 3RZOB 1IKMA 4KY7A 3J81L 1GD7A 3AEVA 2R93G 1FD7D 1EQTA 4Q5VA 3H3VI 3J7A5 1JQYD 3SR1A 4JC0A 4IUUA 3RLFA 3JAME 1VQHA 2F0KA 2VQFQ 1A0IA 3OW2A 3J81c 1HNXQ 3MHBA 3VR6A 3ER0A 4KY6A 2MUYA 3HZXA 3X3NA 4B08A 5JPMC 5IGDA 1CUKA 1D5ZC 2CW0D 1LTID 4OX9L 3KK7A 4DR7L 4IPDA 5IYBH 1STHA 5KNBA 2SDFA 5DM73 4HMIA 2WKCA 1ILQA 4FVMA 4OEMB 2GA4B 1Q8KA 3GTPB 2BE5D 1CKNB 3OTOQ 3NQIA 3EIVA 5FLMG 3T51B 2EY5A 1IW7D 2GVAA 5IGEA 4R8IA 4DV7L 1NSNS 3T1HL 4JI3Q 1BQQT 4CDCC 5D65A 4POGA 1O7IA 3V2TA 3TRZA 1LYLA 2YTXA 3HOVG 4KKTA 2UUBL 5AJ3Q 3KLRA 4DV5Q 3FKIB 5L37A 1NY4A 4GNXC 1J5EQ 3UI2A 2NN6G 1CM9A 5GQOA 1C9OA 1LT3D 1I6VC 3K8AA 4DUYL 3N52A 4PZ6A 3M7GA 1JOOA 1ESRA 1JT8A 1BNZA 3PQIA 4J15A 3R2IA 4OGQC 1WTXA 3RMHA 5BR8L 3DEPA 1WTRA 4YCVA 1JCKB 5IWAL 4IQZA 1VQIA 3HOXG 4KHPQ 1WTVA 5IYCG 1O7LA 1FNVA 4GKKQ 2FXQA 2QEJC 1HA6A 1BCPD 1HJPA 1WTOA 1PH9A 1A8VA 1UWVA 4LMQD 1FJGQ 3TZUA 2ZM6L 1TU2B 1TWGH 2CCZA 3BZKA 3CCSA 3VDYA 3V96A 4ME5A 1ENCA 2Y0SG 2YTYA 4DR6L 4A3IH 3VYSA 3ICEA 5ELNA 4R4CA 3ULLA 5I2YA 3HKZE 3MVVA 5CYUA 1Q81C 1RD9D 1NR4A 3S24A 5IYDH 1GHKA 3L9AX 4JV5L 4ILWA 1CI3M 2MQHA 4OWTB 4PNYA 1LLRD 4R4IA 1M8AA 2QDBA 3CCEA 3CC4A 4C3IG 3R2TA 2DJGC 2N3SA 4DV2Q 1OXTA 4LWCA 3I4NG 1MJCA 1JWSD 1RDPD 3S1QB 2FMCA 2LKVA 2Z9HA 3DWQA 1KD1C 2KQ3A 3M9BA 4IUVA 2EDGA 1E1TA 1N32L 4FF2A 4CJ1B 3PF5A 4JBWA 3QG1A 4X3TA 2PI2E 3K58A 3LWEA 1CQFA 5GAGC 3VR2A 2MHVA 1TKWB 1STNA 4LF6Q 1Y69U 3EBEA 3NBHB 1H9RA 1LUZA 1EYAA 4KKSA 2PNHA 1O7YA 5IGBA 1EU3A 1R4PB 4F88A 1E1OA 2J7ZA 4JI5Q 5FJ8H 3Q24A 2I5MX 1OXUA 3OMCA 2EZVA 1JJCB 4GOPA 3CF5A 3GTKH 3H6MA 1Z47A 2L5TA 2B29A 5JVH3 2KEEA 3PO2G 2CQOA 1SMYD 2A6ED 3FPPA 2KOLA 1LO5D 5GAHC 3HG9A 4XIGS 5DNFA 4P75A 1X65A 2DGYA 4N8X1 1JWMD 1K9MC 1I4HA 2KCCA 4E6IA 2JA7G 2ZXRA 5C44G 2Q2UA 3C3LA 2PQAB 1Y1WH 4LF8Q 3SXHA 4K0KQ 1EIFA 3P7JA 1O80A 3U4VA 1XMQL 1YHBA 1I3QH 2MGSA 2B8FA 2PZTA 4DXGA 2OQ0A 3ULPA 1KNEA 4ZCKA 1YNJD 3KYHC 5ELEA 1Q1BA 1PMRA 3KLSX 3E0JA 3MFGA 1UNSA 2KCMA 1E24A 3Q0AA 1Y1VG 3GTOH 2UXDQ 1JC7A 2A19A 3EQLC 4MTNA 3NBHA 1QWYA 1PH8A 1A3TA 4DV4Q 5BN5A 1E7ZA 2JA5G 1UUPA 2O5JC 2LXJA 2ZJQA 1IL2A 1EL0A 3CMEA 4RH6A 1ZYRD 2QW7A 1KXLA 3HOYG 1FYCA 2F4VL 1X54A 1AEXA 2PYKA 2VUMH 3TDQA 4DAPA 2Z6BA 2MP1A 3BJUA 4DV1Q 1W3SA
chains in the Genus database with same CATH topology
4HIDA 3HOWH 2YYZA 4AIMA 1QVGA 3UDIA 4BBSH 4DK3C 4DR3Q 4GOPB 2UU9Q 5IP9H 3RZOH 2UXBL 2PQAA 3ERSX 1UE6A 2MO1A 4NPSA 3RLOA 2IX0A 2MO0A 1S3OA 3JC66 3KLWA 4LFCL 2NZOA 3FHWA 4HJ8A 2UUCL 4BA1I 1IZ6A 4FDBA 3PO3H 5C0XJ 3TQYA 4JCVE 4X64Q 3BU2A 5LMNQ 4DV0L 1LM0A 4DK6C 4A3FG 3PUXA 1YJ9A 2R92G 3B6YA 3I4MG 3H0GH 1OXXK 5M3MG 4A3BH 3Q8DA 4NXMQ 4AYBE 2MFIA 1MJEA 2NVQH 1HNWQ 1YJNA 2E5LL 3CCVA 2R93H 1T9HA 1N9WA 2KBNA 1L1OA 1QVCA 2N8NA 4MZ9A 2CWPA 3RLNA 1Z9FA 1XMQQ 1I94Q 4LF4L 4PMWA 4QJFA 4YCUA 4GLVB 1QVFA 1HZBA 1Q12A 4KI0A 3CQZH 4B3RL 1NE3A 4DR5Q 2D0PA 4DR2L 2K5NA 3S14H 1N33L 4O2DA 4HJAA 1NBWA 4IPGA 1HZAA 3UE0A 2VQEL 4IOCA 4A3EH 1XMOQ 1VQKA 3M3YH 2JEBI 2R7DA 4IPCA 2ALYB 1YITA 1PH7A 1YNXA 4A3IG 2AWOA 3F2DA 3UE1A 3U4ZA 3T1YQ 3RZDH 3UDFA 5IP7G 2GVBA 1VQOA 5C0XI 2YU9H 3PSIA 4AQYQ 3S2HH 3KDFA 1IBLQ 3E9HA 4JOIC 4UP9A 5IYDG 3F1ZA 4TQUS 2K14A 4X65Q 1J6QA 4A3LG 1VQ8A 1IBKL 4BA2I 3FP9A 3I7FA 2NN6I 2JA8H 2ID0A 4DV3L 1HR0Q 5FLXc 1DGSA 3CW2C 4JI2Q 1PVOA 4L5QA 2PI2A 2IX1A 4B3SQ 2OCEA 5FLMH 1PH4A 2YTVA 1PYBA 4GLAC 3FKIH 1SN8A 1X6OA 1QZHA 1VQAA 5EAYA 2D0OA 2XTIA 3I56A 1EFWA 1AE3A 2A1AA 4YWLA 2YV5A 1H95A 4DR3L 1XPRA 3CD6A 3HKSA 1K3RA 3EN2A 3CC2A 3M4OH 3AQQA 2HIXA 5JJKA 2Z6KA 1QZGA 2WAQG 1QUQB 3HOVH 1X3GA 1AH9A 3D31A 3RN5A 1X9NA 5K36G 2UXBQ 5LMNL 2QEXA 4A3MG 4YY3Q 2VS1A 2NVTH 3G4SA 1TWAH 1MIUA 4X62Q 4DAYB 5HGQA 1BBWA 2JK8A 4LFCQ 2Y0SE 4NXNQ 4OO1G 1SMXA 3HKZG 4BBRG 1N34Q 2UUCQ 4X66L 3CCUA 1SFOH 1L1OC 4IFDJ 4JI4L 1WI5A 4DV0Q 4OONA 4A93G 4UY8C 4JBMA 4LW1A 3A74A 3NENA 3S15H 2NVXH 4L5RC 4DR1Q 4A75A 5GADC 1TWFH 3RNUA 4O0AA 4P74A 3OYYA 2VNUD 3J80i 4QL5A 2K75A 4ME3A 5FJ8G 4DR5L 3S1MH 5M3FG 1BKBA 3AFPA 1A63A 5IT9c 1GM5A 2I0QA 2R7FA 1L1OB 4LF4Q 1VQGA 1BVSA 2AKWB 1E22A 3CC7A 4B3RQ 5IY0A 1CKOA 3HOXH 4JI8L 4DR2Q 5J3BA 4JI7L 5IYCH 1YJWA 3H15A 2VQEQ 1PH1A 1KAWA 4LUVA 1YVCA 2UXCL 3DM3A 1LTLA 4UPAA 1FL0A 2Z0SA 5JEAG 5HY6A 1HR0L 1EQQA 2AHOB 3G71A 2F3IA 1VCIA 4RG1A 3CP0A 3NELA 4IFDI 4GLXA 3PIOA 1UE1A 1Y1WG 2C35B 4JOIA 4L5TA 2CFMA 3AYHB 3IRBA 3KDFB 4GN3B 4HIMA 3AFQA 4EX5A 1IBML 3TEHB 2K4KA 1WCMH 2LXKA 3PUVA 2WB1G 3K0XA 4OWXB 1IYJB 1A62A 1HZCA 4A3GH 2VQFL 1QUQA 3S1QH 5LMUL 4Y52H 4QIWE 3RR5A 2IHFA 1KL9A 3G6EA 4JI6L 3GTMH 2JA6G 3PCOB 4BY7H 2B63G 1SLJA 3I4MH 4R4OA 1D7QA 4JYAQ 4H02A 1VQJA 4YY3L 3KJPA 4HJ7A 2KENA 1P8LA 4C3IH 4DAMA 4JI6Q 4X62L 4IJHA 3JAMc 4NXNL 4BXXG 3KF8B 3HOZG 1PHJA 1K83H 1X3EA 5C3EG 1N34L 3I4NH 3KFUA 3GTGH 4LUZA 3KOJA 3S16H 1CKNA 4BY1H 5JJIA 3F2CA 2CWAA 4LNQA 2KHJA 4OX9Q 2E2IH 4A3DG 2Q2TA 2EIFA 1D8LA 4DR1L 1CKMA 2VL6A 4DNIA 4R1JA 3J7ZC 3GO5A 3OTOL 1B8AA 1GO3E 2BA0A 4X66Q 4GN5A 3I55A 4JI4Q 1JB7A 4JBJA 2DUDA 3CPFA 3E9IA 1VQBA 1YZ6A 2VUMG 4JI3L 2OTJA 5C4XH 1YHAA 1X3FA 2JE6I 4Y7NH 3J81i 2EXDA 3L0OA 3UDXA 4A3JG 1M1KC 4LFBL 3PUWA 4DUZL 4A3KH 1SE8A 1Q7YC 4MNOA 3L7ZC 4DV7Q 3A0JA 2HHHL 3CMAA 1SROA 2N49A 3HOWG 1KRTA 4BBSG 1U0LA 5AJ3L 2JJQA 3GTPH 4DV5L 1UE7A 2AMCB 3CCRA 1EWIA 1J5EL 5IP9G 2WP8J 4HIOA 4JI8Q 2LSSA 4JI7Q 2UXCQ 3CCJA 4XTCS 1I6HH 2WFWA 2UUBQ 4JI0L 3S1RH 1VQ5A 2N78A 1PYSB 3PO3G 1AE2A 1EQRA 1XTDA 1XNQL 3H0GG 1K0RA 4DR4L 1ASZA 4DUYQ 3PO2H 4A3BG 1SR3A 4JI1L 3MEFA 1PA6A 1RIPA 1GD7A 1VQEA 3AEVA 4PG3A 4P73A 2R93G 1PH5A 1IBMQ 5JJLA 4B3ML 1EUJA 3H3VI 3J7A5 1WJJA 3W1BA 4OWWB 4JC0A 4LF5L 3W5OA 3RLFA 2JA7H 3G48A 1EOVA 4PZ8A 1VQHA 1FGUA 4DKAC 5C44H 1R9TH 2VQFQ 1A0IA 3UDGA 4JYAL 3F8TA 3OW2A 4GKJQ 2QA4A 2OTLA 1HH2P 5LMUQ 1EIYB 4HIKA 4KHPL 2WB1E 3CCMA 3J81c 2HQLA 1PFSA 1CSQA 1X55A 2F52A 2K50A 5GROA 5LMNW 4A3EG 1HNXQ 3ER0A 4GKKL 5H1SE 2RF4A 1FVIA 3PUZA 3GDEA 3GTLH 1CUKA 3K7AH 4PZ7A 5IWAQ 1VQ7A 2ZJRA 2E2HH 4YHHL 4OX9L 3STBC 4DR7L 1VQDA 4IPDA 5IYBH 3CCLA 1W2BA 4C2MH 2IHEA 3J81j 4LUOA 2ES2A 3I2ZA 1BBUA 1Y1VH 3KJOA 4C3JH 2JA8G 3H3VH 1Q8KA 3HOUG 3SGIA 1YBYA 2NZHA 2RHQB 1CKNB 3LGJA 2B3GA 2R7ZH 1JJGA 3ZJYC 2ZM6Q 3OTOQ 3EIVA 5FLMG 3S1NH 2GVAA 4DR6Q 3FKIG 4R4QA 4AYBG 1OXSC 4DV7L 3T1HL 1JMCA 2JA5H 3CCQA 4JI3Q 1XPUA 4A3CH 2PMZE 4KLKA 2IT1A 4POGA 1SRUA 3GD7A 2JQOA 1PH6A 1WYDA 3M4PA 2VY3A 5C4JH 4LFBQ 4AH6A 2ZTCA 1VQMA 5C0XG 4DUZQ 3M85A 1O7IA 1N36L 2HT1A 3TRZA 1LYLA 2YTXA 3HOVG 2HHHQ 2RHSB 3HOYH 1VQLA 3L2PA 3F2BA 2UUBL 5AJ3Q 1HR0W 4DV5Q 1NY4A 4GNXC 1J5EQ 1JE5A 4YCWA 1C0AA 2NN6G 1XNRL 1KRSA 5GQOA 1C9OA 4DUYL 3K8AA 4A4IA 3GTQH 4JI0Q 4PZ6A 4OXPA 1GKHA 3TS2A 3STBD 2RCNA 1XNQQ 4GNXB 3TS0A 4DR4Q 1JT8A 1HZ9A 1V43A 1VQ4A 1NMGA 4JI1Q 4ALPA 4J15A 1N32Q 4GKJL 4YWKA 4QGUA 4LF6L 4B3MQ 3J80c 2VW9A 1HNXL 5BR8L 4A3FH 2GN5A 4YCVA 4LF5Q 2D62A 3BZCA 3ULJA 1M90C 5M3MH 2R92H 1S72A 3PV0A 5IWAL 5GAEC 1VQIA 3TREA 3HOXG 4KHPQ 1YEZA 1U5KA 4JI5L 2KHIA 1TXYA 1VQNA 5IYCG 4WJ4A 1K8GA 1WOCA 2K5HA 4APVA 4GKKQ 2FXQA 4JBKA 2ZTDA 1HJPA 2I5LX 4TVAB 1G291 1KC8C 2WAQE 1A8VA 1UWVA 3D0FA 1PH9A 4YHHQ 1P16A 4DR7Q 3PIPA 4HJ9A 4IJLA 1E3PA 3E0EA 3KF6B 3K81C 1FJGQ 2ZM6L 1UEBA 1TWGH 3M7NA 2CCZA 3BZKA 3CCSA 3VDYA 2EQSA 2Y0SG 2YTYA 1VQFA 4DR6L 1Q1EA 4A3IH 3A5UA 3ICEA 5ELNA 1CSPA 1WCMG 4R4CA 3ULLA 4C3HH 3HKZE 2AWNA 5IP7H 4DV6L 4POFA 1Q81C 2VZAA 2BA1A 3M4QA 3S24A 1Q46A 4NB3A 5IYDH 4A3GG 1KIXA 4LF8L 1KHIA 4KHZA 4UP7A 5DLQE 4JV5L 4K0KL 4A3LH 1TWCH 2E2JH 3K80C 3T1HQ 2MQHA 1ASYA 4OWTB 1YHQA 1B70B 4R4IA 4P72A 4BY7G 2ZJPA 4LFAL 2CKZB 4OO1I 3CCEA 5E7NA 5JEAJ 1V9PA 1Q82C 3CC4A 4LF7L 2Q2HA 2N3SA 4DV2Q 1N36Q 4IFDG 1OXTA 3HFZB 1VQ9A 3WWVA 4IPHA 4LWCA 1HNZQ 3I4NG 1MJCA 4GN4B 1KD1C 3M9BA 4GNXA 1OTCA 4BY1G 4B3TL 1XNRQ 3S2DH 3DLLA 2UXDL 1L2FA 3CAMA 4X6AH 2ASBA 1E1TA 1UE5A 2QGQA 2R6GA 3CPWA 1X56A 3RN2A 1VQPA 1N32L 5M5WH 3PF5A 1C7YA 4DV4L 4JBWA 2BH8A 4IO9A 1VQCA 2PI2E 2UUAL 2V1CC 4L5SA 5GAGC 4A3MH 1VS0A 2OWOA 2XGTA 1VQ6A 5C4XG 4R4TA 4WJ3M 1I5FA 5M5YH 4DPGA 4BBRH 1YI2A 4LF6Q 4A3KG 3EBEA 3NBHB 2L15A 5BR8Q 4A93H 1LUZA 3HOUH 2K5VA 3NEMA 1Q86C 2PNHA 4LF9L 4QQBX 5ELOA 3KF6A 1E1OA 1S40A 4JI5Q 4DV1L 5FJ8H 1FJGL 2I5MX 2KCTA 1OXUA 4YWMA 1YIJA 2F4VQ 5M3FH 3K7UC 1NJIC 1JJCB 4GOPA 2IY5B 3CF5A 3PF4A 3GTKH 2I5HA 2UU9L 3I4OA 1Z47A 2B29A 3PO2G 4EQ5A 1V1QA 2CQOA 1GVPA 4RMFA 5IE8A 5M5XH 3CXCA 5GAHC 1Y14B 2E8GA 2ZTEA 4UP8A 4XIGS 1N8RC 4P75A 1X65A 3A5ZB 2DGYA 4X64L 3GTJH 1I50H 3PGZA 4DV6Q 1NMFA 1K9MC 2JA7G 1B7YB 2Q2IA 5C44G 4GS3A 2PQAB 1JJ2A 1Y1WH 2MNAA 2Q2UA 4NXML 4LF8Q 2JEAI 1HNWL 4JV5Q 4A76A 4K0KQ 4DV2L 1EIFA 1MKHA 2BH2A 2ATWA 4HJ5A 1HNZL 1XJVA 3U4VA 1XMQL 1YHBA 1I94L 1I3QH 4LFAQ 1K73C 4LF7Q 4P71A 3ULPA 2OQ0A 2E5LQ 2NVYH 3W1GA 2K52A 1NTGA 3KYHC 4JG2A 5IYBG 1Q1BA 1OXVA 1XMOL 1EYGA 2KCMA 1IXRA 1E24A 2B63H 2JA6H 1Y1VG 4B3TQ 1K8AC 2A8VA 3GTOH 4IOAA 1G51A 2UXDQ 3T1YL 3JAMi 2R7ZG 2JA9A 1L0WA 4AQYL 2A19A 4QY7A 1IBLL 1N33Q 4MTNA 4BXXH 1RL2A 1TWHH 1WFQA 4X65L 5C3EH 4DV4Q 1PH8A 1PH2A 3U58A 3HOZH 2OQKA 2UUAQ 1E7ZA 2JA5G 4A3CG 3S17H 2LXJA 2ZJQA 1IL2A 4A3DH 3PUYA 4JI2L 3CMEA 4B3SL 1IBKQ 1KXLA 1XPOA 3HOYG 3U50C 2F4VL 2H5XA 1X54A 3MXNB 4DV3Q 4GOPC 1PV4A 2VUMH 4LF9Q 1PH3A 1KQSA 3BJUA 2HIVA 4DV1Q 2Z6KC 4A3JH 1G6PA 1W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HID A;  3HOW H;  2YYZ A;  4AIM A;  1QVG A;  3UDI A;  4BBS H;  4DK3 C;  4DR3 Q;  4GOP B;  2UU9 Q;  5IP9 H;  3RZO H;  2UXB L;  2PQA A;  3ERS X;  1UE6 A;  2MO1 A;  4NPS A;  3RLO A;  2IX0 A;  2MO0 A;  1S3O A;  3JC6 6;  3KLW A;  4LFC L;  2NZO A;  3FHW A;  4HJ8 A;  2UUC L;  4BA1 I;  1IZ6 A;  4FDB A;  3PO3 H;  5C0X J;  3TQY A;  4JCV E;  4X64 Q;  3BU2 A;  5LMN Q;  4DV0 L;  1LM0 A;  4DK6 C;  4A3F G;  3PUX A;  1YJ9 A;  2R92 G;  3B6Y A;  3I4M G;  3H0G H;  1OXX K;  5M3M G;  4A3B H;  3Q8D A;  4NXM Q;  4AYB E;  2MFI A;  1MJE A;  2NVQ H;  1HNW Q;  1YJN A;  2E5L L;  3CCV A;  2R93 H;  1T9H A;  1N9W A;  2KBN A;  1L1O A;  1QVC A;  2N8N A;  4MZ9 A;  2CWP A;  3RLN A;  1Z9F A;  1XMQ Q;  1I94 Q;  4LF4 L;  4PMW A;  4QJF A;  4YCU A;  4GLV B;  1QVF A;  1HZB A;  1Q12 A;  4KI0 A;  3CQZ H;  4B3R L;  1NE3 A;  4DR5 Q;  2D0P A;  4DR2 L;  2K5N A;  3S14 H;  1N33 L;  4O2D A;  4HJA A;  1NBW A;  4IPG A;  1HZA A;  3UE0 A;  2VQE L;  4IOC A;  4A3E H;  1XMO Q;  1VQK A;  3M3Y H;  2JEB I;  2R7D A;  4IPC A;  2ALY B;  1YIT A;  1PH7 A;  1YNX A;  4A3I G;  2AWO A;  3F2D A;  3UE1 A;  3U4Z A;  3T1Y Q;  3RZD H;  3UDF A;  5IP7 G;  2GVB A;  1VQO A;  5C0X I;  2YU9 H;  3PSI A;  4AQY Q;  3S2H H;  3KDF A;  1IBL Q;  3E9H A;  4JOI C;  4UP9 A;  5IYD G;  3F1Z A;  4TQU S;  2K14 A;  4X65 Q;  1J6Q A;  4A3L G;  1VQ8 A;  1IBK L;  4BA2 I;  3FP9 A;  3I7F A;  2NN6 I;  2JA8 H;  2ID0 A;  4DV3 L;  1HR0 Q;  5FLX c;  1DGS A;  3CW2 C;  4JI2 Q;  1PVO A;  4L5Q A;  2PI2 A;  2IX1 A;  4B3S Q;  2OCE A;  5FLM H;  1PH4 A;  2YTV A;  1PYB A;  4GLA C;  3FKI H;  1SN8 A;  1X6O A;  1QZH A;  1VQA A;  5EAY A;  2D0O A;  2XTI A;  3I56 A;  1EFW A;  1AE3 A;  2A1A A;  4YWL A;  2YV5 A;  1H95 A;  4DR3 L;  1XPR A;  3CD6 A;  3HKS A;  1K3R A;  3EN2 A;  3CC2 A;  3M4O H;  3AQQ A;  2HIX A;  5JJK A;  2Z6K A;  1QZG A;  2WAQ G;  1QUQ B;  3HOV H;  1X3G A;  1AH9 A;  3D31 A;  3RN5 A;  1X9N A;  5K36 G;  2UXB Q;  5LMN L;  2QEX A;  4A3M G;  4YY3 Q;  2VS1 A;  2NVT H;  3G4S A;  1TWA H;  1MIU A;  4X62 Q;  4DAY B;  5HGQ A;  1BBW A;  2JK8 A;  4LFC Q;  2Y0S E;  4NXN Q;  4OO1 G;  1SMX A;  3HKZ G;  4BBR G;  1N34 Q;  2UUC Q;  4X66 L;  3CCU A;  1SFO H;  1L1O C;  4IFD J;  4JI4 L;  1WI5 A;  4DV0 Q;  4OON A;  4A93 G;  4UY8 C;  4JBM A;  4LW1 A;  3A74 A;  3NEN A;  3S15 H;  2NVX H;  4L5R C;  4DR1 Q;  4A75 A;  5GAD C;  1TWF H;  3RNU A;  4O0A A;  4P74 A;  3OYY A;  2VNU D;  3J80 i;  4QL5 A;  2K75 A;  4ME3 A;  5FJ8 G;  4DR5 L;  3S1M H;  5M3F G;  1BKB A;  3AFP A;  1A63 A;  5IT9 c;  1GM5 A;  2I0Q A;  2R7F A;  1L1O B;  4LF4 Q;  1VQG A;  1BVS A;  2AKW B;  1E22 A;  3CC7 A;  4B3R Q;  5IY0 A;  1CKO A;  3HOX H;  4JI8 L;  4DR2 Q;  5J3B A;  4JI7 L;  5IYC H;  1YJW A;  3H15 A;  2VQE Q;  1PH1 A;  1KAW A;  4LUV A;  1YVC A;  2UXC L;  3DM3 A;  1LTL A;  4UPA A;  1FL0 A;  2Z0S A;  5JEA G;  5HY6 A;  1HR0 L;  1EQQ A;  2AHO B;  3G71 A;  2F3I A;  1VCI A;  4RG1 A;  3CP0 A;  3NEL A;  4IFD I;  4GLX A;  3PIO A;  1UE1 A;  1Y1W G;  2C35 B;  4JOI A;  4L5T A;  2CFM A;  3AYH B;  3IRB A;  3KDF B;  4GN3 B;  4HIM A;  3AFQ A;  4EX5 A;  1IBM L;  3TEH B;  2K4K A;  1WCM H;  2LXK A;  3PUV A;  2WB1 G;  3K0X A;  4OWX B;  1IYJ B;  1A62 A;  1HZC A;  4A3G H;  2VQF L;  1QUQ A;  3S1Q H;  5LMU L;  4Y52 H;  4QIW E;  3RR5 A;  2IHF A;  1KL9 A;  3G6E A;  4JI6 L;  3GTM H;  2JA6 G;  3PCO B;  4BY7 H;  2B63 G;  1SLJ A;  3I4M H;  4R4O A;  1D7Q A;  4JYA Q;  4H02 A;  1VQJ A;  4YY3 L;  3KJP A;  4HJ7 A;  2KEN A;  1P8L A;  4C3I H;  4DAM A;  4JI6 Q;  4X62 L;  4IJH A;  3JAM c;  4NXN L;  4BXX G;  3KF8 B;  3HOZ G;  1PHJ A;  1K83 H;  1X3E A;  5C3E G;  1N34 L;  3I4N H;  3KFU A;  3GTG H;  4LUZ A;  3KOJ A;  3S16 H;  1CKN A;  4BY1 H;  5JJI A;  3F2C A;  2CWA A;  4LNQ A;  2KHJ A;  4OX9 Q;  2E2I H;  4A3D G;  2Q2T A;  2EIF A;  1D8L A;  4DR1 L;  1CKM A;  2VL6 A;  4DNI A;  4R1J A;  3J7Z C;  3GO5 A;  3OTO L;  1B8A A;  1GO3 E;  2BA0 A;  4X66 Q;  4GN5 A;  3I55 A;  4JI4 Q;  1JB7 A;  4JBJ A;  2DUD A;  3CPF A;  3E9I A;  1VQB A;  1YZ6 A;  2VUM G;  4JI3 L;  2OTJ A;  5C4X H;  1YHA A;  1X3F A;  2JE6 I;  4Y7N H;  3J81 i;  2EXD A;  3L0O A;  3UDX A;  4A3J G;  1M1K C;  4LFB L;  3PUW A;  4DUZ L;  4A3K H;  1SE8 A;  1Q7Y C;  4MNO A;  3L7Z C;  4DV7 Q;  3A0J A;  2HHH L;  3CMA A;  1SRO A;  2N49 A;  3HOW G;  1KRT A;  4BBS G;  1U0L A;  5AJ3 L;  2JJQ A;  3GTP H;  4DV5 L;  1UE7 A;  2AMC B;  3CCR A;  1EWI A;  1J5E L;  5IP9 G;  2WP8 J;  4HIO A;  4JI8 Q;  2LSS A;  4JI7 Q;  2UXC Q;  3CCJ A;  4XTC S;  1I6H H;  2WFW A;  2UUB Q;  4JI0 L;  3S1R H;  1VQ5 A;  2N78 A;  1PYS B;  3PO3 G;  1AE2 A;  1EQR A;  1XTD A;  1XNQ L;  3H0G G;  1K0R A;  4DR4 L;  1ASZ A;  4DUY Q;  3PO2 H;  4A3B G;  1SR3 A;  4JI1 L;  3MEF A;  1PA6 A;  1RIP A;  1GD7 A;  1VQE A;  3AEV A;  4PG3 A;  4P73 A;  2R93 G;  1PH5 A;  1IBM Q;  5JJL A;  4B3M L;  1EUJ A;  3H3V I;  3J7A 5;  1WJJ A;  3W1B A;  4OWW B;  4JC0 A;  4LF5 L;  3W5O A;  3RLF A;  2JA7 H;  3G48 A;  1EOV A;  4PZ8 A;  1VQH A;  1FGU A;  4DKA C;  5C44 H;  1R9T H;  2VQF Q;  1A0I A;  3UDG A;  4JYA L;  3F8T A;  3OW2 A;  4GKJ Q;  2QA4 A;  2OTL A;  1HH2 P;  5LMU Q;  1EIY B;  4HIK A;  4KHP L;  2WB1 E;  3CCM A;  3J81 c;  2HQL A;  1PFS A;  1CSQ A;  1X55 A;  2F52 A;  2K50 A;  5GRO A;  5LMN W;  4A3E G;  1HNX Q;  3ER0 A;  4GKK L;  5H1S E;  2RF4 A;  1FVI A;  3PUZ A;  3GDE A;  3GTL H;  1CUK A;  3K7A H;  4PZ7 A;  5IWA Q;  1VQ7 A;  2ZJR A;  2E2H H;  4YHH L;  4OX9 L;  3STB C;  4DR7 L;  1VQD A;  4IPD A;  5IYB H;  3CCL A;  1W2B A;  4C2M H;  2IHE A;  3J81 j;  4LUO A;  2ES2 A;  3I2Z A;  1BBU A;  1Y1V H;  3KJO A;  4C3J H;  2JA8 G;  3H3V H;  1Q8K A;  3HOU G;  3SGI A;  1YBY A;  2NZH A;  2RHQ B;  1CKN B;  3LGJ A;  2B3G A;  2R7Z H;  1JJG A;  3ZJY C;  2ZM6 Q;  3OTO Q;  3EIV A;  5FLM G;  3S1N H;  2GVA A;  4DR6 Q;  3FKI G;  4R4Q A;  4AYB G;  1OXS C;  4DV7 L;  3T1H L;  1JMC A;  2JA5 H;  3CCQ A;  4JI3 Q;  1XPU A;  4A3C H;  2PMZ E;  4KLK A;  2IT1 A;  4POG A;  1SRU A;  3GD7 A;  2JQO A;  1PH6 A;  1WYD A;  3M4P A;  2VY3 A;  5C4J H;  4LFB Q;  4AH6 A;  2ZTC A;  1VQM A;  5C0X G;  4DUZ Q;  3M85 A;  1O7I A;  1N36 L;  2HT1 A;  3TRZ A;  1LYL A;  2YTX A;  3HOV G;  2HHH Q;  2RHS B;  3HOY H;  1VQL A;  3L2P A;  3F2B A;  2UUB L;  5AJ3 Q;  1HR0 W;  4DV5 Q;  1NY4 A;  4GNX C;  1J5E Q;  1JE5 A;  4YCW A;  1C0A A;  2NN6 G;  1XNR L;  1KRS A;  5GQO A;  1C9O A;  4DUY L;  3K8A A;  4A4I A;  3GTQ H;  4JI0 Q;  4PZ6 A;  4OXP A;  1GKH A;  3TS2 A;  3STB D;  2RCN A;  1XNQ Q;  4GNX B;  3TS0 A;  4DR4 Q;  1JT8 A;  1HZ9 A;  1V43 A;  1VQ4 A;  1NMG A;  4JI1 Q;  4ALP A;  4J15 A;  1N32 Q;  4GKJ L;  4YWK A;  4QGU A;  4LF6 L;  4B3M Q;  3J80 c;  2VW9 A;  1HNX L;  5BR8 L;  4A3F H;  2GN5 A;  4YCV A;  4LF5 Q;  2D62 A;  3BZC A;  3ULJ A;  1M90 C;  5M3M H;  2R92 H;  1S72 A;  3PV0 A;  5IWA L;  5GAE C;  1VQI A;  3TRE A;  3HOX G;  4KHP Q;  1YEZ A;  1U5K A;  4JI5 L;  2KHI A;  1TXY A;  1VQN A;  5IYC G;  4WJ4 A;  1K8G A;  1WOC A;  2K5H A;  4APV A;  4GKK Q;  2FXQ A;  4JBK A;  2ZTD A;  1HJP A;  2I5L X;  4TVA B;  1G29 1;  1KC8 C;  2WAQ E;  1A8V A;  1UWV A;  3D0F A;  1PH9 A;  4YHH Q;  1P16 A;  4DR7 Q;  3PIP A;  4HJ9 A;  4IJL A;  1E3P A;  3E0E A;  3KF6 B;  3K81 C;  1FJG Q;  2ZM6 L;  1UEB A;  1TWG H;  3M7N A;  2CCZ A;  3BZK A;  3CCS A;  3VDY A;  2EQS A;  2Y0S G;  2YTY A;  1VQF A;  4DR6 L;  1Q1E A;  4A3I H;  3A5U A;  3ICE A;  5ELN A;  1CSP A;  1WCM G;  4R4C A;  3ULL A;  4C3H H;  3HKZ E;  2AWN A;  5IP7 H;  4DV6 L;  4POF A;  1Q81 C;  2VZA A;  2BA1 A;  3M4Q A;  3S24 A;  1Q46 A;  4NB3 A;  5IYD H;  4A3G G;  1KIX A;  4LF8 L;  1KHI A;  4KHZ A;  4UP7 A;  5DLQ E;  4JV5 L;  4K0K L;  4A3L H;  1TWC H;  2E2J H;  3K80 C;  3T1H Q;  2MQH A;  1ASY A;  4OWT B;  1YHQ A;  1B70 B;  4R4I A;  4P72 A;  4BY7 G;  2ZJP A;  4LFA L;  2CKZ B;  4OO1 I;  3CCE A;  5E7N A;  5JEA J;  1V9P A;  1Q82 C;  3CC4 A;  4LF7 L;  2Q2H A;  2N3S A;  4DV2 Q;  1N36 Q;  4IFD G;  1OXT A;  3HFZ B;  1VQ9 A;  3WWV A;  4IPH A;  4LWC A;  1HNZ Q;  3I4N G;  1MJC A;  4GN4 B;  1KD1 C;  3M9B A;  4GNX A;  1OTC A;  4BY1 G;  4B3T L;  1XNR Q;  3S2D H;  3DLL A;  2UXD L;  1L2F A;  3CAM A;  4X6A H;  2ASB A;  1E1T A;  1UE5 A;  2QGQ A;  2R6G A;  3CPW A;  1X56 A;  3RN2 A;  1VQP A;  1N32 L;  5M5W H;  3PF5 A;  1C7Y A;  4DV4 L;  4JBW A;  2BH8 A;  4IO9 A;  1VQC A;  2PI2 E;  2UUA L;  2V1C C;  4L5S A;  5GAG C;  4A3M H;  1VS0 A;  2OWO A;  2XGT A;  1VQ6 A;  5C4X G;  4R4T A;  4WJ3 M;  1I5F A;  5M5Y H;  4DPG A;  4BBR H;  1YI2 A;  4LF6 Q;  4A3K G;  3EBE A;  3NBH B;  2L15 A;  5BR8 Q;  4A93 H;  1LUZ A;  3HOU H;  2K5V A;  3NEM A;  1Q86 C;  2PNH A;  4LF9 L;  4QQB X;  5ELO A;  3KF6 A;  1E1O A;  1S40 A;  4JI5 Q;  4DV1 L;  5FJ8 H;  1FJG L;  2I5M X;  2KCT A;  1OXU A;  4YWM A;  1YIJ A;  2F4V Q;  5M3F H;  3K7U C;  1NJI C;  1JJC B;  4GOP A;  2IY5 B;  3CF5 A;  3PF4 A;  3GTK H;  2I5H A;  2UU9 L;  3I4O A;  1Z47 A;  2B29 A;  3PO2 G;  4EQ5 A;  1V1Q A;  2CQO A;  1GVP A;  4RMF A;  5IE8 A;  5M5X H;  3CXC A;  5GAH C;  1Y14 B;  2E8G A;  2ZTE A;  4UP8 A;  4XIG S;  1N8R C;  4P75 A;  1X65 A;  3A5Z B;  2DGY A;  4X64 L;  3GTJ H;  1I50 H;  3PGZ A;  4DV6 Q;  1NMF A;  1K9M C;  2JA7 G;  1B7Y B;  2Q2I A;  5C44 G;  4GS3 A;  2PQA B;  1JJ2 A;  1Y1W H;  2MNA A;  2Q2U A;  4NXM L;  4LF8 Q;  2JEA I;  1HNW L;  4JV5 Q;  4A76 A;  4K0K Q;  4DV2 L;  1EIF A;  1MKH A;  2BH2 A;  2ATW A;  4HJ5 A;  1HNZ L;  1XJV A;  3U4V A;  1XMQ L;  1YHB A;  1I94 L;  1I3Q H;  4LFA Q;  1K73 C;  4LF7 Q;  4P71 A;  3ULP A;  2OQ0 A;  2E5L Q;  2NVY H;  3W1G A;  2K52 A;  1NTG A;  3KYH C;  4JG2 A;  5IYB G;  1Q1B A;  1OXV A;  1XMO L;  1EYG A;  2KCM A;  1IXR A;  1E24 A;  2B63 H;  2JA6 H;  1Y1V G;  4B3T Q;  1K8A C;  2A8V A;  3GTO H;  4IOA A;  1G51 A;  2UXD Q;  3T1Y L;  3JAM i;  2R7Z G;  2JA9 A;  1L0W A;  4AQY L;  2A19 A;  4QY7 A;  1IBL L;  1N33 Q;  4MTN A;  4BXX H;  1RL2 A;  1TWH H;  1WFQ A;  4X65 L;  5C3E H;  4DV4 Q;  1PH8 A;  1PH2 A;  3U58 A;  3HOZ H;  2OQK A;  2UUA Q;  1E7Z A;  2JA5 G;  4A3C G;  3S17 H;  2LXJ A;  2ZJQ A;  1IL2 A;  4A3D H;  3PUY A;  4JI2 L;  3CME A;  4B3S L;  1IBK Q;  1KXL A;  1XPO A;  3HOY G;  3U50 C;  2F4V L;  2H5X A;  1X54 A;  3MXN B;  4DV3 Q;  4GOP C;  1PV4 A;  2VUM H;  4LF9 Q;  1PH3 A;  1KQS A;  3BJU A;  2HIV A;  4DV1 Q;  2Z6K C;  4A3J H;  1G6P A;  1W3S A; 
#chains in the Genus database with same CATH topology
 3IKJ A;  3BG3 A;  2R61 A;  2AUK A;  4AIM A;  3OIQ A;  2XIW A;  1RTO A;  4DK0 A;  1HFN A;  2TMP A;  2F4I A;  2F0D A;  2PQA A;  2WB1 B;  1G2T A;  2MO1 A;  2MO0 A;  4LFC L;  3FHW A;  2RSN A;  2NVY B;  4K2L A;  2F0S A;  1Z7T A;  3E6Z X;  3D4R A;  2F03 A;  1RHP A;  3OIP A;  3TQY A;  4X64 Q;  5LMN Q;  3GV6 A;  1SYF A;  1ET6 A;  1YJ9 A;  3PUX A;  3QOL A;  3H0G H;  5M3M G;  2B2Y A;  3BDC A;  2NVQ H;  4HSV A;  4AYB E;  2WAC A;  1EY6 A;  1NR2 A;  3CCV A;  2R93 H;  1JIC A;  3ERO A;  4ZAI A;  2A6H C;  2KBN A;  1QVC A;  2B2T A;  2E2D C;  1I94 Q;  4YCU A;  4N9P A;  3H94 A;  4FP5 D;  1NE3 A;  3J80 E;  1LAC A;  2D0P A;  4OEL B;  1N33 L;  1GUN A;  3UE0 A;  1XMO Q;  2NZ1 D;  4KKU A;  1YNX A;  1PRT C;  3F2D A;  3UE1 A;  3T1Y Q;  3MZ5 A;  5IP7 G;  4I65 A;  3BDO A;  3KDF A;  3AU7 A;  4RKL A;  1G91 A;  5TSS A;  1J6Q A;  2DN8 A;  2E74 C;  1TWG B;  2QDL A;  4KTA A;  4A3I B;  2EJG C;  2PI2 A;  3F2U A;  5FLM H;  3DHQ A;  2YTV A;  4GLA C;  1QZH A;  2L4N A;  1SEB D;  2L55 A;  1CA6 A;  1EFW A;  1AE3 A;  2A1A A;  2A69 C;  1D5X C;  2EVB A;  3CD6 A;  3MXP A;  3S16 B;  3M4O H;  3OHX C;  1QUQ B;  4KN4 C;  1KLU D;  3HOV H;  2BCO A;  2UXB Q;  2NN6 H;  4A3M G;  1PZK D;  1MIU A;  1ROD A;  2JK8 A;  4NXN Q;  2K28 A;  4OO1 G;  3HKZ G;  4G7H C;  2AQ2 B;  5IT9 L;  1SYB A;  2RKS A;  4ZQ3 A;  4A93 G;  1U4P A;  4OON A;  1SXT A;  5EPL A;  4UY8 C;  4LW1 A;  3G6J B;  3NEN A;  1LT4 D;  1TVX A;  2NVX H;  4DR1 Q;  1K8O A;  1S5F D;  3S2H B;  3J80 i;  5JAV A;  3S1M H;  4DR5 L;  1ONL A;  2R3Z A;  1A63 A;  5IT9 c;  1GM5 A;  1VQG A;  1E22 A;  2PZW A;  5IY0 A;  4ODG A;  4OHJ A;  3HOX H;  4IN3 A;  4DR2 Q;  2F0P A;  4JI7 L;  1A3V A;  5IYC H;  3QB3 A;  1YJW A;  2UXC L;  1KAW A;  1LTL A;  1BUV T;  5JEA G;  2PW5 A;  2WV6 D;  2Z0S A;  5HY6 A;  4IFD I;  2AHO B;  4HTH A;  2F3I A;  1VCI A;  4RG1 A;  3CP0 A;  3NEL A;  4GLX A;  3PIO A;  1UE1 A;  5A2Q E;  4GN3 B;  4HIM A;  4ZLT F;  2RDF A;  3TEH B;  2K4K A;  2NWG A;  5FK9 C;  2RQX A;  3AB9 A;  3TP6 A;  1WTP A;  2WB1 G;  1PFN A;  3K0X A;  4TSS A;  3OOC A;  4C56 C;  1QUQ A;  1Y1W B;  4QIW E;  3A56 A;  1EWH A;  2JA6 G;  2G9D A;  2HCC A;  4LJZ C;  1D7Q A;  4XQN A;  4HJ7 A;  2KEN A;  4C3I H;  4FO2 A;  1I3Q B;  4X62 L;  1S4Z A;  4DNR B;  4BXX G;  3KF8 B;  4QB4 A;  5F2D A;  1K83 H;  1PHJ A;  3HOZ G;  3I4N H;  1PFM A;  4LUZ A;  3F2C A;  4OX9 Q;  3D6W A;  4A3D G;  1RF2 D;  2K04 A;  3GTO B;  1D8L A;  2F0W A;  3J7Z C;  3GO5 A;  1SNC A;  2F0O A;  1GO3 E;  2B2U C;  4GN5 A;  1SYG A;  3CPF A;  1CHQ D;  2CH4 W;  3OWE B;  1STA A;  1EIG A;  5JJZ A;  2FMM A;  2EYM A;  1D1I A;  1EQV A;  2EXD A;  4LFB L;  1TQO A;  4DUZ L;  1JE4 A;  1SE8 A;  4DV7 Q;  2BOS A;  2CW0 C;  2F0L A;  1A2T A;  1BR9 A;  3CMA A;  1U0L A;  3GTP H;  1UE7 A;  2AMC B;  5IP9 G;  2VUM B;  2JP1 A;  4ZUI A;  4R8N A;  3P75 A;  4XTC S;  4A3G B;  1I6H H;  2WFW A;  2UUB Q;  1DJR D;  1PYS B;  1AE2 A;  1STE A;  1XNQ L;  1K0R A;  1CT1 D;  4DUY Q;  3PO2 H;  4A3B G;  2HQE A;  1PH5 A;  1IBM Q;  4B3M L;  1DOL A;  1WJJ A;  1U9R A;  4LF5 L;  2JA7 H;  1OTC A;  1EOV A;  1R9T H;  5C44 H;  4DKA C;  1SJH D;  4JYA L;  1CTM A;  3H0G B;  5G3L F;  1EIY B;  4HIK A;  5A2Q L;  2NVQ B;  2HQL A;  5IOC A;  1PFS A;  1CSQ A;  4JI6 Q;  5LMN W;  3BDL A;  3KBG A;  4F87 A;  5H1S E;  4O42 A;  3GDE A;  3GTL H;  4PZ7 A;  5IWA Q;  4CDE C;  2E2H H;  1VQD A;  3I90 A;  1EY7 A;  1W2B A;  3J81 j;  2FJ2 A;  3E3X A;  3TBI B;  1EFI D;  1GHJ A;  1Y1V H;  1HUM A;  1S5D D;  1LAB A;  2B3G A;  3ZJY C;  1AZP A;  2ZM6 Q;  2RCF A;  4DR6 Q;  4R4Q A;  4AYB G;  3FMC A;  1OXS C;  3OPO A;  1JMC A;  1XPU A;  2JA5 H;  3CCQ A;  4FXD A;  2IT1 A;  1S5E D;  1QNU A;  2VY3 A;  5C4J H;  4AH6 A;  2AQ3 B;  2F1M A;  5C0X G;  1EY4 A;  3SDZ A;  3M85 A;  2HT1 A;  1BCP C;  5FLX E;  1BBX C;  2HHH Q;  4K6L A;  1VQL A;  1F9R A;  3HOY H;  3L2P A;  1GJX A;  4HCE A;  4YCW A;  2DNE A;  1C0A A;  2ZXO A;  1XNR L;  1QOH A;  3T4A C;  1KRS A;  1F2M A;  1MSG A;  3M4O B;  1F2L A;  1EEF D;  2CH4 A;  2K6A A;  3HOV B;  2PO4 A;  2RCN A;  3RUZ A;  4EQP A;  3I4L A;  4DR4 Q;  1V43 A;  2XNA C;  4JI1 Q;  1QCB D;  4C1N K;  1N32 Q;  4GKJ L;  1BXT A;  4EQN A;  5T1G A;  3GQB A;  1TII D;  4L63 B;  4CJ0 B;  2VW9 A;  1SE4 A;  2FFK B;  4ID6 A;  3NHH A;  1M90 C;  1U4L A;  5M3M H;  1C4Q A;  3PV0 A;  2F0N A;  2NVX B;  4I7Z C;  3K5L A;  3V05 A;  1TXY A;  5CV9 A;  2OXP A;  2DY7 A;  3S1M B;  4JBK A;  1KNA A;  2I5L X;  1D6E C;  2WAQ E;  4BS9 A;  4YHH Q;  1F9S A;  1GUT A;  3KF6 B;  3K81 C;  1W6K A;  2D9U A;  3M7N A;  1B53 A;  3HOX B;  1B44 D;  1VQF A;  1Q1E A;  3A5U A;  5CV5 A;  1CSP A;  4DV6 L;  5IP7 H;  2AWN A;  5BN3 A;  4POF A;  4FF3 A;  3M4Q A;  1ILP A;  1Q46 A;  5COR A;  4A3G G;  1B50 A;  2WKD A;  1KHI A;  2E2J H;  4JK1 C;  2Y0S B;  5FKA C;  1TT2 A;  1LV9 A;  2HDM A;  1GUW A;  5JEA J;  2K5D A;  1LTG D;  1N36 Q;  3HFZ B;  3A7A B;  1VQ9 A;  1R4Q B;  4Z9C B;  1TY0 A;  2KA7 A;  1HCZ A;  5FO9 B;  1SMY C;  2A6E C;  3A7L A;  4BY1 G;  4HR7 B;  3S2D H;  2R92 B;  3I3C A;  2ASB A;  1LTB D;  1EYD A;  1UE5 A;  2QGQ A;  4C3I B;  1HRJ A;  1C7Y A;  1O7Z A;  2BH8 A;  4IO9 A;  1VQC A;  1K83 B;  3I4N B;  2B39 A;  2V4D A;  4A3M H;  1VS0 A;  2XGT A;  1VQ6 A;  1I5F A;  5M5Y H;  4ZKC B;  4OO1 H;  4IUP A;  2PQE A;  3NPP A;  2JYO A;  4A93 H;  2B2W C;  1PXU A;  1YNJ C;  1Q86 C;  3VYT A;  1WVL A;  4G57 A;  4LF9 L;  3VA5 A;  4QQB X;  5ELO A;  3KF6 A;  5LL6 X;  1S40 A;  3SEB A;  1MGS A;  2CHB D;  1KDA A;  2KCT A;  2F4V Q;  3DM1 A;  4YIJ A;  1GOZ A;  1V8Q A;  1CZW A;  4B9W A;  1V1Q A;  1YNN D;  1GVP A;  5HGT A;  1F9P A;  1NAP A;  5IE8 A;  5LHY 1;  3CXC A;  1Y14 B;  2ZTE A;  2F0Q A;  3T13 A;  1I6H B;  2BDN A;  5JEA H;  3PGZ A;  1ZYR C;  1NMF A;  1B7Y B;  1JJ2 A;  4GS3 A;  3BVM A;  2MNA A;  1FNU A;  3EFX D;  5C4H A;  1Q8I A;  3PO2 B;  2AUJ D;  2BH2 A;  2ATW A;  4IUN A;  1HNZ L;  2F0M A;  2K03 A;  3AMU A;  3DUZ A;  4LFA Q;  4LF7 Q;  2JA7 B;  2NVY H;  3QJY A;  1LTR D;  3FEW X;  5C44 B;  1R9T B;  1NTG A;  2X6G A;  2JA6 H;  1IXR A;  5FO7 B;  5FO8 B;  4B3T Q;  3TN2 A;  1K8A C;  4IOA A;  1G51 A;  3JAM i;  3GTL B;  2JA9 A;  1L0W A;  4AQY L;  4QY7 A;  1N33 Q;  4F8M A;  2VB2 X;  1B9M A;  4BXX H;  1PTO H;  2E2H B;  3HOZ H;  4X65 L;  2UUA Q;  2EYO A;  5J1Z A;  4KHV A;  2WII B;  4A3D H;  1Y1V B;  4JI2 L;  3P20 A;  4L6T B;  1XPO A;  5G3L D;  1PV4 A;  1X3P A;  3KLS A;  2JA5 B;  3BVZ A;  3HGB A;  1KQS A;  1STG A;  4NP5 A;  3JAM L;  5NUC A;  5IGG A;  2JSO A;  5C4J B;  5JVG 3;  4G7O C;  2YYZ A;  4XXE A;  1QVG A;  3HOY B;  2F3V A;  1BOS A;  4GOP B;  2UU9 Q;  5IP9 H;  4CJ2 C;  4IZ8 A;  3A8J E;  4IUT A;  4NPS A;  2IX0 A;  4HED A;  3TME A;  2EY1 A;  1IHZ A;  5C5L A;  4I7A A;  3IFT A;  5C0X J;  3MWY W;  4JCV E;  4DV0 L;  4A3F G;  3S16 H;  1LM0 A;  2VNU D;  2R92 G;  5JJI A;  1OXX K;  4A3B H;  1HNW Q;  4NXM Q;  2MFI A;  1MJE A;  1FGB D;  5EBD A;  1N9W A;  1J9O A;  1SNQ A;  2XVS A;  4PMW A;  4QJF A;  5EKI A;  3CQZ H;  5M3M B;  2QKI C;  4DR5 Q;  4HJA A;  1SE2 A;  2VQE L;  4IOC A;  4IPC A;  1YIT A;  2ALY B;  1PH7 A;  4C3H G;  3RZD H;  1DZ1 A;  1VF5 C;  3S2H H;  1HTP A;  1IBL Q;  4JOI C;  4UP9 A;  2F0V A;  3I8Z A;  2WIN B;  2EYP A;  4A3L G;  4A3J B;  1PFB A;  1LTT D;  3HOW B;  4ZUJ A;  1PTO D;  3CW2 C;  3NSW A;  3WDN A;  4B3S Q;  1PLF A;  3C46 A;  5I6Y A;  1B4O A;  1X6O A;  2D0O A;  3FVQ A;  4YWL A;  2E2J B;  1U4R A;  4DR3 L;  3HRZ C;  3CC2 A;  3AQQ A;  4B9X A;  2Z6K A;  5C0X H;  1JR0 D;  2WAQ G;  4XYO A;  1AH9 A;  3D31 A;  3RN5 A;  3U9S A;  5K36 G;  1K3B C;  2VS1 A;  2NVT H;  1TWA H;  4X62 Q;  2IL8 A;  4H44 C;  3S2D B;  1K8M A;  2F0J A;  5E4W C;  2UUC Q;  1H9S A;  3CCU A;  1L1O C;  3C1E A;  3SE0 A;  1WI5 A;  1SYC A;  2O4X A;  4A3E B;  4QMG A;  5J39 A;  1SDF A;  3BYT B;  4L5R C;  4A75 A;  5GAD C;  4A3M B;  1TWF H;  1RTN A;  1EZ8 A;  4P74 A;  1QIL A;  2K75 A;  4ME3 A;  5M5Y B;  3HKZ B;  5M3F G;  3HEJ A;  1SJE D;  4LF4 Q;  3QWN A;  4A93 B;  1BVS A;  2XSC A;  4B3R Q;  1CKO A;  4JI8 L;  5J3B A;  2EY6 A;  3H15 A;  1YVC A;  2H4O A;  3SK8 A;  1HR0 L;  3G71 A;  2C35 B;  1EZ6 A;  3AYH B;  2EJM A;  3KDF B;  1SYD A;  2K33 A;  1HPC A;  2LXK A;  2EJF C;  5EGT A;  1AFP A;  2XRQ D;  2VXW A;  3OMG A;  1IYJ B;  4A3G H;  2VQF L;  3VYU A;  4Y52 H;  2EOT A;  3G6E A;  2G9H D;  1PDQ A;  1SLJ A;  1V1O A;  3FDT A;  4JYA Q;  1ICW A;  3CRL C;  4DAM A;  4PMC A;  3BVG A;  1N34 L;  3KFU A;  1TS4 A;  5D14 A;  1ET9 A;  4ULL A;  2JA6 B;  4BY1 H;  1H9J A;  4DNI A;  3OTO L;  1B8A A;  4X66 Q;  1TS3 A;  4JI4 Q;  1PTO B;  3NE5 B;  1H9M A;  3HOZ B;  4JI3 L;  3DMU A;  3I72 A;  2OTJ A;  4MN3 A;  3I73 A;  4TRD A;  3L0O A;  4A3J G;  4A3D B;  3G7L A;  1M1K C;  1EY8 A;  3L7Z C;  3HOW G;  5KND A;  1KRT A;  5AJ3 L;  2JJQ A;  4DV5 L;  3CCR A;  1SBB B;  1ZKO A;  1J5E L;  2WP8 J;  1JOK A;  1WCM B;  4FNF A;  4HIO A;  1DXM A;  4R9W A;  2LSS A;  3CCJ A;  1TR5 A;  2D2C C;  2CQA A;  3S1R H;  5ELF A;  1VQ5 A;  1Z6H A;  3PO3 G;  1EY9 A;  2KJX A;  2XWJ B;  2XWB B;  1B1Z A;  1SR3 A;  1OO9 B;  5IGF A;  3SK6 A;  1PA6 A;  1KDB A;  1VQE A;  4PG3 A;  4P73 A;  2C5C A;  3QR8 A;  5C6A A;  2F0I A;  1EUJ A;  3W1B A;  5EBC A;  4OWW B;  1TY2 A;  3GTG B;  1XX8 A;  3G48 A;  4WJ3 M;  3UDG A;  5JOB A;  5A35 A;  4GKJ Q;  1WD1 A;  5LMU Q;  4A3B B;  4KHP L;  4ZRZ A;  3CCM A;  1X55 A;  2F52 A;  2K50 A;  5GRO A;  4A3E G;  4GKK L;  4FXG C;  2RF4 A;  4DK1 A;  2BDO A;  3QO2 A;  1VQ7 A;  3CQZ B;  4C2M H;  1XTC D;  3I2Z A;  2JA8 G;  3H3V H;  1HTL D;  1JB3 A;  2KHS A;  1YBY A;  2NZH A;  2M2L A;  3NTI A;  4HAE A;  2LMC B;  3RZD B;  3S1N H;  4KY5 A;  4DU9 A;  1EOT A;  3PMF A;  2PMZ E;  4KLK A;  3GD7 A;  1PH6 A;  2ZTC A;  5EPJ A;  1VQM A;  2RHS B;  4DXF A;  3R8B A;  4AYB B;  4CKB A;  1HQM C;  5IIF A;  2Q8I B;  4A4I A;  2B2V A;  3J80 L;  4JI0 Q;  4OXP A;  3STB D;  4RHS A;  3K0Y A;  3PIP 3;  2JN4 A;  1ML0 D;  4GNX B;  3TS0 A;  1HZ9 A;  1VQ4 A;  3K7A B;  2NVT B;  1TWA B;  2EXZ A;  4LF6 L;  1HA5 A;  1SSO A;  3J80 c;  4A3F H;  1ENA A;  2R92 H;  2D62 A;  3BZC A;  1S72 A;  1STB A;  3M4Y A;  5I6W A;  5GAE C;  3ND8 A;  2R7Z B;  1YEZ A;  4JI5 L;  2KHI A;  1VQN A;  1TWF B;  4MIU A;  4WJ4 A;  1WOC A;  1FNW A;  4K5W A;  4TVA B;  5FOB B;  1KC8 C;  3NQT A;  4GZY C;  5KIX A;  3ITP A;  1P16 A;  4DR7 Q;  4IJL A;  2F0U A;  2EQS A;  1D5M C;  4KMU C;  3TP7 A;  3SVM A;  1WCM G;  4C3H H;  4K6D A;  2VZA A;  4NB3 A;  4KJO A;  1KIX A;  2OT2 A;  4LF8 L;  2N55 A;  2LFN A;  4UP7 A;  5DLQ E;  4A3L H;  4K0K L;  1TWC H;  3GTQ B;  2Q8T A;  3K80 C;  4DGZ A;  3T1H Q;  1BO0 A;  1AZQ A;  2ICE C;  4BY7 G;  1B70 B;  4P72 A;  2ZJP A;  3C2P A;  2CKZ B;  5CV8 A;  5E7N A;  4IFD G;  1Q82 C;  1EIH A;  3WWV A;  4IPH A;  5C3X A;  1HNZ Q;  3A8I E;  4GN4 B;  2BE5 C;  2IW3 A;  3K5M A;  4GNX A;  1YNN C;  2RA4 A;  5JPN C;  2UXD L;  1IW7 C;  3CAM A;  1GUS A;  3NUC A;  3CPW A;  3RN2 A;  5M5W H;  1IL8 A;  4DV4 L;  4U68 A;  5K36 H;  2V1C C;  4L5S A;  4DF7 A;  2OWO A;  5C4X G;  4BY1 B;  1DM0 B;  1L0Y B;  3MXU A;  1YI2 A;  2EYF A;  4A3K G;  5BR8 Q;  3HOU H;  1RJT A;  4DNT B;  1XWE A;  5IOD A;  3CRK C;  5CC4 A;  1M4V A;  1CQV A;  3K59 A;  3ZYY X;  4KV6 A;  4DV1 L;  3R3O A;  4RFB A;  1YIJ A;  4YWM A;  5M3F H;  1NJI C;  2IY5 B;  3PF4 A;  3I4O A;  4QIW B;  4K8I A;  4H0L C;  5K5P A;  4RKB A;  4RMF A;  1KDC A;  1K28 A;  1A6X A;  1SE3 A;  4UP8 A;  5EQ0 A;  3NXW A;  1N8R C;  3S1R B;  4JW0 A;  2K32 A;  1I50 H;  4X64 L;  1LTA D;  3DXJ C;  2E75 C;  4DFA A;  2B2Y C;  2NBF A;  2Q2I A;  3E5S A;  3CU7 A;  2JEA I;  3NTK A;  4JV5 Q;  4A76 A;  1A2U A;  3NTH A;  5D3I B;  3D8G A;  4HJ5 A;  2B2T C;  2SNM A;  3K57 A;  4V19 0;  1Q3L A;  1I94 L;  4IUR A;  5CGK A;  3QOJ A;  2K52 A;  4JG2 A;  4XT1 B;  1OXV A;  1XMO L;  1EYG A;  2A74 C;  2PCF B;  2A73 B;  4C3J G;  2JXM B;  3T1Y L;  3J81 E;  1QJO A;  2C9O A;  2R7Z G;  3GP7 A;  4RCN A;  1RL2 A;  1TWH H;  2QF7 A;  2OQK A;  4C2M B;  1PTO F;  4A3C G;  3S17 H;  1VMC A;  3PUY A;  1J8I A;  4PMB A;  1Y8O B;  5KYL A;  3U50 C;  3FRP B;  3S1N B;  3MXN B;  1PH3 A;  1A15 A;  4A3J H;  1G6P A;  2EYJ A;  3HOW H;  3UDI A;  4DK3 C;  3MEH A;  1F9Q A;  5I4D A;  3NWT A;  4DR3 Q;  4DAY A;  2UXB L;  1UE6 A;  1EU4 A;  1S3O A;  3JC6 6;  2RDH A;  5I9P A;  1PTO C;  3TZD A;  4BA1 I;  1IZ6 A;  4FDB A;  3PO3 H;  2PW7 A;  3BU2 A;  3B6Y A;  4J1M A;  1PZI D;  3Q8D A;  1G2S A;  4RGM A;  2E5L L;  5T1I A;  2RBM A;  4F7X A;  2CVR A;  1L1O A;  3RLN A;  5C3E B;  1Z9F A;  1XMQ Q;  1D1K A;  2ENB A;  1V1P A;  2EY2 A;  5BN4 A;  4A3F B;  3I91 A;  4KI0 A;  4RCO A;  2L1B A;  5CMD A;  2L0C A;  2K5N A;  4NDX A;  4DR2 L;  3S14 H;  4O2D A;  2EPB A;  3CKI B;  3TSS A;  4A3E H;  1VQK A;  4BWG B;  3M3Y H;  2R7D A;  5FLX L;  2ZXP A;  2Q8R E;  4UDU C;  5ISR A;  1F2Z A;  1VQO A;  2YU9 H;  3E9H A;  4MTK A;  3F1Z A;  4ZKB B;  3J7Y W;  1VQ8 A;  1IBK L;  3MXN A;  2SOB A;  4J8Q A;  3FP9 A;  3I7F A;  2EE1 A;  2NN6 I;  4DN4 M;  2JA8 H;  4DV3 L;  1HR0 Q;  5FLX c;  4BBS B;  2IX3 A;  1PRT B;  3SK5 A;  1DGS A;  1PVO A;  1I4X A;  2IX1 A;  4C3H B;  2OCE A;  1PH4 A;  1PYB A;  3NBI A;  1SN8 A;  1VQA A;  2XTI A;  3I56 A;  3P1H A;  1TWC B;  2YV5 A;  1H95 A;  3VA7 A;  1K3R A;  3EN2 A;  2HIX A;  1UEA B;  4RA8 A;  5JJK A;  1QG7 A;  3T56 B;  2I46 A;  1X3G A;  5DAU A;  5CR3 A;  4FF1 A;  4OIJ A;  1B3Q A;  1RKN A;  1X9N A;  2QEX A;  3MFY A;  3G4S A;  4KJN A;  2M9V A;  4K14 A;  1BBW A;  4LFC Q;  3K6O A;  4BBR G;  1N34 Q;  1SFO H;  4IFD J;  2WAQ B;  1RCV D;  1E2Z A;  3MA2 B;  5M5W B;  4JBM A;  4KD4 A;  1KAB A;  4QL5 A;  1GUO A;  1EEI D;  3AFP A;  2F3W A;  2MJ8 A;  2I0Q A;  2R7F A;  1II3 A;  4M8A A;  2FHT A;  3HOU B;  4RHR A;  1BF4 A;  3CC7 A;  4KD3 A;  3A55 A;  2F0T A;  4LUV A;  3T16 A;  5KYI A;  1DYQ A;  4UPA A;  2IJ0 A;  4K8J A;  3URY A;  5M3F B;  5ELD A;  2O5I C;  4L5T A;  2CFM A;  3IRB A;  1IBM L;  1WCM H;  4RGO S;  3PUV A;  3R93 A;  1IYV A;  1A62 A;  1I50 B;  1HZC A;  5LL6 S;  3RR5 A;  1KL9 A;  2XN9 C;  4JI6 L;  3GTM H;  4BY7 H;  1HFG A;  2B63 G;  3I4M H;  4HN7 A;  4YY3 L;  4IFD H;  3S15 B;  4IJH A;  1AP0 A;  1JOQ A;  4MHE A;  3JAM c;  4KN7 C;  1LTS D;  1X3E A;  1DCZ A;  3BZD B;  5C3E G;  2PNR C;  3GTG H;  3KOJ A;  1CKN A;  1C8C A;  2CWA A;  3NK9 A;  4ZYS A;  2E2I H;  2A5H A;  3EJI A;  2VL6 A;  1H9K A;  1JWU D;  4LK1 C;  4CBV A;  2BA0 A;  1LT5 D;  2B8G A;  1H9S B;  1JB7 A;  1PYW D;  1TWH B;  1G8Z D;  2RSO A;  1NCV A;  2Z8L A;  4S3S A;  2IWH A;  5C4X H;  1YHA A;  2PPB C;  1X3F A;  5C5M A;  3S17 B;  2AQ1 B;  4A3K H;  1Q7Y C;  3A0J A;  2HHH L;  2LY7 A;  2N49 A;  4ABN A;  4BBS G;  3QIA A;  1EWC A;  4CKE A;  5I2X A;  1HUN A;  4K5V A;  1X3Q A;  4RGT A;  4JI7 Q;  4JVZ A;  2UXC Q;  1KLG D;  4HCS A;  2QCP X;  1HQR D;  4H7B A;  4IAL A;  3OWF A;  2SNS A;  4NW2 A;  1CFM A;  1XTD A;  2RDG A;  2NYZ D;  4DR4 L;  1ASZ A;  1LT6 D;  4CHT B;  4JI1 L;  3MEF A;  5KGU A;  2KVM A;  1RIP A;  3SK4 A;  1W6J A;  5JJL A;  1CA5 A;  1MHW C;  2PZU A;  3W5O A;  3PO3 B;  4PZ8 A;  1FGU A;  3MTS A;  4XQJ A;  3F8T A;  2QA4 A;  2OTL A;  1HH2 P;  2WB1 E;  4XQQ A;  1FVI A;  3PUZ A;  3FPU B;  3K7A H;  1Q90 A;  2ZJR A;  1WTW A;  2IPK D;  4YHH L;  5C3W A;  3STB C;  5CBE E;  1L0X B;  4WFN 3;  4K5X A;  3VR3 A;  1Y8N B;  3CCL A;  2A68 D;  4Y7N B;  2IHE A;  3S14 B;  4RAU C;  4LUO A;  2ES2 A;  1BBU A;  3KJO A;  3HOU G;  4C3J H;  3M3Y B;  1DD2 A;  1MBY A;  4ZK9 B;  3SGI A;  2RHQ B;  3LGJ A;  2R7Z H;  2HUG A;  2YU9 B;  3VR5 A;  2KED A;  2B2U A;  2MPM A;  3FKI G;  5CV7 A;  3X3M A;  4A3C H;  2ICI A;  4NKL A;  3A8K E;  5CV4 A;  3NP8 A;  2JA8 B;  1SRU A;  2JQO A;  3DWP A;  1WYD A;  3M4P A;  5IGC A;  4LFB Q;  4OIK A;  4DUZ Q;  3SHL A;  1N36 L;  4DA2 A;  3LX0 A;  3F2B A;  1HR0 W;  3O13 A;  1JE5 A;  2KUM A;  2F0F A;  1Y8P B;  2HD3 A;  2K1B A;  2LS0 1;  3GTQ H;  1BCP B;  1GKH A;  3TS2 A;  1QNK A;  3H09 A;  3H3V C;  2K05 A;  1XNQ Q;  1GUG A;  5M9O A;  1NMG A;  1S5B D;  4ALP A;  3T53 B;  4YWK A;  4QGU A;  4V0B A;  4B3M Q;  1HNX L;  4FYD A;  2GN5 A;  1SFO B;  4LF5 Q;  3ULJ A;  2Z1C A;  3TRE A;  1GXD C;  1U5K A;  3LWU A;  1K8G A;  2K5H A;  4APV A;  1MD2 D;  2ZTD A;  4CKC A;  1G29 1;  1DOM A;  1VMP A;  5EPK A;  1EY5 A;  3D0F A;  2L11 A;  3PIP A;  4HJ9 A;  1E3P A;  3E0E A;  5IT9 E;  5CV6 A;  1UEB A;  3LNN A;  4EGV A;  4G7Z C;  1PRT F;  2BA1 A;  3TP5 A;  3J7A V;  4KHZ A;  1ENF A;  2KCN A;  1ASY A;  1YHQ A;  4IUQ A;  3Q6S A;  2D5D A;  4LFA L;  1EY0 A;  4OO1 I;  4QCL A;  4LF7 L;  1V9P A;  2Q2H A;  4UHV A;  2N88 A;  1AN8 A;  2DNC A;  5EJW A;  4WOR A;  3Q23 A;  1B3A A;  3TP8 A;  3GTM B;  4NMZ A;  4B3T L;  4BY7 B;  1XNR Q;  1T5E A;  5EKL A;  3DLL A;  3I4M B;  1L2F A;  4X6A H;  4RWS C;  4FXK C;  5DEH A;  2OEO A;  2R6G A;  5C4Z A;  1X56 A;  3W2D A;  1VQP A;  5EKK A;  3S9W A;  1SYE A;  4CDF C;  2UUA L;  4G4K A;  2K01 A;  4R4T A;  1HHV A;  1NNX A;  2K7V A;  4DPG A;  4BBR H;  2E2I B;  3Q22 A;  4Q0F A;  3MC0 B;  1A3U A;  2L15 A;  1O78 A;  2K5V A;  3NEM A;  3N6R A;  4CDD C;  2NTS A;  2J0T D;  5C4X B;  2M00 A;  1DON A;  1FJG L;  3IFD A;  5ELC A;  1I4P A;  3K7U C;  4A3K B;  4J6H A;  1I4Q A;  1CHP D;  1F2Y A;  2I5H A;  2UU9 L;  4EQ5 A;  1PZJ D;  3J7A F;  3H91 A;  2P5Z X;  2O2L D;  1ICF B;  5M5X H;  2E76 C;  2E8G A;  3D6C A;  1XYI A;  1IKL A;  3A5Z B;  4DV6 Q;  3GTJ H;  3ND9 A;  3KBX A;  5KEE A;  3WOE A;  3OW7 A;  1HNW L;  4NXM L;  1B9N A;  5DM6 3;  4N8F A;  2K5W A;  4DV2 L;  1MKH A;  2XRS D;  4WRD A;  1SNO A;  1XJV A;  3VR4 A;  1K73 C;  1D2B A;  2FIN B;  4P71 A;  2E5L Q;  3GV3 A;  3W1G A;  5IYB G;  1BDO A;  5I9O A;  2B63 H;  4X3U A;  2A8V A;  4K2K A;  4PV1 C;  1IBL L;  4OL7 A;  4L8J A;  2F0H A;  4KK7 A;  1WFQ A;  5C3E H;  3KUP A;  1PH2 A;  3U58 A;  4UAI A;  1EYC A;  4RGN A;  3GTK B;  4C3J B;  3MAQ A;  1G6Z A;  1MSH A;  2F0G A;  4B3S L;  1IBK Q;  3HP3 A;  4FF4 A;  2H5X A;  4DV3 Q;  4X3K A;  4GOP C;  2B2W A;  4LF9 Q;  3L3O C;  5ELB A;  4XT3 B;  2HIV A;  2Z6K C;  3ONA B;  4HID A;  1TS5 A;  3U9O A;  4BBS H;  5J22 A;  5E4X A;  3RZO H;  1ESF A;  1AW7 A;  3ERS X;  3RLO A;  1MI2 A;  3KLW A;  2NZO A;  4P2C B;  2I07 B;  1ZXT A;  4HJ8 A;  1K0S A;  2UUC L;  4C1N I;  2X6L A;  5D3D A;  3DWA A;  3D4D A;  2NTT A;  1JJG A;  3W3A A;  4DK6 C;  3I4M G;  3NWS A;  2RVL A;  3EVQ A;  1YJN A;  1F77 A;  3RD4 A;  1UAP A;  1T9H A;  4QUF A;  2N8N A;  3BYY B;  2CWP A;  4MZ9 A;  4LAA A;  4LF4 L;  4GLV B;  1QVF A;  1HZB A;  1Q12 A;  3D3R A;  4XYQ A;  4B3R L;  2EYL A;  4WJW A;  1NBW A;  2PMZ B;  4IPG A;  1HZA A;  1T5X D;  5E1F A;  2JEB I;  4A3I G;  1VF7 A;  2AWO A;  2J4X A;  3U4Z A;  3UDF A;  1WTH A;  4U67 3;  2GVB A;  5C0X I;  3PSI A;  4AQY Q;  4PQX A;  5IYD G;  4TQU S;  5HUR A;  1SNM A;  2K14 A;  4X65 Q;  1E2W A;  2L9H A;  1I4G A;  4BA2 I;  3HS0 C;  2ID0 A;  5KNC A;  1TS2 A;  1CZG A;  4DAV A;  4HSP A;  4JI2 Q;  4L5Q A;  1E0B A;  3ERQ A;  3FKI H;  1B2T A;  1IYU A;  5EAY A;  2HCI A;  4QF4 A;  1C48 A;  1STY A;  2A6H D;  3HKS A;  4HMJ A;  1XPR A;  4CGY B;  1U4M A;  4JPB W;  3KF8 A;  1QZG A;  3BS1 A;  4M1U B;  2R93 B;  1BCP F;  2HDL A;  2G5D A;  2H1E A;  1SND A;  5LMN L;  4YY3 Q;  1NUC A;  2OF1 A;  2TSS A;  4DAY B;  5HGQ A;  2Y0S E;  1PRT D;  1WD0 A;  1SMX A;  2Z4I A;  4X66 L;  2QIL A;  4JI4 L;  2K5Q A;  3PIO 3;  4DV0 Q;  3A74 A;  3EA6 A;  3S15 H;  3RNU A;  4O0A A;  3OYY A;  5FJ8 G;  3IAY A;  4N9T A;  2Z4H A;  1SNP A;  4BBR B;  1BKB A;  1HXY D;  1L1O B;  2SEB D;  2AKW B;  1V1P B;  1VDZ A;  2A69 D;  1KTK A;  3K5N A;  2VQE Q;  1PH1 A;  3DM3 A;  1XXG A;  4EQO A;  1FL0 A;  2EYH A;  1EQQ A;  3DEO A;  3IL8 A;  5KRU A;  3CHB D;  3OSO A;  4JOI A;  1Y1W G;  1S5C D;  3AFQ A;  4EX5 A;  1CK1 A;  5M5X B;  1DOK A;  4OWX B;  2ZT9 C;  3GTJ B;  5COY A;  3S1Q H;  1FR3 A;  5LMU L;  3K5O A;  4XDX A;  2DJF C;  2IHF A;  3PCO B;  3A54 A;  4O1N A;  4R4O A;  4H02 A;  1VQJ A;  3KJP A;  1P8L A;  1WTQ A;  3MXG A;  1KAA A;  4NXN L;  1QB5 D;  2KEC A;  2DY8 A;  2L12 A;  5E3F A;  3I70 A;  3C1F A;  4LNQ A;  1E2V A;  2KHJ A;  2B63 B;  2Q2T A;  2EIF A;  4DR1 L;  1CKM A;  1ZEQ X;  4R1J A;  3VYR A;  4H13 C;  5CBA E;  1JOR A;  3I55 A;  2NUC A;  2NB0 A;  4JBJ A;  2DUD A;  4TKO B;  3E9I A;  1VQB A;  1YZ6 A;  2VUM G;  2VB3 X;  4EVO A;  2JE6 I;  4X3S A;  4Y7N H;  1X32 A;  3J81 i;  3UDX A;  2X69 A;  3PUW A;  2F0E A;  4MNO A;  1SRO A;  1EWI A;  1I4R A;  2A68 C;  4JI8 Q;  1QE6 A;  4QUC A;  2B2V C;  4JI0 L;  2N78 A;  5AFW A;  3D4W A;  1EQR A;  1SAP A;  3H0G G;  3WOF A;  3RZO B;  1IKM A;  4KY7 A;  3J81 L;  1GD7 A;  3AEV A;  2R93 G;  1FD7 D;  1EQT A;  4Q5V A;  3H3V I;  3J7A 5;  1JQY D;  3SR1 A;  4JC0 A;  4IUU A;  3RLF A;  3JAM E;  1VQH A;  2F0K A;  2VQF Q;  1A0I A;  3OW2 A;  3J81 c;  1HNX Q;  3MHB A;  3VR6 A;  3ER0 A;  4KY6 A;  2MUY A;  3HZX A;  3X3N A;  4B08 A;  5JPM C;  5IGD A;  1CUK A;  1D5Z C;  2CW0 D;  1LTI D;  4OX9 L;  3KK7 A;  4DR7 L;  4IPD A;  5IYB H;  1STH A;  5KNB A;  2SDF A;  5DM7 3;  4HMI A;  2WKC A;  1ILQ A;  4FVM A;  4OEM B;  2GA4 B;  1Q8K A;  3GTP B;  2BE5 D;  1CKN B;  3OTO Q;  3NQI A;  3EIV A;  5FLM G;  3T51 B;  2EY5 A;  1IW7 D;  2GVA A;  5IGE A;  4R8I A;  4DV7 L;  1NSN S;  3T1H L;  4JI3 Q;  1BQQ T;  4CDC C;  5D65 A;  4POG A;  1O7I A;  3V2T A;  3TRZ A;  1LYL A;  2YTX A;  3HOV G;  4KKT A;  2UUB L;  5AJ3 Q;  3KLR A;  4DV5 Q;  3FKI B;  5L37 A;  1NY4 A;  4GNX C;  1J5E Q;  3UI2 A;  2NN6 G;  1CM9 A;  5GQO A;  1C9O A;  1LT3 D;  1I6V C;  3K8A A;  4DUY L;  3N52 A;  4PZ6 A;  3M7G A;  1JOO A;  1ESR A;  1JT8 A;  1BNZ A;  3PQI A;  4J15 A;  3R2I A;  4OGQ C;  1WTX A;  3RMH A;  5BR8 L;  3DEP A;  1WTR A;  4YCV A;  1JCK B;  5IWA L;  4IQZ A;  1VQI A;  3HOX G;  4KHP Q;  1WTV A;  5IYC G;  1O7L A;  1FNV A;  4GKK Q;  2FXQ A;  2QEJ C;  1HA6 A;  1BCP D;  1HJP A;  1WTO A;  1PH9 A;  1A8V A;  1UWV A;  4LMQ D;  1FJG Q;  3TZU A;  2ZM6 L;  1TU2 B;  1TWG H;  2CCZ A;  3BZK A;  3CCS A;  3VDY A;  3V96 A;  4ME5 A;  1ENC A;  2Y0S G;  2YTY A;  4DR6 L;  4A3I H;  3VYS A;  3ICE A;  5ELN A;  4R4C A;  3ULL A;  5I2Y A;  3HKZ E;  3MVV A;  5CYU A;  1Q81 C;  1RD9 D;  1NR4 A;  3S24 A;  5IYD H;  1GHK A;  3L9A X;  4JV5 L;  4ILW A;  1CI3 M;  2MQH A;  4OWT B;  4PNY A;  1LLR D;  4R4I A;  1M8A A;  2QDB A;  3CCE A;  3CC4 A;  4C3I G;  3R2T A;  2DJG C;  2N3S A;  4DV2 Q;  1OXT A;  4LWC A;  3I4N G;  1MJC A;  1JWS D;  1RDP D;  3S1Q B;  2FMC A;  2LKV A;  2Z9H A;  3DWQ A;  1KD1 C;  2KQ3 A;  3M9B A;  4IUV A;  2EDG A;  1E1T A;  1N32 L;  4FF2 A;  4CJ1 B;  3PF5 A;  4JBW A;  3QG1 A;  4X3T A;  2PI2 E;  3K58 A;  3LWE A;  1CQF A;  5GAG C;  3VR2 A;  2MHV A;  1TKW B;  1STN A;  4LF6 Q;  1Y69 U;  3EBE A;  3NBH B;  1H9R A;  1LUZ A;  1EYA A;  4KKS A;  2PNH A;  1O7Y A;  5IGB A;  1EU3 A;  1R4P B;  4F88 A;  1E1O A;  2J7Z A;  4JI5 Q;  5FJ8 H;  3Q24 A;  2I5M X;  1OXU A;  3OMC A;  2EZV A;  1JJC B;  4GOP A;  3CF5 A;  3GTK H;  3H6M A;  1Z47 A;  2L5T A;  2B29 A;  5JVH 3;  2KEE A;  3PO2 G;  2CQO A;  1SMY D;  2A6E D;  3FPP A;  2KOL A;  1LO5 D;  5GAH C;  3HG9 A;  4XIG S;  5DNF A;  4P75 A;  1X65 A;  2DGY A;  4N8X 1;  1JWM D;  1K9M C;  1I4H A;  2KCC A;  4E6I A;  2JA7 G;  2ZXR A;  5C44 G;  2Q2U A;  3C3L A;  2PQA B;  1Y1W H;  4LF8 Q;  3SXH A;  4K0K Q;  1EIF A;  3P7J A;  1O80 A;  3U4V A;  1XMQ L;  1YHB A;  1I3Q H;  2MGS A;  2B8F A;  2PZT A;  4DXG A;  2OQ0 A;  3ULP A;  1KNE A;  4ZCK A;  1YNJ D;  3KYH C;  5ELE A;  1Q1B A;  1PMR A;  3KLS X;  3E0J A;  3MFG A;  1UNS A;  2KCM A;  1E24 A;  3Q0A A;  1Y1V G;  3GTO H;  2UXD Q;  1JC7 A;  2A19 A;  3EQL C;  4MTN A;  3NBH A;  1QWY A;  1PH8 A;  1A3T A;  4DV4 Q;  5BN5 A;  1E7Z A;  2JA5 G;  1UUP A;  2O5J C;  2LXJ A;  2ZJQ A;  1IL2 A;  1EL0 A;  3CME A;  4RH6 A;  1ZYR D;  2QW7 A;  1KXL A;  3HOY G;  1FYC A;  2F4V L;  1X54 A;  1AEX A;  2PYK A;  2VUM H;  3TDQ A;  4DAP A;  2Z6B A;  2MP1 A;  3BJU A;  4DV1 Q;  1W3S A; 
#chains in the Genus database with same CATH homology
 4HID A;  3HOW H;  2YYZ A;  4AIM A;  1QVG A;  3UDI A;  4BBS H;  4DK3 C;  4DR3 Q;  4GOP B;  2UU9 Q;  5IP9 H;  3RZO H;  2UXB L;  2PQA A;  3ERS X;  1UE6 A;  2MO1 A;  4NPS A;  3RLO A;  2IX0 A;  2MO0 A;  1S3O A;  3JC6 6;  3KLW A;  4LFC L;  2NZO A;  3FHW A;  4HJ8 A;  2UUC L;  4BA1 I;  1IZ6 A;  4FDB A;  3PO3 H;  5C0X J;  3TQY A;  4JCV E;  4X64 Q;  3BU2 A;  5LMN Q;  4DV0 L;  1LM0 A;  4DK6 C;  4A3F G;  3PUX A;  1YJ9 A;  2R92 G;  3B6Y A;  3I4M G;  3H0G H;  1OXX K;  5M3M G;  4A3B H;  3Q8D A;  4NXM Q;  4AYB E;  2MFI A;  1MJE A;  2NVQ H;  1HNW Q;  1YJN A;  2E5L L;  3CCV A;  2R93 H;  1T9H A;  1N9W A;  2KBN A;  1L1O A;  1QVC A;  2N8N A;  4MZ9 A;  2CWP A;  3RLN A;  1Z9F A;  1XMQ Q;  1I94 Q;  4LF4 L;  4PMW A;  4QJF A;  4YCU A;  4GLV B;  1QVF A;  1HZB A;  1Q12 A;  4KI0 A;  3CQZ H;  4B3R L;  1NE3 A;  4DR5 Q;  2D0P A;  4DR2 L;  2K5N A;  3S14 H;  1N33 L;  4O2D A;  4HJA A;  1NBW A;  4IPG A;  1HZA A;  3UE0 A;  2VQE L;  4IOC A;  4A3E H;  1XMO Q;  1VQK A;  3M3Y H;  2JEB I;  2R7D A;  4IPC A;  2ALY B;  1YIT A;  1PH7 A;  1YNX A;  4A3I G;  2AWO A;  3F2D A;  3UE1 A;  3U4Z A;  3T1Y Q;  3RZD H;  3UDF A;  5IP7 G;  2GVB A;  1VQO A;  5C0X I;  2YU9 H;  3PSI A;  4AQY Q;  3S2H H;  3KDF A;  1IBL Q;  3E9H A;  4JOI C;  4UP9 A;  5IYD G;  3F1Z A;  4TQU S;  2K14 A;  4X65 Q;  1J6Q A;  4A3L G;  1VQ8 A;  1IBK L;  4BA2 I;  3FP9 A;  3I7F A;  2NN6 I;  2JA8 H;  2ID0 A;  4DV3 L;  1HR0 Q;  5FLX c;  1DGS A;  3CW2 C;  4JI2 Q;  1PVO A;  4L5Q A;  2PI2 A;  2IX1 A;  4B3S Q;  2OCE A;  5FLM H;  1PH4 A;  2YTV A;  1PYB A;  4GLA C;  3FKI H;  1SN8 A;  1X6O A;  1QZH A;  1VQA A;  5EAY A;  2D0O A;  2XTI A;  3I56 A;  1EFW A;  1AE3 A;  2A1A A;  4YWL A;  2YV5 A;  1H95 A;  4DR3 L;  1XPR A;  3CD6 A;  3HKS A;  1K3R A;  3EN2 A;  3CC2 A;  3M4O H;  3AQQ A;  2HIX A;  5JJK A;  2Z6K A;  1QZG A;  2WAQ G;  1QUQ B;  3HOV H;  1X3G A;  1AH9 A;  3D31 A;  3RN5 A;  1X9N A;  5K36 G;  2UXB Q;  5LMN L;  2QEX A;  4A3M G;  4YY3 Q;  2VS1 A;  2NVT H;  3G4S A;  1TWA H;  1MIU A;  4X62 Q;  4DAY B;  5HGQ A;  1BBW A;  2JK8 A;  4LFC Q;  2Y0S E;  4NXN Q;  4OO1 G;  1SMX A;  3HKZ G;  4BBR G;  1N34 Q;  2UUC Q;  4X66 L;  3CCU A;  1SFO H;  1L1O C;  4IFD J;  4JI4 L;  1WI5 A;  4DV0 Q;  4OON A;  4A93 G;  4UY8 C;  4JBM A;  4LW1 A;  3A74 A;  3NEN A;  3S15 H;  2NVX H;  4L5R C;  4DR1 Q;  4A75 A;  5GAD C;  1TWF H;  3RNU A;  4O0A A;  4P74 A;  3OYY A;  2VNU D;  3J80 i;  4QL5 A;  2K75 A;  4ME3 A;  5FJ8 G;  4DR5 L;  3S1M H;  5M3F G;  1BKB A;  3AFP A;  1A63 A;  5IT9 c;  1GM5 A;  2I0Q A;  2R7F A;  1L1O B;  4LF4 Q;  1VQG A;  1BVS A;  2AKW B;  1E22 A;  3CC7 A;  4B3R Q;  5IY0 A;  1CKO A;  3HOX H;  4JI8 L;  4DR2 Q;  5J3B A;  4JI7 L;  5IYC H;  1YJW A;  3H15 A;  2VQE Q;  1PH1 A;  1KAW A;  4LUV A;  1YVC A;  2UXC L;  3DM3 A;  1LTL A;  4UPA A;  1FL0 A;  2Z0S A;  5JEA G;  5HY6 A;  1HR0 L;  1EQQ A;  2AHO B;  3G71 A;  2F3I A;  1VCI A;  4RG1 A;  3CP0 A;  3NEL A;  4IFD I;  4GLX A;  3PIO A;  1UE1 A;  1Y1W G;  2C35 B;  4JOI A;  4L5T A;  2CFM A;  3AYH B;  3IRB A;  3KDF B;  4GN3 B;  4HIM A;  3AFQ A;  4EX5 A;  1IBM L;  3TEH B;  2K4K A;  1WCM H;  2LXK A;  3PUV A;  2WB1 G;  3K0X A;  4OWX B;  1IYJ B;  1A62 A;  1HZC A;  4A3G H;  2VQF L;  1QUQ A;  3S1Q H;  5LMU L;  4Y52 H;  4QIW E;  3RR5 A;  2IHF A;  1KL9 A;  3G6E A;  4JI6 L;  3GTM H;  2JA6 G;  3PCO B;  4BY7 H;  2B63 G;  1SLJ A;  3I4M H;  4R4O A;  1D7Q A;  4JYA Q;  4H02 A;  1VQJ A;  4YY3 L;  3KJP A;  4HJ7 A;  2KEN A;  1P8L A;  4C3I H;  4DAM A;  4JI6 Q;  4X62 L;  4IJH A;  3JAM c;  4NXN L;  4BXX G;  3KF8 B;  3HOZ G;  1PHJ A;  1K83 H;  1X3E A;  5C3E G;  1N34 L;  3I4N H;  3KFU A;  3GTG H;  4LUZ A;  3KOJ A;  3S16 H;  1CKN A;  4BY1 H;  5JJI A;  3F2C A;  2CWA A;  4LNQ A;  2KHJ A;  4OX9 Q;  2E2I H;  4A3D G;  2Q2T A;  2EIF A;  1D8L A;  4DR1 L;  1CKM A;  2VL6 A;  4DNI A;  4R1J A;  3J7Z C;  3GO5 A;  3OTO L;  1B8A A;  1GO3 E;  2BA0 A;  4X66 Q;  4GN5 A;  3I55 A;  4JI4 Q;  1JB7 A;  4JBJ A;  2DUD A;  3CPF A;  3E9I A;  1VQB A;  1YZ6 A;  2VUM G;  4JI3 L;  2OTJ A;  5C4X H;  1YHA A;  1X3F A;  2JE6 I;  4Y7N H;  3J81 i;  2EXD A;  3L0O A;  3UDX A;  4A3J G;  1M1K C;  4LFB L;  3PUW A;  4DUZ L;  4A3K H;  1SE8 A;  1Q7Y C;  4MNO A;  3L7Z C;  4DV7 Q;  3A0J A;  2HHH L;  3CMA A;  1SRO A;  2N49 A;  3HOW G;  1KRT A;  4BBS G;  1U0L A;  5AJ3 L;  2JJQ A;  3GTP H;  4DV5 L;  1UE7 A;  2AMC B;  3CCR A;  1EWI A;  1J5E L;  5IP9 G;  2WP8 J;  4HIO A;  4JI8 Q;  2LSS A;  4JI7 Q;  2UXC Q;  3CCJ A;  4XTC S;  1I6H H;  2WFW A;  2UUB Q;  4JI0 L;  3S1R H;  1VQ5 A;  2N78 A;  1PYS B;  3PO3 G;  1AE2 A;  1EQR A;  1XTD A;  1XNQ L;  3H0G G;  1K0R A;  4DR4 L;  1ASZ A;  4DUY Q;  3PO2 H;  4A3B G;  1SR3 A;  4JI1 L;  3MEF A;  1PA6 A;  1RIP A;  1GD7 A;  1VQE A;  3AEV A;  4PG3 A;  4P73 A;  2R93 G;  1PH5 A;  1IBM Q;  5JJL A;  4B3M L;  1EUJ A;  3H3V I;  3J7A 5;  1WJJ A;  3W1B A;  4OWW B;  4JC0 A;  4LF5 L;  3W5O A;  3RLF A;  2JA7 H;  3G48 A;  1EOV A;  4PZ8 A;  1VQH A;  1FGU A;  4DKA C;  5C44 H;  1R9T H;  2VQF Q;  1A0I A;  3UDG A;  4JYA L;  3F8T A;  3OW2 A;  4GKJ Q;  2QA4 A;  2OTL A;  1HH2 P;  5LMU Q;  1EIY B;  4HIK A;  4KHP L;  2WB1 E;  3CCM A;  3J81 c;  2HQL A;  1PFS A;  1CSQ A;  1X55 A;  2F52 A;  2K50 A;  5GRO A;  5LMN W;  4A3E G;  1HNX Q;  3ER0 A;  4GKK L;  5H1S E;  2RF4 A;  1FVI A;  3PUZ A;  3GDE A;  3GTL H;  1CUK A;  3K7A H;  4PZ7 A;  5IWA Q;  1VQ7 A;  2ZJR A;  2E2H H;  4YHH L;  4OX9 L;  3STB C;  4DR7 L;  1VQD A;  4IPD A;  5IYB H;  3CCL A;  1W2B A;  4C2M H;  2IHE A;  3J81 j;  4LUO A;  2ES2 A;  3I2Z A;  1BBU A;  1Y1V H;  3KJO A;  4C3J H;  2JA8 G;  3H3V H;  1Q8K A;  3HOU G;  3SGI A;  1YBY A;  2NZH A;  2RHQ B;  1CKN B;  3LGJ A;  2B3G A;  2R7Z H;  1JJG A;  3ZJY C;  2ZM6 Q;  3OTO Q;  3EIV A;  5FLM G;  3S1N H;  2GVA A;  4DR6 Q;  3FKI G;  4R4Q A;  4AYB G;  1OXS C;  4DV7 L;  3T1H L;  1JMC A;  2JA5 H;  3CCQ A;  4JI3 Q;  1XPU A;  4A3C H;  2PMZ E;  4KLK A;  2IT1 A;  4POG A;  1SRU A;  3GD7 A;  2JQO A;  1PH6 A;  1WYD A;  3M4P A;  2VY3 A;  5C4J H;  4LFB Q;  4AH6 A;  2ZTC A;  1VQM A;  5C0X G;  4DUZ Q;  3M85 A;  1O7I A;  1N36 L;  2HT1 A;  3TRZ A;  1LYL A;  2YTX A;  3HOV G;  2HHH Q;  2RHS B;  3HOY H;  1VQL A;  3L2P A;  3F2B A;  2UUB L;  5AJ3 Q;  1HR0 W;  4DV5 Q;  1NY4 A;  4GNX C;  1J5E Q;  1JE5 A;  4YCW A;  1C0A A;  2NN6 G;  1XNR L;  1KRS A;  5GQO A;  1C9O A;  4DUY L;  3K8A A;  4A4I A;  3GTQ H;  4JI0 Q;  4PZ6 A;  4OXP A;  1GKH A;  3TS2 A;  3STB D;  2RCN A;  1XNQ Q;  4GNX B;  3TS0 A;  4DR4 Q;  1JT8 A;  1HZ9 A;  1V43 A;  1VQ4 A;  1NMG A;  4JI1 Q;  4ALP A;  4J15 A;  1N32 Q;  4GKJ L;  4YWK A;  4QGU A;  4LF6 L;  4B3M Q;  3J80 c;  2VW9 A;  1HNX L;  5BR8 L;  4A3F H;  2GN5 A;  4YCV A;  4LF5 Q;  2D62 A;  3BZC A;  3ULJ A;  1M90 C;  5M3M H;  2R92 H;  1S72 A;  3PV0 A;  5IWA L;  5GAE C;  1VQI A;  3TRE A;  3HOX G;  4KHP Q;  1YEZ A;  1U5K A;  4JI5 L;  2KHI A;  1TXY A;  1VQN A;  5IYC G;  4WJ4 A;  1K8G A;  1WOC A;  2K5H A;  4APV A;  4GKK Q;  2FXQ A;  4JBK A;  2ZTD A;  1HJP A;  2I5L X;  4TVA B;  1G29 1;  1KC8 C;  2WAQ E;  1A8V A;  1UWV A;  3D0F A;  1PH9 A;  4YHH Q;  1P16 A;  4DR7 Q;  3PIP A;  4HJ9 A;  4IJL A;  1E3P A;  3E0E A;  3KF6 B;  3K81 C;  1FJG Q;  2ZM6 L;  1UEB A;  1TWG H;  3M7N A;  2CCZ A;  3BZK A;  3CCS A;  3VDY A;  2EQS A;  2Y0S G;  2YTY A;  1VQF A;  4DR6 L;  1Q1E A;  4A3I H;  3A5U A;  3ICE A;  5ELN A;  1CSP A;  1WCM G;  4R4C A;  3ULL A;  4C3H H;  3HKZ E;  2AWN A;  5IP7 H;  4DV6 L;  4POF A;  1Q81 C;  2VZA A;  2BA1 A;  3M4Q A;  3S24 A;  1Q46 A;  4NB3 A;  5IYD H;  4A3G G;  1KIX A;  4LF8 L;  1KHI A;  4KHZ A;  4UP7 A;  5DLQ E;  4JV5 L;  4K0K L;  4A3L H;  1TWC H;  2E2J H;  3K80 C;  3T1H Q;  2MQH A;  1ASY A;  4OWT B;  1YHQ A;  1B70 B;  4R4I A;  4P72 A;  4BY7 G;  2ZJP A;  4LFA L;  2CKZ B;  4OO1 I;  3CCE A;  5E7N A;  5JEA J;  1V9P A;  1Q82 C;  3CC4 A;  4LF7 L;  2Q2H A;  2N3S A;  4DV2 Q;  1N36 Q;  4IFD G;  1OXT A;  3HFZ B;  1VQ9 A;  3WWV A;  4IPH A;  4LWC A;  1HNZ Q;  3I4N G;  1MJC A;  4GN4 B;  1KD1 C;  3M9B A;  4GNX A;  1OTC A;  4BY1 G;  4B3T L;  1XNR Q;  3S2D H;  3DLL A;  2UXD L;  1L2F A;  3CAM A;  4X6A H;  2ASB A;  1E1T A;  1UE5 A;  2QGQ A;  2R6G A;  3CPW A;  1X56 A;  3RN2 A;  1VQP A;  1N32 L;  5M5W H;  3PF5 A;  1C7Y A;  4DV4 L;  4JBW A;  2BH8 A;  4IO9 A;  1VQC A;  2PI2 E;  2UUA L;  2V1C C;  4L5S A;  5GAG C;  4A3M H;  1VS0 A;  2OWO A;  2XGT A;  1VQ6 A;  5C4X G;  4R4T A;  4WJ3 M;  1I5F A;  5M5Y H;  4DPG A;  4BBR H;  1YI2 A;  4LF6 Q;  4A3K G;  3EBE A;  3NBH B;  2L15 A;  5BR8 Q;  4A93 H;  1LUZ A;  3HOU H;  2K5V A;  3NEM A;  1Q86 C;  2PNH A;  4LF9 L;  4QQB X;  5ELO A;  3KF6 A;  1E1O A;  1S40 A;  4JI5 Q;  4DV1 L;  5FJ8 H;  1FJG L;  2I5M X;  2KCT A;  1OXU A;  4YWM A;  1YIJ A;  2F4V Q;  5M3F H;  3K7U C;  1NJI C;  1JJC B;  4GOP A;  2IY5 B;  3CF5 A;  3PF4 A;  3GTK H;  2I5H A;  2UU9 L;  3I4O A;  1Z47 A;  2B29 A;  3PO2 G;  4EQ5 A;  1V1Q A;  2CQO A;  1GVP A;  4RMF A;  5IE8 A;  5M5X H;  3CXC A;  5GAH C;  1Y14 B;  2E8G A;  2ZTE A;  4UP8 A;  4XIG S;  1N8R C;  4P75 A;  1X65 A;  3A5Z B;  2DGY A;  4X64 L;  3GTJ H;  1I50 H;  3PGZ A;  4DV6 Q;  1NMF A;  1K9M C;  2JA7 G;  1B7Y B;  2Q2I A;  5C44 G;  4GS3 A;  2PQA B;  1JJ2 A;  1Y1W H;  2MNA A;  2Q2U A;  4NXM L;  4LF8 Q;  2JEA I;  1HNW L;  4JV5 Q;  4A76 A;  4K0K Q;  4DV2 L;  1EIF A;  1MKH A;  2BH2 A;  2ATW A;  4HJ5 A;  1HNZ L;  1XJV A;  3U4V A;  1XMQ L;  1YHB A;  1I94 L;  1I3Q H;  4LFA Q;  1K73 C;  4LF7 Q;  4P71 A;  3ULP A;  2OQ0 A;  2E5L Q;  2NVY H;  3W1G A;  2K52 A;  1NTG A;  3KYH C;  4JG2 A;  5IYB G;  1Q1B A;  1OXV A;  1XMO L;  1EYG A;  2KCM A;  1IXR A;  1E24 A;  2B63 H;  2JA6 H;  1Y1V G;  4B3T Q;  1K8A C;  2A8V A;  3GTO H;  4IOA A;  1G51 A;  2UXD Q;  3T1Y L;  3JAM i;  2R7Z G;  2JA9 A;  1L0W A;  4AQY L;  2A19 A;  4QY7 A;  1IBL L;  1N33 Q;  4MTN A;  4BXX H;  1RL2 A;  1TWH H;  1WFQ A;  4X65 L;  5C3E H;  4DV4 Q;  1PH8 A;  1PH2 A;  3U58 A;  3HOZ H;  2OQK A;  2UUA Q;  1E7Z A;  2JA5 G;  4A3C G;  3S17 H;  2LXJ A;  2ZJQ A;  1IL2 A;  4A3D H;  3PUY A;  4JI2 L;  3CME A;  4B3S L;  1IBK Q;  1KXL A;  1XPO A;  3HOY G;  3U50 C;  2F4V L;  2H5X A;  1X54 A;  3MXN B;  4DV3 Q;  4GOP C;  1PV4 A;  2VUM H;  4LF9 Q;  1PH3 A;  1KQS A;  3BJU A;  2HIV A;  4DV1 Q;  2Z6K C;  4A3J H;  1G6P A;  1W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...