4R4QA

Crystal structure of rpa70n in complex with 5-(3-((n-(4-(5-carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4qA00
1OXSC 3KF6B 2LXJA 2Q2HA 3M9BA 5BR8Q 4GNXC 4A3MG 3PF5A 1GM5A 1OXTA 2WB1E 2QA4A 4JI8Q 3T1YQ 3HOYH 2Z0SA 1LUZA 4GOPA 1B7YB 3UDXA 3CCJA 4B3TQ 3RZOH 1VQEA 5LMUQ 4JOIC 1L1OC 2OWOA 2IT1A 3PV0A 5C0XJ 3ERSX 1YNXA 1XTDA 3AEVA 2D0PA 5GAHC 2OTJA 2IHEA 5C3EH 4JI0L 1QZHA 4IOAA 4A3EH 2AMCB 4A3KH 3TRZA 4RMFA 5M3MH 1GO3E 4LF9L 2JA7H 4B3RQ 4IPGA 2ZTEA 5FLMG 4BY7H 2VQEL 4BXXH 1S3OA 3J7A5 3S1NH 2KCTA 1N33L 1WI5A 4UPAA 3PUXA 3NELA 3PGZA 1XMOL 3S14H 1IXRA 3K0XA 2N78A 3K8AA 4DR5Q 1K73C 1KHIA 2D0OA 3RR5A 4GKJQ 1PVOA 1UE6A 3RNUA 4AQYL 4BA2I 1AH9A 1TWGH 4LUVA 4X62Q 4IFDJ 3BZKA 3AQQA 1V43A 2E5LQ 2VL6A 4GLVB 5C4XG 1TWAH 4LW1A 1HNZL 1QVCA 2A1AA 3PSIA 3JAMi 1WFQA 4DV1Q 2E2HH 3TS2A 1YJNA 4PZ8A 2PNHA 1ASYA 4YY3L 1O7IA 5AJ3Q 4A3DG 4UP7A 2RHSB 2PQAA 2UUAL 3KFUA 1HZBA 2AHOB 4DV4Q 4QY7A 4DV5L 1JJ2A 3A5UA 4JI6L 3KYHC 1IBLQ 1SLJA 2YTYA 4MZ9A 5FJ8H 3GTGH 5C0XI 4O2DA 1KD1C 5IYCG 3F2BA 2L15A 5LMNL 2AKWB 4DV3Q 1HNWL 4LF6L 4A4IA 4X66L 1FVIA 1PH5A 2IHFA 1IBKL 2F4VL 4AH6A 4A3MH 1N33Q 4DV2Q 3VDYA 1J5EQ 2VW9A 3CC2A 2IY5B 4A3IG 2UU9L 1Y1WG 1PH3A 3UE1A 1I94L 1KL9A 3CCRA 3T1YL 2ZTCA 2UUCQ 1VQBA 5LMNW 3H3VI 1CUKA 4BBRG 3CCSA 1H95A 2JE6I 3BZCA 4LFCL 1HH2P 5FLMH 3M85A 3AFQA 3CCEA 4IO9A 1L0WA 4A76A 1VQ5A 2OCEA 1N8RC 1X65A 2HHHL 1VS0A 3CPWA 2ZM6Q 2NVXH 4JI7L 4KHPL 5JEAJ 3CMEA 4A3CH 4B3ML 2JQOA 2WFWA 4TVAB 1VQ8A 5IYDH 1VQJA 2K4KA 1FGUA 2Z6KA 4P71A 3J80i 3J80c 1D8LA 2ZTDA 4KHPQ 1S72A 4OWTB 1CSPA 2IX0A 3RLNA 2MNAA 4DR4L 1MKHA 2F52A 4GN4B 4YWKA 4A3JH 4R4CA 5FJ8G 4K0KQ 2VZAA 4R4TA 3I55A 4OX9Q 2K52A 4R4QA 5GADC 2KCMA 4IFDI 3CF5A 1N36L 1PA6A 2VQFL 4JBWA 2V1CC 4POGA 3S1RH 2F3IA 1EUJA 4ALPA 1MJEA 3EN2A 1YVCA 4GOPC 4LFCQ 2VQFQ 1HR0W 2EQSA 4QQBX 5GROA 2XGTA 1PHJA 1CKMA 3PIOA 1E22A 4LF5Q 2HQLA 4A3BG 1N32Q 2IX1A 1L1OA 1IL2A 3K7AH 1TWCH 4B3SL 4A3GH 4JBJA 1NY4A 1YIJA 2WP8J 3J7ZC 5GAEC 4YCVA 2UXCQ 1NE3A 3HOVH 3NBHB 3A74A 3S17H 4X66Q 3TQYA 3PUZA 1GD7A 1T9HA 4UP9A 3K80C 2JK8A 4LUZA 4R4OA 3H0GH 1BVSA 1B8AA 4KI0A 4YWLA 5C44G 4QIWE 1YJ9A 1EIYB 4NXMQ 4A3CG 1LM0A 4HJ7A 2NN6I 3CCVA 4GNXA 3KDFA 4P75A 1IBML 2DGYA 2R93H 3CC7A 2YTXA 2E2IH 2ZM6L 1A0IA 4JI7Q 2MO0A 2R7ZG 1V9PA 5M3MG 1HNZQ 1EFWA 1Y1VG 3AYHB 4JI1L 1FJGL 1VCIA 4DV4L 4JOIA 4KHZA 2B63H 1Q8KA 3T1HQ 5AJ3L 4JCVE 3GTKH 4Y52H 1QUQB 1X9NA 3HOZG 4DV0L 4JV5L 4JI1Q 4DV1L 3S24A 4BBSG 1PH2A 4A75A 1I6HH 1VQLA 4DPGA 1JB7A 4UP8A 3JC66 4DR2L 1KXLA 2R92H 1VQCA 1Q81C 3HOWH 3G71A 4LF6Q 4L5SA 3S16H 4YCWA 4AQYQ 2HIVA 1YBYA 1Q46A 1BBWA 2WB1G 3M4QA 2CWPA 2NZHA 1YITA 1XMOQ 2RF4A 2OQ0A 3I4OA 2R7DA 1BBUA 4BY1H 1A63A 1CKNA 3S2HH 1MJCA 2AWOA 2PMZE 4JI5L 3H0GG 1JJGA 4L5RC 1G51A 4X65Q 2Q2UA 3B6YA 2JA6H 2NZOA 2YYZA 3KLWA 3HOVG 4YHHL 2K50A 1B70B 4DAMA 2UXBQ 1XPUA 3HOXG 3T1HL 2GN5A 2QEXA 3GTMH 4JBKA 3D0FA 1FL0A 4APVA 1E3PA 4B3TL 4OWWB 1JT8A 5LMUL 4UY8C 3CXCA 4NXNL 1YHAA 2VQEQ 4JG2A 1K0RA 1K8GA 2HHHQ 1VQMA 2BH2A 3F2CA 1I3QH 1W3SA 1X6OA 2JA5H 3PUWA 4XTCS 3A0JA 2ZJRA 1KRSA 4AYBE 3RZDH 4JI0Q 4RG1A 1JMCA 3J81c 1OXUA 3J81j 1YJWA 1GVPA 4DR6L 4BY1G 4DKAC 2EIFA 1CKOA 1XNRQ 1UEBA 4OX9L 4K0KL 4R4IA 4JC0A 1SN8A 3WWVA 2CKZB 1PH1A 2UU9Q 3RN5A 3SGIA 1K3RA 3Q8DA 3L2PA 1XMQQ 5HGQA 3E0EA 4JI5Q 4PZ6A 5IP9G 4HJ9A 2MO1A 2DUDA 4LF7L 2HIXA 4POFA 3STBD 5M5WH 1XMQL 1M1KC 4OO1G 2ES2A 3I4NH 4DR7L 3FKIH 4LF5L 1Y1WH 2VS1A 3S2DH 4HJ8A 1SROA 5IE8A 4NPSA 5ELOA 2UXDL 3U4ZA 4L5QA 1SFOH 5M3FG 4GLAC 4HIKA 4B3MQ 2Z6KC 3M4OH 4BBRH 2K5NA 4DNIA 1OTCA 3PUYA 3CMAA 3IRBA 2QGQA 3CC4A 1SMXA 4P74A 1IBLL 2B29A 3JAMc 1X3EA 4J15A 1IYJB 1Q12A 1Q1BA 1XNRL 2R6GA 4DV2L 3HOZH 4AIMA 2BH8A 4PG3A 1J5EL 1A62A 2OQKA 2A8VA 4C3HH 2UUCL 5M5YH 1IBKQ 2F4VQ 4DK3C 1Q7YC 4A3LG 1KRTA 1EQQA 1G6PA 1Y1VH 1PV4A 4JI2L 3TREA 1X56A 2PQAB 4A3JG 4KLKA 2YV5A 1NTGA 3D31A 1EYGA 3CPFA 2LXKA 2R92G 1SRUA 4NXML 4BY7G 1D7QA 1OXXK 3PO3G 1HZ9A 5IP7G 4QJFA 3W1GA 1XNQQ 2JA5G 2R93G 5IYCH 4DR1L 1YI2A 2XTIA 4DUYQ 1QZGA 2CFMA 2I5LX 4JV5Q 1UE7A 3CP0A 3HOUH 1WYDA 3E9HA 3HOWG 5C44H 2B63G 1VQDA 1VQ7A 4H02A 4JI6Q 5E7NA 2JA6G 4IPCA 1LTLA 1C0AA 4GLXA 4LFAL 4PZ7A 1E24A 4IFDG 1V1QA 3K7UC 1S40A 4DR3Q 2D62A 1TWFH 3PUVA 4DR5L 2VY3A 5ELNA 4C3IH 5LMNQ 4GKJL 3KOJA 5FLXc 3LGJA 1KAWA 2JA9A 1P8LA 2E5LL 3PF4A 5C4JH 3BJUA 3TEHB 4OO1I 1Z47A 1I5FA 1C9OA 1E7ZA 3I4MH 4IPHA 2GVAA 3KJOA 2CCZA 3G6EA 1QUQA 3RLFA 1M90C 3GTQH 4HJ5A 1WCMH 4IJHA 1N36Q 4A3LH 4LNQA 3CD6A 3ULJA 3OTOQ 1XNQL 3L0OA 5C0XG 4DR7Q 3GDEA 2K5HA 3GTJH 4LFBQ 1X3GA 3U4VA 3G4SA 4A3IH 2UUBQ 1UE5A 3U58A 1N32L 3L7ZC 4DAYB 2ALYB 4DV0Q 3ZJYC 2MFIA 3OW2A 3PO2H 4JYAQ 2UXCL 1EIFA 3A5ZB 2EXDA 1L1OB 3ULPA 5IYBG 1HR0L 2KENA 1A8VA 1NMGA 1CKNB 3J81i 3TS0A 4X64L 1OXVA 3FKIG 3M3YH 1HZAA 1N9WA 3F1ZA 3M7NA 4BBSH 4LWCA 2MQHA 1X54A 4LUOA 3UE0A 5IYDG 5M3FH 1XJVA 2YU9H 3KJPA 4MTNA 1VQ4A 4LF7Q 4DV6Q 3CQZH 4LF8L 3S15H 5IWAQ 4YHHQ 1MIUA 2I5MX 1KIXA 4OWXB 2KHIA 4TQUS 2JEAI 4X65L 3K81C 4L5TA 1RIPA 4HIOA 3CCQA 5IWAL 4O0AA 1KQSA 2YTVA 1WJJA 1R9TH 4NB3A 2B3GA 1W2BA 4Y7NH 4GOPB 4A93G 1E1TA 1JE5A 1TWHH 1K8AC 2UXDQ 1AE2A 1X55A 1PYBA 3CCMA 1EQRA 3KF8B 4EQ5A 2K14A 4LF4L 5IP7H 3F2DA 1DGSA 1WCMG 3I4MG 2I5HA 4DR6Q 1VQOA 3HOXH 2GVBA 3W5OA 4JI3Q 3PCOB 4IJLA 1WOCA 1RL2A 2RCNA 3ULLA 3H15A 4DV7Q 1VQHA 3W1BA 3UDIA 1HNXQ 4JI4Q 5JJKA 5IY0A 3MXNB 3I4NG 4A3FH 2ZJQA 1EOVA 2CWAA 1PH6A 2OTLA 2VUMG 2R7FA 2Y0SE 5DLQE 4ME3A 3U50C 3PO2G 1HZCA 1VQKA 1PFSA 2NN6G 4C2MH 2UUBL 2JA8G 1SE8A 1L2FA 2Q2IA 4HIMA 1EWIA 1X3FA 2E8GA 4JBMA 3S1QH 3RN2A 3NEMA 4NXNQ 2HT1A 3GTLH 3NENA 2AWNA 2PI2E 1HR0Q 4GN5A 4DV5Q 1Q82C 4DV3L 4B3RL 3RLOA 1HNWQ 2UXBL 2KBNA 1YZ6A 4OXPA 1VQFA 5M5XH 4A3DH 4JYAL 3FP9A 3CCLA 2H5XA 1P16A 2BA1A 4A93H 1VQIA 4YWMA 3DLLA 4BA1I 3ER0A 1ASZA 2VNUD 3DM3A 4A3FG 1VQGA 3I7FA 1PH9A 4A3GG 3GTOH 3GD7A 3HKZG 4DUZQ 4JI2Q 2K75A 1QVGA 2CQOA 3EIVA 4FDBA 4X62L 1Y14B 1I94Q 2Q2TA 3HKZE 1Z9FA 1U0LA 4IPDA 1HJPA 4EX5A 1UE1A 1FJGQ 1J6QA 5JJLA 1C7YA 3GO5A 4BXXG 1PH8A 3AFPA 3OTOL 3UDFA 5HY6A 4GNXB 1QVFA 3KDFB 4JI8L 3OYYA 2JEBI 1VQ9A 3S1MH 3FHWA 2UUAQ 1JJCB 1VQPA 4PMWA 4YY3Q 3MEFA 4QGUA 1CSQA 2NVYH 4YCUA 4DUYL 1XPRA 3EBEA 1NMFA 5JJIA 2N3SA 4LFAQ 2LSSA 4P72A 3UDGA 3H3VH 2K5VA 4X6AH 5GAGC 2N8NA 4DR2Q 3HKSA 4B3SQ 5GQOA 1PYSB 1AE3A 4HIDA 4LF9Q 5C4XH 4DV7L 4DR3L 3STBC 3F8TA 1HNXL 1YEZA 2I0QA 1UWVA 1G291 4JI4L 2VUMH 4WJ4A 5K36G 5IT9c 2WAQG 4JI3L 3CCUA 4DUZL 3M4PA 1Q86C 4IOCA 3HOUG 2ASBA 2ID0A 1N34Q 2JA8H 4A3BH 1K83H 2BA0A 4LF8Q 4OONA 1YHBA 1NJIC 4GKKQ 5J3BA 1N34L 1IBMQ 4DR1Q 3HFZB 3G48A 1NBWA 1IZ6A 1SR3A 4P73A 2A19A 1TXYA 4DK6C 2KHJA 1PH7A 5C3EG 3CAMA 1YHQA 3I2ZA 3E9IA 2Y0SG 3PIPA 4A3EG 4A3KG 3KF6A 1E1OA 1Q1EA 1KC8C 4GKKL 2JJQA 2FXQA 1PH4A 2RHQB 3BU2A 4C3JH 4LFBL 2C35B 4XIGS 4WJ3M 3CW2C 1K9MC 4DR4Q 1U5KA 1BKBA 2PI2A 4MNOA 4GN3B 4HJAA 5IP9H 2ZJPA 2WAQE 1XPOA 2E2JH 1GKHA 3I56A 3HOYG 1I50H 2R7ZH 3GTPH 4LF4Q 4QL5A 5H1SE 2JA7G 5JEAG 1VQNA 4R1JA 4GS3A 2NVTH 5BR8L 1LYLA 4X64Q 4DV6L 2NVQH 3ICEA 4AYBG 1VQ6A 3PO3H 1VQAA 2N49A 2ATWA 5IYBH 5EAYA
chains in the Genus database with same CATH superfamily
4GNXC 2LXJA 5BR8Q 2WACA 1OXTA 2B2VC 3HRZC 5FO8B 4UDUC 1B7YB 2AUJD 4F88A 4JOIC 1E2VA 3V2TA 1AP0A 1CFMA 4IOAA 1QZHA 1EZ6A 1NNXA 2QKIC 3VR3A 5M3MH 1EWCA 4LF9L 1PFBA 2QDBA 5CV7A 1LLRD 5FLMG 4BY7H 1O7ZA 1S3OA 3IFDA 3J7A5 1G91A 1BR9A 1N33L 1WI5A 2Q8TA 4ID6A 4UPAA 1SBBB 1T5XD 3PUXA 2KJXA 3K0XA 2N78A 4DR5Q 3DEOA 3RR5A 1PVOA 1UE6A 1BCPF 2F3WA 2E5LQ 3P1HA 2XWJB 3QWNA 1PFNA 4DV1Q 1SMYD 4PZ8A 1F2LA 3OMGA 4A3DG 4UP7A 2RHSB 2JA7B 4DV5L 1JJ2A 3J81L 3A54A 3KYHC 1SLJA 2KECA 1RTNA 2B2TA 2K5DA 5LL6S 4C1NI 5IYCG 3F2BA 3QOLA 5DM73 4DV3Q 3OIQA 5IGGA 4A3MH 2K05A 4DV2Q 5C3WA 1J5EQ 2IJ0A 4PV1C 2VW9A 4DFAA 3D4RA 1PH3A 2E2HB 2F1MA 2MPMA 3UE1A 1KL9A 5EPJA 2ZTCA 2UUCQ 1FYCA 2J4XA 4BBRG 3CCSA 2JE6I 2KQ3A 2NYZD 3Q6SA 4CGYB 4A76A 1TWGB 2J7ZA 1JOKA 1HRJA 3BVZA 1X65A 2NVXH 5JEAJ 4B3ML 1ZYRD 2JQOA 3HZXA 2WFWA 1FNWA 1VQ8A 2Z6KA 3J80i 3J80c 4KHPQ 1S72A 1CSPA 4J6HA 1K8OA 3K5NA 2F0UA 5HURA 4A3BB 2EY6A 1E2ZA 4OGQC 4BBRB 4FO2A 2KCMA 2DNCA 2A68C 2L9HA 2V1CC 4LAAA 4DF7A 1EUJA 4ALPA 1MJEA 1I4PA 4QQBX 1PHJA 2F0VA 1E22A 4LF5Q 2QCPX 4V190 1LT4D 1D2BA 4A3GH 3K7AH 1TWCH 1QNUA 1YIJA 1DOKA 1SYBA 3S17H 1U9RA 4UP9A 1QB5D 4QUCA 1WTPA 4KI0A 4QIWE 4KK7A 3ERQA 1EY7A 1S5CD 4KTAA 2XRQD 3CCVA 2BDNA 1T5EA 3CC7A 4C3IG 5DAUA 3KUPA 1A0IA 2MO0A 5M3MG 1EFWA 1NUCA 4DV4L 4KHZA 3A8JE 1RF2D 1TIID 2PZWA 3OW7A 1Q8KA 3T1HQ 1KLUD 2B63H 1V8QA 4Y52H 1X9NA 3V96A 4JPBW 1PH2A 1VF7A 1PMRA 1VQLA 1U4PA 1B4OA 3JC66 1A15A 3K0YA 2XNAC 2Z1CA 4YCWA 1RJTA 2HIVA 1EY8A 5EPLA 2WB1G 3N52A 2NN6H 2O4XA 1XMOQ 1SE4A 4BY1H 1A63A 4J8QA 5EQ0A 4KKTA 4RCNA 3BG3A 3BS1A 1TU2B 1YNJC 2K50A 1B70B 4XYOA 2R93B 2LY7A 4FXGC 1XPUA 3HOXG 2GN5A 3GTMH 2CH4A 4A3MB 1CM9A 1E3PA 4DNRB 3ICEA 3PO3H 1K8GA 3H0GB 5J22A 3VA7A 2JA5H 1W3SA 2Z4IA 3MXUA 4RG1A 3PQIA 1OXUA 4DKAC 2ENBA 4K0KL 4C1NK 3HOWB 1K3RA 1LTBD 5J39A 2RA4A 3S16B 1EYCA 4LF7L 1D5ZC 2F3VA 4OO1G 3R8BA 4A3FB 4MIUA 3FKIH 3O13A 4LF5L 2UXDL 3U4ZA 4L5QA 4K14A 3M4OH 5D14A 1ENFA 3DM1A 4BBRH 3X3MA 1EIHA 3PUYA 3CMAA 1ET9A 1SMXA 2KEDA 4P74A 2L55A 2F0IA 3I4MB 1EU4A 1Q1BA 1S5FD 4CKEA 1Y8NB 1J5EL 2L11A 1Q3LA 2A8VA 4EQOA 3GV3A 4DK3C 1Q7YC 5AFWA 1EQQA 4X3SA 1Y1VH 1PV4A 2AQ2B 2B8FA 3TREA 4OL7A 2EE1A 3SDZA 1EYGA 3CPFA 4NXML 1TWCB 1D7QA 3PO3G 3I70A 3LWEA 1EU3A 4QJFA 4DK1A 1D6EC 2JA5G 3T4AC 2R93G 2Z4HA 5IYCH 1YI2A 2XTIA 2HCIA 3CQZB 4CJ2C 1S4ZA 2XSCA 1WYDA 2QF7A 5C44H 1SSOA 1VQDA 2K28A 1VQ7A 1L0YB 4KHVA 3EJIA 4PMBA 4BBSB 1WTQA 1LABA 4PZ7A 1E24A 1G2TA 3W3AA 4X3UA 1S40A 2D62A 2VY3A 4GKJL 5BN3A 2A74C 1A6XA 1KNAA 1QOHA 2JA9A 3ONAB 4FXKC 3BJUA 1I6VC 5C5LA 1Z47A 1I5FA 4OO1I 2IPKD 1M90C 4HJ5A 1WCMH 2GA4B 4A3LH 3OTOQ 1XNQL 2HCCA 3D3RA 4DR7Q 3G7LA 1EYAA 1SYEA 2EY1A 4LFBQ 3G4SA 2UUBQ 1E2WA 3U58A 2UXCL 4DV0Q 2MFIA 2KCCA 3TSSA 4C2MB 2EXDA 1L1OB 1Z7TA 3S1QB 1NMGA 3J81i 3KBGA 4C3JB 3TS0A 4BS9A 4QUFA 4X64L 1WD1A 5IOCA 3UI2A 1LTID 1N9WA 4LWCA 2MQHA 1X54A 4YIJA 5IGEA 1XJVA 2OF1A 4RGTA 5A35A 2LFNA 4L63B 2EJGC 2O5JC 1V1PB 2IL8A 3GTLB 3MFGA 1DD2A 2KHIA 4TQUS 2EY2A 5CV5A 2EYOA 2YTVA 1WJJA 4LMQD 4H44C 4KN4C 3RMHA 4A93G 1B44D 1TWHH 1X55A 1EQRA 3S1MB 4GZYC 4N8FA 3EVQA 1M4VA 2GVBA 1EYDA 1WOCA 3ULLA 5JJKA 1SJHD 1VQHA 2K01A 3UDIA 3W1BA 4G7HC 3MXNB 3PIO3 4A3FH 5IT9L 4HN7A 1PH6A 3TP7A 1HQMC 2OTLA 1QWYA 4B9XA 3QOJA 4ODGA 5T1IA 3PO2G 1EY0A 1HZCA 1BOSA 3RN2A 2HT1A 4HSVA 4OEMB 3URYA 4CBVA 1TWAB 2PI2E 1D5XC 3OIPA 1QE6A 1STBA 1Q82C 4DV3L 3T56B 2UXBL 1SMYC 2KBNA 4JYAL 1VQFA 5D3IB 2H5XA 3TP6A 4YWMA 4IUVA 1AZQA 1K83B 4A3FG 3I7FA 1CTMA 3GTOH 3GD7A 3HKZG 5IGCA 4HAEA 3EIVA 4FDBA 3SK4A 3QR8A 2EZVA 5C4XB 1B50A 1Z9FA 4EX5A 3VYRA 1FJGQ 2NVQB 3UDFA 3OYYA 4A3DB 1VQPA 2E2JB 4YY3Q 4QGUA 2NVYH 1GUTA 2JXMB 2G9HD 1NMFA 4KY6A 2V4DA 4LFAQ 4X6AH 5FK9C 2K5VA 2F0NA 1IYVA 1F9QA 3HKSA 2I07B 3TDQA 1AE3A 4HIDA 3F8TA 1YEZA 3K58A 2I0QA 1G291 4JI4L 2E2DC 4JI3L 3M4PA 2NB0A 5CORA 3K5LA 4G57A 2BE5C 1R4PB 4OONA 1NJIC 3K5MA 4GKKQ 1STHA 1IBMQ 3HGBA 3HFZB 1IZ6A 1SR3A 1TXYA 2X6LA 3I2ZA 4DN4M 2Y0SG 3PIPA 1Q1EA 1VDZA 2EJMA 5FO7B 1KC8C 4PQXA 4C3JH 4XIGS 3I73A 3Q23A 2A68D 4DR4Q 1UEAB 1U5KA 2RSNA 5C4HA 4MNOA 3MZ5A 5IP9H 2ZJPA 1XPOA 2VXWA 3KLSX 1VQNA 5IGDA 1LYLA 2FMCA 2MGSA 4DV6L 4AYBG 3CCJA 3R93A 5EAYA 4N8X1 3PF5A 1GM5A 4JI8Q 3T1YQ 4GOPA 1PRTC 3UDXA 3RZOH 4DU9A 3VYSA 5LMUQ 2OWOA 2IT1A 3EQLC 4R8IA 5GAHC 2IHEA 3EROA 2H4OA 2AMCB 4A3KH 2JA7H 4IPGA 1JCKB 4IUQA 5EKLA 5I9PA 2KCTA 4IURA 1IW7C 1SXTA 3NELA 1K73C 1KHIA 2D0OA 3IFTA 4HSPA 1I50B 4LUVA 2VB3X 5ELCA 1X3QA 3AQQA 3BZKA 1V43A 4MHEA 1GOZA 4RKBA 5C4XG 1TWAH 4LW1A 1HNZL 4X3KA 4M8AA 4RWSC 2E2HH 5JPNC 4YY3L 4G7OC 4KKUA 3HOYB 3S1NB 1JWSD 5JPMC 2KCNA 1ZEQX 2NVXB 1DJRD 2AKWB 1BDOA 1FVIA 2IHFA 2EY5A 2B39A 1N33Q 3VDYA 4A3EB 1PTOD 4A3GB 5EJWA 2HQEA 5FKAC 2UU9L 1Y1WG 3FPPA 3T1YL 2K04A 2WB1B 1JORA 3BZCA 3DUZA 3NWTA 1GUGA 3A7LA 1L0WA 1VQ5A 1PYWD 2RKSA 1GXDC 1N8RC 1VS0A 4JI7L 3CMEA 4A3CH 1L0XB 5IYDH 1NAPA 2K4KA 3S14B 4P71A 2ZTDA 2M2LA 4IALA 3MVVA 1HUMA 4N9TA 4A3JH 4YWKA 4DAYA 2F0DA 3AU7A 1RODA 3I55A 4EVOA 1HFNA 4WJWA 5GADC 2E74C 1PA6A 1C48A 2VQFL 4JBWA 4POGA 3S1RH 4V0BA 2IWHA 2F3IA 2RCFA 5CYUA 4EGVA 4LFCQ 4F87A 1U4RA 2F4IA 1R4QB 1STYA 1STEA 1CKMA 1IL8A 5NUCA 2HQLA 3OHXC 1PRTF 3TZUA 5C3XA 4B3SL 5J1ZA 3J7ZC 5GAEC 4YCVA 4ZK9B 3TQYA 1GD7A 1T9HA 4UAIA 2JK8A 2HDMA 1YJ9A 3H0GH 3H94A 4HCEA 2BCOA 3QIAA 3BYTB 4ZRZA 5ISRA 4GNXA 4P75A 3SK8A 2XIWA 2QW7A 2DGYA 1K0SA 2ZM6L 1V9PA 3E0JA 1Y1VG 4BY1B 1FJGL 3OOCA 1E0BA 4U673 4JCVE 1QUQB 4JI1Q 3RZDB 4BBSG 3KF8A 4A75A 1RCVD 2CQAA 4DPGA 3GTMB 4UP8A 2EPBA 2QEJC 3FKIB 1VQCA 4Z9CB 4CDEC 4CDFC 4LF6Q 5KEEA 4AQYQ 2JA5B 5I4DA 2E2IB 1S5BD 1UAPA 2DN8A 2NZHA 2F0KA 4KY5A 3NTKA 2RF4A 4RHSA 4U68A 5EPKA 1RTOA 5M5WB 1YITA 3S2HH 3LWUA 3OWEB 2JA6H 2YYZA 2B2WC 1WTVA 1SJED 1I6HB 4DAMA 4HCSA 3QB3A 2UXBQ 3T1HL 2QEXA 3D0FA 1FL0A 1PZKD 4P2CB 4UY8C 1YHAA 4EQPA 4JG2A 2BH2A 2A69D 1VQMA 1ILQA 4XTCS 3A0JA 1F9SA 4NP5A 1QJOA 4AYBE 3FVQA 1CQFA 3J81c 1TT2A 3J81j 1GVPA 2EIFA 3U9SA 4ZKBB 3VR2A 4JC0A 2F0MA 3RN5A 3Q8DA 3Q24A 1XTCD 2G5DA 5HGQA 4HJ9A 2MO1A 3WDNA 4CDDC 4I65A 3STBD 1XMQL 3DXJC 3DWPA 3KBXA 4A3JB 3S2DH 4HJ8A 1SROA 3MWYW 5ELOA 5IE8A 1TS3A 4RAUC 4GLAC 4IUPA 3SK6A 4B3MQ 4DNIA 4IQZA 1OTCA 2HD3A 2IX3A 3D4WA 2WAQB 1EY5A 3SHLA 5IGBA 1BXTA 4J15A 1MSHA 5C44B 1IYJB 1I4GA 3HG9A 4PG3A 5M9OA 1SNOA 1A62A 2RDHA 1XYIA 2UUCL 5M5YH 2L5TA 1IBKQ 2F4VQ 3C3LA 2CH4W 1LTAD 4DXFA 4KMUC 3D31A 1NTGA 3K5OA 4BY7G 3NBIA 4ZUIA 1HZ9A 4CKCA 3CHBD 1B9NA 2F0OA 1LT6D 2I5LX 1TS2A 1QG7A 1GUWA 3CP0A 3HOUH 1LTTD 4NDXA 5E4XA 2B63G 5KNDA 5E7NA 4DAPA 4GLXA 4UHVA 2PCFB 4IFDG 3RUZA 4DR3Q 1TWFH 5ELNA 5LMNQ 4C3IH 4F7XA 2WKDA 1EWHA 1DM0B 2RBMA 2E5LL 5C4JH 1SNDA 1C9OA 1JQYD 3GTQH 3G6EA 3RLFA 3OWFA 1SDFA 2X69A 3CD6A 4DAVA 3SE0A 1I4QA 5C0XG 3H6MA 3GV6A 3GDEA 2K5HA 2KOLA 1GJXA 1UE5A 2AUKA 3L7ZC 2ALYB 2KA7A 3ZJYC 3OW2A 3ULPA 5CR3A 1ENCA 1U4LA 4HMIA 1EOTA 2R3ZA 1ZXTA 5D65A 1OXVA 3FMCA 3M3YH 3F1ZA 1JWMD 1MD2D 5IYDG 3BYYB 3NUCA 4MTNA 3SXHA 4DV6Q 4LF8L 1YNND 4IUNA 1B9MA 2E76C 5A2QE 1RIPA 3CRKC 4HIOA 5IWAL 4RCOA 4O0AA 4RFBA 4IN3A 3TBIB 5FLXL 1B3QA 1R9TH 2B3GA 1GUNA 4HTHA 1K8AC 2UXDQ 1TKWB 4ILWA 3Q0AA 1PYBA 3CCMA 1SAPA 3KF8B 2K14A 4OIKA 3GTJB 4FF3A 3I4MG 2I5HA 3U9OA 3HEJA 1VQOA 3W5OA 3PCOB 1ZYRC 1HNXQ 2MP1A 3LX0A 1DXMA 5C4ZA 1EOVA 5EKKA 2P5ZX 1BNZA 2VUMG 3U50C 1PFSA 2UUBL 2JA8G 3NQTA 1J9OA 1L2FA 1EWIA 1KDCA 2PQEA 3C1EA 2C5CA 2BDOA 2K32A 1QILA 2BOSA 1HNWQ 4OXPA 4A3DH 3CCLA 3HS0C 4A93H 1VQIA 4ZCKA 3DLLA 2VNUD 3S15B 1H9RA 3MXPA 2F0SA 4X62L 2Q2TA 1Y14B 1I94Q 2OEOA 1LV9A 5A2QL 2N88A 1PH8A 5KIXA 4GNXB 1QVFA 2AQ3B 3SR1A 1ICWA 4WRDA 1PTOC 1BQQT 3FHWA 1CZGA 4PMWA 1G2SA 2O5IC 1CSQA 1B3AA 1TWFB 3EBEA 5JJIA 2H1EA 3H3VH 4DR2Q 2N8NA 5GQOA 5CBAE 4LF9Q 2A5HA 3P7JA 4DR3L 3STBC 1HNXL 1MHWC 5IT9c 2WAQG 4DUZL 3HOUG 2ASBA 4RGNA 2ID0A 1N34Q 2QILA 2ZXOA 1PZID 4BWGB 2SEBD 5FLXE 4CKBA 5C3EG 3CAMA 1YHQA 4A3EG 3KF6A 4ZKCB 2JJQA 2FXQA 1PH4A 3BU2A 3X3NA 1QCBD 1BCPB 3A7AB 3M3YB 1OO9B 1BKBA 2F0PA 2EYJA 4GN3B 1AFPA 2WAQE 4XDXA 1TQOA 3HOYG 2L0CA 4LF4Q 1F9RA 5JEAG 1FNVA 4GS3A 1CHPD 2J0TD 1VQ6A 1VQAA 2F0QA 2ATWA 5IYBH 1LT5D 3M9BA 3KF6B 2WB1E 4B08A 2Z0SA 1LUZA 5K5PA 1O7YA 1M8AA 1VQEA 3SK5A 1L1OC 5C0XJ 3ERSX 1NR2A 5BN4A 4XQJA 2K5WA 3AEVA 5E3FA 3AMUA 2Q8RE 3TRZA 2CW0C 4B3RQ 1H9KA 1CA6A 4BXXH 1S5DD 3S1NH 3DHQA 5CV6A 1B2TA 3S14H 1IXRA 3K8AA 3D6CA 5DNFA 2I46A 2NTTA 3RNUA 4OO1H 4M1UB 4AQYL 2F0HA 4BA2I 1TWGH 5IODA 4X62Q 4IFDJ 1AH9A 1O78A 1U4MA 4NW2A 4E6IA 1QVCA 2A1AA 1TY2A 3TS2A 2B2VA 1WFQA 5C3EB 4B9WA 2PNHA 1K28A 1V1PA 2F0FA 3OSOA 3S1RB 4DV4Q 5CV8A 2R7ZB 3A5UA 3ITPA 2NVTB 5C0XI 2CHBD 4LF6L 1PH5A 3I91A 1IBKL 2F4VL 2PYKA 2SNSA 4L8JA 3CC2A 3T13A 3FRPB 1I94L 1VQBA 3H3VI 3C46A 1EY6A 4K6DA 1DONA 4ABNA 3I4LA 3A55A 4LFCL 3ND8A 1HH2P 5FLMH 3M85A 4IO9A 4PNYA 2OCEA 2HHHL 1VMPA 4XT1B 2ZM6Q 4KHPL 4RGOS 2LS01 3DMUA 5EKIA 2XRSD 1FGUA 1D8LA 3CKIB 2IX0A 3RLNA 3NE5B 5JJZA 5EBDA 4DR4L 1KLGD 3MA2B 1MKHA 1DOMA 5FJ8G 2DJFC 4XYQA 4R4TA 4OX9Q 4R4QA 4IFDI 1PTOH 1A3TA 1MSGA 1G6ZA 2F0LA 3EN2A 4GOPC 2EQSA 1CZWA 3HKZB 2FMMA 4H7BA 3GQBA 4A3BG 1L1OA 1IL2A 1NY4A 4X3TA 1NE3A 3HOVH 3NBHB 4X66Q 1DYQA 1HUNA 3PUZA 4TRDA 3K80C 4LUZA 5C44G 1EIYB 5EGTA 3E3XA 3SVMA 4NXMQ 4A3CG 1CQVA 4HEDA 2NN6I 1IBML 2EYFA 4XQQA 2FFKB 2O2LD 2E2IH 2R93H 2LMCB 4JI7Q 3CRLC 2R7ZG 1HNZQ 5CV9A 3AYHB 4DGZA 3PO3B 3NPPA 1Z6HA 5DM63 1STAA 1A3VA 1SYCA 1UNSA 5AJ3L 3GTKH 3D8GA 3HOZG 4DV1L 1XX8A 1I6HH 1JB7A 5I2YA 2QDLA 4DR2L 3HOWH 2LKVA 3G71A 3S16H 2NUCA 1EY4A 1YBYA 5LL6X 5IIFA 2OQ0A 3S17B 2R7DA 1UUPA 2NZ1D 2K03A 2PMZE 4JI5L 3T51B 1JJGA 4L5RC 1G51A 3WOFA 2Q2UA 2SDFA 4G4KA 2NZOA 3R3OA 2CW0D 3HOVG 4YHHL 3M4OB 4EQNA 4Q5VA 4JBKA 4B3TL 2R92B 1KABA 5LMUL 3CXCA 1SNMA 3EA6A 2VQEQ 1K0RA 3R2TA 2HHHQ 3H3VC 1EY9A 4ZUJA 1KRSA 1LTSD 3S2DB 4RKLA 4JI0Q 1JMCA 4DR6L 3I72A 1Y1VB 2TSSA 4BY1G 1UEBA 4OX9L 2HDLA 3LNNA 2X6GA 3WWVA 2CKZB 1PH1A 3SGIA 4IFDH 3E0EA 5IP9G 2DUDA 1BUVT 4POFA 2Y0SB 4ZYSA 5I6WA 2ES2A 2F0EA 5C4JB 3I4NH 1I3QB 2XN9C 1PLFA 4HIKA 3I8ZA 1SYGA 2K5NA 3IRBA 2QGQA 1PTOB 1PDQA 3CC4A 1B1ZA 1IBLL 2B29A 2EYLA 1X3EA 1XNRL 4DV2L 2BH8A 3OMCA 2OQKA 4A3LG 2MUYA 4LJZC 1KRTA 2ICIA 1G6PA 5IT9E 1WVLA 1X56A 2PQAB 4A3JG 2RDGA 1EZ8A 2YV5A 4KD3A 2LXKA 2R92G 1CI3M 1SRUA 4QCLA 1OXXK 5IP7G 3W1GA 3N6RA 4CJ1B 3RD4A 1Y69U 4DR1L 1Y8PB 1ML0D 4DXGA 4DUYQ 1QZGA 3HOVB 1Y8OB 1EEFD 1ENAA 4C56C 3MC0B 5JOBA 5JVG3 1D1IA 4H02A 2B2UC 1H9MA 1DOLA 5HGTA 1EQVA 3HOZB 1LTLA 1FR3A 5KNCA 3K7UC 5KNBA 3PUVA 3QJYA 3KOJA 4H0LC 3NQIA 1KAWA 2F0GA 1P8LA 2C9OA 3NBHA 4ME5A 2HUGA 5ELBA 3I4MH 1SYFA 3KJOA 1QUQA 1N36Q 1SFOB 4LNQA 1HA6A 5ELDA 1NR4A 3BDOA 4K2LA 5KGUA 2PZUA 1X3GA 3U4VA 4C3HG 3PO2H 1JOOA 3ND9A 3W2DA 1EIFA 3A5ZB 5IYBG 1HR0L 1A8VA 2XWBB 4H13C 1AEXA 1ESRA 3FKIG 5CV4A 1I4HA 4FYDA 1HZAA 3M7NA 4BBSH 2D5DA 3KK7A 4QIWB 4LUOA 3UE0A 4XT3B 5M3FH 4DA2A 4PMCA 4A93B 1VQ4A 4LF7Q 3S15H 1MIUA 2JSOA 5JEAH 2I5MX 1H9SB 1NCVA 5I9OA 2EYHA 4X65L 2B2YA 3K81C 4L5TA 3BDCA 3CCQA 4CDCC 1WCMB 4Y7NH 4J1MA 3TP5A 2EDGA 4GOPB 5C0XH 1AE2A 1XWEA 4LF4L 5IP7H 1EFID 2YU9B 4DR6Q 4R9WA 5FO9B 3HOXH 1IHZA 4IJLA 1RL2A 2RCNA 2K1BA 4JI4Q 3TZDA 1CHQD 4K5WA 4KJOA 4LK1C 3I4NG 3I4NB 1TVXA 2ZJQA 2NTSA 5C6AA 3A56A 2ZXPA 3OPOA 4ME3A 5ELEA 2NN6G 3A8KE 2B2YC 1CK1A 2L1BA 2Q2IA 1X3FA 4JBMA 3NEMA 4NXNQ 1KDBA 5G3LF 2Q8IB 3GTLH 3NENA 2E75C 1HR0Q 4GN5A 4DV5Q 1H9SA 1WTRA 1HQRD 1YZ6A 1FNUA 3IKJA 3NK9A 2B2UA 1I4RA 4BA1I 1ASZA 3IAYA 3DM3A 5G3LD 1VQGA 5I2XA 4DUZQ 1HHVA 1KAAA 4JI2Q 3F2UA 1JC7A 1BO0A 3HKZE 2Z8LA 1U0LA 4IPDA 1HJPA 4RA8A 1UE1A 1EEID 1C4QA 4O42A 1C7YA 3GO5A 2F03A 3OTOL 2JP1A 3KDFB 4JI8L 2JEBI 2UUAQ 4WORA 1JJCB 5M5XB 4N9PA 1XPRA 4K8JA 3D6WA 1WTHA 2R61A 4P72A 3UDGA 1EIGA 5CGKA 3NSWA 4FXDA 1UWVA 2VUMH 4JVZA 1O7LA 5I6YA 1GHKA 1D1KA 3I90A 2JA8H 5ELFA 3MAQA 1K83H 2BA0A 3GTOB 5BN5A 1YHBA 3JAME 2CVRA 3G48A 1NBWA 4P73A 4DK6C 2A19A 2K6AA 5TSSA 2B2WA 3E9IA 4GKKL 5L37A 1E1OA 1FD7D 4JK1C 4LFBL 2A73B 4QF4A 4WJ3M 1K9MC 2PI2A 1HTLD 4FVMA 5M3FB 2E2JH 3J7AF 1GKHA 3I56A 1I50H 2R7ZH 5E1FA 4CHTB 3GTPH 4QL5A 5H1SE 2JA7G 1CA5A 1MI2A 2NVTH 1A3UA 1H9JA 1TR5A 1LT3D 4K6LA 4KJNA 2N49A 1OXSC 4A3MG 2Q2HA 3NWSA 1IW7D 4Y7NB 2QA4A 3HOYH 1HCZA 1K3BC 3AB9A 4B3TQ 2EOTA 1NSNS 4K5VA 3PV0A 3T53B 1YNXA 1XTDA 2D0PA 2OTJA 5C3EH 4JI0L 1SE3A 5LHY1 3S9WA 1DZ1A 4A3EH 4RMFA 1GO3E 4ZLTF 3NTHA 2ZTEA 2VQEL 1RDPD 1B53A 1F2ZA 1HFGA 1SNPA 3PGZA 1XMOL 1AZPA 2N55A 2K7VA 1WTWA 4GKJQ 1K8MA 1JE4A 2VL6A 4GLVB 4XXEA 1PXUA 2IW3A 4K8IA 3PSIA 3JAMi 4KY7A 1YJNA 2PMZB 1BF4A 1ASYA 1O7IA 5M3MB 5AJ3Q 2PQAA 2UUAL 3A8IE 3KFUA 1HZBA 3J81E 2AHOB 4QY7A 1ILPA 4JI6L 3RZOB 3Q22A 1IBLQ 2A6HC 2YTYA 1F2YA 4MZ9A 5FJ8H 3GTGH 4O2DA 1KD1C 1XXGA 2PW5A 2L15A 5LMNL 1HNWL 4A4IA 4X66L 4AH6A 3QG1A 1EL0A 1D5MC 4A3KB 2RVLA 3H91A 2A6HD 5CMDA 1Q90A 2IY5B 1GHJA 4A3IG 3BZDB 5F2DA 3CCRA 5LMNW 1CUKA 1H95A 3CCEA 3AFQA 1W6JA 1TY0A 3CPWA 4RH6A 4MTKA 4DK0A 2WV6D 3C2PA 4TVAB 1HPCA 1VQJA 2VUMB 2EXZA 2JN4A 4IUTA 4OWTB 2MNAA 2F52A 4GN4B 4R4CA 4K0KQ 2VZAA 3H09A 2RQXA 5EBCA 2K52A 2EYPA 3CF5A 1N36L 1YVCA 2VQFQ 3L3OC 1HR0W 1LO5D 3HP3A 2Z9HA 5GROA 4R8NA 2XGTA 4QMGA 3PIOA 1VF5C 1RKNA 4L6TB 3GTPB 1N32Q 2Z6BA 2IX1A 4JBJA 2WP8J 1ESFA 2NWGA 2UXCQ 3GTKB 3MTSA 1EQTA 3A74A 3T16A 3VR4A 1YNJD 3TMEA 3S2HB 2WKCA 1A2UA 2RSOA 4YWLA 4R4OA 1BVSA 1B8AA 1SNQA 1S5ED 2JA6B 1JR0D 2OT2A 1LM0A 4HJ7A 1G8ZD 3TP8A 2KEEA 3KDFA 1JWUD 4OIJA 1SNCA 2YTXA 4NKLA 1GUOA 1SEBD 4JI1L 3K57A 3C1FA 1VCIA 4JOIA 1HTPA 1W6KA 3NP8A 3L9AX 1ICFB 4DV0L 4Q0FA 3S24A 4JV5L 1A2TA 3P20A 3MHBA 2L4NA 4KKSA 1KXLA 2R92H 1Q81C 4L5SA 2JYOA 1Q46A 1BBWA 1PRTB 3M4QA 3MFYA 2CWPA 4I7AA 1MGSA 3I4OA 2KVMA 1BBUA 1CKNA 1ZKOA 1MJCA 2AWOA 2DJGC 3H0GG 2B63B 4K2KA 4X65Q 3B6YA 1TS4A 3KLWA 3GTGB 3VR6A 4CJ0B 1MBYA 4ZAIA 5CBEE 2TMPA 3MXGA 2ICEC 4APVA 1WTOA 4OWWB 1JT8A 3BVGA 1Q8IA 1KTKA 4NXNL 1KDAA 5C5MA 1I3QH 3F2CA 1X6OA 3PUWA 4XQNA 2ZJRA 3RZDH 5M5YB 1KNEA 2RDFA 1YJWA 1X3PA 3J7YW 1CKOA 1XNRQ 1PZJD 4R4IA 1SN8A 3FDTA 2UU9Q 5KYIA 3L2PA 1XMQQ 1WD0A 1J8IA 4JI5Q 4PZ6A 2EVBA 3TN2A 2FJ2A 2HIXA 3QO2A 4MN3A 2D9UA 3IL8A 4FF4A 2AQ1B 5M5WH 4WFN3 1M1KC 3VA5A 2A69C 3DEPA 4DR7L 5IGFA 3DWQA 1Y1WH 2VS1A 4OHJA 4NPSA 1SFOH 5M3FG 4C3IB 2XVSA 2Z6KC 4KD4A 3E6ZX 1F77A 2K5QA 4IZ8A 3NHHA 2NBFA 4DNTB 3JAMc 1PRTD 4FNFA 1Q12A 3HOZH 1F9PA 1II3A 2R6GA 4AIMA 5JVH3 4O1NA 4C3HH 2G9DA 4JI2L 3P75A 2KHSA 3WOEA 1JOQA 4KLKA 2PW7A 2VB2X 1XNQQ 2DNEA 1LTRD 4TKOB 2CFMA 3J7AV 3M7GA 1UE7A 4JV5Q 5DEHA 5KYLA 3E9HA 1ET6A 3HOWG 2BE5D 4JI6Q 2JA6G 4IPCA 1I4XA 2FINB 1C0AA 4LFAL 2M9VA 1STGA 2WIIB 1V1QA 3CU7A 4DR5L 3MXNA 3PO2B 4OELB 1JICA 2EYMA 4ZQ3A 5FLXc 3LGJA 5CC4A 1WTXA 2B8GA 3J80E 4ULLA 3PF4A 3TEHB 2OXPA 1E7ZA 2PO4A 1PTOF 4IPHA 2GVAA 2CCZA 4QB4A 3HOXB 1R9TB 4IJHA 5D3DA 3MEHA 3BDLA 3ULJA 1IYUA 4JW0A 2WINB 3L0OA 1RHPA 3GTJH 4A3IH 1N32L 4DAYB 4JYAQ 5T1GA 3E5SA 4I7ZC 2KENA 2KUMA 1CKNB 3HOUB 1V1OA 3R2IA 2K33A 3NTIA 1LTGD 3SEBA 1RD9D 2YU9H 3KJPA 1F2MA 1TS5A 4F8MA 3CQZH 2ZT9C 5IWAQ 4YHHQ 5FOBB 2MJ8A 1KIXA 2DY8A 4OWXB 2JEAI 4K5XA 4C3JG 3GTQB 1KQSA 1FGBD 5E4WC 3EFXD 1HXYD 2A6EC 4NB3A 5COYA 1W2BA 1HA5A 3FPUB 1E1TA 1JE5A 1IKLA 4RHRA 3GP7A 2M00A 3ZYYX 4EQ5A 3F2DA 1DGSA 1STNA 1WCMG 2A6ED 3NXWA 4JI3Q 3G6JB 4G7ZC 4DV7Q 3H15A 2D2CC 4BY7B 5IY0A 3PIP3 2PPBC 4FP5D 2CWAA 1Y1WB 2R7FA 2Y0SE 5DLQE 4IUUA 1SYDA 3I3CA 1TWHB 1CT1D 4C2MH 1VQKA 2JA8B 1SE8A 1BBXC 4HIMA 4KN7C 2F0TA 2E8GA 3FEWX 3S1QH 1AW7A 2AWNA 2ZXRA 3VYUA 2PNRC 4B3RL 3RLOA 3D4DA 5M5XH 4C3HB 1GUSA 3FP9A 1P16A 2BA1A 3VYTA 2B2TC 1BCPC 1C8CA 3ER0A 1PH9A 4TSSA 4A3GG 3J80L 1VMCA 2SOBA 3DWAA 2K75A 1QVGA 2CQOA 3V05A 5K36H 2FHTA 4S3SA 2MHVA 4HMJA 3BVMA 4HR7B 1J6QA 5JJLA 2PZTA 4BXXG 3VR5A 3AFPA 5HY6A 1JB3A 4NMZA 1VQ9A 3S1MH 2SNMA 3MEFA 1X32A 4YCUA 4DUYL 2N3SA 2LSSA 1DCZA 2F0WA 5GAGC 4FF2A 4B3SQ 4KV6A 5KRUA 1PYSB 2EJFC 5C4XH 4DV7L 5K36G 4WJ4A 4RGMA 3CCUA 1Q86C 4IOCA 2L12A 4A3BH 1PFMA 1AN8A 1O80A 3K59A 4LF8Q 1BCPD 5J3BA 2NVYB 4A3IB 1N34L 3KLRA 3JAML 4DR1Q 3M4YA 1PH7A 2KHJA 5JAVA 4A3KG 1QNKA 1YNNC 2RHQB 3K6OA 2C35B 3KLSA 1LACA 3CW2C 4FF1A 1ONLA 1IKMA 4HJAA 4AYBB 3PMFA 2DY7A 3K7AB 4R1JA 2F0JA 5BR8L 4X64Q 2NVQH 1SE2A
chains in the Genus database with same CATH topology
1OXSC 3KF6B 2LXJA 2Q2HA 3M9BA 5BR8Q 4GNXC 4A3MG 3PF5A 1GM5A 1OXTA 2WB1E 2QA4A 4JI8Q 3T1YQ 3HOYH 2Z0SA 1LUZA 4GOPA 1B7YB 3UDXA 3CCJA 4B3TQ 3RZOH 1VQEA 5LMUQ 4JOIC 1L1OC 2OWOA 2IT1A 3PV0A 5C0XJ 3ERSX 1YNXA 1XTDA 3AEVA 2D0PA 5GAHC 2OTJA 2IHEA 5C3EH 4JI0L 1QZHA 4IOAA 4A3EH 2AMCB 4A3KH 3TRZA 4RMFA 5M3MH 1GO3E 4LF9L 2JA7H 4B3RQ 4IPGA 2ZTEA 5FLMG 4BY7H 2VQEL 4BXXH 1S3OA 3J7A5 3S1NH 2KCTA 1N33L 1WI5A 4UPAA 3PUXA 3NELA 3PGZA 1XMOL 3S14H 1IXRA 3K0XA 2N78A 3K8AA 4DR5Q 1K73C 1KHIA 2D0OA 3RR5A 4GKJQ 1PVOA 1UE6A 3RNUA 4AQYL 4BA2I 1AH9A 1TWGH 4LUVA 4X62Q 4IFDJ 3BZKA 3AQQA 1V43A 2E5LQ 2VL6A 4GLVB 5C4XG 1TWAH 4LW1A 1HNZL 1QVCA 2A1AA 3PSIA 3JAMi 1WFQA 4DV1Q 2E2HH 3TS2A 1YJNA 4PZ8A 2PNHA 1ASYA 4YY3L 1O7IA 5AJ3Q 4A3DG 4UP7A 2RHSB 2PQAA 2UUAL 3KFUA 1HZBA 2AHOB 4DV4Q 4QY7A 4DV5L 1JJ2A 3A5UA 4JI6L 3KYHC 1IBLQ 1SLJA 2YTYA 4MZ9A 5FJ8H 3GTGH 5C0XI 4O2DA 1KD1C 5IYCG 3F2BA 2L15A 5LMNL 2AKWB 4DV3Q 1HNWL 4LF6L 4A4IA 4X66L 1FVIA 1PH5A 2IHFA 1IBKL 2F4VL 4AH6A 4A3MH 1N33Q 4DV2Q 3VDYA 1J5EQ 2VW9A 3CC2A 2IY5B 4A3IG 2UU9L 1Y1WG 1PH3A 3UE1A 1I94L 1KL9A 3CCRA 3T1YL 2ZTCA 2UUCQ 1VQBA 5LMNW 3H3VI 1CUKA 4BBRG 3CCSA 1H95A 2JE6I 3BZCA 4LFCL 1HH2P 5FLMH 3M85A 3AFQA 3CCEA 4IO9A 1L0WA 4A76A 1VQ5A 2OCEA 1N8RC 1X65A 2HHHL 1VS0A 3CPWA 2ZM6Q 2NVXH 4JI7L 4KHPL 5JEAJ 3CMEA 4A3CH 4B3ML 2JQOA 2WFWA 4TVAB 1VQ8A 5IYDH 1VQJA 2K4KA 1FGUA 2Z6KA 4P71A 3J80i 3J80c 1D8LA 2ZTDA 4KHPQ 1S72A 4OWTB 1CSPA 2IX0A 3RLNA 2MNAA 4DR4L 1MKHA 2F52A 4GN4B 4YWKA 4A3JH 4R4CA 5FJ8G 4K0KQ 2VZAA 4R4TA 3I55A 4OX9Q 2K52A 4R4QA 5GADC 2KCMA 4IFDI 3CF5A 1N36L 1PA6A 2VQFL 4JBWA 2V1CC 4POGA 3S1RH 2F3IA 1EUJA 4ALPA 1MJEA 3EN2A 1YVCA 4GOPC 4LFCQ 2VQFQ 1HR0W 2EQSA 4QQBX 5GROA 2XGTA 1PHJA 1CKMA 3PIOA 1E22A 4LF5Q 2HQLA 4A3BG 1N32Q 2IX1A 1L1OA 1IL2A 3K7AH 1TWCH 4B3SL 4A3GH 4JBJA 1NY4A 1YIJA 2WP8J 3J7ZC 5GAEC 4YCVA 2UXCQ 1NE3A 3HOVH 3NBHB 3A74A 3S17H 4X66Q 3TQYA 3PUZA 1GD7A 1T9HA 4UP9A 3K80C 2JK8A 4LUZA 4R4OA 3H0GH 1BVSA 1B8AA 4KI0A 4YWLA 5C44G 4QIWE 1YJ9A 1EIYB 4NXMQ 4A3CG 1LM0A 4HJ7A 2NN6I 3CCVA 4GNXA 3KDFA 4P75A 1IBML 2DGYA 2R93H 3CC7A 2YTXA 2E2IH 2ZM6L 1A0IA 4JI7Q 2MO0A 2R7ZG 1V9PA 5M3MG 1HNZQ 1EFWA 1Y1VG 3AYHB 4JI1L 1FJGL 1VCIA 4DV4L 4JOIA 4KHZA 2B63H 1Q8KA 3T1HQ 5AJ3L 4JCVE 3GTKH 4Y52H 1QUQB 1X9NA 3HOZG 4DV0L 4JV5L 4JI1Q 4DV1L 3S24A 4BBSG 1PH2A 4A75A 1I6HH 1VQLA 4DPGA 1JB7A 4UP8A 3JC66 4DR2L 1KXLA 2R92H 1VQCA 1Q81C 3HOWH 3G71A 4LF6Q 4L5SA 3S16H 4YCWA 4AQYQ 2HIVA 1YBYA 1Q46A 1BBWA 2WB1G 3M4QA 2CWPA 2NZHA 1YITA 1XMOQ 2RF4A 2OQ0A 3I4OA 2R7DA 1BBUA 4BY1H 1A63A 1CKNA 3S2HH 1MJCA 2AWOA 2PMZE 4JI5L 3H0GG 1JJGA 4L5RC 1G51A 4X65Q 2Q2UA 3B6YA 2JA6H 2NZOA 2YYZA 3KLWA 3HOVG 4YHHL 2K50A 1B70B 4DAMA 2UXBQ 1XPUA 3HOXG 3T1HL 2GN5A 2QEXA 3GTMH 4JBKA 3D0FA 1FL0A 4APVA 1E3PA 4B3TL 4OWWB 1JT8A 5LMUL 4UY8C 3CXCA 4NXNL 1YHAA 2VQEQ 4JG2A 1K0RA 1K8GA 2HHHQ 1VQMA 2BH2A 3F2CA 1I3QH 1W3SA 1X6OA 2JA5H 3PUWA 4XTCS 3A0JA 2ZJRA 1KRSA 4AYBE 3RZDH 4JI0Q 4RG1A 1JMCA 3J81c 1OXUA 3J81j 1YJWA 1GVPA 4DR6L 4BY1G 4DKAC 2EIFA 1CKOA 1XNRQ 1UEBA 4OX9L 4K0KL 4R4IA 4JC0A 1SN8A 3WWVA 2CKZB 1PH1A 2UU9Q 3RN5A 3SGIA 1K3RA 3Q8DA 3L2PA 1XMQQ 5HGQA 3E0EA 4JI5Q 4PZ6A 5IP9G 4HJ9A 2MO1A 2DUDA 4LF7L 2HIXA 4POFA 3STBD 5M5WH 1XMQL 1M1KC 4OO1G 2ES2A 3I4NH 4DR7L 3FKIH 4LF5L 1Y1WH 2VS1A 3S2DH 4HJ8A 1SROA 5IE8A 4NPSA 5ELOA 2UXDL 3U4ZA 4L5QA 1SFOH 5M3FG 4GLAC 4HIKA 4B3MQ 2Z6KC 3M4OH 4BBRH 2K5NA 4DNIA 1OTCA 3PUYA 3CMAA 3IRBA 2QGQA 3CC4A 1SMXA 4P74A 1IBLL 2B29A 3JAMc 1X3EA 4J15A 1IYJB 1Q12A 1Q1BA 1XNRL 2R6GA 4DV2L 3HOZH 4AIMA 2BH8A 4PG3A 1J5EL 1A62A 2OQKA 2A8VA 4C3HH 2UUCL 5M5YH 1IBKQ 2F4VQ 4DK3C 1Q7YC 4A3LG 1KRTA 1EQQA 1G6PA 1Y1VH 1PV4A 4JI2L 3TREA 1X56A 2PQAB 4A3JG 4KLKA 2YV5A 1NTGA 3D31A 1EYGA 3CPFA 2LXKA 2R92G 1SRUA 4NXML 4BY7G 1D7QA 1OXXK 3PO3G 1HZ9A 5IP7G 4QJFA 3W1GA 1XNQQ 2JA5G 2R93G 5IYCH 4DR1L 1YI2A 2XTIA 4DUYQ 1QZGA 2CFMA 2I5LX 4JV5Q 1UE7A 3CP0A 3HOUH 1WYDA 3E9HA 3HOWG 5C44H 2B63G 1VQDA 1VQ7A 4H02A 4JI6Q 5E7NA 2JA6G 4IPCA 1LTLA 1C0AA 4GLXA 4LFAL 4PZ7A 1E24A 4IFDG 1V1QA 3K7UC 1S40A 4DR3Q 2D62A 1TWFH 3PUVA 4DR5L 2VY3A 5ELNA 4C3IH 5LMNQ 4GKJL 3KOJA 5FLXc 3LGJA 1KAWA 2JA9A 1P8LA 2E5LL 3PF4A 5C4JH 3BJUA 3TEHB 4OO1I 1Z47A 1I5FA 1C9OA 1E7ZA 3I4MH 4IPHA 2GVAA 3KJOA 2CCZA 3G6EA 1QUQA 3RLFA 1M90C 3GTQH 4HJ5A 1WCMH 4IJHA 1N36Q 4A3LH 4LNQA 3CD6A 3ULJA 3OTOQ 1XNQL 3L0OA 5C0XG 4DR7Q 3GDEA 2K5HA 3GTJH 4LFBQ 1X3GA 3U4VA 3G4SA 4A3IH 2UUBQ 1UE5A 3U58A 1N32L 3L7ZC 4DAYB 2ALYB 4DV0Q 3ZJYC 2MFIA 3OW2A 3PO2H 4JYAQ 2UXCL 1EIFA 3A5ZB 2EXDA 1L1OB 3ULPA 5IYBG 1HR0L 2KENA 1A8VA 1NMGA 1CKNB 3J81i 3TS0A 4X64L 1OXVA 3FKIG 3M3YH 1HZAA 1N9WA 3F1ZA 3M7NA 4BBSH 4LWCA 2MQHA 1X54A 4LUOA 3UE0A 5IYDG 5M3FH 1XJVA 2YU9H 3KJPA 4MTNA 1VQ4A 4LF7Q 4DV6Q 3CQZH 4LF8L 3S15H 5IWAQ 4YHHQ 1MIUA 2I5MX 1KIXA 4OWXB 2KHIA 4TQUS 2JEAI 4X65L 3K81C 4L5TA 1RIPA 4HIOA 3CCQA 5IWAL 4O0AA 1KQSA 2YTVA 1WJJA 1R9TH 4NB3A 2B3GA 1W2BA 4Y7NH 4GOPB 4A93G 1E1TA 1JE5A 1TWHH 1K8AC 2UXDQ 1AE2A 1X55A 1PYBA 3CCMA 1EQRA 3KF8B 4EQ5A 2K14A 4LF4L 5IP7H 3F2DA 1DGSA 1WCMG 3I4MG 2I5HA 4DR6Q 1VQOA 3HOXH 2GVBA 3W5OA 4JI3Q 3PCOB 4IJLA 1WOCA 1RL2A 2RCNA 3ULLA 3H15A 4DV7Q 1VQHA 3W1BA 3UDIA 1HNXQ 4JI4Q 5JJKA 5IY0A 3MXNB 3I4NG 4A3FH 2ZJQA 1EOVA 2CWAA 1PH6A 2OTLA 2VUMG 2R7FA 2Y0SE 5DLQE 4ME3A 3U50C 3PO2G 1HZCA 1VQKA 1PFSA 2NN6G 4C2MH 2UUBL 2JA8G 1SE8A 1L2FA 2Q2IA 4HIMA 1EWIA 1X3FA 2E8GA 4JBMA 3S1QH 3RN2A 3NEMA 4NXNQ 2HT1A 3GTLH 3NENA 2AWNA 2PI2E 1HR0Q 4GN5A 4DV5Q 1Q82C 4DV3L 4B3RL 3RLOA 1HNWQ 2UXBL 2KBNA 1YZ6A 4OXPA 1VQFA 5M5XH 4A3DH 4JYAL 3FP9A 3CCLA 2H5XA 1P16A 2BA1A 4A93H 1VQIA 4YWMA 3DLLA 4BA1I 3ER0A 1ASZA 2VNUD 3DM3A 4A3FG 1VQGA 3I7FA 1PH9A 4A3GG 3GTOH 3GD7A 3HKZG 4DUZQ 4JI2Q 2K75A 1QVGA 2CQOA 3EIVA 4FDBA 4X62L 1Y14B 1I94Q 2Q2TA 3HKZE 1Z9FA 1U0LA 4IPDA 1HJPA 4EX5A 1UE1A 1FJGQ 1J6QA 5JJLA 1C7YA 3GO5A 4BXXG 1PH8A 3AFPA 3OTOL 3UDFA 5HY6A 4GNXB 1QVFA 3KDFB 4JI8L 3OYYA 2JEBI 1VQ9A 3S1MH 3FHWA 2UUAQ 1JJCB 1VQPA 4PMWA 4YY3Q 3MEFA 4QGUA 1CSQA 2NVYH 4YCUA 4DUYL 1XPRA 3EBEA 1NMFA 5JJIA 2N3SA 4LFAQ 2LSSA 4P72A 3UDGA 3H3VH 2K5VA 4X6AH 5GAGC 2N8NA 4DR2Q 3HKSA 4B3SQ 5GQOA 1PYSB 1AE3A 4HIDA 4LF9Q 5C4XH 4DV7L 4DR3L 3STBC 3F8TA 1HNXL 1YEZA 2I0QA 1UWVA 1G291 4JI4L 2VUMH 4WJ4A 5K36G 5IT9c 2WAQG 4JI3L 3CCUA 4DUZL 3M4PA 1Q86C 4IOCA 3HOUG 2ASBA 2ID0A 1N34Q 2JA8H 4A3BH 1K83H 2BA0A 4LF8Q 4OONA 1YHBA 1NJIC 4GKKQ 5J3BA 1N34L 1IBMQ 4DR1Q 3HFZB 3G48A 1NBWA 1IZ6A 1SR3A 4P73A 2A19A 1TXYA 4DK6C 2KHJA 1PH7A 5C3EG 3CAMA 1YHQA 3I2ZA 3E9IA 2Y0SG 3PIPA 4A3EG 4A3KG 3KF6A 1E1OA 1Q1EA 1KC8C 4GKKL 2JJQA 2FXQA 1PH4A 2RHQB 3BU2A 4C3JH 4LFBL 2C35B 4XIGS 4WJ3M 3CW2C 1K9MC 4DR4Q 1U5KA 1BKBA 2PI2A 4MNOA 4GN3B 4HJAA 5IP9H 2ZJPA 2WAQE 1XPOA 2E2JH 1GKHA 3I56A 3HOYG 1I50H 2R7ZH 3GTPH 4LF4Q 4QL5A 5H1SE 2JA7G 5JEAG 1VQNA 4R1JA 4GS3A 2NVTH 5BR8L 1LYLA 4X64Q 4DV6L 2NVQH 3ICEA 4AYBG 1VQ6A 3PO3H 1VQAA 2N49A 2ATWA 5IYBH 5EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXS C;  3KF6 B;  2LXJ A;  2Q2H A;  3M9B A;  5BR8 Q;  4GNX C;  4A3M G;  3PF5 A;  1GM5 A;  1OXT A;  2WB1 E;  2QA4 A;  4JI8 Q;  3T1Y Q;  3HOY H;  2Z0S A;  1LUZ A;  4GOP A;  1B7Y B;  3UDX A;  3CCJ A;  4B3T Q;  3RZO H;  1VQE A;  5LMU Q;  4JOI C;  1L1O C;  2OWO A;  2IT1 A;  3PV0 A;  5C0X J;  3ERS X;  1YNX A;  1XTD A;  3AEV A;  2D0P A;  5GAH C;  2OTJ A;  2IHE A;  5C3E H;  4JI0 L;  1QZH A;  4IOA A;  4A3E H;  2AMC B;  4A3K H;  3TRZ A;  4RMF A;  5M3M H;  1GO3 E;  4LF9 L;  2JA7 H;  4B3R Q;  4IPG A;  2ZTE A;  5FLM G;  4BY7 H;  2VQE L;  4BXX H;  1S3O A;  3J7A 5;  3S1N H;  2KCT A;  1N33 L;  1WI5 A;  4UPA A;  3PUX A;  3NEL A;  3PGZ A;  1XMO L;  3S14 H;  1IXR A;  3K0X A;  2N78 A;  3K8A A;  4DR5 Q;  1K73 C;  1KHI A;  2D0O A;  3RR5 A;  4GKJ Q;  1PVO A;  1UE6 A;  3RNU A;  4AQY L;  4BA2 I;  1AH9 A;  1TWG H;  4LUV A;  4X62 Q;  4IFD J;  3BZK A;  3AQQ A;  1V43 A;  2E5L Q;  2VL6 A;  4GLV B;  5C4X G;  1TWA H;  4LW1 A;  1HNZ L;  1QVC A;  2A1A A;  3PSI A;  3JAM i;  1WFQ A;  4DV1 Q;  2E2H H;  3TS2 A;  1YJN A;  4PZ8 A;  2PNH A;  1ASY A;  4YY3 L;  1O7I A;  5AJ3 Q;  4A3D G;  4UP7 A;  2RHS B;  2PQA A;  2UUA L;  3KFU A;  1HZB A;  2AHO B;  4DV4 Q;  4QY7 A;  4DV5 L;  1JJ2 A;  3A5U A;  4JI6 L;  3KYH C;  1IBL Q;  1SLJ A;  2YTY A;  4MZ9 A;  5FJ8 H;  3GTG H;  5C0X I;  4O2D A;  1KD1 C;  5IYC G;  3F2B A;  2L15 A;  5LMN L;  2AKW B;  4DV3 Q;  1HNW L;  4LF6 L;  4A4I A;  4X66 L;  1FVI A;  1PH5 A;  2IHF A;  1IBK L;  2F4V L;  4AH6 A;  4A3M H;  1N33 Q;  4DV2 Q;  3VDY A;  1J5E Q;  2VW9 A;  3CC2 A;  2IY5 B;  4A3I G;  2UU9 L;  1Y1W G;  1PH3 A;  3UE1 A;  1I94 L;  1KL9 A;  3CCR A;  3T1Y L;  2ZTC A;  2UUC Q;  1VQB A;  5LMN W;  3H3V I;  1CUK A;  4BBR G;  3CCS A;  1H95 A;  2JE6 I;  3BZC A;  4LFC L;  1HH2 P;  5FLM H;  3M85 A;  3AFQ A;  3CCE A;  4IO9 A;  1L0W A;  4A76 A;  1VQ5 A;  2OCE A;  1N8R C;  1X65 A;  2HHH L;  1VS0 A;  3CPW A;  2ZM6 Q;  2NVX H;  4JI7 L;  4KHP L;  5JEA J;  3CME A;  4A3C H;  4B3M L;  2JQO A;  2WFW A;  4TVA B;  1VQ8 A;  5IYD H;  1VQJ A;  2K4K A;  1FGU A;  2Z6K A;  4P71 A;  3J80 i;  3J80 c;  1D8L A;  2ZTD A;  4KHP Q;  1S72 A;  4OWT B;  1CSP A;  2IX0 A;  3RLN A;  2MNA A;  4DR4 L;  1MKH A;  2F52 A;  4GN4 B;  4YWK A;  4A3J H;  4R4C A;  5FJ8 G;  4K0K Q;  2VZA A;  4R4T A;  3I55 A;  4OX9 Q;  2K52 A;  4R4Q A;  5GAD C;  2KCM A;  4IFD I;  3CF5 A;  1N36 L;  1PA6 A;  2VQF L;  4JBW A;  2V1C C;  4POG A;  3S1R H;  2F3I A;  1EUJ A;  4ALP A;  1MJE A;  3EN2 A;  1YVC A;  4GOP C;  4LFC Q;  2VQF Q;  1HR0 W;  2EQS A;  4QQB X;  5GRO A;  2XGT A;  1PHJ A;  1CKM A;  3PIO A;  1E22 A;  4LF5 Q;  2HQL A;  4A3B G;  1N32 Q;  2IX1 A;  1L1O A;  1IL2 A;  3K7A H;  1TWC H;  4B3S L;  4A3G H;  4JBJ A;  1NY4 A;  1YIJ A;  2WP8 J;  3J7Z C;  5GAE C;  4YCV A;  2UXC Q;  1NE3 A;  3HOV H;  3NBH B;  3A74 A;  3S17 H;  4X66 Q;  3TQY A;  3PUZ A;  1GD7 A;  1T9H A;  4UP9 A;  3K80 C;  2JK8 A;  4LUZ A;  4R4O A;  3H0G H;  1BVS A;  1B8A A;  4KI0 A;  4YWL A;  5C44 G;  4QIW E;  1YJ9 A;  1EIY B;  4NXM Q;  4A3C G;  1LM0 A;  4HJ7 A;  2NN6 I;  3CCV A;  4GNX A;  3KDF A;  4P75 A;  1IBM L;  2DGY A;  2R93 H;  3CC7 A;  2YTX A;  2E2I H;  2ZM6 L;  1A0I A;  4JI7 Q;  2MO0 A;  2R7Z G;  1V9P A;  5M3M G;  1HNZ Q;  1EFW A;  1Y1V G;  3AYH B;  4JI1 L;  1FJG L;  1VCI A;  4DV4 L;  4JOI A;  4KHZ A;  2B63 H;  1Q8K A;  3T1H Q;  5AJ3 L;  4JCV E;  3GTK H;  4Y52 H;  1QUQ B;  1X9N A;  3HOZ G;  4DV0 L;  4JV5 L;  4JI1 Q;  4DV1 L;  3S24 A;  4BBS G;  1PH2 A;  4A75 A;  1I6H H;  1VQL A;  4DPG A;  1JB7 A;  4UP8 A;  3JC6 6;  4DR2 L;  1KXL A;  2R92 H;  1VQC A;  1Q81 C;  3HOW H;  3G71 A;  4LF6 Q;  4L5S A;  3S16 H;  4YCW A;  4AQY Q;  2HIV A;  1YBY A;  1Q46 A;  1BBW A;  2WB1 G;  3M4Q A;  2CWP A;  2NZH A;  1YIT A;  1XMO Q;  2RF4 A;  2OQ0 A;  3I4O A;  2R7D A;  1BBU A;  4BY1 H;  1A63 A;  1CKN A;  3S2H H;  1MJC A;  2AWO A;  2PMZ E;  4JI5 L;  3H0G G;  1JJG A;  4L5R C;  1G51 A;  4X65 Q;  2Q2U A;  3B6Y A;  2JA6 H;  2NZO A;  2YYZ A;  3KLW A;  3HOV G;  4YHH L;  2K50 A;  1B70 B;  4DAM A;  2UXB Q;  1XPU A;  3HOX G;  3T1H L;  2GN5 A;  2QEX A;  3GTM H;  4JBK A;  3D0F A;  1FL0 A;  4APV A;  1E3P A;  4B3T L;  4OWW B;  1JT8 A;  5LMU L;  4UY8 C;  3CXC A;  4NXN L;  1YHA A;  2VQE Q;  4JG2 A;  1K0R A;  1K8G A;  2HHH Q;  1VQM A;  2BH2 A;  3F2C A;  1I3Q H;  1W3S A;  1X6O A;  2JA5 H;  3PUW A;  4XTC S;  3A0J A;  2ZJR A;  1KRS A;  4AYB E;  3RZD H;  4JI0 Q;  4RG1 A;  1JMC A;  3J81 c;  1OXU A;  3J81 j;  1YJW A;  1GVP A;  4DR6 L;  4BY1 G;  4DKA C;  2EIF A;  1CKO A;  1XNR Q;  1UEB A;  4OX9 L;  4K0K L;  4R4I A;  4JC0 A;  1SN8 A;  3WWV A;  2CKZ B;  1PH1 A;  2UU9 Q;  3RN5 A;  3SGI A;  1K3R A;  3Q8D A;  3L2P A;  1XMQ Q;  5HGQ A;  3E0E A;  4JI5 Q;  4PZ6 A;  5IP9 G;  4HJ9 A;  2MO1 A;  2DUD A;  4LF7 L;  2HIX A;  4POF A;  3STB D;  5M5W H;  1XMQ L;  1M1K C;  4OO1 G;  2ES2 A;  3I4N H;  4DR7 L;  3FKI H;  4LF5 L;  1Y1W H;  2VS1 A;  3S2D H;  4HJ8 A;  1SRO A;  5IE8 A;  4NPS A;  5ELO A;  2UXD L;  3U4Z A;  4L5Q A;  1SFO H;  5M3F G;  4GLA C;  4HIK A;  4B3M Q;  2Z6K C;  3M4O H;  4BBR H;  2K5N A;  4DNI A;  1OTC A;  3PUY A;  3CMA A;  3IRB A;  2QGQ A;  3CC4 A;  1SMX A;  4P74 A;  1IBL L;  2B29 A;  3JAM c;  1X3E A;  4J15 A;  1IYJ B;  1Q12 A;  1Q1B A;  1XNR L;  2R6G A;  4DV2 L;  3HOZ H;  4AIM A;  2BH8 A;  4PG3 A;  1J5E L;  1A62 A;  2OQK A;  2A8V A;  4C3H H;  2UUC L;  5M5Y H;  1IBK Q;  2F4V Q;  4DK3 C;  1Q7Y C;  4A3L G;  1KRT A;  1EQQ A;  1G6P A;  1Y1V H;  1PV4 A;  4JI2 L;  3TRE A;  1X56 A;  2PQA B;  4A3J G;  4KLK A;  2YV5 A;  1NTG A;  3D31 A;  1EYG A;  3CPF A;  2LXK A;  2R92 G;  1SRU A;  4NXM L;  4BY7 G;  1D7Q A;  1OXX K;  3PO3 G;  1HZ9 A;  5IP7 G;  4QJF A;  3W1G A;  1XNQ Q;  2JA5 G;  2R93 G;  5IYC H;  4DR1 L;  1YI2 A;  2XTI A;  4DUY Q;  1QZG A;  2CFM A;  2I5L X;  4JV5 Q;  1UE7 A;  3CP0 A;  3HOU H;  1WYD A;  3E9H A;  3HOW G;  5C44 H;  2B63 G;  1VQD A;  1VQ7 A;  4H02 A;  4JI6 Q;  5E7N A;  2JA6 G;  4IPC A;  1LTL A;  1C0A A;  4GLX A;  4LFA L;  4PZ7 A;  1E24 A;  4IFD G;  1V1Q A;  3K7U C;  1S40 A;  4DR3 Q;  2D62 A;  1TWF H;  3PUV A;  4DR5 L;  2VY3 A;  5ELN A;  4C3I H;  5LMN Q;  4GKJ L;  3KOJ A;  5FLX c;  3LGJ A;  1KAW A;  2JA9 A;  1P8L A;  2E5L L;  3PF4 A;  5C4J H;  3BJU A;  3TEH B;  4OO1 I;  1Z47 A;  1I5F A;  1C9O A;  1E7Z A;  3I4M H;  4IPH A;  2GVA A;  3KJO A;  2CCZ A;  3G6E A;  1QUQ A;  3RLF A;  1M90 C;  3GTQ H;  4HJ5 A;  1WCM H;  4IJH A;  1N36 Q;  4A3L H;  4LNQ A;  3CD6 A;  3ULJ A;  3OTO Q;  1XNQ L;  3L0O A;  5C0X G;  4DR7 Q;  3GDE A;  2K5H A;  3GTJ H;  4LFB Q;  1X3G A;  3U4V A;  3G4S A;  4A3I H;  2UUB Q;  1UE5 A;  3U58 A;  1N32 L;  3L7Z C;  4DAY B;  2ALY B;  4DV0 Q;  3ZJY C;  2MFI A;  3OW2 A;  3PO2 H;  4JYA Q;  2UXC L;  1EIF A;  3A5Z B;  2EXD A;  1L1O B;  3ULP A;  5IYB G;  1HR0 L;  2KEN A;  1A8V A;  1NMG A;  1CKN B;  3J81 i;  3TS0 A;  4X64 L;  1OXV A;  3FKI G;  3M3Y H;  1HZA A;  1N9W A;  3F1Z A;  3M7N A;  4BBS H;  4LWC A;  2MQH A;  1X54 A;  4LUO A;  3UE0 A;  5IYD G;  5M3F H;  1XJV A;  2YU9 H;  3KJP A;  4MTN A;  1VQ4 A;  4LF7 Q;  4DV6 Q;  3CQZ H;  4LF8 L;  3S15 H;  5IWA Q;  4YHH Q;  1MIU A;  2I5M X;  1KIX A;  4OWX B;  2KHI A;  4TQU S;  2JEA I;  4X65 L;  3K81 C;  4L5T A;  1RIP A;  4HIO A;  3CCQ A;  5IWA L;  4O0A A;  1KQS A;  2YTV A;  1WJJ A;  1R9T H;  4NB3 A;  2B3G A;  1W2B A;  4Y7N H;  4GOP B;  4A93 G;  1E1T A;  1JE5 A;  1TWH H;  1K8A C;  2UXD Q;  1AE2 A;  1X55 A;  1PYB A;  3CCM A;  1EQR A;  3KF8 B;  4EQ5 A;  2K14 A;  4LF4 L;  5IP7 H;  3F2D A;  1DGS A;  1WCM G;  3I4M G;  2I5H A;  4DR6 Q;  1VQO A;  3HOX H;  2GVB A;  3W5O A;  4JI3 Q;  3PCO B;  4IJL A;  1WOC A;  1RL2 A;  2RCN A;  3ULL A;  3H15 A;  4DV7 Q;  1VQH A;  3W1B A;  3UDI A;  1HNX Q;  4JI4 Q;  5JJK A;  5IY0 A;  3MXN B;  3I4N G;  4A3F H;  2ZJQ A;  1EOV A;  2CWA A;  1PH6 A;  2OTL A;  2VUM G;  2R7F A;  2Y0S E;  5DLQ E;  4ME3 A;  3U50 C;  3PO2 G;  1HZC A;  1VQK A;  1PFS A;  2NN6 G;  4C2M H;  2UUB L;  2JA8 G;  1SE8 A;  1L2F A;  2Q2I A;  4HIM A;  1EWI A;  1X3F A;  2E8G A;  4JBM A;  3S1Q H;  3RN2 A;  3NEM A;  4NXN Q;  2HT1 A;  3GTL H;  3NEN A;  2AWN A;  2PI2 E;  1HR0 Q;  4GN5 A;  4DV5 Q;  1Q82 C;  4DV3 L;  4B3R L;  3RLO A;  1HNW Q;  2UXB L;  2KBN A;  1YZ6 A;  4OXP A;  1VQF A;  5M5X H;  4A3D H;  4JYA L;  3FP9 A;  3CCL A;  2H5X A;  1P16 A;  2BA1 A;  4A93 H;  1VQI A;  4YWM A;  3DLL A;  4BA1 I;  3ER0 A;  1ASZ A;  2VNU D;  3DM3 A;  4A3F G;  1VQG A;  3I7F A;  1PH9 A;  4A3G G;  3GTO H;  3GD7 A;  3HKZ G;  4DUZ Q;  4JI2 Q;  2K75 A;  1QVG A;  2CQO A;  3EIV A;  4FDB A;  4X62 L;  1Y14 B;  1I94 Q;  2Q2T A;  3HKZ E;  1Z9F A;  1U0L A;  4IPD A;  1HJP A;  4EX5 A;  1UE1 A;  1FJG Q;  1J6Q A;  5JJL A;  1C7Y A;  3GO5 A;  4BXX G;  1PH8 A;  3AFP A;  3OTO L;  3UDF A;  5HY6 A;  4GNX B;  1QVF A;  3KDF B;  4JI8 L;  3OYY A;  2JEB I;  1VQ9 A;  3S1M H;  3FHW A;  2UUA Q;  1JJC B;  1VQP A;  4PMW A;  4YY3 Q;  3MEF A;  4QGU A;  1CSQ A;  2NVY H;  4YCU A;  4DUY L;  1XPR A;  3EBE A;  1NMF A;  5JJI A;  2N3S A;  4LFA Q;  2LSS A;  4P72 A;  3UDG A;  3H3V H;  2K5V A;  4X6A H;  5GAG C;  2N8N A;  4DR2 Q;  3HKS A;  4B3S Q;  5GQO A;  1PYS B;  1AE3 A;  4HID A;  4LF9 Q;  5C4X H;  4DV7 L;  4DR3 L;  3STB C;  3F8T A;  1HNX L;  1YEZ A;  2I0Q A;  1UWV A;  1G29 1;  4JI4 L;  2VUM H;  4WJ4 A;  5K36 G;  5IT9 c;  2WAQ G;  4JI3 L;  3CCU A;  4DUZ L;  3M4P A;  1Q86 C;  4IOC A;  3HOU G;  2ASB A;  2ID0 A;  1N34 Q;  2JA8 H;  4A3B H;  1K83 H;  2BA0 A;  4LF8 Q;  4OON A;  1YHB A;  1NJI C;  4GKK Q;  5J3B A;  1N34 L;  1IBM Q;  4DR1 Q;  3HFZ B;  3G48 A;  1NBW A;  1IZ6 A;  1SR3 A;  4P73 A;  2A19 A;  1TXY A;  4DK6 C;  2KHJ A;  1PH7 A;  5C3E G;  3CAM A;  1YHQ A;  3I2Z A;  3E9I A;  2Y0S G;  3PIP A;  4A3E G;  4A3K G;  3KF6 A;  1E1O A;  1Q1E A;  1KC8 C;  4GKK L;  2JJQ A;  2FXQ A;  1PH4 A;  2RHQ B;  3BU2 A;  4C3J H;  4LFB L;  2C35 B;  4XIG S;  4WJ3 M;  3CW2 C;  1K9M C;  4DR4 Q;  1U5K A;  1BKB A;  2PI2 A;  4MNO A;  4GN3 B;  4HJA A;  5IP9 H;  2ZJP A;  2WAQ E;  1XPO A;  2E2J H;  1GKH A;  3I56 A;  3HOY G;  1I50 H;  2R7Z H;  3GTP H;  4LF4 Q;  4QL5 A;  5H1S E;  2JA7 G;  5JEA G;  1VQN A;  4R1J A;  4GS3 A;  2NVT H;  5BR8 L;  1LYL A;  4X64 Q;  4DV6 L;  2NVQ H;  3ICE A;  4AYB G;  1VQ6 A;  3PO3 H;  1VQA A;  2N49 A;  2ATW A;  5IYB H;  5EAY A; 
#chains in the Genus database with same CATH topology
 4GNX C;  2LXJ A;  5BR8 Q;  2WAC A;  1OXT A;  2B2V C;  3HRZ C;  5FO8 B;  4UDU C;  1B7Y B;  2AUJ D;  4F88 A;  4JOI C;  1E2V A;  3V2T A;  1AP0 A;  1CFM A;  4IOA A;  1QZH A;  1EZ6 A;  1NNX A;  2QKI C;  3VR3 A;  5M3M H;  1EWC A;  4LF9 L;  1PFB A;  2QDB A;  5CV7 A;  1LLR D;  5FLM G;  4BY7 H;  1O7Z A;  1S3O A;  3IFD A;  3J7A 5;  1G91 A;  1BR9 A;  1N33 L;  1WI5 A;  2Q8T A;  4ID6 A;  4UPA A;  1SBB B;  1T5X D;  3PUX A;  2KJX A;  3K0X A;  2N78 A;  4DR5 Q;  3DEO A;  3RR5 A;  1PVO A;  1UE6 A;  1BCP F;  2F3W A;  2E5L Q;  3P1H A;  2XWJ B;  3QWN A;  1PFN A;  4DV1 Q;  1SMY D;  4PZ8 A;  1F2L A;  3OMG A;  4A3D G;  4UP7 A;  2RHS B;  2JA7 B;  4DV5 L;  1JJ2 A;  3J81 L;  3A54 A;  3KYH C;  1SLJ A;  2KEC A;  1RTN A;  2B2T A;  2K5D A;  5LL6 S;  4C1N I;  5IYC G;  3F2B A;  3QOL A;  5DM7 3;  4DV3 Q;  3OIQ A;  5IGG A;  4A3M H;  2K05 A;  4DV2 Q;  5C3W A;  1J5E Q;  2IJ0 A;  4PV1 C;  2VW9 A;  4DFA A;  3D4R A;  1PH3 A;  2E2H B;  2F1M A;  2MPM A;  3UE1 A;  1KL9 A;  5EPJ A;  2ZTC A;  2UUC Q;  1FYC A;  2J4X A;  4BBR G;  3CCS A;  2JE6 I;  2KQ3 A;  2NYZ D;  3Q6S A;  4CGY B;  4A76 A;  1TWG B;  2J7Z A;  1JOK A;  1HRJ A;  3BVZ A;  1X65 A;  2NVX H;  5JEA J;  4B3M L;  1ZYR D;  2JQO A;  3HZX A;  2WFW A;  1FNW A;  1VQ8 A;  2Z6K A;  3J80 i;  3J80 c;  4KHP Q;  1S72 A;  1CSP A;  4J6H A;  1K8O A;  3K5N A;  2F0U A;  5HUR A;  4A3B B;  2EY6 A;  1E2Z A;  4OGQ C;  4BBR B;  4FO2 A;  2KCM A;  2DNC A;  2A68 C;  2L9H A;  2V1C C;  4LAA A;  4DF7 A;  1EUJ A;  4ALP A;  1MJE A;  1I4P A;  4QQB X;  1PHJ A;  2F0V A;  1E22 A;  4LF5 Q;  2QCP X;  4V19 0;  1LT4 D;  1D2B A;  4A3G H;  3K7A H;  1TWC H;  1QNU A;  1YIJ A;  1DOK A;  1SYB A;  3S17 H;  1U9R A;  4UP9 A;  1QB5 D;  4QUC A;  1WTP A;  4KI0 A;  4QIW E;  4KK7 A;  3ERQ A;  1EY7 A;  1S5C D;  4KTA A;  2XRQ D;  3CCV A;  2BDN A;  1T5E A;  3CC7 A;  4C3I G;  5DAU A;  3KUP A;  1A0I A;  2MO0 A;  5M3M G;  1EFW A;  1NUC A;  4DV4 L;  4KHZ A;  3A8J E;  1RF2 D;  1TII D;  2PZW A;  3OW7 A;  1Q8K A;  3T1H Q;  1KLU D;  2B63 H;  1V8Q A;  4Y52 H;  1X9N A;  3V96 A;  4JPB W;  1PH2 A;  1VF7 A;  1PMR A;  1VQL A;  1U4P A;  1B4O A;  3JC6 6;  1A15 A;  3K0Y A;  2XNA C;  2Z1C A;  4YCW A;  1RJT A;  2HIV A;  1EY8 A;  5EPL A;  2WB1 G;  3N52 A;  2NN6 H;  2O4X A;  1XMO Q;  1SE4 A;  4BY1 H;  1A63 A;  4J8Q A;  5EQ0 A;  4KKT A;  4RCN A;  3BG3 A;  3BS1 A;  1TU2 B;  1YNJ C;  2K50 A;  1B70 B;  4XYO A;  2R93 B;  2LY7 A;  4FXG C;  1XPU A;  3HOX G;  2GN5 A;  3GTM H;  2CH4 A;  4A3M B;  1CM9 A;  1E3P A;  4DNR B;  3ICE A;  3PO3 H;  1K8G A;  3H0G B;  5J22 A;  3VA7 A;  2JA5 H;  1W3S A;  2Z4I A;  3MXU A;  4RG1 A;  3PQI A;  1OXU A;  4DKA C;  2ENB A;  4K0K L;  4C1N K;  3HOW B;  1K3R A;  1LTB D;  5J39 A;  2RA4 A;  3S16 B;  1EYC A;  4LF7 L;  1D5Z C;  2F3V A;  4OO1 G;  3R8B A;  4A3F B;  4MIU A;  3FKI H;  3O13 A;  4LF5 L;  2UXD L;  3U4Z A;  4L5Q A;  4K14 A;  3M4O H;  5D14 A;  1ENF A;  3DM1 A;  4BBR H;  3X3M A;  1EIH A;  3PUY A;  3CMA A;  1ET9 A;  1SMX A;  2KED A;  4P74 A;  2L55 A;  2F0I A;  3I4M B;  1EU4 A;  1Q1B A;  1S5F D;  4CKE A;  1Y8N B;  1J5E L;  2L11 A;  1Q3L A;  2A8V A;  4EQO A;  3GV3 A;  4DK3 C;  1Q7Y C;  5AFW A;  1EQQ A;  4X3S A;  1Y1V H;  1PV4 A;  2AQ2 B;  2B8F A;  3TRE A;  4OL7 A;  2EE1 A;  3SDZ A;  1EYG A;  3CPF A;  4NXM L;  1TWC B;  1D7Q A;  3PO3 G;  3I70 A;  3LWE A;  1EU3 A;  4QJF A;  4DK1 A;  1D6E C;  2JA5 G;  3T4A C;  2R93 G;  2Z4H A;  5IYC H;  1YI2 A;  2XTI A;  2HCI A;  3CQZ B;  4CJ2 C;  1S4Z A;  2XSC A;  1WYD A;  2QF7 A;  5C44 H;  1SSO A;  1VQD A;  2K28 A;  1VQ7 A;  1L0Y B;  4KHV A;  3EJI A;  4PMB A;  4BBS B;  1WTQ A;  1LAB A;  4PZ7 A;  1E24 A;  1G2T A;  3W3A A;  4X3U A;  1S40 A;  2D62 A;  2VY3 A;  4GKJ L;  5BN3 A;  2A74 C;  1A6X A;  1KNA A;  1QOH A;  2JA9 A;  3ONA B;  4FXK C;  3BJU A;  1I6V C;  5C5L A;  1Z47 A;  1I5F A;  4OO1 I;  2IPK D;  1M90 C;  4HJ5 A;  1WCM H;  2GA4 B;  4A3L H;  3OTO Q;  1XNQ L;  2HCC A;  3D3R A;  4DR7 Q;  3G7L A;  1EYA A;  1SYE A;  2EY1 A;  4LFB Q;  3G4S A;  2UUB Q;  1E2W A;  3U58 A;  2UXC L;  4DV0 Q;  2MFI A;  2KCC A;  3TSS A;  4C2M B;  2EXD A;  1L1O B;  1Z7T A;  3S1Q B;  1NMG A;  3J81 i;  3KBG A;  4C3J B;  3TS0 A;  4BS9 A;  4QUF A;  4X64 L;  1WD1 A;  5IOC A;  3UI2 A;  1LTI D;  1N9W A;  4LWC A;  2MQH A;  1X54 A;  4YIJ A;  5IGE A;  1XJV A;  2OF1 A;  4RGT A;  5A35 A;  2LFN A;  4L63 B;  2EJG C;  2O5J C;  1V1P B;  2IL8 A;  3GTL B;  3MFG A;  1DD2 A;  2KHI A;  4TQU S;  2EY2 A;  5CV5 A;  2EYO A;  2YTV A;  1WJJ A;  4LMQ D;  4H44 C;  4KN4 C;  3RMH A;  4A93 G;  1B44 D;  1TWH H;  1X55 A;  1EQR A;  3S1M B;  4GZY C;  4N8F A;  3EVQ A;  1M4V A;  2GVB A;  1EYD A;  1WOC A;  3ULL A;  5JJK A;  1SJH D;  1VQH A;  2K01 A;  3UDI A;  3W1B A;  4G7H C;  3MXN B;  3PIO 3;  4A3F H;  5IT9 L;  4HN7 A;  1PH6 A;  3TP7 A;  1HQM C;  2OTL A;  1QWY A;  4B9X A;  3QOJ A;  4ODG A;  5T1I A;  3PO2 G;  1EY0 A;  1HZC A;  1BOS A;  3RN2 A;  2HT1 A;  4HSV A;  4OEM B;  3URY A;  4CBV A;  1TWA B;  2PI2 E;  1D5X C;  3OIP A;  1QE6 A;  1STB A;  1Q82 C;  4DV3 L;  3T56 B;  2UXB L;  1SMY C;  2KBN A;  4JYA L;  1VQF A;  5D3I B;  2H5X A;  3TP6 A;  4YWM A;  4IUV A;  1AZQ A;  1K83 B;  4A3F G;  3I7F A;  1CTM A;  3GTO H;  3GD7 A;  3HKZ G;  5IGC A;  4HAE A;  3EIV A;  4FDB A;  3SK4 A;  3QR8 A;  2EZV A;  5C4X B;  1B50 A;  1Z9F A;  4EX5 A;  3VYR A;  1FJG Q;  2NVQ B;  3UDF A;  3OYY A;  4A3D B;  1VQP A;  2E2J B;  4YY3 Q;  4QGU A;  2NVY H;  1GUT A;  2JXM B;  2G9H D;  1NMF A;  4KY6 A;  2V4D A;  4LFA Q;  4X6A H;  5FK9 C;  2K5V A;  2F0N A;  1IYV A;  1F9Q A;  3HKS A;  2I07 B;  3TDQ A;  1AE3 A;  4HID A;  3F8T A;  1YEZ A;  3K58 A;  2I0Q A;  1G29 1;  4JI4 L;  2E2D C;  4JI3 L;  3M4P A;  2NB0 A;  5COR A;  3K5L A;  4G57 A;  2BE5 C;  1R4P B;  4OON A;  1NJI C;  3K5M A;  4GKK Q;  1STH A;  1IBM Q;  3HGB A;  3HFZ B;  1IZ6 A;  1SR3 A;  1TXY A;  2X6L A;  3I2Z A;  4DN4 M;  2Y0S G;  3PIP A;  1Q1E A;  1VDZ A;  2EJM A;  5FO7 B;  1KC8 C;  4PQX A;  4C3J H;  4XIG S;  3I73 A;  3Q23 A;  2A68 D;  4DR4 Q;  1UEA B;  1U5K A;  2RSN A;  5C4H A;  4MNO A;  3MZ5 A;  5IP9 H;  2ZJP A;  1XPO A;  2VXW A;  3KLS X;  1VQN A;  5IGD A;  1LYL A;  2FMC A;  2MGS A;  4DV6 L;  4AYB G;  3CCJ A;  3R93 A;  5EAY A;  4N8X 1;  3PF5 A;  1GM5 A;  4JI8 Q;  3T1Y Q;  4GOP A;  1PRT C;  3UDX A;  3RZO H;  4DU9 A;  3VYS A;  5LMU Q;  2OWO A;  2IT1 A;  3EQL C;  4R8I A;  5GAH C;  2IHE A;  3ERO A;  2H4O A;  2AMC B;  4A3K H;  2JA7 H;  4IPG A;  1JCK B;  4IUQ A;  5EKL A;  5I9P A;  2KCT A;  4IUR A;  1IW7 C;  1SXT A;  3NEL A;  1K73 C;  1KHI A;  2D0O A;  3IFT A;  4HSP A;  1I50 B;  4LUV A;  2VB3 X;  5ELC A;  1X3Q A;  3AQQ A;  3BZK A;  1V43 A;  4MHE A;  1GOZ A;  4RKB A;  5C4X G;  1TWA H;  4LW1 A;  1HNZ L;  4X3K A;  4M8A A;  4RWS C;  2E2H H;  5JPN C;  4YY3 L;  4G7O C;  4KKU A;  3HOY B;  3S1N B;  1JWS D;  5JPM C;  2KCN A;  1ZEQ X;  2NVX B;  1DJR D;  2AKW B;  1BDO A;  1FVI A;  2IHF A;  2EY5 A;  2B39 A;  1N33 Q;  3VDY A;  4A3E B;  1PTO D;  4A3G B;  5EJW A;  2HQE A;  5FKA C;  2UU9 L;  1Y1W G;  3FPP A;  3T1Y L;  2K04 A;  2WB1 B;  1JOR A;  3BZC A;  3DUZ A;  3NWT A;  1GUG A;  3A7L A;  1L0W A;  1VQ5 A;  1PYW D;  2RKS A;  1GXD C;  1N8R C;  1VS0 A;  4JI7 L;  3CME A;  4A3C H;  1L0X B;  5IYD H;  1NAP A;  2K4K A;  3S14 B;  4P71 A;  2ZTD A;  2M2L A;  4IAL A;  3MVV A;  1HUM A;  4N9T A;  4A3J H;  4YWK A;  4DAY A;  2F0D A;  3AU7 A;  1ROD A;  3I55 A;  4EVO A;  1HFN A;  4WJW A;  5GAD C;  2E74 C;  1PA6 A;  1C48 A;  2VQF L;  4JBW A;  4POG A;  3S1R H;  4V0B A;  2IWH A;  2F3I A;  2RCF A;  5CYU A;  4EGV A;  4LFC Q;  4F87 A;  1U4R A;  2F4I A;  1R4Q B;  1STY A;  1STE A;  1CKM A;  1IL8 A;  5NUC A;  2HQL A;  3OHX C;  1PRT F;  3TZU A;  5C3X A;  4B3S L;  5J1Z A;  3J7Z C;  5GAE C;  4YCV A;  4ZK9 B;  3TQY A;  1GD7 A;  1T9H A;  4UAI A;  2JK8 A;  2HDM A;  1YJ9 A;  3H0G H;  3H94 A;  4HCE A;  2BCO A;  3QIA A;  3BYT B;  4ZRZ A;  5ISR A;  4GNX A;  4P75 A;  3SK8 A;  2XIW A;  2QW7 A;  2DGY A;  1K0S A;  2ZM6 L;  1V9P A;  3E0J A;  1Y1V G;  4BY1 B;  1FJG L;  3OOC A;  1E0B A;  4U67 3;  4JCV E;  1QUQ B;  4JI1 Q;  3RZD B;  4BBS G;  3KF8 A;  4A75 A;  1RCV D;  2CQA A;  4DPG A;  3GTM B;  4UP8 A;  2EPB A;  2QEJ C;  3FKI B;  1VQC A;  4Z9C B;  4CDE C;  4CDF C;  4LF6 Q;  5KEE A;  4AQY Q;  2JA5 B;  5I4D A;  2E2I B;  1S5B D;  1UAP A;  2DN8 A;  2NZH A;  2F0K A;  4KY5 A;  3NTK A;  2RF4 A;  4RHS A;  4U68 A;  5EPK A;  1RTO A;  5M5W B;  1YIT A;  3S2H H;  3LWU A;  3OWE B;  2JA6 H;  2YYZ A;  2B2W C;  1WTV A;  1SJE D;  1I6H B;  4DAM A;  4HCS A;  3QB3 A;  2UXB Q;  3T1H L;  2QEX A;  3D0F A;  1FL0 A;  1PZK D;  4P2C B;  4UY8 C;  1YHA A;  4EQP A;  4JG2 A;  2BH2 A;  2A69 D;  1VQM A;  1ILQ A;  4XTC S;  3A0J A;  1F9S A;  4NP5 A;  1QJO A;  4AYB E;  3FVQ A;  1CQF A;  3J81 c;  1TT2 A;  3J81 j;  1GVP A;  2EIF A;  3U9S A;  4ZKB B;  3VR2 A;  4JC0 A;  2F0M A;  3RN5 A;  3Q8D A;  3Q24 A;  1XTC D;  2G5D A;  5HGQ A;  4HJ9 A;  2MO1 A;  3WDN A;  4CDD C;  4I65 A;  3STB D;  1XMQ L;  3DXJ C;  3DWP A;  3KBX A;  4A3J B;  3S2D H;  4HJ8 A;  1SRO A;  3MWY W;  5ELO A;  5IE8 A;  1TS3 A;  4RAU C;  4GLA C;  4IUP A;  3SK6 A;  4B3M Q;  4DNI A;  4IQZ A;  1OTC A;  2HD3 A;  2IX3 A;  3D4W A;  2WAQ B;  1EY5 A;  3SHL A;  5IGB A;  1BXT A;  4J15 A;  1MSH A;  5C44 B;  1IYJ B;  1I4G A;  3HG9 A;  4PG3 A;  5M9O A;  1SNO A;  1A62 A;  2RDH A;  1XYI A;  2UUC L;  5M5Y H;  2L5T A;  1IBK Q;  2F4V Q;  3C3L A;  2CH4 W;  1LTA D;  4DXF A;  4KMU C;  3D31 A;  1NTG A;  3K5O A;  4BY7 G;  3NBI A;  4ZUI A;  1HZ9 A;  4CKC A;  3CHB D;  1B9N A;  2F0O A;  1LT6 D;  2I5L X;  1TS2 A;  1QG7 A;  1GUW A;  3CP0 A;  3HOU H;  1LTT D;  4NDX A;  5E4X A;  2B63 G;  5KND A;  5E7N A;  4DAP A;  4GLX A;  4UHV A;  2PCF B;  4IFD G;  3RUZ A;  4DR3 Q;  1TWF H;  5ELN A;  5LMN Q;  4C3I H;  4F7X A;  2WKD A;  1EWH A;  1DM0 B;  2RBM A;  2E5L L;  5C4J H;  1SND A;  1C9O A;  1JQY D;  3GTQ H;  3G6E A;  3RLF A;  3OWF A;  1SDF A;  2X69 A;  3CD6 A;  4DAV A;  3SE0 A;  1I4Q A;  5C0X G;  3H6M A;  3GV6 A;  3GDE A;  2K5H A;  2KOL A;  1GJX A;  1UE5 A;  2AUK A;  3L7Z C;  2ALY B;  2KA7 A;  3ZJY C;  3OW2 A;  3ULP A;  5CR3 A;  1ENC A;  1U4L A;  4HMI A;  1EOT A;  2R3Z A;  1ZXT A;  5D65 A;  1OXV A;  3FMC A;  3M3Y H;  3F1Z A;  1JWM D;  1MD2 D;  5IYD G;  3BYY B;  3NUC A;  4MTN A;  3SXH A;  4DV6 Q;  4LF8 L;  1YNN D;  4IUN A;  1B9M A;  2E76 C;  5A2Q E;  1RIP A;  3CRK C;  4HIO A;  5IWA L;  4RCO A;  4O0A A;  4RFB A;  4IN3 A;  3TBI B;  5FLX L;  1B3Q A;  1R9T H;  2B3G A;  1GUN A;  4HTH A;  1K8A C;  2UXD Q;  1TKW B;  4ILW A;  3Q0A A;  1PYB A;  3CCM A;  1SAP A;  3KF8 B;  2K14 A;  4OIK A;  3GTJ B;  4FF3 A;  3I4M G;  2I5H A;  3U9O A;  3HEJ A;  1VQO A;  3W5O A;  3PCO B;  1ZYR C;  1HNX Q;  2MP1 A;  3LX0 A;  1DXM A;  5C4Z A;  1EOV A;  5EKK A;  2P5Z X;  1BNZ A;  2VUM G;  3U50 C;  1PFS A;  2UUB L;  2JA8 G;  3NQT A;  1J9O A;  1L2F A;  1EWI A;  1KDC A;  2PQE A;  3C1E A;  2C5C A;  2BDO A;  2K32 A;  1QIL A;  2BOS A;  1HNW Q;  4OXP A;  4A3D H;  3CCL A;  3HS0 C;  4A93 H;  1VQI A;  4ZCK A;  3DLL A;  2VNU D;  3S15 B;  1H9R A;  3MXP A;  2F0S A;  4X62 L;  2Q2T A;  1Y14 B;  1I94 Q;  2OEO A;  1LV9 A;  5A2Q L;  2N88 A;  1PH8 A;  5KIX A;  4GNX B;  1QVF A;  2AQ3 B;  3SR1 A;  1ICW A;  4WRD A;  1PTO C;  1BQQ T;  3FHW A;  1CZG A;  4PMW A;  1G2S A;  2O5I C;  1CSQ A;  1B3A A;  1TWF B;  3EBE A;  5JJI A;  2H1E A;  3H3V H;  4DR2 Q;  2N8N A;  5GQO A;  5CBA E;  4LF9 Q;  2A5H A;  3P7J A;  4DR3 L;  3STB C;  1HNX L;  1MHW C;  5IT9 c;  2WAQ G;  4DUZ L;  3HOU G;  2ASB A;  4RGN A;  2ID0 A;  1N34 Q;  2QIL A;  2ZXO A;  1PZI D;  4BWG B;  2SEB D;  5FLX E;  4CKB A;  5C3E G;  3CAM A;  1YHQ A;  4A3E G;  3KF6 A;  4ZKC B;  2JJQ A;  2FXQ A;  1PH4 A;  3BU2 A;  3X3N A;  1QCB D;  1BCP B;  3A7A B;  3M3Y B;  1OO9 B;  1BKB A;  2F0P A;  2EYJ A;  4GN3 B;  1AFP A;  2WAQ E;  4XDX A;  1TQO A;  3HOY G;  2L0C A;  4LF4 Q;  1F9R A;  5JEA G;  1FNV A;  4GS3 A;  1CHP D;  2J0T D;  1VQ6 A;  1VQA A;  2F0Q A;  2ATW A;  5IYB H;  1LT5 D;  3M9B A;  3KF6 B;  2WB1 E;  4B08 A;  2Z0S A;  1LUZ A;  5K5P A;  1O7Y A;  1M8A A;  1VQE A;  3SK5 A;  1L1O C;  5C0X J;  3ERS X;  1NR2 A;  5BN4 A;  4XQJ A;  2K5W A;  3AEV A;  5E3F A;  3AMU A;  2Q8R E;  3TRZ A;  2CW0 C;  4B3R Q;  1H9K A;  1CA6 A;  4BXX H;  1S5D D;  3S1N H;  3DHQ A;  5CV6 A;  1B2T A;  3S14 H;  1IXR A;  3K8A A;  3D6C A;  5DNF A;  2I46 A;  2NTT A;  3RNU A;  4OO1 H;  4M1U B;  4AQY L;  2F0H A;  4BA2 I;  1TWG H;  5IOD A;  4X62 Q;  4IFD J;  1AH9 A;  1O78 A;  1U4M A;  4NW2 A;  4E6I A;  1QVC A;  2A1A A;  1TY2 A;  3TS2 A;  2B2V A;  1WFQ A;  5C3E B;  4B9W A;  2PNH A;  1K28 A;  1V1P A;  2F0F A;  3OSO A;  3S1R B;  4DV4 Q;  5CV8 A;  2R7Z B;  3A5U A;  3ITP A;  2NVT B;  5C0X I;  2CHB D;  4LF6 L;  1PH5 A;  3I91 A;  1IBK L;  2F4V L;  2PYK A;  2SNS A;  4L8J A;  3CC2 A;  3T13 A;  3FRP B;  1I94 L;  1VQB A;  3H3V I;  3C46 A;  1EY6 A;  4K6D A;  1DON A;  4ABN A;  3I4L A;  3A55 A;  4LFC L;  3ND8 A;  1HH2 P;  5FLM H;  3M85 A;  4IO9 A;  4PNY A;  2OCE A;  2HHH L;  1VMP A;  4XT1 B;  2ZM6 Q;  4KHP L;  4RGO S;  2LS0 1;  3DMU A;  5EKI A;  2XRS D;  1FGU A;  1D8L A;  3CKI B;  2IX0 A;  3RLN A;  3NE5 B;  5JJZ A;  5EBD A;  4DR4 L;  1KLG D;  3MA2 B;  1MKH A;  1DOM A;  5FJ8 G;  2DJF C;  4XYQ A;  4R4T A;  4OX9 Q;  4R4Q A;  4IFD I;  1PTO H;  1A3T A;  1MSG A;  1G6Z A;  2F0L A;  3EN2 A;  4GOP C;  2EQS A;  1CZW A;  3HKZ B;  2FMM A;  4H7B A;  3GQB A;  4A3B G;  1L1O A;  1IL2 A;  1NY4 A;  4X3T A;  1NE3 A;  3HOV H;  3NBH B;  4X66 Q;  1DYQ A;  1HUN A;  3PUZ A;  4TRD A;  3K80 C;  4LUZ A;  5C44 G;  1EIY B;  5EGT A;  3E3X A;  3SVM A;  4NXM Q;  4A3C G;  1CQV A;  4HED A;  2NN6 I;  1IBM L;  2EYF A;  4XQQ A;  2FFK B;  2O2L D;  2E2I H;  2R93 H;  2LMC B;  4JI7 Q;  3CRL C;  2R7Z G;  1HNZ Q;  5CV9 A;  3AYH B;  4DGZ A;  3PO3 B;  3NPP A;  1Z6H A;  5DM6 3;  1STA A;  1A3V A;  1SYC A;  1UNS A;  5AJ3 L;  3GTK H;  3D8G A;  3HOZ G;  4DV1 L;  1XX8 A;  1I6H H;  1JB7 A;  5I2Y A;  2QDL A;  4DR2 L;  3HOW H;  2LKV A;  3G71 A;  3S16 H;  2NUC A;  1EY4 A;  1YBY A;  5LL6 X;  5IIF A;  2OQ0 A;  3S17 B;  2R7D A;  1UUP A;  2NZ1 D;  2K03 A;  2PMZ E;  4JI5 L;  3T51 B;  1JJG A;  4L5R C;  1G51 A;  3WOF A;  2Q2U A;  2SDF A;  4G4K A;  2NZO A;  3R3O A;  2CW0 D;  3HOV G;  4YHH L;  3M4O B;  4EQN A;  4Q5V A;  4JBK A;  4B3T L;  2R92 B;  1KAB A;  5LMU L;  3CXC A;  1SNM A;  3EA6 A;  2VQE Q;  1K0R A;  3R2T A;  2HHH Q;  3H3V C;  1EY9 A;  4ZUJ A;  1KRS A;  1LTS D;  3S2D B;  4RKL A;  4JI0 Q;  1JMC A;  4DR6 L;  3I72 A;  1Y1V B;  2TSS A;  4BY1 G;  1UEB A;  4OX9 L;  2HDL A;  3LNN A;  2X6G A;  3WWV A;  2CKZ B;  1PH1 A;  3SGI A;  4IFD H;  3E0E A;  5IP9 G;  2DUD A;  1BUV T;  4POF A;  2Y0S B;  4ZYS A;  5I6W A;  2ES2 A;  2F0E A;  5C4J B;  3I4N H;  1I3Q B;  2XN9 C;  1PLF A;  4HIK A;  3I8Z A;  1SYG A;  2K5N A;  3IRB A;  2QGQ A;  1PTO B;  1PDQ A;  3CC4 A;  1B1Z A;  1IBL L;  2B29 A;  2EYL A;  1X3E A;  1XNR L;  4DV2 L;  2BH8 A;  3OMC A;  2OQK A;  4A3L G;  2MUY A;  4LJZ C;  1KRT A;  2ICI A;  1G6P A;  5IT9 E;  1WVL A;  1X56 A;  2PQA B;  4A3J G;  2RDG A;  1EZ8 A;  2YV5 A;  4KD3 A;  2LXK A;  2R92 G;  1CI3 M;  1SRU A;  4QCL A;  1OXX K;  5IP7 G;  3W1G A;  3N6R A;  4CJ1 B;  3RD4 A;  1Y69 U;  4DR1 L;  1Y8P B;  1ML0 D;  4DXG A;  4DUY Q;  1QZG A;  3HOV B;  1Y8O B;  1EEF D;  1ENA A;  4C56 C;  3MC0 B;  5JOB A;  5JVG 3;  1D1I A;  4H02 A;  2B2U C;  1H9M A;  1DOL A;  5HGT A;  1EQV A;  3HOZ B;  1LTL A;  1FR3 A;  5KNC A;  3K7U C;  5KNB A;  3PUV A;  3QJY A;  3KOJ A;  4H0L C;  3NQI A;  1KAW A;  2F0G A;  1P8L A;  2C9O A;  3NBH A;  4ME5 A;  2HUG A;  5ELB A;  3I4M H;  1SYF A;  3KJO A;  1QUQ A;  1N36 Q;  1SFO B;  4LNQ A;  1HA6 A;  5ELD A;  1NR4 A;  3BDO A;  4K2L A;  5KGU A;  2PZU A;  1X3G A;  3U4V A;  4C3H G;  3PO2 H;  1JOO A;  3ND9 A;  3W2D A;  1EIF A;  3A5Z B;  5IYB G;  1HR0 L;  1A8V A;  2XWB B;  4H13 C;  1AEX A;  1ESR A;  3FKI G;  5CV4 A;  1I4H A;  4FYD A;  1HZA A;  3M7N A;  4BBS H;  2D5D A;  3KK7 A;  4QIW B;  4LUO A;  3UE0 A;  4XT3 B;  5M3F H;  4DA2 A;  4PMC A;  4A93 B;  1VQ4 A;  4LF7 Q;  3S15 H;  1MIU A;  2JSO A;  5JEA H;  2I5M X;  1H9S B;  1NCV A;  5I9O A;  2EYH A;  4X65 L;  2B2Y A;  3K81 C;  4L5T A;  3BDC A;  3CCQ A;  4CDC C;  1WCM B;  4Y7N H;  4J1M A;  3TP5 A;  2EDG A;  4GOP B;  5C0X H;  1AE2 A;  1XWE A;  4LF4 L;  5IP7 H;  1EFI D;  2YU9 B;  4DR6 Q;  4R9W A;  5FO9 B;  3HOX H;  1IHZ A;  4IJL A;  1RL2 A;  2RCN A;  2K1B A;  4JI4 Q;  3TZD A;  1CHQ D;  4K5W A;  4KJO A;  4LK1 C;  3I4N G;  3I4N B;  1TVX A;  2ZJQ A;  2NTS A;  5C6A A;  3A56 A;  2ZXP A;  3OPO A;  4ME3 A;  5ELE A;  2NN6 G;  3A8K E;  2B2Y C;  1CK1 A;  2L1B A;  2Q2I A;  1X3F A;  4JBM A;  3NEM A;  4NXN Q;  1KDB A;  5G3L F;  2Q8I B;  3GTL H;  3NEN A;  2E75 C;  1HR0 Q;  4GN5 A;  4DV5 Q;  1H9S A;  1WTR A;  1HQR D;  1YZ6 A;  1FNU A;  3IKJ A;  3NK9 A;  2B2U A;  1I4R A;  4BA1 I;  1ASZ A;  3IAY A;  3DM3 A;  5G3L D;  1VQG A;  5I2X A;  4DUZ Q;  1HHV A;  1KAA A;  4JI2 Q;  3F2U A;  1JC7 A;  1BO0 A;  3HKZ E;  2Z8L A;  1U0L A;  4IPD A;  1HJP A;  4RA8 A;  1UE1 A;  1EEI D;  1C4Q A;  4O42 A;  1C7Y A;  3GO5 A;  2F03 A;  3OTO L;  2JP1 A;  3KDF B;  4JI8 L;  2JEB I;  2UUA Q;  4WOR A;  1JJC B;  5M5X B;  4N9P A;  1XPR A;  4K8J A;  3D6W A;  1WTH A;  2R61 A;  4P72 A;  3UDG A;  1EIG A;  5CGK A;  3NSW A;  4FXD A;  1UWV A;  2VUM H;  4JVZ A;  1O7L A;  5I6Y A;  1GHK A;  1D1K A;  3I90 A;  2JA8 H;  5ELF A;  3MAQ A;  1K83 H;  2BA0 A;  3GTO B;  5BN5 A;  1YHB A;  3JAM E;  2CVR A;  3G48 A;  1NBW A;  4P73 A;  4DK6 C;  2A19 A;  2K6A A;  5TSS A;  2B2W A;  3E9I A;  4GKK L;  5L37 A;  1E1O A;  1FD7 D;  4JK1 C;  4LFB L;  2A73 B;  4QF4 A;  4WJ3 M;  1K9M C;  2PI2 A;  1HTL D;  4FVM A;  5M3F B;  2E2J H;  3J7A F;  1GKH A;  3I56 A;  1I50 H;  2R7Z H;  5E1F A;  4CHT B;  3GTP H;  4QL5 A;  5H1S E;  2JA7 G;  1CA5 A;  1MI2 A;  2NVT H;  1A3U A;  1H9J A;  1TR5 A;  1LT3 D;  4K6L A;  4KJN A;  2N49 A;  1OXS C;  4A3M G;  2Q2H A;  3NWS A;  1IW7 D;  4Y7N B;  2QA4 A;  3HOY H;  1HCZ A;  1K3B C;  3AB9 A;  4B3T Q;  2EOT A;  1NSN S;  4K5V A;  3PV0 A;  3T53 B;  1YNX A;  1XTD A;  2D0P A;  2OTJ A;  5C3E H;  4JI0 L;  1SE3 A;  5LHY 1;  3S9W A;  1DZ1 A;  4A3E H;  4RMF A;  1GO3 E;  4ZLT F;  3NTH A;  2ZTE A;  2VQE L;  1RDP D;  1B53 A;  1F2Z A;  1HFG A;  1SNP A;  3PGZ A;  1XMO L;  1AZP A;  2N55 A;  2K7V A;  1WTW A;  4GKJ Q;  1K8M A;  1JE4 A;  2VL6 A;  4GLV B;  4XXE A;  1PXU A;  2IW3 A;  4K8I A;  3PSI A;  3JAM i;  4KY7 A;  1YJN A;  2PMZ B;  1BF4 A;  1ASY A;  1O7I A;  5M3M B;  5AJ3 Q;  2PQA A;  2UUA L;  3A8I E;  3KFU A;  1HZB A;  3J81 E;  2AHO B;  4QY7 A;  1ILP A;  4JI6 L;  3RZO B;  3Q22 A;  1IBL Q;  2A6H C;  2YTY A;  1F2Y A;  4MZ9 A;  5FJ8 H;  3GTG H;  4O2D A;  1KD1 C;  1XXG A;  2PW5 A;  2L15 A;  5LMN L;  1HNW L;  4A4I A;  4X66 L;  4AH6 A;  3QG1 A;  1EL0 A;  1D5M C;  4A3K B;  2RVL A;  3H91 A;  2A6H D;  5CMD A;  1Q90 A;  2IY5 B;  1GHJ A;  4A3I G;  3BZD B;  5F2D A;  3CCR A;  5LMN W;  1CUK A;  1H95 A;  3CCE A;  3AFQ A;  1W6J A;  1TY0 A;  3CPW A;  4RH6 A;  4MTK A;  4DK0 A;  2WV6 D;  3C2P A;  4TVA B;  1HPC A;  1VQJ A;  2VUM B;  2EXZ A;  2JN4 A;  4IUT A;  4OWT B;  2MNA A;  2F52 A;  4GN4 B;  4R4C A;  4K0K Q;  2VZA A;  3H09 A;  2RQX A;  5EBC A;  2K52 A;  2EYP A;  3CF5 A;  1N36 L;  1YVC A;  2VQF Q;  3L3O C;  1HR0 W;  1LO5 D;  3HP3 A;  2Z9H A;  5GRO A;  4R8N A;  2XGT A;  4QMG A;  3PIO A;  1VF5 C;  1RKN A;  4L6T B;  3GTP B;  1N32 Q;  2Z6B A;  2IX1 A;  4JBJ A;  2WP8 J;  1ESF A;  2NWG A;  2UXC Q;  3GTK B;  3MTS A;  1EQT A;  3A74 A;  3T16 A;  3VR4 A;  1YNJ D;  3TME A;  3S2H B;  2WKC A;  1A2U A;  2RSO A;  4YWL A;  4R4O A;  1BVS A;  1B8A A;  1SNQ A;  1S5E D;  2JA6 B;  1JR0 D;  2OT2 A;  1LM0 A;  4HJ7 A;  1G8Z D;  3TP8 A;  2KEE A;  3KDF A;  1JWU D;  4OIJ A;  1SNC A;  2YTX A;  4NKL A;  1GUO A;  1SEB D;  4JI1 L;  3K57 A;  3C1F A;  1VCI A;  4JOI A;  1HTP A;  1W6K A;  3NP8 A;  3L9A X;  1ICF B;  4DV0 L;  4Q0F A;  3S24 A;  4JV5 L;  1A2T A;  3P20 A;  3MHB A;  2L4N A;  4KKS A;  1KXL A;  2R92 H;  1Q81 C;  4L5S A;  2JYO A;  1Q46 A;  1BBW A;  1PRT B;  3M4Q A;  3MFY A;  2CWP A;  4I7A A;  1MGS A;  3I4O A;  2KVM A;  1BBU A;  1CKN A;  1ZKO A;  1MJC A;  2AWO A;  2DJG C;  3H0G G;  2B63 B;  4K2K A;  4X65 Q;  3B6Y A;  1TS4 A;  3KLW A;  3GTG B;  3VR6 A;  4CJ0 B;  1MBY A;  4ZAI A;  5CBE E;  2TMP A;  3MXG A;  2ICE C;  4APV A;  1WTO A;  4OWW B;  1JT8 A;  3BVG A;  1Q8I A;  1KTK A;  4NXN L;  1KDA A;  5C5M A;  1I3Q H;  3F2C A;  1X6O A;  3PUW A;  4XQN A;  2ZJR A;  3RZD H;  5M5Y B;  1KNE A;  2RDF A;  1YJW A;  1X3P A;  3J7Y W;  1CKO A;  1XNR Q;  1PZJ D;  4R4I A;  1SN8 A;  3FDT A;  2UU9 Q;  5KYI A;  3L2P A;  1XMQ Q;  1WD0 A;  1J8I A;  4JI5 Q;  4PZ6 A;  2EVB A;  3TN2 A;  2FJ2 A;  2HIX A;  3QO2 A;  4MN3 A;  2D9U A;  3IL8 A;  4FF4 A;  2AQ1 B;  5M5W H;  4WFN 3;  1M1K C;  3VA5 A;  2A69 C;  3DEP A;  4DR7 L;  5IGF A;  3DWQ A;  1Y1W H;  2VS1 A;  4OHJ A;  4NPS A;  1SFO H;  5M3F G;  4C3I B;  2XVS A;  2Z6K C;  4KD4 A;  3E6Z X;  1F77 A;  2K5Q A;  4IZ8 A;  3NHH A;  2NBF A;  4DNT B;  3JAM c;  1PRT D;  4FNF A;  1Q12 A;  3HOZ H;  1F9P A;  1II3 A;  2R6G A;  4AIM A;  5JVH 3;  4O1N A;  4C3H H;  2G9D A;  4JI2 L;  3P75 A;  2KHS A;  3WOE A;  1JOQ A;  4KLK A;  2PW7 A;  2VB2 X;  1XNQ Q;  2DNE A;  1LTR D;  4TKO B;  2CFM A;  3J7A V;  3M7G A;  1UE7 A;  4JV5 Q;  5DEH A;  5KYL A;  3E9H A;  1ET6 A;  3HOW G;  2BE5 D;  4JI6 Q;  2JA6 G;  4IPC A;  1I4X A;  2FIN B;  1C0A A;  4LFA L;  2M9V A;  1STG A;  2WII B;  1V1Q A;  3CU7 A;  4DR5 L;  3MXN A;  3PO2 B;  4OEL B;  1JIC A;  2EYM A;  4ZQ3 A;  5FLX c;  3LGJ A;  5CC4 A;  1WTX A;  2B8G A;  3J80 E;  4ULL A;  3PF4 A;  3TEH B;  2OXP A;  1E7Z A;  2PO4 A;  1PTO F;  4IPH A;  2GVA A;  2CCZ A;  4QB4 A;  3HOX B;  1R9T B;  4IJH A;  5D3D A;  3MEH A;  3BDL A;  3ULJ A;  1IYU A;  4JW0 A;  2WIN B;  3L0O A;  1RHP A;  3GTJ H;  4A3I H;  1N32 L;  4DAY B;  4JYA Q;  5T1G A;  3E5S A;  4I7Z C;  2KEN A;  2KUM A;  1CKN B;  3HOU B;  1V1O A;  3R2I A;  2K33 A;  3NTI A;  1LTG D;  3SEB A;  1RD9 D;  2YU9 H;  3KJP A;  1F2M A;  1TS5 A;  4F8M A;  3CQZ H;  2ZT9 C;  5IWA Q;  4YHH Q;  5FOB B;  2MJ8 A;  1KIX A;  2DY8 A;  4OWX B;  2JEA I;  4K5X A;  4C3J G;  3GTQ B;  1KQS A;  1FGB D;  5E4W C;  3EFX D;  1HXY D;  2A6E C;  4NB3 A;  5COY A;  1W2B A;  1HA5 A;  3FPU B;  1E1T A;  1JE5 A;  1IKL A;  4RHR A;  3GP7 A;  2M00 A;  3ZYY X;  4EQ5 A;  3F2D A;  1DGS A;  1STN A;  1WCM G;  2A6E D;  3NXW A;  4JI3 Q;  3G6J B;  4G7Z C;  4DV7 Q;  3H15 A;  2D2C C;  4BY7 B;  5IY0 A;  3PIP 3;  2PPB C;  4FP5 D;  2CWA A;  1Y1W B;  2R7F A;  2Y0S E;  5DLQ E;  4IUU A;  1SYD A;  3I3C A;  1TWH B;  1CT1 D;  4C2M H;  1VQK A;  2JA8 B;  1SE8 A;  1BBX C;  4HIM A;  4KN7 C;  2F0T A;  2E8G A;  3FEW X;  3S1Q H;  1AW7 A;  2AWN A;  2ZXR A;  3VYU A;  2PNR C;  4B3R L;  3RLO A;  3D4D A;  5M5X H;  4C3H B;  1GUS A;  3FP9 A;  1P16 A;  2BA1 A;  3VYT A;  2B2T C;  1BCP C;  1C8C A;  3ER0 A;  1PH9 A;  4TSS A;  4A3G G;  3J80 L;  1VMC A;  2SOB A;  3DWA A;  2K75 A;  1QVG A;  2CQO A;  3V05 A;  5K36 H;  2FHT A;  4S3S A;  2MHV A;  4HMJ A;  3BVM A;  4HR7 B;  1J6Q A;  5JJL A;  2PZT A;  4BXX G;  3VR5 A;  3AFP A;  5HY6 A;  1JB3 A;  4NMZ A;  1VQ9 A;  3S1M H;  2SNM A;  3MEF A;  1X32 A;  4YCU A;  4DUY L;  2N3S A;  2LSS A;  1DCZ A;  2F0W A;  5GAG C;  4FF2 A;  4B3S Q;  4KV6 A;  5KRU A;  1PYS B;  2EJF C;  5C4X H;  4DV7 L;  5K36 G;  4WJ4 A;  4RGM A;  3CCU A;  1Q86 C;  4IOC A;  2L12 A;  4A3B H;  1PFM A;  1AN8 A;  1O80 A;  3K59 A;  4LF8 Q;  1BCP D;  5J3B A;  2NVY B;  4A3I B;  1N34 L;  3KLR A;  3JAM L;  4DR1 Q;  3M4Y A;  1PH7 A;  2KHJ A;  5JAV A;  4A3K G;  1QNK A;  1YNN C;  2RHQ B;  3K6O A;  2C35 B;  3KLS A;  1LAC A;  3CW2 C;  4FF1 A;  1ONL A;  1IKM A;  4HJA A;  4AYB B;  3PMF A;  2DY7 A;  3K7A B;  4R1J A;  2F0J A;  5BR8 L;  4X64 Q;  2NVQ H;  1SE2 A; 
#chains in the Genus database with same CATH homology
 1OXS C;  3KF6 B;  2LXJ A;  2Q2H A;  3M9B A;  5BR8 Q;  4GNX C;  4A3M G;  3PF5 A;  1GM5 A;  1OXT A;  2WB1 E;  2QA4 A;  4JI8 Q;  3T1Y Q;  3HOY H;  2Z0S A;  1LUZ A;  4GOP A;  1B7Y B;  3UDX A;  3CCJ A;  4B3T Q;  3RZO H;  1VQE A;  5LMU Q;  4JOI C;  1L1O C;  2OWO A;  2IT1 A;  3PV0 A;  5C0X J;  3ERS X;  1YNX A;  1XTD A;  3AEV A;  2D0P A;  5GAH C;  2OTJ A;  2IHE A;  5C3E H;  4JI0 L;  1QZH A;  4IOA A;  4A3E H;  2AMC B;  4A3K H;  3TRZ A;  4RMF A;  5M3M H;  1GO3 E;  4LF9 L;  2JA7 H;  4B3R Q;  4IPG A;  2ZTE A;  5FLM G;  4BY7 H;  2VQE L;  4BXX H;  1S3O A;  3J7A 5;  3S1N H;  2KCT A;  1N33 L;  1WI5 A;  4UPA A;  3PUX A;  3NEL A;  3PGZ A;  1XMO L;  3S14 H;  1IXR A;  3K0X A;  2N78 A;  3K8A A;  4DR5 Q;  1K73 C;  1KHI A;  2D0O A;  3RR5 A;  4GKJ Q;  1PVO A;  1UE6 A;  3RNU A;  4AQY L;  4BA2 I;  1AH9 A;  1TWG H;  4LUV A;  4X62 Q;  4IFD J;  3BZK A;  3AQQ A;  1V43 A;  2E5L Q;  2VL6 A;  4GLV B;  5C4X G;  1TWA H;  4LW1 A;  1HNZ L;  1QVC A;  2A1A A;  3PSI A;  3JAM i;  1WFQ A;  4DV1 Q;  2E2H H;  3TS2 A;  1YJN A;  4PZ8 A;  2PNH A;  1ASY A;  4YY3 L;  1O7I A;  5AJ3 Q;  4A3D G;  4UP7 A;  2RHS B;  2PQA A;  2UUA L;  3KFU A;  1HZB A;  2AHO B;  4DV4 Q;  4QY7 A;  4DV5 L;  1JJ2 A;  3A5U A;  4JI6 L;  3KYH C;  1IBL Q;  1SLJ A;  2YTY A;  4MZ9 A;  5FJ8 H;  3GTG H;  5C0X I;  4O2D A;  1KD1 C;  5IYC G;  3F2B A;  2L15 A;  5LMN L;  2AKW B;  4DV3 Q;  1HNW L;  4LF6 L;  4A4I A;  4X66 L;  1FVI A;  1PH5 A;  2IHF A;  1IBK L;  2F4V L;  4AH6 A;  4A3M H;  1N33 Q;  4DV2 Q;  3VDY A;  1J5E Q;  2VW9 A;  3CC2 A;  2IY5 B;  4A3I G;  2UU9 L;  1Y1W G;  1PH3 A;  3UE1 A;  1I94 L;  1KL9 A;  3CCR A;  3T1Y L;  2ZTC A;  2UUC Q;  1VQB A;  5LMN W;  3H3V I;  1CUK A;  4BBR G;  3CCS A;  1H95 A;  2JE6 I;  3BZC A;  4LFC L;  1HH2 P;  5FLM H;  3M85 A;  3AFQ A;  3CCE A;  4IO9 A;  1L0W A;  4A76 A;  1VQ5 A;  2OCE A;  1N8R C;  1X65 A;  2HHH L;  1VS0 A;  3CPW A;  2ZM6 Q;  2NVX H;  4JI7 L;  4KHP L;  5JEA J;  3CME A;  4A3C H;  4B3M L;  2JQO A;  2WFW A;  4TVA B;  1VQ8 A;  5IYD H;  1VQJ A;  2K4K A;  1FGU A;  2Z6K A;  4P71 A;  3J80 i;  3J80 c;  1D8L A;  2ZTD A;  4KHP Q;  1S72 A;  4OWT B;  1CSP A;  2IX0 A;  3RLN A;  2MNA A;  4DR4 L;  1MKH A;  2F52 A;  4GN4 B;  4YWK A;  4A3J H;  4R4C A;  5FJ8 G;  4K0K Q;  2VZA A;  4R4T A;  3I55 A;  4OX9 Q;  2K52 A;  4R4Q A;  5GAD C;  2KCM A;  4IFD I;  3CF5 A;  1N36 L;  1PA6 A;  2VQF L;  4JBW A;  2V1C C;  4POG A;  3S1R H;  2F3I A;  1EUJ A;  4ALP A;  1MJE A;  3EN2 A;  1YVC A;  4GOP C;  4LFC Q;  2VQF Q;  1HR0 W;  2EQS A;  4QQB X;  5GRO A;  2XGT A;  1PHJ A;  1CKM A;  3PIO A;  1E22 A;  4LF5 Q;  2HQL A;  4A3B G;  1N32 Q;  2IX1 A;  1L1O A;  1IL2 A;  3K7A H;  1TWC H;  4B3S L;  4A3G H;  4JBJ A;  1NY4 A;  1YIJ A;  2WP8 J;  3J7Z C;  5GAE C;  4YCV A;  2UXC Q;  1NE3 A;  3HOV H;  3NBH B;  3A74 A;  3S17 H;  4X66 Q;  3TQY A;  3PUZ A;  1GD7 A;  1T9H A;  4UP9 A;  3K80 C;  2JK8 A;  4LUZ A;  4R4O A;  3H0G H;  1BVS A;  1B8A A;  4KI0 A;  4YWL A;  5C44 G;  4QIW E;  1YJ9 A;  1EIY B;  4NXM Q;  4A3C G;  1LM0 A;  4HJ7 A;  2NN6 I;  3CCV A;  4GNX A;  3KDF A;  4P75 A;  1IBM L;  2DGY A;  2R93 H;  3CC7 A;  2YTX A;  2E2I H;  2ZM6 L;  1A0I A;  4JI7 Q;  2MO0 A;  2R7Z G;  1V9P A;  5M3M G;  1HNZ Q;  1EFW A;  1Y1V G;  3AYH B;  4JI1 L;  1FJG L;  1VCI A;  4DV4 L;  4JOI A;  4KHZ A;  2B63 H;  1Q8K A;  3T1H Q;  5AJ3 L;  4JCV E;  3GTK H;  4Y52 H;  1QUQ B;  1X9N A;  3HOZ G;  4DV0 L;  4JV5 L;  4JI1 Q;  4DV1 L;  3S24 A;  4BBS G;  1PH2 A;  4A75 A;  1I6H H;  1VQL A;  4DPG A;  1JB7 A;  4UP8 A;  3JC6 6;  4DR2 L;  1KXL A;  2R92 H;  1VQC A;  1Q81 C;  3HOW H;  3G71 A;  4LF6 Q;  4L5S A;  3S16 H;  4YCW A;  4AQY Q;  2HIV A;  1YBY A;  1Q46 A;  1BBW A;  2WB1 G;  3M4Q A;  2CWP A;  2NZH A;  1YIT A;  1XMO Q;  2RF4 A;  2OQ0 A;  3I4O A;  2R7D A;  1BBU A;  4BY1 H;  1A63 A;  1CKN A;  3S2H H;  1MJC A;  2AWO A;  2PMZ E;  4JI5 L;  3H0G G;  1JJG A;  4L5R C;  1G51 A;  4X65 Q;  2Q2U A;  3B6Y A;  2JA6 H;  2NZO A;  2YYZ A;  3KLW A;  3HOV G;  4YHH L;  2K50 A;  1B70 B;  4DAM A;  2UXB Q;  1XPU A;  3HOX G;  3T1H L;  2GN5 A;  2QEX A;  3GTM H;  4JBK A;  3D0F A;  1FL0 A;  4APV A;  1E3P A;  4B3T L;  4OWW B;  1JT8 A;  5LMU L;  4UY8 C;  3CXC A;  4NXN L;  1YHA A;  2VQE Q;  4JG2 A;  1K0R A;  1K8G A;  2HHH Q;  1VQM A;  2BH2 A;  3F2C A;  1I3Q H;  1W3S A;  1X6O A;  2JA5 H;  3PUW A;  4XTC S;  3A0J A;  2ZJR A;  1KRS A;  4AYB E;  3RZD H;  4JI0 Q;  4RG1 A;  1JMC A;  3J81 c;  1OXU A;  3J81 j;  1YJW A;  1GVP A;  4DR6 L;  4BY1 G;  4DKA C;  2EIF A;  1CKO A;  1XNR Q;  1UEB A;  4OX9 L;  4K0K L;  4R4I A;  4JC0 A;  1SN8 A;  3WWV A;  2CKZ B;  1PH1 A;  2UU9 Q;  3RN5 A;  3SGI A;  1K3R A;  3Q8D A;  3L2P A;  1XMQ Q;  5HGQ A;  3E0E A;  4JI5 Q;  4PZ6 A;  5IP9 G;  4HJ9 A;  2MO1 A;  2DUD A;  4LF7 L;  2HIX A;  4POF A;  3STB D;  5M5W H;  1XMQ L;  1M1K C;  4OO1 G;  2ES2 A;  3I4N H;  4DR7 L;  3FKI H;  4LF5 L;  1Y1W H;  2VS1 A;  3S2D H;  4HJ8 A;  1SRO A;  5IE8 A;  4NPS A;  5ELO A;  2UXD L;  3U4Z A;  4L5Q A;  1SFO H;  5M3F G;  4GLA C;  4HIK A;  4B3M Q;  2Z6K C;  3M4O H;  4BBR H;  2K5N A;  4DNI A;  1OTC A;  3PUY A;  3CMA A;  3IRB A;  2QGQ A;  3CC4 A;  1SMX A;  4P74 A;  1IBL L;  2B29 A;  3JAM c;  1X3E A;  4J15 A;  1IYJ B;  1Q12 A;  1Q1B A;  1XNR L;  2R6G A;  4DV2 L;  3HOZ H;  4AIM A;  2BH8 A;  4PG3 A;  1J5E L;  1A62 A;  2OQK A;  2A8V A;  4C3H H;  2UUC L;  5M5Y H;  1IBK Q;  2F4V Q;  4DK3 C;  1Q7Y C;  4A3L G;  1KRT A;  1EQQ A;  1G6P A;  1Y1V H;  1PV4 A;  4JI2 L;  3TRE A;  1X56 A;  2PQA B;  4A3J G;  4KLK A;  2YV5 A;  1NTG A;  3D31 A;  1EYG A;  3CPF A;  2LXK A;  2R92 G;  1SRU A;  4NXM L;  4BY7 G;  1D7Q A;  1OXX K;  3PO3 G;  1HZ9 A;  5IP7 G;  4QJF A;  3W1G A;  1XNQ Q;  2JA5 G;  2R93 G;  5IYC H;  4DR1 L;  1YI2 A;  2XTI A;  4DUY Q;  1QZG A;  2CFM A;  2I5L X;  4JV5 Q;  1UE7 A;  3CP0 A;  3HOU H;  1WYD A;  3E9H A;  3HOW G;  5C44 H;  2B63 G;  1VQD A;  1VQ7 A;  4H02 A;  4JI6 Q;  5E7N A;  2JA6 G;  4IPC A;  1LTL A;  1C0A A;  4GLX A;  4LFA L;  4PZ7 A;  1E24 A;  4IFD G;  1V1Q A;  3K7U C;  1S40 A;  4DR3 Q;  2D62 A;  1TWF H;  3PUV A;  4DR5 L;  2VY3 A;  5ELN A;  4C3I H;  5LMN Q;  4GKJ L;  3KOJ A;  5FLX c;  3LGJ A;  1KAW A;  2JA9 A;  1P8L A;  2E5L L;  3PF4 A;  5C4J H;  3BJU A;  3TEH B;  4OO1 I;  1Z47 A;  1I5F A;  1C9O A;  1E7Z A;  3I4M H;  4IPH A;  2GVA A;  3KJO A;  2CCZ A;  3G6E A;  1QUQ A;  3RLF A;  1M90 C;  3GTQ H;  4HJ5 A;  1WCM H;  4IJH A;  1N36 Q;  4A3L H;  4LNQ A;  3CD6 A;  3ULJ A;  3OTO Q;  1XNQ L;  3L0O A;  5C0X G;  4DR7 Q;  3GDE A;  2K5H A;  3GTJ H;  4LFB Q;  1X3G A;  3U4V A;  3G4S A;  4A3I H;  2UUB Q;  1UE5 A;  3U58 A;  1N32 L;  3L7Z C;  4DAY B;  2ALY B;  4DV0 Q;  3ZJY C;  2MFI A;  3OW2 A;  3PO2 H;  4JYA Q;  2UXC L;  1EIF A;  3A5Z B;  2EXD A;  1L1O B;  3ULP A;  5IYB G;  1HR0 L;  2KEN A;  1A8V A;  1NMG A;  1CKN B;  3J81 i;  3TS0 A;  4X64 L;  1OXV A;  3FKI G;  3M3Y H;  1HZA A;  1N9W A;  3F1Z A;  3M7N A;  4BBS H;  4LWC A;  2MQH A;  1X54 A;  4LUO A;  3UE0 A;  5IYD G;  5M3F H;  1XJV A;  2YU9 H;  3KJP A;  4MTN A;  1VQ4 A;  4LF7 Q;  4DV6 Q;  3CQZ H;  4LF8 L;  3S15 H;  5IWA Q;  4YHH Q;  1MIU A;  2I5M X;  1KIX A;  4OWX B;  2KHI A;  4TQU S;  2JEA I;  4X65 L;  3K81 C;  4L5T A;  1RIP A;  4HIO A;  3CCQ A;  5IWA L;  4O0A A;  1KQS A;  2YTV A;  1WJJ A;  1R9T H;  4NB3 A;  2B3G A;  1W2B A;  4Y7N H;  4GOP B;  4A93 G;  1E1T A;  1JE5 A;  1TWH H;  1K8A C;  2UXD Q;  1AE2 A;  1X55 A;  1PYB A;  3CCM A;  1EQR A;  3KF8 B;  4EQ5 A;  2K14 A;  4LF4 L;  5IP7 H;  3F2D A;  1DGS A;  1WCM G;  3I4M G;  2I5H A;  4DR6 Q;  1VQO A;  3HOX H;  2GVB A;  3W5O A;  4JI3 Q;  3PCO B;  4IJL A;  1WOC A;  1RL2 A;  2RCN A;  3ULL A;  3H15 A;  4DV7 Q;  1VQH A;  3W1B A;  3UDI A;  1HNX Q;  4JI4 Q;  5JJK A;  5IY0 A;  3MXN B;  3I4N G;  4A3F H;  2ZJQ A;  1EOV A;  2CWA A;  1PH6 A;  2OTL A;  2VUM G;  2R7F A;  2Y0S E;  5DLQ E;  4ME3 A;  3U50 C;  3PO2 G;  1HZC A;  1VQK A;  1PFS A;  2NN6 G;  4C2M H;  2UUB L;  2JA8 G;  1SE8 A;  1L2F A;  2Q2I A;  4HIM A;  1EWI A;  1X3F A;  2E8G A;  4JBM A;  3S1Q H;  3RN2 A;  3NEM A;  4NXN Q;  2HT1 A;  3GTL H;  3NEN A;  2AWN A;  2PI2 E;  1HR0 Q;  4GN5 A;  4DV5 Q;  1Q82 C;  4DV3 L;  4B3R L;  3RLO A;  1HNW Q;  2UXB L;  2KBN A;  1YZ6 A;  4OXP A;  1VQF A;  5M5X H;  4A3D H;  4JYA L;  3FP9 A;  3CCL A;  2H5X A;  1P16 A;  2BA1 A;  4A93 H;  1VQI A;  4YWM A;  3DLL A;  4BA1 I;  3ER0 A;  1ASZ A;  2VNU D;  3DM3 A;  4A3F G;  1VQG A;  3I7F A;  1PH9 A;  4A3G G;  3GTO H;  3GD7 A;  3HKZ G;  4DUZ Q;  4JI2 Q;  2K75 A;  1QVG A;  2CQO A;  3EIV A;  4FDB A;  4X62 L;  1Y14 B;  1I94 Q;  2Q2T A;  3HKZ E;  1Z9F A;  1U0L A;  4IPD A;  1HJP A;  4EX5 A;  1UE1 A;  1FJG Q;  1J6Q A;  5JJL A;  1C7Y A;  3GO5 A;  4BXX G;  1PH8 A;  3AFP A;  3OTO L;  3UDF A;  5HY6 A;  4GNX B;  1QVF A;  3KDF B;  4JI8 L;  3OYY A;  2JEB I;  1VQ9 A;  3S1M H;  3FHW A;  2UUA Q;  1JJC B;  1VQP A;  4PMW A;  4YY3 Q;  3MEF A;  4QGU A;  1CSQ A;  2NVY H;  4YCU A;  4DUY L;  1XPR A;  3EBE A;  1NMF A;  5JJI A;  2N3S A;  4LFA Q;  2LSS A;  4P72 A;  3UDG A;  3H3V H;  2K5V A;  4X6A H;  5GAG C;  2N8N A;  4DR2 Q;  3HKS A;  4B3S Q;  5GQO A;  1PYS B;  1AE3 A;  4HID A;  4LF9 Q;  5C4X H;  4DV7 L;  4DR3 L;  3STB C;  3F8T A;  1HNX L;  1YEZ A;  2I0Q A;  1UWV A;  1G29 1;  4JI4 L;  2VUM H;  4WJ4 A;  5K36 G;  5IT9 c;  2WAQ G;  4JI3 L;  3CCU A;  4DUZ L;  3M4P A;  1Q86 C;  4IOC A;  3HOU G;  2ASB A;  2ID0 A;  1N34 Q;  2JA8 H;  4A3B H;  1K83 H;  2BA0 A;  4LF8 Q;  4OON A;  1YHB A;  1NJI C;  4GKK Q;  5J3B A;  1N34 L;  1IBM Q;  4DR1 Q;  3HFZ B;  3G48 A;  1NBW A;  1IZ6 A;  1SR3 A;  4P73 A;  2A19 A;  1TXY A;  4DK6 C;  2KHJ A;  1PH7 A;  5C3E G;  3CAM A;  1YHQ A;  3I2Z A;  3E9I A;  2Y0S G;  3PIP A;  4A3E G;  4A3K G;  3KF6 A;  1E1O A;  1Q1E A;  1KC8 C;  4GKK L;  2JJQ A;  2FXQ A;  1PH4 A;  2RHQ B;  3BU2 A;  4C3J H;  4LFB L;  2C35 B;  4XIG S;  4WJ3 M;  3CW2 C;  1K9M C;  4DR4 Q;  1U5K A;  1BKB A;  2PI2 A;  4MNO A;  4GN3 B;  4HJA A;  5IP9 H;  2ZJP A;  2WAQ E;  1XPO A;  2E2J H;  1GKH A;  3I56 A;  3HOY G;  1I50 H;  2R7Z H;  3GTP H;  4LF4 Q;  4QL5 A;  5H1S E;  2JA7 G;  5JEA G;  1VQN A;  4R1J A;  4GS3 A;  2NVT H;  5BR8 L;  1LYL A;  4X64 Q;  4DV6 L;  2NVQ H;  3ICE A;  4AYB G;  1VQ6 A;  3PO3 H;  1VQA A;  2N49 A;  2ATW A;  5IYB H;  5EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...