4R4QA

Crystal structure of rpa70n in complex with 5-(3-((n-(4-(5-carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
121
structure length
121
Chain Sequence
HMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4qA00
1GM5A 4EQ5A 1KHIA 3OTOQ 1B8AA 1UE5A 1V1QA 3GD7A 5C0XG 1I3QH 3S1QH 3F1ZA 5LMUQ 4R4IA 2K75A 1LTLA 4NXML 4K0KL 2IHEA 4DV4L 5C4JH 4DUYQ 1GO3E 1VQ9A 4A3LH 1NMFA 4IPGA 3HOXH 1XMQQ 1Q46A 4QJFA 2HHHQ 4LF9Q 2JA8G 2DUDA 1K3RA 4AIMA 3E9IA 2JA9A 3LGJA 1EOVA 5ELNA 1QVGA 1VQEA 3UE0A 4NPSA 4JI8L 1EWIA 4ALPA 2VZAA 3GTKH 1PH9A 3G6EA 3ULPA 1IXRA 2AWNA 4JBJA 2E2IH 1VQ6A 1TWFH 4GLVB 2FXQA 4IFDG 3S16H 2K14A 2QA4A 1VQMA 1X56A 1OXSC 4DAMA 2A19A 2NVTH 1K73C 3CCLA 5M3FG 1VQ5A 1QZHA 3AEVA 1FJGQ 3UDFA 5M5YH 3W1BA 1WJJA 4JV5L 3BU2A 1KXLA 1VQ7A 2YV5A 4LFBQ 2CQOA 2PNHA 4DNIA 2WB1E 2CFMA 4GOPA 4AQYQ 2CKZB 4YY3Q 2R7ZH 1B70B 1Q7YC 4R4OA 1H95A 1AE2A 3PIPA 1PA6A 1HZ9A 4NXNQ 1CUKA 3EBEA 1N33L 1IYJB 1VQAA 2ZJPA 4DV1L 5FLMG 4A93H 4JI1Q 1WOCA 1IBMQ 4BBRH 3CPFA 3J7A5 4X6AH 3PO2H 4BY7H 1D7QA 4AYBE 1ASYA 5E7NA 3H3VI 1GD7A 5JJKA 4IJHA 5M3MH 3RNUA 1L1OA 1MJCA 3DLLA 2XGTA 2N78A 4LF4Q 1X6OA 3S14H 3GDEA 3F2DA 1N9WA 4A3EH 1E3PA 3TS2A 1E7ZA 5JEAG 4A3BG 3A5ZB 1CKNA 4TQUS 4AH6A 3J81j 1VQ8A 4BXXG 4B3RL 1VQGA 3AFQA 1OXTA 4HJ5A 4A3DG 3HOWG 2F4VL 1VS0A 2UUAQ 1O7IA 4YHHQ 3I55A 4LWCA 3CCMA 3RN5A 4GNXA 1C0AA 5BR8L 4RMFA 5ELOA 1G51A 3G4SA 2V1CC 3PV0A 1E24A 4A3MH 1XPUA 3UE1A 3AYHB 4LF6L 2K52A 1I94Q 4JYAQ 2UXBQ 4YCVA 5IP9G 5IWAL 1K8GA 1EQRA 1PH1A 3T1HQ 1X65A 4DR3L 2Y0SE 4L5QA 1PH8A 1Q12A 3U4VA 1XNRQ 2R7FA 1T9HA 4JI5Q 4J15A 4C3IH 4L5SA 2I5MX 1MKHA 1TWGH 2K5NA 4QY7A 4LF7L 3GTMH 5C0XJ 1WYDA 3PO3G 2R93G 4LFAQ 1PHJA 1OTCA 2ALYB 3DM3A 1YEZA 2ZM6Q 3CMEA 1NBWA 2UXDQ 5AJ3L 4DK6C 1IBKL 1EYGA 2AWOA 2ZJQA 1PVOA 3I4MG 4JI3Q 4RG1A 5C3EH 1PH5A 3M4PA 4IJLA 1QVFA 2Q2UA 5IYDH 1K8AC 1HJPA 4A3JG 4GKKQ 3AFPA 5LMNL 1N34Q 2OTLA 1LUZA 3HOZG 1EUJA 1E1TA 4DR4Q 2B63G 2ZTCA 5GADC 4DV0L 1S40A 2ID0A 1RL2A 4OX9Q 1M1KC 4LFCL 2NN6I 4QGUA 1XTDA 3OTOL 3B6YA 2K50A 1QZGA 3F8TA 5LMUL 2KHJA 1JJCB 2E8GA 4JBKA 1NTGA 3HFZB 1TWCH 3TREA 2IY5B 1VQKA 3U50C 1YJNA 2IX0A 2Q2IA 4DUYL 3HKSA 4JI0Q 4XIGS 4MZ9A 1YJ9A 4B3SQ 1XMQL 4EX5A 2HHHL 4LF9L 1C9OA 1VQ4A 1PFSA 1K0RA 3CCQA 3HOVG 4UP7A 3U58A 1SMXA 1FGUA 1GKHA 1HZAA 1HZCA 1CSPA 1WCMH 3CXCA 3J80c 1KD1C 1A8VA 2R92G 4X66Q 3HOUH 2HIVA 1Q81C 2E5LQ 2Z6KC 1P8LA 2NN6G 4IFDI 1V9PA 1PH3A 4A3KH 2JA5H 2HQLA 1XJVA 4OXPA 3S17H 1VQCA 2JK8A 2ES2A 4GNXB 3FP9A 5LMNW 2R7DA 4PMWA 1WFQA 4LFBL 3G48A 2MO1A 5JJLA 4R4TA 2LSSA 5IYBH 2YU9H 2PQAA 4YY3L 4OONA 3EN2A 4HJ9A 4UP9A 1J5EQ 3PO3H 1W3SA 2N3SA 3CQZH 3E0EA 4DUZL 2VUMG 4DK3C 4YCWA 4IPCA 1NJIC 4JI1L 4DR6Q 3UDXA 1TXYA 5C4XG 4ME3A 1Z9FA 4JG2A 2JA6H 1YVCA 4B3TL 1IBLQ 4LUOA 1KRTA 1R9TH 2IT1A 3HOZH 4BBSG 4LF4L 2AHOB 2AKWB 2B63H 4X65Q 1VQHA 1SROA 3HOYG 3EIVA 1YHAA 3KLWA 3PF4A 2NZHA 2WP8J 2JA7G 4NB3A 5DLQE 1Q1BA 3M4QA 4A3FG 1N8RC 4L5RC 5FJ8H 2UUAL 2MO0A 2B3GA 4YHHL 4DR7Q 4OO1I 2YYZA 3NELA 3ICEA 1X3EA 1FVIA 1VQIA 3WWVA 4IPHA 1HNWQ 3KDFB 1OXVA 3HOUG 3S1MH 4DPGA 2I5HA 2BA0A 3CCEA 1HR0L 1XNQL 2UXBL 5IP7G 4JI7L 4K0KQ 3T1HL 3CPWA 3J81c 1S3OA 3PCOB 4O0AA 1XNRL 4A3GH 4P74A 1LYLA 3J7ZC 4JI5L 4OWXB 1Q82C 3M4OH 3CCSA 1E1OA 4JI2Q 1JMCA 4LW1A 1M90C 2NVYH 4P72A 1HZBA 2OWOA 2YTXA 2Q2TA 4A4IA 3T1YQ 4LFAL 4OO1G 1AH9A 1QUQA 2ZTDA 2RHQB 2JEBI 1VQBA 2UXDL 3STBC 2E2HH 1VQFA 2JEAI 1YJWA 2JA8H 3KF6B 1X54A 4JI3L 3JAMi 1YIJA 2H5XA 4GN4B 3RLFA 4X64Q 3GO5A 1G291 2WFWA 3RZOH 4A3CG 4GKKL 2VUMH 1N34L 1XMOL 5FLXc 4DV7Q 5C4XH 4JCVE 2I0QA 4P75A 4X62Q 5C44G 1NMGA 4DR2L 4JI6L 1YHQA 3CC4A 4OX9L 4POFA 1LM0A 1UE6A 4DV6L 1N32Q 4HIOA 1Y14B 2UUBL 3MXNB 1E22A 1I5FA 1L2FA 2WAQG 4R4CA 3FKIG 5HGQA 5IE8A 4HJAA 4DR1L 4A3IG 1PYBA 4DR5Q 5M3FH 4BA1I 1YNXA 1CKMA 3H15A 1HR0W 3TRZA 3A0JA 5GROA 3CC7A 1PH6A 2E2JH 4JI0L 3STBD 4JI4Q 4LF8Q 3KF8B 2YTYA 4B3SL 4A75A 2KCMA 1PH2A 2RF4A 4A3FH 2R7ZG 2VQEL 1GVPA 3GTLH 3HKZG 2XTIA 4APVA 1HH2P 3CAMA 3TQYA 5FLMH 4BA2I 4FDBA 2OQKA 4KHZA 2IX1A 1U0LA 4X66L 1SLJA 3KOJA 2JQOA 2Q2HA 2E5LL 1A0IA 4A3LG 3I4OA 3HOXG 3TEHB 5M5WH 1QVCA 3K7AH 4UY8C 4GOPB 1VQLA 4IFDJ 4GN5A 2Z6KA 2UXCQ 3L0OA 4DV5Q 4HIMA 3PIOA 2N8NA 4YCUA 3G71A 1Q86C 1ASZA 4QQBX 4A3BH 3NBHB 4BXXH 4LUVA 4A3DH 1HNZQ 1J5EL 3HOWH 2Z0SA 3PGZA 4LF6Q 4BY1G 1SFOH 3RLOA 4KHPQ 1A63A 1NY4A 3S24A 4GLXA 1L1OB 4DR3Q 1OXXK 2N49A 2A8VA 3CD6A 4P71A 2B29A 4C3JH 4DV3Q 2GVBA 1JT8A 3VDYA 4L5TA 3H3VH 1I6HH 1CKNB 2UU9Q 1KRSA 3H0GG 1IBLL 4C3HH 1HNXQ 5IP9H 3BJUA 5IYCG 4DV2Q 3M85A 4YWKA 4IOAA 3CF5A 3L2PA 4A76A 1FJGL 1QUQB 4A93G 3CCVA 3K7UC 1RIPA 4JC0A 5GAGC 4BBRG 5JEAJ 3PO2G 2ATWA 4JOIA 4AQYL 1JB7A 2PI2E 4LNQA 4BY7G 1Z47A 3M3YH 5GAEC 2R93H 2KCTA 4NXNL 3UDIA 3U4ZA 5M3MG 5H1SE 5IY0A 3OW2A 3BZCA 2LXKA 3ULLA 2OTJA 4DV0Q 3CCJA 1IBML 1HNWL 2VQFQ 2UUCQ 3I4MH 4YWMA 3I56A 1YITA 4JBMA 1BBUA 3KYHC 4A3JH 3KJOA 3CW2C 3E9HA 3PF5A 4OWWB 3ULJA 2NVXH 4JOIC 1YI2A 1Q8KA 3PUZA 4C2MH 3J80i 1PV4A 4UPAA 1Y1WG 4JI2L 4LF5Q 4GS3A 4QIWE 4A3MG 1N36Q 4GKJQ 3GTOH 3S2HH 3T1YL 1TWHH 1D8LA 1A62A 1NE3A 5HY6A 4DKAC 2AMCB 2EIFA 2KHIA 4B3MQ 1XPRA 1X55A 1YHBA 3I2ZA 2JE6I 3ER0A 2MNAA 2PI2A 2K5HA 2YTVA 4MTNA 3CMAA 1BKBA 4Y52H 4X64L 3CP0A 3HOVH 2RHSB 2MQHA 2WB1G 4BY1H 3PUXA 3F2CA 4HJ7A 1SRUA 1I94L 1EFWA 4JYAL 1SN8A 2BH8A 3M9BA 3PUWA 4UP8A 3W5OA 4DV7L 1VQOA 4NXMQ 1PH7A 4X62L 3S15H 2R92H 1PYSB 3JAMc 4DV4Q 2K4KA 4DAYB 2L15A 1N32L 4P73A 1J6QA 1L0WA 3H0GH 3L7ZC 3PSIA 3OYYA 2PMZE 5C3EG 4AYBG 1U5KA 1KL9A 5IYCH 5IYDG 4DR5L 4DUZQ 2QEXA 2GVAA 3ERSX 3SGIA 1IL2A 5EAYA 3S1RH 2CCZA 5GAHC 2CWPA 2CWAA 2ZM6L 4JI8Q 4JI4L 4LF8L 3BZKA 3MEFA 4TVAB 1K83H 3S1NH 2HIXA 1IZ6A 2OQ0A 1CKOA 3I7FA 4LUZA 2VY3A 1AE3A 4B3TQ 2D0OA 5GQOA 3Q8DA 2D62A 2D0PA 1S72A 3GTGH 4GOPC 4IO9A 1VQJA 4DR4L 4JBWA 4YWLA 2EXDA 4O2DA 4JV5Q 4WJ4A 1FL0A 1KQSA 4PG3A 1B7YB 1P16A 3FHWA 2JJQA 2KBNA 2PQAB 3ZJYC 3K80C 4BBSH 1DGSA 2HT1A 2UXCL 3I4NG 1N33Q 2DGYA 4DV5L 4DV1Q 3HOYH 1WCMG 1UEBA 1Y1VG 4IOCA 3J81i 2Y0SG 1Y1WH 4KLKA 5M5XH 1L1OC 2WAQE 3NEMA 1YZ6A 2JA7H 3PUVA 1SR3A 3IRBA 3W1GA 2OCEA 2VS1A 1W2BA 1HNZL 1HR0Q 3RR5A 4HIDA 1WI5A 1XNQQ 4A3KG 2JA5G 3D31A 3PUYA 4JI7Q 4KHPL 1JJGA 5J3BA 1JJ2A 3TS0A 2C35B 4DV3L 2MFIA 1VQDA 3UDGA 3KFUA 3K8AA 4B3RQ 5IT9c 1YBYA 3A74A 4GNXC 3HKZE 1VQPA 5IYBG 2UU9L 5JJIA 1HNXL 3NENA 5IP7H 2LXJA 3JC66 2F4VQ 4R1JA 1KAWA 4DV2L 1JE5A 2BA1A 5BR8Q 1MIUA 1MJEA 1EIFA 3RZDH 1EIYB 1PH4A 3M7NA 2RCNA 1X9NA 4XTCS 2GN5A 3CCRA 2JA6G 1OXUA 1TWAH 2I5LX 5IWAQ 1XMOQ 1I50H 1C7YA 3KDFA 2VL6A 4GLAC 4MNOA 4DR2Q 4JI6Q 4DR6L 4QL5A 3AQQA 4DV6Q 2VQFL 4HIKA 2UUCL 2F3IA 4POGA 2VNUD 2ZJRA 3RLNA 1EQQA 2UUBQ 3CCUA 4WJ3M 4A3CH 4KI0A 5C0XI 3GTPH 2R6GA 4DR1Q 1K9MC 3CC2A 5FJ8G 4LF7Q 2K5VA 3GTJH 1SE8A 1UE7A 2F52A 5C44H 4X65L 2BH2A 1V43A 1CSQA 2QGQA 5AJ3Q 4H02A 1XPOA 2ASBA 3D0FA 4PZ8A 4LF5L 2NZOA 2ZTEA 3K0XA 4GN3B 1IBKQ 1KC8C 2VQEQ 1VQNA 2IHFA 3GTQH 3A5UA 1N36L 3FKIH 4A3IH 1G6PA 4PZ6A 4HJ8A 4GKJL 5K36G 4PZ7A 3I4NH 2KENA 3KJPA 4DR7L 4IPDA 4OWTB 1X3GA 2A1AA 4R4QA 5LMNQ 1BBWA 1KIXA 1UE1A 3S2DH 1VCIA 1UWVA 1Y1VH 1X3FA 2VW9A 3RN2A 4Y7NH 2EQSA 4B3ML 3F2BA 1BVSA 3KF6A 2NVQH 4A3GG 1Q1EA 4A3EG 3K81C 4LFCQ
chains in the Genus database with same CATH superfamily
1F9SA 1UE5A 3GD7A 3V96A 5C0XG 3S1QH 2R3ZA 1ENCA 3K5MA 3JAML 4K0KL 2LKVA 3E0JA 2IHEA 2Z8LA 4ZKBB 2WV6D 4EQNA 3SK5A 4RFBA 2F0HA 1RD9D 3K7AB 2JA8G 3D4WA 4LF9Q 1SNMA 4AIMA 2JA9A 3R93A 1EOVA 1QVGA 1BNZA 4OELB 3RZDB 4NPSA 1RTOA 4JI8L 2WKCA 3G6EA 1EU4A 4GLVB 3S16H 1OXSC 1I50B 1VQ5A 4RCNA 4DGZA 3N6RA 4DK1A 1VQ7A 2PNHA 1G91A 2SNMA 1IYUA 4YY3Q 1B70B 1Q7YC 4R4OA 1H95A 3PIPA 4NXNQ 3J81E 3DEOA 1IYJB 3NBHA 5FLMG 3U9SA 2L4NA 4X6AH 2LS01 1ASYA 3H3VI 5JJKA 3S2DB 1CHQD 2K1BA 2RVLA 2XGTA 4Y7NB 3GDEA 3BVZA 2M00A 4A3EH 1BCPB 4AH6A 1CKNA 3IL8A 2K28A 4O42A 1PLFA 3J81j 4OEMB 3HKZB 1I3QB 1OXTA 1O78A 4KKTA 4XQJA 4DAPA 1EYDA 4YHHQ 4LWCA 4H44C 5C4JB 1U4PA 1G51A 3A7AB 1X32A 4LF6L 5I2YA 1DYQA 4DR3L 2Y0SE 4L5QA 5EJWA 4C3IH 3OIQA 4L5SA 4BY1B 3FDTA 2NVTB 4LF7L 5C0XJ 1Q90A 2EY1A 3CMEA 4TSSA 5AJ3L 3K5LA 3KBGA 5DM73 2ZJQA 1PVOA 1FYCA 4IJLA 1PH5A 1QVFA 2Q2UA 2Z6BA 2PW5A 4NMZA 2KECA 4A93B 5CV8A 5KYLA 5LMNL 1N34Q 1ILPA 1EUJA 1E1TA 5CV6A 5KNCA 4DV0L 2B63G 1LTSD 4BY7B 4KJOA 4UHVA 5M3MB 3B6YA 1BCPF 1HA6A 2E8GA 1JOQA 2IY5B 1VQKA 2MUYA 1BQQT 3HKSA 2FINB 4XIGS 4LF9L 1C9OA 1VQ4A 4XQQA 2MP1A 5CV9A 2F0FA 1SMXA 2C9OA 3CXCA 1A8VA 3GQBA 1I4PA 2HIVA 1Y8PB 3J7AF 4Q0FA 3H91A 4A3KH 2JA5H 5JVG3 1XJVA 3KBXA 1VQCA 1CI3M 1WD0A 2ES2A 1S5DD 1HA5A 3NTKA 1WFQA 5JJLA 3I8ZA 2WB1B 2VB3X 4L63B 2YU9H 3MXGA 4YY3L 4OONA 1WVLA 3D4RA 3CQZH 2N3SA 2IWHA 2F0LA 3Q6SA 1NJIC 4TRDA 3UDXA 1D5MC 4QB4A 2KUMA 1DOMA 3MZ5A 4X3TA 3Q0AA 2OEOA 1YVCA 3RD4A 4X3UA 4LUOA 1KRTA 3R2TA 2AKWB 3EIVA 1YHAA 3EROA 3KLWA 5C5LA 3PF4A 4L8JA 2XRSD 4NB3A 2M9VA 2ZXPA 3M4QA 2HDLA 2NTTA 1B3AA 4JW0A 4EVOA 4YHHL 3NHHA 1QE6A 1LTGD 1F2LA 2A69C 1X3EA 1FVIA 1BXTA 1PDQA 4IPHA 3SK4A 5G3LD 4DPGA 3OHXC 5FLXL 5LL6S 3CCEA 1JC7A 1SJED 4JI7L 1WCMB 2EY5A 3J81c 2NVQB 2XIWA 1U4MA 4P74A 4LJZC 2IW3A 5ELFA 5D3IB 3CCSA 2DY8A 2A74C 1M90C 3NUCA 1STNA 3S17B 4RWSC 2YTXA 2Q2TA 3T1YQ 4OO1G 1AH9A 2BDNA 4KN7C 1Z6HA 4RKBA 1VQBA 3STBC 3CHBD 3IAYA 3PIO3 2EOTA 1VQFA 3OPOA 4OIJA 4B08A 5IGBA 2EXZA 3PO3B 3RLFA 2HUGA 4CJ1B 2VUMH 1N34L 1PTOB 4DR2L 3TN2A 4POFA 1O7ZA 1EY6A 4HIOA 1V1PA 2UUBL 2EJFC 1TKWB 4HJAA 4DR1L 2KA7A 4RH6A 2E2JH 1OO9B 3STBD 4JI4Q 2YTYA 2KCMA 4RCOA 4A3FH 2R7ZG 2FMCA 3QWNA 4L6TB 3GTLH 1EY9A 4BA2I 4I65A 1KDBA 5A2QL 2IX1A 1AZPA 2AQ3B 3AB9A 1I4HA 5L37A 1WTVA 3KLSA 3HOXG 3SR1A 3TEHB 1MI2A 3K7AH 1AZQA 5BN5A 1FNUA 4S3SA 4GN5A 1X3PA 3L0OA 4XT1B 4ODGA 4HIMA 1ASZA 2N8NA 5ELBA 4A3BH 3NBHB 4EQPA 4FXGC 4ZK9B 2Z0SA 1YNJC 4FO2A 1SFOH 2F3WA 2N49A 3CD6A 3CRKC 2JA8B 2E75C 1NNXA 5D65A 1D6EC 5KIXA 1PTOF 1FNVA 1CKNB 1H9RA 1I4RA 1HCZA 4C3HH 1HNXQ 5IP9H 5JPNC 3BG3A 3L2PA 4DFAA 1QUQB 3K7UC 3IFTA 1BOSA 1RIPA 4UAIA 5GAGC 4DK0A 4BBRG 5K5PA 4AQYL 1JB7A 4O1NA 3M3YH 1YNJD 2CHBD 3N52A 5C3WA 2HCIA 1K3BC 4K5VA 3I56A 4JBMA 3E3XA 1BCPC 2CVRA 4A3JH 1XWEA 4KD3A 5AFWA 4OWWB 2K5WA 1EY0A 2H4OA 4IZ8A 4RKLA 1SMYC 1FD7D 5FO9B 2F0MA 3GTOH 3S2HH 3T1YL 1NE3A 4DKAC 2AMCB 2QW7A 1X55A 4KMUC 5EPLA 2YTVA 3PMFA 3MTSA 3CMAA 2N88A 3LWEA 3OSOA 3HOVH 2MQHA 4BY1H 1IYVA 4UP8A 4NXMQ 3S15H 2ZT9C 4WRDA 4DV4Q 1LTID 1WTXA 1EOTA 4RGMA 1JQYD 5IGEA 5C3EG 4JPBW 3H09A 1SSOA 4U68A 2QEXA 4DUZQ 5LL6X 2D5DA 4CKEA 1W6JA 3WOEA 2ZM6L 4JI4L 3MEFA 3I72A 5BN4A 3I7FA 2VY3A 3VYRA 1KLUD 1HTPA 5GQOA 3Q8DA 2D62A 1S72A 3GTGH 3VR4A 1LTBD 1VQJA 2HCCA 5IGCA 3HZXA 1MSGA 1S5CD 3AMUA 2F0WA 1KQSA 1LABA 2NVXB 1N33Q 3D3RA 3HOYH 1Y1VG 2B2UC 2DJFC 4IOCA 2Y0SG 1LV9A 4KLKA 5M5XH 1L1OC 2WAQE 2JA7H 1YZ6A 4KJNA 3HOUG 3IRBA 3W1GA 2VS1A 3MA2B 3RR5A 4HIDA 1TS2A 2J7ZA 1A15A 4PV1C 5J3BA 1JJ2A 4CDEC 1CFMA 2WKDA 1PXUA 3A74A 5IYBG 5JJIA 1HNXL 5IP7H 3IKJA 2LXJA 3SHLA 4R1JA 1STEA 3P75A 4FF1A 1JORA 3H0GB 4OIKA 2B2WC 2NVYB 2GN5A 3S1RB 4KY5A 1RDPD 1SBBB 5IWAQ 4HMIA 3KDFA 4JI6Q 4DR6L 4DV6Q 1JB3A 4POGA 2VNUD 2ZJRA 3RLNA 2PCFB 1K9MC 1SXTA 4K2KA 3VR5A 3ONAB 3GTJH 1SE8A 1UE7A 1UAPA 5C44H 1HRJA 3I90A 4KY7A 3X3MA 2ASBA 3GTQH 1KC8C 3FKIH 1PRTD 4A3IH 5K36G 4F8MA 4HJ8A 3I4NH 2KENA 3P20A 1S5ED 1F77A 1UE1A 4K8JA 2AQ1B 5COYA 3KF6A 2NVQH 3VYTA 1Q1EA 2KJXA 5IGDA 1GM5A 1YNND 4EQ5A 3OTOQ 1B8AA 1SE4A 1G2SA 1V1PB 5LMUQ 1JWMD 2MGSA 1LTLA 3T4AC 4NXML 3HRZC 2EYLA 4DV4L 1GO3E 2F1MA 1VQ9A 4A3LH 4IPGA 1ICFB 3BVGA 1B44D 2H1EA 3LGJA 3UE0A 1JWSD 1EWIA 1W6KA 1PZJD 1F9PA 2AWNA 4JBJA 4K2LA 1VQ6A 1TWFH 1PTOC 4N9TA 2FXQA 4B9XA 5IODA 2F0DA 4IFDG 4IN3A 2EDGA 3AEVA 1FJGQ 4J8QA 5M5YH 1WJJA 4FXDA 3I3CA 1K0SA 2YV5A 2CQOA 1AE2A 1HZ9A 1N33L 3DWQA 1IBMQ 3CPFA 3PO2H 4AYBE 5E7NA 1GD7A 2B2UA 4IJHA 4HCSA 1L1OA 5EBCA 1F2YA 4C1NI 3RNUA 3BYYB 2A6HD 5IT9L 3S14H 1IW7C 3F2DA 1DM0B 5EPJA 1E7ZA 5JEAG 2R7ZB 1E2ZA 3A5ZB 3FMCA 4TQUS 3O13A 1VQGA 5C0XH 4HJ5A 1VS0A 3CCMA 5IOCA 3C3LA 4DNRB 1M4VA 4KN4C 4ILWA 5ELOA 3R2IA 4C3JG 3G4SA 3HOXB 4NW2A 2V1CC 4A3MH 3MC0B 3DXJC 3UE1A 2UXBQ 2K52A 1I94Q 2F0TA 5IWAL 1K8GA 3GTKB 1E0BA 3K5OA 3E5SA 1PH8A 3U4VA 1IW7D 2F3VA 1XNRQ 2E2IB 2EZVA 3SE0A 1MKHA 5JOBA 4F88A 3GTMH 2QDLA 3PO3G 1F9RA 4LFAQ 1PHJA 4K8IA 3DM3A 2UXDQ 4MTKA 3SXHA 1EYGA 3I4MG 4WJWA 2O5JC 5IYDH 1HJPA 2RA4A 1LUZA 4DR4Q 4BBRB 4QGUA 3OTOL 1SYDA 2RCFA 1QZGA 3F8TA 5LMUL 1D2BA 1NTGA 3HFZB 1H9MA 1YJ9A 2F0OA 1NCVA 3FPPA 4B3SQ 5T1GA 2MHVA 1SNOA 1JOOA 3U58A 2QDBA 3HS0C 3OWEB 1HZCA 2CW0D 1STHA 4XXEA 2PW7A 4U673 1R4PB 1P8LA 1Q3LA 4Z9CB 4X3SA 2E5LQ 4IFDI 5LHY1 2D2CC 3TP5A 5JVH3 2R7DA 2ICIA 1LT3D 4PMCA 3M7GA 3EN2A 4MHEA 2PMZB 1J5EQ 5JPMC 2OT2A 1EY5A 4HSPA 4YCWA 4IPCA 2F0IA 2Q8TA 5C4XG 2RBMA 2EYMA 5C3EB 4JG2A 2JA6H 4B3TL 3J81L 3NTHA 2IT1A 4BBSG 3DM1A 2B63H 4X65Q 1SROA 1SYGA 1WTWA 2A73B 2B2VC 2Z4HA 4DN4M 1EU3A 1N8RC 4L5RC 5FJ8H 4DR7Q 1TWCB 1HFNA 5HGTA 1NSNS 1QWYA 3KDFB 4PMBA 1OXVA 3S1MH 2I5HA 4OHJA 1HR0L 4QCLA 4PQXA 2UXBL 1Y1VB 3MXUA 3CPWA 1NUCA 2Y0SB 1EYAA 3HOUB 4A3GH 3PCOB 4O0AA 1XNRL 3BVMA 3J7ZC 1Q82C 1MBYA 3M4OH 5M9OA 4JI2Q 2GA4B 1JMCA 4CDCC 2NBFA 2NVYH 1HZBA 2OWOA 4LFAL 1QUQA 4XDXA 1C4QA 2K05A 2UXDL 1ILQA 4IUQA 3VYSA 1YJWA 4KKSA 2D9UA 3KF6B 2F4IA 1X54A 5C3XA 2RDHA 2H5XA 4X64Q 4A3CG 1G291 3GP7A 2IL8A 3TSSA 3KUPA 4FF2A 1NMGA 1DD2A 1YHQA 3CC4A 2SDFA 3EJIA 3MXNB 3NWSA 1E22A 1D1IA 2E74C 2WAQG 1R9TB 5CC4A 1PYBA 4DR5Q 5M3FH 4BA1I 1Y8NB 1YNXA 1CKMA 3TRZA 2ENBA 2XVSA 2OXPA 3CC7A 1HFGA 3PQIA 1PH6A 1Y69U 4CJ2C 4B3SL 2DNCA 1PH2A 1CZWA 2VQEL 1IHZA 5A35A 1GVPA 1SYFA 4G7OC 1BR9A 1CK1A 3NQTA 4KHZA 4F7XA 4ZUJA 1SLJA 2JQOA 2Q2HA 2E5LL 3I4OA 4UY8C 1QVCA 4CJ0B 3I73A 1XXGA 4DV5Q 3PIOA 2XN9C 4YCUA 2I46A 4BXXH 4RAUC 3QJYA 4LUVA 2K01A 1LO5D 4K6LA 5EKIA 2BCOA 4A3DH 1J5EL 3HOWH 3PGZA 2EYJA 4WFN3 1PFMA 2K5QA 1EEID 5I2XA 3GV3A 2E2HB 1L1OB 1OXXK 2A8VA 4P71A 1JT8A 2Q8RE 3VDYA 2VB2X 3RZOB 3MHBA 1PMRA 3H0GG 2JP1A 2WIIB 5IYCG 4DV2Q 4YWKA 5F2DA 5C4ZA 2RSNA 4K14A 1SNPA 3ND9A 2ATWA 4JOIA 4LNQA 1TWGB 2CH4A 2R93H 4G7HC 2KCTA 4NXNL 1J9OA 2B2VA 5H1SE 4CKBA 2LXKA 2OTJA 3QOJA 1Y8OB 1PRTB 1PFNA 1JCKB 2VQFQ 4YWMA 1YITA 1BBUA 3E9HA 3PF5A 1DONA 1BBXC 2K33A 1YI2A 1CA6A 1Q8KA 3PUZA 3J80i 5M5WB 4UPAA 1Y1WG 1PV4A 1LLRD 4JI2L 2Z1CA 4LF5Q 3VA7A 1N36Q 5HY6A 1FR3A 1YHBA 3NBIA 3Q24A 2JE6I 2PI2A 4MTNA 4C3IG 4Y52H 4X64L 3A55A 3S9WA 5KGUA 1T5XD 3F2CA 3R3OA 3ZYYX 1EFWA 3M9BA 3PUWA 3NP8A 1PH7A 2G9DA 4C3JB 2R92H 5CV7A 3AU7A 3JAMc 1WTQA 1I6HB 2NN6H 4DAVA 1A6XA 1T5EA 2B39A 1F2MA 4AYBG 1IL2A 4DR5L 3SGIA 3TMEA 2CCZA 1H9JA 2CWPA 1HPCA 3BZKA 1MD2D 4TVAB 3S1NH 1TY0A 2OQ0A 1CKOA 1AE3A 1PRTF 4KV6A 5D14A 3EQLC 2SEBD 2PYKA 4GOPC 3VR6A 2EXDA 2E76C 2KQ3A 3I4MB 4JV5Q 3TP8A 1GUTA 1D5ZC 3ITPA 2P5ZX 1ESFA 3FHWA 2JJQA 2FJ2A 2KBNA 2HT1A 3K5NA 1K8OA 2DGYA 4DV5L 4DV1Q 2B2YC 4C2MB 3SDZA 2OCEA 1XNQQ 3CU7A 4A3KG 2JA5G 3D31A 3PUYA 3NK9A 2A68D 3RUZA 3TS0A 3K8AA 1D1KA 4B3RQ 1YBYA 1EZ6A 1VQPA 1CZGA 2A5HA 3NENA 1KAWA 1TS4A 4DV2L 5BR8Q 1MIUA 1MJEA 1EIFA 1XYIA 2JYOA 1A2UA 3RZDH 4QUFA 1EIYB 4XTCS 1I6VC 1DOLA 1XMOQ 1I50H 1C7YA 1F9QA 1K83B 2VL6A 4MNOA 4QL5A 2VQFL 4HIKA 1D5XC 2R6GA 1TY2A 1SNQA 4OGQC 1ONLA 3J80E 2K5VA 5C4XB 2XSCA 2EYFA 3D4DA 4WORA 3P1HA 1V43A 2QGQA 1XPOA 4LF5L 2NZOA 1IBKQ 4GN3B 3V05A 2IHFA 1G6PA 3A5UA 1N36L 4FP5D 4BBSB 4PZ6A 4R4QA 3S2DH 1BBWA 5I6WA 1ZXTA 1VCIA 1UWVA 1Y1VH 1X3FA 4Y7NH 3F2BA 1O80A 2IPKD 4LFCQ 2RDFA 3L3OC 5CGKA 1EY7A 3SVMA 4ME5A 1I3QH 3F1ZA 5KRUA 2NWGA 5BN3A 4M1UB 5C4JH 1WTHA 5EBDA 3KK7A 5KYIA 3C2PA 4IUUA 1EY8A 2C5CA 1XMQQ 1Q46A 2HHHQ 1K3RA 5ELNA 1M8AA 3RMHA 2R61A 4IUNA 3MXPA 2EVBA 1IXRA 1L0YB 4IUPA 1E2WA 1TWAB 2K14A 1ET6A 1VQMA 2A19A 2NVTH 3CCLA 5DM63 1QZHA 2B8FA 3UDFA 2ZXRA 3W1BA 4JV5L 5JAVA 1TS5A 3NSWA 4GOPA 3GTPB 1PA6A 4DV1L 4LMQD 4A93H 4JI1Q 1WOCA 1STGA 4H7BA 5ELDA 1HTLD 2BE5D 3J7A5 2WAQB 4BY7H 2B2YA 3A7LA 3J7AV 2NB0A 5M3MH 4ZRZA 1XTCD 1EQVA 3DLLA 2N78A 4KTAA 3TS2A 1E3PA 1JE4A 1PZID 4A3BG 4B3RL 1CHPD 3D8GA 2DJGC 1QNKA 5E3FA 3AFQA 3S1QB 1VF7A 2UUAQ 1C0AA 5BR8L 2K32A 4RMFA 3L9AX 2RDGA 2F0VA 3EFXD 1VDZA 1E24A 1EWHA 3PV0A 1GUWA 4C3HG 1TWHB 4JYAQ 4YCVA 5IP9G 4DU9A 1EQRA 1PH1A 1Q12A 3S16B 4J15A 4V0BA 2F0KA 2I5MX 1HUMA 1ICWA 1TWGH 2K5NA 4QY7A 1B2TA 2BDOA 1YEZA 1NBWA 3VR3A 1IBKL 1WTPA 2JSOA 4RG1A 1DOKA 1DXMA 1PRTC 2L11A 3M4PA 4GZYC 2K03A 4A3JG 3NE5B 1B3QA 1NR2A 2AUJD 3HOZG 2SOBA 2ZTCA 3A8KE 1S40A 2ID0A 1RL2A 4KHVA 4OX9Q 4LFCL 2DN8A 2NN6I 1YNNC 1XTDA 1G8ZD 2K50A 3VR2A 2KHJA 4A3EB 3U50C 3K59A 2IX0A 1KTKA 1XMQL 5KNBA 2HHHL 1K0RA 3HOVG 3NPPA 4UP7A 1XX8A 1SYBA 3R8BA 1KNEA 1FGUA 1HZAA 1CSPA 1WCMH 3QO2A 1Y1WB 3WOFA 3J80c 4V190 3UI2A 1KD1C 2AQ2B 2HDMA 1Q81C 2Z6KC 1V9PA 1PH3A 3H3VC 1SNCA 1B9MA 5D3DA 4FNFA 1B9NA 4OXPA 3TP6A 3S17H 3HP3A 2JK8A 4ZUIA 4GNXB 3FP9A 5LMNW 4C56C 4C3IB 3K6OA 2PZUA 1GUNA 1LTTD 3MXNA 2LSSA 4XYOA 4RGNA 2PQAA 4EGVA 2OF1A 4HN7A 3PO3H 1W3SA 4DUZL 1KLGD 4DK3C 2VXWA 4JI1L 1TT2A 1TXYA 4ME3A 1PTOH 4AYBB 5EQ0A 1HHVA 2PNRC 3T51B 1IBLQ 5CYUA 4HAEA 2J0TD 2A6HC 2AHOB 1SE2A 2FHTA 4IUVA 3HOYG 1Z7TA 2PPBC 2JA7G 1Q1BA 2UUAL 2MO0A 2MPMA 5E4WC 2M2LA 1GXDC 1CQFA 3ICEA 3DEPA 1VQIA 3WWVA 1HNWQ 1EIGA 3Q22A 1SYEA 2BA0A 5J1ZA 1I4GA 5IP7G 4K0KQ 4NP5A 1E2VA 3MVVA 1LYLA 2XRQD 4OWXB 4A3KB 2JA5B 2LY7A 3A8IE 2A6EC 4P72A 3FVQA 1BUVT 4ZAIA 3MFGA 4IALA 1GUGA 2YU9B 2JEAI 2JA8H 1F2ZA 2XWJB 3JAMi 1YIJA 5TSSA 4GN4B 3CQZB 3GO5A 2WFWA 4H0LC 2IX3A 3C1EA 5C4XH 4P75A 5C44G 4JI6L 3K0YA 1QNUA 4OX9L 1EY4A 4DV6L 1LM0A 1UE6A 4TKOB 2BOSA 1Y14B 1I5FA 4BWGB 4R4CA 3FKIG 5IE8A 4A3IG 2A6ED 3OW7A 3H15A 2FFKB 3A0JA 3E6ZX 5IT9E 2HQEA 5ELEA 4DA2A 4A75A 1ENAA 4OL7A 2TMPA 2XTIA 4APVA 3CAMA 5FLMH 1LACA 2CW0C 1U0LA 1RHPA 1EYCA 4A3LG 1TR5A 3HGBA 4GOPB 4R8NA 4IFDJ 1RKNA 2ZXOA 2Z6KA 4FF4A 2L5TA 1RF2D 4FVMA 2B8GA 5DEHA 1LT6D 3EA6A 4PNYA 4J1MA 1JOKA 3FEWX 2AUKA 4LF6Q 4RHRA 3RLOA 4KHPQ 3S24A 4GLXA 4DR3Q 2NYZD 4L5TA 4DXFA 3OIPA 2VUMB 1IBLL 1U9RA 3BJUA 4B9WA 1QILA 4IOAA 3CF5A 1I4QA 1FJGL 1QB5D 3WDNA 3CCVA 3BDLA 1TS3A 5JEAJ 3PO2G 4QF4A 2O5IC 1JWUD 3U4ZA 4ZLTF 3BDCA 2F0GA 5IY0A 3OW2A 2E2JB 1U4RA 3BZCA 4K6DA 4DV0Q 1IBML 3LNNA 1HNWL 2K04A 2UUCQ 4HEDA 3D6CA 4NDXA 3GTLB 3H94A 3KJOA 1S5FD 1GJXA 1HQRD 2NVXH 2PZTA 4JOIC 3OMGA 1PYWD 3X3NA 4QIWE 4A3MG 1ESRA 2EJGC 5FOBB 1TWHH 1A62A 5FK9C 3JAME 4A3BB 1DCZA 1RODA 2KHIA 1XPRA 3I2ZA 3TDQA 2MNAA 1V8QA 1BKBA 3CP0A 2EYPA 3DHQA 2RHSB 1SFOB 3PUXA 4HJ7A 1I94L 1SRUA 1SN8A 2BH8A 3OWFA 1KABA 3KLRA 1B53A 1QCBD 3BZDB 4P73A 1J6QA 3H0GH 3T56B 3L7ZC 3W2DA 4C3HB 3PSIA 5HURA 1DZ1A 2PMZE 1PZKD 1U5KA 1KL9A 5IYCH 5IYDG 3ERSX 3S1RH 1PFBA 1STAA 4RGOS 1ZKOA 5GAHC 1WTRA 2CWAA 2F0NA 3A54A 3LWUA 1TU2B 2LFNA 1IZ6A 3K57A 2Z9HA 3M3YB 1EWCA 4ZKCB 1R4QB 3QB3A 5E4XA 3P7JA 2D0PA 2V4DA 1RCVD 4DR4L 4KY6A 4YWLA 2RKSA 4O2DA 4WJ4A 3CKIB 1CQVA 4PG3A 4A3JB 4KKUA 5C4HA 2KOLA 3HOZB 2L12A 2PQAB 1TQOA 4LAAA 3LX0A 5CR3A 3SK8A 3VYUA 1Y1WH 3NEMA 3GV6A 3PUVA 1HXYD 1KDAA 3GTOB 1VMCA 3S2HB 1WI5A 5EKLA 3MFYA 4JI7Q 4KHPL 3TBIB 1GHJA 4J6HA 1O7LA 1VQDA 3KFUA 4CHTB 5IT9c 3HOVB 3K58A 4GNXC 3HKZE 3JC66 2F0PA 2F4VQ 4HSVA 2EY2A 5EPKA 1JE5A 2CQAA 2BA1A 3S15B 1LT5D 1BF4A 1DJRD 1A3TA 3A56A 3M7NA 5C5MA 1RJTA 3CCRA 2JA6G 4OO1H 1OXUA 2I5LX 5C6AA 4DR2Q 3AQQA 1QOHA 2UUCL 1EQQA 2UUBQ 5C0XI 3GTGB 4DR1Q 5FJ8G 1A3UA 2CH4W 2F52A 4X65L 1CSQA 4DF7A 4RGTA 4PZ8A 4BS9A 2ZTEA 3K0XA 4CDDC 4DR7L 3PIP3 3KJPA 3HOYB 2A1AA 1KIXA 1NAPA 2VW9A 2JA7B 5M5XB 4A3GG 1BVSA 4A3EG 2EJMA 3K81C 3KLSX 1X3QA 2R7ZH 1KHIA 1V1QA 1Q8IA 2QEJC 2IJ0A 2K75A 1LT4D 4IURA 1SAPA 4R4IA 2N55A 2NTSA 3MWYW 2L9HA 2PQEA 4DUYQ 3URYA 1NMFA 3HOXH 4QJFA 2DUDA 2KHSA 3E9IA 1STYA 1VQEA 3KF8A 4ALPA 3GTKH 2VZAA 1PH9A 4C1NK 3ULPA 2E2IH 5J39A 4N9PA 4I7AA 2QA4A 1X56A 4DAMA 3T53B 5EGTA 1K73C 5M3FG 4MIUA 3BU2A 4ZQ3A 1KXLA 3ERQA 4RHSA 4LFBQ 1AN8A 4DNIA 4DNTB 2WB1E 2CFMA 4AQYQ 2CKZB 1EFID 1MSHA 3GTJB 1CUKA 3EBEA 5C44B 2ZJPA 1VQAA 1RTNA 5FO7B 1FNWA 5DNFA 3GTQB 1L0XB 5J22A 4BBRH 4ULLA 3FKIB 4A3IB 1D7QA 1WTOA 3I4NB 5CORA 4M8AA 1MJCA 2A68C 4LF4Q 1X6OA 2KEDA 1N9WA 2L1BA 4BXXG 1VQ8A 1AP0A 3MAQA 1TIID 4A3DG 5FLXE 3HOWG 1SE3A 3BS1A 2F4VL 1O7IA 3I55A 3HG9A 3RN5A 4GNXA 2E2DC 2A69D 1I4XA 2HD3A 2EE1A 3DMUA 1IKLA 4H13C 1XPUA 2ICEC 3AYHB 1FGBD 3T1HQ 1X65A 2WINB 5KNDA 1SYCA 1TWFB 2R7FA 1T9HA 4JI5Q 2Q8IB 2QILA 3G7LA 1O7YA 4HMJA 2R93G 5FKAC 1WYDA 2PO4A 5M5YB 1OTCA 2ALYB 2ZM6Q 4DK6C 2L0CA 5ELCA 1SEBD 2AWOA 4K5WA 4JI3Q 5C3EH 4JVZA 1K8AC 3J80L 4GKKQ 3NTIA 3AFPA 3A8JE 2OTLA 1S4ZA 2SNSA 1HQMC 3FPUB 5GADC 3PO2B 1CT1D 3NQIA 1M1KC 1SNDA 4P2CB 4XYQA 1JJCB 4JBKA 3S14B 1TWCH 1B1ZA 4CGYB 3TREA 4DAYA 1YJNA 4JI0Q 2Q2IA 5A2QE 4DUYL 1II3A 5I9OA 4MZ9A 4EX5A 3DWPA 5IIFA 1PFSA 2EPBA 3CCQA 5CV4A 1GKHA 2R92G 4X66Q 3HOUH 4IUTA 4A3MB 2I07B 5DAUA 1ZEQX 2NN6G 5CBAE 2HQLA 3IFDA 4X3KA 3I4LA 4PMWA 4ZCKA 4LFBL 3G48A 2MO1A 4R4TA 5IYBH 3GTMB 4HJ9A 4UP9A 1EIHA 3E0EA 2VUMG 2KCNA 4DR6Q 1CA5A 4N8X1 1VMPA 2BE5C 1Z9FA 1UNSA 1GUOA 1R9TH 1J8IA 3HOZH 4LF4L 1VQHA 1IKMA 1NR4A 5E1FA 4QUCA 1EZ8A 2NZHA 2WP8J 1GOZA 5DLQE 4A3FG 4FF3A 2B3GA 4OO1I 2X6GA 1H9SA 2YYZA 3NELA 1H9KA 5K36H 1XNQL 5IGGA 1BCPD 3H6MA 3T1HL 2F0EA 4HCEA 2X6LA 1K28A 1S3OA 4JI5L 1E1OA 1SMYD 1ZYRC 5JJZA 3G6JB 4LW1A 3SEBA 4A4IA 2ZTDA 2RHQB 2JEBI 1UUPA 2E2HH 3I91A 4YIJA 4JI3L 1KDCA 3C46A 3RZOH 4GKKL 1XMOL 1LTRD 5FLXc 4DV7Q 4JCVE 4F87A 2I0QA 4X62Q 3HEJA 4ID6A 1N32Q 2JA6B 4IFDH 2EY6A 1L2FA 1ZYRD 5HGQA 2B63B 2G5DA 3DWAA 1HR0W 4G57A 1AFPA 3EVQA 5GROA 4JI0L 3MEHA 4LF8Q 3KF8B 2RF4A 3F2UA 1SDFA 2QF7A 1AEXA 5I6YA 4ZYSA 3HKZG 3U9OA 1HH2P 1ML0D 3TQYA 5I4DA 4FDBA 2K7VA 2OQKA 2F0SA 4X66L 2DNEA 3S1MB 3KOJA 2JN4A 2G9HD 1A0IA 5M5WH 2F0JA 1VQLA 3W3AA 2UXCQ 4A3GB 2B2TC 1WD1A 4QQBX 1Q86C 2O4XA 3G71A 5JEAH 3OMCA 3M4OB 2LMCB 2MJ8A 3BYTB 2DY7A 3M4YA 1HNZQ 1MHWC 4BY1G 5CBEE 1A63A 1NY4A 1LTAD 1V1OA 1BDOA 3T13A 2B29A 4C3JH 4DV3Q 2GVBA 2X69A 4JK1C 5CV5A 2WACA 3H3VH 1I6HH 1ENFA 2NZ1D 2UU9Q 1KRSA 3M85A 3QIAA 4A76A 5IGFA 4MN3A 4A93G 3FRPB 4NKLA 1G6ZA 4FXKC 4JC0A 4BY7G 2PI2E 1Z47A 5M3FB 5GAEC 2EYHA 1MGSA 2L55A 3NWTA 3UDIA 5M3MG 1S5BD 1B4OA 1C48A 3ULLA 2PZWA 4CBVA 3CCJA 2F03A 2NUCA 3I4MH 3QR8A 4XQNA 4K5XA 1BO0A 3KYHC 3CW2C 3ULJA 2J4XA 4RA8A 3BDOA 3T16A 4C2MH 1CTMA 4GS3A 1C8CA 4CKCA 4UDUC 4GKJQ 2TSSA 1D8LA 2KEEA 1B50A 4Q5VA 2EIFA 5KEEA 4B3MQ 3ND8A 4FYDA 3ER0A 4A3DB 2K5HA 3HOWB 1AW7A 2WB1G 4JYAL 4KD4A 3W5OA 4QMGA 1EQTA 4DV7L 3TZDA 1VQOA 5I9PA 3Q23A 1A2TA 4X62L 1PYSB 3DUZA 2K4KA 4DAYB 2L15A 1N32L 1L0WA 5CMDA 5ISRA 3OYYA 2RSOA 2GVAA 5EAYA 4G4KA 3D6WA 4JI8Q 4LF8L 1K83H 1JR0D 2HIXA 2XWBB 2K5DA 4LUZA 2R93B 1PTOD 1STBA 2F0QA 4B3TQ 2D0OA 3SK6A 3QG1A 2FMMA 2O2LD 4IO9A 4JBWA 1FL0A 3OOCA 1B7YB 1P16A 1ET9A 4I7ZC 3ZJYC 3K80C 4BBSH 1DGSA 2UXCL 3I4NG 4R9WA 1A3VA 1WCMG 1UEBA 3J81i 2B2TA 1SR3A 4HTHA 1HNZL 1VF5C 1W2BA 1HR0Q 4R8IA 5T1IA 1K8MA 2XNAC 1HUNA 1U4LA 2B2WA 1JJGA 3TZUA 1EEFD 2RQXA 2C35B 4DV3L 2MFIA 2QKIC 3UDGA 4CDFC 3NXWA 4IQZA 4KK7A 1TVXA 2UU9L 2KCCA 4G7ZC 4ABNA 3C1FA 3VA5A 2R92B 1KNAA 1QJOA 1H9SB 5NUCA 1CM9A 1PH4A 1UEAB 2RCNA 1X9NA 4EQOA 2JXMB 1TWAH 3J7YW 2KVMA 4N8FA 1GHKA 2F0UA 4GLAC 4HR7B 3S1NB 1SJHD 4E6IA 2QCPX 1KAAA 2F3IA 5G3LF 1JICA 5FO8B 3CCUA 4WJ3M 4A3CH 4KI0A 3GTPH 3I70A 3CC2A 3CRLC 4DXGA 4LF7Q 2BH2A 1G2TA 4LK1C 5EKKA 5AJ3Q 4H02A 3QOLA 3D0FA 1GUSA 4XT3B 3V2TA 2VQEQ 1VQNA 4QIWB 1EL0A 1QG7A 4GKJL 4PZ7A 3TP7A 4IPDA 4OWTB 1X3GA 2Z4IA 5LMNQ 2EYOA 3RN2A 4B3ML 2EQSA 1IL8A 4A3FB 2K6AA
chains in the Genus database with same CATH topology
1GM5A 4EQ5A 1KHIA 3OTOQ 1B8AA 1UE5A 1V1QA 3GD7A 5C0XG 1I3QH 3S1QH 3F1ZA 5LMUQ 4R4IA 2K75A 1LTLA 4NXML 4K0KL 2IHEA 4DV4L 5C4JH 4DUYQ 1GO3E 1VQ9A 4A3LH 1NMFA 4IPGA 3HOXH 1XMQQ 1Q46A 4QJFA 2HHHQ 4LF9Q 2JA8G 2DUDA 1K3RA 4AIMA 3E9IA 2JA9A 3LGJA 1EOVA 5ELNA 1QVGA 1VQEA 3UE0A 4NPSA 4JI8L 1EWIA 4ALPA 2VZAA 3GTKH 1PH9A 3G6EA 3ULPA 1IXRA 2AWNA 4JBJA 2E2IH 1VQ6A 1TWFH 4GLVB 2FXQA 4IFDG 3S16H 2K14A 2QA4A 1VQMA 1X56A 1OXSC 4DAMA 2A19A 2NVTH 1K73C 3CCLA 5M3FG 1VQ5A 1QZHA 3AEVA 1FJGQ 3UDFA 5M5YH 3W1BA 1WJJA 4JV5L 3BU2A 1KXLA 1VQ7A 2YV5A 4LFBQ 2CQOA 2PNHA 4DNIA 2WB1E 2CFMA 4GOPA 4AQYQ 2CKZB 4YY3Q 2R7ZH 1B70B 1Q7YC 4R4OA 1H95A 1AE2A 3PIPA 1PA6A 1HZ9A 4NXNQ 1CUKA 3EBEA 1N33L 1IYJB 1VQAA 2ZJPA 4DV1L 5FLMG 4A93H 4JI1Q 1WOCA 1IBMQ 4BBRH 3CPFA 3J7A5 4X6AH 3PO2H 4BY7H 1D7QA 4AYBE 1ASYA 5E7NA 3H3VI 1GD7A 5JJKA 4IJHA 5M3MH 3RNUA 1L1OA 1MJCA 3DLLA 2XGTA 2N78A 4LF4Q 1X6OA 3S14H 3GDEA 3F2DA 1N9WA 4A3EH 1E3PA 3TS2A 1E7ZA 5JEAG 4A3BG 3A5ZB 1CKNA 4TQUS 4AH6A 3J81j 1VQ8A 4BXXG 4B3RL 1VQGA 3AFQA 1OXTA 4HJ5A 4A3DG 3HOWG 2F4VL 1VS0A 2UUAQ 1O7IA 4YHHQ 3I55A 4LWCA 3CCMA 3RN5A 4GNXA 1C0AA 5BR8L 4RMFA 5ELOA 1G51A 3G4SA 2V1CC 3PV0A 1E24A 4A3MH 1XPUA 3UE1A 3AYHB 4LF6L 2K52A 1I94Q 4JYAQ 2UXBQ 4YCVA 5IP9G 5IWAL 1K8GA 1EQRA 1PH1A 3T1HQ 1X65A 4DR3L 2Y0SE 4L5QA 1PH8A 1Q12A 3U4VA 1XNRQ 2R7FA 1T9HA 4JI5Q 4J15A 4C3IH 4L5SA 2I5MX 1MKHA 1TWGH 2K5NA 4QY7A 4LF7L 3GTMH 5C0XJ 1WYDA 3PO3G 2R93G 4LFAQ 1PHJA 1OTCA 2ALYB 3DM3A 1YEZA 2ZM6Q 3CMEA 1NBWA 2UXDQ 5AJ3L 4DK6C 1IBKL 1EYGA 2AWOA 2ZJQA 1PVOA 3I4MG 4JI3Q 4RG1A 5C3EH 1PH5A 3M4PA 4IJLA 1QVFA 2Q2UA 5IYDH 1K8AC 1HJPA 4A3JG 4GKKQ 3AFPA 5LMNL 1N34Q 2OTLA 1LUZA 3HOZG 1EUJA 1E1TA 4DR4Q 2B63G 2ZTCA 5GADC 4DV0L 1S40A 2ID0A 1RL2A 4OX9Q 1M1KC 4LFCL 2NN6I 4QGUA 1XTDA 3OTOL 3B6YA 2K50A 1QZGA 3F8TA 5LMUL 2KHJA 1JJCB 2E8GA 4JBKA 1NTGA 3HFZB 1TWCH 3TREA 2IY5B 1VQKA 3U50C 1YJNA 2IX0A 2Q2IA 4DUYL 3HKSA 4JI0Q 4XIGS 4MZ9A 1YJ9A 4B3SQ 1XMQL 4EX5A 2HHHL 4LF9L 1C9OA 1VQ4A 1PFSA 1K0RA 3CCQA 3HOVG 4UP7A 3U58A 1SMXA 1FGUA 1GKHA 1HZAA 1HZCA 1CSPA 1WCMH 3CXCA 3J80c 1KD1C 1A8VA 2R92G 4X66Q 3HOUH 2HIVA 1Q81C 2E5LQ 2Z6KC 1P8LA 2NN6G 4IFDI 1V9PA 1PH3A 4A3KH 2JA5H 2HQLA 1XJVA 4OXPA 3S17H 1VQCA 2JK8A 2ES2A 4GNXB 3FP9A 5LMNW 2R7DA 4PMWA 1WFQA 4LFBL 3G48A 2MO1A 5JJLA 4R4TA 2LSSA 5IYBH 2YU9H 2PQAA 4YY3L 4OONA 3EN2A 4HJ9A 4UP9A 1J5EQ 3PO3H 1W3SA 2N3SA 3CQZH 3E0EA 4DUZL 2VUMG 4DK3C 4YCWA 4IPCA 1NJIC 4JI1L 4DR6Q 3UDXA 1TXYA 5C4XG 4ME3A 1Z9FA 4JG2A 2JA6H 1YVCA 4B3TL 1IBLQ 4LUOA 1KRTA 1R9TH 2IT1A 3HOZH 4BBSG 4LF4L 2AHOB 2AKWB 2B63H 4X65Q 1VQHA 1SROA 3HOYG 3EIVA 1YHAA 3KLWA 3PF4A 2NZHA 2WP8J 2JA7G 4NB3A 5DLQE 1Q1BA 3M4QA 4A3FG 1N8RC 4L5RC 5FJ8H 2UUAL 2MO0A 2B3GA 4YHHL 4DR7Q 4OO1I 2YYZA 3NELA 3ICEA 1X3EA 1FVIA 1VQIA 3WWVA 4IPHA 1HNWQ 3KDFB 1OXVA 3HOUG 3S1MH 4DPGA 2I5HA 2BA0A 3CCEA 1HR0L 1XNQL 2UXBL 5IP7G 4JI7L 4K0KQ 3T1HL 3CPWA 3J81c 1S3OA 3PCOB 4O0AA 1XNRL 4A3GH 4P74A 1LYLA 3J7ZC 4JI5L 4OWXB 1Q82C 3M4OH 3CCSA 1E1OA 4JI2Q 1JMCA 4LW1A 1M90C 2NVYH 4P72A 1HZBA 2OWOA 2YTXA 2Q2TA 4A4IA 3T1YQ 4LFAL 4OO1G 1AH9A 1QUQA 2ZTDA 2RHQB 2JEBI 1VQBA 2UXDL 3STBC 2E2HH 1VQFA 2JEAI 1YJWA 2JA8H 3KF6B 1X54A 4JI3L 3JAMi 1YIJA 2H5XA 4GN4B 3RLFA 4X64Q 3GO5A 1G291 2WFWA 3RZOH 4A3CG 4GKKL 2VUMH 1N34L 1XMOL 5FLXc 4DV7Q 5C4XH 4JCVE 2I0QA 4P75A 4X62Q 5C44G 1NMGA 4DR2L 4JI6L 1YHQA 3CC4A 4OX9L 4POFA 1LM0A 1UE6A 4DV6L 1N32Q 4HIOA 1Y14B 2UUBL 3MXNB 1E22A 1I5FA 1L2FA 2WAQG 4R4CA 3FKIG 5HGQA 5IE8A 4HJAA 4DR1L 4A3IG 1PYBA 4DR5Q 5M3FH 4BA1I 1YNXA 1CKMA 3H15A 1HR0W 3TRZA 3A0JA 5GROA 3CC7A 1PH6A 2E2JH 4JI0L 3STBD 4JI4Q 4LF8Q 3KF8B 2YTYA 4B3SL 4A75A 2KCMA 1PH2A 2RF4A 4A3FH 2R7ZG 2VQEL 1GVPA 3GTLH 3HKZG 2XTIA 4APVA 1HH2P 3CAMA 3TQYA 5FLMH 4BA2I 4FDBA 2OQKA 4KHZA 2IX1A 1U0LA 4X66L 1SLJA 3KOJA 2JQOA 2Q2HA 2E5LL 1A0IA 4A3LG 3I4OA 3HOXG 3TEHB 5M5WH 1QVCA 3K7AH 4UY8C 4GOPB 1VQLA 4IFDJ 4GN5A 2Z6KA 2UXCQ 3L0OA 4DV5Q 4HIMA 3PIOA 2N8NA 4YCUA 3G71A 1Q86C 1ASZA 4QQBX 4A3BH 3NBHB 4BXXH 4LUVA 4A3DH 1HNZQ 1J5EL 3HOWH 2Z0SA 3PGZA 4LF6Q 4BY1G 1SFOH 3RLOA 4KHPQ 1A63A 1NY4A 3S24A 4GLXA 1L1OB 4DR3Q 1OXXK 2N49A 2A8VA 3CD6A 4P71A 2B29A 4C3JH 4DV3Q 2GVBA 1JT8A 3VDYA 4L5TA 3H3VH 1I6HH 1CKNB 2UU9Q 1KRSA 3H0GG 1IBLL 4C3HH 1HNXQ 5IP9H 3BJUA 5IYCG 4DV2Q 3M85A 4YWKA 4IOAA 3CF5A 3L2PA 4A76A 1FJGL 1QUQB 4A93G 3CCVA 3K7UC 1RIPA 4JC0A 5GAGC 4BBRG 5JEAJ 3PO2G 2ATWA 4JOIA 4AQYL 1JB7A 2PI2E 4LNQA 4BY7G 1Z47A 3M3YH 5GAEC 2R93H 2KCTA 4NXNL 3UDIA 3U4ZA 5M3MG 5H1SE 5IY0A 3OW2A 3BZCA 2LXKA 3ULLA 2OTJA 4DV0Q 3CCJA 1IBML 1HNWL 2VQFQ 2UUCQ 3I4MH 4YWMA 3I56A 1YITA 4JBMA 1BBUA 3KYHC 4A3JH 3KJOA 3CW2C 3E9HA 3PF5A 4OWWB 3ULJA 2NVXH 4JOIC 1YI2A 1Q8KA 3PUZA 4C2MH 3J80i 1PV4A 4UPAA 1Y1WG 4JI2L 4LF5Q 4GS3A 4QIWE 4A3MG 1N36Q 4GKJQ 3GTOH 3S2HH 3T1YL 1TWHH 1D8LA 1A62A 1NE3A 5HY6A 4DKAC 2AMCB 2EIFA 2KHIA 4B3MQ 1XPRA 1X55A 1YHBA 3I2ZA 2JE6I 3ER0A 2MNAA 2PI2A 2K5HA 2YTVA 4MTNA 3CMAA 1BKBA 4Y52H 4X64L 3CP0A 3HOVH 2RHSB 2MQHA 2WB1G 4BY1H 3PUXA 3F2CA 4HJ7A 1SRUA 1I94L 1EFWA 4JYAL 1SN8A 2BH8A 3M9BA 3PUWA 4UP8A 3W5OA 4DV7L 1VQOA 4NXMQ 1PH7A 4X62L 3S15H 2R92H 1PYSB 3JAMc 4DV4Q 2K4KA 4DAYB 2L15A 1N32L 4P73A 1J6QA 1L0WA 3H0GH 3L7ZC 3PSIA 3OYYA 2PMZE 5C3EG 4AYBG 1U5KA 1KL9A 5IYCH 5IYDG 4DR5L 4DUZQ 2QEXA 2GVAA 3ERSX 3SGIA 1IL2A 5EAYA 3S1RH 2CCZA 5GAHC 2CWPA 2CWAA 2ZM6L 4JI8Q 4JI4L 4LF8L 3BZKA 3MEFA 4TVAB 1K83H 3S1NH 2HIXA 1IZ6A 2OQ0A 1CKOA 3I7FA 4LUZA 2VY3A 1AE3A 4B3TQ 2D0OA 5GQOA 3Q8DA 2D62A 2D0PA 1S72A 3GTGH 4GOPC 4IO9A 1VQJA 4DR4L 4JBWA 4YWLA 2EXDA 4O2DA 4JV5Q 4WJ4A 1FL0A 1KQSA 4PG3A 1B7YB 1P16A 3FHWA 2JJQA 2KBNA 2PQAB 3ZJYC 3K80C 4BBSH 1DGSA 2HT1A 2UXCL 3I4NG 1N33Q 2DGYA 4DV5L 4DV1Q 3HOYH 1WCMG 1UEBA 1Y1VG 4IOCA 3J81i 2Y0SG 1Y1WH 4KLKA 5M5XH 1L1OC 2WAQE 3NEMA 1YZ6A 2JA7H 3PUVA 1SR3A 3IRBA 3W1GA 2OCEA 2VS1A 1W2BA 1HNZL 1HR0Q 3RR5A 4HIDA 1WI5A 1XNQQ 4A3KG 2JA5G 3D31A 3PUYA 4JI7Q 4KHPL 1JJGA 5J3BA 1JJ2A 3TS0A 2C35B 4DV3L 2MFIA 1VQDA 3UDGA 3KFUA 3K8AA 4B3RQ 5IT9c 1YBYA 3A74A 4GNXC 3HKZE 1VQPA 5IYBG 2UU9L 5JJIA 1HNXL 3NENA 5IP7H 2LXJA 3JC66 2F4VQ 4R1JA 1KAWA 4DV2L 1JE5A 2BA1A 5BR8Q 1MIUA 1MJEA 1EIFA 3RZDH 1EIYB 1PH4A 3M7NA 2RCNA 1X9NA 4XTCS 2GN5A 3CCRA 2JA6G 1OXUA 1TWAH 2I5LX 5IWAQ 1XMOQ 1I50H 1C7YA 3KDFA 2VL6A 4GLAC 4MNOA 4DR2Q 4JI6Q 4DR6L 4QL5A 3AQQA 4DV6Q 2VQFL 4HIKA 2UUCL 2F3IA 4POGA 2VNUD 2ZJRA 3RLNA 1EQQA 2UUBQ 3CCUA 4WJ3M 4A3CH 4KI0A 5C0XI 3GTPH 2R6GA 4DR1Q 1K9MC 3CC2A 5FJ8G 4LF7Q 2K5VA 3GTJH 1SE8A 1UE7A 2F52A 5C44H 4X65L 2BH2A 1V43A 1CSQA 2QGQA 5AJ3Q 4H02A 1XPOA 2ASBA 3D0FA 4PZ8A 4LF5L 2NZOA 2ZTEA 3K0XA 4GN3B 1IBKQ 1KC8C 2VQEQ 1VQNA 2IHFA 3GTQH 3A5UA 1N36L 3FKIH 4A3IH 1G6PA 4PZ6A 4HJ8A 4GKJL 5K36G 4PZ7A 3I4NH 2KENA 3KJPA 4DR7L 4IPDA 4OWTB 1X3GA 2A1AA 4R4QA 5LMNQ 1BBWA 1KIXA 1UE1A 3S2DH 1VCIA 1UWVA 1Y1VH 1X3FA 2VW9A 3RN2A 4Y7NH 2EQSA 4B3ML 3F2BA 1BVSA 3KF6A 2NVQH 4A3GG 1Q1EA 4A3EG 3K81C 4LFCQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM5 A;  4EQ5 A;  1KHI A;  3OTO Q;  1B8A A;  1UE5 A;  1V1Q A;  3GD7 A;  5C0X G;  1I3Q H;  3S1Q H;  3F1Z A;  5LMU Q;  4R4I A;  2K75 A;  1LTL A;  4NXM L;  4K0K L;  2IHE A;  4DV4 L;  5C4J H;  4DUY Q;  1GO3 E;  1VQ9 A;  4A3L H;  1NMF A;  4IPG A;  3HOX H;  1XMQ Q;  1Q46 A;  4QJF A;  2HHH Q;  4LF9 Q;  2JA8 G;  2DUD A;  1K3R A;  4AIM A;  3E9I A;  2JA9 A;  3LGJ A;  1EOV A;  5ELN A;  1QVG A;  1VQE A;  3UE0 A;  4NPS A;  4JI8 L;  1EWI A;  4ALP A;  2VZA A;  3GTK H;  1PH9 A;  3G6E A;  3ULP A;  1IXR A;  2AWN A;  4JBJ A;  2E2I H;  1VQ6 A;  1TWF H;  4GLV B;  2FXQ A;  4IFD G;  3S16 H;  2K14 A;  2QA4 A;  1VQM A;  1X56 A;  1OXS C;  4DAM A;  2A19 A;  2NVT H;  1K73 C;  3CCL A;  5M3F G;  1VQ5 A;  1QZH A;  3AEV A;  1FJG Q;  3UDF A;  5M5Y H;  3W1B A;  1WJJ A;  4JV5 L;  3BU2 A;  1KXL A;  1VQ7 A;  2YV5 A;  4LFB Q;  2CQO A;  2PNH A;  4DNI A;  2WB1 E;  2CFM A;  4GOP A;  4AQY Q;  2CKZ B;  4YY3 Q;  2R7Z H;  1B70 B;  1Q7Y C;  4R4O A;  1H95 A;  1AE2 A;  3PIP A;  1PA6 A;  1HZ9 A;  4NXN Q;  1CUK A;  3EBE A;  1N33 L;  1IYJ B;  1VQA A;  2ZJP A;  4DV1 L;  5FLM G;  4A93 H;  4JI1 Q;  1WOC A;  1IBM Q;  4BBR H;  3CPF A;  3J7A 5;  4X6A H;  3PO2 H;  4BY7 H;  1D7Q A;  4AYB E;  1ASY A;  5E7N A;  3H3V I;  1GD7 A;  5JJK A;  4IJH A;  5M3M H;  3RNU A;  1L1O A;  1MJC A;  3DLL A;  2XGT A;  2N78 A;  4LF4 Q;  1X6O A;  3S14 H;  3GDE A;  3F2D A;  1N9W A;  4A3E H;  1E3P A;  3TS2 A;  1E7Z A;  5JEA G;  4A3B G;  3A5Z B;  1CKN A;  4TQU S;  4AH6 A;  3J81 j;  1VQ8 A;  4BXX G;  4B3R L;  1VQG A;  3AFQ A;  1OXT A;  4HJ5 A;  4A3D G;  3HOW G;  2F4V L;  1VS0 A;  2UUA Q;  1O7I A;  4YHH Q;  3I55 A;  4LWC A;  3CCM A;  3RN5 A;  4GNX A;  1C0A A;  5BR8 L;  4RMF A;  5ELO A;  1G51 A;  3G4S A;  2V1C C;  3PV0 A;  1E24 A;  4A3M H;  1XPU A;  3UE1 A;  3AYH B;  4LF6 L;  2K52 A;  1I94 Q;  4JYA Q;  2UXB Q;  4YCV A;  5IP9 G;  5IWA L;  1K8G A;  1EQR A;  1PH1 A;  3T1H Q;  1X65 A;  4DR3 L;  2Y0S E;  4L5Q A;  1PH8 A;  1Q12 A;  3U4V A;  1XNR Q;  2R7F A;  1T9H A;  4JI5 Q;  4J15 A;  4C3I H;  4L5S A;  2I5M X;  1MKH A;  1TWG H;  2K5N A;  4QY7 A;  4LF7 L;  3GTM H;  5C0X J;  1WYD A;  3PO3 G;  2R93 G;  4LFA Q;  1PHJ A;  1OTC A;  2ALY B;  3DM3 A;  1YEZ A;  2ZM6 Q;  3CME A;  1NBW A;  2UXD Q;  5AJ3 L;  4DK6 C;  1IBK L;  1EYG A;  2AWO A;  2ZJQ A;  1PVO A;  3I4M G;  4JI3 Q;  4RG1 A;  5C3E H;  1PH5 A;  3M4P A;  4IJL A;  1QVF A;  2Q2U A;  5IYD H;  1K8A C;  1HJP A;  4A3J G;  4GKK Q;  3AFP A;  5LMN L;  1N34 Q;  2OTL A;  1LUZ A;  3HOZ G;  1EUJ A;  1E1T A;  4DR4 Q;  2B63 G;  2ZTC A;  5GAD C;  4DV0 L;  1S40 A;  2ID0 A;  1RL2 A;  4OX9 Q;  1M1K C;  4LFC L;  2NN6 I;  4QGU A;  1XTD A;  3OTO L;  3B6Y A;  2K50 A;  1QZG A;  3F8T A;  5LMU L;  2KHJ A;  1JJC B;  2E8G A;  4JBK A;  1NTG A;  3HFZ B;  1TWC H;  3TRE A;  2IY5 B;  1VQK A;  3U50 C;  1YJN A;  2IX0 A;  2Q2I A;  4DUY L;  3HKS A;  4JI0 Q;  4XIG S;  4MZ9 A;  1YJ9 A;  4B3S Q;  1XMQ L;  4EX5 A;  2HHH L;  4LF9 L;  1C9O A;  1VQ4 A;  1PFS A;  1K0R A;  3CCQ A;  3HOV G;  4UP7 A;  3U58 A;  1SMX A;  1FGU A;  1GKH A;  1HZA A;  1HZC A;  1CSP A;  1WCM H;  3CXC A;  3J80 c;  1KD1 C;  1A8V A;  2R92 G;  4X66 Q;  3HOU H;  2HIV A;  1Q81 C;  2E5L Q;  2Z6K C;  1P8L A;  2NN6 G;  4IFD I;  1V9P A;  1PH3 A;  4A3K H;  2JA5 H;  2HQL A;  1XJV A;  4OXP A;  3S17 H;  1VQC A;  2JK8 A;  2ES2 A;  4GNX B;  3FP9 A;  5LMN W;  2R7D A;  4PMW A;  1WFQ A;  4LFB L;  3G48 A;  2MO1 A;  5JJL A;  4R4T A;  2LSS A;  5IYB H;  2YU9 H;  2PQA A;  4YY3 L;  4OON A;  3EN2 A;  4HJ9 A;  4UP9 A;  1J5E Q;  3PO3 H;  1W3S A;  2N3S A;  3CQZ H;  3E0E A;  4DUZ L;  2VUM G;  4DK3 C;  4YCW A;  4IPC A;  1NJI C;  4JI1 L;  4DR6 Q;  3UDX A;  1TXY A;  5C4X G;  4ME3 A;  1Z9F A;  4JG2 A;  2JA6 H;  1YVC A;  4B3T L;  1IBL Q;  4LUO A;  1KRT A;  1R9T H;  2IT1 A;  3HOZ H;  4BBS G;  4LF4 L;  2AHO B;  2AKW B;  2B63 H;  4X65 Q;  1VQH A;  1SRO A;  3HOY G;  3EIV A;  1YHA A;  3KLW A;  3PF4 A;  2NZH A;  2WP8 J;  2JA7 G;  4NB3 A;  5DLQ E;  1Q1B A;  3M4Q A;  4A3F G;  1N8R C;  4L5R C;  5FJ8 H;  2UUA L;  2MO0 A;  2B3G A;  4YHH L;  4DR7 Q;  4OO1 I;  2YYZ A;  3NEL A;  3ICE A;  1X3E A;  1FVI A;  1VQI A;  3WWV A;  4IPH A;  1HNW Q;  3KDF B;  1OXV A;  3HOU G;  3S1M H;  4DPG A;  2I5H A;  2BA0 A;  3CCE A;  1HR0 L;  1XNQ L;  2UXB L;  5IP7 G;  4JI7 L;  4K0K Q;  3T1H L;  3CPW A;  3J81 c;  1S3O A;  3PCO B;  4O0A A;  1XNR L;  4A3G H;  4P74 A;  1LYL A;  3J7Z C;  4JI5 L;  4OWX B;  1Q82 C;  3M4O H;  3CCS A;  1E1O A;  4JI2 Q;  1JMC A;  4LW1 A;  1M90 C;  2NVY H;  4P72 A;  1HZB A;  2OWO A;  2YTX A;  2Q2T A;  4A4I A;  3T1Y Q;  4LFA L;  4OO1 G;  1AH9 A;  1QUQ A;  2ZTD A;  2RHQ B;  2JEB I;  1VQB A;  2UXD L;  3STB C;  2E2H H;  1VQF A;  2JEA I;  1YJW A;  2JA8 H;  3KF6 B;  1X54 A;  4JI3 L;  3JAM i;  1YIJ A;  2H5X A;  4GN4 B;  3RLF A;  4X64 Q;  3GO5 A;  1G29 1;  2WFW A;  3RZO H;  4A3C G;  4GKK L;  2VUM H;  1N34 L;  1XMO L;  5FLX c;  4DV7 Q;  5C4X H;  4JCV E;  2I0Q A;  4P75 A;  4X62 Q;  5C44 G;  1NMG A;  4DR2 L;  4JI6 L;  1YHQ A;  3CC4 A;  4OX9 L;  4POF A;  1LM0 A;  1UE6 A;  4DV6 L;  1N32 Q;  4HIO A;  1Y14 B;  2UUB L;  3MXN B;  1E22 A;  1I5F A;  1L2F A;  2WAQ G;  4R4C A;  3FKI G;  5HGQ A;  5IE8 A;  4HJA A;  4DR1 L;  4A3I G;  1PYB A;  4DR5 Q;  5M3F H;  4BA1 I;  1YNX A;  1CKM A;  3H15 A;  1HR0 W;  3TRZ A;  3A0J A;  5GRO A;  3CC7 A;  1PH6 A;  2E2J H;  4JI0 L;  3STB D;  4JI4 Q;  4LF8 Q;  3KF8 B;  2YTY A;  4B3S L;  4A75 A;  2KCM A;  1PH2 A;  2RF4 A;  4A3F H;  2R7Z G;  2VQE L;  1GVP A;  3GTL H;  3HKZ G;  2XTI A;  4APV A;  1HH2 P;  3CAM A;  3TQY A;  5FLM H;  4BA2 I;  4FDB A;  2OQK A;  4KHZ A;  2IX1 A;  1U0L A;  4X66 L;  1SLJ A;  3KOJ A;  2JQO A;  2Q2H A;  2E5L L;  1A0I A;  4A3L G;  3I4O A;  3HOX G;  3TEH B;  5M5W H;  1QVC A;  3K7A H;  4UY8 C;  4GOP B;  1VQL A;  4IFD J;  4GN5 A;  2Z6K A;  2UXC Q;  3L0O A;  4DV5 Q;  4HIM A;  3PIO A;  2N8N A;  4YCU A;  3G71 A;  1Q86 C;  1ASZ A;  4QQB X;  4A3B H;  3NBH B;  4BXX H;  4LUV A;  4A3D H;  1HNZ Q;  1J5E L;  3HOW H;  2Z0S A;  3PGZ A;  4LF6 Q;  4BY1 G;  1SFO H;  3RLO A;  4KHP Q;  1A63 A;  1NY4 A;  3S24 A;  4GLX A;  1L1O B;  4DR3 Q;  1OXX K;  2N49 A;  2A8V A;  3CD6 A;  4P71 A;  2B29 A;  4C3J H;  4DV3 Q;  2GVB A;  1JT8 A;  3VDY A;  4L5T A;  3H3V H;  1I6H H;  1CKN B;  2UU9 Q;  1KRS A;  3H0G G;  1IBL L;  4C3H H;  1HNX Q;  5IP9 H;  3BJU A;  5IYC G;  4DV2 Q;  3M85 A;  4YWK A;  4IOA A;  3CF5 A;  3L2P A;  4A76 A;  1FJG L;  1QUQ B;  4A93 G;  3CCV A;  3K7U C;  1RIP A;  4JC0 A;  5GAG C;  4BBR G;  5JEA J;  3PO2 G;  2ATW A;  4JOI A;  4AQY L;  1JB7 A;  2PI2 E;  4LNQ A;  4BY7 G;  1Z47 A;  3M3Y H;  5GAE C;  2R93 H;  2KCT A;  4NXN L;  3UDI A;  3U4Z A;  5M3M G;  5H1S E;  5IY0 A;  3OW2 A;  3BZC A;  2LXK A;  3ULL A;  2OTJ A;  4DV0 Q;  3CCJ A;  1IBM L;  1HNW L;  2VQF Q;  2UUC Q;  3I4M H;  4YWM A;  3I56 A;  1YIT A;  4JBM A;  1BBU A;  3KYH C;  4A3J H;  3KJO A;  3CW2 C;  3E9H A;  3PF5 A;  4OWW B;  3ULJ A;  2NVX H;  4JOI C;  1YI2 A;  1Q8K A;  3PUZ A;  4C2M H;  3J80 i;  1PV4 A;  4UPA A;  1Y1W G;  4JI2 L;  4LF5 Q;  4GS3 A;  4QIW E;  4A3M G;  1N36 Q;  4GKJ Q;  3GTO H;  3S2H H;  3T1Y L;  1TWH H;  1D8L A;  1A62 A;  1NE3 A;  5HY6 A;  4DKA C;  2AMC B;  2EIF A;  2KHI A;  4B3M Q;  1XPR A;  1X55 A;  1YHB A;  3I2Z A;  2JE6 I;  3ER0 A;  2MNA A;  2PI2 A;  2K5H A;  2YTV A;  4MTN A;  3CMA A;  1BKB A;  4Y52 H;  4X64 L;  3CP0 A;  3HOV H;  2RHS B;  2MQH A;  2WB1 G;  4BY1 H;  3PUX A;  3F2C A;  4HJ7 A;  1SRU A;  1I94 L;  1EFW A;  4JYA L;  1SN8 A;  2BH8 A;  3M9B A;  3PUW A;  4UP8 A;  3W5O A;  4DV7 L;  1VQO A;  4NXM Q;  1PH7 A;  4X62 L;  3S15 H;  2R92 H;  1PYS B;  3JAM c;  4DV4 Q;  2K4K A;  4DAY B;  2L15 A;  1N32 L;  4P73 A;  1J6Q A;  1L0W A;  3H0G H;  3L7Z C;  3PSI A;  3OYY A;  2PMZ E;  5C3E G;  4AYB G;  1U5K A;  1KL9 A;  5IYC H;  5IYD G;  4DR5 L;  4DUZ Q;  2QEX A;  2GVA A;  3ERS X;  3SGI A;  1IL2 A;  5EAY A;  3S1R H;  2CCZ A;  5GAH C;  2CWP A;  2CWA A;  2ZM6 L;  4JI8 Q;  4JI4 L;  4LF8 L;  3BZK A;  3MEF A;  4TVA B;  1K83 H;  3S1N H;  2HIX A;  1IZ6 A;  2OQ0 A;  1CKO A;  3I7F A;  4LUZ A;  2VY3 A;  1AE3 A;  4B3T Q;  2D0O A;  5GQO A;  3Q8D A;  2D62 A;  2D0P A;  1S72 A;  3GTG H;  4GOP C;  4IO9 A;  1VQJ A;  4DR4 L;  4JBW A;  4YWL A;  2EXD A;  4O2D A;  4JV5 Q;  4WJ4 A;  1FL0 A;  1KQS A;  4PG3 A;  1B7Y B;  1P16 A;  3FHW A;  2JJQ A;  2KBN A;  2PQA B;  3ZJY C;  3K80 C;  4BBS H;  1DGS A;  2HT1 A;  2UXC L;  3I4N G;  1N33 Q;  2DGY A;  4DV5 L;  4DV1 Q;  3HOY H;  1WCM G;  1UEB A;  1Y1V G;  4IOC A;  3J81 i;  2Y0S G;  1Y1W H;  4KLK A;  5M5X H;  1L1O C;  2WAQ E;  3NEM A;  1YZ6 A;  2JA7 H;  3PUV A;  1SR3 A;  3IRB A;  3W1G A;  2OCE A;  2VS1 A;  1W2B A;  1HNZ L;  1HR0 Q;  3RR5 A;  4HID A;  1WI5 A;  1XNQ Q;  4A3K G;  2JA5 G;  3D31 A;  3PUY A;  4JI7 Q;  4KHP L;  1JJG A;  5J3B A;  1JJ2 A;  3TS0 A;  2C35 B;  4DV3 L;  2MFI A;  1VQD A;  3UDG A;  3KFU A;  3K8A A;  4B3R Q;  5IT9 c;  1YBY A;  3A74 A;  4GNX C;  3HKZ E;  1VQP A;  5IYB G;  2UU9 L;  5JJI A;  1HNX L;  3NEN A;  5IP7 H;  2LXJ A;  3JC6 6;  2F4V Q;  4R1J A;  1KAW A;  4DV2 L;  1JE5 A;  2BA1 A;  5BR8 Q;  1MIU A;  1MJE A;  1EIF A;  3RZD H;  1EIY B;  1PH4 A;  3M7N A;  2RCN A;  1X9N A;  4XTC S;  2GN5 A;  3CCR A;  2JA6 G;  1OXU A;  1TWA H;  2I5L X;  5IWA Q;  1XMO Q;  1I50 H;  1C7Y A;  3KDF A;  2VL6 A;  4GLA C;  4MNO A;  4DR2 Q;  4JI6 Q;  4DR6 L;  4QL5 A;  3AQQ A;  4DV6 Q;  2VQF L;  4HIK A;  2UUC L;  2F3I A;  4POG A;  2VNU D;  2ZJR A;  3RLN A;  1EQQ A;  2UUB Q;  3CCU A;  4WJ3 M;  4A3C H;  4KI0 A;  5C0X I;  3GTP H;  2R6G A;  4DR1 Q;  1K9M C;  3CC2 A;  5FJ8 G;  4LF7 Q;  2K5V A;  3GTJ H;  1SE8 A;  1UE7 A;  2F52 A;  5C44 H;  4X65 L;  2BH2 A;  1V43 A;  1CSQ A;  2QGQ A;  5AJ3 Q;  4H02 A;  1XPO A;  2ASB A;  3D0F A;  4PZ8 A;  4LF5 L;  2NZO A;  2ZTE A;  3K0X A;  4GN3 B;  1IBK Q;  1KC8 C;  2VQE Q;  1VQN A;  2IHF A;  3GTQ H;  3A5U A;  1N36 L;  3FKI H;  4A3I H;  1G6P A;  4PZ6 A;  4HJ8 A;  4GKJ L;  5K36 G;  4PZ7 A;  3I4N H;  2KEN A;  3KJP A;  4DR7 L;  4IPD A;  4OWT B;  1X3G A;  2A1A A;  4R4Q A;  5LMN Q;  1BBW A;  1KIX A;  1UE1 A;  3S2D H;  1VCI A;  1UWV A;  1Y1V H;  1X3F A;  2VW9 A;  3RN2 A;  4Y7N H;  2EQS A;  4B3M L;  3F2B A;  1BVS A;  3KF6 A;  2NVQ H;  4A3G G;  1Q1E A;  4A3E G;  3K81 C;  4LFC Q; 
#chains in the Genus database with same CATH topology
 1F9S A;  1UE5 A;  3GD7 A;  3V96 A;  5C0X G;  3S1Q H;  2R3Z A;  1ENC A;  3K5M A;  3JAM L;  4K0K L;  2LKV A;  3E0J A;  2IHE A;  2Z8L A;  4ZKB B;  2WV6 D;  4EQN A;  3SK5 A;  4RFB A;  2F0H A;  1RD9 D;  3K7A B;  2JA8 G;  3D4W A;  4LF9 Q;  1SNM A;  4AIM A;  2JA9 A;  3R93 A;  1EOV A;  1QVG A;  1BNZ A;  4OEL B;  3RZD B;  4NPS A;  1RTO A;  4JI8 L;  2WKC A;  3G6E A;  1EU4 A;  4GLV B;  3S16 H;  1OXS C;  1I50 B;  1VQ5 A;  4RCN A;  4DGZ A;  3N6R A;  4DK1 A;  1VQ7 A;  2PNH A;  1G91 A;  2SNM A;  1IYU A;  4YY3 Q;  1B70 B;  1Q7Y C;  4R4O A;  1H95 A;  3PIP A;  4NXN Q;  3J81 E;  3DEO A;  1IYJ B;  3NBH A;  5FLM G;  3U9S A;  2L4N A;  4X6A H;  2LS0 1;  1ASY A;  3H3V I;  5JJK A;  3S2D B;  1CHQ D;  2K1B A;  2RVL A;  2XGT A;  4Y7N B;  3GDE A;  3BVZ A;  2M00 A;  4A3E H;  1BCP B;  4AH6 A;  1CKN A;  3IL8 A;  2K28 A;  4O42 A;  1PLF A;  3J81 j;  4OEM B;  3HKZ B;  1I3Q B;  1OXT A;  1O78 A;  4KKT A;  4XQJ A;  4DAP A;  1EYD A;  4YHH Q;  4LWC A;  4H44 C;  5C4J B;  1U4P A;  1G51 A;  3A7A B;  1X32 A;  4LF6 L;  5I2Y A;  1DYQ A;  4DR3 L;  2Y0S E;  4L5Q A;  5EJW A;  4C3I H;  3OIQ A;  4L5S A;  4BY1 B;  3FDT A;  2NVT B;  4LF7 L;  5C0X J;  1Q90 A;  2EY1 A;  3CME A;  4TSS A;  5AJ3 L;  3K5L A;  3KBG A;  5DM7 3;  2ZJQ A;  1PVO A;  1FYC A;  4IJL A;  1PH5 A;  1QVF A;  2Q2U A;  2Z6B A;  2PW5 A;  4NMZ A;  2KEC A;  4A93 B;  5CV8 A;  5KYL A;  5LMN L;  1N34 Q;  1ILP A;  1EUJ A;  1E1T A;  5CV6 A;  5KNC A;  4DV0 L;  2B63 G;  1LTS D;  4BY7 B;  4KJO A;  4UHV A;  5M3M B;  3B6Y A;  1BCP F;  1HA6 A;  2E8G A;  1JOQ A;  2IY5 B;  1VQK A;  2MUY A;  1BQQ T;  3HKS A;  2FIN B;  4XIG S;  4LF9 L;  1C9O A;  1VQ4 A;  4XQQ A;  2MP1 A;  5CV9 A;  2F0F A;  1SMX A;  2C9O A;  3CXC A;  1A8V A;  3GQB A;  1I4P A;  2HIV A;  1Y8P B;  3J7A F;  4Q0F A;  3H91 A;  4A3K H;  2JA5 H;  5JVG 3;  1XJV A;  3KBX A;  1VQC A;  1CI3 M;  1WD0 A;  2ES2 A;  1S5D D;  1HA5 A;  3NTK A;  1WFQ A;  5JJL A;  3I8Z A;  2WB1 B;  2VB3 X;  4L63 B;  2YU9 H;  3MXG A;  4YY3 L;  4OON A;  1WVL A;  3D4R A;  3CQZ H;  2N3S A;  2IWH A;  2F0L A;  3Q6S A;  1NJI C;  4TRD A;  3UDX A;  1D5M C;  4QB4 A;  2KUM A;  1DOM A;  3MZ5 A;  4X3T A;  3Q0A A;  2OEO A;  1YVC A;  3RD4 A;  4X3U A;  4LUO A;  1KRT A;  3R2T A;  2AKW B;  3EIV A;  1YHA A;  3ERO A;  3KLW A;  5C5L A;  3PF4 A;  4L8J A;  2XRS D;  4NB3 A;  2M9V A;  2ZXP A;  3M4Q A;  2HDL A;  2NTT A;  1B3A A;  4JW0 A;  4EVO A;  4YHH L;  3NHH A;  1QE6 A;  1LTG D;  1F2L A;  2A69 C;  1X3E A;  1FVI A;  1BXT A;  1PDQ A;  4IPH A;  3SK4 A;  5G3L D;  4DPG A;  3OHX C;  5FLX L;  5LL6 S;  3CCE A;  1JC7 A;  1SJE D;  4JI7 L;  1WCM B;  2EY5 A;  3J81 c;  2NVQ B;  2XIW A;  1U4M A;  4P74 A;  4LJZ C;  2IW3 A;  5ELF A;  5D3I B;  3CCS A;  2DY8 A;  2A74 C;  1M90 C;  3NUC A;  1STN A;  3S17 B;  4RWS C;  2YTX A;  2Q2T A;  3T1Y Q;  4OO1 G;  1AH9 A;  2BDN A;  4KN7 C;  1Z6H A;  4RKB A;  1VQB A;  3STB C;  3CHB D;  3IAY A;  3PIO 3;  2EOT A;  1VQF A;  3OPO A;  4OIJ A;  4B08 A;  5IGB A;  2EXZ A;  3PO3 B;  3RLF A;  2HUG A;  4CJ1 B;  2VUM H;  1N34 L;  1PTO B;  4DR2 L;  3TN2 A;  4POF A;  1O7Z A;  1EY6 A;  4HIO A;  1V1P A;  2UUB L;  2EJF C;  1TKW B;  4HJA A;  4DR1 L;  2KA7 A;  4RH6 A;  2E2J H;  1OO9 B;  3STB D;  4JI4 Q;  2YTY A;  2KCM A;  4RCO A;  4A3F H;  2R7Z G;  2FMC A;  3QWN A;  4L6T B;  3GTL H;  1EY9 A;  4BA2 I;  4I65 A;  1KDB A;  5A2Q L;  2IX1 A;  1AZP A;  2AQ3 B;  3AB9 A;  1I4H A;  5L37 A;  1WTV A;  3KLS A;  3HOX G;  3SR1 A;  3TEH B;  1MI2 A;  3K7A H;  1AZQ A;  5BN5 A;  1FNU A;  4S3S A;  4GN5 A;  1X3P A;  3L0O A;  4XT1 B;  4ODG A;  4HIM A;  1ASZ A;  2N8N A;  5ELB A;  4A3B H;  3NBH B;  4EQP A;  4FXG C;  4ZK9 B;  2Z0S A;  1YNJ C;  4FO2 A;  1SFO H;  2F3W A;  2N49 A;  3CD6 A;  3CRK C;  2JA8 B;  2E75 C;  1NNX A;  5D65 A;  1D6E C;  5KIX A;  1PTO F;  1FNV A;  1CKN B;  1H9R A;  1I4R A;  1HCZ A;  4C3H H;  1HNX Q;  5IP9 H;  5JPN C;  3BG3 A;  3L2P A;  4DFA A;  1QUQ B;  3K7U C;  3IFT A;  1BOS A;  1RIP A;  4UAI A;  5GAG C;  4DK0 A;  4BBR G;  5K5P A;  4AQY L;  1JB7 A;  4O1N A;  3M3Y H;  1YNJ D;  2CHB D;  3N52 A;  5C3W A;  2HCI A;  1K3B C;  4K5V A;  3I56 A;  4JBM A;  3E3X A;  1BCP C;  2CVR A;  4A3J H;  1XWE A;  4KD3 A;  5AFW A;  4OWW B;  2K5W A;  1EY0 A;  2H4O A;  4IZ8 A;  4RKL A;  1SMY C;  1FD7 D;  5FO9 B;  2F0M A;  3GTO H;  3S2H H;  3T1Y L;  1NE3 A;  4DKA C;  2AMC B;  2QW7 A;  1X55 A;  4KMU C;  5EPL A;  2YTV A;  3PMF A;  3MTS A;  3CMA A;  2N88 A;  3LWE A;  3OSO A;  3HOV H;  2MQH A;  4BY1 H;  1IYV A;  4UP8 A;  4NXM Q;  3S15 H;  2ZT9 C;  4WRD A;  4DV4 Q;  1LTI D;  1WTX A;  1EOT A;  4RGM A;  1JQY D;  5IGE A;  5C3E G;  4JPB W;  3H09 A;  1SSO A;  4U68 A;  2QEX A;  4DUZ Q;  5LL6 X;  2D5D A;  4CKE A;  1W6J A;  3WOE A;  2ZM6 L;  4JI4 L;  3MEF A;  3I72 A;  5BN4 A;  3I7F A;  2VY3 A;  3VYR A;  1KLU D;  1HTP A;  5GQO A;  3Q8D A;  2D62 A;  1S72 A;  3GTG H;  3VR4 A;  1LTB D;  1VQJ A;  2HCC A;  5IGC A;  3HZX A;  1MSG A;  1S5C D;  3AMU A;  2F0W A;  1KQS A;  1LAB A;  2NVX B;  1N33 Q;  3D3R A;  3HOY H;  1Y1V G;  2B2U C;  2DJF C;  4IOC A;  2Y0S G;  1LV9 A;  4KLK A;  5M5X H;  1L1O C;  2WAQ E;  2JA7 H;  1YZ6 A;  4KJN A;  3HOU G;  3IRB A;  3W1G A;  2VS1 A;  3MA2 B;  3RR5 A;  4HID A;  1TS2 A;  2J7Z A;  1A15 A;  4PV1 C;  5J3B A;  1JJ2 A;  4CDE C;  1CFM A;  2WKD A;  1PXU A;  3A74 A;  5IYB G;  5JJI A;  1HNX L;  5IP7 H;  3IKJ A;  2LXJ A;  3SHL A;  4R1J A;  1STE A;  3P75 A;  4FF1 A;  1JOR A;  3H0G B;  4OIK A;  2B2W C;  2NVY B;  2GN5 A;  3S1R B;  4KY5 A;  1RDP D;  1SBB B;  5IWA Q;  4HMI A;  3KDF A;  4JI6 Q;  4DR6 L;  4DV6 Q;  1JB3 A;  4POG A;  2VNU D;  2ZJR A;  3RLN A;  2PCF B;  1K9M C;  1SXT A;  4K2K A;  3VR5 A;  3ONA B;  3GTJ H;  1SE8 A;  1UE7 A;  1UAP A;  5C44 H;  1HRJ A;  3I90 A;  4KY7 A;  3X3M A;  2ASB A;  3GTQ H;  1KC8 C;  3FKI H;  1PRT D;  4A3I H;  5K36 G;  4F8M A;  4HJ8 A;  3I4N H;  2KEN A;  3P20 A;  1S5E D;  1F77 A;  1UE1 A;  4K8J A;  2AQ1 B;  5COY A;  3KF6 A;  2NVQ H;  3VYT A;  1Q1E A;  2KJX A;  5IGD A;  1GM5 A;  1YNN D;  4EQ5 A;  3OTO Q;  1B8A A;  1SE4 A;  1G2S A;  1V1P B;  5LMU Q;  1JWM D;  2MGS A;  1LTL A;  3T4A C;  4NXM L;  3HRZ C;  2EYL A;  4DV4 L;  1GO3 E;  2F1M A;  1VQ9 A;  4A3L H;  4IPG A;  1ICF B;  3BVG A;  1B44 D;  2H1E A;  3LGJ A;  3UE0 A;  1JWS D;  1EWI A;  1W6K A;  1PZJ D;  1F9P A;  2AWN A;  4JBJ A;  4K2L A;  1VQ6 A;  1TWF H;  1PTO C;  4N9T A;  2FXQ A;  4B9X A;  5IOD A;  2F0D A;  4IFD G;  4IN3 A;  2EDG A;  3AEV A;  1FJG Q;  4J8Q A;  5M5Y H;  1WJJ A;  4FXD A;  3I3C A;  1K0S A;  2YV5 A;  2CQO A;  1AE2 A;  1HZ9 A;  1N33 L;  3DWQ A;  1IBM Q;  3CPF A;  3PO2 H;  4AYB E;  5E7N A;  1GD7 A;  2B2U A;  4IJH A;  4HCS A;  1L1O A;  5EBC A;  1F2Y A;  4C1N I;  3RNU A;  3BYY B;  2A6H D;  5IT9 L;  3S14 H;  1IW7 C;  3F2D A;  1DM0 B;  5EPJ A;  1E7Z A;  5JEA G;  2R7Z B;  1E2Z A;  3A5Z B;  3FMC A;  4TQU S;  3O13 A;  1VQG A;  5C0X H;  4HJ5 A;  1VS0 A;  3CCM A;  5IOC A;  3C3L A;  4DNR B;  1M4V A;  4KN4 C;  4ILW A;  5ELO A;  3R2I A;  4C3J G;  3G4S A;  3HOX B;  4NW2 A;  2V1C C;  4A3M H;  3MC0 B;  3DXJ C;  3UE1 A;  2UXB Q;  2K52 A;  1I94 Q;  2F0T A;  5IWA L;  1K8G A;  3GTK B;  1E0B A;  3K5O A;  3E5S A;  1PH8 A;  3U4V A;  1IW7 D;  2F3V A;  1XNR Q;  2E2I B;  2EZV A;  3SE0 A;  1MKH A;  5JOB A;  4F88 A;  3GTM H;  2QDL A;  3PO3 G;  1F9R A;  4LFA Q;  1PHJ A;  4K8I A;  3DM3 A;  2UXD Q;  4MTK A;  3SXH A;  1EYG A;  3I4M G;  4WJW A;  2O5J C;  5IYD H;  1HJP A;  2RA4 A;  1LUZ A;  4DR4 Q;  4BBR B;  4QGU A;  3OTO L;  1SYD A;  2RCF A;  1QZG A;  3F8T A;  5LMU L;  1D2B A;  1NTG A;  3HFZ B;  1H9M A;  1YJ9 A;  2F0O A;  1NCV A;  3FPP A;  4B3S Q;  5T1G A;  2MHV A;  1SNO A;  1JOO A;  3U58 A;  2QDB A;  3HS0 C;  3OWE B;  1HZC A;  2CW0 D;  1STH A;  4XXE A;  2PW7 A;  4U67 3;  1R4P B;  1P8L A;  1Q3L A;  4Z9C B;  4X3S A;  2E5L Q;  4IFD I;  5LHY 1;  2D2C C;  3TP5 A;  5JVH 3;  2R7D A;  2ICI A;  1LT3 D;  4PMC A;  3M7G A;  3EN2 A;  4MHE A;  2PMZ B;  1J5E Q;  5JPM C;  2OT2 A;  1EY5 A;  4HSP A;  4YCW A;  4IPC A;  2F0I A;  2Q8T A;  5C4X G;  2RBM A;  2EYM A;  5C3E B;  4JG2 A;  2JA6 H;  4B3T L;  3J81 L;  3NTH A;  2IT1 A;  4BBS G;  3DM1 A;  2B63 H;  4X65 Q;  1SRO A;  1SYG A;  1WTW A;  2A73 B;  2B2V C;  2Z4H A;  4DN4 M;  1EU3 A;  1N8R C;  4L5R C;  5FJ8 H;  4DR7 Q;  1TWC B;  1HFN A;  5HGT A;  1NSN S;  1QWY A;  3KDF B;  4PMB A;  1OXV A;  3S1M H;  2I5H A;  4OHJ A;  1HR0 L;  4QCL A;  4PQX A;  2UXB L;  1Y1V B;  3MXU A;  3CPW A;  1NUC A;  2Y0S B;  1EYA A;  3HOU B;  4A3G H;  3PCO B;  4O0A A;  1XNR L;  3BVM A;  3J7Z C;  1Q82 C;  1MBY A;  3M4O H;  5M9O A;  4JI2 Q;  2GA4 B;  1JMC A;  4CDC C;  2NBF A;  2NVY H;  1HZB A;  2OWO A;  4LFA L;  1QUQ A;  4XDX A;  1C4Q A;  2K05 A;  2UXD L;  1ILQ A;  4IUQ A;  3VYS A;  1YJW A;  4KKS A;  2D9U A;  3KF6 B;  2F4I A;  1X54 A;  5C3X A;  2RDH A;  2H5X A;  4X64 Q;  4A3C G;  1G29 1;  3GP7 A;  2IL8 A;  3TSS A;  3KUP A;  4FF2 A;  1NMG A;  1DD2 A;  1YHQ A;  3CC4 A;  2SDF A;  3EJI A;  3MXN B;  3NWS A;  1E22 A;  1D1I A;  2E74 C;  2WAQ G;  1R9T B;  5CC4 A;  1PYB A;  4DR5 Q;  5M3F H;  4BA1 I;  1Y8N B;  1YNX A;  1CKM A;  3TRZ A;  2ENB A;  2XVS A;  2OXP A;  3CC7 A;  1HFG A;  3PQI A;  1PH6 A;  1Y69 U;  4CJ2 C;  4B3S L;  2DNC A;  1PH2 A;  1CZW A;  2VQE L;  1IHZ A;  5A35 A;  1GVP A;  1SYF A;  4G7O C;  1BR9 A;  1CK1 A;  3NQT A;  4KHZ A;  4F7X A;  4ZUJ A;  1SLJ A;  2JQO A;  2Q2H A;  2E5L L;  3I4O A;  4UY8 C;  1QVC A;  4CJ0 B;  3I73 A;  1XXG A;  4DV5 Q;  3PIO A;  2XN9 C;  4YCU A;  2I46 A;  4BXX H;  4RAU C;  3QJY A;  4LUV A;  2K01 A;  1LO5 D;  4K6L A;  5EKI A;  2BCO A;  4A3D H;  1J5E L;  3HOW H;  3PGZ A;  2EYJ A;  4WFN 3;  1PFM A;  2K5Q A;  1EEI D;  5I2X A;  3GV3 A;  2E2H B;  1L1O B;  1OXX K;  2A8V A;  4P71 A;  1JT8 A;  2Q8R E;  3VDY A;  2VB2 X;  3RZO B;  3MHB A;  1PMR A;  3H0G G;  2JP1 A;  2WII B;  5IYC G;  4DV2 Q;  4YWK A;  5F2D A;  5C4Z A;  2RSN A;  4K14 A;  1SNP A;  3ND9 A;  2ATW A;  4JOI A;  4LNQ A;  1TWG B;  2CH4 A;  2R93 H;  4G7H C;  2KCT A;  4NXN L;  1J9O A;  2B2V A;  5H1S E;  4CKB A;  2LXK A;  2OTJ A;  3QOJ A;  1Y8O B;  1PRT B;  1PFN A;  1JCK B;  2VQF Q;  4YWM A;  1YIT A;  1BBU A;  3E9H A;  3PF5 A;  1DON A;  1BBX C;  2K33 A;  1YI2 A;  1CA6 A;  1Q8K A;  3PUZ A;  3J80 i;  5M5W B;  4UPA A;  1Y1W G;  1PV4 A;  1LLR D;  4JI2 L;  2Z1C A;  4LF5 Q;  3VA7 A;  1N36 Q;  5HY6 A;  1FR3 A;  1YHB A;  3NBI A;  3Q24 A;  2JE6 I;  2PI2 A;  4MTN A;  4C3I G;  4Y52 H;  4X64 L;  3A55 A;  3S9W A;  5KGU A;  1T5X D;  3F2C A;  3R3O A;  3ZYY X;  1EFW A;  3M9B A;  3PUW A;  3NP8 A;  1PH7 A;  2G9D A;  4C3J B;  2R92 H;  5CV7 A;  3AU7 A;  3JAM c;  1WTQ A;  1I6H B;  2NN6 H;  4DAV A;  1A6X A;  1T5E A;  2B39 A;  1F2M A;  4AYB G;  1IL2 A;  4DR5 L;  3SGI A;  3TME A;  2CCZ A;  1H9J A;  2CWP A;  1HPC A;  3BZK A;  1MD2 D;  4TVA B;  3S1N H;  1TY0 A;  2OQ0 A;  1CKO A;  1AE3 A;  1PRT F;  4KV6 A;  5D14 A;  3EQL C;  2SEB D;  2PYK A;  4GOP C;  3VR6 A;  2EXD A;  2E76 C;  2KQ3 A;  3I4M B;  4JV5 Q;  3TP8 A;  1GUT A;  1D5Z C;  3ITP A;  2P5Z X;  1ESF A;  3FHW A;  2JJQ A;  2FJ2 A;  2KBN A;  2HT1 A;  3K5N A;  1K8O A;  2DGY A;  4DV5 L;  4DV1 Q;  2B2Y C;  4C2M B;  3SDZ A;  2OCE A;  1XNQ Q;  3CU7 A;  4A3K G;  2JA5 G;  3D31 A;  3PUY A;  3NK9 A;  2A68 D;  3RUZ A;  3TS0 A;  3K8A A;  1D1K A;  4B3R Q;  1YBY A;  1EZ6 A;  1VQP A;  1CZG A;  2A5H A;  3NEN A;  1KAW A;  1TS4 A;  4DV2 L;  5BR8 Q;  1MIU A;  1MJE A;  1EIF A;  1XYI A;  2JYO A;  1A2U A;  3RZD H;  4QUF A;  1EIY B;  4XTC S;  1I6V C;  1DOL A;  1XMO Q;  1I50 H;  1C7Y A;  1F9Q A;  1K83 B;  2VL6 A;  4MNO A;  4QL5 A;  2VQF L;  4HIK A;  1D5X C;  2R6G A;  1TY2 A;  1SNQ A;  4OGQ C;  1ONL A;  3J80 E;  2K5V A;  5C4X B;  2XSC A;  2EYF A;  3D4D A;  4WOR A;  3P1H A;  1V43 A;  2QGQ A;  1XPO A;  4LF5 L;  2NZO A;  1IBK Q;  4GN3 B;  3V05 A;  2IHF A;  1G6P A;  3A5U A;  1N36 L;  4FP5 D;  4BBS B;  4PZ6 A;  4R4Q A;  3S2D H;  1BBW A;  5I6W A;  1ZXT A;  1VCI A;  1UWV A;  1Y1V H;  1X3F A;  4Y7N H;  3F2B A;  1O80 A;  2IPK D;  4LFC Q;  2RDF A;  3L3O C;  5CGK A;  1EY7 A;  3SVM A;  4ME5 A;  1I3Q H;  3F1Z A;  5KRU A;  2NWG A;  5BN3 A;  4M1U B;  5C4J H;  1WTH A;  5EBD A;  3KK7 A;  5KYI A;  3C2P A;  4IUU A;  1EY8 A;  2C5C A;  1XMQ Q;  1Q46 A;  2HHH Q;  1K3R A;  5ELN A;  1M8A A;  3RMH A;  2R61 A;  4IUN A;  3MXP A;  2EVB A;  1IXR A;  1L0Y B;  4IUP A;  1E2W A;  1TWA B;  2K14 A;  1ET6 A;  1VQM A;  2A19 A;  2NVT H;  3CCL A;  5DM6 3;  1QZH A;  2B8F A;  3UDF A;  2ZXR A;  3W1B A;  4JV5 L;  5JAV A;  1TS5 A;  3NSW A;  4GOP A;  3GTP B;  1PA6 A;  4DV1 L;  4LMQ D;  4A93 H;  4JI1 Q;  1WOC A;  1STG A;  4H7B A;  5ELD A;  1HTL D;  2BE5 D;  3J7A 5;  2WAQ B;  4BY7 H;  2B2Y A;  3A7L A;  3J7A V;  2NB0 A;  5M3M H;  4ZRZ A;  1XTC D;  1EQV A;  3DLL A;  2N78 A;  4KTA A;  3TS2 A;  1E3P A;  1JE4 A;  1PZI D;  4A3B G;  4B3R L;  1CHP D;  3D8G A;  2DJG C;  1QNK A;  5E3F A;  3AFQ A;  3S1Q B;  1VF7 A;  2UUA Q;  1C0A A;  5BR8 L;  2K32 A;  4RMF A;  3L9A X;  2RDG A;  2F0V A;  3EFX D;  1VDZ A;  1E24 A;  1EWH A;  3PV0 A;  1GUW A;  4C3H G;  1TWH B;  4JYA Q;  4YCV A;  5IP9 G;  4DU9 A;  1EQR A;  1PH1 A;  1Q12 A;  3S16 B;  4J15 A;  4V0B A;  2F0K A;  2I5M X;  1HUM A;  1ICW A;  1TWG H;  2K5N A;  4QY7 A;  1B2T A;  2BDO A;  1YEZ A;  1NBW A;  3VR3 A;  1IBK L;  1WTP A;  2JSO A;  4RG1 A;  1DOK A;  1DXM A;  1PRT C;  2L11 A;  3M4P A;  4GZY C;  2K03 A;  4A3J G;  3NE5 B;  1B3Q A;  1NR2 A;  2AUJ D;  3HOZ G;  2SOB A;  2ZTC A;  3A8K E;  1S40 A;  2ID0 A;  1RL2 A;  4KHV A;  4OX9 Q;  4LFC L;  2DN8 A;  2NN6 I;  1YNN C;  1XTD A;  1G8Z D;  2K50 A;  3VR2 A;  2KHJ A;  4A3E B;  3U50 C;  3K59 A;  2IX0 A;  1KTK A;  1XMQ L;  5KNB A;  2HHH L;  1K0R A;  3HOV G;  3NPP A;  4UP7 A;  1XX8 A;  1SYB A;  3R8B A;  1KNE A;  1FGU A;  1HZA A;  1CSP A;  1WCM H;  3QO2 A;  1Y1W B;  3WOF A;  3J80 c;  4V19 0;  3UI2 A;  1KD1 C;  2AQ2 B;  2HDM A;  1Q81 C;  2Z6K C;  1V9P A;  1PH3 A;  3H3V C;  1SNC A;  1B9M A;  5D3D A;  4FNF A;  1B9N A;  4OXP A;  3TP6 A;  3S17 H;  3HP3 A;  2JK8 A;  4ZUI A;  4GNX B;  3FP9 A;  5LMN W;  4C56 C;  4C3I B;  3K6O A;  2PZU A;  1GUN A;  1LTT D;  3MXN A;  2LSS A;  4XYO A;  4RGN A;  2PQA A;  4EGV A;  2OF1 A;  4HN7 A;  3PO3 H;  1W3S A;  4DUZ L;  1KLG D;  4DK3 C;  2VXW A;  4JI1 L;  1TT2 A;  1TXY A;  4ME3 A;  1PTO H;  4AYB B;  5EQ0 A;  1HHV A;  2PNR C;  3T51 B;  1IBL Q;  5CYU A;  4HAE A;  2J0T D;  2A6H C;  2AHO B;  1SE2 A;  2FHT A;  4IUV A;  3HOY G;  1Z7T A;  2PPB C;  2JA7 G;  1Q1B A;  2UUA L;  2MO0 A;  2MPM A;  5E4W C;  2M2L A;  1GXD C;  1CQF A;  3ICE A;  3DEP A;  1VQI A;  3WWV A;  1HNW Q;  1EIG A;  3Q22 A;  1SYE A;  2BA0 A;  5J1Z A;  1I4G A;  5IP7 G;  4K0K Q;  4NP5 A;  1E2V A;  3MVV A;  1LYL A;  2XRQ D;  4OWX B;  4A3K B;  2JA5 B;  2LY7 A;  3A8I E;  2A6E C;  4P72 A;  3FVQ A;  1BUV T;  4ZAI A;  3MFG A;  4IAL A;  1GUG A;  2YU9 B;  2JEA I;  2JA8 H;  1F2Z A;  2XWJ B;  3JAM i;  1YIJ A;  5TSS A;  4GN4 B;  3CQZ B;  3GO5 A;  2WFW A;  4H0L C;  2IX3 A;  3C1E A;  5C4X H;  4P75 A;  5C44 G;  4JI6 L;  3K0Y A;  1QNU A;  4OX9 L;  1EY4 A;  4DV6 L;  1LM0 A;  1UE6 A;  4TKO B;  2BOS A;  1Y14 B;  1I5F A;  4BWG B;  4R4C A;  3FKI G;  5IE8 A;  4A3I G;  2A6E D;  3OW7 A;  3H15 A;  2FFK B;  3A0J A;  3E6Z X;  5IT9 E;  2HQE A;  5ELE A;  4DA2 A;  4A75 A;  1ENA A;  4OL7 A;  2TMP A;  2XTI A;  4APV A;  3CAM A;  5FLM H;  1LAC A;  2CW0 C;  1U0L A;  1RHP A;  1EYC A;  4A3L G;  1TR5 A;  3HGB A;  4GOP B;  4R8N A;  4IFD J;  1RKN A;  2ZXO A;  2Z6K A;  4FF4 A;  2L5T A;  1RF2 D;  4FVM A;  2B8G A;  5DEH A;  1LT6 D;  3EA6 A;  4PNY A;  4J1M A;  1JOK A;  3FEW X;  2AUK A;  4LF6 Q;  4RHR A;  3RLO A;  4KHP Q;  3S24 A;  4GLX A;  4DR3 Q;  2NYZ D;  4L5T A;  4DXF A;  3OIP A;  2VUM B;  1IBL L;  1U9R A;  3BJU A;  4B9W A;  1QIL A;  4IOA A;  3CF5 A;  1I4Q A;  1FJG L;  1QB5 D;  3WDN A;  3CCV A;  3BDL A;  1TS3 A;  5JEA J;  3PO2 G;  4QF4 A;  2O5I C;  1JWU D;  3U4Z A;  4ZLT F;  3BDC A;  2F0G A;  5IY0 A;  3OW2 A;  2E2J B;  1U4R A;  3BZC A;  4K6D A;  4DV0 Q;  1IBM L;  3LNN A;  1HNW L;  2K04 A;  2UUC Q;  4HED A;  3D6C A;  4NDX A;  3GTL B;  3H94 A;  3KJO A;  1S5F D;  1GJX A;  1HQR D;  2NVX H;  2PZT A;  4JOI C;  3OMG A;  1PYW D;  3X3N A;  4QIW E;  4A3M G;  1ESR A;  2EJG C;  5FOB B;  1TWH H;  1A62 A;  5FK9 C;  3JAM E;  4A3B B;  1DCZ A;  1ROD A;  2KHI A;  1XPR A;  3I2Z A;  3TDQ A;  2MNA A;  1V8Q A;  1BKB A;  3CP0 A;  2EYP A;  3DHQ A;  2RHS B;  1SFO B;  3PUX A;  4HJ7 A;  1I94 L;  1SRU A;  1SN8 A;  2BH8 A;  3OWF A;  1KAB A;  3KLR A;  1B53 A;  1QCB D;  3BZD B;  4P73 A;  1J6Q A;  3H0G H;  3T56 B;  3L7Z C;  3W2D A;  4C3H B;  3PSI A;  5HUR A;  1DZ1 A;  2PMZ E;  1PZK D;  1U5K A;  1KL9 A;  5IYC H;  5IYD G;  3ERS X;  3S1R H;  1PFB A;  1STA A;  4RGO S;  1ZKO A;  5GAH C;  1WTR A;  2CWA A;  2F0N A;  3A54 A;  3LWU A;  1TU2 B;  2LFN A;  1IZ6 A;  3K57 A;  2Z9H A;  3M3Y B;  1EWC A;  4ZKC B;  1R4Q B;  3QB3 A;  5E4X A;  3P7J A;  2D0P A;  2V4D A;  1RCV D;  4DR4 L;  4KY6 A;  4YWL A;  2RKS A;  4O2D A;  4WJ4 A;  3CKI B;  1CQV A;  4PG3 A;  4A3J B;  4KKU A;  5C4H A;  2KOL A;  3HOZ B;  2L12 A;  2PQA B;  1TQO A;  4LAA A;  3LX0 A;  5CR3 A;  3SK8 A;  3VYU A;  1Y1W H;  3NEM A;  3GV6 A;  3PUV A;  1HXY D;  1KDA A;  3GTO B;  1VMC A;  3S2H B;  1WI5 A;  5EKL A;  3MFY A;  4JI7 Q;  4KHP L;  3TBI B;  1GHJ A;  4J6H A;  1O7L A;  1VQD A;  3KFU A;  4CHT B;  5IT9 c;  3HOV B;  3K58 A;  4GNX C;  3HKZ E;  3JC6 6;  2F0P A;  2F4V Q;  4HSV A;  2EY2 A;  5EPK A;  1JE5 A;  2CQA A;  2BA1 A;  3S15 B;  1LT5 D;  1BF4 A;  1DJR D;  1A3T A;  3A56 A;  3M7N A;  5C5M A;  1RJT A;  3CCR A;  2JA6 G;  4OO1 H;  1OXU A;  2I5L X;  5C6A A;  4DR2 Q;  3AQQ A;  1QOH A;  2UUC L;  1EQQ A;  2UUB Q;  5C0X I;  3GTG B;  4DR1 Q;  5FJ8 G;  1A3U A;  2CH4 W;  2F52 A;  4X65 L;  1CSQ A;  4DF7 A;  4RGT A;  4PZ8 A;  4BS9 A;  2ZTE A;  3K0X A;  4CDD C;  4DR7 L;  3PIP 3;  3KJP A;  3HOY B;  2A1A A;  1KIX A;  1NAP A;  2VW9 A;  2JA7 B;  5M5X B;  4A3G G;  1BVS A;  4A3E G;  2EJM A;  3K81 C;  3KLS X;  1X3Q A;  2R7Z H;  1KHI A;  1V1Q A;  1Q8I A;  2QEJ C;  2IJ0 A;  2K75 A;  1LT4 D;  4IUR A;  1SAP A;  4R4I A;  2N55 A;  2NTS A;  3MWY W;  2L9H A;  2PQE A;  4DUY Q;  3URY A;  1NMF A;  3HOX H;  4QJF A;  2DUD A;  2KHS A;  3E9I A;  1STY A;  1VQE A;  3KF8 A;  4ALP A;  3GTK H;  2VZA A;  1PH9 A;  4C1N K;  3ULP A;  2E2I H;  5J39 A;  4N9P A;  4I7A A;  2QA4 A;  1X56 A;  4DAM A;  3T53 B;  5EGT A;  1K73 C;  5M3F G;  4MIU A;  3BU2 A;  4ZQ3 A;  1KXL A;  3ERQ A;  4RHS A;  4LFB Q;  1AN8 A;  4DNI A;  4DNT B;  2WB1 E;  2CFM A;  4AQY Q;  2CKZ B;  1EFI D;  1MSH A;  3GTJ B;  1CUK A;  3EBE A;  5C44 B;  2ZJP A;  1VQA A;  1RTN A;  5FO7 B;  1FNW A;  5DNF A;  3GTQ B;  1L0X B;  5J22 A;  4BBR H;  4ULL A;  3FKI B;  4A3I B;  1D7Q A;  1WTO A;  3I4N B;  5COR A;  4M8A A;  1MJC A;  2A68 C;  4LF4 Q;  1X6O A;  2KED A;  1N9W A;  2L1B A;  4BXX G;  1VQ8 A;  1AP0 A;  3MAQ A;  1TII D;  4A3D G;  5FLX E;  3HOW G;  1SE3 A;  3BS1 A;  2F4V L;  1O7I A;  3I55 A;  3HG9 A;  3RN5 A;  4GNX A;  2E2D C;  2A69 D;  1I4X A;  2HD3 A;  2EE1 A;  3DMU A;  1IKL A;  4H13 C;  1XPU A;  2ICE C;  3AYH B;  1FGB D;  3T1H Q;  1X65 A;  2WIN B;  5KND A;  1SYC A;  1TWF B;  2R7F A;  1T9H A;  4JI5 Q;  2Q8I B;  2QIL A;  3G7L A;  1O7Y A;  4HMJ A;  2R93 G;  5FKA C;  1WYD A;  2PO4 A;  5M5Y B;  1OTC A;  2ALY B;  2ZM6 Q;  4DK6 C;  2L0C A;  5ELC A;  1SEB D;  2AWO A;  4K5W A;  4JI3 Q;  5C3E H;  4JVZ A;  1K8A C;  3J80 L;  4GKK Q;  3NTI A;  3AFP A;  3A8J E;  2OTL A;  1S4Z A;  2SNS A;  1HQM C;  3FPU B;  5GAD C;  3PO2 B;  1CT1 D;  3NQI A;  1M1K C;  1SND A;  4P2C B;  4XYQ A;  1JJC B;  4JBK A;  3S14 B;  1TWC H;  1B1Z A;  4CGY B;  3TRE A;  4DAY A;  1YJN A;  4JI0 Q;  2Q2I A;  5A2Q E;  4DUY L;  1II3 A;  5I9O A;  4MZ9 A;  4EX5 A;  3DWP A;  5IIF A;  1PFS A;  2EPB A;  3CCQ A;  5CV4 A;  1GKH A;  2R92 G;  4X66 Q;  3HOU H;  4IUT A;  4A3M B;  2I07 B;  5DAU A;  1ZEQ X;  2NN6 G;  5CBA E;  2HQL A;  3IFD A;  4X3K A;  3I4L A;  4PMW A;  4ZCK A;  4LFB L;  3G48 A;  2MO1 A;  4R4T A;  5IYB H;  3GTM B;  4HJ9 A;  4UP9 A;  1EIH A;  3E0E A;  2VUM G;  2KCN A;  4DR6 Q;  1CA5 A;  4N8X 1;  1VMP A;  2BE5 C;  1Z9F A;  1UNS A;  1GUO A;  1R9T H;  1J8I A;  3HOZ H;  4LF4 L;  1VQH A;  1IKM A;  1NR4 A;  5E1F A;  4QUC A;  1EZ8 A;  2NZH A;  2WP8 J;  1GOZ A;  5DLQ E;  4A3F G;  4FF3 A;  2B3G A;  4OO1 I;  2X6G A;  1H9S A;  2YYZ A;  3NEL A;  1H9K A;  5K36 H;  1XNQ L;  5IGG A;  1BCP D;  3H6M A;  3T1H L;  2F0E A;  4HCE A;  2X6L A;  1K28 A;  1S3O A;  4JI5 L;  1E1O A;  1SMY D;  1ZYR C;  5JJZ A;  3G6J B;  4LW1 A;  3SEB A;  4A4I A;  2ZTD A;  2RHQ B;  2JEB I;  1UUP A;  2E2H H;  3I91 A;  4YIJ A;  4JI3 L;  1KDC A;  3C46 A;  3RZO H;  4GKK L;  1XMO L;  1LTR D;  5FLX c;  4DV7 Q;  4JCV E;  4F87 A;  2I0Q A;  4X62 Q;  3HEJ A;  4ID6 A;  1N32 Q;  2JA6 B;  4IFD H;  2EY6 A;  1L2F A;  1ZYR D;  5HGQ A;  2B63 B;  2G5D A;  3DWA A;  1HR0 W;  4G57 A;  1AFP A;  3EVQ A;  5GRO A;  4JI0 L;  3MEH A;  4LF8 Q;  3KF8 B;  2RF4 A;  3F2U A;  1SDF A;  2QF7 A;  1AEX A;  5I6Y A;  4ZYS A;  3HKZ G;  3U9O A;  1HH2 P;  1ML0 D;  3TQY A;  5I4D A;  4FDB A;  2K7V A;  2OQK A;  2F0S A;  4X66 L;  2DNE A;  3S1M B;  3KOJ A;  2JN4 A;  2G9H D;  1A0I A;  5M5W H;  2F0J A;  1VQL A;  3W3A A;  2UXC Q;  4A3G B;  2B2T C;  1WD1 A;  4QQB X;  1Q86 C;  2O4X A;  3G71 A;  5JEA H;  3OMC A;  3M4O B;  2LMC B;  2MJ8 A;  3BYT B;  2DY7 A;  3M4Y A;  1HNZ Q;  1MHW C;  4BY1 G;  5CBE E;  1A63 A;  1NY4 A;  1LTA D;  1V1O A;  1BDO A;  3T13 A;  2B29 A;  4C3J H;  4DV3 Q;  2GVB A;  2X69 A;  4JK1 C;  5CV5 A;  2WAC A;  3H3V H;  1I6H H;  1ENF A;  2NZ1 D;  2UU9 Q;  1KRS A;  3M85 A;  3QIA A;  4A76 A;  5IGF A;  4MN3 A;  4A93 G;  3FRP B;  4NKL A;  1G6Z A;  4FXK C;  4JC0 A;  4BY7 G;  2PI2 E;  1Z47 A;  5M3F B;  5GAE C;  2EYH A;  1MGS A;  2L55 A;  3NWT A;  3UDI A;  5M3M G;  1S5B D;  1B4O A;  1C48 A;  3ULL A;  2PZW A;  4CBV A;  3CCJ A;  2F03 A;  2NUC A;  3I4M H;  3QR8 A;  4XQN A;  4K5X A;  1BO0 A;  3KYH C;  3CW2 C;  3ULJ A;  2J4X A;  4RA8 A;  3BDO A;  3T16 A;  4C2M H;  1CTM A;  4GS3 A;  1C8C A;  4CKC A;  4UDU C;  4GKJ Q;  2TSS A;  1D8L A;  2KEE A;  1B50 A;  4Q5V A;  2EIF A;  5KEE A;  4B3M Q;  3ND8 A;  4FYD A;  3ER0 A;  4A3D B;  2K5H A;  3HOW B;  1AW7 A;  2WB1 G;  4JYA L;  4KD4 A;  3W5O A;  4QMG A;  1EQT A;  4DV7 L;  3TZD A;  1VQO A;  5I9P A;  3Q23 A;  1A2T A;  4X62 L;  1PYS B;  3DUZ A;  2K4K A;  4DAY B;  2L15 A;  1N32 L;  1L0W A;  5CMD A;  5ISR A;  3OYY A;  2RSO A;  2GVA A;  5EAY A;  4G4K A;  3D6W A;  4JI8 Q;  4LF8 L;  1K83 H;  1JR0 D;  2HIX A;  2XWB B;  2K5D A;  4LUZ A;  2R93 B;  1PTO D;  1STB A;  2F0Q A;  4B3T Q;  2D0O A;  3SK6 A;  3QG1 A;  2FMM A;  2O2L D;  4IO9 A;  4JBW A;  1FL0 A;  3OOC A;  1B7Y B;  1P16 A;  1ET9 A;  4I7Z C;  3ZJY C;  3K80 C;  4BBS H;  1DGS A;  2UXC L;  3I4N G;  4R9W A;  1A3V A;  1WCM G;  1UEB A;  3J81 i;  2B2T A;  1SR3 A;  4HTH A;  1HNZ L;  1VF5 C;  1W2B A;  1HR0 Q;  4R8I A;  5T1I A;  1K8M A;  2XNA C;  1HUN A;  1U4L A;  2B2W A;  1JJG A;  3TZU A;  1EEF D;  2RQX A;  2C35 B;  4DV3 L;  2MFI A;  2QKI C;  3UDG A;  4CDF C;  3NXW A;  4IQZ A;  4KK7 A;  1TVX A;  2UU9 L;  2KCC A;  4G7Z C;  4ABN A;  3C1F A;  3VA5 A;  2R92 B;  1KNA A;  1QJO A;  1H9S B;  5NUC A;  1CM9 A;  1PH4 A;  1UEA B;  2RCN A;  1X9N A;  4EQO A;  2JXM B;  1TWA H;  3J7Y W;  2KVM A;  4N8F A;  1GHK A;  2F0U A;  4GLA C;  4HR7 B;  3S1N B;  1SJH D;  4E6I A;  2QCP X;  1KAA A;  2F3I A;  5G3L F;  1JIC A;  5FO8 B;  3CCU A;  4WJ3 M;  4A3C H;  4KI0 A;  3GTP H;  3I70 A;  3CC2 A;  3CRL C;  4DXG A;  4LF7 Q;  2BH2 A;  1G2T A;  4LK1 C;  5EKK A;  5AJ3 Q;  4H02 A;  3QOL A;  3D0F A;  1GUS A;  4XT3 B;  3V2T A;  2VQE Q;  1VQN A;  4QIW B;  1EL0 A;  1QG7 A;  4GKJ L;  4PZ7 A;  3TP7 A;  4IPD A;  4OWT B;  1X3G A;  2Z4I A;  5LMN Q;  2EYO A;  3RN2 A;  4B3M L;  2EQS A;  1IL8 A;  4A3F B;  2K6A A; 
#chains in the Genus database with same CATH homology
 1GM5 A;  4EQ5 A;  1KHI A;  3OTO Q;  1B8A A;  1UE5 A;  1V1Q A;  3GD7 A;  5C0X G;  1I3Q H;  3S1Q H;  3F1Z A;  5LMU Q;  4R4I A;  2K75 A;  1LTL A;  4NXM L;  4K0K L;  2IHE A;  4DV4 L;  5C4J H;  4DUY Q;  1GO3 E;  1VQ9 A;  4A3L H;  1NMF A;  4IPG A;  3HOX H;  1XMQ Q;  1Q46 A;  4QJF A;  2HHH Q;  4LF9 Q;  2JA8 G;  2DUD A;  1K3R A;  4AIM A;  3E9I A;  2JA9 A;  3LGJ A;  1EOV A;  5ELN A;  1QVG A;  1VQE A;  3UE0 A;  4NPS A;  4JI8 L;  1EWI A;  4ALP A;  2VZA A;  3GTK H;  1PH9 A;  3G6E A;  3ULP A;  1IXR A;  2AWN A;  4JBJ A;  2E2I H;  1VQ6 A;  1TWF H;  4GLV B;  2FXQ A;  4IFD G;  3S16 H;  2K14 A;  2QA4 A;  1VQM A;  1X56 A;  1OXS C;  4DAM A;  2A19 A;  2NVT H;  1K73 C;  3CCL A;  5M3F G;  1VQ5 A;  1QZH A;  3AEV A;  1FJG Q;  3UDF A;  5M5Y H;  3W1B A;  1WJJ A;  4JV5 L;  3BU2 A;  1KXL A;  1VQ7 A;  2YV5 A;  4LFB Q;  2CQO A;  2PNH A;  4DNI A;  2WB1 E;  2CFM A;  4GOP A;  4AQY Q;  2CKZ B;  4YY3 Q;  2R7Z H;  1B70 B;  1Q7Y C;  4R4O A;  1H95 A;  1AE2 A;  3PIP A;  1PA6 A;  1HZ9 A;  4NXN Q;  1CUK A;  3EBE A;  1N33 L;  1IYJ B;  1VQA A;  2ZJP A;  4DV1 L;  5FLM G;  4A93 H;  4JI1 Q;  1WOC A;  1IBM Q;  4BBR H;  3CPF A;  3J7A 5;  4X6A H;  3PO2 H;  4BY7 H;  1D7Q A;  4AYB E;  1ASY A;  5E7N A;  3H3V I;  1GD7 A;  5JJK A;  4IJH A;  5M3M H;  3RNU A;  1L1O A;  1MJC A;  3DLL A;  2XGT A;  2N78 A;  4LF4 Q;  1X6O A;  3S14 H;  3GDE A;  3F2D A;  1N9W A;  4A3E H;  1E3P A;  3TS2 A;  1E7Z A;  5JEA G;  4A3B G;  3A5Z B;  1CKN A;  4TQU S;  4AH6 A;  3J81 j;  1VQ8 A;  4BXX G;  4B3R L;  1VQG A;  3AFQ A;  1OXT A;  4HJ5 A;  4A3D G;  3HOW G;  2F4V L;  1VS0 A;  2UUA Q;  1O7I A;  4YHH Q;  3I55 A;  4LWC A;  3CCM A;  3RN5 A;  4GNX A;  1C0A A;  5BR8 L;  4RMF A;  5ELO A;  1G51 A;  3G4S A;  2V1C C;  3PV0 A;  1E24 A;  4A3M H;  1XPU A;  3UE1 A;  3AYH B;  4LF6 L;  2K52 A;  1I94 Q;  4JYA Q;  2UXB Q;  4YCV A;  5IP9 G;  5IWA L;  1K8G A;  1EQR A;  1PH1 A;  3T1H Q;  1X65 A;  4DR3 L;  2Y0S E;  4L5Q A;  1PH8 A;  1Q12 A;  3U4V A;  1XNR Q;  2R7F A;  1T9H A;  4JI5 Q;  4J15 A;  4C3I H;  4L5S A;  2I5M X;  1MKH A;  1TWG H;  2K5N A;  4QY7 A;  4LF7 L;  3GTM H;  5C0X J;  1WYD A;  3PO3 G;  2R93 G;  4LFA Q;  1PHJ A;  1OTC A;  2ALY B;  3DM3 A;  1YEZ A;  2ZM6 Q;  3CME A;  1NBW A;  2UXD Q;  5AJ3 L;  4DK6 C;  1IBK L;  1EYG A;  2AWO A;  2ZJQ A;  1PVO A;  3I4M G;  4JI3 Q;  4RG1 A;  5C3E H;  1PH5 A;  3M4P A;  4IJL A;  1QVF A;  2Q2U A;  5IYD H;  1K8A C;  1HJP A;  4A3J G;  4GKK Q;  3AFP A;  5LMN L;  1N34 Q;  2OTL A;  1LUZ A;  3HOZ G;  1EUJ A;  1E1T A;  4DR4 Q;  2B63 G;  2ZTC A;  5GAD C;  4DV0 L;  1S40 A;  2ID0 A;  1RL2 A;  4OX9 Q;  1M1K C;  4LFC L;  2NN6 I;  4QGU A;  1XTD A;  3OTO L;  3B6Y A;  2K50 A;  1QZG A;  3F8T A;  5LMU L;  2KHJ A;  1JJC B;  2E8G A;  4JBK A;  1NTG A;  3HFZ B;  1TWC H;  3TRE A;  2IY5 B;  1VQK A;  3U50 C;  1YJN A;  2IX0 A;  2Q2I A;  4DUY L;  3HKS A;  4JI0 Q;  4XIG S;  4MZ9 A;  1YJ9 A;  4B3S Q;  1XMQ L;  4EX5 A;  2HHH L;  4LF9 L;  1C9O A;  1VQ4 A;  1PFS A;  1K0R A;  3CCQ A;  3HOV G;  4UP7 A;  3U58 A;  1SMX A;  1FGU A;  1GKH A;  1HZA A;  1HZC A;  1CSP A;  1WCM H;  3CXC A;  3J80 c;  1KD1 C;  1A8V A;  2R92 G;  4X66 Q;  3HOU H;  2HIV A;  1Q81 C;  2E5L Q;  2Z6K C;  1P8L A;  2NN6 G;  4IFD I;  1V9P A;  1PH3 A;  4A3K H;  2JA5 H;  2HQL A;  1XJV A;  4OXP A;  3S17 H;  1VQC A;  2JK8 A;  2ES2 A;  4GNX B;  3FP9 A;  5LMN W;  2R7D A;  4PMW A;  1WFQ A;  4LFB L;  3G48 A;  2MO1 A;  5JJL A;  4R4T A;  2LSS A;  5IYB H;  2YU9 H;  2PQA A;  4YY3 L;  4OON A;  3EN2 A;  4HJ9 A;  4UP9 A;  1J5E Q;  3PO3 H;  1W3S A;  2N3S A;  3CQZ H;  3E0E A;  4DUZ L;  2VUM G;  4DK3 C;  4YCW A;  4IPC A;  1NJI C;  4JI1 L;  4DR6 Q;  3UDX A;  1TXY A;  5C4X G;  4ME3 A;  1Z9F A;  4JG2 A;  2JA6 H;  1YVC A;  4B3T L;  1IBL Q;  4LUO A;  1KRT A;  1R9T H;  2IT1 A;  3HOZ H;  4BBS G;  4LF4 L;  2AHO B;  2AKW B;  2B63 H;  4X65 Q;  1VQH A;  1SRO A;  3HOY G;  3EIV A;  1YHA A;  3KLW A;  3PF4 A;  2NZH A;  2WP8 J;  2JA7 G;  4NB3 A;  5DLQ E;  1Q1B A;  3M4Q A;  4A3F G;  1N8R C;  4L5R C;  5FJ8 H;  2UUA L;  2MO0 A;  2B3G A;  4YHH L;  4DR7 Q;  4OO1 I;  2YYZ A;  3NEL A;  3ICE A;  1X3E A;  1FVI A;  1VQI A;  3WWV A;  4IPH A;  1HNW Q;  3KDF B;  1OXV A;  3HOU G;  3S1M H;  4DPG A;  2I5H A;  2BA0 A;  3CCE A;  1HR0 L;  1XNQ L;  2UXB L;  5IP7 G;  4JI7 L;  4K0K Q;  3T1H L;  3CPW A;  3J81 c;  1S3O A;  3PCO B;  4O0A A;  1XNR L;  4A3G H;  4P74 A;  1LYL A;  3J7Z C;  4JI5 L;  4OWX B;  1Q82 C;  3M4O H;  3CCS A;  1E1O A;  4JI2 Q;  1JMC A;  4LW1 A;  1M90 C;  2NVY H;  4P72 A;  1HZB A;  2OWO A;  2YTX A;  2Q2T A;  4A4I A;  3T1Y Q;  4LFA L;  4OO1 G;  1AH9 A;  1QUQ A;  2ZTD A;  2RHQ B;  2JEB I;  1VQB A;  2UXD L;  3STB C;  2E2H H;  1VQF A;  2JEA I;  1YJW A;  2JA8 H;  3KF6 B;  1X54 A;  4JI3 L;  3JAM i;  1YIJ A;  2H5X A;  4GN4 B;  3RLF A;  4X64 Q;  3GO5 A;  1G29 1;  2WFW A;  3RZO H;  4A3C G;  4GKK L;  2VUM H;  1N34 L;  1XMO L;  5FLX c;  4DV7 Q;  5C4X H;  4JCV E;  2I0Q A;  4P75 A;  4X62 Q;  5C44 G;  1NMG A;  4DR2 L;  4JI6 L;  1YHQ A;  3CC4 A;  4OX9 L;  4POF A;  1LM0 A;  1UE6 A;  4DV6 L;  1N32 Q;  4HIO A;  1Y14 B;  2UUB L;  3MXN B;  1E22 A;  1I5F A;  1L2F A;  2WAQ G;  4R4C A;  3FKI G;  5HGQ A;  5IE8 A;  4HJA A;  4DR1 L;  4A3I G;  1PYB A;  4DR5 Q;  5M3F H;  4BA1 I;  1YNX A;  1CKM A;  3H15 A;  1HR0 W;  3TRZ A;  3A0J A;  5GRO A;  3CC7 A;  1PH6 A;  2E2J H;  4JI0 L;  3STB D;  4JI4 Q;  4LF8 Q;  3KF8 B;  2YTY A;  4B3S L;  4A75 A;  2KCM A;  1PH2 A;  2RF4 A;  4A3F H;  2R7Z G;  2VQE L;  1GVP A;  3GTL H;  3HKZ G;  2XTI A;  4APV A;  1HH2 P;  3CAM A;  3TQY A;  5FLM H;  4BA2 I;  4FDB A;  2OQK A;  4KHZ A;  2IX1 A;  1U0L A;  4X66 L;  1SLJ A;  3KOJ A;  2JQO A;  2Q2H A;  2E5L L;  1A0I A;  4A3L G;  3I4O A;  3HOX G;  3TEH B;  5M5W H;  1QVC A;  3K7A H;  4UY8 C;  4GOP B;  1VQL A;  4IFD J;  4GN5 A;  2Z6K A;  2UXC Q;  3L0O A;  4DV5 Q;  4HIM A;  3PIO A;  2N8N A;  4YCU A;  3G71 A;  1Q86 C;  1ASZ A;  4QQB X;  4A3B H;  3NBH B;  4BXX H;  4LUV A;  4A3D H;  1HNZ Q;  1J5E L;  3HOW H;  2Z0S A;  3PGZ A;  4LF6 Q;  4BY1 G;  1SFO H;  3RLO A;  4KHP Q;  1A63 A;  1NY4 A;  3S24 A;  4GLX A;  1L1O B;  4DR3 Q;  1OXX K;  2N49 A;  2A8V A;  3CD6 A;  4P71 A;  2B29 A;  4C3J H;  4DV3 Q;  2GVB A;  1JT8 A;  3VDY A;  4L5T A;  3H3V H;  1I6H H;  1CKN B;  2UU9 Q;  1KRS A;  3H0G G;  1IBL L;  4C3H H;  1HNX Q;  5IP9 H;  3BJU A;  5IYC G;  4DV2 Q;  3M85 A;  4YWK A;  4IOA A;  3CF5 A;  3L2P A;  4A76 A;  1FJG L;  1QUQ B;  4A93 G;  3CCV A;  3K7U C;  1RIP A;  4JC0 A;  5GAG C;  4BBR G;  5JEA J;  3PO2 G;  2ATW A;  4JOI A;  4AQY L;  1JB7 A;  2PI2 E;  4LNQ A;  4BY7 G;  1Z47 A;  3M3Y H;  5GAE C;  2R93 H;  2KCT A;  4NXN L;  3UDI A;  3U4Z A;  5M3M G;  5H1S E;  5IY0 A;  3OW2 A;  3BZC A;  2LXK A;  3ULL A;  2OTJ A;  4DV0 Q;  3CCJ A;  1IBM L;  1HNW L;  2VQF Q;  2UUC Q;  3I4M H;  4YWM A;  3I56 A;  1YIT A;  4JBM A;  1BBU A;  3KYH C;  4A3J H;  3KJO A;  3CW2 C;  3E9H A;  3PF5 A;  4OWW B;  3ULJ A;  2NVX H;  4JOI C;  1YI2 A;  1Q8K A;  3PUZ A;  4C2M H;  3J80 i;  1PV4 A;  4UPA A;  1Y1W G;  4JI2 L;  4LF5 Q;  4GS3 A;  4QIW E;  4A3M G;  1N36 Q;  4GKJ Q;  3GTO H;  3S2H H;  3T1Y L;  1TWH H;  1D8L A;  1A62 A;  1NE3 A;  5HY6 A;  4DKA C;  2AMC B;  2EIF A;  2KHI A;  4B3M Q;  1XPR A;  1X55 A;  1YHB A;  3I2Z A;  2JE6 I;  3ER0 A;  2MNA A;  2PI2 A;  2K5H A;  2YTV A;  4MTN A;  3CMA A;  1BKB A;  4Y52 H;  4X64 L;  3CP0 A;  3HOV H;  2RHS B;  2MQH A;  2WB1 G;  4BY1 H;  3PUX A;  3F2C A;  4HJ7 A;  1SRU A;  1I94 L;  1EFW A;  4JYA L;  1SN8 A;  2BH8 A;  3M9B A;  3PUW A;  4UP8 A;  3W5O A;  4DV7 L;  1VQO A;  4NXM Q;  1PH7 A;  4X62 L;  3S15 H;  2R92 H;  1PYS B;  3JAM c;  4DV4 Q;  2K4K A;  4DAY B;  2L15 A;  1N32 L;  4P73 A;  1J6Q A;  1L0W A;  3H0G H;  3L7Z C;  3PSI A;  3OYY A;  2PMZ E;  5C3E G;  4AYB G;  1U5K A;  1KL9 A;  5IYC H;  5IYD G;  4DR5 L;  4DUZ Q;  2QEX A;  2GVA A;  3ERS X;  3SGI A;  1IL2 A;  5EAY A;  3S1R H;  2CCZ A;  5GAH C;  2CWP A;  2CWA A;  2ZM6 L;  4JI8 Q;  4JI4 L;  4LF8 L;  3BZK A;  3MEF A;  4TVA B;  1K83 H;  3S1N H;  2HIX A;  1IZ6 A;  2OQ0 A;  1CKO A;  3I7F A;  4LUZ A;  2VY3 A;  1AE3 A;  4B3T Q;  2D0O A;  5GQO A;  3Q8D A;  2D62 A;  2D0P A;  1S72 A;  3GTG H;  4GOP C;  4IO9 A;  1VQJ A;  4DR4 L;  4JBW A;  4YWL A;  2EXD A;  4O2D A;  4JV5 Q;  4WJ4 A;  1FL0 A;  1KQS A;  4PG3 A;  1B7Y B;  1P16 A;  3FHW A;  2JJQ A;  2KBN A;  2PQA B;  3ZJY C;  3K80 C;  4BBS H;  1DGS A;  2HT1 A;  2UXC L;  3I4N G;  1N33 Q;  2DGY A;  4DV5 L;  4DV1 Q;  3HOY H;  1WCM G;  1UEB A;  1Y1V G;  4IOC A;  3J81 i;  2Y0S G;  1Y1W H;  4KLK A;  5M5X H;  1L1O C;  2WAQ E;  3NEM A;  1YZ6 A;  2JA7 H;  3PUV A;  1SR3 A;  3IRB A;  3W1G A;  2OCE A;  2VS1 A;  1W2B A;  1HNZ L;  1HR0 Q;  3RR5 A;  4HID A;  1WI5 A;  1XNQ Q;  4A3K G;  2JA5 G;  3D31 A;  3PUY A;  4JI7 Q;  4KHP L;  1JJG A;  5J3B A;  1JJ2 A;  3TS0 A;  2C35 B;  4DV3 L;  2MFI A;  1VQD A;  3UDG A;  3KFU A;  3K8A A;  4B3R Q;  5IT9 c;  1YBY A;  3A74 A;  4GNX C;  3HKZ E;  1VQP A;  5IYB G;  2UU9 L;  5JJI A;  1HNX L;  3NEN A;  5IP7 H;  2LXJ A;  3JC6 6;  2F4V Q;  4R1J A;  1KAW A;  4DV2 L;  1JE5 A;  2BA1 A;  5BR8 Q;  1MIU A;  1MJE A;  1EIF A;  3RZD H;  1EIY B;  1PH4 A;  3M7N A;  2RCN A;  1X9N A;  4XTC S;  2GN5 A;  3CCR A;  2JA6 G;  1OXU A;  1TWA H;  2I5L X;  5IWA Q;  1XMO Q;  1I50 H;  1C7Y A;  3KDF A;  2VL6 A;  4GLA C;  4MNO A;  4DR2 Q;  4JI6 Q;  4DR6 L;  4QL5 A;  3AQQ A;  4DV6 Q;  2VQF L;  4HIK A;  2UUC L;  2F3I A;  4POG A;  2VNU D;  2ZJR A;  3RLN A;  1EQQ A;  2UUB Q;  3CCU A;  4WJ3 M;  4A3C H;  4KI0 A;  5C0X I;  3GTP H;  2R6G A;  4DR1 Q;  1K9M C;  3CC2 A;  5FJ8 G;  4LF7 Q;  2K5V A;  3GTJ H;  1SE8 A;  1UE7 A;  2F52 A;  5C44 H;  4X65 L;  2BH2 A;  1V43 A;  1CSQ A;  2QGQ A;  5AJ3 Q;  4H02 A;  1XPO A;  2ASB A;  3D0F A;  4PZ8 A;  4LF5 L;  2NZO A;  2ZTE A;  3K0X A;  4GN3 B;  1IBK Q;  1KC8 C;  2VQE Q;  1VQN A;  2IHF A;  3GTQ H;  3A5U A;  1N36 L;  3FKI H;  4A3I H;  1G6P A;  4PZ6 A;  4HJ8 A;  4GKJ L;  5K36 G;  4PZ7 A;  3I4N H;  2KEN A;  3KJP A;  4DR7 L;  4IPD A;  4OWT B;  1X3G A;  2A1A A;  4R4Q A;  5LMN Q;  1BBW A;  1KIX A;  1UE1 A;  3S2D H;  1VCI A;  1UWV A;  1Y1V H;  1X3F A;  2VW9 A;  3RN2 A;  4Y7N H;  2EQS A;  4B3M L;  3F2B A;  1BVS A;  3KF6 A;  2NVQ H;  4A3G G;  1Q1E A;  4A3E G;  3K81 C;  4LFC Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...