4A3DH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dH00
4P75A 3PF4A 2Q2HA 1YIJA 1XJVA 4LWCA 1Q7YC 1KD1C 2E2JH 3GTMH 3F8TA 3PIOA 1A8VA 1MKHA 4POFA 3AEVA 4JYAL 4JI8Q 2IY5B 1G51A 4YHHL 4JCVE 2AMCB 5JJLA 5JJIA 4QJFA 1WJJA 4LF4Q 4JI0Q 1NTGA 2LXKA 5M3MG 1HNWL 3HOYG 1J5EQ 4Y7NH 2GN5A 1PHJA 4A3CH 2F4VL 4IPDA 2IHFA 1R9TH 3HOXG 5EAYA 4JI1L 4JBMA 1B7YB 3F1ZA 1YHBA 1XTDA 3CCUA 3PUVA 3I4OA 1K8GA 2E8GA 5IT9c 1U0LA 1VQDA 1VQBA 1EFWA 4X66Q 5M3FG 1VQ4A 3CCJA 4BA2I 4OX9L 4GS3A 3S1QH 4YWLA 3STBC 4DR7Q 4YWMA 4GNXA 5C0XI 3STBD 4A3JG 1H95A 1N34L 3ICEA 3E0EA 1YJNA 4LF9L 1WCMG 5GAHC 2MO0A 3GTGH 1D7QA 1FL0A 1L1OC 1XPUA 1K8AC 1A62A 3UE1A 4GOPB 3KOJA 2AKWB 1G6PA 3WWVA 2VQFQ 4DUYL 3HOXH 3M4OH 4LF8L 1EWIA 4DPGA 3CC7A 3PV0A 2UUAL 4LF9Q 4DV6L 1VQNA 2YYZA 1XMOL 3RLNA 3UDXA 5JEAG 1XMQQ 1FJGL 1PH6A 5C4JH 2JEAI 3UDIA 4R4QA 1CKNA 2OCEA 4Y52H 4A3BH 3RN2A 1XNQL 2D62A 1GD7A 3KF6A 5C0XG 1JE5A 2BH8A 1VQPA 4P73A 4TVAB 4DR5Q 2WP8J 2ZTCA 2OQ0A 4DKAC 4L5RC 1I94L 4POGA 3RZDH 4JV5Q 1WOCA 1EYGA 3KDFB 1NMFA 1SLJA 3FHWA 2NVXH 3J81j 3G71A 1X56A 1VQ9A 3GTOH 3I4MH 3U4ZA 4BY7G 1MJCA 3RNUA 1HNXQ 3PUWA 4MNOA 5FJ8H 4A3JH 2Y0SE 4JC0A 2CFMA 2BH2A 3J81i 1UE5A 4TQUS 1EQRA 4QIWE 2YV5A 1E7ZA 4BY1H 3AFQA 5IE8A 1VS0A 2B3GA 2K5HA 3U58A 5IYDH 1N32Q 3PSIA 4XIGS 1M1KC 1C7YA 4A3KH 3GTPH 1Q82C 4DV2Q 1HNWQ 3M9BA 4BA1I 4A93G 1PH5A 4A3LH 4FDBA 1Y1WG 4LUOA 1L1OB 4HIDA 4HJAA 1GKHA 4PZ6A 3SGIA 2UXBQ 1B8AA 2JJQA 3M4QA 3RR5A 3KYHC 3G6EA 1XNQQ 3G48A 1PH4A 3I7FA 2K52A 1WI5A 2NZOA 3MEFA 4LFCL 1BVSA 1Z47A 2XGTA 3HKSA 4QGUA 4DV7Q 4DR5L 2NVQH 5M5WH 1X3FA 3NENA 4BXXH 2MO1A 5GQOA 2ZJQA 4WJ4A 4P71A 1PH7A 2B63G 3RLFA 3D31A 2YTXA 1TWHH 4DAYB 2KHIA 3IRBA 4JYAQ 1S3OA 3TEHB 4X64Q 4GNXC 3J7ZC 2N8NA 1OXTA 4LFCQ 2XTIA 1NJIC 1C0AA 3K7UC 4R4IA 2OQKA 2ATWA 1X54A 4PG3A 4DV4Q 5J3BA 3T1HQ 5M3FH 3HOUH 4IJLA 4DK6C 1OXVA 4DUZQ 3T1YL 3I4NH 4YWKA 1AE3A 4JI5L 2OTJA 1UWVA 2F52A 1SE8A 1NY4A 2VQFL 1N32L 5GADC 4LNQA 1YJ9A 2UU9L 4R4TA 5M5XH 1CSPA 1UEBA 1I5FA 4X62L 5LMUL 3HOZH 2EXDA 4A3MG 4DR7L 1WFQA 1N36L 2VNUD 5C3EH 1CUKA 1Z9FA 1N34Q 4X6AH 1OXUA 4X66L 4DUZL 2JA7H 3BU2A 2UXCQ 4IJHA 2K5VA 3CXCA 2KBNA 1IZ6A 4DR4L 3ERSX 4A3DG 2I5HA 2JA6G 1KIXA 4LFAQ 1N33L 1YZ6A 2YTVA 3VDYA 4P72A 1OXSC 4QL5A 1FGUA 1YI2A 1OTCA 3S1NH 2PNHA 4DV0Q 4A3EG 2I5LX 4QQBX 4JOIC 4HJ5A 1BBWA 2IX0A 3GTKH 3I56A 2QA4A 1IL2A 3BJUA 3KJOA 1XMOQ 1VQCA 2CWAA 2JA5G 2R7ZH 4K0KQ 1U5KA 2ZTEA 4DR2Q 1KL9A 2N49A 5LMNQ 1HZAA 1E1OA 4GKJL 2VUMG 4QY7A 1PH3A 5DLQE 1SMXA 4A4IA 1AE2A 2PQAB 1NBWA 1HNZQ 2DUDA 1Y1VG 1GO3E 1I3QH 1HZCA 1VQGA 3HKZG 2R92H 3I4NG 3NEMA 2VQEL 1EIFA 1NMGA 1Q8KA 2FXQA 4KLKA 4MZ9A 1BKBA 4ALPA 2R7DA 1HZ9A 3CAMA 4AIMA 1VQAA 4IO9A 2WB1E 2D0OA 2JA6H 1Q1BA 5C4XH 3UDGA 1KC8C 1V1QA 2NN6I 1HNZL 5ELOA 4DR3L 2E5LL 1IYJB 4OX9Q 2JA8G 3FKIH 2LSSA 4IPCA 1YHAA 3DM3A 4LUZA 4YY3Q 5FJ8G 1CKNB 5C0XJ 3CMEA 1PH9A 4A3CG 4GLVB 1IBMQ 2K50A 4GN3B 2JA5H 4BY7H 4GKJQ 3JC66 3HOYH 4A3IG 1JB7A 3ER0A 1XPOA 2A1AA 3CC4A 3CD6A 4JV5L 1WYDA 1PV4A 4KI0A 3CCEA 1X9NA 4JBKA 1E24A 4YY3L 4AYBG 2K4KA 4DV0L 4A3KG 2ZM6Q 2A19A 5IP9H 1VQ5A 3J80i 4KHPL 5IP9G 1O7IA 1YITA 4UP7A 3S24A 5AJ3L 3K80C 3S16H 4B3SQ 2QGQA 2BA0A 2ID0A 3OYYA 1HZBA 1ASYA 5IWAL 2UXDQ 2K75A 2MQHA 3S17H 5LMUQ 4DAMA 3M85A 3CPFA 3KJPA 4IFDI 4A3IH 1M90C 2E2IH 2V1CC 4LFBL 1PVOA 1XNRL 1L0WA 3BZCA 5M3MH 4DR3Q 2E5LQ 4OWWB 1KRSA 1VCIA 1Q12A 1X3EA 4DV4L 3T1HL 3JAMc 1PFSA 2B29A 3H3VH 4LW1A 2PI2E 3PGZA 3GO5A 3OTOQ 3T1YQ 5IYCG 1E1TA 4JI7L 2BA1A 1VQ6A 4LF6Q 2ASBA 3CP0A 4L5TA 5FLMG 5IWAQ 4NXMQ 1KXLA 4B3RQ 4ME3A 4DV7L 1ASZA 4LFBQ 2ZJPA 1UE1A 3EIVA 4A3BG 2L15A 3EBEA 2JQOA 3MXNB 1EUJA 2VL6A 4APVA 3HOVG 2NVTH 1AH9A 2NN6G 5AJ3Q 4DV1Q 3PF5A 3K0XA 2JA9A 4IPGA 1HR0Q 4B3TL 3S1MH 3HKZE 2ZM6L 4DV2L 3UDFA 4C3HH 5LMNL 2RF4A 1PH1A 2JA7G 2HT1A 4HIMA 4KHPQ 1HR0W 5HY6A 4B3SL 1VQFA 4GOPC 4A3MH 4DR4Q 1KRTA 1VQKA 1JJCB 1LUZA 1SN8A 2KCTA 1VQ8A 3RN5A 1N33Q 2JA8H 3GTLH 4JOIA 4IPHA 3TQYA 2Z6KA 4X65L 4DV5Q 2I0QA 5C4XG 5E7NA 3CCSA 4DR1Q 2EIFA 1WCMH 3AFPA 4C3JH 4KHZA 2RHQB 1HR0L 1KQSA 4B3TQ 2NZHA 3LGJA 2PMZE 1N36Q 2UUCL 4BBRH 3HOVH 4BY1G 5GAEC 3HOWG 1P8LA 4H02A 4R1JA 2F3IA 2WAQE 5JEAJ 2R92G 3RLOA 1LM0A 3A0JA 4LF6L 4C2MH 3KFUA 3H3VI 1JJGA 4B3RL 2A8VA 4X65Q 4DV5L 2R7ZG 4A3FH 2Z6KC 4R4OA 3RZOH 4JI5Q 4PMWA 1SROA 4AYBE 1VQIA 4MTNA 3GTQH 1K3RA 4JG2A 3HOZG 3CCVA 3KF8B 4GOPA 2YU9H 1XMQL 3W1BA 1T9HA 1PH8A 4PZ8A 5GAGC 2CKZB 4A3EH 4C3IH 1TXYA 2UUAQ 4OO1G 4HIOA 3CW2C 1IBKQ 4BBRG 1Q46A 2N78A 2WB1G 3H0GG 1YJWA 1L2FA 3EN2A 4DV3Q 4HJ9A 2MNAA 1X6OA 2YTYA 3UE0A 4WJ3M 4GN5A 5HGQA 1JMCA 5IP7G 1QVCA 3ZJYC 5FLMH 1L1OA 4BBSH 4UP9A 4A3GH 4YCUA 2KCMA 1Q86C 1XNRQ 1SRUA 1K0RA 3K81C 2VS1A 3AYHB 5M5YH 4A3FG 4NXNQ 3S14H 1J6QA 2VZAA 3J81c 3NELA 2UXCL 3A74A 3B6YA 5ELNA 3I2ZA 4B3MQ 3GDEA 1VQ7A 3PIPA 1VQOA 2Q2IA 3FP9A 4YHHQ 3CMAA 1Y1WH 1MJEA 3K8AA 3PO2H 4A93H 4L5SA 1LYLA 3PO3G 1V43A 1K9MC 1N9WA 1HNXL 1VQLA 4EX5A 4A3DH 4NXNL 5IYCH 4B3ML 1BBUA 1FVIA 4BXXG 2UU9Q 2RHSB 2Z0SA 1IBLL 1G291 1K73C 4O2DA 3A5UA 4JBWA 2Y0SG 5IYBH 1UE7A 1Q81C 4HJ7A 2HHHQ 1MIUA 4JI1Q 2CWPA 2JK8A 2PQAA 3E9HA 3KF6B 5C44H 4DV3L 4UY8C 4EQ5A 4JI2L 5JJKA 3J80c 4JI3L 1VQMA 1XPRA 2MFIA 2UXDL 3AQQA 4A3GG 2WAQG 3HOUG 3Q8DA 1IBKL 2HHHL 4BBSG 4XTCS 1A63A 1YVCA 4OO1I 1TWCH 4GKKQ 1YHQA 3W1GA 4JI2Q 2OTLA 1EIYB 2Q2TA 1FJGQ 1CKMA 4IOAA 1QZGA 1K83H 4RG1A 3M7NA 3PO2G 2LXJA 3OTOL 2GVAA 1PA6A 2EQSA 5GROA 3CCMA 3W5OA 4J15A 4LF8Q 1PYBA 5BR8L 4OWXB 1YBYA 4AQYQ 1QUQA 5LMNW 1KHIA 4NPSA 4JI6Q 3I4MG 3S2DH 2DGYA 1X3GA 3U50C 1YEZA 3PUXA 3S15H 1NE3A 1TWAH 3K7AH 2UUCQ 3CCQA 1E22A 3A5ZB 2JE6I 2KHJA 1SFOH 3BZKA 4YCVA 5IP7H 4IFDJ 2D0PA 3TS0A 3L7ZC 2K5NA 1C9OA 1X65A 3ULJA 4GNXB 5IYDG 3D0FA 3E9IA 3JAMi 3G4SA 2VW9A 1N8RC 4YCWA 3F2BA 2CQOA 2F4VQ 3HOWH 3S1RH 1JJ2A 4JI4L 2R93G 2R93H 1PH2A 4GLAC 4X64L 1Y1VH 4LF5Q 4JI8L 4R4CA 1GVPA 4GKKL 1DGSA 1CKOA 1EOVA 1LTLA 4P74A 2R6GA 2E2HH 2RCNA 3TRZA 4RMFA 4JBJA 1HH2P 1W3SA 3F2CA 3L2PA 4DV1L 1RL2A 3M4PA 2AWNA 2IT1A 2UUBQ 4JI3Q 3PUYA 4K0KL 4JI7Q 3H15A 1S72A 2VQEQ 4DUYQ 4JI6L 1CSQA 3OW2A 1QVFA 5IYBG 1IXRA 3KLWA 2QEXA 4LF5L 4LF7Q 3ULPA 1PYSB 2ZTDA 2HIVA 3I55A 3U4VA 3PCOB 4OWTB 2Q2UA 1SR3A 3CQZH 4DV6Q 1TWGH 1OXXK 1A0IA 2K14A 3NBHB 1W2BA 2R7FA 2HQLA 2UUBL 1EQQA 4HIKA 1QUQB 3ULLA 2NVYH 1UE6A 2IHEA 4UP8A 5H1SE 3CCRA 1KAWA 2WFWA 4A76A 4DR6L 3PO3H 4LF7L 5C3EG 2JEBI 4OONA 3L0OA 2I5MX 2AWOA 1V9PA 4JI4Q 4A75A 1P16A 4PZ7A 1D8LA 1HJPA 3CPWA 3TS2A 4DR2L 4O0AA 1Y14B 4DR1L 2CCZA 1B70B 4GN4B 4UPAA 4DNIA 2ALYB 3FKIG 4AH6A 1I94Q 1IBLQ 4L5QA 1IBML 1X55A 4OXPA 4LF4L 2KENA 1GM5A 5IY0A 2IX1A 3TREA 1VQHA 4LFAL 1VQEA 1E3PA 2B63H 4X62Q 1I50H 3H0GH 1QZHA 1JT8A 2VY3A 3CF5A 4JI0L 2C35B 2H5XA 3HFZB 1J5EL 3S2HH 4GLXA 1QVGA 2OWOA 1I6HH 3J7A5 2ES2A 5C44G 3KDFA 4NXML 4DR6Q 1Q1EA 1TWFH 2ZJRA 2VUMH 4DK3C 4LUVA 2UXBL 4HJ8A 1VQJA 3GD7A 5FLXc 4IOCA 2PI2A 2AHOB 2HIXA 3PUZA 1S40A 4A3LG 5K36G 3M3YH 4IFDG 5BR8Q 4AQYL 3CC2A 3CCLA 3F2DA 2GVBA 2N3SA 4NB3A 3GTJH 3DLLA 1RIPA 1YNXA
chains in the Genus database with same CATH superfamily
4P75A 2A6EC 4LWCA 1EQVA 1SNCA 5FLXE 3S17B 3AEVA 1LACA 1MKHA 4C1NI 3KLSX 4JI8Q 2IY5B 1G51A 4JCVE 1WJJA 3NWTA 3QJYA 4ZLTF 4LF4Q 1NTGA 2RKSA 1UUPA 1PHJA 3OOCA 4K5VA 2H4OA 5ELBA 4JBMA 2E74C 1YHBA 2HD3A 3IAYA 3EVQA 3I4OA 4RCNA 3CCJA 3M3YB 4GS3A 1EEID 2SNMA 2A5HA 3S1QH 4RGMA 1N34L 2F4IA 1YJNA 2LS01 1PTOC 3DM1A 4A3DB 1HQMC 3OHXC 3BVGA 1SYDA 4IURA 4GOPB 3KOJA 4K6DA 5C4ZA 1YNJC 2JSOA 4DPGA 5KYLA 3CC7A 2UUAL 3TMEA 4DV6L 2YYZA 4DNTB 3ZYYX 1XMOL 5JVG3 5JEAG 1EIHA 1K8OA 2JA7B 3V05A 3GP7A 1QNKA 3S2HB 2D62A 3KF6A 2L0CA 4P73A 4TVAB 2EY6A 3R93A 4DR5Q 1H9KA 3FRPB 3S1NB 1I94L 4JV5Q 3BYYB 3KDFB 3K58A 1NMFA 1STAA 5A2QL 1EY8A 1K8MA 3R3OA 5L37A 3I4MH 1ZXTA 3PUWA 3QB3A 5AFWA 1WD1A 1UAPA 1EQRA 1E7ZA 4BY1H 1VS0A 2B3GA 2K5HA 5M5XB 2WKDA 5IYDH 1N32Q 3TP7A 1FYCA 4NDXA 3ND9A 1B9MA 5C44B 1LV9A 4A93G 1PH5A 1ENFA 1L1OB 1WTRA 1HXYD 2JJQA 4AYBB 4IUTA 1PDQA 1XNQQ 4ZRZA 2NZOA 3MEFA 1BVSA 4DV7Q 2A69D 1X3FA 4BXXH 2MO1A 5C3XA 1HRJA 1GUGA 2ZJQA 4B9WA 3OMGA 4WJ4A 2B63G 3D31A 3IRBA 1H9MA 1S3OA 3U9SA 4XYOA 1SNQA 3E0JA 1PRTC 2X6LA 3EJIA 4UDUC 5EKIA 2F3WA 5DEHA 1C0AA 2XTIA 5E4XA 4A3IB 5KEEA 4R4IA 4PG3A 5CGKA 5J3BA 5G3LD 3I4NH 3T16A 2F52A 1GUTA 4RA8A 2VQFL 4G7OC 4PQXA 5M5XH 1UEBA 1T5EA 3I4LA 3HOZH 2EXDA 1WFQA 1N36L 1N34Q 1ZKOA 4DUZL 3BU2A 3CXCA 2KBNA 1IZ6A 3DHQA 3IFTA 2JA6G 1KIXA 1N33L 4DFAA 2I07B 3S1NH 2I46A 1WTPA 2I5LX 4MIUA 4QQBX 3VYRA 4U673 5CYUA 4IUQA 1CT1D 1IL2A 3BJUA 2JA5G 2PNRC 1TWCB 3KBXA 4J8QA 4OIJA 2G9HD 4F7XA 1Y1VG 4XXEA 2F0OA 4X3SA 2NZ1D 1QE6A 1I4RA 3I70A 1BKBA 3BYTB 4AIMA 2PPBC 1MGSA 1Q1BA 1F9QA 2NVXB 1LT4D 2E5LL 3FKIH 2MGSA 2LSSA 3IL8A 2BOSA 4M1UB 2K50A 1X32A 4EGVA 2CW0C 5FLXL 1OO9B 2EZVA 4N8X1 1BCPC 2B2WC 4KI0A 3VR4A 3CCEA 4JBKA 1A15A 2YU9B 1VQ5A 1EOTA 1STBA 1YITA 3ONAB 5AJ3L 1FR3A 1G91A 4B3SQ 1O80A 2ID0A 1HZBA 3GV6A 1D5ZC 2K75A 4RHRA 5ELEA 2H1EA 1ZYRC 4DR3Q 2WV6D 3D4DA 1X3EA 4NKLA 1PFSA 2X6GA 3PGZA 2R7ZG 3GO5A 3BVZA 2JP1A 5IWAQ 4B3RQ 1JOOA 2MUYA 4LFBQ 1I6HB 2NVTH 4L8JA 1CZGA 5T1IA 1NUCA 5AJ3Q 3PF5A 4EQPA 2QCPX 1HR0Q 5HGTA 2HT1A 3NWSA 1VQFA 2BDOA 1LUZA 4IPHA 2Z6KA 2VXWA 2EYPA 4CDCC 1SSOA 4B3TQ 2RHQB 2NZHA 3K5LA 2PMZE 2WINB 1SE3A 3HOVH 4QIWB 5HURA 5GAEC 1P8LA 3R2IA 4LF6L 4C2MH 1VF5C 4UHVA 4BBSB 4A3FH 2JYOA 2EE1A 5EPKA 3RZOH 2CVRA 2EYHA 4AYBE 1VQIA 1K3RA 4GOPA 2YU9H 2WACA 1JE4A 1TWAB 4C3IH 4IN3A 1BF4A 1SYFA 1EEFD 2XIWA 2LY7A 2NBFA 1TT2A 1X6OA 2YTYA 3HOXB 4BBSH 3CHBD 1CI3M 1JWMD 4I7AA 2C5CA 4C2MB 1Q86C 4A3GH 1XNRQ 2A6ED 1SRUA 1K0RA 3AYHB 3CKIB 3NELA 2UXCL 1TY0A 1VQ7A 1M4VA 3PIPA 4KKSA 1Y1WH 3PO2H 4A93H 3PO3G 1LYLA 3T53B 1N9WA 2F03A 1VQLA 4NXNL 1SNDA 1SMYD 3Q6SA 3TN2A 2AQ1B 1Y8NB 3A5UA 3BVMA 4JI1Q 2OXPA 5C44H 5EJWA 5G3LF 4EQ5A 1HTPA 2HUGA 4C3JB 5IIFA 4JI2L 5JJKA 4RKBA 2EPBA 2UXDL 5C4JB 3OMCA 3MHBA 1U4LA 1YVCA 5CMDA 2OTLA 1FJGQ 1QZGA 1K83H 3VR6A 2LXJA 3OTOL 4KHVA 5J1ZA 2EQSA 3CCMA 2JN4A 3RZDB 4OO1H 4LF8Q 2G9DA 4OWXB 3SK4A 1QUQA 3S2DH 2WIIB 2K05A 3U50C 3PUXA 3A8IE 2UUCQ 1SFOH 2KHJA 2V4DA 3T13A 3L7ZC 5KIXA 1TWFB 2DY8A 4H44C 4GNXB 5DAUA 3HOWH 5C5LA 1PH2A 3RZOB 4FF4A 4JI8L 2RCNA 4DGZA 4RMFA 3SDZA 1W3SA 3F2CA 2F0EA 1CZWA 1RL2A 4X3KA 3DXJC 3LWEA 4ULLA 4JI3Q 2EOTA 4K0KL 1F2MA 1Z7TA 1IXRA 3KLWA 5CBAE 4KMUC 2QEXA 5FOBB 1B53A 1PYSB 3I55A 1H9RA 1SR3A 3CQZH 1NSNS 1OXXK 4DA2A 1EQQA 1QUQB 3TSSA 1UE6A 4DR6L 4U68A 3PO3H 4LF7L 3VR5A 3D4RA 3VYTA 3N6RA 1XX8A 4JI4Q 4JW0A 1P16A 2B8GA 1HJPA 3BDOA 4O0AA 1DJRD 1Y14B 4DR1L 3NTKA 4ZK9B 4UPAA 3FKIG 5FK9C 1IW7D 3TZDA 1EY5A 3R2TA 2XWJB 1VQHA 4LFAL 2J0TD 1VMPA 1JWSD 4K8JA 4ZKCB 1JT8A 5KNBA 4JI0L 4Q5VA 2DNCA 4LAAA 3HFZB 1HPCA 1SJHD 1J5EL 4GLXA 4PV1C 4RCOA 3I4NB 1X3PA 4NXML 5I9OA 1TS5A 2UXBL 1ICFB 2RDHA 2PI2A 2AHOB 2HIXA 2CH4A 4IFDG 1RKNA 1ONLA 1EYAA 2N3SA 2X69A 4RKLA 2EYFA 2B2WA 1RIPA 2K04A 3A54A 1Q7YC 1XJVA 1KD1C 1EY4A 1TU2B 4ZCKA 4JYAL 1QOHA 2XVSA 4DN4M 1PZKD 4JI0Q 3C3LA 5M3MG 4BBRB 1J5EQ 2GN5A 4A3CH 4IPDA 4JPBW 2IHFA 2NUCA 2NYZD 1R9TH 2P5ZX 4DAPA 4JI1L 2EJGC 1B7YB 3F1ZA 1AFPA 2PO4A 3TP8A 3CCUA 1VQDA 3A7LA 1R9TB 4A3MB 4MTKA 4X66Q 4OX9L 1LABA 3VYSA 2RQXA 2JXMB 1CK1A 4YWLA 4DR7Q 2Z1CA 3STBD 2RCFA 1W6JA 4LF9L 2F0WA 1WCMG 1I6VC 2MO0A 1D7QA 2ICIA 1XPUA 1A62A 1ZYRD 3X3NA 1G6PA 3WWVA 2VQFQ 1WTOA 1I50B 1XXGA 4JVZA 2B63B 4LF8L 4XYQA 3PV0A 2QEJC 1HUMA 1CM9A 4NP5A 1SBBB 4KV6A 3E6ZX 2OT2A 1XMQQ 3NPPA 1PH6A 4LMQD 4DK0A 2L4NA 4R4QA 4CJ2C 4A3BH 1F77A 4KJOA 5KNCA 2ZTCA 4DKAC 1LTID 3J7YW 2EYJA 1WOCA 1QILA 1SLJA 3FHWA 1WTXA 5C4XB 3G71A 1VQ9A 3GTOH 4BY7G 3RUZA 1IKLA 1YNJD 5KGUA 4MNOA 4A3JH 2Y0SE 1BCPB 2B2TA 2CFMA 1UE5A 3J81i 3M4OB 1U4PA 5IE8A 1JORA 2HDLA 4L6TB 3PSIA 4IZ8A 4XIGS 1M1KC 3GTPH 4DV2Q 2FMCA 4G7ZC 4BA1I 1ESFA 4F8MA 4A3LH 1SE2A 4FDBA 3X3MA 3QO2A 4HIDA 3SK8A 1B8AA 1KDAA 3M4QA 1Y1VB 4HMIA 1WI5A 2M2LA 1WCMB 4QGUA 4DR5L 2NVQH 1A3TA 2NB0A 3R8BA 2M9VA 4ZAIA 1EY6A 5M5WH 4G7HC 4A3JB 3K5OA 5I2YA 1PZID 2LMCB 4P71A 1PH7A 3GTOB 3QIAA 3RLFA 4B9XA 2KHIA 1HTLD 1OXTA 1O7ZA 2RSNA 1NJIC 3GTKB 2EVBA 4KD4A 5LL6X 2FFKB 4DV4Q 2AUKA 4YWKA 2OTJA 1UWVA 1N32L 1SE8A 4KY6A 2RA4A 4R4TA 1ENAA 5JAVA 4DR7L 3DMUA 2VNUD 1STEA 1CUKA 1OXUA 2RBMA 2EYMA 2JA7H 1ILPA 1LT5D 2A68C 2RVLA 1BNZA 4A3DG 1GXDC 4RWSC 2YTVA 4RFBA 1FGUA 1OTCA 1G8ZD 1G2TA 2F0JA 4RAUC 4C3JG 1II3A 2F0KA 1XMOQ 5BN4A 2R7ZH 2ZTEA 2N49A 1HZAA 2HCCA 3N52A 4TSSA 1SMXA 1HA6A 2E75C 1TWGB 4K2LA 1EY0A 5KYIA 3NEMA 4XQQA 3C2PA 4MZ9A 1D1IA 2R7DA 1HZ9A 2RDGA 3CAMA 1VQAA 3TDQA 2D0OA 5IOCA 4IQZA 3P1HA 1KC8C 1HNZL 5ELOA 4OX9Q 5IGCA 4FXKC 2XRQD 5JPMC 2F0IA 1B3QA 1YHAA 3CMEA 5IGDA 3MAQA 4A3CG 4GLVB 2JA5H 3MVVA 2O5IC 3ER0A 2A1AA 2A73B 1PV4A 1O78A 4KK7A 1X9NA 4DV0L 4A3KG 2ZM6Q 2MPMA 1GUSA 2A19A 4H13C 5EBDA 5IP9G 2G5DA 1CHPD 3K80C 3S16H 2QGQA 2BA0A 3K0YA 1ASYA 5IWAL 2UXDQ 2MQHA 3HZXA 4QUCA 1RTOA 3M85A 1PVOA 5C5MA 3URYA 2E2IH 2V1CC 3BS1A 1XNRL 2E5LQ 1KRSA 4DV4L 3H3VH 3JAMc 2PI2E 3OTOQ 5IYCG 2BA1A 3CP0A 5FLMG 1VF7A 3FMCA 3SXHA 2ZJPA 1UE1A 2F0UA 3EIVA 4A3BG 3HOVG 1F2LA 2VL6A 1F9RA 1AH9A 3HOUB 4B3TL 5CBEE 4DV2L 5LMNL 2JA7G 1HR0W 3C1EA 4B3SL 4A3MH 4DR4Q 5EGTA 1JJCB 5CV6A 1SN8A 2JA8H 3GTMB 1SNPA 3GTLH 4JOIA 1KLUD 5CORA 3CCSA 3HOYB 3HGBA 1JR0D 4KHZA 2Y0SB 1KQSA 2K7VA 4DF7A 1CFMA 4BY1G 4K5XA 2XRSD 2NTTA 3HOWG 4R1JA 2Z9HA 2F3IA 3W2DA 2R61A 3A0JA 2HCIA 3ERQA 4LJZC 4B3RL 4A3KB 2A8VA 4X65Q 2NTSA 3I72A 4IFDH 1PTOF 1LTRD 1EZ8A 4PMWA 1SROA 1MD2D 1Y69U 1Y1WB 3HOZG 1ET6A 3CCVA 3KF8B 3ITPA 1QWYA 3H91A 5LHY1 5GAGC 5KNDA 4A3EH 3K7AB 4OO1G 3MXNA 1IBKQ 1TY2A 2WB1G 1B50A 1SDFA 1H9SB 1U4RA 2F0GA 3OIQA 1GHKA 2MNAA 4BY7B 4GN5A 2OF1A 1QVCA 3H0GB 3ZJYC 1L1OA 2KEDA 4A3BB 1RJTA 2GA4B 5M9OA 5M3FB 1WTWA 2XWBB 3H94A 5J22A 2K6AA 4A3FG 4NXNQ 4ABNA 4HTHA 1DXMA 1VQOA 3DUZA 4YHHQ 1MJEA 3K8AA 4CHTB 1V43A 3KLRA 1K9MC 3U9OA 5JVH3 1HNXL 3MXUA 5FO7B 3GTGB 3A8JE 5IYCH 4B3ML 1B1ZA 2TMPA 4F88A 1FVIA 3Q23A 1IBLL 1V8QA 2DJGC 4O2DA 1F2ZA 4JBWA 5IYBH 2HHHQ 1MIUA 1LT3D 2JK8A 3E9HA 1E2ZA 2B2UA 3KF6B 3TZUA 5I6WA 2B8FA 4IUUA 1VQMA 5CV9A 2AUJD 3AQQA 5IODA 2WAQG 2QKIC 2Z8LA 3PQIA 1G2SA 3MZ5A 3LWUA 3D6CA 4CDEC 5A2QE 5JJZA 4GKKQ 2Q2TA 4A3GB 1EIYB 3HKZB 5FO8B 2WB1B 1TQOA 4J15A 1SYCA 4AQYQ 5C3WA 1WTQA 5JOBA 4NPSA 2SOBA 2TSSA 1NE3A 3LX0A 1TWAH 4HR7B 4C3IB 2MHVA 4K5WA 5CV5A 2PCFB 4TKOB 1FGBD 3BZKA 3BDLA 2K5NA 3J7AF 1X65A 2KVMA 4LK1C 1L0YB 2E76C 3G4SA 2VW9A 3F2BA 2R93H 1JJ2A 4FO2A 4X64L 1FNUA 1EWHA 1GVPA 2D2CC 2E2HH 1HH2P 3M4PA 5JPNC 3MA2B 3NTHA 3M7GA 1S72A 4FYDA 4EVOA 1TS2A 4LF5L 1XTCD 3ULPA 4OWTB 1FD7D 1KABA 4DV6Q 1TWGH 1BXTA 4HN7A 5M3MB 2R7FA 2UUBL 1ET9A 1HHVA 5EPLA 2IHEA 1KAWA 2WFWA 2L55A 2F0QA 3OPOA 2AWOA 2A6HC 4A75A 1PFMA 4L63B 3CRKC 3CPWA 3PO2B 3TS2A 4DR2L 4X3UA 4GN4B 2ALYB 4L5QA 1IBML 1EWCA 4OXPA 1GM5A 2IX1A 1RHPA 1Q8IA 1XYIA 5J39A 2B63H 1I50H 3OSOA 1PRTD 1STYA 3CF5A 2A68D 3V2TA 1A2UA 3S2HH 2HDMA 4ODGA 5E1FA 1I6HH 3J7A5 2ES2A 3KDFA 4DR6Q 5EPJA 1TWFH 1ESRA 1I4HA 5D3DA 4DK3C 4IOCA 4DU9A 4AQYL 3CCLA 3F2DA 2GVBA 2B2YA 3HS0C 1YIJA 4V0BA 2NVQB 2E2JH 3K5MA 1PRTB 3I3CA 3PIOA 4POFA 3I73A 3A8KE 2VB3X 4YHHL 2AMCB 4KY5A 3QG1A 1MHWC 3QOLA 2LXKA 3HOYG 4XT1B 1AN8A 1ILQA 2F0MA 5EAYA 1DOLA 1R4PB 3MXGA 1Y8PB 4QCLA 1XTDA 2R3ZA 3CQZB 1MSHA 1HA5A 3PUVA 1WVLA 1K8GA 3I90A 3EA6A 1VQBA 1IL8A 1Q90A 1KAAA 1AZPA 2HQEA 3SR1A 3STBC 1EYDA 4YWMA 3HOZB 2J4XA 3QR8A 4GNXA 4KKTA 3PMFA 1BCPD 3E0EA 2C9OA 4FP5D 1DZ1A 1L1OC 3UE1A 3Q22A 4DUYL 3HOXH 4CKEA 2D5DA 3NHHA 3A56A 4KKUA 1VQNA 3MXPA 3RLNA 3UDXA 4CKCA 1FJGL 4OELB 5C4JH 5I9PA 4Y52H 3RN2A 5D14A 3QWNA 4O42A 3VA5A 2LFNA 1VQPA 4CDFC 3VR2A 3FPPA 3FKIB 4L5RC 1PLFA 3RZDH 2MP1A 5ISRA 1EYGA 2EJFC 2NVXH 3U4ZA 1A3VA 2IWHA 2ZXRA 4QB4A 4JC0A 1ENCA 3EQLC 2BH2A 1EFID 3EFXD 1AP0A 4QIWE 3AFQA 1MSGA 3F2UA 1Q82C 1I4QA 2BE5D 3NSWA 1HNWQ 2PQEA 1TIID 1BQQT 1Y1WG 3SGIA 2QDLA 2B39A 4DXGA 1PH4A 3I7FA 1B3AA 2NVTB 1AW7A 4C3HG 4WFN3 3HKSA 1J9OA 1G6ZA 1QJOA 1GJXA 2PYKA 4WORA 1DOKA 5ELDA 2YTXA 1TWHH 4WJWA 2EXZA 3TEHB 4CBVA 2XSCA 4X64Q 1EZ6A 3V96A 1LLRD 2N8NA 4LFCQ 2IJ0A 3K7UC 2OQKA 1X54A 1BOSA 3T1HQ 1NCVA 4A3FB 1EIGA 3Q0AA 4DUZQ 4DK6C 1OXVA 5JJLA 4I65A 1AE3A 2M00A 1SNOA 1PTOD 1YJ9A 1EU3A 1NAPA 5IGEA 1CSPA 2K33A 1I5FA 4EQNA 1CA6A 1IKMA 3MTSA 4A3MG 1Z9FA 4X6AH 5FO9B 3MWYW 4ID6A 1RF2D 3I4MB 1E0BA 2I5HA 4LFAQ 1YZ6A 4JK1C 3VDYA 1BUVT 4P72A 2E2DC 1OXSC 4QL5A 4FVMA 2BE5C 5LL6S 4JOIC 1RODA 4HJ5A 1J8IA 4OHJA 4K2KA 2QA4A 2VB2X 4K0KQ 1U5KA 4DR2Q 1HCZA 4GKJL 5LMNQ 1E1OA 3HOVB 3FPUB 1HNZQ 2A74C 1GO3E 1I3QH 1HZCA 1VQGA 3HKZG 1VMCA 2QDBA 3I4NG 4FNFA 2VQEL 1EIFA 1NMGA 1QCBD 2FXQA 4ALPA 5A35A 1TR5A 1PZJD 2Z6BA 4IO9A 3UDGA 4J1MA 4Y7NB 2JA8G 2K1BA 1B4OA 1BBXC 3DM3A 1WTHA 1CKNB 3MFYA 4ZUIA 3EROA 4GKJQ 3JC66 2PW7A 4N9PA 3CD6A 1PXUA 1WYDA 3S14B 3D4WA 5IGFA 1E24A 3MEHA 1GOZA 4YY3L 4AYBG 2K4KA 4BS9A 3BZDB 5DM63 5IP9H 3J80i 3S1MB 4KHPL 1PFNA 3S24A 4HMJA 2DJFC 5CR3A 2L12A 2PZUA 2EJMA 3OYYA 1IYVA 2BCOA 3S17H 5LMUQ 2E2JB 5KRUA 1CTMA 3CPFA 1E2VA 5ELFA 3KJPA 4A3IH 1M90C 1STGA 4IFDI 4RH6A 4LFBL 4PMCA 1L0WA 3BZCA 5M3MH 4OWWB 1VCIA 3T1HL 1NNXA 4FF2A 4JI7L 2QILA 1DM0B 1HFNA 5F2DA 1KXLA 4KJNA 3D6WA 3SE0A 3DWPA 3EBEA 3TP6A 4APVA 1EUJA 4C56C 3P20A 2NWGA 2NN6G 3K0XA 2JA9A 3P7JA 4IPGA 3S1MH 3HKZE 2ZM6L 3S1QB 3UDFA 4C3HH 1PH1A 3PO3B 3A55A 2N88A 3FEWX 1VDZA 2KHSA 5HY6A 1HUNA 4GOPC 4S3SA 5DM73 3BG3A 1VQKA 2ZXPA 1N33Q 3RN5A 2Q8TA 4BY1B 4X65L 2I0QA 3NQTA 1SXTA 5JEAJ 3PIO3 3H3VI 1JJGA 4TRDA 2LKVA 4DV5L 4BWGB 2EY1A 2R93B 1K3BC 1STNA 2Z6KC 4R4OA 4MTNA 3GTQH 4JG2A 4WRDA 1XMQL 3W1BA 1T9HA 4PZ8A 2CKZB 2EY2A 5EBCA 1TXYA 2UUAQ 4HIOA 3CW2C 4BBRG 4XQJA 1ML0D 4CJ1B 1BCPF 1DOMA 1YJWA 4HJ9A 4DV3Q 1EY9A 4O1NA 1JMCA 2ICEC 5IP7G 4K14A 1JOKA 2F0DA 3IKJA 2KCMA 1XWEA 4PMBA 2VS1A 5M5YH 2F0LA 2VZAA 3J81c 1PRTF 3B6YA 2NN6H 5ELNA 2EDGA 2Q2IA 3CMAA 3PIP3 4L5SA 3GQBA 4FXGC 4EX5A 2CW0D 4A3DH 4IUPA 1BBUA 2Z0SA 3VYUA 2KECA 1DONA 2JA6B 1UE7A 3L3OC 4HJ7A 2CWPA 2PQAA 2KA7A 2QF7A 4UY8C 3S1RB 2R92B 1R4QB 4KY7A 4JI3L 4DAYA 4A3GG 2KOLA 3H3VC 2A69C 3HOUG 1KNEA 4BBSG 4XTCS 1A63A 2AQ2B 1YHQA 4JI2Q 4M8AA 3NXWA 5K5PA 2KQ3A 2E2HB 1GHJA 3PO2G 5M5YB 2GVAA 4NMZA 1SEBD 2KJXA 5GROA 3W5OA 4C3IG 1PYBA 4OGQC 3I4MG 1EU4A 1KHIA 2K03A 5LMNW 4JI6Q 2DGYA 5C4HA 1YEZA 1A3UA 1QNUA 5D65A 3S15H 1JWUD 3K7AH 4ZQ3A 3G7LA 3A5ZB 2O2LD 5IP7H 2WKCA 4E6IA 2O5JC 4IFDJ 5IT9L 2BDNA 5E3FA 2F0NA 1C9OA 3ULJA 3AB9A 3D0FA 3P75A 3JAMi 2R93G 4YCWA 1JC7A 2CQOA 2F4VQ 2B2VA 3J80L 4GLAC 4LF5Q 4R4CA 4GKKL 1DGSA 4P74A 1EOVA 1LTLA 2F3VA 3L2PA 1F9SA 2AWNA 2IT1A 2UUBQ 4HCSA 4A3EB 2ZXOA 1U4MA 1T5XD 2IL8A 3JAME 3K57A 5C6AA 3J80E 4LF7Q 2HIVA 2JA5B 3SVMA 2XN9C 3E5SA 4FF1A 1A0IA 2K5DA 1W2BA 4H0LC 3MFGA 4MHEA 4HIKA 3ULLA 2NVYH 5H1SE 4UP8A 3CCRA 4A76A 3NBIA 1TVXA 1D6EC 3L0OA 2I5MX 2N55A 2QW7A 1V9PA 1TS3A 4P2CB 4OIKA 1LTTD 4PZ7A 5CV7A 3NP8A 2B2YC 2A6HD 3S16B 1D8LA 1LTAD 2ZT9C 4V190 4HAEA 2KCNA 1YNNC 1B70B 4DNIA 1IBLQ 1I94Q 1JQYD 3G6JB 4LF4L 2KENA 1FNWA 5E4WC 5IY0A 3TREA 2SNSA 1VQEA 1SJED 1E3PA 3DWQA 4X62Q 1A6XA 3H0GH 1QZHA 2C35B 3NE5B 2H5XA 5EKKA 4DXFA 3CRLC 3KF8A 3AU7A 2F0VA 2VUMH 1MI2A 4LUVA 1KDCA 4G57A 1V1PB 2FJ2A 1VQJA 1D1KA 1S40A 3PUZA 4A3LG 4HSPA 2MJ8A 3M3YH 3CC2A 2L9HA 4NB3A 3GTJH 1BDOA 3DLLA 1YNXA 3NQIA 3KBGA 3PF4A 2Q2HA 1V1PA 3GTMH 2JA8B 3F8TA 1A8VA 1UEAB 2Q8IB 5CV8A 1RCVD 4ZUJA 2DNEA 5JJIA 4QJFA 4FXDA 1HNWL 4KD3A 1PTOH 4Y7NH 2F4VL 4X3TA 3HOXG 5NUCA 2E8GA 5IT9c 4KTAA 1U0LA 4CKBA 2K32A 5M3FG 1VQ4A 1EFWA 1BR9A 4BA2I 2IX3A 2B2UC 2F0TA 3J81E 2F1MA 3KK7A 2Z4HA 5C0XI 1H95A 4A3JG 3ICEA 1LTGD 5GAHC 3GTGH 1FL0A 4ILWA 1K8AC 1H9JA 2AKWB 4OL7A 2DY7A 3M4OH 2CQAA 1EWIA 3J81L 1U9RA 1E2WA 2SDFA 4LF9Q 3VA7A 1EY7A 4RGNA 3UI2A 1D5MC 2JEAI 3UDIA 5CV4A 1S5CD 3K6OA 1CKNA 2OCEA 1XNQL 1GD7A 5C0XG 1JE5A 2KEEA 2BH8A 1BO0A 4QMGA 2WP8J 1S4ZA 2OQ0A 4EQOA 1Y8OB 1QB5D 4POGA 4KN7C 3J81j 1X56A 1SNMA 4IUVA 1MJCA 2K5WA 3C1FA 5DNFA 2EYLA 3RNUA 1HNXQ 5FJ8H 1TWHB 2K5QA 1S5ED 4PNYA 1ICWA 4TQUS 5EQ0A 2FHTA 2YV5A 3QOJA 2IW3A 3U58A 2EY5A 4ZYSA 1PFBA 2Z4IA 1SMYC 1C7YA 4A3KH 5FKAC 1WTVA 1DYQA 3M9BA 4LUOA 4HJAA 1GKHA 4PZ6A 4YIJA 1H9SA 1DD2A 2UXBQ 3RR5A 3KYHC 3G6EA 3G48A 2K52A 5I6YA 4A93B 1TS4A 4LFCL 1Z47A 2XGTA 2PW5A 1O7YA 1JB3A 3NENA 5GQOA 3FDTA 1F2YA 4B08A 1A2TA 3L9AX 4DAYB 4JYAQ 3RMHA 1W6KA 4GNXC 3J7ZC 1HQRD 1YNND 2E2IB 2ATWA 2B2VC 3HOUH 4HEDA 4RHSA 5M3FH 5JEAH 4IJLA 1AEXA 3T1YL 4QF4A 4JI5L 1NY4A 3I8ZA 1KTKA 3A7AB 5BN3A 5GADC 4LNQA 2UU9L 4X62L 5LMUL 1CQFA 2SEBD 3W3AA 4H7BA 5C3EH 4DNRB 5IT9E 4X66L 2UXCQ 4IJHA 2F0FA 2K5VA 4DR4L 3ERSX 1SYGA 1RTNA 4GZYC 3HEJA 3S2DB 1YI2A 2PNHA 4DV0Q 4A3EG 1JICA 3H6MA 1BBWA 2IX0A 4R8NA 3GTKH 3I56A 1PTOB 1LTSD 3KJOA 2L1BA 1VQCA 2CWAA 2WAQB 1KL9A 1SYBA 1S5BD 2VUMG 1UNSA 4QY7A 4RGOS 3JAML 5DLQE 4A4IA 3HRZC 1AE2A 2PQAB 1NBWA 1PH3A 3WOEA 2DUDA 1JCKB 5TSSA 5BN5A 4QUFA 2R92H 4KLKA 1Q8KA 4CJ0B 3T4AC 1D2BA 3OW7A 2JA6H 2WB1E 1CA5A 5C4XH 1V1QA 1EYCA 2F0HA 2NN6I 2Q8RE 4DR3L 4K8IA 1IYJB 4HCEA 4IPCA 4LUZA 3M4YA 4YY3Q 5FJ8G 5C0XJ 1PH9A 1F9PA 4R9WA 4BY7H 1IBMQ 2PZWA 2F0SA 4GN3B 1HFGA 3HOYH 4A3IG 1JB7A 3C46A 1XPOA 3CC4A 4JV5L 1WD0A 1KNAA 4MN3A 4K6LA 2L5TA 5C0XH 2ENBA 1O7IA 3NTIA 4UP7A 3DWAA 1S5DD 4N9TA 3HP3A 4Q0FA 5K36H 1EQTA 2B2TC 3WDNA 2CH4W 1FNVA 2K01A 4DAMA 3BDCA 1I4XA 1Q12A 4XT3B 2B29A 3SK5A 4LW1A 1VQ6A 3T1YQ 1E1TA 4LF6Q 3CU7A 2ASBA 4L5TA 4RGTA 4NXMQ 2VUMB 2FINB 4Z9CB 4ME3A 4DV7L 1ASZA 2L15A 3MXNB 2JQOA 3OIPA 1PYWD 5T1GA 4DV1Q 4CGYB 3K5NA 1CHQD 1LO5D 1IHZA 2RF4A 3IFDA 3O13A 4KHPQ 4HIMA 1MBYA 2KUMA 3TP5A 1Q3LA 1KRTA 5I4DA 3SHLA 4J6HA 2KCTA 1VQ8A 1C8CA 1CQVA 2O4XA 3TQYA 4DV5Q 1DCZA 5C4XG 5E7NA 4DR1Q 2EIFA 1WCMH 3AFPA 4C3JH 1HR0L 4G4KA 3LGJA 2KCCA 1N36Q 4FF3A 1SFOB 2UUCL 4BBRH 3D3RA 1SE4A 4H02A 2WAQE 2R92G 3RLOA 1LM0A 4OEMB 3KFUA 1L0XB 1NR2A 3GTPB 1C48A 1RD9D 3HOWB 1JOQA 3Q24A 1IW7C 1LT6D 4R8IA 4JI5Q 3H09A 4C1NK 1AZQA 1PH8A 1M8AA 2OEOA 3T51B 3E3XA 1GUWA 2FMMA 1Q46A 2N78A 5IGBA 3H0GG 2R7ZB 1I4GA 3FVQA 3LNNA 1L2FA 3EN2A 5ELCA 3J7AV 4WJ3M 3UE0A 5HGQA 1SAPA 5FLMH 3NUCA 2L11A 5COYA 4I7ZC 4UP9A 4YCUA 2NVYB 3K81C 3S14H 1STHA 3GV3A 1J6QA 3A74A 4HSVA 4B3MQ 3I2ZA 3GDEA 4ZKBB 3FP9A 3SK6A 3GTQB 1RDPD 3GTLB 3DEPA 5M5WB 2XNAC 3NBHA 5EKLA 4BXXG 2UU9Q 2RHSB 1G291 1K0SA 1K73C 2Y0SG 1Q81C 2J7ZA 4KN4C 1SYEA 2F0PA 4DV3L 3OWFA 4DAVA 3MC0B 3J80c 4XDXA 2MFIA 1XPRA 3KLSA 3Q8DA 1IBKL 2HHHL 1Z6HA 1NR4A 4OO1I 1TWCH 1KDBA 1K28A 3W1GA 1CKMA 5C3EB 4IOAA 4RG1A 5D3IB 3M7NA 1V1OA 1KLGD 1PA6A 4NW2A 2AQ3B 3AMUA 5BR8L 1YBYA 2RSOA 2CHBD 1GUOA 1X3GA 1B9NA 3CCQA 1PMRA 1O7LA 1E22A 2JE6I 4YCVA 1B44D 1X3QA 2D0PA 3TS0A 3S15B 1D5XC 5IYDG 4XQNA 3E9IA 1N8RC 2K28A 2D9UA 3RD4A 4IALA 3S1RH 4JI4L 1QG7A 1Y1VH 4C3HB 1CKOA 2R6GA 3TRZA 1K83B 4JBJA 3SEBA 4IUNA 4DV1L 3PUYA 4JI7Q 3H15A 2VQEQ 4DUYQ 4JI6L 1CSQA 3OW2A 5IGGA 5IYBG 1B2TA 2DN8A 2ZTDA 3U4VA 3PCOB 4ME5A 2Q2UA 3NK9A 3D8GA 2K14A 3NBHB 2HQLA 2PZTA 3TBIB 2EYOA 5CC4A 3ND8A 5C3EG 2JEBI 4OONA 1LTBD 3S9WA 1EL0A 3HG9A 3WOFA 1ZEQX 4N8FA 2CCZA 1IYUA 4AH6A 3I91A 1GUNA 1X55A 1C4QA 2RDFA 4F87A 2PMZB 2VY3A 3T56B 3VR3A 1I4PA 1QVGA 2OWOA 4DK1A 3OWEB 5C44G 1TKWB 1Q1EA 2ZJRA 3GTJB 5I2XA 4HJ8A 4CDDC 3GD7A 5FLXc 2IPKD 5K36G 5BR8Q 3K59A 3DEOA 3KUPA 1S5FD 4UAIA 1QVFA 1I3QB
chains in the Genus database with same CATH topology
4P75A 3PF4A 2Q2HA 1YIJA 1XJVA 4LWCA 1Q7YC 1KD1C 2E2JH 3GTMH 3F8TA 3PIOA 1A8VA 1MKHA 4POFA 3AEVA 4JYAL 4JI8Q 2IY5B 1G51A 4YHHL 4JCVE 2AMCB 5JJLA 5JJIA 4QJFA 1WJJA 4LF4Q 4JI0Q 1NTGA 2LXKA 5M3MG 1HNWL 3HOYG 1J5EQ 4Y7NH 2GN5A 1PHJA 4A3CH 2F4VL 4IPDA 2IHFA 1R9TH 3HOXG 5EAYA 4JI1L 4JBMA 1B7YB 3F1ZA 1YHBA 1XTDA 3CCUA 3PUVA 3I4OA 1K8GA 2E8GA 5IT9c 1U0LA 1VQDA 1VQBA 1EFWA 4X66Q 5M3FG 1VQ4A 3CCJA 4BA2I 4OX9L 4GS3A 3S1QH 4YWLA 3STBC 4DR7Q 4YWMA 4GNXA 5C0XI 3STBD 4A3JG 1H95A 1N34L 3ICEA 3E0EA 1YJNA 4LF9L 1WCMG 5GAHC 2MO0A 3GTGH 1D7QA 1FL0A 1L1OC 1XPUA 1K8AC 1A62A 3UE1A 4GOPB 3KOJA 2AKWB 1G6PA 3WWVA 2VQFQ 4DUYL 3HOXH 3M4OH 4LF8L 1EWIA 4DPGA 3CC7A 3PV0A 2UUAL 4LF9Q 4DV6L 1VQNA 2YYZA 1XMOL 3RLNA 3UDXA 5JEAG 1XMQQ 1FJGL 1PH6A 5C4JH 2JEAI 3UDIA 4R4QA 1CKNA 2OCEA 4Y52H 4A3BH 3RN2A 1XNQL 2D62A 1GD7A 3KF6A 5C0XG 1JE5A 2BH8A 1VQPA 4P73A 4TVAB 4DR5Q 2WP8J 2ZTCA 2OQ0A 4DKAC 4L5RC 1I94L 4POGA 3RZDH 4JV5Q 1WOCA 1EYGA 3KDFB 1NMFA 1SLJA 3FHWA 2NVXH 3J81j 3G71A 1X56A 1VQ9A 3GTOH 3I4MH 3U4ZA 4BY7G 1MJCA 3RNUA 1HNXQ 3PUWA 4MNOA 5FJ8H 4A3JH 2Y0SE 4JC0A 2CFMA 2BH2A 3J81i 1UE5A 4TQUS 1EQRA 4QIWE 2YV5A 1E7ZA 4BY1H 3AFQA 5IE8A 1VS0A 2B3GA 2K5HA 3U58A 5IYDH 1N32Q 3PSIA 4XIGS 1M1KC 1C7YA 4A3KH 3GTPH 1Q82C 4DV2Q 1HNWQ 3M9BA 4BA1I 4A93G 1PH5A 4A3LH 4FDBA 1Y1WG 4LUOA 1L1OB 4HIDA 4HJAA 1GKHA 4PZ6A 3SGIA 2UXBQ 1B8AA 2JJQA 3M4QA 3RR5A 3KYHC 3G6EA 1XNQQ 3G48A 1PH4A 3I7FA 2K52A 1WI5A 2NZOA 3MEFA 4LFCL 1BVSA 1Z47A 2XGTA 3HKSA 4QGUA 4DV7Q 4DR5L 2NVQH 5M5WH 1X3FA 3NENA 4BXXH 2MO1A 5GQOA 2ZJQA 4WJ4A 4P71A 1PH7A 2B63G 3RLFA 3D31A 2YTXA 1TWHH 4DAYB 2KHIA 3IRBA 4JYAQ 1S3OA 3TEHB 4X64Q 4GNXC 3J7ZC 2N8NA 1OXTA 4LFCQ 2XTIA 1NJIC 1C0AA 3K7UC 4R4IA 2OQKA 2ATWA 1X54A 4PG3A 4DV4Q 5J3BA 3T1HQ 5M3FH 3HOUH 4IJLA 4DK6C 1OXVA 4DUZQ 3T1YL 3I4NH 4YWKA 1AE3A 4JI5L 2OTJA 1UWVA 2F52A 1SE8A 1NY4A 2VQFL 1N32L 5GADC 4LNQA 1YJ9A 2UU9L 4R4TA 5M5XH 1CSPA 1UEBA 1I5FA 4X62L 5LMUL 3HOZH 2EXDA 4A3MG 4DR7L 1WFQA 1N36L 2VNUD 5C3EH 1CUKA 1Z9FA 1N34Q 4X6AH 1OXUA 4X66L 4DUZL 2JA7H 3BU2A 2UXCQ 4IJHA 2K5VA 3CXCA 2KBNA 1IZ6A 4DR4L 3ERSX 4A3DG 2I5HA 2JA6G 1KIXA 4LFAQ 1N33L 1YZ6A 2YTVA 3VDYA 4P72A 1OXSC 4QL5A 1FGUA 1YI2A 1OTCA 3S1NH 2PNHA 4DV0Q 4A3EG 2I5LX 4QQBX 4JOIC 4HJ5A 1BBWA 2IX0A 3GTKH 3I56A 2QA4A 1IL2A 3BJUA 3KJOA 1XMOQ 1VQCA 2CWAA 2JA5G 2R7ZH 4K0KQ 1U5KA 2ZTEA 4DR2Q 1KL9A 2N49A 5LMNQ 1HZAA 1E1OA 4GKJL 2VUMG 4QY7A 1PH3A 5DLQE 1SMXA 4A4IA 1AE2A 2PQAB 1NBWA 1HNZQ 2DUDA 1Y1VG 1GO3E 1I3QH 1HZCA 1VQGA 3HKZG 2R92H 3I4NG 3NEMA 2VQEL 1EIFA 1NMGA 1Q8KA 2FXQA 4KLKA 4MZ9A 1BKBA 4ALPA 2R7DA 1HZ9A 3CAMA 4AIMA 1VQAA 4IO9A 2WB1E 2D0OA 2JA6H 1Q1BA 5C4XH 3UDGA 1KC8C 1V1QA 2NN6I 1HNZL 5ELOA 4DR3L 2E5LL 1IYJB 4OX9Q 2JA8G 3FKIH 2LSSA 4IPCA 1YHAA 3DM3A 4LUZA 4YY3Q 5FJ8G 1CKNB 5C0XJ 3CMEA 1PH9A 4A3CG 4GLVB 1IBMQ 2K50A 4GN3B 2JA5H 4BY7H 4GKJQ 3JC66 3HOYH 4A3IG 1JB7A 3ER0A 1XPOA 2A1AA 3CC4A 3CD6A 4JV5L 1WYDA 1PV4A 4KI0A 3CCEA 1X9NA 4JBKA 1E24A 4YY3L 4AYBG 2K4KA 4DV0L 4A3KG 2ZM6Q 2A19A 5IP9H 1VQ5A 3J80i 4KHPL 5IP9G 1O7IA 1YITA 4UP7A 3S24A 5AJ3L 3K80C 3S16H 4B3SQ 2QGQA 2BA0A 2ID0A 3OYYA 1HZBA 1ASYA 5IWAL 2UXDQ 2K75A 2MQHA 3S17H 5LMUQ 4DAMA 3M85A 3CPFA 3KJPA 4IFDI 4A3IH 1M90C 2E2IH 2V1CC 4LFBL 1PVOA 1XNRL 1L0WA 3BZCA 5M3MH 4DR3Q 2E5LQ 4OWWB 1KRSA 1VCIA 1Q12A 1X3EA 4DV4L 3T1HL 3JAMc 1PFSA 2B29A 3H3VH 4LW1A 2PI2E 3PGZA 3GO5A 3OTOQ 3T1YQ 5IYCG 1E1TA 4JI7L 2BA1A 1VQ6A 4LF6Q 2ASBA 3CP0A 4L5TA 5FLMG 5IWAQ 4NXMQ 1KXLA 4B3RQ 4ME3A 4DV7L 1ASZA 4LFBQ 2ZJPA 1UE1A 3EIVA 4A3BG 2L15A 3EBEA 2JQOA 3MXNB 1EUJA 2VL6A 4APVA 3HOVG 2NVTH 1AH9A 2NN6G 5AJ3Q 4DV1Q 3PF5A 3K0XA 2JA9A 4IPGA 1HR0Q 4B3TL 3S1MH 3HKZE 2ZM6L 4DV2L 3UDFA 4C3HH 5LMNL 2RF4A 1PH1A 2JA7G 2HT1A 4HIMA 4KHPQ 1HR0W 5HY6A 4B3SL 1VQFA 4GOPC 4A3MH 4DR4Q 1KRTA 1VQKA 1JJCB 1LUZA 1SN8A 2KCTA 1VQ8A 3RN5A 1N33Q 2JA8H 3GTLH 4JOIA 4IPHA 3TQYA 2Z6KA 4X65L 4DV5Q 2I0QA 5C4XG 5E7NA 3CCSA 4DR1Q 2EIFA 1WCMH 3AFPA 4C3JH 4KHZA 2RHQB 1HR0L 1KQSA 4B3TQ 2NZHA 3LGJA 2PMZE 1N36Q 2UUCL 4BBRH 3HOVH 4BY1G 5GAEC 3HOWG 1P8LA 4H02A 4R1JA 2F3IA 2WAQE 5JEAJ 2R92G 3RLOA 1LM0A 3A0JA 4LF6L 4C2MH 3KFUA 3H3VI 1JJGA 4B3RL 2A8VA 4X65Q 4DV5L 2R7ZG 4A3FH 2Z6KC 4R4OA 3RZOH 4JI5Q 4PMWA 1SROA 4AYBE 1VQIA 4MTNA 3GTQH 1K3RA 4JG2A 3HOZG 3CCVA 3KF8B 4GOPA 2YU9H 1XMQL 3W1BA 1T9HA 1PH8A 4PZ8A 5GAGC 2CKZB 4A3EH 4C3IH 1TXYA 2UUAQ 4OO1G 4HIOA 3CW2C 1IBKQ 4BBRG 1Q46A 2N78A 2WB1G 3H0GG 1YJWA 1L2FA 3EN2A 4DV3Q 4HJ9A 2MNAA 1X6OA 2YTYA 3UE0A 4WJ3M 4GN5A 5HGQA 1JMCA 5IP7G 1QVCA 3ZJYC 5FLMH 1L1OA 4BBSH 4UP9A 4A3GH 4YCUA 2KCMA 1Q86C 1XNRQ 1SRUA 1K0RA 3K81C 2VS1A 3AYHB 5M5YH 4A3FG 4NXNQ 3S14H 1J6QA 2VZAA 3J81c 3NELA 2UXCL 3A74A 3B6YA 5ELNA 3I2ZA 4B3MQ 3GDEA 1VQ7A 3PIPA 1VQOA 2Q2IA 3FP9A 4YHHQ 3CMAA 1Y1WH 1MJEA 3K8AA 3PO2H 4A93H 4L5SA 1LYLA 3PO3G 1V43A 1K9MC 1N9WA 1HNXL 1VQLA 4EX5A 4A3DH 4NXNL 5IYCH 4B3ML 1BBUA 1FVIA 4BXXG 2UU9Q 2RHSB 2Z0SA 1IBLL 1G291 1K73C 4O2DA 3A5UA 4JBWA 2Y0SG 5IYBH 1UE7A 1Q81C 4HJ7A 2HHHQ 1MIUA 4JI1Q 2CWPA 2JK8A 2PQAA 3E9HA 3KF6B 5C44H 4DV3L 4UY8C 4EQ5A 4JI2L 5JJKA 3J80c 4JI3L 1VQMA 1XPRA 2MFIA 2UXDL 3AQQA 4A3GG 2WAQG 3HOUG 3Q8DA 1IBKL 2HHHL 4BBSG 4XTCS 1A63A 1YVCA 4OO1I 1TWCH 4GKKQ 1YHQA 3W1GA 4JI2Q 2OTLA 1EIYB 2Q2TA 1FJGQ 1CKMA 4IOAA 1QZGA 1K83H 4RG1A 3M7NA 3PO2G 2LXJA 3OTOL 2GVAA 1PA6A 2EQSA 5GROA 3CCMA 3W5OA 4J15A 4LF8Q 1PYBA 5BR8L 4OWXB 1YBYA 4AQYQ 1QUQA 5LMNW 1KHIA 4NPSA 4JI6Q 3I4MG 3S2DH 2DGYA 1X3GA 3U50C 1YEZA 3PUXA 3S15H 1NE3A 1TWAH 3K7AH 2UUCQ 3CCQA 1E22A 3A5ZB 2JE6I 2KHJA 1SFOH 3BZKA 4YCVA 5IP7H 4IFDJ 2D0PA 3TS0A 3L7ZC 2K5NA 1C9OA 1X65A 3ULJA 4GNXB 5IYDG 3D0FA 3E9IA 3JAMi 3G4SA 2VW9A 1N8RC 4YCWA 3F2BA 2CQOA 2F4VQ 3HOWH 3S1RH 1JJ2A 4JI4L 2R93G 2R93H 1PH2A 4GLAC 4X64L 1Y1VH 4LF5Q 4JI8L 4R4CA 1GVPA 4GKKL 1DGSA 1CKOA 1EOVA 1LTLA 4P74A 2R6GA 2E2HH 2RCNA 3TRZA 4RMFA 4JBJA 1HH2P 1W3SA 3F2CA 3L2PA 4DV1L 1RL2A 3M4PA 2AWNA 2IT1A 2UUBQ 4JI3Q 3PUYA 4K0KL 4JI7Q 3H15A 1S72A 2VQEQ 4DUYQ 4JI6L 1CSQA 3OW2A 1QVFA 5IYBG 1IXRA 3KLWA 2QEXA 4LF5L 4LF7Q 3ULPA 1PYSB 2ZTDA 2HIVA 3I55A 3U4VA 3PCOB 4OWTB 2Q2UA 1SR3A 3CQZH 4DV6Q 1TWGH 1OXXK 1A0IA 2K14A 3NBHB 1W2BA 2R7FA 2HQLA 2UUBL 1EQQA 4HIKA 1QUQB 3ULLA 2NVYH 1UE6A 2IHEA 4UP8A 5H1SE 3CCRA 1KAWA 2WFWA 4A76A 4DR6L 3PO3H 4LF7L 5C3EG 2JEBI 4OONA 3L0OA 2I5MX 2AWOA 1V9PA 4JI4Q 4A75A 1P16A 4PZ7A 1D8LA 1HJPA 3CPWA 3TS2A 4DR2L 4O0AA 1Y14B 4DR1L 2CCZA 1B70B 4GN4B 4UPAA 4DNIA 2ALYB 3FKIG 4AH6A 1I94Q 1IBLQ 4L5QA 1IBML 1X55A 4OXPA 4LF4L 2KENA 1GM5A 5IY0A 2IX1A 3TREA 1VQHA 4LFAL 1VQEA 1E3PA 2B63H 4X62Q 1I50H 3H0GH 1QZHA 1JT8A 2VY3A 3CF5A 4JI0L 2C35B 2H5XA 3HFZB 1J5EL 3S2HH 4GLXA 1QVGA 2OWOA 1I6HH 3J7A5 2ES2A 5C44G 3KDFA 4NXML 4DR6Q 1Q1EA 1TWFH 2ZJRA 2VUMH 4DK3C 4LUVA 2UXBL 4HJ8A 1VQJA 3GD7A 5FLXc 4IOCA 2PI2A 2AHOB 2HIXA 3PUZA 1S40A 4A3LG 5K36G 3M3YH 4IFDG 5BR8Q 4AQYL 3CC2A 3CCLA 3F2DA 2GVBA 2N3SA 4NB3A 3GTJH 3DLLA 1RIPA 1YNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  3PF4 A;  2Q2H A;  1YIJ A;  1XJV A;  4LWC A;  1Q7Y C;  1KD1 C;  2E2J H;  3GTM H;  3F8T A;  3PIO A;  1A8V A;  1MKH A;  4POF A;  3AEV A;  4JYA L;  4JI8 Q;  2IY5 B;  1G51 A;  4YHH L;  4JCV E;  2AMC B;  5JJL A;  5JJI A;  4QJF A;  1WJJ A;  4LF4 Q;  4JI0 Q;  1NTG A;  2LXK A;  5M3M G;  1HNW L;  3HOY G;  1J5E Q;  4Y7N H;  2GN5 A;  1PHJ A;  4A3C H;  2F4V L;  4IPD A;  2IHF A;  1R9T H;  3HOX G;  5EAY A;  4JI1 L;  4JBM A;  1B7Y B;  3F1Z A;  1YHB A;  1XTD A;  3CCU A;  3PUV A;  3I4O A;  1K8G A;  2E8G A;  5IT9 c;  1U0L A;  1VQD A;  1VQB A;  1EFW A;  4X66 Q;  5M3F G;  1VQ4 A;  3CCJ A;  4BA2 I;  4OX9 L;  4GS3 A;  3S1Q H;  4YWL A;  3STB C;  4DR7 Q;  4YWM A;  4GNX A;  5C0X I;  3STB D;  4A3J G;  1H95 A;  1N34 L;  3ICE A;  3E0E A;  1YJN A;  4LF9 L;  1WCM G;  5GAH C;  2MO0 A;  3GTG H;  1D7Q A;  1FL0 A;  1L1O C;  1XPU A;  1K8A C;  1A62 A;  3UE1 A;  4GOP B;  3KOJ A;  2AKW B;  1G6P A;  3WWV A;  2VQF Q;  4DUY L;  3HOX H;  3M4O H;  4LF8 L;  1EWI A;  4DPG A;  3CC7 A;  3PV0 A;  2UUA L;  4LF9 Q;  4DV6 L;  1VQN A;  2YYZ A;  1XMO L;  3RLN A;  3UDX A;  5JEA G;  1XMQ Q;  1FJG L;  1PH6 A;  5C4J H;  2JEA I;  3UDI A;  4R4Q A;  1CKN A;  2OCE A;  4Y52 H;  4A3B H;  3RN2 A;  1XNQ L;  2D62 A;  1GD7 A;  3KF6 A;  5C0X G;  1JE5 A;  2BH8 A;  1VQP A;  4P73 A;  4TVA B;  4DR5 Q;  2WP8 J;  2ZTC A;  2OQ0 A;  4DKA C;  4L5R C;  1I94 L;  4POG A;  3RZD H;  4JV5 Q;  1WOC A;  1EYG A;  3KDF B;  1NMF A;  1SLJ A;  3FHW A;  2NVX H;  3J81 j;  3G71 A;  1X56 A;  1VQ9 A;  3GTO H;  3I4M H;  3U4Z A;  4BY7 G;  1MJC A;  3RNU A;  1HNX Q;  3PUW A;  4MNO A;  5FJ8 H;  4A3J H;  2Y0S E;  4JC0 A;  2CFM A;  2BH2 A;  3J81 i;  1UE5 A;  4TQU S;  1EQR A;  4QIW E;  2YV5 A;  1E7Z A;  4BY1 H;  3AFQ A;  5IE8 A;  1VS0 A;  2B3G A;  2K5H A;  3U58 A;  5IYD H;  1N32 Q;  3PSI A;  4XIG S;  1M1K C;  1C7Y A;  4A3K H;  3GTP H;  1Q82 C;  4DV2 Q;  1HNW Q;  3M9B A;  4BA1 I;  4A93 G;  1PH5 A;  4A3L H;  4FDB A;  1Y1W G;  4LUO A;  1L1O B;  4HID A;  4HJA A;  1GKH A;  4PZ6 A;  3SGI A;  2UXB Q;  1B8A A;  2JJQ A;  3M4Q A;  3RR5 A;  3KYH C;  3G6E A;  1XNQ Q;  3G48 A;  1PH4 A;  3I7F A;  2K52 A;  1WI5 A;  2NZO A;  3MEF A;  4LFC L;  1BVS A;  1Z47 A;  2XGT A;  3HKS A;  4QGU A;  4DV7 Q;  4DR5 L;  2NVQ H;  5M5W H;  1X3F A;  3NEN A;  4BXX H;  2MO1 A;  5GQO A;  2ZJQ A;  4WJ4 A;  4P71 A;  1PH7 A;  2B63 G;  3RLF A;  3D31 A;  2YTX A;  1TWH H;  4DAY B;  2KHI A;  3IRB A;  4JYA Q;  1S3O A;  3TEH B;  4X64 Q;  4GNX C;  3J7Z C;  2N8N A;  1OXT A;  4LFC Q;  2XTI A;  1NJI C;  1C0A A;  3K7U C;  4R4I A;  2OQK A;  2ATW A;  1X54 A;  4PG3 A;  4DV4 Q;  5J3B A;  3T1H Q;  5M3F H;  3HOU H;  4IJL A;  4DK6 C;  1OXV A;  4DUZ Q;  3T1Y L;  3I4N H;  4YWK A;  1AE3 A;  4JI5 L;  2OTJ A;  1UWV A;  2F52 A;  1SE8 A;  1NY4 A;  2VQF L;  1N32 L;  5GAD C;  4LNQ A;  1YJ9 A;  2UU9 L;  4R4T A;  5M5X H;  1CSP A;  1UEB A;  1I5F A;  4X62 L;  5LMU L;  3HOZ H;  2EXD A;  4A3M G;  4DR7 L;  1WFQ A;  1N36 L;  2VNU D;  5C3E H;  1CUK A;  1Z9F A;  1N34 Q;  4X6A H;  1OXU A;  4X66 L;  4DUZ L;  2JA7 H;  3BU2 A;  2UXC Q;  4IJH A;  2K5V A;  3CXC A;  2KBN A;  1IZ6 A;  4DR4 L;  3ERS X;  4A3D G;  2I5H A;  2JA6 G;  1KIX A;  4LFA Q;  1N33 L;  1YZ6 A;  2YTV A;  3VDY A;  4P72 A;  1OXS C;  4QL5 A;  1FGU A;  1YI2 A;  1OTC A;  3S1N H;  2PNH A;  4DV0 Q;  4A3E G;  2I5L X;  4QQB X;  4JOI C;  4HJ5 A;  1BBW A;  2IX0 A;  3GTK H;  3I56 A;  2QA4 A;  1IL2 A;  3BJU A;  3KJO A;  1XMO Q;  1VQC A;  2CWA A;  2JA5 G;  2R7Z H;  4K0K Q;  1U5K A;  2ZTE A;  4DR2 Q;  1KL9 A;  2N49 A;  5LMN Q;  1HZA A;  1E1O A;  4GKJ L;  2VUM G;  4QY7 A;  1PH3 A;  5DLQ E;  1SMX A;  4A4I A;  1AE2 A;  2PQA B;  1NBW A;  1HNZ Q;  2DUD A;  1Y1V G;  1GO3 E;  1I3Q H;  1HZC A;  1VQG A;  3HKZ G;  2R92 H;  3I4N G;  3NEM A;  2VQE L;  1EIF A;  1NMG A;  1Q8K A;  2FXQ A;  4KLK A;  4MZ9 A;  1BKB A;  4ALP A;  2R7D A;  1HZ9 A;  3CAM A;  4AIM A;  1VQA A;  4IO9 A;  2WB1 E;  2D0O A;  2JA6 H;  1Q1B A;  5C4X H;  3UDG A;  1KC8 C;  1V1Q A;  2NN6 I;  1HNZ L;  5ELO A;  4DR3 L;  2E5L L;  1IYJ B;  4OX9 Q;  2JA8 G;  3FKI H;  2LSS A;  4IPC A;  1YHA A;  3DM3 A;  4LUZ A;  4YY3 Q;  5FJ8 G;  1CKN B;  5C0X J;  3CME A;  1PH9 A;  4A3C G;  4GLV B;  1IBM Q;  2K50 A;  4GN3 B;  2JA5 H;  4BY7 H;  4GKJ Q;  3JC6 6;  3HOY H;  4A3I G;  1JB7 A;  3ER0 A;  1XPO A;  2A1A A;  3CC4 A;  3CD6 A;  4JV5 L;  1WYD A;  1PV4 A;  4KI0 A;  3CCE A;  1X9N A;  4JBK A;  1E24 A;  4YY3 L;  4AYB G;  2K4K A;  4DV0 L;  4A3K G;  2ZM6 Q;  2A19 A;  5IP9 H;  1VQ5 A;  3J80 i;  4KHP L;  5IP9 G;  1O7I A;  1YIT A;  4UP7 A;  3S24 A;  5AJ3 L;  3K80 C;  3S16 H;  4B3S Q;  2QGQ A;  2BA0 A;  2ID0 A;  3OYY A;  1HZB A;  1ASY A;  5IWA L;  2UXD Q;  2K75 A;  2MQH A;  3S17 H;  5LMU Q;  4DAM A;  3M85 A;  3CPF A;  3KJP A;  4IFD I;  4A3I H;  1M90 C;  2E2I H;  2V1C C;  4LFB L;  1PVO A;  1XNR L;  1L0W A;  3BZC A;  5M3M H;  4DR3 Q;  2E5L Q;  4OWW B;  1KRS A;  1VCI A;  1Q12 A;  1X3E A;  4DV4 L;  3T1H L;  3JAM c;  1PFS A;  2B29 A;  3H3V H;  4LW1 A;  2PI2 E;  3PGZ A;  3GO5 A;  3OTO Q;  3T1Y Q;  5IYC G;  1E1T A;  4JI7 L;  2BA1 A;  1VQ6 A;  4LF6 Q;  2ASB A;  3CP0 A;  4L5T A;  5FLM G;  5IWA Q;  4NXM Q;  1KXL A;  4B3R Q;  4ME3 A;  4DV7 L;  1ASZ A;  4LFB Q;  2ZJP A;  1UE1 A;  3EIV A;  4A3B G;  2L15 A;  3EBE A;  2JQO A;  3MXN B;  1EUJ A;  2VL6 A;  4APV A;  3HOV G;  2NVT H;  1AH9 A;  2NN6 G;  5AJ3 Q;  4DV1 Q;  3PF5 A;  3K0X A;  2JA9 A;  4IPG A;  1HR0 Q;  4B3T L;  3S1M H;  3HKZ E;  2ZM6 L;  4DV2 L;  3UDF A;  4C3H H;  5LMN L;  2RF4 A;  1PH1 A;  2JA7 G;  2HT1 A;  4HIM A;  4KHP Q;  1HR0 W;  5HY6 A;  4B3S L;  1VQF A;  4GOP C;  4A3M H;  4DR4 Q;  1KRT A;  1VQK A;  1JJC B;  1LUZ A;  1SN8 A;  2KCT A;  1VQ8 A;  3RN5 A;  1N33 Q;  2JA8 H;  3GTL H;  4JOI A;  4IPH A;  3TQY A;  2Z6K A;  4X65 L;  4DV5 Q;  2I0Q A;  5C4X G;  5E7N A;  3CCS A;  4DR1 Q;  2EIF A;  1WCM H;  3AFP A;  4C3J H;  4KHZ A;  2RHQ B;  1HR0 L;  1KQS A;  4B3T Q;  2NZH A;  3LGJ A;  2PMZ E;  1N36 Q;  2UUC L;  4BBR H;  3HOV H;  4BY1 G;  5GAE C;  3HOW G;  1P8L A;  4H02 A;  4R1J A;  2F3I A;  2WAQ E;  5JEA J;  2R92 G;  3RLO A;  1LM0 A;  3A0J A;  4LF6 L;  4C2M H;  3KFU A;  3H3V I;  1JJG A;  4B3R L;  2A8V A;  4X65 Q;  4DV5 L;  2R7Z G;  4A3F H;  2Z6K C;  4R4O A;  3RZO H;  4JI5 Q;  4PMW A;  1SRO A;  4AYB E;  1VQI A;  4MTN A;  3GTQ H;  1K3R A;  4JG2 A;  3HOZ G;  3CCV A;  3KF8 B;  4GOP A;  2YU9 H;  1XMQ L;  3W1B A;  1T9H A;  1PH8 A;  4PZ8 A;  5GAG C;  2CKZ B;  4A3E H;  4C3I H;  1TXY A;  2UUA Q;  4OO1 G;  4HIO A;  3CW2 C;  1IBK Q;  4BBR G;  1Q46 A;  2N78 A;  2WB1 G;  3H0G G;  1YJW A;  1L2F A;  3EN2 A;  4DV3 Q;  4HJ9 A;  2MNA A;  1X6O A;  2YTY A;  3UE0 A;  4WJ3 M;  4GN5 A;  5HGQ A;  1JMC A;  5IP7 G;  1QVC A;  3ZJY C;  5FLM H;  1L1O A;  4BBS H;  4UP9 A;  4A3G H;  4YCU A;  2KCM A;  1Q86 C;  1XNR Q;  1SRU A;  1K0R A;  3K81 C;  2VS1 A;  3AYH B;  5M5Y H;  4A3F G;  4NXN Q;  3S14 H;  1J6Q A;  2VZA A;  3J81 c;  3NEL A;  2UXC L;  3A74 A;  3B6Y A;  5ELN A;  3I2Z A;  4B3M Q;  3GDE A;  1VQ7 A;  3PIP A;  1VQO A;  2Q2I A;  3FP9 A;  4YHH Q;  3CMA A;  1Y1W H;  1MJE A;  3K8A A;  3PO2 H;  4A93 H;  4L5S A;  1LYL A;  3PO3 G;  1V43 A;  1K9M C;  1N9W A;  1HNX L;  1VQL A;  4EX5 A;  4A3D H;  4NXN L;  5IYC H;  4B3M L;  1BBU A;  1FVI A;  4BXX G;  2UU9 Q;  2RHS B;  2Z0S A;  1IBL L;  1G29 1;  1K73 C;  4O2D A;  3A5U A;  4JBW A;  2Y0S G;  5IYB H;  1UE7 A;  1Q81 C;  4HJ7 A;  2HHH Q;  1MIU A;  4JI1 Q;  2CWP A;  2JK8 A;  2PQA A;  3E9H A;  3KF6 B;  5C44 H;  4DV3 L;  4UY8 C;  4EQ5 A;  4JI2 L;  5JJK A;  3J80 c;  4JI3 L;  1VQM A;  1XPR A;  2MFI A;  2UXD L;  3AQQ A;  4A3G G;  2WAQ G;  3HOU G;  3Q8D A;  1IBK L;  2HHH L;  4BBS G;  4XTC S;  1A63 A;  1YVC A;  4OO1 I;  1TWC H;  4GKK Q;  1YHQ A;  3W1G A;  4JI2 Q;  2OTL A;  1EIY B;  2Q2T A;  1FJG Q;  1CKM A;  4IOA A;  1QZG A;  1K83 H;  4RG1 A;  3M7N A;  3PO2 G;  2LXJ A;  3OTO L;  2GVA A;  1PA6 A;  2EQS A;  5GRO A;  3CCM A;  3W5O A;  4J15 A;  4LF8 Q;  1PYB A;  5BR8 L;  4OWX B;  1YBY A;  4AQY Q;  1QUQ A;  5LMN W;  1KHI A;  4NPS A;  4JI6 Q;  3I4M G;  3S2D H;  2DGY A;  1X3G A;  3U50 C;  1YEZ A;  3PUX A;  3S15 H;  1NE3 A;  1TWA H;  3K7A H;  2UUC Q;  3CCQ A;  1E22 A;  3A5Z B;  2JE6 I;  2KHJ A;  1SFO H;  3BZK A;  4YCV A;  5IP7 H;  4IFD J;  2D0P A;  3TS0 A;  3L7Z C;  2K5N A;  1C9O A;  1X65 A;  3ULJ A;  4GNX B;  5IYD G;  3D0F A;  3E9I A;  3JAM i;  3G4S A;  2VW9 A;  1N8R C;  4YCW A;  3F2B A;  2CQO A;  2F4V Q;  3HOW H;  3S1R H;  1JJ2 A;  4JI4 L;  2R93 G;  2R93 H;  1PH2 A;  4GLA C;  4X64 L;  1Y1V H;  4LF5 Q;  4JI8 L;  4R4C A;  1GVP A;  4GKK L;  1DGS A;  1CKO A;  1EOV A;  1LTL A;  4P74 A;  2R6G A;  2E2H H;  2RCN A;  3TRZ A;  4RMF A;  4JBJ A;  1HH2 P;  1W3S A;  3F2C A;  3L2P A;  4DV1 L;  1RL2 A;  3M4P A;  2AWN A;  2IT1 A;  2UUB Q;  4JI3 Q;  3PUY A;  4K0K L;  4JI7 Q;  3H15 A;  1S72 A;  2VQE Q;  4DUY Q;  4JI6 L;  1CSQ A;  3OW2 A;  1QVF A;  5IYB G;  1IXR A;  3KLW A;  2QEX A;  4LF5 L;  4LF7 Q;  3ULP A;  1PYS B;  2ZTD A;  2HIV A;  3I55 A;  3U4V A;  3PCO B;  4OWT B;  2Q2U A;  1SR3 A;  3CQZ H;  4DV6 Q;  1TWG H;  1OXX K;  1A0I A;  2K14 A;  3NBH B;  1W2B A;  2R7F A;  2HQL A;  2UUB L;  1EQQ A;  4HIK A;  1QUQ B;  3ULL A;  2NVY H;  1UE6 A;  2IHE A;  4UP8 A;  5H1S E;  3CCR A;  1KAW A;  2WFW A;  4A76 A;  4DR6 L;  3PO3 H;  4LF7 L;  5C3E G;  2JEB I;  4OON A;  3L0O A;  2I5M X;  2AWO A;  1V9P A;  4JI4 Q;  4A75 A;  1P16 A;  4PZ7 A;  1D8L A;  1HJP A;  3CPW A;  3TS2 A;  4DR2 L;  4O0A A;  1Y14 B;  4DR1 L;  2CCZ A;  1B70 B;  4GN4 B;  4UPA A;  4DNI A;  2ALY B;  3FKI G;  4AH6 A;  1I94 Q;  1IBL Q;  4L5Q A;  1IBM L;  1X55 A;  4OXP A;  4LF4 L;  2KEN A;  1GM5 A;  5IY0 A;  2IX1 A;  3TRE A;  1VQH A;  4LFA L;  1VQE A;  1E3P A;  2B63 H;  4X62 Q;  1I50 H;  3H0G H;  1QZH A;  1JT8 A;  2VY3 A;  3CF5 A;  4JI0 L;  2C35 B;  2H5X A;  3HFZ B;  1J5E L;  3S2H H;  4GLX A;  1QVG A;  2OWO A;  1I6H H;  3J7A 5;  2ES2 A;  5C44 G;  3KDF A;  4NXM L;  4DR6 Q;  1Q1E A;  1TWF H;  2ZJR A;  2VUM H;  4DK3 C;  4LUV A;  2UXB L;  4HJ8 A;  1VQJ A;  3GD7 A;  5FLX c;  4IOC A;  2PI2 A;  2AHO B;  2HIX A;  3PUZ A;  1S40 A;  4A3L G;  5K36 G;  3M3Y H;  4IFD G;  5BR8 Q;  4AQY L;  3CC2 A;  3CCL A;  3F2D A;  2GVB A;  2N3S A;  4NB3 A;  3GTJ H;  3DLL A;  1RIP A;  1YNX A; 
#chains in the Genus database with same CATH topology
 4P75 A;  2A6E C;  4LWC A;  1EQV A;  1SNC A;  5FLX E;  3S17 B;  3AEV A;  1LAC A;  1MKH A;  4C1N I;  3KLS X;  4JI8 Q;  2IY5 B;  1G51 A;  4JCV E;  1WJJ A;  3NWT A;  3QJY A;  4ZLT F;  4LF4 Q;  1NTG A;  2RKS A;  1UUP A;  1PHJ A;  3OOC A;  4K5V A;  2H4O A;  5ELB A;  4JBM A;  2E74 C;  1YHB A;  2HD3 A;  3IAY A;  3EVQ A;  3I4O A;  4RCN A;  3CCJ A;  3M3Y B;  4GS3 A;  1EEI D;  2SNM A;  2A5H A;  3S1Q H;  4RGM A;  1N34 L;  2F4I A;  1YJN A;  2LS0 1;  1PTO C;  3DM1 A;  4A3D B;  1HQM C;  3OHX C;  3BVG A;  1SYD A;  4IUR A;  4GOP B;  3KOJ A;  4K6D A;  5C4Z A;  1YNJ C;  2JSO A;  4DPG A;  5KYL A;  3CC7 A;  2UUA L;  3TME A;  4DV6 L;  2YYZ A;  4DNT B;  3ZYY X;  1XMO L;  5JVG 3;  5JEA G;  1EIH A;  1K8O A;  2JA7 B;  3V05 A;  3GP7 A;  1QNK A;  3S2H B;  2D62 A;  3KF6 A;  2L0C A;  4P73 A;  4TVA B;  2EY6 A;  3R93 A;  4DR5 Q;  1H9K A;  3FRP B;  3S1N B;  1I94 L;  4JV5 Q;  3BYY B;  3KDF B;  3K58 A;  1NMF A;  1STA A;  5A2Q L;  1EY8 A;  1K8M A;  3R3O A;  5L37 A;  3I4M H;  1ZXT A;  3PUW A;  3QB3 A;  5AFW A;  1WD1 A;  1UAP A;  1EQR A;  1E7Z A;  4BY1 H;  1VS0 A;  2B3G A;  2K5H A;  5M5X B;  2WKD A;  5IYD H;  1N32 Q;  3TP7 A;  1FYC A;  4NDX A;  3ND9 A;  1B9M A;  5C44 B;  1LV9 A;  4A93 G;  1PH5 A;  1ENF A;  1L1O B;  1WTR A;  1HXY D;  2JJQ A;  4AYB B;  4IUT A;  1PDQ A;  1XNQ Q;  4ZRZ A;  2NZO A;  3MEF A;  1BVS A;  4DV7 Q;  2A69 D;  1X3F A;  4BXX H;  2MO1 A;  5C3X A;  1HRJ A;  1GUG A;  2ZJQ A;  4B9W A;  3OMG A;  4WJ4 A;  2B63 G;  3D31 A;  3IRB A;  1H9M A;  1S3O A;  3U9S A;  4XYO A;  1SNQ A;  3E0J A;  1PRT C;  2X6L A;  3EJI A;  4UDU C;  5EKI A;  2F3W A;  5DEH A;  1C0A A;  2XTI A;  5E4X A;  4A3I B;  5KEE A;  4R4I A;  4PG3 A;  5CGK A;  5J3B A;  5G3L D;  3I4N H;  3T16 A;  2F52 A;  1GUT A;  4RA8 A;  2VQF L;  4G7O C;  4PQX A;  5M5X H;  1UEB A;  1T5E A;  3I4L A;  3HOZ H;  2EXD A;  1WFQ A;  1N36 L;  1N34 Q;  1ZKO A;  4DUZ L;  3BU2 A;  3CXC A;  2KBN A;  1IZ6 A;  3DHQ A;  3IFT A;  2JA6 G;  1KIX A;  1N33 L;  4DFA A;  2I07 B;  3S1N H;  2I46 A;  1WTP A;  2I5L X;  4MIU A;  4QQB X;  3VYR A;  4U67 3;  5CYU A;  4IUQ A;  1CT1 D;  1IL2 A;  3BJU A;  2JA5 G;  2PNR C;  1TWC B;  3KBX A;  4J8Q A;  4OIJ A;  2G9H D;  4F7X A;  1Y1V G;  4XXE A;  2F0O A;  4X3S A;  2NZ1 D;  1QE6 A;  1I4R A;  3I70 A;  1BKB A;  3BYT B;  4AIM A;  2PPB C;  1MGS A;  1Q1B A;  1F9Q A;  2NVX B;  1LT4 D;  2E5L L;  3FKI H;  2MGS A;  2LSS A;  3IL8 A;  2BOS A;  4M1U B;  2K50 A;  1X32 A;  4EGV A;  2CW0 C;  5FLX L;  1OO9 B;  2EZV A;  4N8X 1;  1BCP C;  2B2W C;  4KI0 A;  3VR4 A;  3CCE A;  4JBK A;  1A15 A;  2YU9 B;  1VQ5 A;  1EOT A;  1STB A;  1YIT A;  3ONA B;  5AJ3 L;  1FR3 A;  1G91 A;  4B3S Q;  1O80 A;  2ID0 A;  1HZB A;  3GV6 A;  1D5Z C;  2K75 A;  4RHR A;  5ELE A;  2H1E A;  1ZYR C;  4DR3 Q;  2WV6 D;  3D4D A;  1X3E A;  4NKL A;  1PFS A;  2X6G A;  3PGZ A;  2R7Z G;  3GO5 A;  3BVZ A;  2JP1 A;  5IWA Q;  4B3R Q;  1JOO A;  2MUY A;  4LFB Q;  1I6H B;  2NVT H;  4L8J A;  1CZG A;  5T1I A;  1NUC A;  5AJ3 Q;  3PF5 A;  4EQP A;  2QCP X;  1HR0 Q;  5HGT A;  2HT1 A;  3NWS A;  1VQF A;  2BDO A;  1LUZ A;  4IPH A;  2Z6K A;  2VXW A;  2EYP A;  4CDC C;  1SSO A;  4B3T Q;  2RHQ B;  2NZH A;  3K5L A;  2PMZ E;  2WIN B;  1SE3 A;  3HOV H;  4QIW B;  5HUR A;  5GAE C;  1P8L A;  3R2I A;  4LF6 L;  4C2M H;  1VF5 C;  4UHV A;  4BBS B;  4A3F H;  2JYO A;  2EE1 A;  5EPK A;  3RZO H;  2CVR A;  2EYH A;  4AYB E;  1VQI A;  1K3R A;  4GOP A;  2YU9 H;  2WAC A;  1JE4 A;  1TWA B;  4C3I H;  4IN3 A;  1BF4 A;  1SYF A;  1EEF D;  2XIW A;  2LY7 A;  2NBF A;  1TT2 A;  1X6O A;  2YTY A;  3HOX B;  4BBS H;  3CHB D;  1CI3 M;  1JWM D;  4I7A A;  2C5C A;  4C2M B;  1Q86 C;  4A3G H;  1XNR Q;  2A6E D;  1SRU A;  1K0R A;  3AYH B;  3CKI B;  3NEL A;  2UXC L;  1TY0 A;  1VQ7 A;  1M4V A;  3PIP A;  4KKS A;  1Y1W H;  3PO2 H;  4A93 H;  3PO3 G;  1LYL A;  3T53 B;  1N9W A;  2F03 A;  1VQL A;  4NXN L;  1SND A;  1SMY D;  3Q6S A;  3TN2 A;  2AQ1 B;  1Y8N B;  3A5U A;  3BVM A;  4JI1 Q;  2OXP A;  5C44 H;  5EJW A;  5G3L F;  4EQ5 A;  1HTP A;  2HUG A;  4C3J B;  5IIF A;  4JI2 L;  5JJK A;  4RKB A;  2EPB A;  2UXD L;  5C4J B;  3OMC A;  3MHB A;  1U4L A;  1YVC A;  5CMD A;  2OTL A;  1FJG Q;  1QZG A;  1K83 H;  3VR6 A;  2LXJ A;  3OTO L;  4KHV A;  5J1Z A;  2EQS A;  3CCM A;  2JN4 A;  3RZD B;  4OO1 H;  4LF8 Q;  2G9D A;  4OWX B;  3SK4 A;  1QUQ A;  3S2D H;  2WII B;  2K05 A;  3U50 C;  3PUX A;  3A8I E;  2UUC Q;  1SFO H;  2KHJ A;  2V4D A;  3T13 A;  3L7Z C;  5KIX A;  1TWF B;  2DY8 A;  4H44 C;  4GNX B;  5DAU A;  3HOW H;  5C5L A;  1PH2 A;  3RZO B;  4FF4 A;  4JI8 L;  2RCN A;  4DGZ A;  4RMF A;  3SDZ A;  1W3S A;  3F2C A;  2F0E A;  1CZW A;  1RL2 A;  4X3K A;  3DXJ C;  3LWE A;  4ULL A;  4JI3 Q;  2EOT A;  4K0K L;  1F2M A;  1Z7T A;  1IXR A;  3KLW A;  5CBA E;  4KMU C;  2QEX A;  5FOB B;  1B53 A;  1PYS B;  3I55 A;  1H9R A;  1SR3 A;  3CQZ H;  1NSN S;  1OXX K;  4DA2 A;  1EQQ A;  1QUQ B;  3TSS A;  1UE6 A;  4DR6 L;  4U68 A;  3PO3 H;  4LF7 L;  3VR5 A;  3D4R A;  3VYT A;  3N6R A;  1XX8 A;  4JI4 Q;  4JW0 A;  1P16 A;  2B8G A;  1HJP A;  3BDO A;  4O0A A;  1DJR D;  1Y14 B;  4DR1 L;  3NTK A;  4ZK9 B;  4UPA A;  3FKI G;  5FK9 C;  1IW7 D;  3TZD A;  1EY5 A;  3R2T A;  2XWJ B;  1VQH A;  4LFA L;  2J0T D;  1VMP A;  1JWS D;  4K8J A;  4ZKC B;  1JT8 A;  5KNB A;  4JI0 L;  4Q5V A;  2DNC A;  4LAA A;  3HFZ B;  1HPC A;  1SJH D;  1J5E L;  4GLX A;  4PV1 C;  4RCO A;  3I4N B;  1X3P A;  4NXM L;  5I9O A;  1TS5 A;  2UXB L;  1ICF B;  2RDH A;  2PI2 A;  2AHO B;  2HIX A;  2CH4 A;  4IFD G;  1RKN A;  1ONL A;  1EYA A;  2N3S A;  2X69 A;  4RKL A;  2EYF A;  2B2W A;  1RIP A;  2K04 A;  3A54 A;  1Q7Y C;  1XJV A;  1KD1 C;  1EY4 A;  1TU2 B;  4ZCK A;  4JYA L;  1QOH A;  2XVS A;  4DN4 M;  1PZK D;  4JI0 Q;  3C3L A;  5M3M G;  4BBR B;  1J5E Q;  2GN5 A;  4A3C H;  4IPD A;  4JPB W;  2IHF A;  2NUC A;  2NYZ D;  1R9T H;  2P5Z X;  4DAP A;  4JI1 L;  2EJG C;  1B7Y B;  3F1Z A;  1AFP A;  2PO4 A;  3TP8 A;  3CCU A;  1VQD A;  3A7L A;  1R9T B;  4A3M B;  4MTK A;  4X66 Q;  4OX9 L;  1LAB A;  3VYS A;  2RQX A;  2JXM B;  1CK1 A;  4YWL A;  4DR7 Q;  2Z1C A;  3STB D;  2RCF A;  1W6J A;  4LF9 L;  2F0W A;  1WCM G;  1I6V C;  2MO0 A;  1D7Q A;  2ICI A;  1XPU A;  1A62 A;  1ZYR D;  3X3N A;  1G6P A;  3WWV A;  2VQF Q;  1WTO A;  1I50 B;  1XXG A;  4JVZ A;  2B63 B;  4LF8 L;  4XYQ A;  3PV0 A;  2QEJ C;  1HUM A;  1CM9 A;  4NP5 A;  1SBB B;  4KV6 A;  3E6Z X;  2OT2 A;  1XMQ Q;  3NPP A;  1PH6 A;  4LMQ D;  4DK0 A;  2L4N A;  4R4Q A;  4CJ2 C;  4A3B H;  1F77 A;  4KJO A;  5KNC A;  2ZTC A;  4DKA C;  1LTI D;  3J7Y W;  2EYJ A;  1WOC A;  1QIL A;  1SLJ A;  3FHW A;  1WTX A;  5C4X B;  3G71 A;  1VQ9 A;  3GTO H;  4BY7 G;  3RUZ A;  1IKL A;  1YNJ D;  5KGU A;  4MNO A;  4A3J H;  2Y0S E;  1BCP B;  2B2T A;  2CFM A;  1UE5 A;  3J81 i;  3M4O B;  1U4P A;  5IE8 A;  1JOR A;  2HDL A;  4L6T B;  3PSI A;  4IZ8 A;  4XIG S;  1M1K C;  3GTP H;  4DV2 Q;  2FMC A;  4G7Z C;  4BA1 I;  1ESF A;  4F8M A;  4A3L H;  1SE2 A;  4FDB A;  3X3M A;  3QO2 A;  4HID A;  3SK8 A;  1B8A A;  1KDA A;  3M4Q A;  1Y1V B;  4HMI A;  1WI5 A;  2M2L A;  1WCM B;  4QGU A;  4DR5 L;  2NVQ H;  1A3T A;  2NB0 A;  3R8B A;  2M9V A;  4ZAI A;  1EY6 A;  5M5W H;  4G7H C;  4A3J B;  3K5O A;  5I2Y A;  1PZI D;  2LMC B;  4P71 A;  1PH7 A;  3GTO B;  3QIA A;  3RLF A;  4B9X A;  2KHI A;  1HTL D;  1OXT A;  1O7Z A;  2RSN A;  1NJI C;  3GTK B;  2EVB A;  4KD4 A;  5LL6 X;  2FFK B;  4DV4 Q;  2AUK A;  4YWK A;  2OTJ A;  1UWV A;  1N32 L;  1SE8 A;  4KY6 A;  2RA4 A;  4R4T A;  1ENA A;  5JAV A;  4DR7 L;  3DMU A;  2VNU D;  1STE A;  1CUK A;  1OXU A;  2RBM A;  2EYM A;  2JA7 H;  1ILP A;  1LT5 D;  2A68 C;  2RVL A;  1BNZ A;  4A3D G;  1GXD C;  4RWS C;  2YTV A;  4RFB A;  1FGU A;  1OTC A;  1G8Z D;  1G2T A;  2F0J A;  4RAU C;  4C3J G;  1II3 A;  2F0K A;  1XMO Q;  5BN4 A;  2R7Z H;  2ZTE A;  2N49 A;  1HZA A;  2HCC A;  3N52 A;  4TSS A;  1SMX A;  1HA6 A;  2E75 C;  1TWG B;  4K2L A;  1EY0 A;  5KYI A;  3NEM A;  4XQQ A;  3C2P A;  4MZ9 A;  1D1I A;  2R7D A;  1HZ9 A;  2RDG A;  3CAM A;  1VQA A;  3TDQ A;  2D0O A;  5IOC A;  4IQZ A;  3P1H A;  1KC8 C;  1HNZ L;  5ELO A;  4OX9 Q;  5IGC A;  4FXK C;  2XRQ D;  5JPM C;  2F0I A;  1B3Q A;  1YHA A;  3CME A;  5IGD A;  3MAQ A;  4A3C G;  4GLV B;  2JA5 H;  3MVV A;  2O5I C;  3ER0 A;  2A1A A;  2A73 B;  1PV4 A;  1O78 A;  4KK7 A;  1X9N A;  4DV0 L;  4A3K G;  2ZM6 Q;  2MPM A;  1GUS A;  2A19 A;  4H13 C;  5EBD A;  5IP9 G;  2G5D A;  1CHP D;  3K80 C;  3S16 H;  2QGQ A;  2BA0 A;  3K0Y A;  1ASY A;  5IWA L;  2UXD Q;  2MQH A;  3HZX A;  4QUC A;  1RTO A;  3M85 A;  1PVO A;  5C5M A;  3URY A;  2E2I H;  2V1C C;  3BS1 A;  1XNR L;  2E5L Q;  1KRS A;  4DV4 L;  3H3V H;  3JAM c;  2PI2 E;  3OTO Q;  5IYC G;  2BA1 A;  3CP0 A;  5FLM G;  1VF7 A;  3FMC A;  3SXH A;  2ZJP A;  1UE1 A;  2F0U A;  3EIV A;  4A3B G;  3HOV G;  1F2L A;  2VL6 A;  1F9R A;  1AH9 A;  3HOU B;  4B3T L;  5CBE E;  4DV2 L;  5LMN L;  2JA7 G;  1HR0 W;  3C1E A;  4B3S L;  4A3M H;  4DR4 Q;  5EGT A;  1JJC B;  5CV6 A;  1SN8 A;  2JA8 H;  3GTM B;  1SNP A;  3GTL H;  4JOI A;  1KLU D;  5COR A;  3CCS A;  3HOY B;  3HGB A;  1JR0 D;  4KHZ A;  2Y0S B;  1KQS A;  2K7V A;  4DF7 A;  1CFM A;  4BY1 G;  4K5X A;  2XRS D;  2NTT A;  3HOW G;  4R1J A;  2Z9H A;  2F3I A;  3W2D A;  2R61 A;  3A0J A;  2HCI A;  3ERQ A;  4LJZ C;  4B3R L;  4A3K B;  2A8V A;  4X65 Q;  2NTS A;  3I72 A;  4IFD H;  1PTO F;  1LTR D;  1EZ8 A;  4PMW A;  1SRO A;  1MD2 D;  1Y69 U;  1Y1W B;  3HOZ G;  1ET6 A;  3CCV A;  3KF8 B;  3ITP A;  1QWY A;  3H91 A;  5LHY 1;  5GAG C;  5KND A;  4A3E H;  3K7A B;  4OO1 G;  3MXN A;  1IBK Q;  1TY2 A;  2WB1 G;  1B50 A;  1SDF A;  1H9S B;  1U4R A;  2F0G A;  3OIQ A;  1GHK A;  2MNA A;  4BY7 B;  4GN5 A;  2OF1 A;  1QVC A;  3H0G B;  3ZJY C;  1L1O A;  2KED A;  4A3B B;  1RJT A;  2GA4 B;  5M9O A;  5M3F B;  1WTW A;  2XWB B;  3H94 A;  5J22 A;  2K6A A;  4A3F G;  4NXN Q;  4ABN A;  4HTH A;  1DXM A;  1VQO A;  3DUZ A;  4YHH Q;  1MJE A;  3K8A A;  4CHT B;  1V43 A;  3KLR A;  1K9M C;  3U9O A;  5JVH 3;  1HNX L;  3MXU A;  5FO7 B;  3GTG B;  3A8J E;  5IYC H;  4B3M L;  1B1Z A;  2TMP A;  4F88 A;  1FVI A;  3Q23 A;  1IBL L;  1V8Q A;  2DJG C;  4O2D A;  1F2Z A;  4JBW A;  5IYB H;  2HHH Q;  1MIU A;  1LT3 D;  2JK8 A;  3E9H A;  1E2Z A;  2B2U A;  3KF6 B;  3TZU A;  5I6W A;  2B8F A;  4IUU A;  1VQM A;  5CV9 A;  2AUJ D;  3AQQ A;  5IOD A;  2WAQ G;  2QKI C;  2Z8L A;  3PQI A;  1G2S A;  3MZ5 A;  3LWU A;  3D6C A;  4CDE C;  5A2Q E;  5JJZ A;  4GKK Q;  2Q2T A;  4A3G B;  1EIY B;  3HKZ B;  5FO8 B;  2WB1 B;  1TQO A;  4J15 A;  1SYC A;  4AQY Q;  5C3W A;  1WTQ A;  5JOB A;  4NPS A;  2SOB A;  2TSS A;  1NE3 A;  3LX0 A;  1TWA H;  4HR7 B;  4C3I B;  2MHV A;  4K5W A;  5CV5 A;  2PCF B;  4TKO B;  1FGB D;  3BZK A;  3BDL A;  2K5N A;  3J7A F;  1X65 A;  2KVM A;  4LK1 C;  1L0Y B;  2E76 C;  3G4S A;  2VW9 A;  3F2B A;  2R93 H;  1JJ2 A;  4FO2 A;  4X64 L;  1FNU A;  1EWH A;  1GVP A;  2D2C C;  2E2H H;  1HH2 P;  3M4P A;  5JPN C;  3MA2 B;  3NTH A;  3M7G A;  1S72 A;  4FYD A;  4EVO A;  1TS2 A;  4LF5 L;  1XTC D;  3ULP A;  4OWT B;  1FD7 D;  1KAB A;  4DV6 Q;  1TWG H;  1BXT A;  4HN7 A;  5M3M B;  2R7F A;  2UUB L;  1ET9 A;  1HHV A;  5EPL A;  2IHE A;  1KAW A;  2WFW A;  2L55 A;  2F0Q A;  3OPO A;  2AWO A;  2A6H C;  4A75 A;  1PFM A;  4L63 B;  3CRK C;  3CPW A;  3PO2 B;  3TS2 A;  4DR2 L;  4X3U A;  4GN4 B;  2ALY B;  4L5Q A;  1IBM L;  1EWC A;  4OXP A;  1GM5 A;  2IX1 A;  1RHP A;  1Q8I A;  1XYI A;  5J39 A;  2B63 H;  1I50 H;  3OSO A;  1PRT D;  1STY A;  3CF5 A;  2A68 D;  3V2T A;  1A2U A;  3S2H H;  2HDM A;  4ODG A;  5E1F A;  1I6H H;  3J7A 5;  2ES2 A;  3KDF A;  4DR6 Q;  5EPJ A;  1TWF H;  1ESR A;  1I4H A;  5D3D A;  4DK3 C;  4IOC A;  4DU9 A;  4AQY L;  3CCL A;  3F2D A;  2GVB A;  2B2Y A;  3HS0 C;  1YIJ A;  4V0B A;  2NVQ B;  2E2J H;  3K5M A;  1PRT B;  3I3C A;  3PIO A;  4POF A;  3I73 A;  3A8K E;  2VB3 X;  4YHH L;  2AMC B;  4KY5 A;  3QG1 A;  1MHW C;  3QOL A;  2LXK A;  3HOY G;  4XT1 B;  1AN8 A;  1ILQ A;  2F0M A;  5EAY A;  1DOL A;  1R4P B;  3MXG A;  1Y8P B;  4QCL A;  1XTD A;  2R3Z A;  3CQZ B;  1MSH A;  1HA5 A;  3PUV A;  1WVL A;  1K8G A;  3I90 A;  3EA6 A;  1VQB A;  1IL8 A;  1Q90 A;  1KAA A;  1AZP A;  2HQE A;  3SR1 A;  3STB C;  1EYD A;  4YWM A;  3HOZ B;  2J4X A;  3QR8 A;  4GNX A;  4KKT A;  3PMF A;  1BCP D;  3E0E A;  2C9O A;  4FP5 D;  1DZ1 A;  1L1O C;  3UE1 A;  3Q22 A;  4DUY L;  3HOX H;  4CKE A;  2D5D A;  3NHH A;  3A56 A;  4KKU A;  1VQN A;  3MXP A;  3RLN A;  3UDX A;  4CKC A;  1FJG L;  4OEL B;  5C4J H;  5I9P A;  4Y52 H;  3RN2 A;  5D14 A;  3QWN A;  4O42 A;  3VA5 A;  2LFN A;  1VQP A;  4CDF C;  3VR2 A;  3FPP A;  3FKI B;  4L5R C;  1PLF A;  3RZD H;  2MP1 A;  5ISR A;  1EYG A;  2EJF C;  2NVX H;  3U4Z A;  1A3V A;  2IWH A;  2ZXR A;  4QB4 A;  4JC0 A;  1ENC A;  3EQL C;  2BH2 A;  1EFI D;  3EFX D;  1AP0 A;  4QIW E;  3AFQ A;  1MSG A;  3F2U A;  1Q82 C;  1I4Q A;  2BE5 D;  3NSW A;  1HNW Q;  2PQE A;  1TII D;  1BQQ T;  1Y1W G;  3SGI A;  2QDL A;  2B39 A;  4DXG A;  1PH4 A;  3I7F A;  1B3A A;  2NVT B;  1AW7 A;  4C3H G;  4WFN 3;  3HKS A;  1J9O A;  1G6Z A;  1QJO A;  1GJX A;  2PYK A;  4WOR A;  1DOK A;  5ELD A;  2YTX A;  1TWH H;  4WJW A;  2EXZ A;  3TEH B;  4CBV A;  2XSC A;  4X64 Q;  1EZ6 A;  3V96 A;  1LLR D;  2N8N A;  4LFC Q;  2IJ0 A;  3K7U C;  2OQK A;  1X54 A;  1BOS A;  3T1H Q;  1NCV A;  4A3F B;  1EIG A;  3Q0A A;  4DUZ Q;  4DK6 C;  1OXV A;  5JJL A;  4I65 A;  1AE3 A;  2M00 A;  1SNO A;  1PTO D;  1YJ9 A;  1EU3 A;  1NAP A;  5IGE A;  1CSP A;  2K33 A;  1I5F A;  4EQN A;  1CA6 A;  1IKM A;  3MTS A;  4A3M G;  1Z9F A;  4X6A H;  5FO9 B;  3MWY W;  4ID6 A;  1RF2 D;  3I4M B;  1E0B A;  2I5H A;  4LFA Q;  1YZ6 A;  4JK1 C;  3VDY A;  1BUV T;  4P72 A;  2E2D C;  1OXS C;  4QL5 A;  4FVM A;  2BE5 C;  5LL6 S;  4JOI C;  1ROD A;  4HJ5 A;  1J8I A;  4OHJ A;  4K2K A;  2QA4 A;  2VB2 X;  4K0K Q;  1U5K A;  4DR2 Q;  1HCZ A;  4GKJ L;  5LMN Q;  1E1O A;  3HOV B;  3FPU B;  1HNZ Q;  2A74 C;  1GO3 E;  1I3Q H;  1HZC A;  1VQG A;  3HKZ G;  1VMC A;  2QDB A;  3I4N G;  4FNF A;  2VQE L;  1EIF A;  1NMG A;  1QCB D;  2FXQ A;  4ALP A;  5A35 A;  1TR5 A;  1PZJ D;  2Z6B A;  4IO9 A;  3UDG A;  4J1M A;  4Y7N B;  2JA8 G;  2K1B A;  1B4O A;  1BBX C;  3DM3 A;  1WTH A;  1CKN B;  3MFY A;  4ZUI A;  3ERO A;  4GKJ Q;  3JC6 6;  2PW7 A;  4N9P A;  3CD6 A;  1PXU A;  1WYD A;  3S14 B;  3D4W A;  5IGF A;  1E24 A;  3MEH A;  1GOZ A;  4YY3 L;  4AYB G;  2K4K A;  4BS9 A;  3BZD B;  5DM6 3;  5IP9 H;  3J80 i;  3S1M B;  4KHP L;  1PFN A;  3S24 A;  4HMJ A;  2DJF C;  5CR3 A;  2L12 A;  2PZU A;  2EJM A;  3OYY A;  1IYV A;  2BCO A;  3S17 H;  5LMU Q;  2E2J B;  5KRU A;  1CTM A;  3CPF A;  1E2V A;  5ELF A;  3KJP A;  4A3I H;  1M90 C;  1STG A;  4IFD I;  4RH6 A;  4LFB L;  4PMC A;  1L0W A;  3BZC A;  5M3M H;  4OWW B;  1VCI A;  3T1H L;  1NNX A;  4FF2 A;  4JI7 L;  2QIL A;  1DM0 B;  1HFN A;  5F2D A;  1KXL A;  4KJN A;  3D6W A;  3SE0 A;  3DWP A;  3EBE A;  3TP6 A;  4APV A;  1EUJ A;  4C56 C;  3P20 A;  2NWG A;  2NN6 G;  3K0X A;  2JA9 A;  3P7J A;  4IPG A;  3S1M H;  3HKZ E;  2ZM6 L;  3S1Q B;  3UDF A;  4C3H H;  1PH1 A;  3PO3 B;  3A55 A;  2N88 A;  3FEW X;  1VDZ A;  2KHS A;  5HY6 A;  1HUN A;  4GOP C;  4S3S A;  5DM7 3;  3BG3 A;  1VQK A;  2ZXP A;  1N33 Q;  3RN5 A;  2Q8T A;  4BY1 B;  4X65 L;  2I0Q A;  3NQT A;  1SXT A;  5JEA J;  3PIO 3;  3H3V I;  1JJG A;  4TRD A;  2LKV A;  4DV5 L;  4BWG B;  2EY1 A;  2R93 B;  1K3B C;  1STN A;  2Z6K C;  4R4O A;  4MTN A;  3GTQ H;  4JG2 A;  4WRD A;  1XMQ L;  3W1B A;  1T9H A;  4PZ8 A;  2CKZ B;  2EY2 A;  5EBC A;  1TXY A;  2UUA Q;  4HIO A;  3CW2 C;  4BBR G;  4XQJ A;  1ML0 D;  4CJ1 B;  1BCP F;  1DOM A;  1YJW A;  4HJ9 A;  4DV3 Q;  1EY9 A;  4O1N A;  1JMC A;  2ICE C;  5IP7 G;  4K14 A;  1JOK A;  2F0D A;  3IKJ A;  2KCM A;  1XWE A;  4PMB A;  2VS1 A;  5M5Y H;  2F0L A;  2VZA A;  3J81 c;  1PRT F;  3B6Y A;  2NN6 H;  5ELN A;  2EDG A;  2Q2I A;  3CMA A;  3PIP 3;  4L5S A;  3GQB A;  4FXG C;  4EX5 A;  2CW0 D;  4A3D H;  4IUP A;  1BBU A;  2Z0S A;  3VYU A;  2KEC A;  1DON A;  2JA6 B;  1UE7 A;  3L3O C;  4HJ7 A;  2CWP A;  2PQA A;  2KA7 A;  2QF7 A;  4UY8 C;  3S1R B;  2R92 B;  1R4Q B;  4KY7 A;  4JI3 L;  4DAY A;  4A3G G;  2KOL A;  3H3V C;  2A69 C;  3HOU G;  1KNE A;  4BBS G;  4XTC S;  1A63 A;  2AQ2 B;  1YHQ A;  4JI2 Q;  4M8A A;  3NXW A;  5K5P A;  2KQ3 A;  2E2H B;  1GHJ A;  3PO2 G;  5M5Y B;  2GVA A;  4NMZ A;  1SEB D;  2KJX A;  5GRO A;  3W5O A;  4C3I G;  1PYB A;  4OGQ C;  3I4M G;  1EU4 A;  1KHI A;  2K03 A;  5LMN W;  4JI6 Q;  2DGY A;  5C4H A;  1YEZ A;  1A3U A;  1QNU A;  5D65 A;  3S15 H;  1JWU D;  3K7A H;  4ZQ3 A;  3G7L A;  3A5Z B;  2O2L D;  5IP7 H;  2WKC A;  4E6I A;  2O5J C;  4IFD J;  5IT9 L;  2BDN A;  5E3F A;  2F0N A;  1C9O A;  3ULJ A;  3AB9 A;  3D0F A;  3P75 A;  3JAM i;  2R93 G;  4YCW A;  1JC7 A;  2CQO A;  2F4V Q;  2B2V A;  3J80 L;  4GLA C;  4LF5 Q;  4R4C A;  4GKK L;  1DGS A;  4P74 A;  1EOV A;  1LTL A;  2F3V A;  3L2P A;  1F9S A;  2AWN A;  2IT1 A;  2UUB Q;  4HCS A;  4A3E B;  2ZXO A;  1U4M A;  1T5X D;  2IL8 A;  3JAM E;  3K57 A;  5C6A A;  3J80 E;  4LF7 Q;  2HIV A;  2JA5 B;  3SVM A;  2XN9 C;  3E5S A;  4FF1 A;  1A0I A;  2K5D A;  1W2B A;  4H0L C;  3MFG A;  4MHE A;  4HIK A;  3ULL A;  2NVY H;  5H1S E;  4UP8 A;  3CCR A;  4A76 A;  3NBI A;  1TVX A;  1D6E C;  3L0O A;  2I5M X;  2N55 A;  2QW7 A;  1V9P A;  1TS3 A;  4P2C B;  4OIK A;  1LTT D;  4PZ7 A;  5CV7 A;  3NP8 A;  2B2Y C;  2A6H D;  3S16 B;  1D8L A;  1LTA D;  2ZT9 C;  4V19 0;  4HAE A;  2KCN A;  1YNN C;  1B70 B;  4DNI A;  1IBL Q;  1I94 Q;  1JQY D;  3G6J B;  4LF4 L;  2KEN A;  1FNW A;  5E4W C;  5IY0 A;  3TRE A;  2SNS A;  1VQE A;  1SJE D;  1E3P A;  3DWQ A;  4X62 Q;  1A6X A;  3H0G H;  1QZH A;  2C35 B;  3NE5 B;  2H5X A;  5EKK A;  4DXF A;  3CRL C;  3KF8 A;  3AU7 A;  2F0V A;  2VUM H;  1MI2 A;  4LUV A;  1KDC A;  4G57 A;  1V1P B;  2FJ2 A;  1VQJ A;  1D1K A;  1S40 A;  3PUZ A;  4A3L G;  4HSP A;  2MJ8 A;  3M3Y H;  3CC2 A;  2L9H A;  4NB3 A;  3GTJ H;  1BDO A;  3DLL A;  1YNX A;  3NQI A;  3KBG A;  3PF4 A;  2Q2H A;  1V1P A;  3GTM H;  2JA8 B;  3F8T A;  1A8V A;  1UEA B;  2Q8I B;  5CV8 A;  1RCV D;  4ZUJ A;  2DNE A;  5JJI A;  4QJF A;  4FXD A;  1HNW L;  4KD3 A;  1PTO H;  4Y7N H;  2F4V L;  4X3T A;  3HOX G;  5NUC A;  2E8G A;  5IT9 c;  4KTA A;  1U0L A;  4CKB A;  2K32 A;  5M3F G;  1VQ4 A;  1EFW A;  1BR9 A;  4BA2 I;  2IX3 A;  2B2U C;  2F0T A;  3J81 E;  2F1M A;  3KK7 A;  2Z4H A;  5C0X I;  1H95 A;  4A3J G;  3ICE A;  1LTG D;  5GAH C;  3GTG H;  1FL0 A;  4ILW A;  1K8A C;  1H9J A;  2AKW B;  4OL7 A;  2DY7 A;  3M4O H;  2CQA A;  1EWI A;  3J81 L;  1U9R A;  1E2W A;  2SDF A;  4LF9 Q;  3VA7 A;  1EY7 A;  4RGN A;  3UI2 A;  1D5M C;  2JEA I;  3UDI A;  5CV4 A;  1S5C D;  3K6O A;  1CKN A;  2OCE A;  1XNQ L;  1GD7 A;  5C0X G;  1JE5 A;  2KEE A;  2BH8 A;  1BO0 A;  4QMG A;  2WP8 J;  1S4Z A;  2OQ0 A;  4EQO A;  1Y8O B;  1QB5 D;  4POG A;  4KN7 C;  3J81 j;  1X56 A;  1SNM A;  4IUV A;  1MJC A;  2K5W A;  3C1F A;  5DNF A;  2EYL A;  3RNU A;  1HNX Q;  5FJ8 H;  1TWH B;  2K5Q A;  1S5E D;  4PNY A;  1ICW A;  4TQU S;  5EQ0 A;  2FHT A;  2YV5 A;  3QOJ A;  2IW3 A;  3U58 A;  2EY5 A;  4ZYS A;  1PFB A;  2Z4I A;  1SMY C;  1C7Y A;  4A3K H;  5FKA C;  1WTV A;  1DYQ A;  3M9B A;  4LUO A;  4HJA A;  1GKH A;  4PZ6 A;  4YIJ A;  1H9S A;  1DD2 A;  2UXB Q;  3RR5 A;  3KYH C;  3G6E A;  3G48 A;  2K52 A;  5I6Y A;  4A93 B;  1TS4 A;  4LFC L;  1Z47 A;  2XGT A;  2PW5 A;  1O7Y A;  1JB3 A;  3NEN A;  5GQO A;  3FDT A;  1F2Y A;  4B08 A;  1A2T A;  3L9A X;  4DAY B;  4JYA Q;  3RMH A;  1W6K A;  4GNX C;  3J7Z C;  1HQR D;  1YNN D;  2E2I B;  2ATW A;  2B2V C;  3HOU H;  4HED A;  4RHS A;  5M3F H;  5JEA H;  4IJL A;  1AEX A;  3T1Y L;  4QF4 A;  4JI5 L;  1NY4 A;  3I8Z A;  1KTK A;  3A7A B;  5BN3 A;  5GAD C;  4LNQ A;  2UU9 L;  4X62 L;  5LMU L;  1CQF A;  2SEB D;  3W3A A;  4H7B A;  5C3E H;  4DNR B;  5IT9 E;  4X66 L;  2UXC Q;  4IJH A;  2F0F A;  2K5V A;  4DR4 L;  3ERS X;  1SYG A;  1RTN A;  4GZY C;  3HEJ A;  3S2D B;  1YI2 A;  2PNH A;  4DV0 Q;  4A3E G;  1JIC A;  3H6M A;  1BBW A;  2IX0 A;  4R8N A;  3GTK H;  3I56 A;  1PTO B;  1LTS D;  3KJO A;  2L1B A;  1VQC A;  2CWA A;  2WAQ B;  1KL9 A;  1SYB A;  1S5B D;  2VUM G;  1UNS A;  4QY7 A;  4RGO S;  3JAM L;  5DLQ E;  4A4I A;  3HRZ C;  1AE2 A;  2PQA B;  1NBW A;  1PH3 A;  3WOE A;  2DUD A;  1JCK B;  5TSS A;  5BN5 A;  4QUF A;  2R92 H;  4KLK A;  1Q8K A;  4CJ0 B;  3T4A C;  1D2B A;  3OW7 A;  2JA6 H;  2WB1 E;  1CA5 A;  5C4X H;  1V1Q A;  1EYC A;  2F0H A;  2NN6 I;  2Q8R E;  4DR3 L;  4K8I A;  1IYJ B;  4HCE A;  4IPC A;  4LUZ A;  3M4Y A;  4YY3 Q;  5FJ8 G;  5C0X J;  1PH9 A;  1F9P A;  4R9W A;  4BY7 H;  1IBM Q;  2PZW A;  2F0S A;  4GN3 B;  1HFG A;  3HOY H;  4A3I G;  1JB7 A;  3C46 A;  1XPO A;  3CC4 A;  4JV5 L;  1WD0 A;  1KNA A;  4MN3 A;  4K6L A;  2L5T A;  5C0X H;  2ENB A;  1O7I A;  3NTI A;  4UP7 A;  3DWA A;  1S5D D;  4N9T A;  3HP3 A;  4Q0F A;  5K36 H;  1EQT A;  2B2T C;  3WDN A;  2CH4 W;  1FNV A;  2K01 A;  4DAM A;  3BDC A;  1I4X A;  1Q12 A;  4XT3 B;  2B29 A;  3SK5 A;  4LW1 A;  1VQ6 A;  3T1Y Q;  1E1T A;  4LF6 Q;  3CU7 A;  2ASB A;  4L5T A;  4RGT A;  4NXM Q;  2VUM B;  2FIN B;  4Z9C B;  4ME3 A;  4DV7 L;  1ASZ A;  2L15 A;  3MXN B;  2JQO A;  3OIP A;  1PYW D;  5T1G A;  4DV1 Q;  4CGY B;  3K5N A;  1CHQ D;  1LO5 D;  1IHZ A;  2RF4 A;  3IFD A;  3O13 A;  4KHP Q;  4HIM A;  1MBY A;  2KUM A;  3TP5 A;  1Q3L A;  1KRT A;  5I4D A;  3SHL A;  4J6H A;  2KCT A;  1VQ8 A;  1C8C A;  1CQV A;  2O4X A;  3TQY A;  4DV5 Q;  1DCZ A;  5C4X G;  5E7N A;  4DR1 Q;  2EIF A;  1WCM H;  3AFP A;  4C3J H;  1HR0 L;  4G4K A;  3LGJ A;  2KCC A;  1N36 Q;  4FF3 A;  1SFO B;  2UUC L;  4BBR H;  3D3R A;  1SE4 A;  4H02 A;  2WAQ E;  2R92 G;  3RLO A;  1LM0 A;  4OEM B;  3KFU A;  1L0X B;  1NR2 A;  3GTP B;  1C48 A;  1RD9 D;  3HOW B;  1JOQ A;  3Q24 A;  1IW7 C;  1LT6 D;  4R8I A;  4JI5 Q;  3H09 A;  4C1N K;  1AZQ A;  1PH8 A;  1M8A A;  2OEO A;  3T51 B;  3E3X A;  1GUW A;  2FMM A;  1Q46 A;  2N78 A;  5IGB A;  3H0G G;  2R7Z B;  1I4G A;  3FVQ A;  3LNN A;  1L2F A;  3EN2 A;  5ELC A;  3J7A V;  4WJ3 M;  3UE0 A;  5HGQ A;  1SAP A;  5FLM H;  3NUC A;  2L11 A;  5COY A;  4I7Z C;  4UP9 A;  4YCU A;  2NVY B;  3K81 C;  3S14 H;  1STH A;  3GV3 A;  1J6Q A;  3A74 A;  4HSV A;  4B3M Q;  3I2Z A;  3GDE A;  4ZKB B;  3FP9 A;  3SK6 A;  3GTQ B;  1RDP D;  3GTL B;  3DEP A;  5M5W B;  2XNA C;  3NBH A;  5EKL A;  4BXX G;  2UU9 Q;  2RHS B;  1G29 1;  1K0S A;  1K73 C;  2Y0S G;  1Q81 C;  2J7Z A;  4KN4 C;  1SYE A;  2F0P A;  4DV3 L;  3OWF A;  4DAV A;  3MC0 B;  3J80 c;  4XDX A;  2MFI A;  1XPR A;  3KLS A;  3Q8D A;  1IBK L;  2HHH L;  1Z6H A;  1NR4 A;  4OO1 I;  1TWC H;  1KDB A;  1K28 A;  3W1G A;  1CKM A;  5C3E B;  4IOA A;  4RG1 A;  5D3I B;  3M7N A;  1V1O A;  1KLG D;  1PA6 A;  4NW2 A;  2AQ3 B;  3AMU A;  5BR8 L;  1YBY A;  2RSO A;  2CHB D;  1GUO A;  1X3G A;  1B9N A;  3CCQ A;  1PMR A;  1O7L A;  1E22 A;  2JE6 I;  4YCV A;  1B44 D;  1X3Q A;  2D0P A;  3TS0 A;  3S15 B;  1D5X C;  5IYD G;  4XQN A;  3E9I A;  1N8R C;  2K28 A;  2D9U A;  3RD4 A;  4IAL A;  3S1R H;  4JI4 L;  1QG7 A;  1Y1V H;  4C3H B;  1CKO A;  2R6G A;  3TRZ A;  1K83 B;  4JBJ A;  3SEB A;  4IUN A;  4DV1 L;  3PUY A;  4JI7 Q;  3H15 A;  2VQE Q;  4DUY Q;  4JI6 L;  1CSQ A;  3OW2 A;  5IGG A;  5IYB G;  1B2T A;  2DN8 A;  2ZTD A;  3U4V A;  3PCO B;  4ME5 A;  2Q2U A;  3NK9 A;  3D8G A;  2K14 A;  3NBH B;  2HQL A;  2PZT A;  3TBI B;  2EYO A;  5CC4 A;  3ND8 A;  5C3E G;  2JEB I;  4OON A;  1LTB D;  3S9W A;  1EL0 A;  3HG9 A;  3WOF A;  1ZEQ X;  4N8F A;  2CCZ A;  1IYU A;  4AH6 A;  3I91 A;  1GUN A;  1X55 A;  1C4Q A;  2RDF A;  4F87 A;  2PMZ B;  2VY3 A;  3T56 B;  3VR3 A;  1I4P A;  1QVG A;  2OWO A;  4DK1 A;  3OWE B;  5C44 G;  1TKW B;  1Q1E A;  2ZJR A;  3GTJ B;  5I2X A;  4HJ8 A;  4CDD C;  3GD7 A;  5FLX c;  2IPK D;  5K36 G;  5BR8 Q;  3K59 A;  3DEO A;  3KUP A;  1S5F D;  4UAI A;  1QVF A;  1I3Q B; 
#chains in the Genus database with same CATH homology
 4P75 A;  3PF4 A;  2Q2H A;  1YIJ A;  1XJV A;  4LWC A;  1Q7Y C;  1KD1 C;  2E2J H;  3GTM H;  3F8T A;  3PIO A;  1A8V A;  1MKH A;  4POF A;  3AEV A;  4JYA L;  4JI8 Q;  2IY5 B;  1G51 A;  4YHH L;  4JCV E;  2AMC B;  5JJL A;  5JJI A;  4QJF A;  1WJJ A;  4LF4 Q;  4JI0 Q;  1NTG A;  2LXK A;  5M3M G;  1HNW L;  3HOY G;  1J5E Q;  4Y7N H;  2GN5 A;  1PHJ A;  4A3C H;  2F4V L;  4IPD A;  2IHF A;  1R9T H;  3HOX G;  5EAY A;  4JI1 L;  4JBM A;  1B7Y B;  3F1Z A;  1YHB A;  1XTD A;  3CCU A;  3PUV A;  3I4O A;  1K8G A;  2E8G A;  5IT9 c;  1U0L A;  1VQD A;  1VQB A;  1EFW A;  4X66 Q;  5M3F G;  1VQ4 A;  3CCJ A;  4BA2 I;  4OX9 L;  4GS3 A;  3S1Q H;  4YWL A;  3STB C;  4DR7 Q;  4YWM A;  4GNX A;  5C0X I;  3STB D;  4A3J G;  1H95 A;  1N34 L;  3ICE A;  3E0E A;  1YJN A;  4LF9 L;  1WCM G;  5GAH C;  2MO0 A;  3GTG H;  1D7Q A;  1FL0 A;  1L1O C;  1XPU A;  1K8A C;  1A62 A;  3UE1 A;  4GOP B;  3KOJ A;  2AKW B;  1G6P A;  3WWV A;  2VQF Q;  4DUY L;  3HOX H;  3M4O H;  4LF8 L;  1EWI A;  4DPG A;  3CC7 A;  3PV0 A;  2UUA L;  4LF9 Q;  4DV6 L;  1VQN A;  2YYZ A;  1XMO L;  3RLN A;  3UDX A;  5JEA G;  1XMQ Q;  1FJG L;  1PH6 A;  5C4J H;  2JEA I;  3UDI A;  4R4Q A;  1CKN A;  2OCE A;  4Y52 H;  4A3B H;  3RN2 A;  1XNQ L;  2D62 A;  1GD7 A;  3KF6 A;  5C0X G;  1JE5 A;  2BH8 A;  1VQP A;  4P73 A;  4TVA B;  4DR5 Q;  2WP8 J;  2ZTC A;  2OQ0 A;  4DKA C;  4L5R C;  1I94 L;  4POG A;  3RZD H;  4JV5 Q;  1WOC A;  1EYG A;  3KDF B;  1NMF A;  1SLJ A;  3FHW A;  2NVX H;  3J81 j;  3G71 A;  1X56 A;  1VQ9 A;  3GTO H;  3I4M H;  3U4Z A;  4BY7 G;  1MJC A;  3RNU A;  1HNX Q;  3PUW A;  4MNO A;  5FJ8 H;  4A3J H;  2Y0S E;  4JC0 A;  2CFM A;  2BH2 A;  3J81 i;  1UE5 A;  4TQU S;  1EQR A;  4QIW E;  2YV5 A;  1E7Z A;  4BY1 H;  3AFQ A;  5IE8 A;  1VS0 A;  2B3G A;  2K5H A;  3U58 A;  5IYD H;  1N32 Q;  3PSI A;  4XIG S;  1M1K C;  1C7Y A;  4A3K H;  3GTP H;  1Q82 C;  4DV2 Q;  1HNW Q;  3M9B A;  4BA1 I;  4A93 G;  1PH5 A;  4A3L H;  4FDB A;  1Y1W G;  4LUO A;  1L1O B;  4HID A;  4HJA A;  1GKH A;  4PZ6 A;  3SGI A;  2UXB Q;  1B8A A;  2JJQ A;  3M4Q A;  3RR5 A;  3KYH C;  3G6E A;  1XNQ Q;  3G48 A;  1PH4 A;  3I7F A;  2K52 A;  1WI5 A;  2NZO A;  3MEF A;  4LFC L;  1BVS A;  1Z47 A;  2XGT A;  3HKS A;  4QGU A;  4DV7 Q;  4DR5 L;  2NVQ H;  5M5W H;  1X3F A;  3NEN A;  4BXX H;  2MO1 A;  5GQO A;  2ZJQ A;  4WJ4 A;  4P71 A;  1PH7 A;  2B63 G;  3RLF A;  3D31 A;  2YTX A;  1TWH H;  4DAY B;  2KHI A;  3IRB A;  4JYA Q;  1S3O A;  3TEH B;  4X64 Q;  4GNX C;  3J7Z C;  2N8N A;  1OXT A;  4LFC Q;  2XTI A;  1NJI C;  1C0A A;  3K7U C;  4R4I A;  2OQK A;  2ATW A;  1X54 A;  4PG3 A;  4DV4 Q;  5J3B A;  3T1H Q;  5M3F H;  3HOU H;  4IJL A;  4DK6 C;  1OXV A;  4DUZ Q;  3T1Y L;  3I4N H;  4YWK A;  1AE3 A;  4JI5 L;  2OTJ A;  1UWV A;  2F52 A;  1SE8 A;  1NY4 A;  2VQF L;  1N32 L;  5GAD C;  4LNQ A;  1YJ9 A;  2UU9 L;  4R4T A;  5M5X H;  1CSP A;  1UEB A;  1I5F A;  4X62 L;  5LMU L;  3HOZ H;  2EXD A;  4A3M G;  4DR7 L;  1WFQ A;  1N36 L;  2VNU D;  5C3E H;  1CUK A;  1Z9F A;  1N34 Q;  4X6A H;  1OXU A;  4X66 L;  4DUZ L;  2JA7 H;  3BU2 A;  2UXC Q;  4IJH A;  2K5V A;  3CXC A;  2KBN A;  1IZ6 A;  4DR4 L;  3ERS X;  4A3D G;  2I5H A;  2JA6 G;  1KIX A;  4LFA Q;  1N33 L;  1YZ6 A;  2YTV A;  3VDY A;  4P72 A;  1OXS C;  4QL5 A;  1FGU A;  1YI2 A;  1OTC A;  3S1N H;  2PNH A;  4DV0 Q;  4A3E G;  2I5L X;  4QQB X;  4JOI C;  4HJ5 A;  1BBW A;  2IX0 A;  3GTK H;  3I56 A;  2QA4 A;  1IL2 A;  3BJU A;  3KJO A;  1XMO Q;  1VQC A;  2CWA A;  2JA5 G;  2R7Z H;  4K0K Q;  1U5K A;  2ZTE A;  4DR2 Q;  1KL9 A;  2N49 A;  5LMN Q;  1HZA A;  1E1O A;  4GKJ L;  2VUM G;  4QY7 A;  1PH3 A;  5DLQ E;  1SMX A;  4A4I A;  1AE2 A;  2PQA B;  1NBW A;  1HNZ Q;  2DUD A;  1Y1V G;  1GO3 E;  1I3Q H;  1HZC A;  1VQG A;  3HKZ G;  2R92 H;  3I4N G;  3NEM A;  2VQE L;  1EIF A;  1NMG A;  1Q8K A;  2FXQ A;  4KLK A;  4MZ9 A;  1BKB A;  4ALP A;  2R7D A;  1HZ9 A;  3CAM A;  4AIM A;  1VQA A;  4IO9 A;  2WB1 E;  2D0O A;  2JA6 H;  1Q1B A;  5C4X H;  3UDG A;  1KC8 C;  1V1Q A;  2NN6 I;  1HNZ L;  5ELO A;  4DR3 L;  2E5L L;  1IYJ B;  4OX9 Q;  2JA8 G;  3FKI H;  2LSS A;  4IPC A;  1YHA A;  3DM3 A;  4LUZ A;  4YY3 Q;  5FJ8 G;  1CKN B;  5C0X J;  3CME A;  1PH9 A;  4A3C G;  4GLV B;  1IBM Q;  2K50 A;  4GN3 B;  2JA5 H;  4BY7 H;  4GKJ Q;  3JC6 6;  3HOY H;  4A3I G;  1JB7 A;  3ER0 A;  1XPO A;  2A1A A;  3CC4 A;  3CD6 A;  4JV5 L;  1WYD A;  1PV4 A;  4KI0 A;  3CCE A;  1X9N A;  4JBK A;  1E24 A;  4YY3 L;  4AYB G;  2K4K A;  4DV0 L;  4A3K G;  2ZM6 Q;  2A19 A;  5IP9 H;  1VQ5 A;  3J80 i;  4KHP L;  5IP9 G;  1O7I A;  1YIT A;  4UP7 A;  3S24 A;  5AJ3 L;  3K80 C;  3S16 H;  4B3S Q;  2QGQ A;  2BA0 A;  2ID0 A;  3OYY A;  1HZB A;  1ASY A;  5IWA L;  2UXD Q;  2K75 A;  2MQH A;  3S17 H;  5LMU Q;  4DAM A;  3M85 A;  3CPF A;  3KJP A;  4IFD I;  4A3I H;  1M90 C;  2E2I H;  2V1C C;  4LFB L;  1PVO A;  1XNR L;  1L0W A;  3BZC A;  5M3M H;  4DR3 Q;  2E5L Q;  4OWW B;  1KRS A;  1VCI A;  1Q12 A;  1X3E A;  4DV4 L;  3T1H L;  3JAM c;  1PFS A;  2B29 A;  3H3V H;  4LW1 A;  2PI2 E;  3PGZ A;  3GO5 A;  3OTO Q;  3T1Y Q;  5IYC G;  1E1T A;  4JI7 L;  2BA1 A;  1VQ6 A;  4LF6 Q;  2ASB A;  3CP0 A;  4L5T A;  5FLM G;  5IWA Q;  4NXM Q;  1KXL A;  4B3R Q;  4ME3 A;  4DV7 L;  1ASZ A;  4LFB Q;  2ZJP A;  1UE1 A;  3EIV A;  4A3B G;  2L15 A;  3EBE A;  2JQO A;  3MXN B;  1EUJ A;  2VL6 A;  4APV A;  3HOV G;  2NVT H;  1AH9 A;  2NN6 G;  5AJ3 Q;  4DV1 Q;  3PF5 A;  3K0X A;  2JA9 A;  4IPG A;  1HR0 Q;  4B3T L;  3S1M H;  3HKZ E;  2ZM6 L;  4DV2 L;  3UDF A;  4C3H H;  5LMN L;  2RF4 A;  1PH1 A;  2JA7 G;  2HT1 A;  4HIM A;  4KHP Q;  1HR0 W;  5HY6 A;  4B3S L;  1VQF A;  4GOP C;  4A3M H;  4DR4 Q;  1KRT A;  1VQK A;  1JJC B;  1LUZ A;  1SN8 A;  2KCT A;  1VQ8 A;  3RN5 A;  1N33 Q;  2JA8 H;  3GTL H;  4JOI A;  4IPH A;  3TQY A;  2Z6K A;  4X65 L;  4DV5 Q;  2I0Q A;  5C4X G;  5E7N A;  3CCS A;  4DR1 Q;  2EIF A;  1WCM H;  3AFP A;  4C3J H;  4KHZ A;  2RHQ B;  1HR0 L;  1KQS A;  4B3T Q;  2NZH A;  3LGJ A;  2PMZ E;  1N36 Q;  2UUC L;  4BBR H;  3HOV H;  4BY1 G;  5GAE C;  3HOW G;  1P8L A;  4H02 A;  4R1J A;  2F3I A;  2WAQ E;  5JEA J;  2R92 G;  3RLO A;  1LM0 A;  3A0J A;  4LF6 L;  4C2M H;  3KFU A;  3H3V I;  1JJG A;  4B3R L;  2A8V A;  4X65 Q;  4DV5 L;  2R7Z G;  4A3F H;  2Z6K C;  4R4O A;  3RZO H;  4JI5 Q;  4PMW A;  1SRO A;  4AYB E;  1VQI A;  4MTN A;  3GTQ H;  1K3R A;  4JG2 A;  3HOZ G;  3CCV A;  3KF8 B;  4GOP A;  2YU9 H;  1XMQ L;  3W1B A;  1T9H A;  1PH8 A;  4PZ8 A;  5GAG C;  2CKZ B;  4A3E H;  4C3I H;  1TXY A;  2UUA Q;  4OO1 G;  4HIO A;  3CW2 C;  1IBK Q;  4BBR G;  1Q46 A;  2N78 A;  2WB1 G;  3H0G G;  1YJW A;  1L2F A;  3EN2 A;  4DV3 Q;  4HJ9 A;  2MNA A;  1X6O A;  2YTY A;  3UE0 A;  4WJ3 M;  4GN5 A;  5HGQ A;  1JMC A;  5IP7 G;  1QVC A;  3ZJY C;  5FLM H;  1L1O A;  4BBS H;  4UP9 A;  4A3G H;  4YCU A;  2KCM A;  1Q86 C;  1XNR Q;  1SRU A;  1K0R A;  3K81 C;  2VS1 A;  3AYH B;  5M5Y H;  4A3F G;  4NXN Q;  3S14 H;  1J6Q A;  2VZA A;  3J81 c;  3NEL A;  2UXC L;  3A74 A;  3B6Y A;  5ELN A;  3I2Z A;  4B3M Q;  3GDE A;  1VQ7 A;  3PIP A;  1VQO A;  2Q2I A;  3FP9 A;  4YHH Q;  3CMA A;  1Y1W H;  1MJE A;  3K8A A;  3PO2 H;  4A93 H;  4L5S A;  1LYL A;  3PO3 G;  1V43 A;  1K9M C;  1N9W A;  1HNX L;  1VQL A;  4EX5 A;  4A3D H;  4NXN L;  5IYC H;  4B3M L;  1BBU A;  1FVI A;  4BXX G;  2UU9 Q;  2RHS B;  2Z0S A;  1IBL L;  1G29 1;  1K73 C;  4O2D A;  3A5U A;  4JBW A;  2Y0S G;  5IYB H;  1UE7 A;  1Q81 C;  4HJ7 A;  2HHH Q;  1MIU A;  4JI1 Q;  2CWP A;  2JK8 A;  2PQA A;  3E9H A;  3KF6 B;  5C44 H;  4DV3 L;  4UY8 C;  4EQ5 A;  4JI2 L;  5JJK A;  3J80 c;  4JI3 L;  1VQM A;  1XPR A;  2MFI A;  2UXD L;  3AQQ A;  4A3G G;  2WAQ G;  3HOU G;  3Q8D A;  1IBK L;  2HHH L;  4BBS G;  4XTC S;  1A63 A;  1YVC A;  4OO1 I;  1TWC H;  4GKK Q;  1YHQ A;  3W1G A;  4JI2 Q;  2OTL A;  1EIY B;  2Q2T A;  1FJG Q;  1CKM A;  4IOA A;  1QZG A;  1K83 H;  4RG1 A;  3M7N A;  3PO2 G;  2LXJ A;  3OTO L;  2GVA A;  1PA6 A;  2EQS A;  5GRO A;  3CCM A;  3W5O A;  4J15 A;  4LF8 Q;  1PYB A;  5BR8 L;  4OWX B;  1YBY A;  4AQY Q;  1QUQ A;  5LMN W;  1KHI A;  4NPS A;  4JI6 Q;  3I4M G;  3S2D H;  2DGY A;  1X3G A;  3U50 C;  1YEZ A;  3PUX A;  3S15 H;  1NE3 A;  1TWA H;  3K7A H;  2UUC Q;  3CCQ A;  1E22 A;  3A5Z B;  2JE6 I;  2KHJ A;  1SFO H;  3BZK A;  4YCV A;  5IP7 H;  4IFD J;  2D0P A;  3TS0 A;  3L7Z C;  2K5N A;  1C9O A;  1X65 A;  3ULJ A;  4GNX B;  5IYD G;  3D0F A;  3E9I A;  3JAM i;  3G4S A;  2VW9 A;  1N8R C;  4YCW A;  3F2B A;  2CQO A;  2F4V Q;  3HOW H;  3S1R H;  1JJ2 A;  4JI4 L;  2R93 G;  2R93 H;  1PH2 A;  4GLA C;  4X64 L;  1Y1V H;  4LF5 Q;  4JI8 L;  4R4C A;  1GVP A;  4GKK L;  1DGS A;  1CKO A;  1EOV A;  1LTL A;  4P74 A;  2R6G A;  2E2H H;  2RCN A;  3TRZ A;  4RMF A;  4JBJ A;  1HH2 P;  1W3S A;  3F2C A;  3L2P A;  4DV1 L;  1RL2 A;  3M4P A;  2AWN A;  2IT1 A;  2UUB Q;  4JI3 Q;  3PUY A;  4K0K L;  4JI7 Q;  3H15 A;  1S72 A;  2VQE Q;  4DUY Q;  4JI6 L;  1CSQ A;  3OW2 A;  1QVF A;  5IYB G;  1IXR A;  3KLW A;  2QEX A;  4LF5 L;  4LF7 Q;  3ULP A;  1PYS B;  2ZTD A;  2HIV A;  3I55 A;  3U4V A;  3PCO B;  4OWT B;  2Q2U A;  1SR3 A;  3CQZ H;  4DV6 Q;  1TWG H;  1OXX K;  1A0I A;  2K14 A;  3NBH B;  1W2B A;  2R7F A;  2HQL A;  2UUB L;  1EQQ A;  4HIK A;  1QUQ B;  3ULL A;  2NVY H;  1UE6 A;  2IHE A;  4UP8 A;  5H1S E;  3CCR A;  1KAW A;  2WFW A;  4A76 A;  4DR6 L;  3PO3 H;  4LF7 L;  5C3E G;  2JEB I;  4OON A;  3L0O A;  2I5M X;  2AWO A;  1V9P A;  4JI4 Q;  4A75 A;  1P16 A;  4PZ7 A;  1D8L A;  1HJP A;  3CPW A;  3TS2 A;  4DR2 L;  4O0A A;  1Y14 B;  4DR1 L;  2CCZ A;  1B70 B;  4GN4 B;  4UPA A;  4DNI A;  2ALY B;  3FKI G;  4AH6 A;  1I94 Q;  1IBL Q;  4L5Q A;  1IBM L;  1X55 A;  4OXP A;  4LF4 L;  2KEN A;  1GM5 A;  5IY0 A;  2IX1 A;  3TRE A;  1VQH A;  4LFA L;  1VQE A;  1E3P A;  2B63 H;  4X62 Q;  1I50 H;  3H0G H;  1QZH A;  1JT8 A;  2VY3 A;  3CF5 A;  4JI0 L;  2C35 B;  2H5X A;  3HFZ B;  1J5E L;  3S2H H;  4GLX A;  1QVG A;  2OWO A;  1I6H H;  3J7A 5;  2ES2 A;  5C44 G;  3KDF A;  4NXM L;  4DR6 Q;  1Q1E A;  1TWF H;  2ZJR A;  2VUM H;  4DK3 C;  4LUV A;  2UXB L;  4HJ8 A;  1VQJ A;  3GD7 A;  5FLX c;  4IOC A;  2PI2 A;  2AHO B;  2HIX A;  3PUZ A;  1S40 A;  4A3L G;  5K36 G;  3M3Y H;  4IFD G;  5BR8 Q;  4AQY L;  3CC2 A;  3CCL A;  3F2D A;  2GVB A;  2N3S A;  4NB3 A;  3GTJ H;  3DLL A;  1RIP A;  1YNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...