4A3DH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dH00
2I0QA 1E1TA 2NN6G 4OO1I 2K5NA 3NBHB 4KI0A 2R6GA 3UDXA 2R7ZG 2K52A 4RG1A 1WFQA 2GN5A 3RZDH 3PUXA 1HNZQ 3PUVA 2I5MX 4DK3C 3I2ZA 1M1KC 4LF5Q 1XTDA 4LF7Q 3D31A 3OTOL 4LUVA 1S72A 1I6HH 1M90C 2JK8A 1N33Q 2VUMH 5C0XJ 4L5SA 2VS1A 2Y0SG 4HIDA 2EXDA 4A3EH 5LMNW 4IO9A 4IJHA 1XPRA 1UEBA 1VQOA 1K8AC 4DR4L 3STBC 1XPUA 1R9TH 3PUWA 4JI2Q 3GTOH 4FDBA 4DV3L 4A3KG 1KQSA 4JBJA 3J81i 5JEAJ 1PYBA 4JOIA 1HZCA 1VQ9A 3H0GH 5M3FH 2H5XA 4JI0Q 3I4NG 3K7AH 4TQUS 1N34Q 4GLVB 5GAGC 2EQSA 5IYCG 1KIXA 1Y1VG 1HJPA 2K14A 4JI1L 4DPGA 2B29A 2PMZE 1C7YA 4GNXA 1QUQA 3FP9A 1YI2A 2C35B 3BU2A 4BY1H 2R92G 4A93H 4JI3L 4JI8L 5EAYA 1VQ4A 4AYBE 2OTJA 1CSPA 1YEZA 5FJ8G 4LFAQ 1Q1EA 1J6QA 4DV4L 1EQQA 3CPFA 3A0JA 4OWXB 1HH2P 2YV5A 2N78A 3M4PA 5ELNA 2NVXH 3J80i 3F2DA 3M9BA 2ZJQA 4POGA 1FGUA 1B70B 4MZ9A 4A3FG 4JOIC 3UDIA 4DAYB 3G6EA 3CCSA 1SE8A 3JAMi 3B6YA 3I55A 3L7ZC 4LUZA 3GTQH 1WI5A 2CWPA 3J81j 3F8TA 1HNXQ 2YTYA 1KRTA 1VS0A 2R93G 1CSQA 5IE8A 2PQAA 4C3JH 2JA8G 1UWVA 4GNXC 1RIPA 1WYDA 1PFSA 1PH4A 4YCWA 3PIPA 1KRSA 2K5HA 4KHZA 4BY7H 4JBKA 1X6OA 4BBRH 3T1YL 1WCMG 2JA5G 2MFIA 4BBSG 4B3ML 1MJCA 5IP7G 1AH9A 2R7FA 1NMGA 4OONA 1LM0A 1YIJA 2JA6H 1I94L 4LFCQ 1V1QA 3CP0A 3AQQA 1K8GA 2CWAA 1A63A 2MO1A 5M3MH 1EYGA 3F2BA 4X62L 1C9OA 4XTCS 4JCVE 4DV0L 1KL9A 4GKKL 5ELOA 3Q8DA 4B3MQ 1B8AA 1VQGA 1Q86C 1SRUA 1EQRA 3KLWA 1Y14B 3S14H 1I94Q 4QIWE 4A75A 5HGQA 2B63G 3K7UC 5C4XG 1TXYA 4X62Q 2UUCQ 4NXML 2WAQG 2FXQA 2UUBQ 1E22A 4GKKQ 5C3EG 1V9PA 2PI2A 3AFQA 4Y7NH 4DR3L 4A3FH 1VQLA 4BXXG 4O0AA 5C4JH 1PA6A 3I4MH 1BBWA 3CC2A 2E2IH 3CCJA 4HJ7A 4A3MG 2XTIA 3BJUA 2Y0SE 2UXDL 4X66L 4A3IG 2OQ0A 4LF6Q 2JA7G 3RZOH 3FKIH 2N8NA 2BH2A 4DR6Q 1N36L 4APVA 1Q8KA 4DR1Q 1GM5A 2UXCL 2E2HH 2JA5H 1QVGA 2CCZA 2HT1A 4BBSH 4KHPQ 5IYDH 4JI5L 3BZKA 4NPSA 4DKAC 5IP7H 4HJ8A 1VQPA 1J5EL 4DR7Q 1D8LA 2ZM6Q 4GN5A 1IBML 4X65L 3STBD 4L5RC 3UE0A 1I50H 4LNQA 4HJ5A 1XMQL 2IT1A 4JI7Q 1PVOA 2Z0SA 4PMWA 5IY0A 2JEAI 2K5VA 2N49A 4IFDG 1TWGH 2NVYH 4YWMA 2AKWB 2UUAL 3HOUG 3OW2A 1L2FA 4IPCA 3G71A 4OXPA 1G291 4YHHL 2PI2E 1Y1WG 1ASZA 5JJLA 4R4CA 1CUKA 4O2DA 4YY3Q 1NE3A 1VQ8A 1VQHA 3HKZG 5C44H 1S40A 1Q81C 2MNAA 1VQNA 1PH5A 1IXRA 4BXXH 1VQ7A 1YHBA 4GKJL 3ZJYC 4OX9L 3H3VH 1JB7A 3LGJA 4DV2L 1PH2A 1X3EA 2ALYB 2LXKA 5DLQE 4HIOA 4QQBX 4A3LH 3ICEA 1IBKQ 1Z47A 3IRBA 1JJ2A 4DUYQ 4UPAA 5LMUQ 2CQOA 4L5QA 2CKZB 3HOYH 4OX9Q 4LF9L 2BA1A 3PV0A 2HHHL 4K0KL 3PCOB 1A8VA 2D62A 3HOVH 3CCEA 1BVSA 3RN2A 1VQMA 4P75A 1JE5A 4WJ3M 2NZOA 1KC8C 3KF6A 3PF4A 3BZCA 1CKMA 2K75A 3OTOQ 1VQFA 5M5WH 1XNQL 3CC4A 4LF9Q 2VQFL 4HIKA 3L2PA 1YNXA 3AYHB 3E9IA 4DR4Q 3KJOA 1Q82C 3RN5A 3PO3H 1A62A 3KDFB 1BBUA 3PF5A 4DV3Q 2WP8J 2VQEL 4HIMA 1KHIA 2WAQE 4JYAL 1C0AA 1PH7A 4JC0A 3S1RH 4A3DH 2NZHA 1U5KA 3CCQA 2NN6I 4JI1Q 4IJLA 1W2BA 3TRZA 1UE6A 1E3PA 3A74A 2ASBA 1PH9A 2QGQA 3KOJA 2VZAA 2VQEQ 2R7ZH 1CKNB 3U4VA 3GTMH 3S15H 4JI3Q 4JI8Q 2WFWA 4JYAQ 1WOCA 1H95A 3KFUA 5GAEC 3F1ZA 1OXUA 4DV4Q 1YBYA 1X65A 1E1OA 3M7NA 2WB1G 3GO5A 4GN4B 4LF4L 4LUOA 4KLKA 2AWNA 4IPGA 3CCUA 2ID0A 1L1OB 3M4QA 4J15A 4A3KH 4MNOA 1QVFA 2I5LX 2K50A 5GQOA 4GOPB 5H1SE 2YYZA 3DM3A 4BA2I 1LUZA 2CFMA 2BA0A 3I4NH 1VCIA 3CPWA 1PH6A 1AE3A 4LF8L 5JJIA 5M5YH 4LF4Q 5IYCH 1Y1VH 1XNRL 1OXSC 4P74A 1NBWA 1VQCA 1SN8A 4JG2A 3T1YQ 3UDFA 2R92H 3HKSA 3HKZE 4ALPA 4OWTB 1PH8A 1D7QA 2B3GA 1HR0L 2AWOA 5FJ8H 4A3BG 1E7ZA 1WJJA 5C0XG 3G4SA 1LTLA 1SFOH 1BKBA 4JI4L 1YJNA 1GO3E 1IBLL 1VQBA 2JJQA 5IYBG 1YVCA 4DV0Q 1A0IA 3I4OA 3J7ZC 2ZJPA 3EN2A 4JI6L 3J7A5 4B3SL 1UE5A 4NB3A 5AJ3L 3HOXG 3TS2A 4A3CG 1HNWL 1YJ9A 5JEAG 3CCMA 4DUZL 3S2DH 1YITA 2RHQB 4A3GG 1EUJA 3S1QH 3U50C 1LYLA 2I5HA 4C3HH 1IBLQ 2UXBL 2R93H 3K80C 3JC66 2JA8H 3I56A 4NXMQ 1XMOL 4POFA 4JI6Q 1GD7A 3HOWG 1I3QH 5AJ3Q 1YZ6A 4LFBL 4DR3Q 3K81C 4B3RL 1HNWQ 3A5ZB 5GROA 1SLJA 1YHAA 2HQLA 5IWAL 3CC7A 3UDGA 1PH1A 1GKHA 3HOZG 4DR2L 1WCMH 3MXNB 4A3JG 1KD1C 3CCLA 4UP9A 3PO2G 1FVIA 5K36G 2UXDQ 4X66Q 3PIOA 3KYHC 4Y52H 5IP9G 4LFBQ 4B3RQ 2F3IA 1N32L 1N36Q 2GVAA 2KCTA 2L15A 4DR5L 1EIYB 2OCEA 5IWAQ 5LMNL 1K83H 2UXCQ 1K0RA 2VNUD 4OO1G 2D0PA 4PZ6A 4YWLA 2E5LL 4JI5Q 3TQYA 2VW9A 1J5EQ 1K9MC 3GDEA 1P8LA 2IHEA 3WWVA 2R7DA 2AHOB 1IBMQ 4X65Q 1MKHA 1TWCH 2B63H 4GNXB 1QUQB 5C4XH 1UE1A 2ZTDA 5GAHC 4PG3A 4X64L 4A76A 4DR5Q 1XPOA 1XMQQ 2VUMG 3ULPA 3NELA 1AE2A 3E0EA 2LXJA 1UE7A 5C3EH 2KCMA 2E5LQ 4A3EG 2UUAQ 1N9WA 3H3VI 4DV6L 1VQ5A 4DV1L 3M3YH 1VQ6A 4YHHQ 2VY3A 2A19A 3W1BA 4A3MH 1Q12A 2RF4A 2Q2IA 4ME3A 4LFAL 4A3IH 2WB1E 2JA7H 3H0GG 5M3FG 1X54A 4GKJQ 4AH6A 2Z6KA 1QZHA 4IPHA 4X6AH 1Z9FA 4EX5A 3CQZH 4DV2Q 3MEFA 3AFPA 2IX1A 4C2MH 3EIVA 2PNHA 2PQAB 1P16A 1PV4A 2OWOA 2E8GA 4BY1G 1PYSB 4A93G 3M4OH 4R1JA 5IP9H 1K3RA 2K4KA 3RLNA 4LF5L 4LF7L 1VQJA 3UE1A 3J81c 2HHHQ 1HZ9A 1N33L 1ASYA 4K0KQ 3KF8B 4AIMA 4IFDI 2JA9A 1TWAH 2A1AA 2ATWA 3HOUH 1N8RC 1S3OA 2LSSA 1VQEA 2RCNA 4IOCA 4JI2L 3ERSX 1Y1WH 1XNQQ 4C3IH 1G6PA 4UY8C 4BA1I 4DNIA 2VQFQ 4R4TA 3CCRA 2Z6KC 3TEHB 1MIUA 4JI0L 3CMEA 1QZGA 1IZ6A 1N34L 1PH3A 1T9HA 1I5FA 4AQYL 3RNUA 2QA4A 3S16H 4PZ8A 3L0OA 2XGTA 2ZTEA 3PUYA 3HFZB 4P73A 4BY7G 3J80c 2HIXA 4BBRG 3KJPA 1MJEA 2E2JH 2VL6A 2OTLA 5JJKA 2YTVA 3K0XA 1EOVA 3PGZA 3T1HL 5FLMG 1PHJA 3JAMc 4B3TL 2JA6G 4MTNA 4AQYQ 3NEMA 4QJFA 3RR5A 5FLXc 1NJIC 1XJVA 1OTCA 3CXCA 3SGIA 5M3MG 4R4IA 1QVCA 5J3BA 1L0WA 4R4QA 3FHWA 1JT8A 2KHIA 1YJWA 3S17H 1YHQA 2IHFA 1VQIA 2DUDA 3T1HQ 1U0LA 4B3TQ 2YTXA 4JV5L 1Q7YC 1HNXL 2KENA 3S24A 3M85A 3TS0A 3GD7A 4DAMA 1G51A 1GVPA 2MQHA 5HY6A 2NVTH 1EWIA 1IYJB 2NVQH 3GTKH 4IOAA 3K8AA 1VQKA 4IFDJ 2IY5B 2Q2HA 4JV5Q 3I4MG 2D0OA 3ER0A 4UP7A 3H15A 3S2HH 4YCUA 1JMCA 2JQOA 1OXXK 1DGSA 1TWFH 3ULJA 4LF8Q 1EFWA 4LFCL 1HZAA 3FKIG 3CW2C 4DK6C 4DV5L 3S1MH 1OXTA 1XNRQ 1Q46A 3W1GA 3PSIA 5M5XH 2GVBA 1TWHH 4RMFA 2ES2A 3GTGH 4WJ4A 5IYDG 5FLMH 3GTPH 4OWWB 1V43A 1HR0Q 3AEVA 4DV5Q 4JBMA 3W5OA 4JI4Q 3EBEA 2N3SA 1FL0A 4NXNL 1W3SA 4L5TA 2IX0A 3KDFA 3GTLH 3G48A 3DLLA 2UUCL 4LW1A 3CD6A 3CF5A 3F2CA 2UUBL 4P71A 4UP8A 1B7YB 4HJAA 2Q2UA 4B3SQ 2A8VA 4YWKA 4DV7L 3ULLA 2MO0A 3U4ZA 3TREA 4DUZQ 2OQKA 2F4VL 1FJGL 3S1NH 4NXNQ 2UXBQ 1JJCB 5E7NA 1OXVA 1O7IA 4JBWA 4LF6L 1CKNA 1XMOQ 4AYBG 1K73C 5C44G 3KF6B 4H02A 2ZJRA 4TVAB 4DR6L 2JEBI 4QGUA 4DV7Q 4DR1L 3NENA 3D0FA 3CMAA 5IT9c 2F4VQ 1FJGQ 4DR2Q 4YCVA 4A3LG 4QL5A 1SMXA 4KHPL 4DR7L 1E24A 4GLXA 2ZM6L 3E9HA 5C0XI 1X56A 4A3BH 4GS3A 1NMFA 3VDYA 1Q1BA 2F52A 1N32Q 3HOYG 1L1OA 5IYBH 4LWCA 2Q2TA 4JI7L 1NY4A 5LMNQ 2QEXA 1KAWA 2KHJA 4GOPA 3HOVG 3A5UA 1SR3A 5BR8L 3CCVA 3I7FA 3HOXH 2BH8A 4A3CH 2UU9L 1X55A 4PZ7A 4A3GH 1X3GA 4IPDA 4QY7A 4YY3L 4R4OA 1HR0W 2DGYA 4X64Q 1VQAA 3CAMA 1RL2A 1X9NA 2YU9H 2KBNA 3GTJH 3OYYA 1HZBA 4GLAC 5BR8Q 1X3FA 3HOWH 1SROA 1EIFA 4P72A 1IL2A 2JE6I 2UU9Q 1JJGA 2V1CC 4DV6Q 4GN3B 4EQ5A 4DV1Q 4A4IA 3PO3G 3HOZH 4A3JH 1KXLA 2HIVA 3PUZA 4XIGS 3RLFA 3U58A 1VQDA 1IBKL 3PO2H 1HNZL 2RHSB 1L1OC 2ZTCA 5GADC 4HJ9A 3RLOA 1CKOA 1NTGA 4DUYL 4A3DG 5LMUL 2EIFA 2AMCB 4GOPC
chains in the Genus database with same CATH superfamily
2I0QA 1E1TA 5EKKA 4A93B 4KI0A 2R7ZG 3U9OA 1HNZQ 3X3NA 5KYLA 3PUVA 2I5MX 4PV1C 4LF7Q 4LF5Q 2XN9C 3D31A 5CYUA 1S72A 2MPMA 3GTKB 2NVTB 3NTHA 1I4PA 4L5SA 4HIDA 2EXDA 2F0MA 3L9AX 3Q24A 4IO9A 3MAQA 4ZKBB 3NTKA 3STBC 1W6KA 3NWTA 5I6WA 4TSSA 3PUWA 4LAAA 1M4VA 4JOIA 3H0GH 4TKOB 2H5XA 3OWEB 1S5BD 2X69A 3K7AH 3SK8A 1N34Q 1TY2A 5M5XB 1JOOA 2EQSA 5EKIA 4DPGA 2B29A 2PMZE 1C7YA 4GNXA 2A73B 1YI2A 4YIJA 2JA6B 3DM1A 3OIQA 5T1IA 3VYUA 4A93H 3R2IA 4K8IA 5EAYA 4AYBE 1B2TA 1CT1D 1EY5A 1EQQA 3BZDB 2G5DA 2YV5A 3M4PA 3J80L 3J80i 3M9BA 4J1MA 4XYOA 3H09A 4JOIC 1I4QA 3K0YA 1CHPD 1HNXQ 2EPBA 4ODGA 3HG9A 4CDFC 2R93G 1EY6A 4GNXC 2NB0A 1PFSA 4YCWA 1G2SA 4KHZA 1PFMA 3T1YL 4BBSG 3KF8A 4OONA 1YIJA 2PPBC 2JA6H 1I94L 1FD7D 2CWAA 4RGOS 4XTCS 4JCVE 3A56A 3Q8DA 1SRUA 5I9OA 1I94Q 1D5ZC 5HGQA 5C4XG 2EYOA 2L11A 2KUMA 3E0JA 4H44C 2FXQA 1V9PA 2PI2A 4DR3L 1F9QA 1AW7A 4KKSA 3PO2B 5C4JH 1PA6A 3CC2A 2E2IH 4A3MG 4K2LA 5IGCA 4NKLA 2B2VC 2OQ0A 1RKNA 4DR6Q 1GM5A 3RZDB 1EYCA 4MTKA 2CCZA 1FNWA 4BBSH 5IYDH 1TKWB 4NPSA 1HTLD 1I6HB 4GN5A 3UE0A 1KNEA 1HUNA 5FO7B 3D8GA 2K5VA 2N49A 2AKWB 1JE4A 1FNVA 1DZ1A 5JJLA 4R4CA 4O2DA 2QILA 3HKZG 4BS9A 5C44H 1VQNA 2EE1A 4GKJL 3H3VH 3OSOA 3KLSX 4BY1B 2LXKA 5C5LA 2K04A 1Z47A 1V1OA 5LMUQ 2CKZB 3C1FA 3PV0A 1CFMA 3HOVH 1YNNC 3CCEA 3GTQB 1HHVA 3ND8A 2NZOA 2CW0C 3KF6A 3PMFA 1I4XA 1AP0A 1I4GA 2VQFL 1V1PB 3T53B 2KEEA 3IFTA 3FEWX 2KA7A 4K2KA 1ET6A 4OIJA 4DR4Q 2P5ZX 4CDDC 5BN5A 2WP8J 5M5YB 2MJ8A 1KHIA 1PTOC 4JYAL 1FR3A 4JC0A 1CZGA 5DNFA 1ICWA 5JAVA 1G8ZD 3TRZA 1CKNB 4LJZC 2F0KA 4JYAQ 4JI8Q 3M7GA 3F1ZA 1MHWC 2BCOA 4UAIA 2B2UC 3Q23A 3GO5A 1E2VA 4GN4B 1U4PA 3I4MB 4LUOA 1SDFA 1SAPA 2AWNA 2ID0A 4N9TA 3M4QA 4DXFA 4J15A 5CV4A 1QVFA 4JW0A 1QOHA 5M5YH 1KAAA 1O80A 1OXSC 3A8IE 1SN8A 4JG2A 3UDFA 1WTWA 4J6HA 1I50B 3HKZE 4IN3A 5ELEA 2D5DA 1D7QA 4WFN3 1K83B 2QKIC 3G4SA 1LTLA 2MGSA 1YJNA 4DV0Q 1A0IA 2ZJPA 4B3SL 1HNWL 2X6GA 1YJ9A 4U68A 3CCMA 4DUZL 1YITA 2WAQB 4A3GG 3S1QH 3U50C 3QG1A 2UXBL 3I8ZA 1HPCA 2QW7A 2K32A 1EY4A 4POFA 3FRPB 1HNWQ 4B3RL 5KNCA 1DONA 3A5ZB 4QB4A 4DR2L 1WCMH 3MXNB 2ENBA 5LL6X 3HOZG 2I46A 2RQXA 5K36G 2UXDQ 4X66Q 3PIOA 3CQZB 4Y52H 1D2BA 1VF7A 4B3RQ 2F3IA 1N32L 2BDOA 2GVAA 1WTXA 2KCTA 1N36Q 4ZYSA 2OCEA 2L9HA 5C5MA 1K83H 1SJED 1UNSA 2VNUD 4OO1G 2D0PA 4YWLA 3SE0A 3WWVA 2LFNA 2AHOB 2NTTA 5LHY1 2EJGC 3SHLA 4PG3A 4A76A 1XMQQ 4LMQD 4OEMB 2C5CA 1F77A 3PO3B 3E0EA 1AE2A 1Y8PB 2WKCA 4A3EG 1TS4A 3H3VI 3MXGA 4YHHQ 2VY3A 2HCIA 3S1RB 1Q12A 5CC4A 1QZHA 4IPHA 3D3RA 1C4QA 3CQZH 2IX1A 3AFPA 1SSOA 3IAYA 1PRTD 4RHRA 1PV4A 1HQMC 2E8GA 5M9OA 3JAME 2QDLA 2AUJD 1ENAA 1PYSB 3SEBA 3M4OH 1JORA 2RKSA 1ZYRC 3I72A 2DY7A 3C3LA 3UE1A 2A69D 1N33L 1GJXA 1ASYA 1TS5A 3J7AF 4AIMA 2JA9A 1TWAH 2F0LA 4M8AA 4A3KB 1VQEA 4IUQA 1GUGA 1Y1WH 3I4NB 1EIHA 1G6PA 2DNEA 5A2QL 4R4TA 1Y1VB 1DOLA 4C3JG 4KJOA 1T9HA 4AQYL 3RNUA 4FXKC 2QA4A 4OELB 1HCZA 3P20A 1NR2A 1K28A 3HFZB 2EY5A 3D6WA 4BBRG 2VL6A 4KMUC 3T1HL 5I4DA 4AQYQ 3U9SA 2NUCA 3TN2A 5CV7A 3SGIA 3GTPB 1EOTA 5ELDA 5J3BA 4UDUC 1G2TA 3PIO3 3T1HQ 2PZWA 2JA8B 5F2DA 2KENA 1SNCA 3TSSA 3GD7A 2H4OA 1IYJB 1U9RA 1SNDA 2ZXRA 4Q5VA 2RDGA 3H15A 1GUOA 4UP7A 3S2HH 1JOQA 3TDQA 1OXXK 1WVLA 1IL8A 4LFCL 3S1MH 2FHTA 3W1GA 3VYRA 2GVBA 4RMFA 5D3DA 3GTPH 1PLFA 1D5XC 1V1PA 3NPPA 2F0VA 4DAPA 3W5OA 1QJOA 1OO9B 4JI4Q 2N3SA 5C3EB 1W3SA 3HOXB 4X3TA 3CD6A 1MD2D 5KNDA 1IKLA 2UUBL 5ELBA 5DM63 2HQEA 1ONLA 4EVOA 3D4DA 4A3IB 1FJGL 3M4YA 3HOWB 3S1NH 3URYA 5CV9A 1EY7A 1CKNA 4A3JB 2ZJRA 2EYHA 1I4RA 1VMPA 1FJGQ 1BCPD 3BDCA 4YCVA 4DR7L 3LX0A 2ZM6L 3E9HA 5IGDA 5C0XH 2A68C 3HOYG 1CHQD 4LWCA 2WKDA 4RA8A 2Q2TA 1KAWA 1BXTA 1DOMA 3QOLA 3HOXH 2DJFC 3R93A 3NP8A 1X55A 4N9PA 4QY7A 4IPDA 1HR0W 3QO2A 4X64Q 1VQAA 2KEDA 3CAMA 1X9NA 3GTJH 1HZBA 4GLAC 2OEOA 5CV8A 3HOWH 3NTIA 1EIFA 2JE6I 3IKJA 4GN3B 2E2JB 3MFGA 4A3JH 3PUZA 3OOCA 4XIGS 1SE2A 3RLFA 2RHSB 2ZTCA 4A3DG 3RLOA 2DY8A 3EVQA 3AMUA 2F0TA 1YNJD 1EZ8A 2PNRC 2NN6G 4OO1I 3UDXA 2R6GA 4RG1A 1M8AA 3AB9A 3P1HA 1M1KC 3A7AB 3DXJC 1LT3D 2CH4W 2KVMA 1M90C 2VUMH 2NVQB 3MXNA 2VS1A 2Y0SG 5LMNW 1XPRA 4S3SA 1VQOA 3K5OA 3K58A 1TIID 1R9TH 4FDBA 4DV3L 3J81L 3J81i 5JEAJ 1PYBA 1VQ9A 2OF1A 5M3FH 1O7ZA 4TQUS 3MZ5A 2D2CC 4GLVB 5IYCG 4LFAL 1KIXA 2K14A 4JI1L 2FFKB 3FP9A 1B50A 4L8JA 3BU2A 2RVLA 3GV3A 4ZCKA 3GTLB 2OTJA 4ID6A 2SNMA 1G91A 4LFAQ 1J6QA 3A0JA 4OWXB 1STNA 3SK6A 2ZJQA 1FGUA 1K3BC 1UAPA 4A3FG 3UDIA 4DAYB 3G6EA 1SE8A 3P7JA 3R2TA 3JAMi 3L7ZC 4LUZA 5TSSA 4I65A 1HA5A 3MEHA 1KRTA 4C3HG 4K5XA 1QE6A 1EFID 2A5HA 1WYDA 1PH4A 2XIWA 2F03A 2K5HA 4BY7H 1X6OA 1CTMA 1SYGA 2JA5G 3FKIB 1MJCA 4IUUA 5IP7G 4ZKCB 5BN3A 5CV6A 2K1BA 1RCVD 1EWHA 2AQ2B 2MO1A 3NUCA 4RCOA 5M3MH 3F2BA 1C9OA 4H13C 3O13A 5ELOA 1VQGA 3G7LA 1EQRA 2K6AA 3HRZC 3T4AC 1Y14B 3S14H 4V190 2B63G 1TXYA 1SNMA 4NXML 3AFQA 4A3FH 1STYA 1HTPA 3BVMA 1VQLA 4WRDA 1BBWA 3CCJA 4HJ7A 1V8QA 2XTIA 2Y0SE 1STAA 4FF4A 2JA7G 3RZOH 3FKIH 4CJ1B 4DR1Q 1Q8KA 1I4HA 2JYOA 2E2HH 3RMHA 2JA5H 5IP7H 1J5EL 1VQPA 1D8LA 2FMCA 3STBD 2IX3A 4HJ5A 2RSOA 1PVOA 2IT1A 4JI7Q 4PMWA 4ZUIA 4RGMA 1SYFA 4IFDG 4YWMA 2UUAL 1G6ZA 5KEEA 3HOUG 3OW2A 1G291 1EEFD 3H0GB 2CHBD 2PI2E 3K7AB 3KUPA 1VQHA 1S5FD 1IXRA 1VQ7A 3ZJYC 3QWNA 2CVRA 4DV2L 3J7AV 1X3EA 2DNCA 1JWUD 4A3LH 4A3DB 1IBKQ 2G9HD 1ZEQX 3IRBA 1JJ2A 4KD3A 3J7YW 3NK9A 2CQOA 3BYYB 1LTGD 1CA6A 2Z8LA 4LF9L 2BA1A 2RA4A 1AN8A 3VA7A 2D62A 2L5TA 1BVSA 4P75A 3V96A 1WTRA 5I6YA 5HURA 1AZQA 3PF4A 2K75A 1XNQL 5M5WH 4OIKA 4LF9Q 4DNTB 4HIKA 2ICIA 4H7BA 1YNXA 2LKVA 3KJOA 1BBUA 3PF5A 1S5ED 4HIMA 5ISRA 4A3DH 1SEBD 5G3LF 2NZHA 1U5KA 2EYPA 2NN6I 5EQ0A 3Q22A 1D5MC 3CCQA 1W2BA 3KLRA 3TBIB 2ASBA 1E3PA 3A74A 2R7ZH 2VZAA 3U4VA 3S15H 3T51B 1H95A 3KFUA 2GA4B 5GAEC 1RTNA 1X65A 3MVVA 1SBBB 2WB1G 5CMDA 5C4JB 2E2IB 4IPGA 3P75A 3R8BA 4MNOA 3DM3A 4P2CB 4BA2I 1LUZA 1E2WA 2CFMA 5FKAC 5E1FA 2XSCA 4BBSB 5IIFA 1NBWA 4I7ZC 3CRLC 2F0JA 4BWGB 3T1YQ 3HKSA 1HXYD 2SNSA 2B8GA 3ITPA 4OWTB 1PH8A 4A3BG 2VB3X 1KTKA 1WJJA 3Q6SA 1BF4A 1BKBA 2XRSD 4FXGC 1GO3E 2JJQA 3VA5A 3C46A 3J7A5 3OW7A 3NE5B 2MP1A 3TS2A 2Z4HA 4NB3A 5AJ3L 2JP1A 4A3CG 4KY5A 2F0FA 5C44B 2R93H 3I56A 2SOBA 1A6XA 3A8KE 1I3QH 5AJ3Q 4LFBL 4DR3Q 1EZ6A 2KCCA 1SLJA 1YHAA 3CC7A 5IWAL 2XRQD 5I2YA 3PO2G 1YNND 4FF2A 4F88A 3E3XA 3TP8A 3UI2A 5A2QE 5IP9G 4LFBQ 2CW0D 4ZQ3A 3HOVB 2XWJB 4DAYA 5E4XA 4DR5L 5IWAQ 1K0RA 2C9OA 4Q0FA 1W6JA 2IHEA 1DOKA 3G6JB 1TWCH 5C4XH 2NZ1D 4DR5Q 1BQQT 4C3IG 2F0UA 4G7HC 1PTOD 4RFBA 1JCKB 1T5EA 5IGEA 2QDBA 3HKZB 4CBVA 2A19A 1TQOA 4A3MH 1MSHA 5EPKA 4CKEA 2WB1E 2F0DA 4GKJQ 2K5WA 3GP7A 4R9WA 4AH6A 1EY9A 1Z9FA 4EX5A 3TP7A 4DN4M 1HRJA 4C2MH 3EIVA 2PNHA 2PQAB 3CRKC 4BY1G 2XNAC 1XTCD 2RCFA 3DWQA 4R1JA 1PDQA 5EPLA 5IP9H 1K3RA 2K4KA 4DA2A 3SK5A 1HZ9A 5CBAE 3S17B 4IFDI 1I6VC 2A1AA 1Y8OB 1WD1A 1S3OA 5JPNC 3N52A 4IOCA 4JI2L 4KK7A 4C3IH 2VQFQ 4JI0L 2M2LA 2KQ3A 2F0EA 1LT5D 2B2TA 3RD4A 1SYEA 4KN7C 3S16H 2XGTA 3DWPA 4GOPC 3KJPA 5JJKA 1SXTA 3K0XA 3TZUA 2Z1CA 3K5MA 4QJFA 5FLXc 1OTCA 3CXCA 4FYDA 1DXMA 4R4IA 1PZJD 1L0WA 4CHTB 3FHWA 1A3TA 1YJWA 3S17H 2IHFA 2B8FA 1EYDA 2DUDA 3S1QB 1U0LA 2YTXA 5KIXA 1BBXC 1ENFA 3S24A 2B2TC 3SK4A 4XYQA 4CKCA 1G51A 1GVPA 2MQHA 5HY6A 1EWIA 2QEJC 1WCMB 4IOAA 1DM0B 3I4MG 2D0OA 5FLXL 4IQZA 3MTSA 1GUWA 3DUZA 1TWFH 1QWYA 1NSNS 4KN4C 4QCLA 3LWEA 2PQEA 1Q3LA 5IGBA 1LTRD 3GQBA 4KV6A 1Q46A 1TWHH 2ES2A 3FMCA 3VR4A 1GHKA 4WJ4A 1ET9A 1BCPB 4IALA 4KHVA 2KCNA 3AEVA 3LWUA 2WACA 4QMGA 4B9XA 2IX0A 2A6HC 3HP3A 2UUCL 4LW1A 3CF5A 3F2CA 3H91A 1F2MA 4B3SQ 3K57A 3SVMA 4GZYC 1EQTA 4DUZQ 2F4VL 2A6EC 1IKMA 2UXBQ 1JJCB 2EDGA 4NDXA 1O7IA 4EQNA 4LF6L 4DAVA 1F9SA 5JJZA 4H02A 4L63B 1ZYRD 4TVAB 5DEHA 3NENA 5A35A 5IT9c 4WJWA 2F4VQ 4DR2Q 3M4OB 4QL5A 4KHPL 1JICA 3MC0B 4MIUA 3J81E 1Q1BA 3H6MA 3MXUA 2K05A 1N32Q 1TWAB 4IUNA 1TS2A 2KHJA 1JWMD 1SR3A 3BS1A 3CCVA 1CI3M 1Y1WB 1EYAA 2AUKA 4A3GH 4EQPA 1UUPA 4YY3L 1SYBA 4IURA 4HTHA 2DGYA 1RL2A 2YU9H 2KBNA 5I2XA 1GUNA 4C56C 1SROA 2K03A 5ELCA 1WTOA 3A8JE 3PO3G 3HOZH 1KXLA 2EJMA 5KRUA 3U58A 1WTHA 5K36H 1NNXA 1CKOA 1NTGA 4DUYL 2EIFA 2AMCB 1STBA 4QQBX 2F0IA 3ONAB 5D65A 4ZUJA 1L0XB 2X6LA 4OO1H 3I70A 3N6RA 4DK3C 1XTDA 2K28A 3OTOL 2O4XA 1A15A 4K14A 2JK8A 1N33Q 5C0XJ 1U4MA 4X3KA 1H9MA 4A3EH 4IJHA 2EY2A 1UEBA 3S2HB 1SE3A 1IW7C 1XXGA 4C3JB 4I7AA 4A3KG 3WDNA 4IUPA 1HZCA 3S1MB 1BDOA 3I4NG 3NQIA 2VB2X 3K5LA 1Y1VG 1HJPA 3GV6A 3BVZA 3H3VC 1C48A 1WD0A 1S5CD 4CDCC 2L0CA 3V05A 4JI3L 2R92G 4ABNA 1EY8A 5FJ8G 1PZID 1Q1EA 4DV4L 2FMMA 1HH2P 2NVXH 1JR0D 4L6TB 5ELNA 1QB5D 1H9SB 1B70B 3S1NB 3I55A 3QR8A 1WI5A 2CWPA 3OHXC 2YTYA 1CM9A 1VS0A 4RAUC 2JXMB 5IE8A 4Y7NB 3I73A 2PQAA 4C3JH 2JA8G 1UWVA 4FF3A 5EBDA 2B2YA 2A68D 1KRSA 1D1IA 4BBRH 1MI2A 2M9VA 4B3ML 3NBHA 1NMGA 1LM0A 2F0SA 5EPJA 1CZWA 4LFCQ 1PYWD 1V1QA 3AQQA 3CP0A 4X3SA 1K8GA 4XT3B 1TU2B 4B3MQ 1B8AA 1Q86C 2IL8A 4QIWE 5C6AA 3GTJB 3K7UC 2HDLA 4JK1C 1RDPD 2ZT9C 3CKIB 3R3OA 2UUBQ 1E22A 5C3EG 4BXXG 2L55A 5FK9C 4Y7NH 1A3UA 1UEAB 4O0AA 3BVGA 4F8MA 1IYVA 4DFAA 2F0NA 4A3IG 4RKLA 1GHJA 4K5VA 1IYUA 2CQAA 2N8NA 4E6IA 4APVA 1LT4D 5COYA 5D3IB 3SDZA 2UXCL 3I90A 5AFWA 4JI5L 4HJ8A 4DR7Q 2ZM6Q 2VUMB 1IBML 4X65L 4L5RC 2L12A 1LTAD 2AQ3B 1E2ZA 3L3OC 1ILPA 2Z0SA 2JEAI 5LL6S 2NVYH 1R9TB 1LV9A 3G71A 1Z7TA 1BOSA 4IUVA 5M3FB 1ASZA 1KDBA 1B1ZA 3S9WA 1NE3A 1VQ8A 4JPBW 5EKLA 1Q81C 4BXXH 2MNAA 3QJYA 4OX9L 1XWEA 1SJHD 3EA6A 1PH2A 2ALYB 1B3QA 3LNNA 5DLQE 4HIOA 1AFPA 3ICEA 4DK1A 2IPKD 2HUGA 1B53A 3KBGA 2O2LD 3HOYH 1K8OA 4OX9Q 1SE4A 4EQOA 2HHHL 4K0KL 4PMCA 2N88A 3VR5A 3DEPA 2TSSA 3HZXA 4IUTA 1VQMA 2EYFA 5JOBA 2NBFA 2CH4A 1MSGA 1KC8C 3BYTB 3BZCA 1GXDC 1VQFA 1HA6A 4CKBA 1ESRA 4BY7B 4HCSA 1KNAA 2R3ZA 3RN5A 3HEJA 4F7XA 3SR1A 2E74C 4DV3Q 5D14A 4LK1C 2G9DA 1EL0A 5M3MB 1EU3A 4JI1Q 1EIGA 2NN6H 1UE6A 1PH9A 3GTMH 1K8MA 2F0WA 5KNBA 3S14B 1HFNA 4HN7A 1OXUA 1E1OA 4A3FB 3TP5A 4LF4L 1L1OB 3NHHA 2VXWA 5H1SE 2YYZA 3RZOB 5E3FA 4ZLTF 1VCIA 3V2TA 3CPWA 4LF8L 5JJIA 4LF4Q 2XVSA 1SYCA 5IYCH 1DCZA 2K5DA 2E2HB 2JA5B 1XNRL 1VQCA 2SDFA 3EQLC 2Q8RE 5IGGA 1HR0L 2WINB 1E7ZA 1B9NA 1SFOH 1RODA 1IBLL 1LABA 5IYBG 3FPUB 3AU7A 3EN2A 5J22A 2PMZB 4JI6L 2B63B 2IW3A 5JEAG 2BE5C 3K6OA 4KJNA 2RHQB 1EUJA 4AYBB 4C3HH 1LYLA 1IBLQ 1PXUA 4R8NA 3JC66 5L37A 4NXMQ 1XMOL 4JI6Q 1H9JA 1PTOB 4ZAIA 3UDGA 1GKHA 2JA7B 3CCLA 4ME5A 5CR3A 1FVIA 3NWSA 1QNKA 1S5DD 3KBXA 1H9SA 1ICFB 2H1EA 1SNPA 2L15A 4DNRB 5LMNL 3W3AA 5I9PA 2E5LL 3TQYA 2VW9A 1J5EQ 1P8LA 4MHEA 5M5WB 5C3XA 2KJXA 1MKHA 2B63H 3IL8A 1QUQB 4JVZA 1UE1A 2KOLA 2ZTDA 3HOUB 5HGTA 1Y8NB 1C8CA 3ULPA 1LTTD 2KECA 3NELA 1RJTA 2LXJA 2E5LQ 2UUAQ 1N9WA 5JEAH 4DV6L 1VQ5A 4DV1L 1B9MA 1VQ6A 3M3YH 3A55A 3W1BA 3BDOA 2F0OA 2ZXOA 1PTOH 4ME3A 2JA7H 2FINB 3H0GG 3TMEA 3K59A 1A3VA 2R7ZB 3S15B 4DV2Q 1JOKA 2PZTA 4KKTA 1P16A 1PZKD 5FLXE 4A93G 4QUFA 4LF7L 4LF5L 4XQJA 2JSOA 4OGQC 1SMYC 4IFDH 3HOUH 2LSSA 3ERSX 1L0YB 1ML0D 1XNQQ 4UY8C 1PRTF 4DNIA 3DWAA 3CCRA 2Q8TA 1MIUA 1BNZA 1JWSD 1QZGA 4R8IA 1N34L 1PH3A 1SYDA 1O7LA 1JC7A 4PZ8A 3L0OA 2F3WA 2ZTEA 4FF1A 3W2DA 3PUYA 3J80c 2EOTA 3D4RA 1MJEA 2OTLA 3PGZA 1EOVA 5FLMG 4FVMA 4ILWA 4B3TL 2JA6G 1NJIC 4RGNA 4V0BA 4EGVA 2MUYA 2O5IC 4DK0A 2KHIA 1YHQA 1VQIA 2JN4A 2R93B 4B3TQ 1O78A 1PMRA 3OPOA 4JV5L 2WB1B 1HNXL 1I3QB 3M85A 1QILA 3GTKH 2NVTH 1LTSD 5C4HA 2TMPA 2Q2HA 4JV5Q 5EJWA 2PO4A 3ER0A 2JQOA 1KDCA 1B44D 4O1NA 3ULJA 2F0HA 5IT9E 3HS0C 1EFWA 4DK6C 1TR5A 3MHBA 4DU9A 5M5XH 4IZ8A 4A3BB 1VMCA 1O7YA 1Y69U 4RH6A 1TWCB 5IYDG 5FLMH 5DAUA 3QOJA 1QG7A 3BDLA 5C4XB 1STGA 1E0BA 1FGBD 2OT2A 4TRDA 1FL0A 2B2VA 4L5TA 1A2UA 3DLLA 2ICEC 1ESFA 1CQFA 2PYKA 4P71A 4K8JA 4KY6A 3CU7A 2A8VA 4YWKA 3QB3A 4A3MB 3FPPA 2RDHA 2EY1A 5E7NA 1OXVA 2F1MA 3DHQA 4JBWA 4U673 2F3VA 1K73C 5C44G 4C2MB 4DR6L 2JEBI 4QGUA 4DF7A 1Q90A 5FO8B 2WV6D 4CDEC 4MN3A 4NP5A 4QF4A 1MBYA 1TY0A 1X56A 1PRTB 4A3BH 4GS3A 2RDFA 1L1OA 3A54A 1A2TA 1NY4A 2J7ZA 3HOVG 3A5UA 5BR8L 4A3CH 2UU9L 4C3IB 2B2WA 1JB3A 3KLSA 1F2LA 1BCPF 4R4OA 1D6EC 1VDZA 2Z4IA 5BR8Q 1X3FA 3S16B 1VF5C 1BUVT 1IL2A 3GTOB 2UU9Q 1JJGA 2V1CC 3OWFA 4EQ5A 1Q8IA 2K33A 2HIVA 2HDMA 1VQDA 3PO2H 3T16A 4N8FA 1L1OC 5GADC 2EVBA 5CBEE 2O5JC 5LMUL 2K5QA 4XQQA 3OMCA 2ZXPA 2EXZA 5T1GA 3NQTA 1XYIA 2B2WC 2K5NA 1LO5D 3NBHB 2K52A 1WFQA 2GN5A 3RZDH 3PUXA 3H94A 2RSNA 4NMZA 3I2ZA 3BG3A 4LUVA 1I6HH 1RF2D 3EFXD 1EY0A 1K8AC 4DR4L 1J9OA 1XPUA 3GTOH 4JI2Q 1TWFB 2LS01 1KQSA 4JBJA 3T56B 1HQRD 2BOSA 4JI0Q 4OL7A 1ENCA 5GAGC 1TWHB 2B2UA 3I91A 4ZRZA 1QUQA 2A6HD 4HMJA 2C35B 5EGTA 3OMGA 4FP5D 2BDNA 4BY1H 4JI8L 1VQ4A 1CSPA 1YEZA 1RHPA 2QCPX 2A6ED 2M00A 3T13A 3CPFA 2N78A 4HAEA 3MA2B 2L1BA 3F2DA 2HD3A 5JVH3 4POGA 4MZ9A 3CCSA 3B6YA 4B9WA 4F87A 4KY7A 3GTQH 2NWGA 3J81j 3F8TA 4K6DA 1CSQA 3NBIA 2L4NA 1CA5A 1HUMA 1RIPA 5NUCA 3PIPA 4JBKA 1WCMG 2MFIA 1AH9A 2R7FA 1NCVA 3TP6A 4G57A 3E6ZX 2PCFB 1A63A 1EYGA 2K7VA 4X62L 4DV0L 3VYTA 1KL9A 2E75C 4GKKL 2Z6BA 4A3GB 4FO2A 3KLWA 4A75A 2YU9B 5IODA 1TWGB 3IFDA 1STHA 4X62Q 2UUCQ 1KLUD 1LTBD 4RGTA 2WAQG 4GKKQ 2E76C 3HOZB 3KK7A 3I4MH 4KD4A 3BJUA 5C4ZA 2UXDL 4X66L 1LTID 4LF6Q 2BH2A 1N36L 4UHVA 1ILQA 1QVGA 2HT1A 4QUCA 4KHPQ 3BZKA 4O42A 4DKAC 4XT1B 4PMBA 1I50H 1IW7D 4LNQA 1X3QA 3HGBA 4A3EB 1XMQL 1F9RA 5IT9L 1QNUA 5IY0A 1TWGH 1EQVA 1L2FA 4IPCA 4OXPA 4PQXA 4YHHL 1Y1WG 4YY3Q 1CUKA 4XQNA 1WTVA 3WOFA 1S40A 1PH5A 1YHBA 1JB7A 3LGJA 1BO0A 2LY7A 4QIWB 1FNUA 1RD9D 4XXEA 4DUYQ 1KABA 4UPAA 3PIP3 4L5QA 1JQYD 2HCCA 2NVXB 3PCOB 1A8VA 3FVQA 1DYQA 3D6CA 4FNFA 3RN2A 3VYSA 1JE5A 1WTPA 2LMCB 4WJ3M 5G3LD 2F4IA 1CKMA 3OTOQ 3CC4A 4KKUA 3L2PA 3AYHB 1K0SA 3E9IA 1D1KA 2MHVA 1R4QB 3OIPA 4BBRB 1Q82C 3PO3H 1A62A 3KDFB 2VQEL 5C3WA 4RKBA 2WAQE 1DD2A 4HR7B 1C0AA 1PH7A 3S1RH 3ERQA 2PW5A 4IJLA 2R92B 4DGZA 2WIIB 1S4ZA 2QGQA 3KOJA 2VQEQ 1R4PB 4JI3Q 1F2ZA 2WFWA 1U4LA 1WOCA 4HSVA 3EROA 4DV4Q 1YBYA 3VR6A 2KHSA 1PRTC 3M7NA 4K5WA 4N8X1 1TVXA 2FJ2A 3S2DB 4KLKA 5ELFA 1MGSA 3CCUA 2IWHA 2A74C 4A3KH 2A69C 2I5LX 4HCEA 2K50A 3CHBD 5GQOA 2EJFC 4GOPB 1J8IA 2R61A 4WORA 2BA0A 5DM73 3I4NH 3X3MA 1PH6A 1AE3A 3FDTA 2XWBB 4CJ2C 1Y1VH 4P74A 2QF7A 5JPMC 2R92H 4ALPA 4G7ZC 3Q0AA 2B3GA 2AWOA 5FJ8H 2EY6A 5C0XG 2B39A 4HMIA 4JI4L 2NVYB 1VQBA 1YVCA 2B2YC 1AZPA 3I4OA 3J7ZC 1LT6D 5J1ZA 1UE5A 1EU4A 3WOEA 3HOXG 3S2DH 2NTSA 2I5HA 3K80C 2JA8H 3MFYA 3ND9A 1GD7A 3HOWG 4G7OC 4HEDA 1YZ6A 3K81C 5GROA 2HQLA 1PH1A 4C1NI 4ULLA 5E4WC 4A3JG 3VR3A 1KD1C 4UP9A 3HOYB 4RWSC 3KYHC 3D4WA 2N55A 1EIYB 2UXCQ 2PW7A 3NXWA 4PZ6A 3RUZA 4JI5Q 1K9MC 3GDEA 1CK1A 1U4RA 1H9KA 2RBMA 2R7DA 1STEA 3PQIA 3TZDA 1IBMQ 4X65Q 4CGYB 4GNXB 1XPOA 5GAHC 4X64L 2VUMG 4Z9CB 3NSWA 1PFNA 1B3AA 5FO9B 1UE7A 5C3EH 2KCMA 3A7LA 2Q8IB 1TT2A 2RF4A 2Q2IA 1CQVA 4A3IH 1IHZA 5M3FG 3EJIA 1TS3A 1X54A 4XDXA 2DN8A 2Z6KA 3J80E 4X6AH 3GTMB 3MEFA 2EYJA 2EYMA 2OWOA 1PTOF 1GUTA 3VR2A 2I07B 5CORA 1NR4A 2Y0SB 3RLNA 1VQJA 1QCBD 3J81c 2EZVA 2HHHQ 4K0KQ 1BCPC 3KF8B 4J8QA 1LACA 2ATWA 1ZKOA 1N8RC 2RCNA 3C1EA 5BN4A 1Z6HA 1FYCA 1WTQA 1SNOA 4BA1I 1EEID 3QIAA 2Z6KC 5IOCA 3TEHB 3CMEA 1IZ6A 1BR9A 2AQ1B 1I5FA 4P73A 4BY7G 1X32A 2HIXA 2E2JH 2IJ0A 2YTVA 1SFOB 1PHJA 5J39A 4FXDA 3JAMc 4MTNA 2BE5D 3NEMA 3RR5A 3C2PA 4DXGA 1F9PA 2F0GA 1XJVA 3GTGB 5M3MG 1QVCA 1H9RA 4R4QA 1JT8A 4C3HB 3DMUA 1YNJC 1Q7YC 2EYLA 3E5SA 1ZXTA 3TS0A 4DAMA 2NVQH 3K8AA 3JAML 5KGUA 1VQKA 4IFDJ 5JVG3 2IY5B 1RTOA 2J0TD 3DEOA 4YCUA 1JMCA 2OXPA 2K01A 1DGSA 4LF8Q 2V4DA 1HZAA 3FKIG 1F2YA 3CW2C 4DV5L 4RHSA 1OXTA 1XNRQ 3PSIA 2PZUA 3GTGH 1SNQA 1II3A 4HSPA 4B08A 4OWWB 1V43A 2J4XA 1HR0Q 4OHJA 4DV5Q 4JBMA 5IGFA 3EBEA 4NXNL 3GTLH 3KDFA 3G48A 3ZYYX 3MXPA 1B4OA 3MWYW 5K5PA 1EWCA 4KTAA 3I3CA 3M3YB 4UP8A 1B7YB 4HJAA 2Q2UA 4K6LA 4DV7L 3ULLA 2MO0A 3U4ZA 3TREA 2OQKA 4RCNA 1AEXA 4X3UA 4NXNQ 3I4LA 4G4KA 1PFBA 2F0QA 1X3PA 1XMOQ 4C1NK 4AYBG 3KF6B 1GOZA 4DV7Q 4DR1L 3D0FA 1NAPA 3CMAA 3SXHA 3K5NA 1NUCA 4A3LG 1SMXA 1SMYD 2SEBD 5EBCA 1E24A 4GLXA 1GUSA 4H0LC 5C0XI 1DJRD 1KDAA 1NMFA 3VDYA 2F52A 2E2DC 5IYBH 4JI7L 5LMNQ 2QEXA 4NW2A 2NYZD 4GOPA 4M1UB 4PNYA 1LLRD 2D9UA 3I7FA 2BH8A 1XX8A 1HFGA 1T5XD 5CV5A 4PZ7A 5CGKA 1X3GA 3F2UA 2Z9HA 2DJGC 3OYYA 4P72A 5FOBB 5KYIA 4DV6Q 4DV1Q 4A4IA 4CJ0B 1KLGD 1IBKL 1HNZL 4HJ9A 2F0PA 4ZK9B
chains in the Genus database with same CATH topology
2I0QA 1E1TA 2NN6G 4OO1I 2K5NA 3NBHB 4KI0A 2R6GA 3UDXA 2R7ZG 2K52A 4RG1A 1WFQA 2GN5A 3RZDH 3PUXA 1HNZQ 3PUVA 2I5MX 4DK3C 3I2ZA 1M1KC 4LF5Q 1XTDA 4LF7Q 3D31A 3OTOL 4LUVA 1S72A 1I6HH 1M90C 2JK8A 1N33Q 2VUMH 5C0XJ 4L5SA 2VS1A 2Y0SG 4HIDA 2EXDA 4A3EH 5LMNW 4IO9A 4IJHA 1XPRA 1UEBA 1VQOA 1K8AC 4DR4L 3STBC 1XPUA 1R9TH 3PUWA 4JI2Q 3GTOH 4FDBA 4DV3L 4A3KG 1KQSA 4JBJA 3J81i 5JEAJ 1PYBA 4JOIA 1HZCA 1VQ9A 3H0GH 5M3FH 2H5XA 4JI0Q 3I4NG 3K7AH 4TQUS 1N34Q 4GLVB 5GAGC 2EQSA 5IYCG 1KIXA 1Y1VG 1HJPA 2K14A 4JI1L 4DPGA 2B29A 2PMZE 1C7YA 4GNXA 1QUQA 3FP9A 1YI2A 2C35B 3BU2A 4BY1H 2R92G 4A93H 4JI3L 4JI8L 5EAYA 1VQ4A 4AYBE 2OTJA 1CSPA 1YEZA 5FJ8G 4LFAQ 1Q1EA 1J6QA 4DV4L 1EQQA 3CPFA 3A0JA 4OWXB 1HH2P 2YV5A 2N78A 3M4PA 5ELNA 2NVXH 3J80i 3F2DA 3M9BA 2ZJQA 4POGA 1FGUA 1B70B 4MZ9A 4A3FG 4JOIC 3UDIA 4DAYB 3G6EA 3CCSA 1SE8A 3JAMi 3B6YA 3I55A 3L7ZC 4LUZA 3GTQH 1WI5A 2CWPA 3J81j 3F8TA 1HNXQ 2YTYA 1KRTA 1VS0A 2R93G 1CSQA 5IE8A 2PQAA 4C3JH 2JA8G 1UWVA 4GNXC 1RIPA 1WYDA 1PFSA 1PH4A 4YCWA 3PIPA 1KRSA 2K5HA 4KHZA 4BY7H 4JBKA 1X6OA 4BBRH 3T1YL 1WCMG 2JA5G 2MFIA 4BBSG 4B3ML 1MJCA 5IP7G 1AH9A 2R7FA 1NMGA 4OONA 1LM0A 1YIJA 2JA6H 1I94L 4LFCQ 1V1QA 3CP0A 3AQQA 1K8GA 2CWAA 1A63A 2MO1A 5M3MH 1EYGA 3F2BA 4X62L 1C9OA 4XTCS 4JCVE 4DV0L 1KL9A 4GKKL 5ELOA 3Q8DA 4B3MQ 1B8AA 1VQGA 1Q86C 1SRUA 1EQRA 3KLWA 1Y14B 3S14H 1I94Q 4QIWE 4A75A 5HGQA 2B63G 3K7UC 5C4XG 1TXYA 4X62Q 2UUCQ 4NXML 2WAQG 2FXQA 2UUBQ 1E22A 4GKKQ 5C3EG 1V9PA 2PI2A 3AFQA 4Y7NH 4DR3L 4A3FH 1VQLA 4BXXG 4O0AA 5C4JH 1PA6A 3I4MH 1BBWA 3CC2A 2E2IH 3CCJA 4HJ7A 4A3MG 2XTIA 3BJUA 2Y0SE 2UXDL 4X66L 4A3IG 2OQ0A 4LF6Q 2JA7G 3RZOH 3FKIH 2N8NA 2BH2A 4DR6Q 1N36L 4APVA 1Q8KA 4DR1Q 1GM5A 2UXCL 2E2HH 2JA5H 1QVGA 2CCZA 2HT1A 4BBSH 4KHPQ 5IYDH 4JI5L 3BZKA 4NPSA 4DKAC 5IP7H 4HJ8A 1VQPA 1J5EL 4DR7Q 1D8LA 2ZM6Q 4GN5A 1IBML 4X65L 3STBD 4L5RC 3UE0A 1I50H 4LNQA 4HJ5A 1XMQL 2IT1A 4JI7Q 1PVOA 2Z0SA 4PMWA 5IY0A 2JEAI 2K5VA 2N49A 4IFDG 1TWGH 2NVYH 4YWMA 2AKWB 2UUAL 3HOUG 3OW2A 1L2FA 4IPCA 3G71A 4OXPA 1G291 4YHHL 2PI2E 1Y1WG 1ASZA 5JJLA 4R4CA 1CUKA 4O2DA 4YY3Q 1NE3A 1VQ8A 1VQHA 3HKZG 5C44H 1S40A 1Q81C 2MNAA 1VQNA 1PH5A 1IXRA 4BXXH 1VQ7A 1YHBA 4GKJL 3ZJYC 4OX9L 3H3VH 1JB7A 3LGJA 4DV2L 1PH2A 1X3EA 2ALYB 2LXKA 5DLQE 4HIOA 4QQBX 4A3LH 3ICEA 1IBKQ 1Z47A 3IRBA 1JJ2A 4DUYQ 4UPAA 5LMUQ 2CQOA 4L5QA 2CKZB 3HOYH 4OX9Q 4LF9L 2BA1A 3PV0A 2HHHL 4K0KL 3PCOB 1A8VA 2D62A 3HOVH 3CCEA 1BVSA 3RN2A 1VQMA 4P75A 1JE5A 4WJ3M 2NZOA 1KC8C 3KF6A 3PF4A 3BZCA 1CKMA 2K75A 3OTOQ 1VQFA 5M5WH 1XNQL 3CC4A 4LF9Q 2VQFL 4HIKA 3L2PA 1YNXA 3AYHB 3E9IA 4DR4Q 3KJOA 1Q82C 3RN5A 3PO3H 1A62A 3KDFB 1BBUA 3PF5A 4DV3Q 2WP8J 2VQEL 4HIMA 1KHIA 2WAQE 4JYAL 1C0AA 1PH7A 4JC0A 3S1RH 4A3DH 2NZHA 1U5KA 3CCQA 2NN6I 4JI1Q 4IJLA 1W2BA 3TRZA 1UE6A 1E3PA 3A74A 2ASBA 1PH9A 2QGQA 3KOJA 2VZAA 2VQEQ 2R7ZH 1CKNB 3U4VA 3GTMH 3S15H 4JI3Q 4JI8Q 2WFWA 4JYAQ 1WOCA 1H95A 3KFUA 5GAEC 3F1ZA 1OXUA 4DV4Q 1YBYA 1X65A 1E1OA 3M7NA 2WB1G 3GO5A 4GN4B 4LF4L 4LUOA 4KLKA 2AWNA 4IPGA 3CCUA 2ID0A 1L1OB 3M4QA 4J15A 4A3KH 4MNOA 1QVFA 2I5LX 2K50A 5GQOA 4GOPB 5H1SE 2YYZA 3DM3A 4BA2I 1LUZA 2CFMA 2BA0A 3I4NH 1VCIA 3CPWA 1PH6A 1AE3A 4LF8L 5JJIA 5M5YH 4LF4Q 5IYCH 1Y1VH 1XNRL 1OXSC 4P74A 1NBWA 1VQCA 1SN8A 4JG2A 3T1YQ 3UDFA 2R92H 3HKSA 3HKZE 4ALPA 4OWTB 1PH8A 1D7QA 2B3GA 1HR0L 2AWOA 5FJ8H 4A3BG 1E7ZA 1WJJA 5C0XG 3G4SA 1LTLA 1SFOH 1BKBA 4JI4L 1YJNA 1GO3E 1IBLL 1VQBA 2JJQA 5IYBG 1YVCA 4DV0Q 1A0IA 3I4OA 3J7ZC 2ZJPA 3EN2A 4JI6L 3J7A5 4B3SL 1UE5A 4NB3A 5AJ3L 3HOXG 3TS2A 4A3CG 1HNWL 1YJ9A 5JEAG 3CCMA 4DUZL 3S2DH 1YITA 2RHQB 4A3GG 1EUJA 3S1QH 3U50C 1LYLA 2I5HA 4C3HH 1IBLQ 2UXBL 2R93H 3K80C 3JC66 2JA8H 3I56A 4NXMQ 1XMOL 4POFA 4JI6Q 1GD7A 3HOWG 1I3QH 5AJ3Q 1YZ6A 4LFBL 4DR3Q 3K81C 4B3RL 1HNWQ 3A5ZB 5GROA 1SLJA 1YHAA 2HQLA 5IWAL 3CC7A 3UDGA 1PH1A 1GKHA 3HOZG 4DR2L 1WCMH 3MXNB 4A3JG 1KD1C 3CCLA 4UP9A 3PO2G 1FVIA 5K36G 2UXDQ 4X66Q 3PIOA 3KYHC 4Y52H 5IP9G 4LFBQ 4B3RQ 2F3IA 1N32L 1N36Q 2GVAA 2KCTA 2L15A 4DR5L 1EIYB 2OCEA 5IWAQ 5LMNL 1K83H 2UXCQ 1K0RA 2VNUD 4OO1G 2D0PA 4PZ6A 4YWLA 2E5LL 4JI5Q 3TQYA 2VW9A 1J5EQ 1K9MC 3GDEA 1P8LA 2IHEA 3WWVA 2R7DA 2AHOB 1IBMQ 4X65Q 1MKHA 1TWCH 2B63H 4GNXB 1QUQB 5C4XH 1UE1A 2ZTDA 5GAHC 4PG3A 4X64L 4A76A 4DR5Q 1XPOA 1XMQQ 2VUMG 3ULPA 3NELA 1AE2A 3E0EA 2LXJA 1UE7A 5C3EH 2KCMA 2E5LQ 4A3EG 2UUAQ 1N9WA 3H3VI 4DV6L 1VQ5A 4DV1L 3M3YH 1VQ6A 4YHHQ 2VY3A 2A19A 3W1BA 4A3MH 1Q12A 2RF4A 2Q2IA 4ME3A 4LFAL 4A3IH 2WB1E 2JA7H 3H0GG 5M3FG 1X54A 4GKJQ 4AH6A 2Z6KA 1QZHA 4IPHA 4X6AH 1Z9FA 4EX5A 3CQZH 4DV2Q 3MEFA 3AFPA 2IX1A 4C2MH 3EIVA 2PNHA 2PQAB 1P16A 1PV4A 2OWOA 2E8GA 4BY1G 1PYSB 4A93G 3M4OH 4R1JA 5IP9H 1K3RA 2K4KA 3RLNA 4LF5L 4LF7L 1VQJA 3UE1A 3J81c 2HHHQ 1HZ9A 1N33L 1ASYA 4K0KQ 3KF8B 4AIMA 4IFDI 2JA9A 1TWAH 2A1AA 2ATWA 3HOUH 1N8RC 1S3OA 2LSSA 1VQEA 2RCNA 4IOCA 4JI2L 3ERSX 1Y1WH 1XNQQ 4C3IH 1G6PA 4UY8C 4BA1I 4DNIA 2VQFQ 4R4TA 3CCRA 2Z6KC 3TEHB 1MIUA 4JI0L 3CMEA 1QZGA 1IZ6A 1N34L 1PH3A 1T9HA 1I5FA 4AQYL 3RNUA 2QA4A 3S16H 4PZ8A 3L0OA 2XGTA 2ZTEA 3PUYA 3HFZB 4P73A 4BY7G 3J80c 2HIXA 4BBRG 3KJPA 1MJEA 2E2JH 2VL6A 2OTLA 5JJKA 2YTVA 3K0XA 1EOVA 3PGZA 3T1HL 5FLMG 1PHJA 3JAMc 4B3TL 2JA6G 4MTNA 4AQYQ 3NEMA 4QJFA 3RR5A 5FLXc 1NJIC 1XJVA 1OTCA 3CXCA 3SGIA 5M3MG 4R4IA 1QVCA 5J3BA 1L0WA 4R4QA 3FHWA 1JT8A 2KHIA 1YJWA 3S17H 1YHQA 2IHFA 1VQIA 2DUDA 3T1HQ 1U0LA 4B3TQ 2YTXA 4JV5L 1Q7YC 1HNXL 2KENA 3S24A 3M85A 3TS0A 3GD7A 4DAMA 1G51A 1GVPA 2MQHA 5HY6A 2NVTH 1EWIA 1IYJB 2NVQH 3GTKH 4IOAA 3K8AA 1VQKA 4IFDJ 2IY5B 2Q2HA 4JV5Q 3I4MG 2D0OA 3ER0A 4UP7A 3H15A 3S2HH 4YCUA 1JMCA 2JQOA 1OXXK 1DGSA 1TWFH 3ULJA 4LF8Q 1EFWA 4LFCL 1HZAA 3FKIG 3CW2C 4DK6C 4DV5L 3S1MH 1OXTA 1XNRQ 1Q46A 3W1GA 3PSIA 5M5XH 2GVBA 1TWHH 4RMFA 2ES2A 3GTGH 4WJ4A 5IYDG 5FLMH 3GTPH 4OWWB 1V43A 1HR0Q 3AEVA 4DV5Q 4JBMA 3W5OA 4JI4Q 3EBEA 2N3SA 1FL0A 4NXNL 1W3SA 4L5TA 2IX0A 3KDFA 3GTLH 3G48A 3DLLA 2UUCL 4LW1A 3CD6A 3CF5A 3F2CA 2UUBL 4P71A 4UP8A 1B7YB 4HJAA 2Q2UA 4B3SQ 2A8VA 4YWKA 4DV7L 3ULLA 2MO0A 3U4ZA 3TREA 4DUZQ 2OQKA 2F4VL 1FJGL 3S1NH 4NXNQ 2UXBQ 1JJCB 5E7NA 1OXVA 1O7IA 4JBWA 4LF6L 1CKNA 1XMOQ 4AYBG 1K73C 5C44G 3KF6B 4H02A 2ZJRA 4TVAB 4DR6L 2JEBI 4QGUA 4DV7Q 4DR1L 3NENA 3D0FA 3CMAA 5IT9c 2F4VQ 1FJGQ 4DR2Q 4YCVA 4A3LG 4QL5A 1SMXA 4KHPL 4DR7L 1E24A 4GLXA 2ZM6L 3E9HA 5C0XI 1X56A 4A3BH 4GS3A 1NMFA 3VDYA 1Q1BA 2F52A 1N32Q 3HOYG 1L1OA 5IYBH 4LWCA 2Q2TA 4JI7L 1NY4A 5LMNQ 2QEXA 1KAWA 2KHJA 4GOPA 3HOVG 3A5UA 1SR3A 5BR8L 3CCVA 3I7FA 3HOXH 2BH8A 4A3CH 2UU9L 1X55A 4PZ7A 4A3GH 1X3GA 4IPDA 4QY7A 4YY3L 4R4OA 1HR0W 2DGYA 4X64Q 1VQAA 3CAMA 1RL2A 1X9NA 2YU9H 2KBNA 3GTJH 3OYYA 1HZBA 4GLAC 5BR8Q 1X3FA 3HOWH 1SROA 1EIFA 4P72A 1IL2A 2JE6I 2UU9Q 1JJGA 2V1CC 4DV6Q 4GN3B 4EQ5A 4DV1Q 4A4IA 3PO3G 3HOZH 4A3JH 1KXLA 2HIVA 3PUZA 4XIGS 3RLFA 3U58A 1VQDA 1IBKL 3PO2H 1HNZL 2RHSB 1L1OC 2ZTCA 5GADC 4HJ9A 3RLOA 1CKOA 1NTGA 4DUYL 4A3DG 5LMUL 2EIFA 2AMCB 4GOPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0Q A;  1E1T A;  2NN6 G;  4OO1 I;  2K5N A;  3NBH B;  4KI0 A;  2R6G A;  3UDX A;  2R7Z G;  2K52 A;  4RG1 A;  1WFQ A;  2GN5 A;  3RZD H;  3PUX A;  1HNZ Q;  3PUV A;  2I5M X;  4DK3 C;  3I2Z A;  1M1K C;  4LF5 Q;  1XTD A;  4LF7 Q;  3D31 A;  3OTO L;  4LUV A;  1S72 A;  1I6H H;  1M90 C;  2JK8 A;  1N33 Q;  2VUM H;  5C0X J;  4L5S A;  2VS1 A;  2Y0S G;  4HID A;  2EXD A;  4A3E H;  5LMN W;  4IO9 A;  4IJH A;  1XPR A;  1UEB A;  1VQO A;  1K8A C;  4DR4 L;  3STB C;  1XPU A;  1R9T H;  3PUW A;  4JI2 Q;  3GTO H;  4FDB A;  4DV3 L;  4A3K G;  1KQS A;  4JBJ A;  3J81 i;  5JEA J;  1PYB A;  4JOI A;  1HZC A;  1VQ9 A;  3H0G H;  5M3F H;  2H5X A;  4JI0 Q;  3I4N G;  3K7A H;  4TQU S;  1N34 Q;  4GLV B;  5GAG C;  2EQS A;  5IYC G;  1KIX A;  1Y1V G;  1HJP A;  2K14 A;  4JI1 L;  4DPG A;  2B29 A;  2PMZ E;  1C7Y A;  4GNX A;  1QUQ A;  3FP9 A;  1YI2 A;  2C35 B;  3BU2 A;  4BY1 H;  2R92 G;  4A93 H;  4JI3 L;  4JI8 L;  5EAY A;  1VQ4 A;  4AYB E;  2OTJ A;  1CSP A;  1YEZ A;  5FJ8 G;  4LFA Q;  1Q1E A;  1J6Q A;  4DV4 L;  1EQQ A;  3CPF A;  3A0J A;  4OWX B;  1HH2 P;  2YV5 A;  2N78 A;  3M4P A;  5ELN A;  2NVX H;  3J80 i;  3F2D A;  3M9B A;  2ZJQ A;  4POG A;  1FGU A;  1B70 B;  4MZ9 A;  4A3F G;  4JOI C;  3UDI A;  4DAY B;  3G6E A;  3CCS A;  1SE8 A;  3JAM i;  3B6Y A;  3I55 A;  3L7Z C;  4LUZ A;  3GTQ H;  1WI5 A;  2CWP A;  3J81 j;  3F8T A;  1HNX Q;  2YTY A;  1KRT A;  1VS0 A;  2R93 G;  1CSQ A;  5IE8 A;  2PQA A;  4C3J H;  2JA8 G;  1UWV A;  4GNX C;  1RIP A;  1WYD A;  1PFS A;  1PH4 A;  4YCW A;  3PIP A;  1KRS A;  2K5H A;  4KHZ A;  4BY7 H;  4JBK A;  1X6O A;  4BBR H;  3T1Y L;  1WCM G;  2JA5 G;  2MFI A;  4BBS G;  4B3M L;  1MJC A;  5IP7 G;  1AH9 A;  2R7F A;  1NMG A;  4OON A;  1LM0 A;  1YIJ A;  2JA6 H;  1I94 L;  4LFC Q;  1V1Q A;  3CP0 A;  3AQQ A;  1K8G A;  2CWA A;  1A63 A;  2MO1 A;  5M3M H;  1EYG A;  3F2B A;  4X62 L;  1C9O A;  4XTC S;  4JCV E;  4DV0 L;  1KL9 A;  4GKK L;  5ELO A;  3Q8D A;  4B3M Q;  1B8A A;  1VQG A;  1Q86 C;  1SRU A;  1EQR A;  3KLW A;  1Y14 B;  3S14 H;  1I94 Q;  4QIW E;  4A75 A;  5HGQ A;  2B63 G;  3K7U C;  5C4X G;  1TXY A;  4X62 Q;  2UUC Q;  4NXM L;  2WAQ G;  2FXQ A;  2UUB Q;  1E22 A;  4GKK Q;  5C3E G;  1V9P A;  2PI2 A;  3AFQ A;  4Y7N H;  4DR3 L;  4A3F H;  1VQL A;  4BXX G;  4O0A A;  5C4J H;  1PA6 A;  3I4M H;  1BBW A;  3CC2 A;  2E2I H;  3CCJ A;  4HJ7 A;  4A3M G;  2XTI A;  3BJU A;  2Y0S E;  2UXD L;  4X66 L;  4A3I G;  2OQ0 A;  4LF6 Q;  2JA7 G;  3RZO H;  3FKI H;  2N8N A;  2BH2 A;  4DR6 Q;  1N36 L;  4APV A;  1Q8K A;  4DR1 Q;  1GM5 A;  2UXC L;  2E2H H;  2JA5 H;  1QVG A;  2CCZ A;  2HT1 A;  4BBS H;  4KHP Q;  5IYD H;  4JI5 L;  3BZK A;  4NPS A;  4DKA C;  5IP7 H;  4HJ8 A;  1VQP A;  1J5E L;  4DR7 Q;  1D8L A;  2ZM6 Q;  4GN5 A;  1IBM L;  4X65 L;  3STB D;  4L5R C;  3UE0 A;  1I50 H;  4LNQ A;  4HJ5 A;  1XMQ L;  2IT1 A;  4JI7 Q;  1PVO A;  2Z0S A;  4PMW A;  5IY0 A;  2JEA I;  2K5V A;  2N49 A;  4IFD G;  1TWG H;  2NVY H;  4YWM A;  2AKW B;  2UUA L;  3HOU G;  3OW2 A;  1L2F A;  4IPC A;  3G71 A;  4OXP A;  1G29 1;  4YHH L;  2PI2 E;  1Y1W G;  1ASZ A;  5JJL A;  4R4C A;  1CUK A;  4O2D A;  4YY3 Q;  1NE3 A;  1VQ8 A;  1VQH A;  3HKZ G;  5C44 H;  1S40 A;  1Q81 C;  2MNA A;  1VQN A;  1PH5 A;  1IXR A;  4BXX H;  1VQ7 A;  1YHB A;  4GKJ L;  3ZJY C;  4OX9 L;  3H3V H;  1JB7 A;  3LGJ A;  4DV2 L;  1PH2 A;  1X3E A;  2ALY B;  2LXK A;  5DLQ E;  4HIO A;  4QQB X;  4A3L H;  3ICE A;  1IBK Q;  1Z47 A;  3IRB A;  1JJ2 A;  4DUY Q;  4UPA A;  5LMU Q;  2CQO A;  4L5Q A;  2CKZ B;  3HOY H;  4OX9 Q;  4LF9 L;  2BA1 A;  3PV0 A;  2HHH L;  4K0K L;  3PCO B;  1A8V A;  2D62 A;  3HOV H;  3CCE A;  1BVS A;  3RN2 A;  1VQM A;  4P75 A;  1JE5 A;  4WJ3 M;  2NZO A;  1KC8 C;  3KF6 A;  3PF4 A;  3BZC A;  1CKM A;  2K75 A;  3OTO Q;  1VQF A;  5M5W H;  1XNQ L;  3CC4 A;  4LF9 Q;  2VQF L;  4HIK A;  3L2P A;  1YNX A;  3AYH B;  3E9I A;  4DR4 Q;  3KJO A;  1Q82 C;  3RN5 A;  3PO3 H;  1A62 A;  3KDF B;  1BBU A;  3PF5 A;  4DV3 Q;  2WP8 J;  2VQE L;  4HIM A;  1KHI A;  2WAQ E;  4JYA L;  1C0A A;  1PH7 A;  4JC0 A;  3S1R H;  4A3D H;  2NZH A;  1U5K A;  3CCQ A;  2NN6 I;  4JI1 Q;  4IJL A;  1W2B A;  3TRZ A;  1UE6 A;  1E3P A;  3A74 A;  2ASB A;  1PH9 A;  2QGQ A;  3KOJ A;  2VZA A;  2VQE Q;  2R7Z H;  1CKN B;  3U4V A;  3GTM H;  3S15 H;  4JI3 Q;  4JI8 Q;  2WFW A;  4JYA Q;  1WOC A;  1H95 A;  3KFU A;  5GAE C;  3F1Z A;  1OXU A;  4DV4 Q;  1YBY A;  1X65 A;  1E1O A;  3M7N A;  2WB1 G;  3GO5 A;  4GN4 B;  4LF4 L;  4LUO A;  4KLK A;  2AWN A;  4IPG A;  3CCU A;  2ID0 A;  1L1O B;  3M4Q A;  4J15 A;  4A3K H;  4MNO A;  1QVF A;  2I5L X;  2K50 A;  5GQO A;  4GOP B;  5H1S E;  2YYZ A;  3DM3 A;  4BA2 I;  1LUZ A;  2CFM A;  2BA0 A;  3I4N H;  1VCI A;  3CPW A;  1PH6 A;  1AE3 A;  4LF8 L;  5JJI A;  5M5Y H;  4LF4 Q;  5IYC H;  1Y1V H;  1XNR L;  1OXS C;  4P74 A;  1NBW A;  1VQC A;  1SN8 A;  4JG2 A;  3T1Y Q;  3UDF A;  2R92 H;  3HKS A;  3HKZ E;  4ALP A;  4OWT B;  1PH8 A;  1D7Q A;  2B3G A;  1HR0 L;  2AWO A;  5FJ8 H;  4A3B G;  1E7Z A;  1WJJ A;  5C0X G;  3G4S A;  1LTL A;  1SFO H;  1BKB A;  4JI4 L;  1YJN A;  1GO3 E;  1IBL L;  1VQB A;  2JJQ A;  5IYB G;  1YVC A;  4DV0 Q;  1A0I A;  3I4O A;  3J7Z C;  2ZJP A;  3EN2 A;  4JI6 L;  3J7A 5;  4B3S L;  1UE5 A;  4NB3 A;  5AJ3 L;  3HOX G;  3TS2 A;  4A3C G;  1HNW L;  1YJ9 A;  5JEA G;  3CCM A;  4DUZ L;  3S2D H;  1YIT A;  2RHQ B;  4A3G G;  1EUJ A;  3S1Q H;  3U50 C;  1LYL A;  2I5H A;  4C3H H;  1IBL Q;  2UXB L;  2R93 H;  3K80 C;  3JC6 6;  2JA8 H;  3I56 A;  4NXM Q;  1XMO L;  4POF A;  4JI6 Q;  1GD7 A;  3HOW G;  1I3Q H;  5AJ3 Q;  1YZ6 A;  4LFB L;  4DR3 Q;  3K81 C;  4B3R L;  1HNW Q;  3A5Z B;  5GRO A;  1SLJ A;  1YHA A;  2HQL A;  5IWA L;  3CC7 A;  3UDG A;  1PH1 A;  1GKH A;  3HOZ G;  4DR2 L;  1WCM H;  3MXN B;  4A3J G;  1KD1 C;  3CCL A;  4UP9 A;  3PO2 G;  1FVI A;  5K36 G;  2UXD Q;  4X66 Q;  3PIO A;  3KYH C;  4Y52 H;  5IP9 G;  4LFB Q;  4B3R Q;  2F3I A;  1N32 L;  1N36 Q;  2GVA A;  2KCT A;  2L15 A;  4DR5 L;  1EIY B;  2OCE A;  5IWA Q;  5LMN L;  1K83 H;  2UXC Q;  1K0R A;  2VNU D;  4OO1 G;  2D0P A;  4PZ6 A;  4YWL A;  2E5L L;  4JI5 Q;  3TQY A;  2VW9 A;  1J5E Q;  1K9M C;  3GDE A;  1P8L A;  2IHE A;  3WWV A;  2R7D A;  2AHO B;  1IBM Q;  4X65 Q;  1MKH A;  1TWC H;  2B63 H;  4GNX B;  1QUQ B;  5C4X H;  1UE1 A;  2ZTD A;  5GAH C;  4PG3 A;  4X64 L;  4A76 A;  4DR5 Q;  1XPO A;  1XMQ Q;  2VUM G;  3ULP A;  3NEL A;  1AE2 A;  3E0E A;  2LXJ A;  1UE7 A;  5C3E H;  2KCM A;  2E5L Q;  4A3E G;  2UUA Q;  1N9W A;  3H3V I;  4DV6 L;  1VQ5 A;  4DV1 L;  3M3Y H;  1VQ6 A;  4YHH Q;  2VY3 A;  2A19 A;  3W1B A;  4A3M H;  1Q12 A;  2RF4 A;  2Q2I A;  4ME3 A;  4LFA L;  4A3I H;  2WB1 E;  2JA7 H;  3H0G G;  5M3F G;  1X54 A;  4GKJ Q;  4AH6 A;  2Z6K A;  1QZH A;  4IPH A;  4X6A H;  1Z9F A;  4EX5 A;  3CQZ H;  4DV2 Q;  3MEF A;  3AFP A;  2IX1 A;  4C2M H;  3EIV A;  2PNH A;  2PQA B;  1P16 A;  1PV4 A;  2OWO A;  2E8G A;  4BY1 G;  1PYS B;  4A93 G;  3M4O H;  4R1J A;  5IP9 H;  1K3R A;  2K4K A;  3RLN A;  4LF5 L;  4LF7 L;  1VQJ A;  3UE1 A;  3J81 c;  2HHH Q;  1HZ9 A;  1N33 L;  1ASY A;  4K0K Q;  3KF8 B;  4AIM A;  4IFD I;  2JA9 A;  1TWA H;  2A1A A;  2ATW A;  3HOU H;  1N8R C;  1S3O A;  2LSS A;  1VQE A;  2RCN A;  4IOC A;  4JI2 L;  3ERS X;  1Y1W H;  1XNQ Q;  4C3I H;  1G6P A;  4UY8 C;  4BA1 I;  4DNI A;  2VQF Q;  4R4T A;  3CCR A;  2Z6K C;  3TEH B;  1MIU A;  4JI0 L;  3CME A;  1QZG A;  1IZ6 A;  1N34 L;  1PH3 A;  1T9H A;  1I5F A;  4AQY L;  3RNU A;  2QA4 A;  3S16 H;  4PZ8 A;  3L0O A;  2XGT A;  2ZTE A;  3PUY A;  3HFZ B;  4P73 A;  4BY7 G;  3J80 c;  2HIX A;  4BBR G;  3KJP A;  1MJE A;  2E2J H;  2VL6 A;  2OTL A;  5JJK A;  2YTV A;  3K0X A;  1EOV A;  3PGZ A;  3T1H L;  5FLM G;  1PHJ A;  3JAM c;  4B3T L;  2JA6 G;  4MTN A;  4AQY Q;  3NEM A;  4QJF A;  3RR5 A;  5FLX c;  1NJI C;  1XJV A;  1OTC A;  3CXC A;  3SGI A;  5M3M G;  4R4I A;  1QVC A;  5J3B A;  1L0W A;  4R4Q A;  3FHW A;  1JT8 A;  2KHI A;  1YJW A;  3S17 H;  1YHQ A;  2IHF A;  1VQI A;  2DUD A;  3T1H Q;  1U0L A;  4B3T Q;  2YTX A;  4JV5 L;  1Q7Y C;  1HNX L;  2KEN A;  3S24 A;  3M85 A;  3TS0 A;  3GD7 A;  4DAM A;  1G51 A;  1GVP A;  2MQH A;  5HY6 A;  2NVT H;  1EWI A;  1IYJ B;  2NVQ H;  3GTK H;  4IOA A;  3K8A A;  1VQK A;  4IFD J;  2IY5 B;  2Q2H A;  4JV5 Q;  3I4M G;  2D0O A;  3ER0 A;  4UP7 A;  3H15 A;  3S2H H;  4YCU A;  1JMC A;  2JQO A;  1OXX K;  1DGS A;  1TWF H;  3ULJ A;  4LF8 Q;  1EFW A;  4LFC L;  1HZA A;  3FKI G;  3CW2 C;  4DK6 C;  4DV5 L;  3S1M H;  1OXT A;  1XNR Q;  1Q46 A;  3W1G A;  3PSI A;  5M5X H;  2GVB A;  1TWH H;  4RMF A;  2ES2 A;  3GTG H;  4WJ4 A;  5IYD G;  5FLM H;  3GTP H;  4OWW B;  1V43 A;  1HR0 Q;  3AEV A;  4DV5 Q;  4JBM A;  3W5O A;  4JI4 Q;  3EBE A;  2N3S A;  1FL0 A;  4NXN L;  1W3S A;  4L5T A;  2IX0 A;  3KDF A;  3GTL H;  3G48 A;  3DLL A;  2UUC L;  4LW1 A;  3CD6 A;  3CF5 A;  3F2C A;  2UUB L;  4P71 A;  4UP8 A;  1B7Y B;  4HJA A;  2Q2U A;  4B3S Q;  2A8V A;  4YWK A;  4DV7 L;  3ULL A;  2MO0 A;  3U4Z A;  3TRE A;  4DUZ Q;  2OQK A;  2F4V L;  1FJG L;  3S1N H;  4NXN Q;  2UXB Q;  1JJC B;  5E7N A;  1OXV A;  1O7I A;  4JBW A;  4LF6 L;  1CKN A;  1XMO Q;  4AYB G;  1K73 C;  5C44 G;  3KF6 B;  4H02 A;  2ZJR A;  4TVA B;  4DR6 L;  2JEB I;  4QGU A;  4DV7 Q;  4DR1 L;  3NEN A;  3D0F A;  3CMA A;  5IT9 c;  2F4V Q;  1FJG Q;  4DR2 Q;  4YCV A;  4A3L G;  4QL5 A;  1SMX A;  4KHP L;  4DR7 L;  1E24 A;  4GLX A;  2ZM6 L;  3E9H A;  5C0X I;  1X56 A;  4A3B H;  4GS3 A;  1NMF A;  3VDY A;  1Q1B A;  2F52 A;  1N32 Q;  3HOY G;  1L1O A;  5IYB H;  4LWC A;  2Q2T A;  4JI7 L;  1NY4 A;  5LMN Q;  2QEX A;  1KAW A;  2KHJ A;  4GOP A;  3HOV G;  3A5U A;  1SR3 A;  5BR8 L;  3CCV A;  3I7F A;  3HOX H;  2BH8 A;  4A3C H;  2UU9 L;  1X55 A;  4PZ7 A;  4A3G H;  1X3G A;  4IPD A;  4QY7 A;  4YY3 L;  4R4O A;  1HR0 W;  2DGY A;  4X64 Q;  1VQA A;  3CAM A;  1RL2 A;  1X9N A;  2YU9 H;  2KBN A;  3GTJ H;  3OYY A;  1HZB A;  4GLA C;  5BR8 Q;  1X3F A;  3HOW H;  1SRO A;  1EIF A;  4P72 A;  1IL2 A;  2JE6 I;  2UU9 Q;  1JJG A;  2V1C C;  4DV6 Q;  4GN3 B;  4EQ5 A;  4DV1 Q;  4A4I A;  3PO3 G;  3HOZ H;  4A3J H;  1KXL A;  2HIV A;  3PUZ A;  4XIG S;  3RLF A;  3U58 A;  1VQD A;  1IBK L;  3PO2 H;  1HNZ L;  2RHS B;  1L1O C;  2ZTC A;  5GAD C;  4HJ9 A;  3RLO A;  1CKO A;  1NTG A;  4DUY L;  4A3D G;  5LMU L;  2EIF A;  2AMC B;  4GOP C; 
#chains in the Genus database with same CATH topology
 2I0Q A;  1E1T A;  5EKK A;  4A93 B;  4KI0 A;  2R7Z G;  3U9O A;  1HNZ Q;  3X3N A;  5KYL A;  3PUV A;  2I5M X;  4PV1 C;  4LF7 Q;  4LF5 Q;  2XN9 C;  3D31 A;  5CYU A;  1S72 A;  2MPM A;  3GTK B;  2NVT B;  3NTH A;  1I4P A;  4L5S A;  4HID A;  2EXD A;  2F0M A;  3L9A X;  3Q24 A;  4IO9 A;  3MAQ A;  4ZKB B;  3NTK A;  3STB C;  1W6K A;  3NWT A;  5I6W A;  4TSS A;  3PUW A;  4LAA A;  1M4V A;  4JOI A;  3H0G H;  4TKO B;  2H5X A;  3OWE B;  1S5B D;  2X69 A;  3K7A H;  3SK8 A;  1N34 Q;  1TY2 A;  5M5X B;  1JOO A;  2EQS A;  5EKI A;  4DPG A;  2B29 A;  2PMZ E;  1C7Y A;  4GNX A;  2A73 B;  1YI2 A;  4YIJ A;  2JA6 B;  3DM1 A;  3OIQ A;  5T1I A;  3VYU A;  4A93 H;  3R2I A;  4K8I A;  5EAY A;  4AYB E;  1B2T A;  1CT1 D;  1EY5 A;  1EQQ A;  3BZD B;  2G5D A;  2YV5 A;  3M4P A;  3J80 L;  3J80 i;  3M9B A;  4J1M A;  4XYO A;  3H09 A;  4JOI C;  1I4Q A;  3K0Y A;  1CHP D;  1HNX Q;  2EPB A;  4ODG A;  3HG9 A;  4CDF C;  2R93 G;  1EY6 A;  4GNX C;  2NB0 A;  1PFS A;  4YCW A;  1G2S A;  4KHZ A;  1PFM A;  3T1Y L;  4BBS G;  3KF8 A;  4OON A;  1YIJ A;  2PPB C;  2JA6 H;  1I94 L;  1FD7 D;  2CWA A;  4RGO S;  4XTC S;  4JCV E;  3A56 A;  3Q8D A;  1SRU A;  5I9O A;  1I94 Q;  1D5Z C;  5HGQ A;  5C4X G;  2EYO A;  2L11 A;  2KUM A;  3E0J A;  4H44 C;  2FXQ A;  1V9P A;  2PI2 A;  4DR3 L;  1F9Q A;  1AW7 A;  4KKS A;  3PO2 B;  5C4J H;  1PA6 A;  3CC2 A;  2E2I H;  4A3M G;  4K2L A;  5IGC A;  4NKL A;  2B2V C;  2OQ0 A;  1RKN A;  4DR6 Q;  1GM5 A;  3RZD B;  1EYC A;  4MTK A;  2CCZ A;  1FNW A;  4BBS H;  5IYD H;  1TKW B;  4NPS A;  1HTL D;  1I6H B;  4GN5 A;  3UE0 A;  1KNE A;  1HUN A;  5FO7 B;  3D8G A;  2K5V A;  2N49 A;  2AKW B;  1JE4 A;  1FNV A;  1DZ1 A;  5JJL A;  4R4C A;  4O2D A;  2QIL A;  3HKZ G;  4BS9 A;  5C44 H;  1VQN A;  2EE1 A;  4GKJ L;  3H3V H;  3OSO A;  3KLS X;  4BY1 B;  2LXK A;  5C5L A;  2K04 A;  1Z47 A;  1V1O A;  5LMU Q;  2CKZ B;  3C1F A;  3PV0 A;  1CFM A;  3HOV H;  1YNN C;  3CCE A;  3GTQ B;  1HHV A;  3ND8 A;  2NZO A;  2CW0 C;  3KF6 A;  3PMF A;  1I4X A;  1AP0 A;  1I4G A;  2VQF L;  1V1P B;  3T53 B;  2KEE A;  3IFT A;  3FEW X;  2KA7 A;  4K2K A;  1ET6 A;  4OIJ A;  4DR4 Q;  2P5Z X;  4CDD C;  5BN5 A;  2WP8 J;  5M5Y B;  2MJ8 A;  1KHI A;  1PTO C;  4JYA L;  1FR3 A;  4JC0 A;  1CZG A;  5DNF A;  1ICW A;  5JAV A;  1G8Z D;  3TRZ A;  1CKN B;  4LJZ C;  2F0K A;  4JYA Q;  4JI8 Q;  3M7G A;  3F1Z A;  1MHW C;  2BCO A;  4UAI A;  2B2U C;  3Q23 A;  3GO5 A;  1E2V A;  4GN4 B;  1U4P A;  3I4M B;  4LUO A;  1SDF A;  1SAP A;  2AWN A;  2ID0 A;  4N9T A;  3M4Q A;  4DXF A;  4J15 A;  5CV4 A;  1QVF A;  4JW0 A;  1QOH A;  5M5Y H;  1KAA A;  1O80 A;  1OXS C;  3A8I E;  1SN8 A;  4JG2 A;  3UDF A;  1WTW A;  4J6H A;  1I50 B;  3HKZ E;  4IN3 A;  5ELE A;  2D5D A;  1D7Q A;  4WFN 3;  1K83 B;  2QKI C;  3G4S A;  1LTL A;  2MGS A;  1YJN A;  4DV0 Q;  1A0I A;  2ZJP A;  4B3S L;  1HNW L;  2X6G A;  1YJ9 A;  4U68 A;  3CCM A;  4DUZ L;  1YIT A;  2WAQ B;  4A3G G;  3S1Q H;  3U50 C;  3QG1 A;  2UXB L;  3I8Z A;  1HPC A;  2QW7 A;  2K32 A;  1EY4 A;  4POF A;  3FRP B;  1HNW Q;  4B3R L;  5KNC A;  1DON A;  3A5Z B;  4QB4 A;  4DR2 L;  1WCM H;  3MXN B;  2ENB A;  5LL6 X;  3HOZ G;  2I46 A;  2RQX A;  5K36 G;  2UXD Q;  4X66 Q;  3PIO A;  3CQZ B;  4Y52 H;  1D2B A;  1VF7 A;  4B3R Q;  2F3I A;  1N32 L;  2BDO A;  2GVA A;  1WTX A;  2KCT A;  1N36 Q;  4ZYS A;  2OCE A;  2L9H A;  5C5M A;  1K83 H;  1SJE D;  1UNS A;  2VNU D;  4OO1 G;  2D0P A;  4YWL A;  3SE0 A;  3WWV A;  2LFN A;  2AHO B;  2NTT A;  5LHY 1;  2EJG C;  3SHL A;  4PG3 A;  4A76 A;  1XMQ Q;  4LMQ D;  4OEM B;  2C5C A;  1F77 A;  3PO3 B;  3E0E A;  1AE2 A;  1Y8P B;  2WKC A;  4A3E G;  1TS4 A;  3H3V I;  3MXG A;  4YHH Q;  2VY3 A;  2HCI A;  3S1R B;  1Q12 A;  5CC4 A;  1QZH A;  4IPH A;  3D3R A;  1C4Q A;  3CQZ H;  2IX1 A;  3AFP A;  1SSO A;  3IAY A;  1PRT D;  4RHR A;  1PV4 A;  1HQM C;  2E8G A;  5M9O A;  3JAM E;  2QDL A;  2AUJ D;  1ENA A;  1PYS B;  3SEB A;  3M4O H;  1JOR A;  2RKS A;  1ZYR C;  3I72 A;  2DY7 A;  3C3L A;  3UE1 A;  2A69 D;  1N33 L;  1GJX A;  1ASY A;  1TS5 A;  3J7A F;  4AIM A;  2JA9 A;  1TWA H;  2F0L A;  4M8A A;  4A3K B;  1VQE A;  4IUQ A;  1GUG A;  1Y1W H;  3I4N B;  1EIH A;  1G6P A;  2DNE A;  5A2Q L;  4R4T A;  1Y1V B;  1DOL A;  4C3J G;  4KJO A;  1T9H A;  4AQY L;  3RNU A;  4FXK C;  2QA4 A;  4OEL B;  1HCZ A;  3P20 A;  1NR2 A;  1K28 A;  3HFZ B;  2EY5 A;  3D6W A;  4BBR G;  2VL6 A;  4KMU C;  3T1H L;  5I4D A;  4AQY Q;  3U9S A;  2NUC A;  3TN2 A;  5CV7 A;  3SGI A;  3GTP B;  1EOT A;  5ELD A;  5J3B A;  4UDU C;  1G2T A;  3PIO 3;  3T1H Q;  2PZW A;  2JA8 B;  5F2D A;  2KEN A;  1SNC A;  3TSS A;  3GD7 A;  2H4O A;  1IYJ B;  1U9R A;  1SND A;  2ZXR A;  4Q5V A;  2RDG A;  3H15 A;  1GUO A;  4UP7 A;  3S2H H;  1JOQ A;  3TDQ A;  1OXX K;  1WVL A;  1IL8 A;  4LFC L;  3S1M H;  2FHT A;  3W1G A;  3VYR A;  2GVB A;  4RMF A;  5D3D A;  3GTP H;  1PLF A;  1D5X C;  1V1P A;  3NPP A;  2F0V A;  4DAP A;  3W5O A;  1QJO A;  1OO9 B;  4JI4 Q;  2N3S A;  5C3E B;  1W3S A;  3HOX B;  4X3T A;  3CD6 A;  1MD2 D;  5KND A;  1IKL A;  2UUB L;  5ELB A;  5DM6 3;  2HQE A;  1ONL A;  4EVO A;  3D4D A;  4A3I B;  1FJG L;  3M4Y A;  3HOW B;  3S1N H;  3URY A;  5CV9 A;  1EY7 A;  1CKN A;  4A3J B;  2ZJR A;  2EYH A;  1I4R A;  1VMP A;  1FJG Q;  1BCP D;  3BDC A;  4YCV A;  4DR7 L;  3LX0 A;  2ZM6 L;  3E9H A;  5IGD A;  5C0X H;  2A68 C;  3HOY G;  1CHQ D;  4LWC A;  2WKD A;  4RA8 A;  2Q2T A;  1KAW A;  1BXT A;  1DOM A;  3QOL A;  3HOX H;  2DJF C;  3R93 A;  3NP8 A;  1X55 A;  4N9P A;  4QY7 A;  4IPD A;  1HR0 W;  3QO2 A;  4X64 Q;  1VQA A;  2KED A;  3CAM A;  1X9N A;  3GTJ H;  1HZB A;  4GLA C;  2OEO A;  5CV8 A;  3HOW H;  3NTI A;  1EIF A;  2JE6 I;  3IKJ A;  4GN3 B;  2E2J B;  3MFG A;  4A3J H;  3PUZ A;  3OOC A;  4XIG S;  1SE2 A;  3RLF A;  2RHS B;  2ZTC A;  4A3D G;  3RLO A;  2DY8 A;  3EVQ A;  3AMU A;  2F0T A;  1YNJ D;  1EZ8 A;  2PNR C;  2NN6 G;  4OO1 I;  3UDX A;  2R6G A;  4RG1 A;  1M8A A;  3AB9 A;  3P1H A;  1M1K C;  3A7A B;  3DXJ C;  1LT3 D;  2CH4 W;  2KVM A;  1M90 C;  2VUM H;  2NVQ B;  3MXN A;  2VS1 A;  2Y0S G;  5LMN W;  1XPR A;  4S3S A;  1VQO A;  3K5O A;  3K58 A;  1TII D;  1R9T H;  4FDB A;  4DV3 L;  3J81 L;  3J81 i;  5JEA J;  1PYB A;  1VQ9 A;  2OF1 A;  5M3F H;  1O7Z A;  4TQU S;  3MZ5 A;  2D2C C;  4GLV B;  5IYC G;  4LFA L;  1KIX A;  2K14 A;  4JI1 L;  2FFK B;  3FP9 A;  1B50 A;  4L8J A;  3BU2 A;  2RVL A;  3GV3 A;  4ZCK A;  3GTL B;  2OTJ A;  4ID6 A;  2SNM A;  1G91 A;  4LFA Q;  1J6Q A;  3A0J A;  4OWX B;  1STN A;  3SK6 A;  2ZJQ A;  1FGU A;  1K3B C;  1UAP A;  4A3F G;  3UDI A;  4DAY B;  3G6E A;  1SE8 A;  3P7J A;  3R2T A;  3JAM i;  3L7Z C;  4LUZ A;  5TSS A;  4I65 A;  1HA5 A;  3MEH A;  1KRT A;  4C3H G;  4K5X A;  1QE6 A;  1EFI D;  2A5H A;  1WYD A;  1PH4 A;  2XIW A;  2F03 A;  2K5H A;  4BY7 H;  1X6O A;  1CTM A;  1SYG A;  2JA5 G;  3FKI B;  1MJC A;  4IUU A;  5IP7 G;  4ZKC B;  5BN3 A;  5CV6 A;  2K1B A;  1RCV D;  1EWH A;  2AQ2 B;  2MO1 A;  3NUC A;  4RCO A;  5M3M H;  3F2B A;  1C9O A;  4H13 C;  3O13 A;  5ELO A;  1VQG A;  3G7L A;  1EQR A;  2K6A A;  3HRZ C;  3T4A C;  1Y14 B;  3S14 H;  4V19 0;  2B63 G;  1TXY A;  1SNM A;  4NXM L;  3AFQ A;  4A3F H;  1STY A;  1HTP A;  3BVM A;  1VQL A;  4WRD A;  1BBW A;  3CCJ A;  4HJ7 A;  1V8Q A;  2XTI A;  2Y0S E;  1STA A;  4FF4 A;  2JA7 G;  3RZO H;  3FKI H;  4CJ1 B;  4DR1 Q;  1Q8K A;  1I4H A;  2JYO A;  2E2H H;  3RMH A;  2JA5 H;  5IP7 H;  1J5E L;  1VQP A;  1D8L A;  2FMC A;  3STB D;  2IX3 A;  4HJ5 A;  2RSO A;  1PVO A;  2IT1 A;  4JI7 Q;  4PMW A;  4ZUI A;  4RGM A;  1SYF A;  4IFD G;  4YWM A;  2UUA L;  1G6Z A;  5KEE A;  3HOU G;  3OW2 A;  1G29 1;  1EEF D;  3H0G B;  2CHB D;  2PI2 E;  3K7A B;  3KUP A;  1VQH A;  1S5F D;  1IXR A;  1VQ7 A;  3ZJY C;  3QWN A;  2CVR A;  4DV2 L;  3J7A V;  1X3E A;  2DNC A;  1JWU D;  4A3L H;  4A3D B;  1IBK Q;  2G9H D;  1ZEQ X;  3IRB A;  1JJ2 A;  4KD3 A;  3J7Y W;  3NK9 A;  2CQO A;  3BYY B;  1LTG D;  1CA6 A;  2Z8L A;  4LF9 L;  2BA1 A;  2RA4 A;  1AN8 A;  3VA7 A;  2D62 A;  2L5T A;  1BVS A;  4P75 A;  3V96 A;  1WTR A;  5I6Y A;  5HUR A;  1AZQ A;  3PF4 A;  2K75 A;  1XNQ L;  5M5W H;  4OIK A;  4LF9 Q;  4DNT B;  4HIK A;  2ICI A;  4H7B A;  1YNX A;  2LKV A;  3KJO A;  1BBU A;  3PF5 A;  1S5E D;  4HIM A;  5ISR A;  4A3D H;  1SEB D;  5G3L F;  2NZH A;  1U5K A;  2EYP A;  2NN6 I;  5EQ0 A;  3Q22 A;  1D5M C;  3CCQ A;  1W2B A;  3KLR A;  3TBI B;  2ASB A;  1E3P A;  3A74 A;  2R7Z H;  2VZA A;  3U4V A;  3S15 H;  3T51 B;  1H95 A;  3KFU A;  2GA4 B;  5GAE C;  1RTN A;  1X65 A;  3MVV A;  1SBB B;  2WB1 G;  5CMD A;  5C4J B;  2E2I B;  4IPG A;  3P75 A;  3R8B A;  4MNO A;  3DM3 A;  4P2C B;  4BA2 I;  1LUZ A;  1E2W A;  2CFM A;  5FKA C;  5E1F A;  2XSC A;  4BBS B;  5IIF A;  1NBW A;  4I7Z C;  3CRL C;  2F0J A;  4BWG B;  3T1Y Q;  3HKS A;  1HXY D;  2SNS A;  2B8G A;  3ITP A;  4OWT B;  1PH8 A;  4A3B G;  2VB3 X;  1KTK A;  1WJJ A;  3Q6S A;  1BF4 A;  1BKB A;  2XRS D;  4FXG C;  1GO3 E;  2JJQ A;  3VA5 A;  3C46 A;  3J7A 5;  3OW7 A;  3NE5 B;  2MP1 A;  3TS2 A;  2Z4H A;  4NB3 A;  5AJ3 L;  2JP1 A;  4A3C G;  4KY5 A;  2F0F A;  5C44 B;  2R93 H;  3I56 A;  2SOB A;  1A6X A;  3A8K E;  1I3Q H;  5AJ3 Q;  4LFB L;  4DR3 Q;  1EZ6 A;  2KCC A;  1SLJ A;  1YHA A;  3CC7 A;  5IWA L;  2XRQ D;  5I2Y A;  3PO2 G;  1YNN D;  4FF2 A;  4F88 A;  3E3X A;  3TP8 A;  3UI2 A;  5A2Q E;  5IP9 G;  4LFB Q;  2CW0 D;  4ZQ3 A;  3HOV B;  2XWJ B;  4DAY A;  5E4X A;  4DR5 L;  5IWA Q;  1K0R A;  2C9O A;  4Q0F A;  1W6J A;  2IHE A;  1DOK A;  3G6J B;  1TWC H;  5C4X H;  2NZ1 D;  4DR5 Q;  1BQQ T;  4C3I G;  2F0U A;  4G7H C;  1PTO D;  4RFB A;  1JCK B;  1T5E A;  5IGE A;  2QDB A;  3HKZ B;  4CBV A;  2A19 A;  1TQO A;  4A3M H;  1MSH A;  5EPK A;  4CKE A;  2WB1 E;  2F0D A;  4GKJ Q;  2K5W A;  3GP7 A;  4R9W A;  4AH6 A;  1EY9 A;  1Z9F A;  4EX5 A;  3TP7 A;  4DN4 M;  1HRJ A;  4C2M H;  3EIV A;  2PNH A;  2PQA B;  3CRK C;  4BY1 G;  2XNA C;  1XTC D;  2RCF A;  3DWQ A;  4R1J A;  1PDQ A;  5EPL A;  5IP9 H;  1K3R A;  2K4K A;  4DA2 A;  3SK5 A;  1HZ9 A;  5CBA E;  3S17 B;  4IFD I;  1I6V C;  2A1A A;  1Y8O B;  1WD1 A;  1S3O A;  5JPN C;  3N52 A;  4IOC A;  4JI2 L;  4KK7 A;  4C3I H;  2VQF Q;  4JI0 L;  2M2L A;  2KQ3 A;  2F0E A;  1LT5 D;  2B2T A;  3RD4 A;  1SYE A;  4KN7 C;  3S16 H;  2XGT A;  3DWP A;  4GOP C;  3KJP A;  5JJK A;  1SXT A;  3K0X A;  3TZU A;  2Z1C A;  3K5M A;  4QJF A;  5FLX c;  1OTC A;  3CXC A;  4FYD A;  1DXM A;  4R4I A;  1PZJ D;  1L0W A;  4CHT B;  3FHW A;  1A3T A;  1YJW A;  3S17 H;  2IHF A;  2B8F A;  1EYD A;  2DUD A;  3S1Q B;  1U0L A;  2YTX A;  5KIX A;  1BBX C;  1ENF A;  3S24 A;  2B2T C;  3SK4 A;  4XYQ A;  4CKC A;  1G51 A;  1GVP A;  2MQH A;  5HY6 A;  1EWI A;  2QEJ C;  1WCM B;  4IOA A;  1DM0 B;  3I4M G;  2D0O A;  5FLX L;  4IQZ A;  3MTS A;  1GUW A;  3DUZ A;  1TWF H;  1QWY A;  1NSN S;  4KN4 C;  4QCL A;  3LWE A;  2PQE A;  1Q3L A;  5IGB A;  1LTR D;  3GQB A;  4KV6 A;  1Q46 A;  1TWH H;  2ES2 A;  3FMC A;  3VR4 A;  1GHK A;  4WJ4 A;  1ET9 A;  1BCP B;  4IAL A;  4KHV A;  2KCN A;  3AEV A;  3LWU A;  2WAC A;  4QMG A;  4B9X A;  2IX0 A;  2A6H C;  3HP3 A;  2UUC L;  4LW1 A;  3CF5 A;  3F2C A;  3H91 A;  1F2M A;  4B3S Q;  3K57 A;  3SVM A;  4GZY C;  1EQT A;  4DUZ Q;  2F4V L;  2A6E C;  1IKM A;  2UXB Q;  1JJC B;  2EDG A;  4NDX A;  1O7I A;  4EQN A;  4LF6 L;  4DAV A;  1F9S A;  5JJZ A;  4H02 A;  4L63 B;  1ZYR D;  4TVA B;  5DEH A;  3NEN A;  5A35 A;  5IT9 c;  4WJW A;  2F4V Q;  4DR2 Q;  3M4O B;  4QL5 A;  4KHP L;  1JIC A;  3MC0 B;  4MIU A;  3J81 E;  1Q1B A;  3H6M A;  3MXU A;  2K05 A;  1N32 Q;  1TWA B;  4IUN A;  1TS2 A;  2KHJ A;  1JWM D;  1SR3 A;  3BS1 A;  3CCV A;  1CI3 M;  1Y1W B;  1EYA A;  2AUK A;  4A3G H;  4EQP A;  1UUP A;  4YY3 L;  1SYB A;  4IUR A;  4HTH A;  2DGY A;  1RL2 A;  2YU9 H;  2KBN A;  5I2X A;  1GUN A;  4C56 C;  1SRO A;  2K03 A;  5ELC A;  1WTO A;  3A8J E;  3PO3 G;  3HOZ H;  1KXL A;  2EJM A;  5KRU A;  3U58 A;  1WTH A;  5K36 H;  1NNX A;  1CKO A;  1NTG A;  4DUY L;  2EIF A;  2AMC B;  1STB A;  4QQB X;  2F0I A;  3ONA B;  5D65 A;  4ZUJ A;  1L0X B;  2X6L A;  4OO1 H;  3I70 A;  3N6R A;  4DK3 C;  1XTD A;  2K28 A;  3OTO L;  2O4X A;  1A15 A;  4K14 A;  2JK8 A;  1N33 Q;  5C0X J;  1U4M A;  4X3K A;  1H9M A;  4A3E H;  4IJH A;  2EY2 A;  1UEB A;  3S2H B;  1SE3 A;  1IW7 C;  1XXG A;  4C3J B;  4I7A A;  4A3K G;  3WDN A;  4IUP A;  1HZC A;  3S1M B;  1BDO A;  3I4N G;  3NQI A;  2VB2 X;  3K5L A;  1Y1V G;  1HJP A;  3GV6 A;  3BVZ A;  3H3V C;  1C48 A;  1WD0 A;  1S5C D;  4CDC C;  2L0C A;  3V05 A;  4JI3 L;  2R92 G;  4ABN A;  1EY8 A;  5FJ8 G;  1PZI D;  1Q1E A;  4DV4 L;  2FMM A;  1HH2 P;  2NVX H;  1JR0 D;  4L6T B;  5ELN A;  1QB5 D;  1H9S B;  1B70 B;  3S1N B;  3I55 A;  3QR8 A;  1WI5 A;  2CWP A;  3OHX C;  2YTY A;  1CM9 A;  1VS0 A;  4RAU C;  2JXM B;  5IE8 A;  4Y7N B;  3I73 A;  2PQA A;  4C3J H;  2JA8 G;  1UWV A;  4FF3 A;  5EBD A;  2B2Y A;  2A68 D;  1KRS A;  1D1I A;  4BBR H;  1MI2 A;  2M9V A;  4B3M L;  3NBH A;  1NMG A;  1LM0 A;  2F0S A;  5EPJ A;  1CZW A;  4LFC Q;  1PYW D;  1V1Q A;  3AQQ A;  3CP0 A;  4X3S A;  1K8G A;  4XT3 B;  1TU2 B;  4B3M Q;  1B8A A;  1Q86 C;  2IL8 A;  4QIW E;  5C6A A;  3GTJ B;  3K7U C;  2HDL A;  4JK1 C;  1RDP D;  2ZT9 C;  3CKI B;  3R3O A;  2UUB Q;  1E22 A;  5C3E G;  4BXX G;  2L55 A;  5FK9 C;  4Y7N H;  1A3U A;  1UEA B;  4O0A A;  3BVG A;  4F8M A;  1IYV A;  4DFA A;  2F0N A;  4A3I G;  4RKL A;  1GHJ A;  4K5V A;  1IYU A;  2CQA A;  2N8N A;  4E6I A;  4APV A;  1LT4 D;  5COY A;  5D3I B;  3SDZ A;  2UXC L;  3I90 A;  5AFW A;  4JI5 L;  4HJ8 A;  4DR7 Q;  2ZM6 Q;  2VUM B;  1IBM L;  4X65 L;  4L5R C;  2L12 A;  1LTA D;  2AQ3 B;  1E2Z A;  3L3O C;  1ILP A;  2Z0S A;  2JEA I;  5LL6 S;  2NVY H;  1R9T B;  1LV9 A;  3G71 A;  1Z7T A;  1BOS A;  4IUV A;  5M3F B;  1ASZ A;  1KDB A;  1B1Z A;  3S9W A;  1NE3 A;  1VQ8 A;  4JPB W;  5EKL A;  1Q81 C;  4BXX H;  2MNA A;  3QJY A;  4OX9 L;  1XWE A;  1SJH D;  3EA6 A;  1PH2 A;  2ALY B;  1B3Q A;  3LNN A;  5DLQ E;  4HIO A;  1AFP A;  3ICE A;  4DK1 A;  2IPK D;  2HUG A;  1B53 A;  3KBG A;  2O2L D;  3HOY H;  1K8O A;  4OX9 Q;  1SE4 A;  4EQO A;  2HHH L;  4K0K L;  4PMC A;  2N88 A;  3VR5 A;  3DEP A;  2TSS A;  3HZX A;  4IUT A;  1VQM A;  2EYF A;  5JOB A;  2NBF A;  2CH4 A;  1MSG A;  1KC8 C;  3BYT B;  3BZC A;  1GXD C;  1VQF A;  1HA6 A;  4CKB A;  1ESR A;  4BY7 B;  4HCS A;  1KNA A;  2R3Z A;  3RN5 A;  3HEJ A;  4F7X A;  3SR1 A;  2E74 C;  4DV3 Q;  5D14 A;  4LK1 C;  2G9D A;  1EL0 A;  5M3M B;  1EU3 A;  4JI1 Q;  1EIG A;  2NN6 H;  1UE6 A;  1PH9 A;  3GTM H;  1K8M A;  2F0W A;  5KNB A;  3S14 B;  1HFN A;  4HN7 A;  1OXU A;  1E1O A;  4A3F B;  3TP5 A;  4LF4 L;  1L1O B;  3NHH A;  2VXW A;  5H1S E;  2YYZ A;  3RZO B;  5E3F A;  4ZLT F;  1VCI A;  3V2T A;  3CPW A;  4LF8 L;  5JJI A;  4LF4 Q;  2XVS A;  1SYC A;  5IYC H;  1DCZ A;  2K5D A;  2E2H B;  2JA5 B;  1XNR L;  1VQC A;  2SDF A;  3EQL C;  2Q8R E;  5IGG A;  1HR0 L;  2WIN B;  1E7Z A;  1B9N A;  1SFO H;  1ROD A;  1IBL L;  1LAB A;  5IYB G;  3FPU B;  3AU7 A;  3EN2 A;  5J22 A;  2PMZ B;  4JI6 L;  2B63 B;  2IW3 A;  5JEA G;  2BE5 C;  3K6O A;  4KJN A;  2RHQ B;  1EUJ A;  4AYB B;  4C3H H;  1LYL A;  1IBL Q;  1PXU A;  4R8N A;  3JC6 6;  5L37 A;  4NXM Q;  1XMO L;  4JI6 Q;  1H9J A;  1PTO B;  4ZAI A;  3UDG A;  1GKH A;  2JA7 B;  3CCL A;  4ME5 A;  5CR3 A;  1FVI A;  3NWS A;  1QNK A;  1S5D D;  3KBX A;  1H9S A;  1ICF B;  2H1E A;  1SNP A;  2L15 A;  4DNR B;  5LMN L;  3W3A A;  5I9P A;  2E5L L;  3TQY A;  2VW9 A;  1J5E Q;  1P8L A;  4MHE A;  5M5W B;  5C3X A;  2KJX A;  1MKH A;  2B63 H;  3IL8 A;  1QUQ B;  4JVZ A;  1UE1 A;  2KOL A;  2ZTD A;  3HOU B;  5HGT A;  1Y8N B;  1C8C A;  3ULP A;  1LTT D;  2KEC A;  3NEL A;  1RJT A;  2LXJ A;  2E5L Q;  2UUA Q;  1N9W A;  5JEA H;  4DV6 L;  1VQ5 A;  4DV1 L;  1B9M A;  1VQ6 A;  3M3Y H;  3A55 A;  3W1B A;  3BDO A;  2F0O A;  2ZXO A;  1PTO H;  4ME3 A;  2JA7 H;  2FIN B;  3H0G G;  3TME A;  3K59 A;  1A3V A;  2R7Z B;  3S15 B;  4DV2 Q;  1JOK A;  2PZT A;  4KKT A;  1P16 A;  1PZK D;  5FLX E;  4A93 G;  4QUF A;  4LF7 L;  4LF5 L;  4XQJ A;  2JSO A;  4OGQ C;  1SMY C;  4IFD H;  3HOU H;  2LSS A;  3ERS X;  1L0Y B;  1ML0 D;  1XNQ Q;  4UY8 C;  1PRT F;  4DNI A;  3DWA A;  3CCR A;  2Q8T A;  1MIU A;  1BNZ A;  1JWS D;  1QZG A;  4R8I A;  1N34 L;  1PH3 A;  1SYD A;  1O7L A;  1JC7 A;  4PZ8 A;  3L0O A;  2F3W A;  2ZTE A;  4FF1 A;  3W2D A;  3PUY A;  3J80 c;  2EOT A;  3D4R A;  1MJE A;  2OTL A;  3PGZ A;  1EOV A;  5FLM G;  4FVM A;  4ILW A;  4B3T L;  2JA6 G;  1NJI C;  4RGN A;  4V0B A;  4EGV A;  2MUY A;  2O5I C;  4DK0 A;  2KHI A;  1YHQ A;  1VQI A;  2JN4 A;  2R93 B;  4B3T Q;  1O78 A;  1PMR A;  3OPO A;  4JV5 L;  2WB1 B;  1HNX L;  1I3Q B;  3M85 A;  1QIL A;  3GTK H;  2NVT H;  1LTS D;  5C4H A;  2TMP A;  2Q2H A;  4JV5 Q;  5EJW A;  2PO4 A;  3ER0 A;  2JQO A;  1KDC A;  1B44 D;  4O1N A;  3ULJ A;  2F0H A;  5IT9 E;  3HS0 C;  1EFW A;  4DK6 C;  1TR5 A;  3MHB A;  4DU9 A;  5M5X H;  4IZ8 A;  4A3B B;  1VMC A;  1O7Y A;  1Y69 U;  4RH6 A;  1TWC B;  5IYD G;  5FLM H;  5DAU A;  3QOJ A;  1QG7 A;  3BDL A;  5C4X B;  1STG A;  1E0B A;  1FGB D;  2OT2 A;  4TRD A;  1FL0 A;  2B2V A;  4L5T A;  1A2U A;  3DLL A;  2ICE C;  1ESF A;  1CQF A;  2PYK A;  4P71 A;  4K8J A;  4KY6 A;  3CU7 A;  2A8V A;  4YWK A;  3QB3 A;  4A3M B;  3FPP A;  2RDH A;  2EY1 A;  5E7N A;  1OXV A;  2F1M A;  3DHQ A;  4JBW A;  4U67 3;  2F3V A;  1K73 C;  5C44 G;  4C2M B;  4DR6 L;  2JEB I;  4QGU A;  4DF7 A;  1Q90 A;  5FO8 B;  2WV6 D;  4CDE C;  4MN3 A;  4NP5 A;  4QF4 A;  1MBY A;  1TY0 A;  1X56 A;  1PRT B;  4A3B H;  4GS3 A;  2RDF A;  1L1O A;  3A54 A;  1A2T A;  1NY4 A;  2J7Z A;  3HOV G;  3A5U A;  5BR8 L;  4A3C H;  2UU9 L;  4C3I B;  2B2W A;  1JB3 A;  3KLS A;  1F2L A;  1BCP F;  4R4O A;  1D6E C;  1VDZ A;  2Z4I A;  5BR8 Q;  1X3F A;  3S16 B;  1VF5 C;  1BUV T;  1IL2 A;  3GTO B;  2UU9 Q;  1JJG A;  2V1C C;  3OWF A;  4EQ5 A;  1Q8I A;  2K33 A;  2HIV A;  2HDM A;  1VQD A;  3PO2 H;  3T16 A;  4N8F A;  1L1O C;  5GAD C;  2EVB A;  5CBE E;  2O5J C;  5LMU L;  2K5Q A;  4XQQ A;  3OMC A;  2ZXP A;  2EXZ A;  5T1G A;  3NQT A;  1XYI A;  2B2W C;  2K5N A;  1LO5 D;  3NBH B;  2K52 A;  1WFQ A;  2GN5 A;  3RZD H;  3PUX A;  3H94 A;  2RSN A;  4NMZ A;  3I2Z A;  3BG3 A;  4LUV A;  1I6H H;  1RF2 D;  3EFX D;  1EY0 A;  1K8A C;  4DR4 L;  1J9O A;  1XPU A;  3GTO H;  4JI2 Q;  1TWF B;  2LS0 1;  1KQS A;  4JBJ A;  3T56 B;  1HQR D;  2BOS A;  4JI0 Q;  4OL7 A;  1ENC A;  5GAG C;  1TWH B;  2B2U A;  3I91 A;  4ZRZ A;  1QUQ A;  2A6H D;  4HMJ A;  2C35 B;  5EGT A;  3OMG A;  4FP5 D;  2BDN A;  4BY1 H;  4JI8 L;  1VQ4 A;  1CSP A;  1YEZ A;  1RHP A;  2QCP X;  2A6E D;  2M00 A;  3T13 A;  3CPF A;  2N78 A;  4HAE A;  3MA2 B;  2L1B A;  3F2D A;  2HD3 A;  5JVH 3;  4POG A;  4MZ9 A;  3CCS A;  3B6Y A;  4B9W A;  4F87 A;  4KY7 A;  3GTQ H;  2NWG A;  3J81 j;  3F8T A;  4K6D A;  1CSQ A;  3NBI A;  2L4N A;  1CA5 A;  1HUM A;  1RIP A;  5NUC A;  3PIP A;  4JBK A;  1WCM G;  2MFI A;  1AH9 A;  2R7F A;  1NCV A;  3TP6 A;  4G57 A;  3E6Z X;  2PCF B;  1A63 A;  1EYG A;  2K7V A;  4X62 L;  4DV0 L;  3VYT A;  1KL9 A;  2E75 C;  4GKK L;  2Z6B A;  4A3G B;  4FO2 A;  3KLW A;  4A75 A;  2YU9 B;  5IOD A;  1TWG B;  3IFD A;  1STH A;  4X62 Q;  2UUC Q;  1KLU D;  1LTB D;  4RGT A;  2WAQ G;  4GKK Q;  2E76 C;  3HOZ B;  3KK7 A;  3I4M H;  4KD4 A;  3BJU A;  5C4Z A;  2UXD L;  4X66 L;  1LTI D;  4LF6 Q;  2BH2 A;  1N36 L;  4UHV A;  1ILQ A;  1QVG A;  2HT1 A;  4QUC A;  4KHP Q;  3BZK A;  4O42 A;  4DKA C;  4XT1 B;  4PMB A;  1I50 H;  1IW7 D;  4LNQ A;  1X3Q A;  3HGB A;  4A3E B;  1XMQ L;  1F9R A;  5IT9 L;  1QNU A;  5IY0 A;  1TWG H;  1EQV A;  1L2F A;  4IPC A;  4OXP A;  4PQX A;  4YHH L;  1Y1W G;  4YY3 Q;  1CUK A;  4XQN A;  1WTV A;  3WOF A;  1S40 A;  1PH5 A;  1YHB A;  1JB7 A;  3LGJ A;  1BO0 A;  2LY7 A;  4QIW B;  1FNU A;  1RD9 D;  4XXE A;  4DUY Q;  1KAB A;  4UPA A;  3PIP 3;  4L5Q A;  1JQY D;  2HCC A;  2NVX B;  3PCO B;  1A8V A;  3FVQ A;  1DYQ A;  3D6C A;  4FNF A;  3RN2 A;  3VYS A;  1JE5 A;  1WTP A;  2LMC B;  4WJ3 M;  5G3L D;  2F4I A;  1CKM A;  3OTO Q;  3CC4 A;  4KKU A;  3L2P A;  3AYH B;  1K0S A;  3E9I A;  1D1K A;  2MHV A;  1R4Q B;  3OIP A;  4BBR B;  1Q82 C;  3PO3 H;  1A62 A;  3KDF B;  2VQE L;  5C3W A;  4RKB A;  2WAQ E;  1DD2 A;  4HR7 B;  1C0A A;  1PH7 A;  3S1R H;  3ERQ A;  2PW5 A;  4IJL A;  2R92 B;  4DGZ A;  2WII B;  1S4Z A;  2QGQ A;  3KOJ A;  2VQE Q;  1R4P B;  4JI3 Q;  1F2Z A;  2WFW A;  1U4L A;  1WOC A;  4HSV A;  3ERO A;  4DV4 Q;  1YBY A;  3VR6 A;  2KHS A;  1PRT C;  3M7N A;  4K5W A;  4N8X 1;  1TVX A;  2FJ2 A;  3S2D B;  4KLK A;  5ELF A;  1MGS A;  3CCU A;  2IWH A;  2A74 C;  4A3K H;  2A69 C;  2I5L X;  4HCE A;  2K50 A;  3CHB D;  5GQO A;  2EJF C;  4GOP B;  1J8I A;  2R61 A;  4WOR A;  2BA0 A;  5DM7 3;  3I4N H;  3X3M A;  1PH6 A;  1AE3 A;  3FDT A;  2XWB B;  4CJ2 C;  1Y1V H;  4P74 A;  2QF7 A;  5JPM C;  2R92 H;  4ALP A;  4G7Z C;  3Q0A A;  2B3G A;  2AWO A;  5FJ8 H;  2EY6 A;  5C0X G;  2B39 A;  4HMI A;  4JI4 L;  2NVY B;  1VQB A;  1YVC A;  2B2Y C;  1AZP A;  3I4O A;  3J7Z C;  1LT6 D;  5J1Z A;  1UE5 A;  1EU4 A;  3WOE A;  3HOX G;  3S2D H;  2NTS A;  2I5H A;  3K80 C;  2JA8 H;  3MFY A;  3ND9 A;  1GD7 A;  3HOW G;  4G7O C;  4HED A;  1YZ6 A;  3K81 C;  5GRO A;  2HQL A;  1PH1 A;  4C1N I;  4ULL A;  5E4W C;  4A3J G;  3VR3 A;  1KD1 C;  4UP9 A;  3HOY B;  4RWS C;  3KYH C;  3D4W A;  2N55 A;  1EIY B;  2UXC Q;  2PW7 A;  3NXW A;  4PZ6 A;  3RUZ A;  4JI5 Q;  1K9M C;  3GDE A;  1CK1 A;  1U4R A;  1H9K A;  2RBM A;  2R7D A;  1STE A;  3PQI A;  3TZD A;  1IBM Q;  4X65 Q;  4CGY B;  4GNX B;  1XPO A;  5GAH C;  4X64 L;  2VUM G;  4Z9C B;  3NSW A;  1PFN A;  1B3A A;  5FO9 B;  1UE7 A;  5C3E H;  2KCM A;  3A7L A;  2Q8I B;  1TT2 A;  2RF4 A;  2Q2I A;  1CQV A;  4A3I H;  1IHZ A;  5M3F G;  3EJI A;  1TS3 A;  1X54 A;  4XDX A;  2DN8 A;  2Z6K A;  3J80 E;  4X6A H;  3GTM B;  3MEF A;  2EYJ A;  2EYM A;  2OWO A;  1PTO F;  1GUT A;  3VR2 A;  2I07 B;  5COR A;  1NR4 A;  2Y0S B;  3RLN A;  1VQJ A;  1QCB D;  3J81 c;  2EZV A;  2HHH Q;  4K0K Q;  1BCP C;  3KF8 B;  4J8Q A;  1LAC A;  2ATW A;  1ZKO A;  1N8R C;  2RCN A;  3C1E A;  5BN4 A;  1Z6H A;  1FYC A;  1WTQ A;  1SNO A;  4BA1 I;  1EEI D;  3QIA A;  2Z6K C;  5IOC A;  3TEH B;  3CME A;  1IZ6 A;  1BR9 A;  2AQ1 B;  1I5F A;  4P73 A;  4BY7 G;  1X32 A;  2HIX A;  2E2J H;  2IJ0 A;  2YTV A;  1SFO B;  1PHJ A;  5J39 A;  4FXD A;  3JAM c;  4MTN A;  2BE5 D;  3NEM A;  3RR5 A;  3C2P A;  4DXG A;  1F9P A;  2F0G A;  1XJV A;  3GTG B;  5M3M G;  1QVC A;  1H9R A;  4R4Q A;  1JT8 A;  4C3H B;  3DMU A;  1YNJ C;  1Q7Y C;  2EYL A;  3E5S A;  1ZXT A;  3TS0 A;  4DAM A;  2NVQ H;  3K8A A;  3JAM L;  5KGU A;  1VQK A;  4IFD J;  5JVG 3;  2IY5 B;  1RTO A;  2J0T D;  3DEO A;  4YCU A;  1JMC A;  2OXP A;  2K01 A;  1DGS A;  4LF8 Q;  2V4D A;  1HZA A;  3FKI G;  1F2Y A;  3CW2 C;  4DV5 L;  4RHS A;  1OXT A;  1XNR Q;  3PSI A;  2PZU A;  3GTG H;  1SNQ A;  1II3 A;  4HSP A;  4B08 A;  4OWW B;  1V43 A;  2J4X A;  1HR0 Q;  4OHJ A;  4DV5 Q;  4JBM A;  5IGF A;  3EBE A;  4NXN L;  3GTL H;  3KDF A;  3G48 A;  3ZYY X;  3MXP A;  1B4O A;  3MWY W;  5K5P A;  1EWC A;  4KTA A;  3I3C A;  3M3Y B;  4UP8 A;  1B7Y B;  4HJA A;  2Q2U A;  4K6L A;  4DV7 L;  3ULL A;  2MO0 A;  3U4Z A;  3TRE A;  2OQK A;  4RCN A;  1AEX A;  4X3U A;  4NXN Q;  3I4L A;  4G4K A;  1PFB A;  2F0Q A;  1X3P A;  1XMO Q;  4C1N K;  4AYB G;  3KF6 B;  1GOZ A;  4DV7 Q;  4DR1 L;  3D0F A;  1NAP A;  3CMA A;  3SXH A;  3K5N A;  1NUC A;  4A3L G;  1SMX A;  1SMY D;  2SEB D;  5EBC A;  1E24 A;  4GLX A;  1GUS A;  4H0L C;  5C0X I;  1DJR D;  1KDA A;  1NMF A;  3VDY A;  2F52 A;  2E2D C;  5IYB H;  4JI7 L;  5LMN Q;  2QEX A;  4NW2 A;  2NYZ D;  4GOP A;  4M1U B;  4PNY A;  1LLR D;  2D9U A;  3I7F A;  2BH8 A;  1XX8 A;  1HFG A;  1T5X D;  5CV5 A;  4PZ7 A;  5CGK A;  1X3G A;  3F2U A;  2Z9H A;  2DJG C;  3OYY A;  4P72 A;  5FOB B;  5KYI A;  4DV6 Q;  4DV1 Q;  4A4I A;  4CJ0 B;  1KLG D;  1IBK L;  1HNZ L;  4HJ9 A;  2F0P A;  4ZK9 B; 
#chains in the Genus database with same CATH homology
 2I0Q A;  1E1T A;  2NN6 G;  4OO1 I;  2K5N A;  3NBH B;  4KI0 A;  2R6G A;  3UDX A;  2R7Z G;  2K52 A;  4RG1 A;  1WFQ A;  2GN5 A;  3RZD H;  3PUX A;  1HNZ Q;  3PUV A;  2I5M X;  4DK3 C;  3I2Z A;  1M1K C;  4LF5 Q;  1XTD A;  4LF7 Q;  3D31 A;  3OTO L;  4LUV A;  1S72 A;  1I6H H;  1M90 C;  2JK8 A;  1N33 Q;  2VUM H;  5C0X J;  4L5S A;  2VS1 A;  2Y0S G;  4HID A;  2EXD A;  4A3E H;  5LMN W;  4IO9 A;  4IJH A;  1XPR A;  1UEB A;  1VQO A;  1K8A C;  4DR4 L;  3STB C;  1XPU A;  1R9T H;  3PUW A;  4JI2 Q;  3GTO H;  4FDB A;  4DV3 L;  4A3K G;  1KQS A;  4JBJ A;  3J81 i;  5JEA J;  1PYB A;  4JOI A;  1HZC A;  1VQ9 A;  3H0G H;  5M3F H;  2H5X A;  4JI0 Q;  3I4N G;  3K7A H;  4TQU S;  1N34 Q;  4GLV B;  5GAG C;  2EQS A;  5IYC G;  1KIX A;  1Y1V G;  1HJP A;  2K14 A;  4JI1 L;  4DPG A;  2B29 A;  2PMZ E;  1C7Y A;  4GNX A;  1QUQ A;  3FP9 A;  1YI2 A;  2C35 B;  3BU2 A;  4BY1 H;  2R92 G;  4A93 H;  4JI3 L;  4JI8 L;  5EAY A;  1VQ4 A;  4AYB E;  2OTJ A;  1CSP A;  1YEZ A;  5FJ8 G;  4LFA Q;  1Q1E A;  1J6Q A;  4DV4 L;  1EQQ A;  3CPF A;  3A0J A;  4OWX B;  1HH2 P;  2YV5 A;  2N78 A;  3M4P A;  5ELN A;  2NVX H;  3J80 i;  3F2D A;  3M9B A;  2ZJQ A;  4POG A;  1FGU A;  1B70 B;  4MZ9 A;  4A3F G;  4JOI C;  3UDI A;  4DAY B;  3G6E A;  3CCS A;  1SE8 A;  3JAM i;  3B6Y A;  3I55 A;  3L7Z C;  4LUZ A;  3GTQ H;  1WI5 A;  2CWP A;  3J81 j;  3F8T A;  1HNX Q;  2YTY A;  1KRT A;  1VS0 A;  2R93 G;  1CSQ A;  5IE8 A;  2PQA A;  4C3J H;  2JA8 G;  1UWV A;  4GNX C;  1RIP A;  1WYD A;  1PFS A;  1PH4 A;  4YCW A;  3PIP A;  1KRS A;  2K5H A;  4KHZ A;  4BY7 H;  4JBK A;  1X6O A;  4BBR H;  3T1Y L;  1WCM G;  2JA5 G;  2MFI A;  4BBS G;  4B3M L;  1MJC A;  5IP7 G;  1AH9 A;  2R7F A;  1NMG A;  4OON A;  1LM0 A;  1YIJ A;  2JA6 H;  1I94 L;  4LFC Q;  1V1Q A;  3CP0 A;  3AQQ A;  1K8G A;  2CWA A;  1A63 A;  2MO1 A;  5M3M H;  1EYG A;  3F2B A;  4X62 L;  1C9O A;  4XTC S;  4JCV E;  4DV0 L;  1KL9 A;  4GKK L;  5ELO A;  3Q8D A;  4B3M Q;  1B8A A;  1VQG A;  1Q86 C;  1SRU A;  1EQR A;  3KLW A;  1Y14 B;  3S14 H;  1I94 Q;  4QIW E;  4A75 A;  5HGQ A;  2B63 G;  3K7U C;  5C4X G;  1TXY A;  4X62 Q;  2UUC Q;  4NXM L;  2WAQ G;  2FXQ A;  2UUB Q;  1E22 A;  4GKK Q;  5C3E G;  1V9P A;  2PI2 A;  3AFQ A;  4Y7N H;  4DR3 L;  4A3F H;  1VQL A;  4BXX G;  4O0A A;  5C4J H;  1PA6 A;  3I4M H;  1BBW A;  3CC2 A;  2E2I H;  3CCJ A;  4HJ7 A;  4A3M G;  2XTI A;  3BJU A;  2Y0S E;  2UXD L;  4X66 L;  4A3I G;  2OQ0 A;  4LF6 Q;  2JA7 G;  3RZO H;  3FKI H;  2N8N A;  2BH2 A;  4DR6 Q;  1N36 L;  4APV A;  1Q8K A;  4DR1 Q;  1GM5 A;  2UXC L;  2E2H H;  2JA5 H;  1QVG A;  2CCZ A;  2HT1 A;  4BBS H;  4KHP Q;  5IYD H;  4JI5 L;  3BZK A;  4NPS A;  4DKA C;  5IP7 H;  4HJ8 A;  1VQP A;  1J5E L;  4DR7 Q;  1D8L A;  2ZM6 Q;  4GN5 A;  1IBM L;  4X65 L;  3STB D;  4L5R C;  3UE0 A;  1I50 H;  4LNQ A;  4HJ5 A;  1XMQ L;  2IT1 A;  4JI7 Q;  1PVO A;  2Z0S A;  4PMW A;  5IY0 A;  2JEA I;  2K5V A;  2N49 A;  4IFD G;  1TWG H;  2NVY H;  4YWM A;  2AKW B;  2UUA L;  3HOU G;  3OW2 A;  1L2F A;  4IPC A;  3G71 A;  4OXP A;  1G29 1;  4YHH L;  2PI2 E;  1Y1W G;  1ASZ A;  5JJL A;  4R4C A;  1CUK A;  4O2D A;  4YY3 Q;  1NE3 A;  1VQ8 A;  1VQH A;  3HKZ G;  5C44 H;  1S40 A;  1Q81 C;  2MNA A;  1VQN A;  1PH5 A;  1IXR A;  4BXX H;  1VQ7 A;  1YHB A;  4GKJ L;  3ZJY C;  4OX9 L;  3H3V H;  1JB7 A;  3LGJ A;  4DV2 L;  1PH2 A;  1X3E A;  2ALY B;  2LXK A;  5DLQ E;  4HIO A;  4QQB X;  4A3L H;  3ICE A;  1IBK Q;  1Z47 A;  3IRB A;  1JJ2 A;  4DUY Q;  4UPA A;  5LMU Q;  2CQO A;  4L5Q A;  2CKZ B;  3HOY H;  4OX9 Q;  4LF9 L;  2BA1 A;  3PV0 A;  2HHH L;  4K0K L;  3PCO B;  1A8V A;  2D62 A;  3HOV H;  3CCE A;  1BVS A;  3RN2 A;  1VQM A;  4P75 A;  1JE5 A;  4WJ3 M;  2NZO A;  1KC8 C;  3KF6 A;  3PF4 A;  3BZC A;  1CKM A;  2K75 A;  3OTO Q;  1VQF A;  5M5W H;  1XNQ L;  3CC4 A;  4LF9 Q;  2VQF L;  4HIK A;  3L2P A;  1YNX A;  3AYH B;  3E9I A;  4DR4 Q;  3KJO A;  1Q82 C;  3RN5 A;  3PO3 H;  1A62 A;  3KDF B;  1BBU A;  3PF5 A;  4DV3 Q;  2WP8 J;  2VQE L;  4HIM A;  1KHI A;  2WAQ E;  4JYA L;  1C0A A;  1PH7 A;  4JC0 A;  3S1R H;  4A3D H;  2NZH A;  1U5K A;  3CCQ A;  2NN6 I;  4JI1 Q;  4IJL A;  1W2B A;  3TRZ A;  1UE6 A;  1E3P A;  3A74 A;  2ASB A;  1PH9 A;  2QGQ A;  3KOJ A;  2VZA A;  2VQE Q;  2R7Z H;  1CKN B;  3U4V A;  3GTM H;  3S15 H;  4JI3 Q;  4JI8 Q;  2WFW A;  4JYA Q;  1WOC A;  1H95 A;  3KFU A;  5GAE C;  3F1Z A;  1OXU A;  4DV4 Q;  1YBY A;  1X65 A;  1E1O A;  3M7N A;  2WB1 G;  3GO5 A;  4GN4 B;  4LF4 L;  4LUO A;  4KLK A;  2AWN A;  4IPG A;  3CCU A;  2ID0 A;  1L1O B;  3M4Q A;  4J15 A;  4A3K H;  4MNO A;  1QVF A;  2I5L X;  2K50 A;  5GQO A;  4GOP B;  5H1S E;  2YYZ A;  3DM3 A;  4BA2 I;  1LUZ A;  2CFM A;  2BA0 A;  3I4N H;  1VCI A;  3CPW A;  1PH6 A;  1AE3 A;  4LF8 L;  5JJI A;  5M5Y H;  4LF4 Q;  5IYC H;  1Y1V H;  1XNR L;  1OXS C;  4P74 A;  1NBW A;  1VQC A;  1SN8 A;  4JG2 A;  3T1Y Q;  3UDF A;  2R92 H;  3HKS A;  3HKZ E;  4ALP A;  4OWT B;  1PH8 A;  1D7Q A;  2B3G A;  1HR0 L;  2AWO A;  5FJ8 H;  4A3B G;  1E7Z A;  1WJJ A;  5C0X G;  3G4S A;  1LTL A;  1SFO H;  1BKB A;  4JI4 L;  1YJN A;  1GO3 E;  1IBL L;  1VQB A;  2JJQ A;  5IYB G;  1YVC A;  4DV0 Q;  1A0I A;  3I4O A;  3J7Z C;  2ZJP A;  3EN2 A;  4JI6 L;  3J7A 5;  4B3S L;  1UE5 A;  4NB3 A;  5AJ3 L;  3HOX G;  3TS2 A;  4A3C G;  1HNW L;  1YJ9 A;  5JEA G;  3CCM A;  4DUZ L;  3S2D H;  1YIT A;  2RHQ B;  4A3G G;  1EUJ A;  3S1Q H;  3U50 C;  1LYL A;  2I5H A;  4C3H H;  1IBL Q;  2UXB L;  2R93 H;  3K80 C;  3JC6 6;  2JA8 H;  3I56 A;  4NXM Q;  1XMO L;  4POF A;  4JI6 Q;  1GD7 A;  3HOW G;  1I3Q H;  5AJ3 Q;  1YZ6 A;  4LFB L;  4DR3 Q;  3K81 C;  4B3R L;  1HNW Q;  3A5Z B;  5GRO A;  1SLJ A;  1YHA A;  2HQL A;  5IWA L;  3CC7 A;  3UDG A;  1PH1 A;  1GKH A;  3HOZ G;  4DR2 L;  1WCM H;  3MXN B;  4A3J G;  1KD1 C;  3CCL A;  4UP9 A;  3PO2 G;  1FVI A;  5K36 G;  2UXD Q;  4X66 Q;  3PIO A;  3KYH C;  4Y52 H;  5IP9 G;  4LFB Q;  4B3R Q;  2F3I A;  1N32 L;  1N36 Q;  2GVA A;  2KCT A;  2L15 A;  4DR5 L;  1EIY B;  2OCE A;  5IWA Q;  5LMN L;  1K83 H;  2UXC Q;  1K0R A;  2VNU D;  4OO1 G;  2D0P A;  4PZ6 A;  4YWL A;  2E5L L;  4JI5 Q;  3TQY A;  2VW9 A;  1J5E Q;  1K9M C;  3GDE A;  1P8L A;  2IHE A;  3WWV A;  2R7D A;  2AHO B;  1IBM Q;  4X65 Q;  1MKH A;  1TWC H;  2B63 H;  4GNX B;  1QUQ B;  5C4X H;  1UE1 A;  2ZTD A;  5GAH C;  4PG3 A;  4X64 L;  4A76 A;  4DR5 Q;  1XPO A;  1XMQ Q;  2VUM G;  3ULP A;  3NEL A;  1AE2 A;  3E0E A;  2LXJ A;  1UE7 A;  5C3E H;  2KCM A;  2E5L Q;  4A3E G;  2UUA Q;  1N9W A;  3H3V I;  4DV6 L;  1VQ5 A;  4DV1 L;  3M3Y H;  1VQ6 A;  4YHH Q;  2VY3 A;  2A19 A;  3W1B A;  4A3M H;  1Q12 A;  2RF4 A;  2Q2I A;  4ME3 A;  4LFA L;  4A3I H;  2WB1 E;  2JA7 H;  3H0G G;  5M3F G;  1X54 A;  4GKJ Q;  4AH6 A;  2Z6K A;  1QZH A;  4IPH A;  4X6A H;  1Z9F A;  4EX5 A;  3CQZ H;  4DV2 Q;  3MEF A;  3AFP A;  2IX1 A;  4C2M H;  3EIV A;  2PNH A;  2PQA B;  1P16 A;  1PV4 A;  2OWO A;  2E8G A;  4BY1 G;  1PYS B;  4A93 G;  3M4O H;  4R1J A;  5IP9 H;  1K3R A;  2K4K A;  3RLN A;  4LF5 L;  4LF7 L;  1VQJ A;  3UE1 A;  3J81 c;  2HHH Q;  1HZ9 A;  1N33 L;  1ASY A;  4K0K Q;  3KF8 B;  4AIM A;  4IFD I;  2JA9 A;  1TWA H;  2A1A A;  2ATW A;  3HOU H;  1N8R C;  1S3O A;  2LSS A;  1VQE A;  2RCN A;  4IOC A;  4JI2 L;  3ERS X;  1Y1W H;  1XNQ Q;  4C3I H;  1G6P A;  4UY8 C;  4BA1 I;  4DNI A;  2VQF Q;  4R4T A;  3CCR A;  2Z6K C;  3TEH B;  1MIU A;  4JI0 L;  3CME A;  1QZG A;  1IZ6 A;  1N34 L;  1PH3 A;  1T9H A;  1I5F A;  4AQY L;  3RNU A;  2QA4 A;  3S16 H;  4PZ8 A;  3L0O A;  2XGT A;  2ZTE A;  3PUY A;  3HFZ B;  4P73 A;  4BY7 G;  3J80 c;  2HIX A;  4BBR G;  3KJP A;  1MJE A;  2E2J H;  2VL6 A;  2OTL A;  5JJK A;  2YTV A;  3K0X A;  1EOV A;  3PGZ A;  3T1H L;  5FLM G;  1PHJ A;  3JAM c;  4B3T L;  2JA6 G;  4MTN A;  4AQY Q;  3NEM A;  4QJF A;  3RR5 A;  5FLX c;  1NJI C;  1XJV A;  1OTC A;  3CXC A;  3SGI A;  5M3M G;  4R4I A;  1QVC A;  5J3B A;  1L0W A;  4R4Q A;  3FHW A;  1JT8 A;  2KHI A;  1YJW A;  3S17 H;  1YHQ A;  2IHF A;  1VQI A;  2DUD A;  3T1H Q;  1U0L A;  4B3T Q;  2YTX A;  4JV5 L;  1Q7Y C;  1HNX L;  2KEN A;  3S24 A;  3M85 A;  3TS0 A;  3GD7 A;  4DAM A;  1G51 A;  1GVP A;  2MQH A;  5HY6 A;  2NVT H;  1EWI A;  1IYJ B;  2NVQ H;  3GTK H;  4IOA A;  3K8A A;  1VQK A;  4IFD J;  2IY5 B;  2Q2H A;  4JV5 Q;  3I4M G;  2D0O A;  3ER0 A;  4UP7 A;  3H15 A;  3S2H H;  4YCU A;  1JMC A;  2JQO A;  1OXX K;  1DGS A;  1TWF H;  3ULJ A;  4LF8 Q;  1EFW A;  4LFC L;  1HZA A;  3FKI G;  3CW2 C;  4DK6 C;  4DV5 L;  3S1M H;  1OXT A;  1XNR Q;  1Q46 A;  3W1G A;  3PSI A;  5M5X H;  2GVB A;  1TWH H;  4RMF A;  2ES2 A;  3GTG H;  4WJ4 A;  5IYD G;  5FLM H;  3GTP H;  4OWW B;  1V43 A;  1HR0 Q;  3AEV A;  4DV5 Q;  4JBM A;  3W5O A;  4JI4 Q;  3EBE A;  2N3S A;  1FL0 A;  4NXN L;  1W3S A;  4L5T A;  2IX0 A;  3KDF A;  3GTL H;  3G48 A;  3DLL A;  2UUC L;  4LW1 A;  3CD6 A;  3CF5 A;  3F2C A;  2UUB L;  4P71 A;  4UP8 A;  1B7Y B;  4HJA A;  2Q2U A;  4B3S Q;  2A8V A;  4YWK A;  4DV7 L;  3ULL A;  2MO0 A;  3U4Z A;  3TRE A;  4DUZ Q;  2OQK A;  2F4V L;  1FJG L;  3S1N H;  4NXN Q;  2UXB Q;  1JJC B;  5E7N A;  1OXV A;  1O7I A;  4JBW A;  4LF6 L;  1CKN A;  1XMO Q;  4AYB G;  1K73 C;  5C44 G;  3KF6 B;  4H02 A;  2ZJR A;  4TVA B;  4DR6 L;  2JEB I;  4QGU A;  4DV7 Q;  4DR1 L;  3NEN A;  3D0F A;  3CMA A;  5IT9 c;  2F4V Q;  1FJG Q;  4DR2 Q;  4YCV A;  4A3L G;  4QL5 A;  1SMX A;  4KHP L;  4DR7 L;  1E24 A;  4GLX A;  2ZM6 L;  3E9H A;  5C0X I;  1X56 A;  4A3B H;  4GS3 A;  1NMF A;  3VDY A;  1Q1B A;  2F52 A;  1N32 Q;  3HOY G;  1L1O A;  5IYB H;  4LWC A;  2Q2T A;  4JI7 L;  1NY4 A;  5LMN Q;  2QEX A;  1KAW A;  2KHJ A;  4GOP A;  3HOV G;  3A5U A;  1SR3 A;  5BR8 L;  3CCV A;  3I7F A;  3HOX H;  2BH8 A;  4A3C H;  2UU9 L;  1X55 A;  4PZ7 A;  4A3G H;  1X3G A;  4IPD A;  4QY7 A;  4YY3 L;  4R4O A;  1HR0 W;  2DGY A;  4X64 Q;  1VQA A;  3CAM A;  1RL2 A;  1X9N A;  2YU9 H;  2KBN A;  3GTJ H;  3OYY A;  1HZB A;  4GLA C;  5BR8 Q;  1X3F A;  3HOW H;  1SRO A;  1EIF A;  4P72 A;  1IL2 A;  2JE6 I;  2UU9 Q;  1JJG A;  2V1C C;  4DV6 Q;  4GN3 B;  4EQ5 A;  4DV1 Q;  4A4I A;  3PO3 G;  3HOZ H;  4A3J H;  1KXL A;  2HIV A;  3PUZ A;  4XIG S;  3RLF A;  3U58 A;  1VQD A;  1IBK L;  3PO2 H;  1HNZ L;  2RHS B;  1L1O C;  2ZTC A;  5GAD C;  4HJ9 A;  3RLO A;  1CKO A;  1NTG A;  4DUY L;  4A3D G;  5LMU L;  2EIF A;  2AMC B;  4GOP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...