4A3DH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dH00
4JBMA 4BY7H 1A63A 3M4PA 1VQOA 4H02A 4JG2A 5IY0A 2VQFQ 5IYCH 1BVSA 1I3QH 4UP7A 3JAMi 1EOVA 2CCZA 4QIWE 5IYBG 4A3EG 3HOYH 1JT8A 3OYYA 5M3FH 4NXMQ 4C3IH 2JA7G 4A3BH 1O7IA 2UXBQ 1C9OA 4DV2L 5C0XG 4A3IG 1GM5A 5C44H 1OXSC 3MEFA 4LF4L 3K0XA 4JI0Q 4QJFA 4LF6L 3CC7A 1E3PA 1XNRL 1PYSB 2IX0A 1CKNB 4RMFA 5GQOA 1KC8C 1N34L 1PA6A 2HHHQ 3KF8B 3H15A 3UE0A 4AYBG 1KL9A 1NE3A 2VUMG 4DR1Q 4DR2L 2K50A 4QY7A 4L5SA 3F1ZA 5HY6A 4EQ5A 3RZDH 4JYAQ 3CC2A 1PVOA 1X6OA 2JEBI 3BZKA 4LUOA 1WCMG 3CF5A 4DV6L 1Y1VG 5C3EG 3GTOH 1HNWL 4YCUA 3PUWA 4GLAC 1PYBA 5E7NA 1VQHA 2KCTA 2VY3A 5C4JH 4A3MH 4JI3L 2ZM6L 2E2JH 3H3VI 2QA4A 4LF9Q 3ER0A 3HOVH 2I5LX 4DV5Q 1VQNA 2RCNA 1JMCA 4AIMA 5LMUQ 4BXXG 4GKKQ 4P72A 2Q2UA 4A3GH 3D31A 4LFCL 2NZOA 3HOUG 1TWFH 2MO0A 4TVAB 2WP8J 4B3TQ 1EIYB 1TWHH 5JJIA 1VQ7A 2RHSB 2QGQA 4IFDJ 2A19A 3OW2A 4KHPL 1Q12A 1CUKA 1TWCH 2Z0SA 1Q7YC 5LMNQ 4A3BG 1QVGA 3J81i 2Y0SG 3T1HQ 1L1OB 2MQHA 1UE6A 1SLJA 3I4MG 1TXYA 1VQEA 3PIOA 1PH2A 1LTLA 4JBWA 2OQKA 3I7FA 3D0FA 1IBKQ 1X3FA 2KCMA 3HOWG 1HNZL 2UU9L 1E1OA 4JI4L 1JJCB 4JI1L 1L2FA 2FXQA 3A74A 3I4OA 3FP9A 3AEVA 1PH8A 4LFAL 2UXCL 3KFUA 4YHHL 3AYHB 5C0XJ 1IBMQ 1NMFA 3H0GG 3CCUA 5LMNW 3HKSA 4LUVA 1E1TA 3PUZA 1BBUA 3HOZG 2L15A 3FKIH 3KLWA 3GTQH 3M9BA 3J7A5 2F3IA 4B3MQ 2ZJPA 2RHQB 1I94Q 2YYZA 4X64Q 3J80i 4YY3L 1YJWA 4DV4Q 1N36L 5GAGC 4IPHA 2HIXA 3M85A 1PH1A 5HGQA 2UUBQ 2GVBA 4PZ8A 1P8LA 3S1RH 4DR5Q 4HIOA 1QUQA 4R4OA 3PO2H 1J5EL 2HT1A 2ZTCA 2BA0A 4B3SL 1KXLA 3G4SA 3S1NH 4GKJQ 4DV3L 5FLMG 2ZTDA 1WOCA 2JJQA 5JJKA 1S3OA 2KBNA 2YV5A 1N33Q 1XMOL 4HJAA 4JI2Q 4UPAA 5FJ8G 3RLFA 3T1YL 3ZJYC 2VL6A 4DAMA 1M1KC 3I4NH 3I56A 1UE1A 1XJVA 4FDBA 4LW1A 1JE5A 1SRUA 5IP9G 1YHAA 4BBSG 3CCLA 3KDFA 2XTIA 4X62Q 3PV0A 4X66Q 1I5FA 2F52A 3TEHB 4C2MH 3HOXG 1HH2P 4A3FG 2OQ0A 4B3RQ 3E0EA 1MKHA 1HJPA 1D7QA 3K8AA 4NXNL 4LNQA 3DM3A 2DUDA 4IPCA 4JOIC 3U50C 5IYCG 5K36G 4A3JH 2V1CC 2UXDL 2ID0A 1CSPA 2AHOB 4DK6C 4UY8C 1B8AA 4LF5L 1HZCA 3CAMA 3HOYG 5M3FG 1BKBA 1CKOA 4BBRH 1VQPA 4LF8L 4DR6L 2GVAA 4JI6Q 3ULJA 1EQRA 3AQQA 5H1SE 1R9TH 4L5TA 5C44G 4HIKA 1XNRQ 1SR3A 2N49A 3CMAA 4L5QA 2UUCQ 2E8GA 5ELNA 3S15H 1N32Q 1VQAA 1I50H 1N34Q 3ULLA 1JJGA 4A3KH 4Y52H 4AQYL 3EIVA 1A0IA 4P71A 4R4IA 3CP0A 3Q8DA 1WJJA 3PO3H 1HR0Q 3GTLH 3W5OA 3I2ZA 3PCOB 2BA1A 4JCVE 3B6YA 4XTCS 2BH2A 1PV4A 4RG1A 4GOPA 3SGIA 4HJ5A 4O2DA 5C0XI 4GNXB 1VQ4A 3S17H 2UUAL 3TRZA 4MZ9A 1HNWQ 4JOIA 4BY1H 4ME3A 3I55A 2MO1A 4NB3A 2PI2E 1HZBA 4A3MG 3BJUA 4XIGS 5GAHC 1Y14B 3AFPA 4O0AA 4TQUS 3GTPH 1KAWA 1VQGA 1HR0W 4QGUA 3HOVG 3BU2A 2JE6I 1PH5A 1X3EA 4LFBL 3UDIA 1J6QA 3WWVA 4OO1I 3CC4A 2JA8H 4R4CA 1Z9FA 4JV5L 4A3GG 3RN2A 3U58A 2VZAA 5C4XH 1Q81C 1MJEA 2CWPA 2B29A 1RL2A 1SE8A 3F2CA 1VQCA 2ZTEA 3A5ZB 1Y1WH 4R4TA 1P16A 1Q1EA 3K80C 3A5UA 4A3CH 3LGJA 2AKWB 1L1OC 4DV0Q 2MNAA 3K7UC 4R4QA 4YWLA 5IYDH 1YHBA 3CPFA 3AFQA 3RNUA 2RF4A 2ATWA 4JI5Q 1X9NA 4EX5A 1XMQL 2B3GA 4DR3L 1DGSA 4DV7L 3PUYA 4KI0A 2R92H 1HNZQ 4KLKA 3PF5A 1XNQL 1GO3E 1XPRA 2R93H 5IE8A 2K14A 2R7FA 3CPWA 2PQAA 1QZGA 2VQEL 3KJPA 4DV1Q 3M7NA 1E22A 1YNXA 4P73A 4UP9A 4GN5A 2VQEQ 2K5NA 4LFAQ 2VQFL 1TWGH 1X55A 4YHHQ 4IJHA 2NVQH 1WI5A 4YWMA 1KQSA 4NPSA 1LUZA 2VS1A 3EN2A 5JEAJ 3FHWA 3CCJA 1NJIC 4OX9Q 1QVFA 2NN6G 4JI8L 1EQQA 1JJ2A 2JA7H 3FKIG 1EYGA 1Q8KA 4NXML 2KENA 1YITA 1E24A 3E9IA 3S24A 2UXBL 2Z6KC 2OTJA 1N36Q 4BA2I 2JA6H 3STBD 1VCIA 3F2BA 1C7YA 4DR4Q 5M5YH 4JI0L 1NTGA 2HHHL 4A76A 2PNHA 3NBHB 1J5EQ 1HZ9A 3JAMc 3PO2G 1XPUA 1YEZA 2Q2IA 3ERSX 1YJ9A 1CKMA 5IWAQ 3ULPA 1AE3A 4GS3A 5JJLA 2F4VL 3U4ZA 4C3JH 5BR8L 4AH6A 2I5MX 1KIXA 1PFSA 3RZOH 1Y1VH 3PSIA 1VS0A 4DAYB 3T1YQ 1X65A 1VQLA 1Q46A 2OWOA 2R7ZH 1SROA 3I4NG 3RLNA 4LF9L 1SMXA 1H95A 4POGA 1G6PA 3H3VH 2Z6KA 4DV5L 3F2DA 4DUZQ 1YIJA 3GTMH 3KF6A 4DR7Q 1K9MC 4GKKL 2CWAA 5M3MH 3DLLA 2A8VA 3S2DH 1YHQA 4Y7NH 1FJGQ 2JEAI 1K0RA 1WYDA 3KOJA 3GD7A 5EAYA 1X56A 2K4KA 1KD1C 2EXDA 1L0WA 4JBKA 2UXDQ 4DKAC 4A3JG 2LXJA 1G51A 4HIDA 4DR6Q 1Z47A 4DNIA 4BBRG 5LMNL 1N8RC 2E5LQ 1UEBA 5GAEC 3T1HL 4WJ4A 2ALYB 3CD6A 3GTGH 1VQJA 5AJ3Q 1K73C 1K8AC 1HNXQ 3CCEA 3M3YH 2N78A 1IBKL 4DUYQ 3HOWH 1X54A 1IBLQ 4AQYQ 2GN5A 1S72A 2EIFA 4A3KG 1BBWA 1EWIA 5DLQE 2IT1A 3J7ZC 3L2PA 3PO3G 3GDEA 4BY7G 3STBC 3NEMA 4A3DH 2A1AA 1IBML 1KRSA 3J81c 1QVCA 3UDXA 4HJ7A 4GN4B 4GN3B 1ASYA 4PZ7A 1VQ8A 1VQ6A 4B3ML 1X3GA 1LYLA 2Q2TA 1TWAH 1V1QA 5IP7H 4BY1G 4X64L 4APVA 4DV2Q 1VQBA 4LF4Q 4DV4L 1U0LA 4OWTB 3KDFB 1Q82C 4X65L 2YU9H 4LF6Q 2JQOA 2UUBL 2JA5H 4C3HH 2WFWA 1YVCA 2IX1A 5J3BA 4DR5L 2E2HH 4LFBQ 2LXKA 4GLXA 1YJNA 4JI7L 3TS2A 1GVPA 4DR2Q 2E2IH 2KHJA 2K52A 1N33L 5C4XG 2IHEA 3J80c 2YTVA 1EFWA 2DGYA 1V43A 4QL5A 2BH8A 3CW2C 4JBJA 1VQMA 2K5VA 1VQKA 4JI2L 1E7ZA 4DV6Q 1YI2A 1JB7A 4K0KL 2HQLA 1PH6A 4IPDA 4A3CG 2CFMA 3G6EA 3CCMA 4X6AH 5FLXc 2ZM6Q 1GD7A 5IYDG 1OTCA 1A8VA 4JI3Q 1IL2A 1IZ6A 4DPGA 4DV7Q 2B63H 1NMGA 2NZHA 4X62L 2R92G 4IOAA 1CKNA 2AWOA 2IY5B 3S14H 4A93H 3NELA 4X66L 3RN5A 1PH9A 1M90C 5GADC 3NENA 4B3RL 4LFCQ 3S16H 2Q2HA 1ASZA 1K8GA 2WB1E 3JC66 4GOPB 4HJ8A 1EIFA 4A3FH 1KHIA 1A62A 4KHPQ 4JI8Q 1MIUA 1Q1BA 4LF7L 1C0AA 3EBEA 1WFQA 1D8LA 4BA1I 2CQOA 4JI6L 2QEXA 3OTOL 3GO5A 4PZ6A 1V9PA 2JA6G 2N3SA 2UUCL 2D0PA 2NVYH 4POFA 4A3LH 1N32L 1PH3A 1IXRA 2UU9Q 4JI4Q 3CXCA 4JI1Q 1W3SA 4IPGA 5ELOA 1HR0L 4JC0A 1FGUA 2N8NA 2UXCQ 2NN6I 1SFOH 4YCVA 4OO1G 2F4VQ 2WB1G 1N9WA 3W1BA 3W1GA 5BR8Q 3UDFA 4HJ9A 4A3EH 5IYBH 2WAQE 2XGTA 4OWXB 3G48A 3J81j 2Y0SE 2EQSA 4YY3Q 4A3IH 2R7ZG 1I6HH 1XPOA 4L5RC 1S40A 4IO9A 3S1QH 1NBWA 1B7YB 1L1OA 1OXXK 1NY4A 1XTDA 3CMEA 3K7AH 3L7ZC 2PQAB 3M4QA 2VUMH 2CKZB 1FL0A 1VQ5A 5M3MG 3HFZB 4DR1L 4B3SQ 4DV3Q 4PG3A 3RLOA 3VDYA 1QZHA 5M5WH 1W2BA 4IJLA 1XMOQ 4JYAL 2R6GA 4IOCA 1WCMH 4MNOA 3CQZH 2K75A 2JK8A 5C3EH 3CCQA 1PH4A 2WAQG 3CCVA 2C35B 3TS0A 3M4OH 4DV0L 4IFDI 3UE1A 4JI5L 1MJCA 2ES2A 4YCWA 1UWVA 3K81C 2I5HA 4DK3C 4HIMA 4GLVB 4BXXH 2PI2A 3S2HH 5LMUL 1VQIA 2HIVA 4DV1L 3L0OA 3HOUH 3U4VA 3GTKH 5IT9c 4NXNQ 3A0JA 4LUZA 4A3DG 4B3TL 4OWWB 3PGZA 1G291 4OX9L 2I0QA 3HKZE 3PF4A 3G71A 4LF5Q 4OXPA 2ZJQA 4LF8Q 4KHZA 1T9HA 3BZCA 5IP7G 1K83H 3CCSA 2AWNA 3ICEA 1VQ9A 2R7DA 1CSQA 3I4MH 4DR4L 4X65Q 3IRBA 4R1JA 1B70B 1QUQB 2R93G 3KF6B 2PMZE 2JA5G 1UE7A 3RR5A 2OCEA 1AE2A 2LSSA 1K3RA 4A4IA 2AMCB 4JI7Q 1VQDA 1U5KA 4A75A 5IWAL 3PIPA 3KYHC 1PHJA 4GNXC 3H0GH 2NVTH 4PMWA 3S1MH 3HOZH 4K0KQ 2D62A 3CCRA 1Q86C 3UDGA 2UUAQ 3HKZG 2VW9A 1FVIA 1I94L 2NVXH 2OTLA 2YTYA 1AH9A 4J15A 4UP8A 4QQBX 3TQYA 1YBYA 2VNUD 2H5XA 1PH7A 2D0OA 3MXNB 2KHIA 4ALPA 1GKHA 2B63G 1OXTA 5GROA 4DUZL 3PUVA 2YTXA 4DR7L 1HZAA 1EUJA 1VQFA 1OXVA 2ASBA 1IYJB 4JV5Q 4A93G 4GOPC 3TREA 2JA8G 5FLMH 1FJGL 3KJOA 4GKJL 4LWCA 5M5XH 2IHFA 1OXUA 2ZJRA 5FJ8H 1SN8A 4OONA 4MTNA 1Y1WG 4GNXA 4LF7Q 4WJ3M 1YZ6A 4YWKA 2E5LL 3OTOQ 5JEAG 2K5HA 5IP9H 1UE5A 5AJ3L 4DR3Q 1XMQQ 1HNXL 4BBSH 2MFIA 4IFDG 4P74A 1KRTA 4A3LG 4DUYL 4AYBE 1XNQQ 3F8TA 1IBLL 1RIPA 4P75A 2JA9A 3PUXA 3HOXH 3E9HA 3GTJH 1LM0A
chains in the Genus database with same CATH superfamily
1M4VA 2Z1CA 5IY0A 1EY8A 5IYCH 1BVSA 1I3QH 5KNDA 1PXUA 5J39A 4QIWE 5IYBG 1JT8A 4C3IH 3OOCA 3QR8A 2PPBC 4A3IG 2O5IC 3CC7A 1F2MA 5GQOA 2HHHQ 4H7BA 2EJFC 3QIAA 2PMZB 4A93B 2FMMA 5LHY1 2K50A 4H44C 4QY7A 3F1ZA 5HY6A 1PVOA 1PTOH 4KV6A 1WCMG 1Y1VG 3GTOH 2L1BA 1HNWL 2OXPA 2F0EA 1PYBA 5C4JH 2KCTA 3E3XA 1STAA 2QA4A 4LF9Q 3HOVH 5LL6X 3I4LA 2I5LX 1M8AA 3NUCA 1JWUD 2AUJD 2F0TA 1QNKA 5FO7B 4AIMA 4EGVA 4GKKQ 1G6ZA 4A3GH 1TWFH 1ILQA 4P2CB 2K5WA 3E5SA 1EIYB 1TWHH 1AZQA 3A7AB 1RJTA 2A19A 1AP0A 1Q12A 2QDBA 5A2QL 4DAYA 2DNEA 2KCCA 2MJ8A 4F8MA 4DF7A 1SLJA 2QW7A 4MIUA 5C4HA 3PIOA 4TKOB 3D0FA 3TP6A 2LS01 3VYRA 3GQBA 4K2KA 5I9PA 1ENAA 3I4OA 3FP9A 2UXCL 4U673 5C0XJ 3AYHB 1TVXA 1IBMQ 3EA6A 1LACA 5M5WB 2K5DA 5EKIA 3HOZG 1E1TA 2K1BA 3FKIH 3M9BA 3J7A5 4B3MQ 2RHQB 2YYZA 4X64Q 3J80i 4DV4Q 3CKIB 5GAGC 1PH1A 2UUBQ 4DR5Q 1EY0A 4WFN3 2AUKA 2BE5D 2ZTCA 3S1NH 4DV3L 1WOCA 2L0CA 1SBBB 3QOLA 5KYIA 1UAPA 4UPAA 5FJ8G 3I56A 1XJVA 4LW1A 2WIIB 1QE6A 4RGNA 3D4RA 3GV3A 1I5FA 4FF1A 4A3FG 4B3RQ 2EY5A 2ZXOA 4K8IA 3J80E 1VDZA 4LNQA 5K36G 3C1FA 1CSPA 2BOSA 4G7OC 2F3VA 3WOFA 3CAMA 5M3FG 4ZKBB 2GVAA 3AQQA 5H1SE 1EU3A 3MTSA 1XNRQ 1SR3A 5ELNA 2SNMA 1DXMA 1N34Q 3EIVA 1WJJA 3PO3H 1HR0Q 3GTLH 2BA1A 4XTCS 1WTQA 1LTID 1FD7D 4O2DA 4GNXB 3S17H 2NYZD 2UUAL 4IZ8A 2Z4IA 3I55A 3ZYYX 1X3QA 3AFPA 4O0AA 3GTPH 1HR0W 1ML0D 1C48A 1PH5A 4LFBL 3D4DA 4OO1I 1Z9FA 3A8IE 4OIJA 5I2YA 3N6RA 3RN2A 1PFMA 5C4XH 1Q81C 1SE8A 2ZTEA 1Y1WH 2CVRA 4R4TA 1P16A 4DV0Q 2MNAA 3HOYB 2H1EA 4A3BB 4YIJA 1A2UA 1XMQL 3PUYA 5IE8A 2K14A 2R7FA 1SMYD 3VA5A 4PMCA 3NPPA 2A73B 4LFAQ 4YHHQ 1YNND 1WI5A 4NPSA 3EN2A 5JEAJ 3FHWA 5KNCA 3CCJA 1NR2A 4JI8L 1EQQA 1JJ2A 2JA7H 1KNAA 3URYA 1E24A 3E9IA 1BXTA 1W6KA 2Z6KC 3S24A 1YNJD 2E2JB 3MVVA 2QF7A 4UDUC 5C3XA 2K04A 2HHHL 3NTIA 1TS2A 1J5EQ 1HZ9A 3JAMc 3W3AA 1YEZA 3ERSX 4OO1H 1AE3A 2EJGC 3U4ZA 4KMUC 5BR8L 2I5MX 4CDCC 1PFSA 1VS0A 4DAYB 3T1YQ 3I3CA 1IKMA 5IT9L 1F9PA 3I4NG 2EOTA 2Z9HA 4LF9L 1G6PA 1TQOA 3F2DA 1YIJA 3GTMH 4DR7Q 4GKKL 3L3OC 1O7YA 4Y7NH 1WYDA 1KD1C 3KUPA 5IODA 1AW7A 2B8FA 2LXJA 1A6XA 3MXUA 4DR6Q 1WTOA 1K0SA 3SK4A 4WJ4A 1YNNC 5HGTA 1K73C 3CCEA 3M3YH 3BDOA 4RGMA 3PO2B 4BY7G 1YNJC 3C3LA 1JORA 2A1AA 1IBML 5T1IA 3J81c 1QVCA 3KBXA 4L6TB 5CV8A 1I4RA 2WV6D 1VQ8A 2XRQD 4DAVA 4MHEA 4B3ML 5IP7H 4KK7A 4BY1G 4X64L 1HTLD 1VQBA 4DV4L 1STGA 4LF6Q 4X65L 2UUBL 2AQ1B 2WFWA 1YVCA 4DR5L 3BVMA 1U4RA 3O13A 1CM9A 1YJNA 4RAUC 4JI7L 3TS2A 1GVPA 4DR2Q 1RF2D 2R3ZA 1PRTF 2IHEA 2YTVA 2AQ2B 2K03A 4QL5A 1EOTA 3FDTA 2K5VA 1VQKA 1E7ZA 4DV6Q 2F0GA 5ISRA 1GD7A 1TWAB 1V1OA 2ZM6Q 1IL2A 1HHVA 1R9TB 4CKEA 5JPMC 1NMGA 2NZHA 2YU9B 3TP7A 2R93B 2IY5B 2EYJA 4WORA 4A93H 2EDGA 3KF8A 5GADC 4A3KB 4B3RL 5G3LD 4KTAA 3WDNA 1ASZA 3JC66 2E2IB 2RBMA 4HR7B 1WFQA 1HTPA 2Z6BA 2CQOA 3EROA 2JA6G 1ZEQX 2IWHA 4POFA 4CJ2C 4L8JA 2PZTA 3QWNA 4V190 1JOQA 2B63B 3Q6SA 3I70A 1HXYD 1HR0L 3J7AV 1FGUA 4IURA 2N8NA 1T5XD 2NN6I 1ET9A 2F4VQ 4C3JG 3NQIA 2JYOA 4L5RC 4NKLA 4IO9A 4WRDA 3SDZA 1NBWA 1OXXK 3L7ZC 3MC0B 1MSHA 5J22A 5M3MG 5EGTA 1I4XA 3RD4A 3RLOA 3VDYA 5M5WH 1QJOA 4IJLA 1W2BA 2K7VA 3CU7A 2NVQB 2K75A 3ND8A 2L55A 4ULLA 2C35B 3M4OH 4DV0L 4FF4A 1JWMD 2RDHA 4DNTB 2RKSA 3K81C 2I5HA 4GLVB 4BXXH 2PI2A 5M5YB 3K7AB 2XRSD 1SDFA 3HOUH 1BR9A 1DONA 5IT9c 4A3DG 2NN6H 3HKZE 3PF4A 3G71A 1IYVA 1Y1VB 4LF8Q 3BVZA 3BZCA 4G4KA 1CSQA 4R1JA 2F0SA 1FNUA 1PTOD 1QUQB 2PMZE 1I6VC 4G7HC 1AE2A 5DM73 2AMCB 2XVSA 3S2DB 3PIPA 1PHJA 4HEDA 3H0GH 3NSWA 4PMWA 1D5MC 2D62A 2VB2X 1NSNS 1I94L 4OHJA 1KLUD 2HQEA 1G2TA 2E2DC 2RSNA 1AH9A 3NTHA 4J15A 4S3SA 3K59A 2VNUD 3TN2A 1PH7A 3GTGB 1OXTA 3ERQA 3KLSX 5GROA 2YTXA 4DR7L 1HZAA 1VQFA 1OXVA 1RD9D 3NBIA 3DMUA 2JA8G 3KLSA 5FLMH 3KJOA 4GKJL 1FNWA 1K28A 2TSSA 2F0PA 3A54A 2DJGC 2IHFA 4QB4A 4MTNA 1PYWD 3OHXC 1ZYRD 2F03A 4IALA 3OTOQ 2FJ2A 1GOZA 2NVXB 1EZ8A 3IFTA 2MFIA 4P74A 5J1ZA 5IGDA 4P75A 1ILPA 2Q8TA 4ILWA 2SOBA 1A63A 3M4PA 4JG2A 2VQFQ 1JC7A 4WJWA 3QOJA 1EOVA 3X3NA 1EWCA 4A3EG 3HOYH 4NXMQ 4A3BH 1BO0A 5KRUA 4EQOA 5C0XG 3DEPA 1GM5A 1OXSC 3MEFA 2QILA 3K0XA 1U4MA 4QJFA 4LF6L 2IX0A 1KC8C 3MFGA 1STHA 3KF8B 3H15A 4AYBG 1NE3A 3GP7A 3NXWA 4A3FB 1MI2A 2IW3A 5EQ0A 4DR2L 1WTHA 1EEFD 1LTRD 3BZKA 4LUOA 3CF5A 2A6HD 4DV6L 5C3EG 1I4PA 2HDMA 3Q23A 1GHJA 2I07B 5M3FB 4GLAC 4A3MH 5D65A 2VY3A 2E2JH 4PQXA 2ZM6L 1Z6HA 3MHBA 1K3BC 2XIWA 2RCNA 4QUFA 1JMCA 5LMUQ 1ZYRC 4P72A 2EZVA 2Q2UA 4RWSC 3VR2A 3R2IA 2Z4HA 2NZOA 4F87A 1RTNA 4ZYSA 1F9QA 1QOHA 2K6AA 2RQXA 1NUCA 1VQ7A 2QGQA 1CUKA 1KNEA 1TWCH 2HUGA 2Z0SA 1F2ZA 1QVGA 2Y0SG 3T1HQ 1ESFA 3I4MG 3HP3A 1LTLA 2F1MA 1R4PB 4Q5VA 1HNZL 4Q0FA 1E1OA 1JJCB 3HGBA 4RKBA 1PH8A 1QNUA 5KGUA 1GJXA 2NTTA 3CCUA 3R3OA 4LUVA 3TBIB 3PUZA 1BBUA 2L15A 3EVQA 3NHHA 1YJWA 1N36L 4K5VA 1B2TA 4PZ8A 2JP1A 3VR3A 3S1RH 2A6HC 4HIOA 2NUCA 4J6HA 1AFPA 1U4PA 3PO2H 1SNPA 1IKLA 1Q8IA 1N33Q 4HJAA 1PLFA 4JI2Q 4BWGB 1GUTA 3RLFA 1WTXA 3ZJYC 1M1KC 3GTQB 5FO8B 4FF2A 1OO9B 4KJOA 1JE5A 5IP9G 4BBSG 3KDFA 2FINB 4X66Q 4C2MH 1ET6A 2OQ0A 4RGTA 1ZXTA 1JB3A 3DM3A 2DUDA 4JOIC 1B4OA 3U50C 5IYCG 1GUWA 2O2LD 2UXDL 2ID0A 5FLXE 1B8AA 4H13C 4C3IG 1VQPA 4LF8L 2D9UA 4JI6Q 4HSPA 4ZQ3A 1EEID 3K0YA 3RMHA 1R9TH 3I4NB 4L5TA 4HIKA 1S5BD 2K33A 1TKWB 3S15H 4HN7A 1VQAA 1I50H 3ULLA 5CMDA 5IGBA 4A3KH 4Y52H 4AQYL 1DD2A 3Q8DA 1AN8A 2K32A 3I2ZA 2KCNA 4EQPA 4JCVE 3X3MA 3B6YA 4C56C 2BH2A 2L12A 3FPPA 4RG1A 3SGIA 1B3AA 2LFNA 4HJ5A 1U9RA 1VQ4A 3TRZA 4MZ9A 1HZBA 2HDLA 1Y8OB 3BJUA 1E0BA 5GAHC 4TQUS 3DUZA 3PIP3 1BCPB 1VQGA 3HOVG 1LT5D 2JE6I 4K14A 3UDIA 3WWVA 1E2VA 2CH4W 4R4CA 4A3GG 3HOXB 1HUNA 3E6ZX 4HTHA 2VZAA 4BY7B 2QDLA 3A5ZB 4KHVA 1GUNA 4A3CH 3LGJA 3SHLA 2AKWB 2B39A 4KKSA 4JW0A 5IYDH 1YHBA 3CPFA 3RNUA 2ATWA 2MUYA 5C44B 4DV7L 4KI0A 4KLKA 1GO3E 1X3PA 1EZ6A 1SAPA 3FVQA 5DEHA 3M7NA 5EPKA 3KJPA 4DXFA 1MSGA 1PZID 4UP9A 4GN5A 2VQFL 2NVQH 1KQSA 1LUZA 3RZDB 1NJIC 5CYUA 4OX9Q 3JAML 1SE3A 4J1MA 3FKIG 1EYGA 4NXML 1B9MA 1YITA 3AU7A 2OTJA 2NBFA 1L0YB 1SEBD 1C7YA 4DR4Q 5M5YH 4I7AA 3SXHA 2PZUA 1JCKB 2B2WA 3NBHB 1C8CA 1XPUA 2Q2IA 4UHVA 3FMCA 2X69A 2MHVA 3H94A 3MZ5A 1TWGB 1KIXA 1Y1VH 2EYOA 1DJRD 1HRJA 1CHQD 1HA5A 2B2UA 4FXGC 5D3IB 2A74C 3LWUA 1CTMA 3ONAB 4F88A 2L4NA 4ZKCB 3KBGA 5TSSA 3S2DH 3D4WA 1K0RA 3KOJA 3GD7A 5EAYA 2K4KA 2EXDA 1L0WA 4IUVA 3VR6A 1G51A 4DNIA 1SE4A 3J81L 5GAEC 3T1HL 3GTGH 3CD6A 1VQJA 4N8X1 4ZCKA 2N78A 4KY5A 1X54A 2GN5A 1S72A 2EIFA 1BBWA 5DLQE 3J7ZC 3L2PA 1IYUA 4FVMA 3PO3G 1LTAD 5C6AA 3NEMA 2PNRC 4HJ7A 5CV6A 4GN4B 5AFWA 1ASYA 1ENCA 4N9TA 2B2YC 4IFDI 1LYLA 2Q2TA 4OIKA 1V1QA 3OW7A 2BCOA 4DV2Q 5C5LA 4LF4Q 1BCPC 1VF5C 3KDFB 2JA5H 4C3HH 2F0JA 5ELCA 4NDXA 1EY9A 5EBCA 2QKIC 1BCPF 1N33L 5C4XG 1ONLA 4A3DB 1UUPA 1FYCA 1VQMA 4JI2L 4A3JB 2HQLA 1PH6A 4IPDA 3BZDB 2CFMA 1X32A 5FKAC 4BBRB 1A8VA 1EIHA 2XNAC 4DPGA 1PRTB 4ZLTF 1CKNA 4OL7A 1KDCA 3S14H 4X66L 2E2HB 1DZ1A 3I72A 3S16H 1R4QB 3LX0A 1TS3A 4RFBA 1HQMC 5KNBA 4HJ8A 1EIFA 3NTKA 1KHIA 1TY2A 4KHPQ 1STYA 2R61A 1TT2A 3PQIA 1Q1BA 1D8LA 1JE4A 4DAPA 4JI6L 3BDLA 2F0UA 4IFDH 2B2TA 2F0KA 4A3LH 5KEEA 4JI4Q 4JI1Q 3GV6A 3ND9A 3VYTA 5C4ZA 1W3SA 3P7JA 2JA8B 4OO1G 4LK1C 3W1BA 3W1GA 1S5ED 5DAUA 4X3UA 1V8QA 2MGSA 3G48A 4OWXB 3J81j 1BOSA 4EVOA 1B7YB 1L1OA 1NY4A 1HFGA 1LT6D 1IHZA 2R92B 2VUMH 2CKZB 2K05A 3HFZB 4B3SQ 1PRTD 2R6GA 4IOCA 2OT2A 4RCNA 2C9OA 2JK8A 1TR5A 4A3EB 1BBXC 3BYTB 2F3WA 3HRZC 1CT1D 1CHPD 4HIMA 3R2TA 5JAVA 4AYBB 5I9OA 3U4VA 1TS4A 3SK5A 4NXNQ 2F0DA 3HEJA 3KK7A 1A3TA 2WB1B 4EQNA 4OX9L 2I0QA 5LL6S 3A56A 1Y69U 4OXPA 2ZJQA 5C3EB 1PZKD 5IP7G 3ICEA 2R7ZB 1VQ9A 2R7DA 4DR4L 2A68D 2E74C 3G7LA 1UE7A 2LSSA 1U5KA 3W2DA 1WD0A 3KYHC 4GNXC 4FXDA 3PIO3 4K0KQ 5D3DA 1QG7A 3UDGA 3V2TA 3HKZG 1FVIA 2WAQB 4LJZC 1PRTC 2Y0SB 4UP8A 3TQYA 2H5XA 3I4MB 4O1NA 2M2LA 2RDGA 4A93G 1IYJB 2ZT9C 4RKLA 2ICIA 3TREA 2PCFB 2KVMA 3K5NA 1B3QA 1OXUA 2ZJRA 2F0LA 4LF7Q 4WJ3M 1YZ6A 3QO2A 4BS9A 5I6YA 4DR3Q 4XQNA 1XNQQ 3H09A 1EQVA 1BQQT 3I91A 5JVG3 1D5ZC 3HOXH 2VQEQ 2B2VA 4JBMA 4BY7H 2EY1A 2X6GA 4OEMB 1TS5A 3LWEA 2AQ3B 2A68C 4Z9CB 4ZAIA 4UP7A 3JAMi 2CCZA 2DY8A 3OYYA 5CR3A 3K57A 4NMZA 4CJ1B 4DV2L 3I8ZA 1XYIA 4LF4L 5C44H 4HCEA 2F0QA 4IUNA 1XNRL 1E3PA 1PYSB 1LV9A 4KN4C 1CKNB 3CHBD 4XDXA 4RMFA 1N34L 4BBSB 2KQ3A 1PA6A 1I4GA 1A2TA 4C1NK 1KL9A 1GHKA 4DR1Q 2HD3A 3TZUA 4L5SA 3OIQA 3RZDH 4JYAQ 3CC2A 2OEOA 2JEBI 4DXGA 2Z8LA 3EFXD 2KOLA 4YCUA 3PUWA 3S9WA 5E7NA 4C3IB 3H3VI 1SSOA 4ME5A 3ER0A 1JOKA 2EYFA 2F4IA 1VQNA 2NVYB 4BXXG 2F0VA 3D31A 4CDEC 1CQFA 1S5DD 3HOUG 2MO0A 3U9SA 4B3TQ 3L9AX 1EWHA 5JJIA 1G91A 4E6IA 4KHPL 4IFDJ 1SNDA 1Q7YC 2PW5A 5LMNQ 3J81i 1L1OB 4A3IB 4KKUA 5C4JB 1WTRA 4XYQA 1TXYA 4XQQA 1PH2A 4JBWA 3OWFA 2EPBA 3S1QB 2KCMA 3HOWG 3HOVB 2KA7A 4JI4L 5D14A 2F0WA 1L2FA 2FXQA 4JI1L 3T16A 4NP5A 5FOBB 3AEVA 4LFAL 4K8JA 4KD4A 4YHHL 2PYKA 1TWFB 1RHPA 3H0GG 5LMNW 1WCMB 2EYPA 3CQZB 2ZJPA 1G2SA 3M85A 3IL8A 1KDAA 1V1PA 1P8LA 2GVBA 4R4OA 5IOCA 3S2HB 2ENBA 2F0FA 1XTCD 1J5EL 2HCCA 2KJXA 2BA0A 4B3SL 2PZWA 5JJKA 1HUMA 5FLMG 2JJQA 2YV5A 3GTKB 1D6EC 1JWSD 3K6OA 2LKVA 2LY7A 4X3TA 3LNNA 3T1YL 3TMEA 3FKIB 2VL6A 4O42A 1UE1A 1SNMA 5CV7A 1K83B 1O7LA 2N88A 4G7ZC 1MGSA 1YHAA 2TMPA 3TEHB 4MN3A 1HH2P 1H9SA 3E0EA 1MKHA 1HJPA 1EIGA 3K8AA 4NXNL 3S1NB 2BDNA 1SE2A 4A3JH 4ABNA 2VXWA 3HOZB 3MFYA 2AHOB 4DK6C 4UY8C 3HOYG 1BUVT 1SYFA 1BKBA 4BBRH 4DR6L 3ULJA 3J80L 1JJGA 2N49A 1UNSA 5IGGA 3CMAA 4X3SA 1N32Q 2EY2A 5JOBA 2Q8IB 3CP0A 2RSOA 3W5OA 4OGQC 1E2ZA 4M8AA 2PQEA 4FNFA 4CKCA 4FYDA 5M5XB 5C0XI 5DM63 3CRLC 1HNWQ 2CHBD 2MO1A 4A3MG 2M00A 1MHWC 4FXKC 5CV5A 1Y8PB 5KYLA 2DJFC 3BU2A 3NP8A 3CC4A 2JA8H 1XXGA 1S4ZA 3GTLB 2ZXPA 2B29A 3F2CA 1VQCA 2XWBB 1Q1EA 3K80C 2XN9C 3A5UA 1GUSA 4MTKA 1L1OC 4NW2A 4XYOA 3C46A 4DU9A 3BVGA 2RF4A 1X9NA 4EX5A 4DR3L 1DGSA 4ZUJA 2R92H 1XNQL 2A6ED 2DNCA 1XPRA 3T56B 4KY6A 3CPWA 1QZGA 2PQAA 2VQEL 4DV1Q 1SYEA 1E22A 2K5NA 2KUMA 1X55A 3VYUA 4HSVA 5C4XB 1A3VA 1B9NA 4CDDC 2KENA 1KTKA 3P1HA 5NUCA 1Z7TA 4QF4A 3Q24A 4A76A 1GUGA 3PO2G 1VMCA 5IT9E 1F9SA 1YJ9A 1CKMA 5CV9A 3I73A 4GS3A 5JJLA 2F4VL 3EJIA 4DGZA 1CQVA 1X65A 2CW0D 3M7GA 2R7ZH 3AMUA 1F9RA 1SMXA 2Z6KA 2D5DA 2J4XA 3KF6A 1K9MC 2CWAA 2CH4A 3DLLA 2A8VA 1GUOA 1YHQA 2JEAI 1DOLA 2PO4A 2KEDA 3T53B 1X56A 1PFBA 4HCSA 5IGEA 3VR5A 2A6EC 2F0HA 3UI2A 4DKAC 2NZ1D 2A5HA 1Z47A 2E5LQ 5LMNL 5EBDA 4K6LA 3WOEA 5FK9C 2ALYB 4QUCA 1S5CD 5ELDA 1V1PB 4KJNA 4IUUA 3EQLC 4DUYQ 4U68A 1EY7A 3DWAA 4A3KG 4K2LA 3V96A 2RCFA 2XSCA 2K01A 4QMGA 4PZ7A 1J8IA 4RH6A 2P5ZX 1TWAH 4APVA 4PV1C 3V05A 2JXMB 5BN3A 3Q0AA 4OWTB 4JPBW 5ELEA 1Q82C 2YU9H 2R93H 3I90A 2C5CA 1Q90A 5L37A 3HZXA 5J3BA 3M3YB 4LFBQ 1H9SB 4I65A 2CW0C 2E2IH 1MBYA 3NK9A 3J80c 3Q22A 2DGYA 1PZJD 1V43A 3CW2C 1EFWA 3BDCA 1YI2A 3H91A 4R8NA 4A3CG 3CCMA 3MAQA 4H0LC 1CFMA 5IYDG 4JI3Q 1STEA 3U9OA 2B63H 5E3FA 2RVLA 1PH9A 3RN5A 3TSSA 3NENA 2WKCA 4LFCQ 2M9VA 1F77A 2WB1E 3FEWX 3SE0A 2RA4A 1LTTD 2K5QA 4F7XA 1A62A 4JI8Q 1MIUA 1U4LA 1T5EA 4B08A 3EBEA 2KEEA 3HKZB 2SNSA 3OTOL 1WTVA 3GO5A 4PZ6A 5JEAH 4BY1B 1V9PA 3DWQA 3D6WA 2E75C 3A55A 4UAIA 2NVYH 1N32L 1PH3A 2CQAA 1IXRA 2UU9Q 4CHTB 2V4DA 3CXCA 4K5XA 2L5TA 5E4XA 4YCVA 4R8IA 4IUQA 1N9WA 1CA5A 4GZYC 5BR8Q 4HJ9A 5IYBH 2WAQE 1JR0D 2XGTA 4C1NI 1G8ZD 2Y0SE 4YY3Q 4A3IH 1S40A 3S1QH 3TZDA 1XTDA 4I7ZC 3K7AH 1O7ZA 2PQAB 1A3UA 1DOKA 1BF4A 1FL0A 4HMJA 4TRDA 1QZHA 1BCPD 5A35A 1XMOQ 5ELFA 4CBVA 1WCMH 3NQTA 4MNOA 3CQZH 5E4WC 3F2UA 3CCQA 2WACA 2E76C 1PH4A 1KABA 3TS0A 1D5XC 3AB9A 2JA6B 1QWYA 4YCWA 5I6WA 4DK3C 2O5JC 3S2HH 4PMBA 1O78A 5LMUL 2HIVA 2KECA 4DV1L 3L0OA 1TU2B 2EE1A 3GTKH 1BNZA 4DFAA 4LUZA 4OWWB 3OMGA 3PGZA 1I4QA 1SNCA 4C3JB 4LF5Q 3RZOB 4KHZA 1K83H 3M4YA 4B9WA 3CCSA 1ICFB 3M4OB 1II3A 1W6JA 4X65Q 3IRBA 3A7LA 3J7YW 3KF6B 1STBA 1NR4A 2JA5G 4C3HG 5JVH3 1HFNA 3RR5A 2OCEA 1K3RA 2X6LA 3QG1A 4A4IA 1DYQA 4JI7Q 1VQDA 5M3MB 3K58A 3HS0C 1PDQA 3HOUB 3SR1A 2EXZA 3HOZH 2JN4A 1Q86C 3K5OA 1SYGA 3MWYW 2NVXH 2YTYA 1HCZA 1YBYA 2D0OA 5KIXA 4ALPA 1GKHA 4X3KA 2EY6A 2LMCB 3PUVA 3HOWB 4JV5Q 4L63B 5EJWA 4KN7C 4LWCA 3K5LA 4ZUIA 5M5XH 2F0NA 1SNOA 1ICWA 2Q8RE 5FJ8H 3H0GB 3DXJC 4OONA 1Y1WG 4YWKA 1F2YA 2E5LL 4G57A 4IUTA 2NB0A 1UE5A 4IFDG 1BDOA 1S5FD 1KRTA 4A3LG 4DUYL 3H6MA 2EVBA 1Y8NB 1RIPA 3PUXA 5JPNC 4A3FH 1LM0A 1CZWA 1VQOA 4H02A 4RHSA 1F2LA 5K36H 5M3FH 2JA7G 2BE5C 1O7IA 3CRKC 2UXBQ 1SYDA 3ITPA 1C9OA 3A8KE 4JI0Q 1KDBA 1SXTA 4IUPA 2A69D 3UE0A 1LT3D 4FF3A 3SK8A 2VUMG 5K5PA 4CGYB 1HA6A 4EQ5A 3QJYA 4DN4M 3D3RA 1X6OA 1AZPA 5BN5A 2OF1A 1CI3M 2OWOA 1VQHA 4JI3L 3T13A 4DV5Q 4LFCL 2GA4B 1E2WA 4TVAB 3MA2B 2WP8J 4K6DA 1SFOB 2RHSB 3C2PA 2QCPX 3OW2A 4M1UB 4XT1B 2RDFA 1ENFA 4HMIA 1EY5A 3C1EA 2MQHA 1UE6A 4A3MB 1I6HB 1VQEA 3H3VC 2OQKA 3I7FA 1IBKQ 1X3FA 4ID6A 5CV4A 2UU9L 2G9DA 3A74A 2IX3A 1STNA 1B1ZA 1RODA 3KFUA 1NMFA 3BG3A 3HKSA 2A69C 3GTQH 3KLWA 2EYMA 3VA7A 2F3IA 1TWCB 1I94Q 4QIWB 4YY3L 4IPHA 2HIXA 1K8OA 5HGQA 5F2DA 1QUQA 2HT1A 2IL8A 1KXLA 3G4SA 1KLGD 4GKJQ 2ZTDA 1S3OA 2KBNA 1XMOL 1CK1A 1LTBD 1I4HA 1SMYC 2F0MA 4DAMA 4XQJA 3I4NH 1LT4D 2J0TD 3A8JE 2H4OA 4FDBA 1SRUA 5JJZA 3CCLA 1LTGD 2XTIA 4X62Q 3D6CA 2JSOA 3S1RB 3PV0A 2G5DA 2F52A 4JVZA 3HOXG 3DWPA 1DCZA 1D7QA 4B9XA 4IPCA 3NE5B 2V1CC 2NVTB 4DK1A 3S1MB 3DEOA 1EY4A 2FMCA 3R8BA 4LF5L 1HZCA 3OIPA 1CKOA 3IAYA 1JOOA 1L0XB 1EQRA 1LTSD 5C44G 2UUCQ 2SEBD 4L5QA 2E8GA 1LABA 1VF7A 5EKKA 1NAPA 5FLXL 2BDOA 1A0IA 4P71A 1B44D 4R4IA 5BN4A 3MXPA 3PCOB 4C2MB 1SNQA 1PV4A 4LAAA 5I2XA 1NNXA 4GOPA 1K8MA 4OELB 4JOIA 2G9HD 4ME3A 4BY1H 4NB3A 2PI2E 1H9JA 4XXEA 4XIGS 1Y14B 2DN8A 3MXGA 4KY7A 1KAWA 3TDQA 4QGUA 3S15B 5CBEE 1I50B 1X3EA 1QILA 1J6QA 2WKDA 4JV5L 3GTJB 3U58A 1TY0A 4V0BA 4HAEA 1LLRD 1MJEA 2CWPA 3N52A 1RL2A 1I3QB 2N55A 3OPOA 3K7UC 4R4QA 4YWLA 4DA2A 3G6JB 3RUZA 2B2WC 3AFQA 4JI5Q 2B3GA 1QB5D 2J7ZA 3FPUB 2ZXRA 4FP5D 4R9WA 3JAME 3PF5A 1HNZQ 2I46A 5A2QE 1NCVA 5E1FA 1YNXA 4P73A 2EJMA 1MD2D 1TWGH 4IJHA 4YWMA 2QEJC 1UEAB 1QVFA 2VS1A 4CDFC 1C4QA 2B2UC 2NN6G 1PTOB 1Q8KA 4DK0A 2UXBL 3GTOB 1N36Q 4BA2I 2JA6H 3STBD 1VCIA 3F2BA 4QCLA 4N8FA 4JI0L 1JICA 3PMFA 1NTGA 1TIID 3E0JA 2PNHA 3VR4A 1ESRA 3KLRA 5C3WA 1HPCA 4A3GB 2VB3X 5IWAQ 3ULPA 1WVLA 2NTSA 3OMCA 2B8GA 4C3JH 4LMQD 4AH6A 1TWHB 3RZOH 3PSIA 2O4XA 1VQLA 1Q46A 3TP5A 1SROA 4RGOS 3RLNA 1PFNA 1H95A 4POGA 4K5WA 3H3VH 4DV5L 1DM0B 4KKTA 4DUZQ 1PMRA 5M3MH 1AEXA 5G3LF 1FJGQ 3J81E 4RHRA 3P75A 4JBKA 2UXDQ 4A3JG 1FNVA 1CZGA 1D1KA 1CA6A 4HIDA 4RCOA 1N8RC 4BBRG 5IIFA 1UEBA 5FO9B 1EU4A 1K8AC 5AJ3Q 1HNXQ 1IBKL 3HOWH 2F0OA 3D8GA 1IBLQ 4AQYQ 3BS1A 3MXNA 1EWIA 1H9KA 2K28A 2IT1A 2MP1A 5M9OA 3BYYB 4CKBA 3GDEA 5I4DA 3STBC 4A3DH 1B50A 2XWJB 3DM1A 1KRSA 3UDXA 4GN3B 4ZK9B 4KD3A 1VQ6A 1X3GA 3SK6A 4A3BG 2ICEC 1RCVD 3NWSA 1U0LA 3TP8A 2FHTA 1J9OA 2JQOA 2IX1A 2E2HH 2LXKA 4GLXA 3VYSA 1DOMA 1XWEA 2L11A 2MPMA 2KHJA 2K52A 5CGKA 2BH8A 4DNRB 4JBJA 4ZRZA 4K0KL 1JB7A 4IN3A 2B2TC 3G6EA 4X6AH 4XT3B 5FLXc 5T1GA 1OTCA 1IZ6A 2B2YA 4DV7Q 1WTPA 4X62L 2R92G 4IOAA 2JA5B 2AWOA 1EYCA 4C3HB 4FO2A 3NELA 1M90C 4JK1C 3IFDA 2Q2HA 1K8GA 3PO3B 2F0IA 4GOPB 2HCIA 1PTOC 1FR3A 3J7AF 4IQZA 3OSOA 1A15A 4LF7L 3S17B 1C0AA 4BA1I 3SVMA 2QEXA 2N3SA 4J8QA 2WINB 2UUCL 2D0PA 1PTOF 2IJ0A 1B53A 5C5MA 4TSSA 3GTPB 1EY6A 4IPGA 3MEHA 5ELOA 3S14B 4JC0A 2UXCQ 4PNYA 1SFOH 3S16B 2WB1G 3UDFA 4A3EH 3IKJA 1SYBA 1Y1WB 1SJHD 4ODGA 2EQSA 5C0XH 2R7ZG 1I6HH 1XPOA 1IW7D 1H9RA 3CMEA 2NWGA 5IGFA 5EKLA 3M4QA 5ELBA 1VQ5A 1GXDC 4DR1L 3NBHA 4DV3Q 4PG3A 4JYAL 2D2CC 1D2BA 5C3EH 1SJED 2KHSA 2WAQG 3P20A 3CCVA 2JA7B 3UE1A 3FRPB 1RKNA 4CJ0B 4JI5L 1MJCA 2ES2A 5CC4A 1HQRD 1UWVA 3SEBA 3T51B 1O80A 1VQIA 5HURA 3R93A 1ZKOA 1EQTA 2VUMB 1H9MA 3A0JA 4B3TL 4RA8A 3HG9A 1G291 1KAAA 4N9PA 3DHQA 1T9HA 2AWNA 3I4MH 1D1IA 3NWTA 1B70B 1FGBD 1EYDA 2R93G 2SDFA 1WD1A 3GTMB 1SYCA 4A75A 5IWAL 1IW7C 4Y7NB 2DY7A 1RTOA 2FFKB 5COYA 2NVTH 3S1MH 1EL0A 1VMPA 3CCRA 2UUAQ 5CBAE 2VW9A 1IL8A 3T4AC 3QB3A 1EFID 3K5MA 1JQYD 2OTLA 5IGCA 2EYHA 2IPKD 1EYAA 1QCBD 4QQBX 1Q3LA 1RDPD 2B2VC 3MXNB 2KHIA 2B63G 4DUZL 1EUJA 2ASBA 5DNFA 4GOPC 1FJGL 1SN8A 4GNXA 2PW7A 3OWEB 1LO5D 5JEAG 2K5HA 5IP9H 1XMQQ 2L9HA 5AJ3L 1HNXL 4BBSH 1XX8A 4AYBE 1WTWA 3F8TA 1IBLL 2JA9A 5EPLA 3E9HA 3GTJH 5EPJA 2EYLA 5CORA
chains in the Genus database with same CATH topology
4JBMA 4BY7H 1A63A 3M4PA 1VQOA 4H02A 4JG2A 5IY0A 2VQFQ 5IYCH 1BVSA 1I3QH 4UP7A 3JAMi 1EOVA 2CCZA 4QIWE 5IYBG 4A3EG 3HOYH 1JT8A 3OYYA 5M3FH 4NXMQ 4C3IH 2JA7G 4A3BH 1O7IA 2UXBQ 1C9OA 4DV2L 5C0XG 4A3IG 1GM5A 5C44H 1OXSC 3MEFA 4LF4L 3K0XA 4JI0Q 4QJFA 4LF6L 3CC7A 1E3PA 1XNRL 1PYSB 2IX0A 1CKNB 4RMFA 5GQOA 1KC8C 1N34L 1PA6A 2HHHQ 3KF8B 3H15A 3UE0A 4AYBG 1KL9A 1NE3A 2VUMG 4DR1Q 4DR2L 2K50A 4QY7A 4L5SA 3F1ZA 5HY6A 4EQ5A 3RZDH 4JYAQ 3CC2A 1PVOA 1X6OA 2JEBI 3BZKA 4LUOA 1WCMG 3CF5A 4DV6L 1Y1VG 5C3EG 3GTOH 1HNWL 4YCUA 3PUWA 4GLAC 1PYBA 5E7NA 1VQHA 2KCTA 2VY3A 5C4JH 4A3MH 4JI3L 2ZM6L 2E2JH 3H3VI 2QA4A 4LF9Q 3ER0A 3HOVH 2I5LX 4DV5Q 1VQNA 2RCNA 1JMCA 4AIMA 5LMUQ 4BXXG 4GKKQ 4P72A 2Q2UA 4A3GH 3D31A 4LFCL 2NZOA 3HOUG 1TWFH 2MO0A 4TVAB 2WP8J 4B3TQ 1EIYB 1TWHH 5JJIA 1VQ7A 2RHSB 2QGQA 4IFDJ 2A19A 3OW2A 4KHPL 1Q12A 1CUKA 1TWCH 2Z0SA 1Q7YC 5LMNQ 4A3BG 1QVGA 3J81i 2Y0SG 3T1HQ 1L1OB 2MQHA 1UE6A 1SLJA 3I4MG 1TXYA 1VQEA 3PIOA 1PH2A 1LTLA 4JBWA 2OQKA 3I7FA 3D0FA 1IBKQ 1X3FA 2KCMA 3HOWG 1HNZL 2UU9L 1E1OA 4JI4L 1JJCB 4JI1L 1L2FA 2FXQA 3A74A 3I4OA 3FP9A 3AEVA 1PH8A 4LFAL 2UXCL 3KFUA 4YHHL 3AYHB 5C0XJ 1IBMQ 1NMFA 3H0GG 3CCUA 5LMNW 3HKSA 4LUVA 1E1TA 3PUZA 1BBUA 3HOZG 2L15A 3FKIH 3KLWA 3GTQH 3M9BA 3J7A5 2F3IA 4B3MQ 2ZJPA 2RHQB 1I94Q 2YYZA 4X64Q 3J80i 4YY3L 1YJWA 4DV4Q 1N36L 5GAGC 4IPHA 2HIXA 3M85A 1PH1A 5HGQA 2UUBQ 2GVBA 4PZ8A 1P8LA 3S1RH 4DR5Q 4HIOA 1QUQA 4R4OA 3PO2H 1J5EL 2HT1A 2ZTCA 2BA0A 4B3SL 1KXLA 3G4SA 3S1NH 4GKJQ 4DV3L 5FLMG 2ZTDA 1WOCA 2JJQA 5JJKA 1S3OA 2KBNA 2YV5A 1N33Q 1XMOL 4HJAA 4JI2Q 4UPAA 5FJ8G 3RLFA 3T1YL 3ZJYC 2VL6A 4DAMA 1M1KC 3I4NH 3I56A 1UE1A 1XJVA 4FDBA 4LW1A 1JE5A 1SRUA 5IP9G 1YHAA 4BBSG 3CCLA 3KDFA 2XTIA 4X62Q 3PV0A 4X66Q 1I5FA 2F52A 3TEHB 4C2MH 3HOXG 1HH2P 4A3FG 2OQ0A 4B3RQ 3E0EA 1MKHA 1HJPA 1D7QA 3K8AA 4NXNL 4LNQA 3DM3A 2DUDA 4IPCA 4JOIC 3U50C 5IYCG 5K36G 4A3JH 2V1CC 2UXDL 2ID0A 1CSPA 2AHOB 4DK6C 4UY8C 1B8AA 4LF5L 1HZCA 3CAMA 3HOYG 5M3FG 1BKBA 1CKOA 4BBRH 1VQPA 4LF8L 4DR6L 2GVAA 4JI6Q 3ULJA 1EQRA 3AQQA 5H1SE 1R9TH 4L5TA 5C44G 4HIKA 1XNRQ 1SR3A 2N49A 3CMAA 4L5QA 2UUCQ 2E8GA 5ELNA 3S15H 1N32Q 1VQAA 1I50H 1N34Q 3ULLA 1JJGA 4A3KH 4Y52H 4AQYL 3EIVA 1A0IA 4P71A 4R4IA 3CP0A 3Q8DA 1WJJA 3PO3H 1HR0Q 3GTLH 3W5OA 3I2ZA 3PCOB 2BA1A 4JCVE 3B6YA 4XTCS 2BH2A 1PV4A 4RG1A 4GOPA 3SGIA 4HJ5A 4O2DA 5C0XI 4GNXB 1VQ4A 3S17H 2UUAL 3TRZA 4MZ9A 1HNWQ 4JOIA 4BY1H 4ME3A 3I55A 2MO1A 4NB3A 2PI2E 1HZBA 4A3MG 3BJUA 4XIGS 5GAHC 1Y14B 3AFPA 4O0AA 4TQUS 3GTPH 1KAWA 1VQGA 1HR0W 4QGUA 3HOVG 3BU2A 2JE6I 1PH5A 1X3EA 4LFBL 3UDIA 1J6QA 3WWVA 4OO1I 3CC4A 2JA8H 4R4CA 1Z9FA 4JV5L 4A3GG 3RN2A 3U58A 2VZAA 5C4XH 1Q81C 1MJEA 2CWPA 2B29A 1RL2A 1SE8A 3F2CA 1VQCA 2ZTEA 3A5ZB 1Y1WH 4R4TA 1P16A 1Q1EA 3K80C 3A5UA 4A3CH 3LGJA 2AKWB 1L1OC 4DV0Q 2MNAA 3K7UC 4R4QA 4YWLA 5IYDH 1YHBA 3CPFA 3AFQA 3RNUA 2RF4A 2ATWA 4JI5Q 1X9NA 4EX5A 1XMQL 2B3GA 4DR3L 1DGSA 4DV7L 3PUYA 4KI0A 2R92H 1HNZQ 4KLKA 3PF5A 1XNQL 1GO3E 1XPRA 2R93H 5IE8A 2K14A 2R7FA 3CPWA 2PQAA 1QZGA 2VQEL 3KJPA 4DV1Q 3M7NA 1E22A 1YNXA 4P73A 4UP9A 4GN5A 2VQEQ 2K5NA 4LFAQ 2VQFL 1TWGH 1X55A 4YHHQ 4IJHA 2NVQH 1WI5A 4YWMA 1KQSA 4NPSA 1LUZA 2VS1A 3EN2A 5JEAJ 3FHWA 3CCJA 1NJIC 4OX9Q 1QVFA 2NN6G 4JI8L 1EQQA 1JJ2A 2JA7H 3FKIG 1EYGA 1Q8KA 4NXML 2KENA 1YITA 1E24A 3E9IA 3S24A 2UXBL 2Z6KC 2OTJA 1N36Q 4BA2I 2JA6H 3STBD 1VCIA 3F2BA 1C7YA 4DR4Q 5M5YH 4JI0L 1NTGA 2HHHL 4A76A 2PNHA 3NBHB 1J5EQ 1HZ9A 3JAMc 3PO2G 1XPUA 1YEZA 2Q2IA 3ERSX 1YJ9A 1CKMA 5IWAQ 3ULPA 1AE3A 4GS3A 5JJLA 2F4VL 3U4ZA 4C3JH 5BR8L 4AH6A 2I5MX 1KIXA 1PFSA 3RZOH 1Y1VH 3PSIA 1VS0A 4DAYB 3T1YQ 1X65A 1VQLA 1Q46A 2OWOA 2R7ZH 1SROA 3I4NG 3RLNA 4LF9L 1SMXA 1H95A 4POGA 1G6PA 3H3VH 2Z6KA 4DV5L 3F2DA 4DUZQ 1YIJA 3GTMH 3KF6A 4DR7Q 1K9MC 4GKKL 2CWAA 5M3MH 3DLLA 2A8VA 3S2DH 1YHQA 4Y7NH 1FJGQ 2JEAI 1K0RA 1WYDA 3KOJA 3GD7A 5EAYA 1X56A 2K4KA 1KD1C 2EXDA 1L0WA 4JBKA 2UXDQ 4DKAC 4A3JG 2LXJA 1G51A 4HIDA 4DR6Q 1Z47A 4DNIA 4BBRG 5LMNL 1N8RC 2E5LQ 1UEBA 5GAEC 3T1HL 4WJ4A 2ALYB 3CD6A 3GTGH 1VQJA 5AJ3Q 1K73C 1K8AC 1HNXQ 3CCEA 3M3YH 2N78A 1IBKL 4DUYQ 3HOWH 1X54A 1IBLQ 4AQYQ 2GN5A 1S72A 2EIFA 4A3KG 1BBWA 1EWIA 5DLQE 2IT1A 3J7ZC 3L2PA 3PO3G 3GDEA 4BY7G 3STBC 3NEMA 4A3DH 2A1AA 1IBML 1KRSA 3J81c 1QVCA 3UDXA 4HJ7A 4GN4B 4GN3B 1ASYA 4PZ7A 1VQ8A 1VQ6A 4B3ML 1X3GA 1LYLA 2Q2TA 1TWAH 1V1QA 5IP7H 4BY1G 4X64L 4APVA 4DV2Q 1VQBA 4LF4Q 4DV4L 1U0LA 4OWTB 3KDFB 1Q82C 4X65L 2YU9H 4LF6Q 2JQOA 2UUBL 2JA5H 4C3HH 2WFWA 1YVCA 2IX1A 5J3BA 4DR5L 2E2HH 4LFBQ 2LXKA 4GLXA 1YJNA 4JI7L 3TS2A 1GVPA 4DR2Q 2E2IH 2KHJA 2K52A 1N33L 5C4XG 2IHEA 3J80c 2YTVA 1EFWA 2DGYA 1V43A 4QL5A 2BH8A 3CW2C 4JBJA 1VQMA 2K5VA 1VQKA 4JI2L 1E7ZA 4DV6Q 1YI2A 1JB7A 4K0KL 2HQLA 1PH6A 4IPDA 4A3CG 2CFMA 3G6EA 3CCMA 4X6AH 5FLXc 2ZM6Q 1GD7A 5IYDG 1OTCA 1A8VA 4JI3Q 1IL2A 1IZ6A 4DPGA 4DV7Q 2B63H 1NMGA 2NZHA 4X62L 2R92G 4IOAA 1CKNA 2AWOA 2IY5B 3S14H 4A93H 3NELA 4X66L 3RN5A 1PH9A 1M90C 5GADC 3NENA 4B3RL 4LFCQ 3S16H 2Q2HA 1ASZA 1K8GA 2WB1E 3JC66 4GOPB 4HJ8A 1EIFA 4A3FH 1KHIA 1A62A 4KHPQ 4JI8Q 1MIUA 1Q1BA 4LF7L 1C0AA 3EBEA 1WFQA 1D8LA 4BA1I 2CQOA 4JI6L 2QEXA 3OTOL 3GO5A 4PZ6A 1V9PA 2JA6G 2N3SA 2UUCL 2D0PA 2NVYH 4POFA 4A3LH 1N32L 1PH3A 1IXRA 2UU9Q 4JI4Q 3CXCA 4JI1Q 1W3SA 4IPGA 5ELOA 1HR0L 4JC0A 1FGUA 2N8NA 2UXCQ 2NN6I 1SFOH 4YCVA 4OO1G 2F4VQ 2WB1G 1N9WA 3W1BA 3W1GA 5BR8Q 3UDFA 4HJ9A 4A3EH 5IYBH 2WAQE 2XGTA 4OWXB 3G48A 3J81j 2Y0SE 2EQSA 4YY3Q 4A3IH 2R7ZG 1I6HH 1XPOA 4L5RC 1S40A 4IO9A 3S1QH 1NBWA 1B7YB 1L1OA 1OXXK 1NY4A 1XTDA 3CMEA 3K7AH 3L7ZC 2PQAB 3M4QA 2VUMH 2CKZB 1FL0A 1VQ5A 5M3MG 3HFZB 4DR1L 4B3SQ 4DV3Q 4PG3A 3RLOA 3VDYA 1QZHA 5M5WH 1W2BA 4IJLA 1XMOQ 4JYAL 2R6GA 4IOCA 1WCMH 4MNOA 3CQZH 2K75A 2JK8A 5C3EH 3CCQA 1PH4A 2WAQG 3CCVA 2C35B 3TS0A 3M4OH 4DV0L 4IFDI 3UE1A 4JI5L 1MJCA 2ES2A 4YCWA 1UWVA 3K81C 2I5HA 4DK3C 4HIMA 4GLVB 4BXXH 2PI2A 3S2HH 5LMUL 1VQIA 2HIVA 4DV1L 3L0OA 3HOUH 3U4VA 3GTKH 5IT9c 4NXNQ 3A0JA 4LUZA 4A3DG 4B3TL 4OWWB 3PGZA 1G291 4OX9L 2I0QA 3HKZE 3PF4A 3G71A 4LF5Q 4OXPA 2ZJQA 4LF8Q 4KHZA 1T9HA 3BZCA 5IP7G 1K83H 3CCSA 2AWNA 3ICEA 1VQ9A 2R7DA 1CSQA 3I4MH 4DR4L 4X65Q 3IRBA 4R1JA 1B70B 1QUQB 2R93G 3KF6B 2PMZE 2JA5G 1UE7A 3RR5A 2OCEA 1AE2A 2LSSA 1K3RA 4A4IA 2AMCB 4JI7Q 1VQDA 1U5KA 4A75A 5IWAL 3PIPA 3KYHC 1PHJA 4GNXC 3H0GH 2NVTH 4PMWA 3S1MH 3HOZH 4K0KQ 2D62A 3CCRA 1Q86C 3UDGA 2UUAQ 3HKZG 2VW9A 1FVIA 1I94L 2NVXH 2OTLA 2YTYA 1AH9A 4J15A 4UP8A 4QQBX 3TQYA 1YBYA 2VNUD 2H5XA 1PH7A 2D0OA 3MXNB 2KHIA 4ALPA 1GKHA 2B63G 1OXTA 5GROA 4DUZL 3PUVA 2YTXA 4DR7L 1HZAA 1EUJA 1VQFA 1OXVA 2ASBA 1IYJB 4JV5Q 4A93G 4GOPC 3TREA 2JA8G 5FLMH 1FJGL 3KJOA 4GKJL 4LWCA 5M5XH 2IHFA 1OXUA 2ZJRA 5FJ8H 1SN8A 4OONA 4MTNA 1Y1WG 4GNXA 4LF7Q 4WJ3M 1YZ6A 4YWKA 2E5LL 3OTOQ 5JEAG 2K5HA 5IP9H 1UE5A 5AJ3L 4DR3Q 1XMQQ 1HNXL 4BBSH 2MFIA 4IFDG 4P74A 1KRTA 4A3LG 4DUYL 4AYBE 1XNQQ 3F8TA 1IBLL 1RIPA 4P75A 2JA9A 3PUXA 3HOXH 3E9HA 3GTJH 1LM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBM A;  4BY7 H;  1A63 A;  3M4P A;  1VQO A;  4H02 A;  4JG2 A;  5IY0 A;  2VQF Q;  5IYC H;  1BVS A;  1I3Q H;  4UP7 A;  3JAM i;  1EOV A;  2CCZ A;  4QIW E;  5IYB G;  4A3E G;  3HOY H;  1JT8 A;  3OYY A;  5M3F H;  4NXM Q;  4C3I H;  2JA7 G;  4A3B H;  1O7I A;  2UXB Q;  1C9O A;  4DV2 L;  5C0X G;  4A3I G;  1GM5 A;  5C44 H;  1OXS C;  3MEF A;  4LF4 L;  3K0X A;  4JI0 Q;  4QJF A;  4LF6 L;  3CC7 A;  1E3P A;  1XNR L;  1PYS B;  2IX0 A;  1CKN B;  4RMF A;  5GQO A;  1KC8 C;  1N34 L;  1PA6 A;  2HHH Q;  3KF8 B;  3H15 A;  3UE0 A;  4AYB G;  1KL9 A;  1NE3 A;  2VUM G;  4DR1 Q;  4DR2 L;  2K50 A;  4QY7 A;  4L5S A;  3F1Z A;  5HY6 A;  4EQ5 A;  3RZD H;  4JYA Q;  3CC2 A;  1PVO A;  1X6O A;  2JEB I;  3BZK A;  4LUO A;  1WCM G;  3CF5 A;  4DV6 L;  1Y1V G;  5C3E G;  3GTO H;  1HNW L;  4YCU A;  3PUW A;  4GLA C;  1PYB A;  5E7N A;  1VQH A;  2KCT A;  2VY3 A;  5C4J H;  4A3M H;  4JI3 L;  2ZM6 L;  2E2J H;  3H3V I;  2QA4 A;  4LF9 Q;  3ER0 A;  3HOV H;  2I5L X;  4DV5 Q;  1VQN A;  2RCN A;  1JMC A;  4AIM A;  5LMU Q;  4BXX G;  4GKK Q;  4P72 A;  2Q2U A;  4A3G H;  3D31 A;  4LFC L;  2NZO A;  3HOU G;  1TWF H;  2MO0 A;  4TVA B;  2WP8 J;  4B3T Q;  1EIY B;  1TWH H;  5JJI A;  1VQ7 A;  2RHS B;  2QGQ A;  4IFD J;  2A19 A;  3OW2 A;  4KHP L;  1Q12 A;  1CUK A;  1TWC H;  2Z0S A;  1Q7Y C;  5LMN Q;  4A3B G;  1QVG A;  3J81 i;  2Y0S G;  3T1H Q;  1L1O B;  2MQH A;  1UE6 A;  1SLJ A;  3I4M G;  1TXY A;  1VQE A;  3PIO A;  1PH2 A;  1LTL A;  4JBW A;  2OQK A;  3I7F A;  3D0F A;  1IBK Q;  1X3F A;  2KCM A;  3HOW G;  1HNZ L;  2UU9 L;  1E1O A;  4JI4 L;  1JJC B;  4JI1 L;  1L2F A;  2FXQ A;  3A74 A;  3I4O A;  3FP9 A;  3AEV A;  1PH8 A;  4LFA L;  2UXC L;  3KFU A;  4YHH L;  3AYH B;  5C0X J;  1IBM Q;  1NMF A;  3H0G G;  3CCU A;  5LMN W;  3HKS A;  4LUV A;  1E1T A;  3PUZ A;  1BBU A;  3HOZ G;  2L15 A;  3FKI H;  3KLW A;  3GTQ H;  3M9B A;  3J7A 5;  2F3I A;  4B3M Q;  2ZJP A;  2RHQ B;  1I94 Q;  2YYZ A;  4X64 Q;  3J80 i;  4YY3 L;  1YJW A;  4DV4 Q;  1N36 L;  5GAG C;  4IPH A;  2HIX A;  3M85 A;  1PH1 A;  5HGQ A;  2UUB Q;  2GVB A;  4PZ8 A;  1P8L A;  3S1R H;  4DR5 Q;  4HIO A;  1QUQ A;  4R4O A;  3PO2 H;  1J5E L;  2HT1 A;  2ZTC A;  2BA0 A;  4B3S L;  1KXL A;  3G4S A;  3S1N H;  4GKJ Q;  4DV3 L;  5FLM G;  2ZTD A;  1WOC A;  2JJQ A;  5JJK A;  1S3O A;  2KBN A;  2YV5 A;  1N33 Q;  1XMO L;  4HJA A;  4JI2 Q;  4UPA A;  5FJ8 G;  3RLF A;  3T1Y L;  3ZJY C;  2VL6 A;  4DAM A;  1M1K C;  3I4N H;  3I56 A;  1UE1 A;  1XJV A;  4FDB A;  4LW1 A;  1JE5 A;  1SRU A;  5IP9 G;  1YHA A;  4BBS G;  3CCL A;  3KDF A;  2XTI A;  4X62 Q;  3PV0 A;  4X66 Q;  1I5F A;  2F52 A;  3TEH B;  4C2M H;  3HOX G;  1HH2 P;  4A3F G;  2OQ0 A;  4B3R Q;  3E0E A;  1MKH A;  1HJP A;  1D7Q A;  3K8A A;  4NXN L;  4LNQ A;  3DM3 A;  2DUD A;  4IPC A;  4JOI C;  3U50 C;  5IYC G;  5K36 G;  4A3J H;  2V1C C;  2UXD L;  2ID0 A;  1CSP A;  2AHO B;  4DK6 C;  4UY8 C;  1B8A A;  4LF5 L;  1HZC A;  3CAM A;  3HOY G;  5M3F G;  1BKB A;  1CKO A;  4BBR H;  1VQP A;  4LF8 L;  4DR6 L;  2GVA A;  4JI6 Q;  3ULJ A;  1EQR A;  3AQQ A;  5H1S E;  1R9T H;  4L5T A;  5C44 G;  4HIK A;  1XNR Q;  1SR3 A;  2N49 A;  3CMA A;  4L5Q A;  2UUC Q;  2E8G A;  5ELN A;  3S15 H;  1N32 Q;  1VQA A;  1I50 H;  1N34 Q;  3ULL A;  1JJG A;  4A3K H;  4Y52 H;  4AQY L;  3EIV A;  1A0I A;  4P71 A;  4R4I A;  3CP0 A;  3Q8D A;  1WJJ A;  3PO3 H;  1HR0 Q;  3GTL H;  3W5O A;  3I2Z A;  3PCO B;  2BA1 A;  4JCV E;  3B6Y A;  4XTC S;  2BH2 A;  1PV4 A;  4RG1 A;  4GOP A;  3SGI A;  4HJ5 A;  4O2D A;  5C0X I;  4GNX B;  1VQ4 A;  3S17 H;  2UUA L;  3TRZ A;  4MZ9 A;  1HNW Q;  4JOI A;  4BY1 H;  4ME3 A;  3I55 A;  2MO1 A;  4NB3 A;  2PI2 E;  1HZB A;  4A3M G;  3BJU A;  4XIG S;  5GAH C;  1Y14 B;  3AFP A;  4O0A A;  4TQU S;  3GTP H;  1KAW A;  1VQG A;  1HR0 W;  4QGU A;  3HOV G;  3BU2 A;  2JE6 I;  1PH5 A;  1X3E A;  4LFB L;  3UDI A;  1J6Q A;  3WWV A;  4OO1 I;  3CC4 A;  2JA8 H;  4R4C A;  1Z9F A;  4JV5 L;  4A3G G;  3RN2 A;  3U58 A;  2VZA A;  5C4X H;  1Q81 C;  1MJE A;  2CWP A;  2B29 A;  1RL2 A;  1SE8 A;  3F2C A;  1VQC A;  2ZTE A;  3A5Z B;  1Y1W H;  4R4T A;  1P16 A;  1Q1E A;  3K80 C;  3A5U A;  4A3C H;  3LGJ A;  2AKW B;  1L1O C;  4DV0 Q;  2MNA A;  3K7U C;  4R4Q A;  4YWL A;  5IYD H;  1YHB A;  3CPF A;  3AFQ A;  3RNU A;  2RF4 A;  2ATW A;  4JI5 Q;  1X9N A;  4EX5 A;  1XMQ L;  2B3G A;  4DR3 L;  1DGS A;  4DV7 L;  3PUY A;  4KI0 A;  2R92 H;  1HNZ Q;  4KLK A;  3PF5 A;  1XNQ L;  1GO3 E;  1XPR A;  2R93 H;  5IE8 A;  2K14 A;  2R7F A;  3CPW A;  2PQA A;  1QZG A;  2VQE L;  3KJP A;  4DV1 Q;  3M7N A;  1E22 A;  1YNX A;  4P73 A;  4UP9 A;  4GN5 A;  2VQE Q;  2K5N A;  4LFA Q;  2VQF L;  1TWG H;  1X55 A;  4YHH Q;  4IJH A;  2NVQ H;  1WI5 A;  4YWM A;  1KQS A;  4NPS A;  1LUZ A;  2VS1 A;  3EN2 A;  5JEA J;  3FHW A;  3CCJ A;  1NJI C;  4OX9 Q;  1QVF A;  2NN6 G;  4JI8 L;  1EQQ A;  1JJ2 A;  2JA7 H;  3FKI G;  1EYG A;  1Q8K A;  4NXM L;  2KEN A;  1YIT A;  1E24 A;  3E9I A;  3S24 A;  2UXB L;  2Z6K C;  2OTJ A;  1N36 Q;  4BA2 I;  2JA6 H;  3STB D;  1VCI A;  3F2B A;  1C7Y A;  4DR4 Q;  5M5Y H;  4JI0 L;  1NTG A;  2HHH L;  4A76 A;  2PNH A;  3NBH B;  1J5E Q;  1HZ9 A;  3JAM c;  3PO2 G;  1XPU A;  1YEZ A;  2Q2I A;  3ERS X;  1YJ9 A;  1CKM A;  5IWA Q;  3ULP A;  1AE3 A;  4GS3 A;  5JJL A;  2F4V L;  3U4Z A;  4C3J H;  5BR8 L;  4AH6 A;  2I5M X;  1KIX A;  1PFS A;  3RZO H;  1Y1V H;  3PSI A;  1VS0 A;  4DAY B;  3T1Y Q;  1X65 A;  1VQL A;  1Q46 A;  2OWO A;  2R7Z H;  1SRO A;  3I4N G;  3RLN A;  4LF9 L;  1SMX A;  1H95 A;  4POG A;  1G6P A;  3H3V H;  2Z6K A;  4DV5 L;  3F2D A;  4DUZ Q;  1YIJ A;  3GTM H;  3KF6 A;  4DR7 Q;  1K9M C;  4GKK L;  2CWA A;  5M3M H;  3DLL A;  2A8V A;  3S2D H;  1YHQ A;  4Y7N H;  1FJG Q;  2JEA I;  1K0R A;  1WYD A;  3KOJ A;  3GD7 A;  5EAY A;  1X56 A;  2K4K A;  1KD1 C;  2EXD A;  1L0W A;  4JBK A;  2UXD Q;  4DKA C;  4A3J G;  2LXJ A;  1G51 A;  4HID A;  4DR6 Q;  1Z47 A;  4DNI A;  4BBR G;  5LMN L;  1N8R C;  2E5L Q;  1UEB A;  5GAE C;  3T1H L;  4WJ4 A;  2ALY B;  3CD6 A;  3GTG H;  1VQJ A;  5AJ3 Q;  1K73 C;  1K8A C;  1HNX Q;  3CCE A;  3M3Y H;  2N78 A;  1IBK L;  4DUY Q;  3HOW H;  1X54 A;  1IBL Q;  4AQY Q;  2GN5 A;  1S72 A;  2EIF A;  4A3K G;  1BBW A;  1EWI A;  5DLQ E;  2IT1 A;  3J7Z C;  3L2P A;  3PO3 G;  3GDE A;  4BY7 G;  3STB C;  3NEM A;  4A3D H;  2A1A A;  1IBM L;  1KRS A;  3J81 c;  1QVC A;  3UDX A;  4HJ7 A;  4GN4 B;  4GN3 B;  1ASY A;  4PZ7 A;  1VQ8 A;  1VQ6 A;  4B3M L;  1X3G A;  1LYL A;  2Q2T A;  1TWA H;  1V1Q A;  5IP7 H;  4BY1 G;  4X64 L;  4APV A;  4DV2 Q;  1VQB A;  4LF4 Q;  4DV4 L;  1U0L A;  4OWT B;  3KDF B;  1Q82 C;  4X65 L;  2YU9 H;  4LF6 Q;  2JQO A;  2UUB L;  2JA5 H;  4C3H H;  2WFW A;  1YVC A;  2IX1 A;  5J3B A;  4DR5 L;  2E2H H;  4LFB Q;  2LXK A;  4GLX A;  1YJN A;  4JI7 L;  3TS2 A;  1GVP A;  4DR2 Q;  2E2I H;  2KHJ A;  2K52 A;  1N33 L;  5C4X G;  2IHE A;  3J80 c;  2YTV A;  1EFW A;  2DGY A;  1V43 A;  4QL5 A;  2BH8 A;  3CW2 C;  4JBJ A;  1VQM A;  2K5V A;  1VQK A;  4JI2 L;  1E7Z A;  4DV6 Q;  1YI2 A;  1JB7 A;  4K0K L;  2HQL A;  1PH6 A;  4IPD A;  4A3C G;  2CFM A;  3G6E A;  3CCM A;  4X6A H;  5FLX c;  2ZM6 Q;  1GD7 A;  5IYD G;  1OTC A;  1A8V A;  4JI3 Q;  1IL2 A;  1IZ6 A;  4DPG A;  4DV7 Q;  2B63 H;  1NMG A;  2NZH A;  4X62 L;  2R92 G;  4IOA A;  1CKN A;  2AWO A;  2IY5 B;  3S14 H;  4A93 H;  3NEL A;  4X66 L;  3RN5 A;  1PH9 A;  1M90 C;  5GAD C;  3NEN A;  4B3R L;  4LFC Q;  3S16 H;  2Q2H A;  1ASZ A;  1K8G A;  2WB1 E;  3JC6 6;  4GOP B;  4HJ8 A;  1EIF A;  4A3F H;  1KHI A;  1A62 A;  4KHP Q;  4JI8 Q;  1MIU A;  1Q1B A;  4LF7 L;  1C0A A;  3EBE A;  1WFQ A;  1D8L A;  4BA1 I;  2CQO A;  4JI6 L;  2QEX A;  3OTO L;  3GO5 A;  4PZ6 A;  1V9P A;  2JA6 G;  2N3S A;  2UUC L;  2D0P A;  2NVY H;  4POF A;  4A3L H;  1N32 L;  1PH3 A;  1IXR A;  2UU9 Q;  4JI4 Q;  3CXC A;  4JI1 Q;  1W3S A;  4IPG A;  5ELO A;  1HR0 L;  4JC0 A;  1FGU A;  2N8N A;  2UXC Q;  2NN6 I;  1SFO H;  4YCV A;  4OO1 G;  2F4V Q;  2WB1 G;  1N9W A;  3W1B A;  3W1G A;  5BR8 Q;  3UDF A;  4HJ9 A;  4A3E H;  5IYB H;  2WAQ E;  2XGT A;  4OWX B;  3G48 A;  3J81 j;  2Y0S E;  2EQS A;  4YY3 Q;  4A3I H;  2R7Z G;  1I6H H;  1XPO A;  4L5R C;  1S40 A;  4IO9 A;  3S1Q H;  1NBW A;  1B7Y B;  1L1O A;  1OXX K;  1NY4 A;  1XTD A;  3CME A;  3K7A H;  3L7Z C;  2PQA B;  3M4Q A;  2VUM H;  2CKZ B;  1FL0 A;  1VQ5 A;  5M3M G;  3HFZ B;  4DR1 L;  4B3S Q;  4DV3 Q;  4PG3 A;  3RLO A;  3VDY A;  1QZH A;  5M5W H;  1W2B A;  4IJL A;  1XMO Q;  4JYA L;  2R6G A;  4IOC A;  1WCM H;  4MNO A;  3CQZ H;  2K75 A;  2JK8 A;  5C3E H;  3CCQ A;  1PH4 A;  2WAQ G;  3CCV A;  2C35 B;  3TS0 A;  3M4O H;  4DV0 L;  4IFD I;  3UE1 A;  4JI5 L;  1MJC A;  2ES2 A;  4YCW A;  1UWV A;  3K81 C;  2I5H A;  4DK3 C;  4HIM A;  4GLV B;  4BXX H;  2PI2 A;  3S2H H;  5LMU L;  1VQI A;  2HIV A;  4DV1 L;  3L0O A;  3HOU H;  3U4V A;  3GTK H;  5IT9 c;  4NXN Q;  3A0J A;  4LUZ A;  4A3D G;  4B3T L;  4OWW B;  3PGZ A;  1G29 1;  4OX9 L;  2I0Q A;  3HKZ E;  3PF4 A;  3G71 A;  4LF5 Q;  4OXP A;  2ZJQ A;  4LF8 Q;  4KHZ A;  1T9H A;  3BZC A;  5IP7 G;  1K83 H;  3CCS A;  2AWN A;  3ICE A;  1VQ9 A;  2R7D A;  1CSQ A;  3I4M H;  4DR4 L;  4X65 Q;  3IRB A;  4R1J A;  1B70 B;  1QUQ B;  2R93 G;  3KF6 B;  2PMZ E;  2JA5 G;  1UE7 A;  3RR5 A;  2OCE A;  1AE2 A;  2LSS A;  1K3R A;  4A4I A;  2AMC B;  4JI7 Q;  1VQD A;  1U5K A;  4A75 A;  5IWA L;  3PIP A;  3KYH C;  1PHJ A;  4GNX C;  3H0G H;  2NVT H;  4PMW A;  3S1M H;  3HOZ H;  4K0K Q;  2D62 A;  3CCR A;  1Q86 C;  3UDG A;  2UUA Q;  3HKZ G;  2VW9 A;  1FVI A;  1I94 L;  2NVX H;  2OTL A;  2YTY A;  1AH9 A;  4J15 A;  4UP8 A;  4QQB X;  3TQY A;  1YBY A;  2VNU D;  2H5X A;  1PH7 A;  2D0O A;  3MXN B;  2KHI A;  4ALP A;  1GKH A;  2B63 G;  1OXT A;  5GRO A;  4DUZ L;  3PUV A;  2YTX A;  4DR7 L;  1HZA A;  1EUJ A;  1VQF A;  1OXV A;  2ASB A;  1IYJ B;  4JV5 Q;  4A93 G;  4GOP C;  3TRE A;  2JA8 G;  5FLM H;  1FJG L;  3KJO A;  4GKJ L;  4LWC A;  5M5X H;  2IHF A;  1OXU A;  2ZJR A;  5FJ8 H;  1SN8 A;  4OON A;  4MTN A;  1Y1W G;  4GNX A;  4LF7 Q;  4WJ3 M;  1YZ6 A;  4YWK A;  2E5L L;  3OTO Q;  5JEA G;  2K5H A;  5IP9 H;  1UE5 A;  5AJ3 L;  4DR3 Q;  1XMQ Q;  1HNX L;  4BBS H;  2MFI A;  4IFD G;  4P74 A;  1KRT A;  4A3L G;  4DUY L;  4AYB E;  1XNQ Q;  3F8T A;  1IBL L;  1RIP A;  4P75 A;  2JA9 A;  3PUX A;  3HOX H;  3E9H A;  3GTJ H;  1LM0 A; 
#chains in the Genus database with same CATH topology
 1M4V A;  2Z1C A;  5IY0 A;  1EY8 A;  5IYC H;  1BVS A;  1I3Q H;  5KND A;  1PXU A;  5J39 A;  4QIW E;  5IYB G;  1JT8 A;  4C3I H;  3OOC A;  3QR8 A;  2PPB C;  4A3I G;  2O5I C;  3CC7 A;  1F2M A;  5GQO A;  2HHH Q;  4H7B A;  2EJF C;  3QIA A;  2PMZ B;  4A93 B;  2FMM A;  5LHY 1;  2K50 A;  4H44 C;  4QY7 A;  3F1Z A;  5HY6 A;  1PVO A;  1PTO H;  4KV6 A;  1WCM G;  1Y1V G;  3GTO H;  2L1B A;  1HNW L;  2OXP A;  2F0E A;  1PYB A;  5C4J H;  2KCT A;  3E3X A;  1STA A;  2QA4 A;  4LF9 Q;  3HOV H;  5LL6 X;  3I4L A;  2I5L X;  1M8A A;  3NUC A;  1JWU D;  2AUJ D;  2F0T A;  1QNK A;  5FO7 B;  4AIM A;  4EGV A;  4GKK Q;  1G6Z A;  4A3G H;  1TWF H;  1ILQ A;  4P2C B;  2K5W A;  3E5S A;  1EIY B;  1TWH H;  1AZQ A;  3A7A B;  1RJT A;  2A19 A;  1AP0 A;  1Q12 A;  2QDB A;  5A2Q L;  4DAY A;  2DNE A;  2KCC A;  2MJ8 A;  4F8M A;  4DF7 A;  1SLJ A;  2QW7 A;  4MIU A;  5C4H A;  3PIO A;  4TKO B;  3D0F A;  3TP6 A;  2LS0 1;  3VYR A;  3GQB A;  4K2K A;  5I9P A;  1ENA A;  3I4O A;  3FP9 A;  2UXC L;  4U67 3;  5C0X J;  3AYH B;  1TVX A;  1IBM Q;  3EA6 A;  1LAC A;  5M5W B;  2K5D A;  5EKI A;  3HOZ G;  1E1T A;  2K1B A;  3FKI H;  3M9B A;  3J7A 5;  4B3M Q;  2RHQ B;  2YYZ A;  4X64 Q;  3J80 i;  4DV4 Q;  3CKI B;  5GAG C;  1PH1 A;  2UUB Q;  4DR5 Q;  1EY0 A;  4WFN 3;  2AUK A;  2BE5 D;  2ZTC A;  3S1N H;  4DV3 L;  1WOC A;  2L0C A;  1SBB B;  3QOL A;  5KYI A;  1UAP A;  4UPA A;  5FJ8 G;  3I56 A;  1XJV A;  4LW1 A;  2WII B;  1QE6 A;  4RGN A;  3D4R A;  3GV3 A;  1I5F A;  4FF1 A;  4A3F G;  4B3R Q;  2EY5 A;  2ZXO A;  4K8I A;  3J80 E;  1VDZ A;  4LNQ A;  5K36 G;  3C1F A;  1CSP A;  2BOS A;  4G7O C;  2F3V A;  3WOF A;  3CAM A;  5M3F G;  4ZKB B;  2GVA A;  3AQQ A;  5H1S E;  1EU3 A;  3MTS A;  1XNR Q;  1SR3 A;  5ELN A;  2SNM A;  1DXM A;  1N34 Q;  3EIV A;  1WJJ A;  3PO3 H;  1HR0 Q;  3GTL H;  2BA1 A;  4XTC S;  1WTQ A;  1LTI D;  1FD7 D;  4O2D A;  4GNX B;  3S17 H;  2NYZ D;  2UUA L;  4IZ8 A;  2Z4I A;  3I55 A;  3ZYY X;  1X3Q A;  3AFP A;  4O0A A;  3GTP H;  1HR0 W;  1ML0 D;  1C48 A;  1PH5 A;  4LFB L;  3D4D A;  4OO1 I;  1Z9F A;  3A8I E;  4OIJ A;  5I2Y A;  3N6R A;  3RN2 A;  1PFM A;  5C4X H;  1Q81 C;  1SE8 A;  2ZTE A;  1Y1W H;  2CVR A;  4R4T A;  1P16 A;  4DV0 Q;  2MNA A;  3HOY B;  2H1E A;  4A3B B;  4YIJ A;  1A2U A;  1XMQ L;  3PUY A;  5IE8 A;  2K14 A;  2R7F A;  1SMY D;  3VA5 A;  4PMC A;  3NPP A;  2A73 B;  4LFA Q;  4YHH Q;  1YNN D;  1WI5 A;  4NPS A;  3EN2 A;  5JEA J;  3FHW A;  5KNC A;  3CCJ A;  1NR2 A;  4JI8 L;  1EQQ A;  1JJ2 A;  2JA7 H;  1KNA A;  3URY A;  1E24 A;  3E9I A;  1BXT A;  1W6K A;  2Z6K C;  3S24 A;  1YNJ D;  2E2J B;  3MVV A;  2QF7 A;  4UDU C;  5C3X A;  2K04 A;  2HHH L;  3NTI A;  1TS2 A;  1J5E Q;  1HZ9 A;  3JAM c;  3W3A A;  1YEZ A;  3ERS X;  4OO1 H;  1AE3 A;  2EJG C;  3U4Z A;  4KMU C;  5BR8 L;  2I5M X;  4CDC C;  1PFS A;  1VS0 A;  4DAY B;  3T1Y Q;  3I3C A;  1IKM A;  5IT9 L;  1F9P A;  3I4N G;  2EOT A;  2Z9H A;  4LF9 L;  1G6P A;  1TQO A;  3F2D A;  1YIJ A;  3GTM H;  4DR7 Q;  4GKK L;  3L3O C;  1O7Y A;  4Y7N H;  1WYD A;  1KD1 C;  3KUP A;  5IOD A;  1AW7 A;  2B8F A;  2LXJ A;  1A6X A;  3MXU A;  4DR6 Q;  1WTO A;  1K0S A;  3SK4 A;  4WJ4 A;  1YNN C;  5HGT A;  1K73 C;  3CCE A;  3M3Y H;  3BDO A;  4RGM A;  3PO2 B;  4BY7 G;  1YNJ C;  3C3L A;  1JOR A;  2A1A A;  1IBM L;  5T1I A;  3J81 c;  1QVC A;  3KBX A;  4L6T B;  5CV8 A;  1I4R A;  2WV6 D;  1VQ8 A;  2XRQ D;  4DAV A;  4MHE A;  4B3M L;  5IP7 H;  4KK7 A;  4BY1 G;  4X64 L;  1HTL D;  1VQB A;  4DV4 L;  1STG A;  4LF6 Q;  4X65 L;  2UUB L;  2AQ1 B;  2WFW A;  1YVC A;  4DR5 L;  3BVM A;  1U4R A;  3O13 A;  1CM9 A;  1YJN A;  4RAU C;  4JI7 L;  3TS2 A;  1GVP A;  4DR2 Q;  1RF2 D;  2R3Z A;  1PRT F;  2IHE A;  2YTV A;  2AQ2 B;  2K03 A;  4QL5 A;  1EOT A;  3FDT A;  2K5V A;  1VQK A;  1E7Z A;  4DV6 Q;  2F0G A;  5ISR A;  1GD7 A;  1TWA B;  1V1O A;  2ZM6 Q;  1IL2 A;  1HHV A;  1R9T B;  4CKE A;  5JPM C;  1NMG A;  2NZH A;  2YU9 B;  3TP7 A;  2R93 B;  2IY5 B;  2EYJ A;  4WOR A;  4A93 H;  2EDG A;  3KF8 A;  5GAD C;  4A3K B;  4B3R L;  5G3L D;  4KTA A;  3WDN A;  1ASZ A;  3JC6 6;  2E2I B;  2RBM A;  4HR7 B;  1WFQ A;  1HTP A;  2Z6B A;  2CQO A;  3ERO A;  2JA6 G;  1ZEQ X;  2IWH A;  4POF A;  4CJ2 C;  4L8J A;  2PZT A;  3QWN A;  4V19 0;  1JOQ A;  2B63 B;  3Q6S A;  3I70 A;  1HXY D;  1HR0 L;  3J7A V;  1FGU A;  4IUR A;  2N8N A;  1T5X D;  2NN6 I;  1ET9 A;  2F4V Q;  4C3J G;  3NQI A;  2JYO A;  4L5R C;  4NKL A;  4IO9 A;  4WRD A;  3SDZ A;  1NBW A;  1OXX K;  3L7Z C;  3MC0 B;  1MSH A;  5J22 A;  5M3M G;  5EGT A;  1I4X A;  3RD4 A;  3RLO A;  3VDY A;  5M5W H;  1QJO A;  4IJL A;  1W2B A;  2K7V A;  3CU7 A;  2NVQ B;  2K75 A;  3ND8 A;  2L55 A;  4ULL A;  2C35 B;  3M4O H;  4DV0 L;  4FF4 A;  1JWM D;  2RDH A;  4DNT B;  2RKS A;  3K81 C;  2I5H A;  4GLV B;  4BXX H;  2PI2 A;  5M5Y B;  3K7A B;  2XRS D;  1SDF A;  3HOU H;  1BR9 A;  1DON A;  5IT9 c;  4A3D G;  2NN6 H;  3HKZ E;  3PF4 A;  3G71 A;  1IYV A;  1Y1V B;  4LF8 Q;  3BVZ A;  3BZC A;  4G4K A;  1CSQ A;  4R1J A;  2F0S A;  1FNU A;  1PTO D;  1QUQ B;  2PMZ E;  1I6V C;  4G7H C;  1AE2 A;  5DM7 3;  2AMC B;  2XVS A;  3S2D B;  3PIP A;  1PHJ A;  4HED A;  3H0G H;  3NSW A;  4PMW A;  1D5M C;  2D62 A;  2VB2 X;  1NSN S;  1I94 L;  4OHJ A;  1KLU D;  2HQE A;  1G2T A;  2E2D C;  2RSN A;  1AH9 A;  3NTH A;  4J15 A;  4S3S A;  3K59 A;  2VNU D;  3TN2 A;  1PH7 A;  3GTG B;  1OXT A;  3ERQ A;  3KLS X;  5GRO A;  2YTX A;  4DR7 L;  1HZA A;  1VQF A;  1OXV A;  1RD9 D;  3NBI A;  3DMU A;  2JA8 G;  3KLS A;  5FLM H;  3KJO A;  4GKJ L;  1FNW A;  1K28 A;  2TSS A;  2F0P A;  3A54 A;  2DJG C;  2IHF A;  4QB4 A;  4MTN A;  1PYW D;  3OHX C;  1ZYR D;  2F03 A;  4IAL A;  3OTO Q;  2FJ2 A;  1GOZ A;  2NVX B;  1EZ8 A;  3IFT A;  2MFI A;  4P74 A;  5J1Z A;  5IGD A;  4P75 A;  1ILP A;  2Q8T A;  4ILW A;  2SOB A;  1A63 A;  3M4P A;  4JG2 A;  2VQF Q;  1JC7 A;  4WJW A;  3QOJ A;  1EOV A;  3X3N A;  1EWC A;  4A3E G;  3HOY H;  4NXM Q;  4A3B H;  1BO0 A;  5KRU A;  4EQO A;  5C0X G;  3DEP A;  1GM5 A;  1OXS C;  3MEF A;  2QIL A;  3K0X A;  1U4M A;  4QJF A;  4LF6 L;  2IX0 A;  1KC8 C;  3MFG A;  1STH A;  3KF8 B;  3H15 A;  4AYB G;  1NE3 A;  3GP7 A;  3NXW A;  4A3F B;  1MI2 A;  2IW3 A;  5EQ0 A;  4DR2 L;  1WTH A;  1EEF D;  1LTR D;  3BZK A;  4LUO A;  3CF5 A;  2A6H D;  4DV6 L;  5C3E G;  1I4P A;  2HDM A;  3Q23 A;  1GHJ A;  2I07 B;  5M3F B;  4GLA C;  4A3M H;  5D65 A;  2VY3 A;  2E2J H;  4PQX A;  2ZM6 L;  1Z6H A;  3MHB A;  1K3B C;  2XIW A;  2RCN A;  4QUF A;  1JMC A;  5LMU Q;  1ZYR C;  4P72 A;  2EZV A;  2Q2U A;  4RWS C;  3VR2 A;  3R2I A;  2Z4H A;  2NZO A;  4F87 A;  1RTN A;  4ZYS A;  1F9Q A;  1QOH A;  2K6A A;  2RQX A;  1NUC A;  1VQ7 A;  2QGQ A;  1CUK A;  1KNE A;  1TWC H;  2HUG A;  2Z0S A;  1F2Z A;  1QVG A;  2Y0S G;  3T1H Q;  1ESF A;  3I4M G;  3HP3 A;  1LTL A;  2F1M A;  1R4P B;  4Q5V A;  1HNZ L;  4Q0F A;  1E1O A;  1JJC B;  3HGB A;  4RKB A;  1PH8 A;  1QNU A;  5KGU A;  1GJX A;  2NTT A;  3CCU A;  3R3O A;  4LUV A;  3TBI B;  3PUZ A;  1BBU A;  2L15 A;  3EVQ A;  3NHH A;  1YJW A;  1N36 L;  4K5V A;  1B2T A;  4PZ8 A;  2JP1 A;  3VR3 A;  3S1R H;  2A6H C;  4HIO A;  2NUC A;  4J6H A;  1AFP A;  1U4P A;  3PO2 H;  1SNP A;  1IKL A;  1Q8I A;  1N33 Q;  4HJA A;  1PLF A;  4JI2 Q;  4BWG B;  1GUT A;  3RLF A;  1WTX A;  3ZJY C;  1M1K C;  3GTQ B;  5FO8 B;  4FF2 A;  1OO9 B;  4KJO A;  1JE5 A;  5IP9 G;  4BBS G;  3KDF A;  2FIN B;  4X66 Q;  4C2M H;  1ET6 A;  2OQ0 A;  4RGT A;  1ZXT A;  1JB3 A;  3DM3 A;  2DUD A;  4JOI C;  1B4O A;  3U50 C;  5IYC G;  1GUW A;  2O2L D;  2UXD L;  2ID0 A;  5FLX E;  1B8A A;  4H13 C;  4C3I G;  1VQP A;  4LF8 L;  2D9U A;  4JI6 Q;  4HSP A;  4ZQ3 A;  1EEI D;  3K0Y A;  3RMH A;  1R9T H;  3I4N B;  4L5T A;  4HIK A;  1S5B D;  2K33 A;  1TKW B;  3S15 H;  4HN7 A;  1VQA A;  1I50 H;  3ULL A;  5CMD A;  5IGB A;  4A3K H;  4Y52 H;  4AQY L;  1DD2 A;  3Q8D A;  1AN8 A;  2K32 A;  3I2Z A;  2KCN A;  4EQP A;  4JCV E;  3X3M A;  3B6Y A;  4C56 C;  2BH2 A;  2L12 A;  3FPP A;  4RG1 A;  3SGI A;  1B3A A;  2LFN A;  4HJ5 A;  1U9R A;  1VQ4 A;  3TRZ A;  4MZ9 A;  1HZB A;  2HDL A;  1Y8O B;  3BJU A;  1E0B A;  5GAH C;  4TQU S;  3DUZ A;  3PIP 3;  1BCP B;  1VQG A;  3HOV G;  1LT5 D;  2JE6 I;  4K14 A;  3UDI A;  3WWV A;  1E2V A;  2CH4 W;  4R4C A;  4A3G G;  3HOX B;  1HUN A;  3E6Z X;  4HTH A;  2VZA A;  4BY7 B;  2QDL A;  3A5Z B;  4KHV A;  1GUN A;  4A3C H;  3LGJ A;  3SHL A;  2AKW B;  2B39 A;  4KKS A;  4JW0 A;  5IYD H;  1YHB A;  3CPF A;  3RNU A;  2ATW A;  2MUY A;  5C44 B;  4DV7 L;  4KI0 A;  4KLK A;  1GO3 E;  1X3P A;  1EZ6 A;  1SAP A;  3FVQ A;  5DEH A;  3M7N A;  5EPK A;  3KJP A;  4DXF A;  1MSG A;  1PZI D;  4UP9 A;  4GN5 A;  2VQF L;  2NVQ H;  1KQS A;  1LUZ A;  3RZD B;  1NJI C;  5CYU A;  4OX9 Q;  3JAM L;  1SE3 A;  4J1M A;  3FKI G;  1EYG A;  4NXM L;  1B9M A;  1YIT A;  3AU7 A;  2OTJ A;  2NBF A;  1L0Y B;  1SEB D;  1C7Y A;  4DR4 Q;  5M5Y H;  4I7A A;  3SXH A;  2PZU A;  1JCK B;  2B2W A;  3NBH B;  1C8C A;  1XPU A;  2Q2I A;  4UHV A;  3FMC A;  2X69 A;  2MHV A;  3H94 A;  3MZ5 A;  1TWG B;  1KIX A;  1Y1V H;  2EYO A;  1DJR D;  1HRJ A;  1CHQ D;  1HA5 A;  2B2U A;  4FXG C;  5D3I B;  2A74 C;  3LWU A;  1CTM A;  3ONA B;  4F88 A;  2L4N A;  4ZKC B;  3KBG A;  5TSS A;  3S2D H;  3D4W A;  1K0R A;  3KOJ A;  3GD7 A;  5EAY A;  2K4K A;  2EXD A;  1L0W A;  4IUV A;  3VR6 A;  1G51 A;  4DNI A;  1SE4 A;  3J81 L;  5GAE C;  3T1H L;  3GTG H;  3CD6 A;  1VQJ A;  4N8X 1;  4ZCK A;  2N78 A;  4KY5 A;  1X54 A;  2GN5 A;  1S72 A;  2EIF A;  1BBW A;  5DLQ E;  3J7Z C;  3L2P A;  1IYU A;  4FVM A;  3PO3 G;  1LTA D;  5C6A A;  3NEM A;  2PNR C;  4HJ7 A;  5CV6 A;  4GN4 B;  5AFW A;  1ASY A;  1ENC A;  4N9T A;  2B2Y C;  4IFD I;  1LYL A;  2Q2T A;  4OIK A;  1V1Q A;  3OW7 A;  2BCO A;  4DV2 Q;  5C5L A;  4LF4 Q;  1BCP C;  1VF5 C;  3KDF B;  2JA5 H;  4C3H H;  2F0J A;  5ELC A;  4NDX A;  1EY9 A;  5EBC A;  2QKI C;  1BCP F;  1N33 L;  5C4X G;  1ONL A;  4A3D B;  1UUP A;  1FYC A;  1VQM A;  4JI2 L;  4A3J B;  2HQL A;  1PH6 A;  4IPD A;  3BZD B;  2CFM A;  1X32 A;  5FKA C;  4BBR B;  1A8V A;  1EIH A;  2XNA C;  4DPG A;  1PRT B;  4ZLT F;  1CKN A;  4OL7 A;  1KDC A;  3S14 H;  4X66 L;  2E2H B;  1DZ1 A;  3I72 A;  3S16 H;  1R4Q B;  3LX0 A;  1TS3 A;  4RFB A;  1HQM C;  5KNB A;  4HJ8 A;  1EIF A;  3NTK A;  1KHI A;  1TY2 A;  4KHP Q;  1STY A;  2R61 A;  1TT2 A;  3PQI A;  1Q1B A;  1D8L A;  1JE4 A;  4DAP A;  4JI6 L;  3BDL A;  2F0U A;  4IFD H;  2B2T A;  2F0K A;  4A3L H;  5KEE A;  4JI4 Q;  4JI1 Q;  3GV6 A;  3ND9 A;  3VYT A;  5C4Z A;  1W3S A;  3P7J A;  2JA8 B;  4OO1 G;  4LK1 C;  3W1B A;  3W1G A;  1S5E D;  5DAU A;  4X3U A;  1V8Q A;  2MGS A;  3G48 A;  4OWX B;  3J81 j;  1BOS A;  4EVO A;  1B7Y B;  1L1O A;  1NY4 A;  1HFG A;  1LT6 D;  1IHZ A;  2R92 B;  2VUM H;  2CKZ B;  2K05 A;  3HFZ B;  4B3S Q;  1PRT D;  2R6G A;  4IOC A;  2OT2 A;  4RCN A;  2C9O A;  2JK8 A;  1TR5 A;  4A3E B;  1BBX C;  3BYT B;  2F3W A;  3HRZ C;  1CT1 D;  1CHP D;  4HIM A;  3R2T A;  5JAV A;  4AYB B;  5I9O A;  3U4V A;  1TS4 A;  3SK5 A;  4NXN Q;  2F0D A;  3HEJ A;  3KK7 A;  1A3T A;  2WB1 B;  4EQN A;  4OX9 L;  2I0Q A;  5LL6 S;  3A56 A;  1Y69 U;  4OXP A;  2ZJQ A;  5C3E B;  1PZK D;  5IP7 G;  3ICE A;  2R7Z B;  1VQ9 A;  2R7D A;  4DR4 L;  2A68 D;  2E74 C;  3G7L A;  1UE7 A;  2LSS A;  1U5K A;  3W2D A;  1WD0 A;  3KYH C;  4GNX C;  4FXD A;  3PIO 3;  4K0K Q;  5D3D A;  1QG7 A;  3UDG A;  3V2T A;  3HKZ G;  1FVI A;  2WAQ B;  4LJZ C;  1PRT C;  2Y0S B;  4UP8 A;  3TQY A;  2H5X A;  3I4M B;  4O1N A;  2M2L A;  2RDG A;  4A93 G;  1IYJ B;  2ZT9 C;  4RKL A;  2ICI A;  3TRE A;  2PCF B;  2KVM A;  3K5N A;  1B3Q A;  1OXU A;  2ZJR A;  2F0L A;  4LF7 Q;  4WJ3 M;  1YZ6 A;  3QO2 A;  4BS9 A;  5I6Y A;  4DR3 Q;  4XQN A;  1XNQ Q;  3H09 A;  1EQV A;  1BQQ T;  3I91 A;  5JVG 3;  1D5Z C;  3HOX H;  2VQE Q;  2B2V A;  4JBM A;  4BY7 H;  2EY1 A;  2X6G A;  4OEM B;  1TS5 A;  3LWE A;  2AQ3 B;  2A68 C;  4Z9C B;  4ZAI A;  4UP7 A;  3JAM i;  2CCZ A;  2DY8 A;  3OYY A;  5CR3 A;  3K57 A;  4NMZ A;  4CJ1 B;  4DV2 L;  3I8Z A;  1XYI A;  4LF4 L;  5C44 H;  4HCE A;  2F0Q A;  4IUN A;  1XNR L;  1E3P A;  1PYS B;  1LV9 A;  4KN4 C;  1CKN B;  3CHB D;  4XDX A;  4RMF A;  1N34 L;  4BBS B;  2KQ3 A;  1PA6 A;  1I4G A;  1A2T A;  4C1N K;  1KL9 A;  1GHK A;  4DR1 Q;  2HD3 A;  3TZU A;  4L5S A;  3OIQ A;  3RZD H;  4JYA Q;  3CC2 A;  2OEO A;  2JEB I;  4DXG A;  2Z8L A;  3EFX D;  2KOL A;  4YCU A;  3PUW A;  3S9W A;  5E7N A;  4C3I B;  3H3V I;  1SSO A;  4ME5 A;  3ER0 A;  1JOK A;  2EYF A;  2F4I A;  1VQN A;  2NVY B;  4BXX G;  2F0V A;  3D31 A;  4CDE C;  1CQF A;  1S5D D;  3HOU G;  2MO0 A;  3U9S A;  4B3T Q;  3L9A X;  1EWH A;  5JJI A;  1G91 A;  4E6I A;  4KHP L;  4IFD J;  1SND A;  1Q7Y C;  2PW5 A;  5LMN Q;  3J81 i;  1L1O B;  4A3I B;  4KKU A;  5C4J B;  1WTR A;  4XYQ A;  1TXY A;  4XQQ A;  1PH2 A;  4JBW A;  3OWF A;  2EPB A;  3S1Q B;  2KCM A;  3HOW G;  3HOV B;  2KA7 A;  4JI4 L;  5D14 A;  2F0W A;  1L2F A;  2FXQ A;  4JI1 L;  3T16 A;  4NP5 A;  5FOB B;  3AEV A;  4LFA L;  4K8J A;  4KD4 A;  4YHH L;  2PYK A;  1TWF B;  1RHP A;  3H0G G;  5LMN W;  1WCM B;  2EYP A;  3CQZ B;  2ZJP A;  1G2S A;  3M85 A;  3IL8 A;  1KDA A;  1V1P A;  1P8L A;  2GVB A;  4R4O A;  5IOC A;  3S2H B;  2ENB A;  2F0F A;  1XTC D;  1J5E L;  2HCC A;  2KJX A;  2BA0 A;  4B3S L;  2PZW A;  5JJK A;  1HUM A;  5FLM G;  2JJQ A;  2YV5 A;  3GTK B;  1D6E C;  1JWS D;  3K6O A;  2LKV A;  2LY7 A;  4X3T A;  3LNN A;  3T1Y L;  3TME A;  3FKI B;  2VL6 A;  4O42 A;  1UE1 A;  1SNM A;  5CV7 A;  1K83 B;  1O7L A;  2N88 A;  4G7Z C;  1MGS A;  1YHA A;  2TMP A;  3TEH B;  4MN3 A;  1HH2 P;  1H9S A;  3E0E A;  1MKH A;  1HJP A;  1EIG A;  3K8A A;  4NXN L;  3S1N B;  2BDN A;  1SE2 A;  4A3J H;  4ABN A;  2VXW A;  3HOZ B;  3MFY A;  2AHO B;  4DK6 C;  4UY8 C;  3HOY G;  1BUV T;  1SYF A;  1BKB A;  4BBR H;  4DR6 L;  3ULJ A;  3J80 L;  1JJG A;  2N49 A;  1UNS A;  5IGG A;  3CMA A;  4X3S A;  1N32 Q;  2EY2 A;  5JOB A;  2Q8I B;  3CP0 A;  2RSO A;  3W5O A;  4OGQ C;  1E2Z A;  4M8A A;  2PQE A;  4FNF A;  4CKC A;  4FYD A;  5M5X B;  5C0X I;  5DM6 3;  3CRL C;  1HNW Q;  2CHB D;  2MO1 A;  4A3M G;  2M00 A;  1MHW C;  4FXK C;  5CV5 A;  1Y8P B;  5KYL A;  2DJF C;  3BU2 A;  3NP8 A;  3CC4 A;  2JA8 H;  1XXG A;  1S4Z A;  3GTL B;  2ZXP A;  2B29 A;  3F2C A;  1VQC A;  2XWB B;  1Q1E A;  3K80 C;  2XN9 C;  3A5U A;  1GUS A;  4MTK A;  1L1O C;  4NW2 A;  4XYO A;  3C46 A;  4DU9 A;  3BVG A;  2RF4 A;  1X9N A;  4EX5 A;  4DR3 L;  1DGS A;  4ZUJ A;  2R92 H;  1XNQ L;  2A6E D;  2DNC A;  1XPR A;  3T56 B;  4KY6 A;  3CPW A;  1QZG A;  2PQA A;  2VQE L;  4DV1 Q;  1SYE A;  1E22 A;  2K5N A;  2KUM A;  1X55 A;  3VYU A;  4HSV A;  5C4X B;  1A3V A;  1B9N A;  4CDD C;  2KEN A;  1KTK A;  3P1H A;  5NUC A;  1Z7T A;  4QF4 A;  3Q24 A;  4A76 A;  1GUG A;  3PO2 G;  1VMC A;  5IT9 E;  1F9S A;  1YJ9 A;  1CKM A;  5CV9 A;  3I73 A;  4GS3 A;  5JJL A;  2F4V L;  3EJI A;  4DGZ A;  1CQV A;  1X65 A;  2CW0 D;  3M7G A;  2R7Z H;  3AMU A;  1F9R A;  1SMX A;  2Z6K A;  2D5D A;  2J4X A;  3KF6 A;  1K9M C;  2CWA A;  2CH4 A;  3DLL A;  2A8V A;  1GUO A;  1YHQ A;  2JEA I;  1DOL A;  2PO4 A;  2KED A;  3T53 B;  1X56 A;  1PFB A;  4HCS A;  5IGE A;  3VR5 A;  2A6E C;  2F0H A;  3UI2 A;  4DKA C;  2NZ1 D;  2A5H A;  1Z47 A;  2E5L Q;  5LMN L;  5EBD A;  4K6L A;  3WOE A;  5FK9 C;  2ALY B;  4QUC A;  1S5C D;  5ELD A;  1V1P B;  4KJN A;  4IUU A;  3EQL C;  4DUY Q;  4U68 A;  1EY7 A;  3DWA A;  4A3K G;  4K2L A;  3V96 A;  2RCF A;  2XSC A;  2K01 A;  4QMG A;  4PZ7 A;  1J8I A;  4RH6 A;  2P5Z X;  1TWA H;  4APV A;  4PV1 C;  3V05 A;  2JXM B;  5BN3 A;  3Q0A A;  4OWT B;  4JPB W;  5ELE A;  1Q82 C;  2YU9 H;  2R93 H;  3I90 A;  2C5C A;  1Q90 A;  5L37 A;  3HZX A;  5J3B A;  3M3Y B;  4LFB Q;  1H9S B;  4I65 A;  2CW0 C;  2E2I H;  1MBY A;  3NK9 A;  3J80 c;  3Q22 A;  2DGY A;  1PZJ D;  1V43 A;  3CW2 C;  1EFW A;  3BDC A;  1YI2 A;  3H91 A;  4R8N A;  4A3C G;  3CCM A;  3MAQ A;  4H0L C;  1CFM A;  5IYD G;  4JI3 Q;  1STE A;  3U9O A;  2B63 H;  5E3F A;  2RVL A;  1PH9 A;  3RN5 A;  3TSS A;  3NEN A;  2WKC A;  4LFC Q;  2M9V A;  1F77 A;  2WB1 E;  3FEW X;  3SE0 A;  2RA4 A;  1LTT D;  2K5Q A;  4F7X A;  1A62 A;  4JI8 Q;  1MIU A;  1U4L A;  1T5E A;  4B08 A;  3EBE A;  2KEE A;  3HKZ B;  2SNS A;  3OTO L;  1WTV A;  3GO5 A;  4PZ6 A;  5JEA H;  4BY1 B;  1V9P A;  3DWQ A;  3D6W A;  2E75 C;  3A55 A;  4UAI A;  2NVY H;  1N32 L;  1PH3 A;  2CQA A;  1IXR A;  2UU9 Q;  4CHT B;  2V4D A;  3CXC A;  4K5X A;  2L5T A;  5E4X A;  4YCV A;  4R8I A;  4IUQ A;  1N9W A;  1CA5 A;  4GZY C;  5BR8 Q;  4HJ9 A;  5IYB H;  2WAQ E;  1JR0 D;  2XGT A;  4C1N I;  1G8Z D;  2Y0S E;  4YY3 Q;  4A3I H;  1S40 A;  3S1Q H;  3TZD A;  1XTD A;  4I7Z C;  3K7A H;  1O7Z A;  2PQA B;  1A3U A;  1DOK A;  1BF4 A;  1FL0 A;  4HMJ A;  4TRD A;  1QZH A;  1BCP D;  5A35 A;  1XMO Q;  5ELF A;  4CBV A;  1WCM H;  3NQT A;  4MNO A;  3CQZ H;  5E4W C;  3F2U A;  3CCQ A;  2WAC A;  2E76 C;  1PH4 A;  1KAB A;  3TS0 A;  1D5X C;  3AB9 A;  2JA6 B;  1QWY A;  4YCW A;  5I6W A;  4DK3 C;  2O5J C;  3S2H H;  4PMB A;  1O78 A;  5LMU L;  2HIV A;  2KEC A;  4DV1 L;  3L0O A;  1TU2 B;  2EE1 A;  3GTK H;  1BNZ A;  4DFA A;  4LUZ A;  4OWW B;  3OMG A;  3PGZ A;  1I4Q A;  1SNC A;  4C3J B;  4LF5 Q;  3RZO B;  4KHZ A;  1K83 H;  3M4Y A;  4B9W A;  3CCS A;  1ICF B;  3M4O B;  1II3 A;  1W6J A;  4X65 Q;  3IRB A;  3A7L A;  3J7Y W;  3KF6 B;  1STB A;  1NR4 A;  2JA5 G;  4C3H G;  5JVH 3;  1HFN A;  3RR5 A;  2OCE A;  1K3R A;  2X6L A;  3QG1 A;  4A4I A;  1DYQ A;  4JI7 Q;  1VQD A;  5M3M B;  3K58 A;  3HS0 C;  1PDQ A;  3HOU B;  3SR1 A;  2EXZ A;  3HOZ H;  2JN4 A;  1Q86 C;  3K5O A;  1SYG A;  3MWY W;  2NVX H;  2YTY A;  1HCZ A;  1YBY A;  2D0O A;  5KIX A;  4ALP A;  1GKH A;  4X3K A;  2EY6 A;  2LMC B;  3PUV A;  3HOW B;  4JV5 Q;  4L63 B;  5EJW A;  4KN7 C;  4LWC A;  3K5L A;  4ZUI A;  5M5X H;  2F0N A;  1SNO A;  1ICW A;  2Q8R E;  5FJ8 H;  3H0G B;  3DXJ C;  4OON A;  1Y1W G;  4YWK A;  1F2Y A;  2E5L L;  4G57 A;  4IUT A;  2NB0 A;  1UE5 A;  4IFD G;  1BDO A;  1S5F D;  1KRT A;  4A3L G;  4DUY L;  3H6M A;  2EVB A;  1Y8N B;  1RIP A;  3PUX A;  5JPN C;  4A3F H;  1LM0 A;  1CZW A;  1VQO A;  4H02 A;  4RHS A;  1F2L A;  5K36 H;  5M3F H;  2JA7 G;  2BE5 C;  1O7I A;  3CRK C;  2UXB Q;  1SYD A;  3ITP A;  1C9O A;  3A8K E;  4JI0 Q;  1KDB A;  1SXT A;  4IUP A;  2A69 D;  3UE0 A;  1LT3 D;  4FF3 A;  3SK8 A;  2VUM G;  5K5P A;  4CGY B;  1HA6 A;  4EQ5 A;  3QJY A;  4DN4 M;  3D3R A;  1X6O A;  1AZP A;  5BN5 A;  2OF1 A;  1CI3 M;  2OWO A;  1VQH A;  4JI3 L;  3T13 A;  4DV5 Q;  4LFC L;  2GA4 B;  1E2W A;  4TVA B;  3MA2 B;  2WP8 J;  4K6D A;  1SFO B;  2RHS B;  3C2P A;  2QCP X;  3OW2 A;  4M1U B;  4XT1 B;  2RDF A;  1ENF A;  4HMI A;  1EY5 A;  3C1E A;  2MQH A;  1UE6 A;  4A3M B;  1I6H B;  1VQE A;  3H3V C;  2OQK A;  3I7F A;  1IBK Q;  1X3F A;  4ID6 A;  5CV4 A;  2UU9 L;  2G9D A;  3A74 A;  2IX3 A;  1STN A;  1B1Z A;  1ROD A;  3KFU A;  1NMF A;  3BG3 A;  3HKS A;  2A69 C;  3GTQ H;  3KLW A;  2EYM A;  3VA7 A;  2F3I A;  1TWC B;  1I94 Q;  4QIW B;  4YY3 L;  4IPH A;  2HIX A;  1K8O A;  5HGQ A;  5F2D A;  1QUQ A;  2HT1 A;  2IL8 A;  1KXL A;  3G4S A;  1KLG D;  4GKJ Q;  2ZTD A;  1S3O A;  2KBN A;  1XMO L;  1CK1 A;  1LTB D;  1I4H A;  1SMY C;  2F0M A;  4DAM A;  4XQJ A;  3I4N H;  1LT4 D;  2J0T D;  3A8J E;  2H4O A;  4FDB A;  1SRU A;  5JJZ A;  3CCL A;  1LTG D;  2XTI A;  4X62 Q;  3D6C A;  2JSO A;  3S1R B;  3PV0 A;  2G5D A;  2F52 A;  4JVZ A;  3HOX G;  3DWP A;  1DCZ A;  1D7Q A;  4B9X A;  4IPC A;  3NE5 B;  2V1C C;  2NVT B;  4DK1 A;  3S1M B;  3DEO A;  1EY4 A;  2FMC A;  3R8B A;  4LF5 L;  1HZC A;  3OIP A;  1CKO A;  3IAY A;  1JOO A;  1L0X B;  1EQR A;  1LTS D;  5C44 G;  2UUC Q;  2SEB D;  4L5Q A;  2E8G A;  1LAB A;  1VF7 A;  5EKK A;  1NAP A;  5FLX L;  2BDO A;  1A0I A;  4P71 A;  1B44 D;  4R4I A;  5BN4 A;  3MXP A;  3PCO B;  4C2M B;  1SNQ A;  1PV4 A;  4LAA A;  5I2X A;  1NNX A;  4GOP A;  1K8M A;  4OEL B;  4JOI A;  2G9H D;  4ME3 A;  4BY1 H;  4NB3 A;  2PI2 E;  1H9J A;  4XXE A;  4XIG S;  1Y14 B;  2DN8 A;  3MXG A;  4KY7 A;  1KAW A;  3TDQ A;  4QGU A;  3S15 B;  5CBE E;  1I50 B;  1X3E A;  1QIL A;  1J6Q A;  2WKD A;  4JV5 L;  3GTJ B;  3U58 A;  1TY0 A;  4V0B A;  4HAE A;  1LLR D;  1MJE A;  2CWP A;  3N52 A;  1RL2 A;  1I3Q B;  2N55 A;  3OPO A;  3K7U C;  4R4Q A;  4YWL A;  4DA2 A;  3G6J B;  3RUZ A;  2B2W C;  3AFQ A;  4JI5 Q;  2B3G A;  1QB5 D;  2J7Z A;  3FPU B;  2ZXR A;  4FP5 D;  4R9W A;  3JAM E;  3PF5 A;  1HNZ Q;  2I46 A;  5A2Q E;  1NCV A;  5E1F A;  1YNX A;  4P73 A;  2EJM A;  1MD2 D;  1TWG H;  4IJH A;  4YWM A;  2QEJ C;  1UEA B;  1QVF A;  2VS1 A;  4CDF C;  1C4Q A;  2B2U C;  2NN6 G;  1PTO B;  1Q8K A;  4DK0 A;  2UXB L;  3GTO B;  1N36 Q;  4BA2 I;  2JA6 H;  3STB D;  1VCI A;  3F2B A;  4QCL A;  4N8F A;  4JI0 L;  1JIC A;  3PMF A;  1NTG A;  1TII D;  3E0J A;  2PNH A;  3VR4 A;  1ESR A;  3KLR A;  5C3W A;  1HPC A;  4A3G B;  2VB3 X;  5IWA Q;  3ULP A;  1WVL A;  2NTS A;  3OMC A;  2B8G A;  4C3J H;  4LMQ D;  4AH6 A;  1TWH B;  3RZO H;  3PSI A;  2O4X A;  1VQL A;  1Q46 A;  3TP5 A;  1SRO A;  4RGO S;  3RLN A;  1PFN A;  1H95 A;  4POG A;  4K5W A;  3H3V H;  4DV5 L;  1DM0 B;  4KKT A;  4DUZ Q;  1PMR A;  5M3M H;  1AEX A;  5G3L F;  1FJG Q;  3J81 E;  4RHR A;  3P75 A;  4JBK A;  2UXD Q;  4A3J G;  1FNV A;  1CZG A;  1D1K A;  1CA6 A;  4HID A;  4RCO A;  1N8R C;  4BBR G;  5IIF A;  1UEB A;  5FO9 B;  1EU4 A;  1K8A C;  5AJ3 Q;  1HNX Q;  1IBK L;  3HOW H;  2F0O A;  3D8G A;  1IBL Q;  4AQY Q;  3BS1 A;  3MXN A;  1EWI A;  1H9K A;  2K28 A;  2IT1 A;  2MP1 A;  5M9O A;  3BYY B;  4CKB A;  3GDE A;  5I4D A;  3STB C;  4A3D H;  1B50 A;  2XWJ B;  3DM1 A;  1KRS A;  3UDX A;  4GN3 B;  4ZK9 B;  4KD3 A;  1VQ6 A;  1X3G A;  3SK6 A;  4A3B G;  2ICE C;  1RCV D;  3NWS A;  1U0L A;  3TP8 A;  2FHT A;  1J9O A;  2JQO A;  2IX1 A;  2E2H H;  2LXK A;  4GLX A;  3VYS A;  1DOM A;  1XWE A;  2L11 A;  2MPM A;  2KHJ A;  2K52 A;  5CGK A;  2BH8 A;  4DNR B;  4JBJ A;  4ZRZ A;  4K0K L;  1JB7 A;  4IN3 A;  2B2T C;  3G6E A;  4X6A H;  4XT3 B;  5FLX c;  5T1G A;  1OTC A;  1IZ6 A;  2B2Y A;  4DV7 Q;  1WTP A;  4X62 L;  2R92 G;  4IOA A;  2JA5 B;  2AWO A;  1EYC A;  4C3H B;  4FO2 A;  3NEL A;  1M90 C;  4JK1 C;  3IFD A;  2Q2H A;  1K8G A;  3PO3 B;  2F0I A;  4GOP B;  2HCI A;  1PTO C;  1FR3 A;  3J7A F;  4IQZ A;  3OSO A;  1A15 A;  4LF7 L;  3S17 B;  1C0A A;  4BA1 I;  3SVM A;  2QEX A;  2N3S A;  4J8Q A;  2WIN B;  2UUC L;  2D0P A;  1PTO F;  2IJ0 A;  1B53 A;  5C5M A;  4TSS A;  3GTP B;  1EY6 A;  4IPG A;  3MEH A;  5ELO A;  3S14 B;  4JC0 A;  2UXC Q;  4PNY A;  1SFO H;  3S16 B;  2WB1 G;  3UDF A;  4A3E H;  3IKJ A;  1SYB A;  1Y1W B;  1SJH D;  4ODG A;  2EQS A;  5C0X H;  2R7Z G;  1I6H H;  1XPO A;  1IW7 D;  1H9R A;  3CME A;  2NWG A;  5IGF A;  5EKL A;  3M4Q A;  5ELB A;  1VQ5 A;  1GXD C;  4DR1 L;  3NBH A;  4DV3 Q;  4PG3 A;  4JYA L;  2D2C C;  1D2B A;  5C3E H;  1SJE D;  2KHS A;  2WAQ G;  3P20 A;  3CCV A;  2JA7 B;  3UE1 A;  3FRP B;  1RKN A;  4CJ0 B;  4JI5 L;  1MJC A;  2ES2 A;  5CC4 A;  1HQR D;  1UWV A;  3SEB A;  3T51 B;  1O80 A;  1VQI A;  5HUR A;  3R93 A;  1ZKO A;  1EQT A;  2VUM B;  1H9M A;  3A0J A;  4B3T L;  4RA8 A;  3HG9 A;  1G29 1;  1KAA A;  4N9P A;  3DHQ A;  1T9H A;  2AWN A;  3I4M H;  1D1I A;  3NWT A;  1B70 B;  1FGB D;  1EYD A;  2R93 G;  2SDF A;  1WD1 A;  3GTM B;  1SYC A;  4A75 A;  5IWA L;  1IW7 C;  4Y7N B;  2DY7 A;  1RTO A;  2FFK B;  5COY A;  2NVT H;  3S1M H;  1EL0 A;  1VMP A;  3CCR A;  2UUA Q;  5CBA E;  2VW9 A;  1IL8 A;  3T4A C;  3QB3 A;  1EFI D;  3K5M A;  1JQY D;  2OTL A;  5IGC A;  2EYH A;  2IPK D;  1EYA A;  1QCB D;  4QQB X;  1Q3L A;  1RDP D;  2B2V C;  3MXN B;  2KHI A;  2B63 G;  4DUZ L;  1EUJ A;  2ASB A;  5DNF A;  4GOP C;  1FJG L;  1SN8 A;  4GNX A;  2PW7 A;  3OWE B;  1LO5 D;  5JEA G;  2K5H A;  5IP9 H;  1XMQ Q;  2L9H A;  5AJ3 L;  1HNX L;  4BBS H;  1XX8 A;  4AYB E;  1WTW A;  3F8T A;  1IBL L;  2JA9 A;  5EPL A;  3E9H A;  3GTJ H;  5EPJ A;  2EYL A;  5COR A; 
#chains in the Genus database with same CATH homology
 4JBM A;  4BY7 H;  1A63 A;  3M4P A;  1VQO A;  4H02 A;  4JG2 A;  5IY0 A;  2VQF Q;  5IYC H;  1BVS A;  1I3Q H;  4UP7 A;  3JAM i;  1EOV A;  2CCZ A;  4QIW E;  5IYB G;  4A3E G;  3HOY H;  1JT8 A;  3OYY A;  5M3F H;  4NXM Q;  4C3I H;  2JA7 G;  4A3B H;  1O7I A;  2UXB Q;  1C9O A;  4DV2 L;  5C0X G;  4A3I G;  1GM5 A;  5C44 H;  1OXS C;  3MEF A;  4LF4 L;  3K0X A;  4JI0 Q;  4QJF A;  4LF6 L;  3CC7 A;  1E3P A;  1XNR L;  1PYS B;  2IX0 A;  1CKN B;  4RMF A;  5GQO A;  1KC8 C;  1N34 L;  1PA6 A;  2HHH Q;  3KF8 B;  3H15 A;  3UE0 A;  4AYB G;  1KL9 A;  1NE3 A;  2VUM G;  4DR1 Q;  4DR2 L;  2K50 A;  4QY7 A;  4L5S A;  3F1Z A;  5HY6 A;  4EQ5 A;  3RZD H;  4JYA Q;  3CC2 A;  1PVO A;  1X6O A;  2JEB I;  3BZK A;  4LUO A;  1WCM G;  3CF5 A;  4DV6 L;  1Y1V G;  5C3E G;  3GTO H;  1HNW L;  4YCU A;  3PUW A;  4GLA C;  1PYB A;  5E7N A;  1VQH A;  2KCT A;  2VY3 A;  5C4J H;  4A3M H;  4JI3 L;  2ZM6 L;  2E2J H;  3H3V I;  2QA4 A;  4LF9 Q;  3ER0 A;  3HOV H;  2I5L X;  4DV5 Q;  1VQN A;  2RCN A;  1JMC A;  4AIM A;  5LMU Q;  4BXX G;  4GKK Q;  4P72 A;  2Q2U A;  4A3G H;  3D31 A;  4LFC L;  2NZO A;  3HOU G;  1TWF H;  2MO0 A;  4TVA B;  2WP8 J;  4B3T Q;  1EIY B;  1TWH H;  5JJI A;  1VQ7 A;  2RHS B;  2QGQ A;  4IFD J;  2A19 A;  3OW2 A;  4KHP L;  1Q12 A;  1CUK A;  1TWC H;  2Z0S A;  1Q7Y C;  5LMN Q;  4A3B G;  1QVG A;  3J81 i;  2Y0S G;  3T1H Q;  1L1O B;  2MQH A;  1UE6 A;  1SLJ A;  3I4M G;  1TXY A;  1VQE A;  3PIO A;  1PH2 A;  1LTL A;  4JBW A;  2OQK A;  3I7F A;  3D0F A;  1IBK Q;  1X3F A;  2KCM A;  3HOW G;  1HNZ L;  2UU9 L;  1E1O A;  4JI4 L;  1JJC B;  4JI1 L;  1L2F A;  2FXQ A;  3A74 A;  3I4O A;  3FP9 A;  3AEV A;  1PH8 A;  4LFA L;  2UXC L;  3KFU A;  4YHH L;  3AYH B;  5C0X J;  1IBM Q;  1NMF A;  3H0G G;  3CCU A;  5LMN W;  3HKS A;  4LUV A;  1E1T A;  3PUZ A;  1BBU A;  3HOZ G;  2L15 A;  3FKI H;  3KLW A;  3GTQ H;  3M9B A;  3J7A 5;  2F3I A;  4B3M Q;  2ZJP A;  2RHQ B;  1I94 Q;  2YYZ A;  4X64 Q;  3J80 i;  4YY3 L;  1YJW A;  4DV4 Q;  1N36 L;  5GAG C;  4IPH A;  2HIX A;  3M85 A;  1PH1 A;  5HGQ A;  2UUB Q;  2GVB A;  4PZ8 A;  1P8L A;  3S1R H;  4DR5 Q;  4HIO A;  1QUQ A;  4R4O A;  3PO2 H;  1J5E L;  2HT1 A;  2ZTC A;  2BA0 A;  4B3S L;  1KXL A;  3G4S A;  3S1N H;  4GKJ Q;  4DV3 L;  5FLM G;  2ZTD A;  1WOC A;  2JJQ A;  5JJK A;  1S3O A;  2KBN A;  2YV5 A;  1N33 Q;  1XMO L;  4HJA A;  4JI2 Q;  4UPA A;  5FJ8 G;  3RLF A;  3T1Y L;  3ZJY C;  2VL6 A;  4DAM A;  1M1K C;  3I4N H;  3I56 A;  1UE1 A;  1XJV A;  4FDB A;  4LW1 A;  1JE5 A;  1SRU A;  5IP9 G;  1YHA A;  4BBS G;  3CCL A;  3KDF A;  2XTI A;  4X62 Q;  3PV0 A;  4X66 Q;  1I5F A;  2F52 A;  3TEH B;  4C2M H;  3HOX G;  1HH2 P;  4A3F G;  2OQ0 A;  4B3R Q;  3E0E A;  1MKH A;  1HJP A;  1D7Q A;  3K8A A;  4NXN L;  4LNQ A;  3DM3 A;  2DUD A;  4IPC A;  4JOI C;  3U50 C;  5IYC G;  5K36 G;  4A3J H;  2V1C C;  2UXD L;  2ID0 A;  1CSP A;  2AHO B;  4DK6 C;  4UY8 C;  1B8A A;  4LF5 L;  1HZC A;  3CAM A;  3HOY G;  5M3F G;  1BKB A;  1CKO A;  4BBR H;  1VQP A;  4LF8 L;  4DR6 L;  2GVA A;  4JI6 Q;  3ULJ A;  1EQR A;  3AQQ A;  5H1S E;  1R9T H;  4L5T A;  5C44 G;  4HIK A;  1XNR Q;  1SR3 A;  2N49 A;  3CMA A;  4L5Q A;  2UUC Q;  2E8G A;  5ELN A;  3S15 H;  1N32 Q;  1VQA A;  1I50 H;  1N34 Q;  3ULL A;  1JJG A;  4A3K H;  4Y52 H;  4AQY L;  3EIV A;  1A0I A;  4P71 A;  4R4I A;  3CP0 A;  3Q8D A;  1WJJ A;  3PO3 H;  1HR0 Q;  3GTL H;  3W5O A;  3I2Z A;  3PCO B;  2BA1 A;  4JCV E;  3B6Y A;  4XTC S;  2BH2 A;  1PV4 A;  4RG1 A;  4GOP A;  3SGI A;  4HJ5 A;  4O2D A;  5C0X I;  4GNX B;  1VQ4 A;  3S17 H;  2UUA L;  3TRZ A;  4MZ9 A;  1HNW Q;  4JOI A;  4BY1 H;  4ME3 A;  3I55 A;  2MO1 A;  4NB3 A;  2PI2 E;  1HZB A;  4A3M G;  3BJU A;  4XIG S;  5GAH C;  1Y14 B;  3AFP A;  4O0A A;  4TQU S;  3GTP H;  1KAW A;  1VQG A;  1HR0 W;  4QGU A;  3HOV G;  3BU2 A;  2JE6 I;  1PH5 A;  1X3E A;  4LFB L;  3UDI A;  1J6Q A;  3WWV A;  4OO1 I;  3CC4 A;  2JA8 H;  4R4C A;  1Z9F A;  4JV5 L;  4A3G G;  3RN2 A;  3U58 A;  2VZA A;  5C4X H;  1Q81 C;  1MJE A;  2CWP A;  2B29 A;  1RL2 A;  1SE8 A;  3F2C A;  1VQC A;  2ZTE A;  3A5Z B;  1Y1W H;  4R4T A;  1P16 A;  1Q1E A;  3K80 C;  3A5U A;  4A3C H;  3LGJ A;  2AKW B;  1L1O C;  4DV0 Q;  2MNA A;  3K7U C;  4R4Q A;  4YWL A;  5IYD H;  1YHB A;  3CPF A;  3AFQ A;  3RNU A;  2RF4 A;  2ATW A;  4JI5 Q;  1X9N A;  4EX5 A;  1XMQ L;  2B3G A;  4DR3 L;  1DGS A;  4DV7 L;  3PUY A;  4KI0 A;  2R92 H;  1HNZ Q;  4KLK A;  3PF5 A;  1XNQ L;  1GO3 E;  1XPR A;  2R93 H;  5IE8 A;  2K14 A;  2R7F A;  3CPW A;  2PQA A;  1QZG A;  2VQE L;  3KJP A;  4DV1 Q;  3M7N A;  1E22 A;  1YNX A;  4P73 A;  4UP9 A;  4GN5 A;  2VQE Q;  2K5N A;  4LFA Q;  2VQF L;  1TWG H;  1X55 A;  4YHH Q;  4IJH A;  2NVQ H;  1WI5 A;  4YWM A;  1KQS A;  4NPS A;  1LUZ A;  2VS1 A;  3EN2 A;  5JEA J;  3FHW A;  3CCJ A;  1NJI C;  4OX9 Q;  1QVF A;  2NN6 G;  4JI8 L;  1EQQ A;  1JJ2 A;  2JA7 H;  3FKI G;  1EYG A;  1Q8K A;  4NXM L;  2KEN A;  1YIT A;  1E24 A;  3E9I A;  3S24 A;  2UXB L;  2Z6K C;  2OTJ A;  1N36 Q;  4BA2 I;  2JA6 H;  3STB D;  1VCI A;  3F2B A;  1C7Y A;  4DR4 Q;  5M5Y H;  4JI0 L;  1NTG A;  2HHH L;  4A76 A;  2PNH A;  3NBH B;  1J5E Q;  1HZ9 A;  3JAM c;  3PO2 G;  1XPU A;  1YEZ A;  2Q2I A;  3ERS X;  1YJ9 A;  1CKM A;  5IWA Q;  3ULP A;  1AE3 A;  4GS3 A;  5JJL A;  2F4V L;  3U4Z A;  4C3J H;  5BR8 L;  4AH6 A;  2I5M X;  1KIX A;  1PFS A;  3RZO H;  1Y1V H;  3PSI A;  1VS0 A;  4DAY B;  3T1Y Q;  1X65 A;  1VQL A;  1Q46 A;  2OWO A;  2R7Z H;  1SRO A;  3I4N G;  3RLN A;  4LF9 L;  1SMX A;  1H95 A;  4POG A;  1G6P A;  3H3V H;  2Z6K A;  4DV5 L;  3F2D A;  4DUZ Q;  1YIJ A;  3GTM H;  3KF6 A;  4DR7 Q;  1K9M C;  4GKK L;  2CWA A;  5M3M H;  3DLL A;  2A8V A;  3S2D H;  1YHQ A;  4Y7N H;  1FJG Q;  2JEA I;  1K0R A;  1WYD A;  3KOJ A;  3GD7 A;  5EAY A;  1X56 A;  2K4K A;  1KD1 C;  2EXD A;  1L0W A;  4JBK A;  2UXD Q;  4DKA C;  4A3J G;  2LXJ A;  1G51 A;  4HID A;  4DR6 Q;  1Z47 A;  4DNI A;  4BBR G;  5LMN L;  1N8R C;  2E5L Q;  1UEB A;  5GAE C;  3T1H L;  4WJ4 A;  2ALY B;  3CD6 A;  3GTG H;  1VQJ A;  5AJ3 Q;  1K73 C;  1K8A C;  1HNX Q;  3CCE A;  3M3Y H;  2N78 A;  1IBK L;  4DUY Q;  3HOW H;  1X54 A;  1IBL Q;  4AQY Q;  2GN5 A;  1S72 A;  2EIF A;  4A3K G;  1BBW A;  1EWI A;  5DLQ E;  2IT1 A;  3J7Z C;  3L2P A;  3PO3 G;  3GDE A;  4BY7 G;  3STB C;  3NEM A;  4A3D H;  2A1A A;  1IBM L;  1KRS A;  3J81 c;  1QVC A;  3UDX A;  4HJ7 A;  4GN4 B;  4GN3 B;  1ASY A;  4PZ7 A;  1VQ8 A;  1VQ6 A;  4B3M L;  1X3G A;  1LYL A;  2Q2T A;  1TWA H;  1V1Q A;  5IP7 H;  4BY1 G;  4X64 L;  4APV A;  4DV2 Q;  1VQB A;  4LF4 Q;  4DV4 L;  1U0L A;  4OWT B;  3KDF B;  1Q82 C;  4X65 L;  2YU9 H;  4LF6 Q;  2JQO A;  2UUB L;  2JA5 H;  4C3H H;  2WFW A;  1YVC A;  2IX1 A;  5J3B A;  4DR5 L;  2E2H H;  4LFB Q;  2LXK A;  4GLX A;  1YJN A;  4JI7 L;  3TS2 A;  1GVP A;  4DR2 Q;  2E2I H;  2KHJ A;  2K52 A;  1N33 L;  5C4X G;  2IHE A;  3J80 c;  2YTV A;  1EFW A;  2DGY A;  1V43 A;  4QL5 A;  2BH8 A;  3CW2 C;  4JBJ A;  1VQM A;  2K5V A;  1VQK A;  4JI2 L;  1E7Z A;  4DV6 Q;  1YI2 A;  1JB7 A;  4K0K L;  2HQL A;  1PH6 A;  4IPD A;  4A3C G;  2CFM A;  3G6E A;  3CCM A;  4X6A H;  5FLX c;  2ZM6 Q;  1GD7 A;  5IYD G;  1OTC A;  1A8V A;  4JI3 Q;  1IL2 A;  1IZ6 A;  4DPG A;  4DV7 Q;  2B63 H;  1NMG A;  2NZH A;  4X62 L;  2R92 G;  4IOA A;  1CKN A;  2AWO A;  2IY5 B;  3S14 H;  4A93 H;  3NEL A;  4X66 L;  3RN5 A;  1PH9 A;  1M90 C;  5GAD C;  3NEN A;  4B3R L;  4LFC Q;  3S16 H;  2Q2H A;  1ASZ A;  1K8G A;  2WB1 E;  3JC6 6;  4GOP B;  4HJ8 A;  1EIF A;  4A3F H;  1KHI A;  1A62 A;  4KHP Q;  4JI8 Q;  1MIU A;  1Q1B A;  4LF7 L;  1C0A A;  3EBE A;  1WFQ A;  1D8L A;  4BA1 I;  2CQO A;  4JI6 L;  2QEX A;  3OTO L;  3GO5 A;  4PZ6 A;  1V9P A;  2JA6 G;  2N3S A;  2UUC L;  2D0P A;  2NVY H;  4POF A;  4A3L H;  1N32 L;  1PH3 A;  1IXR A;  2UU9 Q;  4JI4 Q;  3CXC A;  4JI1 Q;  1W3S A;  4IPG A;  5ELO A;  1HR0 L;  4JC0 A;  1FGU A;  2N8N A;  2UXC Q;  2NN6 I;  1SFO H;  4YCV A;  4OO1 G;  2F4V Q;  2WB1 G;  1N9W A;  3W1B A;  3W1G A;  5BR8 Q;  3UDF A;  4HJ9 A;  4A3E H;  5IYB H;  2WAQ E;  2XGT A;  4OWX B;  3G48 A;  3J81 j;  2Y0S E;  2EQS A;  4YY3 Q;  4A3I H;  2R7Z G;  1I6H H;  1XPO A;  4L5R C;  1S40 A;  4IO9 A;  3S1Q H;  1NBW A;  1B7Y B;  1L1O A;  1OXX K;  1NY4 A;  1XTD A;  3CME A;  3K7A H;  3L7Z C;  2PQA B;  3M4Q A;  2VUM H;  2CKZ B;  1FL0 A;  1VQ5 A;  5M3M G;  3HFZ B;  4DR1 L;  4B3S Q;  4DV3 Q;  4PG3 A;  3RLO A;  3VDY A;  1QZH A;  5M5W H;  1W2B A;  4IJL A;  1XMO Q;  4JYA L;  2R6G A;  4IOC A;  1WCM H;  4MNO A;  3CQZ H;  2K75 A;  2JK8 A;  5C3E H;  3CCQ A;  1PH4 A;  2WAQ G;  3CCV A;  2C35 B;  3TS0 A;  3M4O H;  4DV0 L;  4IFD I;  3UE1 A;  4JI5 L;  1MJC A;  2ES2 A;  4YCW A;  1UWV A;  3K81 C;  2I5H A;  4DK3 C;  4HIM A;  4GLV B;  4BXX H;  2PI2 A;  3S2H H;  5LMU L;  1VQI A;  2HIV A;  4DV1 L;  3L0O A;  3HOU H;  3U4V A;  3GTK H;  5IT9 c;  4NXN Q;  3A0J A;  4LUZ A;  4A3D G;  4B3T L;  4OWW B;  3PGZ A;  1G29 1;  4OX9 L;  2I0Q A;  3HKZ E;  3PF4 A;  3G71 A;  4LF5 Q;  4OXP A;  2ZJQ A;  4LF8 Q;  4KHZ A;  1T9H A;  3BZC A;  5IP7 G;  1K83 H;  3CCS A;  2AWN A;  3ICE A;  1VQ9 A;  2R7D A;  1CSQ A;  3I4M H;  4DR4 L;  4X65 Q;  3IRB A;  4R1J A;  1B70 B;  1QUQ B;  2R93 G;  3KF6 B;  2PMZ E;  2JA5 G;  1UE7 A;  3RR5 A;  2OCE A;  1AE2 A;  2LSS A;  1K3R A;  4A4I A;  2AMC B;  4JI7 Q;  1VQD A;  1U5K A;  4A75 A;  5IWA L;  3PIP A;  3KYH C;  1PHJ A;  4GNX C;  3H0G H;  2NVT H;  4PMW A;  3S1M H;  3HOZ H;  4K0K Q;  2D62 A;  3CCR A;  1Q86 C;  3UDG A;  2UUA Q;  3HKZ G;  2VW9 A;  1FVI A;  1I94 L;  2NVX H;  2OTL A;  2YTY A;  1AH9 A;  4J15 A;  4UP8 A;  4QQB X;  3TQY A;  1YBY A;  2VNU D;  2H5X A;  1PH7 A;  2D0O A;  3MXN B;  2KHI A;  4ALP A;  1GKH A;  2B63 G;  1OXT A;  5GRO A;  4DUZ L;  3PUV A;  2YTX A;  4DR7 L;  1HZA A;  1EUJ A;  1VQF A;  1OXV A;  2ASB A;  1IYJ B;  4JV5 Q;  4A93 G;  4GOP C;  3TRE A;  2JA8 G;  5FLM H;  1FJG L;  3KJO A;  4GKJ L;  4LWC A;  5M5X H;  2IHF A;  1OXU A;  2ZJR A;  5FJ8 H;  1SN8 A;  4OON A;  4MTN A;  1Y1W G;  4GNX A;  4LF7 Q;  4WJ3 M;  1YZ6 A;  4YWK A;  2E5L L;  3OTO Q;  5JEA G;  2K5H A;  5IP9 H;  1UE5 A;  5AJ3 L;  4DR3 Q;  1XMQ Q;  1HNX L;  4BBS H;  2MFI A;  4IFD G;  4P74 A;  1KRT A;  4A3L G;  4DUY L;  4AYB E;  1XNQ Q;  3F8T A;  1IBL L;  1RIP A;  4P75 A;  2JA9 A;  3PUX A;  3HOX H;  3E9H A;  3GTJ H;  1LM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...