4A3DH

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dH00
2E5LQ 1UE7A 5LMUL 4LF6L 3CD6A 1L1OB 2JA6G 1YJNA 1E1OA 4BBRH 1PFSA 3AEVA 3S2HH 4DPGA 3TS0A 1H95A 3CPFA 1X65A 1A0IA 2H5XA 3HOXG 1EYGA 2N3SA 4QL5A 4A3DG 3CCSA 3FKIG 3G4SA 2KBNA 2ZJQA 4BXXG 4PZ7A 1E3PA 4DAYB 1E22A 4B3TL 1N32L 4X65Q 4DUYQ 1SLJA 1Z9FA 4GN4B 1PH6A 2NVXH 1PH1A 1KL9A 3RZDH 4LF7Q 1YHBA 1VQ6A 4LF4Q 1N8RC 4JG2A 2KENA 1K3RA 4JI6L 1S72A 5LMNQ 3KFUA 4JI5Q 4DR6Q 1VQFA 4R4QA 1OTCA 3M85A 3PV0A 4TQUS 5AJ3Q 2DGYA 4DV3L 1JJGA 3Q8DA 4HIMA 5M5YH 1GM5A 2JA5H 3M7NA 5M3MG 5FJ8H 3E0EA 1PH7A 2OTJA 4DK3C 3W5OA 2AWOA 4YWLA 2UU9L 4LFBQ 1EWIA 4B3SL 5H1SE 3H0GH 1QVFA 4RMFA 3CCMA 3D31A 4DV5L 1HH2P 1LUZA 2MO0A 3K0XA 5M5XH 5IYCG 3TRZA 4A3EG 1XMOQ 1M90C 1FL0A 1R9TH 4L5SA 1C9OA 2D62A 2K14A 4UP9A 4OONA 5M3FH 1PYSB 1AE3A 1A63A 5C44G 4C3HH 1C0AA 1EQQA 1W3SA 2N78A 3K81C 2UXDL 5HGQA 4DR1L 3KLWA 1JJCB 4NXNL 4LF8Q 2R6GA 2WB1E 3DLLA 4LFAL 3OTOQ 3I4OA 3NBHB 4L5TA 1N33Q 3HKZG 2CFMA 4A3KG 2B29A 4A3IG 2N49A 4GOPC 3STBD 3D0FA 5EAYA 1WI5A 1Y1VH 1EQRA 2Q2HA 1G51A 1SN8A 3HOWG 4JOIC 5BR8L 4ALPA 4A76A 2VQFQ 1VQ4A 1XNRQ 2Z6KA 4NB3A 4OX9Q 1K83H 4DV4Q 4YWMA 2I5HA 1VQOA 3G6EA 1NE3A 1J6QA 1VQBA 3I4NH 2HIVA 3GTQH 5IP9H 1PH2A 1L1OA 2R93G 5JEAJ 2CQOA 2MNAA 3I7FA 2QEXA 3LGJA 2AHOB 1X3EA 4DR4Q 4DNIA 4HJAA 4JI4L 1KAWA 2GVAA 3M9BA 4A3BH 1XNQL 1WCMH 4UP8A 4DKAC 4DV1Q 4DR4L 2WAQE 1UE6A 2F4VL 3HOYG 1N36Q 3PO2G 2HT1A 1YITA 4KHZA 4JI1L 1K9MC 1SMXA 4KLKA 2QA4A 2EXDA 4GKKQ 4X66L 2B63G 4JI8L 3EBEA 3MXNB 4PZ8A 4GS3A 4YWKA 1XMQL 1IBMQ 3PF4A 1HNXL 2F3IA 3KJOA 3U50C 4YCWA 4K0KQ 4LF9Q 3HFZB 3F2CA 3GTMH 3HOUG 1IBLQ 1HNZQ 3BZCA 2Q2UA 3UDFA 2PNHA 1X3GA 4B3RL 4OXPA 4IPGA 4JI2Q 3NENA 3E9IA 3I4MG 3EN2A 4QQBX 4DR2Q 4DV7L 1YI2A 3RLFA 2DUDA 1KRTA 1XPRA 4LFCL 3CCQA 2WFWA 2CWPA 2UUBQ 3OYYA 3RR5A 1K8AC 4A93G 1GKHA 2HHHQ 2ATWA 2UXCL 4GKJQ 1E24A 3J81i 1JE5A 5IYBH 1UE1A 4X62Q 3AFQA 1TWAH 1EOVA 3J7A5 4JBJA 4IJLA 4X64L 1HJPA 2NZHA 2YTXA 4H02A 4AQYL 1NY4A 1S3OA 1NJIC 4BA2I 1IYJB 2IHEA 2JA5G 1MKHA 4JBWA 1N34Q 4LUZA 5FJ8G 1W2BA 1D8LA 2E2IH 4IOAA 4X6AH 1VQMA 1FVIA 1T9HA 4HIKA 3VDYA 3T1YL 4GN3B 1AE2A 2KCMA 2LXJA 2B3GA 3K7UC 5GQOA 1A62A 3TS2A 3UDXA 1YJ9A 2D0OA 4A3FH 4A3LH 3RLNA 1XTDA 1UEBA 4JYAL 5IYDH 2PQAB 2JJQA 4YY3L 1B70B 1YBYA 1Q8KA 1VQ8A 3HOZH 1HZAA 3F1ZA 5C4XH 4LWCA 3ICEA 1Q1EA 1VQAA 5IWAQ 2UUCL 4P73A 4JI3Q 3H3VI 2F52A 3K8AA 4JI5L 4DV6Q 1XJVA 1JMCA 4DR6L 4A3CH 2EIFA 4HJ9A 2JEBI 4IOCA 3CCVA 2R92H 2K52A 3JC66 4O2DA 1HZCA 3ER0A 3KF8B 3KJPA 4R1JA 2ZM6L 4Y7NH 4R4CA 3DM3A 3RN2A 1PH8A 1VQKA 4RG1A 1GO3E 1Z47A 1CKOA 4XTCS 5HY6A 3TREA 4AIMA 4DR5Q 1IL2A 4BBSH 5FLMH 4LFBL 1X3FA 3S17H 3CCRA 1JB7A 2OWOA 1DGSA 4A4IA 4OWWB 5C3EH 1TWFH 1Q7YC 1D7QA 1I94Q 2AWNA 2MO1A 3S2DH 3HKSA 3PUWA 1ASZA 3I4NG 1YVCA 5IP9G 4ME3A 1K0RA 4A75A 4B3TQ 1N32Q 5JEAG 2PI2A 1WJJA 1TWHH 1OXXK 2E2JH 1FJGQ 4AYBE 5LMNW 5ELNA 2RHQB 3S1MH 3OTOL 4A3BG 5IP7H 1HNWQ 1WCMG 2UUAQ 1N33L 2QGQA 2HQLA 4UY8C 1PH3A 1BBWA 2XGTA 5FLXc 2WAQG 2YV5A 2CWAA 1KC8C 4JI7Q 3JAMc 1PH5A 1U5KA 4C2MH 1VQLA 1SR3A 1VQJA 1BBUA 1TWGH 4DV3Q 3CC4A 1QUQB 4GN5A 4JCVE 3CCUA 2NN6G 4GNXC 4LNQA 2UU9Q 4DV0Q 2YTVA 3BU2A 2VQFL 3HOXH 4A3MG 1K8GA 2RF4A 3CCLA 4B3SQ 3STBC 4DV4L 4P74A 4HJ5A 2I5MX 3FKIH 4DV5Q 4R4TA 2WP8J 4BXXH 3ULPA 4IFDJ 2ZJRA 2ZJPA 3MEFA 3CW2C 1PYBA 1SE8A 4YHHL 4MTNA 2Y0SG 1J5EL 4JC0A 2JA8G 1KHIA 1N9WA 2VY3A 3IRBA 1OXVA 1VQIA 1Y1WH 3UE0A 3EIVA 3GTKH 2R7FA 1WOCA 4NXNQ 4HJ8A 1N36L 1G6PA 3B6YA 1IXRA 3GTJH 1CKMA 5GAEC 4LW1A 1VQCA 2KCTA 4OO1G 1YHAA 5JJKA 2I5LX 3PUVA 1PA6A 4OWTB 4LF5Q 4A3JG 3TEHB 1IBML 4WJ4A 2R7ZG 2AMCB 3J81j 4POGA 3S1NH 2VUMH 2NN6I 3F2BA 2CCZA 1BKBA 3GTPH 4LF9L 4K0KL 2Z6KC 2MFIA 4BY7G 2K5VA 2GN5A 1HR0Q 3KYHC 4B3ML 2NZOA 1VQPA 3S15H 4JI2L 2UXBL 2EQSA 3A74A 4BBRG 4A3LG 2VNUD 5C44H 4DAMA 3AFPA 4DR7Q 4PZ6A 4BY1H 5IYDG 5C0XJ 1V43A 2JA9A 3CP0A 2JE6I 1MJEA 4JV5L 4TVAB 2MQHA 2IY5B 3CC7A 1VQDA 3T1HQ 4O0AA 4NXMQ 4GKJL 5E7NA 3A5UA 2VS1A 4DR3L 1PHJA 4JBMA 1U0LA 3PO3H 2FXQA 4J15A 1B7YB 4A3KH 4A3CG 1KD1C 4YCUA 1I3QH 2VQEL 1G291 4A3IH 4OO1I 4JI1Q 1IBKL 4GNXB 4GOPB 3U58A 2R92G 1UE5A 5GROA 4X66Q 1XPUA 2OCEA 4JI8Q 3RNUA 1EIYB 1N34L 1HNXQ 2HIXA 4JBKA 1OXUA 3SGIA 1L0WA 2E5LL 4JI0Q 5FLMG 2GVBA 3M4OH 3PUZA 4IPDA 4QIWE 2CKZB 3PCOB 1VQHA 2PMZE 2AKWB 2RCNA 3S24A 2ASBA 2Z0SA 1MIUA 1QUQA 5C3EG 4C3JH 2A1AA 4DUZQ 2R93H 4MZ9A 3H0GG 2BH8A 3GTLH 3KDFB 3RLOA 1KQSA 3PIPA 1Y14B 2NVTH 2A8VA 2E8GA 2JQOA 3HOVH 1MJCA 4X65L 1Q1BA 4DUYL 3S16H 1KIXA 1EIFA 4JI3L 5IWAL 5M3FG 3CCEA 2NVQH 3S1QH 4LF7L 2UXCQ 2K75A 5K36G 1B8AA 4LF4L 5IP7G 4AYBG 4A3GH 1VQ5A 4DV2Q 2OQKA 5LMNL 1YZ6A 1SFOH 4X64Q 1QZHA 2IX1A 4AQYQ 2JA7H 4DR5L 4APVA 2WB1G 5AJ3L 1VQGA 1LYLA 3ZJYC 3CF5A 4DK6C 3I55A 2K4KA 3HOUH 4OWXB 3NELA 3NEMA 1I5FA 4GLAC 1KRSA 1TXYA 1YJWA 2LXKA 3CMAA 1I94L 3BJUA 1Y1VG 5LMUQ 1ASYA 4LF6Q 2JEAI 3CQZH 3T1YQ 3GTOH 3I4MH 3U4VA 4IFDG 1XMOL 4JYAQ 2BA1A 3OW2A 3GD7A 1YHQA 4YY3Q 1I50H 1FJGL 4A93H 2XTIA 3S1RH 3H3VH 1GD7A 1QVGA 5JJLA 3RZOH 1Q82C 1Y1WG 1HNWL 3U4ZA 2UUCQ 2UUAL 4Y52H 3PO2H 4LF8L 1FGUA 3G71A 1X55A 1CKNB 1VCIA 4JI7L 4JI6Q 2RHSB 1VQ7A 2ZM6Q 4BA1I 3I2ZA 4EX5A 1NTGA 4XIGS 1OXTA 4PMWA 3W1GA 4GLXA 3BZKA 4QY7A 3CXCA 4DV0L 1K73C 2IX0A 2VUMG 3PSIA 4FDBA 4GNXA 3FP9A 4GOPA 2JA6H 2LSSA 3UDIA 4HIOA 3ULLA 2YTYA 3KF6B 4IPHA 1XNRL 4OX9L 1NMGA 2YYZA 4A3DH 3UE1A 4JOIA 5GADC 2K5NA 3RN5A 1SROA 4IPCA 4IFDI 3J80c 1V9PA 1QZGA 3CMEA 4BY1G 4P75A 3PIOA 1C7YA 1VQ9A 1E1TA 1KXLA 4GLVB 1UWVA 4UP7A 3GO5A 3TQYA 5C0XG 3FHWA 2BH2A 1L2FA 1Q12A 2ID0A 1VQNA 3UDGA 3A5ZB 2R7DA 3KDFA 4UPAA 2N8NA 2PI2E 1EUJA 3PUXA 4HJ7A 3PF5A 2UXDQ 4DR1Q 3PO3G 4DV1L 1JJ2A 4LF5L 2PQAA 3K80C 4QGUA 4LFAQ 3JAMi 1BVSA 3ULJA 3M3YH 2C35B 5IYBG 3E9HA 4GKKL 2ES2A 5ELOA 4C3IH 1M1KC 3S14H 1V1QA 3PGZA 3PUYA 5M3MH 2IHFA 1TWCH 2BA0A 1HR0L 1O7IA 2V1CC 1PH4A 2KHIA 2ZTEA 4R4OA 2OTLA 1A8VA 4L5RC 1CSQA 2JK8A 2OQ0A 3M4PA 3J80i 5BR8Q 3J7ZC 1HNZL 5IYCH 1WFQA 3I56A 1IBLL 4DR7L 2K5HA 1P16A 4A3EH 1HZ9A 1X9NA 1EFWA 1L1OC 4IJHA 4L5QA 4YHHQ 2I0QA 1PVOA 3W1BA 1J5EQ 5DLQE 1OXSC 4DR2L 3CPWA 3F8TA 5C0XI 3T1HL 4A3FG 4NXML 3K7AH 3HOVG 1NMFA 3GDEA 3H15A 1WYDA 2UUBL 3HOZG 1E7ZA 1QVCA 5C4XG 5JJIA 2HHHL 4JI4Q 1HZBA 3HKZE 4EQ5A 4A3GG 1XNQQ 3M4QA 4P71A 2D0PA 4X62L 3J81c 4HIDA 4P72A 1VQEA 2ALYB 3L0OA 2F4VQ 3GTGH 1LTLA 1X56A 4NPSA 3CC2A 3ERSX 1YIJA 2Q2TA 3AYHB 5IT9c 2JA7G 1RL2A 4JI0L 4BY7H 4A3MH 2Q2IA 1HR0W 4WJ3M 1VS0A 1CKNA 3CAMA 1P8LA 4QJFA 1SRUA 1XPOA 1XMQQ 1IZ6A 5GAGC 3HOWH 3F2DA 5C4JH 4BBSG 2L15A 2Y0SE 1CUKA 4DUZL 5IY0A 4IO9A 4B3MQ 3L7ZC 4LUOA 3L2PA 2NVYH 4PG3A 3WWVA 1Q86C 1YEZA 2A19A 2UXBQ 1GVPA 1LM0A 2VZAA 3G48A 4MNOA 2YU9H 1NBWA 2JA8H 1PH9A 4POFA 4R4IA 4B3RQ 2E2HH 2K50A 5IE8A 4JV5Q 1Q46A 3KF6A 2ZTCA 1I6HH 1CSPA 2IT1A 5J3BA 4LUVA 1Q81C 4AH6A 4DV7Q 1AH9A 2KHJA 4LFCQ 4KI0A 4DR3Q 5GAHC 4DV2L 1S40A 3HOYH 4KHPQ 1RIPA 3A0JA 4DV6L 4A3JH 1PV4A 2VQEQ 1YNXA 2VW9A 1X6OA 2VL6A 3AQQA 1IBKQ 2R7ZH 1JT8A 2ZTDA 4YCVA 2B63H 5M5WH 4KHPL 3CCJA 1X54A 3KOJA
chains in the Genus database with same CATH superfamily
2E5LQ 3MFGA 4RGTA 2CH4W 1UE7A 2IX3A 1LO5D 1YJNA 1E1OA 1J8IA 1SYDA 2QDLA 3HKZB 4HEDA 3CPFA 4ZYSA 1TS5A 2H5XA 3HOXG 2F03A 1EY0A 2N3SA 3IFDA 4BY7B 5EKLA 2ZJQA 4DAYB 1I4GA 1E22A 3HOWB 4DUYQ 1JOOA 1Z9FA 2F0EA 3KLRA 1EY9A 1PH1A 1KL9A 5BN3A 3RZDH 2LY7A 2Y0SB 3TZDA 3I4LA 2YU9B 2JA8B 1GJXA 5ELDA 1S72A 1H9SB 2E2HB 3QWNA 3DXJC 3M85A 2JP1A 3PV0A 1E0BA 4TQUS 5AJ3Q 4ILWA 5I9PA 4C3IG 4HIMA 1ZKOA 3FDTA 5AFWA 4UAIA 2QKIC 4DK3C 3S9WA 3PO2B 1EWIA 2PCFB 2KJXA 5H1SE 1K8MA 1SE4A 4MHEA 4RMFA 4FYDA 2IPKD 3K0XA 5JAVA 3DMUA 2ICEC 4A3EG 1XMOQ 4L5SA 2K1BA 3Q23A 1C9OA 4UP9A 5M3FH 1PYSB 1A63A 3FRPB 1JORA 1EQQA 3HOUB 3K81C 1TIID 4BBRB 2UXDL 4V0BA 5HGQA 3KLWA 3QB3A 1PTOB 4NDXA 2M9VA 2RKSA 4L5TA 1IHZA 4A3KG 2K5DA 4GOPC 3D0FA 1EQRA 1G51A 3SK8A 4JOIC 3V2TA 1GUTA 4YWMA 1AFPA 3I4NH 1G8ZD 3CRLC 3HGBA 2CQOA 2EYHA 1QB5D 5M5XB 1XNQL 2F0PA 4DAYA 5IT9E 1KNAA 4DR4L 1E2WA 3RD4A 2EJMA 4JI1L 1SMXA 4C3HB 5DM63 2EXDA 2B63G 3MXNB 4GS3A 1XMQL 1HNXL 3OMGA 5JOBA 1H9SA 1ENCA 2F3IA 3KJOA 1HQMC 3RUZA 3U50C 4LF9Q 3CRKC 1DD2A 3F2CA 1IBLQ 1HNZQ 2Q2UA 2PNHA 3P75A 4N8X1 1IYVA 3E9IA 3UI2A 3I4MG 2DUDA 4QUFA 1XPRA 1ICWA 4LFCL 2UUBQ 3RR5A 2TMPA 5EGTA 4A93G 3J81i 2F0VA 5IYBH 1UE1A 4X62Q 4OO1H 2B2TA 3DWAA 5E3FA 1HJPA 4DGZA 1NY4A 1ZYRC 1NJIC 4A3BB 1JE4A 1D8LA 1VDZA 2A6HC 1BO0A 3VDYA 4JVZA 2KCMA 1XYIA 3AB9A 2K5WA 1UEBA 5IYDH 2JJQA 1AN8A 1DJRD 1YBYA 1VQ8A 1HZAA 4OEMB 3GTMB 2RVLA 1HUNA 1EU4A 3N52A 4P73A 4JI5L 2NB0A 3CCVA 4O2DA 1EIHA 2A69D 4KTAA 1GO3E 5HY6A 1CKOA 4LK1C 1X3FA 3CCRA 2WINB 1Q7YC 4EGVA 1D7QA 1H9JA 3HG9A 2AWNA 3PUWA 3TMEA 1EQVA 1B53A 1ASZA 1G2TA 1YVCA 2E2JH 4K8IA 4AYBE 1BBXC 2HUGA 5LMNW 1QNUA 3F2UA 3S1MH 5IP7H 3QOLA 2RA4A 1WCMG 4A3FB 2QGQA 2HQLA 4UY8C 2YV5A 2CWAA 4N9TA 4JI7Q 3JAMc 1SR3A 1VQJA 4DV3Q 4GN5A 1S5CD 3A7AB 4DV0Q 2VQFL 3HOXH 3VYTA 2RF4A 4B3SQ 3STBC 3A7LA 3SE0A 2ZJRA 2RBMA 3TDQA 4YHHL 4BBSB 1J5EL 2J7ZA 3A56A 4KHVA 3WOFA 4K6LA 1LT5D 1N36L 1T5XD 3B6YA 4LW1A 4M1UB 1YHAA 2ZXRA 1PA6A 5EKIA 1SJED 4DAVA 1TS4A 3MA2B 2NN6I 3F2BA 3GTPH 1YNND 2NZOA 1CHQD 2FINB 3TSSA 1V43A 4HR7B 3SR1A 2EYMA 2CW0D 2RSNA 1VQDA 4RWSC 3SK6A 3T1HQ 4NXMQ 3FKIB 4GKJL 3A5UA 4DU9A 2VS1A 3T13A 3PO3H 4J15A 1B7YB 1UAPA 4A3KH 3Q6SA 1KD1C 4YCUA 4GNXB 4K2KA 3RNUA 1BQQT 1EIYB 2FFKB 1N34L 2E5LL 1PZID 3PUZA 4QIWE 4QB4A 3PCOB 1VQHA 2RCNA 1MIUA 1O7LA 5C3EG 4RHSA 3IFTA 4MZ9A 3PIO3 3KDFB 2NVTH 3PIPA 2E8GA 1MJCA 5T1IA 3OHXC 4DUYL 5EPKA 1KIXA 4H0LC 1CK1A 1EIFA 3A54A 4ZAIA 4JI3L 3CCEA 4CJ2C 2HDMA 3S15B 2UXCQ 2WV6D 1B8AA 5K36G 4AYBG 3ZYYX 4G7OC 1VQ5A 1PMRA 2OQKA 4APVA 5AJ3L 1VQGA 1M8AA 2K4KA 1TXYA 1YJWA 4K5VA 3H3VC 3CMAA 4A3IB 4RAUC 3CQZH 2P5ZX 3I4MH 1XMOL 1YHQA 1SNPA 5IODA 1IKMA 1FJGL 4A93H 2XTIA 4ME5A 3H3VH 3RZOH 3H09A 3S2HB 1Y1WG 1HNWL 3K57A 3G71A 1X55A 1VCIA 1VQ7A 3I2ZA 1BCPF 4XIGS 1OXTA 3EROA 3W1GA 3S16B 2NVQB 2K28A 3J80E 2VUMG 1DONA 1PLFA 4FDBA 4GNXA 2JA6H 3ULLA 3R93A 3TP8A 5GADC 1IW7C 2K5NA 1WTRA 1MBYA 3FEWX 3SHLA 1A3TA 4BY1G 3DUZA 1E1TA 1KXLA 4GLVB 3FHWA 1Q12A 3KDFA 1X3PA 4HJ7A 2UXDQ 4YIJA 4Q0FA 4LF5L 2B2UC 4H44C 3E9HA 3S1RB 1LTRD 1M1KC 1R4PB 2BA0A 3TBIB 1O7IA 4L5RC 2F0KA 3NPPA 4L8JA 2OQ0A 3M4PA 3J80i 3J7ZC 3R2IA 1IBLL 1HNZL 5IYCH 4DR7L 4C3JG 1LV9A 1P16A 1HZ9A 1RODA 5C3XA 1PVOA 3D3RA 1IKLA 3GDEA 2UUBL 1NR4A 3BS1A 1B3AA 1D1IA 2XIWA 3HKZE 4A3GG 1XNQQ 4X62L 3CHBD 4DR4Q 4FXDA 5CV5A 4NPSA 4WJWA 3WOEA 1YIJA 4UHVA 4DN4M 2Q2TA 3NE5B 3K0YA 1Z7TA 1VS0A 1XMQQ 3SK5A 2PZWA 1STNA 3KUPA 3F2DA 2L15A 2Y0SE 4F87A 4B3MQ 3WWVA 3GTJB 1YEZA 3OWEB 1WD0A 1GVPA 2UXBQ 2B8GA 1NBWA 3HP3A 2BDOA 5M3MB 5IE8A 1Q46A 2TSSA 2IT1A 2EY1A 5J3BA 2NYZD 4LFCQ 3LX0A 5GAHC 1G6ZA 3C1EA 1V1OA 2VW9A 4ZRZA 2VL6A 1IBKQ 2E2DC 1LTSD 2F0LA 3K7AB 3CCJA 2DN8A 3D4DA 5CYUA 4LF6L 1L1OB 4U68A 4MTKA 2EJFC 1S5ED 1PFSA 3AEVA 4DPGA 2Z8LA 1X65A 4B08A 4A3DG 1QNKA 3NK9A 2K04A 4A3MB 2KBNA 1B3QA 1PTOF 1PFMA 1RF2D 3W3AA 2NVYB 1YHBA 1VQ6A 4JG2A 4JI6L 4JI5Q 2CH4A 3TP6A 1D2BA 2DGYA 4DV3L 3QO2A 3Q8DA 2DNCA 5M5YH 1SBBB 2JA5H 5ELFA 1L0YB 5FJ8H 1PFNA 5C3WA 3HOYB 4YWLA 2ZT9C 4A3JB 3M7GA 2R7ZB 4B3SL 1F2YA 3T16A 3CCMA 4GZYC 1LUZA 2EYPA 3NHHA 3TRZA 4Z9CB 1FL0A 1M90C 2O5JC 2K14A 4OONA 3PQIA 3OW7A 5C44G 4KKUA 1HPCA 1W3SA 5K36H 1MSGA 4DR1L 1JJCB 2IL8A 1JC7A 1EZ8A 4LFAL 3I4OA 1EZ6A 1C48A 2B2WA 3HKZG 2RDGA 1V8QA 1A3UA 3RZDB 1WI5A 2Q2HA 4CBVA 4DA2A 3HOWG 4ALPA 2VQFQ 3D4RA 1XNRQ 4OX9Q 1LT4D 2JYOA 1BCPB 2EYLA 2HIVA 3VR5A 3GTQH 1PH2A 1L1OA 4DNTB 4K14A 4V190 3I7FA 5JJZA 4DNIA 2HDLA 1J9OA 3M9BA 1N36Q 3PO2G 2DJFC 2A68D 1YITA 5M3FB 1STYA 1K9MC 4KLKA 2B2VA 1AZQA 1Q3LA 4YWKA 3G7LA 4CKBA 4TRDA 1I4XA 3W2DA 2K01A 1KDBA 2EYOA 3HOUG 1SNDA 3MXUA 1FNVA 4KN4C 3HS0C 1DCZA 1CA6A 3EN2A 4DXFA 4DR2Q 4QQBX 4DV7L 2WFWA 4OL7A 1K8AC 1PZKD 4UDUC 4LAAA 2UXCL 4MIUA 4ZCKA 4GKJQ 3I4NB 1JE5A 5ELCA 3AFQA 1TWAH 3U9OA 4JBJA 4H13C 1KLUD 1FYCA 1EY8A 1GUOA 3DWQA 4BA2I 1IYJB 1VMPA 1W2BA 1N34Q 2E2IH 4DFAA 4IOAA 1DOMA 4HIKA 3V96A 2EY6A 4HCSA 1MI2A 2NBFA 1A62A 2EYJA 3UDXA 1YJ9A 1XTDA 5CBEE 4OELB 2PQAB 4ZKBB 1B70B 1A2UA 1Q8KA 3F1ZA 4C3HG 3L3OC 3Q22A 1VQAA 4JI3Q 3H3VI 2F52A 4FNFA 4DV6Q 3J7AF 4DR6L 2BOSA 4O42A 4IOCA 2R92H 3VYSA 3EFXD 3IL8A 3RN2A 1PRTF 2EJGC 1Z47A 4LFBL 2A69C 4CGYB 4WFN3 3E5SA 4IUNA 2OWOA 1DGSA 4M8AA 2XWJB 1M4VA 1TWFH 4G7HC 1JB3A 5LL6X 2SNMA 1D5ZC 3E0JA 5IP9G 4JK1C 4I7AA 1KABA 1N32Q 1BXTA 5JEAG 1TWHH 2ENBA 2MJ8A 3BZDB 3JAME 1FJGQ 1SNMA 1AZPA 4A3BG 2IW3A 1AEXA 3H6MA 1X32A 2L4NA 1HNWQ 5IGBA 2WACA 1EQTA 1PH3A 4C1NK 1BBWA 1W6KA 5FLXc 2M2LA 2R61A 5I2YA 2EY5A 1PH5A 1PXUA 1TWGH 1QUQB 4G7ZC 4H7BA 3CCLA 2YTVA 3BU2A 1EEFD 3I91A 3KLSA 1SMYD 2V4DA 4DK0A 4KK7A 4DV4L 1YNJD 4DV5Q 2WIIB 1O7ZA 3MVVA 1LTID 2ZJPA 2Q8IB 3CW2C 1SE8A 1Y69U 2VY3A 1U9RA 4O1NA 3IRBA 2G9HD 2XNAC 4F7XA 1NUCA 4RH6A 3GTKH 2R7FA 4NXNQ 3J7YW 1C8CA 2K03A 1VQCA 1VF5C 2KCTA 3FVQA 2I5LX 4OWTB 4LF5Q 2E2JB 3J81j 1NNXA 3MEHA 4RCNA 4POGA 3S1NH 3S1MB 1BKBA 4OIJA 2F4IA 2MUYA 5I9OA 1BR9A 5JVG3 2MFIA 1LTAD 1S5FD 3KYHC 1YNNC 4B3ML 4XDXA 4IURA 2UXBL 1WTQA 4A3LG 2VNUD 5C44H 4DR7Q 4PZ6A 2JA9A 3CP0A 1STGA 4TVAB 2IY5B 3HOXB 3IKJA 1WVLA 2CW0C 2BE5C 1PHJA 1U0LA 2FXQA 4DK1A 3VR4A 5KNDA 4A3CG 1HXYD 1IBKL 3DM1A 3KBGA 1VF7A 5GROA 4X66Q 4JI8Q 5G3LF 1EU3A 1LTTD 2EPBA 3T53B 1BUVT 4CJ1B 1BDOA 1KAAA 3DEOA 5FLMG 3M4OH 4CHTB 4IPDA 2F0HA 2CKZB 2ASBA 3H94A 1QUQA 2KA7A 1SE3A 3EA6A 3H0GG 1HHVA 1D1KA 4IUPA 2BH8A 3RLOA 1Y14B 1ILPA 2I46A 3GTPB 1TY0A 3HOVH 3MC0B 1CZWA 5IWAL 3ERQA 5CV9A 2PZUA 1ESFA 3NTKA 5A2QE 5IGEA 3KLSX 3J81L 1A3VA 1EY7A 4HSPA 1B1ZA 1U4RA 1AW7A 2F0MA 5IT9L 4X64Q 1F9SA 1S5BD 4AQYQ 2JA7H 1LYLA 5EPLA 3CF5A 1F2MA 3HOUH 2D5DA 3NELA 3PO3B 2XWBB 4GLAC 1KRSA 2XRQD 2A6ED 4A3KB 2LXKA 1I94L 1Y1VG 1RTNA 4LF6Q 3P7JA 3OOCA 2LMCB 1BCPD 3MXNA 5D65A 4IFDG 4JYAQ 3OW2A 4KKSA 4YY3Q 4IUQA 2Z1CA 1F9PA 1SAPA 1HFGA 2UUCQ 4Y52H 2QDBA 1STEA 5K5PA 3DHQA 4JI6Q 4R8NA 4BA1I 1NTGA 4PMWA 3NBIA 4QY7A 2N55A 1LACA 1F9RA 1XNRL 4OX9L 1NMGA 1GHJA 3UE1A 1PRTB 1QJOA 1SROA 4IPCA 4ZK9B 1QZGA 3PIOA 2F3WA 4XYQA 1C7YA 3TZUA 1I6VC 2FJ2A 2ID0A 3FMCA 1VQNA 2QILA 3A5ZB 3CQZB 3IAYA 1EUJA 3I4MB 4DR1Q 1JJ2A 4NW2A 4LFAQ 1BVSA 3M3YH 4A93B 5CV7A 3RZOB 4C3IH 4CDCC 3S14H 3PGZA 1O78A 2CHBD 2SDFA 2QF7A 1HR0L 2V1CC 2A5HA 3DEPA 5C5LA 1CSQA 2JK8A 3QJYA 2E75C 1G2SA 2K5HA 3ONAB 4XT3B 4CDDC 4A3EH 3K5NA 4L5QA 5JEAH 1E2VA 5DLQE 4DNRB 5ELEA 1OXSC 4XQNA 3CPWA 1HTLD 4DR2L 1EL0A 2JA6B 3P1HA 1WYDA 3HOZG 4IUUA 1QVCA 5C4XG 2ZXOA 3J81c 4BWGB 3GTGH 4P72A 1VQEA 1LTLA 3H91A 3A8JE 3ERSX 5IT9c 2F3VA 1DXMA 4WJ3M 3FPPA 5C4JH 1S5DD 4DUZL 4LUOA 3HRZC 1OO9B 4FO2A 2A19A 2VZAA 2Q8TA 1JWUD 2HQEA 4MNOA 4R4IA 1VMCA 2K50A 4JV5Q 1K0SA 1I6HH 5JVH3 4LUVA 4DV7Q 1XXGA 3U9SA 3C1FA 4ZQ3A 5J39A 4DR3Q 1SE2A 4DV2L 1G91A 4DV6L 2VQEQ 2EXZA 3BVZA 1PTOD 5M5WH 3OIPA 2H1EA 2B63H 1X54A 5KGUA 1B50A 4G57A 3KOJA 4I7ZC 5KIXA 2B2YC 5LMUL 1SYFA 3OWFA 3C3LA 2KEDA 1CQVA 5KYLA 3TS0A 1H95A 1A0IA 3GV6A 1EYGA 1Y8PB 3CCSA 2K32A 5HGTA 1F9QA 4E6IA 3HZXA 4LJZC 4HTHA 1N32L 1SLJA 2H4OA 1PH6A 2NVXH 2C9OA 3VR3A 5EQ0A 1N8RC 1K3RA 3LWEA 2R93B 4DR6Q 1II3A 3NXWA 1OTCA 4PMCA 2RCFA 3EQLC 1JJGA 4RKBA 1GM5A 3K5MA 2EDGA 5M3MG 3E0EA 2OTJA 1BOSA 2AWOA 4LFBQ 3BVMA 3H0GH 3L9AX 3D31A 4DV5L 1HH2P 2MO0A 5FO7B 3SXHA 1R9TH 2D62A 1AE3A 2VB2X 2OXPA 2LS01 2PO4A 1CA5A 4X3SA 1C0AA 4XQJA 1F77A 2N78A 1A2TA 1QILA 3T51B 4NXNL 4KMUC 2WB1E 2K6AA 3NBHB 2KOLA 2B2UA 1UUPA 2N49A 2D9UA 1T5EA 1SEBD 3STBD 1C4QA 1Y1VH 4P2CB 4EQPA 4ULLA 5BR8L 4KKTA 2O4XA 4N8FA 1MSHA 4A76A 4IFDH 3A8KE 2Z6KA 4NB3A 5I6WA 1O7YA 1K83H 4DV4Q 2I5HA 1NE3A 1VQBA 3N6RA 3R8BA 1STHA 5M5YB 2JA5B 5JEAJ 1U4MA 3QG1A 2MNAA 2QEXA 3LGJA 4IALA 4HJAA 2GVAA 2F0DA 1RHPA 1WCMH 4QUCA 5FO9B 4DV1Q 1GXDC 1UE6A 2F4VL 3HOYG 2HT1A 1KLGD 4KHZA 2A68C 2QA4A 4X66L 3I90A 4JI8L 3PF4A 4CKCA 1ENAA 4YCWA 1F2LA 1TQOA 3HFZB 3J80L 1X3GA 1HFNA 3BDCA 1F2ZA 3MFYA 3NENA 3K5OA 3RLFA 1KRTA 2CWPA 3OYYA 1GKHA 5E1FA 5J22A 2ATWA 1E24A 2MPMA 4L63B 4MN3A 3GTQB 3M4YA 3J7A5 4IJLA 4X64L 4H02A 4AQYL 1S3OA 2DJGC 3NBHA 1MKHA 3C46A 4JBWA 4LUZA 3TP5A 4K6DA 1VQMA 2WAQB 4GN3B 2LXJA 2B3GA 1PRTD 2K7VA 4JYAL 4YY3L 1RJTA 3HOZH 3I8ZA 5C4XH 3ICEA 2MGSA 5IWAQ 4JPBW 2UUCL 2L55A 3K8AA 4HJ9A 1SNCA 2JEBI 3KJPA 2Z9HA 1HZCA 3MXPA 1VQKA 4FF4A 4R1JA 3GP7A 1SYCA 4R4CA 4Y7NH 1QG7A 2PQEA 1HA6A 4RG1A 4XTCS 3D4WA 3S17H 2O2LD 1TWAB 4A4IA 4RKLA 5C3EH 1I94Q 3D6WA 3S2DH 2F0JA 3HKSA 3NTHA 2KCNA 3G6JB 3I4NG 1K28A 1EYDA 4A75A 4B3TQ 3CKIB 2E2IB 5FKAC 1WJJA 2F0SA 5FLXE 1OXXK 1RD9D 1SSOA 3VA7A 1EY6A 2K33A 2A74C 4K5WA 5ELNA 3OTOL 4J8QA 1N33L 5D3DA 2XGTA 1AP0A 1KC8C 4PQXA 3QR8A 2FMCA 4C2MH 1VQLA 1BBUA 4KY7A 4JCVE 5CV6A 2L11A 4LNQA 3KK7A 2AUJD 1IYUA 2G5DA 2UU9Q 4BY7G 3MHBA 4R8IA 2R92B 1SMYC 2WP8J 4KD3A 3ULPA 1YNJC 4IFDJ 1LT6D 4RFBA 1DOLA 1PYBA 2Y0SG 4JC0A 3NQTA 5KNCA 2JA8G 3HEJA 3X3NA 2F0TA 1OXVA 1MGSA 1Y1WH 3UE0A 3EIVA 1WOCA 4HJ8A 2J0TD 2B2WC 2PNRC 1G6PA 1IXRA 3GTJH 1CKMA 5GAEC 4OO1G 4WJ4A 1A15A 1NCVA 1IBML 1PYWD 2VB3X 2SNSA 2VUMH 1SYEA 2CCZA 4K0KL 5F2DA 1ENFA 4CDEC 1B9MA 5KNBA 1HR0Q 2PW5A 4RGNA 3CU7A 4ZLTF 4JI2L 5G3LD 2WB1B 4BBRG 1TWGB 4BY1H 5IYDG 3SK4A 1MJEA 1NAPA 2JE6I 4JV5L 1WTHA 5C5MA 4O0AA 3VA5A 3MXGA 4X3UA 1PFBA 4DR3L 4JBMA 2E76C 4XXEA 1JQYD 2Z4IA 2B2VC 2VQEL 1I3QH 4IUVA 4GOPB 1QWYA 2IJ0A 1UE5A 2NTSA 5CMDA 1RDPD 1B44D 4JBKA 2MP1A 4HCEA 3GTKB 2F0UA 4R9WA 4QF4A 2GVBA 1CM9A 2AKWB 3S24A 3MTSA 2Z0SA 5IGDA 4C3JH 4DUZQ 3GTLH 1KQSA 3S1NB 1FD7D 2NTTA 2DY8A 2JQOA 4FF2A 1CHPD 1Q1BA 3S1QH 2E74C 4KD4A 3GV3A 4A3GH 5IP7G 4KV6A 5C44B 4DV2Q 1ICFB 1YZ6A 1SFOH 2IX1A 1XX8A 1H9KA 1HCZA 2QEJC 4DR5L 4WRDA 2N88A 4DK6C 3I55A 5IGGA 3BJUA 5LMUQ 2A6EC 3T1YQ 3GTOH 5I6YA 1BCPC 5M9OA 3GD7A 5EJWA 1I50H 3K6OA 3M4OB 1HA5A 1GD7A 5JJLA 1GUNA 1D5XC 2LKVA 1Q82C 5IOCA 3U4ZA 2UUAL 2PMZB 1R4QB 5E4WC 1FGUA 1CKNB 4C56C 2VXWA 2ZM6Q 3HOVB 3O13A 4KY6A 1PZJD 3SDZA 1A6XA 3CXCA 1K73C 4IQZA 5ISRA 4GOPA 1H9MA 1LTGD 2LSSA 2RSOA 2AUKA 4IPHA 4K8JA 4A3DH 4JOIA 2JA7B 1EYAA 3RN5A 4IFDI 5IGFA 2QCPX 3R2TA 3E3XA 1VQ9A 1UWVA 3TQYA 3GO5A 5C0XG 2BH2A 1EOTA 1B2TA 2OF1A 5CORA 3NUCA 2N8NA 2PI2E 3PF5A 3PO3G 4DV1L 2PQAA 4QGUA 2EY2A 3JAMi 3ULJA 1ILQA 4DXGA 2C35B 5DAUA 3PUYA 1TWCH 1NR2A 1V1PB 3K5LA 4R4OA 1A8VA 4ODGA 4WORA 4ID6A 5BR8Q 3DWPA 1WFQA 1Q90A 5E4XA 1X9NA 1UNSA 4JW0A 5T1GA 3J81E 1SJHD 4A3FG 1KDCA 1NMFA 5TSSA 3H15A 1QOHA 1SNOA 1TU2B 3JAML 2HD3A 3M4QA 2D0PA 4P71A 1RTOA 4HIDA 5EKKA 4EVOA 2ALYB 2F4VQ 5I2XA 4ZUJA 4TKOB 3CC2A 1ET9A 3D6CA 4BY7H 4JI0L 2CQAA 2Q2IA 1CKNA 3CAMA 1P8LA 1WTWA 1SRUA 3HOWH 1TT2A 2L0CA 4BBSG 1WTXA 4IZ8A 5IY0A 4DAPA 1SNQA 2OT2A 1Q86C 3M3YB 5KRUA 1LM0A 2YU9H 2JA8H 4C3IB 3S14B 2E2HH 3NWSA 4KY5A 2ZTCA 1CSPA 1Q81C 3X3MA 5L37A 2KHJA 2OEOA 4KI0A 3URYA 4A3EB 1S40A 1RIPA 2B2TC 3PO2H 1X6OA 4FXKC 5IIFA 3WDNA 2ZTDA 2K05A 2F0OA 3LNNA 3MAQA 2EE1A 1PTOC 4RGOS 1ESRA 4F88A 1E2ZA 1IL8A 5IGCA 4ABNA 5CGKA 3CD6A 2JA6G 4BBRH 5CC4A 3GTGB 5EPJA 4QL5A 3KBXA 1V1PA 4IN3A 3FKIG 3G4SA 1PTOH 3VR2A 4BXXG 4PZ7A 1E3PA 2SEBD 1UEAB 4B3TL 4X65Q 5C4JB 2KUMA 4GN4B 3QIAA 4LF7Q 4HSVA 4LF4Q 2KENA 1Q8IA 1EFID 5LMNQ 3KFUA 1VQFA 4R4QA 2NVTB 1I6HB 1U4LA 3OSOA 2WKCA 2O5IC 5LHY1 3M7NA 5BN4A 4TSSA 2D2CC 1PH7A 3W5OA 2UU9L 3T56B 3TN2A 1QVFA 2F0QA 2ZXPA 1TS2A 3E6ZX 5M5XH 2B63B 5IYCG 4NKLA 5M5WB 1TR5A 3SEBA 3BYTB 1GHKA 5COYA 5J1ZA 5CV4A 4C3HH 5C4ZA 2L5TA 4DF7A 5DEHA 1HTPA 1HQRD 4LF8Q 2R6GA 3OPOA 3DLLA 3OTOQ 1EYCA 3I70A 5A2QL 2F0IA 3I72A 1N33Q 2CFMA 2B29A 1WTVA 4A3IG 2M00A 2NVXB 5EAYA 1H9RA 1SN8A 1VQ4A 2EVBA 5FK9C 1VQOA 2FMMA 1PDQA 3G6EA 1J6QA 5IP9H 1LABA 2R93G 3BYYB 1RCVD 5EBDA 2F0FA 2AHOB 1X3EA 3H0GB 4NP5A 4JI4L 1KAWA 4ZUIA 4A3BH 2BCOA 3J7AV 4UP8A 4DKAC 2WAQE 4FF3A 2JSOA 1R9TB 4ZKCB 4GKKQ 3EBEA 4PZ8A 2KVMA 1IBMQ 4K0KQ 1Y8NB 3GTMH 5D3IB 2XN9C 1U4PA 3BZCA 1DYQA 2DY7A 3ND8A 4FP5D 3UDFA 3A8IE 4B3RL 4OXPA 4IPGA 5JPNC 4PV1C 5C0XH 4KN7C 4JI2Q 1TS3A 1GUWA 2BE5D 1Y1VB 1HUMA 1YI2A 3CCQA 1WTOA 1I4HA 3MWYW 1K83B 2HHHQ 2G9DA 2F1MA 2XVSA 1DM0B 2X6LA 1SYBA 1EOVA 1ZYRD 3AMUA 1DZ1A 1KNEA 2NZHA 2YTXA 3QOJA 4KJOA 2IHEA 2JA5G 1QE6A 4X6AH 2A6HD 1WCMB 5FJ8G 2B2YA 5CBAE 3K59A 1FVIA 1D5MC 1GOZA 1T9HA 2L9HA 2PZTA 3T1YL 1BF4A 1AE2A 1STBA 1EEID 3K7UC 5GQOA 3TS2A 4A3LH 4OHJA 2D0OA 4A3FH 3RLNA 1PRTC 2Q8RE 3NQIA 1XTCD 2B8FA 4LWCA 5I4DA 1Q1EA 3ITPA 1TVXA 1XJVA 1JMCA 4A3CH 3Q0AA 2EIFA 4C1NI 2L12A 2K52A 3JC66 2ZM6L 3KF8B 3ER0A 3P20A 3AU7A 2IWHA 5JPMC 4KHPQ 1PH8A 3DM3A 1LLRD 1CTMA 4X3KA 1FNWA 4BBSH 3TREA 4DR5Q 3BG3A 1IL2A 1KTKA 4AIMA 5FLMH 2F0NA 1JB7A 1KDAA 2A73B 1GUSA 4OWWB 2MO1A 3A55A 1I4QA 3BDLA 4ME3A 1K0RA 1EWHA 5D14A 1TKWB 1TY2A 2PI2A 4N9PA 1FGBD 1EIGA 2RHQB 1DOKA 1JOKA 2ICIA 3NTIA 4EQOA 2KEEA 5FO8B 2UUAQ 2B39A 2K5QA 5C4HA 2WAQG 3NWTA 2NZ1D 1Y8OB 2RDHA 2XRSD 3HOZB 5C4XB 1EY5A 1U5KA 5LL6S 3CC4A 3CCUA 2NN6G 4PNYA 4BS9A 4GNXC 4A3MG 1K8GA 4P74A 4HJ5A 2I5MX 3C2PA 3FKIH 1ZXTA 4R4TA 2JN4A 4BXXH 4J6HA 4Y7NB 3MEFA 3PIP3 4RHRA 4MTNA 2GA4B 1B9NA 2HCCA 1KHIA 2C5CA 1N9WA 3S17B 1SYGA 1I4RA 1S4ZA 1VQIA 5C3EB 3NSWA 1WD1A 2PPBC 1Z6HA 3S2DB 4G4KA 3Q24A 2X6GA 2RDFA 2DNEA 3MZ5A 3PUVA 4A3JG 3TEHB 2R7ZG 2AMCB 3VYRA 1K8OA 2KHSA 3GQBA 1JCKB 4LF9L 2Z6KC 4AYBB 1EWCA 3KF8A 2K5VA 2GN5A 3RMHA 4PMBA 1VQPA 2PW7A 3S15H 2EYFA 1CZGA 2EQSA 3A74A 4C2MB 1ZEQX 4DAMA 3AFPA 4HMJA 5C0XJ 4I65A 1NSNS 1L0XB 2MQHA 3LWUA 3CC7A 5E7NA 5KYIA 2X69A 4KJNA 4A3IH 4OO1I 1G291 3FPUB 4RA8A 4JI1Q 5NUCA 2JXMB 3D8GA 2R92G 3U58A 3I3CA 1XPUA 4L6TB 2OCEA 1Y1WB 1HNXQ 2HIXA 3NP8A 1OXUA 3SGIA 1L0WA 4JI0Q 5BN5A 3S2HH 2PMZE 2A1AA 2R93H 2F0GA 2AQ3B 2A8VA 2VUMB 3SVMA 4J1MA 1JWSD 4XYOA 4X65L 2R3ZA 1B4OA 3S16H 2HCIA 5M3FG 2NVQH 1CI3M 4B9WA 4LF7L 2K75A 4K2LA 4LF4L 3EVQA 4OIKA 1JWMD 1CT1D 1O80A 4QCLA 4BY1B 5LMNL 2KCCA 4OGQC 1QZHA 1MD2D 2WB1G 2BDNA 1LTBD 4S3SA 3ZJYC 4OWXB 4CKEA 2Z6BA 1I5FA 3I73A 3NEMA 4F8MA 1I3QB 2JEAI 1EY4A 4LMQD 1ASYA 1SXTA 3U4VA 2BA1A 4Q5VA 2XSCA 4HMIA 5EBCA 4CDFC 4IUTA 5ELBA 3S1RH 1QVGA 3VYUA 1QCBD 4QIWB 4C3JB 2Z4HA 4LF8L 3GTLB 1HRJA 5CV8A 4JI7L 1WTPA 4FXGC 2RHSB 5A35A 4EX5A 3BVGA 4GLXA 1FR3A 3BDOA 3BZKA 3S1QB 4DV0L 1K3BC 3VR6A 2IX0A 3PSIA 3ND9A 4A3GB 2AQ1B 3FP9A 3UDIA 4HIOA 2KECA 2YTYA 3KF6B 1IW7D 1SFOB 4XQQA 2YYZA 4CJ0B 4QMGA 3J80c 1V9PA 3CMEA 4P75A 3OIQA 3V05A 4UP7A 1L2FA 3UDGA 4UPAA 2R7DA 1BNZA 1ET6A 3PUXA 3GTOB 3EJIA 2NWGA 1FNUA 1TWFB 2FHTA 3K80C 1I50B 5IYBG 1STAA 1D6EC 4GKKL 2ES2A 5ELOA 1V1QA 1TWHB 1JR0D 5M3MH 2IHFA 4FVMA 1PH4A 2KHIA 2ZTEA 2OTLA 4RGMA 3I56A 2AQ2B 5HURA 1EFWA 2I0QA 1L1OC 2PYKA 4IJHA 4RCOA 4YHHQ 3W1BA 1J5EQ 1CFMA 1JOQA 1W6JA 3R3OA 2QW7A 3F8TA 5FOBB 5C0XI 3T1HL 5CR3A 3K7AH 4NXML 3HOVG 1E7ZA 2WKDA 2NUCA 3T4AC 5FLXL 2SOBA 4A3DB 5JJIA 2HHHL 4JI4Q 1HZBA 4EQ5A 1ML0D 3L0OA 1X56A 1LT3D 2NN6H 5C6AA 1CQFA 3AYHB 4B9XA 2J4XA 5KEEA 2JA7G 2CVRA 1RL2A 4A3MH 1JICA 1HR0W 1GUGA 1ONLA 4QJFA 1X3QA 1XPOA 1IZ6A 5GAGC 5DNFA 4IO9A 1CUKA 2RQXA 3L7ZC 3L2PA 2NVYH 4HN7A 4PG3A 4NMZA 5DM73 2F0WA 3G48A 4HAEA 1PH9A 4POFA 3K58A 2MHVA 4B3RQ 2L1BA 1TWCB 3KF6A 1SDFA 4U673 4AH6A 1AH9A 4K5XA 2KQ3A 1I4PA 3OMCA 4EQNA 3HOYH 2LFNA 3A0JA 1MHWC 4A3JH 1PV4A 1RKNA 1YNXA 3TP7A 3AQQA 2R7ZH 5JJKA 1JT8A 4XT1B 2EOTA 4X3TA 4YCVA 2EZVA 4KHPL 1XWEA 2I07B 3PMFA 4FF1A
chains in the Genus database with same CATH topology
2E5LQ 1UE7A 5LMUL 4LF6L 3CD6A 1L1OB 2JA6G 1YJNA 1E1OA 4BBRH 1PFSA 3AEVA 3S2HH 4DPGA 3TS0A 1H95A 3CPFA 1X65A 1A0IA 2H5XA 3HOXG 1EYGA 2N3SA 4QL5A 4A3DG 3CCSA 3FKIG 3G4SA 2KBNA 2ZJQA 4BXXG 4PZ7A 1E3PA 4DAYB 1E22A 4B3TL 1N32L 4X65Q 4DUYQ 1SLJA 1Z9FA 4GN4B 1PH6A 2NVXH 1PH1A 1KL9A 3RZDH 4LF7Q 1YHBA 1VQ6A 4LF4Q 1N8RC 4JG2A 2KENA 1K3RA 4JI6L 1S72A 5LMNQ 3KFUA 4JI5Q 4DR6Q 1VQFA 4R4QA 1OTCA 3M85A 3PV0A 4TQUS 5AJ3Q 2DGYA 4DV3L 1JJGA 3Q8DA 4HIMA 5M5YH 1GM5A 2JA5H 3M7NA 5M3MG 5FJ8H 3E0EA 1PH7A 2OTJA 4DK3C 3W5OA 2AWOA 4YWLA 2UU9L 4LFBQ 1EWIA 4B3SL 5H1SE 3H0GH 1QVFA 4RMFA 3CCMA 3D31A 4DV5L 1HH2P 1LUZA 2MO0A 3K0XA 5M5XH 5IYCG 3TRZA 4A3EG 1XMOQ 1M90C 1FL0A 1R9TH 4L5SA 1C9OA 2D62A 2K14A 4UP9A 4OONA 5M3FH 1PYSB 1AE3A 1A63A 5C44G 4C3HH 1C0AA 1EQQA 1W3SA 2N78A 3K81C 2UXDL 5HGQA 4DR1L 3KLWA 1JJCB 4NXNL 4LF8Q 2R6GA 2WB1E 3DLLA 4LFAL 3OTOQ 3I4OA 3NBHB 4L5TA 1N33Q 3HKZG 2CFMA 4A3KG 2B29A 4A3IG 2N49A 4GOPC 3STBD 3D0FA 5EAYA 1WI5A 1Y1VH 1EQRA 2Q2HA 1G51A 1SN8A 3HOWG 4JOIC 5BR8L 4ALPA 4A76A 2VQFQ 1VQ4A 1XNRQ 2Z6KA 4NB3A 4OX9Q 1K83H 4DV4Q 4YWMA 2I5HA 1VQOA 3G6EA 1NE3A 1J6QA 1VQBA 3I4NH 2HIVA 3GTQH 5IP9H 1PH2A 1L1OA 2R93G 5JEAJ 2CQOA 2MNAA 3I7FA 2QEXA 3LGJA 2AHOB 1X3EA 4DR4Q 4DNIA 4HJAA 4JI4L 1KAWA 2GVAA 3M9BA 4A3BH 1XNQL 1WCMH 4UP8A 4DKAC 4DV1Q 4DR4L 2WAQE 1UE6A 2F4VL 3HOYG 1N36Q 3PO2G 2HT1A 1YITA 4KHZA 4JI1L 1K9MC 1SMXA 4KLKA 2QA4A 2EXDA 4GKKQ 4X66L 2B63G 4JI8L 3EBEA 3MXNB 4PZ8A 4GS3A 4YWKA 1XMQL 1IBMQ 3PF4A 1HNXL 2F3IA 3KJOA 3U50C 4YCWA 4K0KQ 4LF9Q 3HFZB 3F2CA 3GTMH 3HOUG 1IBLQ 1HNZQ 3BZCA 2Q2UA 3UDFA 2PNHA 1X3GA 4B3RL 4OXPA 4IPGA 4JI2Q 3NENA 3E9IA 3I4MG 3EN2A 4QQBX 4DR2Q 4DV7L 1YI2A 3RLFA 2DUDA 1KRTA 1XPRA 4LFCL 3CCQA 2WFWA 2CWPA 2UUBQ 3OYYA 3RR5A 1K8AC 4A93G 1GKHA 2HHHQ 2ATWA 2UXCL 4GKJQ 1E24A 3J81i 1JE5A 5IYBH 1UE1A 4X62Q 3AFQA 1TWAH 1EOVA 3J7A5 4JBJA 4IJLA 4X64L 1HJPA 2NZHA 2YTXA 4H02A 4AQYL 1NY4A 1S3OA 1NJIC 4BA2I 1IYJB 2IHEA 2JA5G 1MKHA 4JBWA 1N34Q 4LUZA 5FJ8G 1W2BA 1D8LA 2E2IH 4IOAA 4X6AH 1VQMA 1FVIA 1T9HA 4HIKA 3VDYA 3T1YL 4GN3B 1AE2A 2KCMA 2LXJA 2B3GA 3K7UC 5GQOA 1A62A 3TS2A 3UDXA 1YJ9A 2D0OA 4A3FH 4A3LH 3RLNA 1XTDA 1UEBA 4JYAL 5IYDH 2PQAB 2JJQA 4YY3L 1B70B 1YBYA 1Q8KA 1VQ8A 3HOZH 1HZAA 3F1ZA 5C4XH 4LWCA 3ICEA 1Q1EA 1VQAA 5IWAQ 2UUCL 4P73A 4JI3Q 3H3VI 2F52A 3K8AA 4JI5L 4DV6Q 1XJVA 1JMCA 4DR6L 4A3CH 2EIFA 4HJ9A 2JEBI 4IOCA 3CCVA 2R92H 2K52A 3JC66 4O2DA 1HZCA 3ER0A 3KF8B 3KJPA 4R1JA 2ZM6L 4Y7NH 4R4CA 3DM3A 3RN2A 1PH8A 1VQKA 4RG1A 1GO3E 1Z47A 1CKOA 4XTCS 5HY6A 3TREA 4AIMA 4DR5Q 1IL2A 4BBSH 5FLMH 4LFBL 1X3FA 3S17H 3CCRA 1JB7A 2OWOA 1DGSA 4A4IA 4OWWB 5C3EH 1TWFH 1Q7YC 1D7QA 1I94Q 2AWNA 2MO1A 3S2DH 3HKSA 3PUWA 1ASZA 3I4NG 1YVCA 5IP9G 4ME3A 1K0RA 4A75A 4B3TQ 1N32Q 5JEAG 2PI2A 1WJJA 1TWHH 1OXXK 2E2JH 1FJGQ 4AYBE 5LMNW 5ELNA 2RHQB 3S1MH 3OTOL 4A3BG 5IP7H 1HNWQ 1WCMG 2UUAQ 1N33L 2QGQA 2HQLA 4UY8C 1PH3A 1BBWA 2XGTA 5FLXc 2WAQG 2YV5A 2CWAA 1KC8C 4JI7Q 3JAMc 1PH5A 1U5KA 4C2MH 1VQLA 1SR3A 1VQJA 1BBUA 1TWGH 4DV3Q 3CC4A 1QUQB 4GN5A 4JCVE 3CCUA 2NN6G 4GNXC 4LNQA 2UU9Q 4DV0Q 2YTVA 3BU2A 2VQFL 3HOXH 4A3MG 1K8GA 2RF4A 3CCLA 4B3SQ 3STBC 4DV4L 4P74A 4HJ5A 2I5MX 3FKIH 4DV5Q 4R4TA 2WP8J 4BXXH 3ULPA 4IFDJ 2ZJRA 2ZJPA 3MEFA 3CW2C 1PYBA 1SE8A 4YHHL 4MTNA 2Y0SG 1J5EL 4JC0A 2JA8G 1KHIA 1N9WA 2VY3A 3IRBA 1OXVA 1VQIA 1Y1WH 3UE0A 3EIVA 3GTKH 2R7FA 1WOCA 4NXNQ 4HJ8A 1N36L 1G6PA 3B6YA 1IXRA 3GTJH 1CKMA 5GAEC 4LW1A 1VQCA 2KCTA 4OO1G 1YHAA 5JJKA 2I5LX 3PUVA 1PA6A 4OWTB 4LF5Q 4A3JG 3TEHB 1IBML 4WJ4A 2R7ZG 2AMCB 3J81j 4POGA 3S1NH 2VUMH 2NN6I 3F2BA 2CCZA 1BKBA 3GTPH 4LF9L 4K0KL 2Z6KC 2MFIA 4BY7G 2K5VA 2GN5A 1HR0Q 3KYHC 4B3ML 2NZOA 1VQPA 3S15H 4JI2L 2UXBL 2EQSA 3A74A 4BBRG 4A3LG 2VNUD 5C44H 4DAMA 3AFPA 4DR7Q 4PZ6A 4BY1H 5IYDG 5C0XJ 1V43A 2JA9A 3CP0A 2JE6I 1MJEA 4JV5L 4TVAB 2MQHA 2IY5B 3CC7A 1VQDA 3T1HQ 4O0AA 4NXMQ 4GKJL 5E7NA 3A5UA 2VS1A 4DR3L 1PHJA 4JBMA 1U0LA 3PO3H 2FXQA 4J15A 1B7YB 4A3KH 4A3CG 1KD1C 4YCUA 1I3QH 2VQEL 1G291 4A3IH 4OO1I 4JI1Q 1IBKL 4GNXB 4GOPB 3U58A 2R92G 1UE5A 5GROA 4X66Q 1XPUA 2OCEA 4JI8Q 3RNUA 1EIYB 1N34L 1HNXQ 2HIXA 4JBKA 1OXUA 3SGIA 1L0WA 2E5LL 4JI0Q 5FLMG 2GVBA 3M4OH 3PUZA 4IPDA 4QIWE 2CKZB 3PCOB 1VQHA 2PMZE 2AKWB 2RCNA 3S24A 2ASBA 2Z0SA 1MIUA 1QUQA 5C3EG 4C3JH 2A1AA 4DUZQ 2R93H 4MZ9A 3H0GG 2BH8A 3GTLH 3KDFB 3RLOA 1KQSA 3PIPA 1Y14B 2NVTH 2A8VA 2E8GA 2JQOA 3HOVH 1MJCA 4X65L 1Q1BA 4DUYL 3S16H 1KIXA 1EIFA 4JI3L 5IWAL 5M3FG 3CCEA 2NVQH 3S1QH 4LF7L 2UXCQ 2K75A 5K36G 1B8AA 4LF4L 5IP7G 4AYBG 4A3GH 1VQ5A 4DV2Q 2OQKA 5LMNL 1YZ6A 1SFOH 4X64Q 1QZHA 2IX1A 4AQYQ 2JA7H 4DR5L 4APVA 2WB1G 5AJ3L 1VQGA 1LYLA 3ZJYC 3CF5A 4DK6C 3I55A 2K4KA 3HOUH 4OWXB 3NELA 3NEMA 1I5FA 4GLAC 1KRSA 1TXYA 1YJWA 2LXKA 3CMAA 1I94L 3BJUA 1Y1VG 5LMUQ 1ASYA 4LF6Q 2JEAI 3CQZH 3T1YQ 3GTOH 3I4MH 3U4VA 4IFDG 1XMOL 4JYAQ 2BA1A 3OW2A 3GD7A 1YHQA 4YY3Q 1I50H 1FJGL 4A93H 2XTIA 3S1RH 3H3VH 1GD7A 1QVGA 5JJLA 3RZOH 1Q82C 1Y1WG 1HNWL 3U4ZA 2UUCQ 2UUAL 4Y52H 3PO2H 4LF8L 1FGUA 3G71A 1X55A 1CKNB 1VCIA 4JI7L 4JI6Q 2RHSB 1VQ7A 2ZM6Q 4BA1I 3I2ZA 4EX5A 1NTGA 4XIGS 1OXTA 4PMWA 3W1GA 4GLXA 3BZKA 4QY7A 3CXCA 4DV0L 1K73C 2IX0A 2VUMG 3PSIA 4FDBA 4GNXA 3FP9A 4GOPA 2JA6H 2LSSA 3UDIA 4HIOA 3ULLA 2YTYA 3KF6B 4IPHA 1XNRL 4OX9L 1NMGA 2YYZA 4A3DH 3UE1A 4JOIA 5GADC 2K5NA 3RN5A 1SROA 4IPCA 4IFDI 3J80c 1V9PA 1QZGA 3CMEA 4BY1G 4P75A 3PIOA 1C7YA 1VQ9A 1E1TA 1KXLA 4GLVB 1UWVA 4UP7A 3GO5A 3TQYA 5C0XG 3FHWA 2BH2A 1L2FA 1Q12A 2ID0A 1VQNA 3UDGA 3A5ZB 2R7DA 3KDFA 4UPAA 2N8NA 2PI2E 1EUJA 3PUXA 4HJ7A 3PF5A 2UXDQ 4DR1Q 3PO3G 4DV1L 1JJ2A 4LF5L 2PQAA 3K80C 4QGUA 4LFAQ 3JAMi 1BVSA 3ULJA 3M3YH 2C35B 5IYBG 3E9HA 4GKKL 2ES2A 5ELOA 4C3IH 1M1KC 3S14H 1V1QA 3PGZA 3PUYA 5M3MH 2IHFA 1TWCH 2BA0A 1HR0L 1O7IA 2V1CC 1PH4A 2KHIA 2ZTEA 4R4OA 2OTLA 1A8VA 4L5RC 1CSQA 2JK8A 2OQ0A 3M4PA 3J80i 5BR8Q 3J7ZC 1HNZL 5IYCH 1WFQA 3I56A 1IBLL 4DR7L 2K5HA 1P16A 4A3EH 1HZ9A 1X9NA 1EFWA 1L1OC 4IJHA 4L5QA 4YHHQ 2I0QA 1PVOA 3W1BA 1J5EQ 5DLQE 1OXSC 4DR2L 3CPWA 3F8TA 5C0XI 3T1HL 4A3FG 4NXML 3K7AH 3HOVG 1NMFA 3GDEA 3H15A 1WYDA 2UUBL 3HOZG 1E7ZA 1QVCA 5C4XG 5JJIA 2HHHL 4JI4Q 1HZBA 3HKZE 4EQ5A 4A3GG 1XNQQ 3M4QA 4P71A 2D0PA 4X62L 3J81c 4HIDA 4P72A 1VQEA 2ALYB 3L0OA 2F4VQ 3GTGH 1LTLA 1X56A 4NPSA 3CC2A 3ERSX 1YIJA 2Q2TA 3AYHB 5IT9c 2JA7G 1RL2A 4JI0L 4BY7H 4A3MH 2Q2IA 1HR0W 4WJ3M 1VS0A 1CKNA 3CAMA 1P8LA 4QJFA 1SRUA 1XPOA 1XMQQ 1IZ6A 5GAGC 3HOWH 3F2DA 5C4JH 4BBSG 2L15A 2Y0SE 1CUKA 4DUZL 5IY0A 4IO9A 4B3MQ 3L7ZC 4LUOA 3L2PA 2NVYH 4PG3A 3WWVA 1Q86C 1YEZA 2A19A 2UXBQ 1GVPA 1LM0A 2VZAA 3G48A 4MNOA 2YU9H 1NBWA 2JA8H 1PH9A 4POFA 4R4IA 4B3RQ 2E2HH 2K50A 5IE8A 4JV5Q 1Q46A 3KF6A 2ZTCA 1I6HH 1CSPA 2IT1A 5J3BA 4LUVA 1Q81C 4AH6A 4DV7Q 1AH9A 2KHJA 4LFCQ 4KI0A 4DR3Q 5GAHC 4DV2L 1S40A 3HOYH 4KHPQ 1RIPA 3A0JA 4DV6L 4A3JH 1PV4A 2VQEQ 1YNXA 2VW9A 1X6OA 2VL6A 3AQQA 1IBKQ 2R7ZH 1JT8A 2ZTDA 4YCVA 2B63H 5M5WH 4KHPL 3CCJA 1X54A 3KOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L Q;  1UE7 A;  5LMU L;  4LF6 L;  3CD6 A;  1L1O B;  2JA6 G;  1YJN A;  1E1O A;  4BBR H;  1PFS A;  3AEV A;  3S2H H;  4DPG A;  3TS0 A;  1H95 A;  3CPF A;  1X65 A;  1A0I A;  2H5X A;  3HOX G;  1EYG A;  2N3S A;  4QL5 A;  4A3D G;  3CCS A;  3FKI G;  3G4S A;  2KBN A;  2ZJQ A;  4BXX G;  4PZ7 A;  1E3P A;  4DAY B;  1E22 A;  4B3T L;  1N32 L;  4X65 Q;  4DUY Q;  1SLJ A;  1Z9F A;  4GN4 B;  1PH6 A;  2NVX H;  1PH1 A;  1KL9 A;  3RZD H;  4LF7 Q;  1YHB A;  1VQ6 A;  4LF4 Q;  1N8R C;  4JG2 A;  2KEN A;  1K3R A;  4JI6 L;  1S72 A;  5LMN Q;  3KFU A;  4JI5 Q;  4DR6 Q;  1VQF A;  4R4Q A;  1OTC A;  3M85 A;  3PV0 A;  4TQU S;  5AJ3 Q;  2DGY A;  4DV3 L;  1JJG A;  3Q8D A;  4HIM A;  5M5Y H;  1GM5 A;  2JA5 H;  3M7N A;  5M3M G;  5FJ8 H;  3E0E A;  1PH7 A;  2OTJ A;  4DK3 C;  3W5O A;  2AWO A;  4YWL A;  2UU9 L;  4LFB Q;  1EWI A;  4B3S L;  5H1S E;  3H0G H;  1QVF A;  4RMF A;  3CCM A;  3D31 A;  4DV5 L;  1HH2 P;  1LUZ A;  2MO0 A;  3K0X A;  5M5X H;  5IYC G;  3TRZ A;  4A3E G;  1XMO Q;  1M90 C;  1FL0 A;  1R9T H;  4L5S A;  1C9O A;  2D62 A;  2K14 A;  4UP9 A;  4OON A;  5M3F H;  1PYS B;  1AE3 A;  1A63 A;  5C44 G;  4C3H H;  1C0A A;  1EQQ A;  1W3S A;  2N78 A;  3K81 C;  2UXD L;  5HGQ A;  4DR1 L;  3KLW A;  1JJC B;  4NXN L;  4LF8 Q;  2R6G A;  2WB1 E;  3DLL A;  4LFA L;  3OTO Q;  3I4O A;  3NBH B;  4L5T A;  1N33 Q;  3HKZ G;  2CFM A;  4A3K G;  2B29 A;  4A3I G;  2N49 A;  4GOP C;  3STB D;  3D0F A;  5EAY A;  1WI5 A;  1Y1V H;  1EQR A;  2Q2H A;  1G51 A;  1SN8 A;  3HOW G;  4JOI C;  5BR8 L;  4ALP A;  4A76 A;  2VQF Q;  1VQ4 A;  1XNR Q;  2Z6K A;  4NB3 A;  4OX9 Q;  1K83 H;  4DV4 Q;  4YWM A;  2I5H A;  1VQO A;  3G6E A;  1NE3 A;  1J6Q A;  1VQB A;  3I4N H;  2HIV A;  3GTQ H;  5IP9 H;  1PH2 A;  1L1O A;  2R93 G;  5JEA J;  2CQO A;  2MNA A;  3I7F A;  2QEX A;  3LGJ A;  2AHO B;  1X3E A;  4DR4 Q;  4DNI A;  4HJA A;  4JI4 L;  1KAW A;  2GVA A;  3M9B A;  4A3B H;  1XNQ L;  1WCM H;  4UP8 A;  4DKA C;  4DV1 Q;  4DR4 L;  2WAQ E;  1UE6 A;  2F4V L;  3HOY G;  1N36 Q;  3PO2 G;  2HT1 A;  1YIT A;  4KHZ A;  4JI1 L;  1K9M C;  1SMX A;  4KLK A;  2QA4 A;  2EXD A;  4GKK Q;  4X66 L;  2B63 G;  4JI8 L;  3EBE A;  3MXN B;  4PZ8 A;  4GS3 A;  4YWK A;  1XMQ L;  1IBM Q;  3PF4 A;  1HNX L;  2F3I A;  3KJO A;  3U50 C;  4YCW A;  4K0K Q;  4LF9 Q;  3HFZ B;  3F2C A;  3GTM H;  3HOU G;  1IBL Q;  1HNZ Q;  3BZC A;  2Q2U A;  3UDF A;  2PNH A;  1X3G A;  4B3R L;  4OXP A;  4IPG A;  4JI2 Q;  3NEN A;  3E9I A;  3I4M G;  3EN2 A;  4QQB X;  4DR2 Q;  4DV7 L;  1YI2 A;  3RLF A;  2DUD A;  1KRT A;  1XPR A;  4LFC L;  3CCQ A;  2WFW A;  2CWP A;  2UUB Q;  3OYY A;  3RR5 A;  1K8A C;  4A93 G;  1GKH A;  2HHH Q;  2ATW A;  2UXC L;  4GKJ Q;  1E24 A;  3J81 i;  1JE5 A;  5IYB H;  1UE1 A;  4X62 Q;  3AFQ A;  1TWA H;  1EOV A;  3J7A 5;  4JBJ A;  4IJL A;  4X64 L;  1HJP A;  2NZH A;  2YTX A;  4H02 A;  4AQY L;  1NY4 A;  1S3O A;  1NJI C;  4BA2 I;  1IYJ B;  2IHE A;  2JA5 G;  1MKH A;  4JBW A;  1N34 Q;  4LUZ A;  5FJ8 G;  1W2B A;  1D8L A;  2E2I H;  4IOA A;  4X6A H;  1VQM A;  1FVI A;  1T9H A;  4HIK A;  3VDY A;  3T1Y L;  4GN3 B;  1AE2 A;  2KCM A;  2LXJ A;  2B3G A;  3K7U C;  5GQO A;  1A62 A;  3TS2 A;  3UDX A;  1YJ9 A;  2D0O A;  4A3F H;  4A3L H;  3RLN A;  1XTD A;  1UEB A;  4JYA L;  5IYD H;  2PQA B;  2JJQ A;  4YY3 L;  1B70 B;  1YBY A;  1Q8K A;  1VQ8 A;  3HOZ H;  1HZA A;  3F1Z A;  5C4X H;  4LWC A;  3ICE A;  1Q1E A;  1VQA A;  5IWA Q;  2UUC L;  4P73 A;  4JI3 Q;  3H3V I;  2F52 A;  3K8A A;  4JI5 L;  4DV6 Q;  1XJV A;  1JMC A;  4DR6 L;  4A3C H;  2EIF A;  4HJ9 A;  2JEB I;  4IOC A;  3CCV A;  2R92 H;  2K52 A;  3JC6 6;  4O2D A;  1HZC A;  3ER0 A;  3KF8 B;  3KJP A;  4R1J A;  2ZM6 L;  4Y7N H;  4R4C A;  3DM3 A;  3RN2 A;  1PH8 A;  1VQK A;  4RG1 A;  1GO3 E;  1Z47 A;  1CKO A;  4XTC S;  5HY6 A;  3TRE A;  4AIM A;  4DR5 Q;  1IL2 A;  4BBS H;  5FLM H;  4LFB L;  1X3F A;  3S17 H;  3CCR A;  1JB7 A;  2OWO A;  1DGS A;  4A4I A;  4OWW B;  5C3E H;  1TWF H;  1Q7Y C;  1D7Q A;  1I94 Q;  2AWN A;  2MO1 A;  3S2D H;  3HKS A;  3PUW A;  1ASZ A;  3I4N G;  1YVC A;  5IP9 G;  4ME3 A;  1K0R A;  4A75 A;  4B3T Q;  1N32 Q;  5JEA G;  2PI2 A;  1WJJ A;  1TWH H;  1OXX K;  2E2J H;  1FJG Q;  4AYB E;  5LMN W;  5ELN A;  2RHQ B;  3S1M H;  3OTO L;  4A3B G;  5IP7 H;  1HNW Q;  1WCM G;  2UUA Q;  1N33 L;  2QGQ A;  2HQL A;  4UY8 C;  1PH3 A;  1BBW A;  2XGT A;  5FLX c;  2WAQ G;  2YV5 A;  2CWA A;  1KC8 C;  4JI7 Q;  3JAM c;  1PH5 A;  1U5K A;  4C2M H;  1VQL A;  1SR3 A;  1VQJ A;  1BBU A;  1TWG H;  4DV3 Q;  3CC4 A;  1QUQ B;  4GN5 A;  4JCV E;  3CCU A;  2NN6 G;  4GNX C;  4LNQ A;  2UU9 Q;  4DV0 Q;  2YTV A;  3BU2 A;  2VQF L;  3HOX H;  4A3M G;  1K8G A;  2RF4 A;  3CCL A;  4B3S Q;  3STB C;  4DV4 L;  4P74 A;  4HJ5 A;  2I5M X;  3FKI H;  4DV5 Q;  4R4T A;  2WP8 J;  4BXX H;  3ULP A;  4IFD J;  2ZJR A;  2ZJP A;  3MEF A;  3CW2 C;  1PYB A;  1SE8 A;  4YHH L;  4MTN A;  2Y0S G;  1J5E L;  4JC0 A;  2JA8 G;  1KHI A;  1N9W A;  2VY3 A;  3IRB A;  1OXV A;  1VQI A;  1Y1W H;  3UE0 A;  3EIV A;  3GTK H;  2R7F A;  1WOC A;  4NXN Q;  4HJ8 A;  1N36 L;  1G6P A;  3B6Y A;  1IXR A;  3GTJ H;  1CKM A;  5GAE C;  4LW1 A;  1VQC A;  2KCT A;  4OO1 G;  1YHA A;  5JJK A;  2I5L X;  3PUV A;  1PA6 A;  4OWT B;  4LF5 Q;  4A3J G;  3TEH B;  1IBM L;  4WJ4 A;  2R7Z G;  2AMC B;  3J81 j;  4POG A;  3S1N H;  2VUM H;  2NN6 I;  3F2B A;  2CCZ A;  1BKB A;  3GTP H;  4LF9 L;  4K0K L;  2Z6K C;  2MFI A;  4BY7 G;  2K5V A;  2GN5 A;  1HR0 Q;  3KYH C;  4B3M L;  2NZO A;  1VQP A;  3S15 H;  4JI2 L;  2UXB L;  2EQS A;  3A74 A;  4BBR G;  4A3L G;  2VNU D;  5C44 H;  4DAM A;  3AFP A;  4DR7 Q;  4PZ6 A;  4BY1 H;  5IYD G;  5C0X J;  1V43 A;  2JA9 A;  3CP0 A;  2JE6 I;  1MJE A;  4JV5 L;  4TVA B;  2MQH A;  2IY5 B;  3CC7 A;  1VQD A;  3T1H Q;  4O0A A;  4NXM Q;  4GKJ L;  5E7N A;  3A5U A;  2VS1 A;  4DR3 L;  1PHJ A;  4JBM A;  1U0L A;  3PO3 H;  2FXQ A;  4J15 A;  1B7Y B;  4A3K H;  4A3C G;  1KD1 C;  4YCU A;  1I3Q H;  2VQE L;  1G29 1;  4A3I H;  4OO1 I;  4JI1 Q;  1IBK L;  4GNX B;  4GOP B;  3U58 A;  2R92 G;  1UE5 A;  5GRO A;  4X66 Q;  1XPU A;  2OCE A;  4JI8 Q;  3RNU A;  1EIY B;  1N34 L;  1HNX Q;  2HIX A;  4JBK A;  1OXU A;  3SGI A;  1L0W A;  2E5L L;  4JI0 Q;  5FLM G;  2GVB A;  3M4O H;  3PUZ A;  4IPD A;  4QIW E;  2CKZ B;  3PCO B;  1VQH A;  2PMZ E;  2AKW B;  2RCN A;  3S24 A;  2ASB A;  2Z0S A;  1MIU A;  1QUQ A;  5C3E G;  4C3J H;  2A1A A;  4DUZ Q;  2R93 H;  4MZ9 A;  3H0G G;  2BH8 A;  3GTL H;  3KDF B;  3RLO A;  1KQS A;  3PIP A;  1Y14 B;  2NVT H;  2A8V A;  2E8G A;  2JQO A;  3HOV H;  1MJC A;  4X65 L;  1Q1B A;  4DUY L;  3S16 H;  1KIX A;  1EIF A;  4JI3 L;  5IWA L;  5M3F G;  3CCE A;  2NVQ H;  3S1Q H;  4LF7 L;  2UXC Q;  2K75 A;  5K36 G;  1B8A A;  4LF4 L;  5IP7 G;  4AYB G;  4A3G H;  1VQ5 A;  4DV2 Q;  2OQK A;  5LMN L;  1YZ6 A;  1SFO H;  4X64 Q;  1QZH A;  2IX1 A;  4AQY Q;  2JA7 H;  4DR5 L;  4APV A;  2WB1 G;  5AJ3 L;  1VQG A;  1LYL A;  3ZJY C;  3CF5 A;  4DK6 C;  3I55 A;  2K4K A;  3HOU H;  4OWX B;  3NEL A;  3NEM A;  1I5F A;  4GLA C;  1KRS A;  1TXY A;  1YJW A;  2LXK A;  3CMA A;  1I94 L;  3BJU A;  1Y1V G;  5LMU Q;  1ASY A;  4LF6 Q;  2JEA I;  3CQZ H;  3T1Y Q;  3GTO H;  3I4M H;  3U4V A;  4IFD G;  1XMO L;  4JYA Q;  2BA1 A;  3OW2 A;  3GD7 A;  1YHQ A;  4YY3 Q;  1I50 H;  1FJG L;  4A93 H;  2XTI A;  3S1R H;  3H3V H;  1GD7 A;  1QVG A;  5JJL A;  3RZO H;  1Q82 C;  1Y1W G;  1HNW L;  3U4Z A;  2UUC Q;  2UUA L;  4Y52 H;  3PO2 H;  4LF8 L;  1FGU A;  3G71 A;  1X55 A;  1CKN B;  1VCI A;  4JI7 L;  4JI6 Q;  2RHS B;  1VQ7 A;  2ZM6 Q;  4BA1 I;  3I2Z A;  4EX5 A;  1NTG A;  4XIG S;  1OXT A;  4PMW A;  3W1G A;  4GLX A;  3BZK A;  4QY7 A;  3CXC A;  4DV0 L;  1K73 C;  2IX0 A;  2VUM G;  3PSI A;  4FDB A;  4GNX A;  3FP9 A;  4GOP A;  2JA6 H;  2LSS A;  3UDI A;  4HIO A;  3ULL A;  2YTY A;  3KF6 B;  4IPH A;  1XNR L;  4OX9 L;  1NMG A;  2YYZ A;  4A3D H;  3UE1 A;  4JOI A;  5GAD C;  2K5N A;  3RN5 A;  1SRO A;  4IPC A;  4IFD I;  3J80 c;  1V9P A;  1QZG A;  3CME A;  4BY1 G;  4P75 A;  3PIO A;  1C7Y A;  1VQ9 A;  1E1T A;  1KXL A;  4GLV B;  1UWV A;  4UP7 A;  3GO5 A;  3TQY A;  5C0X G;  3FHW A;  2BH2 A;  1L2F A;  1Q12 A;  2ID0 A;  1VQN A;  3UDG A;  3A5Z B;  2R7D A;  3KDF A;  4UPA A;  2N8N A;  2PI2 E;  1EUJ A;  3PUX A;  4HJ7 A;  3PF5 A;  2UXD Q;  4DR1 Q;  3PO3 G;  4DV1 L;  1JJ2 A;  4LF5 L;  2PQA A;  3K80 C;  4QGU A;  4LFA Q;  3JAM i;  1BVS A;  3ULJ A;  3M3Y H;  2C35 B;  5IYB G;  3E9H A;  4GKK L;  2ES2 A;  5ELO A;  4C3I H;  1M1K C;  3S14 H;  1V1Q A;  3PGZ A;  3PUY A;  5M3M H;  2IHF A;  1TWC H;  2BA0 A;  1HR0 L;  1O7I A;  2V1C C;  1PH4 A;  2KHI A;  2ZTE A;  4R4O A;  2OTL A;  1A8V A;  4L5R C;  1CSQ A;  2JK8 A;  2OQ0 A;  3M4P A;  3J80 i;  5BR8 Q;  3J7Z C;  1HNZ L;  5IYC H;  1WFQ A;  3I56 A;  1IBL L;  4DR7 L;  2K5H A;  1P16 A;  4A3E H;  1HZ9 A;  1X9N A;  1EFW A;  1L1O C;  4IJH A;  4L5Q A;  4YHH Q;  2I0Q A;  1PVO A;  3W1B A;  1J5E Q;  5DLQ E;  1OXS C;  4DR2 L;  3CPW A;  3F8T A;  5C0X I;  3T1H L;  4A3F G;  4NXM L;  3K7A H;  3HOV G;  1NMF A;  3GDE A;  3H15 A;  1WYD A;  2UUB L;  3HOZ G;  1E7Z A;  1QVC A;  5C4X G;  5JJI A;  2HHH L;  4JI4 Q;  1HZB A;  3HKZ E;  4EQ5 A;  4A3G G;  1XNQ Q;  3M4Q A;  4P71 A;  2D0P A;  4X62 L;  3J81 c;  4HID A;  4P72 A;  1VQE A;  2ALY B;  3L0O A;  2F4V Q;  3GTG H;  1LTL A;  1X56 A;  4NPS A;  3CC2 A;  3ERS X;  1YIJ A;  2Q2T A;  3AYH B;  5IT9 c;  2JA7 G;  1RL2 A;  4JI0 L;  4BY7 H;  4A3M H;  2Q2I A;  1HR0 W;  4WJ3 M;  1VS0 A;  1CKN A;  3CAM A;  1P8L A;  4QJF A;  1SRU A;  1XPO A;  1XMQ Q;  1IZ6 A;  5GAG C;  3HOW H;  3F2D A;  5C4J H;  4BBS G;  2L15 A;  2Y0S E;  1CUK A;  4DUZ L;  5IY0 A;  4IO9 A;  4B3M Q;  3L7Z C;  4LUO A;  3L2P A;  2NVY H;  4PG3 A;  3WWV A;  1Q86 C;  1YEZ A;  2A19 A;  2UXB Q;  1GVP A;  1LM0 A;  2VZA A;  3G48 A;  4MNO A;  2YU9 H;  1NBW A;  2JA8 H;  1PH9 A;  4POF A;  4R4I A;  4B3R Q;  2E2H H;  2K50 A;  5IE8 A;  4JV5 Q;  1Q46 A;  3KF6 A;  2ZTC A;  1I6H H;  1CSP A;  2IT1 A;  5J3B A;  4LUV A;  1Q81 C;  4AH6 A;  4DV7 Q;  1AH9 A;  2KHJ A;  4LFC Q;  4KI0 A;  4DR3 Q;  5GAH C;  4DV2 L;  1S40 A;  3HOY H;  4KHP Q;  1RIP A;  3A0J A;  4DV6 L;  4A3J H;  1PV4 A;  2VQE Q;  1YNX A;  2VW9 A;  1X6O A;  2VL6 A;  3AQQ A;  1IBK Q;  2R7Z H;  1JT8 A;  2ZTD A;  4YCV A;  2B63 H;  5M5W H;  4KHP L;  3CCJ A;  1X54 A;  3KOJ A; 
#chains in the Genus database with same CATH topology
 2E5L Q;  3MFG A;  4RGT A;  2CH4 W;  1UE7 A;  2IX3 A;  1LO5 D;  1YJN A;  1E1O A;  1J8I A;  1SYD A;  2QDL A;  3HKZ B;  4HED A;  3CPF A;  4ZYS A;  1TS5 A;  2H5X A;  3HOX G;  2F03 A;  1EY0 A;  2N3S A;  3IFD A;  4BY7 B;  5EKL A;  2ZJQ A;  4DAY B;  1I4G A;  1E22 A;  3HOW B;  4DUY Q;  1JOO A;  1Z9F A;  2F0E A;  3KLR A;  1EY9 A;  1PH1 A;  1KL9 A;  5BN3 A;  3RZD H;  2LY7 A;  2Y0S B;  3TZD A;  3I4L A;  2YU9 B;  2JA8 B;  1GJX A;  5ELD A;  1S72 A;  1H9S B;  2E2H B;  3QWN A;  3DXJ C;  3M85 A;  2JP1 A;  3PV0 A;  1E0B A;  4TQU S;  5AJ3 Q;  4ILW A;  5I9P A;  4C3I G;  4HIM A;  1ZKO A;  3FDT A;  5AFW A;  4UAI A;  2QKI C;  4DK3 C;  3S9W A;  3PO2 B;  1EWI A;  2PCF B;  2KJX A;  5H1S E;  1K8M A;  1SE4 A;  4MHE A;  4RMF A;  4FYD A;  2IPK D;  3K0X A;  5JAV A;  3DMU A;  2ICE C;  4A3E G;  1XMO Q;  4L5S A;  2K1B A;  3Q23 A;  1C9O A;  4UP9 A;  5M3F H;  1PYS B;  1A63 A;  3FRP B;  1JOR A;  1EQQ A;  3HOU B;  3K81 C;  1TII D;  4BBR B;  2UXD L;  4V0B A;  5HGQ A;  3KLW A;  3QB3 A;  1PTO B;  4NDX A;  2M9V A;  2RKS A;  4L5T A;  1IHZ A;  4A3K G;  2K5D A;  4GOP C;  3D0F A;  1EQR A;  1G51 A;  3SK8 A;  4JOI C;  3V2T A;  1GUT A;  4YWM A;  1AFP A;  3I4N H;  1G8Z D;  3CRL C;  3HGB A;  2CQO A;  2EYH A;  1QB5 D;  5M5X B;  1XNQ L;  2F0P A;  4DAY A;  5IT9 E;  1KNA A;  4DR4 L;  1E2W A;  3RD4 A;  2EJM A;  4JI1 L;  1SMX A;  4C3H B;  5DM6 3;  2EXD A;  2B63 G;  3MXN B;  4GS3 A;  1XMQ L;  1HNX L;  3OMG A;  5JOB A;  1H9S A;  1ENC A;  2F3I A;  3KJO A;  1HQM C;  3RUZ A;  3U50 C;  4LF9 Q;  3CRK C;  1DD2 A;  3F2C A;  1IBL Q;  1HNZ Q;  2Q2U A;  2PNH A;  3P75 A;  4N8X 1;  1IYV A;  3E9I A;  3UI2 A;  3I4M G;  2DUD A;  4QUF A;  1XPR A;  1ICW A;  4LFC L;  2UUB Q;  3RR5 A;  2TMP A;  5EGT A;  4A93 G;  3J81 i;  2F0V A;  5IYB H;  1UE1 A;  4X62 Q;  4OO1 H;  2B2T A;  3DWA A;  5E3F A;  1HJP A;  4DGZ A;  1NY4 A;  1ZYR C;  1NJI C;  4A3B B;  1JE4 A;  1D8L A;  1VDZ A;  2A6H C;  1BO0 A;  3VDY A;  4JVZ A;  2KCM A;  1XYI A;  3AB9 A;  2K5W A;  1UEB A;  5IYD H;  2JJQ A;  1AN8 A;  1DJR D;  1YBY A;  1VQ8 A;  1HZA A;  4OEM B;  3GTM B;  2RVL A;  1HUN A;  1EU4 A;  3N52 A;  4P73 A;  4JI5 L;  2NB0 A;  3CCV A;  4O2D A;  1EIH A;  2A69 D;  4KTA A;  1GO3 E;  5HY6 A;  1CKO A;  4LK1 C;  1X3F A;  3CCR A;  2WIN B;  1Q7Y C;  4EGV A;  1D7Q A;  1H9J A;  3HG9 A;  2AWN A;  3PUW A;  3TME A;  1EQV A;  1B53 A;  1ASZ A;  1G2T A;  1YVC A;  2E2J H;  4K8I A;  4AYB E;  1BBX C;  2HUG A;  5LMN W;  1QNU A;  3F2U A;  3S1M H;  5IP7 H;  3QOL A;  2RA4 A;  1WCM G;  4A3F B;  2QGQ A;  2HQL A;  4UY8 C;  2YV5 A;  2CWA A;  4N9T A;  4JI7 Q;  3JAM c;  1SR3 A;  1VQJ A;  4DV3 Q;  4GN5 A;  1S5C D;  3A7A B;  4DV0 Q;  2VQF L;  3HOX H;  3VYT A;  2RF4 A;  4B3S Q;  3STB C;  3A7L A;  3SE0 A;  2ZJR A;  2RBM A;  3TDQ A;  4YHH L;  4BBS B;  1J5E L;  2J7Z A;  3A56 A;  4KHV A;  3WOF A;  4K6L A;  1LT5 D;  1N36 L;  1T5X D;  3B6Y A;  4LW1 A;  4M1U B;  1YHA A;  2ZXR A;  1PA6 A;  5EKI A;  1SJE D;  4DAV A;  1TS4 A;  3MA2 B;  2NN6 I;  3F2B A;  3GTP H;  1YNN D;  2NZO A;  1CHQ D;  2FIN B;  3TSS A;  1V43 A;  4HR7 B;  3SR1 A;  2EYM A;  2CW0 D;  2RSN A;  1VQD A;  4RWS C;  3SK6 A;  3T1H Q;  4NXM Q;  3FKI B;  4GKJ L;  3A5U A;  4DU9 A;  2VS1 A;  3T13 A;  3PO3 H;  4J15 A;  1B7Y B;  1UAP A;  4A3K H;  3Q6S A;  1KD1 C;  4YCU A;  4GNX B;  4K2K A;  3RNU A;  1BQQ T;  1EIY B;  2FFK B;  1N34 L;  2E5L L;  1PZI D;  3PUZ A;  4QIW E;  4QB4 A;  3PCO B;  1VQH A;  2RCN A;  1MIU A;  1O7L A;  5C3E G;  4RHS A;  3IFT A;  4MZ9 A;  3PIO 3;  3KDF B;  2NVT H;  3PIP A;  2E8G A;  1MJC A;  5T1I A;  3OHX C;  4DUY L;  5EPK A;  1KIX A;  4H0L C;  1CK1 A;  1EIF A;  3A54 A;  4ZAI A;  4JI3 L;  3CCE A;  4CJ2 C;  2HDM A;  3S15 B;  2UXC Q;  2WV6 D;  1B8A A;  5K36 G;  4AYB G;  3ZYY X;  4G7O C;  1VQ5 A;  1PMR A;  2OQK A;  4APV A;  5AJ3 L;  1VQG A;  1M8A A;  2K4K A;  1TXY A;  1YJW A;  4K5V A;  3H3V C;  3CMA A;  4A3I B;  4RAU C;  3CQZ H;  2P5Z X;  3I4M H;  1XMO L;  1YHQ A;  1SNP A;  5IOD A;  1IKM A;  1FJG L;  4A93 H;  2XTI A;  4ME5 A;  3H3V H;  3RZO H;  3H09 A;  3S2H B;  1Y1W G;  1HNW L;  3K57 A;  3G71 A;  1X55 A;  1VCI A;  1VQ7 A;  3I2Z A;  1BCP F;  4XIG S;  1OXT A;  3ERO A;  3W1G A;  3S16 B;  2NVQ B;  2K28 A;  3J80 E;  2VUM G;  1DON A;  1PLF A;  4FDB A;  4GNX A;  2JA6 H;  3ULL A;  3R93 A;  3TP8 A;  5GAD C;  1IW7 C;  2K5N A;  1WTR A;  1MBY A;  3FEW X;  3SHL A;  1A3T A;  4BY1 G;  3DUZ A;  1E1T A;  1KXL A;  4GLV B;  3FHW A;  1Q12 A;  3KDF A;  1X3P A;  4HJ7 A;  2UXD Q;  4YIJ A;  4Q0F A;  4LF5 L;  2B2U C;  4H44 C;  3E9H A;  3S1R B;  1LTR D;  1M1K C;  1R4P B;  2BA0 A;  3TBI B;  1O7I A;  4L5R C;  2F0K A;  3NPP A;  4L8J A;  2OQ0 A;  3M4P A;  3J80 i;  3J7Z C;  3R2I A;  1IBL L;  1HNZ L;  5IYC H;  4DR7 L;  4C3J G;  1LV9 A;  1P16 A;  1HZ9 A;  1ROD A;  5C3X A;  1PVO A;  3D3R A;  1IKL A;  3GDE A;  2UUB L;  1NR4 A;  3BS1 A;  1B3A A;  1D1I A;  2XIW A;  3HKZ E;  4A3G G;  1XNQ Q;  4X62 L;  3CHB D;  4DR4 Q;  4FXD A;  5CV5 A;  4NPS A;  4WJW A;  3WOE A;  1YIJ A;  4UHV A;  4DN4 M;  2Q2T A;  3NE5 B;  3K0Y A;  1Z7T A;  1VS0 A;  1XMQ Q;  3SK5 A;  2PZW A;  1STN A;  3KUP A;  3F2D A;  2L15 A;  2Y0S E;  4F87 A;  4B3M Q;  3WWV A;  3GTJ B;  1YEZ A;  3OWE B;  1WD0 A;  1GVP A;  2UXB Q;  2B8G A;  1NBW A;  3HP3 A;  2BDO A;  5M3M B;  5IE8 A;  1Q46 A;  2TSS A;  2IT1 A;  2EY1 A;  5J3B A;  2NYZ D;  4LFC Q;  3LX0 A;  5GAH C;  1G6Z A;  3C1E A;  1V1O A;  2VW9 A;  4ZRZ A;  2VL6 A;  1IBK Q;  2E2D C;  1LTS D;  2F0L A;  3K7A B;  3CCJ A;  2DN8 A;  3D4D A;  5CYU A;  4LF6 L;  1L1O B;  4U68 A;  4MTK A;  2EJF C;  1S5E D;  1PFS A;  3AEV A;  4DPG A;  2Z8L A;  1X65 A;  4B08 A;  4A3D G;  1QNK A;  3NK9 A;  2K04 A;  4A3M B;  2KBN A;  1B3Q A;  1PTO F;  1PFM A;  1RF2 D;  3W3A A;  2NVY B;  1YHB A;  1VQ6 A;  4JG2 A;  4JI6 L;  4JI5 Q;  2CH4 A;  3TP6 A;  1D2B A;  2DGY A;  4DV3 L;  3QO2 A;  3Q8D A;  2DNC A;  5M5Y H;  1SBB B;  2JA5 H;  5ELF A;  1L0Y B;  5FJ8 H;  1PFN A;  5C3W A;  3HOY B;  4YWL A;  2ZT9 C;  4A3J B;  3M7G A;  2R7Z B;  4B3S L;  1F2Y A;  3T16 A;  3CCM A;  4GZY C;  1LUZ A;  2EYP A;  3NHH A;  3TRZ A;  4Z9C B;  1FL0 A;  1M90 C;  2O5J C;  2K14 A;  4OON A;  3PQI A;  3OW7 A;  5C44 G;  4KKU A;  1HPC A;  1W3S A;  5K36 H;  1MSG A;  4DR1 L;  1JJC B;  2IL8 A;  1JC7 A;  1EZ8 A;  4LFA L;  3I4O A;  1EZ6 A;  1C48 A;  2B2W A;  3HKZ G;  2RDG A;  1V8Q A;  1A3U A;  3RZD B;  1WI5 A;  2Q2H A;  4CBV A;  4DA2 A;  3HOW G;  4ALP A;  2VQF Q;  3D4R A;  1XNR Q;  4OX9 Q;  1LT4 D;  2JYO A;  1BCP B;  2EYL A;  2HIV A;  3VR5 A;  3GTQ H;  1PH2 A;  1L1O A;  4DNT B;  4K14 A;  4V19 0;  3I7F A;  5JJZ A;  4DNI A;  2HDL A;  1J9O A;  3M9B A;  1N36 Q;  3PO2 G;  2DJF C;  2A68 D;  1YIT A;  5M3F B;  1STY A;  1K9M C;  4KLK A;  2B2V A;  1AZQ A;  1Q3L A;  4YWK A;  3G7L A;  4CKB A;  4TRD A;  1I4X A;  3W2D A;  2K01 A;  1KDB A;  2EYO A;  3HOU G;  1SND A;  3MXU A;  1FNV A;  4KN4 C;  3HS0 C;  1DCZ A;  1CA6 A;  3EN2 A;  4DXF A;  4DR2 Q;  4QQB X;  4DV7 L;  2WFW A;  4OL7 A;  1K8A C;  1PZK D;  4UDU C;  4LAA A;  2UXC L;  4MIU A;  4ZCK A;  4GKJ Q;  3I4N B;  1JE5 A;  5ELC A;  3AFQ A;  1TWA H;  3U9O A;  4JBJ A;  4H13 C;  1KLU D;  1FYC A;  1EY8 A;  1GUO A;  3DWQ A;  4BA2 I;  1IYJ B;  1VMP A;  1W2B A;  1N34 Q;  2E2I H;  4DFA A;  4IOA A;  1DOM A;  4HIK A;  3V96 A;  2EY6 A;  4HCS A;  1MI2 A;  2NBF A;  1A62 A;  2EYJ A;  3UDX A;  1YJ9 A;  1XTD A;  5CBE E;  4OEL B;  2PQA B;  4ZKB B;  1B70 B;  1A2U A;  1Q8K A;  3F1Z A;  4C3H G;  3L3O C;  3Q22 A;  1VQA A;  4JI3 Q;  3H3V I;  2F52 A;  4FNF A;  4DV6 Q;  3J7A F;  4DR6 L;  2BOS A;  4O42 A;  4IOC A;  2R92 H;  3VYS A;  3EFX D;  3IL8 A;  3RN2 A;  1PRT F;  2EJG C;  1Z47 A;  4LFB L;  2A69 C;  4CGY B;  4WFN 3;  3E5S A;  4IUN A;  2OWO A;  1DGS A;  4M8A A;  2XWJ B;  1M4V A;  1TWF H;  4G7H C;  1JB3 A;  5LL6 X;  2SNM A;  1D5Z C;  3E0J A;  5IP9 G;  4JK1 C;  4I7A A;  1KAB A;  1N32 Q;  1BXT A;  5JEA G;  1TWH H;  2ENB A;  2MJ8 A;  3BZD B;  3JAM E;  1FJG Q;  1SNM A;  1AZP A;  4A3B G;  2IW3 A;  1AEX A;  3H6M A;  1X32 A;  2L4N A;  1HNW Q;  5IGB A;  2WAC A;  1EQT A;  1PH3 A;  4C1N K;  1BBW A;  1W6K A;  5FLX c;  2M2L A;  2R61 A;  5I2Y A;  2EY5 A;  1PH5 A;  1PXU A;  1TWG H;  1QUQ B;  4G7Z C;  4H7B A;  3CCL A;  2YTV A;  3BU2 A;  1EEF D;  3I91 A;  3KLS A;  1SMY D;  2V4D A;  4DK0 A;  4KK7 A;  4DV4 L;  1YNJ D;  4DV5 Q;  2WII B;  1O7Z A;  3MVV A;  1LTI D;  2ZJP A;  2Q8I B;  3CW2 C;  1SE8 A;  1Y69 U;  2VY3 A;  1U9R A;  4O1N A;  3IRB A;  2G9H D;  2XNA C;  4F7X A;  1NUC A;  4RH6 A;  3GTK H;  2R7F A;  4NXN Q;  3J7Y W;  1C8C A;  2K03 A;  1VQC A;  1VF5 C;  2KCT A;  3FVQ A;  2I5L X;  4OWT B;  4LF5 Q;  2E2J B;  3J81 j;  1NNX A;  3MEH A;  4RCN A;  4POG A;  3S1N H;  3S1M B;  1BKB A;  4OIJ A;  2F4I A;  2MUY A;  5I9O A;  1BR9 A;  5JVG 3;  2MFI A;  1LTA D;  1S5F D;  3KYH C;  1YNN C;  4B3M L;  4XDX A;  4IUR A;  2UXB L;  1WTQ A;  4A3L G;  2VNU D;  5C44 H;  4DR7 Q;  4PZ6 A;  2JA9 A;  3CP0 A;  1STG A;  4TVA B;  2IY5 B;  3HOX B;  3IKJ A;  1WVL A;  2CW0 C;  2BE5 C;  1PHJ A;  1U0L A;  2FXQ A;  4DK1 A;  3VR4 A;  5KND A;  4A3C G;  1HXY D;  1IBK L;  3DM1 A;  3KBG A;  1VF7 A;  5GRO A;  4X66 Q;  4JI8 Q;  5G3L F;  1EU3 A;  1LTT D;  2EPB A;  3T53 B;  1BUV T;  4CJ1 B;  1BDO A;  1KAA A;  3DEO A;  5FLM G;  3M4O H;  4CHT B;  4IPD A;  2F0H A;  2CKZ B;  2ASB A;  3H94 A;  1QUQ A;  2KA7 A;  1SE3 A;  3EA6 A;  3H0G G;  1HHV A;  1D1K A;  4IUP A;  2BH8 A;  3RLO A;  1Y14 B;  1ILP A;  2I46 A;  3GTP B;  1TY0 A;  3HOV H;  3MC0 B;  1CZW A;  5IWA L;  3ERQ A;  5CV9 A;  2PZU A;  1ESF A;  3NTK A;  5A2Q E;  5IGE A;  3KLS X;  3J81 L;  1A3V A;  1EY7 A;  4HSP A;  1B1Z A;  1U4R A;  1AW7 A;  2F0M A;  5IT9 L;  4X64 Q;  1F9S A;  1S5B D;  4AQY Q;  2JA7 H;  1LYL A;  5EPL A;  3CF5 A;  1F2M A;  3HOU H;  2D5D A;  3NEL A;  3PO3 B;  2XWB B;  4GLA C;  1KRS A;  2XRQ D;  2A6E D;  4A3K B;  2LXK A;  1I94 L;  1Y1V G;  1RTN A;  4LF6 Q;  3P7J A;  3OOC A;  2LMC B;  1BCP D;  3MXN A;  5D65 A;  4IFD G;  4JYA Q;  3OW2 A;  4KKS A;  4YY3 Q;  4IUQ A;  2Z1C A;  1F9P A;  1SAP A;  1HFG A;  2UUC Q;  4Y52 H;  2QDB A;  1STE A;  5K5P A;  3DHQ A;  4JI6 Q;  4R8N A;  4BA1 I;  1NTG A;  4PMW A;  3NBI A;  4QY7 A;  2N55 A;  1LAC A;  1F9R A;  1XNR L;  4OX9 L;  1NMG A;  1GHJ A;  3UE1 A;  1PRT B;  1QJO A;  1SRO A;  4IPC A;  4ZK9 B;  1QZG A;  3PIO A;  2F3W A;  4XYQ A;  1C7Y A;  3TZU A;  1I6V C;  2FJ2 A;  2ID0 A;  3FMC A;  1VQN A;  2QIL A;  3A5Z B;  3CQZ B;  3IAY A;  1EUJ A;  3I4M B;  4DR1 Q;  1JJ2 A;  4NW2 A;  4LFA Q;  1BVS A;  3M3Y H;  4A93 B;  5CV7 A;  3RZO B;  4C3I H;  4CDC C;  3S14 H;  3PGZ A;  1O78 A;  2CHB D;  2SDF A;  2QF7 A;  1HR0 L;  2V1C C;  2A5H A;  3DEP A;  5C5L A;  1CSQ A;  2JK8 A;  3QJY A;  2E75 C;  1G2S A;  2K5H A;  3ONA B;  4XT3 B;  4CDD C;  4A3E H;  3K5N A;  4L5Q A;  5JEA H;  1E2V A;  5DLQ E;  4DNR B;  5ELE A;  1OXS C;  4XQN A;  3CPW A;  1HTL D;  4DR2 L;  1EL0 A;  2JA6 B;  3P1H A;  1WYD A;  3HOZ G;  4IUU A;  1QVC A;  5C4X G;  2ZXO A;  3J81 c;  4BWG B;  3GTG H;  4P72 A;  1VQE A;  1LTL A;  3H91 A;  3A8J E;  3ERS X;  5IT9 c;  2F3V A;  1DXM A;  4WJ3 M;  3FPP A;  5C4J H;  1S5D D;  4DUZ L;  4LUO A;  3HRZ C;  1OO9 B;  4FO2 A;  2A19 A;  2VZA A;  2Q8T A;  1JWU D;  2HQE A;  4MNO A;  4R4I A;  1VMC A;  2K50 A;  4JV5 Q;  1K0S A;  1I6H H;  5JVH 3;  4LUV A;  4DV7 Q;  1XXG A;  3U9S A;  3C1F A;  4ZQ3 A;  5J39 A;  4DR3 Q;  1SE2 A;  4DV2 L;  1G91 A;  4DV6 L;  2VQE Q;  2EXZ A;  3BVZ A;  1PTO D;  5M5W H;  3OIP A;  2H1E A;  2B63 H;  1X54 A;  5KGU A;  1B50 A;  4G57 A;  3KOJ A;  4I7Z C;  5KIX A;  2B2Y C;  5LMU L;  1SYF A;  3OWF A;  3C3L A;  2KED A;  1CQV A;  5KYL A;  3TS0 A;  1H95 A;  1A0I A;  3GV6 A;  1EYG A;  1Y8P B;  3CCS A;  2K32 A;  5HGT A;  1F9Q A;  4E6I A;  3HZX A;  4LJZ C;  4HTH A;  1N32 L;  1SLJ A;  2H4O A;  1PH6 A;  2NVX H;  2C9O A;  3VR3 A;  5EQ0 A;  1N8R C;  1K3R A;  3LWE A;  2R93 B;  4DR6 Q;  1II3 A;  3NXW A;  1OTC A;  4PMC A;  2RCF A;  3EQL C;  1JJG A;  4RKB A;  1GM5 A;  3K5M A;  2EDG A;  5M3M G;  3E0E A;  2OTJ A;  1BOS A;  2AWO A;  4LFB Q;  3BVM A;  3H0G H;  3L9A X;  3D31 A;  4DV5 L;  1HH2 P;  2MO0 A;  5FO7 B;  3SXH A;  1R9T H;  2D62 A;  1AE3 A;  2VB2 X;  2OXP A;  2LS0 1;  2PO4 A;  1CA5 A;  4X3S A;  1C0A A;  4XQJ A;  1F77 A;  2N78 A;  1A2T A;  1QIL A;  3T51 B;  4NXN L;  4KMU C;  2WB1 E;  2K6A A;  3NBH B;  2KOL A;  2B2U A;  1UUP A;  2N49 A;  2D9U A;  1T5E A;  1SEB D;  3STB D;  1C4Q A;  1Y1V H;  4P2C B;  4EQP A;  4ULL A;  5BR8 L;  4KKT A;  2O4X A;  4N8F A;  1MSH A;  4A76 A;  4IFD H;  3A8K E;  2Z6K A;  4NB3 A;  5I6W A;  1O7Y A;  1K83 H;  4DV4 Q;  2I5H A;  1NE3 A;  1VQB A;  3N6R A;  3R8B A;  1STH A;  5M5Y B;  2JA5 B;  5JEA J;  1U4M A;  3QG1 A;  2MNA A;  2QEX A;  3LGJ A;  4IAL A;  4HJA A;  2GVA A;  2F0D A;  1RHP A;  1WCM H;  4QUC A;  5FO9 B;  4DV1 Q;  1GXD C;  1UE6 A;  2F4V L;  3HOY G;  2HT1 A;  1KLG D;  4KHZ A;  2A68 C;  2QA4 A;  4X66 L;  3I90 A;  4JI8 L;  3PF4 A;  4CKC A;  1ENA A;  4YCW A;  1F2L A;  1TQO A;  3HFZ B;  3J80 L;  1X3G A;  1HFN A;  3BDC A;  1F2Z A;  3MFY A;  3NEN A;  3K5O A;  3RLF A;  1KRT A;  2CWP A;  3OYY A;  1GKH A;  5E1F A;  5J22 A;  2ATW A;  1E24 A;  2MPM A;  4L63 B;  4MN3 A;  3GTQ B;  3M4Y A;  3J7A 5;  4IJL A;  4X64 L;  4H02 A;  4AQY L;  1S3O A;  2DJG C;  3NBH A;  1MKH A;  3C46 A;  4JBW A;  4LUZ A;  3TP5 A;  4K6D A;  1VQM A;  2WAQ B;  4GN3 B;  2LXJ A;  2B3G A;  1PRT D;  2K7V A;  4JYA L;  4YY3 L;  1RJT A;  3HOZ H;  3I8Z A;  5C4X H;  3ICE A;  2MGS A;  5IWA Q;  4JPB W;  2UUC L;  2L55 A;  3K8A A;  4HJ9 A;  1SNC A;  2JEB I;  3KJP A;  2Z9H A;  1HZC A;  3MXP A;  1VQK A;  4FF4 A;  4R1J A;  3GP7 A;  1SYC A;  4R4C A;  4Y7N H;  1QG7 A;  2PQE A;  1HA6 A;  4RG1 A;  4XTC S;  3D4W A;  3S17 H;  2O2L D;  1TWA B;  4A4I A;  4RKL A;  5C3E H;  1I94 Q;  3D6W A;  3S2D H;  2F0J A;  3HKS A;  3NTH A;  2KCN A;  3G6J B;  3I4N G;  1K28 A;  1EYD A;  4A75 A;  4B3T Q;  3CKI B;  2E2I B;  5FKA C;  1WJJ A;  2F0S A;  5FLX E;  1OXX K;  1RD9 D;  1SSO A;  3VA7 A;  1EY6 A;  2K33 A;  2A74 C;  4K5W A;  5ELN A;  3OTO L;  4J8Q A;  1N33 L;  5D3D A;  2XGT A;  1AP0 A;  1KC8 C;  4PQX A;  3QR8 A;  2FMC A;  4C2M H;  1VQL A;  1BBU A;  4KY7 A;  4JCV E;  5CV6 A;  2L11 A;  4LNQ A;  3KK7 A;  2AUJ D;  1IYU A;  2G5D A;  2UU9 Q;  4BY7 G;  3MHB A;  4R8I A;  2R92 B;  1SMY C;  2WP8 J;  4KD3 A;  3ULP A;  1YNJ C;  4IFD J;  1LT6 D;  4RFB A;  1DOL A;  1PYB A;  2Y0S G;  4JC0 A;  3NQT A;  5KNC A;  2JA8 G;  3HEJ A;  3X3N A;  2F0T A;  1OXV A;  1MGS A;  1Y1W H;  3UE0 A;  3EIV A;  1WOC A;  4HJ8 A;  2J0T D;  2B2W C;  2PNR C;  1G6P A;  1IXR A;  3GTJ H;  1CKM A;  5GAE C;  4OO1 G;  4WJ4 A;  1A15 A;  1NCV A;  1IBM L;  1PYW D;  2VB3 X;  2SNS A;  2VUM H;  1SYE A;  2CCZ A;  4K0K L;  5F2D A;  1ENF A;  4CDE C;  1B9M A;  5KNB A;  1HR0 Q;  2PW5 A;  4RGN A;  3CU7 A;  4ZLT F;  4JI2 L;  5G3L D;  2WB1 B;  4BBR G;  1TWG B;  4BY1 H;  5IYD G;  3SK4 A;  1MJE A;  1NAP A;  2JE6 I;  4JV5 L;  1WTH A;  5C5M A;  4O0A A;  3VA5 A;  3MXG A;  4X3U A;  1PFB A;  4DR3 L;  4JBM A;  2E76 C;  4XXE A;  1JQY D;  2Z4I A;  2B2V C;  2VQE L;  1I3Q H;  4IUV A;  4GOP B;  1QWY A;  2IJ0 A;  1UE5 A;  2NTS A;  5CMD A;  1RDP D;  1B44 D;  4JBK A;  2MP1 A;  4HCE A;  3GTK B;  2F0U A;  4R9W A;  4QF4 A;  2GVB A;  1CM9 A;  2AKW B;  3S24 A;  3MTS A;  2Z0S A;  5IGD A;  4C3J H;  4DUZ Q;  3GTL H;  1KQS A;  3S1N B;  1FD7 D;  2NTT A;  2DY8 A;  2JQO A;  4FF2 A;  1CHP D;  1Q1B A;  3S1Q H;  2E74 C;  4KD4 A;  3GV3 A;  4A3G H;  5IP7 G;  4KV6 A;  5C44 B;  4DV2 Q;  1ICF B;  1YZ6 A;  1SFO H;  2IX1 A;  1XX8 A;  1H9K A;  1HCZ A;  2QEJ C;  4DR5 L;  4WRD A;  2N88 A;  4DK6 C;  3I55 A;  5IGG A;  3BJU A;  5LMU Q;  2A6E C;  3T1Y Q;  3GTO H;  5I6Y A;  1BCP C;  5M9O A;  3GD7 A;  5EJW A;  1I50 H;  3K6O A;  3M4O B;  1HA5 A;  1GD7 A;  5JJL A;  1GUN A;  1D5X C;  2LKV A;  1Q82 C;  5IOC A;  3U4Z A;  2UUA L;  2PMZ B;  1R4Q B;  5E4W C;  1FGU A;  1CKN B;  4C56 C;  2VXW A;  2ZM6 Q;  3HOV B;  3O13 A;  4KY6 A;  1PZJ D;  3SDZ A;  1A6X A;  3CXC A;  1K73 C;  4IQZ A;  5ISR A;  4GOP A;  1H9M A;  1LTG D;  2LSS A;  2RSO A;  2AUK A;  4IPH A;  4K8J A;  4A3D H;  4JOI A;  2JA7 B;  1EYA A;  3RN5 A;  4IFD I;  5IGF A;  2QCP X;  3R2T A;  3E3X A;  1VQ9 A;  1UWV A;  3TQY A;  3GO5 A;  5C0X G;  2BH2 A;  1EOT A;  1B2T A;  2OF1 A;  5COR A;  3NUC A;  2N8N A;  2PI2 E;  3PF5 A;  3PO3 G;  4DV1 L;  2PQA A;  4QGU A;  2EY2 A;  3JAM i;  3ULJ A;  1ILQ A;  4DXG A;  2C35 B;  5DAU A;  3PUY A;  1TWC H;  1NR2 A;  1V1P B;  3K5L A;  4R4O A;  1A8V A;  4ODG A;  4WOR A;  4ID6 A;  5BR8 Q;  3DWP A;  1WFQ A;  1Q90 A;  5E4X A;  1X9N A;  1UNS A;  4JW0 A;  5T1G A;  3J81 E;  1SJH D;  4A3F G;  1KDC A;  1NMF A;  5TSS A;  3H15 A;  1QOH A;  1SNO A;  1TU2 B;  3JAM L;  2HD3 A;  3M4Q A;  2D0P A;  4P71 A;  1RTO A;  4HID A;  5EKK A;  4EVO A;  2ALY B;  2F4V Q;  5I2X A;  4ZUJ A;  4TKO B;  3CC2 A;  1ET9 A;  3D6C A;  4BY7 H;  4JI0 L;  2CQA A;  2Q2I A;  1CKN A;  3CAM A;  1P8L A;  1WTW A;  1SRU A;  3HOW H;  1TT2 A;  2L0C A;  4BBS G;  1WTX A;  4IZ8 A;  5IY0 A;  4DAP A;  1SNQ A;  2OT2 A;  1Q86 C;  3M3Y B;  5KRU A;  1LM0 A;  2YU9 H;  2JA8 H;  4C3I B;  3S14 B;  2E2H H;  3NWS A;  4KY5 A;  2ZTC A;  1CSP A;  1Q81 C;  3X3M A;  5L37 A;  2KHJ A;  2OEO A;  4KI0 A;  3URY A;  4A3E B;  1S40 A;  1RIP A;  2B2T C;  3PO2 H;  1X6O A;  4FXK C;  5IIF A;  3WDN A;  2ZTD A;  2K05 A;  2F0O A;  3LNN A;  3MAQ A;  2EE1 A;  1PTO C;  4RGO S;  1ESR A;  4F88 A;  1E2Z A;  1IL8 A;  5IGC A;  4ABN A;  5CGK A;  3CD6 A;  2JA6 G;  4BBR H;  5CC4 A;  3GTG B;  5EPJ A;  4QL5 A;  3KBX A;  1V1P A;  4IN3 A;  3FKI G;  3G4S A;  1PTO H;  3VR2 A;  4BXX G;  4PZ7 A;  1E3P A;  2SEB D;  1UEA B;  4B3T L;  4X65 Q;  5C4J B;  2KUM A;  4GN4 B;  3QIA A;  4LF7 Q;  4HSV A;  4LF4 Q;  2KEN A;  1Q8I A;  1EFI D;  5LMN Q;  3KFU A;  1VQF A;  4R4Q A;  2NVT B;  1I6H B;  1U4L A;  3OSO A;  2WKC A;  2O5I C;  5LHY 1;  3M7N A;  5BN4 A;  4TSS A;  2D2C C;  1PH7 A;  3W5O A;  2UU9 L;  3T56 B;  3TN2 A;  1QVF A;  2F0Q A;  2ZXP A;  1TS2 A;  3E6Z X;  5M5X H;  2B63 B;  5IYC G;  4NKL A;  5M5W B;  1TR5 A;  3SEB A;  3BYT B;  1GHK A;  5COY A;  5J1Z A;  5CV4 A;  4C3H H;  5C4Z A;  2L5T A;  4DF7 A;  5DEH A;  1HTP A;  1HQR D;  4LF8 Q;  2R6G A;  3OPO A;  3DLL A;  3OTO Q;  1EYC A;  3I70 A;  5A2Q L;  2F0I A;  3I72 A;  1N33 Q;  2CFM A;  2B29 A;  1WTV A;  4A3I G;  2M00 A;  2NVX B;  5EAY A;  1H9R A;  1SN8 A;  1VQ4 A;  2EVB A;  5FK9 C;  1VQO A;  2FMM A;  1PDQ A;  3G6E A;  1J6Q A;  5IP9 H;  1LAB A;  2R93 G;  3BYY B;  1RCV D;  5EBD A;  2F0F A;  2AHO B;  1X3E A;  3H0G B;  4NP5 A;  4JI4 L;  1KAW A;  4ZUI A;  4A3B H;  2BCO A;  3J7A V;  4UP8 A;  4DKA C;  2WAQ E;  4FF3 A;  2JSO A;  1R9T B;  4ZKC B;  4GKK Q;  3EBE A;  4PZ8 A;  2KVM A;  1IBM Q;  4K0K Q;  1Y8N B;  3GTM H;  5D3I B;  2XN9 C;  1U4P A;  3BZC A;  1DYQ A;  2DY7 A;  3ND8 A;  4FP5 D;  3UDF A;  3A8I E;  4B3R L;  4OXP A;  4IPG A;  5JPN C;  4PV1 C;  5C0X H;  4KN7 C;  4JI2 Q;  1TS3 A;  1GUW A;  2BE5 D;  1Y1V B;  1HUM A;  1YI2 A;  3CCQ A;  1WTO A;  1I4H A;  3MWY W;  1K83 B;  2HHH Q;  2G9D A;  2F1M A;  2XVS A;  1DM0 B;  2X6L A;  1SYB A;  1EOV A;  1ZYR D;  3AMU A;  1DZ1 A;  1KNE A;  2NZH A;  2YTX A;  3QOJ A;  4KJO A;  2IHE A;  2JA5 G;  1QE6 A;  4X6A H;  2A6H D;  1WCM B;  5FJ8 G;  2B2Y A;  5CBA E;  3K59 A;  1FVI A;  1D5M C;  1GOZ A;  1T9H A;  2L9H A;  2PZT A;  3T1Y L;  1BF4 A;  1AE2 A;  1STB A;  1EEI D;  3K7U C;  5GQO A;  3TS2 A;  4A3L H;  4OHJ A;  2D0O A;  4A3F H;  3RLN A;  1PRT C;  2Q8R E;  3NQI A;  1XTC D;  2B8F A;  4LWC A;  5I4D A;  1Q1E A;  3ITP A;  1TVX A;  1XJV A;  1JMC A;  4A3C H;  3Q0A A;  2EIF A;  4C1N I;  2L12 A;  2K52 A;  3JC6 6;  2ZM6 L;  3KF8 B;  3ER0 A;  3P20 A;  3AU7 A;  2IWH A;  5JPM C;  4KHP Q;  1PH8 A;  3DM3 A;  1LLR D;  1CTM A;  4X3K A;  1FNW A;  4BBS H;  3TRE A;  4DR5 Q;  3BG3 A;  1IL2 A;  1KTK A;  4AIM A;  5FLM H;  2F0N A;  1JB7 A;  1KDA A;  2A73 B;  1GUS A;  4OWW B;  2MO1 A;  3A55 A;  1I4Q A;  3BDL A;  4ME3 A;  1K0R A;  1EWH A;  5D14 A;  1TKW B;  1TY2 A;  2PI2 A;  4N9P A;  1FGB D;  1EIG A;  2RHQ B;  1DOK A;  1JOK A;  2ICI A;  3NTI A;  4EQO A;  2KEE A;  5FO8 B;  2UUA Q;  2B39 A;  2K5Q A;  5C4H A;  2WAQ G;  3NWT A;  2NZ1 D;  1Y8O B;  2RDH A;  2XRS D;  3HOZ B;  5C4X B;  1EY5 A;  1U5K A;  5LL6 S;  3CC4 A;  3CCU A;  2NN6 G;  4PNY A;  4BS9 A;  4GNX C;  4A3M G;  1K8G A;  4P74 A;  4HJ5 A;  2I5M X;  3C2P A;  3FKI H;  1ZXT A;  4R4T A;  2JN4 A;  4BXX H;  4J6H A;  4Y7N B;  3MEF A;  3PIP 3;  4RHR A;  4MTN A;  2GA4 B;  1B9N A;  2HCC A;  1KHI A;  2C5C A;  1N9W A;  3S17 B;  1SYG A;  1I4R A;  1S4Z A;  1VQI A;  5C3E B;  3NSW A;  1WD1 A;  2PPB C;  1Z6H A;  3S2D B;  4G4K A;  3Q24 A;  2X6G A;  2RDF A;  2DNE A;  3MZ5 A;  3PUV A;  4A3J G;  3TEH B;  2R7Z G;  2AMC B;  3VYR A;  1K8O A;  2KHS A;  3GQB A;  1JCK B;  4LF9 L;  2Z6K C;  4AYB B;  1EWC A;  3KF8 A;  2K5V A;  2GN5 A;  3RMH A;  4PMB A;  1VQP A;  2PW7 A;  3S15 H;  2EYF A;  1CZG A;  2EQS A;  3A74 A;  4C2M B;  1ZEQ X;  4DAM A;  3AFP A;  4HMJ A;  5C0X J;  4I65 A;  1NSN S;  1L0X B;  2MQH A;  3LWU A;  3CC7 A;  5E7N A;  5KYI A;  2X69 A;  4KJN A;  4A3I H;  4OO1 I;  1G29 1;  3FPU B;  4RA8 A;  4JI1 Q;  5NUC A;  2JXM B;  3D8G A;  2R92 G;  3U58 A;  3I3C A;  1XPU A;  4L6T B;  2OCE A;  1Y1W B;  1HNX Q;  2HIX A;  3NP8 A;  1OXU A;  3SGI A;  1L0W A;  4JI0 Q;  5BN5 A;  3S2H H;  2PMZ E;  2A1A A;  2R93 H;  2F0G A;  2AQ3 B;  2A8V A;  2VUM B;  3SVM A;  4J1M A;  1JWS D;  4XYO A;  4X65 L;  2R3Z A;  1B4O A;  3S16 H;  2HCI A;  5M3F G;  2NVQ H;  1CI3 M;  4B9W A;  4LF7 L;  2K75 A;  4K2L A;  4LF4 L;  3EVQ A;  4OIK A;  1JWM D;  1CT1 D;  1O80 A;  4QCL A;  4BY1 B;  5LMN L;  2KCC A;  4OGQ C;  1QZH A;  1MD2 D;  2WB1 G;  2BDN A;  1LTB D;  4S3S A;  3ZJY C;  4OWX B;  4CKE A;  2Z6B A;  1I5F A;  3I73 A;  3NEM A;  4F8M A;  1I3Q B;  2JEA I;  1EY4 A;  4LMQ D;  1ASY A;  1SXT A;  3U4V A;  2BA1 A;  4Q5V A;  2XSC A;  4HMI A;  5EBC A;  4CDF C;  4IUT A;  5ELB A;  3S1R H;  1QVG A;  3VYU A;  1QCB D;  4QIW B;  4C3J B;  2Z4H A;  4LF8 L;  3GTL B;  1HRJ A;  5CV8 A;  4JI7 L;  1WTP A;  4FXG C;  2RHS B;  5A35 A;  4EX5 A;  3BVG A;  4GLX A;  1FR3 A;  3BDO A;  3BZK A;  3S1Q B;  4DV0 L;  1K3B C;  3VR6 A;  2IX0 A;  3PSI A;  3ND9 A;  4A3G B;  2AQ1 B;  3FP9 A;  3UDI A;  4HIO A;  2KEC A;  2YTY A;  3KF6 B;  1IW7 D;  1SFO B;  4XQQ A;  2YYZ A;  4CJ0 B;  4QMG A;  3J80 c;  1V9P A;  3CME A;  4P75 A;  3OIQ A;  3V05 A;  4UP7 A;  1L2F A;  3UDG A;  4UPA A;  2R7D A;  1BNZ A;  1ET6 A;  3PUX A;  3GTO B;  3EJI A;  2NWG A;  1FNU A;  1TWF B;  2FHT A;  3K80 C;  1I50 B;  5IYB G;  1STA A;  1D6E C;  4GKK L;  2ES2 A;  5ELO A;  1V1Q A;  1TWH B;  1JR0 D;  5M3M H;  2IHF A;  4FVM A;  1PH4 A;  2KHI A;  2ZTE A;  2OTL A;  4RGM A;  3I56 A;  2AQ2 B;  5HUR A;  1EFW A;  2I0Q A;  1L1O C;  2PYK A;  4IJH A;  4RCO A;  4YHH Q;  3W1B A;  1J5E Q;  1CFM A;  1JOQ A;  1W6J A;  3R3O A;  2QW7 A;  3F8T A;  5FOB B;  5C0X I;  3T1H L;  5CR3 A;  3K7A H;  4NXM L;  3HOV G;  1E7Z A;  2WKD A;  2NUC A;  3T4A C;  5FLX L;  2SOB A;  4A3D B;  5JJI A;  2HHH L;  4JI4 Q;  1HZB A;  4EQ5 A;  1ML0 D;  3L0O A;  1X56 A;  1LT3 D;  2NN6 H;  5C6A A;  1CQF A;  3AYH B;  4B9X A;  2J4X A;  5KEE A;  2JA7 G;  2CVR A;  1RL2 A;  4A3M H;  1JIC A;  1HR0 W;  1GUG A;  1ONL A;  4QJF A;  1X3Q A;  1XPO A;  1IZ6 A;  5GAG C;  5DNF A;  4IO9 A;  1CUK A;  2RQX A;  3L7Z C;  3L2P A;  2NVY H;  4HN7 A;  4PG3 A;  4NMZ A;  5DM7 3;  2F0W A;  3G48 A;  4HAE A;  1PH9 A;  4POF A;  3K58 A;  2MHV A;  4B3R Q;  2L1B A;  1TWC B;  3KF6 A;  1SDF A;  4U67 3;  4AH6 A;  1AH9 A;  4K5X A;  2KQ3 A;  1I4P A;  3OMC A;  4EQN A;  3HOY H;  2LFN A;  3A0J A;  1MHW C;  4A3J H;  1PV4 A;  1RKN A;  1YNX A;  3TP7 A;  3AQQ A;  2R7Z H;  5JJK A;  1JT8 A;  4XT1 B;  2EOT A;  4X3T A;  4YCV A;  2EZV A;  4KHP L;  1XWE A;  2I07 B;  3PMF A;  4FF1 A; 
#chains in the Genus database with same CATH homology
 2E5L Q;  1UE7 A;  5LMU L;  4LF6 L;  3CD6 A;  1L1O B;  2JA6 G;  1YJN A;  1E1O A;  4BBR H;  1PFS A;  3AEV A;  3S2H H;  4DPG A;  3TS0 A;  1H95 A;  3CPF A;  1X65 A;  1A0I A;  2H5X A;  3HOX G;  1EYG A;  2N3S A;  4QL5 A;  4A3D G;  3CCS A;  3FKI G;  3G4S A;  2KBN A;  2ZJQ A;  4BXX G;  4PZ7 A;  1E3P A;  4DAY B;  1E22 A;  4B3T L;  1N32 L;  4X65 Q;  4DUY Q;  1SLJ A;  1Z9F A;  4GN4 B;  1PH6 A;  2NVX H;  1PH1 A;  1KL9 A;  3RZD H;  4LF7 Q;  1YHB A;  1VQ6 A;  4LF4 Q;  1N8R C;  4JG2 A;  2KEN A;  1K3R A;  4JI6 L;  1S72 A;  5LMN Q;  3KFU A;  4JI5 Q;  4DR6 Q;  1VQF A;  4R4Q A;  1OTC A;  3M85 A;  3PV0 A;  4TQU S;  5AJ3 Q;  2DGY A;  4DV3 L;  1JJG A;  3Q8D A;  4HIM A;  5M5Y H;  1GM5 A;  2JA5 H;  3M7N A;  5M3M G;  5FJ8 H;  3E0E A;  1PH7 A;  2OTJ A;  4DK3 C;  3W5O A;  2AWO A;  4YWL A;  2UU9 L;  4LFB Q;  1EWI A;  4B3S L;  5H1S E;  3H0G H;  1QVF A;  4RMF A;  3CCM A;  3D31 A;  4DV5 L;  1HH2 P;  1LUZ A;  2MO0 A;  3K0X A;  5M5X H;  5IYC G;  3TRZ A;  4A3E G;  1XMO Q;  1M90 C;  1FL0 A;  1R9T H;  4L5S A;  1C9O A;  2D62 A;  2K14 A;  4UP9 A;  4OON A;  5M3F H;  1PYS B;  1AE3 A;  1A63 A;  5C44 G;  4C3H H;  1C0A A;  1EQQ A;  1W3S A;  2N78 A;  3K81 C;  2UXD L;  5HGQ A;  4DR1 L;  3KLW A;  1JJC B;  4NXN L;  4LF8 Q;  2R6G A;  2WB1 E;  3DLL A;  4LFA L;  3OTO Q;  3I4O A;  3NBH B;  4L5T A;  1N33 Q;  3HKZ G;  2CFM A;  4A3K G;  2B29 A;  4A3I G;  2N49 A;  4GOP C;  3STB D;  3D0F A;  5EAY A;  1WI5 A;  1Y1V H;  1EQR A;  2Q2H A;  1G51 A;  1SN8 A;  3HOW G;  4JOI C;  5BR8 L;  4ALP A;  4A76 A;  2VQF Q;  1VQ4 A;  1XNR Q;  2Z6K A;  4NB3 A;  4OX9 Q;  1K83 H;  4DV4 Q;  4YWM A;  2I5H A;  1VQO A;  3G6E A;  1NE3 A;  1J6Q A;  1VQB A;  3I4N H;  2HIV A;  3GTQ H;  5IP9 H;  1PH2 A;  1L1O A;  2R93 G;  5JEA J;  2CQO A;  2MNA A;  3I7F A;  2QEX A;  3LGJ A;  2AHO B;  1X3E A;  4DR4 Q;  4DNI A;  4HJA A;  4JI4 L;  1KAW A;  2GVA A;  3M9B A;  4A3B H;  1XNQ L;  1WCM H;  4UP8 A;  4DKA C;  4DV1 Q;  4DR4 L;  2WAQ E;  1UE6 A;  2F4V L;  3HOY G;  1N36 Q;  3PO2 G;  2HT1 A;  1YIT A;  4KHZ A;  4JI1 L;  1K9M C;  1SMX A;  4KLK A;  2QA4 A;  2EXD A;  4GKK Q;  4X66 L;  2B63 G;  4JI8 L;  3EBE A;  3MXN B;  4PZ8 A;  4GS3 A;  4YWK A;  1XMQ L;  1IBM Q;  3PF4 A;  1HNX L;  2F3I A;  3KJO A;  3U50 C;  4YCW A;  4K0K Q;  4LF9 Q;  3HFZ B;  3F2C A;  3GTM H;  3HOU G;  1IBL Q;  1HNZ Q;  3BZC A;  2Q2U A;  3UDF A;  2PNH A;  1X3G A;  4B3R L;  4OXP A;  4IPG A;  4JI2 Q;  3NEN A;  3E9I A;  3I4M G;  3EN2 A;  4QQB X;  4DR2 Q;  4DV7 L;  1YI2 A;  3RLF A;  2DUD A;  1KRT A;  1XPR A;  4LFC L;  3CCQ A;  2WFW A;  2CWP A;  2UUB Q;  3OYY A;  3RR5 A;  1K8A C;  4A93 G;  1GKH A;  2HHH Q;  2ATW A;  2UXC L;  4GKJ Q;  1E24 A;  3J81 i;  1JE5 A;  5IYB H;  1UE1 A;  4X62 Q;  3AFQ A;  1TWA H;  1EOV A;  3J7A 5;  4JBJ A;  4IJL A;  4X64 L;  1HJP A;  2NZH A;  2YTX A;  4H02 A;  4AQY L;  1NY4 A;  1S3O A;  1NJI C;  4BA2 I;  1IYJ B;  2IHE A;  2JA5 G;  1MKH A;  4JBW A;  1N34 Q;  4LUZ A;  5FJ8 G;  1W2B A;  1D8L A;  2E2I H;  4IOA A;  4X6A H;  1VQM A;  1FVI A;  1T9H A;  4HIK A;  3VDY A;  3T1Y L;  4GN3 B;  1AE2 A;  2KCM A;  2LXJ A;  2B3G A;  3K7U C;  5GQO A;  1A62 A;  3TS2 A;  3UDX A;  1YJ9 A;  2D0O A;  4A3F H;  4A3L H;  3RLN A;  1XTD A;  1UEB A;  4JYA L;  5IYD H;  2PQA B;  2JJQ A;  4YY3 L;  1B70 B;  1YBY A;  1Q8K A;  1VQ8 A;  3HOZ H;  1HZA A;  3F1Z A;  5C4X H;  4LWC A;  3ICE A;  1Q1E A;  1VQA A;  5IWA Q;  2UUC L;  4P73 A;  4JI3 Q;  3H3V I;  2F52 A;  3K8A A;  4JI5 L;  4DV6 Q;  1XJV A;  1JMC A;  4DR6 L;  4A3C H;  2EIF A;  4HJ9 A;  2JEB I;  4IOC A;  3CCV A;  2R92 H;  2K52 A;  3JC6 6;  4O2D A;  1HZC A;  3ER0 A;  3KF8 B;  3KJP A;  4R1J A;  2ZM6 L;  4Y7N H;  4R4C A;  3DM3 A;  3RN2 A;  1PH8 A;  1VQK A;  4RG1 A;  1GO3 E;  1Z47 A;  1CKO A;  4XTC S;  5HY6 A;  3TRE A;  4AIM A;  4DR5 Q;  1IL2 A;  4BBS H;  5FLM H;  4LFB L;  1X3F A;  3S17 H;  3CCR A;  1JB7 A;  2OWO A;  1DGS A;  4A4I A;  4OWW B;  5C3E H;  1TWF H;  1Q7Y C;  1D7Q A;  1I94 Q;  2AWN A;  2MO1 A;  3S2D H;  3HKS A;  3PUW A;  1ASZ A;  3I4N G;  1YVC A;  5IP9 G;  4ME3 A;  1K0R A;  4A75 A;  4B3T Q;  1N32 Q;  5JEA G;  2PI2 A;  1WJJ A;  1TWH H;  1OXX K;  2E2J H;  1FJG Q;  4AYB E;  5LMN W;  5ELN A;  2RHQ B;  3S1M H;  3OTO L;  4A3B G;  5IP7 H;  1HNW Q;  1WCM G;  2UUA Q;  1N33 L;  2QGQ A;  2HQL A;  4UY8 C;  1PH3 A;  1BBW A;  2XGT A;  5FLX c;  2WAQ G;  2YV5 A;  2CWA A;  1KC8 C;  4JI7 Q;  3JAM c;  1PH5 A;  1U5K A;  4C2M H;  1VQL A;  1SR3 A;  1VQJ A;  1BBU A;  1TWG H;  4DV3 Q;  3CC4 A;  1QUQ B;  4GN5 A;  4JCV E;  3CCU A;  2NN6 G;  4GNX C;  4LNQ A;  2UU9 Q;  4DV0 Q;  2YTV A;  3BU2 A;  2VQF L;  3HOX H;  4A3M G;  1K8G A;  2RF4 A;  3CCL A;  4B3S Q;  3STB C;  4DV4 L;  4P74 A;  4HJ5 A;  2I5M X;  3FKI H;  4DV5 Q;  4R4T A;  2WP8 J;  4BXX H;  3ULP A;  4IFD J;  2ZJR A;  2ZJP A;  3MEF A;  3CW2 C;  1PYB A;  1SE8 A;  4YHH L;  4MTN A;  2Y0S G;  1J5E L;  4JC0 A;  2JA8 G;  1KHI A;  1N9W A;  2VY3 A;  3IRB A;  1OXV A;  1VQI A;  1Y1W H;  3UE0 A;  3EIV A;  3GTK H;  2R7F A;  1WOC A;  4NXN Q;  4HJ8 A;  1N36 L;  1G6P A;  3B6Y A;  1IXR A;  3GTJ H;  1CKM A;  5GAE C;  4LW1 A;  1VQC A;  2KCT A;  4OO1 G;  1YHA A;  5JJK A;  2I5L X;  3PUV A;  1PA6 A;  4OWT B;  4LF5 Q;  4A3J G;  3TEH B;  1IBM L;  4WJ4 A;  2R7Z G;  2AMC B;  3J81 j;  4POG A;  3S1N H;  2VUM H;  2NN6 I;  3F2B A;  2CCZ A;  1BKB A;  3GTP H;  4LF9 L;  4K0K L;  2Z6K C;  2MFI A;  4BY7 G;  2K5V A;  2GN5 A;  1HR0 Q;  3KYH C;  4B3M L;  2NZO A;  1VQP A;  3S15 H;  4JI2 L;  2UXB L;  2EQS A;  3A74 A;  4BBR G;  4A3L G;  2VNU D;  5C44 H;  4DAM A;  3AFP A;  4DR7 Q;  4PZ6 A;  4BY1 H;  5IYD G;  5C0X J;  1V43 A;  2JA9 A;  3CP0 A;  2JE6 I;  1MJE A;  4JV5 L;  4TVA B;  2MQH A;  2IY5 B;  3CC7 A;  1VQD A;  3T1H Q;  4O0A A;  4NXM Q;  4GKJ L;  5E7N A;  3A5U A;  2VS1 A;  4DR3 L;  1PHJ A;  4JBM A;  1U0L A;  3PO3 H;  2FXQ A;  4J15 A;  1B7Y B;  4A3K H;  4A3C G;  1KD1 C;  4YCU A;  1I3Q H;  2VQE L;  1G29 1;  4A3I H;  4OO1 I;  4JI1 Q;  1IBK L;  4GNX B;  4GOP B;  3U58 A;  2R92 G;  1UE5 A;  5GRO A;  4X66 Q;  1XPU A;  2OCE A;  4JI8 Q;  3RNU A;  1EIY B;  1N34 L;  1HNX Q;  2HIX A;  4JBK A;  1OXU A;  3SGI A;  1L0W A;  2E5L L;  4JI0 Q;  5FLM G;  2GVB A;  3M4O H;  3PUZ A;  4IPD A;  4QIW E;  2CKZ B;  3PCO B;  1VQH A;  2PMZ E;  2AKW B;  2RCN A;  3S24 A;  2ASB A;  2Z0S A;  1MIU A;  1QUQ A;  5C3E G;  4C3J H;  2A1A A;  4DUZ Q;  2R93 H;  4MZ9 A;  3H0G G;  2BH8 A;  3GTL H;  3KDF B;  3RLO A;  1KQS A;  3PIP A;  1Y14 B;  2NVT H;  2A8V A;  2E8G A;  2JQO A;  3HOV H;  1MJC A;  4X65 L;  1Q1B A;  4DUY L;  3S16 H;  1KIX A;  1EIF A;  4JI3 L;  5IWA L;  5M3F G;  3CCE A;  2NVQ H;  3S1Q H;  4LF7 L;  2UXC Q;  2K75 A;  5K36 G;  1B8A A;  4LF4 L;  5IP7 G;  4AYB G;  4A3G H;  1VQ5 A;  4DV2 Q;  2OQK A;  5LMN L;  1YZ6 A;  1SFO H;  4X64 Q;  1QZH A;  2IX1 A;  4AQY Q;  2JA7 H;  4DR5 L;  4APV A;  2WB1 G;  5AJ3 L;  1VQG A;  1LYL A;  3ZJY C;  3CF5 A;  4DK6 C;  3I55 A;  2K4K A;  3HOU H;  4OWX B;  3NEL A;  3NEM A;  1I5F A;  4GLA C;  1KRS A;  1TXY A;  1YJW A;  2LXK A;  3CMA A;  1I94 L;  3BJU A;  1Y1V G;  5LMU Q;  1ASY A;  4LF6 Q;  2JEA I;  3CQZ H;  3T1Y Q;  3GTO H;  3I4M H;  3U4V A;  4IFD G;  1XMO L;  4JYA Q;  2BA1 A;  3OW2 A;  3GD7 A;  1YHQ A;  4YY3 Q;  1I50 H;  1FJG L;  4A93 H;  2XTI A;  3S1R H;  3H3V H;  1GD7 A;  1QVG A;  5JJL A;  3RZO H;  1Q82 C;  1Y1W G;  1HNW L;  3U4Z A;  2UUC Q;  2UUA L;  4Y52 H;  3PO2 H;  4LF8 L;  1FGU A;  3G71 A;  1X55 A;  1CKN B;  1VCI A;  4JI7 L;  4JI6 Q;  2RHS B;  1VQ7 A;  2ZM6 Q;  4BA1 I;  3I2Z A;  4EX5 A;  1NTG A;  4XIG S;  1OXT A;  4PMW A;  3W1G A;  4GLX A;  3BZK A;  4QY7 A;  3CXC A;  4DV0 L;  1K73 C;  2IX0 A;  2VUM G;  3PSI A;  4FDB A;  4GNX A;  3FP9 A;  4GOP A;  2JA6 H;  2LSS A;  3UDI A;  4HIO A;  3ULL A;  2YTY A;  3KF6 B;  4IPH A;  1XNR L;  4OX9 L;  1NMG A;  2YYZ A;  4A3D H;  3UE1 A;  4JOI A;  5GAD C;  2K5N A;  3RN5 A;  1SRO A;  4IPC A;  4IFD I;  3J80 c;  1V9P A;  1QZG A;  3CME A;  4BY1 G;  4P75 A;  3PIO A;  1C7Y A;  1VQ9 A;  1E1T A;  1KXL A;  4GLV B;  1UWV A;  4UP7 A;  3GO5 A;  3TQY A;  5C0X G;  3FHW A;  2BH2 A;  1L2F A;  1Q12 A;  2ID0 A;  1VQN A;  3UDG A;  3A5Z B;  2R7D A;  3KDF A;  4UPA A;  2N8N A;  2PI2 E;  1EUJ A;  3PUX A;  4HJ7 A;  3PF5 A;  2UXD Q;  4DR1 Q;  3PO3 G;  4DV1 L;  1JJ2 A;  4LF5 L;  2PQA A;  3K80 C;  4QGU A;  4LFA Q;  3JAM i;  1BVS A;  3ULJ A;  3M3Y H;  2C35 B;  5IYB G;  3E9H A;  4GKK L;  2ES2 A;  5ELO A;  4C3I H;  1M1K C;  3S14 H;  1V1Q A;  3PGZ A;  3PUY A;  5M3M H;  2IHF A;  1TWC H;  2BA0 A;  1HR0 L;  1O7I A;  2V1C C;  1PH4 A;  2KHI A;  2ZTE A;  4R4O A;  2OTL A;  1A8V A;  4L5R C;  1CSQ A;  2JK8 A;  2OQ0 A;  3M4P A;  3J80 i;  5BR8 Q;  3J7Z C;  1HNZ L;  5IYC H;  1WFQ A;  3I56 A;  1IBL L;  4DR7 L;  2K5H A;  1P16 A;  4A3E H;  1HZ9 A;  1X9N A;  1EFW A;  1L1O C;  4IJH A;  4L5Q A;  4YHH Q;  2I0Q A;  1PVO A;  3W1B A;  1J5E Q;  5DLQ E;  1OXS C;  4DR2 L;  3CPW A;  3F8T A;  5C0X I;  3T1H L;  4A3F G;  4NXM L;  3K7A H;  3HOV G;  1NMF A;  3GDE A;  3H15 A;  1WYD A;  2UUB L;  3HOZ G;  1E7Z A;  1QVC A;  5C4X G;  5JJI A;  2HHH L;  4JI4 Q;  1HZB A;  3HKZ E;  4EQ5 A;  4A3G G;  1XNQ Q;  3M4Q A;  4P71 A;  2D0P A;  4X62 L;  3J81 c;  4HID A;  4P72 A;  1VQE A;  2ALY B;  3L0O A;  2F4V Q;  3GTG H;  1LTL A;  1X56 A;  4NPS A;  3CC2 A;  3ERS X;  1YIJ A;  2Q2T A;  3AYH B;  5IT9 c;  2JA7 G;  1RL2 A;  4JI0 L;  4BY7 H;  4A3M H;  2Q2I A;  1HR0 W;  4WJ3 M;  1VS0 A;  1CKN A;  3CAM A;  1P8L A;  4QJF A;  1SRU A;  1XPO A;  1XMQ Q;  1IZ6 A;  5GAG C;  3HOW H;  3F2D A;  5C4J H;  4BBS G;  2L15 A;  2Y0S E;  1CUK A;  4DUZ L;  5IY0 A;  4IO9 A;  4B3M Q;  3L7Z C;  4LUO A;  3L2P A;  2NVY H;  4PG3 A;  3WWV A;  1Q86 C;  1YEZ A;  2A19 A;  2UXB Q;  1GVP A;  1LM0 A;  2VZA A;  3G48 A;  4MNO A;  2YU9 H;  1NBW A;  2JA8 H;  1PH9 A;  4POF A;  4R4I A;  4B3R Q;  2E2H H;  2K50 A;  5IE8 A;  4JV5 Q;  1Q46 A;  3KF6 A;  2ZTC A;  1I6H H;  1CSP A;  2IT1 A;  5J3B A;  4LUV A;  1Q81 C;  4AH6 A;  4DV7 Q;  1AH9 A;  2KHJ A;  4LFC Q;  4KI0 A;  4DR3 Q;  5GAH C;  4DV2 L;  1S40 A;  3HOY H;  4KHP Q;  1RIP A;  3A0J A;  4DV6 L;  4A3J H;  1PV4 A;  2VQE Q;  1YNX A;  2VW9 A;  1X6O A;  2VL6 A;  3AQQ A;  1IBK Q;  2R7Z H;  1JT8 A;  2ZTD A;  4YCV A;  2B63 H;  5M5W H;  4KHP L;  3CCJ A;  1X54 A;  3KOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...