1RDPD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rdpD00
1S5FD 4RH6A 3TSSA 3DWQA 4RHRA 5ELEA 1D5MC 1EFID 1UNSA 1V1PA 1AW7A 4K6LA 1KLUD 2G9HD 1SBBB 1EU4A 1LTID 3R2IA 1BXTA 2NTTA 3R8BA 1SXTA 4C56C 1AN8A 1I4RA 1TS5A 1V1PB 1DJRD 4O1NA 1I4HA 1ET9A 2WV6D 1XXGA 1I4QA 2CHBD 2AQ1B 1JCKB 1I4GA 1L0XB 1FNUA 1PRTC 1RF2D 4RHSA 1KTKA 2RDGA 1CK1A 5ELDA 1PTOH 1PTOC 1I4PA 1LTAD 4RFBA 1PRTB 1S5BD 1PZID 1FD7D 2IJ0A 2XRQD 2QILA 1MD2D 1PTOB 3GP7A 1QILA 3BZDB 2ICIA 1XTCD 3DWPA 1HA5A 1LT3D 1ENFA 2XNAC 1EWCA 1D5ZC 2NTSA 4L63B 4Z9CB 1EEID 2R61A 5FK9C 1T5XD 1RDPD 3W2DA 1M4VA 1STEA 1L0YB 1B44D 4TSSA 1LLRD 1DYQA 1JR0D 5FKAC 2AQ3B 2J4XA 1LT5D 1SEBD 5I4DA 1CT1D 1JWMD 1PRTF 1B1ZA 5ELFA 1PRTD 1LT4D 1RCVD 1CHPD 1LO5D 1PTOF 1TS2A 2XN9C 1D6EC 1PTOD 1G8ZD 4DXGA 2AQ2B 1D5XC 1BCPC 1SJHD 5D3DA 1RD9D 1TY2A 3MFGA 3KLSX 4BWGB 4DXFA 1FNWA 1JWSD 3OWEB 1F77A 2XRSD 4RGTA 1BCPB 4RGNA 1FNVA 1SE4A 3BYTB 3URYA 1LTGD 1PZKD 1FGBD 2TSSA 3DWAA 1S5CD 4L6TB 5ELBA 4RGOS 4ZYSA 1ET6A 3O13A 1UUPA 3EFXD 1HQRD 3EA6A 5ELCA 2Z8LA 3SEBA 1EEFD 1CQVA 2O2LD 1LTBD 3CHBD 1TS3A 1HTLD 2QEJC 4RCOA 1SE3A 4UDUC 1I4XA 3BYYB 3BVZA 1LTSD 3BVGA 4RGMA 2IPKD 1S5ED 1GOZA 1TY0A 1JQYD 1BCPF 3MC0B 1JWUD 4OHJA 1BCPD 1SE2A 2SEBD 2RDHA 1HXYD 3R2TA 1LTTD 3BVMA 1PYWD 5D3IB 1PZJD 1SJED 1EU3A 1V1OA 5TSSA 1S5DD 1TS4A 1LT6D 1KLGD 1CHQD 1ESFA 3V05A 1LTRD
chains in the Genus database with same CATH superfamily
4K5WA 1TWCB 1UNSA 1B3AA 1BXTA 4AIMA 1T9HA 3EBEA 1WTVA 3CCRA 4JCVE 1V1PB 3HOVB 1QNKA 1I4HA 1GHKA 1XNRL 2Z6BA 3M85A 4RKLA 2CHBD 5IY0A 3NP8A 4KHPQ 4HSPA 4TRDA 5C6AA 3E5SA 4QQBX 5IP9G 1SYDA 1TWHH 4FF2A 4RFBA 3SDZA 2KUMA 1PZID 1CKNA 2F03A 1YEZA 3VR2A 2XRQD 3GTLH 3AFQA 2IY5B 3DWPA 4BY7H 4IUVA 4MIUA 2Q8IB 2IX1A 4KD3A 1KAWA 3H15A 1WI5A 3QOJA 4JK1C 3MHBA 4X64L 4K0KL 1A15A 4Z9CB 2LY7A 1YVCA 2L9HA 1IBML 1STEA 5GADC 2CCZA 3M4PA 4XT1B 4QJFA 3QO2A 3UDFA 5JEAJ 1IBKL 3SVMA 3A5ZB 3FPUB 2A69C 3CC7A 5LMNL 5D65A 5BR8Q 2K5HA 1SEBD 1PRTF 1Q81C 1C0AA 1IKMA 1D6EC 4DUZQ 4P74A 3S17B 2RQXA 4KN7C 4GS3A 4B3MQ 3VYSA 1N34L 1K83B 4JI6Q 2RBMA 4ME5A 2F52A 3PO2G 1M1KC 3BDLA 4N9TA 3Q6SA 2A68C 3S14B 3UDXA 4RG1A 2F4VQ 2PQAA 2A5HA 1K3RA 4ZRZA 4LMQD 1KIXA 3Q23A 2MQHA 2FMMA 3Q24A 3S15H 3GTGB 3M7GA 2JJQA 1RTOA 3CHBD 2ZXRA 3HOYH 3T13A 3S1NB 1TWGH 2FINB 2NUCA 2AUJD 3G6EA 2E2IB 4BBSG 3PIP3 5JJLA 2R92G 1ZYRC 2RF4A 1JICA 5J22A 2F4IA 4A3DB 2GVAA 2ZJQA 1JWUD 2LSSA 1EOTA 4DR7L 5M3MB 2F0VA 3GTPB 3VA7A 3KF8A 4DV1Q 1LV9A 1VCIA 5IGCA 1N9WA 4LF7Q 2WB1B 2OF1A 1B3QA 5M5WB 5ELEA 1SMXA 3P7JA 1GKHA 1KNEA 1WTWA 4J6HA 3R8BA 1FR3A 4C56C 2ZM6Q 4A3JH 1CTMA 2N88A 4DF7A 3J81L 4K5XA 1Y69U 4X6AH 1ZKOA 3U9OA 2DJGC 1EQTA 3ONAB 3TDQA 4KHPL 1DOKA 2OTJA 2F0IA 3K5NA 1E0BA 3CW2C 3EROA 1SNOA 1EQVA 1VQLA 1EIFA 1MD2D 1TWHB 1HA5A 3OSOA 4RA8A 1XTDA 4CJ2C 1NMFA 2VZAA 2YTXA 4JC0A 4L63B 5FO8B 1EY4A 3GTLB 3SR1A 1A0IA 3RR5A 2UUBQ 2NN6G 3IRBA 2CVRA 3EJIA 3H0GH 1CFMA 4TSSA 1EZ8A 2EY5A 3TP7A 4JI5Q 1WFQA 5GAGC 3J81j 2QA4A 3N6RA 4Q5VA 4IQZA 5EKIA 2B8FA 5BR8L 5ISRA 1X65A 1LO5D 2M00A 2VQEL 5C4ZA 2WKDA 1A63A 1G6PA 2L11A 4YWLA 5JEAG 4DUZL 1D7QA 3UI2A 3KK7A 3PO3G 5LL6S 1F77A 4JI6L 4JI1L 2SNSA 1J8IA 4BS9A 5CV5A 4CDEC 4J8QA 1B8AA 4OELB 2F0KA 1QOHA 5E4WC 2F4VL 3EFXD 4JI0Q 3NQIA 5I9OA 1BOSA 1HPCA 3SEBA 5M5XH 2CWAA 1LTBD 3MZ5A 1CKMA 1HTLD 3RZDH 4KN4C 4PZ6A 2F0FA 4UDUC 2MP1A 5C0XJ 1QB5D 1PH3A 1SYCA 3S15B 2F0PA 1SYFA 3JAME 1OXUA 4LF6Q 5IT9c 1BCPF 2ZTEA 3NWSA 4ULLA 1IYVA 1PH1A 2JA8B 2B2WC 4DV5L 4MHEA 1M90C 1PXUA 3HOZG 4I7ZC 1YHAA 3Q22A 5JVH3 2H1EA 1EU3A 2Y0SG 2NB0A 3HG9A 2Q8TA 3RD4A 1GHJA 1EQRA 4DR6Q 2L12A 4LF7L 4HCSA 4IPCA 2I5HA 3X3MA 2L55A 4B9WA 2Z4HA 1VQOA 3PUVA 2ZM6L 1HQMC 5KRUA 3L7ZC 3RNUA 2C35B 1D1IA 1KTKA 1BF4A 4F87A 1O7IA 2R7FA 1FD7D 3GTOB 3CU7A 4FXGC 2L5TA 1E22A 1U5KA 1Y8PB 3I55A 1S3OA 4DV7Q 4C3IH 2R61A 4DV4Q 1HNWL 4LUVA 1IL2A 1XNQQ 3CMAA 2WAQE 4A3KG 2DNEA 4CJ0B 2VW9A 1I6HH 4U673 4GOPC 2ZJPA 3CRKC 1SR3A 1PMRA 3H0GB 1CT1D 2BE5D 1JWMD 5G3LD 4JI5L 5ELFA 1AP0A 1HA6A 2IW3A 1PTOD 4G7OC 4CKBA 1RD9D 2IHEA 1CKOA 3DEOA 3C1FA 2G5DA 1LTLA 2F0WA 4UP8A 3ULPA 1F9QA 1C8CA 1YHBA 3MA2B 1VQ8A 3CPWA 4MNOA 5E1FA 4A3BG 1Z7TA 1STAA 1EL0A 1VMPA 1O7YA 3HP3A 5FLMH 2DN8A 2F1MA 1QWYA 4WRDA 4DV3Q 1XWEA 1SMYD 2PI2A 4XYQA 2B29A 3KLSA 3ER0A 2NVXH 5IGEA 5M5XB 1SDFA 3BVGA 3OWFA 4OIJA 4QY7A 2YV5A 3J80i 1E2WA 3ND9A 4DAVA 1O7ZA 3EVQA 1MIUA 4LF6L 4OONA 3KDFB 5EAYA 5I6YA 4BBRH 4KY5A 1B70B 4R4QA 3NTHA 4C3HH 4G7HC 1F2ZA 2EYPA 1BO0A 3BDOA 1CHQD 3I4OA 5CGKA 1WD0A 1ESFA 3CQZH 5C0XG 4RH6A 5FJ8G 1QE6A 1IYJB 1Y14B 1YNJD 4C3JH 3HOXG 1YIJA 1SNPA 4UP9A 3H3VI 2NZHA 1QG7A 2RCFA 3RLOA 2OCEA 3H91A 1STGA 2RDGA 3NELA 2EY1A 1NY4A 3M4OH 1ESRA 4K5VA 2VQFL 1MJCA 4ZKCB 4LK1C 4DK0A 2ICIA 1XTCD 1X3PA 4HIOA 1TKWB 1V1QA 1CSQA 1EZ6A 1W3SA 4NMZA 3AQQA 5C5LA 2QDLA 1VF7A 3NSWA 3N52A 2NWGA 2R7ZH 3VR6A 1ONLA 1VQHA 1M4VA 2NYZD 3I3CA 2PPBC 3FKIH 3NEMA 1Y1VG 1JE4A 3QIAA 1PFBA 3WDNA 4C3IB 1NJIC 2HQLA 2XGTA 4R8IA 1B2TA 4DR1Q 5GAHC 1EYAA 4LF8Q 1LT5D 4R1JA 5ELOA 2ALYB 3B6YA 2VUMH 4HR7B 4EQPA 2PMZE 4GOPB 1PRTD 1Y1WH 5KIXA 1UEBA 2PNHA 3G48A 1IW7D 1J5EL 3T53B 2L4NA 5IGDA 1X55A 1IZ6A 3OWEB 5DM63 2K1BA 2B2UA 1LYLA 3PMFA 2OEOA 2KOLA 1WTPA 1WD1A 3A8IE 4O42A 2JA7G 5K36H 5GAEC 1HQRD 2O4XA 1HNXQ 1WTQA 3IAYA 2HUGA 3SXHA 1CQVA 3D3RA 5HY6A 2F0JA 4AYBG 4LF4Q 3I70A 4TKOB 3RZOH 4DV3L 3F2DA 2FMCA 3K5MA 1UEAB 2RHQB 1GOZA 4DV0L 1H9JA 1TWAH 1U4MA 2NVXB 3K81C 5IIFA 5IGFA 3HOWG 4HJ7A 4A93H 5D3IB 3TREA 2UXDL 5CBAE 1B50A 1SNDA 1TS4A 5C4XG 1KL9A 2XIWA 1TR5A 4BBRB 3A56A 1IYUA 2FHTA 4RKBA 4C3HB 3RUZA 1AW7A 4C1NK 1EU4A 1Q82C 4BY1G 3CF5A 3I4MG 1AEXA 3K5OA 3IKJA 4CBVA 4CKCA 2F0LA 1PV4A 2R3ZA 2K04A 4UPAA 5EBCA 3M3YB 2DY7A 4HMJA 4OL7A 3VYRA 1RF2D 4C3JB 4JYAQ 1JJGA 2K5NA 2B2WA 5I2YA 3D31A 1I4PA 1TWCH 5BN3A 2K5QA 3Q0AA 2F0OA 1O7LA 4A3FH 1JC7A 1STBA 2CQOA 3CCMA 1SNMA 3G6JB 3EIVA 3FP9A 3PQIA 5LMUQ 1N8RC 1HZ9A 2WAQG 5E7NA 4ZAIA 4LFCQ 2SOBA 1K73C 3M4OB 1N33Q 1DOLA 4K6DA 3J80L 4IURA 4IUPA 3VDYA 3DLLA 4A3IH 4DUYQ 4HIDA 3FKIB 1RL2A 1TIID 1WCMH 2Z4IA 4TQUS 4DR1L 3MEHA 2K50A 4LF8L 4ILWA 2EYOA 3F1ZA 4POFA 1KDAA 3G4SA 3S1QH 2R93G 4L8JA 2NVTH 3HOUB 1Y1WB 3TS2A 1FNWA 5C3WA 2PW5A 1L1OB 1HR0W 1I3QH 2K5VA 2F0QA 1PZKD 4XQQA 1JB7A 5FLMG 1B9MA 4KD4A 1DXMA 2CQAA 4U68A 4GOPA 2ZXPA 4N8FA 4EQNA 1PH5A 5JJIA 1SROA 5F2DA 1L0WA 2JA6G 2A74C 3S17H 1XPOA 2VNUD 3OOCA 3U9SA 5IYBH 4O2DA 4BXXH 4JOIA 1K83H 3W3AA 1QCBD 1K8AC 2JYOA 4QCLA 1I4XA 1MGSA 2VB2X 4HJ8A 4BA2I 2EVBA 3P20A 2FJ2A 3RZOB 1BCPD 4KLKA 4A3GG 3E3XA 2VB3X 3BVMA 2I5MX 3A0JA 2VS1A 4PMBA 3GTGH 3U4VA 1TWAB 1KLGD 3S1NH 3CCVA 2BDNA 2FXQA 4A93B 2OXPA 4A3MG 1J6QA 4MZ9A 2V4DA 2WINB 4S3SA 4A3EH 2JP1A 2V1CC 4RMFA 1TS5A 4RWSC 5T1IA 2WV6D 3ERQA 3GTPH 1C4QA 4IZ8A 4K2KA 4WORA 3V96A 2NVYB 4K8IA 4LNQA 1UAPA 3T1YL 2DJFC 2EXDA 3MEFA 1CK1A 4GZYC 1PTOH 1PTOC 5J39A 5M5WH 4JI7Q 1BVSA 1LTAD 3U50C 1E2ZA 1TXYA 1HR0Q 3ITPA 2X6LA 2CFMA 3KF6A 3S9WA 4DR2L 1QZHA 1KRSA 5C44H 1NMGA 2YYZA 4OX9Q 1NR2A 3ERSX 5LMUL 4A3FB 1GUNA 2N3SA 4LFCL 2Y0SE 3T16A 2QGQA 1R4PB 1N33L 1P8LA 5IGGA 4DAPA 2EIFA 3I4NB 1SMYC 4DUYL 4JBMA 4BBSB 2OQ0A 3D6WA 1MJEA 3D4WA 2B39A 4A3IB 2K7VA 4J1MA 4XXEA 1LT4D 1RCVD 4OO1G 2R6GA 2XN9C 4JG2A 5LL6X 2EYLA 4DV6L 1WCMB 1SJHD 5KYIA 1Y8NB 4EQOA 4P72A 1SNCA 3S1QB 4DGZA 5DNFA 1ILQA 5EJWA 4P73A 2NVTB 5IP7G 3OMCA 3EQLC 1FGBD 4ZYSA 4FO2A 1AZQA 3O13A 1EWHA 3J81c 2B2VA 3K80C 2ASBA 1I3QB 3HS0C 1YNJC 4OGQC 4X66Q 1Q8IA 5HGTA 2VQEQ 3PUXA 4QUFA 4A3LH 1FGUA 2BOSA 3T56B 3RN2A 4CKEA 5FLXE 1N32Q 1L1OA 4FP5D 2HCCA 4B3SL 4JI1Q 5IYDH 5J3BA 2E8GA 1S72A 2E74C 4IFDI 1GXDC 1VQPA 3FVQA 5KEEA 1S5DD 3QJYA 2N8NA 2ZT9C 2QEXA 2HIXA 3TSSA 1Q8KA 2G9HD 3K59A 1VQCA 2WFWA 1AN8A 5C3EG 2JA8H 2ZJRA 1SYEA 5CV8A 4A3EB 2ZTDA 3CMEA 4DV5Q 1I4GA 1L0XB 1PRTC 2O5JC 1WOCA 1PFSA 3HOVG 1IW7C 2Z0SA 2ZTCA 3CCLA 2UUAQ 4X3TA 1VQDA 5ELNA 4JI7L 1A3TA 4I65A 1PTOB 3BZDB 3VR4A 2MHVA 1BBXC 1HR0L 2EZVA 1Z9FA 2HHHQ 4DNIA 2A6HC 4OX9L 3UDIA 2UXCL 4OWTB 5C44B 3GTQB 3W2DA 5IYCH 1BBWA 3GV6A 1SN8A 2SNMA 3LWUA 3C3LA 1DYQA 1II3A 4NKLA 3A74A 3RLFA 3GTOH 1HCZA 4QGUA 1V43A 1PH4A 3W5OA 4Y7NH 3CD6A 2EDGA 2IT1A 4JV5Q 1EY9A 1AE2A 4IOCA 3HOZB 1IHZA 1TY2A 1HNWQ 2M9VA 2B2UC 1B53A 1GO3E 2VL6A 2D5DA 4NXML 3FEWX 1F2YA 1VQ9A 1TQOA 1S5CD 1PLFA 1DM0B 2IWHA 2Z6KA 1UUPA 5FOBB 3JAML 2Z1CA 4IFDH 1C48A 2Q8RE 3EN2A 1VQ6A 2F0MA 2JA5H 2CWPA 1UE7A 4ZQ3A 4X66L 1J9OA 1TS3A 2OTLA 4R4TA 1MKHA 4YCUA 5A2QE 1GJXA 4G57A 4ODGA 4P2CB 5KNDA 1EQQA 2M2LA 1N32L 3HKZG 2K05A 3D8GA 1EIYB 1I94L 4B9XA 2UU9Q 1BQQT 4A3DG 4NXNQ 4X3SA 5ELDA 3E0JA 1X3FA 4A3CG 4A3KB 2MUYA 5M3MG 5M3FG 1C9OA 2K28A 2NTTA 3DUZA 4IN3A 4K8JA 2KBNA 1EY6A 2EYFA 2WIIB 3IL8A 2K6AA 3PIOA 4R9WA 1FNUA 2G9DA 2LKVA 1X54A 4AYBE 2B2TA 4XIGS 1HTPA 3VYUA 3I7FA 1PRTB 3GD7A 4LWCA 3SK8A 3OW7A 3GP7A 2YU9H 5I2XA 2UUAL 3QG1A 5C3XA 2JN4A 2NZ1D 4I7AA 2XSCA 4UY8C 1F9RA 1LT3D 4KY7A 5JJZA 4LAAA 1K8GA 1SFOH 4N9PA 4CGYB 3PUYA 1EYDA 2HHHL 2AKWB 1GVPA 4FNFA 3LWEA 1B4OA 1JR0D 4MTNA 3D4RA 4FVMA 1BKBA 3MXNB 2VQFQ 4BY7G 5DEHA 3D0FA 1KNAA 1PH7A 4X62Q 2EQSA 1BCPC 1ICWA 4JV5L 4LFAL 4Y7NB 2IHFA 1ILPA 1FNVA 3URYA 1HUNA 4KHVA 4IUQA 1B9NA 3W1BA 1E24A 2MFIA 2Q2HA 4QUCA 3CCUA 1STNA 4JOIC 5L37A 4IO9A 2O2LD 1VS0A 4LUZA 1FL0A 3OTOQ 4FF3A 1J5EQ 4EGVA 4CJ1B 2JA5B 1LACA 2E2JH 4ZK9B 1E3PA 4UP7A 4HJ5A 4YHHQ 3QOLA 4IUNA 4BA1I 1PYWD 2B63H 1V1OA 5TSSA 3HOYG 1ZXTA 2RHSB 3D6CA 3OHXC 1QJOA 1CA5A 3UE1A 2UU9L 3MXGA 1Y1VB 2XTIA 3DXJC 1YHQA 4NXNL 1SYGA 4WJ4A 1WJJA 4TVAB 4GN5A 4DV0Q 1DJRD 1NR4A 3S2HH 3SK6A 5JPMC 3S24A 2UXDQ 1PH8A 2F0TA 1VQGA 1VQIA 4JVZA 1UE5A 1KC8C 4OO1I 2IJ0A 1IBLQ 5A35A 2K4KA 2QILA 1D2BA 2KECA 1PH2A 1TT2A 4QB4A 4ZUJA 4A3JG 2XNAC 1EWCA 2AUKA 3M3YH 1ENCA 4K14A 4G7ZC 1SYBA 2YU9B 3SHLA 3CP0A 4WJ3M 5CV7A 1SFOB 1HH2P 4XDXA 5EPJA 5IT9E 1SAPA 4QMGA 1QZGA 2E76C 3MXUA 3C46A 1XYIA 3I90A 2KENA 3NTKA 4UAIA 5D3DA 1KRTA 3GO5A 5C4HA 4X62L 3H0GG 4IUTA 3KLSX 3PV0A 5EQ0A 4L5SA 1L2FA 3ZYYX 4H0LC 1BCPB 2PCFB 2E2HH 3TP6A 3RN5A 1EOVA 1LTGD 1IKLA 3MXNA 3A7LA 2P5ZX 1ET6A 2B2VC 4KI0A 2H5XA 2Z8LA 4NB3A 3HOUH 4A4IA 2RCNA 4CDCC 3A5UA 4RCOA 1L1OC 1TWFB 3OTOL 2RVLA 2IPKD 2A1AA 4DR4Q 2WAQB 1HZAA 2RDHA 1HXYD 3R2TA 2E2JB 3J80c 4YHHL 1OXTA 4LF5Q 1Q90A 3AB9A 3KLWA 3C1EA 1R4QB 3PSIA 2BH8A 1DOMA 1A6XA 2RA4A 2HDMA 3AU7A 5IP9H 3BDCA 3DWQA 2B63B 4RHRA 1K8OA 2F3IA 3J7ZC 3GTJH 1WTXA 1RODA 4YIJA 2MJ8A 1GUWA 2I0QA 4FDBA 3CC2A 2D2CC 3M4QA 2TMPA 1JCKB 2E75C 2R93B 3S2HB 1A8VA 5JJKA 1VQKA 1NTGA 3H3VH 3H3VC 2PZTA 3NWTA 4DK6C 4GLVB 1IBLL 4DK1A 1QVFA 3KF6B 2D0PA 1KQSA 1DONA 2NVYH 1X32A 2JA6B 2KHSA 1E1OA 3STBD 1XMQQ 2NN6I 4PMCA 2GVBA 3T1YQ 4F7XA 2LXJA 3PO2H 3BJUA 4R8NA 4ZUIA 1PVOA 1QVCA 3F2UA 1VQ5A 3UE0A 4HIKA 1B1ZA 4ZKBB 4DR2Q 2A8VA 1A2TA 4PNYA 4GKJQ 4C3IG 4A3GB 5C5MA 2UUCL 1ENAA 1G8ZD 2J0TD 1NBWA 1P16A 1D5XC 3SE0A 2NVQB 3NTIA 1W2BA 3MXPA 2XVSA 2B3GA 4BWGB 3I4NH 4DXFA 3TS0A 4WJWA 2CW0D 1LM0A 4R4IA 4A3MB 2F3WA 4BBSH 3BYTB 1HNZL 3WWVA 2R92H 2Z6KC 4B3RQ 4X65Q 2AHOB 2AMCB 2OT2A 3TEHB 3PGZA 4KKUA 3GQBA 3OW2A 2E2HB 4Y52H 3HFZB 1K9MC 4A75A 5CC4A 1A2UA 1KXLA 3E0EA 4DV6Q 1V8QA 3K0XA 3KJPA 1W6KA 3J7AF 3L2PA 1EY0A 3FDTA 4RGMA 3MVVA 3NUCA 4JBKA 2K5WA 1SE2A 4P71A 1WTHA 5C4JH 1LTTD 4DR4L 1PZJD 1WTOA 2NZOA 2KEEA 5EPKA 4LF5L 4DU9A 2PMZB 1LTRD 1S5FD 3VR3A 1HRJA 4KMUC 3BG3A 3E9HA 4DPGA 2ZXOA 5IGBA 4L5RC 1CZWA 4B3SQ 3GTKH 1UE1A 3ND8A 4KKTA 1ET9A 5HURA 4BBRG 3GTJB 1S40A 4DNTB 4C3HG 2L0CA 4YCWA 3PIO3 4FXDA 2B2TC 2NN6H 4H44C 3ULJA 2HDLA 4ABNA 3AEVA 2JA9A 1EFWA 1GUGA 4HSVA 1N36L 4FF1A 3CCEA 3S1MB 3HKZE 1YZ6A 4IPGA 4C3JG 4JBWA 3PF4A 1U0LA 4C2MH 5EPLA 4V190 1EEID 5GQOA 3J81i 4KJNA 1F9SA 3WOEA 5JEAH 1ML0D 2BE5C 1XMQL 2BDOA 3PO3H 4DAYA 1W6JA 5CMDA 1KDBA 1RKNA 1WYDA 2AQ3B 4POGA 3GTMH 5COYA 2LXKA 3E6ZX 2JXMB 3PO2B 1YJNA 1CA6A 1FYCA 2R7ZG 2QDBA 4GKJL 3GTQH 3FKIG 4UHVA 4YWKA 2K52A 4DV2L 2UXCQ 5LHY1 4B3TL 1EYGA 1HFNA 3X3NA 1KABA 3LGJA 1GD7A 2XWJB 1EIGA 4DK3C 1BBUA 2VUMG 1I6VC 5FLXL 1EIHA 2ATWA 4X65L 1Y1WG 4B3RL 5EKKA 3M7NA 2R92B 5JVG3 5ELCA 1NUCA 4CHTB 3HOZH 3OIPA 3CKIB 4LFBL 3SK4A 1JJ2A 2QW7A 1SE3A 1NCVA 2E2DC 3AFPA 5CYUA 4IUUA 1I50H 4NXMQ 5AFWA 5K36G 3C2PA 3VYTA 1HZCA 1HUMA 4AQYL 1S4ZA 1CI3M 3PCOB 1A3VA 4HCEA 1VQ4A 1HJPA 1LT6D 5JAVA 4XQJA 5C4JB 1Y8OB 4JI2Q 4X3KA 3TBIB 5C0XI 1JOQA 1UE6A 3J7AV 1D5MC 1ICFB 4KTAA 2MPMA 2EPBA 2KCMA 3I91A 3NPPA 4ZCKA 1G2TA 2C9OA 2PI2E 3SK5A 3E9IA 3GV3A 1NSNS 4A93G 1K0SA 3VA5A 4GNXC 1XXGA 1XJVA 5NUCA 1OXXK 2LMCB 3GTKB 4RHSA 2D0OA 2K01A 2X69A 1STYA 3I72A 4EVOA 1I94Q 1H9SA 4FXKC 4A3KH 5AJ3Q 1F2MA 4DFAA 3MFYA 5BN5A 1AE3A 1QILA 3JAMc 4MTKA 4PG3A 1I5FA 3T4AC 1ENFA 2RSNA 2NTSA 2N78A 5CR3A 1YNND 2E5LQ 2A6ED 4KHZA 1UWVA 4JI4Q 3NQTA 4JI8Q 5JOBA 3TN2A 1YITA 2IX0A 2PZUA 4C2MB 4IPDA 3BZCA 4A3FG 4GN4B 2J4XA 2B8GA 4A3BH 4GKKQ 3TP8A 4QL5A 3PO3B 3HKZB 2ENBA 2PQEA 3TRZA 2Q2UA 3I4NG 1EWIA 4PZ7A 3GTMB 4DXGA 3L9AX 1H9KA 3FPPA 4XYOA 3MFGA 1NNXA 5DLQE 2GN5A 4A3IG 4RGNA 4HAEA 1H9MA 1Z47A 4RGTA 5T1GA 2EE1A 3A8JE 5A2QL 1BR9A 1OXVA 5M9OA 1WCMG 3CAMA 4L6TB 3LNNA 2AWNA 1XMOQ 5M3FB 1PFMA 1CUKA 2PYKA 1C7YA 1VQNA 5HGQA 1G2SA 3I73A 5GROA 1EUJA 1XPUA 4LF9L 2YTVA 4NPSA 3U58A 4LFAQ 3A55A 2N49A 5C0XH 4QIWE 3BYYB 4HEDA 3S2DH 5FJ8H 2Y0SB 4O0AA 2AWOA 1JMCA 1QNUA 1VDZA 2EXZA 4IJLA 4DR5Q 3HOXH 1Q1BA 3I8ZA 5JPNC 1EY8A 1I50B 4GLAC 5IYBG 4BXXG 4L5QA 1BUVT 1QUQB 1RIPA 1YNXA 4OWWB 4IOAA 1NAPA 3STBC 4JI2L 1V1PA 4XQNA 4K6LA 4X3UA 3R2IA 1LABA 1O78A 3A54A 4HMIA 2FFKB 1X9NA 1G291 4BY7B 4P75A 5CV6A 1DD2A 3QB3A 4WFN3 1X56A 2JEAI 2RSOA 2ICEC 5KGUA 4KY6A 4GNXB 1Y1VH 1STHA 1IXRA 3L0OA 5FO9B 4YY3Q 5CORA 4B08A 4A3EG 2B2YA 3BS1A 5AJ3L 4HTHA 2CW0C 4ALPA 3J81E 1MSHA 4H02A 2HT1A 2X6GA 5D14A 4NW2A 3KUPA 5FK9C 4B3ML 4HIMA 4JW0A 2E5LL 4FYDA 2WB1G 3DMUA 3P1HA 1GUTA 4JI4L 3QR8A 4JI8L 1MI2A 2A73B 2KJXA 1V9PA 3L3OC 5C44G 1PH9A 2JSOA 2OWOA 2JA7H 3FRPB 3K7UC 3ZJYC 4GKKL 5K5PA 4A3BB 2AQ2B 3K58A 1VQBA 3ULLA 3R93A 1PYBA 3RMHA 5I9PA 2NBFA 2HIVA 3KBXA 3HOYB 1JWSD 1TWGB 1SRUA 2CKZB 3W1GA 2XRSD 1BDOA 4QF4A 3HZXA 5ELBA 1VQ7A 3JC66 3T1HQ 2K75A 1XMOL 3HOWH 3BZKA 3EA6A 4J15A 4IFDJ 4DV1L 4Q0FA 2VY3A 5E4XA 1VQAA 5C4XH 1PA6A 2RKSA 3TP5A 3F2CA 1PFNA 4GN3B 2DGYA 2EJGC 3NK9A 4ME3A 2UXBQ 4R4OA 1SLJA 4PQXA 4BY1H 3I4MH 2K33A 4OHJA 1X3GA 2BA0A 2SEBD 2SDFA 3S2DB 1T5EA 4A3JB 1KHIA 4DR5L 1H95A 1Q46A 4AH6A 1EY7A 1SJED 3HOXB 4A3LG 5CV9A 3NE5B 4V0BA 3FMCA 3NBHB 5EGTA 3BU2A 2F0UA 3CPFA 1MBYA 2R7DA 1TWFH 2VXWA 2XWBB 3AYHB 5M5YH 3CCQA 1ASYA 2MGSA 4YCVA 5IYDG 4QIWB 1LTID 1SXTA 1VQJA 1U4PA 1I4QA 1JOOA 3H09A 2AQ1B 2UUBL 1QUQA 5CBEE 3HGBA 3OIQA 1AFPA 4G4KA 3Q8DA 1Q1EA 4YY3L 5KYLA 2JA8G 1A62A 2BH2A 1PYSB 3DEPA 5IT9L 1JT8A 2PZWA 3T51B 5EKLA 2HD3A 5EBDA 4E6IA 2R93H 2EYHA 4ZLTF 1T5XD 1F2LA 1JORA 2Q2IA 4YWMA 1L0YB 3KBGA 4GNXA 2PNRC 1AZPA 3ICEA 3HKSA 1MHWC 1EYCA 3K8AA 1HFGA 3MTSA 2CH4A 2LS01 5I4DA 2F0EA 4DN4M 1D8LA 4JI0L 1SNQA 1BNZA 2F0GA 4APVA 3OYYA 2JA6H 5IYCG 2JA7B 1AH9A 3RZDB 1VMCA 2I5LX 1CSPA 4F8MA 1CQFA 3TQYA 5KNCA 3M4YA 4HN7A 1OO9B 2TSSA 2KHJA 2H4OA 4M1UB 3K6OA 4AYBB 4RGOS 2LFNA 2PW7A 4A3GH 3NENA 1D1KA 3T1HL 3P75A 2UUCQ 2KQ3A 4EX5A 2A69D 2NVQH 3WOFA 1QVGA 2HQEA 1TU2B 4JI3Q 2QEJC 3PIPA 3I56A 4DR6L 1WTRA 2KCTA 3HOWB 2GA4B 1E2VA 3G71A 4A3MH 1G91A 1PHJA 1LTSD 3OMGA 5C4XB 4GLXA 2EY2A 1HNZQ 2UXBL 1VQMA 1E7ZA 2KHIA 1EY5A 4IFDG 3MAQA 2MO0A 4R4CA 3DM3A 2JA5G 2F0DA 4BY1B 3I4MB 4KKSA 5IE8A 2BCOA 3PUZA 2A68D 1YNNC 4DNRB 3V05A 2Z9HA 1O80A 1SE8A 2A6EC 4H13C 1U4RA 3V2TA 4OIKA 4DR3Q 4PMWA 3DHQA 1SBBB 4N8X1 5KNBA 5I6WA 5M5YB 4DV7L 3QWNA 4DV4L 3S1RH 2EY6A 1YJ9A 1XPRA 2IL8A 1Q7YC 2N55A 5J1ZA 1XNQL 2EYMA 4A76A 1KDCA 3VR5A 1G6ZA 1ZYRD 2CH4W 3NBHA 4C1NI 5IODA 1B7YB 2K32A 1I6HB 1JE5A 1F9PA 3K57A 3LX0A 2K5DA 1KAAA 1D5ZC 4ID6A 4OO1H 1RJTA 1PDQA 3DM1A 4IJHA 4RCNA 3K7AH 1CM9A 1B44D 2D9UA 2A6HD 2K14A 3S1MH 3CC4A 3KYHC 5FKAC 5IP7H 1N36Q 4DAYB 1VQEA 2JQOA 1FJGQ 2Q2TA 2ES2A 1TS2A 3MWYW 2EJMA 2QKIC 1JB3A 1X3QA 5IWAQ 1HZBA 2MO1A 4CDDC 4HJAA 1Q3LA 2IX3A 4KV6A 4MN3A 4DKAC 5IOCA 2C5CA 3S16H 2L1BA 1H9RA 3GDEA 3RLNA 3F8TA 1DGSA 3DWAA 4XTCS 3U4ZA 3FHWA 1YBYA 4OEMB 3KLRA 3AMUA 4M8AA 3CCSA 1G51A 3I4LA 2K03A 3K5LA 2DUDA 1ZEQX 1Z6HA 1E1TA 2QF7A 3HEJA 3NHHA 3TMEA 5DM73 3PF5A 1X6OA 5LMNW 2EJFC 3CCJA 4DV2Q 2PO4A 4B3TQ 2BA1A 3CQZB 1WVLA 4JI3L 1X3EA 3BVZA 3KDFA 1R9TH 1S5ED 1K0RA 1JQYD 1RHPA 3KOJA 5C3EH 3KJOA 1VF5C 2JEBI 1A3UA 4NDXA 1JJCB 2RDFA 1TVXA 3PUWA 4L5TA 2F0SA 1KD1C 4LFBQ 1M8AA 5DAUA 3HOVH 4LUOA 2O5IC 1XX8A 2KCNA 1CKNB 1EFID 4LW1A 1KLUD 3M9BA 4F88A 1XNRQ 1NE3A 1I4RA 4DR3L 2F0HA 4JBJA 3HRZC 4O1NA 2F0NA 3IFDA 4LJZC 1HHVA 2B63G 1PH6A 2QCPX 4NP5A 5H1SE 4AQYQ 2R7ZB 1DZ1A 3A7AB 3S1RB 2DY8A 3R3OA 2JK8A 1S5BD 1SSOA 1H9SB 2B2YC 5FLXc 4OXPA 1ASZA 2YTYA 1YI2A 2WP8J 2VUMB 3H6MA 2JE6I 4X64Q 4K0KQ 1K28A 3H94A 1IBMQ 5CV4A 4K2LA 2WACA 3F2BA 2HCIA 1RDPD 1OXSC 1IBKQ 1FVIA 2EOTA 2OQKA 3G7LA 2KVMA 2MNAA 5LMNQ 1LLRD 4KK7A 3NXWA 1YJWA 2KEDA 3KFUA 1VQFA 3K7AB 2DNCA 5G3LF 1IL8A 1Q12A 2PQAB 1DCZA 2EYJA 3J80E 2I07B 4XT3B 1CHPD 1PTOF 1HNXL 1FJGL 5BN4A 1U4LA 1N34Q 1K3BC 1RTNA 3NBIA 4EQ5A 4LF4L 2A19A 3S14H 5IWAL 2J7ZA 2L15A 2D62A 4RAUC 1SE4A 4DAMA 3UDGA 3J7YW 3TZUA 1K8MA 1LUZA 1U9RA 3CXCA 1GM5A 1OTCA 2KCCA 4OWXB 3S16B 4CDFC 1Q86C 3TZDA 2F3VA 2I46A 2E2IH 3A8KE 3OPOA 2WB1E 1EEFD 3KF8B 4PZ8A 3CRLC 3D4DA 3J7A5 4PV1C 4IPHA 3I2ZA 4A3DH 4KJOA 5FO7B 4A3CH 4IALA 5M3MH 1JOKA 1TY0A 5M3FH 2KA7A 4DR7Q 3MC0B 1GUOA 3IFTA 4HJ9A 1R9TB 4JYAL 1GUSA 4H7BA 2ID0A 4DA2A 3JAMi 3HOUG 3K0YA 5E3FA 3SGIA 5C3EB 4JPBW 4FF4A 2WKCA 1MSGA 4LF9Q 1CZGA
chains in the Genus database with same CATH topology
4K5WA 1TWCB 1UNSA 1B3AA 1BXTA 1WTVA 3HOVB 1V1PB 1QNKA 1I4HA 1GHKA 3M85A 4RKLA 2CHBD 3NP8A 4HSPA 4TRDA 5C6AA 3E5SA 1SYDA 4FF2A 4RFBA 3SDZA 2KUMA 1PZID 2F03A 3VR2A 2XRQD 3DWPA 4IUVA 4MIUA 2Q8IB 2IX1A 4KD3A 3QOJA 4JK1C 3MHBA 1A15A 4Z9CB 2LY7A 2L9HA 1STEA 4XT1B 3QO2A 5JEAJ 3SVMA 3FPUB 2A69C 5D65A 1SEBD 1PRTF 1IKMA 1D6EC 3S17B 2RQXA 4KN7C 3VYSA 1K83B 2RBMA 4ME5A 3BDLA 4N9TA 3Q6SA 2A68C 3S14B 2A5HA 4ZRZA 4LMQD 3Q23A 2FMMA 3Q24A 3GTGB 3M7GA 1RTOA 3CHBD 2ZXRA 3T13A 3S1NB 2FINB 2NUCA 2AUJD 2E2IB 3PIP3 1ZYRC 1JICA 5J22A 2F4IA 4A3DB 1JWUD 1EOTA 5M3MB 2F0VA 3GTPB 3VA7A 3KF8A 1LV9A 1VCIA 5IGCA 2WB1B 2OF1A 5M5WB 5ELEA 3P7JA 1KNEA 1WTWA 4J6HA 3R8BA 1FR3A 4C56C 1CTMA 2N88A 4DF7A 3J81L 4K5XA 1Y69U 1ZKOA 3U9OA 1EQTA 3ONAB 3TDQA 1DOKA 2F0IA 3K5NA 1E0BA 3EROA 1SNOA 1EQVA 1MD2D 1TWHB 1HA5A 3OSOA 4RA8A 4CJ2C 5FO8B 4L63B 1EY4A 3GTLB 3SR1A 2NN6G 2CVRA 3EJIA 1CFMA 4TSSA 1EZ8A 2EY5A 3TP7A 3N6RA 4Q5VA 4IQZA 5EKIA 2B8FA 5ISRA 1LO5D 2M00A 5C4ZA 2WKDA 2L11A 5JEAG 3UI2A 3KK7A 5LL6S 1F77A 2SNSA 1J8IA 4BS9A 5CV5A 4J8QA 2F0KA 1QOHA 5E4WC 3EFXD 3NQIA 5I9OA 1BOSA 1HPCA 3SEBA 1LTBD 3MZ5A 1HTLD 4KN4C 2F0FA 4UDUC 2MP1A 5C0XJ 1QB5D 1SYCA 3S15B 2F0PA 1SYFA 3JAME 1OXUA 1BCPF 3NWSA 4ULLA 1IYVA 2JA8B 2B2WC 4MHEA 1PXUA 4I7ZC 3Q22A 5JVH3 2H1EA 1EU3A 2NB0A 3HG9A 2Q8TA 3RD4A 1GHJA 2L12A 4HCSA 3X3MA 2L55A 4B9WA 2Z4HA 3PUVA 1HQMC 5KRUA 3L7ZC 1D1IA 1KTKA 1BF4A 4F87A 1FD7D 3GTOB 3CU7A 4FXGC 2L5TA 1Y8PB 2R61A 2DNEA 4CJ0B 4U673 3CRKC 1PMRA 3H0GB 1CT1D 2BE5D 1JWMD 5G3LD 5ELFA 1AP0A 1HA6A 2IW3A 1PTOD 4G7OC 4CKBA 1RD9D 3DEOA 3C1FA 2F0WA 1F9QA 1C8CA 3MA2B 5E1FA 1Z7TA 1STAA 1EL0A 1VMPA 1O7YA 3HP3A 2DN8A 2F1MA 1QWYA 4WRDA 1XWEA 1SMYD 4XYQA 3KLSA 5IGEA 5M5XB 1SDFA 3BVGA 3OWFA 4OIJA 1E2WA 3ND9A 4DAVA 1O7ZA 3EVQA 5I6YA 4KY5A 3NTHA 4G7HC 1F2ZA 2EYPA 1BO0A 3BDOA 1CHQD 5CGKA 1WD0A 1ESFA 5C0XG 4RH6A 1QE6A 1YNJD 1SNPA 1QG7A 3H91A 1STGA 2RDGA 2EY1A 1ESRA 4K5VA 4ZKCB 4LK1C 4DK0A 2ICIA 1XTCD 1X3PA 1TKWB 1EZ6A 4NMZA 5C5LA 1VF7A 3NSWA 3N52A 2NWGA 3VR6A 1ONLA 2PPBC 1M4VA 2NYZD 3I3CA 1JE4A 3QIAA 1PFBA 3WDNA 4C3IB 4R8IA 1B2TA 1EYAA 1LT5D 4EQPA 1PRTD 5KIXA 1IW7D 3T53B 2L4NA 5IGDA 3OWEB 5DM63 2K1BA 2B2UA 3PMFA 2OEOA 2KOLA 1WTPA 1WD1A 3A8IE 4O42A 5K36H 1HQRD 2O4XA 1WTQA 3IAYA 2HUGA 3SXHA 1CQVA 3D3RA 2F0JA 3I70A 4TKOB 2FMCA 3K5MA 1UEAB 1GOZA 1H9JA 1U4MA 2NVXB 5IIFA 5IGFA 5D3IB 5CBAE 1B50A 1SNDA 1TS4A 2XIWA 1TR5A 4BBRB 3A56A 1IYUA 2FHTA 4RKBA 4C3HB 3RUZA 1AW7A 4C1NK 1EU4A 1AEXA 3K5OA 3IKJA 4CBVA 4CKCA 2F0LA 2R3ZA 2K04A 5EBCA 3M3YB 2DY7A 4HMJA 4OL7A 3VYRA 1RF2D 4C3JB 2B2WA 5I2YA 3D31A 1I4PA 5BN3A 2K5QA 3Q0AA 2F0OA 1O7LA 1JC7A 1STBA 1SNMA 3G6JB 4ZAIA 2SOBA 3M4OB 1DOLA 4K6DA 3J80L 4IURA 4IUPA 3FKIB 1TIID 2Z4IA 4TQUS 3MEHA 4ILWA 2EYOA 1KDAA 4L8JA 3HOUB 1Y1WB 1FNWA 5C3WA 2PW5A 2F0QA 1PZKD 4XQQA 1B9MA 4KD4A 1DXMA 2CQAA 4U68A 2ZXPA 4EQNA 5F2DA 2A74C 2VNUD 3OOCA 3U9SA 3W3AA 1QCBD 2JYOA 4QCLA 1I4XA 1MGSA 2VB2X 4BA2I 2EVBA 3P20A 2FJ2A 3RZOB 1BCPD 2VB3X 3BVMA 4PMBA 1TWAB 1KLGD 2BDNA 4A93B 2OXPA 2V4DA 2WINB 4S3SA 2JP1A 1TS5A 4RWSC 5T1IA 2WV6D 3ERQA 1C4QA 4IZ8A 4K2KA 4WORA 3V96A 2NVYB 4K8IA 1UAPA 1CK1A 4GZYC 1PTOH 1PTOC 5J39A 1LTAD 1E2ZA 3ITPA 2X6LA 3S9WA 2YYZA 1NR2A 4A3FB 1GUNA 3T16A 1R4PB 5IGGA 4DAPA 3I4NB 1SMYC 4BBSB 3D6WA 3D4WA 2B39A 4A3IB 2K7VA 4J1MA 4XXEA 1LT4D 1RCVD 4OO1G 2R6GA 2XN9C 5LL6X 2EYLA 1WCMB 1SJHD 5KYIA 1Y8NB 4EQOA 1SNCA 3S1QB 4DGZA 5DNFA 1ILQA 5EJWA 2NVTB 3OMCA 3EQLC 1FGBD 4ZYSA 4FO2A 1AZQA 3O13A 1EWHA 2B2VA 1I3QB 3HS0C 1YNJC 4OGQC 1Q8IA 5HGTA 3PUXA 4QUFA 2BOSA 3T56B 4CKEA 5FLXE 4FP5D 2HCCA 2E74C 4IFDI 1GXDC 3FVQA 5KEEA 1S5DD 3QJYA 2ZT9C 3TSSA 2G9HD 3K59A 1AN8A 1SYEA 5CV8A 4A3EB 1I4GA 1L0XB 1PRTC 2O5JC 1IW7C 4X3TA 1A3TA 4I65A 1PTOB 3BZDB 3VR4A 2MHVA 1BBXC 2EZVA 2A6HC 5C44B 3GTQB 3W2DA 3GV6A 2SNMA 3LWUA 3C3LA 1DYQA 1II3A 4NKLA 3RLFA 1HCZA 1V43A 2EDGA 2IT1A 1EY9A 3HOZB 1IHZA 1TY2A 2M9VA 2B2UC 1B53A 2D5DA 3FEWX 1F2YA 1TQOA 1S5CD 1PLFA 1DM0B 2IWHA 1UUPA 5FOBB 3JAML 2Z1CA 4IFDH 1C48A 2Q8RE 2F0MA 4ZQ3A 1J9OA 1TS3A 5A2QE 1GJXA 4G57A 4ODGA 4P2CB 5KNDA 2M2LA 2K05A 3D8GA 4B9XA 1BQQT 4X3SA 5ELDA 3E0JA 4A3KB 2MUYA 2K28A 2NTTA 3DUZA 4IN3A 4K8JA 1EY6A 2EYFA 2WIIB 3IL8A 2K6AA 4R9WA 1FNUA 2G9DA 2LKVA 2B2TA 4XIGS 1HTPA 3VYUA 1PRTB 3GD7A 3SK8A 3OW7A 3GP7A 5I2XA 3QG1A 5C3XA 2NZ1D 2XSCA 1F9RA 5JJZA 1LT3D 4KY7A 4LAAA 4N9PA 4CGYB 3PUYA 1EYDA 4FNFA 3LWEA 1B4OA 1JR0D 3D4RA 4FVMA 5DEHA 1KNAA 1BCPC 1ICWA 4Y7NB 1ILPA 1FNVA 3URYA 1HUNA 4KHVA 4IUQA 1B9NA 4QUCA 1STNA 2O2LD 4FF3A 4EGVA 4CJ1B 2JA5B 1LACA 4ZK9B 3QOLA 4IUNA 4BA1I 1PYWD 1V1OA 5TSSA 1ZXTA 3D6CA 3OHXC 1QJOA 1CA5A 3MXGA 1Y1VB 3DXJC 1SYGA 1DJRD 1NR4A 3SK6A 5JPMC 2F0TA 4OO1I 2IJ0A 5A35A 1D2BA 2QILA 2KECA 1TT2A 4QB4A 4ZUJA 2XNAC 1EWCA 2AUKA 1ENCA 4K14A 4G7ZC 1SYBA 2YU9B 3SHLA 5CV7A 1SFOB 4XDXA 5EPJA 5IT9E 1SAPA 4QMGA 2E76C 3MXUA 3C46A 1XYIA 3I90A 3NTKA 4UAIA 5D3DA 3GO5A 5C4HA 4IUTA 3KLSX 3PV0A 5EQ0A 3ZYYX 4H0LC 1BCPB 2PCFB 3TP6A 1LTGD 1IKLA 3MXNA 3A7LA 1ET6A 2B2VC 4KI0A 2Z8LA 4RCOA 1TWFB 2RVLA 2IPKD 2WAQB 2RDHA 1HXYD 3R2TA 2E2JB 1OXTA 1Q90A 3AB9A 3C1EA 1R4QB 1DOMA 1A6XA 2RA4A 2HDMA 3AU7A 3BDCA 3DWQA 2B63B 4RHRA 1K8OA 1WTXA 1RODA 4YIJA 2MJ8A 1GUWA 2D2CC 2TMPA 1JCKB 2E75C 2R93B 3S2HB 3H3VC 2PZTA 3NWTA 4DK1A 1DONA 1X32A 2JA6B 2KHSA 2NN6I 4PMCA 4F7XA 4R8NA 4ZUIA 3F2UA 1B1ZA 4ZKBB 1A2TA 4PNYA 4C3IG 4A3GB 5C5MA 1ENAA 1G8ZD 2J0TD 1D5XC 3SE0A 2NVQB 3NTIA 3MXPA 2XVSA 4BWGB 4DXFA 4WJWA 2CW0D 4A3MB 2F3WA 3BYTB 2OT2A 4KKUA 3GQBA 2E2HB 5CC4A 1A2UA 1V8QA 1W6KA 3J7AF 1EY0A 3FDTA 4RGMA 3MVVA 3NUCA 2K5WA 1SE2A 1LTTD 1PZJD 1WTOA 2KEEA 5EPKA 4DU9A 2PMZB 1LTRD 1S5FD 3VR3A 1HRJA 4KMUC 3BG3A 2ZXOA 5IGBA 1CZWA 3ND8A 4KKTA 1ET9A 5HURA 3GTJB 4DNTB 4C3HG 2L0CA 3PIO3 4FXDA 2B2TC 2NN6H 4H44C 2HDLA 4ABNA 1GUGA 4HSVA 4FF1A 3S1MB 4C3JG 4JBWA 5EPLA 4V190 1EEID 4KJNA 1F9SA 3WOEA 5JEAH 1ML0D 2BE5C 2BDOA 4DAYA 1W6JA 5CMDA 1KDBA 1RKNA 2AQ3B 5COYA 3E6ZX 2JXMB 3PO2B 1CA6A 1FYCA 2QDBA 5LHY1 1HFNA 3X3NA 1KABA 2XWJB 1EIGA 1I6VC 5FLXL 1EIHA 5EKKA 3M7NA 2R92B 5JVG3 5ELCA 1NUCA 4CHTB 3OIPA 3CKIB 3SK4A 1SE3A 1NCVA 2E2DC 5CYUA 4IUUA 5AFWA 5K36G 3C2PA 3VYTA 1HUMA 1S4ZA 1CI3M 4HCEA 1A3VA 1LT6D 5JAVA 4XQJA 5C4JB 1Y8OB 4X3KA 3TBIB 5C0XI 1JOQA 3J7AV 1D5MC 4KTAA 2MPMA 2EPBA 3I91A 3NPPA 1G2TA 2C9OA 3SK5A 3GV3A 1NSNS 3VA5A 1XXGA 5NUCA 1OXXK 2LMCB 3GTKB 4RHSA 2K01A 2X69A 1STYA 3I72A 4EVOA 1H9SA 4FXKC 1F2MA 4DFAA 3MFYA 5BN5A 1QILA 3T4AC 1ENFA 2RSNA 2NTSA 5CR3A 1YNND 2A6ED 4KHZA 3NQTA 5JOBA 3TN2A 2IX0A 2PZUA 4C2MB 2J4XA 2B8GA 1CZGA 3TP8A 3PO3B 3HKZB 2ENBA 2PQEA 3GTMB 4DXGA 3L9AX 1H9KA 3FPPA 4XYOA 3MFGA 4RGNA 4HAEA 1H9MA 1Z47A 4RGTA 5T1GA 2EE1A 3A8JE 5A2QL 1BR9A 1OXVA 5M9OA 4L6TB 3LNNA 2AWNA 5M3FB 1PFMA 2PYKA 1G2SA 3I73A 3A55A 5C0XH 3BYYB 4HEDA 2Y0SB 2AWOA 1QNUA 1VDZA 2EXZA 1Q1BA 3I8ZA 5JPNC 1EY8A 1I50B 1BUVT 1NAPA 1V1PA 4XQNA 4K6LA 4X3UA 3R2IA 1LABA 1O78A 3A54A 4HMIA 2FFKB 1G291 4BY7B 5CV6A 1DD2A 3QB3A 4WFN3 2JEAI 2RSOA 2ICEC 5KGUA 4KY6A 1STHA 5FO9B 5CORA 4B08A 2B2YA 3BS1A 4HTHA 2CW0C 3J81E 1MSHA 2X6GA 5D14A 4NW2A 3KUPA 5FK9C 4FYDA 3DMUA 3P1HA 1GUTA 1MI2A 2A73B 2KJXA 3L3OC 2JSOA 3FRPB 5K5PA 4A3BB 2AQ2B 3K58A 3R93A 3RMHA 5I9PA 2NBFA 3KBXA 3HOYB 1JWSD 1TWGB 2XRSD 1BDOA 4QF4A 3HZXA 5ELBA 3EA6A 4IFDJ 4Q0FA 5E4XA 2RKSA 3TP5A 1PFNA 2EJGC 3NK9A 4PQXA 2K33A 4OHJA 2BA0A 2SEBD 2SDFA 3S2DB 1T5EA 4A3JB 1EY7A 1SJED 3HOXB 5CV9A 3NE5B 4V0BA 3FMCA 5EGTA 2F0UA 1MBYA 2VXWA 2XWBB 2MGSA 4QIWB 1LTID 1SXTA 1U4PA 1I4QA 1JOOA 3H09A 2AQ1B 5CBEE 3HGBA 3OIQA 1AFPA 4G4KA 1Q1EA 5KYLA 3DEPA 5IT9L 2PZWA 3T51B 5EKLA 5EBDA 4E6IA 2EYHA 4ZLTF 1T5XD 1F2LA 1JORA 1L0YB 3KBGA 2PNRC 1AZPA 1EYCA 1HFGA 3MTSA 2LS01 5I4DA 2F0EA 4DN4M 1SNQA 1BNZA 2F0GA 2JA7B 3RZDB 1VMCA 4F8MA 1CQFA 5KNCA 3M4YA 4HN7A 1OO9B 2TSSA 4M1UB 2H4OA 3K6OA 4AYBB 4RGOS 2LFNA 2PW7A 1D1KA 3P75A 2KQ3A 2A69D 3WOFA 2HQEA 1TU2B 2QEJC 1WTRA 3HOWB 2GA4B 1E2VA 1G91A 1LTSD 3OMGA 5C4XB 2EY2A 1EY5A 4IFDG 3MAQA 2F0DA 4BY1B 3I4MB 4KKSA 2BCOA 3PUZA 2A68D 1YNNC 4DNRB 3V05A 1O80A 2A6EC 4H13C 1U4RA 3V2TA 4OIKA 4PMWA 3DHQA 1SBBB 5KNBA 5I6WA 5M5YB 3QWNA 2EY6A 2IL8A 2N55A 5J1ZA 2EYMA 1KDCA 3VR5A 1G6ZA 1ZYRD 3NBHA 4C1NI 5IODA 1I6HB 2K32A 1F9PA 3K57A 3LX0A 2K5DA 1KAAA 1D5ZC 4ID6A 4OO1H 1RJTA 1PDQA 3DM1A 4RCNA 1CM9A 1B44D 2D9UA 2A6HD 5FKAC 1TS2A 3MWYW 2EJMA 2QKIC 1JB3A 1X3QA 1Q3LA 2IX3A 4KV6A 4MN3A 5IOCA 2C5CA 2L1BA 1H9RA 3DWAA 4XTCS 3KLRA 3AMUA 4M8AA 3I4LA 3K5LA 2K03A 1ZEQX 1Z6HA 2QF7A 3HEJA 3NHHA 3TMEA 5DM73 2EJFC 2PO4A 2BA1A 3CQZB 1WVLA 3BVZA 1S5ED 1JQYD 1RHPA 1VF5C 2JEBI 1A3UA 4NDXA 2RDFA 1TVXA 3PUWA 2F0SA 1M8AA 5DAUA 2O5IC 1XX8A 2KCNA 1EFID 1KLUD 4F88A 1I4RA 2F0HA 3HRZC 4O1NA 2F0NA 3IFDA 4LJZC 1HHVA 2QCPX 4NP5A 2R7ZB 1DZ1A 3A7AB 3S1RB 2DY8A 3R3OA 1S5BD 1SSOA 1H9SB 2B2YC 2WP8J 2VUMB 3H6MA 2JE6I 3H94A 5CV4A 4K2LA 2WACA 2HCIA 1RDPD 1OXSC 2EOTA 3G7LA 2KVMA 1LLRD 4KK7A 3NXWA 2KEDA 3K7AB 2DNCA 5G3LF 1IL8A 1Q12A 1DCZA 2EYJA 3J80E 2I07B 4XT3B 1CHPD 1PTOF 5BN4A 1U4LA 3NBIA 1RTNA 2J7ZA 2D62A 4RAUC 1SE4A 3J7YW 3TZUA 1K8MA 1U9RA 3S16B 2KCCA 3TZDA 2F3VA 2I46A 3A8KE 3OPOA 1EEFD 3CRLC 3D4DA 4PV1C 4KJOA 5FO7B 4IALA 1JOKA 1TY0A 2KA7A 3MC0B 1GUOA 3IFTA 1R9TB 1GUSA 4H7BA 2ID0A 4DA2A 3K0YA 5E3FA 5C3EB 4FF4A 2WKCA 1MSGA 4HR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5F D;  4RH6 A;  3TSS A;  3DWQ A;  4RHR A;  5ELE A;  1D5M C;  1EFI D;  1UNS A;  1V1P A;  1AW7 A;  4K6L A;  1KLU D;  2G9H D;  1SBB B;  1EU4 A;  1LTI D;  3R2I A;  1BXT A;  2NTT A;  3R8B A;  1SXT A;  4C56 C;  1AN8 A;  1I4R A;  1TS5 A;  1V1P B;  1DJR D;  4O1N A;  1I4H A;  1ET9 A;  2WV6 D;  1XXG A;  1I4Q A;  2CHB D;  2AQ1 B;  1JCK B;  1I4G A;  1L0X B;  1FNU A;  1PRT C;  1RF2 D;  4RHS A;  1KTK A;  2RDG A;  1CK1 A;  5ELD A;  1PTO H;  1PTO C;  1I4P A;  1LTA D;  4RFB A;  1PRT B;  1S5B D;  1PZI D;  1FD7 D;  2IJ0 A;  2XRQ D;  2QIL A;  1MD2 D;  1PTO B;  3GP7 A;  1QIL A;  3BZD B;  2ICI A;  1XTC D;  3DWP A;  1HA5 A;  1LT3 D;  1ENF A;  2XNA C;  1EWC A;  1D5Z C;  2NTS A;  4L63 B;  4Z9C B;  1EEI D;  2R61 A;  5FK9 C;  1T5X D;  1RDP D;  3W2D A;  1M4V A;  1STE A;  1L0Y B;  1B44 D;  4TSS A;  1LLR D;  1DYQ A;  1JR0 D;  5FKA C;  2AQ3 B;  2J4X A;  1LT5 D;  1SEB D;  5I4D A;  1CT1 D;  1JWM D;  1PRT F;  1B1Z A;  5ELF A;  1PRT D;  1LT4 D;  1RCV D;  1CHP D;  1LO5 D;  1PTO F;  1TS2 A;  2XN9 C;  1D6E C;  1PTO D;  1G8Z D;  4DXG A;  2AQ2 B;  1D5X C;  1BCP C;  1SJH D;  5D3D A;  1RD9 D;  1TY2 A;  3MFG A;  3KLS X;  4BWG B;  4DXF A;  1FNW A;  1JWS D;  3OWE B;  1F77 A;  2XRS D;  4RGT A;  1BCP B;  4RGN A;  1FNV A;  1SE4 A;  3BYT B;  3URY A;  1LTG D;  1PZK D;  1FGB D;  2TSS A;  3DWA A;  1S5C D;  4L6T B;  5ELB A;  4RGO S;  4ZYS A;  1ET6 A;  3O13 A;  1UUP A;  3EFX D;  1HQR D;  3EA6 A;  5ELC A;  2Z8L A;  3SEB A;  1EEF D;  1CQV A;  2O2L D;  1LTB D;  3CHB D;  1TS3 A;  1HTL D;  2QEJ C;  4RCO A;  1SE3 A;  4UDU C;  1I4X A;  3BYY B;  3BVZ A;  1LTS D;  3BVG A;  4RGM A;  2IPK D;  1S5E D;  1GOZ A;  1TY0 A;  1JQY D;  1BCP F;  3MC0 B;  1JWU D;  4OHJ A;  1BCP D;  1SE2 A;  2SEB D;  2RDH A;  1HXY D;  3R2T A;  1LTT D;  3BVM A;  1PYW D;  5D3I B;  1PZJ D;  1SJE D;  1EU3 A;  1V1O A;  5TSS A;  1S5D D;  1TS4 A;  1LT6 D;  1KLG D;  1CHQ D;  1ESF A;  3V05 A;  1LTR D; 
#chains in the Genus database with same CATH topology
 4K5W A;  1TWC B;  1UNS A;  1B3A A;  1BXT A;  4AIM A;  1T9H A;  3EBE A;  1WTV A;  3CCR A;  4JCV E;  1V1P B;  3HOV B;  1QNK A;  1I4H A;  1GHK A;  1XNR L;  2Z6B A;  3M85 A;  4RKL A;  2CHB D;  5IY0 A;  3NP8 A;  4KHP Q;  4HSP A;  4TRD A;  5C6A A;  3E5S A;  4QQB X;  5IP9 G;  1SYD A;  1TWH H;  4FF2 A;  4RFB A;  3SDZ A;  2KUM A;  1PZI D;  1CKN A;  2F03 A;  1YEZ A;  3VR2 A;  2XRQ D;  3GTL H;  3AFQ A;  2IY5 B;  3DWP A;  4BY7 H;  4IUV A;  4MIU A;  2Q8I B;  2IX1 A;  4KD3 A;  1KAW A;  3H15 A;  1WI5 A;  3QOJ A;  4JK1 C;  3MHB A;  4X64 L;  4K0K L;  1A15 A;  4Z9C B;  2LY7 A;  1YVC A;  2L9H A;  1IBM L;  1STE A;  5GAD C;  2CCZ A;  3M4P A;  4XT1 B;  4QJF A;  3QO2 A;  3UDF A;  5JEA J;  1IBK L;  3SVM A;  3A5Z B;  3FPU B;  2A69 C;  3CC7 A;  5LMN L;  5D65 A;  5BR8 Q;  2K5H A;  1SEB D;  1PRT F;  1Q81 C;  1C0A A;  1IKM A;  1D6E C;  4DUZ Q;  4P74 A;  3S17 B;  2RQX A;  4KN7 C;  4GS3 A;  4B3M Q;  3VYS A;  1N34 L;  1K83 B;  4JI6 Q;  2RBM A;  4ME5 A;  2F52 A;  3PO2 G;  1M1K C;  3BDL A;  4N9T A;  3Q6S A;  2A68 C;  3S14 B;  3UDX A;  4RG1 A;  2F4V Q;  2PQA A;  2A5H A;  1K3R A;  4ZRZ A;  4LMQ D;  1KIX A;  3Q23 A;  2MQH A;  2FMM A;  3Q24 A;  3S15 H;  3GTG B;  3M7G A;  2JJQ A;  1RTO A;  3CHB D;  2ZXR A;  3HOY H;  3T13 A;  3S1N B;  1TWG H;  2FIN B;  2NUC A;  2AUJ D;  3G6E A;  2E2I B;  4BBS G;  3PIP 3;  5JJL A;  2R92 G;  1ZYR C;  2RF4 A;  1JIC A;  5J22 A;  2F4I A;  4A3D B;  2GVA A;  2ZJQ A;  1JWU D;  2LSS A;  1EOT A;  4DR7 L;  5M3M B;  2F0V A;  3GTP B;  3VA7 A;  3KF8 A;  4DV1 Q;  1LV9 A;  1VCI A;  5IGC A;  1N9W A;  4LF7 Q;  2WB1 B;  2OF1 A;  1B3Q A;  5M5W B;  5ELE A;  1SMX A;  3P7J A;  1GKH A;  1KNE A;  1WTW A;  4J6H A;  3R8B A;  1FR3 A;  4C56 C;  2ZM6 Q;  4A3J H;  1CTM A;  2N88 A;  4DF7 A;  3J81 L;  4K5X A;  1Y69 U;  4X6A H;  1ZKO A;  3U9O A;  2DJG C;  1EQT A;  3ONA B;  3TDQ A;  4KHP L;  1DOK A;  2OTJ A;  2F0I A;  3K5N A;  1E0B A;  3CW2 C;  3ERO A;  1SNO A;  1EQV A;  1VQL A;  1EIF A;  1MD2 D;  1TWH B;  1HA5 A;  3OSO A;  4RA8 A;  1XTD A;  4CJ2 C;  1NMF A;  2VZA A;  2YTX A;  4JC0 A;  4L63 B;  5FO8 B;  1EY4 A;  3GTL B;  3SR1 A;  1A0I A;  3RR5 A;  2UUB Q;  2NN6 G;  3IRB A;  2CVR A;  3EJI A;  3H0G H;  1CFM A;  4TSS A;  1EZ8 A;  2EY5 A;  3TP7 A;  4JI5 Q;  1WFQ A;  5GAG C;  3J81 j;  2QA4 A;  3N6R A;  4Q5V A;  4IQZ A;  5EKI A;  2B8F A;  5BR8 L;  5ISR A;  1X65 A;  1LO5 D;  2M00 A;  2VQE L;  5C4Z A;  2WKD A;  1A63 A;  1G6P A;  2L11 A;  4YWL A;  5JEA G;  4DUZ L;  1D7Q A;  3UI2 A;  3KK7 A;  3PO3 G;  5LL6 S;  1F77 A;  4JI6 L;  4JI1 L;  2SNS A;  1J8I A;  4BS9 A;  5CV5 A;  4CDE C;  4J8Q A;  1B8A A;  4OEL B;  2F0K A;  1QOH A;  5E4W C;  2F4V L;  3EFX D;  4JI0 Q;  3NQI A;  5I9O A;  1BOS A;  1HPC A;  3SEB A;  5M5X H;  2CWA A;  1LTB D;  3MZ5 A;  1CKM A;  1HTL D;  3RZD H;  4KN4 C;  4PZ6 A;  2F0F A;  4UDU C;  2MP1 A;  5C0X J;  1QB5 D;  1PH3 A;  1SYC A;  3S15 B;  2F0P A;  1SYF A;  3JAM E;  1OXU A;  4LF6 Q;  5IT9 c;  1BCP F;  2ZTE A;  3NWS A;  4ULL A;  1IYV A;  1PH1 A;  2JA8 B;  2B2W C;  4DV5 L;  4MHE A;  1M90 C;  1PXU A;  3HOZ G;  4I7Z C;  1YHA A;  3Q22 A;  5JVH 3;  2H1E A;  1EU3 A;  2Y0S G;  2NB0 A;  3HG9 A;  2Q8T A;  3RD4 A;  1GHJ A;  1EQR A;  4DR6 Q;  2L12 A;  4LF7 L;  4HCS A;  4IPC A;  2I5H A;  3X3M A;  2L55 A;  4B9W A;  2Z4H A;  1VQO A;  3PUV A;  2ZM6 L;  1HQM C;  5KRU A;  3L7Z C;  3RNU A;  2C35 B;  1D1I A;  1KTK A;  1BF4 A;  4F87 A;  1O7I A;  2R7F A;  1FD7 D;  3GTO B;  3CU7 A;  4FXG C;  2L5T A;  1E22 A;  1U5K A;  1Y8P B;  3I55 A;  1S3O A;  4DV7 Q;  4C3I H;  2R61 A;  4DV4 Q;  1HNW L;  4LUV A;  1IL2 A;  1XNQ Q;  3CMA A;  2WAQ E;  4A3K G;  2DNE A;  4CJ0 B;  2VW9 A;  1I6H H;  4U67 3;  4GOP C;  2ZJP A;  3CRK C;  1SR3 A;  1PMR A;  3H0G B;  1CT1 D;  2BE5 D;  1JWM D;  5G3L D;  4JI5 L;  5ELF A;  1AP0 A;  1HA6 A;  2IW3 A;  1PTO D;  4G7O C;  4CKB A;  1RD9 D;  2IHE A;  1CKO A;  3DEO A;  3C1F A;  2G5D A;  1LTL A;  2F0W A;  4UP8 A;  3ULP A;  1F9Q A;  1C8C A;  1YHB A;  3MA2 B;  1VQ8 A;  3CPW A;  4MNO A;  5E1F A;  4A3B G;  1Z7T A;  1STA A;  1EL0 A;  1VMP A;  1O7Y A;  3HP3 A;  5FLM H;  2DN8 A;  2F1M A;  1QWY A;  4WRD A;  4DV3 Q;  1XWE A;  1SMY D;  2PI2 A;  4XYQ A;  2B29 A;  3KLS A;  3ER0 A;  2NVX H;  5IGE A;  5M5X B;  1SDF A;  3BVG A;  3OWF A;  4OIJ A;  4QY7 A;  2YV5 A;  3J80 i;  1E2W A;  3ND9 A;  4DAV A;  1O7Z A;  3EVQ A;  1MIU A;  4LF6 L;  4OON A;  3KDF B;  5EAY A;  5I6Y A;  4BBR H;  4KY5 A;  1B70 B;  4R4Q A;  3NTH A;  4C3H H;  4G7H C;  1F2Z A;  2EYP A;  1BO0 A;  3BDO A;  1CHQ D;  3I4O A;  5CGK A;  1WD0 A;  1ESF A;  3CQZ H;  5C0X G;  4RH6 A;  5FJ8 G;  1QE6 A;  1IYJ B;  1Y14 B;  1YNJ D;  4C3J H;  3HOX G;  1YIJ A;  1SNP A;  4UP9 A;  3H3V I;  2NZH A;  1QG7 A;  2RCF A;  3RLO A;  2OCE A;  3H91 A;  1STG A;  2RDG A;  3NEL A;  2EY1 A;  1NY4 A;  3M4O H;  1ESR A;  4K5V A;  2VQF L;  1MJC A;  4ZKC B;  4LK1 C;  4DK0 A;  2ICI A;  1XTC D;  1X3P A;  4HIO A;  1TKW B;  1V1Q A;  1CSQ A;  1EZ6 A;  1W3S A;  4NMZ A;  3AQQ A;  5C5L A;  2QDL A;  1VF7 A;  3NSW A;  3N52 A;  2NWG A;  2R7Z H;  3VR6 A;  1ONL A;  1VQH A;  1M4V A;  2NYZ D;  3I3C A;  2PPB C;  3FKI H;  3NEM A;  1Y1V G;  1JE4 A;  3QIA A;  1PFB A;  3WDN A;  4C3I B;  1NJI C;  2HQL A;  2XGT A;  4R8I A;  1B2T A;  4DR1 Q;  5GAH C;  1EYA A;  4LF8 Q;  1LT5 D;  4R1J A;  5ELO A;  2ALY B;  3B6Y A;  2VUM H;  4HR7 B;  4EQP A;  2PMZ E;  4GOP B;  1PRT D;  1Y1W H;  5KIX A;  1UEB A;  2PNH A;  3G48 A;  1IW7 D;  1J5E L;  3T53 B;  2L4N A;  5IGD A;  1X55 A;  1IZ6 A;  3OWE B;  5DM6 3;  2K1B A;  2B2U A;  1LYL A;  3PMF A;  2OEO A;  2KOL A;  1WTP A;  1WD1 A;  3A8I E;  4O42 A;  2JA7 G;  5K36 H;  5GAE C;  1HQR D;  2O4X A;  1HNX Q;  1WTQ A;  3IAY A;  2HUG A;  3SXH A;  1CQV A;  3D3R A;  5HY6 A;  2F0J A;  4AYB G;  4LF4 Q;  3I70 A;  4TKO B;  3RZO H;  4DV3 L;  3F2D A;  2FMC A;  3K5M A;  1UEA B;  2RHQ B;  1GOZ A;  4DV0 L;  1H9J A;  1TWA H;  1U4M A;  2NVX B;  3K81 C;  5IIF A;  5IGF A;  3HOW G;  4HJ7 A;  4A93 H;  5D3I B;  3TRE A;  2UXD L;  5CBA E;  1B50 A;  1SND A;  1TS4 A;  5C4X G;  1KL9 A;  2XIW A;  1TR5 A;  4BBR B;  3A56 A;  1IYU A;  2FHT A;  4RKB A;  4C3H B;  3RUZ A;  1AW7 A;  4C1N K;  1EU4 A;  1Q82 C;  4BY1 G;  3CF5 A;  3I4M G;  1AEX A;  3K5O A;  3IKJ A;  4CBV A;  4CKC A;  2F0L A;  1PV4 A;  2R3Z A;  2K04 A;  4UPA A;  5EBC A;  3M3Y B;  2DY7 A;  4HMJ A;  4OL7 A;  3VYR A;  1RF2 D;  4C3J B;  4JYA Q;  1JJG A;  2K5N A;  2B2W A;  5I2Y A;  3D31 A;  1I4P A;  1TWC H;  5BN3 A;  2K5Q A;  3Q0A A;  2F0O A;  1O7L A;  4A3F H;  1JC7 A;  1STB A;  2CQO A;  3CCM A;  1SNM A;  3G6J B;  3EIV A;  3FP9 A;  3PQI A;  5LMU Q;  1N8R C;  1HZ9 A;  2WAQ G;  5E7N A;  4ZAI A;  4LFC Q;  2SOB A;  1K73 C;  3M4O B;  1N33 Q;  1DOL A;  4K6D A;  3J80 L;  4IUR A;  4IUP A;  3VDY A;  3DLL A;  4A3I H;  4DUY Q;  4HID A;  3FKI B;  1RL2 A;  1TII D;  1WCM H;  2Z4I A;  4TQU S;  4DR1 L;  3MEH A;  2K50 A;  4LF8 L;  4ILW A;  2EYO A;  3F1Z A;  4POF A;  1KDA A;  3G4S A;  3S1Q H;  2R93 G;  4L8J A;  2NVT H;  3HOU B;  1Y1W B;  3TS2 A;  1FNW A;  5C3W A;  2PW5 A;  1L1O B;  1HR0 W;  1I3Q H;  2K5V A;  2F0Q A;  1PZK D;  4XQQ A;  1JB7 A;  5FLM G;  1B9M A;  4KD4 A;  1DXM A;  2CQA A;  4U68 A;  4GOP A;  2ZXP A;  4N8F A;  4EQN A;  1PH5 A;  5JJI A;  1SRO A;  5F2D A;  1L0W A;  2JA6 G;  2A74 C;  3S17 H;  1XPO A;  2VNU D;  3OOC A;  3U9S A;  5IYB H;  4O2D A;  4BXX H;  4JOI A;  1K83 H;  3W3A A;  1QCB D;  1K8A C;  2JYO A;  4QCL A;  1I4X A;  1MGS A;  2VB2 X;  4HJ8 A;  4BA2 I;  2EVB A;  3P20 A;  2FJ2 A;  3RZO B;  1BCP D;  4KLK A;  4A3G G;  3E3X A;  2VB3 X;  3BVM A;  2I5M X;  3A0J A;  2VS1 A;  4PMB A;  3GTG H;  3U4V A;  1TWA B;  1KLG D;  3S1N H;  3CCV A;  2BDN A;  2FXQ A;  4A93 B;  2OXP A;  4A3M G;  1J6Q A;  4MZ9 A;  2V4D A;  2WIN B;  4S3S A;  4A3E H;  2JP1 A;  2V1C C;  4RMF A;  1TS5 A;  4RWS C;  5T1I A;  2WV6 D;  3ERQ A;  3GTP H;  1C4Q A;  4IZ8 A;  4K2K A;  4WOR A;  3V96 A;  2NVY B;  4K8I A;  4LNQ A;  1UAP A;  3T1Y L;  2DJF C;  2EXD A;  3MEF A;  1CK1 A;  4GZY C;  1PTO H;  1PTO C;  5J39 A;  5M5W H;  4JI7 Q;  1BVS A;  1LTA D;  3U50 C;  1E2Z A;  1TXY A;  1HR0 Q;  3ITP A;  2X6L A;  2CFM A;  3KF6 A;  3S9W A;  4DR2 L;  1QZH A;  1KRS A;  5C44 H;  1NMG A;  2YYZ A;  4OX9 Q;  1NR2 A;  3ERS X;  5LMU L;  4A3F B;  1GUN A;  2N3S A;  4LFC L;  2Y0S E;  3T16 A;  2QGQ A;  1R4P B;  1N33 L;  1P8L A;  5IGG A;  4DAP A;  2EIF A;  3I4N B;  1SMY C;  4DUY L;  4JBM A;  4BBS B;  2OQ0 A;  3D6W A;  1MJE A;  3D4W A;  2B39 A;  4A3I B;  2K7V A;  4J1M A;  4XXE A;  1LT4 D;  1RCV D;  4OO1 G;  2R6G A;  2XN9 C;  4JG2 A;  5LL6 X;  2EYL A;  4DV6 L;  1WCM B;  1SJH D;  5KYI A;  1Y8N B;  4EQO A;  4P72 A;  1SNC A;  3S1Q B;  4DGZ A;  5DNF A;  1ILQ A;  5EJW A;  4P73 A;  2NVT B;  5IP7 G;  3OMC A;  3EQL C;  1FGB D;  4ZYS A;  4FO2 A;  1AZQ A;  3O13 A;  1EWH A;  3J81 c;  2B2V A;  3K80 C;  2ASB A;  1I3Q B;  3HS0 C;  1YNJ C;  4OGQ C;  4X66 Q;  1Q8I A;  5HGT A;  2VQE Q;  3PUX A;  4QUF A;  4A3L H;  1FGU A;  2BOS A;  3T56 B;  3RN2 A;  4CKE A;  5FLX E;  1N32 Q;  1L1O A;  4FP5 D;  2HCC A;  4B3S L;  4JI1 Q;  5IYD H;  5J3B A;  2E8G A;  1S72 A;  2E74 C;  4IFD I;  1GXD C;  1VQP A;  3FVQ A;  5KEE A;  1S5D D;  3QJY A;  2N8N A;  2ZT9 C;  2QEX A;  2HIX A;  3TSS A;  1Q8K A;  2G9H D;  3K59 A;  1VQC A;  2WFW A;  1AN8 A;  5C3E G;  2JA8 H;  2ZJR A;  1SYE A;  5CV8 A;  4A3E B;  2ZTD A;  3CME A;  4DV5 Q;  1I4G A;  1L0X B;  1PRT C;  2O5J C;  1WOC A;  1PFS A;  3HOV G;  1IW7 C;  2Z0S A;  2ZTC A;  3CCL A;  2UUA Q;  4X3T A;  1VQD A;  5ELN A;  4JI7 L;  1A3T A;  4I65 A;  1PTO B;  3BZD B;  3VR4 A;  2MHV A;  1BBX C;  1HR0 L;  2EZV A;  1Z9F A;  2HHH Q;  4DNI A;  2A6H C;  4OX9 L;  3UDI A;  2UXC L;  4OWT B;  5C44 B;  3GTQ B;  3W2D A;  5IYC H;  1BBW A;  3GV6 A;  1SN8 A;  2SNM A;  3LWU A;  3C3L A;  1DYQ A;  1II3 A;  4NKL A;  3A74 A;  3RLF A;  3GTO H;  1HCZ A;  4QGU A;  1V43 A;  1PH4 A;  3W5O A;  4Y7N H;  3CD6 A;  2EDG A;  2IT1 A;  4JV5 Q;  1EY9 A;  1AE2 A;  4IOC A;  3HOZ B;  1IHZ A;  1TY2 A;  1HNW Q;  2M9V A;  2B2U C;  1B53 A;  1GO3 E;  2VL6 A;  2D5D A;  4NXM L;  3FEW X;  1F2Y A;  1VQ9 A;  1TQO A;  1S5C D;  1PLF A;  1DM0 B;  2IWH A;  2Z6K A;  1UUP A;  5FOB B;  3JAM L;  2Z1C A;  4IFD H;  1C48 A;  2Q8R E;  3EN2 A;  1VQ6 A;  2F0M A;  2JA5 H;  2CWP A;  1UE7 A;  4ZQ3 A;  4X66 L;  1J9O A;  1TS3 A;  2OTL A;  4R4T A;  1MKH A;  4YCU A;  5A2Q E;  1GJX A;  4G57 A;  4ODG A;  4P2C B;  5KND A;  1EQQ A;  2M2L A;  1N32 L;  3HKZ G;  2K05 A;  3D8G A;  1EIY B;  1I94 L;  4B9X A;  2UU9 Q;  1BQQ T;  4A3D G;  4NXN Q;  4X3S A;  5ELD A;  3E0J A;  1X3F A;  4A3C G;  4A3K B;  2MUY A;  5M3M G;  5M3F G;  1C9O A;  2K28 A;  2NTT A;  3DUZ A;  4IN3 A;  4K8J A;  2KBN A;  1EY6 A;  2EYF A;  2WII B;  3IL8 A;  2K6A A;  3PIO A;  4R9W A;  1FNU A;  2G9D A;  2LKV A;  1X54 A;  4AYB E;  2B2T A;  4XIG S;  1HTP A;  3VYU A;  3I7F A;  1PRT B;  3GD7 A;  4LWC A;  3SK8 A;  3OW7 A;  3GP7 A;  2YU9 H;  5I2X A;  2UUA L;  3QG1 A;  5C3X A;  2JN4 A;  2NZ1 D;  4I7A A;  2XSC A;  4UY8 C;  1F9R A;  1LT3 D;  4KY7 A;  5JJZ A;  4LAA A;  1K8G A;  1SFO H;  4N9P A;  4CGY B;  3PUY A;  1EYD A;  2HHH L;  2AKW B;  1GVP A;  4FNF A;  3LWE A;  1B4O A;  1JR0 D;  4MTN A;  3D4R A;  4FVM A;  1BKB A;  3MXN B;  2VQF Q;  4BY7 G;  5DEH A;  3D0F A;  1KNA A;  1PH7 A;  4X62 Q;  2EQS A;  1BCP C;  1ICW A;  4JV5 L;  4LFA L;  4Y7N B;  2IHF A;  1ILP A;  1FNV A;  3URY A;  1HUN A;  4KHV A;  4IUQ A;  1B9N A;  3W1B A;  1E24 A;  2MFI A;  2Q2H A;  4QUC A;  3CCU A;  1STN A;  4JOI C;  5L37 A;  4IO9 A;  2O2L D;  1VS0 A;  4LUZ A;  1FL0 A;  3OTO Q;  4FF3 A;  1J5E Q;  4EGV A;  4CJ1 B;  2JA5 B;  1LAC A;  2E2J H;  4ZK9 B;  1E3P A;  4UP7 A;  4HJ5 A;  4YHH Q;  3QOL A;  4IUN A;  4BA1 I;  1PYW D;  2B63 H;  1V1O A;  5TSS A;  3HOY G;  1ZXT A;  2RHS B;  3D6C A;  3OHX C;  1QJO A;  1CA5 A;  3UE1 A;  2UU9 L;  3MXG A;  1Y1V B;  2XTI A;  3DXJ C;  1YHQ A;  4NXN L;  1SYG A;  4WJ4 A;  1WJJ A;  4TVA B;  4GN5 A;  4DV0 Q;  1DJR D;  1NR4 A;  3S2H H;  3SK6 A;  5JPM C;  3S24 A;  2UXD Q;  1PH8 A;  2F0T A;  1VQG A;  1VQI A;  4JVZ A;  1UE5 A;  1KC8 C;  4OO1 I;  2IJ0 A;  1IBL Q;  5A35 A;  2K4K A;  2QIL A;  1D2B A;  2KEC A;  1PH2 A;  1TT2 A;  4QB4 A;  4ZUJ A;  4A3J G;  2XNA C;  1EWC A;  2AUK A;  3M3Y H;  1ENC A;  4K14 A;  4G7Z C;  1SYB A;  2YU9 B;  3SHL A;  3CP0 A;  4WJ3 M;  5CV7 A;  1SFO B;  1HH2 P;  4XDX A;  5EPJ A;  5IT9 E;  1SAP A;  4QMG A;  1QZG A;  2E76 C;  3MXU A;  3C46 A;  1XYI A;  3I90 A;  2KEN A;  3NTK A;  4UAI A;  5D3D A;  1KRT A;  3GO5 A;  5C4H A;  4X62 L;  3H0G G;  4IUT A;  3KLS X;  3PV0 A;  5EQ0 A;  4L5S A;  1L2F A;  3ZYY X;  4H0L C;  1BCP B;  2PCF B;  2E2H H;  3TP6 A;  3RN5 A;  1EOV A;  1LTG D;  1IKL A;  3MXN A;  3A7L A;  2P5Z X;  1ET6 A;  2B2V C;  4KI0 A;  2H5X A;  2Z8L A;  4NB3 A;  3HOU H;  4A4I A;  2RCN A;  4CDC C;  3A5U A;  4RCO A;  1L1O C;  1TWF B;  3OTO L;  2RVL A;  2IPK D;  2A1A A;  4DR4 Q;  2WAQ B;  1HZA A;  2RDH A;  1HXY D;  3R2T A;  2E2J B;  3J80 c;  4YHH L;  1OXT A;  4LF5 Q;  1Q90 A;  3AB9 A;  3KLW A;  3C1E A;  1R4Q B;  3PSI A;  2BH8 A;  1DOM A;  1A6X A;  2RA4 A;  2HDM A;  3AU7 A;  5IP9 H;  3BDC A;  3DWQ A;  2B63 B;  4RHR A;  1K8O A;  2F3I A;  3J7Z C;  3GTJ H;  1WTX A;  1ROD A;  4YIJ A;  2MJ8 A;  1GUW A;  2I0Q A;  4FDB A;  3CC2 A;  2D2C C;  3M4Q A;  2TMP A;  1JCK B;  2E75 C;  2R93 B;  3S2H B;  1A8V A;  5JJK A;  1VQK A;  1NTG A;  3H3V H;  3H3V C;  2PZT A;  3NWT A;  4DK6 C;  4GLV B;  1IBL L;  4DK1 A;  1QVF A;  3KF6 B;  2D0P A;  1KQS A;  1DON A;  2NVY H;  1X32 A;  2JA6 B;  2KHS A;  1E1O A;  3STB D;  1XMQ Q;  2NN6 I;  4PMC A;  2GVB A;  3T1Y Q;  4F7X A;  2LXJ A;  3PO2 H;  3BJU A;  4R8N A;  4ZUI A;  1PVO A;  1QVC A;  3F2U A;  1VQ5 A;  3UE0 A;  4HIK A;  1B1Z A;  4ZKB B;  4DR2 Q;  2A8V A;  1A2T A;  4PNY A;  4GKJ Q;  4C3I G;  4A3G B;  5C5M A;  2UUC L;  1ENA A;  1G8Z D;  2J0T D;  1NBW A;  1P16 A;  1D5X C;  3SE0 A;  2NVQ B;  3NTI A;  1W2B A;  3MXP A;  2XVS A;  2B3G A;  4BWG B;  3I4N H;  4DXF A;  3TS0 A;  4WJW A;  2CW0 D;  1LM0 A;  4R4I A;  4A3M B;  2F3W A;  4BBS H;  3BYT B;  1HNZ L;  3WWV A;  2R92 H;  2Z6K C;  4B3R Q;  4X65 Q;  2AHO B;  2AMC B;  2OT2 A;  3TEH B;  3PGZ A;  4KKU A;  3GQB A;  3OW2 A;  2E2H B;  4Y52 H;  3HFZ B;  1K9M C;  4A75 A;  5CC4 A;  1A2U A;  1KXL A;  3E0E A;  4DV6 Q;  1V8Q A;  3K0X A;  3KJP A;  1W6K A;  3J7A F;  3L2P A;  1EY0 A;  3FDT A;  4RGM A;  3MVV A;  3NUC A;  4JBK A;  2K5W A;  1SE2 A;  4P71 A;  1WTH A;  5C4J H;  1LTT D;  4DR4 L;  1PZJ D;  1WTO A;  2NZO A;  2KEE A;  5EPK A;  4LF5 L;  4DU9 A;  2PMZ B;  1LTR D;  1S5F D;  3VR3 A;  1HRJ A;  4KMU C;  3BG3 A;  3E9H A;  4DPG A;  2ZXO A;  5IGB A;  4L5R C;  1CZW A;  4B3S Q;  3GTK H;  1UE1 A;  3ND8 A;  4KKT A;  1ET9 A;  5HUR A;  4BBR G;  3GTJ B;  1S40 A;  4DNT B;  4C3H G;  2L0C A;  4YCW A;  3PIO 3;  4FXD A;  2B2T C;  2NN6 H;  4H44 C;  3ULJ A;  2HDL A;  4ABN A;  3AEV A;  2JA9 A;  1EFW A;  1GUG A;  4HSV A;  1N36 L;  4FF1 A;  3CCE A;  3S1M B;  3HKZ E;  1YZ6 A;  4IPG A;  4C3J G;  4JBW A;  3PF4 A;  1U0L A;  4C2M H;  5EPL A;  4V19 0;  1EEI D;  5GQO A;  3J81 i;  4KJN A;  1F9S A;  3WOE A;  5JEA H;  1ML0 D;  2BE5 C;  1XMQ L;  2BDO A;  3PO3 H;  4DAY A;  1W6J A;  5CMD A;  1KDB A;  1RKN A;  1WYD A;  2AQ3 B;  4POG A;  3GTM H;  5COY A;  2LXK A;  3E6Z X;  2JXM B;  3PO2 B;  1YJN A;  1CA6 A;  1FYC A;  2R7Z G;  2QDB A;  4GKJ L;  3GTQ H;  3FKI G;  4UHV A;  4YWK A;  2K52 A;  4DV2 L;  2UXC Q;  5LHY 1;  4B3T L;  1EYG A;  1HFN A;  3X3N A;  1KAB A;  3LGJ A;  1GD7 A;  2XWJ B;  1EIG A;  4DK3 C;  1BBU A;  2VUM G;  1I6V C;  5FLX L;  1EIH A;  2ATW A;  4X65 L;  1Y1W G;  4B3R L;  5EKK A;  3M7N A;  2R92 B;  5JVG 3;  5ELC A;  1NUC A;  4CHT B;  3HOZ H;  3OIP A;  3CKI B;  4LFB L;  3SK4 A;  1JJ2 A;  2QW7 A;  1SE3 A;  1NCV A;  2E2D C;  3AFP A;  5CYU A;  4IUU A;  1I50 H;  4NXM Q;  5AFW A;  5K36 G;  3C2P A;  3VYT A;  1HZC A;  1HUM A;  4AQY L;  1S4Z A;  1CI3 M;  3PCO B;  1A3V A;  4HCE A;  1VQ4 A;  1HJP A;  1LT6 D;  5JAV A;  4XQJ A;  5C4J B;  1Y8O B;  4JI2 Q;  4X3K A;  3TBI B;  5C0X I;  1JOQ A;  1UE6 A;  3J7A V;  1D5M C;  1ICF B;  4KTA A;  2MPM A;  2EPB A;  2KCM A;  3I91 A;  3NPP A;  4ZCK A;  1G2T A;  2C9O A;  2PI2 E;  3SK5 A;  3E9I A;  3GV3 A;  1NSN S;  4A93 G;  1K0S A;  3VA5 A;  4GNX C;  1XXG A;  1XJV A;  5NUC A;  1OXX K;  2LMC B;  3GTK B;  4RHS A;  2D0O A;  2K01 A;  2X69 A;  1STY A;  3I72 A;  4EVO A;  1I94 Q;  1H9S A;  4FXK C;  4A3K H;  5AJ3 Q;  1F2M A;  4DFA A;  3MFY A;  5BN5 A;  1AE3 A;  1QIL A;  3JAM c;  4MTK A;  4PG3 A;  1I5F A;  3T4A C;  1ENF A;  2RSN A;  2NTS A;  2N78 A;  5CR3 A;  1YNN D;  2E5L Q;  2A6E D;  4KHZ A;  1UWV A;  4JI4 Q;  3NQT A;  4JI8 Q;  5JOB A;  3TN2 A;  1YIT A;  2IX0 A;  2PZU A;  4C2M B;  4IPD A;  3BZC A;  4A3F G;  4GN4 B;  2J4X A;  2B8G A;  4A3B H;  4GKK Q;  3TP8 A;  4QL5 A;  3PO3 B;  3HKZ B;  2ENB A;  2PQE A;  3TRZ A;  2Q2U A;  3I4N G;  1EWI A;  4PZ7 A;  3GTM B;  4DXG A;  3L9A X;  1H9K A;  3FPP A;  4XYO A;  3MFG A;  1NNX A;  5DLQ E;  2GN5 A;  4A3I G;  4RGN A;  4HAE A;  1H9M A;  1Z47 A;  4RGT A;  5T1G A;  2EE1 A;  3A8J E;  5A2Q L;  1BR9 A;  1OXV A;  5M9O A;  1WCM G;  3CAM A;  4L6T B;  3LNN A;  2AWN A;  1XMO Q;  5M3F B;  1PFM A;  1CUK A;  2PYK A;  1C7Y A;  1VQN A;  5HGQ A;  1G2S A;  3I73 A;  5GRO A;  1EUJ A;  1XPU A;  4LF9 L;  2YTV A;  4NPS A;  3U58 A;  4LFA Q;  3A55 A;  2N49 A;  5C0X H;  4QIW E;  3BYY B;  4HED A;  3S2D H;  5FJ8 H;  2Y0S B;  4O0A A;  2AWO A;  1JMC A;  1QNU A;  1VDZ A;  2EXZ A;  4IJL A;  4DR5 Q;  3HOX H;  1Q1B A;  3I8Z A;  5JPN C;  1EY8 A;  1I50 B;  4GLA C;  5IYB G;  4BXX G;  4L5Q A;  1BUV T;  1QUQ B;  1RIP A;  1YNX A;  4OWW B;  4IOA A;  1NAP A;  3STB C;  4JI2 L;  1V1P A;  4XQN A;  4K6L A;  4X3U A;  3R2I A;  1LAB A;  1O78 A;  3A54 A;  4HMI A;  2FFK B;  1X9N A;  1G29 1;  4BY7 B;  4P75 A;  5CV6 A;  1DD2 A;  3QB3 A;  4WFN 3;  1X56 A;  2JEA I;  2RSO A;  2ICE C;  5KGU A;  4KY6 A;  4GNX B;  1Y1V H;  1STH A;  1IXR A;  3L0O A;  5FO9 B;  4YY3 Q;  5COR A;  4B08 A;  4A3E G;  2B2Y A;  3BS1 A;  5AJ3 L;  4HTH A;  2CW0 C;  4ALP A;  3J81 E;  1MSH A;  4H02 A;  2HT1 A;  2X6G A;  5D14 A;  4NW2 A;  3KUP A;  5FK9 C;  4B3M L;  4HIM A;  4JW0 A;  2E5L L;  4FYD A;  2WB1 G;  3DMU A;  3P1H A;  1GUT A;  4JI4 L;  3QR8 A;  4JI8 L;  1MI2 A;  2A73 B;  2KJX A;  1V9P A;  3L3O C;  5C44 G;  1PH9 A;  2JSO A;  2OWO A;  2JA7 H;  3FRP B;  3K7U C;  3ZJY C;  4GKK L;  5K5P A;  4A3B B;  2AQ2 B;  3K58 A;  1VQB A;  3ULL A;  3R93 A;  1PYB A;  3RMH A;  5I9P A;  2NBF A;  2HIV A;  3KBX A;  3HOY B;  1JWS D;  1TWG B;  1SRU A;  2CKZ B;  3W1G A;  2XRS D;  1BDO A;  4QF4 A;  3HZX A;  5ELB A;  1VQ7 A;  3JC6 6;  3T1H Q;  2K75 A;  1XMO L;  3HOW H;  3BZK A;  3EA6 A;  4J15 A;  4IFD J;  4DV1 L;  4Q0F A;  2VY3 A;  5E4X A;  1VQA A;  5C4X H;  1PA6 A;  2RKS A;  3TP5 A;  3F2C A;  1PFN A;  4GN3 B;  2DGY A;  2EJG C;  3NK9 A;  4ME3 A;  2UXB Q;  4R4O A;  1SLJ A;  4PQX A;  4BY1 H;  3I4M H;  2K33 A;  4OHJ A;  1X3G A;  2BA0 A;  2SEB D;  2SDF A;  3S2D B;  1T5E A;  4A3J B;  1KHI A;  4DR5 L;  1H95 A;  1Q46 A;  4AH6 A;  1EY7 A;  1SJE D;  3HOX B;  4A3L G;  5CV9 A;  3NE5 B;  4V0B A;  3FMC A;  3NBH B;  5EGT A;  3BU2 A;  2F0U A;  3CPF A;  1MBY A;  2R7D A;  1TWF H;  2VXW A;  2XWB B;  3AYH B;  5M5Y H;  3CCQ A;  1ASY A;  2MGS A;  4YCV A;  5IYD G;  4QIW B;  1LTI D;  1SXT A;  1VQJ A;  1U4P A;  1I4Q A;  1JOO A;  3H09 A;  2AQ1 B;  2UUB L;  1QUQ A;  5CBE E;  3HGB A;  3OIQ A;  1AFP A;  4G4K A;  3Q8D A;  1Q1E A;  4YY3 L;  5KYL A;  2JA8 G;  1A62 A;  2BH2 A;  1PYS B;  3DEP A;  5IT9 L;  1JT8 A;  2PZW A;  3T51 B;  5EKL A;  2HD3 A;  5EBD A;  4E6I A;  2R93 H;  2EYH A;  4ZLT F;  1T5X D;  1F2L A;  1JOR A;  2Q2I A;  4YWM A;  1L0Y B;  3KBG A;  4GNX A;  2PNR C;  1AZP A;  3ICE A;  3HKS A;  1MHW C;  1EYC A;  3K8A A;  1HFG A;  3MTS A;  2CH4 A;  2LS0 1;  5I4D A;  2F0E A;  4DN4 M;  1D8L A;  4JI0 L;  1SNQ A;  1BNZ A;  2F0G A;  4APV A;  3OYY A;  2JA6 H;  5IYC G;  2JA7 B;  1AH9 A;  3RZD B;  1VMC A;  2I5L X;  1CSP A;  4F8M A;  1CQF A;  3TQY A;  5KNC A;  3M4Y A;  4HN7 A;  1OO9 B;  2TSS A;  2KHJ A;  2H4O A;  4M1U B;  3K6O A;  4AYB B;  4RGO S;  2LFN A;  2PW7 A;  4A3G H;  3NEN A;  1D1K A;  3T1H L;  3P75 A;  2UUC Q;  2KQ3 A;  4EX5 A;  2A69 D;  2NVQ H;  3WOF A;  1QVG A;  2HQE A;  1TU2 B;  4JI3 Q;  2QEJ C;  3PIP A;  3I56 A;  4DR6 L;  1WTR A;  2KCT A;  3HOW B;  2GA4 B;  1E2V A;  3G71 A;  4A3M H;  1G91 A;  1PHJ A;  1LTS D;  3OMG A;  5C4X B;  4GLX A;  2EY2 A;  1HNZ Q;  2UXB L;  1VQM A;  1E7Z A;  2KHI A;  1EY5 A;  4IFD G;  3MAQ A;  2MO0 A;  4R4C A;  3DM3 A;  2JA5 G;  2F0D A;  4BY1 B;  3I4M B;  4KKS A;  5IE8 A;  2BCO A;  3PUZ A;  2A68 D;  1YNN C;  4DNR B;  3V05 A;  2Z9H A;  1O80 A;  1SE8 A;  2A6E C;  4H13 C;  1U4R A;  3V2T A;  4OIK A;  4DR3 Q;  4PMW A;  3DHQ A;  1SBB B;  4N8X 1;  5KNB A;  5I6W A;  5M5Y B;  4DV7 L;  3QWN A;  4DV4 L;  3S1R H;  2EY6 A;  1YJ9 A;  1XPR A;  2IL8 A;  1Q7Y C;  2N55 A;  5J1Z A;  1XNQ L;  2EYM A;  4A76 A;  1KDC A;  3VR5 A;  1G6Z A;  1ZYR D;  2CH4 W;  3NBH A;  4C1N I;  5IOD A;  1B7Y B;  2K32 A;  1I6H B;  1JE5 A;  1F9P A;  3K57 A;  3LX0 A;  2K5D A;  1KAA A;  1D5Z C;  4ID6 A;  4OO1 H;  1RJT A;  1PDQ A;  3DM1 A;  4IJH A;  4RCN A;  3K7A H;  1CM9 A;  1B44 D;  2D9U A;  2A6H D;  2K14 A;  3S1M H;  3CC4 A;  3KYH C;  5FKA C;  5IP7 H;  1N36 Q;  4DAY B;  1VQE A;  2JQO A;  1FJG Q;  2Q2T A;  2ES2 A;  1TS2 A;  3MWY W;  2EJM A;  2QKI C;  1JB3 A;  1X3Q A;  5IWA Q;  1HZB A;  2MO1 A;  4CDD C;  4HJA A;  1Q3L A;  2IX3 A;  4KV6 A;  4MN3 A;  4DKA C;  5IOC A;  2C5C A;  3S16 H;  2L1B A;  1H9R A;  3GDE A;  3RLN A;  3F8T A;  1DGS A;  3DWA A;  4XTC S;  3U4Z A;  3FHW A;  1YBY A;  4OEM B;  3KLR A;  3AMU A;  4M8A A;  3CCS A;  1G51 A;  3I4L A;  2K03 A;  3K5L A;  2DUD A;  1ZEQ X;  1Z6H A;  1E1T A;  2QF7 A;  3HEJ A;  3NHH A;  3TME A;  5DM7 3;  3PF5 A;  1X6O A;  5LMN W;  2EJF C;  3CCJ A;  4DV2 Q;  2PO4 A;  4B3T Q;  2BA1 A;  3CQZ B;  1WVL A;  4JI3 L;  1X3E A;  3BVZ A;  3KDF A;  1R9T H;  1S5E D;  1K0R A;  1JQY D;  1RHP A;  3KOJ A;  5C3E H;  3KJO A;  1VF5 C;  2JEB I;  1A3U A;  4NDX A;  1JJC B;  2RDF A;  1TVX A;  3PUW A;  4L5T A;  2F0S A;  1KD1 C;  4LFB Q;  1M8A A;  5DAU A;  3HOV H;  4LUO A;  2O5I C;  1XX8 A;  2KCN A;  1CKN B;  1EFI D;  4LW1 A;  1KLU D;  3M9B A;  4F88 A;  1XNR Q;  1NE3 A;  1I4R A;  4DR3 L;  2F0H A;  4JBJ A;  3HRZ C;  4O1N A;  2F0N A;  3IFD A;  4LJZ C;  1HHV A;  2B63 G;  1PH6 A;  2QCP X;  4NP5 A;  5H1S E;  4AQY Q;  2R7Z B;  1DZ1 A;  3A7A B;  3S1R B;  2DY8 A;  3R3O A;  2JK8 A;  1S5B D;  1SSO A;  1H9S B;  2B2Y C;  5FLX c;  4OXP A;  1ASZ A;  2YTY A;  1YI2 A;  2WP8 J;  2VUM B;  3H6M A;  2JE6 I;  4X64 Q;  4K0K Q;  1K28 A;  3H94 A;  1IBM Q;  5CV4 A;  4K2L A;  2WAC A;  3F2B A;  2HCI A;  1RDP D;  1OXS C;  1IBK Q;  1FVI A;  2EOT A;  2OQK A;  3G7L A;  2KVM A;  2MNA A;  5LMN Q;  1LLR D;  4KK7 A;  3NXW A;  1YJW A;  2KED A;  3KFU A;  1VQF A;  3K7A B;  2DNC A;  5G3L F;  1IL8 A;  1Q12 A;  2PQA B;  1DCZ A;  2EYJ A;  3J80 E;  2I07 B;  4XT3 B;  1CHP D;  1PTO F;  1HNX L;  1FJG L;  5BN4 A;  1U4L A;  1N34 Q;  1K3B C;  1RTN A;  3NBI A;  4EQ5 A;  4LF4 L;  2A19 A;  3S14 H;  5IWA L;  2J7Z A;  2L15 A;  2D62 A;  4RAU C;  1SE4 A;  4DAM A;  3UDG A;  3J7Y W;  3TZU A;  1K8M A;  1LUZ A;  1U9R A;  3CXC A;  1GM5 A;  1OTC A;  2KCC A;  4OWX B;  3S16 B;  4CDF C;  1Q86 C;  3TZD A;  2F3V A;  2I46 A;  2E2I H;  3A8K E;  3OPO A;  2WB1 E;  1EEF D;  3KF8 B;  4PZ8 A;  3CRL C;  3D4D A;  3J7A 5;  4PV1 C;  4IPH A;  3I2Z A;  4A3D H;  4KJO A;  5FO7 B;  4A3C H;  4IAL A;  5M3M H;  1JOK A;  1TY0 A;  5M3F H;  2KA7 A;  4DR7 Q;  3MC0 B;  1GUO A;  3IFT A;  4HJ9 A;  1R9T B;  4JYA L;  1GUS A;  4H7B A;  2ID0 A;  4DA2 A;  3JAM i;  3HOU G;  3K0Y A;  5E3F A;  3SGI A;  5C3E B;  4JPB W;  4FF4 A;  2WKC A;  1MSG A;  4LF9 Q;  1CZG A; 
#chains in the Genus database with same CATH homology
 4K5W A;  1TWC B;  1UNS A;  1B3A A;  1BXT A;  1WTV A;  3HOV B;  1V1P B;  1QNK A;  1I4H A;  1GHK A;  3M85 A;  4RKL A;  2CHB D;  3NP8 A;  4HSP A;  4TRD A;  5C6A A;  3E5S A;  1SYD A;  4FF2 A;  4RFB A;  3SDZ A;  2KUM A;  1PZI D;  2F03 A;  3VR2 A;  2XRQ D;  3DWP A;  4IUV A;  4MIU A;  2Q8I B;  2IX1 A;  4KD3 A;  3QOJ A;  4JK1 C;  3MHB A;  1A15 A;  4Z9C B;  2LY7 A;  2L9H A;  1STE A;  4XT1 B;  3QO2 A;  5JEA J;  3SVM A;  3FPU B;  2A69 C;  5D65 A;  1SEB D;  1PRT F;  1IKM A;  1D6E C;  3S17 B;  2RQX A;  4KN7 C;  3VYS A;  1K83 B;  2RBM A;  4ME5 A;  3BDL A;  4N9T A;  3Q6S A;  2A68 C;  3S14 B;  2A5H A;  4ZRZ A;  4LMQ D;  3Q23 A;  2FMM A;  3Q24 A;  3GTG B;  3M7G A;  1RTO A;  3CHB D;  2ZXR A;  3T13 A;  3S1N B;  2FIN B;  2NUC A;  2AUJ D;  2E2I B;  3PIP 3;  1ZYR C;  1JIC A;  5J22 A;  2F4I A;  4A3D B;  1JWU D;  1EOT A;  5M3M B;  2F0V A;  3GTP B;  3VA7 A;  3KF8 A;  1LV9 A;  1VCI A;  5IGC A;  2WB1 B;  2OF1 A;  5M5W B;  5ELE A;  3P7J A;  1KNE A;  1WTW A;  4J6H A;  3R8B A;  1FR3 A;  4C56 C;  1CTM A;  2N88 A;  4DF7 A;  3J81 L;  4K5X A;  1Y69 U;  1ZKO A;  3U9O A;  1EQT A;  3ONA B;  3TDQ A;  1DOK A;  2F0I A;  3K5N A;  1E0B A;  3ERO A;  1SNO A;  1EQV A;  1MD2 D;  1TWH B;  1HA5 A;  3OSO A;  4RA8 A;  4CJ2 C;  5FO8 B;  4L63 B;  1EY4 A;  3GTL B;  3SR1 A;  2NN6 G;  2CVR A;  3EJI A;  1CFM A;  4TSS A;  1EZ8 A;  2EY5 A;  3TP7 A;  3N6R A;  4Q5V A;  4IQZ A;  5EKI A;  2B8F A;  5ISR A;  1LO5 D;  2M00 A;  5C4Z A;  2WKD A;  2L11 A;  5JEA G;  3UI2 A;  3KK7 A;  5LL6 S;  1F77 A;  2SNS A;  1J8I A;  4BS9 A;  5CV5 A;  4J8Q A;  2F0K A;  1QOH A;  5E4W C;  3EFX D;  3NQI A;  5I9O A;  1BOS A;  1HPC A;  3SEB A;  1LTB D;  3MZ5 A;  1HTL D;  4KN4 C;  2F0F A;  4UDU C;  2MP1 A;  5C0X J;  1QB5 D;  1SYC A;  3S15 B;  2F0P A;  1SYF A;  3JAM E;  1OXU A;  1BCP F;  3NWS A;  4ULL A;  1IYV A;  2JA8 B;  2B2W C;  4MHE A;  1PXU A;  4I7Z C;  3Q22 A;  5JVH 3;  2H1E A;  1EU3 A;  2NB0 A;  3HG9 A;  2Q8T A;  3RD4 A;  1GHJ A;  2L12 A;  4HCS A;  3X3M A;  2L55 A;  4B9W A;  2Z4H A;  3PUV A;  1HQM C;  5KRU A;  3L7Z C;  1D1I A;  1KTK A;  1BF4 A;  4F87 A;  1FD7 D;  3GTO B;  3CU7 A;  4FXG C;  2L5T A;  1Y8P B;  2R61 A;  2DNE A;  4CJ0 B;  4U67 3;  3CRK C;  1PMR A;  3H0G B;  1CT1 D;  2BE5 D;  1JWM D;  5G3L D;  5ELF A;  1AP0 A;  1HA6 A;  2IW3 A;  1PTO D;  4G7O C;  4CKB A;  1RD9 D;  3DEO A;  3C1F A;  2F0W A;  1F9Q A;  1C8C A;  3MA2 B;  5E1F A;  1Z7T A;  1STA A;  1EL0 A;  1VMP A;  1O7Y A;  3HP3 A;  2DN8 A;  2F1M A;  1QWY A;  4WRD A;  1XWE A;  1SMY D;  4XYQ A;  3KLS A;  5IGE A;  5M5X B;  1SDF A;  3BVG A;  3OWF A;  4OIJ A;  1E2W A;  3ND9 A;  4DAV A;  1O7Z A;  3EVQ A;  5I6Y A;  4KY5 A;  3NTH A;  4G7H C;  1F2Z A;  2EYP A;  1BO0 A;  3BDO A;  1CHQ D;  5CGK A;  1WD0 A;  1ESF A;  5C0X G;  4RH6 A;  1QE6 A;  1YNJ D;  1SNP A;  1QG7 A;  3H91 A;  1STG A;  2RDG A;  2EY1 A;  1ESR A;  4K5V A;  4ZKC B;  4LK1 C;  4DK0 A;  2ICI A;  1XTC D;  1X3P A;  1TKW B;  1EZ6 A;  4NMZ A;  5C5L A;  1VF7 A;  3NSW A;  3N52 A;  2NWG A;  3VR6 A;  1ONL A;  2PPB C;  1M4V A;  2NYZ D;  3I3C A;  1JE4 A;  3QIA A;  1PFB A;  3WDN A;  4C3I B;  4R8I A;  1B2T A;  1EYA A;  1LT5 D;  4EQP A;  1PRT D;  5KIX A;  1IW7 D;  3T53 B;  2L4N A;  5IGD A;  3OWE B;  5DM6 3;  2K1B A;  2B2U A;  3PMF A;  2OEO A;  2KOL A;  1WTP A;  1WD1 A;  3A8I E;  4O42 A;  5K36 H;  1HQR D;  2O4X A;  1WTQ A;  3IAY A;  2HUG A;  3SXH A;  1CQV A;  3D3R A;  2F0J A;  3I70 A;  4TKO B;  2FMC A;  3K5M A;  1UEA B;  1GOZ A;  1H9J A;  1U4M A;  2NVX B;  5IIF A;  5IGF A;  5D3I B;  5CBA E;  1B50 A;  1SND A;  1TS4 A;  2XIW A;  1TR5 A;  4BBR B;  3A56 A;  1IYU A;  2FHT A;  4RKB A;  4C3H B;  3RUZ A;  1AW7 A;  4C1N K;  1EU4 A;  1AEX A;  3K5O A;  3IKJ A;  4CBV A;  4CKC A;  2F0L A;  2R3Z A;  2K04 A;  5EBC A;  3M3Y B;  2DY7 A;  4HMJ A;  4OL7 A;  3VYR A;  1RF2 D;  4C3J B;  2B2W A;  5I2Y A;  3D31 A;  1I4P A;  5BN3 A;  2K5Q A;  3Q0A A;  2F0O A;  1O7L A;  1JC7 A;  1STB A;  1SNM A;  3G6J B;  4ZAI A;  2SOB A;  3M4O B;  1DOL A;  4K6D A;  3J80 L;  4IUR A;  4IUP A;  3FKI B;  1TII D;  2Z4I A;  4TQU S;  3MEH A;  4ILW A;  2EYO A;  1KDA A;  4L8J A;  3HOU B;  1Y1W B;  1FNW A;  5C3W A;  2PW5 A;  2F0Q A;  1PZK D;  4XQQ A;  1B9M A;  4KD4 A;  1DXM A;  2CQA A;  4U68 A;  2ZXP A;  4EQN A;  5F2D A;  2A74 C;  2VNU D;  3OOC A;  3U9S A;  3W3A A;  1QCB D;  2JYO A;  4QCL A;  1I4X A;  1MGS A;  2VB2 X;  4BA2 I;  2EVB A;  3P20 A;  2FJ2 A;  3RZO B;  1BCP D;  2VB3 X;  3BVM A;  4PMB A;  1TWA B;  1KLG D;  2BDN A;  4A93 B;  2OXP A;  2V4D A;  2WIN B;  4S3S A;  2JP1 A;  1TS5 A;  4RWS C;  5T1I A;  2WV6 D;  3ERQ A;  1C4Q A;  4IZ8 A;  4K2K A;  4WOR A;  3V96 A;  2NVY B;  4K8I A;  1UAP A;  1CK1 A;  4GZY C;  1PTO H;  1PTO C;  5J39 A;  1LTA D;  1E2Z A;  3ITP A;  2X6L A;  3S9W A;  2YYZ A;  1NR2 A;  4A3F B;  1GUN A;  3T16 A;  1R4P B;  5IGG A;  4DAP A;  3I4N B;  1SMY C;  4BBS B;  3D6W A;  3D4W A;  2B39 A;  4A3I B;  2K7V A;  4J1M A;  4XXE A;  1LT4 D;  1RCV D;  4OO1 G;  2R6G A;  2XN9 C;  5LL6 X;  2EYL A;  1WCM B;  1SJH D;  5KYI A;  1Y8N B;  4EQO A;  1SNC A;  3S1Q B;  4DGZ A;  5DNF A;  1ILQ A;  5EJW A;  2NVT B;  3OMC A;  3EQL C;  1FGB D;  4ZYS A;  4FO2 A;  1AZQ A;  3O13 A;  1EWH A;  2B2V A;  1I3Q B;  3HS0 C;  1YNJ C;  4OGQ C;  1Q8I A;  5HGT A;  3PUX A;  4QUF A;  2BOS A;  3T56 B;  4CKE A;  5FLX E;  4FP5 D;  2HCC A;  2E74 C;  4IFD I;  1GXD C;  3FVQ A;  5KEE A;  1S5D D;  3QJY A;  2ZT9 C;  3TSS A;  2G9H D;  3K59 A;  1AN8 A;  1SYE A;  5CV8 A;  4A3E B;  1I4G A;  1L0X B;  1PRT C;  2O5J C;  1IW7 C;  4X3T A;  1A3T A;  4I65 A;  1PTO B;  3BZD B;  3VR4 A;  2MHV A;  1BBX C;  2EZV A;  2A6H C;  5C44 B;  3GTQ B;  3W2D A;  3GV6 A;  2SNM A;  3LWU A;  3C3L A;  1DYQ A;  1II3 A;  4NKL A;  3RLF A;  1HCZ A;  1V43 A;  2EDG A;  2IT1 A;  1EY9 A;  3HOZ B;  1IHZ A;  1TY2 A;  2M9V A;  2B2U C;  1B53 A;  2D5D A;  3FEW X;  1F2Y A;  1TQO A;  1S5C D;  1PLF A;  1DM0 B;  2IWH A;  1UUP A;  5FOB B;  3JAM L;  2Z1C A;  4IFD H;  1C48 A;  2Q8R E;  2F0M A;  4ZQ3 A;  1J9O A;  1TS3 A;  5A2Q E;  1GJX A;  4G57 A;  4ODG A;  4P2C B;  5KND A;  2M2L A;  2K05 A;  3D8G A;  4B9X A;  1BQQ T;  4X3S A;  5ELD A;  3E0J A;  4A3K B;  2MUY A;  2K28 A;  2NTT A;  3DUZ A;  4IN3 A;  4K8J A;  1EY6 A;  2EYF A;  2WII B;  3IL8 A;  2K6A A;  4R9W A;  1FNU A;  2G9D A;  2LKV A;  2B2T A;  4XIG S;  1HTP A;  3VYU A;  1PRT B;  3GD7 A;  3SK8 A;  3OW7 A;  3GP7 A;  5I2X A;  3QG1 A;  5C3X A;  2NZ1 D;  2XSC A;  1F9R A;  5JJZ A;  1LT3 D;  4KY7 A;  4LAA A;  4N9P A;  4CGY B;  3PUY A;  1EYD A;  4FNF A;  3LWE A;  1B4O A;  1JR0 D;  3D4R A;  4FVM A;  5DEH A;  1KNA A;  1BCP C;  1ICW A;  4Y7N B;  1ILP A;  1FNV A;  3URY A;  1HUN A;  4KHV A;  4IUQ A;  1B9N A;  4QUC A;  1STN A;  2O2L D;  4FF3 A;  4EGV A;  4CJ1 B;  2JA5 B;  1LAC A;  4ZK9 B;  3QOL A;  4IUN A;  4BA1 I;  1PYW D;  1V1O A;  5TSS A;  1ZXT A;  3D6C A;  3OHX C;  1QJO A;  1CA5 A;  3MXG A;  1Y1V B;  3DXJ C;  1SYG A;  1DJR D;  1NR4 A;  3SK6 A;  5JPM C;  2F0T A;  4OO1 I;  2IJ0 A;  5A35 A;  1D2B A;  2QIL A;  2KEC A;  1TT2 A;  4QB4 A;  4ZUJ A;  2XNA C;  1EWC A;  2AUK A;  1ENC A;  4K14 A;  4G7Z C;  1SYB A;  2YU9 B;  3SHL A;  5CV7 A;  1SFO B;  4XDX A;  5EPJ A;  5IT9 E;  1SAP A;  4QMG A;  2E76 C;  3MXU A;  3C46 A;  1XYI A;  3I90 A;  3NTK A;  4UAI A;  5D3D A;  3GO5 A;  5C4H A;  4IUT A;  3KLS X;  3PV0 A;  5EQ0 A;  3ZYY X;  4H0L C;  1BCP B;  2PCF B;  3TP6 A;  1LTG D;  1IKL A;  3MXN A;  3A7L A;  1ET6 A;  2B2V C;  4KI0 A;  2Z8L A;  4RCO A;  1TWF B;  2RVL A;  2IPK D;  2WAQ B;  2RDH A;  1HXY D;  3R2T A;  2E2J B;  1OXT A;  1Q90 A;  3AB9 A;  3C1E A;  1R4Q B;  1DOM A;  1A6X A;  2RA4 A;  2HDM A;  3AU7 A;  3BDC A;  3DWQ A;  2B63 B;  4RHR A;  1K8O A;  1WTX A;  1ROD A;  4YIJ A;  2MJ8 A;  1GUW A;  2D2C C;  2TMP A;  1JCK B;  2E75 C;  2R93 B;  3S2H B;  3H3V C;  2PZT A;  3NWT A;  4DK1 A;  1DON A;  1X32 A;  2JA6 B;  2KHS A;  2NN6 I;  4PMC A;  4F7X A;  4R8N A;  4ZUI A;  3F2U A;  1B1Z A;  4ZKB B;  1A2T A;  4PNY A;  4C3I G;  4A3G B;  5C5M A;  1ENA A;  1G8Z D;  2J0T D;  1D5X C;  3SE0 A;  2NVQ B;  3NTI A;  3MXP A;  2XVS A;  4BWG B;  4DXF A;  4WJW A;  2CW0 D;  4A3M B;  2F3W A;  3BYT B;  2OT2 A;  4KKU A;  3GQB A;  2E2H B;  5CC4 A;  1A2U A;  1V8Q A;  1W6K A;  3J7A F;  1EY0 A;  3FDT A;  4RGM A;  3MVV A;  3NUC A;  2K5W A;  1SE2 A;  1LTT D;  1PZJ D;  1WTO A;  2KEE A;  5EPK A;  4DU9 A;  2PMZ B;  1LTR D;  1S5F D;  3VR3 A;  1HRJ A;  4KMU C;  3BG3 A;  2ZXO A;  5IGB A;  1CZW A;  3ND8 A;  4KKT A;  1ET9 A;  5HUR A;  3GTJ B;  4DNT B;  4C3H G;  2L0C A;  3PIO 3;  4FXD A;  2B2T C;  2NN6 H;  4H44 C;  2HDL A;  4ABN A;  1GUG A;  4HSV A;  4FF1 A;  3S1M B;  4C3J G;  4JBW A;  5EPL A;  4V19 0;  1EEI D;  4KJN A;  1F9S A;  3WOE A;  5JEA H;  1ML0 D;  2BE5 C;  2BDO A;  4DAY A;  1W6J A;  5CMD A;  1KDB A;  1RKN A;  2AQ3 B;  5COY A;  3E6Z X;  2JXM B;  3PO2 B;  1CA6 A;  1FYC A;  2QDB A;  5LHY 1;  1HFN A;  3X3N A;  1KAB A;  2XWJ B;  1EIG A;  1I6V C;  5FLX L;  1EIH A;  5EKK A;  3M7N A;  2R92 B;  5JVG 3;  5ELC A;  1NUC A;  4CHT B;  3OIP A;  3CKI B;  3SK4 A;  1SE3 A;  1NCV A;  2E2D C;  5CYU A;  4IUU A;  5AFW A;  5K36 G;  3C2P A;  3VYT A;  1HUM A;  1S4Z A;  1CI3 M;  4HCE A;  1A3V A;  1LT6 D;  5JAV A;  4XQJ A;  5C4J B;  1Y8O B;  4X3K A;  3TBI B;  5C0X I;  1JOQ A;  3J7A V;  1D5M C;  4KTA A;  2MPM A;  2EPB A;  3I91 A;  3NPP A;  1G2T A;  2C9O A;  3SK5 A;  3GV3 A;  1NSN S;  3VA5 A;  1XXG A;  5NUC A;  1OXX K;  2LMC B;  3GTK B;  4RHS A;  2K01 A;  2X69 A;  1STY A;  3I72 A;  4EVO A;  1H9S A;  4FXK C;  1F2M A;  4DFA A;  3MFY A;  5BN5 A;  1QIL A;  3T4A C;  1ENF A;  2RSN A;  2NTS A;  5CR3 A;  1YNN D;  2A6E D;  4KHZ A;  3NQT A;  5JOB A;  3TN2 A;  2IX0 A;  2PZU A;  4C2M B;  2J4X A;  2B8G A;  1CZG A;  3TP8 A;  3PO3 B;  3HKZ B;  2ENB A;  2PQE A;  3GTM B;  4DXG A;  3L9A X;  1H9K A;  3FPP A;  4XYO A;  3MFG A;  4RGN A;  4HAE A;  1H9M A;  1Z47 A;  4RGT A;  5T1G A;  2EE1 A;  3A8J E;  5A2Q L;  1BR9 A;  1OXV A;  5M9O A;  4L6T B;  3LNN A;  2AWN A;  5M3F B;  1PFM A;  2PYK A;  1G2S A;  3I73 A;  3A55 A;  5C0X H;  3BYY B;  4HED A;  2Y0S B;  2AWO A;  1QNU A;  1VDZ A;  2EXZ A;  1Q1B A;  3I8Z A;  5JPN C;  1EY8 A;  1I50 B;  1BUV T;  1NAP A;  1V1P A;  4XQN A;  4K6L A;  4X3U A;  3R2I A;  1LAB A;  1O78 A;  3A54 A;  4HMI A;  2FFK B;  1G29 1;  4BY7 B;  5CV6 A;  1DD2 A;  3QB3 A;  4WFN 3;  2JEA I;  2RSO A;  2ICE C;  5KGU A;  4KY6 A;  1STH A;  5FO9 B;  5COR A;  4B08 A;  2B2Y A;  3BS1 A;  4HTH A;  2CW0 C;  3J81 E;  1MSH A;  2X6G A;  5D14 A;  4NW2 A;  3KUP A;  5FK9 C;  4FYD A;  3DMU A;  3P1H A;  1GUT A;  1MI2 A;  2A73 B;  2KJX A;  3L3O C;  2JSO A;  3FRP B;  5K5P A;  4A3B B;  2AQ2 B;  3K58 A;  3R93 A;  3RMH A;  5I9P A;  2NBF A;  3KBX A;  3HOY B;  1JWS D;  1TWG B;  2XRS D;  1BDO A;  4QF4 A;  3HZX A;  5ELB A;  3EA6 A;  4IFD J;  4Q0F A;  5E4X A;  2RKS A;  3TP5 A;  1PFN A;  2EJG C;  3NK9 A;  4PQX A;  2K33 A;  4OHJ A;  2BA0 A;  2SEB D;  2SDF A;  3S2D B;  1T5E A;  4A3J B;  1EY7 A;  1SJE D;  3HOX B;  5CV9 A;  3NE5 B;  4V0B A;  3FMC A;  5EGT A;  2F0U A;  1MBY A;  2VXW A;  2XWB B;  2MGS A;  4QIW B;  1LTI D;  1SXT A;  1U4P A;  1I4Q A;  1JOO A;  3H09 A;  2AQ1 B;  5CBE E;  3HGB A;  3OIQ A;  1AFP A;  4G4K A;  1Q1E A;  5KYL A;  3DEP A;  5IT9 L;  2PZW A;  3T51 B;  5EKL A;  5EBD A;  4E6I A;  2EYH A;  4ZLT F;  1T5X D;  1F2L A;  1JOR A;  1L0Y B;  3KBG A;  2PNR C;  1AZP A;  1EYC A;  1HFG A;  3MTS A;  2LS0 1;  5I4D A;  2F0E A;  4DN4 M;  1SNQ A;  1BNZ A;  2F0G A;  2JA7 B;  3RZD B;  1VMC A;  4F8M A;  1CQF A;  5KNC A;  3M4Y A;  4HN7 A;  1OO9 B;  2TSS A;  4M1U B;  2H4O A;  3K6O A;  4AYB B;  4RGO S;  2LFN A;  2PW7 A;  1D1K A;  3P75 A;  2KQ3 A;  2A69 D;  3WOF A;  2HQE A;  1TU2 B;  2QEJ C;  1WTR A;  3HOW B;  2GA4 B;  1E2V A;  1G91 A;  1LTS D;  3OMG A;  5C4X B;  2EY2 A;  1EY5 A;  4IFD G;  3MAQ A;  2F0D A;  4BY1 B;  3I4M B;  4KKS A;  2BCO A;  3PUZ A;  2A68 D;  1YNN C;  4DNR B;  3V05 A;  1O80 A;  2A6E C;  4H13 C;  1U4R A;  3V2T A;  4OIK A;  4PMW A;  3DHQ A;  1SBB B;  5KNB A;  5I6W A;  5M5Y B;  3QWN A;  2EY6 A;  2IL8 A;  2N55 A;  5J1Z A;  2EYM A;  1KDC A;  3VR5 A;  1G6Z A;  1ZYR D;  3NBH A;  4C1N I;  5IOD A;  1I6H B;  2K32 A;  1F9P A;  3K57 A;  3LX0 A;  2K5D A;  1KAA A;  1D5Z C;  4ID6 A;  4OO1 H;  1RJT A;  1PDQ A;  3DM1 A;  4RCN A;  1CM9 A;  1B44 D;  2D9U A;  2A6H D;  5FKA C;  1TS2 A;  3MWY W;  2EJM A;  2QKI C;  1JB3 A;  1X3Q A;  1Q3L A;  2IX3 A;  4KV6 A;  4MN3 A;  5IOC A;  2C5C A;  2L1B A;  1H9R A;  3DWA A;  4XTC S;  3KLR A;  3AMU A;  4M8A A;  3I4L A;  3K5L A;  2K03 A;  1ZEQ X;  1Z6H A;  2QF7 A;  3HEJ A;  3NHH A;  3TME A;  5DM7 3;  2EJF C;  2PO4 A;  2BA1 A;  3CQZ B;  1WVL A;  3BVZ A;  1S5E D;  1JQY D;  1RHP A;  1VF5 C;  2JEB I;  1A3U A;  4NDX A;  2RDF A;  1TVX A;  3PUW A;  2F0S A;  1M8A A;  5DAU A;  2O5I C;  1XX8 A;  2KCN A;  1EFI D;  1KLU D;  4F88 A;  1I4R A;  2F0H A;  3HRZ C;  4O1N A;  2F0N A;  3IFD A;  4LJZ C;  1HHV A;  2QCP X;  4NP5 A;  2R7Z B;  1DZ1 A;  3A7A B;  3S1R B;  2DY8 A;  3R3O A;  1S5B D;  1SSO A;  1H9S B;  2B2Y C;  2WP8 J;  2VUM B;  3H6M A;  2JE6 I;  3H94 A;  5CV4 A;  4K2L A;  2WAC A;  2HCI A;  1RDP D;  1OXS C;  2EOT A;  3G7L A;  2KVM A;  1LLR D;  4KK7 A;  3NXW A;  2KED A;  3K7A B;  2DNC A;  5G3L F;  1IL8 A;  1Q12 A;  1DCZ A;  2EYJ A;  3J80 E;  2I07 B;  4XT3 B;  1CHP D;  1PTO F;  5BN4 A;  1U4L A;  3NBI A;  1RTN A;  2J7Z A;  2D62 A;  4RAU C;  1SE4 A;  3J7Y W;  3TZU A;  1K8M A;  1U9R A;  3S16 B;  2KCC A;  3TZD A;  2F3V A;  2I46 A;  3A8K E;  3OPO A;  1EEF D;  3CRL C;  3D4D A;  4PV1 C;  4KJO A;  5FO7 B;  4IAL A;  1JOK A;  1TY0 A;  2KA7 A;  3MC0 B;  1GUO A;  3IFT A;  1R9T B;  1GUS A;  4H7B A;  2ID0 A;  4DA2 A;  3K0Y A;  5E3F A;  5C3E B;  4FF4 A;  2WKC A;  1MSG A;  4HR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...