1RDPD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rdpD00
1RCVD 3SEBA 1RDPD 4RGMA 3R8BA 5D3DA 3KLSX 2Z8LA 2R61A 1EEFD 1HA5A 1HQRD 1LT3D 1ESFA 1PRTF 1STEA 4O1NA 3URYA 1EU4A 4RHSA 1D5MC 1PTOF 4L63B 4DXFA 5ELDA 1TS2A 1FNVA 1PRTB 3R2IA 2XN9C 4BWGB 3EFXD 1UUPA 1PTOB 2WV6D 1KLGD 1BCPB 1TY2A 1V1PA 4RGOS 1LO5D 1PRTC 1LTRD 2G9HD 1PTOH 4TSSA 3V05A 1KTKA 1PTOC 2AQ1B 2RDHA 1BCPC 1LT5D 1SBBB 2IPKD 3BVGA 1B1ZA 1JWMD 1S5FD 2SEBD 1I4PA 1UNSA 3BVMA 1SEBD 1TY0A 4RHRA 1CHPD 1L0XB 1ET6A 1JWSD 1TS3A 1I4HA 2TSSA 1G8ZD 1S5BD 3DWQA 1CK1A 1PZJD 1SJHD 1QILA 2O2LD 1AW7A 3BYTB 4ZYSA 4RGTA 1TS4A 1T5XD 5I4DA 1V1OA 4C56C 3OWEB 1CT1D 3BYYB 4RFBA 1M4VA 1FNUA 5D3IB 1SE4A 3TSSA 1AN8A 1S5DD 2XRSD 3CHBD 4K6LA 2AQ2B 2QILA 2IJ0A 1EWCA 1SE2A 4RCOA 5ELCA 5FK9C 1S5ED 2NTTA 1TS5A 1ENFA 1I4QA 4UDUC 1XTCD 1FGBD 1FNWA 1PYWD 1FD7D 3BZDB 1LTSD 1SE3A 1DJRD 1PZID 1SXTA 1EFID 2XNAC 3GP7A 2QEJC 4RH6A 1JQYD 1SJED 1PZKD 4L6TB 5ELBA 1EEID 1DYQA 1JCKB 1S5CD 3W2DA 2ICIA 3DWPA 1I4GA 1D5ZC 2J4XA 1EU3A 1LTID 1CQVA 1V1PB 2XRQD 1LLRD 1MD2D 1JWUD 4Z9CB 1D6EC 2AQ3B 1HXYD 1L0YB 5FKAC 1KLUD 3R2TA 1CHQD 1LTBD 3DWAA 1LTTD 1LT4D 1B44D 1BCPF 3MFGA 1JR0D 4RGNA 1BXTA 1D5XC 5ELFA 1RD9D 1LTAD 1ET9A 1I4XA 1RF2D 5TSSA 4OHJA 2NTSA 5ELEA 1LT6D 4DXGA 1PRTD 3BVZA 3MC0B 1I4RA 2RDGA 1PTOD 3O13A 1F77A 1XXGA 1BCPD 1HTLD 2CHBD 1LTGD 1GOZA 3EA6A
chains in the Genus database with same CATH superfamily
1RCVD 3NTKA 1WCMB 2LXJA 5M3MH 2LMCB 1JT8A 3CCVA 4PV1C 4CDEC 5C4HA 2VW9A 1EU4A 3HEJA 4JI8Q 1Y1VG 2IX1A 4PG3A 3OYYA 1TS2A 2D62A 3EFXD 2G9HD 3K5NA 3DXJC 3QIAA 1SFOH 2XTIA 4PZ6A 4GKJL 1JWMD 1SNQA 3F2BA 4DUYL 1OXSC 2YYZA 4H7BA 1JOKA 1TY0A 3I4NH 4DU9A 3KF6B 2WB1B 5KYIA 3G48A 3FKIH 2EYMA 2QF7A 5HGQA 1CZWA 2F4VQ 3HOYH 4B08A 1O7IA 4BBRB 2JEAI 1EIHA 2IY5B 3KF8A 1CSQA 1CZGA 1XTDA 4YWKA 1I6HB 3SHLA 3GTPB 3S1QB 3MXUA 3EIVA 3GTGB 4GLVB 1ENFA 4A3BG 4IUTA 3AB9A 2K5QA 3H3VC 2E2HB 2XSCA 3K58A 2KHJA 4GNXB 3TS2A 2XNAC 2QEJC 1DM0B 1VQAA 5ELBA 3OHXC 2Q8TA 1JCKB 2KOLA 3T56B 3OTOQ 4A3CH 1EQRA 1U9RA 2VNUD 3OPOA 2HHHL 1STBA 1GM5A 3BS1A 1D2BA 3QO2A 1L1OC 1UEBA 4WJWA 5E7NA 5JEAJ 3PF5A 4JBJA 2JA6H 3W1BA 3HS0C 5BN3A 2I46A 3BJUA 1B2TA 2NZ1D 4DGZA 5C3WA 4C3HH 4J15A 4DV6Q 1G2TA 3RZDB 1HJPA 1EYDA 4KJOA 1LT6D 2KVMA 5GAHC 1I4RA 4HMJA 4BA2I 4X64L 1W6JA 3BVZA 4A3DB 1JOQA 3SEBA 3I4MH 1EZ6A 5IYCH 4R4TA 2I0QA 4DV4L 4LUOA 2OT2A 3NWSA 3K5OA 1R9TH 4JI6Q 5C44B 4RHSA 2O5JC 4TRDA 1HR0L 3M7NA 1NUCA 3PO3B 1AH9A 2HCIA 3SR1A 1KLGD 1HZAA 1TWCH 3CCQA 1BOSA 4DAYB 1KL9A 1LO5D 1LTRD 3NBHA 1WTVA 3HOUH 2VS1A 2RDHA 3EBEA 3GTQB 4MTKA 5FO9B 4DR5Q 4LK1C 1UNSA 1N8RC 5IGBA 3M7GA 1EL0A 3EVQA 4RHRA 2AWOA 1CHPD 2UXCQ 4K2KA 1SAPA 3PUXA 1XNRQ 1IHZA 2EYOA 4A75A 4B9XA 4QB4A 1PZJD 2X69A 3WWVA 3TRZA 2YTXA 3H09A 3BU2A 3U9OA 5LL6S 2JA5H 5FLXc 4QQBX 2KQ3A 5C4JB 2Z6KA 4V190 4JVZA 3A55A 1U0LA 3ERQA 3NPPA 4EQNA 4HIOA 4JI0L 1IW7D 5F2DA 4A3JB 2E2JB 5A2QL 5C0XI 3K5LA 1YHQA 1ONLA 3J80c 4BY7H 2JXMB 1CUKA 1X55A 2Q2UA 2K5DA 1QVFA 2PNHA 1SE2A 3CCEA 5I9PA 2ASBA 2A73B 4UDUC 4LFCL 2VQEQ 2KCTA 5C4ZA 2EY1A 4LFBQ 4BS9A 1QOHA 3DUZA 2X6LA 1DOKA 2K04A 1VQIA 1EIFA 4AYBG 1E2VA 1TVXA 1TKWB 1L1OB 2B2TA 2C35B 3I72A 3NTHA 5AFWA 3PMFA 2XGTA 4Z9CB 1PFMA 1HRJA 1L0YB 3DM3A 5FJ8G 1B7YB 4XT1B 3GTJB 1YBYA 3OMGA 5C4XG 1Y1VB 5HURA 2JJQA 1FYCA 3ER0A 1GUGA 1SYBA 3G6EA 2E5LQ 5TSSA 3Q22A 3AQQA 3J80E 3J81i 2HDLA 3D6WA 1F2MA 1RDPD 2ZTEA 3S16B 3F8TA 2P5ZX 1PH1A 3FKIB 4GNXA 3CQZH 3VYTA 1GHKA 1WJJA 4M8AA 1E1TA 2WAQG 2VUMH 3GTOH 1PTOF 3NELA 3HOVH 4FNFA 1VQ8A 4DV0L 1K3RA 4RAUC 4RKBA 3HOZG 3ONAB 4DPGA 2FFKB 2NVQH 1V8QA 3OW7A 1BCPC 1TWAH 1N33Q 1JICA 3FPUB 2EJMA 1HHVA 4OGQC 3I7FA 3H0GH 4JOIC 2KA7A 3PV0A 1NY4A 3E6ZX 4EQ5A 1EY8A 3PIP3 3T51B 1GVPA 1STHA 3I56A 2B2YA 3CC4A 4JW0A 4JC0A 5CV4A 1RTOA 3BDCA 3QOJA 2NVXH 2R3ZA 4H13C 2OQKA 1I6VC 4IO9A 3NTIA 4KY5A 4FYDA 4OX9L 3KLRA 5D3IB 2MQHA 4KLKA 2QILA 1OXXK 3OMCA 2F0WA 4NDXA 1AEXA 4QIWE 1S5ED 1Y69U 1EYAA 1OXVA 1DONA 1BNZA 2JA8B 4DAYA 4KN7C 2HIVA 4A3MH 1K73C 2MP1A 3IKJA 1YNXA 1I3QB 2QDLA 3S17B 3VR4A 2PQAB 4DUZQ 4OEMB 1ZXTA 1PDQA 2K50A 5M5XH 4JI8L 4A3KB 4A93H 1JWUD 2NN6H 4QL5A 5IP7G 3ZYYX 5E4XA 3JC66 4QUCA 4X66L 3I4LA 3MFGA 1X3EA 1N9WA 4KN4C 5M3FH 4RA8A 4GN5A 5CORA 4DN4M 4JI7Q 4B3RQ 1LTAD 1ET9A 5JEAH 4LF9Q 3HOXB 1DGSA 2WINB 1B3QA 4N9PA 1R4PB 4R4QA 2MO1A 2A1AA 3MXPA 5BR8Q 3S2HH 1UE6A 4K14A 5GAEC 3J80i 3R8BA 4CKEA 4OO1G 1PRTF 4JI1Q 3GTLH 3CCMA 1O7YA 5ELDA 1L1OA 1VF7A 1SE8A 5C0XJ 4QY7A 5M5WB 1BCPB 5CYUA 4RGOS 2DN8A 3I8ZA 1LM0A 4YY3Q 3RNUA 5IGFA 3HOWH 4DR2Q 4BBSH 1Y1WH 4J8QA 1L0XB 3OTOL 1ET6A 1TS3A 2SDFA 2IHEA 3TN2A 1G291 2ZXPA 1MSHA 2L5TA 4S3SA 2F0JA 3P7JA 3S24A 3VA7A 2B63G 3EN2A 4A3FB 1N36Q 3K59A 3E0JA 1SMYC 3KBXA 3NQTA 4A3IH 4IUVA 3OWEB 1X56A 1A3UA 3Q8DA 1Y14B 4ULLA 4HAEA 1YNJD 3OWFA 3CHBD 3D4WA 1WCMG 2R6GA 3U58A 5IP9H 1XMOQ 4GZYC 2IJ0A 2B29A 3HKSA 3QJYA 1KNAA 1GUSA 1NCVA 1GD7A 5IYBH 4LF8L 5G3LF 3M4YA 3Q0AA 2ZJRA 3OIPA 5C4XB 3UE0A 2JP1A 1A8VA 1LTSD 1SE3A 3HRZC 4BY1H 3KUPA 4V0BA 4JI6L 1DYQA 3AYHB 4I7ZC 3DWPA 2A74C 2RHSB 2RVLA 1WI5A 4DV5Q 1WTXA 1SLJA 1DD2A 3L3OC 2Q8RE 4LF7Q 3GTOB 4XYQA 1KXLA 1GXDC 3DWAA 2QA4A 4C3JG 1BCPF 4A3GH 2FJ2A 2GA4B 4OELB 1BXTA 2A6EC 1TWFH 4DK3C 4DR5L 5ELFA 3A5ZB 1CKNA 2PO4A 3T4AC 4OHJA 1CTMA 3MXNA 4P72A 3U50C 2CQOA 2E8GA 3PIO3 4LF5Q 2NBFA 1XNRL 2ZXOA 2UUBL 1S4ZA 1PA6A 1B9MA 3T1HQ 2WKDA 5KNDA 1HNWL 5LMNW 3D8GA 4WRDA 2K5VA 1G6ZA 2B2VC 1Q46A 2KECA 2SNSA 5C3EG 3WOFA 3C46A 3NK9A 1LT3D 1F2YA 2NUCA 3A8JE 2PQAA 5I2YA 4PMBA 2WKCA 1ZYRC 1VQ9A 3GTMB 3N6RA 1FJGL 1KTKA 5FLMH 2VQEL 4ILWA 4POFA 2L12A 2VZAA 4LFBL 1SN8A 1AZQA 2H1EA 5AJ3Q 1F9QA 3MWYW 3D3RA 3GD7A 4A3MB 4PZ8A 2GVAA 1E24A 2B8GA 1QILA 2R7FA 3D0FA 5GAGC 2I5LX 3K80C 4RG1A 4IPCA 4XQJA 2DJGC 1EIGA 2DGYA 1YEZA 1FR3A 1VS0A 4C56C 3TREA 1RL2A 3BYYB 5LMNQ 4BA1I 4XT3B 3NHHA 3TSSA 2E5LL 4K6LA 3CAMA 4K5VA 1F9SA 1Q3LA 2BH2A 4IN3A 5C44G 4APVA 4EGVA 4JOIA 3SK6A 2R92B 1SXTA 1EFID 2H4OA 5D14A 5EPLA 1QZHA 1CA5A 3PO3G 1S72A 3S2HB 1S5CD 3MFYA 3GV6A 4IUQA 1I50B 1QCBD 1GJXA 4DNRB 4LF4L 1V1QA 4N8X1 4OWXB 3L0OA 3CPFA 3J81j 1CFMA 2EJGC 4BXXG 5I6YA 1D6EC 2E2IH 1U4RA 5IIFA 2LY7A 4AYBE 1EYCA 4OO1I 2CKZB 3T13A 3W5OA 1HQMC 4DV7Q 1C8CA 1WTHA 3LWEA 4DV3Q 1CM9A 3FMCA 1EQQA 2RQXA 3O13A 1F77A 1PFBA 2PI2A 1LTGD 2BE5C 3S1MB 3I2ZA 4A3JG 1HA6A 1YNJC 1TQOA 1VQJA 5LHY1 4CHTB 2A69C 5M5YB 4IQZA 3EJIA 3J81L 4X62Q 1HPCA 1B9NA 1IL8A 1PH6A 2O5IC 2PZWA 1U5KA 1O78A 4A3EB 5J22A 3R2IA 4IPGA 2PYKA 1UUPA 1CKMA 4PMCA 4CDDC 2LXKA 1IL2A 1IZ6A 3G71A 1Y8OB 1PTOH 2WAQE 1SNCA 1UE7A 1KRSA 1LACA 4GKKQ 3H94A 5C0XH 3CRKC 3X3MA 3RZOB 5E4WC 4P74A 3PO2B 2HUGA 1XPUA 4DUZL 1G8ZD 1A63A 1GKHA 3X3NA 4XXEA 3A5UA 1TU2B 1GHJA 4P2CB 1DZ1A 4JPBW 3TS0A 3MXGA 1MJCA 4DR4Q 4HIKA 1T5XD 3F2UA 4KMUC 2Q2HA 1F2ZA 4NXMQ 2ICEC 2ZXRA 3KK7A 3GTKB 2L11A 1SNPA 4JI7L 1V43A 4KTAA 3JAMc 2UXDL 4LF9L 3I90A 4EQOA 2VB2X 3ULLA 3FKIG 3TP8A 5BR8L 4C3JB 1YI2A 4NMZA 1RODA 1ZKOA 4F8MA 1B3AA 1JQYD 1NMFA 4XTCS 2SNMA 4Y7NH 5CGKA 5G3LD 1JE5A 2ICIA 1UEAB 4JI1L 1A2UA 1BUVT 2R7ZB 1VQKA 2H5XA 1M1KC 4C3IB 2R93B 3GQBA 3M3YB 2RA4A 3D6CA 3C1EA 5C3EB 2JSOA 1PH2A 1SNMA 3BG3A 4HJ7A 2VY3A 4JBMA 2XVSA 5IYDG 1KIXA 4KKSA 2K32A 5IOCA 2UU9L 1DXMA 3C1FA 3TZDA 4POGA 2EIFA 1SR3A 2F0VA 4DR2L 4A3CG 2UXBQ 3JAME 5CV7A 1XWEA 3MC0B 1T5EA 1PXUA 1D1KA 2Z4HA 1PH3A 3V2TA 1BCPD 2X6GA 4F7XA 2FMMA 4WFN3 3W3AA 3AU7A 5FLXL 1CSPA 1N36L 4DV1Q 2Z8LA 4K8IA 2R61A 3S15H 3K7AB 4O2DA 1STEA 4HMIA 2JA8G 2CQAA 1TXYA 1EUJA 3PCOB 2WFWA 3ICEA 1XMOL 2K5HA 1VMCA 2D0PA 1K8GA 2ES2A 4DAMA 1CKOA 2QKIC 3VYUA 2Y0SE 4A3KG 1AP0A 1X3PA 4NXNQ 1VQCA 1EQVA 3I91A 5IY0A 4B3SQ 1I4PA 4AQYL 1LYLA 2F3WA 2N88A 4QF4A 4N8FA 3RN2A 3P75A 2EYLA 1SJHD 2FINB 2O2LD 1JB7A 3FHWA 4X3SA 4LF7L 1LTLA 4QMGA 4ABNA 3CMAA 2B2VA 3HOXG 3OOCA 1NE3A 2K33A 2K01A 2NZHA 4LFAQ 2RHQB 1TWHB 3SDZA 4NPSA 3SK8A 4DK0A 1HNZQ 1IYVA 4YWLA 2UUCQ 1TWGB 4CDFC 1BF4A 5I2XA 3IFTA 3CD6A 1AFPA 1SYGA 2PMZE 5E1FA 1DJRD 1PMRA 2CH4W 3CMEA 1YIJA 1KRTA 2OCEA 4GN3B 3A74A 2K52A 2RKSA 4JBKA 1KAWA 3VR6A 4C2MB 1J5EQ 3SVMA 2D5DA 2NZOA 2EDGA 1R4QB 2JA7H 4F88A 4AH6A 3H3VI 4IOAA 3E9IA 5DEHA 1STGA 2DJFC 4FF1A 5JPMC 3PUVA 4XQQA 1J9OA 4HSPA 4A3FG 2YTVA 3HKZG 5AJ3L 1B50A 2VQFQ 2WB1E 3IRBA 4A76A 4HTHA 4ALPA 1YNNC 3S14H 3MEHA 1I94Q 5EBDA 5M3MB 1Q8IA 1H9SA 4DNTB 3URYA 3VA5A 2PPBC 2N78A 2KENA 5LMNL 1XYIA 1C4QA 1SRUA 2ID0A 5KGUA 3I70A 4JYAQ 1QJOA 2AWNA 2C9OA 3DEPA 4IOCA 4H0LC 1SMYD 1SFOB 4KHZA 3KFUA 3OSOA 3B6YA 1XNQL 1FL0A 1N34Q 1K83H 4JI5L 2R7DA 2F0GA 5LL6X 3I4NB 2LS01 1WYDA 2NVYH 5CMDA 1QWYA 5FJ8H 1QZGA 5I6WA 2E76C 4R8IA 4OWWB 3HOVG 4U68A 1XPRA 4L5TA 3HOYB 2B2UC 1HNXQ 1Q81C 4IPHA 3TQYA 3S2DH 1WTWA 4NP5A 3U9SA 3UDFA 4I7AA 1QVCA 4HJ5A 2G9DA 3H0GG 4JV5Q 5IT9L 1SNDA 1WTOA 3UE1A 4DV7L 4PNYA 1J6QA 5BN5A 1EY6A 3QB3A 3U4ZA 2WIIB 1J8IA 1KDAA 2NTTA 4MIUA 4DFAA 2GN5A 2QEXA 3WDNA 5FO7B 2UUAQ 1K0RA 2A6ED 3BZDB 3A8IE 2JN4A 3KJPA 3HOZH 1GO3E 1BBUA 2IT1A 4WJ4A 2F4IA 1IKMA 3L7ZC 3RUZA 1H9MA 4JI3Q 5A35A 1CKNB 4MN3A 2IHFA 1X9NA 1LTID 4OONA 1LLRD 3MXNB 2CCZA 2CW0C 5CV9A 2JA6B 5IGGA 1Y8PB 5FKAC 2YU9H 5NUCA 4DR6Q 4A3MG 2RCFA 5DAUA 2F0KA 4GKKL 4C3HB 3TP5A 2NVTH 2N8NA 2O4XA 2ZM6Q 3Q24A 5K36G 3LWUA 5KNCA 3T1YQ 1I4XA 4G7HC 1ZYRD 2A6HC 2M00A 1WD1A 1A3VA 4ME5A 4P73A 4R9WA 2RDGA 2E74C 1Z6HA 1XXGA 3M4OH 3I4MB 1Q82C 3EA6A 4K8JA 1HH2P 3S1RH 1D1IA 4HN7A 1R9TB 3VR3A 4X3KA 4E6IA 5A2QE 1EEFD 4LJZC 2EYHA 4OXPA 4NXML 1LUZA 3LNNA 4OL7A 4DXFA 1SROA 1TWCB 1NBWA 3ZJYC 2R92G 3HOUB 3STBC 4C1NK 2E75C 1VQ7A 2BDNA 1TIID 3S9WA 4QJFA 1WD0A 2F4VL 3D4RA 1OXTA 1S40A 5IP7H 1K0SA 3DWQA 4N9TA 1IBLQ 1STYA 1CK1A 1JE4A 4GKJQ 4CGYB 2K5NA 2JA5B 3HZXA 3AMUA 5H1SE 1N32Q 2CFMA 5FO8B 4IFDG 1OXUA 4ZUIA 2V1CC 1PVOA 3A7AB 2EXDA 4ZRZA 1ENCA 3E3XA 1A62A 2XWBB 3CC7A 1M4VA 3BDOA 1VQBA 3HOWG 4BY7B 1HZBA 4BBSG 2QGQA 1AN8A 5ELCA 2BOSA 4OO1H 4DNIA 3PUZA 5C3XA 2M9VA 2OEOA 5GROA 3HFZB 5EPKA 3F2CA 1IKLA 3J7A5 3TP6A 1PYWD 4RWSC 4FXGC 3BZKA 5JVG3 4A3EG 4DV1L 3HKZB 4HEDA 3K81C 4RH6A 4Y52H 4ZKBB 2HCCA 3W2DA 1A3TA 1GUTA 2A68C 1D5ZC 2BE5D 2N3SA 1BKBA 2XRQD 1STNA 1HR0W 1MD2D 5IGDA 2DNEA 3A56A 1MI2A 2CVRA 4DV6L 4L5SA 1QNUA 2A69D 1VQMA 1F2LA 3PO2G 4MZ9A 4CJ1B 4X6AH 4YCWA 3OW2A 1E22A 1JJCB 1LTTD 4FXKC 2HHHQ 1ICWA 2EXZA 2KHSA 3S1NH 1DOMA 2EZVA 3VR2A 4F87A 4B3SL 2B63H 2F0PA 3TZUA 2EE1A 4DXGA 5FOBB 2ATWA 2D9UA 1GOZA 3SE0A 4ZUJA 1KC8C 1B53A 4KHPQ 4A3LG 4EX5A 3TBIB 3CQZB 1WCMH 4DR4L 4KY6A 2VUMB 5K5PA 4O1NA 3HOVB 3MZ5A 4DR1Q 5CV8A 1M8AA 3WOEA 3BZCA 1TR5A 2J0TD 2ZJPA 1PFNA 4H02A 4DV4Q 2XN9C 4BWGB 1EZ8A 4M1UB 1HNZL 4FXDA 2NVQB 4TSSA 1TWAB 2UXCL 5ELOA 4HCEA 3H0GB 4L8JA 3QWNA 1HR0Q 2ZTDA 4XIGS 2R7ZG 2E2DC 4C3IG 4GS3A 2R93G 1LV9A 4IZ8A 1NR4A 2LKVA 1EWHA 3F2DA 1ZEQX 1S5BD 2BA0A 2NVXB 2N49A 1X3QA 3BYTB 4G7OC 1VQ4A 2G5DA 3A0JA 4ODGA 3RD4A 2OQ0A 2ALYB 4BBRH 5KRUA 4DR3Q 1RHPA 3FP9A 3J7YW 5BN4A 4U673 2ZJQA 2CWAA 1S5DD 2WP8J 1I6HH 2AQ2B 5EKKA 3GTPH 2F0EA 2VQFL 3S1QH 5ELNA 1WTPA 4ZKCB 2V4DA 2DY7A 3GTGH 3T16A 2EYJA 3J7AV 5C6AA 4JI0Q 3DLLA 1QB5D 4B3TQ 2E2HH 1VQ5A 3GP7A 1KD1C 2F0LA 3LGJA 4HJAA 4LMQD 4UP7A 1HTPA 5M5XB 4LFCQ 1MJEA 3RLOA 2LSSA 4A93B 4ME3A 3K5MA 1V1PB 2B2UA 5J39A 2KEEA 1JC7A 4NKLA 4JYAL 4TKOB 3PGZA 1HUMA 3RLNA 1SSOA 3AFPA 2YV5A 3H15A 1OTCA 1X6OA 1EFWA 5M3FB 2FXQA 3K57A 3G7LA 3IL8A 4HR7B 1SNOA 2EY5A 2IX3A 3H91A 2NTSA 1ASYA 3V96A 1Q12A 4FDBA 5HY6A 3RZDH 4JI4Q 1HFGA 4O42A 4WORA 4LUZA 2EVBA 3C2PA 1EU3A 3QOLA 3P20A 2OWOA 2KEDA 1HNXL 1II3A 4RGMA 4A3DH 2RBMA 3NSWA 3SXHA 1VQFA 3GTLB 4L5RC 4JV5L 1X3GA 1N33L 4I65A 4L63B 5C44H 2F0MA 2D0OA 2PI2E 2J7ZA 3E5SA 4IFDI 3PO3H 2JQOA 5CV5A 1MGSA 4G4KA 3DM1A 3NBIA 3PF4A 2KCMA 3CW2C 4TQUS 3GTQH 3HOWB 4BBSB 1YZ6A 1Y1WB 3RN5A 3BVMA 1SEBD 2MUYA 5DM73 2M2LA 3NWTA 4G57A 4FF4A 1G2SA 4KHVA 1AW7A 4K0KQ 4JCVE 5JVH3 2L1BA 1TT2A 4A3IB 2C5CA 2K03A 4XQNA 4R8NA 1TS4A 4CKCA 4DR6L 4K5WA 5C4JH 4Q0FA 4HSVA 1FNUA 4DF7A 2JK8A 5EBCA 1SE4A 3U4VA 2ZM6L 3NUCA 3Q23A 5M3MG 1NSNS 3TDQA 3T1YL 1MIUA 4A3JH 1JJ2A 2E2JH 4LNQA 3ULJA 5JOBA 5FK9C 1AZPA 1TS5A 1PH7A 1ML0D 3H3VH 2A5HA 3I3CA 3PUWA 1FD7D 3UDXA 3CCJA 1PH5A 5JJLA 4BY1B 1VQGA 4IUUA 1EIYB 4B3MQ 1SDFA 1YNND 3CXCA 2F52A 2J4XA 3NQIA 4FVMA 4XDXA 1VDZA 2F0DA 2PMZB 2A8VA 3I4NG 5J3BA 2IL8A 2K4KA 4B3RL 3VYRA 3NXWA 1CHQD 4A3GB 4JBWA 1B44D 1TWFB 1JR0D 3GTJH 3D31A 1E0BA 4OWTB 1H9SB 3HOYG 3ND9A 1IBKQ 1Y1VH 1VQPA 5ELEA 1MKHA 1H95A 4X3TA 4MNOA 4X66Q 4YCVA 1O80A 3SGIA 1IBLL 1AE3A 2PQEA 3LX0A 1A6XA 1NMGA 1N32L 3S16H 3KJOA 2EYPA 1HQRD 1EY0A 1SMXA 5C5MA 3K0YA 1O7ZA 2CH4A 5IWAQ 4YY3L 4YHHQ 4HJ8A 1VQ6A 3NP8A 1FVIA 1WFQA 4O0AA 2F0UA 3CCSA 2AKWB 1YVCA 1V1PA 4IPDA 3J81c 1YJNA 1K8AC 1PTOC 2AQ1B 1MBYA 1VQEA 2IPKD 3BVGA 2Z1CA 1GUOA 1D7QA 2JA6G 5L37A 2F0QA 3J7ZC 3KBGA 2D2CC 5IYDH 5IGEA 4KK7A 2WACA 2B2WC 1VQDA 3PUYA 5EPJA 4C3HG 4A3BH 4QUFA 3I55A 3J80L 2Z6BA 2K05A 4P71A 1EOTA 3DEOA 4EQPA 5I4DA 4LF6Q 5DLQE 3KOJA 5I9OA 3TEHB 3I4MG 3FDTA 5IYCG 2PW7A 3R93A 1SYCA 2CW0D 2MO0A 2XRSD 5IE8A 1XX8A 3TP7A 3L2PA 5CBAE 3TMEA 2XIWA 1UE5A 3J81E 1NAPA 3PIPA 4DV5L 1Q8KA 2JA8H 1PV4A 1A15A 3C3LA 1K28A 2NWGA 4PMWA 4KHPL 4YWMA 1RKNA 2A6HD 4K6DA 2OF1A 1U4PA 1I3QH 3HOUG 4LF8Q 3S17H 2RSOA 4AIMA 5GADC 4DR1L 2JA9A 1E2WA 2K1BA 5JAVA 2K28A 1W2BA 4A3KH 2E2IB 3W1GA 3RMHA 3DMUA 2EY6A 3T53B 2KUMA 3G4SA 1CI3M 4IFDJ 4FF3A 1DOLA 1H9RA 2N55A 4LF5L 1PH9A 1LT4D 2L0CA 3PQIA 4RGNA 1UAPA 4JI2Q 3T1HL 4RKLA 4DV2Q 2ENBA 2ZT9C 4QCLA 4CJ2C 2JA5G 4ZK9B 5CBEE 1EY5A 5EJWA 1RF2D 3STBD 1D8LA 4QIWB 3VR5A 3HOXH 1PH4A 4TVAB 1ESRA 2I07B 2PZUA 5LMUQ 4R4OA 4BY7G 1CQFA 2JYOA 3CPWA 2JA7G 2AUJD 4DR3L 2UUBQ 1ESFA 3HG9A 4LUVA 2NYZD 4NB3A 1HNWQ 4GN4B 4GOPC 1FNVA 4Q5VA 1U4MA 1BBXC 1L2FA 1PTOB 4ZAIA 1PRTC 5M5WH 2Z9HA 2FHTA 1K8MA 1SBBB 4IURA 3L9AX 4UP8A 1IYJB 3KDFB 4B3TL 3K8AA 2SEBD 2K14A 3F1ZA 4GLAC 3KYHC 3JAMi 1PLFA 5EKIA 3CCRA 2A19A 1FJGQ 1WOCA 1ASZA 2XWJB 4B9WA 3Q6SA 1XMQQ 1HCZA 1QVGA 1I5FA 2EOTA 3J7AF 4DR7Q 2AHOB 2K7VA 1X32A 4UAIA 4HIMA 2EPBA 3BDLA 2F0HA 4A3FH 3SK4A 1V1OA 4A4IA 4IALA 3KF6A 5J1ZA 1VCIA 1KAAA 3OIQA 2A68D 3E0EA 4HCSA 4RMFA 2JEBI 1KDBA 1LABA 4ZCKA 5GQOA 2BCOA 2LFNA 1A0IA 5FLXE 4JI4L 3NE5B 2VUMG 1MHWC 1XTCD 3UI2A 1ILPA 2JE6I 3MAQA 2F03A 5C4XH 1H9JA 2PW5A 1PZID 3CKIB 4Y7NB 4DAPA 3CCLA 1PZKD 4ID6A 1EEID 1WTQA 1E2ZA 4WJ3M 1Q7YC 4KKTA 1H9KA 1IXRA 4KI0A 4MHEA 2F0SA 4FP5D 1KLUD 4DV3L 4FF2A 1ILQA 3P1HA 4X65Q 1LTBD 1IYUA 1O7LA 3I73A 4LF4Q 2F0NA 1IBMQ 2AMCB 3A54A 1FGUA 2EJFC 5EAYA 4YCUA 3MTSA 2K75A 1HTLD 4X62L 3CF5A 4IJLA 3ITPA 1M90C 1G91A 1OO9B 4K0KL 1B4OA 1NR2A 3S15B 1Z47A 1X65A 4GOPB 4A3BB 1RJTA 1HZCA 1D5MC 1EY7A 1C9OA 3NEMA 2VXWA 1PRTB 1F9PA 2WV6D 1L0WA 1EWIA 5DNFA 3GTMH 4J1MA 4KJNA 4H44C 1T9HA 1JB3A 4A93G 1S5FD 1SYFA 4JG2A 3PIOA 2NN6G 4LW1A 2KCNA 4B3ML 3CU7A 3MA2B 1I4HA 1S3OA 1BVSA 1XPOA 4IJHA 5M3FG 2HQLA 4UPAA 4R4CA 4PQXA 2IX0A 5JEAG 1YHBA 4C1NI 4ZYSA 1VQOA 5K36H 1HUNA 2HD3A 2F0IA 3G6JB 1CT1D 4RFBA 1MSGA 5COYA 2K6AA 2Q2IA 4DK6C 2F1MA 3EQLC 1IBKL 4DAVA 1KABA 3QR8A 1RTNA 1EWCA 4FO2A 1Q1EA 2DY8A 1FGBD 1FNWA 2FMCA 5IT9c 4KV6A 2KJXA 4DUYQ 2UXDQ 3SK5A 1BO0A 3KDFA 2R92H 3ND8A 1UE1A 5EKLA 5IWAL 1K9MC 2L55A 1I50H 4CBVA 4EVOA 4YHHL 3A8KE 4R4IA 1XJVA 1IW7C 2B2WA 1PFSA 2MHVA 4UP9A 1Y1WG 2QDBA 1GUWA 2JA7B 4ZQ3A 5T1IA 4K2LA 2UXBL 3R2TA 1E3PA 2L9HA 3KLSA 1X3FA 5EQ0A 2MNAA 3ULPA 1JMCA 3AEVA 1QUQB 2PCFB 1D5XC 2PNRC 4G7ZC 2Y0SG 1KDCA 2EQSA 4HJ9A 4A3IG 4IFDH 3S14B 2MFIA 3E9HA 2HT1A 2CHBD 1NNXA 2UU9Q 3M85A 1PYBA 4X3UA 1HZ9A 2YTYA 3S1MH 5IT9E 5IP9G 5D3DA 5HGTA 3KLSX 1HA5A 2KHIA 5IYBG 2VL6A 1G6PA 4LF6L 5KYLA 5M5YH 4DKAC 1NJIC 1WTRA 4UY8C 3EROA 4LWCA 1Z7TA 4UHVA 3N52A 4NXNL 3ERSX 1K3BC 4OIJA 4BY1G 4A3EH 1EY9A 1SYDA 2BH8A 2AUKA 1VMPA 1PH8A 1K83B 4AYBB 1LT5D 1BBWA 1QNKA 3VYSA 1E7ZA 1B1ZA 2L4NA 1Q86C 2NVYB 4L5QA 1U4LA 4NW2A 3RZOH 1G51A 3H6MA 3VDYA 1EQTA 3PO2H 3M9BA 2GVBA 4A3GG 4X64Q 1BQQT 4J6HA 3GDEA 4LFAL 2IW3A 4AQYQ 3S2DB 3FVQA 3M4PA 2I5MX 4RGTA 4DK1A 5JJZA 2UUCL 1AE2A 4P75A 1SYEA 1NTGA 5D65A 1BDOA 4JI2L 5DM63 2RSNA 4PZ7A 4DV2L 4GOPA 3MEFA 4K5XA 5CC4A 5KNBA 3GTKH 1EYGA 1HFNA 1VQHA 4A3LH 2K5WA 1GUNA 1V9PA 4YIJA 2WB1G 1W3SA 3DHQA 2WAQB 5CR3A 5T1GA 5LMUL 1J5EL 4C3JH 1KNEA 2B3GA 1Q90A 3HOZB 4BBRG 2NB0A 4L6TB 2TMPA 5FLMG 3K7UC 3RLFA 2EYFA 1YITA 5KEEA 2EY2A 1YJWA 1KQSA 3GV3A 2R7ZH 1YHAA 1ENAA 3IFDA 4C3IH 2R93H 2YU9B 2AQ3B 2ZTCA 1HXYD 3NENA 1BR9A 3M3YH 4IUNA 5C3EH 3UDIA 1QG7A 2QW7A 2NVTB 4QGUA 1UWVA 3R3OA 1I94L 1Z9FA 1RD9D 2MPMA 1Q1BA 4CKBA 2F0TA 3GO5A 1XMQL 3M4OB 1PTOD 1WVLA 3PSIA 2OTJA 2HQEA 3CCUA 4DR7L 3S1RB 3MHBA 4CDCC 2F0OA 1JORA 3D4DA 2NN6I 3KF8B 3FEWX 2KBNA 2Z6KC 1A2TA 3A7LA 3K7AH 2QCPX 1N34L 4DA2A 4XYOA 2MJ8A 2OXPA 2BA1A 2B39A 3MVVA 2VB3X 5IGCA 1TY2A 3V05A 1X54A 5IODA 5CV6A 2IWHA 4GLXA 1VQNA 4MTNA 4A3DG 1Y8NB 4HIDA 2RCNA 1QUQA 3HKZE 3M4QA 4LAAA 1C48A 1KHIA 2Q8IB 1JWSD 2TSSA 1XNQQ 3K6OA 2PZTA 2B2TC 4KY7A 2HIXA 4JI5Q 1B8AA 1K8OA 3JAML 2I5HA 3FRPB 5JPNC 1B70B 1F9RA 2F3VA 3CC2A 2F0FA 5EGTA 4RCNA 4X65L 5KIXA 4KKUA 1DCZA 2Z4IA 1ICFB 1QE6A 2UUAL 4R1JA 3HGBA 1RIPA 1TWHH 4DV0Q 3UDGA 1IBML 2L15A 1PYSB 4RCOA 4BXXH 1P8LA 1TWGH 1I4QA 3RR5A 1JOOA 4JI3L 1C7YA 2HDMA 2KCCA 2SOBA 1PHJA 2MGSA 2Y0SB 3FPPA 2DNCA 2RF4A 4KD3A 1SJED 2RDFA 4GNXC 2Z0SA 1P16A 1STAA 4CJ0B 2DUDA 5E3FA 2BDOA 1I4GA 1W6KA 2F3IA 1CQVA 1EOVA 3CP0A 4OIKA 3NBHB 4C2MH 5M9OA 5C0XG 3KLWA 1CA6A 1E1OA 5JJKA 2B8FA 2CWPA 3QG1A 1YJ9A 2OTLA 3CRLC 3I4OA 3S1NB 3IAYA 5ISRA 4JK1C 2B63B 3K0XA 4OX9Q 1VF5C 4ZLTF 4KD4A 2Q2TA 1VQLA 1PRTD 5JJIA 5C5LA 2B2YC 4IUPA 1C0AA 3AFQA 3HP3A 1JJGA 1EY4A
chains in the Genus database with same CATH topology
1RCVD 3NTKA 1WCMB 2LMCB 4PV1C 5C4HA 1EU4A 3HEJA 2IX1A 1TS2A 2D62A 3EFXD 2G9HD 3K5NA 3DXJC 3QIAA 1JWMD 1SNQA 1OXSC 2YYZA 4H7BA 1JOKA 1TY0A 4DU9A 2WB1B 5KYIA 2EYMA 2QF7A 1CZWA 4B08A 4BBRB 2JEAI 1EIHA 3KF8A 1CZGA 1I6HB 3SHLA 3GTPB 3S1QB 3MXUA 3GTGB 1ENFA 4IUTA 3AB9A 2K5QA 3H3VC 2E2HB 2XSCA 3K58A 2XNAC 2QEJC 1DM0B 5ELBA 3OHXC 2Q8TA 1JCKB 2KOLA 3T56B 1U9RA 2VNUD 3OPOA 1STBA 3BS1A 1D2BA 3QO2A 4WJWA 5JEAJ 3HS0C 5BN3A 2I46A 1B2TA 2NZ1D 4DGZA 5C3WA 1G2TA 3RZDB 1EYDA 4KJOA 1LT6D 2KVMA 1I4RA 4HMJA 4BA2I 1W6JA 3BVZA 4A3DB 1JOQA 3SEBA 1EZ6A 2OT2A 3NWSA 3K5OA 5C44B 4RHSA 2O5JC 4TRDA 3M7NA 1NUCA 3PO3B 2HCIA 3SR1A 1KLGD 1BOSA 1LO5D 3NBHA 1LTRD 1WTVA 2RDHA 3GTQB 5FO9B 4LK1C 1UNSA 5IGBA 3M7GA 1EL0A 3EVQA 4RHRA 2AWOA 1CHPD 4K2KA 1SAPA 3PUXA 1IHZA 2EYOA 4B9XA 4QB4A 1PZJD 2X69A 3H09A 3U9OA 5LL6S 2KQ3A 5C4JB 4V190 3A55A 3ERQA 3NPPA 4EQNA 1IW7D 5F2DA 4A3JB 2E2JB 5A2QL 5C0XI 3K5LA 1ONLA 2JXMB 2K5DA 1SE2A 5I9PA 2A73B 4UDUC 5C4ZA 2EY1A 4BS9A 1QOHA 3DUZA 2X6LA 1DOKA 2K04A 1E2VA 1TVXA 1TKWB 2B2TA 3I72A 3NTHA 5AFWA 3PMFA 4Z9CB 1PFMA 1HRJA 1L0YB 4XT1B 3GTJB 3OMGA 1Y1VB 5HURA 1FYCA 1GUGA 1SYBA 5TSSA 3Q22A 3J80E 2HDLA 3D6WA 1F2MA 1RDPD 3S16B 3FKIB 1GHKA 3VYTA 4M8AA 1PTOF 4FNFA 4RAUC 4RKBA 3ONAB 2FFKB 1V8QA 3OW7A 1BCPC 1JICA 3FPUB 2EJMA 1HHVA 4OGQC 2KA7A 3E6ZX 3PV0A 1EY8A 3PIP3 3T51B 1STHA 2B2YA 5CV4A 1RTOA 3BDCA 3QOJA 2R3ZA 4H13C 1I6VC 3NTIA 4KY5A 4FYDA 3KLRA 5D3IB 2QILA 1OXXK 3OMCA 2F0WA 4NDXA 1AEXA 1S5ED 1Y69U 1EYAA 1OXVA 1DONA 1BNZA 2JA8B 4DAYA 4KN7C 2MP1A 3IKJA 1I3QB 3S17B 3VR4A 1ZXTA 1PDQA 4A3KB 1JWUD 2NN6H 3ZYYX 5E4XA 4QUCA 3I4LA 3MFGA 4KN4C 4RA8A 5CORA 4DN4M 1LTAD 1ET9A 5JEAH 3HOXB 2WINB 4N9PA 1R4PB 3MXPA 4K14A 3R8BA 4CKEA 4OO1G 1PRTF 1O7YA 5ELDA 1VF7A 5C0XJ 5M5WB 1BCPB 5CYUA 4RGOS 2DN8A 3I8ZA 5IGFA 4J8QA 1L0XB 1ET6A 1TS3A 2SDFA 3TN2A 1G291 2ZXPA 1MSHA 2L5TA 4S3SA 2F0JA 3P7JA 3VA7A 4A3FB 3K59A 3E0JA 1SMYC 3KBXA 3NQTA 4IUVA 3OWEB 1A3UA 4ULLA 4HAEA 1YNJD 3OWFA 3CHBD 3D4WA 2R6GA 4GZYC 2IJ0A 3QJYA 1KNAA 1GUSA 1NCVA 5G3LF 3M4YA 3Q0AA 3OIPA 5C4XB 2JP1A 1LTSD 1SE3A 3HRZC 3KUPA 4V0BA 1DYQA 4I7ZC 3DWPA 2A74C 2RVLA 1WTXA 1DD2A 3L3OC 2Q8RE 3GTOB 4XYQA 1GXDC 3DWAA 4C3JG 1BCPF 2FJ2A 2GA4B 1BXTA 2A6EC 5ELFA 2PO4A 3T4AC 4OHJA 1CTMA 3MXNA 3PIO3 2NBFA 2ZXOA 1S4ZA 1B9MA 2WKDA 5KNDA 3D8GA 4WRDA 1G6ZA 2B2VC 2KECA 2SNSA 3WOFA 3C46A 3NK9A 1LT3D 1F2YA 2NUCA 3A8JE 5I2YA 4PMBA 2WKCA 1ZYRC 3GTMB 3N6RA 1KTKA 4ILWA 2L12A 1AZQA 2H1EA 1F9QA 3MWYW 3D3RA 3GD7A 4A3MB 2B8GA 1QILA 4XQJA 1EIGA 1FR3A 4C56C 3BYYB 4BA1I 4XT3B 3NHHA 3TSSA 4K6LA 4K5VA 1F9SA 1Q3LA 4IN3A 4EGVA 3SK6A 2R92B 1SXTA 1EFID 2H4OA 5D14A 5EPLA 1CA5A 3S2HB 1S5CD 3MFYA 3GV6A 4IUQA 1I50B 1QCBD 1GJXA 4DNRB 1CFMA 2EJGC 5I6YA 1D6EC 1U4RA 5IIFA 2LY7A 1EYCA 4OO1I 3T13A 1HQMC 1C8CA 3LWEA 1CM9A 3FMCA 2RQXA 3O13A 1F77A 1PFBA 1LTGD 2BE5C 3S1MB 1HA6A 1YNJC 1TQOA 5LHY1 4CHTB 2A69C 5M5YB 4IQZA 3EJIA 3J81L 1HPCA 1B9NA 1IL8A 2O5IC 2PZWA 1O78A 4A3EB 5J22A 3R2IA 2PYKA 1UUPA 4PMCA 1Y8OB 1PTOH 1SNCA 1LACA 3H94A 5C0XH 3CRKC 3X3MA 3RZOB 5E4WC 3PO2B 2HUGA 1G8ZD 3X3NA 4XXEA 1TU2B 1GHJA 4P2CB 1DZ1A 3MXGA 1T5XD 3F2UA 4KMUC 1F2ZA 2ICEC 2ZXRA 3KK7A 3GTKB 2L11A 1SNPA 1V43A 4KTAA 3I90A 4EQOA 2VB2X 3TP8A 4C3JB 4NMZA 1RODA 4F8MA 1ZKOA 1B3AA 1JQYD 4XTCS 2SNMA 5CGKA 5G3LD 2ICIA 1UEAB 1A2UA 1BUVT 2R7ZB 4C3IB 2R93B 3GQBA 3M3YB 2RA4A 3D6CA 3C1EA 5C3EB 2JSOA 1SNMA 3BG3A 2XVSA 4KKSA 2K32A 5IOCA 1DXMA 3C1FA 3TZDA 2F0VA 3JAME 5CV7A 1XWEA 3MC0B 1T5EA 1PXUA 1D1KA 2Z4HA 3V2TA 1BCPD 2X6GA 4F7XA 2FMMA 4WFN3 3W3AA 3AU7A 5FLXL 2Z8LA 4K8IA 2R61A 3K7AB 1STEA 4HMIA 2CQAA 1VMCA 2QKIC 3VYUA 1AP0A 1X3PA 1EQVA 3I91A 1I4PA 2F3WA 2N88A 4QF4A 3P75A 2EYLA 1SJHD 2FINB 2O2LD 4X3SA 4QMGA 4ABNA 2B2VA 3OOCA 2K33A 2K01A 1TWHB 3SDZA 3SK8A 4DK0A 1IYVA 1TWGB 1BF4A 5I2XA 3IFTA 1AFPA 1SYGA 5E1FA 1DJRD 1PMRA 2RKSA 3VR6A 4C2MB 3SVMA 2D5DA 2EDGA 1R4QB 4F88A 5DEHA 1STGA 4FF1A 5JPMC 3PUVA 4XQQA 1J9OA 4HSPA 1B50A 4HTHA 1YNNC 3MEHA 5EBDA 5M3MB 1Q8IA 1H9SA 4DNTB 3URYA 3VA5A 2PPBC 1XYIA 1C4QA 2ID0A 5KGUA 3I70A 1QJOA 2AWNA 2C9OA 3DEPA 4H0LC 1SMYD 1SFOB 4KHZA 3OSOA 2F0GA 5LL6X 3I4NB 2LS01 5CMDA 1QWYA 5I6WA 2E76C 4R8IA 4U68A 3HOYB 2B2UC 1WTWA 4NP5A 3U9SA 2G9DA 5IT9L 1SNDA 1WTOA 4PNYA 5BN5A 1EY6A 3QB3A 2WIIB 1J8IA 1KDAA 2NTTA 4MIUA 4DFAA 3WDNA 5FO7B 2A6ED 3BZDB 3A8IE 2IT1A 2F4IA 1IKMA 3L7ZC 3RUZA 1H9MA 5A35A 4MN3A 1LTID 1LLRD 2CW0C 5CV9A 2JA6B 5IGGA 1Y8PB 5FKAC 5NUCA 5DAUA 2F0KA 4C3HB 3TP5A 2O4XA 3Q24A 5K36G 3LWUA 5KNCA 1I4XA 4G7HC 1ZYRD 2A6HC 2M00A 1WD1A 1A3VA 4ME5A 4R9WA 2RDGA 2E74C 1Z6HA 1XXGA 3I4MB 3EA6A 4K8JA 1D1IA 4HN7A 1R9TB 3VR3A 4X3KA 4E6IA 5A2QE 1EEFD 4LJZC 2EYHA 3LNNA 4OL7A 4DXFA 1TWCB 3HOUB 4C1NK 2E75C 2BDNA 1TIID 3S9WA 1WD0A 3D4RA 1OXTA 3DWQA 4N9TA 1STYA 1CK1A 1JE4A 4CGYB 2JA5B 3HZXA 3AMUA 5FO8B 4IFDG 1OXUA 4ZUIA 3A7AB 4ZRZA 1ENCA 2XWBB 1M4VA 3BDOA 4BY7B 1AN8A 5ELCA 2BOSA 4OO1H 3PUZA 5C3XA 2M9VA 2OEOA 5EPKA 1IKLA 3TP6A 1PYWD 4RWSC 4FXGC 5JVG3 3HKZB 4HEDA 4RH6A 4ZKBB 2HCCA 3W2DA 1A3TA 1GUTA 2A68C 1D5ZC 2BE5D 2XRQD 1STNA 1MD2D 5IGDA 2DNEA 3A56A 1MI2A 2CVRA 1QNUA 2A69D 1F2LA 4CJ1B 1LTTD 4FXKC 1ICWA 2EXZA 2KHSA 1DOMA 2EZVA 3VR2A 4F87A 2F0PA 3TZUA 2EE1A 4DXGA 5FOBB 2D9UA 1GOZA 3SE0A 4ZUJA 1B53A 3TBIB 3CQZB 4KY6A 2VUMB 5K5PA 4O1NA 3HOVB 3MZ5A 5CV8A 1M8AA 3WOEA 1TR5A 2J0TD 1PFNA 2XN9C 4BWGB 1EZ8A 4M1UB 4FXDA 2NVQB 4TSSA 1TWAB 4HCEA 3H0GB 4L8JA 3QWNA 4XIGS 2E2DC 4C3IG 1LV9A 4IZ8A 1NR4A 2LKVA 1EWHA 1ZEQX 1S5BD 2BA0A 2NVXB 1X3QA 3BYTB 4G7OC 4ODGA 3RD4A 5KRUA 1RHPA 3J7YW 5BN4A 4U673 1S5DD 2WP8J 2AQ2B 5EKKA 2F0EA 1WTPA 4ZKCB 2V4DA 2DY7A 3T16A 2EYJA 3J7AV 5C6AA 1QB5D 3GP7A 2F0LA 4LMQD 1HTPA 5M5XB 4A93B 3K5MA 1V1PB 2B2UA 5J39A 2KEEA 1JC7A 4NKLA 4TKOB 1HUMA 1SSOA 5M3FB 3K57A 3G7LA 3IL8A 4HR7B 1SNOA 2EY5A 2IX3A 3H91A 2NTSA 3V96A 1Q12A 1HFGA 4O42A 4WORA 3C2PA 2EVBA 1EU3A 3QOLA 3P20A 2KEDA 1II3A 4RGMA 2RBMA 3NSWA 3SXHA 3GTLB 4I65A 4L63B 2F0MA 2J7ZA 3E5SA 4IFDI 5CV5A 1MGSA 4G4KA 3DM1A 3NBIA 4TQUS 3HOWB 4BBSB 1Y1WB 3BVMA 1SEBD 2MUYA 5DM73 2M2LA 3NWTA 4G57A 4FF4A 1G2SA 4KHVA 1AW7A 5JVH3 2L1BA 1TT2A 4A3IB 2C5CA 2K03A 4XQNA 4R8NA 1TS4A 4CKCA 4K5WA 4Q0FA 4HSVA 1FNUA 4DF7A 5EBCA 1SE4A 3NUCA 3Q23A 1NSNS 3TDQA 5JOBA 5FK9C 1AZPA 1TS5A 1ML0D 2A5HA 3I3CA 3PUWA 1FD7D 4BY1B 4IUUA 1SDFA 1YNND 2J4XA 3NQIA 4FVMA 4XDXA 1VDZA 2F0DA 2PMZB 2IL8A 3VYRA 3NXWA 1CHQD 4A3GB 4JBWA 1B44D 1TWFB 1JR0D 3D31A 1E0BA 1H9SB 3ND9A 5ELEA 4X3TA 1O80A 2PQEA 3LX0A 1A6XA 2EYPA 1HQRD 1EY0A 5C5MA 3K0YA 1O7ZA 3NP8A 2F0UA 1V1PA 1PTOC 2AQ1B 1MBYA 2IPKD 3BVGA 2Z1CA 1GUOA 2F0QA 3KBGA 2D2CC 5IGEA 4KK7A 2WACA 2B2WC 5EPJA 3PUYA 4C3HG 4QUFA 3J80L 2K05A 1EOTA 3DEOA 4EQPA 5I4DA 5I9OA 3FDTA 2PW7A 3R93A 1SYCA 2CW0D 2XRSD 1XX8A 3TP7A 5CBAE 3TMEA 2XIWA 3J81E 1NAPA 1A15A 3C3LA 2NWGA 4PMWA 1RKNA 2A6HD 4K6DA 2OF1A 1U4PA 2RSOA 1E2WA 2K1BA 5JAVA 2K28A 2E2IB 3RMHA 3DMUA 2EY6A 3T53B 2KUMA 1CI3M 4IFDJ 4FF3A 1DOLA 1H9RA 2N55A 1LT4D 2L0CA 4RGNA 1UAPA 4RKLA 2ENBA 2ZT9C 4QCLA 4CJ2C 4ZK9B 5CBEE 1EY5A 5EJWA 1RF2D 4QIWB 3VR5A 1ESRA 2I07B 2PZUA 1CQFA 2JYOA 2AUJD 1ESFA 3HG9A 2NYZD 1FNVA 4Q5VA 1U4MA 1BBXC 1PTOB 4ZAIA 1PRTC 2FHTA 1K8MA 1SBBB 4IURA 3L9AX 2SEBD 1PLFA 5EKIA 2XWJB 4B9WA 3Q6SA 1HCZA 3J7AF 2EOTA 2K7VA 1X32A 4UAIA 2EPBA 3BDLA 2F0HA 3SK4A 1V1OA 4IALA 5J1ZA 1VCIA 1KAAA 3OIQA 2A68D 4HCSA 2JEBI 1KDBA 1LABA 2BCOA 2LFNA 5FLXE 3NE5B 1XTCD 3UI2A 1ILPA 2JE6I 3MAQA 2F03A 1H9JA 2PW5A 1PZID 3CKIB 4Y7NB 4DAPA 1PZKD 4ID6A 1EEID 1WTQA 1E2ZA 4KKTA 1H9KA 4KI0A 4MHEA 2F0SA 4FP5D 1KLUD 4FF2A 1ILQA 3P1HA 1LTBD 1IYUA 1O7LA 3I73A 2F0NA 3A54A 2EJFC 3MTSA 1HTLD 3ITPA 1G91A 1OO9B 1B4OA 1NR2A 3S15B 1Z47A 4A3BB 1RJTA 1D5MC 1EY7A 2VXWA 1PRTB 1F9PA 2WV6D 5DNFA 4J1MA 4KJNA 4H44C 1JB3A 1S5FD 1SYFA 2NN6G 2KCNA 3CU7A 3MA2B 1I4HA 4PQXA 2IX0A 5JEAG 4C1NI 4ZYSA 5K36H 1HUNA 2F0IA 3G6JB 1CT1D 4RFBA 1MSGA 5COYA 2K6AA 2F1MA 3EQLC 4DAVA 1KABA 1RTNA 1EWCA 4FO2A 1Q1EA 2DY8A 1FGBD 1FNWA 2FMCA 4KV6A 2KJXA 3SK5A 1BO0A 3ND8A 5EKLA 2L55A 4CBVA 4EVOA 3A8KE 1IW7C 2B2WA 2MHVA 2QDBA 1GUWA 2JA7B 4ZQ3A 5T1IA 4K2LA 3R2TA 2L9HA 3KLSA 5EQ0A 2PCFB 1D5XC 2PNRC 4G7ZC 1KDCA 4IFDH 3S14B 2CHBD 3M85A 4X3UA 5IT9E 5D3DA 5HGTA 3KLSX 1HA5A 5KYLA 1WTRA 3EROA 1Z7TA 3N52A 4OIJA 1EY9A 1SYDA 2AUKA 1VMPA 1K83B 4AYBB 1LT5D 1QNKA 3VYSA 1B1ZA 2L4NA 2NVYB 1U4LA 4NW2A 3H6MA 1EQTA 1BQQT 4J6HA 2IW3A 3S2DB 3FVQA 4RGTA 4DK1A 5JJZA 1SYEA 5D65A 1BDOA 5DM63 2RSNA 4K5XA 5CC4A 5KNBA 1HFNA 2K5WA 1GUNA 4YIJA 3DHQA 2WAQB 5CR3A 5T1GA 1KNEA 1Q90A 3HOZB 2NB0A 4L6TB 2TMPA 3RLFA 2EYFA 5KEEA 2EY2A 3GV3A 1ENAA 3IFDA 2YU9B 2AQ3B 1HXYD 1BR9A 4IUNA 1QG7A 2NVTB 3R3OA 1RD9D 2MPMA 1Q1BA 4CKBA 2F0TA 3GO5A 3M4OB 1PTOD 1WVLA 2HQEA 3S1RB 3MHBA 2F0OA 1JORA 3D4DA 2NN6I 3FEWX 1A2TA 3A7LA 2QCPX 4DA2A 4XYOA 2MJ8A 2OXPA 2BA1A 2B39A 3MVVA 2VB3X 5IGCA 1TY2A 3V05A 5IODA 5CV6A 2IWHA 1Y8NB 4LAAA 1C48A 2Q8IB 1JWSD 2TSSA 3K6OA 2PZTA 2B2TC 4KY7A 1K8OA 3JAML 3FRPB 5JPNC 1F9RA 2F3VA 2F0FA 5EGTA 4RCNA 5KIXA 4KKUA 1DCZA 2Z4IA 1QE6A 3HGBA 4RCOA 1I4QA 1JOOA 2HDMA 2KCCA 2SOBA 2MGSA 2Y0SB 3FPPA 2DNCA 4KD3A 1SJED 2RDFA 1STAA 4CJ0B 5E3FA 2BDOA 1I4GA 1W6KA 1CQVA 5C0XG 4OIKA 5M9OA 1CA6A 2B8FA 3QG1A 3CRLC 3S1NB 3IAYA 5ISRA 4JK1C 2B63B 1VF5C 4ZLTF 4KD4A 1PRTD 5C5LA 2B2YC 4IUPA 3HP3A 1EY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCV D;  3SEB A;  1RDP D;  4RGM A;  3R8B A;  5D3D A;  3KLS X;  2Z8L A;  2R61 A;  1EEF D;  1HA5 A;  1HQR D;  1LT3 D;  1ESF A;  1PRT F;  1STE A;  4O1N A;  3URY A;  1EU4 A;  4RHS A;  1D5M C;  1PTO F;  4L63 B;  4DXF A;  5ELD A;  1TS2 A;  1FNV A;  1PRT B;  3R2I A;  2XN9 C;  4BWG B;  3EFX D;  1UUP A;  1PTO B;  2WV6 D;  1KLG D;  1BCP B;  1TY2 A;  1V1P A;  4RGO S;  1LO5 D;  1PRT C;  1LTR D;  2G9H D;  1PTO H;  4TSS A;  3V05 A;  1KTK A;  1PTO C;  2AQ1 B;  2RDH A;  1BCP C;  1LT5 D;  1SBB B;  2IPK D;  3BVG A;  1B1Z A;  1JWM D;  1S5F D;  2SEB D;  1I4P A;  1UNS A;  3BVM A;  1SEB D;  1TY0 A;  4RHR A;  1CHP D;  1L0X B;  1ET6 A;  1JWS D;  1TS3 A;  1I4H A;  2TSS A;  1G8Z D;  1S5B D;  3DWQ A;  1CK1 A;  1PZJ D;  1SJH D;  1QIL A;  2O2L D;  1AW7 A;  3BYT B;  4ZYS A;  4RGT A;  1TS4 A;  1T5X D;  5I4D A;  1V1O A;  4C56 C;  3OWE B;  1CT1 D;  3BYY B;  4RFB A;  1M4V A;  1FNU A;  5D3I B;  1SE4 A;  3TSS A;  1AN8 A;  1S5D D;  2XRS D;  3CHB D;  4K6L A;  2AQ2 B;  2QIL A;  2IJ0 A;  1EWC A;  1SE2 A;  4RCO A;  5ELC A;  5FK9 C;  1S5E D;  2NTT A;  1TS5 A;  1ENF A;  1I4Q A;  4UDU C;  1XTC D;  1FGB D;  1FNW A;  1PYW D;  1FD7 D;  3BZD B;  1LTS D;  1SE3 A;  1DJR D;  1PZI D;  1SXT A;  1EFI D;  2XNA C;  3GP7 A;  2QEJ C;  4RH6 A;  1JQY D;  1SJE D;  1PZK D;  4L6T B;  5ELB A;  1EEI D;  1DYQ A;  1JCK B;  1S5C D;  3W2D A;  2ICI A;  3DWP A;  1I4G A;  1D5Z C;  2J4X A;  1EU3 A;  1LTI D;  1CQV A;  1V1P B;  2XRQ D;  1LLR D;  1MD2 D;  1JWU D;  4Z9C B;  1D6E C;  2AQ3 B;  1HXY D;  1L0Y B;  5FKA C;  1KLU D;  3R2T A;  1CHQ D;  1LTB D;  3DWA A;  1LTT D;  1LT4 D;  1B44 D;  1BCP F;  3MFG A;  1JR0 D;  4RGN A;  1BXT A;  1D5X C;  5ELF A;  1RD9 D;  1LTA D;  1ET9 A;  1I4X A;  1RF2 D;  5TSS A;  4OHJ A;  2NTS A;  5ELE A;  1LT6 D;  4DXG A;  1PRT D;  3BVZ A;  3MC0 B;  1I4R A;  2RDG A;  1PTO D;  3O13 A;  1F77 A;  1XXG A;  1BCP D;  1HTL D;  2CHB D;  1LTG D;  1GOZ A;  3EA6 A; 
#chains in the Genus database with same CATH topology
 1RCV D;  3NTK A;  1WCM B;  2LXJ A;  5M3M H;  2LMC B;  1JT8 A;  3CCV A;  4PV1 C;  4CDE C;  5C4H A;  2VW9 A;  1EU4 A;  3HEJ A;  4JI8 Q;  1Y1V G;  2IX1 A;  4PG3 A;  3OYY A;  1TS2 A;  2D62 A;  3EFX D;  2G9H D;  3K5N A;  3DXJ C;  3QIA A;  1SFO H;  2XTI A;  4PZ6 A;  4GKJ L;  1JWM D;  1SNQ A;  3F2B A;  4DUY L;  1OXS C;  2YYZ A;  4H7B A;  1JOK A;  1TY0 A;  3I4N H;  4DU9 A;  3KF6 B;  2WB1 B;  5KYI A;  3G48 A;  3FKI H;  2EYM A;  2QF7 A;  5HGQ A;  1CZW A;  2F4V Q;  3HOY H;  4B08 A;  1O7I A;  4BBR B;  2JEA I;  1EIH A;  2IY5 B;  3KF8 A;  1CSQ A;  1CZG A;  1XTD A;  4YWK A;  1I6H B;  3SHL A;  3GTP B;  3S1Q B;  3MXU A;  3EIV A;  3GTG B;  4GLV B;  1ENF A;  4A3B G;  4IUT A;  3AB9 A;  2K5Q A;  3H3V C;  2E2H B;  2XSC A;  3K58 A;  2KHJ A;  4GNX B;  3TS2 A;  2XNA C;  2QEJ C;  1DM0 B;  1VQA A;  5ELB A;  3OHX C;  2Q8T A;  1JCK B;  2KOL A;  3T56 B;  3OTO Q;  4A3C H;  1EQR A;  1U9R A;  2VNU D;  3OPO A;  2HHH L;  1STB A;  1GM5 A;  3BS1 A;  1D2B A;  3QO2 A;  1L1O C;  1UEB A;  4WJW A;  5E7N A;  5JEA J;  3PF5 A;  4JBJ A;  2JA6 H;  3W1B A;  3HS0 C;  5BN3 A;  2I46 A;  3BJU A;  1B2T A;  2NZ1 D;  4DGZ A;  5C3W A;  4C3H H;  4J15 A;  4DV6 Q;  1G2T A;  3RZD B;  1HJP A;  1EYD A;  4KJO A;  1LT6 D;  2KVM A;  5GAH C;  1I4R A;  4HMJ A;  4BA2 I;  4X64 L;  1W6J A;  3BVZ A;  4A3D B;  1JOQ A;  3SEB A;  3I4M H;  1EZ6 A;  5IYC H;  4R4T A;  2I0Q A;  4DV4 L;  4LUO A;  2OT2 A;  3NWS A;  3K5O A;  1R9T H;  4JI6 Q;  5C44 B;  4RHS A;  2O5J C;  4TRD A;  1HR0 L;  3M7N A;  1NUC A;  3PO3 B;  1AH9 A;  2HCI A;  3SR1 A;  1KLG D;  1HZA A;  1TWC H;  3CCQ A;  1BOS A;  4DAY B;  1KL9 A;  1LO5 D;  1LTR D;  3NBH A;  1WTV A;  3HOU H;  2VS1 A;  2RDH A;  3EBE A;  3GTQ B;  4MTK A;  5FO9 B;  4DR5 Q;  4LK1 C;  1UNS A;  1N8R C;  5IGB A;  3M7G A;  1EL0 A;  3EVQ A;  4RHR A;  2AWO A;  1CHP D;  2UXC Q;  4K2K A;  1SAP A;  3PUX A;  1XNR Q;  1IHZ A;  2EYO A;  4A75 A;  4B9X A;  4QB4 A;  1PZJ D;  2X69 A;  3WWV A;  3TRZ A;  2YTX A;  3H09 A;  3BU2 A;  3U9O A;  5LL6 S;  2JA5 H;  5FLX c;  4QQB X;  2KQ3 A;  5C4J B;  2Z6K A;  4V19 0;  4JVZ A;  3A55 A;  1U0L A;  3ERQ A;  3NPP A;  4EQN A;  4HIO A;  4JI0 L;  1IW7 D;  5F2D A;  4A3J B;  2E2J B;  5A2Q L;  5C0X I;  3K5L A;  1YHQ A;  1ONL A;  3J80 c;  4BY7 H;  2JXM B;  1CUK A;  1X55 A;  2Q2U A;  2K5D A;  1QVF A;  2PNH A;  1SE2 A;  3CCE A;  5I9P A;  2ASB A;  2A73 B;  4UDU C;  4LFC L;  2VQE Q;  2KCT A;  5C4Z A;  2EY1 A;  4LFB Q;  4BS9 A;  1QOH A;  3DUZ A;  2X6L A;  1DOK A;  2K04 A;  1VQI A;  1EIF A;  4AYB G;  1E2V A;  1TVX A;  1TKW B;  1L1O B;  2B2T A;  2C35 B;  3I72 A;  3NTH A;  5AFW A;  3PMF A;  2XGT A;  4Z9C B;  1PFM A;  1HRJ A;  1L0Y B;  3DM3 A;  5FJ8 G;  1B7Y B;  4XT1 B;  3GTJ B;  1YBY A;  3OMG A;  5C4X G;  1Y1V B;  5HUR A;  2JJQ A;  1FYC A;  3ER0 A;  1GUG A;  1SYB A;  3G6E A;  2E5L Q;  5TSS A;  3Q22 A;  3AQQ A;  3J80 E;  3J81 i;  2HDL A;  3D6W A;  1F2M A;  1RDP D;  2ZTE A;  3S16 B;  3F8T A;  2P5Z X;  1PH1 A;  3FKI B;  4GNX A;  3CQZ H;  3VYT A;  1GHK A;  1WJJ A;  4M8A A;  1E1T A;  2WAQ G;  2VUM H;  3GTO H;  1PTO F;  3NEL A;  3HOV H;  4FNF A;  1VQ8 A;  4DV0 L;  1K3R A;  4RAU C;  4RKB A;  3HOZ G;  3ONA B;  4DPG A;  2FFK B;  2NVQ H;  1V8Q A;  3OW7 A;  1BCP C;  1TWA H;  1N33 Q;  1JIC A;  3FPU B;  2EJM A;  1HHV A;  4OGQ C;  3I7F A;  3H0G H;  4JOI C;  2KA7 A;  3PV0 A;  1NY4 A;  3E6Z X;  4EQ5 A;  1EY8 A;  3PIP 3;  3T51 B;  1GVP A;  1STH A;  3I56 A;  2B2Y A;  3CC4 A;  4JW0 A;  4JC0 A;  5CV4 A;  1RTO A;  3BDC A;  3QOJ A;  2NVX H;  2R3Z A;  4H13 C;  2OQK A;  1I6V C;  4IO9 A;  3NTI A;  4KY5 A;  4FYD A;  4OX9 L;  3KLR A;  5D3I B;  2MQH A;  4KLK A;  2QIL A;  1OXX K;  3OMC A;  2F0W A;  4NDX A;  1AEX A;  4QIW E;  1S5E D;  1Y69 U;  1EYA A;  1OXV A;  1DON A;  1BNZ A;  2JA8 B;  4DAY A;  4KN7 C;  2HIV A;  4A3M H;  1K73 C;  2MP1 A;  3IKJ A;  1YNX A;  1I3Q B;  2QDL A;  3S17 B;  3VR4 A;  2PQA B;  4DUZ Q;  4OEM B;  1ZXT A;  1PDQ A;  2K50 A;  5M5X H;  4JI8 L;  4A3K B;  4A93 H;  1JWU D;  2NN6 H;  4QL5 A;  5IP7 G;  3ZYY X;  5E4X A;  3JC6 6;  4QUC A;  4X66 L;  3I4L A;  3MFG A;  1X3E A;  1N9W A;  4KN4 C;  5M3F H;  4RA8 A;  4GN5 A;  5COR A;  4DN4 M;  4JI7 Q;  4B3R Q;  1LTA D;  1ET9 A;  5JEA H;  4LF9 Q;  3HOX B;  1DGS A;  2WIN B;  1B3Q A;  4N9P A;  1R4P B;  4R4Q A;  2MO1 A;  2A1A A;  3MXP A;  5BR8 Q;  3S2H H;  1UE6 A;  4K14 A;  5GAE C;  3J80 i;  3R8B A;  4CKE A;  4OO1 G;  1PRT F;  4JI1 Q;  3GTL H;  3CCM A;  1O7Y A;  5ELD A;  1L1O A;  1VF7 A;  1SE8 A;  5C0X J;  4QY7 A;  5M5W B;  1BCP B;  5CYU A;  4RGO S;  2DN8 A;  3I8Z A;  1LM0 A;  4YY3 Q;  3RNU A;  5IGF A;  3HOW H;  4DR2 Q;  4BBS H;  1Y1W H;  4J8Q A;  1L0X B;  3OTO L;  1ET6 A;  1TS3 A;  2SDF A;  2IHE A;  3TN2 A;  1G29 1;  2ZXP A;  1MSH A;  2L5T A;  4S3S A;  2F0J A;  3P7J A;  3S24 A;  3VA7 A;  2B63 G;  3EN2 A;  4A3F B;  1N36 Q;  3K59 A;  3E0J A;  1SMY C;  3KBX A;  3NQT A;  4A3I H;  4IUV A;  3OWE B;  1X56 A;  1A3U A;  3Q8D A;  1Y14 B;  4ULL A;  4HAE A;  1YNJ D;  3OWF A;  3CHB D;  3D4W A;  1WCM G;  2R6G A;  3U58 A;  5IP9 H;  1XMO Q;  4GZY C;  2IJ0 A;  2B29 A;  3HKS A;  3QJY A;  1KNA A;  1GUS A;  1NCV A;  1GD7 A;  5IYB H;  4LF8 L;  5G3L F;  3M4Y A;  3Q0A A;  2ZJR A;  3OIP A;  5C4X B;  3UE0 A;  2JP1 A;  1A8V A;  1LTS D;  1SE3 A;  3HRZ C;  4BY1 H;  3KUP A;  4V0B A;  4JI6 L;  1DYQ A;  3AYH B;  4I7Z C;  3DWP A;  2A74 C;  2RHS B;  2RVL A;  1WI5 A;  4DV5 Q;  1WTX A;  1SLJ A;  1DD2 A;  3L3O C;  2Q8R E;  4LF7 Q;  3GTO B;  4XYQ A;  1KXL A;  1GXD C;  3DWA A;  2QA4 A;  4C3J G;  1BCP F;  4A3G H;  2FJ2 A;  2GA4 B;  4OEL B;  1BXT A;  2A6E C;  1TWF H;  4DK3 C;  4DR5 L;  5ELF A;  3A5Z B;  1CKN A;  2PO4 A;  3T4A C;  4OHJ A;  1CTM A;  3MXN A;  4P72 A;  3U50 C;  2CQO A;  2E8G A;  3PIO 3;  4LF5 Q;  2NBF A;  1XNR L;  2ZXO A;  2UUB L;  1S4Z A;  1PA6 A;  1B9M A;  3T1H Q;  2WKD A;  5KND A;  1HNW L;  5LMN W;  3D8G A;  4WRD A;  2K5V A;  1G6Z A;  2B2V C;  1Q46 A;  2KEC A;  2SNS A;  5C3E G;  3WOF A;  3C46 A;  3NK9 A;  1LT3 D;  1F2Y A;  2NUC A;  3A8J E;  2PQA A;  5I2Y A;  4PMB A;  2WKC A;  1ZYR C;  1VQ9 A;  3GTM B;  3N6R A;  1FJG L;  1KTK A;  5FLM H;  2VQE L;  4ILW A;  4POF A;  2L12 A;  2VZA A;  4LFB L;  1SN8 A;  1AZQ A;  2H1E A;  5AJ3 Q;  1F9Q A;  3MWY W;  3D3R A;  3GD7 A;  4A3M B;  4PZ8 A;  2GVA A;  1E24 A;  2B8G A;  1QIL A;  2R7F A;  3D0F A;  5GAG C;  2I5L X;  3K80 C;  4RG1 A;  4IPC A;  4XQJ A;  2DJG C;  1EIG A;  2DGY A;  1YEZ A;  1FR3 A;  1VS0 A;  4C56 C;  3TRE A;  1RL2 A;  3BYY B;  5LMN Q;  4BA1 I;  4XT3 B;  3NHH A;  3TSS A;  2E5L L;  4K6L A;  3CAM A;  4K5V A;  1F9S A;  1Q3L A;  2BH2 A;  4IN3 A;  5C44 G;  4APV A;  4EGV A;  4JOI A;  3SK6 A;  2R92 B;  1SXT A;  1EFI D;  2H4O A;  5D14 A;  5EPL A;  1QZH A;  1CA5 A;  3PO3 G;  1S72 A;  3S2H B;  1S5C D;  3MFY A;  3GV6 A;  4IUQ A;  1I50 B;  1QCB D;  1GJX A;  4DNR B;  4LF4 L;  1V1Q A;  4N8X 1;  4OWX B;  3L0O A;  3CPF A;  3J81 j;  1CFM A;  2EJG C;  4BXX G;  5I6Y A;  1D6E C;  2E2I H;  1U4R A;  5IIF A;  2LY7 A;  4AYB E;  1EYC A;  4OO1 I;  2CKZ B;  3T13 A;  3W5O A;  1HQM C;  4DV7 Q;  1C8C A;  1WTH A;  3LWE A;  4DV3 Q;  1CM9 A;  3FMC A;  1EQQ A;  2RQX A;  3O13 A;  1F77 A;  1PFB A;  2PI2 A;  1LTG D;  2BE5 C;  3S1M B;  3I2Z A;  4A3J G;  1HA6 A;  1YNJ C;  1TQO A;  1VQJ A;  5LHY 1;  4CHT B;  2A69 C;  5M5Y B;  4IQZ A;  3EJI A;  3J81 L;  4X62 Q;  1HPC A;  1B9N A;  1IL8 A;  1PH6 A;  2O5I C;  2PZW A;  1U5K A;  1O78 A;  4A3E B;  5J22 A;  3R2I A;  4IPG A;  2PYK A;  1UUP A;  1CKM A;  4PMC A;  4CDD C;  2LXK A;  1IL2 A;  1IZ6 A;  3G71 A;  1Y8O B;  1PTO H;  2WAQ E;  1SNC A;  1UE7 A;  1KRS A;  1LAC A;  4GKK Q;  3H94 A;  5C0X H;  3CRK C;  3X3M A;  3RZO B;  5E4W C;  4P74 A;  3PO2 B;  2HUG A;  1XPU A;  4DUZ L;  1G8Z D;  1A63 A;  1GKH A;  3X3N A;  4XXE A;  3A5U A;  1TU2 B;  1GHJ A;  4P2C B;  1DZ1 A;  4JPB W;  3TS0 A;  3MXG A;  1MJC A;  4DR4 Q;  4HIK A;  1T5X D;  3F2U A;  4KMU C;  2Q2H A;  1F2Z A;  4NXM Q;  2ICE C;  2ZXR A;  3KK7 A;  3GTK B;  2L11 A;  1SNP A;  4JI7 L;  1V43 A;  4KTA A;  3JAM c;  2UXD L;  4LF9 L;  3I90 A;  4EQO A;  2VB2 X;  3ULL A;  3FKI G;  3TP8 A;  5BR8 L;  4C3J B;  1YI2 A;  4NMZ A;  1ROD A;  1ZKO A;  4F8M A;  1B3A A;  1JQY D;  1NMF A;  4XTC S;  2SNM A;  4Y7N H;  5CGK A;  5G3L D;  1JE5 A;  2ICI A;  1UEA B;  4JI1 L;  1A2U A;  1BUV T;  2R7Z B;  1VQK A;  2H5X A;  1M1K C;  4C3I B;  2R93 B;  3GQB A;  3M3Y B;  2RA4 A;  3D6C A;  3C1E A;  5C3E B;  2JSO A;  1PH2 A;  1SNM A;  3BG3 A;  4HJ7 A;  2VY3 A;  4JBM A;  2XVS A;  5IYD G;  1KIX A;  4KKS A;  2K32 A;  5IOC A;  2UU9 L;  1DXM A;  3C1F A;  3TZD A;  4POG A;  2EIF A;  1SR3 A;  2F0V A;  4DR2 L;  4A3C G;  2UXB Q;  3JAM E;  5CV7 A;  1XWE A;  3MC0 B;  1T5E A;  1PXU A;  1D1K A;  2Z4H A;  1PH3 A;  3V2T A;  1BCP D;  2X6G A;  4F7X A;  2FMM A;  4WFN 3;  3W3A A;  3AU7 A;  5FLX L;  1CSP A;  1N36 L;  4DV1 Q;  2Z8L A;  4K8I A;  2R61 A;  3S15 H;  3K7A B;  4O2D A;  1STE A;  4HMI A;  2JA8 G;  2CQA A;  1TXY A;  1EUJ A;  3PCO B;  2WFW A;  3ICE A;  1XMO L;  2K5H A;  1VMC A;  2D0P A;  1K8G A;  2ES2 A;  4DAM A;  1CKO A;  2QKI C;  3VYU A;  2Y0S E;  4A3K G;  1AP0 A;  1X3P A;  4NXN Q;  1VQC A;  1EQV A;  3I91 A;  5IY0 A;  4B3S Q;  1I4P A;  4AQY L;  1LYL A;  2F3W A;  2N88 A;  4QF4 A;  4N8F A;  3RN2 A;  3P75 A;  2EYL A;  1SJH D;  2FIN B;  2O2L D;  1JB7 A;  3FHW A;  4X3S A;  4LF7 L;  1LTL A;  4QMG A;  4ABN A;  3CMA A;  2B2V A;  3HOX G;  3OOC A;  1NE3 A;  2K33 A;  2K01 A;  2NZH A;  4LFA Q;  2RHQ B;  1TWH B;  3SDZ A;  4NPS A;  3SK8 A;  4DK0 A;  1HNZ Q;  1IYV A;  4YWL A;  2UUC Q;  1TWG B;  4CDF C;  1BF4 A;  5I2X A;  3IFT A;  3CD6 A;  1AFP A;  1SYG A;  2PMZ E;  5E1F A;  1DJR D;  1PMR A;  2CH4 W;  3CME A;  1YIJ A;  1KRT A;  2OCE A;  4GN3 B;  3A74 A;  2K52 A;  2RKS A;  4JBK A;  1KAW A;  3VR6 A;  4C2M B;  1J5E Q;  3SVM A;  2D5D A;  2NZO A;  2EDG A;  1R4Q B;  2JA7 H;  4F88 A;  4AH6 A;  3H3V I;  4IOA A;  3E9I A;  5DEH A;  1STG A;  2DJF C;  4FF1 A;  5JPM C;  3PUV A;  4XQQ A;  1J9O A;  4HSP A;  4A3F G;  2YTV A;  3HKZ G;  5AJ3 L;  1B50 A;  2VQF Q;  2WB1 E;  3IRB A;  4A76 A;  4HTH A;  4ALP A;  1YNN C;  3S14 H;  3MEH A;  1I94 Q;  5EBD A;  5M3M B;  1Q8I A;  1H9S A;  4DNT B;  3URY A;  3VA5 A;  2PPB C;  2N78 A;  2KEN A;  5LMN L;  1XYI A;  1C4Q A;  1SRU A;  2ID0 A;  5KGU A;  3I70 A;  4JYA Q;  1QJO A;  2AWN A;  2C9O A;  3DEP A;  4IOC A;  4H0L C;  1SMY D;  1SFO B;  4KHZ A;  3KFU A;  3OSO A;  3B6Y A;  1XNQ L;  1FL0 A;  1N34 Q;  1K83 H;  4JI5 L;  2R7D A;  2F0G A;  5LL6 X;  3I4N B;  2LS0 1;  1WYD A;  2NVY H;  5CMD A;  1QWY A;  5FJ8 H;  1QZG A;  5I6W A;  2E76 C;  4R8I A;  4OWW B;  3HOV G;  4U68 A;  1XPR A;  4L5T A;  3HOY B;  2B2U C;  1HNX Q;  1Q81 C;  4IPH A;  3TQY A;  3S2D H;  1WTW A;  4NP5 A;  3U9S A;  3UDF A;  4I7A A;  1QVC A;  4HJ5 A;  2G9D A;  3H0G G;  4JV5 Q;  5IT9 L;  1SND A;  1WTO A;  3UE1 A;  4DV7 L;  4PNY A;  1J6Q A;  5BN5 A;  1EY6 A;  3QB3 A;  3U4Z A;  2WII B;  1J8I A;  1KDA A;  2NTT A;  4MIU A;  4DFA A;  2GN5 A;  2QEX A;  3WDN A;  5FO7 B;  2UUA Q;  1K0R A;  2A6E D;  3BZD B;  3A8I E;  2JN4 A;  3KJP A;  3HOZ H;  1GO3 E;  1BBU A;  2IT1 A;  4WJ4 A;  2F4I A;  1IKM A;  3L7Z C;  3RUZ A;  1H9M A;  4JI3 Q;  5A35 A;  1CKN B;  4MN3 A;  2IHF A;  1X9N A;  1LTI D;  4OON A;  1LLR D;  3MXN B;  2CCZ A;  2CW0 C;  5CV9 A;  2JA6 B;  5IGG A;  1Y8P B;  5FKA C;  2YU9 H;  5NUC A;  4DR6 Q;  4A3M G;  2RCF A;  5DAU A;  2F0K A;  4GKK L;  4C3H B;  3TP5 A;  2NVT H;  2N8N A;  2O4X A;  2ZM6 Q;  3Q24 A;  5K36 G;  3LWU A;  5KNC A;  3T1Y Q;  1I4X A;  4G7H C;  1ZYR D;  2A6H C;  2M00 A;  1WD1 A;  1A3V A;  4ME5 A;  4P73 A;  4R9W A;  2RDG A;  2E74 C;  1Z6H A;  1XXG A;  3M4O H;  3I4M B;  1Q82 C;  3EA6 A;  4K8J A;  1HH2 P;  3S1R H;  1D1I A;  4HN7 A;  1R9T B;  3VR3 A;  4X3K A;  4E6I A;  5A2Q E;  1EEF D;  4LJZ C;  2EYH A;  4OXP A;  4NXM L;  1LUZ A;  3LNN A;  4OL7 A;  4DXF A;  1SRO A;  1TWC B;  1NBW A;  3ZJY C;  2R92 G;  3HOU B;  3STB C;  4C1N K;  2E75 C;  1VQ7 A;  2BDN A;  1TII D;  3S9W A;  4QJF A;  1WD0 A;  2F4V L;  3D4R A;  1OXT A;  1S40 A;  5IP7 H;  1K0S A;  3DWQ A;  4N9T A;  1IBL Q;  1STY A;  1CK1 A;  1JE4 A;  4GKJ Q;  4CGY B;  2K5N A;  2JA5 B;  3HZX A;  3AMU A;  5H1S E;  1N32 Q;  2CFM A;  5FO8 B;  4IFD G;  1OXU A;  4ZUI A;  2V1C C;  1PVO A;  3A7A B;  2EXD A;  4ZRZ A;  1ENC A;  3E3X A;  1A62 A;  2XWB B;  3CC7 A;  1M4V A;  3BDO A;  1VQB A;  3HOW G;  4BY7 B;  1HZB A;  4BBS G;  2QGQ A;  1AN8 A;  5ELC A;  2BOS A;  4OO1 H;  4DNI A;  3PUZ A;  5C3X A;  2M9V A;  2OEO A;  5GRO A;  3HFZ B;  5EPK A;  3F2C A;  1IKL A;  3J7A 5;  3TP6 A;  1PYW D;  4RWS C;  4FXG C;  3BZK A;  5JVG 3;  4A3E G;  4DV1 L;  3HKZ B;  4HED A;  3K81 C;  4RH6 A;  4Y52 H;  4ZKB B;  2HCC A;  3W2D A;  1A3T A;  1GUT A;  2A68 C;  1D5Z C;  2BE5 D;  2N3S A;  1BKB A;  2XRQ D;  1STN A;  1HR0 W;  1MD2 D;  5IGD A;  2DNE A;  3A56 A;  1MI2 A;  2CVR A;  4DV6 L;  4L5S A;  1QNU A;  2A69 D;  1VQM A;  1F2L A;  3PO2 G;  4MZ9 A;  4CJ1 B;  4X6A H;  4YCW A;  3OW2 A;  1E22 A;  1JJC B;  1LTT D;  4FXK C;  2HHH Q;  1ICW A;  2EXZ A;  2KHS A;  3S1N H;  1DOM A;  2EZV A;  3VR2 A;  4F87 A;  4B3S L;  2B63 H;  2F0P A;  3TZU A;  2EE1 A;  4DXG A;  5FOB B;  2ATW A;  2D9U A;  1GOZ A;  3SE0 A;  4ZUJ A;  1KC8 C;  1B53 A;  4KHP Q;  4A3L G;  4EX5 A;  3TBI B;  3CQZ B;  1WCM H;  4DR4 L;  4KY6 A;  2VUM B;  5K5P A;  4O1N A;  3HOV B;  3MZ5 A;  4DR1 Q;  5CV8 A;  1M8A A;  3WOE A;  3BZC A;  1TR5 A;  2J0T D;  2ZJP A;  1PFN A;  4H02 A;  4DV4 Q;  2XN9 C;  4BWG B;  1EZ8 A;  4M1U B;  1HNZ L;  4FXD A;  2NVQ B;  4TSS A;  1TWA B;  2UXC L;  5ELO A;  4HCE A;  3H0G B;  4L8J A;  3QWN A;  1HR0 Q;  2ZTD A;  4XIG S;  2R7Z G;  2E2D C;  4C3I G;  4GS3 A;  2R93 G;  1LV9 A;  4IZ8 A;  1NR4 A;  2LKV A;  1EWH A;  3F2D A;  1ZEQ X;  1S5B D;  2BA0 A;  2NVX B;  2N49 A;  1X3Q A;  3BYT B;  4G7O C;  1VQ4 A;  2G5D A;  3A0J A;  4ODG A;  3RD4 A;  2OQ0 A;  2ALY B;  4BBR H;  5KRU A;  4DR3 Q;  1RHP A;  3FP9 A;  3J7Y W;  5BN4 A;  4U67 3;  2ZJQ A;  2CWA A;  1S5D D;  2WP8 J;  1I6H H;  2AQ2 B;  5EKK A;  3GTP H;  2F0E A;  2VQF L;  3S1Q H;  5ELN A;  1WTP A;  4ZKC B;  2V4D A;  2DY7 A;  3GTG H;  3T16 A;  2EYJ A;  3J7A V;  5C6A A;  4JI0 Q;  3DLL A;  1QB5 D;  4B3T Q;  2E2H H;  1VQ5 A;  3GP7 A;  1KD1 C;  2F0L A;  3LGJ A;  4HJA A;  4LMQ D;  4UP7 A;  1HTP A;  5M5X B;  4LFC Q;  1MJE A;  3RLO A;  2LSS A;  4A93 B;  4ME3 A;  3K5M A;  1V1P B;  2B2U A;  5J39 A;  2KEE A;  1JC7 A;  4NKL A;  4JYA L;  4TKO B;  3PGZ A;  1HUM A;  3RLN A;  1SSO A;  3AFP A;  2YV5 A;  3H15 A;  1OTC A;  1X6O A;  1EFW A;  5M3F B;  2FXQ A;  3K57 A;  3G7L A;  3IL8 A;  4HR7 B;  1SNO A;  2EY5 A;  2IX3 A;  3H91 A;  2NTS A;  1ASY A;  3V96 A;  1Q12 A;  4FDB A;  5HY6 A;  3RZD H;  4JI4 Q;  1HFG A;  4O42 A;  4WOR A;  4LUZ A;  2EVB A;  3C2P A;  1EU3 A;  3QOL A;  3P20 A;  2OWO A;  2KED A;  1HNX L;  1II3 A;  4RGM A;  4A3D H;  2RBM A;  3NSW A;  3SXH A;  1VQF A;  3GTL B;  4L5R C;  4JV5 L;  1X3G A;  1N33 L;  4I65 A;  4L63 B;  5C44 H;  2F0M A;  2D0O A;  2PI2 E;  2J7Z A;  3E5S A;  4IFD I;  3PO3 H;  2JQO A;  5CV5 A;  1MGS A;  4G4K A;  3DM1 A;  3NBI A;  3PF4 A;  2KCM A;  3CW2 C;  4TQU S;  3GTQ H;  3HOW B;  4BBS B;  1YZ6 A;  1Y1W B;  3RN5 A;  3BVM A;  1SEB D;  2MUY A;  5DM7 3;  2M2L A;  3NWT A;  4G57 A;  4FF4 A;  1G2S A;  4KHV A;  1AW7 A;  4K0K Q;  4JCV E;  5JVH 3;  2L1B A;  1TT2 A;  4A3I B;  2C5C A;  2K03 A;  4XQN A;  4R8N A;  1TS4 A;  4CKC A;  4DR6 L;  4K5W A;  5C4J H;  4Q0F A;  4HSV A;  1FNU A;  4DF7 A;  2JK8 A;  5EBC A;  1SE4 A;  3U4V A;  2ZM6 L;  3NUC A;  3Q23 A;  5M3M G;  1NSN S;  3TDQ A;  3T1Y L;  1MIU A;  4A3J H;  1JJ2 A;  2E2J H;  4LNQ A;  3ULJ A;  5JOB A;  5FK9 C;  1AZP A;  1TS5 A;  1PH7 A;  1ML0 D;  3H3V H;  2A5H A;  3I3C A;  3PUW A;  1FD7 D;  3UDX A;  3CCJ A;  1PH5 A;  5JJL A;  4BY1 B;  1VQG A;  4IUU A;  1EIY B;  4B3M Q;  1SDF A;  1YNN D;  3CXC A;  2F52 A;  2J4X A;  3NQI A;  4FVM A;  4XDX A;  1VDZ A;  2F0D A;  2PMZ B;  2A8V A;  3I4N G;  5J3B A;  2IL8 A;  2K4K A;  4B3R L;  3VYR A;  3NXW A;  1CHQ D;  4A3G B;  4JBW A;  1B44 D;  1TWF B;  1JR0 D;  3GTJ H;  3D31 A;  1E0B A;  4OWT B;  1H9S B;  3HOY G;  3ND9 A;  1IBK Q;  1Y1V H;  1VQP A;  5ELE A;  1MKH A;  1H95 A;  4X3T A;  4MNO A;  4X66 Q;  4YCV A;  1O80 A;  3SGI A;  1IBL L;  1AE3 A;  2PQE A;  3LX0 A;  1A6X A;  1NMG A;  1N32 L;  3S16 H;  3KJO A;  2EYP A;  1HQR D;  1EY0 A;  1SMX A;  5C5M A;  3K0Y A;  1O7Z A;  2CH4 A;  5IWA Q;  4YY3 L;  4YHH Q;  4HJ8 A;  1VQ6 A;  3NP8 A;  1FVI A;  1WFQ A;  4O0A A;  2F0U A;  3CCS A;  2AKW B;  1YVC A;  1V1P A;  4IPD A;  3J81 c;  1YJN A;  1K8A C;  1PTO C;  2AQ1 B;  1MBY A;  1VQE A;  2IPK D;  3BVG A;  2Z1C A;  1GUO A;  1D7Q A;  2JA6 G;  5L37 A;  2F0Q A;  3J7Z C;  3KBG A;  2D2C C;  5IYD H;  5IGE A;  4KK7 A;  2WAC A;  2B2W C;  1VQD A;  3PUY A;  5EPJ A;  4C3H G;  4A3B H;  4QUF A;  3I55 A;  3J80 L;  2Z6B A;  2K05 A;  4P71 A;  1EOT A;  3DEO A;  4EQP A;  5I4D A;  4LF6 Q;  5DLQ E;  3KOJ A;  5I9O A;  3TEH B;  3I4M G;  3FDT A;  5IYC G;  2PW7 A;  3R93 A;  1SYC A;  2CW0 D;  2MO0 A;  2XRS D;  5IE8 A;  1XX8 A;  3TP7 A;  3L2P A;  5CBA E;  3TME A;  2XIW A;  1UE5 A;  3J81 E;  1NAP A;  3PIP A;  4DV5 L;  1Q8K A;  2JA8 H;  1PV4 A;  1A15 A;  3C3L A;  1K28 A;  2NWG A;  4PMW A;  4KHP L;  4YWM A;  1RKN A;  2A6H D;  4K6D A;  2OF1 A;  1U4P A;  1I3Q H;  3HOU G;  4LF8 Q;  3S17 H;  2RSO A;  4AIM A;  5GAD C;  4DR1 L;  2JA9 A;  1E2W A;  2K1B A;  5JAV A;  2K28 A;  1W2B A;  4A3K H;  2E2I B;  3W1G A;  3RMH A;  3DMU A;  2EY6 A;  3T53 B;  2KUM A;  3G4S A;  1CI3 M;  4IFD J;  4FF3 A;  1DOL A;  1H9R A;  2N55 A;  4LF5 L;  1PH9 A;  1LT4 D;  2L0C A;  3PQI A;  4RGN A;  1UAP A;  4JI2 Q;  3T1H L;  4RKL A;  4DV2 Q;  2ENB A;  2ZT9 C;  4QCL A;  4CJ2 C;  2JA5 G;  4ZK9 B;  5CBE E;  1EY5 A;  5EJW A;  1RF2 D;  3STB D;  1D8L A;  4QIW B;  3VR5 A;  3HOX H;  1PH4 A;  4TVA B;  1ESR A;  2I07 B;  2PZU A;  5LMU Q;  4R4O A;  4BY7 G;  1CQF A;  2JYO A;  3CPW A;  2JA7 G;  2AUJ D;  4DR3 L;  2UUB Q;  1ESF A;  3HG9 A;  4LUV A;  2NYZ D;  4NB3 A;  1HNW Q;  4GN4 B;  4GOP C;  1FNV A;  4Q5V A;  1U4M A;  1BBX C;  1L2F A;  1PTO B;  4ZAI A;  1PRT C;  5M5W H;  2Z9H A;  2FHT A;  1K8M A;  1SBB B;  4IUR A;  3L9A X;  4UP8 A;  1IYJ B;  3KDF B;  4B3T L;  3K8A A;  2SEB D;  2K14 A;  3F1Z A;  4GLA C;  3KYH C;  3JAM i;  1PLF A;  5EKI A;  3CCR A;  2A19 A;  1FJG Q;  1WOC A;  1ASZ A;  2XWJ B;  4B9W A;  3Q6S A;  1XMQ Q;  1HCZ A;  1QVG A;  1I5F A;  2EOT A;  3J7A F;  4DR7 Q;  2AHO B;  2K7V A;  1X32 A;  4UAI A;  4HIM A;  2EPB A;  3BDL A;  2F0H A;  4A3F H;  3SK4 A;  1V1O A;  4A4I A;  4IAL A;  3KF6 A;  5J1Z A;  1VCI A;  1KAA A;  3OIQ A;  2A68 D;  3E0E A;  4HCS A;  4RMF A;  2JEB I;  1KDB A;  1LAB A;  4ZCK A;  5GQO A;  2BCO A;  2LFN A;  1A0I A;  5FLX E;  4JI4 L;  3NE5 B;  2VUM G;  1MHW C;  1XTC D;  3UI2 A;  1ILP A;  2JE6 I;  3MAQ A;  2F03 A;  5C4X H;  1H9J A;  2PW5 A;  1PZI D;  3CKI B;  4Y7N B;  4DAP A;  3CCL A;  1PZK D;  4ID6 A;  1EEI D;  1WTQ A;  1E2Z A;  4WJ3 M;  1Q7Y C;  4KKT A;  1H9K A;  1IXR A;  4KI0 A;  4MHE A;  2F0S A;  4FP5 D;  1KLU D;  4DV3 L;  4FF2 A;  1ILQ A;  3P1H A;  4X65 Q;  1LTB D;  1IYU A;  1O7L A;  3I73 A;  4LF4 Q;  2F0N A;  1IBM Q;  2AMC B;  3A54 A;  1FGU A;  2EJF C;  5EAY A;  4YCU A;  3MTS A;  2K75 A;  1HTL D;  4X62 L;  3CF5 A;  4IJL A;  3ITP A;  1M90 C;  1G91 A;  1OO9 B;  4K0K L;  1B4O A;  1NR2 A;  3S15 B;  1Z47 A;  1X65 A;  4GOP B;  4A3B B;  1RJT A;  1HZC A;  1D5M C;  1EY7 A;  1C9O A;  3NEM A;  2VXW A;  1PRT B;  1F9P A;  2WV6 D;  1L0W A;  1EWI A;  5DNF A;  3GTM H;  4J1M A;  4KJN A;  4H44 C;  1T9H A;  1JB3 A;  4A93 G;  1S5F D;  1SYF A;  4JG2 A;  3PIO A;  2NN6 G;  4LW1 A;  2KCN A;  4B3M L;  3CU7 A;  3MA2 B;  1I4H A;  1S3O A;  1BVS A;  1XPO A;  4IJH A;  5M3F G;  2HQL A;  4UPA A;  4R4C A;  4PQX A;  2IX0 A;  5JEA G;  1YHB A;  4C1N I;  4ZYS A;  1VQO A;  5K36 H;  1HUN A;  2HD3 A;  2F0I A;  3G6J B;  1CT1 D;  4RFB A;  1MSG A;  5COY A;  2K6A A;  2Q2I A;  4DK6 C;  2F1M A;  3EQL C;  1IBK L;  4DAV A;  1KAB A;  3QR8 A;  1RTN A;  1EWC A;  4FO2 A;  1Q1E A;  2DY8 A;  1FGB D;  1FNW A;  2FMC A;  5IT9 c;  4KV6 A;  2KJX A;  4DUY Q;  2UXD Q;  3SK5 A;  1BO0 A;  3KDF A;  2R92 H;  3ND8 A;  1UE1 A;  5EKL A;  5IWA L;  1K9M C;  2L55 A;  1I50 H;  4CBV A;  4EVO A;  4YHH L;  3A8K E;  4R4I A;  1XJV A;  1IW7 C;  2B2W A;  1PFS A;  2MHV A;  4UP9 A;  1Y1W G;  2QDB A;  1GUW A;  2JA7 B;  4ZQ3 A;  5T1I A;  4K2L A;  2UXB L;  3R2T A;  1E3P A;  2L9H A;  3KLS A;  1X3F A;  5EQ0 A;  2MNA A;  3ULP A;  1JMC A;  3AEV A;  1QUQ B;  2PCF B;  1D5X C;  2PNR C;  4G7Z C;  2Y0S G;  1KDC A;  2EQS A;  4HJ9 A;  4A3I G;  4IFD H;  3S14 B;  2MFI A;  3E9H A;  2HT1 A;  2CHB D;  1NNX A;  2UU9 Q;  3M85 A;  1PYB A;  4X3U A;  1HZ9 A;  2YTY A;  3S1M H;  5IT9 E;  5IP9 G;  5D3D A;  5HGT A;  3KLS X;  1HA5 A;  2KHI A;  5IYB G;  2VL6 A;  1G6P A;  4LF6 L;  5KYL A;  5M5Y H;  4DKA C;  1NJI C;  1WTR A;  4UY8 C;  3ERO A;  4LWC A;  1Z7T A;  4UHV A;  3N52 A;  4NXN L;  3ERS X;  1K3B C;  4OIJ A;  4BY1 G;  4A3E H;  1EY9 A;  1SYD A;  2BH8 A;  2AUK A;  1VMP A;  1PH8 A;  1K83 B;  4AYB B;  1LT5 D;  1BBW A;  1QNK A;  3VYS A;  1E7Z A;  1B1Z A;  2L4N A;  1Q86 C;  2NVY B;  4L5Q A;  1U4L A;  4NW2 A;  3RZO H;  1G51 A;  3H6M A;  3VDY A;  1EQT A;  3PO2 H;  3M9B A;  2GVB A;  4A3G G;  4X64 Q;  1BQQ T;  4J6H A;  3GDE A;  4LFA L;  2IW3 A;  4AQY Q;  3S2D B;  3FVQ A;  3M4P A;  2I5M X;  4RGT A;  4DK1 A;  5JJZ A;  2UUC L;  1AE2 A;  4P75 A;  1SYE A;  1NTG A;  5D65 A;  1BDO A;  4JI2 L;  5DM6 3;  2RSN A;  4PZ7 A;  4DV2 L;  4GOP A;  3MEF A;  4K5X A;  5CC4 A;  5KNB A;  3GTK H;  1EYG A;  1HFN A;  1VQH A;  4A3L H;  2K5W A;  1GUN A;  1V9P A;  4YIJ A;  2WB1 G;  1W3S A;  3DHQ A;  2WAQ B;  5CR3 A;  5T1G A;  5LMU L;  1J5E L;  4C3J H;  1KNE A;  2B3G A;  1Q90 A;  3HOZ B;  4BBR G;  2NB0 A;  4L6T B;  2TMP A;  5FLM G;  3K7U C;  3RLF A;  2EYF A;  1YIT A;  5KEE A;  2EY2 A;  1YJW A;  1KQS A;  3GV3 A;  2R7Z H;  1YHA A;  1ENA A;  3IFD A;  4C3I H;  2R93 H;  2YU9 B;  2AQ3 B;  2ZTC A;  1HXY D;  3NEN A;  1BR9 A;  3M3Y H;  4IUN A;  5C3E H;  3UDI A;  1QG7 A;  2QW7 A;  2NVT B;  4QGU A;  1UWV A;  3R3O A;  1I94 L;  1Z9F A;  1RD9 D;  2MPM A;  1Q1B A;  4CKB A;  2F0T A;  3GO5 A;  1XMQ L;  3M4O B;  1PTO D;  1WVL A;  3PSI A;  2OTJ A;  2HQE A;  3CCU A;  4DR7 L;  3S1R B;  3MHB A;  4CDC C;  2F0O A;  1JOR A;  3D4D A;  2NN6 I;  3KF8 B;  3FEW X;  2KBN A;  2Z6K C;  1A2T A;  3A7L A;  3K7A H;  2QCP X;  1N34 L;  4DA2 A;  4XYO A;  2MJ8 A;  2OXP A;  2BA1 A;  2B39 A;  3MVV A;  2VB3 X;  5IGC A;  1TY2 A;  3V05 A;  1X54 A;  5IOD A;  5CV6 A;  2IWH A;  4GLX A;  1VQN A;  4MTN A;  4A3D G;  1Y8N B;  4HID A;  2RCN A;  1QUQ A;  3HKZ E;  3M4Q A;  4LAA A;  1C48 A;  1KHI A;  2Q8I B;  1JWS D;  2TSS A;  1XNQ Q;  3K6O A;  2PZT A;  2B2T C;  4KY7 A;  2HIX A;  4JI5 Q;  1B8A A;  1K8O A;  3JAM L;  2I5H A;  3FRP B;  5JPN C;  1B70 B;  1F9R A;  2F3V A;  3CC2 A;  2F0F A;  5EGT A;  4RCN A;  4X65 L;  5KIX A;  4KKU A;  1DCZ A;  2Z4I A;  1ICF B;  1QE6 A;  2UUA L;  4R1J A;  3HGB A;  1RIP A;  1TWH H;  4DV0 Q;  3UDG A;  1IBM L;  2L15 A;  1PYS B;  4RCO A;  4BXX H;  1P8L A;  1TWG H;  1I4Q A;  3RR5 A;  1JOO A;  4JI3 L;  1C7Y A;  2HDM A;  2KCC A;  2SOB A;  1PHJ A;  2MGS A;  2Y0S B;  3FPP A;  2DNC A;  2RF4 A;  4KD3 A;  1SJE D;  2RDF A;  4GNX C;  2Z0S A;  1P16 A;  1STA A;  4CJ0 B;  2DUD A;  5E3F A;  2BDO A;  1I4G A;  1W6K A;  2F3I A;  1CQV A;  1EOV A;  3CP0 A;  4OIK A;  3NBH B;  4C2M H;  5M9O A;  5C0X G;  3KLW A;  1CA6 A;  1E1O A;  5JJK A;  2B8F A;  2CWP A;  3QG1 A;  1YJ9 A;  2OTL A;  3CRL C;  3I4O A;  3S1N B;  3IAY A;  5ISR A;  4JK1 C;  2B63 B;  3K0X A;  4OX9 Q;  1VF5 C;  4ZLT F;  4KD4 A;  2Q2T A;  1VQL A;  1PRT D;  5JJI A;  5C5L A;  2B2Y C;  4IUP A;  1C0A A;  3AFQ A;  3HP3 A;  1JJG A;  1EY4 A; 
#chains in the Genus database with same CATH homology
 1RCV D;  3NTK A;  1WCM B;  2LMC B;  4PV1 C;  5C4H A;  1EU4 A;  3HEJ A;  2IX1 A;  1TS2 A;  2D62 A;  3EFX D;  2G9H D;  3K5N A;  3DXJ C;  3QIA A;  1JWM D;  1SNQ A;  1OXS C;  2YYZ A;  4H7B A;  1JOK A;  1TY0 A;  4DU9 A;  2WB1 B;  5KYI A;  2EYM A;  2QF7 A;  1CZW A;  4B08 A;  4BBR B;  2JEA I;  1EIH A;  3KF8 A;  1CZG A;  1I6H B;  3SHL A;  3GTP B;  3S1Q B;  3MXU A;  3GTG B;  1ENF A;  4IUT A;  3AB9 A;  2K5Q A;  3H3V C;  2E2H B;  2XSC A;  3K58 A;  2XNA C;  2QEJ C;  1DM0 B;  5ELB A;  3OHX C;  2Q8T A;  1JCK B;  2KOL A;  3T56 B;  1U9R A;  2VNU D;  3OPO A;  1STB A;  3BS1 A;  1D2B A;  3QO2 A;  4WJW A;  5JEA J;  3HS0 C;  5BN3 A;  2I46 A;  1B2T A;  2NZ1 D;  4DGZ A;  5C3W A;  1G2T A;  3RZD B;  1EYD A;  4KJO A;  1LT6 D;  2KVM A;  1I4R A;  4HMJ A;  4BA2 I;  1W6J A;  3BVZ A;  4A3D B;  1JOQ A;  3SEB A;  1EZ6 A;  2OT2 A;  3NWS A;  3K5O A;  5C44 B;  4RHS A;  2O5J C;  4TRD A;  3M7N A;  1NUC A;  3PO3 B;  2HCI A;  3SR1 A;  1KLG D;  1BOS A;  1LO5 D;  3NBH A;  1LTR D;  1WTV A;  2RDH A;  3GTQ B;  5FO9 B;  4LK1 C;  1UNS A;  5IGB A;  3M7G A;  1EL0 A;  3EVQ A;  4RHR A;  2AWO A;  1CHP D;  4K2K A;  1SAP A;  3PUX A;  1IHZ A;  2EYO A;  4B9X A;  4QB4 A;  1PZJ D;  2X69 A;  3H09 A;  3U9O A;  5LL6 S;  2KQ3 A;  5C4J B;  4V19 0;  3A55 A;  3ERQ A;  3NPP A;  4EQN A;  1IW7 D;  5F2D A;  4A3J B;  2E2J B;  5A2Q L;  5C0X I;  3K5L A;  1ONL A;  2JXM B;  2K5D A;  1SE2 A;  5I9P A;  2A73 B;  4UDU C;  5C4Z A;  2EY1 A;  4BS9 A;  1QOH A;  3DUZ A;  2X6L A;  1DOK A;  2K04 A;  1E2V A;  1TVX A;  1TKW B;  2B2T A;  3I72 A;  3NTH A;  5AFW A;  3PMF A;  4Z9C B;  1PFM A;  1HRJ A;  1L0Y B;  4XT1 B;  3GTJ B;  3OMG A;  1Y1V B;  5HUR A;  1FYC A;  1GUG A;  1SYB A;  5TSS A;  3Q22 A;  3J80 E;  2HDL A;  3D6W A;  1F2M A;  1RDP D;  3S16 B;  3FKI B;  1GHK A;  3VYT A;  4M8A A;  1PTO F;  4FNF A;  4RAU C;  4RKB A;  3ONA B;  2FFK B;  1V8Q A;  3OW7 A;  1BCP C;  1JIC A;  3FPU B;  2EJM A;  1HHV A;  4OGQ C;  2KA7 A;  3E6Z X;  3PV0 A;  1EY8 A;  3PIP 3;  3T51 B;  1STH A;  2B2Y A;  5CV4 A;  1RTO A;  3BDC A;  3QOJ A;  2R3Z A;  4H13 C;  1I6V C;  3NTI A;  4KY5 A;  4FYD A;  3KLR A;  5D3I B;  2QIL A;  1OXX K;  3OMC A;  2F0W A;  4NDX A;  1AEX A;  1S5E D;  1Y69 U;  1EYA A;  1OXV A;  1DON A;  1BNZ A;  2JA8 B;  4DAY A;  4KN7 C;  2MP1 A;  3IKJ A;  1I3Q B;  3S17 B;  3VR4 A;  1ZXT A;  1PDQ A;  4A3K B;  1JWU D;  2NN6 H;  3ZYY X;  5E4X A;  4QUC A;  3I4L A;  3MFG A;  4KN4 C;  4RA8 A;  5COR A;  4DN4 M;  1LTA D;  1ET9 A;  5JEA H;  3HOX B;  2WIN B;  4N9P A;  1R4P B;  3MXP A;  4K14 A;  3R8B A;  4CKE A;  4OO1 G;  1PRT F;  1O7Y A;  5ELD A;  1VF7 A;  5C0X J;  5M5W B;  1BCP B;  5CYU A;  4RGO S;  2DN8 A;  3I8Z A;  5IGF A;  4J8Q A;  1L0X B;  1ET6 A;  1TS3 A;  2SDF A;  3TN2 A;  1G29 1;  2ZXP A;  1MSH A;  2L5T A;  4S3S A;  2F0J A;  3P7J A;  3VA7 A;  4A3F B;  3K59 A;  3E0J A;  1SMY C;  3KBX A;  3NQT A;  4IUV A;  3OWE B;  1A3U A;  4ULL A;  4HAE A;  1YNJ D;  3OWF A;  3CHB D;  3D4W A;  2R6G A;  4GZY C;  2IJ0 A;  3QJY A;  1KNA A;  1GUS A;  1NCV A;  5G3L F;  3M4Y A;  3Q0A A;  3OIP A;  5C4X B;  2JP1 A;  1LTS D;  1SE3 A;  3HRZ C;  3KUP A;  4V0B A;  1DYQ A;  4I7Z C;  3DWP A;  2A74 C;  2RVL A;  1WTX A;  1DD2 A;  3L3O C;  2Q8R E;  3GTO B;  4XYQ A;  1GXD C;  3DWA A;  4C3J G;  1BCP F;  2FJ2 A;  2GA4 B;  1BXT A;  2A6E C;  5ELF A;  2PO4 A;  3T4A C;  4OHJ A;  1CTM A;  3MXN A;  3PIO 3;  2NBF A;  2ZXO A;  1S4Z A;  1B9M A;  2WKD A;  5KND A;  3D8G A;  4WRD A;  1G6Z A;  2B2V C;  2KEC A;  2SNS A;  3WOF A;  3C46 A;  3NK9 A;  1LT3 D;  1F2Y A;  2NUC A;  3A8J E;  5I2Y A;  4PMB A;  2WKC A;  1ZYR C;  3GTM B;  3N6R A;  1KTK A;  4ILW A;  2L12 A;  1AZQ A;  2H1E A;  1F9Q A;  3MWY W;  3D3R A;  3GD7 A;  4A3M B;  2B8G A;  1QIL A;  4XQJ A;  1EIG A;  1FR3 A;  4C56 C;  3BYY B;  4BA1 I;  4XT3 B;  3NHH A;  3TSS A;  4K6L A;  4K5V A;  1F9S A;  1Q3L A;  4IN3 A;  4EGV A;  3SK6 A;  2R92 B;  1SXT A;  1EFI D;  2H4O A;  5D14 A;  5EPL A;  1CA5 A;  3S2H B;  1S5C D;  3MFY A;  3GV6 A;  4IUQ A;  1I50 B;  1QCB D;  1GJX A;  4DNR B;  1CFM A;  2EJG C;  5I6Y A;  1D6E C;  1U4R A;  5IIF A;  2LY7 A;  1EYC A;  4OO1 I;  3T13 A;  1HQM C;  1C8C A;  3LWE A;  1CM9 A;  3FMC A;  2RQX A;  3O13 A;  1F77 A;  1PFB A;  1LTG D;  2BE5 C;  3S1M B;  1HA6 A;  1YNJ C;  1TQO A;  5LHY 1;  4CHT B;  2A69 C;  5M5Y B;  4IQZ A;  3EJI A;  3J81 L;  1HPC A;  1B9N A;  1IL8 A;  2O5I C;  2PZW A;  1O78 A;  4A3E B;  5J22 A;  3R2I A;  2PYK A;  1UUP A;  4PMC A;  1Y8O B;  1PTO H;  1SNC A;  1LAC A;  3H94 A;  5C0X H;  3CRK C;  3X3M A;  3RZO B;  5E4W C;  3PO2 B;  2HUG A;  1G8Z D;  3X3N A;  4XXE A;  1TU2 B;  1GHJ A;  4P2C B;  1DZ1 A;  3MXG A;  1T5X D;  3F2U A;  4KMU C;  1F2Z A;  2ICE C;  2ZXR A;  3KK7 A;  3GTK B;  2L11 A;  1SNP A;  1V43 A;  4KTA A;  3I90 A;  4EQO A;  2VB2 X;  3TP8 A;  4C3J B;  4NMZ A;  1ROD A;  4F8M A;  1ZKO A;  1B3A A;  1JQY D;  4XTC S;  2SNM A;  5CGK A;  5G3L D;  2ICI A;  1UEA B;  1A2U A;  1BUV T;  2R7Z B;  4C3I B;  2R93 B;  3GQB A;  3M3Y B;  2RA4 A;  3D6C A;  3C1E A;  5C3E B;  2JSO A;  1SNM A;  3BG3 A;  2XVS A;  4KKS A;  2K32 A;  5IOC A;  1DXM A;  3C1F A;  3TZD A;  2F0V A;  3JAM E;  5CV7 A;  1XWE A;  3MC0 B;  1T5E A;  1PXU A;  1D1K A;  2Z4H A;  3V2T A;  1BCP D;  2X6G A;  4F7X A;  2FMM A;  4WFN 3;  3W3A A;  3AU7 A;  5FLX L;  2Z8L A;  4K8I A;  2R61 A;  3K7A B;  1STE A;  4HMI A;  2CQA A;  1VMC A;  2QKI C;  3VYU A;  1AP0 A;  1X3P A;  1EQV A;  3I91 A;  1I4P A;  2F3W A;  2N88 A;  4QF4 A;  3P75 A;  2EYL A;  1SJH D;  2FIN B;  2O2L D;  4X3S A;  4QMG A;  4ABN A;  2B2V A;  3OOC A;  2K33 A;  2K01 A;  1TWH B;  3SDZ A;  3SK8 A;  4DK0 A;  1IYV A;  1TWG B;  1BF4 A;  5I2X A;  3IFT A;  1AFP A;  1SYG A;  5E1F A;  1DJR D;  1PMR A;  2RKS A;  3VR6 A;  4C2M B;  3SVM A;  2D5D A;  2EDG A;  1R4Q B;  4F88 A;  5DEH A;  1STG A;  4FF1 A;  5JPM C;  3PUV A;  4XQQ A;  1J9O A;  4HSP A;  1B50 A;  4HTH A;  1YNN C;  3MEH A;  5EBD A;  5M3M B;  1Q8I A;  1H9S A;  4DNT B;  3URY A;  3VA5 A;  2PPB C;  1XYI A;  1C4Q A;  2ID0 A;  5KGU A;  3I70 A;  1QJO A;  2AWN A;  2C9O A;  3DEP A;  4H0L C;  1SMY D;  1SFO B;  4KHZ A;  3OSO A;  2F0G A;  5LL6 X;  3I4N B;  2LS0 1;  5CMD A;  1QWY A;  5I6W A;  2E76 C;  4R8I A;  4U68 A;  3HOY B;  2B2U C;  1WTW A;  4NP5 A;  3U9S A;  2G9D A;  5IT9 L;  1SND A;  1WTO A;  4PNY A;  5BN5 A;  1EY6 A;  3QB3 A;  2WII B;  1J8I A;  1KDA A;  2NTT A;  4MIU A;  4DFA A;  3WDN A;  5FO7 B;  2A6E D;  3BZD B;  3A8I E;  2IT1 A;  2F4I A;  1IKM A;  3L7Z C;  3RUZ A;  1H9M A;  5A35 A;  4MN3 A;  1LTI D;  1LLR D;  2CW0 C;  5CV9 A;  2JA6 B;  5IGG A;  1Y8P B;  5FKA C;  5NUC A;  5DAU A;  2F0K A;  4C3H B;  3TP5 A;  2O4X A;  3Q24 A;  5K36 G;  3LWU A;  5KNC A;  1I4X A;  4G7H C;  1ZYR D;  2A6H C;  2M00 A;  1WD1 A;  1A3V A;  4ME5 A;  4R9W A;  2RDG A;  2E74 C;  1Z6H A;  1XXG A;  3I4M B;  3EA6 A;  4K8J A;  1D1I A;  4HN7 A;  1R9T B;  3VR3 A;  4X3K A;  4E6I A;  5A2Q E;  1EEF D;  4LJZ C;  2EYH A;  3LNN A;  4OL7 A;  4DXF A;  1TWC B;  3HOU B;  4C1N K;  2E75 C;  2BDN A;  1TII D;  3S9W A;  1WD0 A;  3D4R A;  1OXT A;  3DWQ A;  4N9T A;  1STY A;  1CK1 A;  1JE4 A;  4CGY B;  2JA5 B;  3HZX A;  3AMU A;  5FO8 B;  4IFD G;  1OXU A;  4ZUI A;  3A7A B;  4ZRZ A;  1ENC A;  2XWB B;  1M4V A;  3BDO A;  4BY7 B;  1AN8 A;  5ELC A;  2BOS A;  4OO1 H;  3PUZ A;  5C3X A;  2M9V A;  2OEO A;  5EPK A;  1IKL A;  3TP6 A;  1PYW D;  4RWS C;  4FXG C;  5JVG 3;  3HKZ B;  4HED A;  4RH6 A;  4ZKB B;  2HCC A;  3W2D A;  1A3T A;  1GUT A;  2A68 C;  1D5Z C;  2BE5 D;  2XRQ D;  1STN A;  1MD2 D;  5IGD A;  2DNE A;  3A56 A;  1MI2 A;  2CVR A;  1QNU A;  2A69 D;  1F2L A;  4CJ1 B;  1LTT D;  4FXK C;  1ICW A;  2EXZ A;  2KHS A;  1DOM A;  2EZV A;  3VR2 A;  4F87 A;  2F0P A;  3TZU A;  2EE1 A;  4DXG A;  5FOB B;  2D9U A;  1GOZ A;  3SE0 A;  4ZUJ A;  1B53 A;  3TBI B;  3CQZ B;  4KY6 A;  2VUM B;  5K5P A;  4O1N A;  3HOV B;  3MZ5 A;  5CV8 A;  1M8A A;  3WOE A;  1TR5 A;  2J0T D;  1PFN A;  2XN9 C;  4BWG B;  1EZ8 A;  4M1U B;  4FXD A;  2NVQ B;  4TSS A;  1TWA B;  4HCE A;  3H0G B;  4L8J A;  3QWN A;  4XIG S;  2E2D C;  4C3I G;  1LV9 A;  4IZ8 A;  1NR4 A;  2LKV A;  1EWH A;  1ZEQ X;  1S5B D;  2BA0 A;  2NVX B;  1X3Q A;  3BYT B;  4G7O C;  4ODG A;  3RD4 A;  5KRU A;  1RHP A;  3J7Y W;  5BN4 A;  4U67 3;  1S5D D;  2WP8 J;  2AQ2 B;  5EKK A;  2F0E A;  1WTP A;  4ZKC B;  2V4D A;  2DY7 A;  3T16 A;  2EYJ A;  3J7A V;  5C6A A;  1QB5 D;  3GP7 A;  2F0L A;  4LMQ D;  1HTP A;  5M5X B;  4A93 B;  3K5M A;  1V1P B;  2B2U A;  5J39 A;  2KEE A;  1JC7 A;  4NKL A;  4TKO B;  1HUM A;  1SSO A;  5M3F B;  3K57 A;  3G7L A;  3IL8 A;  4HR7 B;  1SNO A;  2EY5 A;  2IX3 A;  3H91 A;  2NTS A;  3V96 A;  1Q12 A;  1HFG A;  4O42 A;  4WOR A;  3C2P A;  2EVB A;  1EU3 A;  3QOL A;  3P20 A;  2KED A;  1II3 A;  4RGM A;  2RBM A;  3NSW A;  3SXH A;  3GTL B;  4I65 A;  4L63 B;  2F0M A;  2J7Z A;  3E5S A;  4IFD I;  5CV5 A;  1MGS A;  4G4K A;  3DM1 A;  3NBI A;  4TQU S;  3HOW B;  4BBS B;  1Y1W B;  3BVM A;  1SEB D;  2MUY A;  5DM7 3;  2M2L A;  3NWT A;  4G57 A;  4FF4 A;  1G2S A;  4KHV A;  1AW7 A;  5JVH 3;  2L1B A;  1TT2 A;  4A3I B;  2C5C A;  2K03 A;  4XQN A;  4R8N A;  1TS4 A;  4CKC A;  4K5W A;  4Q0F A;  4HSV A;  1FNU A;  4DF7 A;  5EBC A;  1SE4 A;  3NUC A;  3Q23 A;  1NSN S;  3TDQ A;  5JOB A;  5FK9 C;  1AZP A;  1TS5 A;  1ML0 D;  2A5H A;  3I3C A;  3PUW A;  1FD7 D;  4BY1 B;  4IUU A;  1SDF A;  1YNN D;  2J4X A;  3NQI A;  4FVM A;  4XDX A;  1VDZ A;  2F0D A;  2PMZ B;  2IL8 A;  3VYR A;  3NXW A;  1CHQ D;  4A3G B;  4JBW A;  1B44 D;  1TWF B;  1JR0 D;  3D31 A;  1E0B A;  1H9S B;  3ND9 A;  5ELE A;  4X3T A;  1O80 A;  2PQE A;  3LX0 A;  1A6X A;  2EYP A;  1HQR D;  1EY0 A;  5C5M A;  3K0Y A;  1O7Z A;  3NP8 A;  2F0U A;  1V1P A;  1PTO C;  2AQ1 B;  1MBY A;  2IPK D;  3BVG A;  2Z1C A;  1GUO A;  2F0Q A;  3KBG A;  2D2C C;  5IGE A;  4KK7 A;  2WAC A;  2B2W C;  5EPJ A;  3PUY A;  4C3H G;  4QUF A;  3J80 L;  2K05 A;  1EOT A;  3DEO A;  4EQP A;  5I4D A;  5I9O A;  3FDT A;  2PW7 A;  3R93 A;  1SYC A;  2CW0 D;  2XRS D;  1XX8 A;  3TP7 A;  5CBA E;  3TME A;  2XIW A;  3J81 E;  1NAP A;  1A15 A;  3C3L A;  2NWG A;  4PMW A;  1RKN A;  2A6H D;  4K6D A;  2OF1 A;  1U4P A;  2RSO A;  1E2W A;  2K1B A;  5JAV A;  2K28 A;  2E2I B;  3RMH A;  3DMU A;  2EY6 A;  3T53 B;  2KUM A;  1CI3 M;  4IFD J;  4FF3 A;  1DOL A;  1H9R A;  2N55 A;  1LT4 D;  2L0C A;  4RGN A;  1UAP A;  4RKL A;  2ENB A;  2ZT9 C;  4QCL A;  4CJ2 C;  4ZK9 B;  5CBE E;  1EY5 A;  5EJW A;  1RF2 D;  4QIW B;  3VR5 A;  1ESR A;  2I07 B;  2PZU A;  1CQF A;  2JYO A;  2AUJ D;  1ESF A;  3HG9 A;  2NYZ D;  1FNV A;  4Q5V A;  1U4M A;  1BBX C;  1PTO B;  4ZAI A;  1PRT C;  2FHT A;  1K8M A;  1SBB B;  4IUR A;  3L9A X;  2SEB D;  1PLF A;  5EKI A;  2XWJ B;  4B9W A;  3Q6S A;  1HCZ A;  3J7A F;  2EOT A;  2K7V A;  1X32 A;  4UAI A;  2EPB A;  3BDL A;  2F0H A;  3SK4 A;  1V1O A;  4IAL A;  5J1Z A;  1VCI A;  1KAA A;  3OIQ A;  2A68 D;  4HCS A;  2JEB I;  1KDB A;  1LAB A;  2BCO A;  2LFN A;  5FLX E;  3NE5 B;  1XTC D;  3UI2 A;  1ILP A;  2JE6 I;  3MAQ A;  2F03 A;  1H9J A;  2PW5 A;  1PZI D;  3CKI B;  4Y7N B;  4DAP A;  1PZK D;  4ID6 A;  1EEI D;  1WTQ A;  1E2Z A;  4KKT A;  1H9K A;  4KI0 A;  4MHE A;  2F0S A;  4FP5 D;  1KLU D;  4FF2 A;  1ILQ A;  3P1H A;  1LTB D;  1IYU A;  1O7L A;  3I73 A;  2F0N A;  3A54 A;  2EJF C;  3MTS A;  1HTL D;  3ITP A;  1G91 A;  1OO9 B;  1B4O A;  1NR2 A;  3S15 B;  1Z47 A;  4A3B B;  1RJT A;  1D5M C;  1EY7 A;  2VXW A;  1PRT B;  1F9P A;  2WV6 D;  5DNF A;  4J1M A;  4KJN A;  4H44 C;  1JB3 A;  1S5F D;  1SYF A;  2NN6 G;  2KCN A;  3CU7 A;  3MA2 B;  1I4H A;  4PQX A;  2IX0 A;  5JEA G;  4C1N I;  4ZYS A;  5K36 H;  1HUN A;  2F0I A;  3G6J B;  1CT1 D;  4RFB A;  1MSG A;  5COY A;  2K6A A;  2F1M A;  3EQL C;  4DAV A;  1KAB A;  1RTN A;  1EWC A;  4FO2 A;  1Q1E A;  2DY8 A;  1FGB D;  1FNW A;  2FMC A;  4KV6 A;  2KJX A;  3SK5 A;  1BO0 A;  3ND8 A;  5EKL A;  2L55 A;  4CBV A;  4EVO A;  3A8K E;  1IW7 C;  2B2W A;  2MHV A;  2QDB A;  1GUW A;  2JA7 B;  4ZQ3 A;  5T1I A;  4K2L A;  3R2T A;  2L9H A;  3KLS A;  5EQ0 A;  2PCF B;  1D5X C;  2PNR C;  4G7Z C;  1KDC A;  4IFD H;  3S14 B;  2CHB D;  3M85 A;  4X3U A;  5IT9 E;  5D3D A;  5HGT A;  3KLS X;  1HA5 A;  5KYL A;  1WTR A;  3ERO A;  1Z7T A;  3N52 A;  4OIJ A;  1EY9 A;  1SYD A;  2AUK A;  1VMP A;  1K83 B;  4AYB B;  1LT5 D;  1QNK A;  3VYS A;  1B1Z A;  2L4N A;  2NVY B;  1U4L A;  4NW2 A;  3H6M A;  1EQT A;  1BQQ T;  4J6H A;  2IW3 A;  3S2D B;  3FVQ A;  4RGT A;  4DK1 A;  5JJZ A;  1SYE A;  5D65 A;  1BDO A;  5DM6 3;  2RSN A;  4K5X A;  5CC4 A;  5KNB A;  1HFN A;  2K5W A;  1GUN A;  4YIJ A;  3DHQ A;  2WAQ B;  5CR3 A;  5T1G A;  1KNE A;  1Q90 A;  3HOZ B;  2NB0 A;  4L6T B;  2TMP A;  3RLF A;  2EYF A;  5KEE A;  2EY2 A;  3GV3 A;  1ENA A;  3IFD A;  2YU9 B;  2AQ3 B;  1HXY D;  1BR9 A;  4IUN A;  1QG7 A;  2NVT B;  3R3O A;  1RD9 D;  2MPM A;  1Q1B A;  4CKB A;  2F0T A;  3GO5 A;  3M4O B;  1PTO D;  1WVL A;  2HQE A;  3S1R B;  3MHB A;  2F0O A;  1JOR A;  3D4D A;  2NN6 I;  3FEW X;  1A2T A;  3A7L A;  2QCP X;  4DA2 A;  4XYO A;  2MJ8 A;  2OXP A;  2BA1 A;  2B39 A;  3MVV A;  2VB3 X;  5IGC A;  1TY2 A;  3V05 A;  5IOD A;  5CV6 A;  2IWH A;  1Y8N B;  4LAA A;  1C48 A;  2Q8I B;  1JWS D;  2TSS A;  3K6O A;  2PZT A;  2B2T C;  4KY7 A;  1K8O A;  3JAM L;  3FRP B;  5JPN C;  1F9R A;  2F3V A;  2F0F A;  5EGT A;  4RCN A;  5KIX A;  4KKU A;  1DCZ A;  2Z4I A;  1QE6 A;  3HGB A;  4RCO A;  1I4Q A;  1JOO A;  2HDM A;  2KCC A;  2SOB A;  2MGS A;  2Y0S B;  3FPP A;  2DNC A;  4KD3 A;  1SJE D;  2RDF A;  1STA A;  4CJ0 B;  5E3F A;  2BDO A;  1I4G A;  1W6K A;  1CQV A;  5C0X G;  4OIK A;  5M9O A;  1CA6 A;  2B8F A;  3QG1 A;  3CRL C;  3S1N B;  3IAY A;  5ISR A;  4JK1 C;  2B63 B;  1VF5 C;  4ZLT F;  4KD4 A;  1PRT D;  5C5L A;  2B2Y C;  4IUP A;  3HP3 A;  1EY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...