1RDPD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords cholera toxin B protein (CTB)
total genus 23
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rdpD00
1PRTF 1TS5A 1KTKA 4C56C 3URYA 4RHSA 1BCPF 1PYWD 1LT6D 1FD7D 1D5ZC 1PRTD 2RDHA 1AN8A 3GP7A 1SBBB 1V1PB 2O2LD 3BYYB 1EEFD 3CHBD 2NTTA 5ELBA 1EEID 2AQ1B 4RFBA 1FGBD 1TS3A 1BCPB 1ESFA 1JR0D 1JWMD 4K6LA 1I4RA 4RH6A 1S5DD 2NTSA 1ET9A 3R8BA 2IPKD 4BWGB 1SE2A 1EFID 3SEBA 2WV6D 2G9HD 3OWEB 1EU4A 1LTSD 3MFGA 2R61A 1TY0A 1TY2A 1XTCD 1S5ED 1D6EC 1PZID 5D3DA 3TSSA 1D5XC 1XXGA 1I4GA 3DWAA 1PRTC 5ELDA 2XNAC 1KLUD 1CT1D 4RHRA 3BVGA 1TS4A 2QILA 1AW7A 1RF2D 2RDGA 1LTBD 2SEBD 3MC0B 4RGOS 3V05A 1STEA 3BYTB 5FKAC 1PTOB 4OHJA 1LTAD 1TS2A 1ET6A 1PTOC 1D5MC 1I4XA 1B44D 1BCPD 1LO5D 5ELFA 4RGTA 1CHPD 1LTRD 1UNSA 1DYQA 1FNUA 1DJRD 1I4PA 1SJHD 1LT3D 1LT4D 5FK9C 1FNVA 1V1OA 2TSSA 1HQRD 4RCOA 1SE3A 2IJ0A 1I4HA 2QEJC 3DWPA 1PRTB 1HA5A 1V1PA 1F77A 3DWQA 5D3IB 5ELCA 2XRQD 4L63B 2AQ3B 3R2TA 1MD2D 1CK1A 2J4XA 1SE4A 1EU3A 3EA6A 1HTLD 1SJED 1HXYD 4Z9CB 2ICIA 1PTOD 1T5XD 1S5BD 2Z8LA 5I4DA 4O1NA 1BCPC 1PZKD 3BVZA 3KLSX 2AQ2B 1SXTA 4RGNA 2XN9C 1G8ZD 1UUPA 1SEBD 4RGMA 1CQVA 1LT5D 1GOZA 3O13A 4UDUC 1S5FD 1LLRD 1B1ZA 1LTID 4DXGA 3BVMA 1PZJD 1I4QA 3BZDB 1JQYD 1PTOH 1RDPD 1RD9D 1CHQD 1L0YB 2XRSD 1S5CD 1BXTA 1LTGD 1RCVD 4TSSA 2CHBD 1M4VA 5TSSA 4ZYSA 1LTTD 3EFXD 1JWUD 1PTOF 3W2DA 4L6TB 1JCKB 4DXFA 3R2IA 1QILA 1EWCA 5ELEA 1ENFA 1KLGD 1FNWA 1JWSD 1L0XB
chains in the Genus database with same CATH superfamily
1PRTF 2X6LA 4C3HB 1R4PB 2CCZA 4FF4A 4RHSA 3HOVH 1PYWD 1PRTD 2KHJA 1MIUA 4KN4C 2R7DA 4X65L 1XNRL 1SYCA 2DUDA 3TRZA 5C4XB 4BS9A 1EEID 4RFBA 2JA6H 2UUCQ 1V9PA 4PZ7A 4ME5A 1DD2A 1KAWA 3TZDA 1C48A 3QO2A 5CV4A 1B50A 2B2WA 4Y52H 3SEBA 4DR2Q 5DM63 5C44H 3RZDH 1VQMA 4AYBE 1CKNA 4GN3B 5D3DA 5H1SE 3K8AA 2MP1A 5CV7A 3H94A 3W5OA 2E74C 2ALYB 1FJGL 2B39A 2GVAA 2D2CC 1WTXA 2B2VC 3PO2G 1IKMA 4G4KA 1G6ZA 2I5HA 1O80A 3VYUA 3J81E 1OXSC 3V05A 2SEBD 1GUWA 1QWYA 4E6IA 4OHJA 5ELFA 3HP3A 5ISRA 5IYBH 2EY6A 1E2VA 2IWHA 5FLMG 3K7AB 1Y8NB 4JYAQ 1QVGA 3QIAA 2ZTCA 4OWTB 1SSOA 5A2QE 1WTPA 1MBYA 1B3QA 5IOCA 3TDQA 4AYBB 2M9VA 4ULLA 4B3TQ 4EQPA 3CQZH 2AUJD 1VS0A 4HTHA 3UE0A 1BCPC 2AQ2B 3RLOA 3CAMA 4A3IB 1GVPA 4FXKC 1TU2B 2HCCA 5BR8Q 5FO9B 1F9QA 2IHEA 4XDXA 4C1NI 4U673 2JA6G 3EQLC 4OELB 2WFWA 1ZXTA 1K73C 2JQOA 1IW7D 2RCNA 3KF6B 3M4YA 1YJWA 2K33A 4NP5A 2SNSA 2NVYB 2JXMB 1IBKQ 5JJLA 1STAA 5LL6S 1JOQA 1Y1WH 1HCZA 2IHFA 4V190 4LUVA 4L6TB 2M00A 3FVQA 3H6MA 4BY1H 1Y8OB 3PUWA 4PV1C 3UDIA 3R93A 4A3DG 4OWXB 3CCMA 2KA7A 3CRKC 4A3LH 3S1RB 5IE8A 3L2PA 3D4DA 1GUSA 1PYSB 3OPOA 2UUCL 3CHBD 1NTGA 5C5MA 2AQ1B 1V1QA 2Z9HA 1F2ZA 5EBDA 1BR9A 4IJHA 3HKZE 1AE2A 3HEJA 2B2UA 3MHBA 5FLXc 1JJ2A 3HOXH 1WTQA 1WI5A 3STBD 4WJ3M 3N52A 4DR3L 2RSNA 4P75A 1QCBD 2XGTA 1LACA 5L37A 4GKKQ 3V2TA 3VYTA 3TP8A 2CH4W 1X32A 4FVMA 1PH7A 4PMCA 5I9PA 4A3GB 1Y1WB 4JI1Q 2A73B 5C0XG 4LFAL 1OXTA 2OTLA 4LUZA 1RF2D 3I72A 4L5QA 4X62Q 1QB5D 1EQQA 3NTHA 1QZHA 3GTJH 3C1EA 4KI0A 2PI2A 2Y0SG 1GKHA 2DY8A 1UNSA 3I55A 1VQIA 5CV6A 3HOZB 1XYIA 2R7ZH 3F2UA 2K1BA 4NKLA 2G9DA 1SYEA 1UE6A 1BVSA 2A69D 1TXYA 2K7VA 2VUMB 3GTGB 3H09A 4B3TL 4JI0L 2F0VA 3NP8A 4X66Q 1EU3A 4A3LG 4OXPA 4DV2Q 1X3QA 2KHSA 1AEXA 3SDZA 3PV0A 4O1NA 2QW7A 1Y1VG 3FHWA 5K36H 2B2WC 3KLSX 1CA5A 1ZEQX 5C4JH 1II3A 2F4VQ 2PQAA 4DV0Q 2EY1A 2IT1A 4NDXA 4A3MB 4CDFC 4DXGA 2VB2X 3QOJA 4IQZA 4BY7G 1U0LA 3M4PA 1L1OB 4MN3A 2JA5G 2MO1A 4QGUA 3K5NA 2EYHA 3F2CA 4NXNQ 5IP9H 2OT2A 5FO7B 3RD4A 1RCVD 1V43A 3T16A 3F2DA 1CM9A 2WAQE 3IFTA 5TSSA 1H95A 1PH1A 4JBKA 1FR3A 4AQYL 2HHHQ 2K75A 4QIWB 3KLSA 4JCVE 4A93G 1HR0W 4HIKA 2R7ZB 4HSVA 4DPGA 1XNQL 1MHWC 1TS5A 2AKWB 1VF5C 2BH8A 2RDHA 4HCEA 3DXJC 3I4NB 4I65A 2EYMA 4PMBA 1QUQA 4DR5Q 2DNCA 3QWNA 2KENA 3SR1A 4NW2A 4CDCC 4JI6L 2KCMA 1YJ9A 1Q86C 2K5VA 1JR0D 2MFIA 3HS0C 1FGUA 1OXVA 5M5XB 5M3FB 1E1TA 1S5DD 5C3EH 1ENAA 3TP5A 4JI4L 2B29A 2L55A 1NSNS 5A35A 2MNAA 2C35B 1FVIA 1YNXA 4ZKCB 3ND8A 3J7A5 1XTCD 4JI2L 2ZTDA 4A3EB 5JJIA 3GTGH 2HDLA 4JW0A 1FL0A 4LFAQ 2PNHA 2B8GA 3NQTA 1K8MA 2Q8RE 3C3LA 4G7OC 4J15A 4K8JA 1M90C 3BG3A 4HAEA 2F0HA 1QZGA 1N32Q 1EY4A 1A8VA 2A6ED 2HQEA 1NJIC 4CBVA 1O7LA 1YI2A 2JA9A 3BZKA 1PH5A 1FJGQ 3KDFB 5IGEA 3HOVG 1PFBA 4M1UB 4WJ4A 4IUNA 3J80c 1GD7A 1OTCA 4MTNA 5C3XA 1F77A 4A93H 1RJTA 2OTJA 2HCIA 1MD2D 1CK1A 2EZVA 5C44G 3GTLB 3HOWH 4A3BH 4K14A 4Z9CB 4DV6L 3NSWA 3NXWA 5LL6X 3U9SA 1HUMA 1VQ7A 4F7XA 2R92H 4HEDA 5GROA 1SYBA 2K5NA 1B1ZA 2AMCB 1UE5A 1EYCA 4P73A 2L11A 1RDPD 4OONA 4KY7A 1J5EQ 1G291 1YVCA 1E7ZA 3FMCA 3T1YL 3PIP3 1LTGD 3PO2H 1LV9A 1EYGA 3U4ZA 1IKLA 2A6HC 3HOVB 1Y1VH 2K28A 5C0XI 1TVXA 1QILA 1F9SA 1STNA 3I56A 2KJXA 3MFYA 2I0QA 1MKHA 1KLGD 1BKBA 1DONA 3PIO3 4DV4Q 1VQFA 2F0JA 4A3BB 1XJVA 3LGJA 1MSHA 1X54A 1H9RA 4R9WA 3M85A 3G6EA 2CWPA 1H9SA 1YJNA 1W3SA 2JA7B 1AP0A 3CW2C 1NR2A 2F0OA 2ZT9C 4KHPL 4EQNA 3I91A 4ZK9B 4IZ8A 4DV1L 5FJ8H 4XQNA 1RHPA 1HNZL 4UAIA 4B9XA 4XXEA 2WKCA 2BDNA 1D6EC 3CCSA 3EN2A 3K5OA 3W1BA 4S3SA 2XTIA 1C9OA 5KYIA 5M3FG 3J7AF 1B9NA 4O2DA 4MIUA 3S15H 1D1IA 1KLUD 3GQBA 2K14A 1PA6A 3ULLA 5IYCG 1K9MC 1N9WA 3E5SA 5CV5A 4C2MB 3S1QB 5KNCA 5DEHA 3JAML 3ERSX 3PO2B 1BBWA 3A0JA 3I2ZA 4JK1C 1S40A 5FK9C 1O7YA 1SE3A 1V1PA 2KBNA 4ZQ3A 4A3IH 1SROA 4DR7L 2EYPA 4JI7L 5EQ0A 4C3IH 4XT3B 5HGTA 3T4AC 2EXZA 2PZTA 2UUAQ 1SDFA 1CI3M 1PFSA 2VNUD 1AH9A 4RGMA 4YHHQ 2VL6A 1WOCA 1QE6A 2DJFC 4BBRG 1VQBA 5GADC 3A54A 1YITA 1I4QA 4IUPA 3DM3A 2HDMA 2QGQA 1O7ZA 1MSGA 2NZ1D 1MGSA 1DGSA 1O7IA 1XTDA 3D6WA 2A1AA 2EVBA 1TR5A 2IX1A 2BCOA 4LF4L 1NY4A 1YEZA 2JK8A 1N33L 5EKLA 4DXFA 1SYFA 2PZWA 4DV4L 4LFBL 1EL0A 3OMCA 1JWSD 2EY5A 1L0XB 5BN4A 3U50C 1V1PB 1RTOA 2R3ZA 4A3CH 3SXHA 1S3OA 4C2MH 1MI2A 3H3VH 2WAQG 1L2FA 3L0OA 3TP7A 4KMUC 2A6EC 4CDEC 1B70B 3NWSA 4LJZC 3J80i 1KAAA 1W6KA 5C6AA 4HIOA 1LTSD 3DEPA 3S9WA 5IP9G 1SNOA 3T53B 2Q2UA 4IFDG 2YTVA 1I4GA 1ONLA 2JA5H 4O0AA 1I5FA 1CT1D 4HN7A 2F0UA 2UXBL 2LMCB 1I6VC 4GOPA 4BA2I 3J81j 4A3FH 3S1RH 5J1ZA 1TWCB 3BYTB 5JEAH 4GZYC 2EQSA 3M4OB 4F87A 4DNRB 2D9UA 4WORA 3HG9A 4DGZA 3RNUA 2R6GA 3KFUA 2X69A 1SJHD 2XIWA 4JI8Q 1EWIA 4XTCS 2ZJRA 2KCTA 1A6XA 1TWGB 4DR7Q 1PRTB 1HA5A 1I50H 2ZJQA 2AQ3B 3P1HA 3C46A 3EA6A 3HOWB 1HTLD 2WB1G 2A6HD 1JOOA 5IYCH 3ONAB 4B3MQ 4QUCA 1ZYRD 2F0WA 1EYAA 3NHHA 5C3EG 4DUYQ 5M5WH 1PDQA 3A8IE 1G8ZD 2DN8A 3DLLA 1DCZA 3D3RA 2WACA 1HTPA 5FLMH 2PMZB 3W3AA 3S2HB 4JV5Q 3FDTA 2MUYA 4QMGA 2A74C 2QA4A 1SFOB 1D2BA 1RD9D 4A3MH 1N32L 4YWLA 2R93G 1TT2A 3MXGA 4C3IG 3Q6SA 4LNQA 1A0IA 4P71A 4RA8A 1F2YA 2CFMA 4LF5Q 1M8AA 1PTOF 1EIHA 3W1GA 2HT1A 3KJPA 3ULPA 1LUZA 3OYYA 3CCUA 2PO4A 2EJGC 4LF9L 2C5CA 1BO0A 2YU9H 1D5ZC 1Z47A 2WB1E 3HKSA 5IGGA 4HR7B 2B2YA 3CCRA 1P8LA 3BYYB 2VXWA 2K04A 2WKDA 4IOCA 2AHOB 2P5ZX 4A3EH 3UDFA 1EU4A 1E2WA 2VQEL 3PUVA 4JI5L 2F0FA 4L8JA 2DY7A 4R4TA 4N8X1 5JOBA 3WOFA 2JSOA 1E2ZA 1K3RA 4L5RC 4HJ5A 4Y7NB 1N36Q 3HOXG 2NWGA 1WJJA 1TS2A 3BDOA 1D5MC 4ZUJA 1SYDA 2IL8A 1DYQA 2F0LA 4ZAIA 1AFPA 4FO2A 1GUTA 1I4HA 2MQHA 3PMFA 1PV4A 2CQOA 2BA0A 3PUYA 1HUNA 4NPSA 3SK4A 1CTMA 2J4XA 2NBFA 1SR3A 4DAVA 2OEOA 2XWBB 1BNZA 5I6WA 3VDYA 3HOZH 4P74A 1K28A 4MHEA 3RMHA 3I73A 4IURA 5FJ8G 3RN2A 1QOHA 2RKSA 3F8TA 1UEBA 2RDFA 3NBHA 2CVRA 4PNYA 1KDCA 2E2HB 4UY8C 3TS2A 1D7QA 2IW3A 5C3WA 4GNXA 4EVOA 4A3JB 2BH2A 2KECA 3I70A 1B53A 4X66L 1XMQQ 1WVLA 5JJKA 4DKAC 2SNMA 4R8NA 5C5LA 3URYA 4CKCA 2M2LA 1EY0A 2C9OA 3ZYYX 5LMUL 1YNJD 2JA5B 4DR2L 3NE5B 4B3SL 2F0EA 2O2LD 2NVYH 2H5XA 2K32A 3JC66 3A8KE 1EIYB 1I4RA 4OO1H 2NTSA 1IXRA 1B4OA 4DV7Q 3AFPA 1JOKA 1NUCA 4F8MA 2CH4A 1GHKA 5CORA 2KVMA 4L5TA 3AEVA 4POFA 2JA7H 4LF7Q 1EWHA 1JC7A 4LK1C 1W6JA 3JAME 4RG1A 4BBRB 1HNXQ 3CC2A 2N3SA 3NBIA 5DNFA 1N33Q 3T51B 1ZYRC 2EXDA 2QILA 4PG3A 4HJ9A 1LTBD 1G51A 4DR1L 1HA6A 3MAQA 3HOXB 1Z9FA 4LW1A 3UDXA 5ELOA 5IT9E 3E0JA 2IX0A 3S17B 2ZXOA 1F9PA 3TEHB 4FF3A 2RSOA 1EY8A 1JJGA 2OF1A 5CBAE 1DJRD 4POGA 1V1OA 2B2TC 1KABA 1SMYC 4RCOA 4C3JH 5BR8L 3G7LA 1JB7A 2IX3A 4RWSC 3MXNA 2A8VA 4DNIA 1QNKA 3F1ZA 5CC4A 5EPLA 4OL7A 3HOYG 1X3EA 1DZ1A 2EPBA 3RN5A 1HQMC 1WCMH 1JE5A 2JA8B 1YZ6A 1G91A 3OIPA 2JYOA 2JP1A 5EBCA 4HJ8A 1ILQA 1S4ZA 3GTLH 3KDFA 1R4QB 3PF4A 1J6QA 2UXBQ 3NQIA 1YHQA 4J6HA 3KF8B 3J81L 3KF8A 5C44B 3OW7A 1PYBA 5C4XG 2N55A 3NWTA 4DUYL 1PH3A 4J1MA 3S16B 2Q8TA 1XMQL 1G6PA 3W2DA 1GO3E 5E3FA 1BBXC 3EJIA 2I07B 3S2DH 5IGBA 2NVQB 4JI8L 1WTWA 5JJZA 5M3MH 2PPBC 5FO8B 1OO9B 1F2MA 4C56C 3GV3A 2E2IB 1EY5A 2ICEC 5DM73 1KQSA 2H4OA 4OX9Q 1EEFD 1Y1VB 3OTOL 1VQLA 3X3NA 2EOTA 4BXXH 1H9KA 1TS3A 2QEXA 1IL8A 1BCPB 4X65Q 1WCMB 4KD3A 4DV7L 1XNRQ 4JI0Q 2A5HA 4RH6A 3GTKB 3EBEA 4H13C 4C3JG 1K0SA 3I3CA 4G7ZC 2L1BA 3U58A 4C3JB 1OXUA 2E75C 1HR0Q 4DV2L 5K5PA 1XMOL 1KD1C 1EY9A 3S17H 1SNCA 1VQ5A 3UI2A 1Q82C 2WB1B 1HZCA 3FPPA 3FKIG 1CSQA 3PQIA 4OIJA 4K2KA 4BY7H 4KN7C 4RHRA 2BE5D 2R7FA 3VR6A 3NK9A 1PLFA 2RDGA 5IWAQ 4LF9Q 1STEA 5HY6A 1X56A 3PSIA 5E4XA 2HUGA 2F0GA 1GHJA 4X64L 4JI3Q 1QVFA 1HPCA 1SN8A 3LWEA 3HKZG 1LT3D 4BBSH 1FNVA 4ILWA 1IZ6A 4EQ5A 1J8IA 4A3JH 1E24A 4K8IA 1DOKA 2L5TA 1B8AA 2SOBA 3BDLA 2ICIA 4AIMA 3VA7A 3IKJA 1JICA 2D62A 4QIWE 4DV5Q 1SXTA 4DK0A 5AJ3Q 4DU9A 1SRUA 4HCSA 3TS0A 4QB4A 1GOZA 1NAPA 2WAQB 4GN4B 5IP7H 1NCVA 4A3FB 3T56B 4MZ9A 1AE3A 4AH6A 5IYDH 2JA6B 4LF6L 1CHQD 2RHSB 4A3IG 2J0TD 3EVQA 1BXTA 3MWYW 1H9SB 1M4VA 4IUTA 3A7AB 3QJYA 3C2PA 2L0CA 2L4NA 3P20A 3J7YW 4PZ8A 3R2IA 2EJMA 1SLJA 4JI7Q 1GXDC 1FNWA 1Q8IA 4ZUIA 5FLXL 1L1OA 2OXPA 3BU2A 1CZGA 1YNND 2ZM6Q 1BQQT 4HSPA 2NVXH 1CFMA 5C4XH 1AZPA 1DXMA 1TWFB 2YTXA 4ZLTF 3BS1A 3HOUB 3HOWG 3AB9A 1T9HA 1ET9A 4KHVA 2RCFA 1QJOA 1SE2A 1E0BA 3JAMc 2AWOA 1SFOH 3NTKA 4LF8L 2YYZA 3K0XA 4UP7A 3K7AH 2H1EA 2OQ0A 3MFGA 2R92G 3IL8A 1TY2A 2Q8IB 1K83B 5KIXA 5AFWA 3D6CA 5CYUA 4JG2A 1HZ9A 1BBUA 1ILPA 5IY0A 1KXLA 4IUVA 4R1JA 2F3IA 2R7ZG 1PFNA 5M5YB 4DUZQ 3ER0A 1A2UA 2JA8H 3GTQH 1ENCA 3MC0B 1VQKA 3SK8A 1PTOB 2WIIB 1PXUA 3E6ZX 5IGCA 4IUUA 1UWVA 4QY7A 4DR6Q 3I8ZA 1NNXA 4X62L 4G57A 4DAMA 5A2QL 2B8FA 1PH6A 3MXUA 4RKBA 1A3UA 1TWCH 4XT1B 3R2TA 3ITPA 3HZXA 4GNXB 5FOBB 2OWOA 2ASBA 3K57A 3H15A 1F2LA 2BDOA 2CQAA 4ZCKA 2F1MA 3T1YQ 5HGQA 2Z6KC 1Q81C 1D8LA 1XPOA 1W2BA 1N34Q 4IPHA 3AQQA 3NBHB 4C3HG 5IIFA 5C3EB 5IT9L 1U5KA 5M9OA 1U4LA 3NPPA 3JAMi 2K5DA 4KY6A 4LUOA 1VMPA 2XRSD 5FLXE 2MHVA 2L9HA 2V1CC 4LMQD 3MVVA 2Z0SA 4A3KH 3J7AV 4TVAB 1UAPA 1VQDA 4ZYSA 1ASYA 1K8AC 5BN3A 3H3VC 4GLXA 1OXXK 2NVQH 3S2DB 4ABNA 4UPAA 3GTPB 2HHHL 2K01A 3I90A 1KTKA 1FYCA 4GLVB 3K81C 1R9TH 1FD7D 3CD6A 2RHQB 3Q8DA 3I4MG 2F52A 1I94L 4X3TA 4DR5L 1UE7A 1GUGA 1K8OA 2MGSA 4KTAA 3I7FA 5IGFA 2ES2A 5EKIA 1VQ8A 3GDEA 2F03A 2WV6D 2G9HD 2VZAA 3X3MA 4OX9L 1PFMA 2R61A 1Q12A 1YNJC 2OCEA 5I9OA 3BDCA 1STHA 5ELNA 2L15A 1IBMQ 2A68D 3DWAA 4DR4Q 1CZWA 3K6OA 3MTSA 2QF7A 3CPFA 4CGYB 5J39A 1HR0L 1XPUA 2F3VA 4C3HH 4CJ2C 1AW7A 2NN6G 5EPKA 1Z7TA 1N8RC 1HH2P 1TIID 2K05A 4LF4Q 3J80L 3ULJA 2DNEA 3GTMB 2EYFA 2O4XA 4MNOA 5E4WC 3PO3H 2F0DA 1SNDA 1Q3LA 4A3BG 4JYAL 2PMZE 2PQAB 4C3IB 2VW9A 4DNTB 1CHPD 4CJ1B 3OSOA 4R4CA 3S1MH 2K4KA 2RF4A 2UUAL 3BJUA 4I7AA 3S14H 2JN4A 2TSSA 2F0NA 1K0RA 2EDGA 3KLWA 4R4QA 3M3YB 4HIMA 4X3UA 1NMGA 1HFNA 1H9MA 1EOVA 1K3BC 1JORA 3EROA 1SJED 1HXYD 2PI2E 1SYGA 4HMJA 1VQAA 3T1HQ 1Q1BA 2RVLA 3BVZA 1KDBA 1U9RA 4BA1I 3I4MH 3FEWX 2VUMG 4CJ0B 3CP0A 1DOLA 3E9IA 1WTOA 1SMYD 1ZKOA 3D31A 3KYHC 1TQOA 4P72A 5JPNC 4GNXC 5BN5A 2IY5B 3I4NG 1VQJA 2D5DA 5IWAL 4TKOB 4DV5L 5AJ3L 4BBSG 3QG1A 2XWJB 1HJPA 3HOUG 3IRBA 3EFXD 1JWUD 1U4PA 2N8NA 2JEBI 2LXKA 1TKWB 1CQFA 1HNXL 1ESRA 2EYOA 3S14B 3BZDB 4LF6Q 1LT6D 1IL2A 5D14A 1RTNA 4LFCL 4DV3L 2PQEA 1YHBA 4H0LC 1SNMA 4KJOA 2UXDQ 1T5EA 2NTTA 3G71A 1VQOA 2R93B 3S1NH 3OHXC 2LS01 4ID6A 5JAVA 1TWHH 1I50B 1EQRA 1C7YA 4PMWA 5M3FH 1V8QA 3R8BA 3L7ZC 4K5WA 3KUPA 4KLKA 4XQQA 2UUBL 2Z6KA 2ATWA 4K5VA 1VQGA 2FHTA 2Q2IA 3K58A 1BDOA 4NB3A 4GKKL 1JJCB 4ME3A 1STGA 1I6HH 4APVA 3H91A 3L9AX 3J80E 4DV1Q 2KOLA 5IP7G 1STYA 1D5XC 3VYSA 3NUCA 3D0FA 3RUZA 4IUQA 5CMDA 3TREA 2WINB 5J22A 4B3SQ 5LMNQ 1A3VA 2E2IH 1Q8KA 4EGVA 2EY2A 1PTOC 3SVMA 3KJOA 2XVSA 1B44D 1K8GA 4B3ML 3A5ZB 1NBWA 5JVG3 5KNBA 2ZM6L 2K50A 1X3PA 3QB3A 3HKZB 5M5WB 5JEAJ 3GTKH 4FYDA 4LAAA 2QEJC 4DK3C 1PH4A 2EYLA 5ELCA 4JBWA 4JVZA 2BE5C 3CC7A 2JEAI 3SGIA 5GAEC 4LF8Q 2NN6H 2B2UC 5NUCA 4CKBA 2Z4IA 4RGNA 4YCUA 1WTVA 1UUPA 3KLRA 1TWAB 2PYKA 3IFDA 4FDBA 2ZTEA 5DLQE 4UDUC 4R8IA 2JA8G 3NELA 1STBA 4Y7NH 3G6JB 1JQYD 3FKIB 2MPMA 1QG7A 2F0TA 3WWVA 3E0EA 4ZKBB 4DUZL 3MXNB 2JJQA 5K36G 1L0YB 1VMCA 4OEMB 4FF1A 3IAYA 2CHBD 5E1FA 1XMOQ 4DR6L 2FXQA 1WCMG 1HZBA 1NR4A 3DEOA 4M8AA 2LSSA 3WOEA 4WRDA 4K0KQ 2VUMH 2QDBA 4RAUC 1Q46A 2ZXPA 1ML0D 4DV3Q 4IPDA 4KKSA 4A3MG 2A68C 2R92B 5IT9c 1AN8A 3KF6A 1Q90A 3M4OH 3I4OA 2V4DA 2LFNA 3GD7A 1Q7YC 1CSPA 4DAPA 3AMUA 1XX8A 2EYJA 1VQNA 4G7HC 3U4VA 4JBMA 4JI4Q 4IFDI 4IFDH 2D0PA 4K6LA 4UP8A 4C1NK 5I6YA 3Q24A 5CV8A 1A3TA 4F88A 4JBJA 4AYBG 1Y69U 3KBXA 3P75A 4I7ZC 1TY0A 1BOSA 3H0GB 3CU7A 4TQUS 1YNNC 1M1KC 4HMIA 3TSSA 4B3RQ 4HJ7A 3PF5A 1XXGA 2FINB 4OWWB 2XNAC 2A19A 4O42A 4K2LA 2KEDA 3L3OC 3HOYB 4EX5A 1ICFB 1CA6A 2RA4A 2VQFL 1ET6A 1IYJB 4B9WA 4RMFA 3DHQA 3GTQB 2DJGC 2E76C 1LTRD 3S1MB 2OQKA 1VQHA 3TQYA 1O78A 3CMAA 1VQEA 4OGQC 1JT8A 1I94Q 2IJ0A 3RLFA 2UU9L 3M3YH 2B2YC 4X6AH 2XRQD 2HQLA 3GTOB 2NN6I 4BY1B 2VB3X 4H7BA 3DMUA 4YY3Q 3TZUA 4KY5A 1A2TA 1PZKD 1WYDA 3I4MB 3J81i 4GN5A 4FXGC 3MA2B 1CQVA 1S72A 4FXDA 3O13A 3CCLA 2QDLA 1CKNB 1KDAA 3PUZA 3SE0A 3BVMA 1PZJD 3ND9A 3ZJYC 2JA7G 4JI3L 4NXMQ 1Y14B 2K5WA 2VS1A 3FPUB 1Y8PB 3PO3G 5C0XJ 1E1OA 4HJAA 2HIXA 4K0KL 4DV0L 2KHIA 1EWCA 3CMEA 1NE3A 4WJWA 3R3OA 1L1OC 3PGZA 4KJNA 5I2YA 3LX0A 1MJCA 5EJWA 5IYDG 4A3EG 4KKTA 1VF7A 3RZDB 2NVTB 4IN3A 1HRJA 1ICWA 4RKLA 1B2TA 1FGBD 1U4MA 2E2JB 1TWHB 1ESFA 2X6GA 2JE6I 1VQ9A 3HOYH 1HNZQ 4BWGB 2LXJA 2F0KA 3I4NH 1EFID 4QL5A 1VQPA 5M3MB 3OWFA 4DR1Q 3OOCA 2GA4B 1YIJA 1I3QB 2KCNA 1KL9A 3HOUH 5EKKA 5F2DA 3BZCA 3MEHA 1EFWA 1EQTA 2Z6BA 4JI5Q 4JPBW 5COYA 1VQCA 2PCFB 2NZHA 3BVGA 4K6DA 5D65A 4HIDA 3CC4A 3K7UC 1R9TB 2NYZD 4RGOS 3SK6A 1AZQA 3ICEA 1LTAD 2AUKA 3DM1A 4U68A 3CF5A 2CW0D 4QJFA 4RGTA 2B63B 4DK6C 3VYRA 1QVCA 4GLAC 1LT4D 4ALPA 3HOZG 2FMCA 2G5DA 3KOJA 1TWGH 4BY7B 3AU7A 2F0PA 1CUKA 1IBLQ 3I4LA 1IYUA 4DAYB 3OTOQ 2YV5A 4YHHL 1S5BD 1L0WA 3A5UA 1UE1A 3Q22A 1P16A 3NEMA 2O5IC 2UXCQ 2YU9B 1C0AA 2QKIC 1LM0A 1C4QA 2PZUA 1X3GA 5M5XH 2YTYA 3FKIH 1JMCA 3PUXA 2Q2HA 3U9OA 4QQBX 5KGUA 2KQ3A 5T1IA 2MJ8A 3VR2A 1RKNA 1KRSA 2GVBA 4TSSA 1GM5A 3AFQA 3HFZB 4DR3Q 3K0YA 4BBRH 1WD0A 4CDDC 1X9NA 4CHTB 2B63G 1IBML 1CKOA 5KRUA 2ENBA 4OO1G 2HIVA 1BCPF 4UP9A 4X64Q 2XSCA 3A56A 5G3LD 4BBSB 4H44C 2F0SA 4DV6Q 4A3JG 5LMUQ 3PIPA 4CKEA 4DAYA 1LABA 5C0XH 2WP8J 2I46A 1HNWL 5KEEA 3CPWA 3VR4A 4WFN3 1WD1A 1EY6A 1DOMA 1QNUA 4BXXG 5CGKA 4MTKA 1S5ED 3HRZC 2BA1A 2TMPA 4JOIA 2NUCA 3VR3A 1HZAA 4IOAA 5ELDA 2HD3A 3TN2A 2NZOA 1TS4A 5LMNW 2ZJPA 1KNEA 3M9BA 2PW5A 1ASZA 4QF4A 3MEFA 1RIPA 3V96A 1EYDA 1EIFA 2Y0SB 1BCPD 1LO5D 3S1NB 1SMXA 5JVH3 1FNUA 3E3XA 1HQRD 1KNAA 5JPMC 1QUQB 5JEAG 3DWQA 1IW7C 4L63B 3SK5A 1XPRA 3FP9A 1A62A 3PO3B 5IGDA 2N78A 5M5YH 4KHPQ 5KNDA 1PTOD 2UXCL 4N8FA 2J7ZA 4XYOA 4XYQA 1LT5D 2UU9Q 2Y0SE 1J9OA 3CQZB 1S5FD 1VDZA 1LLRD 3P7JA 5LHY1 3F2BA 2E2HH 1PTOH 2F0QA 1X3FA 1K83H 5EGTA 4TRDA 1RL2A 5M3MG 3CXCA 3D8GA 1A15A 3M7GA 4GKJQ 1GJXA 4XQJA 2ZXRA 2D0OA 4K5XA 4GOPC 2E2DC 4H02A 1C8CA 2KCCA 1LTLA 3S1QH 4A3CG 4JI2Q 3OIQA 4A3GH 1TWFH 5ELEA 3SHLA 1G2SA 2CWAA 1I3QH 1SE8A 4A3DB 2BOSA 1BF4A 2RBMA 2SDFA 2EJFC 2QCPX 2E8GA 1XWEA 3GTJB 1SBBB 3G4SA 4YY3L 1B9MA 4X3KA 2LY7A 1EIGA 5IYBG 4JC0A 4DFAA 3H3VI 2FMMA 4B08A 3N6RA 1JWMD 2RQXA 1GUNA 5J3BA 3UE1A 3S2HH 2AWNA 3H0GH 4NXNL 4A76A 2B63H 4YCVA 1F9RA 2B2TA 1SNQA 2B2VA 2GN5A 1KRTA 4ZRZA 1KIXA 1B3AA 3PCOB 2K03A 3KK7A 4RCNA 1EZ6A 4A3FG 4AQYQ 2O5JC 2FFKB 3QOLA 1PH2A 4L5SA 1XNQQ 1PRTC 3K5LA 3RLNA 2N88A 1NMFA 4DA2A 3G48A 5GAGC 4LFCQ 1KC8C 4J8QA 4KD4A 1UEAB 2UXDL 1WTHA 3MXPA 2KUMA 4YCWA 2K6AA 4A3KB 3CCEA 4BY1G 3TMEA 4YWKA 3NTIA 1PVOA 1WFQA 3GTOH 1Y1WG 3S24A 1J5EL 3GTPH 4DF7A 4PZ6A 3E9HA 2E5LL 4KK7A 1IHZA 3DWPA 3ERQA 1N34L 5C4HA 5GAHC 1PHJA 1JE4A 5D3IB 2K52A 3LWUA 4A3DH 4PQXA 3CCJA 4XIGS 4DK1A 2L12A 1T5XD 3D4WA 1VCIA 5I4DA 1E22A 3M4QA 4KHZA 1U4RA 1G2TA 1SNPA 2XN9C 3UDGA 4P2CB 5LMNL 1KHIA 3QR8A 5HURA 1DM0B 1VQ6A 4JOIC 3AYHB 1IBLL 3H0GG 1RODA 4GKJL 2MO0A 5C4JB 1GUOA 4V0BA 5CV9A 1PH9A 4NMZA 2F3WA 1HHVA 3WDNA 2KEEA 2Z4HA 1E3PA 2F0IA 5EPJA 3S16H 2CKZB 3J7ZC 3CCQA 1HFGA 4IJLA 5I2XA 4QUFA 3Q23A 1LTTD 4JI1L 2N49A 3CCVA 5GQOA 1JCKB 5EAYA 4JV5L 3RZOH 1ENFA 1YHAA 4B3RL 2VY3A 4KKUA 2NVTH 5IODA 2F0MA 4A3KG 1MJEA 4LFBQ 3VR5A 5G3LF 4IFDJ 3GP7A 3T13A 2FJ2A 3D4RA 2B3GA 5E7NA 5ELBA 4LF5L 4R4OA 4OO1I 3VA5A 2VQFQ 3K5MA 2F4IA 5CBEE 2Z1CA 4DR4L 2IPKD 4FP5D 3MZ5A 3LNNA 1X6OA 4A3GG 3KBGA 4IO9A 1B7YB 4IPCA 4LF7L 3GO5A 3OWEB 2I5LX 4KV6A 4Q5VA 1EY7A 3Q0AA 1PZID 1EQVA 5KYLA 4X3SA 3OW2A 3GTMH 4Q0FA 1JB3A 3A7LA 3RR5A 2R93H 1A63A 2PW7A 3C1FA 2K5HA 3NENA 1Z6HA 3RZOB 5FKAC 4DN4M 3GV6A 5CR3A 1I4XA 4ODGA 3K80C 3TP6A 2ID0A 4NXML 4A4IA 2E5LQ 4A93B 2PNRC 3STBC 2E2JH 3T1HL 1I4PA 1LYLA 1X55A 3PIOA 1EZ8A 2F4VL 3HGBA 4LWCA 3OMGA 5C4ZA 4IPGA 1CKMA 3M7NA 1HNWQ 3K59A 1SE4A 4N9PA 4GOPB 1VQ4A 4QCLA 1IYVA 2Z8LA 2CW0C 2VQEQ 2EIFA 1Q1EA 3TBIB 1PMRA 4A75A 4EQOA 1SEBD 1WTRA 4UHVA 2UUBQ 3CRLC 4YWMA 1LTID 4OIKA 1I6HB 2DGYA 2NB0A 2NVXB 1X65A 4YIJA 3CKIB 1EOTA 3A8JE 4IALA 2LKVA 1H9JA 1EUJA 1S5CD 3J81c 2A69C 2K5QA 4N9TA 1PH8A 1N36L 4GS3A 1YBYA 3B6YA 1IBKL 1D1KA 3DUZA 2EE1A 5T1GA 4JI6Q 1BUVT 2Q2TA 1SAPA 3A74A 3EIVA 4FNFA 3S15B 3FRPB 4R4IA 5DAUA 1TWAH 2I5MX 4FF2A 3A55A
chains in the Genus database with same CATH topology
1PRTF 2X6LA 4C3HB 1R4PB 4FF4A 4RHSA 1PYWD 1PRTD 4KN4C 1SYCA 5C4XB 4BS9A 1EEID 4RFBA 4ME5A 1DD2A 3TZDA 1C48A 3QO2A 5CV4A 1B50A 2B2WA 3SEBA 5DM63 5D3DA 2MP1A 5CV7A 3H94A 2E74C 2B39A 2D2CC 1WTXA 2B2VC 1IKMA 4G4KA 1G6ZA 1O80A 3VYUA 3J81E 1OXSC 3V05A 2SEBD 1GUWA 1QWYA 4E6IA 4OHJA 5ELFA 3HP3A 5ISRA 2EY6A 1E2VA 2IWHA 3K7AB 1Y8NB 3QIAA 1SSOA 5A2QE 1WTPA 1MBYA 5IOCA 3TDQA 4AYBB 2M9VA 4ULLA 4EQPA 2AUJD 4HTHA 1BCPC 2AQ2B 4A3IB 4FXKC 1TU2B 2HCCA 5FO9B 1F9QA 4XDXA 4U673 4C1NI 3EQLC 1ZXTA 1IW7D 3M4YA 2K33A 4NP5A 2SNSA 2NVYB 2JXMB 1STAA 5LL6S 1JOQA 1HCZA 4V190 4L6TB 2M00A 3FVQA 3H6MA 1Y8OB 3PUWA 4PV1C 3R93A 2KA7A 3CRKC 3S1RB 3D4DA 1GUSA 3OPOA 3CHBD 5C5MA 2AQ1B 1F2ZA 5EBDA 1BR9A 3HEJA 2B2UA 3MHBA 1WTQA 3N52A 2RSNA 1QCBD 1LACA 3V2TA 3VYTA 3TP8A 4FVMA 1X32A 4PMCA 5I9PA 4A3GB 1Y1WB 2A73B 5C0XG 1OXTA 1RF2D 3I72A 1QB5D 3NTHA 3C1EA 4KI0A 2DY8A 1UNSA 5CV6A 3HOZB 1XYIA 3F2UA 2K1BA 4NKLA 2G9DA 1SYEA 2K7VA 2A69D 2VUMB 3GTGB 3H09A 2F0VA 3NP8A 1EU3A 1X3QA 2KHSA 1AEXA 3SDZA 3PV0A 4O1NA 5K36H 2B2WC 3KLSX 1CA5A 1ZEQX 1II3A 2EY1A 2IT1A 4A3MB 4NDXA 4DXGA 2VB2X 3QOJA 4IQZA 4MN3A 3K5NA 2EYHA 2OT2A 5FO7B 3RD4A 1RCVD 1V43A 3T16A 1CM9A 5TSSA 3IFTA 1FR3A 4QIWB 3KLSA 2R7ZB 4HSVA 1TS5A 1VF5C 2RDHA 4HCEA 3DXJC 3I4NB 4I65A 2EYMA 4PMBA 2DNCA 3QWNA 3SR1A 4NW2A 1JR0D 3HS0C 5M5XB 1OXVA 5M3FB 1S5DD 1ENAA 3TP5A 2L55A 1NSNS 5A35A 4ZKCB 3ND8A 1XTCD 4A3EB 2HDLA 2B8GA 3NQTA 1K8MA 2Q8RE 3C3LA 4G7OC 4K8JA 3BG3A 4HAEA 2F0HA 1EY4A 2HQEA 2A6ED 4CBVA 1O7LA 5IGEA 1PFBA 4M1UB 4IUNA 5C3XA 1F77A 1RJTA 2HCIA 1MD2D 1CK1A 2EZVA 3GTLB 4K14A 4Z9CB 3NSWA 3NXWA 5LL6X 3U9SA 1HUMA 4F7XA 4HEDA 1SYBA 1B1ZA 1EYCA 2L11A 1RDPD 4KY7A 1G291 3FMCA 3PIP3 1LTGD 1LV9A 3HOVB 1IKLA 2A6HC 5C0XI 2K28A 1TVXA 1QILA 1F9SA 1STNA 2KJXA 3MFYA 1KLGD 1DONA 3PIO3 2F0JA 4A3BB 1MSHA 1H9RA 4R9WA 3M85A 1H9SA 2JA7B 1AP0A 1NR2A 2F0OA 2ZT9C 4EQNA 3I91A 4ZK9B 4IZ8A 4XQNA 1RHPA 4UAIA 4B9XA 4XXEA 2WKCA 2BDNA 1D6EC 3K5OA 4S3SA 5KYIA 3J7AF 1B9NA 4MIUA 1D1IA 1KLUD 3GQBA 3E5SA 5CV5A 4C2MB 3S1QB 5KNCA 5DEHA 3JAML 3PO2B 4JK1C 5FK9C 1O7YA 1SE3A 1V1PA 4ZQ3A 2EYPA 5EQ0A 4XT3B 5HGTA 3T4AC 2EXZA 2PZTA 1SDFA 1CI3M 2VNUD 4RGMA 1QE6A 3A54A 1I4QA 4IUPA 2HDMA 1O7ZA 1MSGA 2NZ1D 1MGSA 3D6WA 2EVBA 1TR5A 2IX1A 2BCOA 5EKLA 4DXFA 1SYFA 2PZWA 1EL0A 3OMCA 1JWSD 2EY5A 1L0XB 5BN4A 1V1PB 1RTOA 2R3ZA 3SXHA 1MI2A 3TP7A 4KMUC 2A6EC 3NWSA 4LJZC 1KAAA 1W6KA 5C6AA 1LTSD 3DEPA 3S9WA 1SNOA 3T53B 4IFDG 1I4GA 1ONLA 1CT1D 4HN7A 2F0UA 2LMCB 1I6VC 4BA2I 5J1ZA 1TWCB 3BYTB 5JEAH 4GZYC 3M4OB 4F87A 4DNRB 2D9UA 4WORA 3HG9A 4DGZA 2R6GA 2X69A 1SJHD 2XIWA 4XTCS 1A6XA 1TWGB 1PRTB 1HA5A 2AQ3B 3P1HA 3C46A 3EA6A 3HOWB 1HTLD 2A6HD 1JOOA 3ONAB 4QUCA 1ZYRD 2F0WA 1EYAA 3NHHA 1PDQA 3A8IE 1G8ZD 2DN8A 1DCZA 3D3RA 2WACA 1HTPA 2PMZB 3W3AA 3S2HB 3FDTA 2MUYA 4QMGA 2A74C 1SFOB 1D2BA 1RD9D 1TT2A 3MXGA 4C3IG 3Q6SA 4RA8A 1F2YA 1M8AA 1PTOF 1EIHA 2PO4A 2EJGC 2C5CA 1BO0A 1D5ZC 1Z47A 5IGGA 4HR7B 2B2YA 3BYYB 2VXWA 2K04A 2WKDA 1EU4A 1E2WA 3PUVA 2F0FA 4L8JA 2DY7A 5JOBA 3WOFA 2JSOA 1E2ZA 4Y7NB 2NWGA 3BDOA 1TS2A 1D5MC 4ZUJA 1SYDA 2IL8A 1DYQA 2F0LA 4ZAIA 1AFPA 4FO2A 1GUTA 1I4HA 3PMFA 2BA0A 3PUYA 1HUNA 3SK4A 1CTMA 2J4XA 2NBFA 4DAVA 2OEOA 2XWBB 1BNZA 5I6WA 4MHEA 3RMHA 3I73A 4IURA 1QOHA 2RKSA 2RDFA 3NBHA 2CVRA 4PNYA 1KDCA 2E2HB 2IW3A 5C3WA 4EVOA 4A3JB 2KECA 3I70A 1B53A 1WVLA 2SNMA 4R8NA 5C5LA 3URYA 4CKCA 2M2LA 1EY0A 2C9OA 3ZYYX 1YNJD 2JA5B 3NE5B 2F0EA 2O2LD 2K32A 3A8KE 1I4RA 4OO1H 2NTSA 1B4OA 1JOKA 1NUCA 4F8MA 1GHKA 5CORA 2KVMA 1EWHA 1JC7A 4LK1C 1W6JA 3JAME 4BBRB 3NBIA 5DNFA 3T51B 1ZYRC 2QILA 1LTBD 1HA6A 3MAQA 3HOXB 5IT9E 3E0JA 2IX0A 3S17B 2ZXOA 1F9PA 4FF3A 2RSOA 1EY8A 2OF1A 5CBAE 1DJRD 1V1OA 2B2TC 1KABA 1SMYC 4RCOA 3G7LA 2IX3A 4RWSC 3MXNA 1QNKA 5CC4A 5EPLA 4OL7A 1DZ1A 2EPBA 1HQMC 2JA8B 1G91A 3OIPA 2JYOA 2JP1A 5EBCA 1ILQA 1S4ZA 1R4QB 3NQIA 4J6HA 3J81L 3KF8A 5C44B 3OW7A 2N55A 3NWTA 3S16B 4J1MA 2Q8TA 3W2DA 5E3FA 1BBXC 3EJIA 2I07B 2NVQB 5IGBA 1WTWA 5JJZA 2PPBC 5FO8B 1OO9B 1F2MA 4C56C 3GV3A 2E2IB 1EY5A 2ICEC 5DM73 2H4OA 1EEFD 1Y1VB 3X3NA 2EOTA 1H9KA 1TS3A 1IL8A 1BCPB 1WCMB 4KD3A 2A5HA 4RH6A 3GTKB 4H13C 4C3JG 3I3CA 4G7ZC 2L1BA 4C3JB 1OXUA 2E75C 5K5PA 1EY9A 1SNCA 3UI2A 2WB1B 3FPPA 4OIJA 4K2KA 4KN7C 4RHRA 2BE5D 3VR6A 3NK9A 1PLFA 2RDGA 1STEA 5E4XA 2HUGA 2F0GA 1GHJA 1HPCA 3LWEA 1LT3D 1FNVA 4ILWA 1J8IA 4K8IA 1DOKA 2L5TA 2SOBA 3BDLA 2ICIA 3VA7A 3IKJA 1JICA 2D62A 1SXTA 4DK0A 4DU9A 4HCSA 4QB4A 1GOZA 1NAPA 2WAQB 1NCVA 4A3FB 3T56B 2JA6B 1CHQD 2J0TD 3EVQA 1BXTA 3MWYW 1H9SB 1M4VA 4IUTA 3A7AB 3QJYA 3C2PA 2L0CA 2L4NA 3P20A 3J7YW 3R2IA 2EJMA 1GXDC 1FNWA 1Q8IA 4ZUIA 5FLXL 2OXPA 1CZGA 1YNND 1BQQT 4HSPA 1CFMA 1AZPA 1DXMA 1TWFB 4ZLTF 3BS1A 3HOUB 3AB9A 1ET9A 4KHVA 1QJOA 1SE2A 1E0BA 2AWOA 3NTKA 2YYZA 2H1EA 3MFGA 3IL8A 1TY2A 2Q8IB 1K83B 5KIXA 5AFWA 3D6CA 5CYUA 1ILPA 4IUVA 1PFNA 5M5YB 1A2UA 1ENCA 3MC0B 3SK8A 1PTOB 2WIIB 1PXUA 3E6ZX 5IGCA 4IUUA 3I8ZA 4G57A 5A2QL 2B8FA 3MXUA 4RKBA 1A3UA 4XT1B 3R2TA 3ITPA 3HZXA 5FOBB 3K57A 1F2LA 2BDOA 2CQAA 2F1MA 4C3HG 5C3EB 5IIFA 5IT9L 5M9OA 1U4LA 3NPPA 2K5DA 4KY6A 1VMPA 2XRSD 5FLXE 2MHVA 2L9HA 4LMQD 3MVVA 3J7AV 1UAPA 4ZYSA 5BN3A 3H3VC 1OXXK 3S2DB 4ABNA 3GTPB 2K01A 3I90A 1KTKA 1FYCA 1FD7D 4X3TA 1GUGA 1K8OA 2MGSA 4KTAA 5IGFA 5EKIA 2F03A 2WV6D 2G9HD 3X3MA 1PFMA 2R61A 1Q12A 1YNJC 5I9OA 3BDCA 1STHA 2A68D 3DWAA 1CZWA 3K6OA 3MTSA 2QF7A 4CGYB 5J39A 2F3VA 4CJ2C 1AW7A 2NN6G 5EPKA 1Z7TA 1TIID 2K05A 3J80L 2DNEA 3GTMB 2EYFA 2O4XA 5E4WC 2F0DA 1SNDA 1Q3LA 4C3IB 4DNTB 1CHPD 4CJ1B 3OSOA 2TSSA 2F0NA 2EDGA 3M3YB 4X3UA 1HFNA 1H9MA 1JORA 3EROA 1SJED 1HXYD 1SYGA 4HMJA 1Q1BA 2RVLA 3BVZA 1KDBA 1U9RA 4BA1I 3FEWX 4CJ0B 1DOLA 1WTOA 1SMYD 1ZKOA 3D31A 1TQOA 5JPNC 5BN5A 2D5DA 4TKOB 3QG1A 2XWJB 3EFXD 1JWUD 1U4PA 2JEBI 1TKWB 1CQFA 1ESRA 2EYOA 3S14B 3BZDB 1LT6D 5D14A 1RTNA 2PQEA 4H0LC 1SNMA 4KJOA 1T5EA 2NTTA 2R93B 3OHXC 2LS01 4ID6A 5JAVA 1I50B 4PMWA 1V8QA 3R8BA 3L7ZC 4K5WA 3KUPA 4XQQA 4K5VA 2FHTA 3K58A 1BDOA 1STGA 3H91A 3L9AX 3J80E 2KOLA 1STYA 1D5XC 3VYSA 3NUCA 3RUZA 4IUQA 5CMDA 2WINB 5J22A 1A3VA 4EGVA 2EY2A 1PTOC 3SVMA 2XVSA 1B44D 5JVG3 5KNBA 1X3PA 3QB3A 3HKZB 5M5WB 5JEAJ 4FYDA 4LAAA 2QEJC 2EYLA 5ELCA 4JBWA 2BE5C 2JEAI 2NN6H 2B2UC 5NUCA 4CKBA 2Z4IA 4RGNA 1WTVA 1UUPA 3KLRA 1TWAB 2PYKA 3IFDA 4UDUC 4R8IA 1STBA 3G6JB 1JQYD 3FKIB 2MPMA 1QG7A 2F0TA 4ZKBB 5K36G 1L0YB 1VMCA 4FF1A 3IAYA 2CHBD 5E1FA 1NR4A 3DEOA 4M8AA 3WOEA 4WRDA 2QDBA 4RAUC 2ZXPA 1ML0D 4KKSA 2A68C 2R92B 1AN8A 1Q90A 2V4DA 2LFNA 3GD7A 4DAPA 3AMUA 1XX8A 2EYJA 4G7HC 4IFDI 4IFDH 4K6LA 4C1NK 5I6YA 3Q24A 5CV8A 1A3TA 4F88A 1Y69U 3KBXA 3P75A 4I7ZC 1TY0A 1BOSA 3H0GB 3CU7A 4TQUS 1YNNC 4HMIA 3TSSA 1XXGA 2FINB 2XNAC 4O42A 4K2LA 2KEDA 3L3OC 3HOYB 1CA6A 2RA4A 1ET6A 4B9WA 3DHQA 3GTQB 2E76C 1LTRD 3S1MB 1O78A 4OGQC 2IJ0A 3RLFA 2B2YC 2XRQD 3GTOB 2NN6I 4BY1B 2VB3X 4H7BA 3DMUA 3TZUA 4KY5A 1A2TA 1PZKD 3I4MB 4FXGC 3MA2B 1CQVA 4FXDA 3O13A 3PUZA 1KDAA 3SE0A 3BVMA 1PZJD 3ND9A 2K5WA 3FPUB 1Y8PB 5C0XJ 1EWCA 4WJWA 3R3OA 4KJNA 5I2YA 3LX0A 5EJWA 4KKTA 1VF7A 3RZDB 2NVTB 4IN3A 1HRJA 1ICWA 4RKLA 1B2TA 1FGBD 1U4MA 2E2JB 1TWHB 1ESFA 2X6GA 2JE6I 4BWGB 2F0KA 1EFID 5M3MB 3OWFA 3OOCA 2GA4B 1I3QB 2KCNA 5EKKA 5F2DA 3MEHA 1EQTA 5COYA 2PCFB 3BVGA 4K6DA 5D65A 1R9TB 2NYZD 4RGOS 3SK6A 1AZQA 1LTAD 2AUKA 3DM1A 4U68A 2CW0D 4RGTA 2B63B 3VYRA 1LT4D 2FMCA 4BY7B 3AU7A 2F0PA 3I4LA 1IYUA 1S5BD 3Q22A 2O5IC 2YU9B 2QKIC 1C4QA 2PZUA 3PUXA 3U9OA 5KGUA 2KQ3A 5T1IA 2MJ8A 3VR2A 1RKNA 4TSSA 3K0YA 1WD0A 4CHTB 5KRUA 2ENBA 4OO1G 1BCPF 2XSCA 3A56A 5G3LD 4BBSB 4H44C 2F0SA 4CKEA 4DAYA 1LABA 5C0XH 2WP8J 2I46A 5KEEA 3VR4A 4WFN3 1WD1A 1EY6A 1DOMA 1QNUA 5CGKA 1S5ED 3HRZC 2BA1A 2TMPA 3VR3A 2NUCA 5ELDA 3TN2A 1TS4A 1KNEA 2PW5A 4QF4A 3V96A 1EYDA 2Y0SB 1BCPD 1LO5D 3S1NB 5JVH3 1FNUA 1HQRD 1KNAA 5JPMC 5JEAG 3DWQA 1IW7C 4L63B 3SK5A 3PO3B 5IGDA 5KNDA 1PTOD 2J7ZA 4XYOA 4XYQA 1LT5D 1J9OA 3CQZB 1S5FD 1VDZA 1LLRD 3P7JA 5LHY1 1PTOH 2F0QA 5EGTA 4TRDA 3D8GA 1A15A 3M7GA 1GJXA 4XQJA 2ZXRA 4K5XA 2E2DC 1C8CA 2KCCA 3OIQA 5ELEA 3SHLA 1G2SA 4A3DB 2BOSA 1BF4A 2RBMA 2SDFA 2EJFC 2QCPX 1XWEA 3GTJB 1SBBB 1B9MA 4X3KA 2LY7A 1EIGA 4DFAA 2FMMA 4B08A 3N6RA 1JWMD 2RQXA 1GUNA 2AWNA 1F9RA 2B2TA 1SNQA 2B2VA 4ZRZA 1B3AA 2K03A 3KK7A 4RCNA 1EZ6A 2O5JC 2FFKB 3QOLA 1PRTC 3K5LA 4DA2A 2N88A 4J8QA 4KD4A 1UEAB 3MXPA 2KUMA 2K6AA 4A3KB 3TMEA 3NTIA 4DF7A 4KK7A 1IHZA 3DWPA 3ERQA 5C4HA 1JE4A 5D3IB 3LWUA 4PQXA 4XIGS 4DK1A 2L12A 1T5XD 3D4WA 1VCIA 5I4DA 1G2TA 4KHZA 1U4RA 1SNPA 2XN9C 4P2CB 5HURA 1DM0B 1RODA 5C4JB 1GUOA 4V0BA 5CV9A 4NMZA 2F3WA 1HHVA 3WDNA 2KEEA 2Z4HA 2F0IA 5EPJA 1HFGA 5I2XA 3Q23A 4QUFA 1LTTD 1JCKB 1ENFA 4KKUA 5IODA 2F0MA 3VR5A 5G3LF 4IFDJ 3GP7A 3T13A 2FJ2A 3D4RA 5ELBA 4OO1I 3VA5A 3K5MA 2F4IA 5CBEE 2Z1CA 2IPKD 4FP5D 3MZ5A 3LNNA 3KBGA 3GO5A 3OWEB 4KV6A 4Q5VA 1EY7A 3Q0AA 1PZID 1EQVA 5KYLA 4X3SA 4Q0FA 1JB3A 3A7LA 2PW7A 3C1FA 1Z6HA 3RZOB 5FKAC 4DN4M 3GV6A 5CR3A 1I4XA 4ODGA 3TP6A 2ID0A 4A93B 2PNRC 1I4PA 1EZ8A 3HGBA 3OMGA 5C4ZA 3M7NA 3K59A 1SE4A 4N9PA 1IYVA 4QCLA 2Z8LA 2CW0C 1Q1EA 3TBIB 1PMRA 4EQOA 1SEBD 1WTRA 3CRLC 1LTID 4OIKA 1I6HB 2NB0A 2NVXB 4YIJA 3CKIB 1EOTA 3A8JE 4IALA 2LKVA 1H9JA 1S5CD 2A69C 2K5QA 4N9TA 1D1KA 3DUZA 2EE1A 5T1GA 1BUVT 1SAPA 4FNFA 3S15B 3FRPB 5DAUA 4FF2A 3A55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT F;  1TS5 A;  1KTK A;  4C56 C;  3URY A;  4RHS A;  1BCP F;  1PYW D;  1LT6 D;  1FD7 D;  1D5Z C;  1PRT D;  2RDH A;  1AN8 A;  3GP7 A;  1SBB B;  1V1P B;  2O2L D;  3BYY B;  1EEF D;  3CHB D;  2NTT A;  5ELB A;  1EEI D;  2AQ1 B;  4RFB A;  1FGB D;  1TS3 A;  1BCP B;  1ESF A;  1JR0 D;  1JWM D;  4K6L A;  1I4R A;  4RH6 A;  1S5D D;  2NTS A;  1ET9 A;  3R8B A;  2IPK D;  4BWG B;  1SE2 A;  1EFI D;  3SEB A;  2WV6 D;  2G9H D;  3OWE B;  1EU4 A;  1LTS D;  3MFG A;  2R61 A;  1TY0 A;  1TY2 A;  1XTC D;  1S5E D;  1D6E C;  1PZI D;  5D3D A;  3TSS A;  1D5X C;  1XXG A;  1I4G A;  3DWA A;  1PRT C;  5ELD A;  2XNA C;  1KLU D;  1CT1 D;  4RHR A;  3BVG A;  1TS4 A;  2QIL A;  1AW7 A;  1RF2 D;  2RDG A;  1LTB D;  2SEB D;  3MC0 B;  4RGO S;  3V05 A;  1STE A;  3BYT B;  5FKA C;  1PTO B;  4OHJ A;  1LTA D;  1TS2 A;  1ET6 A;  1PTO C;  1D5M C;  1I4X A;  1B44 D;  1BCP D;  1LO5 D;  5ELF A;  4RGT A;  1CHP D;  1LTR D;  1UNS A;  1DYQ A;  1FNU A;  1DJR D;  1I4P A;  1SJH D;  1LT3 D;  1LT4 D;  5FK9 C;  1FNV A;  1V1O A;  2TSS A;  1HQR D;  4RCO A;  1SE3 A;  2IJ0 A;  1I4H A;  2QEJ C;  3DWP A;  1PRT B;  1HA5 A;  1V1P A;  1F77 A;  3DWQ A;  5D3I B;  5ELC A;  2XRQ D;  4L63 B;  2AQ3 B;  3R2T A;  1MD2 D;  1CK1 A;  2J4X A;  1SE4 A;  1EU3 A;  3EA6 A;  1HTL D;  1SJE D;  1HXY D;  4Z9C B;  2ICI A;  1PTO D;  1T5X D;  1S5B D;  2Z8L A;  5I4D A;  4O1N A;  1BCP C;  1PZK D;  3BVZ A;  3KLS X;  2AQ2 B;  1SXT A;  4RGN A;  2XN9 C;  1G8Z D;  1UUP A;  1SEB D;  4RGM A;  1CQV A;  1LT5 D;  1GOZ A;  3O13 A;  4UDU C;  1S5F D;  1LLR D;  1B1Z A;  1LTI D;  4DXG A;  3BVM A;  1PZJ D;  1I4Q A;  3BZD B;  1JQY D;  1PTO H;  1RDP D;  1RD9 D;  1CHQ D;  1L0Y B;  2XRS D;  1S5C D;  1BXT A;  1LTG D;  1RCV D;  4TSS A;  2CHB D;  1M4V A;  5TSS A;  4ZYS A;  1LTT D;  3EFX D;  1JWU D;  1PTO F;  3W2D A;  4L6T B;  1JCK B;  4DXF A;  3R2I A;  1QIL A;  1EWC A;  5ELE A;  1ENF A;  1KLG D;  1FNW A;  1JWS D;  1L0X B; 
#chains in the Genus database with same CATH topology
 1PRT F;  2X6L A;  4C3H B;  1R4P B;  2CCZ A;  4FF4 A;  4RHS A;  3HOV H;  1PYW D;  1PRT D;  2KHJ A;  1MIU A;  4KN4 C;  2R7D A;  4X65 L;  1XNR L;  1SYC A;  2DUD A;  3TRZ A;  5C4X B;  4BS9 A;  1EEI D;  4RFB A;  2JA6 H;  2UUC Q;  1V9P A;  4PZ7 A;  4ME5 A;  1DD2 A;  1KAW A;  3TZD A;  1C48 A;  3QO2 A;  5CV4 A;  1B50 A;  2B2W A;  4Y52 H;  3SEB A;  4DR2 Q;  5DM6 3;  5C44 H;  3RZD H;  1VQM A;  4AYB E;  1CKN A;  4GN3 B;  5D3D A;  5H1S E;  3K8A A;  2MP1 A;  5CV7 A;  3H94 A;  3W5O A;  2E74 C;  2ALY B;  1FJG L;  2B39 A;  2GVA A;  2D2C C;  1WTX A;  2B2V C;  3PO2 G;  1IKM A;  4G4K A;  1G6Z A;  2I5H A;  1O80 A;  3VYU A;  3J81 E;  1OXS C;  3V05 A;  2SEB D;  1GUW A;  1QWY A;  4E6I A;  4OHJ A;  5ELF A;  3HP3 A;  5ISR A;  5IYB H;  2EY6 A;  1E2V A;  2IWH A;  5FLM G;  3K7A B;  1Y8N B;  4JYA Q;  1QVG A;  3QIA A;  2ZTC A;  4OWT B;  1SSO A;  5A2Q E;  1WTP A;  1MBY A;  1B3Q A;  5IOC A;  3TDQ A;  4AYB B;  2M9V A;  4ULL A;  4B3T Q;  4EQP A;  3CQZ H;  2AUJ D;  1VS0 A;  4HTH A;  3UE0 A;  1BCP C;  2AQ2 B;  3RLO A;  3CAM A;  4A3I B;  1GVP A;  4FXK C;  1TU2 B;  2HCC A;  5BR8 Q;  5FO9 B;  1F9Q A;  2IHE A;  4XDX A;  4C1N I;  4U67 3;  2JA6 G;  3EQL C;  4OEL B;  2WFW A;  1ZXT A;  1K73 C;  2JQO A;  1IW7 D;  2RCN A;  3KF6 B;  3M4Y A;  1YJW A;  2K33 A;  4NP5 A;  2SNS A;  2NVY B;  2JXM B;  1IBK Q;  5JJL A;  1STA A;  5LL6 S;  1JOQ A;  1Y1W H;  1HCZ A;  2IHF A;  4V19 0;  4LUV A;  4L6T B;  2M00 A;  3FVQ A;  3H6M A;  4BY1 H;  1Y8O B;  3PUW A;  4PV1 C;  3UDI A;  3R93 A;  4A3D G;  4OWX B;  3CCM A;  2KA7 A;  3CRK C;  4A3L H;  3S1R B;  5IE8 A;  3L2P A;  3D4D A;  1GUS A;  1PYS B;  3OPO A;  2UUC L;  3CHB D;  1NTG A;  5C5M A;  2AQ1 B;  1V1Q A;  2Z9H A;  1F2Z A;  5EBD A;  1BR9 A;  4IJH A;  3HKZ E;  1AE2 A;  3HEJ A;  2B2U A;  3MHB A;  5FLX c;  1JJ2 A;  3HOX H;  1WTQ A;  1WI5 A;  3STB D;  4WJ3 M;  3N52 A;  4DR3 L;  2RSN A;  4P75 A;  1QCB D;  2XGT A;  1LAC A;  5L37 A;  4GKK Q;  3V2T A;  3VYT A;  3TP8 A;  2CH4 W;  1X32 A;  4FVM A;  1PH7 A;  4PMC A;  5I9P A;  4A3G B;  1Y1W B;  4JI1 Q;  2A73 B;  5C0X G;  4LFA L;  1OXT A;  2OTL A;  4LUZ A;  1RF2 D;  3I72 A;  4L5Q A;  4X62 Q;  1QB5 D;  1EQQ A;  3NTH A;  1QZH A;  3GTJ H;  3C1E A;  4KI0 A;  2PI2 A;  2Y0S G;  1GKH A;  2DY8 A;  1UNS A;  3I55 A;  1VQI A;  5CV6 A;  3HOZ B;  1XYI A;  2R7Z H;  3F2U A;  2K1B A;  4NKL A;  2G9D A;  1SYE A;  1UE6 A;  1BVS A;  2A69 D;  1TXY A;  2K7V A;  2VUM B;  3GTG B;  3H09 A;  4B3T L;  4JI0 L;  2F0V A;  3NP8 A;  4X66 Q;  1EU3 A;  4A3L G;  4OXP A;  4DV2 Q;  1X3Q A;  2KHS A;  1AEX A;  3SDZ A;  3PV0 A;  4O1N A;  2QW7 A;  1Y1V G;  3FHW A;  5K36 H;  2B2W C;  3KLS X;  1CA5 A;  1ZEQ X;  5C4J H;  1II3 A;  2F4V Q;  2PQA A;  4DV0 Q;  2EY1 A;  2IT1 A;  4NDX A;  4A3M B;  4CDF C;  4DXG A;  2VB2 X;  3QOJ A;  4IQZ A;  4BY7 G;  1U0L A;  3M4P A;  1L1O B;  4MN3 A;  2JA5 G;  2MO1 A;  4QGU A;  3K5N A;  2EYH A;  3F2C A;  4NXN Q;  5IP9 H;  2OT2 A;  5FO7 B;  3RD4 A;  1RCV D;  1V43 A;  3T16 A;  3F2D A;  1CM9 A;  2WAQ E;  3IFT A;  5TSS A;  1H95 A;  1PH1 A;  4JBK A;  1FR3 A;  4AQY L;  2HHH Q;  2K75 A;  4QIW B;  3KLS A;  4JCV E;  4A93 G;  1HR0 W;  4HIK A;  2R7Z B;  4HSV A;  4DPG A;  1XNQ L;  1MHW C;  1TS5 A;  2AKW B;  1VF5 C;  2BH8 A;  2RDH A;  4HCE A;  3DXJ C;  3I4N B;  4I65 A;  2EYM A;  4PMB A;  1QUQ A;  4DR5 Q;  2DNC A;  3QWN A;  2KEN A;  3SR1 A;  4NW2 A;  4CDC C;  4JI6 L;  2KCM A;  1YJ9 A;  1Q86 C;  2K5V A;  1JR0 D;  2MFI A;  3HS0 C;  1FGU A;  1OXV A;  5M5X B;  5M3F B;  1E1T A;  1S5D D;  5C3E H;  1ENA A;  3TP5 A;  4JI4 L;  2B29 A;  2L55 A;  1NSN S;  5A35 A;  2MNA A;  2C35 B;  1FVI A;  1YNX A;  4ZKC B;  3ND8 A;  3J7A 5;  1XTC D;  4JI2 L;  2ZTD A;  4A3E B;  5JJI A;  3GTG H;  2HDL A;  4JW0 A;  1FL0 A;  4LFA Q;  2PNH A;  2B8G A;  3NQT A;  1K8M A;  2Q8R E;  3C3L A;  4G7O C;  4J15 A;  4K8J A;  1M90 C;  3BG3 A;  4HAE A;  2F0H A;  1QZG A;  1N32 Q;  1EY4 A;  1A8V A;  2A6E D;  2HQE A;  1NJI C;  4CBV A;  1O7L A;  1YI2 A;  2JA9 A;  3BZK A;  1PH5 A;  1FJG Q;  3KDF B;  5IGE A;  3HOV G;  1PFB A;  4M1U B;  4WJ4 A;  4IUN A;  3J80 c;  1GD7 A;  1OTC A;  4MTN A;  5C3X A;  1F77 A;  4A93 H;  1RJT A;  2OTJ A;  2HCI A;  1MD2 D;  1CK1 A;  2EZV A;  5C44 G;  3GTL B;  3HOW H;  4A3B H;  4K14 A;  4Z9C B;  4DV6 L;  3NSW A;  3NXW A;  5LL6 X;  3U9S A;  1HUM A;  1VQ7 A;  4F7X A;  2R92 H;  4HED A;  5GRO A;  1SYB A;  2K5N A;  1B1Z A;  2AMC B;  1UE5 A;  1EYC A;  4P73 A;  2L11 A;  1RDP D;  4OON A;  4KY7 A;  1J5E Q;  1G29 1;  1YVC A;  1E7Z A;  3FMC A;  3T1Y L;  3PIP 3;  1LTG D;  3PO2 H;  1LV9 A;  1EYG A;  3U4Z A;  1IKL A;  2A6H C;  3HOV B;  1Y1V H;  2K28 A;  5C0X I;  1TVX A;  1QIL A;  1F9S A;  1STN A;  3I56 A;  2KJX A;  3MFY A;  2I0Q A;  1MKH A;  1KLG D;  1BKB A;  1DON A;  3PIO 3;  4DV4 Q;  1VQF A;  2F0J A;  4A3B B;  1XJV A;  3LGJ A;  1MSH A;  1X54 A;  1H9R A;  4R9W A;  3M85 A;  3G6E A;  2CWP A;  1H9S A;  1YJN A;  1W3S A;  2JA7 B;  1AP0 A;  3CW2 C;  1NR2 A;  2F0O A;  2ZT9 C;  4KHP L;  4EQN A;  3I91 A;  4ZK9 B;  4IZ8 A;  4DV1 L;  5FJ8 H;  4XQN A;  1RHP A;  1HNZ L;  4UAI A;  4B9X A;  4XXE A;  2WKC A;  2BDN A;  1D6E C;  3CCS A;  3EN2 A;  3K5O A;  3W1B A;  4S3S A;  2XTI A;  1C9O A;  5KYI A;  5M3F G;  3J7A F;  1B9N A;  4O2D A;  4MIU A;  3S15 H;  1D1I A;  1KLU D;  3GQB A;  2K14 A;  1PA6 A;  3ULL A;  5IYC G;  1K9M C;  1N9W A;  3E5S A;  5CV5 A;  4C2M B;  3S1Q B;  5KNC A;  5DEH A;  3JAM L;  3ERS X;  3PO2 B;  1BBW A;  3A0J A;  3I2Z A;  4JK1 C;  1S40 A;  5FK9 C;  1O7Y A;  1SE3 A;  1V1P A;  2KBN A;  4ZQ3 A;  4A3I H;  1SRO A;  4DR7 L;  2EYP A;  4JI7 L;  5EQ0 A;  4C3I H;  4XT3 B;  5HGT A;  3T4A C;  2EXZ A;  2PZT A;  2UUA Q;  1SDF A;  1CI3 M;  1PFS A;  2VNU D;  1AH9 A;  4RGM A;  4YHH Q;  2VL6 A;  1WOC A;  1QE6 A;  2DJF C;  4BBR G;  1VQB A;  5GAD C;  3A54 A;  1YIT A;  1I4Q A;  4IUP A;  3DM3 A;  2HDM A;  2QGQ A;  1O7Z A;  1MSG A;  2NZ1 D;  1MGS A;  1DGS A;  1O7I A;  1XTD A;  3D6W A;  2A1A A;  2EVB A;  1TR5 A;  2IX1 A;  2BCO A;  4LF4 L;  1NY4 A;  1YEZ A;  2JK8 A;  1N33 L;  5EKL A;  4DXF A;  1SYF A;  2PZW A;  4DV4 L;  4LFB L;  1EL0 A;  3OMC A;  1JWS D;  2EY5 A;  1L0X B;  5BN4 A;  3U50 C;  1V1P B;  1RTO A;  2R3Z A;  4A3C H;  3SXH A;  1S3O A;  4C2M H;  1MI2 A;  3H3V H;  2WAQ G;  1L2F A;  3L0O A;  3TP7 A;  4KMU C;  2A6E C;  4CDE C;  1B70 B;  3NWS A;  4LJZ C;  3J80 i;  1KAA A;  1W6K A;  5C6A A;  4HIO A;  1LTS D;  3DEP A;  3S9W A;  5IP9 G;  1SNO A;  3T53 B;  2Q2U A;  4IFD G;  2YTV A;  1I4G A;  1ONL A;  2JA5 H;  4O0A A;  1I5F A;  1CT1 D;  4HN7 A;  2F0U A;  2UXB L;  2LMC B;  1I6V C;  4GOP A;  4BA2 I;  3J81 j;  4A3F H;  3S1R H;  5J1Z A;  1TWC B;  3BYT B;  5JEA H;  4GZY C;  2EQS A;  3M4O B;  4F87 A;  4DNR B;  2D9U A;  4WOR A;  3HG9 A;  4DGZ A;  3RNU A;  2R6G A;  3KFU A;  2X69 A;  1SJH D;  2XIW A;  4JI8 Q;  1EWI A;  4XTC S;  2ZJR A;  2KCT A;  1A6X A;  1TWG B;  4DR7 Q;  1PRT B;  1HA5 A;  1I50 H;  2ZJQ A;  2AQ3 B;  3P1H A;  3C46 A;  3EA6 A;  3HOW B;  1HTL D;  2WB1 G;  2A6H D;  1JOO A;  5IYC H;  3ONA B;  4B3M Q;  4QUC A;  1ZYR D;  2F0W A;  1EYA A;  3NHH A;  5C3E G;  4DUY Q;  5M5W H;  1PDQ A;  3A8I E;  1G8Z D;  2DN8 A;  3DLL A;  1DCZ A;  3D3R A;  2WAC A;  1HTP A;  5FLM H;  2PMZ B;  3W3A A;  3S2H B;  4JV5 Q;  3FDT A;  2MUY A;  4QMG A;  2A74 C;  2QA4 A;  1SFO B;  1D2B A;  1RD9 D;  4A3M H;  1N32 L;  4YWL A;  2R93 G;  1TT2 A;  3MXG A;  4C3I G;  3Q6S A;  4LNQ A;  1A0I A;  4P71 A;  4RA8 A;  1F2Y A;  2CFM A;  4LF5 Q;  1M8A A;  1PTO F;  1EIH A;  3W1G A;  2HT1 A;  3KJP A;  3ULP A;  1LUZ A;  3OYY A;  3CCU A;  2PO4 A;  2EJG C;  4LF9 L;  2C5C A;  1BO0 A;  2YU9 H;  1D5Z C;  1Z47 A;  2WB1 E;  3HKS A;  5IGG A;  4HR7 B;  2B2Y A;  3CCR A;  1P8L A;  3BYY B;  2VXW A;  2K04 A;  2WKD A;  4IOC A;  2AHO B;  2P5Z X;  4A3E H;  3UDF A;  1EU4 A;  1E2W A;  2VQE L;  3PUV A;  4JI5 L;  2F0F A;  4L8J A;  2DY7 A;  4R4T A;  4N8X 1;  5JOB A;  3WOF A;  2JSO A;  1E2Z A;  1K3R A;  4L5R C;  4HJ5 A;  4Y7N B;  1N36 Q;  3HOX G;  2NWG A;  1WJJ A;  1TS2 A;  3BDO A;  1D5M C;  4ZUJ A;  1SYD A;  2IL8 A;  1DYQ A;  2F0L A;  4ZAI A;  1AFP A;  4FO2 A;  1GUT A;  1I4H A;  2MQH A;  3PMF A;  1PV4 A;  2CQO A;  2BA0 A;  3PUY A;  1HUN A;  4NPS A;  3SK4 A;  1CTM A;  2J4X A;  2NBF A;  1SR3 A;  4DAV A;  2OEO A;  2XWB B;  1BNZ A;  5I6W A;  3VDY A;  3HOZ H;  4P74 A;  1K28 A;  4MHE A;  3RMH A;  3I73 A;  4IUR A;  5FJ8 G;  3RN2 A;  1QOH A;  2RKS A;  3F8T A;  1UEB A;  2RDF A;  3NBH A;  2CVR A;  4PNY A;  1KDC A;  2E2H B;  4UY8 C;  3TS2 A;  1D7Q A;  2IW3 A;  5C3W A;  4GNX A;  4EVO A;  4A3J B;  2BH2 A;  2KEC A;  3I70 A;  1B53 A;  4X66 L;  1XMQ Q;  1WVL A;  5JJK A;  4DKA C;  2SNM A;  4R8N A;  5C5L A;  3URY A;  4CKC A;  2M2L A;  1EY0 A;  2C9O A;  3ZYY X;  5LMU L;  1YNJ D;  2JA5 B;  4DR2 L;  3NE5 B;  4B3S L;  2F0E A;  2O2L D;  2NVY H;  2H5X A;  2K32 A;  3JC6 6;  3A8K E;  1EIY B;  1I4R A;  4OO1 H;  2NTS A;  1IXR A;  1B4O A;  4DV7 Q;  3AFP A;  1JOK A;  1NUC A;  4F8M A;  2CH4 A;  1GHK A;  5COR A;  2KVM A;  4L5T A;  3AEV A;  4POF A;  2JA7 H;  4LF7 Q;  1EWH A;  1JC7 A;  4LK1 C;  1W6J A;  3JAM E;  4RG1 A;  4BBR B;  1HNX Q;  3CC2 A;  2N3S A;  3NBI A;  5DNF A;  1N33 Q;  3T51 B;  1ZYR C;  2EXD A;  2QIL A;  4PG3 A;  4HJ9 A;  1LTB D;  1G51 A;  4DR1 L;  1HA6 A;  3MAQ A;  3HOX B;  1Z9F A;  4LW1 A;  3UDX A;  5ELO A;  5IT9 E;  3E0J A;  2IX0 A;  3S17 B;  2ZXO A;  1F9P A;  3TEH B;  4FF3 A;  2RSO A;  1EY8 A;  1JJG A;  2OF1 A;  5CBA E;  1DJR D;  4POG A;  1V1O A;  2B2T C;  1KAB A;  1SMY C;  4RCO A;  4C3J H;  5BR8 L;  3G7L A;  1JB7 A;  2IX3 A;  4RWS C;  3MXN A;  2A8V A;  4DNI A;  1QNK A;  3F1Z A;  5CC4 A;  5EPL A;  4OL7 A;  3HOY G;  1X3E A;  1DZ1 A;  2EPB A;  3RN5 A;  1HQM C;  1WCM H;  1JE5 A;  2JA8 B;  1YZ6 A;  1G91 A;  3OIP A;  2JYO A;  2JP1 A;  5EBC A;  4HJ8 A;  1ILQ A;  1S4Z A;  3GTL H;  3KDF A;  1R4Q B;  3PF4 A;  1J6Q A;  2UXB Q;  3NQI A;  1YHQ A;  4J6H A;  3KF8 B;  3J81 L;  3KF8 A;  5C44 B;  3OW7 A;  1PYB A;  5C4X G;  2N55 A;  3NWT A;  4DUY L;  1PH3 A;  4J1M A;  3S16 B;  2Q8T A;  1XMQ L;  1G6P A;  3W2D A;  1GO3 E;  5E3F A;  1BBX C;  3EJI A;  2I07 B;  3S2D H;  5IGB A;  2NVQ B;  4JI8 L;  1WTW A;  5JJZ A;  5M3M H;  2PPB C;  5FO8 B;  1OO9 B;  1F2M A;  4C56 C;  3GV3 A;  2E2I B;  1EY5 A;  2ICE C;  5DM7 3;  1KQS A;  2H4O A;  4OX9 Q;  1EEF D;  1Y1V B;  3OTO L;  1VQL A;  3X3N A;  2EOT A;  4BXX H;  1H9K A;  1TS3 A;  2QEX A;  1IL8 A;  1BCP B;  4X65 Q;  1WCM B;  4KD3 A;  4DV7 L;  1XNR Q;  4JI0 Q;  2A5H A;  4RH6 A;  3GTK B;  3EBE A;  4H13 C;  4C3J G;  1K0S A;  3I3C A;  4G7Z C;  2L1B A;  3U58 A;  4C3J B;  1OXU A;  2E75 C;  1HR0 Q;  4DV2 L;  5K5P A;  1XMO L;  1KD1 C;  1EY9 A;  3S17 H;  1SNC A;  1VQ5 A;  3UI2 A;  1Q82 C;  2WB1 B;  1HZC A;  3FPP A;  3FKI G;  1CSQ A;  3PQI A;  4OIJ A;  4K2K A;  4BY7 H;  4KN7 C;  4RHR A;  2BE5 D;  2R7F A;  3VR6 A;  3NK9 A;  1PLF A;  2RDG A;  5IWA Q;  4LF9 Q;  1STE A;  5HY6 A;  1X56 A;  3PSI A;  5E4X A;  2HUG A;  2F0G A;  1GHJ A;  4X64 L;  4JI3 Q;  1QVF A;  1HPC A;  1SN8 A;  3LWE A;  3HKZ G;  1LT3 D;  4BBS H;  1FNV A;  4ILW A;  1IZ6 A;  4EQ5 A;  1J8I A;  4A3J H;  1E24 A;  4K8I A;  1DOK A;  2L5T A;  1B8A A;  2SOB A;  3BDL A;  2ICI A;  4AIM A;  3VA7 A;  3IKJ A;  1JIC A;  2D62 A;  4QIW E;  4DV5 Q;  1SXT A;  4DK0 A;  5AJ3 Q;  4DU9 A;  1SRU A;  4HCS A;  3TS0 A;  4QB4 A;  1GOZ A;  1NAP A;  2WAQ B;  4GN4 B;  5IP7 H;  1NCV A;  4A3F B;  3T56 B;  4MZ9 A;  1AE3 A;  4AH6 A;  5IYD H;  2JA6 B;  4LF6 L;  1CHQ D;  2RHS B;  4A3I G;  2J0T D;  3EVQ A;  1BXT A;  3MWY W;  1H9S B;  1M4V A;  4IUT A;  3A7A B;  3QJY A;  3C2P A;  2L0C A;  2L4N A;  3P20 A;  3J7Y W;  4PZ8 A;  3R2I A;  2EJM A;  1SLJ A;  4JI7 Q;  1GXD C;  1FNW A;  1Q8I A;  4ZUI A;  5FLX L;  1L1O A;  2OXP A;  3BU2 A;  1CZG A;  1YNN D;  2ZM6 Q;  1BQQ T;  4HSP A;  2NVX H;  1CFM A;  5C4X H;  1AZP A;  1DXM A;  1TWF B;  2YTX A;  4ZLT F;  3BS1 A;  3HOU B;  3HOW G;  3AB9 A;  1T9H A;  1ET9 A;  4KHV A;  2RCF A;  1QJO A;  1SE2 A;  1E0B A;  3JAM c;  2AWO A;  1SFO H;  3NTK A;  4LF8 L;  2YYZ A;  3K0X A;  4UP7 A;  3K7A H;  2H1E A;  2OQ0 A;  3MFG A;  2R92 G;  3IL8 A;  1TY2 A;  2Q8I B;  1K83 B;  5KIX A;  5AFW A;  3D6C A;  5CYU A;  4JG2 A;  1HZ9 A;  1BBU A;  1ILP A;  5IY0 A;  1KXL A;  4IUV A;  4R1J A;  2F3I A;  2R7Z G;  1PFN A;  5M5Y B;  4DUZ Q;  3ER0 A;  1A2U A;  2JA8 H;  3GTQ H;  1ENC A;  3MC0 B;  1VQK A;  3SK8 A;  1PTO B;  2WII B;  1PXU A;  3E6Z X;  5IGC A;  4IUU A;  1UWV A;  4QY7 A;  4DR6 Q;  3I8Z A;  1NNX A;  4X62 L;  4G57 A;  4DAM A;  5A2Q L;  2B8F A;  1PH6 A;  3MXU A;  4RKB A;  1A3U A;  1TWC H;  4XT1 B;  3R2T A;  3ITP A;  3HZX A;  4GNX B;  5FOB B;  2OWO A;  2ASB A;  3K57 A;  3H15 A;  1F2L A;  2BDO A;  2CQA A;  4ZCK A;  2F1M A;  3T1Y Q;  5HGQ A;  2Z6K C;  1Q81 C;  1D8L A;  1XPO A;  1W2B A;  1N34 Q;  4IPH A;  3AQQ A;  3NBH B;  4C3H G;  5IIF A;  5C3E B;  5IT9 L;  1U5K A;  5M9O A;  1U4L A;  3NPP A;  3JAM i;  2K5D A;  4KY6 A;  4LUO A;  1VMP A;  2XRS D;  5FLX E;  2MHV A;  2L9H A;  2V1C C;  4LMQ D;  3MVV A;  2Z0S A;  4A3K H;  3J7A V;  4TVA B;  1UAP A;  1VQD A;  4ZYS A;  1ASY A;  1K8A C;  5BN3 A;  3H3V C;  4GLX A;  1OXX K;  2NVQ H;  3S2D B;  4ABN A;  4UPA A;  3GTP B;  2HHH L;  2K01 A;  3I90 A;  1KTK A;  1FYC A;  4GLV B;  3K81 C;  1R9T H;  1FD7 D;  3CD6 A;  2RHQ B;  3Q8D A;  3I4M G;  2F52 A;  1I94 L;  4X3T A;  4DR5 L;  1UE7 A;  1GUG A;  1K8O A;  2MGS A;  4KTA A;  3I7F A;  5IGF A;  2ES2 A;  5EKI A;  1VQ8 A;  3GDE A;  2F03 A;  2WV6 D;  2G9H D;  2VZA A;  3X3M A;  4OX9 L;  1PFM A;  2R61 A;  1Q12 A;  1YNJ C;  2OCE A;  5I9O A;  3BDC A;  1STH A;  5ELN A;  2L15 A;  1IBM Q;  2A68 D;  3DWA A;  4DR4 Q;  1CZW A;  3K6O A;  3MTS A;  2QF7 A;  3CPF A;  4CGY B;  5J39 A;  1HR0 L;  1XPU A;  2F3V A;  4C3H H;  4CJ2 C;  1AW7 A;  2NN6 G;  5EPK A;  1Z7T A;  1N8R C;  1HH2 P;  1TII D;  2K05 A;  4LF4 Q;  3J80 L;  3ULJ A;  2DNE A;  3GTM B;  2EYF A;  2O4X A;  4MNO A;  5E4W C;  3PO3 H;  2F0D A;  1SND A;  1Q3L A;  4A3B G;  4JYA L;  2PMZ E;  2PQA B;  4C3I B;  2VW9 A;  4DNT B;  1CHP D;  4CJ1 B;  3OSO A;  4R4C A;  3S1M H;  2K4K A;  2RF4 A;  2UUA L;  3BJU A;  4I7A A;  3S14 H;  2JN4 A;  2TSS A;  2F0N A;  1K0R A;  2EDG A;  3KLW A;  4R4Q A;  3M3Y B;  4HIM A;  4X3U A;  1NMG A;  1HFN A;  1H9M A;  1EOV A;  1K3B C;  1JOR A;  3ERO A;  1SJE D;  1HXY D;  2PI2 E;  1SYG A;  4HMJ A;  1VQA A;  3T1H Q;  1Q1B A;  2RVL A;  3BVZ A;  1KDB A;  1U9R A;  4BA1 I;  3I4M H;  3FEW X;  2VUM G;  4CJ0 B;  3CP0 A;  1DOL A;  3E9I A;  1WTO A;  1SMY D;  1ZKO A;  3D31 A;  3KYH C;  1TQO A;  4P72 A;  5JPN C;  4GNX C;  5BN5 A;  2IY5 B;  3I4N G;  1VQJ A;  2D5D A;  5IWA L;  4TKO B;  4DV5 L;  5AJ3 L;  4BBS G;  3QG1 A;  2XWJ B;  1HJP A;  3HOU G;  3IRB A;  3EFX D;  1JWU D;  1U4P A;  2N8N A;  2JEB I;  2LXK A;  1TKW B;  1CQF A;  1HNX L;  1ESR A;  2EYO A;  3S14 B;  3BZD B;  4LF6 Q;  1LT6 D;  1IL2 A;  5D14 A;  1RTN A;  4LFC L;  4DV3 L;  2PQE A;  1YHB A;  4H0L C;  1SNM A;  4KJO A;  2UXD Q;  1T5E A;  2NTT A;  3G71 A;  1VQO A;  2R93 B;  3S1N H;  3OHX C;  2LS0 1;  4ID6 A;  5JAV A;  1TWH H;  1I50 B;  1EQR A;  1C7Y A;  4PMW A;  5M3F H;  1V8Q A;  3R8B A;  3L7Z C;  4K5W A;  3KUP A;  4KLK A;  4XQQ A;  2UUB L;  2Z6K A;  2ATW A;  4K5V A;  1VQG A;  2FHT A;  2Q2I A;  3K58 A;  1BDO A;  4NB3 A;  4GKK L;  1JJC B;  4ME3 A;  1STG A;  1I6H H;  4APV A;  3H91 A;  3L9A X;  3J80 E;  4DV1 Q;  2KOL A;  5IP7 G;  1STY A;  1D5X C;  3VYS A;  3NUC A;  3D0F A;  3RUZ A;  4IUQ A;  5CMD A;  3TRE A;  2WIN B;  5J22 A;  4B3S Q;  5LMN Q;  1A3V A;  2E2I H;  1Q8K A;  4EGV A;  2EY2 A;  1PTO C;  3SVM A;  3KJO A;  2XVS A;  1B44 D;  1K8G A;  4B3M L;  3A5Z B;  1NBW A;  5JVG 3;  5KNB A;  2ZM6 L;  2K50 A;  1X3P A;  3QB3 A;  3HKZ B;  5M5W B;  5JEA J;  3GTK H;  4FYD A;  4LAA A;  2QEJ C;  4DK3 C;  1PH4 A;  2EYL A;  5ELC A;  4JBW A;  4JVZ A;  2BE5 C;  3CC7 A;  2JEA I;  3SGI A;  5GAE C;  4LF8 Q;  2NN6 H;  2B2U C;  5NUC A;  4CKB A;  2Z4I A;  4RGN A;  4YCU A;  1WTV A;  1UUP A;  3KLR A;  1TWA B;  2PYK A;  3IFD A;  4FDB A;  2ZTE A;  5DLQ E;  4UDU C;  4R8I A;  2JA8 G;  3NEL A;  1STB A;  4Y7N H;  3G6J B;  1JQY D;  3FKI B;  2MPM A;  1QG7 A;  2F0T A;  3WWV A;  3E0E A;  4ZKB B;  4DUZ L;  3MXN B;  2JJQ A;  5K36 G;  1L0Y B;  1VMC A;  4OEM B;  4FF1 A;  3IAY A;  2CHB D;  5E1F A;  1XMO Q;  4DR6 L;  2FXQ A;  1WCM G;  1HZB A;  1NR4 A;  3DEO A;  4M8A A;  2LSS A;  3WOE A;  4WRD A;  4K0K Q;  2VUM H;  2QDB A;  4RAU C;  1Q46 A;  2ZXP A;  1ML0 D;  4DV3 Q;  4IPD A;  4KKS A;  4A3M G;  2A68 C;  2R92 B;  5IT9 c;  1AN8 A;  3KF6 A;  1Q90 A;  3M4O H;  3I4O A;  2V4D A;  2LFN A;  3GD7 A;  1Q7Y C;  1CSP A;  4DAP A;  3AMU A;  1XX8 A;  2EYJ A;  1VQN A;  4G7H C;  3U4V A;  4JBM A;  4JI4 Q;  4IFD I;  4IFD H;  2D0P A;  4K6L A;  4UP8 A;  4C1N K;  5I6Y A;  3Q24 A;  5CV8 A;  1A3T A;  4F88 A;  4JBJ A;  4AYB G;  1Y69 U;  3KBX A;  3P75 A;  4I7Z C;  1TY0 A;  1BOS A;  3H0G B;  3CU7 A;  4TQU S;  1YNN C;  1M1K C;  4HMI A;  3TSS A;  4B3R Q;  4HJ7 A;  3PF5 A;  1XXG A;  2FIN B;  4OWW B;  2XNA C;  2A19 A;  4O42 A;  4K2L A;  2KED A;  3L3O C;  3HOY B;  4EX5 A;  1ICF B;  1CA6 A;  2RA4 A;  2VQF L;  1ET6 A;  1IYJ B;  4B9W A;  4RMF A;  3DHQ A;  3GTQ B;  2DJG C;  2E76 C;  1LTR D;  3S1M B;  2OQK A;  1VQH A;  3TQY A;  1O78 A;  3CMA A;  1VQE A;  4OGQ C;  1JT8 A;  1I94 Q;  2IJ0 A;  3RLF A;  2UU9 L;  3M3Y H;  2B2Y C;  4X6A H;  2XRQ D;  2HQL A;  3GTO B;  2NN6 I;  4BY1 B;  2VB3 X;  4H7B A;  3DMU A;  4YY3 Q;  3TZU A;  4KY5 A;  1A2T A;  1PZK D;  1WYD A;  3I4M B;  3J81 i;  4GN5 A;  4FXG C;  3MA2 B;  1CQV A;  1S72 A;  4FXD A;  3O13 A;  3CCL A;  2QDL A;  1CKN B;  1KDA A;  3PUZ A;  3SE0 A;  3BVM A;  1PZJ D;  3ND9 A;  3ZJY C;  2JA7 G;  4JI3 L;  4NXM Q;  1Y14 B;  2K5W A;  2VS1 A;  3FPU B;  1Y8P B;  3PO3 G;  5C0X J;  1E1O A;  4HJA A;  2HIX A;  4K0K L;  4DV0 L;  2KHI A;  1EWC A;  3CME A;  1NE3 A;  4WJW A;  3R3O A;  1L1O C;  3PGZ A;  4KJN A;  5I2Y A;  3LX0 A;  1MJC A;  5EJW A;  5IYD G;  4A3E G;  4KKT A;  1VF7 A;  3RZD B;  2NVT B;  4IN3 A;  1HRJ A;  1ICW A;  4RKL A;  1B2T A;  1FGB D;  1U4M A;  2E2J B;  1TWH B;  1ESF A;  2X6G A;  2JE6 I;  1VQ9 A;  3HOY H;  1HNZ Q;  4BWG B;  2LXJ A;  2F0K A;  3I4N H;  1EFI D;  4QL5 A;  1VQP A;  5M3M B;  3OWF A;  4DR1 Q;  3OOC A;  2GA4 B;  1YIJ A;  1I3Q B;  2KCN A;  1KL9 A;  3HOU H;  5EKK A;  5F2D A;  3BZC A;  3MEH A;  1EFW A;  1EQT A;  2Z6B A;  4JI5 Q;  4JPB W;  5COY A;  1VQC A;  2PCF B;  2NZH A;  3BVG A;  4K6D A;  5D65 A;  4HID A;  3CC4 A;  3K7U C;  1R9T B;  2NYZ D;  4RGO S;  3SK6 A;  1AZQ A;  3ICE A;  1LTA D;  2AUK A;  3DM1 A;  4U68 A;  3CF5 A;  2CW0 D;  4QJF A;  4RGT A;  2B63 B;  4DK6 C;  3VYR A;  1QVC A;  4GLA C;  1LT4 D;  4ALP A;  3HOZ G;  2FMC A;  2G5D A;  3KOJ A;  1TWG H;  4BY7 B;  3AU7 A;  2F0P A;  1CUK A;  1IBL Q;  3I4L A;  1IYU A;  4DAY B;  3OTO Q;  2YV5 A;  4YHH L;  1S5B D;  1L0W A;  3A5U A;  1UE1 A;  3Q22 A;  1P16 A;  3NEM A;  2O5I C;  2UXC Q;  2YU9 B;  1C0A A;  2QKI C;  1LM0 A;  1C4Q A;  2PZU A;  1X3G A;  5M5X H;  2YTY A;  3FKI H;  1JMC A;  3PUX A;  2Q2H A;  3U9O A;  4QQB X;  5KGU A;  2KQ3 A;  5T1I A;  2MJ8 A;  3VR2 A;  1RKN A;  1KRS A;  2GVB A;  4TSS A;  1GM5 A;  3AFQ A;  3HFZ B;  4DR3 Q;  3K0Y A;  4BBR H;  1WD0 A;  4CDD C;  1X9N A;  4CHT B;  2B63 G;  1IBM L;  1CKO A;  5KRU A;  2ENB A;  4OO1 G;  2HIV A;  1BCP F;  4UP9 A;  4X64 Q;  2XSC A;  3A56 A;  5G3L D;  4BBS B;  4H44 C;  2F0S A;  4DV6 Q;  4A3J G;  5LMU Q;  3PIP A;  4CKE A;  4DAY A;  1LAB A;  5C0X H;  2WP8 J;  2I46 A;  1HNW L;  5KEE A;  3CPW A;  3VR4 A;  4WFN 3;  1WD1 A;  1EY6 A;  1DOM A;  1QNU A;  4BXX G;  5CGK A;  4MTK A;  1S5E D;  3HRZ C;  2BA1 A;  2TMP A;  4JOI A;  2NUC A;  3VR3 A;  1HZA A;  4IOA A;  5ELD A;  2HD3 A;  3TN2 A;  2NZO A;  1TS4 A;  5LMN W;  2ZJP A;  1KNE A;  3M9B A;  2PW5 A;  1ASZ A;  4QF4 A;  3MEF A;  1RIP A;  3V96 A;  1EYD A;  1EIF A;  2Y0S B;  1BCP D;  1LO5 D;  3S1N B;  1SMX A;  5JVH 3;  1FNU A;  3E3X A;  1HQR D;  1KNA A;  5JPM C;  1QUQ B;  5JEA G;  3DWQ A;  1IW7 C;  4L63 B;  3SK5 A;  1XPR A;  3FP9 A;  1A62 A;  3PO3 B;  5IGD A;  2N78 A;  5M5Y H;  4KHP Q;  5KND A;  1PTO D;  2UXC L;  4N8F A;  2J7Z A;  4XYO A;  4XYQ A;  1LT5 D;  2UU9 Q;  2Y0S E;  1J9O A;  3CQZ B;  1S5F D;  1VDZ A;  1LLR D;  3P7J A;  5LHY 1;  3F2B A;  2E2H H;  1PTO H;  2F0Q A;  1X3F A;  1K83 H;  5EGT A;  4TRD A;  1RL2 A;  5M3M G;  3CXC A;  3D8G A;  1A15 A;  3M7G A;  4GKJ Q;  1GJX A;  4XQJ A;  2ZXR A;  2D0O A;  4K5X A;  4GOP C;  2E2D C;  4H02 A;  1C8C A;  2KCC A;  1LTL A;  3S1Q H;  4A3C G;  4JI2 Q;  3OIQ A;  4A3G H;  1TWF H;  5ELE A;  3SHL A;  1G2S A;  2CWA A;  1I3Q H;  1SE8 A;  4A3D B;  2BOS A;  1BF4 A;  2RBM A;  2SDF A;  2EJF C;  2QCP X;  2E8G A;  1XWE A;  3GTJ B;  1SBB B;  3G4S A;  4YY3 L;  1B9M A;  4X3K A;  2LY7 A;  1EIG A;  5IYB G;  4JC0 A;  4DFA A;  3H3V I;  2FMM A;  4B08 A;  3N6R A;  1JWM D;  2RQX A;  1GUN A;  5J3B A;  3UE1 A;  3S2H H;  2AWN A;  3H0G H;  4NXN L;  4A76 A;  2B63 H;  4YCV A;  1F9R A;  2B2T A;  1SNQ A;  2B2V A;  2GN5 A;  1KRT A;  4ZRZ A;  1KIX A;  1B3A A;  3PCO B;  2K03 A;  3KK7 A;  4RCN A;  1EZ6 A;  4A3F G;  4AQY Q;  2O5J C;  2FFK B;  3QOL A;  1PH2 A;  4L5S A;  1XNQ Q;  1PRT C;  3K5L A;  3RLN A;  2N88 A;  1NMF A;  4DA2 A;  3G48 A;  5GAG C;  4LFC Q;  1KC8 C;  4J8Q A;  4KD4 A;  1UEA B;  2UXD L;  1WTH A;  3MXP A;  2KUM A;  4YCW A;  2K6A A;  4A3K B;  3CCE A;  4BY1 G;  3TME A;  4YWK A;  3NTI A;  1PVO A;  1WFQ A;  3GTO H;  1Y1W G;  3S24 A;  1J5E L;  3GTP H;  4DF7 A;  4PZ6 A;  3E9H A;  2E5L L;  4KK7 A;  1IHZ A;  3DWP A;  3ERQ A;  1N34 L;  5C4H A;  5GAH C;  1PHJ A;  1JE4 A;  5D3I B;  2K52 A;  3LWU A;  4A3D H;  4PQX A;  3CCJ A;  4XIG S;  4DK1 A;  2L12 A;  1T5X D;  3D4W A;  1VCI A;  5I4D A;  1E22 A;  3M4Q A;  4KHZ A;  1U4R A;  1G2T A;  1SNP A;  2XN9 C;  3UDG A;  4P2C B;  5LMN L;  1KHI A;  3QR8 A;  5HUR A;  1DM0 B;  1VQ6 A;  4JOI C;  3AYH B;  1IBL L;  3H0G G;  1ROD A;  4GKJ L;  2MO0 A;  5C4J B;  1GUO A;  4V0B A;  5CV9 A;  1PH9 A;  4NMZ A;  2F3W A;  1HHV A;  3WDN A;  2KEE A;  2Z4H A;  1E3P A;  2F0I A;  5EPJ A;  3S16 H;  2CKZ B;  3J7Z C;  3CCQ A;  1HFG A;  4IJL A;  5I2X A;  4QUF A;  3Q23 A;  1LTT D;  4JI1 L;  2N49 A;  3CCV A;  5GQO A;  1JCK B;  5EAY A;  4JV5 L;  3RZO H;  1ENF A;  1YHA A;  4B3R L;  2VY3 A;  4KKU A;  2NVT H;  5IOD A;  2F0M A;  4A3K G;  1MJE A;  4LFB Q;  3VR5 A;  5G3L F;  4IFD J;  3GP7 A;  3T13 A;  2FJ2 A;  3D4R A;  2B3G A;  5E7N A;  5ELB A;  4LF5 L;  4R4O A;  4OO1 I;  3VA5 A;  2VQF Q;  3K5M A;  2F4I A;  5CBE E;  2Z1C A;  4DR4 L;  2IPK D;  4FP5 D;  3MZ5 A;  3LNN A;  1X6O A;  4A3G G;  3KBG A;  4IO9 A;  1B7Y B;  4IPC A;  4LF7 L;  3GO5 A;  3OWE B;  2I5L X;  4KV6 A;  4Q5V A;  1EY7 A;  3Q0A A;  1PZI D;  1EQV A;  5KYL A;  4X3S A;  3OW2 A;  3GTM H;  4Q0F A;  1JB3 A;  3A7L A;  3RR5 A;  2R93 H;  1A63 A;  2PW7 A;  3C1F A;  2K5H A;  3NEN A;  1Z6H A;  3RZO B;  5FKA C;  4DN4 M;  3GV6 A;  5CR3 A;  1I4X A;  4ODG A;  3K80 C;  3TP6 A;  2ID0 A;  4NXM L;  4A4I A;  2E5L Q;  4A93 B;  2PNR C;  3STB C;  2E2J H;  3T1H L;  1I4P A;  1LYL A;  1X55 A;  3PIO A;  1EZ8 A;  2F4V L;  3HGB A;  4LWC A;  3OMG A;  5C4Z A;  4IPG A;  1CKM A;  3M7N A;  1HNW Q;  3K59 A;  1SE4 A;  4N9P A;  4GOP B;  1VQ4 A;  4QCL A;  1IYV A;  2Z8L A;  2CW0 C;  2VQE Q;  2EIF A;  1Q1E A;  3TBI B;  1PMR A;  4A75 A;  4EQO A;  1SEB D;  1WTR A;  4UHV A;  2UUB Q;  3CRL C;  4YWM A;  1LTI D;  4OIK A;  1I6H B;  2DGY A;  2NB0 A;  2NVX B;  1X65 A;  4YIJ A;  3CKI B;  1EOT A;  3A8J E;  4IAL A;  2LKV A;  1H9J A;  1EUJ A;  1S5C D;  3J81 c;  2A69 C;  2K5Q A;  4N9T A;  1PH8 A;  1N36 L;  4GS3 A;  1YBY A;  3B6Y A;  1IBK L;  1D1K A;  3DUZ A;  2EE1 A;  5T1G A;  4JI6 Q;  1BUV T;  2Q2T A;  1SAP A;  3A74 A;  3EIV A;  4FNF A;  3S15 B;  3FRP B;  4R4I A;  5DAU A;  1TWA H;  2I5M X;  4FF2 A;  3A55 A; 
#chains in the Genus database with same CATH homology
 1PRT F;  2X6L A;  4C3H B;  1R4P B;  4FF4 A;  4RHS A;  1PYW D;  1PRT D;  4KN4 C;  1SYC A;  5C4X B;  4BS9 A;  1EEI D;  4RFB A;  4ME5 A;  1DD2 A;  3TZD A;  1C48 A;  3QO2 A;  5CV4 A;  1B50 A;  2B2W A;  3SEB A;  5DM6 3;  5D3D A;  2MP1 A;  5CV7 A;  3H94 A;  2E74 C;  2B39 A;  2D2C C;  1WTX A;  2B2V C;  1IKM A;  4G4K A;  1G6Z A;  1O80 A;  3VYU A;  3J81 E;  1OXS C;  3V05 A;  2SEB D;  1GUW A;  1QWY A;  4E6I A;  4OHJ A;  5ELF A;  3HP3 A;  5ISR A;  2EY6 A;  1E2V A;  2IWH A;  3K7A B;  1Y8N B;  3QIA A;  1SSO A;  5A2Q E;  1WTP A;  1MBY A;  5IOC A;  3TDQ A;  4AYB B;  2M9V A;  4ULL A;  4EQP A;  2AUJ D;  4HTH A;  1BCP C;  2AQ2 B;  4A3I B;  4FXK C;  1TU2 B;  2HCC A;  5FO9 B;  1F9Q A;  4XDX A;  4U67 3;  4C1N I;  3EQL C;  1ZXT A;  1IW7 D;  3M4Y A;  2K33 A;  4NP5 A;  2SNS A;  2NVY B;  2JXM B;  1STA A;  5LL6 S;  1JOQ A;  1HCZ A;  4V19 0;  4L6T B;  2M00 A;  3FVQ A;  3H6M A;  1Y8O B;  3PUW A;  4PV1 C;  3R93 A;  2KA7 A;  3CRK C;  3S1R B;  3D4D A;  1GUS A;  3OPO A;  3CHB D;  5C5M A;  2AQ1 B;  1F2Z A;  5EBD A;  1BR9 A;  3HEJ A;  2B2U A;  3MHB A;  1WTQ A;  3N52 A;  2RSN A;  1QCB D;  1LAC A;  3V2T A;  3VYT A;  3TP8 A;  4FVM A;  1X32 A;  4PMC A;  5I9P A;  4A3G B;  1Y1W B;  2A73 B;  5C0X G;  1OXT A;  1RF2 D;  3I72 A;  1QB5 D;  3NTH A;  3C1E A;  4KI0 A;  2DY8 A;  1UNS A;  5CV6 A;  3HOZ B;  1XYI A;  3F2U A;  2K1B A;  4NKL A;  2G9D A;  1SYE A;  2K7V A;  2A69 D;  2VUM B;  3GTG B;  3H09 A;  2F0V A;  3NP8 A;  1EU3 A;  1X3Q A;  2KHS A;  1AEX A;  3SDZ A;  3PV0 A;  4O1N A;  5K36 H;  2B2W C;  3KLS X;  1CA5 A;  1ZEQ X;  1II3 A;  2EY1 A;  2IT1 A;  4A3M B;  4NDX A;  4DXG A;  2VB2 X;  3QOJ A;  4IQZ A;  4MN3 A;  3K5N A;  2EYH A;  2OT2 A;  5FO7 B;  3RD4 A;  1RCV D;  1V43 A;  3T16 A;  1CM9 A;  5TSS A;  3IFT A;  1FR3 A;  4QIW B;  3KLS A;  2R7Z B;  4HSV A;  1TS5 A;  1VF5 C;  2RDH A;  4HCE A;  3DXJ C;  3I4N B;  4I65 A;  2EYM A;  4PMB A;  2DNC A;  3QWN A;  3SR1 A;  4NW2 A;  1JR0 D;  3HS0 C;  5M5X B;  1OXV A;  5M3F B;  1S5D D;  1ENA A;  3TP5 A;  2L55 A;  1NSN S;  5A35 A;  4ZKC B;  3ND8 A;  1XTC D;  4A3E B;  2HDL A;  2B8G A;  3NQT A;  1K8M A;  2Q8R E;  3C3L A;  4G7O C;  4K8J A;  3BG3 A;  4HAE A;  2F0H A;  1EY4 A;  2HQE A;  2A6E D;  4CBV A;  1O7L A;  5IGE A;  1PFB A;  4M1U B;  4IUN A;  5C3X A;  1F77 A;  1RJT A;  2HCI A;  1MD2 D;  1CK1 A;  2EZV A;  3GTL B;  4K14 A;  4Z9C B;  3NSW A;  3NXW A;  5LL6 X;  3U9S A;  1HUM A;  4F7X A;  4HED A;  1SYB A;  1B1Z A;  1EYC A;  2L11 A;  1RDP D;  4KY7 A;  1G29 1;  3FMC A;  3PIP 3;  1LTG D;  1LV9 A;  3HOV B;  1IKL A;  2A6H C;  5C0X I;  2K28 A;  1TVX A;  1QIL A;  1F9S A;  1STN A;  2KJX A;  3MFY A;  1KLG D;  1DON A;  3PIO 3;  2F0J A;  4A3B B;  1MSH A;  1H9R A;  4R9W A;  3M85 A;  1H9S A;  2JA7 B;  1AP0 A;  1NR2 A;  2F0O A;  2ZT9 C;  4EQN A;  3I91 A;  4ZK9 B;  4IZ8 A;  4XQN A;  1RHP A;  4UAI A;  4B9X A;  4XXE A;  2WKC A;  2BDN A;  1D6E C;  3K5O A;  4S3S A;  5KYI A;  3J7A F;  1B9N A;  4MIU A;  1D1I A;  1KLU D;  3GQB A;  3E5S A;  5CV5 A;  4C2M B;  3S1Q B;  5KNC A;  5DEH A;  3JAM L;  3PO2 B;  4JK1 C;  5FK9 C;  1O7Y A;  1SE3 A;  1V1P A;  4ZQ3 A;  2EYP A;  5EQ0 A;  4XT3 B;  5HGT A;  3T4A C;  2EXZ A;  2PZT A;  1SDF A;  1CI3 M;  2VNU D;  4RGM A;  1QE6 A;  3A54 A;  1I4Q A;  4IUP A;  2HDM A;  1O7Z A;  1MSG A;  2NZ1 D;  1MGS A;  3D6W A;  2EVB A;  1TR5 A;  2IX1 A;  2BCO A;  5EKL A;  4DXF A;  1SYF A;  2PZW A;  1EL0 A;  3OMC A;  1JWS D;  2EY5 A;  1L0X B;  5BN4 A;  1V1P B;  1RTO A;  2R3Z A;  3SXH A;  1MI2 A;  3TP7 A;  4KMU C;  2A6E C;  3NWS A;  4LJZ C;  1KAA A;  1W6K A;  5C6A A;  1LTS D;  3DEP A;  3S9W A;  1SNO A;  3T53 B;  4IFD G;  1I4G A;  1ONL A;  1CT1 D;  4HN7 A;  2F0U A;  2LMC B;  1I6V C;  4BA2 I;  5J1Z A;  1TWC B;  3BYT B;  5JEA H;  4GZY C;  3M4O B;  4F87 A;  4DNR B;  2D9U A;  4WOR A;  3HG9 A;  4DGZ A;  2R6G A;  2X69 A;  1SJH D;  2XIW A;  4XTC S;  1A6X A;  1TWG B;  1PRT B;  1HA5 A;  2AQ3 B;  3P1H A;  3C46 A;  3EA6 A;  3HOW B;  1HTL D;  2A6H D;  1JOO A;  3ONA B;  4QUC A;  1ZYR D;  2F0W A;  1EYA A;  3NHH A;  1PDQ A;  3A8I E;  1G8Z D;  2DN8 A;  1DCZ A;  3D3R A;  2WAC A;  1HTP A;  2PMZ B;  3W3A A;  3S2H B;  3FDT A;  2MUY A;  4QMG A;  2A74 C;  1SFO B;  1D2B A;  1RD9 D;  1TT2 A;  3MXG A;  4C3I G;  3Q6S A;  4RA8 A;  1F2Y A;  1M8A A;  1PTO F;  1EIH A;  2PO4 A;  2EJG C;  2C5C A;  1BO0 A;  1D5Z C;  1Z47 A;  5IGG A;  4HR7 B;  2B2Y A;  3BYY B;  2VXW A;  2K04 A;  2WKD A;  1EU4 A;  1E2W A;  3PUV A;  2F0F A;  4L8J A;  2DY7 A;  5JOB A;  3WOF A;  2JSO A;  1E2Z A;  4Y7N B;  2NWG A;  3BDO A;  1TS2 A;  1D5M C;  4ZUJ A;  1SYD A;  2IL8 A;  1DYQ A;  2F0L A;  4ZAI A;  1AFP A;  4FO2 A;  1GUT A;  1I4H A;  3PMF A;  2BA0 A;  3PUY A;  1HUN A;  3SK4 A;  1CTM A;  2J4X A;  2NBF A;  4DAV A;  2OEO A;  2XWB B;  1BNZ A;  5I6W A;  4MHE A;  3RMH A;  3I73 A;  4IUR A;  1QOH A;  2RKS A;  2RDF A;  3NBH A;  2CVR A;  4PNY A;  1KDC A;  2E2H B;  2IW3 A;  5C3W A;  4EVO A;  4A3J B;  2KEC A;  3I70 A;  1B53 A;  1WVL A;  2SNM A;  4R8N A;  5C5L A;  3URY A;  4CKC A;  2M2L A;  1EY0 A;  2C9O A;  3ZYY X;  1YNJ D;  2JA5 B;  3NE5 B;  2F0E A;  2O2L D;  2K32 A;  3A8K E;  1I4R A;  4OO1 H;  2NTS A;  1B4O A;  1JOK A;  1NUC A;  4F8M A;  1GHK A;  5COR A;  2KVM A;  1EWH A;  1JC7 A;  4LK1 C;  1W6J A;  3JAM E;  4BBR B;  3NBI A;  5DNF A;  3T51 B;  1ZYR C;  2QIL A;  1LTB D;  1HA6 A;  3MAQ A;  3HOX B;  5IT9 E;  3E0J A;  2IX0 A;  3S17 B;  2ZXO A;  1F9P A;  4FF3 A;  2RSO A;  1EY8 A;  2OF1 A;  5CBA E;  1DJR D;  1V1O A;  2B2T C;  1KAB A;  1SMY C;  4RCO A;  3G7L A;  2IX3 A;  4RWS C;  3MXN A;  1QNK A;  5CC4 A;  5EPL A;  4OL7 A;  1DZ1 A;  2EPB A;  1HQM C;  2JA8 B;  1G91 A;  3OIP A;  2JYO A;  2JP1 A;  5EBC A;  1ILQ A;  1S4Z A;  1R4Q B;  3NQI A;  4J6H A;  3J81 L;  3KF8 A;  5C44 B;  3OW7 A;  2N55 A;  3NWT A;  3S16 B;  4J1M A;  2Q8T A;  3W2D A;  5E3F A;  1BBX C;  3EJI A;  2I07 B;  2NVQ B;  5IGB A;  1WTW A;  5JJZ A;  2PPB C;  5FO8 B;  1OO9 B;  1F2M A;  4C56 C;  3GV3 A;  2E2I B;  1EY5 A;  2ICE C;  5DM7 3;  2H4O A;  1EEF D;  1Y1V B;  3X3N A;  2EOT A;  1H9K A;  1TS3 A;  1IL8 A;  1BCP B;  1WCM B;  4KD3 A;  2A5H A;  4RH6 A;  3GTK B;  4H13 C;  4C3J G;  3I3C A;  4G7Z C;  2L1B A;  4C3J B;  1OXU A;  2E75 C;  5K5P A;  1EY9 A;  1SNC A;  3UI2 A;  2WB1 B;  3FPP A;  4OIJ A;  4K2K A;  4KN7 C;  4RHR A;  2BE5 D;  3VR6 A;  3NK9 A;  1PLF A;  2RDG A;  1STE A;  5E4X A;  2HUG A;  2F0G A;  1GHJ A;  1HPC A;  3LWE A;  1LT3 D;  1FNV A;  4ILW A;  1J8I A;  4K8I A;  1DOK A;  2L5T A;  2SOB A;  3BDL A;  2ICI A;  3VA7 A;  3IKJ A;  1JIC A;  2D62 A;  1SXT A;  4DK0 A;  4DU9 A;  4HCS A;  4QB4 A;  1GOZ A;  1NAP A;  2WAQ B;  1NCV A;  4A3F B;  3T56 B;  2JA6 B;  1CHQ D;  2J0T D;  3EVQ A;  1BXT A;  3MWY W;  1H9S B;  1M4V A;  4IUT A;  3A7A B;  3QJY A;  3C2P A;  2L0C A;  2L4N A;  3P20 A;  3J7Y W;  3R2I A;  2EJM A;  1GXD C;  1FNW A;  1Q8I A;  4ZUI A;  5FLX L;  2OXP A;  1CZG A;  1YNN D;  1BQQ T;  4HSP A;  1CFM A;  1AZP A;  1DXM A;  1TWF B;  4ZLT F;  3BS1 A;  3HOU B;  3AB9 A;  1ET9 A;  4KHV A;  1QJO A;  1SE2 A;  1E0B A;  2AWO A;  3NTK A;  2YYZ A;  2H1E A;  3MFG A;  3IL8 A;  1TY2 A;  2Q8I B;  1K83 B;  5KIX A;  5AFW A;  3D6C A;  5CYU A;  1ILP A;  4IUV A;  1PFN A;  5M5Y B;  1A2U A;  1ENC A;  3MC0 B;  3SK8 A;  1PTO B;  2WII B;  1PXU A;  3E6Z X;  5IGC A;  4IUU A;  3I8Z A;  4G57 A;  5A2Q L;  2B8F A;  3MXU A;  4RKB A;  1A3U A;  4XT1 B;  3R2T A;  3ITP A;  3HZX A;  5FOB B;  3K57 A;  1F2L A;  2BDO A;  2CQA A;  2F1M A;  4C3H G;  5C3E B;  5IIF A;  5IT9 L;  5M9O A;  1U4L A;  3NPP A;  2K5D A;  4KY6 A;  1VMP A;  2XRS D;  5FLX E;  2MHV A;  2L9H A;  4LMQ D;  3MVV A;  3J7A V;  1UAP A;  4ZYS A;  5BN3 A;  3H3V C;  1OXX K;  3S2D B;  4ABN A;  3GTP B;  2K01 A;  3I90 A;  1KTK A;  1FYC A;  1FD7 D;  4X3T A;  1GUG A;  1K8O A;  2MGS A;  4KTA A;  5IGF A;  5EKI A;  2F03 A;  2WV6 D;  2G9H D;  3X3M A;  1PFM A;  2R61 A;  1Q12 A;  1YNJ C;  5I9O A;  3BDC A;  1STH A;  2A68 D;  3DWA A;  1CZW A;  3K6O A;  3MTS A;  2QF7 A;  4CGY B;  5J39 A;  2F3V A;  4CJ2 C;  1AW7 A;  2NN6 G;  5EPK A;  1Z7T A;  1TII D;  2K05 A;  3J80 L;  2DNE A;  3GTM B;  2EYF A;  2O4X A;  5E4W C;  2F0D A;  1SND A;  1Q3L A;  4C3I B;  4DNT B;  1CHP D;  4CJ1 B;  3OSO A;  2TSS A;  2F0N A;  2EDG A;  3M3Y B;  4X3U A;  1HFN A;  1H9M A;  1JOR A;  3ERO A;  1SJE D;  1HXY D;  1SYG A;  4HMJ A;  1Q1B A;  2RVL A;  3BVZ A;  1KDB A;  1U9R A;  4BA1 I;  3FEW X;  4CJ0 B;  1DOL A;  1WTO A;  1SMY D;  1ZKO A;  3D31 A;  1TQO A;  5JPN C;  5BN5 A;  2D5D A;  4TKO B;  3QG1 A;  2XWJ B;  3EFX D;  1JWU D;  1U4P A;  2JEB I;  1TKW B;  1CQF A;  1ESR A;  2EYO A;  3S14 B;  3BZD B;  1LT6 D;  5D14 A;  1RTN A;  2PQE A;  4H0L C;  1SNM A;  4KJO A;  1T5E A;  2NTT A;  2R93 B;  3OHX C;  2LS0 1;  4ID6 A;  5JAV A;  1I50 B;  4PMW A;  1V8Q A;  3R8B A;  3L7Z C;  4K5W A;  3KUP A;  4XQQ A;  4K5V A;  2FHT A;  3K58 A;  1BDO A;  1STG A;  3H91 A;  3L9A X;  3J80 E;  2KOL A;  1STY A;  1D5X C;  3VYS A;  3NUC A;  3RUZ A;  4IUQ A;  5CMD A;  2WIN B;  5J22 A;  1A3V A;  4EGV A;  2EY2 A;  1PTO C;  3SVM A;  2XVS A;  1B44 D;  5JVG 3;  5KNB A;  1X3P A;  3QB3 A;  3HKZ B;  5M5W B;  5JEA J;  4FYD A;  4LAA A;  2QEJ C;  2EYL A;  5ELC A;  4JBW A;  2BE5 C;  2JEA I;  2NN6 H;  2B2U C;  5NUC A;  4CKB A;  2Z4I A;  4RGN A;  1WTV A;  1UUP A;  3KLR A;  1TWA B;  2PYK A;  3IFD A;  4UDU C;  4R8I A;  1STB A;  3G6J B;  1JQY D;  3FKI B;  2MPM A;  1QG7 A;  2F0T A;  4ZKB B;  5K36 G;  1L0Y B;  1VMC A;  4FF1 A;  3IAY A;  2CHB D;  5E1F A;  1NR4 A;  3DEO A;  4M8A A;  3WOE A;  4WRD A;  2QDB A;  4RAU C;  2ZXP A;  1ML0 D;  4KKS A;  2A68 C;  2R92 B;  1AN8 A;  1Q90 A;  2V4D A;  2LFN A;  3GD7 A;  4DAP A;  3AMU A;  1XX8 A;  2EYJ A;  4G7H C;  4IFD I;  4IFD H;  4K6L A;  4C1N K;  5I6Y A;  3Q24 A;  5CV8 A;  1A3T A;  4F88 A;  1Y69 U;  3KBX A;  3P75 A;  4I7Z C;  1TY0 A;  1BOS A;  3H0G B;  3CU7 A;  4TQU S;  1YNN C;  4HMI A;  3TSS A;  1XXG A;  2FIN B;  2XNA C;  4O42 A;  4K2L A;  2KED A;  3L3O C;  3HOY B;  1CA6 A;  2RA4 A;  1ET6 A;  4B9W A;  3DHQ A;  3GTQ B;  2E76 C;  1LTR D;  3S1M B;  1O78 A;  4OGQ C;  2IJ0 A;  3RLF A;  2B2Y C;  2XRQ D;  3GTO B;  2NN6 I;  4BY1 B;  2VB3 X;  4H7B A;  3DMU A;  3TZU A;  4KY5 A;  1A2T A;  1PZK D;  3I4M B;  4FXG C;  3MA2 B;  1CQV A;  4FXD A;  3O13 A;  3PUZ A;  1KDA A;  3SE0 A;  3BVM A;  1PZJ D;  3ND9 A;  2K5W A;  3FPU B;  1Y8P B;  5C0X J;  1EWC A;  4WJW A;  3R3O A;  4KJN A;  5I2Y A;  3LX0 A;  5EJW A;  4KKT A;  1VF7 A;  3RZD B;  2NVT B;  4IN3 A;  1HRJ A;  1ICW A;  4RKL A;  1B2T A;  1FGB D;  1U4M A;  2E2J B;  1TWH B;  1ESF A;  2X6G A;  2JE6 I;  4BWG B;  2F0K A;  1EFI D;  5M3M B;  3OWF A;  3OOC A;  2GA4 B;  1I3Q B;  2KCN A;  5EKK A;  5F2D A;  3MEH A;  1EQT A;  5COY A;  2PCF B;  3BVG A;  4K6D A;  5D65 A;  1R9T B;  2NYZ D;  4RGO S;  3SK6 A;  1AZQ A;  1LTA D;  2AUK A;  3DM1 A;  4U68 A;  2CW0 D;  4RGT A;  2B63 B;  3VYR A;  1LT4 D;  2FMC A;  4BY7 B;  3AU7 A;  2F0P A;  3I4L A;  1IYU A;  1S5B D;  3Q22 A;  2O5I C;  2YU9 B;  2QKI C;  1C4Q A;  2PZU A;  3PUX A;  3U9O A;  5KGU A;  2KQ3 A;  5T1I A;  2MJ8 A;  3VR2 A;  1RKN A;  4TSS A;  3K0Y A;  1WD0 A;  4CHT B;  5KRU A;  2ENB A;  4OO1 G;  1BCP F;  2XSC A;  3A56 A;  5G3L D;  4BBS B;  4H44 C;  2F0S A;  4CKE A;  4DAY A;  1LAB A;  5C0X H;  2WP8 J;  2I46 A;  5KEE A;  3VR4 A;  4WFN 3;  1WD1 A;  1EY6 A;  1DOM A;  1QNU A;  5CGK A;  1S5E D;  3HRZ C;  2BA1 A;  2TMP A;  3VR3 A;  2NUC A;  5ELD A;  3TN2 A;  1TS4 A;  1KNE A;  2PW5 A;  4QF4 A;  3V96 A;  1EYD A;  2Y0S B;  1BCP D;  1LO5 D;  3S1N B;  5JVH 3;  1FNU A;  1HQR D;  1KNA A;  5JPM C;  5JEA G;  3DWQ A;  1IW7 C;  4L63 B;  3SK5 A;  3PO3 B;  5IGD A;  5KND A;  1PTO D;  2J7Z A;  4XYO A;  4XYQ A;  1LT5 D;  1J9O A;  3CQZ B;  1S5F D;  1VDZ A;  1LLR D;  3P7J A;  5LHY 1;  1PTO H;  2F0Q A;  5EGT A;  4TRD A;  3D8G A;  1A15 A;  3M7G A;  1GJX A;  4XQJ A;  2ZXR A;  4K5X A;  2E2D C;  1C8C A;  2KCC A;  3OIQ A;  5ELE A;  3SHL A;  1G2S A;  4A3D B;  2BOS A;  1BF4 A;  2RBM A;  2SDF A;  2EJF C;  2QCP X;  1XWE A;  3GTJ B;  1SBB B;  1B9M A;  4X3K A;  2LY7 A;  1EIG A;  4DFA A;  2FMM A;  4B08 A;  3N6R A;  1JWM D;  2RQX A;  1GUN A;  2AWN A;  1F9R A;  2B2T A;  1SNQ A;  2B2V A;  4ZRZ A;  1B3A A;  2K03 A;  3KK7 A;  4RCN A;  1EZ6 A;  2O5J C;  2FFK B;  3QOL A;  1PRT C;  3K5L A;  4DA2 A;  2N88 A;  4J8Q A;  4KD4 A;  1UEA B;  3MXP A;  2KUM A;  2K6A A;  4A3K B;  3TME A;  3NTI A;  4DF7 A;  4KK7 A;  1IHZ A;  3DWP A;  3ERQ A;  5C4H A;  1JE4 A;  5D3I B;  3LWU A;  4PQX A;  4XIG S;  4DK1 A;  2L12 A;  1T5X D;  3D4W A;  1VCI A;  5I4D A;  1G2T A;  4KHZ A;  1U4R A;  1SNP A;  2XN9 C;  4P2C B;  5HUR A;  1DM0 B;  1ROD A;  5C4J B;  1GUO A;  4V0B A;  5CV9 A;  4NMZ A;  2F3W A;  1HHV A;  3WDN A;  2KEE A;  2Z4H A;  2F0I A;  5EPJ A;  1HFG A;  5I2X A;  3Q23 A;  4QUF A;  1LTT D;  1JCK B;  1ENF A;  4KKU A;  5IOD A;  2F0M A;  3VR5 A;  5G3L F;  4IFD J;  3GP7 A;  3T13 A;  2FJ2 A;  3D4R A;  5ELB A;  4OO1 I;  3VA5 A;  3K5M A;  2F4I A;  5CBE E;  2Z1C A;  2IPK D;  4FP5 D;  3MZ5 A;  3LNN A;  3KBG A;  3GO5 A;  3OWE B;  4KV6 A;  4Q5V A;  1EY7 A;  3Q0A A;  1PZI D;  1EQV A;  5KYL A;  4X3S A;  4Q0F A;  1JB3 A;  3A7L A;  2PW7 A;  3C1F A;  1Z6H A;  3RZO B;  5FKA C;  4DN4 M;  3GV6 A;  5CR3 A;  1I4X A;  4ODG A;  3TP6 A;  2ID0 A;  4A93 B;  2PNR C;  1I4P A;  1EZ8 A;  3HGB A;  3OMG A;  5C4Z A;  3M7N A;  3K59 A;  1SE4 A;  4N9P A;  1IYV A;  4QCL A;  2Z8L A;  2CW0 C;  1Q1E A;  3TBI B;  1PMR A;  4EQO A;  1SEB D;  1WTR A;  3CRL C;  1LTI D;  4OIK A;  1I6H B;  2NB0 A;  2NVX B;  4YIJ A;  3CKI B;  1EOT A;  3A8J E;  4IAL A;  2LKV A;  1H9J A;  1S5C D;  2A69 C;  2K5Q A;  4N9T A;  1D1K A;  3DUZ A;  2EE1 A;  5T1G A;  1BUV T;  1SAP A;  4FNF A;  3S15 B;  3FRP B;  5DAU A;  4FF2 A;  3A55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...