2UUCL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucL00
4DV6Q 4UP8A 4GNXB 2VL6A 4O0AA 5LMUL 5EAYA 4NXNQ 4OWWB 3S2HH 4Y52H 1RIPA 1LTLA 1IBML 4DR3Q 4JBKA 3L7ZC 3ULPA 4YCUA 1EOVA 2VQFQ 1OXTA 4QQBX 1CKNA 4OXPA 5IWAQ 3A5UA 1QVFA 3CMAA 3STBC 2GN5A 4KLKA 3K7AH 4LF5L 2UUBL 1HH2P 2JEBI 5GQOA 1LM0A 4DV0L 4TQUS 3UDGA 4JV5L 4X6AH 3HOUH 4JC0A 1OXSC 1UE6A 2NVYH 4DV4Q 1P8LA 4MNOA 3CCEA 4DR5L 1C9OA 1X55A 4DV6L 4HJAA 1N32Q 4BA2I 1QUQB 2KBNA 4BXXH 4A3LG 4BBRH 2EQSA 3K7UC 5H1SE 1X3GA 3ICEA 2LSSA 3HOXG 3CC7A 2VQEQ 4DR2Q 4JI3Q 4BY7H 3HOUG 1BBWA 4DV1Q 4BY1G 2Q2TA 1E7ZA 2OQ0A 4EQ5A 1QZGA 1K8GA 4JI4Q 5IYDH 1PH3A 2JJQA 2MFIA 3CCQA 4JI0L 3PUXA 2UUAQ 1XNRQ 1N32L 1P16A 2UXBL 3OYYA 3T1YQ 2UUCL 1Y1VG 3HKSA 5C0XG 1UE7A 2K52A 5LMNL 1KRTA 3TRZA 3PUWA 2R7FA 1VQDA 4FDBA 1W2BA 2D0OA 2MO0A 1Y1WG 1QVGA 2E8GA 1PA6A 2OTLA 4L5TA 4YWMA 3M9BA 5AJ3L 5GADC 4DV7Q 4LF6Q 3AFQA 2K5NA 4BBSH 1CKMA 3HKZE 4LFCL 4A3CH 1N8RC 3I56A 2B63G 3OW2A 2D0PA 1ASYA 1A63A 1S3OA 3PO2G 5ELNA 1MJEA 4LF5Q 3HOWH 4LUZA 1HNWL 4GLVB 4LF6L 2R93H 2ASBA 2D62A 3BZKA 5J3BA 1VS0A 4O2DA 5JEAG 3U4VA 2PQAA 3S2DH 5C4XH 4LF4Q 1FL0A 4YHHQ 4A3BG 1YJNA 4GOPA 1XPUA 1VQCA 2QEXA 2IY5B 3NEMA 1XJVA 2YU9H 2ZTCA 1I3QH 4PZ7A 1JT8A 4BBRG 2H5XA 3PO3G 4BXXG 3EN2A 5IP7G 4AH6A 4GNXC 1MJCA 3KDFA 3LGJA 1BBUA 1IYJB 2N49A 2PMZE 2R7ZG 4DV3L 1B70B 4GOPC 1FVIA 4A3GH 4HIKA 3U50C 1PH6A 1GVPA 1VQKA 4JI3L 1B8AA 1YEZA 3KJPA 2Q2HA 3J81i 2F4VL 5IYBG 3NELA 3M4PA 3J7A5 1S72A 1KC8C 2JE6I 3ULLA 3GDEA 4XTCS 5E7NA 4A4IA 1J6QA 4GNXA 1KQSA 3HOYH 2UXCL 2NZOA 2K50A 4IPHA 4JG2A 3T1HQ 4DV0Q 4AQYL 4QJFA 2VQFL 1KD1C 5DLQE 1IXRA 4KHZA 5C4XG 1E1OA 2KCMA 1XMOL 1CKNB 4A93H 4K0KQ 1KXLA 3PUYA 1V43A 2GVBA 1O7IA 4X65L 1X65A 2N3SA 1BVSA 2K5HA 4A3MH 1K8AC 2ATWA 1VQIA 3GTPH 2HHHL 4QY7A 3M4QA 1FJGL 2AWNA 3RLNA 2IT1A 4IOAA 1YIJA 1EUJA 4JI1Q 4DAYB 5IY0A 4POFA 2HQLA 4A3IH 4WJ3M 1N34Q 4ALPA 2UU9L 3S15H 1YZ6A 5JJIA 5IWAL 3AEVA 2F52A 1YBYA 1YNXA 1KRSA 2E2HH 4HJ8A 2JA7H 1HNXL 3BJUA 1GD7A 4B3ML 3DM3A 3AYHB 4TVAB 5FLMH 4X66L 5IP9H 1SROA 1I94L 4L5SA 2JA7G 2ALYB 1Z9FA 4A3GG 5LMNQ 4JI5Q 2IX1A 3B6YA 3H3VH 1WCMH 2WFWA 2Q2IA 3KLWA 4P75A 4JI2Q 5C0XI 1VQPA 1IBKL 1EYGA 2JA8G 2JA9A 3PIPA 5C3EH 1Q82C 1AH9A 1UEBA 4DUZL 4IPGA 1UWVA 3J81c 1HNZL 2BA1A 1XPRA 4EX5A 2A1AA 2Y0SE 3KF8B 3WWVA 1H95A 3G6EA 2K75A 1JE5A 3D0FA 3HKZG 4GN4B 1IZ6A 2I5HA 2VZAA 4MZ9A 2N78A 2VS1A 4OO1I 3CMEA 4DR3L 4A3JG 1NBWA 2RHSB 2JEAI 3TEHB 4A75A 1UE1A 3FKIH 2PQAB 3IRBA 1X9NA 4K0KL 4B3SQ 3F1ZA 1V1QA 3H3VI 4NXML 3GTKH 4DUZQ 2PI2E 4JCVE 4DV3Q 3M3YH 3M85A 3UDXA 2DUDA 3JAMi 1K83H 3CCJA 1PH4A 1FGUA 3ERSX 1NMGA 4HJ5A 1PH2A 3FKIG 3KYHC 2AMCB 5GROA 1VQJA 3CCLA 1VQNA 1N33Q 1I5FA 1X3FA 4APVA 4A3EG 4POGA 1VQEA 3S1NH 1IBLQ 4A93G 1PH7A 4DR4Q 2OCEA 1K73C 3S17H 1CSQA 4X66Q 1GM5A 4NB3A 1KL9A 1TWAH 2QGQA 5M5YH 1L1OB 2A19A 2R7ZH 2NN6G 4LF9L 4KHPL 3F8TA 2L15A 1W3SA 4HIMA 4X62Q 1IBLL 2IHEA 1PH5A 1KIXA 3L0OA 4JI4L 2KHJA 3BU2A 3W5OA 4GKKQ 1X3EA 3HOYG 5M3MG 1PFSA 5GAHC 4JBMA 4GKJQ 4DKAC 4RMFA 2Y0SG 4LW1A 2E2JH 4OWTB 4RG1A 2EXDA 4JI2L 5FJ8G 2I5MX 1IBKQ 3GTLH 5IYBH 1AE3A 3RZOH 1Q1BA 4H02A 5IP9G 2CCZA 4JI7Q 5M3MH 4YY3L 3Q8DA 3J80c 1EQRA 2UUCQ 2C35B 1WYDA 5C0XJ 3L2PA 3PF4A 3CCMA 1DGSA 4P72A 1YHQA 1Q8KA 5JJKA 1G6PA 3TREA 1I94Q 1K9MC 1SR3A 3NENA 1OXXK 1KHIA 2DGYA 3KF6A 2RCNA 5BR8Q 1HZCA 1VQAA 4UP7A 4LFBL 4P74A 4YWLA 3HOWG 2KHIA 4L5QA 5FLMG 3D31A 4LUVA 2ZJPA 1YHBA 1E22A 4JI5L 4LF7L 3K81C 5IE8A 4BY1H 2LXKA 1VCIA 4HIDA 3PIOA 1M1KC 4LF9Q 3HOZH 5HGQA 5FLXc 5LMUQ 4GS3A 1VQ5A 4LF4L 1Q12A 3M4OH 2E2IH 1EQQA 3RLFA 1HNZQ 2FXQA 2XGTA 3UE0A 4LF7Q 4B3RL 2ZTEA 1A0IA 4IJHA 5IYCG 4AYBE 3VDYA 5HY6A 5M5XH 4DV5L 4PZ6A 1XNQL 4R4IA 1VQHA 3F2CA 4UY8C 3F2BA 2ZM6L 3GTQH 3HFZB 3S16H 3S1QH 1EWIA 1YI2A 2PNHA 4DAMA 2Q2UA 1D8LA 1I50H 1M90C 3E9HA 4DV4L 4DR5Q 4LFCQ 2OTJA 1VQ7A 1TXYA 1KAWA 1L1OC 1OXUA 2EIFA 2WB1G 3A5ZB 2RHQB 3E0EA 4IPDA 1N9WA 2IX0A 5AJ3Q 3HOVH 1NJIC 4A3DG 3GTOH 1VQ6A 3CCVA 3PSIA 1JB7A 1X54A 4DK3C 4DV1L 2YTXA 4AQYQ 4A3FH 3CPFA 2JA5H 4HJ9A 4R1JA 1QZHA 3KJOA 1C7YA 1HZAA 1RL2A 1SE8A 4B3SL 1GKHA 4LF8Q 4DR7L 3STBD 1VQ4A 1E3PA 2AWOA 5FJ8H 1VQOA 3ER0A 1PYSB 4C3JH 1PV4A 2UUAL 4JI8Q 1XTDA 4BBSG 3S24A 2ZJQA 1L1OA 2K5VA 2NVXH 5IYCH 4GKKL 2IHFA 1X6OA 2ZJRA 1U5KA 3T1YL 4YHHL 3CCUA 1FJGQ 1Z47A 1OXVA 4R4QA 4C3HH 4A3IG 4OONA 2OWOA 3K8AA 3PUZA 1Y1VH 4A3CG 1CSPA 2HIVA 4OX9L 1PH1A 3E9IA 2XTIA 3F2DA 3ULJA 2JQOA 3KOJA 1MIUA 3RN2A 3J7ZC 3CF5A 2V1CC 4JBWA 1HJPA 1VQFA 5M5WH 4A3MG 3A0JA 4JYAQ 5C4JH 3AQQA 2CWPA 3I4OA 4JI6Q 3PV0A 4B3TL 4NXMQ 2JK8A 1AE2A 2BH8A 3CW2C 3CP0A 3H0GH 4GN5A 1L2FA 4YY3Q 3K0XA 3U58A 4BY7G 1D7QA 3HOXH 3K80C 2BH2A 5C3EG 3JAMc 4IFDI 2YV5A 3TQYA 2ZM6Q 1PH8A 2N8NA 1MKHA 2R7DA 4C3IH 2HT1A 1EFWA 2WP8J 2Z0SA 4DV2Q 4DR6L 5C44H 1VQBA 2UXDQ 4JI0Q 3KF6B 2F3IA 5JJLA 3EIVA 3ZJYC 2YYZA 5GAEC 3DLLA 4DV7L 2A8VA 2VNUD 4A3JH 1ASZA 1R9TH 2OQKA 2CQOA 1N34L 2Z6KA 4DV2L 4DR6Q 1Q7YC 4MTNA 3KFUA 4YCWA 3UDIA 3CCRA 4IPCA 4AYBG 1XMQQ 3CXCA 3RLOA 4KI0A 1K3RA 4WJ4A 1LUZA 2NZHA 4LF8L 4DR7Q 1X56A 1G291 3CQZH 1PHJA 4P71A 1U0LA 2GVAA 4Y7NH 1SRUA 4C2MH 1YITA 2R93G 3I4MH 1OTCA 4B3RQ 4ME3A 5BR8L 1WOCA 1GO3E 3I55A 4PMWA 2KCTA 4GLXA 4YWKA 4NXNL 2NVTH 2WB1E 1XPOA 1VQMA 2E5LQ 2B63H 3PUVA 1IL2A 3BZCA 3GTGH 3GD7A 4KHPQ 4GLAC 3PGZA 4JI1L 3CC4A 3I4MG 2AHOB 4A3DH 3HOVG 4JBJA 4GN3B 1T9HA 1VQ8A 1Q1EA 1HR0W 4L5RC 1N36L 1HZ9A 1J5EL 2NVQH 1HR0L 4R4OA 3MEFA 3I4NH 4JOIA 4X64Q 3OTOQ 3GTJH 2VUMG 3PO3H 4IFDG 1BKBA 3S1RH 4JI7L 5M3FH 2UXCQ 1N33L 1Q81C 3CAMA 4LFAQ 3S14H 2KENA 1HNWQ 4A3FG 1WCMG 3FP9A 4DUYQ 3H15A 4B3TQ 4X65Q 3NBHB 3PCOB 4OO1G 3SGIA 5M3FG 4JYAL 2B3GA 1UE5A 1SN8A 1V9PA 5GAGC 2VW9A 3M7NA 2R92H 1WJJA 1WI5A 4LNQA 3PO2H 1TWHH 3CD6A 4DUYL 2WAQG 3H0GG 1SLJA 4UPAA 1JJCB 1NMFA 4LWCA 1E24A 4A3EH 4X62L 3I4NG 2BA0A 3KDFB 3U4ZA 3CPWA 1Y14B 3TS2A 4JV5Q 3J81j 4A3BH 4QGUA 4XIGS 4DR1L 4UP9A 2E5LL 2JA6G 3CCSA 2VY3A 4A76A 1A8VA 4DV5Q 1NTGA 1XMOQ 1SFOH 1VQLA 3J80i 3EBEA 5LMNW 4AIMA 3RZDH 2ES2A 4JI6L 2RF4A 1XMQL 3HOZG 3GO5A 4DNIA 1IBMQ 4J15A 3T1HL 3RNUA 1YHAA 3OTOL 3PF5A 2UXBQ 4QL5A 2CKZB 3I2ZA 4DPGA 2HHHQ 1XNRL 4JOIC 4A3LH 2K14A 1PYBA 2MO1A 1HR0Q 2YTVA 4IOCA 1CKOA 4OWXB 2JA6H 4IO9A 2I5LX 1Y1WH 1S40A 1E1TA 3FHWA 1B7YB 4QIWE 3RR5A 1K0RA 3W1BA 4X64L 2UUBQ 1YJ9A 1EIYB 2YTYA 1I6HH 2NN6I 3A74A 4A3KG 4JI8L 1TWFH 2HIXA 1YJWA 2AKWB 2JA8H 3UDFA 1JJGA 3S1MH 4IFDJ 1LYLA 4PG3A 4LFAL 4HIOA 5IT9c 2UU9Q 5IYDG 1Q46A 3AFPA 4YCVA 2WAQE 2VUMH 5IP7H 4OX9Q 1A62A 2R92G 3W1GA 1TWGH 2VQEL 4DR2L 4A3KH 4DR4L 3GTMH 2CWAA 3JC66 2F4VQ 1Q86C 5JEAJ 5C44G 1PVOA 2CFMA 1NE3A 1HNXQ 4B3MQ 4NPSA 4HJ7A 2MNAA 4BA1I 3TS0A 1YVCA 4DK6C 4R4TA 2K4KA 2MQHA 1J5EQ 1JMCA 4DR1Q 1XNQQ 1PH9A 1JJ2A 1QUQA 2QA4A 1N36Q 3G48A 3UE1A 4LFBQ 2PI2A 2Z6KC 2R6GA 1EIFA 1SMXA 4R4CA 1CUKA 4GKJL 4P73A 1TWCH 3G71A 1C0AA 1WFQA 4GOPB 1G51A 3CC2A 1QVCA 3I7FA 1NY4A 3MXNB 4IJLA 3RN5A 1VQ9A 5K36G 1HZBA 2ID0A 2B29A 4PZ8A 1L0WA 1VQGA 2LXJA 3G4SA 2I0QA 5ELOA 2UXDL 2JA5G 2ZTDA 4LUOA
chains in the Genus database with same CATH superfamily
2F0QA 2VL6A 3VR5A 1I4RA 4JBKA 3OIPA 3E3XA 2VQFQ 4RWSC 1CKNA 1H9JA 4OXPA 3K7AB 5ELFA 4KK7A 1HH2P 1AP0A 5EPJA 3G6JB 3UDGA 3S15B 1OXSC 4MNOA 5G3LD 1C9OA 1X55A 2EY1A 3P20A 1N32Q 4KKSA 5DM73 2JA7B 5H1SE 3ICEA 2LSSA 1ESRA 3K0YA 2VXWA 3HOXG 5HGTA 1PXUA 1EY0A 2KHSA 4DR2Q 5D65A 1BBWA 1EEFD 4IUVA 4A3JB 1JB3A 4BY1G 1IL8A 3X3NA 3NBIA 4K5WA 2JJQA 4JI0L 2UUAQ 1I6VC 1P16A 2UXBL 2UUCL 2L1BA 1KRTA 4FDBA 1PA6A 2E8GA 2XWBB 4YWMA 2AQ3B 4ZRZA 1GJXA 1S3OA 4KJOA 1HNWL 4GLVB 1HQRD 2ASBA 2D62A 2K04A 4G57A 5CV6A 4KD4A 5C4XB 3MZ5A 2FINB 4YHHQ 1XPUA 1VQCA 2CW0D 5CR3A 4FYDA 3NEMA 3A8JE 2ZTCA 1I3QH 2YU9H 3MWYW 3PO3G 2OEOA 4BXXG 4X3SA 5IP7G 5A2QE 1MJCA 4KHVA 2N49A 2QDLA 1FVIA 4GOPC 4A3GH 1JOQA 4PQXA 1GVPA 1KC8C 3PO2B 3SEBA 3GDEA 4CBVA 4IURA 3RZOB 1LV9A 4K5XA 1J6QA 2UXCL 2K50A 4DV0Q 4BY7B 1KD1C 1PFMA 5DLQE 4OHJA 3BDLA 5C4XG 1E1OA 5IGBA 3MHBA 1CKNB 3URYA 1KXLA 2EOTA 1O7IA 2N3SA 1VMCA 1BVSA 4QUCA 1FJGL 4IOAA 1EUJA 2WAQB 2UU9L 2EJGC 4UDUC 3FEWX 4BWGB 3PIO3 4HJ8A 3J80E 1EY4A 1HNXL 4B3ML 3DM3A 4TVAB 3VYSA 4OEMB 1SROA 2MPMA 5LMNQ 3S9WA 4JI5Q 2IX1A 1BXTA 1QG7A 1SNPA 3QG1A 2HDMA 2JA9A 1UEBA 4DUZL 1Y8OB 3OWFA 4IPGA 1HNZL 2Y0SE 1H9MA 4WORA 1H95A 3D0FA 1CI3M 4XT3B 1IZ6A 1CT1D 2SOBA 5KRUA 5J22A 2N78A 3KLSX 4A3KB 4DR3L 1QB5D 3EROA 1H9SB 3F1ZA 1QWYA 4IALA 3HOWB 2DUDA 1K83H 1B53A 3K5NA 3MVVA 1I4PA 2KA7A 1BQQT 1PH2A 2AMCB 5GROA 1VQJA 3S1MB 2HCIA 3TMEA 2OCEA 1CSQA 4X66Q 1EZ6A 2QGQA 2NN6G 4MHEA 4LF9L 3SK4A 3DWAA 4OGQC 1IHZA 1LT3D 4HCEA 4LW1A 2ZXRA 2E2JH 4KY5A 3VR3A 5LL6X 2PCFB 4ZUIA 2E2HB 5FJ8G 3GTLH 5IYBH 3LWEA 5FO7B 1DCZA 1GOZA 1K8MA 1WVLA 5E4WC 3J80c 1S5FD 5BN5A 2UUCQ 3T13A 1LTTD 1WYDA 4A93B 4WFN3 1S4ZA 2BDNA 3PF4A 1Q8KA 5JJKA 1FD7D 1I94Q 3KF6A 2DGYA 1TIID 5BR8Q 1HZCA 4P74A 4YWLA 4ME5A 2KHIA 1HPCA 1UUPA 5FLMG 2DY7A 3M4YA 2ZJPA 1YHBA 3HOZB 2LXKA 1A3UA 1M1KC 4RKLA 2Y0SB 5I4DA 1EQQA 1A0IA 4AYBE 2XSCA 2L5TA 4R4IA 3S1QB 3S16H 3OIQA 1HFGA 4DXFA 4FF4A 4BS9A 1QE6A 2YU9B 4LAAA 2C5CA 2PPBC 1WTQA 4N8FA 4P2CB 3OOCA 1N9WA 4A3DG 5FK9C 1JE4A 2F0NA 2EY2A 3D4WA 3V05A 4ZKBB 3C2PA 3S14B 2JA5B 1C7YA 4DR7L 1E3PA 2AWOA 2H1EA 1FR3A 5FJ8H 1PYSB 4C3JH 2UUAL 4CKEA 1Y8NB 3S24A 4RHRA 1X6OA 4YHHL 1FJGQ 1T5XD 2XVSA 4OONA 3K8AA 3NBHA 1BCPF 1Y1VH 3PUZA 4OX9L 3S17B 5KEEA 2XTIA 3ULJA 2NB0A 1AZQA 2V1CC 4JBWA 5M5WH 3A0JA 4FXGC 3AQQA 4ZYSA 4K2LA 4B3TL 3FDTA 1AE2A 3CW2C 1B9NA 3H0GH 3H3VC 3K0XA 4BY7G 1D7QA 2L4NA 4IFDI 3OWEB 2BCOA 1QNUA 1EFWA 2WP8J 4DR6L 4S3SA 3FMCA 3EIVA 3UI2A 4CDDC 2VB2X 4DV7L 2A8VA 3D6WA 5C6AA 2CQOA 2QW7A 4DR6Q 5DNFA 1D1KA 3CCRA 2XIWA 4OELB 5NUCA 4AYBG 1ZEQX 2IL8A 4KI0A 1K3RA 4L8JA 2V4DA 2L55A 2NZHA 3PMFA 4DR7Q 1X56A 1D5ZC 4P71A 2GVAA 4Y7NH 3EVQA 1SRUA 3NK9A 1OTCA 1PLFA 2Z4HA 1GO3E 4GLXA 4NP5A 2Z6BA 1XPOA 1CFMA 3ONAB 3PUVA 1E2VA 1U4LA 3GTGH 3NE5B 4GLAC 3PGZA 1W6JA 2OT2A 3I4MG 3N52A 2KECA 4JBJA 4GN3B 3QOJA 2NBFA 3TZDA 1VQ8A 1L0XB 1HZ9A 2X6GA 1TWFB 1DOLA 1J5EL 2NVQH 5L37A 3FPPA 3I70A 4R4OA 4X64Q 3GTJH 2SNMA 1BKBA 3S1RH 5M3FH 1MI2A 5KNBA 3T56B 1VF7A 4LFAQ 4HSVA 2EY6A 1WCMG 3N6RA 4X65Q 4ZAIA 3HP3A 4OO1G 4X3KA 1SN8A 1JOKA 1A3VA 1O7YA 2R92H 1EFID 1WJJA 5CYUA 3Q22A 2Q8TA 1GUNA 3H0GG 1I4GA 1PTOH 4KN4C 2E74C 2E76C 1E24A 5KGUA 2BA0A 5D3DA 4X3TA 1Y14B 3TS2A 1HA6A 3GTJB 4UP9A 2JA6G 4ULLA 3CCSA 2D9UA 1NTGA 1XMOQ 4DK1A 3J80i 1EZ8A 4C3IB 2RF4A 1XMQL 4ZLTF 3BDCA 4C3JG 3T1HL 3OTOL 5LHY1 3RUZA 2CKZB 3I2ZA 1WD1A 2R3ZA 4IN3A 2JA6H 3CRKC 2CCZA 4QIWE 3FHWA 4X64L 2UUBQ 3QB3A 4C1NK 1YJ9A 5C3EB 3A74A 5KNCA 4JI8L 2HIXA 3BVZA 4PG3A 1DONA 5IT9c 3AFPA 3CQZB 2R92G 2L9HA 4ABNA 4DR4L 4EQPA 5JEAJ 2F0VA 1CQFA 5JPMC 4HJ7A 4N8X1 4TRDA 4R9WA 1PFBA 4R4TA 5E1FA 2MQHA 1JMCA 1QUQA 1F9PA 1ZYRD 1N36Q 3G48A 3UE1A 3QR8A 1EIFA 1SMXA 2M2LA 1TWCH 1QVCA 1Y1VB 1PRTC 1L0WA 2I0QA 4QIWB 1YNND 2A69C 1DOMA 2JA5G 1S5BD 4GNXB 1WTWA 4DAVA 4Y52H 1RIPA 3L7ZC 3QOLA 3K57A 1OXTA 4QQBX 3DEPA 5IWAQ 4IZ8A 1TS2A 3CMAA 4KLKA 4NDXA 4LF5L 1OO9B 2UUBL 2JEBI 2BE5D 2K05A 4DV0L 4JV5L 4JW0A 1ICWA 2K32A 4JC0A 4PMBA 2NVYH 3CCEA 2NVYB 4DV6L 4HJAA 1KDCA 1KNAA 3ND8A 2MJ8A 4BXXH 4A3LG 2EQSA 5C5LA 3A8KE 3E6ZX 3CC7A 4JI3Q 3PQIA 2E75C 1U9RA 1BDOA 4DU9A 5IYDH 4A3BB 1DZ1A 1GHKA 3CCQA 1XNRQ 1ZYRC 2F0IA 1AFPA 4M1UB 1UE7A 2K52A 3TRZA 3PUWA 2EXZA 5COYA 1Z7TA 2D0OA 1QVGA 4GZYC 2A6ED 5AJ3L 1JICA 3FRPB 4DV7Q 1CKMA 5CV5A 1ENAA 1ENFA 5ELNA 3PO2G 3HOWH 3ND9A 4O1NA 3BZKA 4KTAA 3GQBA 2F0OA 2PMZB 4C1NI 2PQAA 4LF4Q 2NTSA 4A3BG 1YJNA 2AQ2B 2QEXA 5EPLA 2EYOA 4DAYA 4EGVA 4GNXC 4DNTB 4F88A 2PMZE 5IT9E 3MFYA 4A3IB 3U50C 1PRTB 4JI3L 1B8AA 1YEZA 3KJPA 5IYBG 1CZWA 2RSNA 2PYKA 4KKTA 3I72A 4XTCS 5E7NA 5FO9B 1KQSA 2DJGC 2NZOA 4QJFA 2VQFL 2WINB 1LABA 1STAA 3K59A 1IXRA 4KHZA 5I6WA 1XMOL 2PZTA 5CV7A 4K0KQ 3PUYA 1V43A 4IUPA 1K8AC 3I73A 2F0UA 4QY7A 3M4QA 2AWNA 2E2DC 2L12A 3RLNA 2VB3X 1M8AA 4JI1Q 3WOEA 3HZXA 4MTKA 4POFA 4A3IH 4WJ3M 1EYCA 1PFNA 2CH4W 5JJIA 1B50A 1BCPB 1Q3LA 1X32A 3AEVA 2F52A 2FHTA 2PW5A 2JA7H 1A3TA 3AYHB 5FLMH 1F9SA 5IP9H 1I94L 5DM63 3M3YB 2ALYB 1JWMD 1Z9FA 2R61A 4A3GG 5EKLA 3B6YA 5IGFA 2WFWA 2Q2IA 2JA8G 1BOSA 4JI2Q 3S1NB 1EYGA 1G2SA 5C3EH 1TU2B 3J81c 2BA1A 3WWVA 4NKLA 4ODGA 1EY8A 1JE5A 2I5HA 3EA6A 2VZAA 1WD0A 5KIXA 3IKJA 5C5MA 1RCVD 2VS1A 4OO1I 3CMEA 1JQYD 1BR9A 5LL6S 2WKCA 3KBXA 3TEHB 1SSOA 1UE1A 3FKIH 2Z8LA 1X9NA 4K0KL 2L11A 1IKLA 4JCVE 4DV3Q 3V96A 3CCJA 2MHVA 2K03A 3ERSX 4HJ5A 3KYHC 3GTQB 1VQNA 1I5FA 1EQVA 1IBLQ 4A93G 4K6LA 3NTKA 4DR4Q 1LTAD 1VMPA 2R7ZH 2A19A 3NUCA 4M8AA 2L15A 1AEXA 2NZ1D 1IBLL 3D4DA 4JI4L 4DF7A 1X3EA 1G91A 1PFSA 3P1HA 1C8CA 2EXDA 4JI2L 3OMCA 1PYWD 3E0JA 2SDFA 2I46A 5J1ZA 3O13A 4BBRB 3HKZB 4YY3L 1GUOA 3Q8DA 2F3VA 1YNJC 2C35B 2IJ0A 5BN4A 3K5MA 1SYEA 3L2PA 3CCMA 4P72A 5EGTA 1I6HB 5DEHA 1K9MC 3NENA 1KHIA 4WRDA 1VQAA 2F0TA 4XQQA 1ML0D 4JI5L 3K81C 1VCIA 4LF9Q 4NMZA 2PO4A 5FLXc 1NNXA 4GS3A 1YNNC 4LF4L 1E2WA 1Q12A 3DM1A 4RFBA 2E2IH 2XWJB 1HNZQ 4RCNA 3R3OA 4B3RL 1SDFA 4IJHA 1FNUA 3VDYA 5M5XH 4PZ6A 4QUFA 3F2BA 2ZM6L 2BE5C 5ELBA 2Q2UA 1HFNA 1Y8PB 1M90C 3IAYA 1EIGA 1WTHA 2FFKB 4EVOA 4LFCQ 2OTJA 1PTOD 3KK7A 3VR4A 2RBMA 1L1OC 1OXUA 2JN4A 3E0EA 2IX0A 2RSOA 4G4KA 5AJ3Q 1NJIC 1HHVA 2K33A 1VQ6A 3CCVA 2X69A 3S1RB 1X54A 3SK6A 5I9PA 1K0SA 1SE8A 5EKKA 1GKHA 3TSSA 4FO2A 1PV4A 4LF8Q 1ILPA 1VQOA 4H7BA 3H09A 4BBSG 1V8QA 5M9OA 5IYCH 4GKKL 4FF1A 1Z47A 4C3HH 4F7XA 4U68A 3TN2A 5EQ0A 3R2IA 3F2DA 3TP6A 5I9OA 3KOJA 1MIUA 3J7ZC 2QILA 1MGSA 3CF5A 2EZVA 3TBIB 4A3MG 4JYAQ 2CWPA 4JI6Q 4NXMQ 1HUMA 4OIKA 2BH8A 1R4PB 2K1BA 4UAIA 3I4MB 3K80C 1BF4A 5C3EG 5ELDA 2YV5A 3L9AX 2ZM6Q 1PH8A 2JP1A 3GTLB 4C3IH 2J4XA 3I8ZA 3QJYA 4X3UA 3G7LA 2Z0SA 1VQBA 2UXDQ 4JI0Q 5JJLA 1CZGA 1LLRD 2YYZA 3ZJYC 2R92B 4A3JH 1LT6D 1N34L 2Z6KA 2F0HA 3OMGA 4YCWA 3UDIA 2F4IA 3CKIB 1PZKD 1U4PA 4IPCA 1XMQQ 3RLOA 3K5LA 4LF8L 1RODA 1G291 3I90A 5IGCA 2R93G 1F9RA 5BR8L 2EJMA 4ZQ3A 5CGKA 4F87A 1ONLA 4KY6A 2B63H 1IL2A 2RCFA 3TDQA 5ELCA 3QO2A 4JI1L 2B2WA 3MFGA 3S16B 1S5CD 2AHOB 4EQOA 1B1ZA 3HOVG 1BBXC 4L5RC 3I4LA 1Q1EA 2HDLA 4CJ0B 5ELEA 1ESFA 1SMYC 5FOBB 3I4NB 1KLUD 5I2YA 2RDGA 2O2LD 3P75A 3MTSA 3C1EA 3E5SA 2VUMG 2CHBD 4QF4A 2XRQD 3J81E 3RMHA 2UXCQ 2KCNA 1N33L 3FKIB 1GUSA 3IL8A 3S14H 1PTOF 2KENA 1HNWQ 3FP9A 3NTHA 4YIJA 3H15A 4C3JB 1BCPC 1HRJA 1VDZA 2WB1B 2VW9A 3M7NA 3PO2H 1WI5A 1E2ZA 2LFNA 1TWHH 1FNVA 1M4VA 4ILWA 5IGDA 5JVH3 1SE2A 3RD4A 4A3EH 2AQ1B 1F77A 3I4NG 3KDFB 2DNCA 3S2HB 4JV5Q 2B2YA 3BDOA 5JVG3 2F0GA 4A76A 4XT1B 3EBEA 1IBMQ 4J15A 3CRLC 4QL5A 2L0CA 4DPGA 2CQAA 2EYPA 2ZXOA 4A3LH 1HR0Q 1PYBA 2YTVA 1CKOA 2PQEA 4OWXB 1CA6A 1IYUA 4CJ1B 4IO9A 2QEJC 1Y1WH 1TQOA 1DXMA 1B7YB 2A74C 4B3SQ 3W1BA 1SYBA 2M00A 2NN6I 2RKSA 2EDGA 5CBEE 4IFDJ 5EBDA 3TP8A 2Z9HA 2K28A 4HIOA 2F3WA 1G2TA 2UU9Q 1DYQA 1EEID 1UAPA 3PO3B 1ZXTA 2VQEL 4A3KH 1WTRA 2F4VQ 1Q86C 5C44G 4IUUA 2NUCA 1HNXQ 4B3MQ 3W2DA 1II3A 5KYIA 4BA1I 3TS0A 3JAME 4DK6C 3SHLA 4ZUJA 1J5EQ 1JJ2A 2KUMA 2R6GA 4R4CA 2E2JB 1CUKA 1C4QA 2CW0C 4LK1C 4P73A 4GKJL 1J9OA 3CC2A 3I7FA 4IJLA 3MXNB 3RN5A 2ID0A 3GV6A 1U4RA 1WTPA 3VR6A 4UP8A 4O0AA 5EAYA 4OWWB 1IBML 4DR3Q 3ULPA 1SEBD 4OL7A 4YCUA 1EOVA 1PDQA 1AW7A 5K5PA 3A5UA 5C4JB 3STBC 2GN5A 3K7AH 4K2KA 4V0BA 1LM0A 3HOUH 1STGA 3KLRA 4N9PA 1QUQB 1EY9A 2KBNA 4LMQD 5BN3A 2JYOA 1SBBB 1IYVA 3K7UC 3K58A 2VQEQ 3I91A 1STHA 1JC7A 3HOUG 4DV1Q 4RA8A 2Q2TA 1FGBD 2F1MA 4OIJA 1QZGA 1K8GA 3AMUA 4I65A 2MFIA 3IFDA 1N32L 1O78A 2NYZD 3HKSA 5C0XG 3R93A 1VQDA 2MO0A 2OTLA 4L5TA 5GADC 4A3CH 3AFQA 2K5NA 4BBSH 1N8RC 1I4HA 1ASYA 3NPPA 1A63A 1MJEA 4LF5Q 1CQVA 4LUZA 4A3DB 4RH6A 1DOKA 4IQZA 2GA4B 2G5DA 1SYGA 4O2DA 3U4VA 3S2DH 5C4XH 1FL0A 1MBYA 2EYHA 1TWAB 1O80A 1HA5A 4FXDA 3KBGA 4BBRG 1MHWC 3EN2A 4AH6A 3BZDB 3KDFA 3EJIA 3LGJA 2R7ZG 1Y69U 1D5MC 1EWCA 4HIKA 2H4OA 1VQKA 1I4XA 1X3PA 1TVXA 3J81i 3NELA 5C4ZA 1SYCA 3A54A 3ULLA 3P7JA 4A4IA 4GNXA 1RTOA 5C44B 2PNRC 4IPHA 3VA7A 4AQYL 4FF2A 1B9MA 1TWHB 2PZWA 3BYTB 4IUQA 2K6AA 2EYMA 1X65A 2K01A 2C9OA 4A3MH 4ZCKA 2ATWA 3K6OA 3Q0AA 4RGTA 2IT1A 4DAYB 5IY0A 2EYFA 1LACA 1CHQD 3H0GB 4ALPA 2RDHA 1YZ6A 4QCLA 3D6CA 1IW7C 3MXGA 5IWAL 1YNXA 1D6EC 3LWUA 4L5SA 1PRTD 2JA7G 3H3VH 2EY5A 3KLWA 3DWQA 3GP7A 4PNYA 4FP5D 3PIPA 1AH9A 1GHJA 3IFTA 5CV4A 4EX5A 3KF8B 3HKZG 4I7ZC 1QJOA 1TKWB 1LTSD 4MZ9A 1JOOA 1TWGB 3GTMB 1NBWA 1EYAA 4A75A 1HTPA 3GTGB 3IRBA 1EOTA 3OW7A 2DNEA 4NXML 3FPUB 4HCSA 2PI2E 4DUZQ 1HTLD 3JAMi 5AFWA 1PH4A 1NMGA 1H9KA 1LO5D 3CCLA 2NVQB 1X3FA 1JR0D 2FJ2A 3SE0A 4NB3A 5M5YH 1L1OB 4KHPL 2K5WA 1F2YA 5M3FB 4RGMA 4CGYB 4HIMA 4X62Q 4KV6A 2IHEA 3L0OA 2KHJA 3BU2A 4GKKQ 3HOYG 3R2TA 5M3MG 4JBMA 3TP7A 4GKJQ 4RMFA 1H9RA 5IGEA 1HUNA 1EY6A 4RG1A 3FVQA 4H0LC 1IBKQ 3MAQA 2KEDA 4H02A 5T1GA 4IFDH 5M3MH 1PTOB 3DEOA 1EQRA 1S5ED 3SK5A 4C3IG 1TY2A 1EY5A 1TS3A 1J8IA 4HTHA 1G6PA 2WIIB 1SR3A 5M5YB 1OXXK 4UP7A 2F0SA 1CA5A 4TKOB 3VA5A 4MIUA 5CV8A 3BVMA 5DAUA 4LUVA 3HOUB 1E22A 1DM0B 4LF7L 3H91A 3HOZH 4HIDA 3PIOA 3T53B 5HGQA 2ZT9C 1VQ5A 1RKNA 1RJTA 2FXQA 2XGTA 5C3WA 4LF7Q 5A35A 5IYCG 4CDCC 1VQHA 3GTQH 2A6HD 3WDNA 1R9TB 3S1QH 4DAMA 1I50H 3E9HA 1SE3A 1DJRD 1VQ7A 1KAWA 2RDFA 1TR5A 2IW3A 3HGBA 1QOHA 1V1OA 2EIFA 2WB1G 3A5ZB 1BO0A 2RHQB 1K28A 3T16A 3HOVH 1B3QA 4CKBA 1QCBD 1B2TA 3AB9A 4DV1L 4AQYQ 2YTXA 4A3FH 2JA5H 4R1JA 4L63B 3KJOA 1HZAA 1RL2A 3BS1A 3A8IE 3ER0A 4JI8Q 1XTDA 5EPKA 1V1PB 2ZJQA 2IHFA 3T1YL 1TS4A 5JOBA 2OWOA 4A3IG 4A3CG 2HIVA 1I50B 2DN8A 1PH1A 3E9IA 3D4RA 5JEAH 1F2ZA 2O5JC 1HJPA 1EL0A 5C0XH 4Q5VA 4DFAA 3I4OA 3C46A 2M9VA 3BYYB 3CP0A 4GN5A 1L2FA 4YY3Q 3U58A 1U4MA 4BY1B 4HSPA 3TQYA 2N8NA 1MKHA 2D5DA 3U9SA 3BG3A 2HT1A 1LTGD 1TT2A 4DV2Q 4K5VA 5C44H 3T51B 3KF6B 2F3IA 1G6ZA 5M5XB 5GAEC 1ASZA 4KD3A 5I6YA 4DXGA 1NR2A 1LTRD 1CM9A 3NXWA 4RGOS 4DV2L 4MTNA 1AZPA 3CXCA 2K7VA 1LUZA 1PZID 4K6DA 1QILA 4MN3A 3T4AC 4C2MH 4C3HG 2A68C 4XDXA 4C2MB 4B3RQ 2F0EA 1EIHA 3I55A 4PMWA 4DA2A 1E0BA 1SNQA 2NVTH 2WB1E 1HQMC 2LS01 3BZCA 3NHHA 4KHPQ 5JJZA 1NUCA 4IUNA 1QNKA 2SNSA 3CC4A 4QB4A 3MC0B 5CORA 1SNOA 2BDOA 1T9HA 1HR0W 2AUKA 1SNDA 1STNA 1HR0L 3MXNA 3H6MA 2B2WC 3MEFA 2A5HA 5K36H 2Q8IB 3PO3H 4IFDG 3NTIA 2J0TD 1NSNS 4U673 3VYTA 3CAMA 4NW2A 5CV9A 5FO8B 1JWSD 4CJ2C 3NBHB 5E4XA 3SGIA 4JYAL 1V9PA 4LNQA 3CD6A 2WAQG 3HOYB 5M3MB 1SLJA 1SNMA 1ET6A 1C48A 1JJCB 4UPAA 4LWCA 2WACA 4FF3A 4X62L 4KJNA 5FKAC 1MD2D 3CPWA 3J81j 1STEA 1SJHD 1XXGA 4EQNA 4QGUA 4DR1L 2E5LL 1LTBD 3U9OA 2VY3A 3GTPB 1A8VA 3QWNA 5KYLA 2K5DA 3RZDH 2ES2A 4AIMA 4JI6L 1KTKA 3GO5A 3RNUA 4OO1H 3ERQA 2UXBQ 2LMCB 2HHHQ 1ICFB 3NP8A 4HMIA 2EE1A 4JOIC 5IT9L 2MO1A 1TWCB 5T1IA 4IOCA 3NSWA 3LNNA 3J7YW 2I5LX 1EIYB 1Z6HA 2QCPX 4Z9CB 4L6TB 4C56C 4A3KG 1YJWA 4G7ZC 1WCMB 1LYLA 1ET9A 2B2TC 2A69D 4PV1C 4AYBB 1STYA 2VUMH 2Z4IA 4OX9Q 1A62A 5FLXL 2R7ZB 2CWAA 2EJFC 2CFMA 1D1IA 1NE3A 2B2UC 3K5OA 1PMRA 2D2CC 2K4KA 1PH9A 4LFBQ 2Z6KC 3DWPA 1RF2D 1BNZA 3G71A 2JA6B 1WFQA 1G51A 2QKIC 5K36G 3A56A 4PZ8A 1EYDA 1VQGA 3G4SA 5ELOA 1A2TA 3EFXD 2MUYA 4I7AA 4KY7A 4DV6Q 1RHPA 4NXNQ 5LMUL 2TMPA 3DUZA 5CC4A 3S2HH 1X3QA 1UNSA 1LTLA 4RKBA 1ENCA 1NR4A 1QVFA 2Q8RE 3J7AF 4CDFC 2OXPA 5GQOA 4TQUS 4X6AH 1RD9D 3D8GA 4DV4Q 1UE6A 2TSSA 4DR5L 1P8LA 1KDBA 1GUGA 1F9QA 4BA2I 4FNFA 4BBRH 1X3GA 4ZK9B 2B2TA 4BY7H 2IWHA 2JA8B 2B8FA 1B44D 3ITPA 4JI4Q 1E7ZA 2OQ0A 4EQ5A 1PH3A 3L3OC 3PUXA 2P5ZX 4TSSA 1K3BC 3OYYA 3T1YQ 1Y1VG 1SFOB 5LMNL 2F03A 2HCCA 2R7FA 1W2BA 1Y1WG 1F2LA 3M9BA 2KCCA 4LF6Q 3HKZE 4LFCL 3I56A 2B63G 3OW2A 5ISRA 2D0PA 2X6LA 3A7LA 2NWGA 5IGGA 2G9DA 2AUJD 4LF6L 2R93B 2R93H 2O4XA 1KDAA 3Q6SA 4HEDA 1VS0A 5J3BA 5JEAG 4DNRB 2WV6D 2LKVA 1BUVT 4GOPA 3SR1A 2IY5B 4IUTA 1XJVA 3M7GA 1T5EA 3I3CA 4PZ7A 4Y7NB 3TP5A 1JT8A 2H5XA 3A55A 4DAPA 3CU7A 1BBUA 1IYJB 1H9SA 4CKCA 4DV3L 1B70B 4K8JA 4B9XA 3DXJC 4Q0FA 1PH6A 2Q2HA 2F4VL 3M4PA 4RCOA 2RQXA 4XQNA 3J7A5 1S72A 1DD2A 2HUGA 3MXUA 2JE6I 3NQTA 2A68D 2MP1A 3HOYH 1SNCA 4JG2A 3T1HQ 2A73B 3SVMA 5FLXE 2KCMA 4QMGA 2KOLA 4A93H 2ZXPA 2GVBA 4X65L 3GV3A 2K5HA 1A2UA 1VQIA 3GTPH 2HHHL 3SK8A 2HD3A 5D14A 3ZYYX 3CHBD 2QDBA 1YIJA 3MA2B 2HQLA 1N34Q 3S15H 3RZDB 1YBYA 1KRSA 2E2HH 3BJUA 1GD7A 3GTKB 4X66L 2B2YC 2EVBA 1WCMH 4O42A 5EBCA 4P75A 4G7HC 1IBKL 5C0XI 3MXPA 1VQPA 1K8OA 1LT5D 1TS5A 1Q82C 1UWVA 1G8ZD 4J8QA 4JVZA 1XPRA 2A1AA 4H44C 4LJZC 3G6EA 2K75A 1HCZA 4GN4B 4PMCA 1VF5C 3HOVB 5IIFA 1F2MA 4A3JG 3PIP3 4F8MA 2RHSB 2JEAI 1EY7A 2PQAB 1NAPA 3J80L 1V1QA 3H3VI 5JAVA 1Q90A 3GTKH 5F2DA 2XRSD 5EKIA 3M85A 3M3YH 1SYFA 3UDXA 1WTVA 4UHVA 1FGUA 2B2VA 3FKIG 2CVRA 1IKMA 1N33Q 4APVA 4A3EG 4POGA 1VQEA 1TY0A 3S1NH 3S2DB 4J6HA 4DGZA 1PH7A 1K73C 3S17H 2O5IC 1GM5A 4A3MB 1KL9A 1TWAH 1SXTA 3SDZA 5G3LF 2F0KA 3R8BA 3F8TA 1JORA 1W3SA 4A3GB 1PH5A 1KIXA 3W5OA 5C4HA 4B08A 2B8GA 1EWHA 5E3FA 5GAHC 4DKAC 2JSOA 2LY7A 2Y0SG 4A3FB 4OWTB 2I5MX 3JAML 1AE3A 3RZOH 2E2IB 1Q1BA 5IP9G 4JK1C 1MSHA 4JI7Q 4KKUA 4FXKC 4A3EB 4J1MA 5C0XJ 4FVMA 1DGSA 1YHQA 3TREA 2G9HD 2NN6H 2F0FA 1JWUD 4LFBL 2RCNA 1CTMA 2A6HC 2RA4A 3HOWG 4L5QA 3AU7A 2N88A 3SXHA 1O7ZA 4XYQA 3D31A 3GTOB 1D2BA 2OF1A 1RDPD 3HG9A 5IE8A 4BY1H 5C3XA 4RAUC 5LMUQ 3M4OH 2F0DA 3VYRA 3RLFA 1GXDC 3UE0A 2ZTEA 1W6KA 1RTNA 3KF8A 5HY6A 4DV5L 1XNQL 3F2CA 3OPOA 4UY8C 3HFZB 1EWIA 1Y1WB 1YI2A 2PNHA 1D8LA 1GUWA 2SEBD 2PZUA 3W3AA 4DV4L 4DR5Q 1XYIA 3EQLC 1TXYA 2K5QA 1JCKB 3F2UA 4IPDA 4V190 4DK0A 2QF7A 3GTOH 2ICEC 3PSIA 1UEAB 1JB7A 4DK3C 4HAEA 3CPFA 4HJ9A 1XWEA 1QZHA 3NQIA 4B3SL 3KLSA 3STBD 1VQ4A 1PZJD 1K83B 1L1OA 2K5VA 2NVXH 2KVMA 2NVXB 5A2QL 2ZJRA 1NCVA 1U5KA 2CH4A 4R8IA 3CCUA 1OXVA 4R4QA 3J81L 4C3HB 3MEHA 3VYUA 1CSPA 1KAAA 3DMUA 4KN7C 2JQOA 2F0LA 3RN2A 1A15A 2PW7A 1VQFA 3QIAA 5C4JH 3V2TA 2EPBA 3PV0A 5IODA 2JK8A 1SE4A 3HRZC 1CK1A 3HOXH 3HOXB 5TSSA 2BH2A 3JAMc 2NTTA 1I4QA 3BVGA 1FNWA 2R7DA 2B2VC 3A7AB 2F0MA 1B3AA 2KEEA 2FMCA 3Q23A 2BOSA 4BBSB 4XXEA 3DLLA 2VNUD 1Q8IA 1R9TH 2OQKA 1AN8A 2FMMA 3D3RA 2EYJA 3Q24A 1Q7YC 3DHQA 3KFUA 2KJXA 2DY8A 2N55A 3C3LA 1KABA 1HXYD 4WJ4A 1SAPA 1O7LA 2VUMB 2KQ3A 4K14A 3CQZH 1PHJA 1I3QB 1U0LA 1YITA 4B9WA 2ICIA 3I4MH 4HN7A 4ME3A 1WOCA 5I2XA 2MGSA 3TZUA 2B2UA 2KCTA 4H13C 1PTOC 4YWKA 4NXNL 2B63B 1VQMA 4CHTB 2E5LQ 3J7AV 3WOFA 1MSGA 3GD7A 3NWSA 2IX3A 1YNJD 2EYLA 1EU3A 4A3DH 1KNEA 3NWTA 4RHSA 1N36L 3H94A 5EJWA 3KUPA 3I4NH 4JOIA 1WTXA 5D3IB 4DN4M 3OTOQ 1V1PA 1SJED 2A6EC 4E6IA 4JI7L 3OHXC 2HQEA 3OSOA 3X3MA 1Q81C 1R4QB 5J39A 4A3FG 4G7OC 4DUYQ 4B3TQ 1FYCA 1L0YB 3PCOB 5M3FG 2B3GA 1UE5A 5GAGC 1LTID 1ILQA 4DUYL 1STBA 3C1FA 1B4OA 2XN9C 1IW7D 2B39A 2I07B 1NMFA 5M5WB 3U4ZA 1SYDA 4A3BH 4XIGS 1BCPD 1D5XC 4ID6A 2IPKD 1LT4D 1GUTA 4DV5Q 1VQLA 1SFOH 5LMNW 1WTOA 5KNDA 1CHPD 3HOZG 4DNIA 1XX8A 3M4OB 2F0PA 1YHAA 4HMJA 3PF5A 5CMDA 3VR2A 4ZKCB 1XNRL 4JPBW 2K14A 4HR7B 1S40A 1E1TA 3RR5A 1K0RA 2YTYA 4WJWA 1I6HH 2WKDA 3HEJA 1TWFH 3HS0C 2AKWB 5HURA 2JA8H 4R8NA 3UDFA 1JJGA 3S1MH 4K8IA 2XNAC 1XTCD 4LFAL 4RGNA 2Z1CA 5IYDG 1Q46A 4YCVA 1PRTF 2WAQE 5IP7H 1KLGD 2F0JA 2ENBA 3W1GA 1TWGH 4KMUC 4DR2L 5IOCA 3GTMH 1S5DD 3JC66 1PVOA 2JXMB 4N9TA 4XYOA 4NPSA 1A6XA 1SMYD 2MNAA 3LX0A 2NVTB 1YVCA 5JPNC 2F0WA 1EQTA 4DR1Q 1XNQQ 2QA4A 2PI2A 4CDEC 1ZKOA 2RVLA 1EU4A 1C0AA 4GOPB 4XQJA 2DJFC 1NY4A 1VQ9A 1HZBA 2B29A 2LXJA 2J7ZA 2UXDL 5CBAE 2ZTDA 4LUOA
chains in the Genus database with same CATH topology
4DV6Q 4UP8A 4GNXB 2VL6A 4O0AA 5LMUL 5EAYA 4NXNQ 4OWWB 3S2HH 4Y52H 1RIPA 1LTLA 1IBML 4DR3Q 4JBKA 3L7ZC 3ULPA 4YCUA 1EOVA 2VQFQ 1OXTA 4QQBX 1CKNA 4OXPA 5IWAQ 3A5UA 1QVFA 3CMAA 3STBC 2GN5A 4KLKA 3K7AH 4LF5L 2UUBL 1HH2P 2JEBI 5GQOA 1LM0A 4DV0L 4TQUS 3UDGA 4JV5L 4X6AH 3HOUH 4JC0A 1OXSC 1UE6A 2NVYH 4DV4Q 1P8LA 4MNOA 3CCEA 4DR5L 1C9OA 1X55A 4DV6L 4HJAA 1N32Q 4BA2I 1QUQB 2KBNA 4BXXH 4A3LG 4BBRH 2EQSA 3K7UC 5H1SE 1X3GA 3ICEA 2LSSA 3HOXG 3CC7A 2VQEQ 4DR2Q 4JI3Q 4BY7H 3HOUG 1BBWA 4DV1Q 4BY1G 2Q2TA 1E7ZA 2OQ0A 4EQ5A 1QZGA 1K8GA 4JI4Q 5IYDH 1PH3A 2JJQA 2MFIA 3CCQA 4JI0L 3PUXA 2UUAQ 1XNRQ 1N32L 1P16A 2UXBL 3OYYA 3T1YQ 2UUCL 1Y1VG 3HKSA 5C0XG 1UE7A 2K52A 5LMNL 1KRTA 3TRZA 3PUWA 2R7FA 1VQDA 4FDBA 1W2BA 2D0OA 2MO0A 1Y1WG 1QVGA 2E8GA 1PA6A 2OTLA 4L5TA 4YWMA 3M9BA 5AJ3L 5GADC 4DV7Q 4LF6Q 3AFQA 2K5NA 4BBSH 1CKMA 3HKZE 4LFCL 4A3CH 1N8RC 3I56A 2B63G 3OW2A 2D0PA 1ASYA 1A63A 1S3OA 3PO2G 5ELNA 1MJEA 4LF5Q 3HOWH 4LUZA 1HNWL 4GLVB 4LF6L 2R93H 2ASBA 2D62A 3BZKA 5J3BA 1VS0A 4O2DA 5JEAG 3U4VA 2PQAA 3S2DH 5C4XH 4LF4Q 1FL0A 4YHHQ 4A3BG 1YJNA 4GOPA 1XPUA 1VQCA 2QEXA 2IY5B 3NEMA 1XJVA 2YU9H 2ZTCA 1I3QH 4PZ7A 1JT8A 4BBRG 2H5XA 3PO3G 4BXXG 3EN2A 5IP7G 4AH6A 4GNXC 1MJCA 3KDFA 3LGJA 1BBUA 1IYJB 2N49A 2PMZE 2R7ZG 4DV3L 1B70B 4GOPC 1FVIA 4A3GH 4HIKA 3U50C 1PH6A 1GVPA 1VQKA 4JI3L 1B8AA 1YEZA 3KJPA 2Q2HA 3J81i 2F4VL 5IYBG 3NELA 3M4PA 3J7A5 1S72A 1KC8C 2JE6I 3ULLA 3GDEA 4XTCS 5E7NA 4A4IA 1J6QA 4GNXA 1KQSA 3HOYH 2UXCL 2NZOA 2K50A 4IPHA 4JG2A 3T1HQ 4DV0Q 4AQYL 4QJFA 2VQFL 1KD1C 5DLQE 1IXRA 4KHZA 5C4XG 1E1OA 2KCMA 1XMOL 1CKNB 4A93H 4K0KQ 1KXLA 3PUYA 1V43A 2GVBA 1O7IA 4X65L 1X65A 2N3SA 1BVSA 2K5HA 4A3MH 1K8AC 2ATWA 1VQIA 3GTPH 2HHHL 4QY7A 3M4QA 1FJGL 2AWNA 3RLNA 2IT1A 4IOAA 1YIJA 1EUJA 4JI1Q 4DAYB 5IY0A 4POFA 2HQLA 4A3IH 4WJ3M 1N34Q 4ALPA 2UU9L 3S15H 1YZ6A 5JJIA 5IWAL 3AEVA 2F52A 1YBYA 1YNXA 1KRSA 2E2HH 4HJ8A 2JA7H 1HNXL 3BJUA 1GD7A 4B3ML 3DM3A 3AYHB 4TVAB 5FLMH 4X66L 5IP9H 1SROA 1I94L 4L5SA 2JA7G 2ALYB 1Z9FA 4A3GG 5LMNQ 4JI5Q 2IX1A 3B6YA 3H3VH 1WCMH 2WFWA 2Q2IA 3KLWA 4P75A 4JI2Q 5C0XI 1VQPA 1IBKL 1EYGA 2JA8G 2JA9A 3PIPA 5C3EH 1Q82C 1AH9A 1UEBA 4DUZL 4IPGA 1UWVA 3J81c 1HNZL 2BA1A 1XPRA 4EX5A 2A1AA 2Y0SE 3KF8B 3WWVA 1H95A 3G6EA 2K75A 1JE5A 3D0FA 3HKZG 4GN4B 1IZ6A 2I5HA 2VZAA 4MZ9A 2N78A 2VS1A 4OO1I 3CMEA 4DR3L 4A3JG 1NBWA 2RHSB 2JEAI 3TEHB 4A75A 1UE1A 3FKIH 2PQAB 3IRBA 1X9NA 4K0KL 4B3SQ 3F1ZA 1V1QA 3H3VI 4NXML 3GTKH 4DUZQ 2PI2E 4JCVE 4DV3Q 3M3YH 3M85A 3UDXA 2DUDA 3JAMi 1K83H 3CCJA 1PH4A 1FGUA 3ERSX 1NMGA 4HJ5A 1PH2A 3FKIG 3KYHC 2AMCB 5GROA 1VQJA 3CCLA 1VQNA 1N33Q 1I5FA 1X3FA 4APVA 4A3EG 4POGA 1VQEA 3S1NH 1IBLQ 4A93G 1PH7A 4DR4Q 2OCEA 1K73C 3S17H 1CSQA 4X66Q 1GM5A 4NB3A 1KL9A 1TWAH 2QGQA 5M5YH 1L1OB 2A19A 2R7ZH 2NN6G 4LF9L 4KHPL 3F8TA 2L15A 1W3SA 4HIMA 4X62Q 1IBLL 2IHEA 1PH5A 1KIXA 3L0OA 4JI4L 2KHJA 3BU2A 3W5OA 4GKKQ 1X3EA 3HOYG 5M3MG 1PFSA 5GAHC 4JBMA 4GKJQ 4DKAC 4RMFA 2Y0SG 4LW1A 2E2JH 4OWTB 4RG1A 2EXDA 4JI2L 5FJ8G 2I5MX 1IBKQ 3GTLH 5IYBH 1AE3A 3RZOH 1Q1BA 4H02A 5IP9G 2CCZA 4JI7Q 5M3MH 4YY3L 3Q8DA 3J80c 1EQRA 2UUCQ 2C35B 1WYDA 5C0XJ 3L2PA 3PF4A 3CCMA 1DGSA 4P72A 1YHQA 1Q8KA 5JJKA 1G6PA 3TREA 1I94Q 1K9MC 1SR3A 3NENA 1OXXK 1KHIA 2DGYA 3KF6A 2RCNA 5BR8Q 1HZCA 1VQAA 4UP7A 4LFBL 4P74A 4YWLA 3HOWG 2KHIA 4L5QA 5FLMG 3D31A 4LUVA 2ZJPA 1YHBA 1E22A 4JI5L 4LF7L 3K81C 5IE8A 4BY1H 2LXKA 1VCIA 4HIDA 3PIOA 1M1KC 4LF9Q 3HOZH 5HGQA 5FLXc 5LMUQ 4GS3A 1VQ5A 4LF4L 1Q12A 3M4OH 2E2IH 1EQQA 3RLFA 1HNZQ 2FXQA 2XGTA 3UE0A 4LF7Q 4B3RL 2ZTEA 1A0IA 4IJHA 5IYCG 4AYBE 3VDYA 5HY6A 5M5XH 4DV5L 4PZ6A 1XNQL 4R4IA 1VQHA 3F2CA 4UY8C 3F2BA 2ZM6L 3GTQH 3HFZB 3S16H 3S1QH 1EWIA 1YI2A 2PNHA 4DAMA 2Q2UA 1D8LA 1I50H 1M90C 3E9HA 4DV4L 4DR5Q 4LFCQ 2OTJA 1VQ7A 1TXYA 1KAWA 1L1OC 1OXUA 2EIFA 2WB1G 3A5ZB 2RHQB 3E0EA 4IPDA 1N9WA 2IX0A 5AJ3Q 3HOVH 1NJIC 4A3DG 3GTOH 1VQ6A 3CCVA 3PSIA 1JB7A 1X54A 4DK3C 4DV1L 2YTXA 4AQYQ 4A3FH 3CPFA 2JA5H 4HJ9A 4R1JA 1QZHA 3KJOA 1C7YA 1HZAA 1RL2A 1SE8A 4B3SL 1GKHA 4LF8Q 4DR7L 3STBD 1VQ4A 1E3PA 2AWOA 5FJ8H 1VQOA 3ER0A 1PYSB 4C3JH 1PV4A 2UUAL 4JI8Q 1XTDA 4BBSG 3S24A 2ZJQA 1L1OA 2K5VA 2NVXH 5IYCH 4GKKL 2IHFA 1X6OA 2ZJRA 1U5KA 3T1YL 4YHHL 3CCUA 1FJGQ 1Z47A 1OXVA 4R4QA 4C3HH 4A3IG 4OONA 2OWOA 3K8AA 3PUZA 1Y1VH 4A3CG 1CSPA 2HIVA 4OX9L 1PH1A 3E9IA 2XTIA 3F2DA 3ULJA 2JQOA 3KOJA 1MIUA 3RN2A 3J7ZC 3CF5A 2V1CC 4JBWA 1HJPA 1VQFA 5M5WH 4A3MG 3A0JA 4JYAQ 5C4JH 3AQQA 2CWPA 3I4OA 4JI6Q 3PV0A 4B3TL 4NXMQ 2JK8A 1AE2A 2BH8A 3CW2C 3CP0A 3H0GH 4GN5A 1L2FA 4YY3Q 3K0XA 3U58A 4BY7G 1D7QA 3HOXH 3K80C 2BH2A 5C3EG 3JAMc 4IFDI 2YV5A 3TQYA 2ZM6Q 1PH8A 2N8NA 1MKHA 2R7DA 4C3IH 2HT1A 1EFWA 2WP8J 2Z0SA 4DV2Q 4DR6L 5C44H 1VQBA 2UXDQ 4JI0Q 3KF6B 2F3IA 5JJLA 3EIVA 3ZJYC 2YYZA 5GAEC 3DLLA 4DV7L 2A8VA 2VNUD 4A3JH 1ASZA 1R9TH 2OQKA 2CQOA 1N34L 2Z6KA 4DV2L 4DR6Q 1Q7YC 4MTNA 3KFUA 4YCWA 3UDIA 3CCRA 4IPCA 4AYBG 1XMQQ 3CXCA 3RLOA 4KI0A 1K3RA 4WJ4A 1LUZA 2NZHA 4LF8L 4DR7Q 1X56A 1G291 3CQZH 1PHJA 4P71A 1U0LA 2GVAA 4Y7NH 1SRUA 4C2MH 1YITA 2R93G 3I4MH 1OTCA 4B3RQ 4ME3A 5BR8L 1WOCA 1GO3E 3I55A 4PMWA 2KCTA 4GLXA 4YWKA 4NXNL 2NVTH 2WB1E 1XPOA 1VQMA 2E5LQ 2B63H 3PUVA 1IL2A 3BZCA 3GTGH 3GD7A 4KHPQ 4GLAC 3PGZA 4JI1L 3CC4A 3I4MG 2AHOB 4A3DH 3HOVG 4JBJA 4GN3B 1T9HA 1VQ8A 1Q1EA 1HR0W 4L5RC 1N36L 1HZ9A 1J5EL 2NVQH 1HR0L 4R4OA 3MEFA 3I4NH 4JOIA 4X64Q 3OTOQ 3GTJH 2VUMG 3PO3H 4IFDG 1BKBA 3S1RH 4JI7L 5M3FH 2UXCQ 1N33L 1Q81C 3CAMA 4LFAQ 3S14H 2KENA 1HNWQ 4A3FG 1WCMG 3FP9A 4DUYQ 3H15A 4B3TQ 4X65Q 3NBHB 3PCOB 4OO1G 3SGIA 5M3FG 4JYAL 2B3GA 1UE5A 1SN8A 1V9PA 5GAGC 2VW9A 3M7NA 2R92H 1WJJA 1WI5A 4LNQA 3PO2H 1TWHH 3CD6A 4DUYL 2WAQG 3H0GG 1SLJA 4UPAA 1JJCB 1NMFA 4LWCA 1E24A 4A3EH 4X62L 3I4NG 2BA0A 3KDFB 3U4ZA 3CPWA 1Y14B 3TS2A 4JV5Q 3J81j 4A3BH 4QGUA 4XIGS 4DR1L 4UP9A 2E5LL 2JA6G 3CCSA 2VY3A 4A76A 1A8VA 4DV5Q 1NTGA 1XMOQ 1SFOH 1VQLA 3J80i 3EBEA 5LMNW 4AIMA 3RZDH 2ES2A 4JI6L 2RF4A 1XMQL 3HOZG 3GO5A 4DNIA 1IBMQ 4J15A 3T1HL 3RNUA 1YHAA 3OTOL 3PF5A 2UXBQ 4QL5A 2CKZB 3I2ZA 4DPGA 2HHHQ 1XNRL 4JOIC 4A3LH 2K14A 1PYBA 2MO1A 1HR0Q 2YTVA 4IOCA 1CKOA 4OWXB 2JA6H 4IO9A 2I5LX 1Y1WH 1S40A 1E1TA 3FHWA 1B7YB 4QIWE 3RR5A 1K0RA 3W1BA 4X64L 2UUBQ 1YJ9A 1EIYB 2YTYA 1I6HH 2NN6I 3A74A 4A3KG 4JI8L 1TWFH 2HIXA 1YJWA 2AKWB 2JA8H 3UDFA 1JJGA 3S1MH 4IFDJ 1LYLA 4PG3A 4LFAL 4HIOA 5IT9c 2UU9Q 5IYDG 1Q46A 3AFPA 4YCVA 2WAQE 2VUMH 5IP7H 4OX9Q 1A62A 2R92G 3W1GA 1TWGH 2VQEL 4DR2L 4A3KH 4DR4L 3GTMH 2CWAA 3JC66 2F4VQ 1Q86C 5JEAJ 5C44G 1PVOA 2CFMA 1NE3A 1HNXQ 4B3MQ 4NPSA 4HJ7A 2MNAA 4BA1I 3TS0A 1YVCA 4DK6C 4R4TA 2K4KA 2MQHA 1J5EQ 1JMCA 4DR1Q 1XNQQ 1PH9A 1JJ2A 1QUQA 2QA4A 1N36Q 3G48A 3UE1A 4LFBQ 2PI2A 2Z6KC 2R6GA 1EIFA 1SMXA 4R4CA 1CUKA 4GKJL 4P73A 1TWCH 3G71A 1C0AA 1WFQA 4GOPB 1G51A 3CC2A 1QVCA 3I7FA 1NY4A 3MXNB 4IJLA 3RN5A 1VQ9A 5K36G 1HZBA 2ID0A 2B29A 4PZ8A 1L0WA 1VQGA 2LXJA 3G4SA 2I0QA 5ELOA 2UXDL 2JA5G 2ZTDA 4LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 Q;  4UP8 A;  4GNX B;  2VL6 A;  4O0A A;  5LMU L;  5EAY A;  4NXN Q;  4OWW B;  3S2H H;  4Y52 H;  1RIP A;  1LTL A;  1IBM L;  4DR3 Q;  4JBK A;  3L7Z C;  3ULP A;  4YCU A;  1EOV A;  2VQF Q;  1OXT A;  4QQB X;  1CKN A;  4OXP A;  5IWA Q;  3A5U A;  1QVF A;  3CMA A;  3STB C;  2GN5 A;  4KLK A;  3K7A H;  4LF5 L;  2UUB L;  1HH2 P;  2JEB I;  5GQO A;  1LM0 A;  4DV0 L;  4TQU S;  3UDG A;  4JV5 L;  4X6A H;  3HOU H;  4JC0 A;  1OXS C;  1UE6 A;  2NVY H;  4DV4 Q;  1P8L A;  4MNO A;  3CCE A;  4DR5 L;  1C9O A;  1X55 A;  4DV6 L;  4HJA A;  1N32 Q;  4BA2 I;  1QUQ B;  2KBN A;  4BXX H;  4A3L G;  4BBR H;  2EQS A;  3K7U C;  5H1S E;  1X3G A;  3ICE A;  2LSS A;  3HOX G;  3CC7 A;  2VQE Q;  4DR2 Q;  4JI3 Q;  4BY7 H;  3HOU G;  1BBW A;  4DV1 Q;  4BY1 G;  2Q2T A;  1E7Z A;  2OQ0 A;  4EQ5 A;  1QZG A;  1K8G A;  4JI4 Q;  5IYD H;  1PH3 A;  2JJQ A;  2MFI A;  3CCQ A;  4JI0 L;  3PUX A;  2UUA Q;  1XNR Q;  1N32 L;  1P16 A;  2UXB L;  3OYY A;  3T1Y Q;  2UUC L;  1Y1V G;  3HKS A;  5C0X G;  1UE7 A;  2K52 A;  5LMN L;  1KRT A;  3TRZ A;  3PUW A;  2R7F A;  1VQD A;  4FDB A;  1W2B A;  2D0O A;  2MO0 A;  1Y1W G;  1QVG A;  2E8G A;  1PA6 A;  2OTL A;  4L5T A;  4YWM A;  3M9B A;  5AJ3 L;  5GAD C;  4DV7 Q;  4LF6 Q;  3AFQ A;  2K5N A;  4BBS H;  1CKM A;  3HKZ E;  4LFC L;  4A3C H;  1N8R C;  3I56 A;  2B63 G;  3OW2 A;  2D0P A;  1ASY A;  1A63 A;  1S3O A;  3PO2 G;  5ELN A;  1MJE A;  4LF5 Q;  3HOW H;  4LUZ A;  1HNW L;  4GLV B;  4LF6 L;  2R93 H;  2ASB A;  2D62 A;  3BZK A;  5J3B A;  1VS0 A;  4O2D A;  5JEA G;  3U4V A;  2PQA A;  3S2D H;  5C4X H;  4LF4 Q;  1FL0 A;  4YHH Q;  4A3B G;  1YJN A;  4GOP A;  1XPU A;  1VQC A;  2QEX A;  2IY5 B;  3NEM A;  1XJV A;  2YU9 H;  2ZTC A;  1I3Q H;  4PZ7 A;  1JT8 A;  4BBR G;  2H5X A;  3PO3 G;  4BXX G;  3EN2 A;  5IP7 G;  4AH6 A;  4GNX C;  1MJC A;  3KDF A;  3LGJ A;  1BBU A;  1IYJ B;  2N49 A;  2PMZ E;  2R7Z G;  4DV3 L;  1B70 B;  4GOP C;  1FVI A;  4A3G H;  4HIK A;  3U50 C;  1PH6 A;  1GVP A;  1VQK A;  4JI3 L;  1B8A A;  1YEZ A;  3KJP A;  2Q2H A;  3J81 i;  2F4V L;  5IYB G;  3NEL A;  3M4P A;  3J7A 5;  1S72 A;  1KC8 C;  2JE6 I;  3ULL A;  3GDE A;  4XTC S;  5E7N A;  4A4I A;  1J6Q A;  4GNX A;  1KQS A;  3HOY H;  2UXC L;  2NZO A;  2K50 A;  4IPH A;  4JG2 A;  3T1H Q;  4DV0 Q;  4AQY L;  4QJF A;  2VQF L;  1KD1 C;  5DLQ E;  1IXR A;  4KHZ A;  5C4X G;  1E1O A;  2KCM A;  1XMO L;  1CKN B;  4A93 H;  4K0K Q;  1KXL A;  3PUY A;  1V43 A;  2GVB A;  1O7I A;  4X65 L;  1X65 A;  2N3S A;  1BVS A;  2K5H A;  4A3M H;  1K8A C;  2ATW A;  1VQI A;  3GTP H;  2HHH L;  4QY7 A;  3M4Q A;  1FJG L;  2AWN A;  3RLN A;  2IT1 A;  4IOA A;  1YIJ A;  1EUJ A;  4JI1 Q;  4DAY B;  5IY0 A;  4POF A;  2HQL A;  4A3I H;  4WJ3 M;  1N34 Q;  4ALP A;  2UU9 L;  3S15 H;  1YZ6 A;  5JJI A;  5IWA L;  3AEV A;  2F52 A;  1YBY A;  1YNX A;  1KRS A;  2E2H H;  4HJ8 A;  2JA7 H;  1HNX L;  3BJU A;  1GD7 A;  4B3M L;  3DM3 A;  3AYH B;  4TVA B;  5FLM H;  4X66 L;  5IP9 H;  1SRO A;  1I94 L;  4L5S A;  2JA7 G;  2ALY B;  1Z9F A;  4A3G G;  5LMN Q;  4JI5 Q;  2IX1 A;  3B6Y A;  3H3V H;  1WCM H;  2WFW A;  2Q2I A;  3KLW A;  4P75 A;  4JI2 Q;  5C0X I;  1VQP A;  1IBK L;  1EYG A;  2JA8 G;  2JA9 A;  3PIP A;  5C3E H;  1Q82 C;  1AH9 A;  1UEB A;  4DUZ L;  4IPG A;  1UWV A;  3J81 c;  1HNZ L;  2BA1 A;  1XPR A;  4EX5 A;  2A1A A;  2Y0S E;  3KF8 B;  3WWV A;  1H95 A;  3G6E A;  2K75 A;  1JE5 A;  3D0F A;  3HKZ G;  4GN4 B;  1IZ6 A;  2I5H A;  2VZA A;  4MZ9 A;  2N78 A;  2VS1 A;  4OO1 I;  3CME A;  4DR3 L;  4A3J G;  1NBW A;  2RHS B;  2JEA I;  3TEH B;  4A75 A;  1UE1 A;  3FKI H;  2PQA B;  3IRB A;  1X9N A;  4K0K L;  4B3S Q;  3F1Z A;  1V1Q A;  3H3V I;  4NXM L;  3GTK H;  4DUZ Q;  2PI2 E;  4JCV E;  4DV3 Q;  3M3Y H;  3M85 A;  3UDX A;  2DUD A;  3JAM i;  1K83 H;  3CCJ A;  1PH4 A;  1FGU A;  3ERS X;  1NMG A;  4HJ5 A;  1PH2 A;  3FKI G;  3KYH C;  2AMC B;  5GRO A;  1VQJ A;  3CCL A;  1VQN A;  1N33 Q;  1I5F A;  1X3F A;  4APV A;  4A3E G;  4POG A;  1VQE A;  3S1N H;  1IBL Q;  4A93 G;  1PH7 A;  4DR4 Q;  2OCE A;  1K73 C;  3S17 H;  1CSQ A;  4X66 Q;  1GM5 A;  4NB3 A;  1KL9 A;  1TWA H;  2QGQ A;  5M5Y H;  1L1O B;  2A19 A;  2R7Z H;  2NN6 G;  4LF9 L;  4KHP L;  3F8T A;  2L15 A;  1W3S A;  4HIM A;  4X62 Q;  1IBL L;  2IHE A;  1PH5 A;  1KIX A;  3L0O A;  4JI4 L;  2KHJ A;  3BU2 A;  3W5O A;  4GKK Q;  1X3E A;  3HOY G;  5M3M G;  1PFS A;  5GAH C;  4JBM A;  4GKJ Q;  4DKA C;  4RMF A;  2Y0S G;  4LW1 A;  2E2J H;  4OWT B;  4RG1 A;  2EXD A;  4JI2 L;  5FJ8 G;  2I5M X;  1IBK Q;  3GTL H;  5IYB H;  1AE3 A;  3RZO H;  1Q1B A;  4H02 A;  5IP9 G;  2CCZ A;  4JI7 Q;  5M3M H;  4YY3 L;  3Q8D A;  3J80 c;  1EQR A;  2UUC Q;  2C35 B;  1WYD A;  5C0X J;  3L2P A;  3PF4 A;  3CCM A;  1DGS A;  4P72 A;  1YHQ A;  1Q8K A;  5JJK A;  1G6P A;  3TRE A;  1I94 Q;  1K9M C;  1SR3 A;  3NEN A;  1OXX K;  1KHI A;  2DGY A;  3KF6 A;  2RCN A;  5BR8 Q;  1HZC A;  1VQA A;  4UP7 A;  4LFB L;  4P74 A;  4YWL A;  3HOW G;  2KHI A;  4L5Q A;  5FLM G;  3D31 A;  4LUV A;  2ZJP A;  1YHB A;  1E22 A;  4JI5 L;  4LF7 L;  3K81 C;  5IE8 A;  4BY1 H;  2LXK A;  1VCI A;  4HID A;  3PIO A;  1M1K C;  4LF9 Q;  3HOZ H;  5HGQ A;  5FLX c;  5LMU Q;  4GS3 A;  1VQ5 A;  4LF4 L;  1Q12 A;  3M4O H;  2E2I H;  1EQQ A;  3RLF A;  1HNZ Q;  2FXQ A;  2XGT A;  3UE0 A;  4LF7 Q;  4B3R L;  2ZTE A;  1A0I A;  4IJH A;  5IYC G;  4AYB E;  3VDY A;  5HY6 A;  5M5X H;  4DV5 L;  4PZ6 A;  1XNQ L;  4R4I A;  1VQH A;  3F2C A;  4UY8 C;  3F2B A;  2ZM6 L;  3GTQ H;  3HFZ B;  3S16 H;  3S1Q H;  1EWI A;  1YI2 A;  2PNH A;  4DAM A;  2Q2U A;  1D8L A;  1I50 H;  1M90 C;  3E9H A;  4DV4 L;  4DR5 Q;  4LFC Q;  2OTJ A;  1VQ7 A;  1TXY A;  1KAW A;  1L1O C;  1OXU A;  2EIF A;  2WB1 G;  3A5Z B;  2RHQ B;  3E0E A;  4IPD A;  1N9W A;  2IX0 A;  5AJ3 Q;  3HOV H;  1NJI C;  4A3D G;  3GTO H;  1VQ6 A;  3CCV A;  3PSI A;  1JB7 A;  1X54 A;  4DK3 C;  4DV1 L;  2YTX A;  4AQY Q;  4A3F H;  3CPF A;  2JA5 H;  4HJ9 A;  4R1J A;  1QZH A;  3KJO A;  1C7Y A;  1HZA A;  1RL2 A;  1SE8 A;  4B3S L;  1GKH A;  4LF8 Q;  4DR7 L;  3STB D;  1VQ4 A;  1E3P A;  2AWO A;  5FJ8 H;  1VQO A;  3ER0 A;  1PYS B;  4C3J H;  1PV4 A;  2UUA L;  4JI8 Q;  1XTD A;  4BBS G;  3S24 A;  2ZJQ A;  1L1O A;  2K5V A;  2NVX H;  5IYC H;  4GKK L;  2IHF A;  1X6O A;  2ZJR A;  1U5K A;  3T1Y L;  4YHH L;  3CCU A;  1FJG Q;  1Z47 A;  1OXV A;  4R4Q A;  4C3H H;  4A3I G;  4OON A;  2OWO A;  3K8A A;  3PUZ A;  1Y1V H;  4A3C G;  1CSP A;  2HIV A;  4OX9 L;  1PH1 A;  3E9I A;  2XTI A;  3F2D A;  3ULJ A;  2JQO A;  3KOJ A;  1MIU A;  3RN2 A;  3J7Z C;  3CF5 A;  2V1C C;  4JBW A;  1HJP A;  1VQF A;  5M5W H;  4A3M G;  3A0J A;  4JYA Q;  5C4J H;  3AQQ A;  2CWP A;  3I4O A;  4JI6 Q;  3PV0 A;  4B3T L;  4NXM Q;  2JK8 A;  1AE2 A;  2BH8 A;  3CW2 C;  3CP0 A;  3H0G H;  4GN5 A;  1L2F A;  4YY3 Q;  3K0X A;  3U58 A;  4BY7 G;  1D7Q A;  3HOX H;  3K80 C;  2BH2 A;  5C3E G;  3JAM c;  4IFD I;  2YV5 A;  3TQY A;  2ZM6 Q;  1PH8 A;  2N8N A;  1MKH A;  2R7D A;  4C3I H;  2HT1 A;  1EFW A;  2WP8 J;  2Z0S A;  4DV2 Q;  4DR6 L;  5C44 H;  1VQB A;  2UXD Q;  4JI0 Q;  3KF6 B;  2F3I A;  5JJL A;  3EIV A;  3ZJY C;  2YYZ A;  5GAE C;  3DLL A;  4DV7 L;  2A8V A;  2VNU D;  4A3J H;  1ASZ A;  1R9T H;  2OQK A;  2CQO A;  1N34 L;  2Z6K A;  4DV2 L;  4DR6 Q;  1Q7Y C;  4MTN A;  3KFU A;  4YCW A;  3UDI A;  3CCR A;  4IPC A;  4AYB G;  1XMQ Q;  3CXC A;  3RLO A;  4KI0 A;  1K3R A;  4WJ4 A;  1LUZ A;  2NZH A;  4LF8 L;  4DR7 Q;  1X56 A;  1G29 1;  3CQZ H;  1PHJ A;  4P71 A;  1U0L A;  2GVA A;  4Y7N H;  1SRU A;  4C2M H;  1YIT A;  2R93 G;  3I4M H;  1OTC A;  4B3R Q;  4ME3 A;  5BR8 L;  1WOC A;  1GO3 E;  3I55 A;  4PMW A;  2KCT A;  4GLX A;  4YWK A;  4NXN L;  2NVT H;  2WB1 E;  1XPO A;  1VQM A;  2E5L Q;  2B63 H;  3PUV A;  1IL2 A;  3BZC A;  3GTG H;  3GD7 A;  4KHP Q;  4GLA C;  3PGZ A;  4JI1 L;  3CC4 A;  3I4M G;  2AHO B;  4A3D H;  3HOV G;  4JBJ A;  4GN3 B;  1T9H A;  1VQ8 A;  1Q1E A;  1HR0 W;  4L5R C;  1N36 L;  1HZ9 A;  1J5E L;  2NVQ H;  1HR0 L;  4R4O A;  3MEF A;  3I4N H;  4JOI A;  4X64 Q;  3OTO Q;  3GTJ H;  2VUM G;  3PO3 H;  4IFD G;  1BKB A;  3S1R H;  4JI7 L;  5M3F H;  2UXC Q;  1N33 L;  1Q81 C;  3CAM A;  4LFA Q;  3S14 H;  2KEN A;  1HNW Q;  4A3F G;  1WCM G;  3FP9 A;  4DUY Q;  3H15 A;  4B3T Q;  4X65 Q;  3NBH B;  3PCO B;  4OO1 G;  3SGI A;  5M3F G;  4JYA L;  2B3G A;  1UE5 A;  1SN8 A;  1V9P A;  5GAG C;  2VW9 A;  3M7N A;  2R92 H;  1WJJ A;  1WI5 A;  4LNQ A;  3PO2 H;  1TWH H;  3CD6 A;  4DUY L;  2WAQ G;  3H0G G;  1SLJ A;  4UPA A;  1JJC B;  1NMF A;  4LWC A;  1E24 A;  4A3E H;  4X62 L;  3I4N G;  2BA0 A;  3KDF B;  3U4Z A;  3CPW A;  1Y14 B;  3TS2 A;  4JV5 Q;  3J81 j;  4A3B H;  4QGU A;  4XIG S;  4DR1 L;  4UP9 A;  2E5L L;  2JA6 G;  3CCS A;  2VY3 A;  4A76 A;  1A8V A;  4DV5 Q;  1NTG A;  1XMO Q;  1SFO H;  1VQL A;  3J80 i;  3EBE A;  5LMN W;  4AIM A;  3RZD H;  2ES2 A;  4JI6 L;  2RF4 A;  1XMQ L;  3HOZ G;  3GO5 A;  4DNI A;  1IBM Q;  4J15 A;  3T1H L;  3RNU A;  1YHA A;  3OTO L;  3PF5 A;  2UXB Q;  4QL5 A;  2CKZ B;  3I2Z A;  4DPG A;  2HHH Q;  1XNR L;  4JOI C;  4A3L H;  2K14 A;  1PYB A;  2MO1 A;  1HR0 Q;  2YTV A;  4IOC A;  1CKO A;  4OWX B;  2JA6 H;  4IO9 A;  2I5L X;  1Y1W H;  1S40 A;  1E1T A;  3FHW A;  1B7Y B;  4QIW E;  3RR5 A;  1K0R A;  3W1B A;  4X64 L;  2UUB Q;  1YJ9 A;  1EIY B;  2YTY A;  1I6H H;  2NN6 I;  3A74 A;  4A3K G;  4JI8 L;  1TWF H;  2HIX A;  1YJW A;  2AKW B;  2JA8 H;  3UDF A;  1JJG A;  3S1M H;  4IFD J;  1LYL A;  4PG3 A;  4LFA L;  4HIO A;  5IT9 c;  2UU9 Q;  5IYD G;  1Q46 A;  3AFP A;  4YCV A;  2WAQ E;  2VUM H;  5IP7 H;  4OX9 Q;  1A62 A;  2R92 G;  3W1G A;  1TWG H;  2VQE L;  4DR2 L;  4A3K H;  4DR4 L;  3GTM H;  2CWA A;  3JC6 6;  2F4V Q;  1Q86 C;  5JEA J;  5C44 G;  1PVO A;  2CFM A;  1NE3 A;  1HNX Q;  4B3M Q;  4NPS A;  4HJ7 A;  2MNA A;  4BA1 I;  3TS0 A;  1YVC A;  4DK6 C;  4R4T A;  2K4K A;  2MQH A;  1J5E Q;  1JMC A;  4DR1 Q;  1XNQ Q;  1PH9 A;  1JJ2 A;  1QUQ A;  2QA4 A;  1N36 Q;  3G48 A;  3UE1 A;  4LFB Q;  2PI2 A;  2Z6K C;  2R6G A;  1EIF A;  1SMX A;  4R4C A;  1CUK A;  4GKJ L;  4P73 A;  1TWC H;  3G71 A;  1C0A A;  1WFQ A;  4GOP B;  1G51 A;  3CC2 A;  1QVC A;  3I7F A;  1NY4 A;  3MXN B;  4IJL A;  3RN5 A;  1VQ9 A;  5K36 G;  1HZB A;  2ID0 A;  2B29 A;  4PZ8 A;  1L0W A;  1VQG A;  2LXJ A;  3G4S A;  2I0Q A;  5ELO A;  2UXD L;  2JA5 G;  2ZTD A;  4LUO A; 
#chains in the Genus database with same CATH topology
 2F0Q A;  2VL6 A;  3VR5 A;  1I4R A;  4JBK A;  3OIP A;  3E3X A;  2VQF Q;  4RWS C;  1CKN A;  1H9J A;  4OXP A;  3K7A B;  5ELF A;  4KK7 A;  1HH2 P;  1AP0 A;  5EPJ A;  3G6J B;  3UDG A;  3S15 B;  1OXS C;  4MNO A;  5G3L D;  1C9O A;  1X55 A;  2EY1 A;  3P20 A;  1N32 Q;  4KKS A;  5DM7 3;  2JA7 B;  5H1S E;  3ICE A;  2LSS A;  1ESR A;  3K0Y A;  2VXW A;  3HOX G;  5HGT A;  1PXU A;  1EY0 A;  2KHS A;  4DR2 Q;  5D65 A;  1BBW A;  1EEF D;  4IUV A;  4A3J B;  1JB3 A;  4BY1 G;  1IL8 A;  3X3N A;  3NBI A;  4K5W A;  2JJQ A;  4JI0 L;  2UUA Q;  1I6V C;  1P16 A;  2UXB L;  2UUC L;  2L1B A;  1KRT A;  4FDB A;  1PA6 A;  2E8G A;  2XWB B;  4YWM A;  2AQ3 B;  4ZRZ A;  1GJX A;  1S3O A;  4KJO A;  1HNW L;  4GLV B;  1HQR D;  2ASB A;  2D62 A;  2K04 A;  4G57 A;  5CV6 A;  4KD4 A;  5C4X B;  3MZ5 A;  2FIN B;  4YHH Q;  1XPU A;  1VQC A;  2CW0 D;  5CR3 A;  4FYD A;  3NEM A;  3A8J E;  2ZTC A;  1I3Q H;  2YU9 H;  3MWY W;  3PO3 G;  2OEO A;  4BXX G;  4X3S A;  5IP7 G;  5A2Q E;  1MJC A;  4KHV A;  2N49 A;  2QDL A;  1FVI A;  4GOP C;  4A3G H;  1JOQ A;  4PQX A;  1GVP A;  1KC8 C;  3PO2 B;  3SEB A;  3GDE A;  4CBV A;  4IUR A;  3RZO B;  1LV9 A;  4K5X A;  1J6Q A;  2UXC L;  2K50 A;  4DV0 Q;  4BY7 B;  1KD1 C;  1PFM A;  5DLQ E;  4OHJ A;  3BDL A;  5C4X G;  1E1O A;  5IGB A;  3MHB A;  1CKN B;  3URY A;  1KXL A;  2EOT A;  1O7I A;  2N3S A;  1VMC A;  1BVS A;  4QUC A;  1FJG L;  4IOA A;  1EUJ A;  2WAQ B;  2UU9 L;  2EJG C;  4UDU C;  3FEW X;  4BWG B;  3PIO 3;  4HJ8 A;  3J80 E;  1EY4 A;  1HNX L;  4B3M L;  3DM3 A;  4TVA B;  3VYS A;  4OEM B;  1SRO A;  2MPM A;  5LMN Q;  3S9W A;  4JI5 Q;  2IX1 A;  1BXT A;  1QG7 A;  1SNP A;  3QG1 A;  2HDM A;  2JA9 A;  1UEB A;  4DUZ L;  1Y8O B;  3OWF A;  4IPG A;  1HNZ L;  2Y0S E;  1H9M A;  4WOR A;  1H95 A;  3D0F A;  1CI3 M;  4XT3 B;  1IZ6 A;  1CT1 D;  2SOB A;  5KRU A;  5J22 A;  2N78 A;  3KLS X;  4A3K B;  4DR3 L;  1QB5 D;  3ERO A;  1H9S B;  3F1Z A;  1QWY A;  4IAL A;  3HOW B;  2DUD A;  1K83 H;  1B53 A;  3K5N A;  3MVV A;  1I4P A;  2KA7 A;  1BQQ T;  1PH2 A;  2AMC B;  5GRO A;  1VQJ A;  3S1M B;  2HCI A;  3TME A;  2OCE A;  1CSQ A;  4X66 Q;  1EZ6 A;  2QGQ A;  2NN6 G;  4MHE A;  4LF9 L;  3SK4 A;  3DWA A;  4OGQ C;  1IHZ A;  1LT3 D;  4HCE A;  4LW1 A;  2ZXR A;  2E2J H;  4KY5 A;  3VR3 A;  5LL6 X;  2PCF B;  4ZUI A;  2E2H B;  5FJ8 G;  3GTL H;  5IYB H;  3LWE A;  5FO7 B;  1DCZ A;  1GOZ A;  1K8M A;  1WVL A;  5E4W C;  3J80 c;  1S5F D;  5BN5 A;  2UUC Q;  3T13 A;  1LTT D;  1WYD A;  4A93 B;  4WFN 3;  1S4Z A;  2BDN A;  3PF4 A;  1Q8K A;  5JJK A;  1FD7 D;  1I94 Q;  3KF6 A;  2DGY A;  1TII D;  5BR8 Q;  1HZC A;  4P74 A;  4YWL A;  4ME5 A;  2KHI A;  1HPC A;  1UUP A;  5FLM G;  2DY7 A;  3M4Y A;  2ZJP A;  1YHB A;  3HOZ B;  2LXK A;  1A3U A;  1M1K C;  4RKL A;  2Y0S B;  5I4D A;  1EQQ A;  1A0I A;  4AYB E;  2XSC A;  2L5T A;  4R4I A;  3S1Q B;  3S16 H;  3OIQ A;  1HFG A;  4DXF A;  4FF4 A;  4BS9 A;  1QE6 A;  2YU9 B;  4LAA A;  2C5C A;  2PPB C;  1WTQ A;  4N8F A;  4P2C B;  3OOC A;  1N9W A;  4A3D G;  5FK9 C;  1JE4 A;  2F0N A;  2EY2 A;  3D4W A;  3V05 A;  4ZKB B;  3C2P A;  3S14 B;  2JA5 B;  1C7Y A;  4DR7 L;  1E3P A;  2AWO A;  2H1E A;  1FR3 A;  5FJ8 H;  1PYS B;  4C3J H;  2UUA L;  4CKE A;  1Y8N B;  3S24 A;  4RHR A;  1X6O A;  4YHH L;  1FJG Q;  1T5X D;  2XVS A;  4OON A;  3K8A A;  3NBH A;  1BCP F;  1Y1V H;  3PUZ A;  4OX9 L;  3S17 B;  5KEE A;  2XTI A;  3ULJ A;  2NB0 A;  1AZQ A;  2V1C C;  4JBW A;  5M5W H;  3A0J A;  4FXG C;  3AQQ A;  4ZYS A;  4K2L A;  4B3T L;  3FDT A;  1AE2 A;  3CW2 C;  1B9N A;  3H0G H;  3H3V C;  3K0X A;  4BY7 G;  1D7Q A;  2L4N A;  4IFD I;  3OWE B;  2BCO A;  1QNU A;  1EFW A;  2WP8 J;  4DR6 L;  4S3S A;  3FMC A;  3EIV A;  3UI2 A;  4CDD C;  2VB2 X;  4DV7 L;  2A8V A;  3D6W A;  5C6A A;  2CQO A;  2QW7 A;  4DR6 Q;  5DNF A;  1D1K A;  3CCR A;  2XIW A;  4OEL B;  5NUC A;  4AYB G;  1ZEQ X;  2IL8 A;  4KI0 A;  1K3R A;  4L8J A;  2V4D A;  2L55 A;  2NZH A;  3PMF A;  4DR7 Q;  1X56 A;  1D5Z C;  4P71 A;  2GVA A;  4Y7N H;  3EVQ A;  1SRU A;  3NK9 A;  1OTC A;  1PLF A;  2Z4H A;  1GO3 E;  4GLX A;  4NP5 A;  2Z6B A;  1XPO A;  1CFM A;  3ONA B;  3PUV A;  1E2V A;  1U4L A;  3GTG H;  3NE5 B;  4GLA C;  3PGZ A;  1W6J A;  2OT2 A;  3I4M G;  3N52 A;  2KEC A;  4JBJ A;  4GN3 B;  3QOJ A;  2NBF A;  3TZD A;  1VQ8 A;  1L0X B;  1HZ9 A;  2X6G A;  1TWF B;  1DOL A;  1J5E L;  2NVQ H;  5L37 A;  3FPP A;  3I70 A;  4R4O A;  4X64 Q;  3GTJ H;  2SNM A;  1BKB A;  3S1R H;  5M3F H;  1MI2 A;  5KNB A;  3T56 B;  1VF7 A;  4LFA Q;  4HSV A;  2EY6 A;  1WCM G;  3N6R A;  4X65 Q;  4ZAI A;  3HP3 A;  4OO1 G;  4X3K A;  1SN8 A;  1JOK A;  1A3V A;  1O7Y A;  2R92 H;  1EFI D;  1WJJ A;  5CYU A;  3Q22 A;  2Q8T A;  1GUN A;  3H0G G;  1I4G A;  1PTO H;  4KN4 C;  2E74 C;  2E76 C;  1E24 A;  5KGU A;  2BA0 A;  5D3D A;  4X3T A;  1Y14 B;  3TS2 A;  1HA6 A;  3GTJ B;  4UP9 A;  2JA6 G;  4ULL A;  3CCS A;  2D9U A;  1NTG A;  1XMO Q;  4DK1 A;  3J80 i;  1EZ8 A;  4C3I B;  2RF4 A;  1XMQ L;  4ZLT F;  3BDC A;  4C3J G;  3T1H L;  3OTO L;  5LHY 1;  3RUZ A;  2CKZ B;  3I2Z A;  1WD1 A;  2R3Z A;  4IN3 A;  2JA6 H;  3CRK C;  2CCZ A;  4QIW E;  3FHW A;  4X64 L;  2UUB Q;  3QB3 A;  4C1N K;  1YJ9 A;  5C3E B;  3A74 A;  5KNC A;  4JI8 L;  2HIX A;  3BVZ A;  4PG3 A;  1DON A;  5IT9 c;  3AFP A;  3CQZ B;  2R92 G;  2L9H A;  4ABN A;  4DR4 L;  4EQP A;  5JEA J;  2F0V A;  1CQF A;  5JPM C;  4HJ7 A;  4N8X 1;  4TRD A;  4R9W A;  1PFB A;  4R4T A;  5E1F A;  2MQH A;  1JMC A;  1QUQ A;  1F9P A;  1ZYR D;  1N36 Q;  3G48 A;  3UE1 A;  3QR8 A;  1EIF A;  1SMX A;  2M2L A;  1TWC H;  1QVC A;  1Y1V B;  1PRT C;  1L0W A;  2I0Q A;  4QIW B;  1YNN D;  2A69 C;  1DOM A;  2JA5 G;  1S5B D;  4GNX B;  1WTW A;  4DAV A;  4Y52 H;  1RIP A;  3L7Z C;  3QOL A;  3K57 A;  1OXT A;  4QQB X;  3DEP A;  5IWA Q;  4IZ8 A;  1TS2 A;  3CMA A;  4KLK A;  4NDX A;  4LF5 L;  1OO9 B;  2UUB L;  2JEB I;  2BE5 D;  2K05 A;  4DV0 L;  4JV5 L;  4JW0 A;  1ICW A;  2K32 A;  4JC0 A;  4PMB A;  2NVY H;  3CCE A;  2NVY B;  4DV6 L;  4HJA A;  1KDC A;  1KNA A;  3ND8 A;  2MJ8 A;  4BXX H;  4A3L G;  2EQS A;  5C5L A;  3A8K E;  3E6Z X;  3CC7 A;  4JI3 Q;  3PQI A;  2E75 C;  1U9R A;  1BDO A;  4DU9 A;  5IYD H;  4A3B B;  1DZ1 A;  1GHK A;  3CCQ A;  1XNR Q;  1ZYR C;  2F0I A;  1AFP A;  4M1U B;  1UE7 A;  2K52 A;  3TRZ A;  3PUW A;  2EXZ A;  5COY A;  1Z7T A;  2D0O A;  1QVG A;  4GZY C;  2A6E D;  5AJ3 L;  1JIC A;  3FRP B;  4DV7 Q;  1CKM A;  5CV5 A;  1ENA A;  1ENF A;  5ELN A;  3PO2 G;  3HOW H;  3ND9 A;  4O1N A;  3BZK A;  4KTA A;  3GQB A;  2F0O A;  2PMZ B;  4C1N I;  2PQA A;  4LF4 Q;  2NTS A;  4A3B G;  1YJN A;  2AQ2 B;  2QEX A;  5EPL A;  2EYO A;  4DAY A;  4EGV A;  4GNX C;  4DNT B;  4F88 A;  2PMZ E;  5IT9 E;  3MFY A;  4A3I B;  3U50 C;  1PRT B;  4JI3 L;  1B8A A;  1YEZ A;  3KJP A;  5IYB G;  1CZW A;  2RSN A;  2PYK A;  4KKT A;  3I72 A;  4XTC S;  5E7N A;  5FO9 B;  1KQS A;  2DJG C;  2NZO A;  4QJF A;  2VQF L;  2WIN B;  1LAB A;  1STA A;  3K59 A;  1IXR A;  4KHZ A;  5I6W A;  1XMO L;  2PZT A;  5CV7 A;  4K0K Q;  3PUY A;  1V43 A;  4IUP A;  1K8A C;  3I73 A;  2F0U A;  4QY7 A;  3M4Q A;  2AWN A;  2E2D C;  2L12 A;  3RLN A;  2VB3 X;  1M8A A;  4JI1 Q;  3WOE A;  3HZX A;  4MTK A;  4POF A;  4A3I H;  4WJ3 M;  1EYC A;  1PFN A;  2CH4 W;  5JJI A;  1B50 A;  1BCP B;  1Q3L A;  1X32 A;  3AEV A;  2F52 A;  2FHT A;  2PW5 A;  2JA7 H;  1A3T A;  3AYH B;  5FLM H;  1F9S A;  5IP9 H;  1I94 L;  5DM6 3;  3M3Y B;  2ALY B;  1JWM D;  1Z9F A;  2R61 A;  4A3G G;  5EKL A;  3B6Y A;  5IGF A;  2WFW A;  2Q2I A;  2JA8 G;  1BOS A;  4JI2 Q;  3S1N B;  1EYG A;  1G2S A;  5C3E H;  1TU2 B;  3J81 c;  2BA1 A;  3WWV A;  4NKL A;  4ODG A;  1EY8 A;  1JE5 A;  2I5H A;  3EA6 A;  2VZA A;  1WD0 A;  5KIX A;  3IKJ A;  5C5M A;  1RCV D;  2VS1 A;  4OO1 I;  3CME A;  1JQY D;  1BR9 A;  5LL6 S;  2WKC A;  3KBX A;  3TEH B;  1SSO A;  1UE1 A;  3FKI H;  2Z8L A;  1X9N A;  4K0K L;  2L11 A;  1IKL A;  4JCV E;  4DV3 Q;  3V96 A;  3CCJ A;  2MHV A;  2K03 A;  3ERS X;  4HJ5 A;  3KYH C;  3GTQ B;  1VQN A;  1I5F A;  1EQV A;  1IBL Q;  4A93 G;  4K6L A;  3NTK A;  4DR4 Q;  1LTA D;  1VMP A;  2R7Z H;  2A19 A;  3NUC A;  4M8A A;  2L15 A;  1AEX A;  2NZ1 D;  1IBL L;  3D4D A;  4JI4 L;  4DF7 A;  1X3E A;  1G91 A;  1PFS A;  3P1H A;  1C8C A;  2EXD A;  4JI2 L;  3OMC A;  1PYW D;  3E0J A;  2SDF A;  2I46 A;  5J1Z A;  3O13 A;  4BBR B;  3HKZ B;  4YY3 L;  1GUO A;  3Q8D A;  2F3V A;  1YNJ C;  2C35 B;  2IJ0 A;  5BN4 A;  3K5M A;  1SYE A;  3L2P A;  3CCM A;  4P72 A;  5EGT A;  1I6H B;  5DEH A;  1K9M C;  3NEN A;  1KHI A;  4WRD A;  1VQA A;  2F0T A;  4XQQ A;  1ML0 D;  4JI5 L;  3K81 C;  1VCI A;  4LF9 Q;  4NMZ A;  2PO4 A;  5FLX c;  1NNX A;  4GS3 A;  1YNN C;  4LF4 L;  1E2W A;  1Q12 A;  3DM1 A;  4RFB A;  2E2I H;  2XWJ B;  1HNZ Q;  4RCN A;  3R3O A;  4B3R L;  1SDF A;  4IJH A;  1FNU A;  3VDY A;  5M5X H;  4PZ6 A;  4QUF A;  3F2B A;  2ZM6 L;  2BE5 C;  5ELB A;  2Q2U A;  1HFN A;  1Y8P B;  1M90 C;  3IAY A;  1EIG A;  1WTH A;  2FFK B;  4EVO A;  4LFC Q;  2OTJ A;  1PTO D;  3KK7 A;  3VR4 A;  2RBM A;  1L1O C;  1OXU A;  2JN4 A;  3E0E A;  2IX0 A;  2RSO A;  4G4K A;  5AJ3 Q;  1NJI C;  1HHV A;  2K33 A;  1VQ6 A;  3CCV A;  2X69 A;  3S1R B;  1X54 A;  3SK6 A;  5I9P A;  1K0S A;  1SE8 A;  5EKK A;  1GKH A;  3TSS A;  4FO2 A;  1PV4 A;  4LF8 Q;  1ILP A;  1VQO A;  4H7B A;  3H09 A;  4BBS G;  1V8Q A;  5M9O A;  5IYC H;  4GKK L;  4FF1 A;  1Z47 A;  4C3H H;  4F7X A;  4U68 A;  3TN2 A;  5EQ0 A;  3R2I A;  3F2D A;  3TP6 A;  5I9O A;  3KOJ A;  1MIU A;  3J7Z C;  2QIL A;  1MGS A;  3CF5 A;  2EZV A;  3TBI B;  4A3M G;  4JYA Q;  2CWP A;  4JI6 Q;  4NXM Q;  1HUM A;  4OIK A;  2BH8 A;  1R4P B;  2K1B A;  4UAI A;  3I4M B;  3K80 C;  1BF4 A;  5C3E G;  5ELD A;  2YV5 A;  3L9A X;  2ZM6 Q;  1PH8 A;  2JP1 A;  3GTL B;  4C3I H;  2J4X A;  3I8Z A;  3QJY A;  4X3U A;  3G7L A;  2Z0S A;  1VQB A;  2UXD Q;  4JI0 Q;  5JJL A;  1CZG A;  1LLR D;  2YYZ A;  3ZJY C;  2R92 B;  4A3J H;  1LT6 D;  1N34 L;  2Z6K A;  2F0H A;  3OMG A;  4YCW A;  3UDI A;  2F4I A;  3CKI B;  1PZK D;  1U4P A;  4IPC A;  1XMQ Q;  3RLO A;  3K5L A;  4LF8 L;  1ROD A;  1G29 1;  3I90 A;  5IGC A;  2R93 G;  1F9R A;  5BR8 L;  2EJM A;  4ZQ3 A;  5CGK A;  4F87 A;  1ONL A;  4KY6 A;  2B63 H;  1IL2 A;  2RCF A;  3TDQ A;  5ELC A;  3QO2 A;  4JI1 L;  2B2W A;  3MFG A;  3S16 B;  1S5C D;  2AHO B;  4EQO A;  1B1Z A;  3HOV G;  1BBX C;  4L5R C;  3I4L A;  1Q1E A;  2HDL A;  4CJ0 B;  5ELE A;  1ESF A;  1SMY C;  5FOB B;  3I4N B;  1KLU D;  5I2Y A;  2RDG A;  2O2L D;  3P75 A;  3MTS A;  3C1E A;  3E5S A;  2VUM G;  2CHB D;  4QF4 A;  2XRQ D;  3J81 E;  3RMH A;  2UXC Q;  2KCN A;  1N33 L;  3FKI B;  1GUS A;  3IL8 A;  3S14 H;  1PTO F;  2KEN A;  1HNW Q;  3FP9 A;  3NTH A;  4YIJ A;  3H15 A;  4C3J B;  1BCP C;  1HRJ A;  1VDZ A;  2WB1 B;  2VW9 A;  3M7N A;  3PO2 H;  1WI5 A;  1E2Z A;  2LFN A;  1TWH H;  1FNV A;  1M4V A;  4ILW A;  5IGD A;  5JVH 3;  1SE2 A;  3RD4 A;  4A3E H;  2AQ1 B;  1F77 A;  3I4N G;  3KDF B;  2DNC A;  3S2H B;  4JV5 Q;  2B2Y A;  3BDO A;  5JVG 3;  2F0G A;  4A76 A;  4XT1 B;  3EBE A;  1IBM Q;  4J15 A;  3CRL C;  4QL5 A;  2L0C A;  4DPG A;  2CQA A;  2EYP A;  2ZXO A;  4A3L H;  1HR0 Q;  1PYB A;  2YTV A;  1CKO A;  2PQE A;  4OWX B;  1CA6 A;  1IYU A;  4CJ1 B;  4IO9 A;  2QEJ C;  1Y1W H;  1TQO A;  1DXM A;  1B7Y B;  2A74 C;  4B3S Q;  3W1B A;  1SYB A;  2M00 A;  2NN6 I;  2RKS A;  2EDG A;  5CBE E;  4IFD J;  5EBD A;  3TP8 A;  2Z9H A;  2K28 A;  4HIO A;  2F3W A;  1G2T A;  2UU9 Q;  1DYQ A;  1EEI D;  1UAP A;  3PO3 B;  1ZXT A;  2VQE L;  4A3K H;  1WTR A;  2F4V Q;  1Q86 C;  5C44 G;  4IUU A;  2NUC A;  1HNX Q;  4B3M Q;  3W2D A;  1II3 A;  5KYI A;  4BA1 I;  3TS0 A;  3JAM E;  4DK6 C;  3SHL A;  4ZUJ A;  1J5E Q;  1JJ2 A;  2KUM A;  2R6G A;  4R4C A;  2E2J B;  1CUK A;  1C4Q A;  2CW0 C;  4LK1 C;  4P73 A;  4GKJ L;  1J9O A;  3CC2 A;  3I7F A;  4IJL A;  3MXN B;  3RN5 A;  2ID0 A;  3GV6 A;  1U4R A;  1WTP A;  3VR6 A;  4UP8 A;  4O0A A;  5EAY A;  4OWW B;  1IBM L;  4DR3 Q;  3ULP A;  1SEB D;  4OL7 A;  4YCU A;  1EOV A;  1PDQ A;  1AW7 A;  5K5P A;  3A5U A;  5C4J B;  3STB C;  2GN5 A;  3K7A H;  4K2K A;  4V0B A;  1LM0 A;  3HOU H;  1STG A;  3KLR A;  4N9P A;  1QUQ B;  1EY9 A;  2KBN A;  4LMQ D;  5BN3 A;  2JYO A;  1SBB B;  1IYV A;  3K7U C;  3K58 A;  2VQE Q;  3I91 A;  1STH A;  1JC7 A;  3HOU G;  4DV1 Q;  4RA8 A;  2Q2T A;  1FGB D;  2F1M A;  4OIJ A;  1QZG A;  1K8G A;  3AMU A;  4I65 A;  2MFI A;  3IFD A;  1N32 L;  1O78 A;  2NYZ D;  3HKS A;  5C0X G;  3R93 A;  1VQD A;  2MO0 A;  2OTL A;  4L5T A;  5GAD C;  4A3C H;  3AFQ A;  2K5N A;  4BBS H;  1N8R C;  1I4H A;  1ASY A;  3NPP A;  1A63 A;  1MJE A;  4LF5 Q;  1CQV A;  4LUZ A;  4A3D B;  4RH6 A;  1DOK A;  4IQZ A;  2GA4 B;  2G5D A;  1SYG A;  4O2D A;  3U4V A;  3S2D H;  5C4X H;  1FL0 A;  1MBY A;  2EYH A;  1TWA B;  1O80 A;  1HA5 A;  4FXD A;  3KBG A;  4BBR G;  1MHW C;  3EN2 A;  4AH6 A;  3BZD B;  3KDF A;  3EJI A;  3LGJ A;  2R7Z G;  1Y69 U;  1D5M C;  1EWC A;  4HIK A;  2H4O A;  1VQK A;  1I4X A;  1X3P A;  1TVX A;  3J81 i;  3NEL A;  5C4Z A;  1SYC A;  3A54 A;  3ULL A;  3P7J A;  4A4I A;  4GNX A;  1RTO A;  5C44 B;  2PNR C;  4IPH A;  3VA7 A;  4AQY L;  4FF2 A;  1B9M A;  1TWH B;  2PZW A;  3BYT B;  4IUQ A;  2K6A A;  2EYM A;  1X65 A;  2K01 A;  2C9O A;  4A3M H;  4ZCK A;  2ATW A;  3K6O A;  3Q0A A;  4RGT A;  2IT1 A;  4DAY B;  5IY0 A;  2EYF A;  1LAC A;  1CHQ D;  3H0G B;  4ALP A;  2RDH A;  1YZ6 A;  4QCL A;  3D6C A;  1IW7 C;  3MXG A;  5IWA L;  1YNX A;  1D6E C;  3LWU A;  4L5S A;  1PRT D;  2JA7 G;  3H3V H;  2EY5 A;  3KLW A;  3DWQ A;  3GP7 A;  4PNY A;  4FP5 D;  3PIP A;  1AH9 A;  1GHJ A;  3IFT A;  5CV4 A;  4EX5 A;  3KF8 B;  3HKZ G;  4I7Z C;  1QJO A;  1TKW B;  1LTS D;  4MZ9 A;  1JOO A;  1TWG B;  3GTM B;  1NBW A;  1EYA A;  4A75 A;  1HTP A;  3GTG B;  3IRB A;  1EOT A;  3OW7 A;  2DNE A;  4NXM L;  3FPU B;  4HCS A;  2PI2 E;  4DUZ Q;  1HTL D;  3JAM i;  5AFW A;  1PH4 A;  1NMG A;  1H9K A;  1LO5 D;  3CCL A;  2NVQ B;  1X3F A;  1JR0 D;  2FJ2 A;  3SE0 A;  4NB3 A;  5M5Y H;  1L1O B;  4KHP L;  2K5W A;  1F2Y A;  5M3F B;  4RGM A;  4CGY B;  4HIM A;  4X62 Q;  4KV6 A;  2IHE A;  3L0O A;  2KHJ A;  3BU2 A;  4GKK Q;  3HOY G;  3R2T A;  5M3M G;  4JBM A;  3TP7 A;  4GKJ Q;  4RMF A;  1H9R A;  5IGE A;  1HUN A;  1EY6 A;  4RG1 A;  3FVQ A;  4H0L C;  1IBK Q;  3MAQ A;  2KED A;  4H02 A;  5T1G A;  4IFD H;  5M3M H;  1PTO B;  3DEO A;  1EQR A;  1S5E D;  3SK5 A;  4C3I G;  1TY2 A;  1EY5 A;  1TS3 A;  1J8I A;  4HTH A;  1G6P A;  2WII B;  1SR3 A;  5M5Y B;  1OXX K;  4UP7 A;  2F0S A;  1CA5 A;  4TKO B;  3VA5 A;  4MIU A;  5CV8 A;  3BVM A;  5DAU A;  4LUV A;  3HOU B;  1E22 A;  1DM0 B;  4LF7 L;  3H91 A;  3HOZ H;  4HID A;  3PIO A;  3T53 B;  5HGQ A;  2ZT9 C;  1VQ5 A;  1RKN A;  1RJT A;  2FXQ A;  2XGT A;  5C3W A;  4LF7 Q;  5A35 A;  5IYC G;  4CDC C;  1VQH A;  3GTQ H;  2A6H D;  3WDN A;  1R9T B;  3S1Q H;  4DAM A;  1I50 H;  3E9H A;  1SE3 A;  1DJR D;  1VQ7 A;  1KAW A;  2RDF A;  1TR5 A;  2IW3 A;  3HGB A;  1QOH A;  1V1O A;  2EIF A;  2WB1 G;  3A5Z B;  1BO0 A;  2RHQ B;  1K28 A;  3T16 A;  3HOV H;  1B3Q A;  4CKB A;  1QCB D;  1B2T A;  3AB9 A;  4DV1 L;  4AQY Q;  2YTX A;  4A3F H;  2JA5 H;  4R1J A;  4L63 B;  3KJO A;  1HZA A;  1RL2 A;  3BS1 A;  3A8I E;  3ER0 A;  4JI8 Q;  1XTD A;  5EPK A;  1V1P B;  2ZJQ A;  2IHF A;  3T1Y L;  1TS4 A;  5JOB A;  2OWO A;  4A3I G;  4A3C G;  2HIV A;  1I50 B;  2DN8 A;  1PH1 A;  3E9I A;  3D4R A;  5JEA H;  1F2Z A;  2O5J C;  1HJP A;  1EL0 A;  5C0X H;  4Q5V A;  4DFA A;  3I4O A;  3C46 A;  2M9V A;  3BYY B;  3CP0 A;  4GN5 A;  1L2F A;  4YY3 Q;  3U58 A;  1U4M A;  4BY1 B;  4HSP A;  3TQY A;  2N8N A;  1MKH A;  2D5D A;  3U9S A;  3BG3 A;  2HT1 A;  1LTG D;  1TT2 A;  4DV2 Q;  4K5V A;  5C44 H;  3T51 B;  3KF6 B;  2F3I A;  1G6Z A;  5M5X B;  5GAE C;  1ASZ A;  4KD3 A;  5I6Y A;  4DXG A;  1NR2 A;  1LTR D;  1CM9 A;  3NXW A;  4RGO S;  4DV2 L;  4MTN A;  1AZP A;  3CXC A;  2K7V A;  1LUZ A;  1PZI D;  4K6D A;  1QIL A;  4MN3 A;  3T4A C;  4C2M H;  4C3H G;  2A68 C;  4XDX A;  4C2M B;  4B3R Q;  2F0E A;  1EIH A;  3I55 A;  4PMW A;  4DA2 A;  1E0B A;  1SNQ A;  2NVT H;  2WB1 E;  1HQM C;  2LS0 1;  3BZC A;  3NHH A;  4KHP Q;  5JJZ A;  1NUC A;  4IUN A;  1QNK A;  2SNS A;  3CC4 A;  4QB4 A;  3MC0 B;  5COR A;  1SNO A;  2BDO A;  1T9H A;  1HR0 W;  2AUK A;  1SND A;  1STN A;  1HR0 L;  3MXN A;  3H6M A;  2B2W C;  3MEF A;  2A5H A;  5K36 H;  2Q8I B;  3PO3 H;  4IFD G;  3NTI A;  2J0T D;  1NSN S;  4U67 3;  3VYT A;  3CAM A;  4NW2 A;  5CV9 A;  5FO8 B;  1JWS D;  4CJ2 C;  3NBH B;  5E4X A;  3SGI A;  4JYA L;  1V9P A;  4LNQ A;  3CD6 A;  2WAQ G;  3HOY B;  5M3M B;  1SLJ A;  1SNM A;  1ET6 A;  1C48 A;  1JJC B;  4UPA A;  4LWC A;  2WAC A;  4FF3 A;  4X62 L;  4KJN A;  5FKA C;  1MD2 D;  3CPW A;  3J81 j;  1STE A;  1SJH D;  1XXG A;  4EQN A;  4QGU A;  4DR1 L;  2E5L L;  1LTB D;  3U9O A;  2VY3 A;  3GTP B;  1A8V A;  3QWN A;  5KYL A;  2K5D A;  3RZD H;  2ES2 A;  4AIM A;  4JI6 L;  1KTK A;  3GO5 A;  3RNU A;  4OO1 H;  3ERQ A;  2UXB Q;  2LMC B;  2HHH Q;  1ICF B;  3NP8 A;  4HMI A;  2EE1 A;  4JOI C;  5IT9 L;  2MO1 A;  1TWC B;  5T1I A;  4IOC A;  3NSW A;  3LNN A;  3J7Y W;  2I5L X;  1EIY B;  1Z6H A;  2QCP X;  4Z9C B;  4L6T B;  4C56 C;  4A3K G;  1YJW A;  4G7Z C;  1WCM B;  1LYL A;  1ET9 A;  2B2T C;  2A69 D;  4PV1 C;  4AYB B;  1STY A;  2VUM H;  2Z4I A;  4OX9 Q;  1A62 A;  5FLX L;  2R7Z B;  2CWA A;  2EJF C;  2CFM A;  1D1I A;  1NE3 A;  2B2U C;  3K5O A;  1PMR A;  2D2C C;  2K4K A;  1PH9 A;  4LFB Q;  2Z6K C;  3DWP A;  1RF2 D;  1BNZ A;  3G71 A;  2JA6 B;  1WFQ A;  1G51 A;  2QKI C;  5K36 G;  3A56 A;  4PZ8 A;  1EYD A;  1VQG A;  3G4S A;  5ELO A;  1A2T A;  3EFX D;  2MUY A;  4I7A A;  4KY7 A;  4DV6 Q;  1RHP A;  4NXN Q;  5LMU L;  2TMP A;  3DUZ A;  5CC4 A;  3S2H H;  1X3Q A;  1UNS A;  1LTL A;  4RKB A;  1ENC A;  1NR4 A;  1QVF A;  2Q8R E;  3J7A F;  4CDF C;  2OXP A;  5GQO A;  4TQU S;  4X6A H;  1RD9 D;  3D8G A;  4DV4 Q;  1UE6 A;  2TSS A;  4DR5 L;  1P8L A;  1KDB A;  1GUG A;  1F9Q A;  4BA2 I;  4FNF A;  4BBR H;  1X3G A;  4ZK9 B;  2B2T A;  4BY7 H;  2IWH A;  2JA8 B;  2B8F A;  1B44 D;  3ITP A;  4JI4 Q;  1E7Z A;  2OQ0 A;  4EQ5 A;  1PH3 A;  3L3O C;  3PUX A;  2P5Z X;  4TSS A;  1K3B C;  3OYY A;  3T1Y Q;  1Y1V G;  1SFO B;  5LMN L;  2F03 A;  2HCC A;  2R7F A;  1W2B A;  1Y1W G;  1F2L A;  3M9B A;  2KCC A;  4LF6 Q;  3HKZ E;  4LFC L;  3I56 A;  2B63 G;  3OW2 A;  5ISR A;  2D0P A;  2X6L A;  3A7L A;  2NWG A;  5IGG A;  2G9D A;  2AUJ D;  4LF6 L;  2R93 B;  2R93 H;  2O4X A;  1KDA A;  3Q6S A;  4HED A;  1VS0 A;  5J3B A;  5JEA G;  4DNR B;  2WV6 D;  2LKV A;  1BUV T;  4GOP A;  3SR1 A;  2IY5 B;  4IUT A;  1XJV A;  3M7G A;  1T5E A;  3I3C A;  4PZ7 A;  4Y7N B;  3TP5 A;  1JT8 A;  2H5X A;  3A55 A;  4DAP A;  3CU7 A;  1BBU A;  1IYJ B;  1H9S A;  4CKC A;  4DV3 L;  1B70 B;  4K8J A;  4B9X A;  3DXJ C;  4Q0F A;  1PH6 A;  2Q2H A;  2F4V L;  3M4P A;  4RCO A;  2RQX A;  4XQN A;  3J7A 5;  1S72 A;  1DD2 A;  2HUG A;  3MXU A;  2JE6 I;  3NQT A;  2A68 D;  2MP1 A;  3HOY H;  1SNC A;  4JG2 A;  3T1H Q;  2A73 B;  3SVM A;  5FLX E;  2KCM A;  4QMG A;  2KOL A;  4A93 H;  2ZXP A;  2GVB A;  4X65 L;  3GV3 A;  2K5H A;  1A2U A;  1VQI A;  3GTP H;  2HHH L;  3SK8 A;  2HD3 A;  5D14 A;  3ZYY X;  3CHB D;  2QDB A;  1YIJ A;  3MA2 B;  2HQL A;  1N34 Q;  3S15 H;  3RZD B;  1YBY A;  1KRS A;  2E2H H;  3BJU A;  1GD7 A;  3GTK B;  4X66 L;  2B2Y C;  2EVB A;  1WCM H;  4O42 A;  5EBC A;  4P75 A;  4G7H C;  1IBK L;  5C0X I;  3MXP A;  1VQP A;  1K8O A;  1LT5 D;  1TS5 A;  1Q82 C;  1UWV A;  1G8Z D;  4J8Q A;  4JVZ A;  1XPR A;  2A1A A;  4H44 C;  4LJZ C;  3G6E A;  2K75 A;  1HCZ A;  4GN4 B;  4PMC A;  1VF5 C;  3HOV B;  5IIF A;  1F2M A;  4A3J G;  3PIP 3;  4F8M A;  2RHS B;  2JEA I;  1EY7 A;  2PQA B;  1NAP A;  3J80 L;  1V1Q A;  3H3V I;  5JAV A;  1Q90 A;  3GTK H;  5F2D A;  2XRS D;  5EKI A;  3M85 A;  3M3Y H;  1SYF A;  3UDX A;  1WTV A;  4UHV A;  1FGU A;  2B2V A;  3FKI G;  2CVR A;  1IKM A;  1N33 Q;  4APV A;  4A3E G;  4POG A;  1VQE A;  1TY0 A;  3S1N H;  3S2D B;  4J6H A;  4DGZ A;  1PH7 A;  1K73 C;  3S17 H;  2O5I C;  1GM5 A;  4A3M B;  1KL9 A;  1TWA H;  1SXT A;  3SDZ A;  5G3L F;  2F0K A;  3R8B A;  3F8T A;  1JOR A;  1W3S A;  4A3G B;  1PH5 A;  1KIX A;  3W5O A;  5C4H A;  4B08 A;  2B8G A;  1EWH A;  5E3F A;  5GAH C;  4DKA C;  2JSO A;  2LY7 A;  2Y0S G;  4A3F B;  4OWT B;  2I5M X;  3JAM L;  1AE3 A;  3RZO H;  2E2I B;  1Q1B A;  5IP9 G;  4JK1 C;  1MSH A;  4JI7 Q;  4KKU A;  4FXK C;  4A3E B;  4J1M A;  5C0X J;  4FVM A;  1DGS A;  1YHQ A;  3TRE A;  2G9H D;  2NN6 H;  2F0F A;  1JWU D;  4LFB L;  2RCN A;  1CTM A;  2A6H C;  2RA4 A;  3HOW G;  4L5Q A;  3AU7 A;  2N88 A;  3SXH A;  1O7Z A;  4XYQ A;  3D31 A;  3GTO B;  1D2B A;  2OF1 A;  1RDP D;  3HG9 A;  5IE8 A;  4BY1 H;  5C3X A;  4RAU C;  5LMU Q;  3M4O H;  2F0D A;  3VYR A;  3RLF A;  1GXD C;  3UE0 A;  2ZTE A;  1W6K A;  1RTN A;  3KF8 A;  5HY6 A;  4DV5 L;  1XNQ L;  3F2C A;  3OPO A;  4UY8 C;  3HFZ B;  1EWI A;  1Y1W B;  1YI2 A;  2PNH A;  1D8L A;  1GUW A;  2SEB D;  2PZU A;  3W3A A;  4DV4 L;  4DR5 Q;  1XYI A;  3EQL C;  1TXY A;  2K5Q A;  1JCK B;  3F2U A;  4IPD A;  4V19 0;  4DK0 A;  2QF7 A;  3GTO H;  2ICE C;  3PSI A;  1UEA B;  1JB7 A;  4DK3 C;  4HAE A;  3CPF A;  4HJ9 A;  1XWE A;  1QZH A;  3NQI A;  4B3S L;  3KLS A;  3STB D;  1VQ4 A;  1PZJ D;  1K83 B;  1L1O A;  2K5V A;  2NVX H;  2KVM A;  2NVX B;  5A2Q L;  2ZJR A;  1NCV A;  1U5K A;  2CH4 A;  4R8I A;  3CCU A;  1OXV A;  4R4Q A;  3J81 L;  4C3H B;  3MEH A;  3VYU A;  1CSP A;  1KAA A;  3DMU A;  4KN7 C;  2JQO A;  2F0L A;  3RN2 A;  1A15 A;  2PW7 A;  1VQF A;  3QIA A;  5C4J H;  3V2T A;  2EPB A;  3PV0 A;  5IOD A;  2JK8 A;  1SE4 A;  3HRZ C;  1CK1 A;  3HOX H;  3HOX B;  5TSS A;  2BH2 A;  3JAM c;  2NTT A;  1I4Q A;  3BVG A;  1FNW A;  2R7D A;  2B2V C;  3A7A B;  2F0M A;  1B3A A;  2KEE A;  2FMC A;  3Q23 A;  2BOS A;  4BBS B;  4XXE A;  3DLL A;  2VNU D;  1Q8I A;  1R9T H;  2OQK A;  1AN8 A;  2FMM A;  3D3R A;  2EYJ A;  3Q24 A;  1Q7Y C;  3DHQ A;  3KFU A;  2KJX A;  2DY8 A;  2N55 A;  3C3L A;  1KAB A;  1HXY D;  4WJ4 A;  1SAP A;  1O7L A;  2VUM B;  2KQ3 A;  4K14 A;  3CQZ H;  1PHJ A;  1I3Q B;  1U0L A;  1YIT A;  4B9W A;  2ICI A;  3I4M H;  4HN7 A;  4ME3 A;  1WOC A;  5I2X A;  2MGS A;  3TZU A;  2B2U A;  2KCT A;  4H13 C;  1PTO C;  4YWK A;  4NXN L;  2B63 B;  1VQM A;  4CHT B;  2E5L Q;  3J7A V;  3WOF A;  1MSG A;  3GD7 A;  3NWS A;  2IX3 A;  1YNJ D;  2EYL A;  1EU3 A;  4A3D H;  1KNE A;  3NWT A;  4RHS A;  1N36 L;  3H94 A;  5EJW A;  3KUP A;  3I4N H;  4JOI A;  1WTX A;  5D3I B;  4DN4 M;  3OTO Q;  1V1P A;  1SJE D;  2A6E C;  4E6I A;  4JI7 L;  3OHX C;  2HQE A;  3OSO A;  3X3M A;  1Q81 C;  1R4Q B;  5J39 A;  4A3F G;  4G7O C;  4DUY Q;  4B3T Q;  1FYC A;  1L0Y B;  3PCO B;  5M3F G;  2B3G A;  1UE5 A;  5GAG C;  1LTI D;  1ILQ A;  4DUY L;  1STB A;  3C1F A;  1B4O A;  2XN9 C;  1IW7 D;  2B39 A;  2I07 B;  1NMF A;  5M5W B;  3U4Z A;  1SYD A;  4A3B H;  4XIG S;  1BCP D;  1D5X C;  4ID6 A;  2IPK D;  1LT4 D;  1GUT A;  4DV5 Q;  1VQL A;  1SFO H;  5LMN W;  1WTO A;  5KND A;  1CHP D;  3HOZ G;  4DNI A;  1XX8 A;  3M4O B;  2F0P A;  1YHA A;  4HMJ A;  3PF5 A;  5CMD A;  3VR2 A;  4ZKC B;  1XNR L;  4JPB W;  2K14 A;  4HR7 B;  1S40 A;  1E1T A;  3RR5 A;  1K0R A;  2YTY A;  4WJW A;  1I6H H;  2WKD A;  3HEJ A;  1TWF H;  3HS0 C;  2AKW B;  5HUR A;  2JA8 H;  4R8N A;  3UDF A;  1JJG A;  3S1M H;  4K8I A;  2XNA C;  1XTC D;  4LFA L;  4RGN A;  2Z1C A;  5IYD G;  1Q46 A;  4YCV A;  1PRT F;  2WAQ E;  5IP7 H;  1KLG D;  2F0J A;  2ENB A;  3W1G A;  1TWG H;  4KMU C;  4DR2 L;  5IOC A;  3GTM H;  1S5D D;  3JC6 6;  1PVO A;  2JXM B;  4N9T A;  4XYO A;  4NPS A;  1A6X A;  1SMY D;  2MNA A;  3LX0 A;  2NVT B;  1YVC A;  5JPN C;  2F0W A;  1EQT A;  4DR1 Q;  1XNQ Q;  2QA4 A;  2PI2 A;  4CDE C;  1ZKO A;  2RVL A;  1EU4 A;  1C0A A;  4GOP B;  4XQJ A;  2DJF C;  1NY4 A;  1VQ9 A;  1HZB A;  2B29 A;  2LXJ A;  2J7Z A;  2UXD L;  5CBA E;  2ZTD A;  4LUO A; 
#chains in the Genus database with same CATH homology
 4DV6 Q;  4UP8 A;  4GNX B;  2VL6 A;  4O0A A;  5LMU L;  5EAY A;  4NXN Q;  4OWW B;  3S2H H;  4Y52 H;  1RIP A;  1LTL A;  1IBM L;  4DR3 Q;  4JBK A;  3L7Z C;  3ULP A;  4YCU A;  1EOV A;  2VQF Q;  1OXT A;  4QQB X;  1CKN A;  4OXP A;  5IWA Q;  3A5U A;  1QVF A;  3CMA A;  3STB C;  2GN5 A;  4KLK A;  3K7A H;  4LF5 L;  2UUB L;  1HH2 P;  2JEB I;  5GQO A;  1LM0 A;  4DV0 L;  4TQU S;  3UDG A;  4JV5 L;  4X6A H;  3HOU H;  4JC0 A;  1OXS C;  1UE6 A;  2NVY H;  4DV4 Q;  1P8L A;  4MNO A;  3CCE A;  4DR5 L;  1C9O A;  1X55 A;  4DV6 L;  4HJA A;  1N32 Q;  4BA2 I;  1QUQ B;  2KBN A;  4BXX H;  4A3L G;  4BBR H;  2EQS A;  3K7U C;  5H1S E;  1X3G A;  3ICE A;  2LSS A;  3HOX G;  3CC7 A;  2VQE Q;  4DR2 Q;  4JI3 Q;  4BY7 H;  3HOU G;  1BBW A;  4DV1 Q;  4BY1 G;  2Q2T A;  1E7Z A;  2OQ0 A;  4EQ5 A;  1QZG A;  1K8G A;  4JI4 Q;  5IYD H;  1PH3 A;  2JJQ A;  2MFI A;  3CCQ A;  4JI0 L;  3PUX A;  2UUA Q;  1XNR Q;  1N32 L;  1P16 A;  2UXB L;  3OYY A;  3T1Y Q;  2UUC L;  1Y1V G;  3HKS A;  5C0X G;  1UE7 A;  2K52 A;  5LMN L;  1KRT A;  3TRZ A;  3PUW A;  2R7F A;  1VQD A;  4FDB A;  1W2B A;  2D0O A;  2MO0 A;  1Y1W G;  1QVG A;  2E8G A;  1PA6 A;  2OTL A;  4L5T A;  4YWM A;  3M9B A;  5AJ3 L;  5GAD C;  4DV7 Q;  4LF6 Q;  3AFQ A;  2K5N A;  4BBS H;  1CKM A;  3HKZ E;  4LFC L;  4A3C H;  1N8R C;  3I56 A;  2B63 G;  3OW2 A;  2D0P A;  1ASY A;  1A63 A;  1S3O A;  3PO2 G;  5ELN A;  1MJE A;  4LF5 Q;  3HOW H;  4LUZ A;  1HNW L;  4GLV B;  4LF6 L;  2R93 H;  2ASB A;  2D62 A;  3BZK A;  5J3B A;  1VS0 A;  4O2D A;  5JEA G;  3U4V A;  2PQA A;  3S2D H;  5C4X H;  4LF4 Q;  1FL0 A;  4YHH Q;  4A3B G;  1YJN A;  4GOP A;  1XPU A;  1VQC A;  2QEX A;  2IY5 B;  3NEM A;  1XJV A;  2YU9 H;  2ZTC A;  1I3Q H;  4PZ7 A;  1JT8 A;  4BBR G;  2H5X A;  3PO3 G;  4BXX G;  3EN2 A;  5IP7 G;  4AH6 A;  4GNX C;  1MJC A;  3KDF A;  3LGJ A;  1BBU A;  1IYJ B;  2N49 A;  2PMZ E;  2R7Z G;  4DV3 L;  1B70 B;  4GOP C;  1FVI A;  4A3G H;  4HIK A;  3U50 C;  1PH6 A;  1GVP A;  1VQK A;  4JI3 L;  1B8A A;  1YEZ A;  3KJP A;  2Q2H A;  3J81 i;  2F4V L;  5IYB G;  3NEL A;  3M4P A;  3J7A 5;  1S72 A;  1KC8 C;  2JE6 I;  3ULL A;  3GDE A;  4XTC S;  5E7N A;  4A4I A;  1J6Q A;  4GNX A;  1KQS A;  3HOY H;  2UXC L;  2NZO A;  2K50 A;  4IPH A;  4JG2 A;  3T1H Q;  4DV0 Q;  4AQY L;  4QJF A;  2VQF L;  1KD1 C;  5DLQ E;  1IXR A;  4KHZ A;  5C4X G;  1E1O A;  2KCM A;  1XMO L;  1CKN B;  4A93 H;  4K0K Q;  1KXL A;  3PUY A;  1V43 A;  2GVB A;  1O7I A;  4X65 L;  1X65 A;  2N3S A;  1BVS A;  2K5H A;  4A3M H;  1K8A C;  2ATW A;  1VQI A;  3GTP H;  2HHH L;  4QY7 A;  3M4Q A;  1FJG L;  2AWN A;  3RLN A;  2IT1 A;  4IOA A;  1YIJ A;  1EUJ A;  4JI1 Q;  4DAY B;  5IY0 A;  4POF A;  2HQL A;  4A3I H;  4WJ3 M;  1N34 Q;  4ALP A;  2UU9 L;  3S15 H;  1YZ6 A;  5JJI A;  5IWA L;  3AEV A;  2F52 A;  1YBY A;  1YNX A;  1KRS A;  2E2H H;  4HJ8 A;  2JA7 H;  1HNX L;  3BJU A;  1GD7 A;  4B3M L;  3DM3 A;  3AYH B;  4TVA B;  5FLM H;  4X66 L;  5IP9 H;  1SRO A;  1I94 L;  4L5S A;  2JA7 G;  2ALY B;  1Z9F A;  4A3G G;  5LMN Q;  4JI5 Q;  2IX1 A;  3B6Y A;  3H3V H;  1WCM H;  2WFW A;  2Q2I A;  3KLW A;  4P75 A;  4JI2 Q;  5C0X I;  1VQP A;  1IBK L;  1EYG A;  2JA8 G;  2JA9 A;  3PIP A;  5C3E H;  1Q82 C;  1AH9 A;  1UEB A;  4DUZ L;  4IPG A;  1UWV A;  3J81 c;  1HNZ L;  2BA1 A;  1XPR A;  4EX5 A;  2A1A A;  2Y0S E;  3KF8 B;  3WWV A;  1H95 A;  3G6E A;  2K75 A;  1JE5 A;  3D0F A;  3HKZ G;  4GN4 B;  1IZ6 A;  2I5H A;  2VZA A;  4MZ9 A;  2N78 A;  2VS1 A;  4OO1 I;  3CME A;  4DR3 L;  4A3J G;  1NBW A;  2RHS B;  2JEA I;  3TEH B;  4A75 A;  1UE1 A;  3FKI H;  2PQA B;  3IRB A;  1X9N A;  4K0K L;  4B3S Q;  3F1Z A;  1V1Q A;  3H3V I;  4NXM L;  3GTK H;  4DUZ Q;  2PI2 E;  4JCV E;  4DV3 Q;  3M3Y H;  3M85 A;  3UDX A;  2DUD A;  3JAM i;  1K83 H;  3CCJ A;  1PH4 A;  1FGU A;  3ERS X;  1NMG A;  4HJ5 A;  1PH2 A;  3FKI G;  3KYH C;  2AMC B;  5GRO A;  1VQJ A;  3CCL A;  1VQN A;  1N33 Q;  1I5F A;  1X3F A;  4APV A;  4A3E G;  4POG A;  1VQE A;  3S1N H;  1IBL Q;  4A93 G;  1PH7 A;  4DR4 Q;  2OCE A;  1K73 C;  3S17 H;  1CSQ A;  4X66 Q;  1GM5 A;  4NB3 A;  1KL9 A;  1TWA H;  2QGQ A;  5M5Y H;  1L1O B;  2A19 A;  2R7Z H;  2NN6 G;  4LF9 L;  4KHP L;  3F8T A;  2L15 A;  1W3S A;  4HIM A;  4X62 Q;  1IBL L;  2IHE A;  1PH5 A;  1KIX A;  3L0O A;  4JI4 L;  2KHJ A;  3BU2 A;  3W5O A;  4GKK Q;  1X3E A;  3HOY G;  5M3M G;  1PFS A;  5GAH C;  4JBM A;  4GKJ Q;  4DKA C;  4RMF A;  2Y0S G;  4LW1 A;  2E2J H;  4OWT B;  4RG1 A;  2EXD A;  4JI2 L;  5FJ8 G;  2I5M X;  1IBK Q;  3GTL H;  5IYB H;  1AE3 A;  3RZO H;  1Q1B A;  4H02 A;  5IP9 G;  2CCZ A;  4JI7 Q;  5M3M H;  4YY3 L;  3Q8D A;  3J80 c;  1EQR A;  2UUC Q;  2C35 B;  1WYD A;  5C0X J;  3L2P A;  3PF4 A;  3CCM A;  1DGS A;  4P72 A;  1YHQ A;  1Q8K A;  5JJK A;  1G6P A;  3TRE A;  1I94 Q;  1K9M C;  1SR3 A;  3NEN A;  1OXX K;  1KHI A;  2DGY A;  3KF6 A;  2RCN A;  5BR8 Q;  1HZC A;  1VQA A;  4UP7 A;  4LFB L;  4P74 A;  4YWL A;  3HOW G;  2KHI A;  4L5Q A;  5FLM G;  3D31 A;  4LUV A;  2ZJP A;  1YHB A;  1E22 A;  4JI5 L;  4LF7 L;  3K81 C;  5IE8 A;  4BY1 H;  2LXK A;  1VCI A;  4HID A;  3PIO A;  1M1K C;  4LF9 Q;  3HOZ H;  5HGQ A;  5FLX c;  5LMU Q;  4GS3 A;  1VQ5 A;  4LF4 L;  1Q12 A;  3M4O H;  2E2I H;  1EQQ A;  3RLF A;  1HNZ Q;  2FXQ A;  2XGT A;  3UE0 A;  4LF7 Q;  4B3R L;  2ZTE A;  1A0I A;  4IJH A;  5IYC G;  4AYB E;  3VDY A;  5HY6 A;  5M5X H;  4DV5 L;  4PZ6 A;  1XNQ L;  4R4I A;  1VQH A;  3F2C A;  4UY8 C;  3F2B A;  2ZM6 L;  3GTQ H;  3HFZ B;  3S16 H;  3S1Q H;  1EWI A;  1YI2 A;  2PNH A;  4DAM A;  2Q2U A;  1D8L A;  1I50 H;  1M90 C;  3E9H A;  4DV4 L;  4DR5 Q;  4LFC Q;  2OTJ A;  1VQ7 A;  1TXY A;  1KAW A;  1L1O C;  1OXU A;  2EIF A;  2WB1 G;  3A5Z B;  2RHQ B;  3E0E A;  4IPD A;  1N9W A;  2IX0 A;  5AJ3 Q;  3HOV H;  1NJI C;  4A3D G;  3GTO H;  1VQ6 A;  3CCV A;  3PSI A;  1JB7 A;  1X54 A;  4DK3 C;  4DV1 L;  2YTX A;  4AQY Q;  4A3F H;  3CPF A;  2JA5 H;  4HJ9 A;  4R1J A;  1QZH A;  3KJO A;  1C7Y A;  1HZA A;  1RL2 A;  1SE8 A;  4B3S L;  1GKH A;  4LF8 Q;  4DR7 L;  3STB D;  1VQ4 A;  1E3P A;  2AWO A;  5FJ8 H;  1VQO A;  3ER0 A;  1PYS B;  4C3J H;  1PV4 A;  2UUA L;  4JI8 Q;  1XTD A;  4BBS G;  3S24 A;  2ZJQ A;  1L1O A;  2K5V A;  2NVX H;  5IYC H;  4GKK L;  2IHF A;  1X6O A;  2ZJR A;  1U5K A;  3T1Y L;  4YHH L;  3CCU A;  1FJG Q;  1Z47 A;  1OXV A;  4R4Q A;  4C3H H;  4A3I G;  4OON A;  2OWO A;  3K8A A;  3PUZ A;  1Y1V H;  4A3C G;  1CSP A;  2HIV A;  4OX9 L;  1PH1 A;  3E9I A;  2XTI A;  3F2D A;  3ULJ A;  2JQO A;  3KOJ A;  1MIU A;  3RN2 A;  3J7Z C;  3CF5 A;  2V1C C;  4JBW A;  1HJP A;  1VQF A;  5M5W H;  4A3M G;  3A0J A;  4JYA Q;  5C4J H;  3AQQ A;  2CWP A;  3I4O A;  4JI6 Q;  3PV0 A;  4B3T L;  4NXM Q;  2JK8 A;  1AE2 A;  2BH8 A;  3CW2 C;  3CP0 A;  3H0G H;  4GN5 A;  1L2F A;  4YY3 Q;  3K0X A;  3U58 A;  4BY7 G;  1D7Q A;  3HOX H;  3K80 C;  2BH2 A;  5C3E G;  3JAM c;  4IFD I;  2YV5 A;  3TQY A;  2ZM6 Q;  1PH8 A;  2N8N A;  1MKH A;  2R7D A;  4C3I H;  2HT1 A;  1EFW A;  2WP8 J;  2Z0S A;  4DV2 Q;  4DR6 L;  5C44 H;  1VQB A;  2UXD Q;  4JI0 Q;  3KF6 B;  2F3I A;  5JJL A;  3EIV A;  3ZJY C;  2YYZ A;  5GAE C;  3DLL A;  4DV7 L;  2A8V A;  2VNU D;  4A3J H;  1ASZ A;  1R9T H;  2OQK A;  2CQO A;  1N34 L;  2Z6K A;  4DV2 L;  4DR6 Q;  1Q7Y C;  4MTN A;  3KFU A;  4YCW A;  3UDI A;  3CCR A;  4IPC A;  4AYB G;  1XMQ Q;  3CXC A;  3RLO A;  4KI0 A;  1K3R A;  4WJ4 A;  1LUZ A;  2NZH A;  4LF8 L;  4DR7 Q;  1X56 A;  1G29 1;  3CQZ H;  1PHJ A;  4P71 A;  1U0L A;  2GVA A;  4Y7N H;  1SRU A;  4C2M H;  1YIT A;  2R93 G;  3I4M H;  1OTC A;  4B3R Q;  4ME3 A;  5BR8 L;  1WOC A;  1GO3 E;  3I55 A;  4PMW A;  2KCT A;  4GLX A;  4YWK A;  4NXN L;  2NVT H;  2WB1 E;  1XPO A;  1VQM A;  2E5L Q;  2B63 H;  3PUV A;  1IL2 A;  3BZC A;  3GTG H;  3GD7 A;  4KHP Q;  4GLA C;  3PGZ A;  4JI1 L;  3CC4 A;  3I4M G;  2AHO B;  4A3D H;  3HOV G;  4JBJ A;  4GN3 B;  1T9H A;  1VQ8 A;  1Q1E A;  1HR0 W;  4L5R C;  1N36 L;  1HZ9 A;  1J5E L;  2NVQ H;  1HR0 L;  4R4O A;  3MEF A;  3I4N H;  4JOI A;  4X64 Q;  3OTO Q;  3GTJ H;  2VUM G;  3PO3 H;  4IFD G;  1BKB A;  3S1R H;  4JI7 L;  5M3F H;  2UXC Q;  1N33 L;  1Q81 C;  3CAM A;  4LFA Q;  3S14 H;  2KEN A;  1HNW Q;  4A3F G;  1WCM G;  3FP9 A;  4DUY Q;  3H15 A;  4B3T Q;  4X65 Q;  3NBH B;  3PCO B;  4OO1 G;  3SGI A;  5M3F G;  4JYA L;  2B3G A;  1UE5 A;  1SN8 A;  1V9P A;  5GAG C;  2VW9 A;  3M7N A;  2R92 H;  1WJJ A;  1WI5 A;  4LNQ A;  3PO2 H;  1TWH H;  3CD6 A;  4DUY L;  2WAQ G;  3H0G G;  1SLJ A;  4UPA A;  1JJC B;  1NMF A;  4LWC A;  1E24 A;  4A3E H;  4X62 L;  3I4N G;  2BA0 A;  3KDF B;  3U4Z A;  3CPW A;  1Y14 B;  3TS2 A;  4JV5 Q;  3J81 j;  4A3B H;  4QGU A;  4XIG S;  4DR1 L;  4UP9 A;  2E5L L;  2JA6 G;  3CCS A;  2VY3 A;  4A76 A;  1A8V A;  4DV5 Q;  1NTG A;  1XMO Q;  1SFO H;  1VQL A;  3J80 i;  3EBE A;  5LMN W;  4AIM A;  3RZD H;  2ES2 A;  4JI6 L;  2RF4 A;  1XMQ L;  3HOZ G;  3GO5 A;  4DNI A;  1IBM Q;  4J15 A;  3T1H L;  3RNU A;  1YHA A;  3OTO L;  3PF5 A;  2UXB Q;  4QL5 A;  2CKZ B;  3I2Z A;  4DPG A;  2HHH Q;  1XNR L;  4JOI C;  4A3L H;  2K14 A;  1PYB A;  2MO1 A;  1HR0 Q;  2YTV A;  4IOC A;  1CKO A;  4OWX B;  2JA6 H;  4IO9 A;  2I5L X;  1Y1W H;  1S40 A;  1E1T A;  3FHW A;  1B7Y B;  4QIW E;  3RR5 A;  1K0R A;  3W1B A;  4X64 L;  2UUB Q;  1YJ9 A;  1EIY B;  2YTY A;  1I6H H;  2NN6 I;  3A74 A;  4A3K G;  4JI8 L;  1TWF H;  2HIX A;  1YJW A;  2AKW B;  2JA8 H;  3UDF A;  1JJG A;  3S1M H;  4IFD J;  1LYL A;  4PG3 A;  4LFA L;  4HIO A;  5IT9 c;  2UU9 Q;  5IYD G;  1Q46 A;  3AFP A;  4YCV A;  2WAQ E;  2VUM H;  5IP7 H;  4OX9 Q;  1A62 A;  2R92 G;  3W1G A;  1TWG H;  2VQE L;  4DR2 L;  4A3K H;  4DR4 L;  3GTM H;  2CWA A;  3JC6 6;  2F4V Q;  1Q86 C;  5JEA J;  5C44 G;  1PVO A;  2CFM A;  1NE3 A;  1HNX Q;  4B3M Q;  4NPS A;  4HJ7 A;  2MNA A;  4BA1 I;  3TS0 A;  1YVC A;  4DK6 C;  4R4T A;  2K4K A;  2MQH A;  1J5E Q;  1JMC A;  4DR1 Q;  1XNQ Q;  1PH9 A;  1JJ2 A;  1QUQ A;  2QA4 A;  1N36 Q;  3G48 A;  3UE1 A;  4LFB Q;  2PI2 A;  2Z6K C;  2R6G A;  1EIF A;  1SMX A;  4R4C A;  1CUK A;  4GKJ L;  4P73 A;  1TWC H;  3G71 A;  1C0A A;  1WFQ A;  4GOP B;  1G51 A;  3CC2 A;  1QVC A;  3I7F A;  1NY4 A;  3MXN B;  4IJL A;  3RN5 A;  1VQ9 A;  5K36 G;  1HZB A;  2ID0 A;  2B29 A;  4PZ8 A;  1L0W A;  1VQG A;  2LXJ A;  3G4S A;  2I0Q A;  5ELO A;  2UXD L;  2JA5 G;  2ZTD A;  4LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...