2UUCL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucL00
3GTJH 3GTLH 1VS0A 4GN3B 1C9OA 2N49A 1OXXK 3PUYA 5JJIA 1VQ6A 1B7YB 4HJ7A 4LUZA 3CCVA 5GROA 5IY0A 1YVCA 3T1YQ 4A3JH 4BY7H 1B70B 1Z47A 3CC2A 4EX5A 2K5VA 1IXRA 3L7ZC 2I5LX 4BBSG 3HKZE 3CCMA 3OTOQ 4A3IG 5FLMH 2UXBQ 5IYCG 1LTLA 2AWOA 1HJPA 4YCWA 4YWMA 4X64L 2QA4A 1HNXL 1NMFA 1ASZA 1IBKL 3NBHB 4IFDJ 2ALYB 1OXVA 3RZDH 5IYBH 4LUOA 3HOWH 1MJEA 1VQJA 1TWGH 1PH2A 4DR2Q 3NEMA 2I5MX 2K4KA 2N78A 3M4PA 2IY5B 1SROA 2OQ0A 4KI0A 3TEHB 1FGUA 3CCJA 1NBWA 3CP0A 2QEXA 3CCEA 2VNUD 1EIFA 1JMCA 4GNXA 1PH6A 4B3ML 3HOVH 4A3IH 3KF6B 5JJKA 2D0OA 4JI7Q 3L0OA 4A76A 4DAMA 1GM5A 2R7FA 1I50H 5IP9G 4DR3Q 3K8AA 4PZ7A 4DV2Q 2PI2E 2I0QA 3KYHC 1HR0L 4JBMA 4X6AH 3M4QA 4DV1L 2XGTA 3ER0A 1UWVA 1HZCA 1VQAA 3A0JA 2CFMA 2IX1A 2K50A 3TQYA 4JI4Q 2OQKA 5AJ3L 4DV7Q 3S1NH 3K0XA 3HOXG 4OWTB 3SGIA 3CQZH 1L1OA 1QVCA 3F2BA 4JI3Q 1CUKA 1X3FA 2RHQB 3E9IA 3F2CA 1W2BA 4A3CH 2OTLA 3JAMi 4IFDI 3CF5A 4C3IH 1Q7YC 1Q12A 2C35B 4BBRH 3H0GG 2ES2A 1UEBA 1HNZQ 1A63A 1QZHA 1VQCA 1WYDA 3U50C 3J81c 2LSSA 4DR1Q 4A3LH 1TWFH 1XPRA 1VQHA 1XNRQ 4KHPQ 3OTOL 5IP9H 4LF9Q 1I5FA 3UE0A 4OXPA 1VQIA 4GLVB 4P74A 2UXBL 2OWOA 2NVTH 1KHIA 2V1CC 2F4VQ 2IHFA 4L5QA 2VUMH 5C4XG 3CXCA 2JK8A 1SE8A 1VQLA 1VQ9A 4LFCQ 1WFQA 2JA7G 2JEBI 2UUAQ 2KCTA 2AMCB 1YNXA 2CWAA 5M3FG 1BKBA 2WB1G 4HJ5A 3T1HQ 4JI1L 3I55A 1YI2A 3H0GH 2FXQA 1L0WA 2HT1A 1N9WA 4HJ9A 2ATWA 1BVSA 1X3GA 1KXLA 3D31A 2OTJA 2JA5G 1CKNB 1MIUA 3S1QH 5JEAJ 1SR3A 4UY8C 1CKMA 1SN8A 2D62A 2I5HA 5HGQA 4X66L 2ZM6Q 3RN5A 1PV4A 3H3VI 4DV2L 4A3DH 2Q2HA 4HIMA 1PA6A 5C0XG 1PYBA 1E22A 2D0PA 2Q2IA 5M3MH 4X64Q 2YTVA 2AKWB 1RL2A 1HNXQ 1IBKQ 4A3KG 1LM0A 5C0XI 3CPWA 1KQSA 2EIFA 2N8NA 4BY1G 1X55A 2B63G 2JA6G 1CSPA 4A3EG 4GOPC 2E2HH 2VZAA 2JA5H 3AQQA 2LXKA 3FHWA 4LNQA 1K8GA 3H3VH 1LUZA 1R9TH 2BA0A 4KLKA 4A3JG 4B3MQ 4JG2A 5C44H 1TWAH 1B8AA 2LXJA 5ELOA 1YJNA 2ZJQA 3CW2C 4LF6Q 1OXSC 4HIOA 5C3EH 1W3SA 3HOZG 4IOAA 1C0AA 4GKJQ 4R4QA 4Y7NH 4QL5A 4X65L 2F4VL 4RMFA 3ICEA 1K8AC 3PO2H 3KLWA 4LFCL 1SLJA 4JYAQ 4GS3A 2A8VA 2JA6H 1H95A 1NY4A 2YTYA 4A3EH 1PH8A 4QJFA 1E24A 2K5HA 4C3HH 2N3SA 5IYBG 1VQ4A 3HOWG 3KDFA 3M9BA 3KFUA 1M1KC 2RF4A 3F1ZA 5M5YH 4TQUS 2PQAA 1KC8C 2KHJA 4DR6L 5FJ8H 2ZM6L 2VQEQ 4IJHA 3HOVG 3HOZH 4UPAA 4IPCA 4BXXH 3OYYA 2DGYA 3JC66 1XJVA 2HIXA 4LF4Q 2B3GA 1XTDA 2KBNA 3ZJYC 3F2DA 1PH3A 5LMUQ 1MKHA 1AE2A 1N34L 1YBYA 4DPGA 4GNXB 1VCIA 5FLXc 3PIPA 1MJCA 1EIYB 4AIMA 4L5TA 3VDYA 1N33L 5GAHC 3PGZA 1WJJA 3K7AH 3JAMc 3S15H 2E2IH 4B3RQ 2VW9A 3CC7A 3TRZA 4C2MH 4JI1Q 3H15A 2WAQG 2WB1E 4JBWA 4R4TA 4EQ5A 3S24A 4P75A 4A3CG 1DGSA 4K0KL 1I3QH 2VS1A 3GTMH 3MEFA 1VQEA 4BBRG 1L1OB 4LF7Q 4DKAC 1PVOA 3PSIA 2E5LQ 1HH2P 2JQOA 3GO5A 3OW2A 1IBLL 4LF8Q 2NVQH 4A3LG 3GD7A 4LF6L 4JV5L 4X66Q 4JI2L 2PNHA 2A19A 4NB3A 4GKJL 2R7ZG 3ULPA 1P8LA 2K14A 1YEZA 4HJ8A 1XMOL 1A62A 3K81C 3KF8B 1K9MC 4AYBG 1XPUA 1NE3A 1YHQA 4LFAL 4DR5Q 3G6EA 2VUMG 4A3BG 1D8LA 1EUJA 2GVBA 1HZBA 3E0EA 2NN6G 4AQYL 1VQ7A 4PMWA 2JA8G 3J80i 1Y1VH 1IYJB 1KRTA 1PH4A 1VQKA 1EQQA 4MZ9A 1TWHH 2HHHQ 4IFDG 2NN6I 2BH8A 5BR8L 4NPSA 1NJIC 1VQPA 4JCVE 2KENA 3WWVA 4UP7A 1HZAA 1TXYA 1JJCB 2K75A 3RNUA 4GOPB 4WJ3M 4OO1I 4H02A 2NZOA 2K5NA 2VQEL 2JEAI 1KAWA 3M85A 2R7ZH 5HY6A 1K3RA 1OTCA 4LF4L 1CKOA 1L2FA 3PIOA 4GNXC 2HQLA 1X56A 3UDGA 4JI5Q 1EFWA 3AEVA 2Y0SG 3PF5A 5LMUL 1VQGA 2Z6KA 4X65Q 4A3BH 3I4NH 1Q1BA 1GO3E 4JI8Q 2JA8H 4A3DG 3D0FA 1I6HH 1Q8KA 2NZHA 4ME3A 5M3MG 1PH5A 3AFPA 4B3RL 4RG1A 1BBWA 4HIDA 1V9PA 1NTGA 4GN4B 5IE8A 4DV4L 4DAYB 2UUCL 3GTQH 3A74A 1JJ2A 2YV5A 1L1OC 1OXTA 3ERSX 1UE1A 3HKZG 4KHZA 4MNOA 3TREA 3PV0A 3CCQA 4A3MG 1GD7A 3FP9A 1I94L 4JI6L 1G291 3S14H 4LF7L 1FJGQ 4YHHQ 2E5LL 2R6GA 4LF8L 3RZOH 4DR6Q 2EQSA 4O2DA 3S16H 4APVA 1S40A 3GTOH 3STBC 1N8RC 5C44G 1GKHA 3RLOA 1VQMA 3U58A 5IYDH 1V1QA 5C3EG 3CCLA 1N34Q 4A93H 4A3GH 4JBJA 4P73A 2UXCL 4DR5L 3CCSA 5E7NA 2CKZB 2YU9H 3PO2G 1N33Q 4BA2I 4O0AA 5JJLA 4DR7L 2YTXA 2HHHL 4OWWB 1JT8A 1JE5A 1WCMH 1TWCH 3GTGH 4A3MH 2MO0A 1N32Q 1S3OA 3RLFA 2WAQE 3ULLA 5GAGC 3M4OH 4K0KQ 2ASBA 4FDBA 1JJGA 2UUBL 4JOIA 4QIWE 4B3TQ 1IBLQ 3KDFB 2R93G 1WOCA 2ZTCA 2BH2A 4DR4L 4JI5L 5FJ8G 4JV5Q 1WI5A 4JI2Q 2MFIA 5JEAG 3I2ZA 2F52A 2IX0A 3UE1A 5IWAL 1QZGA 4BXXG 1G51A 1XPOA 4P72A 1XMOQ 4POFA 4JI8L 2YYZA 1Q82C 3S1MH 4LFAQ 1YHAA 4JYAL 1EOVA 1Q1EA 4QGUA 4AYBE 4AQYQ 4LWCA 2IHEA 3RN2A 1N36L 3S1RH 3RLNA 1V43A 4DV0Q 4GLXA 2RHSB 3BJUA 5BR8Q 2CWPA 4GLAC 3KJOA 1PH1A 4OWXB 3CCUA 5GAEC 1QUQA 3G4SA 1T9HA 5IP7H 2R93H 1FJGL 4YHHL 3E9HA 4XTCS 1S72A 4NXMQ 1KL9A 2WFWA 2E2JH 2DUDA 3A5ZB 1KD1C 1VQ8A 2NVXH 1VQNA 3TS2A 2CQOA 3FKIG 1Q86C 4YWKA 1E3PA 2CCZA 4POGA 3I4MH 1HNWL 1G6PA 1X65A 1X9NA 1SFOH 3J80c 4LF5Q 3NELA 4PG3A 1YJ9A 1UE7A 4DNIA 4LFBL 4AH6A 3HKSA 4OONA 4IOCA 5C4JH 5IT9c 3M3YH 4YCUA 2UUCQ 1Y1VG 4DV4Q 4TVAB 5H1SE 1YJWA 1N32L 3PCOB 3I4OA 2K52A 4OX9L 3U4ZA 1VQOA 1NMGA 1PH7A 3PF4A 4ALPA 4X62L 3IRBA 3LGJA 2R7DA 5LMNL 4JI6Q 2R92G 3CD6A 1I94Q 3HOYH 3PO3H 4QQBX 1LYLA 2JA9A 1IBML 2MQHA 1J5EL 3S17H 2UU9L 4B3TL 1AE3A 1UE5A 3FKIH 1GVPA 1P16A 5J3BA 4C3JH 3G48A 1SMXA 1EQRA 4MTNA 3HOUH 1QVGA 3AYHB 3DLLA 1K73C 2QGQA 2NVYH 3F8TA 4HJAA 2KHIA 2Z0SA 4L5SA 2UXCQ 4J15A 4LUVA 1K0RA 1C7YA 3I4NG 3GTKH 2IT1A 1SRUA 4UP8A 2L15A 5EAYA 4DUYQ 2E8GA 4DR7Q 3L2PA 4DV0L 4A3FG 5ELNA 3Q8DA 3UDIA 4YY3L 5GQOA 4HIKA 3CPFA 3S2DH 4DV6L 1UE6A 4JC0A 2R92H 4BBSH 3M7NA 3S2HH 1FVIA 4B3SL 2KCMA 4OO1G 1JB7A 4L5RC 4GKKQ 1VQBA 4GN5A 2UUBQ 4IPHA 5IYCH 4JI0L 4NXML 2UXDQ 2EXDA 3J81j 3W1BA 3BZKA 2B29A 4DR4Q 1IZ6A 4DV5L 3GDEA 3J7ZC 2VQFL 5IWAQ 3PUVA 1E7ZA 2GN5A 4LF5L 3CC4A 5IYDG 1IL2A 1K83H 2MNAA 1Y1WG 2Q2UA 4A93G 3KF6A 4A3GG 4A3FH 5M5XH 4DV3Q 1N36Q 2H5XA 3CAMA 2PMZE 2A1AA 1PYSB 3T1YL 3G71A 4UP9A 3K80C 1WCMG 2JE6I 3CMAA 1VQ5A 2ZTDA 3KJPA 2PI2A 3TS0A 4XIGS 4R4OA 4NXNQ 1HZ9A 3BZCA 3UDFA 1J6QA 2F3IA 4IJLA 1YZ6A 3DM3A 3EN2A 5C0XJ 1KRSA 3I7FA 3W5OA 2MO1A 3HOXH 1XMQQ 1E1OA 5LMNW 4LW1A 1HNWQ 1Y1WH 4GOPA 4DUZQ 1ASYA 4YCVA 1U5KA 2RCNA 3BU2A 3U4VA 1YIJA 1XNQQ 4LFBQ 4DR2L 1VQFA 2WP8J 4DUYL 2Z6KC 1PH9A 4A4IA 5M5WH 1YHBA 5K36G 4PZ8A 3GTPH 4WJ4A 4PZ6A 4A75A 1PFSA 1QVFA 3W1GA 4OX9Q 3AFQA 5GADC 1EYGA 4X62Q 3K7UC 5LMNQ 4JI7L 4GKKL 1IBMQ 1VQDA 3J81i 1J5EQ 2UXDL 5C4XH 3RR5A 2UU9Q 2ZJPA 5IP7G 4DK3C 2ZJRA 4DR3L 1U0LA 4IPGA 4QY7A 2BA1A 4BA1I 1Q46A 4IO9A 2JA7H 3J7A5 1BBUA 3B6YA 1FL0A 4JI4L 1QUQB 5M3FH 4DV7L 4JBKA 1Y14B 3HFZB 2PQAB 3I4MG 3I56A 1CKNA 1X54A 3MXNB 4JI3L 1A0IA 1RIPA 4DK6C 2ZTEA 1EWIA 2VL6A 2JJQA 4DV3L 1E1TA 1HR0W 4Y52H 3PUZA 1Q81C 4YY3Q 1HNZL 2AWNA 4DV6Q 2GVAA 4DR1L 2Q2TA 4B3SQ 1PHJA 1YITA 1XNRL 4BY7G 1Z9FA 4NXNL 3STBD 4KHPL 3A5UA 3EBEA 4LF9L 3CCRA 4JI0Q 3HOYG 3PO3G 2OCEA 3NENA 3EIVA 3UDXA 4IPDA 2XTIA 3KOJA 4R4CA 4R1JA 3ULJA 5FLMG 1KIXA 4A3KH 1HR0Q 2AHOB 1CSQA 1XMQL 4DV5Q 3PUWA 4DV1Q 4BY1H 1OXUA 4JOIC 2VQFQ 2B63H 2VY3A 2HIVA 2UUAL 1M90C 1D7QA 1X3EA 2ID0A 5AJ3Q 4R4IA 2Y0SE 4DUZL 1O7IA 3PUXA 1XNQL 5DLQE 3HOUG 1AH9A 4YWLA 3T1HL 1A8VA 4P71A 3CMEA 1X6OA
chains in the Genus database with same CATH superfamily
3GTJH 4RAUC 1C9OA 1DJRD 1OXXK 2N49A 1EU4A 3V96A 1NR4A 3T1YQ 2K5WA 4A3JH 5CBEE 1Y69U 3ONAB 5FO8B 3BZDB 3HKZE 2EY6A 1K3BC 2UXBQ 4PMCA 3Q22A 2AWOA 4YCWA 1ASZA 5BN3A 2C5CA 3J81L 3SEBA 1OXVA 3RZDH 3HOWH 2K05A 1VQJA 1TWAB 1EY4A 5IGBA 1PH2A 3M4PA 4NKLA 4Y7NB 1BQQT 3CP0A 1G2TA 2RDFA 1JMCA 5A2QE 4EQPA 1LTID 4B3ML 3HOVH 3KF6B 5IGFA 2EVBA 4C3HB 1BNZA 2I0QA 2ZXRA 3M4QA 1C0AA 4V0BA 2EYPA 1STBA 1TIID 2K50A 2OQKA 5AJ3L 1B53A 2RKSA 4OWTB 3SGIA 4TSSA 2F0SA 3I70A 3HOZB 1X3FA 1H9KA 1U4MA 2OTLA 2KOLA 4C3IH 1Q12A 2SEBD 2ES2A 1UEBA 4DR1Q 4A3LH 3J81c 1TWFH 3K7AB 2E2IB 3MA2B 4LF9Q 4DA2A 4C2MB 1EU3A 2F4VQ 2IHFA 5C4XG 5CC4A 3CXCA 3GTMB 2JA7G 1SMYD 1WFQA 4UHVA 1LTAD 4XQNA 5M3FG 2I46A 4HJ5A 4CKCA 2K01A 3BYTB 3LWUA 1X3GA 1BF4A 3D3RA 4FXKC 2OTJA 1Y8NB 4KKSA 1CKNB 3DWPA 5I6WA 1QJOA 1Z7TA 2C9OA 1SR3A 2D62A 3I4LA 5HGQA 2ZM6Q 4X66L 1PV4A 4R9WA 5C0XG 4X64Q 1E22A 2AKWB 1RL2A 2PPBC 3M7GA 1LTSD 5FOBB 5C0XI 3CPWA 1YNJD 1KQSA 1K0SA 4XYQA 3OMCA 4C3HG 2E2HH 4WORA 4FO2A 1JR0D 3WOEA 1I6HB 3FHWA 4MHEA 1K8GA 3H3VH 1LUZA 1EWCA 5C44H 1K8OA 2EOTA 3DUZA 1ICFB 2LXJA 5ELOA 4HIOA 3HOZG 4IOAA 2XSCA 4RMFA 3ICEA 4K5WA 1GUGA 3KLWA 2F3VA 2F0IA 1EY9A 3S14B 4RHSA 1XTCD 4A3EH 3RD4A 4QJFA 1E24A 2K5HA 5L37A 3S16B 2K7VA 3VR2A 5M5YH 1Y1WB 3QOJA 1JOOA 2ZXPA 4FVMA 1PTOF 2PNRC 1J9OA 2VQEQ 4BXXH 4ZKCB 3ZJYC 2KBNA 3NQTA 4DPGA 4GNXB 1VCIA 2X69A 3M4OB 3VDYA 4BS9A 5GAHC 4OGQC 1PRTF 3NQIA 3S15H 1U4RA 3TP8A 5EQ0A 4ZCKA 2WB1E 4EQ5A 4HMIA 3IFDA 4K0KL 4L8JA 4LF8Q 4HTHA 5D3DA 2R7ZG 1DYQA 2WV6D 4GKJL 3ULPA 3I3CA 1YEZA 1A62A 2K03A 2CHBD 1YHQA 1SNQA 1D8LA 1EUJA 2GVBA 1HZBA 1RD9D 3HEJA 2R93B 2FHTA 1EL0A 2XN9C 4JVZA 2B2TA 1VQKA 4MZ9A 2HHHQ 4IFDG 4NPSA 1NJIC 1VQPA 3SR1A 2M2LA 1EY7A 2EYFA 2K75A 3RNUA 4WJ3M 1TS5A 5EPLA 2AQ1B 2XNAC 3T56B 5HY6A 1ZEQX 4LF4L 3PIOA 2F0JA 3GP7A 4PMBA 1VQGA 4X65Q 1LV9A 2MPMA 3I4NH 2CQAA 2NN6H 3BDCA 4JI8Q 1KLGD 3PO3B 4FNFA 3S17B 4FF3A 4HIDA 1S5DD 1ENAA 1XX8A 2Z9HA 3ITPA 5IE8A 2UUCL 3HOUB 4KHZA 4MNOA 3HKZG 4DXFA 3CCQA 1I94L 4YHHQ 2KJXA 1EY5A 2QEJC 3RZOH 3W3AA 2EQSA 4O2DA 2RBMA 1S40A 3STBC 1HUNA 1MSGA 4FF4A 4BBSB 3CCLA 4WJWA 4A93H 4JBJA 4P73A 2YU9H 3TMEA 3PO2G 5JJLA 1JT8A 1SNMA 4XDXA 5FO7B 1CM9A 3GTGH 2DY7A 5J39A 3E6ZX 1ML0D 2WAQE 4DNRB 1ENCA 3DEOA 4C1NI 4Z9CB 2R93G 4B3TQ 2ZTCA 4JI5L 5FJ8G 4JV5Q 3DWQA 3JAME 2IX0A 2J4XA 4POFA 2YYZA 1Q82C 1DCZA 1JE4A 1EOVA 1Q90A 2OXPA 4AYBE 4QGUA 3IAYA 1A6XA 5DNFA 3HRZC 3BJUA 4C56C 2HDMA 1GOZA 1SNOA 1H9SA 5GAEC 3LNNA 1B3QA 3G4SA 4CDDC 2PQEA 5FO9B 1FJGL 2O2LD 3NUCA 3MXNA 4NXMQ 1VQNA 3EVQA 2NVXH 3GTPB 2F03A 2CQOA 3FKIG 3P75A 1PMRA 1PRTC 4POGA 3TDQA 2NTSA 1AN8A 1EZ8A 3HS0C 3U9SA 4LFBL 5C4JH 3M3YH 1IYVA 1LTTD 4ID6A 1QWYA 1IKLA 1Y1VG 1N32L 3A8KE 3PCOB 3I4OA 4OX9L 2DY8A 3Q6SA 5LMNL 2WB1B 4JI6Q 2BDOA 1UEAB 2R92G 4QQBX 2FFKB 2JA9A 1IBML 2UU9L 1C4QA 1UE5A 2DNCA 1P16A 1K73C 1HFNA 2NVYH 3F8TA 2FJ2A 4HJAA 4L5SA 1TS4A 3NPPA 4CGYB 5JVH3 3D4WA 4DR7Q 4ZKBB 1PFMA 4A3FG 2F0PA 3UDIA 4YY3L 4HIKA 5DAUA 4BY1B 2B63B 4B3SL 2KCMA 4OO1G 1JB7A 3HGBA 4A3EB 3NBIA 2UUBQ 4JI0L 3ND8A 2OT2A 2RSOA 2A68C 3X3MA 3J81j 4LAAA 4DR4Q 2SNMA 2IPKD 3J7ZC 2CW0C 3J7AV 4FF2A 1I4GA 1E7ZA 1GHKA 3OPOA 3CC4A 1AW7A 5IYDG 3KF6A 1N36Q 2H5XA 1TT2A 3NE5B 3T1YL 3G71A 4RWSC 1RKNA 3MFGA 1BDOA 2B2TC 2BOSA 2G5DA 3KJPA 1PTOB 2Z4HA 2EZVA 4ZQ3A 5JJZA 5CYUA 3UDFA 1J6QA 5C0XJ 5KRUA 2KUMA 2DJGC 5EKKA 4QF4A 3BDLA 2LFNA 1JQYD 3U4VA 4B08A 1PRTB 2KEEA 1F9PA 5E1FA 1FGBD 2F0KA 4A4IA 2L55A 4HAEA 2F0NA 4FYDA 1BCPC 2RCFA 1NUCA 3CQZB 3KK7A 2VXWA 2NUCA 2WAQB 5CORA 5FLXE 1J5EQ 5C4XH 2TSSA 4ABNA 5C3XA 5EGTA 4BA1I 4BBRB 2JA7H 3B6YA 5M3FH 5G3LD 4JBKA 1Y14B 3C1EA 5NUCA 3I4MG 2CVRA 1CKNA 1SYEA 5TSSA 4IZ8A 5CV5A 1CQFA 4AYBB 4DV6Q 1EY0A 4DR1L 1PHJA 2O5IC 1Z9FA 3P20A 3STBD 1FR3A 1I4RA 4DNTB 3A5UA 4LF9L 5C0XH 3EIVA 4ZK9B 2XTIA 3H0GB 4R4CA 1D5MC 1D5ZC 5E4XA 4V190 2AHOB 3K5LA 3Q0AA 2N55A 3G6JB 4I65A 3S1QB 1F2MA 4B9XA 1M90C 2ID0A 3ERQA 4DUZL 5A35A 4YWLA 2F0LA 3N52A 4P71A 1X6OA 1HQMC 1VS0A 4O42A 4A3DB 2MP1A 1HRJA 4LUZA 4NW2A 4RGMA 5M3MB 3CCVA 5HURA 4PQXA 4BY7H 2K5VA 2YU9B 2RDHA 4KKTA 2L1BA 3OTOQ 4A3IG 1EIHA 5FLMH 2WINB 1SNCA 5IYCG 1F2ZA 4X64L 1HJPA 2QA4A 1RCVD 4IFDJ 2NTTA 2ALYB 2L9HA 1RHPA 4LUOA 4MIUA 3NEMA 1W6JA 1WTRA 2IY5B 1SROA 2XWJB 5LL6X 5C3EB 1D6EC 2OQ0A 4KI0A 3VYRA 2SDFA 3H91A 1I4PA 4UAIA 1GJXA 4GNXA 1EQVA 4DN4M 2JA6B 2D0OA 4JI7Q 4A76A 1GUOA 1GM5A 3K59A 1PRTD 2AUJD 5IP9G 5IGCA 1HR0L 1FNUA 4X6AH 1ONLA 3P1HA 3CRKC 4JI4Q 3TQYA 1CI3M 3K0XA 4CDEC 3L9AX 4JI3Q 1W2BA 3JAMi 3CF5A 2G9HD 1SEBD 3H0GG 1WTPA 1HNZQ 3VYUA 1VQCA 2LSSA 1O7YA 2DNEA 1VQHA 2WKDA 3DM1A 4OELB 4CKEA 3M3YB 5BN5A 2OWOA 2NVTH 2P5ZX 5CBAE 1SE8A 1VQLA 1KNAA 4LFCQ 4IFDH 1B2TA 1YNXA 3GV3A 2B8GA 4H13C 3OW7A 1YI2A 2FXQA 2HT1A 2ATWA 1CZGA 3TN2A 3D31A 3VA5A 1CFMA 1EEID 4UY8C 1CKMA 1Y8OB 2L12A 2CW0D 2M9VA 4DV2L 1PA6A 2JYOA 2NWGA 1S5FD 1IBKQ 2B2YA 2LY7A 1RODA 1STEA 1STAA 3KLSX 2JA6G 1CSPA 3RMHA 1IW7C 2VZAA 2QCPX 2JA5H 3H09A 2LXKA 1HFGA 4RH6A 1R9TH 4KLKA 5BN4A 4JG2A 1D2BA 2F0EA 3MXGA 3CW2C 1U4PA 4X65L 5IODA 4QUCA 1K8AC 3PO2H 1SLJA 4JYAQ 1LABA 2NYZD 1NY4A 1GHJA 3NP8A 4QCLA 5IYBG 2KA7A 1BOSA 1BCPD 3KFUA 4P2CB 1M1KC 2RF4A 3F1ZA 4TQUS 2FMCA 4A3GB 5ELDA 4OIJA 2KHJA 5FJ8H 2F0GA 4IPCA 1O78A 1WCMB 3OYYA 2DGYA 4BWGB 4A3MB 1DOMA 2B3GA 1PH3A 1DZ1A 4PV1C 1YBYA 2F4IA 5FLXc 3PIPA 1MJCA 1STGA 4AIMA 4KD3A 5ELBA 3PGZA 4B3RQ 1VF7A 3VYTA 2VW9A 4JI1Q 3E0JA 3S24A 5KNDA 1EFID 1B44D 3Q24A 3S1MB 1L1OB 4DKAC 1PVOA 3PSIA 3GO5A 2NVQH 1ZYRC 3S1RB 4LF6L 4JV5L 1IKMA 2A19A 1RF2D 2PO4A 5D65A 5ELEA 4HJ8A 2Q8IB 4DR5Q 3G6EA 2VUMG 1QCBD 3J80i 5I4DA 1Y1VH 2R61A 1IYJB 2DJFC 3FDTA 4F88A 2BH8A 2A73B 2O4XA 4Q0FA 2KENA 2MJ8A 3NBHA 3K5MA 4H02A 2NZOA 1A2TA 4K2KA 1L0YB 2K5NA 2JEAI 1KAWA 3V2TA 1L2FA 4GNXC 2HQLA 4IUNA 4DAPA 5LMUL 4A3BH 1GO3E 2JA8H 2G9DA 3HOYB 1Q8KA 2NZHA 4IALA 1PH5A 1O7ZA 3I72A 3FVQA 2B8FA 1WTQA 1V9PA 1NTGA 4C3JB 3GTQH 4OO1H 2YV5A 1OXTA 3EFXD 3ERSX 1UE1A 4A3MG 4JI6L 3PV0A 4IUQA 3DXJC 4LF7L 2NZ1D 2E5LL 2B2VA 4DR6Q 1UUPA 2R3ZA 4IQZA 3GTOH 3KLRA 3T13A 1JORA 1LTGD 1Z6HA 1S4ZA 1V1QA 5IYDH 1N34Q 3CCSA 4K8JA 4O0AA 1SE2A 4DR7L 4OWWB 4CJ2C 2HCCA 1JE5A 2KECA 3BYYB 1TWCH 1S3OA 4E6IA 3ULLA 2V4DA 2ASBA 1JJGA 1K83B 2UUBL 1PLFA 5M5XB 1IBLQ 2BH2A 4DR4L 1WI5A 2JN4A 4JI2Q 1E2ZA 5JEAG 2F52A 5I6YA 1G51A 2QF7A 1XPOA 1QG7A 1FYCA 4HSPA 4LWCA 1N36L 2KCCA 1V43A 2H1EA 4DV0Q 2B2YC 5BR8Q 3HOXB 3KJOA 5C4HA 4EGVA 3CCUA 2EJFC 2M00A 1T9HA 3QR8A 1S72A 3LX0A 3MAQA 4RCOA 2WFWA 1EQTA 2X6LA 2E2JH 1VMCA 3A5ZB 1KD1C 1VQ8A 3TS2A 4N8X1 3OOCA 1B3AA 5IGGA 3I4MH 1CA6A 2CCZA 1G6PA 1SFOH 1PDQA 4WFN3 4LF5Q 4DNIA 1MI2A 1IW7D 3SXHA 4DV4Q 1YJWA 4TVAB 1QE6A 2K52A 3VR6A 1NMGA 2K6AA 1PH7A 3PF4A 4XQJA 3IRBA 4M8AA 1J5EL 3T53B 3URYA 1F2YA 3G48A 1SMXA 5KIXA 2JA5B 4F8MA 3CU7A 1QVGA 1TKWB 2F0OA 3AYHB 4HMJA 1G6ZA 2QGQA 2LMCB 1MD2D 4DFAA 1K0RA 1C7YA 1EIGA 4UP8A 1SRUA 4DUYQ 4X3UA 3A56A 2E8GA 3TP6A 5A2QL 1GUNA 1EYDA 5ELNA 5GQOA 4J1MA 4A3KB 2L5TA 4DV6L 1PZKD 4JC0A 3M7NA 3S2HH 1FVIA 4GKKQ 4IPHA 5IYCH 3R8BA 2EXDA 3GTJB 1H9MA 4N9TA 3VR5A 3A7LA 4OEMB 3W1BA 5ISRA 5IGDA 4A3JB 5IWAQ 2B2WA 1IL2A 2MNAA 1Y1WG 3T51B 1MGSA 2PMZE 4FF1A 1CT1D 3M4YA 3PIO3 3CMAA 3GV6A 2A74C 1VQ5A 4KN4C 1ZYRD 3RZDB 2PI2A 3HOWB 2IX3A 3BZCA 4FXGC 5JOBA 3OMGA 3C1FA 3DM3A 3I7FA 2PW7A 3H3VC 3W5OA 3DEPA 1IYUA 2E76C 4U673 1J8IA 4LW1A 1HNWQ 4GOPA 3HOVB 1R4PB 4YCVA 1U5KA 2RCNA 3BU2A 1XNQQ 5AFWA 1VQFA 4B9WA 4L63B 4CDFC 1TQOA 1PH9A 5M5WH 4K2LA 1YHBA 2F0WA 5K36G 4PZ8A 4C1NK 4A75A 3W1GA 2D2CC 5GADC 3QJYA 1EYGA 3I91A 2N88A 5KEEA 4JI7L 4KY6A 5EBCA 1SDFA 2EJGC 1VQDA 2UXDL 3RR5A 2ZJRA 1U0LA 4DAYA 4C3IB 1AZPA 4R8IA 1Q46A 1I4XA 1SSOA 4K8IA 1FL0A 2B2VC 1C8CA 4JI4L 1SAPA 4HEDA 4IN3A 3I56A 1TWFB 4JI3L 1KDAA 4DK6C 4DV3L 1EWIA 2VL6A 1WD1A 1OO9B 1HR0W 4GZYC 1MSHA 2D9UA 3PUZA 1Q81C 1HNZL 1EWHA 1PTOC 2AWNA 4KD4A 3K5OA 1XWEA 1ZXTA 4F87A 1ILPA 4NXNL 3X3NA 5CV9A 3EBEA 3T16A 3TSSA 3HP3A 3PO3G 3UDXA 4RGOS 5HGTA 1KIXA 1XMQL 4K6LA 3PUWA 2Q8TA 2VQFQ 1QILA 1WTHA 2WACA 5AJ3Q 3HOUG 2PW5A 4CBVA 2Y0SB 3GTLH 3Q23A 3PUYA 5JJIA 4RKBA 2EY5A 1B7YB 4OHJA 4HJ7A 1YVCA 1K28A 1Z47A 3CC2A 4BBSG 3NTHA 2EYOA 3D4RA 2E2HB 3KLSA 5DM63 1NMFA 2EY1A 1IBKL 2B2UA 3NBHB 4G4KA 5IYBH 1MJEA 5C44B 1TWGH 2I5MX 2K4KA 3QOLA 3TEHB 3CCJA 1KDCA 1FNWA 2QEXA 2VNUD 3OSOA 1F9QA 3SE0A 1PH6A 1SJHD 5JJKA 5KGUA 2QDBA 1EOTA 3E5SA 3R2IA 3SVMA 1I50H 1L0XB 4PZ7A 5EPKA 2PI2E 5M5YB 4DV1L 3ER0A 1UWVA 1ESRA 1TY0A 4JYAL 3S1NH 1KLUD 4RHRA 4DV7Q 5E3FA 1TR5A 2QILA 1L1OA 1QVCA 1S5BD 2OF1A 1CUKA 2RHQB 3A55A 3UI2A 3TP7A 2F1MA 4OL7A 4QB4A 1SFOB 2PMZB 1QZHA 5J1ZA 3U50C 1WYDA 4KK7A 4KMUC 3S15B 4KHPQ 1VQIA 2EY2A 4GLVB 1BR9A 5CV4A 2UXBL 1KHIA 2Z4IA 2VUMH 1NSNS 2F0MA 3NTIA 4H7BA 2CWAA 3HZXA 1BKBA 1B9MA 2WB1G 3BVMA 4JI1L 2B2WC 1SYBA 1L0WA 2KVMA 4HJ9A 1BVSA 1KXLA 2XWBB 1AEXA 2X6GA 5JEAJ 3BVZA 2I5HA 4XXEA 3TP5A 3J80E 4FXDA 3H3VI 2Q2HA 2J7ZA 4MTKA 1PYBA 3OWEB 1HNXQ 5IT9E 2JP1A 5CV8A 4ZAIA 1TS2A 2EIFA 4BY1G 1X55A 2B63G 4K6DA 2EYHA 4KTAA 1KTKA 4L6TB 5D3IB 4A3EG 4GOPC 3F2UA 1O80A 4XT1B 3MTSA 3I4NB 5C6AA 3CHBD 1LO5D 3K6OA 4EVOA 2BA0A 3JAML 1TWAH 1D1KA 3KUPA 4CKBA 3I73A 2EPBA 1OXSC 1LLRD 3T4AC 1JCKB 4GKJQ 4Y7NH 2F4VL 3QWNA 2E2DC 4ODGA 2F0DA 1KABA 3RZOB 2EE1A 2YTYA 1PH8A 4C3HH 1H9RA 2N3SA 4Q5VA 1CHPD 5D14A 3M9BA 1XYIA 2XIWA 5CV7A 4A93B 4I7ZC 4IUTA 1PXUA 4DR6L 2AQ2B 5JEAH 4G7ZC 2ZM6L 4IJHA 3HOZH 2HUGA 4UPAA 3OIQA 2PYKA 4IUPA 4RGNA 3JC66 4EQOA 1XJVA 4LF4Q 3GTGB 1VF5C 1DD2A 1DXMA 1PZJD 1MKHA 1N34L 3MZ5A 4L5TA 3FPUB 3S9WA 3DMUA 1WJJA 3K7AH 3JAMc 2E2IH 2MUYA 4WRDA 1EYAA 3TRZA 1PTOD 4C2MH 3H15A 2WAQG 1IHZA 4JBWA 2F3WA 4A3CG 1DGSA 3V05A 4TKOB 1JOKA 1NNXA 3GTMH 3MEFA 1VQEA 4BBRG 3R2TA 3OW2A 1IBLL 3C2PA 3GD7A 4JI2L 4NB3A 2K14A 1XPUA 1K9MC 4AYBG 2FINB 1NE3A 1VQ7A 2NN6G 4PMWA 1PH4A 1EQQA 4K5VA 2NN6I 3C46A 2B2UC 2NVXB 5BR8L 1ILQA 2IWHA 4JCVE 3WWVA 1MBYA 4UP7A 1VDZA 1TXYA 4GOPB 2PZTA 4N9PA 1DOLA 2VQEL 5C4JB 2A6EC 3M85A 2R7ZH 1K3RA 1CKOA 3UDGA 4JI5Q 1X56A 1EFWA 3AEVA 3PF5A 3J7AF 1Q1BA 4A3DG 5C3WA 3R93A 1I6HH 4F7XA 5M3MG 3AFPA 4RG1A 2KEDA 4GN4B 4PNYA 4DV4L 4DAYB 3A74A 2K32A 3KBXA 1JJ2A 1KNEA 2HCIA 1L1OC 2SNSA 2NVYB 1SYGA 1ENFA 3FP9A 3QO2A 1G291 3S14H 1TWGB 4ME5A 1FJGQ 4LF8L 3S16H 1N8RC 3U58A 3ZYYX 5C3EG 1JOQA 2E74C 5E7NA 3SDZA 5KNBA 1F2LA 1N33Q 4BA2I 2YTXA 2PZWA 2HHHL 1CK1A 1PFBA 1N32Q 1GUTA 2RVLA 4O1NA 2K33A 4EQNA 3RLFA 3S1NB 3J80L 1GUSA 5FLXL 3M4OH 1RJTA 4NDXA 1B1ZA 1M4VA 4JOIA 3KDFB 3VYSA 4JPBW 2PZUA 4QIWB 3OWFA 5IWAL 4P72A 1PZID 1A15A 1XMOQ 4JI8L 3MEHA 1HTPA 1RTNA 4LFAQ 2WKCA 1Q1EA 3MC0B 3SK4A 4AQYQ 3RN2A 5T1IA 3RLNA 1BXTA 3VA7A 4GLXA 2RSNA 2EYJA 2H4OA 2R93H 1O7LA 4YHHL 3E9HA 4XTCS 1SYDA 2DUDA 3A8JE 4JK1C 4ZRZA 1Q86C 1HNWL 2IW3A 1X9NA 3J80c 3NELA 4PG3A 1YJ9A 4AH6A 4OONA 2EDGA 5C4XB 4U68A 5IT9c 1B9NA 2JA7B 1II3A 4XYOA 4K14A 3U4ZA 1VQOA 2MHVA 2QDLA 5M3FB 4ALPA 3LGJA 2QW7A 2R7DA 3PIP3 3PO3H 4YIJA 3S17H 4B3TL 1AE3A 3FKIH 1GVPA 1UNSA 3BVGA 1EQRA 4MTNA 3HOUH 2UXCQ 1I6VC 4J15A 4LUVA 3GTKH 5EAYA 3HG9A 1E2VA 1HHVA 3S2DH 1U4LA 2R92H 4BBSH 4TRDA 4L5RC 2L4NA 4GN5A 3D4DA 4NXML 2EJMA 1WTOA 2B29A 1YNNC 1IZ6A 2CH4A 3GDEA 2VQFL 1STHA 4BY7B 2GA4B 1T5EA 5EKIA 3QIAA 4DGZA 2Q2UA 1JICA 4A3GG 4HSVA 4A3FH 2Z1CA 3CAMA 1SNDA 4G7OC 1WCMG 4KV6A 3KF8A 2F0QA 4KJOA 3TS0A 4XIGS 2VB3X 1ET9A 2WIIB 4R4OA 2EYLA 1YZ6A 2HQEA 3EN2A 2F0TA 3QB3A 2BE5C 5I9OA 5FK9C 4HCEA 5LMNW 4DUZQ 2KHSA 1ASYA 4OIKA 5M9OA 4KKUA 1QOHA 1X3PA 2WP8J 3EROA 2JSOA 4R8NA 5G3LF 3GTPH 4PZ6A 1PFSA 2CH4W 1AZQA 4X62Q 2A6ED 2ENBA 1CA5A 1NCVA 3J81i 2L11A 5IP7G 4DK3C 1LT5D 3J7A5 3IFTA 1BBUA 1F77A 2FMMA 3MHBA 1QUQB 4H0LC 4DV7L 4KN7C 2AQ3B 5LHY1 1LTRD 1A0IA 4IUVA 2R7ZB 2ZTEA 5CV6A 5I9PA 1E1TA 2NVTB 1TS3A 4Y52H 3K0YA 1PYWD 1V8QA 4IUUA 2Z8LA 1X3QA 2Q2TA 1YITA 4G7HC 4ZLTF 4BY7G 1A3UA 4KHPL 2LS01 2KQ3A 3AU7A 3H94A 3HOYG 2OCEA 4IPDA 5FLMG 1BBXC 2IJ0A 5CMDA 1HR0Q 1CSQA 4JW0A 4DV5Q 1EYCA 4BY1H 4JOIC 4C3JG 2B63H 2HIVA 4S3SA 1D7QA 1X3EA 3OIPA 4R4IA 2Y0SE 1O7IA 3D6CA 3PUXA 4G57A 4GN3B 1NR2A 5C5LA 1VQ6A 4DK1A 2EXZA 4ILWA 1R4QB 2TMPA 5GROA 5IY0A 1G2SA 1S5ED 1V1PB 1B70B 4EX5A 1IXRA 3L7ZC 2I5LX 4RFBA 5J22A 2LKVA 3RUZA 3CCMA 2EYMA 2HDLA 3HKZB 4QUFA 1LTLA 4YWMA 1HNXL 1SJED 3SK5A 1R9TB 4X3TA 1PTOH 3U9OA 1FD7D 4DR2Q 2N78A 5EJWA 1FGUA 1NBWA 3CCEA 1EIFA 1LT4D 3TZUA 3PO2B 1EY8A 4A3IH 3L0OA 5F2DA 5EKLA 4DAMA 3K58A 2R7FA 4DR3Q 3K8AA 3NWTA 4DV2Q 4JBMA 3KYHC 2IX1A 2XGTA 3A0JA 1HZCA 1VQAA 2CFMA 3CKIB 4CJ1B 3HOXG 3A54A 3CQZH 3F2BA 3R3OA 3F2CA 3E9IA 4A3CH 4IFDI 1Q7YC 2C35B 1F9SA 4BBRH 1CQVA 1EZ6A 2PCFB 5IOCA 1A63A 3SK6A 3FEWX 2SOBA 1XPRA 1XNRQ 1IL8A 1JC7A 1GUWA 3NXWA 3OTOL 5IP9H 3O13A 1I5FA 3UE0A 4OXPA 1LACA 4P74A 2F0UA 1AFPA 1STYA 2E75C 1QNUA 2V1CC 4L5QA 3EA6A 5EBDA 4RGTA 5I2XA 2JK8A 3E3XA 1VQ9A 1SE3A 2JEBI 2UUAQ 2KCTA 2AMCB 3ND9A 1UAPA 2NVQB 3FKIB 3T1HQ 1F9RA 1M8AA 3I55A 2ICIA 3H0GH 1EY6A 1N9WA 2A69C 3CRLC 1HA6A 2JA5G 3S1QH 1MIUA 3TBIB 3GTKB 2DN8A 4N8FA 1Y1VB 2XRQD 1WTXA 1SN8A 1YNND 3RN5A 3K57A 2Z6BA 5FKAC 3S2DB 4A3DH 4HIMA 2R92B 4XT3B 2Q2IA 1SXTA 2D0PA 1HA5A 5M3MH 2YTVA 5ELFA 1LT3D 4A3KG 1LM0A 2N8NA 1HPCA 1MHWC 3BG3A 1ICWA 2AUKA 4A3BB 3AQQA 3SK8A 5I2YA 4NP5A 4LNQA 4DU9A 2JA8B 4A3JG 2BDNA 4NMZA 4QMGA 4A3FB 2BE5D 4B3MQ 1BCPF 1B8AA 2ZJQA 1YJNA 4LF6Q 1G8ZD 1TY2A 5C3EH 3GTQB 1W3SA 4R4QA 1WTVA 4QL5A 1B4OA 4LMQD 2O5JC 1CTMA 4LFCL 4GS3A 2A8VA 2JA6H 2F0VA 1H95A 1HXYD 1EEFD 1VQ4A 3HOWG 3GTOB 3KDFA 2A5HA 1V1OA 2K04A 5CGKA 2HD3A 1SYFA 2PQAA 1KC8C 3HOVG 4XQQA 4HN7A 1TWCB 2HIXA 1D5XC 1XTDA 3F2DA 5LMUQ 1AE2A 2K28A 3I90A 4UDUC 1EIYB 1VMPA 1FNVA 1N33L 5KYLA 1SYCA 2RQXA 1E0BA 4CHTB 3CC7A 2VB2X 4R4TA 4P75A 5C5MA 3KBGA 1I3QH 2VS1A 4C3IG 2Q8RE 1JWUD 3IKJA 4LF7Q 3FRPB 3NHHA 3IL8A 2E5LQ 1HH2P 2JQOA 4A3LG 2JXMB 4X66Q 2PNHA 5JPNC 3L3OC 2K1BA 1P8LA 1HCZA 1XMOL 3K81C 3KF8B 1G91A 4LFAL 4A3BG 3E0EA 4AQYL 2JA8G 1KRTA 2E2JB 5DM73 3J7YW 2A6HC 1TWHH 2K5QA 4RCNA 1T5XD 3I4MB 1HZAA 1JJCB 2ICEC 3PQIA 2F0HA 1RTOA 4OO1I 3C3LA 2I07B 2K5DA 1OTCA 4X3KA 2Y0SG 2Z6KA 3D0FA 4RKLA 1STNA 4ME3A 4B3RL 1BBWA 1SE4A 3TREA 1GD7A 2J0TD 2R6GA 5ELCA 3MWYW 4APVA 1JB3A 3AMUA 1B50A 1RDPD 5C44G 4CJ0B 1GKHA 3RLOA 3P7JA 1VQMA 3S2HB 5IGEA 1NAPA 3PMFA 4A3GH 2UXCL 4A3IB 4DR5L 1TVXA 2CKZB 3NTKA 2RA4A 1WCMH 5KYIA 4A3MH 2MO0A 5E4WC 1JWSD 5GAGC 4K0KQ 2XVSA 4FDBA 2IL8A 1ZKOA 3MXUA 1AP0A 4QIWE 1WOCA 4KJNA 3SHLA 2MFIA 3I2ZA 3UE1A 5KNCA 1QZGA 4BXXG 1WTWA 1DONA 3S1MH 1YHAA 4K5XA 2IHEA 2A69D 3S1RH 4J8QA 2XRSD 5JVG3 4KY7A 2RHSB 3A8IE 2CWPA 4GLAC 1PH1A 4OWXB 4HR7B 3GQBA 1QNKA 1QUQA 1Q8IA 5IP7H 1TU2B 1SBBB 1KL9A 3NSWA 2L0CA 1Q3LA 1QB5D 3NWSA 5M5WB 5EPJA 1PFNA 5C4ZA 4M1UB 4YWKA 1E3PA 4ZUJA 1X65A 1LTBD 1UE7A 4RA8A 5T1GA 5IIFA 3HKSA 3WDNA 1HTLD 4IOCA 4I7AA 4YCUA 4DK0A 3J81E 3BDOA 1DM0B 2UUCQ 5H1SE 3I8ZA 1A3TA 1WVLA 4X62L 3CD6A 4KHVA 1I94Q 3HOYH 1LYLA 2NBFA 1HUMA 2MQHA 4IURA 5JPMC 2NB0A 5J3BA 4C3JH 3DLLA 3VR3A 5JAVA 4KY5A 2QKIC 3W2DA 1WD0A 2KHIA 1V1PA 2Z0SA 3G7LA 4X3SA 3I4NG 1KAAA 3MFYA 2IT1A 1SMYC 4HCSA 2L15A 3EQLC 2ZT9C 3L2PA 4DV0L 3Q8DA 3CPFA 1UE6A 1HQRD 4LJZC 1LT6D 1I4QA 1VQBA 1K8MA 3FMCA 1BCPB 2UXDQ 3GTLB 1CHQD 3BZKA 4LK1C 1C48A 3H6MA 1A3VA 4DV5L 2OEOA 5LL6S 3PUVA 2GN5A 4LF5L 5DEHA 1K83H 2MGSA 4A93G 3D8GA 4FP5D 4CDCC 5M5XH 5CR3A 4DV3Q 1YNJC 2D5DA 2A1AA 1PYSB 1GXDC 1H9JA 4UP9A 3K80C 2JE6I 2RDGA 2ZTDA 4ZYSA 2BCOA 1CZWA 4NXNQ 1HZ9A 1BUVT 1I4HA 3VR4A 2F3IA 3LWEA 4IJLA 3EJIA 1KRSA 1SNPA 2B39A 1I3QB 2MO1A 3HOXH 1XMQQ 1E1OA 1Y1WH 2A6HD 1E2WA 1YIJA 1JWMD 4LFBQ 3AB9A 4DAVA 4DR2L 4DUYL 2Z6KC 3MVVA 2ZXOA 3N6RA 1I50B 4WJ4A 1X32A 2F0FA 1ET6A 4H44C 1QVFA 4OX9Q 3AFQA 2A68D 1DOKA 5LMNQ 3K7UC 3OHXC 4GKKL 3DHQA 3NK9A 4J6HA 1TWHB 1IBMQ 3FPPA 2UU9Q 1BO0A 2ZJPA 4ULLA 5IT9L 4DR3L 3K5NA 1A2UA 4IPGA 4QY7A 2BA1A 4IO9A 5K5PA 1H9SB 3WOFA 3QG1A 3DWAA 3HFZB 2PQAB 1U9RA 4DF7A 1X54A 3MXNB 1RIPA 1Y8PB 5K36H 1XXGA 2JJQA 1S5CD 4DXGA 1ESFA 1D1IA 4ZUIA 2VUMB 4YY3Q 2GVAA 4B3SQ 1XNRL 1W6KA 5COYA 3CCRA 4JI0Q 2KCNA 3TZDA 3NENA 3KOJA 4R1JA 3ULJA 3D6WA 4A3KH 3A7AB 4DV1Q 3BS1A 1OXUA 2VY3A 1KDBA 2UUAL 1AH9A 1XNQL 3MXPA 5DLQE 3T1HL 1A8VA 3CMEA 4MN3A
chains in the Genus database with same CATH topology
3GTJH 3GTLH 1VS0A 4GN3B 1C9OA 2N49A 1OXXK 3PUYA 5JJIA 1VQ6A 1B7YB 4HJ7A 4LUZA 3CCVA 5GROA 5IY0A 1YVCA 3T1YQ 4A3JH 4BY7H 1B70B 1Z47A 3CC2A 4EX5A 2K5VA 1IXRA 3L7ZC 2I5LX 4BBSG 3HKZE 3CCMA 3OTOQ 4A3IG 5FLMH 2UXBQ 5IYCG 1LTLA 2AWOA 1HJPA 4YCWA 4YWMA 4X64L 2QA4A 1HNXL 1NMFA 1ASZA 1IBKL 3NBHB 4IFDJ 2ALYB 1OXVA 3RZDH 5IYBH 4LUOA 3HOWH 1MJEA 1VQJA 1TWGH 1PH2A 4DR2Q 3NEMA 2I5MX 2K4KA 2N78A 3M4PA 2IY5B 1SROA 2OQ0A 4KI0A 3TEHB 1FGUA 3CCJA 1NBWA 3CP0A 2QEXA 3CCEA 2VNUD 1EIFA 1JMCA 4GNXA 1PH6A 4B3ML 3HOVH 4A3IH 3KF6B 5JJKA 2D0OA 4JI7Q 3L0OA 4A76A 4DAMA 1GM5A 2R7FA 1I50H 5IP9G 4DR3Q 3K8AA 4PZ7A 4DV2Q 2PI2E 2I0QA 3KYHC 1HR0L 4JBMA 4X6AH 3M4QA 4DV1L 2XGTA 3ER0A 1UWVA 1HZCA 1VQAA 3A0JA 2CFMA 2IX1A 2K50A 3TQYA 4JI4Q 2OQKA 5AJ3L 4DV7Q 3S1NH 3K0XA 3HOXG 4OWTB 3SGIA 3CQZH 1L1OA 1QVCA 3F2BA 4JI3Q 1CUKA 1X3FA 2RHQB 3E9IA 3F2CA 1W2BA 4A3CH 2OTLA 3JAMi 4IFDI 3CF5A 4C3IH 1Q7YC 1Q12A 2C35B 4BBRH 3H0GG 2ES2A 1UEBA 1HNZQ 1A63A 1QZHA 1VQCA 1WYDA 3U50C 3J81c 2LSSA 4DR1Q 4A3LH 1TWFH 1XPRA 1VQHA 1XNRQ 4KHPQ 3OTOL 5IP9H 4LF9Q 1I5FA 3UE0A 4OXPA 1VQIA 4GLVB 4P74A 2UXBL 2OWOA 2NVTH 1KHIA 2V1CC 2F4VQ 2IHFA 4L5QA 2VUMH 5C4XG 3CXCA 2JK8A 1SE8A 1VQLA 1VQ9A 4LFCQ 1WFQA 2JA7G 2JEBI 2UUAQ 2KCTA 2AMCB 1YNXA 2CWAA 5M3FG 1BKBA 2WB1G 4HJ5A 3T1HQ 4JI1L 3I55A 1YI2A 3H0GH 2FXQA 1L0WA 2HT1A 1N9WA 4HJ9A 2ATWA 1BVSA 1X3GA 1KXLA 3D31A 2OTJA 2JA5G 1CKNB 1MIUA 3S1QH 5JEAJ 1SR3A 4UY8C 1CKMA 1SN8A 2D62A 2I5HA 5HGQA 4X66L 2ZM6Q 3RN5A 1PV4A 3H3VI 4DV2L 4A3DH 2Q2HA 4HIMA 1PA6A 5C0XG 1PYBA 1E22A 2D0PA 2Q2IA 5M3MH 4X64Q 2YTVA 2AKWB 1RL2A 1HNXQ 1IBKQ 4A3KG 1LM0A 5C0XI 3CPWA 1KQSA 2EIFA 2N8NA 4BY1G 1X55A 2B63G 2JA6G 1CSPA 4A3EG 4GOPC 2E2HH 2VZAA 2JA5H 3AQQA 2LXKA 3FHWA 4LNQA 1K8GA 3H3VH 1LUZA 1R9TH 2BA0A 4KLKA 4A3JG 4B3MQ 4JG2A 5C44H 1TWAH 1B8AA 2LXJA 5ELOA 1YJNA 2ZJQA 3CW2C 4LF6Q 1OXSC 4HIOA 5C3EH 1W3SA 3HOZG 4IOAA 1C0AA 4GKJQ 4R4QA 4Y7NH 4QL5A 4X65L 2F4VL 4RMFA 3ICEA 1K8AC 3PO2H 3KLWA 4LFCL 1SLJA 4JYAQ 4GS3A 2A8VA 2JA6H 1H95A 1NY4A 2YTYA 4A3EH 1PH8A 4QJFA 1E24A 2K5HA 4C3HH 2N3SA 5IYBG 1VQ4A 3HOWG 3KDFA 3M9BA 3KFUA 1M1KC 2RF4A 3F1ZA 5M5YH 4TQUS 2PQAA 1KC8C 2KHJA 4DR6L 5FJ8H 2ZM6L 2VQEQ 4IJHA 3HOVG 3HOZH 4UPAA 4IPCA 4BXXH 3OYYA 2DGYA 3JC66 1XJVA 2HIXA 4LF4Q 2B3GA 1XTDA 2KBNA 3ZJYC 3F2DA 1PH3A 5LMUQ 1MKHA 1AE2A 1N34L 1YBYA 4DPGA 4GNXB 1VCIA 5FLXc 3PIPA 1MJCA 1EIYB 4AIMA 4L5TA 3VDYA 1N33L 5GAHC 3PGZA 1WJJA 3K7AH 3JAMc 3S15H 2E2IH 4B3RQ 2VW9A 3CC7A 3TRZA 4C2MH 4JI1Q 3H15A 2WAQG 2WB1E 4JBWA 4R4TA 4EQ5A 3S24A 4P75A 4A3CG 1DGSA 4K0KL 1I3QH 2VS1A 3GTMH 3MEFA 1VQEA 4BBRG 1L1OB 4LF7Q 4DKAC 1PVOA 3PSIA 2E5LQ 1HH2P 2JQOA 3GO5A 3OW2A 1IBLL 4LF8Q 2NVQH 4A3LG 3GD7A 4LF6L 4JV5L 4X66Q 4JI2L 2PNHA 2A19A 4NB3A 4GKJL 2R7ZG 3ULPA 1P8LA 2K14A 1YEZA 4HJ8A 1XMOL 1A62A 3K81C 3KF8B 1K9MC 4AYBG 1XPUA 1NE3A 1YHQA 4LFAL 4DR5Q 3G6EA 2VUMG 4A3BG 1D8LA 1EUJA 2GVBA 1HZBA 3E0EA 2NN6G 4AQYL 1VQ7A 4PMWA 2JA8G 3J80i 1Y1VH 1IYJB 1KRTA 1PH4A 1VQKA 1EQQA 4MZ9A 1TWHH 2HHHQ 4IFDG 2NN6I 2BH8A 5BR8L 4NPSA 1NJIC 1VQPA 4JCVE 2KENA 3WWVA 4UP7A 1HZAA 1TXYA 1JJCB 2K75A 3RNUA 4GOPB 4WJ3M 4OO1I 4H02A 2NZOA 2K5NA 2VQEL 2JEAI 1KAWA 3M85A 2R7ZH 5HY6A 1K3RA 1OTCA 4LF4L 1CKOA 1L2FA 3PIOA 4GNXC 2HQLA 1X56A 3UDGA 4JI5Q 1EFWA 3AEVA 2Y0SG 3PF5A 5LMUL 1VQGA 2Z6KA 4X65Q 4A3BH 3I4NH 1Q1BA 1GO3E 4JI8Q 2JA8H 4A3DG 3D0FA 1I6HH 1Q8KA 2NZHA 4ME3A 5M3MG 1PH5A 3AFPA 4B3RL 4RG1A 1BBWA 4HIDA 1V9PA 1NTGA 4GN4B 5IE8A 4DV4L 4DAYB 2UUCL 3GTQH 3A74A 1JJ2A 2YV5A 1L1OC 1OXTA 3ERSX 1UE1A 3HKZG 4KHZA 4MNOA 3TREA 3PV0A 3CCQA 4A3MG 1GD7A 3FP9A 1I94L 4JI6L 1G291 3S14H 4LF7L 1FJGQ 4YHHQ 2E5LL 2R6GA 4LF8L 3RZOH 4DR6Q 2EQSA 4O2DA 3S16H 4APVA 1S40A 3GTOH 3STBC 1N8RC 5C44G 1GKHA 3RLOA 1VQMA 3U58A 5IYDH 1V1QA 5C3EG 3CCLA 1N34Q 4A93H 4A3GH 4JBJA 4P73A 2UXCL 4DR5L 3CCSA 5E7NA 2CKZB 2YU9H 3PO2G 1N33Q 4BA2I 4O0AA 5JJLA 4DR7L 2YTXA 2HHHL 4OWWB 1JT8A 1JE5A 1WCMH 1TWCH 3GTGH 4A3MH 2MO0A 1N32Q 1S3OA 3RLFA 2WAQE 3ULLA 5GAGC 3M4OH 4K0KQ 2ASBA 4FDBA 1JJGA 2UUBL 4JOIA 4QIWE 4B3TQ 1IBLQ 3KDFB 2R93G 1WOCA 2ZTCA 2BH2A 4DR4L 4JI5L 5FJ8G 4JV5Q 1WI5A 4JI2Q 2MFIA 5JEAG 3I2ZA 2F52A 2IX0A 3UE1A 5IWAL 1QZGA 4BXXG 1G51A 1XPOA 4P72A 1XMOQ 4POFA 4JI8L 2YYZA 1Q82C 3S1MH 4LFAQ 1YHAA 4JYAL 1EOVA 1Q1EA 4QGUA 4AYBE 4AQYQ 4LWCA 2IHEA 3RN2A 1N36L 3S1RH 3RLNA 1V43A 4DV0Q 4GLXA 2RHSB 3BJUA 5BR8Q 2CWPA 4GLAC 3KJOA 1PH1A 4OWXB 3CCUA 5GAEC 1QUQA 3G4SA 1T9HA 5IP7H 2R93H 1FJGL 4YHHL 3E9HA 4XTCS 1S72A 4NXMQ 1KL9A 2WFWA 2E2JH 2DUDA 3A5ZB 1KD1C 1VQ8A 2NVXH 1VQNA 3TS2A 2CQOA 3FKIG 1Q86C 4YWKA 1E3PA 2CCZA 4POGA 3I4MH 1HNWL 1G6PA 1X65A 1X9NA 1SFOH 3J80c 4LF5Q 3NELA 4PG3A 1YJ9A 1UE7A 4DNIA 4LFBL 4AH6A 3HKSA 4OONA 4IOCA 5C4JH 5IT9c 3M3YH 4YCUA 2UUCQ 1Y1VG 4DV4Q 4TVAB 5H1SE 1YJWA 1N32L 3PCOB 3I4OA 2K52A 4OX9L 3U4ZA 1VQOA 1NMGA 1PH7A 3PF4A 4ALPA 4X62L 3IRBA 3LGJA 2R7DA 5LMNL 4JI6Q 2R92G 3CD6A 1I94Q 3HOYH 3PO3H 4QQBX 1LYLA 2JA9A 1IBML 2MQHA 1J5EL 3S17H 2UU9L 4B3TL 1AE3A 1UE5A 3FKIH 1GVPA 1P16A 5J3BA 4C3JH 3G48A 1SMXA 1EQRA 4MTNA 3HOUH 1QVGA 3AYHB 3DLLA 1K73C 2QGQA 2NVYH 3F8TA 4HJAA 2KHIA 2Z0SA 4L5SA 2UXCQ 4J15A 4LUVA 1K0RA 1C7YA 3I4NG 3GTKH 2IT1A 1SRUA 4UP8A 2L15A 5EAYA 4DUYQ 2E8GA 4DR7Q 3L2PA 4DV0L 4A3FG 5ELNA 3Q8DA 3UDIA 4YY3L 5GQOA 4HIKA 3CPFA 3S2DH 4DV6L 1UE6A 4JC0A 2R92H 4BBSH 3M7NA 3S2HH 1FVIA 4B3SL 2KCMA 4OO1G 1JB7A 4L5RC 4GKKQ 1VQBA 4GN5A 2UUBQ 4IPHA 5IYCH 4JI0L 4NXML 2UXDQ 2EXDA 3J81j 3W1BA 3BZKA 2B29A 4DR4Q 1IZ6A 4DV5L 3GDEA 3J7ZC 2VQFL 5IWAQ 3PUVA 1E7ZA 2GN5A 4LF5L 3CC4A 5IYDG 1IL2A 1K83H 2MNAA 1Y1WG 2Q2UA 4A93G 3KF6A 4A3GG 4A3FH 5M5XH 4DV3Q 1N36Q 2H5XA 3CAMA 2PMZE 2A1AA 1PYSB 3T1YL 3G71A 4UP9A 3K80C 1WCMG 2JE6I 3CMAA 1VQ5A 2ZTDA 3KJPA 2PI2A 3TS0A 4XIGS 4R4OA 4NXNQ 1HZ9A 3BZCA 3UDFA 1J6QA 2F3IA 4IJLA 1YZ6A 3DM3A 3EN2A 5C0XJ 1KRSA 3I7FA 3W5OA 2MO1A 3HOXH 1XMQQ 1E1OA 5LMNW 4LW1A 1HNWQ 1Y1WH 4GOPA 4DUZQ 1ASYA 4YCVA 1U5KA 2RCNA 3BU2A 3U4VA 1YIJA 1XNQQ 4LFBQ 4DR2L 1VQFA 2WP8J 4DUYL 2Z6KC 1PH9A 4A4IA 5M5WH 1YHBA 5K36G 4PZ8A 3GTPH 4WJ4A 4PZ6A 4A75A 1PFSA 1QVFA 3W1GA 4OX9Q 3AFQA 5GADC 1EYGA 4X62Q 3K7UC 5LMNQ 4JI7L 4GKKL 1IBMQ 1VQDA 3J81i 1J5EQ 2UXDL 5C4XH 3RR5A 2UU9Q 2ZJPA 5IP7G 4DK3C 2ZJRA 4DR3L 1U0LA 4IPGA 4QY7A 2BA1A 4BA1I 1Q46A 4IO9A 2JA7H 3J7A5 1BBUA 3B6YA 1FL0A 4JI4L 1QUQB 5M3FH 4DV7L 4JBKA 1Y14B 3HFZB 2PQAB 3I4MG 3I56A 1CKNA 1X54A 3MXNB 4JI3L 1A0IA 1RIPA 4DK6C 2ZTEA 1EWIA 2VL6A 2JJQA 4DV3L 1E1TA 1HR0W 4Y52H 3PUZA 1Q81C 4YY3Q 1HNZL 2AWNA 4DV6Q 2GVAA 4DR1L 2Q2TA 4B3SQ 1PHJA 1YITA 1XNRL 4BY7G 1Z9FA 4NXNL 3STBD 4KHPL 3A5UA 3EBEA 4LF9L 3CCRA 4JI0Q 3HOYG 3PO3G 2OCEA 3NENA 3EIVA 3UDXA 4IPDA 2XTIA 3KOJA 4R4CA 4R1JA 3ULJA 5FLMG 1KIXA 4A3KH 1HR0Q 2AHOB 1CSQA 1XMQL 4DV5Q 3PUWA 4DV1Q 4BY1H 1OXUA 4JOIC 2VQFQ 2B63H 2VY3A 2HIVA 2UUAL 1M90C 1D7QA 1X3EA 2ID0A 5AJ3Q 4R4IA 2Y0SE 4DUZL 1O7IA 3PUXA 1XNQL 5DLQE 3HOUG 1AH9A 4YWLA 3T1HL 1A8VA 4P71A 3CMEA 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ H;  3GTL H;  1VS0 A;  4GN3 B;  1C9O A;  2N49 A;  1OXX K;  3PUY A;  5JJI A;  1VQ6 A;  1B7Y B;  4HJ7 A;  4LUZ A;  3CCV A;  5GRO A;  5IY0 A;  1YVC A;  3T1Y Q;  4A3J H;  4BY7 H;  1B70 B;  1Z47 A;  3CC2 A;  4EX5 A;  2K5V A;  1IXR A;  3L7Z C;  2I5L X;  4BBS G;  3HKZ E;  3CCM A;  3OTO Q;  4A3I G;  5FLM H;  2UXB Q;  5IYC G;  1LTL A;  2AWO A;  1HJP A;  4YCW A;  4YWM A;  4X64 L;  2QA4 A;  1HNX L;  1NMF A;  1ASZ A;  1IBK L;  3NBH B;  4IFD J;  2ALY B;  1OXV A;  3RZD H;  5IYB H;  4LUO A;  3HOW H;  1MJE A;  1VQJ A;  1TWG H;  1PH2 A;  4DR2 Q;  3NEM A;  2I5M X;  2K4K A;  2N78 A;  3M4P A;  2IY5 B;  1SRO A;  2OQ0 A;  4KI0 A;  3TEH B;  1FGU A;  3CCJ A;  1NBW A;  3CP0 A;  2QEX A;  3CCE A;  2VNU D;  1EIF A;  1JMC A;  4GNX A;  1PH6 A;  4B3M L;  3HOV H;  4A3I H;  3KF6 B;  5JJK A;  2D0O A;  4JI7 Q;  3L0O A;  4A76 A;  4DAM A;  1GM5 A;  2R7F A;  1I50 H;  5IP9 G;  4DR3 Q;  3K8A A;  4PZ7 A;  4DV2 Q;  2PI2 E;  2I0Q A;  3KYH C;  1HR0 L;  4JBM A;  4X6A H;  3M4Q A;  4DV1 L;  2XGT A;  3ER0 A;  1UWV A;  1HZC A;  1VQA A;  3A0J A;  2CFM A;  2IX1 A;  2K50 A;  3TQY A;  4JI4 Q;  2OQK A;  5AJ3 L;  4DV7 Q;  3S1N H;  3K0X A;  3HOX G;  4OWT B;  3SGI A;  3CQZ H;  1L1O A;  1QVC A;  3F2B A;  4JI3 Q;  1CUK A;  1X3F A;  2RHQ B;  3E9I A;  3F2C A;  1W2B A;  4A3C H;  2OTL A;  3JAM i;  4IFD I;  3CF5 A;  4C3I H;  1Q7Y C;  1Q12 A;  2C35 B;  4BBR H;  3H0G G;  2ES2 A;  1UEB A;  1HNZ Q;  1A63 A;  1QZH A;  1VQC A;  1WYD A;  3U50 C;  3J81 c;  2LSS A;  4DR1 Q;  4A3L H;  1TWF H;  1XPR A;  1VQH A;  1XNR Q;  4KHP Q;  3OTO L;  5IP9 H;  4LF9 Q;  1I5F A;  3UE0 A;  4OXP A;  1VQI A;  4GLV B;  4P74 A;  2UXB L;  2OWO A;  2NVT H;  1KHI A;  2V1C C;  2F4V Q;  2IHF A;  4L5Q A;  2VUM H;  5C4X G;  3CXC A;  2JK8 A;  1SE8 A;  1VQL A;  1VQ9 A;  4LFC Q;  1WFQ A;  2JA7 G;  2JEB I;  2UUA Q;  2KCT A;  2AMC B;  1YNX A;  2CWA A;  5M3F G;  1BKB A;  2WB1 G;  4HJ5 A;  3T1H Q;  4JI1 L;  3I55 A;  1YI2 A;  3H0G H;  2FXQ A;  1L0W A;  2HT1 A;  1N9W A;  4HJ9 A;  2ATW A;  1BVS A;  1X3G A;  1KXL A;  3D31 A;  2OTJ A;  2JA5 G;  1CKN B;  1MIU A;  3S1Q H;  5JEA J;  1SR3 A;  4UY8 C;  1CKM A;  1SN8 A;  2D62 A;  2I5H A;  5HGQ A;  4X66 L;  2ZM6 Q;  3RN5 A;  1PV4 A;  3H3V I;  4DV2 L;  4A3D H;  2Q2H A;  4HIM A;  1PA6 A;  5C0X G;  1PYB A;  1E22 A;  2D0P A;  2Q2I A;  5M3M H;  4X64 Q;  2YTV A;  2AKW B;  1RL2 A;  1HNX Q;  1IBK Q;  4A3K G;  1LM0 A;  5C0X I;  3CPW A;  1KQS A;  2EIF A;  2N8N A;  4BY1 G;  1X55 A;  2B63 G;  2JA6 G;  1CSP A;  4A3E G;  4GOP C;  2E2H H;  2VZA A;  2JA5 H;  3AQQ A;  2LXK A;  3FHW A;  4LNQ A;  1K8G A;  3H3V H;  1LUZ A;  1R9T H;  2BA0 A;  4KLK A;  4A3J G;  4B3M Q;  4JG2 A;  5C44 H;  1TWA H;  1B8A A;  2LXJ A;  5ELO A;  1YJN A;  2ZJQ A;  3CW2 C;  4LF6 Q;  1OXS C;  4HIO A;  5C3E H;  1W3S A;  3HOZ G;  4IOA A;  1C0A A;  4GKJ Q;  4R4Q A;  4Y7N H;  4QL5 A;  4X65 L;  2F4V L;  4RMF A;  3ICE A;  1K8A C;  3PO2 H;  3KLW A;  4LFC L;  1SLJ A;  4JYA Q;  4GS3 A;  2A8V A;  2JA6 H;  1H95 A;  1NY4 A;  2YTY A;  4A3E H;  1PH8 A;  4QJF A;  1E24 A;  2K5H A;  4C3H H;  2N3S A;  5IYB G;  1VQ4 A;  3HOW G;  3KDF A;  3M9B A;  3KFU A;  1M1K C;  2RF4 A;  3F1Z A;  5M5Y H;  4TQU S;  2PQA A;  1KC8 C;  2KHJ A;  4DR6 L;  5FJ8 H;  2ZM6 L;  2VQE Q;  4IJH A;  3HOV G;  3HOZ H;  4UPA A;  4IPC A;  4BXX H;  3OYY A;  2DGY A;  3JC6 6;  1XJV A;  2HIX A;  4LF4 Q;  2B3G A;  1XTD A;  2KBN A;  3ZJY C;  3F2D A;  1PH3 A;  5LMU Q;  1MKH A;  1AE2 A;  1N34 L;  1YBY A;  4DPG A;  4GNX B;  1VCI A;  5FLX c;  3PIP A;  1MJC A;  1EIY B;  4AIM A;  4L5T A;  3VDY A;  1N33 L;  5GAH C;  3PGZ A;  1WJJ A;  3K7A H;  3JAM c;  3S15 H;  2E2I H;  4B3R Q;  2VW9 A;  3CC7 A;  3TRZ A;  4C2M H;  4JI1 Q;  3H15 A;  2WAQ G;  2WB1 E;  4JBW A;  4R4T A;  4EQ5 A;  3S24 A;  4P75 A;  4A3C G;  1DGS A;  4K0K L;  1I3Q H;  2VS1 A;  3GTM H;  3MEF A;  1VQE A;  4BBR G;  1L1O B;  4LF7 Q;  4DKA C;  1PVO A;  3PSI A;  2E5L Q;  1HH2 P;  2JQO A;  3GO5 A;  3OW2 A;  1IBL L;  4LF8 Q;  2NVQ H;  4A3L G;  3GD7 A;  4LF6 L;  4JV5 L;  4X66 Q;  4JI2 L;  2PNH A;  2A19 A;  4NB3 A;  4GKJ L;  2R7Z G;  3ULP A;  1P8L A;  2K14 A;  1YEZ A;  4HJ8 A;  1XMO L;  1A62 A;  3K81 C;  3KF8 B;  1K9M C;  4AYB G;  1XPU A;  1NE3 A;  1YHQ A;  4LFA L;  4DR5 Q;  3G6E A;  2VUM G;  4A3B G;  1D8L A;  1EUJ A;  2GVB A;  1HZB A;  3E0E A;  2NN6 G;  4AQY L;  1VQ7 A;  4PMW A;  2JA8 G;  3J80 i;  1Y1V H;  1IYJ B;  1KRT A;  1PH4 A;  1VQK A;  1EQQ A;  4MZ9 A;  1TWH H;  2HHH Q;  4IFD G;  2NN6 I;  2BH8 A;  5BR8 L;  4NPS A;  1NJI C;  1VQP A;  4JCV E;  2KEN A;  3WWV A;  4UP7 A;  1HZA A;  1TXY A;  1JJC B;  2K75 A;  3RNU A;  4GOP B;  4WJ3 M;  4OO1 I;  4H02 A;  2NZO A;  2K5N A;  2VQE L;  2JEA I;  1KAW A;  3M85 A;  2R7Z H;  5HY6 A;  1K3R A;  1OTC A;  4LF4 L;  1CKO A;  1L2F A;  3PIO A;  4GNX C;  2HQL A;  1X56 A;  3UDG A;  4JI5 Q;  1EFW A;  3AEV A;  2Y0S G;  3PF5 A;  5LMU L;  1VQG A;  2Z6K A;  4X65 Q;  4A3B H;  3I4N H;  1Q1B A;  1GO3 E;  4JI8 Q;  2JA8 H;  4A3D G;  3D0F A;  1I6H H;  1Q8K A;  2NZH A;  4ME3 A;  5M3M G;  1PH5 A;  3AFP A;  4B3R L;  4RG1 A;  1BBW A;  4HID A;  1V9P A;  1NTG A;  4GN4 B;  5IE8 A;  4DV4 L;  4DAY B;  2UUC L;  3GTQ H;  3A74 A;  1JJ2 A;  2YV5 A;  1L1O C;  1OXT A;  3ERS X;  1UE1 A;  3HKZ G;  4KHZ A;  4MNO A;  3TRE A;  3PV0 A;  3CCQ A;  4A3M G;  1GD7 A;  3FP9 A;  1I94 L;  4JI6 L;  1G29 1;  3S14 H;  4LF7 L;  1FJG Q;  4YHH Q;  2E5L L;  2R6G A;  4LF8 L;  3RZO H;  4DR6 Q;  2EQS A;  4O2D A;  3S16 H;  4APV A;  1S40 A;  3GTO H;  3STB C;  1N8R C;  5C44 G;  1GKH A;  3RLO A;  1VQM A;  3U58 A;  5IYD H;  1V1Q A;  5C3E G;  3CCL A;  1N34 Q;  4A93 H;  4A3G H;  4JBJ A;  4P73 A;  2UXC L;  4DR5 L;  3CCS A;  5E7N A;  2CKZ B;  2YU9 H;  3PO2 G;  1N33 Q;  4BA2 I;  4O0A A;  5JJL A;  4DR7 L;  2YTX A;  2HHH L;  4OWW B;  1JT8 A;  1JE5 A;  1WCM H;  1TWC H;  3GTG H;  4A3M H;  2MO0 A;  1N32 Q;  1S3O A;  3RLF A;  2WAQ E;  3ULL A;  5GAG C;  3M4O H;  4K0K Q;  2ASB A;  4FDB A;  1JJG A;  2UUB L;  4JOI A;  4QIW E;  4B3T Q;  1IBL Q;  3KDF B;  2R93 G;  1WOC A;  2ZTC A;  2BH2 A;  4DR4 L;  4JI5 L;  5FJ8 G;  4JV5 Q;  1WI5 A;  4JI2 Q;  2MFI A;  5JEA G;  3I2Z A;  2F52 A;  2IX0 A;  3UE1 A;  5IWA L;  1QZG A;  4BXX G;  1G51 A;  1XPO A;  4P72 A;  1XMO Q;  4POF A;  4JI8 L;  2YYZ A;  1Q82 C;  3S1M H;  4LFA Q;  1YHA A;  4JYA L;  1EOV A;  1Q1E A;  4QGU A;  4AYB E;  4AQY Q;  4LWC A;  2IHE A;  3RN2 A;  1N36 L;  3S1R H;  3RLN A;  1V43 A;  4DV0 Q;  4GLX A;  2RHS B;  3BJU A;  5BR8 Q;  2CWP A;  4GLA C;  3KJO A;  1PH1 A;  4OWX B;  3CCU A;  5GAE C;  1QUQ A;  3G4S A;  1T9H A;  5IP7 H;  2R93 H;  1FJG L;  4YHH L;  3E9H A;  4XTC S;  1S72 A;  4NXM Q;  1KL9 A;  2WFW A;  2E2J H;  2DUD A;  3A5Z B;  1KD1 C;  1VQ8 A;  2NVX H;  1VQN A;  3TS2 A;  2CQO A;  3FKI G;  1Q86 C;  4YWK A;  1E3P A;  2CCZ A;  4POG A;  3I4M H;  1HNW L;  1G6P A;  1X65 A;  1X9N A;  1SFO H;  3J80 c;  4LF5 Q;  3NEL A;  4PG3 A;  1YJ9 A;  1UE7 A;  4DNI A;  4LFB L;  4AH6 A;  3HKS A;  4OON A;  4IOC A;  5C4J H;  5IT9 c;  3M3Y H;  4YCU A;  2UUC Q;  1Y1V G;  4DV4 Q;  4TVA B;  5H1S E;  1YJW A;  1N32 L;  3PCO B;  3I4O A;  2K52 A;  4OX9 L;  3U4Z A;  1VQO A;  1NMG A;  1PH7 A;  3PF4 A;  4ALP A;  4X62 L;  3IRB A;  3LGJ A;  2R7D A;  5LMN L;  4JI6 Q;  2R92 G;  3CD6 A;  1I94 Q;  3HOY H;  3PO3 H;  4QQB X;  1LYL A;  2JA9 A;  1IBM L;  2MQH A;  1J5E L;  3S17 H;  2UU9 L;  4B3T L;  1AE3 A;  1UE5 A;  3FKI H;  1GVP A;  1P16 A;  5J3B A;  4C3J H;  3G48 A;  1SMX A;  1EQR A;  4MTN A;  3HOU H;  1QVG A;  3AYH B;  3DLL A;  1K73 C;  2QGQ A;  2NVY H;  3F8T A;  4HJA A;  2KHI A;  2Z0S A;  4L5S A;  2UXC Q;  4J15 A;  4LUV A;  1K0R A;  1C7Y A;  3I4N G;  3GTK H;  2IT1 A;  1SRU A;  4UP8 A;  2L15 A;  5EAY A;  4DUY Q;  2E8G A;  4DR7 Q;  3L2P A;  4DV0 L;  4A3F G;  5ELN A;  3Q8D A;  3UDI A;  4YY3 L;  5GQO A;  4HIK A;  3CPF A;  3S2D H;  4DV6 L;  1UE6 A;  4JC0 A;  2R92 H;  4BBS H;  3M7N A;  3S2H H;  1FVI A;  4B3S L;  2KCM A;  4OO1 G;  1JB7 A;  4L5R C;  4GKK Q;  1VQB A;  4GN5 A;  2UUB Q;  4IPH A;  5IYC H;  4JI0 L;  4NXM L;  2UXD Q;  2EXD A;  3J81 j;  3W1B A;  3BZK A;  2B29 A;  4DR4 Q;  1IZ6 A;  4DV5 L;  3GDE A;  3J7Z C;  2VQF L;  5IWA Q;  3PUV A;  1E7Z A;  2GN5 A;  4LF5 L;  3CC4 A;  5IYD G;  1IL2 A;  1K83 H;  2MNA A;  1Y1W G;  2Q2U A;  4A93 G;  3KF6 A;  4A3G G;  4A3F H;  5M5X H;  4DV3 Q;  1N36 Q;  2H5X A;  3CAM A;  2PMZ E;  2A1A A;  1PYS B;  3T1Y L;  3G71 A;  4UP9 A;  3K80 C;  1WCM G;  2JE6 I;  3CMA A;  1VQ5 A;  2ZTD A;  3KJP A;  2PI2 A;  3TS0 A;  4XIG S;  4R4O A;  4NXN Q;  1HZ9 A;  3BZC A;  3UDF A;  1J6Q A;  2F3I A;  4IJL A;  1YZ6 A;  3DM3 A;  3EN2 A;  5C0X J;  1KRS A;  3I7F A;  3W5O A;  2MO1 A;  3HOX H;  1XMQ Q;  1E1O A;  5LMN W;  4LW1 A;  1HNW Q;  1Y1W H;  4GOP A;  4DUZ Q;  1ASY A;  4YCV A;  1U5K A;  2RCN A;  3BU2 A;  3U4V A;  1YIJ A;  1XNQ Q;  4LFB Q;  4DR2 L;  1VQF A;  2WP8 J;  4DUY L;  2Z6K C;  1PH9 A;  4A4I A;  5M5W H;  1YHB A;  5K36 G;  4PZ8 A;  3GTP H;  4WJ4 A;  4PZ6 A;  4A75 A;  1PFS A;  1QVF A;  3W1G A;  4OX9 Q;  3AFQ A;  5GAD C;  1EYG A;  4X62 Q;  3K7U C;  5LMN Q;  4JI7 L;  4GKK L;  1IBM Q;  1VQD A;  3J81 i;  1J5E Q;  2UXD L;  5C4X H;  3RR5 A;  2UU9 Q;  2ZJP A;  5IP7 G;  4DK3 C;  2ZJR A;  4DR3 L;  1U0L A;  4IPG A;  4QY7 A;  2BA1 A;  4BA1 I;  1Q46 A;  4IO9 A;  2JA7 H;  3J7A 5;  1BBU A;  3B6Y A;  1FL0 A;  4JI4 L;  1QUQ B;  5M3F H;  4DV7 L;  4JBK A;  1Y14 B;  3HFZ B;  2PQA B;  3I4M G;  3I56 A;  1CKN A;  1X54 A;  3MXN B;  4JI3 L;  1A0I A;  1RIP A;  4DK6 C;  2ZTE A;  1EWI A;  2VL6 A;  2JJQ A;  4DV3 L;  1E1T A;  1HR0 W;  4Y52 H;  3PUZ A;  1Q81 C;  4YY3 Q;  1HNZ L;  2AWN A;  4DV6 Q;  2GVA A;  4DR1 L;  2Q2T A;  4B3S Q;  1PHJ A;  1YIT A;  1XNR L;  4BY7 G;  1Z9F A;  4NXN L;  3STB D;  4KHP L;  3A5U A;  3EBE A;  4LF9 L;  3CCR A;  4JI0 Q;  3HOY G;  3PO3 G;  2OCE A;  3NEN A;  3EIV A;  3UDX A;  4IPD A;  2XTI A;  3KOJ A;  4R4C A;  4R1J A;  3ULJ A;  5FLM G;  1KIX A;  4A3K H;  1HR0 Q;  2AHO B;  1CSQ A;  1XMQ L;  4DV5 Q;  3PUW A;  4DV1 Q;  4BY1 H;  1OXU A;  4JOI C;  2VQF Q;  2B63 H;  2VY3 A;  2HIV A;  2UUA L;  1M90 C;  1D7Q A;  1X3E A;  2ID0 A;  5AJ3 Q;  4R4I A;  2Y0S E;  4DUZ L;  1O7I A;  3PUX A;  1XNQ L;  5DLQ E;  3HOU G;  1AH9 A;  4YWL A;  3T1H L;  1A8V A;  4P71 A;  3CME A;  1X6O A; 
#chains in the Genus database with same CATH topology
 3GTJ H;  4RAU C;  1C9O A;  1DJR D;  1OXX K;  2N49 A;  1EU4 A;  3V96 A;  1NR4 A;  3T1Y Q;  2K5W A;  4A3J H;  5CBE E;  1Y69 U;  3ONA B;  5FO8 B;  3BZD B;  3HKZ E;  2EY6 A;  1K3B C;  2UXB Q;  4PMC A;  3Q22 A;  2AWO A;  4YCW A;  1ASZ A;  5BN3 A;  2C5C A;  3J81 L;  3SEB A;  1OXV A;  3RZD H;  3HOW H;  2K05 A;  1VQJ A;  1TWA B;  1EY4 A;  5IGB A;  1PH2 A;  3M4P A;  4NKL A;  4Y7N B;  1BQQ T;  3CP0 A;  1G2T A;  2RDF A;  1JMC A;  5A2Q E;  4EQP A;  1LTI D;  4B3M L;  3HOV H;  3KF6 B;  5IGF A;  2EVB A;  4C3H B;  1BNZ A;  2I0Q A;  2ZXR A;  3M4Q A;  1C0A A;  4V0B A;  2EYP A;  1STB A;  1TII D;  2K50 A;  2OQK A;  5AJ3 L;  1B53 A;  2RKS A;  4OWT B;  3SGI A;  4TSS A;  2F0S A;  3I70 A;  3HOZ B;  1X3F A;  1H9K A;  1U4M A;  2OTL A;  2KOL A;  4C3I H;  1Q12 A;  2SEB D;  2ES2 A;  1UEB A;  4DR1 Q;  4A3L H;  3J81 c;  1TWF H;  3K7A B;  2E2I B;  3MA2 B;  4LF9 Q;  4DA2 A;  4C2M B;  1EU3 A;  2F4V Q;  2IHF A;  5C4X G;  5CC4 A;  3CXC A;  3GTM B;  2JA7 G;  1SMY D;  1WFQ A;  4UHV A;  1LTA D;  4XQN A;  5M3F G;  2I46 A;  4HJ5 A;  4CKC A;  2K01 A;  3BYT B;  3LWU A;  1X3G A;  1BF4 A;  3D3R A;  4FXK C;  2OTJ A;  1Y8N B;  4KKS A;  1CKN B;  3DWP A;  5I6W A;  1QJO A;  1Z7T A;  2C9O A;  1SR3 A;  2D62 A;  3I4L A;  5HGQ A;  2ZM6 Q;  4X66 L;  1PV4 A;  4R9W A;  5C0X G;  4X64 Q;  1E22 A;  2AKW B;  1RL2 A;  2PPB C;  3M7G A;  1LTS D;  5FOB B;  5C0X I;  3CPW A;  1YNJ D;  1KQS A;  1K0S A;  4XYQ A;  3OMC A;  4C3H G;  2E2H H;  4WOR A;  4FO2 A;  1JR0 D;  3WOE A;  1I6H B;  3FHW A;  4MHE A;  1K8G A;  3H3V H;  1LUZ A;  1EWC A;  5C44 H;  1K8O A;  2EOT A;  3DUZ A;  1ICF B;  2LXJ A;  5ELO A;  4HIO A;  3HOZ G;  4IOA A;  2XSC A;  4RMF A;  3ICE A;  4K5W A;  1GUG A;  3KLW A;  2F3V A;  2F0I A;  1EY9 A;  3S14 B;  4RHS A;  1XTC D;  4A3E H;  3RD4 A;  4QJF A;  1E24 A;  2K5H A;  5L37 A;  3S16 B;  2K7V A;  3VR2 A;  5M5Y H;  1Y1W B;  3QOJ A;  1JOO A;  2ZXP A;  4FVM A;  1PTO F;  2PNR C;  1J9O A;  2VQE Q;  4BXX H;  4ZKC B;  3ZJY C;  2KBN A;  3NQT A;  4DPG A;  4GNX B;  1VCI A;  2X69 A;  3M4O B;  3VDY A;  4BS9 A;  5GAH C;  4OGQ C;  1PRT F;  3NQI A;  3S15 H;  1U4R A;  3TP8 A;  5EQ0 A;  4ZCK A;  2WB1 E;  4EQ5 A;  4HMI A;  3IFD A;  4K0K L;  4L8J A;  4LF8 Q;  4HTH A;  5D3D A;  2R7Z G;  1DYQ A;  2WV6 D;  4GKJ L;  3ULP A;  3I3C A;  1YEZ A;  1A62 A;  2K03 A;  2CHB D;  1YHQ A;  1SNQ A;  1D8L A;  1EUJ A;  2GVB A;  1HZB A;  1RD9 D;  3HEJ A;  2R93 B;  2FHT A;  1EL0 A;  2XN9 C;  4JVZ A;  2B2T A;  1VQK A;  4MZ9 A;  2HHH Q;  4IFD G;  4NPS A;  1NJI C;  1VQP A;  3SR1 A;  2M2L A;  1EY7 A;  2EYF A;  2K75 A;  3RNU A;  4WJ3 M;  1TS5 A;  5EPL A;  2AQ1 B;  2XNA C;  3T56 B;  5HY6 A;  1ZEQ X;  4LF4 L;  3PIO A;  2F0J A;  3GP7 A;  4PMB A;  1VQG A;  4X65 Q;  1LV9 A;  2MPM A;  3I4N H;  2CQA A;  2NN6 H;  3BDC A;  4JI8 Q;  1KLG D;  3PO3 B;  4FNF A;  3S17 B;  4FF3 A;  4HID A;  1S5D D;  1ENA A;  1XX8 A;  2Z9H A;  3ITP A;  5IE8 A;  2UUC L;  3HOU B;  4KHZ A;  4MNO A;  3HKZ G;  4DXF A;  3CCQ A;  1I94 L;  4YHH Q;  2KJX A;  1EY5 A;  2QEJ C;  3RZO H;  3W3A A;  2EQS A;  4O2D A;  2RBM A;  1S40 A;  3STB C;  1HUN A;  1MSG A;  4FF4 A;  4BBS B;  3CCL A;  4WJW A;  4A93 H;  4JBJ A;  4P73 A;  2YU9 H;  3TME A;  3PO2 G;  5JJL A;  1JT8 A;  1SNM A;  4XDX A;  5FO7 B;  1CM9 A;  3GTG H;  2DY7 A;  5J39 A;  3E6Z X;  1ML0 D;  2WAQ E;  4DNR B;  1ENC A;  3DEO A;  4C1N I;  4Z9C B;  2R93 G;  4B3T Q;  2ZTC A;  4JI5 L;  5FJ8 G;  4JV5 Q;  3DWQ A;  3JAM E;  2IX0 A;  2J4X A;  4POF A;  2YYZ A;  1Q82 C;  1DCZ A;  1JE4 A;  1EOV A;  1Q90 A;  2OXP A;  4AYB E;  4QGU A;  3IAY A;  1A6X A;  5DNF A;  3HRZ C;  3BJU A;  4C56 C;  2HDM A;  1GOZ A;  1SNO A;  1H9S A;  5GAE C;  3LNN A;  1B3Q A;  3G4S A;  4CDD C;  2PQE A;  5FO9 B;  1FJG L;  2O2L D;  3NUC A;  3MXN A;  4NXM Q;  1VQN A;  3EVQ A;  2NVX H;  3GTP B;  2F03 A;  2CQO A;  3FKI G;  3P75 A;  1PMR A;  1PRT C;  4POG A;  3TDQ A;  2NTS A;  1AN8 A;  1EZ8 A;  3HS0 C;  3U9S A;  4LFB L;  5C4J H;  3M3Y H;  1IYV A;  1LTT D;  4ID6 A;  1QWY A;  1IKL A;  1Y1V G;  1N32 L;  3A8K E;  3PCO B;  3I4O A;  4OX9 L;  2DY8 A;  3Q6S A;  5LMN L;  2WB1 B;  4JI6 Q;  2BDO A;  1UEA B;  2R92 G;  4QQB X;  2FFK B;  2JA9 A;  1IBM L;  2UU9 L;  1C4Q A;  1UE5 A;  2DNC A;  1P16 A;  1K73 C;  1HFN A;  2NVY H;  3F8T A;  2FJ2 A;  4HJA A;  4L5S A;  1TS4 A;  3NPP A;  4CGY B;  5JVH 3;  3D4W A;  4DR7 Q;  4ZKB B;  1PFM A;  4A3F G;  2F0P A;  3UDI A;  4YY3 L;  4HIK A;  5DAU A;  4BY1 B;  2B63 B;  4B3S L;  2KCM A;  4OO1 G;  1JB7 A;  3HGB A;  4A3E B;  3NBI A;  2UUB Q;  4JI0 L;  3ND8 A;  2OT2 A;  2RSO A;  2A68 C;  3X3M A;  3J81 j;  4LAA A;  4DR4 Q;  2SNM A;  2IPK D;  3J7Z C;  2CW0 C;  3J7A V;  4FF2 A;  1I4G A;  1E7Z A;  1GHK A;  3OPO A;  3CC4 A;  1AW7 A;  5IYD G;  3KF6 A;  1N36 Q;  2H5X A;  1TT2 A;  3NE5 B;  3T1Y L;  3G71 A;  4RWS C;  1RKN A;  3MFG A;  1BDO A;  2B2T C;  2BOS A;  2G5D A;  3KJP A;  1PTO B;  2Z4H A;  2EZV A;  4ZQ3 A;  5JJZ A;  5CYU A;  3UDF A;  1J6Q A;  5C0X J;  5KRU A;  2KUM A;  2DJG C;  5EKK A;  4QF4 A;  3BDL A;  2LFN A;  1JQY D;  3U4V A;  4B08 A;  1PRT B;  2KEE A;  1F9P A;  5E1F A;  1FGB D;  2F0K A;  4A4I A;  2L55 A;  4HAE A;  2F0N A;  4FYD A;  1BCP C;  2RCF A;  1NUC A;  3CQZ B;  3KK7 A;  2VXW A;  2NUC A;  2WAQ B;  5COR A;  5FLX E;  1J5E Q;  5C4X H;  2TSS A;  4ABN A;  5C3X A;  5EGT A;  4BA1 I;  4BBR B;  2JA7 H;  3B6Y A;  5M3F H;  5G3L D;  4JBK A;  1Y14 B;  3C1E A;  5NUC A;  3I4M G;  2CVR A;  1CKN A;  1SYE A;  5TSS A;  4IZ8 A;  5CV5 A;  1CQF A;  4AYB B;  4DV6 Q;  1EY0 A;  4DR1 L;  1PHJ A;  2O5I C;  1Z9F A;  3P20 A;  3STB D;  1FR3 A;  1I4R A;  4DNT B;  3A5U A;  4LF9 L;  5C0X H;  3EIV A;  4ZK9 B;  2XTI A;  3H0G B;  4R4C A;  1D5M C;  1D5Z C;  5E4X A;  4V19 0;  2AHO B;  3K5L A;  3Q0A A;  2N55 A;  3G6J B;  4I65 A;  3S1Q B;  1F2M A;  4B9X A;  1M90 C;  2ID0 A;  3ERQ A;  4DUZ L;  5A35 A;  4YWL A;  2F0L A;  3N52 A;  4P71 A;  1X6O A;  1HQM C;  1VS0 A;  4O42 A;  4A3D B;  2MP1 A;  1HRJ A;  4LUZ A;  4NW2 A;  4RGM A;  5M3M B;  3CCV A;  5HUR A;  4PQX A;  4BY7 H;  2K5V A;  2YU9 B;  2RDH A;  4KKT A;  2L1B A;  3OTO Q;  4A3I G;  1EIH A;  5FLM H;  2WIN B;  1SNC A;  5IYC G;  1F2Z A;  4X64 L;  1HJP A;  2QA4 A;  1RCV D;  4IFD J;  2NTT A;  2ALY B;  2L9H A;  1RHP A;  4LUO A;  4MIU A;  3NEM A;  1W6J A;  1WTR A;  2IY5 B;  1SRO A;  2XWJ B;  5LL6 X;  5C3E B;  1D6E C;  2OQ0 A;  4KI0 A;  3VYR A;  2SDF A;  3H91 A;  1I4P A;  4UAI A;  1GJX A;  4GNX A;  1EQV A;  4DN4 M;  2JA6 B;  2D0O A;  4JI7 Q;  4A76 A;  1GUO A;  1GM5 A;  3K59 A;  1PRT D;  2AUJ D;  5IP9 G;  5IGC A;  1HR0 L;  1FNU A;  4X6A H;  1ONL A;  3P1H A;  3CRK C;  4JI4 Q;  3TQY A;  1CI3 M;  3K0X A;  4CDE C;  3L9A X;  4JI3 Q;  1W2B A;  3JAM i;  3CF5 A;  2G9H D;  1SEB D;  3H0G G;  1WTP A;  1HNZ Q;  3VYU A;  1VQC A;  2LSS A;  1O7Y A;  2DNE A;  1VQH A;  2WKD A;  3DM1 A;  4OEL B;  4CKE A;  3M3Y B;  5BN5 A;  2OWO A;  2NVT H;  2P5Z X;  5CBA E;  1SE8 A;  1VQL A;  1KNA A;  4LFC Q;  4IFD H;  1B2T A;  1YNX A;  3GV3 A;  2B8G A;  4H13 C;  3OW7 A;  1YI2 A;  2FXQ A;  2HT1 A;  2ATW A;  1CZG A;  3TN2 A;  3D31 A;  3VA5 A;  1CFM A;  1EEI D;  4UY8 C;  1CKM A;  1Y8O B;  2L12 A;  2CW0 D;  2M9V A;  4DV2 L;  1PA6 A;  2JYO A;  2NWG A;  1S5F D;  1IBK Q;  2B2Y A;  2LY7 A;  1ROD A;  1STE A;  1STA A;  3KLS X;  2JA6 G;  1CSP A;  3RMH A;  1IW7 C;  2VZA A;  2QCP X;  2JA5 H;  3H09 A;  2LXK A;  1HFG A;  4RH6 A;  1R9T H;  4KLK A;  5BN4 A;  4JG2 A;  1D2B A;  2F0E A;  3MXG A;  3CW2 C;  1U4P A;  4X65 L;  5IOD A;  4QUC A;  1K8A C;  3PO2 H;  1SLJ A;  4JYA Q;  1LAB A;  2NYZ D;  1NY4 A;  1GHJ A;  3NP8 A;  4QCL A;  5IYB G;  2KA7 A;  1BOS A;  1BCP D;  3KFU A;  4P2C B;  1M1K C;  2RF4 A;  3F1Z A;  4TQU S;  2FMC A;  4A3G B;  5ELD A;  4OIJ A;  2KHJ A;  5FJ8 H;  2F0G A;  4IPC A;  1O78 A;  1WCM B;  3OYY A;  2DGY A;  4BWG B;  4A3M B;  1DOM A;  2B3G A;  1PH3 A;  1DZ1 A;  4PV1 C;  1YBY A;  2F4I A;  5FLX c;  3PIP A;  1MJC A;  1STG A;  4AIM A;  4KD3 A;  5ELB A;  3PGZ A;  4B3R Q;  1VF7 A;  3VYT A;  2VW9 A;  4JI1 Q;  3E0J A;  3S24 A;  5KND A;  1EFI D;  1B44 D;  3Q24 A;  3S1M B;  1L1O B;  4DKA C;  1PVO A;  3PSI A;  3GO5 A;  2NVQ H;  1ZYR C;  3S1R B;  4LF6 L;  4JV5 L;  1IKM A;  2A19 A;  1RF2 D;  2PO4 A;  5D65 A;  5ELE A;  4HJ8 A;  2Q8I B;  4DR5 Q;  3G6E A;  2VUM G;  1QCB D;  3J80 i;  5I4D A;  1Y1V H;  2R61 A;  1IYJ B;  2DJF C;  3FDT A;  4F88 A;  2BH8 A;  2A73 B;  2O4X A;  4Q0F A;  2KEN A;  2MJ8 A;  3NBH A;  3K5M A;  4H02 A;  2NZO A;  1A2T A;  4K2K A;  1L0Y B;  2K5N A;  2JEA I;  1KAW A;  3V2T A;  1L2F A;  4GNX C;  2HQL A;  4IUN A;  4DAP A;  5LMU L;  4A3B H;  1GO3 E;  2JA8 H;  2G9D A;  3HOY B;  1Q8K A;  2NZH A;  4IAL A;  1PH5 A;  1O7Z A;  3I72 A;  3FVQ A;  2B8F A;  1WTQ A;  1V9P A;  1NTG A;  4C3J B;  3GTQ H;  4OO1 H;  2YV5 A;  1OXT A;  3EFX D;  3ERS X;  1UE1 A;  4A3M G;  4JI6 L;  3PV0 A;  4IUQ A;  3DXJ C;  4LF7 L;  2NZ1 D;  2E5L L;  2B2V A;  4DR6 Q;  1UUP A;  2R3Z A;  4IQZ A;  3GTO H;  3KLR A;  3T13 A;  1JOR A;  1LTG D;  1Z6H A;  1S4Z A;  1V1Q A;  5IYD H;  1N34 Q;  3CCS A;  4K8J A;  4O0A A;  1SE2 A;  4DR7 L;  4OWW B;  4CJ2 C;  2HCC A;  1JE5 A;  2KEC A;  3BYY B;  1TWC H;  1S3O A;  4E6I A;  3ULL A;  2V4D A;  2ASB A;  1JJG A;  1K83 B;  2UUB L;  1PLF A;  5M5X B;  1IBL Q;  2BH2 A;  4DR4 L;  1WI5 A;  2JN4 A;  4JI2 Q;  1E2Z A;  5JEA G;  2F52 A;  5I6Y A;  1G51 A;  2QF7 A;  1XPO A;  1QG7 A;  1FYC A;  4HSP A;  4LWC A;  1N36 L;  2KCC A;  1V43 A;  2H1E A;  4DV0 Q;  2B2Y C;  5BR8 Q;  3HOX B;  3KJO A;  5C4H A;  4EGV A;  3CCU A;  2EJF C;  2M00 A;  1T9H A;  3QR8 A;  1S72 A;  3LX0 A;  3MAQ A;  4RCO A;  2WFW A;  1EQT A;  2X6L A;  2E2J H;  1VMC A;  3A5Z B;  1KD1 C;  1VQ8 A;  3TS2 A;  4N8X 1;  3OOC A;  1B3A A;  5IGG A;  3I4M H;  1CA6 A;  2CCZ A;  1G6P A;  1SFO H;  1PDQ A;  4WFN 3;  4LF5 Q;  4DNI A;  1MI2 A;  1IW7 D;  3SXH A;  4DV4 Q;  1YJW A;  4TVA B;  1QE6 A;  2K52 A;  3VR6 A;  1NMG A;  2K6A A;  1PH7 A;  3PF4 A;  4XQJ A;  3IRB A;  4M8A A;  1J5E L;  3T53 B;  3URY A;  1F2Y A;  3G48 A;  1SMX A;  5KIX A;  2JA5 B;  4F8M A;  3CU7 A;  1QVG A;  1TKW B;  2F0O A;  3AYH B;  4HMJ A;  1G6Z A;  2QGQ A;  2LMC B;  1MD2 D;  4DFA A;  1K0R A;  1C7Y A;  1EIG A;  4UP8 A;  1SRU A;  4DUY Q;  4X3U A;  3A56 A;  2E8G A;  3TP6 A;  5A2Q L;  1GUN A;  1EYD A;  5ELN A;  5GQO A;  4J1M A;  4A3K B;  2L5T A;  4DV6 L;  1PZK D;  4JC0 A;  3M7N A;  3S2H H;  1FVI A;  4GKK Q;  4IPH A;  5IYC H;  3R8B A;  2EXD A;  3GTJ B;  1H9M A;  4N9T A;  3VR5 A;  3A7L A;  4OEM B;  3W1B A;  5ISR A;  5IGD A;  4A3J B;  5IWA Q;  2B2W A;  1IL2 A;  2MNA A;  1Y1W G;  3T51 B;  1MGS A;  2PMZ E;  4FF1 A;  1CT1 D;  3M4Y A;  3PIO 3;  3CMA A;  3GV6 A;  2A74 C;  1VQ5 A;  4KN4 C;  1ZYR D;  3RZD B;  2PI2 A;  3HOW B;  2IX3 A;  3BZC A;  4FXG C;  5JOB A;  3OMG A;  3C1F A;  3DM3 A;  3I7F A;  2PW7 A;  3H3V C;  3W5O A;  3DEP A;  1IYU A;  2E76 C;  4U67 3;  1J8I A;  4LW1 A;  1HNW Q;  4GOP A;  3HOV B;  1R4P B;  4YCV A;  1U5K A;  2RCN A;  3BU2 A;  1XNQ Q;  5AFW A;  1VQF A;  4B9W A;  4L63 B;  4CDF C;  1TQO A;  1PH9 A;  5M5W H;  4K2L A;  1YHB A;  2F0W A;  5K36 G;  4PZ8 A;  4C1N K;  4A75 A;  3W1G A;  2D2C C;  5GAD C;  3QJY A;  1EYG A;  3I91 A;  2N88 A;  5KEE A;  4JI7 L;  4KY6 A;  5EBC A;  1SDF A;  2EJG C;  1VQD A;  2UXD L;  3RR5 A;  2ZJR A;  1U0L A;  4DAY A;  4C3I B;  1AZP A;  4R8I A;  1Q46 A;  1I4X A;  1SSO A;  4K8I A;  1FL0 A;  2B2V C;  1C8C A;  4JI4 L;  1SAP A;  4HED A;  4IN3 A;  3I56 A;  1TWF B;  4JI3 L;  1KDA A;  4DK6 C;  4DV3 L;  1EWI A;  2VL6 A;  1WD1 A;  1OO9 B;  1HR0 W;  4GZY C;  1MSH A;  2D9U A;  3PUZ A;  1Q81 C;  1HNZ L;  1EWH A;  1PTO C;  2AWN A;  4KD4 A;  3K5O A;  1XWE A;  1ZXT A;  4F87 A;  1ILP A;  4NXN L;  3X3N A;  5CV9 A;  3EBE A;  3T16 A;  3TSS A;  3HP3 A;  3PO3 G;  3UDX A;  4RGO S;  5HGT A;  1KIX A;  1XMQ L;  4K6L A;  3PUW A;  2Q8T A;  2VQF Q;  1QIL A;  1WTH A;  2WAC A;  5AJ3 Q;  3HOU G;  2PW5 A;  4CBV A;  2Y0S B;  3GTL H;  3Q23 A;  3PUY A;  5JJI A;  4RKB A;  2EY5 A;  1B7Y B;  4OHJ A;  4HJ7 A;  1YVC A;  1K28 A;  1Z47 A;  3CC2 A;  4BBS G;  3NTH A;  2EYO A;  3D4R A;  2E2H B;  3KLS A;  5DM6 3;  1NMF A;  2EY1 A;  1IBK L;  2B2U A;  3NBH B;  4G4K A;  5IYB H;  1MJE A;  5C44 B;  1TWG H;  2I5M X;  2K4K A;  3QOL A;  3TEH B;  3CCJ A;  1KDC A;  1FNW A;  2QEX A;  2VNU D;  3OSO A;  1F9Q A;  3SE0 A;  1PH6 A;  1SJH D;  5JJK A;  5KGU A;  2QDB A;  1EOT A;  3E5S A;  3R2I A;  3SVM A;  1I50 H;  1L0X B;  4PZ7 A;  5EPK A;  2PI2 E;  5M5Y B;  4DV1 L;  3ER0 A;  1UWV A;  1ESR A;  1TY0 A;  4JYA L;  3S1N H;  1KLU D;  4RHR A;  4DV7 Q;  5E3F A;  1TR5 A;  2QIL A;  1L1O A;  1QVC A;  1S5B D;  2OF1 A;  1CUK A;  2RHQ B;  3A55 A;  3UI2 A;  3TP7 A;  2F1M A;  4OL7 A;  4QB4 A;  1SFO B;  2PMZ B;  1QZH A;  5J1Z A;  3U50 C;  1WYD A;  4KK7 A;  4KMU C;  3S15 B;  4KHP Q;  1VQI A;  2EY2 A;  4GLV B;  1BR9 A;  5CV4 A;  2UXB L;  1KHI A;  2Z4I A;  2VUM H;  1NSN S;  2F0M A;  3NTI A;  4H7B A;  2CWA A;  3HZX A;  1BKB A;  1B9M A;  2WB1 G;  3BVM A;  4JI1 L;  2B2W C;  1SYB A;  1L0W A;  2KVM A;  4HJ9 A;  1BVS A;  1KXL A;  2XWB B;  1AEX A;  2X6G A;  5JEA J;  3BVZ A;  2I5H A;  4XXE A;  3TP5 A;  3J80 E;  4FXD A;  3H3V I;  2Q2H A;  2J7Z A;  4MTK A;  1PYB A;  3OWE B;  1HNX Q;  5IT9 E;  2JP1 A;  5CV8 A;  4ZAI A;  1TS2 A;  2EIF A;  4BY1 G;  1X55 A;  2B63 G;  4K6D A;  2EYH A;  4KTA A;  1KTK A;  4L6T B;  5D3I B;  4A3E G;  4GOP C;  3F2U A;  1O80 A;  4XT1 B;  3MTS A;  3I4N B;  5C6A A;  3CHB D;  1LO5 D;  3K6O A;  4EVO A;  2BA0 A;  3JAM L;  1TWA H;  1D1K A;  3KUP A;  4CKB A;  3I73 A;  2EPB A;  1OXS C;  1LLR D;  3T4A C;  1JCK B;  4GKJ Q;  4Y7N H;  2F4V L;  3QWN A;  2E2D C;  4ODG A;  2F0D A;  1KAB A;  3RZO B;  2EE1 A;  2YTY A;  1PH8 A;  4C3H H;  1H9R A;  2N3S A;  4Q5V A;  1CHP D;  5D14 A;  3M9B A;  1XYI A;  2XIW A;  5CV7 A;  4A93 B;  4I7Z C;  4IUT A;  1PXU A;  4DR6 L;  2AQ2 B;  5JEA H;  4G7Z C;  2ZM6 L;  4IJH A;  3HOZ H;  2HUG A;  4UPA A;  3OIQ A;  2PYK A;  4IUP A;  4RGN A;  3JC6 6;  4EQO A;  1XJV A;  4LF4 Q;  3GTG B;  1VF5 C;  1DD2 A;  1DXM A;  1PZJ D;  1MKH A;  1N34 L;  3MZ5 A;  4L5T A;  3FPU B;  3S9W A;  3DMU A;  1WJJ A;  3K7A H;  3JAM c;  2E2I H;  2MUY A;  4WRD A;  1EYA A;  3TRZ A;  1PTO D;  4C2M H;  3H15 A;  2WAQ G;  1IHZ A;  4JBW A;  2F3W A;  4A3C G;  1DGS A;  3V05 A;  4TKO B;  1JOK A;  1NNX A;  3GTM H;  3MEF A;  1VQE A;  4BBR G;  3R2T A;  3OW2 A;  1IBL L;  3C2P A;  3GD7 A;  4JI2 L;  4NB3 A;  2K14 A;  1XPU A;  1K9M C;  4AYB G;  2FIN B;  1NE3 A;  1VQ7 A;  2NN6 G;  4PMW A;  1PH4 A;  1EQQ A;  4K5V A;  2NN6 I;  3C46 A;  2B2U C;  2NVX B;  5BR8 L;  1ILQ A;  2IWH A;  4JCV E;  3WWV A;  1MBY A;  4UP7 A;  1VDZ A;  1TXY A;  4GOP B;  2PZT A;  4N9P A;  1DOL A;  2VQE L;  5C4J B;  2A6E C;  3M85 A;  2R7Z H;  1K3R A;  1CKO A;  3UDG A;  4JI5 Q;  1X56 A;  1EFW A;  3AEV A;  3PF5 A;  3J7A F;  1Q1B A;  4A3D G;  5C3W A;  3R93 A;  1I6H H;  4F7X A;  5M3M G;  3AFP A;  4RG1 A;  2KED A;  4GN4 B;  4PNY A;  4DV4 L;  4DAY B;  3A74 A;  2K32 A;  3KBX A;  1JJ2 A;  1KNE A;  2HCI A;  1L1O C;  2SNS A;  2NVY B;  1SYG A;  1ENF A;  3FP9 A;  3QO2 A;  1G29 1;  3S14 H;  1TWG B;  4ME5 A;  1FJG Q;  4LF8 L;  3S16 H;  1N8R C;  3U58 A;  3ZYY X;  5C3E G;  1JOQ A;  2E74 C;  5E7N A;  3SDZ A;  5KNB A;  1F2L A;  1N33 Q;  4BA2 I;  2YTX A;  2PZW A;  2HHH L;  1CK1 A;  1PFB A;  1N32 Q;  1GUT A;  2RVL A;  4O1N A;  2K33 A;  4EQN A;  3RLF A;  3S1N B;  3J80 L;  1GUS A;  5FLX L;  3M4O H;  1RJT A;  4NDX A;  1B1Z A;  1M4V A;  4JOI A;  3KDF B;  3VYS A;  4JPB W;  2PZU A;  4QIW B;  3OWF A;  5IWA L;  4P72 A;  1PZI D;  1A15 A;  1XMO Q;  4JI8 L;  3MEH A;  1HTP A;  1RTN A;  4LFA Q;  2WKC A;  1Q1E A;  3MC0 B;  3SK4 A;  4AQY Q;  3RN2 A;  5T1I A;  3RLN A;  1BXT A;  3VA7 A;  4GLX A;  2RSN A;  2EYJ A;  2H4O A;  2R93 H;  1O7L A;  4YHH L;  3E9H A;  4XTC S;  1SYD A;  2DUD A;  3A8J E;  4JK1 C;  4ZRZ A;  1Q86 C;  1HNW L;  2IW3 A;  1X9N A;  3J80 c;  3NEL A;  4PG3 A;  1YJ9 A;  4AH6 A;  4OON A;  2EDG A;  5C4X B;  4U68 A;  5IT9 c;  1B9N A;  2JA7 B;  1II3 A;  4XYO A;  4K14 A;  3U4Z A;  1VQO A;  2MHV A;  2QDL A;  5M3F B;  4ALP A;  3LGJ A;  2QW7 A;  2R7D A;  3PIP 3;  3PO3 H;  4YIJ A;  3S17 H;  4B3T L;  1AE3 A;  3FKI H;  1GVP A;  1UNS A;  3BVG A;  1EQR A;  4MTN A;  3HOU H;  2UXC Q;  1I6V C;  4J15 A;  4LUV A;  3GTK H;  5EAY A;  3HG9 A;  1E2V A;  1HHV A;  3S2D H;  1U4L A;  2R92 H;  4BBS H;  4TRD A;  4L5R C;  2L4N A;  4GN5 A;  3D4D A;  4NXM L;  2EJM A;  1WTO A;  2B29 A;  1YNN C;  1IZ6 A;  2CH4 A;  3GDE A;  2VQF L;  1STH A;  4BY7 B;  2GA4 B;  1T5E A;  5EKI A;  3QIA A;  4DGZ A;  2Q2U A;  1JIC A;  4A3G G;  4HSV A;  4A3F H;  2Z1C A;  3CAM A;  1SND A;  4G7O C;  1WCM G;  4KV6 A;  3KF8 A;  2F0Q A;  4KJO A;  3TS0 A;  4XIG S;  2VB3 X;  1ET9 A;  2WII B;  4R4O A;  2EYL A;  1YZ6 A;  2HQE A;  3EN2 A;  2F0T A;  3QB3 A;  2BE5 C;  5I9O A;  5FK9 C;  4HCE A;  5LMN W;  4DUZ Q;  2KHS A;  1ASY A;  4OIK A;  5M9O A;  4KKU A;  1QOH A;  1X3P A;  2WP8 J;  3ERO A;  2JSO A;  4R8N A;  5G3L F;  3GTP H;  4PZ6 A;  1PFS A;  2CH4 W;  1AZQ A;  4X62 Q;  2A6E D;  2ENB A;  1CA5 A;  1NCV A;  3J81 i;  2L11 A;  5IP7 G;  4DK3 C;  1LT5 D;  3J7A 5;  3IFT A;  1BBU A;  1F77 A;  2FMM A;  3MHB A;  1QUQ B;  4H0L C;  4DV7 L;  4KN7 C;  2AQ3 B;  5LHY 1;  1LTR D;  1A0I A;  4IUV A;  2R7Z B;  2ZTE A;  5CV6 A;  5I9P A;  1E1T A;  2NVT B;  1TS3 A;  4Y52 H;  3K0Y A;  1PYW D;  1V8Q A;  4IUU A;  2Z8L A;  1X3Q A;  2Q2T A;  1YIT A;  4G7H C;  4ZLT F;  4BY7 G;  1A3U A;  4KHP L;  2LS0 1;  2KQ3 A;  3AU7 A;  3H94 A;  3HOY G;  2OCE A;  4IPD A;  5FLM G;  1BBX C;  2IJ0 A;  5CMD A;  1HR0 Q;  1CSQ A;  4JW0 A;  4DV5 Q;  1EYC A;  4BY1 H;  4JOI C;  4C3J G;  2B63 H;  2HIV A;  4S3S A;  1D7Q A;  1X3E A;  3OIP A;  4R4I A;  2Y0S E;  1O7I A;  3D6C A;  3PUX A;  4G57 A;  4GN3 B;  1NR2 A;  5C5L A;  1VQ6 A;  4DK1 A;  2EXZ A;  4ILW A;  1R4Q B;  2TMP A;  5GRO A;  5IY0 A;  1G2S A;  1S5E D;  1V1P B;  1B70 B;  4EX5 A;  1IXR A;  3L7Z C;  2I5L X;  4RFB A;  5J22 A;  2LKV A;  3RUZ A;  3CCM A;  2EYM A;  2HDL A;  3HKZ B;  4QUF A;  1LTL A;  4YWM A;  1HNX L;  1SJE D;  3SK5 A;  1R9T B;  4X3T A;  1PTO H;  3U9O A;  1FD7 D;  4DR2 Q;  2N78 A;  5EJW A;  1FGU A;  1NBW A;  3CCE A;  1EIF A;  1LT4 D;  3TZU A;  3PO2 B;  1EY8 A;  4A3I H;  3L0O A;  5F2D A;  5EKL A;  4DAM A;  3K58 A;  2R7F A;  4DR3 Q;  3K8A A;  3NWT A;  4DV2 Q;  4JBM A;  3KYH C;  2IX1 A;  2XGT A;  3A0J A;  1HZC A;  1VQA A;  2CFM A;  3CKI B;  4CJ1 B;  3HOX G;  3A54 A;  3CQZ H;  3F2B A;  3R3O A;  3F2C A;  3E9I A;  4A3C H;  4IFD I;  1Q7Y C;  2C35 B;  1F9S A;  4BBR H;  1CQV A;  1EZ6 A;  2PCF B;  5IOC A;  1A63 A;  3SK6 A;  3FEW X;  2SOB A;  1XPR A;  1XNR Q;  1IL8 A;  1JC7 A;  1GUW A;  3NXW A;  3OTO L;  5IP9 H;  3O13 A;  1I5F A;  3UE0 A;  4OXP A;  1LAC A;  4P74 A;  2F0U A;  1AFP A;  1STY A;  2E75 C;  1QNU A;  2V1C C;  4L5Q A;  3EA6 A;  5EBD A;  4RGT A;  5I2X A;  2JK8 A;  3E3X A;  1VQ9 A;  1SE3 A;  2JEB I;  2UUA Q;  2KCT A;  2AMC B;  3ND9 A;  1UAP A;  2NVQ B;  3FKI B;  3T1H Q;  1F9R A;  1M8A A;  3I55 A;  2ICI A;  3H0G H;  1EY6 A;  1N9W A;  2A69 C;  3CRL C;  1HA6 A;  2JA5 G;  3S1Q H;  1MIU A;  3TBI B;  3GTK B;  2DN8 A;  4N8F A;  1Y1V B;  2XRQ D;  1WTX A;  1SN8 A;  1YNN D;  3RN5 A;  3K57 A;  2Z6B A;  5FKA C;  3S2D B;  4A3D H;  4HIM A;  2R92 B;  4XT3 B;  2Q2I A;  1SXT A;  2D0P A;  1HA5 A;  5M3M H;  2YTV A;  5ELF A;  1LT3 D;  4A3K G;  1LM0 A;  2N8N A;  1HPC A;  1MHW C;  3BG3 A;  1ICW A;  2AUK A;  4A3B B;  3AQQ A;  3SK8 A;  5I2Y A;  4NP5 A;  4LNQ A;  4DU9 A;  2JA8 B;  4A3J G;  2BDN A;  4NMZ A;  4QMG A;  4A3F B;  2BE5 D;  4B3M Q;  1BCP F;  1B8A A;  2ZJQ A;  1YJN A;  4LF6 Q;  1G8Z D;  1TY2 A;  5C3E H;  3GTQ B;  1W3S A;  4R4Q A;  1WTV A;  4QL5 A;  1B4O A;  4LMQ D;  2O5J C;  1CTM A;  4LFC L;  4GS3 A;  2A8V A;  2JA6 H;  2F0V A;  1H95 A;  1HXY D;  1EEF D;  1VQ4 A;  3HOW G;  3GTO B;  3KDF A;  2A5H A;  1V1O A;  2K04 A;  5CGK A;  2HD3 A;  1SYF A;  2PQA A;  1KC8 C;  3HOV G;  4XQQ A;  4HN7 A;  1TWC B;  2HIX A;  1D5X C;  1XTD A;  3F2D A;  5LMU Q;  1AE2 A;  2K28 A;  3I90 A;  4UDU C;  1EIY B;  1VMP A;  1FNV A;  1N33 L;  5KYL A;  1SYC A;  2RQX A;  1E0B A;  4CHT B;  3CC7 A;  2VB2 X;  4R4T A;  4P75 A;  5C5M A;  3KBG A;  1I3Q H;  2VS1 A;  4C3I G;  2Q8R E;  1JWU D;  3IKJ A;  4LF7 Q;  3FRP B;  3NHH A;  3IL8 A;  2E5L Q;  1HH2 P;  2JQO A;  4A3L G;  2JXM B;  4X66 Q;  2PNH A;  5JPN C;  3L3O C;  2K1B A;  1P8L A;  1HCZ A;  1XMO L;  3K81 C;  3KF8 B;  1G91 A;  4LFA L;  4A3B G;  3E0E A;  4AQY L;  2JA8 G;  1KRT A;  2E2J B;  5DM7 3;  3J7Y W;  2A6H C;  1TWH H;  2K5Q A;  4RCN A;  1T5X D;  3I4M B;  1HZA A;  1JJC B;  2ICE C;  3PQI A;  2F0H A;  1RTO A;  4OO1 I;  3C3L A;  2I07 B;  2K5D A;  1OTC A;  4X3K A;  2Y0S G;  2Z6K A;  3D0F A;  4RKL A;  1STN A;  4ME3 A;  4B3R L;  1BBW A;  1SE4 A;  3TRE A;  1GD7 A;  2J0T D;  2R6G A;  5ELC A;  3MWY W;  4APV A;  1JB3 A;  3AMU A;  1B50 A;  1RDP D;  5C44 G;  4CJ0 B;  1GKH A;  3RLO A;  3P7J A;  1VQM A;  3S2H B;  5IGE A;  1NAP A;  3PMF A;  4A3G H;  2UXC L;  4A3I B;  4DR5 L;  1TVX A;  2CKZ B;  3NTK A;  2RA4 A;  1WCM H;  5KYI A;  4A3M H;  2MO0 A;  5E4W C;  1JWS D;  5GAG C;  4K0K Q;  2XVS A;  4FDB A;  2IL8 A;  1ZKO A;  3MXU A;  1AP0 A;  4QIW E;  1WOC A;  4KJN A;  3SHL A;  2MFI A;  3I2Z A;  3UE1 A;  5KNC A;  1QZG A;  4BXX G;  1WTW A;  1DON A;  3S1M H;  1YHA A;  4K5X A;  2IHE A;  2A69 D;  3S1R H;  4J8Q A;  2XRS D;  5JVG 3;  4KY7 A;  2RHS B;  3A8I E;  2CWP A;  4GLA C;  1PH1 A;  4OWX B;  4HR7 B;  3GQB A;  1QNK A;  1QUQ A;  1Q8I A;  5IP7 H;  1TU2 B;  1SBB B;  1KL9 A;  3NSW A;  2L0C A;  1Q3L A;  1QB5 D;  3NWS A;  5M5W B;  5EPJ A;  1PFN A;  5C4Z A;  4M1U B;  4YWK A;  1E3P A;  4ZUJ A;  1X65 A;  1LTB D;  1UE7 A;  4RA8 A;  5T1G A;  5IIF A;  3HKS A;  3WDN A;  1HTL D;  4IOC A;  4I7A A;  4YCU A;  4DK0 A;  3J81 E;  3BDO A;  1DM0 B;  2UUC Q;  5H1S E;  3I8Z A;  1A3T A;  1WVL A;  4X62 L;  3CD6 A;  4KHV A;  1I94 Q;  3HOY H;  1LYL A;  2NBF A;  1HUM A;  2MQH A;  4IUR A;  5JPM C;  2NB0 A;  5J3B A;  4C3J H;  3DLL A;  3VR3 A;  5JAV A;  4KY5 A;  2QKI C;  3W2D A;  1WD0 A;  2KHI A;  1V1P A;  2Z0S A;  3G7L A;  4X3S A;  3I4N G;  1KAA A;  3MFY A;  2IT1 A;  1SMY C;  4HCS A;  2L15 A;  3EQL C;  2ZT9 C;  3L2P A;  4DV0 L;  3Q8D A;  3CPF A;  1UE6 A;  1HQR D;  4LJZ C;  1LT6 D;  1I4Q A;  1VQB A;  1K8M A;  3FMC A;  1BCP B;  2UXD Q;  3GTL B;  1CHQ D;  3BZK A;  4LK1 C;  1C48 A;  3H6M A;  1A3V A;  4DV5 L;  2OEO A;  5LL6 S;  3PUV A;  2GN5 A;  4LF5 L;  5DEH A;  1K83 H;  2MGS A;  4A93 G;  3D8G A;  4FP5 D;  4CDC C;  5M5X H;  5CR3 A;  4DV3 Q;  1YNJ C;  2D5D A;  2A1A A;  1PYS B;  1GXD C;  1H9J A;  4UP9 A;  3K80 C;  2JE6 I;  2RDG A;  2ZTD A;  4ZYS A;  2BCO A;  1CZW A;  4NXN Q;  1HZ9 A;  1BUV T;  1I4H A;  3VR4 A;  2F3I A;  3LWE A;  4IJL A;  3EJI A;  1KRS A;  1SNP A;  2B39 A;  1I3Q B;  2MO1 A;  3HOX H;  1XMQ Q;  1E1O A;  1Y1W H;  2A6H D;  1E2W A;  1YIJ A;  1JWM D;  4LFB Q;  3AB9 A;  4DAV A;  4DR2 L;  4DUY L;  2Z6K C;  3MVV A;  2ZXO A;  3N6R A;  1I50 B;  4WJ4 A;  1X32 A;  2F0F A;  1ET6 A;  4H44 C;  1QVF A;  4OX9 Q;  3AFQ A;  2A68 D;  1DOK A;  5LMN Q;  3K7U C;  3OHX C;  4GKK L;  3DHQ A;  3NK9 A;  4J6H A;  1TWH B;  1IBM Q;  3FPP A;  2UU9 Q;  1BO0 A;  2ZJP A;  4ULL A;  5IT9 L;  4DR3 L;  3K5N A;  1A2U A;  4IPG A;  4QY7 A;  2BA1 A;  4IO9 A;  5K5P A;  1H9S B;  3WOF A;  3QG1 A;  3DWA A;  3HFZ B;  2PQA B;  1U9R A;  4DF7 A;  1X54 A;  3MXN B;  1RIP A;  1Y8P B;  5K36 H;  1XXG A;  2JJQ A;  1S5C D;  4DXG A;  1ESF A;  1D1I A;  4ZUI A;  2VUM B;  4YY3 Q;  2GVA A;  4B3S Q;  1XNR L;  1W6K A;  5COY A;  3CCR A;  4JI0 Q;  2KCN A;  3TZD A;  3NEN A;  3KOJ A;  4R1J A;  3ULJ A;  3D6W A;  4A3K H;  3A7A B;  4DV1 Q;  3BS1 A;  1OXU A;  2VY3 A;  1KDB A;  2UUA L;  1AH9 A;  1XNQ L;  3MXP A;  5DLQ E;  3T1H L;  1A8V A;  3CME A;  4MN3 A; 
#chains in the Genus database with same CATH homology
 3GTJ H;  3GTL H;  1VS0 A;  4GN3 B;  1C9O A;  2N49 A;  1OXX K;  3PUY A;  5JJI A;  1VQ6 A;  1B7Y B;  4HJ7 A;  4LUZ A;  3CCV A;  5GRO A;  5IY0 A;  1YVC A;  3T1Y Q;  4A3J H;  4BY7 H;  1B70 B;  1Z47 A;  3CC2 A;  4EX5 A;  2K5V A;  1IXR A;  3L7Z C;  2I5L X;  4BBS G;  3HKZ E;  3CCM A;  3OTO Q;  4A3I G;  5FLM H;  2UXB Q;  5IYC G;  1LTL A;  2AWO A;  1HJP A;  4YCW A;  4YWM A;  4X64 L;  2QA4 A;  1HNX L;  1NMF A;  1ASZ A;  1IBK L;  3NBH B;  4IFD J;  2ALY B;  1OXV A;  3RZD H;  5IYB H;  4LUO A;  3HOW H;  1MJE A;  1VQJ A;  1TWG H;  1PH2 A;  4DR2 Q;  3NEM A;  2I5M X;  2K4K A;  2N78 A;  3M4P A;  2IY5 B;  1SRO A;  2OQ0 A;  4KI0 A;  3TEH B;  1FGU A;  3CCJ A;  1NBW A;  3CP0 A;  2QEX A;  3CCE A;  2VNU D;  1EIF A;  1JMC A;  4GNX A;  1PH6 A;  4B3M L;  3HOV H;  4A3I H;  3KF6 B;  5JJK A;  2D0O A;  4JI7 Q;  3L0O A;  4A76 A;  4DAM A;  1GM5 A;  2R7F A;  1I50 H;  5IP9 G;  4DR3 Q;  3K8A A;  4PZ7 A;  4DV2 Q;  2PI2 E;  2I0Q A;  3KYH C;  1HR0 L;  4JBM A;  4X6A H;  3M4Q A;  4DV1 L;  2XGT A;  3ER0 A;  1UWV A;  1HZC A;  1VQA A;  3A0J A;  2CFM A;  2IX1 A;  2K50 A;  3TQY A;  4JI4 Q;  2OQK A;  5AJ3 L;  4DV7 Q;  3S1N H;  3K0X A;  3HOX G;  4OWT B;  3SGI A;  3CQZ H;  1L1O A;  1QVC A;  3F2B A;  4JI3 Q;  1CUK A;  1X3F A;  2RHQ B;  3E9I A;  3F2C A;  1W2B A;  4A3C H;  2OTL A;  3JAM i;  4IFD I;  3CF5 A;  4C3I H;  1Q7Y C;  1Q12 A;  2C35 B;  4BBR H;  3H0G G;  2ES2 A;  1UEB A;  1HNZ Q;  1A63 A;  1QZH A;  1VQC A;  1WYD A;  3U50 C;  3J81 c;  2LSS A;  4DR1 Q;  4A3L H;  1TWF H;  1XPR A;  1VQH A;  1XNR Q;  4KHP Q;  3OTO L;  5IP9 H;  4LF9 Q;  1I5F A;  3UE0 A;  4OXP A;  1VQI A;  4GLV B;  4P74 A;  2UXB L;  2OWO A;  2NVT H;  1KHI A;  2V1C C;  2F4V Q;  2IHF A;  4L5Q A;  2VUM H;  5C4X G;  3CXC A;  2JK8 A;  1SE8 A;  1VQL A;  1VQ9 A;  4LFC Q;  1WFQ A;  2JA7 G;  2JEB I;  2UUA Q;  2KCT A;  2AMC B;  1YNX A;  2CWA A;  5M3F G;  1BKB A;  2WB1 G;  4HJ5 A;  3T1H Q;  4JI1 L;  3I55 A;  1YI2 A;  3H0G H;  2FXQ A;  1L0W A;  2HT1 A;  1N9W A;  4HJ9 A;  2ATW A;  1BVS A;  1X3G A;  1KXL A;  3D31 A;  2OTJ A;  2JA5 G;  1CKN B;  1MIU A;  3S1Q H;  5JEA J;  1SR3 A;  4UY8 C;  1CKM A;  1SN8 A;  2D62 A;  2I5H A;  5HGQ A;  4X66 L;  2ZM6 Q;  3RN5 A;  1PV4 A;  3H3V I;  4DV2 L;  4A3D H;  2Q2H A;  4HIM A;  1PA6 A;  5C0X G;  1PYB A;  1E22 A;  2D0P A;  2Q2I A;  5M3M H;  4X64 Q;  2YTV A;  2AKW B;  1RL2 A;  1HNX Q;  1IBK Q;  4A3K G;  1LM0 A;  5C0X I;  3CPW A;  1KQS A;  2EIF A;  2N8N A;  4BY1 G;  1X55 A;  2B63 G;  2JA6 G;  1CSP A;  4A3E G;  4GOP C;  2E2H H;  2VZA A;  2JA5 H;  3AQQ A;  2LXK A;  3FHW A;  4LNQ A;  1K8G A;  3H3V H;  1LUZ A;  1R9T H;  2BA0 A;  4KLK A;  4A3J G;  4B3M Q;  4JG2 A;  5C44 H;  1TWA H;  1B8A A;  2LXJ A;  5ELO A;  1YJN A;  2ZJQ A;  3CW2 C;  4LF6 Q;  1OXS C;  4HIO A;  5C3E H;  1W3S A;  3HOZ G;  4IOA A;  1C0A A;  4GKJ Q;  4R4Q A;  4Y7N H;  4QL5 A;  4X65 L;  2F4V L;  4RMF A;  3ICE A;  1K8A C;  3PO2 H;  3KLW A;  4LFC L;  1SLJ A;  4JYA Q;  4GS3 A;  2A8V A;  2JA6 H;  1H95 A;  1NY4 A;  2YTY A;  4A3E H;  1PH8 A;  4QJF A;  1E24 A;  2K5H A;  4C3H H;  2N3S A;  5IYB G;  1VQ4 A;  3HOW G;  3KDF A;  3M9B A;  3KFU A;  1M1K C;  2RF4 A;  3F1Z A;  5M5Y H;  4TQU S;  2PQA A;  1KC8 C;  2KHJ A;  4DR6 L;  5FJ8 H;  2ZM6 L;  2VQE Q;  4IJH A;  3HOV G;  3HOZ H;  4UPA A;  4IPC A;  4BXX H;  3OYY A;  2DGY A;  3JC6 6;  1XJV A;  2HIX A;  4LF4 Q;  2B3G A;  1XTD A;  2KBN A;  3ZJY C;  3F2D A;  1PH3 A;  5LMU Q;  1MKH A;  1AE2 A;  1N34 L;  1YBY A;  4DPG A;  4GNX B;  1VCI A;  5FLX c;  3PIP A;  1MJC A;  1EIY B;  4AIM A;  4L5T A;  3VDY A;  1N33 L;  5GAH C;  3PGZ A;  1WJJ A;  3K7A H;  3JAM c;  3S15 H;  2E2I H;  4B3R Q;  2VW9 A;  3CC7 A;  3TRZ A;  4C2M H;  4JI1 Q;  3H15 A;  2WAQ G;  2WB1 E;  4JBW A;  4R4T A;  4EQ5 A;  3S24 A;  4P75 A;  4A3C G;  1DGS A;  4K0K L;  1I3Q H;  2VS1 A;  3GTM H;  3MEF A;  1VQE A;  4BBR G;  1L1O B;  4LF7 Q;  4DKA C;  1PVO A;  3PSI A;  2E5L Q;  1HH2 P;  2JQO A;  3GO5 A;  3OW2 A;  1IBL L;  4LF8 Q;  2NVQ H;  4A3L G;  3GD7 A;  4LF6 L;  4JV5 L;  4X66 Q;  4JI2 L;  2PNH A;  2A19 A;  4NB3 A;  4GKJ L;  2R7Z G;  3ULP A;  1P8L A;  2K14 A;  1YEZ A;  4HJ8 A;  1XMO L;  1A62 A;  3K81 C;  3KF8 B;  1K9M C;  4AYB G;  1XPU A;  1NE3 A;  1YHQ A;  4LFA L;  4DR5 Q;  3G6E A;  2VUM G;  4A3B G;  1D8L A;  1EUJ A;  2GVB A;  1HZB A;  3E0E A;  2NN6 G;  4AQY L;  1VQ7 A;  4PMW A;  2JA8 G;  3J80 i;  1Y1V H;  1IYJ B;  1KRT A;  1PH4 A;  1VQK A;  1EQQ A;  4MZ9 A;  1TWH H;  2HHH Q;  4IFD G;  2NN6 I;  2BH8 A;  5BR8 L;  4NPS A;  1NJI C;  1VQP A;  4JCV E;  2KEN A;  3WWV A;  4UP7 A;  1HZA A;  1TXY A;  1JJC B;  2K75 A;  3RNU A;  4GOP B;  4WJ3 M;  4OO1 I;  4H02 A;  2NZO A;  2K5N A;  2VQE L;  2JEA I;  1KAW A;  3M85 A;  2R7Z H;  5HY6 A;  1K3R A;  1OTC A;  4LF4 L;  1CKO A;  1L2F A;  3PIO A;  4GNX C;  2HQL A;  1X56 A;  3UDG A;  4JI5 Q;  1EFW A;  3AEV A;  2Y0S G;  3PF5 A;  5LMU L;  1VQG A;  2Z6K A;  4X65 Q;  4A3B H;  3I4N H;  1Q1B A;  1GO3 E;  4JI8 Q;  2JA8 H;  4A3D G;  3D0F A;  1I6H H;  1Q8K A;  2NZH A;  4ME3 A;  5M3M G;  1PH5 A;  3AFP A;  4B3R L;  4RG1 A;  1BBW A;  4HID A;  1V9P A;  1NTG A;  4GN4 B;  5IE8 A;  4DV4 L;  4DAY B;  2UUC L;  3GTQ H;  3A74 A;  1JJ2 A;  2YV5 A;  1L1O C;  1OXT A;  3ERS X;  1UE1 A;  3HKZ G;  4KHZ A;  4MNO A;  3TRE A;  3PV0 A;  3CCQ A;  4A3M G;  1GD7 A;  3FP9 A;  1I94 L;  4JI6 L;  1G29 1;  3S14 H;  4LF7 L;  1FJG Q;  4YHH Q;  2E5L L;  2R6G A;  4LF8 L;  3RZO H;  4DR6 Q;  2EQS A;  4O2D A;  3S16 H;  4APV A;  1S40 A;  3GTO H;  3STB C;  1N8R C;  5C44 G;  1GKH A;  3RLO A;  1VQM A;  3U58 A;  5IYD H;  1V1Q A;  5C3E G;  3CCL A;  1N34 Q;  4A93 H;  4A3G H;  4JBJ A;  4P73 A;  2UXC L;  4DR5 L;  3CCS A;  5E7N A;  2CKZ B;  2YU9 H;  3PO2 G;  1N33 Q;  4BA2 I;  4O0A A;  5JJL A;  4DR7 L;  2YTX A;  2HHH L;  4OWW B;  1JT8 A;  1JE5 A;  1WCM H;  1TWC H;  3GTG H;  4A3M H;  2MO0 A;  1N32 Q;  1S3O A;  3RLF A;  2WAQ E;  3ULL A;  5GAG C;  3M4O H;  4K0K Q;  2ASB A;  4FDB A;  1JJG A;  2UUB L;  4JOI A;  4QIW E;  4B3T Q;  1IBL Q;  3KDF B;  2R93 G;  1WOC A;  2ZTC A;  2BH2 A;  4DR4 L;  4JI5 L;  5FJ8 G;  4JV5 Q;  1WI5 A;  4JI2 Q;  2MFI A;  5JEA G;  3I2Z A;  2F52 A;  2IX0 A;  3UE1 A;  5IWA L;  1QZG A;  4BXX G;  1G51 A;  1XPO A;  4P72 A;  1XMO Q;  4POF A;  4JI8 L;  2YYZ A;  1Q82 C;  3S1M H;  4LFA Q;  1YHA A;  4JYA L;  1EOV A;  1Q1E A;  4QGU A;  4AYB E;  4AQY Q;  4LWC A;  2IHE A;  3RN2 A;  1N36 L;  3S1R H;  3RLN A;  1V43 A;  4DV0 Q;  4GLX A;  2RHS B;  3BJU A;  5BR8 Q;  2CWP A;  4GLA C;  3KJO A;  1PH1 A;  4OWX B;  3CCU A;  5GAE C;  1QUQ A;  3G4S A;  1T9H A;  5IP7 H;  2R93 H;  1FJG L;  4YHH L;  3E9H A;  4XTC S;  1S72 A;  4NXM Q;  1KL9 A;  2WFW A;  2E2J H;  2DUD A;  3A5Z B;  1KD1 C;  1VQ8 A;  2NVX H;  1VQN A;  3TS2 A;  2CQO A;  3FKI G;  1Q86 C;  4YWK A;  1E3P A;  2CCZ A;  4POG A;  3I4M H;  1HNW L;  1G6P A;  1X65 A;  1X9N A;  1SFO H;  3J80 c;  4LF5 Q;  3NEL A;  4PG3 A;  1YJ9 A;  1UE7 A;  4DNI A;  4LFB L;  4AH6 A;  3HKS A;  4OON A;  4IOC A;  5C4J H;  5IT9 c;  3M3Y H;  4YCU A;  2UUC Q;  1Y1V G;  4DV4 Q;  4TVA B;  5H1S E;  1YJW A;  1N32 L;  3PCO B;  3I4O A;  2K52 A;  4OX9 L;  3U4Z A;  1VQO A;  1NMG A;  1PH7 A;  3PF4 A;  4ALP A;  4X62 L;  3IRB A;  3LGJ A;  2R7D A;  5LMN L;  4JI6 Q;  2R92 G;  3CD6 A;  1I94 Q;  3HOY H;  3PO3 H;  4QQB X;  1LYL A;  2JA9 A;  1IBM L;  2MQH A;  1J5E L;  3S17 H;  2UU9 L;  4B3T L;  1AE3 A;  1UE5 A;  3FKI H;  1GVP A;  1P16 A;  5J3B A;  4C3J H;  3G48 A;  1SMX A;  1EQR A;  4MTN A;  3HOU H;  1QVG A;  3AYH B;  3DLL A;  1K73 C;  2QGQ A;  2NVY H;  3F8T A;  4HJA A;  2KHI A;  2Z0S A;  4L5S A;  2UXC Q;  4J15 A;  4LUV A;  1K0R A;  1C7Y A;  3I4N G;  3GTK H;  2IT1 A;  1SRU A;  4UP8 A;  2L15 A;  5EAY A;  4DUY Q;  2E8G A;  4DR7 Q;  3L2P A;  4DV0 L;  4A3F G;  5ELN A;  3Q8D A;  3UDI A;  4YY3 L;  5GQO A;  4HIK A;  3CPF A;  3S2D H;  4DV6 L;  1UE6 A;  4JC0 A;  2R92 H;  4BBS H;  3M7N A;  3S2H H;  1FVI A;  4B3S L;  2KCM A;  4OO1 G;  1JB7 A;  4L5R C;  4GKK Q;  1VQB A;  4GN5 A;  2UUB Q;  4IPH A;  5IYC H;  4JI0 L;  4NXM L;  2UXD Q;  2EXD A;  3J81 j;  3W1B A;  3BZK A;  2B29 A;  4DR4 Q;  1IZ6 A;  4DV5 L;  3GDE A;  3J7Z C;  2VQF L;  5IWA Q;  3PUV A;  1E7Z A;  2GN5 A;  4LF5 L;  3CC4 A;  5IYD G;  1IL2 A;  1K83 H;  2MNA A;  1Y1W G;  2Q2U A;  4A93 G;  3KF6 A;  4A3G G;  4A3F H;  5M5X H;  4DV3 Q;  1N36 Q;  2H5X A;  3CAM A;  2PMZ E;  2A1A A;  1PYS B;  3T1Y L;  3G71 A;  4UP9 A;  3K80 C;  1WCM G;  2JE6 I;  3CMA A;  1VQ5 A;  2ZTD A;  3KJP A;  2PI2 A;  3TS0 A;  4XIG S;  4R4O A;  4NXN Q;  1HZ9 A;  3BZC A;  3UDF A;  1J6Q A;  2F3I A;  4IJL A;  1YZ6 A;  3DM3 A;  3EN2 A;  5C0X J;  1KRS A;  3I7F A;  3W5O A;  2MO1 A;  3HOX H;  1XMQ Q;  1E1O A;  5LMN W;  4LW1 A;  1HNW Q;  1Y1W H;  4GOP A;  4DUZ Q;  1ASY A;  4YCV A;  1U5K A;  2RCN A;  3BU2 A;  3U4V A;  1YIJ A;  1XNQ Q;  4LFB Q;  4DR2 L;  1VQF A;  2WP8 J;  4DUY L;  2Z6K C;  1PH9 A;  4A4I A;  5M5W H;  1YHB A;  5K36 G;  4PZ8 A;  3GTP H;  4WJ4 A;  4PZ6 A;  4A75 A;  1PFS A;  1QVF A;  3W1G A;  4OX9 Q;  3AFQ A;  5GAD C;  1EYG A;  4X62 Q;  3K7U C;  5LMN Q;  4JI7 L;  4GKK L;  1IBM Q;  1VQD A;  3J81 i;  1J5E Q;  2UXD L;  5C4X H;  3RR5 A;  2UU9 Q;  2ZJP A;  5IP7 G;  4DK3 C;  2ZJR A;  4DR3 L;  1U0L A;  4IPG A;  4QY7 A;  2BA1 A;  4BA1 I;  1Q46 A;  4IO9 A;  2JA7 H;  3J7A 5;  1BBU A;  3B6Y A;  1FL0 A;  4JI4 L;  1QUQ B;  5M3F H;  4DV7 L;  4JBK A;  1Y14 B;  3HFZ B;  2PQA B;  3I4M G;  3I56 A;  1CKN A;  1X54 A;  3MXN B;  4JI3 L;  1A0I A;  1RIP A;  4DK6 C;  2ZTE A;  1EWI A;  2VL6 A;  2JJQ A;  4DV3 L;  1E1T A;  1HR0 W;  4Y52 H;  3PUZ A;  1Q81 C;  4YY3 Q;  1HNZ L;  2AWN A;  4DV6 Q;  2GVA A;  4DR1 L;  2Q2T A;  4B3S Q;  1PHJ A;  1YIT A;  1XNR L;  4BY7 G;  1Z9F A;  4NXN L;  3STB D;  4KHP L;  3A5U A;  3EBE A;  4LF9 L;  3CCR A;  4JI0 Q;  3HOY G;  3PO3 G;  2OCE A;  3NEN A;  3EIV A;  3UDX A;  4IPD A;  2XTI A;  3KOJ A;  4R4C A;  4R1J A;  3ULJ A;  5FLM G;  1KIX A;  4A3K H;  1HR0 Q;  2AHO B;  1CSQ A;  1XMQ L;  4DV5 Q;  3PUW A;  4DV1 Q;  4BY1 H;  1OXU A;  4JOI C;  2VQF Q;  2B63 H;  2VY3 A;  2HIV A;  2UUA L;  1M90 C;  1D7Q A;  1X3E A;  2ID0 A;  5AJ3 Q;  4R4I A;  2Y0S E;  4DUZ L;  1O7I A;  3PUX A;  1XNQ L;  5DLQ E;  3HOU G;  1AH9 A;  4YWL A;  3T1H L;  1A8V A;  4P71 A;  3CME A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...