2UUCL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucL00
4IPHA 4GNXC 1OTCA 1QVFA 3PF5A 1T9HA 2ZM6L 3K80C 4DV5L 3BJUA 4DR1L 1KC8C 4X65L 2UU9Q 1N36L 1XNRL 4HJ5A 1Y14B 2NN6G 4UPAA 1OXSC 3J80i 4PZ8A 1VQBA 2D0OA 3M9BA 5IWAQ 2VNUD 2I5LX 4R1JA 2ATWA 5IWAL 4A3DH 1CKNA 1C7YA 3TEHB 1A62A 1U5KA 3TS2A 5IYCG 4A3CH 4X6AH 2MQHA 2CKZB 2JEBI 4L5RC 1KIXA 3CF5A 1HNWQ 3J7ZC 2WB1G 2AWNA 4X62L 1SRUA 2UXCL 4PG3A 5GQOA 3PUYA 2JA7H 1HNWL 1HZCA 2NVTH 1OXXK 4BXXH 1QVGA 2Y0SG 1QUQB 3JC66 1P16A 2K50A 1AE2A 1KAWA 3NEMA 4PZ6A 2N3SA 4FDBA 3J81j 1PH6A 2ZJQA 2ZTEA 4JBMA 1RIPA 1HH2P 3CC4A 1Q1BA 3FKIH 1SLJA 1PVOA 2VL6A 2Z6KC 4DUYL 1E3PA 1SROA 2R92G 1N32L 2WAQG 3AQQA 3FP9A 4DPGA 3J81i 4JBJA 4X64L 4IFDJ 1Z47A 5C3EG 4A3KG 3ULLA 2CFMA 4LFBL 2N78A 2YTXA 1HNXQ 3GTPH 1EUJA 2UUAQ 2JA6H 3DLLA 1P8LA 3CCEA 4BBSG 3AFQA 4A3IH 4JI1Q 2MNAA 1XMQL 2UUAL 2I0QA 3NBHB 1IBLQ 4DR7Q 2D0PA 1EOVA 4GN4B 4PMWA 3HOWG 3TRZA 3PO3H 1Q81C 1KRSA 4HIDA 2ZJRA 3FHWA 4TQUS 4A3FH 1Q12A 2VY3A 1VQCA 4A3GH 4LFCQ 2ES2A 2JA5H 5M5YH 1K8AC 4LF9Q 1XPOA 1LUZA 4JBWA 4O2DA 2K5HA 2PNHA 3PUVA 3CPFA 5IYBH 4JOIC 4LF9L 2F4VQ 4L5QA 3S2HH 2Q2UA 1QZHA 3J80c 2F4VL 1CKMA 5HY6A 4A3CG 1A0IA 5AJ3Q 2HIVA 4R4TA 4PZ7A 4NXML 3GTLH 4IFDI 4K0KQ 1K9MC 2B3GA 1D8LA 1PFSA 3ERSX 1VQGA 4LNQA 2ID0A 4POGA 2JA7G 1X54A 4LUVA 3H3VI 4K0KL 4BXXG 3PO2H 1K0RA 1U0LA 2V1CC 2A19A 2F3IA 3CAMA 1IBKL 4GN5A 3G71A 3HKSA 4JI4Q 1JT8A 4R4QA 1SMXA 1VQ4A 3S1NH 1Q7YC 1L2FA 1XNQQ 2D62A 2RCNA 5LMNQ 3E9HA 2OTLA 3M4PA 4KHPL 4DK3C 3KDFB 1HNZL 4OO1I 4DUZL 1X3EA 4IPDA 1UWVA 3CC2A 2A8VA 2MO0A 3W1BA 2AKWB 4KHZA 4OWWB 1S3OA 5M5XH 4H02A 3CQZH 3A0JA 4WJ3M 2OWOA 3E0EA 1SN8A 4NXNL 1NE3A 3Q8DA 4XIGS 2MFIA 4KLKA 3J81c 3B6YA 4A93H 3S17H 3RZDH 3PIPA 2JA6G 5IP9H 4DV3L 2XTIA 3KF8B 4YY3L 4LF6L 4A3IG 2JE6I 2CQOA 2H5XA 3PO3G 2IHEA 4JI2Q 1KHIA 5JEAG 3KF6A 5JJIA 1VQ8A 3PF4A 4A3FG 2UXDQ 4A3GG 2EXDA 4JI2L 5LMNW 3CD6A 2JA5G 1YJNA 1VQ6A 2NN6I 3JAMc 1L1OB 1GD7A 1GVPA 4A3LH 4A4IA 3IRBA 5FLMG 4GOPC 4C2MH 3K8AA 3RNUA 5IYBG 4A3KH 4JI7Q 3M3YH 2GVAA 4C3JH 3LGJA 4P74A 5GAGC 4HJ9A 3T1YQ 1Y1WH 2VUMG 2IX0A 4LUOA 2PQAA 4X66L 2IT1A 1KD1C 1M90C 3HOVH 2OTJA 1K73C 2VQFL 3HKZG 1PV4A 3M4OH 4GLAC 1VQFA 1FVIA 4IPCA 3WWVA 1NBWA 2Q2TA 1XPRA 2AMCB 3KLWA 1HZBA 2NVXH 3CMAA 1KL9A 1W3SA 4EX5A 1UE6A 3PO2G 1TWCH 1VS0A 1E22A 2HIXA 4UP8A 4HJ8A 4DAMA 2UU9L 4AIMA 1TWFH 3U50C 1S40A 1BVSA 4DV2Q 5EAYA 3KFUA 4A3EG 2I5MX 4B3TQ 2BH2A 4LWCA 3S14H 4LW1A 4DV2L 4B3TL 4YCVA 2R7DA 4GLVB 4DR4Q 1I50H 2Q2IA 3CCJA 3ULPA 1Q8KA 5ELNA 1ASYA 4UP9A 4DV7Q 3I2ZA 4JV5Q 4A93G 3CPWA 2YV5A 3U4ZA 2AWOA 5IP9G 2OQ0A 4DV7L 1UE7A 2ZTCA 1AE3A 1SFOH 2RF4A 5HGQA 2N8NA 2JA9A 3T1HQ 2LSSA 3UDGA 2EIFA 3OW2A 3BZCA 4JI0Q 3EIVA 4DNIA 3I56A 1VCIA 5GROA 4A3JH 3ULJA 4JI0L 3S2DH 3KJPA 1E1TA 3TQYA 4A75A 1N33Q 2ASBA 4A3LG 4A76A 1Q82C 3U58A 4C3IH 4JC0A 3F2BA 1Y1WG 1DGSA 1PH9A 1N33L 4MTNA 3RLNA 3HOVG 1C9OA 2JJQA 4IJLA 2Y0SE 4GOPB 1YI2A 1R9TH 1QZGA 1HNXL 1YITA 4DR3Q 2K5VA 3GTJH 3M85A 4DV1Q 1L1OC 1YNXA 2KENA 1TWHH 2KHJA 4DAYB 4JI1L 3ICEA 2KCTA 4NPSA 1YVCA 4DR3L 1N34Q 1IBLL 1VQAA 3BU2A 2VZAA 5JEAJ 4DR7L 1C0AA 1X65A 4JI8Q 3CCLA 4MNOA 4O0AA 3CMEA 3CCSA 2WAQE 1N34L 1ASZA 5FLMH 4LFCL 1VQ7A 4JI8L 3ER0A 2Z0SA 1YHQA 1QVCA 4XTCS 3I7FA 1X3GA 3NENA 3K7UC 4YHHQ 3PUWA 3STBC 1PH7A 1J5EQ 2FXQA 2DGYA 4AQYQ 3W5OA 4DK6C 2BA1A 3MEFA 4YHHL 1HZ9A 2R7FA 2XGTA 5FLXc 3F8TA 5AJ3L 3H15A 2RHQB 1S72A 1J5EL 2CCZA 1XPUA 4JI3Q 5JJLA 3F1ZA 1BKBA 3UDXA 1PA6A 4AYBG 4LF8Q 2LXJA 4JI3L 2PMZE 4WJ4A 1K83H 1Q86C 1RL2A 2K52A 3CCQA 4JI4L 2K75A 2KBNA 4EQ5A 4LF8L 4DR6Q 3CW2C 3D0FA 5JJKA 1B8AA 4A3EH 3EBEA 5LMNL 1XNQL 1M1KC 4A3JG 4GNXA 1EQQA 1VQNA 4POFA 1GO3E 1NY4A 4R4CA 3NELA 5K36G 1TXYA 4DR2Q 3KOJA 2OQKA 4P71A 1CSPA 4A3MG 1EFWA 2Q2HA 4GKKQ 1X56A 4DR2L 3KF6B 2JA8H 5IYDH 2B63H 2KCMA 3RR5A 1UEBA 2UUCQ 4JI6Q 2E2HH 4LF4Q 2RHSB 2R7ZH 2NZHA 1L0WA 4GN3B 5DLQE 2UUCL 4JI6L 1X9NA 4LF4L 3KJOA 1PH3A 4YCUA 2K5NA 2A1AA 4C3HH 2PQAB 5M5WH 1N9WA 3KDFA 4LF7Q 4BA1I 2UXDL 4NB3A 1WJJA 3PV0A 1X3FA 3UE1A 1PYBA 4AH6A 5IE8A 1FJGQ 2UXBQ 2GVBA 1FL0A 5M3FH 4JI7L 1IL2A 1I3QH 1KXLA 4JYAQ 2BH8A 1GKHA 3MXNB 3GTQH 3T1YL 3RLFA 2Z6KA 1V43A 1WOCA 4OXPA 1MKHA 3EN2A 5M3MH 1JJGA 4KI0A 4R4OA 3I4MH 5H1SE 3CCRA 3RN2A 1HR0W 2YTYA 2E2JH 3A74A 2NZOA 1CKNB 1A63A 4B3SQ 3A5UA 3GO5A 1Q1EA 1SE8A 4ALPA 2R6GA 4LF5Q 1E7ZA 2F52A 3PCOB 3L0OA 1H95A 1OXTA 3PUZA 4IOAA 3G48A 1AH9A 5C4XH 2WFWA 1LM0A 1WCMH 4DKAC 2OCEA 4YWLA 1PH2A 4LF5L 4GKJQ 5J3BA 3GTGH 1VQDA 5IT9c 2KHIA 1A8VA 4QJFA 4J15A 3CC7A 4DR1Q 4TVAB 2ZM6Q 1YHAA 4P73A 3F2CA 4IJHA 1N36Q 1XNRQ 1Q46A 3G6EA 3S24A 4JCVE 2L15A 4RMFA 4DR4L 4JOIA 2JA8G 5IYDG 2CWAA 2B63G 2IX1A 5C0XG 4JI5Q 4JV5L 4OONA 2R7ZG 1JB7A 1X6OA 1VQOA 1VQMA 1LYLA 4LUZA 2WP8J 4JI5L 1VQKA 1JJCB 2VUMH 1G291 3PIOA 4HJ7A 4BY7H 1I6HH 4X62Q 4P75A 3T1HL 1BBUA 2UXCQ 4QIWE 2YU9H 3AYHB 3H0GH 1Y1VH 3K7AH 3U4VA 1I5FA 1NMFA 4HIOA 1PH4A 2JEAI 1WI5A 2BA0A 3STBD 2WB1E 3CCVA 1YJWA 1VQ5A 1IBMQ 4A3MH 3HOYG 5M3FG 3AEVA 4A3BH 2UUBQ 1B7YB 1TWGH 1VQLA 4L5SA 3PUXA 3VDYA 2HT1A 3M7NA 2C35B 3KYHC 1IBML 3HOZH 2UUBL 2PI2A 5GAEC 2R93H 3PGZA 3CCMA 5E7NA 4IOCA 2VW9A 3BZKA 5M3MG 4DUYQ 1EWIA 2N49A 2YTVA 4JG2A 3I4MG 1N32Q 2ZTDA 1QUQA 3F2DA 4DV0Q 1MIUA 4BBRH 3M4QA 4DV1L 1SR3A 3L7ZC 4X64Q 1NMGA 4JBKA 3GTOH 4BA2I 2HHHQ 4DV0L 3HOUG 1XTDA 5IY0A 3TREA 4LFBQ 1TWAH 1VQHA 4QY7A 2HHHL 3UE0A 3H3VH 5C4XG 1WCMG 3L2PA 1PHJA 2MO1A 4OWXB 1HZAA 1XMQQ 1IYJB 1EQRA 5C44H 4IO9A 1NTGA 4ME3A 2DUDA 1E1OA 1E24A 3JAMi 2JQOA 3RLOA 2GN5A 2B29A 5C4JH 3I55A 4DR5Q 5FJ8H 2LXKA 1YZ6A 3K0XA 3HOXH 4HIMA 4GOPA 4AQYL 1IZ6A 2I5HA 2JK8A 3CP0A 4OX9Q 4DR5L 3RN5A 2CWPA 3GDEA 2IY5B 1EIYB 1EYGA 5ELOA 4GNXB 1W2BA 4OX9L 1JE5A 2E8GA 2ZJPA 3GTKH 1WFQA 1V9PA 1MJEA 4LFAQ 4A3DG 4B3RQ 3I4NH 1CUKA 3AFPA 5IP7H 4NXMQ 1Z9FA 1G51A 1CSQA 4GLXA 4BY1H 4DV4Q 1VQPA 3UDIA 3S1MH 4BY7G 4DR6L 5GADC 4LFAL 1UE1A 4IPGA 2E5LQ 4L5TA 4B3RL 1I94Q 3H0GG 3RZOH 1Y1VG 2HQLA 4DV4L 4HJAA 1HJPA 3I4OA 3S15H 1B70B 2E5LL 4UY8C 1IBKQ 1I94L 1G6PA 4APVA 3OTOQ 4A3BG 1NJIC 2VS1A 1PYSB 2EQSA 2YYZA 3A5ZB 1HR0Q 4KHPQ 4RG1A 1HNZQ 4QGUA 1VQ9A 3HOZG 4DUZQ 2PI2E 3OTOL 4GKKL 4AYBE 2R93G 5C0XJ 1HR0L 2NVYH 3DM3A 3FKIG 1X55A 1KQSA 1YEZA 1OXUA 4BBRG 4DV6Q 5IYCH 1PH1A 4YWKA 2QEXA 4Y52H 4IFDG 4Y7NH 4NXNQ 4DV6L 1JMCA 1BBWA 2K14A 3K81C 1LTLA 4DV3Q 4LF7L 3HOYH 2K4KA 1YJ9A 1N8RC 4YY3Q 1K8GA 4LF6Q 2NVQH 3E9IA 5C44G 1PH8A 1GM5A 4HIKA 1YHBA 1YBYA 4GS3A 4R4IA 1FJGL 1OXVA 2UXBL 5GAHC 1D7QA 4QL5A 4MZ9A 2QGQA 3W1GA 3S1QH 3S16H 4JYAL 2VQEQ 3S1RH 4OO1G 3GD7A 4UP7A 3CCUA 3OYYA 4YCWA 1XMOQ 1K3RA 2IHFA 5FJ8G 3HOXG 4QQBX 1VQEA 1EIFA 3UDFA 3SGIA 4OWTB 2VQEL 2E2IH 1UE5A 1VQJA 2R92H 1XMOL 4B3MQ 3CXCA 5BR8Q 3TS0A 1PH5A 1JJ2A 5C0XI 1O7IA 5LMUQ 3HOUH 4YWMA 1IXRA 4B3SL 1V1QA 1J6QA 4B3ML 1FGUA 4X66Q 5BR8L 5C3EH 3ZJYC 5LMUL 2VQFQ 3J7A5 1XJVA 2QA4A 2AHOB 3GTMH 2ALYB 5IP7G 1KRTA 3I4NG 3PSIA 1YIJA 4BY1G 1VQIA 1L1OA 1WYDA 4P72A 3D31A 1CKOA 4BBSH 3HFZB 4GKJL 3HKZE 4DV5Q 1MJCA 3G4SA 4X65Q 3HOWH
chains in the Genus database with same CATH superfamily
3H94A 1T9HA 4DR1L 3EVQA 1N36L 1XNRL 5D3IB 2D9UA 1DZ1A 4MIUA 2VNUD 1QG7A 5DM63 2M00A 4PMCA 5EKKA 1D6EC 1DONA 4CDFC 1I50B 4A3CH 5IT9E 1BUVT 1HNWQ 1LT3D 3CF5A 4X62L 4M8AA 4PQXA 1SRUA 5GQOA 4AYBB 1CTMA 2NVTH 4BXXH 1QVGA 2F0FA 3JC66 1FNUA 2K50A 4DK1A 1AE2A 3J81j 4FDBA 2G9DA 1SYDA 2ZTEA 1RIPA 1Q1BA 3FKIH 4IUVA 2VL6A 2HDLA 2PNRC 4ZKCB 3AQQA 1Z6HA 4X64L 2JA6B 1Z47A 5C3EG 1R9TB 1B1ZA 2B2UC 5CV7A 1EZ8A 4QUCA 1B53A 3T56B 3K6OA 4BBSG 3AFQA 1EYCA 4ULLA 2MNAA 3TZUA 1XMQL 4A3FB 4DR7Q 3RD4A 2D0PA 1EOVA 4PMWA 1DJRD 2WKCA 1KRSA 4HIDA 2BCOA 3FHWA 1Q81C 4X3KA 3KUPA 1JE4A 2Z4IA 2JA5H 4QCLA 1LUZA 4JBWA 5KYIA 2K5HA 3M7GA 3PUVA 4JOIC 4ZUJA 4LF9L 2CW0D 4L5QA 4IUTA 3J80c 3EROA 4PZ7A 4K0KQ 1D8LA 3VYUA 2XN9C 5EPKA 2RSNA 4ID6A 1K0RA 1U0LA 2V1CC 2F3IA 4GN5A 3G71A 3P7JA 1VQ4A 1LO5D 2JN4A 3SDZA 2D62A 2PW5A 3DXJC 2OTLA 5J1ZA 4DK3C 1FNVA 1JCKB 4ZLTF 4OWWB 1S3OA 5EBDA 2KEEA 4RHSA 2JA8B 3RZDB 2B63B 2MPMA 1NE3A 4XIGS 2MFIA 1D5MC 2EYJA 3J81c 4A93H 2O5JC 3S17H 4O42A 1H9SA 1I6VC 3D4DA 2JA6G 1KNAA 1LTSD 1Q3LA 2OEOA 2H5XA 2QCPX 5IOCA 3PO3G 5M5WB 3KF6A 1UEAB 2B8GA 3PF4A 4A3FG 1BOSA 4C2MB 4A3GG 2EXDA 4JI2L 3CD6A 1HCZA 4N9PA 2O5IC 3Q24A 1V1OA 1GD7A 4A3LH 1TS2A 3M4OH 5FLMG 3M3YH 5IYBG 1JB3A 4C3JH 3GTQB 3LGJA 5NUCA 2A68D 3T1YQ 2IX0A 3K5OA 1VQFA 2Q2TA 4DF7A 3J7AV 1TR5A 1LTTD 1JC7A 1W3SA 1YNND 1EY7A 1UE6A 3MXNA 1JWMD 1VS0A 1BNZA 1D1IA 2UU9L 4AIMA 1V8QA 3KFUA 4WFN3 2BH2A 2NBFA 2PCFB 2ZT9C 3JAML 2EJMA 4B3TL 1ILPA 4YCVA 3GP7A 2SNSA 3E6ZX 2O4XA 4DR4Q 1I50H 3VA7A 4J1MA 3ULPA 4DXFA 3L3OC 3HG9A 1A3UA 1AW7A 1FNWA 3U4ZA 1NSNS 2RCFA 2OQ0A 2VUMB 5BN3A 3I91A 2JA9A 3HGBA 3K7AB 3OW2A 3I56A 5GROA 4V190 3BVGA 3OMCA 3ULJA 3KLRA 5LL6X 5K36H 1E1TA 2F0MA 3QIAA 3F2BA 3RLNA 1PZID 3HOVG 3D3RA 1R9TH 4DA2A 1WTRA 2F0JA 3MFGA 1EL0A 3Q6SA 1YITA 3M85A 2B2WC 2ZXRA 4DV1Q 4DAYB 1C8CA 2KENA 1I4HA 1HQRD 1AZPA 3EFXD 4NPSA 4RCNA 4DR3L 1HUMA 1C0AA 3CCLA 4MNOA 3CMEA 3CCSA 2WAQE 5FLMH 1VQ7A 2B2TA 4JI8L 4K5XA 2SOBA 1QVCA 3IFDA 3AU7A 1A3TA 3IFTA 4WRDA 3K7UC 4NMZA 4YHHQ 4S3SA 2PW7A 1PH7A 2DGYA 2FHTA 1SJHD 1RODA 4HSVA 3I72A 5JAVA 2CCZA 1K83B 1HTPA 5ELCA 1BKBA 5I6WA 2LXJA 4WJ4A 1RL2A 4JI4L 3S1MB 3L9AX 2A6ED 2K75A 2KBNA 4EQ5A 4LF8L 3CW2C 4RCOA 2CVRA 1XNQL 1M1KC 1M4VA 1K0SA 4GNXA 1VQNA 1NY4A 2KQ3A 1TXYA 4HR7B 1S5FD 2CH4A 1C48A 1EFWA 1GXDC 1XWEA 1HFNA 4DR2L 1KTKA 3H6MA 2JA8H 2B63H 5ELDA 5C0XH 4CDDC 2I46A 2NZHA 5DLQE 1LTBD 4JI6L 5F2DA 1PH3A 2K5NA 1GUNA 2XRSD 5M5WH 1KDBA 4LF7Q 2UXDL 4QB4A 1SXTA 4NB3A 1WJJA 1EYDA 1NCVA 3UE1A 1PYBA 5IE8A 5D65A 2GVBA 4KY6A 4EVOA 2H4OA 3S1QB 1QE6A 3S16B 1SJED 3GTQH 2Z6KA 3H3VC 1JJGA 4KI0A 2D5DA 4ZRZA 1SMYC 1I4GA 2KUMA 4B3SQ 3LX0A 2QKIC 4KJOA 3GTMB 2R6GA 1E7ZA 1AH9A 1LM0A 1WCMH 2OCEA 3R3OA 1U4RA 4J8QA 4GKJQ 1VQDA 3DHQA 3CC7A 4J15A 1T5XD 4DR1Q 4TVAB 3TP8A 2F3WA 1BBXC 1N36Q 1XNRQ 1Q46A 3G6EA 4KV6A 5IYDG 1I4RA 2A6HC 3QJYA 4E6IA 1JB7A 3T53B 1GOZA 1LYLA 5CMDA 2VUMH 1NNXA 3O13A 1IYVA 4X62Q 4OL7A 1WTVA 4B08A 4C3HG 3H0GH 3K7AH 3U4VA 2R3ZA 3STBD 2L12A 3AEVA 4A3BH 1LV9A 2UUBQ 4OGQC 3SK5A 2HT1A 3M7NA 2C35B 1IBML 1TKWB 5GAEC 4CHTB 3PGZA 3CCMA 4IOCA 1SNCA 3BZKA 3A8KE 4DK0A 1EWIA 1QILA 3F2DA 4KKUA 4X64Q 3SK4A 2QF7A 1PHJA 2MO1A 4R9WA 1XMQQ 4IO9A 1NTGA 1BCPF 1CQFA 5C4JB 2J0TD 2KHSA 5LL6S 2GN5A 5M5YB 1IW7C 1LTAD 2LXKA 1AN8A 4GOPA 4AQYL 2I5HA 2IX3A 1XTCD 2IY5B 5KRUA 3NBHA 4Q5VA 4XQNA 1RTOA 1V9PA 3E0JA 3I3CA 1ET9A 4H7BA 3GTLB 1M8AA 5IP7H 2QDLA 5HURA 2D2CC 4K6LA 3S1MH 4OHJA 4B3RL 1BQQT 2QDBA 1Y1VG 2FMMA 1EY6A 1JWSD 1JR0D 2PZUA 3BDOA 1B70B 2E5LL 4UY8C 5CORA 4APVA 1CHPD 4ZQ3A 3OTOQ 2YYZA 2KA7A 2NVYB 3A5ZB 1HR0Q 2NN6H 4QGUA 3I8ZA 3HOZG 2A69C 4XXEA 2CQAA 4AYBE 3NBIA 5C4HA 4QIWB 5I2YA 3FPUB 2F0LA 1S5CD 2WB1B 3CQZB 1ZXTA 4DV6Q 4YWKA 2QEXA 1BCPC 1XX8A 2F0NA 2EZVA 2KECA 1N8RC 3MA2B 1K8GA 3E9IA 5E1FA 1GHJA 2B2TC 4R4IA 4X3TA 1OXVA 2N55A 4QL5A 4MZ9A 2QGQA 3BG3A 3S1QH 3S16H 3V05A 2VQEQ 1SNMA 5EJWA 4DAPA 4XT1B 2WACA 4CKEA 1AFPA 2IHFA 5FJ8G 3IKJA 1VQEA 4PV1C 3UDFA 1U4PA 1A6XA 1UE5A 1VQJA 4ZCKA 4ZAIA 1WTOA 3CXCA 4YWMA 3QB3A 4B3ML 5BR8L 5LMUL 2F0OA 1XJVA 3GTMH 1CT1D 1KRTA 1YIJA 4BY1G 3X3MA 4RGMA 1VQIA 1L1OA 1MI2A 3D31A 2NVXB 1HRJA 3A56A 3G4SA 4X65Q 1EZ6A 5EBCA 4IPHA 4GNXC 2ZM6L 4DV5L 2UU9Q 2Q8IB 1CA6A 4FVMA 2RVLA 2BOSA 2XWBB 4UPAA 1OXSC 3J80i 1VQBA 2D0OA 1V1PA 2I5LX 2PZWA 2ATWA 4U673 5IWAL 1C7YA 3N6RA 1FGBD 1U5KA 3TS2A 3ERQA 4X6AH 2EOTA 4L5RC 1KIXA 2QEJC 3TZDA 4OIJA 1RHPA 2AWNA 2WB1G 3J7ZC 2UXCL 4PG3A 2EY2A 2Z4HA 1H9RA 1QUQB 1RF2D 2GA4B 3DWPA 3NE5B 1SFOB 1P16A 1RDPD 1KAWA 3NEMA 4PZ6A 4NKLA 4JBMA 1HH2P 3CC4A 1PFMA 2XVSA 1PVOA 5ELFA 2Z6KC 1E3PA 1SROA 5CV8A 1N32L 2WAQG 4DPGA 3V2TA 3J81i 2AQ1B 3ULLA 1A3VA 3DUZA 2UUAQ 3AMUA 3SK8A 1P8LA 5IIFA 4EGVA 4A3IH 1EY9A 4GN4B 4N8FA 2J4XA 4TQUS 3MXGA 2ES2A 5M5YH 1K8AC 4O2DA 2PNHA 1B50A 3K5NA 1SAPA 1A2TA 2LY7A 2OF1A 3HKZB 5J22A 3CU7A 3S2HH 5D14A 3FEWX 2F4VL 2FFKB 5HY6A 4A3CG 1A0IA 4R4TA 4NXML 3GTLH 5G3LD 1PFSA 1F9RA 4MHEA 4LNQA 1PTOF 4QUFA 3I4LA 4BXXG 4JI4Q 1JT8A 2WKDA 3NK9A 1SMXA 5DNFA 3M4YA 1XNQQ 3M4PA 4DUZL 1X3EA 2M2LA 4IPDA 1UWVA 3CC2A 4ILWA 2MO0A 3W1BA 4H02A 3CQZH 1B44D 3S17B 3E0EA 1STYA 1YNJD 2E2HB 3B6YA 3J80L 3T51B 3PIPA 4YY3L 1Y8NB 2CQOA 2F0PA 1KHIA 5JJIA 3I73A 3M4OB 2UXDQ 2OT2A 2JA5G 1YJNA 1GVPA 1HFGA 4KMUC 4GOPC 4L63B 3RNUA 4HN7A 1Y1WH 4P74A 1DXMA 4LUOA 1PTOC 2PQAA 1KD1C 2DJGC 2K1BA 3HKZG 1W6KA 5KGUA 3OHXC 5DAUA 1J9OA 2HQEA 3K57A 2EXZA 3KLWA 1HZBA 2ICEC 2NVXH 3CMAA 1KL9A 1DOLA 1F77A 3J81L 2KEDA 1TWCH 5C4XB 1Z7TA 1LTRD 1B4OA 2HIXA 1E2WA 1TWFH 1BVSA 4DV2Q 5C6AA 5EAYA 2I5MX 1TIID 3S14H 3QO2A 4LW1A 3BVZA 3R2IA 5ISRA 5C5LA 1BO0A 2HD3A 1Q8KA 2BE5C 4RA8A 5ELNA 5CC4A 4A93G 2F0KA 3K0YA 2YV5A 2AWOA 4DV7L 2ZTCA 1B3AA 1AE3A 1E0BA 1SFOH 5HGQA 2N8NA 1MD2D 2EIFA 3QWNA 4JI0Q 4K2KA 1VCIA 2CHBD 1D5XC 4JVZA 3Q23A 4A3LG 1N33Q 2LKVA 1KNEA 4A76A 2X6LA 4C3JG 3U58A 4C3IH 3E3XA 1LACA 1PH9A 5JVG3 4K14A 2A74C 2JJQA 2C9OA 1YI2A 3D6WA 1QZGA 1L1OC 2KHJA 4JI1L 2L0CA 1YVCA 1IBLL 1N34Q 1VQAA 1TWAB 2VZAA 1X65A 2AQ2B 5T1GA 3H09A 3ER0A 3HP3A 1VF7A 3NENA 3IAYA 4G7HC 1J5EQ 3HOXB 2AUKA 4AQYQ 4DK6C 5FLXc 2R7FA 3H15A 3VR5A 4IUUA 4JI3Q 2NB0A 2F0QA 1DCZA 3F1ZA 3UDXA 1PA6A 4AYBG 5IGDA 3P75A 1QNKA 3A55A 1JQYD 1U4LA 4OELB 3U9OA 5I9PA 3IL8A 5FOBB 3OIPA 5I4DA 1GO3E 1H9SB 5K36G 2VB3X 2OQKA 2Q2HA 2Z6BA 3KF6B 4IUNA 5A2QE 1EIHA 2SDFA 5HGTA 2UUCQ 2E2HH 2R7ZH 3RUZA 4IN3A 4CKBA 1IYUA 4Y7NB 4LF4L 4GZYC 5A2QL 4KHVA 2Y0SB 1PRTF 4BA1I 2NVQB 1LT6D 1GUSA 1WTHA 4AH6A 2OXPA 1JICA 4FXKC 1KXLA 2MHVA 3MXNB 3GV6A 4OXPA 2R92B 4R4OA 3I4MH 4K8JA 4L6TB 2RDGA 5C3XA 1ESRA 2NWGA 1CKNB 3A5UA 3GO5A 1WCMB 1XYIA 3JAME 1SE2A 3KBGA 3PUZA 1F9SA 2WFWA 1DM0B 5C4XH 1HUNA 4LF5L 4YWLA 5J3BA 3GTGB 4UHVA 4UAIA 5IT9c 1W6JA 2ZM6Q 1YHAA 4P73A 4HEDA 4IJHA 2PMZB 4WJWA 3F2CA 4H44C 4JCVE 4RMFA 3W2DA 2JA8G 1AP0A 4M1UB 1RJTA 2B63G 4A3DB 5EQ0A 5C0XG 4JI5Q 3CHBD 1CQVA 1VQMA 2JP1A 3GV3A 4LUZA 1PRTC 3H0GB 1VQKA 1DYQA 3T1HL 1D5ZC 5FKAC 2UXCQ 4QIWE 2Q8RE 3AYHB 2YU9H 1I5FA 4HIOA 4A3BB 2K01A 1WI5A 2BA0A 3SEBA 2WB1E 1G8ZD 2FMCA 3C1FA 1ZEQX 1BCPB 2F0DA 3MEHA 4KN7C 2KVMA 2R93H 2N49A 1N32Q 1IHZA 2RKSA 4DV0Q 3L7ZC 4JBKA 1NMGA 1WD1A 2HHHQ 4IFDH 4F7XA 1XTDA 3A7LA 5IY0A 1EEID 1TWAH 4QY7A 3UE0A 1LT5D 3H3VH 4OEMB 1WCMG 4CDEC 4XQJA 1IYJB 1EQRA 5I9OA 1ZYRD 3QR8A 4OO1H 2B29A 3SHLA 4HIMA 3HOXH 4DR5L 3RN5A 1EIYB 1EYAA 5ELOA 1G91A 4GNXB 4DAYA 4OX9L 1JE5A 2E8GA 5EKIA 3GTKH 4A3DG 3I4NH 1CUKA 4NXMQ 2VUMG 1Z9FA 1G51A 4GLXA 3A8JE 1O7YA 4DV4Q 2X69A 4DR6L 5GADC 4LFAL 4IPGA 4LAAA 4L5TA 3NQIA 3H0GG 3WOEA 2HQLA 3PO2B 1SNOA 4HJAA 4F87A 1I94L 2F3VA 1EY8A 2LFNA 4A3BG 2A5HA 1EQVA 1I4XA 3SE0A 1VQ9A 4DUZQ 2PI2E 1FR3A 4GKKL 5C0XJ 1B9NA 2F0GA 1X55A 1STBA 5IYCH 1JORA 4K2LA 4Y52H 4Y7NH 2CW0C 3MVVA 1JMCA 1WTPA 1F2YA 4YY3Q 2NVQH 3PMFA 2UXBL 1YHBA 1R4PB 3S1RH 3GD7A 1TS4A 1TVXA 3CCUA 2DNEA 1EIFA 5LHY1 2R92H 4IURA 3KF8A 4A3KB 1XMOL 3TS0A 3K5MA 1PH5A 5C0XI 1O7IA 2WIIB 2IPKD 3ND8A 3ZJYC 3J7A5 3VYTA 2AHOB 2ALYB 5IP7G 3DEPA 2ENBA 3C1EA 1STHA 4CKCA 1CKOA 3HFZB 4KD4A 3HKZE 3DMUA 4A75A 3GTGH 2IWHA 3HOWH 1QVFA 3BJUA 1KC8C 4HJ5A 2NN6G 2VXWA 4PZ8A 5FK9C 4DGZA 4K5WA 2VB2X 4A3DH 2DNCA 5KIXA 4NDXA 4FNFA 3I90A 3QG1A 2CKZB 2JEBI 1LT4D 1SBBB 2A68C 1EU3A 2JA7H 3PUYA 3A7AB 4RKBA 1HNWL 1HZCA 1PZKD 1OXXK 2F0WA 4CGYB 3SR1A 1IL8A 4KD3A 5KEEA 1SYCA 1YNNC 3D8GA 4A3JB 3K58A 4HTHA 1SLJA 1ILQA 4DUYL 3FP9A 5AFWA 1SYFA 5IODA 1JOQA 3G6JB 1I4PA 4A3KG 1EFID 4IUPA 4A3IB 2CFMA 2N78A 1F2ZA 2YTXA 1EUJA 3GTJB 4JW0A 2SNMA 2QW7A 4JI1Q 2I0QA 3NBHB 1IBLQ 1S5DD 1ENCA 3TRZA 1PTOB 5JEAH 2ZJRA 2HDMA 2DJFC 1L0XB 1SSOA 1SE3A 1MSGA 1EU4A 1VQCA 2VY3A 3BZDB 3FDTA 4LF9Q 4FF1A 3S2HB 1C4QA 3TP6A 4O1NA 3K5LA 5DM73 5C5MA 1VMPA 5CV5A 2Q2UA 1QZHA 2L1BA 1CZGA 1CKMA 3KBXA 4I7ZC 4Q0FA 2HIVA 2HUGA 4NP5A 1E2VA 1F9QA 2B3GA 3ERSX 2DY7A 4N9TA 2ID0A 1X54A 4K0KL 3PO2H 2EY5A 1HHVA 1IBKL 3NQTA 4R4QA 5JOBA 1L2FA 2RCNA 2P5ZX 4KHPL 3KDFB 1HNZL 1Y69U 3CKIB 4I7AA 3LWUA 4K8IA 1MHWC 2AKWB 2M9VA 4KHZA 5M5XH 5M9OA 2LMCB 4U68A 3QOLA 3A0JA 4WJ3M 2K5QA 2OWOA 1HQMC 2RSOA 2EE1A 5IP9H 5KNCA 2XTIA 1DOKA 1VDZA 4A3IG 4DU9A 2IHEA 3GQBA 3HS0C 4JI2Q 4C1NI 1PFNA 2EYOA 4BWGB 4P2CB 3BDCA 2XRQD 5LMNW 1Y1WB 1VQ6A 2NN6I 3KK7A 1G6ZA 2A6EC 1L1OB 5M3FB 5CBEE 3MAQA 4A3KH 2GVAA 4HJ9A 3NWTA 1K73C 3SVMA 2VQFL 4GLAC 2K03A 1G2TA 4IPCA 1NBWA 1TWCB 4ME5A 4Z9CB 2AMCB 1XPRA 2WV6D 4EX5A 1TWFB 1E22A 1MSHA 1TQOA 4UP8A 4FO2A 4HJ8A 4EQNA 4ABNA 3S14B 2PZTA 1S5ED 3ONAB 2PO4A 5BN5A 4B3TQ 4K5VA 4LWCA 1KAAA 1DOMA 2TMPA 4LMQD 4HMJA 3OOCA 3NXWA 5L37A 2R7DA 4GLVB 1BDOA 2Q2IA 3CCJA 3T13A 1K8OA 3C3LA 3I2ZA 4KY7A 2EJFC 3D6CA 1F2LA 3CPWA 1EOTA 3VR4A 3SK6A 2RF4A 3T1HQ 4ZKBB 4H13C 3UDGA 3TBIB 4DNIA 4A3JH 1GUWA 4C3IB 1CHQD 3U9SA 4A3MB 2O2LD 3S2DH 1D1KA 1Y1WG 2L9HA 1DGSA 4FYDA 1C9OA 2Y0SE 1HNXL 4BBRB 4DR3Q 3GTJH 3GTOB 1GUOA 2KCTA 2CH4W 3BU2A 1K8MA 1PTOH 4JI8Q 1JWUD 3LWEA 4ZK9B 4LFCL 5C44B 2F0SA 1YHQA 3FMCA 3EQLC 3NTHA 3I7FA 1X3GA 3OIQA 3STBC 4DNTB 2BA1A 1Q90A 4YHHL 5AJ3L 4IZ8A 2XGTA 3WOFA 1XPUA 1FYCA 1MBYA 2LS01 2PYKA 3P1HA 4F88A 2PQEA 2K5DA 3SXHA 1B9MA 4LF8Q 4DFAA 2K5WA 2PMZE 1LTGD 2G5DA 4DR6Q 3D0FA 5JJKA 1B8AA 3EBEA 5LMNL 4K6DA 3J80E 1WD0A 2NYZD 2B39A 4QF4A 1PRTB 3NELA 4DR2Q 3KOJA 4C3IG 4P71A 1CSPA 4A3MG 2R7ZB 1Y8PB 1STGA 5E4WC 4XQQA 4GKKQ 3VR3A 2XNAC 1AEXA 2RA4A 4JI6Q 2RHSB 5E3FA 5DEHA 2RDHA 5FLXL 1SYBA 3KJOA 3OW7A 4YCUA 2A1AA 3I70A 2PQAB 2PPBC 2B2YA 3HOYB 5T1IA 3PV0A 4BS9A 3HZXA 4ZYSA 2UXBQ 5M3FH 1FL0A 1SYGA 4JI7L 3J81E 1I3QH 4G7OC 1VF5C 2BH8A 1GKHA 3I4MB 1FD7D 3RLFA 1V43A 4MN3A 3EN2A 5M3MH 3NHHA 3MXUA 2EJGC 2Q8TA 3C46A 3HOUB 1HR0W 2YTYA 3A74A 3R93A 3W3AA 5C3EB 1Q1EA 4ALPA 2K32A 3NWSA 2ICIA 4JK1C 1H95A 1OXTA 4IOAA 3BYYB 2E76C 3PIO3 3OPOA 1PH2A 1ONLA 4X3UA 3BS1A 3TP5A 4N8X1 3MWYW 2KHIA 1A8VA 4QJFA 4TKOB 4C1NK 4X3SA 2F0HA 4FP5D 1WTWA 3NP8A 2TSSA 1H9MA 2L15A 2B2VA 2K6AA 1STEA 2SEBD 4JV5L 1HA5A 4KY5A 2R7ZG 3VR2A 1SNDA 1X6OA 1VQOA 2E2DC 1HPCA 2WP8J 2YU9B 1GJXA 1JJCB 3PIOA 4HJ7A 3C2PA 4BY7H 3LNNA 3MHBA 1EY4A 4P75A 1BBUA 1PFBA 5CGKA 2JEAI 1ET6A 1YJWA 4G4KA 1VQ5A 1IBMQ 4A3MH 1EIGA 3HOYG 2R93B 1B7YB 1TWGH 1VQLA 4L5SA 3PUXA 5EPLA 5IT9L 3KYHC 2NZ1D 2Z1CA 4WORA 1K3BC 5JVH3 2UUBL 2QILA 5E7NA 4DUYQ 4JG2A 2YTVA 3I4MG 3KLSX 2F0UA 3A54A 2EY6A 2XIWA 1MIUA 1NR2A 4BBRH 5IGEA 3M4QA 1SR3A 3GTOH 4G57A 3HOUG 4HAEA 3GTPB 3TREA 1GHKA 4FXDA 1VQHA 5C4XG 1IKMA 4OWXB 2A73B 2DN8A 1HZAA 4ZUIA 1PDQA 5C44H 4ME3A 3PO3B 4CJ1B 2DUDA 3EA6A 1E1OA 4A3GB 3JAMi 2JQOA 3RLOA 2X6GA 3I55A 5G3LF 3K0XA 1KDCA 3KLSA 2JK8A 3CP0A 3GTKB 2CWPA 3GDEA 1BXTA 3I4NB 2MUYA 1W2BA 3P20A 4QMGA 2ZJPA 2F0EA 1UUPA 1WFQA 2KJXA 3X3NA 4B3RQ 4LK1C 1CSQA 2E5LQ 1EWHA 2EDGA 3S15H 3K59A 4DN4M 1IBKQ 2HCCA 3S1NB 4RKLA 1G6PA 1J8IA 1NJIC 2VS1A 1PYSB 2EQSA 4KHPQ 1SMYD 4RG1A 1AZQA 1HNZQ 3BVMA 4PNYA 3OTOL 2R93G 1SEBD 1HR0L 1RKNA 3DEOA 2RQXA 1GUGA 1YEZA 3S9WA 4IFDG 1RD9D 4DV6L 1CA5A 1BBWA 2K14A 2EYHA 4FXGC 1LTLA 4RH6A 2K28A 1KLUD 3HOYH 2K4KA 1ICWA 3BDLA 2JSOA 3S1RB 1PH8A 1GM5A 4HIKA 1FJGL 2C5CA 2EPBA 2FJ2A 2A6HD 1BF4A 1VMCA 1ENFA 5EKLA 4JYAL 4UP7A 4OO1G 3OYYA 3HOXG 2VQEL 2E2IH 2L5TA 4B3MQ 5BR8Q 1E2ZA 3T16A 5LMUQ 3HOUH 1J6QA 3HOVB 1FGUA 5C3EH 2VQFQ 3I4NG 2QA4A 3Q0AA 2EYLA 3UI2A 3HOWB 5BN4A 2F03A 4BBSH 1TT2A 4DV5Q 1MJCA 4KTAA 1YNJC 4RWSC 1OTCA 3PF5A 3K80C 5CR3A 4X65L 1Y14B 5IWAQ 3M9BA 4R1JA 2ZXOA 1CKNA 1KABA 3TEHB 1A62A 3TN2A 3FRPB 5IYCG 2JA7B 2MQHA 1TU2B 2L55A 5IGBA 2BDOA 2NTTA 1CK1A 2B2YC 1LLRD 2Y0SG 3E5SA 5FO7B 1IW7D 2R61A 2FINB 1O7LA 1KLGD 1I4QA 3R2TA 4R8NA 2N3SA 4H0LC 1PH6A 2ZJQA 4HMIA 3WDNA 4DNRB 1B3QA 2R92G 4JBJA 3DWAA 2K05A 4IFDJ 3ND9A 4ODGA 5IGFA 4CDCC 4LFBL 3GTPH 1HNXQ 1ICFB 3MZ5A 3DLLA 2JA6H 5I2XA 3CCEA 1QCBD 1TWHB 3CRKC 1NAPA 3V96A 2UUAL 2E75C 2A69D 3HOWG 3PO3H 2G9HD 1PZJD 3Q22A 1PMRA 1QWYA 4A3FH 1A2UA 1Q12A 4A3GH 4LFCQ 1XPOA 4F8MA 1TY2A 3A8IE 3CPFA 5IYBH 2B2VC 4IALA 2F4VQ 1CZWA 1BCPD 2AQ3B 2K7VA 4HSPA 4XT3B 5AJ3Q 4IFDI 3AB9A 1K9MC 1U4MA 2MJ8A 2MGSA 1VQGA 4POGA 2JA7G 3H3VI 4LUVA 2KCCA 2A19A 3CAMA 3MFYA 3HKSA 3S1NH 4A3EB 4OIKA 1QNUA 3NTIA 1Q7YC 5LMNQ 1EY5A 3E9HA 3PQIA 5TSSA 4OO1I 5EPJA 5C3WA 2EVBA 5M5XB 1TY0A 2NTSA 2IL8A 2A8VA 1EEFD 4TRDA 1Q8IA 2F0VA 5JPNC 4HCEA 5KYLA 1SN8A 3CRLC 4NXNL 3Q8DA 4KLKA 3RZDH 4B9WA 2RBMA 4DV3L 3H91A 3KF8B 4LF6L 2JE6I 3DM1A 4C3HB 4DXGA 5JEAG 4EQOA 1VQ8A 1H9JA 4YIJA 3JAMc 3OSOA 4FF3A 4A4IA 3IRBA 4JI7Q 4C2MH 3K8AA 5GAGC 1G2SA 1UNSA 1F9PA 4NW2A 1R4QB 4X66L 2OTJA 3HOVH 2IT1A 2WINB 1M90C 2J7ZA 1JOOA 1PV4A 2E2JB 1FVIA 3WWVA 1TS3A 1LTID 1EWCA 5JPMC 1ML0D 3PO2G 2NUCA 3R8BA 1PLFA 4DAMA 3U50C 1S40A 2EYFA 4IUQA 1SDFA 4A3EG 3TSSA 4DV2L 5EGTA 3VR6A 1ESFA 4J6HA 5J39A 1ASYA 4UP9A 4DV7Q 4JV5Q 1SYEA 3MC0B 5IP9G 1UE7A 1I6HB 4B9XA 3TDQA 2LSSA 1Y1VB 3BZCA 3EIVA 3EJIA 2L11A 3S2DB 5ELBA 4EQPA 4I65A 1O78A 4JI0L 3KJPA 3TQYA 2ASBA 1Q82C 3HOZB 1GUTA 4JC0A 1N33L 4MTNA 5IGCA 1XXGA 2IW3A 4IJLA 4GOPB 2XWJB 3QOJA 2EYPA 1RTNA 2H1EA 2K5VA 1YNXA 1TWHH 1WTXA 3ICEA 4R8IA 4DR7L 5JEAJ 2F4IA 4O0AA 1QJOA 1N34L 1A15A 1ASZA 1NUCA 2Z0SA 4XTCS 2KCNA 3HEJA 1O7ZA 3PUWA 4C56C 2FXQA 3VYRA 3W5OA 1WVLA 1MGSA 3MEFA 1HZ9A 1S72A 3F8TA 1J5EL 1SNPA 2RHQB 5JJLA 3D4RA 3URYA 4JI3L 1K83H 1Q86C 2K52A 4BY1B 2XSCA 3CCQA 5KNDA 1HTLD 1ZKOA 5A35A 4A3EH 3RZOB 1CI3M 5FO8B 5CV9A 4KJNA 1S5BD 4A3JG 3ITPA 1EQQA 1PTOD 4POFA 2HCIA 4FF2A 4R4CA 5COYA 4IQZA 1X3QA 2IJ0A 1PXUA 1D2BA 1ZYRC 4KK7A 1X56A 5IYDH 2KCMA 3RR5A 1UEBA 1TS5A 4LF4Q 1ENAA 2B8FA 2JXMB 2L4NA 1L0WA 4GN3B 1UAPA 4CBVA 2UUCL 4XYQA 5I6YA 1X9NA 3RMHA 1KDAA 4C3HH 1N9WA 1QOHA 3KDFA 1U9RA 4UDUC 1I3QB 5IGGA 1X3FA 1FJGQ 4TSSA 2F0IA 1IL2A 5M3MB 2BE5D 4JYAQ 3T1YL 1F2MA 1RCVD 4XDXA 4KKTA 1WOCA 1LABA 1MKHA 2MP1A 2WAQB 1V1PB 5H1SE 4HCSA 3CCRA 3OWEB 3RN2A 2E2JH 2NZOA 5JJZA 1A63A 1SE8A 2B2UA 4LF5Q 3PCOB 2F52A 3L0OA 1PYWD 2F1MA 3G48A 2AUJD 4G7ZC 3BYTB 1JOKA 4DKAC 3NSWA 2EYMA 3J7AF 4PMBA 3ZYYX 3OWFA 1BR9A 3J7YW 3S24A 1OO9B 4DR4L 4JOIA 5ELEA 2CWAA 3N52A 2IX1A 4XYOA 3VA5A 4OONA 4BY7B 1HXYD 3D4WA 4JI5L 1G291 1I6HH 1DD2A 4KN4C 1Y1VH 2NVTB 2V4DA 1NMFA 1TWGB 1PH4A 2Z9HA 1IKLA 3CCVA 1H9KA 5M3FG 2I07B 3VDYA 3G7LA 3FPPA 3HOZH 3FKIB 2PI2A 3NPPA 2VW9A 5M3MG 1CFMA 2BDNA 1X32A 2ZTDA 1QUQA 3DWQA 3T4AC 1T5EA 1SE4A 4DV1L 5CV4A 4BA2I 4DV0L 1SNQA 2RDFA 5CV6A 3TMEA 4LFBQ 2HHHL 3L2PA 1X3PA 1B2TA 5CBAE 3MTSA 1E24A 1HA6A 2JA5B 5C4JH 4DR5Q 5FJ8H 1YZ6A 4MTKA 1CM9A 1IZ6A 4OX9Q 2JYOA 3TP7A 1O80A 3FVQA 1EYGA 1MJEA 4LFAQ 4JPBW 3AFPA 4BY7G 4BY1H 5E4XA 1VQPA 3UDIA 3S15B 2K33A 1UE1A 1K28A 2N88A 1QB5D 1I94Q 2ZXPA 3RZOH 4DV4L 1HJPA 3I4OA 1S4ZA 5FLXE 5FO9B 3PIP3 1NR4A 1EQTA 4RGTA 1STNA 4LJZC 4DAVA 4CJ0B 2E74C 2NVYH 3DM3A 1II3A 3FKIG 1KQSA 1OXUA 4BBRG 1PH1A 5D3DA 5K5PA 1Y8OB 4NXNQ 2KOLA 3MXPA 4A93B 2DY8A 3K81C 4RHRA 2EY1A 4DV3Q 4LF7L 1YJ9A 4LF6Q 5CYUA 1STAA 5C44G 1D7QA 4GS3A 1YBYA 3VYSA 5GAHC 3F2UA 3W1GA 3NUCA 2E2IB 4RGNA 5C4ZA 4RFBA 4KKSA 3HRZC 2F0TA 4YCWA 1K3RA 4V0BA 1XMOQ 3OMGA 4QQBX 3NTKA 4CJ2C 1WTQA 3SGIA 4OWTB 1PRTD 3M3YB 4C3JB 1JJ2A 1IXRA 2Z8LA 4B3SL 1V1QA 4X66Q 1L0YB 4FF4A 4BBSB 4RGOS 1EY0A 3PSIA 4RAUC 2B2WA 2K04A 1WYDA 4P72A 4GKJL 4L8JA 5KNBA
chains in the Genus database with same CATH topology
4IPHA 4GNXC 1OTCA 1QVFA 3PF5A 1T9HA 2ZM6L 3K80C 4DV5L 3BJUA 4DR1L 1KC8C 4X65L 2UU9Q 1N36L 1XNRL 4HJ5A 1Y14B 2NN6G 4UPAA 1OXSC 3J80i 4PZ8A 1VQBA 2D0OA 3M9BA 5IWAQ 2VNUD 2I5LX 4R1JA 2ATWA 5IWAL 4A3DH 1CKNA 1C7YA 3TEHB 1A62A 1U5KA 3TS2A 5IYCG 4A3CH 4X6AH 2MQHA 2CKZB 2JEBI 4L5RC 1KIXA 3CF5A 1HNWQ 3J7ZC 2WB1G 2AWNA 4X62L 1SRUA 2UXCL 4PG3A 5GQOA 3PUYA 2JA7H 1HNWL 1HZCA 2NVTH 1OXXK 4BXXH 1QVGA 2Y0SG 1QUQB 3JC66 1P16A 2K50A 1AE2A 1KAWA 3NEMA 4PZ6A 2N3SA 4FDBA 3J81j 1PH6A 2ZJQA 2ZTEA 4JBMA 1RIPA 1HH2P 3CC4A 1Q1BA 3FKIH 1SLJA 1PVOA 2VL6A 2Z6KC 4DUYL 1E3PA 1SROA 2R92G 1N32L 2WAQG 3AQQA 3FP9A 4DPGA 3J81i 4JBJA 4X64L 4IFDJ 1Z47A 5C3EG 4A3KG 3ULLA 2CFMA 4LFBL 2N78A 2YTXA 1HNXQ 3GTPH 1EUJA 2UUAQ 2JA6H 3DLLA 1P8LA 3CCEA 4BBSG 3AFQA 4A3IH 4JI1Q 2MNAA 1XMQL 2UUAL 2I0QA 3NBHB 1IBLQ 4DR7Q 2D0PA 1EOVA 4GN4B 4PMWA 3HOWG 3TRZA 3PO3H 1Q81C 1KRSA 4HIDA 2ZJRA 3FHWA 4TQUS 4A3FH 1Q12A 2VY3A 1VQCA 4A3GH 4LFCQ 2ES2A 2JA5H 5M5YH 1K8AC 4LF9Q 1XPOA 1LUZA 4JBWA 4O2DA 2K5HA 2PNHA 3PUVA 3CPFA 5IYBH 4JOIC 4LF9L 2F4VQ 4L5QA 3S2HH 2Q2UA 1QZHA 3J80c 2F4VL 1CKMA 5HY6A 4A3CG 1A0IA 5AJ3Q 2HIVA 4R4TA 4PZ7A 4NXML 3GTLH 4IFDI 4K0KQ 1K9MC 2B3GA 1D8LA 1PFSA 3ERSX 1VQGA 4LNQA 2ID0A 4POGA 2JA7G 1X54A 4LUVA 3H3VI 4K0KL 4BXXG 3PO2H 1K0RA 1U0LA 2V1CC 2A19A 2F3IA 3CAMA 1IBKL 4GN5A 3G71A 3HKSA 4JI4Q 1JT8A 4R4QA 1SMXA 1VQ4A 3S1NH 1Q7YC 1L2FA 1XNQQ 2D62A 2RCNA 5LMNQ 3E9HA 2OTLA 3M4PA 4KHPL 4DK3C 3KDFB 1HNZL 4OO1I 4DUZL 1X3EA 4IPDA 1UWVA 3CC2A 2A8VA 2MO0A 3W1BA 2AKWB 4KHZA 4OWWB 1S3OA 5M5XH 4H02A 3CQZH 3A0JA 4WJ3M 2OWOA 3E0EA 1SN8A 4NXNL 1NE3A 3Q8DA 4XIGS 2MFIA 4KLKA 3J81c 3B6YA 4A93H 3S17H 3RZDH 3PIPA 2JA6G 5IP9H 4DV3L 2XTIA 3KF8B 4YY3L 4LF6L 4A3IG 2JE6I 2CQOA 2H5XA 3PO3G 2IHEA 4JI2Q 1KHIA 5JEAG 3KF6A 5JJIA 1VQ8A 3PF4A 4A3FG 2UXDQ 4A3GG 2EXDA 4JI2L 5LMNW 3CD6A 2JA5G 1YJNA 1VQ6A 2NN6I 3JAMc 1L1OB 1GD7A 1GVPA 4A3LH 4A4IA 3IRBA 5FLMG 4GOPC 4C2MH 3K8AA 3RNUA 5IYBG 4A3KH 4JI7Q 3M3YH 2GVAA 4C3JH 3LGJA 4P74A 5GAGC 4HJ9A 3T1YQ 1Y1WH 2VUMG 2IX0A 4LUOA 2PQAA 4X66L 2IT1A 1KD1C 1M90C 3HOVH 2OTJA 1K73C 2VQFL 3HKZG 1PV4A 3M4OH 4GLAC 1VQFA 1FVIA 4IPCA 3WWVA 1NBWA 2Q2TA 1XPRA 2AMCB 3KLWA 1HZBA 2NVXH 3CMAA 1KL9A 1W3SA 4EX5A 1UE6A 3PO2G 1TWCH 1VS0A 1E22A 2HIXA 4UP8A 4HJ8A 4DAMA 2UU9L 4AIMA 1TWFH 3U50C 1S40A 1BVSA 4DV2Q 5EAYA 3KFUA 4A3EG 2I5MX 4B3TQ 2BH2A 4LWCA 3S14H 4LW1A 4DV2L 4B3TL 4YCVA 2R7DA 4GLVB 4DR4Q 1I50H 2Q2IA 3CCJA 3ULPA 1Q8KA 5ELNA 1ASYA 4UP9A 4DV7Q 3I2ZA 4JV5Q 4A93G 3CPWA 2YV5A 3U4ZA 2AWOA 5IP9G 2OQ0A 4DV7L 1UE7A 2ZTCA 1AE3A 1SFOH 2RF4A 5HGQA 2N8NA 2JA9A 3T1HQ 2LSSA 3UDGA 2EIFA 3OW2A 3BZCA 4JI0Q 3EIVA 4DNIA 3I56A 1VCIA 5GROA 4A3JH 3ULJA 4JI0L 3S2DH 3KJPA 1E1TA 3TQYA 4A75A 1N33Q 2ASBA 4A3LG 4A76A 1Q82C 3U58A 4C3IH 4JC0A 3F2BA 1Y1WG 1DGSA 1PH9A 1N33L 4MTNA 3RLNA 3HOVG 1C9OA 2JJQA 4IJLA 2Y0SE 4GOPB 1YI2A 1R9TH 1QZGA 1HNXL 1YITA 4DR3Q 2K5VA 3GTJH 3M85A 4DV1Q 1L1OC 1YNXA 2KENA 1TWHH 2KHJA 4DAYB 4JI1L 3ICEA 2KCTA 4NPSA 1YVCA 4DR3L 1N34Q 1IBLL 1VQAA 3BU2A 2VZAA 5JEAJ 4DR7L 1C0AA 1X65A 4JI8Q 3CCLA 4MNOA 4O0AA 3CMEA 3CCSA 2WAQE 1N34L 1ASZA 5FLMH 4LFCL 1VQ7A 4JI8L 3ER0A 2Z0SA 1YHQA 1QVCA 4XTCS 3I7FA 1X3GA 3NENA 3K7UC 4YHHQ 3PUWA 3STBC 1PH7A 1J5EQ 2FXQA 2DGYA 4AQYQ 3W5OA 4DK6C 2BA1A 3MEFA 4YHHL 1HZ9A 2R7FA 2XGTA 5FLXc 3F8TA 5AJ3L 3H15A 2RHQB 1S72A 1J5EL 2CCZA 1XPUA 4JI3Q 5JJLA 3F1ZA 1BKBA 3UDXA 1PA6A 4AYBG 4LF8Q 2LXJA 4JI3L 2PMZE 4WJ4A 1K83H 1Q86C 1RL2A 2K52A 3CCQA 4JI4L 2K75A 2KBNA 4EQ5A 4LF8L 4DR6Q 3CW2C 3D0FA 5JJKA 1B8AA 4A3EH 3EBEA 5LMNL 1XNQL 1M1KC 4A3JG 4GNXA 1EQQA 1VQNA 4POFA 1GO3E 1NY4A 4R4CA 3NELA 5K36G 1TXYA 4DR2Q 3KOJA 2OQKA 4P71A 1CSPA 4A3MG 1EFWA 2Q2HA 4GKKQ 1X56A 4DR2L 3KF6B 2JA8H 5IYDH 2B63H 2KCMA 3RR5A 1UEBA 2UUCQ 4JI6Q 2E2HH 4LF4Q 2RHSB 2R7ZH 2NZHA 1L0WA 4GN3B 5DLQE 2UUCL 4JI6L 1X9NA 4LF4L 3KJOA 1PH3A 4YCUA 2K5NA 2A1AA 4C3HH 2PQAB 5M5WH 1N9WA 3KDFA 4LF7Q 4BA1I 2UXDL 4NB3A 1WJJA 3PV0A 1X3FA 3UE1A 1PYBA 4AH6A 5IE8A 1FJGQ 2UXBQ 2GVBA 1FL0A 5M3FH 4JI7L 1IL2A 1I3QH 1KXLA 4JYAQ 2BH8A 1GKHA 3MXNB 3GTQH 3T1YL 3RLFA 2Z6KA 1V43A 1WOCA 4OXPA 1MKHA 3EN2A 5M3MH 1JJGA 4KI0A 4R4OA 3I4MH 5H1SE 3CCRA 3RN2A 1HR0W 2YTYA 2E2JH 3A74A 2NZOA 1CKNB 1A63A 4B3SQ 3A5UA 3GO5A 1Q1EA 1SE8A 4ALPA 2R6GA 4LF5Q 1E7ZA 2F52A 3PCOB 3L0OA 1H95A 1OXTA 3PUZA 4IOAA 3G48A 1AH9A 5C4XH 2WFWA 1LM0A 1WCMH 4DKAC 2OCEA 4YWLA 1PH2A 4LF5L 4GKJQ 5J3BA 3GTGH 1VQDA 5IT9c 2KHIA 1A8VA 4QJFA 4J15A 3CC7A 4DR1Q 4TVAB 2ZM6Q 1YHAA 4P73A 3F2CA 4IJHA 1N36Q 1XNRQ 1Q46A 3G6EA 3S24A 4JCVE 2L15A 4RMFA 4DR4L 4JOIA 2JA8G 5IYDG 2CWAA 2B63G 2IX1A 5C0XG 4JI5Q 4JV5L 4OONA 2R7ZG 1JB7A 1X6OA 1VQOA 1VQMA 1LYLA 4LUZA 2WP8J 4JI5L 1VQKA 1JJCB 2VUMH 1G291 3PIOA 4HJ7A 4BY7H 1I6HH 4X62Q 4P75A 3T1HL 1BBUA 2UXCQ 4QIWE 2YU9H 3AYHB 3H0GH 1Y1VH 3K7AH 3U4VA 1I5FA 1NMFA 4HIOA 1PH4A 2JEAI 1WI5A 2BA0A 3STBD 2WB1E 3CCVA 1YJWA 1VQ5A 1IBMQ 4A3MH 3HOYG 5M3FG 3AEVA 4A3BH 2UUBQ 1B7YB 1TWGH 1VQLA 4L5SA 3PUXA 3VDYA 2HT1A 3M7NA 2C35B 3KYHC 1IBML 3HOZH 2UUBL 2PI2A 5GAEC 2R93H 3PGZA 3CCMA 5E7NA 4IOCA 2VW9A 3BZKA 5M3MG 4DUYQ 1EWIA 2N49A 2YTVA 4JG2A 3I4MG 1N32Q 2ZTDA 1QUQA 3F2DA 4DV0Q 1MIUA 4BBRH 3M4QA 4DV1L 1SR3A 3L7ZC 4X64Q 1NMGA 4JBKA 3GTOH 4BA2I 2HHHQ 4DV0L 3HOUG 1XTDA 5IY0A 3TREA 4LFBQ 1TWAH 1VQHA 4QY7A 2HHHL 3UE0A 3H3VH 5C4XG 1WCMG 3L2PA 1PHJA 2MO1A 4OWXB 1HZAA 1XMQQ 1IYJB 1EQRA 5C44H 4IO9A 1NTGA 4ME3A 2DUDA 1E1OA 1E24A 3JAMi 2JQOA 3RLOA 2GN5A 2B29A 5C4JH 3I55A 4DR5Q 5FJ8H 2LXKA 1YZ6A 3K0XA 3HOXH 4HIMA 4GOPA 4AQYL 1IZ6A 2I5HA 2JK8A 3CP0A 4OX9Q 4DR5L 3RN5A 2CWPA 3GDEA 2IY5B 1EIYB 1EYGA 5ELOA 4GNXB 1W2BA 4OX9L 1JE5A 2E8GA 2ZJPA 3GTKH 1WFQA 1V9PA 1MJEA 4LFAQ 4A3DG 4B3RQ 3I4NH 1CUKA 3AFPA 5IP7H 4NXMQ 1Z9FA 1G51A 1CSQA 4GLXA 4BY1H 4DV4Q 1VQPA 3UDIA 3S1MH 4BY7G 4DR6L 5GADC 4LFAL 1UE1A 4IPGA 2E5LQ 4L5TA 4B3RL 1I94Q 3H0GG 3RZOH 1Y1VG 2HQLA 4DV4L 4HJAA 1HJPA 3I4OA 3S15H 1B70B 2E5LL 4UY8C 1IBKQ 1I94L 1G6PA 4APVA 3OTOQ 4A3BG 1NJIC 2VS1A 1PYSB 2EQSA 2YYZA 3A5ZB 1HR0Q 4KHPQ 4RG1A 1HNZQ 4QGUA 1VQ9A 3HOZG 4DUZQ 2PI2E 3OTOL 4GKKL 4AYBE 2R93G 5C0XJ 1HR0L 2NVYH 3DM3A 3FKIG 1X55A 1KQSA 1YEZA 1OXUA 4BBRG 4DV6Q 5IYCH 1PH1A 4YWKA 2QEXA 4Y52H 4IFDG 4Y7NH 4NXNQ 4DV6L 1JMCA 1BBWA 2K14A 3K81C 1LTLA 4DV3Q 4LF7L 3HOYH 2K4KA 1YJ9A 1N8RC 4YY3Q 1K8GA 4LF6Q 2NVQH 3E9IA 5C44G 1PH8A 1GM5A 4HIKA 1YHBA 1YBYA 4GS3A 4R4IA 1FJGL 1OXVA 2UXBL 5GAHC 1D7QA 4QL5A 4MZ9A 2QGQA 3W1GA 3S1QH 3S16H 4JYAL 2VQEQ 3S1RH 4OO1G 3GD7A 4UP7A 3CCUA 3OYYA 4YCWA 1XMOQ 1K3RA 2IHFA 5FJ8G 3HOXG 4QQBX 1VQEA 1EIFA 3UDFA 3SGIA 4OWTB 2VQEL 2E2IH 1UE5A 1VQJA 2R92H 1XMOL 4B3MQ 3CXCA 5BR8Q 3TS0A 1PH5A 1JJ2A 5C0XI 1O7IA 5LMUQ 3HOUH 4YWMA 1IXRA 4B3SL 1V1QA 1J6QA 4B3ML 1FGUA 4X66Q 5BR8L 5C3EH 3ZJYC 5LMUL 2VQFQ 3J7A5 1XJVA 2QA4A 2AHOB 3GTMH 2ALYB 5IP7G 1KRTA 3I4NG 3PSIA 1YIJA 4BY1G 1VQIA 1L1OA 1WYDA 4P72A 3D31A 1CKOA 4BBSH 3HFZB 4GKJL 3HKZE 4DV5Q 1MJCA 3G4SA 4X65Q 3HOWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPH A;  4GNX C;  1OTC A;  1QVF A;  3PF5 A;  1T9H A;  2ZM6 L;  3K80 C;  4DV5 L;  3BJU A;  4DR1 L;  1KC8 C;  4X65 L;  2UU9 Q;  1N36 L;  1XNR L;  4HJ5 A;  1Y14 B;  2NN6 G;  4UPA A;  1OXS C;  3J80 i;  4PZ8 A;  1VQB A;  2D0O A;  3M9B A;  5IWA Q;  2VNU D;  2I5L X;  4R1J A;  2ATW A;  5IWA L;  4A3D H;  1CKN A;  1C7Y A;  3TEH B;  1A62 A;  1U5K A;  3TS2 A;  5IYC G;  4A3C H;  4X6A H;  2MQH A;  2CKZ B;  2JEB I;  4L5R C;  1KIX A;  3CF5 A;  1HNW Q;  3J7Z C;  2WB1 G;  2AWN A;  4X62 L;  1SRU A;  2UXC L;  4PG3 A;  5GQO A;  3PUY A;  2JA7 H;  1HNW L;  1HZC A;  2NVT H;  1OXX K;  4BXX H;  1QVG A;  2Y0S G;  1QUQ B;  3JC6 6;  1P16 A;  2K50 A;  1AE2 A;  1KAW A;  3NEM A;  4PZ6 A;  2N3S A;  4FDB A;  3J81 j;  1PH6 A;  2ZJQ A;  2ZTE A;  4JBM A;  1RIP A;  1HH2 P;  3CC4 A;  1Q1B A;  3FKI H;  1SLJ A;  1PVO A;  2VL6 A;  2Z6K C;  4DUY L;  1E3P A;  1SRO A;  2R92 G;  1N32 L;  2WAQ G;  3AQQ A;  3FP9 A;  4DPG A;  3J81 i;  4JBJ A;  4X64 L;  4IFD J;  1Z47 A;  5C3E G;  4A3K G;  3ULL A;  2CFM A;  4LFB L;  2N78 A;  2YTX A;  1HNX Q;  3GTP H;  1EUJ A;  2UUA Q;  2JA6 H;  3DLL A;  1P8L A;  3CCE A;  4BBS G;  3AFQ A;  4A3I H;  4JI1 Q;  2MNA A;  1XMQ L;  2UUA L;  2I0Q A;  3NBH B;  1IBL Q;  4DR7 Q;  2D0P A;  1EOV A;  4GN4 B;  4PMW A;  3HOW G;  3TRZ A;  3PO3 H;  1Q81 C;  1KRS A;  4HID A;  2ZJR A;  3FHW A;  4TQU S;  4A3F H;  1Q12 A;  2VY3 A;  1VQC A;  4A3G H;  4LFC Q;  2ES2 A;  2JA5 H;  5M5Y H;  1K8A C;  4LF9 Q;  1XPO A;  1LUZ A;  4JBW A;  4O2D A;  2K5H A;  2PNH A;  3PUV A;  3CPF A;  5IYB H;  4JOI C;  4LF9 L;  2F4V Q;  4L5Q A;  3S2H H;  2Q2U A;  1QZH A;  3J80 c;  2F4V L;  1CKM A;  5HY6 A;  4A3C G;  1A0I A;  5AJ3 Q;  2HIV A;  4R4T A;  4PZ7 A;  4NXM L;  3GTL H;  4IFD I;  4K0K Q;  1K9M C;  2B3G A;  1D8L A;  1PFS A;  3ERS X;  1VQG A;  4LNQ A;  2ID0 A;  4POG A;  2JA7 G;  1X54 A;  4LUV A;  3H3V I;  4K0K L;  4BXX G;  3PO2 H;  1K0R A;  1U0L A;  2V1C C;  2A19 A;  2F3I A;  3CAM A;  1IBK L;  4GN5 A;  3G71 A;  3HKS A;  4JI4 Q;  1JT8 A;  4R4Q A;  1SMX A;  1VQ4 A;  3S1N H;  1Q7Y C;  1L2F A;  1XNQ Q;  2D62 A;  2RCN A;  5LMN Q;  3E9H A;  2OTL A;  3M4P A;  4KHP L;  4DK3 C;  3KDF B;  1HNZ L;  4OO1 I;  4DUZ L;  1X3E A;  4IPD A;  1UWV A;  3CC2 A;  2A8V A;  2MO0 A;  3W1B A;  2AKW B;  4KHZ A;  4OWW B;  1S3O A;  5M5X H;  4H02 A;  3CQZ H;  3A0J A;  4WJ3 M;  2OWO A;  3E0E A;  1SN8 A;  4NXN L;  1NE3 A;  3Q8D A;  4XIG S;  2MFI A;  4KLK A;  3J81 c;  3B6Y A;  4A93 H;  3S17 H;  3RZD H;  3PIP A;  2JA6 G;  5IP9 H;  4DV3 L;  2XTI A;  3KF8 B;  4YY3 L;  4LF6 L;  4A3I G;  2JE6 I;  2CQO A;  2H5X A;  3PO3 G;  2IHE A;  4JI2 Q;  1KHI A;  5JEA G;  3KF6 A;  5JJI A;  1VQ8 A;  3PF4 A;  4A3F G;  2UXD Q;  4A3G G;  2EXD A;  4JI2 L;  5LMN W;  3CD6 A;  2JA5 G;  1YJN A;  1VQ6 A;  2NN6 I;  3JAM c;  1L1O B;  1GD7 A;  1GVP A;  4A3L H;  4A4I A;  3IRB A;  5FLM G;  4GOP C;  4C2M H;  3K8A A;  3RNU A;  5IYB G;  4A3K H;  4JI7 Q;  3M3Y H;  2GVA A;  4C3J H;  3LGJ A;  4P74 A;  5GAG C;  4HJ9 A;  3T1Y Q;  1Y1W H;  2VUM G;  2IX0 A;  4LUO A;  2PQA A;  4X66 L;  2IT1 A;  1KD1 C;  1M90 C;  3HOV H;  2OTJ A;  1K73 C;  2VQF L;  3HKZ G;  1PV4 A;  3M4O H;  4GLA C;  1VQF A;  1FVI A;  4IPC A;  3WWV A;  1NBW A;  2Q2T A;  1XPR A;  2AMC B;  3KLW A;  1HZB A;  2NVX H;  3CMA A;  1KL9 A;  1W3S A;  4EX5 A;  1UE6 A;  3PO2 G;  1TWC H;  1VS0 A;  1E22 A;  2HIX A;  4UP8 A;  4HJ8 A;  4DAM A;  2UU9 L;  4AIM A;  1TWF H;  3U50 C;  1S40 A;  1BVS A;  4DV2 Q;  5EAY A;  3KFU A;  4A3E G;  2I5M X;  4B3T Q;  2BH2 A;  4LWC A;  3S14 H;  4LW1 A;  4DV2 L;  4B3T L;  4YCV A;  2R7D A;  4GLV B;  4DR4 Q;  1I50 H;  2Q2I A;  3CCJ A;  3ULP A;  1Q8K A;  5ELN A;  1ASY A;  4UP9 A;  4DV7 Q;  3I2Z A;  4JV5 Q;  4A93 G;  3CPW A;  2YV5 A;  3U4Z A;  2AWO A;  5IP9 G;  2OQ0 A;  4DV7 L;  1UE7 A;  2ZTC A;  1AE3 A;  1SFO H;  2RF4 A;  5HGQ A;  2N8N A;  2JA9 A;  3T1H Q;  2LSS A;  3UDG A;  2EIF A;  3OW2 A;  3BZC A;  4JI0 Q;  3EIV A;  4DNI A;  3I56 A;  1VCI A;  5GRO A;  4A3J H;  3ULJ A;  4JI0 L;  3S2D H;  3KJP A;  1E1T A;  3TQY A;  4A75 A;  1N33 Q;  2ASB A;  4A3L G;  4A76 A;  1Q82 C;  3U58 A;  4C3I H;  4JC0 A;  3F2B A;  1Y1W G;  1DGS A;  1PH9 A;  1N33 L;  4MTN A;  3RLN A;  3HOV G;  1C9O A;  2JJQ A;  4IJL A;  2Y0S E;  4GOP B;  1YI2 A;  1R9T H;  1QZG A;  1HNX L;  1YIT A;  4DR3 Q;  2K5V A;  3GTJ H;  3M85 A;  4DV1 Q;  1L1O C;  1YNX A;  2KEN A;  1TWH H;  2KHJ A;  4DAY B;  4JI1 L;  3ICE A;  2KCT A;  4NPS A;  1YVC A;  4DR3 L;  1N34 Q;  1IBL L;  1VQA A;  3BU2 A;  2VZA A;  5JEA J;  4DR7 L;  1C0A A;  1X65 A;  4JI8 Q;  3CCL A;  4MNO A;  4O0A A;  3CME A;  3CCS A;  2WAQ E;  1N34 L;  1ASZ A;  5FLM H;  4LFC L;  1VQ7 A;  4JI8 L;  3ER0 A;  2Z0S A;  1YHQ A;  1QVC A;  4XTC S;  3I7F A;  1X3G A;  3NEN A;  3K7U C;  4YHH Q;  3PUW A;  3STB C;  1PH7 A;  1J5E Q;  2FXQ A;  2DGY A;  4AQY Q;  3W5O A;  4DK6 C;  2BA1 A;  3MEF A;  4YHH L;  1HZ9 A;  2R7F A;  2XGT A;  5FLX c;  3F8T A;  5AJ3 L;  3H15 A;  2RHQ B;  1S72 A;  1J5E L;  2CCZ A;  1XPU A;  4JI3 Q;  5JJL A;  3F1Z A;  1BKB A;  3UDX A;  1PA6 A;  4AYB G;  4LF8 Q;  2LXJ A;  4JI3 L;  2PMZ E;  4WJ4 A;  1K83 H;  1Q86 C;  1RL2 A;  2K52 A;  3CCQ A;  4JI4 L;  2K75 A;  2KBN A;  4EQ5 A;  4LF8 L;  4DR6 Q;  3CW2 C;  3D0F A;  5JJK A;  1B8A A;  4A3E H;  3EBE A;  5LMN L;  1XNQ L;  1M1K C;  4A3J G;  4GNX A;  1EQQ A;  1VQN A;  4POF A;  1GO3 E;  1NY4 A;  4R4C A;  3NEL A;  5K36 G;  1TXY A;  4DR2 Q;  3KOJ A;  2OQK A;  4P71 A;  1CSP A;  4A3M G;  1EFW A;  2Q2H A;  4GKK Q;  1X56 A;  4DR2 L;  3KF6 B;  2JA8 H;  5IYD H;  2B63 H;  2KCM A;  3RR5 A;  1UEB A;  2UUC Q;  4JI6 Q;  2E2H H;  4LF4 Q;  2RHS B;  2R7Z H;  2NZH A;  1L0W A;  4GN3 B;  5DLQ E;  2UUC L;  4JI6 L;  1X9N A;  4LF4 L;  3KJO A;  1PH3 A;  4YCU A;  2K5N A;  2A1A A;  4C3H H;  2PQA B;  5M5W H;  1N9W A;  3KDF A;  4LF7 Q;  4BA1 I;  2UXD L;  4NB3 A;  1WJJ A;  3PV0 A;  1X3F A;  3UE1 A;  1PYB A;  4AH6 A;  5IE8 A;  1FJG Q;  2UXB Q;  2GVB A;  1FL0 A;  5M3F H;  4JI7 L;  1IL2 A;  1I3Q H;  1KXL A;  4JYA Q;  2BH8 A;  1GKH A;  3MXN B;  3GTQ H;  3T1Y L;  3RLF A;  2Z6K A;  1V43 A;  1WOC A;  4OXP A;  1MKH A;  3EN2 A;  5M3M H;  1JJG A;  4KI0 A;  4R4O A;  3I4M H;  5H1S E;  3CCR A;  3RN2 A;  1HR0 W;  2YTY A;  2E2J H;  3A74 A;  2NZO A;  1CKN B;  1A63 A;  4B3S Q;  3A5U A;  3GO5 A;  1Q1E A;  1SE8 A;  4ALP A;  2R6G A;  4LF5 Q;  1E7Z A;  2F52 A;  3PCO B;  3L0O A;  1H95 A;  1OXT A;  3PUZ A;  4IOA A;  3G48 A;  1AH9 A;  5C4X H;  2WFW A;  1LM0 A;  1WCM H;  4DKA C;  2OCE A;  4YWL A;  1PH2 A;  4LF5 L;  4GKJ Q;  5J3B A;  3GTG H;  1VQD A;  5IT9 c;  2KHI A;  1A8V A;  4QJF A;  4J15 A;  3CC7 A;  4DR1 Q;  4TVA B;  2ZM6 Q;  1YHA A;  4P73 A;  3F2C A;  4IJH A;  1N36 Q;  1XNR Q;  1Q46 A;  3G6E A;  3S24 A;  4JCV E;  2L15 A;  4RMF A;  4DR4 L;  4JOI A;  2JA8 G;  5IYD G;  2CWA A;  2B63 G;  2IX1 A;  5C0X G;  4JI5 Q;  4JV5 L;  4OON A;  2R7Z G;  1JB7 A;  1X6O A;  1VQO A;  1VQM A;  1LYL A;  4LUZ A;  2WP8 J;  4JI5 L;  1VQK A;  1JJC B;  2VUM H;  1G29 1;  3PIO A;  4HJ7 A;  4BY7 H;  1I6H H;  4X62 Q;  4P75 A;  3T1H L;  1BBU A;  2UXC Q;  4QIW E;  2YU9 H;  3AYH B;  3H0G H;  1Y1V H;  3K7A H;  3U4V A;  1I5F A;  1NMF A;  4HIO A;  1PH4 A;  2JEA I;  1WI5 A;  2BA0 A;  3STB D;  2WB1 E;  3CCV A;  1YJW A;  1VQ5 A;  1IBM Q;  4A3M H;  3HOY G;  5M3F G;  3AEV A;  4A3B H;  2UUB Q;  1B7Y B;  1TWG H;  1VQL A;  4L5S A;  3PUX A;  3VDY A;  2HT1 A;  3M7N A;  2C35 B;  3KYH C;  1IBM L;  3HOZ H;  2UUB L;  2PI2 A;  5GAE C;  2R93 H;  3PGZ A;  3CCM A;  5E7N A;  4IOC A;  2VW9 A;  3BZK A;  5M3M G;  4DUY Q;  1EWI A;  2N49 A;  2YTV A;  4JG2 A;  3I4M G;  1N32 Q;  2ZTD A;  1QUQ A;  3F2D A;  4DV0 Q;  1MIU A;  4BBR H;  3M4Q A;  4DV1 L;  1SR3 A;  3L7Z C;  4X64 Q;  1NMG A;  4JBK A;  3GTO H;  4BA2 I;  2HHH Q;  4DV0 L;  3HOU G;  1XTD A;  5IY0 A;  3TRE A;  4LFB Q;  1TWA H;  1VQH A;  4QY7 A;  2HHH L;  3UE0 A;  3H3V H;  5C4X G;  1WCM G;  3L2P A;  1PHJ A;  2MO1 A;  4OWX B;  1HZA A;  1XMQ Q;  1IYJ B;  1EQR A;  5C44 H;  4IO9 A;  1NTG A;  4ME3 A;  2DUD A;  1E1O A;  1E24 A;  3JAM i;  2JQO A;  3RLO A;  2GN5 A;  2B29 A;  5C4J H;  3I55 A;  4DR5 Q;  5FJ8 H;  2LXK A;  1YZ6 A;  3K0X A;  3HOX H;  4HIM A;  4GOP A;  4AQY L;  1IZ6 A;  2I5H A;  2JK8 A;  3CP0 A;  4OX9 Q;  4DR5 L;  3RN5 A;  2CWP A;  3GDE A;  2IY5 B;  1EIY B;  1EYG A;  5ELO A;  4GNX B;  1W2B A;  4OX9 L;  1JE5 A;  2E8G A;  2ZJP A;  3GTK H;  1WFQ A;  1V9P A;  1MJE A;  4LFA Q;  4A3D G;  4B3R Q;  3I4N H;  1CUK A;  3AFP A;  5IP7 H;  4NXM Q;  1Z9F A;  1G51 A;  1CSQ A;  4GLX A;  4BY1 H;  4DV4 Q;  1VQP A;  3UDI A;  3S1M H;  4BY7 G;  4DR6 L;  5GAD C;  4LFA L;  1UE1 A;  4IPG A;  2E5L Q;  4L5T A;  4B3R L;  1I94 Q;  3H0G G;  3RZO H;  1Y1V G;  2HQL A;  4DV4 L;  4HJA A;  1HJP A;  3I4O A;  3S15 H;  1B70 B;  2E5L L;  4UY8 C;  1IBK Q;  1I94 L;  1G6P A;  4APV A;  3OTO Q;  4A3B G;  1NJI C;  2VS1 A;  1PYS B;  2EQS A;  2YYZ A;  3A5Z B;  1HR0 Q;  4KHP Q;  4RG1 A;  1HNZ Q;  4QGU A;  1VQ9 A;  3HOZ G;  4DUZ Q;  2PI2 E;  3OTO L;  4GKK L;  4AYB E;  2R93 G;  5C0X J;  1HR0 L;  2NVY H;  3DM3 A;  3FKI G;  1X55 A;  1KQS A;  1YEZ A;  1OXU A;  4BBR G;  4DV6 Q;  5IYC H;  1PH1 A;  4YWK A;  2QEX A;  4Y52 H;  4IFD G;  4Y7N H;  4NXN Q;  4DV6 L;  1JMC A;  1BBW A;  2K14 A;  3K81 C;  1LTL A;  4DV3 Q;  4LF7 L;  3HOY H;  2K4K A;  1YJ9 A;  1N8R C;  4YY3 Q;  1K8G A;  4LF6 Q;  2NVQ H;  3E9I A;  5C44 G;  1PH8 A;  1GM5 A;  4HIK A;  1YHB A;  1YBY A;  4GS3 A;  4R4I A;  1FJG L;  1OXV A;  2UXB L;  5GAH C;  1D7Q A;  4QL5 A;  4MZ9 A;  2QGQ A;  3W1G A;  3S1Q H;  3S16 H;  4JYA L;  2VQE Q;  3S1R H;  4OO1 G;  3GD7 A;  4UP7 A;  3CCU A;  3OYY A;  4YCW A;  1XMO Q;  1K3R A;  2IHF A;  5FJ8 G;  3HOX G;  4QQB X;  1VQE A;  1EIF A;  3UDF A;  3SGI A;  4OWT B;  2VQE L;  2E2I H;  1UE5 A;  1VQJ A;  2R92 H;  1XMO L;  4B3M Q;  3CXC A;  5BR8 Q;  3TS0 A;  1PH5 A;  1JJ2 A;  5C0X I;  1O7I A;  5LMU Q;  3HOU H;  4YWM A;  1IXR A;  4B3S L;  1V1Q A;  1J6Q A;  4B3M L;  1FGU A;  4X66 Q;  5BR8 L;  5C3E H;  3ZJY C;  5LMU L;  2VQF Q;  3J7A 5;  1XJV A;  2QA4 A;  2AHO B;  3GTM H;  2ALY B;  5IP7 G;  1KRT A;  3I4N G;  3PSI A;  1YIJ A;  4BY1 G;  1VQI A;  1L1O A;  1WYD A;  4P72 A;  3D31 A;  1CKO A;  4BBS H;  3HFZ B;  4GKJ L;  3HKZ E;  4DV5 Q;  1MJC A;  3G4S A;  4X65 Q;  3HOW H; 
#chains in the Genus database with same CATH topology
 3H94 A;  1T9H A;  4DR1 L;  3EVQ A;  1N36 L;  1XNR L;  5D3I B;  2D9U A;  1DZ1 A;  4MIU A;  2VNU D;  1QG7 A;  5DM6 3;  2M00 A;  4PMC A;  5EKK A;  1D6E C;  1DON A;  4CDF C;  1I50 B;  4A3C H;  5IT9 E;  1BUV T;  1HNW Q;  1LT3 D;  3CF5 A;  4X62 L;  4M8A A;  4PQX A;  1SRU A;  5GQO A;  4AYB B;  1CTM A;  2NVT H;  4BXX H;  1QVG A;  2F0F A;  3JC6 6;  1FNU A;  2K50 A;  4DK1 A;  1AE2 A;  3J81 j;  4FDB A;  2G9D A;  1SYD A;  2ZTE A;  1RIP A;  1Q1B A;  3FKI H;  4IUV A;  2VL6 A;  2HDL A;  2PNR C;  4ZKC B;  3AQQ A;  1Z6H A;  4X64 L;  2JA6 B;  1Z47 A;  5C3E G;  1R9T B;  1B1Z A;  2B2U C;  5CV7 A;  1EZ8 A;  4QUC A;  1B53 A;  3T56 B;  3K6O A;  4BBS G;  3AFQ A;  1EYC A;  4ULL A;  2MNA A;  3TZU A;  1XMQ L;  4A3F B;  4DR7 Q;  3RD4 A;  2D0P A;  1EOV A;  4PMW A;  1DJR D;  2WKC A;  1KRS A;  4HID A;  2BCO A;  3FHW A;  1Q81 C;  4X3K A;  3KUP A;  1JE4 A;  2Z4I A;  2JA5 H;  4QCL A;  1LUZ A;  4JBW A;  5KYI A;  2K5H A;  3M7G A;  3PUV A;  4JOI C;  4ZUJ A;  4LF9 L;  2CW0 D;  4L5Q A;  4IUT A;  3J80 c;  3ERO A;  4PZ7 A;  4K0K Q;  1D8L A;  3VYU A;  2XN9 C;  5EPK A;  2RSN A;  4ID6 A;  1K0R A;  1U0L A;  2V1C C;  2F3I A;  4GN5 A;  3G71 A;  3P7J A;  1VQ4 A;  1LO5 D;  2JN4 A;  3SDZ A;  2D62 A;  2PW5 A;  3DXJ C;  2OTL A;  5J1Z A;  4DK3 C;  1FNV A;  1JCK B;  4ZLT F;  4OWW B;  1S3O A;  5EBD A;  2KEE A;  4RHS A;  2JA8 B;  3RZD B;  2B63 B;  2MPM A;  1NE3 A;  4XIG S;  2MFI A;  1D5M C;  2EYJ A;  3J81 c;  4A93 H;  2O5J C;  3S17 H;  4O42 A;  1H9S A;  1I6V C;  3D4D A;  2JA6 G;  1KNA A;  1LTS D;  1Q3L A;  2OEO A;  2H5X A;  2QCP X;  5IOC A;  3PO3 G;  5M5W B;  3KF6 A;  1UEA B;  2B8G A;  3PF4 A;  4A3F G;  1BOS A;  4C2M B;  4A3G G;  2EXD A;  4JI2 L;  3CD6 A;  1HCZ A;  4N9P A;  2O5I C;  3Q24 A;  1V1O A;  1GD7 A;  4A3L H;  1TS2 A;  3M4O H;  5FLM G;  3M3Y H;  5IYB G;  1JB3 A;  4C3J H;  3GTQ B;  3LGJ A;  5NUC A;  2A68 D;  3T1Y Q;  2IX0 A;  3K5O A;  1VQF A;  2Q2T A;  4DF7 A;  3J7A V;  1TR5 A;  1LTT D;  1JC7 A;  1W3S A;  1YNN D;  1EY7 A;  1UE6 A;  3MXN A;  1JWM D;  1VS0 A;  1BNZ A;  1D1I A;  2UU9 L;  4AIM A;  1V8Q A;  3KFU A;  4WFN 3;  2BH2 A;  2NBF A;  2PCF B;  2ZT9 C;  3JAM L;  2EJM A;  4B3T L;  1ILP A;  4YCV A;  3GP7 A;  2SNS A;  3E6Z X;  2O4X A;  4DR4 Q;  1I50 H;  3VA7 A;  4J1M A;  3ULP A;  4DXF A;  3L3O C;  3HG9 A;  1A3U A;  1AW7 A;  1FNW A;  3U4Z A;  1NSN S;  2RCF A;  2OQ0 A;  2VUM B;  5BN3 A;  3I91 A;  2JA9 A;  3HGB A;  3K7A B;  3OW2 A;  3I56 A;  5GRO A;  4V19 0;  3BVG A;  3OMC A;  3ULJ A;  3KLR A;  5LL6 X;  5K36 H;  1E1T A;  2F0M A;  3QIA A;  3F2B A;  3RLN A;  1PZI D;  3HOV G;  3D3R A;  1R9T H;  4DA2 A;  1WTR A;  2F0J A;  3MFG A;  1EL0 A;  3Q6S A;  1YIT A;  3M85 A;  2B2W C;  2ZXR A;  4DV1 Q;  4DAY B;  1C8C A;  2KEN A;  1I4H A;  1HQR D;  1AZP A;  3EFX D;  4NPS A;  4RCN A;  4DR3 L;  1HUM A;  1C0A A;  3CCL A;  4MNO A;  3CME A;  3CCS A;  2WAQ E;  5FLM H;  1VQ7 A;  2B2T A;  4JI8 L;  4K5X A;  2SOB A;  1QVC A;  3IFD A;  3AU7 A;  1A3T A;  3IFT A;  4WRD A;  3K7U C;  4NMZ A;  4YHH Q;  4S3S A;  2PW7 A;  1PH7 A;  2DGY A;  2FHT A;  1SJH D;  1ROD A;  4HSV A;  3I72 A;  5JAV A;  2CCZ A;  1K83 B;  1HTP A;  5ELC A;  1BKB A;  5I6W A;  2LXJ A;  4WJ4 A;  1RL2 A;  4JI4 L;  3S1M B;  3L9A X;  2A6E D;  2K75 A;  2KBN A;  4EQ5 A;  4LF8 L;  3CW2 C;  4RCO A;  2CVR A;  1XNQ L;  1M1K C;  1M4V A;  1K0S A;  4GNX A;  1VQN A;  1NY4 A;  2KQ3 A;  1TXY A;  4HR7 B;  1S5F D;  2CH4 A;  1C48 A;  1EFW A;  1GXD C;  1XWE A;  1HFN A;  4DR2 L;  1KTK A;  3H6M A;  2JA8 H;  2B63 H;  5ELD A;  5C0X H;  4CDD C;  2I46 A;  2NZH A;  5DLQ E;  1LTB D;  4JI6 L;  5F2D A;  1PH3 A;  2K5N A;  1GUN A;  2XRS D;  5M5W H;  1KDB A;  4LF7 Q;  2UXD L;  4QB4 A;  1SXT A;  4NB3 A;  1WJJ A;  1EYD A;  1NCV A;  3UE1 A;  1PYB A;  5IE8 A;  5D65 A;  2GVB A;  4KY6 A;  4EVO A;  2H4O A;  3S1Q B;  1QE6 A;  3S16 B;  1SJE D;  3GTQ H;  2Z6K A;  3H3V C;  1JJG A;  4KI0 A;  2D5D A;  4ZRZ A;  1SMY C;  1I4G A;  2KUM A;  4B3S Q;  3LX0 A;  2QKI C;  4KJO A;  3GTM B;  2R6G A;  1E7Z A;  1AH9 A;  1LM0 A;  1WCM H;  2OCE A;  3R3O A;  1U4R A;  4J8Q A;  4GKJ Q;  1VQD A;  3DHQ A;  3CC7 A;  4J15 A;  1T5X D;  4DR1 Q;  4TVA B;  3TP8 A;  2F3W A;  1BBX C;  1N36 Q;  1XNR Q;  1Q46 A;  3G6E A;  4KV6 A;  5IYD G;  1I4R A;  2A6H C;  3QJY A;  4E6I A;  1JB7 A;  3T53 B;  1GOZ A;  1LYL A;  5CMD A;  2VUM H;  1NNX A;  3O13 A;  1IYV A;  4X62 Q;  4OL7 A;  1WTV A;  4B08 A;  4C3H G;  3H0G H;  3K7A H;  3U4V A;  2R3Z A;  3STB D;  2L12 A;  3AEV A;  4A3B H;  1LV9 A;  2UUB Q;  4OGQ C;  3SK5 A;  2HT1 A;  3M7N A;  2C35 B;  1IBM L;  1TKW B;  5GAE C;  4CHT B;  3PGZ A;  3CCM A;  4IOC A;  1SNC A;  3BZK A;  3A8K E;  4DK0 A;  1EWI A;  1QIL A;  3F2D A;  4KKU A;  4X64 Q;  3SK4 A;  2QF7 A;  1PHJ A;  2MO1 A;  4R9W A;  1XMQ Q;  4IO9 A;  1NTG A;  1BCP F;  1CQF A;  5C4J B;  2J0T D;  2KHS A;  5LL6 S;  2GN5 A;  5M5Y B;  1IW7 C;  1LTA D;  2LXK A;  1AN8 A;  4GOP A;  4AQY L;  2I5H A;  2IX3 A;  1XTC D;  2IY5 B;  5KRU A;  3NBH A;  4Q5V A;  4XQN A;  1RTO A;  1V9P A;  3E0J A;  3I3C A;  1ET9 A;  4H7B A;  3GTL B;  1M8A A;  5IP7 H;  2QDL A;  5HUR A;  2D2C C;  4K6L A;  3S1M H;  4OHJ A;  4B3R L;  1BQQ T;  2QDB A;  1Y1V G;  2FMM A;  1EY6 A;  1JWS D;  1JR0 D;  2PZU A;  3BDO A;  1B70 B;  2E5L L;  4UY8 C;  5COR A;  4APV A;  1CHP D;  4ZQ3 A;  3OTO Q;  2YYZ A;  2KA7 A;  2NVY B;  3A5Z B;  1HR0 Q;  2NN6 H;  4QGU A;  3I8Z A;  3HOZ G;  2A69 C;  4XXE A;  2CQA A;  4AYB E;  3NBI A;  5C4H A;  4QIW B;  5I2Y A;  3FPU B;  2F0L A;  1S5C D;  2WB1 B;  3CQZ B;  1ZXT A;  4DV6 Q;  4YWK A;  2QEX A;  1BCP C;  1XX8 A;  2F0N A;  2EZV A;  2KEC A;  1N8R C;  3MA2 B;  1K8G A;  3E9I A;  5E1F A;  1GHJ A;  2B2T C;  4R4I A;  4X3T A;  1OXV A;  2N55 A;  4QL5 A;  4MZ9 A;  2QGQ A;  3BG3 A;  3S1Q H;  3S16 H;  3V05 A;  2VQE Q;  1SNM A;  5EJW A;  4DAP A;  4XT1 B;  2WAC A;  4CKE A;  1AFP A;  2IHF A;  5FJ8 G;  3IKJ A;  1VQE A;  4PV1 C;  3UDF A;  1U4P A;  1A6X A;  1UE5 A;  1VQJ A;  4ZCK A;  4ZAI A;  1WTO A;  3CXC A;  4YWM A;  3QB3 A;  4B3M L;  5BR8 L;  5LMU L;  2F0O A;  1XJV A;  3GTM H;  1CT1 D;  1KRT A;  1YIJ A;  4BY1 G;  3X3M A;  4RGM A;  1VQI A;  1L1O A;  1MI2 A;  3D31 A;  2NVX B;  1HRJ A;  3A56 A;  3G4S A;  4X65 Q;  1EZ6 A;  5EBC A;  4IPH A;  4GNX C;  2ZM6 L;  4DV5 L;  2UU9 Q;  2Q8I B;  1CA6 A;  4FVM A;  2RVL A;  2BOS A;  2XWB B;  4UPA A;  1OXS C;  3J80 i;  1VQB A;  2D0O A;  1V1P A;  2I5L X;  2PZW A;  2ATW A;  4U67 3;  5IWA L;  1C7Y A;  3N6R A;  1FGB D;  1U5K A;  3TS2 A;  3ERQ A;  4X6A H;  2EOT A;  4L5R C;  1KIX A;  2QEJ C;  3TZD A;  4OIJ A;  1RHP A;  2AWN A;  2WB1 G;  3J7Z C;  2UXC L;  4PG3 A;  2EY2 A;  2Z4H A;  1H9R A;  1QUQ B;  1RF2 D;  2GA4 B;  3DWP A;  3NE5 B;  1SFO B;  1P16 A;  1RDP D;  1KAW A;  3NEM A;  4PZ6 A;  4NKL A;  4JBM A;  1HH2 P;  3CC4 A;  1PFM A;  2XVS A;  1PVO A;  5ELF A;  2Z6K C;  1E3P A;  1SRO A;  5CV8 A;  1N32 L;  2WAQ G;  4DPG A;  3V2T A;  3J81 i;  2AQ1 B;  3ULL A;  1A3V A;  3DUZ A;  2UUA Q;  3AMU A;  3SK8 A;  1P8L A;  5IIF A;  4EGV A;  4A3I H;  1EY9 A;  4GN4 B;  4N8F A;  2J4X A;  4TQU S;  3MXG A;  2ES2 A;  5M5Y H;  1K8A C;  4O2D A;  2PNH A;  1B50 A;  3K5N A;  1SAP A;  1A2T A;  2LY7 A;  2OF1 A;  3HKZ B;  5J22 A;  3CU7 A;  3S2H H;  5D14 A;  3FEW X;  2F4V L;  2FFK B;  5HY6 A;  4A3C G;  1A0I A;  4R4T A;  4NXM L;  3GTL H;  5G3L D;  1PFS A;  1F9R A;  4MHE A;  4LNQ A;  1PTO F;  4QUF A;  3I4L A;  4BXX G;  4JI4 Q;  1JT8 A;  2WKD A;  3NK9 A;  1SMX A;  5DNF A;  3M4Y A;  1XNQ Q;  3M4P A;  4DUZ L;  1X3E A;  2M2L A;  4IPD A;  1UWV A;  3CC2 A;  4ILW A;  2MO0 A;  3W1B A;  4H02 A;  3CQZ H;  1B44 D;  3S17 B;  3E0E A;  1STY A;  1YNJ D;  2E2H B;  3B6Y A;  3J80 L;  3T51 B;  3PIP A;  4YY3 L;  1Y8N B;  2CQO A;  2F0P A;  1KHI A;  5JJI A;  3I73 A;  3M4O B;  2UXD Q;  2OT2 A;  2JA5 G;  1YJN A;  1GVP A;  1HFG A;  4KMU C;  4GOP C;  4L63 B;  3RNU A;  4HN7 A;  1Y1W H;  4P74 A;  1DXM A;  4LUO A;  1PTO C;  2PQA A;  1KD1 C;  2DJG C;  2K1B A;  3HKZ G;  1W6K A;  5KGU A;  3OHX C;  5DAU A;  1J9O A;  2HQE A;  3K57 A;  2EXZ A;  3KLW A;  1HZB A;  2ICE C;  2NVX H;  3CMA A;  1KL9 A;  1DOL A;  1F77 A;  3J81 L;  2KED A;  1TWC H;  5C4X B;  1Z7T A;  1LTR D;  1B4O A;  2HIX A;  1E2W A;  1TWF H;  1BVS A;  4DV2 Q;  5C6A A;  5EAY A;  2I5M X;  1TII D;  3S14 H;  3QO2 A;  4LW1 A;  3BVZ A;  3R2I A;  5ISR A;  5C5L A;  1BO0 A;  2HD3 A;  1Q8K A;  2BE5 C;  4RA8 A;  5ELN A;  5CC4 A;  4A93 G;  2F0K A;  3K0Y A;  2YV5 A;  2AWO A;  4DV7 L;  2ZTC A;  1B3A A;  1AE3 A;  1E0B A;  1SFO H;  5HGQ A;  2N8N A;  1MD2 D;  2EIF A;  3QWN A;  4JI0 Q;  4K2K A;  1VCI A;  2CHB D;  1D5X C;  4JVZ A;  3Q23 A;  4A3L G;  1N33 Q;  2LKV A;  1KNE A;  4A76 A;  2X6L A;  4C3J G;  3U58 A;  4C3I H;  3E3X A;  1LAC A;  1PH9 A;  5JVG 3;  4K14 A;  2A74 C;  2JJQ A;  2C9O A;  1YI2 A;  3D6W A;  1QZG A;  1L1O C;  2KHJ A;  4JI1 L;  2L0C A;  1YVC A;  1IBL L;  1N34 Q;  1VQA A;  1TWA B;  2VZA A;  1X65 A;  2AQ2 B;  5T1G A;  3H09 A;  3ER0 A;  3HP3 A;  1VF7 A;  3NEN A;  3IAY A;  4G7H C;  1J5E Q;  3HOX B;  2AUK A;  4AQY Q;  4DK6 C;  5FLX c;  2R7F A;  3H15 A;  3VR5 A;  4IUU A;  4JI3 Q;  2NB0 A;  2F0Q A;  1DCZ A;  3F1Z A;  3UDX A;  1PA6 A;  4AYB G;  5IGD A;  3P75 A;  1QNK A;  3A55 A;  1JQY D;  1U4L A;  4OEL B;  3U9O A;  5I9P A;  3IL8 A;  5FOB B;  3OIP A;  5I4D A;  1GO3 E;  1H9S B;  5K36 G;  2VB3 X;  2OQK A;  2Q2H A;  2Z6B A;  3KF6 B;  4IUN A;  5A2Q E;  1EIH A;  2SDF A;  5HGT A;  2UUC Q;  2E2H H;  2R7Z H;  3RUZ A;  4IN3 A;  4CKB A;  1IYU A;  4Y7N B;  4LF4 L;  4GZY C;  5A2Q L;  4KHV A;  2Y0S B;  1PRT F;  4BA1 I;  2NVQ B;  1LT6 D;  1GUS A;  1WTH A;  4AH6 A;  2OXP A;  1JIC A;  4FXK C;  1KXL A;  2MHV A;  3MXN B;  3GV6 A;  4OXP A;  2R92 B;  4R4O A;  3I4M H;  4K8J A;  4L6T B;  2RDG A;  5C3X A;  1ESR A;  2NWG A;  1CKN B;  3A5U A;  3GO5 A;  1WCM B;  1XYI A;  3JAM E;  1SE2 A;  3KBG A;  3PUZ A;  1F9S A;  2WFW A;  1DM0 B;  5C4X H;  1HUN A;  4LF5 L;  4YWL A;  5J3B A;  3GTG B;  4UHV A;  4UAI A;  5IT9 c;  1W6J A;  2ZM6 Q;  1YHA A;  4P73 A;  4HED A;  4IJH A;  2PMZ B;  4WJW A;  3F2C A;  4H44 C;  4JCV E;  4RMF A;  3W2D A;  2JA8 G;  1AP0 A;  4M1U B;  1RJT A;  2B63 G;  4A3D B;  5EQ0 A;  5C0X G;  4JI5 Q;  3CHB D;  1CQV A;  1VQM A;  2JP1 A;  3GV3 A;  4LUZ A;  1PRT C;  3H0G B;  1VQK A;  1DYQ A;  3T1H L;  1D5Z C;  5FKA C;  2UXC Q;  4QIW E;  2Q8R E;  3AYH B;  2YU9 H;  1I5F A;  4HIO A;  4A3B B;  2K01 A;  1WI5 A;  2BA0 A;  3SEB A;  2WB1 E;  1G8Z D;  2FMC A;  3C1F A;  1ZEQ X;  1BCP B;  2F0D A;  3MEH A;  4KN7 C;  2KVM A;  2R93 H;  2N49 A;  1N32 Q;  1IHZ A;  2RKS A;  4DV0 Q;  3L7Z C;  4JBK A;  1NMG A;  1WD1 A;  2HHH Q;  4IFD H;  4F7X A;  1XTD A;  3A7L A;  5IY0 A;  1EEI D;  1TWA H;  4QY7 A;  3UE0 A;  1LT5 D;  3H3V H;  4OEM B;  1WCM G;  4CDE C;  4XQJ A;  1IYJ B;  1EQR A;  5I9O A;  1ZYR D;  3QR8 A;  4OO1 H;  2B29 A;  3SHL A;  4HIM A;  3HOX H;  4DR5 L;  3RN5 A;  1EIY B;  1EYA A;  5ELO A;  1G91 A;  4GNX B;  4DAY A;  4OX9 L;  1JE5 A;  2E8G A;  5EKI A;  3GTK H;  4A3D G;  3I4N H;  1CUK A;  4NXM Q;  2VUM G;  1Z9F A;  1G51 A;  4GLX A;  3A8J E;  1O7Y A;  4DV4 Q;  2X69 A;  4DR6 L;  5GAD C;  4LFA L;  4IPG A;  4LAA A;  4L5T A;  3NQI A;  3H0G G;  3WOE A;  2HQL A;  3PO2 B;  1SNO A;  4HJA A;  4F87 A;  1I94 L;  2F3V A;  1EY8 A;  2LFN A;  4A3B G;  2A5H A;  1EQV A;  1I4X A;  3SE0 A;  1VQ9 A;  4DUZ Q;  2PI2 E;  1FR3 A;  4GKK L;  5C0X J;  1B9N A;  2F0G A;  1X55 A;  1STB A;  5IYC H;  1JOR A;  4K2L A;  4Y52 H;  4Y7N H;  2CW0 C;  3MVV A;  1JMC A;  1WTP A;  1F2Y A;  4YY3 Q;  2NVQ H;  3PMF A;  2UXB L;  1YHB A;  1R4P B;  3S1R H;  3GD7 A;  1TS4 A;  1TVX A;  3CCU A;  2DNE A;  1EIF A;  5LHY 1;  2R92 H;  4IUR A;  3KF8 A;  4A3K B;  1XMO L;  3TS0 A;  3K5M A;  1PH5 A;  5C0X I;  1O7I A;  2WII B;  2IPK D;  3ND8 A;  3ZJY C;  3J7A 5;  3VYT A;  2AHO B;  2ALY B;  5IP7 G;  3DEP A;  2ENB A;  3C1E A;  1STH A;  4CKC A;  1CKO A;  3HFZ B;  4KD4 A;  3HKZ E;  3DMU A;  4A75 A;  3GTG H;  2IWH A;  3HOW H;  1QVF A;  3BJU A;  1KC8 C;  4HJ5 A;  2NN6 G;  2VXW A;  4PZ8 A;  5FK9 C;  4DGZ A;  4K5W A;  2VB2 X;  4A3D H;  2DNC A;  5KIX A;  4NDX A;  4FNF A;  3I90 A;  3QG1 A;  2CKZ B;  2JEB I;  1LT4 D;  1SBB B;  2A68 C;  1EU3 A;  2JA7 H;  3PUY A;  3A7A B;  4RKB A;  1HNW L;  1HZC A;  1PZK D;  1OXX K;  2F0W A;  4CGY B;  3SR1 A;  1IL8 A;  4KD3 A;  5KEE A;  1SYC A;  1YNN C;  3D8G A;  4A3J B;  3K58 A;  4HTH A;  1SLJ A;  1ILQ A;  4DUY L;  3FP9 A;  5AFW A;  1SYF A;  5IOD A;  1JOQ A;  3G6J B;  1I4P A;  4A3K G;  1EFI D;  4IUP A;  4A3I B;  2CFM A;  2N78 A;  1F2Z A;  2YTX A;  1EUJ A;  3GTJ B;  4JW0 A;  2SNM A;  2QW7 A;  4JI1 Q;  2I0Q A;  3NBH B;  1IBL Q;  1S5D D;  1ENC A;  3TRZ A;  1PTO B;  5JEA H;  2ZJR A;  2HDM A;  2DJF C;  1L0X B;  1SSO A;  1SE3 A;  1MSG A;  1EU4 A;  1VQC A;  2VY3 A;  3BZD B;  3FDT A;  4LF9 Q;  4FF1 A;  3S2H B;  1C4Q A;  3TP6 A;  4O1N A;  3K5L A;  5DM7 3;  5C5M A;  1VMP A;  5CV5 A;  2Q2U A;  1QZH A;  2L1B A;  1CZG A;  1CKM A;  3KBX A;  4I7Z C;  4Q0F A;  2HIV A;  2HUG A;  4NP5 A;  1E2V A;  1F9Q A;  2B3G A;  3ERS X;  2DY7 A;  4N9T A;  2ID0 A;  1X54 A;  4K0K L;  3PO2 H;  2EY5 A;  1HHV A;  1IBK L;  3NQT A;  4R4Q A;  5JOB A;  1L2F A;  2RCN A;  2P5Z X;  4KHP L;  3KDF B;  1HNZ L;  1Y69 U;  3CKI B;  4I7A A;  3LWU A;  4K8I A;  1MHW C;  2AKW B;  2M9V A;  4KHZ A;  5M5X H;  5M9O A;  2LMC B;  4U68 A;  3QOL A;  3A0J A;  4WJ3 M;  2K5Q A;  2OWO A;  1HQM C;  2RSO A;  2EE1 A;  5IP9 H;  5KNC A;  2XTI A;  1DOK A;  1VDZ A;  4A3I G;  4DU9 A;  2IHE A;  3GQB A;  3HS0 C;  4JI2 Q;  4C1N I;  1PFN A;  2EYO A;  4BWG B;  4P2C B;  3BDC A;  2XRQ D;  5LMN W;  1Y1W B;  1VQ6 A;  2NN6 I;  3KK7 A;  1G6Z A;  2A6E C;  1L1O B;  5M3F B;  5CBE E;  3MAQ A;  4A3K H;  2GVA A;  4HJ9 A;  3NWT A;  1K73 C;  3SVM A;  2VQF L;  4GLA C;  2K03 A;  1G2T A;  4IPC A;  1NBW A;  1TWC B;  4ME5 A;  4Z9C B;  2AMC B;  1XPR A;  2WV6 D;  4EX5 A;  1TWF B;  1E22 A;  1MSH A;  1TQO A;  4UP8 A;  4FO2 A;  4HJ8 A;  4EQN A;  4ABN A;  3S14 B;  2PZT A;  1S5E D;  3ONA B;  2PO4 A;  5BN5 A;  4B3T Q;  4K5V A;  4LWC A;  1KAA A;  1DOM A;  2TMP A;  4LMQ D;  4HMJ A;  3OOC A;  3NXW A;  5L37 A;  2R7D A;  4GLV B;  1BDO A;  2Q2I A;  3CCJ A;  3T13 A;  1K8O A;  3C3L A;  3I2Z A;  4KY7 A;  2EJF C;  3D6C A;  1F2L A;  3CPW A;  1EOT A;  3VR4 A;  3SK6 A;  2RF4 A;  3T1H Q;  4ZKB B;  4H13 C;  3UDG A;  3TBI B;  4DNI A;  4A3J H;  1GUW A;  4C3I B;  1CHQ D;  3U9S A;  4A3M B;  2O2L D;  3S2D H;  1D1K A;  1Y1W G;  2L9H A;  1DGS A;  4FYD A;  1C9O A;  2Y0S E;  1HNX L;  4BBR B;  4DR3 Q;  3GTJ H;  3GTO B;  1GUO A;  2KCT A;  2CH4 W;  3BU2 A;  1K8M A;  1PTO H;  4JI8 Q;  1JWU D;  3LWE A;  4ZK9 B;  4LFC L;  5C44 B;  2F0S A;  1YHQ A;  3FMC A;  3EQL C;  3NTH A;  3I7F A;  1X3G A;  3OIQ A;  3STB C;  4DNT B;  2BA1 A;  1Q90 A;  4YHH L;  5AJ3 L;  4IZ8 A;  2XGT A;  3WOF A;  1XPU A;  1FYC A;  1MBY A;  2LS0 1;  2PYK A;  3P1H A;  4F88 A;  2PQE A;  2K5D A;  3SXH A;  1B9M A;  4LF8 Q;  4DFA A;  2K5W A;  2PMZ E;  1LTG D;  2G5D A;  4DR6 Q;  3D0F A;  5JJK A;  1B8A A;  3EBE A;  5LMN L;  4K6D A;  3J80 E;  1WD0 A;  2NYZ D;  2B39 A;  4QF4 A;  1PRT B;  3NEL A;  4DR2 Q;  3KOJ A;  4C3I G;  4P71 A;  1CSP A;  4A3M G;  2R7Z B;  1Y8P B;  1STG A;  5E4W C;  4XQQ A;  4GKK Q;  3VR3 A;  2XNA C;  1AEX A;  2RA4 A;  4JI6 Q;  2RHS B;  5E3F A;  5DEH A;  2RDH A;  5FLX L;  1SYB A;  3KJO A;  3OW7 A;  4YCU A;  2A1A A;  3I70 A;  2PQA B;  2PPB C;  2B2Y A;  3HOY B;  5T1I A;  3PV0 A;  4BS9 A;  3HZX A;  4ZYS A;  2UXB Q;  5M3F H;  1FL0 A;  1SYG A;  4JI7 L;  3J81 E;  1I3Q H;  4G7O C;  1VF5 C;  2BH8 A;  1GKH A;  3I4M B;  1FD7 D;  3RLF A;  1V43 A;  4MN3 A;  3EN2 A;  5M3M H;  3NHH A;  3MXU A;  2EJG C;  2Q8T A;  3C46 A;  3HOU B;  1HR0 W;  2YTY A;  3A74 A;  3R93 A;  3W3A A;  5C3E B;  1Q1E A;  4ALP A;  2K32 A;  3NWS A;  2ICI A;  4JK1 C;  1H95 A;  1OXT A;  4IOA A;  3BYY B;  2E76 C;  3PIO 3;  3OPO A;  1PH2 A;  1ONL A;  4X3U A;  3BS1 A;  3TP5 A;  4N8X 1;  3MWY W;  2KHI A;  1A8V A;  4QJF A;  4TKO B;  4C1N K;  4X3S A;  2F0H A;  4FP5 D;  1WTW A;  3NP8 A;  2TSS A;  1H9M A;  2L15 A;  2B2V A;  2K6A A;  1STE A;  2SEB D;  4JV5 L;  1HA5 A;  4KY5 A;  2R7Z G;  3VR2 A;  1SND A;  1X6O A;  1VQO A;  2E2D C;  1HPC A;  2WP8 J;  2YU9 B;  1GJX A;  1JJC B;  3PIO A;  4HJ7 A;  3C2P A;  4BY7 H;  3LNN A;  3MHB A;  1EY4 A;  4P75 A;  1BBU A;  1PFB A;  5CGK A;  2JEA I;  1ET6 A;  1YJW A;  4G4K A;  1VQ5 A;  1IBM Q;  4A3M H;  1EIG A;  3HOY G;  2R93 B;  1B7Y B;  1TWG H;  1VQL A;  4L5S A;  3PUX A;  5EPL A;  5IT9 L;  3KYH C;  2NZ1 D;  2Z1C A;  4WOR A;  1K3B C;  5JVH 3;  2UUB L;  2QIL A;  5E7N A;  4DUY Q;  4JG2 A;  2YTV A;  3I4M G;  3KLS X;  2F0U A;  3A54 A;  2EY6 A;  2XIW A;  1MIU A;  1NR2 A;  4BBR H;  5IGE A;  3M4Q A;  1SR3 A;  3GTO H;  4G57 A;  3HOU G;  4HAE A;  3GTP B;  3TRE A;  1GHK A;  4FXD A;  1VQH A;  5C4X G;  1IKM A;  4OWX B;  2A73 B;  2DN8 A;  1HZA A;  4ZUI A;  1PDQ A;  5C44 H;  4ME3 A;  3PO3 B;  4CJ1 B;  2DUD A;  3EA6 A;  1E1O A;  4A3G B;  3JAM i;  2JQO A;  3RLO A;  2X6G A;  3I55 A;  5G3L F;  3K0X A;  1KDC A;  3KLS A;  2JK8 A;  3CP0 A;  3GTK B;  2CWP A;  3GDE A;  1BXT A;  3I4N B;  2MUY A;  1W2B A;  3P20 A;  4QMG A;  2ZJP A;  2F0E A;  1UUP A;  1WFQ A;  2KJX A;  3X3N A;  4B3R Q;  4LK1 C;  1CSQ A;  2E5L Q;  1EWH A;  2EDG A;  3S15 H;  3K59 A;  4DN4 M;  1IBK Q;  2HCC A;  3S1N B;  4RKL A;  1G6P A;  1J8I A;  1NJI C;  2VS1 A;  1PYS B;  2EQS A;  4KHP Q;  1SMY D;  4RG1 A;  1AZQ A;  1HNZ Q;  3BVM A;  4PNY A;  3OTO L;  2R93 G;  1SEB D;  1HR0 L;  1RKN A;  3DEO A;  2RQX A;  1GUG A;  1YEZ A;  3S9W A;  4IFD G;  1RD9 D;  4DV6 L;  1CA5 A;  1BBW A;  2K14 A;  2EYH A;  4FXG C;  1LTL A;  4RH6 A;  2K28 A;  1KLU D;  3HOY H;  2K4K A;  1ICW A;  3BDL A;  2JSO A;  3S1R B;  1PH8 A;  1GM5 A;  4HIK A;  1FJG L;  2C5C A;  2EPB A;  2FJ2 A;  2A6H D;  1BF4 A;  1VMC A;  1ENF A;  5EKL A;  4JYA L;  4UP7 A;  4OO1 G;  3OYY A;  3HOX G;  2VQE L;  2E2I H;  2L5T A;  4B3M Q;  5BR8 Q;  1E2Z A;  3T16 A;  5LMU Q;  3HOU H;  1J6Q A;  3HOV B;  1FGU A;  5C3E H;  2VQF Q;  3I4N G;  2QA4 A;  3Q0A A;  2EYL A;  3UI2 A;  3HOW B;  5BN4 A;  2F03 A;  4BBS H;  1TT2 A;  4DV5 Q;  1MJC A;  4KTA A;  1YNJ C;  4RWS C;  1OTC A;  3PF5 A;  3K80 C;  5CR3 A;  4X65 L;  1Y14 B;  5IWA Q;  3M9B A;  4R1J A;  2ZXO A;  1CKN A;  1KAB A;  3TEH B;  1A62 A;  3TN2 A;  3FRP B;  5IYC G;  2JA7 B;  2MQH A;  1TU2 B;  2L55 A;  5IGB A;  2BDO A;  2NTT A;  1CK1 A;  2B2Y C;  1LLR D;  2Y0S G;  3E5S A;  5FO7 B;  1IW7 D;  2R61 A;  2FIN B;  1O7L A;  1KLG D;  1I4Q A;  3R2T A;  4R8N A;  2N3S A;  4H0L C;  1PH6 A;  2ZJQ A;  4HMI A;  3WDN A;  4DNR B;  1B3Q A;  2R92 G;  4JBJ A;  3DWA A;  2K05 A;  4IFD J;  3ND9 A;  4ODG A;  5IGF A;  4CDC C;  4LFB L;  3GTP H;  1HNX Q;  1ICF B;  3MZ5 A;  3DLL A;  2JA6 H;  5I2X A;  3CCE A;  1QCB D;  1TWH B;  3CRK C;  1NAP A;  3V96 A;  2UUA L;  2E75 C;  2A69 D;  3HOW G;  3PO3 H;  2G9H D;  1PZJ D;  3Q22 A;  1PMR A;  1QWY A;  4A3F H;  1A2U A;  1Q12 A;  4A3G H;  4LFC Q;  1XPO A;  4F8M A;  1TY2 A;  3A8I E;  3CPF A;  5IYB H;  2B2V C;  4IAL A;  2F4V Q;  1CZW A;  1BCP D;  2AQ3 B;  2K7V A;  4HSP A;  4XT3 B;  5AJ3 Q;  4IFD I;  3AB9 A;  1K9M C;  1U4M A;  2MJ8 A;  2MGS A;  1VQG A;  4POG A;  2JA7 G;  3H3V I;  4LUV A;  2KCC A;  2A19 A;  3CAM A;  3MFY A;  3HKS A;  3S1N H;  4A3E B;  4OIK A;  1QNU A;  3NTI A;  1Q7Y C;  5LMN Q;  1EY5 A;  3E9H A;  3PQI A;  5TSS A;  4OO1 I;  5EPJ A;  5C3W A;  2EVB A;  5M5X B;  1TY0 A;  2NTS A;  2IL8 A;  2A8V A;  1EEF D;  4TRD A;  1Q8I A;  2F0V A;  5JPN C;  4HCE A;  5KYL A;  1SN8 A;  3CRL C;  4NXN L;  3Q8D A;  4KLK A;  3RZD H;  4B9W A;  2RBM A;  4DV3 L;  3H91 A;  3KF8 B;  4LF6 L;  2JE6 I;  3DM1 A;  4C3H B;  4DXG A;  5JEA G;  4EQO A;  1VQ8 A;  1H9J A;  4YIJ A;  3JAM c;  3OSO A;  4FF3 A;  4A4I A;  3IRB A;  4JI7 Q;  4C2M H;  3K8A A;  5GAG C;  1G2S A;  1UNS A;  1F9P A;  4NW2 A;  1R4Q B;  4X66 L;  2OTJ A;  3HOV H;  2IT1 A;  2WIN B;  1M90 C;  2J7Z A;  1JOO A;  1PV4 A;  2E2J B;  1FVI A;  3WWV A;  1TS3 A;  1LTI D;  1EWC A;  5JPM C;  1ML0 D;  3PO2 G;  2NUC A;  3R8B A;  1PLF A;  4DAM A;  3U50 C;  1S40 A;  2EYF A;  4IUQ A;  1SDF A;  4A3E G;  3TSS A;  4DV2 L;  5EGT A;  3VR6 A;  1ESF A;  4J6H A;  5J39 A;  1ASY A;  4UP9 A;  4DV7 Q;  4JV5 Q;  1SYE A;  3MC0 B;  5IP9 G;  1UE7 A;  1I6H B;  4B9X A;  3TDQ A;  2LSS A;  1Y1V B;  3BZC A;  3EIV A;  3EJI A;  2L11 A;  3S2D B;  5ELB A;  4EQP A;  4I65 A;  1O78 A;  4JI0 L;  3KJP A;  3TQY A;  2ASB A;  1Q82 C;  3HOZ B;  1GUT A;  4JC0 A;  1N33 L;  4MTN A;  5IGC A;  1XXG A;  2IW3 A;  4IJL A;  4GOP B;  2XWJ B;  3QOJ A;  2EYP A;  1RTN A;  2H1E A;  2K5V A;  1YNX A;  1TWH H;  1WTX A;  3ICE A;  4R8I A;  4DR7 L;  5JEA J;  2F4I A;  4O0A A;  1QJO A;  1N34 L;  1A15 A;  1ASZ A;  1NUC A;  2Z0S A;  4XTC S;  2KCN A;  3HEJ A;  1O7Z A;  3PUW A;  4C56 C;  2FXQ A;  3VYR A;  3W5O A;  1WVL A;  1MGS A;  3MEF A;  1HZ9 A;  1S72 A;  3F8T A;  1J5E L;  1SNP A;  2RHQ B;  5JJL A;  3D4R A;  3URY A;  4JI3 L;  1K83 H;  1Q86 C;  2K52 A;  4BY1 B;  2XSC A;  3CCQ A;  5KND A;  1HTL D;  1ZKO A;  5A35 A;  4A3E H;  3RZO B;  1CI3 M;  5FO8 B;  5CV9 A;  4KJN A;  1S5B D;  4A3J G;  3ITP A;  1EQQ A;  1PTO D;  4POF A;  2HCI A;  4FF2 A;  4R4C A;  5COY A;  4IQZ A;  1X3Q A;  2IJ0 A;  1PXU A;  1D2B A;  1ZYR C;  4KK7 A;  1X56 A;  5IYD H;  2KCM A;  3RR5 A;  1UEB A;  1TS5 A;  4LF4 Q;  1ENA A;  2B8F A;  2JXM B;  2L4N A;  1L0W A;  4GN3 B;  1UAP A;  4CBV A;  2UUC L;  4XYQ A;  5I6Y A;  1X9N A;  3RMH A;  1KDA A;  4C3H H;  1N9W A;  1QOH A;  3KDF A;  1U9R A;  4UDU C;  1I3Q B;  5IGG A;  1X3F A;  1FJG Q;  4TSS A;  2F0I A;  1IL2 A;  5M3M B;  2BE5 D;  4JYA Q;  3T1Y L;  1F2M A;  1RCV D;  4XDX A;  4KKT A;  1WOC A;  1LAB A;  1MKH A;  2MP1 A;  2WAQ B;  1V1P B;  5H1S E;  4HCS A;  3CCR A;  3OWE B;  3RN2 A;  2E2J H;  2NZO A;  5JJZ A;  1A63 A;  1SE8 A;  2B2U A;  4LF5 Q;  3PCO B;  2F52 A;  3L0O A;  1PYW D;  2F1M A;  3G48 A;  2AUJ D;  4G7Z C;  3BYT B;  1JOK A;  4DKA C;  3NSW A;  2EYM A;  3J7A F;  4PMB A;  3ZYY X;  3OWF A;  1BR9 A;  3J7Y W;  3S24 A;  1OO9 B;  4DR4 L;  4JOI A;  5ELE A;  2CWA A;  3N52 A;  2IX1 A;  4XYO A;  3VA5 A;  4OON A;  4BY7 B;  1HXY D;  3D4W A;  4JI5 L;  1G29 1;  1I6H H;  1DD2 A;  4KN4 C;  1Y1V H;  2NVT B;  2V4D A;  1NMF A;  1TWG B;  1PH4 A;  2Z9H A;  1IKL A;  3CCV A;  1H9K A;  5M3F G;  2I07 B;  3VDY A;  3G7L A;  3FPP A;  3HOZ H;  3FKI B;  2PI2 A;  3NPP A;  2VW9 A;  5M3M G;  1CFM A;  2BDN A;  1X32 A;  2ZTD A;  1QUQ A;  3DWQ A;  3T4A C;  1T5E A;  1SE4 A;  4DV1 L;  5CV4 A;  4BA2 I;  4DV0 L;  1SNQ A;  2RDF A;  5CV6 A;  3TME A;  4LFB Q;  2HHH L;  3L2P A;  1X3P A;  1B2T A;  5CBA E;  3MTS A;  1E24 A;  1HA6 A;  2JA5 B;  5C4J H;  4DR5 Q;  5FJ8 H;  1YZ6 A;  4MTK A;  1CM9 A;  1IZ6 A;  4OX9 Q;  2JYO A;  3TP7 A;  1O80 A;  3FVQ A;  1EYG A;  1MJE A;  4LFA Q;  4JPB W;  3AFP A;  4BY7 G;  4BY1 H;  5E4X A;  1VQP A;  3UDI A;  3S15 B;  2K33 A;  1UE1 A;  1K28 A;  2N88 A;  1QB5 D;  1I94 Q;  2ZXP A;  3RZO H;  4DV4 L;  1HJP A;  3I4O A;  1S4Z A;  5FLX E;  5FO9 B;  3PIP 3;  1NR4 A;  1EQT A;  4RGT A;  1STN A;  4LJZ C;  4DAV A;  4CJ0 B;  2E74 C;  2NVY H;  3DM3 A;  1II3 A;  3FKI G;  1KQS A;  1OXU A;  4BBR G;  1PH1 A;  5D3D A;  5K5P A;  1Y8O B;  4NXN Q;  2KOL A;  3MXP A;  4A93 B;  2DY8 A;  3K81 C;  4RHR A;  2EY1 A;  4DV3 Q;  4LF7 L;  1YJ9 A;  4LF6 Q;  5CYU A;  1STA A;  5C44 G;  1D7Q A;  4GS3 A;  1YBY A;  3VYS A;  5GAH C;  3F2U A;  3W1G A;  3NUC A;  2E2I B;  4RGN A;  5C4Z A;  4RFB A;  4KKS A;  3HRZ C;  2F0T A;  4YCW A;  1K3R A;  4V0B A;  1XMO Q;  3OMG A;  4QQB X;  3NTK A;  4CJ2 C;  1WTQ A;  3SGI A;  4OWT B;  1PRT D;  3M3Y B;  4C3J B;  1JJ2 A;  1IXR A;  2Z8L A;  4B3S L;  1V1Q A;  4X66 Q;  1L0Y B;  4FF4 A;  4BBS B;  4RGO S;  1EY0 A;  3PSI A;  4RAU C;  2B2W A;  2K04 A;  1WYD A;  4P72 A;  4GKJ L;  4L8J A;  5KNB A; 
#chains in the Genus database with same CATH homology
 4IPH A;  4GNX C;  1OTC A;  1QVF A;  3PF5 A;  1T9H A;  2ZM6 L;  3K80 C;  4DV5 L;  3BJU A;  4DR1 L;  1KC8 C;  4X65 L;  2UU9 Q;  1N36 L;  1XNR L;  4HJ5 A;  1Y14 B;  2NN6 G;  4UPA A;  1OXS C;  3J80 i;  4PZ8 A;  1VQB A;  2D0O A;  3M9B A;  5IWA Q;  2VNU D;  2I5L X;  4R1J A;  2ATW A;  5IWA L;  4A3D H;  1CKN A;  1C7Y A;  3TEH B;  1A62 A;  1U5K A;  3TS2 A;  5IYC G;  4A3C H;  4X6A H;  2MQH A;  2CKZ B;  2JEB I;  4L5R C;  1KIX A;  3CF5 A;  1HNW Q;  3J7Z C;  2WB1 G;  2AWN A;  4X62 L;  1SRU A;  2UXC L;  4PG3 A;  5GQO A;  3PUY A;  2JA7 H;  1HNW L;  1HZC A;  2NVT H;  1OXX K;  4BXX H;  1QVG A;  2Y0S G;  1QUQ B;  3JC6 6;  1P16 A;  2K50 A;  1AE2 A;  1KAW A;  3NEM A;  4PZ6 A;  2N3S A;  4FDB A;  3J81 j;  1PH6 A;  2ZJQ A;  2ZTE A;  4JBM A;  1RIP A;  1HH2 P;  3CC4 A;  1Q1B A;  3FKI H;  1SLJ A;  1PVO A;  2VL6 A;  2Z6K C;  4DUY L;  1E3P A;  1SRO A;  2R92 G;  1N32 L;  2WAQ G;  3AQQ A;  3FP9 A;  4DPG A;  3J81 i;  4JBJ A;  4X64 L;  4IFD J;  1Z47 A;  5C3E G;  4A3K G;  3ULL A;  2CFM A;  4LFB L;  2N78 A;  2YTX A;  1HNX Q;  3GTP H;  1EUJ A;  2UUA Q;  2JA6 H;  3DLL A;  1P8L A;  3CCE A;  4BBS G;  3AFQ A;  4A3I H;  4JI1 Q;  2MNA A;  1XMQ L;  2UUA L;  2I0Q A;  3NBH B;  1IBL Q;  4DR7 Q;  2D0P A;  1EOV A;  4GN4 B;  4PMW A;  3HOW G;  3TRZ A;  3PO3 H;  1Q81 C;  1KRS A;  4HID A;  2ZJR A;  3FHW A;  4TQU S;  4A3F H;  1Q12 A;  2VY3 A;  1VQC A;  4A3G H;  4LFC Q;  2ES2 A;  2JA5 H;  5M5Y H;  1K8A C;  4LF9 Q;  1XPO A;  1LUZ A;  4JBW A;  4O2D A;  2K5H A;  2PNH A;  3PUV A;  3CPF A;  5IYB H;  4JOI C;  4LF9 L;  2F4V Q;  4L5Q A;  3S2H H;  2Q2U A;  1QZH A;  3J80 c;  2F4V L;  1CKM A;  5HY6 A;  4A3C G;  1A0I A;  5AJ3 Q;  2HIV A;  4R4T A;  4PZ7 A;  4NXM L;  3GTL H;  4IFD I;  4K0K Q;  1K9M C;  2B3G A;  1D8L A;  1PFS A;  3ERS X;  1VQG A;  4LNQ A;  2ID0 A;  4POG A;  2JA7 G;  1X54 A;  4LUV A;  3H3V I;  4K0K L;  4BXX G;  3PO2 H;  1K0R A;  1U0L A;  2V1C C;  2A19 A;  2F3I A;  3CAM A;  1IBK L;  4GN5 A;  3G71 A;  3HKS A;  4JI4 Q;  1JT8 A;  4R4Q A;  1SMX A;  1VQ4 A;  3S1N H;  1Q7Y C;  1L2F A;  1XNQ Q;  2D62 A;  2RCN A;  5LMN Q;  3E9H A;  2OTL A;  3M4P A;  4KHP L;  4DK3 C;  3KDF B;  1HNZ L;  4OO1 I;  4DUZ L;  1X3E A;  4IPD A;  1UWV A;  3CC2 A;  2A8V A;  2MO0 A;  3W1B A;  2AKW B;  4KHZ A;  4OWW B;  1S3O A;  5M5X H;  4H02 A;  3CQZ H;  3A0J A;  4WJ3 M;  2OWO A;  3E0E A;  1SN8 A;  4NXN L;  1NE3 A;  3Q8D A;  4XIG S;  2MFI A;  4KLK A;  3J81 c;  3B6Y A;  4A93 H;  3S17 H;  3RZD H;  3PIP A;  2JA6 G;  5IP9 H;  4DV3 L;  2XTI A;  3KF8 B;  4YY3 L;  4LF6 L;  4A3I G;  2JE6 I;  2CQO A;  2H5X A;  3PO3 G;  2IHE A;  4JI2 Q;  1KHI A;  5JEA G;  3KF6 A;  5JJI A;  1VQ8 A;  3PF4 A;  4A3F G;  2UXD Q;  4A3G G;  2EXD A;  4JI2 L;  5LMN W;  3CD6 A;  2JA5 G;  1YJN A;  1VQ6 A;  2NN6 I;  3JAM c;  1L1O B;  1GD7 A;  1GVP A;  4A3L H;  4A4I A;  3IRB A;  5FLM G;  4GOP C;  4C2M H;  3K8A A;  3RNU A;  5IYB G;  4A3K H;  4JI7 Q;  3M3Y H;  2GVA A;  4C3J H;  3LGJ A;  4P74 A;  5GAG C;  4HJ9 A;  3T1Y Q;  1Y1W H;  2VUM G;  2IX0 A;  4LUO A;  2PQA A;  4X66 L;  2IT1 A;  1KD1 C;  1M90 C;  3HOV H;  2OTJ A;  1K73 C;  2VQF L;  3HKZ G;  1PV4 A;  3M4O H;  4GLA C;  1VQF A;  1FVI A;  4IPC A;  3WWV A;  1NBW A;  2Q2T A;  1XPR A;  2AMC B;  3KLW A;  1HZB A;  2NVX H;  3CMA A;  1KL9 A;  1W3S A;  4EX5 A;  1UE6 A;  3PO2 G;  1TWC H;  1VS0 A;  1E22 A;  2HIX A;  4UP8 A;  4HJ8 A;  4DAM A;  2UU9 L;  4AIM A;  1TWF H;  3U50 C;  1S40 A;  1BVS A;  4DV2 Q;  5EAY A;  3KFU A;  4A3E G;  2I5M X;  4B3T Q;  2BH2 A;  4LWC A;  3S14 H;  4LW1 A;  4DV2 L;  4B3T L;  4YCV A;  2R7D A;  4GLV B;  4DR4 Q;  1I50 H;  2Q2I A;  3CCJ A;  3ULP A;  1Q8K A;  5ELN A;  1ASY A;  4UP9 A;  4DV7 Q;  3I2Z A;  4JV5 Q;  4A93 G;  3CPW A;  2YV5 A;  3U4Z A;  2AWO A;  5IP9 G;  2OQ0 A;  4DV7 L;  1UE7 A;  2ZTC A;  1AE3 A;  1SFO H;  2RF4 A;  5HGQ A;  2N8N A;  2JA9 A;  3T1H Q;  2LSS A;  3UDG A;  2EIF A;  3OW2 A;  3BZC A;  4JI0 Q;  3EIV A;  4DNI A;  3I56 A;  1VCI A;  5GRO A;  4A3J H;  3ULJ A;  4JI0 L;  3S2D H;  3KJP A;  1E1T A;  3TQY A;  4A75 A;  1N33 Q;  2ASB A;  4A3L G;  4A76 A;  1Q82 C;  3U58 A;  4C3I H;  4JC0 A;  3F2B A;  1Y1W G;  1DGS A;  1PH9 A;  1N33 L;  4MTN A;  3RLN A;  3HOV G;  1C9O A;  2JJQ A;  4IJL A;  2Y0S E;  4GOP B;  1YI2 A;  1R9T H;  1QZG A;  1HNX L;  1YIT A;  4DR3 Q;  2K5V A;  3GTJ H;  3M85 A;  4DV1 Q;  1L1O C;  1YNX A;  2KEN A;  1TWH H;  2KHJ A;  4DAY B;  4JI1 L;  3ICE A;  2KCT A;  4NPS A;  1YVC A;  4DR3 L;  1N34 Q;  1IBL L;  1VQA A;  3BU2 A;  2VZA A;  5JEA J;  4DR7 L;  1C0A A;  1X65 A;  4JI8 Q;  3CCL A;  4MNO A;  4O0A A;  3CME A;  3CCS A;  2WAQ E;  1N34 L;  1ASZ A;  5FLM H;  4LFC L;  1VQ7 A;  4JI8 L;  3ER0 A;  2Z0S A;  1YHQ A;  1QVC A;  4XTC S;  3I7F A;  1X3G A;  3NEN A;  3K7U C;  4YHH Q;  3PUW A;  3STB C;  1PH7 A;  1J5E Q;  2FXQ A;  2DGY A;  4AQY Q;  3W5O A;  4DK6 C;  2BA1 A;  3MEF A;  4YHH L;  1HZ9 A;  2R7F A;  2XGT A;  5FLX c;  3F8T A;  5AJ3 L;  3H15 A;  2RHQ B;  1S72 A;  1J5E L;  2CCZ A;  1XPU A;  4JI3 Q;  5JJL A;  3F1Z A;  1BKB A;  3UDX A;  1PA6 A;  4AYB G;  4LF8 Q;  2LXJ A;  4JI3 L;  2PMZ E;  4WJ4 A;  1K83 H;  1Q86 C;  1RL2 A;  2K52 A;  3CCQ A;  4JI4 L;  2K75 A;  2KBN A;  4EQ5 A;  4LF8 L;  4DR6 Q;  3CW2 C;  3D0F A;  5JJK A;  1B8A A;  4A3E H;  3EBE A;  5LMN L;  1XNQ L;  1M1K C;  4A3J G;  4GNX A;  1EQQ A;  1VQN A;  4POF A;  1GO3 E;  1NY4 A;  4R4C A;  3NEL A;  5K36 G;  1TXY A;  4DR2 Q;  3KOJ A;  2OQK A;  4P71 A;  1CSP A;  4A3M G;  1EFW A;  2Q2H A;  4GKK Q;  1X56 A;  4DR2 L;  3KF6 B;  2JA8 H;  5IYD H;  2B63 H;  2KCM A;  3RR5 A;  1UEB A;  2UUC Q;  4JI6 Q;  2E2H H;  4LF4 Q;  2RHS B;  2R7Z H;  2NZH A;  1L0W A;  4GN3 B;  5DLQ E;  2UUC L;  4JI6 L;  1X9N A;  4LF4 L;  3KJO A;  1PH3 A;  4YCU A;  2K5N A;  2A1A A;  4C3H H;  2PQA B;  5M5W H;  1N9W A;  3KDF A;  4LF7 Q;  4BA1 I;  2UXD L;  4NB3 A;  1WJJ A;  3PV0 A;  1X3F A;  3UE1 A;  1PYB A;  4AH6 A;  5IE8 A;  1FJG Q;  2UXB Q;  2GVB A;  1FL0 A;  5M3F H;  4JI7 L;  1IL2 A;  1I3Q H;  1KXL A;  4JYA Q;  2BH8 A;  1GKH A;  3MXN B;  3GTQ H;  3T1Y L;  3RLF A;  2Z6K A;  1V43 A;  1WOC A;  4OXP A;  1MKH A;  3EN2 A;  5M3M H;  1JJG A;  4KI0 A;  4R4O A;  3I4M H;  5H1S E;  3CCR A;  3RN2 A;  1HR0 W;  2YTY A;  2E2J H;  3A74 A;  2NZO A;  1CKN B;  1A63 A;  4B3S Q;  3A5U A;  3GO5 A;  1Q1E A;  1SE8 A;  4ALP A;  2R6G A;  4LF5 Q;  1E7Z A;  2F52 A;  3PCO B;  3L0O A;  1H95 A;  1OXT A;  3PUZ A;  4IOA A;  3G48 A;  1AH9 A;  5C4X H;  2WFW A;  1LM0 A;  1WCM H;  4DKA C;  2OCE A;  4YWL A;  1PH2 A;  4LF5 L;  4GKJ Q;  5J3B A;  3GTG H;  1VQD A;  5IT9 c;  2KHI A;  1A8V A;  4QJF A;  4J15 A;  3CC7 A;  4DR1 Q;  4TVA B;  2ZM6 Q;  1YHA A;  4P73 A;  3F2C A;  4IJH A;  1N36 Q;  1XNR Q;  1Q46 A;  3G6E A;  3S24 A;  4JCV E;  2L15 A;  4RMF A;  4DR4 L;  4JOI A;  2JA8 G;  5IYD G;  2CWA A;  2B63 G;  2IX1 A;  5C0X G;  4JI5 Q;  4JV5 L;  4OON A;  2R7Z G;  1JB7 A;  1X6O A;  1VQO A;  1VQM A;  1LYL A;  4LUZ A;  2WP8 J;  4JI5 L;  1VQK A;  1JJC B;  2VUM H;  1G29 1;  3PIO A;  4HJ7 A;  4BY7 H;  1I6H H;  4X62 Q;  4P75 A;  3T1H L;  1BBU A;  2UXC Q;  4QIW E;  2YU9 H;  3AYH B;  3H0G H;  1Y1V H;  3K7A H;  3U4V A;  1I5F A;  1NMF A;  4HIO A;  1PH4 A;  2JEA I;  1WI5 A;  2BA0 A;  3STB D;  2WB1 E;  3CCV A;  1YJW A;  1VQ5 A;  1IBM Q;  4A3M H;  3HOY G;  5M3F G;  3AEV A;  4A3B H;  2UUB Q;  1B7Y B;  1TWG H;  1VQL A;  4L5S A;  3PUX A;  3VDY A;  2HT1 A;  3M7N A;  2C35 B;  3KYH C;  1IBM L;  3HOZ H;  2UUB L;  2PI2 A;  5GAE C;  2R93 H;  3PGZ A;  3CCM A;  5E7N A;  4IOC A;  2VW9 A;  3BZK A;  5M3M G;  4DUY Q;  1EWI A;  2N49 A;  2YTV A;  4JG2 A;  3I4M G;  1N32 Q;  2ZTD A;  1QUQ A;  3F2D A;  4DV0 Q;  1MIU A;  4BBR H;  3M4Q A;  4DV1 L;  1SR3 A;  3L7Z C;  4X64 Q;  1NMG A;  4JBK A;  3GTO H;  4BA2 I;  2HHH Q;  4DV0 L;  3HOU G;  1XTD A;  5IY0 A;  3TRE A;  4LFB Q;  1TWA H;  1VQH A;  4QY7 A;  2HHH L;  3UE0 A;  3H3V H;  5C4X G;  1WCM G;  3L2P A;  1PHJ A;  2MO1 A;  4OWX B;  1HZA A;  1XMQ Q;  1IYJ B;  1EQR A;  5C44 H;  4IO9 A;  1NTG A;  4ME3 A;  2DUD A;  1E1O A;  1E24 A;  3JAM i;  2JQO A;  3RLO A;  2GN5 A;  2B29 A;  5C4J H;  3I55 A;  4DR5 Q;  5FJ8 H;  2LXK A;  1YZ6 A;  3K0X A;  3HOX H;  4HIM A;  4GOP A;  4AQY L;  1IZ6 A;  2I5H A;  2JK8 A;  3CP0 A;  4OX9 Q;  4DR5 L;  3RN5 A;  2CWP A;  3GDE A;  2IY5 B;  1EIY B;  1EYG A;  5ELO A;  4GNX B;  1W2B A;  4OX9 L;  1JE5 A;  2E8G A;  2ZJP A;  3GTK H;  1WFQ A;  1V9P A;  1MJE A;  4LFA Q;  4A3D G;  4B3R Q;  3I4N H;  1CUK A;  3AFP A;  5IP7 H;  4NXM Q;  1Z9F A;  1G51 A;  1CSQ A;  4GLX A;  4BY1 H;  4DV4 Q;  1VQP A;  3UDI A;  3S1M H;  4BY7 G;  4DR6 L;  5GAD C;  4LFA L;  1UE1 A;  4IPG A;  2E5L Q;  4L5T A;  4B3R L;  1I94 Q;  3H0G G;  3RZO H;  1Y1V G;  2HQL A;  4DV4 L;  4HJA A;  1HJP A;  3I4O A;  3S15 H;  1B70 B;  2E5L L;  4UY8 C;  1IBK Q;  1I94 L;  1G6P A;  4APV A;  3OTO Q;  4A3B G;  1NJI C;  2VS1 A;  1PYS B;  2EQS A;  2YYZ A;  3A5Z B;  1HR0 Q;  4KHP Q;  4RG1 A;  1HNZ Q;  4QGU A;  1VQ9 A;  3HOZ G;  4DUZ Q;  2PI2 E;  3OTO L;  4GKK L;  4AYB E;  2R93 G;  5C0X J;  1HR0 L;  2NVY H;  3DM3 A;  3FKI G;  1X55 A;  1KQS A;  1YEZ A;  1OXU A;  4BBR G;  4DV6 Q;  5IYC H;  1PH1 A;  4YWK A;  2QEX A;  4Y52 H;  4IFD G;  4Y7N H;  4NXN Q;  4DV6 L;  1JMC A;  1BBW A;  2K14 A;  3K81 C;  1LTL A;  4DV3 Q;  4LF7 L;  3HOY H;  2K4K A;  1YJ9 A;  1N8R C;  4YY3 Q;  1K8G A;  4LF6 Q;  2NVQ H;  3E9I A;  5C44 G;  1PH8 A;  1GM5 A;  4HIK A;  1YHB A;  1YBY A;  4GS3 A;  4R4I A;  1FJG L;  1OXV A;  2UXB L;  5GAH C;  1D7Q A;  4QL5 A;  4MZ9 A;  2QGQ A;  3W1G A;  3S1Q H;  3S16 H;  4JYA L;  2VQE Q;  3S1R H;  4OO1 G;  3GD7 A;  4UP7 A;  3CCU A;  3OYY A;  4YCW A;  1XMO Q;  1K3R A;  2IHF A;  5FJ8 G;  3HOX G;  4QQB X;  1VQE A;  1EIF A;  3UDF A;  3SGI A;  4OWT B;  2VQE L;  2E2I H;  1UE5 A;  1VQJ A;  2R92 H;  1XMO L;  4B3M Q;  3CXC A;  5BR8 Q;  3TS0 A;  1PH5 A;  1JJ2 A;  5C0X I;  1O7I A;  5LMU Q;  3HOU H;  4YWM A;  1IXR A;  4B3S L;  1V1Q A;  1J6Q A;  4B3M L;  1FGU A;  4X66 Q;  5BR8 L;  5C3E H;  3ZJY C;  5LMU L;  2VQF Q;  3J7A 5;  1XJV A;  2QA4 A;  2AHO B;  3GTM H;  2ALY B;  5IP7 G;  1KRT A;  3I4N G;  3PSI A;  1YIJ A;  4BY1 G;  1VQI A;  1L1O A;  1WYD A;  4P72 A;  3D31 A;  1CKO A;  4BBS H;  3HFZ B;  4GKJ L;  3HKZ E;  4DV5 Q;  1MJC A;  3G4S A;  4X65 Q;  3HOW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...