2UUCL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucL00
4YWKA 4X64L 3F2DA 1Q7YC 4RMFA 3J7A5 1YHBA 4DV3L 2JA6G 2R7DA 1PH5A 4JI3L 2K5NA 4LUZA 2UUCQ 3CCEA 1Q1BA 1WFQA 1C7YA 2C35B 1VQHA 4JI3Q 1L1OC 2HQLA 3RLOA 1HH2P 2Q2IA 1Q8KA 4DR1Q 2WB1G 1QZGA 3T1HQ 1MJEA 5C4XH 4JV5L 1QZHA 1OTCA 3T1YL 3AYHB 4IJLA 2E8GA 4JG2A 1L0WA 1I6HH 1OXSC 4A3MH 1IBKL 1H95A 2UXBL 2DUDA 4P74A 2CKZB 3NENA 1IBLQ 4KI0A 1CKNA 1GD7A 3S1MH 4DR2Q 2ALYB 2Q2UA 3HKZE 3I4NH 4DV4Q 1K9MC 4JI1Q 2B63H 1K8GA 1Y1WH 2A19A 4GS3A 4L5TA 3ZJYC 1X55A 3J81j 1GM5A 1N32L 3HOUH 1VQ5A 3KFUA 3GDEA 5AJ3L 4J15A 4BY7G 1HNWQ 5C3EG 1XMOL 4ME3A 4OWXB 2DGYA 5AJ3Q 1K0RA 4QL5A 3CCMA 1EOVA 3G71A 2E2IH 4A3FG 5FJ8G 4LF7Q 1WOCA 4AIMA 4LFCQ 5IP9H 4JI8L 1Y14B 2R93G 1HJPA 2YYZA 3CF5A 2B29A 3TEHB 2JA5G 1BVSA 1Q86C 1M1KC 1SFOH 4UPAA 1JJCB 3F1ZA 4ALPA 2JEAI 1AE3A 1DGSA 2AHOB 5IWAQ 4YCWA 1YZ6A 4L5SA 2YU9H 4A3LG 4DUYQ 1GO3E 1G291 1Q12A 5IYBG 4A93H 4A3CG 4L5RC 4EQ5A 1J5EQ 1XNQQ 3FP9A 2ZM6L 3SGIA 4GKJL 3CMEA 3GTKH 1C0AA 3J80i 1XTDA 1N34Q 3PO2H 2VZAA 4GKJQ 1HNZL 1W2BA 4L5QA 1V43A 3CPWA 4A3GG 3BZKA 1EWIA 4IPHA 1X56A 3AQQA 2NVXH 1TWFH 3I2ZA 1NTGA 1IBMQ 1GKHA 2GVBA 5M3FH 1XPUA 1TWGH 1P8LA 1E7ZA 1C9OA 2LXKA 3KF6B 2CQOA 4BY7H 1N36L 3F8TA 3EIVA 5C3EH 2N49A 2R6GA 2GVAA 1OXVA 1XPRA 3RNUA 2K5VA 2UU9Q 2NN6G 4BA1I 5FJ8H 5M3MH 2ZJQA 4P75A 2BH2A 4Y7NH 4OX9L 3L0OA 1N33Q 3I4OA 3PO3H 4A3IG 3HFZB 2JA5H 1JT8A 1QVGA 3PF4A 1KHIA 4KHZA 4HJ7A 1X3GA 3CW2C 2Z6KC 3M4QA 4LF4L 3Q8DA 4GN4B 2JA8G 2Z6KA 1ASZA 4A3CH 4B3RQ 2N78A 3F2BA 1NMGA 1VQ7A 1KAWA 2QEXA 4YY3L 4JI4Q 1HNXL 5IT9c 2R92H 4AYBG 1Q81C 1IYJB 4P72A 1KRSA 4X62L 4IPCA 2JA9A 3M85A 3U58A 4A3JG 1SROA 1NY4A 4LFBL 4A3GH 5LMNW 1D7QA 1EUJA 4POGA 5JJKA 3HKSA 3STBC 4LF8Q 2EQSA 3K8AA 4LFBQ 4DUZL 3JAMc 3M4OH 4JI0Q 4LUOA 4P73A 4DV2L 4K0KQ 3KDFA 3E9HA 2A1AA 3GTOH 4R4TA 1UE5A 2WAQE 1LM0A 3CCRA 4JI7Q 1NJIC 2NVTH 5IYDH 2ZTCA 2I0QA 2KCMA 3I4NG 4C2MH 2B63G 1Y1WG 1HR0L 4GKKQ 4NXMQ 1VQIA 3U50C 1B7YB 2KBNA 4YWMA 3UDXA 4A4IA 4B3MQ 2XTIA 4OXPA 1T9HA 1CSQA 1VQEA 2R7FA 3S1NH 1E24A 1YJNA 2CWPA 3G48A 1YEZA 2UUCL 4B3TQ 5IP9G 3AEVA 5FLMH 3UDGA 2UUAQ 2F52A 2VQFQ 4JOIA 4DR1L 4LF9Q 3T1HL 1XMQQ 1WYDA 1CKNB 2UXCQ 1K8AC 4DR4Q 5M5WH 2NVQH 4FDBA 4A3JH 5GQOA 2ASBA 5M5YH 2D0PA 4A93G 3PSIA 1BBWA 5GROA 2K50A 2MO0A 3RLNA 2NZOA 5IYCH 4DV0Q 2K5HA 2KENA 5FLXc 1PH3A 1I5FA 4DR2L 4X65Q 1N8RC 3RN2A 2JK8A 4DV7Q 4DV4L 1VQGA 3A5ZB 4JI1L 2CWAA 2VL6A 4JI6Q 3PO2G 5IE8A 2V1CC 1PH6A 2K4KA 2VQEQ 2IX1A 4IO9A 5C0XJ 5JJIA 4JI5Q 3G6EA 4A3EH 2NVYH 1HNWL 4DAMA 2RHSB 5M3FG 2N8NA 1WCMG 3B6YA 3OTOQ 2GN5A 1VQPA 3CD6A 4JI2L 3GO5A 3PUYA 4DV5L 4LFCL 4LF7L 3ULPA 2VY3A 3H3VI 4QGUA 1KC8C 5GAHC 1I3QH 4DR5Q 1VS0A 2PMZE 1SMXA 1FL0A 3J81c 3TS2A 4HIOA 4DR7Q 4JI2Q 3M7NA 4DV5Q 4OO1I 1PV4A 5M3MG 1TXYA 2AWOA 1Z47A 4R4QA 1UE6A 1VQAA 4C3IH 5JEAJ 5IWAL 3PO3G 3CC7A 5LMUQ 3E9IA 4DUYL 1TWHH 2I5MX 1CUKA 3S17H 1Q1EA 2IHFA 1W3SA 4GLVB 3HOWH 4AYBE 3H0GH 1J5EL 4OO1G 1EQQA 1XNQL 3MXNB 3S2DH 1CSPA 2D0OA 2K75A 4H02A 1G51A 1B8AA 1X9NA 1N34L 3STBD 3I55A 1PH7A 1VQ8A 1S72A 1X3EA 2E2JH 1NE3A 2OQKA 4GLXA 3M4PA 2R92G 1LUZA 1UE1A 4R1JA 1X65A 4AQYQ 1PVOA 1FGUA 1OXUA 2Y0SG 1K3RA 2LXJA 2AMCB 4UP9A 1IBML 1K83H 1LTLA 1NMFA 2I5LX 3KLWA 4DV6Q 3GTJH 4LF5Q 1UEBA 3W1BA 1KIXA 3AFPA 2ZTEA 4C3JH 2HT1A 1WCMH 4OX9Q 1YI2A 3DM3A 1EFWA 2OWOA 3PUWA 1VQ9A 2UU9L 5LMNQ 1E3PA 5M5XH 2JE6I 1HZAA 4MNOA 4TQUS 5ELNA 5ELOA 5IYDG 2QA4A 4OWWB 1N33L 3L2PA 3CCQA 2Q2HA 1UE7A 4DPGA 1Q82C 3PUZA 2VW9A 3CXCA 1ASYA 4WJ3M 1A62A 4BBRG 2OTLA 4QY7A 4B3RL 3PIOA 2MQHA 1A0IA 1XNRQ 1VQ4A 2IY5B 4QJFA 3ER0A 4JI4L 2R7ZG 2WB1E 1IL2A 1SN8A 2BA1A 1VQNA 5FLMG 2JEBI 3KDFB 4EX5A 2UXDQ 1BKBA 3EN2A 3HKZG 4A76A 4A3DH 5E7NA 3J80c 3GTLH 2KHIA 4MZ9A 4AH6A 2LSSA 3BZCA 5IP7H 2EIFA 4LF8L 4JBWA 4LWCA 1VQOA 3CCUA 2EXDA 4JI0L 1E22A 3RZOH 5C0XI 4K0KL 1N9WA 4HJAA 4DR3Q 2Q2TA 5BR8Q 4PMWA 5IYCG 4X66Q 4GOPB 2NZHA 3D0FA 1UWVA 2RCNA 3LGJA 3CQZH 2UUBL 4JBMA 4JI7L 3GD7A 4JYAQ 2L15A 3M3YH 4Y52H 3NEMA 4DR6Q 3CCSA 4GN3B 2HHHQ 4BY1H 1M90C 2UUBQ 4NXML 4GKKL 4BBSG 1IBLL 1X3FA 4B3ML 3FKIH 4GLAC 4TVAB 4QQBX 4WJ4A 4A3EG 4R4OA 4GOPC 1KL9A 3W5OA 2ES2A 1KD1C 3HOYG 2K14A 4BBRH 3KYHC 3CCVA 2IHEA 4HJ5A 4GOPA 3S1RH 1I94L 1VQKA 3NBHB 4B3TL 4IPGA 3OYYA 3CMAA 5JJLA 2UUAL 1I94Q 1YBYA 2VQFL 4LF9L 2R7ZH 3TREA 1PH1A 4XIGS 4JOIC 1XMQL 2UXCL 2OTJA 5JEAG 1PA6A 3A0JA 3KJPA 4DR4L 3CAMA 4JBJA 3ULLA 4KHPQ 1HZBA 3F2CA 3J81i 1JJ2A 3RN5A 1YHAA 5J3BA 3S24A 4LF6Q 1PYBA 4NXNQ 4NB3A 4DKAC 1J6QA 1FJGL 3CCJA 2AKWB 1SLJA 2PI2A 3HOWG 3H0GG 1KQSA 4DV0L 4A3BH 2Y0SE 3IRBA 3JC66 4LFAQ 1FJGQ 2BH8A 4X65L 3DLLA 1CKMA 1OXTA 4DV7L 4B3SL 4BXXH 2WP8J 1A8VA 4YWLA 4O0AA 4JI6L 2VUMH 3KF8B 2E5LL 1YITA 3A74A 2VQEL 3RZDH 4B3SQ 3PGZA 4R4CA 1S3OA 1MKHA 3KOJA 2K52A 2ATWA 4JI5L 2E5LQ 2F4VQ 5C4JH 1YIJA 4BBSH 3TRZA 3I56A 3PUVA 4HIMA 3U4VA 4X64Q 2BA0A 4YHHL 3OW2A 3OTOL 4DV3Q 2AWNA 3CC2A 5EAYA 2VS1A 3HOYH 1VQFA 4YHHQ 1PH2A 1R9TH 4DR5L 2OQ0A 1L1OA 3K7AH 4XTCS 3HOZG 4DR7L 4MTNA 3G4SA 4R4IA 3GTPH 3S2HH 3UE1A 5GADC 4JV5Q 1JJGA 3HOXG 3T1YQ 5LMUL 4RG1A 3UE0A 3E0EA 2B3GA 1Y1VH 3A5UA 3RR5A 3FHWA 1IBKQ 2HIXA 2UXBQ 1HR0W 1RL2A 1KXLA 1E1OA 4IFDJ 1TWAH 1VQ6A 3GTQH 1U5KA 2KCTA 4C3HH 3KJOA 3TQYA 4UP8A 2WFWA 4DV1L 3ICEA 5C44G 2ID0A 2WAQG 2CFMA 5IY0A 4X6AH 3I4MG 1N32Q 4HJ9A 4AQYL 1S40A 2ZJPA 1IZ6A 4DV1Q 4A3DG 2JA7H 2ZM6Q 3PIPA 2JA6H 5IP7G 4DV6L 3UDFA 1XMOQ 4A75A 3I7FA 1QVCA 3MEFA 4IPDA 3CCLA 4LF5L 2MO1A 1BBUA 1WI5A 4OONA 3BJUA 1YVCA 2YV5A 3PUXA 4DAYB 1HZ9A 4A3KG 1IXRA 2MFIA 2YTVA 2XGTA 2PQAB 4JI8Q 1JMCA 1VQCA 5LMNL 4BA2I 1O7IA 4YCUA 4PG3A 1NBWA 3CC4A 1WJJA 3PF5A 3HOZH 2A8VA 1YNXA 4KLKA 3HOVG 4BY1G 3J7ZC 3S14H 3HOXH 1RIPA 5HGQA 4LNQA 4APVA 3FKIG 1PFSA 2CCZA 2VNUD 3CP0A 1MJCA 1TWCH 2IX0A 1CKOA 2PQAA 2F3IA 1SRUA 4JC0A 4LUVA 4PZ8A 5HY6A 4DNIA 1XNRL 3H3VH 1AH9A 1Z9FA 5DLQE 1VQJA 1L2FA 1HNZQ 3GTMH 1PH8A 4IOAA 1VQLA 1V9PA 1VCIA 5H1SE 3JAMi 2ZJRA 2UXDL 2FXQA 2NN6I 2H5XA 1SR3A 4PZ6A 4DK3C 5C44H 1EYGA 3I4MH 4JBKA 1X6OA 1EQRA 1YJ9A 3H15A 1QVFA 1N36Q 3W1GA 2Z0SA 4A3FH 2RHQB 3ULJA 1QUQB 3RLFA 1VQBA 2PNHA 3BU2A 4DR3L 5BR8L 2R93H 4HIKA 2JJQA 2HIVA 4X66L 3TS0A 4A3KH 4A3BG 1B70B 3NELA 4BXXG 4IJHA 4IOCA 4HJ8A 1VQMA 2PI2E 4JYAL 2VUMG 3PCOB 3AFQA 1D8LA 3KF6A 3PV0A 4QIWE 2YTYA 2HHHL 4DR6L 4GNXB 4JCVE 4A3LH 5IYBH 1A63A 1X54A 2MNAA 3EBEA 1SE8A 4GN5A 4UY8C 2D62A 5C0XG 3HOVH 1V1QA 3L7ZC 4UP7A 4LF4Q 1QUQA 3WWVA 1JE5A 4OWTB 3M9BA 3D31A 1KRTA 1YHQA 2YTXA 1PH9A 3CPFA 2RF4A 4YY3Q 4GNXC 1XPOA 2KHJA 1EIYB 1MIUA 1HNXQ 4P71A 1PH4A 5C4XG 4O2DA 2QGQA 5K36G 4GNXA 2E2HH 1P16A 3ERSX 4X62Q 2OCEA 3S15H 4LW1A 1XJVA 4IFDI 3GTGH 4KHPL 3S1QH 3K7UC 3K0XA 4A3MG 1FVIA 3S16H 4LF6L 2JA7G 1G6PA 4NXNL 1E1TA 1Q46A 1YJWA 2ZTDA 1Y1VG 4HIDA 4DUZQ 1PYSB 1HZCA 1K73C 4DV2Q 1PHJA 4YCVA 4IFDG 2N3SA 4DK6C 1I50H 1AE2A 4LFAL 1GVPA 3K81C 1LYLA 2JQOA 1EIFA 3U4ZA 4NPSA 4POFA 3UDIA 4A3IH 1JB7A 3HOUG 1HR0Q 1U0LA 3K80C 3VDYA 1VQDA 2I5HA 4PZ7A 5GAGC 2F4VL 1L1OB 2JA8H 2IT1A 5GAEC 1OXXK
chains in the Genus database with same CATH superfamily
4X64L 3F2DA 1SNOA 1STHA 1DCZA 1EYAA 2UUCQ 1Q1BA 1D5XC 1HH2P 2WB1G 5C4XH 2QDLA 3DUZA 1L0WA 1I6HH 2CH4W 4XQQA 1IBKL 2UXBL 4FXDA 1V1PB 2VB2X 4BY1B 1PZKD 2ALYB 1WTWA 3I4NH 4FXKC 1K8GA 3C1EA 1IW7D 2A19A 1UEAB 3BS1A 1IKLA 1EY7A 3CKIB 1B53A 3R8BA 1B44D 2E2DC 2PNRC 1EY8A 1O7ZA 1AZPA 4TSSA 5IGDA 4DN4M 1EOVA 3S16B 2B2UA 1EYCA 4AIMA 4LFCQ 1LABA 1Y14B 1XYIA 1EY9A 2YYZA 4LK1C 4RKLA 4UPAA 3F1ZA 1PMRA 3NWTA 1DGSA 4BWGB 1MI2A 4EQ5A 2VUMB 3FP9A 5J39A 4K14A 2P5ZX 3HEJA 1HNZL 2F3WA 3LX0A 2PYKA 5L37A 4A3GG 5C4ZA 1GUWA 4RGMA 3SE0A 1X56A 1O7YA 1NTGA 1IBMQ 5M3FH 2EYPA 1TWGH 3VYRA 2CQOA 1N36L 3F8TA 5C3EH 3CHBD 5KNBA 1HHVA 2GVAA 1NCVA 1PYWD 1KNEA 2K7VA 1OXVA 1DD2A 2K5VA 2EYLA 4BA1I 5BN5A 5M3MH 3K5OA 4JW0A 1N33Q 3SXHA 1I4GA 2Z6KC 1SXTA 2JA8G 2Z6KA 3A8JE 4A3CH 4B3RQ 1MSGA 1IYUA 1PRTD 2C9OA 5AFWA 1HXYD 4J6HA 1HNXL 2JA7B 2VB3X 2JA6B 1U4MA 1KRSA 4X62L 3U58A 5LMNW 1U9RA 3MWYW 2NYZD 1G2SA 4LF8Q 2EQSA 1F2ZA 3K8AA 1B3AA 4EQPA 3OMCA 1PTOB 3J81E 3MXPA 4P73A 4HTHA 4K0KQ 1ZYRC 2K33A 3KLSX 1UE5A 3BDOA 3Q24A 4IALA 4JI7Q 2NVTH 2ZTCA 3GTKB 2A6ED 4C2MH 2RCFA 4K5WA 2EZVA 2B63G 1Y1WG 3QIAA 4NXMQ 3SHLA 4WORA 3U50C 4A4IA 4B3MQ 3UDXA 3FMCA 4CJ1B 1A15A 1HPCA 1E24A 4DAPA 5I2XA 1PRTB 1LT5D 4BY7B 2UUAQ 1A3TA 4FYDA 4DR1L 4JOIA 1CHPD 3T1HL 2UXCQ 1K8AC 1RDPD 5IOCA 5M5WH 2NVQH 5GQOA 1NAPA 3HG9A 4MIUA 2JA5B 3R2TA 2NZOA 2KENA 3LWEA 1PH3A 1N8RC 2JK8A 1VQGA 3A5ZB 2KQ3A 3JAML 3EA6A 1QB5D 4U673 4QUFA 4IO9A 5JJIA 4FF4A 2A6HD 5IGEA 1TS4A 1Y8OB 1HNWL 1K0SA 1VMPA 3GO5A 3PUYA 4DV5L 4LF7L 2F0KA 2L5TA 1KC8C 3J80E 4DF7A 4DR5Q 1VS0A 1SMXA 1FL0A 2DN8A 3J81c 4HIOA 4DV5Q 3GTOB 4R4QA 1VQAA 3KBXA 3PO3G 3CC7A 3S17H 2TMPA 3SK6A 1Q1EA 4ABNA 1XNQL 5EBCA 4A3IB 1CSPA 4G7HC 1RODA 4LJZC 2RDFA 1G51A 3S1NB 2L4NA 2Z8LA 3MFYA 2OQKA 2R92G 4R1JA 3PIP3 4AQYQ 1K3RA 4RGOS 3R2IA 4UP9A 1DOLA 3X3MA 2KEEA 3AFPA 4A3JB 1WCMH 1QE6A 1EFWA 3D6WA 2UU9L 5ELDA 2JE6I 4MNOA 4TQUS 2QA4A 5IYDG 4ZK9B 2Q2HA 2F0MA 1ILPA 3BDCA 1XX8A 2EYFA 3CXCA 1A62A 2OXPA 3WDNA 3KLRA 1LTGD 1EU4A 1SSOA 4G57A 2IY5B 3G6JB 4PNYA 2R7ZG 1IL2A 2BA1A 3NQIA 5CMDA 2JEBI 4EX5A 1GUTA 3HKZG 4A76A 1EY4A 3J80c 3BZCA 4HCSA 1EYDA 4LWCA 4DGZA 1N9WA 2JN4A 1CQFA 4DR3Q 5C5MA 4OL7A 4X66Q 2YU9B 1UWVA 4JBMA 4JYAQ 3P1HA 1SMYC 1X3PA 2F03A 3NEMA 4BY1H 2KUMA 4TKOB 4PQXA 5D65A 4ULLA 4GOPC 5CYUA 3W5OA 1KD1C 3K5LA 4HN7A 3HP3A 4GOPA 2IHEA 4HJ5A 1VQKA 2K32A 3T4AC 4F87A 2NVXB 1ZEQX 1TWFB 1UAPA 5JJLA 1F2LA 4C3JB 1TY2A 2EE1A 3ULLA 1Y8PB 3RN5A 1YHAA 5J3BA 2K6AA 4NXNQ 4DKAC 2PCFB 1FJGL 3OMGA 3CCJA 1YNJD 3NXWA 1AW7A 1T5XD 1FJGQ 2BH8A 1OXTA 2WP8J 4YWLA 4I7ZC 4JI6L 2VUMH 1R4QB 3KOJA 1STEA 1C48A 2PPBC 5COYA 5JAVA 4YHHL 1W6KA 2HCIA 5FO7B 3OW2A 2Y0SB 3HOYH 2K5WA 1VQFA 4YHHQ 3EROA 3VA7A 3OIQA 3MAQA 3Q23A 2SOBA 5I9OA 4KD3A 3T1YQ 5JEAH 3FHWA 1Q8IA 1BBXC 1KXLA 3V05A 1CA6A 3C2PA 1VQ6A 3GTQH 2J4XA 4C3HH 4HSVA 2WFWA 5C44G 1EQTA 3DWQA 2WAQG 4FVMA 4DK1A 4HJ9A 4KKUA 1GJXA 2JA7H 3BVMA 1CTMA 3VR2A 2JA6H 5IP7G 1FNVA 4DV6L 2WV6D 4LF5L 2EYMA 1WI5A 2MO1A 4OONA 3BJUA 5CC4A 2YV5A 3PUXA 2MFIA 2XGTA 2NB0A 4KMUC 4YCUA 1S4ZA 1WJJA 2F0PA 5M5YB 3QG1A 4FF3A 3HOZH 3HOVG 3A8IE 2M9VA 2Z9HA 4HEDA 3S14H 3HOXH 4HMJA 1E2VA 1BDOA 3J7YW 3K58A 3P7JA 2PQAA 3H3VH 4JC0A 4BBSB 3SK8A 5DLQE 3NHHA 4HSPA 4A3EB 3MZ5A 3GTMH 5JPMC 2NN6I 1SR3A 3ITPA 4NDXA 3OSOA 1J9OA 4K6LA 1EOTA 1DXMA 1YJ9A 2R61A 2H4OA 1DZ1A 1JWSD 2RHQB 3BU2A 2PNHA 4DXFA 1R4PB 4HIKA 2JJQA 2K5DA 4A3KH 3NELA 1WTVA 4IJHA 2XN9C 4IOCA 2KEDA 1KAAA 2L55A 3HOWB 3H0GB 3KF6A 5ELFA 2YTYA 3SR1A 1ENAA 3MTSA 1LTAD 4UY8C 3N6RA 2D62A 5FOBB 3L7ZC 5G3LF 1QUQA 1EL0A 5FK9C 1HRJA 3PQIA 3ONAB 2K5QA 2QW7A 4YY3Q 1EIYB 1LLRD 4IQZA 5C4XG 2QGQA 5K36G 5TSSA 3ERSX 2OCEA 4QUCA 3H09A 2JYOA 4KHPL 1G6PA 1Y1VG 1PHJA 5DEHA 1QNUA 2NN6H 3MHBA 1RJTA 1U4RA 1TWCB 1LYLA 1EIFA 1GHJA 3U4ZA 3UDIA 4OEMB 4A3IH 1Y8NB 2XNAC 4IUQA 3K80C 3DXJC 4FF2A 2I5HA 3J81i 3K5NA 1Q7YC 1YHBA 2PQEA 4DV3L 3I4MB 4G7ZC 4A3DB 1AFPA 1KNAA 1AEXA 1L1OC 4RCOA 1K8MA 1Q8KA 2Q2IA 5CR3A 2I46A 4JV5L 1OTCA 1SNMA 4RGTA 1OXSC 3MC0B 3W3AA 3CQZB 1IBLQ 4KI0A 1GD7A 2Q2UA 1A6XA 4DV4Q 1K9MC 2M2LA 4GS3A 3J81j 1N32L 1S5FD 3HOUH 3KLSA 5T1IA 1SYEA 3KFUA 3V2TA 1SJHD 4V0BA 1H9SB 5C3EG 1XMOL 4ME3A 2DGYA 4QL5A 3CCMA 2CH4A 4L8JA 3G71A 4A3FG 4JI8L 1GUOA 2F0WA 1G8ZD 4FP5D 3CF5A 3TEHB 1WVLA 4NMZA 4H44C 5EJWA 1SFOH 5CV6A 4ALPA 4L5SA 5IWAQ 4A3BB 1YZ6A 2YU9H 4F88A 3T13A 4A3CG 2H1EA 2MPMA 2ZM6L 3VR6A 1L0YB 3J80i 3P20A 2B2YA 1XTDA 1ZYRD 2VZAA 4XDXA 5C4JB 1CFMA 3NUCA 2F0JA 3NTHA 1EWIA 3MXNA 2HQEA 1SYGA 5EPLA 2NVXH 1PLFA 1TWFH 2AQ2B 4MHEA 3E0JA 3FDTA 1E7ZA 3MEHA 4WJWA 4ZCKA 5KNCA 3S2HB 3IAYA 4XQJA 4A3MB 5J1ZA 4ODGA 2ZJQA 4P75A 3L0OA 2J0TD 3S1MB 1ESRA 1SYDA 2N55A 3AMUA 3HFZB 4WRDA 4KHZA 1CA5A 3FEWX 3M4QA 5EKIA 5FLXE 4LF4L 1EY5A 1NMGA 3K59A 1VQ7A 4JI4Q 2E2IB 4S3SA 1EWHA 4L63B 4IPCA 4LFBL 1B4OA 5JJKA 1WTOA 1HCZA 4LFBQ 4DUZL 3M4OH 2WB1B 4ZQ3A 4JI0Q 4DV2L 1I6VC 1ICWA 2EY2A 3QOJA 1LM0A 3K57A 2I0QA 4K6DA 4GKKQ 2RDHA 3EQLC 1B7YB 2KBNA 2IJ0A 1ENCA 1VDZA 2R7FA 4JPBW 1LTBD 1XWEA 5IGCA 2SDFA 2WKCA 2CWPA 2B39A 1YEZA 3K5MA 2UUCL 5IP9G 3AEVA 2RKSA 5FLMH 1XTCD 3UDGA 2VQFQ 5I6WA 4Q0FA 1CKNB 3CRLC 3MFGA 5M5YH 1AN8A 3TZUA 4A93G 1ZXTA 1TU2B 1IKMA 1BBWA 2MO0A 1TIID 5IYCH 1B9NA 2RBMA 5FLXc 4U68A 3ND8A 4X65Q 3RN2A 2LFNA 3PO2G 2CWAA 3T53B 3BVGA 5C0XJ 5DM73 4JI5Q 4A3EH 2NVYH 2A69C 1PZID 4CDEC 1WCMG 4A3GB 1PTOF 3OTOQ 3OW7A 3CD6A 4JI2L 2KA7A 2B2UC 4LFCL 3GTGB 5A35A 5GAHC 2MUYA 4JI2Q 1AP0A 3WOEA 1H9MA 2DY7A 1HFNA 5LMUQ 3E9IA 4G7OC 1RCVD 4NP5A 2F0GA 3H0GH 3HOWH 1X3QA 1NR4A 1SE2A 2A68C 1JOKA 1PXUA 2CHBD 1PRTF 4LMQD 4UHVA 3STBD 4CHTB 1S72A 2JA8B 4GLXA 3M4PA 3DEPA 2D9UA 2LXJA 2AMCB 1SMYD 3I4LA 1IBML 3S9WA 1RF2D 1NMFA 2EPBA 3GTJH 3W1BA 1KIXA 3SK4A 1PTOD 1YI2A 3TP5A 1VQ9A 2F4IA 1E3PA 2GA4B 2G9DA 5ELNA 4OWWB 1N33L 3I72A 3N52A 2B2VA 4UDUC 4E6IA 1ASYA 1QILA 2CVRA 2B63B 2OTLA 4B3RL 1Y1WB 2MQHA 4K8IA 2X6LA 1QJOA 1VQ4A 4QJFA 5F2DA 2WB1E 5IGGA 3KDFB 2UXDQ 3EN2A 3NQTA 4A3DH 4AH6A 2B8GA 1BCPF 1HTLD 4LF8L 1FNUA 4ZYSA 4JBWA 4GZYC 3CCUA 4K0KL 5A2QE 5BR8Q 4GOPB 3D0FA 4JK1C 4JI7L 1VF7A 3BYTB 3CQZH 3LGJA 2FMMA 1S5CD 1MSHA 2L15A 5IGFA 4Y52H 3CCSA 4GN3B 4NXML 1GHKA 3BZDB 4B3ML 4GLAC 4QQBX 4WJ4A 2OEOA 2ES2A 1KDAA 3HOYG 3EFXD 3URYA 4BBRH 2L1BA 5EQ0A 2IWHA 3CMAA 2UUAL 5KEEA 1IYVA 4XIGS 3C1FA 4FXGC 4JOIC 2UXCL 5JEAG 1G2TA 2G5DA 1HZBA 2PZWA 1KTKA 4C3IG 3S24A 4LF6Q 1BCPD 1F2MA 2AKWB 1SLJA 2PI2A 4C3HG 2EY6A 4Y7NB 3NBHA 4UAIA 4A3BH 3J80L 3PO3B 3JC66 4LFAQ 4FNFA 1EIGA 3DLLA 1D1KA 4O0AA 4L6TB 2F4VQ 2XWBB 2HDLA 2ICEC 1ESFA 4HAEA 5C4JH 5IGBA 1A2TA 2BCOA 3T16A 3GTLB 4RHRA 2R92B 3D4RA 3NPPA 2AWNA 3CC2A 4K2LA 2VS1A 5CBAE 2O5JC 4DR5L 1EY0A 3KF8A 5K5PA 4ZRZA 2BDOA 3HOZG 4R4IA 3GTPH 3S2HH 5DM63 5GADC 3HOXG 2B3GA 2EOTA 3A55A 3M3YB 3RR5A 1B9MA 2HIXA 2WKDA 1XXGA 3Q6SA 5EPJA 1BCPB 1SNPA 3TQYA 2ZXPA 5CV5A 3ICEA 3S1RB 5IY0A 1B2TA 1BO0A 4AQYL 3TDQA 3CRKC 1V1PA 3ZYYX 2R7ZB 5JVH3 3MEFA 3HKZB 1GUSA 1BBUA 4A3KG 1Q82C 1HZ9A 4K8JA 2PQAB 4RA8A 1VQCA 4LAAA 4BA2I 3CC4A 1KLGD 1EZ8A 3OIPA 1JWMD 2A8VA 4K5VA 3HGBA 4XYOA 4KLKA 5EKLA 4DFAA 3J7ZC 1V8QA 2MHVA 4CGYB 1QNKA 5CV9A 2G9HD 4LNQA 3FKIG 2E76C 4DAYA 3CP0A 2IX0A 1HUMA 2F3IA 3C46A 2AQ1B 3A56A 4R8IA 3IL8A 3TP6A 1VQLA 2XRSD 2ZJRA 1F9SA 2FXQA 1M8AA 1NSNS 3M7GA 4PZ6A 1EYGA 1B50A 1X6OA 1EQRA 1A3VA 5KGUA 1I3QB 3I8ZA 2Z0SA 2IW3A 3QO2A 3ULJA 1QUQB 4H13C 3RLFA 2XIWA 4DR3L 4X66L 3MVVA 5JVG3 1B70B 1FNWA 1TWHB 4EGVA 4BXXG 1FYCA 1VQMA 4JYAL 3PCOB 1D8LA 3R3OA 4JCVE 1A63A 1X54A 2MNAA 4ILWA 5C0XG 2D2CC 1JE5A 4J8QA 2LMCB 4OWTB 3M9BA 1A3UA 3MA2B 1KRTA 2YTXA 1PH9A 1LT4D 2BDNA 4IZ8A 2RF4A 1MIUA 1PH4A 3T51B 1GOZA 4IFDI 4LW1A 1XJVA 3GTGH 4IUPA 3K7UC 3K0XA 3VR4A 3S16H 4NXNL 5M5XB 4XT1B 1HZCA 1K73C 3M4YA 4YCVA 2N3SA 1STAA 1AE2A 1GVPA 3K81C 1PFBA 2WIIB 2JQOA 3D4DA 3FRPB 4POFA 3MXUA 1JB7A 3E6ZX 3HOUG 1EWCA 2Q8IB 5E4WC 1U0LA 1HR0Q 3K0YA 3P75A 1L1OB 2JA8H 5GAEC 1OXXK 1CI3M 5C44B 4YWKA 2WAQB 3EJIA 4DAVA 4RMFA 2HD3A 1G91A 2AUJD 2R7DA 5JOBA 3H3VC 3OHXC 2NTSA 4HCEA 3CCEA 1WFQA 2C35B 2RQXA 3GV3A 3X3NA 2KECA 2B2WC 1MJEA 2F0TA 3RZOB 2B2WA 3T1YL 2E8GA 1CZGA 1D1IA 1H95A 3HRZC 2CKZB 1F9PA 1D5MC 4P74A 2PW5A 1LT3D 3HOVB 4IFDH 2PO4A 4DR2Q 1JOOA 5I4DA 3HKZE 1ICFB 2B63H 1U4PA 4JI1Q 1Y1WH 1HTPA 3FPUB 1X55A 2JSOA 1GM5A 1JWUD 1SE4A 2K05A 5AJ3L 3TBIB 1F77A 5IT9E 5AJ3Q 4P2CB 3LWUA 2R93G 4ZUJA 5NUCA 1HJPA 4G4KA 2C5CA 1I50B 1I4QA 1BVSA 3I3CA 1AZQA 4CJ0B 2SEBD 1AE3A 1PTOH 2AHOB 4A3LG 4DUYQ 5IYBG 1G291 1HUNA 5CV8A 4L5RC 1J5EQ 2ZT9C 1BUVT 2PMZB 3SGIA 4GKJL 3RZDB 3GTKH 3KK7A 1N34Q 3RUZA 1I4RA 1STNA 4IUUA 4GKJQ 4L5QA 1YNNC 1V43A 5ELBA 2K01A 4IPHA 3IFDA 3I2ZA 4J1MA 3VYTA 1DOMA 5C4XB 1P8LA 4BY7H 5LHY1 3EIVA 1UNSA 2N49A 3O13A 2R6GA 4RHSA 4DU9A 1WTXA 2A6HC 3RNUA 5FJ8H 1Y1VB 4V190 4Y7NH 3A54A 3PO3H 2JA5H 1JT8A 1QVGA 1H9JA 1KHIA 1TWAB 4HJ7A 1X3GA 3CW2C 5J22A 3Q8DA 4GN4B 4DXGA 2EYOA 5E1FA 3F2BA 3C3LA 2LKVA 4N8X1 4YY3L 4CKBA 5IT9c 2R92H 4AYBG 1TY0A 1IYJB 4P72A 5FO8B 2JA9A 3M85A 5IODA 1D7QA 1STYA 1ONLA 1LO5D 1RTNA 4PMBA 2A69D 3E9HA 2A1AA 3D3RA 3GTOH 1CQVA 2WAQE 3CCRA 1NJIC 5IYDH 3I4NG 3D6CA 1TS2A 4JVZA 2EJMA 1JOQA 1II3A 2XTIA 1CM9A 1CSQA 3S1NH 1YJNA 3G48A 4KN4C 1JE4A 3I70A 4B3TQ 1ILQA 1SE3A 1TS3A 4KJNA 5C3EB 4LF9Q 1H9RA 1XMQQ 4A3FB 2KCNA 4DR4Q 1SNQA 2DNEA 4FDBA 4A3JH 2ASBA 2QKIC 2KJXA 2D0PA 3BDLA 1GUNA 4XQNA 5GROA 2K50A 4KKTA 2IL8A 4DV0Q 1IBLL 2K5HA 1I5FA 4DV7Q 2HUGA 4DV4L 3VA5A 2VL6A 2XVSA 1ET6A 2V1CC 1PH6A 3NWSA 2VQEQ 2IX1A 4KN7C 1BF4A 3G6EA 4DAMA 2F0UA 2RHSB 5M3FG 2N8NA 1JICA 4ZUIA 3B6YA 1VQPA 2E2HB 2L11A 3ULPA 4QGUA 3S1QB 3TS2A 1I3QH 2PMZE 1F2YA 2FHTA 1QG7A 4DR7Q 3LNNA 4OO1I 1PV4A 5M3MG 1Z47A 1UE6A 3AB9A 5JEAJ 5IWAL 4C2MB 1TWHH 1CUKA 4AYBE 5E4XA 2BE5C 2D0OA 3L3OC 4KJOA 3VR5A 1B8AA 2K28A 2B2YC 1BOSA 3I55A 2JXMB 2DJFC 1PH7A 1VQ8A 4CJ2C 5D3DA 1NE3A 3KUPA 1X65A 1FGUA 3U9SA 5FLXL 3I90A 2OF1A 5M5WB 1UEBA 1Z7TA 2ZTEA 4C3JH 2HT1A 4OX9Q 3DM3A 2FINB 3PUWA 5LMNQ 5M5XH 3L2PA 3CCQA 1MHWC 2VW9A 4WJ3M 5HGTA 2QILA 5T1GA 1MD2D 4BBRG 4N8FA 4QY7A 3PIO3 1A0IA 1XNRQ 4OO1H 3ER0A 4JI4L 4EQOA 1IHZA 4KKSA 1VQNA 2F0QA 1BKBA 4QF4A 5E7NA 4QCLA 2KHIA 2LSSA 4IN3A 3OOCA 5IP7H 1X32A 1VQOA 1S5ED 4OGQC 4JI0L 2X69A 1E22A 3RZOH 3S17B 1KDCA 4PMWA 3DWPA 3L9AX 3RD4A 4I65A 2NZHA 2RCNA 2UUBL 1EQVA 4A93B 1TR5A 1C8CA 5KNDA 1TKWB 1SEBD 3UI2A 4DR6Q 4GKKL 2HHHQ 1M90C 2UUBQ 4Z9CB 1H9KA 1X3FA 4TVAB 3PO2B 5ISRA 4EVOA 3HZXA 4R4OA 5C6AA 1KL9A 1BNZA 4H0LC 3CCVA 5C3XA 3NBHB 4DNTB 3OYYA 3E5SA 5D3IB 1WCMB 1YBYA 2VQFL 2F3VA 5HURA 3TREA 1PH1A 2OTJA 3TSSA 1PA6A 3A0JA 3KJPA 5E3FA 1CT1D 1PYBA 1J6QA 1KQSA 2LY7A 1O78A 2L0CA 2HDMA 2E74C 4X65L 4B3SL 1CKMA 3KF8B 4XT3B 2O4XA 4KY5A 3A74A 3RZDH 4B3SQ 3PGZA 4R4CA 1S3OA 3QR8A 2K52A 4JI5L 1NNXA 1YIJA 4BBSH 3ND9A 2I07B 3PUVA 4HIMA 3I91A 4X64Q 2N88A 5CV7A 3OTOL 4F8MA 2R3ZA 5EAYA 4KTAA 1Q90A 2X6GA 1Q3LA 3FVQA 2OQ0A 4KV6A 3TN2A 5K36H 4MTNA 3UE1A 2O5IC 1MGSA 3QWNA 3J7AV 5LMUL 3GV6A 1Y1VH 1WTPA 1HQMC 5JPNC 4CDFC 1IBKQ 2UXBQ 1RL2A 2A5HA 4R9WA 1E1OA 5CGKA 2K1BA 1TWAH 4H7BA 2QEJC 1U5KA 2J7ZA 4B08A 2ID0A 1FD7D 2CFMA 4X6AH 5C4HA 3NSWA 4KHVA 2ZJPA 1S40A 2EVBA 3PIPA 1SAPA 4A75A 1QVCA 3CCLA 3Q0AA 4DAYB 1ML0D 2YTVA 1TT2A 1O7IA 4X3SA 4PG3A 1H9SA 1K8OA 2K04A 2AQ3B 3DEOA 4BY1G 1WTQA 2IX3A 2OT2A 2B2VC 1DM0B 1PFSA 5A2QL 2WACA 1TWCH 4PZ8A 3J81L 1BQQT 1SRUA 4LUVA 5HY6A 4DNIA 4C56C 4XXEA 1Z9FA 1VQJA 1D6EC 1L2FA 1HNZQ 1NR2A 1VCIA 3HOYB 5H1SE 4C1NK 2NBFA 2UXDL 2ZXRA 4PV1C 2F0LA 4DK3C 3I4MH 4JBKA 3GQBA 1VMCA 3H15A 1N36Q 1E2WA 4A3FH 4NW2A 1DYQA 1F9QA 5BR8L 4C3IB 2FJ2A 4HJ8A 3GTQB 2PI2E 4C3HB 2CW0C 2VUMG 1DONA 2RVLA 3S2DB 2D5DA 1SE8A 4GN5A 1V1QA 2E2JB 2HCCA 1Y69U 3D31A 1SNDA 1D5ZC 1YHQA 1E0BA 3OWEB 1LTRD 4EQNA 2KHJA 5EPKA 4ME5A 4GNXC 4P71A 1XPOA 1K83B 3NTIA 1HNXQ 2KHSA 4GNXA 2E2HH 4QB4A 4X62Q 3D8GA 2E75C 3S1QH 1IL8A 2EJFC 4LF6L 3HOZB 1E1TA 2ZTDA 4HIDA 4F7XA 1PYSB 4IFDG 4RWSC 3S14B 4DK6C 5KYLA 3HOXB 1GUGA 3V96A 4LFAL 4IUVA 5D14A 4NPSA 3GP7A 2V4DA 2RSNA 1WD1A 3GTMB 1VQDA 5GAGC 2F4VL 1SJED 2JA7G 4CKCA 2JA6G 3J7A5 1B1ZA 2VXWA 1PH5A 4JI3L 1GXDC 1LTID 2K5NA 1Z6HA 4LUZA 2NTTA 3R93A 1C7YA 1VQHA 4JI3Q 2HQLA 3RLOA 4DR1Q 1SYBA 1QZGA 3T1HQ 4A3KB 1YNND 1QZHA 1OO9B 3AYHB 4IJLA 4JG2A 4X3KA 2Q8TA 4A3MH 1EEID 2DUDA 3NENA 1CKNA 3S1MH 2FFKB 4MTKA 3FKIB 2TSSA 4L5TA 3ZJYC 1JORA 3DM1A 4BS9A 1VQ5A 3A7AB 3GDEA 4J15A 1WTHA 1SYFA 4BY7G 1HNWQ 2NUCA 4OWXB 4CDDC 1K0RA 1EIHA 2EDGA 2E2IH 5FJ8G 4LF7Q 1WOCA 5IP9H 3H91A 4FO2A 2NZ1D 2B29A 2JA5G 3KBGA 1Q86C 1M1KC 1JJCB 3JAME 2JEAI 4YCWA 1GO3E 1Q12A 4A93H 2F0VA 1QWYA 1XNQQ 2FMCA 3CMEA 4OIJA 1C0AA 1B3QA 3PO2H 5BN3A 1UUPA 3NK9A 1W2BA 3CPWA 3F2UA 1I4HA 3BZKA 3K6OA 2QDBA 3AQQA 4K2KA 1XPUA 1GKHA 2GVBA 4KY6A 1R9TB 3TMEA 1K3BC 1C9OA 2LXKA 3KF6B 3K7AB 3WOFA 1NUCA 4RGNA 1IW7C 1XPRA 2UU9Q 2NN6G 1I4PA 4R8NA 1FR3A 5EGTA 2BH2A 5IIFA 3D4WA 5LL6X 3I4OA 4NKLA 4A3IG 3TP8A 3PF4A 2Z1CA 2XSCA 2EJGC 1E2ZA 4M8AA 3BG3A 2B8FA 3MXGA 1HFGA 4WFN3 3HOUB 1ASZA 1M4VA 2N78A 2IPKD 2WINB 4TRDA 1KAWA 2QEXA 4N9PA 5FKAC 1Q81C 1PFNA 3H94A 2ENBA 4A3JG 1RD9D 1NY4A 1SROA 4X3TA 4A3GH 2KOLA 1EUJA 4POGA 3HKSA 3STBC 1SFOB 1CK1A 3JAMc 4LUOA 3W2DA 3KDFA 3HS0C 2O2LD 2EY1A 4R4TA 1JCKB 3SDZA 2KCMA 2F0NA 1HR0L 4IUNA 2QCPX 5I2YA 1PTOC 2MGSA 1VQIA 4YWMA 2EY5A 2BOSA 4OXPA 1T9HA 1VQEA 3NE5B 5C5LA 1JR0D 1SDFA 1VF5C 2EXZA 2F0OA 4RKBA 3G7LA 3VR3A 2BE5D 1ZKOA 2F52A 2L12A 4OELB 5JJZA 1EEFD 5DAUA 1WYDA 1V1OA 2R93B 5IT9L 1PRTC 3OWFA 1ENFA 1JB3A 1QCBD 3PSIA 4KY7A 5CORA 2Z6BA 3RLNA 5KIXA 2XWJB 5I6YA 4DR2L 2Z4IA 4JI1L 4JI6Q 3J7AF 3VYSA 5IE8A 5ELCA 2K4KA 1EFID 4C3JG 4KK7A 1I4XA 2GN5A 2F1MA 3S15B 3H3VI 2VY3A 2A6EC 3M4OB 4HMIA 3M7NA 2Q8RE 3IKJA 4IURA 2RSOA 5EKKA 1TXYA 2AWOA 4C3IH 4DUYL 2I5MX 2IHFA 1W3SA 4GLVB 2K03A 1J5EL 4OO1G 1EQQA 3MXNB 3S2DH 1HA5A 2B2TC 2K75A 4H02A 1X9NA 1N34L 1SYCA 2B2TA 1JC7A 1X3EA 2DJGC 2E2JH 1BCPC 1LUZA 1UE1A 1PVOA 3NTKA 3DMUA 1W6JA 1OXUA 2Y0SG 1K83H 1LTLA 2I5LX 4AYBB 3KLWA 4DV6Q 4LF5Q 1LT6D 1S5DD 2OWOA 1KABA 2ICIA 4C1NI 1I6HB 1D2BA 1HZAA 5ELOA 3AU7A 1UE7A 4DPGA 4ZAIA 3PUZA 3DWAA 3I4NB 1RHPA 4QMGA 3PIOA 2NVYB 3A8KE 4RAUC 1C4QA 3E3XA 2QF7A 1CZWA 2EYJA 2L9HA 1WTRA 1SN8A 1MBYA 2A73B 5C3WA 5FLMG 3BYYB 3GTLH 4MZ9A 2F0IA 1J8IA 3NBIA 1CHQD 2EIFA 2EXDA 2JP1A 5C0XI 4IUTA 4HJAA 2Q2TA 4B9WA 3SVMA 5IYCG 4M1UB 1BXTA 3GD7A 3M3YH 1JQYD 4DK0A 3TZDA 2DY8A 2F0HA 4BBSG 2F0DA 4CBVA 3FKIH 4A3EG 4N9TA 4CDCC 3H6MA 3ERQA 4HR7B 2K14A 3KYHC 1I94L 3S1RH 1ET9A 4QIWB 4B3TL 3GTJB 4IPGA 5M3FB 1I94Q 1TWGB 2KVMA 2M00A 4LF9L 2R7ZH 4MN3A 1XMQL 2KCCA 1SNCA 2AUKA 1RTOA 2A68D 3CAMA 4ID6A 4JBJA 4B9XA 3F2CA 4DR4L 1JJ2A 4KHPQ 1S5BD 5CV4A 4NB3A 1LTSD 4FF1A 5M3MB 3HOWG 1STBA 3H0GG 1WD0A 2EYHA 4DV0L 2Y0SE 3IRBA 5M9OA 1A2UA 4BXXH 4DV7L 4I7AA 1A8VA 2E5LL 1YITA 2VQEL 4ZLTF 2ATWA 1MKHA 5G3LD 5C0XH 2E5LQ 3VYUA 2F0EA 3TRZA 2SNMA 3I56A 3U4VA 2BA0A 1EU3A 4DV3Q 1LACA 2PW7A 1KLUD 1PH2A 1R9TH 4XYQA 2F0SA 1L1OA 3K7AH 4XTCS 5ELEA 2CQAA 4DR7L 3G4SA 4Q5VA 1HA6A 4OHJA 4JV5Q 2ZXOA 1JJGA 1LV9A 1BR9A 4RG1A 3UE0A 3E0EA 3A5UA 2NVTB 1HR0W 1O7LA 4IFDJ 1TS5A 2KCTA 3QB3A 3KJOA 1TQOA 5LL6S 4UP8A 4RCNA 4DV1L 4BBRB 3FPPA 3I4MG 1N32Q 1IZ6A 4DV1Q 2RA4A 2CW0D 4A3DG 4OIKA 2PZTA 1YNJC 1XMOQ 4O42A 3UDFA 3I7FA 1L0XB 2MP1A 4IPDA 1LTTD 4OX9L 1YVCA 1YJWA 1IXRA 2Z4HA 1JMCA 4JI8Q 3TP7A 5LMNL 4KD4A 2NVQB 5FO9B 1NBWA 3PF5A 4RH6A 1YNXA 2DNCA 1PZJD 3A7LA 1RIPA 3CU7A 5CBEE 4APVA 5HGQA 2CCZA 1K28A 2VNUD 2ZM6Q 1MJCA 1STGA 1CKOA 2PZUA 1XNRL 1AH9A 3IFTA 5BN4A 3I73A 2RDGA 4X3UA 1PH8A 4IOAA 1V9PA 2MJ8A 3JAMi 2F0FA 4YIJA 2H5XA 5C44H 3GTPB 1QOHA 1TVXA 4RFBA 3EVQA 1DJRD 1QVFA 3W1GA 1U4LA 1HQRD 1VQBA 2R93H 3TS0A 4A3BG 2HIVA 5EBDA 4QIWE 3AFQA 3PV0A 4DR6L 2LS01 4ZKBB 2SNSA 2HHHL 4GNXB 4A3LH 5IYBH 3QOLA 3EBEA 1PDQA 1SBBB 3QJYA 3T56B 4UP7A 5DNFA 3NP8A 4LF4Q 3HOVH 3DHQA 3BVZA 3WWVA 4DA2A 3RMHA 3SEBA 1RKNA 3CPFA 4ZKCB 3PMFA 4O2DA 1DOKA 1P16A 1KDBA 3S15H 4PMCA 5KRUA 2NWGA 3U9OA 4A3MG 1FVIA 1FGBD 5KYIA 1T5EA 1Q46A 1G6ZA 4DUZQ 2A74C 4DV2Q 1EZ6A 1I50H 1EY6A 3OPOA 2XRQD 3Q22A 5I9PA 3SK5A 1PFMA 1O80A 3VDYA 4PZ7A 4DNRB 4CKEA 4K5XA 4O1NA 2IT1A 1F9RA
chains in the Genus database with same CATH topology
4YWKA 4X64L 3F2DA 1Q7YC 4RMFA 3J7A5 1YHBA 4DV3L 2JA6G 2R7DA 1PH5A 4JI3L 2K5NA 4LUZA 2UUCQ 3CCEA 1Q1BA 1WFQA 1C7YA 2C35B 1VQHA 4JI3Q 1L1OC 2HQLA 3RLOA 1HH2P 2Q2IA 1Q8KA 4DR1Q 2WB1G 1QZGA 3T1HQ 1MJEA 5C4XH 4JV5L 1QZHA 1OTCA 3T1YL 3AYHB 4IJLA 2E8GA 4JG2A 1L0WA 1I6HH 1OXSC 4A3MH 1IBKL 1H95A 2UXBL 2DUDA 4P74A 2CKZB 3NENA 1IBLQ 4KI0A 1CKNA 1GD7A 3S1MH 4DR2Q 2ALYB 2Q2UA 3HKZE 3I4NH 4DV4Q 1K9MC 4JI1Q 2B63H 1K8GA 1Y1WH 2A19A 4GS3A 4L5TA 3ZJYC 1X55A 3J81j 1GM5A 1N32L 3HOUH 1VQ5A 3KFUA 3GDEA 5AJ3L 4J15A 4BY7G 1HNWQ 5C3EG 1XMOL 4ME3A 4OWXB 2DGYA 5AJ3Q 1K0RA 4QL5A 3CCMA 1EOVA 3G71A 2E2IH 4A3FG 5FJ8G 4LF7Q 1WOCA 4AIMA 4LFCQ 5IP9H 4JI8L 1Y14B 2R93G 1HJPA 2YYZA 3CF5A 2B29A 3TEHB 2JA5G 1BVSA 1Q86C 1M1KC 1SFOH 4UPAA 1JJCB 3F1ZA 4ALPA 2JEAI 1AE3A 1DGSA 2AHOB 5IWAQ 4YCWA 1YZ6A 4L5SA 2YU9H 4A3LG 4DUYQ 1GO3E 1G291 1Q12A 5IYBG 4A93H 4A3CG 4L5RC 4EQ5A 1J5EQ 1XNQQ 3FP9A 2ZM6L 3SGIA 4GKJL 3CMEA 3GTKH 1C0AA 3J80i 1XTDA 1N34Q 3PO2H 2VZAA 4GKJQ 1HNZL 1W2BA 4L5QA 1V43A 3CPWA 4A3GG 3BZKA 1EWIA 4IPHA 1X56A 3AQQA 2NVXH 1TWFH 3I2ZA 1NTGA 1IBMQ 1GKHA 2GVBA 5M3FH 1XPUA 1TWGH 1P8LA 1E7ZA 1C9OA 2LXKA 3KF6B 2CQOA 4BY7H 1N36L 3F8TA 3EIVA 5C3EH 2N49A 2R6GA 2GVAA 1OXVA 1XPRA 3RNUA 2K5VA 2UU9Q 2NN6G 4BA1I 5FJ8H 5M3MH 2ZJQA 4P75A 2BH2A 4Y7NH 4OX9L 3L0OA 1N33Q 3I4OA 3PO3H 4A3IG 3HFZB 2JA5H 1JT8A 1QVGA 3PF4A 1KHIA 4KHZA 4HJ7A 1X3GA 3CW2C 2Z6KC 3M4QA 4LF4L 3Q8DA 4GN4B 2JA8G 2Z6KA 1ASZA 4A3CH 4B3RQ 2N78A 3F2BA 1NMGA 1VQ7A 1KAWA 2QEXA 4YY3L 4JI4Q 1HNXL 5IT9c 2R92H 4AYBG 1Q81C 1IYJB 4P72A 1KRSA 4X62L 4IPCA 2JA9A 3M85A 3U58A 4A3JG 1SROA 1NY4A 4LFBL 4A3GH 5LMNW 1D7QA 1EUJA 4POGA 5JJKA 3HKSA 3STBC 4LF8Q 2EQSA 3K8AA 4LFBQ 4DUZL 3JAMc 3M4OH 4JI0Q 4LUOA 4P73A 4DV2L 4K0KQ 3KDFA 3E9HA 2A1AA 3GTOH 4R4TA 1UE5A 2WAQE 1LM0A 3CCRA 4JI7Q 1NJIC 2NVTH 5IYDH 2ZTCA 2I0QA 2KCMA 3I4NG 4C2MH 2B63G 1Y1WG 1HR0L 4GKKQ 4NXMQ 1VQIA 3U50C 1B7YB 2KBNA 4YWMA 3UDXA 4A4IA 4B3MQ 2XTIA 4OXPA 1T9HA 1CSQA 1VQEA 2R7FA 3S1NH 1E24A 1YJNA 2CWPA 3G48A 1YEZA 2UUCL 4B3TQ 5IP9G 3AEVA 5FLMH 3UDGA 2UUAQ 2F52A 2VQFQ 4JOIA 4DR1L 4LF9Q 3T1HL 1XMQQ 1WYDA 1CKNB 2UXCQ 1K8AC 4DR4Q 5M5WH 2NVQH 4FDBA 4A3JH 5GQOA 2ASBA 5M5YH 2D0PA 4A93G 3PSIA 1BBWA 5GROA 2K50A 2MO0A 3RLNA 2NZOA 5IYCH 4DV0Q 2K5HA 2KENA 5FLXc 1PH3A 1I5FA 4DR2L 4X65Q 1N8RC 3RN2A 2JK8A 4DV7Q 4DV4L 1VQGA 3A5ZB 4JI1L 2CWAA 2VL6A 4JI6Q 3PO2G 5IE8A 2V1CC 1PH6A 2K4KA 2VQEQ 2IX1A 4IO9A 5C0XJ 5JJIA 4JI5Q 3G6EA 4A3EH 2NVYH 1HNWL 4DAMA 2RHSB 5M3FG 2N8NA 1WCMG 3B6YA 3OTOQ 2GN5A 1VQPA 3CD6A 4JI2L 3GO5A 3PUYA 4DV5L 4LFCL 4LF7L 3ULPA 2VY3A 3H3VI 4QGUA 1KC8C 5GAHC 1I3QH 4DR5Q 1VS0A 2PMZE 1SMXA 1FL0A 3J81c 3TS2A 4HIOA 4DR7Q 4JI2Q 3M7NA 4DV5Q 4OO1I 1PV4A 5M3MG 1TXYA 2AWOA 1Z47A 4R4QA 1UE6A 1VQAA 4C3IH 5JEAJ 5IWAL 3PO3G 3CC7A 5LMUQ 3E9IA 4DUYL 1TWHH 2I5MX 1CUKA 3S17H 1Q1EA 2IHFA 1W3SA 4GLVB 3HOWH 4AYBE 3H0GH 1J5EL 4OO1G 1EQQA 1XNQL 3MXNB 3S2DH 1CSPA 2D0OA 2K75A 4H02A 1G51A 1B8AA 1X9NA 1N34L 3STBD 3I55A 1PH7A 1VQ8A 1S72A 1X3EA 2E2JH 1NE3A 2OQKA 4GLXA 3M4PA 2R92G 1LUZA 1UE1A 4R1JA 1X65A 4AQYQ 1PVOA 1FGUA 1OXUA 2Y0SG 1K3RA 2LXJA 2AMCB 4UP9A 1IBML 1K83H 1LTLA 1NMFA 2I5LX 3KLWA 4DV6Q 3GTJH 4LF5Q 1UEBA 3W1BA 1KIXA 3AFPA 2ZTEA 4C3JH 2HT1A 1WCMH 4OX9Q 1YI2A 3DM3A 1EFWA 2OWOA 3PUWA 1VQ9A 2UU9L 5LMNQ 1E3PA 5M5XH 2JE6I 1HZAA 4MNOA 4TQUS 5ELNA 5ELOA 5IYDG 2QA4A 4OWWB 1N33L 3L2PA 3CCQA 2Q2HA 1UE7A 4DPGA 1Q82C 3PUZA 2VW9A 3CXCA 1ASYA 4WJ3M 1A62A 4BBRG 2OTLA 4QY7A 4B3RL 3PIOA 2MQHA 1A0IA 1XNRQ 1VQ4A 2IY5B 4QJFA 3ER0A 4JI4L 2R7ZG 2WB1E 1IL2A 1SN8A 2BA1A 1VQNA 5FLMG 2JEBI 3KDFB 4EX5A 2UXDQ 1BKBA 3EN2A 3HKZG 4A76A 4A3DH 5E7NA 3J80c 3GTLH 2KHIA 4MZ9A 4AH6A 2LSSA 3BZCA 5IP7H 2EIFA 4LF8L 4JBWA 4LWCA 1VQOA 3CCUA 2EXDA 4JI0L 1E22A 3RZOH 5C0XI 4K0KL 1N9WA 4HJAA 4DR3Q 2Q2TA 5BR8Q 4PMWA 5IYCG 4X66Q 4GOPB 2NZHA 3D0FA 1UWVA 2RCNA 3LGJA 3CQZH 2UUBL 4JBMA 4JI7L 3GD7A 4JYAQ 2L15A 3M3YH 4Y52H 3NEMA 4DR6Q 3CCSA 4GN3B 2HHHQ 4BY1H 1M90C 2UUBQ 4NXML 4GKKL 4BBSG 1IBLL 1X3FA 4B3ML 3FKIH 4GLAC 4TVAB 4QQBX 4WJ4A 4A3EG 4R4OA 4GOPC 1KL9A 3W5OA 2ES2A 1KD1C 3HOYG 2K14A 4BBRH 3KYHC 3CCVA 2IHEA 4HJ5A 4GOPA 3S1RH 1I94L 1VQKA 3NBHB 4B3TL 4IPGA 3OYYA 3CMAA 5JJLA 2UUAL 1I94Q 1YBYA 2VQFL 4LF9L 2R7ZH 3TREA 1PH1A 4XIGS 4JOIC 1XMQL 2UXCL 2OTJA 5JEAG 1PA6A 3A0JA 3KJPA 4DR4L 3CAMA 4JBJA 3ULLA 4KHPQ 1HZBA 3F2CA 3J81i 1JJ2A 3RN5A 1YHAA 5J3BA 3S24A 4LF6Q 1PYBA 4NXNQ 4NB3A 4DKAC 1J6QA 1FJGL 3CCJA 2AKWB 1SLJA 2PI2A 3HOWG 3H0GG 1KQSA 4DV0L 4A3BH 2Y0SE 3IRBA 3JC66 4LFAQ 1FJGQ 2BH8A 4X65L 3DLLA 1CKMA 1OXTA 4DV7L 4B3SL 4BXXH 2WP8J 1A8VA 4YWLA 4O0AA 4JI6L 2VUMH 3KF8B 2E5LL 1YITA 3A74A 2VQEL 3RZDH 4B3SQ 3PGZA 4R4CA 1S3OA 1MKHA 3KOJA 2K52A 2ATWA 4JI5L 2E5LQ 2F4VQ 5C4JH 1YIJA 4BBSH 3TRZA 3I56A 3PUVA 4HIMA 3U4VA 4X64Q 2BA0A 4YHHL 3OW2A 3OTOL 4DV3Q 2AWNA 3CC2A 5EAYA 2VS1A 3HOYH 1VQFA 4YHHQ 1PH2A 1R9TH 4DR5L 2OQ0A 1L1OA 3K7AH 4XTCS 3HOZG 4DR7L 4MTNA 3G4SA 4R4IA 3GTPH 3S2HH 3UE1A 5GADC 4JV5Q 1JJGA 3HOXG 3T1YQ 5LMUL 4RG1A 3UE0A 3E0EA 2B3GA 1Y1VH 3A5UA 3RR5A 3FHWA 1IBKQ 2HIXA 2UXBQ 1HR0W 1RL2A 1KXLA 1E1OA 4IFDJ 1TWAH 1VQ6A 3GTQH 1U5KA 2KCTA 4C3HH 3KJOA 3TQYA 4UP8A 2WFWA 4DV1L 3ICEA 5C44G 2ID0A 2WAQG 2CFMA 5IY0A 4X6AH 3I4MG 1N32Q 4HJ9A 4AQYL 1S40A 2ZJPA 1IZ6A 4DV1Q 4A3DG 2JA7H 2ZM6Q 3PIPA 2JA6H 5IP7G 4DV6L 3UDFA 1XMOQ 4A75A 3I7FA 1QVCA 3MEFA 4IPDA 3CCLA 4LF5L 2MO1A 1BBUA 1WI5A 4OONA 3BJUA 1YVCA 2YV5A 3PUXA 4DAYB 1HZ9A 4A3KG 1IXRA 2MFIA 2YTVA 2XGTA 2PQAB 4JI8Q 1JMCA 1VQCA 5LMNL 4BA2I 1O7IA 4YCUA 4PG3A 1NBWA 3CC4A 1WJJA 3PF5A 3HOZH 2A8VA 1YNXA 4KLKA 3HOVG 4BY1G 3J7ZC 3S14H 3HOXH 1RIPA 5HGQA 4LNQA 4APVA 3FKIG 1PFSA 2CCZA 2VNUD 3CP0A 1MJCA 1TWCH 2IX0A 1CKOA 2PQAA 2F3IA 1SRUA 4JC0A 4LUVA 4PZ8A 5HY6A 4DNIA 1XNRL 3H3VH 1AH9A 1Z9FA 5DLQE 1VQJA 1L2FA 1HNZQ 3GTMH 1PH8A 4IOAA 1VQLA 1V9PA 1VCIA 5H1SE 3JAMi 2ZJRA 2UXDL 2FXQA 2NN6I 2H5XA 1SR3A 4PZ6A 4DK3C 5C44H 1EYGA 3I4MH 4JBKA 1X6OA 1EQRA 1YJ9A 3H15A 1QVFA 1N36Q 3W1GA 2Z0SA 4A3FH 2RHQB 3ULJA 1QUQB 3RLFA 1VQBA 2PNHA 3BU2A 4DR3L 5BR8L 2R93H 4HIKA 2JJQA 2HIVA 4X66L 3TS0A 4A3KH 4A3BG 1B70B 3NELA 4BXXG 4IJHA 4IOCA 4HJ8A 1VQMA 2PI2E 4JYAL 2VUMG 3PCOB 3AFQA 1D8LA 3KF6A 3PV0A 4QIWE 2YTYA 2HHHL 4DR6L 4GNXB 4JCVE 4A3LH 5IYBH 1A63A 1X54A 2MNAA 3EBEA 1SE8A 4GN5A 4UY8C 2D62A 5C0XG 3HOVH 1V1QA 3L7ZC 4UP7A 4LF4Q 1QUQA 3WWVA 1JE5A 4OWTB 3M9BA 3D31A 1KRTA 1YHQA 2YTXA 1PH9A 3CPFA 2RF4A 4YY3Q 4GNXC 1XPOA 2KHJA 1EIYB 1MIUA 1HNXQ 4P71A 1PH4A 5C4XG 4O2DA 2QGQA 5K36G 4GNXA 2E2HH 1P16A 3ERSX 4X62Q 2OCEA 3S15H 4LW1A 1XJVA 4IFDI 3GTGH 4KHPL 3S1QH 3K7UC 3K0XA 4A3MG 1FVIA 3S16H 4LF6L 2JA7G 1G6PA 4NXNL 1E1TA 1Q46A 1YJWA 2ZTDA 1Y1VG 4HIDA 4DUZQ 1PYSB 1HZCA 1K73C 4DV2Q 1PHJA 4YCVA 4IFDG 2N3SA 4DK6C 1I50H 1AE2A 4LFAL 1GVPA 3K81C 1LYLA 2JQOA 1EIFA 3U4ZA 4NPSA 4POFA 3UDIA 4A3IH 1JB7A 3HOUG 1HR0Q 1U0LA 3K80C 3VDYA 1VQDA 2I5HA 4PZ7A 5GAGC 2F4VL 1L1OB 2JA8H 2IT1A 5GAEC 1OXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWK A;  4X64 L;  3F2D A;  1Q7Y C;  4RMF A;  3J7A 5;  1YHB A;  4DV3 L;  2JA6 G;  2R7D A;  1PH5 A;  4JI3 L;  2K5N A;  4LUZ A;  2UUC Q;  3CCE A;  1Q1B A;  1WFQ A;  1C7Y A;  2C35 B;  1VQH A;  4JI3 Q;  1L1O C;  2HQL A;  3RLO A;  1HH2 P;  2Q2I A;  1Q8K A;  4DR1 Q;  2WB1 G;  1QZG A;  3T1H Q;  1MJE A;  5C4X H;  4JV5 L;  1QZH A;  1OTC A;  3T1Y L;  3AYH B;  4IJL A;  2E8G A;  4JG2 A;  1L0W A;  1I6H H;  1OXS C;  4A3M H;  1IBK L;  1H95 A;  2UXB L;  2DUD A;  4P74 A;  2CKZ B;  3NEN A;  1IBL Q;  4KI0 A;  1CKN A;  1GD7 A;  3S1M H;  4DR2 Q;  2ALY B;  2Q2U A;  3HKZ E;  3I4N H;  4DV4 Q;  1K9M C;  4JI1 Q;  2B63 H;  1K8G A;  1Y1W H;  2A19 A;  4GS3 A;  4L5T A;  3ZJY C;  1X55 A;  3J81 j;  1GM5 A;  1N32 L;  3HOU H;  1VQ5 A;  3KFU A;  3GDE A;  5AJ3 L;  4J15 A;  4BY7 G;  1HNW Q;  5C3E G;  1XMO L;  4ME3 A;  4OWX B;  2DGY A;  5AJ3 Q;  1K0R A;  4QL5 A;  3CCM A;  1EOV A;  3G71 A;  2E2I H;  4A3F G;  5FJ8 G;  4LF7 Q;  1WOC A;  4AIM A;  4LFC Q;  5IP9 H;  4JI8 L;  1Y14 B;  2R93 G;  1HJP A;  2YYZ A;  3CF5 A;  2B29 A;  3TEH B;  2JA5 G;  1BVS A;  1Q86 C;  1M1K C;  1SFO H;  4UPA A;  1JJC B;  3F1Z A;  4ALP A;  2JEA I;  1AE3 A;  1DGS A;  2AHO B;  5IWA Q;  4YCW A;  1YZ6 A;  4L5S A;  2YU9 H;  4A3L G;  4DUY Q;  1GO3 E;  1G29 1;  1Q12 A;  5IYB G;  4A93 H;  4A3C G;  4L5R C;  4EQ5 A;  1J5E Q;  1XNQ Q;  3FP9 A;  2ZM6 L;  3SGI A;  4GKJ L;  3CME A;  3GTK H;  1C0A A;  3J80 i;  1XTD A;  1N34 Q;  3PO2 H;  2VZA A;  4GKJ Q;  1HNZ L;  1W2B A;  4L5Q A;  1V43 A;  3CPW A;  4A3G G;  3BZK A;  1EWI A;  4IPH A;  1X56 A;  3AQQ A;  2NVX H;  1TWF H;  3I2Z A;  1NTG A;  1IBM Q;  1GKH A;  2GVB A;  5M3F H;  1XPU A;  1TWG H;  1P8L A;  1E7Z A;  1C9O A;  2LXK A;  3KF6 B;  2CQO A;  4BY7 H;  1N36 L;  3F8T A;  3EIV A;  5C3E H;  2N49 A;  2R6G A;  2GVA A;  1OXV A;  1XPR A;  3RNU A;  2K5V A;  2UU9 Q;  2NN6 G;  4BA1 I;  5FJ8 H;  5M3M H;  2ZJQ A;  4P75 A;  2BH2 A;  4Y7N H;  4OX9 L;  3L0O A;  1N33 Q;  3I4O A;  3PO3 H;  4A3I G;  3HFZ B;  2JA5 H;  1JT8 A;  1QVG A;  3PF4 A;  1KHI A;  4KHZ A;  4HJ7 A;  1X3G A;  3CW2 C;  2Z6K C;  3M4Q A;  4LF4 L;  3Q8D A;  4GN4 B;  2JA8 G;  2Z6K A;  1ASZ A;  4A3C H;  4B3R Q;  2N78 A;  3F2B A;  1NMG A;  1VQ7 A;  1KAW A;  2QEX A;  4YY3 L;  4JI4 Q;  1HNX L;  5IT9 c;  2R92 H;  4AYB G;  1Q81 C;  1IYJ B;  4P72 A;  1KRS A;  4X62 L;  4IPC A;  2JA9 A;  3M85 A;  3U58 A;  4A3J G;  1SRO A;  1NY4 A;  4LFB L;  4A3G H;  5LMN W;  1D7Q A;  1EUJ A;  4POG A;  5JJK A;  3HKS A;  3STB C;  4LF8 Q;  2EQS A;  3K8A A;  4LFB Q;  4DUZ L;  3JAM c;  3M4O H;  4JI0 Q;  4LUO A;  4P73 A;  4DV2 L;  4K0K Q;  3KDF A;  3E9H A;  2A1A A;  3GTO H;  4R4T A;  1UE5 A;  2WAQ E;  1LM0 A;  3CCR A;  4JI7 Q;  1NJI C;  2NVT H;  5IYD H;  2ZTC A;  2I0Q A;  2KCM A;  3I4N G;  4C2M H;  2B63 G;  1Y1W G;  1HR0 L;  4GKK Q;  4NXM Q;  1VQI A;  3U50 C;  1B7Y B;  2KBN A;  4YWM A;  3UDX A;  4A4I A;  4B3M Q;  2XTI A;  4OXP A;  1T9H A;  1CSQ A;  1VQE A;  2R7F A;  3S1N H;  1E24 A;  1YJN A;  2CWP A;  3G48 A;  1YEZ A;  2UUC L;  4B3T Q;  5IP9 G;  3AEV A;  5FLM H;  3UDG A;  2UUA Q;  2F52 A;  2VQF Q;  4JOI A;  4DR1 L;  4LF9 Q;  3T1H L;  1XMQ Q;  1WYD A;  1CKN B;  2UXC Q;  1K8A C;  4DR4 Q;  5M5W H;  2NVQ H;  4FDB A;  4A3J H;  5GQO A;  2ASB A;  5M5Y H;  2D0P A;  4A93 G;  3PSI A;  1BBW A;  5GRO A;  2K50 A;  2MO0 A;  3RLN A;  2NZO A;  5IYC H;  4DV0 Q;  2K5H A;  2KEN A;  5FLX c;  1PH3 A;  1I5F A;  4DR2 L;  4X65 Q;  1N8R C;  3RN2 A;  2JK8 A;  4DV7 Q;  4DV4 L;  1VQG A;  3A5Z B;  4JI1 L;  2CWA A;  2VL6 A;  4JI6 Q;  3PO2 G;  5IE8 A;  2V1C C;  1PH6 A;  2K4K A;  2VQE Q;  2IX1 A;  4IO9 A;  5C0X J;  5JJI A;  4JI5 Q;  3G6E A;  4A3E H;  2NVY H;  1HNW L;  4DAM A;  2RHS B;  5M3F G;  2N8N A;  1WCM G;  3B6Y A;  3OTO Q;  2GN5 A;  1VQP A;  3CD6 A;  4JI2 L;  3GO5 A;  3PUY A;  4DV5 L;  4LFC L;  4LF7 L;  3ULP A;  2VY3 A;  3H3V I;  4QGU A;  1KC8 C;  5GAH C;  1I3Q H;  4DR5 Q;  1VS0 A;  2PMZ E;  1SMX A;  1FL0 A;  3J81 c;  3TS2 A;  4HIO A;  4DR7 Q;  4JI2 Q;  3M7N A;  4DV5 Q;  4OO1 I;  1PV4 A;  5M3M G;  1TXY A;  2AWO A;  1Z47 A;  4R4Q A;  1UE6 A;  1VQA A;  4C3I H;  5JEA J;  5IWA L;  3PO3 G;  3CC7 A;  5LMU Q;  3E9I A;  4DUY L;  1TWH H;  2I5M X;  1CUK A;  3S17 H;  1Q1E A;  2IHF A;  1W3S A;  4GLV B;  3HOW H;  4AYB E;  3H0G H;  1J5E L;  4OO1 G;  1EQQ A;  1XNQ L;  3MXN B;  3S2D H;  1CSP A;  2D0O A;  2K75 A;  4H02 A;  1G51 A;  1B8A A;  1X9N A;  1N34 L;  3STB D;  3I55 A;  1PH7 A;  1VQ8 A;  1S72 A;  1X3E A;  2E2J H;  1NE3 A;  2OQK A;  4GLX A;  3M4P A;  2R92 G;  1LUZ A;  1UE1 A;  4R1J A;  1X65 A;  4AQY Q;  1PVO A;  1FGU A;  1OXU A;  2Y0S G;  1K3R A;  2LXJ A;  2AMC B;  4UP9 A;  1IBM L;  1K83 H;  1LTL A;  1NMF A;  2I5L X;  3KLW A;  4DV6 Q;  3GTJ H;  4LF5 Q;  1UEB A;  3W1B A;  1KIX A;  3AFP A;  2ZTE A;  4C3J H;  2HT1 A;  1WCM H;  4OX9 Q;  1YI2 A;  3DM3 A;  1EFW A;  2OWO A;  3PUW A;  1VQ9 A;  2UU9 L;  5LMN Q;  1E3P A;  5M5X H;  2JE6 I;  1HZA A;  4MNO A;  4TQU S;  5ELN A;  5ELO A;  5IYD G;  2QA4 A;  4OWW B;  1N33 L;  3L2P A;  3CCQ A;  2Q2H A;  1UE7 A;  4DPG A;  1Q82 C;  3PUZ A;  2VW9 A;  3CXC A;  1ASY A;  4WJ3 M;  1A62 A;  4BBR G;  2OTL A;  4QY7 A;  4B3R L;  3PIO A;  2MQH A;  1A0I A;  1XNR Q;  1VQ4 A;  2IY5 B;  4QJF A;  3ER0 A;  4JI4 L;  2R7Z G;  2WB1 E;  1IL2 A;  1SN8 A;  2BA1 A;  1VQN A;  5FLM G;  2JEB I;  3KDF B;  4EX5 A;  2UXD Q;  1BKB A;  3EN2 A;  3HKZ G;  4A76 A;  4A3D H;  5E7N A;  3J80 c;  3GTL H;  2KHI A;  4MZ9 A;  4AH6 A;  2LSS A;  3BZC A;  5IP7 H;  2EIF A;  4LF8 L;  4JBW A;  4LWC A;  1VQO A;  3CCU A;  2EXD A;  4JI0 L;  1E22 A;  3RZO H;  5C0X I;  4K0K L;  1N9W A;  4HJA A;  4DR3 Q;  2Q2T A;  5BR8 Q;  4PMW A;  5IYC G;  4X66 Q;  4GOP B;  2NZH A;  3D0F A;  1UWV A;  2RCN A;  3LGJ A;  3CQZ H;  2UUB L;  4JBM A;  4JI7 L;  3GD7 A;  4JYA Q;  2L15 A;  3M3Y H;  4Y52 H;  3NEM A;  4DR6 Q;  3CCS A;  4GN3 B;  2HHH Q;  4BY1 H;  1M90 C;  2UUB Q;  4NXM L;  4GKK L;  4BBS G;  1IBL L;  1X3F A;  4B3M L;  3FKI H;  4GLA C;  4TVA B;  4QQB X;  4WJ4 A;  4A3E G;  4R4O A;  4GOP C;  1KL9 A;  3W5O A;  2ES2 A;  1KD1 C;  3HOY G;  2K14 A;  4BBR H;  3KYH C;  3CCV A;  2IHE A;  4HJ5 A;  4GOP A;  3S1R H;  1I94 L;  1VQK A;  3NBH B;  4B3T L;  4IPG A;  3OYY A;  3CMA A;  5JJL A;  2UUA L;  1I94 Q;  1YBY A;  2VQF L;  4LF9 L;  2R7Z H;  3TRE A;  1PH1 A;  4XIG S;  4JOI C;  1XMQ L;  2UXC L;  2OTJ A;  5JEA G;  1PA6 A;  3A0J A;  3KJP A;  4DR4 L;  3CAM A;  4JBJ A;  3ULL A;  4KHP Q;  1HZB A;  3F2C A;  3J81 i;  1JJ2 A;  3RN5 A;  1YHA A;  5J3B A;  3S24 A;  4LF6 Q;  1PYB A;  4NXN Q;  4NB3 A;  4DKA C;  1J6Q A;  1FJG L;  3CCJ A;  2AKW B;  1SLJ A;  2PI2 A;  3HOW G;  3H0G G;  1KQS A;  4DV0 L;  4A3B H;  2Y0S E;  3IRB A;  3JC6 6;  4LFA Q;  1FJG Q;  2BH8 A;  4X65 L;  3DLL A;  1CKM A;  1OXT A;  4DV7 L;  4B3S L;  4BXX H;  2WP8 J;  1A8V A;  4YWL A;  4O0A A;  4JI6 L;  2VUM H;  3KF8 B;  2E5L L;  1YIT A;  3A74 A;  2VQE L;  3RZD H;  4B3S Q;  3PGZ A;  4R4C A;  1S3O A;  1MKH A;  3KOJ A;  2K52 A;  2ATW A;  4JI5 L;  2E5L Q;  2F4V Q;  5C4J H;  1YIJ A;  4BBS H;  3TRZ A;  3I56 A;  3PUV A;  4HIM A;  3U4V A;  4X64 Q;  2BA0 A;  4YHH L;  3OW2 A;  3OTO L;  4DV3 Q;  2AWN A;  3CC2 A;  5EAY A;  2VS1 A;  3HOY H;  1VQF A;  4YHH Q;  1PH2 A;  1R9T H;  4DR5 L;  2OQ0 A;  1L1O A;  3K7A H;  4XTC S;  3HOZ G;  4DR7 L;  4MTN A;  3G4S A;  4R4I A;  3GTP H;  3S2H H;  3UE1 A;  5GAD C;  4JV5 Q;  1JJG A;  3HOX G;  3T1Y Q;  5LMU L;  4RG1 A;  3UE0 A;  3E0E A;  2B3G A;  1Y1V H;  3A5U A;  3RR5 A;  3FHW A;  1IBK Q;  2HIX A;  2UXB Q;  1HR0 W;  1RL2 A;  1KXL A;  1E1O A;  4IFD J;  1TWA H;  1VQ6 A;  3GTQ H;  1U5K A;  2KCT A;  4C3H H;  3KJO A;  3TQY A;  4UP8 A;  2WFW A;  4DV1 L;  3ICE A;  5C44 G;  2ID0 A;  2WAQ G;  2CFM A;  5IY0 A;  4X6A H;  3I4M G;  1N32 Q;  4HJ9 A;  4AQY L;  1S40 A;  2ZJP A;  1IZ6 A;  4DV1 Q;  4A3D G;  2JA7 H;  2ZM6 Q;  3PIP A;  2JA6 H;  5IP7 G;  4DV6 L;  3UDF A;  1XMO Q;  4A75 A;  3I7F A;  1QVC A;  3MEF A;  4IPD A;  3CCL A;  4LF5 L;  2MO1 A;  1BBU A;  1WI5 A;  4OON A;  3BJU A;  1YVC A;  2YV5 A;  3PUX A;  4DAY B;  1HZ9 A;  4A3K G;  1IXR A;  2MFI A;  2YTV A;  2XGT A;  2PQA B;  4JI8 Q;  1JMC A;  1VQC A;  5LMN L;  4BA2 I;  1O7I A;  4YCU A;  4PG3 A;  1NBW A;  3CC4 A;  1WJJ A;  3PF5 A;  3HOZ H;  2A8V A;  1YNX A;  4KLK A;  3HOV G;  4BY1 G;  3J7Z C;  3S14 H;  3HOX H;  1RIP A;  5HGQ A;  4LNQ A;  4APV A;  3FKI G;  1PFS A;  2CCZ A;  2VNU D;  3CP0 A;  1MJC A;  1TWC H;  2IX0 A;  1CKO A;  2PQA A;  2F3I A;  1SRU A;  4JC0 A;  4LUV A;  4PZ8 A;  5HY6 A;  4DNI A;  1XNR L;  3H3V H;  1AH9 A;  1Z9F A;  5DLQ E;  1VQJ A;  1L2F A;  1HNZ Q;  3GTM H;  1PH8 A;  4IOA A;  1VQL A;  1V9P A;  1VCI A;  5H1S E;  3JAM i;  2ZJR A;  2UXD L;  2FXQ A;  2NN6 I;  2H5X A;  1SR3 A;  4PZ6 A;  4DK3 C;  5C44 H;  1EYG A;  3I4M H;  4JBK A;  1X6O A;  1EQR A;  1YJ9 A;  3H15 A;  1QVF A;  1N36 Q;  3W1G A;  2Z0S A;  4A3F H;  2RHQ B;  3ULJ A;  1QUQ B;  3RLF A;  1VQB A;  2PNH A;  3BU2 A;  4DR3 L;  5BR8 L;  2R93 H;  4HIK A;  2JJQ A;  2HIV A;  4X66 L;  3TS0 A;  4A3K H;  4A3B G;  1B70 B;  3NEL A;  4BXX G;  4IJH A;  4IOC A;  4HJ8 A;  1VQM A;  2PI2 E;  4JYA L;  2VUM G;  3PCO B;  3AFQ A;  1D8L A;  3KF6 A;  3PV0 A;  4QIW E;  2YTY A;  2HHH L;  4DR6 L;  4GNX B;  4JCV E;  4A3L H;  5IYB H;  1A63 A;  1X54 A;  2MNA A;  3EBE A;  1SE8 A;  4GN5 A;  4UY8 C;  2D62 A;  5C0X G;  3HOV H;  1V1Q A;  3L7Z C;  4UP7 A;  4LF4 Q;  1QUQ A;  3WWV A;  1JE5 A;  4OWT B;  3M9B A;  3D31 A;  1KRT A;  1YHQ A;  2YTX A;  1PH9 A;  3CPF A;  2RF4 A;  4YY3 Q;  4GNX C;  1XPO A;  2KHJ A;  1EIY B;  1MIU A;  1HNX Q;  4P71 A;  1PH4 A;  5C4X G;  4O2D A;  2QGQ A;  5K36 G;  4GNX A;  2E2H H;  1P16 A;  3ERS X;  4X62 Q;  2OCE A;  3S15 H;  4LW1 A;  1XJV A;  4IFD I;  3GTG H;  4KHP L;  3S1Q H;  3K7U C;  3K0X A;  4A3M G;  1FVI A;  3S16 H;  4LF6 L;  2JA7 G;  1G6P A;  4NXN L;  1E1T A;  1Q46 A;  1YJW A;  2ZTD A;  1Y1V G;  4HID A;  4DUZ Q;  1PYS B;  1HZC A;  1K73 C;  4DV2 Q;  1PHJ A;  4YCV A;  4IFD G;  2N3S A;  4DK6 C;  1I50 H;  1AE2 A;  4LFA L;  1GVP A;  3K81 C;  1LYL A;  2JQO A;  1EIF A;  3U4Z A;  4NPS A;  4POF A;  3UDI A;  4A3I H;  1JB7 A;  3HOU G;  1HR0 Q;  1U0L A;  3K80 C;  3VDY A;  1VQD A;  2I5H A;  4PZ7 A;  5GAG C;  2F4V L;  1L1O B;  2JA8 H;  2IT1 A;  5GAE C;  1OXX K; 
#chains in the Genus database with same CATH topology
 4X64 L;  3F2D A;  1SNO A;  1STH A;  1DCZ A;  1EYA A;  2UUC Q;  1Q1B A;  1D5X C;  1HH2 P;  2WB1 G;  5C4X H;  2QDL A;  3DUZ A;  1L0W A;  1I6H H;  2CH4 W;  4XQQ A;  1IBK L;  2UXB L;  4FXD A;  1V1P B;  2VB2 X;  4BY1 B;  1PZK D;  2ALY B;  1WTW A;  3I4N H;  4FXK C;  1K8G A;  3C1E A;  1IW7 D;  2A19 A;  1UEA B;  3BS1 A;  1IKL A;  1EY7 A;  3CKI B;  1B53 A;  3R8B A;  1B44 D;  2E2D C;  2PNR C;  1EY8 A;  1O7Z A;  1AZP A;  4TSS A;  5IGD A;  4DN4 M;  1EOV A;  3S16 B;  2B2U A;  1EYC A;  4AIM A;  4LFC Q;  1LAB A;  1Y14 B;  1XYI A;  1EY9 A;  2YYZ A;  4LK1 C;  4RKL A;  4UPA A;  3F1Z A;  1PMR A;  3NWT A;  1DGS A;  4BWG B;  1MI2 A;  4EQ5 A;  2VUM B;  3FP9 A;  5J39 A;  4K14 A;  2P5Z X;  3HEJ A;  1HNZ L;  2F3W A;  3LX0 A;  2PYK A;  5L37 A;  4A3G G;  5C4Z A;  1GUW A;  4RGM A;  3SE0 A;  1X56 A;  1O7Y A;  1NTG A;  1IBM Q;  5M3F H;  2EYP A;  1TWG H;  3VYR A;  2CQO A;  1N36 L;  3F8T A;  5C3E H;  3CHB D;  5KNB A;  1HHV A;  2GVA A;  1NCV A;  1PYW D;  1KNE A;  2K7V A;  1OXV A;  1DD2 A;  2K5V A;  2EYL A;  4BA1 I;  5BN5 A;  5M3M H;  3K5O A;  4JW0 A;  1N33 Q;  3SXH A;  1I4G A;  2Z6K C;  1SXT A;  2JA8 G;  2Z6K A;  3A8J E;  4A3C H;  4B3R Q;  1MSG A;  1IYU A;  1PRT D;  2C9O A;  5AFW A;  1HXY D;  4J6H A;  1HNX L;  2JA7 B;  2VB3 X;  2JA6 B;  1U4M A;  1KRS A;  4X62 L;  3U58 A;  5LMN W;  1U9R A;  3MWY W;  2NYZ D;  1G2S A;  4LF8 Q;  2EQS A;  1F2Z A;  3K8A A;  1B3A A;  4EQP A;  3OMC A;  1PTO B;  3J81 E;  3MXP A;  4P73 A;  4HTH A;  4K0K Q;  1ZYR C;  2K33 A;  3KLS X;  1UE5 A;  3BDO A;  3Q24 A;  4IAL A;  4JI7 Q;  2NVT H;  2ZTC A;  3GTK B;  2A6E D;  4C2M H;  2RCF A;  4K5W A;  2EZV A;  2B63 G;  1Y1W G;  3QIA A;  4NXM Q;  3SHL A;  4WOR A;  3U50 C;  4A4I A;  4B3M Q;  3UDX A;  3FMC A;  4CJ1 B;  1A15 A;  1HPC A;  1E24 A;  4DAP A;  5I2X A;  1PRT B;  1LT5 D;  4BY7 B;  2UUA Q;  1A3T A;  4FYD A;  4DR1 L;  4JOI A;  1CHP D;  3T1H L;  2UXC Q;  1K8A C;  1RDP D;  5IOC A;  5M5W H;  2NVQ H;  5GQO A;  1NAP A;  3HG9 A;  4MIU A;  2JA5 B;  3R2T A;  2NZO A;  2KEN A;  3LWE A;  1PH3 A;  1N8R C;  2JK8 A;  1VQG A;  3A5Z B;  2KQ3 A;  3JAM L;  3EA6 A;  1QB5 D;  4U67 3;  4QUF A;  4IO9 A;  5JJI A;  4FF4 A;  2A6H D;  5IGE A;  1TS4 A;  1Y8O B;  1HNW L;  1K0S A;  1VMP A;  3GO5 A;  3PUY A;  4DV5 L;  4LF7 L;  2F0K A;  2L5T A;  1KC8 C;  3J80 E;  4DF7 A;  4DR5 Q;  1VS0 A;  1SMX A;  1FL0 A;  2DN8 A;  3J81 c;  4HIO A;  4DV5 Q;  3GTO B;  4R4Q A;  1VQA A;  3KBX A;  3PO3 G;  3CC7 A;  3S17 H;  2TMP A;  3SK6 A;  1Q1E A;  4ABN A;  1XNQ L;  5EBC A;  4A3I B;  1CSP A;  4G7H C;  1ROD A;  4LJZ C;  2RDF A;  1G51 A;  3S1N B;  2L4N A;  2Z8L A;  3MFY A;  2OQK A;  2R92 G;  4R1J A;  3PIP 3;  4AQY Q;  1K3R A;  4RGO S;  3R2I A;  4UP9 A;  1DOL A;  3X3M A;  2KEE A;  3AFP A;  4A3J B;  1WCM H;  1QE6 A;  1EFW A;  3D6W A;  2UU9 L;  5ELD A;  2JE6 I;  4MNO A;  4TQU S;  2QA4 A;  5IYD G;  4ZK9 B;  2Q2H A;  2F0M A;  1ILP A;  3BDC A;  1XX8 A;  2EYF A;  3CXC A;  1A62 A;  2OXP A;  3WDN A;  3KLR A;  1LTG D;  1EU4 A;  1SSO A;  4G57 A;  2IY5 B;  3G6J B;  4PNY A;  2R7Z G;  1IL2 A;  2BA1 A;  3NQI A;  5CMD A;  2JEB I;  4EX5 A;  1GUT A;  3HKZ G;  4A76 A;  1EY4 A;  3J80 c;  3BZC A;  4HCS A;  1EYD A;  4LWC A;  4DGZ A;  1N9W A;  2JN4 A;  1CQF A;  4DR3 Q;  5C5M A;  4OL7 A;  4X66 Q;  2YU9 B;  1UWV A;  4JBM A;  4JYA Q;  3P1H A;  1SMY C;  1X3P A;  2F03 A;  3NEM A;  4BY1 H;  2KUM A;  4TKO B;  4PQX A;  5D65 A;  4ULL A;  4GOP C;  5CYU A;  3W5O A;  1KD1 C;  3K5L A;  4HN7 A;  3HP3 A;  4GOP A;  2IHE A;  4HJ5 A;  1VQK A;  2K32 A;  3T4A C;  4F87 A;  2NVX B;  1ZEQ X;  1TWF B;  1UAP A;  5JJL A;  1F2L A;  4C3J B;  1TY2 A;  2EE1 A;  3ULL A;  1Y8P B;  3RN5 A;  1YHA A;  5J3B A;  2K6A A;  4NXN Q;  4DKA C;  2PCF B;  1FJG L;  3OMG A;  3CCJ A;  1YNJ D;  3NXW A;  1AW7 A;  1T5X D;  1FJG Q;  2BH8 A;  1OXT A;  2WP8 J;  4YWL A;  4I7Z C;  4JI6 L;  2VUM H;  1R4Q B;  3KOJ A;  1STE A;  1C48 A;  2PPB C;  5COY A;  5JAV A;  4YHH L;  1W6K A;  2HCI A;  5FO7 B;  3OW2 A;  2Y0S B;  3HOY H;  2K5W A;  1VQF A;  4YHH Q;  3ERO A;  3VA7 A;  3OIQ A;  3MAQ A;  3Q23 A;  2SOB A;  5I9O A;  4KD3 A;  3T1Y Q;  5JEA H;  3FHW A;  1Q8I A;  1BBX C;  1KXL A;  3V05 A;  1CA6 A;  3C2P A;  1VQ6 A;  3GTQ H;  2J4X A;  4C3H H;  4HSV A;  2WFW A;  5C44 G;  1EQT A;  3DWQ A;  2WAQ G;  4FVM A;  4DK1 A;  4HJ9 A;  4KKU A;  1GJX A;  2JA7 H;  3BVM A;  1CTM A;  3VR2 A;  2JA6 H;  5IP7 G;  1FNV A;  4DV6 L;  2WV6 D;  4LF5 L;  2EYM A;  1WI5 A;  2MO1 A;  4OON A;  3BJU A;  5CC4 A;  2YV5 A;  3PUX A;  2MFI A;  2XGT A;  2NB0 A;  4KMU C;  4YCU A;  1S4Z A;  1WJJ A;  2F0P A;  5M5Y B;  3QG1 A;  4FF3 A;  3HOZ H;  3HOV G;  3A8I E;  2M9V A;  2Z9H A;  4HED A;  3S14 H;  3HOX H;  4HMJ A;  1E2V A;  1BDO A;  3J7Y W;  3K58 A;  3P7J A;  2PQA A;  3H3V H;  4JC0 A;  4BBS B;  3SK8 A;  5DLQ E;  3NHH A;  4HSP A;  4A3E B;  3MZ5 A;  3GTM H;  5JPM C;  2NN6 I;  1SR3 A;  3ITP A;  4NDX A;  3OSO A;  1J9O A;  4K6L A;  1EOT A;  1DXM A;  1YJ9 A;  2R61 A;  2H4O A;  1DZ1 A;  1JWS D;  2RHQ B;  3BU2 A;  2PNH A;  4DXF A;  1R4P B;  4HIK A;  2JJQ A;  2K5D A;  4A3K H;  3NEL A;  1WTV A;  4IJH A;  2XN9 C;  4IOC A;  2KED A;  1KAA A;  2L55 A;  3HOW B;  3H0G B;  3KF6 A;  5ELF A;  2YTY A;  3SR1 A;  1ENA A;  3MTS A;  1LTA D;  4UY8 C;  3N6R A;  2D62 A;  5FOB B;  3L7Z C;  5G3L F;  1QUQ A;  1EL0 A;  5FK9 C;  1HRJ A;  3PQI A;  3ONA B;  2K5Q A;  2QW7 A;  4YY3 Q;  1EIY B;  1LLR D;  4IQZ A;  5C4X G;  2QGQ A;  5K36 G;  5TSS A;  3ERS X;  2OCE A;  4QUC A;  3H09 A;  2JYO A;  4KHP L;  1G6P A;  1Y1V G;  1PHJ A;  5DEH A;  1QNU A;  2NN6 H;  3MHB A;  1RJT A;  1U4R A;  1TWC B;  1LYL A;  1EIF A;  1GHJ A;  3U4Z A;  3UDI A;  4OEM B;  4A3I H;  1Y8N B;  2XNA C;  4IUQ A;  3K80 C;  3DXJ C;  4FF2 A;  2I5H A;  3J81 i;  3K5N A;  1Q7Y C;  1YHB A;  2PQE A;  4DV3 L;  3I4M B;  4G7Z C;  4A3D B;  1AFP A;  1KNA A;  1AEX A;  1L1O C;  4RCO A;  1K8M A;  1Q8K A;  2Q2I A;  5CR3 A;  2I46 A;  4JV5 L;  1OTC A;  1SNM A;  4RGT A;  1OXS C;  3MC0 B;  3W3A A;  3CQZ B;  1IBL Q;  4KI0 A;  1GD7 A;  2Q2U A;  1A6X A;  4DV4 Q;  1K9M C;  2M2L A;  4GS3 A;  3J81 j;  1N32 L;  1S5F D;  3HOU H;  3KLS A;  5T1I A;  1SYE A;  3KFU A;  3V2T A;  1SJH D;  4V0B A;  1H9S B;  5C3E G;  1XMO L;  4ME3 A;  2DGY A;  4QL5 A;  3CCM A;  2CH4 A;  4L8J A;  3G71 A;  4A3F G;  4JI8 L;  1GUO A;  2F0W A;  1G8Z D;  4FP5 D;  3CF5 A;  3TEH B;  1WVL A;  4NMZ A;  4H44 C;  5EJW A;  1SFO H;  5CV6 A;  4ALP A;  4L5S A;  5IWA Q;  4A3B B;  1YZ6 A;  2YU9 H;  4F88 A;  3T13 A;  4A3C G;  2H1E A;  2MPM A;  2ZM6 L;  3VR6 A;  1L0Y B;  3J80 i;  3P20 A;  2B2Y A;  1XTD A;  1ZYR D;  2VZA A;  4XDX A;  5C4J B;  1CFM A;  3NUC A;  2F0J A;  3NTH A;  1EWI A;  3MXN A;  2HQE A;  1SYG A;  5EPL A;  2NVX H;  1PLF A;  1TWF H;  2AQ2 B;  4MHE A;  3E0J A;  3FDT A;  1E7Z A;  3MEH A;  4WJW A;  4ZCK A;  5KNC A;  3S2H B;  3IAY A;  4XQJ A;  4A3M B;  5J1Z A;  4ODG A;  2ZJQ A;  4P75 A;  3L0O A;  2J0T D;  3S1M B;  1ESR A;  1SYD A;  2N55 A;  3AMU A;  3HFZ B;  4WRD A;  4KHZ A;  1CA5 A;  3FEW X;  3M4Q A;  5EKI A;  5FLX E;  4LF4 L;  1EY5 A;  1NMG A;  3K59 A;  1VQ7 A;  4JI4 Q;  2E2I B;  4S3S A;  1EWH A;  4L63 B;  4IPC A;  4LFB L;  1B4O A;  5JJK A;  1WTO A;  1HCZ A;  4LFB Q;  4DUZ L;  3M4O H;  2WB1 B;  4ZQ3 A;  4JI0 Q;  4DV2 L;  1I6V C;  1ICW A;  2EY2 A;  3QOJ A;  1LM0 A;  3K57 A;  2I0Q A;  4K6D A;  4GKK Q;  2RDH A;  3EQL C;  1B7Y B;  2KBN A;  2IJ0 A;  1ENC A;  1VDZ A;  2R7F A;  4JPB W;  1LTB D;  1XWE A;  5IGC A;  2SDF A;  2WKC A;  2CWP A;  2B39 A;  1YEZ A;  3K5M A;  2UUC L;  5IP9 G;  3AEV A;  2RKS A;  5FLM H;  1XTC D;  3UDG A;  2VQF Q;  5I6W A;  4Q0F A;  1CKN B;  3CRL C;  3MFG A;  5M5Y H;  1AN8 A;  3TZU A;  4A93 G;  1ZXT A;  1TU2 B;  1IKM A;  1BBW A;  2MO0 A;  1TII D;  5IYC H;  1B9N A;  2RBM A;  5FLX c;  4U68 A;  3ND8 A;  4X65 Q;  3RN2 A;  2LFN A;  3PO2 G;  2CWA A;  3T53 B;  3BVG A;  5C0X J;  5DM7 3;  4JI5 Q;  4A3E H;  2NVY H;  2A69 C;  1PZI D;  4CDE C;  1WCM G;  4A3G B;  1PTO F;  3OTO Q;  3OW7 A;  3CD6 A;  4JI2 L;  2KA7 A;  2B2U C;  4LFC L;  3GTG B;  5A35 A;  5GAH C;  2MUY A;  4JI2 Q;  1AP0 A;  3WOE A;  1H9M A;  2DY7 A;  1HFN A;  5LMU Q;  3E9I A;  4G7O C;  1RCV D;  4NP5 A;  2F0G A;  3H0G H;  3HOW H;  1X3Q A;  1NR4 A;  1SE2 A;  2A68 C;  1JOK A;  1PXU A;  2CHB D;  1PRT F;  4LMQ D;  4UHV A;  3STB D;  4CHT B;  1S72 A;  2JA8 B;  4GLX A;  3M4P A;  3DEP A;  2D9U A;  2LXJ A;  2AMC B;  1SMY D;  3I4L A;  1IBM L;  3S9W A;  1RF2 D;  1NMF A;  2EPB A;  3GTJ H;  3W1B A;  1KIX A;  3SK4 A;  1PTO D;  1YI2 A;  3TP5 A;  1VQ9 A;  2F4I A;  1E3P A;  2GA4 B;  2G9D A;  5ELN A;  4OWW B;  1N33 L;  3I72 A;  3N52 A;  2B2V A;  4UDU C;  4E6I A;  1ASY A;  1QIL A;  2CVR A;  2B63 B;  2OTL A;  4B3R L;  1Y1W B;  2MQH A;  4K8I A;  2X6L A;  1QJO A;  1VQ4 A;  4QJF A;  5F2D A;  2WB1 E;  5IGG A;  3KDF B;  2UXD Q;  3EN2 A;  3NQT A;  4A3D H;  4AH6 A;  2B8G A;  1BCP F;  1HTL D;  4LF8 L;  1FNU A;  4ZYS A;  4JBW A;  4GZY C;  3CCU A;  4K0K L;  5A2Q E;  5BR8 Q;  4GOP B;  3D0F A;  4JK1 C;  4JI7 L;  1VF7 A;  3BYT B;  3CQZ H;  3LGJ A;  2FMM A;  1S5C D;  1MSH A;  2L15 A;  5IGF A;  4Y52 H;  3CCS A;  4GN3 B;  4NXM L;  1GHK A;  3BZD B;  4B3M L;  4GLA C;  4QQB X;  4WJ4 A;  2OEO A;  2ES2 A;  1KDA A;  3HOY G;  3EFX D;  3URY A;  4BBR H;  2L1B A;  5EQ0 A;  2IWH A;  3CMA A;  2UUA L;  5KEE A;  1IYV A;  4XIG S;  3C1F A;  4FXG C;  4JOI C;  2UXC L;  5JEA G;  1G2T A;  2G5D A;  1HZB A;  2PZW A;  1KTK A;  4C3I G;  3S24 A;  4LF6 Q;  1BCP D;  1F2M A;  2AKW B;  1SLJ A;  2PI2 A;  4C3H G;  2EY6 A;  4Y7N B;  3NBH A;  4UAI A;  4A3B H;  3J80 L;  3PO3 B;  3JC6 6;  4LFA Q;  4FNF A;  1EIG A;  3DLL A;  1D1K A;  4O0A A;  4L6T B;  2F4V Q;  2XWB B;  2HDL A;  2ICE C;  1ESF A;  4HAE A;  5C4J H;  5IGB A;  1A2T A;  2BCO A;  3T16 A;  3GTL B;  4RHR A;  2R92 B;  3D4R A;  3NPP A;  2AWN A;  3CC2 A;  4K2L A;  2VS1 A;  5CBA E;  2O5J C;  4DR5 L;  1EY0 A;  3KF8 A;  5K5P A;  4ZRZ A;  2BDO A;  3HOZ G;  4R4I A;  3GTP H;  3S2H H;  5DM6 3;  5GAD C;  3HOX G;  2B3G A;  2EOT A;  3A55 A;  3M3Y B;  3RR5 A;  1B9M A;  2HIX A;  2WKD A;  1XXG A;  3Q6S A;  5EPJ A;  1BCP B;  1SNP A;  3TQY A;  2ZXP A;  5CV5 A;  3ICE A;  3S1R B;  5IY0 A;  1B2T A;  1BO0 A;  4AQY L;  3TDQ A;  3CRK C;  1V1P A;  3ZYY X;  2R7Z B;  5JVH 3;  3MEF A;  3HKZ B;  1GUS A;  1BBU A;  4A3K G;  1Q82 C;  1HZ9 A;  4K8J A;  2PQA B;  4RA8 A;  1VQC A;  4LAA A;  4BA2 I;  3CC4 A;  1KLG D;  1EZ8 A;  3OIP A;  1JWM D;  2A8V A;  4K5V A;  3HGB A;  4XYO A;  4KLK A;  5EKL A;  4DFA A;  3J7Z C;  1V8Q A;  2MHV A;  4CGY B;  1QNK A;  5CV9 A;  2G9H D;  4LNQ A;  3FKI G;  2E76 C;  4DAY A;  3CP0 A;  2IX0 A;  1HUM A;  2F3I A;  3C46 A;  2AQ1 B;  3A56 A;  4R8I A;  3IL8 A;  3TP6 A;  1VQL A;  2XRS D;  2ZJR A;  1F9S A;  2FXQ A;  1M8A A;  1NSN S;  3M7G A;  4PZ6 A;  1EYG A;  1B50 A;  1X6O A;  1EQR A;  1A3V A;  5KGU A;  1I3Q B;  3I8Z A;  2Z0S A;  2IW3 A;  3QO2 A;  3ULJ A;  1QUQ B;  4H13 C;  3RLF A;  2XIW A;  4DR3 L;  4X66 L;  3MVV A;  5JVG 3;  1B70 B;  1FNW A;  1TWH B;  4EGV A;  4BXX G;  1FYC A;  1VQM A;  4JYA L;  3PCO B;  1D8L A;  3R3O A;  4JCV E;  1A63 A;  1X54 A;  2MNA A;  4ILW A;  5C0X G;  2D2C C;  1JE5 A;  4J8Q A;  2LMC B;  4OWT B;  3M9B A;  1A3U A;  3MA2 B;  1KRT A;  2YTX A;  1PH9 A;  1LT4 D;  2BDN A;  4IZ8 A;  2RF4 A;  1MIU A;  1PH4 A;  3T51 B;  1GOZ A;  4IFD I;  4LW1 A;  1XJV A;  3GTG H;  4IUP A;  3K7U C;  3K0X A;  3VR4 A;  3S16 H;  4NXN L;  5M5X B;  4XT1 B;  1HZC A;  1K73 C;  3M4Y A;  4YCV A;  2N3S A;  1STA A;  1AE2 A;  1GVP A;  3K81 C;  1PFB A;  2WII B;  2JQO A;  3D4D A;  3FRP B;  4POF A;  3MXU A;  1JB7 A;  3E6Z X;  3HOU G;  1EWC A;  2Q8I B;  5E4W C;  1U0L A;  1HR0 Q;  3K0Y A;  3P75 A;  1L1O B;  2JA8 H;  5GAE C;  1OXX K;  1CI3 M;  5C44 B;  4YWK A;  2WAQ B;  3EJI A;  4DAV A;  4RMF A;  2HD3 A;  1G91 A;  2AUJ D;  2R7D A;  5JOB A;  3H3V C;  3OHX C;  2NTS A;  4HCE A;  3CCE A;  1WFQ A;  2C35 B;  2RQX A;  3GV3 A;  3X3N A;  2KEC A;  2B2W C;  1MJE A;  2F0T A;  3RZO B;  2B2W A;  3T1Y L;  2E8G A;  1CZG A;  1D1I A;  1H95 A;  3HRZ C;  2CKZ B;  1F9P A;  1D5M C;  4P74 A;  2PW5 A;  1LT3 D;  3HOV B;  4IFD H;  2PO4 A;  4DR2 Q;  1JOO A;  5I4D A;  3HKZ E;  1ICF B;  2B63 H;  1U4P A;  4JI1 Q;  1Y1W H;  1HTP A;  3FPU B;  1X55 A;  2JSO A;  1GM5 A;  1JWU D;  1SE4 A;  2K05 A;  5AJ3 L;  3TBI B;  1F77 A;  5IT9 E;  5AJ3 Q;  4P2C B;  3LWU A;  2R93 G;  4ZUJ A;  5NUC A;  1HJP A;  4G4K A;  2C5C A;  1I50 B;  1I4Q A;  1BVS A;  3I3C A;  1AZQ A;  4CJ0 B;  2SEB D;  1AE3 A;  1PTO H;  2AHO B;  4A3L G;  4DUY Q;  5IYB G;  1G29 1;  1HUN A;  5CV8 A;  4L5R C;  1J5E Q;  2ZT9 C;  1BUV T;  2PMZ B;  3SGI A;  4GKJ L;  3RZD B;  3GTK H;  3KK7 A;  1N34 Q;  3RUZ A;  1I4R A;  1STN A;  4IUU A;  4GKJ Q;  4L5Q A;  1YNN C;  1V43 A;  5ELB A;  2K01 A;  4IPH A;  3IFD A;  3I2Z A;  4J1M A;  3VYT A;  1DOM A;  5C4X B;  1P8L A;  4BY7 H;  5LHY 1;  3EIV A;  1UNS A;  2N49 A;  3O13 A;  2R6G A;  4RHS A;  4DU9 A;  1WTX A;  2A6H C;  3RNU A;  5FJ8 H;  1Y1V B;  4V19 0;  4Y7N H;  3A54 A;  3PO3 H;  2JA5 H;  1JT8 A;  1QVG A;  1H9J A;  1KHI A;  1TWA B;  4HJ7 A;  1X3G A;  3CW2 C;  5J22 A;  3Q8D A;  4GN4 B;  4DXG A;  2EYO A;  5E1F A;  3F2B A;  3C3L A;  2LKV A;  4N8X 1;  4YY3 L;  4CKB A;  5IT9 c;  2R92 H;  4AYB G;  1TY0 A;  1IYJ B;  4P72 A;  5FO8 B;  2JA9 A;  3M85 A;  5IOD A;  1D7Q A;  1STY A;  1ONL A;  1LO5 D;  1RTN A;  4PMB A;  2A69 D;  3E9H A;  2A1A A;  3D3R A;  3GTO H;  1CQV A;  2WAQ E;  3CCR A;  1NJI C;  5IYD H;  3I4N G;  3D6C A;  1TS2 A;  4JVZ A;  2EJM A;  1JOQ A;  1II3 A;  2XTI A;  1CM9 A;  1CSQ A;  3S1N H;  1YJN A;  3G48 A;  4KN4 C;  1JE4 A;  3I70 A;  4B3T Q;  1ILQ A;  1SE3 A;  1TS3 A;  4KJN A;  5C3E B;  4LF9 Q;  1H9R A;  1XMQ Q;  4A3F B;  2KCN A;  4DR4 Q;  1SNQ A;  2DNE A;  4FDB A;  4A3J H;  2ASB A;  2QKI C;  2KJX A;  2D0P A;  3BDL A;  1GUN A;  4XQN A;  5GRO A;  2K50 A;  4KKT A;  2IL8 A;  4DV0 Q;  1IBL L;  2K5H A;  1I5F A;  4DV7 Q;  2HUG A;  4DV4 L;  3VA5 A;  2VL6 A;  2XVS A;  1ET6 A;  2V1C C;  1PH6 A;  3NWS A;  2VQE Q;  2IX1 A;  4KN7 C;  1BF4 A;  3G6E A;  4DAM A;  2F0U A;  2RHS B;  5M3F G;  2N8N A;  1JIC A;  4ZUI A;  3B6Y A;  1VQP A;  2E2H B;  2L11 A;  3ULP A;  4QGU A;  3S1Q B;  3TS2 A;  1I3Q H;  2PMZ E;  1F2Y A;  2FHT A;  1QG7 A;  4DR7 Q;  3LNN A;  4OO1 I;  1PV4 A;  5M3M G;  1Z47 A;  1UE6 A;  3AB9 A;  5JEA J;  5IWA L;  4C2M B;  1TWH H;  1CUK A;  4AYB E;  5E4X A;  2BE5 C;  2D0O A;  3L3O C;  4KJO A;  3VR5 A;  1B8A A;  2K28 A;  2B2Y C;  1BOS A;  3I55 A;  2JXM B;  2DJF C;  1PH7 A;  1VQ8 A;  4CJ2 C;  5D3D A;  1NE3 A;  3KUP A;  1X65 A;  1FGU A;  3U9S A;  5FLX L;  3I90 A;  2OF1 A;  5M5W B;  1UEB A;  1Z7T A;  2ZTE A;  4C3J H;  2HT1 A;  4OX9 Q;  3DM3 A;  2FIN B;  3PUW A;  5LMN Q;  5M5X H;  3L2P A;  3CCQ A;  1MHW C;  2VW9 A;  4WJ3 M;  5HGT A;  2QIL A;  5T1G A;  1MD2 D;  4BBR G;  4N8F A;  4QY7 A;  3PIO 3;  1A0I A;  1XNR Q;  4OO1 H;  3ER0 A;  4JI4 L;  4EQO A;  1IHZ A;  4KKS A;  1VQN A;  2F0Q A;  1BKB A;  4QF4 A;  5E7N A;  4QCL A;  2KHI A;  2LSS A;  4IN3 A;  3OOC A;  5IP7 H;  1X32 A;  1VQO A;  1S5E D;  4OGQ C;  4JI0 L;  2X69 A;  1E22 A;  3RZO H;  3S17 B;  1KDC A;  4PMW A;  3DWP A;  3L9A X;  3RD4 A;  4I65 A;  2NZH A;  2RCN A;  2UUB L;  1EQV A;  4A93 B;  1TR5 A;  1C8C A;  5KND A;  1TKW B;  1SEB D;  3UI2 A;  4DR6 Q;  4GKK L;  2HHH Q;  1M90 C;  2UUB Q;  4Z9C B;  1H9K A;  1X3F A;  4TVA B;  3PO2 B;  5ISR A;  4EVO A;  3HZX A;  4R4O A;  5C6A A;  1KL9 A;  1BNZ A;  4H0L C;  3CCV A;  5C3X A;  3NBH B;  4DNT B;  3OYY A;  3E5S A;  5D3I B;  1WCM B;  1YBY A;  2VQF L;  2F3V A;  5HUR A;  3TRE A;  1PH1 A;  2OTJ A;  3TSS A;  1PA6 A;  3A0J A;  3KJP A;  5E3F A;  1CT1 D;  1PYB A;  1J6Q A;  1KQS A;  2LY7 A;  1O78 A;  2L0C A;  2HDM A;  2E74 C;  4X65 L;  4B3S L;  1CKM A;  3KF8 B;  4XT3 B;  2O4X A;  4KY5 A;  3A74 A;  3RZD H;  4B3S Q;  3PGZ A;  4R4C A;  1S3O A;  3QR8 A;  2K52 A;  4JI5 L;  1NNX A;  1YIJ A;  4BBS H;  3ND9 A;  2I07 B;  3PUV A;  4HIM A;  3I91 A;  4X64 Q;  2N88 A;  5CV7 A;  3OTO L;  4F8M A;  2R3Z A;  5EAY A;  4KTA A;  1Q90 A;  2X6G A;  1Q3L A;  3FVQ A;  2OQ0 A;  4KV6 A;  3TN2 A;  5K36 H;  4MTN A;  3UE1 A;  2O5I C;  1MGS A;  3QWN A;  3J7A V;  5LMU L;  3GV6 A;  1Y1V H;  1WTP A;  1HQM C;  5JPN C;  4CDF C;  1IBK Q;  2UXB Q;  1RL2 A;  2A5H A;  4R9W A;  1E1O A;  5CGK A;  2K1B A;  1TWA H;  4H7B A;  2QEJ C;  1U5K A;  2J7Z A;  4B08 A;  2ID0 A;  1FD7 D;  2CFM A;  4X6A H;  5C4H A;  3NSW A;  4KHV A;  2ZJP A;  1S40 A;  2EVB A;  3PIP A;  1SAP A;  4A75 A;  1QVC A;  3CCL A;  3Q0A A;  4DAY B;  1ML0 D;  2YTV A;  1TT2 A;  1O7I A;  4X3S A;  4PG3 A;  1H9S A;  1K8O A;  2K04 A;  2AQ3 B;  3DEO A;  4BY1 G;  1WTQ A;  2IX3 A;  2OT2 A;  2B2V C;  1DM0 B;  1PFS A;  5A2Q L;  2WAC A;  1TWC H;  4PZ8 A;  3J81 L;  1BQQ T;  1SRU A;  4LUV A;  5HY6 A;  4DNI A;  4C56 C;  4XXE A;  1Z9F A;  1VQJ A;  1D6E C;  1L2F A;  1HNZ Q;  1NR2 A;  1VCI A;  3HOY B;  5H1S E;  4C1N K;  2NBF A;  2UXD L;  2ZXR A;  4PV1 C;  2F0L A;  4DK3 C;  3I4M H;  4JBK A;  3GQB A;  1VMC A;  3H15 A;  1N36 Q;  1E2W A;  4A3F H;  4NW2 A;  1DYQ A;  1F9Q A;  5BR8 L;  4C3I B;  2FJ2 A;  4HJ8 A;  3GTQ B;  2PI2 E;  4C3H B;  2CW0 C;  2VUM G;  1DON A;  2RVL A;  3S2D B;  2D5D A;  1SE8 A;  4GN5 A;  1V1Q A;  2E2J B;  2HCC A;  1Y69 U;  3D31 A;  1SND A;  1D5Z C;  1YHQ A;  1E0B A;  3OWE B;  1LTR D;  4EQN A;  2KHJ A;  5EPK A;  4ME5 A;  4GNX C;  4P71 A;  1XPO A;  1K83 B;  3NTI A;  1HNX Q;  2KHS A;  4GNX A;  2E2H H;  4QB4 A;  4X62 Q;  3D8G A;  2E75 C;  3S1Q H;  1IL8 A;  2EJF C;  4LF6 L;  3HOZ B;  1E1T A;  2ZTD A;  4HID A;  4F7X A;  1PYS B;  4IFD G;  4RWS C;  3S14 B;  4DK6 C;  5KYL A;  3HOX B;  1GUG A;  3V96 A;  4LFA L;  4IUV A;  5D14 A;  4NPS A;  3GP7 A;  2V4D A;  2RSN A;  1WD1 A;  3GTM B;  1VQD A;  5GAG C;  2F4V L;  1SJE D;  2JA7 G;  4CKC A;  2JA6 G;  3J7A 5;  1B1Z A;  2VXW A;  1PH5 A;  4JI3 L;  1GXD C;  1LTI D;  2K5N A;  1Z6H A;  4LUZ A;  2NTT A;  3R93 A;  1C7Y A;  1VQH A;  4JI3 Q;  2HQL A;  3RLO A;  4DR1 Q;  1SYB A;  1QZG A;  3T1H Q;  4A3K B;  1YNN D;  1QZH A;  1OO9 B;  3AYH B;  4IJL A;  4JG2 A;  4X3K A;  2Q8T A;  4A3M H;  1EEI D;  2DUD A;  3NEN A;  1CKN A;  3S1M H;  2FFK B;  4MTK A;  3FKI B;  2TSS A;  4L5T A;  3ZJY C;  1JOR A;  3DM1 A;  4BS9 A;  1VQ5 A;  3A7A B;  3GDE A;  4J15 A;  1WTH A;  1SYF A;  4BY7 G;  1HNW Q;  2NUC A;  4OWX B;  4CDD C;  1K0R A;  1EIH A;  2EDG A;  2E2I H;  5FJ8 G;  4LF7 Q;  1WOC A;  5IP9 H;  3H91 A;  4FO2 A;  2NZ1 D;  2B29 A;  2JA5 G;  3KBG A;  1Q86 C;  1M1K C;  1JJC B;  3JAM E;  2JEA I;  4YCW A;  1GO3 E;  1Q12 A;  4A93 H;  2F0V A;  1QWY A;  1XNQ Q;  2FMC A;  3CME A;  4OIJ A;  1C0A A;  1B3Q A;  3PO2 H;  5BN3 A;  1UUP A;  3NK9 A;  1W2B A;  3CPW A;  3F2U A;  1I4H A;  3BZK A;  3K6O A;  2QDB A;  3AQQ A;  4K2K A;  1XPU A;  1GKH A;  2GVB A;  4KY6 A;  1R9T B;  3TME A;  1K3B C;  1C9O A;  2LXK A;  3KF6 B;  3K7A B;  3WOF A;  1NUC A;  4RGN A;  1IW7 C;  1XPR A;  2UU9 Q;  2NN6 G;  1I4P A;  4R8N A;  1FR3 A;  5EGT A;  2BH2 A;  5IIF A;  3D4W A;  5LL6 X;  3I4O A;  4NKL A;  4A3I G;  3TP8 A;  3PF4 A;  2Z1C A;  2XSC A;  2EJG C;  1E2Z A;  4M8A A;  3BG3 A;  2B8F A;  3MXG A;  1HFG A;  4WFN 3;  3HOU B;  1ASZ A;  1M4V A;  2N78 A;  2IPK D;  2WIN B;  4TRD A;  1KAW A;  2QEX A;  4N9P A;  5FKA C;  1Q81 C;  1PFN A;  3H94 A;  2ENB A;  4A3J G;  1RD9 D;  1NY4 A;  1SRO A;  4X3T A;  4A3G H;  2KOL A;  1EUJ A;  4POG A;  3HKS A;  3STB C;  1SFO B;  1CK1 A;  3JAM c;  4LUO A;  3W2D A;  3KDF A;  3HS0 C;  2O2L D;  2EY1 A;  4R4T A;  1JCK B;  3SDZ A;  2KCM A;  2F0N A;  1HR0 L;  4IUN A;  2QCP X;  5I2Y A;  1PTO C;  2MGS A;  1VQI A;  4YWM A;  2EY5 A;  2BOS A;  4OXP A;  1T9H A;  1VQE A;  3NE5 B;  5C5L A;  1JR0 D;  1SDF A;  1VF5 C;  2EXZ A;  2F0O A;  4RKB A;  3G7L A;  3VR3 A;  2BE5 D;  1ZKO A;  2F52 A;  2L12 A;  4OEL B;  5JJZ A;  1EEF D;  5DAU A;  1WYD A;  1V1O A;  2R93 B;  5IT9 L;  1PRT C;  3OWF A;  1ENF A;  1JB3 A;  1QCB D;  3PSI A;  4KY7 A;  5COR A;  2Z6B A;  3RLN A;  5KIX A;  2XWJ B;  5I6Y A;  4DR2 L;  2Z4I A;  4JI1 L;  4JI6 Q;  3J7A F;  3VYS A;  5IE8 A;  5ELC A;  2K4K A;  1EFI D;  4C3J G;  4KK7 A;  1I4X A;  2GN5 A;  2F1M A;  3S15 B;  3H3V I;  2VY3 A;  2A6E C;  3M4O B;  4HMI A;  3M7N A;  2Q8R E;  3IKJ A;  4IUR A;  2RSO A;  5EKK A;  1TXY A;  2AWO A;  4C3I H;  4DUY L;  2I5M X;  2IHF A;  1W3S A;  4GLV B;  2K03 A;  1J5E L;  4OO1 G;  1EQQ A;  3MXN B;  3S2D H;  1HA5 A;  2B2T C;  2K75 A;  4H02 A;  1X9N A;  1N34 L;  1SYC A;  2B2T A;  1JC7 A;  1X3E A;  2DJG C;  2E2J H;  1BCP C;  1LUZ A;  1UE1 A;  1PVO A;  3NTK A;  3DMU A;  1W6J A;  1OXU A;  2Y0S G;  1K83 H;  1LTL A;  2I5L X;  4AYB B;  3KLW A;  4DV6 Q;  4LF5 Q;  1LT6 D;  1S5D D;  2OWO A;  1KAB A;  2ICI A;  4C1N I;  1I6H B;  1D2B A;  1HZA A;  5ELO A;  3AU7 A;  1UE7 A;  4DPG A;  4ZAI A;  3PUZ A;  3DWA A;  3I4N B;  1RHP A;  4QMG A;  3PIO A;  2NVY B;  3A8K E;  4RAU C;  1C4Q A;  3E3X A;  2QF7 A;  1CZW A;  2EYJ A;  2L9H A;  1WTR A;  1SN8 A;  1MBY A;  2A73 B;  5C3W A;  5FLM G;  3BYY B;  3GTL H;  4MZ9 A;  2F0I A;  1J8I A;  3NBI A;  1CHQ D;  2EIF A;  2EXD A;  2JP1 A;  5C0X I;  4IUT A;  4HJA A;  2Q2T A;  4B9W A;  3SVM A;  5IYC G;  4M1U B;  1BXT A;  3GD7 A;  3M3Y H;  1JQY D;  4DK0 A;  3TZD A;  2DY8 A;  2F0H A;  4BBS G;  2F0D A;  4CBV A;  3FKI H;  4A3E G;  4N9T A;  4CDC C;  3H6M A;  3ERQ A;  4HR7 B;  2K14 A;  3KYH C;  1I94 L;  3S1R H;  1ET9 A;  4QIW B;  4B3T L;  3GTJ B;  4IPG A;  5M3F B;  1I94 Q;  1TWG B;  2KVM A;  2M00 A;  4LF9 L;  2R7Z H;  4MN3 A;  1XMQ L;  2KCC A;  1SNC A;  2AUK A;  1RTO A;  2A68 D;  3CAM A;  4ID6 A;  4JBJ A;  4B9X A;  3F2C A;  4DR4 L;  1JJ2 A;  4KHP Q;  1S5B D;  5CV4 A;  4NB3 A;  1LTS D;  4FF1 A;  5M3M B;  3HOW G;  1STB A;  3H0G G;  1WD0 A;  2EYH A;  4DV0 L;  2Y0S E;  3IRB A;  5M9O A;  1A2U A;  4BXX H;  4DV7 L;  4I7A A;  1A8V A;  2E5L L;  1YIT A;  2VQE L;  4ZLT F;  2ATW A;  1MKH A;  5G3L D;  5C0X H;  2E5L Q;  3VYU A;  2F0E A;  3TRZ A;  2SNM A;  3I56 A;  3U4V A;  2BA0 A;  1EU3 A;  4DV3 Q;  1LAC A;  2PW7 A;  1KLU D;  1PH2 A;  1R9T H;  4XYQ A;  2F0S A;  1L1O A;  3K7A H;  4XTC S;  5ELE A;  2CQA A;  4DR7 L;  3G4S A;  4Q5V A;  1HA6 A;  4OHJ A;  4JV5 Q;  2ZXO A;  1JJG A;  1LV9 A;  1BR9 A;  4RG1 A;  3UE0 A;  3E0E A;  3A5U A;  2NVT B;  1HR0 W;  1O7L A;  4IFD J;  1TS5 A;  2KCT A;  3QB3 A;  3KJO A;  1TQO A;  5LL6 S;  4UP8 A;  4RCN A;  4DV1 L;  4BBR B;  3FPP A;  3I4M G;  1N32 Q;  1IZ6 A;  4DV1 Q;  2RA4 A;  2CW0 D;  4A3D G;  4OIK A;  2PZT A;  1YNJ C;  1XMO Q;  4O42 A;  3UDF A;  3I7F A;  1L0X B;  2MP1 A;  4IPD A;  1LTT D;  4OX9 L;  1YVC A;  1YJW A;  1IXR A;  2Z4H A;  1JMC A;  4JI8 Q;  3TP7 A;  5LMN L;  4KD4 A;  2NVQ B;  5FO9 B;  1NBW A;  3PF5 A;  4RH6 A;  1YNX A;  2DNC A;  1PZJ D;  3A7L A;  1RIP A;  3CU7 A;  5CBE E;  4APV A;  5HGQ A;  2CCZ A;  1K28 A;  2VNU D;  2ZM6 Q;  1MJC A;  1STG A;  1CKO A;  2PZU A;  1XNR L;  1AH9 A;  3IFT A;  5BN4 A;  3I73 A;  2RDG A;  4X3U A;  1PH8 A;  4IOA A;  1V9P A;  2MJ8 A;  3JAM i;  2F0F A;  4YIJ A;  2H5X A;  5C44 H;  3GTP B;  1QOH A;  1TVX A;  4RFB A;  3EVQ A;  1DJR D;  1QVF A;  3W1G A;  1U4L A;  1HQR D;  1VQB A;  2R93 H;  3TS0 A;  4A3B G;  2HIV A;  5EBD A;  4QIW E;  3AFQ A;  3PV0 A;  4DR6 L;  2LS0 1;  4ZKB B;  2SNS A;  2HHH L;  4GNX B;  4A3L H;  5IYB H;  3QOL A;  3EBE A;  1PDQ A;  1SBB B;  3QJY A;  3T56 B;  4UP7 A;  5DNF A;  3NP8 A;  4LF4 Q;  3HOV H;  3DHQ A;  3BVZ A;  3WWV A;  4DA2 A;  3RMH A;  3SEB A;  1RKN A;  3CPF A;  4ZKC B;  3PMF A;  4O2D A;  1DOK A;  1P16 A;  1KDB A;  3S15 H;  4PMC A;  5KRU A;  2NWG A;  3U9O A;  4A3M G;  1FVI A;  1FGB D;  5KYI A;  1T5E A;  1Q46 A;  1G6Z A;  4DUZ Q;  2A74 C;  4DV2 Q;  1EZ6 A;  1I50 H;  1EY6 A;  3OPO A;  2XRQ D;  3Q22 A;  5I9P A;  3SK5 A;  1PFM A;  1O80 A;  3VDY A;  4PZ7 A;  4DNR B;  4CKE A;  4K5X A;  4O1N A;  2IT1 A;  1F9R A; 
#chains in the Genus database with same CATH homology
 4YWK A;  4X64 L;  3F2D A;  1Q7Y C;  4RMF A;  3J7A 5;  1YHB A;  4DV3 L;  2JA6 G;  2R7D A;  1PH5 A;  4JI3 L;  2K5N A;  4LUZ A;  2UUC Q;  3CCE A;  1Q1B A;  1WFQ A;  1C7Y A;  2C35 B;  1VQH A;  4JI3 Q;  1L1O C;  2HQL A;  3RLO A;  1HH2 P;  2Q2I A;  1Q8K A;  4DR1 Q;  2WB1 G;  1QZG A;  3T1H Q;  1MJE A;  5C4X H;  4JV5 L;  1QZH A;  1OTC A;  3T1Y L;  3AYH B;  4IJL A;  2E8G A;  4JG2 A;  1L0W A;  1I6H H;  1OXS C;  4A3M H;  1IBK L;  1H95 A;  2UXB L;  2DUD A;  4P74 A;  2CKZ B;  3NEN A;  1IBL Q;  4KI0 A;  1CKN A;  1GD7 A;  3S1M H;  4DR2 Q;  2ALY B;  2Q2U A;  3HKZ E;  3I4N H;  4DV4 Q;  1K9M C;  4JI1 Q;  2B63 H;  1K8G A;  1Y1W H;  2A19 A;  4GS3 A;  4L5T A;  3ZJY C;  1X55 A;  3J81 j;  1GM5 A;  1N32 L;  3HOU H;  1VQ5 A;  3KFU A;  3GDE A;  5AJ3 L;  4J15 A;  4BY7 G;  1HNW Q;  5C3E G;  1XMO L;  4ME3 A;  4OWX B;  2DGY A;  5AJ3 Q;  1K0R A;  4QL5 A;  3CCM A;  1EOV A;  3G71 A;  2E2I H;  4A3F G;  5FJ8 G;  4LF7 Q;  1WOC A;  4AIM A;  4LFC Q;  5IP9 H;  4JI8 L;  1Y14 B;  2R93 G;  1HJP A;  2YYZ A;  3CF5 A;  2B29 A;  3TEH B;  2JA5 G;  1BVS A;  1Q86 C;  1M1K C;  1SFO H;  4UPA A;  1JJC B;  3F1Z A;  4ALP A;  2JEA I;  1AE3 A;  1DGS A;  2AHO B;  5IWA Q;  4YCW A;  1YZ6 A;  4L5S A;  2YU9 H;  4A3L G;  4DUY Q;  1GO3 E;  1G29 1;  1Q12 A;  5IYB G;  4A93 H;  4A3C G;  4L5R C;  4EQ5 A;  1J5E Q;  1XNQ Q;  3FP9 A;  2ZM6 L;  3SGI A;  4GKJ L;  3CME A;  3GTK H;  1C0A A;  3J80 i;  1XTD A;  1N34 Q;  3PO2 H;  2VZA A;  4GKJ Q;  1HNZ L;  1W2B A;  4L5Q A;  1V43 A;  3CPW A;  4A3G G;  3BZK A;  1EWI A;  4IPH A;  1X56 A;  3AQQ A;  2NVX H;  1TWF H;  3I2Z A;  1NTG A;  1IBM Q;  1GKH A;  2GVB A;  5M3F H;  1XPU A;  1TWG H;  1P8L A;  1E7Z A;  1C9O A;  2LXK A;  3KF6 B;  2CQO A;  4BY7 H;  1N36 L;  3F8T A;  3EIV A;  5C3E H;  2N49 A;  2R6G A;  2GVA A;  1OXV A;  1XPR A;  3RNU A;  2K5V A;  2UU9 Q;  2NN6 G;  4BA1 I;  5FJ8 H;  5M3M H;  2ZJQ A;  4P75 A;  2BH2 A;  4Y7N H;  4OX9 L;  3L0O A;  1N33 Q;  3I4O A;  3PO3 H;  4A3I G;  3HFZ B;  2JA5 H;  1JT8 A;  1QVG A;  3PF4 A;  1KHI A;  4KHZ A;  4HJ7 A;  1X3G A;  3CW2 C;  2Z6K C;  3M4Q A;  4LF4 L;  3Q8D A;  4GN4 B;  2JA8 G;  2Z6K A;  1ASZ A;  4A3C H;  4B3R Q;  2N78 A;  3F2B A;  1NMG A;  1VQ7 A;  1KAW A;  2QEX A;  4YY3 L;  4JI4 Q;  1HNX L;  5IT9 c;  2R92 H;  4AYB G;  1Q81 C;  1IYJ B;  4P72 A;  1KRS A;  4X62 L;  4IPC A;  2JA9 A;  3M85 A;  3U58 A;  4A3J G;  1SRO A;  1NY4 A;  4LFB L;  4A3G H;  5LMN W;  1D7Q A;  1EUJ A;  4POG A;  5JJK A;  3HKS A;  3STB C;  4LF8 Q;  2EQS A;  3K8A A;  4LFB Q;  4DUZ L;  3JAM c;  3M4O H;  4JI0 Q;  4LUO A;  4P73 A;  4DV2 L;  4K0K Q;  3KDF A;  3E9H A;  2A1A A;  3GTO H;  4R4T A;  1UE5 A;  2WAQ E;  1LM0 A;  3CCR A;  4JI7 Q;  1NJI C;  2NVT H;  5IYD H;  2ZTC A;  2I0Q A;  2KCM A;  3I4N G;  4C2M H;  2B63 G;  1Y1W G;  1HR0 L;  4GKK Q;  4NXM Q;  1VQI A;  3U50 C;  1B7Y B;  2KBN A;  4YWM A;  3UDX A;  4A4I A;  4B3M Q;  2XTI A;  4OXP A;  1T9H A;  1CSQ A;  1VQE A;  2R7F A;  3S1N H;  1E24 A;  1YJN A;  2CWP A;  3G48 A;  1YEZ A;  2UUC L;  4B3T Q;  5IP9 G;  3AEV A;  5FLM H;  3UDG A;  2UUA Q;  2F52 A;  2VQF Q;  4JOI A;  4DR1 L;  4LF9 Q;  3T1H L;  1XMQ Q;  1WYD A;  1CKN B;  2UXC Q;  1K8A C;  4DR4 Q;  5M5W H;  2NVQ H;  4FDB A;  4A3J H;  5GQO A;  2ASB A;  5M5Y H;  2D0P A;  4A93 G;  3PSI A;  1BBW A;  5GRO A;  2K50 A;  2MO0 A;  3RLN A;  2NZO A;  5IYC H;  4DV0 Q;  2K5H A;  2KEN A;  5FLX c;  1PH3 A;  1I5F A;  4DR2 L;  4X65 Q;  1N8R C;  3RN2 A;  2JK8 A;  4DV7 Q;  4DV4 L;  1VQG A;  3A5Z B;  4JI1 L;  2CWA A;  2VL6 A;  4JI6 Q;  3PO2 G;  5IE8 A;  2V1C C;  1PH6 A;  2K4K A;  2VQE Q;  2IX1 A;  4IO9 A;  5C0X J;  5JJI A;  4JI5 Q;  3G6E A;  4A3E H;  2NVY H;  1HNW L;  4DAM A;  2RHS B;  5M3F G;  2N8N A;  1WCM G;  3B6Y A;  3OTO Q;  2GN5 A;  1VQP A;  3CD6 A;  4JI2 L;  3GO5 A;  3PUY A;  4DV5 L;  4LFC L;  4LF7 L;  3ULP A;  2VY3 A;  3H3V I;  4QGU A;  1KC8 C;  5GAH C;  1I3Q H;  4DR5 Q;  1VS0 A;  2PMZ E;  1SMX A;  1FL0 A;  3J81 c;  3TS2 A;  4HIO A;  4DR7 Q;  4JI2 Q;  3M7N A;  4DV5 Q;  4OO1 I;  1PV4 A;  5M3M G;  1TXY A;  2AWO A;  1Z47 A;  4R4Q A;  1UE6 A;  1VQA A;  4C3I H;  5JEA J;  5IWA L;  3PO3 G;  3CC7 A;  5LMU Q;  3E9I A;  4DUY L;  1TWH H;  2I5M X;  1CUK A;  3S17 H;  1Q1E A;  2IHF A;  1W3S A;  4GLV B;  3HOW H;  4AYB E;  3H0G H;  1J5E L;  4OO1 G;  1EQQ A;  1XNQ L;  3MXN B;  3S2D H;  1CSP A;  2D0O A;  2K75 A;  4H02 A;  1G51 A;  1B8A A;  1X9N A;  1N34 L;  3STB D;  3I55 A;  1PH7 A;  1VQ8 A;  1S72 A;  1X3E A;  2E2J H;  1NE3 A;  2OQK A;  4GLX A;  3M4P A;  2R92 G;  1LUZ A;  1UE1 A;  4R1J A;  1X65 A;  4AQY Q;  1PVO A;  1FGU A;  1OXU A;  2Y0S G;  1K3R A;  2LXJ A;  2AMC B;  4UP9 A;  1IBM L;  1K83 H;  1LTL A;  1NMF A;  2I5L X;  3KLW A;  4DV6 Q;  3GTJ H;  4LF5 Q;  1UEB A;  3W1B A;  1KIX A;  3AFP A;  2ZTE A;  4C3J H;  2HT1 A;  1WCM H;  4OX9 Q;  1YI2 A;  3DM3 A;  1EFW A;  2OWO A;  3PUW A;  1VQ9 A;  2UU9 L;  5LMN Q;  1E3P A;  5M5X H;  2JE6 I;  1HZA A;  4MNO A;  4TQU S;  5ELN A;  5ELO A;  5IYD G;  2QA4 A;  4OWW B;  1N33 L;  3L2P A;  3CCQ A;  2Q2H A;  1UE7 A;  4DPG A;  1Q82 C;  3PUZ A;  2VW9 A;  3CXC A;  1ASY A;  4WJ3 M;  1A62 A;  4BBR G;  2OTL A;  4QY7 A;  4B3R L;  3PIO A;  2MQH A;  1A0I A;  1XNR Q;  1VQ4 A;  2IY5 B;  4QJF A;  3ER0 A;  4JI4 L;  2R7Z G;  2WB1 E;  1IL2 A;  1SN8 A;  2BA1 A;  1VQN A;  5FLM G;  2JEB I;  3KDF B;  4EX5 A;  2UXD Q;  1BKB A;  3EN2 A;  3HKZ G;  4A76 A;  4A3D H;  5E7N A;  3J80 c;  3GTL H;  2KHI A;  4MZ9 A;  4AH6 A;  2LSS A;  3BZC A;  5IP7 H;  2EIF A;  4LF8 L;  4JBW A;  4LWC A;  1VQO A;  3CCU A;  2EXD A;  4JI0 L;  1E22 A;  3RZO H;  5C0X I;  4K0K L;  1N9W A;  4HJA A;  4DR3 Q;  2Q2T A;  5BR8 Q;  4PMW A;  5IYC G;  4X66 Q;  4GOP B;  2NZH A;  3D0F A;  1UWV A;  2RCN A;  3LGJ A;  3CQZ H;  2UUB L;  4JBM A;  4JI7 L;  3GD7 A;  4JYA Q;  2L15 A;  3M3Y H;  4Y52 H;  3NEM A;  4DR6 Q;  3CCS A;  4GN3 B;  2HHH Q;  4BY1 H;  1M90 C;  2UUB Q;  4NXM L;  4GKK L;  4BBS G;  1IBL L;  1X3F A;  4B3M L;  3FKI H;  4GLA C;  4TVA B;  4QQB X;  4WJ4 A;  4A3E G;  4R4O A;  4GOP C;  1KL9 A;  3W5O A;  2ES2 A;  1KD1 C;  3HOY G;  2K14 A;  4BBR H;  3KYH C;  3CCV A;  2IHE A;  4HJ5 A;  4GOP A;  3S1R H;  1I94 L;  1VQK A;  3NBH B;  4B3T L;  4IPG A;  3OYY A;  3CMA A;  5JJL A;  2UUA L;  1I94 Q;  1YBY A;  2VQF L;  4LF9 L;  2R7Z H;  3TRE A;  1PH1 A;  4XIG S;  4JOI C;  1XMQ L;  2UXC L;  2OTJ A;  5JEA G;  1PA6 A;  3A0J A;  3KJP A;  4DR4 L;  3CAM A;  4JBJ A;  3ULL A;  4KHP Q;  1HZB A;  3F2C A;  3J81 i;  1JJ2 A;  3RN5 A;  1YHA A;  5J3B A;  3S24 A;  4LF6 Q;  1PYB A;  4NXN Q;  4NB3 A;  4DKA C;  1J6Q A;  1FJG L;  3CCJ A;  2AKW B;  1SLJ A;  2PI2 A;  3HOW G;  3H0G G;  1KQS A;  4DV0 L;  4A3B H;  2Y0S E;  3IRB A;  3JC6 6;  4LFA Q;  1FJG Q;  2BH8 A;  4X65 L;  3DLL A;  1CKM A;  1OXT A;  4DV7 L;  4B3S L;  4BXX H;  2WP8 J;  1A8V A;  4YWL A;  4O0A A;  4JI6 L;  2VUM H;  3KF8 B;  2E5L L;  1YIT A;  3A74 A;  2VQE L;  3RZD H;  4B3S Q;  3PGZ A;  4R4C A;  1S3O A;  1MKH A;  3KOJ A;  2K52 A;  2ATW A;  4JI5 L;  2E5L Q;  2F4V Q;  5C4J H;  1YIJ A;  4BBS H;  3TRZ A;  3I56 A;  3PUV A;  4HIM A;  3U4V A;  4X64 Q;  2BA0 A;  4YHH L;  3OW2 A;  3OTO L;  4DV3 Q;  2AWN A;  3CC2 A;  5EAY A;  2VS1 A;  3HOY H;  1VQF A;  4YHH Q;  1PH2 A;  1R9T H;  4DR5 L;  2OQ0 A;  1L1O A;  3K7A H;  4XTC S;  3HOZ G;  4DR7 L;  4MTN A;  3G4S A;  4R4I A;  3GTP H;  3S2H H;  3UE1 A;  5GAD C;  4JV5 Q;  1JJG A;  3HOX G;  3T1Y Q;  5LMU L;  4RG1 A;  3UE0 A;  3E0E A;  2B3G A;  1Y1V H;  3A5U A;  3RR5 A;  3FHW A;  1IBK Q;  2HIX A;  2UXB Q;  1HR0 W;  1RL2 A;  1KXL A;  1E1O A;  4IFD J;  1TWA H;  1VQ6 A;  3GTQ H;  1U5K A;  2KCT A;  4C3H H;  3KJO A;  3TQY A;  4UP8 A;  2WFW A;  4DV1 L;  3ICE A;  5C44 G;  2ID0 A;  2WAQ G;  2CFM A;  5IY0 A;  4X6A H;  3I4M G;  1N32 Q;  4HJ9 A;  4AQY L;  1S40 A;  2ZJP A;  1IZ6 A;  4DV1 Q;  4A3D G;  2JA7 H;  2ZM6 Q;  3PIP A;  2JA6 H;  5IP7 G;  4DV6 L;  3UDF A;  1XMO Q;  4A75 A;  3I7F A;  1QVC A;  3MEF A;  4IPD A;  3CCL A;  4LF5 L;  2MO1 A;  1BBU A;  1WI5 A;  4OON A;  3BJU A;  1YVC A;  2YV5 A;  3PUX A;  4DAY B;  1HZ9 A;  4A3K G;  1IXR A;  2MFI A;  2YTV A;  2XGT A;  2PQA B;  4JI8 Q;  1JMC A;  1VQC A;  5LMN L;  4BA2 I;  1O7I A;  4YCU A;  4PG3 A;  1NBW A;  3CC4 A;  1WJJ A;  3PF5 A;  3HOZ H;  2A8V A;  1YNX A;  4KLK A;  3HOV G;  4BY1 G;  3J7Z C;  3S14 H;  3HOX H;  1RIP A;  5HGQ A;  4LNQ A;  4APV A;  3FKI G;  1PFS A;  2CCZ A;  2VNU D;  3CP0 A;  1MJC A;  1TWC H;  2IX0 A;  1CKO A;  2PQA A;  2F3I A;  1SRU A;  4JC0 A;  4LUV A;  4PZ8 A;  5HY6 A;  4DNI A;  1XNR L;  3H3V H;  1AH9 A;  1Z9F A;  5DLQ E;  1VQJ A;  1L2F A;  1HNZ Q;  3GTM H;  1PH8 A;  4IOA A;  1VQL A;  1V9P A;  1VCI A;  5H1S E;  3JAM i;  2ZJR A;  2UXD L;  2FXQ A;  2NN6 I;  2H5X A;  1SR3 A;  4PZ6 A;  4DK3 C;  5C44 H;  1EYG A;  3I4M H;  4JBK A;  1X6O A;  1EQR A;  1YJ9 A;  3H15 A;  1QVF A;  1N36 Q;  3W1G A;  2Z0S A;  4A3F H;  2RHQ B;  3ULJ A;  1QUQ B;  3RLF A;  1VQB A;  2PNH A;  3BU2 A;  4DR3 L;  5BR8 L;  2R93 H;  4HIK A;  2JJQ A;  2HIV A;  4X66 L;  3TS0 A;  4A3K H;  4A3B G;  1B70 B;  3NEL A;  4BXX G;  4IJH A;  4IOC A;  4HJ8 A;  1VQM A;  2PI2 E;  4JYA L;  2VUM G;  3PCO B;  3AFQ A;  1D8L A;  3KF6 A;  3PV0 A;  4QIW E;  2YTY A;  2HHH L;  4DR6 L;  4GNX B;  4JCV E;  4A3L H;  5IYB H;  1A63 A;  1X54 A;  2MNA A;  3EBE A;  1SE8 A;  4GN5 A;  4UY8 C;  2D62 A;  5C0X G;  3HOV H;  1V1Q A;  3L7Z C;  4UP7 A;  4LF4 Q;  1QUQ A;  3WWV A;  1JE5 A;  4OWT B;  3M9B A;  3D31 A;  1KRT A;  1YHQ A;  2YTX A;  1PH9 A;  3CPF A;  2RF4 A;  4YY3 Q;  4GNX C;  1XPO A;  2KHJ A;  1EIY B;  1MIU A;  1HNX Q;  4P71 A;  1PH4 A;  5C4X G;  4O2D A;  2QGQ A;  5K36 G;  4GNX A;  2E2H H;  1P16 A;  3ERS X;  4X62 Q;  2OCE A;  3S15 H;  4LW1 A;  1XJV A;  4IFD I;  3GTG H;  4KHP L;  3S1Q H;  3K7U C;  3K0X A;  4A3M G;  1FVI A;  3S16 H;  4LF6 L;  2JA7 G;  1G6P A;  4NXN L;  1E1T A;  1Q46 A;  1YJW A;  2ZTD A;  1Y1V G;  4HID A;  4DUZ Q;  1PYS B;  1HZC A;  1K73 C;  4DV2 Q;  1PHJ A;  4YCV A;  4IFD G;  2N3S A;  4DK6 C;  1I50 H;  1AE2 A;  4LFA L;  1GVP A;  3K81 C;  1LYL A;  2JQO A;  1EIF A;  3U4Z A;  4NPS A;  4POF A;  3UDI A;  4A3I H;  1JB7 A;  3HOU G;  1HR0 Q;  1U0L A;  3K80 C;  3VDY A;  1VQD A;  2I5H A;  4PZ7 A;  5GAG C;  2F4V L;  1L1O B;  2JA8 H;  2IT1 A;  5GAE C;  1OXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...