4K0KL

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kL00
3K8AA 1N32L 1IBLQ 3KOJA 1X6OA 3UDIA 1VQ7A 2VZAA 3W5OA 4LF7Q 3FP9A 4LF6L 2ZM6Q 2R6GA 5IE8A 4AYBE 1N33L 4P74A 4DV0L 5IYBH 2NZOA 2JK8A 3CP0A 4R4TA 5C0XJ 4JI3L 1IL2A 3GTKH 4BY7G 4LFAQ 4YWKA 1WJJA 3MXNB 4DR1L 5JJIA 2JA8H 2ZJPA 4DR3Q 2VQFL 2CCZA 2XTIA 2NN6G 1N9WA 1E7ZA 3DM3A 4JCVE 5M3MG 1VQPA 4A3BH 4DNIA 3D31A 4DV1Q 2PI2E 1VQLA 2F4VL 1N32Q 1KD1C 2IY5B 1NMFA 4H02A 4A76A 2K5VA 4X64L 1KIXA 2Q2TA 3T1YL 2OTJA 4LF6Q 4X65L 5GAGC 4DPGA 1N33Q 4MNOA 2UUBL 4Y7NH 1NBWA 2MO1A 5HY6A 4R4OA 4OXPA 3RLNA 3M85A 4JI3Q 2C35B 3SGIA 1C9OA 3F2DA 4DR1Q 3W1GA 1K9MC 4BA2I 2UXDQ 2VQFQ 1IZ6A 4DR4Q 2WB1G 3I56A 3PUXA 3I4NG 5C0XG 2VQEL 3CCJA 2A8VA 3L0OA 1YJWA 2F4VQ 2KBNA 3BU2A 1PHJA 3F8TA 3S1RH 1XPUA 1Z9FA 3M4PA 4X64Q 1VQ6A 3HOYG 3T1YQ 1TWGH 1ASYA 4L5SA 4X65Q 3K0XA 3CAMA 1VQEA 3RZDH 1PA6A 1CKNA 1VQ9A 1V1QA 2UUBQ 5DLQE 1EOVA 1PH7A 3I55A 1K3RA 4DV4L 1YITA 1P8LA 4QIWE 4IPCA 2RHQB 1R9TH 4JBWA 4LUOA 1VQHA 3J80c 2B3GA 2A1AA 4PZ7A 3GTLH 1E1OA 2VQEQ 3JC66 4DV2L 1VQ4A 1PH4A 4JBKA 4L5RC 1OXSC 2JQOA 1GO3E 1QZHA 2PQAB 3KDFB 1W3SA 1YHBA 3HOXH 1Y1WH 4A3CG 3J7A5 3RLOA 2K52A 1PYSB 3U58A 2JA7G 3KFUA 4WJ3M 2JA6G 3STBD 4A93H 4GN4B 4QY7A 1KRSA 1H95A 4L5QA 1V9PA 2JJQA 1OXXK 1VQMA 3LGJA 1G291 3HOVG 4A3DG 2VS1A 4NB3A 4QL5A 3NENA 4LNQA 4DV2Q 1L2FA 4R4QA 1HNXL 4GLAC 2DGYA 1L1OC 2K50A 3W1BA 4TVAB 3G71A 1OXVA 4JI0L 3K81C 1D8LA 4DAMA 1HJPA 2N8NA 3OTOL 1IBML 1Q1EA 4JBMA 3F2CA 4NXML 2AKWB 1VQNA 1X55A 2UXBL 1U5KA 1SN8A 3PO2G 1HR0L 2JE6I 4LFCL 1TWHH 2JA5G 2RCNA 3UDXA 1X54A 2GVAA 2XGTA 2LXJA 5HGQA 4DV7L 1PH5A 1HNXQ 4GKJL 2OQKA 1VQOA 4JI0Q 1K73C 1SFOH 4BY7H 4AH6A 4DUYL 3WWVA 4YWMA 2I5LX 4B3TL 5ELOA 1K0RA 3OTOQ 1XNRL 1TWCH 2LSSA 4NXMQ 5C4XG 1S72A 2CWAA 4A3IG 2UXBQ 1L1OB 1HR0Q 2OCEA 3AFPA 4LFCQ 1S40A 4OO1I 2I5HA 1WYDA 4C3HH 1QZGA 2Y0SE 2JEAI 2KHIA 3S14H 1P16A 4O0AA 4HJAA 3RN5A 4LF7L 4DV7Q 1PH2A 4GKJQ 2Z6KA 4LF9L 2YYZA 1YZ6A 4OWWB 2ZJQA 3ULJA 1KAWA 1NE3A 5E7NA 4DUYQ 4KHZA 3DLLA 4IOAA 4B3TQ 4LWCA 2K14A 4JV5L 1XNRQ 3S1MH 4C3IH 1KQSA 2NVTH 3TRZA 1CKMA 1NTGA 2IX0A 3KF8B 1IXRA 3I4NH 3GTMH 2PI2A 2R93G 4A3KG 2ZTDA 5IWAQ 4B3RL 2QA4A 2B63G 3HOYH 1PYBA 1T9HA 2Z6KC 1VQFA 4UP7A 2VUMH 1N36L 2R92G 5IP9G 4C2MH 4R4CA 3A5ZB 4LF9Q 1GM5A 1PH1A 3CC4A 4HJ5A 1VQDA 2I0QA 2AHOB 3U4VA 4GN3B 2YTXA 1PV4A 2RF4A 1CUKA 4JV5Q 1LTLA 5M5YH 4A3MG 3PSIA 1E3PA 1GKHA 2WFWA 4HJ9A 2UXDL 4C3JH 4EX5A 3M9BA 2HT1A 3M3YH 4DR4L 2K4KA 1C0AA 2R7DA 2AMCB 2Q2IA 4B3RQ 1CKOA 5M5XH 2PQAA 3KDFA 2QEXA 1EWIA 4P71A 5IP7G 5IYDG 3RLFA 2ES2A 5C3EG 4A3CH 4JI5L 4PMWA 3UE1A 1VQBA 3S24A 3PIPA 4DR5L 5AJ3L 1HNZL 4NPSA 4GLXA 1N36Q 2UUAL 2ATWA 2VNUD 1YI2A 4A3FG 2JA7H 4A3GH 2JA6H 1A63A 3A5UA 3KJOA 4FDBA 3CCMA 3VDYA 1Y1VG 4LF5L 1JJGA 2HIVA 2E2IH 1QUQB 2WP8J 4GS3A 2E2HH 4YWLA 1K83H 2HHHL 4R1JA 4DV3L 4JI7L 3HOVH 1JE5A 4A3DH 4IFDI 1B8AA 3ER0A 1KC8C 4DV5L 1I5FA 3U50C 4A75A 4DV6L 1VQJA 4P72A 1IYJB 3JAMc 4HIKA 2KCTA 4DAYB 1A8VA 2N49A 5BR8L 2CWPA 4DR5Q 4JI5Q 1HNZQ 5AJ3Q 3PO3G 2R7ZG 2UUAQ 1E22A 3CQZH 3HOUG 1MJEA 3PO2H 2KCMA 3EIVA 2ZTEA 4LF5Q 2VUMG 3H0GG 1SRUA 2JA5H 3PUVA 4GNXC 4JI7Q 2HHHQ 2WB1E 4DV3Q 1E24A 3UDGA 1EQQA 5ELNA 1EFWA 4DV5Q 3K80C 3CCLA 1QVCA 3FKIG 1MJCA 4DUZL 4DV6Q 2NZHA 2PNHA 4LUZA 1Q8KA 5FLMG 5C44G 2UUCQ 4J15A 4PG3A 4LF4L 2ID0A 3CCSA 5BR8Q 3I4MG 5C4XH 3GD7A 1L1OA 4A3IH 5LMNW 3CCVA 3GO5A 2A19A 1XNQL 1AE3A 1BBWA 4XTCS 4A3LG 1G51A 3I4OA 2K5NA 2E5LL 4A3GG 4OO1G 1FJGL 4DR7L 3CMAA 1VQCA 4DR6L 3TS2A 1VQKA 3JAMi 4DUZQ 2D62A 2OTLA 1WCMG 3G48A 4BY1G 1A0IA 4GNXB 4LF4Q 1VQ5A 5JJLA 4NXNL 1VQIA 4TQUS 4JI2L 4O2DA 3K7UC 4JI8L 1K8AC 1GD7A 1M90C 1Q1BA 1D7QA 1YBYA 1X65A 4YCUA 1BVSA 1PFSA 2H5XA 3AFQA 4YHHL 1XNQQ 2R93H 1LM0A 1LYLA 4A3KH 5IYCG 2E5LQ 2B63H 4WJ4A 1FJGQ 4LUVA 4DR7Q 1Q81C 1VS0A 2I5MX 3ULLA 4DR6Q 3I2ZA 3CPFA 4LW1A 2ASBA 1TWAH 1HR0W 3TEHB 2KHJA 3PGZA 5IP9H 1XMOL 2R92H 3PF4A 4DR2L 5GAHC 2DUDA 1Q86C 3ICEA 4A4IA 3HOZG 2BA0A 1YHAA 3PUYA 5GROA 4NXNQ 3S2HH 4JI2Q 1N34L 4A3MH 2N3SA 4JI8Q 3GTPH 4QJFA 4BBRG 4HJ7A 4JYAL 1RL2A 1TWFH 3UDFA 2WAQG 3A74A 1LUZA 4YHHQ 1BBUA 3ERSX 4JI1L 3TS0A 1EYGA 3EBEA 1IBKL 3PCOB 1JJCB 3F2BA 5IP7H 5IYDH 1PH9A 4IJLA 2E8GA 3F1ZA 5C3EH 1YJNA 3AQQA 1YJ9A 5IWAL 4A3JG 1MIUA 2ALYB 4POFA 1XTDA 2RHSB 3PUZA 1XMOQ 4A3FH 4K0KQ 1XMQQ 5J3BA 5JJKA 4DR2Q 1J5EL 2Q2HA 2BH2A 4UP9A 4HIMA 3FHWA 1Y1VH 1QUQA 2WAQE 4A3EG 2R7ZH 4OWTB 4RMFA 3HKZG 1N34Q 3PUWA 4X62L 3HOUH 4X66Q 3KYHC 4JYAQ 3U4ZA 2YTVA 4LF8L 4IFDG 5IT9c 3HKSA 4MZ9A 3CCEA 1L0WA 4APVA 1J6QA 4BBSG 4JI1Q 4HIOA 1C7YA 1I3QH 3S1QH 5JEAG 1IBKQ 4IPGA 1YVCA 1G6PA 1JJ2A 2KENA 5FJ8H 3IRBA 1I6HH 3J81i 1GVPA 2GN5A 1SR3A 3STBC 3PO3H 5GQOA 3OYYA 2IT1A 3HKZE 1J5EQ 2CQOA 3CW2C 4UP8A 3H0GH 1W2BA 4R4IA 3GTGH 3MEFA 4X62Q 2EXDA 1M1KC 3CD6A 3E9IA 1SE8A 1KXLA 1K8GA 4LF8Q 1UWVA 2R7FA 4BXXG 1B70B 3FKIH 3E0EA 4AYBG 4RG1A 2VY3A 5FLMH 5C44H 3NELA 1QVFA 2YU9H 3S1NH 1FL0A 4MTNA 1Q7YC 5K36G 1EUJA 4IO9A 3E9HA 3I4MH 1X3EA 1WFQA 1Y14B 3KF6B 1X3GA 3HOWG 3L2PA 4BA1I 1O7IA 3S2DH 1XPRA 1NJIC 4A3LH 3CPWA 2JEBI 2Z0SA 1UE1A 1WI5A 2FXQA 1PH3A 2VL6A 1PH8A 2MNAA 4YY3L 1AH9A 2F3IA 1EIFA 4KHPL 3G4SA 1WCMH 4JC0A 1WOCA 4OONA 2MQHA 3CCUA 4GNXA 4BY1H 4YCVA 3BZCA 2N78A 2UUCL 4DK3C 3M7NA 5FJ8G 1SROA 1SLJA 1XPOA 4GLVB 1JMCA 3M4OH 1EQRA 2K75A 3A0JA 4GOPB 2MFIA 2L15A 5IYCH 3RN2A 1KHIA 3EN2A 4JBJA 4AIMA 2NVYH 4YY3Q 4DV0Q 1OXTA 1QVGA 1CSPA 4KHPQ 2UU9L 3GTJH 4POGA 3CMEA 5LMUL 1X56A 1S3OA 3HOZH 2B29A 2NVXH 5FLXc 2Q2UA 4OX9L 4XIGS 3GDEA 4BBRH 3M4QA 4L5TA 3TREA 2ZTCA 3UE0A 1HH2P 1OTCA 1Q12A 1Z47A 2ZJRA 4UPAA 3S15H 2E2JH 1I50H 4PZ8A 4EQ5A 1OXUA 1VCIA 4P75A 1HZ9A 2IHEA 4PZ6A 1UE7A 3T1HL 4A3JH 3CCQA 2UU9Q 4GKKL 5IYBG 5LMUQ 4QQBX 3BZKA 3OW2A 4HIDA 4A3EH 1EIYB 4OX9Q 3GTOH 4ME3A 2JA8G 3L7ZC 2EQSA 4JOIA 2NN6I 3CC7A 3HFZB 3BJUA 3J81j 4A3BG 1YNXA 5LMNL 3CC2A 1RIPA 2AWNA 4BBSH 2F52A 3AYHB 2BA1A 1VQGA 2MO0A 1NY4A 4OWXB 3T1HQ 2QGQA 2NVQH 4X6AH 3PF5A 4P73A 2CFMA 1A62A 2JA9A 1PH6A 5M5WH 2K5HA 4HJ8A 2UXCL 1UE6A 2LXKA 3PIOA 2V1CC 3PV0A 4DV4Q 4GKKQ 3GTQH 2D0PA 2D0OA 5H1SE 4IFDJ 3J81c 1VQAA 1XMQL 4JOIC 3ZJYC 3S16H 4K0KL 3ULPA 3J7ZC 1HZCA 5IY0A 3RNUA 1I94L 4Y52H 5JEAJ 2PMZE 4AQYL 4IPDA 2AWOA 4BXXH 2OQ0A 4X66L 5LMNQ 3H3VI 5C0XI 1N8RC 2IX1A 1BKBA 5GAEC 3Q8DA 4KI0A 3CCRA 5M3FH 1MKHA 1ASZA 3TQYA 5EAYA 5GADC 3KF6A 2HIXA 2UXCQ 3HOWH 3KLWA 1DGSA 4GN5A 4B3SL 1JB7A 1KL9A 3KJPA 2VW9A 5C4JH 3D0FA 1CKNB 1SMXA 3J80i 3CXCA 1XJVA 2GVBA 1I94Q 1TXYA 4JI4L 1HNWL 1Q46A 2Y0SG 4AQYQ 4IPHA 4LFBL 2OWOA 2HQLA 1UEBA 1V43A 1AE2A 2EIFA 3RZOH 1YEZA 1IBMQ 4QGUA 1PVOA 2IHFA 5M3MH 3HOXG 1Y1WG 4B3ML 3RR5A 4JI6L 1B7YB 1HZBA 4DKAC 4GOPA 4JG2A 4B3SQ 3S17H 1YIJA 3NBHB 1JT8A 1VQ8A 4IJHA 1FGUA 4A93G 1HZAA 1CSQA 1IBLL 1X3FA 4JI4Q 1HNWQ 2BH8A 4LFBQ 4KLKA 1FVIA 2ZM6L 3K7AH 4ALPA 3G6EA 1Q82C 1E1TA 3NEMA 2YTYA 1YHQA 3B6YA 2CKZB 4LFAL 4IOCA 1U0LA 4GOPC 1NMGA 5M3FG 4DR3L 2YV5A 3I7FA 3H15A 1X9NA 1UE5A 4B3MQ 4JI6Q 4UY8C 3H3VH 3AEVA 4DK6C 3CF5A 4YCWA 1KRTA 4DV1L
chains in the Genus database with same CATH superfamily
3NUCA 2A69D 5T1IA 4K6DA 3KOJA 1IBLQ 2VZAA 4B9WA 4DAVA 4P74A 1IKLA 5EQ0A 1IL2A 2F0LA 4DR1L 2MUYA 2EY6A 4PMCA 4JCVE 1VQPA 2AQ3B 1KDBA 4DNIA 2XWJB 3SEBA 1BCPF 2PI2E 1VQLA 1N32Q 1HHVA 3MTSA 3OOCA 2K5VA 2Q2TA 3URYA 2WIIB 4LF6Q 1LTBD 1GUOA 1NBWA 5HY6A 4R4OA 4ZCKA 4RGMA 3A8KE 1K9MC 4BA2I 1SNOA 1H9SB 2VQFQ 2WB1G 3PUXA 2VQEL 3CCJA 4QCLA 2FHTA 3BYYB 3BU2A 3H91A 1PHJA 1YNJD 1DOLA 1ASYA 1LTAD 4BY7B 4RFBA 3HRZC 2IX3A 1C4QA 5CV4A 5JVH3 1EOVA 4IUPA 2EJFC 2EPBA 3I55A 3K5LA 4DV4L 2HDMA 1R9TH 5DM63 1E1OA 1NR4A 2F0EA 4KY6A 1VQ4A 3HEJA 1LT3D 1PH4A 4JBKA 1OXSC 2PQAB 3KDFB 1W3SA 1DZ1A 2WINB 2J0TD 3J7A5 2R7ZB 3RLOA 5C5LA 2JA7G 1WD1A 4QY7A 1ENCA 2X6GA 3FRPB 1I3QB 4RGOS 3OMCA 3GTMB 2JJQA 2E75C 4C1NI 3W2DA 2EXZA 4NB3A 4LNQA 4DV2Q 1L2FA 1TS2A 3SXHA 1HNXL 4RCOA 2K50A 3G71A 4JI0L 5BN3A 4DAMA 1HJPA 2PYKA 4C2MB 3OTOL 1IBML 2L5TA 3QR8A 1X55A 1T5XD 1V1OA 3PO2G 1STBA 5JAVA 1HR0L 1EFID 1U4PA 2NTTA 1AFPA 4G4KA 2RCNA 3VYSA 1QWYA 2XGTA 4DV7L 1GHJA 4EGVA 4GKJL 5EPKA 2EY5A 4FVMA 1SFOH 4AH6A 5ELBA 5I9OA 1E2WA 4NXMQ 4K5WA 3NP8A 1JWMD 3AFPA 4LFCQ 2QKIC 1KDAA 1QILA 4FO2A 3PMFA 4F87A 2ZXOA 3K5OA 3H6MA 1PDQA 4LF9L 1STGA 1NE3A 1EQTA 2B2TA 2L4NA 4L6TB 1PTOD 1F2MA 2K14A 2A6EC 1XNRQ 5JVG3 1MHWC 2XNAC 5JOBA 2JA5B 5JJZA 4IQZA 4CKBA 5IWAQ 2E2DC 2B63G 4HTHA 1VQFA 4UP7A 4HMJA 1A3TA 3P20A 4BBRB 4DNRB 1U9RA 3S9WA 2PO4A 1GM5A 1PH1A 3CC4A 2AHOB 1I50B 2EY1A 3A7AB 2AUJD 1HA5A 5JPMC 4A3MG 3PSIA 4HMIA 2G9DA 5IGBA 1F9PA 1EIHA 3M9BA 4DR4L 1C0AA 1D1KA 2K4KA 1A6XA 3NQTA 2R7DA 4DGZA 2F0SA 2QEXA 5IP7G 2ES2A 3RLFA 1TT2A 1PLFA 2ICIA 4ODGA 4JI5L 1LTSD 3X3MA 3PIPA 4A3EB 3M4OH 5AJ3L 4K8JA 2KEDA 2JA7H 2B2UA 3L3OC 4FDBA 4UAIA 3CCMA 2MJ8A 4GS3A 3TMEA 2E2HH 2HHHL 1PRTB 4R1JA 4IFDI 4JK1C 1TKWB 3ER0A 3U50C 4IURA 1VQJA 2CVRA 1QB5D 2KCTA 4DK1A 4DAYB 1A8VA 3ONAB 2K01A 2UUAQ 2K28A 3CQZH 1WVLA 1Y8NB 2F0IA 3PO2H 1YNND 1SYGA 2H1EA 2KCMA 2ZTEA 3H0GG 1STHA 4ZKCB 2ENBA 3D4WA 4N9TA 4GNXC 1EY7A 3OIQA 1E24A 4DV5Q 3K80C 3MFYA 3CCLA 3VYRA 2NZHA 3OSOA 4QUCA 1Q8KA 3JAML 3FMCA 3SK4A 2UUCQ 4PG3A 5LL6S 4LF4L 1B3QA 3CCSA 4RAUC 1Y1VB 1JQYD 5LMNW 4R8IA 1AE3A 3I4OA 4A3GG 3E5SA 4ZK9B 3RZOB 3CMAA 4DR6L 1OO9B 2L11A 1DONA 2NZ1D 4CDCC 3JAMi 1IKMA 2F0OA 1WCMG 2WKDA 1DJRD 3IFDA 3D8GA 2K33A 1K8AC 3KF8A 1UNSA 4YCUA 1XNQQ 1F9RA 3TZUA 2B63H 3OMGA 1FJGQ 4LUVA 1Q81C 2I5MX 3FKIB 5IGEA 2FMMA 1HR0W 3PGZA 4IUUA 3F2UA 3PF4A 4DR2L 1ZXTA 4MHEA 1YHAA 3M3YB 3MVVA 1N34L 4A3MH 4JI8Q 3GTPH 4HJ7A 4JYAL 1HPCA 3KBXA 1A2TA 3A74A 4E6IA 4YHHQ 3ERSX 1EYGA 3E3XA 3EBEA 3Q6SA 2A6HC 3F2BA 5IP7H 1PH9A 1YJNA 5CR3A 4A3JG 1Q8IA 4POFA 1XTDA 3NWTA 2F0WA 1XMOQ 1XMQQ 5J3BA 2Q2HA 2RDGA 2IW3A 4HIMA 1QUQA 4OELB 1EQVA 2RBMA 3HKZG 4X66Q 2EYFA 3SE0A 1RCVD 2NBFA 3U4ZA 3HKSA 3CCEA 1L0WA 3S1QH 5FJ8H 1I6HH 1GVPA 1QNUA 3NTHA 3H0GH 1BDOA 4R4IA 1L0XB 3MEFA 2KVMA 5IT9L 2A74C 4KD3A 1K8GA 4LF8Q 2R7FA 4BXXG 1CZWA 3VR2A 1IW7D 4B08A 2YU9H 3EFXD 1FL0A 3GV3A 1Q7YC 1Y14B 1CTMA 5KYLA 3C2PA 1SMYC 3C1FA 2EYLA 4BA1I 1XPRA 1NJIC 1UUPA 1WI5A 1PH3A 3D4DA 4ME5A 2SNSA 2F3IA 4KHPL 1S4ZA 1WCMH 4TRDA 4OONA 3CCUA 2MQHA 2QILA 1RTOA 2QDLA 3M7NA 5I9PA 1SROA 1SLJA 4HCSA 1AW7A 4CDDC 3RN2A 2Q8RE 1KHIA 4AIMA 4YY3Q 4DV0Q 4G7OC 5M3FB 1BO0A 4CGYB 2F0JA 2L12A 3GTJH 1QCBD 2B29A 4NP5A 2AQ2B 4XYOA 2ZTCA 2AUKA 4K2KA 1II3A 1Q12A 2E74C 2ZJRA 2Z4IA 2E2JH 2EYJA 1QJOA 5CGKA 4M8AA 1HZ9A 1B53A 1GOZA 2F0VA 4A3JH 3OPOA 3OWFA 3LNNA 3NXWA 4GKKL 4R8NA 5IYBG 1BOSA 5LMUQ 4QQBX 1ICFB 4QMGA 3DUZA 4DK0A 4ME3A 2JA8G 2ZXRA 4CDEC 1C48A 2NN6I 1PTOB 4A3BG 3CC2A 3AYHB 3OHXC 4XT3B 5A2QL 1R4QB 3K7AB 3KUPA 3T1HQ 2QGQA 3PF5A 2LXKA 1JWSD 3PV0A 1RKNA 4FNFA 2D0PA 2D0OA 1EY9A 1Q90A 4ZAIA 1WD0A 5JEAJ 4ABNA 4AQYL 4IPDA 2AWOA 2C9OA 4BXXH 4FYDA 5C0XI 5M9OA 1BKBA 4CJ0B 5GAEC 5EAYA 3KF6A 4OIKA 3KLWA 4OHJA 4GN5A 4B3SL 2KUMA 2VW9A 3VR3A 3CXCA 4MTKA 1PFBA 1I94Q 1HNWL 1Q46A 1O7LA 4RGTA 2B2VA 2VXWA 2HQLA 1UEBA 2EIFA 2JA7B 4QGUA 1Y69U 3RUZA 1QNKA 4IZ8A 3HOXG 4DKAC 3S17H 2RSOA 2E2HB 3EVQA 1ET6A 1FGUA 1O80A 2A5HA 1IBLL 1NAPA 2B2WC 1NCVA 4Q5VA 3QOJA 4LFBQ 3ND8A 4KK7A 3PO2B 2CKZB 2FINB 4IOCA 5COYA 4B3MQ 3H15A 4FF1A 3CF5A 4YCWA 1KRTA 3LWEA 4X3KA 2K6AA 1N32L 2QCPX 3FP9A 4LF6L 5IE8A 4AYBE 2M9VA 5IYBH 3CP0A 2JK8A 3HP3A 4R4TA 3GTKH 1GJXA 4RWSC 3GV6A 4LFAQ 3MXNB 1QG7A 2JA8H 2ZJPA 4DR3Q 1UEAB 3VA7A 2VQFL 1TIID 1B2TA 2F3VA 1N9WA 4N8FA 1A3VA 5M3MG 1W6JA 3K57A 3Q24A 4A3BH 2BCOA 1GUSA 4C3HG 1KD1C 3MA2B 2IY5B 1KIXA 5GAGC 1S5BD 4DU9A 1N33Q 4Y7NH 1LV9A 5I6WA 3I72A 4OXPA 3M85A 1A2UA 2C35B 1X32A 3F2DA 2UXDQ 4KN7C 2B63B 1IZ6A 3I4LA 4JVZA 1HA6A 2KBNA 3F8TA 1XPUA 4KV6A 1Z9FA 3M4PA 4X64Q 1B4OA 1VQ6A 1SDFA 1A3UA 1TWGH 1PZID 3A56A 4X65Q 3K0XA 3RZDH 1VQ9A 2UUBQ 3GTPB 3N6RA 1G6ZA 1TY2A 5EBDA 5T1GA 1PH7A 2F0FA 1P8LA 1VMPA 4LUOA 4K6LA 4FF2A 2Z9HA 4C3JG 3MWYW 5HGTA 3PIO3 3JC66 4DV2L 3GQBA 4L5RC 1EY0A 4FXDA 5A35A 5FK9C 3HOXH 4A3CG 4ZLTF 5K5PA 4WJ3M 3STBD 3S1MB 4GN4B 4J6HA 1H95A 1PRTD 2ICEC 3WDNA 4FXGC 4A3DG 1I6HB 2VS1A 4QL5A 3NENA 1EY6A 1VF5C 3I8ZA 3E0JA 3T56B 1OXVA 5IGGA 2E76C 3H0GB 2NB0A 4JBMA 4WFN3 3F2CA 4NXML 1U5KA 2OT2A 4O42A 2JE6I 3RMHA 4LFCL 5M5YB 2EYPA 3ERQA 2IWHA 3H94A 1BXTA 2YU9B 3H09A 3UDXA 3R2IA 2FFKB 5HGQA 1GXDC 1EWCA 1I4PA 4K8IA 5DNFA 1WTPA 1TVXA 1HCZA 1FNVA 1PXUA 4A3GB 3A54A 2JA6B 1XNRL 1TWCH 1S72A 2MPMA 4A3IG 5EBCA 1L1OB 3QOLA 4DF7A 2E2IB 1LT6D 2EYHA 1ML0D 5F2DA 1S40A 4C3HH 1WCMB 4IN3A 1CT1D 1QZGA 2WKCA 3WOFA 2KCCA 3AB9A 4L63B 4HJAA 4LF7L 1PH2A 4FP5D 4N9PA 3OIPA 2YYZA 4ZUIA 3J7YW 4DUYQ 3MC0B 2RQXA 4KKSA 1H9SA 1PTOF 1KQSA 2PZUA 2K5QA 1CKMA 1NTGA 4J1MA 2PI2A 3KBGA 1D1IA 2R93G 4A3KG 2ZTDA 2QA4A 4DN4M 5A2QE 1PYBA 1VF7A 2Z6KC 3DWAA 2CH4W 2VUMH 4FF4A 2EJGC 4R4CA 1ILQA 4HJ5A 2KQ3A 2E2JB 1I6VC 5L37A 5J39A 2QEJC 3EA6A 4C3JH 4A3JB 4EX5A 2Q2IA 2DN8A 2PW7A 2PQAA 3KDFA 2A68C 5C3EG 4A3CH 3UE1A 1VQBA 3HKZB 2F03A 1SYEA 2UUAL 1A63A 4A3FG 3A5UA 3KJOA 1JJGA 1J9OA 1LT4D 4B9XA 1K83H 4U68A 4A3DH 1WTHA 4FXKC 4RHSA 4DV5L 1LO5D 1LTRD 1IYJB 2LMCB 4ILWA 4HIKA 3HG9A 3PO3G 3S2HB 1MJEA 2VB2X 1SRUA 1HUMA 4BWGB 4JI7Q 4ZUJA 1SYBA 3VR6A 4DV3Q 4NDXA 2EYMA 5ELNA 1I4HA 1QVCA 1HQMC 5C44G 4TSSA 3I4MG 4X3UA 4A3IH 3CCVA 3HOUB 1EY4A 2A19A 1BBWA 4XTCS 1XNQL 1K0SA 4A3LG 2K32A 2K5NA 3BDLA 1FJGL 1B3AA 1VQCA 1LACA 1QE6A 2FJ2A 1J8IA 2D62A 1SE3A 3S17B 1DYQA 3R3OA 4BY1G 4TQUS 4O2DA 1BCPC 4JI8L 1X65A 4YHHL 2R93H 4A3KH 2D2CC 1LTTD 1E2ZA 3CPFA 4DFAA 1XMOL 3BS1A 3KK7A 1EWHA 1Q86C 4A4IA 2BA0A 3PUYA 4NXNQ 1HXYD 2NUCA 1TWFH 4QF4A 3NSWA 1R4PB 2DY7A 3Q23A 1EU3A 3PCOB 1JJCB 4G7HC 4IJLA 2E8GA 1B44D 3F1ZA 2CW0C 5E4XA 5C3EH 4WORA 2K7VA 1IHZA 3AMUA 3PUZA 4A3FH 4K0KQ 4TKOB 4A3BB 2WAQE 3PUWA 2TSSA 2KHSA 4LF8L 4IFDG 4ULLA 1J6QA 1SJED 4BBSG 4JI1Q 5ELCA 1IBKQ 1YVCA 4DAYA 2KENA 1DXMA 1SR3A 1FYCA 3PO3H 3HOZB 2IT1A 4KD4A 3I90A 3NE5B 1B9MA 2B8FA 1AN8A 2WAQB 3G7LA 4KY5A 3GTGH 3E9IA 4K5VA 1UWVA 2IJ0A 3E0EA 4AYBG 2VY3A 2F0UA 1B9NA 5C44H 3RZDB 1QVFA 4KTAA 2SEBD 4IO9A 2O5IC 3I4MH 3CHBD 1WFQA 3UI2A 3L2PA 3FVQA 1DD2A 4A3LH 2F0KA 1MGSA 3CPWA 2Z0SA 3BVZA 1PH8A 2HD3A 4YY3L 1AH9A 4V0BA 2PW5A 2CQAA 2X6LA 4RGNA 3Q22A 3HOXB 4BY1H 4YCVA 1ZYRC 2NVQB 2GA4B 5M5WB 4KKUA 2EVBA 2PZTA 4LJZC 3GTQB 1CQFA 5FJ8G 1XPOA 1JMCA 1EQRA 3A0JA 2OF1A 2L15A 4POGA 1DOKA 5LMUL 3SHLA 2NVXH 2MGSA 5FLXc 1RDPD 5FO9B 4L5TA 5C4JB 1HFGA 4H0LC 4UPAA 4FF3A 2HQEA 5C5MA 4P75A 3PQIA 3H3VC 4PZ6A 3T1HL 2KJXA 3CU7A 4XXEA 2HCIA 3ZYYX 1TQOA 3CCQA 1IYVA 1HFNA 1TWCB 5M3MB 3OW2A 1EIYB 3GTOH 1RJTA 3L7ZC 5G3LD 4C3HB 2EQSA 5FKAC 4JOIA 3CC7A 3HFZB 4IFDH 1K28A 4LMQD 2BE5C 1YNXA 1SNDA 3QG1A 4BBSH 2A6ED 1EY8A 2BA1A 1PZJD 4GZYC 4X3TA 4RKBA 2JA9A 1PH6A 1EIGA 1I4GA 4DV4Q 2P5ZX 4QIWB 3S16H 3BYTB 3NQIA 3W3AA 3J7ZC 4Y52H 1I94L 4G57A 5LMNQ 3H3VI 3CCRA 3BDCA 4U673 2B39A 1ASZA 5KNDA 1BQQT 5GADC 2HIXA 4RH6A 1DGSA 2F0HA 2SNMA 1CKNB 1SMXA 1XJVA 1GUGA 1E2VA 2GVBA 1KDCA 1TXYA 1AEXA 1ET9A 1G2SA 4LFBL 2IPKD 4RHRA 1IBMQ 4B3ML 4PNYA 3RR5A 2XN9C 3TBIB 1K83B 4A3DB 2B2YC 3NBHB 1CSQA 4ZQ3A 5I6YA 3MFGA 1DM0B 5EPJA 4KLKA 5FLXE 1AZPA 3G6EA 1E1TA 2F4IA 2YTYA 3U9SA 3B6YA 5HURA 5ELEA 4LFAL 2VB3X 4GOPC 1NMGA 4DR3L 3H3VH 1UE5A 2Y0SB 2XRQD 3K8AA 1WTXA 1R9TB 3UDIA 2LFNA 1VQ7A 3NWSA 2ZM6Q 1N33L 3ND9A 5C0XJ 4A3IB 2K1BA 4BY7G 3QB3A 1XXGA 2SOBA 2CCZA 3TZDA 2XTIA 2NN6G 1E7ZA 3DM3A 3T13A 4DV1Q 1NMFA 1H9RA 4X64L 4A76A 4HSVA 1XWEA 4X65L 4Q0FA 2UUBL 3RLNA 4JI3Q 1FD7D 3SGIA 1SSOA 1ESFA 1A15A 2EY2A 4A3KB 1LTID 4ZKBB 1G2TA 4DAPA 4DR4Q 4XDXA 4C3IG 1CA6A 5C0XG 2F4VQ 3S1RH 3D3RA 3HOYG 5ELFA 3T1YQ 1CFMA 4L5SA 1SFOB 2A6HD 2N88A 1K3RA 3QIAA 4UHVA 1YITA 1H9JA 4IPCA 4JBWA 3GTLH 3KLRA 5J22A 4NMZA 2LS01 5JPNC 1FR3A 1MSGA 2XVSA 1YHBA 4WRDA 3TP8A 1Q3LA 3KFUA 4ZRZA 1EYDA 4G7ZC 1TS4A 2WB1B 5C3XA 1KRSA 4L5QA 1PRTF 1EL0A 1V9PA 2DJGC 1VQMA 4OL7A 1G291 3P1HA 2O2LD 5IIFA 3I73A 3CRKC 4GLAC 1HUNA 3RD4A 1Y8PB 1KNAA 4TVAB 3K81C 1D8LA 3R2TA 2N8NA 3MXPA 1PFMA 1Q1EA 3GTGB 4HEDA 1VQNA 1ONLA 1SMYD 1TWHH 2RCFA 5C44B 2JA5G 1KLUD 2GVAA 1Z7TA 2O5JC 1PH5A 2WV6D 1ESRA 3MXNA 1K73C 4BY7H 3M4OB 4DUYL 3WWVA 5ELOA 1K0RA 5E4WC 5TSSA 5C4XG 2NN6H 1PMRA 1S5CD 2CWAA 2UXBQ 3TP5A 1BCPB 2IL8A 4OO1I 2I5HA 1WYDA 2JEAI 2KHIA 1JOKA 1BBXC 1P16A 4ZYSA 1CK1A 1GUNA 1KAWA 4K5XA 3CQZB 4B3TQ 4IOAA 4LWCA 2OXPA 4C3IH 3TRZA 3A8IE 2IX0A 1IXRA 3QO2A 5C0XH 3GTMH 1FNWA 4RA8A 4PMBA 4OEMB 3HOYH 2NVXB 4H7BA 1F9SA 2B2TC 2R92G 4C2MH 1ILPA 3K5MA 3A5ZB 5KEEA 4J8QA 1VQDA 3U4VA 3SK5A 2RF4A 1CUKA 4JV5Q 4R9WA 2Q8IB 2SDFA 1GKHA 4HJ9A 2HT1A 2ZT9C 1JORA 3MZ5A 2AMCB 4B3RQ 4KY7A 5M5XH 4P71A 5IYDG 1SNMA 3S24A 3GTOB 2BDOA 4NPSA 1E0BA 2F0TA 1N36Q 2ATWA 2DJFC 1YI2A 3VDYA 5EKIA 1Y1VG 4BBSB 2WP8J 4JI7L 4H13C 4PV1C 4DV3L 1KC8C 1I5FA 2K05A 4A75A 5ELDA 5BN4A 4XQQA 2CWPA 4IUNA 4DR5Q 2DY8A 4QUFA 2B2UC 1HNZQ 1E22A 5FO7B 1BR9A 4A3MB 2VUMG 4LF5Q 2DNEA 5EPLA 5E1FA 1SNQA 2JA5H 1D2BA 3MAQA 2Q8TA 3FKIG 4DV6Q 4LUZA 5J1ZA 2R61A 5FLMG 1KABA 2JSOA 2QF7A 5BR8Q 3NBIA 5C4XH 1L1OA 1EU4A 2A69C 4IUVA 3BDOA 4QB4A 5EGTA 3GO5A 2K04A 4F7XA 5EJWA 1EEID 1JOQA 3TS2A 3S1QB 1VQKA 1SE2A 1SJHD 4DUZQ 1FNUA 2OTLA 3G48A 4GNXB 4KMUC 1VQ5A 4NXNL 1Q1BA 1PYWD 1D7QA 1YBYA 3M7GA 1BVSA 1PFSA 2Z8LA 1LM0A 1S5FD 2E5LQ 1D5XC 4WJ4A 1STNA 1SBBB 5D3DA 4DR7Q 1VS0A 3ULLA 2Z6BA 3FPUB 3I2ZA 4LW1A 2ASBA 1TWAH 3TEHB 2KHJA 2R92H 1F77A 4F88A 2F0MA 5GAHC 4LAAA 1GUTA 3N52A 1RD9D 4K14A 4JI2Q 2F0GA 4N8X1 2N3SA 5C4ZA 2F0QA 1RL2A 3UDFA 1YNJC 1LUZA 4JI1L 1IBKL 5IYDH 1YJ9A 5IWAL 1MIUA 5CORA 3WOEA 2RHSB 2ZXPA 2RKSA 1Y1VH 3I70A 2PMZB 1DOMA 1QOHA 1SEBD 2YTVA 4MZ9A 5E3FA 4HIOA 5KNCA 1C7YA 1ENAA 1G6PA 1JJ2A 4CKEA 3IRBA 3J81i 3GTJB 1UAPA 2GN5A 1JCKB 4CKCA 5GQOA 3OYYA 5C4HA 3HKZE 1M8AA 4H44C 2CQOA 1WTVA 1J5EQ 3CW2C 4O1NA 1W2BA 5EKKA 4X62Q 1M1KC 2EXDA 3CD6A 3PIP3 1KXLA 3S1RB 3HZXA 3CKIB 1RHPA 1B70B 3FKIH 1MBYA 4RG1A 5FLMH 1JE4A 5K36G 3TP7A 1EY5A 1X3EA 1WTQA 3HOWG 3S2DH 3GTLB 1XX8A 2FXQA 4RKLA 2VL6A 3P75A 1SYDA 2MNAA 1V1PB 3G4SA 1CQVA 1FGBD 3VYUA 4OGQC 1K8MA 3L9AX 3G6JB 4KKTA 1G91A 5CV6A 2UUCL 3IAYA 1KAAA 5LHY1 4DK3C 2EZVA 3V96A 1SNCA 4GOPB 2MFIA 5KYIA 4M1UB 3EN2A 2K5WA 4JBJA 2NVYH 1OXTA 1QVGA 4X3SA 1MD2D 5CC4A 1JC7A 1PTOC 2FMCA 2RDFA 3CMEA 1V8QA 3IFTA 3MXGA 1X56A 3VA5A 2XWBB 3TREA 1TWHB 1OTCA 1Z47A 2HUGA 3QJYA 3S15H 2CH4A 5IODA 1OXUA 1VCIA 2V4DA 4UDUC 2IHEA 2QW7A 4CBVA 2UU9Q 1LTGD 4KJNA 5FLXL 3R8BA 4HIDA 4OX9Q 5G3LF 3SDZA 1NNXA 4XQJA 1ICWA 3A55A 5LMNL 5D14A 3HGBA 2F52A 2JP1A 1VQGA 2MO0A 1NY4A 2M00A 4OWXB 4EQNA 2H4OA 4P73A 2XRSD 1UE6A 1Z6HA 4C3IB 3PIOA 1L0YB 4IFDJ 3EROA 3J81c 4Z9CB 1XMQL 5CBAE 3J80L 3ULPA 2DNCA 1HZCA 3RNUA 1WTRA 4I65A 2PZWA 3HOYB 1EZ6A 4X66L 5NUCA 1N8RC 2LKVA 5M3FH 3DXJC 5K36H 1YNNC 3GTKB 2UXCQ 3HOWH 1JB7A 1KL9A 3KJPA 1EZ8A 2JA8B 2A68D 3D0FA 3J80i 5M5XB 2PCFB 2B2WA 4HAEA 4IALA 1BNZA 3K0YA 3C1EA 1PVOA 2IHFA 1CHPD 4Y7NB 4RCNA 1Y1WG 1B7YB 3A7LA 2TMPA 1YIJA 3BVGA 1VQ8A 1PTOH 4IJHA 5CV8A 4A93G 1HZAA 1X3FA 4JI4Q 1JICA 2NYZD 3TP6A 2B2VC 1F2LA 4HN7A 2ZM6L 3K7AH 3C3LA 1Q82C 1CZGA 3NEMA 1YHQA 1TWGB 5ISRA 1U0LA 3I7FA 1X9NA 4JI6Q 1RTNA 1IYUA 1SXTA 3U9OA 4DV1L 4ID6A 1VDZA 2KEEA 3T51B 1X6OA 1SNPA 3W5OA 5CYUA 4LF7Q 2R6GA 1MI2A 4XT1B 4DV0L 3VYTA 5C4XB 2NZOA 4JI3L 4YWKA 1WJJA 1EYCA 5JJIA 2L1BA 1O78A 1S5ED 4C56C 2CHBD 3D31A 2KCNA 1BCPD 2F4VL 3A8JE 4H02A 5FO8B 4P2CB 5KNBA 3T1YL 3J81E 2OTJA 4DPGA 4MNOA 3KLSA 2MO1A 1C9OA 4DR1Q 3W1GA 1NUCA 3DHQA 1WTOA 3T16A 2X69A 3NTKA 3BVMA 3I56A 3I4NG 1TWAB 4I7AA 2A8VA 3L0OA 1YJWA 2F3WA 2R92B 1H9MA 3D4RA 4KJOA 2EE1A 2LY7A 3CAMA 1VQEA 1PA6A 1CKNA 1V1QA 2CW0D 5DLQE 1SYFA 3OWEB 1HQRD 4QIWE 2RHQB 1IW7C 1VQHA 5BN5A 3J80c 2B3GA 2A1AA 4PZ7A 2VQEQ 1O7YA 3DMUA 5IGDA 2EYOA 2JQOA 1GO3E 1VMCA 4HSPA 1QZHA 1Y1WH 1C8CA 4EVOA 1CHQD 5IOCA 2K52A 1PYSB 3NBHA 3U58A 5DM73 2JA6G 3TSSA 4A93H 4JPBW 3HOVG 1OXXK 3LGJA 1O7ZA 2K03A 4R4QA 3W1BA 2DGYA 1L1OC 1TR5A 5EKLA 2R3ZA 2VUMB 5C3WA 2AKWB 1IL8A 2F0PA 2UXBL 1SN8A 4DNTB 5C6AA 3X3NA 1W6KA 4C3JB 3FDTA 1X54A 5CMDA 2LXJA 2JXMB 3GP7A 2RSNA 5D3IB 1HNXQ 2OQKA 1VQOA 4JI0Q 4YIJA 4C1NK 2EOTA 4YWMA 3S2DB 2I5LX 4B3TL 3OTOQ 3DM1A 3LWUA 2LSSA 1ZYRD 2HDLA 4IUQA 1HR0Q 2OCEA 5IGCA 4K2LA 2Y0SE 1CA5A 3S14H 5CBEE 4O0AA 3RN5A 2K5DA 4DV7Q 1B50A 4GKJQ 2Z6KA 4OWWB 1YZ6A 3K5NA 2ZJQA 3D6WA 5E7NA 3ULJA 1AP0A 4KHZA 4KN4C 3DLLA 4JV5L 3S1MH 2NVTH 3KF8B 2NVYB 3I4NH 1WTWA 3BG3A 4WJWA 4B3RL 1Y8OB 3O13A 1T9HA 1ENFA 1PFNA 1N36L 5IP9G 4LF9Q 4XYQA 2G9HD 4KHVA 3J80E 2I0QA 3S15B 3V05A 3P7JA 4GN3B 3C46A 2YTXA 1PV4A 1LTLA 5M5YH 1E3PA 5CV5A 2WFWA 2UXDL 1SAPA 1CKOA 2BE5D 1I4QA 1EWIA 1EEFD 4DR5L 4PMWA 1HNZL 4GLXA 2VNUD 2MHVA 4A3GH 2JA6H 3SVMA 3MEHA 4LF5L 1D6EC 1STYA 2HIVA 2RDHA 2E2IH 1QUQB 2R7ZG 3HOUG 1XYIA 3BZDB 4YWLA 3HOVH 3S1NH 2R93B 1JE5A 1B8AA 1SE4A 4DV6L 1F2YA 1DCZA 3I91A 4P72A 3JAMc 2N49A 5BR8L 4S3SA 1H9KA 2I46A 4JI5Q 1JR0D 2C5CA 5AJ3Q 2RVLA 2M2LA 3EIVA 2PNRC 2KOLA 2F0DA 1TWFB 5KIXA 1TS5A 2O4XA 3PUVA 1PZKD 2HHHQ 1U4LA 2WB1E 1JOOA 3UDGA 1EQQA 1EFWA 1HRJA 4DUZL 1MJCA 3HOWB 2PNHA 5C3EB 5D65A 1RF2D 1X3PA 4BS9A 4J15A 3DEPA 2ID0A 2Z4HA 4A3FB 4F8MA 1S5DD 3GD7A 4LK1C 3SR1A 1G51A 2E5LL 4OO1G 4DXGA 1EYAA 3TDQA 4DR7L 5KRUA 2MP1A 4CDFC 1A0IA 4LF4Q 3PO3B 5JJLA 1ZKOA 1VQIA 4JI2L 3K7UC 1GD7A 1M90C 3K58A 3FEWX 4DA2A 1STEA 4EQPA 2H5XA 3AFQA 1LYLA 5IYCG 2XSCA 4DR6Q 1LLRD 2KA7A 5IP9H 1TU2B 2DUDA 3I4MB 3ICEA 3HOZG 2XIWA 5GROA 3S2HH 3CRLC 1F9QA 2EDGA 4QJFA 4BBRG 2BOSA 2WAQG 1BUVT 1BBUA 1LABA 5FOBB 3TS0A 1KLGD 3AQQA 2G5DA 3IKJA 2ALYB 3AU7A 4BY1B 3EQLC 1GHKA 2A73B 1JB3A 1CM9A 3T53B 5JJKA 2D5DA 4DR2Q 3HS0C 3QWNA 4CJ1B 1J5EL 2BH2A 4UP9A 3FHWA 4A3EG 2R7ZH 4OWTB 4RMFA 1N34Q 3HOUH 4X62L 2QDBA 3KYHC 4JYAQ 2Z1CA 2JYOA 2EJMA 3JAME 5IT9c 4APVA 2AQ1B 1I3QH 3NTIA 5JEAG 4IPGA 4V190 3DWQA 4NKLA 3STBC 4I7ZC 3SK8A 2L0CA 1PRTC 3MXUA 4UP8A 3D6CA 5IGFA 1EOTA 1SE8A 2J7ZA 1D5MC 1BF4A 3NELA 4MTNA 4CHTB 1EUJA 3V2TA 3E9HA 1I4XA 3KF6B 3T4AC 3K6OA 1X3GA 3J7AV 1O7IA 2F0NA 1K8OA 4OO1H 2JEBI 1UE1A 3M4YA 1G8ZD 2N55A 2PQEA 1EIFA 2JN4A 1MSHA 1Y1WB 4JC0A 1TS3A 1WOCA 4GNXA 1LT5D 1I4RA 5KGUA 3BZCA 2N78A 5I4DA 1NSNS 4A93B 4CJ2C 4GLVB 3S16B 3KLSX 1U4MA 2K75A 1HTLD 3NK9A 3VR5A 2L9HA 4DXFA 5IYCH 4EQOA 5DEHA 4AYBB 1T5EA 1CSPA 4KHPQ 2UU9L 3SK6A 1S3OA 3HOZH 2PPBC 2Q2UA 4OX9L 4XIGS 3GDEA 3K59A 4BBRH 3M4QA 3Q0AA 3UE0A 1HH2P 5CV7A 3FPPA 2J4XA 1I50H 4PZ8A 2BDNA 4EQ5A 4MN3A 1UE7A 3TN2A 2F1MA 3DWPA 2NTSA 3BZKA 4A3EH 5IT9E 1HTPA 3ITPA 2B8GA 3BJUA 3J81j 3S14B 1RIPA 2AWNA 2OEOA 1F2ZA 3EJIA 1SYCA 5JEAH 1GUWA 2KECA 2NVQH 4X6AH 3DEOA 4NW2A 2CFMA 1A62A 3R93A 2UXCL 5M5WH 2K5HA 4HJ8A 4GKKQ 4XQNA 2V1CC 2NVTB 3GTQH 3I3CA 5H1SE 1VQAA 4K0KL 4JOIC 3ZJYC 1KNEA 3I4NB 5IY0A 2D9UA 2PMZE 4HCEA 4HR7B 2OQ0A 3NPPA 1STAA 1X3QA 2IX1A 4PQXA 3Q8DA 4JW0A 4KI0A 5CV9A 1MKHA 1B1ZA 3TQYA 4MIUA 1AZQA 3J81L 2NWGA 3IL8A 5C4JH 2B2YA 4JI4L 3VR4A 2Y0SG 2WACA 1XTCD 4AQYQ 1U4RA 4IPHA 3MHBA 1D5ZC 1V1PA 2OWOA 1V43A 5I2XA 4L8JA 1AE2A 3RZOH 1YEZA 1JWUD 4IUTA 5M3MH 3E6ZX 1KTKA 3LX0A 4JI6L 3S1NB 1HZBA 4GOPA 4JG2A 4B3SQ 1ZEQX 3J7AF 3HOVB 1K3BC 1JT8A 2I07B 5DAUA 1M4VA 2RA4A 1NR2A 1CI3M 1HNWQ 2BH8A 1FVIA 3NHHA 4ALPA 5I2YA 5LL6X 5AFWA 1TY0A 2HCCA 2L55A 5M3FG 2YV5A 4UY8C 4OIJA 1RODA 3AEVA 3OW7A 4DK6C 3M3YH
chains in the Genus database with same CATH topology
3K8AA 1N32L 1IBLQ 3KOJA 1X6OA 3UDIA 1VQ7A 2VZAA 3W5OA 4LF7Q 3FP9A 4LF6L 2ZM6Q 2R6GA 5IE8A 4AYBE 1N33L 4P74A 4DV0L 5IYBH 2NZOA 2JK8A 3CP0A 4R4TA 5C0XJ 4JI3L 1IL2A 3GTKH 4BY7G 4LFAQ 4YWKA 1WJJA 3MXNB 4DR1L 5JJIA 2JA8H 2ZJPA 4DR3Q 2VQFL 2CCZA 2XTIA 2NN6G 1N9WA 1E7ZA 3DM3A 4JCVE 5M3MG 1VQPA 4A3BH 4DNIA 3D31A 4DV1Q 2PI2E 1VQLA 2F4VL 1N32Q 1KD1C 2IY5B 1NMFA 4H02A 4A76A 2K5VA 4X64L 1KIXA 2Q2TA 3T1YL 2OTJA 4LF6Q 4X65L 5GAGC 4DPGA 1N33Q 4MNOA 2UUBL 4Y7NH 1NBWA 2MO1A 5HY6A 4R4OA 4OXPA 3RLNA 3M85A 4JI3Q 2C35B 3SGIA 1C9OA 3F2DA 4DR1Q 3W1GA 1K9MC 4BA2I 2UXDQ 2VQFQ 1IZ6A 4DR4Q 2WB1G 3I56A 3PUXA 3I4NG 5C0XG 2VQEL 3CCJA 2A8VA 3L0OA 1YJWA 2F4VQ 2KBNA 3BU2A 1PHJA 3F8TA 3S1RH 1XPUA 1Z9FA 3M4PA 4X64Q 1VQ6A 3HOYG 3T1YQ 1TWGH 1ASYA 4L5SA 4X65Q 3K0XA 3CAMA 1VQEA 3RZDH 1PA6A 1CKNA 1VQ9A 1V1QA 2UUBQ 5DLQE 1EOVA 1PH7A 3I55A 1K3RA 4DV4L 1YITA 1P8LA 4QIWE 4IPCA 2RHQB 1R9TH 4JBWA 4LUOA 1VQHA 3J80c 2B3GA 2A1AA 4PZ7A 3GTLH 1E1OA 2VQEQ 3JC66 4DV2L 1VQ4A 1PH4A 4JBKA 4L5RC 1OXSC 2JQOA 1GO3E 1QZHA 2PQAB 3KDFB 1W3SA 1YHBA 3HOXH 1Y1WH 4A3CG 3J7A5 3RLOA 2K52A 1PYSB 3U58A 2JA7G 3KFUA 4WJ3M 2JA6G 3STBD 4A93H 4GN4B 4QY7A 1KRSA 1H95A 4L5QA 1V9PA 2JJQA 1OXXK 1VQMA 3LGJA 1G291 3HOVG 4A3DG 2VS1A 4NB3A 4QL5A 3NENA 4LNQA 4DV2Q 1L2FA 4R4QA 1HNXL 4GLAC 2DGYA 1L1OC 2K50A 3W1BA 4TVAB 3G71A 1OXVA 4JI0L 3K81C 1D8LA 4DAMA 1HJPA 2N8NA 3OTOL 1IBML 1Q1EA 4JBMA 3F2CA 4NXML 2AKWB 1VQNA 1X55A 2UXBL 1U5KA 1SN8A 3PO2G 1HR0L 2JE6I 4LFCL 1TWHH 2JA5G 2RCNA 3UDXA 1X54A 2GVAA 2XGTA 2LXJA 5HGQA 4DV7L 1PH5A 1HNXQ 4GKJL 2OQKA 1VQOA 4JI0Q 1K73C 1SFOH 4BY7H 4AH6A 4DUYL 3WWVA 4YWMA 2I5LX 4B3TL 5ELOA 1K0RA 3OTOQ 1XNRL 1TWCH 2LSSA 4NXMQ 5C4XG 1S72A 2CWAA 4A3IG 2UXBQ 1L1OB 1HR0Q 2OCEA 3AFPA 4LFCQ 1S40A 4OO1I 2I5HA 1WYDA 4C3HH 1QZGA 2Y0SE 2JEAI 2KHIA 3S14H 1P16A 4O0AA 4HJAA 3RN5A 4LF7L 4DV7Q 1PH2A 4GKJQ 2Z6KA 4LF9L 2YYZA 1YZ6A 4OWWB 2ZJQA 3ULJA 1KAWA 1NE3A 5E7NA 4DUYQ 4KHZA 3DLLA 4IOAA 4B3TQ 4LWCA 2K14A 4JV5L 1XNRQ 3S1MH 4C3IH 1KQSA 2NVTH 3TRZA 1CKMA 1NTGA 2IX0A 3KF8B 1IXRA 3I4NH 3GTMH 2PI2A 2R93G 4A3KG 2ZTDA 5IWAQ 4B3RL 2QA4A 2B63G 3HOYH 1PYBA 1T9HA 2Z6KC 1VQFA 4UP7A 2VUMH 1N36L 2R92G 5IP9G 4C2MH 4R4CA 3A5ZB 4LF9Q 1GM5A 1PH1A 3CC4A 4HJ5A 1VQDA 2I0QA 2AHOB 3U4VA 4GN3B 2YTXA 1PV4A 2RF4A 1CUKA 4JV5Q 1LTLA 5M5YH 4A3MG 3PSIA 1E3PA 1GKHA 2WFWA 4HJ9A 2UXDL 4C3JH 4EX5A 3M9BA 2HT1A 3M3YH 4DR4L 2K4KA 1C0AA 2R7DA 2AMCB 2Q2IA 4B3RQ 1CKOA 5M5XH 2PQAA 3KDFA 2QEXA 1EWIA 4P71A 5IP7G 5IYDG 3RLFA 2ES2A 5C3EG 4A3CH 4JI5L 4PMWA 3UE1A 1VQBA 3S24A 3PIPA 4DR5L 5AJ3L 1HNZL 4NPSA 4GLXA 1N36Q 2UUAL 2ATWA 2VNUD 1YI2A 4A3FG 2JA7H 4A3GH 2JA6H 1A63A 3A5UA 3KJOA 4FDBA 3CCMA 3VDYA 1Y1VG 4LF5L 1JJGA 2HIVA 2E2IH 1QUQB 2WP8J 4GS3A 2E2HH 4YWLA 1K83H 2HHHL 4R1JA 4DV3L 4JI7L 3HOVH 1JE5A 4A3DH 4IFDI 1B8AA 3ER0A 1KC8C 4DV5L 1I5FA 3U50C 4A75A 4DV6L 1VQJA 4P72A 1IYJB 3JAMc 4HIKA 2KCTA 4DAYB 1A8VA 2N49A 5BR8L 2CWPA 4DR5Q 4JI5Q 1HNZQ 5AJ3Q 3PO3G 2R7ZG 2UUAQ 1E22A 3CQZH 3HOUG 1MJEA 3PO2H 2KCMA 3EIVA 2ZTEA 4LF5Q 2VUMG 3H0GG 1SRUA 2JA5H 3PUVA 4GNXC 4JI7Q 2HHHQ 2WB1E 4DV3Q 1E24A 3UDGA 1EQQA 5ELNA 1EFWA 4DV5Q 3K80C 3CCLA 1QVCA 3FKIG 1MJCA 4DUZL 4DV6Q 2NZHA 2PNHA 4LUZA 1Q8KA 5FLMG 5C44G 2UUCQ 4J15A 4PG3A 4LF4L 2ID0A 3CCSA 5BR8Q 3I4MG 5C4XH 3GD7A 1L1OA 4A3IH 5LMNW 3CCVA 3GO5A 2A19A 1XNQL 1AE3A 1BBWA 4XTCS 4A3LG 1G51A 3I4OA 2K5NA 2E5LL 4A3GG 4OO1G 1FJGL 4DR7L 3CMAA 1VQCA 4DR6L 3TS2A 1VQKA 3JAMi 4DUZQ 2D62A 2OTLA 1WCMG 3G48A 4BY1G 1A0IA 4GNXB 4LF4Q 1VQ5A 5JJLA 4NXNL 1VQIA 4TQUS 4JI2L 4O2DA 3K7UC 4JI8L 1K8AC 1GD7A 1M90C 1Q1BA 1D7QA 1YBYA 1X65A 4YCUA 1BVSA 1PFSA 2H5XA 3AFQA 4YHHL 1XNQQ 2R93H 1LM0A 1LYLA 4A3KH 5IYCG 2E5LQ 2B63H 4WJ4A 1FJGQ 4LUVA 4DR7Q 1Q81C 1VS0A 2I5MX 3ULLA 4DR6Q 3I2ZA 3CPFA 4LW1A 2ASBA 1TWAH 1HR0W 3TEHB 2KHJA 3PGZA 5IP9H 1XMOL 2R92H 3PF4A 4DR2L 5GAHC 2DUDA 1Q86C 3ICEA 4A4IA 3HOZG 2BA0A 1YHAA 3PUYA 5GROA 4NXNQ 3S2HH 4JI2Q 1N34L 4A3MH 2N3SA 4JI8Q 3GTPH 4QJFA 4BBRG 4HJ7A 4JYAL 1RL2A 1TWFH 3UDFA 2WAQG 3A74A 1LUZA 4YHHQ 1BBUA 3ERSX 4JI1L 3TS0A 1EYGA 3EBEA 1IBKL 3PCOB 1JJCB 3F2BA 5IP7H 5IYDH 1PH9A 4IJLA 2E8GA 3F1ZA 5C3EH 1YJNA 3AQQA 1YJ9A 5IWAL 4A3JG 1MIUA 2ALYB 4POFA 1XTDA 2RHSB 3PUZA 1XMOQ 4A3FH 4K0KQ 1XMQQ 5J3BA 5JJKA 4DR2Q 1J5EL 2Q2HA 2BH2A 4UP9A 4HIMA 3FHWA 1Y1VH 1QUQA 2WAQE 4A3EG 2R7ZH 4OWTB 4RMFA 3HKZG 1N34Q 3PUWA 4X62L 3HOUH 4X66Q 3KYHC 4JYAQ 3U4ZA 2YTVA 4LF8L 4IFDG 5IT9c 3HKSA 4MZ9A 3CCEA 1L0WA 4APVA 1J6QA 4BBSG 4JI1Q 4HIOA 1C7YA 1I3QH 3S1QH 5JEAG 1IBKQ 4IPGA 1YVCA 1G6PA 1JJ2A 2KENA 5FJ8H 3IRBA 1I6HH 3J81i 1GVPA 2GN5A 1SR3A 3STBC 3PO3H 5GQOA 3OYYA 2IT1A 3HKZE 1J5EQ 2CQOA 3CW2C 4UP8A 3H0GH 1W2BA 4R4IA 3GTGH 3MEFA 4X62Q 2EXDA 1M1KC 3CD6A 3E9IA 1SE8A 1KXLA 1K8GA 4LF8Q 1UWVA 2R7FA 4BXXG 1B70B 3FKIH 3E0EA 4AYBG 4RG1A 2VY3A 5FLMH 5C44H 3NELA 1QVFA 2YU9H 3S1NH 1FL0A 4MTNA 1Q7YC 5K36G 1EUJA 4IO9A 3E9HA 3I4MH 1X3EA 1WFQA 1Y14B 3KF6B 1X3GA 3HOWG 3L2PA 4BA1I 1O7IA 3S2DH 1XPRA 1NJIC 4A3LH 3CPWA 2JEBI 2Z0SA 1UE1A 1WI5A 2FXQA 1PH3A 2VL6A 1PH8A 2MNAA 4YY3L 1AH9A 2F3IA 1EIFA 4KHPL 3G4SA 1WCMH 4JC0A 1WOCA 4OONA 2MQHA 3CCUA 4GNXA 4BY1H 4YCVA 3BZCA 2N78A 2UUCL 4DK3C 3M7NA 5FJ8G 1SROA 1SLJA 1XPOA 4GLVB 1JMCA 3M4OH 1EQRA 2K75A 3A0JA 4GOPB 2MFIA 2L15A 5IYCH 3RN2A 1KHIA 3EN2A 4JBJA 4AIMA 2NVYH 4YY3Q 4DV0Q 1OXTA 1QVGA 1CSPA 4KHPQ 2UU9L 3GTJH 4POGA 3CMEA 5LMUL 1X56A 1S3OA 3HOZH 2B29A 2NVXH 5FLXc 2Q2UA 4OX9L 4XIGS 3GDEA 4BBRH 3M4QA 4L5TA 3TREA 2ZTCA 3UE0A 1HH2P 1OTCA 1Q12A 1Z47A 2ZJRA 4UPAA 3S15H 2E2JH 1I50H 4PZ8A 4EQ5A 1OXUA 1VCIA 4P75A 1HZ9A 2IHEA 4PZ6A 1UE7A 3T1HL 4A3JH 3CCQA 2UU9Q 4GKKL 5IYBG 5LMUQ 4QQBX 3BZKA 3OW2A 4HIDA 4A3EH 1EIYB 4OX9Q 3GTOH 4ME3A 2JA8G 3L7ZC 2EQSA 4JOIA 2NN6I 3CC7A 3HFZB 3BJUA 3J81j 4A3BG 1YNXA 5LMNL 3CC2A 1RIPA 2AWNA 4BBSH 2F52A 3AYHB 2BA1A 1VQGA 2MO0A 1NY4A 4OWXB 3T1HQ 2QGQA 2NVQH 4X6AH 3PF5A 4P73A 2CFMA 1A62A 2JA9A 1PH6A 5M5WH 2K5HA 4HJ8A 2UXCL 1UE6A 2LXKA 3PIOA 2V1CC 3PV0A 4DV4Q 4GKKQ 3GTQH 2D0PA 2D0OA 5H1SE 4IFDJ 3J81c 1VQAA 1XMQL 4JOIC 3ZJYC 3S16H 4K0KL 3ULPA 3J7ZC 1HZCA 5IY0A 3RNUA 1I94L 4Y52H 5JEAJ 2PMZE 4AQYL 4IPDA 2AWOA 4BXXH 2OQ0A 4X66L 5LMNQ 3H3VI 5C0XI 1N8RC 2IX1A 1BKBA 5GAEC 3Q8DA 4KI0A 3CCRA 5M3FH 1MKHA 1ASZA 3TQYA 5EAYA 5GADC 3KF6A 2HIXA 2UXCQ 3HOWH 3KLWA 1DGSA 4GN5A 4B3SL 1JB7A 1KL9A 3KJPA 2VW9A 5C4JH 3D0FA 1CKNB 1SMXA 3J80i 3CXCA 1XJVA 2GVBA 1I94Q 1TXYA 4JI4L 1HNWL 1Q46A 2Y0SG 4AQYQ 4IPHA 4LFBL 2OWOA 2HQLA 1UEBA 1V43A 1AE2A 2EIFA 3RZOH 1YEZA 1IBMQ 4QGUA 1PVOA 2IHFA 5M3MH 3HOXG 1Y1WG 4B3ML 3RR5A 4JI6L 1B7YB 1HZBA 4DKAC 4GOPA 4JG2A 4B3SQ 3S17H 1YIJA 3NBHB 1JT8A 1VQ8A 4IJHA 1FGUA 4A93G 1HZAA 1CSQA 1IBLL 1X3FA 4JI4Q 1HNWQ 2BH8A 4LFBQ 4KLKA 1FVIA 2ZM6L 3K7AH 4ALPA 3G6EA 1Q82C 1E1TA 3NEMA 2YTYA 1YHQA 3B6YA 2CKZB 4LFAL 4IOCA 1U0LA 4GOPC 1NMGA 5M3FG 4DR3L 2YV5A 3I7FA 3H15A 1X9NA 1UE5A 4B3MQ 4JI6Q 4UY8C 3H3VH 3AEVA 4DK6C 3CF5A 4YCWA 1KRTA 4DV1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8A A;  1N32 L;  1IBL Q;  3KOJ A;  1X6O A;  3UDI A;  1VQ7 A;  2VZA A;  3W5O A;  4LF7 Q;  3FP9 A;  4LF6 L;  2ZM6 Q;  2R6G A;  5IE8 A;  4AYB E;  1N33 L;  4P74 A;  4DV0 L;  5IYB H;  2NZO A;  2JK8 A;  3CP0 A;  4R4T A;  5C0X J;  4JI3 L;  1IL2 A;  3GTK H;  4BY7 G;  4LFA Q;  4YWK A;  1WJJ A;  3MXN B;  4DR1 L;  5JJI A;  2JA8 H;  2ZJP A;  4DR3 Q;  2VQF L;  2CCZ A;  2XTI A;  2NN6 G;  1N9W A;  1E7Z A;  3DM3 A;  4JCV E;  5M3M G;  1VQP A;  4A3B H;  4DNI A;  3D31 A;  4DV1 Q;  2PI2 E;  1VQL A;  2F4V L;  1N32 Q;  1KD1 C;  2IY5 B;  1NMF A;  4H02 A;  4A76 A;  2K5V A;  4X64 L;  1KIX A;  2Q2T A;  3T1Y L;  2OTJ A;  4LF6 Q;  4X65 L;  5GAG C;  4DPG A;  1N33 Q;  4MNO A;  2UUB L;  4Y7N H;  1NBW A;  2MO1 A;  5HY6 A;  4R4O A;  4OXP A;  3RLN A;  3M85 A;  4JI3 Q;  2C35 B;  3SGI A;  1C9O A;  3F2D A;  4DR1 Q;  3W1G A;  1K9M C;  4BA2 I;  2UXD Q;  2VQF Q;  1IZ6 A;  4DR4 Q;  2WB1 G;  3I56 A;  3PUX A;  3I4N G;  5C0X G;  2VQE L;  3CCJ A;  2A8V A;  3L0O A;  1YJW A;  2F4V Q;  2KBN A;  3BU2 A;  1PHJ A;  3F8T A;  3S1R H;  1XPU A;  1Z9F A;  3M4P A;  4X64 Q;  1VQ6 A;  3HOY G;  3T1Y Q;  1TWG H;  1ASY A;  4L5S A;  4X65 Q;  3K0X A;  3CAM A;  1VQE A;  3RZD H;  1PA6 A;  1CKN A;  1VQ9 A;  1V1Q A;  2UUB Q;  5DLQ E;  1EOV A;  1PH7 A;  3I55 A;  1K3R A;  4DV4 L;  1YIT A;  1P8L A;  4QIW E;  4IPC A;  2RHQ B;  1R9T H;  4JBW A;  4LUO A;  1VQH A;  3J80 c;  2B3G A;  2A1A A;  4PZ7 A;  3GTL H;  1E1O A;  2VQE Q;  3JC6 6;  4DV2 L;  1VQ4 A;  1PH4 A;  4JBK A;  4L5R C;  1OXS C;  2JQO A;  1GO3 E;  1QZH A;  2PQA B;  3KDF B;  1W3S A;  1YHB A;  3HOX H;  1Y1W H;  4A3C G;  3J7A 5;  3RLO A;  2K52 A;  1PYS B;  3U58 A;  2JA7 G;  3KFU A;  4WJ3 M;  2JA6 G;  3STB D;  4A93 H;  4GN4 B;  4QY7 A;  1KRS A;  1H95 A;  4L5Q A;  1V9P A;  2JJQ A;  1OXX K;  1VQM A;  3LGJ A;  1G29 1;  3HOV G;  4A3D G;  2VS1 A;  4NB3 A;  4QL5 A;  3NEN A;  4LNQ A;  4DV2 Q;  1L2F A;  4R4Q A;  1HNX L;  4GLA C;  2DGY A;  1L1O C;  2K50 A;  3W1B A;  4TVA B;  3G71 A;  1OXV A;  4JI0 L;  3K81 C;  1D8L A;  4DAM A;  1HJP A;  2N8N A;  3OTO L;  1IBM L;  1Q1E A;  4JBM A;  3F2C A;  4NXM L;  2AKW B;  1VQN A;  1X55 A;  2UXB L;  1U5K A;  1SN8 A;  3PO2 G;  1HR0 L;  2JE6 I;  4LFC L;  1TWH H;  2JA5 G;  2RCN A;  3UDX A;  1X54 A;  2GVA A;  2XGT A;  2LXJ A;  5HGQ A;  4DV7 L;  1PH5 A;  1HNX Q;  4GKJ L;  2OQK A;  1VQO A;  4JI0 Q;  1K73 C;  1SFO H;  4BY7 H;  4AH6 A;  4DUY L;  3WWV A;  4YWM A;  2I5L X;  4B3T L;  5ELO A;  1K0R A;  3OTO Q;  1XNR L;  1TWC H;  2LSS A;  4NXM Q;  5C4X G;  1S72 A;  2CWA A;  4A3I G;  2UXB Q;  1L1O B;  1HR0 Q;  2OCE A;  3AFP A;  4LFC Q;  1S40 A;  4OO1 I;  2I5H A;  1WYD A;  4C3H H;  1QZG A;  2Y0S E;  2JEA I;  2KHI A;  3S14 H;  1P16 A;  4O0A A;  4HJA A;  3RN5 A;  4LF7 L;  4DV7 Q;  1PH2 A;  4GKJ Q;  2Z6K A;  4LF9 L;  2YYZ A;  1YZ6 A;  4OWW B;  2ZJQ A;  3ULJ A;  1KAW A;  1NE3 A;  5E7N A;  4DUY Q;  4KHZ A;  3DLL A;  4IOA A;  4B3T Q;  4LWC A;  2K14 A;  4JV5 L;  1XNR Q;  3S1M H;  4C3I H;  1KQS A;  2NVT H;  3TRZ A;  1CKM A;  1NTG A;  2IX0 A;  3KF8 B;  1IXR A;  3I4N H;  3GTM H;  2PI2 A;  2R93 G;  4A3K G;  2ZTD A;  5IWA Q;  4B3R L;  2QA4 A;  2B63 G;  3HOY H;  1PYB A;  1T9H A;  2Z6K C;  1VQF A;  4UP7 A;  2VUM H;  1N36 L;  2R92 G;  5IP9 G;  4C2M H;  4R4C A;  3A5Z B;  4LF9 Q;  1GM5 A;  1PH1 A;  3CC4 A;  4HJ5 A;  1VQD A;  2I0Q A;  2AHO B;  3U4V A;  4GN3 B;  2YTX A;  1PV4 A;  2RF4 A;  1CUK A;  4JV5 Q;  1LTL A;  5M5Y H;  4A3M G;  3PSI A;  1E3P A;  1GKH A;  2WFW A;  4HJ9 A;  2UXD L;  4C3J H;  4EX5 A;  3M9B A;  2HT1 A;  3M3Y H;  4DR4 L;  2K4K A;  1C0A A;  2R7D A;  2AMC B;  2Q2I A;  4B3R Q;  1CKO A;  5M5X H;  2PQA A;  3KDF A;  2QEX A;  1EWI A;  4P71 A;  5IP7 G;  5IYD G;  3RLF A;  2ES2 A;  5C3E G;  4A3C H;  4JI5 L;  4PMW A;  3UE1 A;  1VQB A;  3S24 A;  3PIP A;  4DR5 L;  5AJ3 L;  1HNZ L;  4NPS A;  4GLX A;  1N36 Q;  2UUA L;  2ATW A;  2VNU D;  1YI2 A;  4A3F G;  2JA7 H;  4A3G H;  2JA6 H;  1A63 A;  3A5U A;  3KJO A;  4FDB A;  3CCM A;  3VDY A;  1Y1V G;  4LF5 L;  1JJG A;  2HIV A;  2E2I H;  1QUQ B;  2WP8 J;  4GS3 A;  2E2H H;  4YWL A;  1K83 H;  2HHH L;  4R1J A;  4DV3 L;  4JI7 L;  3HOV H;  1JE5 A;  4A3D H;  4IFD I;  1B8A A;  3ER0 A;  1KC8 C;  4DV5 L;  1I5F A;  3U50 C;  4A75 A;  4DV6 L;  1VQJ A;  4P72 A;  1IYJ B;  3JAM c;  4HIK A;  2KCT A;  4DAY B;  1A8V A;  2N49 A;  5BR8 L;  2CWP A;  4DR5 Q;  4JI5 Q;  1HNZ Q;  5AJ3 Q;  3PO3 G;  2R7Z G;  2UUA Q;  1E22 A;  3CQZ H;  3HOU G;  1MJE A;  3PO2 H;  2KCM A;  3EIV A;  2ZTE A;  4LF5 Q;  2VUM G;  3H0G G;  1SRU A;  2JA5 H;  3PUV A;  4GNX C;  4JI7 Q;  2HHH Q;  2WB1 E;  4DV3 Q;  1E24 A;  3UDG A;  1EQQ A;  5ELN A;  1EFW A;  4DV5 Q;  3K80 C;  3CCL A;  1QVC A;  3FKI G;  1MJC A;  4DUZ L;  4DV6 Q;  2NZH A;  2PNH A;  4LUZ A;  1Q8K A;  5FLM G;  5C44 G;  2UUC Q;  4J15 A;  4PG3 A;  4LF4 L;  2ID0 A;  3CCS A;  5BR8 Q;  3I4M G;  5C4X H;  3GD7 A;  1L1O A;  4A3I H;  5LMN W;  3CCV A;  3GO5 A;  2A19 A;  1XNQ L;  1AE3 A;  1BBW A;  4XTC S;  4A3L G;  1G51 A;  3I4O A;  2K5N A;  2E5L L;  4A3G G;  4OO1 G;  1FJG L;  4DR7 L;  3CMA A;  1VQC A;  4DR6 L;  3TS2 A;  1VQK A;  3JAM i;  4DUZ Q;  2D62 A;  2OTL A;  1WCM G;  3G48 A;  4BY1 G;  1A0I A;  4GNX B;  4LF4 Q;  1VQ5 A;  5JJL A;  4NXN L;  1VQI A;  4TQU S;  4JI2 L;  4O2D A;  3K7U C;  4JI8 L;  1K8A C;  1GD7 A;  1M90 C;  1Q1B A;  1D7Q A;  1YBY A;  1X65 A;  4YCU A;  1BVS A;  1PFS A;  2H5X A;  3AFQ A;  4YHH L;  1XNQ Q;  2R93 H;  1LM0 A;  1LYL A;  4A3K H;  5IYC G;  2E5L Q;  2B63 H;  4WJ4 A;  1FJG Q;  4LUV A;  4DR7 Q;  1Q81 C;  1VS0 A;  2I5M X;  3ULL A;  4DR6 Q;  3I2Z A;  3CPF A;  4LW1 A;  2ASB A;  1TWA H;  1HR0 W;  3TEH B;  2KHJ A;  3PGZ A;  5IP9 H;  1XMO L;  2R92 H;  3PF4 A;  4DR2 L;  5GAH C;  2DUD A;  1Q86 C;  3ICE A;  4A4I A;  3HOZ G;  2BA0 A;  1YHA A;  3PUY A;  5GRO A;  4NXN Q;  3S2H H;  4JI2 Q;  1N34 L;  4A3M H;  2N3S A;  4JI8 Q;  3GTP H;  4QJF A;  4BBR G;  4HJ7 A;  4JYA L;  1RL2 A;  1TWF H;  3UDF A;  2WAQ G;  3A74 A;  1LUZ A;  4YHH Q;  1BBU A;  3ERS X;  4JI1 L;  3TS0 A;  1EYG A;  3EBE A;  1IBK L;  3PCO B;  1JJC B;  3F2B A;  5IP7 H;  5IYD H;  1PH9 A;  4IJL A;  2E8G A;  3F1Z A;  5C3E H;  1YJN A;  3AQQ A;  1YJ9 A;  5IWA L;  4A3J G;  1MIU A;  2ALY B;  4POF A;  1XTD A;  2RHS B;  3PUZ A;  1XMO Q;  4A3F H;  4K0K Q;  1XMQ Q;  5J3B A;  5JJK A;  4DR2 Q;  1J5E L;  2Q2H A;  2BH2 A;  4UP9 A;  4HIM A;  3FHW A;  1Y1V H;  1QUQ A;  2WAQ E;  4A3E G;  2R7Z H;  4OWT B;  4RMF A;  3HKZ G;  1N34 Q;  3PUW A;  4X62 L;  3HOU H;  4X66 Q;  3KYH C;  4JYA Q;  3U4Z A;  2YTV A;  4LF8 L;  4IFD G;  5IT9 c;  3HKS A;  4MZ9 A;  3CCE A;  1L0W A;  4APV A;  1J6Q A;  4BBS G;  4JI1 Q;  4HIO A;  1C7Y A;  1I3Q H;  3S1Q H;  5JEA G;  1IBK Q;  4IPG A;  1YVC A;  1G6P A;  1JJ2 A;  2KEN A;  5FJ8 H;  3IRB A;  1I6H H;  3J81 i;  1GVP A;  2GN5 A;  1SR3 A;  3STB C;  3PO3 H;  5GQO A;  3OYY A;  2IT1 A;  3HKZ E;  1J5E Q;  2CQO A;  3CW2 C;  4UP8 A;  3H0G H;  1W2B A;  4R4I A;  3GTG H;  3MEF A;  4X62 Q;  2EXD A;  1M1K C;  3CD6 A;  3E9I A;  1SE8 A;  1KXL A;  1K8G A;  4LF8 Q;  1UWV A;  2R7F A;  4BXX G;  1B70 B;  3FKI H;  3E0E A;  4AYB G;  4RG1 A;  2VY3 A;  5FLM H;  5C44 H;  3NEL A;  1QVF A;  2YU9 H;  3S1N H;  1FL0 A;  4MTN A;  1Q7Y C;  5K36 G;  1EUJ A;  4IO9 A;  3E9H A;  3I4M H;  1X3E A;  1WFQ A;  1Y14 B;  3KF6 B;  1X3G A;  3HOW G;  3L2P A;  4BA1 I;  1O7I A;  3S2D H;  1XPR A;  1NJI C;  4A3L H;  3CPW A;  2JEB I;  2Z0S A;  1UE1 A;  1WI5 A;  2FXQ A;  1PH3 A;  2VL6 A;  1PH8 A;  2MNA A;  4YY3 L;  1AH9 A;  2F3I A;  1EIF A;  4KHP L;  3G4S A;  1WCM H;  4JC0 A;  1WOC A;  4OON A;  2MQH A;  3CCU A;  4GNX A;  4BY1 H;  4YCV A;  3BZC A;  2N78 A;  2UUC L;  4DK3 C;  3M7N A;  5FJ8 G;  1SRO A;  1SLJ A;  1XPO A;  4GLV B;  1JMC A;  3M4O H;  1EQR A;  2K75 A;  3A0J A;  4GOP B;  2MFI A;  2L15 A;  5IYC H;  3RN2 A;  1KHI A;  3EN2 A;  4JBJ A;  4AIM A;  2NVY H;  4YY3 Q;  4DV0 Q;  1OXT A;  1QVG A;  1CSP A;  4KHP Q;  2UU9 L;  3GTJ H;  4POG A;  3CME A;  5LMU L;  1X56 A;  1S3O A;  3HOZ H;  2B29 A;  2NVX H;  5FLX c;  2Q2U A;  4OX9 L;  4XIG S;  3GDE A;  4BBR H;  3M4Q A;  4L5T A;  3TRE A;  2ZTC A;  3UE0 A;  1HH2 P;  1OTC A;  1Q12 A;  1Z47 A;  2ZJR A;  4UPA A;  3S15 H;  2E2J H;  1I50 H;  4PZ8 A;  4EQ5 A;  1OXU A;  1VCI A;  4P75 A;  1HZ9 A;  2IHE A;  4PZ6 A;  1UE7 A;  3T1H L;  4A3J H;  3CCQ A;  2UU9 Q;  4GKK L;  5IYB G;  5LMU Q;  4QQB X;  3BZK A;  3OW2 A;  4HID A;  4A3E H;  1EIY B;  4OX9 Q;  3GTO H;  4ME3 A;  2JA8 G;  3L7Z C;  2EQS A;  4JOI A;  2NN6 I;  3CC7 A;  3HFZ B;  3BJU A;  3J81 j;  4A3B G;  1YNX A;  5LMN L;  3CC2 A;  1RIP A;  2AWN A;  4BBS H;  2F52 A;  3AYH B;  2BA1 A;  1VQG A;  2MO0 A;  1NY4 A;  4OWX B;  3T1H Q;  2QGQ A;  2NVQ H;  4X6A H;  3PF5 A;  4P73 A;  2CFM A;  1A62 A;  2JA9 A;  1PH6 A;  5M5W H;  2K5H A;  4HJ8 A;  2UXC L;  1UE6 A;  2LXK A;  3PIO A;  2V1C C;  3PV0 A;  4DV4 Q;  4GKK Q;  3GTQ H;  2D0P A;  2D0O A;  5H1S E;  4IFD J;  3J81 c;  1VQA A;  1XMQ L;  4JOI C;  3ZJY C;  3S16 H;  4K0K L;  3ULP A;  3J7Z C;  1HZC A;  5IY0 A;  3RNU A;  1I94 L;  4Y52 H;  5JEA J;  2PMZ E;  4AQY L;  4IPD A;  2AWO A;  4BXX H;  2OQ0 A;  4X66 L;  5LMN Q;  3H3V I;  5C0X I;  1N8R C;  2IX1 A;  1BKB A;  5GAE C;  3Q8D A;  4KI0 A;  3CCR A;  5M3F H;  1MKH A;  1ASZ A;  3TQY A;  5EAY A;  5GAD C;  3KF6 A;  2HIX A;  2UXC Q;  3HOW H;  3KLW A;  1DGS A;  4GN5 A;  4B3S L;  1JB7 A;  1KL9 A;  3KJP A;  2VW9 A;  5C4J H;  3D0F A;  1CKN B;  1SMX A;  3J80 i;  3CXC A;  1XJV A;  2GVB A;  1I94 Q;  1TXY A;  4JI4 L;  1HNW L;  1Q46 A;  2Y0S G;  4AQY Q;  4IPH A;  4LFB L;  2OWO A;  2HQL A;  1UEB A;  1V43 A;  1AE2 A;  2EIF A;  3RZO H;  1YEZ A;  1IBM Q;  4QGU A;  1PVO A;  2IHF A;  5M3M H;  3HOX G;  1Y1W G;  4B3M L;  3RR5 A;  4JI6 L;  1B7Y B;  1HZB A;  4DKA C;  4GOP A;  4JG2 A;  4B3S Q;  3S17 H;  1YIJ A;  3NBH B;  1JT8 A;  1VQ8 A;  4IJH A;  1FGU A;  4A93 G;  1HZA A;  1CSQ A;  1IBL L;  1X3F A;  4JI4 Q;  1HNW Q;  2BH8 A;  4LFB Q;  4KLK A;  1FVI A;  2ZM6 L;  3K7A H;  4ALP A;  3G6E A;  1Q82 C;  1E1T A;  3NEM A;  2YTY A;  1YHQ A;  3B6Y A;  2CKZ B;  4LFA L;  4IOC A;  1U0L A;  4GOP C;  1NMG A;  5M3F G;  4DR3 L;  2YV5 A;  3I7F A;  3H15 A;  1X9N A;  1UE5 A;  4B3M Q;  4JI6 Q;  4UY8 C;  3H3V H;  3AEV A;  4DK6 C;  3CF5 A;  4YCW A;  1KRT A;  4DV1 L; 
#chains in the Genus database with same CATH topology
 3NUC A;  2A69 D;  5T1I A;  4K6D A;  3KOJ A;  1IBL Q;  2VZA A;  4B9W A;  4DAV A;  4P74 A;  1IKL A;  5EQ0 A;  1IL2 A;  2F0L A;  4DR1 L;  2MUY A;  2EY6 A;  4PMC A;  4JCV E;  1VQP A;  2AQ3 B;  1KDB A;  4DNI A;  2XWJ B;  3SEB A;  1BCP F;  2PI2 E;  1VQL A;  1N32 Q;  1HHV A;  3MTS A;  3OOC A;  2K5V A;  2Q2T A;  3URY A;  2WII B;  4LF6 Q;  1LTB D;  1GUO A;  1NBW A;  5HY6 A;  4R4O A;  4ZCK A;  4RGM A;  3A8K E;  1K9M C;  4BA2 I;  1SNO A;  1H9S B;  2VQF Q;  2WB1 G;  3PUX A;  2VQE L;  3CCJ A;  4QCL A;  2FHT A;  3BYY B;  3BU2 A;  3H91 A;  1PHJ A;  1YNJ D;  1DOL A;  1ASY A;  1LTA D;  4BY7 B;  4RFB A;  3HRZ C;  2IX3 A;  1C4Q A;  5CV4 A;  5JVH 3;  1EOV A;  4IUP A;  2EJF C;  2EPB A;  3I55 A;  3K5L A;  4DV4 L;  2HDM A;  1R9T H;  5DM6 3;  1E1O A;  1NR4 A;  2F0E A;  4KY6 A;  1VQ4 A;  3HEJ A;  1LT3 D;  1PH4 A;  4JBK A;  1OXS C;  2PQA B;  3KDF B;  1W3S A;  1DZ1 A;  2WIN B;  2J0T D;  3J7A 5;  2R7Z B;  3RLO A;  5C5L A;  2JA7 G;  1WD1 A;  4QY7 A;  1ENC A;  2X6G A;  3FRP B;  1I3Q B;  4RGO S;  3OMC A;  3GTM B;  2JJQ A;  2E75 C;  4C1N I;  3W2D A;  2EXZ A;  4NB3 A;  4LNQ A;  4DV2 Q;  1L2F A;  1TS2 A;  3SXH A;  1HNX L;  4RCO A;  2K50 A;  3G71 A;  4JI0 L;  5BN3 A;  4DAM A;  1HJP A;  2PYK A;  4C2M B;  3OTO L;  1IBM L;  2L5T A;  3QR8 A;  1X55 A;  1T5X D;  1V1O A;  3PO2 G;  1STB A;  5JAV A;  1HR0 L;  1EFI D;  1U4P A;  2NTT A;  1AFP A;  4G4K A;  2RCN A;  3VYS A;  1QWY A;  2XGT A;  4DV7 L;  1GHJ A;  4EGV A;  4GKJ L;  5EPK A;  2EY5 A;  4FVM A;  1SFO H;  4AH6 A;  5ELB A;  5I9O A;  1E2W A;  4NXM Q;  4K5W A;  3NP8 A;  1JWM D;  3AFP A;  4LFC Q;  2QKI C;  1KDA A;  1QIL A;  4FO2 A;  3PMF A;  4F87 A;  2ZXO A;  3K5O A;  3H6M A;  1PDQ A;  4LF9 L;  1STG A;  1NE3 A;  1EQT A;  2B2T A;  2L4N A;  4L6T B;  1PTO D;  1F2M A;  2K14 A;  2A6E C;  1XNR Q;  5JVG 3;  1MHW C;  2XNA C;  5JOB A;  2JA5 B;  5JJZ A;  4IQZ A;  4CKB A;  5IWA Q;  2E2D C;  2B63 G;  4HTH A;  1VQF A;  4UP7 A;  4HMJ A;  1A3T A;  3P20 A;  4BBR B;  4DNR B;  1U9R A;  3S9W A;  2PO4 A;  1GM5 A;  1PH1 A;  3CC4 A;  2AHO B;  1I50 B;  2EY1 A;  3A7A B;  2AUJ D;  1HA5 A;  5JPM C;  4A3M G;  3PSI A;  4HMI A;  2G9D A;  5IGB A;  1F9P A;  1EIH A;  3M9B A;  4DR4 L;  1C0A A;  1D1K A;  2K4K A;  1A6X A;  3NQT A;  2R7D A;  4DGZ A;  2F0S A;  2QEX A;  5IP7 G;  2ES2 A;  3RLF A;  1TT2 A;  1PLF A;  2ICI A;  4ODG A;  4JI5 L;  1LTS D;  3X3M A;  3PIP A;  4A3E B;  3M4O H;  5AJ3 L;  4K8J A;  2KED A;  2JA7 H;  2B2U A;  3L3O C;  4FDB A;  4UAI A;  3CCM A;  2MJ8 A;  4GS3 A;  3TME A;  2E2H H;  2HHH L;  1PRT B;  4R1J A;  4IFD I;  4JK1 C;  1TKW B;  3ER0 A;  3U50 C;  4IUR A;  1VQJ A;  2CVR A;  1QB5 D;  2KCT A;  4DK1 A;  4DAY B;  1A8V A;  3ONA B;  2K01 A;  2UUA Q;  2K28 A;  3CQZ H;  1WVL A;  1Y8N B;  2F0I A;  3PO2 H;  1YNN D;  1SYG A;  2H1E A;  2KCM A;  2ZTE A;  3H0G G;  1STH A;  4ZKC B;  2ENB A;  3D4W A;  4N9T A;  4GNX C;  1EY7 A;  3OIQ A;  1E24 A;  4DV5 Q;  3K80 C;  3MFY A;  3CCL A;  3VYR A;  2NZH A;  3OSO A;  4QUC A;  1Q8K A;  3JAM L;  3FMC A;  3SK4 A;  2UUC Q;  4PG3 A;  5LL6 S;  4LF4 L;  1B3Q A;  3CCS A;  4RAU C;  1Y1V B;  1JQY D;  5LMN W;  4R8I A;  1AE3 A;  3I4O A;  4A3G G;  3E5S A;  4ZK9 B;  3RZO B;  3CMA A;  4DR6 L;  1OO9 B;  2L11 A;  1DON A;  2NZ1 D;  4CDC C;  3JAM i;  1IKM A;  2F0O A;  1WCM G;  2WKD A;  1DJR D;  3IFD A;  3D8G A;  2K33 A;  1K8A C;  3KF8 A;  1UNS A;  4YCU A;  1XNQ Q;  1F9R A;  3TZU A;  2B63 H;  3OMG A;  1FJG Q;  4LUV A;  1Q81 C;  2I5M X;  3FKI B;  5IGE A;  2FMM A;  1HR0 W;  3PGZ A;  4IUU A;  3F2U A;  3PF4 A;  4DR2 L;  1ZXT A;  4MHE A;  1YHA A;  3M3Y B;  3MVV A;  1N34 L;  4A3M H;  4JI8 Q;  3GTP H;  4HJ7 A;  4JYA L;  1HPC A;  3KBX A;  1A2T A;  3A74 A;  4E6I A;  4YHH Q;  3ERS X;  1EYG A;  3E3X A;  3EBE A;  3Q6S A;  2A6H C;  3F2B A;  5IP7 H;  1PH9 A;  1YJN A;  5CR3 A;  4A3J G;  1Q8I A;  4POF A;  1XTD A;  3NWT A;  2F0W A;  1XMO Q;  1XMQ Q;  5J3B A;  2Q2H A;  2RDG A;  2IW3 A;  4HIM A;  1QUQ A;  4OEL B;  1EQV A;  2RBM A;  3HKZ G;  4X66 Q;  2EYF A;  3SE0 A;  1RCV D;  2NBF A;  3U4Z A;  3HKS A;  3CCE A;  1L0W A;  3S1Q H;  5FJ8 H;  1I6H H;  1GVP A;  1QNU A;  3NTH A;  3H0G H;  1BDO A;  4R4I A;  1L0X B;  3MEF A;  2KVM A;  5IT9 L;  2A74 C;  4KD3 A;  1K8G A;  4LF8 Q;  2R7F A;  4BXX G;  1CZW A;  3VR2 A;  1IW7 D;  4B08 A;  2YU9 H;  3EFX D;  1FL0 A;  3GV3 A;  1Q7Y C;  1Y14 B;  1CTM A;  5KYL A;  3C2P A;  1SMY C;  3C1F A;  2EYL A;  4BA1 I;  1XPR A;  1NJI C;  1UUP A;  1WI5 A;  1PH3 A;  3D4D A;  4ME5 A;  2SNS A;  2F3I A;  4KHP L;  1S4Z A;  1WCM H;  4TRD A;  4OON A;  3CCU A;  2MQH A;  2QIL A;  1RTO A;  2QDL A;  3M7N A;  5I9P A;  1SRO A;  1SLJ A;  4HCS A;  1AW7 A;  4CDD C;  3RN2 A;  2Q8R E;  1KHI A;  4AIM A;  4YY3 Q;  4DV0 Q;  4G7O C;  5M3F B;  1BO0 A;  4CGY B;  2F0J A;  2L12 A;  3GTJ H;  1QCB D;  2B29 A;  4NP5 A;  2AQ2 B;  4XYO A;  2ZTC A;  2AUK A;  4K2K A;  1II3 A;  1Q12 A;  2E74 C;  2ZJR A;  2Z4I A;  2E2J H;  2EYJ A;  1QJO A;  5CGK A;  4M8A A;  1HZ9 A;  1B53 A;  1GOZ A;  2F0V A;  4A3J H;  3OPO A;  3OWF A;  3LNN A;  3NXW A;  4GKK L;  4R8N A;  5IYB G;  1BOS A;  5LMU Q;  4QQB X;  1ICF B;  4QMG A;  3DUZ A;  4DK0 A;  4ME3 A;  2JA8 G;  2ZXR A;  4CDE C;  1C48 A;  2NN6 I;  1PTO B;  4A3B G;  3CC2 A;  3AYH B;  3OHX C;  4XT3 B;  5A2Q L;  1R4Q B;  3K7A B;  3KUP A;  3T1H Q;  2QGQ A;  3PF5 A;  2LXK A;  1JWS D;  3PV0 A;  1RKN A;  4FNF A;  2D0P A;  2D0O A;  1EY9 A;  1Q90 A;  4ZAI A;  1WD0 A;  5JEA J;  4ABN A;  4AQY L;  4IPD A;  2AWO A;  2C9O A;  4BXX H;  4FYD A;  5C0X I;  5M9O A;  1BKB A;  4CJ0 B;  5GAE C;  5EAY A;  3KF6 A;  4OIK A;  3KLW A;  4OHJ A;  4GN5 A;  4B3S L;  2KUM A;  2VW9 A;  3VR3 A;  3CXC A;  4MTK A;  1PFB A;  1I94 Q;  1HNW L;  1Q46 A;  1O7L A;  4RGT A;  2B2V A;  2VXW A;  2HQL A;  1UEB A;  2EIF A;  2JA7 B;  4QGU A;  1Y69 U;  3RUZ A;  1QNK A;  4IZ8 A;  3HOX G;  4DKA C;  3S17 H;  2RSO A;  2E2H B;  3EVQ A;  1ET6 A;  1FGU A;  1O80 A;  2A5H A;  1IBL L;  1NAP A;  2B2W C;  1NCV A;  4Q5V A;  3QOJ A;  4LFB Q;  3ND8 A;  4KK7 A;  3PO2 B;  2CKZ B;  2FIN B;  4IOC A;  5COY A;  4B3M Q;  3H15 A;  4FF1 A;  3CF5 A;  4YCW A;  1KRT A;  3LWE A;  4X3K A;  2K6A A;  1N32 L;  2QCP X;  3FP9 A;  4LF6 L;  5IE8 A;  4AYB E;  2M9V A;  5IYB H;  3CP0 A;  2JK8 A;  3HP3 A;  4R4T A;  3GTK H;  1GJX A;  4RWS C;  3GV6 A;  4LFA Q;  3MXN B;  1QG7 A;  2JA8 H;  2ZJP A;  4DR3 Q;  1UEA B;  3VA7 A;  2VQF L;  1TII D;  1B2T A;  2F3V A;  1N9W A;  4N8F A;  1A3V A;  5M3M G;  1W6J A;  3K57 A;  3Q24 A;  4A3B H;  2BCO A;  1GUS A;  4C3H G;  1KD1 C;  3MA2 B;  2IY5 B;  1KIX A;  5GAG C;  1S5B D;  4DU9 A;  1N33 Q;  4Y7N H;  1LV9 A;  5I6W A;  3I72 A;  4OXP A;  3M85 A;  1A2U A;  2C35 B;  1X32 A;  3F2D A;  2UXD Q;  4KN7 C;  2B63 B;  1IZ6 A;  3I4L A;  4JVZ A;  1HA6 A;  2KBN A;  3F8T A;  1XPU A;  4KV6 A;  1Z9F A;  3M4P A;  4X64 Q;  1B4O A;  1VQ6 A;  1SDF A;  1A3U A;  1TWG H;  1PZI D;  3A56 A;  4X65 Q;  3K0X A;  3RZD H;  1VQ9 A;  2UUB Q;  3GTP B;  3N6R A;  1G6Z A;  1TY2 A;  5EBD A;  5T1G A;  1PH7 A;  2F0F A;  1P8L A;  1VMP A;  4LUO A;  4K6L A;  4FF2 A;  2Z9H A;  4C3J G;  3MWY W;  5HGT A;  3PIO 3;  3JC6 6;  4DV2 L;  3GQB A;  4L5R C;  1EY0 A;  4FXD A;  5A35 A;  5FK9 C;  3HOX H;  4A3C G;  4ZLT F;  5K5P A;  4WJ3 M;  3STB D;  3S1M B;  4GN4 B;  4J6H A;  1H95 A;  1PRT D;  2ICE C;  3WDN A;  4FXG C;  4A3D G;  1I6H B;  2VS1 A;  4QL5 A;  3NEN A;  1EY6 A;  1VF5 C;  3I8Z A;  3E0J A;  3T56 B;  1OXV A;  5IGG A;  2E76 C;  3H0G B;  2NB0 A;  4JBM A;  4WFN 3;  3F2C A;  4NXM L;  1U5K A;  2OT2 A;  4O42 A;  2JE6 I;  3RMH A;  4LFC L;  5M5Y B;  2EYP A;  3ERQ A;  2IWH A;  3H94 A;  1BXT A;  2YU9 B;  3H09 A;  3UDX A;  3R2I A;  2FFK B;  5HGQ A;  1GXD C;  1EWC A;  1I4P A;  4K8I A;  5DNF A;  1WTP A;  1TVX A;  1HCZ A;  1FNV A;  1PXU A;  4A3G B;  3A54 A;  2JA6 B;  1XNR L;  1TWC H;  1S72 A;  2MPM A;  4A3I G;  5EBC A;  1L1O B;  3QOL A;  4DF7 A;  2E2I B;  1LT6 D;  2EYH A;  1ML0 D;  5F2D A;  1S40 A;  4C3H H;  1WCM B;  4IN3 A;  1CT1 D;  1QZG A;  2WKC A;  3WOF A;  2KCC A;  3AB9 A;  4L63 B;  4HJA A;  4LF7 L;  1PH2 A;  4FP5 D;  4N9P A;  3OIP A;  2YYZ A;  4ZUI A;  3J7Y W;  4DUY Q;  3MC0 B;  2RQX A;  4KKS A;  1H9S A;  1PTO F;  1KQS A;  2PZU A;  2K5Q A;  1CKM A;  1NTG A;  4J1M A;  2PI2 A;  3KBG A;  1D1I A;  2R93 G;  4A3K G;  2ZTD A;  2QA4 A;  4DN4 M;  5A2Q E;  1PYB A;  1VF7 A;  2Z6K C;  3DWA A;  2CH4 W;  2VUM H;  4FF4 A;  2EJG C;  4R4C A;  1ILQ A;  4HJ5 A;  2KQ3 A;  2E2J B;  1I6V C;  5L37 A;  5J39 A;  2QEJ C;  3EA6 A;  4C3J H;  4A3J B;  4EX5 A;  2Q2I A;  2DN8 A;  2PW7 A;  2PQA A;  3KDF A;  2A68 C;  5C3E G;  4A3C H;  3UE1 A;  1VQB A;  3HKZ B;  2F03 A;  1SYE A;  2UUA L;  1A63 A;  4A3F G;  3A5U A;  3KJO A;  1JJG A;  1J9O A;  1LT4 D;  4B9X A;  1K83 H;  4U68 A;  4A3D H;  1WTH A;  4FXK C;  4RHS A;  4DV5 L;  1LO5 D;  1LTR D;  1IYJ B;  2LMC B;  4ILW A;  4HIK A;  3HG9 A;  3PO3 G;  3S2H B;  1MJE A;  2VB2 X;  1SRU A;  1HUM A;  4BWG B;  4JI7 Q;  4ZUJ A;  1SYB A;  3VR6 A;  4DV3 Q;  4NDX A;  2EYM A;  5ELN A;  1I4H A;  1QVC A;  1HQM C;  5C44 G;  4TSS A;  3I4M G;  4X3U A;  4A3I H;  3CCV A;  3HOU B;  1EY4 A;  2A19 A;  1BBW A;  4XTC S;  1XNQ L;  1K0S A;  4A3L G;  2K32 A;  2K5N A;  3BDL A;  1FJG L;  1B3A A;  1VQC A;  1LAC A;  1QE6 A;  2FJ2 A;  1J8I A;  2D62 A;  1SE3 A;  3S17 B;  1DYQ A;  3R3O A;  4BY1 G;  4TQU S;  4O2D A;  1BCP C;  4JI8 L;  1X65 A;  4YHH L;  2R93 H;  4A3K H;  2D2C C;  1LTT D;  1E2Z A;  3CPF A;  4DFA A;  1XMO L;  3BS1 A;  3KK7 A;  1EWH A;  1Q86 C;  4A4I A;  2BA0 A;  3PUY A;  4NXN Q;  1HXY D;  2NUC A;  1TWF H;  4QF4 A;  3NSW A;  1R4P B;  2DY7 A;  3Q23 A;  1EU3 A;  3PCO B;  1JJC B;  4G7H C;  4IJL A;  2E8G A;  1B44 D;  3F1Z A;  2CW0 C;  5E4X A;  5C3E H;  4WOR A;  2K7V A;  1IHZ A;  3AMU A;  3PUZ A;  4A3F H;  4K0K Q;  4TKO B;  4A3B B;  2WAQ E;  3PUW A;  2TSS A;  2KHS A;  4LF8 L;  4IFD G;  4ULL A;  1J6Q A;  1SJE D;  4BBS G;  4JI1 Q;  5ELC A;  1IBK Q;  1YVC A;  4DAY A;  2KEN A;  1DXM A;  1SR3 A;  1FYC A;  3PO3 H;  3HOZ B;  2IT1 A;  4KD4 A;  3I90 A;  3NE5 B;  1B9M A;  2B8F A;  1AN8 A;  2WAQ B;  3G7L A;  4KY5 A;  3GTG H;  3E9I A;  4K5V A;  1UWV A;  2IJ0 A;  3E0E A;  4AYB G;  2VY3 A;  2F0U A;  1B9N A;  5C44 H;  3RZD B;  1QVF A;  4KTA A;  2SEB D;  4IO9 A;  2O5I C;  3I4M H;  3CHB D;  1WFQ A;  3UI2 A;  3L2P A;  3FVQ A;  1DD2 A;  4A3L H;  2F0K A;  1MGS A;  3CPW A;  2Z0S A;  3BVZ A;  1PH8 A;  2HD3 A;  4YY3 L;  1AH9 A;  4V0B A;  2PW5 A;  2CQA A;  2X6L A;  4RGN A;  3Q22 A;  3HOX B;  4BY1 H;  4YCV A;  1ZYR C;  2NVQ B;  2GA4 B;  5M5W B;  4KKU A;  2EVB A;  2PZT A;  4LJZ C;  3GTQ B;  1CQF A;  5FJ8 G;  1XPO A;  1JMC A;  1EQR A;  3A0J A;  2OF1 A;  2L15 A;  4POG A;  1DOK A;  5LMU L;  3SHL A;  2NVX H;  2MGS A;  5FLX c;  1RDP D;  5FO9 B;  4L5T A;  5C4J B;  1HFG A;  4H0L C;  4UPA A;  4FF3 A;  2HQE A;  5C5M A;  4P75 A;  3PQI A;  3H3V C;  4PZ6 A;  3T1H L;  2KJX A;  3CU7 A;  4XXE A;  2HCI A;  3ZYY X;  1TQO A;  3CCQ A;  1IYV A;  1HFN A;  1TWC B;  5M3M B;  3OW2 A;  1EIY B;  3GTO H;  1RJT A;  3L7Z C;  5G3L D;  4C3H B;  2EQS A;  5FKA C;  4JOI A;  3CC7 A;  3HFZ B;  4IFD H;  1K28 A;  4LMQ D;  2BE5 C;  1YNX A;  1SND A;  3QG1 A;  4BBS H;  2A6E D;  1EY8 A;  2BA1 A;  1PZJ D;  4GZY C;  4X3T A;  4RKB A;  2JA9 A;  1PH6 A;  1EIG A;  1I4G A;  4DV4 Q;  2P5Z X;  4QIW B;  3S16 H;  3BYT B;  3NQI A;  3W3A A;  3J7Z C;  4Y52 H;  1I94 L;  4G57 A;  5LMN Q;  3H3V I;  3CCR A;  3BDC A;  4U67 3;  2B39 A;  1ASZ A;  5KND A;  1BQQ T;  5GAD C;  2HIX A;  4RH6 A;  1DGS A;  2F0H A;  2SNM A;  1CKN B;  1SMX A;  1XJV A;  1GUG A;  1E2V A;  2GVB A;  1KDC A;  1TXY A;  1AEX A;  1ET9 A;  1G2S A;  4LFB L;  2IPK D;  4RHR A;  1IBM Q;  4B3M L;  4PNY A;  3RR5 A;  2XN9 C;  3TBI B;  1K83 B;  4A3D B;  2B2Y C;  3NBH B;  1CSQ A;  4ZQ3 A;  5I6Y A;  3MFG A;  1DM0 B;  5EPJ A;  4KLK A;  5FLX E;  1AZP A;  3G6E A;  1E1T A;  2F4I A;  2YTY A;  3U9S A;  3B6Y A;  5HUR A;  5ELE A;  4LFA L;  2VB3 X;  4GOP C;  1NMG A;  4DR3 L;  3H3V H;  1UE5 A;  2Y0S B;  2XRQ D;  3K8A A;  1WTX A;  1R9T B;  3UDI A;  2LFN A;  1VQ7 A;  3NWS A;  2ZM6 Q;  1N33 L;  3ND9 A;  5C0X J;  4A3I B;  2K1B A;  4BY7 G;  3QB3 A;  1XXG A;  2SOB A;  2CCZ A;  3TZD A;  2XTI A;  2NN6 G;  1E7Z A;  3DM3 A;  3T13 A;  4DV1 Q;  1NMF A;  1H9R A;  4X64 L;  4A76 A;  4HSV A;  1XWE A;  4X65 L;  4Q0F A;  2UUB L;  3RLN A;  4JI3 Q;  1FD7 D;  3SGI A;  1SSO A;  1ESF A;  1A15 A;  2EY2 A;  4A3K B;  1LTI D;  4ZKB B;  1G2T A;  4DAP A;  4DR4 Q;  4XDX A;  4C3I G;  1CA6 A;  5C0X G;  2F4V Q;  3S1R H;  3D3R A;  3HOY G;  5ELF A;  3T1Y Q;  1CFM A;  4L5S A;  1SFO B;  2A6H D;  2N88 A;  1K3R A;  3QIA A;  4UHV A;  1YIT A;  1H9J A;  4IPC A;  4JBW A;  3GTL H;  3KLR A;  5J22 A;  4NMZ A;  2LS0 1;  5JPN C;  1FR3 A;  1MSG A;  2XVS A;  1YHB A;  4WRD A;  3TP8 A;  1Q3L A;  3KFU A;  4ZRZ A;  1EYD A;  4G7Z C;  1TS4 A;  2WB1 B;  5C3X A;  1KRS A;  4L5Q A;  1PRT F;  1EL0 A;  1V9P A;  2DJG C;  1VQM A;  4OL7 A;  1G29 1;  3P1H A;  2O2L D;  5IIF A;  3I73 A;  3CRK C;  4GLA C;  1HUN A;  3RD4 A;  1Y8P B;  1KNA A;  4TVA B;  3K81 C;  1D8L A;  3R2T A;  2N8N A;  3MXP A;  1PFM A;  1Q1E A;  3GTG B;  4HED A;  1VQN A;  1ONL A;  1SMY D;  1TWH H;  2RCF A;  5C44 B;  2JA5 G;  1KLU D;  2GVA A;  1Z7T A;  2O5J C;  1PH5 A;  2WV6 D;  1ESR A;  3MXN A;  1K73 C;  4BY7 H;  3M4O B;  4DUY L;  3WWV A;  5ELO A;  1K0R A;  5E4W C;  5TSS A;  5C4X G;  2NN6 H;  1PMR A;  1S5C D;  2CWA A;  2UXB Q;  3TP5 A;  1BCP B;  2IL8 A;  4OO1 I;  2I5H A;  1WYD A;  2JEA I;  2KHI A;  1JOK A;  1BBX C;  1P16 A;  4ZYS A;  1CK1 A;  1GUN A;  1KAW A;  4K5X A;  3CQZ B;  4B3T Q;  4IOA A;  4LWC A;  2OXP A;  4C3I H;  3TRZ A;  3A8I E;  2IX0 A;  1IXR A;  3QO2 A;  5C0X H;  3GTM H;  1FNW A;  4RA8 A;  4PMB A;  4OEM B;  3HOY H;  2NVX B;  4H7B A;  1F9S A;  2B2T C;  2R92 G;  4C2M H;  1ILP A;  3K5M A;  3A5Z B;  5KEE A;  4J8Q A;  1VQD A;  3U4V A;  3SK5 A;  2RF4 A;  1CUK A;  4JV5 Q;  4R9W A;  2Q8I B;  2SDF A;  1GKH A;  4HJ9 A;  2HT1 A;  2ZT9 C;  1JOR A;  3MZ5 A;  2AMC B;  4B3R Q;  4KY7 A;  5M5X H;  4P71 A;  5IYD G;  1SNM A;  3S24 A;  3GTO B;  2BDO A;  4NPS A;  1E0B A;  2F0T A;  1N36 Q;  2ATW A;  2DJF C;  1YI2 A;  3VDY A;  5EKI A;  1Y1V G;  4BBS B;  2WP8 J;  4JI7 L;  4H13 C;  4PV1 C;  4DV3 L;  1KC8 C;  1I5F A;  2K05 A;  4A75 A;  5ELD A;  5BN4 A;  4XQQ A;  2CWP A;  4IUN A;  4DR5 Q;  2DY8 A;  4QUF A;  2B2U C;  1HNZ Q;  1E22 A;  5FO7 B;  1BR9 A;  4A3M B;  2VUM G;  4LF5 Q;  2DNE A;  5EPL A;  5E1F A;  1SNQ A;  2JA5 H;  1D2B A;  3MAQ A;  2Q8T A;  3FKI G;  4DV6 Q;  4LUZ A;  5J1Z A;  2R61 A;  5FLM G;  1KAB A;  2JSO A;  2QF7 A;  5BR8 Q;  3NBI A;  5C4X H;  1L1O A;  1EU4 A;  2A69 C;  4IUV A;  3BDO A;  4QB4 A;  5EGT A;  3GO5 A;  2K04 A;  4F7X A;  5EJW A;  1EEI D;  1JOQ A;  3TS2 A;  3S1Q B;  1VQK A;  1SE2 A;  1SJH D;  4DUZ Q;  1FNU A;  2OTL A;  3G48 A;  4GNX B;  4KMU C;  1VQ5 A;  4NXN L;  1Q1B A;  1PYW D;  1D7Q A;  1YBY A;  3M7G A;  1BVS A;  1PFS A;  2Z8L A;  1LM0 A;  1S5F D;  2E5L Q;  1D5X C;  4WJ4 A;  1STN A;  1SBB B;  5D3D A;  4DR7 Q;  1VS0 A;  3ULL A;  2Z6B A;  3FPU B;  3I2Z A;  4LW1 A;  2ASB A;  1TWA H;  3TEH B;  2KHJ A;  2R92 H;  1F77 A;  4F88 A;  2F0M A;  5GAH C;  4LAA A;  1GUT A;  3N52 A;  1RD9 D;  4K14 A;  4JI2 Q;  2F0G A;  4N8X 1;  2N3S A;  5C4Z A;  2F0Q A;  1RL2 A;  3UDF A;  1YNJ C;  1LUZ A;  4JI1 L;  1IBK L;  5IYD H;  1YJ9 A;  5IWA L;  1MIU A;  5COR A;  3WOE A;  2RHS B;  2ZXP A;  2RKS A;  1Y1V H;  3I70 A;  2PMZ B;  1DOM A;  1QOH A;  1SEB D;  2YTV A;  4MZ9 A;  5E3F A;  4HIO A;  5KNC A;  1C7Y A;  1ENA A;  1G6P A;  1JJ2 A;  4CKE A;  3IRB A;  3J81 i;  3GTJ B;  1UAP A;  2GN5 A;  1JCK B;  4CKC A;  5GQO A;  3OYY A;  5C4H A;  3HKZ E;  1M8A A;  4H44 C;  2CQO A;  1WTV A;  1J5E Q;  3CW2 C;  4O1N A;  1W2B A;  5EKK A;  4X62 Q;  1M1K C;  2EXD A;  3CD6 A;  3PIP 3;  1KXL A;  3S1R B;  3HZX A;  3CKI B;  1RHP A;  1B70 B;  3FKI H;  1MBY A;  4RG1 A;  5FLM H;  1JE4 A;  5K36 G;  3TP7 A;  1EY5 A;  1X3E A;  1WTQ A;  3HOW G;  3S2D H;  3GTL B;  1XX8 A;  2FXQ A;  4RKL A;  2VL6 A;  3P75 A;  1SYD A;  2MNA A;  1V1P B;  3G4S A;  1CQV A;  1FGB D;  3VYU A;  4OGQ C;  1K8M A;  3L9A X;  3G6J B;  4KKT A;  1G91 A;  5CV6 A;  2UUC L;  3IAY A;  1KAA A;  5LHY 1;  4DK3 C;  2EZV A;  3V96 A;  1SNC A;  4GOP B;  2MFI A;  5KYI A;  4M1U B;  3EN2 A;  2K5W A;  4JBJ A;  2NVY H;  1OXT A;  1QVG A;  4X3S A;  1MD2 D;  5CC4 A;  1JC7 A;  1PTO C;  2FMC A;  2RDF A;  3CME A;  1V8Q A;  3IFT A;  3MXG A;  1X56 A;  3VA5 A;  2XWB B;  3TRE A;  1TWH B;  1OTC A;  1Z47 A;  2HUG A;  3QJY A;  3S15 H;  2CH4 A;  5IOD A;  1OXU A;  1VCI A;  2V4D A;  4UDU C;  2IHE A;  2QW7 A;  4CBV A;  2UU9 Q;  1LTG D;  4KJN A;  5FLX L;  3R8B A;  4HID A;  4OX9 Q;  5G3L F;  3SDZ A;  1NNX A;  4XQJ A;  1ICW A;  3A55 A;  5LMN L;  5D14 A;  3HGB A;  2F52 A;  2JP1 A;  1VQG A;  2MO0 A;  1NY4 A;  2M00 A;  4OWX B;  4EQN A;  2H4O A;  4P73 A;  2XRS D;  1UE6 A;  1Z6H A;  4C3I B;  3PIO A;  1L0Y B;  4IFD J;  3ERO A;  3J81 c;  4Z9C B;  1XMQ L;  5CBA E;  3J80 L;  3ULP A;  2DNC A;  1HZC A;  3RNU A;  1WTR A;  4I65 A;  2PZW A;  3HOY B;  1EZ6 A;  4X66 L;  5NUC A;  1N8R C;  2LKV A;  5M3F H;  3DXJ C;  5K36 H;  1YNN C;  3GTK B;  2UXC Q;  3HOW H;  1JB7 A;  1KL9 A;  3KJP A;  1EZ8 A;  2JA8 B;  2A68 D;  3D0F A;  3J80 i;  5M5X B;  2PCF B;  2B2W A;  4HAE A;  4IAL A;  1BNZ A;  3K0Y A;  3C1E A;  1PVO A;  2IHF A;  1CHP D;  4Y7N B;  4RCN A;  1Y1W G;  1B7Y B;  3A7L A;  2TMP A;  1YIJ A;  3BVG A;  1VQ8 A;  1PTO H;  4IJH A;  5CV8 A;  4A93 G;  1HZA A;  1X3F A;  4JI4 Q;  1JIC A;  2NYZ D;  3TP6 A;  2B2V C;  1F2L A;  4HN7 A;  2ZM6 L;  3K7A H;  3C3L A;  1Q82 C;  1CZG A;  3NEM A;  1YHQ A;  1TWG B;  5ISR A;  1U0L A;  3I7F A;  1X9N A;  4JI6 Q;  1RTN A;  1IYU A;  1SXT A;  3U9O A;  4DV1 L;  4ID6 A;  1VDZ A;  2KEE A;  3T51 B;  1X6O A;  1SNP A;  3W5O A;  5CYU A;  4LF7 Q;  2R6G A;  1MI2 A;  4XT1 B;  4DV0 L;  3VYT A;  5C4X B;  2NZO A;  4JI3 L;  4YWK A;  1WJJ A;  1EYC A;  5JJI A;  2L1B A;  1O78 A;  1S5E D;  4C56 C;  2CHB D;  3D31 A;  2KCN A;  1BCP D;  2F4V L;  3A8J E;  4H02 A;  5FO8 B;  4P2C B;  5KNB A;  3T1Y L;  3J81 E;  2OTJ A;  4DPG A;  4MNO A;  3KLS A;  2MO1 A;  1C9O A;  4DR1 Q;  3W1G A;  1NUC A;  3DHQ A;  1WTO A;  3T16 A;  2X69 A;  3NTK A;  3BVM A;  3I56 A;  3I4N G;  1TWA B;  4I7A A;  2A8V A;  3L0O A;  1YJW A;  2F3W A;  2R92 B;  1H9M A;  3D4R A;  4KJO A;  2EE1 A;  2LY7 A;  3CAM A;  1VQE A;  1PA6 A;  1CKN A;  1V1Q A;  2CW0 D;  5DLQ E;  1SYF A;  3OWE B;  1HQR D;  4QIW E;  2RHQ B;  1IW7 C;  1VQH A;  5BN5 A;  3J80 c;  2B3G A;  2A1A A;  4PZ7 A;  2VQE Q;  1O7Y A;  3DMU A;  5IGD A;  2EYO A;  2JQO A;  1GO3 E;  1VMC A;  4HSP A;  1QZH A;  1Y1W H;  1C8C A;  4EVO A;  1CHQ D;  5IOC A;  2K52 A;  1PYS B;  3NBH A;  3U58 A;  5DM7 3;  2JA6 G;  3TSS A;  4A93 H;  4JPB W;  3HOV G;  1OXX K;  3LGJ A;  1O7Z A;  2K03 A;  4R4Q A;  3W1B A;  2DGY A;  1L1O C;  1TR5 A;  5EKL A;  2R3Z A;  2VUM B;  5C3W A;  2AKW B;  1IL8 A;  2F0P A;  2UXB L;  1SN8 A;  4DNT B;  5C6A A;  3X3N A;  1W6K A;  4C3J B;  3FDT A;  1X54 A;  5CMD A;  2LXJ A;  2JXM B;  3GP7 A;  2RSN A;  5D3I B;  1HNX Q;  2OQK A;  1VQO A;  4JI0 Q;  4YIJ A;  4C1N K;  2EOT A;  4YWM A;  3S2D B;  2I5L X;  4B3T L;  3OTO Q;  3DM1 A;  3LWU A;  2LSS A;  1ZYR D;  2HDL A;  4IUQ A;  1HR0 Q;  2OCE A;  5IGC A;  4K2L A;  2Y0S E;  1CA5 A;  3S14 H;  5CBE E;  4O0A A;  3RN5 A;  2K5D A;  4DV7 Q;  1B50 A;  4GKJ Q;  2Z6K A;  4OWW B;  1YZ6 A;  3K5N A;  2ZJQ A;  3D6W A;  5E7N A;  3ULJ A;  1AP0 A;  4KHZ A;  4KN4 C;  3DLL A;  4JV5 L;  3S1M H;  2NVT H;  3KF8 B;  2NVY B;  3I4N H;  1WTW A;  3BG3 A;  4WJW A;  4B3R L;  1Y8O B;  3O13 A;  1T9H A;  1ENF A;  1PFN A;  1N36 L;  5IP9 G;  4LF9 Q;  4XYQ A;  2G9H D;  4KHV A;  3J80 E;  2I0Q A;  3S15 B;  3V05 A;  3P7J A;  4GN3 B;  3C46 A;  2YTX A;  1PV4 A;  1LTL A;  5M5Y H;  1E3P A;  5CV5 A;  2WFW A;  2UXD L;  1SAP A;  1CKO A;  2BE5 D;  1I4Q A;  1EWI A;  1EEF D;  4DR5 L;  4PMW A;  1HNZ L;  4GLX A;  2VNU D;  2MHV A;  4A3G H;  2JA6 H;  3SVM A;  3MEH A;  4LF5 L;  1D6E C;  1STY A;  2HIV A;  2RDH A;  2E2I H;  1QUQ B;  2R7Z G;  3HOU G;  1XYI A;  3BZD B;  4YWL A;  3HOV H;  3S1N H;  2R93 B;  1JE5 A;  1B8A A;  1SE4 A;  4DV6 L;  1F2Y A;  1DCZ A;  3I91 A;  4P72 A;  3JAM c;  2N49 A;  5BR8 L;  4S3S A;  1H9K A;  2I46 A;  4JI5 Q;  1JR0 D;  2C5C A;  5AJ3 Q;  2RVL A;  2M2L A;  3EIV A;  2PNR C;  2KOL A;  2F0D A;  1TWF B;  5KIX A;  1TS5 A;  2O4X A;  3PUV A;  1PZK D;  2HHH Q;  1U4L A;  2WB1 E;  1JOO A;  3UDG A;  1EQQ A;  1EFW A;  1HRJ A;  4DUZ L;  1MJC A;  3HOW B;  2PNH A;  5C3E B;  5D65 A;  1RF2 D;  1X3P A;  4BS9 A;  4J15 A;  3DEP A;  2ID0 A;  2Z4H A;  4A3F B;  4F8M A;  1S5D D;  3GD7 A;  4LK1 C;  3SR1 A;  1G51 A;  2E5L L;  4OO1 G;  4DXG A;  1EYA A;  3TDQ A;  4DR7 L;  5KRU A;  2MP1 A;  4CDF C;  1A0I A;  4LF4 Q;  3PO3 B;  5JJL A;  1ZKO A;  1VQI A;  4JI2 L;  3K7U C;  1GD7 A;  1M90 C;  3K58 A;  3FEW X;  4DA2 A;  1STE A;  4EQP A;  2H5X A;  3AFQ A;  1LYL A;  5IYC G;  2XSC A;  4DR6 Q;  1LLR D;  2KA7 A;  5IP9 H;  1TU2 B;  2DUD A;  3I4M B;  3ICE A;  3HOZ G;  2XIW A;  5GRO A;  3S2H H;  3CRL C;  1F9Q A;  2EDG A;  4QJF A;  4BBR G;  2BOS A;  2WAQ G;  1BUV T;  1BBU A;  1LAB A;  5FOB B;  3TS0 A;  1KLG D;  3AQQ A;  2G5D A;  3IKJ A;  2ALY B;  3AU7 A;  4BY1 B;  3EQL C;  1GHK A;  2A73 B;  1JB3 A;  1CM9 A;  3T53 B;  5JJK A;  2D5D A;  4DR2 Q;  3HS0 C;  3QWN A;  4CJ1 B;  1J5E L;  2BH2 A;  4UP9 A;  3FHW A;  4A3E G;  2R7Z H;  4OWT B;  4RMF A;  1N34 Q;  3HOU H;  4X62 L;  2QDB A;  3KYH C;  4JYA Q;  2Z1C A;  2JYO A;  2EJM A;  3JAM E;  5IT9 c;  4APV A;  2AQ1 B;  1I3Q H;  3NTI A;  5JEA G;  4IPG A;  4V19 0;  3DWQ A;  4NKL A;  3STB C;  4I7Z C;  3SK8 A;  2L0C A;  1PRT C;  3MXU A;  4UP8 A;  3D6C A;  5IGF A;  1EOT A;  1SE8 A;  2J7Z A;  1D5M C;  1BF4 A;  3NEL A;  4MTN A;  4CHT B;  1EUJ A;  3V2T A;  3E9H A;  1I4X A;  3KF6 B;  3T4A C;  3K6O A;  1X3G A;  3J7A V;  1O7I A;  2F0N A;  1K8O A;  4OO1 H;  2JEB I;  1UE1 A;  3M4Y A;  1G8Z D;  2N55 A;  2PQE A;  1EIF A;  2JN4 A;  1MSH A;  1Y1W B;  4JC0 A;  1TS3 A;  1WOC A;  4GNX A;  1LT5 D;  1I4R A;  5KGU A;  3BZC A;  2N78 A;  5I4D A;  1NSN S;  4A93 B;  4CJ2 C;  4GLV B;  3S16 B;  3KLS X;  1U4M A;  2K75 A;  1HTL D;  3NK9 A;  3VR5 A;  2L9H A;  4DXF A;  5IYC H;  4EQO A;  5DEH A;  4AYB B;  1T5E A;  1CSP A;  4KHP Q;  2UU9 L;  3SK6 A;  1S3O A;  3HOZ H;  2PPB C;  2Q2U A;  4OX9 L;  4XIG S;  3GDE A;  3K59 A;  4BBR H;  3M4Q A;  3Q0A A;  3UE0 A;  1HH2 P;  5CV7 A;  3FPP A;  2J4X A;  1I50 H;  4PZ8 A;  2BDN A;  4EQ5 A;  4MN3 A;  1UE7 A;  3TN2 A;  2F1M A;  3DWP A;  2NTS A;  3BZK A;  4A3E H;  5IT9 E;  1HTP A;  3ITP A;  2B8G A;  3BJU A;  3J81 j;  3S14 B;  1RIP A;  2AWN A;  2OEO A;  1F2Z A;  3EJI A;  1SYC A;  5JEA H;  1GUW A;  2KEC A;  2NVQ H;  4X6A H;  3DEO A;  4NW2 A;  2CFM A;  1A62 A;  3R93 A;  2UXC L;  5M5W H;  2K5H A;  4HJ8 A;  4GKK Q;  4XQN A;  2V1C C;  2NVT B;  3GTQ H;  3I3C A;  5H1S E;  1VQA A;  4K0K L;  4JOI C;  3ZJY C;  1KNE A;  3I4N B;  5IY0 A;  2D9U A;  2PMZ E;  4HCE A;  4HR7 B;  2OQ0 A;  3NPP A;  1STA A;  1X3Q A;  2IX1 A;  4PQX A;  3Q8D A;  4JW0 A;  4KI0 A;  5CV9 A;  1MKH A;  1B1Z A;  3TQY A;  4MIU A;  1AZQ A;  3J81 L;  2NWG A;  3IL8 A;  5C4J H;  2B2Y A;  4JI4 L;  3VR4 A;  2Y0S G;  2WAC A;  1XTC D;  4AQY Q;  1U4R A;  4IPH A;  3MHB A;  1D5Z C;  1V1P A;  2OWO A;  1V43 A;  5I2X A;  4L8J A;  1AE2 A;  3RZO H;  1YEZ A;  1JWU D;  4IUT A;  5M3M H;  3E6Z X;  1KTK A;  3LX0 A;  4JI6 L;  3S1N B;  1HZB A;  4GOP A;  4JG2 A;  4B3S Q;  1ZEQ X;  3J7A F;  3HOV B;  1K3B C;  1JT8 A;  2I07 B;  5DAU A;  1M4V A;  2RA4 A;  1NR2 A;  1CI3 M;  1HNW Q;  2BH8 A;  1FVI A;  3NHH A;  4ALP A;  5I2Y A;  5LL6 X;  5AFW A;  1TY0 A;  2HCC A;  2L55 A;  5M3F G;  2YV5 A;  4UY8 C;  4OIJ A;  1ROD A;  3AEV A;  3OW7 A;  4DK6 C;  3M3Y H; 
#chains in the Genus database with same CATH homology
 3K8A A;  1N32 L;  1IBL Q;  3KOJ A;  1X6O A;  3UDI A;  1VQ7 A;  2VZA A;  3W5O A;  4LF7 Q;  3FP9 A;  4LF6 L;  2ZM6 Q;  2R6G A;  5IE8 A;  4AYB E;  1N33 L;  4P74 A;  4DV0 L;  5IYB H;  2NZO A;  2JK8 A;  3CP0 A;  4R4T A;  5C0X J;  4JI3 L;  1IL2 A;  3GTK H;  4BY7 G;  4LFA Q;  4YWK A;  1WJJ A;  3MXN B;  4DR1 L;  5JJI A;  2JA8 H;  2ZJP A;  4DR3 Q;  2VQF L;  2CCZ A;  2XTI A;  2NN6 G;  1N9W A;  1E7Z A;  3DM3 A;  4JCV E;  5M3M G;  1VQP A;  4A3B H;  4DNI A;  3D31 A;  4DV1 Q;  2PI2 E;  1VQL A;  2F4V L;  1N32 Q;  1KD1 C;  2IY5 B;  1NMF A;  4H02 A;  4A76 A;  2K5V A;  4X64 L;  1KIX A;  2Q2T A;  3T1Y L;  2OTJ A;  4LF6 Q;  4X65 L;  5GAG C;  4DPG A;  1N33 Q;  4MNO A;  2UUB L;  4Y7N H;  1NBW A;  2MO1 A;  5HY6 A;  4R4O A;  4OXP A;  3RLN A;  3M85 A;  4JI3 Q;  2C35 B;  3SGI A;  1C9O A;  3F2D A;  4DR1 Q;  3W1G A;  1K9M C;  4BA2 I;  2UXD Q;  2VQF Q;  1IZ6 A;  4DR4 Q;  2WB1 G;  3I56 A;  3PUX A;  3I4N G;  5C0X G;  2VQE L;  3CCJ A;  2A8V A;  3L0O A;  1YJW A;  2F4V Q;  2KBN A;  3BU2 A;  1PHJ A;  3F8T A;  3S1R H;  1XPU A;  1Z9F A;  3M4P A;  4X64 Q;  1VQ6 A;  3HOY G;  3T1Y Q;  1TWG H;  1ASY A;  4L5S A;  4X65 Q;  3K0X A;  3CAM A;  1VQE A;  3RZD H;  1PA6 A;  1CKN A;  1VQ9 A;  1V1Q A;  2UUB Q;  5DLQ E;  1EOV A;  1PH7 A;  3I55 A;  1K3R A;  4DV4 L;  1YIT A;  1P8L A;  4QIW E;  4IPC A;  2RHQ B;  1R9T H;  4JBW A;  4LUO A;  1VQH A;  3J80 c;  2B3G A;  2A1A A;  4PZ7 A;  3GTL H;  1E1O A;  2VQE Q;  3JC6 6;  4DV2 L;  1VQ4 A;  1PH4 A;  4JBK A;  4L5R C;  1OXS C;  2JQO A;  1GO3 E;  1QZH A;  2PQA B;  3KDF B;  1W3S A;  1YHB A;  3HOX H;  1Y1W H;  4A3C G;  3J7A 5;  3RLO A;  2K52 A;  1PYS B;  3U58 A;  2JA7 G;  3KFU A;  4WJ3 M;  2JA6 G;  3STB D;  4A93 H;  4GN4 B;  4QY7 A;  1KRS A;  1H95 A;  4L5Q A;  1V9P A;  2JJQ A;  1OXX K;  1VQM A;  3LGJ A;  1G29 1;  3HOV G;  4A3D G;  2VS1 A;  4NB3 A;  4QL5 A;  3NEN A;  4LNQ A;  4DV2 Q;  1L2F A;  4R4Q A;  1HNX L;  4GLA C;  2DGY A;  1L1O C;  2K50 A;  3W1B A;  4TVA B;  3G71 A;  1OXV A;  4JI0 L;  3K81 C;  1D8L A;  4DAM A;  1HJP A;  2N8N A;  3OTO L;  1IBM L;  1Q1E A;  4JBM A;  3F2C A;  4NXM L;  2AKW B;  1VQN A;  1X55 A;  2UXB L;  1U5K A;  1SN8 A;  3PO2 G;  1HR0 L;  2JE6 I;  4LFC L;  1TWH H;  2JA5 G;  2RCN A;  3UDX A;  1X54 A;  2GVA A;  2XGT A;  2LXJ A;  5HGQ A;  4DV7 L;  1PH5 A;  1HNX Q;  4GKJ L;  2OQK A;  1VQO A;  4JI0 Q;  1K73 C;  1SFO H;  4BY7 H;  4AH6 A;  4DUY L;  3WWV A;  4YWM A;  2I5L X;  4B3T L;  5ELO A;  1K0R A;  3OTO Q;  1XNR L;  1TWC H;  2LSS A;  4NXM Q;  5C4X G;  1S72 A;  2CWA A;  4A3I G;  2UXB Q;  1L1O B;  1HR0 Q;  2OCE A;  3AFP A;  4LFC Q;  1S40 A;  4OO1 I;  2I5H A;  1WYD A;  4C3H H;  1QZG A;  2Y0S E;  2JEA I;  2KHI A;  3S14 H;  1P16 A;  4O0A A;  4HJA A;  3RN5 A;  4LF7 L;  4DV7 Q;  1PH2 A;  4GKJ Q;  2Z6K A;  4LF9 L;  2YYZ A;  1YZ6 A;  4OWW B;  2ZJQ A;  3ULJ A;  1KAW A;  1NE3 A;  5E7N A;  4DUY Q;  4KHZ A;  3DLL A;  4IOA A;  4B3T Q;  4LWC A;  2K14 A;  4JV5 L;  1XNR Q;  3S1M H;  4C3I H;  1KQS A;  2NVT H;  3TRZ A;  1CKM A;  1NTG A;  2IX0 A;  3KF8 B;  1IXR A;  3I4N H;  3GTM H;  2PI2 A;  2R93 G;  4A3K G;  2ZTD A;  5IWA Q;  4B3R L;  2QA4 A;  2B63 G;  3HOY H;  1PYB A;  1T9H A;  2Z6K C;  1VQF A;  4UP7 A;  2VUM H;  1N36 L;  2R92 G;  5IP9 G;  4C2M H;  4R4C A;  3A5Z B;  4LF9 Q;  1GM5 A;  1PH1 A;  3CC4 A;  4HJ5 A;  1VQD A;  2I0Q A;  2AHO B;  3U4V A;  4GN3 B;  2YTX A;  1PV4 A;  2RF4 A;  1CUK A;  4JV5 Q;  1LTL A;  5M5Y H;  4A3M G;  3PSI A;  1E3P A;  1GKH A;  2WFW A;  4HJ9 A;  2UXD L;  4C3J H;  4EX5 A;  3M9B A;  2HT1 A;  3M3Y H;  4DR4 L;  2K4K A;  1C0A A;  2R7D A;  2AMC B;  2Q2I A;  4B3R Q;  1CKO A;  5M5X H;  2PQA A;  3KDF A;  2QEX A;  1EWI A;  4P71 A;  5IP7 G;  5IYD G;  3RLF A;  2ES2 A;  5C3E G;  4A3C H;  4JI5 L;  4PMW A;  3UE1 A;  1VQB A;  3S24 A;  3PIP A;  4DR5 L;  5AJ3 L;  1HNZ L;  4NPS A;  4GLX A;  1N36 Q;  2UUA L;  2ATW A;  2VNU D;  1YI2 A;  4A3F G;  2JA7 H;  4A3G H;  2JA6 H;  1A63 A;  3A5U A;  3KJO A;  4FDB A;  3CCM A;  3VDY A;  1Y1V G;  4LF5 L;  1JJG A;  2HIV A;  2E2I H;  1QUQ B;  2WP8 J;  4GS3 A;  2E2H H;  4YWL A;  1K83 H;  2HHH L;  4R1J A;  4DV3 L;  4JI7 L;  3HOV H;  1JE5 A;  4A3D H;  4IFD I;  1B8A A;  3ER0 A;  1KC8 C;  4DV5 L;  1I5F A;  3U50 C;  4A75 A;  4DV6 L;  1VQJ A;  4P72 A;  1IYJ B;  3JAM c;  4HIK A;  2KCT A;  4DAY B;  1A8V A;  2N49 A;  5BR8 L;  2CWP A;  4DR5 Q;  4JI5 Q;  1HNZ Q;  5AJ3 Q;  3PO3 G;  2R7Z G;  2UUA Q;  1E22 A;  3CQZ H;  3HOU G;  1MJE A;  3PO2 H;  2KCM A;  3EIV A;  2ZTE A;  4LF5 Q;  2VUM G;  3H0G G;  1SRU A;  2JA5 H;  3PUV A;  4GNX C;  4JI7 Q;  2HHH Q;  2WB1 E;  4DV3 Q;  1E24 A;  3UDG A;  1EQQ A;  5ELN A;  1EFW A;  4DV5 Q;  3K80 C;  3CCL A;  1QVC A;  3FKI G;  1MJC A;  4DUZ L;  4DV6 Q;  2NZH A;  2PNH A;  4LUZ A;  1Q8K A;  5FLM G;  5C44 G;  2UUC Q;  4J15 A;  4PG3 A;  4LF4 L;  2ID0 A;  3CCS A;  5BR8 Q;  3I4M G;  5C4X H;  3GD7 A;  1L1O A;  4A3I H;  5LMN W;  3CCV A;  3GO5 A;  2A19 A;  1XNQ L;  1AE3 A;  1BBW A;  4XTC S;  4A3L G;  1G51 A;  3I4O A;  2K5N A;  2E5L L;  4A3G G;  4OO1 G;  1FJG L;  4DR7 L;  3CMA A;  1VQC A;  4DR6 L;  3TS2 A;  1VQK A;  3JAM i;  4DUZ Q;  2D62 A;  2OTL A;  1WCM G;  3G48 A;  4BY1 G;  1A0I A;  4GNX B;  4LF4 Q;  1VQ5 A;  5JJL A;  4NXN L;  1VQI A;  4TQU S;  4JI2 L;  4O2D A;  3K7U C;  4JI8 L;  1K8A C;  1GD7 A;  1M90 C;  1Q1B A;  1D7Q A;  1YBY A;  1X65 A;  4YCU A;  1BVS A;  1PFS A;  2H5X A;  3AFQ A;  4YHH L;  1XNQ Q;  2R93 H;  1LM0 A;  1LYL A;  4A3K H;  5IYC G;  2E5L Q;  2B63 H;  4WJ4 A;  1FJG Q;  4LUV A;  4DR7 Q;  1Q81 C;  1VS0 A;  2I5M X;  3ULL A;  4DR6 Q;  3I2Z A;  3CPF A;  4LW1 A;  2ASB A;  1TWA H;  1HR0 W;  3TEH B;  2KHJ A;  3PGZ A;  5IP9 H;  1XMO L;  2R92 H;  3PF4 A;  4DR2 L;  5GAH C;  2DUD A;  1Q86 C;  3ICE A;  4A4I A;  3HOZ G;  2BA0 A;  1YHA A;  3PUY A;  5GRO A;  4NXN Q;  3S2H H;  4JI2 Q;  1N34 L;  4A3M H;  2N3S A;  4JI8 Q;  3GTP H;  4QJF A;  4BBR G;  4HJ7 A;  4JYA L;  1RL2 A;  1TWF H;  3UDF A;  2WAQ G;  3A74 A;  1LUZ A;  4YHH Q;  1BBU A;  3ERS X;  4JI1 L;  3TS0 A;  1EYG A;  3EBE A;  1IBK L;  3PCO B;  1JJC B;  3F2B A;  5IP7 H;  5IYD H;  1PH9 A;  4IJL A;  2E8G A;  3F1Z A;  5C3E H;  1YJN A;  3AQQ A;  1YJ9 A;  5IWA L;  4A3J G;  1MIU A;  2ALY B;  4POF A;  1XTD A;  2RHS B;  3PUZ A;  1XMO Q;  4A3F H;  4K0K Q;  1XMQ Q;  5J3B A;  5JJK A;  4DR2 Q;  1J5E L;  2Q2H A;  2BH2 A;  4UP9 A;  4HIM A;  3FHW A;  1Y1V H;  1QUQ A;  2WAQ E;  4A3E G;  2R7Z H;  4OWT B;  4RMF A;  3HKZ G;  1N34 Q;  3PUW A;  4X62 L;  3HOU H;  4X66 Q;  3KYH C;  4JYA Q;  3U4Z A;  2YTV A;  4LF8 L;  4IFD G;  5IT9 c;  3HKS A;  4MZ9 A;  3CCE A;  1L0W A;  4APV A;  1J6Q A;  4BBS G;  4JI1 Q;  4HIO A;  1C7Y A;  1I3Q H;  3S1Q H;  5JEA G;  1IBK Q;  4IPG A;  1YVC A;  1G6P A;  1JJ2 A;  2KEN A;  5FJ8 H;  3IRB A;  1I6H H;  3J81 i;  1GVP A;  2GN5 A;  1SR3 A;  3STB C;  3PO3 H;  5GQO A;  3OYY A;  2IT1 A;  3HKZ E;  1J5E Q;  2CQO A;  3CW2 C;  4UP8 A;  3H0G H;  1W2B A;  4R4I A;  3GTG H;  3MEF A;  4X62 Q;  2EXD A;  1M1K C;  3CD6 A;  3E9I A;  1SE8 A;  1KXL A;  1K8G A;  4LF8 Q;  1UWV A;  2R7F A;  4BXX G;  1B70 B;  3FKI H;  3E0E A;  4AYB G;  4RG1 A;  2VY3 A;  5FLM H;  5C44 H;  3NEL A;  1QVF A;  2YU9 H;  3S1N H;  1FL0 A;  4MTN A;  1Q7Y C;  5K36 G;  1EUJ A;  4IO9 A;  3E9H A;  3I4M H;  1X3E A;  1WFQ A;  1Y14 B;  3KF6 B;  1X3G A;  3HOW G;  3L2P A;  4BA1 I;  1O7I A;  3S2D H;  1XPR A;  1NJI C;  4A3L H;  3CPW A;  2JEB I;  2Z0S A;  1UE1 A;  1WI5 A;  2FXQ A;  1PH3 A;  2VL6 A;  1PH8 A;  2MNA A;  4YY3 L;  1AH9 A;  2F3I A;  1EIF A;  4KHP L;  3G4S A;  1WCM H;  4JC0 A;  1WOC A;  4OON A;  2MQH A;  3CCU A;  4GNX A;  4BY1 H;  4YCV A;  3BZC A;  2N78 A;  2UUC L;  4DK3 C;  3M7N A;  5FJ8 G;  1SRO A;  1SLJ A;  1XPO A;  4GLV B;  1JMC A;  3M4O H;  1EQR A;  2K75 A;  3A0J A;  4GOP B;  2MFI A;  2L15 A;  5IYC H;  3RN2 A;  1KHI A;  3EN2 A;  4JBJ A;  4AIM A;  2NVY H;  4YY3 Q;  4DV0 Q;  1OXT A;  1QVG A;  1CSP A;  4KHP Q;  2UU9 L;  3GTJ H;  4POG A;  3CME A;  5LMU L;  1X56 A;  1S3O A;  3HOZ H;  2B29 A;  2NVX H;  5FLX c;  2Q2U A;  4OX9 L;  4XIG S;  3GDE A;  4BBR H;  3M4Q A;  4L5T A;  3TRE A;  2ZTC A;  3UE0 A;  1HH2 P;  1OTC A;  1Q12 A;  1Z47 A;  2ZJR A;  4UPA A;  3S15 H;  2E2J H;  1I50 H;  4PZ8 A;  4EQ5 A;  1OXU A;  1VCI A;  4P75 A;  1HZ9 A;  2IHE A;  4PZ6 A;  1UE7 A;  3T1H L;  4A3J H;  3CCQ A;  2UU9 Q;  4GKK L;  5IYB G;  5LMU Q;  4QQB X;  3BZK A;  3OW2 A;  4HID A;  4A3E H;  1EIY B;  4OX9 Q;  3GTO H;  4ME3 A;  2JA8 G;  3L7Z C;  2EQS A;  4JOI A;  2NN6 I;  3CC7 A;  3HFZ B;  3BJU A;  3J81 j;  4A3B G;  1YNX A;  5LMN L;  3CC2 A;  1RIP A;  2AWN A;  4BBS H;  2F52 A;  3AYH B;  2BA1 A;  1VQG A;  2MO0 A;  1NY4 A;  4OWX B;  3T1H Q;  2QGQ A;  2NVQ H;  4X6A H;  3PF5 A;  4P73 A;  2CFM A;  1A62 A;  2JA9 A;  1PH6 A;  5M5W H;  2K5H A;  4HJ8 A;  2UXC L;  1UE6 A;  2LXK A;  3PIO A;  2V1C C;  3PV0 A;  4DV4 Q;  4GKK Q;  3GTQ H;  2D0P A;  2D0O A;  5H1S E;  4IFD J;  3J81 c;  1VQA A;  1XMQ L;  4JOI C;  3ZJY C;  3S16 H;  4K0K L;  3ULP A;  3J7Z C;  1HZC A;  5IY0 A;  3RNU A;  1I94 L;  4Y52 H;  5JEA J;  2PMZ E;  4AQY L;  4IPD A;  2AWO A;  4BXX H;  2OQ0 A;  4X66 L;  5LMN Q;  3H3V I;  5C0X I;  1N8R C;  2IX1 A;  1BKB A;  5GAE C;  3Q8D A;  4KI0 A;  3CCR A;  5M3F H;  1MKH A;  1ASZ A;  3TQY A;  5EAY A;  5GAD C;  3KF6 A;  2HIX A;  2UXC Q;  3HOW H;  3KLW A;  1DGS A;  4GN5 A;  4B3S L;  1JB7 A;  1KL9 A;  3KJP A;  2VW9 A;  5C4J H;  3D0F A;  1CKN B;  1SMX A;  3J80 i;  3CXC A;  1XJV A;  2GVB A;  1I94 Q;  1TXY A;  4JI4 L;  1HNW L;  1Q46 A;  2Y0S G;  4AQY Q;  4IPH A;  4LFB L;  2OWO A;  2HQL A;  1UEB A;  1V43 A;  1AE2 A;  2EIF A;  3RZO H;  1YEZ A;  1IBM Q;  4QGU A;  1PVO A;  2IHF A;  5M3M H;  3HOX G;  1Y1W G;  4B3M L;  3RR5 A;  4JI6 L;  1B7Y B;  1HZB A;  4DKA C;  4GOP A;  4JG2 A;  4B3S Q;  3S17 H;  1YIJ A;  3NBH B;  1JT8 A;  1VQ8 A;  4IJH A;  1FGU A;  4A93 G;  1HZA A;  1CSQ A;  1IBL L;  1X3F A;  4JI4 Q;  1HNW Q;  2BH8 A;  4LFB Q;  4KLK A;  1FVI A;  2ZM6 L;  3K7A H;  4ALP A;  3G6E A;  1Q82 C;  1E1T A;  3NEM A;  2YTY A;  1YHQ A;  3B6Y A;  2CKZ B;  4LFA L;  4IOC A;  1U0L A;  4GOP C;  1NMG A;  5M3F G;  4DR3 L;  2YV5 A;  3I7F A;  3H15 A;  1X9N A;  1UE5 A;  4B3M Q;  4JI6 Q;  4UY8 C;  3H3V H;  3AEV A;  4DK6 C;  3CF5 A;  4YCW A;  1KRT A;  4DV1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...