4K0KL

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kL00
4MTNA 2B63H 3M85A 4DUYQ 3Q8DA 2R92H 1JT8A 3D0FA 1HZAA 1HNWL 1XMQL 1YZ6A 3RZOH 3KJPA 3ICEA 4DR2L 4X66Q 3ULJA 4K0KQ 4P74A 3ER0A 3I4OA 2F52A 2Z6KA 2IX1A 4A75A 1N33Q 3A74A 3J80i 4AYBG 1Y1WG 3HOZG 1A0IA 4DUZQ 3UDXA 3S1RH 1OXVA 1V43A 3RR5A 5GAGC 1VQCA 5C0XJ 3PF5A 4JI3L 1EYGA 3G4SA 1P16A 1VQGA 2OQ0A 3KDFA 4DV0Q 3EN2A 1TXYA 2AHOB 1NJIC 3NBHB 2IHEA 4JI1L 4X62L 2UU9L 4BY7G 1Y1WH 3HOZH 4A3EG 4BBRG 1K3RA 3H3VI 4EX5A 5M3MG 1VQHA 4OWWB 3FKIG 5H1SE 1K9MC 4QY7A 2ZTDA 2A19A 2VQEL 3ULPA 1QUQA 2Z6KC 1L2FA 2ZM6L 1XMOQ 4BY7H 3KF6B 1NMFA 4R4TA 4A3EH 4BBRH 4GNXA 2ZJRA 2E2JH 1AH9A 5M3MH 3J7ZC 1I5FA 1EWIA 1VQNA 1TWAH 4KHPL 1WI5A 1ASZA 4JBMA 1MKHA 3S15H 4YY3L 4A3CH 4HIOA 4HJ5A 2I0QA 2E2HH 1J5EL 2GN5A 3HOYH 1A8VA 5E7NA 3H15A 3CCMA 4DV0L 1E7ZA 5JJKA 3BU2A 4JOIA 3CCUA 2N78A 1YI2A 1CKOA 1XNQQ 2E5LL 3VDYA 1N34L 4HJ9A 1HR0Q 1E24A 4GNXC 3MEFA 1Q8KA 4HJAA 4B3TL 4L5SA 1HNZL 3KOJA 4A3LG 2I5LX 1N32Q 4X65Q 1X3GA 5IYCG 4IFDJ 3W5OA 3PO3H 4LW1A 1WOCA 4A76A 4RG1A 4QIWE 2PMZE 4A3LH 2Y0SE 2UXBQ 5HY6A 4B3MQ 5IYCH 3PO2G 4DNIA 5GADC 5M5YH 3JC66 3PSIA 4KHZA 3J80c 4O0AA 3GTQH 3FHWA 1IXRA 1VQ5A 2NVQH 5AJ3L 2ZJQA 1HNXL 3E9IA 4LF6L 3B6YA 4H02A 3KDFB 3GTJH 3GO5A 3PO2H 4PZ8A 4DR5Q 4IPDA 1PH3A 2VQFL 5LMNW 3PGZA 2VUMG 1VCIA 1L1OB 2B3GA 2VS1A 4L5TA 1Q82C 4OO1G 2OTJA 1I94Q 1SFOH 4LF7Q 1HZ9A 2JA5G 4JYAL 1U0LA 1QUQB 1YNXA 1KD1C 3CF5A 1N8RC 2PQAB 4GNXB 1IBMQ 2NVXH 4QGUA 2VUMH 1VQOA 2JK8A 2K75A 3UDGA 4B3ML 3F2CA 1N9WA 2EQSA 1YHQA 3G71A 4R4OA 5IT9c 1Q7YC 3NENA 1PHJA 3KLWA 5LMUL 2JA5H 2XGTA 3UE1A 1AE2A 4DV5L 3GTLH 1K0RA 2A8VA 3HKZG 2UUBQ 1QVCA 2ASBA 2CKZB 5JEAJ 5M5WH 4GKKQ 3U58A 5K36G 4JI8Q 4FDBA 2EIFA 3W1GA 5BR8Q 1VQ8A 1XPRA 1KL9A 5DLQE 1YHBA 1SRUA 4P73A 4YWMA 1XNRL 2AKWB 4DK6C 2KCMA 4DV4Q 4JI7Q 1KC8C 1BBWA 4IJHA 5IYDG 3PUVA 2Q2TA 2BH2A 1SROA 3RLOA 2VL6A 4AQYL 2UXDL 3I56A 2NZHA 4GS3A 3RLFA 4AYBE 4HJ7A 1IBML 1EIFA 1B8AA 2JE6I 2QGQA 1N36Q 2GVAA 4J15A 5IYDH 4JC0A 4NXNQ 1X54A 3BZKA 1SMXA 2KENA 3K7AH 1B70B 3PUXA 3CW2C 4IPGA 2NZOA 4IOCA 2UXCL 3T1HQ 2UUCQ 2ZTEA 1OXXK 3S24A 4AH6A 2QA4A 4ME3A 4GKKL 2HIVA 2JJQA 1XPUA 4R4CA 5JJLA 1Q81C 2JQOA 1X6OA 3GTGH 3GTMH 1YBYA 4A3DG 5EAYA 1JJ2A 1Q46A 1HJPA 1TWCH 3A5UA 4GLVB 4X64L 4DV6Q 4DR3L 1VQMA 4ALPA 1UWVA 2JEBI 2K4KA 3GDEA 4QJFA 3RNUA 1FJGL 1SR3A 2AWNA 2C35B 2CFMA 4JI0Q 2R6GA 3E0EA 4LF8L 2ID0A 3OW2A 1OXSC 1YJNA 5FLXc 2HT1A 5FJ8G 4A3DH 4LFBL 3AEVA 2NVTH 1YHAA 4JI4L 2MO0A 4R4IA 3L2PA 5FLMG 2WP8J 1O7IA 1U5KA 3TEHB 5M5XH 3OTOL 4JI2Q 2N49A 4P72A 4DR1L 5FJ8H 2D62A 4A3BH 1VQEA 1C0AA 2E8GA 1C7YA 5FLMH 2A1AA 4UPAA 1RIPA 3EBEA 1GKHA 1PH7A 1E1TA 3PIOA 1IBKQ 1OTCA 4A3CG 5C4XG 3KF8B 4DUYL 5JJIA 1MJCA 4QQBX 5IP7H 4P75A 3UE0A 2JA6G 3HOYG 2JA7G 1NE3A 2KHIA 4X66L 5LMNQ 1OXUA 4DKAC 1V9PA 1PH5A 4K0KL 5IP9G 1UEBA 1UE7A 2L15A 5C4XH 1VQPA 3TRZA 2ES2A 1A63A 4DV2Q 1Q1EA 1Q12A 1N33L 4TQUS 1K83H 3STBC 4AIMA 5C44G 1UE5A 4DUZL 4B3SQ 3S1QH 4XTCS 1YITA 4YHHQ 2JA6H 1GVPA 2JA7H 3CMEA 3HKSA 4DR7Q 2V1CC 4JI6Q 2NN6G 5IP9H 2RHQB 3U4ZA 4DV1Q 4GKJQ 4GOPC 4XIGS 3PO3G 1GM5A 2ZJPA 5C44H 4A4IA 1SE8A 1FGUA 5C3EG 1QVGA 1VQJA 1TWHH 4MNOA 4DR4Q 4OO1I 2K52A 1VQ4A 5ELNA 4B3RQ 5C0XG 4DV7Q 1XJVA 2ZTCA 2KBNA 3BZCA 1XMOL 1WCMH 1X56A 1S72A 1EFWA 5C3EH 1LUZA 3HOXG 2HQLA 3F1ZA 1CUKA 1T9HA 3CPWA 3T1YQ 4LF5Q 4LF4Q 3S16H 2D0OA 4L5QA 3J7A5 2IHFA 4GLAC 1Y14B 4PMWA 4JBWA 3HKZE 3HOXH 2R93G 1NTGA 4KLKA 4OWXB 1XNQL 3I7FA 4RMFA 2UUAQ 4GN3B 1NBWA 1JMCA 1HR0L 3I2ZA 2I5MX 2AMCB 3U4VA 3G6EA 4A3FG 3H0GH 1UE1A 2R93H 1KXLA 2WB1G 1N32L 5GROA 1P8LA 3KYHC 4X65L 5ELOA 4BA1I 3AQQA 2YTXA 1KIXA 4IPHA 2MFIA 1HZBA 4NXMQ 4A3GG 3M4QA 1A62A 3FP9A 1PVOA 1FVIA 2N3SA 2RCNA 4LUZA 3M4PA 3CCVA 4A3FH 1QZHA 2HHHQ 4LFCQ 1GD7A 2UXBL 4JV5Q 1JB7A 3T1YL 4NPSA 3CCRA 1UE6A 4LUVA 4A3MG 4A3GH 3PUYA 3A0JA 3CC7A 3DM3A 4IFDG 3PV0A 1PYBA 3CPFA 2KCTA 1PH2A 2K5VA 4DR6Q 2MNAA 4DR5L 1PYSB 4A3MH 4LF9Q 1IBLQ 1C9OA 3S1NH 2JA9A 3HOWG 3CC2A 1Q86C 1JJGA 1G51A 4PZ6A 3K7UC 5J3BA 4C3HH 2JEAI 1I94L 4A93G 2PI2A 2WFWA 4LF7L 1CKMA 1R9TH 1EQQA 3CP0A 3U50C 1KRSA 2HIXA 4LFAQ 3BJUA 2PI2E 2RF4A 5C4JH 3HOWH 3HOVG 2CWPA 4OX9Q 1D8LA 1I3QH 4A93H 4BXXG 1EQRA 2KHJA 1VQFA 3J81i 3STBD 5GAHC 3F2DA 3ZJYC 2UUBL 3KF6A 3I4NG 3HOVH 1XTDA 3CMAA 1HNWQ 4PG3A 4YCVA 1XMQQ 2IX0A 4JI8L 4OONA 4BXXH 5BR8L 4DR2Q 1EIYB 1PH8A 4JCVE 1QZGA 3S14H 4C3JH 1LM0A 3NELA 3RLNA 3TS0A 4POFA 1NMGA 1AE3A 3ULLA 1SN8A 4DV4L 1Q1BA 5HGQA 3PIPA 1X9NA 2E2IH 4JI7L 3I4NH 4EQ5A 1KQSA 2Z0SA 3CQZH 1SLJA 1M1KC 4JBJA 2YU9H 4DAYB 3TS2A 5JEAG 1J6QA 3UDFA 1KHIA 2VY3A 3OYYA 2F4VQ 3M7NA 4A3BG 3GTKH 3WWVA 4JI1Q 2UU9Q 4X62Q 3CCLA 1N36L 2EXDA 4C2MH 1IL2A 3CXCA 1NY4A 4NXNL 4HIMA 3JAMi 2ALYB 2NN6I 3CC4A 1CKNA 1CSPA 1BBUA 3F8TA 3GD7A 2VQEQ 4A3KG 5IP7G 1MIUA 2ZM6Q 3T1HL 1OXTA 3EIVA 4MZ9A 1W2BA 1WJJA 3PCOB 4YWKA 2Q2HA 2UUCL 4OWTB 2LSSA 1BKBA 2R7FA 4KHPQ 4GOPA 1PFSA 1VQAA 1VQBA 5C0XI 4YY3Q 4DV6L 4L5RC 2IT1A 5IYBG 1VS0A 4A3KH 3KFUA 1PH1A 1K73C 1KAWA 2DGYA 1LTLA 4A3JG 4HIDA 3RZDH 2VW9A 5GAEC 1YIJA 1J5EQ 4JI0L 4LUOA 4DAMA 3I55A 3KJOA 4YWLA 2F4VL 1HZCA 3K81C 4BA2I 3D31A 2WAQG 5IYBH 4WJ3M 1G6PA 2E5LQ 2MO1A 1E22A 3AFQA 1N34Q 4A3JH 1D7QA 1L1OA 1KRTA 4B3TQ 1X3FA 1HNZQ 4JI2L 1FL0A 3J81c 2JA8G 3NEMA 5IWAQ 2LXKA 4P71A 1WCMG 2RHSB 1X55A 4JI5Q 2PQAA 4O2DA 2WB1E 1EOVA 4IPCA 2OCEA 1PV4A 1IBKL 3FKIH 2JA8H 4BY1G 4JBKA 3DLLA 1DGSA 4TVAB 2YTVA 2NVYH 3TQYA 3A5ZB 1W3SA 2K5NA 4IJLA 5LMNL 1GO3E 4R1JA 5AJ3Q 2B29A 5M3FG 4HJ8A 1L1OC 1HNXQ 1S3OA 3W1BA 2OWOA 4LF6Q 1B7YB 4KI0A 4DV2L 4BY1H 2OTLA 4YCUA 1YJWA 1WFQA 4Y52H 5IY0A 4B3SL 3CCQA 1CSQA 1QVFA 4YHHL 4IFDI 1JJCB 3H0GG 2VQFQ 4UP9A 3HOUG 3JAMc 3RN5A 3AFPA 4DK3C 5M3FH 4JI6L 3PF4A 4DR7L 4GKJL 4DV1L 4QL5A 2AWOA 3G48A 1CKNB 4DV3Q 1V1QA 1E3PA 5IWAL 3ERSX 1YJ9A 4JYAQ 1S40A 4GN4B 4DR4L 2IY5B 4JI5L 2CWAA 3H3VH 1H95A 3HOUH 3CCJA 3F2BA 4GLXA 1LYLA 3E9HA 4GOPB 2H5XA 4DV7L 4B3RL 4JOIC 1E1OA 1YEZA 2LXJA 1Y1VG 1K8GA 2CCZA 5LMUQ 2XTIA 4APVA 4POGA 4DV5Q 4PZ7A 4IOAA 3PUZA 3L0OA 4LF5L 4LF4L 3K0XA 2D0PA 4Y7NH 4WJ4A 1Y1VH 1XPOA 2K50A 2VNUD 1EUJA 3AYHB 1TWGH 4BBSG 1Z9FA 4UP7A 4IO9A 1XNRQ 3UDIA 3RN2A 1PH4A 1RL2A 3M9BA 2UUAL 1VQKA 1X3EA 4DV3L 3PUWA 1JE5A 4R4QA 4UP8A 2BA1A 3LGJA 4DPGA 4HIKA 4AQYQ 1L0WA 2UXDQ 4X6AH 4UY8C 1VQ6A 3GTOH 2YYZA 3MXNB 4BBSH 3I4MG 2K5HA 3SGIA 3TREA 2QEXA 2Y0SG 4NXML 1TWFH 3S17H 2N8NA 3K8AA 1HR0W 2BA0A 2ATWA 1IZ6A 4LWCA 4LFCL 2HHHL 2PNHA 3S2HH 4JG2A 3CCEA 3CAMA 2BH8A 4JV5L 2VZAA 1MJEA 3I4MH 2UXCQ 1G291 3L7ZC 1VQDA 4A3IG 2R7ZG 5GQOA 1ASYA 3M3YH 1M90C 4C3IH 1VQIA 2K14A 4DR3Q 3M4OH 4X64Q 2FXQA 4DR6L 3S2DH 3K80C 4A3IH 1FJGQ 2R7ZH 4OXPA 3S1MH 4LF9L 1IBLL 1IYJB 4LF8Q 1I6HH 2DUDA 1BVSA 4LFBQ 1Z47A 2F3IA 3GTPH 3IRBA 3CCSA 1X65A 1PH6A 4JI4Q 1WYDA 4LNQA 2YTYA 4JI3Q 2CQOA 1K8AC 2YV5A 1HH2P 3J81j 3OTOQ 4LFAL 1YVCA 1VQ9A 2B63G 2I5HA 2WAQE 4DR1Q 2Q2UA 3CD6A 4NB3A 2Q2IA 2R92G 1I50H 1PA6A 4OX9L 5IE8A 1VQLA 2MQHA 2OQKA 1PH9A 2R7DA 2GVBA 1VQ7A 4YCWA 3HFZB 4GN5A
chains in the Genus database with same CATH superfamily
4MTNA 4X3KA 2B63H 3M85A 4RHSA 1JT8A 1MSHA 5TSSA 1HZAA 1YZ6A 2I46A 4X66Q 1DM0B 1V1PB 3I4OA 5M5XB 1Y1WG 3UDXA 4DA2A 5C0XJ 3PF5A 4JI3L 1P16A 1II3A 2B2VA 3KDFA 3EN2A 1SNCA 1GUSA 2HQEA 2IHEA 2UU9L 4X62L 3HOZH 1ILPA 4A3EG 1K3RA 3D4DA 3NQIA 3H3VI 5M3MG 1VQHA 2B2WA 1LT4D 1EU4A 2IJ0A 2Z6KC 1XMOQ 2QCPX 3HG9A 1HPCA 2F0PA 1I5FA 1VQNA 3S1QB 2EOTA 1WI5A 2F3VA 1ASZA 3S15H 1EIHA 4YY3L 2JA6B 4A3CH 3D6CA 4HJ5A 5I6YA 5ELCA 4DK1A 2GN5A 1OO9B 1ICWA 2WAQB 5E7NA 3FEWX 2Q8RE 2N78A 1CZGA 1CKOA 1MD2D 3NWSA 1G6ZA 3QIAA 5BN3A 1M4VA 1ET6A 1SBBB 4KJNA 4IFDJ 3W5OA 1HFGA 1LTSD 3VR5A 1ILQA 2QEJC 4DXFA 3QOLA 3DWQA 3PO2G 5M5YH 2DJGC 4O0AA 5G3LD 1VQ5A 3NWTA 3CKIB 1JWUD 1HNXL 3B6YA 2EY5A 5ELEA 1UAPA 4XYQA 4PZ8A 3EROA 2VQFL 5DAUA 1TR5A 1GUNA 3L9AX 2VS1A 5FO7B 2OTJA 4IUPA 4A3FB 1SFOH 1I94Q 3MEHA 4DAYA 4JYAL 2K5QA 3H6MA 1KD1C 1AP0A 2G9DA 1N8RC 3OIQA 2VB2X 2K75A 3X3NA 3IL8A 2EQSA 1SNDA 3G71A 5IT9c 4FXDA 3NENA 1SYDA 3LNNA 3GTLH 3C1EA 2LFNA 2ASBA 1QVCA 1LT3D 3U58A 3W1GA 2EIFA 5BR8Q 1B9NA 1GUGA 4C56C 1YHBA 4P73A 1EFID 4YWMA 1IW7C 4DK6C 2KCMA 4DV4Q 5IT9E 4JI7Q 4IJHA 2NYZD 3GP7A 1SROA 3O13A 1QOHA 2VL6A 4QIWB 3RMHA 1VF5C 1EIFA 2F0TA 4HMIA 1WTOA 2JE6I 1RCVD 2B8GA 4J15A 4JC0A 4NXNQ 2KENA 1B70B 3PUXA 2KEDA 2DJFC 5C4HA 3C2PA 2KECA 2UUCQ 1F77A 4C3JB 3EA6A 2QA4A 4GKKL 1H9RA 2HIVA 5CC4A 3GTGH 3A5UA 4GLVB 4X64L 5CV7A 3VR3A 2JEBI 3GDEA 2JSOA 3RNUA 1FJGL 2CFMA 4JI0Q 1I50B 1PFBA 2ID0A 1OXSC 4OIJA 4A3DH 1BUVT 4LFBL 3AEVA 4R4IA 3L2PA 3FPPA 1SYFA 5FJ8H 3RZOB 3H09A 3SDZA 3QR8A 4F88A 1VQEA 3NXWA 4JW0A 5FLMH 4A3KB 5IGCA 1IBKQ 5JJIA 1SEBD 3DEPA 4QQBX 3UE0A 2WKCA 3HOYG 3OIPA 4HAEA 4ZKBB 2ICEC 4A3JB 1UEBA 4OL7A 4ZUIA 4DV2Q 1S5CD 4AIMA 1UE5A 1HA5A 1TS4A 4RKBA 2JA7H 2V1CC 4JI6Q 3U4ZA 4BBRB 4XIGS 2L1BA 3MZ5A 3PO3G 1A2UA 2ZJPA 1ZYRD 4TRDA 3I70A 1S5DD 2K52A 2LKVA 4DV7Q 4KV6A 4XT3B 2A68C 1WCMH 1AEXA 4PQXA 1LUZA 2HQLA 2FFKB 1CUKA 1QNKA 2WKDA 2E2DC 2NTTA 2Z1CA 3IFDA 4L5QA 5C0XH 3J7A5 2HUGA 3HKZE 5G3LF 1A3TA 1EYCA 2B2UC 4KLKA 5CBAE 3HOUB 4GN3B 2Z4HA 3I2ZA 3I72A 4X3TA 3G6EA 3H0GH 1UE1A 1AW7A 2R93H 2XVSA 4XDXA 3E6ZX 3KYHC 1KIXA 4BA1I 2EJGC 2NVQB 1KDBA 3OW7A 1GOZA 1HUNA 4K8JA 2G5DA 4I65A 1HTLD 4LUZA 3CCVA 2AUJD 3QB3A 3T1YL 1KLGD 1C8CA 1RKNA 4A3MG 2EYLA 1HQRD 3A0JA 2KHSA 1F9SA 2Z4IA 1PXUA 1PH2A 3V96A 2F0SA 2VUMB 4DR5L 4LF9Q 1BF4A 4IFDH 3CC2A 1I4XA 1Q86C 4C3HH 1CTMA 1K8MA 3A8IE 1TS3A 3ONAB 5ELFA 1SNMA 1CKMA 1EQQA 2PMZB 2Y0SB 2PI2E 2RF4A 3HOWH 2CW0C 3N6RA 3HOVG 2X6GA 4OGQC 5BN4A 4KK7A 2F0FA 3SEBA 1STEA 1MSGA 1EY5A 4EQOA 1STAA 5JPNC 5GAHC 3ZJYC 2O5IC 1RTNA 4PG3A 4YCVA 3SXHA 3T56B 4OONA 4BXXH 4JCVE 3QWNA 3S14H 3RLNA 2F3WA 3FRPB 2R3ZA 4HSVA 3VR2A 3ULLA 3I4NH 1EY4A 3K7AB 2IPKD 2KEEA 2Z0SA 2YU9H 2XWBB 2F4VQ 1KHIA 3OYYA 2UU9Q 4X62Q 2D9UA 5ISRA 3R2IA 2R92B 2EYHA 3J7AF 1MHWC 2XWJB 1MIUA 3T1HL 1W2BA 3EIVA 4MZ9A 1WJJA 2LSSA 1K28A 1PFSA 5JVG3 3E3XA 4YY3Q 3KFUA 2BOSA 4ID6A 1LTLA 2G9HD 5CV5A 1YIJA 1GUWA 1Y1WB 2J7ZA 1O78A 4BA2I 1G6PA 3HGBA 2WAQG 2PNRC 5ELBA 4ZRZA 1D7QA 1L1OA 4A3EB 4JI2L 2E2JB 4HCEA 5M3MB 3NEMA 1F9QA 2PPBC 5C4XB 2WB1E 3VYSA 4IPCA 1L0XB 1EL0A 1DGSA 3I3CA 4GZYC 4EQPA 2NVYH 3TQYA 2SDFA 1ZXTA 4HJ8A 5LMNL 4R1JA 1PTOF 1HNXQ 4LNQA 5C44B 3QO2A 1B7YB 2NUCA 3KK7A 2F0MA 3H91A 2VQFQ 3ND8A 4UP9A 3AFPA 4DK3C 5M3FH 5EGTA 5IT9L 4DV1L 2AWOA 1DOKA 1CKNB 3G48A 4CKBA 1JQYD 2F0DA 2TMPA 1BCPF 4JYAQ 1QCBD 4GN4B 2B39A 1STNA 4DR4L 5M9OA 4V190 2L55A 4J8QA 5C3XA 4B3RL 2H5XA 1YEZA 1Y8OB 3PO2B 5I4DA 4IOAA 1F2MA 1O7YA 1H9SA 2AUKA 4Y7NH 4WJ4A 2CHBD 3MTSA 2K50A 5EKKA 2VNUD 1TWGH 4R9WA 4UP7A 3RN2A 2EPBA 3DMUA 3W3AA 1X3EA 4DV3L 3PUWA 1JE5A 2BA1A 1GUTA 4A3GB 3TREA 4M1UB 1QNUA 3SGIA 4NXML 2N8NA 2E75C 2ATWA 5JVH3 1IZ6A 5JOBA 4LFCL 2PNHA 3A54A 3CAMA 2ZXOA 2VZAA 1MJEA 3I4MH 1X3QA 2Z9HA 3OOCA 3KF8A 1ASYA 3M3YH 1B2TA 4C1NI 4X64Q 2FXQA 1NSNS 4DR6L 1PTOC 1LO5D 1NCVA 1FJGQ 2MHVA 4A93B 1SYEA 4LFBQ 1Z47A 2K7VA 3GTPH 1A3UA 4HTHA 5IGDA 4CBVA 1HH2P 4LFAL 2I5HA 2K28A 3R8BA 3CD6A 2A5HA 5IE8A 2OQKA 1VQLA 2R7DA 1VQ7A 4YCWA 3V2TA 3EVQA 2EYJA 4P2CB 1SYBA 5D65A 5A2QE 4PMBA 4G7ZC 1TY2A 2CVRA 2E74C 2NVTB 3HS0C 2Z6KA 2KOLA 4A75A 3A74A 1A0IA 3AB9A 3S1RH 4K6LA 2RKSA 5FKAC 1VQCA 4DV0Q 1EZ6A 2OQ0A 1TXYA 2AHOB 5FK9C 3NBHB 4JI1L 4BBRG 2RDHA 1K9MC 2A19A 5CV6A 2VQEL 1SNOA 2PCFB 2ZM6L 1Z7TA 4BY7H 3KF6B 1NMFA 1AH9A 1PRTF 1EWIA 1TWAH 1PFNA 4JBMA 2EXZA 3BVZA 5IGEA 1VMPA 1NR2A 2L0CA 2E2HH 4V0BA 3HOYH 1A8VA 2QF7A 3CCMA 1SMYD 1B4OA 2FJ2A 2TSSA 4JOIA 5EKLA 1VDZA 2E5LL 1NNXA 4GNXC 3MEFA 1Q8KA 4B3TL 4A3LG 2KQ3A 1J8IA 1FYCA 1U4RA 5IYCG 1XWEA 2BE5D 3SVMA 3PO3H 2OEOA 3S16B 4BY1B 5CORA 2PMZE 2Y0SE 5HY6A 4B3MQ 1Y69U 4KJOA 3OPOA 3PSIA 1IXRA 5AJ3L 3E9IA 4DN4M 2NB0A 3KDFB 1DYQA 1MGSA 2AQ3B 2PZWA 4DR5Q 5LMNW 3PGZA 2VUMG 1S5ED 1VCIA 2B3GA 4YIJA 5FO8B 1JOKA 1SDFA 2BDNA 1QWYA 2PQAB 1SNQA 4QB4A 1DOMA 1VQOA 1Y1VB 2JK8A 1U4MA 4OO1H 2F0JA 4QCLA 2Q8TA 1N9WA 4KN4C 4R4OA 2JA5H 4ODGA 5LMUL 2XGTA 3UE1A 1AE2A 1GHJA 4DV5L 2A8VA 4A3MB 3S1NB 1PRTC 3CRKC 2CKZB 5JEAJ 5FLXL 5K36G 2F0IA 1DZ1A 3TP6A 2EDGA 2XRSD 4IUUA 5DLQE 4DAVA 1TWFB 2CH4A 4CDFC 1ENCA 1KC8C 5IYDG 1PYWD 4FXKC 1PLFA 2Q2TA 3RLOA 4L8JA 3I56A 1D1IA 3ITPA 2J0TD 4RCOA 1IBML 2PW5A 1HHVA 2QGQA 3I90A 1EQVA 1HUMA 1EYDA 3HOVB 3P1HA 4XXEA 1SMXA 4IPGA 4NDXA 1F2YA 3T1HQ 4AH6A 4XQNA 3UI2A 2JJQA 3OWEB 4ME5A 5KEEA 2B2TC 2E2IB 5JJLA 2JQOA 1X6OA 3GTMH 3CQZB 4DR3L 1HJPA 1TWCH 4ZYSA 2EE1A 2NZ1D 2IX3A 1UWVA 2C35B 3A55A 2K03A 2C9OA 3X3MA 2A6EC 2FINB 2O4XA 1YHAA 4JI4L 3DWPA 1O7IA 1JOQA 5HURA 2F0GA 3TEHB 5M5XH 1CA6A 2F4IA 4JI2Q 2N49A 1TIID 4DR1L 1ICFB 1XXGA 3T4AC 2KUMA 2D62A 2M9VA 2PQEA 4RFBA 1SJED 5EPJA 1C7YA 2KCNA 5J39A 1PH7A 1OTCA 5C4XG 3RZDB 2A6HD 1IYVA 4DUYL 2QILA 1YNJD 1RTOA 4P75A 1NE3A 4XT1B 2KHIA 1PH5A 5LMNQ 1V9PA 4OIKA 5IP9G 1MBYA 1VQPA 3TRZA 1X32A 3HP3A 1Q12A 4TQUS 3STBC 5C44G 4DUZL 3S1QH 2AQ1B 2WACA 2JA6H 3CMEA 1CHPD 4RKLA 4FF3A 4DV1Q 1G2SA 2XNAC 4A4IA 1GJXA 2F0LA 4DR4Q 4MNOA 2B2UA 1BDOA 2NN6H 5ELNA 2K33A 4B3RQ 3KLRA 1EY9A 1X56A 1EFWA 1HQMC 2A69C 5C3EH 4FP5D 4CJ0B 1T9HA 1CQFA 2D0OA 5EJWA 2B2YC 4QUFA 3HOXH 1GXDC 1R4QB 2M2LA 3E0JA 2MGSA 1HR0L 5DEHA 3K58A 2I5MX 1BO0A 3U4VA 1B3AA 5M5YB 1N32L 2F0EA 5GROA 4X6AH 4NXMQ 2DNCA 1F2ZA 4NMZA 4A3GG 2N3SA 1ESRA 4LFCQ 3M4PA 4A3FH 3IFTA 5A35A 2L9HA 3CC7A 4F8MA 2EYMA 2KCTA 1JCKB 5A2QL 4DR6Q 1MI2A 2XIWA 4Q0FA 2JA9A 5CMDA 3S17B 5J3BA 3K7UC 2JEAI 4A93G 2PI2A 3MA2B 2WFWA 4JK1C 3GTLB 1KRSA 2HIXA 5CYUA 4LFAQ 1QG7A 2X69A 3BJUA 3C46A 1QILA 2L4NA 3M4OB 1EQRA 1EEFD 3TP7A 2Q8IB 1G91A 1XX8A 3J81i 2F1MA 4FNFA 1I6HB 5T1GA 2UUBL 3CMAA 1CM9A 1EWHA 1TKWB 4C3JH 3TS0A 4POFA 1NMGA 1A6XA 2ZT9C 3DXJC 4EQ5A 1SLJA 5E1FA 4ZAIA 2VY3A 3M7NA 4JI1Q 3SK5A 1IL2A 5D3IB 3CXCA 5JEAH 1BBUA 2VQEQ 1PTOH 1UNSA 2ZM6Q 4QMGA 1X3PA 4RHRA 2O5JC 2R7FA 4GOPA 1VQAA 1FNUA 1VQBA 3KBXA 1V8QA 5C0XI 3BS1A 3QJYA 4L5RC 2IT1A 5IYBG 1VS0A 4A3KH 3JAML 1K73C 2DGYA 5KNCA 1EY6A 2PW7A 4HIDA 3I55A 3KJOA 4YWLA 4RGNA 1HZCA 4ZLTF 1BQQT 2E5LQ 4A3JH 4B3TQ 2JA8G 3J81c 3IAYA 5IWAQ 1X55A 4JI5Q 1SSOA 1EOVA 2F0UA 1PV4A 1IHZA 4BY1G 4TVAB 4E6IA 2YTVA 1KAAA 1D6EC 3A5ZB 3J81E 2K32A 1EY8A 3K5MA 1K0SA 2K5NA 4IJLA 1GO3E 5AJ3Q 2B29A 2OWOA 4KI0A 4YCUA 3BYTB 4QF4A 4Y52H 4B3SL 1O80A 1BR9A 1KTKA 3D4WA 4IFDI 4JVZA 1RJTA 3RN5A 4GKJL 1TS2A 1WTRA 5IGBA 1E3PA 3ERSX 1S40A 5CBEE 2CWAA 1H95A 1H9JA 5EBCA 3HOUH 3GTQB 3MC0B 3MXPA 4GLXA 1LYLA 1Y1VG 2CCZA 5LMUQ 1KNAA 3GTJB 4DV5Q 4PZ7A 4IN3A 3K0XA 3V05A 2R93B 5I9PA 1XPOA 2A6HC 1EUJA 3AYHB 4BBSG 1Z9FA 5DM63 1YNJC 3UDIA 3PQIA 2A74C 1LLRD 3M9BA 1VQKA 2NVXB 3GV6A 1J9OA 4UP8A 4ZUJA 4DPGA 4HIKA 1VQ6A 3GTOH 2YYZA 1PDQA 5I9OA 5EPKA 1QE6A 3DWAA 4IUVA 3K8AA 1HR0W 5M5WB 4LWCA 2HHHL 4JG2A 3CCEA 3WDNA 1U4LA 4JV5L 4FXGC 2Z6BA 5CR3A 3TDQA 3NTHA 4A3IG 2R7ZG 1JICA 2NWGA 4WRDA 4C3HB 1I4GA 4C3IH 1VQIA 4N8FA 3TP8A 4DR3Q 1CQVA 3S2DH 4FF1A 3HOWB 2DNEA 3BG3A 4OXPA 1IBLL 1EOTA 1BVSA 1PH6A 4JI4Q 1WYDA 1PZID 2YTYA 4JI3Q 3AMUA 2ENBA 2B63G 1TT2A 2WAQE 4DR1Q 2Q2IA 1PA6A 4OX9L 4DNTB 2WV6D 3VR4A 1RF2D 1H9SB 4GN5A 3I4NB 1KDCA 2HDLA 2D5DA 4DUYQ 2R92H 4G4KA 4LAAA 2EYFA 2JN4A 1Q8IA 1JWMD 1SE4A 1LTAD 3KJPA 4DR2L 3ICEA 3ULJA 2XRQD 2LY7A 4KTAA 3ER0A 2F52A 2EZVA 4N8X1 3SE0A 4AYBG 3MWYW 3SK4A 3HOZG 4DUZQ 3RR5A 2IW3A 4A3BB 3DHQA 3HEJA 3G4SA 2L11A 2R61A 4B9WA 2EY6A 1JB3A 5E3FA 1UUPA 5KGUA 4LJZC 1Y1WH 1L0YB 1U9RA 4QY7A 2IL8A 1F9PA 2K04A 3FPUB 4O42A 1QUQA 1L2FA 3RD4A 4A3EH 2E2JH 4GNXA 1AFPA 2WIIB 5M3MH 1K83B 1QJOA 3H3VC 4IALA 1J5EL 3H15A 5JJKA 4HCSA 5D14A 2RVLA 3TP5A 3VDYA 1N34L 1HR0Q 3ERQA 4L5SA 1HNZL 1N32Q 1DXMA 2NVYB 3K59A 1X3GA 3K6OA 4RG1A 4QIWE 5HGTA 3WOEA 1CZWA 5I6WA 1EU3A 1ZEQX 2EJFC 4DNIA 5M3FB 4KHZA 1DOLA 3ND9A 2ZJQA 4H7BA 3T51B 1A15A 2MP1A 3GO5A 3PO2H 3ZYYX 2SOBA 1PH3A 1PZJD 2H1EA 4L5TA 4WJWA 1S4ZA 1U0LA 1Q3LA 3BDOA 3CF5A 1O7ZA 5D3DA 3UDGA 5CV4A 1TWGB 1YHQA 1DJRD 1Q7YC 3KLWA 5EQ0A 1K0RA 1ZYRC 2UUBQ 2QW7A 4PV1C 4GKKQ 4FDBA 1VQ8A 4K8IA 1HTPA 1XPRA 1SRUA 2QDLA 1XNRL 1FGBD 1V1OA 1Q90A 2LMCB 3KUPA 5C4JB 1BBWA 1TU2B 2B2TA 1I4HA 4S3SA 3PUVA 4KD3A 2BH2A 1I3QB 4AQYL 2SNSA 3RLFA 4CHTB 4HJ7A 1EY7A 5DM73 3BZKA 2EY2A 4IOCA 5IGGA 3S24A 1OXXK 1YNND 4ME3A 4ABNA 3DM1A 3NK9A 3TBIB 2RSNA 2F0VA 4CKCA 5LHY1 4A3DG 2DN8A 5EAYA 1VQMA 1JJ2A 3NSWA 3MXGA 4ALPA 1D2BA 3KBGA 3MVVA 4O1NA 3GTKB 4XYOA 3J81L 1SR3A 2AWNA 2R6GA 3E0EA 5J1ZA 4C2MB 1YJNA 2HT1A 4LK1C 1T5XD 5FJ8G 2NVTH 2MO0A 4DAPA 5FLMG 2WP8J 3SK6A 1EEID 4P72A 4FF2A 2K5WA 1RIPA 3EBEA 1GKHA 1PFMA 1MJCA 2JA7G 1SNPA 4RGOS 4DKAC 4K0KL 1UE7A 3L3OC 2L15A 2ES2A 3URYA 1N33L 1STYA 3BZDB 4B3SQ 4DU9A 1GVPA 3HKSA 1LV9A 1IYUA 5IGFA 4GKJQ 1GM5A 3FKIB 2OF1A 2JA8B 2B2YA 1FGUA 1U4PA 1VQJA 1TWHH 1XTCD 4OO1I 1WTQA 5C0XG 2OT2A 3BZCA 4CKEA 1IW7D 3NTIA 2KA7A 1S72A 2HCIA 3F1ZA 1B50A 1CA5A 3CPWA 1EIGA 3T1YQ 3S16H 4FO2A 2IHFA 1Y14B 3H94A 4RAUC 3E5SA 2R93G 4DF7A 1T5EA 1HFNA 2HDMA 1CFMA 4OWXB 3TMEA 3I7FA 4RMFA 1XNQL 2FMMA 4IZ8A 1M8AA 1GHKA 2AMCB 4ULLA 1RODA 1KXLA 1P8LA 4X65L 1SAPA 5ELOA 3AQQA 4IPHA 2MFIA 1HZBA 3R2TA 1A62A 3FP9A 2DY7A 5FOBB 2RCNA 5CV9A 1QZHA 2HHHQ 4DK0A 2UXBL 1GD7A 3DUZA 1IKMA 4JV5Q 4KKUA 1RD9D 1C48A 2CH4W 3D8GA 3RUZA 1JB7A 2X6LA 1UE6A 3CCRA 3NTKA 1STHA 3PUYA 1KABA 3EFXD 1CI3M 1I4QA 4IFDG 3PV0A 5LL6S 4C3HG 3CPFA 1S5FD 3Q6SA 4BBSB 1PYSB 4A3MH 4RCNA 1IBLQ 3S1NH 3HOWG 4KY6A 4MN3A 5LL6X 3VYUA 3S2HB 4LF7L 3Q0AA 1R9TH 3CP0A 3U50C 2XN9C 2J4XA 5I2YA 3NBHA 1ESFA 3GV3A 4K5WA 1LACA 1I4RA 4OX9Q 1D8LA 4BXXG 2KCCA 2KHJA 1VQFA 3BVGA 3F2DA 4A3IB 2R7ZB 3S1MB 3KF6A 3I4NG 3HOVH 1XTDA 1EWCA 2PZTA 2IX0A 4JI8L 4DR2Q 1PH8A 1CK1A 1QB5D 5L37A 1QZGA 1BBXC 3K5OA 2KJXA 1AE3A 1SN8A 2E2IH 4BS9A 5KRUA 1KQSA 3CQZH 1M1KC 4DAYB 1J6QA 3UDFA 4A3BG 4R8NA 2PYKA 3CCLA 1N36L 2B63B 3GTMB 1HRJA 2ALYB 2NN6I 2SNMA 3CC4A 1CSPA 1RDPD 3FVQA 3GD7A 3WOFA 5IP7G 1H9KA 3G7LA 4FYDA 3PCOB 4YWKA 3A7AB 4OWTB 4PMCA 1BKBA 4OEMB 4DV6L 1KAWA 3I8ZA 5IODA 3FDTA 1FR3A 1G8ZD 3RZDH 2VW9A 1J5EQ 4AYBB 3HOZB 4LUOA 4DAMA 2F4VL 3D31A 3VA5A 3OWFA 3AFQA 1E22A 1N34Q 2EJMA 3BDCA 4KHVA 1X3FA 3OMGA 1HNZQ 1TY0A 1SYGA 3S15B 1E2ZA 3W2DA 2RHSB 1PZKD 1SE3A 2BDOA 2EVBA 3TZDA 3MXNA 2PQAA 3DEOA 2OCEA 1JC7A 2NBFA 3OMCA 3DLLA 4K2KA 4OHJA 1JOOA 4CJ2C 4UDUC 2Z8LA 3MAQA 5M3FG 1BOSA 1YNNC 3M7GA 3W1BA 4M8AA 1EQTA 2OTLA 1YJWA 1WFQA 2CW0D 3C3LA 1CSQA 1QVFA 4YHHL 1JJCB 3MXUA 4RWSC 4DR7L 3VYTA 4C1NK 2KVMA 1S5BD 4DV3Q 5C3EB 4K2LA 1YJ9A 1JORA 1SE2A 4KN7C 4R8IA 2IY5B 2K5DA 3H3VH 3K5LA 4DFAA 3F2BA 1Z6HA 5KIXA 3OHXC 4GOPB 1LTTD 1E1OA 4JOIC 3HOXB 2LXJA 3NQTA 2XTIA 2RCFA 4WFN3 1EYAA 3KLSX 4LF5L 3L0OA 4LF4L 1VMCA 2D0PA 2C5CA 3TZUA 2F03A 1SFOB 4IO9A 1XNRQ 1SXTA 1PH4A 1RL2A 4IUNA 2UUAL 5F2DA 1V1PA 2WB1B 3LGJA 1LTID 4AQYQ 1L0WA 3MHBA 4UY8C 3I4MG 2V4DA 2EYOA 1SMYC 3S17H 3LWUA 3C1FA 2BA0A 3A8JE 3T13A 4JPBW 4IURA 2BH8A 3AU7A 4XQQA 5AFWA 3NUCA 2BE5C 1M90C 4FF4A 2K14A 3M4OH 3NBIA 1NR4A 2K05A 1FNVA 1I6HH 2RQXA 3CCSA 3CU7A 1X65A 4J6HA 2CQOA 4NW2A 1IKLA 4U68A 4ZQ3A 5C5MA 1YVCA 1VQ9A 2PO4A 2SEBD 2Q2UA 2JP1A 4NB3A 1ET9A 3I91A 1I50H 3GTGB 1LT5D 2M00A 1H9MA 2OXPA 3Q8DA 3D0FA 1HNWL 4A3DB 1XMQL 3RZOH 1C4QA 4K0KQ 4P74A 3QG1A 2IX1A 4ILWA 1N33Q 3J80i 3S9WA 1OXVA 1V43A 2MPMA 5GAGC 1PTOB 1TQOA 1EYGA 1VQGA 3A8KE 1B53A 1NJIC 2MJ8A 1EY0A 4BY7G 3TN2A 4BWGB 4EX5A 4DXGA 3FKIG 4OWWB 5H1SE 1LABA 2ZTDA 3ULPA 1BCPB 1I6VC 4R4TA 4BBRH 2ZJRA 3J7AV 3J7ZC 4KHPL 1MKHA 2B2VC 2JA7B 4HIOA 2I0QA 1TVXA 2AQ2B 1KLUD 4MIUA 4DV0L 1E7ZA 4CGYB 2B2WC 3BU2A 3CCUA 1YI2A 1XNQQ 4UHVA 2JXMB 4HJ9A 1E24A 4IUQA 3BVMA 3GQBA 4HJAA 3T16A 4N9PA 3KOJA 2XSCA 1WCMB 2I5LX 4X65Q 1WVLA 1WTVA 4LW1A 1WOCA 4A76A 1ML0D 1PTOD 2I07B 3I4LA 4A3LH 2UXBQ 1ENAA 5IYCH 1LT6D 2RA4A 3JC66 4EQNA 3U9SA 5EBDA 5GADC 3J80c 1R4PB 3FHWA 1JWSD 3GTQH 2NVQH 2ZXRA 4LF6L 2F0QA 4H02A 1WTXA 3GTJH 1LTRD 3H0GB 4B08A 1BCPD 4IPDA 1ZKOA 1F9RA 3HRZC 1L1OB 3D6WA 1B44D 3J80E 3R3OA 4I7AA 3I73A 1Q82C 4OO1G 1NUCA 4LF7Q 1HZ9A 2JA5G 4LMQD 1QUQB 1KDAA 1A2TA 1YNXA 4GNXB 1IBMQ 4MTKA 2NVXH 4QGUA 2VUMH 5I2XA 4HR7B 4PNYA 4B3ML 3F2CA 1PHJA 2K6AA 4I7ZC 5C4ZA 1E0BA 1O7LA 3HKZG 5M5WH 4JI8Q 3GTOB 4KMUC 5KYIA 3EJIA 1KL9A 2AKWB 3SK8A 2ICIA 2ZXPA 5K36H 2UXDL 3FMCA 2NZHA 4GS3A 4AYBE 2IWHA 1B8AA 1WTHA 4KKTA 1N36Q 2GVAA 1HXYD 5IYDH 4C3IB 1X54A 4RA8A 3K7AH 2K1BA 3CW2C 4H44C 2NZOA 3S2DB 2UXCL 5ELDA 4Q5VA 5DNFA 3S14B 2ZTEA 3QOJA 5FO9B 2NTSA 1XPUA 4R4CA 1GUOA 3NP8A 4F7XA 1Q81C 5E4XA 4CDDC 1YBYA 1Q46A 2YU9B 4DV6Q 1BNZA 1PRTB 2K4KA 4QJFA 4LF8L 3OW2A 5FLXc 5E4WC 5J22A 4G57A 1HA6A 4ZCKA 4IQZA 4WORA 1U5KA 3OTOL 1VF7A 3P20A 3NPPA 1AZPA 4A3BH 1E2WA 5EPLA 1C0AA 2E8GA 5FLXE 2A1AA 4UPAA 1B1ZA 4HN7A 4A3CG 1E1TA 3PIOA 3KF8B 1HCZA 5T1IA 5IP7H 2A73B 1CT1D 2CQAA 4EVOA 2JA6G 4X66L 1OXUA 4XQJA 5C4XH 1JR0D 2O2LD 1A63A 1Q1EA 2HD3A 1K83H 3SHLA 4XTCS 1YITA 4YHHQ 4DR7Q 2NN6G 5IP9H 2RHQB 4GOPC 5C44H 3EQLC 1SE8A 1PRTD 2B8FA 5C3EG 4IUTA 1QVGA 3TSSA 4EGVA 1ONLA 1B3QA 1TS5A 1VQ4A 1DONA 3MFYA 1XJVA 2ZTCA 1LTGD 2KBNA 3PIO3 1XMOL 2QDBA 3F2UA 3T53B 1WTWA 3U9OA 3HOXG 3Q24A 4ZKCB 2DY8A 4UAIA 4LF5Q 4LF4Q 3K57A 4NP5A 1LTBD 4GLAC 4RGTA 4PMWA 4JBWA 4QUCA 1NTGA 2PZUA 2UUAQ 2HCCA 1D5XC 1NBWA 1JMCA 1E2VA 4OELB 4A3FG 2GA4B 2WB1G 4MHEA 4N9TA 2YTXA 3NHHA 1IL8A 1Y8PB 3M4QA 1PVOA 4F87A 1FVIA 4Y7NB 4NKLA 1DD2A 5KNDA 4KD4A 4NPSA 5CGKA 2A6ED 4LUVA 4A3GH 3A7LA 4Z9CB 3DM3A 3R93A 5JPMC 1K3BC 1PYBA 1Y8NB 2L5TA 2K5VA 5JJZA 2MNAA 4L63B 1C9OA 3Q22A 5CV8A 1JJGA 1G51A 4PZ6A 4K5VA 1I94L 3D4RA 3I4MB 1A3VA 5C4JH 3M4YA 3M3YB 2CWPA 1I3QH 4A93H 4CJ1B 3P7JA 4G7OC 3Q23A 3STBD 4C3JG 4HEDA 2D2CC 1DCZA 3OSOA 4K5XA 1HNWQ 3J7YW 1XMQQ 1D5ZC 3GTPB 5BR8L 1EIYB 1EZ8A 1NAPA 3CRLC 4H0LC 1LM0A 3NELA 1RHPA 1JE4A 4DV4L 1X9NA 1Q1BA 5HGQA 3PIPA 4JI7L 5JAVA 4X3SA 1WD0A 4JBJA 1D5MC 2F0OA 3TS2A 5JEAG 3VR6A 3GTKH 1BCPC 3WWVA 1B9MA 2A69D 2EXDA 2WINB 4C2MH 1NY4A 4NXNL 1SYCA 3JAMi 4HIMA 1CKNA 3MFGA 1FD7D 3F8TA 4A3KG 4RGMA 1OXTA 2UUCL 4TKOB 2Q2HA 4CDEC 4H13C 4TSSA 2VXWA 4RH6A 2QKIC 4KHPQ 3S1RB 5EKIA 1I4PA 1PH1A 4A3JG 2JYOA 5GAEC 3PIP3 4JI0L 3K81C 4WJ3M 5IYBH 3CHBD 3KLSA 2RBMA 2MO1A 1W6KA 3G6JB 1STGA 1PMRA 4BY7B 4KY5A 4DGZA 3SR1A 1KRTA 3A56A 1FL0A 3J80L 1KNEA 1TWAB 2LXKA 4P71A 2P5ZX 4CDCC 1WCMG 2E76C 4O2DA 5IOCA 2MUYA 3HZXA 1IBKL 2E2HB 3FKIH 4HSPA 2JA8H 4JBKA 3HOYB 1WTPA 3LX0A 1UEAB 1W3SA 2RDFA 1L1OC 4LF6Q 1S3OA 4BY1H 4DV2L 4HMJA 1TWHB 5IY0A 3CCQA 5KNBA 1D1KA 3H0GG 1XYIA 3HOUG 3JAMc 3PO3B 4JI6L 3PF4A 3LWEA 4QL5A 4DNRB 2K01A 3BYYB 1V1QA 4K14A 5IWAL 5BN5A 4JI5L 1AN8A 2N88A 3CCJA 2N55A 3K0YA 3E9HA 4DV7L 3JAME 2H4OA 5COYA 1K8GA 2BCOA 4APVA 4POGA 2LS01 1CHQD 4KY7A 3PUZA 1STBA 2F0KA 5NUCA 1Y1VH 2L12A 4FVMA 2FMCA 1W6JA 5IIFA 1WD1A 4X3UA 2F0WA 5KYLA 4R4QA 2UXDQ 5C6AA 4BBSH 2JA5B 1FNWA 3MXNB 2VB3X 2RSOA 2K5HA 2QEXA 2RDGA 2Y0SG 1TWFH 3NE5B 3IKJA 2EY1A 4C3IG 3S2HH 4K6DA 2UXCQ 5C3WA 4B9XA 1G291 3L7ZC 5K5PA 1VQDA 3HKZB 5GQOA 5C5LA 1K8OA 3K5NA 1SJHD 4G7HC 1R9TB 3PMFA 2F0HA 3K80C 4ZK9B 4A3IH 2R7ZH 3S1MH 3VA7A 4LF9L 4LF8Q 1IYJB 2FHTA 3P75A 2DUDA 2F3IA 1ENFA 1F2LA 3IRBA 4L6TB 1AZQA 3N52A 1K8AC 2YV5A 3VYRA 3D3RA 2EYPA 4KKSA 3J81j 4U673 3OTOQ 1BXTA 2A68D 3BDLA 2R92G 2F0NA 4J1MA 2MQHA 1G2TA 1PH9A 1TWCB 2GVBA 3HFZB
chains in the Genus database with same CATH topology
4MTNA 2B63H 3M85A 4DUYQ 3Q8DA 2R92H 1JT8A 3D0FA 1HZAA 1HNWL 1XMQL 1YZ6A 3RZOH 3KJPA 3ICEA 4DR2L 4X66Q 3ULJA 4K0KQ 4P74A 3ER0A 3I4OA 2F52A 2Z6KA 2IX1A 4A75A 1N33Q 3A74A 3J80i 4AYBG 1Y1WG 3HOZG 1A0IA 4DUZQ 3UDXA 3S1RH 1OXVA 1V43A 3RR5A 5GAGC 1VQCA 5C0XJ 3PF5A 4JI3L 1EYGA 3G4SA 1P16A 1VQGA 2OQ0A 3KDFA 4DV0Q 3EN2A 1TXYA 2AHOB 1NJIC 3NBHB 2IHEA 4JI1L 4X62L 2UU9L 4BY7G 1Y1WH 3HOZH 4A3EG 4BBRG 1K3RA 3H3VI 4EX5A 5M3MG 1VQHA 4OWWB 3FKIG 5H1SE 1K9MC 4QY7A 2ZTDA 2A19A 2VQEL 3ULPA 1QUQA 2Z6KC 1L2FA 2ZM6L 1XMOQ 4BY7H 3KF6B 1NMFA 4R4TA 4A3EH 4BBRH 4GNXA 2ZJRA 2E2JH 1AH9A 5M3MH 3J7ZC 1I5FA 1EWIA 1VQNA 1TWAH 4KHPL 1WI5A 1ASZA 4JBMA 1MKHA 3S15H 4YY3L 4A3CH 4HIOA 4HJ5A 2I0QA 2E2HH 1J5EL 2GN5A 3HOYH 1A8VA 5E7NA 3H15A 3CCMA 4DV0L 1E7ZA 5JJKA 3BU2A 4JOIA 3CCUA 2N78A 1YI2A 1CKOA 1XNQQ 2E5LL 3VDYA 1N34L 4HJ9A 1HR0Q 1E24A 4GNXC 3MEFA 1Q8KA 4HJAA 4B3TL 4L5SA 1HNZL 3KOJA 4A3LG 2I5LX 1N32Q 4X65Q 1X3GA 5IYCG 4IFDJ 3W5OA 3PO3H 4LW1A 1WOCA 4A76A 4RG1A 4QIWE 2PMZE 4A3LH 2Y0SE 2UXBQ 5HY6A 4B3MQ 5IYCH 3PO2G 4DNIA 5GADC 5M5YH 3JC66 3PSIA 4KHZA 3J80c 4O0AA 3GTQH 3FHWA 1IXRA 1VQ5A 2NVQH 5AJ3L 2ZJQA 1HNXL 3E9IA 4LF6L 3B6YA 4H02A 3KDFB 3GTJH 3GO5A 3PO2H 4PZ8A 4DR5Q 4IPDA 1PH3A 2VQFL 5LMNW 3PGZA 2VUMG 1VCIA 1L1OB 2B3GA 2VS1A 4L5TA 1Q82C 4OO1G 2OTJA 1I94Q 1SFOH 4LF7Q 1HZ9A 2JA5G 4JYAL 1U0LA 1QUQB 1YNXA 1KD1C 3CF5A 1N8RC 2PQAB 4GNXB 1IBMQ 2NVXH 4QGUA 2VUMH 1VQOA 2JK8A 2K75A 3UDGA 4B3ML 3F2CA 1N9WA 2EQSA 1YHQA 3G71A 4R4OA 5IT9c 1Q7YC 3NENA 1PHJA 3KLWA 5LMUL 2JA5H 2XGTA 3UE1A 1AE2A 4DV5L 3GTLH 1K0RA 2A8VA 3HKZG 2UUBQ 1QVCA 2ASBA 2CKZB 5JEAJ 5M5WH 4GKKQ 3U58A 5K36G 4JI8Q 4FDBA 2EIFA 3W1GA 5BR8Q 1VQ8A 1XPRA 1KL9A 5DLQE 1YHBA 1SRUA 4P73A 4YWMA 1XNRL 2AKWB 4DK6C 2KCMA 4DV4Q 4JI7Q 1KC8C 1BBWA 4IJHA 5IYDG 3PUVA 2Q2TA 2BH2A 1SROA 3RLOA 2VL6A 4AQYL 2UXDL 3I56A 2NZHA 4GS3A 3RLFA 4AYBE 4HJ7A 1IBML 1EIFA 1B8AA 2JE6I 2QGQA 1N36Q 2GVAA 4J15A 5IYDH 4JC0A 4NXNQ 1X54A 3BZKA 1SMXA 2KENA 3K7AH 1B70B 3PUXA 3CW2C 4IPGA 2NZOA 4IOCA 2UXCL 3T1HQ 2UUCQ 2ZTEA 1OXXK 3S24A 4AH6A 2QA4A 4ME3A 4GKKL 2HIVA 2JJQA 1XPUA 4R4CA 5JJLA 1Q81C 2JQOA 1X6OA 3GTGH 3GTMH 1YBYA 4A3DG 5EAYA 1JJ2A 1Q46A 1HJPA 1TWCH 3A5UA 4GLVB 4X64L 4DV6Q 4DR3L 1VQMA 4ALPA 1UWVA 2JEBI 2K4KA 3GDEA 4QJFA 3RNUA 1FJGL 1SR3A 2AWNA 2C35B 2CFMA 4JI0Q 2R6GA 3E0EA 4LF8L 2ID0A 3OW2A 1OXSC 1YJNA 5FLXc 2HT1A 5FJ8G 4A3DH 4LFBL 3AEVA 2NVTH 1YHAA 4JI4L 2MO0A 4R4IA 3L2PA 5FLMG 2WP8J 1O7IA 1U5KA 3TEHB 5M5XH 3OTOL 4JI2Q 2N49A 4P72A 4DR1L 5FJ8H 2D62A 4A3BH 1VQEA 1C0AA 2E8GA 1C7YA 5FLMH 2A1AA 4UPAA 1RIPA 3EBEA 1GKHA 1PH7A 1E1TA 3PIOA 1IBKQ 1OTCA 4A3CG 5C4XG 3KF8B 4DUYL 5JJIA 1MJCA 4QQBX 5IP7H 4P75A 3UE0A 2JA6G 3HOYG 2JA7G 1NE3A 2KHIA 4X66L 5LMNQ 1OXUA 4DKAC 1V9PA 1PH5A 4K0KL 5IP9G 1UEBA 1UE7A 2L15A 5C4XH 1VQPA 3TRZA 2ES2A 1A63A 4DV2Q 1Q1EA 1Q12A 1N33L 4TQUS 1K83H 3STBC 4AIMA 5C44G 1UE5A 4DUZL 4B3SQ 3S1QH 4XTCS 1YITA 4YHHQ 2JA6H 1GVPA 2JA7H 3CMEA 3HKSA 4DR7Q 2V1CC 4JI6Q 2NN6G 5IP9H 2RHQB 3U4ZA 4DV1Q 4GKJQ 4GOPC 4XIGS 3PO3G 1GM5A 2ZJPA 5C44H 4A4IA 1SE8A 1FGUA 5C3EG 1QVGA 1VQJA 1TWHH 4MNOA 4DR4Q 4OO1I 2K52A 1VQ4A 5ELNA 4B3RQ 5C0XG 4DV7Q 1XJVA 2ZTCA 2KBNA 3BZCA 1XMOL 1WCMH 1X56A 1S72A 1EFWA 5C3EH 1LUZA 3HOXG 2HQLA 3F1ZA 1CUKA 1T9HA 3CPWA 3T1YQ 4LF5Q 4LF4Q 3S16H 2D0OA 4L5QA 3J7A5 2IHFA 4GLAC 1Y14B 4PMWA 4JBWA 3HKZE 3HOXH 2R93G 1NTGA 4KLKA 4OWXB 1XNQL 3I7FA 4RMFA 2UUAQ 4GN3B 1NBWA 1JMCA 1HR0L 3I2ZA 2I5MX 2AMCB 3U4VA 3G6EA 4A3FG 3H0GH 1UE1A 2R93H 1KXLA 2WB1G 1N32L 5GROA 1P8LA 3KYHC 4X65L 5ELOA 4BA1I 3AQQA 2YTXA 1KIXA 4IPHA 2MFIA 1HZBA 4NXMQ 4A3GG 3M4QA 1A62A 3FP9A 1PVOA 1FVIA 2N3SA 2RCNA 4LUZA 3M4PA 3CCVA 4A3FH 1QZHA 2HHHQ 4LFCQ 1GD7A 2UXBL 4JV5Q 1JB7A 3T1YL 4NPSA 3CCRA 1UE6A 4LUVA 4A3MG 4A3GH 3PUYA 3A0JA 3CC7A 3DM3A 4IFDG 3PV0A 1PYBA 3CPFA 2KCTA 1PH2A 2K5VA 4DR6Q 2MNAA 4DR5L 1PYSB 4A3MH 4LF9Q 1IBLQ 1C9OA 3S1NH 2JA9A 3HOWG 3CC2A 1Q86C 1JJGA 1G51A 4PZ6A 3K7UC 5J3BA 4C3HH 2JEAI 1I94L 4A93G 2PI2A 2WFWA 4LF7L 1CKMA 1R9TH 1EQQA 3CP0A 3U50C 1KRSA 2HIXA 4LFAQ 3BJUA 2PI2E 2RF4A 5C4JH 3HOWH 3HOVG 2CWPA 4OX9Q 1D8LA 1I3QH 4A93H 4BXXG 1EQRA 2KHJA 1VQFA 3J81i 3STBD 5GAHC 3F2DA 3ZJYC 2UUBL 3KF6A 3I4NG 3HOVH 1XTDA 3CMAA 1HNWQ 4PG3A 4YCVA 1XMQQ 2IX0A 4JI8L 4OONA 4BXXH 5BR8L 4DR2Q 1EIYB 1PH8A 4JCVE 1QZGA 3S14H 4C3JH 1LM0A 3NELA 3RLNA 3TS0A 4POFA 1NMGA 1AE3A 3ULLA 1SN8A 4DV4L 1Q1BA 5HGQA 3PIPA 1X9NA 2E2IH 4JI7L 3I4NH 4EQ5A 1KQSA 2Z0SA 3CQZH 1SLJA 1M1KC 4JBJA 2YU9H 4DAYB 3TS2A 5JEAG 1J6QA 3UDFA 1KHIA 2VY3A 3OYYA 2F4VQ 3M7NA 4A3BG 3GTKH 3WWVA 4JI1Q 2UU9Q 4X62Q 3CCLA 1N36L 2EXDA 4C2MH 1IL2A 3CXCA 1NY4A 4NXNL 4HIMA 3JAMi 2ALYB 2NN6I 3CC4A 1CKNA 1CSPA 1BBUA 3F8TA 3GD7A 2VQEQ 4A3KG 5IP7G 1MIUA 2ZM6Q 3T1HL 1OXTA 3EIVA 4MZ9A 1W2BA 1WJJA 3PCOB 4YWKA 2Q2HA 2UUCL 4OWTB 2LSSA 1BKBA 2R7FA 4KHPQ 4GOPA 1PFSA 1VQAA 1VQBA 5C0XI 4YY3Q 4DV6L 4L5RC 2IT1A 5IYBG 1VS0A 4A3KH 3KFUA 1PH1A 1K73C 1KAWA 2DGYA 1LTLA 4A3JG 4HIDA 3RZDH 2VW9A 5GAEC 1YIJA 1J5EQ 4JI0L 4LUOA 4DAMA 3I55A 3KJOA 4YWLA 2F4VL 1HZCA 3K81C 4BA2I 3D31A 2WAQG 5IYBH 4WJ3M 1G6PA 2E5LQ 2MO1A 1E22A 3AFQA 1N34Q 4A3JH 1D7QA 1L1OA 1KRTA 4B3TQ 1X3FA 1HNZQ 4JI2L 1FL0A 3J81c 2JA8G 3NEMA 5IWAQ 2LXKA 4P71A 1WCMG 2RHSB 1X55A 4JI5Q 2PQAA 4O2DA 2WB1E 1EOVA 4IPCA 2OCEA 1PV4A 1IBKL 3FKIH 2JA8H 4BY1G 4JBKA 3DLLA 1DGSA 4TVAB 2YTVA 2NVYH 3TQYA 3A5ZB 1W3SA 2K5NA 4IJLA 5LMNL 1GO3E 4R1JA 5AJ3Q 2B29A 5M3FG 4HJ8A 1L1OC 1HNXQ 1S3OA 3W1BA 2OWOA 4LF6Q 1B7YB 4KI0A 4DV2L 4BY1H 2OTLA 4YCUA 1YJWA 1WFQA 4Y52H 5IY0A 4B3SL 3CCQA 1CSQA 1QVFA 4YHHL 4IFDI 1JJCB 3H0GG 2VQFQ 4UP9A 3HOUG 3JAMc 3RN5A 3AFPA 4DK3C 5M3FH 4JI6L 3PF4A 4DR7L 4GKJL 4DV1L 4QL5A 2AWOA 3G48A 1CKNB 4DV3Q 1V1QA 1E3PA 5IWAL 3ERSX 1YJ9A 4JYAQ 1S40A 4GN4B 4DR4L 2IY5B 4JI5L 2CWAA 3H3VH 1H95A 3HOUH 3CCJA 3F2BA 4GLXA 1LYLA 3E9HA 4GOPB 2H5XA 4DV7L 4B3RL 4JOIC 1E1OA 1YEZA 2LXJA 1Y1VG 1K8GA 2CCZA 5LMUQ 2XTIA 4APVA 4POGA 4DV5Q 4PZ7A 4IOAA 3PUZA 3L0OA 4LF5L 4LF4L 3K0XA 2D0PA 4Y7NH 4WJ4A 1Y1VH 1XPOA 2K50A 2VNUD 1EUJA 3AYHB 1TWGH 4BBSG 1Z9FA 4UP7A 4IO9A 1XNRQ 3UDIA 3RN2A 1PH4A 1RL2A 3M9BA 2UUAL 1VQKA 1X3EA 4DV3L 3PUWA 1JE5A 4R4QA 4UP8A 2BA1A 3LGJA 4DPGA 4HIKA 4AQYQ 1L0WA 2UXDQ 4X6AH 4UY8C 1VQ6A 3GTOH 2YYZA 3MXNB 4BBSH 3I4MG 2K5HA 3SGIA 3TREA 2QEXA 2Y0SG 4NXML 1TWFH 3S17H 2N8NA 3K8AA 1HR0W 2BA0A 2ATWA 1IZ6A 4LWCA 4LFCL 2HHHL 2PNHA 3S2HH 4JG2A 3CCEA 3CAMA 2BH8A 4JV5L 2VZAA 1MJEA 3I4MH 2UXCQ 1G291 3L7ZC 1VQDA 4A3IG 2R7ZG 5GQOA 1ASYA 3M3YH 1M90C 4C3IH 1VQIA 2K14A 4DR3Q 3M4OH 4X64Q 2FXQA 4DR6L 3S2DH 3K80C 4A3IH 1FJGQ 2R7ZH 4OXPA 3S1MH 4LF9L 1IBLL 1IYJB 4LF8Q 1I6HH 2DUDA 1BVSA 4LFBQ 1Z47A 2F3IA 3GTPH 3IRBA 3CCSA 1X65A 1PH6A 4JI4Q 1WYDA 4LNQA 2YTYA 4JI3Q 2CQOA 1K8AC 2YV5A 1HH2P 3J81j 3OTOQ 4LFAL 1YVCA 1VQ9A 2B63G 2I5HA 2WAQE 4DR1Q 2Q2UA 3CD6A 4NB3A 2Q2IA 2R92G 1I50H 1PA6A 4OX9L 5IE8A 1VQLA 2MQHA 2OQKA 1PH9A 2R7DA 2GVBA 1VQ7A 4YCWA 3HFZB 4GN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTN A;  2B63 H;  3M85 A;  4DUY Q;  3Q8D A;  2R92 H;  1JT8 A;  3D0F A;  1HZA A;  1HNW L;  1XMQ L;  1YZ6 A;  3RZO H;  3KJP A;  3ICE A;  4DR2 L;  4X66 Q;  3ULJ A;  4K0K Q;  4P74 A;  3ER0 A;  3I4O A;  2F52 A;  2Z6K A;  2IX1 A;  4A75 A;  1N33 Q;  3A74 A;  3J80 i;  4AYB G;  1Y1W G;  3HOZ G;  1A0I A;  4DUZ Q;  3UDX A;  3S1R H;  1OXV A;  1V43 A;  3RR5 A;  5GAG C;  1VQC A;  5C0X J;  3PF5 A;  4JI3 L;  1EYG A;  3G4S A;  1P16 A;  1VQG A;  2OQ0 A;  3KDF A;  4DV0 Q;  3EN2 A;  1TXY A;  2AHO B;  1NJI C;  3NBH B;  2IHE A;  4JI1 L;  4X62 L;  2UU9 L;  4BY7 G;  1Y1W H;  3HOZ H;  4A3E G;  4BBR G;  1K3R A;  3H3V I;  4EX5 A;  5M3M G;  1VQH A;  4OWW B;  3FKI G;  5H1S E;  1K9M C;  4QY7 A;  2ZTD A;  2A19 A;  2VQE L;  3ULP A;  1QUQ A;  2Z6K C;  1L2F A;  2ZM6 L;  1XMO Q;  4BY7 H;  3KF6 B;  1NMF A;  4R4T A;  4A3E H;  4BBR H;  4GNX A;  2ZJR A;  2E2J H;  1AH9 A;  5M3M H;  3J7Z C;  1I5F A;  1EWI A;  1VQN A;  1TWA H;  4KHP L;  1WI5 A;  1ASZ A;  4JBM A;  1MKH A;  3S15 H;  4YY3 L;  4A3C H;  4HIO A;  4HJ5 A;  2I0Q A;  2E2H H;  1J5E L;  2GN5 A;  3HOY H;  1A8V A;  5E7N A;  3H15 A;  3CCM A;  4DV0 L;  1E7Z A;  5JJK A;  3BU2 A;  4JOI A;  3CCU A;  2N78 A;  1YI2 A;  1CKO A;  1XNQ Q;  2E5L L;  3VDY A;  1N34 L;  4HJ9 A;  1HR0 Q;  1E24 A;  4GNX C;  3MEF A;  1Q8K A;  4HJA A;  4B3T L;  4L5S A;  1HNZ L;  3KOJ A;  4A3L G;  2I5L X;  1N32 Q;  4X65 Q;  1X3G A;  5IYC G;  4IFD J;  3W5O A;  3PO3 H;  4LW1 A;  1WOC A;  4A76 A;  4RG1 A;  4QIW E;  2PMZ E;  4A3L H;  2Y0S E;  2UXB Q;  5HY6 A;  4B3M Q;  5IYC H;  3PO2 G;  4DNI A;  5GAD C;  5M5Y H;  3JC6 6;  3PSI A;  4KHZ A;  3J80 c;  4O0A A;  3GTQ H;  3FHW A;  1IXR A;  1VQ5 A;  2NVQ H;  5AJ3 L;  2ZJQ A;  1HNX L;  3E9I A;  4LF6 L;  3B6Y A;  4H02 A;  3KDF B;  3GTJ H;  3GO5 A;  3PO2 H;  4PZ8 A;  4DR5 Q;  4IPD A;  1PH3 A;  2VQF L;  5LMN W;  3PGZ A;  2VUM G;  1VCI A;  1L1O B;  2B3G A;  2VS1 A;  4L5T A;  1Q82 C;  4OO1 G;  2OTJ A;  1I94 Q;  1SFO H;  4LF7 Q;  1HZ9 A;  2JA5 G;  4JYA L;  1U0L A;  1QUQ B;  1YNX A;  1KD1 C;  3CF5 A;  1N8R C;  2PQA B;  4GNX B;  1IBM Q;  2NVX H;  4QGU A;  2VUM H;  1VQO A;  2JK8 A;  2K75 A;  3UDG A;  4B3M L;  3F2C A;  1N9W A;  2EQS A;  1YHQ A;  3G71 A;  4R4O A;  5IT9 c;  1Q7Y C;  3NEN A;  1PHJ A;  3KLW A;  5LMU L;  2JA5 H;  2XGT A;  3UE1 A;  1AE2 A;  4DV5 L;  3GTL H;  1K0R A;  2A8V A;  3HKZ G;  2UUB Q;  1QVC A;  2ASB A;  2CKZ B;  5JEA J;  5M5W H;  4GKK Q;  3U58 A;  5K36 G;  4JI8 Q;  4FDB A;  2EIF A;  3W1G A;  5BR8 Q;  1VQ8 A;  1XPR A;  1KL9 A;  5DLQ E;  1YHB A;  1SRU A;  4P73 A;  4YWM A;  1XNR L;  2AKW B;  4DK6 C;  2KCM A;  4DV4 Q;  4JI7 Q;  1KC8 C;  1BBW A;  4IJH A;  5IYD G;  3PUV A;  2Q2T A;  2BH2 A;  1SRO A;  3RLO A;  2VL6 A;  4AQY L;  2UXD L;  3I56 A;  2NZH A;  4GS3 A;  3RLF A;  4AYB E;  4HJ7 A;  1IBM L;  1EIF A;  1B8A A;  2JE6 I;  2QGQ A;  1N36 Q;  2GVA A;  4J15 A;  5IYD H;  4JC0 A;  4NXN Q;  1X54 A;  3BZK A;  1SMX A;  2KEN A;  3K7A H;  1B70 B;  3PUX A;  3CW2 C;  4IPG A;  2NZO A;  4IOC A;  2UXC L;  3T1H Q;  2UUC Q;  2ZTE A;  1OXX K;  3S24 A;  4AH6 A;  2QA4 A;  4ME3 A;  4GKK L;  2HIV A;  2JJQ A;  1XPU A;  4R4C A;  5JJL A;  1Q81 C;  2JQO A;  1X6O A;  3GTG H;  3GTM H;  1YBY A;  4A3D G;  5EAY A;  1JJ2 A;  1Q46 A;  1HJP A;  1TWC H;  3A5U A;  4GLV B;  4X64 L;  4DV6 Q;  4DR3 L;  1VQM A;  4ALP A;  1UWV A;  2JEB I;  2K4K A;  3GDE A;  4QJF A;  3RNU A;  1FJG L;  1SR3 A;  2AWN A;  2C35 B;  2CFM A;  4JI0 Q;  2R6G A;  3E0E A;  4LF8 L;  2ID0 A;  3OW2 A;  1OXS C;  1YJN A;  5FLX c;  2HT1 A;  5FJ8 G;  4A3D H;  4LFB L;  3AEV A;  2NVT H;  1YHA A;  4JI4 L;  2MO0 A;  4R4I A;  3L2P A;  5FLM G;  2WP8 J;  1O7I A;  1U5K A;  3TEH B;  5M5X H;  3OTO L;  4JI2 Q;  2N49 A;  4P72 A;  4DR1 L;  5FJ8 H;  2D62 A;  4A3B H;  1VQE A;  1C0A A;  2E8G A;  1C7Y A;  5FLM H;  2A1A A;  4UPA A;  1RIP A;  3EBE A;  1GKH A;  1PH7 A;  1E1T A;  3PIO A;  1IBK Q;  1OTC A;  4A3C G;  5C4X G;  3KF8 B;  4DUY L;  5JJI A;  1MJC A;  4QQB X;  5IP7 H;  4P75 A;  3UE0 A;  2JA6 G;  3HOY G;  2JA7 G;  1NE3 A;  2KHI A;  4X66 L;  5LMN Q;  1OXU A;  4DKA C;  1V9P A;  1PH5 A;  4K0K L;  5IP9 G;  1UEB A;  1UE7 A;  2L15 A;  5C4X H;  1VQP A;  3TRZ A;  2ES2 A;  1A63 A;  4DV2 Q;  1Q1E A;  1Q12 A;  1N33 L;  4TQU S;  1K83 H;  3STB C;  4AIM A;  5C44 G;  1UE5 A;  4DUZ L;  4B3S Q;  3S1Q H;  4XTC S;  1YIT A;  4YHH Q;  2JA6 H;  1GVP A;  2JA7 H;  3CME A;  3HKS A;  4DR7 Q;  2V1C C;  4JI6 Q;  2NN6 G;  5IP9 H;  2RHQ B;  3U4Z A;  4DV1 Q;  4GKJ Q;  4GOP C;  4XIG S;  3PO3 G;  1GM5 A;  2ZJP A;  5C44 H;  4A4I A;  1SE8 A;  1FGU A;  5C3E G;  1QVG A;  1VQJ A;  1TWH H;  4MNO A;  4DR4 Q;  4OO1 I;  2K52 A;  1VQ4 A;  5ELN A;  4B3R Q;  5C0X G;  4DV7 Q;  1XJV A;  2ZTC A;  2KBN A;  3BZC A;  1XMO L;  1WCM H;  1X56 A;  1S72 A;  1EFW A;  5C3E H;  1LUZ A;  3HOX G;  2HQL A;  3F1Z A;  1CUK A;  1T9H A;  3CPW A;  3T1Y Q;  4LF5 Q;  4LF4 Q;  3S16 H;  2D0O A;  4L5Q A;  3J7A 5;  2IHF A;  4GLA C;  1Y14 B;  4PMW A;  4JBW A;  3HKZ E;  3HOX H;  2R93 G;  1NTG A;  4KLK A;  4OWX B;  1XNQ L;  3I7F A;  4RMF A;  2UUA Q;  4GN3 B;  1NBW A;  1JMC A;  1HR0 L;  3I2Z A;  2I5M X;  2AMC B;  3U4V A;  3G6E A;  4A3F G;  3H0G H;  1UE1 A;  2R93 H;  1KXL A;  2WB1 G;  1N32 L;  5GRO A;  1P8L A;  3KYH C;  4X65 L;  5ELO A;  4BA1 I;  3AQQ A;  2YTX A;  1KIX A;  4IPH A;  2MFI A;  1HZB A;  4NXM Q;  4A3G G;  3M4Q A;  1A62 A;  3FP9 A;  1PVO A;  1FVI A;  2N3S A;  2RCN A;  4LUZ A;  3M4P A;  3CCV A;  4A3F H;  1QZH A;  2HHH Q;  4LFC Q;  1GD7 A;  2UXB L;  4JV5 Q;  1JB7 A;  3T1Y L;  4NPS A;  3CCR A;  1UE6 A;  4LUV A;  4A3M G;  4A3G H;  3PUY A;  3A0J A;  3CC7 A;  3DM3 A;  4IFD G;  3PV0 A;  1PYB A;  3CPF A;  2KCT A;  1PH2 A;  2K5V A;  4DR6 Q;  2MNA A;  4DR5 L;  1PYS B;  4A3M H;  4LF9 Q;  1IBL Q;  1C9O A;  3S1N H;  2JA9 A;  3HOW G;  3CC2 A;  1Q86 C;  1JJG A;  1G51 A;  4PZ6 A;  3K7U C;  5J3B A;  4C3H H;  2JEA I;  1I94 L;  4A93 G;  2PI2 A;  2WFW A;  4LF7 L;  1CKM A;  1R9T H;  1EQQ A;  3CP0 A;  3U50 C;  1KRS A;  2HIX A;  4LFA Q;  3BJU A;  2PI2 E;  2RF4 A;  5C4J H;  3HOW H;  3HOV G;  2CWP A;  4OX9 Q;  1D8L A;  1I3Q H;  4A93 H;  4BXX G;  1EQR A;  2KHJ A;  1VQF A;  3J81 i;  3STB D;  5GAH C;  3F2D A;  3ZJY C;  2UUB L;  3KF6 A;  3I4N G;  3HOV H;  1XTD A;  3CMA A;  1HNW Q;  4PG3 A;  4YCV A;  1XMQ Q;  2IX0 A;  4JI8 L;  4OON A;  4BXX H;  5BR8 L;  4DR2 Q;  1EIY B;  1PH8 A;  4JCV E;  1QZG A;  3S14 H;  4C3J H;  1LM0 A;  3NEL A;  3RLN A;  3TS0 A;  4POF A;  1NMG A;  1AE3 A;  3ULL A;  1SN8 A;  4DV4 L;  1Q1B A;  5HGQ A;  3PIP A;  1X9N A;  2E2I H;  4JI7 L;  3I4N H;  4EQ5 A;  1KQS A;  2Z0S A;  3CQZ H;  1SLJ A;  1M1K C;  4JBJ A;  2YU9 H;  4DAY B;  3TS2 A;  5JEA G;  1J6Q A;  3UDF A;  1KHI A;  2VY3 A;  3OYY A;  2F4V Q;  3M7N A;  4A3B G;  3GTK H;  3WWV A;  4JI1 Q;  2UU9 Q;  4X62 Q;  3CCL A;  1N36 L;  2EXD A;  4C2M H;  1IL2 A;  3CXC A;  1NY4 A;  4NXN L;  4HIM A;  3JAM i;  2ALY B;  2NN6 I;  3CC4 A;  1CKN A;  1CSP A;  1BBU A;  3F8T A;  3GD7 A;  2VQE Q;  4A3K G;  5IP7 G;  1MIU A;  2ZM6 Q;  3T1H L;  1OXT A;  3EIV A;  4MZ9 A;  1W2B A;  1WJJ A;  3PCO B;  4YWK A;  2Q2H A;  2UUC L;  4OWT B;  2LSS A;  1BKB A;  2R7F A;  4KHP Q;  4GOP A;  1PFS A;  1VQA A;  1VQB A;  5C0X I;  4YY3 Q;  4DV6 L;  4L5R C;  2IT1 A;  5IYB G;  1VS0 A;  4A3K H;  3KFU A;  1PH1 A;  1K73 C;  1KAW A;  2DGY A;  1LTL A;  4A3J G;  4HID A;  3RZD H;  2VW9 A;  5GAE C;  1YIJ A;  1J5E Q;  4JI0 L;  4LUO A;  4DAM A;  3I55 A;  3KJO A;  4YWL A;  2F4V L;  1HZC A;  3K81 C;  4BA2 I;  3D31 A;  2WAQ G;  5IYB H;  4WJ3 M;  1G6P A;  2E5L Q;  2MO1 A;  1E22 A;  3AFQ A;  1N34 Q;  4A3J H;  1D7Q A;  1L1O A;  1KRT A;  4B3T Q;  1X3F A;  1HNZ Q;  4JI2 L;  1FL0 A;  3J81 c;  2JA8 G;  3NEM A;  5IWA Q;  2LXK A;  4P71 A;  1WCM G;  2RHS B;  1X55 A;  4JI5 Q;  2PQA A;  4O2D A;  2WB1 E;  1EOV A;  4IPC A;  2OCE A;  1PV4 A;  1IBK L;  3FKI H;  2JA8 H;  4BY1 G;  4JBK A;  3DLL A;  1DGS A;  4TVA B;  2YTV A;  2NVY H;  3TQY A;  3A5Z B;  1W3S A;  2K5N A;  4IJL A;  5LMN L;  1GO3 E;  4R1J A;  5AJ3 Q;  2B29 A;  5M3F G;  4HJ8 A;  1L1O C;  1HNX Q;  1S3O A;  3W1B A;  2OWO A;  4LF6 Q;  1B7Y B;  4KI0 A;  4DV2 L;  4BY1 H;  2OTL A;  4YCU A;  1YJW A;  1WFQ A;  4Y52 H;  5IY0 A;  4B3S L;  3CCQ A;  1CSQ A;  1QVF A;  4YHH L;  4IFD I;  1JJC B;  3H0G G;  2VQF Q;  4UP9 A;  3HOU G;  3JAM c;  3RN5 A;  3AFP A;  4DK3 C;  5M3F H;  4JI6 L;  3PF4 A;  4DR7 L;  4GKJ L;  4DV1 L;  4QL5 A;  2AWO A;  3G48 A;  1CKN B;  4DV3 Q;  1V1Q A;  1E3P A;  5IWA L;  3ERS X;  1YJ9 A;  4JYA Q;  1S40 A;  4GN4 B;  4DR4 L;  2IY5 B;  4JI5 L;  2CWA A;  3H3V H;  1H95 A;  3HOU H;  3CCJ A;  3F2B A;  4GLX A;  1LYL A;  3E9H A;  4GOP B;  2H5X A;  4DV7 L;  4B3R L;  4JOI C;  1E1O A;  1YEZ A;  2LXJ A;  1Y1V G;  1K8G A;  2CCZ A;  5LMU Q;  2XTI A;  4APV A;  4POG A;  4DV5 Q;  4PZ7 A;  4IOA A;  3PUZ A;  3L0O A;  4LF5 L;  4LF4 L;  3K0X A;  2D0P A;  4Y7N H;  4WJ4 A;  1Y1V H;  1XPO A;  2K50 A;  2VNU D;  1EUJ A;  3AYH B;  1TWG H;  4BBS G;  1Z9F A;  4UP7 A;  4IO9 A;  1XNR Q;  3UDI A;  3RN2 A;  1PH4 A;  1RL2 A;  3M9B A;  2UUA L;  1VQK A;  1X3E A;  4DV3 L;  3PUW A;  1JE5 A;  4R4Q A;  4UP8 A;  2BA1 A;  3LGJ A;  4DPG A;  4HIK A;  4AQY Q;  1L0W A;  2UXD Q;  4X6A H;  4UY8 C;  1VQ6 A;  3GTO H;  2YYZ A;  3MXN B;  4BBS H;  3I4M G;  2K5H A;  3SGI A;  3TRE A;  2QEX A;  2Y0S G;  4NXM L;  1TWF H;  3S17 H;  2N8N A;  3K8A A;  1HR0 W;  2BA0 A;  2ATW A;  1IZ6 A;  4LWC A;  4LFC L;  2HHH L;  2PNH A;  3S2H H;  4JG2 A;  3CCE A;  3CAM A;  2BH8 A;  4JV5 L;  2VZA A;  1MJE A;  3I4M H;  2UXC Q;  1G29 1;  3L7Z C;  1VQD A;  4A3I G;  2R7Z G;  5GQO A;  1ASY A;  3M3Y H;  1M90 C;  4C3I H;  1VQI A;  2K14 A;  4DR3 Q;  3M4O H;  4X64 Q;  2FXQ A;  4DR6 L;  3S2D H;  3K80 C;  4A3I H;  1FJG Q;  2R7Z H;  4OXP A;  3S1M H;  4LF9 L;  1IBL L;  1IYJ B;  4LF8 Q;  1I6H H;  2DUD A;  1BVS A;  4LFB Q;  1Z47 A;  2F3I A;  3GTP H;  3IRB A;  3CCS A;  1X65 A;  1PH6 A;  4JI4 Q;  1WYD A;  4LNQ A;  2YTY A;  4JI3 Q;  2CQO A;  1K8A C;  2YV5 A;  1HH2 P;  3J81 j;  3OTO Q;  4LFA L;  1YVC A;  1VQ9 A;  2B63 G;  2I5H A;  2WAQ E;  4DR1 Q;  2Q2U A;  3CD6 A;  4NB3 A;  2Q2I A;  2R92 G;  1I50 H;  1PA6 A;  4OX9 L;  5IE8 A;  1VQL A;  2MQH A;  2OQK A;  1PH9 A;  2R7D A;  2GVB A;  1VQ7 A;  4YCW A;  3HFZ B;  4GN5 A; 
#chains in the Genus database with same CATH topology
 4MTN A;  4X3K A;  2B63 H;  3M85 A;  4RHS A;  1JT8 A;  1MSH A;  5TSS A;  1HZA A;  1YZ6 A;  2I46 A;  4X66 Q;  1DM0 B;  1V1P B;  3I4O A;  5M5X B;  1Y1W G;  3UDX A;  4DA2 A;  5C0X J;  3PF5 A;  4JI3 L;  1P16 A;  1II3 A;  2B2V A;  3KDF A;  3EN2 A;  1SNC A;  1GUS A;  2HQE A;  2IHE A;  2UU9 L;  4X62 L;  3HOZ H;  1ILP A;  4A3E G;  1K3R A;  3D4D A;  3NQI A;  3H3V I;  5M3M G;  1VQH A;  2B2W A;  1LT4 D;  1EU4 A;  2IJ0 A;  2Z6K C;  1XMO Q;  2QCP X;  3HG9 A;  1HPC A;  2F0P A;  1I5F A;  1VQN A;  3S1Q B;  2EOT A;  1WI5 A;  2F3V A;  1ASZ A;  3S15 H;  1EIH A;  4YY3 L;  2JA6 B;  4A3C H;  3D6C A;  4HJ5 A;  5I6Y A;  5ELC A;  4DK1 A;  2GN5 A;  1OO9 B;  1ICW A;  2WAQ B;  5E7N A;  3FEW X;  2Q8R E;  2N78 A;  1CZG A;  1CKO A;  1MD2 D;  3NWS A;  1G6Z A;  3QIA A;  5BN3 A;  1M4V A;  1ET6 A;  1SBB B;  4KJN A;  4IFD J;  3W5O A;  1HFG A;  1LTS D;  3VR5 A;  1ILQ A;  2QEJ C;  4DXF A;  3QOL A;  3DWQ A;  3PO2 G;  5M5Y H;  2DJG C;  4O0A A;  5G3L D;  1VQ5 A;  3NWT A;  3CKI B;  1JWU D;  1HNX L;  3B6Y A;  2EY5 A;  5ELE A;  1UAP A;  4XYQ A;  4PZ8 A;  3ERO A;  2VQF L;  5DAU A;  1TR5 A;  1GUN A;  3L9A X;  2VS1 A;  5FO7 B;  2OTJ A;  4IUP A;  4A3F B;  1SFO H;  1I94 Q;  3MEH A;  4DAY A;  4JYA L;  2K5Q A;  3H6M A;  1KD1 C;  1AP0 A;  2G9D A;  1N8R C;  3OIQ A;  2VB2 X;  2K75 A;  3X3N A;  3IL8 A;  2EQS A;  1SND A;  3G71 A;  5IT9 c;  4FXD A;  3NEN A;  1SYD A;  3LNN A;  3GTL H;  3C1E A;  2LFN A;  2ASB A;  1QVC A;  1LT3 D;  3U58 A;  3W1G A;  2EIF A;  5BR8 Q;  1B9N A;  1GUG A;  4C56 C;  1YHB A;  4P73 A;  1EFI D;  4YWM A;  1IW7 C;  4DK6 C;  2KCM A;  4DV4 Q;  5IT9 E;  4JI7 Q;  4IJH A;  2NYZ D;  3GP7 A;  1SRO A;  3O13 A;  1QOH A;  2VL6 A;  4QIW B;  3RMH A;  1VF5 C;  1EIF A;  2F0T A;  4HMI A;  1WTO A;  2JE6 I;  1RCV D;  2B8G A;  4J15 A;  4JC0 A;  4NXN Q;  2KEN A;  1B70 B;  3PUX A;  2KED A;  2DJF C;  5C4H A;  3C2P A;  2KEC A;  2UUC Q;  1F77 A;  4C3J B;  3EA6 A;  2QA4 A;  4GKK L;  1H9R A;  2HIV A;  5CC4 A;  3GTG H;  3A5U A;  4GLV B;  4X64 L;  5CV7 A;  3VR3 A;  2JEB I;  3GDE A;  2JSO A;  3RNU A;  1FJG L;  2CFM A;  4JI0 Q;  1I50 B;  1PFB A;  2ID0 A;  1OXS C;  4OIJ A;  4A3D H;  1BUV T;  4LFB L;  3AEV A;  4R4I A;  3L2P A;  3FPP A;  1SYF A;  5FJ8 H;  3RZO B;  3H09 A;  3SDZ A;  3QR8 A;  4F88 A;  1VQE A;  3NXW A;  4JW0 A;  5FLM H;  4A3K B;  5IGC A;  1IBK Q;  5JJI A;  1SEB D;  3DEP A;  4QQB X;  3UE0 A;  2WKC A;  3HOY G;  3OIP A;  4HAE A;  4ZKB B;  2ICE C;  4A3J B;  1UEB A;  4OL7 A;  4ZUI A;  4DV2 Q;  1S5C D;  4AIM A;  1UE5 A;  1HA5 A;  1TS4 A;  4RKB A;  2JA7 H;  2V1C C;  4JI6 Q;  3U4Z A;  4BBR B;  4XIG S;  2L1B A;  3MZ5 A;  3PO3 G;  1A2U A;  2ZJP A;  1ZYR D;  4TRD A;  3I70 A;  1S5D D;  2K52 A;  2LKV A;  4DV7 Q;  4KV6 A;  4XT3 B;  2A68 C;  1WCM H;  1AEX A;  4PQX A;  1LUZ A;  2HQL A;  2FFK B;  1CUK A;  1QNK A;  2WKD A;  2E2D C;  2NTT A;  2Z1C A;  3IFD A;  4L5Q A;  5C0X H;  3J7A 5;  2HUG A;  3HKZ E;  5G3L F;  1A3T A;  1EYC A;  2B2U C;  4KLK A;  5CBA E;  3HOU B;  4GN3 B;  2Z4H A;  3I2Z A;  3I72 A;  4X3T A;  3G6E A;  3H0G H;  1UE1 A;  1AW7 A;  2R93 H;  2XVS A;  4XDX A;  3E6Z X;  3KYH C;  1KIX A;  4BA1 I;  2EJG C;  2NVQ B;  1KDB A;  3OW7 A;  1GOZ A;  1HUN A;  4K8J A;  2G5D A;  4I65 A;  1HTL D;  4LUZ A;  3CCV A;  2AUJ D;  3QB3 A;  3T1Y L;  1KLG D;  1C8C A;  1RKN A;  4A3M G;  2EYL A;  1HQR D;  3A0J A;  2KHS A;  1F9S A;  2Z4I A;  1PXU A;  1PH2 A;  3V96 A;  2F0S A;  2VUM B;  4DR5 L;  4LF9 Q;  1BF4 A;  4IFD H;  3CC2 A;  1I4X A;  1Q86 C;  4C3H H;  1CTM A;  1K8M A;  3A8I E;  1TS3 A;  3ONA B;  5ELF A;  1SNM A;  1CKM A;  1EQQ A;  2PMZ B;  2Y0S B;  2PI2 E;  2RF4 A;  3HOW H;  2CW0 C;  3N6R A;  3HOV G;  2X6G A;  4OGQ C;  5BN4 A;  4KK7 A;  2F0F A;  3SEB A;  1STE A;  1MSG A;  1EY5 A;  4EQO A;  1STA A;  5JPN C;  5GAH C;  3ZJY C;  2O5I C;  1RTN A;  4PG3 A;  4YCV A;  3SXH A;  3T56 B;  4OON A;  4BXX H;  4JCV E;  3QWN A;  3S14 H;  3RLN A;  2F3W A;  3FRP B;  2R3Z A;  4HSV A;  3VR2 A;  3ULL A;  3I4N H;  1EY4 A;  3K7A B;  2IPK D;  2KEE A;  2Z0S A;  2YU9 H;  2XWB B;  2F4V Q;  1KHI A;  3OYY A;  2UU9 Q;  4X62 Q;  2D9U A;  5ISR A;  3R2I A;  2R92 B;  2EYH A;  3J7A F;  1MHW C;  2XWJ B;  1MIU A;  3T1H L;  1W2B A;  3EIV A;  4MZ9 A;  1WJJ A;  2LSS A;  1K28 A;  1PFS A;  5JVG 3;  3E3X A;  4YY3 Q;  3KFU A;  2BOS A;  4ID6 A;  1LTL A;  2G9H D;  5CV5 A;  1YIJ A;  1GUW A;  1Y1W B;  2J7Z A;  1O78 A;  4BA2 I;  1G6P A;  3HGB A;  2WAQ G;  2PNR C;  5ELB A;  4ZRZ A;  1D7Q A;  1L1O A;  4A3E B;  4JI2 L;  2E2J B;  4HCE A;  5M3M B;  3NEM A;  1F9Q A;  2PPB C;  5C4X B;  2WB1 E;  3VYS A;  4IPC A;  1L0X B;  1EL0 A;  1DGS A;  3I3C A;  4GZY C;  4EQP A;  2NVY H;  3TQY A;  2SDF A;  1ZXT A;  4HJ8 A;  5LMN L;  4R1J A;  1PTO F;  1HNX Q;  4LNQ A;  5C44 B;  3QO2 A;  1B7Y B;  2NUC A;  3KK7 A;  2F0M A;  3H91 A;  2VQF Q;  3ND8 A;  4UP9 A;  3AFP A;  4DK3 C;  5M3F H;  5EGT A;  5IT9 L;  4DV1 L;  2AWO A;  1DOK A;  1CKN B;  3G48 A;  4CKB A;  1JQY D;  2F0D A;  2TMP A;  1BCP F;  4JYA Q;  1QCB D;  4GN4 B;  2B39 A;  1STN A;  4DR4 L;  5M9O A;  4V19 0;  2L55 A;  4J8Q A;  5C3X A;  4B3R L;  2H5X A;  1YEZ A;  1Y8O B;  3PO2 B;  5I4D A;  4IOA A;  1F2M A;  1O7Y A;  1H9S A;  2AUK A;  4Y7N H;  4WJ4 A;  2CHB D;  3MTS A;  2K50 A;  5EKK A;  2VNU D;  1TWG H;  4R9W A;  4UP7 A;  3RN2 A;  2EPB A;  3DMU A;  3W3A A;  1X3E A;  4DV3 L;  3PUW A;  1JE5 A;  2BA1 A;  1GUT A;  4A3G B;  3TRE A;  4M1U B;  1QNU A;  3SGI A;  4NXM L;  2N8N A;  2E75 C;  2ATW A;  5JVH 3;  1IZ6 A;  5JOB A;  4LFC L;  2PNH A;  3A54 A;  3CAM A;  2ZXO A;  2VZA A;  1MJE A;  3I4M H;  1X3Q A;  2Z9H A;  3OOC A;  3KF8 A;  1ASY A;  3M3Y H;  1B2T A;  4C1N I;  4X64 Q;  2FXQ A;  1NSN S;  4DR6 L;  1PTO C;  1LO5 D;  1NCV A;  1FJG Q;  2MHV A;  4A93 B;  1SYE A;  4LFB Q;  1Z47 A;  2K7V A;  3GTP H;  1A3U A;  4HTH A;  5IGD A;  4CBV A;  1HH2 P;  4LFA L;  2I5H A;  2K28 A;  3R8B A;  3CD6 A;  2A5H A;  5IE8 A;  2OQK A;  1VQL A;  2R7D A;  1VQ7 A;  4YCW A;  3V2T A;  3EVQ A;  2EYJ A;  4P2C B;  1SYB A;  5D65 A;  5A2Q E;  4PMB A;  4G7Z C;  1TY2 A;  2CVR A;  2E74 C;  2NVT B;  3HS0 C;  2Z6K A;  2KOL A;  4A75 A;  3A74 A;  1A0I A;  3AB9 A;  3S1R H;  4K6L A;  2RKS A;  5FKA C;  1VQC A;  4DV0 Q;  1EZ6 A;  2OQ0 A;  1TXY A;  2AHO B;  5FK9 C;  3NBH B;  4JI1 L;  4BBR G;  2RDH A;  1K9M C;  2A19 A;  5CV6 A;  2VQE L;  1SNO A;  2PCF B;  2ZM6 L;  1Z7T A;  4BY7 H;  3KF6 B;  1NMF A;  1AH9 A;  1PRT F;  1EWI A;  1TWA H;  1PFN A;  4JBM A;  2EXZ A;  3BVZ A;  5IGE A;  1VMP A;  1NR2 A;  2L0C A;  2E2H H;  4V0B A;  3HOY H;  1A8V A;  2QF7 A;  3CCM A;  1SMY D;  1B4O A;  2FJ2 A;  2TSS A;  4JOI A;  5EKL A;  1VDZ A;  2E5L L;  1NNX A;  4GNX C;  3MEF A;  1Q8K A;  4B3T L;  4A3L G;  2KQ3 A;  1J8I A;  1FYC A;  1U4R A;  5IYC G;  1XWE A;  2BE5 D;  3SVM A;  3PO3 H;  2OEO A;  3S16 B;  4BY1 B;  5COR A;  2PMZ E;  2Y0S E;  5HY6 A;  4B3M Q;  1Y69 U;  4KJO A;  3OPO A;  3PSI A;  1IXR A;  5AJ3 L;  3E9I A;  4DN4 M;  2NB0 A;  3KDF B;  1DYQ A;  1MGS A;  2AQ3 B;  2PZW A;  4DR5 Q;  5LMN W;  3PGZ A;  2VUM G;  1S5E D;  1VCI A;  2B3G A;  4YIJ A;  5FO8 B;  1JOK A;  1SDF A;  2BDN A;  1QWY A;  2PQA B;  1SNQ A;  4QB4 A;  1DOM A;  1VQO A;  1Y1V B;  2JK8 A;  1U4M A;  4OO1 H;  2F0J A;  4QCL A;  2Q8T A;  1N9W A;  4KN4 C;  4R4O A;  2JA5 H;  4ODG A;  5LMU L;  2XGT A;  3UE1 A;  1AE2 A;  1GHJ A;  4DV5 L;  2A8V A;  4A3M B;  3S1N B;  1PRT C;  3CRK C;  2CKZ B;  5JEA J;  5FLX L;  5K36 G;  2F0I A;  1DZ1 A;  3TP6 A;  2EDG A;  2XRS D;  4IUU A;  5DLQ E;  4DAV A;  1TWF B;  2CH4 A;  4CDF C;  1ENC A;  1KC8 C;  5IYD G;  1PYW D;  4FXK C;  1PLF A;  2Q2T A;  3RLO A;  4L8J A;  3I56 A;  1D1I A;  3ITP A;  2J0T D;  4RCO A;  1IBM L;  2PW5 A;  1HHV A;  2QGQ A;  3I90 A;  1EQV A;  1HUM A;  1EYD A;  3HOV B;  3P1H A;  4XXE A;  1SMX A;  4IPG A;  4NDX A;  1F2Y A;  3T1H Q;  4AH6 A;  4XQN A;  3UI2 A;  2JJQ A;  3OWE B;  4ME5 A;  5KEE A;  2B2T C;  2E2I B;  5JJL A;  2JQO A;  1X6O A;  3GTM H;  3CQZ B;  4DR3 L;  1HJP A;  1TWC H;  4ZYS A;  2EE1 A;  2NZ1 D;  2IX3 A;  1UWV A;  2C35 B;  3A55 A;  2K03 A;  2C9O A;  3X3M A;  2A6E C;  2FIN B;  2O4X A;  1YHA A;  4JI4 L;  3DWP A;  1O7I A;  1JOQ A;  5HUR A;  2F0G A;  3TEH B;  5M5X H;  1CA6 A;  2F4I A;  4JI2 Q;  2N49 A;  1TII D;  4DR1 L;  1ICF B;  1XXG A;  3T4A C;  2KUM A;  2D62 A;  2M9V A;  2PQE A;  4RFB A;  1SJE D;  5EPJ A;  1C7Y A;  2KCN A;  5J39 A;  1PH7 A;  1OTC A;  5C4X G;  3RZD B;  2A6H D;  1IYV A;  4DUY L;  2QIL A;  1YNJ D;  1RTO A;  4P75 A;  1NE3 A;  4XT1 B;  2KHI A;  1PH5 A;  5LMN Q;  1V9P A;  4OIK A;  5IP9 G;  1MBY A;  1VQP A;  3TRZ A;  1X32 A;  3HP3 A;  1Q12 A;  4TQU S;  3STB C;  5C44 G;  4DUZ L;  3S1Q H;  2AQ1 B;  2WAC A;  2JA6 H;  3CME A;  1CHP D;  4RKL A;  4FF3 A;  4DV1 Q;  1G2S A;  2XNA C;  4A4I A;  1GJX A;  2F0L A;  4DR4 Q;  4MNO A;  2B2U A;  1BDO A;  2NN6 H;  5ELN A;  2K33 A;  4B3R Q;  3KLR A;  1EY9 A;  1X56 A;  1EFW A;  1HQM C;  2A69 C;  5C3E H;  4FP5 D;  4CJ0 B;  1T9H A;  1CQF A;  2D0O A;  5EJW A;  2B2Y C;  4QUF A;  3HOX H;  1GXD C;  1R4Q B;  2M2L A;  3E0J A;  2MGS A;  1HR0 L;  5DEH A;  3K58 A;  2I5M X;  1BO0 A;  3U4V A;  1B3A A;  5M5Y B;  1N32 L;  2F0E A;  5GRO A;  4X6A H;  4NXM Q;  2DNC A;  1F2Z A;  4NMZ A;  4A3G G;  2N3S A;  1ESR A;  4LFC Q;  3M4P A;  4A3F H;  3IFT A;  5A35 A;  2L9H A;  3CC7 A;  4F8M A;  2EYM A;  2KCT A;  1JCK B;  5A2Q L;  4DR6 Q;  1MI2 A;  2XIW A;  4Q0F A;  2JA9 A;  5CMD A;  3S17 B;  5J3B A;  3K7U C;  2JEA I;  4A93 G;  2PI2 A;  3MA2 B;  2WFW A;  4JK1 C;  3GTL B;  1KRS A;  2HIX A;  5CYU A;  4LFA Q;  1QG7 A;  2X69 A;  3BJU A;  3C46 A;  1QIL A;  2L4N A;  3M4O B;  1EQR A;  1EEF D;  3TP7 A;  2Q8I B;  1G91 A;  1XX8 A;  3J81 i;  2F1M A;  4FNF A;  1I6H B;  5T1G A;  2UUB L;  3CMA A;  1CM9 A;  1EWH A;  1TKW B;  4C3J H;  3TS0 A;  4POF A;  1NMG A;  1A6X A;  2ZT9 C;  3DXJ C;  4EQ5 A;  1SLJ A;  5E1F A;  4ZAI A;  2VY3 A;  3M7N A;  4JI1 Q;  3SK5 A;  1IL2 A;  5D3I B;  3CXC A;  5JEA H;  1BBU A;  2VQE Q;  1PTO H;  1UNS A;  2ZM6 Q;  4QMG A;  1X3P A;  4RHR A;  2O5J C;  2R7F A;  4GOP A;  1VQA A;  1FNU A;  1VQB A;  3KBX A;  1V8Q A;  5C0X I;  3BS1 A;  3QJY A;  4L5R C;  2IT1 A;  5IYB G;  1VS0 A;  4A3K H;  3JAM L;  1K73 C;  2DGY A;  5KNC A;  1EY6 A;  2PW7 A;  4HID A;  3I55 A;  3KJO A;  4YWL A;  4RGN A;  1HZC A;  4ZLT F;  1BQQ T;  2E5L Q;  4A3J H;  4B3T Q;  2JA8 G;  3J81 c;  3IAY A;  5IWA Q;  1X55 A;  4JI5 Q;  1SSO A;  1EOV A;  2F0U A;  1PV4 A;  1IHZ A;  4BY1 G;  4TVA B;  4E6I A;  2YTV A;  1KAA A;  1D6E C;  3A5Z B;  3J81 E;  2K32 A;  1EY8 A;  3K5M A;  1K0S A;  2K5N A;  4IJL A;  1GO3 E;  5AJ3 Q;  2B29 A;  2OWO A;  4KI0 A;  4YCU A;  3BYT B;  4QF4 A;  4Y52 H;  4B3S L;  1O80 A;  1BR9 A;  1KTK A;  3D4W A;  4IFD I;  4JVZ A;  1RJT A;  3RN5 A;  4GKJ L;  1TS2 A;  1WTR A;  5IGB A;  1E3P A;  3ERS X;  1S40 A;  5CBE E;  2CWA A;  1H95 A;  1H9J A;  5EBC A;  3HOU H;  3GTQ B;  3MC0 B;  3MXP A;  4GLX A;  1LYL A;  1Y1V G;  2CCZ A;  5LMU Q;  1KNA A;  3GTJ B;  4DV5 Q;  4PZ7 A;  4IN3 A;  3K0X A;  3V05 A;  2R93 B;  5I9P A;  1XPO A;  2A6H C;  1EUJ A;  3AYH B;  4BBS G;  1Z9F A;  5DM6 3;  1YNJ C;  3UDI A;  3PQI A;  2A74 C;  1LLR D;  3M9B A;  1VQK A;  2NVX B;  3GV6 A;  1J9O A;  4UP8 A;  4ZUJ A;  4DPG A;  4HIK A;  1VQ6 A;  3GTO H;  2YYZ A;  1PDQ A;  5I9O A;  5EPK A;  1QE6 A;  3DWA A;  4IUV A;  3K8A A;  1HR0 W;  5M5W B;  4LWC A;  2HHH L;  4JG2 A;  3CCE A;  3WDN A;  1U4L A;  4JV5 L;  4FXG C;  2Z6B A;  5CR3 A;  3TDQ A;  3NTH A;  4A3I G;  2R7Z G;  1JIC A;  2NWG A;  4WRD A;  4C3H B;  1I4G A;  4C3I H;  1VQI A;  4N8F A;  3TP8 A;  4DR3 Q;  1CQV A;  3S2D H;  4FF1 A;  3HOW B;  2DNE A;  3BG3 A;  4OXP A;  1IBL L;  1EOT A;  1BVS A;  1PH6 A;  4JI4 Q;  1WYD A;  1PZI D;  2YTY A;  4JI3 Q;  3AMU A;  2ENB A;  2B63 G;  1TT2 A;  2WAQ E;  4DR1 Q;  2Q2I A;  1PA6 A;  4OX9 L;  4DNT B;  2WV6 D;  3VR4 A;  1RF2 D;  1H9S B;  4GN5 A;  3I4N B;  1KDC A;  2HDL A;  2D5D A;  4DUY Q;  2R92 H;  4G4K A;  4LAA A;  2EYF A;  2JN4 A;  1Q8I A;  1JWM D;  1SE4 A;  1LTA D;  3KJP A;  4DR2 L;  3ICE A;  3ULJ A;  2XRQ D;  2LY7 A;  4KTA A;  3ER0 A;  2F52 A;  2EZV A;  4N8X 1;  3SE0 A;  4AYB G;  3MWY W;  3SK4 A;  3HOZ G;  4DUZ Q;  3RR5 A;  2IW3 A;  4A3B B;  3DHQ A;  3HEJ A;  3G4S A;  2L11 A;  2R61 A;  4B9W A;  2EY6 A;  1JB3 A;  5E3F A;  1UUP A;  5KGU A;  4LJZ C;  1Y1W H;  1L0Y B;  1U9R A;  4QY7 A;  2IL8 A;  1F9P A;  2K04 A;  3FPU B;  4O42 A;  1QUQ A;  1L2F A;  3RD4 A;  4A3E H;  2E2J H;  4GNX A;  1AFP A;  2WII B;  5M3M H;  1K83 B;  1QJO A;  3H3V C;  4IAL A;  1J5E L;  3H15 A;  5JJK A;  4HCS A;  5D14 A;  2RVL A;  3TP5 A;  3VDY A;  1N34 L;  1HR0 Q;  3ERQ A;  4L5S A;  1HNZ L;  1N32 Q;  1DXM A;  2NVY B;  3K59 A;  1X3G A;  3K6O A;  4RG1 A;  4QIW E;  5HGT A;  3WOE A;  1CZW A;  5I6W A;  1EU3 A;  1ZEQ X;  2EJF C;  4DNI A;  5M3F B;  4KHZ A;  1DOL A;  3ND9 A;  2ZJQ A;  4H7B A;  3T51 B;  1A15 A;  2MP1 A;  3GO5 A;  3PO2 H;  3ZYY X;  2SOB A;  1PH3 A;  1PZJ D;  2H1E A;  4L5T A;  4WJW A;  1S4Z A;  1U0L A;  1Q3L A;  3BDO A;  3CF5 A;  1O7Z A;  5D3D A;  3UDG A;  5CV4 A;  1TWG B;  1YHQ A;  1DJR D;  1Q7Y C;  3KLW A;  5EQ0 A;  1K0R A;  1ZYR C;  2UUB Q;  2QW7 A;  4PV1 C;  4GKK Q;  4FDB A;  1VQ8 A;  4K8I A;  1HTP A;  1XPR A;  1SRU A;  2QDL A;  1XNR L;  1FGB D;  1V1O A;  1Q90 A;  2LMC B;  3KUP A;  5C4J B;  1BBW A;  1TU2 B;  2B2T A;  1I4H A;  4S3S A;  3PUV A;  4KD3 A;  2BH2 A;  1I3Q B;  4AQY L;  2SNS A;  3RLF A;  4CHT B;  4HJ7 A;  1EY7 A;  5DM7 3;  3BZK A;  2EY2 A;  4IOC A;  5IGG A;  3S24 A;  1OXX K;  1YNN D;  4ME3 A;  4ABN A;  3DM1 A;  3NK9 A;  3TBI B;  2RSN A;  2F0V A;  4CKC A;  5LHY 1;  4A3D G;  2DN8 A;  5EAY A;  1VQM A;  1JJ2 A;  3NSW A;  3MXG A;  4ALP A;  1D2B A;  3KBG A;  3MVV A;  4O1N A;  3GTK B;  4XYO A;  3J81 L;  1SR3 A;  2AWN A;  2R6G A;  3E0E A;  5J1Z A;  4C2M B;  1YJN A;  2HT1 A;  4LK1 C;  1T5X D;  5FJ8 G;  2NVT H;  2MO0 A;  4DAP A;  5FLM G;  2WP8 J;  3SK6 A;  1EEI D;  4P72 A;  4FF2 A;  2K5W A;  1RIP A;  3EBE A;  1GKH A;  1PFM A;  1MJC A;  2JA7 G;  1SNP A;  4RGO S;  4DKA C;  4K0K L;  1UE7 A;  3L3O C;  2L15 A;  2ES2 A;  3URY A;  1N33 L;  1STY A;  3BZD B;  4B3S Q;  4DU9 A;  1GVP A;  3HKS A;  1LV9 A;  1IYU A;  5IGF A;  4GKJ Q;  1GM5 A;  3FKI B;  2OF1 A;  2JA8 B;  2B2Y A;  1FGU A;  1U4P A;  1VQJ A;  1TWH H;  1XTC D;  4OO1 I;  1WTQ A;  5C0X G;  2OT2 A;  3BZC A;  4CKE A;  1IW7 D;  3NTI A;  2KA7 A;  1S72 A;  2HCI A;  3F1Z A;  1B50 A;  1CA5 A;  3CPW A;  1EIG A;  3T1Y Q;  3S16 H;  4FO2 A;  2IHF A;  1Y14 B;  3H94 A;  4RAU C;  3E5S A;  2R93 G;  4DF7 A;  1T5E A;  1HFN A;  2HDM A;  1CFM A;  4OWX B;  3TME A;  3I7F A;  4RMF A;  1XNQ L;  2FMM A;  4IZ8 A;  1M8A A;  1GHK A;  2AMC B;  4ULL A;  1ROD A;  1KXL A;  1P8L A;  4X65 L;  1SAP A;  5ELO A;  3AQQ A;  4IPH A;  2MFI A;  1HZB A;  3R2T A;  1A62 A;  3FP9 A;  2DY7 A;  5FOB B;  2RCN A;  5CV9 A;  1QZH A;  2HHH Q;  4DK0 A;  2UXB L;  1GD7 A;  3DUZ A;  1IKM A;  4JV5 Q;  4KKU A;  1RD9 D;  1C48 A;  2CH4 W;  3D8G A;  3RUZ A;  1JB7 A;  2X6L A;  1UE6 A;  3CCR A;  3NTK A;  1STH A;  3PUY A;  1KAB A;  3EFX D;  1CI3 M;  1I4Q A;  4IFD G;  3PV0 A;  5LL6 S;  4C3H G;  3CPF A;  1S5F D;  3Q6S A;  4BBS B;  1PYS B;  4A3M H;  4RCN A;  1IBL Q;  3S1N H;  3HOW G;  4KY6 A;  4MN3 A;  5LL6 X;  3VYU A;  3S2H B;  4LF7 L;  3Q0A A;  1R9T H;  3CP0 A;  3U50 C;  2XN9 C;  2J4X A;  5I2Y A;  3NBH A;  1ESF A;  3GV3 A;  4K5W A;  1LAC A;  1I4R A;  4OX9 Q;  1D8L A;  4BXX G;  2KCC A;  2KHJ A;  1VQF A;  3BVG A;  3F2D A;  4A3I B;  2R7Z B;  3S1M B;  3KF6 A;  3I4N G;  3HOV H;  1XTD A;  1EWC A;  2PZT A;  2IX0 A;  4JI8 L;  4DR2 Q;  1PH8 A;  1CK1 A;  1QB5 D;  5L37 A;  1QZG A;  1BBX C;  3K5O A;  2KJX A;  1AE3 A;  1SN8 A;  2E2I H;  4BS9 A;  5KRU A;  1KQS A;  3CQZ H;  1M1K C;  4DAY B;  1J6Q A;  3UDF A;  4A3B G;  4R8N A;  2PYK A;  3CCL A;  1N36 L;  2B63 B;  3GTM B;  1HRJ A;  2ALY B;  2NN6 I;  2SNM A;  3CC4 A;  1CSP A;  1RDP D;  3FVQ A;  3GD7 A;  3WOF A;  5IP7 G;  1H9K A;  3G7L A;  4FYD A;  3PCO B;  4YWK A;  3A7A B;  4OWT B;  4PMC A;  1BKB A;  4OEM B;  4DV6 L;  1KAW A;  3I8Z A;  5IOD A;  3FDT A;  1FR3 A;  1G8Z D;  3RZD H;  2VW9 A;  1J5E Q;  4AYB B;  3HOZ B;  4LUO A;  4DAM A;  2F4V L;  3D31 A;  3VA5 A;  3OWF A;  3AFQ A;  1E22 A;  1N34 Q;  2EJM A;  3BDC A;  4KHV A;  1X3F A;  3OMG A;  1HNZ Q;  1TY0 A;  1SYG A;  3S15 B;  1E2Z A;  3W2D A;  2RHS B;  1PZK D;  1SE3 A;  2BDO A;  2EVB A;  3TZD A;  3MXN A;  2PQA A;  3DEO A;  2OCE A;  1JC7 A;  2NBF A;  3OMC A;  3DLL A;  4K2K A;  4OHJ A;  1JOO A;  4CJ2 C;  4UDU C;  2Z8L A;  3MAQ A;  5M3F G;  1BOS A;  1YNN C;  3M7G A;  3W1B A;  4M8A A;  1EQT A;  2OTL A;  1YJW A;  1WFQ A;  2CW0 D;  3C3L A;  1CSQ A;  1QVF A;  4YHH L;  1JJC B;  3MXU A;  4RWS C;  4DR7 L;  3VYT A;  4C1N K;  2KVM A;  1S5B D;  4DV3 Q;  5C3E B;  4K2L A;  1YJ9 A;  1JOR A;  1SE2 A;  4KN7 C;  4R8I A;  2IY5 B;  2K5D A;  3H3V H;  3K5L A;  4DFA A;  3F2B A;  1Z6H A;  5KIX A;  3OHX C;  4GOP B;  1LTT D;  1E1O A;  4JOI C;  3HOX B;  2LXJ A;  3NQT A;  2XTI A;  2RCF A;  4WFN 3;  1EYA A;  3KLS X;  4LF5 L;  3L0O A;  4LF4 L;  1VMC A;  2D0P A;  2C5C A;  3TZU A;  2F03 A;  1SFO B;  4IO9 A;  1XNR Q;  1SXT A;  1PH4 A;  1RL2 A;  4IUN A;  2UUA L;  5F2D A;  1V1P A;  2WB1 B;  3LGJ A;  1LTI D;  4AQY Q;  1L0W A;  3MHB A;  4UY8 C;  3I4M G;  2V4D A;  2EYO A;  1SMY C;  3S17 H;  3LWU A;  3C1F A;  2BA0 A;  3A8J E;  3T13 A;  4JPB W;  4IUR A;  2BH8 A;  3AU7 A;  4XQQ A;  5AFW A;  3NUC A;  2BE5 C;  1M90 C;  4FF4 A;  2K14 A;  3M4O H;  3NBI A;  1NR4 A;  2K05 A;  1FNV A;  1I6H H;  2RQX A;  3CCS A;  3CU7 A;  1X65 A;  4J6H A;  2CQO A;  4NW2 A;  1IKL A;  4U68 A;  4ZQ3 A;  5C5M A;  1YVC A;  1VQ9 A;  2PO4 A;  2SEB D;  2Q2U A;  2JP1 A;  4NB3 A;  1ET9 A;  3I91 A;  1I50 H;  3GTG B;  1LT5 D;  2M00 A;  1H9M A;  2OXP A;  3Q8D A;  3D0F A;  1HNW L;  4A3D B;  1XMQ L;  3RZO H;  1C4Q A;  4K0K Q;  4P74 A;  3QG1 A;  2IX1 A;  4ILW A;  1N33 Q;  3J80 i;  3S9W A;  1OXV A;  1V43 A;  2MPM A;  5GAG C;  1PTO B;  1TQO A;  1EYG A;  1VQG A;  3A8K E;  1B53 A;  1NJI C;  2MJ8 A;  1EY0 A;  4BY7 G;  3TN2 A;  4BWG B;  4EX5 A;  4DXG A;  3FKI G;  4OWW B;  5H1S E;  1LAB A;  2ZTD A;  3ULP A;  1BCP B;  1I6V C;  4R4T A;  4BBR H;  2ZJR A;  3J7A V;  3J7Z C;  4KHP L;  1MKH A;  2B2V C;  2JA7 B;  4HIO A;  2I0Q A;  1TVX A;  2AQ2 B;  1KLU D;  4MIU A;  4DV0 L;  1E7Z A;  4CGY B;  2B2W C;  3BU2 A;  3CCU A;  1YI2 A;  1XNQ Q;  4UHV A;  2JXM B;  4HJ9 A;  1E24 A;  4IUQ A;  3BVM A;  3GQB A;  4HJA A;  3T16 A;  4N9P A;  3KOJ A;  2XSC A;  1WCM B;  2I5L X;  4X65 Q;  1WVL A;  1WTV A;  4LW1 A;  1WOC A;  4A76 A;  1ML0 D;  1PTO D;  2I07 B;  3I4L A;  4A3L H;  2UXB Q;  1ENA A;  5IYC H;  1LT6 D;  2RA4 A;  3JC6 6;  4EQN A;  3U9S A;  5EBD A;  5GAD C;  3J80 c;  1R4P B;  3FHW A;  1JWS D;  3GTQ H;  2NVQ H;  2ZXR A;  4LF6 L;  2F0Q A;  4H02 A;  1WTX A;  3GTJ H;  1LTR D;  3H0G B;  4B08 A;  1BCP D;  4IPD A;  1ZKO A;  1F9R A;  3HRZ C;  1L1O B;  3D6W A;  1B44 D;  3J80 E;  3R3O A;  4I7A A;  3I73 A;  1Q82 C;  4OO1 G;  1NUC A;  4LF7 Q;  1HZ9 A;  2JA5 G;  4LMQ D;  1QUQ B;  1KDA A;  1A2T A;  1YNX A;  4GNX B;  1IBM Q;  4MTK A;  2NVX H;  4QGU A;  2VUM H;  5I2X A;  4HR7 B;  4PNY A;  4B3M L;  3F2C A;  1PHJ A;  2K6A A;  4I7Z C;  5C4Z A;  1E0B A;  1O7L A;  3HKZ G;  5M5W H;  4JI8 Q;  3GTO B;  4KMU C;  5KYI A;  3EJI A;  1KL9 A;  2AKW B;  3SK8 A;  2ICI A;  2ZXP A;  5K36 H;  2UXD L;  3FMC A;  2NZH A;  4GS3 A;  4AYB E;  2IWH A;  1B8A A;  1WTH A;  4KKT A;  1N36 Q;  2GVA A;  1HXY D;  5IYD H;  4C3I B;  1X54 A;  4RA8 A;  3K7A H;  2K1B A;  3CW2 C;  4H44 C;  2NZO A;  3S2D B;  2UXC L;  5ELD A;  4Q5V A;  5DNF A;  3S14 B;  2ZTE A;  3QOJ A;  5FO9 B;  2NTS A;  1XPU A;  4R4C A;  1GUO A;  3NP8 A;  4F7X A;  1Q81 C;  5E4X A;  4CDD C;  1YBY A;  1Q46 A;  2YU9 B;  4DV6 Q;  1BNZ A;  1PRT B;  2K4K A;  4QJF A;  4LF8 L;  3OW2 A;  5FLX c;  5E4W C;  5J22 A;  4G57 A;  1HA6 A;  4ZCK A;  4IQZ A;  4WOR A;  1U5K A;  3OTO L;  1VF7 A;  3P20 A;  3NPP A;  1AZP A;  4A3B H;  1E2W A;  5EPL A;  1C0A A;  2E8G A;  5FLX E;  2A1A A;  4UPA A;  1B1Z A;  4HN7 A;  4A3C G;  1E1T A;  3PIO A;  3KF8 B;  1HCZ A;  5T1I A;  5IP7 H;  2A73 B;  1CT1 D;  2CQA A;  4EVO A;  2JA6 G;  4X66 L;  1OXU A;  4XQJ A;  5C4X H;  1JR0 D;  2O2L D;  1A63 A;  1Q1E A;  2HD3 A;  1K83 H;  3SHL A;  4XTC S;  1YIT A;  4YHH Q;  4DR7 Q;  2NN6 G;  5IP9 H;  2RHQ B;  4GOP C;  5C44 H;  3EQL C;  1SE8 A;  1PRT D;  2B8F A;  5C3E G;  4IUT A;  1QVG A;  3TSS A;  4EGV A;  1ONL A;  1B3Q A;  1TS5 A;  1VQ4 A;  1DON A;  3MFY A;  1XJV A;  2ZTC A;  1LTG D;  2KBN A;  3PIO 3;  1XMO L;  2QDB A;  3F2U A;  3T53 B;  1WTW A;  3U9O A;  3HOX G;  3Q24 A;  4ZKC B;  2DY8 A;  4UAI A;  4LF5 Q;  4LF4 Q;  3K57 A;  4NP5 A;  1LTB D;  4GLA C;  4RGT A;  4PMW A;  4JBW A;  4QUC A;  1NTG A;  2PZU A;  2UUA Q;  2HCC A;  1D5X C;  1NBW A;  1JMC A;  1E2V A;  4OEL B;  4A3F G;  2GA4 B;  2WB1 G;  4MHE A;  4N9T A;  2YTX A;  3NHH A;  1IL8 A;  1Y8P B;  3M4Q A;  1PVO A;  4F87 A;  1FVI A;  4Y7N B;  4NKL A;  1DD2 A;  5KND A;  4KD4 A;  4NPS A;  5CGK A;  2A6E D;  4LUV A;  4A3G H;  3A7L A;  4Z9C B;  3DM3 A;  3R93 A;  5JPM C;  1K3B C;  1PYB A;  1Y8N B;  2L5T A;  2K5V A;  5JJZ A;  2MNA A;  4L63 B;  1C9O A;  3Q22 A;  5CV8 A;  1JJG A;  1G51 A;  4PZ6 A;  4K5V A;  1I94 L;  3D4R A;  3I4M B;  1A3V A;  5C4J H;  3M4Y A;  3M3Y B;  2CWP A;  1I3Q H;  4A93 H;  4CJ1 B;  3P7J A;  4G7O C;  3Q23 A;  3STB D;  4C3J G;  4HED A;  2D2C C;  1DCZ A;  3OSO A;  4K5X A;  1HNW Q;  3J7Y W;  1XMQ Q;  1D5Z C;  3GTP B;  5BR8 L;  1EIY B;  1EZ8 A;  1NAP A;  3CRL C;  4H0L C;  1LM0 A;  3NEL A;  1RHP A;  1JE4 A;  4DV4 L;  1X9N A;  1Q1B A;  5HGQ A;  3PIP A;  4JI7 L;  5JAV A;  4X3S A;  1WD0 A;  4JBJ A;  1D5M C;  2F0O A;  3TS2 A;  5JEA G;  3VR6 A;  3GTK H;  1BCP C;  3WWV A;  1B9M A;  2A69 D;  2EXD A;  2WIN B;  4C2M H;  1NY4 A;  4NXN L;  1SYC A;  3JAM i;  4HIM A;  1CKN A;  3MFG A;  1FD7 D;  3F8T A;  4A3K G;  4RGM A;  1OXT A;  2UUC L;  4TKO B;  2Q2H A;  4CDE C;  4H13 C;  4TSS A;  2VXW A;  4RH6 A;  2QKI C;  4KHP Q;  3S1R B;  5EKI A;  1I4P A;  1PH1 A;  4A3J G;  2JYO A;  5GAE C;  3PIP 3;  4JI0 L;  3K81 C;  4WJ3 M;  5IYB H;  3CHB D;  3KLS A;  2RBM A;  2MO1 A;  1W6K A;  3G6J B;  1STG A;  1PMR A;  4BY7 B;  4KY5 A;  4DGZ A;  3SR1 A;  1KRT A;  3A56 A;  1FL0 A;  3J80 L;  1KNE A;  1TWA B;  2LXK A;  4P71 A;  2P5Z X;  4CDC C;  1WCM G;  2E76 C;  4O2D A;  5IOC A;  2MUY A;  3HZX A;  1IBK L;  2E2H B;  3FKI H;  4HSP A;  2JA8 H;  4JBK A;  3HOY B;  1WTP A;  3LX0 A;  1UEA B;  1W3S A;  2RDF A;  1L1O C;  4LF6 Q;  1S3O A;  4BY1 H;  4DV2 L;  4HMJ A;  1TWH B;  5IY0 A;  3CCQ A;  5KNB A;  1D1K A;  3H0G G;  1XYI A;  3HOU G;  3JAM c;  3PO3 B;  4JI6 L;  3PF4 A;  3LWE A;  4QL5 A;  4DNR B;  2K01 A;  3BYY B;  1V1Q A;  4K14 A;  5IWA L;  5BN5 A;  4JI5 L;  1AN8 A;  2N88 A;  3CCJ A;  2N55 A;  3K0Y A;  3E9H A;  4DV7 L;  3JAM E;  2H4O A;  5COY A;  1K8G A;  2BCO A;  4APV A;  4POG A;  2LS0 1;  1CHQ D;  4KY7 A;  3PUZ A;  1STB A;  2F0K A;  5NUC A;  1Y1V H;  2L12 A;  4FVM A;  2FMC A;  1W6J A;  5IIF A;  1WD1 A;  4X3U A;  2F0W A;  5KYL A;  4R4Q A;  2UXD Q;  5C6A A;  4BBS H;  2JA5 B;  1FNW A;  3MXN B;  2VB3 X;  2RSO A;  2K5H A;  2QEX A;  2RDG A;  2Y0S G;  1TWF H;  3NE5 B;  3IKJ A;  2EY1 A;  4C3I G;  3S2H H;  4K6D A;  2UXC Q;  5C3W A;  4B9X A;  1G29 1;  3L7Z C;  5K5P A;  1VQD A;  3HKZ B;  5GQO A;  5C5L A;  1K8O A;  3K5N A;  1SJH D;  4G7H C;  1R9T B;  3PMF A;  2F0H A;  3K80 C;  4ZK9 B;  4A3I H;  2R7Z H;  3S1M H;  3VA7 A;  4LF9 L;  4LF8 Q;  1IYJ B;  2FHT A;  3P75 A;  2DUD A;  2F3I A;  1ENF A;  1F2L A;  3IRB A;  4L6T B;  1AZQ A;  3N52 A;  1K8A C;  2YV5 A;  3VYR A;  3D3R A;  2EYP A;  4KKS A;  3J81 j;  4U67 3;  3OTO Q;  1BXT A;  2A68 D;  3BDL A;  2R92 G;  2F0N A;  4J1M A;  2MQH A;  1G2T A;  1PH9 A;  1TWC B;  2GVB A;  3HFZ B; 
#chains in the Genus database with same CATH homology
 4MTN A;  2B63 H;  3M85 A;  4DUY Q;  3Q8D A;  2R92 H;  1JT8 A;  3D0F A;  1HZA A;  1HNW L;  1XMQ L;  1YZ6 A;  3RZO H;  3KJP A;  3ICE A;  4DR2 L;  4X66 Q;  3ULJ A;  4K0K Q;  4P74 A;  3ER0 A;  3I4O A;  2F52 A;  2Z6K A;  2IX1 A;  4A75 A;  1N33 Q;  3A74 A;  3J80 i;  4AYB G;  1Y1W G;  3HOZ G;  1A0I A;  4DUZ Q;  3UDX A;  3S1R H;  1OXV A;  1V43 A;  3RR5 A;  5GAG C;  1VQC A;  5C0X J;  3PF5 A;  4JI3 L;  1EYG A;  3G4S A;  1P16 A;  1VQG A;  2OQ0 A;  3KDF A;  4DV0 Q;  3EN2 A;  1TXY A;  2AHO B;  1NJI C;  3NBH B;  2IHE A;  4JI1 L;  4X62 L;  2UU9 L;  4BY7 G;  1Y1W H;  3HOZ H;  4A3E G;  4BBR G;  1K3R A;  3H3V I;  4EX5 A;  5M3M G;  1VQH A;  4OWW B;  3FKI G;  5H1S E;  1K9M C;  4QY7 A;  2ZTD A;  2A19 A;  2VQE L;  3ULP A;  1QUQ A;  2Z6K C;  1L2F A;  2ZM6 L;  1XMO Q;  4BY7 H;  3KF6 B;  1NMF A;  4R4T A;  4A3E H;  4BBR H;  4GNX A;  2ZJR A;  2E2J H;  1AH9 A;  5M3M H;  3J7Z C;  1I5F A;  1EWI A;  1VQN A;  1TWA H;  4KHP L;  1WI5 A;  1ASZ A;  4JBM A;  1MKH A;  3S15 H;  4YY3 L;  4A3C H;  4HIO A;  4HJ5 A;  2I0Q A;  2E2H H;  1J5E L;  2GN5 A;  3HOY H;  1A8V A;  5E7N A;  3H15 A;  3CCM A;  4DV0 L;  1E7Z A;  5JJK A;  3BU2 A;  4JOI A;  3CCU A;  2N78 A;  1YI2 A;  1CKO A;  1XNQ Q;  2E5L L;  3VDY A;  1N34 L;  4HJ9 A;  1HR0 Q;  1E24 A;  4GNX C;  3MEF A;  1Q8K A;  4HJA A;  4B3T L;  4L5S A;  1HNZ L;  3KOJ A;  4A3L G;  2I5L X;  1N32 Q;  4X65 Q;  1X3G A;  5IYC G;  4IFD J;  3W5O A;  3PO3 H;  4LW1 A;  1WOC A;  4A76 A;  4RG1 A;  4QIW E;  2PMZ E;  4A3L H;  2Y0S E;  2UXB Q;  5HY6 A;  4B3M Q;  5IYC H;  3PO2 G;  4DNI A;  5GAD C;  5M5Y H;  3JC6 6;  3PSI A;  4KHZ A;  3J80 c;  4O0A A;  3GTQ H;  3FHW A;  1IXR A;  1VQ5 A;  2NVQ H;  5AJ3 L;  2ZJQ A;  1HNX L;  3E9I A;  4LF6 L;  3B6Y A;  4H02 A;  3KDF B;  3GTJ H;  3GO5 A;  3PO2 H;  4PZ8 A;  4DR5 Q;  4IPD A;  1PH3 A;  2VQF L;  5LMN W;  3PGZ A;  2VUM G;  1VCI A;  1L1O B;  2B3G A;  2VS1 A;  4L5T A;  1Q82 C;  4OO1 G;  2OTJ A;  1I94 Q;  1SFO H;  4LF7 Q;  1HZ9 A;  2JA5 G;  4JYA L;  1U0L A;  1QUQ B;  1YNX A;  1KD1 C;  3CF5 A;  1N8R C;  2PQA B;  4GNX B;  1IBM Q;  2NVX H;  4QGU A;  2VUM H;  1VQO A;  2JK8 A;  2K75 A;  3UDG A;  4B3M L;  3F2C A;  1N9W A;  2EQS A;  1YHQ A;  3G71 A;  4R4O A;  5IT9 c;  1Q7Y C;  3NEN A;  1PHJ A;  3KLW A;  5LMU L;  2JA5 H;  2XGT A;  3UE1 A;  1AE2 A;  4DV5 L;  3GTL H;  1K0R A;  2A8V A;  3HKZ G;  2UUB Q;  1QVC A;  2ASB A;  2CKZ B;  5JEA J;  5M5W H;  4GKK Q;  3U58 A;  5K36 G;  4JI8 Q;  4FDB A;  2EIF A;  3W1G A;  5BR8 Q;  1VQ8 A;  1XPR A;  1KL9 A;  5DLQ E;  1YHB A;  1SRU A;  4P73 A;  4YWM A;  1XNR L;  2AKW B;  4DK6 C;  2KCM A;  4DV4 Q;  4JI7 Q;  1KC8 C;  1BBW A;  4IJH A;  5IYD G;  3PUV A;  2Q2T A;  2BH2 A;  1SRO A;  3RLO A;  2VL6 A;  4AQY L;  2UXD L;  3I56 A;  2NZH A;  4GS3 A;  3RLF A;  4AYB E;  4HJ7 A;  1IBM L;  1EIF A;  1B8A A;  2JE6 I;  2QGQ A;  1N36 Q;  2GVA A;  4J15 A;  5IYD H;  4JC0 A;  4NXN Q;  1X54 A;  3BZK A;  1SMX A;  2KEN A;  3K7A H;  1B70 B;  3PUX A;  3CW2 C;  4IPG A;  2NZO A;  4IOC A;  2UXC L;  3T1H Q;  2UUC Q;  2ZTE A;  1OXX K;  3S24 A;  4AH6 A;  2QA4 A;  4ME3 A;  4GKK L;  2HIV A;  2JJQ A;  1XPU A;  4R4C A;  5JJL A;  1Q81 C;  2JQO A;  1X6O A;  3GTG H;  3GTM H;  1YBY A;  4A3D G;  5EAY A;  1JJ2 A;  1Q46 A;  1HJP A;  1TWC H;  3A5U A;  4GLV B;  4X64 L;  4DV6 Q;  4DR3 L;  1VQM A;  4ALP A;  1UWV A;  2JEB I;  2K4K A;  3GDE A;  4QJF A;  3RNU A;  1FJG L;  1SR3 A;  2AWN A;  2C35 B;  2CFM A;  4JI0 Q;  2R6G A;  3E0E A;  4LF8 L;  2ID0 A;  3OW2 A;  1OXS C;  1YJN A;  5FLX c;  2HT1 A;  5FJ8 G;  4A3D H;  4LFB L;  3AEV A;  2NVT H;  1YHA A;  4JI4 L;  2MO0 A;  4R4I A;  3L2P A;  5FLM G;  2WP8 J;  1O7I A;  1U5K A;  3TEH B;  5M5X H;  3OTO L;  4JI2 Q;  2N49 A;  4P72 A;  4DR1 L;  5FJ8 H;  2D62 A;  4A3B H;  1VQE A;  1C0A A;  2E8G A;  1C7Y A;  5FLM H;  2A1A A;  4UPA A;  1RIP A;  3EBE A;  1GKH A;  1PH7 A;  1E1T A;  3PIO A;  1IBK Q;  1OTC A;  4A3C G;  5C4X G;  3KF8 B;  4DUY L;  5JJI A;  1MJC A;  4QQB X;  5IP7 H;  4P75 A;  3UE0 A;  2JA6 G;  3HOY G;  2JA7 G;  1NE3 A;  2KHI A;  4X66 L;  5LMN Q;  1OXU A;  4DKA C;  1V9P A;  1PH5 A;  4K0K L;  5IP9 G;  1UEB A;  1UE7 A;  2L15 A;  5C4X H;  1VQP A;  3TRZ A;  2ES2 A;  1A63 A;  4DV2 Q;  1Q1E A;  1Q12 A;  1N33 L;  4TQU S;  1K83 H;  3STB C;  4AIM A;  5C44 G;  1UE5 A;  4DUZ L;  4B3S Q;  3S1Q H;  4XTC S;  1YIT A;  4YHH Q;  2JA6 H;  1GVP A;  2JA7 H;  3CME A;  3HKS A;  4DR7 Q;  2V1C C;  4JI6 Q;  2NN6 G;  5IP9 H;  2RHQ B;  3U4Z A;  4DV1 Q;  4GKJ Q;  4GOP C;  4XIG S;  3PO3 G;  1GM5 A;  2ZJP A;  5C44 H;  4A4I A;  1SE8 A;  1FGU A;  5C3E G;  1QVG A;  1VQJ A;  1TWH H;  4MNO A;  4DR4 Q;  4OO1 I;  2K52 A;  1VQ4 A;  5ELN A;  4B3R Q;  5C0X G;  4DV7 Q;  1XJV A;  2ZTC A;  2KBN A;  3BZC A;  1XMO L;  1WCM H;  1X56 A;  1S72 A;  1EFW A;  5C3E H;  1LUZ A;  3HOX G;  2HQL A;  3F1Z A;  1CUK A;  1T9H A;  3CPW A;  3T1Y Q;  4LF5 Q;  4LF4 Q;  3S16 H;  2D0O A;  4L5Q A;  3J7A 5;  2IHF A;  4GLA C;  1Y14 B;  4PMW A;  4JBW A;  3HKZ E;  3HOX H;  2R93 G;  1NTG A;  4KLK A;  4OWX B;  1XNQ L;  3I7F A;  4RMF A;  2UUA Q;  4GN3 B;  1NBW A;  1JMC A;  1HR0 L;  3I2Z A;  2I5M X;  2AMC B;  3U4V A;  3G6E A;  4A3F G;  3H0G H;  1UE1 A;  2R93 H;  1KXL A;  2WB1 G;  1N32 L;  5GRO A;  1P8L A;  3KYH C;  4X65 L;  5ELO A;  4BA1 I;  3AQQ A;  2YTX A;  1KIX A;  4IPH A;  2MFI A;  1HZB A;  4NXM Q;  4A3G G;  3M4Q A;  1A62 A;  3FP9 A;  1PVO A;  1FVI A;  2N3S A;  2RCN A;  4LUZ A;  3M4P A;  3CCV A;  4A3F H;  1QZH A;  2HHH Q;  4LFC Q;  1GD7 A;  2UXB L;  4JV5 Q;  1JB7 A;  3T1Y L;  4NPS A;  3CCR A;  1UE6 A;  4LUV A;  4A3M G;  4A3G H;  3PUY A;  3A0J A;  3CC7 A;  3DM3 A;  4IFD G;  3PV0 A;  1PYB A;  3CPF A;  2KCT A;  1PH2 A;  2K5V A;  4DR6 Q;  2MNA A;  4DR5 L;  1PYS B;  4A3M H;  4LF9 Q;  1IBL Q;  1C9O A;  3S1N H;  2JA9 A;  3HOW G;  3CC2 A;  1Q86 C;  1JJG A;  1G51 A;  4PZ6 A;  3K7U C;  5J3B A;  4C3H H;  2JEA I;  1I94 L;  4A93 G;  2PI2 A;  2WFW A;  4LF7 L;  1CKM A;  1R9T H;  1EQQ A;  3CP0 A;  3U50 C;  1KRS A;  2HIX A;  4LFA Q;  3BJU A;  2PI2 E;  2RF4 A;  5C4J H;  3HOW H;  3HOV G;  2CWP A;  4OX9 Q;  1D8L A;  1I3Q H;  4A93 H;  4BXX G;  1EQR A;  2KHJ A;  1VQF A;  3J81 i;  3STB D;  5GAH C;  3F2D A;  3ZJY C;  2UUB L;  3KF6 A;  3I4N G;  3HOV H;  1XTD A;  3CMA A;  1HNW Q;  4PG3 A;  4YCV A;  1XMQ Q;  2IX0 A;  4JI8 L;  4OON A;  4BXX H;  5BR8 L;  4DR2 Q;  1EIY B;  1PH8 A;  4JCV E;  1QZG A;  3S14 H;  4C3J H;  1LM0 A;  3NEL A;  3RLN A;  3TS0 A;  4POF A;  1NMG A;  1AE3 A;  3ULL A;  1SN8 A;  4DV4 L;  1Q1B A;  5HGQ A;  3PIP A;  1X9N A;  2E2I H;  4JI7 L;  3I4N H;  4EQ5 A;  1KQS A;  2Z0S A;  3CQZ H;  1SLJ A;  1M1K C;  4JBJ A;  2YU9 H;  4DAY B;  3TS2 A;  5JEA G;  1J6Q A;  3UDF A;  1KHI A;  2VY3 A;  3OYY A;  2F4V Q;  3M7N A;  4A3B G;  3GTK H;  3WWV A;  4JI1 Q;  2UU9 Q;  4X62 Q;  3CCL A;  1N36 L;  2EXD A;  4C2M H;  1IL2 A;  3CXC A;  1NY4 A;  4NXN L;  4HIM A;  3JAM i;  2ALY B;  2NN6 I;  3CC4 A;  1CKN A;  1CSP A;  1BBU A;  3F8T A;  3GD7 A;  2VQE Q;  4A3K G;  5IP7 G;  1MIU A;  2ZM6 Q;  3T1H L;  1OXT A;  3EIV A;  4MZ9 A;  1W2B A;  1WJJ A;  3PCO B;  4YWK A;  2Q2H A;  2UUC L;  4OWT B;  2LSS A;  1BKB A;  2R7F A;  4KHP Q;  4GOP A;  1PFS A;  1VQA A;  1VQB A;  5C0X I;  4YY3 Q;  4DV6 L;  4L5R C;  2IT1 A;  5IYB G;  1VS0 A;  4A3K H;  3KFU A;  1PH1 A;  1K73 C;  1KAW A;  2DGY A;  1LTL A;  4A3J G;  4HID A;  3RZD H;  2VW9 A;  5GAE C;  1YIJ A;  1J5E Q;  4JI0 L;  4LUO A;  4DAM A;  3I55 A;  3KJO A;  4YWL A;  2F4V L;  1HZC A;  3K81 C;  4BA2 I;  3D31 A;  2WAQ G;  5IYB H;  4WJ3 M;  1G6P A;  2E5L Q;  2MO1 A;  1E22 A;  3AFQ A;  1N34 Q;  4A3J H;  1D7Q A;  1L1O A;  1KRT A;  4B3T Q;  1X3F A;  1HNZ Q;  4JI2 L;  1FL0 A;  3J81 c;  2JA8 G;  3NEM A;  5IWA Q;  2LXK A;  4P71 A;  1WCM G;  2RHS B;  1X55 A;  4JI5 Q;  2PQA A;  4O2D A;  2WB1 E;  1EOV A;  4IPC A;  2OCE A;  1PV4 A;  1IBK L;  3FKI H;  2JA8 H;  4BY1 G;  4JBK A;  3DLL A;  1DGS A;  4TVA B;  2YTV A;  2NVY H;  3TQY A;  3A5Z B;  1W3S A;  2K5N A;  4IJL A;  5LMN L;  1GO3 E;  4R1J A;  5AJ3 Q;  2B29 A;  5M3F G;  4HJ8 A;  1L1O C;  1HNX Q;  1S3O A;  3W1B A;  2OWO A;  4LF6 Q;  1B7Y B;  4KI0 A;  4DV2 L;  4BY1 H;  2OTL A;  4YCU A;  1YJW A;  1WFQ A;  4Y52 H;  5IY0 A;  4B3S L;  3CCQ A;  1CSQ A;  1QVF A;  4YHH L;  4IFD I;  1JJC B;  3H0G G;  2VQF Q;  4UP9 A;  3HOU G;  3JAM c;  3RN5 A;  3AFP A;  4DK3 C;  5M3F H;  4JI6 L;  3PF4 A;  4DR7 L;  4GKJ L;  4DV1 L;  4QL5 A;  2AWO A;  3G48 A;  1CKN B;  4DV3 Q;  1V1Q A;  1E3P A;  5IWA L;  3ERS X;  1YJ9 A;  4JYA Q;  1S40 A;  4GN4 B;  4DR4 L;  2IY5 B;  4JI5 L;  2CWA A;  3H3V H;  1H95 A;  3HOU H;  3CCJ A;  3F2B A;  4GLX A;  1LYL A;  3E9H A;  4GOP B;  2H5X A;  4DV7 L;  4B3R L;  4JOI C;  1E1O A;  1YEZ A;  2LXJ A;  1Y1V G;  1K8G A;  2CCZ A;  5LMU Q;  2XTI A;  4APV A;  4POG A;  4DV5 Q;  4PZ7 A;  4IOA A;  3PUZ A;  3L0O A;  4LF5 L;  4LF4 L;  3K0X A;  2D0P A;  4Y7N H;  4WJ4 A;  1Y1V H;  1XPO A;  2K50 A;  2VNU D;  1EUJ A;  3AYH B;  1TWG H;  4BBS G;  1Z9F A;  4UP7 A;  4IO9 A;  1XNR Q;  3UDI A;  3RN2 A;  1PH4 A;  1RL2 A;  3M9B A;  2UUA L;  1VQK A;  1X3E A;  4DV3 L;  3PUW A;  1JE5 A;  4R4Q A;  4UP8 A;  2BA1 A;  3LGJ A;  4DPG A;  4HIK A;  4AQY Q;  1L0W A;  2UXD Q;  4X6A H;  4UY8 C;  1VQ6 A;  3GTO H;  2YYZ A;  3MXN B;  4BBS H;  3I4M G;  2K5H A;  3SGI A;  3TRE A;  2QEX A;  2Y0S G;  4NXM L;  1TWF H;  3S17 H;  2N8N A;  3K8A A;  1HR0 W;  2BA0 A;  2ATW A;  1IZ6 A;  4LWC A;  4LFC L;  2HHH L;  2PNH A;  3S2H H;  4JG2 A;  3CCE A;  3CAM A;  2BH8 A;  4JV5 L;  2VZA A;  1MJE A;  3I4M H;  2UXC Q;  1G29 1;  3L7Z C;  1VQD A;  4A3I G;  2R7Z G;  5GQO A;  1ASY A;  3M3Y H;  1M90 C;  4C3I H;  1VQI A;  2K14 A;  4DR3 Q;  3M4O H;  4X64 Q;  2FXQ A;  4DR6 L;  3S2D H;  3K80 C;  4A3I H;  1FJG Q;  2R7Z H;  4OXP A;  3S1M H;  4LF9 L;  1IBL L;  1IYJ B;  4LF8 Q;  1I6H H;  2DUD A;  1BVS A;  4LFB Q;  1Z47 A;  2F3I A;  3GTP H;  3IRB A;  3CCS A;  1X65 A;  1PH6 A;  4JI4 Q;  1WYD A;  4LNQ A;  2YTY A;  4JI3 Q;  2CQO A;  1K8A C;  2YV5 A;  1HH2 P;  3J81 j;  3OTO Q;  4LFA L;  1YVC A;  1VQ9 A;  2B63 G;  2I5H A;  2WAQ E;  4DR1 Q;  2Q2U A;  3CD6 A;  4NB3 A;  2Q2I A;  2R92 G;  1I50 H;  1PA6 A;  4OX9 L;  5IE8 A;  1VQL A;  2MQH A;  2OQK A;  1PH9 A;  2R7D A;  2GVB A;  1VQ7 A;  4YCW A;  3HFZ B;  4GN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...