4K0KL

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kL00
1Y14B 2VNUD 3HKZG 3LGJA 4DK6C 3G6EA 3HKSA 4JI5L 4JI0Q 1D8LA 5FLMH 2OQKA 4X62Q 5J3BA 4LFAL 3KYHC 1MJCA 3K81C 4BA2I 4DR7Q 2D0OA 3M4PA 1JB7A 2JA5H 1K73C 4JI8L 4JI6Q 4LNQA 2JA8H 3I55A 4X66L 3S1RH 4DV3Q 2CWPA 2NN6G 1QZGA 1X3FA 3J81c 1YHBA 1L2FA 2LXJA 4TQUS 2E5LL 2I5HA 1TWGH 1VQ4A 3CCRA 3L0OA 4Y52H 2WB1G 4JBWA 1JE5A 3F8TA 1VQ8A 1UWVA 4LF7Q 1QVFA 4AYBG 4DR3Q 1A62A 1X56A 4LF6L 1HZBA 1SE8A 5IP9G 2EXDA 4QL5A 2HIXA 4LFAQ 1JMCA 4B3ML 1IZ6A 4DPGA 1TWAH 2PNHA 4JI8Q 4B3RL 2RCNA 3I2ZA 4X66Q 2VZAA 3KFUA 3STBD 5IP9H 1EYGA 4GKKL 3S14H 4POGA 4WJ3M 4DR1L 2E5LQ 1YIJA 4JV5Q 1IBLQ 3T1YL 2V1CC 2UXBQ 4IPCA 3RN5A 4HIKA 4GKJL 1OXUA 4LFBQ 4A3MG 4DAMA 3J80c 1FGUA 4A3BG 1NY4A 1XMOQ 1G291 4LF6Q 5GROA 1BBUA 1PH5A 1G51A 1OXTA 4A3JG 3H3VI 2VW9A 1VQBA 4A3MH 2D62A 3ICEA 4B3MQ 4O2DA 1BKBA 2DGYA 4OWXB 1Q86C 4JI4L 4A3BH 3GTGH 1C0AA 3JAMi 1JJGA 2I5LX 2RF4A 4R4IA 5JEAG 5BR8Q 4BBRG 4YHHL 4GKKQ 1IXRA 3S2DH 4A3JH 4DR1Q 1YZ6A 1JJCB 1KHIA 1HH2P 4A3CG 1XPRA 5IYCG 4A93G 4GKJQ 5M5YH 2MFIA 3E9IA 4JYAL 1NJIC 5EAYA 1PH4A 1VQAA 1QVCA 4LF5L 1YJWA 4BBRH 3CCVA 4DV1L 1M90C 1G6PA 3PSIA 4GLAC 4OX9L 1VQFA 3CF5A 1N36L 4A3CH 4A93H 5IYCH 4GNXC 4EX5A 4DV7Q 1J6QA 1NBWA 2AWNA 1CKNA 2MO0A 3U58A 1WI5A 1HZCA 5IWAL 4LW1A 1PH9A 5LMNL 2F4VL 3HOWG 3CCQA 1CKMA 1E1OA 4GLVB 5E7NA 3GTOH 3S16H 1MIUA 1UEBA 1WJJA 2I5MX 2OQ0A 1XJVA 4IPDA 1RIPA 2QGQA 4IPHA 1YITA 4X6AH 4ME3A 1L0WA 2Q2UA 1SFOH 1LM0A 2JA9A 1FVIA 4DR2L 1E22A 2UUAQ 1QUQB 1XNRL 3J81i 3HOWH 4LWCA 3S1NH 1VQMA 3I4NG 3TS0A 4A3LG 2ALYB 3PIPA 3A74A 1N36Q 2ZJPA 2HIVA 1A63A 2ZJQA 4K0KL 3ER0A 1IYJB 3GD7A 3TS2A 1FL0A 4IOAA 3S2HH 5GAEC 1GKHA 5IWAQ 1WCMG 5M3FG 4OWTB 4DR5L 1Y1VG 4A75A 4LF4L 3I4NH 4MZ9A 5LMNQ 2F4VQ 4A3LH 5GQOA 3UDIA 4QGUA 2NVYH 1HNZL 2MO1A 1AH9A 2D0PA 1X3EA 3OYYA 3PUWA 4A3EG 1WCMH 3DLLA 5M3FH 4OO1G 2ZJRA 2K14A 4P74A 3ZJYC 5C44G 2UU9L 2OWOA 4OWWB 1VQDA 2YV5A 4JOIA 4DV4L 2Z6KC 1OTCA 3TRZA 1HNWL 1A0IA 2CFMA 2B63G 1CSPA 1HR0L 2JK8A 3I56A 4XTCS 4GOPA 4DR6L 4A3EH 2IX1A 4JI0L 4YWMA 3J80i 4K0KQ 4QIWE 4X62L 1L1OB 4HIDA 1MKHA 4O0AA 1VQPA 5H1SE 5C44H 4DR7L 4YWKA 1Q7YC 1V1QA 2EIFA 4JI6L 1CKOA 1S3OA 2B63H 4DR5Q 1KL9A 4DV3L 1U5KA 1KXLA 3BZCA 3K7AH 1U0LA 2KHJA 3K8AA 4NB3A 3G4SA 3ULJA 1UE1A 3AFPA 4R1JA 5IY0A 3CW2C 1VQ7A 3HOZG 1A8VA 4DKAC 2UU9Q 1YNXA 4OXPA 4BXXH 5JEAJ 1GVPA 3NENA 4JI1Q 4DR3L 1HR0Q 1WOCA 4DR6Q 2A19A 2PQAB 3D31A 1I3QH 3AQQA 2CQOA 2ZTCA 3J7A5 3E0EA 4LF9L 1XPUA 3HOZH 5JJKA 3J7ZC 1VQ5A 4Y7NH 1OXXK 1VQCA 3UDGA 4JV5L 2ATWA 1IBLL 2N78A 4GN3B 3W1BA 2UXBL 3Q8DA 3RLOA 2K5NA 2BH8A 4LFBL 1C9OA 3IRBA 1K83H 3PUZA 1EIYB 1Q1EA 4DV2Q 1O7IA 2JJQA 3RLNA 1XMOL 3FKIG 2ZTDA 3K7UC 1PH3A 3HKZE 3RN2A 4LF9Q 3M85A 4RG1A 3KDFA 2UUCL 4HIMA 3KF6B 1Q12A 2CCZA 1PH7A 3FKIH 4YCWA 5BR8L 3F1ZA 4GS3A 4JI7L 4AH6A 3GTPH 2NZOA 2VQEQ 2CWAA 1VQIA 4PZ8A 3NEMA 3A5ZB 4YY3L 2YTXA 4HJ7A 1IBKQ 2K50A 4DAYB 5GADC 3BJUA 4X64Q 4WJ4A 2KCMA 4C2MH 2IHEA 1Z9FA 4P75A 1R9TH 3AFQA 2UXCQ 2L15A 4DV7L 1VQOA 1K8GA 1DGSA 5DLQE 1YJ9A 1VQGA 1CSQA 2UUCQ 2PMZE 1KRSA 2QEXA 1E24A 1XTDA 4PZ6A 2JA7G 2WFWA 4JI7Q 3M4QA 4EQ5A 2ID0A 3I4OA 3S24A 1VQ6A 1PYBA 4C3HH 1EOVA 3NBHB 3PGZA 3CPWA 4B3TQ 2F3IA 4GNXA 4YY3Q 5LMNW 2UUAL 3S1QH 4C3IH 3CCUA 2JA7H 3TQYA 1UE6A 1NMFA 3L7ZC 2YTYA 4L5TA 1PV4A 2AMCB 2Q2TA 3HFZB 1P8LA 3CMEA 3J81j 1HJPA 5C0XJ 1NE3A 2H5XA 1WYDA 2XGTA 2PI2A 5JJIA 4IFDG 1H95A 1X55A 4JBKA 1SRUA 4L5SA 1C7YA 4OO1I 4LUZA 4R4OA 2HT1A 4A3DG 2GN5A 1W3SA 4RMFA 4IO9A 4NXML 2F52A 2R7ZG 1VQJA 1SR3A 3RR5A 3EIVA 5GAHC 2HHHQ 2K75A 1SLJA 4H02A 1J5EQ 1YVCA 4DR4Q 2VY3A 1TXYA 4QQBX 1CUKA 2BH2A 2R93G 1X65A 1YEZA 2R7ZH 4KHPL 3BZKA 1FJGL 3AYHB 3PUYA 2E2IH 5K36G 2NVTH 1KAWA 2Y0SG 3WWVA 4JCVE 3PF5A 1ASZA 3HOVG 1VQLA 1OXVA 5HGQA 2NVQH 2R93H 4A76A 3PIOA 5C0XI 1HR0W 4DUYL 4P71A 2B29A 2YYZA 2KBNA 3M9BA 3G48A 1EUJA 4J15A 5M5WH 1IBML 4NXNL 2Z6KA 4MTNA 4UPAA 4X65L 3H15A 4LUOA 4IPGA 4DV5L 3HOVH 4JI3Q 5IYDG 1BVSA 1X3GA 4L5QA 4AIMA 1S72A 3RLFA 3CCSA 2BA1A 4LFCL 1Z47A 3HOXG 2Q2IA 4JG2A 1CKNB 1Y1VH 3S1MH 3CMAA 1BBWA 2WAQG 3H3VH 1L1OC 4JI1L 4DV0L 1FJGQ 4R4TA 2NN6I 5IYDH 3HOXH 4DV6Q 1X9NA 3D0FA 4QJFA 5IP7G 1XPOA 4A4IA 1YJNA 2ZTEA 1B70B 4DUYQ 3W5OA 4UP9A 3KJOA 4PG3A 1N34L 1IBMQ 4DV5Q 4X65Q 4NXNQ 4A3GG 1M1KC 5LMUL 1K0RA 1Q46A 3EN2A 3PUVA 3GTLH 4JI2Q 1N32Q 2UXDQ 1K3RA 4LFCQ 2JA6G 1HZ9A 1VCIA 2Z0SA 3U4VA 3RZDH 3CC7A 4DV2L 4A3GH 4DV0Q 2ASBA 1SMXA 5GAGC 2A8VA 3AEVA 3NELA 1K9MC 2JA6H 2KENA 5C4JH 4DUZL 3SGIA 1ASYA 1I94L 5C4XG 1D7QA 1AE3A 1VS0A 2IHFA 1N34Q 1PHJA 2A1AA 2R6GA 1KC8C 2VQEL 1I5FA 5LMUQ 4GOPB 3ULPA 2VQFL 4GN5A 4IFDJ 3A5UA 1PA6A 5C4XH 1IBKL 4B3SQ 1I50H 3GTJH 1Q8KA 2UUBQ 4X64L 3PO2G 3CP0A 4P72A 4NXMQ 2K5VA 2MQHA 3CPFA 2EQSA 2UXCL 4HJ8A 4DUZQ 3M4OH 1YHQA 4LF8Q 4DNIA 1V9PA 3OTOL 3JC66 1I94Q 4UP7A 3PO2H 1W2BA 4KHPQ 3K0XA 3FP9A 3K80C 4HJ9A 1B7YB 2JE6I 4IOCA 1X6OA 4YCVA 1PVOA 2AHOB 1K8AC 2N49A 2VQFQ 3T1HL 3BU2A 3RNUA 4B3TL 3I7FA 2NVXH 1EQRA 3S15H 1EFWA 3CCJA 3I4MG 2WB1E 4IFDI 4HJAA 4XIGS 4AYBE 1GO3E 1TWFH 1N33L 1HZAA 1B8AA 4JI5Q 2JQOA 3TEHB 2OTLA 2ES2A 2N3SA 3STBC 3I4MH 1PH2A 3OTOQ 3GO5A 1Y1WG 1OXSC 1VQEA 1YHAA 2K5HA 1Q82C 4KLKA 2FXQA 2RHSB 5C3EG 1HNXL 1TWCH 3H0GG 1XMQL 3M3YH 3S17H 1T9HA 1PH8A 1WFQA 2PI2E 2YTVA 3FHWA 4PZ7A 2HHHL 3T1HQ 1J5EL 1P16A 1Y1WH 2HQLA 2E2JH 3GTQH 4DR4L 4BA1I 1N8RC 4BBSG 4POFA 1SROA 1E3PA 1V43A 2VL6A 3KDFB 5FJ8G 2DUDA 2LXKA 5C3EH 3PUXA 3H0GH 1N33Q 3DM3A 2YU9H 3HOUG 1GM5A 1EIFA 3GTKH 4HJ5A 4KHZA 4BY7G 2R7DA 4BBSH 1QUQA 2WP8J 5FJ8H 5FLXc 3KJPA 3U4ZA 4B3RQ 5ELNA 3HOYG 3HOUH 4UY8C 5HY6A 2KHIA 1EQQA 1JT8A 1HNXQ 3CQZH 4C3JH 4AQYL 5ELOA 1XMQQ 4BY7H 3T1YQ 4JI3L 2BA0A 3CC2A 4JC0A 2IX0A 1RL2A 2R92G 1EWIA 2N8NA 3UE1A 2JEAI 3HOYH 3UDFA 1PYSB 2RHQB 1LYLA 3L2PA 4JBJA 4R4CA 3CAMA 4OONA 3F2DA 5JJLA 2MNAA 4JBMA 2ZM6L 5AJ3L 4DK3C 3KOJA 4ALPA 4DV6L 4A3IG 1PH1A 1KD1C 3MXNB 2I0QA 2R92H 4YWLA 4QY7A 4BY1G 3UE0A 4JI4Q 3CD6A 4GNXB 3OW2A 2KCTA 5M5XH 1S40A 2CKZB 1GD7A 4YHHQ 3UDXA 3B6YA 4TVAB 1LUZA 1PH6A 4AQYQ 3M7NA 1L1OA 1KIXA 4A3IH 4JI2L 4JYAQ 4BY1H 2B3GA 2XTIA 3U50C 1N32L 2UXDL 3GDEA 3TREA 3W1GA 4A3FG 4LF5Q 2AKWB 2VS1A 4DV1Q 3E9HA 1YI2A 4A3DH 1VQ9A 2VUMG 4YCUA 5IE8A 2K52A 4OX9Q 4LUVA 2ZM6Q 5AJ3Q 2NZHA 3KF8B 2Y0SE 1E7ZA 1I6HH 1KRTA 3PF4A 3ERSX 5M3MG 4A3FH 2Q2HA 5IT9c 1QVGA 2E2HH 1E1TA 2OTJA 2VUMH 3MEFA 2PQAA 3PO3G 3CCMA 2QA4A 3G71A 1XNQL 5IP7H 5M3MH 2K4KA 1LTLA 3KLWA 3CXCA 3EBEA 4R4QA 4GN4B 3CCEA 4DR2Q 4MNOA 4IJLA 4NPSA 3CCLA 4B3SL 1XNRQ 1X54A 2UUBL 2WAQE 3GTMH 3PO3H 1VQHA 1Q1BA 4GLXA 3PCOB 3VDYA 4UP8A 1NTGA 1N9WA 3JAMc 2IY5B 2AWOA 5IYBG 1MJEA 1YBYA 4PMWA 3F2CA 1UE5A 1KQSA 1TWHH 2C35B 4JOIC 4LF8L 2GVBA 4FDBA 2JEBI 1Q81C 1VQKA 1PFSA 4P73A 3CC4A 4GOPC 4LF4Q 4IJHA 1IL2A 3A0JA 2OCEA 1JJ2A 4BXXG 1HNZQ 2E8GA 2GVAA 3ULLA 4APVA 4A3KG 1UE7A 5IYBH 4HIOA 1VQNA 2R7FA 1AE2A 2IT1A 3RZOH 1XNQQ 3PV0A 4KI0A 5C0XG 2LSSA 5FLMG 3KF6A 1QZHA 1NMGA 3F2BA 4LF7L 4L5RC 4DV4Q 2JA5G 2JA8G 1HNWQ 4A3KH 1SN8A
chains in the Genus database with same CATH superfamily
3HKZG 1BNZA 3HKSA 1PLFA 3RMHA 2K32A 4JI0Q 1D8LA 1QJOA 2OQKA 4LFAL 5J3BA 1MJCA 4BA2I 1O7YA 1YNND 3M4PA 2NVYB 1CA5A 1K73C 4JI8L 4JI6Q 2RSOA 4DV3Q 1SAPA 3MXGA 4XT3B 1QZGA 1Y1VB 4TQUS 2J4XA 2I5HA 3CCRA 3OPOA 3Q6SA 4LF7Q 4FP5D 1OO9B 4J8QA 4AYBG 1QVFA 5C44B 1X56A 4IZ8A 4JPBW 2EXDA 4O1NA 1GUWA 3NBHA 4QL5A 2HIXA 4ME5A 1WTHA 3OIQA 1Q8IA 1TWAH 1GUNA 1ZYRC 4FNFA 4X66Q 3STBD 4WJ3M 5KNDA 4POGA 1BUVT 4DR1L 1ET6A 2E5LQ 1J8IA 2JP1A 3RN5A 1VF7A 4A3MG 2F0QA 4XQNA 2Q8IB 1G91A 1I3QB 1FGUA 4LF6Q 1VQBA 2D62A 1B9NA 4JI4L 3JAMi 1EY5A 2I5LX 2RF4A 4YHHL 3NBIA 5BR8Q 4GKKQ 3E0JA 3ITPA 3S2DH 1K83B 1YZ6A 2RA4A 5FLXL 5IYCG 5EAYA 5CC4A 2P5ZX 4RCOA 3A8JE 1QVCA 4L6TB 5JEAH 4BBRH 3CCVA 4LF5L 2SNSA 1U9RA 1G6PA 1IYVA 4OX9L 1ILQA 5KYIA 4A93H 1BCPF 3PO2B 2RBMA 3R93A 2RDHA 1HZCA 1JOKA 3LWUA 1PZJD 1WJJA 2I5MX 4RHRA 1TS3A 4E6IA 1YITA 1L0WA 1TWFB 2Q2UA 1LM0A 1QNUA 3MZ5A 1QUQB 3J81i 3VYTA 3MFGA 2F0OA 3TS0A 1WVLA 1BF4A 3TS2A 3S2HH 1TWCB 3WDNA 5BN5A 4MZ9A 5LMNQ 4A3LH 2QF7A 2KQ3A 3UDIA 5IT9L 1AH9A 5KEEA 1IKMA 5ELDA 3I91A 2JA7B 2EYMA 1UAPA 3DLLA 5M3FH 4OO1G 2ZJRA 2UU9L 4DGZA 3I73A 4JOIA 1A0IA 2B63G 3A55A 4DN4M 1HR0L 3I56A 4GOPA 4A3EH 3J80i 4L63B 1VQPA 1PZID 2OF1A 3HG9A 4KY6A 1Q7YC 4WFN3 2E75C 1KL9A 2EY1A 1KXLA 2RDFA 1TS4A 3K8AA 1FYCA 3ULJA 1W6KA 5IY0A 1HFGA 4DNTB 4OGQC 1TIID 3HOZG 1A8VA 1B53A 4WORA 1GVPA 2F0TA 3VR4A 2EZVA 3NENA 4JI1Q 3TSSA 2R93B 4DR6Q 4K6DA 3AQQA 2CQOA 2QW7A 4B9WA 2Y0SB 4CBVA 1BO0A 1VQ5A 2MUYA 3DWPA 1OXXK 3J7YW 2KA7A 4IUTA 4JV5L 1CFMA 2WKCA 2N78A 2K5NA 4LFBL 1PFMA 2RSNA 5KGUA 5L37A 4DV2Q 2NYZD 2JJQA 4IUPA 3FKIG 3HOXB 2XVSA 3HKZE 4G7OC 1T5XD 2WKDA 4H13C 1STAA 3GP7A 1A3TA 1MD2D 2UUCL 3NTKA 4HIMA 2IPKD 1Q12A 1PRTB 5J22A 1BCPC 1PH7A 2CCZA 4BS9A 4DXFA 3DXJC 2BDOA 3BZDB 1SYCA 3RZDB 1ML0D 4PZ8A 3NEMA 3IAYA 5GADC 4X64Q 2NUCA 1MSGA 3NSWA 5CBAE 5C4JB 1G8ZD 2F0UA 3K57A 2SNMA 4DV7L 1VQOA 1X3PA 4XQJA 1VQGA 1JC7A 2F0HA 5DNFA 2QEXA 2F03A 4C3IG 2F0DA 4PZ6A 3GQBA 2WFWA 2WV6D 4ODGA 3QG1A 2ID0A 3GTJB 3I4OA 1H9JA 4C3HH 4WJWA 4GNXA 4YY3Q 2F0GA 2IX3A 3CCUA 3TQYA 1U4RA 1P8LA 2AQ2B 4DF7A 3J81j 4IFDG 1X55A 1SRUA 2HDMA 4OHJA 2HT1A 1W3SA 4IO9A 2R7ZG 2F52A 1CA6A 3C46A 2KEDA 4H02A 2EJFC 4RA8A 4EGVA 4QF4A 5CYUA 1FGBD 2LMCB 5CV5A 3PUYA 2JN4A 3K0YA 2NVTH 1KAWA 3HOVG 1VDZA 1ASZA 1OXVA 5HGQA 2F0LA 4P71A 2DJGC 4CKEA 1WD1A 2XRQD 1EWCA 2PMZB 1Y1WB 4NXNL 3GTQB 4UPAA 1GHKA 4LUOA 4IPGA 4HEDA 1X3GA 4AIMA 4K2KA 1D5XC 3MA2B 3RLFA 2X6LA 2YU9B 3S1MH 1BBWA 3H3VH 4BBSB 1FJGQ 1YNJD 1V8QA 1U4LA 5IYDH 1WTPA 1DOMA 2G9HD 1X9NA 4QJFA 3S2DB 4DUYQ 3S9WA 3KJOA 1JWSD 2N55A 1N34L 1RJTA 4A3GG 1Q46A 1NAPA 3EN2A 1IW7D 2RQXA 5BN4A 3E6ZX 2Z0SA 3U4VA 4DV0Q 2R92B 1B1ZA 2BDNA 3NELA 5M5XB 4RKBA 1HA5A 2B2VC 3FMCA 2JA6H 4DUZL 4G7HC 4FF2A 4A3IB 1H9MA 1X3QA 5G3LD 2M9VA 4CJ0B 4TSSA 2VQEL 3K6OA 3P75A 2B8GA 4G7ZC 3A5UA 5JPNC 2F3WA 2KJXA 5CV7A 1F9RA 1I50H 2UUBQ 2E2JB 4A3FB 1YNNC 2KHSA 2MQHA 2VUMB 2UXCL 1TU2B 1A15A 4DNIA 1F77A 4QIWB 1I94Q 3SK5A 5CMDA 3K0XA 2PO4A 4HJ9A 1B7YB 1EY9A 3R2TA 3QB3A 3NQIA 1MGSA 3GTMB 3VYUA 2VQFQ 3T1HL 2K05A 3I7FA 4OEMB 3I4MG 1TWHB 1WTWA 3Q23A 2CW0D 2JQOA 1PTOF 3STBC 4JK1C 3U9OA 2E2DC 3OTOQ 3JAME 1QWYA 1YHAA 3RZOB 4ID6A 1STYA 1PDQA 2FXQA 3R3OA 2RHSB 1S5CD 1XMQL 1PH8A 2YTVA 1GUSA 4DR4L 1SMYD 4L8JA 1E3PA 1PRTF 2A6HD 3C1FA 4NP5A 4QUCA 3PUXA 5C3EH 3DM3A 3KLRA 4OELB 4C3JG 2R7DA 4MIUA 3KK7A 4RH6A 3KJPA 1KAAA 3HOYG 5HY6A 1JT8A 3K5OA 4AQYL 2F0NA 3CKIB 4JI3L 3OIPA 1F2MA 4TKOB 1EWIA 1CHQD 4X3TA 3J81E 2PZWA 1LYLA 2O4XA 2WB1B 2A68D 1DM0B 4ALPA 4DV6L 1GOZA 4YWLA 4JI4Q 1MBYA 3OW2A 4YHHQ 3B6YA 1LUZA 1KLUD 2Z1CA 2D2CC 1L1OA 2CHBD 1N32L 1WTOA 4BY1H 1JOOA 4KY5A 4LF5Q 2VB2X 4YCUA 5IE8A 2K52A 4OX9Q 2CH4A 4CJ1B 1TT2A 3J80E 3P7JA 1UUPA 2E2HH 3VA7A 4A3JB 3MEFA 2XRSD 3DEPA 5M3MH 4B3SL 3CCLA 3RD4A 2F0FA 1VQHA 1WTQA 4GLXA 2EYHA 4UP8A 3V05A 3JAMc 1A3UA 1U4MA 4PNYA 5JVG3 2LFNA 2C35B 4HN7A 2JEBI 5EPKA 2FMCA 5J39A 4IJHA 4BXXG 3ULLA 4APVA 4A3KG 3G6JB 4HIOA 1XNQQ 3PV0A 5C0XG 1G6ZA 2LSSA 1IHZA 1NMGA 1LT4D 1HTLD 2IL8A 2JA5G 3BG3A 3LGJA 4DK6C 4KKUA 3I4NB 3K81C 4DAYA 1HCZA 3TZUA 2JA8H 1I4RA 1CK1A 3I55A 1EQVA 3FEWX 3S1RH 4ZKCB 2NN6G 1WCMB 1I4GA 4N8FA 4F88A 1X3FA 3J81c 5FKAC 1TWGH 4WRDA 3L0OA 5KIXA 3J81L 3QO2A 5ELCA 5COYA 5IP9G 1SE8A 1SEBD 1JWMD 1SE2A 4EQPA 4ZK9B 5EPJA 4DPGA 1O80A 2Z8LA 1SNPA 2RCNA 3ERQA 3I2ZA 3S14H 2B2YC 4JV5Q 4GKJL 5JOBA 4LFBQ 2F0MA 3J80c 3QOLA 4A3BG 4QMGA 2JA6B 1BBUA 1PH5A 1JICA 1G51A 1OXTA 3J80L 3NWSA 4A3MH 4Y7NB 3BVMA 4B3MQ 4O2DA 4OWXB 1Q86C 4IUVA 2EY5A 4R4IA 5A35A 1IXRA 5I9PA 1HH2P 1XPRA 5M5YH 1D1KA 1PH4A 5KYLA 1PFBA 1J9OA 5EGTA 1N36L 5IYCH 4DV7Q 3I3CA 3U58A 1CKNA 1Z7TA 2MO0A 5J1ZA 4XYOA 1PH9A 1GUGA 2F4VL 3HOWG 1CKMA 5E7NA 1E2WA 2DN8A 1SE3A 4X6AH 4C2MB 4ME3A 1SFOH 1R9TB 2BE5D 1XNRL 1RTOA 2ENBA 1LABA 2EY2A 1LLRD 5EPLA 4K14A 3PIPA 3A74A 4K0KL 1IYJB 1FL0A 2NZ1D 4IOAA 5C3WA 1GKHA 5IWAQ 1AZQA 4DR5L 1Y1VG 4LF4L 5GQOA 3S1QB 4NKLA 4QGUA 2MO1A 5T1IA 4IUNA 4FVMA 4K5VA 5I2YA 2HD3A 1AP0A 1YNJC 2OWOA 5C44G 3WOEA 1VQDA 2YV5A 3NP8A 3TRZA 1CSPA 2J0TD 4XTCS 3SXHA 4OO1H 1IL8A 1V1QA 2EIFA 4ZKBB 2B63H 1HHVA 4HSVA 1SJED 1IW7C 3K7AH 1U0LA 1Z6HA 3AFPA 1VQ7A 2RDGA 4OXPA 1BQQT 3W2DA 4HAEA 4MHEA 4N8X1 4DR3L 3PIP3 2PQAB 1AZPA 1NNXA 1B9MA 1HXYD 3D31A 3HOZH 5JJKA 3J7A5 4LF9L 1XPUA 5ELEA 5IGDA 3J7ZC 3DHQA 1KNAA 5EBDA 1VQCA 3UDGA 1IBLL 3W1BA 2UXBL 3Q8DA 3RLOA 1WTVA 2BH8A 3PUZA 3IRBA 1ESRA 4QUFA 1Q1EA 1O7IA 1XMOL 2ZTDA 3V2TA 3R2IA 1D6EC 4H0LC 3LNNA 3TP5A 2K1BA 1NSNS 3MWYW 3FKIH 1STNA 2Z9HA 4AH6A 3GTPH 3FRPB 1EWHA 2NZOA 2VQEQ 1VMCA 1RF2D 2L4NA 5C5MA 2Q8TA 4HJ7A 2K50A 2CW0C 1EY6A 4P2CB 4WJ4A 2KCMA 1V1PB 4P75A 1RHPA 1T5EA 3CRLC 4B9XA 3FVQA 4HTHA 2UXCQ 1EZ8A 5IOCA 1YJ9A 2C9OA 3H6MA 1KRSA 2JA7G 4JI7Q 5C4XB 1SMYC 1EOVA 1B4OA 2A6HC 3PGZA 1ET9A 5E3FA 4C3IH 1UE6A 4L5TA 1PV4A 2AMCB 2Q2TA 1M4VA 3CMEA 5C0XJ 2EYLA 3AB9A 4G4KA 5JJIA 1STHA 4MTKA 5CORA 1C7YA 3C3LA 4OO1I 4LUZA 1TWGB 1SYEA 1VQJA 1DONA 1SLJA 4IFDH 3BVGA 3ND9A 4DR4Q 2R93G 1STEA 2A68C 2MJ8A 2R7ZH 1O78A 3TP7A 4ZYSA 3BZKA 5K36G 2Y0SG 4JCVE 1LT3D 2NVQH 3KLSX 2XN9C 1HR0W 3GV3A 2B29A 2YYZA 1LTAD 3M9BA 1TR5A 3G48A 1EUJA 5M5WH 1XWEA 1IBML 2B2TC 2Z6KA 4MTNA 4NXMQ 3HOVH 3S16H 2SDFA 1Y69U 4JI3Q 1S72A 3CCSA 2B2UA 2BA1A 1Z47A 3H0GB 3HOXG 3KLSA 1XTCD 2J7ZA 4FXDA 1KABA 4A3MB 4HSPA 3TZDA 3HRZC 3D4DA 2F0VA 2I07B 3FPUB 4DV6Q 2PZUA 4UP9A 1UEAB 1SYDA 1EY0A 4X3KA 4X65Q 4DV5Q 5LMUL 1K0RA 4KD3A 3GTLH 1N32Q 1I6VC 4LFCQ 2QILA 3CC7A 3D4WA 3SK4A 3TN2A 1O7ZA 4A3GH 1ILPA 2L5TA 1SMXA 4CGYB 1BDOA 2EVBA 4HMIA 1ENAA 1L0YB 3L3OC 2IHFA 3H3VC 2A1AA 1EYCA 3OMCA 2MHVA 3NE5B 5KRUA 3ULPA 2QCPX 1IBKL 4B3SQ 3DWQA 2K5DA 5EKKA 1I6HB 3OSOA 2EQSA 1HPCA 5IGGA 3M4OH 4KN4C 4UP7A 1W2BA 3K80C 2B39A 3GV6A 1ESFA 1LTGD 4YCVA 2LS01 1PVOA 4QCLA 3PO3B 2N49A 3RNUA 1GUOA 2NVXH 1TY0A 1EQRA 2IJ0A 4IFDI 2DJFC 2EJGC 4AYBE 1A6XA 5HURA 1HZAA 4KY7A 3J7AF 2N3SA 2TSSA 3DM1A 1PXUA 3EFXD 3I4MH 1Y1WG 2K5HA 1HNXL 4ZRZA 3S17H 3M3YH 1LTTD 2HHHL 4C56C 3OWFA 2HQLA 4BBSG 4POFA 1SROA 1V43A 3KDFB 1HUNA 1QNKA 1Y8NB 4NMZA 1N33Q 3HOUG 3D6WA 3GTKH 4BY7G 1RCVD 3UI2A 1QUQA 1DOLA 2WP8J 2ICIA 1EQQA 2IWHA 5JPMC 3CQZH 4C3JH 5ELOA 1MI2A 1RD9D 2IX0A 1RL2A 1I4HA 3A7LA 2R92G 3HOYH 3E3XA 2RHQB 3L2PA 1MHWC 4JBJA 3CAMA 4OONA 4R4CA 3F2DA 4JBMA 2ZM6L 1TWAB 2XNAC 3H09A 5AJ3L 1PH1A 2PYKA 1LTRD 4A3IG 2F0WA 3F2UA 4TVAB 1B3QA 2BE5C 2K6AA 4KHVA 1R4PB 5I6YA 1KIXA 1HA6A 3A56A 2UXDL 2B3GA 4RFBA 1HUMA 3VYRA 3W1GA 4A3FG 2AKWB 1YI2A 3E9HA 3HS0C 4A3DH 2VUMG 5FO8B 4KV6A 3MXPA 3K59A 2NZHA 3KF8B 2Y0SE 2EPBA 3PF4A 4KTAA 5DEHA 4QB4A 4HCEA 2JXMB 3CCMA 1SJHD 1F2ZA 5A2QE 3G71A 4BBRB 5IP7H 2LKVA 3CXCA 3EBEA 3T56B 1XNRQ 4NPSA 3L9AX 4S3SA 4A93B 5EQ0A 4KD4A 3VDYA 2KECA 1LACA 2AWOA 1KNEA 4JOIC 1SYFA 4P73A 4KHPL 1HTPA 4GOPC 4LF4Q 1HQMC 4XDXA 4DXGA 3W3AA 1UE7A 3TBIB 2HQEA 3NTHA 2K01A 1SNDA 5FLMG 1QZHA 2PNRC 3CRKC 3F2BA 3A54A 4L5RC 4LF7L 3IKJA 3I8ZA 4A3KH 3SK8A 3S2HB 2VNUD 2NVQB 3G6EA 5D65A 4JI5L 2L1BA 3KYHC 4RGTA 3C1EA 4ABNA 5M5WB 1JB7A 1CQFA 1SNCA 2JA5H 4X66L 1BXTA 1X32A 2CWPA 2PCFB 5M3FB 1AW7A 1AFPA 2E5LL 1B44D 1YHBA 5NUCA 3NXWA 1PFNA 4LK1C 1VQ4A 1Q90A 2OT2A 4Y52H 2WB1G 4JBWA 1JE5A 1VQ8A 4A3EB 3OOCA 4DR3Q 1A62A 4LF6L 1BR9A 4LFAQ 1FNVA 1QB5D 5FO9B 4JI8Q 3GTLB 4RGMA 5IP9H 4GKKL 4C1NI 1IBLQ 3T1YL 2V1CC 3EVQA 2UXBQ 2B2WA 2EJMA 5TSSA 4DAMA 1EY8A 2DNEA 1XMOQ 2G9DA 1EYAA 1EU3A 2IW3A 4XT1B 3H3VI 4A3JG 3BYYB 4F8MA 3Q22A 1BKBA 4A3BH 3GTGH 1C0AA 4UDUC 2KUMA 1DOKA 4DR1Q 1JJCB 1KHIA 2QDLA 1XX8A 5ISRA 1DJRD 4A3CG 4JYAL 2MFIA 3I90A 1YJWA 3PSIA 4GLAC 3M4OB 1JORA 4GNXC 4EX5A 2AWNA 1WI5A 4LW1A 2Z4IA 2F0PA 1S5FD 5LMNL 1MIUA 1XJVA 2OQ0A 1RIPA 2QGQA 2A74C 1U4PA 2KCNA 1FVIA 3HOWH 3MVVA 2K7VA 3S1NH 3I4NG 2ALYB 1A63A 3ER0A 1WCMG 1H9RA 1A3VA 5JJZA 4A75A 4FO2A 4C3HB 1CI3M 2O5IC 1D2BA 2NVYH 4NW2A 2D0PA 5CGKA 2F0EA 3MXUA 3PUWA 2H1EA 3SVMA 2BCOA 1OTCA 1I4XA 5I2XA 1HNWL 2JK8A 4DR6L 2FMMA 4YWMA 4QIWE 4X62L 4HIDA 1MKHA 4IALA 4O0AA 5H1SE 5C44H 4DR7L 1H9SA 1S3OA 3JAML 5T1GA 1F9QA 4FF1A 3MFYA 2V4DA 1SNQA 3BZCA 3EQLC 3CU7A 1E0BA 2CQAA 4NB3A 1UE1A 4R1JA 3CW2C 2UU9Q 1YNXA 5JEAJ 2NVTB 2XWJB 1HR0Q 4JW0A 5JVH3 1HFNA 2A19A 1I3QH 5DM63 3N52A 1EYDA 1JWUD 1F9PA 5HGTA 1V1OA 2ATWA 3S1MB 4A3DB 1C9OA 1K83H 1EIYB 1EFID 3PQIA 1EIGA 1ICFB 2WAQB 1CHPD 4X3SA 3KF6B 1ZEQX 3O13A 1UNSA 4YCWA 1KDBA 5C4HA 2B8FA 2E76C 3A5ZB 1TS5A 1B2TA 2HDLA 4YY3L 2YTXA 1IBKQ 1GJXA 2F0IA 3BJUA 2PW5A 1S5DD 2L12A 1Z9FA 4K6LA 5G3LF 3P1HA 1WD0A 3A8IE 1K8GA 5DLQE 1TS2A 3J7AV 1S4ZA 3K5MA 1CSQA 2UUCQ 2O5JC 2C5CA 4CDFC 1XTDA 3MTSA 3I70A 5CR3A 4EQ5A 1I50B 3S24A 1LTBD 1PYBA 4H7BA 3NBHB 2UUAL 2OEOA 1AEXA 2JA7H 1SDFA 3L7ZC 1NR2A 2YTYA 1K8MA 3HFZB 4U673 1HJPA 4RCNA 4CDCC 3QIAA 3EJIA 1WYDA 2KOLA 2PI2A 5D3IB 4JBKA 3VR2A 2DY8A 4XYQA 2GN5A 3NQTA 4RMFA 1I4PA 3RR5A 5E4WC 3EIVA 1TY2A 2HHHQ 2K75A 2AUKA 3NUCA 4IN3A 3EA6A 5CV6A 5C5LA 2BH2A 1X65A 3U9SA 1EQTA 1FJGL 3AYHB 4J6HA 4KN7C 3WWVA 1VQLA 2R93H 4A76A 3PIOA 4DUYL 2R3ZA 2KBNA 5EBCA 3H15A 3H94A 1K3BC 5C3EB 1LV9A 4DK1A 3NPPA 3K58A 4DAPA 1PTOH 1L1OC 4DV0L 1S5ED 4R4TA 1QCBD 3KBGA 3GTGB 1EU4A 3HOXH 3D0FA 3C2PA 1XPOA 3DUZA 1K0SA 2ZTEA 3W5OA 1K28A 5CV9A 3VA5A 4PG3A 4NXNQ 2KVMA 2K03A 1M1KC 5FLXE 3VR5A 2UXDQ 4TRDA 1K3RA 2EY6A 1HZ9A 1VCIA 3RZDH 4K5XA 1S5BD 2ASBA 2GA4B 4KKTA 1CQVA 5IGEA 2A8VA 3AEVA 2DNCA 1K9MC 5C4JH 2SOBA 3PIO3 1I94L 5C4XG 1PYWD 1AE3A 1D7QA 1VS0A 3URYA 1N34Q 4BY1B 1NR4A 2EE1A 1I5FA 4GOPB 5D3DA 2VQFL 4GN5A 4ZLTF 3AMUA 2X6GA 2AQ3B 3GTJH 1Q8KA 4HMJA 4CJ2C 1CTMA 3PO2G 3T16A 4P72A 2E2HB 4O42A 3VYSA 2SEBD 3CPFA 3NK9A 4HJ8A 3QJYA 4DUZQ 1YHQA 1RTNA 1V9PA 1M8AA 3OTOL 3JC66 4KHPQ 3FP9A 4H44C 5M3MB 4KMUC 4IOCA 1X6OA 3TMEA 4R9WA 4C1NK 5IT9E 2MPMA 3QR8A 3BU2A 4B3TL 5I6WA 2D9UA 3S15H 1EFWA 2NTTA 3CCJA 2FFKB 5C3XA 4HJAA 4V0BA 3FDTA 2ICEC 4OIKA 1B8AA 3X3MA 4JI5Q 4PV1C 2OTLA 2ES2A 2A73B 4K5WA 2LY7A 1PH2A 4Q5VA 2A6ED 1VQEA 3H0GG 1T9HA 3MXNA 4I7ZC 3T1HQ 4PQXA 1J5EL 1Y1WH 3GTQH 4BA1I 1N8RC 2VL6A 1IKLA 5FJ8G 2VXWA 2M2LA 1EL0A 3ND8A 2YU9H 1VF5C 4EVOA 2JA8B 1EIFA 4KHZA 4BBSH 3S1RB 3HKZB 1PMRA 1TKWB 1B3AA 5FLXc 3U4ZA 4OL7A 3HOUH 4UY8C 2KHIA 3EROA 1XMQQ 4BY7H 1XYIA 3T1YQ 2BA0A 1LT6D 2EYOA 4CHTB 4IQZA 4I7AA 3UE1A 2MP1A 3UDFA 1PYSB 3KBXA 4UAIA 4CDEC 4HCSA 3G7LA 2MNAA 4AYBB 4YIJA 1EEFD 2R92H 2I0QA 2EYPA 2A69D 3CD6A 3S14B 3UE0A 4GNXB 5M5XH 2CKZB 1GD7A 1AN8A 3UDXA 3DWAA 3P20A 1PH6A 4AQYQ 3M7NA 3E5SA 4K2LA 1GXDC 4A3IH 3V96A 4JI2L 4JYAQ 3U50C 4G57A 3BDCA 4FXGC 2AQ1B 3OW7A 4DNRB 1LT5D 1KRTA 3D6CA 4A3FH 2Q2HA 5IT9c 4B08A 2OTJA 2VUMH 2PQAA 5M5YB 3PO3G 1XNQL 1LTLA 4GN4B 3PMFA 4MNOA 1RDPD 2B2VA 2FJ2A 1X54A 3GTMH 2IY5B 5IYBG 1MJEA 1HRJA 1SE4A 1TWHH 4LF8L 4EQNA 2F0SA 4FDBA 2L0CA 4CKBA 1VQKA 1PFSA 3A0JA 1JJ2A 4KJOA 2E8GA 2GVAA 1SFOB 1EOTA 4JVZA 2WINB 1D5MC 2R7FA 3RZOH 5E4XA 4KI0A 1PTOD 4ZCKA 4IURA 1HNWQ 1SN8A 1Y14B 1A2UA 3R8BA 2FHTA 5FLMH 4X62Q 1SYGA 4DR7Q 2D0OA 4LNQA 1PRTD 1V1PA 5EJWA 1KDCA 4FYDA 2F0JA 1L2FA 2LXJA 1CT1D 1PTOB 5ELFA 3F8TA 1UWVA 2PPBC 1HZBA 1E2VA 3D8GA 3VR3A 2B63B 3X3NA 2I46A 1JMCA 1RODA 4B3ML 3K7AB 1IZ6A 2PNHA 4B3RL 4OIJA 3M7GA 2VZAA 3KFUA 1EYGA 1TVXA 4KKSA 1YIJA 3RUZA 4IPCA 4R8IA 4RHSA 4BWGB 4HIKA 1OXUA 3TP6A 5CV4A 3HOZB 1QG7A 1NY4A 1G291 4FF3A 3BVZA 5GROA 4M8AA 2XIWA 2VW9A 3SR1A 3ICEA 1CZWA 4N9TA 2DGYA 3HEJA 3H91A 1SYBA 3DEOA 1JJGA 2E74C 5JEAG 4BBRG 1SBBB 4A3JH 1STGA 5JAVA 2K5WA 4A93G 3OMGA 3KUPA 4GKJQ 3E9IA 1NJIC 1ZKOA 1VQAA 2G5DA 1M90C 4DV1L 1QILA 3ZYYX 1VQFA 3CF5A 4A3CH 1JOQA 3NWTA 3FKIB 1J6QA 1NBWA 2JSOA 5IWAL 3GTPB 3SHLA 5FOBB 3CCQA 1E1OA 1JCKB 4GLVB 3GTOH 2FINB 1UEBA 4IPDA 5CBEE 3S15B 4DU9A 3WOFA 4XXEA 1FNUA 1SSOA 4IPHA 3NHHA 2UUAQ 2JA9A 4DR2L 1E22A 4LWCA 1VQMA 4A3LG 1QOHA 3SE0A 1N36Q 3DMUA 5EKIA 2ZJPA 1CM9A 2HIVA 2PW7A 2ZJQA 4Z9CB 3GD7A 4DAVA 4NDXA 4RKLA 5GAEC 2EYFA 5ELBA 5M3FG 4OWTB 3QOJA 1QE6A 5AFWA 3I4NH 2F4VQ 1HNZL 2NTSA 4C3IB 1X3EA 3OYYA 4A3EG 1WCMH 5F2DA 2K14A 1Y8PB 4P74A 4N9PA 3ZJYC 4OWWB 4RGNA 1DCZA 5IGFA 2Z6KC 4DV4L 2CFMA 1JE4A 3BDOA 2JYOA 1F2YA 1FR3A 2B2UC 1R4QB 4JI0L 2IX1A 4K0KQ 1L1OB 3HOUB 1D5ZC 4YWKA 2EDGA 2ZXOA 4DA2A 1CKOA 4JI6L 4BY7B 4DR5Q 3ONAB 4DV3L 1U5KA 1ENFA 2KHJA 3OWEB 3G4SA 3A7AB 3T4AC 2R7ZB 2R61A 4DKAC 4BXXH 2L55A 1WOCA 4LMQD 4K8IA 4ZQ3A 5C0XH 2ZTCA 3E0EA 1BBXC 1GUTA 5C6AA 3S16B 3HOVB 4ZAIA 4Y7NH 3Q0AA 5IIFA 4GN3B 5DAUA 2O2LD 2NN6H 4R8NA 1H9SB 2L9HA 3CHBD 5E1FA 3RLNA 3K7UC 1PH3A 3D3RA 3RN2A 1KTKA 4LF9Q 2B2YA 3M85A 4RG1A 3QWNA 1CZGA 3KDFA 5C4ZA 5LL6X 3MAQA 1C48A 5BR8L 3F1ZA 4GS3A 4JI7L 1C4QA 3SDZA 1ZYRD 2CWAA 1VQIA 3M4YA 4A3GB 1GHJA 4ZUIA 4DAYB 1H9KA 4C2MH 2IHEA 1A2TA 4XQQA 1R9TH 1MSHA 1L0XB 2A6EC 3AFQA 2L15A 1EY4A 1DGSA 1G2SA 4C3HG 4FXKC 2PMZE 1LTSD 1E24A 2XWBB 2NB0A 2KEEA 2ZXPA 3M4QA 5A2QL 1VQ6A 3CPWA 4B3TQ 4FF4A 2F3IA 4DFAA 3S1QH 5LMNW 1SNOA 1VMPA 2F1MA 1K8OA 2NBFA 1NMFA 1JR0D 1O7LA 3IFDA 3LWEA 2TMPA 4Q0FA 5CV8A 5BN3A 5IGCA 1NE3A 2H5XA 1ENCA 2XGTA 1H95A 4L5SA 1JB3A 1EIHA 2RKSA 3D4RA 4R4OA 4NXML 2NVXB 3KF8A 1D1IA 1SR3A 2PZTA 5GAHC 1DZ1A 3BDLA 1J5EQ 1YVCA 5I4DA 5IGBA 2VY3A 1TXYA 4K8JA 1CUKA 4QQBX 1KDAA 1ONLA 2F0KA 1YEZA 1DXMA 2A69C 2E2IH 3I4MB 3PF5A 5C0XI 3S17B 3M3YB 1WTRA 4J15A 4A3DG 4DV5L 4X65L 3HP3A 4I65A 4ULLA 2Z4HA 5IYDG 1BVSA 4L5QA 4LFCL 3I4LA 2Q2IA 4JG2A 1CKNB 1Y1VH 4F87A 3CMAA 2L11A 2WAQG 1EEID 3GTKB 2F3VA 4JI1L 2NN6I 2D5DA 3NTIA 4J1MA 2AUJD 5IP7G 4A4IA 1YJNA 3BS1A 4LAAA 1B70B 3CQZB 4C3JB 2WIIB 1IBMQ 4IUUA 3HOYB 3PUVA 4JI2Q 3MHBA 1W6JA 3HGBA 2JA6G 5M9OA 3MC0B 4DV2L 5GAGC 3OHXC 3TP8A 5LL6S 4RWSC 2KENA 1SNMA 1XXGA 3SGIA 3GTOB 1ASYA 3SK6A 1PTOC 1PHJA 1STBA 2R6GA 3I72A 3SEBA 1KC8C 5LMUQ 4IFDJ 2CH4W 1PA6A 5C4XH 2ZT9C 2BOSA 4X64L 2M00A 2WACA 4RAUC 2F4IA 3CP0A 1LO5D 2K5VA 2EXZA 1PRTC 4HR7B 4PMCA 3LX0A 4UHVA 4LF8Q 1F2LA 2X69A 1EZ6A 1FD7D 3PO2H 2HCIA 2JE6I 2AHOB 1TQOA 1BCPD 5IODA 1K8AC 2OXPA 2HCCA 4GZYC 2QEJC 1DYQA 1IYUA 2WB1E 3FPPA 2K33A 3T53B 4XIGS 1GO3E 1TWFH 1N33L 3T51B 3TEHB 1Y8OB 5DM73 2PQEA 3GO5A 4F7XA 1OXSC 1Q82C 4KLKA 1I4QA 3T13A 1NCVA 5C3EG 1TWCH 2ZXRA 1BCPB 2NWGA 5KNCA 1WFQA 2PI2E 3FHWA 4PZ7A 5I9OA 5FK9C 2E2JH 1II3A 1F9SA 1ICWA 1P16A 1ZXTA 2EYJA 3VR6A 4A3KB 5D14A 3TDQA 2H4OA 2DUDA 2LXKA 1C8CA 4DK0A 2K04A 3H0GH 1DD2A 2B2WC 2EOTA 2JA5B 1GM5A 2A5HA 4HJ5A 1EY7A 5FJ8H 4KJNA 4B3RQ 2K28A 5ELNA 4ILWA 4U68A 2VB3X 2DY7A 1PZKD 2CVRA 1WTXA 1HNXQ 1KLGD 5K5PA 3A8KE 1NUCA 3CC2A 4JC0A 1SXTA 2N8NA 2JEAI 2KCCA 4IUQA 1BOSA 2MGSA 5JJLA 3N6RA 4CDDC 4V190 4CKCA 4DK3C 2B2TA 3KOJA 1KD1C 3MXNB 4QY7A 4ZUJA 4BY1G 2KCTA 1S40A 3K5NA 4M1UB 5K36H 3Q24A 1E2ZA 2QKIC 4KK7A 4RGOS 3MEHA 2XTIA 3GDEA 3TREA 2VS1A 4DV1Q 5EKLA 1VQ9A 2XSCA 4LUVA 3BYTB 4A3BB 2ZM6Q 1G2TA 5AJ3Q 1HQRD 1E7ZA 2RCFA 1I6HH 3ERSX 5M3MG 4X3UA 1QVGA 2Z6BA 1E1TA 2QDBA 4EQOA 2N88A 2HUGA 5KNBA 2QA4A 5FO7B 1JQYD 2K4KA 2K5QA 3KLWA 4R4QA 1LTID 3CCEA 4DR2Q 4IJLA 4MN3A 2UUBL 2WAQE 3PO3H 1Q1BA 4PMBA 3PCOB 1NTGA 1N9WA 1FNWA 1KQSA 1YBYA 3IL8A 3IFTA 1UE5A 3HZXA 4PMWA 3F2CA 1Q3LA 3K5LA 2GVBA 4LJZC 3AU7A 2RVLA 1Q81C 3CC4A 1IL2A 2OCEA 1HNZQ 5IYBH 1VQNA 1RKNA 1AE2A 2IT1A 3HOWB 3S1NB 3KF6A 2Q8RE 2E2IB 2JA8G 4DV4Q 5LHY1 1B50A
chains in the Genus database with same CATH topology
1Y14B 2VNUD 3HKZG 3LGJA 4DK6C 3G6EA 3HKSA 4JI5L 4JI0Q 1D8LA 5FLMH 2OQKA 4X62Q 5J3BA 4LFAL 3KYHC 1MJCA 3K81C 4BA2I 4DR7Q 2D0OA 3M4PA 1JB7A 2JA5H 1K73C 4JI8L 4JI6Q 4LNQA 2JA8H 3I55A 4X66L 3S1RH 4DV3Q 2CWPA 2NN6G 1QZGA 1X3FA 3J81c 1YHBA 1L2FA 2LXJA 4TQUS 2E5LL 2I5HA 1TWGH 1VQ4A 3CCRA 3L0OA 4Y52H 2WB1G 4JBWA 1JE5A 3F8TA 1VQ8A 1UWVA 4LF7Q 1QVFA 4AYBG 4DR3Q 1A62A 1X56A 4LF6L 1HZBA 1SE8A 5IP9G 2EXDA 4QL5A 2HIXA 4LFAQ 1JMCA 4B3ML 1IZ6A 4DPGA 1TWAH 2PNHA 4JI8Q 4B3RL 2RCNA 3I2ZA 4X66Q 2VZAA 3KFUA 3STBD 5IP9H 1EYGA 4GKKL 3S14H 4POGA 4WJ3M 4DR1L 2E5LQ 1YIJA 4JV5Q 1IBLQ 3T1YL 2V1CC 2UXBQ 4IPCA 3RN5A 4HIKA 4GKJL 1OXUA 4LFBQ 4A3MG 4DAMA 3J80c 1FGUA 4A3BG 1NY4A 1XMOQ 1G291 4LF6Q 5GROA 1BBUA 1PH5A 1G51A 1OXTA 4A3JG 3H3VI 2VW9A 1VQBA 4A3MH 2D62A 3ICEA 4B3MQ 4O2DA 1BKBA 2DGYA 4OWXB 1Q86C 4JI4L 4A3BH 3GTGH 1C0AA 3JAMi 1JJGA 2I5LX 2RF4A 4R4IA 5JEAG 5BR8Q 4BBRG 4YHHL 4GKKQ 1IXRA 3S2DH 4A3JH 4DR1Q 1YZ6A 1JJCB 1KHIA 1HH2P 4A3CG 1XPRA 5IYCG 4A93G 4GKJQ 5M5YH 2MFIA 3E9IA 4JYAL 1NJIC 5EAYA 1PH4A 1VQAA 1QVCA 4LF5L 1YJWA 4BBRH 3CCVA 4DV1L 1M90C 1G6PA 3PSIA 4GLAC 4OX9L 1VQFA 3CF5A 1N36L 4A3CH 4A93H 5IYCH 4GNXC 4EX5A 4DV7Q 1J6QA 1NBWA 2AWNA 1CKNA 2MO0A 3U58A 1WI5A 1HZCA 5IWAL 4LW1A 1PH9A 5LMNL 2F4VL 3HOWG 3CCQA 1CKMA 1E1OA 4GLVB 5E7NA 3GTOH 3S16H 1MIUA 1UEBA 1WJJA 2I5MX 2OQ0A 1XJVA 4IPDA 1RIPA 2QGQA 4IPHA 1YITA 4X6AH 4ME3A 1L0WA 2Q2UA 1SFOH 1LM0A 2JA9A 1FVIA 4DR2L 1E22A 2UUAQ 1QUQB 1XNRL 3J81i 3HOWH 4LWCA 3S1NH 1VQMA 3I4NG 3TS0A 4A3LG 2ALYB 3PIPA 3A74A 1N36Q 2ZJPA 2HIVA 1A63A 2ZJQA 4K0KL 3ER0A 1IYJB 3GD7A 3TS2A 1FL0A 4IOAA 3S2HH 5GAEC 1GKHA 5IWAQ 1WCMG 5M3FG 4OWTB 4DR5L 1Y1VG 4A75A 4LF4L 3I4NH 4MZ9A 5LMNQ 2F4VQ 4A3LH 5GQOA 3UDIA 4QGUA 2NVYH 1HNZL 2MO1A 1AH9A 2D0PA 1X3EA 3OYYA 3PUWA 4A3EG 1WCMH 3DLLA 5M3FH 4OO1G 2ZJRA 2K14A 4P74A 3ZJYC 5C44G 2UU9L 2OWOA 4OWWB 1VQDA 2YV5A 4JOIA 4DV4L 2Z6KC 1OTCA 3TRZA 1HNWL 1A0IA 2CFMA 2B63G 1CSPA 1HR0L 2JK8A 3I56A 4XTCS 4GOPA 4DR6L 4A3EH 2IX1A 4JI0L 4YWMA 3J80i 4K0KQ 4QIWE 4X62L 1L1OB 4HIDA 1MKHA 4O0AA 1VQPA 5H1SE 5C44H 4DR7L 4YWKA 1Q7YC 1V1QA 2EIFA 4JI6L 1CKOA 1S3OA 2B63H 4DR5Q 1KL9A 4DV3L 1U5KA 1KXLA 3BZCA 3K7AH 1U0LA 2KHJA 3K8AA 4NB3A 3G4SA 3ULJA 1UE1A 3AFPA 4R1JA 5IY0A 3CW2C 1VQ7A 3HOZG 1A8VA 4DKAC 2UU9Q 1YNXA 4OXPA 4BXXH 5JEAJ 1GVPA 3NENA 4JI1Q 4DR3L 1HR0Q 1WOCA 4DR6Q 2A19A 2PQAB 3D31A 1I3QH 3AQQA 2CQOA 2ZTCA 3J7A5 3E0EA 4LF9L 1XPUA 3HOZH 5JJKA 3J7ZC 1VQ5A 4Y7NH 1OXXK 1VQCA 3UDGA 4JV5L 2ATWA 1IBLL 2N78A 4GN3B 3W1BA 2UXBL 3Q8DA 3RLOA 2K5NA 2BH8A 4LFBL 1C9OA 3IRBA 1K83H 3PUZA 1EIYB 1Q1EA 4DV2Q 1O7IA 2JJQA 3RLNA 1XMOL 3FKIG 2ZTDA 3K7UC 1PH3A 3HKZE 3RN2A 4LF9Q 3M85A 4RG1A 3KDFA 2UUCL 4HIMA 3KF6B 1Q12A 2CCZA 1PH7A 3FKIH 4YCWA 5BR8L 3F1ZA 4GS3A 4JI7L 4AH6A 3GTPH 2NZOA 2VQEQ 2CWAA 1VQIA 4PZ8A 3NEMA 3A5ZB 4YY3L 2YTXA 4HJ7A 1IBKQ 2K50A 4DAYB 5GADC 3BJUA 4X64Q 4WJ4A 2KCMA 4C2MH 2IHEA 1Z9FA 4P75A 1R9TH 3AFQA 2UXCQ 2L15A 4DV7L 1VQOA 1K8GA 1DGSA 5DLQE 1YJ9A 1VQGA 1CSQA 2UUCQ 2PMZE 1KRSA 2QEXA 1E24A 1XTDA 4PZ6A 2JA7G 2WFWA 4JI7Q 3M4QA 4EQ5A 2ID0A 3I4OA 3S24A 1VQ6A 1PYBA 4C3HH 1EOVA 3NBHB 3PGZA 3CPWA 4B3TQ 2F3IA 4GNXA 4YY3Q 5LMNW 2UUAL 3S1QH 4C3IH 3CCUA 2JA7H 3TQYA 1UE6A 1NMFA 3L7ZC 2YTYA 4L5TA 1PV4A 2AMCB 2Q2TA 3HFZB 1P8LA 3CMEA 3J81j 1HJPA 5C0XJ 1NE3A 2H5XA 1WYDA 2XGTA 2PI2A 5JJIA 4IFDG 1H95A 1X55A 4JBKA 1SRUA 4L5SA 1C7YA 4OO1I 4LUZA 4R4OA 2HT1A 4A3DG 2GN5A 1W3SA 4RMFA 4IO9A 4NXML 2F52A 2R7ZG 1VQJA 1SR3A 3RR5A 3EIVA 5GAHC 2HHHQ 2K75A 1SLJA 4H02A 1J5EQ 1YVCA 4DR4Q 2VY3A 1TXYA 4QQBX 1CUKA 2BH2A 2R93G 1X65A 1YEZA 2R7ZH 4KHPL 3BZKA 1FJGL 3AYHB 3PUYA 2E2IH 5K36G 2NVTH 1KAWA 2Y0SG 3WWVA 4JCVE 3PF5A 1ASZA 3HOVG 1VQLA 1OXVA 5HGQA 2NVQH 2R93H 4A76A 3PIOA 5C0XI 1HR0W 4DUYL 4P71A 2B29A 2YYZA 2KBNA 3M9BA 3G48A 1EUJA 4J15A 5M5WH 1IBML 4NXNL 2Z6KA 4MTNA 4UPAA 4X65L 3H15A 4LUOA 4IPGA 4DV5L 3HOVH 4JI3Q 5IYDG 1BVSA 1X3GA 4L5QA 4AIMA 1S72A 3RLFA 3CCSA 2BA1A 4LFCL 1Z47A 3HOXG 2Q2IA 4JG2A 1CKNB 1Y1VH 3S1MH 3CMAA 1BBWA 2WAQG 3H3VH 1L1OC 4JI1L 4DV0L 1FJGQ 4R4TA 2NN6I 5IYDH 3HOXH 4DV6Q 1X9NA 3D0FA 4QJFA 5IP7G 1XPOA 4A4IA 1YJNA 2ZTEA 1B70B 4DUYQ 3W5OA 4UP9A 3KJOA 4PG3A 1N34L 1IBMQ 4DV5Q 4X65Q 4NXNQ 4A3GG 1M1KC 5LMUL 1K0RA 1Q46A 3EN2A 3PUVA 3GTLH 4JI2Q 1N32Q 2UXDQ 1K3RA 4LFCQ 2JA6G 1HZ9A 1VCIA 2Z0SA 3U4VA 3RZDH 3CC7A 4DV2L 4A3GH 4DV0Q 2ASBA 1SMXA 5GAGC 2A8VA 3AEVA 3NELA 1K9MC 2JA6H 2KENA 5C4JH 4DUZL 3SGIA 1ASYA 1I94L 5C4XG 1D7QA 1AE3A 1VS0A 2IHFA 1N34Q 1PHJA 2A1AA 2R6GA 1KC8C 2VQEL 1I5FA 5LMUQ 4GOPB 3ULPA 2VQFL 4GN5A 4IFDJ 3A5UA 1PA6A 5C4XH 1IBKL 4B3SQ 1I50H 3GTJH 1Q8KA 2UUBQ 4X64L 3PO2G 3CP0A 4P72A 4NXMQ 2K5VA 2MQHA 3CPFA 2EQSA 2UXCL 4HJ8A 4DUZQ 3M4OH 1YHQA 4LF8Q 4DNIA 1V9PA 3OTOL 3JC66 1I94Q 4UP7A 3PO2H 1W2BA 4KHPQ 3K0XA 3FP9A 3K80C 4HJ9A 1B7YB 2JE6I 4IOCA 1X6OA 4YCVA 1PVOA 2AHOB 1K8AC 2N49A 2VQFQ 3T1HL 3BU2A 3RNUA 4B3TL 3I7FA 2NVXH 1EQRA 3S15H 1EFWA 3CCJA 3I4MG 2WB1E 4IFDI 4HJAA 4XIGS 4AYBE 1GO3E 1TWFH 1N33L 1HZAA 1B8AA 4JI5Q 2JQOA 3TEHB 2OTLA 2ES2A 2N3SA 3STBC 3I4MH 1PH2A 3OTOQ 3GO5A 1Y1WG 1OXSC 1VQEA 1YHAA 2K5HA 1Q82C 4KLKA 2FXQA 2RHSB 5C3EG 1HNXL 1TWCH 3H0GG 1XMQL 3M3YH 3S17H 1T9HA 1PH8A 1WFQA 2PI2E 2YTVA 3FHWA 4PZ7A 2HHHL 3T1HQ 1J5EL 1P16A 1Y1WH 2HQLA 2E2JH 3GTQH 4DR4L 4BA1I 1N8RC 4BBSG 4POFA 1SROA 1E3PA 1V43A 2VL6A 3KDFB 5FJ8G 2DUDA 2LXKA 5C3EH 3PUXA 3H0GH 1N33Q 3DM3A 2YU9H 3HOUG 1GM5A 1EIFA 3GTKH 4HJ5A 4KHZA 4BY7G 2R7DA 4BBSH 1QUQA 2WP8J 5FJ8H 5FLXc 3KJPA 3U4ZA 4B3RQ 5ELNA 3HOYG 3HOUH 4UY8C 5HY6A 2KHIA 1EQQA 1JT8A 1HNXQ 3CQZH 4C3JH 4AQYL 5ELOA 1XMQQ 4BY7H 3T1YQ 4JI3L 2BA0A 3CC2A 4JC0A 2IX0A 1RL2A 2R92G 1EWIA 2N8NA 3UE1A 2JEAI 3HOYH 3UDFA 1PYSB 2RHQB 1LYLA 3L2PA 4JBJA 4R4CA 3CAMA 4OONA 3F2DA 5JJLA 2MNAA 4JBMA 2ZM6L 5AJ3L 4DK3C 3KOJA 4ALPA 4DV6L 4A3IG 1PH1A 1KD1C 3MXNB 2I0QA 2R92H 4YWLA 4QY7A 4BY1G 3UE0A 4JI4Q 3CD6A 4GNXB 3OW2A 2KCTA 5M5XH 1S40A 2CKZB 1GD7A 4YHHQ 3UDXA 3B6YA 4TVAB 1LUZA 1PH6A 4AQYQ 3M7NA 1L1OA 1KIXA 4A3IH 4JI2L 4JYAQ 4BY1H 2B3GA 2XTIA 3U50C 1N32L 2UXDL 3GDEA 3TREA 3W1GA 4A3FG 4LF5Q 2AKWB 2VS1A 4DV1Q 3E9HA 1YI2A 4A3DH 1VQ9A 2VUMG 4YCUA 5IE8A 2K52A 4OX9Q 4LUVA 2ZM6Q 5AJ3Q 2NZHA 3KF8B 2Y0SE 1E7ZA 1I6HH 1KRTA 3PF4A 3ERSX 5M3MG 4A3FH 2Q2HA 5IT9c 1QVGA 2E2HH 1E1TA 2OTJA 2VUMH 3MEFA 2PQAA 3PO3G 3CCMA 2QA4A 3G71A 1XNQL 5IP7H 5M3MH 2K4KA 1LTLA 3KLWA 3CXCA 3EBEA 4R4QA 4GN4B 3CCEA 4DR2Q 4MNOA 4IJLA 4NPSA 3CCLA 4B3SL 1XNRQ 1X54A 2UUBL 2WAQE 3GTMH 3PO3H 1VQHA 1Q1BA 4GLXA 3PCOB 3VDYA 4UP8A 1NTGA 1N9WA 3JAMc 2IY5B 2AWOA 5IYBG 1MJEA 1YBYA 4PMWA 3F2CA 1UE5A 1KQSA 1TWHH 2C35B 4JOIC 4LF8L 2GVBA 4FDBA 2JEBI 1Q81C 1VQKA 1PFSA 4P73A 3CC4A 4GOPC 4LF4Q 4IJHA 1IL2A 3A0JA 2OCEA 1JJ2A 4BXXG 1HNZQ 2E8GA 2GVAA 3ULLA 4APVA 4A3KG 1UE7A 5IYBH 4HIOA 1VQNA 2R7FA 1AE2A 2IT1A 3RZOH 1XNQQ 3PV0A 4KI0A 5C0XG 2LSSA 5FLMG 3KF6A 1QZHA 1NMGA 3F2BA 4LF7L 4L5RC 4DV4Q 2JA5G 2JA8G 1HNWQ 4A3KH 1SN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y14 B;  2VNU D;  3HKZ G;  3LGJ A;  4DK6 C;  3G6E A;  3HKS A;  4JI5 L;  4JI0 Q;  1D8L A;  5FLM H;  2OQK A;  4X62 Q;  5J3B A;  4LFA L;  3KYH C;  1MJC A;  3K81 C;  4BA2 I;  4DR7 Q;  2D0O A;  3M4P A;  1JB7 A;  2JA5 H;  1K73 C;  4JI8 L;  4JI6 Q;  4LNQ A;  2JA8 H;  3I55 A;  4X66 L;  3S1R H;  4DV3 Q;  2CWP A;  2NN6 G;  1QZG A;  1X3F A;  3J81 c;  1YHB A;  1L2F A;  2LXJ A;  4TQU S;  2E5L L;  2I5H A;  1TWG H;  1VQ4 A;  3CCR A;  3L0O A;  4Y52 H;  2WB1 G;  4JBW A;  1JE5 A;  3F8T A;  1VQ8 A;  1UWV A;  4LF7 Q;  1QVF A;  4AYB G;  4DR3 Q;  1A62 A;  1X56 A;  4LF6 L;  1HZB A;  1SE8 A;  5IP9 G;  2EXD A;  4QL5 A;  2HIX A;  4LFA Q;  1JMC A;  4B3M L;  1IZ6 A;  4DPG A;  1TWA H;  2PNH A;  4JI8 Q;  4B3R L;  2RCN A;  3I2Z A;  4X66 Q;  2VZA A;  3KFU A;  3STB D;  5IP9 H;  1EYG A;  4GKK L;  3S14 H;  4POG A;  4WJ3 M;  4DR1 L;  2E5L Q;  1YIJ A;  4JV5 Q;  1IBL Q;  3T1Y L;  2V1C C;  2UXB Q;  4IPC A;  3RN5 A;  4HIK A;  4GKJ L;  1OXU A;  4LFB Q;  4A3M G;  4DAM A;  3J80 c;  1FGU A;  4A3B G;  1NY4 A;  1XMO Q;  1G29 1;  4LF6 Q;  5GRO A;  1BBU A;  1PH5 A;  1G51 A;  1OXT A;  4A3J G;  3H3V I;  2VW9 A;  1VQB A;  4A3M H;  2D62 A;  3ICE A;  4B3M Q;  4O2D A;  1BKB A;  2DGY A;  4OWX B;  1Q86 C;  4JI4 L;  4A3B H;  3GTG H;  1C0A A;  3JAM i;  1JJG A;  2I5L X;  2RF4 A;  4R4I A;  5JEA G;  5BR8 Q;  4BBR G;  4YHH L;  4GKK Q;  1IXR A;  3S2D H;  4A3J H;  4DR1 Q;  1YZ6 A;  1JJC B;  1KHI A;  1HH2 P;  4A3C G;  1XPR A;  5IYC G;  4A93 G;  4GKJ Q;  5M5Y H;  2MFI A;  3E9I A;  4JYA L;  1NJI C;  5EAY A;  1PH4 A;  1VQA A;  1QVC A;  4LF5 L;  1YJW A;  4BBR H;  3CCV A;  4DV1 L;  1M90 C;  1G6P A;  3PSI A;  4GLA C;  4OX9 L;  1VQF A;  3CF5 A;  1N36 L;  4A3C H;  4A93 H;  5IYC H;  4GNX C;  4EX5 A;  4DV7 Q;  1J6Q A;  1NBW A;  2AWN A;  1CKN A;  2MO0 A;  3U58 A;  1WI5 A;  1HZC A;  5IWA L;  4LW1 A;  1PH9 A;  5LMN L;  2F4V L;  3HOW G;  3CCQ A;  1CKM A;  1E1O A;  4GLV B;  5E7N A;  3GTO H;  3S16 H;  1MIU A;  1UEB A;  1WJJ A;  2I5M X;  2OQ0 A;  1XJV A;  4IPD A;  1RIP A;  2QGQ A;  4IPH A;  1YIT A;  4X6A H;  4ME3 A;  1L0W A;  2Q2U A;  1SFO H;  1LM0 A;  2JA9 A;  1FVI A;  4DR2 L;  1E22 A;  2UUA Q;  1QUQ B;  1XNR L;  3J81 i;  3HOW H;  4LWC A;  3S1N H;  1VQM A;  3I4N G;  3TS0 A;  4A3L G;  2ALY B;  3PIP A;  3A74 A;  1N36 Q;  2ZJP A;  2HIV A;  1A63 A;  2ZJQ A;  4K0K L;  3ER0 A;  1IYJ B;  3GD7 A;  3TS2 A;  1FL0 A;  4IOA A;  3S2H H;  5GAE C;  1GKH A;  5IWA Q;  1WCM G;  5M3F G;  4OWT B;  4DR5 L;  1Y1V G;  4A75 A;  4LF4 L;  3I4N H;  4MZ9 A;  5LMN Q;  2F4V Q;  4A3L H;  5GQO A;  3UDI A;  4QGU A;  2NVY H;  1HNZ L;  2MO1 A;  1AH9 A;  2D0P A;  1X3E A;  3OYY A;  3PUW A;  4A3E G;  1WCM H;  3DLL A;  5M3F H;  4OO1 G;  2ZJR A;  2K14 A;  4P74 A;  3ZJY C;  5C44 G;  2UU9 L;  2OWO A;  4OWW B;  1VQD A;  2YV5 A;  4JOI A;  4DV4 L;  2Z6K C;  1OTC A;  3TRZ A;  1HNW L;  1A0I A;  2CFM A;  2B63 G;  1CSP A;  1HR0 L;  2JK8 A;  3I56 A;  4XTC S;  4GOP A;  4DR6 L;  4A3E H;  2IX1 A;  4JI0 L;  4YWM A;  3J80 i;  4K0K Q;  4QIW E;  4X62 L;  1L1O B;  4HID A;  1MKH A;  4O0A A;  1VQP A;  5H1S E;  5C44 H;  4DR7 L;  4YWK A;  1Q7Y C;  1V1Q A;  2EIF A;  4JI6 L;  1CKO A;  1S3O A;  2B63 H;  4DR5 Q;  1KL9 A;  4DV3 L;  1U5K A;  1KXL A;  3BZC A;  3K7A H;  1U0L A;  2KHJ A;  3K8A A;  4NB3 A;  3G4S A;  3ULJ A;  1UE1 A;  3AFP A;  4R1J A;  5IY0 A;  3CW2 C;  1VQ7 A;  3HOZ G;  1A8V A;  4DKA C;  2UU9 Q;  1YNX A;  4OXP A;  4BXX H;  5JEA J;  1GVP A;  3NEN A;  4JI1 Q;  4DR3 L;  1HR0 Q;  1WOC A;  4DR6 Q;  2A19 A;  2PQA B;  3D31 A;  1I3Q H;  3AQQ A;  2CQO A;  2ZTC A;  3J7A 5;  3E0E A;  4LF9 L;  1XPU A;  3HOZ H;  5JJK A;  3J7Z C;  1VQ5 A;  4Y7N H;  1OXX K;  1VQC A;  3UDG A;  4JV5 L;  2ATW A;  1IBL L;  2N78 A;  4GN3 B;  3W1B A;  2UXB L;  3Q8D A;  3RLO A;  2K5N A;  2BH8 A;  4LFB L;  1C9O A;  3IRB A;  1K83 H;  3PUZ A;  1EIY B;  1Q1E A;  4DV2 Q;  1O7I A;  2JJQ A;  3RLN A;  1XMO L;  3FKI G;  2ZTD A;  3K7U C;  1PH3 A;  3HKZ E;  3RN2 A;  4LF9 Q;  3M85 A;  4RG1 A;  3KDF A;  2UUC L;  4HIM A;  3KF6 B;  1Q12 A;  2CCZ A;  1PH7 A;  3FKI H;  4YCW A;  5BR8 L;  3F1Z A;  4GS3 A;  4JI7 L;  4AH6 A;  3GTP H;  2NZO A;  2VQE Q;  2CWA A;  1VQI A;  4PZ8 A;  3NEM A;  3A5Z B;  4YY3 L;  2YTX A;  4HJ7 A;  1IBK Q;  2K50 A;  4DAY B;  5GAD C;  3BJU A;  4X64 Q;  4WJ4 A;  2KCM A;  4C2M H;  2IHE A;  1Z9F A;  4P75 A;  1R9T H;  3AFQ A;  2UXC Q;  2L15 A;  4DV7 L;  1VQO A;  1K8G A;  1DGS A;  5DLQ E;  1YJ9 A;  1VQG A;  1CSQ A;  2UUC Q;  2PMZ E;  1KRS A;  2QEX A;  1E24 A;  1XTD A;  4PZ6 A;  2JA7 G;  2WFW A;  4JI7 Q;  3M4Q A;  4EQ5 A;  2ID0 A;  3I4O A;  3S24 A;  1VQ6 A;  1PYB A;  4C3H H;  1EOV A;  3NBH B;  3PGZ A;  3CPW A;  4B3T Q;  2F3I A;  4GNX A;  4YY3 Q;  5LMN W;  2UUA L;  3S1Q H;  4C3I H;  3CCU A;  2JA7 H;  3TQY A;  1UE6 A;  1NMF A;  3L7Z C;  2YTY A;  4L5T A;  1PV4 A;  2AMC B;  2Q2T A;  3HFZ B;  1P8L A;  3CME A;  3J81 j;  1HJP A;  5C0X J;  1NE3 A;  2H5X A;  1WYD A;  2XGT A;  2PI2 A;  5JJI A;  4IFD G;  1H95 A;  1X55 A;  4JBK A;  1SRU A;  4L5S A;  1C7Y A;  4OO1 I;  4LUZ A;  4R4O A;  2HT1 A;  4A3D G;  2GN5 A;  1W3S A;  4RMF A;  4IO9 A;  4NXM L;  2F52 A;  2R7Z G;  1VQJ A;  1SR3 A;  3RR5 A;  3EIV A;  5GAH C;  2HHH Q;  2K75 A;  1SLJ A;  4H02 A;  1J5E Q;  1YVC A;  4DR4 Q;  2VY3 A;  1TXY A;  4QQB X;  1CUK A;  2BH2 A;  2R93 G;  1X65 A;  1YEZ A;  2R7Z H;  4KHP L;  3BZK A;  1FJG L;  3AYH B;  3PUY A;  2E2I H;  5K36 G;  2NVT H;  1KAW A;  2Y0S G;  3WWV A;  4JCV E;  3PF5 A;  1ASZ A;  3HOV G;  1VQL A;  1OXV A;  5HGQ A;  2NVQ H;  2R93 H;  4A76 A;  3PIO A;  5C0X I;  1HR0 W;  4DUY L;  4P71 A;  2B29 A;  2YYZ A;  2KBN A;  3M9B A;  3G48 A;  1EUJ A;  4J15 A;  5M5W H;  1IBM L;  4NXN L;  2Z6K A;  4MTN A;  4UPA A;  4X65 L;  3H15 A;  4LUO A;  4IPG A;  4DV5 L;  3HOV H;  4JI3 Q;  5IYD G;  1BVS A;  1X3G A;  4L5Q A;  4AIM A;  1S72 A;  3RLF A;  3CCS A;  2BA1 A;  4LFC L;  1Z47 A;  3HOX G;  2Q2I A;  4JG2 A;  1CKN B;  1Y1V H;  3S1M H;  3CMA A;  1BBW A;  2WAQ G;  3H3V H;  1L1O C;  4JI1 L;  4DV0 L;  1FJG Q;  4R4T A;  2NN6 I;  5IYD H;  3HOX H;  4DV6 Q;  1X9N A;  3D0F A;  4QJF A;  5IP7 G;  1XPO A;  4A4I A;  1YJN A;  2ZTE A;  1B70 B;  4DUY Q;  3W5O A;  4UP9 A;  3KJO A;  4PG3 A;  1N34 L;  1IBM Q;  4DV5 Q;  4X65 Q;  4NXN Q;  4A3G G;  1M1K C;  5LMU L;  1K0R A;  1Q46 A;  3EN2 A;  3PUV A;  3GTL H;  4JI2 Q;  1N32 Q;  2UXD Q;  1K3R A;  4LFC Q;  2JA6 G;  1HZ9 A;  1VCI A;  2Z0S A;  3U4V A;  3RZD H;  3CC7 A;  4DV2 L;  4A3G H;  4DV0 Q;  2ASB A;  1SMX A;  5GAG C;  2A8V A;  3AEV A;  3NEL A;  1K9M C;  2JA6 H;  2KEN A;  5C4J H;  4DUZ L;  3SGI A;  1ASY A;  1I94 L;  5C4X G;  1D7Q A;  1AE3 A;  1VS0 A;  2IHF A;  1N34 Q;  1PHJ A;  2A1A A;  2R6G A;  1KC8 C;  2VQE L;  1I5F A;  5LMU Q;  4GOP B;  3ULP A;  2VQF L;  4GN5 A;  4IFD J;  3A5U A;  1PA6 A;  5C4X H;  1IBK L;  4B3S Q;  1I50 H;  3GTJ H;  1Q8K A;  2UUB Q;  4X64 L;  3PO2 G;  3CP0 A;  4P72 A;  4NXM Q;  2K5V A;  2MQH A;  3CPF A;  2EQS A;  2UXC L;  4HJ8 A;  4DUZ Q;  3M4O H;  1YHQ A;  4LF8 Q;  4DNI A;  1V9P A;  3OTO L;  3JC6 6;  1I94 Q;  4UP7 A;  3PO2 H;  1W2B A;  4KHP Q;  3K0X A;  3FP9 A;  3K80 C;  4HJ9 A;  1B7Y B;  2JE6 I;  4IOC A;  1X6O A;  4YCV A;  1PVO A;  2AHO B;  1K8A C;  2N49 A;  2VQF Q;  3T1H L;  3BU2 A;  3RNU A;  4B3T L;  3I7F A;  2NVX H;  1EQR A;  3S15 H;  1EFW A;  3CCJ A;  3I4M G;  2WB1 E;  4IFD I;  4HJA A;  4XIG S;  4AYB E;  1GO3 E;  1TWF H;  1N33 L;  1HZA A;  1B8A A;  4JI5 Q;  2JQO A;  3TEH B;  2OTL A;  2ES2 A;  2N3S A;  3STB C;  3I4M H;  1PH2 A;  3OTO Q;  3GO5 A;  1Y1W G;  1OXS C;  1VQE A;  1YHA A;  2K5H A;  1Q82 C;  4KLK A;  2FXQ A;  2RHS B;  5C3E G;  1HNX L;  1TWC H;  3H0G G;  1XMQ L;  3M3Y H;  3S17 H;  1T9H A;  1PH8 A;  1WFQ A;  2PI2 E;  2YTV A;  3FHW A;  4PZ7 A;  2HHH L;  3T1H Q;  1J5E L;  1P16 A;  1Y1W H;  2HQL A;  2E2J H;  3GTQ H;  4DR4 L;  4BA1 I;  1N8R C;  4BBS G;  4POF A;  1SRO A;  1E3P A;  1V43 A;  2VL6 A;  3KDF B;  5FJ8 G;  2DUD A;  2LXK A;  5C3E H;  3PUX A;  3H0G H;  1N33 Q;  3DM3 A;  2YU9 H;  3HOU G;  1GM5 A;  1EIF A;  3GTK H;  4HJ5 A;  4KHZ A;  4BY7 G;  2R7D A;  4BBS H;  1QUQ A;  2WP8 J;  5FJ8 H;  5FLX c;  3KJP A;  3U4Z A;  4B3R Q;  5ELN A;  3HOY G;  3HOU H;  4UY8 C;  5HY6 A;  2KHI A;  1EQQ A;  1JT8 A;  1HNX Q;  3CQZ H;  4C3J H;  4AQY L;  5ELO A;  1XMQ Q;  4BY7 H;  3T1Y Q;  4JI3 L;  2BA0 A;  3CC2 A;  4JC0 A;  2IX0 A;  1RL2 A;  2R92 G;  1EWI A;  2N8N A;  3UE1 A;  2JEA I;  3HOY H;  3UDF A;  1PYS B;  2RHQ B;  1LYL A;  3L2P A;  4JBJ A;  4R4C A;  3CAM A;  4OON A;  3F2D A;  5JJL A;  2MNA A;  4JBM A;  2ZM6 L;  5AJ3 L;  4DK3 C;  3KOJ A;  4ALP A;  4DV6 L;  4A3I G;  1PH1 A;  1KD1 C;  3MXN B;  2I0Q A;  2R92 H;  4YWL A;  4QY7 A;  4BY1 G;  3UE0 A;  4JI4 Q;  3CD6 A;  4GNX B;  3OW2 A;  2KCT A;  5M5X H;  1S40 A;  2CKZ B;  1GD7 A;  4YHH Q;  3UDX A;  3B6Y A;  4TVA B;  1LUZ A;  1PH6 A;  4AQY Q;  3M7N A;  1L1O A;  1KIX A;  4A3I H;  4JI2 L;  4JYA Q;  4BY1 H;  2B3G A;  2XTI A;  3U50 C;  1N32 L;  2UXD L;  3GDE A;  3TRE A;  3W1G A;  4A3F G;  4LF5 Q;  2AKW B;  2VS1 A;  4DV1 Q;  3E9H A;  1YI2 A;  4A3D H;  1VQ9 A;  2VUM G;  4YCU A;  5IE8 A;  2K52 A;  4OX9 Q;  4LUV A;  2ZM6 Q;  5AJ3 Q;  2NZH A;  3KF8 B;  2Y0S E;  1E7Z A;  1I6H H;  1KRT A;  3PF4 A;  3ERS X;  5M3M G;  4A3F H;  2Q2H A;  5IT9 c;  1QVG A;  2E2H H;  1E1T A;  2OTJ A;  2VUM H;  3MEF A;  2PQA A;  3PO3 G;  3CCM A;  2QA4 A;  3G71 A;  1XNQ L;  5IP7 H;  5M3M H;  2K4K A;  1LTL A;  3KLW A;  3CXC A;  3EBE A;  4R4Q A;  4GN4 B;  3CCE A;  4DR2 Q;  4MNO A;  4IJL A;  4NPS A;  3CCL A;  4B3S L;  1XNR Q;  1X54 A;  2UUB L;  2WAQ E;  3GTM H;  3PO3 H;  1VQH A;  1Q1B A;  4GLX A;  3PCO B;  3VDY A;  4UP8 A;  1NTG A;  1N9W A;  3JAM c;  2IY5 B;  2AWO A;  5IYB G;  1MJE A;  1YBY A;  4PMW A;  3F2C A;  1UE5 A;  1KQS A;  1TWH H;  2C35 B;  4JOI C;  4LF8 L;  2GVB A;  4FDB A;  2JEB I;  1Q81 C;  1VQK A;  1PFS A;  4P73 A;  3CC4 A;  4GOP C;  4LF4 Q;  4IJH A;  1IL2 A;  3A0J A;  2OCE A;  1JJ2 A;  4BXX G;  1HNZ Q;  2E8G A;  2GVA A;  3ULL A;  4APV A;  4A3K G;  1UE7 A;  5IYB H;  4HIO A;  1VQN A;  2R7F A;  1AE2 A;  2IT1 A;  3RZO H;  1XNQ Q;  3PV0 A;  4KI0 A;  5C0X G;  2LSS A;  5FLM G;  3KF6 A;  1QZH A;  1NMG A;  3F2B A;  4LF7 L;  4L5R C;  4DV4 Q;  2JA5 G;  2JA8 G;  1HNW Q;  4A3K H;  1SN8 A; 
#chains in the Genus database with same CATH topology
 3HKZ G;  1BNZ A;  3HKS A;  1PLF A;  3RMH A;  2K32 A;  4JI0 Q;  1D8L A;  1QJO A;  2OQK A;  4LFA L;  5J3B A;  1MJC A;  4BA2 I;  1O7Y A;  1YNN D;  3M4P A;  2NVY B;  1CA5 A;  1K73 C;  4JI8 L;  4JI6 Q;  2RSO A;  4DV3 Q;  1SAP A;  3MXG A;  4XT3 B;  1QZG A;  1Y1V B;  4TQU S;  2J4X A;  2I5H A;  3CCR A;  3OPO A;  3Q6S A;  4LF7 Q;  4FP5 D;  1OO9 B;  4J8Q A;  4AYB G;  1QVF A;  5C44 B;  1X56 A;  4IZ8 A;  4JPB W;  2EXD A;  4O1N A;  1GUW A;  3NBH A;  4QL5 A;  2HIX A;  4ME5 A;  1WTH A;  3OIQ A;  1Q8I A;  1TWA H;  1GUN A;  1ZYR C;  4FNF A;  4X66 Q;  3STB D;  4WJ3 M;  5KND A;  4POG A;  1BUV T;  4DR1 L;  1ET6 A;  2E5L Q;  1J8I A;  2JP1 A;  3RN5 A;  1VF7 A;  4A3M G;  2F0Q A;  4XQN A;  2Q8I B;  1G91 A;  1I3Q B;  1FGU A;  4LF6 Q;  1VQB A;  2D62 A;  1B9N A;  4JI4 L;  3JAM i;  1EY5 A;  2I5L X;  2RF4 A;  4YHH L;  3NBI A;  5BR8 Q;  4GKK Q;  3E0J A;  3ITP A;  3S2D H;  1K83 B;  1YZ6 A;  2RA4 A;  5FLX L;  5IYC G;  5EAY A;  5CC4 A;  2P5Z X;  4RCO A;  3A8J E;  1QVC A;  4L6T B;  5JEA H;  4BBR H;  3CCV A;  4LF5 L;  2SNS A;  1U9R A;  1G6P A;  1IYV A;  4OX9 L;  1ILQ A;  5KYI A;  4A93 H;  1BCP F;  3PO2 B;  2RBM A;  3R93 A;  2RDH A;  1HZC A;  1JOK A;  3LWU A;  1PZJ D;  1WJJ A;  2I5M X;  4RHR A;  1TS3 A;  4E6I A;  1YIT A;  1L0W A;  1TWF B;  2Q2U A;  1LM0 A;  1QNU A;  3MZ5 A;  1QUQ B;  3J81 i;  3VYT A;  3MFG A;  2F0O A;  3TS0 A;  1WVL A;  1BF4 A;  3TS2 A;  3S2H H;  1TWC B;  3WDN A;  5BN5 A;  4MZ9 A;  5LMN Q;  4A3L H;  2QF7 A;  2KQ3 A;  3UDI A;  5IT9 L;  1AH9 A;  5KEE A;  1IKM A;  5ELD A;  3I91 A;  2JA7 B;  2EYM A;  1UAP A;  3DLL A;  5M3F H;  4OO1 G;  2ZJR A;  2UU9 L;  4DGZ A;  3I73 A;  4JOI A;  1A0I A;  2B63 G;  3A55 A;  4DN4 M;  1HR0 L;  3I56 A;  4GOP A;  4A3E H;  3J80 i;  4L63 B;  1VQP A;  1PZI D;  2OF1 A;  3HG9 A;  4KY6 A;  1Q7Y C;  4WFN 3;  2E75 C;  1KL9 A;  2EY1 A;  1KXL A;  2RDF A;  1TS4 A;  3K8A A;  1FYC A;  3ULJ A;  1W6K A;  5IY0 A;  1HFG A;  4DNT B;  4OGQ C;  1TII D;  3HOZ G;  1A8V A;  1B53 A;  4WOR A;  1GVP A;  2F0T A;  3VR4 A;  2EZV A;  3NEN A;  4JI1 Q;  3TSS A;  2R93 B;  4DR6 Q;  4K6D A;  3AQQ A;  2CQO A;  2QW7 A;  4B9W A;  2Y0S B;  4CBV A;  1BO0 A;  1VQ5 A;  2MUY A;  3DWP A;  1OXX K;  3J7Y W;  2KA7 A;  4IUT A;  4JV5 L;  1CFM A;  2WKC A;  2N78 A;  2K5N A;  4LFB L;  1PFM A;  2RSN A;  5KGU A;  5L37 A;  4DV2 Q;  2NYZ D;  2JJQ A;  4IUP A;  3FKI G;  3HOX B;  2XVS A;  3HKZ E;  4G7O C;  1T5X D;  2WKD A;  4H13 C;  1STA A;  3GP7 A;  1A3T A;  1MD2 D;  2UUC L;  3NTK A;  4HIM A;  2IPK D;  1Q12 A;  1PRT B;  5J22 A;  1BCP C;  1PH7 A;  2CCZ A;  4BS9 A;  4DXF A;  3DXJ C;  2BDO A;  3BZD B;  1SYC A;  3RZD B;  1ML0 D;  4PZ8 A;  3NEM A;  3IAY A;  5GAD C;  4X64 Q;  2NUC A;  1MSG A;  3NSW A;  5CBA E;  5C4J B;  1G8Z D;  2F0U A;  3K57 A;  2SNM A;  4DV7 L;  1VQO A;  1X3P A;  4XQJ A;  1VQG A;  1JC7 A;  2F0H A;  5DNF A;  2QEX A;  2F03 A;  4C3I G;  2F0D A;  4PZ6 A;  3GQB A;  2WFW A;  2WV6 D;  4ODG A;  3QG1 A;  2ID0 A;  3GTJ B;  3I4O A;  1H9J A;  4C3H H;  4WJW A;  4GNX A;  4YY3 Q;  2F0G A;  2IX3 A;  3CCU A;  3TQY A;  1U4R A;  1P8L A;  2AQ2 B;  4DF7 A;  3J81 j;  4IFD G;  1X55 A;  1SRU A;  2HDM A;  4OHJ A;  2HT1 A;  1W3S A;  4IO9 A;  2R7Z G;  2F52 A;  1CA6 A;  3C46 A;  2KED A;  4H02 A;  2EJF C;  4RA8 A;  4EGV A;  4QF4 A;  5CYU A;  1FGB D;  2LMC B;  5CV5 A;  3PUY A;  2JN4 A;  3K0Y A;  2NVT H;  1KAW A;  3HOV G;  1VDZ A;  1ASZ A;  1OXV A;  5HGQ A;  2F0L A;  4P71 A;  2DJG C;  4CKE A;  1WD1 A;  2XRQ D;  1EWC A;  2PMZ B;  1Y1W B;  4NXN L;  3GTQ B;  4UPA A;  1GHK A;  4LUO A;  4IPG A;  4HED A;  1X3G A;  4AIM A;  4K2K A;  1D5X C;  3MA2 B;  3RLF A;  2X6L A;  2YU9 B;  3S1M H;  1BBW A;  3H3V H;  4BBS B;  1FJG Q;  1YNJ D;  1V8Q A;  1U4L A;  5IYD H;  1WTP A;  1DOM A;  2G9H D;  1X9N A;  4QJF A;  3S2D B;  4DUY Q;  3S9W A;  3KJO A;  1JWS D;  2N55 A;  1N34 L;  1RJT A;  4A3G G;  1Q46 A;  1NAP A;  3EN2 A;  1IW7 D;  2RQX A;  5BN4 A;  3E6Z X;  2Z0S A;  3U4V A;  4DV0 Q;  2R92 B;  1B1Z A;  2BDN A;  3NEL A;  5M5X B;  4RKB A;  1HA5 A;  2B2V C;  3FMC A;  2JA6 H;  4DUZ L;  4G7H C;  4FF2 A;  4A3I B;  1H9M A;  1X3Q A;  5G3L D;  2M9V A;  4CJ0 B;  4TSS A;  2VQE L;  3K6O A;  3P75 A;  2B8G A;  4G7Z C;  3A5U A;  5JPN C;  2F3W A;  2KJX A;  5CV7 A;  1F9R A;  1I50 H;  2UUB Q;  2E2J B;  4A3F B;  1YNN C;  2KHS A;  2MQH A;  2VUM B;  2UXC L;  1TU2 B;  1A15 A;  4DNI A;  1F77 A;  4QIW B;  1I94 Q;  3SK5 A;  5CMD A;  3K0X A;  2PO4 A;  4HJ9 A;  1B7Y B;  1EY9 A;  3R2T A;  3QB3 A;  3NQI A;  1MGS A;  3GTM B;  3VYU A;  2VQF Q;  3T1H L;  2K05 A;  3I7F A;  4OEM B;  3I4M G;  1TWH B;  1WTW A;  3Q23 A;  2CW0 D;  2JQO A;  1PTO F;  3STB C;  4JK1 C;  3U9O A;  2E2D C;  3OTO Q;  3JAM E;  1QWY A;  1YHA A;  3RZO B;  4ID6 A;  1STY A;  1PDQ A;  2FXQ A;  3R3O A;  2RHS B;  1S5C D;  1XMQ L;  1PH8 A;  2YTV A;  1GUS A;  4DR4 L;  1SMY D;  4L8J A;  1E3P A;  1PRT F;  2A6H D;  3C1F A;  4NP5 A;  4QUC A;  3PUX A;  5C3E H;  3DM3 A;  3KLR A;  4OEL B;  4C3J G;  2R7D A;  4MIU A;  3KK7 A;  4RH6 A;  3KJP A;  1KAA A;  3HOY G;  5HY6 A;  1JT8 A;  3K5O A;  4AQY L;  2F0N A;  3CKI B;  4JI3 L;  3OIP A;  1F2M A;  4TKO B;  1EWI A;  1CHQ D;  4X3T A;  3J81 E;  2PZW A;  1LYL A;  2O4X A;  2WB1 B;  2A68 D;  1DM0 B;  4ALP A;  4DV6 L;  1GOZ A;  4YWL A;  4JI4 Q;  1MBY A;  3OW2 A;  4YHH Q;  3B6Y A;  1LUZ A;  1KLU D;  2Z1C A;  2D2C C;  1L1O A;  2CHB D;  1N32 L;  1WTO A;  4BY1 H;  1JOO A;  4KY5 A;  4LF5 Q;  2VB2 X;  4YCU A;  5IE8 A;  2K52 A;  4OX9 Q;  2CH4 A;  4CJ1 B;  1TT2 A;  3J80 E;  3P7J A;  1UUP A;  2E2H H;  3VA7 A;  4A3J B;  3MEF A;  2XRS D;  3DEP A;  5M3M H;  4B3S L;  3CCL A;  3RD4 A;  2F0F A;  1VQH A;  1WTQ A;  4GLX A;  2EYH A;  4UP8 A;  3V05 A;  3JAM c;  1A3U A;  1U4M A;  4PNY A;  5JVG 3;  2LFN A;  2C35 B;  4HN7 A;  2JEB I;  5EPK A;  2FMC A;  5J39 A;  4IJH A;  4BXX G;  3ULL A;  4APV A;  4A3K G;  3G6J B;  4HIO A;  1XNQ Q;  3PV0 A;  5C0X G;  1G6Z A;  2LSS A;  1IHZ A;  1NMG A;  1LT4 D;  1HTL D;  2IL8 A;  2JA5 G;  3BG3 A;  3LGJ A;  4DK6 C;  4KKU A;  3I4N B;  3K81 C;  4DAY A;  1HCZ A;  3TZU A;  2JA8 H;  1I4R A;  1CK1 A;  3I55 A;  1EQV A;  3FEW X;  3S1R H;  4ZKC B;  2NN6 G;  1WCM B;  1I4G A;  4N8F A;  4F88 A;  1X3F A;  3J81 c;  5FKA C;  1TWG H;  4WRD A;  3L0O A;  5KIX A;  3J81 L;  3QO2 A;  5ELC A;  5COY A;  5IP9 G;  1SE8 A;  1SEB D;  1JWM D;  1SE2 A;  4EQP A;  4ZK9 B;  5EPJ A;  4DPG A;  1O80 A;  2Z8L A;  1SNP A;  2RCN A;  3ERQ A;  3I2Z A;  3S14 H;  2B2Y C;  4JV5 Q;  4GKJ L;  5JOB A;  4LFB Q;  2F0M A;  3J80 c;  3QOL A;  4A3B G;  4QMG A;  2JA6 B;  1BBU A;  1PH5 A;  1JIC A;  1G51 A;  1OXT A;  3J80 L;  3NWS A;  4A3M H;  4Y7N B;  3BVM A;  4B3M Q;  4O2D A;  4OWX B;  1Q86 C;  4IUV A;  2EY5 A;  4R4I A;  5A35 A;  1IXR A;  5I9P A;  1HH2 P;  1XPR A;  5M5Y H;  1D1K A;  1PH4 A;  5KYL A;  1PFB A;  1J9O A;  5EGT A;  1N36 L;  5IYC H;  4DV7 Q;  3I3C A;  3U58 A;  1CKN A;  1Z7T A;  2MO0 A;  5J1Z A;  4XYO A;  1PH9 A;  1GUG A;  2F4V L;  3HOW G;  1CKM A;  5E7N A;  1E2W A;  2DN8 A;  1SE3 A;  4X6A H;  4C2M B;  4ME3 A;  1SFO H;  1R9T B;  2BE5 D;  1XNR L;  1RTO A;  2ENB A;  1LAB A;  2EY2 A;  1LLR D;  5EPL A;  4K14 A;  3PIP A;  3A74 A;  4K0K L;  1IYJ B;  1FL0 A;  2NZ1 D;  4IOA A;  5C3W A;  1GKH A;  5IWA Q;  1AZQ A;  4DR5 L;  1Y1V G;  4LF4 L;  5GQO A;  3S1Q B;  4NKL A;  4QGU A;  2MO1 A;  5T1I A;  4IUN A;  4FVM A;  4K5V A;  5I2Y A;  2HD3 A;  1AP0 A;  1YNJ C;  2OWO A;  5C44 G;  3WOE A;  1VQD A;  2YV5 A;  3NP8 A;  3TRZ A;  1CSP A;  2J0T D;  4XTC S;  3SXH A;  4OO1 H;  1IL8 A;  1V1Q A;  2EIF A;  4ZKB B;  2B63 H;  1HHV A;  4HSV A;  1SJE D;  1IW7 C;  3K7A H;  1U0L A;  1Z6H A;  3AFP A;  1VQ7 A;  2RDG A;  4OXP A;  1BQQ T;  3W2D A;  4HAE A;  4MHE A;  4N8X 1;  4DR3 L;  3PIP 3;  2PQA B;  1AZP A;  1NNX A;  1B9M A;  1HXY D;  3D31 A;  3HOZ H;  5JJK A;  3J7A 5;  4LF9 L;  1XPU A;  5ELE A;  5IGD A;  3J7Z C;  3DHQ A;  1KNA A;  5EBD A;  1VQC A;  3UDG A;  1IBL L;  3W1B A;  2UXB L;  3Q8D A;  3RLO A;  1WTV A;  2BH8 A;  3PUZ A;  3IRB A;  1ESR A;  4QUF A;  1Q1E A;  1O7I A;  1XMO L;  2ZTD A;  3V2T A;  3R2I A;  1D6E C;  4H0L C;  3LNN A;  3TP5 A;  2K1B A;  1NSN S;  3MWY W;  3FKI H;  1STN A;  2Z9H A;  4AH6 A;  3GTP H;  3FRP B;  1EWH A;  2NZO A;  2VQE Q;  1VMC A;  1RF2 D;  2L4N A;  5C5M A;  2Q8T A;  4HJ7 A;  2K50 A;  2CW0 C;  1EY6 A;  4P2C B;  4WJ4 A;  2KCM A;  1V1P B;  4P75 A;  1RHP A;  1T5E A;  3CRL C;  4B9X A;  3FVQ A;  4HTH A;  2UXC Q;  1EZ8 A;  5IOC A;  1YJ9 A;  2C9O A;  3H6M A;  1KRS A;  2JA7 G;  4JI7 Q;  5C4X B;  1SMY C;  1EOV A;  1B4O A;  2A6H C;  3PGZ A;  1ET9 A;  5E3F A;  4C3I H;  1UE6 A;  4L5T A;  1PV4 A;  2AMC B;  2Q2T A;  1M4V A;  3CME A;  5C0X J;  2EYL A;  3AB9 A;  4G4K A;  5JJI A;  1STH A;  4MTK A;  5COR A;  1C7Y A;  3C3L A;  4OO1 I;  4LUZ A;  1TWG B;  1SYE A;  1VQJ A;  1DON A;  1SLJ A;  4IFD H;  3BVG A;  3ND9 A;  4DR4 Q;  2R93 G;  1STE A;  2A68 C;  2MJ8 A;  2R7Z H;  1O78 A;  3TP7 A;  4ZYS A;  3BZK A;  5K36 G;  2Y0S G;  4JCV E;  1LT3 D;  2NVQ H;  3KLS X;  2XN9 C;  1HR0 W;  3GV3 A;  2B29 A;  2YYZ A;  1LTA D;  3M9B A;  1TR5 A;  3G48 A;  1EUJ A;  5M5W H;  1XWE A;  1IBM L;  2B2T C;  2Z6K A;  4MTN A;  4NXM Q;  3HOV H;  3S16 H;  2SDF A;  1Y69 U;  4JI3 Q;  1S72 A;  3CCS A;  2B2U A;  2BA1 A;  1Z47 A;  3H0G B;  3HOX G;  3KLS A;  1XTC D;  2J7Z A;  4FXD A;  1KAB A;  4A3M B;  4HSP A;  3TZD A;  3HRZ C;  3D4D A;  2F0V A;  2I07 B;  3FPU B;  4DV6 Q;  2PZU A;  4UP9 A;  1UEA B;  1SYD A;  1EY0 A;  4X3K A;  4X65 Q;  4DV5 Q;  5LMU L;  1K0R A;  4KD3 A;  3GTL H;  1N32 Q;  1I6V C;  4LFC Q;  2QIL A;  3CC7 A;  3D4W A;  3SK4 A;  3TN2 A;  1O7Z A;  4A3G H;  1ILP A;  2L5T A;  1SMX A;  4CGY B;  1BDO A;  2EVB A;  4HMI A;  1ENA A;  1L0Y B;  3L3O C;  2IHF A;  3H3V C;  2A1A A;  1EYC A;  3OMC A;  2MHV A;  3NE5 B;  5KRU A;  3ULP A;  2QCP X;  1IBK L;  4B3S Q;  3DWQ A;  2K5D A;  5EKK A;  1I6H B;  3OSO A;  2EQS A;  1HPC A;  5IGG A;  3M4O H;  4KN4 C;  4UP7 A;  1W2B A;  3K80 C;  2B39 A;  3GV6 A;  1ESF A;  1LTG D;  4YCV A;  2LS0 1;  1PVO A;  4QCL A;  3PO3 B;  2N49 A;  3RNU A;  1GUO A;  2NVX H;  1TY0 A;  1EQR A;  2IJ0 A;  4IFD I;  2DJF C;  2EJG C;  4AYB E;  1A6X A;  5HUR A;  1HZA A;  4KY7 A;  3J7A F;  2N3S A;  2TSS A;  3DM1 A;  1PXU A;  3EFX D;  3I4M H;  1Y1W G;  2K5H A;  1HNX L;  4ZRZ A;  3S17 H;  3M3Y H;  1LTT D;  2HHH L;  4C56 C;  3OWF A;  2HQL A;  4BBS G;  4POF A;  1SRO A;  1V43 A;  3KDF B;  1HUN A;  1QNK A;  1Y8N B;  4NMZ A;  1N33 Q;  3HOU G;  3D6W A;  3GTK H;  4BY7 G;  1RCV D;  3UI2 A;  1QUQ A;  1DOL A;  2WP8 J;  2ICI A;  1EQQ A;  2IWH A;  5JPM C;  3CQZ H;  4C3J H;  5ELO A;  1MI2 A;  1RD9 D;  2IX0 A;  1RL2 A;  1I4H A;  3A7L A;  2R92 G;  3HOY H;  3E3X A;  2RHQ B;  3L2P A;  1MHW C;  4JBJ A;  3CAM A;  4OON A;  4R4C A;  3F2D A;  4JBM A;  2ZM6 L;  1TWA B;  2XNA C;  3H09 A;  5AJ3 L;  1PH1 A;  2PYK A;  1LTR D;  4A3I G;  2F0W A;  3F2U A;  4TVA B;  1B3Q A;  2BE5 C;  2K6A A;  4KHV A;  1R4P B;  5I6Y A;  1KIX A;  1HA6 A;  3A56 A;  2UXD L;  2B3G A;  4RFB A;  1HUM A;  3VYR A;  3W1G A;  4A3F G;  2AKW B;  1YI2 A;  3E9H A;  3HS0 C;  4A3D H;  2VUM G;  5FO8 B;  4KV6 A;  3MXP A;  3K59 A;  2NZH A;  3KF8 B;  2Y0S E;  2EPB A;  3PF4 A;  4KTA A;  5DEH A;  4QB4 A;  4HCE A;  2JXM B;  3CCM A;  1SJH D;  1F2Z A;  5A2Q E;  3G71 A;  4BBR B;  5IP7 H;  2LKV A;  3CXC A;  3EBE A;  3T56 B;  1XNR Q;  4NPS A;  3L9A X;  4S3S A;  4A93 B;  5EQ0 A;  4KD4 A;  3VDY A;  2KEC A;  1LAC A;  2AWO A;  1KNE A;  4JOI C;  1SYF A;  4P73 A;  4KHP L;  1HTP A;  4GOP C;  4LF4 Q;  1HQM C;  4XDX A;  4DXG A;  3W3A A;  1UE7 A;  3TBI B;  2HQE A;  3NTH A;  2K01 A;  1SND A;  5FLM G;  1QZH A;  2PNR C;  3CRK C;  3F2B A;  3A54 A;  4L5R C;  4LF7 L;  3IKJ A;  3I8Z A;  4A3K H;  3SK8 A;  3S2H B;  2VNU D;  2NVQ B;  3G6E A;  5D65 A;  4JI5 L;  2L1B A;  3KYH C;  4RGT A;  3C1E A;  4ABN A;  5M5W B;  1JB7 A;  1CQF A;  1SNC A;  2JA5 H;  4X66 L;  1BXT A;  1X32 A;  2CWP A;  2PCF B;  5M3F B;  1AW7 A;  1AFP A;  2E5L L;  1B44 D;  1YHB A;  5NUC A;  3NXW A;  1PFN A;  4LK1 C;  1VQ4 A;  1Q90 A;  2OT2 A;  4Y52 H;  2WB1 G;  4JBW A;  1JE5 A;  1VQ8 A;  4A3E B;  3OOC A;  4DR3 Q;  1A62 A;  4LF6 L;  1BR9 A;  4LFA Q;  1FNV A;  1QB5 D;  5FO9 B;  4JI8 Q;  3GTL B;  4RGM A;  5IP9 H;  4GKK L;  4C1N I;  1IBL Q;  3T1Y L;  2V1C C;  3EVQ A;  2UXB Q;  2B2W A;  2EJM A;  5TSS A;  4DAM A;  1EY8 A;  2DNE A;  1XMO Q;  2G9D A;  1EYA A;  1EU3 A;  2IW3 A;  4XT1 B;  3H3V I;  4A3J G;  3BYY B;  4F8M A;  3Q22 A;  1BKB A;  4A3B H;  3GTG H;  1C0A A;  4UDU C;  2KUM A;  1DOK A;  4DR1 Q;  1JJC B;  1KHI A;  2QDL A;  1XX8 A;  5ISR A;  1DJR D;  4A3C G;  4JYA L;  2MFI A;  3I90 A;  1YJW A;  3PSI A;  4GLA C;  3M4O B;  1JOR A;  4GNX C;  4EX5 A;  2AWN A;  1WI5 A;  4LW1 A;  2Z4I A;  2F0P A;  1S5F D;  5LMN L;  1MIU A;  1XJV A;  2OQ0 A;  1RIP A;  2QGQ A;  2A74 C;  1U4P A;  2KCN A;  1FVI A;  3HOW H;  3MVV A;  2K7V A;  3S1N H;  3I4N G;  2ALY B;  1A63 A;  3ER0 A;  1WCM G;  1H9R A;  1A3V A;  5JJZ A;  4A75 A;  4FO2 A;  4C3H B;  1CI3 M;  2O5I C;  1D2B A;  2NVY H;  4NW2 A;  2D0P A;  5CGK A;  2F0E A;  3MXU A;  3PUW A;  2H1E A;  3SVM A;  2BCO A;  1OTC A;  1I4X A;  5I2X A;  1HNW L;  2JK8 A;  4DR6 L;  2FMM A;  4YWM A;  4QIW E;  4X62 L;  4HID A;  1MKH A;  4IAL A;  4O0A A;  5H1S E;  5C44 H;  4DR7 L;  1H9S A;  1S3O A;  3JAM L;  5T1G A;  1F9Q A;  4FF1 A;  3MFY A;  2V4D A;  1SNQ A;  3BZC A;  3EQL C;  3CU7 A;  1E0B A;  2CQA A;  4NB3 A;  1UE1 A;  4R1J A;  3CW2 C;  2UU9 Q;  1YNX A;  5JEA J;  2NVT B;  2XWJ B;  1HR0 Q;  4JW0 A;  5JVH 3;  1HFN A;  2A19 A;  1I3Q H;  5DM6 3;  3N52 A;  1EYD A;  1JWU D;  1F9P A;  5HGT A;  1V1O A;  2ATW A;  3S1M B;  4A3D B;  1C9O A;  1K83 H;  1EIY B;  1EFI D;  3PQI A;  1EIG A;  1ICF B;  2WAQ B;  1CHP D;  4X3S A;  3KF6 B;  1ZEQ X;  3O13 A;  1UNS A;  4YCW A;  1KDB A;  5C4H A;  2B8F A;  2E76 C;  3A5Z B;  1TS5 A;  1B2T A;  2HDL A;  4YY3 L;  2YTX A;  1IBK Q;  1GJX A;  2F0I A;  3BJU A;  2PW5 A;  1S5D D;  2L12 A;  1Z9F A;  4K6L A;  5G3L F;  3P1H A;  1WD0 A;  3A8I E;  1K8G A;  5DLQ E;  1TS2 A;  3J7A V;  1S4Z A;  3K5M A;  1CSQ A;  2UUC Q;  2O5J C;  2C5C A;  4CDF C;  1XTD A;  3MTS A;  3I70 A;  5CR3 A;  4EQ5 A;  1I50 B;  3S24 A;  1LTB D;  1PYB A;  4H7B A;  3NBH B;  2UUA L;  2OEO A;  1AEX A;  2JA7 H;  1SDF A;  3L7Z C;  1NR2 A;  2YTY A;  1K8M A;  3HFZ B;  4U67 3;  1HJP A;  4RCN A;  4CDC C;  3QIA A;  3EJI A;  1WYD A;  2KOL A;  2PI2 A;  5D3I B;  4JBK A;  3VR2 A;  2DY8 A;  4XYQ A;  2GN5 A;  3NQT A;  4RMF A;  1I4P A;  3RR5 A;  5E4W C;  3EIV A;  1TY2 A;  2HHH Q;  2K75 A;  2AUK A;  3NUC A;  4IN3 A;  3EA6 A;  5CV6 A;  5C5L A;  2BH2 A;  1X65 A;  3U9S A;  1EQT A;  1FJG L;  3AYH B;  4J6H A;  4KN7 C;  3WWV A;  1VQL A;  2R93 H;  4A76 A;  3PIO A;  4DUY L;  2R3Z A;  2KBN A;  5EBC A;  3H15 A;  3H94 A;  1K3B C;  5C3E B;  1LV9 A;  4DK1 A;  3NPP A;  3K58 A;  4DAP A;  1PTO H;  1L1O C;  4DV0 L;  1S5E D;  4R4T A;  1QCB D;  3KBG A;  3GTG B;  1EU4 A;  3HOX H;  3D0F A;  3C2P A;  1XPO A;  3DUZ A;  1K0S A;  2ZTE A;  3W5O A;  1K28 A;  5CV9 A;  3VA5 A;  4PG3 A;  4NXN Q;  2KVM A;  2K03 A;  1M1K C;  5FLX E;  3VR5 A;  2UXD Q;  4TRD A;  1K3R A;  2EY6 A;  1HZ9 A;  1VCI A;  3RZD H;  4K5X A;  1S5B D;  2ASB A;  2GA4 B;  4KKT A;  1CQV A;  5IGE A;  2A8V A;  3AEV A;  2DNC A;  1K9M C;  5C4J H;  2SOB A;  3PIO 3;  1I94 L;  5C4X G;  1PYW D;  1AE3 A;  1D7Q A;  1VS0 A;  3URY A;  1N34 Q;  4BY1 B;  1NR4 A;  2EE1 A;  1I5F A;  4GOP B;  5D3D A;  2VQF L;  4GN5 A;  4ZLT F;  3AMU A;  2X6G A;  2AQ3 B;  3GTJ H;  1Q8K A;  4HMJ A;  4CJ2 C;  1CTM A;  3PO2 G;  3T16 A;  4P72 A;  2E2H B;  4O42 A;  3VYS A;  2SEB D;  3CPF A;  3NK9 A;  4HJ8 A;  3QJY A;  4DUZ Q;  1YHQ A;  1RTN A;  1V9P A;  1M8A A;  3OTO L;  3JC6 6;  4KHP Q;  3FP9 A;  4H44 C;  5M3M B;  4KMU C;  4IOC A;  1X6O A;  3TME A;  4R9W A;  4C1N K;  5IT9 E;  2MPM A;  3QR8 A;  3BU2 A;  4B3T L;  5I6W A;  2D9U A;  3S15 H;  1EFW A;  2NTT A;  3CCJ A;  2FFK B;  5C3X A;  4HJA A;  4V0B A;  3FDT A;  2ICE C;  4OIK A;  1B8A A;  3X3M A;  4JI5 Q;  4PV1 C;  2OTL A;  2ES2 A;  2A73 B;  4K5W A;  2LY7 A;  1PH2 A;  4Q5V A;  2A6E D;  1VQE A;  3H0G G;  1T9H A;  3MXN A;  4I7Z C;  3T1H Q;  4PQX A;  1J5E L;  1Y1W H;  3GTQ H;  4BA1 I;  1N8R C;  2VL6 A;  1IKL A;  5FJ8 G;  2VXW A;  2M2L A;  1EL0 A;  3ND8 A;  2YU9 H;  1VF5 C;  4EVO A;  2JA8 B;  1EIF A;  4KHZ A;  4BBS H;  3S1R B;  3HKZ B;  1PMR A;  1TKW B;  1B3A A;  5FLX c;  3U4Z A;  4OL7 A;  3HOU H;  4UY8 C;  2KHI A;  3ERO A;  1XMQ Q;  4BY7 H;  1XYI A;  3T1Y Q;  2BA0 A;  1LT6 D;  2EYO A;  4CHT B;  4IQZ A;  4I7A A;  3UE1 A;  2MP1 A;  3UDF A;  1PYS B;  3KBX A;  4UAI A;  4CDE C;  4HCS A;  3G7L A;  2MNA A;  4AYB B;  4YIJ A;  1EEF D;  2R92 H;  2I0Q A;  2EYP A;  2A69 D;  3CD6 A;  3S14 B;  3UE0 A;  4GNX B;  5M5X H;  2CKZ B;  1GD7 A;  1AN8 A;  3UDX A;  3DWA A;  3P20 A;  1PH6 A;  4AQY Q;  3M7N A;  3E5S A;  4K2L A;  1GXD C;  4A3I H;  3V96 A;  4JI2 L;  4JYA Q;  3U50 C;  4G57 A;  3BDC A;  4FXG C;  2AQ1 B;  3OW7 A;  4DNR B;  1LT5 D;  1KRT A;  3D6C A;  4A3F H;  2Q2H A;  5IT9 c;  4B08 A;  2OTJ A;  2VUM H;  2PQA A;  5M5Y B;  3PO3 G;  1XNQ L;  1LTL A;  4GN4 B;  3PMF A;  4MNO A;  1RDP D;  2B2V A;  2FJ2 A;  1X54 A;  3GTM H;  2IY5 B;  5IYB G;  1MJE A;  1HRJ A;  1SE4 A;  1TWH H;  4LF8 L;  4EQN A;  2F0S A;  4FDB A;  2L0C A;  4CKB A;  1VQK A;  1PFS A;  3A0J A;  1JJ2 A;  4KJO A;  2E8G A;  2GVA A;  1SFO B;  1EOT A;  4JVZ A;  2WIN B;  1D5M C;  2R7F A;  3RZO H;  5E4X A;  4KI0 A;  1PTO D;  4ZCK A;  4IUR A;  1HNW Q;  1SN8 A;  1Y14 B;  1A2U A;  3R8B A;  2FHT A;  5FLM H;  4X62 Q;  1SYG A;  4DR7 Q;  2D0O A;  4LNQ A;  1PRT D;  1V1P A;  5EJW A;  1KDC A;  4FYD A;  2F0J A;  1L2F A;  2LXJ A;  1CT1 D;  1PTO B;  5ELF A;  3F8T A;  1UWV A;  2PPB C;  1HZB A;  1E2V A;  3D8G A;  3VR3 A;  2B63 B;  3X3N A;  2I46 A;  1JMC A;  1ROD A;  4B3M L;  3K7A B;  1IZ6 A;  2PNH A;  4B3R L;  4OIJ A;  3M7G A;  2VZA A;  3KFU A;  1EYG A;  1TVX A;  4KKS A;  1YIJ A;  3RUZ A;  4IPC A;  4R8I A;  4RHS A;  4BWG B;  4HIK A;  1OXU A;  3TP6 A;  5CV4 A;  3HOZ B;  1QG7 A;  1NY4 A;  1G29 1;  4FF3 A;  3BVZ A;  5GRO A;  4M8A A;  2XIW A;  2VW9 A;  3SR1 A;  3ICE A;  1CZW A;  4N9T A;  2DGY A;  3HEJ A;  3H91 A;  1SYB A;  3DEO A;  1JJG A;  2E74 C;  5JEA G;  4BBR G;  1SBB B;  4A3J H;  1STG A;  5JAV A;  2K5W A;  4A93 G;  3OMG A;  3KUP A;  4GKJ Q;  3E9I A;  1NJI C;  1ZKO A;  1VQA A;  2G5D A;  1M90 C;  4DV1 L;  1QIL A;  3ZYY X;  1VQF A;  3CF5 A;  4A3C H;  1JOQ A;  3NWT A;  3FKI B;  1J6Q A;  1NBW A;  2JSO A;  5IWA L;  3GTP B;  3SHL A;  5FOB B;  3CCQ A;  1E1O A;  1JCK B;  4GLV B;  3GTO H;  2FIN B;  1UEB A;  4IPD A;  5CBE E;  3S15 B;  4DU9 A;  3WOF A;  4XXE A;  1FNU A;  1SSO A;  4IPH A;  3NHH A;  2UUA Q;  2JA9 A;  4DR2 L;  1E22 A;  4LWC A;  1VQM A;  4A3L G;  1QOH A;  3SE0 A;  1N36 Q;  3DMU A;  5EKI A;  2ZJP A;  1CM9 A;  2HIV A;  2PW7 A;  2ZJQ A;  4Z9C B;  3GD7 A;  4DAV A;  4NDX A;  4RKL A;  5GAE C;  2EYF A;  5ELB A;  5M3F G;  4OWT B;  3QOJ A;  1QE6 A;  5AFW A;  3I4N H;  2F4V Q;  1HNZ L;  2NTS A;  4C3I B;  1X3E A;  3OYY A;  4A3E G;  1WCM H;  5F2D A;  2K14 A;  1Y8P B;  4P74 A;  4N9P A;  3ZJY C;  4OWW B;  4RGN A;  1DCZ A;  5IGF A;  2Z6K C;  4DV4 L;  2CFM A;  1JE4 A;  3BDO A;  2JYO A;  1F2Y A;  1FR3 A;  2B2U C;  1R4Q B;  4JI0 L;  2IX1 A;  4K0K Q;  1L1O B;  3HOU B;  1D5Z C;  4YWK A;  2EDG A;  2ZXO A;  4DA2 A;  1CKO A;  4JI6 L;  4BY7 B;  4DR5 Q;  3ONA B;  4DV3 L;  1U5K A;  1ENF A;  2KHJ A;  3OWE B;  3G4S A;  3A7A B;  3T4A C;  2R7Z B;  2R61 A;  4DKA C;  4BXX H;  2L55 A;  1WOC A;  4LMQ D;  4K8I A;  4ZQ3 A;  5C0X H;  2ZTC A;  3E0E A;  1BBX C;  1GUT A;  5C6A A;  3S16 B;  3HOV B;  4ZAI A;  4Y7N H;  3Q0A A;  5IIF A;  4GN3 B;  5DAU A;  2O2L D;  2NN6 H;  4R8N A;  1H9S B;  2L9H A;  3CHB D;  5E1F A;  3RLN A;  3K7U C;  1PH3 A;  3D3R A;  3RN2 A;  1KTK A;  4LF9 Q;  2B2Y A;  3M85 A;  4RG1 A;  3QWN A;  1CZG A;  3KDF A;  5C4Z A;  5LL6 X;  3MAQ A;  1C48 A;  5BR8 L;  3F1Z A;  4GS3 A;  4JI7 L;  1C4Q A;  3SDZ A;  1ZYR D;  2CWA A;  1VQI A;  3M4Y A;  4A3G B;  1GHJ A;  4ZUI A;  4DAY B;  1H9K A;  4C2M H;  2IHE A;  1A2T A;  4XQQ A;  1R9T H;  1MSH A;  1L0X B;  2A6E C;  3AFQ A;  2L15 A;  1EY4 A;  1DGS A;  1G2S A;  4C3H G;  4FXK C;  2PMZ E;  1LTS D;  1E24 A;  2XWB B;  2NB0 A;  2KEE A;  2ZXP A;  3M4Q A;  5A2Q L;  1VQ6 A;  3CPW A;  4B3T Q;  4FF4 A;  2F3I A;  4DFA A;  3S1Q H;  5LMN W;  1SNO A;  1VMP A;  2F1M A;  1K8O A;  2NBF A;  1NMF A;  1JR0 D;  1O7L A;  3IFD A;  3LWE A;  2TMP A;  4Q0F A;  5CV8 A;  5BN3 A;  5IGC A;  1NE3 A;  2H5X A;  1ENC A;  2XGT A;  1H95 A;  4L5S A;  1JB3 A;  1EIH A;  2RKS A;  3D4R A;  4R4O A;  4NXM L;  2NVX B;  3KF8 A;  1D1I A;  1SR3 A;  2PZT A;  5GAH C;  1DZ1 A;  3BDL A;  1J5E Q;  1YVC A;  5I4D A;  5IGB A;  2VY3 A;  1TXY A;  4K8J A;  1CUK A;  4QQB X;  1KDA A;  1ONL A;  2F0K A;  1YEZ A;  1DXM A;  2A69 C;  2E2I H;  3I4M B;  3PF5 A;  5C0X I;  3S17 B;  3M3Y B;  1WTR A;  4J15 A;  4A3D G;  4DV5 L;  4X65 L;  3HP3 A;  4I65 A;  4ULL A;  2Z4H A;  5IYD G;  1BVS A;  4L5Q A;  4LFC L;  3I4L A;  2Q2I A;  4JG2 A;  1CKN B;  1Y1V H;  4F87 A;  3CMA A;  2L11 A;  2WAQ G;  1EEI D;  3GTK B;  2F3V A;  4JI1 L;  2NN6 I;  2D5D A;  3NTI A;  4J1M A;  2AUJ D;  5IP7 G;  4A4I A;  1YJN A;  3BS1 A;  4LAA A;  1B70 B;  3CQZ B;  4C3J B;  2WII B;  1IBM Q;  4IUU A;  3HOY B;  3PUV A;  4JI2 Q;  3MHB A;  1W6J A;  3HGB A;  2JA6 G;  5M9O A;  3MC0 B;  4DV2 L;  5GAG C;  3OHX C;  3TP8 A;  5LL6 S;  4RWS C;  2KEN A;  1SNM A;  1XXG A;  3SGI A;  3GTO B;  1ASY A;  3SK6 A;  1PTO C;  1PHJ A;  1STB A;  2R6G A;  3I72 A;  3SEB A;  1KC8 C;  5LMU Q;  4IFD J;  2CH4 W;  1PA6 A;  5C4X H;  2ZT9 C;  2BOS A;  4X64 L;  2M00 A;  2WAC A;  4RAU C;  2F4I A;  3CP0 A;  1LO5 D;  2K5V A;  2EXZ A;  1PRT C;  4HR7 B;  4PMC A;  3LX0 A;  4UHV A;  4LF8 Q;  1F2L A;  2X69 A;  1EZ6 A;  1FD7 D;  3PO2 H;  2HCI A;  2JE6 I;  2AHO B;  1TQO A;  1BCP D;  5IOD A;  1K8A C;  2OXP A;  2HCC A;  4GZY C;  2QEJ C;  1DYQ A;  1IYU A;  2WB1 E;  3FPP A;  2K33 A;  3T53 B;  4XIG S;  1GO3 E;  1TWF H;  1N33 L;  3T51 B;  3TEH B;  1Y8O B;  5DM7 3;  2PQE A;  3GO5 A;  4F7X A;  1OXS C;  1Q82 C;  4KLK A;  1I4Q A;  3T13 A;  1NCV A;  5C3E G;  1TWC H;  2ZXR A;  1BCP B;  2NWG A;  5KNC A;  1WFQ A;  2PI2 E;  3FHW A;  4PZ7 A;  5I9O A;  5FK9 C;  2E2J H;  1II3 A;  1F9S A;  1ICW A;  1P16 A;  1ZXT A;  2EYJ A;  3VR6 A;  4A3K B;  5D14 A;  3TDQ A;  2H4O A;  2DUD A;  2LXK A;  1C8C A;  4DK0 A;  2K04 A;  3H0G H;  1DD2 A;  2B2W C;  2EOT A;  2JA5 B;  1GM5 A;  2A5H A;  4HJ5 A;  1EY7 A;  5FJ8 H;  4KJN A;  4B3R Q;  2K28 A;  5ELN A;  4ILW A;  4U68 A;  2VB3 X;  2DY7 A;  1PZK D;  2CVR A;  1WTX A;  1HNX Q;  1KLG D;  5K5P A;  3A8K E;  1NUC A;  3CC2 A;  4JC0 A;  1SXT A;  2N8N A;  2JEA I;  2KCC A;  4IUQ A;  1BOS A;  2MGS A;  5JJL A;  3N6R A;  4CDD C;  4V19 0;  4CKC A;  4DK3 C;  2B2T A;  3KOJ A;  1KD1 C;  3MXN B;  4QY7 A;  4ZUJ A;  4BY1 G;  2KCT A;  1S40 A;  3K5N A;  4M1U B;  5K36 H;  3Q24 A;  1E2Z A;  2QKI C;  4KK7 A;  4RGO S;  3MEH A;  2XTI A;  3GDE A;  3TRE A;  2VS1 A;  4DV1 Q;  5EKL A;  1VQ9 A;  2XSC A;  4LUV A;  3BYT B;  4A3B B;  2ZM6 Q;  1G2T A;  5AJ3 Q;  1HQR D;  1E7Z A;  2RCF A;  1I6H H;  3ERS X;  5M3M G;  4X3U A;  1QVG A;  2Z6B A;  1E1T A;  2QDB A;  4EQO A;  2N88 A;  2HUG A;  5KNB A;  2QA4 A;  5FO7 B;  1JQY D;  2K4K A;  2K5Q A;  3KLW A;  4R4Q A;  1LTI D;  3CCE A;  4DR2 Q;  4IJL A;  4MN3 A;  2UUB L;  2WAQ E;  3PO3 H;  1Q1B A;  4PMB A;  3PCO B;  1NTG A;  1N9W A;  1FNW A;  1KQS A;  1YBY A;  3IL8 A;  3IFT A;  1UE5 A;  3HZX A;  4PMW A;  3F2C A;  1Q3L A;  3K5L A;  2GVB A;  4LJZ C;  3AU7 A;  2RVL A;  1Q81 C;  3CC4 A;  1IL2 A;  2OCE A;  1HNZ Q;  5IYB H;  1VQN A;  1RKN A;  1AE2 A;  2IT1 A;  3HOW B;  3S1N B;  3KF6 A;  2Q8R E;  2E2I B;  2JA8 G;  4DV4 Q;  5LHY 1;  1B50 A; 
#chains in the Genus database with same CATH homology
 1Y14 B;  2VNU D;  3HKZ G;  3LGJ A;  4DK6 C;  3G6E A;  3HKS A;  4JI5 L;  4JI0 Q;  1D8L A;  5FLM H;  2OQK A;  4X62 Q;  5J3B A;  4LFA L;  3KYH C;  1MJC A;  3K81 C;  4BA2 I;  4DR7 Q;  2D0O A;  3M4P A;  1JB7 A;  2JA5 H;  1K73 C;  4JI8 L;  4JI6 Q;  4LNQ A;  2JA8 H;  3I55 A;  4X66 L;  3S1R H;  4DV3 Q;  2CWP A;  2NN6 G;  1QZG A;  1X3F A;  3J81 c;  1YHB A;  1L2F A;  2LXJ A;  4TQU S;  2E5L L;  2I5H A;  1TWG H;  1VQ4 A;  3CCR A;  3L0O A;  4Y52 H;  2WB1 G;  4JBW A;  1JE5 A;  3F8T A;  1VQ8 A;  1UWV A;  4LF7 Q;  1QVF A;  4AYB G;  4DR3 Q;  1A62 A;  1X56 A;  4LF6 L;  1HZB A;  1SE8 A;  5IP9 G;  2EXD A;  4QL5 A;  2HIX A;  4LFA Q;  1JMC A;  4B3M L;  1IZ6 A;  4DPG A;  1TWA H;  2PNH A;  4JI8 Q;  4B3R L;  2RCN A;  3I2Z A;  4X66 Q;  2VZA A;  3KFU A;  3STB D;  5IP9 H;  1EYG A;  4GKK L;  3S14 H;  4POG A;  4WJ3 M;  4DR1 L;  2E5L Q;  1YIJ A;  4JV5 Q;  1IBL Q;  3T1Y L;  2V1C C;  2UXB Q;  4IPC A;  3RN5 A;  4HIK A;  4GKJ L;  1OXU A;  4LFB Q;  4A3M G;  4DAM A;  3J80 c;  1FGU A;  4A3B G;  1NY4 A;  1XMO Q;  1G29 1;  4LF6 Q;  5GRO A;  1BBU A;  1PH5 A;  1G51 A;  1OXT A;  4A3J G;  3H3V I;  2VW9 A;  1VQB A;  4A3M H;  2D62 A;  3ICE A;  4B3M Q;  4O2D A;  1BKB A;  2DGY A;  4OWX B;  1Q86 C;  4JI4 L;  4A3B H;  3GTG H;  1C0A A;  3JAM i;  1JJG A;  2I5L X;  2RF4 A;  4R4I A;  5JEA G;  5BR8 Q;  4BBR G;  4YHH L;  4GKK Q;  1IXR A;  3S2D H;  4A3J H;  4DR1 Q;  1YZ6 A;  1JJC B;  1KHI A;  1HH2 P;  4A3C G;  1XPR A;  5IYC G;  4A93 G;  4GKJ Q;  5M5Y H;  2MFI A;  3E9I A;  4JYA L;  1NJI C;  5EAY A;  1PH4 A;  1VQA A;  1QVC A;  4LF5 L;  1YJW A;  4BBR H;  3CCV A;  4DV1 L;  1M90 C;  1G6P A;  3PSI A;  4GLA C;  4OX9 L;  1VQF A;  3CF5 A;  1N36 L;  4A3C H;  4A93 H;  5IYC H;  4GNX C;  4EX5 A;  4DV7 Q;  1J6Q A;  1NBW A;  2AWN A;  1CKN A;  2MO0 A;  3U58 A;  1WI5 A;  1HZC A;  5IWA L;  4LW1 A;  1PH9 A;  5LMN L;  2F4V L;  3HOW G;  3CCQ A;  1CKM A;  1E1O A;  4GLV B;  5E7N A;  3GTO H;  3S16 H;  1MIU A;  1UEB A;  1WJJ A;  2I5M X;  2OQ0 A;  1XJV A;  4IPD A;  1RIP A;  2QGQ A;  4IPH A;  1YIT A;  4X6A H;  4ME3 A;  1L0W A;  2Q2U A;  1SFO H;  1LM0 A;  2JA9 A;  1FVI A;  4DR2 L;  1E22 A;  2UUA Q;  1QUQ B;  1XNR L;  3J81 i;  3HOW H;  4LWC A;  3S1N H;  1VQM A;  3I4N G;  3TS0 A;  4A3L G;  2ALY B;  3PIP A;  3A74 A;  1N36 Q;  2ZJP A;  2HIV A;  1A63 A;  2ZJQ A;  4K0K L;  3ER0 A;  1IYJ B;  3GD7 A;  3TS2 A;  1FL0 A;  4IOA A;  3S2H H;  5GAE C;  1GKH A;  5IWA Q;  1WCM G;  5M3F G;  4OWT B;  4DR5 L;  1Y1V G;  4A75 A;  4LF4 L;  3I4N H;  4MZ9 A;  5LMN Q;  2F4V Q;  4A3L H;  5GQO A;  3UDI A;  4QGU A;  2NVY H;  1HNZ L;  2MO1 A;  1AH9 A;  2D0P A;  1X3E A;  3OYY A;  3PUW A;  4A3E G;  1WCM H;  3DLL A;  5M3F H;  4OO1 G;  2ZJR A;  2K14 A;  4P74 A;  3ZJY C;  5C44 G;  2UU9 L;  2OWO A;  4OWW B;  1VQD A;  2YV5 A;  4JOI A;  4DV4 L;  2Z6K C;  1OTC A;  3TRZ A;  1HNW L;  1A0I A;  2CFM A;  2B63 G;  1CSP A;  1HR0 L;  2JK8 A;  3I56 A;  4XTC S;  4GOP A;  4DR6 L;  4A3E H;  2IX1 A;  4JI0 L;  4YWM A;  3J80 i;  4K0K Q;  4QIW E;  4X62 L;  1L1O B;  4HID A;  1MKH A;  4O0A A;  1VQP A;  5H1S E;  5C44 H;  4DR7 L;  4YWK A;  1Q7Y C;  1V1Q A;  2EIF A;  4JI6 L;  1CKO A;  1S3O A;  2B63 H;  4DR5 Q;  1KL9 A;  4DV3 L;  1U5K A;  1KXL A;  3BZC A;  3K7A H;  1U0L A;  2KHJ A;  3K8A A;  4NB3 A;  3G4S A;  3ULJ A;  1UE1 A;  3AFP A;  4R1J A;  5IY0 A;  3CW2 C;  1VQ7 A;  3HOZ G;  1A8V A;  4DKA C;  2UU9 Q;  1YNX A;  4OXP A;  4BXX H;  5JEA J;  1GVP A;  3NEN A;  4JI1 Q;  4DR3 L;  1HR0 Q;  1WOC A;  4DR6 Q;  2A19 A;  2PQA B;  3D31 A;  1I3Q H;  3AQQ A;  2CQO A;  2ZTC A;  3J7A 5;  3E0E A;  4LF9 L;  1XPU A;  3HOZ H;  5JJK A;  3J7Z C;  1VQ5 A;  4Y7N H;  1OXX K;  1VQC A;  3UDG A;  4JV5 L;  2ATW A;  1IBL L;  2N78 A;  4GN3 B;  3W1B A;  2UXB L;  3Q8D A;  3RLO A;  2K5N A;  2BH8 A;  4LFB L;  1C9O A;  3IRB A;  1K83 H;  3PUZ A;  1EIY B;  1Q1E A;  4DV2 Q;  1O7I A;  2JJQ A;  3RLN A;  1XMO L;  3FKI G;  2ZTD A;  3K7U C;  1PH3 A;  3HKZ E;  3RN2 A;  4LF9 Q;  3M85 A;  4RG1 A;  3KDF A;  2UUC L;  4HIM A;  3KF6 B;  1Q12 A;  2CCZ A;  1PH7 A;  3FKI H;  4YCW A;  5BR8 L;  3F1Z A;  4GS3 A;  4JI7 L;  4AH6 A;  3GTP H;  2NZO A;  2VQE Q;  2CWA A;  1VQI A;  4PZ8 A;  3NEM A;  3A5Z B;  4YY3 L;  2YTX A;  4HJ7 A;  1IBK Q;  2K50 A;  4DAY B;  5GAD C;  3BJU A;  4X64 Q;  4WJ4 A;  2KCM A;  4C2M H;  2IHE A;  1Z9F A;  4P75 A;  1R9T H;  3AFQ A;  2UXC Q;  2L15 A;  4DV7 L;  1VQO A;  1K8G A;  1DGS A;  5DLQ E;  1YJ9 A;  1VQG A;  1CSQ A;  2UUC Q;  2PMZ E;  1KRS A;  2QEX A;  1E24 A;  1XTD A;  4PZ6 A;  2JA7 G;  2WFW A;  4JI7 Q;  3M4Q A;  4EQ5 A;  2ID0 A;  3I4O A;  3S24 A;  1VQ6 A;  1PYB A;  4C3H H;  1EOV A;  3NBH B;  3PGZ A;  3CPW A;  4B3T Q;  2F3I A;  4GNX A;  4YY3 Q;  5LMN W;  2UUA L;  3S1Q H;  4C3I H;  3CCU A;  2JA7 H;  3TQY A;  1UE6 A;  1NMF A;  3L7Z C;  2YTY A;  4L5T A;  1PV4 A;  2AMC B;  2Q2T A;  3HFZ B;  1P8L A;  3CME A;  3J81 j;  1HJP A;  5C0X J;  1NE3 A;  2H5X A;  1WYD A;  2XGT A;  2PI2 A;  5JJI A;  4IFD G;  1H95 A;  1X55 A;  4JBK A;  1SRU A;  4L5S A;  1C7Y A;  4OO1 I;  4LUZ A;  4R4O A;  2HT1 A;  4A3D G;  2GN5 A;  1W3S A;  4RMF A;  4IO9 A;  4NXM L;  2F52 A;  2R7Z G;  1VQJ A;  1SR3 A;  3RR5 A;  3EIV A;  5GAH C;  2HHH Q;  2K75 A;  1SLJ A;  4H02 A;  1J5E Q;  1YVC A;  4DR4 Q;  2VY3 A;  1TXY A;  4QQB X;  1CUK A;  2BH2 A;  2R93 G;  1X65 A;  1YEZ A;  2R7Z H;  4KHP L;  3BZK A;  1FJG L;  3AYH B;  3PUY A;  2E2I H;  5K36 G;  2NVT H;  1KAW A;  2Y0S G;  3WWV A;  4JCV E;  3PF5 A;  1ASZ A;  3HOV G;  1VQL A;  1OXV A;  5HGQ A;  2NVQ H;  2R93 H;  4A76 A;  3PIO A;  5C0X I;  1HR0 W;  4DUY L;  4P71 A;  2B29 A;  2YYZ A;  2KBN A;  3M9B A;  3G48 A;  1EUJ A;  4J15 A;  5M5W H;  1IBM L;  4NXN L;  2Z6K A;  4MTN A;  4UPA A;  4X65 L;  3H15 A;  4LUO A;  4IPG A;  4DV5 L;  3HOV H;  4JI3 Q;  5IYD G;  1BVS A;  1X3G A;  4L5Q A;  4AIM A;  1S72 A;  3RLF A;  3CCS A;  2BA1 A;  4LFC L;  1Z47 A;  3HOX G;  2Q2I A;  4JG2 A;  1CKN B;  1Y1V H;  3S1M H;  3CMA A;  1BBW A;  2WAQ G;  3H3V H;  1L1O C;  4JI1 L;  4DV0 L;  1FJG Q;  4R4T A;  2NN6 I;  5IYD H;  3HOX H;  4DV6 Q;  1X9N A;  3D0F A;  4QJF A;  5IP7 G;  1XPO A;  4A4I A;  1YJN A;  2ZTE A;  1B70 B;  4DUY Q;  3W5O A;  4UP9 A;  3KJO A;  4PG3 A;  1N34 L;  1IBM Q;  4DV5 Q;  4X65 Q;  4NXN Q;  4A3G G;  1M1K C;  5LMU L;  1K0R A;  1Q46 A;  3EN2 A;  3PUV A;  3GTL H;  4JI2 Q;  1N32 Q;  2UXD Q;  1K3R A;  4LFC Q;  2JA6 G;  1HZ9 A;  1VCI A;  2Z0S A;  3U4V A;  3RZD H;  3CC7 A;  4DV2 L;  4A3G H;  4DV0 Q;  2ASB A;  1SMX A;  5GAG C;  2A8V A;  3AEV A;  3NEL A;  1K9M C;  2JA6 H;  2KEN A;  5C4J H;  4DUZ L;  3SGI A;  1ASY A;  1I94 L;  5C4X G;  1D7Q A;  1AE3 A;  1VS0 A;  2IHF A;  1N34 Q;  1PHJ A;  2A1A A;  2R6G A;  1KC8 C;  2VQE L;  1I5F A;  5LMU Q;  4GOP B;  3ULP A;  2VQF L;  4GN5 A;  4IFD J;  3A5U A;  1PA6 A;  5C4X H;  1IBK L;  4B3S Q;  1I50 H;  3GTJ H;  1Q8K A;  2UUB Q;  4X64 L;  3PO2 G;  3CP0 A;  4P72 A;  4NXM Q;  2K5V A;  2MQH A;  3CPF A;  2EQS A;  2UXC L;  4HJ8 A;  4DUZ Q;  3M4O H;  1YHQ A;  4LF8 Q;  4DNI A;  1V9P A;  3OTO L;  3JC6 6;  1I94 Q;  4UP7 A;  3PO2 H;  1W2B A;  4KHP Q;  3K0X A;  3FP9 A;  3K80 C;  4HJ9 A;  1B7Y B;  2JE6 I;  4IOC A;  1X6O A;  4YCV A;  1PVO A;  2AHO B;  1K8A C;  2N49 A;  2VQF Q;  3T1H L;  3BU2 A;  3RNU A;  4B3T L;  3I7F A;  2NVX H;  1EQR A;  3S15 H;  1EFW A;  3CCJ A;  3I4M G;  2WB1 E;  4IFD I;  4HJA A;  4XIG S;  4AYB E;  1GO3 E;  1TWF H;  1N33 L;  1HZA A;  1B8A A;  4JI5 Q;  2JQO A;  3TEH B;  2OTL A;  2ES2 A;  2N3S A;  3STB C;  3I4M H;  1PH2 A;  3OTO Q;  3GO5 A;  1Y1W G;  1OXS C;  1VQE A;  1YHA A;  2K5H A;  1Q82 C;  4KLK A;  2FXQ A;  2RHS B;  5C3E G;  1HNX L;  1TWC H;  3H0G G;  1XMQ L;  3M3Y H;  3S17 H;  1T9H A;  1PH8 A;  1WFQ A;  2PI2 E;  2YTV A;  3FHW A;  4PZ7 A;  2HHH L;  3T1H Q;  1J5E L;  1P16 A;  1Y1W H;  2HQL A;  2E2J H;  3GTQ H;  4DR4 L;  4BA1 I;  1N8R C;  4BBS G;  4POF A;  1SRO A;  1E3P A;  1V43 A;  2VL6 A;  3KDF B;  5FJ8 G;  2DUD A;  2LXK A;  5C3E H;  3PUX A;  3H0G H;  1N33 Q;  3DM3 A;  2YU9 H;  3HOU G;  1GM5 A;  1EIF A;  3GTK H;  4HJ5 A;  4KHZ A;  4BY7 G;  2R7D A;  4BBS H;  1QUQ A;  2WP8 J;  5FJ8 H;  5FLX c;  3KJP A;  3U4Z A;  4B3R Q;  5ELN A;  3HOY G;  3HOU H;  4UY8 C;  5HY6 A;  2KHI A;  1EQQ A;  1JT8 A;  1HNX Q;  3CQZ H;  4C3J H;  4AQY L;  5ELO A;  1XMQ Q;  4BY7 H;  3T1Y Q;  4JI3 L;  2BA0 A;  3CC2 A;  4JC0 A;  2IX0 A;  1RL2 A;  2R92 G;  1EWI A;  2N8N A;  3UE1 A;  2JEA I;  3HOY H;  3UDF A;  1PYS B;  2RHQ B;  1LYL A;  3L2P A;  4JBJ A;  4R4C A;  3CAM A;  4OON A;  3F2D A;  5JJL A;  2MNA A;  4JBM A;  2ZM6 L;  5AJ3 L;  4DK3 C;  3KOJ A;  4ALP A;  4DV6 L;  4A3I G;  1PH1 A;  1KD1 C;  3MXN B;  2I0Q A;  2R92 H;  4YWL A;  4QY7 A;  4BY1 G;  3UE0 A;  4JI4 Q;  3CD6 A;  4GNX B;  3OW2 A;  2KCT A;  5M5X H;  1S40 A;  2CKZ B;  1GD7 A;  4YHH Q;  3UDX A;  3B6Y A;  4TVA B;  1LUZ A;  1PH6 A;  4AQY Q;  3M7N A;  1L1O A;  1KIX A;  4A3I H;  4JI2 L;  4JYA Q;  4BY1 H;  2B3G A;  2XTI A;  3U50 C;  1N32 L;  2UXD L;  3GDE A;  3TRE A;  3W1G A;  4A3F G;  4LF5 Q;  2AKW B;  2VS1 A;  4DV1 Q;  3E9H A;  1YI2 A;  4A3D H;  1VQ9 A;  2VUM G;  4YCU A;  5IE8 A;  2K52 A;  4OX9 Q;  4LUV A;  2ZM6 Q;  5AJ3 Q;  2NZH A;  3KF8 B;  2Y0S E;  1E7Z A;  1I6H H;  1KRT A;  3PF4 A;  3ERS X;  5M3M G;  4A3F H;  2Q2H A;  5IT9 c;  1QVG A;  2E2H H;  1E1T A;  2OTJ A;  2VUM H;  3MEF A;  2PQA A;  3PO3 G;  3CCM A;  2QA4 A;  3G71 A;  1XNQ L;  5IP7 H;  5M3M H;  2K4K A;  1LTL A;  3KLW A;  3CXC A;  3EBE A;  4R4Q A;  4GN4 B;  3CCE A;  4DR2 Q;  4MNO A;  4IJL A;  4NPS A;  3CCL A;  4B3S L;  1XNR Q;  1X54 A;  2UUB L;  2WAQ E;  3GTM H;  3PO3 H;  1VQH A;  1Q1B A;  4GLX A;  3PCO B;  3VDY A;  4UP8 A;  1NTG A;  1N9W A;  3JAM c;  2IY5 B;  2AWO A;  5IYB G;  1MJE A;  1YBY A;  4PMW A;  3F2C A;  1UE5 A;  1KQS A;  1TWH H;  2C35 B;  4JOI C;  4LF8 L;  2GVB A;  4FDB A;  2JEB I;  1Q81 C;  1VQK A;  1PFS A;  4P73 A;  3CC4 A;  4GOP C;  4LF4 Q;  4IJH A;  1IL2 A;  3A0J A;  2OCE A;  1JJ2 A;  4BXX G;  1HNZ Q;  2E8G A;  2GVA A;  3ULL A;  4APV A;  4A3K G;  1UE7 A;  5IYB H;  4HIO A;  1VQN A;  2R7F A;  1AE2 A;  2IT1 A;  3RZO H;  1XNQ Q;  3PV0 A;  4KI0 A;  5C0X G;  2LSS A;  5FLM G;  3KF6 A;  1QZH A;  1NMG A;  3F2B A;  4LF7 L;  4L5R C;  4DV4 Q;  2JA5 G;  2JA8 G;  1HNW Q;  4A3K H;  1SN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...