4K0KL

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kL00
4QJFA 4APVA 1J5EL 4IPDA 3OTOQ 4BBSH 2CFMA 4C3IH 3BZKA 5C44G 2RF4A 4GOPB 1XMOQ 1W2BA 4A3EH 4DUYL 2IHFA 1QUQA 3A0JA 2Q2TA 4DAMA 3E9HA 3JAMc 1L1OB 1HR0Q 1YHAA 4LW1A 1EUJA 1T9HA 3CCUA 1V1QA 4DV7Q 4GLXA 1M1KC 2B63G 4LF8Q 4GKJQ 1NY4A 1TXYA 2R93G 3KF6A 2GVAA 3NELA 1C9OA 2ZJPA 1IBML 4A3CG 4IPHA 4X64L 3CCJA 3D31A 2R92H 4BY1G 3T1YL 2K5HA 3CPFA 2JA6H 2K75A 3UE1A 3HOVH 5LMNQ 4YY3L 1EQRA 1KRSA 3K0XA 4C3JH 1WCMG 4YCUA 3ULJA 4HIMA 3LGJA 2PQAB 4B3SQ 1TWFH 3K7UC 2IT1A 4GOPC 2UU9L 1I94L 5K36G 1NMGA 4IOCA 2QEXA 3HOYG 2Y0SG 3L2PA 1IBLL 1VQ9A 4KLKA 4JI6L 2RCNA 1EQQA 1L1OC 4DR4L 5IT9c 3L0OA 4BBRG 4X66L 1GVPA 2WAQG 3J81i 3WWVA 3CCEA 2BH2A 4JI3L 3A5UA 3KJOA 1S3OA 4LFAQ 2VQEL 4A3GG 1KAWA 1GO3E 2C35B 1I50H 4DAYB 5M5WH 4HJ8A 4DR5Q 4A3KH 2E5LL 4L5SA 3GTKH 4BXXG 4BA2I 4Y52H 4DV4L 2VS1A 1FGUA 2UUCQ 2VZAA 1QVCA 3HKZG 4OWTB 4QY7A 4GN4B 1VQHA 2QGQA 1PH5A 1SRUA 2Z6KC 1D8LA 1PHJA 3G48A 1PFSA 5IP7G 1YZ6A 3UDGA 1YJWA 1IBKQ 1ASYA 2HIXA 2ALYB 2KCTA 2ZM6L 4DV1L 4UP8A 3I56A 2N78A 4R4OA 3ER0A 4R4IA 4LUOA 1HZCA 5C0XI 2E5LQ 3RN2A 2JA8H 1L2FA 2XGTA 3CF5A 4GN3B 4OWXB 3F1ZA 3MXNB 1VQPA 4DV2L 4H02A 2NVYH 5C3EG 1S72A 1PH9A 3UE0A 3A74A 5C0XJ 3KDFB 3H0GG 4JI8Q 3CD6A 3PO3H 4KI0A 4YWKA 1VQLA 1K73C 1B8AA 4JV5Q 4LFBL 1Y1VH 5ELOA 3GD7A 3S1MH 2YYZA 4JCVE 4DR6L 1EFWA 4O0AA 1FL0A 2A1AA 1QUQB 2JQOA 4A3MG 2AWNA 2F4VQ 4LUZA 4DV3L 2JEBI 2YU9H 1N32Q 3AFPA 3J7A5 1YHBA 2B3GA 3AYHB 4YHHL 3KF6B 2MNAA 1TWAH 2OCEA 1E3PA 4PZ6A 3HOWG 4GLVB 1M90C 4DK3C 3K80C 1XNQQ 3M3YH 2F52A 1BKBA 4R4QA 4BY7G 2UXCL 5IY0A 1H95A 3I4NG 2UXBQ 1LTLA 3NEMA 1PH1A 4A3JH 4LF4L 4ME3A 1VQNA 1HNZQ 1QVFA 3RR5A 1IXRA 1V43A 3GTLH 2EXDA 1A0IA 1NBWA 4IPCA 1DGSA 4QQBX 4TQUS 1PH7A 1Q46A 1N36Q 4JYAQ 1YBYA 1Q12A 1W3SA 3F2BA 4DR1L 4JBKA 4A3BG 4B3ML 3J80i 1JE5A 2EQSA 4HIDA 1UE7A 5M5YH 4NXNL 2LXJA 3GDEA 3HOZG 4UP9A 3M4OH 1X9NA 3OYYA 1D7QA 2ES2A 2JA5G 4HIKA 4JI0L 1HZBA 4WJ4A 5GAEC 3FKIH 1JJCB 3EIVA 1X3FA 4K0KL 2D62A 4X62L 1Y1WH 1B7YB 1HZ9A 1Q86C 1PH6A 3HOUH 4NXNQ 2KCMA 2KHJA 3G6EA 1NJIC 4B3TQ 1SLJA 1NTGA 3OW2A 3T1HL 4IFDI 1HNWL 1RL2A 2IX1A 3F8TA 1A62A 1JJGA 4JI1L 1X6OA 3NENA 1JJ2A 4B3RQ 1MKHA 4AYBE 3E0EA 5FLMH 1Y14B 4GN5A 1PA6A 2AMCB 2UUAL 3VDYA 5IYBH 1PVOA 3J81c 3CMEA 4LFCQ 1NMFA 1YEZA 4X65Q 3GTQH 3TS2A 2E2IH 4X6AH 4JI2L 2K5NA 2I5MX 3CXCA 5C44H 3U4VA 1XPOA 3PUZA 1U0LA 2OQKA 1N33Q 4LF7L 2VQFQ 4DR7L 2NVXH 1AE2A 2UUBL 3PO2G 2GVBA 1UE1A 5GAHC 1P8LA 2DGYA 1Q82C 1RIPA 4GS3A 4P72A 5IYDG 4P71A 3PV0A 3CCQA 1J5EQ 4BY1H 4NXML 2D0OA 2KHIA 2WP8J 3HOXG 3TS0A 1Z47A 1KD1C 1MJEA 2JA7H 4DUYQ 1E22A 2OTJA 1HJPA 3I2ZA 1B70B 5IP9G 5C4XH 2ZTCA 3BJUA 1QZGA 5HGQA 4IFDG 2PMZE 2K14A 4P75A 1YJ9A 4LF5L 1O7IA 2VY3A 1IBMQ 4JC0A 4X64Q 2LXKA 5DLQE 4BBSG 3U50C 4KHPL 3T1YQ 4MNOA 3AFQA 4A3EG 1YITA 3G71A 1FVIA 3KLWA 3K8AA 4YWMA 3ULLA 3GO5A 3PIOA 3RNUA 1YHQA 2H5XA 3CCVA 1CKNA 4YY3Q 5M5XH 1VQBA 4P74A 3GTGH 4JBMA 2ATWA 4DUZL 2VUMG 3GTOH 1KHIA 2WB1E 1LM0A 2KBNA 1XNRL 4GKKL 5BR8L 1I94Q 2UU9Q 4WJ3M 4BXXH 5IYCH 2HQLA 1NE3A 1TWGH 2R92G 1IBLQ 3FHWA 4JI6Q 1X54A 2JA6G 1SR3A 4DR4Q 3M4QA 1Q8KA 4DR3L 3HOVG 4X66Q 4UY8C 3PUXA 2K50A 4JI4L 4JBWA 3CMAA 5ELNA 4FDBA 4JI3Q 2YTYA 2R7ZH 3JC66 2VQEQ 2NN6I 3CCMA 4A3IH 4POFA 1XPRA 1K3RA 1SN8A 4YCWA 4C2MH 1X3GA 1VCIA 3PF4A 3Q8DA 4DV4Q 4MTNA 4LF6L 1TWHH 2KENA 3GTMH 2D0PA 4IJHA 2EIFA 3G4SA 1VQFA 4QIWE 1K83H 2K4KA 1PYSB 1KIXA 2JK8A 4TVAB 1E1TA 1SROA 2CWAA 2ZM6Q 4DV1Q 1JB7A 1Q1BA 2ASBA 1SE8A 3M85A 4A3KG 2I0QA 3HFZB 3K81C 3UDXA 3JAMi 4OX9L 2A8VA 1VQGA 3TEHB 1K8GA 2Q2HA 3J81j 3H3VI 4DV2Q 1N9WA 3D0FA 5AJ3L 3H15A 1XJVA 1X55A 1XTDA 2CKZB 3S24A 2NVTH 2ZJRA 5JEAJ 4LFBQ 4NPSA 1EIFA 3M7NA 2CWPA 5M3MH 3EN2A 1OXXK 2Y0SE 3H3VH 1HZAA 4OX9Q 1MIUA 4DV5L 3I4MG 1E7ZA 1OXVA 2R6GA 3PGZA 4DR6Q 1CUKA 3BZCA 5LMUL 4A76A 3CPWA 1XMQL 1K8AC 2WAQE 4OO1G 4LF9L 4HIOA 1VQJA 5C0XG 4L5RC 2A19A 3PO3G 3RLOA 4QGUA 4DV3Q 1Y1VG 1PH3A 1A8VA 4YHHQ 1V9PA 4OONA 1VQ4A 4XIGS 3STBD 4DV6L 4A3LH 1VQEA 2K5VA 2UXCQ 4AYBG 2ZTEA 2ID0A 1CKMA 2BA0A 3U58A 4DR2L 1HR0W 1WYDA 4RMFA 4LF4Q 1CKNB 3F2CA 4IO9A 1QVGA 4OWWB 3S2DH 3SGIA 3RLFA 4O2DA 4A3DH 1N34L 4A93H 2IY5B 1BBUA 5E7NA 2IX0A 3CQZH 3CC7A 4YCVA 3GTJH 2RHQB 1FJGQ 5J3BA 1ASZA 1X3EA 4DR1Q 3PUYA 5LMNW 4DK6C 4A3FH 4B3MQ 2JJQA 4A3JG 1YVCA 1VQ8A 2JEAI 3F2DA 1PH8A 4LUVA 2GN5A 4KHZA 3KFUA 2MO0A 5M3FH 4JI0Q 4A4IA 2VNUD 5FJ8G 1LYLA 3A5ZB 4K0KQ 5JJIA 4X62Q 4PZ8A 1HNXL 5HY6A 2E2JH 4L5TA 1VQMA 2HHHQ 1TWCH 4JI5L 1N8RC 3T1HQ 3AEVA 1HNWQ 3UDFA 4POGA 3K7AH 5IWAL 2NVQH 1AE3A 3FKIG 3KOJA 4JI1Q 3RZDH 1Y1WG 3PO2H 3S17H 1KRTA 2B63H 2UUAQ 3HOUG 4JI5Q 3W5OA 2WB1G 1K9MC 4AQYL 1VQIA 4JI7L 1FJGL 3E9IA 3RZOH 1EOVA 2R93H 5IYDH 2HHHL 2JA9A 4A3CH 2UXDL 1BVSA 4JI2Q 3OTOL 3HOXH 3S2HH 1AH9A 4GNXA 1YNXA 1PYBA 2L15A 1XMOL 1S40A 4P73A 2HIVA 4LF7Q 4DR7Q 1A63A 3FP9A 1SFOH 5FLMG 2UUBQ 1HR0L 4DV7L 2E2HH 1VQ6A 1WCMH 4LF8L 4GKJL 4JOIA 1WFQA 1IL2A 2YTVA 4DPGA 4ALPA 2CCZA 3TRZA 3IRBA 3PF5A 3HOYH 4NXMQ 4PZ7A 3AQQA 2FXQA 1QZHA 4JBJA 4BBRH 3RN5A 5LMNL 1EIYB 2IHEA 2VUMH 4B3SL 4LF5Q 5GQOA 1MJCA 3S1QH 4A3GH 1LUZA 4KHPQ 2OQ0A 2JA7G 1X56A 5C4XG 2AKWB 2OTLA 2HT1A 2ZTDA 1G6PA 3STBC 3CCLA 2I5HA 5EAYA 3PUVA 3PCOB 2LSSA 5IP7H 4DUZQ 4LFAL 4GKKQ 1YIJA 1XNRQ 5BR8Q 2MQHA 3NBHB 4EQ5A 4DR5L 2K52A 3KJPA 1WJJA 2Z0SA 1EYGA 2AHOB 2UUCL 4DR3Q 4LWCA 4YWLA 5C3EH 1OTCA 4JI4Q 3H0GH 5GAGC 4XTCS 1IBKL 1UE6A 2R7DA 1L0WA 3J80c 1CSPA 3PUWA 5IYCG 3B6YA 2JE6I 4PMWA 5GADC 1PV4A 1E24A 4UPAA 3S15H 4LF6Q 4HJ5A 1IYJB 4Y7NH 2NZOA 2CQOA 2N49A 4QL5A 4NB3A 1EWIA 2PI2E 4A3MH 4JI8L 3W1GA 4C3HH 4IPGA 2R7ZG 4JV5L 5C4JH 2WFWA 4A3IG 1J6QA 4PG3A 3S1RH 2JA8G 3HOWH 3I4MH 3GTPH 4L5QA 4BY7H 3BU2A 4GNXB 3HKSA 4MZ9A 3I4NH 3KF8B 2N3SA 3EBEA 1VQ5A 5AJ3Q 1JT8A 2NN6G 1CKOA 4IJLA 2F4VL 1OXUA 2V1CC 2YTXA 4DV0L 1N32L 4JG2A 4LNQA 1UEBA 4GOPA 4A75A 5H1SE 4DV5Q 1WOCA 1GKHA 1VQCA 3M9BA 1XNQL 3ICEA 2RHSB 2UXBL 1L1OA 5LMUQ 1OXSC 1XMQQ 1C0AA 3HKZE 4LF9Q 4A3BH 3S16H 1G51A 1PH2A 2PI2A 1VQAA 4OXPA 1YJNA 1HH2P 3L7ZC 4UP7A 4DV0Q 2MO1A 1X65A 1HNZL 2QA4A 3UDIA 5JEAG 3ERSX 3RLNA 1PH4A 3HOZH 5M3MG 1UE5A 4GNXC 2Q2UA 2N8NA 4AH6A 3PSIA 2JA5H 2MFIA 1E1OA 4DV6Q 3CW2C 3S1NH 3CC2A 1N36L 4JYAL 1I6HH 2R7FA 3I7FA 4DNIA 5FLXc 3PIPA 3W1BA 4DR2Q 4BA1I 3DM3A 4HJAA 2PQAA 4JOIC 2Z6KA 4AIMA 1KC8C 3J7ZC 1IZ6A 2AWOA 3TQYA 2OWOA 2Q2IA 2DUDA 5JJLA 1N34Q 2NZHA 1Z9FA 2ZJQA 4A3LG 5JJKA 5FJ8H 4R4CA 1KL9A 4OO1I 4J15A 2F3IA 1I3QH 4GLAC 3CC4A 1XPUA 1Q7YC 1R9TH 1VQOA 1Q81C 4B3TL 3I55A 4R4TA 1SMXA 4A3DG 2VL6A 3M4PA 3TREA 3ZJYC 3ULPA 4A93G 3CP0A 1I5FA 1GD7A 1U5KA 1BBWA 2XTIA 3MEFA 1C7YA 2BH8A 3DLLA 1UWVA 1OXTA 2YV5A 3I4OA 3S14H 4B3RL 4R1JA 1K0RA 2VW9A 4A3FG 1JMCA 2I5LX 1YI2A 1HNXQ 1P16A 4LFCL 2B29A 4RG1A 4X65L 1GM5A 1WI5A 4IOAA 5M3FG 1KQSA 1G291 5IE8A 4HJ9A 5GROA 1N33L 4DKAC 5IWAQ 2BA1A 2VQFL 3U4ZA 2PNHA 5IP9H 1CSQA 3CCSA 3KDFA 1VQDA 4HJ7A 1VQ7A 1VQKA 4IFDJ 1KXLA 4EX5A 3CCRA 5IYBG 4AQYQ 3CAMA 1Q1EA 3KYHC 2E8GA 4JI7Q 1VS0A 2UXDQ
chains in the Genus database with same CATH superfamily
3BZKA 1XMOQ 2RF4A 4A3EH 1JC7A 1JOKA 1YNNC 1L1OB 2R61A 2AQ3B 2B63G 2L1BA 1M1KC 1PXUA 4GKJQ 1DM0B 3NELA 1C9OA 4I7AA 3KLRA 4IPHA 5IT9E 3DEOA 3CPFA 3A8IE 2IW3A 3HOVH 1PYWD 1TVXA 4N9PA 2IT1A 2EY5A 1I94L 1NMGA 4IOCA 4WORA 1A3VA 5JPNC 3HOYG 4J1MA 3L2PA 4KLKA 1EQQA 5IT9c 2EJMA 4X66L 1GVPA 4KK7A 1ESFA 3J81i 1WTPA 3W3AA 4CBVA 1L0XB 3KJOA 1BCPF 2F0LA 1AZPA 1BCPB 1S4ZA 3M4YA 4BXXG 3NE5B 1O7YA 4OELB 2UUCQ 3HKZG 1VQHA 2QGQA 3TP5A 2Z6KC 3QR8A 4GZYC 5JOBA 1CZGA 4JPBW 3I56A 4R4IA 3ER0A 1HZCA 1W6KA 1U4PA 1L2FA 3CF5A 3TP8A 1YNND 1RJTA 3EJIA 3D3RA 3MXNB 1VQPA 1O80A 4DV2L 2NN6H 5C3EG 4JI8Q 2CVRA 2E75C 4UDUC 1B8AA 1VQLA 2F3WA 2YYZA 4JCVE 5F2DA 4OEMB 2D2CC 4DGZA 1C8CA 3MFGA 4LUZA 2JEBI 1N32Q 3AFPA 3J7A5 4YHHL 1IYVA 2MNAA 2OCEA 1E3PA 4BY7G 3S1MB 1XNQQ 2F52A 1EWCA 4R4QA 5IY0A 1D6EC 1G2TA 4HN7A 5ELCA 2PW7A 4HTHA 3K5MA 1PH7A 1SYCA 1TQOA 1N36Q 1Q12A 1AFPA 5E4XA 1W3SA 3F2BA 3LWEA 4JBKA 4B3ML 3J80i 1TS4A 2NTTA 5CBAE 1UE7A 5M5YH 4NXNL 2LXJA 1X9NA 3GTLB 4B9XA 2ES2A 5L37A 3EIVA 4K0KL 4X62L 5JVH3 5CC4A 1U9RA 3DWPA 2PMZB 3G6EA 1PRTF 1BDOA 1J9OA 1NJIC 5KRUA 1SLJA 1PRTB 2K5QA 4B3TQ 4FF1A 2A74C 2MPMA 2IX1A 3M4OB 1A62A 1JJGA 1KAAA 4RCOA 3VDYA 2VB3X 1QILA 2IL8A 3CMEA 3AB9A 5T1GA 3TS2A 1Q8IA 2WB1B 2OXPA 1WTOA 4JI2L 3CXCA 5C44H 4IZ8A 3PUZA 4IN3A 3I70A 4DR7L 2B2VA 3TZUA 2EDGA 2KVMA 1Y8NB 4K5XA 5CV5A 5GAHC 2DGYA 3PV0A 3BVGA 1RODA 4L6TB 3TS0A 3ITPA 1SYGA 2OTJA 5IP9G 1CFMA 2O2LD 1LT3D 4QIWB 3K59A 1YJ9A 4LF5L 4BWGB 1IBMQ 1NR4A 5EKKA 3U50C 1YNJC 4A3EG 1FVIA 3KLWA 3Q22A 1A6XA 2XVSA 3ULLA 3PIOA 1LABA 2EJGC 2JA7B 3VYUA 4OHJA 3OIQA 4P74A 3J7AV 4DUZL 2VUMG 1W6JA 1KHIA 3GTOH 2KBNA 2O4XA 5DNFA 4GKKL 5CYUA 4WJ3M 1HFGA 4F8MA 2J7ZA 3HOVG 4M8AA 2K50A 4JI3Q 5M5XB 1I6VC 2K05A 3CCMA 1XPRA 4H13C 1SN8A 4YCWA 3PF4A 1TWGB 1RKNA 3VA7A 3G4SA 2RSNA 1LLRD 1KIXA 4R8NA 4DV1Q 4CDDC 1Q1BA 2R7ZB 3HFZB 4IURA 2F0MA 4OX9L 4C2MB 1K8GA 2WINB 2Q2HA 3BG3A 5AJ3L 1RTOA 2I07B 1X55A 1XTDA 3S24A 1K83B 1WD1A 5JEAJ 1B9MA 3FRPB 4X3KA 3M7NA 3QB3A 1QG7A 3EN2A 2Y0SE 3H3VH 1AN8A 4DV5L 4DR6Q 1OXVA 4B08A 3SR1A 4LF9L 4HIOA 1VQJA 1SNCA 1QNUA 3CU7A 5C0XG 2A19A 1HUMA 5EQ0A 1MD2D 4K5WA 4MTKA 3RLOA 5HURA 3D4DA 1V9PA 5FLXE 4XIGS 2B2VC 4DV6L 4AYBG 1PDQA 2ZTEA 2DJFC 3M7GA 4DR2L 1KLUD 1WYDA 4RMFA 4OWWB 3SGIA 1STAA 3QOLA 2IX0A 3CQZH 3D8GA 3MTSA 5J3BA 3OMCA 4CKBA 3FEWX 4DK6C 1YVCA 3X3MA 3H6MA 1PH8A 1RTNA 3ND9A 1GOZA 3MWYW 5JPMC 4ODGA 4A93B 2RCFA 3QJYA 1NCVA 5FJ8G 1X3PA 3KLSA 3GTJB 4PZ8A 5HY6A 4KKUA 1VQMA 3UI2A 1N8RC 4OO1H 2F4IA 1STYA 3DHQA 1HNWQ 3D6CA 1BNZA 3TZDA 4NKLA 2CW0C 4HR7B 1FD7D 3PO2H 4V0BA 1KRTA 1E0BA 3P1HA 2JXMB 2K33A 1K9MC 1VQIA 2EYMA 2R93H 1DOKA 1EOVA 3RZOH 3RUZA 2HHHL 3QWNA 2A6HC 1TWCB 4A3CH 1EY0A 4RHRA 5HGTA 4GNXA 1GUTA 1CTMA 2L15A 3JAME 1XMOL 1S40A 4LF7Q 3KUPA 1SFOH 1XWEA 2QILA 4ZKCB 3RZDB 2E2HH 2UUBQ 1WCMH 4GKJL 3Q24A 5FO8B 4DPGA 4ALPA 2CCZA 3IRBA 4PZ7A 5CV8A 3S2HB 1UAPA 1QZHA 4JBJA 2F0HA 1EIYB 4DAVA 1I4GA 2IHEA 1MJCA 4A3GH 4EGVA 2OQ0A 2Y0SB 1STGA 2ENBA 2OTLA 3ONAB 2ZTDA 3NWSA 2IWHA 4UAIA 5EAYA 1M4VA 5ISRA 5M9OA 3TP7A 2VUMB 1STNA 2CW0D 3IL8A 1WJJA 2Z0SA 5A2QE 3WOFA 1EY9A 3EVQA 2UUCL 5COYA 4JI4Q 4RAUC 2EOTA 3PUWA 1KDCA 4G57A 5GADC 1E24A 4HJ5A 4Y7NH 2CQOA 2N49A 1VDZA 4YIJA 4JI8L 4C3HH 2EJFC 3H0GB 3HGBA 3HOWH 2JN4A 2VB2X 3GTPH 3R2IA 1ZXTA 4MZ9A 3I4NH 1JORA 3KF8B 1CKOA 4IJLA 2J0TD 1OXUA 1N32L 4A3MB 4JVZA 1UEBA 1QOHA 4NMZA 5C4JB 4A75A 3K5LA 1XNQL 3S1RB 2XRQD 4M1UB 1AEXA 1L1OA 1OXSC 1H9RA 5LMUQ 4ZQ3A 3CHBD 2MO1A 4FXKC 1X65A 2QA4A 3UDIA 4GNXC 3PSIA 2MFIA 3TDQA 4ZAIA 4DU9A 1N36L 4KD3A 1MBYA 4DNIA 3PIPA 2F0EA 1EOTA 2ICEC 3GV3A 2NZHA 4K5VA 3HOZB 3MFYA 1EY6A 1PTOC 4R4CA 3NBIA 1KL9A 2JA5B 3S1NB 1I6HB 3J81L 1ENFA 1Q7YC 1VQOA 4B3TL 2KQ3A 3M4PA 2F0VA 3A56A 3MXUA 3CP0A 1GD7A 2AUJD 2E5LL 1C7YA 4FF3A 2YV5A 3BS1A 2EE1A 4R1JA 1K0RA 1EY4A 2VW9A 1JMCA 1HNXQ 1I3QB 3T53B 4G7ZC 1GM5A 1VMCA 5IE8A 5EBCA 4HJ9A 5GROA 1SMYC 4DKAC 5IWAQ 3MXNA 1SJHD 5C5MA 3U4ZA 2PNHA 3DEPA 3CCSA 4HJ7A 1KXLA 1VQKA 4EX5A 3CCRA 4AQYQ 3CAMA 1Q1EA 4JI7Q 2E8GA 2RA4A 4OO1G 3QO2A 2MP1A 4QUCA 4APVA 4C3IH 1D5MC 2OEOA 4GOPB 1W2BA 3HOXB 1HR0Q 1YHAA 1K0SA 2DNCA 2H1EA 1NY4A 2R93G 4LMQD 3TN2A 4N9TA 1IBML 4A3CG 3CCJA 4PNYA 2K5HA 2JA6H 4BBSB 1STEA 3UE1A 1S5FD 3K0XA 3K6OA 4C3JH 1JB3A 1WCMG 3ULJA 4PMBA 3LGJA 1TWFH 1SE2A 5KYLA 4PMCA 3MXGA 5FOBB 1VQ9A 1QCBD 1BXTA 2RCNA 4CKCA 1L1OC 2R92B 5BN5A 2WAQG 4B9WA 3C3LA 4JI3L 3J80L 4LFAQ 4A3GG 1B4OA 1KAWA 1T5XD 1I50H 3KBXA 2VS1A 1DZ1A 2VZAA 3Q23A 2M9VA 2B8FA 3VR6A 1V1OA 1D8LA 1PHJA 1J8IA 2PZWA 1ASYA 3UDGA 4FP5D 1EU3A 4DV1L 3QG1A 2E5LQ 2N78A 3CRKC 2D9UA 5M5WB 3GTKB 4GN3B 1HHVA 4A3KB 3VR3A 1HA6A 2IX3A 1SE4A 2NVYH 4H02A 5C0XJ 4KI0A 2QEJC 1KABA 5LHY1 3NK9A 4JV5Q 4N8X1 5ELOA 3DM1A 4DR6L 2EY1A 4O0AA 1GUNA 1QUQB 2JQOA 2F4VQ 4C3HG 5LL6S 2F0DA 1F9RA 2ZT9C 3OWFA 3PO3B 1YHBA 3KF6B 5CORA 1TWAH 4PZ6A 3HOWG 1Y1VB 3M3YH 3K80C 1BKBA 3G7LA 4CJ2C 3I4NG 3NEMA 3R93A 3I73A 2VXWA 3N52A 4N8FA 1LTGD 2A69C 2BDNA 4RA8A 2Z4HA 4IPCA 1S5CD 3L3OC 1DGSA 3A55A 2YU9B 4QQBX 1IW7C 4RWSC 2WACA 1CM9A 1O78A 1FNWA 2MGSA 2EPBA 4DK0A 2EQSA 1PFNA 3OW7A 4A3JB 3GDEA 5C4HA 1NAPA 5KYIA 1FR3A 4UP9A 2EY2A 4I65A 1HXYD 3MA2B 4WJ4A 3VYTA 3FKIH 3OMGA 2K03A 1HZ9A 1PH6A 3HOUH 4LAAA 1NTGA 3OW2A 5CR3A 1FNVA 1HNWL 1NUCA 1EY5A 4J8QA 3W2DA 1ICWA 1WTHA 2DN8A 1NR2A 1PA6A 1Y14B 2AMCB 3T51B 4V190 1PVOA 1Y1WB 4X65Q 3GTQH 2E2IH 3SK4A 1TS2A 4X6AH 3U4VA 1GHKA 4LF7L 2VQFQ 2NVXH 3TSSA 1PRTC 2UUBL 2A69D 2EZVA 1UE1A 1EU4A 4XT1B 3MZ5A 1RIPA 4GS3A 1IW7D 5IYDG 2PZUA 1J5EQ 1JE4A 4BY1H 2KHIA 1BUVT 1B70B 2ZTCA 2PMZE 3VYSA 3A54A 5DAUA 3ZYYX 1A3TA 2VY3A 4X64Q 5IT9L 4HMJA 4C3IG 1YITA 1HTLD 3GO5A 3RNUA 5JJZA 2BE5C 1YHQA 3CCVA 5C4XB 1VQBA 3NTKA 4FXDA 5FK9C 2WB1E 3NTHA 2UU9Q 4CJ1B 2HQLA 1NE3A 1HQRD 2F0OA 3FHWA 4ILWA 4JI6Q 4OIKA 2JA6G 1SR3A 2FINB 3C1EA 1I4RA 4H44C 4C3JG 4JBWA 4KD4A 4JI4L 1IL8A 4FDBA 2YTYA 3A8KE 5NUCA 4TSSA 3JC66 5C6AA 3GTGB 4ZCKA 4A3IH 3MAQA 1H9JA 1EY8A 3Q8DA 1PRTD 2JYOA 2QCPX 1TWHH 4MTNA 2EIFA 1VQFA 4QIWE 2K4KA 1ZEQX 1SROA 1JB7A 2AQ1B 2JSOA 1SE8A 1LV9A 2FMMA 3UDXA 2JA8B 3LWUA 2LMCB 1D5ZC 1XXGA 3D0FA 3GTMB 1SYDA 2CKZB 2NTSA 4NPSA 3BDOA 2BE5D 4FF2A 2R6GA 3E3XA 3BZCA 5LMUL 1K8AC 1G6ZA 4L5RC 1ESRA 4QGUA 4DV3Q 1KDBA 2NVTB 1VQ4A 4OONA 3J7AF 2FMCA 5M3MB 5KNBA 4A3LH 2UXCQ 1MSGA 3FDTA 3U58A 2BA0A 1HR0W 3A7AB 3BDCA 4LF4Q 3F2CA 1KNAA 3S2DH 5I2YA 3L9AX 1BBUA 3EROA 2B8GA 3V2TA 3PUYA 2E76C 4KHZA 1IHZA 2AQ2B 5IGCA 3HP3A 4A3DB 4JI0Q 4A4IA 2VNUD 3NUCA 2Z9HA 2AUKA 1LYLA 2KUMA 2SOBA 1HNXL 4WRDA 4A3FB 4KHVA 1ONLA 1V1PB 1WTQA 3AEVA 3UDFA 3K7AH 5IWAL 2NVQH 1AE3A 3FKIG 3KOJA 4JI1Q 5M3FB 1E2VA 2NB0A 5DM73 5FO9B 5KIXA 3HOUG 1LT4D 4L8JA 4JI5Q 1EQTA 4AQYL 4JI7L 3E9IA 2JA9A 2HCCA 1CA5A 1U4MA 3HOXH 1PYBA 2K32A 3KF8A 1HR0L 3PIO3 2RDHA 3OHXC 3S17B 3I91A 1IL2A 2B63B 1PZID 5K36H 5I9OA 3NQIA 2F0KA 4BBRH 4QF4A 1Q90A 4K6LA 5J22A 1Y8PB 3HOYB 2NYZD 1GJXA 2HDMA 2AKWB 2NBFA 2QDBA 4O1NA 1G6PA 1PFBA 3CCLA 1ICFB 4NW2A 3I72A 4LFAL 3SVMA 3S1QB 2K5WA 3BVMA 2AHOB 1HFNA 2H4OA 4ID6A 3D4WA 4LWCA 3HKZB 4ZK9B 3K5NA 4XTCS 1XTCD 2Z6BA 2R7DA 3F2UA 5EKLA 1CSPA 1PV4A 1IYJB 4DFAA 5I9PA 2SEBD 4QL5A 1EWIA 3W1GA 3BDLA 1L0YB 5C3EB 4IPGA 4RGMA 4JV5L 2WFWA 4A3IG 3QOJA 4PG3A 3I4MH 3O13A 1H9SB 2PO4A 4L5QA 3BU2A 1GUWA 2NWGA 1PTOH 1LTTD 3S15B 4NDXA 2N3SA 4K2LA 1VQ5A 5FO7B 1JT8A 2NN6G 5KNDA 2F4VL 4ULLA 2YTXA 4DV0L 4GOPA 1LTRD 3BYTB 5H1SE 1GKHA 3M9BA 4DXFA 4BY7B 1C0AA 1NNXA 2B2UC 4A3BH 3S16H 1ENCA 5JAVA 1YJNA 4UP7A 1PH4A 3RLNA 3ND8A 1UE5A 3MHBA 4FVMA 2Q2UA 2N8NA 4E6IA 2C9OA 5C4ZA 4K6DA 2R7FA 5AFWA 2ZXPA 5FLXc 1BBXC 1TS5A 1KC8C 1IZ6A 2AWOA 1M8AA 2Q2IA 3EFXD 5JJLA 1N34Q 1ILPA 4A3LG 2KEEA 3CC4A 4GLAC 2KOLA 1TT2A 1JOQA 5JVG3 1RDPD 1Q81C 4R4TA 2VL6A 1I5FA 1XYIA 2F0UA 2XTIA 3MEFA 3R8BA 5BN3A 1DONA 4JW0A 1UWVA 1OXTA 1STHA 3I4OA 5A35A 5D3IB 2I5LX 3I8ZA 1D2BA 4X65L 1WI5A 1R9TB 2E2JB 4IOAA 4CGYB 2PCFB 4CJ0B 2VQFL 2BA1A 2B39A 1VQDA 3S14B 2Z4IA 1ILQA 1KDAA 1FGBD 2UXDQ 4FO2A 1B3AA 1J5EL 4IPDA 3OTOQ 2CFMA 5C44G 2K01A 2IHFA 1QUQA 5ELFA 3P20A 1A3UA 3E9HA 1O7LA 4IUNA 3JAMc 3CCUA 1TKWB 5D65A 3V05A 2QDLA 3GV6A 3KF6A 2GVAA 4X64L 3I90A 1U4RA 3LNNA 3AMUA 3VYRA 2K75A 4A3EB 2KECA 1EQRA 3K0YA 4YCUA 4KKTA 2SDFA 4HIMA 5IGDA 2PQAB 1G2SA 1F2ZA 4GOPC 4G4KA 5IGBA 2UU9L 5K36G 2QEXA 4CDEC 4CHTB 4JI6L 2X6LA 3L0OA 4BBRG 3CKIB 3URYA 1RD9D 3WWVA 3CCEA 3HOVB 2BH2A 1PZJD 5D3DA 4F88A 2F3VA 2XWJB 3C2PA 2LFNA 1CHPD 1F2MA 3SEBA 4L63B 4HJ8A 1E2ZA 4TRDA 4L5SA 4Y52H 3FPUB 4J6HA 1QVCA 1PH5A 4GN4B 3VR4A 4G7OC 3G48A 1QNKA 1CZWA 1YZ6A 1YJWA 1IBKQ 2HIXA 2ALYB 4UP8A 3OPOA 5C0XI 2B2WC 4LUOA 5I6WA 2JA8H 1SE3A 4OWXB 3TBIB 2C5CA 1EEFD 1PLFA 3UE0A 3A74A 3KDFB 3CD6A 1GUGA 4YWKA 3EA6A 1K73C 4DXGA 3GD7A 3S1MH 4H0LC 1EFWA 1DCZA 2Q8TA 5JEAH 4DV3L 2G9HD 4RGTA 1SJED 2B3GA 3AYHB 5EJWA 4GLVB 4DK3C 3E0JA 2RKSA 2UXCL 1H95A 1SAPA 4JK1C 2UXBQ 1LTLA 3WOEA 1LACA 4AYBB 1BQQT 4LF4L 4ME3A 1VQNA 1ET6A 1HNZQ 3GTLH 3RR5A 1IXRA 4DAPA 3NPPA 4TQUS 1Q46A 1MHWC 1JWUD 4MIUA 1YBYA 4A3BG 1JE5A 1UEAB 3Q6SA 3RD4A 1B3QA 1RF2D 2E74C 1JR0D 3M4OH 4X3TA 1B1ZA 4MN3A 5T1IA 1D7QA 5KGUA 4HIKA 4JI0L 3OWEB 3J81E 1EZ8A 1Q86C 5E4WC 4NXNQ 2KCMA 2KHJA 2L5TA 3H3VC 5M5YB 3T13A 4IFDI 1RL2A 4JI1L 4EVOA 1X6OA 2XNAC 3NENA 1RHPA 1JJ2A 1MKHA 5IYBH 3J81c 2F03A 1YEZA 3DUZA 3J7YW 1K3BC 1XPOA 2I5MX 1SXTA 1U0LA 1SNMA 1GXDC 2KCNA 1I4HA 3CRLC 4QB4A 2Z8LA 3PO2G 1FYCA 1CT1D 3NHHA 1P8LA 1Q82C 4P72A 4P71A 2A73B 2D0OA 1MJEA 1Z47A 5C44B 2F0FA 1E22A 4DUYQ 1HJPA 3I2ZA 1QZGA 2DNEA 2JA7H 3BJUA 5HGQA 4HCSA 1G8ZD 4P75A 4G7HC 4IQZA 4F87A 2QKIC 1D5XC 1LTAD 3T1YQ 1DYQA 3K8AA 4YY3Q 5M5XH 5E1FA 1BR9A 1LM0A 4BXXH 3MVVA 5IYCH 1TWGH 1IBLQ 2ICIA 4DR4Q 3M4QA 2EYJA 4UY8C 1DOMA 1F9SA 3J80E 5ELNA 3D6WA 3C1FA 2R7ZH 2VQEQ 3GTOB 4POFA 2KJXA 2B2TC 3DXJC 3GTKH 4C2MH 1EIGA 4DV4Q 2KENA 4Z9CB 4IUVA 1MSHA 2G9DA 1K83H 3BZDB 5E3FA 1V1PA 4TVAB 2ASBA 1E1TA 2ZM6Q 2CWAA 3M85A 2I0QA 3AU7A 1JOOA 3K81C 3JAMi 4RH6A 4RCNA 4DNRB 2A8VA 1KNEA 3TEHB 1TS3A 1ET9A 4IALA 3J81j 3H3VI 2K7VA 1WVLA 4ZUIA 2F0IA 4IUTA 4KY7A 4LFBQ 1CK1A 2CWPA 1OXXK 3V96A 1HZAA 1EYAA 1QB5D 1SNDA 4OX9Q 2F0SA 1Z7TA 1CUKA 4A76A 4WFN3 2WAQE 4XXEA 5I6YA 1PH3A 1A8VA 5C5LA 3STBD 4RKBA 1CKNB 3LX0A 1VMPA 3FPPA 4X3SA 1QVGA 1XX8A 4O2DA 1N34L 4A93H 2IY5B 3SXHA 3CC7A 4YCVA 5CGKA 1SYFA 3GTJH 2DY7A 5IOCA 1TY0A 1X3EA 3PQIA 4DR1Q 4TKOB 2JJQA 1VQ8A 2JEAI 1KLGD 5BN4A 4LUVA 5K5PA 2MO0A 4K8IA 3NQTA 4KY6A 4R8IA 3CQZB 2LY7A 3A5ZB 4O42A 1II3A 2K5DA 2E2JH 1TWCH 4KN7C 3I4LA 3EQLC 3T1HQ 3HZXA 1DJRD 1QE6A 4POGA 1R4QB 2K28A 3RZDH 3SHLA 2RVLA 3K57A 2UUAQ 3W5OA 2HDLA 2WB1G 2EYPA 2UXDL 1BVSA 1H9SA 2HD3A 5C3XA 3OTOL 2F0WA 3S2HH 2F0PA 4KN4C 3MC0B 1SBBB 4ZRZA 1AH9A 4P73A 1A63A 2HQEA 3H09A 3FP9A 1G91A 2PYKA 1H9MA 1HCZA 3PO2B 4JOIA 1WFQA 1B50A 2R93B 3RZOB 2ZXOA 4NXMQ 4S3SA 2FXQA 3RN5A 1SFOB 2XRSD 3SK5A 2VUMH 2E2HB 3SK6A 4I7ZC 1MGSA 1WCMB 4FXGC 1IKLA 1LO5D 4KHPQ 4RFBA 2JA7G 1X56A 2N55A 3N6RA 2CHBD 2HT1A 3X3NA 2I5HA 3PCOB 2LSSA 2LKVA 2N88A 2WAQB 2K6AA 5IP7H 4DA2A 1YIJA 1GUSA 1XNRQ 5BR8Q 4IUUA 2MQHA 2NUCA 3NBHB 5J39A 1F2YA 2K52A 3KJPA 4A3GB 3HS0C 5EPKA 2BOSA 3NTIA 4DR3Q 1D1IA 1OTCA 3E5SA 4C1NK 3H0GH 5GAGC 1IBKL 4IUQA 1UE6A 1I4PA 1L0WA 2D5DA 2WIIB 3A7LA 5IYCG 3B6YA 2JE6I 4MHEA 4LF6Q 1ENAA 1IYUA 4NB3A 2F0TA 2PI2E 3NSWA 5CV4A 2B2YC 4A3MH 2R7ZG 4KJOA 5C4JH 4ABNA 3I3CA 3S1RH 1F2LA 1EFID 1F77A 1LTBD 3HKSA 4KTAA 3EBEA 4Y7NB 2M00A 5C0XH 2M2LA 2R3ZA 3NXWA 4F7XA 4JG2A 3IFTA 4C3HB 4LNQA 4KKSA 4K2KA 1CI3M 1VQCA 3HOWB 3ICEA 2RHSB 5ELEA 3GTPB 2UXBL 3H94A 1XMQQ 1EQVA 3HKZE 4ME5A 1G51A 1PH2A 3I4NB 1VQAA 1HH2P 3L7ZC 4U68A 1HA5A 1HNZL 3ERSX 3HOZH 1SDFA 1AW7A 4AH6A 2JA5H 3S1NH 1I6HH 3CC2A 1R4PB 2XWBB 4RGNA 3I7FA 4K14A 3P7JA 4BA1I 2PQAA 4JOIC 4AIMA 3J7ZC 3TQYA 2DUDA 1X32A 3H91A 3BVZA 5JJKA 5FJ8H 1VF7A 4J15A 2F3IA 1KTKA 3D4RA 1I3QH 1F9PA 4QMGA 3TP6A 2OF1A 3I55A 2L9HA 3KLSX 4RHSA 2EY6A 3TREA 4A93G 1U5KA 1BBWA 1C48A 2BH8A 3DLLA 2X69A 3T56B 1PZKD 3SDZA 2FFKB 1YI2A 5CMDA 4HSPA 1P16A 2B2UA 4HSVA 4RG1A 4FYDA 4XQNA 2DJGC 4EQOA 1KQSA 1EZ6A 3T4AC 3E6ZX 1A15A 3MXPA 3KDFA 1VQ7A 4IFDH 2DY8A 3DWAA 4OGQC 1FJGQ 1BO0A 1VS0A 4QJFA 4BBSH 4C56C 1JWMD 4DUYL 1JICA 3A0JA 3OIPA 2WV6D 4DAMA 4Q5VA 4LW1A 4DV7Q 1EUJA 1T9HA 3KBGA 1V1QA 4GLXA 4LF8Q 1TXYA 2MJ8A 3WDNA 2ZJPA 4HMIA 5TSSA 3VA5A 3D31A 2R92H 4BY1G 3T1YL 4C3IB 5LMNQ 4YY3L 1KRSA 1Z6HA 4FNFA 5DM63 2GA4B 4B3SQ 5G3LD 3K7UC 4PV1C 1IKMA 2Y0SG 1IBLL 4KMUC 4DR4L 2O5IC 4EQPA 2JA6B 2LS01 3A5UA 4C3JB 1S3OA 2TMPA 2VQEL 1GO3E 1TWFB 2C35B 1SNOA 2V4DA 2L55A 1DXMA 4DAYB 5M5WH 1SYEA 4DR5Q 4A3KH 4BA2I 4DV4L 1FGUA 4OWTB 4QY7A 4H7BA 1SRUA 4HEDA 2NZ1D 1PFSA 4RGOS 5IGGA 5IP7G 2PPBC 2KCTA 2RSOA 2Q8IB 2ZM6L 1BF4A 1QVFA 4R4OA 3RN2A 2XGTA 1SSOA 1I50B 3F1ZA 4DNTB 1PH9A 1Y8OB 1S72A 3H0GG 3PO3H 2L0CA 4PQXA 4LFBL 1Y1VH 2OT2A 4KV6A 2FHTA 1FL0A 2KEDA 2A1AA 5EKIA 5LL6X 1E2WA 5ELBA 4A3MG 2AWNA 2NVYB 1YNJD 2YU9H 5CV6A 1T5EA 5FLXL 1C4QA 1M90C 5G3LF 2XN9C 4LK1C 1PH1A 5D14A 4A3JH 3U9SA 1SEBD 2RDGA 1V43A 4WJWA 3NP8A 2EXDA 1A0IA 1NBWA 4HAEA 2L4NA 1GUOA 1B2TA 1TWAB 2B2WA 4JYAQ 1UUPA 4Q0FA 3M3YB 4CKEA 4DR1L 1WD0A 1PMRA 4HIDA 3HOZG 3FVQA 3OYYA 2WKDA 2JA5G 1HZBA 5GAEC 2PW5A 1JJCB 1X3FA 1WTRA 2D62A 1Y1WH 1B7YB 3HEJA 2J4XA 3T1HL 3U9OA 2PNRC 4OL7A 3F8TA 2JP1A 1I4QA 1I4XA 4B3RQ 2KCCA 2X6GA 4AYBE 3E0EA 5FLMH 3FKIB 4GN5A 1WTXA 4C1NI 5EPJA 2UUAL 3OSOA 1JQYD 4LFCQ 1NMFA 1UNSA 3HOUB 1SNPA 5IODA 3GP7A 3TMEA 2F0GA 4FF4A 2K5NA 1BOSA 2OQKA 1N33Q 1SYBA 1S5DD 4EQNA 3JAML 1Q3LA 3K5OA 2KA7A 1AE2A 1WTVA 1DOLA 4R9WA 1HTPA 1ZKOA 2GVBA 3IAYA 3CCQA 3GTQB 2E2IB 4NXML 4K8JA 3HOXG 2WP8J 1KD1C 2A68C 5C4XH 2A6EC 2NVXB 4IFDG 2K14A 1HUNA 3BYYB 1O7IA 2F0JA 5KEEA 4JC0A 2LXKA 5DLQE 4BBSG 4KHPL 2Q2TA 4MNOA 3AFQA 3G71A 4BY1B 4YWMA 4CDFC 2H5XA 1CKNA 3GTGH 4JBMA 2ATWA 2CH4A 1XNRL 1ZYRC 5BR8L 1I94Q 3K58A 2R92G 1TR5A 1X54A 1Y69U 5A2QL 1EIHA 1Q8KA 4DR3L 3SE0A 4X66Q 4U673 3PUXA 2Q8RE 3CMAA 2NN6I 3HG9A 2IJ0A 1K3RA 1X3GA 1VCIA 5IIFA 2MUYA 4LF6L 2TSSA 3VR5A 3GTMH 2D0PA 4IJHA 2A6HD 1EY7A 1LTSD 2HCIA 1PYSB 2EVBA 2JK8A 4A3KG 2A68D 4A3IB 2A6ED 2ZXRA 5ELDA 3S9WA 1VQGA 1EL0A 4ZLTF 1TWHB 4DV2Q 1JWSD 1N9WA 3H15A 1XJVA 3PIP3 2NVTH 5I2XA 2ZJRA 4XQJA 1EIFA 5CV9A 5CBEE 5M3MH 1U4LA 1MIUA 3I4MG 1E7ZA 2EYLA 3PGZA 3CPWA 2F1MA 1XMQL 4CDCC 1EEID 1SNQA 1ZYRD 2O5JC 3PO3G 1QWYA 1Y1VG 5EGTA 4YHHQ 1STBA 3P75A 1PFMA 1VQEA 2K5VA 2B2TA 4DK1A 2L12A 4RKLA 4ZYSA 3Q0AA 2ID0A 1CKMA 1CQVA 2CH4W 2BDOA 3HRZC 4IO9A 1HQMC 4LJZC 3RLFA 4A3DH 4XYQA 3GQBA 2K04A 4IUPA 5E7NA 2I46A 2RHQB 1ASZA 5LMNW 4A3FH 4B3MQ 4UHVA 4A3JG 4BS9A 3F2DA 3PMFA 3NBHA 2GN5A 3KFUA 2EYOA 2SNMA 3S2DB 1A2UA 5M3FH 4QUFA 2SNSA 4K0KQ 5JJIA 4X62Q 1AP0A 1JCKB 4KY5A 1HRJA 4L5TA 2Z1CA 4JI5L 1X3QA 2K1BA 1CQFA 2FJ2A 1TY2A 2PQEA 2XSCA 1Y1WG 1EYDA 3S17H 3MEHA 2B63H 1ML0D 3IKJA 3VR2A 1FJGL 5IYDH 1S5BD 4JI2Q 2RQXA 1YNXA 1LTID 2HIVA 2RDFA 4DR7Q 5KNCA 3K7AB 2NVQB 5FLMG 1A2TA 4XT3B 2F0QA 1H9KA 1DD2A 4DV7L 1VQ6A 2L11A 4LF8L 3TRZA 5I4DA 2YTVA 1EWHA 2BCOA 5J1ZA 3PF5A 5EPLA 3HOYH 3DMUA 3AQQA 5LMNL 4ZUJA 4B3SL 4LF5Q 3KK7A 1V8QA 1PTOD 5GQOA 1VF5C 3S1QH 1CHQD 1QJOA 1LUZA 2EYHA 2P5ZX 2PZTA 3ERQA 5C4XG 3STBC 4BBRB 3PUVA 1LT6D 2RBMA 1EYCA 4DUZQ 4GKKQ 4EQ5A 4DN4M 4DR5L 1K28A 1EYGA 2IPKD 5EBDA 4QCLA 4YWLA 5C3WA 5C3EH 2MHVA 2QF7A 1RCVD 1SMYD 5IGEA 3J80c 1AZQA 4PMWA 3IFDA 3S15H 4UPAA 2NZOA 3FMCA 1D1KA 4HCEA 3T16A 2A5HA 2F0NA 3DWQA 1J6QA 2JA8G 4BY7H 1LT5D 2QW7A 2KHSA 4GNXB 1F9QA 1BCPC 4DF7A 5AJ3Q 1FNUA 2V1CC 2G5DA 3SK8A 4X3UA 2EYFA 4DV5Q 1WOCA 1CA6A 2CQAA 3I4MB 4NP5A 1B44D 5IGFA 1GHJA 1PTOF 4LF9Q 1PTOB 1OO9B 2PI2A 3R2TA 4OXPA 1TIID 3QIAA 2HUGA 4DV0Q 4KJNA 1O7ZA 5JEAG 5M3MG 1B53A 2E2DC 5DEHA 1E1OA 4DV6Q 3CW2C 4JYAL 4XDXA 5FKAC 3OOCA 1MI2A 3W1BA 4DR2Q 4ZKBB 3DM3A 4HJAA 2Z6KA 4A3BB 4XYOA 3S16B 2OWOA 2B2YA 3NWTA 1B9NA 5CV7A 1Z9FA 2ZJQA 4OO1I 2WKCA 1XPUA 1R9TH 1K8OA 3G6JB 4DAYA 1SMXA 4A3DG 3ZJYC 3ULPA 1WTWA 1BCPD 1K8MA 3S14H 4B3RL 1S5ED 4A3FG 3C46A 4LFCL 2B29A 4P2CB 3RMHA 4XQQA 3A8JE 1HPCA 5M3FG 1G291 1N33L 1NSNS 2EXZA 4OIJA 5IP9H 1CSQA 4IFDJ 3R3OA 1TU2B 5IYBG 2XIWA 3KYHC 2HHHQ
chains in the Genus database with same CATH topology
4QJFA 4APVA 1J5EL 4IPDA 3OTOQ 4BBSH 2CFMA 4C3IH 3BZKA 5C44G 2RF4A 4GOPB 1XMOQ 1W2BA 4A3EH 4DUYL 2IHFA 1QUQA 3A0JA 2Q2TA 4DAMA 3E9HA 3JAMc 1L1OB 1HR0Q 1YHAA 4LW1A 1EUJA 1T9HA 3CCUA 1V1QA 4DV7Q 4GLXA 1M1KC 2B63G 4LF8Q 4GKJQ 1NY4A 1TXYA 2R93G 3KF6A 2GVAA 3NELA 1C9OA 2ZJPA 1IBML 4A3CG 4IPHA 4X64L 3CCJA 3D31A 2R92H 4BY1G 3T1YL 2K5HA 3CPFA 2JA6H 2K75A 3UE1A 3HOVH 5LMNQ 4YY3L 1EQRA 1KRSA 3K0XA 4C3JH 1WCMG 4YCUA 3ULJA 4HIMA 3LGJA 2PQAB 4B3SQ 1TWFH 3K7UC 2IT1A 4GOPC 2UU9L 1I94L 5K36G 1NMGA 4IOCA 2QEXA 3HOYG 2Y0SG 3L2PA 1IBLL 1VQ9A 4KLKA 4JI6L 2RCNA 1EQQA 1L1OC 4DR4L 5IT9c 3L0OA 4BBRG 4X66L 1GVPA 2WAQG 3J81i 3WWVA 3CCEA 2BH2A 4JI3L 3A5UA 3KJOA 1S3OA 4LFAQ 2VQEL 4A3GG 1KAWA 1GO3E 2C35B 1I50H 4DAYB 5M5WH 4HJ8A 4DR5Q 4A3KH 2E5LL 4L5SA 3GTKH 4BXXG 4BA2I 4Y52H 4DV4L 2VS1A 1FGUA 2UUCQ 2VZAA 1QVCA 3HKZG 4OWTB 4QY7A 4GN4B 1VQHA 2QGQA 1PH5A 1SRUA 2Z6KC 1D8LA 1PHJA 3G48A 1PFSA 5IP7G 1YZ6A 3UDGA 1YJWA 1IBKQ 1ASYA 2HIXA 2ALYB 2KCTA 2ZM6L 4DV1L 4UP8A 3I56A 2N78A 4R4OA 3ER0A 4R4IA 4LUOA 1HZCA 5C0XI 2E5LQ 3RN2A 2JA8H 1L2FA 2XGTA 3CF5A 4GN3B 4OWXB 3F1ZA 3MXNB 1VQPA 4DV2L 4H02A 2NVYH 5C3EG 1S72A 1PH9A 3UE0A 3A74A 5C0XJ 3KDFB 3H0GG 4JI8Q 3CD6A 3PO3H 4KI0A 4YWKA 1VQLA 1K73C 1B8AA 4JV5Q 4LFBL 1Y1VH 5ELOA 3GD7A 3S1MH 2YYZA 4JCVE 4DR6L 1EFWA 4O0AA 1FL0A 2A1AA 1QUQB 2JQOA 4A3MG 2AWNA 2F4VQ 4LUZA 4DV3L 2JEBI 2YU9H 1N32Q 3AFPA 3J7A5 1YHBA 2B3GA 3AYHB 4YHHL 3KF6B 2MNAA 1TWAH 2OCEA 1E3PA 4PZ6A 3HOWG 4GLVB 1M90C 4DK3C 3K80C 1XNQQ 3M3YH 2F52A 1BKBA 4R4QA 4BY7G 2UXCL 5IY0A 1H95A 3I4NG 2UXBQ 1LTLA 3NEMA 1PH1A 4A3JH 4LF4L 4ME3A 1VQNA 1HNZQ 1QVFA 3RR5A 1IXRA 1V43A 3GTLH 2EXDA 1A0IA 1NBWA 4IPCA 1DGSA 4QQBX 4TQUS 1PH7A 1Q46A 1N36Q 4JYAQ 1YBYA 1Q12A 1W3SA 3F2BA 4DR1L 4JBKA 4A3BG 4B3ML 3J80i 1JE5A 2EQSA 4HIDA 1UE7A 5M5YH 4NXNL 2LXJA 3GDEA 3HOZG 4UP9A 3M4OH 1X9NA 3OYYA 1D7QA 2ES2A 2JA5G 4HIKA 4JI0L 1HZBA 4WJ4A 5GAEC 3FKIH 1JJCB 3EIVA 1X3FA 4K0KL 2D62A 4X62L 1Y1WH 1B7YB 1HZ9A 1Q86C 1PH6A 3HOUH 4NXNQ 2KCMA 2KHJA 3G6EA 1NJIC 4B3TQ 1SLJA 1NTGA 3OW2A 3T1HL 4IFDI 1HNWL 1RL2A 2IX1A 3F8TA 1A62A 1JJGA 4JI1L 1X6OA 3NENA 1JJ2A 4B3RQ 1MKHA 4AYBE 3E0EA 5FLMH 1Y14B 4GN5A 1PA6A 2AMCB 2UUAL 3VDYA 5IYBH 1PVOA 3J81c 3CMEA 4LFCQ 1NMFA 1YEZA 4X65Q 3GTQH 3TS2A 2E2IH 4X6AH 4JI2L 2K5NA 2I5MX 3CXCA 5C44H 3U4VA 1XPOA 3PUZA 1U0LA 2OQKA 1N33Q 4LF7L 2VQFQ 4DR7L 2NVXH 1AE2A 2UUBL 3PO2G 2GVBA 1UE1A 5GAHC 1P8LA 2DGYA 1Q82C 1RIPA 4GS3A 4P72A 5IYDG 4P71A 3PV0A 3CCQA 1J5EQ 4BY1H 4NXML 2D0OA 2KHIA 2WP8J 3HOXG 3TS0A 1Z47A 1KD1C 1MJEA 2JA7H 4DUYQ 1E22A 2OTJA 1HJPA 3I2ZA 1B70B 5IP9G 5C4XH 2ZTCA 3BJUA 1QZGA 5HGQA 4IFDG 2PMZE 2K14A 4P75A 1YJ9A 4LF5L 1O7IA 2VY3A 1IBMQ 4JC0A 4X64Q 2LXKA 5DLQE 4BBSG 3U50C 4KHPL 3T1YQ 4MNOA 3AFQA 4A3EG 1YITA 3G71A 1FVIA 3KLWA 3K8AA 4YWMA 3ULLA 3GO5A 3PIOA 3RNUA 1YHQA 2H5XA 3CCVA 1CKNA 4YY3Q 5M5XH 1VQBA 4P74A 3GTGH 4JBMA 2ATWA 4DUZL 2VUMG 3GTOH 1KHIA 2WB1E 1LM0A 2KBNA 1XNRL 4GKKL 5BR8L 1I94Q 2UU9Q 4WJ3M 4BXXH 5IYCH 2HQLA 1NE3A 1TWGH 2R92G 1IBLQ 3FHWA 4JI6Q 1X54A 2JA6G 1SR3A 4DR4Q 3M4QA 1Q8KA 4DR3L 3HOVG 4X66Q 4UY8C 3PUXA 2K50A 4JI4L 4JBWA 3CMAA 5ELNA 4FDBA 4JI3Q 2YTYA 2R7ZH 3JC66 2VQEQ 2NN6I 3CCMA 4A3IH 4POFA 1XPRA 1K3RA 1SN8A 4YCWA 4C2MH 1X3GA 1VCIA 3PF4A 3Q8DA 4DV4Q 4MTNA 4LF6L 1TWHH 2KENA 3GTMH 2D0PA 4IJHA 2EIFA 3G4SA 1VQFA 4QIWE 1K83H 2K4KA 1PYSB 1KIXA 2JK8A 4TVAB 1E1TA 1SROA 2CWAA 2ZM6Q 4DV1Q 1JB7A 1Q1BA 2ASBA 1SE8A 3M85A 4A3KG 2I0QA 3HFZB 3K81C 3UDXA 3JAMi 4OX9L 2A8VA 1VQGA 3TEHB 1K8GA 2Q2HA 3J81j 3H3VI 4DV2Q 1N9WA 3D0FA 5AJ3L 3H15A 1XJVA 1X55A 1XTDA 2CKZB 3S24A 2NVTH 2ZJRA 5JEAJ 4LFBQ 4NPSA 1EIFA 3M7NA 2CWPA 5M3MH 3EN2A 1OXXK 2Y0SE 3H3VH 1HZAA 4OX9Q 1MIUA 4DV5L 3I4MG 1E7ZA 1OXVA 2R6GA 3PGZA 4DR6Q 1CUKA 3BZCA 5LMUL 4A76A 3CPWA 1XMQL 1K8AC 2WAQE 4OO1G 4LF9L 4HIOA 1VQJA 5C0XG 4L5RC 2A19A 3PO3G 3RLOA 4QGUA 4DV3Q 1Y1VG 1PH3A 1A8VA 4YHHQ 1V9PA 4OONA 1VQ4A 4XIGS 3STBD 4DV6L 4A3LH 1VQEA 2K5VA 2UXCQ 4AYBG 2ZTEA 2ID0A 1CKMA 2BA0A 3U58A 4DR2L 1HR0W 1WYDA 4RMFA 4LF4Q 1CKNB 3F2CA 4IO9A 1QVGA 4OWWB 3S2DH 3SGIA 3RLFA 4O2DA 4A3DH 1N34L 4A93H 2IY5B 1BBUA 5E7NA 2IX0A 3CQZH 3CC7A 4YCVA 3GTJH 2RHQB 1FJGQ 5J3BA 1ASZA 1X3EA 4DR1Q 3PUYA 5LMNW 4DK6C 4A3FH 4B3MQ 2JJQA 4A3JG 1YVCA 1VQ8A 2JEAI 3F2DA 1PH8A 4LUVA 2GN5A 4KHZA 3KFUA 2MO0A 5M3FH 4JI0Q 4A4IA 2VNUD 5FJ8G 1LYLA 3A5ZB 4K0KQ 5JJIA 4X62Q 4PZ8A 1HNXL 5HY6A 2E2JH 4L5TA 1VQMA 2HHHQ 1TWCH 4JI5L 1N8RC 3T1HQ 3AEVA 1HNWQ 3UDFA 4POGA 3K7AH 5IWAL 2NVQH 1AE3A 3FKIG 3KOJA 4JI1Q 3RZDH 1Y1WG 3PO2H 3S17H 1KRTA 2B63H 2UUAQ 3HOUG 4JI5Q 3W5OA 2WB1G 1K9MC 4AQYL 1VQIA 4JI7L 1FJGL 3E9IA 3RZOH 1EOVA 2R93H 5IYDH 2HHHL 2JA9A 4A3CH 2UXDL 1BVSA 4JI2Q 3OTOL 3HOXH 3S2HH 1AH9A 4GNXA 1YNXA 1PYBA 2L15A 1XMOL 1S40A 4P73A 2HIVA 4LF7Q 4DR7Q 1A63A 3FP9A 1SFOH 5FLMG 2UUBQ 1HR0L 4DV7L 2E2HH 1VQ6A 1WCMH 4LF8L 4GKJL 4JOIA 1WFQA 1IL2A 2YTVA 4DPGA 4ALPA 2CCZA 3TRZA 3IRBA 3PF5A 3HOYH 4NXMQ 4PZ7A 3AQQA 2FXQA 1QZHA 4JBJA 4BBRH 3RN5A 5LMNL 1EIYB 2IHEA 2VUMH 4B3SL 4LF5Q 5GQOA 1MJCA 3S1QH 4A3GH 1LUZA 4KHPQ 2OQ0A 2JA7G 1X56A 5C4XG 2AKWB 2OTLA 2HT1A 2ZTDA 1G6PA 3STBC 3CCLA 2I5HA 5EAYA 3PUVA 3PCOB 2LSSA 5IP7H 4DUZQ 4LFAL 4GKKQ 1YIJA 1XNRQ 5BR8Q 2MQHA 3NBHB 4EQ5A 4DR5L 2K52A 3KJPA 1WJJA 2Z0SA 1EYGA 2AHOB 2UUCL 4DR3Q 4LWCA 4YWLA 5C3EH 1OTCA 4JI4Q 3H0GH 5GAGC 4XTCS 1IBKL 1UE6A 2R7DA 1L0WA 3J80c 1CSPA 3PUWA 5IYCG 3B6YA 2JE6I 4PMWA 5GADC 1PV4A 1E24A 4UPAA 3S15H 4LF6Q 4HJ5A 1IYJB 4Y7NH 2NZOA 2CQOA 2N49A 4QL5A 4NB3A 1EWIA 2PI2E 4A3MH 4JI8L 3W1GA 4C3HH 4IPGA 2R7ZG 4JV5L 5C4JH 2WFWA 4A3IG 1J6QA 4PG3A 3S1RH 2JA8G 3HOWH 3I4MH 3GTPH 4L5QA 4BY7H 3BU2A 4GNXB 3HKSA 4MZ9A 3I4NH 3KF8B 2N3SA 3EBEA 1VQ5A 5AJ3Q 1JT8A 2NN6G 1CKOA 4IJLA 2F4VL 1OXUA 2V1CC 2YTXA 4DV0L 1N32L 4JG2A 4LNQA 1UEBA 4GOPA 4A75A 5H1SE 4DV5Q 1WOCA 1GKHA 1VQCA 3M9BA 1XNQL 3ICEA 2RHSB 2UXBL 1L1OA 5LMUQ 1OXSC 1XMQQ 1C0AA 3HKZE 4LF9Q 4A3BH 3S16H 1G51A 1PH2A 2PI2A 1VQAA 4OXPA 1YJNA 1HH2P 3L7ZC 4UP7A 4DV0Q 2MO1A 1X65A 1HNZL 2QA4A 3UDIA 5JEAG 3ERSX 3RLNA 1PH4A 3HOZH 5M3MG 1UE5A 4GNXC 2Q2UA 2N8NA 4AH6A 3PSIA 2JA5H 2MFIA 1E1OA 4DV6Q 3CW2C 3S1NH 3CC2A 1N36L 4JYAL 1I6HH 2R7FA 3I7FA 4DNIA 5FLXc 3PIPA 3W1BA 4DR2Q 4BA1I 3DM3A 4HJAA 2PQAA 4JOIC 2Z6KA 4AIMA 1KC8C 3J7ZC 1IZ6A 2AWOA 3TQYA 2OWOA 2Q2IA 2DUDA 5JJLA 1N34Q 2NZHA 1Z9FA 2ZJQA 4A3LG 5JJKA 5FJ8H 4R4CA 1KL9A 4OO1I 4J15A 2F3IA 1I3QH 4GLAC 3CC4A 1XPUA 1Q7YC 1R9TH 1VQOA 1Q81C 4B3TL 3I55A 4R4TA 1SMXA 4A3DG 2VL6A 3M4PA 3TREA 3ZJYC 3ULPA 4A93G 3CP0A 1I5FA 1GD7A 1U5KA 1BBWA 2XTIA 3MEFA 1C7YA 2BH8A 3DLLA 1UWVA 1OXTA 2YV5A 3I4OA 3S14H 4B3RL 4R1JA 1K0RA 2VW9A 4A3FG 1JMCA 2I5LX 1YI2A 1HNXQ 1P16A 4LFCL 2B29A 4RG1A 4X65L 1GM5A 1WI5A 4IOAA 5M3FG 1KQSA 1G291 5IE8A 4HJ9A 5GROA 1N33L 4DKAC 5IWAQ 2BA1A 2VQFL 3U4ZA 2PNHA 5IP9H 1CSQA 3CCSA 3KDFA 1VQDA 4HJ7A 1VQ7A 1VQKA 4IFDJ 1KXLA 4EX5A 3CCRA 5IYBG 4AQYQ 3CAMA 1Q1EA 3KYHC 2E8GA 4JI7Q 1VS0A 2UXDQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF A;  4APV A;  1J5E L;  4IPD A;  3OTO Q;  4BBS H;  2CFM A;  4C3I H;  3BZK A;  5C44 G;  2RF4 A;  4GOP B;  1XMO Q;  1W2B A;  4A3E H;  4DUY L;  2IHF A;  1QUQ A;  3A0J A;  2Q2T A;  4DAM A;  3E9H A;  3JAM c;  1L1O B;  1HR0 Q;  1YHA A;  4LW1 A;  1EUJ A;  1T9H A;  3CCU A;  1V1Q A;  4DV7 Q;  4GLX A;  1M1K C;  2B63 G;  4LF8 Q;  4GKJ Q;  1NY4 A;  1TXY A;  2R93 G;  3KF6 A;  2GVA A;  3NEL A;  1C9O A;  2ZJP A;  1IBM L;  4A3C G;  4IPH A;  4X64 L;  3CCJ A;  3D31 A;  2R92 H;  4BY1 G;  3T1Y L;  2K5H A;  3CPF A;  2JA6 H;  2K75 A;  3UE1 A;  3HOV H;  5LMN Q;  4YY3 L;  1EQR A;  1KRS A;  3K0X A;  4C3J H;  1WCM G;  4YCU A;  3ULJ A;  4HIM A;  3LGJ A;  2PQA B;  4B3S Q;  1TWF H;  3K7U C;  2IT1 A;  4GOP C;  2UU9 L;  1I94 L;  5K36 G;  1NMG A;  4IOC A;  2QEX A;  3HOY G;  2Y0S G;  3L2P A;  1IBL L;  1VQ9 A;  4KLK A;  4JI6 L;  2RCN A;  1EQQ A;  1L1O C;  4DR4 L;  5IT9 c;  3L0O A;  4BBR G;  4X66 L;  1GVP A;  2WAQ G;  3J81 i;  3WWV A;  3CCE A;  2BH2 A;  4JI3 L;  3A5U A;  3KJO A;  1S3O A;  4LFA Q;  2VQE L;  4A3G G;  1KAW A;  1GO3 E;  2C35 B;  1I50 H;  4DAY B;  5M5W H;  4HJ8 A;  4DR5 Q;  4A3K H;  2E5L L;  4L5S A;  3GTK H;  4BXX G;  4BA2 I;  4Y52 H;  4DV4 L;  2VS1 A;  1FGU A;  2UUC Q;  2VZA A;  1QVC A;  3HKZ G;  4OWT B;  4QY7 A;  4GN4 B;  1VQH A;  2QGQ A;  1PH5 A;  1SRU A;  2Z6K C;  1D8L A;  1PHJ A;  3G48 A;  1PFS A;  5IP7 G;  1YZ6 A;  3UDG A;  1YJW A;  1IBK Q;  1ASY A;  2HIX A;  2ALY B;  2KCT A;  2ZM6 L;  4DV1 L;  4UP8 A;  3I56 A;  2N78 A;  4R4O A;  3ER0 A;  4R4I A;  4LUO A;  1HZC A;  5C0X I;  2E5L Q;  3RN2 A;  2JA8 H;  1L2F A;  2XGT A;  3CF5 A;  4GN3 B;  4OWX B;  3F1Z A;  3MXN B;  1VQP A;  4DV2 L;  4H02 A;  2NVY H;  5C3E G;  1S72 A;  1PH9 A;  3UE0 A;  3A74 A;  5C0X J;  3KDF B;  3H0G G;  4JI8 Q;  3CD6 A;  3PO3 H;  4KI0 A;  4YWK A;  1VQL A;  1K73 C;  1B8A A;  4JV5 Q;  4LFB L;  1Y1V H;  5ELO A;  3GD7 A;  3S1M H;  2YYZ A;  4JCV E;  4DR6 L;  1EFW A;  4O0A A;  1FL0 A;  2A1A A;  1QUQ B;  2JQO A;  4A3M G;  2AWN A;  2F4V Q;  4LUZ A;  4DV3 L;  2JEB I;  2YU9 H;  1N32 Q;  3AFP A;  3J7A 5;  1YHB A;  2B3G A;  3AYH B;  4YHH L;  3KF6 B;  2MNA A;  1TWA H;  2OCE A;  1E3P A;  4PZ6 A;  3HOW G;  4GLV B;  1M90 C;  4DK3 C;  3K80 C;  1XNQ Q;  3M3Y H;  2F52 A;  1BKB A;  4R4Q A;  4BY7 G;  2UXC L;  5IY0 A;  1H95 A;  3I4N G;  2UXB Q;  1LTL A;  3NEM A;  1PH1 A;  4A3J H;  4LF4 L;  4ME3 A;  1VQN A;  1HNZ Q;  1QVF A;  3RR5 A;  1IXR A;  1V43 A;  3GTL H;  2EXD A;  1A0I A;  1NBW A;  4IPC A;  1DGS A;  4QQB X;  4TQU S;  1PH7 A;  1Q46 A;  1N36 Q;  4JYA Q;  1YBY A;  1Q12 A;  1W3S A;  3F2B A;  4DR1 L;  4JBK A;  4A3B G;  4B3M L;  3J80 i;  1JE5 A;  2EQS A;  4HID A;  1UE7 A;  5M5Y H;  4NXN L;  2LXJ A;  3GDE A;  3HOZ G;  4UP9 A;  3M4O H;  1X9N A;  3OYY A;  1D7Q A;  2ES2 A;  2JA5 G;  4HIK A;  4JI0 L;  1HZB A;  4WJ4 A;  5GAE C;  3FKI H;  1JJC B;  3EIV A;  1X3F A;  4K0K L;  2D62 A;  4X62 L;  1Y1W H;  1B7Y B;  1HZ9 A;  1Q86 C;  1PH6 A;  3HOU H;  4NXN Q;  2KCM A;  2KHJ A;  3G6E A;  1NJI C;  4B3T Q;  1SLJ A;  1NTG A;  3OW2 A;  3T1H L;  4IFD I;  1HNW L;  1RL2 A;  2IX1 A;  3F8T A;  1A62 A;  1JJG A;  4JI1 L;  1X6O A;  3NEN A;  1JJ2 A;  4B3R Q;  1MKH A;  4AYB E;  3E0E A;  5FLM H;  1Y14 B;  4GN5 A;  1PA6 A;  2AMC B;  2UUA L;  3VDY A;  5IYB H;  1PVO A;  3J81 c;  3CME A;  4LFC Q;  1NMF A;  1YEZ A;  4X65 Q;  3GTQ H;  3TS2 A;  2E2I H;  4X6A H;  4JI2 L;  2K5N A;  2I5M X;  3CXC A;  5C44 H;  3U4V A;  1XPO A;  3PUZ A;  1U0L A;  2OQK A;  1N33 Q;  4LF7 L;  2VQF Q;  4DR7 L;  2NVX H;  1AE2 A;  2UUB L;  3PO2 G;  2GVB A;  1UE1 A;  5GAH C;  1P8L A;  2DGY A;  1Q82 C;  1RIP A;  4GS3 A;  4P72 A;  5IYD G;  4P71 A;  3PV0 A;  3CCQ A;  1J5E Q;  4BY1 H;  4NXM L;  2D0O A;  2KHI A;  2WP8 J;  3HOX G;  3TS0 A;  1Z47 A;  1KD1 C;  1MJE A;  2JA7 H;  4DUY Q;  1E22 A;  2OTJ A;  1HJP A;  3I2Z A;  1B70 B;  5IP9 G;  5C4X H;  2ZTC A;  3BJU A;  1QZG A;  5HGQ A;  4IFD G;  2PMZ E;  2K14 A;  4P75 A;  1YJ9 A;  4LF5 L;  1O7I A;  2VY3 A;  1IBM Q;  4JC0 A;  4X64 Q;  2LXK A;  5DLQ E;  4BBS G;  3U50 C;  4KHP L;  3T1Y Q;  4MNO A;  3AFQ A;  4A3E G;  1YIT A;  3G71 A;  1FVI A;  3KLW A;  3K8A A;  4YWM A;  3ULL A;  3GO5 A;  3PIO A;  3RNU A;  1YHQ A;  2H5X A;  3CCV A;  1CKN A;  4YY3 Q;  5M5X H;  1VQB A;  4P74 A;  3GTG H;  4JBM A;  2ATW A;  4DUZ L;  2VUM G;  3GTO H;  1KHI A;  2WB1 E;  1LM0 A;  2KBN A;  1XNR L;  4GKK L;  5BR8 L;  1I94 Q;  2UU9 Q;  4WJ3 M;  4BXX H;  5IYC H;  2HQL A;  1NE3 A;  1TWG H;  2R92 G;  1IBL Q;  3FHW A;  4JI6 Q;  1X54 A;  2JA6 G;  1SR3 A;  4DR4 Q;  3M4Q A;  1Q8K A;  4DR3 L;  3HOV G;  4X66 Q;  4UY8 C;  3PUX A;  2K50 A;  4JI4 L;  4JBW A;  3CMA A;  5ELN A;  4FDB A;  4JI3 Q;  2YTY A;  2R7Z H;  3JC6 6;  2VQE Q;  2NN6 I;  3CCM A;  4A3I H;  4POF A;  1XPR A;  1K3R A;  1SN8 A;  4YCW A;  4C2M H;  1X3G A;  1VCI A;  3PF4 A;  3Q8D A;  4DV4 Q;  4MTN A;  4LF6 L;  1TWH H;  2KEN A;  3GTM H;  2D0P A;  4IJH A;  2EIF A;  3G4S A;  1VQF A;  4QIW E;  1K83 H;  2K4K A;  1PYS B;  1KIX A;  2JK8 A;  4TVA B;  1E1T A;  1SRO A;  2CWA A;  2ZM6 Q;  4DV1 Q;  1JB7 A;  1Q1B A;  2ASB A;  1SE8 A;  3M85 A;  4A3K G;  2I0Q A;  3HFZ B;  3K81 C;  3UDX A;  3JAM i;  4OX9 L;  2A8V A;  1VQG A;  3TEH B;  1K8G A;  2Q2H A;  3J81 j;  3H3V I;  4DV2 Q;  1N9W A;  3D0F A;  5AJ3 L;  3H15 A;  1XJV A;  1X55 A;  1XTD A;  2CKZ B;  3S24 A;  2NVT H;  2ZJR A;  5JEA J;  4LFB Q;  4NPS A;  1EIF A;  3M7N A;  2CWP A;  5M3M H;  3EN2 A;  1OXX K;  2Y0S E;  3H3V H;  1HZA A;  4OX9 Q;  1MIU A;  4DV5 L;  3I4M G;  1E7Z A;  1OXV A;  2R6G A;  3PGZ A;  4DR6 Q;  1CUK A;  3BZC A;  5LMU L;  4A76 A;  3CPW A;  1XMQ L;  1K8A C;  2WAQ E;  4OO1 G;  4LF9 L;  4HIO A;  1VQJ A;  5C0X G;  4L5R C;  2A19 A;  3PO3 G;  3RLO A;  4QGU A;  4DV3 Q;  1Y1V G;  1PH3 A;  1A8V A;  4YHH Q;  1V9P A;  4OON A;  1VQ4 A;  4XIG S;  3STB D;  4DV6 L;  4A3L H;  1VQE A;  2K5V A;  2UXC Q;  4AYB G;  2ZTE A;  2ID0 A;  1CKM A;  2BA0 A;  3U58 A;  4DR2 L;  1HR0 W;  1WYD A;  4RMF A;  4LF4 Q;  1CKN B;  3F2C A;  4IO9 A;  1QVG A;  4OWW B;  3S2D H;  3SGI A;  3RLF A;  4O2D A;  4A3D H;  1N34 L;  4A93 H;  2IY5 B;  1BBU A;  5E7N A;  2IX0 A;  3CQZ H;  3CC7 A;  4YCV A;  3GTJ H;  2RHQ B;  1FJG Q;  5J3B A;  1ASZ A;  1X3E A;  4DR1 Q;  3PUY A;  5LMN W;  4DK6 C;  4A3F H;  4B3M Q;  2JJQ A;  4A3J G;  1YVC A;  1VQ8 A;  2JEA I;  3F2D A;  1PH8 A;  4LUV A;  2GN5 A;  4KHZ A;  3KFU A;  2MO0 A;  5M3F H;  4JI0 Q;  4A4I A;  2VNU D;  5FJ8 G;  1LYL A;  3A5Z B;  4K0K Q;  5JJI A;  4X62 Q;  4PZ8 A;  1HNX L;  5HY6 A;  2E2J H;  4L5T A;  1VQM A;  2HHH Q;  1TWC H;  4JI5 L;  1N8R C;  3T1H Q;  3AEV A;  1HNW Q;  3UDF A;  4POG A;  3K7A H;  5IWA L;  2NVQ H;  1AE3 A;  3FKI G;  3KOJ A;  4JI1 Q;  3RZD H;  1Y1W G;  3PO2 H;  3S17 H;  1KRT A;  2B63 H;  2UUA Q;  3HOU G;  4JI5 Q;  3W5O A;  2WB1 G;  1K9M C;  4AQY L;  1VQI A;  4JI7 L;  1FJG L;  3E9I A;  3RZO H;  1EOV A;  2R93 H;  5IYD H;  2HHH L;  2JA9 A;  4A3C H;  2UXD L;  1BVS A;  4JI2 Q;  3OTO L;  3HOX H;  3S2H H;  1AH9 A;  4GNX A;  1YNX A;  1PYB A;  2L15 A;  1XMO L;  1S40 A;  4P73 A;  2HIV A;  4LF7 Q;  4DR7 Q;  1A63 A;  3FP9 A;  1SFO H;  5FLM G;  2UUB Q;  1HR0 L;  4DV7 L;  2E2H H;  1VQ6 A;  1WCM H;  4LF8 L;  4GKJ L;  4JOI A;  1WFQ A;  1IL2 A;  2YTV A;  4DPG A;  4ALP A;  2CCZ A;  3TRZ A;  3IRB A;  3PF5 A;  3HOY H;  4NXM Q;  4PZ7 A;  3AQQ A;  2FXQ A;  1QZH A;  4JBJ A;  4BBR H;  3RN5 A;  5LMN L;  1EIY B;  2IHE A;  2VUM H;  4B3S L;  4LF5 Q;  5GQO A;  1MJC A;  3S1Q H;  4A3G H;  1LUZ A;  4KHP Q;  2OQ0 A;  2JA7 G;  1X56 A;  5C4X G;  2AKW B;  2OTL A;  2HT1 A;  2ZTD A;  1G6P A;  3STB C;  3CCL A;  2I5H A;  5EAY A;  3PUV A;  3PCO B;  2LSS A;  5IP7 H;  4DUZ Q;  4LFA L;  4GKK Q;  1YIJ A;  1XNR Q;  5BR8 Q;  2MQH A;  3NBH B;  4EQ5 A;  4DR5 L;  2K52 A;  3KJP A;  1WJJ A;  2Z0S A;  1EYG A;  2AHO B;  2UUC L;  4DR3 Q;  4LWC A;  4YWL A;  5C3E H;  1OTC A;  4JI4 Q;  3H0G H;  5GAG C;  4XTC S;  1IBK L;  1UE6 A;  2R7D A;  1L0W A;  3J80 c;  1CSP A;  3PUW A;  5IYC G;  3B6Y A;  2JE6 I;  4PMW A;  5GAD C;  1PV4 A;  1E24 A;  4UPA A;  3S15 H;  4LF6 Q;  4HJ5 A;  1IYJ B;  4Y7N H;  2NZO A;  2CQO A;  2N49 A;  4QL5 A;  4NB3 A;  1EWI A;  2PI2 E;  4A3M H;  4JI8 L;  3W1G A;  4C3H H;  4IPG A;  2R7Z G;  4JV5 L;  5C4J H;  2WFW A;  4A3I G;  1J6Q A;  4PG3 A;  3S1R H;  2JA8 G;  3HOW H;  3I4M H;  3GTP H;  4L5Q A;  4BY7 H;  3BU2 A;  4GNX B;  3HKS A;  4MZ9 A;  3I4N H;  3KF8 B;  2N3S A;  3EBE A;  1VQ5 A;  5AJ3 Q;  1JT8 A;  2NN6 G;  1CKO A;  4IJL A;  2F4V L;  1OXU A;  2V1C C;  2YTX A;  4DV0 L;  1N32 L;  4JG2 A;  4LNQ A;  1UEB A;  4GOP A;  4A75 A;  5H1S E;  4DV5 Q;  1WOC A;  1GKH A;  1VQC A;  3M9B A;  1XNQ L;  3ICE A;  2RHS B;  2UXB L;  1L1O A;  5LMU Q;  1OXS C;  1XMQ Q;  1C0A A;  3HKZ E;  4LF9 Q;  4A3B H;  3S16 H;  1G51 A;  1PH2 A;  2PI2 A;  1VQA A;  4OXP A;  1YJN A;  1HH2 P;  3L7Z C;  4UP7 A;  4DV0 Q;  2MO1 A;  1X65 A;  1HNZ L;  2QA4 A;  3UDI A;  5JEA G;  3ERS X;  3RLN A;  1PH4 A;  3HOZ H;  5M3M G;  1UE5 A;  4GNX C;  2Q2U A;  2N8N A;  4AH6 A;  3PSI A;  2JA5 H;  2MFI A;  1E1O A;  4DV6 Q;  3CW2 C;  3S1N H;  3CC2 A;  1N36 L;  4JYA L;  1I6H H;  2R7F A;  3I7F A;  4DNI A;  5FLX c;  3PIP A;  3W1B A;  4DR2 Q;  4BA1 I;  3DM3 A;  4HJA A;  2PQA A;  4JOI C;  2Z6K A;  4AIM A;  1KC8 C;  3J7Z C;  1IZ6 A;  2AWO A;  3TQY A;  2OWO A;  2Q2I A;  2DUD A;  5JJL A;  1N34 Q;  2NZH A;  1Z9F A;  2ZJQ A;  4A3L G;  5JJK A;  5FJ8 H;  4R4C A;  1KL9 A;  4OO1 I;  4J15 A;  2F3I A;  1I3Q H;  4GLA C;  3CC4 A;  1XPU A;  1Q7Y C;  1R9T H;  1VQO A;  1Q81 C;  4B3T L;  3I55 A;  4R4T A;  1SMX A;  4A3D G;  2VL6 A;  3M4P A;  3TRE A;  3ZJY C;  3ULP A;  4A93 G;  3CP0 A;  1I5F A;  1GD7 A;  1U5K A;  1BBW A;  2XTI A;  3MEF A;  1C7Y A;  2BH8 A;  3DLL A;  1UWV A;  1OXT A;  2YV5 A;  3I4O A;  3S14 H;  4B3R L;  4R1J A;  1K0R A;  2VW9 A;  4A3F G;  1JMC A;  2I5L X;  1YI2 A;  1HNX Q;  1P16 A;  4LFC L;  2B29 A;  4RG1 A;  4X65 L;  1GM5 A;  1WI5 A;  4IOA A;  5M3F G;  1KQS A;  1G29 1;  5IE8 A;  4HJ9 A;  5GRO A;  1N33 L;  4DKA C;  5IWA Q;  2BA1 A;  2VQF L;  3U4Z A;  2PNH A;  5IP9 H;  1CSQ A;  3CCS A;  3KDF A;  1VQD A;  4HJ7 A;  1VQ7 A;  1VQK A;  4IFD J;  1KXL A;  4EX5 A;  3CCR A;  5IYB G;  4AQY Q;  3CAM A;  1Q1E A;  3KYH C;  2E8G A;  4JI7 Q;  1VS0 A;  2UXD Q; 
#chains in the Genus database with same CATH topology
 3BZK A;  1XMO Q;  2RF4 A;  4A3E H;  1JC7 A;  1JOK A;  1YNN C;  1L1O B;  2R61 A;  2AQ3 B;  2B63 G;  2L1B A;  1M1K C;  1PXU A;  4GKJ Q;  1DM0 B;  3NEL A;  1C9O A;  4I7A A;  3KLR A;  4IPH A;  5IT9 E;  3DEO A;  3CPF A;  3A8I E;  2IW3 A;  3HOV H;  1PYW D;  1TVX A;  4N9P A;  2IT1 A;  2EY5 A;  1I94 L;  1NMG A;  4IOC A;  4WOR A;  1A3V A;  5JPN C;  3HOY G;  4J1M A;  3L2P A;  4KLK A;  1EQQ A;  5IT9 c;  2EJM A;  4X66 L;  1GVP A;  4KK7 A;  1ESF A;  3J81 i;  1WTP A;  3W3A A;  4CBV A;  1L0X B;  3KJO A;  1BCP F;  2F0L A;  1AZP A;  1BCP B;  1S4Z A;  3M4Y A;  4BXX G;  3NE5 B;  1O7Y A;  4OEL B;  2UUC Q;  3HKZ G;  1VQH A;  2QGQ A;  3TP5 A;  2Z6K C;  3QR8 A;  4GZY C;  5JOB A;  1CZG A;  4JPB W;  3I56 A;  4R4I A;  3ER0 A;  1HZC A;  1W6K A;  1U4P A;  1L2F A;  3CF5 A;  3TP8 A;  1YNN D;  1RJT A;  3EJI A;  3D3R A;  3MXN B;  1VQP A;  1O80 A;  4DV2 L;  2NN6 H;  5C3E G;  4JI8 Q;  2CVR A;  2E75 C;  4UDU C;  1B8A A;  1VQL A;  2F3W A;  2YYZ A;  4JCV E;  5F2D A;  4OEM B;  2D2C C;  4DGZ A;  1C8C A;  3MFG A;  4LUZ A;  2JEB I;  1N32 Q;  3AFP A;  3J7A 5;  4YHH L;  1IYV A;  2MNA A;  2OCE A;  1E3P A;  4BY7 G;  3S1M B;  1XNQ Q;  2F52 A;  1EWC A;  4R4Q A;  5IY0 A;  1D6E C;  1G2T A;  4HN7 A;  5ELC A;  2PW7 A;  4HTH A;  3K5M A;  1PH7 A;  1SYC A;  1TQO A;  1N36 Q;  1Q12 A;  1AFP A;  5E4X A;  1W3S A;  3F2B A;  3LWE A;  4JBK A;  4B3M L;  3J80 i;  1TS4 A;  2NTT A;  5CBA E;  1UE7 A;  5M5Y H;  4NXN L;  2LXJ A;  1X9N A;  3GTL B;  4B9X A;  2ES2 A;  5L37 A;  3EIV A;  4K0K L;  4X62 L;  5JVH 3;  5CC4 A;  1U9R A;  3DWP A;  2PMZ B;  3G6E A;  1PRT F;  1BDO A;  1J9O A;  1NJI C;  5KRU A;  1SLJ A;  1PRT B;  2K5Q A;  4B3T Q;  4FF1 A;  2A74 C;  2MPM A;  2IX1 A;  3M4O B;  1A62 A;  1JJG A;  1KAA A;  4RCO A;  3VDY A;  2VB3 X;  1QIL A;  2IL8 A;  3CME A;  3AB9 A;  5T1G A;  3TS2 A;  1Q8I A;  2WB1 B;  2OXP A;  1WTO A;  4JI2 L;  3CXC A;  5C44 H;  4IZ8 A;  3PUZ A;  4IN3 A;  3I70 A;  4DR7 L;  2B2V A;  3TZU A;  2EDG A;  2KVM A;  1Y8N B;  4K5X A;  5CV5 A;  5GAH C;  2DGY A;  3PV0 A;  3BVG A;  1ROD A;  4L6T B;  3TS0 A;  3ITP A;  1SYG A;  2OTJ A;  5IP9 G;  1CFM A;  2O2L D;  1LT3 D;  4QIW B;  3K59 A;  1YJ9 A;  4LF5 L;  4BWG B;  1IBM Q;  1NR4 A;  5EKK A;  3U50 C;  1YNJ C;  4A3E G;  1FVI A;  3KLW A;  3Q22 A;  1A6X A;  2XVS A;  3ULL A;  3PIO A;  1LAB A;  2EJG C;  2JA7 B;  3VYU A;  4OHJ A;  3OIQ A;  4P74 A;  3J7A V;  4DUZ L;  2VUM G;  1W6J A;  1KHI A;  3GTO H;  2KBN A;  2O4X A;  5DNF A;  4GKK L;  5CYU A;  4WJ3 M;  1HFG A;  4F8M A;  2J7Z A;  3HOV G;  4M8A A;  2K50 A;  4JI3 Q;  5M5X B;  1I6V C;  2K05 A;  3CCM A;  1XPR A;  4H13 C;  1SN8 A;  4YCW A;  3PF4 A;  1TWG B;  1RKN A;  3VA7 A;  3G4S A;  2RSN A;  1LLR D;  1KIX A;  4R8N A;  4DV1 Q;  4CDD C;  1Q1B A;  2R7Z B;  3HFZ B;  4IUR A;  2F0M A;  4OX9 L;  4C2M B;  1K8G A;  2WIN B;  2Q2H A;  3BG3 A;  5AJ3 L;  1RTO A;  2I07 B;  1X55 A;  1XTD A;  3S24 A;  1K83 B;  1WD1 A;  5JEA J;  1B9M A;  3FRP B;  4X3K A;  3M7N A;  3QB3 A;  1QG7 A;  3EN2 A;  2Y0S E;  3H3V H;  1AN8 A;  4DV5 L;  4DR6 Q;  1OXV A;  4B08 A;  3SR1 A;  4LF9 L;  4HIO A;  1VQJ A;  1SNC A;  1QNU A;  3CU7 A;  5C0X G;  2A19 A;  1HUM A;  5EQ0 A;  1MD2 D;  4K5W A;  4MTK A;  3RLO A;  5HUR A;  3D4D A;  1V9P A;  5FLX E;  4XIG S;  2B2V C;  4DV6 L;  4AYB G;  1PDQ A;  2ZTE A;  2DJF C;  3M7G A;  4DR2 L;  1KLU D;  1WYD A;  4RMF A;  4OWW B;  3SGI A;  1STA A;  3QOL A;  2IX0 A;  3CQZ H;  3D8G A;  3MTS A;  5J3B A;  3OMC A;  4CKB A;  3FEW X;  4DK6 C;  1YVC A;  3X3M A;  3H6M A;  1PH8 A;  1RTN A;  3ND9 A;  1GOZ A;  3MWY W;  5JPM C;  4ODG A;  4A93 B;  2RCF A;  3QJY A;  1NCV A;  5FJ8 G;  1X3P A;  3KLS A;  3GTJ B;  4PZ8 A;  5HY6 A;  4KKU A;  1VQM A;  3UI2 A;  1N8R C;  4OO1 H;  2F4I A;  1STY A;  3DHQ A;  1HNW Q;  3D6C A;  1BNZ A;  3TZD A;  4NKL A;  2CW0 C;  4HR7 B;  1FD7 D;  3PO2 H;  4V0B A;  1KRT A;  1E0B A;  3P1H A;  2JXM B;  2K33 A;  1K9M C;  1VQI A;  2EYM A;  2R93 H;  1DOK A;  1EOV A;  3RZO H;  3RUZ A;  2HHH L;  3QWN A;  2A6H C;  1TWC B;  4A3C H;  1EY0 A;  4RHR A;  5HGT A;  4GNX A;  1GUT A;  1CTM A;  2L15 A;  3JAM E;  1XMO L;  1S40 A;  4LF7 Q;  3KUP A;  1SFO H;  1XWE A;  2QIL A;  4ZKC B;  3RZD B;  2E2H H;  2UUB Q;  1WCM H;  4GKJ L;  3Q24 A;  5FO8 B;  4DPG A;  4ALP A;  2CCZ A;  3IRB A;  4PZ7 A;  5CV8 A;  3S2H B;  1UAP A;  1QZH A;  4JBJ A;  2F0H A;  1EIY B;  4DAV A;  1I4G A;  2IHE A;  1MJC A;  4A3G H;  4EGV A;  2OQ0 A;  2Y0S B;  1STG A;  2ENB A;  2OTL A;  3ONA B;  2ZTD A;  3NWS A;  2IWH A;  4UAI A;  5EAY A;  1M4V A;  5ISR A;  5M9O A;  3TP7 A;  2VUM B;  1STN A;  2CW0 D;  3IL8 A;  1WJJ A;  2Z0S A;  5A2Q E;  3WOF A;  1EY9 A;  3EVQ A;  2UUC L;  5COY A;  4JI4 Q;  4RAU C;  2EOT A;  3PUW A;  1KDC A;  4G57 A;  5GAD C;  1E24 A;  4HJ5 A;  4Y7N H;  2CQO A;  2N49 A;  1VDZ A;  4YIJ A;  4JI8 L;  4C3H H;  2EJF C;  3H0G B;  3HGB A;  3HOW H;  2JN4 A;  2VB2 X;  3GTP H;  3R2I A;  1ZXT A;  4MZ9 A;  3I4N H;  1JOR A;  3KF8 B;  1CKO A;  4IJL A;  2J0T D;  1OXU A;  1N32 L;  4A3M B;  4JVZ A;  1UEB A;  1QOH A;  4NMZ A;  5C4J B;  4A75 A;  3K5L A;  1XNQ L;  3S1R B;  2XRQ D;  4M1U B;  1AEX A;  1L1O A;  1OXS C;  1H9R A;  5LMU Q;  4ZQ3 A;  3CHB D;  2MO1 A;  4FXK C;  1X65 A;  2QA4 A;  3UDI A;  4GNX C;  3PSI A;  2MFI A;  3TDQ A;  4ZAI A;  4DU9 A;  1N36 L;  4KD3 A;  1MBY A;  4DNI A;  3PIP A;  2F0E A;  1EOT A;  2ICE C;  3GV3 A;  2NZH A;  4K5V A;  3HOZ B;  3MFY A;  1EY6 A;  1PTO C;  4R4C A;  3NBI A;  1KL9 A;  2JA5 B;  3S1N B;  1I6H B;  3J81 L;  1ENF A;  1Q7Y C;  1VQO A;  4B3T L;  2KQ3 A;  3M4P A;  2F0V A;  3A56 A;  3MXU A;  3CP0 A;  1GD7 A;  2AUJ D;  2E5L L;  1C7Y A;  4FF3 A;  2YV5 A;  3BS1 A;  2EE1 A;  4R1J A;  1K0R A;  1EY4 A;  2VW9 A;  1JMC A;  1HNX Q;  1I3Q B;  3T53 B;  4G7Z C;  1GM5 A;  1VMC A;  5IE8 A;  5EBC A;  4HJ9 A;  5GRO A;  1SMY C;  4DKA C;  5IWA Q;  3MXN A;  1SJH D;  5C5M A;  3U4Z A;  2PNH A;  3DEP A;  3CCS A;  4HJ7 A;  1KXL A;  1VQK A;  4EX5 A;  3CCR A;  4AQY Q;  3CAM A;  1Q1E A;  4JI7 Q;  2E8G A;  2RA4 A;  4OO1 G;  3QO2 A;  2MP1 A;  4QUC A;  4APV A;  4C3I H;  1D5M C;  2OEO A;  4GOP B;  1W2B A;  3HOX B;  1HR0 Q;  1YHA A;  1K0S A;  2DNC A;  2H1E A;  1NY4 A;  2R93 G;  4LMQ D;  3TN2 A;  4N9T A;  1IBM L;  4A3C G;  3CCJ A;  4PNY A;  2K5H A;  2JA6 H;  4BBS B;  1STE A;  3UE1 A;  1S5F D;  3K0X A;  3K6O A;  4C3J H;  1JB3 A;  1WCM G;  3ULJ A;  4PMB A;  3LGJ A;  1TWF H;  1SE2 A;  5KYL A;  4PMC A;  3MXG A;  5FOB B;  1VQ9 A;  1QCB D;  1BXT A;  2RCN A;  4CKC A;  1L1O C;  2R92 B;  5BN5 A;  2WAQ G;  4B9W A;  3C3L A;  4JI3 L;  3J80 L;  4LFA Q;  4A3G G;  1B4O A;  1KAW A;  1T5X D;  1I50 H;  3KBX A;  2VS1 A;  1DZ1 A;  2VZA A;  3Q23 A;  2M9V A;  2B8F A;  3VR6 A;  1V1O A;  1D8L A;  1PHJ A;  1J8I A;  2PZW A;  1ASY A;  3UDG A;  4FP5 D;  1EU3 A;  4DV1 L;  3QG1 A;  2E5L Q;  2N78 A;  3CRK C;  2D9U A;  5M5W B;  3GTK B;  4GN3 B;  1HHV A;  4A3K B;  3VR3 A;  1HA6 A;  2IX3 A;  1SE4 A;  2NVY H;  4H02 A;  5C0X J;  4KI0 A;  2QEJ C;  1KAB A;  5LHY 1;  3NK9 A;  4JV5 Q;  4N8X 1;  5ELO A;  3DM1 A;  4DR6 L;  2EY1 A;  4O0A A;  1GUN A;  1QUQ B;  2JQO A;  2F4V Q;  4C3H G;  5LL6 S;  2F0D A;  1F9R A;  2ZT9 C;  3OWF A;  3PO3 B;  1YHB A;  3KF6 B;  5COR A;  1TWA H;  4PZ6 A;  3HOW G;  1Y1V B;  3M3Y H;  3K80 C;  1BKB A;  3G7L A;  4CJ2 C;  3I4N G;  3NEM A;  3R93 A;  3I73 A;  2VXW A;  3N52 A;  4N8F A;  1LTG D;  2A69 C;  2BDN A;  4RA8 A;  2Z4H A;  4IPC A;  1S5C D;  3L3O C;  1DGS A;  3A55 A;  2YU9 B;  4QQB X;  1IW7 C;  4RWS C;  2WAC A;  1CM9 A;  1O78 A;  1FNW A;  2MGS A;  2EPB A;  4DK0 A;  2EQS A;  1PFN A;  3OW7 A;  4A3J B;  3GDE A;  5C4H A;  1NAP A;  5KYI A;  1FR3 A;  4UP9 A;  2EY2 A;  4I65 A;  1HXY D;  3MA2 B;  4WJ4 A;  3VYT A;  3FKI H;  3OMG A;  2K03 A;  1HZ9 A;  1PH6 A;  3HOU H;  4LAA A;  1NTG A;  3OW2 A;  5CR3 A;  1FNV A;  1HNW L;  1NUC A;  1EY5 A;  4J8Q A;  3W2D A;  1ICW A;  1WTH A;  2DN8 A;  1NR2 A;  1PA6 A;  1Y14 B;  2AMC B;  3T51 B;  4V19 0;  1PVO A;  1Y1W B;  4X65 Q;  3GTQ H;  2E2I H;  3SK4 A;  1TS2 A;  4X6A H;  3U4V A;  1GHK A;  4LF7 L;  2VQF Q;  2NVX H;  3TSS A;  1PRT C;  2UUB L;  2A69 D;  2EZV A;  1UE1 A;  1EU4 A;  4XT1 B;  3MZ5 A;  1RIP A;  4GS3 A;  1IW7 D;  5IYD G;  2PZU A;  1J5E Q;  1JE4 A;  4BY1 H;  2KHI A;  1BUV T;  1B70 B;  2ZTC A;  2PMZ E;  3VYS A;  3A54 A;  5DAU A;  3ZYY X;  1A3T A;  2VY3 A;  4X64 Q;  5IT9 L;  4HMJ A;  4C3I G;  1YIT A;  1HTL D;  3GO5 A;  3RNU A;  5JJZ A;  2BE5 C;  1YHQ A;  3CCV A;  5C4X B;  1VQB A;  3NTK A;  4FXD A;  5FK9 C;  2WB1 E;  3NTH A;  2UU9 Q;  4CJ1 B;  2HQL A;  1NE3 A;  1HQR D;  2F0O A;  3FHW A;  4ILW A;  4JI6 Q;  4OIK A;  2JA6 G;  1SR3 A;  2FIN B;  3C1E A;  1I4R A;  4H44 C;  4C3J G;  4JBW A;  4KD4 A;  4JI4 L;  1IL8 A;  4FDB A;  2YTY A;  3A8K E;  5NUC A;  4TSS A;  3JC6 6;  5C6A A;  3GTG B;  4ZCK A;  4A3I H;  3MAQ A;  1H9J A;  1EY8 A;  3Q8D A;  1PRT D;  2JYO A;  2QCP X;  1TWH H;  4MTN A;  2EIF A;  1VQF A;  4QIW E;  2K4K A;  1ZEQ X;  1SRO A;  1JB7 A;  2AQ1 B;  2JSO A;  1SE8 A;  1LV9 A;  2FMM A;  3UDX A;  2JA8 B;  3LWU A;  2LMC B;  1D5Z C;  1XXG A;  3D0F A;  3GTM B;  1SYD A;  2CKZ B;  2NTS A;  4NPS A;  3BDO A;  2BE5 D;  4FF2 A;  2R6G A;  3E3X A;  3BZC A;  5LMU L;  1K8A C;  1G6Z A;  4L5R C;  1ESR A;  4QGU A;  4DV3 Q;  1KDB A;  2NVT B;  1VQ4 A;  4OON A;  3J7A F;  2FMC A;  5M3M B;  5KNB A;  4A3L H;  2UXC Q;  1MSG A;  3FDT A;  3U58 A;  2BA0 A;  1HR0 W;  3A7A B;  3BDC A;  4LF4 Q;  3F2C A;  1KNA A;  3S2D H;  5I2Y A;  3L9A X;  1BBU A;  3ERO A;  2B8G A;  3V2T A;  3PUY A;  2E76 C;  4KHZ A;  1IHZ A;  2AQ2 B;  5IGC A;  3HP3 A;  4A3D B;  4JI0 Q;  4A4I A;  2VNU D;  3NUC A;  2Z9H A;  2AUK A;  1LYL A;  2KUM A;  2SOB A;  1HNX L;  4WRD A;  4A3F B;  4KHV A;  1ONL A;  1V1P B;  1WTQ A;  3AEV A;  3UDF A;  3K7A H;  5IWA L;  2NVQ H;  1AE3 A;  3FKI G;  3KOJ A;  4JI1 Q;  5M3F B;  1E2V A;  2NB0 A;  5DM7 3;  5FO9 B;  5KIX A;  3HOU G;  1LT4 D;  4L8J A;  4JI5 Q;  1EQT A;  4AQY L;  4JI7 L;  3E9I A;  2JA9 A;  2HCC A;  1CA5 A;  1U4M A;  3HOX H;  1PYB A;  2K32 A;  3KF8 A;  1HR0 L;  3PIO 3;  2RDH A;  3OHX C;  3S17 B;  3I91 A;  1IL2 A;  2B63 B;  1PZI D;  5K36 H;  5I9O A;  3NQI A;  2F0K A;  4BBR H;  4QF4 A;  1Q90 A;  4K6L A;  5J22 A;  1Y8P B;  3HOY B;  2NYZ D;  1GJX A;  2HDM A;  2AKW B;  2NBF A;  2QDB A;  4O1N A;  1G6P A;  1PFB A;  3CCL A;  1ICF B;  4NW2 A;  3I72 A;  4LFA L;  3SVM A;  3S1Q B;  2K5W A;  3BVM A;  2AHO B;  1HFN A;  2H4O A;  4ID6 A;  3D4W A;  4LWC A;  3HKZ B;  4ZK9 B;  3K5N A;  4XTC S;  1XTC D;  2Z6B A;  2R7D A;  3F2U A;  5EKL A;  1CSP A;  1PV4 A;  1IYJ B;  4DFA A;  5I9P A;  2SEB D;  4QL5 A;  1EWI A;  3W1G A;  3BDL A;  1L0Y B;  5C3E B;  4IPG A;  4RGM A;  4JV5 L;  2WFW A;  4A3I G;  3QOJ A;  4PG3 A;  3I4M H;  3O13 A;  1H9S B;  2PO4 A;  4L5Q A;  3BU2 A;  1GUW A;  2NWG A;  1PTO H;  1LTT D;  3S15 B;  4NDX A;  2N3S A;  4K2L A;  1VQ5 A;  5FO7 B;  1JT8 A;  2NN6 G;  5KND A;  2F4V L;  4ULL A;  2YTX A;  4DV0 L;  4GOP A;  1LTR D;  3BYT B;  5H1S E;  1GKH A;  3M9B A;  4DXF A;  4BY7 B;  1C0A A;  1NNX A;  2B2U C;  4A3B H;  3S16 H;  1ENC A;  5JAV A;  1YJN A;  4UP7 A;  1PH4 A;  3RLN A;  3ND8 A;  1UE5 A;  3MHB A;  4FVM A;  2Q2U A;  2N8N A;  4E6I A;  2C9O A;  5C4Z A;  4K6D A;  2R7F A;  5AFW A;  2ZXP A;  5FLX c;  1BBX C;  1TS5 A;  1KC8 C;  1IZ6 A;  2AWO A;  1M8A A;  2Q2I A;  3EFX D;  5JJL A;  1N34 Q;  1ILP A;  4A3L G;  2KEE A;  3CC4 A;  4GLA C;  2KOL A;  1TT2 A;  1JOQ A;  5JVG 3;  1RDP D;  1Q81 C;  4R4T A;  2VL6 A;  1I5F A;  1XYI A;  2F0U A;  2XTI A;  3MEF A;  3R8B A;  5BN3 A;  1DON A;  4JW0 A;  1UWV A;  1OXT A;  1STH A;  3I4O A;  5A35 A;  5D3I B;  2I5L X;  3I8Z A;  1D2B A;  4X65 L;  1WI5 A;  1R9T B;  2E2J B;  4IOA A;  4CGY B;  2PCF B;  4CJ0 B;  2VQF L;  2BA1 A;  2B39 A;  1VQD A;  3S14 B;  2Z4I A;  1ILQ A;  1KDA A;  1FGB D;  2UXD Q;  4FO2 A;  1B3A A;  1J5E L;  4IPD A;  3OTO Q;  2CFM A;  5C44 G;  2K01 A;  2IHF A;  1QUQ A;  5ELF A;  3P20 A;  1A3U A;  3E9H A;  1O7L A;  4IUN A;  3JAM c;  3CCU A;  1TKW B;  5D65 A;  3V05 A;  2QDL A;  3GV6 A;  3KF6 A;  2GVA A;  4X64 L;  3I90 A;  1U4R A;  3LNN A;  3AMU A;  3VYR A;  2K75 A;  4A3E B;  2KEC A;  1EQR A;  3K0Y A;  4YCU A;  4KKT A;  2SDF A;  4HIM A;  5IGD A;  2PQA B;  1G2S A;  1F2Z A;  4GOP C;  4G4K A;  5IGB A;  2UU9 L;  5K36 G;  2QEX A;  4CDE C;  4CHT B;  4JI6 L;  2X6L A;  3L0O A;  4BBR G;  3CKI B;  3URY A;  1RD9 D;  3WWV A;  3CCE A;  3HOV B;  2BH2 A;  1PZJ D;  5D3D A;  4F88 A;  2F3V A;  2XWJ B;  3C2P A;  2LFN A;  1CHP D;  1F2M A;  3SEB A;  4L63 B;  4HJ8 A;  1E2Z A;  4TRD A;  4L5S A;  4Y52 H;  3FPU B;  4J6H A;  1QVC A;  1PH5 A;  4GN4 B;  3VR4 A;  4G7O C;  3G48 A;  1QNK A;  1CZW A;  1YZ6 A;  1YJW A;  1IBK Q;  2HIX A;  2ALY B;  4UP8 A;  3OPO A;  5C0X I;  2B2W C;  4LUO A;  5I6W A;  2JA8 H;  1SE3 A;  4OWX B;  3TBI B;  2C5C A;  1EEF D;  1PLF A;  3UE0 A;  3A74 A;  3KDF B;  3CD6 A;  1GUG A;  4YWK A;  3EA6 A;  1K73 C;  4DXG A;  3GD7 A;  3S1M H;  4H0L C;  1EFW A;  1DCZ A;  2Q8T A;  5JEA H;  4DV3 L;  2G9H D;  4RGT A;  1SJE D;  2B3G A;  3AYH B;  5EJW A;  4GLV B;  4DK3 C;  3E0J A;  2RKS A;  2UXC L;  1H95 A;  1SAP A;  4JK1 C;  2UXB Q;  1LTL A;  3WOE A;  1LAC A;  4AYB B;  1BQQ T;  4LF4 L;  4ME3 A;  1VQN A;  1ET6 A;  1HNZ Q;  3GTL H;  3RR5 A;  1IXR A;  4DAP A;  3NPP A;  4TQU S;  1Q46 A;  1MHW C;  1JWU D;  4MIU A;  1YBY A;  4A3B G;  1JE5 A;  1UEA B;  3Q6S A;  3RD4 A;  1B3Q A;  1RF2 D;  2E74 C;  1JR0 D;  3M4O H;  4X3T A;  1B1Z A;  4MN3 A;  5T1I A;  1D7Q A;  5KGU A;  4HIK A;  4JI0 L;  3OWE B;  3J81 E;  1EZ8 A;  1Q86 C;  5E4W C;  4NXN Q;  2KCM A;  2KHJ A;  2L5T A;  3H3V C;  5M5Y B;  3T13 A;  4IFD I;  1RL2 A;  4JI1 L;  4EVO A;  1X6O A;  2XNA C;  3NEN A;  1RHP A;  1JJ2 A;  1MKH A;  5IYB H;  3J81 c;  2F03 A;  1YEZ A;  3DUZ A;  3J7Y W;  1K3B C;  1XPO A;  2I5M X;  1SXT A;  1U0L A;  1SNM A;  1GXD C;  2KCN A;  1I4H A;  3CRL C;  4QB4 A;  2Z8L A;  3PO2 G;  1FYC A;  1CT1 D;  3NHH A;  1P8L A;  1Q82 C;  4P72 A;  4P71 A;  2A73 B;  2D0O A;  1MJE A;  1Z47 A;  5C44 B;  2F0F A;  1E22 A;  4DUY Q;  1HJP A;  3I2Z A;  1QZG A;  2DNE A;  2JA7 H;  3BJU A;  5HGQ A;  4HCS A;  1G8Z D;  4P75 A;  4G7H C;  4IQZ A;  4F87 A;  2QKI C;  1D5X C;  1LTA D;  3T1Y Q;  1DYQ A;  3K8A A;  4YY3 Q;  5M5X H;  5E1F A;  1BR9 A;  1LM0 A;  4BXX H;  3MVV A;  5IYC H;  1TWG H;  1IBL Q;  2ICI A;  4DR4 Q;  3M4Q A;  2EYJ A;  4UY8 C;  1DOM A;  1F9S A;  3J80 E;  5ELN A;  3D6W A;  3C1F A;  2R7Z H;  2VQE Q;  3GTO B;  4POF A;  2KJX A;  2B2T C;  3DXJ C;  3GTK H;  4C2M H;  1EIG A;  4DV4 Q;  2KEN A;  4Z9C B;  4IUV A;  1MSH A;  2G9D A;  1K83 H;  3BZD B;  5E3F A;  1V1P A;  4TVA B;  2ASB A;  1E1T A;  2ZM6 Q;  2CWA A;  3M85 A;  2I0Q A;  3AU7 A;  1JOO A;  3K81 C;  3JAM i;  4RH6 A;  4RCN A;  4DNR B;  2A8V A;  1KNE A;  3TEH B;  1TS3 A;  1ET9 A;  4IAL A;  3J81 j;  3H3V I;  2K7V A;  1WVL A;  4ZUI A;  2F0I A;  4IUT A;  4KY7 A;  4LFB Q;  1CK1 A;  2CWP A;  1OXX K;  3V96 A;  1HZA A;  1EYA A;  1QB5 D;  1SND A;  4OX9 Q;  2F0S A;  1Z7T A;  1CUK A;  4A76 A;  4WFN 3;  2WAQ E;  4XXE A;  5I6Y A;  1PH3 A;  1A8V A;  5C5L A;  3STB D;  4RKB A;  1CKN B;  3LX0 A;  1VMP A;  3FPP A;  4X3S A;  1QVG A;  1XX8 A;  4O2D A;  1N34 L;  4A93 H;  2IY5 B;  3SXH A;  3CC7 A;  4YCV A;  5CGK A;  1SYF A;  3GTJ H;  2DY7 A;  5IOC A;  1TY0 A;  1X3E A;  3PQI A;  4DR1 Q;  4TKO B;  2JJQ A;  1VQ8 A;  2JEA I;  1KLG D;  5BN4 A;  4LUV A;  5K5P A;  2MO0 A;  4K8I A;  3NQT A;  4KY6 A;  4R8I A;  3CQZ B;  2LY7 A;  3A5Z B;  4O42 A;  1II3 A;  2K5D A;  2E2J H;  1TWC H;  4KN7 C;  3I4L A;  3EQL C;  3T1H Q;  3HZX A;  1DJR D;  1QE6 A;  4POG A;  1R4Q B;  2K28 A;  3RZD H;  3SHL A;  2RVL A;  3K57 A;  2UUA Q;  3W5O A;  2HDL A;  2WB1 G;  2EYP A;  2UXD L;  1BVS A;  1H9S A;  2HD3 A;  5C3X A;  3OTO L;  2F0W A;  3S2H H;  2F0P A;  4KN4 C;  3MC0 B;  1SBB B;  4ZRZ A;  1AH9 A;  4P73 A;  1A63 A;  2HQE A;  3H09 A;  3FP9 A;  1G91 A;  2PYK A;  1H9M A;  1HCZ A;  3PO2 B;  4JOI A;  1WFQ A;  1B50 A;  2R93 B;  3RZO B;  2ZXO A;  4NXM Q;  4S3S A;  2FXQ A;  3RN5 A;  1SFO B;  2XRS D;  3SK5 A;  2VUM H;  2E2H B;  3SK6 A;  4I7Z C;  1MGS A;  1WCM B;  4FXG C;  1IKL A;  1LO5 D;  4KHP Q;  4RFB A;  2JA7 G;  1X56 A;  2N55 A;  3N6R A;  2CHB D;  2HT1 A;  3X3N A;  2I5H A;  3PCO B;  2LSS A;  2LKV A;  2N88 A;  2WAQ B;  2K6A A;  5IP7 H;  4DA2 A;  1YIJ A;  1GUS A;  1XNR Q;  5BR8 Q;  4IUU A;  2MQH A;  2NUC A;  3NBH B;  5J39 A;  1F2Y A;  2K52 A;  3KJP A;  4A3G B;  3HS0 C;  5EPK A;  2BOS A;  3NTI A;  4DR3 Q;  1D1I A;  1OTC A;  3E5S A;  4C1N K;  3H0G H;  5GAG C;  1IBK L;  4IUQ A;  1UE6 A;  1I4P A;  1L0W A;  2D5D A;  2WII B;  3A7L A;  5IYC G;  3B6Y A;  2JE6 I;  4MHE A;  4LF6 Q;  1ENA A;  1IYU A;  4NB3 A;  2F0T A;  2PI2 E;  3NSW A;  5CV4 A;  2B2Y C;  4A3M H;  2R7Z G;  4KJO A;  5C4J H;  4ABN A;  3I3C A;  3S1R H;  1F2L A;  1EFI D;  1F77 A;  1LTB D;  3HKS A;  4KTA A;  3EBE A;  4Y7N B;  2M00 A;  5C0X H;  2M2L A;  2R3Z A;  3NXW A;  4F7X A;  4JG2 A;  3IFT A;  4C3H B;  4LNQ A;  4KKS A;  4K2K A;  1CI3 M;  1VQC A;  3HOW B;  3ICE A;  2RHS B;  5ELE A;  3GTP B;  2UXB L;  3H94 A;  1XMQ Q;  1EQV A;  3HKZ E;  4ME5 A;  1G51 A;  1PH2 A;  3I4N B;  1VQA A;  1HH2 P;  3L7Z C;  4U68 A;  1HA5 A;  1HNZ L;  3ERS X;  3HOZ H;  1SDF A;  1AW7 A;  4AH6 A;  2JA5 H;  3S1N H;  1I6H H;  3CC2 A;  1R4P B;  2XWB B;  4RGN A;  3I7F A;  4K14 A;  3P7J A;  4BA1 I;  2PQA A;  4JOI C;  4AIM A;  3J7Z C;  3TQY A;  2DUD A;  1X32 A;  3H91 A;  3BVZ A;  5JJK A;  5FJ8 H;  1VF7 A;  4J15 A;  2F3I A;  1KTK A;  3D4R A;  1I3Q H;  1F9P A;  4QMG A;  3TP6 A;  2OF1 A;  3I55 A;  2L9H A;  3KLS X;  4RHS A;  2EY6 A;  3TRE A;  4A93 G;  1U5K A;  1BBW A;  1C48 A;  2BH8 A;  3DLL A;  2X69 A;  3T56 B;  1PZK D;  3SDZ A;  2FFK B;  1YI2 A;  5CMD A;  4HSP A;  1P16 A;  2B2U A;  4HSV A;  4RG1 A;  4FYD A;  4XQN A;  2DJG C;  4EQO A;  1KQS A;  1EZ6 A;  3T4A C;  3E6Z X;  1A15 A;  3MXP A;  3KDF A;  1VQ7 A;  4IFD H;  2DY8 A;  3DWA A;  4OGQ C;  1FJG Q;  1BO0 A;  1VS0 A;  4QJF A;  4BBS H;  4C56 C;  1JWM D;  4DUY L;  1JIC A;  3A0J A;  3OIP A;  2WV6 D;  4DAM A;  4Q5V A;  4LW1 A;  4DV7 Q;  1EUJ A;  1T9H A;  3KBG A;  1V1Q A;  4GLX A;  4LF8 Q;  1TXY A;  2MJ8 A;  3WDN A;  2ZJP A;  4HMI A;  5TSS A;  3VA5 A;  3D31 A;  2R92 H;  4BY1 G;  3T1Y L;  4C3I B;  5LMN Q;  4YY3 L;  1KRS A;  1Z6H A;  4FNF A;  5DM6 3;  2GA4 B;  4B3S Q;  5G3L D;  3K7U C;  4PV1 C;  1IKM A;  2Y0S G;  1IBL L;  4KMU C;  4DR4 L;  2O5I C;  4EQP A;  2JA6 B;  2LS0 1;  3A5U A;  4C3J B;  1S3O A;  2TMP A;  2VQE L;  1GO3 E;  1TWF B;  2C35 B;  1SNO A;  2V4D A;  2L55 A;  1DXM A;  4DAY B;  5M5W H;  1SYE A;  4DR5 Q;  4A3K H;  4BA2 I;  4DV4 L;  1FGU A;  4OWT B;  4QY7 A;  4H7B A;  1SRU A;  4HED A;  2NZ1 D;  1PFS A;  4RGO S;  5IGG A;  5IP7 G;  2PPB C;  2KCT A;  2RSO A;  2Q8I B;  2ZM6 L;  1BF4 A;  1QVF A;  4R4O A;  3RN2 A;  2XGT A;  1SSO A;  1I50 B;  3F1Z A;  4DNT B;  1PH9 A;  1Y8O B;  1S72 A;  3H0G G;  3PO3 H;  2L0C A;  4PQX A;  4LFB L;  1Y1V H;  2OT2 A;  4KV6 A;  2FHT A;  1FL0 A;  2KED A;  2A1A A;  5EKI A;  5LL6 X;  1E2W A;  5ELB A;  4A3M G;  2AWN A;  2NVY B;  1YNJ D;  2YU9 H;  5CV6 A;  1T5E A;  5FLX L;  1C4Q A;  1M90 C;  5G3L F;  2XN9 C;  4LK1 C;  1PH1 A;  5D14 A;  4A3J H;  3U9S A;  1SEB D;  2RDG A;  1V43 A;  4WJW A;  3NP8 A;  2EXD A;  1A0I A;  1NBW A;  4HAE A;  2L4N A;  1GUO A;  1B2T A;  1TWA B;  2B2W A;  4JYA Q;  1UUP A;  4Q0F A;  3M3Y B;  4CKE A;  4DR1 L;  1WD0 A;  1PMR A;  4HID A;  3HOZ G;  3FVQ A;  3OYY A;  2WKD A;  2JA5 G;  1HZB A;  5GAE C;  2PW5 A;  1JJC B;  1X3F A;  1WTR A;  2D62 A;  1Y1W H;  1B7Y B;  3HEJ A;  2J4X A;  3T1H L;  3U9O A;  2PNR C;  4OL7 A;  3F8T A;  2JP1 A;  1I4Q A;  1I4X A;  4B3R Q;  2KCC A;  2X6G A;  4AYB E;  3E0E A;  5FLM H;  3FKI B;  4GN5 A;  1WTX A;  4C1N I;  5EPJ A;  2UUA L;  3OSO A;  1JQY D;  4LFC Q;  1NMF A;  1UNS A;  3HOU B;  1SNP A;  5IOD A;  3GP7 A;  3TME A;  2F0G A;  4FF4 A;  2K5N A;  1BOS A;  2OQK A;  1N33 Q;  1SYB A;  1S5D D;  4EQN A;  3JAM L;  1Q3L A;  3K5O A;  2KA7 A;  1AE2 A;  1WTV A;  1DOL A;  4R9W A;  1HTP A;  1ZKO A;  2GVB A;  3IAY A;  3CCQ A;  3GTQ B;  2E2I B;  4NXM L;  4K8J A;  3HOX G;  2WP8 J;  1KD1 C;  2A68 C;  5C4X H;  2A6E C;  2NVX B;  4IFD G;  2K14 A;  1HUN A;  3BYY B;  1O7I A;  2F0J A;  5KEE A;  4JC0 A;  2LXK A;  5DLQ E;  4BBS G;  4KHP L;  2Q2T A;  4MNO A;  3AFQ A;  3G71 A;  4BY1 B;  4YWM A;  4CDF C;  2H5X A;  1CKN A;  3GTG H;  4JBM A;  2ATW A;  2CH4 A;  1XNR L;  1ZYR C;  5BR8 L;  1I94 Q;  3K58 A;  2R92 G;  1TR5 A;  1X54 A;  1Y69 U;  5A2Q L;  1EIH A;  1Q8K A;  4DR3 L;  3SE0 A;  4X66 Q;  4U67 3;  3PUX A;  2Q8R E;  3CMA A;  2NN6 I;  3HG9 A;  2IJ0 A;  1K3R A;  1X3G A;  1VCI A;  5IIF A;  2MUY A;  4LF6 L;  2TSS A;  3VR5 A;  3GTM H;  2D0P A;  4IJH A;  2A6H D;  1EY7 A;  1LTS D;  2HCI A;  1PYS B;  2EVB A;  2JK8 A;  4A3K G;  2A68 D;  4A3I B;  2A6E D;  2ZXR A;  5ELD A;  3S9W A;  1VQG A;  1EL0 A;  4ZLT F;  1TWH B;  4DV2 Q;  1JWS D;  1N9W A;  3H15 A;  1XJV A;  3PIP 3;  2NVT H;  5I2X A;  2ZJR A;  4XQJ A;  1EIF A;  5CV9 A;  5CBE E;  5M3M H;  1U4L A;  1MIU A;  3I4M G;  1E7Z A;  2EYL A;  3PGZ A;  3CPW A;  2F1M A;  1XMQ L;  4CDC C;  1EEI D;  1SNQ A;  1ZYR D;  2O5J C;  3PO3 G;  1QWY A;  1Y1V G;  5EGT A;  4YHH Q;  1STB A;  3P75 A;  1PFM A;  1VQE A;  2K5V A;  2B2T A;  4DK1 A;  2L12 A;  4RKL A;  4ZYS A;  3Q0A A;  2ID0 A;  1CKM A;  1CQV A;  2CH4 W;  2BDO A;  3HRZ C;  4IO9 A;  1HQM C;  4LJZ C;  3RLF A;  4A3D H;  4XYQ A;  3GQB A;  2K04 A;  4IUP A;  5E7N A;  2I46 A;  2RHQ B;  1ASZ A;  5LMN W;  4A3F H;  4B3M Q;  4UHV A;  4A3J G;  4BS9 A;  3F2D A;  3PMF A;  3NBH A;  2GN5 A;  3KFU A;  2EYO A;  2SNM A;  3S2D B;  1A2U A;  5M3F H;  4QUF A;  2SNS A;  4K0K Q;  5JJI A;  4X62 Q;  1AP0 A;  1JCK B;  4KY5 A;  1HRJ A;  4L5T A;  2Z1C A;  4JI5 L;  1X3Q A;  2K1B A;  1CQF A;  2FJ2 A;  1TY2 A;  2PQE A;  2XSC A;  1Y1W G;  1EYD A;  3S17 H;  3MEH A;  2B63 H;  1ML0 D;  3IKJ A;  3VR2 A;  1FJG L;  5IYD H;  1S5B D;  4JI2 Q;  2RQX A;  1YNX A;  1LTI D;  2HIV A;  2RDF A;  4DR7 Q;  5KNC A;  3K7A B;  2NVQ B;  5FLM G;  1A2T A;  4XT3 B;  2F0Q A;  1H9K A;  1DD2 A;  4DV7 L;  1VQ6 A;  2L11 A;  4LF8 L;  3TRZ A;  5I4D A;  2YTV A;  1EWH A;  2BCO A;  5J1Z A;  3PF5 A;  5EPL A;  3HOY H;  3DMU A;  3AQQ A;  5LMN L;  4ZUJ A;  4B3S L;  4LF5 Q;  3KK7 A;  1V8Q A;  1PTO D;  5GQO A;  1VF5 C;  3S1Q H;  1CHQ D;  1QJO A;  1LUZ A;  2EYH A;  2P5Z X;  2PZT A;  3ERQ A;  5C4X G;  3STB C;  4BBR B;  3PUV A;  1LT6 D;  2RBM A;  1EYC A;  4DUZ Q;  4GKK Q;  4EQ5 A;  4DN4 M;  4DR5 L;  1K28 A;  1EYG A;  2IPK D;  5EBD A;  4QCL A;  4YWL A;  5C3W A;  5C3E H;  2MHV A;  2QF7 A;  1RCV D;  1SMY D;  5IGE A;  3J80 c;  1AZQ A;  4PMW A;  3IFD A;  3S15 H;  4UPA A;  2NZO A;  3FMC A;  1D1K A;  4HCE A;  3T16 A;  2A5H A;  2F0N A;  3DWQ A;  1J6Q A;  2JA8 G;  4BY7 H;  1LT5 D;  2QW7 A;  2KHS A;  4GNX B;  1F9Q A;  1BCP C;  4DF7 A;  5AJ3 Q;  1FNU A;  2V1C C;  2G5D A;  3SK8 A;  4X3U A;  2EYF A;  4DV5 Q;  1WOC A;  1CA6 A;  2CQA A;  3I4M B;  4NP5 A;  1B44 D;  5IGF A;  1GHJ A;  1PTO F;  4LF9 Q;  1PTO B;  1OO9 B;  2PI2 A;  3R2T A;  4OXP A;  1TII D;  3QIA A;  2HUG A;  4DV0 Q;  4KJN A;  1O7Z A;  5JEA G;  5M3M G;  1B53 A;  2E2D C;  5DEH A;  1E1O A;  4DV6 Q;  3CW2 C;  4JYA L;  4XDX A;  5FKA C;  3OOC A;  1MI2 A;  3W1B A;  4DR2 Q;  4ZKB B;  3DM3 A;  4HJA A;  2Z6K A;  4A3B B;  4XYO A;  3S16 B;  2OWO A;  2B2Y A;  3NWT A;  1B9N A;  5CV7 A;  1Z9F A;  2ZJQ A;  4OO1 I;  2WKC A;  1XPU A;  1R9T H;  1K8O A;  3G6J B;  4DAY A;  1SMX A;  4A3D G;  3ZJY C;  3ULP A;  1WTW A;  1BCP D;  1K8M A;  3S14 H;  4B3R L;  1S5E D;  4A3F G;  3C46 A;  4LFC L;  2B29 A;  4P2C B;  3RMH A;  4XQQ A;  3A8J E;  1HPC A;  5M3F G;  1G29 1;  1N33 L;  1NSN S;  2EXZ A;  4OIJ A;  5IP9 H;  1CSQ A;  4IFD J;  3R3O A;  1TU2 B;  5IYB G;  2XIW A;  3KYH C;  2HHH Q; 
#chains in the Genus database with same CATH homology
 4QJF A;  4APV A;  1J5E L;  4IPD A;  3OTO Q;  4BBS H;  2CFM A;  4C3I H;  3BZK A;  5C44 G;  2RF4 A;  4GOP B;  1XMO Q;  1W2B A;  4A3E H;  4DUY L;  2IHF A;  1QUQ A;  3A0J A;  2Q2T A;  4DAM A;  3E9H A;  3JAM c;  1L1O B;  1HR0 Q;  1YHA A;  4LW1 A;  1EUJ A;  1T9H A;  3CCU A;  1V1Q A;  4DV7 Q;  4GLX A;  1M1K C;  2B63 G;  4LF8 Q;  4GKJ Q;  1NY4 A;  1TXY A;  2R93 G;  3KF6 A;  2GVA A;  3NEL A;  1C9O A;  2ZJP A;  1IBM L;  4A3C G;  4IPH A;  4X64 L;  3CCJ A;  3D31 A;  2R92 H;  4BY1 G;  3T1Y L;  2K5H A;  3CPF A;  2JA6 H;  2K75 A;  3UE1 A;  3HOV H;  5LMN Q;  4YY3 L;  1EQR A;  1KRS A;  3K0X A;  4C3J H;  1WCM G;  4YCU A;  3ULJ A;  4HIM A;  3LGJ A;  2PQA B;  4B3S Q;  1TWF H;  3K7U C;  2IT1 A;  4GOP C;  2UU9 L;  1I94 L;  5K36 G;  1NMG A;  4IOC A;  2QEX A;  3HOY G;  2Y0S G;  3L2P A;  1IBL L;  1VQ9 A;  4KLK A;  4JI6 L;  2RCN A;  1EQQ A;  1L1O C;  4DR4 L;  5IT9 c;  3L0O A;  4BBR G;  4X66 L;  1GVP A;  2WAQ G;  3J81 i;  3WWV A;  3CCE A;  2BH2 A;  4JI3 L;  3A5U A;  3KJO A;  1S3O A;  4LFA Q;  2VQE L;  4A3G G;  1KAW A;  1GO3 E;  2C35 B;  1I50 H;  4DAY B;  5M5W H;  4HJ8 A;  4DR5 Q;  4A3K H;  2E5L L;  4L5S A;  3GTK H;  4BXX G;  4BA2 I;  4Y52 H;  4DV4 L;  2VS1 A;  1FGU A;  2UUC Q;  2VZA A;  1QVC A;  3HKZ G;  4OWT B;  4QY7 A;  4GN4 B;  1VQH A;  2QGQ A;  1PH5 A;  1SRU A;  2Z6K C;  1D8L A;  1PHJ A;  3G48 A;  1PFS A;  5IP7 G;  1YZ6 A;  3UDG A;  1YJW A;  1IBK Q;  1ASY A;  2HIX A;  2ALY B;  2KCT A;  2ZM6 L;  4DV1 L;  4UP8 A;  3I56 A;  2N78 A;  4R4O A;  3ER0 A;  4R4I A;  4LUO A;  1HZC A;  5C0X I;  2E5L Q;  3RN2 A;  2JA8 H;  1L2F A;  2XGT A;  3CF5 A;  4GN3 B;  4OWX B;  3F1Z A;  3MXN B;  1VQP A;  4DV2 L;  4H02 A;  2NVY H;  5C3E G;  1S72 A;  1PH9 A;  3UE0 A;  3A74 A;  5C0X J;  3KDF B;  3H0G G;  4JI8 Q;  3CD6 A;  3PO3 H;  4KI0 A;  4YWK A;  1VQL A;  1K73 C;  1B8A A;  4JV5 Q;  4LFB L;  1Y1V H;  5ELO A;  3GD7 A;  3S1M H;  2YYZ A;  4JCV E;  4DR6 L;  1EFW A;  4O0A A;  1FL0 A;  2A1A A;  1QUQ B;  2JQO A;  4A3M G;  2AWN A;  2F4V Q;  4LUZ A;  4DV3 L;  2JEB I;  2YU9 H;  1N32 Q;  3AFP A;  3J7A 5;  1YHB A;  2B3G A;  3AYH B;  4YHH L;  3KF6 B;  2MNA A;  1TWA H;  2OCE A;  1E3P A;  4PZ6 A;  3HOW G;  4GLV B;  1M90 C;  4DK3 C;  3K80 C;  1XNQ Q;  3M3Y H;  2F52 A;  1BKB A;  4R4Q A;  4BY7 G;  2UXC L;  5IY0 A;  1H95 A;  3I4N G;  2UXB Q;  1LTL A;  3NEM A;  1PH1 A;  4A3J H;  4LF4 L;  4ME3 A;  1VQN A;  1HNZ Q;  1QVF A;  3RR5 A;  1IXR A;  1V43 A;  3GTL H;  2EXD A;  1A0I A;  1NBW A;  4IPC A;  1DGS A;  4QQB X;  4TQU S;  1PH7 A;  1Q46 A;  1N36 Q;  4JYA Q;  1YBY A;  1Q12 A;  1W3S A;  3F2B A;  4DR1 L;  4JBK A;  4A3B G;  4B3M L;  3J80 i;  1JE5 A;  2EQS A;  4HID A;  1UE7 A;  5M5Y H;  4NXN L;  2LXJ A;  3GDE A;  3HOZ G;  4UP9 A;  3M4O H;  1X9N A;  3OYY A;  1D7Q A;  2ES2 A;  2JA5 G;  4HIK A;  4JI0 L;  1HZB A;  4WJ4 A;  5GAE C;  3FKI H;  1JJC B;  3EIV A;  1X3F A;  4K0K L;  2D62 A;  4X62 L;  1Y1W H;  1B7Y B;  1HZ9 A;  1Q86 C;  1PH6 A;  3HOU H;  4NXN Q;  2KCM A;  2KHJ A;  3G6E A;  1NJI C;  4B3T Q;  1SLJ A;  1NTG A;  3OW2 A;  3T1H L;  4IFD I;  1HNW L;  1RL2 A;  2IX1 A;  3F8T A;  1A62 A;  1JJG A;  4JI1 L;  1X6O A;  3NEN A;  1JJ2 A;  4B3R Q;  1MKH A;  4AYB E;  3E0E A;  5FLM H;  1Y14 B;  4GN5 A;  1PA6 A;  2AMC B;  2UUA L;  3VDY A;  5IYB H;  1PVO A;  3J81 c;  3CME A;  4LFC Q;  1NMF A;  1YEZ A;  4X65 Q;  3GTQ H;  3TS2 A;  2E2I H;  4X6A H;  4JI2 L;  2K5N A;  2I5M X;  3CXC A;  5C44 H;  3U4V A;  1XPO A;  3PUZ A;  1U0L A;  2OQK A;  1N33 Q;  4LF7 L;  2VQF Q;  4DR7 L;  2NVX H;  1AE2 A;  2UUB L;  3PO2 G;  2GVB A;  1UE1 A;  5GAH C;  1P8L A;  2DGY A;  1Q82 C;  1RIP A;  4GS3 A;  4P72 A;  5IYD G;  4P71 A;  3PV0 A;  3CCQ A;  1J5E Q;  4BY1 H;  4NXM L;  2D0O A;  2KHI A;  2WP8 J;  3HOX G;  3TS0 A;  1Z47 A;  1KD1 C;  1MJE A;  2JA7 H;  4DUY Q;  1E22 A;  2OTJ A;  1HJP A;  3I2Z A;  1B70 B;  5IP9 G;  5C4X H;  2ZTC A;  3BJU A;  1QZG A;  5HGQ A;  4IFD G;  2PMZ E;  2K14 A;  4P75 A;  1YJ9 A;  4LF5 L;  1O7I A;  2VY3 A;  1IBM Q;  4JC0 A;  4X64 Q;  2LXK A;  5DLQ E;  4BBS G;  3U50 C;  4KHP L;  3T1Y Q;  4MNO A;  3AFQ A;  4A3E G;  1YIT A;  3G71 A;  1FVI A;  3KLW A;  3K8A A;  4YWM A;  3ULL A;  3GO5 A;  3PIO A;  3RNU A;  1YHQ A;  2H5X A;  3CCV A;  1CKN A;  4YY3 Q;  5M5X H;  1VQB A;  4P74 A;  3GTG H;  4JBM A;  2ATW A;  4DUZ L;  2VUM G;  3GTO H;  1KHI A;  2WB1 E;  1LM0 A;  2KBN A;  1XNR L;  4GKK L;  5BR8 L;  1I94 Q;  2UU9 Q;  4WJ3 M;  4BXX H;  5IYC H;  2HQL A;  1NE3 A;  1TWG H;  2R92 G;  1IBL Q;  3FHW A;  4JI6 Q;  1X54 A;  2JA6 G;  1SR3 A;  4DR4 Q;  3M4Q A;  1Q8K A;  4DR3 L;  3HOV G;  4X66 Q;  4UY8 C;  3PUX A;  2K50 A;  4JI4 L;  4JBW A;  3CMA A;  5ELN A;  4FDB A;  4JI3 Q;  2YTY A;  2R7Z H;  3JC6 6;  2VQE Q;  2NN6 I;  3CCM A;  4A3I H;  4POF A;  1XPR A;  1K3R A;  1SN8 A;  4YCW A;  4C2M H;  1X3G A;  1VCI A;  3PF4 A;  3Q8D A;  4DV4 Q;  4MTN A;  4LF6 L;  1TWH H;  2KEN A;  3GTM H;  2D0P A;  4IJH A;  2EIF A;  3G4S A;  1VQF A;  4QIW E;  1K83 H;  2K4K A;  1PYS B;  1KIX A;  2JK8 A;  4TVA B;  1E1T A;  1SRO A;  2CWA A;  2ZM6 Q;  4DV1 Q;  1JB7 A;  1Q1B A;  2ASB A;  1SE8 A;  3M85 A;  4A3K G;  2I0Q A;  3HFZ B;  3K81 C;  3UDX A;  3JAM i;  4OX9 L;  2A8V A;  1VQG A;  3TEH B;  1K8G A;  2Q2H A;  3J81 j;  3H3V I;  4DV2 Q;  1N9W A;  3D0F A;  5AJ3 L;  3H15 A;  1XJV A;  1X55 A;  1XTD A;  2CKZ B;  3S24 A;  2NVT H;  2ZJR A;  5JEA J;  4LFB Q;  4NPS A;  1EIF A;  3M7N A;  2CWP A;  5M3M H;  3EN2 A;  1OXX K;  2Y0S E;  3H3V H;  1HZA A;  4OX9 Q;  1MIU A;  4DV5 L;  3I4M G;  1E7Z A;  1OXV A;  2R6G A;  3PGZ A;  4DR6 Q;  1CUK A;  3BZC A;  5LMU L;  4A76 A;  3CPW A;  1XMQ L;  1K8A C;  2WAQ E;  4OO1 G;  4LF9 L;  4HIO A;  1VQJ A;  5C0X G;  4L5R C;  2A19 A;  3PO3 G;  3RLO A;  4QGU A;  4DV3 Q;  1Y1V G;  1PH3 A;  1A8V A;  4YHH Q;  1V9P A;  4OON A;  1VQ4 A;  4XIG S;  3STB D;  4DV6 L;  4A3L H;  1VQE A;  2K5V A;  2UXC Q;  4AYB G;  2ZTE A;  2ID0 A;  1CKM A;  2BA0 A;  3U58 A;  4DR2 L;  1HR0 W;  1WYD A;  4RMF A;  4LF4 Q;  1CKN B;  3F2C A;  4IO9 A;  1QVG A;  4OWW B;  3S2D H;  3SGI A;  3RLF A;  4O2D A;  4A3D H;  1N34 L;  4A93 H;  2IY5 B;  1BBU A;  5E7N A;  2IX0 A;  3CQZ H;  3CC7 A;  4YCV A;  3GTJ H;  2RHQ B;  1FJG Q;  5J3B A;  1ASZ A;  1X3E A;  4DR1 Q;  3PUY A;  5LMN W;  4DK6 C;  4A3F H;  4B3M Q;  2JJQ A;  4A3J G;  1YVC A;  1VQ8 A;  2JEA I;  3F2D A;  1PH8 A;  4LUV A;  2GN5 A;  4KHZ A;  3KFU A;  2MO0 A;  5M3F H;  4JI0 Q;  4A4I A;  2VNU D;  5FJ8 G;  1LYL A;  3A5Z B;  4K0K Q;  5JJI A;  4X62 Q;  4PZ8 A;  1HNX L;  5HY6 A;  2E2J H;  4L5T A;  1VQM A;  2HHH Q;  1TWC H;  4JI5 L;  1N8R C;  3T1H Q;  3AEV A;  1HNW Q;  3UDF A;  4POG A;  3K7A H;  5IWA L;  2NVQ H;  1AE3 A;  3FKI G;  3KOJ A;  4JI1 Q;  3RZD H;  1Y1W G;  3PO2 H;  3S17 H;  1KRT A;  2B63 H;  2UUA Q;  3HOU G;  4JI5 Q;  3W5O A;  2WB1 G;  1K9M C;  4AQY L;  1VQI A;  4JI7 L;  1FJG L;  3E9I A;  3RZO H;  1EOV A;  2R93 H;  5IYD H;  2HHH L;  2JA9 A;  4A3C H;  2UXD L;  1BVS A;  4JI2 Q;  3OTO L;  3HOX H;  3S2H H;  1AH9 A;  4GNX A;  1YNX A;  1PYB A;  2L15 A;  1XMO L;  1S40 A;  4P73 A;  2HIV A;  4LF7 Q;  4DR7 Q;  1A63 A;  3FP9 A;  1SFO H;  5FLM G;  2UUB Q;  1HR0 L;  4DV7 L;  2E2H H;  1VQ6 A;  1WCM H;  4LF8 L;  4GKJ L;  4JOI A;  1WFQ A;  1IL2 A;  2YTV A;  4DPG A;  4ALP A;  2CCZ A;  3TRZ A;  3IRB A;  3PF5 A;  3HOY H;  4NXM Q;  4PZ7 A;  3AQQ A;  2FXQ A;  1QZH A;  4JBJ A;  4BBR H;  3RN5 A;  5LMN L;  1EIY B;  2IHE A;  2VUM H;  4B3S L;  4LF5 Q;  5GQO A;  1MJC A;  3S1Q H;  4A3G H;  1LUZ A;  4KHP Q;  2OQ0 A;  2JA7 G;  1X56 A;  5C4X G;  2AKW B;  2OTL A;  2HT1 A;  2ZTD A;  1G6P A;  3STB C;  3CCL A;  2I5H A;  5EAY A;  3PUV A;  3PCO B;  2LSS A;  5IP7 H;  4DUZ Q;  4LFA L;  4GKK Q;  1YIJ A;  1XNR Q;  5BR8 Q;  2MQH A;  3NBH B;  4EQ5 A;  4DR5 L;  2K52 A;  3KJP A;  1WJJ A;  2Z0S A;  1EYG A;  2AHO B;  2UUC L;  4DR3 Q;  4LWC A;  4YWL A;  5C3E H;  1OTC A;  4JI4 Q;  3H0G H;  5GAG C;  4XTC S;  1IBK L;  1UE6 A;  2R7D A;  1L0W A;  3J80 c;  1CSP A;  3PUW A;  5IYC G;  3B6Y A;  2JE6 I;  4PMW A;  5GAD C;  1PV4 A;  1E24 A;  4UPA A;  3S15 H;  4LF6 Q;  4HJ5 A;  1IYJ B;  4Y7N H;  2NZO A;  2CQO A;  2N49 A;  4QL5 A;  4NB3 A;  1EWI A;  2PI2 E;  4A3M H;  4JI8 L;  3W1G A;  4C3H H;  4IPG A;  2R7Z G;  4JV5 L;  5C4J H;  2WFW A;  4A3I G;  1J6Q A;  4PG3 A;  3S1R H;  2JA8 G;  3HOW H;  3I4M H;  3GTP H;  4L5Q A;  4BY7 H;  3BU2 A;  4GNX B;  3HKS A;  4MZ9 A;  3I4N H;  3KF8 B;  2N3S A;  3EBE A;  1VQ5 A;  5AJ3 Q;  1JT8 A;  2NN6 G;  1CKO A;  4IJL A;  2F4V L;  1OXU A;  2V1C C;  2YTX A;  4DV0 L;  1N32 L;  4JG2 A;  4LNQ A;  1UEB A;  4GOP A;  4A75 A;  5H1S E;  4DV5 Q;  1WOC A;  1GKH A;  1VQC A;  3M9B A;  1XNQ L;  3ICE A;  2RHS B;  2UXB L;  1L1O A;  5LMU Q;  1OXS C;  1XMQ Q;  1C0A A;  3HKZ E;  4LF9 Q;  4A3B H;  3S16 H;  1G51 A;  1PH2 A;  2PI2 A;  1VQA A;  4OXP A;  1YJN A;  1HH2 P;  3L7Z C;  4UP7 A;  4DV0 Q;  2MO1 A;  1X65 A;  1HNZ L;  2QA4 A;  3UDI A;  5JEA G;  3ERS X;  3RLN A;  1PH4 A;  3HOZ H;  5M3M G;  1UE5 A;  4GNX C;  2Q2U A;  2N8N A;  4AH6 A;  3PSI A;  2JA5 H;  2MFI A;  1E1O A;  4DV6 Q;  3CW2 C;  3S1N H;  3CC2 A;  1N36 L;  4JYA L;  1I6H H;  2R7F A;  3I7F A;  4DNI A;  5FLX c;  3PIP A;  3W1B A;  4DR2 Q;  4BA1 I;  3DM3 A;  4HJA A;  2PQA A;  4JOI C;  2Z6K A;  4AIM A;  1KC8 C;  3J7Z C;  1IZ6 A;  2AWO A;  3TQY A;  2OWO A;  2Q2I A;  2DUD A;  5JJL A;  1N34 Q;  2NZH A;  1Z9F A;  2ZJQ A;  4A3L G;  5JJK A;  5FJ8 H;  4R4C A;  1KL9 A;  4OO1 I;  4J15 A;  2F3I A;  1I3Q H;  4GLA C;  3CC4 A;  1XPU A;  1Q7Y C;  1R9T H;  1VQO A;  1Q81 C;  4B3T L;  3I55 A;  4R4T A;  1SMX A;  4A3D G;  2VL6 A;  3M4P A;  3TRE A;  3ZJY C;  3ULP A;  4A93 G;  3CP0 A;  1I5F A;  1GD7 A;  1U5K A;  1BBW A;  2XTI A;  3MEF A;  1C7Y A;  2BH8 A;  3DLL A;  1UWV A;  1OXT A;  2YV5 A;  3I4O A;  3S14 H;  4B3R L;  4R1J A;  1K0R A;  2VW9 A;  4A3F G;  1JMC A;  2I5L X;  1YI2 A;  1HNX Q;  1P16 A;  4LFC L;  2B29 A;  4RG1 A;  4X65 L;  1GM5 A;  1WI5 A;  4IOA A;  5M3F G;  1KQS A;  1G29 1;  5IE8 A;  4HJ9 A;  5GRO A;  1N33 L;  4DKA C;  5IWA Q;  2BA1 A;  2VQF L;  3U4Z A;  2PNH A;  5IP9 H;  1CSQ A;  3CCS A;  3KDF A;  1VQD A;  4HJ7 A;  1VQ7 A;  1VQK A;  4IFD J;  1KXL A;  4EX5 A;  3CCR A;  5IYB G;  4AQY Q;  3CAM A;  1Q1E A;  3KYH C;  2E8G A;  4JI7 Q;  1VS0 A;  2UXD Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...