4BY7H

Elongating rna polymerase ii-bye1 tld complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7H00
4RG1A 1XJVA 3I7FA 1FL0A 1YVCA 4BY1H 1NE3A 3T1YL 4IOCA 3I4MH 4NXMQ 2D0OA 5E7NA 1OXUA 2UUBQ 4DUZL 5M5XH 2Q2UA 3Q8DA 3PUYA 4JCVE 3NBHB 3KOJA 2NVXH 1YHBA 2HT1A 2N49A 2A1AA 3HOUH 1YZ6A 4BXXH 5C4XH 4IFDJ 3ULJA 1PH9A 3LGJA 2OTJA 1AH9A 1CKOA 4J15A 1PH8A 4HIKA 5IYDH 2IHFA 2Q2HA 3PO3G 5IT9c 1PH3A 1VQDA 1E1OA 1B7YB 1X3GA 4GKJL 1H95A 4DV6L 5H1SE 4KI0A 2ASBA 2JA6H 3GTLH 4BBSG 1HNZL 2BH2A 4IFDG 1EUJA 5C0XJ 1UE1A 3H3VH 5IP7G 2UUAQ 4A3KH 1XNRQ 4Y52H 2CKZB 2YV5A 1RIPA 1D8LA 1L1OC 4GKJQ 5IYBH 3TQYA 3E0EA 1QZHA 4A75A 3GTMH 2NVYH 1N32Q 2ALYB 3DLLA 3S1NH 3HOZH 3KF6A 4GNXA 3CF5A 4A3JG 2DUDA 4GOPB 4LF9L 4Y7NH 3WWVA 1Q1BA 2R7ZH 2IT1A 5IY0A 5ELNA 4YHHL 4TQUS 1CKMA 4EX5A 4JI8Q 3AYHB 5C0XG 3GTOH 2LSSA 4X64Q 4GLVB 4HIDA 2K5HA 5IP9G 4BBRG 4DR6L 4JOIC 1KHIA 4JG2A 4DR7L 1P8LA 4OXPA 4PMWA 1XNQQ 2JA8G 1G291 4LWCA 3J80i 1VQHA 4KLKA 1WFQA 1U0LA 1IBKQ 4YHHQ 4BY7H 4A76A 4MTNA 4OO1G 3D31A 2OQKA 3CW2C 3L0OA 4QL5A 2UUCL 4TVAB 2CCZA 4DV7L 1QVCA 2QA4A 4GN5A 4A3GG 1TWHH 2ZTCA 4UP9A 2VUMH 1N33L 2F3IA 1X55A 1Y1VG 2FXQA 4H02A 4C3HH 1HR0Q 3PGZA 2R7FA 3CCEA 1MJEA 4IFDI 4X65Q 1HZAA 1Q82C 4EQ5A 1K73C 1KL9A 3M85A 1G51A 1A0IA 3BJUA 1YJNA 3A5UA 2ZTDA 1JB7A 2A19A 2VW9A 3AFPA 2UUCQ 4DV0L 2B3GA 4JI5Q 1UWVA 1VQ8A 5M3FG 1M90C 1K9MC 3K80C 2B63G 1MJCA 1N33Q 5GAEC 3M4OH 3M3YH 1V43A 2E2JH 3RN2A 3S24A 3ZJYC 3G71A 5C44H 2AMCB 3E9HA 2HHHQ 3RN5A 3JAMc 3F2BA 3CCRA 1YJWA 1YNXA 1I6HH 4LFAQ 2AWNA 3AEVA 1VQEA 4BY1G 3I4MG 2LXJA 1IBLL 4LUOA 1SFOH 1Z9FA 1W2BA 1VQIA 3U4VA 2VQFL 1HNWL 3UDXA 4NB3A 4DUYQ 2RCNA 3HOWH 1IL2A 3T1HL 4DR5L 2MO0A 4JI1L 2K50A 1JJGA 4HJAA 3ICEA 3U50C 2UXDL 4OO1I 3ULPA 1NMGA 3HOUG 3F2CA 3DM3A 3W1BA 5K36G 1VQ5A 4BXXG 4AYBE 1E22A 5C4XG 3FHWA 4R4QA 5FLMH 4WJ4A 1JT8A 1SMXA 4GN3B 4R4IA 2MQHA 1PH6A 1JJ2A 2JA7H 4AH6A 4A3LH 4C2MH 2I5MX 4L5QA 3OW2A 3U58A 1DGSA 4LF7L 5IYDG 3I56A 3CMAA 1XMOQ 1GKHA 2GVAA 4JI1Q 2H5XA 3STBD 2NZHA 4YCUA 2JA6G 4A3FH 4O2DA 4JBJA 5BR8Q 3PCOB 2E2IH 4DAMA 4DV5Q 3M9BA 2R92H 2K4KA 1XPRA 2E2HH 4WJ3M 4A3KG 4LFCQ 1VQMA 3I55A 3A74A 3L7ZC 1PH1A 4XIGS 2WFWA 5IYBG 1VQJA 4A3EH 3KDFB 3M4QA 1KRSA 3D0FA 3HOZG 1PYBA 2JJQA 3MXNB 1VS0A 4JBKA 3OYYA 2ZJQA 4DAYB 4UP7A 3K8AA 1VQ4A 1PVOA 4HJ9A 3AQQA 2AKWB 1VQCA 1C0AA 3HOXH 1BBUA 1N34Q 1LYLA 1VQBA 1OXSC 4HJ8A 3F8TA 1EIYB 1V1QA 1CSQA 3S14H 3J81c 4BY7G 2PQAB 3AFQA 1XTDA 1OXXK 2D62A 4HIMA 2UU9Q 3K7UC 2ZM6Q 2I0QA 2UUAL 4JI4Q 4JI7Q 4BA2I 1XNRL 1WI5A 2BH8A 3VDYA 2VUMG 1L1OA 1OXTA 4X66Q 4GOPC 3PO2H 1N32L 3A5ZB 3I4NH 3G4SA 1X3FA 1QVGA 4K0KQ 3FKIH 1N36Q 1TXYA 2E8GA 4YCWA 1QZGA 3H3VI 4JI8L 1VQGA 4QJFA 3GTJH 1TWAH 2JQOA 3HFZB 3PUZA 1X54A 4AYBG 4X64L 1X9NA 1S40A 2KENA 1K8AC 2E5LQ 3CD6A 1LUZA 2CQOA 3S1RH 4HJ5A 4FDBA 1E3PA 4LF4Q 2Y0SE 5M3MH 2K5VA 1NTGA 1XNQL 4JOIA 3CCSA 4P71A 2VNUD 1WYDA 2K75A 5C44G 2F52A 3PSIA 2V1CC 4IJHA 4QQBX 2IY5B 3PIPA 1IBKL 3KFUA 3KF8B 5LMNQ 4AQYL 1ASZA 2CFMA 1PH7A 3TRZA 2UXBQ 1YBYA 2EXDA 4R4CA 1Q46A 4B3SQ 1HZCA 4JI0Q 1QUQB 2MFIA 2KCTA 2B29A 1BBWA 2JA9A 4O0AA 3HOWG 4HIOA 1HR0L 1C9OA 1L2FA 2YTYA 1YI2A 4YCVA 5C3EH 4X65L 3TEHB 1Q81C 3HOYH 2K14A 4P74A 4A3BH 4AQYQ 4R4TA 3J81i 5FLMG 2KBNA 1SR3A 4JI5L 3GTGH 1AE3A 3BZCA 3GO5A 1J5EQ 2JA7G 4A3LG 1N8RC 1FVIA 4A3DH 1EIFA 1MIUA 1A8VA 3GTKH 4YWLA 3TREA 4JI6Q 4KHPQ 2HHHL 3FP9A 4A3IH 1RL2A 5DLQE 4X62Q 3KLWA 4A3FG 4LFAL 3S1QH 1EWIA 1CKNA 5J3BA 5IWAQ 5GADC 2YU9H 4DR4L 4NPSA 1L0WA 4JC0A 1TWCH 2R92G 4DUYL 3CCVA 4LF5Q 4JV5Q 4LNQA 3G48A 4A3EG 3RZOH 4ME3A 5JJKA 4DNIA 3CC2A 1E24A 1I3QH 1UE5A 4PZ7A 4A93H 2YTVA 2Q2TA 3PV0A 4C3IH 4DV2Q 1JMCA 4IOAA 5GAGC 3PUXA 5ELOA 4A4IA 1YIJA 1EQQA 4LF6Q 4DR4Q 5EAYA 3KF6B 4GNXB 3S2HH 2JA5H 3K81C 1KRTA 2KHIA 1SROA 2RF4A 3EBEA 3HOXG 3PUWA 5LMUL 4DR1L 1XMOL 2CWAA 1B8AA 1MKHA 2GN5A 4PZ6A 1R9TH 1C7YA 1K8GA 2JEAI 2VQEQ 2Y0SG 1XMQL 3TS0A 4GLAC 1WJJA 2ID0A 1WCMH 2LXKA 1BKBA 5BR8L 3J81j 3CCQA 4OWWB 4XTCS 3CC4A 5JJIA 3OTOQ 4DV5L 1T9HA 2IX1A 1W3SA 2OTLA 3K7AH 4LFCL 1YHAA 5LMUQ 3EIVA 4YY3Q 4IPGA 4DR1Q 4L5RC 2I5HA 1VQ7A 3RNUA 1E7ZA 3PO2G 4PZ8A 3S17H 2K52A 3U4ZA 3I4NG 1XMQQ 2BA0A 1J6QA 1YHQA 3FKIG 2EIFA 4DPGA 2PQAA 2RHQB 1S72A 2HIVA 1NBWA 5JJLA 2UXCQ 1B70B 1SN8A 2WAQE 4P75A 3STBC 5FJ8H 4GKKQ 3KJPA 3H0GH 1N34L 1TWGH 4DK3C 5M3MG 1EOVA 3JAMi 1VQAA 1UE7A 1U5KA 3F2DA 2OWOA 2WB1E 2PNHA 4LFBL 1PA6A 3PUVA 1KAWA 2R7ZG 1YITA 4DV3L 3HKSA 2UU9L 1I94Q 3S2DH 4GN4B 2ZM6L 1Q1EA 3RLOA 3RZDH 1XPOA 1PHJA 4JI4L 4JI7L 3GTPH 3A0JA 2R6GA 4ALPA 4JI3Q 1K3RA 4X66L 1TWFH 1VQ6A 2XTIA 2N78A 4GOPA 5IE8A 4OX9Q 5C3EG 2KCMA 4LFBQ 4K0KL 4AIMA 1N36L 2L15A 3HOYG 4A3BG 1Y1WH 3I4OA 1OXVA 1M1KC 5GAHC 4DV3Q 3H15A 4JYAL 4APVA 2OCEA 3JC66 4LUVA 3UE1A 1HR0W 1SRUA 1HNXQ 2E5LL 3TS2A 4A3CH 3L2PA 1G6PA 1NJIC 4A3DG 4LF4L 1EFWA 1VQ9A 1GVPA 1D7QA 1IBMQ 5IYCH 3UDGA 3J7A5 3UDFA 3HOVH 4A3IG 1I50H 4GS3A 3HKZE 1JE5A 4IJLA 1HH2P 3G6EA 3CCUA 5LMNL 1NMFA 3J80c 1OTCA 1GO3E 3UDIA 4JYAQ 3CC7A 4B3SL 2NVQH 4JI0L 2K5NA 3BZKA 3ER0A 2N8NA 5M5YH 2YTXA 3T1YQ 5M5WH 4IO9A 1HZ9A 1A62A 4HJ7A 2N3SA 1A63A 3PF4A 4DUZQ 2R93H 4DKAC 1YEZA 1I5FA 1KC8C 4A93G 3I2ZA 2NZOA 3S15H 1VQKA 2I5LX 3CP0A 3BU2A 1Q12A 3RLNA 4IPCA 1PFSA 1ASYA 3GTQH 3CPWA 1X56A 1Z47A 4B3ML 4JI2L 3CCJA 1J5EL 2UXBL 1EQRA 2PI2E 1VQPA 4A3MH 2JA5G 2AWOA 2A8VA 1SE8A 3ULLA 1NY4A 2WAQG 3B6YA 4DK6C 2IX0A 1VQLA 2ATWA 4UP8A 4IPHA 4JI6L 2HQLA 1YJ9A 4KHPL 3F1ZA 4BA1I 3S1MH 4DV6Q 4UY8C 4X62L 3J7ZC 2Z6KA 3EN2A 1WCMG 2WB1G 4JI2Q 5IWAL 1SLJA 4DR3L 1HNZQ 2EQSA 3MEFA 2MNAA 3CCLA 3K0XA 2C35B 4QIWE 2F4VL 1CSPA 1P16A 1GM5A 1VQFA 3M4PA 4KHZA 2DGYA 4LF5L 4JV5L 1PH2A 4YWMA 3CMEA 1K0RA 2JK8A 1WOCA 2Z6KC 2RHSB 2JEBI 3PIOA 4DV2L 4GNXC 2VL6A 3SGIA 2QGQA 1L1OB 2MO1A 4DR3Q 3IRBA 5GROA 4LF6L 4LF9Q 4JBMA 2F4VQ 5FJ8G 4PG3A 4B3TL 1UEBA 3H0GG 4DR2L 1QVFA 3PO3H 4B3MQ 2VQEL 1IZ6A 4L5TA 1KIXA 4DR6Q 4POGA 4DR7Q 1PYSB 4UPAA 5FLXc 3RR5A 4C3JH 4BBSH 1CUKA 2Z0SA 3GD7A 1E1TA 3OTOL 2JE6I 3HKZG 4GLXA 4B3TQ 4YY3L 1IYJB 5IP7H 3KDFA 4DV4L 2ZTEA 4DV7Q 4DR2Q 1VQNA 3UE0A 4NXNL 2Q2IA 4L5SA 2KHJA 2NN6G 1PH4A 4QY7A 3W1GA 2XGTA 1PH5A 1FJGL 2BA1A 4B3RL 3CPFA 4A3JH 1Y1WG 4OONA 1Q7YC 3CQZH 1Q86C 4OWTB 3RLFA 5C0XI 4QGUA 2UXCL 1JJCB 1N9WA 1S3OA 2PI2A 4LF8L 1Q8KA 1VCIA 3CAMA 2WP8J 1KQSA 4DV0Q 5AJ3L 2ZJRA 4DV4Q 1XPUA 4GKKL 4A3CG 4NXNQ 1HZBA 3CXCA 1V9PA 5IP9H 2NVTH 3GDEA 1UE6A 5JEAJ 4BBRH 4RMFA 5IYCG 1K83H 2JA8H 3S16H 1FJGQ 3ERSX 3HOVG 4MNOA 2VY3A 4P72A 4R4OA 4OWXB 4B3RQ 4IPDA 4POFA 2HIXA 3PF5A 4LF8Q 3NELA 5GQOA 1IXRA 2YYZA 1I94L 3KYHC 1Y14B 4MZ9A 5AJ3Q 2ES2A 5HGQA 1IBLQ 3CCMA 1LTLA 4DV1L 2VQFQ 4JI3L 1CKNB 4A3GH 2CWPA 5JEAG 5LMNW 1HNWQ 1LM0A 2IHEA 2PMZE 2R93G 1Y1VH 4OX9L 4LW1A 3T1HQ 4YWKA 4DR5Q 1KXLA 1FGUA 1X3EA 3W5OA 2UXDQ 3NEMA 1O7IA 2AHOB 4JBWA 4R1JA 1AE2A 5C4JH 2D0PA 2QEXA 1GD7A 1PV4A 1HNXL 1HJPA 4X6AH 4DV1Q 1BVSA 2VS1A 4P73A 4A3MG 2NN6I 4NXML 5M3FH 2VZAA 1EYGA 2B63H 3M7NA 3NENA 2OQ0A 2R7DA 2ZJPA 1IBML 2GVBA 2UUBL 4LF7Q 1X65A 5HY6A 4LUZA 3E9IA 1VQOA 1KD1C 1QUQA 1X6OA 3KJOA
chains in the Genus database with same CATH superfamily
2MJ8A 1XJVA 3I7FA 1K8OA 5I2XA 1JR0D 3I4MH 3ND9A 2D0OA 2RQXA 1EQVA 4FXKC 4OHJA 1ONLA 2UUBQ 4DUZL 5C4HA 2F0NA 3N52A 5CV8A 3NBHB 4FO2A 3Q24A 1YHBA 2NVXH 1B1ZA 2N49A 2WKCA 1EYAA 1YZ6A 1V1PB 5IGDA 4ZLTF 1C8CA 2G9DA 4OIJA 1CKOA 4RFBA 1Q90A 4HIKA 1JC7A 1VQDA 1E1OA 1B7YB 4GKJL 4C3IG 4DV6L 3QO2A 2CW0C 1SMYD 3J80E 2B8GA 2WINB 1ESFA 1WD0A 1ZYRC 4XYQA 1CHPD 4ABNA 2QKIC 5IYBH 4GKJQ 3TQYA 5C3EB 1QZHA 3GTMH 1N32Q 1SYCA 2WKDA 3DLLA 2EY6A 3KF6A 5IY0A 3S9WA 5ELNA 4EX5A 5CYUA 5IGCA 5I6WA 2K5HA 1LV9A 1ZKOA 1II3A 4JOIC 1SYDA 4JG2A 1EL0A 4DR7L 1JQYD 4OXPA 4ZYSA 2JA8G 3J80i 5KNCA 1WFQA 1ESRA 2IW3A 1EFID 1RDPD 3L0OA 1B3QA 4TVAB 3BG3A 1V8QA 4H02A 1HR0Q 4CDFC 5KNBA 4EQ5A 1AZQA 1G51A 1A0IA 2A6EC 1PZID 2VW9A 3AFPA 3AMUA 1VQ8A 1M90C 1K9MC 2XN9C 3S24A 1U9RA 5C44H 3E9HA 2OT2A 2HHHQ 5FLXE 4RGOS 3F2BA 3A7AB 3CCRA 1YNXA 3SK5A 1IBLL 1FD7D 3GV3A 3K7AB 4CKCA 1TVXA 4ZKBB 4DUYQ 3JAML 1IL2A 1CA6A 4JI1L 3C2PA 2K50A 3U50C 4A3FB 2UXDL 3ULPA 1NMGA 3F2CA 1VQ5A 5C4XG 3FHWA 1TIID 1SJHD 4AH6A 3OW2A 3U58A 1DGSA 1BCPF 1TWGB 2F3VA 2JYOA 3I56A 3FMCA 2EJGC 1I4PA 4FXGC 4JI1Q 1PRTB 4RCNA 3STBD 3E3XA 1EQTA 4YCUA 3SK4A 4A3FH 3T51B 3SVMA 5BR8Q 3HKZB 3PCOB 4RA8A 3M9BA 2R92H 2K03A 3OHXC 4A3KG 1VQMA 2OF1A 1SEBD 4XIGS 1VQJA 5I9OA 3HOZG 4MTKA 1VS0A 4JBKA 1ML0D 1TQOA 2ZJQA 4UP7A 1HUMA 3I4LA 2AKWB 1VQCA 1ET6A 2PZTA 3J7AV 3HOVB 4PQXA 4HJ8A 4JK1C 1V1QA 2BE5C 5EKIA 3J81c 4BY7G 2NVQB 1XTDA 1OXXK 2D62A 2SNMA 2HCCA 5M5WB 4JI4Q 4LK1C 1XNRL 1K0SA 2VUMG 1OXTA 4GOPC 3A5ZB 3I4NH 3RMHA 4K0KQ 1N36Q 1PFNA 2E8GA 1DYQA 3H3VI 2EYFA 1VQGA 2UXBL 3NWTA 2B2VA 4OIKA 2E5LQ 1LUZA 2J4XA 4FDBA 1E3PA 5M3MH 3HOYB 1NTGA 1XNQL 3CCSA 2K75A 1EYDA 2F52A 3PSIA 3QWNA 5KGUA 1SNPA 4KKTA 1ASZA 1PH7A 3TRZA 2UXBQ 2D5DA 4R4CA 4A3DB 1PZJD 2IX3A 2KCTA 2B29A 1Q8IA 1PFMA 1A15A 4L63B 5CV6A 2DJGC 4HMJA 4HIOA 1C9OA 1U4MA 1GJXA 4X65L 4DGZA 3TZDA 3HOYH 2K14A 4P74A 4RWSC 1PLFA 4K8JA 5FLMG 2KBNA 4JI5L 1TWCB 5IIFA 1AE3A 3BZCA 3KBXA 4BS9A 2AQ3B 3MWYW 4A3DH 3P75A 1EIFA 1MIUA 4C3IB 4YWLA 3OW7A 4J6HA 1B9MA 5DLQE 2SEBD 3S2HB 3S1QH 1EWIA 3BYYB 1CKNA 4N8FA 5GADC 1F2LA 4JC0A 1TWCH 5EKLA 1ENAA 3W3AA 2PNRC 1E2ZA 3CC2A 2K5DA 1PMRA 4C3IH 1SBBB 5GAGC 4A4IA 4LF6Q 1DOKA 3KF6B 3S2HH 1KRTA 3QR8A 1GXDC 1NR2A 5C4ZA 3PUWA 2A74C 3HOXG 4DR1L 1R9TH 2JA8B 1K8GA 3G6JB 3EA6A 1GUGA 3WDNA 1B2TA 4GLAC 2ID0A 4JPBW 2B2TA 3J81j 4XTCS 4DR1Q 4L5RC 1F2MA 1WTHA 4YY3Q 2E2DC 3PO2G 3S17H 2BA0A 3NQIA 4KTAA 4DPGA 2RHQB 1NBWA 1BBXC 2PO4A 5JJLA 1B70B 3PIO3 1JORA 1JOQA 1EOVA 2OWOA 2WB1E 2F0QA 3PUVA 2R7ZG 1YITA 3VYUA 3A54A 1IKLA 2UU9L 1A3TA 1I94Q 1Q1EA 1PHJA 4JI7L 3RUZA 5D3IB 1SNCA 3BVGA 4JI3Q 2E74C 4RAUC 1WTOA 3VR2A 2XTIA 2KCMA 4AIMA 2L15A 3I4OA 5JAVA 1GUSA 4APVA 2OCEA 3CRLC 3SK6A 3TS2A 1HNXQ 3K5NA 3QOJA 3L2PA 1WVLA 4R8NA 1IBMQ 5IYCH 4RGTA 1WTPA 1VMPA 3J7A5 3UDFA 4A3IG 2F0DA 3HKZE 1JE5A 5ELFA 5LMNL 3J80c 1HQRD 3UDIA 1PDQA 2Z9HA 4B3SL 2XSCA 4A3KB 4NW2A 1HZ9A 5JEAH 2N3SA 1A63A 5IGEA 1LTAD 1YEZA 3R8BA 1D5MC 4A93G 3HOZB 1A2UA 1T5XD 3BU2A 1JCKB 1Q12A 3BDLA 1JB3A 2KJXA 3LWEA 3GTQH 4PV1C 1EY4A 1X56A 1Z47A 4RH6A 4B3ML 1H9SA 4IUPA 5CBEE 2AWOA 4A3MH 2JA5G 1EY6A 3ULLA 3B6YA 4NDXA 2MP1A 1I4RA 1TKWB 3R3OA 4UP8A 1STNA 4JI6L 1K28A 1WTVA 4UY8C 1BUVT 3W2DA 1AFPA 4X62L 4BY7B 3EN2A 4B3MQ 4UDUC 1SLJA 2I46A 2CHBD 5JVH3 1CSPA 4JV5L 1GM5A 1VQFA 2VUMB 2DGYA 3G7LA 5EPJA 3CMEA 2RHSB 4DV2L 4CDCC 4EQPA 2MO1A 2B2WA 2K32A 3IRBA 1D6EC 3NXWA 3D4WA 4DXFA 5FJ8G 1UEBA 3M3YB 5EQ0A 3MHBA 3URYA 2VQEL 1IZ6A 2PW7A 1I6VC 1E0BA 5FLXc 4C3JH 1E1TA 3OTOL 1CI3M 3KDFA 1HA6A 4IUQA 4NXNL 1KDCA 4L5SA 2EYOA 1MI2A 1PTOC 2O5JC 1U4LA 1V1OA 1PH5A 1FJGL 3CPFA 1Y1WG 1WTQA 3RLFA 3KUPA 3Q6SA 4EVOA 2PI2A 1Q8KA 1VCIA 5C0XH 2ZJRA 1XPUA 3TDQA 3NE5B 4NXNQ 3E0JA 3OSOA 4K6DA 5IP9H 3GDEA 1ZEQX 2TMPA 1FJGQ 4ZK9B 2SOBA 4IPDA 2HIXA 4OO1H 1IXRA 3SHLA 4MZ9A 2E2HB 3CCMA 3QIAA 1UEAB 1PTOF 4A3GH 1CKNB 3VR6A 1A2TA 4K5VA 1G8ZD 5G3LF 3OMGA 1O7IA 4DF7A 1KAAA 4XYOA 2QEXA 1ENFA 3ITPA 4NXML 2K1BA 3HOXB 3TP6A 5JVG3 1X65A 4LUZA 5EBDA 3E9IA 3NPPA 2SNSA 2R61A 2JP1A 3KJOA 4RG1A 1Y69U 3L9AX 1AW7A 3T1YL 2F0HA 4NXMQ 1BDOA 1CQVA 2A68C 2F0SA 2ZXOA 1OXUA 1K8MA 1WTRA 3KOJA 1TY2A 4V190 4WORA 3HOUH 4XT1B 4BXXH 1XX8A 2F0TA 4IFDJ 1PH9A 3LGJA 5LL6X 1AH9A 5C6AA 1HTLD 2Q2HA 4KJOA 5IT9c 5E3FA 3D6WA 4Y7NB 2R7ZB 1VDZA 4WFN3 1TR5A 1JOOA 2EYMA 4HEDA 4HCSA 2QEJC 1UE1A 3UI2A 2UUAQ 3TP7A 1LTTD 2X6LA 2CKZB 2YV5A 1L1OC 5ELDA 3VA7A 3E0EA 4MN3A 4A75A 2NVYH 3MXUA 4CHTB 1H9KA 4X3SA 4DK1A 3CF5A 2PPBC 4Y7NH 3WWVA 2R7ZH 1GHKA 4TQUS 4JI8Q 2K05A 2R3ZA 4XT3B 2F0JA 4ODGA 4C3HB 2M2LA 4DR6L 5DEHA 2EYPA 4A3IB 1G291 4H0LC 1VF5C 4KLKA 1TT2A 4A76A 4ZKCB 1SE2A 4QL5A 1TS4A 5KYLA 4DV7L 4G7OC 4GN5A 1TWHH 2XWJB 2F3IA 1I3QB 4C3HH 3CCEA 1MJEA 1HZAA 1Q82C 1K73C 1C48A 2ZTDA 4IZ8A 2RA4A 5KEEA 2B3GA 5A2QL 2JA5B 1UWVA 1GOZA 4R8IA 2B63G 1JE4A 4FF3A 3M4OH 1NUCA 2RVLA 1IYVA 3NTKA 1LT6D 1UNSA 1W6JA 3G71A 4HR7B 2FMMA 2A5HA 2AMCB 4JVZA 1EEID 4BY1G 3D4DA 1DXMA 4C2MB 1Z9FA 3DMUA 4FP5D 2VQFL 1HNWL 2NZ1D 3OPOA 3UDXA 3HOWH 2MO0A 2G9HD 1JJGA 5K36G 2EZVA 4R4QA 4WJ4A 2VXWA 1SMXA 4GN3B 1LO5D 2L5TA 1XWEA 1M8AA 5JJZA 4A3LH 4C2MH 2I5MX 5E4XA 4A3EB 4LF7L 5IYDG 1XMOQ 3CMAA 1GKHA 2GVAA 1GHJA 2JA6G 4O2DA 2F0LA 4JBJA 2PYKA 3S2DB 5C5LA 4KJNA 4DAMA 2A6HD 5FOBB 2HUGA 2K4KA 1XPRA 4WJ3M 4K5XA 4LFCQ 2EVBA 1TWFB 3L7ZC 3MC0B 4WRDA 4A3EH 3KDFB 3S14B 1Y1WB 1PYBA 3OYYA 1C0AA 3V96A 3IFTA 1EEFD 4X3UA 1LYLA 1VQBA 1EZ8A 1I50B 2D9UA 3S14H 3NUCA 5M5YB 4QUFA 3MFYA 4HIMA 3T4AC 4BA2I 3BVZA 1CFMA 1WI5A 2BH8A 4QIWB 4X66Q 1S5DD 3C1EA 3J81L 5CMDA 1N32L 1R4QB 3G4SA 1TY0A 4YCWA 2F0IA 3HFZB 3PUZA 1WTXA 1X9NA 1K8AC 2KENA 3MZ5A 3CD6A 2ENBA 2CQOA 4MHEA 1SMYC 2ICIA 3A7LA 4LF4Q 3VYSA 3F2UA 4QQBX 2QF7A 2V1CC 3PIPA 1DD2A 1YBYA 1HZCA 2AQ1B 4JI0Q 3TZUA 1HA5A 3MFGA 1RD9D 1HR0L 4DA2A 5C3EH 4R4TA 1MHWC 3DWQA 3GO5A 1J5EQ 2JA7G 4KY7A 1FVIA 2RDHA 3R93A 3EQLC 2FMCA 1JWSD 5CV7A 1RHPA 2HHHL 1KABA 2BCOA 3KLWA 2X6GA 4TSSA 4DUYL 4H44C 3U9SA 5L37A 1BNZA 4LF5Q 1CHQD 3G48A 4ME3A 5JJKA 1PRTD 4DNIA 1UE5A 4PZ7A 2PMZB 2WB1B 1XXGA 3PV0A 1JMCA 4HSPA 2ZT9C 5E4WC 1STHA 3PUXA 3J7AF 1BCPD 4NMZA 2B2UC 2KHIA 2RF4A 3EBEA 5LMUL 1YNJD 4PZ6A 1MKHA 1AEXA 1STGA 1CZWA 2JEAI 2Y0SG 1DCZA 1L0YB 2LXKA 5CORA 5BR8L 1BKBA 1YNJC 3K5OA 4G57A 3VA5A 3K7AH 5LMUQ 3EIVA 4IPGA 1QB5D 1GUWA 3U4ZA 1EU4A 3V2TA 1SNDA 4G7HC 1J6QA 4K2LA 3FKIG 2EIFA 2PQAA 2HIVA 3R2TA 1O78A 3GTPB 1B50A 1BCPB 5D65A 1SN8A 3IFDA 3STBC 4GKKQ 2C5CA 1TWGH 4DK3C 1HPCA 4K6LA 5ELEA 1KAWA 4DV3L 4BY1B 4ID6A 3A8JE 5EBCA 4C1NK 1S5FD 4JI4L 3HEJA 3X3NA 1XPOA 3GTPH 4CDDC 2L12A 5M5XB 3A0JA 1K3RA 1VQ6A 2N78A 3MXGA 4OX9Q 4K0KL 1N36L 4A3BG 1M1KC 5FO7B 4DV3Q 4F8MA 3HRZC 3CRKC 4LUVA 2Q8TA 1SRUA 2E5LL 4A3CH 1G6PA 3DHQA 2Z6BA 2EYHA 2LKVA 2F0KA 4H7BA 3UDGA 3HOVH 2JA6B 4B9WA 4L6TB 3CCUA 1RJTA 1GO3E 2DNEA 3DEOA 1RKNA 2NVQH 2RDGA 3OOCA 1JWUD 5M5WH 4IO9A 4E6IA 3C1FA 1BXTA 2J0TD 3PF4A 4DKAC 5LL6S 1I5FA 3J80L 4XQJA 4UAIA 2I5LX 1HHVA 2XRQD 5I6YA 1KDAA 1G2SA 1PYWD 1ASYA 1B53A 2QDLA 3GTOB 3AB9A 2PI2E 1O7LA 5EPLA 5D14A 4M1UB 2WAQG 4DK6C 2ATWA 2JSOA 1YJ9A 4BA1I 3ONAB 5JPNC 3J7ZC 1QILA 4ME5A 5I4DA 1WCMG 2B2YA 4DR3L 1HNZQ 3FEWX 1PXUA 2EQSA 2MNAA 3CCLA 4QCLA 1EY0A 3K0XA 4QIWE 2MGSA 4U673 4KHZA 2KCCA 4OEMB 3U9OA 4YWMA 3GQBA 1K0RA 2JEBI 2F0VA 2VL6A 2HQEA 4DR3Q 4LF6L 4LF9Q 4IN3A 4B3TL 3NTIA 4ZAIA 4KY6A 3H0GG 4DR2L 2K28A 1IYUA 2H4OA 1QCBD 5I9PA 1KIXA 2QW7A 4XQQA 4UPAA 5EGTA 1HFGA 5T1GA 3GD7A 4B3TQ 1E2WA 3D4RA 2F0EA 1EY7A 4YY3L 4DR2Q 1K83B 3UE0A 5FLXL 2KHJA 3A56A 2NN6G 1PH4A 4QY7A 3W1GA 4DAYA 1I4QA 2BA1A 2KCNA 5EJWA 4B3RL 2E76C 3EVQA 5C0XI 4QGUA 1JJCB 1S3OA 4LF8L 1MSGA 4FF4A 3CAMA 3QB3A 4DV0Q 1HXYD 5AJ3L 4FF1A 2Z4IA 4HTHA 1HZBA 1SYBA 1V9PA 5JEAJ 3I91A 4O1NA 1K83H 3K58A 2JA8H 5EPKA 3ERSX 4B3RQ 4MNOA 4P72A 4XXEA 4K14A 4POFA 4LF8Q 1O7ZA 1XTCD 2F0MA 2YYZA 1TS5A 3KYHC 1I94L 5AJ3Q 2A69D 4RGNA 4JI3L 5LMNW 3T53B 2C9OA 2IHEA 1QNKA 2PMZE 2R93G 3T1HQ 4DR5Q 1X3EA 3W5OA 1SJED 5LHY1 2WV6D 1HNXL 4X6AH 4P2CB 1ILQA 4P73A 2FINB 2NN6I 4K8IA 1SYGA 3CKIB 2R7DA 1IBML 2GVBA 5C3XA 1EU3A 5HY6A 3KF8A 4OELB 5CV9A 2Y0SB 5C4XB 5K5PA 1LABA 1QUQA 1X6OA 3VYRA 1YVCA 3KLRA 4F7XA 3P20A 1ZXTA 1EOTA 3DM1A 3A8KE 4EQNA 2EY2A 1K3BC 2Q2UA 4JCVE 5A35A 2HT1A 3GTLB 1A3UA 2ICEC 3FKIB 4ZRZA 5C4XH 1VMCA 3HGBA 1QJOA 2HCIA 4J15A 1EIGA 1OO9B 1PH8A 2WIIB 2IHFA 3PO3G 1X3GA 2LFNA 5H1SE 4DAVA 2ASBA 4BBSG 3GTLH 5ISRA 4IFDG 1EUJA 5IT9L 5C0XJ 3H3VH 3I73A 1G91A 5IP7G 4A3KH 1RIPA 5J39A 3MEHA 3LX0A 3V05A 2ALYB 4A3BB 1LTBD 2EJMA 3HOZH 4GNXA 4A3JG 2DUDA 2IT1A 2F1MA 4TKOB 1CKMA 3AYHB 2B2VC 2LSSA 5BN5A 4X64Q 4GLVB 2EE1A 4HIDA 4BBRG 1P8LA 4LWCA 1VQHA 2RDFA 1U0LA 1IBKQ 4BY7H 3BDOA 5KYIA 2YU9B 3D31A 2OQKA 2UUCL 2CCZA 1QVCA 2QA4A 1CM9A 1STEA 2E2JB 4UP9A 2KA7A 1I4XA 2NWGA 2VUMH 3TSSA 3RZOB 3DEPA 1Y1VG 3PGZA 1GUOA 4IFDI 2F0GA 4DU9A 1F2ZA 3QG1A 1YJNA 1SFOB 3A5UA 1JB7A 2A19A 2UUCQ 1FNUA 2CVRA 2O2LD 5M3FG 3K80C 1MJCA 1NR4A 5GAEC 1O7YA 3M3YH 1V43A 2E2JH 3RN2A 4KD3A 3N6RA 1NAPA 2N55A 4LFAQ 4FF2A 3AEVA 2BDNA 1VQEA 2AQ2B 3I4MG 2LXJA 1SFOH 3PMFA 1W2BA 3PIP3 4PMCA 1VQOA 2RCNA 5JPMC 1C4QA 4QMGA 3DM3A 3W1BA 4DFAA 1E22A 3MA2B 2IJ0A 5FLMH 3FDTA 4R4IA 2A73B 1PH6A 3AU7A 5FO8B 2NUCA 5J22A 2O4XA 5BN3A 2DY7A 2K6AA 1SAPA 1F9SA 2NZHA 1MBYA 1PTOB 2G5DA 1D1IA 4DV5Q 4MIUA 4KKUA 2E2HH 5IYBG 3MVVA 3M4QA 2JJQA 3Q23A 1HCZA 4IUVA 4DAYB 3BYTB 2QCPX 1S5ED 3K8AA 1LT4D 1VQ4A 1PVOA 4EGVA 1LT3D 3AQQA 4HJ9A 2RSOA 3HOXH 3PO2B 2AUJD 1N34Q 1QG7A 5BN4A 1SNQA 1WTWA 3VYTA 5FO9B 3GTJB 1TWAB 4QUCA 3P7JA 1L0XB 5KRUA 3S1RB 1KTKA 2CQAA 2ZM6Q 2I0QA 2UUAL 1YNND 2R93B 1RCVD 3PO2H 2PW5A 2I07B 1QVGA 1TXYA 5TSSA 4XQNA 2PCFB 2VB2X 1KLGD 4JI8L 3GTJH 1BO0A 1TWAH 2KQ3A 4AYBG 1X54A 1S40A 2KVMA 3S1RH 1EY9A 2L0CA 2Y0SE 3WOFA 4JOIA 2VNUD 1WYDA 4DNTB 5C44G 2IY5B 1R4PB 2PZWA 3KF8B 1SNMA 4AQYL 3KLSA 2EXDA 1LTID 1QUQB 1X3PA 4B9XA 2EYLA 4YIJA 3GTKB 2JA9A 4O0AA 5D3DA 2F3WA 1L2FA 1YI2A 3SEBA 3TEHB 1STBA 4AQYQ 4KV6A 3J81i 1SR3A 4K2KA 4DNRB 1FNWA 1N8RC 1UUPA 5CR3A 5CV5A 5CC4A 4A93B 3T56B 3VR4A 1ILPA 3GTKH 4KHPQ 4RHRA 4A3IH 1RL2A 5T1IA 4A3FG 2LY7A 2NBFA 1JICA 5IWAQ 1FR3A 4DR4L 2Q8RE 4NPSA 4IUTA 1H9SB 4EQOA 2R92G 1A3VA 2B2UA 4IALA 4LNQA 4A93H 1I3QH 3NSWA 1M4VA 3CQZB 2B2WC 2DY8A 2XRSD 5ELOA 4DR4Q 2WACA 5EAYA 4GNXB 3A8IE 2JA5H 4RKLA 3EFXD 5IGBA 1IL8A 1XMOL 2HDMA 3S16B 2KEEA 4ZUIA 3JAME 1XMQL 1H9RA 1Y8PB 4CJ0B 1WJJA 1VF7A 1SYFA 3CC4A 5JJIA 1T9HA 4J1MA 4Q0FA 4LFCL 1YHAA 3CHBD 4KD4A 2I5HA 3RNUA 2KOLA 1KNEA 3D3RA 1E7ZA 3I4NG 1XMQQ 4QF4A 5CV4A 1LTSD 2UXCQ 2WAQE 2ZXPA 5FJ8H 4X3KA 4N9TA 5M3FB 3KJPA 3SR1A 5M3MG 1LT5D 3JAMi 2PNHA 2A6HC 4LFBL 1Y8NB 5J1ZA 3I4MB 3S2DH 3HP3A 4GN4B 3NWSA 4CJ1B 1S4ZA 1IKMA 2R6GA 4ALPA 1SDFA 1EIHA 4X66L 1TWFH 3RD4A 2JXMB 4GOPA 4LFBQ 3HOYG 1Y1WH 1EWHA 1OXVA 1CK1A 2DN8A 3H15A 3MXPA 4JYAL 4KY5A 3JC66 1HR0W 5CBAE 4A3DG 4LF4L 1EFWA 1GVPA 1D7QA 3S15B 2FJ2A 3GV6A 2AUKA 1I50H 4IJLA 1HH2P 1OTCA 4JYAQ 1ET9A 3WOEA 3CC7A 4JI0L 2N8NA 5M5YH 2CW0D 1A62A 4DUZQ 3GTMB 2QDBA 2NZOA 3S15H 5FK9C 4KHVA 1ZYRD 1PFSA 2HD3A 1D1KA 1J5EL 1NCVA 1VQPA 3HG9A 2A8VA 3DUZA 2Z8LA 1SE8A 1VQLA 2HQLA 2XVSA 3F1ZA 4DV6Q 5IOCA 3QJYA 4FNFA 1D5ZC 2EJFC 3FPPA 4IUNA 2C35B 1P16A 4LF5L 1KDBA 1LTRD 1PH2A 2Z1CA 3HZXA 1MD2D 3NK9A 2FHTA 2JK8A 1WOCA 2Z6KC 4Z9CB 2K5QA 3SGIA 3E5SA 5GROA 3ERQA 4JBMA 4AYBB 3KLSX 4PG3A 2ZXRA 4R9WA 2A6ED 1ICWA 4L5TA 5C44B 4POGA 4DR7Q 1PYSB 2B39A 3RR5A 2L11A 1CUKA 2V4DA 2JE6I 1PRTC 5KIXA 1IYJB 4DV4L 2ZTEA 2Q2IA 4CKEA 3NTHA 3MXNA 1NNXA 1BCPC 1FYCA 2XGTA 3SK8A 5CGKA 1Q7YC 1Q86C 4ULLA 4OWTB 1N9WA 1D5XC 2WP8J 4GKKL 4DV4Q 3EROA 1GUNA 3CXCA 1UE6A 4RMFA 5IYCG 2L55A 4OWXB 2IPKD 1PRTF 1NSNS 1X3QA 3NELA 3NQTA 1Y14B 2B63B 5HGQA 1IBLQ 2R92B 4DV1L 2F0OA 2L9HA 2CWPA 5JEAG 5M9OA 3IAYA 4OX9L 4FVMA 3KK7A 1KXLA 1FGUA 4OL7A 1Y8OB 2UXDQ 3NEMA 5DAUA 3H94A 3D6CA 1IHZA 2AHOB 4R1JA 4S3SA 1AE2A 2D0PA 1PV4A 1HJPA 1SYEA 4ZQ3A 2Q8IB 4DV1Q 1BVSA 4GZYC 4A3MG 1I4HA 1STYA 5KNDA 1EYGA 2B63H 3NP8A 2ZJPA 3ND8A 2BOSA 1KD1C 4GS3A 1X32A 1RTNA 1FL0A 4C56C 4BY1H 1NE3A 4IOCA 4RCOA 5E7NA 3SXHA 1TS3A 1F2YA 5DM63 4ZCKA 2BE5D 1HUNA 4PNYA 5M5XH 4OGQC 3Q8DA 1SE3A 3I4NB 2LMCB 3PUYA 2K04A 2BDOA 1Z7TA 4FXDA 2M9VA 2A1AA 3HS0C 5K36H 1CA5A 4KN4C 1AN8A 3ULJA 5ELBA 2OTJA 4KN7C 3T16A 5IYDH 3CU7A 5M3MB 1PH3A 3BDCA 3S1NB 4I7AA 3K57A 1H95A 4HN7A 2SDFA 4KI0A 1QOHA 2X69A 4C3JG 2JA6H 1HNZL 2BH2A 2PZUA 4F87A 3DWAA 1XNRQ 4Y52H 1J8IA 1D8LA 3FVQA 5ELCA 5IT9E 5FKAC 3S1NH 3OMCA 1DOLA 4GOPB 4LF9L 1DZ1A 1Q1BA 3H6MA 4YHHL 1BF4A 5C0XG 3TN2A 3GTOH 3TP5A 2DNCA 1A6XA 3PQIA 5IP9G 1KHIA 1O80A 4PMWA 1XNQQ 4NKLA 3S1QB 2O5IC 4YHHQ 2VB3X 4MTNA 4OO1G 1IW7D 3CW2C 5COYA 4XDXA 4A3GG 2ZTCA 1N33L 1X55A 2FXQA 4RHSA 4TRDA 3X3MA 2R7FA 2LS01 1I6HB 1IW7C 4X65Q 1KL9A 3D8GA 3R2IA 3M85A 3BJUA 4BWGB 4JI5Q 2MHVA 5AFWA 4DV0L 1N33Q 4FYDA 1R9TB 3ZJYC 3EJIA 3RN5A 1SE4A 4ZUJA 3JAMc 2XNAC 4DN4M 2MUYA 2IL8A 1GUTA 1YJWA 2JA7B 1I6HH 4HAEA 2AWNA 2NB0A 4LUOA 5NUCA 1VQIA 3U4VA 3E6ZX 2KHSA 1I4GA 4NB3A 1CTMA 5E1FA 3T1HL 3S17B 1UAPA 4DR5L 5I2YA 1F9QA 1U4PA 3OIQA 4HJAA 3ICEA 1T5EA 3IKJA 4OO1I 5IGFA 3HOUG 2E2IB 4BXXG 4AYBE 5HURA 1JT8A 4I7ZC 3OWFA 4CBVA 2MQHA 1JJ2A 2JA7H 2FFKB 4L5QA 4HSVA 2CH4W 1LACA 2H5XA 2A69C 3I70A 4B08A 2P5ZX 4DAPA 1DOMA 3DXJC 2K7VA 4V0BA 1B3AA 2E2IH 1F77A 3H09A 4ILWA 2D2CC 3I55A 3A74A 1PH1A 2EYJA 2WFWA 2K01A 1QNUA 1KRSA 1Q3LA 2K5WA 3K5MA 3H3VC 3D0FA 1F9RA 3MXNB 3BZDB 1RF2D 3VR5A 1BBUA 1RODA 3GP7A 1OXSC 3F8TA 1EIYB 1CSQA 4CKBA 3OIPA 2PQAB 3AFQA 2UU9Q 3K7UC 1CT1D 4JI7Q 3C3LA 3VDYA 1BR9A 1L1OA 4C3HG 4I65A 3TP8A 1X3FA 3FKIH 3K59A 3LNNA 1QZGA 3GTQB 1SXTA 4QJFA 2JQOA 4X64L 4A3MB 2F03A 3ZYYX 4HJ5A 1KLUD 2K5VA 3FPUB 4P71A 2L1BA 4IJHA 3GTGB 1SNOA 1IBKL 1JWMD 3KFUA 5LMNQ 2CFMA 3TBIB 1BOSA 1LLRD 1Q46A 4L8JA 4B3SQ 4IQZA 2MFIA 1BBWA 3HOWG 4O42A 2YTYA 4G7ZC 4YCVA 3FRPB 4CDEC 1Q81C 4A3BH 3K6OA 2EOTA 3GTGH 4IUUA 3T13A 1EY8A 4A3LG 2F0WA 4NP5A 2F0FA 1HFNA 3VR3A 4DK0A 1A8VA 4HMIA 3TREA 4JI6Q 3FP9A 1QE6A 4C3JB 2F0PA 4X62Q 4LFAL 2B2YC 1EZ6A 1STAA 5DNFA 1E2VA 2CH4A 5J3BA 1RTOA 2YU9H 2WAQB 5EKKA 1D2BA 2NTSA 3I8ZA 1L0WA 2EY5A 5A2QE 1DJRD 3CCVA 4JV5Q 4A3EG 3RZOH 1E24A 1G2TA 3M4YA 1WCMB 2YTVA 2Q2TA 2NYZD 4DV2Q 4IOAA 3J7YW 1PTOD 1S5CD 1YIJA 1ICFB 1EQQA 4WJWA 2KEDA 3K81C 1SROA 5G3LD 2CWAA 1B8AA 2GN5A 1C7YA 2VQEQ 3BVMA 2J7ZA 3TS0A 3L3OC 1WCMH 3CCQA 1DONA 2TSSA 4IURA 4OWWB 1HRJA 3KBGA 3H0GB 3OTOQ 4DV5L 4CGYB 2IX1A 1W3SA 2OTLA 4A3GB 4N9PA 3NBHA 1VQ7A 3MAQA 2RCFA 4RKBA 4PZ8A 2L4NA 1V1PA 2K52A 1YHQA 2B2TC 1H9MA 1S72A 3SDZA 3RZDB 2Z4HA 4P75A 3TMEA 3I72A 2F0UA 3SE0A 1FNVA 3H0GH 1N34L 3O13A 2M00A 1VQAA 1UE7A 1U5KA 3F2DA 4PMBA 1EWCA 1B4OA 1PA6A 4HCEA 1TS2A 4U68A 3HKSA 3A55A 1HTPA 1PTOH 5JOBA 1JOKA 2ZM6L 3RLOA 3RZDH 4KKSA 3K5LA 1QWYA 1SSOA 4JW0A 4X3TA 2OEOA 2XIWA 4G4KA 2NN6H 2QILA 5IE8A 5C3EG 3HOUB 2A68D 2B8FA 1HQMC 5GAHC 3I90A 4J8QA 3UE1A 1B44D 4DXGA 2RBMA 1NJIC 5HGTA 1BQQT 4F88A 1VQ9A 1MGSA 3Q0AA 4KMUC 2XWBB 1YNNC 3G6EA 3J81E 1NMFA 3OWEB 3QOLA 4UHVA 3C46A 3MTSA 2F4IA 2K5NA 3BZKA 3ER0A 3T1YQ 2YTXA 2DJFC 2N88A 4HJ7A 3S1MB 2R93H 4Q5VA 2NVYB 1PZKD 1KC8C 4H13C 3I2ZA 2RKSA 1VQKA 3CP0A 3RLNA 4IPCA 3CPWA 4JI2L 1U4RA 3CCJA 1EQRA 3I3CA 2H1EA 3K0YA 1NY4A 2IX0A 4IPHA 4KHPL 2OXPA 2HDLA 3S1MH 2K33A 3NHHA 2RSNA 2Z6KA 2WB1G 1DM0B 4JI2Q 5IWAL 3MEFA 2EDGA 3PO3B 4LMQD 2F4VL 1TWHB 4C1NI 3M4PA 2GA4B 5C3WA 4BBSB 2E75C 1AZPA 3PIOA 2NTTA 4GNXC 2QGQA 1L1OB 4KK7A 5IODA 1AP0A 1CZGA 2IWHA 2F4VQ 2PQEA 2EY1A 3M4OB 1QVFA 3PO3H 4LAAA 4DR6Q 4A3JB 1EY5A 1ENCA 5C5MA 3LWUA 1WD1A 1TU2B 4BBSH 1B9NA 1LTGD 2Z0SA 4IFDH 3HKZG 3M7GA 4GLXA 2NVTB 4BBRB 5IP7H 1VQNA 4DV7Q 3HOWB 4K5WA 1G6ZA 1EYCA 1S5BD 3P1HA 4QB4A 4A3JH 1KNAA 1F9PA 4OONA 3CQZH 2UXCL 1KQSA 4A3CG 4M8AA 1Y1VB 1H9JA 2NVTH 4BBRH 3H91A 3S16H 4N8X1 2EXZA 3HOVG 2VY3A 4R4OA 5DM73 5C4JB 3BS1A 3PF5A 5GQOA 3Q22A 2ES2A 3IL8A 1LTLA 2JN4A 3DWPA 2VQFQ 1HNWQ 3NBIA 5IGGA 1LM0A 5F2DA 1Y1VH 1W6KA 4LW1A 4YWKA 4CJ2C 1FGBD 4LJZC 1J9OA 1CQFA 1MSHA 2KECA 4JBWA 1Z6HA 5C4JH 1GD7A 1XYIA 2KUMA 1PFBA 2VS1A 5M3FH 2VZAA 3M7NA 3NENA 2MPMA 2OQ0A 4LF7Q 2NVXB 2UUBL 2EPBA 4RGMA
chains in the Genus database with same CATH topology
4RG1A 1XJVA 3I7FA 1FL0A 1YVCA 4BY1H 1NE3A 3T1YL 4IOCA 3I4MH 4NXMQ 2D0OA 5E7NA 1OXUA 2UUBQ 4DUZL 5M5XH 2Q2UA 3Q8DA 3PUYA 4JCVE 3NBHB 3KOJA 2NVXH 1YHBA 2HT1A 2N49A 2A1AA 3HOUH 1YZ6A 4BXXH 5C4XH 4IFDJ 3ULJA 1PH9A 3LGJA 2OTJA 1AH9A 1CKOA 4J15A 1PH8A 4HIKA 5IYDH 2IHFA 2Q2HA 3PO3G 5IT9c 1PH3A 1VQDA 1E1OA 1B7YB 1X3GA 4GKJL 1H95A 4DV6L 5H1SE 4KI0A 2ASBA 2JA6H 3GTLH 4BBSG 1HNZL 2BH2A 4IFDG 1EUJA 5C0XJ 1UE1A 3H3VH 5IP7G 2UUAQ 4A3KH 1XNRQ 4Y52H 2CKZB 2YV5A 1RIPA 1D8LA 1L1OC 4GKJQ 5IYBH 3TQYA 3E0EA 1QZHA 4A75A 3GTMH 2NVYH 1N32Q 2ALYB 3DLLA 3S1NH 3HOZH 3KF6A 4GNXA 3CF5A 4A3JG 2DUDA 4GOPB 4LF9L 4Y7NH 3WWVA 1Q1BA 2R7ZH 2IT1A 5IY0A 5ELNA 4YHHL 4TQUS 1CKMA 4EX5A 4JI8Q 3AYHB 5C0XG 3GTOH 2LSSA 4X64Q 4GLVB 4HIDA 2K5HA 5IP9G 4BBRG 4DR6L 4JOIC 1KHIA 4JG2A 4DR7L 1P8LA 4OXPA 4PMWA 1XNQQ 2JA8G 1G291 4LWCA 3J80i 1VQHA 4KLKA 1WFQA 1U0LA 1IBKQ 4YHHQ 4BY7H 4A76A 4MTNA 4OO1G 3D31A 2OQKA 3CW2C 3L0OA 4QL5A 2UUCL 4TVAB 2CCZA 4DV7L 1QVCA 2QA4A 4GN5A 4A3GG 1TWHH 2ZTCA 4UP9A 2VUMH 1N33L 2F3IA 1X55A 1Y1VG 2FXQA 4H02A 4C3HH 1HR0Q 3PGZA 2R7FA 3CCEA 1MJEA 4IFDI 4X65Q 1HZAA 1Q82C 4EQ5A 1K73C 1KL9A 3M85A 1G51A 1A0IA 3BJUA 1YJNA 3A5UA 2ZTDA 1JB7A 2A19A 2VW9A 3AFPA 2UUCQ 4DV0L 2B3GA 4JI5Q 1UWVA 1VQ8A 5M3FG 1M90C 1K9MC 3K80C 2B63G 1MJCA 1N33Q 5GAEC 3M4OH 3M3YH 1V43A 2E2JH 3RN2A 3S24A 3ZJYC 3G71A 5C44H 2AMCB 3E9HA 2HHHQ 3RN5A 3JAMc 3F2BA 3CCRA 1YJWA 1YNXA 1I6HH 4LFAQ 2AWNA 3AEVA 1VQEA 4BY1G 3I4MG 2LXJA 1IBLL 4LUOA 1SFOH 1Z9FA 1W2BA 1VQIA 3U4VA 2VQFL 1HNWL 3UDXA 4NB3A 4DUYQ 2RCNA 3HOWH 1IL2A 3T1HL 4DR5L 2MO0A 4JI1L 2K50A 1JJGA 4HJAA 3ICEA 3U50C 2UXDL 4OO1I 3ULPA 1NMGA 3HOUG 3F2CA 3DM3A 3W1BA 5K36G 1VQ5A 4BXXG 4AYBE 1E22A 5C4XG 3FHWA 4R4QA 5FLMH 4WJ4A 1JT8A 1SMXA 4GN3B 4R4IA 2MQHA 1PH6A 1JJ2A 2JA7H 4AH6A 4A3LH 4C2MH 2I5MX 4L5QA 3OW2A 3U58A 1DGSA 4LF7L 5IYDG 3I56A 3CMAA 1XMOQ 1GKHA 2GVAA 4JI1Q 2H5XA 3STBD 2NZHA 4YCUA 2JA6G 4A3FH 4O2DA 4JBJA 5BR8Q 3PCOB 2E2IH 4DAMA 4DV5Q 3M9BA 2R92H 2K4KA 1XPRA 2E2HH 4WJ3M 4A3KG 4LFCQ 1VQMA 3I55A 3A74A 3L7ZC 1PH1A 4XIGS 2WFWA 5IYBG 1VQJA 4A3EH 3KDFB 3M4QA 1KRSA 3D0FA 3HOZG 1PYBA 2JJQA 3MXNB 1VS0A 4JBKA 3OYYA 2ZJQA 4DAYB 4UP7A 3K8AA 1VQ4A 1PVOA 4HJ9A 3AQQA 2AKWB 1VQCA 1C0AA 3HOXH 1BBUA 1N34Q 1LYLA 1VQBA 1OXSC 4HJ8A 3F8TA 1EIYB 1V1QA 1CSQA 3S14H 3J81c 4BY7G 2PQAB 3AFQA 1XTDA 1OXXK 2D62A 4HIMA 2UU9Q 3K7UC 2ZM6Q 2I0QA 2UUAL 4JI4Q 4JI7Q 4BA2I 1XNRL 1WI5A 2BH8A 3VDYA 2VUMG 1L1OA 1OXTA 4X66Q 4GOPC 3PO2H 1N32L 3A5ZB 3I4NH 3G4SA 1X3FA 1QVGA 4K0KQ 3FKIH 1N36Q 1TXYA 2E8GA 4YCWA 1QZGA 3H3VI 4JI8L 1VQGA 4QJFA 3GTJH 1TWAH 2JQOA 3HFZB 3PUZA 1X54A 4AYBG 4X64L 1X9NA 1S40A 2KENA 1K8AC 2E5LQ 3CD6A 1LUZA 2CQOA 3S1RH 4HJ5A 4FDBA 1E3PA 4LF4Q 2Y0SE 5M3MH 2K5VA 1NTGA 1XNQL 4JOIA 3CCSA 4P71A 2VNUD 1WYDA 2K75A 5C44G 2F52A 3PSIA 2V1CC 4IJHA 4QQBX 2IY5B 3PIPA 1IBKL 3KFUA 3KF8B 5LMNQ 4AQYL 1ASZA 2CFMA 1PH7A 3TRZA 2UXBQ 1YBYA 2EXDA 4R4CA 1Q46A 4B3SQ 1HZCA 4JI0Q 1QUQB 2MFIA 2KCTA 2B29A 1BBWA 2JA9A 4O0AA 3HOWG 4HIOA 1HR0L 1C9OA 1L2FA 2YTYA 1YI2A 4YCVA 5C3EH 4X65L 3TEHB 1Q81C 3HOYH 2K14A 4P74A 4A3BH 4AQYQ 4R4TA 3J81i 5FLMG 2KBNA 1SR3A 4JI5L 3GTGH 1AE3A 3BZCA 3GO5A 1J5EQ 2JA7G 4A3LG 1N8RC 1FVIA 4A3DH 1EIFA 1MIUA 1A8VA 3GTKH 4YWLA 3TREA 4JI6Q 4KHPQ 2HHHL 3FP9A 4A3IH 1RL2A 5DLQE 4X62Q 3KLWA 4A3FG 4LFAL 3S1QH 1EWIA 1CKNA 5J3BA 5IWAQ 5GADC 2YU9H 4DR4L 4NPSA 1L0WA 4JC0A 1TWCH 2R92G 4DUYL 3CCVA 4LF5Q 4JV5Q 4LNQA 3G48A 4A3EG 3RZOH 4ME3A 5JJKA 4DNIA 3CC2A 1E24A 1I3QH 1UE5A 4PZ7A 4A93H 2YTVA 2Q2TA 3PV0A 4C3IH 4DV2Q 1JMCA 4IOAA 5GAGC 3PUXA 5ELOA 4A4IA 1YIJA 1EQQA 4LF6Q 4DR4Q 5EAYA 3KF6B 4GNXB 3S2HH 2JA5H 3K81C 1KRTA 2KHIA 1SROA 2RF4A 3EBEA 3HOXG 3PUWA 5LMUL 4DR1L 1XMOL 2CWAA 1B8AA 1MKHA 2GN5A 4PZ6A 1R9TH 1C7YA 1K8GA 2JEAI 2VQEQ 2Y0SG 1XMQL 3TS0A 4GLAC 1WJJA 2ID0A 1WCMH 2LXKA 1BKBA 5BR8L 3J81j 3CCQA 4OWWB 4XTCS 3CC4A 5JJIA 3OTOQ 4DV5L 1T9HA 2IX1A 1W3SA 2OTLA 3K7AH 4LFCL 1YHAA 5LMUQ 3EIVA 4YY3Q 4IPGA 4DR1Q 4L5RC 2I5HA 1VQ7A 3RNUA 1E7ZA 3PO2G 4PZ8A 3S17H 2K52A 3U4ZA 3I4NG 1XMQQ 2BA0A 1J6QA 1YHQA 3FKIG 2EIFA 4DPGA 2PQAA 2RHQB 1S72A 2HIVA 1NBWA 5JJLA 2UXCQ 1B70B 1SN8A 2WAQE 4P75A 3STBC 5FJ8H 4GKKQ 3KJPA 3H0GH 1N34L 1TWGH 4DK3C 5M3MG 1EOVA 3JAMi 1VQAA 1UE7A 1U5KA 3F2DA 2OWOA 2WB1E 2PNHA 4LFBL 1PA6A 3PUVA 1KAWA 2R7ZG 1YITA 4DV3L 3HKSA 2UU9L 1I94Q 3S2DH 4GN4B 2ZM6L 1Q1EA 3RLOA 3RZDH 1XPOA 1PHJA 4JI4L 4JI7L 3GTPH 3A0JA 2R6GA 4ALPA 4JI3Q 1K3RA 4X66L 1TWFH 1VQ6A 2XTIA 2N78A 4GOPA 5IE8A 4OX9Q 5C3EG 2KCMA 4LFBQ 4K0KL 4AIMA 1N36L 2L15A 3HOYG 4A3BG 1Y1WH 3I4OA 1OXVA 1M1KC 5GAHC 4DV3Q 3H15A 4JYAL 4APVA 2OCEA 3JC66 4LUVA 3UE1A 1HR0W 1SRUA 1HNXQ 2E5LL 3TS2A 4A3CH 3L2PA 1G6PA 1NJIC 4A3DG 4LF4L 1EFWA 1VQ9A 1GVPA 1D7QA 1IBMQ 5IYCH 3UDGA 3J7A5 3UDFA 3HOVH 4A3IG 1I50H 4GS3A 3HKZE 1JE5A 4IJLA 1HH2P 3G6EA 3CCUA 5LMNL 1NMFA 3J80c 1OTCA 1GO3E 3UDIA 4JYAQ 3CC7A 4B3SL 2NVQH 4JI0L 2K5NA 3BZKA 3ER0A 2N8NA 5M5YH 2YTXA 3T1YQ 5M5WH 4IO9A 1HZ9A 1A62A 4HJ7A 2N3SA 1A63A 3PF4A 4DUZQ 2R93H 4DKAC 1YEZA 1I5FA 1KC8C 4A93G 3I2ZA 2NZOA 3S15H 1VQKA 2I5LX 3CP0A 3BU2A 1Q12A 3RLNA 4IPCA 1PFSA 1ASYA 3GTQH 3CPWA 1X56A 1Z47A 4B3ML 4JI2L 3CCJA 1J5EL 2UXBL 1EQRA 2PI2E 1VQPA 4A3MH 2JA5G 2AWOA 2A8VA 1SE8A 3ULLA 1NY4A 2WAQG 3B6YA 4DK6C 2IX0A 1VQLA 2ATWA 4UP8A 4IPHA 4JI6L 2HQLA 1YJ9A 4KHPL 3F1ZA 4BA1I 3S1MH 4DV6Q 4UY8C 4X62L 3J7ZC 2Z6KA 3EN2A 1WCMG 2WB1G 4JI2Q 5IWAL 1SLJA 4DR3L 1HNZQ 2EQSA 3MEFA 2MNAA 3CCLA 3K0XA 2C35B 4QIWE 2F4VL 1CSPA 1P16A 1GM5A 1VQFA 3M4PA 4KHZA 2DGYA 4LF5L 4JV5L 1PH2A 4YWMA 3CMEA 1K0RA 2JK8A 1WOCA 2Z6KC 2RHSB 2JEBI 3PIOA 4DV2L 4GNXC 2VL6A 3SGIA 2QGQA 1L1OB 2MO1A 4DR3Q 3IRBA 5GROA 4LF6L 4LF9Q 4JBMA 2F4VQ 5FJ8G 4PG3A 4B3TL 1UEBA 3H0GG 4DR2L 1QVFA 3PO3H 4B3MQ 2VQEL 1IZ6A 4L5TA 1KIXA 4DR6Q 4POGA 4DR7Q 1PYSB 4UPAA 5FLXc 3RR5A 4C3JH 4BBSH 1CUKA 2Z0SA 3GD7A 1E1TA 3OTOL 2JE6I 3HKZG 4GLXA 4B3TQ 4YY3L 1IYJB 5IP7H 3KDFA 4DV4L 2ZTEA 4DV7Q 4DR2Q 1VQNA 3UE0A 4NXNL 2Q2IA 4L5SA 2KHJA 2NN6G 1PH4A 4QY7A 3W1GA 2XGTA 1PH5A 1FJGL 2BA1A 4B3RL 3CPFA 4A3JH 1Y1WG 4OONA 1Q7YC 3CQZH 1Q86C 4OWTB 3RLFA 5C0XI 4QGUA 2UXCL 1JJCB 1N9WA 1S3OA 2PI2A 4LF8L 1Q8KA 1VCIA 3CAMA 2WP8J 1KQSA 4DV0Q 5AJ3L 2ZJRA 4DV4Q 1XPUA 4GKKL 4A3CG 4NXNQ 1HZBA 3CXCA 1V9PA 5IP9H 2NVTH 3GDEA 1UE6A 5JEAJ 4BBRH 4RMFA 5IYCG 1K83H 2JA8H 3S16H 1FJGQ 3ERSX 3HOVG 4MNOA 2VY3A 4P72A 4R4OA 4OWXB 4B3RQ 4IPDA 4POFA 2HIXA 3PF5A 4LF8Q 3NELA 5GQOA 1IXRA 2YYZA 1I94L 3KYHC 1Y14B 4MZ9A 5AJ3Q 2ES2A 5HGQA 1IBLQ 3CCMA 1LTLA 4DV1L 2VQFQ 4JI3L 1CKNB 4A3GH 2CWPA 5JEAG 5LMNW 1HNWQ 1LM0A 2IHEA 2PMZE 2R93G 1Y1VH 4OX9L 4LW1A 3T1HQ 4YWKA 4DR5Q 1KXLA 1FGUA 1X3EA 3W5OA 2UXDQ 3NEMA 1O7IA 2AHOB 4JBWA 4R1JA 1AE2A 5C4JH 2D0PA 2QEXA 1GD7A 1PV4A 1HNXL 1HJPA 4X6AH 4DV1Q 1BVSA 2VS1A 4P73A 4A3MG 2NN6I 4NXML 5M3FH 2VZAA 1EYGA 2B63H 3M7NA 3NENA 2OQ0A 2R7DA 2ZJPA 1IBML 2GVBA 2UUBL 4LF7Q 1X65A 5HY6A 4LUZA 3E9IA 1VQOA 1KD1C 1QUQA 1X6OA 3KJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG1 A;  1XJV A;  3I7F A;  1FL0 A;  1YVC A;  4BY1 H;  1NE3 A;  3T1Y L;  4IOC A;  3I4M H;  4NXM Q;  2D0O A;  5E7N A;  1OXU A;  2UUB Q;  4DUZ L;  5M5X H;  2Q2U A;  3Q8D A;  3PUY A;  4JCV E;  3NBH B;  3KOJ A;  2NVX H;  1YHB A;  2HT1 A;  2N49 A;  2A1A A;  3HOU H;  1YZ6 A;  4BXX H;  5C4X H;  4IFD J;  3ULJ A;  1PH9 A;  3LGJ A;  2OTJ A;  1AH9 A;  1CKO A;  4J15 A;  1PH8 A;  4HIK A;  5IYD H;  2IHF A;  2Q2H A;  3PO3 G;  5IT9 c;  1PH3 A;  1VQD A;  1E1O A;  1B7Y B;  1X3G A;  4GKJ L;  1H95 A;  4DV6 L;  5H1S E;  4KI0 A;  2ASB A;  2JA6 H;  3GTL H;  4BBS G;  1HNZ L;  2BH2 A;  4IFD G;  1EUJ A;  5C0X J;  1UE1 A;  3H3V H;  5IP7 G;  2UUA Q;  4A3K H;  1XNR Q;  4Y52 H;  2CKZ B;  2YV5 A;  1RIP A;  1D8L A;  1L1O C;  4GKJ Q;  5IYB H;  3TQY A;  3E0E A;  1QZH A;  4A75 A;  3GTM H;  2NVY H;  1N32 Q;  2ALY B;  3DLL A;  3S1N H;  3HOZ H;  3KF6 A;  4GNX A;  3CF5 A;  4A3J G;  2DUD A;  4GOP B;  4LF9 L;  4Y7N H;  3WWV A;  1Q1B A;  2R7Z H;  2IT1 A;  5IY0 A;  5ELN A;  4YHH L;  4TQU S;  1CKM A;  4EX5 A;  4JI8 Q;  3AYH B;  5C0X G;  3GTO H;  2LSS A;  4X64 Q;  4GLV B;  4HID A;  2K5H A;  5IP9 G;  4BBR G;  4DR6 L;  4JOI C;  1KHI A;  4JG2 A;  4DR7 L;  1P8L A;  4OXP A;  4PMW A;  1XNQ Q;  2JA8 G;  1G29 1;  4LWC A;  3J80 i;  1VQH A;  4KLK A;  1WFQ A;  1U0L A;  1IBK Q;  4YHH Q;  4BY7 H;  4A76 A;  4MTN A;  4OO1 G;  3D31 A;  2OQK A;  3CW2 C;  3L0O A;  4QL5 A;  2UUC L;  4TVA B;  2CCZ A;  4DV7 L;  1QVC A;  2QA4 A;  4GN5 A;  4A3G G;  1TWH H;  2ZTC A;  4UP9 A;  2VUM H;  1N33 L;  2F3I A;  1X55 A;  1Y1V G;  2FXQ A;  4H02 A;  4C3H H;  1HR0 Q;  3PGZ A;  2R7F A;  3CCE A;  1MJE A;  4IFD I;  4X65 Q;  1HZA A;  1Q82 C;  4EQ5 A;  1K73 C;  1KL9 A;  3M85 A;  1G51 A;  1A0I A;  3BJU A;  1YJN A;  3A5U A;  2ZTD A;  1JB7 A;  2A19 A;  2VW9 A;  3AFP A;  2UUC Q;  4DV0 L;  2B3G A;  4JI5 Q;  1UWV A;  1VQ8 A;  5M3F G;  1M90 C;  1K9M C;  3K80 C;  2B63 G;  1MJC A;  1N33 Q;  5GAE C;  3M4O H;  3M3Y H;  1V43 A;  2E2J H;  3RN2 A;  3S24 A;  3ZJY C;  3G71 A;  5C44 H;  2AMC B;  3E9H A;  2HHH Q;  3RN5 A;  3JAM c;  3F2B A;  3CCR A;  1YJW A;  1YNX A;  1I6H H;  4LFA Q;  2AWN A;  3AEV A;  1VQE A;  4BY1 G;  3I4M G;  2LXJ A;  1IBL L;  4LUO A;  1SFO H;  1Z9F A;  1W2B A;  1VQI A;  3U4V A;  2VQF L;  1HNW L;  3UDX A;  4NB3 A;  4DUY Q;  2RCN A;  3HOW H;  1IL2 A;  3T1H L;  4DR5 L;  2MO0 A;  4JI1 L;  2K50 A;  1JJG A;  4HJA A;  3ICE A;  3U50 C;  2UXD L;  4OO1 I;  3ULP A;  1NMG A;  3HOU G;  3F2C A;  3DM3 A;  3W1B A;  5K36 G;  1VQ5 A;  4BXX G;  4AYB E;  1E22 A;  5C4X G;  3FHW A;  4R4Q A;  5FLM H;  4WJ4 A;  1JT8 A;  1SMX A;  4GN3 B;  4R4I A;  2MQH A;  1PH6 A;  1JJ2 A;  2JA7 H;  4AH6 A;  4A3L H;  4C2M H;  2I5M X;  4L5Q A;  3OW2 A;  3U58 A;  1DGS A;  4LF7 L;  5IYD G;  3I56 A;  3CMA A;  1XMO Q;  1GKH A;  2GVA A;  4JI1 Q;  2H5X A;  3STB D;  2NZH A;  4YCU A;  2JA6 G;  4A3F H;  4O2D A;  4JBJ A;  5BR8 Q;  3PCO B;  2E2I H;  4DAM A;  4DV5 Q;  3M9B A;  2R92 H;  2K4K A;  1XPR A;  2E2H H;  4WJ3 M;  4A3K G;  4LFC Q;  1VQM A;  3I55 A;  3A74 A;  3L7Z C;  1PH1 A;  4XIG S;  2WFW A;  5IYB G;  1VQJ A;  4A3E H;  3KDF B;  3M4Q A;  1KRS A;  3D0F A;  3HOZ G;  1PYB A;  2JJQ A;  3MXN B;  1VS0 A;  4JBK A;  3OYY A;  2ZJQ A;  4DAY B;  4UP7 A;  3K8A A;  1VQ4 A;  1PVO A;  4HJ9 A;  3AQQ A;  2AKW B;  1VQC A;  1C0A A;  3HOX H;  1BBU A;  1N34 Q;  1LYL A;  1VQB A;  1OXS C;  4HJ8 A;  3F8T A;  1EIY B;  1V1Q A;  1CSQ A;  3S14 H;  3J81 c;  4BY7 G;  2PQA B;  3AFQ A;  1XTD A;  1OXX K;  2D62 A;  4HIM A;  2UU9 Q;  3K7U C;  2ZM6 Q;  2I0Q A;  2UUA L;  4JI4 Q;  4JI7 Q;  4BA2 I;  1XNR L;  1WI5 A;  2BH8 A;  3VDY A;  2VUM G;  1L1O A;  1OXT A;  4X66 Q;  4GOP C;  3PO2 H;  1N32 L;  3A5Z B;  3I4N H;  3G4S A;  1X3F A;  1QVG A;  4K0K Q;  3FKI H;  1N36 Q;  1TXY A;  2E8G A;  4YCW A;  1QZG A;  3H3V I;  4JI8 L;  1VQG A;  4QJF A;  3GTJ H;  1TWA H;  2JQO A;  3HFZ B;  3PUZ A;  1X54 A;  4AYB G;  4X64 L;  1X9N A;  1S40 A;  2KEN A;  1K8A C;  2E5L Q;  3CD6 A;  1LUZ A;  2CQO A;  3S1R H;  4HJ5 A;  4FDB A;  1E3P A;  4LF4 Q;  2Y0S E;  5M3M H;  2K5V A;  1NTG A;  1XNQ L;  4JOI A;  3CCS A;  4P71 A;  2VNU D;  1WYD A;  2K75 A;  5C44 G;  2F52 A;  3PSI A;  2V1C C;  4IJH A;  4QQB X;  2IY5 B;  3PIP A;  1IBK L;  3KFU A;  3KF8 B;  5LMN Q;  4AQY L;  1ASZ A;  2CFM A;  1PH7 A;  3TRZ A;  2UXB Q;  1YBY A;  2EXD A;  4R4C A;  1Q46 A;  4B3S Q;  1HZC A;  4JI0 Q;  1QUQ B;  2MFI A;  2KCT A;  2B29 A;  1BBW A;  2JA9 A;  4O0A A;  3HOW G;  4HIO A;  1HR0 L;  1C9O A;  1L2F A;  2YTY A;  1YI2 A;  4YCV A;  5C3E H;  4X65 L;  3TEH B;  1Q81 C;  3HOY H;  2K14 A;  4P74 A;  4A3B H;  4AQY Q;  4R4T A;  3J81 i;  5FLM G;  2KBN A;  1SR3 A;  4JI5 L;  3GTG H;  1AE3 A;  3BZC A;  3GO5 A;  1J5E Q;  2JA7 G;  4A3L G;  1N8R C;  1FVI A;  4A3D H;  1EIF A;  1MIU A;  1A8V A;  3GTK H;  4YWL A;  3TRE A;  4JI6 Q;  4KHP Q;  2HHH L;  3FP9 A;  4A3I H;  1RL2 A;  5DLQ E;  4X62 Q;  3KLW A;  4A3F G;  4LFA L;  3S1Q H;  1EWI A;  1CKN A;  5J3B A;  5IWA Q;  5GAD C;  2YU9 H;  4DR4 L;  4NPS A;  1L0W A;  4JC0 A;  1TWC H;  2R92 G;  4DUY L;  3CCV A;  4LF5 Q;  4JV5 Q;  4LNQ A;  3G48 A;  4A3E G;  3RZO H;  4ME3 A;  5JJK A;  4DNI A;  3CC2 A;  1E24 A;  1I3Q H;  1UE5 A;  4PZ7 A;  4A93 H;  2YTV A;  2Q2T A;  3PV0 A;  4C3I H;  4DV2 Q;  1JMC A;  4IOA A;  5GAG C;  3PUX A;  5ELO A;  4A4I A;  1YIJ A;  1EQQ A;  4LF6 Q;  4DR4 Q;  5EAY A;  3KF6 B;  4GNX B;  3S2H H;  2JA5 H;  3K81 C;  1KRT A;  2KHI A;  1SRO A;  2RF4 A;  3EBE A;  3HOX G;  3PUW A;  5LMU L;  4DR1 L;  1XMO L;  2CWA A;  1B8A A;  1MKH A;  2GN5 A;  4PZ6 A;  1R9T H;  1C7Y A;  1K8G A;  2JEA I;  2VQE Q;  2Y0S G;  1XMQ L;  3TS0 A;  4GLA C;  1WJJ A;  2ID0 A;  1WCM H;  2LXK A;  1BKB A;  5BR8 L;  3J81 j;  3CCQ A;  4OWW B;  4XTC S;  3CC4 A;  5JJI A;  3OTO Q;  4DV5 L;  1T9H A;  2IX1 A;  1W3S A;  2OTL A;  3K7A H;  4LFC L;  1YHA A;  5LMU Q;  3EIV A;  4YY3 Q;  4IPG A;  4DR1 Q;  4L5R C;  2I5H A;  1VQ7 A;  3RNU A;  1E7Z A;  3PO2 G;  4PZ8 A;  3S17 H;  2K52 A;  3U4Z A;  3I4N G;  1XMQ Q;  2BA0 A;  1J6Q A;  1YHQ A;  3FKI G;  2EIF A;  4DPG A;  2PQA A;  2RHQ B;  1S72 A;  2HIV A;  1NBW A;  5JJL A;  2UXC Q;  1B70 B;  1SN8 A;  2WAQ E;  4P75 A;  3STB C;  5FJ8 H;  4GKK Q;  3KJP A;  3H0G H;  1N34 L;  1TWG H;  4DK3 C;  5M3M G;  1EOV A;  3JAM i;  1VQA A;  1UE7 A;  1U5K A;  3F2D A;  2OWO A;  2WB1 E;  2PNH A;  4LFB L;  1PA6 A;  3PUV A;  1KAW A;  2R7Z G;  1YIT A;  4DV3 L;  3HKS A;  2UU9 L;  1I94 Q;  3S2D H;  4GN4 B;  2ZM6 L;  1Q1E A;  3RLO A;  3RZD H;  1XPO A;  1PHJ A;  4JI4 L;  4JI7 L;  3GTP H;  3A0J A;  2R6G A;  4ALP A;  4JI3 Q;  1K3R A;  4X66 L;  1TWF H;  1VQ6 A;  2XTI A;  2N78 A;  4GOP A;  5IE8 A;  4OX9 Q;  5C3E G;  2KCM A;  4LFB Q;  4K0K L;  4AIM A;  1N36 L;  2L15 A;  3HOY G;  4A3B G;  1Y1W H;  3I4O A;  1OXV A;  1M1K C;  5GAH C;  4DV3 Q;  3H15 A;  4JYA L;  4APV A;  2OCE A;  3JC6 6;  4LUV A;  3UE1 A;  1HR0 W;  1SRU A;  1HNX Q;  2E5L L;  3TS2 A;  4A3C H;  3L2P A;  1G6P A;  1NJI C;  4A3D G;  4LF4 L;  1EFW A;  1VQ9 A;  1GVP A;  1D7Q A;  1IBM Q;  5IYC H;  3UDG A;  3J7A 5;  3UDF A;  3HOV H;  4A3I G;  1I50 H;  4GS3 A;  3HKZ E;  1JE5 A;  4IJL A;  1HH2 P;  3G6E A;  3CCU A;  5LMN L;  1NMF A;  3J80 c;  1OTC A;  1GO3 E;  3UDI A;  4JYA Q;  3CC7 A;  4B3S L;  2NVQ H;  4JI0 L;  2K5N A;  3BZK A;  3ER0 A;  2N8N A;  5M5Y H;  2YTX A;  3T1Y Q;  5M5W H;  4IO9 A;  1HZ9 A;  1A62 A;  4HJ7 A;  2N3S A;  1A63 A;  3PF4 A;  4DUZ Q;  2R93 H;  4DKA C;  1YEZ A;  1I5F A;  1KC8 C;  4A93 G;  3I2Z A;  2NZO A;  3S15 H;  1VQK A;  2I5L X;  3CP0 A;  3BU2 A;  1Q12 A;  3RLN A;  4IPC A;  1PFS A;  1ASY A;  3GTQ H;  3CPW A;  1X56 A;  1Z47 A;  4B3M L;  4JI2 L;  3CCJ A;  1J5E L;  2UXB L;  1EQR A;  2PI2 E;  1VQP A;  4A3M H;  2JA5 G;  2AWO A;  2A8V A;  1SE8 A;  3ULL A;  1NY4 A;  2WAQ G;  3B6Y A;  4DK6 C;  2IX0 A;  1VQL A;  2ATW A;  4UP8 A;  4IPH A;  4JI6 L;  2HQL A;  1YJ9 A;  4KHP L;  3F1Z A;  4BA1 I;  3S1M H;  4DV6 Q;  4UY8 C;  4X62 L;  3J7Z C;  2Z6K A;  3EN2 A;  1WCM G;  2WB1 G;  4JI2 Q;  5IWA L;  1SLJ A;  4DR3 L;  1HNZ Q;  2EQS A;  3MEF A;  2MNA A;  3CCL A;  3K0X A;  2C35 B;  4QIW E;  2F4V L;  1CSP A;  1P16 A;  1GM5 A;  1VQF A;  3M4P A;  4KHZ A;  2DGY A;  4LF5 L;  4JV5 L;  1PH2 A;  4YWM A;  3CME A;  1K0R A;  2JK8 A;  1WOC A;  2Z6K C;  2RHS B;  2JEB I;  3PIO A;  4DV2 L;  4GNX C;  2VL6 A;  3SGI A;  2QGQ A;  1L1O B;  2MO1 A;  4DR3 Q;  3IRB A;  5GRO A;  4LF6 L;  4LF9 Q;  4JBM A;  2F4V Q;  5FJ8 G;  4PG3 A;  4B3T L;  1UEB A;  3H0G G;  4DR2 L;  1QVF A;  3PO3 H;  4B3M Q;  2VQE L;  1IZ6 A;  4L5T A;  1KIX A;  4DR6 Q;  4POG A;  4DR7 Q;  1PYS B;  4UPA A;  5FLX c;  3RR5 A;  4C3J H;  4BBS H;  1CUK A;  2Z0S A;  3GD7 A;  1E1T A;  3OTO L;  2JE6 I;  3HKZ G;  4GLX A;  4B3T Q;  4YY3 L;  1IYJ B;  5IP7 H;  3KDF A;  4DV4 L;  2ZTE A;  4DV7 Q;  4DR2 Q;  1VQN A;  3UE0 A;  4NXN L;  2Q2I A;  4L5S A;  2KHJ A;  2NN6 G;  1PH4 A;  4QY7 A;  3W1G A;  2XGT A;  1PH5 A;  1FJG L;  2BA1 A;  4B3R L;  3CPF A;  4A3J H;  1Y1W G;  4OON A;  1Q7Y C;  3CQZ H;  1Q86 C;  4OWT B;  3RLF A;  5C0X I;  4QGU A;  2UXC L;  1JJC B;  1N9W A;  1S3O A;  2PI2 A;  4LF8 L;  1Q8K A;  1VCI A;  3CAM A;  2WP8 J;  1KQS A;  4DV0 Q;  5AJ3 L;  2ZJR A;  4DV4 Q;  1XPU A;  4GKK L;  4A3C G;  4NXN Q;  1HZB A;  3CXC A;  1V9P A;  5IP9 H;  2NVT H;  3GDE A;  1UE6 A;  5JEA J;  4BBR H;  4RMF A;  5IYC G;  1K83 H;  2JA8 H;  3S16 H;  1FJG Q;  3ERS X;  3HOV G;  4MNO A;  2VY3 A;  4P72 A;  4R4O A;  4OWX B;  4B3R Q;  4IPD A;  4POF A;  2HIX A;  3PF5 A;  4LF8 Q;  3NEL A;  5GQO A;  1IXR A;  2YYZ A;  1I94 L;  3KYH C;  1Y14 B;  4MZ9 A;  5AJ3 Q;  2ES2 A;  5HGQ A;  1IBL Q;  3CCM A;  1LTL A;  4DV1 L;  2VQF Q;  4JI3 L;  1CKN B;  4A3G H;  2CWP A;  5JEA G;  5LMN W;  1HNW Q;  1LM0 A;  2IHE A;  2PMZ E;  2R93 G;  1Y1V H;  4OX9 L;  4LW1 A;  3T1H Q;  4YWK A;  4DR5 Q;  1KXL A;  1FGU A;  1X3E A;  3W5O A;  2UXD Q;  3NEM A;  1O7I A;  2AHO B;  4JBW A;  4R1J A;  1AE2 A;  5C4J H;  2D0P A;  2QEX A;  1GD7 A;  1PV4 A;  1HNX L;  1HJP A;  4X6A H;  4DV1 Q;  1BVS A;  2VS1 A;  4P73 A;  4A3M G;  2NN6 I;  4NXM L;  5M3F H;  2VZA A;  1EYG A;  2B63 H;  3M7N A;  3NEN A;  2OQ0 A;  2R7D A;  2ZJP A;  1IBM L;  2GVB A;  2UUB L;  4LF7 Q;  1X65 A;  5HY6 A;  4LUZ A;  3E9I A;  1VQO A;  1KD1 C;  1QUQ A;  1X6O A;  3KJO A; 
#chains in the Genus database with same CATH topology
 2MJ8 A;  1XJV A;  3I7F A;  1K8O A;  5I2X A;  1JR0 D;  3I4M H;  3ND9 A;  2D0O A;  2RQX A;  1EQV A;  4FXK C;  4OHJ A;  1ONL A;  2UUB Q;  4DUZ L;  5C4H A;  2F0N A;  3N52 A;  5CV8 A;  3NBH B;  4FO2 A;  3Q24 A;  1YHB A;  2NVX H;  1B1Z A;  2N49 A;  2WKC A;  1EYA A;  1YZ6 A;  1V1P B;  5IGD A;  4ZLT F;  1C8C A;  2G9D A;  4OIJ A;  1CKO A;  4RFB A;  1Q90 A;  4HIK A;  1JC7 A;  1VQD A;  1E1O A;  1B7Y B;  4GKJ L;  4C3I G;  4DV6 L;  3QO2 A;  2CW0 C;  1SMY D;  3J80 E;  2B8G A;  2WIN B;  1ESF A;  1WD0 A;  1ZYR C;  4XYQ A;  1CHP D;  4ABN A;  2QKI C;  5IYB H;  4GKJ Q;  3TQY A;  5C3E B;  1QZH A;  3GTM H;  1N32 Q;  1SYC A;  2WKD A;  3DLL A;  2EY6 A;  3KF6 A;  5IY0 A;  3S9W A;  5ELN A;  4EX5 A;  5CYU A;  5IGC A;  5I6W A;  2K5H A;  1LV9 A;  1ZKO A;  1II3 A;  4JOI C;  1SYD A;  4JG2 A;  1EL0 A;  4DR7 L;  1JQY D;  4OXP A;  4ZYS A;  2JA8 G;  3J80 i;  5KNC A;  1WFQ A;  1ESR A;  2IW3 A;  1EFI D;  1RDP D;  3L0O A;  1B3Q A;  4TVA B;  3BG3 A;  1V8Q A;  4H02 A;  1HR0 Q;  4CDF C;  5KNB A;  4EQ5 A;  1AZQ A;  1G51 A;  1A0I A;  2A6E C;  1PZI D;  2VW9 A;  3AFP A;  3AMU A;  1VQ8 A;  1M90 C;  1K9M C;  2XN9 C;  3S24 A;  1U9R A;  5C44 H;  3E9H A;  2OT2 A;  2HHH Q;  5FLX E;  4RGO S;  3F2B A;  3A7A B;  3CCR A;  1YNX A;  3SK5 A;  1IBL L;  1FD7 D;  3GV3 A;  3K7A B;  4CKC A;  1TVX A;  4ZKB B;  4DUY Q;  3JAM L;  1IL2 A;  1CA6 A;  4JI1 L;  3C2P A;  2K50 A;  3U50 C;  4A3F B;  2UXD L;  3ULP A;  1NMG A;  3F2C A;  1VQ5 A;  5C4X G;  3FHW A;  1TII D;  1SJH D;  4AH6 A;  3OW2 A;  3U58 A;  1DGS A;  1BCP F;  1TWG B;  2F3V A;  2JYO A;  3I56 A;  3FMC A;  2EJG C;  1I4P A;  4FXG C;  4JI1 Q;  1PRT B;  4RCN A;  3STB D;  3E3X A;  1EQT A;  4YCU A;  3SK4 A;  4A3F H;  3T51 B;  3SVM A;  5BR8 Q;  3HKZ B;  3PCO B;  4RA8 A;  3M9B A;  2R92 H;  2K03 A;  3OHX C;  4A3K G;  1VQM A;  2OF1 A;  1SEB D;  4XIG S;  1VQJ A;  5I9O A;  3HOZ G;  4MTK A;  1VS0 A;  4JBK A;  1ML0 D;  1TQO A;  2ZJQ A;  4UP7 A;  1HUM A;  3I4L A;  2AKW B;  1VQC A;  1ET6 A;  2PZT A;  3J7A V;  3HOV B;  4PQX A;  4HJ8 A;  4JK1 C;  1V1Q A;  2BE5 C;  5EKI A;  3J81 c;  4BY7 G;  2NVQ B;  1XTD A;  1OXX K;  2D62 A;  2SNM A;  2HCC A;  5M5W B;  4JI4 Q;  4LK1 C;  1XNR L;  1K0S A;  2VUM G;  1OXT A;  4GOP C;  3A5Z B;  3I4N H;  3RMH A;  4K0K Q;  1N36 Q;  1PFN A;  2E8G A;  1DYQ A;  3H3V I;  2EYF A;  1VQG A;  2UXB L;  3NWT A;  2B2V A;  4OIK A;  2E5L Q;  1LUZ A;  2J4X A;  4FDB A;  1E3P A;  5M3M H;  3HOY B;  1NTG A;  1XNQ L;  3CCS A;  2K75 A;  1EYD A;  2F52 A;  3PSI A;  3QWN A;  5KGU A;  1SNP A;  4KKT A;  1ASZ A;  1PH7 A;  3TRZ A;  2UXB Q;  2D5D A;  4R4C A;  4A3D B;  1PZJ D;  2IX3 A;  2KCT A;  2B29 A;  1Q8I A;  1PFM A;  1A15 A;  4L63 B;  5CV6 A;  2DJG C;  4HMJ A;  4HIO A;  1C9O A;  1U4M A;  1GJX A;  4X65 L;  4DGZ A;  3TZD A;  3HOY H;  2K14 A;  4P74 A;  4RWS C;  1PLF A;  4K8J A;  5FLM G;  2KBN A;  4JI5 L;  1TWC B;  5IIF A;  1AE3 A;  3BZC A;  3KBX A;  4BS9 A;  2AQ3 B;  3MWY W;  4A3D H;  3P75 A;  1EIF A;  1MIU A;  4C3I B;  4YWL A;  3OW7 A;  4J6H A;  1B9M A;  5DLQ E;  2SEB D;  3S2H B;  3S1Q H;  1EWI A;  3BYY B;  1CKN A;  4N8F A;  5GAD C;  1F2L A;  4JC0 A;  1TWC H;  5EKL A;  1ENA A;  3W3A A;  2PNR C;  1E2Z A;  3CC2 A;  2K5D A;  1PMR A;  4C3I H;  1SBB B;  5GAG C;  4A4I A;  4LF6 Q;  1DOK A;  3KF6 B;  3S2H H;  1KRT A;  3QR8 A;  1GXD C;  1NR2 A;  5C4Z A;  3PUW A;  2A74 C;  3HOX G;  4DR1 L;  1R9T H;  2JA8 B;  1K8G A;  3G6J B;  3EA6 A;  1GUG A;  3WDN A;  1B2T A;  4GLA C;  2ID0 A;  4JPB W;  2B2T A;  3J81 j;  4XTC S;  4DR1 Q;  4L5R C;  1F2M A;  1WTH A;  4YY3 Q;  2E2D C;  3PO2 G;  3S17 H;  2BA0 A;  3NQI A;  4KTA A;  4DPG A;  2RHQ B;  1NBW A;  1BBX C;  2PO4 A;  5JJL A;  1B70 B;  3PIO 3;  1JOR A;  1JOQ A;  1EOV A;  2OWO A;  2WB1 E;  2F0Q A;  3PUV A;  2R7Z G;  1YIT A;  3VYU A;  3A54 A;  1IKL A;  2UU9 L;  1A3T A;  1I94 Q;  1Q1E A;  1PHJ A;  4JI7 L;  3RUZ A;  5D3I B;  1SNC A;  3BVG A;  4JI3 Q;  2E74 C;  4RAU C;  1WTO A;  3VR2 A;  2XTI A;  2KCM A;  4AIM A;  2L15 A;  3I4O A;  5JAV A;  1GUS A;  4APV A;  2OCE A;  3CRL C;  3SK6 A;  3TS2 A;  1HNX Q;  3K5N A;  3QOJ A;  3L2P A;  1WVL A;  4R8N A;  1IBM Q;  5IYC H;  4RGT A;  1WTP A;  1VMP A;  3J7A 5;  3UDF A;  4A3I G;  2F0D A;  3HKZ E;  1JE5 A;  5ELF A;  5LMN L;  3J80 c;  1HQR D;  3UDI A;  1PDQ A;  2Z9H A;  4B3S L;  2XSC A;  4A3K B;  4NW2 A;  1HZ9 A;  5JEA H;  2N3S A;  1A63 A;  5IGE A;  1LTA D;  1YEZ A;  3R8B A;  1D5M C;  4A93 G;  3HOZ B;  1A2U A;  1T5X D;  3BU2 A;  1JCK B;  1Q12 A;  3BDL A;  1JB3 A;  2KJX A;  3LWE A;  3GTQ H;  4PV1 C;  1EY4 A;  1X56 A;  1Z47 A;  4RH6 A;  4B3M L;  1H9S A;  4IUP A;  5CBE E;  2AWO A;  4A3M H;  2JA5 G;  1EY6 A;  3ULL A;  3B6Y A;  4NDX A;  2MP1 A;  1I4R A;  1TKW B;  3R3O A;  4UP8 A;  1STN A;  4JI6 L;  1K28 A;  1WTV A;  4UY8 C;  1BUV T;  3W2D A;  1AFP A;  4X62 L;  4BY7 B;  3EN2 A;  4B3M Q;  4UDU C;  1SLJ A;  2I46 A;  2CHB D;  5JVH 3;  1CSP A;  4JV5 L;  1GM5 A;  1VQF A;  2VUM B;  2DGY A;  3G7L A;  5EPJ A;  3CME A;  2RHS B;  4DV2 L;  4CDC C;  4EQP A;  2MO1 A;  2B2W A;  2K32 A;  3IRB A;  1D6E C;  3NXW A;  3D4W A;  4DXF A;  5FJ8 G;  1UEB A;  3M3Y B;  5EQ0 A;  3MHB A;  3URY A;  2VQE L;  1IZ6 A;  2PW7 A;  1I6V C;  1E0B A;  5FLX c;  4C3J H;  1E1T A;  3OTO L;  1CI3 M;  3KDF A;  1HA6 A;  4IUQ A;  4NXN L;  1KDC A;  4L5S A;  2EYO A;  1MI2 A;  1PTO C;  2O5J C;  1U4L A;  1V1O A;  1PH5 A;  1FJG L;  3CPF A;  1Y1W G;  1WTQ A;  3RLF A;  3KUP A;  3Q6S A;  4EVO A;  2PI2 A;  1Q8K A;  1VCI A;  5C0X H;  2ZJR A;  1XPU A;  3TDQ A;  3NE5 B;  4NXN Q;  3E0J A;  3OSO A;  4K6D A;  5IP9 H;  3GDE A;  1ZEQ X;  2TMP A;  1FJG Q;  4ZK9 B;  2SOB A;  4IPD A;  2HIX A;  4OO1 H;  1IXR A;  3SHL A;  4MZ9 A;  2E2H B;  3CCM A;  3QIA A;  1UEA B;  1PTO F;  4A3G H;  1CKN B;  3VR6 A;  1A2T A;  4K5V A;  1G8Z D;  5G3L F;  3OMG A;  1O7I A;  4DF7 A;  1KAA A;  4XYO A;  2QEX A;  1ENF A;  3ITP A;  4NXM L;  2K1B A;  3HOX B;  3TP6 A;  5JVG 3;  1X65 A;  4LUZ A;  5EBD A;  3E9I A;  3NPP A;  2SNS A;  2R61 A;  2JP1 A;  3KJO A;  4RG1 A;  1Y69 U;  3L9A X;  1AW7 A;  3T1Y L;  2F0H A;  4NXM Q;  1BDO A;  1CQV A;  2A68 C;  2F0S A;  2ZXO A;  1OXU A;  1K8M A;  1WTR A;  3KOJ A;  1TY2 A;  4V19 0;  4WOR A;  3HOU H;  4XT1 B;  4BXX H;  1XX8 A;  2F0T A;  4IFD J;  1PH9 A;  3LGJ A;  5LL6 X;  1AH9 A;  5C6A A;  1HTL D;  2Q2H A;  4KJO A;  5IT9 c;  5E3F A;  3D6W A;  4Y7N B;  2R7Z B;  1VDZ A;  4WFN 3;  1TR5 A;  1JOO A;  2EYM A;  4HED A;  4HCS A;  2QEJ C;  1UE1 A;  3UI2 A;  2UUA Q;  3TP7 A;  1LTT D;  2X6L A;  2CKZ B;  2YV5 A;  1L1O C;  5ELD A;  3VA7 A;  3E0E A;  4MN3 A;  4A75 A;  2NVY H;  3MXU A;  4CHT B;  1H9K A;  4X3S A;  4DK1 A;  3CF5 A;  2PPB C;  4Y7N H;  3WWV A;  2R7Z H;  1GHK A;  4TQU S;  4JI8 Q;  2K05 A;  2R3Z A;  4XT3 B;  2F0J A;  4ODG A;  4C3H B;  2M2L A;  4DR6 L;  5DEH A;  2EYP A;  4A3I B;  1G29 1;  4H0L C;  1VF5 C;  4KLK A;  1TT2 A;  4A76 A;  4ZKC B;  1SE2 A;  4QL5 A;  1TS4 A;  5KYL A;  4DV7 L;  4G7O C;  4GN5 A;  1TWH H;  2XWJ B;  2F3I A;  1I3Q B;  4C3H H;  3CCE A;  1MJE A;  1HZA A;  1Q82 C;  1K73 C;  1C48 A;  2ZTD A;  4IZ8 A;  2RA4 A;  5KEE A;  2B3G A;  5A2Q L;  2JA5 B;  1UWV A;  1GOZ A;  4R8I A;  2B63 G;  1JE4 A;  4FF3 A;  3M4O H;  1NUC A;  2RVL A;  1IYV A;  3NTK A;  1LT6 D;  1UNS A;  1W6J A;  3G71 A;  4HR7 B;  2FMM A;  2A5H A;  2AMC B;  4JVZ A;  1EEI D;  4BY1 G;  3D4D A;  1DXM A;  4C2M B;  1Z9F A;  3DMU A;  4FP5 D;  2VQF L;  1HNW L;  2NZ1 D;  3OPO A;  3UDX A;  3HOW H;  2MO0 A;  2G9H D;  1JJG A;  5K36 G;  2EZV A;  4R4Q A;  4WJ4 A;  2VXW A;  1SMX A;  4GN3 B;  1LO5 D;  2L5T A;  1XWE A;  1M8A A;  5JJZ A;  4A3L H;  4C2M H;  2I5M X;  5E4X A;  4A3E B;  4LF7 L;  5IYD G;  1XMO Q;  3CMA A;  1GKH A;  2GVA A;  1GHJ A;  2JA6 G;  4O2D A;  2F0L A;  4JBJ A;  2PYK A;  3S2D B;  5C5L A;  4KJN A;  4DAM A;  2A6H D;  5FOB B;  2HUG A;  2K4K A;  1XPR A;  4WJ3 M;  4K5X A;  4LFC Q;  2EVB A;  1TWF B;  3L7Z C;  3MC0 B;  4WRD A;  4A3E H;  3KDF B;  3S14 B;  1Y1W B;  1PYB A;  3OYY A;  1C0A A;  3V96 A;  3IFT A;  1EEF D;  4X3U A;  1LYL A;  1VQB A;  1EZ8 A;  1I50 B;  2D9U A;  3S14 H;  3NUC A;  5M5Y B;  4QUF A;  3MFY A;  4HIM A;  3T4A C;  4BA2 I;  3BVZ A;  1CFM A;  1WI5 A;  2BH8 A;  4QIW B;  4X66 Q;  1S5D D;  3C1E A;  3J81 L;  5CMD A;  1N32 L;  1R4Q B;  3G4S A;  1TY0 A;  4YCW A;  2F0I A;  3HFZ B;  3PUZ A;  1WTX A;  1X9N A;  1K8A C;  2KEN A;  3MZ5 A;  3CD6 A;  2ENB A;  2CQO A;  4MHE A;  1SMY C;  2ICI A;  3A7L A;  4LF4 Q;  3VYS A;  3F2U A;  4QQB X;  2QF7 A;  2V1C C;  3PIP A;  1DD2 A;  1YBY A;  1HZC A;  2AQ1 B;  4JI0 Q;  3TZU A;  1HA5 A;  3MFG A;  1RD9 D;  1HR0 L;  4DA2 A;  5C3E H;  4R4T A;  1MHW C;  3DWQ A;  3GO5 A;  1J5E Q;  2JA7 G;  4KY7 A;  1FVI A;  2RDH A;  3R93 A;  3EQL C;  2FMC A;  1JWS D;  5CV7 A;  1RHP A;  2HHH L;  1KAB A;  2BCO A;  3KLW A;  2X6G A;  4TSS A;  4DUY L;  4H44 C;  3U9S A;  5L37 A;  1BNZ A;  4LF5 Q;  1CHQ D;  3G48 A;  4ME3 A;  5JJK A;  1PRT D;  4DNI A;  1UE5 A;  4PZ7 A;  2PMZ B;  2WB1 B;  1XXG A;  3PV0 A;  1JMC A;  4HSP A;  2ZT9 C;  5E4W C;  1STH A;  3PUX A;  3J7A F;  1BCP D;  4NMZ A;  2B2U C;  2KHI A;  2RF4 A;  3EBE A;  5LMU L;  1YNJ D;  4PZ6 A;  1MKH A;  1AEX A;  1STG A;  1CZW A;  2JEA I;  2Y0S G;  1DCZ A;  1L0Y B;  2LXK A;  5COR A;  5BR8 L;  1BKB A;  1YNJ C;  3K5O A;  4G57 A;  3VA5 A;  3K7A H;  5LMU Q;  3EIV A;  4IPG A;  1QB5 D;  1GUW A;  3U4Z A;  1EU4 A;  3V2T A;  1SND A;  4G7H C;  1J6Q A;  4K2L A;  3FKI G;  2EIF A;  2PQA A;  2HIV A;  3R2T A;  1O78 A;  3GTP B;  1B50 A;  1BCP B;  5D65 A;  1SN8 A;  3IFD A;  3STB C;  4GKK Q;  2C5C A;  1TWG H;  4DK3 C;  1HPC A;  4K6L A;  5ELE A;  1KAW A;  4DV3 L;  4BY1 B;  4ID6 A;  3A8J E;  5EBC A;  4C1N K;  1S5F D;  4JI4 L;  3HEJ A;  3X3N A;  1XPO A;  3GTP H;  4CDD C;  2L12 A;  5M5X B;  3A0J A;  1K3R A;  1VQ6 A;  2N78 A;  3MXG A;  4OX9 Q;  4K0K L;  1N36 L;  4A3B G;  1M1K C;  5FO7 B;  4DV3 Q;  4F8M A;  3HRZ C;  3CRK C;  4LUV A;  2Q8T A;  1SRU A;  2E5L L;  4A3C H;  1G6P A;  3DHQ A;  2Z6B A;  2EYH A;  2LKV A;  2F0K A;  4H7B A;  3UDG A;  3HOV H;  2JA6 B;  4B9W A;  4L6T B;  3CCU A;  1RJT A;  1GO3 E;  2DNE A;  3DEO A;  1RKN A;  2NVQ H;  2RDG A;  3OOC A;  1JWU D;  5M5W H;  4IO9 A;  4E6I A;  3C1F A;  1BXT A;  2J0T D;  3PF4 A;  4DKA C;  5LL6 S;  1I5F A;  3J80 L;  4XQJ A;  4UAI A;  2I5L X;  1HHV A;  2XRQ D;  5I6Y A;  1KDA A;  1G2S A;  1PYW D;  1ASY A;  1B53 A;  2QDL A;  3GTO B;  3AB9 A;  2PI2 E;  1O7L A;  5EPL A;  5D14 A;  4M1U B;  2WAQ G;  4DK6 C;  2ATW A;  2JSO A;  1YJ9 A;  4BA1 I;  3ONA B;  5JPN C;  3J7Z C;  1QIL A;  4ME5 A;  5I4D A;  1WCM G;  2B2Y A;  4DR3 L;  1HNZ Q;  3FEW X;  1PXU A;  2EQS A;  2MNA A;  3CCL A;  4QCL A;  1EY0 A;  3K0X A;  4QIW E;  2MGS A;  4U67 3;  4KHZ A;  2KCC A;  4OEM B;  3U9O A;  4YWM A;  3GQB A;  1K0R A;  2JEB I;  2F0V A;  2VL6 A;  2HQE A;  4DR3 Q;  4LF6 L;  4LF9 Q;  4IN3 A;  4B3T L;  3NTI A;  4ZAI A;  4KY6 A;  3H0G G;  4DR2 L;  2K28 A;  1IYU A;  2H4O A;  1QCB D;  5I9P A;  1KIX A;  2QW7 A;  4XQQ A;  4UPA A;  5EGT A;  1HFG A;  5T1G A;  3GD7 A;  4B3T Q;  1E2W A;  3D4R A;  2F0E A;  1EY7 A;  4YY3 L;  4DR2 Q;  1K83 B;  3UE0 A;  5FLX L;  2KHJ A;  3A56 A;  2NN6 G;  1PH4 A;  4QY7 A;  3W1G A;  4DAY A;  1I4Q A;  2BA1 A;  2KCN A;  5EJW A;  4B3R L;  2E76 C;  3EVQ A;  5C0X I;  4QGU A;  1JJC B;  1S3O A;  4LF8 L;  1MSG A;  4FF4 A;  3CAM A;  3QB3 A;  4DV0 Q;  1HXY D;  5AJ3 L;  4FF1 A;  2Z4I A;  4HTH A;  1HZB A;  1SYB A;  1V9P A;  5JEA J;  3I91 A;  4O1N A;  1K83 H;  3K58 A;  2JA8 H;  5EPK A;  3ERS X;  4B3R Q;  4MNO A;  4P72 A;  4XXE A;  4K14 A;  4POF A;  4LF8 Q;  1O7Z A;  1XTC D;  2F0M A;  2YYZ A;  1TS5 A;  3KYH C;  1I94 L;  5AJ3 Q;  2A69 D;  4RGN A;  4JI3 L;  5LMN W;  3T53 B;  2C9O A;  2IHE A;  1QNK A;  2PMZ E;  2R93 G;  3T1H Q;  4DR5 Q;  1X3E A;  3W5O A;  1SJE D;  5LHY 1;  2WV6 D;  1HNX L;  4X6A H;  4P2C B;  1ILQ A;  4P73 A;  2FIN B;  2NN6 I;  4K8I A;  1SYG A;  3CKI B;  2R7D A;  1IBM L;  2GVB A;  5C3X A;  1EU3 A;  5HY6 A;  3KF8 A;  4OEL B;  5CV9 A;  2Y0S B;  5C4X B;  5K5P A;  1LAB A;  1QUQ A;  1X6O A;  3VYR A;  1YVC A;  3KLR A;  4F7X A;  3P20 A;  1ZXT A;  1EOT A;  3DM1 A;  3A8K E;  4EQN A;  2EY2 A;  1K3B C;  2Q2U A;  4JCV E;  5A35 A;  2HT1 A;  3GTL B;  1A3U A;  2ICE C;  3FKI B;  4ZRZ A;  5C4X H;  1VMC A;  3HGB A;  1QJO A;  2HCI A;  4J15 A;  1EIG A;  1OO9 B;  1PH8 A;  2WII B;  2IHF A;  3PO3 G;  1X3G A;  2LFN A;  5H1S E;  4DAV A;  2ASB A;  4BBS G;  3GTL H;  5ISR A;  4IFD G;  1EUJ A;  5IT9 L;  5C0X J;  3H3V H;  3I73 A;  1G91 A;  5IP7 G;  4A3K H;  1RIP A;  5J39 A;  3MEH A;  3LX0 A;  3V05 A;  2ALY B;  4A3B B;  1LTB D;  2EJM A;  3HOZ H;  4GNX A;  4A3J G;  2DUD A;  2IT1 A;  2F1M A;  4TKO B;  1CKM A;  3AYH B;  2B2V C;  2LSS A;  5BN5 A;  4X64 Q;  4GLV B;  2EE1 A;  4HID A;  4BBR G;  1P8L A;  4LWC A;  1VQH A;  2RDF A;  1U0L A;  1IBK Q;  4BY7 H;  3BDO A;  5KYI A;  2YU9 B;  3D31 A;  2OQK A;  2UUC L;  2CCZ A;  1QVC A;  2QA4 A;  1CM9 A;  1STE A;  2E2J B;  4UP9 A;  2KA7 A;  1I4X A;  2NWG A;  2VUM H;  3TSS A;  3RZO B;  3DEP A;  1Y1V G;  3PGZ A;  1GUO A;  4IFD I;  2F0G A;  4DU9 A;  1F2Z A;  3QG1 A;  1YJN A;  1SFO B;  3A5U A;  1JB7 A;  2A19 A;  2UUC Q;  1FNU A;  2CVR A;  2O2L D;  5M3F G;  3K80 C;  1MJC A;  1NR4 A;  5GAE C;  1O7Y A;  3M3Y H;  1V43 A;  2E2J H;  3RN2 A;  4KD3 A;  3N6R A;  1NAP A;  2N55 A;  4LFA Q;  4FF2 A;  3AEV A;  2BDN A;  1VQE A;  2AQ2 B;  3I4M G;  2LXJ A;  1SFO H;  3PMF A;  1W2B A;  3PIP 3;  4PMC A;  1VQO A;  2RCN A;  5JPM C;  1C4Q A;  4QMG A;  3DM3 A;  3W1B A;  4DFA A;  1E22 A;  3MA2 B;  2IJ0 A;  5FLM H;  3FDT A;  4R4I A;  2A73 B;  1PH6 A;  3AU7 A;  5FO8 B;  2NUC A;  5J22 A;  2O4X A;  5BN3 A;  2DY7 A;  2K6A A;  1SAP A;  1F9S A;  2NZH A;  1MBY A;  1PTO B;  2G5D A;  1D1I A;  4DV5 Q;  4MIU A;  4KKU A;  2E2H H;  5IYB G;  3MVV A;  3M4Q A;  2JJQ A;  3Q23 A;  1HCZ A;  4IUV A;  4DAY B;  3BYT B;  2QCP X;  1S5E D;  3K8A A;  1LT4 D;  1VQ4 A;  1PVO A;  4EGV A;  1LT3 D;  3AQQ A;  4HJ9 A;  2RSO A;  3HOX H;  3PO2 B;  2AUJ D;  1N34 Q;  1QG7 A;  5BN4 A;  1SNQ A;  1WTW A;  3VYT A;  5FO9 B;  3GTJ B;  1TWA B;  4QUC A;  3P7J A;  1L0X B;  5KRU A;  3S1R B;  1KTK A;  2CQA A;  2ZM6 Q;  2I0Q A;  2UUA L;  1YNN D;  2R93 B;  1RCV D;  3PO2 H;  2PW5 A;  2I07 B;  1QVG A;  1TXY A;  5TSS A;  4XQN A;  2PCF B;  2VB2 X;  1KLG D;  4JI8 L;  3GTJ H;  1BO0 A;  1TWA H;  2KQ3 A;  4AYB G;  1X54 A;  1S40 A;  2KVM A;  3S1R H;  1EY9 A;  2L0C A;  2Y0S E;  3WOF A;  4JOI A;  2VNU D;  1WYD A;  4DNT B;  5C44 G;  2IY5 B;  1R4P B;  2PZW A;  3KF8 B;  1SNM A;  4AQY L;  3KLS A;  2EXD A;  1LTI D;  1QUQ B;  1X3P A;  4B9X A;  2EYL A;  4YIJ A;  3GTK B;  2JA9 A;  4O0A A;  5D3D A;  2F3W A;  1L2F A;  1YI2 A;  3SEB A;  3TEH B;  1STB A;  4AQY Q;  4KV6 A;  3J81 i;  1SR3 A;  4K2K A;  4DNR B;  1FNW A;  1N8R C;  1UUP A;  5CR3 A;  5CV5 A;  5CC4 A;  4A93 B;  3T56 B;  3VR4 A;  1ILP A;  3GTK H;  4KHP Q;  4RHR A;  4A3I H;  1RL2 A;  5T1I A;  4A3F G;  2LY7 A;  2NBF A;  1JIC A;  5IWA Q;  1FR3 A;  4DR4 L;  2Q8R E;  4NPS A;  4IUT A;  1H9S B;  4EQO A;  2R92 G;  1A3V A;  2B2U A;  4IAL A;  4LNQ A;  4A93 H;  1I3Q H;  3NSW A;  1M4V A;  3CQZ B;  2B2W C;  2DY8 A;  2XRS D;  5ELO A;  4DR4 Q;  2WAC A;  5EAY A;  4GNX B;  3A8I E;  2JA5 H;  4RKL A;  3EFX D;  5IGB A;  1IL8 A;  1XMO L;  2HDM A;  3S16 B;  2KEE A;  4ZUI A;  3JAM E;  1XMQ L;  1H9R A;  1Y8P B;  4CJ0 B;  1WJJ A;  1VF7 A;  1SYF A;  3CC4 A;  5JJI A;  1T9H A;  4J1M A;  4Q0F A;  4LFC L;  1YHA A;  3CHB D;  4KD4 A;  2I5H A;  3RNU A;  2KOL A;  1KNE A;  3D3R A;  1E7Z A;  3I4N G;  1XMQ Q;  4QF4 A;  5CV4 A;  1LTS D;  2UXC Q;  2WAQ E;  2ZXP A;  5FJ8 H;  4X3K A;  4N9T A;  5M3F B;  3KJP A;  3SR1 A;  5M3M G;  1LT5 D;  3JAM i;  2PNH A;  2A6H C;  4LFB L;  1Y8N B;  5J1Z A;  3I4M B;  3S2D H;  3HP3 A;  4GN4 B;  3NWS A;  4CJ1 B;  1S4Z A;  1IKM A;  2R6G A;  4ALP A;  1SDF A;  1EIH A;  4X66 L;  1TWF H;  3RD4 A;  2JXM B;  4GOP A;  4LFB Q;  3HOY G;  1Y1W H;  1EWH A;  1OXV A;  1CK1 A;  2DN8 A;  3H15 A;  3MXP A;  4JYA L;  4KY5 A;  3JC6 6;  1HR0 W;  5CBA E;  4A3D G;  4LF4 L;  1EFW A;  1GVP A;  1D7Q A;  3S15 B;  2FJ2 A;  3GV6 A;  2AUK A;  1I50 H;  4IJL A;  1HH2 P;  1OTC A;  4JYA Q;  1ET9 A;  3WOE A;  3CC7 A;  4JI0 L;  2N8N A;  5M5Y H;  2CW0 D;  1A62 A;  4DUZ Q;  3GTM B;  2QDB A;  2NZO A;  3S15 H;  5FK9 C;  4KHV A;  1ZYR D;  1PFS A;  2HD3 A;  1D1K A;  1J5E L;  1NCV A;  1VQP A;  3HG9 A;  2A8V A;  3DUZ A;  2Z8L A;  1SE8 A;  1VQL A;  2HQL A;  2XVS A;  3F1Z A;  4DV6 Q;  5IOC A;  3QJY A;  4FNF A;  1D5Z C;  2EJF C;  3FPP A;  4IUN A;  2C35 B;  1P16 A;  4LF5 L;  1KDB A;  1LTR D;  1PH2 A;  2Z1C A;  3HZX A;  1MD2 D;  3NK9 A;  2FHT A;  2JK8 A;  1WOC A;  2Z6K C;  4Z9C B;  2K5Q A;  3SGI A;  3E5S A;  5GRO A;  3ERQ A;  4JBM A;  4AYB B;  3KLS X;  4PG3 A;  2ZXR A;  4R9W A;  2A6E D;  1ICW A;  4L5T A;  5C44 B;  4POG A;  4DR7 Q;  1PYS B;  2B39 A;  3RR5 A;  2L11 A;  1CUK A;  2V4D A;  2JE6 I;  1PRT C;  5KIX A;  1IYJ B;  4DV4 L;  2ZTE A;  2Q2I A;  4CKE A;  3NTH A;  3MXN A;  1NNX A;  1BCP C;  1FYC A;  2XGT A;  3SK8 A;  5CGK A;  1Q7Y C;  1Q86 C;  4ULL A;  4OWT B;  1N9W A;  1D5X C;  2WP8 J;  4GKK L;  4DV4 Q;  3ERO A;  1GUN A;  3CXC A;  1UE6 A;  4RMF A;  5IYC G;  2L55 A;  4OWX B;  2IPK D;  1PRT F;  1NSN S;  1X3Q A;  3NEL A;  3NQT A;  1Y14 B;  2B63 B;  5HGQ A;  1IBL Q;  2R92 B;  4DV1 L;  2F0O A;  2L9H A;  2CWP A;  5JEA G;  5M9O A;  3IAY A;  4OX9 L;  4FVM A;  3KK7 A;  1KXL A;  1FGU A;  4OL7 A;  1Y8O B;  2UXD Q;  3NEM A;  5DAU A;  3H94 A;  3D6C A;  1IHZ A;  2AHO B;  4R1J A;  4S3S A;  1AE2 A;  2D0P A;  1PV4 A;  1HJP A;  1SYE A;  4ZQ3 A;  2Q8I B;  4DV1 Q;  1BVS A;  4GZY C;  4A3M G;  1I4H A;  1STY A;  5KND A;  1EYG A;  2B63 H;  3NP8 A;  2ZJP A;  3ND8 A;  2BOS A;  1KD1 C;  4GS3 A;  1X32 A;  1RTN A;  1FL0 A;  4C56 C;  4BY1 H;  1NE3 A;  4IOC A;  4RCO A;  5E7N A;  3SXH A;  1TS3 A;  1F2Y A;  5DM6 3;  4ZCK A;  2BE5 D;  1HUN A;  4PNY A;  5M5X H;  4OGQ C;  3Q8D A;  1SE3 A;  3I4N B;  2LMC B;  3PUY A;  2K04 A;  2BDO A;  1Z7T A;  4FXD A;  2M9V A;  2A1A A;  3HS0 C;  5K36 H;  1CA5 A;  4KN4 C;  1AN8 A;  3ULJ A;  5ELB A;  2OTJ A;  4KN7 C;  3T16 A;  5IYD H;  3CU7 A;  5M3M B;  1PH3 A;  3BDC A;  3S1N B;  4I7A A;  3K57 A;  1H95 A;  4HN7 A;  2SDF A;  4KI0 A;  1QOH A;  2X69 A;  4C3J G;  2JA6 H;  1HNZ L;  2BH2 A;  2PZU A;  4F87 A;  3DWA A;  1XNR Q;  4Y52 H;  1J8I A;  1D8L A;  3FVQ A;  5ELC A;  5IT9 E;  5FKA C;  3S1N H;  3OMC A;  1DOL A;  4GOP B;  4LF9 L;  1DZ1 A;  1Q1B A;  3H6M A;  4YHH L;  1BF4 A;  5C0X G;  3TN2 A;  3GTO H;  3TP5 A;  2DNC A;  1A6X A;  3PQI A;  5IP9 G;  1KHI A;  1O80 A;  4PMW A;  1XNQ Q;  4NKL A;  3S1Q B;  2O5I C;  4YHH Q;  2VB3 X;  4MTN A;  4OO1 G;  1IW7 D;  3CW2 C;  5COY A;  4XDX A;  4A3G G;  2ZTC A;  1N33 L;  1X55 A;  2FXQ A;  4RHS A;  4TRD A;  3X3M A;  2R7F A;  2LS0 1;  1I6H B;  1IW7 C;  4X65 Q;  1KL9 A;  3D8G A;  3R2I A;  3M85 A;  3BJU A;  4BWG B;  4JI5 Q;  2MHV A;  5AFW A;  4DV0 L;  1N33 Q;  4FYD A;  1R9T B;  3ZJY C;  3EJI A;  3RN5 A;  1SE4 A;  4ZUJ A;  3JAM c;  2XNA C;  4DN4 M;  2MUY A;  2IL8 A;  1GUT A;  1YJW A;  2JA7 B;  1I6H H;  4HAE A;  2AWN A;  2NB0 A;  4LUO A;  5NUC A;  1VQI A;  3U4V A;  3E6Z X;  2KHS A;  1I4G A;  4NB3 A;  1CTM A;  5E1F A;  3T1H L;  3S17 B;  1UAP A;  4DR5 L;  5I2Y A;  1F9Q A;  1U4P A;  3OIQ A;  4HJA A;  3ICE A;  1T5E A;  3IKJ A;  4OO1 I;  5IGF A;  3HOU G;  2E2I B;  4BXX G;  4AYB E;  5HUR A;  1JT8 A;  4I7Z C;  3OWF A;  4CBV A;  2MQH A;  1JJ2 A;  2JA7 H;  2FFK B;  4L5Q A;  4HSV A;  2CH4 W;  1LAC A;  2H5X A;  2A69 C;  3I70 A;  4B08 A;  2P5Z X;  4DAP A;  1DOM A;  3DXJ C;  2K7V A;  4V0B A;  1B3A A;  2E2I H;  1F77 A;  3H09 A;  4ILW A;  2D2C C;  3I55 A;  3A74 A;  1PH1 A;  2EYJ A;  2WFW A;  2K01 A;  1QNU A;  1KRS A;  1Q3L A;  2K5W A;  3K5M A;  3H3V C;  3D0F A;  1F9R A;  3MXN B;  3BZD B;  1RF2 D;  3VR5 A;  1BBU A;  1ROD A;  3GP7 A;  1OXS C;  3F8T A;  1EIY B;  1CSQ A;  4CKB A;  3OIP A;  2PQA B;  3AFQ A;  2UU9 Q;  3K7U C;  1CT1 D;  4JI7 Q;  3C3L A;  3VDY A;  1BR9 A;  1L1O A;  4C3H G;  4I65 A;  3TP8 A;  1X3F A;  3FKI H;  3K59 A;  3LNN A;  1QZG A;  3GTQ B;  1SXT A;  4QJF A;  2JQO A;  4X64 L;  4A3M B;  2F03 A;  3ZYY X;  4HJ5 A;  1KLU D;  2K5V A;  3FPU B;  4P71 A;  2L1B A;  4IJH A;  3GTG B;  1SNO A;  1IBK L;  1JWM D;  3KFU A;  5LMN Q;  2CFM A;  3TBI B;  1BOS A;  1LLR D;  1Q46 A;  4L8J A;  4B3S Q;  4IQZ A;  2MFI A;  1BBW A;  3HOW G;  4O42 A;  2YTY A;  4G7Z C;  4YCV A;  3FRP B;  4CDE C;  1Q81 C;  4A3B H;  3K6O A;  2EOT A;  3GTG H;  4IUU A;  3T13 A;  1EY8 A;  4A3L G;  2F0W A;  4NP5 A;  2F0F A;  1HFN A;  3VR3 A;  4DK0 A;  1A8V A;  4HMI A;  3TRE A;  4JI6 Q;  3FP9 A;  1QE6 A;  4C3J B;  2F0P A;  4X62 Q;  4LFA L;  2B2Y C;  1EZ6 A;  1STA A;  5DNF A;  1E2V A;  2CH4 A;  5J3B A;  1RTO A;  2YU9 H;  2WAQ B;  5EKK A;  1D2B A;  2NTS A;  3I8Z A;  1L0W A;  2EY5 A;  5A2Q E;  1DJR D;  3CCV A;  4JV5 Q;  4A3E G;  3RZO H;  1E24 A;  1G2T A;  3M4Y A;  1WCM B;  2YTV A;  2Q2T A;  2NYZ D;  4DV2 Q;  4IOA A;  3J7Y W;  1PTO D;  1S5C D;  1YIJ A;  1ICF B;  1EQQ A;  4WJW A;  2KED A;  3K81 C;  1SRO A;  5G3L D;  2CWA A;  1B8A A;  2GN5 A;  1C7Y A;  2VQE Q;  3BVM A;  2J7Z A;  3TS0 A;  3L3O C;  1WCM H;  3CCQ A;  1DON A;  2TSS A;  4IUR A;  4OWW B;  1HRJ A;  3KBG A;  3H0G B;  3OTO Q;  4DV5 L;  4CGY B;  2IX1 A;  1W3S A;  2OTL A;  4A3G B;  4N9P A;  3NBH A;  1VQ7 A;  3MAQ A;  2RCF A;  4RKB A;  4PZ8 A;  2L4N A;  1V1P A;  2K52 A;  1YHQ A;  2B2T C;  1H9M A;  1S72 A;  3SDZ A;  3RZD B;  2Z4H A;  4P75 A;  3TME A;  3I72 A;  2F0U A;  3SE0 A;  1FNV A;  3H0G H;  1N34 L;  3O13 A;  2M00 A;  1VQA A;  1UE7 A;  1U5K A;  3F2D A;  4PMB A;  1EWC A;  1B4O A;  1PA6 A;  4HCE A;  1TS2 A;  4U68 A;  3HKS A;  3A55 A;  1HTP A;  1PTO H;  5JOB A;  1JOK A;  2ZM6 L;  3RLO A;  3RZD H;  4KKS A;  3K5L A;  1QWY A;  1SSO A;  4JW0 A;  4X3T A;  2OEO A;  2XIW A;  4G4K A;  2NN6 H;  2QIL A;  5IE8 A;  5C3E G;  3HOU B;  2A68 D;  2B8F A;  1HQM C;  5GAH C;  3I90 A;  4J8Q A;  3UE1 A;  1B44 D;  4DXG A;  2RBM A;  1NJI C;  5HGT A;  1BQQ T;  4F88 A;  1VQ9 A;  1MGS A;  3Q0A A;  4KMU C;  2XWB B;  1YNN C;  3G6E A;  3J81 E;  1NMF A;  3OWE B;  3QOL A;  4UHV A;  3C46 A;  3MTS A;  2F4I A;  2K5N A;  3BZK A;  3ER0 A;  3T1Y Q;  2YTX A;  2DJF C;  2N88 A;  4HJ7 A;  3S1M B;  2R93 H;  4Q5V A;  2NVY B;  1PZK D;  1KC8 C;  4H13 C;  3I2Z A;  2RKS A;  1VQK A;  3CP0 A;  3RLN A;  4IPC A;  3CPW A;  4JI2 L;  1U4R A;  3CCJ A;  1EQR A;  3I3C A;  2H1E A;  3K0Y A;  1NY4 A;  2IX0 A;  4IPH A;  4KHP L;  2OXP A;  2HDL A;  3S1M H;  2K33 A;  3NHH A;  2RSN A;  2Z6K A;  2WB1 G;  1DM0 B;  4JI2 Q;  5IWA L;  3MEF A;  2EDG A;  3PO3 B;  4LMQ D;  2F4V L;  1TWH B;  4C1N I;  3M4P A;  2GA4 B;  5C3W A;  4BBS B;  2E75 C;  1AZP A;  3PIO A;  2NTT A;  4GNX C;  2QGQ A;  1L1O B;  4KK7 A;  5IOD A;  1AP0 A;  1CZG A;  2IWH A;  2F4V Q;  2PQE A;  2EY1 A;  3M4O B;  1QVF A;  3PO3 H;  4LAA A;  4DR6 Q;  4A3J B;  1EY5 A;  1ENC A;  5C5M A;  3LWU A;  1WD1 A;  1TU2 B;  4BBS H;  1B9N A;  1LTG D;  2Z0S A;  4IFD H;  3HKZ G;  3M7G A;  4GLX A;  2NVT B;  4BBR B;  5IP7 H;  1VQN A;  4DV7 Q;  3HOW B;  4K5W A;  1G6Z A;  1EYC A;  1S5B D;  3P1H A;  4QB4 A;  4A3J H;  1KNA A;  1F9P A;  4OON A;  3CQZ H;  2UXC L;  1KQS A;  4A3C G;  4M8A A;  1Y1V B;  1H9J A;  2NVT H;  4BBR H;  3H91 A;  3S16 H;  4N8X 1;  2EXZ A;  3HOV G;  2VY3 A;  4R4O A;  5DM7 3;  5C4J B;  3BS1 A;  3PF5 A;  5GQO A;  3Q22 A;  2ES2 A;  3IL8 A;  1LTL A;  2JN4 A;  3DWP A;  2VQF Q;  1HNW Q;  3NBI A;  5IGG A;  1LM0 A;  5F2D A;  1Y1V H;  1W6K A;  4LW1 A;  4YWK A;  4CJ2 C;  1FGB D;  4LJZ C;  1J9O A;  1CQF A;  1MSH A;  2KEC A;  4JBW A;  1Z6H A;  5C4J H;  1GD7 A;  1XYI A;  2KUM A;  1PFB A;  2VS1 A;  5M3F H;  2VZA A;  3M7N A;  3NEN A;  2MPM A;  2OQ0 A;  4LF7 Q;  2NVX B;  2UUB L;  2EPB A;  4RGM A; 
#chains in the Genus database with same CATH homology
 4RG1 A;  1XJV A;  3I7F A;  1FL0 A;  1YVC A;  4BY1 H;  1NE3 A;  3T1Y L;  4IOC A;  3I4M H;  4NXM Q;  2D0O A;  5E7N A;  1OXU A;  2UUB Q;  4DUZ L;  5M5X H;  2Q2U A;  3Q8D A;  3PUY A;  4JCV E;  3NBH B;  3KOJ A;  2NVX H;  1YHB A;  2HT1 A;  2N49 A;  2A1A A;  3HOU H;  1YZ6 A;  4BXX H;  5C4X H;  4IFD J;  3ULJ A;  1PH9 A;  3LGJ A;  2OTJ A;  1AH9 A;  1CKO A;  4J15 A;  1PH8 A;  4HIK A;  5IYD H;  2IHF A;  2Q2H A;  3PO3 G;  5IT9 c;  1PH3 A;  1VQD A;  1E1O A;  1B7Y B;  1X3G A;  4GKJ L;  1H95 A;  4DV6 L;  5H1S E;  4KI0 A;  2ASB A;  2JA6 H;  3GTL H;  4BBS G;  1HNZ L;  2BH2 A;  4IFD G;  1EUJ A;  5C0X J;  1UE1 A;  3H3V H;  5IP7 G;  2UUA Q;  4A3K H;  1XNR Q;  4Y52 H;  2CKZ B;  2YV5 A;  1RIP A;  1D8L A;  1L1O C;  4GKJ Q;  5IYB H;  3TQY A;  3E0E A;  1QZH A;  4A75 A;  3GTM H;  2NVY H;  1N32 Q;  2ALY B;  3DLL A;  3S1N H;  3HOZ H;  3KF6 A;  4GNX A;  3CF5 A;  4A3J G;  2DUD A;  4GOP B;  4LF9 L;  4Y7N H;  3WWV A;  1Q1B A;  2R7Z H;  2IT1 A;  5IY0 A;  5ELN A;  4YHH L;  4TQU S;  1CKM A;  4EX5 A;  4JI8 Q;  3AYH B;  5C0X G;  3GTO H;  2LSS A;  4X64 Q;  4GLV B;  4HID A;  2K5H A;  5IP9 G;  4BBR G;  4DR6 L;  4JOI C;  1KHI A;  4JG2 A;  4DR7 L;  1P8L A;  4OXP A;  4PMW A;  1XNQ Q;  2JA8 G;  1G29 1;  4LWC A;  3J80 i;  1VQH A;  4KLK A;  1WFQ A;  1U0L A;  1IBK Q;  4YHH Q;  4BY7 H;  4A76 A;  4MTN A;  4OO1 G;  3D31 A;  2OQK A;  3CW2 C;  3L0O A;  4QL5 A;  2UUC L;  4TVA B;  2CCZ A;  4DV7 L;  1QVC A;  2QA4 A;  4GN5 A;  4A3G G;  1TWH H;  2ZTC A;  4UP9 A;  2VUM H;  1N33 L;  2F3I A;  1X55 A;  1Y1V G;  2FXQ A;  4H02 A;  4C3H H;  1HR0 Q;  3PGZ A;  2R7F A;  3CCE A;  1MJE A;  4IFD I;  4X65 Q;  1HZA A;  1Q82 C;  4EQ5 A;  1K73 C;  1KL9 A;  3M85 A;  1G51 A;  1A0I A;  3BJU A;  1YJN A;  3A5U A;  2ZTD A;  1JB7 A;  2A19 A;  2VW9 A;  3AFP A;  2UUC Q;  4DV0 L;  2B3G A;  4JI5 Q;  1UWV A;  1VQ8 A;  5M3F G;  1M90 C;  1K9M C;  3K80 C;  2B63 G;  1MJC A;  1N33 Q;  5GAE C;  3M4O H;  3M3Y H;  1V43 A;  2E2J H;  3RN2 A;  3S24 A;  3ZJY C;  3G71 A;  5C44 H;  2AMC B;  3E9H A;  2HHH Q;  3RN5 A;  3JAM c;  3F2B A;  3CCR A;  1YJW A;  1YNX A;  1I6H H;  4LFA Q;  2AWN A;  3AEV A;  1VQE A;  4BY1 G;  3I4M G;  2LXJ A;  1IBL L;  4LUO A;  1SFO H;  1Z9F A;  1W2B A;  1VQI A;  3U4V A;  2VQF L;  1HNW L;  3UDX A;  4NB3 A;  4DUY Q;  2RCN A;  3HOW H;  1IL2 A;  3T1H L;  4DR5 L;  2MO0 A;  4JI1 L;  2K50 A;  1JJG A;  4HJA A;  3ICE A;  3U50 C;  2UXD L;  4OO1 I;  3ULP A;  1NMG A;  3HOU G;  3F2C A;  3DM3 A;  3W1B A;  5K36 G;  1VQ5 A;  4BXX G;  4AYB E;  1E22 A;  5C4X G;  3FHW A;  4R4Q A;  5FLM H;  4WJ4 A;  1JT8 A;  1SMX A;  4GN3 B;  4R4I A;  2MQH A;  1PH6 A;  1JJ2 A;  2JA7 H;  4AH6 A;  4A3L H;  4C2M H;  2I5M X;  4L5Q A;  3OW2 A;  3U58 A;  1DGS A;  4LF7 L;  5IYD G;  3I56 A;  3CMA A;  1XMO Q;  1GKH A;  2GVA A;  4JI1 Q;  2H5X A;  3STB D;  2NZH A;  4YCU A;  2JA6 G;  4A3F H;  4O2D A;  4JBJ A;  5BR8 Q;  3PCO B;  2E2I H;  4DAM A;  4DV5 Q;  3M9B A;  2R92 H;  2K4K A;  1XPR A;  2E2H H;  4WJ3 M;  4A3K G;  4LFC Q;  1VQM A;  3I55 A;  3A74 A;  3L7Z C;  1PH1 A;  4XIG S;  2WFW A;  5IYB G;  1VQJ A;  4A3E H;  3KDF B;  3M4Q A;  1KRS A;  3D0F A;  3HOZ G;  1PYB A;  2JJQ A;  3MXN B;  1VS0 A;  4JBK A;  3OYY A;  2ZJQ A;  4DAY B;  4UP7 A;  3K8A A;  1VQ4 A;  1PVO A;  4HJ9 A;  3AQQ A;  2AKW B;  1VQC A;  1C0A A;  3HOX H;  1BBU A;  1N34 Q;  1LYL A;  1VQB A;  1OXS C;  4HJ8 A;  3F8T A;  1EIY B;  1V1Q A;  1CSQ A;  3S14 H;  3J81 c;  4BY7 G;  2PQA B;  3AFQ A;  1XTD A;  1OXX K;  2D62 A;  4HIM A;  2UU9 Q;  3K7U C;  2ZM6 Q;  2I0Q A;  2UUA L;  4JI4 Q;  4JI7 Q;  4BA2 I;  1XNR L;  1WI5 A;  2BH8 A;  3VDY A;  2VUM G;  1L1O A;  1OXT A;  4X66 Q;  4GOP C;  3PO2 H;  1N32 L;  3A5Z B;  3I4N H;  3G4S A;  1X3F A;  1QVG A;  4K0K Q;  3FKI H;  1N36 Q;  1TXY A;  2E8G A;  4YCW A;  1QZG A;  3H3V I;  4JI8 L;  1VQG A;  4QJF A;  3GTJ H;  1TWA H;  2JQO A;  3HFZ B;  3PUZ A;  1X54 A;  4AYB G;  4X64 L;  1X9N A;  1S40 A;  2KEN A;  1K8A C;  2E5L Q;  3CD6 A;  1LUZ A;  2CQO A;  3S1R H;  4HJ5 A;  4FDB A;  1E3P A;  4LF4 Q;  2Y0S E;  5M3M H;  2K5V A;  1NTG A;  1XNQ L;  4JOI A;  3CCS A;  4P71 A;  2VNU D;  1WYD A;  2K75 A;  5C44 G;  2F52 A;  3PSI A;  2V1C C;  4IJH A;  4QQB X;  2IY5 B;  3PIP A;  1IBK L;  3KFU A;  3KF8 B;  5LMN Q;  4AQY L;  1ASZ A;  2CFM A;  1PH7 A;  3TRZ A;  2UXB Q;  1YBY A;  2EXD A;  4R4C A;  1Q46 A;  4B3S Q;  1HZC A;  4JI0 Q;  1QUQ B;  2MFI A;  2KCT A;  2B29 A;  1BBW A;  2JA9 A;  4O0A A;  3HOW G;  4HIO A;  1HR0 L;  1C9O A;  1L2F A;  2YTY A;  1YI2 A;  4YCV A;  5C3E H;  4X65 L;  3TEH B;  1Q81 C;  3HOY H;  2K14 A;  4P74 A;  4A3B H;  4AQY Q;  4R4T A;  3J81 i;  5FLM G;  2KBN A;  1SR3 A;  4JI5 L;  3GTG H;  1AE3 A;  3BZC A;  3GO5 A;  1J5E Q;  2JA7 G;  4A3L G;  1N8R C;  1FVI A;  4A3D H;  1EIF A;  1MIU A;  1A8V A;  3GTK H;  4YWL A;  3TRE A;  4JI6 Q;  4KHP Q;  2HHH L;  3FP9 A;  4A3I H;  1RL2 A;  5DLQ E;  4X62 Q;  3KLW A;  4A3F G;  4LFA L;  3S1Q H;  1EWI A;  1CKN A;  5J3B A;  5IWA Q;  5GAD C;  2YU9 H;  4DR4 L;  4NPS A;  1L0W A;  4JC0 A;  1TWC H;  2R92 G;  4DUY L;  3CCV A;  4LF5 Q;  4JV5 Q;  4LNQ A;  3G48 A;  4A3E G;  3RZO H;  4ME3 A;  5JJK A;  4DNI A;  3CC2 A;  1E24 A;  1I3Q H;  1UE5 A;  4PZ7 A;  4A93 H;  2YTV A;  2Q2T A;  3PV0 A;  4C3I H;  4DV2 Q;  1JMC A;  4IOA A;  5GAG C;  3PUX A;  5ELO A;  4A4I A;  1YIJ A;  1EQQ A;  4LF6 Q;  4DR4 Q;  5EAY A;  3KF6 B;  4GNX B;  3S2H H;  2JA5 H;  3K81 C;  1KRT A;  2KHI A;  1SRO A;  2RF4 A;  3EBE A;  3HOX G;  3PUW A;  5LMU L;  4DR1 L;  1XMO L;  2CWA A;  1B8A A;  1MKH A;  2GN5 A;  4PZ6 A;  1R9T H;  1C7Y A;  1K8G A;  2JEA I;  2VQE Q;  2Y0S G;  1XMQ L;  3TS0 A;  4GLA C;  1WJJ A;  2ID0 A;  1WCM H;  2LXK A;  1BKB A;  5BR8 L;  3J81 j;  3CCQ A;  4OWW B;  4XTC S;  3CC4 A;  5JJI A;  3OTO Q;  4DV5 L;  1T9H A;  2IX1 A;  1W3S A;  2OTL A;  3K7A H;  4LFC L;  1YHA A;  5LMU Q;  3EIV A;  4YY3 Q;  4IPG A;  4DR1 Q;  4L5R C;  2I5H A;  1VQ7 A;  3RNU A;  1E7Z A;  3PO2 G;  4PZ8 A;  3S17 H;  2K52 A;  3U4Z A;  3I4N G;  1XMQ Q;  2BA0 A;  1J6Q A;  1YHQ A;  3FKI G;  2EIF A;  4DPG A;  2PQA A;  2RHQ B;  1S72 A;  2HIV A;  1NBW A;  5JJL A;  2UXC Q;  1B70 B;  1SN8 A;  2WAQ E;  4P75 A;  3STB C;  5FJ8 H;  4GKK Q;  3KJP A;  3H0G H;  1N34 L;  1TWG H;  4DK3 C;  5M3M G;  1EOV A;  3JAM i;  1VQA A;  1UE7 A;  1U5K A;  3F2D A;  2OWO A;  2WB1 E;  2PNH A;  4LFB L;  1PA6 A;  3PUV A;  1KAW A;  2R7Z G;  1YIT A;  4DV3 L;  3HKS A;  2UU9 L;  1I94 Q;  3S2D H;  4GN4 B;  2ZM6 L;  1Q1E A;  3RLO A;  3RZD H;  1XPO A;  1PHJ A;  4JI4 L;  4JI7 L;  3GTP H;  3A0J A;  2R6G A;  4ALP A;  4JI3 Q;  1K3R A;  4X66 L;  1TWF H;  1VQ6 A;  2XTI A;  2N78 A;  4GOP A;  5IE8 A;  4OX9 Q;  5C3E G;  2KCM A;  4LFB Q;  4K0K L;  4AIM A;  1N36 L;  2L15 A;  3HOY G;  4A3B G;  1Y1W H;  3I4O A;  1OXV A;  1M1K C;  5GAH C;  4DV3 Q;  3H15 A;  4JYA L;  4APV A;  2OCE A;  3JC6 6;  4LUV A;  3UE1 A;  1HR0 W;  1SRU A;  1HNX Q;  2E5L L;  3TS2 A;  4A3C H;  3L2P A;  1G6P A;  1NJI C;  4A3D G;  4LF4 L;  1EFW A;  1VQ9 A;  1GVP A;  1D7Q A;  1IBM Q;  5IYC H;  3UDG A;  3J7A 5;  3UDF A;  3HOV H;  4A3I G;  1I50 H;  4GS3 A;  3HKZ E;  1JE5 A;  4IJL A;  1HH2 P;  3G6E A;  3CCU A;  5LMN L;  1NMF A;  3J80 c;  1OTC A;  1GO3 E;  3UDI A;  4JYA Q;  3CC7 A;  4B3S L;  2NVQ H;  4JI0 L;  2K5N A;  3BZK A;  3ER0 A;  2N8N A;  5M5Y H;  2YTX A;  3T1Y Q;  5M5W H;  4IO9 A;  1HZ9 A;  1A62 A;  4HJ7 A;  2N3S A;  1A63 A;  3PF4 A;  4DUZ Q;  2R93 H;  4DKA C;  1YEZ A;  1I5F A;  1KC8 C;  4A93 G;  3I2Z A;  2NZO A;  3S15 H;  1VQK A;  2I5L X;  3CP0 A;  3BU2 A;  1Q12 A;  3RLN A;  4IPC A;  1PFS A;  1ASY A;  3GTQ H;  3CPW A;  1X56 A;  1Z47 A;  4B3M L;  4JI2 L;  3CCJ A;  1J5E L;  2UXB L;  1EQR A;  2PI2 E;  1VQP A;  4A3M H;  2JA5 G;  2AWO A;  2A8V A;  1SE8 A;  3ULL A;  1NY4 A;  2WAQ G;  3B6Y A;  4DK6 C;  2IX0 A;  1VQL A;  2ATW A;  4UP8 A;  4IPH A;  4JI6 L;  2HQL A;  1YJ9 A;  4KHP L;  3F1Z A;  4BA1 I;  3S1M H;  4DV6 Q;  4UY8 C;  4X62 L;  3J7Z C;  2Z6K A;  3EN2 A;  1WCM G;  2WB1 G;  4JI2 Q;  5IWA L;  1SLJ A;  4DR3 L;  1HNZ Q;  2EQS A;  3MEF A;  2MNA A;  3CCL A;  3K0X A;  2C35 B;  4QIW E;  2F4V L;  1CSP A;  1P16 A;  1GM5 A;  1VQF A;  3M4P A;  4KHZ A;  2DGY A;  4LF5 L;  4JV5 L;  1PH2 A;  4YWM A;  3CME A;  1K0R A;  2JK8 A;  1WOC A;  2Z6K C;  2RHS B;  2JEB I;  3PIO A;  4DV2 L;  4GNX C;  2VL6 A;  3SGI A;  2QGQ A;  1L1O B;  2MO1 A;  4DR3 Q;  3IRB A;  5GRO A;  4LF6 L;  4LF9 Q;  4JBM A;  2F4V Q;  5FJ8 G;  4PG3 A;  4B3T L;  1UEB A;  3H0G G;  4DR2 L;  1QVF A;  3PO3 H;  4B3M Q;  2VQE L;  1IZ6 A;  4L5T A;  1KIX A;  4DR6 Q;  4POG A;  4DR7 Q;  1PYS B;  4UPA A;  5FLX c;  3RR5 A;  4C3J H;  4BBS H;  1CUK A;  2Z0S A;  3GD7 A;  1E1T A;  3OTO L;  2JE6 I;  3HKZ G;  4GLX A;  4B3T Q;  4YY3 L;  1IYJ B;  5IP7 H;  3KDF A;  4DV4 L;  2ZTE A;  4DV7 Q;  4DR2 Q;  1VQN A;  3UE0 A;  4NXN L;  2Q2I A;  4L5S A;  2KHJ A;  2NN6 G;  1PH4 A;  4QY7 A;  3W1G A;  2XGT A;  1PH5 A;  1FJG L;  2BA1 A;  4B3R L;  3CPF A;  4A3J H;  1Y1W G;  4OON A;  1Q7Y C;  3CQZ H;  1Q86 C;  4OWT B;  3RLF A;  5C0X I;  4QGU A;  2UXC L;  1JJC B;  1N9W A;  1S3O A;  2PI2 A;  4LF8 L;  1Q8K A;  1VCI A;  3CAM A;  2WP8 J;  1KQS A;  4DV0 Q;  5AJ3 L;  2ZJR A;  4DV4 Q;  1XPU A;  4GKK L;  4A3C G;  4NXN Q;  1HZB A;  3CXC A;  1V9P A;  5IP9 H;  2NVT H;  3GDE A;  1UE6 A;  5JEA J;  4BBR H;  4RMF A;  5IYC G;  1K83 H;  2JA8 H;  3S16 H;  1FJG Q;  3ERS X;  3HOV G;  4MNO A;  2VY3 A;  4P72 A;  4R4O A;  4OWX B;  4B3R Q;  4IPD A;  4POF A;  2HIX A;  3PF5 A;  4LF8 Q;  3NEL A;  5GQO A;  1IXR A;  2YYZ A;  1I94 L;  3KYH C;  1Y14 B;  4MZ9 A;  5AJ3 Q;  2ES2 A;  5HGQ A;  1IBL Q;  3CCM A;  1LTL A;  4DV1 L;  2VQF Q;  4JI3 L;  1CKN B;  4A3G H;  2CWP A;  5JEA G;  5LMN W;  1HNW Q;  1LM0 A;  2IHE A;  2PMZ E;  2R93 G;  1Y1V H;  4OX9 L;  4LW1 A;  3T1H Q;  4YWK A;  4DR5 Q;  1KXL A;  1FGU A;  1X3E A;  3W5O A;  2UXD Q;  3NEM A;  1O7I A;  2AHO B;  4JBW A;  4R1J A;  1AE2 A;  5C4J H;  2D0P A;  2QEX A;  1GD7 A;  1PV4 A;  1HNX L;  1HJP A;  4X6A H;  4DV1 Q;  1BVS A;  2VS1 A;  4P73 A;  4A3M G;  2NN6 I;  4NXM L;  5M3F H;  2VZA A;  1EYG A;  2B63 H;  3M7N A;  3NEN A;  2OQ0 A;  2R7D A;  2ZJP A;  1IBM L;  2GVB A;  2UUB L;  4LF7 Q;  1X65 A;  5HY6 A;  4LUZ A;  3E9I A;  1VQO A;  1KD1 C;  1QUQ A;  1X6O A;  3KJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...