4BY7H

Elongating rna polymerase ii-bye1 tld complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7H00
2RHQB 3S15H 4IJLA 1AE3A 3K80C 4NXNQ 5IP7H 3GTOH 4A3BG 3KYHC 1PH2A 1KD1C 4POGA 4A3DH 3STBD 1XNRL 3HOWG 3PO3H 4GKJQ 1PH1A 2UUCL 4A3LH 1HH2P 2JA5G 3KFUA 4R4TA 2JA8G 3S1NH 5GQOA 3CCLA 4J15A 4EX5A 1YNXA 3CCVA 2OTJA 1EIFA 2OCEA 4DR1L 2CFMA 1BBUA 1SN8A 2RCNA 4BY1G 4DR6Q 2I5LX 1QVGA 1BKBA 5K36G 3TREA 4DUZQ 1IBKL 3A5ZB 1N32L 3L0OA 3CXCA 4A76A 1E24A 3CCMA 2Q2TA 1YVCA 5GROA 4DUYL 1TWGH 4B3RQ 2UXDL 4YCVA 1UE6A 1TWAH 4LW1A 4JI1Q 4IFDI 1EIYB 4BBSH 2K52A 1OXSC 1G6PA 2WAQG 1ASZA 4JI0Q 1N36L 3HOZG 2JA6G 4DR4Q 4GOPB 4OX9L 2Q2HA 1L1OC 2F3IA 2ZM6Q 4A93G 1CKNB 1VQGA 4C3HH 1VQAA 1PHJA 4DR3Q 4ME3A 2CCZA 2HHHQ 4JI3Q 5LMNQ 5GAEC 4LF6L 3DM3A 1X55A 1TWFH 2UUBL 2B63H 1EOVA 5M3MH 2HT1A 4Y52H 1IYJB 4DV7Q 3T1YL 1SR3A 5C4XH 1NE3A 3GTLH 1Z47A 3TQYA 1OXXK 1XTDA 4PZ6A 4YHHQ 2RF4A 4DV3Q 2OQKA 2NN6G 3BJUA 4XIGS 3OYYA 3HOXH 3F2BA 4OWXB 3CMAA 1Y1WH 1P8LA 2Z0SA 1WI5A 4JI2Q 3G71A 4GN4B 1VQEA 2K4KA 5H1SE 1QZHA 4LF4Q 3WWVA 1V9PA 1HNZL 1T9HA 4WJ3M 4OWTB 2K14A 5AJ3Q 5LMNW 2YTXA 1N34Q 3AYHB 1XNQQ 4UP8A 1NJIC 2B3GA 2QA4A 2FXQA 1VQJA 1GVPA 4X66Q 4DV5Q 4A3KG 3HOVH 1PYSB 1WCMG 4IJHA 1JJCB 3UDGA 5IY0A 4HJ5A 4IFDG 4IOCA 5E7NA 2CWAA 1SE8A 2KHIA 3PUZA 4KI0A 3I7FA 2XGTA 4C3IH 4JI0L 3OTOQ 1SROA 4KLKA 2PMZE 1N33Q 3HOUH 2VUMH 3FP9A 4UP9A 4LFAQ 2I5HA 2ZM6L 3M85A 5GAHC 4P73A 2VNUD 4DR3L 4B3ML 4MNOA 5FJ8H 3H3VH 4DV7L 2Y0SG 1RIPA 2MO1A 3S14H 1G291 3PF5A 1GD7A 1VQDA 4OWWB 3HKZE 4DR7Q 4UPAA 4DV3L 2EXDA 1Q1EA 1UE7A 2YU9H 4JI7Q 3CCQA 4C2MH 3RN2A 1HZBA 3KJOA 4JI2L 3S1MH 1X65A 1AE2A 3I4OA 3AFQA 2ZTDA 1PH9A 1XPUA 3I4MH 4A3GG 3L7ZC 1N9WA 5IP7G 4YWKA 3F2DA 1K8GA 2UU9Q 3D0FA 5AJ3L 2VQFL 3EN2A 4POFA 2N8NA 4LF9Q 2A8VA 2N78A 2HIXA 1N34L 1Y14B 4AIMA 3J81i 4LF8Q 2MO0A 4O0AA 4JBMA 1PA6A 4L5SA 1NBWA 3CC4A 3JAMc 2D0OA 2YTVA 3PV0A 3FKIH 3I4NG 2PI2E 1VQBA 3KF8B 3LGJA 5IP9H 4DV5L 2HQLA 3T1HQ 4YCWA 3A5UA 5FLXc 1YITA 2PNHA 4PMWA 4LFCQ 4GNXB 2IX0A 2LXJA 4JI8Q 4A3EG 2LXKA 3UDXA 3S16H 4DV4Q 1GKHA 1J6QA 3RLOA 1GM5A 1QZGA 1WOCA 2DUDA 1N33L 4TVAB 4LUZA 4LNQA 4LFAL 5IYBH 1NY4A 1DGSA 1I6HH 3H0GH 1KIXA 4AYBE 3GTGH 1R9TH 4DKAC 3SGIA 3CPFA 4QIWE 3BZCA 5M5WH 3HKZG 3K0XA 4L5QA 4DR7L 1HJPA 1OTCA 2VL6A 1S40A 1PH4A 4JI7L 5C44H 5GADC 4A3JH 3K7UC 2B63G 3S1QH 4IFDJ 3AFPA 3H3VI 1Q7YC 5C4XG 1LTLA 4A3CH 4JC0A 2R6GA 4O2DA 2PQAA 4A3LG 2R92G 1A8VA 3HOXG 2UU9L 3M9BA 3KDFB 2ZJRA 1Y1WG 1M1KC 2BH2A 1VQFA 1GO3E 3KF6A 4A4IA 2AWOA 3CQZH 4LF8L 4IPHA 4LF7Q 4YWLA 4QL5A 3J80i 4IPCA 4R4QA 4JI6Q 4NPSA 1EUJA 1CKOA 3B6YA 2VZAA 4X62Q 3GTQH 2IY5B 3PCOB 4LFCL 2IHFA 3RLNA 3S1RH 5ELNA 2KHJA 3GTKH 4ALPA 1YBYA 4JI8L 4DV1Q 1Q82C 4IO9A 4PZ8A 4DV4L 1FL0A 5M5XH 2KCMA 3HOVG 4HJ8A 4X6AH 4A3IH 4MTNA 4K0KQ 1EWIA 1X56A 3FHWA 1KAWA 1I94Q 4P71A 2BA0A 4AYBG 1KHIA 4QJFA 2MNAA 2Z6KC 4DR2Q 2JEAI 1OXUA 1KQSA 2NVQH 4LUOA 1D7QA 1TWHH 3HOUG 3GD7A 4BY7G 2NZHA 4GLAC 3K8AA 2JJQA 2R7FA 3PSIA 5IYCG 3U58A 5JJKA 4JCVE 2IX1A 4DV6Q 1FJGQ 5FJ8G 4GKKQ 2Y0SE 4JI5Q 1L1OB 3ULLA 4KHZA 3RZOH 3BZKA 2QGQA 3W1GA 5GAGC 2VQEQ 4NXNL 3GTJH 1PH8A 1PYBA 3HFZB 4JOIA 5C0XI 1HR0Q 3PO2H 4GKJL 1MJCA 1VQKA 3KOJA 4QQBX 3I4MG 5C3EG 1LUZA 3GO5A 2C35B 4R1JA 5LMUQ 3S2HH 4DR5Q 4GLXA 4JV5Q 4BBRH 4Y7NH 1SMXA 4DR6L 1CSPA 4R4IA 3CCJA 1S72A 2VY3A 1B70B 4YY3Q 4DUZL 1XJVA 3KJPA 4IPDA 4DV1L 2YTYA 3MEFA 1JE5A 4AQYQ 3CCSA 1B7YB 2E2HH 1CSQA 1HR0W 4B3RL 1MKHA 1M90C 4JI1L 4DV2Q 4GLVB 2F52A 2PQAB 3E9HA 1L2FA 1SRUA 1IXRA 4H02A 2GVBA 4YCUA 4DR2L 1PH5A 4X65Q 4DR4L 5M3FG 3KF6B 2NVTH 4HIMA 3M3YH 5IYBG 2OQ0A 3PIPA 1K8AC 2DGYA 4JI3L 4DV6L 2HHHL 1HZCA 5LMNL 3RZDH 1YJ9A 3RNUA 5FLMH 1K83H 1VQIA 3UDFA 4B3SQ 4JI4Q 1E22A 1TXYA 4UY8C 2E8GA 2KCTA 1CUKA 1X3FA 4YHHL 3S2DH 1JJGA 2ZJQA 4OXPA 4GS3A 5C0XG 3CPWA 4A3JG 1J5EQ 1VQNA 4LFBQ 1KRSA 1HR0L 5ELOA 3CW2C 3ERSX 4P75A 3I2ZA 3NEMA 1WFQA 1MJEA 5LMUL 4P74A 4LF4L 3HOZH 2B29A 4A3DG 1CKMA 2UXBQ 2CKZB 2GVAA 1PH6A 4NXMQ 5IYDH 4A93H 1Z9FA 1A62A 1XNQL 3ZJYC 1NMFA 1VQ8A 1YJNA 2Z6KA 1YHBA 4X66L 2ID0A 2EQSA 4JOIC 3U4VA 4AH6A 1LM0A 1U0LA 4B3TQ 2UXCQ 1H95A 4DV2L 2IHEA 1Q86C 2R7ZH 1EQRA 4GN5A 4EQ5A 2E2IH 1YJWA 3OTOL 2Q2UA 3PUXA 2K50A 3W1BA 4A3IG 2BH8A 1I3QH 1K3RA 2K5NA 4L5RC 1VQ4A 4BBSG 3RN5A 4BXXH 2WB1G 4IPGA 3NBHB 4JG2A 1IBLQ 4DAMA 1IL2A 4B3SL 3CP0A 2R7DA 3HKSA 1RL2A 1HZ9A 3U50C 4A3MH 4DAYB 2AKWB 3M4OH 1LYLA 2D0PA 3PUWA 1WCMH 1J5EL 4DK6C 5M3MG 4LFBL 1HNWQ 1D8LA 3CCRA 1IBKQ 1PH7A 2Q2IA 1OXTA 1QVFA 2N49A 1JJ2A 2IT1A 3KLWA 1N32Q 3EIVA 2KBNA 3RR5A 3CAMA 1A63A 3NENA 1N8RC 4DUYQ 3F8TA 4NXML 1QUQA 3CC7A 3J81c 4LF9L 2I0QA 3PO2G 2KENA 4PZ7A 2UXDQ 3G48A 2NVXH 4YWMA 3A0JA 4XTCS 4C3JH 2OTLA 1PV4A 3G6EA 3CCUA 2YYZA 2AMCB 1NTGA 2CWPA 1KC8C 1Q81C 4BBRG 1TWCH 4OX9Q 2CQOA 3TS0A 1E1TA 4LWCA 3T1HL 1YEZA 5JJIA 4JBJA 2UXCL 3STBC 4HJ9A 1OXVA 1FGUA 4DV0Q 1I5FA 3IRBA 1YZ6A 2ZJPA 3TS2A 5C0XJ 2UUBQ 1VQMA 2K5HA 3MXNB 1E7ZA 2E5LQ 3T1YQ 2MQHA 1WYDA 4JBWA 2XTIA 2WP8J 5JJLA 2ES2A 4A3GH 1VQLA 1Y1VH 3J7A5 2JA7H 3ULPA 3F2CA 4OO1I 1A0IA 1Q1BA 3I56A 2NN6I 3RLFA 3CF5A 1VQ7A 1IBMQ 1YHQA 2K75A 1X3EA 4A3FH 1IBLL 1K9MC 2VUMG 4JYAQ 5JEAG 4DPGA 1HNXQ 3UE0A 1MIUA 3PUYA 5J3BA 4X64Q 1BVSA 1HNZQ 1EFWA 3HOYH 3I4NH 1B8AA 1HNWL 3Q8DA 5FLMG 2VS1A 1BBWA 1P16A 1VQ6A 4LUVA 3K7AH 4A3EH 4IOAA 2JA9A 3TRZA 4OONA 2HIVA 3I55A 4GOPC 2E2JH 2F4VQ 3CCEA 1VQPA 1FVIA 4DK3C 1V43A 2ATWA 1VQCA 4LF7L 3EBEA 1VCIA 3E9IA 1VQHA 1VQ9A 2A19A 1PH3A 4JI6L 3GTPH 2ASBA 4BA2I 3GTMH 5IYDG 4HJ7A 4X62L 1SLJA 3M4PA 4TQUS 3J81j 4B3MQ 4DV0L 4UP7A 2GN5A 2QEXA 2R93H 3FKIG 2E5LL 3AQQA 3CD6A 4APVA 5IP9G 4FDBA 1AH9A 3PO3G 2UUAQ 4GNXA 4K0KL 1I94L 3JAMi 2NVYH 1C9OA 4P72A 3J80c 2R92H 4A3BH 2R7ZG 1KRTA 1Q46A 4QGUA 3PF4A 5M5YH 3TEHB 1IBML 3HOWH 4PG3A 3S17H 2JA5H 1QUQB 2JA8H 3DLLA 2RHSB 5HGQA 2OWOA 4JYAL 3UDIA 3ULJA 5BR8Q 1HNXL 4L5TA 5IE8A 4X64L 2UXBL 3H0GG 2NZOA 2VQFQ 4BY1H 4BXXG 1FJGL 2WB1E 4RMFA 1SFOH 4HIKA 4GKKL 4JI5L 1KXLA 3G4SA 1WJJA 4RG1A 2VQEL 1PVOA 2ALYB 5C44G 4HJAA 4A3MG 2A1AA 1XMOQ 1JB7A 1E1OA 2F4VL 2V1CC 2N3SA 1KL9A 3UE1A 1ASYA 1V1QA 2K5VA 2I5MX 2EIFA 2H5XA 3M7NA 3JC66 1C7YA 4A3CG 1PFSA 3KDFA 4QY7A 4KHPQ 4DR5L 3ER0A 4HIOA 2JA6H 4JBKA 4JV5L 4WJ4A 1X6OA 4BY7H 2JEBI 3D31A 5JEAJ 5IYCH 5IWAQ 3S24A 3ICEA 1X9NA 3NELA 4YY3L 5C4JH 3F1ZA 4LF5Q 3VDYA 1YI2A 1XMQQ 1EYGA 2JK8A 2WFWA 2PI2A 3W5OA 4AQYL 2UUAL 1NMGA 3PUVA 4GN3B 1QVCA 1XPOA 4NB3A 1Q8KA 3AEVA 4OO1G 1YHAA 5IT9c 1JMCA 1UE5A 4MZ9A 2ZTEA 3A74A 2JQOA 2MFIA 2AWNA 1YIJA 4X65L 1UWVA 1VQOA 1X3GA 3CMEA 5C3EH 1VS0A 1Y1VG 3U4ZA 5BR8L 2JA7G 2VW9A 1VQ5A 1HZAA 1XPRA 1Q12A 4GOPA 1XNRQ 2JE6I 2ZTCA 4R4CA 3PIOA 2UUCQ 1K73C 4A3FG 1EQQA 4A75A 1CKNA 5EAYA 5HY6A 3BU2A 4BA1I 4HIDA 3K81C 4GNXC 4JI4L 3HOYG 4DR1Q 4A3KH 1XMOL 3H15A 1U5KA 1L1OA 3L2PA 1C0AA 1K0RA 4KHPL 1O7IA 3E0EA 5M3FH 1UE1A 5IWAL 5DLQE 1JT8A 3GDEA 1W2BA 1W3SA 2WAQE 1N36Q 4LF5L 4DNIA 2BA1A 3J7ZC 1XMQL 4R4OA 1X54A 2D62A 3PGZA 1UEBA 2YV5A 1G51A 1S3OA 3M4QA 1L0WA 3OW2A 1E3PA 4B3TL 4LF6Q 1I50H 2AHOB 2R93G 3CC2A 1IZ6A 2L15A 2LSSA
chains in the Genus database with same CATH superfamily
3GV3A 2R93B 1EQTA 3K80C 3GTOH 5FO7B 1LACA 1LT5D 3HOWG 4JPBW 1PH1A 2UUCL 4R4TA 2JA5B 2CFMA 1BBUA 4BY1G 5K36G 3TREA 4DUZQ 4HCSA 2F0DA 3IFTA 1N32L 3CXCA 5E4XA 4XT1B 4ZKCB 1ICFB 2FINB 1TWGH 2PYKA 3MXUA 4FNFA 4O42A 4B3RQ 2QILA 1UE6A 4LW1A 4I65A 5FK9C 2WAQG 1N36L 1EIGA 2F0PA 4DK0A 5JPNC 1TS5A 2GA4B 3TN2A 2ZM6Q 4A93G 4C3HH 2JXMB 1WD1A 2QCPX 1L0YB 2HHHQ 5GAEC 1TWFH 4Y52H 4DV7Q 3GTLH 4F88A 1OXXK 4IALA 4PZ6A 2RF4A 1I6HH 2NN6G 3MC0B 1LTTD 1HA5A 1U9RA 2PW7A 3F2BA 1EYAA 1UUPA 2K7VA 1WI5A 3VYSA 1QZHA 3TDQA 1EEID 1V8QA 1B4OA 4TRDA 4JVZA 2B2YC 4OWTB 1I3QB 2WKCA 3D4RA 4BS9A 1EIHA 1E2WA 4UP8A 1NJIC 1QILA 2B3GA 1ET6A 4CKCA 4DV5Q 4IUPA 2F4IA 1PYSB 1JJCB 2SNMA 3EVQA 1E2ZA 5C5LA 3PUZA 1WCMB 2EY1A 1D2BA 4N9TA 2PMZE 2K6AA 2B39A 2VUMH 4TSSA 2WV6D 3SK5A 2ZM6L 1U4MA 2E75C 4B3ML 4FO2A 1WTRA 5FJ8H 3H3VH 2B2UC 4DV7L 3S14H 1IKMA 1G291 2K1BA 2M9VA 3T4AC 4UPAA 2YU9H 2EXDA 1FD7D 1Q1EA 5NUCA 1DD2A 2KEEA 1HZBA 1X3QA 3FEWX 3H6MA 2F0FA 1YNNC 4K8JA 3I4MH 1B9NA 3F2DA 1DZ1A 3J80E 3EN2A 3PO3G 1Y1VB 2N78A 3J81i 1T5XD 5TSSA 1NBWA 2IPKD 3JAMc 3PV0A 3VR3A 4Q5VA 3TP5A 2A6HC 4DV5L 4A3FB 4YCWA 2PNHA 4K5XA 2XSCA 3K6OA 3T13A 4JI8Q 4DV4Q 1LABA 3W2DA 1GM5A 1K8OA 5JVG3 2PMZB 3WDNA 2BDNA 1R9TH 3SGIA 1GHJA 5M5WH 4L5QA 2K04A 5C5MA 1H9MA 2JN4A 1JWSD 3GTPB 4HCEA 4NMZA 3GTMB 1T5EA 4J1MA 2B63B 2R6GA 2ICIA 4O2DA 2K5DA 1EL0A 4DFAA 1Y1WG 1TR5A 1IL8A 3KF6A 4A4IA 2EJMA 4IPHA 3A8IE 5IGCA 5I9PA 3S17B 4K6DA 2RKSA 3MXPA 3VR4A 1RTNA 3H09A 4X62Q 3GTQH 4OO1H 1JQYD 3S1RH 2KHJA 4ALPA 1YBYA 4JI8L 1Q82C 2XWJB 4DV4L 4LJZC 1KTKA 2EYHA 2KCMA 4A3IH 2C9OA 3FHWA 5LL6S 1KAWA 4DXFA 1NR2A 4CDDC 2JEAI 2NVQH 1KQSA 1D7QA 1XX8A 1H9JA 4BY7G 3X3MA 3U58A 1U4LA 4JW0A 4DV6Q 3ND8A 5KGUA 1ESRA 4GKKQ 2RDFA 2Y0SE 1GUWA 1L1OB 5J1ZA 4WJWA 2QGQA 2VQEQ 4NXNL 4JOIA 3D4WA 5C0XI 1QB5D 2ENBA 5E3FA 4QUFA 4R1JA 2OF1A 4GLXA 1TS3A 4Y7NH 1ML0D 5C3EB 4YY3Q 3NHHA 3E5SA 1XJVA 3KJPA 4IPDA 4NP5A 2KJXA 3MEFA 1UEAB 1JE5A 3CCSA 4KD3A 1HR0W 2HCCA 4JI1L 4H02A 4DR4L 4XQQA 5M3FG 5EKLA 3HEJA 1XYIA 4HIMA 2BDOA 2OQ0A 4JI3L 4DV6L 1DOLA 3RNUA 4V190 5FLMH 4RGNA 1HRJA 2I07B 3OWEB 1PTOC 2Y0SB 4GS3A 3A8JE 5EGTA 2XIWA 5KNDA 4P75A 5BN3A 4A3JB 1B44D 4A3DG 2L9HA 2CW0D 2CKZB 1PH6A 3VR5A 4A93H 1CZGA 2F0OA 3SDZA 1FR3A 1YJNA 2X69A 1YHBA 1YNND 2EQSA 2B2TA 2EY5A 2Z9HA 2KOLA 3PIO3 1H95A 2L0CA 4MHEA 2NN6H 3U9SA 1EQRA 4EQ5A 2R7ZH 1ENFA 2Q2UA 5I4DA 3W1BA 4LAAA 2A6HD 1K3RA 2J4XA 4JK1C 1VQ4A 4LMQD 3SXHA 1TWGB 2WB1G 3NBHB 1RF2D 4DAMA 4M8AA 3NTIA 2E2DC 1HZ9A 4A3MH 3PUWA 3T56B 5KYLA 4C3HB 3CCRA 1OXTA 2L11A 3KLWA 1TWFB 2KUMA 3CKIB 3HZXA 3NENA 5G3LF 1N8RC 2KHSA 3GTLB 1HFNA 1LTGD 3QIAA 3PO2G 4PZ7A 2NVXH 4ZCKA 1I6HB 4C3JH 3J80L 2AMCB 1NTGA 5JVH3 1Q8IA 3O13A 1Q81C 4OX9Q 1E1TA 1PMRA 1YEZA 2DY8A 1I5FA 3JAME 1VQMA 2UUBQ 1KLUD 1E7ZA 1RDPD 3MXNB 5CYUA 2E5LQ 1WYDA 2XTIA 2ES2A 2F0JA 1TQOA 3J7A5 3ULPA 3F2CA 3BYTB 1EY8A 1X3EA 1AP0A 2G9HD 3UE0A 4X64Q 5J3BA 1O7ZA 2VUMB 3V05A 1VF7A 3VA7A 2VS1A 1VQ6A 1TY0A 1A2TA 1K83B 1F2LA 3I55A 2E2JH 2MP1A 3D4DA 2F4VQ 3S14B 1FVIA 1SMYC 2CHBD 2PNRC 2YU9B 3S2DB 1EY5A 1D6EC 2ATWA 1O80A 1VCIA 2A19A 4K2LA 3DEOA 3I4MB 2DY7A 2SEBD 1F77A 2QEXA 1QCBD 2R93H 1ENAA 2E5LL 4CDFC 2UUAQ 4GNXA 3J7AF 2NVYH 1C9OA 1Q46A 4PG3A 2JA5H 1QUQB 4KKUA 1FNWA 2M2LA 3DMUA 4MTKA 2E2IB 4L5TA 4X64L 3BDOA 1H9SB 2E74C 4R9WA 5EBCA 4UDUC 4F87A 4HIKA 2RBMA 3G4SA 1R9TB 1PVOA 1CK1A 2F4VL 1E1OA 5M5WB 1C4QA 2V1CC 1ASYA 3P1HA 1G8ZD 2H5XA 5DM73 3KDFA 2FMCA 3CRLC 1B53A 4BY7H 4KKSA 2JEBI 4IN3A 5A35A 1STAA 1EWCA 1E2VA 1PZKD 5C4JH 5LHY1 1ICWA 3OOCA 1YI2A 1QE6A 4OHJA 2UUAL 2LMCB 1XPOA 4NB3A 1Q8KA 4ZUJA 3K0YA 5IT9c 3GTQB 3VR6A 2MFIA 3OWFA 1VQOA 1Z7TA 3S1RB 1KABA 1PTOF 3FVQA 2JA7G 1XPRA 1XNRQ 4A75A 1CKNA 4X3TA 3K81C 2NVQB 4EQOA 1SNDA 4IFDH 5CBEE 5I6WA 1K0RA 4ZKBB 3N52A 2RCFA 1ILQA 5M3FH 3K7AB 1WVLA 3QWNA 4NDXA 1JT8A 4EQPA 3WOFA 1W2BA 1FNUA 2WAQE 1LT6D 1X54A 1NR4A 1S3OA 1L0WA 4B3TL 4LF6Q 2B2YA 1S5ED 1RODA 4M1UB 2LSSA 4EGVA 4X3SA 1GJXA 2EZVA 4A3DH 1VMPA 1XNRL 3AB9A 4GKJQ 1HH2P 1D5MC 3S1NH 1EY4A 4DGZA 2A69C 4J15A 1YNXA 3I70A 1G6ZA 1EIFA 2NWGA 1BNZA 4I7AA 1IBKL 1LTSD 3IAYA 3HRZC 1GUNA 3CCMA 1YVCA 4DUYL 1PRTD 4YCVA 1BUVT 1EIYB 1OXSC 4ID6A 4JI0Q 3HOZG 1GUTA 1L1OC 2WAQB 1CQVA 1VQGA 1VQAA 4YIJA 4LF6L 5LMNQ 3DM3A 3KF8A 5KIXA 4A93B 2B63H 2HT1A 4G7HC 5C4XH 2IL8A 5BN4A 2R3ZA 4YHHQ 2EYPA 3JAML 3BJUA 5K5PA 3HOXH 3OYYA 4F8MA 1WTOA 2Z0SA 5CV5A 4JI2Q 1PFNA 1ZXTA 2V4DA 3C3LA 4GN4B 1VQEA 4FF3A 4LF4Q 1V9PA 4WJ3M 2K14A 4FVMA 2L55A 1LLRD 3I73A 1XNQQ 2QA4A 2FXQA 2F0IA 1VQJA 2RQXA 1GVPA 3DWAA 3SK4A 3HOVH 4ZQ3A 1HTPA 4IJHA 1AW7A 4HJ5A 1HUNA 4IOCA 5E7NA 1Y8NB 4A3MB 2EYFA 4B9XA 1SE8A 3I7FA 4JI0L 3IKJA 3LNNA 3OTOQ 5KYIA 3HOUH 3FP9A 4UP9A 3M85A 2VNUD 5CV9A 5CC4A 5CORA 4MNOA 1EZ8A 4FYDA 2NVXB 1RIPA 3VYUA 4C3JB 1JOQA 1SNQA 4OWWB 3UI2A 4DR7Q 1STEA 1UE7A 2A5HA 3CCQA 3TZUA 4C2MH 3RN2A 4JI2L 1SE2A 1AE2A 3I4OA 4UAIA 2ZTDA 1PH9A 1XPUA 3SVMA 4RA8A 1FNVA 1SNOA 1SYCA 4YWKA 5IP7G 1DCZA 2FMMA 3D0FA 1K8GA 2UU9Q 2VQFL 4POFA 1G2SA 4A3LG 2HIXA 3URYA 4LF8Q 2RDGA 1PA6A 3EA6A 4K5WA 1PFBA 3K5LA 1A3TA 5D65A 3T1HQ 2K5QA 3A5UA 1TT2A 3HG9A 1YITA 2IX0A 4A3EG 1S5CD 1GKHA 4PV1C 5AFWA 5IYBH 1NY4A 2E2JB 3GTGH 3VYTA 4DKAC 1GUOA 3CPFA 3M7GA 3K0XA 4DR7L 1OTCA 1S40A 2XRQD 5GADC 4A3JH 4G57A 3K7UC 4ZLTF 4IFDJ 2RA4A 3H3VI 2AUJD 2NB0A 4JC0A 2KQ3A 1A8VA 3I91A 2UU9L 3M9BA 2IW3A 5IT9E 2NVYB 4LF8L 4LF7Q 1SEBD 4O1NA 3J80i 3K58A 4L6TB 4QUCA 3J7YW 4JI6Q 4NPSA 2IY5B 4DXGA 4K6LA 4H44C 3RLNA 3GTKH 4DV1Q 1PRTB 1FL0A 2A69D 2AUKA 4X6AH 4MTNA 4K0KQ 1ZEQX 1M8AA 2BA0A 4AYBG 4CBVA 4HEDA 3BDCA 2PZWA 4LUOA 1TWHH 3S9WA 5JJKA 3K8AA 5IYCG 2F0EA 3NBIA 3H3VC 5EKIA 2K03A 4BY7B 1FJGQ 3VR2A 4C56C 2EYLA 1SYGA 4RGMA 5C4JB 4JI5Q 3RZOH 5E4WC 3BZKA 1DJRD 1G2TA 5CGKA 4QQBX 5JJZA 1MJCA 1VQKA 3GO5A 1PYWD 4DR5Q 4JV5Q 4CDEC 2EY6A 1S72A 1B70B 1ILPA 4DUZL 1Q90A 4DAYA 4DV1L 1II3A 4S3SA 4WORA 4ODGA 1BXTA 4AQYQ 2E2HH 4B3RL 3A56A 1MKHA 4GLVB 4WRDA 3E9HA 1I4GA 1DOKA 4OO1I 1QNKA 2GVBA 2Z1CA 2G5DA 4ULLA 3KF6B 2NVTH 1HXYD 1LTRD 1AN8A 4H13C 5M3FB 5IGEA 1K8AC 2HHHL 3RZDH 3QOLA 1YJ9A 1K83H 3I4LA 4X3KA 5CMDA 4B3SQ 3A7AB 4UY8C 1TXYA 2B2VC 2E8GA 2CW0C 4R8NA 3S2DH 3MA2B 4OXPA 5C0XG 1VQNA 3MWYW 2IJ0A 5ELOA 4KTAA 3D8GA 1I4HA 3ERSX 3I2ZA 1MJEA 1WFQA 4OEMB 4QB4A 3HOZH 2B29A 1CKMA 2DN8A 1JC7A 4OIKA 4NXMQ 5ELCA 1Z9FA 4RAUC 4A3DB 4X3UA 3ZJYC 1NMFA 5I6YA 2Z6KA 4HR7B 1AZQA 3S1NB 2CH4A 5E1FA 3U4VA 5CV7A 2UXCQ 3HGBA 2IHEA 1Q86C 2LY7A 4WFN3 1SDFA 2E2IH 4K8IA 2RDHA 1CHPD 2ZXPA 1JOKA 2ZXRA 5M5XB 3TP6A 2JP1A 4BXXH 1IBLQ 1IL2A 4B3SL 3GQBA 2KEDA 1RL2A 4XQNA 2MGSA 4CHTB 2B8FA 1HNWQ 3TZDA 5EPLA 1QVFA 3D6CA 1IYUA 2KBNA 4PNYA 2JSOA 5C4XB 4NXML 1BOSA 3CC7A 2UXDQ 1PZID 4LK1C 3HOXB 3A0JA 2OTLA 1PV4A 3G6EA 3CCUA 3PO2B 3M4YA 4EQNA 4BBRG 1TWCH 3S2HB 5JJIA 2UXCL 1FGUA 3IRBA 1YZ6A 2ZJPA 3TS2A 3W3AA 2Z6BA 3T1YQ 2MQHA 4CKEA 1VQLA 3DWQA 1A6XA 3ND9A 3HOVB 2NN6I 1IBMQ 4C1NK 5IGBA 2QDLA 1IBLL 1NUCA 2LS01 1SJED 4JYAQ 5JEAG 4DK1A 1HNXQ 4OELB 3PUYA 1HNZQ 1PDQA 1EFWA 1I4QA 3HOUB 3M3YB 2K33A 1HNWL 2SNSA 2F0UA 3K7AH 4A3EH 3TRZA 4OONA 5C3WA 1J9OA 2A6ED 4C2MB 2P5ZX 1MHWC 3E9IA 4V0BA 2O2LD 5IT9L 1BCPB 4XQJA 5IYDG 1EU4A 4X62L 3M4PA 1ZKOA 2GN5A 1JE4A 3AQQA 4APVA 5IP9G 3JAMi 4P72A 1PXUA 1CTMA 1LV9A 2PO4A 2X6GA 1IBML 3HOWH 2L4NA 2Z8LA 4JYAL 1HNXL 3H0GG 2NZOA 4BY1H 1B1ZA 3PQIA 5K36H 3Q22A 3NPPA 2AQ3B 4GKKL 2LFNA 3GTGB 4I7ZC 1S4ZA 1SBBB 1Y8PB 2VQEL 5DM63 2Z4HA 1JB7A 3WOEA 2QDBA 5IODA 2K05A 2EIFA 1PFSA 2RSNA 3D31A 5IYCH 1X9NA 3NELA 3C1EA 1X32A 4YY3L 3H91A 4B08A 1BBXC 1K0SA 1B9MA 3R2IA 2JK8A 2WFWA 1G91A 5HURA 4G7OC 3MFGA 1JMCA 1UE5A 2AWNA 1YIJA 1UWVA 5ELFA 1WD0A 3GTKB 1Y1VG 2VW9A 4HMJA 1HZAA 1Q12A 4GOPA 2JE6I 1HUMA 2OEOA 3TMEA 1K73C 4A3FG 5HY6A 3BU2A 2A68C 3BS1A 1TWHB 5J22A 3HOYG 5DNFA 1U5KA 1L1OA 3KK7A 5C3XA 1C0AA 1MD2D 1W6KA 3DXJC 1XXGA 4E6IA 1UE1A 1CHQD 3RZOB 1FYCA 5IIFA 3R2TA 1W3SA 2TMPA 4XXEA 1K28A 2CQAA 4DNIA 2BOSA 4R4OA 3PGZA 1UEBA 3OMCA 3M4QA 2EY2A 3VYRA 1BO0A 3CC2A 5L37A 1MSGA 1S5DD 3NXWA 1O7LA 4C1NI 2RHQB 4IJLA 1AE3A 4A3BG 2M00A 1PH2A 5C6AA 4POGA 2E2HB 3PO3H 4RKLA 2JA8G 2HDLA 5GQOA 3CCVA 4EX5A 2OTJA 1PRTC 2D2CC 1SN8A 2RCNA 3RMHA 5CV8A 4DR6Q 2NVTB 2L5TA 1BKBA 1A3VA 4ZYSA 5EPJA 3A5ZB 3RZDB 4BWGB 3L0OA 4A76A 3GP7A 1STGA 5T1GA 1S5FD 2F0NA 4IFDI 1DM0B 3QO2A 3I72A 1EOTA 2DJFC 2JA6G 4GZYC 5D3IB 4OX9L 3OIPA 2F3IA 1JICA 3HOZB 1SSOA 1CKNB 4P2CB 2CCZA 3QR8A 1E0BA 2F0KA 1TIID 1X55A 2UUBL 2ZXOA 1IYJB 1Z47A 3E6ZX 4DV3Q 2OQKA 3NQIA 1A3UA 3Q6SA 3CMAA 1Y1WH 4XDXA 3QOJA 1A2UA 2K01A 1V1PA 3K5NA 1QWYA 3BZDB 3G6JB 4IZ8A 1T9HA 5AJ3Q 3NBHA 5LMNW 2YTXA 1N34Q 1SE4A 3AYHB 3C2PA 2XVSA 4X66Q 4A3KG 3NP8A 3SE0A 5M9OA 4R8IA 4IUNA 2CWAA 1VF5C 1SROA 4LFAQ 2I5HA 4QMGA 5GAHC 4P73A 1EYCA 4U68A 1H9RA 1JCKB 3SEBA 2Y0SG 1DYQA 2MO1A 2EYMA 1GD7A 1EQVA 1VQDA 3NE5B 3P75A 4DV3L 3BVGA 4JI7Q 1L0XB 1TWCB 3A54A 1RJTA 5JPMC 1O78A 4HTHA 4RGOS 3AFQA 5CR3A 2QKIC 4A3GG 3L7ZC 1N9WA 5AJ3L 5BN5A 2N8NA 5KNCA 4LF9Q 1N34L 4FF1A 2A8VA 4AIMA 2MO0A 4JBMA 4L5SA 4K2KA 5KNBA 1XWEA 2D0OA 1GXDC 3I4NG 2PI2E 3KF8B 3LGJA 4IUUA 5IP9H 2HQLA 2WACA 5DEHA 3C46A 1I4XA 3UDXA 3MZ5A 3KLSX 1J6QA 2A68D 1WOCA 2DUDA 2F3VA 4LUZA 3E0JA 4LFAL 4A3EB 3H0GH 1KIXA 4AYBE 3I3CA 2EYOA 3MHBA 4DAPA 1TWAB 3FDTA 4CGYB 3BZCA 3HKZG 4RCNA 4G7ZC 1TU2B 1HJPA 4KV6A 2VL6A 3A7LA 5EBDA 4JI7L 1RTOA 3S1QH 3V2TA 4K14A 4KY7A 2PQAA 2R92G 2ZJRA 1M1KC 2AQ1B 1VQFA 2L12A 2AWOA 3CQZH 1H9SA 3HOWB 2XN9C 4R4QA 2BE5C 3QJYA 2F0GA 1AZPA 3PCOB 4BY1B 4PZ8A 5FOBB 1C48A 5M5XH 2B2UA 1F9RA 1DONA 1EWIA 1X56A 1I94Q 4P71A 2B2VA 2SOBA 5C4ZA 1SNCA 2MNAA 4RGTA 2NUCA 4DR2Q 3FPPA 1GUSA 1OXUA 4KK7A 3DUZA 4AYBB 2B2TC 1STBA 2NZHA 4GLAC 2JJQA 3PSIA 5A2QE 1EY0A 2IX1A 5FJ8G 1QG7A 3LWUA 4KHZA 3R8BA 1PRTF 3D3RA 3W1GA 4KJNA 1BCPC 1PH8A 1F9PA 1I6VC 3HFZB 4GKJL 3PO2H 4MN3A 3I4MG 4DNRB 2C35B 5LMUQ 3S2HH 2HD3A 2OXPA 1SMXA 1CSPA 3SHLA 2VY3A 4XT3B 2PCFB 5F2DA 3PIP3 1GHKA 3A8KE 4ZUIA 4DR2L 1PH5A 4YCUA 4X65Q 1WTVA 5JOBA 3S16B 3M3YH 5ELEA 2EXZA 1DOMA 2KCCA 1HZCA 3FMCA 5LMNL 2D9UA 3NSWA 5CBAE 4JI4Q 2XRSD 5IOCA 1X3FA 4YHHL 1SJHD 1JJGA 2H4OA 2ZJQA 1KRSA 4G4KA 5LMUL 1QOHA 4LF4L 2PPBC 5KEEA 2GVAA 1VDZA 1XNQL 1CQFA 1MGSA 1VQ8A 4H7BA 3PO3B 2L1BA 1F2YA 4ABNA 4OL7A 4AH6A 1U0LA 4RHSA 4DF7A 4GN5A 1YJWA 3OTOL 2BCOA 4A3IG 2BH8A 1TS4A 1MSHA 5D3DA 2B2WC 3KLSA 2PW5A 4BBSG 3RN5A 1SNPA 2F0HA 2Q8RE 4RHRA 3BG3A 4L63B 2R7DA 1EY7A 3HKSA 4Z9CB 4DAYB 3M4OH 2D0PA 5M3MG 1D8LA 1BDOA 2Q2IA 1JJ2A 1N32Q 2FHTA 4IQZA 3CAMA 4RWSC 3F8TA 4CJ0B 2KENA 3G48A 3HS0C 2MJ8A 1UAPA 4YWMA 3BYYB 3TP8A 1Y1WB 2CWPA 1EYDA 1HPCA 3TS0A 4LWCA 3T1HL 4JBJA 3STBC 3K5OA 4HJ9A 1OXVA 4BBRB 2KECA 1U4RA 1CZWA 4JBWA 5JJLA 4A3GH 3Q23A 2BE5D 2JA7H 5FO8B 1A0IA 1Q1BA 2EDGA 3F2UA 3CF5A 4ZRZA 4C3IG 4OGQC 4QF4A 4DPGA 1U4PA 1MIUA 4F7XA 1CA5A 1BVSA 3I4NH 1B8AA 2RSOA 2A6EC 3Q8DA 5FLMG 1ESFA 3EQLC 1BBWA 4LUVA 2JA9A 2HIVA 1JORA 2J0TD 3SK6A 3CCEA 1V43A 1EU3A 1VQCA 3K57A 4LF7L 2EOTA 1HQMC 4JI6L 2ASBA 2F0MA 3NQTA 4HJ7A 3Q0AA 1BCPD 4TQUS 3J81j 2K32A 4B3MQ 2CVRA 1LTAD 3FKIG 4FXGC 1WTXA 2A73B 3CD6A 1AH9A 1KDBA 4N8X1 4K0KL 2R92H 4CKBA 2R7ZG 3V96A 4KN7C 1KRTA 4QGUA 5M5YH 2K28A 3DLLA 2RHSB 5HGQA 4KJOA 2OWOA 5FLXL 3UDIA 3AU7A 1BCPF 5LL6X 1FJGL 2WB1E 3H0GB 1SFOH 4JI5L 5A2QL 1KXLA 2I46A 1WJJA 4MIUA 4PMBA 4RG1A 4A3MG 5C44G 1WTQA 1JR0D 2A1AA 2N3SA 3K5MA 1MI2A 3UE1A 1V1QA 2K5VA 2I5MX 3A55A 3M7NA 3JC66 1C7YA 3G7LA 4A3CG 2F03A 4DR5L 3S1QB 3ER0A 4JBKA 4JV5L 1B3QA 1K3BC 5D14A 5IWAQ 1SXTA 4C3JG 3F1ZA 3RUZA 3KLRA 4CDCC 1UNSA 4LF5Q 3VDYA 2Q8IB 3CQZB 1EYGA 5C4HA 1F2ZA 4XYQA 3W5OA 1NMGA 4L8JA 3PUVA 4AQYL 3DEPA 4QCLA 1TVXA 4MZ9A 1EEFD 1PLFA 2FFKB 4PQXA 3CMEA 1HTLD 1SNMA 1VS0A 3U4ZA 2LKVA 1VQ5A 1QJOA 3SR1A 3P7JA 3DHQA 5EQ0A 3PIOA 1EQQA 4BA1I 4HIDA 1JWMD 2WB1B 3KBXA 4DR1Q 1SYDA 1MBYA 3HOYB 3L3OC 3VA5A 3HP3A 1BR9A 1O7IA 2F3WA 5IWAL 5DLQE 1HCZA 1RKNA 2EE1A 4LF5L 2BA1A 3KUPA 3DWPA 2N88A 2YV5A 3OW2A 1SAPA 1E3PA 5I9OA 2AHOB 2KVMA 2R93G 2VB2X 1STHA 1IZ6A 2L15A 4IUTA 3S15H 1LT4D 4ME5A 4KHVA 1KAAA 4NXNQ 5IP7H 3KYHC 1KD1C 1CFMA 3CRKC 2O4XA 3STBD 4A3LH 2JA5G 3KFUA 4A3BB 1HHVA 3CCLA 5COYA 2OCEA 4DR1L 2JA8B 2I5LX 2F0LA 1QVGA 5DAUA 3FRPB 5ELDA 3EJIA 3NWSA 1CA6A 4DN4M 1E24A 2Q2TA 1LTID 5GROA 2SDFA 2UXDL 2NYZD 5EPKA 1TWAH 4JI1Q 2WIIB 2K52A 4BBSH 1KNEA 3TSSA 1ASZA 3CU7A 1STNA 1GUGA 4DR4Q 1EY6A 4GOPB 2Q2HA 4FF2A 3MVVA 1EY9A 2JA6B 4KMUC 3MAQA 1PHJA 4DR3Q 4ME3A 4JI3Q 3J7AV 3N6RA 1AEXA 1EOVA 3C1FA 5M3MH 3T1YL 1SR3A 1NE3A 1HA6A 3T51B 2XWBB 4RCOA 1B3AA 3TQYA 1XTDA 3MFYA 4XIGS 4OWXB 1P8LA 3G71A 2K4KA 5H1SE 3ERQA 3J81E 1NCVA 2E76C 3WWVA 1HNZL 2NZ1D 1Y8OB 3BDLA 3R93A 5JAVA 1K8MA 2H1EA 2F0QA 3AMUA 1S5BD 3OMGA 2IWHA 1WCMG 5EKKA 2F0VA 2NTTA 5T1IA 5IY0A 3UDGA 4IFDG 1J8IA 3NTHA 4A3KB 3U9OA 3M4OB 1SYBA 2KHIA 4KI0A 2XGTA 4C3IH 1KLGD 4KLKA 1N33Q 4FP5D 1Q3LA 4DR3L 3T16A 1TKWB 1LTBD 2G9DA 2DJGC 4J6HA 3PF5A 3TP7A 3HKZE 4KY6A 1PZJD 1O7YA 3KJOA 3S1MH 1X65A 2F0TA 1EWHA 1I50B 1ZYRC 2DNCA 4NW2A 2X6LA 1PFMA 1STYA 4A3GB 1HFGA 4CJ2C 1Y14B 3GTOB 2JA7B 4O0AA 2OT2A 3CC4A 4FF4A 2NBFA 2YTVA 4KN4C 3FKIH 1VQBA 4J8QA 2F1MA 1FGBD 4CJ1B 5FLXc 3I4NB 1TY2A 1OO9B 4RFBA 4PMWA 4LFCQ 4GNXB 2MHVA 2LXJA 3S16H 1D5ZC 2LXKA 3RLOA 1QZGA 1N33L 4TVAB 4LNQA 1V1PB 2ICEC 1DGSA 5G3LD 4DU9A 4N9PA 4QIWE 1PH4A 5C44H 5C0XH 2F0SA 3HKZB 2B63G 1PTOH 1Z6HA 2R61A 3AFPA 1Q7YC 5C4XG 1LTLA 2D5DA 1RCVD 3IL8A 4A3CH 1DXMA 1LO5D 3HOXG 2BH2A 3KDFB 1GO3E 4FXKC 2KA7A 2R92B 2PQEA 4YWLA 3NWTA 4QL5A 5M5YB 4IPCA 4RKBA 1TS2A 1EUJA 1CKOA 3B6YA 2VZAA 2Q8TA 2PZTA 4U673 4LFCL 2IHFA 5ELNA 1R4QB 1M4VA 4IO9A 2MUYA 1SFOB 3HOVG 4HJ8A 2TSSA 1NAPA 2EYJA 1KHIA 4QJFA 2Z6KC 3T53B 3TBIB 4EVOA 4KD4A 3EFXD 3HOUG 3GD7A 1F9SA 1G6PA 2K5WA 2R7FA 2O5IC 4JCVE 4QIWB 3I8ZA 2N55A 1YNJC 1XTCD 3QB3A 3ULLA 5FO9B 2HQEA 5GAGC 1B2TA 3E3XA 3GTJH 1D1KA 1PYBA 1HR0Q 2RVLA 4DA2A 1D1IA 3KOJA 1X3PA 5C3EG 1LUZA 2WKDA 4KY5A 3X3NA 1QNUA 1RD9D 1JOOA 4BBRH 4DR6L 1EFID 1IW7C 4R4IA 3CCJA 1LT3D 2B2WA 2YTYA 5CV4A 1B7YB 1CSQA 1M90C 4IUVA 4DV2Q 2F52A 2PQAB 4DAVA 1L2FA 1SRUA 1IXRA 1F2MA 3MTSA 1Y69U 5JEAH 5ELBA 5IYBG 3PMFA 3PIPA 2DGYA 1AFPA 3LX0A 3DM1A 2VB3X 1VQIA 4Q0FA 3RD4A 1C8CA 1JB3A 3UDFA 5ISRA 1E22A 1F9QA 2KCTA 1CUKA 3MXNA 3CPWA 4A3JG 1J5EQ 4LFBQ 2A74C 2WINB 1HR0L 1CM9A 2JYOA 3P20A 3CW2C 3NEMA 4P74A 2C5CA 1KDCA 4K5VA 3MXGA 5IGGA 1I4RA 1BQQT 1PTOD 3S15B 5IYDH 1ET9A 1KNAA 3J81L 3K59A 1A62A 2QEJC 4IUQA 1NSNS 1ZYRD 4X66L 2ID0A 4JOIC 1LM0A 4B3TQ 2ZT9C 4DV2L 3PUXA 2K50A 1I3QH 1VMCA 4HSVA 2K5NA 3BVZA 4RH6A 4L5RC 4A3IB 4HN7A 1V1OA 4IPGA 4ZAIA 4JG2A 4BBSB 3CP0A 2Z4IA 1SYEA 4C3HG 4HMIA 3R3OA 3U50C 2AKWB 4LFBL 1LYLA 1J5EL 1WCMH 4DK6C 1HQRD 1IBKQ 1PH7A 2N49A 2IT1A 4ZK9B 3EIVA 5M3MB 5IGDA 3RR5A 1A63A 4DUYQ 4PMCA 1QUQA 3BVMA 5KRUA 2I0QA 4LF9L 3OSOA 5FKAC 3MEHA 3EROA 4XTCS 4XYOA 1IKLA 2YYZA 5EJWA 1KC8C 2HUGA 2CQOA 1W6JA 2FJ2A 4OIJA 4Y7NB 4DV0Q 3I90A 5C0XJ 2K5HA 2MPMA 3FPUB 3IFDA 2XNAC 2WP8J 1WTPA 4TKOB 1Y1VH 2NTSA 5FLXE 1SYFA 3I56A 3RLFA 1VQ7A 4FXDA 3H94A 5I2YA 1YHQA 2K75A 4A3FH 1K9MC 2VUMG 1B50A 4C3IB 2UXBQ 4IURA 3GV6A 3HOYH 2O5JC 3NUCA 2EJGC 1P16A 4IOAA 2HDMA 2KCNA 4GOPC 1VQPA 4DK3C 4H0LC 1YNJD 3EBEA 2AQ2B 5IGFA 3S1MB 1VQHA 1VQ9A 1PH3A 4B9WA 3GTPH 4BA2I 3ZYYX 3GTMH 1SLJA 1SMYD 2EPBA 4DV0L 1IYVA 4UP7A 4HAEA 5I2XA 4FDBA 4HSPA 1A15A 3FKIB 1I94L 2PZUA 1IW7D 3J80c 4A3BH 3ONAB 2HCIA 3PF4A 3S17H 3TEHB 2JA8H 2R7ZB 1D5XC 1GOZA 3ULJA 5BR8Q 2UXBL 3D6WA 5IE8A 1JWUD 2VQFQ 4BXXG 3L9AX 3CHBD 4RMFA 1WTWA 1H9KA 1KDAA 1EZ6A 2ALYB 4HJAA 4DNTB 1XMOQ 1KL9A 5C44B 3NTKA 4KHPQ 4QY7A 1PTOB 2JA6H 3LWEA 4HIOA 1CT1D 4WJ4A 1X6OA 3OIQA 2B8GA 5JEAJ 5HGTA 3S24A 3ICEA 2F0WA 1XMQQ 1CI3M 4ILWA 3NK9A 2PI2A 4GN3B 1QVCA 1ENCA 3AEVA 4OO1G 1RHPA 1YHAA 2DNEA 2J7ZA 2ZTEA 3A74A 2JQOA 1WTHA 4X65L 1R4PB 1X3GA 5C3EH 3Q24A 3OHXC 5BR8L 2ZTCA 4R4CA 2UUCQ 3KBGA 1SE3A 3SK8A 5EAYA 1I4PA 1NNXA 4GNXC 4JI4L 4KKTA 1BF4A 4A3KH 1XMOL 3H15A 1IHZA 3L2PA 5J39A 1ONLA 4KHPL 4UHVA 3E0EA 2VXWA 4NKLA 3ITPA 3OPOA 2EJFC 3GDEA 4N8FA 3GTJB 1N36Q 2QW7A 2IX3A 3J7ZC 1XMQL 2D62A 5CV6A 1G51A 3OW7A 3QG1A 1I50H 2CH4W 2QF7A 2EVBA 3J81c
chains in the Genus database with same CATH topology
2RHQB 3S15H 4IJLA 1AE3A 3K80C 4NXNQ 5IP7H 3GTOH 4A3BG 3KYHC 1PH2A 1KD1C 4POGA 4A3DH 3STBD 1XNRL 3HOWG 3PO3H 4GKJQ 1PH1A 2UUCL 4A3LH 1HH2P 2JA5G 3KFUA 4R4TA 2JA8G 3S1NH 5GQOA 3CCLA 4J15A 4EX5A 1YNXA 3CCVA 2OTJA 1EIFA 2OCEA 4DR1L 2CFMA 1BBUA 1SN8A 2RCNA 4BY1G 4DR6Q 2I5LX 1QVGA 1BKBA 5K36G 3TREA 4DUZQ 1IBKL 3A5ZB 1N32L 3L0OA 3CXCA 4A76A 1E24A 3CCMA 2Q2TA 1YVCA 5GROA 4DUYL 1TWGH 4B3RQ 2UXDL 4YCVA 1UE6A 1TWAH 4LW1A 4JI1Q 4IFDI 1EIYB 4BBSH 2K52A 1OXSC 1G6PA 2WAQG 1ASZA 4JI0Q 1N36L 3HOZG 2JA6G 4DR4Q 4GOPB 4OX9L 2Q2HA 1L1OC 2F3IA 2ZM6Q 4A93G 1CKNB 1VQGA 4C3HH 1VQAA 1PHJA 4DR3Q 4ME3A 2CCZA 2HHHQ 4JI3Q 5LMNQ 5GAEC 4LF6L 3DM3A 1X55A 1TWFH 2UUBL 2B63H 1EOVA 5M3MH 2HT1A 4Y52H 1IYJB 4DV7Q 3T1YL 1SR3A 5C4XH 1NE3A 3GTLH 1Z47A 3TQYA 1OXXK 1XTDA 4PZ6A 4YHHQ 2RF4A 4DV3Q 2OQKA 2NN6G 3BJUA 4XIGS 3OYYA 3HOXH 3F2BA 4OWXB 3CMAA 1Y1WH 1P8LA 2Z0SA 1WI5A 4JI2Q 3G71A 4GN4B 1VQEA 2K4KA 5H1SE 1QZHA 4LF4Q 3WWVA 1V9PA 1HNZL 1T9HA 4WJ3M 4OWTB 2K14A 5AJ3Q 5LMNW 2YTXA 1N34Q 3AYHB 1XNQQ 4UP8A 1NJIC 2B3GA 2QA4A 2FXQA 1VQJA 1GVPA 4X66Q 4DV5Q 4A3KG 3HOVH 1PYSB 1WCMG 4IJHA 1JJCB 3UDGA 5IY0A 4HJ5A 4IFDG 4IOCA 5E7NA 2CWAA 1SE8A 2KHIA 3PUZA 4KI0A 3I7FA 2XGTA 4C3IH 4JI0L 3OTOQ 1SROA 4KLKA 2PMZE 1N33Q 3HOUH 2VUMH 3FP9A 4UP9A 4LFAQ 2I5HA 2ZM6L 3M85A 5GAHC 4P73A 2VNUD 4DR3L 4B3ML 4MNOA 5FJ8H 3H3VH 4DV7L 2Y0SG 1RIPA 2MO1A 3S14H 1G291 3PF5A 1GD7A 1VQDA 4OWWB 3HKZE 4DR7Q 4UPAA 4DV3L 2EXDA 1Q1EA 1UE7A 2YU9H 4JI7Q 3CCQA 4C2MH 3RN2A 1HZBA 3KJOA 4JI2L 3S1MH 1X65A 1AE2A 3I4OA 3AFQA 2ZTDA 1PH9A 1XPUA 3I4MH 4A3GG 3L7ZC 1N9WA 5IP7G 4YWKA 3F2DA 1K8GA 2UU9Q 3D0FA 5AJ3L 2VQFL 3EN2A 4POFA 2N8NA 4LF9Q 2A8VA 2N78A 2HIXA 1N34L 1Y14B 4AIMA 3J81i 4LF8Q 2MO0A 4O0AA 4JBMA 1PA6A 4L5SA 1NBWA 3CC4A 3JAMc 2D0OA 2YTVA 3PV0A 3FKIH 3I4NG 2PI2E 1VQBA 3KF8B 3LGJA 5IP9H 4DV5L 2HQLA 3T1HQ 4YCWA 3A5UA 5FLXc 1YITA 2PNHA 4PMWA 4LFCQ 4GNXB 2IX0A 2LXJA 4JI8Q 4A3EG 2LXKA 3UDXA 3S16H 4DV4Q 1GKHA 1J6QA 3RLOA 1GM5A 1QZGA 1WOCA 2DUDA 1N33L 4TVAB 4LUZA 4LNQA 4LFAL 5IYBH 1NY4A 1DGSA 1I6HH 3H0GH 1KIXA 4AYBE 3GTGH 1R9TH 4DKAC 3SGIA 3CPFA 4QIWE 3BZCA 5M5WH 3HKZG 3K0XA 4L5QA 4DR7L 1HJPA 1OTCA 2VL6A 1S40A 1PH4A 4JI7L 5C44H 5GADC 4A3JH 3K7UC 2B63G 3S1QH 4IFDJ 3AFPA 3H3VI 1Q7YC 5C4XG 1LTLA 4A3CH 4JC0A 2R6GA 4O2DA 2PQAA 4A3LG 2R92G 1A8VA 3HOXG 2UU9L 3M9BA 3KDFB 2ZJRA 1Y1WG 1M1KC 2BH2A 1VQFA 1GO3E 3KF6A 4A4IA 2AWOA 3CQZH 4LF8L 4IPHA 4LF7Q 4YWLA 4QL5A 3J80i 4IPCA 4R4QA 4JI6Q 4NPSA 1EUJA 1CKOA 3B6YA 2VZAA 4X62Q 3GTQH 2IY5B 3PCOB 4LFCL 2IHFA 3RLNA 3S1RH 5ELNA 2KHJA 3GTKH 4ALPA 1YBYA 4JI8L 4DV1Q 1Q82C 4IO9A 4PZ8A 4DV4L 1FL0A 5M5XH 2KCMA 3HOVG 4HJ8A 4X6AH 4A3IH 4MTNA 4K0KQ 1EWIA 1X56A 3FHWA 1KAWA 1I94Q 4P71A 2BA0A 4AYBG 1KHIA 4QJFA 2MNAA 2Z6KC 4DR2Q 2JEAI 1OXUA 1KQSA 2NVQH 4LUOA 1D7QA 1TWHH 3HOUG 3GD7A 4BY7G 2NZHA 4GLAC 3K8AA 2JJQA 2R7FA 3PSIA 5IYCG 3U58A 5JJKA 4JCVE 2IX1A 4DV6Q 1FJGQ 5FJ8G 4GKKQ 2Y0SE 4JI5Q 1L1OB 3ULLA 4KHZA 3RZOH 3BZKA 2QGQA 3W1GA 5GAGC 2VQEQ 4NXNL 3GTJH 1PH8A 1PYBA 3HFZB 4JOIA 5C0XI 1HR0Q 3PO2H 4GKJL 1MJCA 1VQKA 3KOJA 4QQBX 3I4MG 5C3EG 1LUZA 3GO5A 2C35B 4R1JA 5LMUQ 3S2HH 4DR5Q 4GLXA 4JV5Q 4BBRH 4Y7NH 1SMXA 4DR6L 1CSPA 4R4IA 3CCJA 1S72A 2VY3A 1B70B 4YY3Q 4DUZL 1XJVA 3KJPA 4IPDA 4DV1L 2YTYA 3MEFA 1JE5A 4AQYQ 3CCSA 1B7YB 2E2HH 1CSQA 1HR0W 4B3RL 1MKHA 1M90C 4JI1L 4DV2Q 4GLVB 2F52A 2PQAB 3E9HA 1L2FA 1SRUA 1IXRA 4H02A 2GVBA 4YCUA 4DR2L 1PH5A 4X65Q 4DR4L 5M3FG 3KF6B 2NVTH 4HIMA 3M3YH 5IYBG 2OQ0A 3PIPA 1K8AC 2DGYA 4JI3L 4DV6L 2HHHL 1HZCA 5LMNL 3RZDH 1YJ9A 3RNUA 5FLMH 1K83H 1VQIA 3UDFA 4B3SQ 4JI4Q 1E22A 1TXYA 4UY8C 2E8GA 2KCTA 1CUKA 1X3FA 4YHHL 3S2DH 1JJGA 2ZJQA 4OXPA 4GS3A 5C0XG 3CPWA 4A3JG 1J5EQ 1VQNA 4LFBQ 1KRSA 1HR0L 5ELOA 3CW2C 3ERSX 4P75A 3I2ZA 3NEMA 1WFQA 1MJEA 5LMUL 4P74A 4LF4L 3HOZH 2B29A 4A3DG 1CKMA 2UXBQ 2CKZB 2GVAA 1PH6A 4NXMQ 5IYDH 4A93H 1Z9FA 1A62A 1XNQL 3ZJYC 1NMFA 1VQ8A 1YJNA 2Z6KA 1YHBA 4X66L 2ID0A 2EQSA 4JOIC 3U4VA 4AH6A 1LM0A 1U0LA 4B3TQ 2UXCQ 1H95A 4DV2L 2IHEA 1Q86C 2R7ZH 1EQRA 4GN5A 4EQ5A 2E2IH 1YJWA 3OTOL 2Q2UA 3PUXA 2K50A 3W1BA 4A3IG 2BH8A 1I3QH 1K3RA 2K5NA 4L5RC 1VQ4A 4BBSG 3RN5A 4BXXH 2WB1G 4IPGA 3NBHB 4JG2A 1IBLQ 4DAMA 1IL2A 4B3SL 3CP0A 2R7DA 3HKSA 1RL2A 1HZ9A 3U50C 4A3MH 4DAYB 2AKWB 3M4OH 1LYLA 2D0PA 3PUWA 1WCMH 1J5EL 4DK6C 5M3MG 4LFBL 1HNWQ 1D8LA 3CCRA 1IBKQ 1PH7A 2Q2IA 1OXTA 1QVFA 2N49A 1JJ2A 2IT1A 3KLWA 1N32Q 3EIVA 2KBNA 3RR5A 3CAMA 1A63A 3NENA 1N8RC 4DUYQ 3F8TA 4NXML 1QUQA 3CC7A 3J81c 4LF9L 2I0QA 3PO2G 2KENA 4PZ7A 2UXDQ 3G48A 2NVXH 4YWMA 3A0JA 4XTCS 4C3JH 2OTLA 1PV4A 3G6EA 3CCUA 2YYZA 2AMCB 1NTGA 2CWPA 1KC8C 1Q81C 4BBRG 1TWCH 4OX9Q 2CQOA 3TS0A 1E1TA 4LWCA 3T1HL 1YEZA 5JJIA 4JBJA 2UXCL 3STBC 4HJ9A 1OXVA 1FGUA 4DV0Q 1I5FA 3IRBA 1YZ6A 2ZJPA 3TS2A 5C0XJ 2UUBQ 1VQMA 2K5HA 3MXNB 1E7ZA 2E5LQ 3T1YQ 2MQHA 1WYDA 4JBWA 2XTIA 2WP8J 5JJLA 2ES2A 4A3GH 1VQLA 1Y1VH 3J7A5 2JA7H 3ULPA 3F2CA 4OO1I 1A0IA 1Q1BA 3I56A 2NN6I 3RLFA 3CF5A 1VQ7A 1IBMQ 1YHQA 2K75A 1X3EA 4A3FH 1IBLL 1K9MC 2VUMG 4JYAQ 5JEAG 4DPGA 1HNXQ 3UE0A 1MIUA 3PUYA 5J3BA 4X64Q 1BVSA 1HNZQ 1EFWA 3HOYH 3I4NH 1B8AA 1HNWL 3Q8DA 5FLMG 2VS1A 1BBWA 1P16A 1VQ6A 4LUVA 3K7AH 4A3EH 4IOAA 2JA9A 3TRZA 4OONA 2HIVA 3I55A 4GOPC 2E2JH 2F4VQ 3CCEA 1VQPA 1FVIA 4DK3C 1V43A 2ATWA 1VQCA 4LF7L 3EBEA 1VCIA 3E9IA 1VQHA 1VQ9A 2A19A 1PH3A 4JI6L 3GTPH 2ASBA 4BA2I 3GTMH 5IYDG 4HJ7A 4X62L 1SLJA 3M4PA 4TQUS 3J81j 4B3MQ 4DV0L 4UP7A 2GN5A 2QEXA 2R93H 3FKIG 2E5LL 3AQQA 3CD6A 4APVA 5IP9G 4FDBA 1AH9A 3PO3G 2UUAQ 4GNXA 4K0KL 1I94L 3JAMi 2NVYH 1C9OA 4P72A 3J80c 2R92H 4A3BH 2R7ZG 1KRTA 1Q46A 4QGUA 3PF4A 5M5YH 3TEHB 1IBML 3HOWH 4PG3A 3S17H 2JA5H 1QUQB 2JA8H 3DLLA 2RHSB 5HGQA 2OWOA 4JYAL 3UDIA 3ULJA 5BR8Q 1HNXL 4L5TA 5IE8A 4X64L 2UXBL 3H0GG 2NZOA 2VQFQ 4BY1H 4BXXG 1FJGL 2WB1E 4RMFA 1SFOH 4HIKA 4GKKL 4JI5L 1KXLA 3G4SA 1WJJA 4RG1A 2VQEL 1PVOA 2ALYB 5C44G 4HJAA 4A3MG 2A1AA 1XMOQ 1JB7A 1E1OA 2F4VL 2V1CC 2N3SA 1KL9A 3UE1A 1ASYA 1V1QA 2K5VA 2I5MX 2EIFA 2H5XA 3M7NA 3JC66 1C7YA 4A3CG 1PFSA 3KDFA 4QY7A 4KHPQ 4DR5L 3ER0A 4HIOA 2JA6H 4JBKA 4JV5L 4WJ4A 1X6OA 4BY7H 2JEBI 3D31A 5JEAJ 5IYCH 5IWAQ 3S24A 3ICEA 1X9NA 3NELA 4YY3L 5C4JH 3F1ZA 4LF5Q 3VDYA 1YI2A 1XMQQ 1EYGA 2JK8A 2WFWA 2PI2A 3W5OA 4AQYL 2UUAL 1NMGA 3PUVA 4GN3B 1QVCA 1XPOA 4NB3A 1Q8KA 3AEVA 4OO1G 1YHAA 5IT9c 1JMCA 1UE5A 4MZ9A 2ZTEA 3A74A 2JQOA 2MFIA 2AWNA 1YIJA 4X65L 1UWVA 1VQOA 1X3GA 3CMEA 5C3EH 1VS0A 1Y1VG 3U4ZA 5BR8L 2JA7G 2VW9A 1VQ5A 1HZAA 1XPRA 1Q12A 4GOPA 1XNRQ 2JE6I 2ZTCA 4R4CA 3PIOA 2UUCQ 1K73C 4A3FG 1EQQA 4A75A 1CKNA 5EAYA 5HY6A 3BU2A 4BA1I 4HIDA 3K81C 4GNXC 4JI4L 3HOYG 4DR1Q 4A3KH 1XMOL 3H15A 1U5KA 1L1OA 3L2PA 1C0AA 1K0RA 4KHPL 1O7IA 3E0EA 5M3FH 1UE1A 5IWAL 5DLQE 1JT8A 3GDEA 1W2BA 1W3SA 2WAQE 1N36Q 4LF5L 4DNIA 2BA1A 3J7ZC 1XMQL 4R4OA 1X54A 2D62A 3PGZA 1UEBA 2YV5A 1G51A 1S3OA 3M4QA 1L0WA 3OW2A 1E3PA 4B3TL 4LF6Q 1I50H 2AHOB 2R93G 3CC2A 1IZ6A 2L15A 2LSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHQ B;  3S15 H;  4IJL A;  1AE3 A;  3K80 C;  4NXN Q;  5IP7 H;  3GTO H;  4A3B G;  3KYH C;  1PH2 A;  1KD1 C;  4POG A;  4A3D H;  3STB D;  1XNR L;  3HOW G;  3PO3 H;  4GKJ Q;  1PH1 A;  2UUC L;  4A3L H;  1HH2 P;  2JA5 G;  3KFU A;  4R4T A;  2JA8 G;  3S1N H;  5GQO A;  3CCL A;  4J15 A;  4EX5 A;  1YNX A;  3CCV A;  2OTJ A;  1EIF A;  2OCE A;  4DR1 L;  2CFM A;  1BBU A;  1SN8 A;  2RCN A;  4BY1 G;  4DR6 Q;  2I5L X;  1QVG A;  1BKB A;  5K36 G;  3TRE A;  4DUZ Q;  1IBK L;  3A5Z B;  1N32 L;  3L0O A;  3CXC A;  4A76 A;  1E24 A;  3CCM A;  2Q2T A;  1YVC A;  5GRO A;  4DUY L;  1TWG H;  4B3R Q;  2UXD L;  4YCV A;  1UE6 A;  1TWA H;  4LW1 A;  4JI1 Q;  4IFD I;  1EIY B;  4BBS H;  2K52 A;  1OXS C;  1G6P A;  2WAQ G;  1ASZ A;  4JI0 Q;  1N36 L;  3HOZ G;  2JA6 G;  4DR4 Q;  4GOP B;  4OX9 L;  2Q2H A;  1L1O C;  2F3I A;  2ZM6 Q;  4A93 G;  1CKN B;  1VQG A;  4C3H H;  1VQA A;  1PHJ A;  4DR3 Q;  4ME3 A;  2CCZ A;  2HHH Q;  4JI3 Q;  5LMN Q;  5GAE C;  4LF6 L;  3DM3 A;  1X55 A;  1TWF H;  2UUB L;  2B63 H;  1EOV A;  5M3M H;  2HT1 A;  4Y52 H;  1IYJ B;  4DV7 Q;  3T1Y L;  1SR3 A;  5C4X H;  1NE3 A;  3GTL H;  1Z47 A;  3TQY A;  1OXX K;  1XTD A;  4PZ6 A;  4YHH Q;  2RF4 A;  4DV3 Q;  2OQK A;  2NN6 G;  3BJU A;  4XIG S;  3OYY A;  3HOX H;  3F2B A;  4OWX B;  3CMA A;  1Y1W H;  1P8L A;  2Z0S A;  1WI5 A;  4JI2 Q;  3G71 A;  4GN4 B;  1VQE A;  2K4K A;  5H1S E;  1QZH A;  4LF4 Q;  3WWV A;  1V9P A;  1HNZ L;  1T9H A;  4WJ3 M;  4OWT B;  2K14 A;  5AJ3 Q;  5LMN W;  2YTX A;  1N34 Q;  3AYH B;  1XNQ Q;  4UP8 A;  1NJI C;  2B3G A;  2QA4 A;  2FXQ A;  1VQJ A;  1GVP A;  4X66 Q;  4DV5 Q;  4A3K G;  3HOV H;  1PYS B;  1WCM G;  4IJH A;  1JJC B;  3UDG A;  5IY0 A;  4HJ5 A;  4IFD G;  4IOC A;  5E7N A;  2CWA A;  1SE8 A;  2KHI A;  3PUZ A;  4KI0 A;  3I7F A;  2XGT A;  4C3I H;  4JI0 L;  3OTO Q;  1SRO A;  4KLK A;  2PMZ E;  1N33 Q;  3HOU H;  2VUM H;  3FP9 A;  4UP9 A;  4LFA Q;  2I5H A;  2ZM6 L;  3M85 A;  5GAH C;  4P73 A;  2VNU D;  4DR3 L;  4B3M L;  4MNO A;  5FJ8 H;  3H3V H;  4DV7 L;  2Y0S G;  1RIP A;  2MO1 A;  3S14 H;  1G29 1;  3PF5 A;  1GD7 A;  1VQD A;  4OWW B;  3HKZ E;  4DR7 Q;  4UPA A;  4DV3 L;  2EXD A;  1Q1E A;  1UE7 A;  2YU9 H;  4JI7 Q;  3CCQ A;  4C2M H;  3RN2 A;  1HZB A;  3KJO A;  4JI2 L;  3S1M H;  1X65 A;  1AE2 A;  3I4O A;  3AFQ A;  2ZTD A;  1PH9 A;  1XPU A;  3I4M H;  4A3G G;  3L7Z C;  1N9W A;  5IP7 G;  4YWK A;  3F2D A;  1K8G A;  2UU9 Q;  3D0F A;  5AJ3 L;  2VQF L;  3EN2 A;  4POF A;  2N8N A;  4LF9 Q;  2A8V A;  2N78 A;  2HIX A;  1N34 L;  1Y14 B;  4AIM A;  3J81 i;  4LF8 Q;  2MO0 A;  4O0A A;  4JBM A;  1PA6 A;  4L5S A;  1NBW A;  3CC4 A;  3JAM c;  2D0O A;  2YTV A;  3PV0 A;  3FKI H;  3I4N G;  2PI2 E;  1VQB A;  3KF8 B;  3LGJ A;  5IP9 H;  4DV5 L;  2HQL A;  3T1H Q;  4YCW A;  3A5U A;  5FLX c;  1YIT A;  2PNH A;  4PMW A;  4LFC Q;  4GNX B;  2IX0 A;  2LXJ A;  4JI8 Q;  4A3E G;  2LXK A;  3UDX A;  3S16 H;  4DV4 Q;  1GKH A;  1J6Q A;  3RLO A;  1GM5 A;  1QZG A;  1WOC A;  2DUD A;  1N33 L;  4TVA B;  4LUZ A;  4LNQ A;  4LFA L;  5IYB H;  1NY4 A;  1DGS A;  1I6H H;  3H0G H;  1KIX A;  4AYB E;  3GTG H;  1R9T H;  4DKA C;  3SGI A;  3CPF A;  4QIW E;  3BZC A;  5M5W H;  3HKZ G;  3K0X A;  4L5Q A;  4DR7 L;  1HJP A;  1OTC A;  2VL6 A;  1S40 A;  1PH4 A;  4JI7 L;  5C44 H;  5GAD C;  4A3J H;  3K7U C;  2B63 G;  3S1Q H;  4IFD J;  3AFP A;  3H3V I;  1Q7Y C;  5C4X G;  1LTL A;  4A3C H;  4JC0 A;  2R6G A;  4O2D A;  2PQA A;  4A3L G;  2R92 G;  1A8V A;  3HOX G;  2UU9 L;  3M9B A;  3KDF B;  2ZJR A;  1Y1W G;  1M1K C;  2BH2 A;  1VQF A;  1GO3 E;  3KF6 A;  4A4I A;  2AWO A;  3CQZ H;  4LF8 L;  4IPH A;  4LF7 Q;  4YWL A;  4QL5 A;  3J80 i;  4IPC A;  4R4Q A;  4JI6 Q;  4NPS A;  1EUJ A;  1CKO A;  3B6Y A;  2VZA A;  4X62 Q;  3GTQ H;  2IY5 B;  3PCO B;  4LFC L;  2IHF A;  3RLN A;  3S1R H;  5ELN A;  2KHJ A;  3GTK H;  4ALP A;  1YBY A;  4JI8 L;  4DV1 Q;  1Q82 C;  4IO9 A;  4PZ8 A;  4DV4 L;  1FL0 A;  5M5X H;  2KCM A;  3HOV G;  4HJ8 A;  4X6A H;  4A3I H;  4MTN A;  4K0K Q;  1EWI A;  1X56 A;  3FHW A;  1KAW A;  1I94 Q;  4P71 A;  2BA0 A;  4AYB G;  1KHI A;  4QJF A;  2MNA A;  2Z6K C;  4DR2 Q;  2JEA I;  1OXU A;  1KQS A;  2NVQ H;  4LUO A;  1D7Q A;  1TWH H;  3HOU G;  3GD7 A;  4BY7 G;  2NZH A;  4GLA C;  3K8A A;  2JJQ A;  2R7F A;  3PSI A;  5IYC G;  3U58 A;  5JJK A;  4JCV E;  2IX1 A;  4DV6 Q;  1FJG Q;  5FJ8 G;  4GKK Q;  2Y0S E;  4JI5 Q;  1L1O B;  3ULL A;  4KHZ A;  3RZO H;  3BZK A;  2QGQ A;  3W1G A;  5GAG C;  2VQE Q;  4NXN L;  3GTJ H;  1PH8 A;  1PYB A;  3HFZ B;  4JOI A;  5C0X I;  1HR0 Q;  3PO2 H;  4GKJ L;  1MJC A;  1VQK A;  3KOJ A;  4QQB X;  3I4M G;  5C3E G;  1LUZ A;  3GO5 A;  2C35 B;  4R1J A;  5LMU Q;  3S2H H;  4DR5 Q;  4GLX A;  4JV5 Q;  4BBR H;  4Y7N H;  1SMX A;  4DR6 L;  1CSP A;  4R4I A;  3CCJ A;  1S72 A;  2VY3 A;  1B70 B;  4YY3 Q;  4DUZ L;  1XJV A;  3KJP A;  4IPD A;  4DV1 L;  2YTY A;  3MEF A;  1JE5 A;  4AQY Q;  3CCS A;  1B7Y B;  2E2H H;  1CSQ A;  1HR0 W;  4B3R L;  1MKH A;  1M90 C;  4JI1 L;  4DV2 Q;  4GLV B;  2F52 A;  2PQA B;  3E9H A;  1L2F A;  1SRU A;  1IXR A;  4H02 A;  2GVB A;  4YCU A;  4DR2 L;  1PH5 A;  4X65 Q;  4DR4 L;  5M3F G;  3KF6 B;  2NVT H;  4HIM A;  3M3Y H;  5IYB G;  2OQ0 A;  3PIP A;  1K8A C;  2DGY A;  4JI3 L;  4DV6 L;  2HHH L;  1HZC A;  5LMN L;  3RZD H;  1YJ9 A;  3RNU A;  5FLM H;  1K83 H;  1VQI A;  3UDF A;  4B3S Q;  4JI4 Q;  1E22 A;  1TXY A;  4UY8 C;  2E8G A;  2KCT A;  1CUK A;  1X3F A;  4YHH L;  3S2D H;  1JJG A;  2ZJQ A;  4OXP A;  4GS3 A;  5C0X G;  3CPW A;  4A3J G;  1J5E Q;  1VQN A;  4LFB Q;  1KRS A;  1HR0 L;  5ELO A;  3CW2 C;  3ERS X;  4P75 A;  3I2Z A;  3NEM A;  1WFQ A;  1MJE A;  5LMU L;  4P74 A;  4LF4 L;  3HOZ H;  2B29 A;  4A3D G;  1CKM A;  2UXB Q;  2CKZ B;  2GVA A;  1PH6 A;  4NXM Q;  5IYD H;  4A93 H;  1Z9F A;  1A62 A;  1XNQ L;  3ZJY C;  1NMF A;  1VQ8 A;  1YJN A;  2Z6K A;  1YHB A;  4X66 L;  2ID0 A;  2EQS A;  4JOI C;  3U4V A;  4AH6 A;  1LM0 A;  1U0L A;  4B3T Q;  2UXC Q;  1H95 A;  4DV2 L;  2IHE A;  1Q86 C;  2R7Z H;  1EQR A;  4GN5 A;  4EQ5 A;  2E2I H;  1YJW A;  3OTO L;  2Q2U A;  3PUX A;  2K50 A;  3W1B A;  4A3I G;  2BH8 A;  1I3Q H;  1K3R A;  2K5N A;  4L5R C;  1VQ4 A;  4BBS G;  3RN5 A;  4BXX H;  2WB1 G;  4IPG A;  3NBH B;  4JG2 A;  1IBL Q;  4DAM A;  1IL2 A;  4B3S L;  3CP0 A;  2R7D A;  3HKS A;  1RL2 A;  1HZ9 A;  3U50 C;  4A3M H;  4DAY B;  2AKW B;  3M4O H;  1LYL A;  2D0P A;  3PUW A;  1WCM H;  1J5E L;  4DK6 C;  5M3M G;  4LFB L;  1HNW Q;  1D8L A;  3CCR A;  1IBK Q;  1PH7 A;  2Q2I A;  1OXT A;  1QVF A;  2N49 A;  1JJ2 A;  2IT1 A;  3KLW A;  1N32 Q;  3EIV A;  2KBN A;  3RR5 A;  3CAM A;  1A63 A;  3NEN A;  1N8R C;  4DUY Q;  3F8T A;  4NXM L;  1QUQ A;  3CC7 A;  3J81 c;  4LF9 L;  2I0Q A;  3PO2 G;  2KEN A;  4PZ7 A;  2UXD Q;  3G48 A;  2NVX H;  4YWM A;  3A0J A;  4XTC S;  4C3J H;  2OTL A;  1PV4 A;  3G6E A;  3CCU A;  2YYZ A;  2AMC B;  1NTG A;  2CWP A;  1KC8 C;  1Q81 C;  4BBR G;  1TWC H;  4OX9 Q;  2CQO A;  3TS0 A;  1E1T A;  4LWC A;  3T1H L;  1YEZ A;  5JJI A;  4JBJ A;  2UXC L;  3STB C;  4HJ9 A;  1OXV A;  1FGU A;  4DV0 Q;  1I5F A;  3IRB A;  1YZ6 A;  2ZJP A;  3TS2 A;  5C0X J;  2UUB Q;  1VQM A;  2K5H A;  3MXN B;  1E7Z A;  2E5L Q;  3T1Y Q;  2MQH A;  1WYD A;  4JBW A;  2XTI A;  2WP8 J;  5JJL A;  2ES2 A;  4A3G H;  1VQL A;  1Y1V H;  3J7A 5;  2JA7 H;  3ULP A;  3F2C A;  4OO1 I;  1A0I A;  1Q1B A;  3I56 A;  2NN6 I;  3RLF A;  3CF5 A;  1VQ7 A;  1IBM Q;  1YHQ A;  2K75 A;  1X3E A;  4A3F H;  1IBL L;  1K9M C;  2VUM G;  4JYA Q;  5JEA G;  4DPG A;  1HNX Q;  3UE0 A;  1MIU A;  3PUY A;  5J3B A;  4X64 Q;  1BVS A;  1HNZ Q;  1EFW A;  3HOY H;  3I4N H;  1B8A A;  1HNW L;  3Q8D A;  5FLM G;  2VS1 A;  1BBW A;  1P16 A;  1VQ6 A;  4LUV A;  3K7A H;  4A3E H;  4IOA A;  2JA9 A;  3TRZ A;  4OON A;  2HIV A;  3I55 A;  4GOP C;  2E2J H;  2F4V Q;  3CCE A;  1VQP A;  1FVI A;  4DK3 C;  1V43 A;  2ATW A;  1VQC A;  4LF7 L;  3EBE A;  1VCI A;  3E9I A;  1VQH A;  1VQ9 A;  2A19 A;  1PH3 A;  4JI6 L;  3GTP H;  2ASB A;  4BA2 I;  3GTM H;  5IYD G;  4HJ7 A;  4X62 L;  1SLJ A;  3M4P A;  4TQU S;  3J81 j;  4B3M Q;  4DV0 L;  4UP7 A;  2GN5 A;  2QEX A;  2R93 H;  3FKI G;  2E5L L;  3AQQ A;  3CD6 A;  4APV A;  5IP9 G;  4FDB A;  1AH9 A;  3PO3 G;  2UUA Q;  4GNX A;  4K0K L;  1I94 L;  3JAM i;  2NVY H;  1C9O A;  4P72 A;  3J80 c;  2R92 H;  4A3B H;  2R7Z G;  1KRT A;  1Q46 A;  4QGU A;  3PF4 A;  5M5Y H;  3TEH B;  1IBM L;  3HOW H;  4PG3 A;  3S17 H;  2JA5 H;  1QUQ B;  2JA8 H;  3DLL A;  2RHS B;  5HGQ A;  2OWO A;  4JYA L;  3UDI A;  3ULJ A;  5BR8 Q;  1HNX L;  4L5T A;  5IE8 A;  4X64 L;  2UXB L;  3H0G G;  2NZO A;  2VQF Q;  4BY1 H;  4BXX G;  1FJG L;  2WB1 E;  4RMF A;  1SFO H;  4HIK A;  4GKK L;  4JI5 L;  1KXL A;  3G4S A;  1WJJ A;  4RG1 A;  2VQE L;  1PVO A;  2ALY B;  5C44 G;  4HJA A;  4A3M G;  2A1A A;  1XMO Q;  1JB7 A;  1E1O A;  2F4V L;  2V1C C;  2N3S A;  1KL9 A;  3UE1 A;  1ASY A;  1V1Q A;  2K5V A;  2I5M X;  2EIF A;  2H5X A;  3M7N A;  3JC6 6;  1C7Y A;  4A3C G;  1PFS A;  3KDF A;  4QY7 A;  4KHP Q;  4DR5 L;  3ER0 A;  4HIO A;  2JA6 H;  4JBK A;  4JV5 L;  4WJ4 A;  1X6O A;  4BY7 H;  2JEB I;  3D31 A;  5JEA J;  5IYC H;  5IWA Q;  3S24 A;  3ICE A;  1X9N A;  3NEL A;  4YY3 L;  5C4J H;  3F1Z A;  4LF5 Q;  3VDY A;  1YI2 A;  1XMQ Q;  1EYG A;  2JK8 A;  2WFW A;  2PI2 A;  3W5O A;  4AQY L;  2UUA L;  1NMG A;  3PUV A;  4GN3 B;  1QVC A;  1XPO A;  4NB3 A;  1Q8K A;  3AEV A;  4OO1 G;  1YHA A;  5IT9 c;  1JMC A;  1UE5 A;  4MZ9 A;  2ZTE A;  3A74 A;  2JQO A;  2MFI A;  2AWN A;  1YIJ A;  4X65 L;  1UWV A;  1VQO A;  1X3G A;  3CME A;  5C3E H;  1VS0 A;  1Y1V G;  3U4Z A;  5BR8 L;  2JA7 G;  2VW9 A;  1VQ5 A;  1HZA A;  1XPR A;  1Q12 A;  4GOP A;  1XNR Q;  2JE6 I;  2ZTC A;  4R4C A;  3PIO A;  2UUC Q;  1K73 C;  4A3F G;  1EQQ A;  4A75 A;  1CKN A;  5EAY A;  5HY6 A;  3BU2 A;  4BA1 I;  4HID A;  3K81 C;  4GNX C;  4JI4 L;  3HOY G;  4DR1 Q;  4A3K H;  1XMO L;  3H15 A;  1U5K A;  1L1O A;  3L2P A;  1C0A A;  1K0R A;  4KHP L;  1O7I A;  3E0E A;  5M3F H;  1UE1 A;  5IWA L;  5DLQ E;  1JT8 A;  3GDE A;  1W2B A;  1W3S A;  2WAQ E;  1N36 Q;  4LF5 L;  4DNI A;  2BA1 A;  3J7Z C;  1XMQ L;  4R4O A;  1X54 A;  2D62 A;  3PGZ A;  1UEB A;  2YV5 A;  1G51 A;  1S3O A;  3M4Q A;  1L0W A;  3OW2 A;  1E3P A;  4B3T L;  4LF6 Q;  1I50 H;  2AHO B;  2R93 G;  3CC2 A;  1IZ6 A;  2L15 A;  2LSS A; 
#chains in the Genus database with same CATH topology
 3GV3 A;  2R93 B;  1EQT A;  3K80 C;  3GTO H;  5FO7 B;  1LAC A;  1LT5 D;  3HOW G;  4JPB W;  1PH1 A;  2UUC L;  4R4T A;  2JA5 B;  2CFM A;  1BBU A;  4BY1 G;  5K36 G;  3TRE A;  4DUZ Q;  4HCS A;  2F0D A;  3IFT A;  1N32 L;  3CXC A;  5E4X A;  4XT1 B;  4ZKC B;  1ICF B;  2FIN B;  1TWG H;  2PYK A;  3MXU A;  4FNF A;  4O42 A;  4B3R Q;  2QIL A;  1UE6 A;  4LW1 A;  4I65 A;  5FK9 C;  2WAQ G;  1N36 L;  1EIG A;  2F0P A;  4DK0 A;  5JPN C;  1TS5 A;  2GA4 B;  3TN2 A;  2ZM6 Q;  4A93 G;  4C3H H;  2JXM B;  1WD1 A;  2QCP X;  1L0Y B;  2HHH Q;  5GAE C;  1TWF H;  4Y52 H;  4DV7 Q;  3GTL H;  4F88 A;  1OXX K;  4IAL A;  4PZ6 A;  2RF4 A;  1I6H H;  2NN6 G;  3MC0 B;  1LTT D;  1HA5 A;  1U9R A;  2PW7 A;  3F2B A;  1EYA A;  1UUP A;  2K7V A;  1WI5 A;  3VYS A;  1QZH A;  3TDQ A;  1EEI D;  1V8Q A;  1B4O A;  4TRD A;  4JVZ A;  2B2Y C;  4OWT B;  1I3Q B;  2WKC A;  3D4R A;  4BS9 A;  1EIH A;  1E2W A;  4UP8 A;  1NJI C;  1QIL A;  2B3G A;  1ET6 A;  4CKC A;  4DV5 Q;  4IUP A;  2F4I A;  1PYS B;  1JJC B;  2SNM A;  3EVQ A;  1E2Z A;  5C5L A;  3PUZ A;  1WCM B;  2EY1 A;  1D2B A;  4N9T A;  2PMZ E;  2K6A A;  2B39 A;  2VUM H;  4TSS A;  2WV6 D;  3SK5 A;  2ZM6 L;  1U4M A;  2E75 C;  4B3M L;  4FO2 A;  1WTR A;  5FJ8 H;  3H3V H;  2B2U C;  4DV7 L;  3S14 H;  1IKM A;  1G29 1;  2K1B A;  2M9V A;  3T4A C;  4UPA A;  2YU9 H;  2EXD A;  1FD7 D;  1Q1E A;  5NUC A;  1DD2 A;  2KEE A;  1HZB A;  1X3Q A;  3FEW X;  3H6M A;  2F0F A;  1YNN C;  4K8J A;  3I4M H;  1B9N A;  3F2D A;  1DZ1 A;  3J80 E;  3EN2 A;  3PO3 G;  1Y1V B;  2N78 A;  3J81 i;  1T5X D;  5TSS A;  1NBW A;  2IPK D;  3JAM c;  3PV0 A;  3VR3 A;  4Q5V A;  3TP5 A;  2A6H C;  4DV5 L;  4A3F B;  4YCW A;  2PNH A;  4K5X A;  2XSC A;  3K6O A;  3T13 A;  4JI8 Q;  4DV4 Q;  1LAB A;  3W2D A;  1GM5 A;  1K8O A;  5JVG 3;  2PMZ B;  3WDN A;  2BDN A;  1R9T H;  3SGI A;  1GHJ A;  5M5W H;  4L5Q A;  2K04 A;  5C5M A;  1H9M A;  2JN4 A;  1JWS D;  3GTP B;  4HCE A;  4NMZ A;  3GTM B;  1T5E A;  4J1M A;  2B63 B;  2R6G A;  2ICI A;  4O2D A;  2K5D A;  1EL0 A;  4DFA A;  1Y1W G;  1TR5 A;  1IL8 A;  3KF6 A;  4A4I A;  2EJM A;  4IPH A;  3A8I E;  5IGC A;  5I9P A;  3S17 B;  4K6D A;  2RKS A;  3MXP A;  3VR4 A;  1RTN A;  3H09 A;  4X62 Q;  3GTQ H;  4OO1 H;  1JQY D;  3S1R H;  2KHJ A;  4ALP A;  1YBY A;  4JI8 L;  1Q82 C;  2XWJ B;  4DV4 L;  4LJZ C;  1KTK A;  2EYH A;  2KCM A;  4A3I H;  2C9O A;  3FHW A;  5LL6 S;  1KAW A;  4DXF A;  1NR2 A;  4CDD C;  2JEA I;  2NVQ H;  1KQS A;  1D7Q A;  1XX8 A;  1H9J A;  4BY7 G;  3X3M A;  3U58 A;  1U4L A;  4JW0 A;  4DV6 Q;  3ND8 A;  5KGU A;  1ESR A;  4GKK Q;  2RDF A;  2Y0S E;  1GUW A;  1L1O B;  5J1Z A;  4WJW A;  2QGQ A;  2VQE Q;  4NXN L;  4JOI A;  3D4W A;  5C0X I;  1QB5 D;  2ENB A;  5E3F A;  4QUF A;  4R1J A;  2OF1 A;  4GLX A;  1TS3 A;  4Y7N H;  1ML0 D;  5C3E B;  4YY3 Q;  3NHH A;  3E5S A;  1XJV A;  3KJP A;  4IPD A;  4NP5 A;  2KJX A;  3MEF A;  1UEA B;  1JE5 A;  3CCS A;  4KD3 A;  1HR0 W;  2HCC A;  4JI1 L;  4H02 A;  4DR4 L;  4XQQ A;  5M3F G;  5EKL A;  3HEJ A;  1XYI A;  4HIM A;  2BDO A;  2OQ0 A;  4JI3 L;  4DV6 L;  1DOL A;  3RNU A;  4V19 0;  5FLM H;  4RGN A;  1HRJ A;  2I07 B;  3OWE B;  1PTO C;  2Y0S B;  4GS3 A;  3A8J E;  5EGT A;  2XIW A;  5KND A;  4P75 A;  5BN3 A;  4A3J B;  1B44 D;  4A3D G;  2L9H A;  2CW0 D;  2CKZ B;  1PH6 A;  3VR5 A;  4A93 H;  1CZG A;  2F0O A;  3SDZ A;  1FR3 A;  1YJN A;  2X69 A;  1YHB A;  1YNN D;  2EQS A;  2B2T A;  2EY5 A;  2Z9H A;  2KOL A;  3PIO 3;  1H95 A;  2L0C A;  4MHE A;  2NN6 H;  3U9S A;  1EQR A;  4EQ5 A;  2R7Z H;  1ENF A;  2Q2U A;  5I4D A;  3W1B A;  4LAA A;  2A6H D;  1K3R A;  2J4X A;  4JK1 C;  1VQ4 A;  4LMQ D;  3SXH A;  1TWG B;  2WB1 G;  3NBH B;  1RF2 D;  4DAM A;  4M8A A;  3NTI A;  2E2D C;  1HZ9 A;  4A3M H;  3PUW A;  3T56 B;  5KYL A;  4C3H B;  3CCR A;  1OXT A;  2L11 A;  3KLW A;  1TWF B;  2KUM A;  3CKI B;  3HZX A;  3NEN A;  5G3L F;  1N8R C;  2KHS A;  3GTL B;  1HFN A;  1LTG D;  3QIA A;  3PO2 G;  4PZ7 A;  2NVX H;  4ZCK A;  1I6H B;  4C3J H;  3J80 L;  2AMC B;  1NTG A;  5JVH 3;  1Q8I A;  3O13 A;  1Q81 C;  4OX9 Q;  1E1T A;  1PMR A;  1YEZ A;  2DY8 A;  1I5F A;  3JAM E;  1VQM A;  2UUB Q;  1KLU D;  1E7Z A;  1RDP D;  3MXN B;  5CYU A;  2E5L Q;  1WYD A;  2XTI A;  2ES2 A;  2F0J A;  1TQO A;  3J7A 5;  3ULP A;  3F2C A;  3BYT B;  1EY8 A;  1X3E A;  1AP0 A;  2G9H D;  3UE0 A;  4X64 Q;  5J3B A;  1O7Z A;  2VUM B;  3V05 A;  1VF7 A;  3VA7 A;  2VS1 A;  1VQ6 A;  1TY0 A;  1A2T A;  1K83 B;  1F2L A;  3I55 A;  2E2J H;  2MP1 A;  3D4D A;  2F4V Q;  3S14 B;  1FVI A;  1SMY C;  2CHB D;  2PNR C;  2YU9 B;  3S2D B;  1EY5 A;  1D6E C;  2ATW A;  1O80 A;  1VCI A;  2A19 A;  4K2L A;  3DEO A;  3I4M B;  2DY7 A;  2SEB D;  1F77 A;  2QEX A;  1QCB D;  2R93 H;  1ENA A;  2E5L L;  4CDF C;  2UUA Q;  4GNX A;  3J7A F;  2NVY H;  1C9O A;  1Q46 A;  4PG3 A;  2JA5 H;  1QUQ B;  4KKU A;  1FNW A;  2M2L A;  3DMU A;  4MTK A;  2E2I B;  4L5T A;  4X64 L;  3BDO A;  1H9S B;  2E74 C;  4R9W A;  5EBC A;  4UDU C;  4F87 A;  4HIK A;  2RBM A;  3G4S A;  1R9T B;  1PVO A;  1CK1 A;  2F4V L;  1E1O A;  5M5W B;  1C4Q A;  2V1C C;  1ASY A;  3P1H A;  1G8Z D;  2H5X A;  5DM7 3;  3KDF A;  2FMC A;  3CRL C;  1B53 A;  4BY7 H;  4KKS A;  2JEB I;  4IN3 A;  5A35 A;  1STA A;  1EWC A;  1E2V A;  1PZK D;  5C4J H;  5LHY 1;  1ICW A;  3OOC A;  1YI2 A;  1QE6 A;  4OHJ A;  2UUA L;  2LMC B;  1XPO A;  4NB3 A;  1Q8K A;  4ZUJ A;  3K0Y A;  5IT9 c;  3GTQ B;  3VR6 A;  2MFI A;  3OWF A;  1VQO A;  1Z7T A;  3S1R B;  1KAB A;  1PTO F;  3FVQ A;  2JA7 G;  1XPR A;  1XNR Q;  4A75 A;  1CKN A;  4X3T A;  3K81 C;  2NVQ B;  4EQO A;  1SND A;  4IFD H;  5CBE E;  5I6W A;  1K0R A;  4ZKB B;  3N52 A;  2RCF A;  1ILQ A;  5M3F H;  3K7A B;  1WVL A;  3QWN A;  4NDX A;  1JT8 A;  4EQP A;  3WOF A;  1W2B A;  1FNU A;  2WAQ E;  1LT6 D;  1X54 A;  1NR4 A;  1S3O A;  1L0W A;  4B3T L;  4LF6 Q;  2B2Y A;  1S5E D;  1ROD A;  4M1U B;  2LSS A;  4EGV A;  4X3S A;  1GJX A;  2EZV A;  4A3D H;  1VMP A;  1XNR L;  3AB9 A;  4GKJ Q;  1HH2 P;  1D5M C;  3S1N H;  1EY4 A;  4DGZ A;  2A69 C;  4J15 A;  1YNX A;  3I70 A;  1G6Z A;  1EIF A;  2NWG A;  1BNZ A;  4I7A A;  1IBK L;  1LTS D;  3IAY A;  3HRZ C;  1GUN A;  3CCM A;  1YVC A;  4DUY L;  1PRT D;  4YCV A;  1BUV T;  1EIY B;  1OXS C;  4ID6 A;  4JI0 Q;  3HOZ G;  1GUT A;  1L1O C;  2WAQ B;  1CQV A;  1VQG A;  1VQA A;  4YIJ A;  4LF6 L;  5LMN Q;  3DM3 A;  3KF8 A;  5KIX A;  4A93 B;  2B63 H;  2HT1 A;  4G7H C;  5C4X H;  2IL8 A;  5BN4 A;  2R3Z A;  4YHH Q;  2EYP A;  3JAM L;  3BJU A;  5K5P A;  3HOX H;  3OYY A;  4F8M A;  1WTO A;  2Z0S A;  5CV5 A;  4JI2 Q;  1PFN A;  1ZXT A;  2V4D A;  3C3L A;  4GN4 B;  1VQE A;  4FF3 A;  4LF4 Q;  1V9P A;  4WJ3 M;  2K14 A;  4FVM A;  2L55 A;  1LLR D;  3I73 A;  1XNQ Q;  2QA4 A;  2FXQ A;  2F0I A;  1VQJ A;  2RQX A;  1GVP A;  3DWA A;  3SK4 A;  3HOV H;  4ZQ3 A;  1HTP A;  4IJH A;  1AW7 A;  4HJ5 A;  1HUN A;  4IOC A;  5E7N A;  1Y8N B;  4A3M B;  2EYF A;  4B9X A;  1SE8 A;  3I7F A;  4JI0 L;  3IKJ A;  3LNN A;  3OTO Q;  5KYI A;  3HOU H;  3FP9 A;  4UP9 A;  3M85 A;  2VNU D;  5CV9 A;  5CC4 A;  5COR A;  4MNO A;  1EZ8 A;  4FYD A;  2NVX B;  1RIP A;  3VYU A;  4C3J B;  1JOQ A;  1SNQ A;  4OWW B;  3UI2 A;  4DR7 Q;  1STE A;  1UE7 A;  2A5H A;  3CCQ A;  3TZU A;  4C2M H;  3RN2 A;  4JI2 L;  1SE2 A;  1AE2 A;  3I4O A;  4UAI A;  2ZTD A;  1PH9 A;  1XPU A;  3SVM A;  4RA8 A;  1FNV A;  1SNO A;  1SYC A;  4YWK A;  5IP7 G;  1DCZ A;  2FMM A;  3D0F A;  1K8G A;  2UU9 Q;  2VQF L;  4POF A;  1G2S A;  4A3L G;  2HIX A;  3URY A;  4LF8 Q;  2RDG A;  1PA6 A;  3EA6 A;  4K5W A;  1PFB A;  3K5L A;  1A3T A;  5D65 A;  3T1H Q;  2K5Q A;  3A5U A;  1TT2 A;  3HG9 A;  1YIT A;  2IX0 A;  4A3E G;  1S5C D;  1GKH A;  4PV1 C;  5AFW A;  5IYB H;  1NY4 A;  2E2J B;  3GTG H;  3VYT A;  4DKA C;  1GUO A;  3CPF A;  3M7G A;  3K0X A;  4DR7 L;  1OTC A;  1S40 A;  2XRQ D;  5GAD C;  4A3J H;  4G57 A;  3K7U C;  4ZLT F;  4IFD J;  2RA4 A;  3H3V I;  2AUJ D;  2NB0 A;  4JC0 A;  2KQ3 A;  1A8V A;  3I91 A;  2UU9 L;  3M9B A;  2IW3 A;  5IT9 E;  2NVY B;  4LF8 L;  4LF7 Q;  1SEB D;  4O1N A;  3J80 i;  3K58 A;  4L6T B;  4QUC A;  3J7Y W;  4JI6 Q;  4NPS A;  2IY5 B;  4DXG A;  4K6L A;  4H44 C;  3RLN A;  3GTK H;  4DV1 Q;  1PRT B;  1FL0 A;  2A69 D;  2AUK A;  4X6A H;  4MTN A;  4K0K Q;  1ZEQ X;  1M8A A;  2BA0 A;  4AYB G;  4CBV A;  4HED A;  3BDC A;  2PZW A;  4LUO A;  1TWH H;  3S9W A;  5JJK A;  3K8A A;  5IYC G;  2F0E A;  3NBI A;  3H3V C;  5EKI A;  2K03 A;  4BY7 B;  1FJG Q;  3VR2 A;  4C56 C;  2EYL A;  1SYG A;  4RGM A;  5C4J B;  4JI5 Q;  3RZO H;  5E4W C;  3BZK A;  1DJR D;  1G2T A;  5CGK A;  4QQB X;  5JJZ A;  1MJC A;  1VQK A;  3GO5 A;  1PYW D;  4DR5 Q;  4JV5 Q;  4CDE C;  2EY6 A;  1S72 A;  1B70 B;  1ILP A;  4DUZ L;  1Q90 A;  4DAY A;  4DV1 L;  1II3 A;  4S3S A;  4WOR A;  4ODG A;  1BXT A;  4AQY Q;  2E2H H;  4B3R L;  3A56 A;  1MKH A;  4GLV B;  4WRD A;  3E9H A;  1I4G A;  1DOK A;  4OO1 I;  1QNK A;  2GVB A;  2Z1C A;  2G5D A;  4ULL A;  3KF6 B;  2NVT H;  1HXY D;  1LTR D;  1AN8 A;  4H13 C;  5M3F B;  5IGE A;  1K8A C;  2HHH L;  3RZD H;  3QOL A;  1YJ9 A;  1K83 H;  3I4L A;  4X3K A;  5CMD A;  4B3S Q;  3A7A B;  4UY8 C;  1TXY A;  2B2V C;  2E8G A;  2CW0 C;  4R8N A;  3S2D H;  3MA2 B;  4OXP A;  5C0X G;  1VQN A;  3MWY W;  2IJ0 A;  5ELO A;  4KTA A;  3D8G A;  1I4H A;  3ERS X;  3I2Z A;  1MJE A;  1WFQ A;  4OEM B;  4QB4 A;  3HOZ H;  2B29 A;  1CKM A;  2DN8 A;  1JC7 A;  4OIK A;  4NXM Q;  5ELC A;  1Z9F A;  4RAU C;  4A3D B;  4X3U A;  3ZJY C;  1NMF A;  5I6Y A;  2Z6K A;  4HR7 B;  1AZQ A;  3S1N B;  2CH4 A;  5E1F A;  3U4V A;  5CV7 A;  2UXC Q;  3HGB A;  2IHE A;  1Q86 C;  2LY7 A;  4WFN 3;  1SDF A;  2E2I H;  4K8I A;  2RDH A;  1CHP D;  2ZXP A;  1JOK A;  2ZXR A;  5M5X B;  3TP6 A;  2JP1 A;  4BXX H;  1IBL Q;  1IL2 A;  4B3S L;  3GQB A;  2KED A;  1RL2 A;  4XQN A;  2MGS A;  4CHT B;  2B8F A;  1HNW Q;  3TZD A;  5EPL A;  1QVF A;  3D6C A;  1IYU A;  2KBN A;  4PNY A;  2JSO A;  5C4X B;  4NXM L;  1BOS A;  3CC7 A;  2UXD Q;  1PZI D;  4LK1 C;  3HOX B;  3A0J A;  2OTL A;  1PV4 A;  3G6E A;  3CCU A;  3PO2 B;  3M4Y A;  4EQN A;  4BBR G;  1TWC H;  3S2H B;  5JJI A;  2UXC L;  1FGU A;  3IRB A;  1YZ6 A;  2ZJP A;  3TS2 A;  3W3A A;  2Z6B A;  3T1Y Q;  2MQH A;  4CKE A;  1VQL A;  3DWQ A;  1A6X A;  3ND9 A;  3HOV B;  2NN6 I;  1IBM Q;  4C1N K;  5IGB A;  2QDL A;  1IBL L;  1NUC A;  2LS0 1;  1SJE D;  4JYA Q;  5JEA G;  4DK1 A;  1HNX Q;  4OEL B;  3PUY A;  1HNZ Q;  1PDQ A;  1EFW A;  1I4Q A;  3HOU B;  3M3Y B;  2K33 A;  1HNW L;  2SNS A;  2F0U A;  3K7A H;  4A3E H;  3TRZ A;  4OON A;  5C3W A;  1J9O A;  2A6E D;  4C2M B;  2P5Z X;  1MHW C;  3E9I A;  4V0B A;  2O2L D;  5IT9 L;  1BCP B;  4XQJ A;  5IYD G;  1EU4 A;  4X62 L;  3M4P A;  1ZKO A;  2GN5 A;  1JE4 A;  3AQQ A;  4APV A;  5IP9 G;  3JAM i;  4P72 A;  1PXU A;  1CTM A;  1LV9 A;  2PO4 A;  2X6G A;  1IBM L;  3HOW H;  2L4N A;  2Z8L A;  4JYA L;  1HNX L;  3H0G G;  2NZO A;  4BY1 H;  1B1Z A;  3PQI A;  5K36 H;  3Q22 A;  3NPP A;  2AQ3 B;  4GKK L;  2LFN A;  3GTG B;  4I7Z C;  1S4Z A;  1SBB B;  1Y8P B;  2VQE L;  5DM6 3;  2Z4H A;  1JB7 A;  3WOE A;  2QDB A;  5IOD A;  2K05 A;  2EIF A;  1PFS A;  2RSN A;  3D31 A;  5IYC H;  1X9N A;  3NEL A;  3C1E A;  1X32 A;  4YY3 L;  3H91 A;  4B08 A;  1BBX C;  1K0S A;  1B9M A;  3R2I A;  2JK8 A;  2WFW A;  1G91 A;  5HUR A;  4G7O C;  3MFG A;  1JMC A;  1UE5 A;  2AWN A;  1YIJ A;  1UWV A;  5ELF A;  1WD0 A;  3GTK B;  1Y1V G;  2VW9 A;  4HMJ A;  1HZA A;  1Q12 A;  4GOP A;  2JE6 I;  1HUM A;  2OEO A;  3TME A;  1K73 C;  4A3F G;  5HY6 A;  3BU2 A;  2A68 C;  3BS1 A;  1TWH B;  5J22 A;  3HOY G;  5DNF A;  1U5K A;  1L1O A;  3KK7 A;  5C3X A;  1C0A A;  1MD2 D;  1W6K A;  3DXJ C;  1XXG A;  4E6I A;  1UE1 A;  1CHQ D;  3RZO B;  1FYC A;  5IIF A;  3R2T A;  1W3S A;  2TMP A;  4XXE A;  1K28 A;  2CQA A;  4DNI A;  2BOS A;  4R4O A;  3PGZ A;  1UEB A;  3OMC A;  3M4Q A;  2EY2 A;  3VYR A;  1BO0 A;  3CC2 A;  5L37 A;  1MSG A;  1S5D D;  3NXW A;  1O7L A;  4C1N I;  2RHQ B;  4IJL A;  1AE3 A;  4A3B G;  2M00 A;  1PH2 A;  5C6A A;  4POG A;  2E2H B;  3PO3 H;  4RKL A;  2JA8 G;  2HDL A;  5GQO A;  3CCV A;  4EX5 A;  2OTJ A;  1PRT C;  2D2C C;  1SN8 A;  2RCN A;  3RMH A;  5CV8 A;  4DR6 Q;  2NVT B;  2L5T A;  1BKB A;  1A3V A;  4ZYS A;  5EPJ A;  3A5Z B;  3RZD B;  4BWG B;  3L0O A;  4A76 A;  3GP7 A;  1STG A;  5T1G A;  1S5F D;  2F0N A;  4IFD I;  1DM0 B;  3QO2 A;  3I72 A;  1EOT A;  2DJF C;  2JA6 G;  4GZY C;  5D3I B;  4OX9 L;  3OIP A;  2F3I A;  1JIC A;  3HOZ B;  1SSO A;  1CKN B;  4P2C B;  2CCZ A;  3QR8 A;  1E0B A;  2F0K A;  1TII D;  1X55 A;  2UUB L;  2ZXO A;  1IYJ B;  1Z47 A;  3E6Z X;  4DV3 Q;  2OQK A;  3NQI A;  1A3U A;  3Q6S A;  3CMA A;  1Y1W H;  4XDX A;  3QOJ A;  1A2U A;  2K01 A;  1V1P A;  3K5N A;  1QWY A;  3BZD B;  3G6J B;  4IZ8 A;  1T9H A;  5AJ3 Q;  3NBH A;  5LMN W;  2YTX A;  1N34 Q;  1SE4 A;  3AYH B;  3C2P A;  2XVS A;  4X66 Q;  4A3K G;  3NP8 A;  3SE0 A;  5M9O A;  4R8I A;  4IUN A;  2CWA A;  1VF5 C;  1SRO A;  4LFA Q;  2I5H A;  4QMG A;  5GAH C;  4P73 A;  1EYC A;  4U68 A;  1H9R A;  1JCK B;  3SEB A;  2Y0S G;  1DYQ A;  2MO1 A;  2EYM A;  1GD7 A;  1EQV A;  1VQD A;  3NE5 B;  3P75 A;  4DV3 L;  3BVG A;  4JI7 Q;  1L0X B;  1TWC B;  3A54 A;  1RJT A;  5JPM C;  1O78 A;  4HTH A;  4RGO S;  3AFQ A;  5CR3 A;  2QKI C;  4A3G G;  3L7Z C;  1N9W A;  5AJ3 L;  5BN5 A;  2N8N A;  5KNC A;  4LF9 Q;  1N34 L;  4FF1 A;  2A8V A;  4AIM A;  2MO0 A;  4JBM A;  4L5S A;  4K2K A;  5KNB A;  1XWE A;  2D0O A;  1GXD C;  3I4N G;  2PI2 E;  3KF8 B;  3LGJ A;  4IUU A;  5IP9 H;  2HQL A;  2WAC A;  5DEH A;  3C46 A;  1I4X A;  3UDX A;  3MZ5 A;  3KLS X;  1J6Q A;  2A68 D;  1WOC A;  2DUD A;  2F3V A;  4LUZ A;  3E0J A;  4LFA L;  4A3E B;  3H0G H;  1KIX A;  4AYB E;  3I3C A;  2EYO A;  3MHB A;  4DAP A;  1TWA B;  3FDT A;  4CGY B;  3BZC A;  3HKZ G;  4RCN A;  4G7Z C;  1TU2 B;  1HJP A;  4KV6 A;  2VL6 A;  3A7L A;  5EBD A;  4JI7 L;  1RTO A;  3S1Q H;  3V2T A;  4K14 A;  4KY7 A;  2PQA A;  2R92 G;  2ZJR A;  1M1K C;  2AQ1 B;  1VQF A;  2L12 A;  2AWO A;  3CQZ H;  1H9S A;  3HOW B;  2XN9 C;  4R4Q A;  2BE5 C;  3QJY A;  2F0G A;  1AZP A;  3PCO B;  4BY1 B;  4PZ8 A;  5FOB B;  1C48 A;  5M5X H;  2B2U A;  1F9R A;  1DON A;  1EWI A;  1X56 A;  1I94 Q;  4P71 A;  2B2V A;  2SOB A;  5C4Z A;  1SNC A;  2MNA A;  4RGT A;  2NUC A;  4DR2 Q;  3FPP A;  1GUS A;  1OXU A;  4KK7 A;  3DUZ A;  4AYB B;  2B2T C;  1STB A;  2NZH A;  4GLA C;  2JJQ A;  3PSI A;  5A2Q E;  1EY0 A;  2IX1 A;  5FJ8 G;  1QG7 A;  3LWU A;  4KHZ A;  3R8B A;  1PRT F;  3D3R A;  3W1G A;  4KJN A;  1BCP C;  1PH8 A;  1F9P A;  1I6V C;  3HFZ B;  4GKJ L;  3PO2 H;  4MN3 A;  3I4M G;  4DNR B;  2C35 B;  5LMU Q;  3S2H H;  2HD3 A;  2OXP A;  1SMX A;  1CSP A;  3SHL A;  2VY3 A;  4XT3 B;  2PCF B;  5F2D A;  3PIP 3;  1GHK A;  3A8K E;  4ZUI A;  4DR2 L;  1PH5 A;  4YCU A;  4X65 Q;  1WTV A;  5JOB A;  3S16 B;  3M3Y H;  5ELE A;  2EXZ A;  1DOM A;  2KCC A;  1HZC A;  3FMC A;  5LMN L;  2D9U A;  3NSW A;  5CBA E;  4JI4 Q;  2XRS D;  5IOC A;  1X3F A;  4YHH L;  1SJH D;  1JJG A;  2H4O A;  2ZJQ A;  1KRS A;  4G4K A;  5LMU L;  1QOH A;  4LF4 L;  2PPB C;  5KEE A;  2GVA A;  1VDZ A;  1XNQ L;  1CQF A;  1MGS A;  1VQ8 A;  4H7B A;  3PO3 B;  2L1B A;  1F2Y A;  4ABN A;  4OL7 A;  4AH6 A;  1U0L A;  4RHS A;  4DF7 A;  4GN5 A;  1YJW A;  3OTO L;  2BCO A;  4A3I G;  2BH8 A;  1TS4 A;  1MSH A;  5D3D A;  2B2W C;  3KLS A;  2PW5 A;  4BBS G;  3RN5 A;  1SNP A;  2F0H A;  2Q8R E;  4RHR A;  3BG3 A;  4L63 B;  2R7D A;  1EY7 A;  3HKS A;  4Z9C B;  4DAY B;  3M4O H;  2D0P A;  5M3M G;  1D8L A;  1BDO A;  2Q2I A;  1JJ2 A;  1N32 Q;  2FHT A;  4IQZ A;  3CAM A;  4RWS C;  3F8T A;  4CJ0 B;  2KEN A;  3G48 A;  3HS0 C;  2MJ8 A;  1UAP A;  4YWM A;  3BYY B;  3TP8 A;  1Y1W B;  2CWP A;  1EYD A;  1HPC A;  3TS0 A;  4LWC A;  3T1H L;  4JBJ A;  3STB C;  3K5O A;  4HJ9 A;  1OXV A;  4BBR B;  2KEC A;  1U4R A;  1CZW A;  4JBW A;  5JJL A;  4A3G H;  3Q23 A;  2BE5 D;  2JA7 H;  5FO8 B;  1A0I A;  1Q1B A;  2EDG A;  3F2U A;  3CF5 A;  4ZRZ A;  4C3I G;  4OGQ C;  4QF4 A;  4DPG A;  1U4P A;  1MIU A;  4F7X A;  1CA5 A;  1BVS A;  3I4N H;  1B8A A;  2RSO A;  2A6E C;  3Q8D A;  5FLM G;  1ESF A;  3EQL C;  1BBW A;  4LUV A;  2JA9 A;  2HIV A;  1JOR A;  2J0T D;  3SK6 A;  3CCE A;  1V43 A;  1EU3 A;  1VQC A;  3K57 A;  4LF7 L;  2EOT A;  1HQM C;  4JI6 L;  2ASB A;  2F0M A;  3NQT A;  4HJ7 A;  3Q0A A;  1BCP D;  4TQU S;  3J81 j;  2K32 A;  4B3M Q;  2CVR A;  1LTA D;  3FKI G;  4FXG C;  1WTX A;  2A73 B;  3CD6 A;  1AH9 A;  1KDB A;  4N8X 1;  4K0K L;  2R92 H;  4CKB A;  2R7Z G;  3V96 A;  4KN7 C;  1KRT A;  4QGU A;  5M5Y H;  2K28 A;  3DLL A;  2RHS B;  5HGQ A;  4KJO A;  2OWO A;  5FLX L;  3UDI A;  3AU7 A;  1BCP F;  5LL6 X;  1FJG L;  2WB1 E;  3H0G B;  1SFO H;  4JI5 L;  5A2Q L;  1KXL A;  2I46 A;  1WJJ A;  4MIU A;  4PMB A;  4RG1 A;  4A3M G;  5C44 G;  1WTQ A;  1JR0 D;  2A1A A;  2N3S A;  3K5M A;  1MI2 A;  3UE1 A;  1V1Q A;  2K5V A;  2I5M X;  3A55 A;  3M7N A;  3JC6 6;  1C7Y A;  3G7L A;  4A3C G;  2F03 A;  4DR5 L;  3S1Q B;  3ER0 A;  4JBK A;  4JV5 L;  1B3Q A;  1K3B C;  5D14 A;  5IWA Q;  1SXT A;  4C3J G;  3F1Z A;  3RUZ A;  3KLR A;  4CDC C;  1UNS A;  4LF5 Q;  3VDY A;  2Q8I B;  3CQZ B;  1EYG A;  5C4H A;  1F2Z A;  4XYQ A;  3W5O A;  1NMG A;  4L8J A;  3PUV A;  4AQY L;  3DEP A;  4QCL A;  1TVX A;  4MZ9 A;  1EEF D;  1PLF A;  2FFK B;  4PQX A;  3CME A;  1HTL D;  1SNM A;  1VS0 A;  3U4Z A;  2LKV A;  1VQ5 A;  1QJO A;  3SR1 A;  3P7J A;  3DHQ A;  5EQ0 A;  3PIO A;  1EQQ A;  4BA1 I;  4HID A;  1JWM D;  2WB1 B;  3KBX A;  4DR1 Q;  1SYD A;  1MBY A;  3HOY B;  3L3O C;  3VA5 A;  3HP3 A;  1BR9 A;  1O7I A;  2F3W A;  5IWA L;  5DLQ E;  1HCZ A;  1RKN A;  2EE1 A;  4LF5 L;  2BA1 A;  3KUP A;  3DWP A;  2N88 A;  2YV5 A;  3OW2 A;  1SAP A;  1E3P A;  5I9O A;  2AHO B;  2KVM A;  2R93 G;  2VB2 X;  1STH A;  1IZ6 A;  2L15 A;  4IUT A;  3S15 H;  1LT4 D;  4ME5 A;  4KHV A;  1KAA A;  4NXN Q;  5IP7 H;  3KYH C;  1KD1 C;  1CFM A;  3CRK C;  2O4X A;  3STB D;  4A3L H;  2JA5 G;  3KFU A;  4A3B B;  1HHV A;  3CCL A;  5COY A;  2OCE A;  4DR1 L;  2JA8 B;  2I5L X;  2F0L A;  1QVG A;  5DAU A;  3FRP B;  5ELD A;  3EJI A;  3NWS A;  1CA6 A;  4DN4 M;  1E24 A;  2Q2T A;  1LTI D;  5GRO A;  2SDF A;  2UXD L;  2NYZ D;  5EPK A;  1TWA H;  4JI1 Q;  2WII B;  2K52 A;  4BBS H;  1KNE A;  3TSS A;  1ASZ A;  3CU7 A;  1STN A;  1GUG A;  4DR4 Q;  1EY6 A;  4GOP B;  2Q2H A;  4FF2 A;  3MVV A;  1EY9 A;  2JA6 B;  4KMU C;  3MAQ A;  1PHJ A;  4DR3 Q;  4ME3 A;  4JI3 Q;  3J7A V;  3N6R A;  1AEX A;  1EOV A;  3C1F A;  5M3M H;  3T1Y L;  1SR3 A;  1NE3 A;  1HA6 A;  3T51 B;  2XWB B;  4RCO A;  1B3A A;  3TQY A;  1XTD A;  3MFY A;  4XIG S;  4OWX B;  1P8L A;  3G71 A;  2K4K A;  5H1S E;  3ERQ A;  3J81 E;  1NCV A;  2E76 C;  3WWV A;  1HNZ L;  2NZ1 D;  1Y8O B;  3BDL A;  3R93 A;  5JAV A;  1K8M A;  2H1E A;  2F0Q A;  3AMU A;  1S5B D;  3OMG A;  2IWH A;  1WCM G;  5EKK A;  2F0V A;  2NTT A;  5T1I A;  5IY0 A;  3UDG A;  4IFD G;  1J8I A;  3NTH A;  4A3K B;  3U9O A;  3M4O B;  1SYB A;  2KHI A;  4KI0 A;  2XGT A;  4C3I H;  1KLG D;  4KLK A;  1N33 Q;  4FP5 D;  1Q3L A;  4DR3 L;  3T16 A;  1TKW B;  1LTB D;  2G9D A;  2DJG C;  4J6H A;  3PF5 A;  3TP7 A;  3HKZ E;  4KY6 A;  1PZJ D;  1O7Y A;  3KJO A;  3S1M H;  1X65 A;  2F0T A;  1EWH A;  1I50 B;  1ZYR C;  2DNC A;  4NW2 A;  2X6L A;  1PFM A;  1STY A;  4A3G B;  1HFG A;  4CJ2 C;  1Y14 B;  3GTO B;  2JA7 B;  4O0A A;  2OT2 A;  3CC4 A;  4FF4 A;  2NBF A;  2YTV A;  4KN4 C;  3FKI H;  1VQB A;  4J8Q A;  2F1M A;  1FGB D;  4CJ1 B;  5FLX c;  3I4N B;  1TY2 A;  1OO9 B;  4RFB A;  4PMW A;  4LFC Q;  4GNX B;  2MHV A;  2LXJ A;  3S16 H;  1D5Z C;  2LXK A;  3RLO A;  1QZG A;  1N33 L;  4TVA B;  4LNQ A;  1V1P B;  2ICE C;  1DGS A;  5G3L D;  4DU9 A;  4N9P A;  4QIW E;  1PH4 A;  5C44 H;  5C0X H;  2F0S A;  3HKZ B;  2B63 G;  1PTO H;  1Z6H A;  2R61 A;  3AFP A;  1Q7Y C;  5C4X G;  1LTL A;  2D5D A;  1RCV D;  3IL8 A;  4A3C H;  1DXM A;  1LO5 D;  3HOX G;  2BH2 A;  3KDF B;  1GO3 E;  4FXK C;  2KA7 A;  2R92 B;  2PQE A;  4YWL A;  3NWT A;  4QL5 A;  5M5Y B;  4IPC A;  4RKB A;  1TS2 A;  1EUJ A;  1CKO A;  3B6Y A;  2VZA A;  2Q8T A;  2PZT A;  4U67 3;  4LFC L;  2IHF A;  5ELN A;  1R4Q B;  1M4V A;  4IO9 A;  2MUY A;  1SFO B;  3HOV G;  4HJ8 A;  2TSS A;  1NAP A;  2EYJ A;  1KHI A;  4QJF A;  2Z6K C;  3T53 B;  3TBI B;  4EVO A;  4KD4 A;  3EFX D;  3HOU G;  3GD7 A;  1F9S A;  1G6P A;  2K5W A;  2R7F A;  2O5I C;  4JCV E;  4QIW B;  3I8Z A;  2N55 A;  1YNJ C;  1XTC D;  3QB3 A;  3ULL A;  5FO9 B;  2HQE A;  5GAG C;  1B2T A;  3E3X A;  3GTJ H;  1D1K A;  1PYB A;  1HR0 Q;  2RVL A;  4DA2 A;  1D1I A;  3KOJ A;  1X3P A;  5C3E G;  1LUZ A;  2WKD A;  4KY5 A;  3X3N A;  1QNU A;  1RD9 D;  1JOO A;  4BBR H;  4DR6 L;  1EFI D;  1IW7 C;  4R4I A;  3CCJ A;  1LT3 D;  2B2W A;  2YTY A;  5CV4 A;  1B7Y B;  1CSQ A;  1M90 C;  4IUV A;  4DV2 Q;  2F52 A;  2PQA B;  4DAV A;  1L2F A;  1SRU A;  1IXR A;  1F2M A;  3MTS A;  1Y69 U;  5JEA H;  5ELB A;  5IYB G;  3PMF A;  3PIP A;  2DGY A;  1AFP A;  3LX0 A;  3DM1 A;  2VB3 X;  1VQI A;  4Q0F A;  3RD4 A;  1C8C A;  1JB3 A;  3UDF A;  5ISR A;  1E22 A;  1F9Q A;  2KCT A;  1CUK A;  3MXN A;  3CPW A;  4A3J G;  1J5E Q;  4LFB Q;  2A74 C;  2WIN B;  1HR0 L;  1CM9 A;  2JYO A;  3P20 A;  3CW2 C;  3NEM A;  4P74 A;  2C5C A;  1KDC A;  4K5V A;  3MXG A;  5IGG A;  1I4R A;  1BQQ T;  1PTO D;  3S15 B;  5IYD H;  1ET9 A;  1KNA A;  3J81 L;  3K59 A;  1A62 A;  2QEJ C;  4IUQ A;  1NSN S;  1ZYR D;  4X66 L;  2ID0 A;  4JOI C;  1LM0 A;  4B3T Q;  2ZT9 C;  4DV2 L;  3PUX A;  2K50 A;  1I3Q H;  1VMC A;  4HSV A;  2K5N A;  3BVZ A;  4RH6 A;  4L5R C;  4A3I B;  4HN7 A;  1V1O A;  4IPG A;  4ZAI A;  4JG2 A;  4BBS B;  3CP0 A;  2Z4I A;  1SYE A;  4C3H G;  4HMI A;  3R3O A;  3U50 C;  2AKW B;  4LFB L;  1LYL A;  1J5E L;  1WCM H;  4DK6 C;  1HQR D;  1IBK Q;  1PH7 A;  2N49 A;  2IT1 A;  4ZK9 B;  3EIV A;  5M3M B;  5IGD A;  3RR5 A;  1A63 A;  4DUY Q;  4PMC A;  1QUQ A;  3BVM A;  5KRU A;  2I0Q A;  4LF9 L;  3OSO A;  5FKA C;  3MEH A;  3ERO A;  4XTC S;  4XYO A;  1IKL A;  2YYZ A;  5EJW A;  1KC8 C;  2HUG A;  2CQO A;  1W6J A;  2FJ2 A;  4OIJ A;  4Y7N B;  4DV0 Q;  3I90 A;  5C0X J;  2K5H A;  2MPM A;  3FPU B;  3IFD A;  2XNA C;  2WP8 J;  1WTP A;  4TKO B;  1Y1V H;  2NTS A;  5FLX E;  1SYF A;  3I56 A;  3RLF A;  1VQ7 A;  4FXD A;  3H94 A;  5I2Y A;  1YHQ A;  2K75 A;  4A3F H;  1K9M C;  2VUM G;  1B50 A;  4C3I B;  2UXB Q;  4IUR A;  3GV6 A;  3HOY H;  2O5J C;  3NUC A;  2EJG C;  1P16 A;  4IOA A;  2HDM A;  2KCN A;  4GOP C;  1VQP A;  4DK3 C;  4H0L C;  1YNJ D;  3EBE A;  2AQ2 B;  5IGF A;  3S1M B;  1VQH A;  1VQ9 A;  1PH3 A;  4B9W A;  3GTP H;  4BA2 I;  3ZYY X;  3GTM H;  1SLJ A;  1SMY D;  2EPB A;  4DV0 L;  1IYV A;  4UP7 A;  4HAE A;  5I2X A;  4FDB A;  4HSP A;  1A15 A;  3FKI B;  1I94 L;  2PZU A;  1IW7 D;  3J80 c;  4A3B H;  3ONA B;  2HCI A;  3PF4 A;  3S17 H;  3TEH B;  2JA8 H;  2R7Z B;  1D5X C;  1GOZ A;  3ULJ A;  5BR8 Q;  2UXB L;  3D6W A;  5IE8 A;  1JWU D;  2VQF Q;  4BXX G;  3L9A X;  3CHB D;  4RMF A;  1WTW A;  1H9K A;  1KDA A;  1EZ6 A;  2ALY B;  4HJA A;  4DNT B;  1XMO Q;  1KL9 A;  5C44 B;  3NTK A;  4KHP Q;  4QY7 A;  1PTO B;  2JA6 H;  3LWE A;  4HIO A;  1CT1 D;  4WJ4 A;  1X6O A;  3OIQ A;  2B8G A;  5JEA J;  5HGT A;  3S24 A;  3ICE A;  2F0W A;  1XMQ Q;  1CI3 M;  4ILW A;  3NK9 A;  2PI2 A;  4GN3 B;  1QVC A;  1ENC A;  3AEV A;  4OO1 G;  1RHP A;  1YHA A;  2DNE A;  2J7Z A;  2ZTE A;  3A74 A;  2JQO A;  1WTH A;  4X65 L;  1R4P B;  1X3G A;  5C3E H;  3Q24 A;  3OHX C;  5BR8 L;  2ZTC A;  4R4C A;  2UUC Q;  3KBG A;  1SE3 A;  3SK8 A;  5EAY A;  1I4P A;  1NNX A;  4GNX C;  4JI4 L;  4KKT A;  1BF4 A;  4A3K H;  1XMO L;  3H15 A;  1IHZ A;  3L2P A;  5J39 A;  1ONL A;  4KHP L;  4UHV A;  3E0E A;  2VXW A;  4NKL A;  3ITP A;  3OPO A;  2EJF C;  3GDE A;  4N8F A;  3GTJ B;  1N36 Q;  2QW7 A;  2IX3 A;  3J7Z C;  1XMQ L;  2D62 A;  5CV6 A;  1G51 A;  3OW7 A;  3QG1 A;  1I50 H;  2CH4 W;  2QF7 A;  2EVB A;  3J81 c; 
#chains in the Genus database with same CATH homology
 2RHQ B;  3S15 H;  4IJL A;  1AE3 A;  3K80 C;  4NXN Q;  5IP7 H;  3GTO H;  4A3B G;  3KYH C;  1PH2 A;  1KD1 C;  4POG A;  4A3D H;  3STB D;  1XNR L;  3HOW G;  3PO3 H;  4GKJ Q;  1PH1 A;  2UUC L;  4A3L H;  1HH2 P;  2JA5 G;  3KFU A;  4R4T A;  2JA8 G;  3S1N H;  5GQO A;  3CCL A;  4J15 A;  4EX5 A;  1YNX A;  3CCV A;  2OTJ A;  1EIF A;  2OCE A;  4DR1 L;  2CFM A;  1BBU A;  1SN8 A;  2RCN A;  4BY1 G;  4DR6 Q;  2I5L X;  1QVG A;  1BKB A;  5K36 G;  3TRE A;  4DUZ Q;  1IBK L;  3A5Z B;  1N32 L;  3L0O A;  3CXC A;  4A76 A;  1E24 A;  3CCM A;  2Q2T A;  1YVC A;  5GRO A;  4DUY L;  1TWG H;  4B3R Q;  2UXD L;  4YCV A;  1UE6 A;  1TWA H;  4LW1 A;  4JI1 Q;  4IFD I;  1EIY B;  4BBS H;  2K52 A;  1OXS C;  1G6P A;  2WAQ G;  1ASZ A;  4JI0 Q;  1N36 L;  3HOZ G;  2JA6 G;  4DR4 Q;  4GOP B;  4OX9 L;  2Q2H A;  1L1O C;  2F3I A;  2ZM6 Q;  4A93 G;  1CKN B;  1VQG A;  4C3H H;  1VQA A;  1PHJ A;  4DR3 Q;  4ME3 A;  2CCZ A;  2HHH Q;  4JI3 Q;  5LMN Q;  5GAE C;  4LF6 L;  3DM3 A;  1X55 A;  1TWF H;  2UUB L;  2B63 H;  1EOV A;  5M3M H;  2HT1 A;  4Y52 H;  1IYJ B;  4DV7 Q;  3T1Y L;  1SR3 A;  5C4X H;  1NE3 A;  3GTL H;  1Z47 A;  3TQY A;  1OXX K;  1XTD A;  4PZ6 A;  4YHH Q;  2RF4 A;  4DV3 Q;  2OQK A;  2NN6 G;  3BJU A;  4XIG S;  3OYY A;  3HOX H;  3F2B A;  4OWX B;  3CMA A;  1Y1W H;  1P8L A;  2Z0S A;  1WI5 A;  4JI2 Q;  3G71 A;  4GN4 B;  1VQE A;  2K4K A;  5H1S E;  1QZH A;  4LF4 Q;  3WWV A;  1V9P A;  1HNZ L;  1T9H A;  4WJ3 M;  4OWT B;  2K14 A;  5AJ3 Q;  5LMN W;  2YTX A;  1N34 Q;  3AYH B;  1XNQ Q;  4UP8 A;  1NJI C;  2B3G A;  2QA4 A;  2FXQ A;  1VQJ A;  1GVP A;  4X66 Q;  4DV5 Q;  4A3K G;  3HOV H;  1PYS B;  1WCM G;  4IJH A;  1JJC B;  3UDG A;  5IY0 A;  4HJ5 A;  4IFD G;  4IOC A;  5E7N A;  2CWA A;  1SE8 A;  2KHI A;  3PUZ A;  4KI0 A;  3I7F A;  2XGT A;  4C3I H;  4JI0 L;  3OTO Q;  1SRO A;  4KLK A;  2PMZ E;  1N33 Q;  3HOU H;  2VUM H;  3FP9 A;  4UP9 A;  4LFA Q;  2I5H A;  2ZM6 L;  3M85 A;  5GAH C;  4P73 A;  2VNU D;  4DR3 L;  4B3M L;  4MNO A;  5FJ8 H;  3H3V H;  4DV7 L;  2Y0S G;  1RIP A;  2MO1 A;  3S14 H;  1G29 1;  3PF5 A;  1GD7 A;  1VQD A;  4OWW B;  3HKZ E;  4DR7 Q;  4UPA A;  4DV3 L;  2EXD A;  1Q1E A;  1UE7 A;  2YU9 H;  4JI7 Q;  3CCQ A;  4C2M H;  3RN2 A;  1HZB A;  3KJO A;  4JI2 L;  3S1M H;  1X65 A;  1AE2 A;  3I4O A;  3AFQ A;  2ZTD A;  1PH9 A;  1XPU A;  3I4M H;  4A3G G;  3L7Z C;  1N9W A;  5IP7 G;  4YWK A;  3F2D A;  1K8G A;  2UU9 Q;  3D0F A;  5AJ3 L;  2VQF L;  3EN2 A;  4POF A;  2N8N A;  4LF9 Q;  2A8V A;  2N78 A;  2HIX A;  1N34 L;  1Y14 B;  4AIM A;  3J81 i;  4LF8 Q;  2MO0 A;  4O0A A;  4JBM A;  1PA6 A;  4L5S A;  1NBW A;  3CC4 A;  3JAM c;  2D0O A;  2YTV A;  3PV0 A;  3FKI H;  3I4N G;  2PI2 E;  1VQB A;  3KF8 B;  3LGJ A;  5IP9 H;  4DV5 L;  2HQL A;  3T1H Q;  4YCW A;  3A5U A;  5FLX c;  1YIT A;  2PNH A;  4PMW A;  4LFC Q;  4GNX B;  2IX0 A;  2LXJ A;  4JI8 Q;  4A3E G;  2LXK A;  3UDX A;  3S16 H;  4DV4 Q;  1GKH A;  1J6Q A;  3RLO A;  1GM5 A;  1QZG A;  1WOC A;  2DUD A;  1N33 L;  4TVA B;  4LUZ A;  4LNQ A;  4LFA L;  5IYB H;  1NY4 A;  1DGS A;  1I6H H;  3H0G H;  1KIX A;  4AYB E;  3GTG H;  1R9T H;  4DKA C;  3SGI A;  3CPF A;  4QIW E;  3BZC A;  5M5W H;  3HKZ G;  3K0X A;  4L5Q A;  4DR7 L;  1HJP A;  1OTC A;  2VL6 A;  1S40 A;  1PH4 A;  4JI7 L;  5C44 H;  5GAD C;  4A3J H;  3K7U C;  2B63 G;  3S1Q H;  4IFD J;  3AFP A;  3H3V I;  1Q7Y C;  5C4X G;  1LTL A;  4A3C H;  4JC0 A;  2R6G A;  4O2D A;  2PQA A;  4A3L G;  2R92 G;  1A8V A;  3HOX G;  2UU9 L;  3M9B A;  3KDF B;  2ZJR A;  1Y1W G;  1M1K C;  2BH2 A;  1VQF A;  1GO3 E;  3KF6 A;  4A4I A;  2AWO A;  3CQZ H;  4LF8 L;  4IPH A;  4LF7 Q;  4YWL A;  4QL5 A;  3J80 i;  4IPC A;  4R4Q A;  4JI6 Q;  4NPS A;  1EUJ A;  1CKO A;  3B6Y A;  2VZA A;  4X62 Q;  3GTQ H;  2IY5 B;  3PCO B;  4LFC L;  2IHF A;  3RLN A;  3S1R H;  5ELN A;  2KHJ A;  3GTK H;  4ALP A;  1YBY A;  4JI8 L;  4DV1 Q;  1Q82 C;  4IO9 A;  4PZ8 A;  4DV4 L;  1FL0 A;  5M5X H;  2KCM A;  3HOV G;  4HJ8 A;  4X6A H;  4A3I H;  4MTN A;  4K0K Q;  1EWI A;  1X56 A;  3FHW A;  1KAW A;  1I94 Q;  4P71 A;  2BA0 A;  4AYB G;  1KHI A;  4QJF A;  2MNA A;  2Z6K C;  4DR2 Q;  2JEA I;  1OXU A;  1KQS A;  2NVQ H;  4LUO A;  1D7Q A;  1TWH H;  3HOU G;  3GD7 A;  4BY7 G;  2NZH A;  4GLA C;  3K8A A;  2JJQ A;  2R7F A;  3PSI A;  5IYC G;  3U58 A;  5JJK A;  4JCV E;  2IX1 A;  4DV6 Q;  1FJG Q;  5FJ8 G;  4GKK Q;  2Y0S E;  4JI5 Q;  1L1O B;  3ULL A;  4KHZ A;  3RZO H;  3BZK A;  2QGQ A;  3W1G A;  5GAG C;  2VQE Q;  4NXN L;  3GTJ H;  1PH8 A;  1PYB A;  3HFZ B;  4JOI A;  5C0X I;  1HR0 Q;  3PO2 H;  4GKJ L;  1MJC A;  1VQK A;  3KOJ A;  4QQB X;  3I4M G;  5C3E G;  1LUZ A;  3GO5 A;  2C35 B;  4R1J A;  5LMU Q;  3S2H H;  4DR5 Q;  4GLX A;  4JV5 Q;  4BBR H;  4Y7N H;  1SMX A;  4DR6 L;  1CSP A;  4R4I A;  3CCJ A;  1S72 A;  2VY3 A;  1B70 B;  4YY3 Q;  4DUZ L;  1XJV A;  3KJP A;  4IPD A;  4DV1 L;  2YTY A;  3MEF A;  1JE5 A;  4AQY Q;  3CCS A;  1B7Y B;  2E2H H;  1CSQ A;  1HR0 W;  4B3R L;  1MKH A;  1M90 C;  4JI1 L;  4DV2 Q;  4GLV B;  2F52 A;  2PQA B;  3E9H A;  1L2F A;  1SRU A;  1IXR A;  4H02 A;  2GVB A;  4YCU A;  4DR2 L;  1PH5 A;  4X65 Q;  4DR4 L;  5M3F G;  3KF6 B;  2NVT H;  4HIM A;  3M3Y H;  5IYB G;  2OQ0 A;  3PIP A;  1K8A C;  2DGY A;  4JI3 L;  4DV6 L;  2HHH L;  1HZC A;  5LMN L;  3RZD H;  1YJ9 A;  3RNU A;  5FLM H;  1K83 H;  1VQI A;  3UDF A;  4B3S Q;  4JI4 Q;  1E22 A;  1TXY A;  4UY8 C;  2E8G A;  2KCT A;  1CUK A;  1X3F A;  4YHH L;  3S2D H;  1JJG A;  2ZJQ A;  4OXP A;  4GS3 A;  5C0X G;  3CPW A;  4A3J G;  1J5E Q;  1VQN A;  4LFB Q;  1KRS A;  1HR0 L;  5ELO A;  3CW2 C;  3ERS X;  4P75 A;  3I2Z A;  3NEM A;  1WFQ A;  1MJE A;  5LMU L;  4P74 A;  4LF4 L;  3HOZ H;  2B29 A;  4A3D G;  1CKM A;  2UXB Q;  2CKZ B;  2GVA A;  1PH6 A;  4NXM Q;  5IYD H;  4A93 H;  1Z9F A;  1A62 A;  1XNQ L;  3ZJY C;  1NMF A;  1VQ8 A;  1YJN A;  2Z6K A;  1YHB A;  4X66 L;  2ID0 A;  2EQS A;  4JOI C;  3U4V A;  4AH6 A;  1LM0 A;  1U0L A;  4B3T Q;  2UXC Q;  1H95 A;  4DV2 L;  2IHE A;  1Q86 C;  2R7Z H;  1EQR A;  4GN5 A;  4EQ5 A;  2E2I H;  1YJW A;  3OTO L;  2Q2U A;  3PUX A;  2K50 A;  3W1B A;  4A3I G;  2BH8 A;  1I3Q H;  1K3R A;  2K5N A;  4L5R C;  1VQ4 A;  4BBS G;  3RN5 A;  4BXX H;  2WB1 G;  4IPG A;  3NBH B;  4JG2 A;  1IBL Q;  4DAM A;  1IL2 A;  4B3S L;  3CP0 A;  2R7D A;  3HKS A;  1RL2 A;  1HZ9 A;  3U50 C;  4A3M H;  4DAY B;  2AKW B;  3M4O H;  1LYL A;  2D0P A;  3PUW A;  1WCM H;  1J5E L;  4DK6 C;  5M3M G;  4LFB L;  1HNW Q;  1D8L A;  3CCR A;  1IBK Q;  1PH7 A;  2Q2I A;  1OXT A;  1QVF A;  2N49 A;  1JJ2 A;  2IT1 A;  3KLW A;  1N32 Q;  3EIV A;  2KBN A;  3RR5 A;  3CAM A;  1A63 A;  3NEN A;  1N8R C;  4DUY Q;  3F8T A;  4NXM L;  1QUQ A;  3CC7 A;  3J81 c;  4LF9 L;  2I0Q A;  3PO2 G;  2KEN A;  4PZ7 A;  2UXD Q;  3G48 A;  2NVX H;  4YWM A;  3A0J A;  4XTC S;  4C3J H;  2OTL A;  1PV4 A;  3G6E A;  3CCU A;  2YYZ A;  2AMC B;  1NTG A;  2CWP A;  1KC8 C;  1Q81 C;  4BBR G;  1TWC H;  4OX9 Q;  2CQO A;  3TS0 A;  1E1T A;  4LWC A;  3T1H L;  1YEZ A;  5JJI A;  4JBJ A;  2UXC L;  3STB C;  4HJ9 A;  1OXV A;  1FGU A;  4DV0 Q;  1I5F A;  3IRB A;  1YZ6 A;  2ZJP A;  3TS2 A;  5C0X J;  2UUB Q;  1VQM A;  2K5H A;  3MXN B;  1E7Z A;  2E5L Q;  3T1Y Q;  2MQH A;  1WYD A;  4JBW A;  2XTI A;  2WP8 J;  5JJL A;  2ES2 A;  4A3G H;  1VQL A;  1Y1V H;  3J7A 5;  2JA7 H;  3ULP A;  3F2C A;  4OO1 I;  1A0I A;  1Q1B A;  3I56 A;  2NN6 I;  3RLF A;  3CF5 A;  1VQ7 A;  1IBM Q;  1YHQ A;  2K75 A;  1X3E A;  4A3F H;  1IBL L;  1K9M C;  2VUM G;  4JYA Q;  5JEA G;  4DPG A;  1HNX Q;  3UE0 A;  1MIU A;  3PUY A;  5J3B A;  4X64 Q;  1BVS A;  1HNZ Q;  1EFW A;  3HOY H;  3I4N H;  1B8A A;  1HNW L;  3Q8D A;  5FLM G;  2VS1 A;  1BBW A;  1P16 A;  1VQ6 A;  4LUV A;  3K7A H;  4A3E H;  4IOA A;  2JA9 A;  3TRZ A;  4OON A;  2HIV A;  3I55 A;  4GOP C;  2E2J H;  2F4V Q;  3CCE A;  1VQP A;  1FVI A;  4DK3 C;  1V43 A;  2ATW A;  1VQC A;  4LF7 L;  3EBE A;  1VCI A;  3E9I A;  1VQH A;  1VQ9 A;  2A19 A;  1PH3 A;  4JI6 L;  3GTP H;  2ASB A;  4BA2 I;  3GTM H;  5IYD G;  4HJ7 A;  4X62 L;  1SLJ A;  3M4P A;  4TQU S;  3J81 j;  4B3M Q;  4DV0 L;  4UP7 A;  2GN5 A;  2QEX A;  2R93 H;  3FKI G;  2E5L L;  3AQQ A;  3CD6 A;  4APV A;  5IP9 G;  4FDB A;  1AH9 A;  3PO3 G;  2UUA Q;  4GNX A;  4K0K L;  1I94 L;  3JAM i;  2NVY H;  1C9O A;  4P72 A;  3J80 c;  2R92 H;  4A3B H;  2R7Z G;  1KRT A;  1Q46 A;  4QGU A;  3PF4 A;  5M5Y H;  3TEH B;  1IBM L;  3HOW H;  4PG3 A;  3S17 H;  2JA5 H;  1QUQ B;  2JA8 H;  3DLL A;  2RHS B;  5HGQ A;  2OWO A;  4JYA L;  3UDI A;  3ULJ A;  5BR8 Q;  1HNX L;  4L5T A;  5IE8 A;  4X64 L;  2UXB L;  3H0G G;  2NZO A;  2VQF Q;  4BY1 H;  4BXX G;  1FJG L;  2WB1 E;  4RMF A;  1SFO H;  4HIK A;  4GKK L;  4JI5 L;  1KXL A;  3G4S A;  1WJJ A;  4RG1 A;  2VQE L;  1PVO A;  2ALY B;  5C44 G;  4HJA A;  4A3M G;  2A1A A;  1XMO Q;  1JB7 A;  1E1O A;  2F4V L;  2V1C C;  2N3S A;  1KL9 A;  3UE1 A;  1ASY A;  1V1Q A;  2K5V A;  2I5M X;  2EIF A;  2H5X A;  3M7N A;  3JC6 6;  1C7Y A;  4A3C G;  1PFS A;  3KDF A;  4QY7 A;  4KHP Q;  4DR5 L;  3ER0 A;  4HIO A;  2JA6 H;  4JBK A;  4JV5 L;  4WJ4 A;  1X6O A;  4BY7 H;  2JEB I;  3D31 A;  5JEA J;  5IYC H;  5IWA Q;  3S24 A;  3ICE A;  1X9N A;  3NEL A;  4YY3 L;  5C4J H;  3F1Z A;  4LF5 Q;  3VDY A;  1YI2 A;  1XMQ Q;  1EYG A;  2JK8 A;  2WFW A;  2PI2 A;  3W5O A;  4AQY L;  2UUA L;  1NMG A;  3PUV A;  4GN3 B;  1QVC A;  1XPO A;  4NB3 A;  1Q8K A;  3AEV A;  4OO1 G;  1YHA A;  5IT9 c;  1JMC A;  1UE5 A;  4MZ9 A;  2ZTE A;  3A74 A;  2JQO A;  2MFI A;  2AWN A;  1YIJ A;  4X65 L;  1UWV A;  1VQO A;  1X3G A;  3CME A;  5C3E H;  1VS0 A;  1Y1V G;  3U4Z A;  5BR8 L;  2JA7 G;  2VW9 A;  1VQ5 A;  1HZA A;  1XPR A;  1Q12 A;  4GOP A;  1XNR Q;  2JE6 I;  2ZTC A;  4R4C A;  3PIO A;  2UUC Q;  1K73 C;  4A3F G;  1EQQ A;  4A75 A;  1CKN A;  5EAY A;  5HY6 A;  3BU2 A;  4BA1 I;  4HID A;  3K81 C;  4GNX C;  4JI4 L;  3HOY G;  4DR1 Q;  4A3K H;  1XMO L;  3H15 A;  1U5K A;  1L1O A;  3L2P A;  1C0A A;  1K0R A;  4KHP L;  1O7I A;  3E0E A;  5M3F H;  1UE1 A;  5IWA L;  5DLQ E;  1JT8 A;  3GDE A;  1W2B A;  1W3S A;  2WAQ E;  1N36 Q;  4LF5 L;  4DNI A;  2BA1 A;  3J7Z C;  1XMQ L;  4R4O A;  1X54 A;  2D62 A;  3PGZ A;  1UEB A;  2YV5 A;  1G51 A;  1S3O A;  3M4Q A;  1L0W A;  3OW2 A;  1E3P A;  4B3T L;  4LF6 Q;  1I50 H;  2AHO B;  2R93 G;  3CC2 A;  1IZ6 A;  2L15 A;  2LSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...