4BY7H

Elongating rna polymerase ii-bye1 tld complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4by7H00
3K0XA 5ELOA 1GM5A 1VQ9A 1QUQB 1A8VA 4JV5L 1VQMA 4A3BG 4L5TA 4B3TQ 4B3SQ 1MIUA 2NZOA 2OCEA 1JJCB 3KJOA 1N33Q 2KHIA 2HQLA 3K8AA 1K83H 4GOPA 4IPDA 3I4NH 5JEAJ 1S3OA 3PUYA 2ES2A 4GKKQ 4DV5Q 4B3RL 5BR8Q 1I5FA 3GTMH 4POFA 4DV4L 1AH9A 5IP9H 4JI8L 4DR1Q 4K0KL 2HHHQ 3E9HA 4QGUA 1CSQA 4KHPQ 1VQFA 4LF5Q 1YZ6A 4IFDI 3ULLA 3M3YH 1UWVA 3BZKA 1L0WA 5IP7H 5FLXc 2ZJPA 3CCVA 1Q7YC 1LUZA 1HR0L 1NTGA 4ALPA 3W1GA 1WI5A 3H0GH 4YHHL 1UE7A 1YBYA 4NB3A 1Q12A 3STBC 4JI6L 1PH1A 2UXCQ 3ZJYC 2VY3A 4JI5Q 3PF5A 5EAYA 4X65L 4BY7G 3ICEA 2PNHA 2Y0SG 4HIMA 2B63G 1M90C 1B7YB 4IFDG 5IYCH 3HOUG 4QJFA 4DK6C 3I2ZA 1Y1WG 1PH6A 1Q86C 5IYBH 4A3IG 1UEBA 1X3GA 2JA7G 1XPUA 1K3RA 4DNIA 4OX9Q 5LMUQ 2UUAL 1N33L 3A0JA 4A76A 1EFWA 3NBHB 1I3QH 3NEMA 3PF4A 3HOZH 4GLVB 1PH9A 1VQDA 2NZHA 4YCUA 4LFCL 1X65A 3LGJA 4B3MQ 1NMGA 1TXYA 1KXLA 4JI2Q 2ZJRA 1YJNA 2CWAA 4B3RQ 4AIMA 2ATWA 2F3IA 1FVIA 5IYBG 1Z47A 2VQFL 4IOCA 4A3IH 3M9BA 2UUBQ 1E22A 4X64L 1SMXA 1EYGA 3F2CA 4LWCA 4O2DA 3K7UC 4GKJL 4JYAL 1X54A 2I5MX 2WAQE 3WWVA 5IT9c 1B70B 4H02A 2PMZE 2RCNA 5M3MG 1OXXK 3PGZA 2MNAA 3CCJA 4R4CA 2IHEA 1C7YA 2HHHL 4A3GH 1PVOA 2K14A 3U50C 2UXBQ 1WJJA 1CKNA 4JBKA 1FJGQ 2DUDA 4GLAC 5C0XI 1GD7A 1S40A 1CUKA 2NVQH 3HFZB 4YWKA 1Q8KA 3CW2C 4TQUS 3F2DA 1HZAA 4DPGA 4A3CH 5JJLA 1VS0A 4B3SL 1XNRL 1VQIA 3VDYA 2YTXA 1VQ8A 3J80i 5C3EG 1K9MC 1VQNA 3I7FA 1SE8A 2KCTA 1C0AA 3MXNB 3I4NG 4IPHA 2I5HA 3GTJH 4LF6L 3M4OH 4BXXH 2HIXA 3G6EA 1PH8A 4P74A 2E2JH 3PIOA 2QGQA 1U5KA 5IP7G 3HOVH 1XNRQ 3CD6A 3M7NA 4A3LG 4DV7Q 3A5ZB 5M3FG 2BH8A 3F2BA 2JA5G 4A3KH 3F1ZA 4LW1A 4C3JH 1KC8C 1G6PA 2ZM6Q 1Z9FA 2KBNA 5HY6A 1V43A 2E2HH 3TEHB 1PFSA 3OYYA 3PO2H 1N34Q 3BZCA 1JMCA 1K8AC 1VQ7A 3M4QA 3AFPA 3HOXG 3CCQA 4DUZQ 2VUMH 4DAYB 1E3PA 3K7AH 4A93G 4DUYQ 2Q2IA 2VL6A 4DV2Q 1VQBA 2B63H 2RHSB 1PH5A 5C44H 1OXSC 1IBKQ 4JI6Q 3FKIG 2JA8H 3HOXH 4IFDJ 2RHQB 2JA9A 4DR7Q 4OX9L 4QY7A 2YYZA 4X6AH 1XNQL 3CMEA 1PH4A 3TS2A 2YTVA 4AH6A 4DR2L 4JI7Q 2IX0A 1EOVA 2BA1A 3CP0A 4MZ9A 5E7NA 3GTKH 4A3GG 1NMFA 4KHPL 4QL5A 4JI2L 1PH2A 1A63A 1XMOQ 2LSSA 3CMAA 2EIFA 4LFCQ 1X56A 4K0KQ 4HJ5A 1XPRA 4DKAC 4BBSH 1YITA 4JBMA 1HNZL 4HIOA 1VQ4A 4A3FG 2A1AA 1QVGA 4JI4Q 2BH2A 5LMNQ 1IBLQ 4JI7L 5FLMG 3KYHC 4A93H 3RR5A 3HOWG 2D62A 1BBWA 1N8RC 3M85A 5GAHC 4BY7H 4BXXG 3TREA 4BA1I 1NY4A 4GKJQ 3UE0A 2UXDQ 3BU2A 3JAMi 4A3EG 4X64Q 3TRZA 3GTLH 1IBKL 2E2IH 4LNQA 1X6OA 3CF5A 2L15A 1E24A 1IBLL 2JQOA 3RLNA 1SN8A 3A5UA 4R4OA 3CCUA 3I4MH 3J80c 4P73A 4A3BH 1Q82C 5GAEC 2K5NA 4XIGS 4JC0A 3S2DH 4PMWA 4OO1G 1PHJA 1AE3A 1N36Q 1YEZA 1N9WA 2Z6KA 3HOYG 1Y14B 4DV5L 3S16H 1O7IA 4GKKL 2ZM6L 4LF9L 4UP8A 1GKHA 4R1JA 1TWHH 1N32Q 2GVAA 2UU9L 1RL2A 5LMNW 4TVAB 4DAMA 3T1YQ 5C4XG 4LF5L 4DUYL 1P8LA 4L5SA 4OWXB 4DUZL 1VCIA 1VQCA 4BY1G 2JJQA 3NENA 4A3DG 2NN6G 5M5XH 1Y1VG 4P71A 5M5YH 2UXCL 1HNXQ 2R92G 4UP7A 1Q1BA 4A4IA 4MNOA 2K5HA 4A3MH 4JOIC 4YWLA 5J3BA 3S2HH 3CQZH 2ZTDA 1K0RA 4DV7L 4LF7L 1TWAH 3CCMA 4PZ8A 3RLOA 4DK3C 4R4TA 3CC2A 3J81i 3KLWA 1N34L 2JK8A 2AKWB 2CQOA 3FKIH 3K81C 3S14H 3OTOL 2OTLA 5FLMH 1KD1C 1X55A 4DV6Q 3U58A 1QZHA 2JE6I 4A3JG 4JI0Q 4DR6Q 2ZTEA 3CXCA 1OXVA 2UU9Q 1YI2A 4GS3A 1YHBA 5JEAG 2WFWA 5IYDH 3CCSA 3I56A 3D31A 4LUOA 4YCVA 3HOZG 4XTCS 1PH3A 2VNUD 1LTLA 1EWIA 2D0OA 2HIVA 3GO5A 1EQRA 1IYJB 4GNXC 1JJ2A 2C35B 2R7ZG 2HT1A 3Q8DA 4ME3A 5AJ3Q 1UE5A 5IWAL 2XGTA 3S24A 3EN2A 4KHZA 1XTDA 3HOUH 1GO3E 3S17H 2Q2HA 1PYSB 2QA4A 5H1SE 3T1YL 2UXDL 5DLQE 4JI1Q 2BA0A 3DM3A 4JCVE 1YJWA 1J5EL 2UUCL 5C4XH 3KF8B 1VQPA 1SFOH 4DR4Q 4LFBQ 1IXRA 3PUWA 4P72A 4IOAA 4DR3Q 1XJVA 2F4VQ 1Q1EA 1FJGL 1HNZQ 3ULJA 4C3HH 3HOWH 1HJPA 4J15A 4YY3Q 4GOPC 1VQLA 3RZOH 2VQEL 1SROA 1VQJA 1WYDA 3STBD 3EBEA 5C4JH 2B29A 4AQYQ 4HIDA 1XMQL 1T9HA 2B3GA 3G4SA 3T1HL 1XNQQ 2K4KA 5LMUL 2UUAQ 4APVA 1I94L 3HOYH 1CKOA 3PIPA 1AE2A 4YHHQ 4JYAQ 1A62A 3U4VA 3HKZG 1HR0Q 1JE5A 1I6HH 3L7ZC 2WAQG 1L1OA 4QIWE 4YWMA 1A0IA 2GN5A 2I5LX 4C2MH 1HZBA 5IYDG 1N36L 2N8NA 4LFAQ 1PYBA 4X65Q 4JI5L 1KAWA 2DGYA 3KOJA 2CFMA 5K36G 3CCEA 2A19A 4EQ5A 2VUMG 4JBJA 3RNUA 4OWWB 4GNXA 1E7ZA 2KCMA 4IJHA 1TWGH 4L5QA 4B3ML 3KF6A 1X3EA 1WCMG 4HJ8A 3T1HQ 4UP9A 4Y7NH 1NJIC 3S15H 3CC4A 2NVYH 2H5XA 3KDFB 1LYLA 2WP8J 2XTIA 3W5OA 3UDGA 4A3MG 3I4MG 4WJ4A 1QVCA 2MO0A 1VQHA 3H3VI 1UE6A 2VW9A 5C44G 4JI3Q 1SR3A 2F4VL 4DR5L 1IBML 2ASBA 2JEAI 1CSPA 1VQ5A 4NXMQ 2EQSA 1P16A 1WFQA 3F8TA 2JA8G 4JI1L 1SLJA 3J81j 1HNWQ 1KHIA 4P75A 1J5EQ 2N3SA 2N49A 3CAMA 3H15A 4A3FH 4HJAA 1W2BA 1MJEA 4DR6L 3PV0A 1NE3A 4LUZA 4NXNL 3GTPH 4DV1L 3G71A 3J7A5 5IE8A 1XMQQ 4BBRG 2NN6I 4HJ9A 2Y0SE 5C0XJ 3PO2G 2JA5H 4JV5Q 5M3FH 1CKMA 1RIPA 1D8LA 1EQQA 2R93H 5BR8L 2Z0SA 1L1OC 2R92H 2JA7H 3L0OA 4BA2I 1HZ9A 4IPCA 2PQAA 2ZJQA 3E0EA 1BVSA 2K75A 4NXNQ 1YHQA 1W3SA 3PSIA 4WJ3M 4RMFA 1YVCA 1B8AA 4PZ7A 3UE1A 2WB1E 4AYBE 5C3EH 3OTOQ 2MQHA 1X3FA 3KJPA 3FP9A 2R6GA 3NELA 4EX5A 1KRSA 4GNXB 2JA6H 4LF4Q 2VQFQ 5GQOA 3CPWA 4A3CG 3GDEA 2F52A 4PZ6A 2KENA 4JI3L 1FL0A 4Y52H 4A3KG 1IL2A 3U4ZA 4BBSG 3UDIA 3S1QH 2QEXA 4QQBX 1YHAA 4UY8C 1IZ6A 3ER0A 4JI0L 4NPSA 2A8VA 5M3MH 2NVTH 1BBUA 5IP9G 1FGUA 5FJ8H 1HNWL 2ZTCA 1Q81C 2I0QA 3RN5A 4GN4B 4HIKA 3CPFA 4NXML 3IRBA 2CCZA 1OTCA 4DR5Q 1IBMQ 2JA6G 2K5VA 1D7QA 3A74A 3ULPA 1VQGA 1U0LA 4DV3Q 1L1OB 4LF4L 4YCWA 5M5WH 3H3VH 4LF7Q 4OO1I 4DV1Q 5ELNA 3RN2A 2ID0A 3S1RH 1L2FA 1X9NA 2RF4A 4OXPA 3OW2A 1N32L 1E1TA 1G51A 1V1QA 3L2PA 4DV0L 5GADC 2PQAB 1XPOA 2CKZB 3HKZE 2Q2TA 1K73C 2UUBL 3AQQA 3H0GG 1VQOA 4LF9Q 3KFUA 1QUQA 2LXKA 4X66Q 4AQYL 3HKSA 3S1NH 3KF6B 4KI0A 3PUXA 3HOVG 4A3JH 4A3LH 3PCOB 4PG3A 4GLXA 4LF8Q 2D0PA 4OWTB 3KDFA 2Q2UA 4GOPB 5IYCG 1OXUA 2E5LL 1Y1VH 1KIXA 4A3DH 5C0XG 3TS0A 5GROA 1HH2P 1TWFH 4BY1H 1VQEA 4R4IA 2OQKA 3EIVA 2AMCB 1I94Q 2IHFA 1YIJA 2PI2E 4JI4L 1C9OA 1WOCA 2KHJA 3AYHB 1YJ9A 2OWOA 2LXJA 5FJ8G 3MEFA 3PUZA 5JJKA 5AJ3L 4LF8L 2PI2A 2R7FA 3JC66 5IY0A 1VQ6A 4LFAL 1WCMH 2CWPA 1XMOL 1KL9A 5JJIA 5GAGC 4GN5A 2ALYB 4MTNA 3UDXA 4O0AA 2E8GA 4GN3B 3DLLA 1OXTA 4DR2Q 1VQAA 2R93G 4DR4L 1KRTA 1EIYB 2UUCQ 2AHOB 4LFBL 1SRUA 1NBWA 4KLKA 2YU9H 3GTGH 4DR7L 1Y1WH 3AEVA 2VS1A 4OONA 3TQYA 5LMNL 2E5LQ 3B6YA 3BJUA 4DV6L 3J7ZC 2MO1A 4JBWA 1ASZA 4B3TL 4DV3L 4L5RC 3CCLA 2VQEQ 4JG2A 2OTJA 4A3EH 2MFIA 4UPAA 2YTYA 1M1KC 2JEBI 4POGA 1QVFA 2YV5A 3E9IA 3J81c 4DV4Q 4IPGA 2GVBA 3RLFA 1DGSA 4X66L 1HZCA 1QZGA 4JOIA 1HR0W 1BKBA 1EUJA 4X62L 3JAMc 1PH7A 4DV0Q 3UDFA 3GTQH 1KQSA 1EIFA 1R9TH 1H95A 4FDBA 4IO9A 3K80C 4BBRH 2K52A 4DV2L 1PV4A 3PO3H 2VZAA 4IJLA 4LF6Q 2IT1A 4JI8Q 3CCRA 1GVPA 1YNXA 4YY3L 4DR1L 2AWOA 3I55A 1ASYA 3G48A 4DR3L 1PA6A 3PUVA 1JJGA 1JT8A 1Q46A 4RG1A 2K50A 1K8GA 1VQKA 2EXDA 3SGIA 3W1BA 1E1OA 1G291 1TWCH 2N78A 3D0FA 3GTOH 4A75A 1CKNB 2Z6KC 3AFQA 3M4PA 4R4QA 3CC7A 3ERSX 2R7ZH 2WB1G 4AYBG 4X62Q 2AWNA 5IWAQ 1J6QA 1S72A 2IX1A 3PO3G 2OQ0A 1LM0A 1HNXL 3FHWA 5HGQA 1JB7A 4LUVA 1I50H 2R7DA 1MKHA 1UE1A 3I4OA 4HJ7A 2IY5B 1MJCA 1V9PA 2FXQA 2V1CC 2NVXH 2UXBL 3RZDH 3S1MH 3GD7A 4C3IH
chains in the Genus database with same CATH superfamily
1A15A 5FKAC 1VQ9A 3SK5A 1DYQA 1MSHA 4JV5L 1VQMA 4L5TA 4OIJA 1PZKD 4X3SA 1CFMA 2NZOA 2OCEA 1O7YA 3ERQA 3KJOA 1N33Q 2MP1A 3NWTA 5BR8Q 3FKIB 4IUTA 4DV4L 4K8JA 2HHHQ 1G8ZD 3QOJA 1EZ6A 4LF5Q 1YZ6A 4IFDI 3ULLA 1CA6A 1Q7YC 5L37A 1LUZA 1NTGA 1SE4A 3W1GA 1YBYA 4CJ2C 2E2IB 1TS2A 1WTVA 4X65L 2JP1A 2K05A 2PNHA 1M90C 3HOUG 4QJFA 5F2DA 5IYBH 1K3RA 1JWUD 2DJFC 2DJGC 2QEJC 3FMCA 3NEMA 1VQDA 2NZHA 2HDMA 5JEAH 1KXLA 1X65A 3LGJA 1NMGA 1O80A 1WCMB 1I6VC 2F3IA 5M5YB 2UUBQ 2QKIC 4LWCA 1JICA 3K7UC 3GTGB 4JYAL 1TY0A 1RCVD 2WAQE 4DGZA 5IT9c 5C3XA 1B70B 2PMZE 3NHHA 2K01A 3GV6A 4K6DA 5M3MG 5E4WC 5M3MB 1TS3A 3CCJA 2O5IC 4A3GH 5FK9C 2HHHL 2NVTB 3VYSA 2DUDA 2LKVA 2E2DC 1S40A 2NVQH 3CW2C 3F2DA 1STHA 5IGBA 2YTXA 3J80i 5C3EG 2A6ED 2KCTA 1C0AA 3MXNB 3PO3B 4RGNA 5FOBB 3M4OH 2HIXA 3PIOA 5IP7G 1U5KA 1EZ8A 3HOVH 1XNRQ 5J39A 3KLRA 3M7NA 4DV7Q 2LFNA 2JA5G 2MGSA 4HTHA 3NTIA 1PRTB 1G6PA 4R8IA 3I72A 5C4XB 1Z9FA 2KBNA 1YNND 2PW7A 2X69A 1QNUA 2F0GA 1JMCA 1CTMA 3N6RA 3HOXG 3I70A 3W3AA 4DAYB 4CDDC 1JOOA 4DUYQ 1VQBA 2RHSB 5EBCA 3SDZA 5IIFA 3HOXH 3MXPA 1CHQD 1W6JA 5D3DA 5EPJA 1JR0D 4DR7Q 4QY7A 1XNQL 1PH4A 2NTSA 2YTVA 1EY9A 4AH6A 4JI7Q 4FXDA 3GTKH 1BCPC 1O78A 1PH2A 3NBHA 4DKAC 4FYDA 3MXNA 1HNZL 1QVGA 1VQ4A 2A1AA 2F0MA 1LTGD 5FLMG 1VMCA 3KYHC 1ENCA 2D62A 1FR3A 2KEDA 2XWJB 3M85A 2AUKA 4BA1I 1NY4A 3U9OA 3BU2A 4A3EG 3TRZA 4LNQA 3CF5A 4ZUIA 2H1EA 5T1IA 3I4MH 3A5UA 3CCUA 4P73A 1TS5A 2TMPA 1NAPA 5T1GA 1U4LA 3G7LA 5GAEC 2K5NA 4JC0A 4PMWA 2B2YA 1N9WA 4U68A 2EPBA 4DV5L 1MGSA 2BCOA 4GKKL 4RGTA 5FLXL 1GKHA 2KCNA 4P2CB 1I4PA 5EPLA 3T1YQ 3NTKA 4CGYB 2OEOA 5CC4A 2EYJA 2DN8A 1P8LA 4FP5D 5CR3A 5KNCA 1VQCA 3R3OA 1XX8A 4IUVA 5M9OA 1BDOA 1EY8A 1S4ZA 5E4XA 1Q1BA 3Q22A 1VMPA 4A3MH 1D1IA 5FLXE 1B9MA 1HXYD 4R4TA 3CC2A 1N34L 1GUOA 2CQOA 2IW3A 1QWYA 2OTLA 3BVMA 4DV6Q 1XXGA 2L9HA 3QIAA 1YI2A 4JK1C 1YHBA 3KK7A 5JEAG 2WFWA 2F0SA 3BYYB 3HOZG 3OIQA 2F0DA 3L3OC 4N8FA 3J80E 2VNUD 4K5WA 3TP7A 1EQRA 2I46A 3NTHA 4GNXC 1GUNA 4J8QA 1JJ2A 2C35B 3H94A 2F0KA 4ME3A 1PXUA 3T53B 4V0BA 1DOKA 2X6GA 1GHJA 3HOUH 2Q2HA 3VA5A 4JI1Q 2BA0A 4EQPA 5AFWA 4TKOB 1VQPA 4LFBQ 2EJFC 2NZ1D 4P72A 1HRJA 1NCVA 1Q3LA 2C9OA 1GUWA 1HNZQ 3QO2A 4UAIA 3S1NB 1PTOH 2VQEL 4IN3A 1WYDA 1SEBD 1SXTA 2NYZD 4HIDA 1A2TA 1X3QA 3T1HL 1PTOC 1XNQQ 2K4KA 1I94L 1PZID 4KJOA 1A62A 1A2UA 2XSCA 2F0IA 2WAQG 2QILA 2GN5A 5IYDG 4LFAQ 1PYBA 3BDLA 1AW7A 3KOJA 1HPCA 4EQ5A 2RBMA 1DXMA 4JBJA 3TBIB 1E7ZA 2HUGA 3DUZA 4MTKA 2NVQB 4L5QA 4YIJA 3GTMB 1X3EA 1Y1WB 3GTLB 3J7YW 4UP9A 4ZK9B 1NJIC 2WKCA 1LYLA 2XTIA 1TR5A 1XYIA 4A3BB 3H3VI 1VQHA 3SK6A 4E6IA 4J6HA 2XNAC 1EYAA 4Q0FA 3F8TA 1P16A 1WFQA 3NBIA 3A55A 1PDQA 4XDXA 4NXNL 3HOVB 4N9TA 4R9WA 3T51B 4DV1L 3M4YA 1V1OA 1ILQA 1EQQA 1B9NA 4FF1A 3MXUA 2R92H 5E3FA 4IPCA 1BVSA 2K75A 2F0WA 5EJWA 5CYUA 4Q5VA 4AYBE 3KJPA 3KFUA 3FP9A 3NELA 1KRSA 5GQOA 1G91A 1CQFA 3MFGA 5IODA 1RDPD 2KENA 3I8ZA 1FL0A 4JI3L 4Y52H 5DNFA 3FVQA 3GTKB 3LWUA 3A7AB 4NW2A 3UDIA 2QEXA 3ER0A 4NPSA 1F9RA 1HNWL 4CKBA 1ENAA 5EKKA 3RN5A 2I0QA 2Z9HA 4NXML 2CCZA 4DR5Q 2K5VA 3K59A 3A74A 1VQGA 1U0LA 4DV3Q 4LF4L 5M5WH 4CJ1B 1I4HA 4LF7Q 4DV1Q 3RN2A 3VR6A 3S2DB 2RF4A 1HHVA 3SHLA 1E1TA 4PNYA 4EGVA 4C3HB 3HOWB 1GUGA 1SDFA 2JYOA 1ICFB 3PUXA 2EYPA 2D0PA 2E5LL 5C0XG 2O4XA 1HH2P 4BY1H 3A56A 2IHFA 1L0XB 1YNNC 1C9OA 2VUMB 2VB2X 4LFAL 1WCMH 4ABNA 5JJIA 4GN5A 1PRTD 1D5MC 1OXTA 3VA7A 1QNKA 1HFGA 3GTGH 5LL6S 4DR7L 2E5LQ 3PQIA 4AYBB 1HQRD 2MO1A 1ASZA 4CKEA 1ONLA 2EZVA 4BBSB 3CCLA 2VQEQ 2OTJA 4A3EH 2JEBI 4BS9A 2YV5A 3E9IA 3J81c 1GOZA 3V05A 1HA5A 4ZUJA 4X62L 1AP0A 3UDFA 1KQSA 2EYFA 1KNEA 1H9MA 3C1EA 4HSVA 1MSGA 1STAA 4MHEA 2Z1CA 4C3HG 1QB5D 2IJ0A 4L6TB 4IJLA 2SNMA 4DR1L 1ICWA 1YNXA 2AWOA 3I55A 1ASYA 2E2JB 3PUVA 3D8GA 1JT8A 1Q46A 2PCFB 2C5CA 4LAAA 2N78A 3D0FA 2WB1G 5IWAQ 2WV6D 3PO3G 3BVZA 5A35A 1JB7A 4LUVA 3I4OA 4HJ7A 4C1NK 2FXQA 2UXBL 2EXZA 3K0XA 1QUQB 3S2HB 4B3TQ 4XT3B 2QF7A 3DXJC 3MFYA 3DWPA 3K8AA 1K83H 4GOPA 1S5ED 2RDHA 1EU3A 5IP9H 4Y7NB 1CSQA 4KHPQ 3W2DA 5C5LA 5J22A 2SNSA 4QB4A 1L0WA 2B2UA 4KKSA 4J1MA 4PV1C 1HR0L 4ALPA 1WI5A 2NN6H 1UE7A 1WD1A 5I9PA 3FDTA 2RSOA 4V190 2UXCQ 2F0OA 2ENBA 2NB0A 3SVMA 4JI5Q 5EAYA 2PW5A 1SNDA 3KLSA 3GTPB 4C1NI 4HIMA 2N88A 2B63G 1B7YB 4M1UB 3L9AX 2RDFA 3CRLC 1SBBB 3WDNA 1XPUA 1RTNA 1N33L 4A76A 5EQ0A 1EFWA 4L63B 1QILA 3PF4A 2HD3A 2IWHA 4YCUA 2A6HD 2B2WA 2ZJRA 1YJNA 2CWAA 1KLUD 2O2LD 3U9SA 1U4MA 1E22A 1EYGA 1Z7TA 1W6KA 2I5MX 1U4PA 2F4IA 4OL7A 1JE4A 2MJ8A 2E74C 4R4CA 1WVLA 2K14A 1WJJA 4JPBW 5CBAE 1TWGB 3HFZB 1Q8KA 4FF2A 5KYIA 4A3CH 5M5WB 1OO9B 1BO0A 2XRQD 1XNRL 1SE3A 4FVMA 2HDLA 1EQTA 3AB9A 5KIXA 3NQIA 2RKSA 1TIID 1LTSD 4IPHA 2I5HA 3GTJH 1GXDC 4LF6L 5JOBA 4HMIA 3UI2A 1PH8A 3AU7A 4R8NA 3C1FA 3A5ZB 5M3FG 1ZYRD 1TWCB 4KK7A 4I7ZC 4FXKC 4PMCA 1ILPA 1TWFB 1V43A 2R61A 4ZYSA 3TEHB 1PFSA 3OYYA 2JA7B 1N34Q 3BZCA 4RWSC 1VQ7A 1PFMA 3M4QA 3AFPA 1G6ZA 3K7AH 1EU4A 2Q2IA 2VL6A 1F77A 4DV2Q 2B63H 2F0JA 3FKIG 2EVBA 3I4LA 4HR7B 1PTOF 2LS01 3GQBA 1Y8OB 2YYZA 3IFDA 4U673 4X6AH 1SNOA 1EOVA 2BA1A 5E7NA 4A3GG 4KHPL 3VR3A 3K5LA 1LTRD 2JN4A 1XMOQ 2B2TC 1A63A 4DN4M 2EYLA 4BBSH 1STEA 3IAYA 4JBMA 1LLRD 2A69D 3EROA 3LX0A 1N8RC 4BY7H 3DHQA 1DD2A 4KY5A 3P1HA 4I65A 3JAMi 3GTLH 1IBKL 2E2IH 1X6OA 2JQOA 2BDOA 3RLNA 4H7BA 4R4OA 1Q82C 4QCLA 4XIGS 1N36Q 5I6WA 2Z6KA 1Y14B 2M2LA 2FINB 1O7IA 4RGMA 2ZM6L 4RHSA 1BUVT 2B2VC 1TWHH 4R1JA 1N32Q 5LMNW 2G9DA 4TVAB 5A2QE 4DAMA 4LF5L 5FO9B 2X6LA 4L5SA 5M3FB 2NTTA 5I6YA 4RH6A 2AUJD 2JJQA 3NENA 1SAPA 5CV5A 1ESRA 1Y1VG 3P75A 2MPMA 1J9OA 2R92G 4KJNA 3D6CA 2B2TA 3S1MB 1STGA 2K03A 1HCZA 2K5HA 1GUSA 3C3LA 4JOIC 1T5EA 4YWLA 3S2HH 2ZTDA 1TWAH 1QCBD 4A3GB 3RLOA 2BE5D 3KLWA 3E6ZX 5ELDA 3K81C 3QJYA 3OTOL 5FLMH 1L0YB 1QZHA 1FNVA 1H9SB 4DR6Q 5IGEA 4F8MA 2CQAA 3A7LA 1LT5D 1EWIA 3R93A 3M4OB 1IYJB 5IT9E 3Q8DA 1UE5A 2XGTA 4NMZA 3S17H 2K5WA 2QA4A 4ODGA 1ML0D 5H1SE 2UXDL 5DLQE 3DM3A 1CT1D 4X3KA 1J5EL 1C8CA 3KF8B 5C4ZA 4IOAA 1XJVA 2F4VQ 1PRTC 4C3HH 2EYOA 4K5VA 4J15A 3RZOH 1VQLA 5C4JH 4ME5A 2B29A 2DNEA 2E76C 1U4RA 3ND9A 2K5QA 4ILWA 2EE1A 1CKOA 4YHHQ 4JYAQ 4S3SA 3U4VA 3HKZG 5DM63 1V8QA 1FNWA 1EEID 1A0IA 2I5LX 1N36L 2K6AA 3K5OA 3DMUA 5HGTA 1C48A 4JI5L 1CHPD 2DGYA 5K36G 2VUMG 2EJGC 2PNRC 4GNXA 1FYCA 1EY0A 2K33A 1HUNA 1LACA 5ELEA 5G3LF 3I4MB 3W5OA 2WP8J 3I4MG 4WJ4A 3A8JE 2VB3X 2L11A 1NR4A 4JI3Q 3H91A 4DR5L 2ASBA 4PMBA 4CDFC 1VQ5A 4NXMQ 1BOSA 2EQSA 2F0PA 2JA8G 1HNWQ 1KHIA 3C46A 3GTQB 2N49A 1C4QA 4HJAA 1W2BA 3PV0A 1AEXA 3WOFA 1F2MA 1XMQQ 5C0XJ 1I4QA 5COYA 4K2KA 4DNRB 1D8LA 4DFAA 5M5XB 5BR8L 2Z0SA 2KEEA 2JA7H 1LO5D 1HZ9A 1YNJD 1UAPA 4FXGC 3H09A 3TP6A 4ZQ3A 4NXNQ 1HA6A 1DOMA 4WJ3M 4RMFA 3RMHA 3JAML 2V4DA 4PZ7A 2B63B 3UE1A 1DM0B 1RHPA 1EEFD 2F0QA 3CPWA 4A3CG 3AMUA 1Y69U 3BZDB 2L4NA 2KOLA 1IL2A 1PFNA 3U4ZA 3S1QH 2F0EA 5CV7A 4C56C 4QQBX 4UY8C 5EPKA 4JI0L 2EDGA 1BBUA 1QE6A 3P7JA 1FGUA 5FJ8H 4A93B 2B2YC 1HUMA 3KBXA 1PLFA 1F2YA 4HIKA 1VF7A 5CBEE 1HFNA 1EY4A 1JWSD 1A6XA 1JB3A 1QG7A 2GA4B 4FF4A 5ELNA 5EKIA 3M3YB 1L2FA 1X9NA 3R8BA 4OXPA 3VYRA 3L2PA 5GADC 1XPOA 2CKZB 1K73C 3H0GG 1VQOA 4LF9Q 2LXKA 4X66Q 1NUCA 2RVLA 1UUPA 3KF6B 2EY1A 1H9RA 4A3LH 1AN8A 2J4XA 3PCOB 4KKTA 2Q2UA 5IYCG 2E2HB 4R4IA 1LT4D 1I94Q 1I3QB 4JI4L 1YJ9A 2LXJA 3CQZB 2R7FA 1KL9A 4DR2Q 4LFBL 1EIYB 2AHOB 2RQXA 1SRUA 1NBWA 2CHBD 1JQYD 4KLKA 2YU9H 1Y1WH 3VYUA 4OONA 5LMNL 2NVYB 1E2VA 2WB1B 3BJUA 3ND8A 4B08A 4JBWA 4DV6L 2EJMA 2F0UA 4N9PA 4DV3L 3D4RA 1SSOA 4JG2A 2KA7A 2M00A 1WTXA 1I6HH 1B44D 1DGSA 1HR0W 4JOIA 1I4XA 3KBGA 2D2CC 1EUJA 1PH7A 4DV0Q 1PZJD 1EIFA 1H95A 4FDBA 4IO9A 3K80C 5CV6A 1B1ZA 3P20A 3NP8A 3H6MA 3S16B 3I90A 1SFOB 4YY3L 1VDZA 4DR3L 1QJOA 3MA2B 4DXGA 2L5TA 1K8GA 2K50A 4HN7A 1E2WA 1E1OA 1G291 1TWCH 3TP5A 2QCPX 4A75A 2R7ZH 3AFQA 4R4QA 3ERSX 4AYBG 2AWNA 1S72A 1J6QA 2WINB 2IY5B 4XXEA 1MJCA 1F9PA 3GD7A 5ELOA 1GM5A 5JVG3 3NE5B 4A3BG 5K36H 3E3XA 4B3SQ 2HQLA 2A73B 3I4NH 1S3OA 2ES2A 4GKKQ 4DV5Q 4B3RL 2BE5C 3S14B 4DR1Q 1JOQA 5J1ZA 3E9HA 4QGUA 3VR4A 5CV9A 1VQFA 5EKLA 3LWEA 2FMCA 3S1RB 5IGDA 1UWVA 3CCVA 2J0TD 1BF4A 3H0GH 4YHHL 4NB3A 1Q12A 3STBC 4OHJA 2EOTA 1LTBD 3EVQA 3NQTA 4KN4C 4QMGA 3PF5A 3K5MA 3ICEA 2A74C 3OW7A 3HOUB 1EYDA 5IYCH 3DM1A 4JVZA 4F7XA 1IL8A 1X3GA 2R93B 2G5DA 4DNIA 5I4DA 1TWHB 3T16A 4FO2A 4KY6A 1CM9A 4GLVB 5JJZA 1PH9A 3OHXC 3HOZH 4LFCL 4JI2Q 1RKNA 2PQEA 5D14A 4B3RQ 4AIMA 1KNAA 2ATWA 4A3IH 2VQFL 3M9BA 4X64L 3F2CA 1V1PA 4O2DA 4GKJL 4FF3A 4ULLA 2F03A 4IUQA 2AQ2B 3WWVA 3MEHA 3K57A 4H02A 1JORA 1ZKOA 4DAYA 5KEEA 4DNTB 1TWAB 1OXXK 1DONA 1MBYA 2IHEA 3U50C 3A8KE 1CKNA 1SJHD 4JBKA 4GLAC 1GD7A 2A6EC 1CUKA 1SYCA 2F1MA 4YWKA 3V96A 4TQUS 1NNXA 3BS1A 1HZAA 5JJLA 2PZTA 4IFDH 4B3SL 4DXFA 1VQIA 3VDYA 1VQ8A 1LT3D 3I7FA 2CVRA 5K5PA 1LT6D 3MHBA 3I4NG 1XTCD 4K14A 5KGUA 1ENFA 2M9VA 4FNFA 2E2JH 4C3JG 2EY2A 4A3FB 5IOCA 4A3JB 1H9JA 4KD4A 2BH8A 3F2BA 3SK4A 3F1ZA 4LW1A 4C3JH 4A3KH 2JA5B 5JPNC 1X3PA 2ZM6Q 2E2HH 5I2XA 1I50B 2B39A 1UNSA 3CCQA 1LABA 4MN3A 3I73A 1E3PA 1R4QB 2K04A 5C4JB 2E75C 1U9RA 1PH5A 1IBKQ 4KKUA 2JA6B 4C3IG 2RHQB 1K83B 2JA9A 3ZYYX 3QWNA 3CMEA 3TS2A 2CH4W 2IX0A 3CP0A 1Z6HA 3E5SA 4MZ9A 1KAAA 4NKLA 3CMAA 5IT9L 1X56A 4JI4Q 5LMNQ 4CDCC 3RR5A 3HOWG 1BBWA 4BXXG 3TREA 5CV4A 3MTSA 3EA6A 1S5BD 4GKJQ 5TSSA 4G7HC 4X64Q 1K8MA 4DF7A 2L15A 1E24A 3S15B 1R9TB 1SN8A 5IGCA 3J80c 1B2TA 2H4OA 3J7AF 3S2DH 1BXTA 1AE3A 4N8X1 3HOYG 4EQNA 3S16H 1EWHA 4OIKA 3BG3A 3OPOA 4UHVA 2GVAA 2UU9L 1RL2A 4RKBA 3HEJA 5C4XG 1I4RA 4K8IA 5ELBA 4DUYL 2AQ3B 3J81E 3NK9A 1VCIA 1RODA 1EOTA 5FO7B 4IURA 2ICEC 2ZXOA 3QG1A 1TQOA 2NN6G 4P71A 5M5XH 1SNPA 3TN2A 3URYA 1HNXQ 4DK1A 4L8JA 4A4IA 2NVXB 3FPUB 4RGOS 4K5XA 4C3IB 3ONAB 1E0BA 3OOCA 1K0RA 4DV7L 2WAQB 3CCMA 1FNUA 3O13A 4PZ8A 4DK3C 3OMGA 2B2UC 2JK8A 3FKIH 1JCKB 2B8GA 3S14H 2HCIA 4EVOA 3DEOA 1KD1C 1ET9A 2O5JC 4X3UA 3Q6SA 4JI0Q 1M4VA 2UU9Q 4A3EB 2F0HA 3D3RA 3I56A 1SNQA 4YCVA 1STBA 2B2VA 2D0OA 2R7ZG 5BN3A 2HT1A 3D6WA 1SYGA 5HURA 1CZWA 2BOSA 1EY7A 4KHZA 3HS0C 2OF1A 1JWMD 1PYSB 2JSOA 4JCVE 3T13A 2IL8A 1YJWA 4GZYC 1O7ZA 4KD3A 1II3A 3PUWA 4UDUC 4DR3Q 3PO2B 1FJGL 2LMCB 3ULJA 1D5XC 4WJWA 3MAQA 1HJPA 4O42A 4CJ0B 4YY3Q 2ICIA 3STBD 1DOLA 2A68D 3EBEA 1XMQL 1GJXA 1T9HA 3NUCA 2B3GA 3G4SA 2JA8B 4B9WA 1FD7D 3HRZC 4APVA 3HOYH 1G2SA 3PIPA 2KJXA 5KNBA 1HR0Q 1PFBA 5CMDA 3L7ZC 1L1OA 3T4AC 5BN5A 2ZT9C 3RZDB 1HZBA 5KYLA 5C0XH 4X65Q 2JXMB 3CCEA 1TY2A 3K6OA 1PYWD 5NUCA 2KQ3A 4OWWB 4BY7B 1BBXC 4WRDA 1WTRA 1SYBA 4K2LA 1LTTD 1JC7A 1WCMG 4Y7NH 2NVYH 3LNNA 3UDGA 2MO0A 1UE6A 2VW9A 1I6HB 4QUFA 2F4VL 3KUPA 2JEAI 1CSPA 4HSPA 3NWSA 4RKLA 1SLJA 1MJEA 2N3SA 3H15A 4A3FH 4LUZA 3GTPH 1IYUA 1SYFA 3J7A5 5IE8A 3TZUA 4HJ9A 3PO2G 4JV5Q 2Y0SE 3V2TA 2JA5H 2PYKA 5M3FH 1CKMA 1RIPA 3MC0B 4IALA 4HEDA 1TVXA 3DWQA 4XT1B 1CQVA 2ZJQA 4B9XA 1W3SA 3A54A 1YVCA 1B8AA 5D3IB 5C3EH 3OTOQ 1X3FA 2A68C 2R6GA 3HP3A 4IQZA 4DK0A 2JA6H 2VQFQ 3GDEA 2F52A 4PZ6A 3KF8A 2Z8LA 3EQLC 1D1KA 1H9KA 4A3KG 2R3ZA 4BBSG 1YHAA 1STYA 2Q8TA 2A8VA 1R4PB 4XQQA 1K0SA 5IP9G 1Q81C 4GN4B 3WOEA 3CPFA 1IBMQ 2JA6G 1D7QA 1X32A 3ULPA 2F3VA 3SK8A 1L1OB 1SYDA 3H3VH 4OO1I 4DAPA 3S17B 1SYEA 2ID0A 4CBVA 3S1RH 3M7GA 1N32L 4ID6A 1G51A 3E0JA 3IKJA 1CZGA 2PQAB 2UUBL 3AQQA 3QB3A 3X3MA 4AQYL 5IGFA 3HOVG 4PG3A 4GLXA 4OWTB 4OELB 4QUCA 5I9OA 4GOPB 3OWEB 1OXUA 1B53A 3GP7A 1Y1VH 3VYTA 3TS0A 1TWFH 2OQKA 4KTAA 1AZQA 4F87A 1TU2B 1WOCA 3AYHB 2KHJA 3CU7A 4C2MB 3K0YA 5CGKA 5FJ8G 3MEFA 4A3MB 3PUZA 1PTOD 5AJ3L 4LF8L 4QF4A 2PI2A 3JC66 3R2IA 5IY0A 5C44B 1SMYD 3CHBD 3SXHA 1VQ6A 1TS4A 2OT2A 2CWPA 2VXWA 5GAGC 2EYMA 4O0AA 1DZ1A 4GN3B 1TKWB 2R93G 1VQAA 4DR4L 1KRTA 2UUCQ 3OIPA 4IZ8A 1WD0A 3TQYA 3B6YA 4B3TL 3PIO3 4L5RC 1B50A 4ZRZA 4DV4Q 1RTOA 2GVBA 1SMYC 1HZCA 4RA8A 3FEWX 1QZGA 1KABA 1BKBA 1EIGA 3GTQH 2XVSA 3K58A 2NBFA 2Y0SB 4I7AA 2XRSD 2WIIB 5E1FA 4BBRH 4BWGB 4DV2L 1PV4A 3PO3H 1I4GA 4LF6Q 3CCRA 2K1BA 1NSNS 3HKZB 1IW7C 2DY8A 1JJGA 1PTOB 2F0VA 3GV3A 4RG1A 2DNCA 4DAVA 4G7ZC 3SGIA 4C3JB 3M4PA 5BN4A 1AZPA 4X62Q 2IX1A 3HOYB 2OQ0A 1HQMC 3FHWA 1I50H 3QR8A 1UE1A 4ZAIA 3RZDH 3S1MH 5I2YA 1A8VA 2BDNA 2SOBA 3S1QB 3QOLA 3MWYW 1IHZA 1MIUA 3HOXB 5C6AA 1JJCB 2KHIA 1D5ZC 4IPDA 5JEAJ 4ZKCB 2Z4HA 3PUYA 3NXWA 2DY7A 3GTMH 1I5FA 4ZCKA 4POFA 1AH9A 1BCPF 3EJIA 4JI8L 4K0KL 4RCNA 1S5FD 2ZXRA 3J80L 1KDAA 2FJ2A 3M3YH 4B3MQ 3BZKA 4KV6A 5IP7H 5FLXc 4H13C 2ZJPA 3KLSX 3ITPA 1K28A 4JI6L 1PH1A 3ZJYC 4JW0A 2VY3A 4ZLTF 4BY7G 2P5ZX 2Y0SG 4IFDG 1RJTA 4DK6C 3I2ZA 1Y1WG 4KMUC 1KLGD 1PH6A 1Q86C 4A3IG 1UEBA 2JA7G 1BCPD 4OX9Q 5G3LD 5LMUQ 2UUAL 3A0JA 2Q8IB 3NBHB 4K6LA 1I3QH 5KRUA 1IYVA 1EQVA 2KUMA 4LJZC 4KY7A 2RSNA 1TXYA 4XQNA 3H3VC 1FVIA 5IYBG 1Z47A 2B8FA 4IOCA 1SMXA 1SNCA 1Q90A 2YU9B 1X54A 4G7OC 2N55A 4OEMB 4RAUC 2A69C 2L12A 2RCNA 1EIHA 3S9WA 2CW0D 3PGZA 2MNAA 2QDLA 4RCOA 1C7YA 1PVOA 2UXBQ 1BQQT 4QIWB 3SEBA 1FJGQ 1JOKA 2J7ZA 2D9UA 5C0XI 5LL6X 1AFPA 4DPGA 1VS0A 1D6EC 2ZXPA 5A2QL 1VQNA 1K9MC 2FHTA 1SE8A 4KHVA 1BCPB 5LHY1 2RDGA 1ZYRC 5DEHA 4BXXH 3G6EA 4P74A 3MZ5A 3T56B 2QGQA 3TMEA 4XYQA 4A3LG 3CD6A 2PO4A 3NPPA 2TSSA 2R7ZB 1KC8C 1HTPA 3RD4A 5ISRA 2F0FA 1ESFA 1Y1VB 5HY6A 1KTKA 3FRPB 3PO2H 3RUZA 1K8AC 4DUZQ 2VUMH 2KHSA 4A93G 4LK1C 2G9HD 1GHKA 5C44H 1OXSC 1TT2A 4JI6Q 2JA8H 4IFDJ 4OX9L 2L0CA 4DU9A 2F3WA 4TRDA 4DR2L 1ET6A 2PPBC 1T5XD 1NMFA 4QL5A 4JI2L 1WTWA 2LSSA 3CKIB 2EIFA 4WFN3 4LFCQ 4K0KQ 4HJ5A 2CH4A 4G4KA 5IGGA 1XPRA 1YITA 1EFID 4HIOA 4A3FG 2BH2A 1IBLQ 4JI7L 3BYTB 4A93H 2PZWA 3I3CA 1GUTA 5GAHC 1STNA 1F2ZA 4H0LC 3UE0A 2UXDQ 4KN7C 1NR2A 1V1PB 1ZEQX 1IBLL 1EY6A 2I07B 3DEPA 1DJRD 4A3BH 3PIP3 3BDCA 4OGQC 4OO1G 4CKCA 1SE2A 1PHJA 1H9SA 1D2BA 1YEZA 2RA4A 3MVVA 3X3NA 4LF9L 4UP8A 5EGTA 4OO1H 3JAME 1WTQA 2K28A 3R2TA 2EYHA 3BDOA 3HOZB 4F88A 4OWXB 4DUZL 2K32A 2NWGA 4BY1G 4A3DB 4XYOA 4A3DG 5M5YH 2UXCL 2R92B 2Z6BA 2MUYA 4UP7A 5EBDA 1EYCA 1B4OA 1Q8IA 1BNZA 1RD9D 2WKDA 4MNOA 4HCSA 2QDBA 1EL0A 2NUCA 4HCEA 5J3BA 3CQZH 2KCCA 2IPKD 5C3EB 1LTID 4LF7L 1KDBA 1ZXTA 1F9QA 5C3WA 1S5CD 3J81i 2KVMA 2AKWB 4Z9CB 5DAUA 4H44C 5JVH3 1O7LA 2F0LA 1IKLA 2OXPA 3K5NA 1X55A 3EFXD 3U58A 4IUNA 2JE6I 3D4WA 4A3JG 2ZTEA 3CXCA 1OXVA 3SR1A 4GS3A 3TSSA 5IYDH 3CCSA 2K5DA 3D31A 4LUOA 4RHRA 4X3TA 1PMRA 4XTCS 1PH3A 1LTLA 2HIVA 3GO5A 3HGBA 3G6JB 4NDXA 5AJ3Q 5IWAL 3S24A 3EN2A 4IUPA 1XTDA 1GO3E 4RFBA 3T1YL 1G2TA 1B3AA 1MD2D 2UUCL 5C4XH 4XQJA 1SFOH 4DR4Q 1IXRA 1Q1EA 1E2ZA 3OWFA 3HOWH 4GOPC 1HTLD 1SROA 1VQJA 3Q24A 4AQYQ 2RCFA 3GTOB 5LMUL 2UUAQ 1QOHA 1MHWC 3VR5A 1AE2A 4BY1B 1F9SA 1JE5A 4QIWE 4YWMA 4C2MH 1LV9A 2N8NA 2A6HC 2PMZB 2K7VA 2EY5A 3DWAA 1KAWA 2CFMA 2A19A 3FPPA 1IW7D 2F0TA 2D5DA 3I4NB 3RNUA 2KCMA 3NSWA 4IJHA 1TWGH 3D4DA 4B3ML 3KF6A 1WTOA 1B3QA 4HJ8A 3T1HQ 1UEAB 3OSOA 3S15H 4C3IH 3HG9A 3CC4A 2H5XA 4O1NA 3KDFB 4A3MG 1QVCA 5C44G 4TSSA 3PMFA 1SR3A 1IBML 3IFTA 3GTJB 3H0GB 5DM73 4JI1L 3J81j 4P75A 1J5EQ 3CAMA 1CI3M 1SNMA 2XWBB 4DR6L 1NE3A 2FMMA 1EWCA 1M8AA 4EQOA 3G71A 4BBRB 1VF5C 2NN6I 4BBRG 4CDEC 3F2UA 5ELCA 4WORA 3MXGA 2R93H 4NP5A 3VR2A 1L1OC 3L0OA 4BA2I 2PQAA 3E0EA 2EY6A 1YHQA 3K7AB 3PSIA 2KECA 4DA2A 1BR9A 5JAVA 3TDQA 3C2PA 2WB1E 2MQHA 4HAEA 4GNXB 4EX5A 4LF4Q 2WACA 4A3IB 3TP8A 1DCZA 4HMJA 4LMQD 1LTAD 2Q8RE 1CK1A 2B2WC 2MHVA 3HZXA 2Z4IA 1IZ6A 4G57A 5M3MH 2NVTH 3TZDA 2ZTCA 3SE0A 3IRBA 1OTCA 2AQ1B 2SDFA 5CORA 4YCWA 1CA5A 3Q0AA 2CW0C 5D65A 4IUUA 3OW2A 4DV0L 1V1QA 3CRKC 3HKZE 2Q2TA 1PRTF 1YNJC 1RF2D 1QUQA 3HKSA 3S1NH 4ZKBB 5FO8B 4KI0A 2XIWA 2F0NA 4A3JH 4LF8Q 1WTHA 2XN9C 4A3KB 3KDFA 1A3VA 1KDCA 5C4HA 2LY7A 3J7AV 1KIXA 4A3DH 5GROA 1VQEA 3EIVA 1K3BC 2AMCB 2PZUA 1YIJA 1F2LA 2PI2E 2OWOA 1A3TA 3A8IE 2L1BA 5JJKA 1WTPA 1XMOL 1K8OA 2ALYB 4MTNA 4PQXA 3UDXA 1Y8PB 3Q23A 3IL8A 2E8GA 3DLLA 3AEVA 2VS1A 5C5MA 3J7ZC 2A5HA 5CV8A 3BVGA 2MFIA 4UPAA 2YTYA 1M1KC 4POGA 1QVFA 4IPGA 3RLFA 4X66L 4MIUA 1Y8NB 5KNDA 3JAMc 1A3UA 2L55A 1R9TH 2HQEA 1IKMA 1XWEA 1SJED 2K52A 1J8IA 2VZAA 1EY5A 2IT1A 4JI8Q 1GVPA 4CHTB 1FGBD 1MI2A 3G48A 1PA6A 3RZOB 2HCCA 5JPMC 3J81L 2QW7A 3N52A 2IX3A 1VQKA 2EXDA 3W1BA 3GTOH 1S5DD 1CKNB 2Z6KC 3CC7A 5ELFA 1LM0A 1HNXL 5HGQA 2R7DA 4M8AA 1MKHA 2SEBD 2FFKB 1V9PA 3I91A 2V1CC 2NVXH 3OMCA
chains in the Genus database with same CATH topology
3K0XA 5ELOA 1GM5A 1VQ9A 1QUQB 1A8VA 4JV5L 1VQMA 4A3BG 4L5TA 4B3TQ 4B3SQ 1MIUA 2NZOA 2OCEA 1JJCB 3KJOA 1N33Q 2KHIA 2HQLA 3K8AA 1K83H 4GOPA 4IPDA 3I4NH 5JEAJ 1S3OA 3PUYA 2ES2A 4GKKQ 4DV5Q 4B3RL 5BR8Q 1I5FA 3GTMH 4POFA 4DV4L 1AH9A 5IP9H 4JI8L 4DR1Q 4K0KL 2HHHQ 3E9HA 4QGUA 1CSQA 4KHPQ 1VQFA 4LF5Q 1YZ6A 4IFDI 3ULLA 3M3YH 1UWVA 3BZKA 1L0WA 5IP7H 5FLXc 2ZJPA 3CCVA 1Q7YC 1LUZA 1HR0L 1NTGA 4ALPA 3W1GA 1WI5A 3H0GH 4YHHL 1UE7A 1YBYA 4NB3A 1Q12A 3STBC 4JI6L 1PH1A 2UXCQ 3ZJYC 2VY3A 4JI5Q 3PF5A 5EAYA 4X65L 4BY7G 3ICEA 2PNHA 2Y0SG 4HIMA 2B63G 1M90C 1B7YB 4IFDG 5IYCH 3HOUG 4QJFA 4DK6C 3I2ZA 1Y1WG 1PH6A 1Q86C 5IYBH 4A3IG 1UEBA 1X3GA 2JA7G 1XPUA 1K3RA 4DNIA 4OX9Q 5LMUQ 2UUAL 1N33L 3A0JA 4A76A 1EFWA 3NBHB 1I3QH 3NEMA 3PF4A 3HOZH 4GLVB 1PH9A 1VQDA 2NZHA 4YCUA 4LFCL 1X65A 3LGJA 4B3MQ 1NMGA 1TXYA 1KXLA 4JI2Q 2ZJRA 1YJNA 2CWAA 4B3RQ 4AIMA 2ATWA 2F3IA 1FVIA 5IYBG 1Z47A 2VQFL 4IOCA 4A3IH 3M9BA 2UUBQ 1E22A 4X64L 1SMXA 1EYGA 3F2CA 4LWCA 4O2DA 3K7UC 4GKJL 4JYAL 1X54A 2I5MX 2WAQE 3WWVA 5IT9c 1B70B 4H02A 2PMZE 2RCNA 5M3MG 1OXXK 3PGZA 2MNAA 3CCJA 4R4CA 2IHEA 1C7YA 2HHHL 4A3GH 1PVOA 2K14A 3U50C 2UXBQ 1WJJA 1CKNA 4JBKA 1FJGQ 2DUDA 4GLAC 5C0XI 1GD7A 1S40A 1CUKA 2NVQH 3HFZB 4YWKA 1Q8KA 3CW2C 4TQUS 3F2DA 1HZAA 4DPGA 4A3CH 5JJLA 1VS0A 4B3SL 1XNRL 1VQIA 3VDYA 2YTXA 1VQ8A 3J80i 5C3EG 1K9MC 1VQNA 3I7FA 1SE8A 2KCTA 1C0AA 3MXNB 3I4NG 4IPHA 2I5HA 3GTJH 4LF6L 3M4OH 4BXXH 2HIXA 3G6EA 1PH8A 4P74A 2E2JH 3PIOA 2QGQA 1U5KA 5IP7G 3HOVH 1XNRQ 3CD6A 3M7NA 4A3LG 4DV7Q 3A5ZB 5M3FG 2BH8A 3F2BA 2JA5G 4A3KH 3F1ZA 4LW1A 4C3JH 1KC8C 1G6PA 2ZM6Q 1Z9FA 2KBNA 5HY6A 1V43A 2E2HH 3TEHB 1PFSA 3OYYA 3PO2H 1N34Q 3BZCA 1JMCA 1K8AC 1VQ7A 3M4QA 3AFPA 3HOXG 3CCQA 4DUZQ 2VUMH 4DAYB 1E3PA 3K7AH 4A93G 4DUYQ 2Q2IA 2VL6A 4DV2Q 1VQBA 2B63H 2RHSB 1PH5A 5C44H 1OXSC 1IBKQ 4JI6Q 3FKIG 2JA8H 3HOXH 4IFDJ 2RHQB 2JA9A 4DR7Q 4OX9L 4QY7A 2YYZA 4X6AH 1XNQL 3CMEA 1PH4A 3TS2A 2YTVA 4AH6A 4DR2L 4JI7Q 2IX0A 1EOVA 2BA1A 3CP0A 4MZ9A 5E7NA 3GTKH 4A3GG 1NMFA 4KHPL 4QL5A 4JI2L 1PH2A 1A63A 1XMOQ 2LSSA 3CMAA 2EIFA 4LFCQ 1X56A 4K0KQ 4HJ5A 1XPRA 4DKAC 4BBSH 1YITA 4JBMA 1HNZL 4HIOA 1VQ4A 4A3FG 2A1AA 1QVGA 4JI4Q 2BH2A 5LMNQ 1IBLQ 4JI7L 5FLMG 3KYHC 4A93H 3RR5A 3HOWG 2D62A 1BBWA 1N8RC 3M85A 5GAHC 4BY7H 4BXXG 3TREA 4BA1I 1NY4A 4GKJQ 3UE0A 2UXDQ 3BU2A 3JAMi 4A3EG 4X64Q 3TRZA 3GTLH 1IBKL 2E2IH 4LNQA 1X6OA 3CF5A 2L15A 1E24A 1IBLL 2JQOA 3RLNA 1SN8A 3A5UA 4R4OA 3CCUA 3I4MH 3J80c 4P73A 4A3BH 1Q82C 5GAEC 2K5NA 4XIGS 4JC0A 3S2DH 4PMWA 4OO1G 1PHJA 1AE3A 1N36Q 1YEZA 1N9WA 2Z6KA 3HOYG 1Y14B 4DV5L 3S16H 1O7IA 4GKKL 2ZM6L 4LF9L 4UP8A 1GKHA 4R1JA 1TWHH 1N32Q 2GVAA 2UU9L 1RL2A 5LMNW 4TVAB 4DAMA 3T1YQ 5C4XG 4LF5L 4DUYL 1P8LA 4L5SA 4OWXB 4DUZL 1VCIA 1VQCA 4BY1G 2JJQA 3NENA 4A3DG 2NN6G 5M5XH 1Y1VG 4P71A 5M5YH 2UXCL 1HNXQ 2R92G 4UP7A 1Q1BA 4A4IA 4MNOA 2K5HA 4A3MH 4JOIC 4YWLA 5J3BA 3S2HH 3CQZH 2ZTDA 1K0RA 4DV7L 4LF7L 1TWAH 3CCMA 4PZ8A 3RLOA 4DK3C 4R4TA 3CC2A 3J81i 3KLWA 1N34L 2JK8A 2AKWB 2CQOA 3FKIH 3K81C 3S14H 3OTOL 2OTLA 5FLMH 1KD1C 1X55A 4DV6Q 3U58A 1QZHA 2JE6I 4A3JG 4JI0Q 4DR6Q 2ZTEA 3CXCA 1OXVA 2UU9Q 1YI2A 4GS3A 1YHBA 5JEAG 2WFWA 5IYDH 3CCSA 3I56A 3D31A 4LUOA 4YCVA 3HOZG 4XTCS 1PH3A 2VNUD 1LTLA 1EWIA 2D0OA 2HIVA 3GO5A 1EQRA 1IYJB 4GNXC 1JJ2A 2C35B 2R7ZG 2HT1A 3Q8DA 4ME3A 5AJ3Q 1UE5A 5IWAL 2XGTA 3S24A 3EN2A 4KHZA 1XTDA 3HOUH 1GO3E 3S17H 2Q2HA 1PYSB 2QA4A 5H1SE 3T1YL 2UXDL 5DLQE 4JI1Q 2BA0A 3DM3A 4JCVE 1YJWA 1J5EL 2UUCL 5C4XH 3KF8B 1VQPA 1SFOH 4DR4Q 4LFBQ 1IXRA 3PUWA 4P72A 4IOAA 4DR3Q 1XJVA 2F4VQ 1Q1EA 1FJGL 1HNZQ 3ULJA 4C3HH 3HOWH 1HJPA 4J15A 4YY3Q 4GOPC 1VQLA 3RZOH 2VQEL 1SROA 1VQJA 1WYDA 3STBD 3EBEA 5C4JH 2B29A 4AQYQ 4HIDA 1XMQL 1T9HA 2B3GA 3G4SA 3T1HL 1XNQQ 2K4KA 5LMUL 2UUAQ 4APVA 1I94L 3HOYH 1CKOA 3PIPA 1AE2A 4YHHQ 4JYAQ 1A62A 3U4VA 3HKZG 1HR0Q 1JE5A 1I6HH 3L7ZC 2WAQG 1L1OA 4QIWE 4YWMA 1A0IA 2GN5A 2I5LX 4C2MH 1HZBA 5IYDG 1N36L 2N8NA 4LFAQ 1PYBA 4X65Q 4JI5L 1KAWA 2DGYA 3KOJA 2CFMA 5K36G 3CCEA 2A19A 4EQ5A 2VUMG 4JBJA 3RNUA 4OWWB 4GNXA 1E7ZA 2KCMA 4IJHA 1TWGH 4L5QA 4B3ML 3KF6A 1X3EA 1WCMG 4HJ8A 3T1HQ 4UP9A 4Y7NH 1NJIC 3S15H 3CC4A 2NVYH 2H5XA 3KDFB 1LYLA 2WP8J 2XTIA 3W5OA 3UDGA 4A3MG 3I4MG 4WJ4A 1QVCA 2MO0A 1VQHA 3H3VI 1UE6A 2VW9A 5C44G 4JI3Q 1SR3A 2F4VL 4DR5L 1IBML 2ASBA 2JEAI 1CSPA 1VQ5A 4NXMQ 2EQSA 1P16A 1WFQA 3F8TA 2JA8G 4JI1L 1SLJA 3J81j 1HNWQ 1KHIA 4P75A 1J5EQ 2N3SA 2N49A 3CAMA 3H15A 4A3FH 4HJAA 1W2BA 1MJEA 4DR6L 3PV0A 1NE3A 4LUZA 4NXNL 3GTPH 4DV1L 3G71A 3J7A5 5IE8A 1XMQQ 4BBRG 2NN6I 4HJ9A 2Y0SE 5C0XJ 3PO2G 2JA5H 4JV5Q 5M3FH 1CKMA 1RIPA 1D8LA 1EQQA 2R93H 5BR8L 2Z0SA 1L1OC 2R92H 2JA7H 3L0OA 4BA2I 1HZ9A 4IPCA 2PQAA 2ZJQA 3E0EA 1BVSA 2K75A 4NXNQ 1YHQA 1W3SA 3PSIA 4WJ3M 4RMFA 1YVCA 1B8AA 4PZ7A 3UE1A 2WB1E 4AYBE 5C3EH 3OTOQ 2MQHA 1X3FA 3KJPA 3FP9A 2R6GA 3NELA 4EX5A 1KRSA 4GNXB 2JA6H 4LF4Q 2VQFQ 5GQOA 3CPWA 4A3CG 3GDEA 2F52A 4PZ6A 2KENA 4JI3L 1FL0A 4Y52H 4A3KG 1IL2A 3U4ZA 4BBSG 3UDIA 3S1QH 2QEXA 4QQBX 1YHAA 4UY8C 1IZ6A 3ER0A 4JI0L 4NPSA 2A8VA 5M3MH 2NVTH 1BBUA 5IP9G 1FGUA 5FJ8H 1HNWL 2ZTCA 1Q81C 2I0QA 3RN5A 4GN4B 4HIKA 3CPFA 4NXML 3IRBA 2CCZA 1OTCA 4DR5Q 1IBMQ 2JA6G 2K5VA 1D7QA 3A74A 3ULPA 1VQGA 1U0LA 4DV3Q 1L1OB 4LF4L 4YCWA 5M5WH 3H3VH 4LF7Q 4OO1I 4DV1Q 5ELNA 3RN2A 2ID0A 3S1RH 1L2FA 1X9NA 2RF4A 4OXPA 3OW2A 1N32L 1E1TA 1G51A 1V1QA 3L2PA 4DV0L 5GADC 2PQAB 1XPOA 2CKZB 3HKZE 2Q2TA 1K73C 2UUBL 3AQQA 3H0GG 1VQOA 4LF9Q 3KFUA 1QUQA 2LXKA 4X66Q 4AQYL 3HKSA 3S1NH 3KF6B 4KI0A 3PUXA 3HOVG 4A3JH 4A3LH 3PCOB 4PG3A 4GLXA 4LF8Q 2D0PA 4OWTB 3KDFA 2Q2UA 4GOPB 5IYCG 1OXUA 2E5LL 1Y1VH 1KIXA 4A3DH 5C0XG 3TS0A 5GROA 1HH2P 1TWFH 4BY1H 1VQEA 4R4IA 2OQKA 3EIVA 2AMCB 1I94Q 2IHFA 1YIJA 2PI2E 4JI4L 1C9OA 1WOCA 2KHJA 3AYHB 1YJ9A 2OWOA 2LXJA 5FJ8G 3MEFA 3PUZA 5JJKA 5AJ3L 4LF8L 2PI2A 2R7FA 3JC66 5IY0A 1VQ6A 4LFAL 1WCMH 2CWPA 1XMOL 1KL9A 5JJIA 5GAGC 4GN5A 2ALYB 4MTNA 3UDXA 4O0AA 2E8GA 4GN3B 3DLLA 1OXTA 4DR2Q 1VQAA 2R93G 4DR4L 1KRTA 1EIYB 2UUCQ 2AHOB 4LFBL 1SRUA 1NBWA 4KLKA 2YU9H 3GTGH 4DR7L 1Y1WH 3AEVA 2VS1A 4OONA 3TQYA 5LMNL 2E5LQ 3B6YA 3BJUA 4DV6L 3J7ZC 2MO1A 4JBWA 1ASZA 4B3TL 4DV3L 4L5RC 3CCLA 2VQEQ 4JG2A 2OTJA 4A3EH 2MFIA 4UPAA 2YTYA 1M1KC 2JEBI 4POGA 1QVFA 2YV5A 3E9IA 3J81c 4DV4Q 4IPGA 2GVBA 3RLFA 1DGSA 4X66L 1HZCA 1QZGA 4JOIA 1HR0W 1BKBA 1EUJA 4X62L 3JAMc 1PH7A 4DV0Q 3UDFA 3GTQH 1KQSA 1EIFA 1R9TH 1H95A 4FDBA 4IO9A 3K80C 4BBRH 2K52A 4DV2L 1PV4A 3PO3H 2VZAA 4IJLA 4LF6Q 2IT1A 4JI8Q 3CCRA 1GVPA 1YNXA 4YY3L 4DR1L 2AWOA 3I55A 1ASYA 3G48A 4DR3L 1PA6A 3PUVA 1JJGA 1JT8A 1Q46A 4RG1A 2K50A 1K8GA 1VQKA 2EXDA 3SGIA 3W1BA 1E1OA 1G291 1TWCH 2N78A 3D0FA 3GTOH 4A75A 1CKNB 2Z6KC 3AFQA 3M4PA 4R4QA 3CC7A 3ERSX 2R7ZH 2WB1G 4AYBG 4X62Q 2AWNA 5IWAQ 1J6QA 1S72A 2IX1A 3PO3G 2OQ0A 1LM0A 1HNXL 3FHWA 5HGQA 1JB7A 4LUVA 1I50H 2R7DA 1MKHA 1UE1A 3I4OA 4HJ7A 2IY5B 1MJCA 1V9PA 2FXQA 2V1CC 2NVXH 2UXBL 3RZDH 3S1MH 3GD7A 4C3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0X A;  5ELO A;  1GM5 A;  1VQ9 A;  1QUQ B;  1A8V A;  4JV5 L;  1VQM A;  4A3B G;  4L5T A;  4B3T Q;  4B3S Q;  1MIU A;  2NZO A;  2OCE A;  1JJC B;  3KJO A;  1N33 Q;  2KHI A;  2HQL A;  3K8A A;  1K83 H;  4GOP A;  4IPD A;  3I4N H;  5JEA J;  1S3O A;  3PUY A;  2ES2 A;  4GKK Q;  4DV5 Q;  4B3R L;  5BR8 Q;  1I5F A;  3GTM H;  4POF A;  4DV4 L;  1AH9 A;  5IP9 H;  4JI8 L;  4DR1 Q;  4K0K L;  2HHH Q;  3E9H A;  4QGU A;  1CSQ A;  4KHP Q;  1VQF A;  4LF5 Q;  1YZ6 A;  4IFD I;  3ULL A;  3M3Y H;  1UWV A;  3BZK A;  1L0W A;  5IP7 H;  5FLX c;  2ZJP A;  3CCV A;  1Q7Y C;  1LUZ A;  1HR0 L;  1NTG A;  4ALP A;  3W1G A;  1WI5 A;  3H0G H;  4YHH L;  1UE7 A;  1YBY A;  4NB3 A;  1Q12 A;  3STB C;  4JI6 L;  1PH1 A;  2UXC Q;  3ZJY C;  2VY3 A;  4JI5 Q;  3PF5 A;  5EAY A;  4X65 L;  4BY7 G;  3ICE A;  2PNH A;  2Y0S G;  4HIM A;  2B63 G;  1M90 C;  1B7Y B;  4IFD G;  5IYC H;  3HOU G;  4QJF A;  4DK6 C;  3I2Z A;  1Y1W G;  1PH6 A;  1Q86 C;  5IYB H;  4A3I G;  1UEB A;  1X3G A;  2JA7 G;  1XPU A;  1K3R A;  4DNI A;  4OX9 Q;  5LMU Q;  2UUA L;  1N33 L;  3A0J A;  4A76 A;  1EFW A;  3NBH B;  1I3Q H;  3NEM A;  3PF4 A;  3HOZ H;  4GLV B;  1PH9 A;  1VQD A;  2NZH A;  4YCU A;  4LFC L;  1X65 A;  3LGJ A;  4B3M Q;  1NMG A;  1TXY A;  1KXL A;  4JI2 Q;  2ZJR A;  1YJN A;  2CWA A;  4B3R Q;  4AIM A;  2ATW A;  2F3I A;  1FVI A;  5IYB G;  1Z47 A;  2VQF L;  4IOC A;  4A3I H;  3M9B A;  2UUB Q;  1E22 A;  4X64 L;  1SMX A;  1EYG A;  3F2C A;  4LWC A;  4O2D A;  3K7U C;  4GKJ L;  4JYA L;  1X54 A;  2I5M X;  2WAQ E;  3WWV A;  5IT9 c;  1B70 B;  4H02 A;  2PMZ E;  2RCN A;  5M3M G;  1OXX K;  3PGZ A;  2MNA A;  3CCJ A;  4R4C A;  2IHE A;  1C7Y A;  2HHH L;  4A3G H;  1PVO A;  2K14 A;  3U50 C;  2UXB Q;  1WJJ A;  1CKN A;  4JBK A;  1FJG Q;  2DUD A;  4GLA C;  5C0X I;  1GD7 A;  1S40 A;  1CUK A;  2NVQ H;  3HFZ B;  4YWK A;  1Q8K A;  3CW2 C;  4TQU S;  3F2D A;  1HZA A;  4DPG A;  4A3C H;  5JJL A;  1VS0 A;  4B3S L;  1XNR L;  1VQI A;  3VDY A;  2YTX A;  1VQ8 A;  3J80 i;  5C3E G;  1K9M C;  1VQN A;  3I7F A;  1SE8 A;  2KCT A;  1C0A A;  3MXN B;  3I4N G;  4IPH A;  2I5H A;  3GTJ H;  4LF6 L;  3M4O H;  4BXX H;  2HIX A;  3G6E A;  1PH8 A;  4P74 A;  2E2J H;  3PIO A;  2QGQ A;  1U5K A;  5IP7 G;  3HOV H;  1XNR Q;  3CD6 A;  3M7N A;  4A3L G;  4DV7 Q;  3A5Z B;  5M3F G;  2BH8 A;  3F2B A;  2JA5 G;  4A3K H;  3F1Z A;  4LW1 A;  4C3J H;  1KC8 C;  1G6P A;  2ZM6 Q;  1Z9F A;  2KBN A;  5HY6 A;  1V43 A;  2E2H H;  3TEH B;  1PFS A;  3OYY A;  3PO2 H;  1N34 Q;  3BZC A;  1JMC A;  1K8A C;  1VQ7 A;  3M4Q A;  3AFP A;  3HOX G;  3CCQ A;  4DUZ Q;  2VUM H;  4DAY B;  1E3P A;  3K7A H;  4A93 G;  4DUY Q;  2Q2I A;  2VL6 A;  4DV2 Q;  1VQB A;  2B63 H;  2RHS B;  1PH5 A;  5C44 H;  1OXS C;  1IBK Q;  4JI6 Q;  3FKI G;  2JA8 H;  3HOX H;  4IFD J;  2RHQ B;  2JA9 A;  4DR7 Q;  4OX9 L;  4QY7 A;  2YYZ A;  4X6A H;  1XNQ L;  3CME A;  1PH4 A;  3TS2 A;  2YTV A;  4AH6 A;  4DR2 L;  4JI7 Q;  2IX0 A;  1EOV A;  2BA1 A;  3CP0 A;  4MZ9 A;  5E7N A;  3GTK H;  4A3G G;  1NMF A;  4KHP L;  4QL5 A;  4JI2 L;  1PH2 A;  1A63 A;  1XMO Q;  2LSS A;  3CMA A;  2EIF A;  4LFC Q;  1X56 A;  4K0K Q;  4HJ5 A;  1XPR A;  4DKA C;  4BBS H;  1YIT A;  4JBM A;  1HNZ L;  4HIO A;  1VQ4 A;  4A3F G;  2A1A A;  1QVG A;  4JI4 Q;  2BH2 A;  5LMN Q;  1IBL Q;  4JI7 L;  5FLM G;  3KYH C;  4A93 H;  3RR5 A;  3HOW G;  2D62 A;  1BBW A;  1N8R C;  3M85 A;  5GAH C;  4BY7 H;  4BXX G;  3TRE A;  4BA1 I;  1NY4 A;  4GKJ Q;  3UE0 A;  2UXD Q;  3BU2 A;  3JAM i;  4A3E G;  4X64 Q;  3TRZ A;  3GTL H;  1IBK L;  2E2I H;  4LNQ A;  1X6O A;  3CF5 A;  2L15 A;  1E24 A;  1IBL L;  2JQO A;  3RLN A;  1SN8 A;  3A5U A;  4R4O A;  3CCU A;  3I4M H;  3J80 c;  4P73 A;  4A3B H;  1Q82 C;  5GAE C;  2K5N A;  4XIG S;  4JC0 A;  3S2D H;  4PMW A;  4OO1 G;  1PHJ A;  1AE3 A;  1N36 Q;  1YEZ A;  1N9W A;  2Z6K A;  3HOY G;  1Y14 B;  4DV5 L;  3S16 H;  1O7I A;  4GKK L;  2ZM6 L;  4LF9 L;  4UP8 A;  1GKH A;  4R1J A;  1TWH H;  1N32 Q;  2GVA A;  2UU9 L;  1RL2 A;  5LMN W;  4TVA B;  4DAM A;  3T1Y Q;  5C4X G;  4LF5 L;  4DUY L;  1P8L A;  4L5S A;  4OWX B;  4DUZ L;  1VCI A;  1VQC A;  4BY1 G;  2JJQ A;  3NEN A;  4A3D G;  2NN6 G;  5M5X H;  1Y1V G;  4P71 A;  5M5Y H;  2UXC L;  1HNX Q;  2R92 G;  4UP7 A;  1Q1B A;  4A4I A;  4MNO A;  2K5H A;  4A3M H;  4JOI C;  4YWL A;  5J3B A;  3S2H H;  3CQZ H;  2ZTD A;  1K0R A;  4DV7 L;  4LF7 L;  1TWA H;  3CCM A;  4PZ8 A;  3RLO A;  4DK3 C;  4R4T A;  3CC2 A;  3J81 i;  3KLW A;  1N34 L;  2JK8 A;  2AKW B;  2CQO A;  3FKI H;  3K81 C;  3S14 H;  3OTO L;  2OTL A;  5FLM H;  1KD1 C;  1X55 A;  4DV6 Q;  3U58 A;  1QZH A;  2JE6 I;  4A3J G;  4JI0 Q;  4DR6 Q;  2ZTE A;  3CXC A;  1OXV A;  2UU9 Q;  1YI2 A;  4GS3 A;  1YHB A;  5JEA G;  2WFW A;  5IYD H;  3CCS A;  3I56 A;  3D31 A;  4LUO A;  4YCV A;  3HOZ G;  4XTC S;  1PH3 A;  2VNU D;  1LTL A;  1EWI A;  2D0O A;  2HIV A;  3GO5 A;  1EQR A;  1IYJ B;  4GNX C;  1JJ2 A;  2C35 B;  2R7Z G;  2HT1 A;  3Q8D A;  4ME3 A;  5AJ3 Q;  1UE5 A;  5IWA L;  2XGT A;  3S24 A;  3EN2 A;  4KHZ A;  1XTD A;  3HOU H;  1GO3 E;  3S17 H;  2Q2H A;  1PYS B;  2QA4 A;  5H1S E;  3T1Y L;  2UXD L;  5DLQ E;  4JI1 Q;  2BA0 A;  3DM3 A;  4JCV E;  1YJW A;  1J5E L;  2UUC L;  5C4X H;  3KF8 B;  1VQP A;  1SFO H;  4DR4 Q;  4LFB Q;  1IXR A;  3PUW A;  4P72 A;  4IOA A;  4DR3 Q;  1XJV A;  2F4V Q;  1Q1E A;  1FJG L;  1HNZ Q;  3ULJ A;  4C3H H;  3HOW H;  1HJP A;  4J15 A;  4YY3 Q;  4GOP C;  1VQL A;  3RZO H;  2VQE L;  1SRO A;  1VQJ A;  1WYD A;  3STB D;  3EBE A;  5C4J H;  2B29 A;  4AQY Q;  4HID A;  1XMQ L;  1T9H A;  2B3G A;  3G4S A;  3T1H L;  1XNQ Q;  2K4K A;  5LMU L;  2UUA Q;  4APV A;  1I94 L;  3HOY H;  1CKO A;  3PIP A;  1AE2 A;  4YHH Q;  4JYA Q;  1A62 A;  3U4V A;  3HKZ G;  1HR0 Q;  1JE5 A;  1I6H H;  3L7Z C;  2WAQ G;  1L1O A;  4QIW E;  4YWM A;  1A0I A;  2GN5 A;  2I5L X;  4C2M H;  1HZB A;  5IYD G;  1N36 L;  2N8N A;  4LFA Q;  1PYB A;  4X65 Q;  4JI5 L;  1KAW A;  2DGY A;  3KOJ A;  2CFM A;  5K36 G;  3CCE A;  2A19 A;  4EQ5 A;  2VUM G;  4JBJ A;  3RNU A;  4OWW B;  4GNX A;  1E7Z A;  2KCM A;  4IJH A;  1TWG H;  4L5Q A;  4B3M L;  3KF6 A;  1X3E A;  1WCM G;  4HJ8 A;  3T1H Q;  4UP9 A;  4Y7N H;  1NJI C;  3S15 H;  3CC4 A;  2NVY H;  2H5X A;  3KDF B;  1LYL A;  2WP8 J;  2XTI A;  3W5O A;  3UDG A;  4A3M G;  3I4M G;  4WJ4 A;  1QVC A;  2MO0 A;  1VQH A;  3H3V I;  1UE6 A;  2VW9 A;  5C44 G;  4JI3 Q;  1SR3 A;  2F4V L;  4DR5 L;  1IBM L;  2ASB A;  2JEA I;  1CSP A;  1VQ5 A;  4NXM Q;  2EQS A;  1P16 A;  1WFQ A;  3F8T A;  2JA8 G;  4JI1 L;  1SLJ A;  3J81 j;  1HNW Q;  1KHI A;  4P75 A;  1J5E Q;  2N3S A;  2N49 A;  3CAM A;  3H15 A;  4A3F H;  4HJA A;  1W2B A;  1MJE A;  4DR6 L;  3PV0 A;  1NE3 A;  4LUZ A;  4NXN L;  3GTP H;  4DV1 L;  3G71 A;  3J7A 5;  5IE8 A;  1XMQ Q;  4BBR G;  2NN6 I;  4HJ9 A;  2Y0S E;  5C0X J;  3PO2 G;  2JA5 H;  4JV5 Q;  5M3F H;  1CKM A;  1RIP A;  1D8L A;  1EQQ A;  2R93 H;  5BR8 L;  2Z0S A;  1L1O C;  2R92 H;  2JA7 H;  3L0O A;  4BA2 I;  1HZ9 A;  4IPC A;  2PQA A;  2ZJQ A;  3E0E A;  1BVS A;  2K75 A;  4NXN Q;  1YHQ A;  1W3S A;  3PSI A;  4WJ3 M;  4RMF A;  1YVC A;  1B8A A;  4PZ7 A;  3UE1 A;  2WB1 E;  4AYB E;  5C3E H;  3OTO Q;  2MQH A;  1X3F A;  3KJP A;  3FP9 A;  2R6G A;  3NEL A;  4EX5 A;  1KRS A;  4GNX B;  2JA6 H;  4LF4 Q;  2VQF Q;  5GQO A;  3CPW A;  4A3C G;  3GDE A;  2F52 A;  4PZ6 A;  2KEN A;  4JI3 L;  1FL0 A;  4Y52 H;  4A3K G;  1IL2 A;  3U4Z A;  4BBS G;  3UDI A;  3S1Q H;  2QEX A;  4QQB X;  1YHA A;  4UY8 C;  1IZ6 A;  3ER0 A;  4JI0 L;  4NPS A;  2A8V A;  5M3M H;  2NVT H;  1BBU A;  5IP9 G;  1FGU A;  5FJ8 H;  1HNW L;  2ZTC A;  1Q81 C;  2I0Q A;  3RN5 A;  4GN4 B;  4HIK A;  3CPF A;  4NXM L;  3IRB A;  2CCZ A;  1OTC A;  4DR5 Q;  1IBM Q;  2JA6 G;  2K5V A;  1D7Q A;  3A74 A;  3ULP A;  1VQG A;  1U0L A;  4DV3 Q;  1L1O B;  4LF4 L;  4YCW A;  5M5W H;  3H3V H;  4LF7 Q;  4OO1 I;  4DV1 Q;  5ELN A;  3RN2 A;  2ID0 A;  3S1R H;  1L2F A;  1X9N A;  2RF4 A;  4OXP A;  3OW2 A;  1N32 L;  1E1T A;  1G51 A;  1V1Q A;  3L2P A;  4DV0 L;  5GAD C;  2PQA B;  1XPO A;  2CKZ B;  3HKZ E;  2Q2T A;  1K73 C;  2UUB L;  3AQQ A;  3H0G G;  1VQO A;  4LF9 Q;  3KFU A;  1QUQ A;  2LXK A;  4X66 Q;  4AQY L;  3HKS A;  3S1N H;  3KF6 B;  4KI0 A;  3PUX A;  3HOV G;  4A3J H;  4A3L H;  3PCO B;  4PG3 A;  4GLX A;  4LF8 Q;  2D0P A;  4OWT B;  3KDF A;  2Q2U A;  4GOP B;  5IYC G;  1OXU A;  2E5L L;  1Y1V H;  1KIX A;  4A3D H;  5C0X G;  3TS0 A;  5GRO A;  1HH2 P;  1TWF H;  4BY1 H;  1VQE A;  4R4I A;  2OQK A;  3EIV A;  2AMC B;  1I94 Q;  2IHF A;  1YIJ A;  2PI2 E;  4JI4 L;  1C9O A;  1WOC A;  2KHJ A;  3AYH B;  1YJ9 A;  2OWO A;  2LXJ A;  5FJ8 G;  3MEF A;  3PUZ A;  5JJK A;  5AJ3 L;  4LF8 L;  2PI2 A;  2R7F A;  3JC6 6;  5IY0 A;  1VQ6 A;  4LFA L;  1WCM H;  2CWP A;  1XMO L;  1KL9 A;  5JJI A;  5GAG C;  4GN5 A;  2ALY B;  4MTN A;  3UDX A;  4O0A A;  2E8G A;  4GN3 B;  3DLL A;  1OXT A;  4DR2 Q;  1VQA A;  2R93 G;  4DR4 L;  1KRT A;  1EIY B;  2UUC Q;  2AHO B;  4LFB L;  1SRU A;  1NBW A;  4KLK A;  2YU9 H;  3GTG H;  4DR7 L;  1Y1W H;  3AEV A;  2VS1 A;  4OON A;  3TQY A;  5LMN L;  2E5L Q;  3B6Y A;  3BJU A;  4DV6 L;  3J7Z C;  2MO1 A;  4JBW A;  1ASZ A;  4B3T L;  4DV3 L;  4L5R C;  3CCL A;  2VQE Q;  4JG2 A;  2OTJ A;  4A3E H;  2MFI A;  4UPA A;  2YTY A;  1M1K C;  2JEB I;  4POG A;  1QVF A;  2YV5 A;  3E9I A;  3J81 c;  4DV4 Q;  4IPG A;  2GVB A;  3RLF A;  1DGS A;  4X66 L;  1HZC A;  1QZG A;  4JOI A;  1HR0 W;  1BKB A;  1EUJ A;  4X62 L;  3JAM c;  1PH7 A;  4DV0 Q;  3UDF A;  3GTQ H;  1KQS A;  1EIF A;  1R9T H;  1H95 A;  4FDB A;  4IO9 A;  3K80 C;  4BBR H;  2K52 A;  4DV2 L;  1PV4 A;  3PO3 H;  2VZA A;  4IJL A;  4LF6 Q;  2IT1 A;  4JI8 Q;  3CCR A;  1GVP A;  1YNX A;  4YY3 L;  4DR1 L;  2AWO A;  3I55 A;  1ASY A;  3G48 A;  4DR3 L;  1PA6 A;  3PUV A;  1JJG A;  1JT8 A;  1Q46 A;  4RG1 A;  2K50 A;  1K8G A;  1VQK A;  2EXD A;  3SGI A;  3W1B A;  1E1O A;  1G29 1;  1TWC H;  2N78 A;  3D0F A;  3GTO H;  4A75 A;  1CKN B;  2Z6K C;  3AFQ A;  3M4P A;  4R4Q A;  3CC7 A;  3ERS X;  2R7Z H;  2WB1 G;  4AYB G;  4X62 Q;  2AWN A;  5IWA Q;  1J6Q A;  1S72 A;  2IX1 A;  3PO3 G;  2OQ0 A;  1LM0 A;  1HNX L;  3FHW A;  5HGQ A;  1JB7 A;  4LUV A;  1I50 H;  2R7D A;  1MKH A;  1UE1 A;  3I4O A;  4HJ7 A;  2IY5 B;  1MJC A;  1V9P A;  2FXQ A;  2V1C C;  2NVX H;  2UXB L;  3RZD H;  3S1M H;  3GD7 A;  4C3I H; 
#chains in the Genus database with same CATH topology
 1A15 A;  5FKA C;  1VQ9 A;  3SK5 A;  1DYQ A;  1MSH A;  4JV5 L;  1VQM A;  4L5T A;  4OIJ A;  1PZK D;  4X3S A;  1CFM A;  2NZO A;  2OCE A;  1O7Y A;  3ERQ A;  3KJO A;  1N33 Q;  2MP1 A;  3NWT A;  5BR8 Q;  3FKI B;  4IUT A;  4DV4 L;  4K8J A;  2HHH Q;  1G8Z D;  3QOJ A;  1EZ6 A;  4LF5 Q;  1YZ6 A;  4IFD I;  3ULL A;  1CA6 A;  1Q7Y C;  5L37 A;  1LUZ A;  1NTG A;  1SE4 A;  3W1G A;  1YBY A;  4CJ2 C;  2E2I B;  1TS2 A;  1WTV A;  4X65 L;  2JP1 A;  2K05 A;  2PNH A;  1M90 C;  3HOU G;  4QJF A;  5F2D A;  5IYB H;  1K3R A;  1JWU D;  2DJF C;  2DJG C;  2QEJ C;  3FMC A;  3NEM A;  1VQD A;  2NZH A;  2HDM A;  5JEA H;  1KXL A;  1X65 A;  3LGJ A;  1NMG A;  1O80 A;  1WCM B;  1I6V C;  2F3I A;  5M5Y B;  2UUB Q;  2QKI C;  4LWC A;  1JIC A;  3K7U C;  3GTG B;  4JYA L;  1TY0 A;  1RCV D;  2WAQ E;  4DGZ A;  5IT9 c;  5C3X A;  1B70 B;  2PMZ E;  3NHH A;  2K01 A;  3GV6 A;  4K6D A;  5M3M G;  5E4W C;  5M3M B;  1TS3 A;  3CCJ A;  2O5I C;  4A3G H;  5FK9 C;  2HHH L;  2NVT B;  3VYS A;  2DUD A;  2LKV A;  2E2D C;  1S40 A;  2NVQ H;  3CW2 C;  3F2D A;  1STH A;  5IGB A;  2YTX A;  3J80 i;  5C3E G;  2A6E D;  2KCT A;  1C0A A;  3MXN B;  3PO3 B;  4RGN A;  5FOB B;  3M4O H;  2HIX A;  3PIO A;  5IP7 G;  1U5K A;  1EZ8 A;  3HOV H;  1XNR Q;  5J39 A;  3KLR A;  3M7N A;  4DV7 Q;  2LFN A;  2JA5 G;  2MGS A;  4HTH A;  3NTI A;  1PRT B;  1G6P A;  4R8I A;  3I72 A;  5C4X B;  1Z9F A;  2KBN A;  1YNN D;  2PW7 A;  2X69 A;  1QNU A;  2F0G A;  1JMC A;  1CTM A;  3N6R A;  3HOX G;  3I70 A;  3W3A A;  4DAY B;  4CDD C;  1JOO A;  4DUY Q;  1VQB A;  2RHS B;  5EBC A;  3SDZ A;  5IIF A;  3HOX H;  3MXP A;  1CHQ D;  1W6J A;  5D3D A;  5EPJ A;  1JR0 D;  4DR7 Q;  4QY7 A;  1XNQ L;  1PH4 A;  2NTS A;  2YTV A;  1EY9 A;  4AH6 A;  4JI7 Q;  4FXD A;  3GTK H;  1BCP C;  1O78 A;  1PH2 A;  3NBH A;  4DKA C;  4FYD A;  3MXN A;  1HNZ L;  1QVG A;  1VQ4 A;  2A1A A;  2F0M A;  1LTG D;  5FLM G;  1VMC A;  3KYH C;  1ENC A;  2D62 A;  1FR3 A;  2KED A;  2XWJ B;  3M85 A;  2AUK A;  4BA1 I;  1NY4 A;  3U9O A;  3BU2 A;  4A3E G;  3TRZ A;  4LNQ A;  3CF5 A;  4ZUI A;  2H1E A;  5T1I A;  3I4M H;  3A5U A;  3CCU A;  4P73 A;  1TS5 A;  2TMP A;  1NAP A;  5T1G A;  1U4L A;  3G7L A;  5GAE C;  2K5N A;  4JC0 A;  4PMW A;  2B2Y A;  1N9W A;  4U68 A;  2EPB A;  4DV5 L;  1MGS A;  2BCO A;  4GKK L;  4RGT A;  5FLX L;  1GKH A;  2KCN A;  4P2C B;  1I4P A;  5EPL A;  3T1Y Q;  3NTK A;  4CGY B;  2OEO A;  5CC4 A;  2EYJ A;  2DN8 A;  1P8L A;  4FP5 D;  5CR3 A;  5KNC A;  1VQC A;  3R3O A;  1XX8 A;  4IUV A;  5M9O A;  1BDO A;  1EY8 A;  1S4Z A;  5E4X A;  1Q1B A;  3Q22 A;  1VMP A;  4A3M H;  1D1I A;  5FLX E;  1B9M A;  1HXY D;  4R4T A;  3CC2 A;  1N34 L;  1GUO A;  2CQO A;  2IW3 A;  1QWY A;  2OTL A;  3BVM A;  4DV6 Q;  1XXG A;  2L9H A;  3QIA A;  1YI2 A;  4JK1 C;  1YHB A;  3KK7 A;  5JEA G;  2WFW A;  2F0S A;  3BYY B;  3HOZ G;  3OIQ A;  2F0D A;  3L3O C;  4N8F A;  3J80 E;  2VNU D;  4K5W A;  3TP7 A;  1EQR A;  2I46 A;  3NTH A;  4GNX C;  1GUN A;  4J8Q A;  1JJ2 A;  2C35 B;  3H94 A;  2F0K A;  4ME3 A;  1PXU A;  3T53 B;  4V0B A;  1DOK A;  2X6G A;  1GHJ A;  3HOU H;  2Q2H A;  3VA5 A;  4JI1 Q;  2BA0 A;  4EQP A;  5AFW A;  4TKO B;  1VQP A;  4LFB Q;  2EJF C;  2NZ1 D;  4P72 A;  1HRJ A;  1NCV A;  1Q3L A;  2C9O A;  1GUW A;  1HNZ Q;  3QO2 A;  4UAI A;  3S1N B;  1PTO H;  2VQE L;  4IN3 A;  1WYD A;  1SEB D;  1SXT A;  2NYZ D;  4HID A;  1A2T A;  1X3Q A;  3T1H L;  1PTO C;  1XNQ Q;  2K4K A;  1I94 L;  1PZI D;  4KJO A;  1A62 A;  1A2U A;  2XSC A;  2F0I A;  2WAQ G;  2QIL A;  2GN5 A;  5IYD G;  4LFA Q;  1PYB A;  3BDL A;  1AW7 A;  3KOJ A;  1HPC A;  4EQ5 A;  2RBM A;  1DXM A;  4JBJ A;  3TBI B;  1E7Z A;  2HUG A;  3DUZ A;  4MTK A;  2NVQ B;  4L5Q A;  4YIJ A;  3GTM B;  1X3E A;  1Y1W B;  3GTL B;  3J7Y W;  4UP9 A;  4ZK9 B;  1NJI C;  2WKC A;  1LYL A;  2XTI A;  1TR5 A;  1XYI A;  4A3B B;  3H3V I;  1VQH A;  3SK6 A;  4E6I A;  4J6H A;  2XNA C;  1EYA A;  4Q0F A;  3F8T A;  1P16 A;  1WFQ A;  3NBI A;  3A55 A;  1PDQ A;  4XDX A;  4NXN L;  3HOV B;  4N9T A;  4R9W A;  3T51 B;  4DV1 L;  3M4Y A;  1V1O A;  1ILQ A;  1EQQ A;  1B9N A;  4FF1 A;  3MXU A;  2R92 H;  5E3F A;  4IPC A;  1BVS A;  2K75 A;  2F0W A;  5EJW A;  5CYU A;  4Q5V A;  4AYB E;  3KJP A;  3KFU A;  3FP9 A;  3NEL A;  1KRS A;  5GQO A;  1G91 A;  1CQF A;  3MFG A;  5IOD A;  1RDP D;  2KEN A;  3I8Z A;  1FL0 A;  4JI3 L;  4Y52 H;  5DNF A;  3FVQ A;  3GTK B;  3LWU A;  3A7A B;  4NW2 A;  3UDI A;  2QEX A;  3ER0 A;  4NPS A;  1F9R A;  1HNW L;  4CKB A;  1ENA A;  5EKK A;  3RN5 A;  2I0Q A;  2Z9H A;  4NXM L;  2CCZ A;  4DR5 Q;  2K5V A;  3K59 A;  3A74 A;  1VQG A;  1U0L A;  4DV3 Q;  4LF4 L;  5M5W H;  4CJ1 B;  1I4H A;  4LF7 Q;  4DV1 Q;  3RN2 A;  3VR6 A;  3S2D B;  2RF4 A;  1HHV A;  3SHL A;  1E1T A;  4PNY A;  4EGV A;  4C3H B;  3HOW B;  1GUG A;  1SDF A;  2JYO A;  1ICF B;  3PUX A;  2EYP A;  2D0P A;  2E5L L;  5C0X G;  2O4X A;  1HH2 P;  4BY1 H;  3A56 A;  2IHF A;  1L0X B;  1YNN C;  1C9O A;  2VUM B;  2VB2 X;  4LFA L;  1WCM H;  4ABN A;  5JJI A;  4GN5 A;  1PRT D;  1D5M C;  1OXT A;  3VA7 A;  1QNK A;  1HFG A;  3GTG H;  5LL6 S;  4DR7 L;  2E5L Q;  3PQI A;  4AYB B;  1HQR D;  2MO1 A;  1ASZ A;  4CKE A;  1ONL A;  2EZV A;  4BBS B;  3CCL A;  2VQE Q;  2OTJ A;  4A3E H;  2JEB I;  4BS9 A;  2YV5 A;  3E9I A;  3J81 c;  1GOZ A;  3V05 A;  1HA5 A;  4ZUJ A;  4X62 L;  1AP0 A;  3UDF A;  1KQS A;  2EYF A;  1KNE A;  1H9M A;  3C1E A;  4HSV A;  1MSG A;  1STA A;  4MHE A;  2Z1C A;  4C3H G;  1QB5 D;  2IJ0 A;  4L6T B;  4IJL A;  2SNM A;  4DR1 L;  1ICW A;  1YNX A;  2AWO A;  3I55 A;  1ASY A;  2E2J B;  3PUV A;  3D8G A;  1JT8 A;  1Q46 A;  2PCF B;  2C5C A;  4LAA A;  2N78 A;  3D0F A;  2WB1 G;  5IWA Q;  2WV6 D;  3PO3 G;  3BVZ A;  5A35 A;  1JB7 A;  4LUV A;  3I4O A;  4HJ7 A;  4C1N K;  2FXQ A;  2UXB L;  2EXZ A;  3K0X A;  1QUQ B;  3S2H B;  4B3T Q;  4XT3 B;  2QF7 A;  3DXJ C;  3MFY A;  3DWP A;  3K8A A;  1K83 H;  4GOP A;  1S5E D;  2RDH A;  1EU3 A;  5IP9 H;  4Y7N B;  1CSQ A;  4KHP Q;  3W2D A;  5C5L A;  5J22 A;  2SNS A;  4QB4 A;  1L0W A;  2B2U A;  4KKS A;  4J1M A;  4PV1 C;  1HR0 L;  4ALP A;  1WI5 A;  2NN6 H;  1UE7 A;  1WD1 A;  5I9P A;  3FDT A;  2RSO A;  4V19 0;  2UXC Q;  2F0O A;  2ENB A;  2NB0 A;  3SVM A;  4JI5 Q;  5EAY A;  2PW5 A;  1SND A;  3KLS A;  3GTP B;  4C1N I;  4HIM A;  2N88 A;  2B63 G;  1B7Y B;  4M1U B;  3L9A X;  2RDF A;  3CRL C;  1SBB B;  3WDN A;  1XPU A;  1RTN A;  1N33 L;  4A76 A;  5EQ0 A;  1EFW A;  4L63 B;  1QIL A;  3PF4 A;  2HD3 A;  2IWH A;  4YCU A;  2A6H D;  2B2W A;  2ZJR A;  1YJN A;  2CWA A;  1KLU D;  2O2L D;  3U9S A;  1U4M A;  1E22 A;  1EYG A;  1Z7T A;  1W6K A;  2I5M X;  1U4P A;  2F4I A;  4OL7 A;  1JE4 A;  2MJ8 A;  2E74 C;  4R4C A;  1WVL A;  2K14 A;  1WJJ A;  4JPB W;  5CBA E;  1TWG B;  3HFZ B;  1Q8K A;  4FF2 A;  5KYI A;  4A3C H;  5M5W B;  1OO9 B;  1BO0 A;  2XRQ D;  1XNR L;  1SE3 A;  4FVM A;  2HDL A;  1EQT A;  3AB9 A;  5KIX A;  3NQI A;  2RKS A;  1TII D;  1LTS D;  4IPH A;  2I5H A;  3GTJ H;  1GXD C;  4LF6 L;  5JOB A;  4HMI A;  3UI2 A;  1PH8 A;  3AU7 A;  4R8N A;  3C1F A;  3A5Z B;  5M3F G;  1ZYR D;  1TWC B;  4KK7 A;  4I7Z C;  4FXK C;  4PMC A;  1ILP A;  1TWF B;  1V43 A;  2R61 A;  4ZYS A;  3TEH B;  1PFS A;  3OYY A;  2JA7 B;  1N34 Q;  3BZC A;  4RWS C;  1VQ7 A;  1PFM A;  3M4Q A;  3AFP A;  1G6Z A;  3K7A H;  1EU4 A;  2Q2I A;  2VL6 A;  1F77 A;  4DV2 Q;  2B63 H;  2F0J A;  3FKI G;  2EVB A;  3I4L A;  4HR7 B;  1PTO F;  2LS0 1;  3GQB A;  1Y8O B;  2YYZ A;  3IFD A;  4U67 3;  4X6A H;  1SNO A;  1EOV A;  2BA1 A;  5E7N A;  4A3G G;  4KHP L;  3VR3 A;  3K5L A;  1LTR D;  2JN4 A;  1XMO Q;  2B2T C;  1A63 A;  4DN4 M;  2EYL A;  4BBS H;  1STE A;  3IAY A;  4JBM A;  1LLR D;  2A69 D;  3ERO A;  3LX0 A;  1N8R C;  4BY7 H;  3DHQ A;  1DD2 A;  4KY5 A;  3P1H A;  4I65 A;  3JAM i;  3GTL H;  1IBK L;  2E2I H;  1X6O A;  2JQO A;  2BDO A;  3RLN A;  4H7B A;  4R4O A;  1Q82 C;  4QCL A;  4XIG S;  1N36 Q;  5I6W A;  2Z6K A;  1Y14 B;  2M2L A;  2FIN B;  1O7I A;  4RGM A;  2ZM6 L;  4RHS A;  1BUV T;  2B2V C;  1TWH H;  4R1J A;  1N32 Q;  5LMN W;  2G9D A;  4TVA B;  5A2Q E;  4DAM A;  4LF5 L;  5FO9 B;  2X6L A;  4L5S A;  5M3F B;  2NTT A;  5I6Y A;  4RH6 A;  2AUJ D;  2JJQ A;  3NEN A;  1SAP A;  5CV5 A;  1ESR A;  1Y1V G;  3P75 A;  2MPM A;  1J9O A;  2R92 G;  4KJN A;  3D6C A;  2B2T A;  3S1M B;  1STG A;  2K03 A;  1HCZ A;  2K5H A;  1GUS A;  3C3L A;  4JOI C;  1T5E A;  4YWL A;  3S2H H;  2ZTD A;  1TWA H;  1QCB D;  4A3G B;  3RLO A;  2BE5 D;  3KLW A;  3E6Z X;  5ELD A;  3K81 C;  3QJY A;  3OTO L;  5FLM H;  1L0Y B;  1QZH A;  1FNV A;  1H9S B;  4DR6 Q;  5IGE A;  4F8M A;  2CQA A;  3A7L A;  1LT5 D;  1EWI A;  3R93 A;  3M4O B;  1IYJ B;  5IT9 E;  3Q8D A;  1UE5 A;  2XGT A;  4NMZ A;  3S17 H;  2K5W A;  2QA4 A;  4ODG A;  1ML0 D;  5H1S E;  2UXD L;  5DLQ E;  3DM3 A;  1CT1 D;  4X3K A;  1J5E L;  1C8C A;  3KF8 B;  5C4Z A;  4IOA A;  1XJV A;  2F4V Q;  1PRT C;  4C3H H;  2EYO A;  4K5V A;  4J15 A;  3RZO H;  1VQL A;  5C4J H;  4ME5 A;  2B29 A;  2DNE A;  2E76 C;  1U4R A;  3ND9 A;  2K5Q A;  4ILW A;  2EE1 A;  1CKO A;  4YHH Q;  4JYA Q;  4S3S A;  3U4V A;  3HKZ G;  5DM6 3;  1V8Q A;  1FNW A;  1EEI D;  1A0I A;  2I5L X;  1N36 L;  2K6A A;  3K5O A;  3DMU A;  5HGT A;  1C48 A;  4JI5 L;  1CHP D;  2DGY A;  5K36 G;  2VUM G;  2EJG C;  2PNR C;  4GNX A;  1FYC A;  1EY0 A;  2K33 A;  1HUN A;  1LAC A;  5ELE A;  5G3L F;  3I4M B;  3W5O A;  2WP8 J;  3I4M G;  4WJ4 A;  3A8J E;  2VB3 X;  2L11 A;  1NR4 A;  4JI3 Q;  3H91 A;  4DR5 L;  2ASB A;  4PMB A;  4CDF C;  1VQ5 A;  4NXM Q;  1BOS A;  2EQS A;  2F0P A;  2JA8 G;  1HNW Q;  1KHI A;  3C46 A;  3GTQ B;  2N49 A;  1C4Q A;  4HJA A;  1W2B A;  3PV0 A;  1AEX A;  3WOF A;  1F2M A;  1XMQ Q;  5C0X J;  1I4Q A;  5COY A;  4K2K A;  4DNR B;  1D8L A;  4DFA A;  5M5X B;  5BR8 L;  2Z0S A;  2KEE A;  2JA7 H;  1LO5 D;  1HZ9 A;  1YNJ D;  1UAP A;  4FXG C;  3H09 A;  3TP6 A;  4ZQ3 A;  4NXN Q;  1HA6 A;  1DOM A;  4WJ3 M;  4RMF A;  3RMH A;  3JAM L;  2V4D A;  4PZ7 A;  2B63 B;  3UE1 A;  1DM0 B;  1RHP A;  1EEF D;  2F0Q A;  3CPW A;  4A3C G;  3AMU A;  1Y69 U;  3BZD B;  2L4N A;  2KOL A;  1IL2 A;  1PFN A;  3U4Z A;  3S1Q H;  2F0E A;  5CV7 A;  4C56 C;  4QQB X;  4UY8 C;  5EPK A;  4JI0 L;  2EDG A;  1BBU A;  1QE6 A;  3P7J A;  1FGU A;  5FJ8 H;  4A93 B;  2B2Y C;  1HUM A;  3KBX A;  1PLF A;  1F2Y A;  4HIK A;  1VF7 A;  5CBE E;  1HFN A;  1EY4 A;  1JWS D;  1A6X A;  1JB3 A;  1QG7 A;  2GA4 B;  4FF4 A;  5ELN A;  5EKI A;  3M3Y B;  1L2F A;  1X9N A;  3R8B A;  4OXP A;  3VYR A;  3L2P A;  5GAD C;  1XPO A;  2CKZ B;  1K73 C;  3H0G G;  1VQO A;  4LF9 Q;  2LXK A;  4X66 Q;  1NUC A;  2RVL A;  1UUP A;  3KF6 B;  2EY1 A;  1H9R A;  4A3L H;  1AN8 A;  2J4X A;  3PCO B;  4KKT A;  2Q2U A;  5IYC G;  2E2H B;  4R4I A;  1LT4 D;  1I94 Q;  1I3Q B;  4JI4 L;  1YJ9 A;  2LXJ A;  3CQZ B;  2R7F A;  1KL9 A;  4DR2 Q;  4LFB L;  1EIY B;  2AHO B;  2RQX A;  1SRU A;  1NBW A;  2CHB D;  1JQY D;  4KLK A;  2YU9 H;  1Y1W H;  3VYU A;  4OON A;  5LMN L;  2NVY B;  1E2V A;  2WB1 B;  3BJU A;  3ND8 A;  4B08 A;  4JBW A;  4DV6 L;  2EJM A;  2F0U A;  4N9P A;  4DV3 L;  3D4R A;  1SSO A;  4JG2 A;  2KA7 A;  2M00 A;  1WTX A;  1I6H H;  1B44 D;  1DGS A;  1HR0 W;  4JOI A;  1I4X A;  3KBG A;  2D2C C;  1EUJ A;  1PH7 A;  4DV0 Q;  1PZJ D;  1EIF A;  1H95 A;  4FDB A;  4IO9 A;  3K80 C;  5CV6 A;  1B1Z A;  3P20 A;  3NP8 A;  3H6M A;  3S16 B;  3I90 A;  1SFO B;  4YY3 L;  1VDZ A;  4DR3 L;  1QJO A;  3MA2 B;  4DXG A;  2L5T A;  1K8G A;  2K50 A;  4HN7 A;  1E2W A;  1E1O A;  1G29 1;  1TWC H;  3TP5 A;  2QCP X;  4A75 A;  2R7Z H;  3AFQ A;  4R4Q A;  3ERS X;  4AYB G;  2AWN A;  1S72 A;  1J6Q A;  2WIN B;  2IY5 B;  4XXE A;  1MJC A;  1F9P A;  3GD7 A;  5ELO A;  1GM5 A;  5JVG 3;  3NE5 B;  4A3B G;  5K36 H;  3E3X A;  4B3S Q;  2HQL A;  2A73 B;  3I4N H;  1S3O A;  2ES2 A;  4GKK Q;  4DV5 Q;  4B3R L;  2BE5 C;  3S14 B;  4DR1 Q;  1JOQ A;  5J1Z A;  3E9H A;  4QGU A;  3VR4 A;  5CV9 A;  1VQF A;  5EKL A;  3LWE A;  2FMC A;  3S1R B;  5IGD A;  1UWV A;  3CCV A;  2J0T D;  1BF4 A;  3H0G H;  4YHH L;  4NB3 A;  1Q12 A;  3STB C;  4OHJ A;  2EOT A;  1LTB D;  3EVQ A;  3NQT A;  4KN4 C;  4QMG A;  3PF5 A;  3K5M A;  3ICE A;  2A74 C;  3OW7 A;  3HOU B;  1EYD A;  5IYC H;  3DM1 A;  4JVZ A;  4F7X A;  1IL8 A;  1X3G A;  2R93 B;  2G5D A;  4DNI A;  5I4D A;  1TWH B;  3T16 A;  4FO2 A;  4KY6 A;  1CM9 A;  4GLV B;  5JJZ A;  1PH9 A;  3OHX C;  3HOZ H;  4LFC L;  4JI2 Q;  1RKN A;  2PQE A;  5D14 A;  4B3R Q;  4AIM A;  1KNA A;  2ATW A;  4A3I H;  2VQF L;  3M9B A;  4X64 L;  3F2C A;  1V1P A;  4O2D A;  4GKJ L;  4FF3 A;  4ULL A;  2F03 A;  4IUQ A;  2AQ2 B;  3WWV A;  3MEH A;  3K57 A;  4H02 A;  1JOR A;  1ZKO A;  4DAY A;  5KEE A;  4DNT B;  1TWA B;  1OXX K;  1DON A;  1MBY A;  2IHE A;  3U50 C;  3A8K E;  1CKN A;  1SJH D;  4JBK A;  4GLA C;  1GD7 A;  2A6E C;  1CUK A;  1SYC A;  2F1M A;  4YWK A;  3V96 A;  4TQU S;  1NNX A;  3BS1 A;  1HZA A;  5JJL A;  2PZT A;  4IFD H;  4B3S L;  4DXF A;  1VQI A;  3VDY A;  1VQ8 A;  1LT3 D;  3I7F A;  2CVR A;  5K5P A;  1LT6 D;  3MHB A;  3I4N G;  1XTC D;  4K14 A;  5KGU A;  1ENF A;  2M9V A;  4FNF A;  2E2J H;  4C3J G;  2EY2 A;  4A3F B;  5IOC A;  4A3J B;  1H9J A;  4KD4 A;  2BH8 A;  3F2B A;  3SK4 A;  3F1Z A;  4LW1 A;  4C3J H;  4A3K H;  2JA5 B;  5JPN C;  1X3P A;  2ZM6 Q;  2E2H H;  5I2X A;  1I50 B;  2B39 A;  1UNS A;  3CCQ A;  1LAB A;  4MN3 A;  3I73 A;  1E3P A;  1R4Q B;  2K04 A;  5C4J B;  2E75 C;  1U9R A;  1PH5 A;  1IBK Q;  4KKU A;  2JA6 B;  4C3I G;  2RHQ B;  1K83 B;  2JA9 A;  3ZYY X;  3QWN A;  3CME A;  3TS2 A;  2CH4 W;  2IX0 A;  3CP0 A;  1Z6H A;  3E5S A;  4MZ9 A;  1KAA A;  4NKL A;  3CMA A;  5IT9 L;  1X56 A;  4JI4 Q;  5LMN Q;  4CDC C;  3RR5 A;  3HOW G;  1BBW A;  4BXX G;  3TRE A;  5CV4 A;  3MTS A;  3EA6 A;  1S5B D;  4GKJ Q;  5TSS A;  4G7H C;  4X64 Q;  1K8M A;  4DF7 A;  2L15 A;  1E24 A;  3S15 B;  1R9T B;  1SN8 A;  5IGC A;  3J80 c;  1B2T A;  2H4O A;  3J7A F;  3S2D H;  1BXT A;  1AE3 A;  4N8X 1;  3HOY G;  4EQN A;  3S16 H;  1EWH A;  4OIK A;  3BG3 A;  3OPO A;  4UHV A;  2GVA A;  2UU9 L;  1RL2 A;  4RKB A;  3HEJ A;  5C4X G;  1I4R A;  4K8I A;  5ELB A;  4DUY L;  2AQ3 B;  3J81 E;  3NK9 A;  1VCI A;  1ROD A;  1EOT A;  5FO7 B;  4IUR A;  2ICE C;  2ZXO A;  3QG1 A;  1TQO A;  2NN6 G;  4P71 A;  5M5X H;  1SNP A;  3TN2 A;  3URY A;  1HNX Q;  4DK1 A;  4L8J A;  4A4I A;  2NVX B;  3FPU B;  4RGO S;  4K5X A;  4C3I B;  3ONA B;  1E0B A;  3OOC A;  1K0R A;  4DV7 L;  2WAQ B;  3CCM A;  1FNU A;  3O13 A;  4PZ8 A;  4DK3 C;  3OMG A;  2B2U C;  2JK8 A;  3FKI H;  1JCK B;  2B8G A;  3S14 H;  2HCI A;  4EVO A;  3DEO A;  1KD1 C;  1ET9 A;  2O5J C;  4X3U A;  3Q6S A;  4JI0 Q;  1M4V A;  2UU9 Q;  4A3E B;  2F0H A;  3D3R A;  3I56 A;  1SNQ A;  4YCV A;  1STB A;  2B2V A;  2D0O A;  2R7Z G;  5BN3 A;  2HT1 A;  3D6W A;  1SYG A;  5HUR A;  1CZW A;  2BOS A;  1EY7 A;  4KHZ A;  3HS0 C;  2OF1 A;  1JWM D;  1PYS B;  2JSO A;  4JCV E;  3T13 A;  2IL8 A;  1YJW A;  4GZY C;  1O7Z A;  4KD3 A;  1II3 A;  3PUW A;  4UDU C;  4DR3 Q;  3PO2 B;  1FJG L;  2LMC B;  3ULJ A;  1D5X C;  4WJW A;  3MAQ A;  1HJP A;  4O42 A;  4CJ0 B;  4YY3 Q;  2ICI A;  3STB D;  1DOL A;  2A68 D;  3EBE A;  1XMQ L;  1GJX A;  1T9H A;  3NUC A;  2B3G A;  3G4S A;  2JA8 B;  4B9W A;  1FD7 D;  3HRZ C;  4APV A;  3HOY H;  1G2S A;  3PIP A;  2KJX A;  5KNB A;  1HR0 Q;  1PFB A;  5CMD A;  3L7Z C;  1L1O A;  3T4A C;  5BN5 A;  2ZT9 C;  3RZD B;  1HZB A;  5KYL A;  5C0X H;  4X65 Q;  2JXM B;  3CCE A;  1TY2 A;  3K6O A;  1PYW D;  5NUC A;  2KQ3 A;  4OWW B;  4BY7 B;  1BBX C;  4WRD A;  1WTR A;  1SYB A;  4K2L A;  1LTT D;  1JC7 A;  1WCM G;  4Y7N H;  2NVY H;  3LNN A;  3UDG A;  2MO0 A;  1UE6 A;  2VW9 A;  1I6H B;  4QUF A;  2F4V L;  3KUP A;  2JEA I;  1CSP A;  4HSP A;  3NWS A;  4RKL A;  1SLJ A;  1MJE A;  2N3S A;  3H15 A;  4A3F H;  4LUZ A;  3GTP H;  1IYU A;  1SYF A;  3J7A 5;  5IE8 A;  3TZU A;  4HJ9 A;  3PO2 G;  4JV5 Q;  2Y0S E;  3V2T A;  2JA5 H;  2PYK A;  5M3F H;  1CKM A;  1RIP A;  3MC0 B;  4IAL A;  4HED A;  1TVX A;  3DWQ A;  4XT1 B;  1CQV A;  2ZJQ A;  4B9X A;  1W3S A;  3A54 A;  1YVC A;  1B8A A;  5D3I B;  5C3E H;  3OTO Q;  1X3F A;  2A68 C;  2R6G A;  3HP3 A;  4IQZ A;  4DK0 A;  2JA6 H;  2VQF Q;  3GDE A;  2F52 A;  4PZ6 A;  3KF8 A;  2Z8L A;  3EQL C;  1D1K A;  1H9K A;  4A3K G;  2R3Z A;  4BBS G;  1YHA A;  1STY A;  2Q8T A;  2A8V A;  1R4P B;  4XQQ A;  1K0S A;  5IP9 G;  1Q81 C;  4GN4 B;  3WOE A;  3CPF A;  1IBM Q;  2JA6 G;  1D7Q A;  1X32 A;  3ULP A;  2F3V A;  3SK8 A;  1L1O B;  1SYD A;  3H3V H;  4OO1 I;  4DAP A;  3S17 B;  1SYE A;  2ID0 A;  4CBV A;  3S1R H;  3M7G A;  1N32 L;  4ID6 A;  1G51 A;  3E0J A;  3IKJ A;  1CZG A;  2PQA B;  2UUB L;  3AQQ A;  3QB3 A;  3X3M A;  4AQY L;  5IGF A;  3HOV G;  4PG3 A;  4GLX A;  4OWT B;  4OEL B;  4QUC A;  5I9O A;  4GOP B;  3OWE B;  1OXU A;  1B53 A;  3GP7 A;  1Y1V H;  3VYT A;  3TS0 A;  1TWF H;  2OQK A;  4KTA A;  1AZQ A;  4F87 A;  1TU2 B;  1WOC A;  3AYH B;  2KHJ A;  3CU7 A;  4C2M B;  3K0Y A;  5CGK A;  5FJ8 G;  3MEF A;  4A3M B;  3PUZ A;  1PTO D;  5AJ3 L;  4LF8 L;  4QF4 A;  2PI2 A;  3JC6 6;  3R2I A;  5IY0 A;  5C44 B;  1SMY D;  3CHB D;  3SXH A;  1VQ6 A;  1TS4 A;  2OT2 A;  2CWP A;  2VXW A;  5GAG C;  2EYM A;  4O0A A;  1DZ1 A;  4GN3 B;  1TKW B;  2R93 G;  1VQA A;  4DR4 L;  1KRT A;  2UUC Q;  3OIP A;  4IZ8 A;  1WD0 A;  3TQY A;  3B6Y A;  4B3T L;  3PIO 3;  4L5R C;  1B50 A;  4ZRZ A;  4DV4 Q;  1RTO A;  2GVB A;  1SMY C;  1HZC A;  4RA8 A;  3FEW X;  1QZG A;  1KAB A;  1BKB A;  1EIG A;  3GTQ H;  2XVS A;  3K58 A;  2NBF A;  2Y0S B;  4I7A A;  2XRS D;  2WII B;  5E1F A;  4BBR H;  4BWG B;  4DV2 L;  1PV4 A;  3PO3 H;  1I4G A;  4LF6 Q;  3CCR A;  2K1B A;  1NSN S;  3HKZ B;  1IW7 C;  2DY8 A;  1JJG A;  1PTO B;  2F0V A;  3GV3 A;  4RG1 A;  2DNC A;  4DAV A;  4G7Z C;  3SGI A;  4C3J B;  3M4P A;  5BN4 A;  1AZP A;  4X62 Q;  2IX1 A;  3HOY B;  2OQ0 A;  1HQM C;  3FHW A;  1I50 H;  3QR8 A;  1UE1 A;  4ZAI A;  3RZD H;  3S1M H;  5I2Y A;  1A8V A;  2BDN A;  2SOB A;  3S1Q B;  3QOL A;  3MWY W;  1IHZ A;  1MIU A;  3HOX B;  5C6A A;  1JJC B;  2KHI A;  1D5Z C;  4IPD A;  5JEA J;  4ZKC B;  2Z4H A;  3PUY A;  3NXW A;  2DY7 A;  3GTM H;  1I5F A;  4ZCK A;  4POF A;  1AH9 A;  1BCP F;  3EJI A;  4JI8 L;  4K0K L;  4RCN A;  1S5F D;  2ZXR A;  3J80 L;  1KDA A;  2FJ2 A;  3M3Y H;  4B3M Q;  3BZK A;  4KV6 A;  5IP7 H;  5FLX c;  4H13 C;  2ZJP A;  3KLS X;  3ITP A;  1K28 A;  4JI6 L;  1PH1 A;  3ZJY C;  4JW0 A;  2VY3 A;  4ZLT F;  4BY7 G;  2P5Z X;  2Y0S G;  4IFD G;  1RJT A;  4DK6 C;  3I2Z A;  1Y1W G;  4KMU C;  1KLG D;  1PH6 A;  1Q86 C;  4A3I G;  1UEB A;  2JA7 G;  1BCP D;  4OX9 Q;  5G3L D;  5LMU Q;  2UUA L;  3A0J A;  2Q8I B;  3NBH B;  4K6L A;  1I3Q H;  5KRU A;  1IYV A;  1EQV A;  2KUM A;  4LJZ C;  4KY7 A;  2RSN A;  1TXY A;  4XQN A;  3H3V C;  1FVI A;  5IYB G;  1Z47 A;  2B8F A;  4IOC A;  1SMX A;  1SNC A;  1Q90 A;  2YU9 B;  1X54 A;  4G7O C;  2N55 A;  4OEM B;  4RAU C;  2A69 C;  2L12 A;  2RCN A;  1EIH A;  3S9W A;  2CW0 D;  3PGZ A;  2MNA A;  2QDL A;  4RCO A;  1C7Y A;  1PVO A;  2UXB Q;  1BQQ T;  4QIW B;  3SEB A;  1FJG Q;  1JOK A;  2J7Z A;  2D9U A;  5C0X I;  5LL6 X;  1AFP A;  4DPG A;  1VS0 A;  1D6E C;  2ZXP A;  5A2Q L;  1VQN A;  1K9M C;  2FHT A;  1SE8 A;  4KHV A;  1BCP B;  5LHY 1;  2RDG A;  1ZYR C;  5DEH A;  4BXX H;  3G6E A;  4P74 A;  3MZ5 A;  3T56 B;  2QGQ A;  3TME A;  4XYQ A;  4A3L G;  3CD6 A;  2PO4 A;  3NPP A;  2TSS A;  2R7Z B;  1KC8 C;  1HTP A;  3RD4 A;  5ISR A;  2F0F A;  1ESF A;  1Y1V B;  5HY6 A;  1KTK A;  3FRP B;  3PO2 H;  3RUZ A;  1K8A C;  4DUZ Q;  2VUM H;  2KHS A;  4A93 G;  4LK1 C;  2G9H D;  1GHK A;  5C44 H;  1OXS C;  1TT2 A;  4JI6 Q;  2JA8 H;  4IFD J;  4OX9 L;  2L0C A;  4DU9 A;  2F3W A;  4TRD A;  4DR2 L;  1ET6 A;  2PPB C;  1T5X D;  1NMF A;  4QL5 A;  4JI2 L;  1WTW A;  2LSS A;  3CKI B;  2EIF A;  4WFN 3;  4LFC Q;  4K0K Q;  4HJ5 A;  2CH4 A;  4G4K A;  5IGG A;  1XPR A;  1YIT A;  1EFI D;  4HIO A;  4A3F G;  2BH2 A;  1IBL Q;  4JI7 L;  3BYT B;  4A93 H;  2PZW A;  3I3C A;  1GUT A;  5GAH C;  1STN A;  1F2Z A;  4H0L C;  3UE0 A;  2UXD Q;  4KN7 C;  1NR2 A;  1V1P B;  1ZEQ X;  1IBL L;  1EY6 A;  2I07 B;  3DEP A;  1DJR D;  4A3B H;  3PIP 3;  3BDC A;  4OGQ C;  4OO1 G;  4CKC A;  1SE2 A;  1PHJ A;  1H9S A;  1D2B A;  1YEZ A;  2RA4 A;  3MVV A;  3X3N A;  4LF9 L;  4UP8 A;  5EGT A;  4OO1 H;  3JAM E;  1WTQ A;  2K28 A;  3R2T A;  2EYH A;  3BDO A;  3HOZ B;  4F88 A;  4OWX B;  4DUZ L;  2K32 A;  2NWG A;  4BY1 G;  4A3D B;  4XYO A;  4A3D G;  5M5Y H;  2UXC L;  2R92 B;  2Z6B A;  2MUY A;  4UP7 A;  5EBD A;  1EYC A;  1B4O A;  1Q8I A;  1BNZ A;  1RD9 D;  2WKD A;  4MNO A;  4HCS A;  2QDB A;  1EL0 A;  2NUC A;  4HCE A;  5J3B A;  3CQZ H;  2KCC A;  2IPK D;  5C3E B;  1LTI D;  4LF7 L;  1KDB A;  1ZXT A;  1F9Q A;  5C3W A;  1S5C D;  3J81 i;  2KVM A;  2AKW B;  4Z9C B;  5DAU A;  4H44 C;  5JVH 3;  1O7L A;  2F0L A;  1IKL A;  2OXP A;  3K5N A;  1X55 A;  3EFX D;  3U58 A;  4IUN A;  2JE6 I;  3D4W A;  4A3J G;  2ZTE A;  3CXC A;  1OXV A;  3SR1 A;  4GS3 A;  3TSS A;  5IYD H;  3CCS A;  2K5D A;  3D31 A;  4LUO A;  4RHR A;  4X3T A;  1PMR A;  4XTC S;  1PH3 A;  1LTL A;  2HIV A;  3GO5 A;  3HGB A;  3G6J B;  4NDX A;  5AJ3 Q;  5IWA L;  3S24 A;  3EN2 A;  4IUP A;  1XTD A;  1GO3 E;  4RFB A;  3T1Y L;  1G2T A;  1B3A A;  1MD2 D;  2UUC L;  5C4X H;  4XQJ A;  1SFO H;  4DR4 Q;  1IXR A;  1Q1E A;  1E2Z A;  3OWF A;  3HOW H;  4GOP C;  1HTL D;  1SRO A;  1VQJ A;  3Q24 A;  4AQY Q;  2RCF A;  3GTO B;  5LMU L;  2UUA Q;  1QOH A;  1MHW C;  3VR5 A;  1AE2 A;  4BY1 B;  1F9S A;  1JE5 A;  4QIW E;  4YWM A;  4C2M H;  1LV9 A;  2N8N A;  2A6H C;  2PMZ B;  2K7V A;  2EY5 A;  3DWA A;  1KAW A;  2CFM A;  2A19 A;  3FPP A;  1IW7 D;  2F0T A;  2D5D A;  3I4N B;  3RNU A;  2KCM A;  3NSW A;  4IJH A;  1TWG H;  3D4D A;  4B3M L;  3KF6 A;  1WTO A;  1B3Q A;  4HJ8 A;  3T1H Q;  1UEA B;  3OSO A;  3S15 H;  4C3I H;  3HG9 A;  3CC4 A;  2H5X A;  4O1N A;  3KDF B;  4A3M G;  1QVC A;  5C44 G;  4TSS A;  3PMF A;  1SR3 A;  1IBM L;  3IFT A;  3GTJ B;  3H0G B;  5DM7 3;  4JI1 L;  3J81 j;  4P75 A;  1J5E Q;  3CAM A;  1CI3 M;  1SNM A;  2XWB B;  4DR6 L;  1NE3 A;  2FMM A;  1EWC A;  1M8A A;  4EQO A;  3G71 A;  4BBR B;  1VF5 C;  2NN6 I;  4BBR G;  4CDE C;  3F2U A;  5ELC A;  4WOR A;  3MXG A;  2R93 H;  4NP5 A;  3VR2 A;  1L1O C;  3L0O A;  4BA2 I;  2PQA A;  3E0E A;  2EY6 A;  1YHQ A;  3K7A B;  3PSI A;  2KEC A;  4DA2 A;  1BR9 A;  5JAV A;  3TDQ A;  3C2P A;  2WB1 E;  2MQH A;  4HAE A;  4GNX B;  4EX5 A;  4LF4 Q;  2WAC A;  4A3I B;  3TP8 A;  1DCZ A;  4HMJ A;  4LMQ D;  1LTA D;  2Q8R E;  1CK1 A;  2B2W C;  2MHV A;  3HZX A;  2Z4I A;  1IZ6 A;  4G57 A;  5M3M H;  2NVT H;  3TZD A;  2ZTC A;  3SE0 A;  3IRB A;  1OTC A;  2AQ1 B;  2SDF A;  5COR A;  4YCW A;  1CA5 A;  3Q0A A;  2CW0 C;  5D65 A;  4IUU A;  3OW2 A;  4DV0 L;  1V1Q A;  3CRK C;  3HKZ E;  2Q2T A;  1PRT F;  1YNJ C;  1RF2 D;  1QUQ A;  3HKS A;  3S1N H;  4ZKB B;  5FO8 B;  4KI0 A;  2XIW A;  2F0N A;  4A3J H;  4LF8 Q;  1WTH A;  2XN9 C;  4A3K B;  3KDF A;  1A3V A;  1KDC A;  5C4H A;  2LY7 A;  3J7A V;  1KIX A;  4A3D H;  5GRO A;  1VQE A;  3EIV A;  1K3B C;  2AMC B;  2PZU A;  1YIJ A;  1F2L A;  2PI2 E;  2OWO A;  1A3T A;  3A8I E;  2L1B A;  5JJK A;  1WTP A;  1XMO L;  1K8O A;  2ALY B;  4MTN A;  4PQX A;  3UDX A;  1Y8P B;  3Q23 A;  3IL8 A;  2E8G A;  3DLL A;  3AEV A;  2VS1 A;  5C5M A;  3J7Z C;  2A5H A;  5CV8 A;  3BVG A;  2MFI A;  4UPA A;  2YTY A;  1M1K C;  4POG A;  1QVF A;  4IPG A;  3RLF A;  4X66 L;  4MIU A;  1Y8N B;  5KND A;  3JAM c;  1A3U A;  2L55 A;  1R9T H;  2HQE A;  1IKM A;  1XWE A;  1SJE D;  2K52 A;  1J8I A;  2VZA A;  1EY5 A;  2IT1 A;  4JI8 Q;  1GVP A;  4CHT B;  1FGB D;  1MI2 A;  3G48 A;  1PA6 A;  3RZO B;  2HCC A;  5JPM C;  3J81 L;  2QW7 A;  3N52 A;  2IX3 A;  1VQK A;  2EXD A;  3W1B A;  3GTO H;  1S5D D;  1CKN B;  2Z6K C;  3CC7 A;  5ELF A;  1LM0 A;  1HNX L;  5HGQ A;  2R7D A;  4M8A A;  1MKH A;  2SEB D;  2FFK B;  1V9P A;  3I91 A;  2V1C C;  2NVX H;  3OMC A; 
#chains in the Genus database with same CATH homology
 3K0X A;  5ELO A;  1GM5 A;  1VQ9 A;  1QUQ B;  1A8V A;  4JV5 L;  1VQM A;  4A3B G;  4L5T A;  4B3T Q;  4B3S Q;  1MIU A;  2NZO A;  2OCE A;  1JJC B;  3KJO A;  1N33 Q;  2KHI A;  2HQL A;  3K8A A;  1K83 H;  4GOP A;  4IPD A;  3I4N H;  5JEA J;  1S3O A;  3PUY A;  2ES2 A;  4GKK Q;  4DV5 Q;  4B3R L;  5BR8 Q;  1I5F A;  3GTM H;  4POF A;  4DV4 L;  1AH9 A;  5IP9 H;  4JI8 L;  4DR1 Q;  4K0K L;  2HHH Q;  3E9H A;  4QGU A;  1CSQ A;  4KHP Q;  1VQF A;  4LF5 Q;  1YZ6 A;  4IFD I;  3ULL A;  3M3Y H;  1UWV A;  3BZK A;  1L0W A;  5IP7 H;  5FLX c;  2ZJP A;  3CCV A;  1Q7Y C;  1LUZ A;  1HR0 L;  1NTG A;  4ALP A;  3W1G A;  1WI5 A;  3H0G H;  4YHH L;  1UE7 A;  1YBY A;  4NB3 A;  1Q12 A;  3STB C;  4JI6 L;  1PH1 A;  2UXC Q;  3ZJY C;  2VY3 A;  4JI5 Q;  3PF5 A;  5EAY A;  4X65 L;  4BY7 G;  3ICE A;  2PNH A;  2Y0S G;  4HIM A;  2B63 G;  1M90 C;  1B7Y B;  4IFD G;  5IYC H;  3HOU G;  4QJF A;  4DK6 C;  3I2Z A;  1Y1W G;  1PH6 A;  1Q86 C;  5IYB H;  4A3I G;  1UEB A;  1X3G A;  2JA7 G;  1XPU A;  1K3R A;  4DNI A;  4OX9 Q;  5LMU Q;  2UUA L;  1N33 L;  3A0J A;  4A76 A;  1EFW A;  3NBH B;  1I3Q H;  3NEM A;  3PF4 A;  3HOZ H;  4GLV B;  1PH9 A;  1VQD A;  2NZH A;  4YCU A;  4LFC L;  1X65 A;  3LGJ A;  4B3M Q;  1NMG A;  1TXY A;  1KXL A;  4JI2 Q;  2ZJR A;  1YJN A;  2CWA A;  4B3R Q;  4AIM A;  2ATW A;  2F3I A;  1FVI A;  5IYB G;  1Z47 A;  2VQF L;  4IOC A;  4A3I H;  3M9B A;  2UUB Q;  1E22 A;  4X64 L;  1SMX A;  1EYG A;  3F2C A;  4LWC A;  4O2D A;  3K7U C;  4GKJ L;  4JYA L;  1X54 A;  2I5M X;  2WAQ E;  3WWV A;  5IT9 c;  1B70 B;  4H02 A;  2PMZ E;  2RCN A;  5M3M G;  1OXX K;  3PGZ A;  2MNA A;  3CCJ A;  4R4C A;  2IHE A;  1C7Y A;  2HHH L;  4A3G H;  1PVO A;  2K14 A;  3U50 C;  2UXB Q;  1WJJ A;  1CKN A;  4JBK A;  1FJG Q;  2DUD A;  4GLA C;  5C0X I;  1GD7 A;  1S40 A;  1CUK A;  2NVQ H;  3HFZ B;  4YWK A;  1Q8K A;  3CW2 C;  4TQU S;  3F2D A;  1HZA A;  4DPG A;  4A3C H;  5JJL A;  1VS0 A;  4B3S L;  1XNR L;  1VQI A;  3VDY A;  2YTX A;  1VQ8 A;  3J80 i;  5C3E G;  1K9M C;  1VQN A;  3I7F A;  1SE8 A;  2KCT A;  1C0A A;  3MXN B;  3I4N G;  4IPH A;  2I5H A;  3GTJ H;  4LF6 L;  3M4O H;  4BXX H;  2HIX A;  3G6E A;  1PH8 A;  4P74 A;  2E2J H;  3PIO A;  2QGQ A;  1U5K A;  5IP7 G;  3HOV H;  1XNR Q;  3CD6 A;  3M7N A;  4A3L G;  4DV7 Q;  3A5Z B;  5M3F G;  2BH8 A;  3F2B A;  2JA5 G;  4A3K H;  3F1Z A;  4LW1 A;  4C3J H;  1KC8 C;  1G6P A;  2ZM6 Q;  1Z9F A;  2KBN A;  5HY6 A;  1V43 A;  2E2H H;  3TEH B;  1PFS A;  3OYY A;  3PO2 H;  1N34 Q;  3BZC A;  1JMC A;  1K8A C;  1VQ7 A;  3M4Q A;  3AFP A;  3HOX G;  3CCQ A;  4DUZ Q;  2VUM H;  4DAY B;  1E3P A;  3K7A H;  4A93 G;  4DUY Q;  2Q2I A;  2VL6 A;  4DV2 Q;  1VQB A;  2B63 H;  2RHS B;  1PH5 A;  5C44 H;  1OXS C;  1IBK Q;  4JI6 Q;  3FKI G;  2JA8 H;  3HOX H;  4IFD J;  2RHQ B;  2JA9 A;  4DR7 Q;  4OX9 L;  4QY7 A;  2YYZ A;  4X6A H;  1XNQ L;  3CME A;  1PH4 A;  3TS2 A;  2YTV A;  4AH6 A;  4DR2 L;  4JI7 Q;  2IX0 A;  1EOV A;  2BA1 A;  3CP0 A;  4MZ9 A;  5E7N A;  3GTK H;  4A3G G;  1NMF A;  4KHP L;  4QL5 A;  4JI2 L;  1PH2 A;  1A63 A;  1XMO Q;  2LSS A;  3CMA A;  2EIF A;  4LFC Q;  1X56 A;  4K0K Q;  4HJ5 A;  1XPR A;  4DKA C;  4BBS H;  1YIT A;  4JBM A;  1HNZ L;  4HIO A;  1VQ4 A;  4A3F G;  2A1A A;  1QVG A;  4JI4 Q;  2BH2 A;  5LMN Q;  1IBL Q;  4JI7 L;  5FLM G;  3KYH C;  4A93 H;  3RR5 A;  3HOW G;  2D62 A;  1BBW A;  1N8R C;  3M85 A;  5GAH C;  4BY7 H;  4BXX G;  3TRE A;  4BA1 I;  1NY4 A;  4GKJ Q;  3UE0 A;  2UXD Q;  3BU2 A;  3JAM i;  4A3E G;  4X64 Q;  3TRZ A;  3GTL H;  1IBK L;  2E2I H;  4LNQ A;  1X6O A;  3CF5 A;  2L15 A;  1E24 A;  1IBL L;  2JQO A;  3RLN A;  1SN8 A;  3A5U A;  4R4O A;  3CCU A;  3I4M H;  3J80 c;  4P73 A;  4A3B H;  1Q82 C;  5GAE C;  2K5N A;  4XIG S;  4JC0 A;  3S2D H;  4PMW A;  4OO1 G;  1PHJ A;  1AE3 A;  1N36 Q;  1YEZ A;  1N9W A;  2Z6K A;  3HOY G;  1Y14 B;  4DV5 L;  3S16 H;  1O7I A;  4GKK L;  2ZM6 L;  4LF9 L;  4UP8 A;  1GKH A;  4R1J A;  1TWH H;  1N32 Q;  2GVA A;  2UU9 L;  1RL2 A;  5LMN W;  4TVA B;  4DAM A;  3T1Y Q;  5C4X G;  4LF5 L;  4DUY L;  1P8L A;  4L5S A;  4OWX B;  4DUZ L;  1VCI A;  1VQC A;  4BY1 G;  2JJQ A;  3NEN A;  4A3D G;  2NN6 G;  5M5X H;  1Y1V G;  4P71 A;  5M5Y H;  2UXC L;  1HNX Q;  2R92 G;  4UP7 A;  1Q1B A;  4A4I A;  4MNO A;  2K5H A;  4A3M H;  4JOI C;  4YWL A;  5J3B A;  3S2H H;  3CQZ H;  2ZTD A;  1K0R A;  4DV7 L;  4LF7 L;  1TWA H;  3CCM A;  4PZ8 A;  3RLO A;  4DK3 C;  4R4T A;  3CC2 A;  3J81 i;  3KLW A;  1N34 L;  2JK8 A;  2AKW B;  2CQO A;  3FKI H;  3K81 C;  3S14 H;  3OTO L;  2OTL A;  5FLM H;  1KD1 C;  1X55 A;  4DV6 Q;  3U58 A;  1QZH A;  2JE6 I;  4A3J G;  4JI0 Q;  4DR6 Q;  2ZTE A;  3CXC A;  1OXV A;  2UU9 Q;  1YI2 A;  4GS3 A;  1YHB A;  5JEA G;  2WFW A;  5IYD H;  3CCS A;  3I56 A;  3D31 A;  4LUO A;  4YCV A;  3HOZ G;  4XTC S;  1PH3 A;  2VNU D;  1LTL A;  1EWI A;  2D0O A;  2HIV A;  3GO5 A;  1EQR A;  1IYJ B;  4GNX C;  1JJ2 A;  2C35 B;  2R7Z G;  2HT1 A;  3Q8D A;  4ME3 A;  5AJ3 Q;  1UE5 A;  5IWA L;  2XGT A;  3S24 A;  3EN2 A;  4KHZ A;  1XTD A;  3HOU H;  1GO3 E;  3S17 H;  2Q2H A;  1PYS B;  2QA4 A;  5H1S E;  3T1Y L;  2UXD L;  5DLQ E;  4JI1 Q;  2BA0 A;  3DM3 A;  4JCV E;  1YJW A;  1J5E L;  2UUC L;  5C4X H;  3KF8 B;  1VQP A;  1SFO H;  4DR4 Q;  4LFB Q;  1IXR A;  3PUW A;  4P72 A;  4IOA A;  4DR3 Q;  1XJV A;  2F4V Q;  1Q1E A;  1FJG L;  1HNZ Q;  3ULJ A;  4C3H H;  3HOW H;  1HJP A;  4J15 A;  4YY3 Q;  4GOP C;  1VQL A;  3RZO H;  2VQE L;  1SRO A;  1VQJ A;  1WYD A;  3STB D;  3EBE A;  5C4J H;  2B29 A;  4AQY Q;  4HID A;  1XMQ L;  1T9H A;  2B3G A;  3G4S A;  3T1H L;  1XNQ Q;  2K4K A;  5LMU L;  2UUA Q;  4APV A;  1I94 L;  3HOY H;  1CKO A;  3PIP A;  1AE2 A;  4YHH Q;  4JYA Q;  1A62 A;  3U4V A;  3HKZ G;  1HR0 Q;  1JE5 A;  1I6H H;  3L7Z C;  2WAQ G;  1L1O A;  4QIW E;  4YWM A;  1A0I A;  2GN5 A;  2I5L X;  4C2M H;  1HZB A;  5IYD G;  1N36 L;  2N8N A;  4LFA Q;  1PYB A;  4X65 Q;  4JI5 L;  1KAW A;  2DGY A;  3KOJ A;  2CFM A;  5K36 G;  3CCE A;  2A19 A;  4EQ5 A;  2VUM G;  4JBJ A;  3RNU A;  4OWW B;  4GNX A;  1E7Z A;  2KCM A;  4IJH A;  1TWG H;  4L5Q A;  4B3M L;  3KF6 A;  1X3E A;  1WCM G;  4HJ8 A;  3T1H Q;  4UP9 A;  4Y7N H;  1NJI C;  3S15 H;  3CC4 A;  2NVY H;  2H5X A;  3KDF B;  1LYL A;  2WP8 J;  2XTI A;  3W5O A;  3UDG A;  4A3M G;  3I4M G;  4WJ4 A;  1QVC A;  2MO0 A;  1VQH A;  3H3V I;  1UE6 A;  2VW9 A;  5C44 G;  4JI3 Q;  1SR3 A;  2F4V L;  4DR5 L;  1IBM L;  2ASB A;  2JEA I;  1CSP A;  1VQ5 A;  4NXM Q;  2EQS A;  1P16 A;  1WFQ A;  3F8T A;  2JA8 G;  4JI1 L;  1SLJ A;  3J81 j;  1HNW Q;  1KHI A;  4P75 A;  1J5E Q;  2N3S A;  2N49 A;  3CAM A;  3H15 A;  4A3F H;  4HJA A;  1W2B A;  1MJE A;  4DR6 L;  3PV0 A;  1NE3 A;  4LUZ A;  4NXN L;  3GTP H;  4DV1 L;  3G71 A;  3J7A 5;  5IE8 A;  1XMQ Q;  4BBR G;  2NN6 I;  4HJ9 A;  2Y0S E;  5C0X J;  3PO2 G;  2JA5 H;  4JV5 Q;  5M3F H;  1CKM A;  1RIP A;  1D8L A;  1EQQ A;  2R93 H;  5BR8 L;  2Z0S A;  1L1O C;  2R92 H;  2JA7 H;  3L0O A;  4BA2 I;  1HZ9 A;  4IPC A;  2PQA A;  2ZJQ A;  3E0E A;  1BVS A;  2K75 A;  4NXN Q;  1YHQ A;  1W3S A;  3PSI A;  4WJ3 M;  4RMF A;  1YVC A;  1B8A A;  4PZ7 A;  3UE1 A;  2WB1 E;  4AYB E;  5C3E H;  3OTO Q;  2MQH A;  1X3F A;  3KJP A;  3FP9 A;  2R6G A;  3NEL A;  4EX5 A;  1KRS A;  4GNX B;  2JA6 H;  4LF4 Q;  2VQF Q;  5GQO A;  3CPW A;  4A3C G;  3GDE A;  2F52 A;  4PZ6 A;  2KEN A;  4JI3 L;  1FL0 A;  4Y52 H;  4A3K G;  1IL2 A;  3U4Z A;  4BBS G;  3UDI A;  3S1Q H;  2QEX A;  4QQB X;  1YHA A;  4UY8 C;  1IZ6 A;  3ER0 A;  4JI0 L;  4NPS A;  2A8V A;  5M3M H;  2NVT H;  1BBU A;  5IP9 G;  1FGU A;  5FJ8 H;  1HNW L;  2ZTC A;  1Q81 C;  2I0Q A;  3RN5 A;  4GN4 B;  4HIK A;  3CPF A;  4NXM L;  3IRB A;  2CCZ A;  1OTC A;  4DR5 Q;  1IBM Q;  2JA6 G;  2K5V A;  1D7Q A;  3A74 A;  3ULP A;  1VQG A;  1U0L A;  4DV3 Q;  1L1O B;  4LF4 L;  4YCW A;  5M5W H;  3H3V H;  4LF7 Q;  4OO1 I;  4DV1 Q;  5ELN A;  3RN2 A;  2ID0 A;  3S1R H;  1L2F A;  1X9N A;  2RF4 A;  4OXP A;  3OW2 A;  1N32 L;  1E1T A;  1G51 A;  1V1Q A;  3L2P A;  4DV0 L;  5GAD C;  2PQA B;  1XPO A;  2CKZ B;  3HKZ E;  2Q2T A;  1K73 C;  2UUB L;  3AQQ A;  3H0G G;  1VQO A;  4LF9 Q;  3KFU A;  1QUQ A;  2LXK A;  4X66 Q;  4AQY L;  3HKS A;  3S1N H;  3KF6 B;  4KI0 A;  3PUX A;  3HOV G;  4A3J H;  4A3L H;  3PCO B;  4PG3 A;  4GLX A;  4LF8 Q;  2D0P A;  4OWT B;  3KDF A;  2Q2U A;  4GOP B;  5IYC G;  1OXU A;  2E5L L;  1Y1V H;  1KIX A;  4A3D H;  5C0X G;  3TS0 A;  5GRO A;  1HH2 P;  1TWF H;  4BY1 H;  1VQE A;  4R4I A;  2OQK A;  3EIV A;  2AMC B;  1I94 Q;  2IHF A;  1YIJ A;  2PI2 E;  4JI4 L;  1C9O A;  1WOC A;  2KHJ A;  3AYH B;  1YJ9 A;  2OWO A;  2LXJ A;  5FJ8 G;  3MEF A;  3PUZ A;  5JJK A;  5AJ3 L;  4LF8 L;  2PI2 A;  2R7F A;  3JC6 6;  5IY0 A;  1VQ6 A;  4LFA L;  1WCM H;  2CWP A;  1XMO L;  1KL9 A;  5JJI A;  5GAG C;  4GN5 A;  2ALY B;  4MTN A;  3UDX A;  4O0A A;  2E8G A;  4GN3 B;  3DLL A;  1OXT A;  4DR2 Q;  1VQA A;  2R93 G;  4DR4 L;  1KRT A;  1EIY B;  2UUC Q;  2AHO B;  4LFB L;  1SRU A;  1NBW A;  4KLK A;  2YU9 H;  3GTG H;  4DR7 L;  1Y1W H;  3AEV A;  2VS1 A;  4OON A;  3TQY A;  5LMN L;  2E5L Q;  3B6Y A;  3BJU A;  4DV6 L;  3J7Z C;  2MO1 A;  4JBW A;  1ASZ A;  4B3T L;  4DV3 L;  4L5R C;  3CCL A;  2VQE Q;  4JG2 A;  2OTJ A;  4A3E H;  2MFI A;  4UPA A;  2YTY A;  1M1K C;  2JEB I;  4POG A;  1QVF A;  2YV5 A;  3E9I A;  3J81 c;  4DV4 Q;  4IPG A;  2GVB A;  3RLF A;  1DGS A;  4X66 L;  1HZC A;  1QZG A;  4JOI A;  1HR0 W;  1BKB A;  1EUJ A;  4X62 L;  3JAM c;  1PH7 A;  4DV0 Q;  3UDF A;  3GTQ H;  1KQS A;  1EIF A;  1R9T H;  1H95 A;  4FDB A;  4IO9 A;  3K80 C;  4BBR H;  2K52 A;  4DV2 L;  1PV4 A;  3PO3 H;  2VZA A;  4IJL A;  4LF6 Q;  2IT1 A;  4JI8 Q;  3CCR A;  1GVP A;  1YNX A;  4YY3 L;  4DR1 L;  2AWO A;  3I55 A;  1ASY A;  3G48 A;  4DR3 L;  1PA6 A;  3PUV A;  1JJG A;  1JT8 A;  1Q46 A;  4RG1 A;  2K50 A;  1K8G A;  1VQK A;  2EXD A;  3SGI A;  3W1B A;  1E1O A;  1G29 1;  1TWC H;  2N78 A;  3D0F A;  3GTO H;  4A75 A;  1CKN B;  2Z6K C;  3AFQ A;  3M4P A;  4R4Q A;  3CC7 A;  3ERS X;  2R7Z H;  2WB1 G;  4AYB G;  4X62 Q;  2AWN A;  5IWA Q;  1J6Q A;  1S72 A;  2IX1 A;  3PO3 G;  2OQ0 A;  1LM0 A;  1HNX L;  3FHW A;  5HGQ A;  1JB7 A;  4LUV A;  1I50 H;  2R7D A;  1MKH A;  1UE1 A;  3I4O A;  4HJ7 A;  2IY5 B;  1MJC A;  1V9P A;  2FXQ A;  2V1C C;  2NVX H;  2UXB L;  3RZD H;  3S1M H;  3GD7 A;  4C3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...