3WOFA

Crystal structure of p23-45 gp39 (6-132) bound to thermus thermophilus rna polymerase beta-flap domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
129
Chain Sequence
GPIHIERYEIEARDTKLGPERITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIVVRTVRLRRGDPGVELKPGVREVVRVYVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit beta
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 26
structure length 129
sequence length 129
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.150 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3wofA00
2A6HC 2LY7A 3GTKB 3H0GB 1I3QB 3I4MB 3GTLB 3I4NB 4A3BB 2R93B 2A68C 3GTQB 1I50B 2NVXB 1SMYC 4BBRB 4A3DB 4C3JB 1WCMB 3RZDB 4A3FB 4BY1B 3TBIB 4KN4C 3PO3B 1YNJC 3HOYB 4G7OC 1TWHB 3M3YB 4A3IB 1YNNC 3GTOB 4A3JB 4KMUC 2BE5C 4C3IB 5C4JB 2R7ZB 4AYBB 3S15B 4KN7C 2JA7B 3S1MB 1I6HB 2PMZB 4BY7B 4A3KB 4A3MB 2E2HB 2NVYB 2WB1B 2CW0C 2NVQB 3S14B 1TWCB 3EQLC 2JA8B 5C44B 3HOVB 3M4OB 4G7HC 4A93B 4A3EB 1I6VC 3FKIB 3WOEA 1Y1WB 2JA6B 3HOWB 4A3GB 4C3HB 3K7AB 2E2IB 1R9TB 4BBSB 3S16B 2B63B 3S2DB 2E2JB 5C4XB 3HKZB 1TWFB 3RZOB 2R92B 4LK1C 3PO2B 5M3FB 5M5WB 2A6EC 3GTPB 3S2HB 3S17B 3HOZB 4GZYC 3H3VC 2Y0SB 4G7ZC 2A69C 2PPBC 5M5YB 4QIWB 3HOUB 3S1NB 1Y1VB 3WOFA 3S1RB 2O5JC 1TWAB 2JA5B 5M5XB 1K83B 2YU9B 3GTMB 2WAQB 2NVTB 5C3EB 4Y7NB 2VUMB 4LJZC 2O5IC 1IW7C 1SFOB 4C2MB 1ZYRC 3S1QB 3DXJC 3HOXB 1HQMC 4JK1C 1TWGB 5M3MB 3GTGB 3CQZB 3GTJB
chains in the Genus database with same CATH superfamily
2K52A 4A3LG 4DNTB 2B2YC 2A68C 3QJYA 1QG7A 4A3DB 2C35B 1C9OA 1GUOA 1JCKB 2EVBA 2WAQE 1RD9D 2JSOA 3FMCA 4DAYA 4C3JH 1EWIA 2D2CC 3A5UA 1Z7TA 1HPCA 1HNWL 1N36Q 4JVZA 1TQOA 2ZT9C 4IQZA 4C3IB 3KJOA 1HRJA 4AYBB 4JW0A 3E3XA 1JMCA 2O4XA 4K5XA 1WOCA 4BY7B 4A3KB 3W1GA 1VQFA 2TSSA 3CRLC 4RGMA 5ISRA 1OO9B 3DWQA 3T4AC 1TS4A 2A68D 5COYA 1HNXQ 5ELFA 2Q8IB 3AB9A 4ILWA 2VQFL 4FXDA 1RODA 2BOSA 1P16A 2M00A 1E7ZA 3OPOA 2L0CA 1HNWQ 1RTOA 3NENA 4JC0A 1K73C 3L9AX 3OTOL 2SNMA 4IN3A 1F2YA 1VQLA 4MHEA 1BDOA 2IHEA 1JC7A 3JAME 2IHFA 3CCVA 1SE3A 1RCVD 2EYMA 2I5LX 4H0LC 5EJWA 2JA8G 4NXNL 1Y1VB 3WOFA 2HCCA 4PG3A 3EIVA 4EX5A 4A3EG 2VQFQ 4BA1I 5KGUA 1AEXA 1W6KA 1KNEA 2EYFA 3KFUA 3GTJH 4NP5A 3PF4A 1XTCD 5EPJA 3H0GH 1VQ4A 2ICIA 4HAEA 5J22A 4Y7NB 4KJOA 3F1ZA 3OTOQ 2VB3X 3GTQH 2D0OA 2A8VA 4I7AA 5C4XG 2NVTH 2EQSA 1IW7D 2QF7A 1D2BA 4HR7B 2G9DA 5C3WA 5JOBA 2K05A 3D4RA 5IYCH 1GJXA 3CQZB 1VCIA 4DR6L 4FF1A 2A6HC 2L12A 1U4RA 3K8AA 5CMDA 4NXNQ 1KDAA 2WFWA 4YWKA 5M3MH 1NR4A 1S40A 1M90C 3I4MB 1GUNA 3SR1A 2KQ3A 3NQIA 2NVXB 5NUCA 3ULPA 1U4MA 4I7ZC 4CDCC 3PMFA 1UE6A 4A3FB 3IRBA 3KYHC 1W2BA 5G3LD 2F0GA 1O7LA 1EU4A 1YNNC 1K8GA 2EOTA 3FEWX 4NDXA 4ID6A 5E3FA 5LHY1 1BOSA 1O7YA 2DJFC 4R8IA 3HOXG 3U50C 5FLMG 2JJQA 1SE4A 4A3MB 5EAYA 2RDGA 2CW0C 2N55A 4DR6Q 2A6HD 2E2JH 4EQPA 5IOCA 1NCVA 1YEZA 4R4IA 3DM3A 3M4OB 3S2HH 4MN3A 4CKCA 4J8QA 1F9SA 2DN8A 4BBRG 3HOZH 3PUYA 2WAQG 4X64L 1KC8C 1EIGA 1CHPD 1IYVA 2E8GA 2QKIC 2V1CC 2SOBA 3J81i 1E3PA 4LF7L 2OEOA 4RGNA 1V43A 1QILA 3KLSA 1ASZA 2CW0D 1OTCA 2NB0A 3CU7A 5BN4A 2RCFA 1VQCA 1JQYD 3MWYW 3S1NB 2PQEA 1WTPA 4A93G 1MGSA 5D3DA 4X64Q 1K83B 3PO2H 3R2TA 2CQOA 1TWAH 4GN5A 1GO3E 3E6ZX 3MA2B 3KBXA 3VR3A 1PYSB 2B2VA 3IL8A 5FOBB 4GNXB 3GTLH 4CJ0B 1ICFB 4H44C 3STBC 1VQ5A 1HZBA 3I73A 4MNOA 5JPNC 3BYYB 4LF7Q 1BBXC 4HSVA 5IODA 4IALA 1SYDA 3NELA 4K0KQ 1I4XA 5IT9E 5E1FA 3CC2A 2EY6A 5GAGC 4A3JH 1X3FA 1I4PA 4DNIA 3J7A5 2EJMA 2R7ZH 3MTSA 3S15H 2ALYB 1IL2A 1K8AC 1GUGA 4X3KA 1LLRD 1YI2A 1VQAA 3QO2A 5JVH3 2BCOA 1RKNA 4FXGC 5EQ0A 3KBGA 4PZ7A 1E2WA 5LMNQ 4K8JA 5I4DA 3QOLA 1PRTB 3T1HL 4DV1Q 2NZ1D 5FLXL 2VY3A 4BXXH 4KI0A 1TY0A 3FKIH 3FPUB 1JT8A 1SNOA 1X3GA 2WACA 5FO7B 1D6EC 3I72A 3J81E 2E2HB 2E2IH 1NTGA 2NVQB 5T1IA 5C6AA 1DOKA 2C5CA 2K32A 3S14B 1JB7A 3EQLC 2JQOA 3CD6A 5I2XA 5IP7H 4ZK9B 3IFDA 1JWUD 4GN4B 1VQ6A 1BXTA 4IO9A 5IP9H 1OXXK 4RGOS 4LF4L 3WOEA 3CAMA 3F2BA 1HUNA 5K36H 3K6OA 4ZRZA 4JBMA 5I6YA 4DK0A 2QDBA 5CV5A 3T1HQ 1U5KA 2XTIA 1B1ZA 5E4WC 4QL5A 4KKSA 2K75A 3M4YA 4N9TA 4H02A 2F0QA 4PNYA 5HURA 2AWNA 2A6EC 1JJ2A 4IFDG 2F0VA 4N9PA 2B3GA 2JA9A 3OYYA 3G71A 3FHWA 2BH8A 2V4DA 5GADC 1Z9FA 2D9UA 2A69C 1NY4A 4IUUA 1ET9A 2QA4A 4JI0L 3J7ZC 2ICEC 5AFWA 2YYZA 3RD4A 4IPGA 1Y1VH 3R2IA 1QUQB 1A2TA 1UNSA 2PNRC 4LMQD 2D62A 1Q90A 3M7NA 2ZTEA 3PIOA 2B2VC 4JPBW 4DV0L 4YHHL 3QR8A 3I4NH 2EYHA 5EKKA 3R93A 2VUMB 3GV6A 1I50H 2B8FA 1YJWA 2N49A 3MXGA 3C46A 3HKZG 4LWCA 1ZKOA 2A6ED 1JE4A 1GHJA 1NUCA 1LT4D 2PQAA 3TP6A 3SE0A 1WD0A 3HOYH 3PO3H 5EKLA 1EYCA 2A69D 2LY7A 4CKEA 3SDZA 2FINB 4JI0Q 1I3QB 4F8MA 3CQZH 2JA7H 1TS3A 3GO5A 1Q8IA 2XWJB 5CBAE 1LT6D 2KBNA 4TKOB 5I2YA 2QEXA 2F4VQ 2JA5G 2Z6BA 4HJ7A 2ZJPA 4BY1B 2I07B 4DV0Q 3ERQA 2B63G 3TBIB 3A7LA 3T16A 1YNJC 1FJGL 1H9KA 1XYIA 2IX1A 5M3FG 4YY3L 1EYAA 2L1BA 5C0XJ 1L0YB 2UXCL 1LO5D 1XPUA 2MPMA 3K57A 2PMZB 4A3GH 1AP0A 4B08A 3OW7A 2B2UA 3IFTA 3L0OA 3RN5A 4YCWA 1Q46A 1YBYA 3LWEA 1HR0W 4B3TL 5FKAC 1B44D 3MVVA 3EA6A 3AMUA 3M4OH 2RQXA 3SK6A 1UAPA 3H3VI 1CK1A 1H9SB 1FJGQ 1CSQA 2PO4A 2MNAA 2CKZB 5CBEE 4YY3Q 4NB3A 1DONA 4JOIC 4XIGS 1CKNB 1HZCA 4KK7A 2UXCQ 3Q8DA 4POGA 4DN4M 1UEBA 2F0OA 3CCRA 1AW7A 3E5SA 5C3EH 3CPFA 4ZKCB 4LUZA 2F0EA 5DM73 4HIKA 5C44G 1WTHA 3GDEA 2HUGA 3DWPA 1DCZA 3GTGH 2KEDA 4WORA 1QE6A 1RJTA 1SR3A 4A3CG 5DAUA 2RHQB 1NR2A 2CCZA 1KDCA 1H9JA 4X66L 4A3BH 4LFCL 2PW7A 3DWAA 2HCIA 4CGYB 1CKOA 4WFN3 4DV7Q 4DR7Q 3GP7A 1F2MA 1WCMH 3MC0B 2RF4A 3VR4A 2F0SA 3BYTB 2ATWA 1UE7A 1A3UA 2G5DA 4RHSA 1HQMC 4CDDC 1TWHH 2K33A 4Q0FA 2D5DA 4KJNA 4GOPC 3GTJB 3I91A 2HIXA 1VQMA 3H0GB 3M4PA 4PMCA 1LTRD 1K3RA 2K6AA 3AU7A 4M8AA 3GTQB 2NVYH 3D8GA 5GAEC 1B70B 4N8FA 5KYIA 3NE5B 1XMQL 4EQOA 1BCPF 1VDZA 2HQEA 5FLXE 1JOOA 3J7AV 2RCNA 3HEJA 4X66Q 2JA6H 1MBYA 1Y1WH 1GVPA 1MSGA 1T5XD 2LXJA 2B2UC 1F9PA 4BBSH 1S3OA 2ES2A 3KF8A 5IYBH 1B8AA 1LT5D 4K2KA 3S14H 2I5MX 2CHBD 1Q81C 4NMZA 1K28A 1ML0D 5CV4A 1XMQQ 1I94L 3U9SA 2GVBA 1X3PA 3LX0A 4ME5A 3HOUH 4QF4A 3MXUA 1LUZA 2LXKA 2MJ8A 4PMWA 3PIO3 4IPCA 2E2JB 1HJPA 1JJGA 4DR2L 4IJHA 1KABA 3I3CA 2K4KA 3TEHB 3ZJYC 1MSHA 2YU9H 2ZM6L 4UPAA 4JI3L 3MFYA 1JOQA 3UDFA 3S2HB 2FMMA 4XTCS 2F3VA 2F52A 4DK1A 3GV3A 3HS0C 4AIMA 3HOZB 2NTTA 3ND8A 2Y0SB 1B7YB 1CA6A 3DUZA 2A1AA 4IPHA 1A62A 4R4CA 3OWEB 2O5JC 1UUPA 2JYOA 2PNHA 3HFZB 2KENA 1PTOF 3NUCA 1NJIC 4RCOA 2KA7A 3HOWG 3GTKH 1B3AA 4HIOA 2L15A 2JP1A 2WAQB 3V96A 4OO1G 1E22A 1Q1BA 3BVMA 3I55A 4DR2Q 1QVGA 3L2PA 1XNRL 3PV0A 1ZYRC 2ZM6Q 3V05A 4JI3Q 2ID0A 1X56A 1IBMQ 2E75C 1E0BA 4AH6A 1PYWD 1F2LA 3UE1A 2IWHA 3PO2B 1LTTD 5IY0A 1ONLA 3ZYYX 1B50A 1FR3A 3BDLA 3CHBD 3GTLB 1BR9A 3A7AB 1QWYA 1TS2A 1NBWA 3QG1A 4QGUA 3DEOA 5AJ3L 1I3QH 5JEAH 1KAAA 3Q22A 2QCPX 2B2TA 4R4QA 5LL6S 4CJ2C 2OQ0A 3W5OA 3M9BA 5LL6X 3CMAA 3Q23A 1Z6HA 4DAYB 1SNDA 1Q8KA 5CV7A 4JBWA 5IYDG 2Q2TA 1SYEA 2H1EA 4LF6Q 4A3JB 1PXUA 1EOTA 1XNRQ 1PYBA 1PA6A 2R7ZB 2K5HA 4LUVA 3S15B 4G57A 4DUYQ 1X3EA 3Q24A 5L37A 1FYCA 1F2ZA 1EU3A 2EYOA 2HT1A 1IZ6A 4CHTB 1N34L 1QCBD 1KD1C 2R93G 1RL2A 5J39A 3FKIB 2HDMA 2EY5A 4DV6L 1SNQA 5I9PA 4K8IA 4A3LH 4JYAL 5M5YH 3TMEA 3KLSX 2BH2A 2E2IB 3EJIA 1MIUA 4KLKA 2WKCA 4A3IG 1EY0A 1GUWA 5J3BA 4LUOA 2RSNA 4DK6C 4ZYSA 2Z6KC 1I4GA 1S5FD 4RMFA 3NPPA 2YTYA 2OQKA 2K03A 1T9HA 3CMEA 3QOJA 4GN3B 3K59A 3K0YA 1GUSA 1EFID 1EIFA 1V1PB 1K0RA 1N34Q 2RVLA 4EQNA 4P2CB 2TMPA 4DV6Q 4F7XA 5JAVA 4JYAQ 5FLXc 4P72A 4A75A 4TVAB 1VQIA 1B9NA 4S3SA 4IOAA 4C3HG 1BQQT 1GUTA 1KHIA 2MQHA 1GOZA 1IW7C 5EBCA 2XNAC 5IGCA 5EPLA 1STNA 2F0UA 1KIXA 2B39A 1EY9A 2Z0SA 1EWCA 1MI2A 4DV2L 4XDXA 3AEVA 4JK1C 4OHJA 3M3YH 3GTOH 3AFQA 1D1IA 3TP7A 3D4DA 5HGTA 3I4NB 2B2TC 1I50B 4IUNA 1SXTA 3ICEA 4X3SA 1SMYC 2PZWA 1IBKL 4X62L 1J8IA 2ZJQA 1BBWA 2JA8H 1HXYD 3PO3B 3TN2A 2ZJRA 2N3SA 3HOYB 3NXWA 4A3EH 1SLJA 1CT1D 2IX3A 2UUAL 1HR0L 1AZPA 2LSSA 4HJ8A 1PVOA 4CKBA 2Z4IA 4DV2Q 2JA7B 4AYBE 2F0TA 1TVXA 4X3UA 2AMCB 3HZXA 2UUBL 1X65A 1DGSA 3HGBA 2LS01 4DF7A 3GD7A 5C4XH 3K5MA 3P75A 1SNMA 2EXZA 1HZAA 4G4KA 1YHQA 2K04A 3KJPA 2LKVA 4XQJA 4BWGB 1SMYD 1YJNA 2L11A 4X62Q 1IBKQ 4Q5VA 4PMBA 2F03A 4X3TA 3G6EA 4A3GB 2HDLA 2VW9A 1PTOD 3CRKC 4R9WA 1EEFD 2XSCA 1A2UA 3MZ5A 3H15A 1I4HA 2UXDL 2B63B 1CZWA 3BZCA 1LTBD 3NBHA 2UUAQ 1HR0Q 1WTVA 5M3FB 5DEHA 4B3ML 3GTMH 3LNNA 1DD2A 3FRPB 1HCZA 4OIJA 4GS3A 5KNCA 3PCOB 4U68A 4ZAIA 5D3IB 3J80L 2KEEA 3N6RA 4B3RL 4QIWB 3HOXH 1JB3A 2F0DA 2K5WA 4M1UB 3TQYA 4F87A 5FLMH 4LFBL 2LMCB 4O1NA 3HOVG 5ELOA 1EIYB 1F77A 5FO9B 1WTXA 2EJFC 2KCCA 4LNQA 4IFDI 4JI1L 3H91A 4R1JA 5C3EB 4LW1A 3HKZE 2UXDQ 3TP8A 3MXNB 1L1OB 4BBRH 3IKJA 1B2TA 2NZHA 3S1QB 2J0TD 2K5VA 2RKSA 4B3MQ 4BA2I 4JBKA 4HCSA 5CV8A 2VL6A 1N8RC 3GTGB 3T51B 1NMGA 4HEDA 2P5ZX 1V1OA 1VQ8A 4LFBQ 1GHKA 4ABNA 4POFA 4A3BB 1E24A 3H09A 2AUJD 2R3ZA 2RBMA 3PUXA 2MHVA 1WCMB 1XXGA 2MUYA 3EROA 1TWCH 2WKDA 4DR1L 4JI1Q 4RAUC 3SHLA 2R92G 1YHAA 2EYJA 1TWHB 2RDHA 4A93H 3BVZA 4JI2L 2HQLA 4HSPA 2G9HD 3GQBA 3PUZA 1X54A 1X32A 1YIJA 2NVYB 1VQ9A 5BR8L 1NMFA 3VA5A 1TWFH 4L6TB 3RLFA 1H9MA 1YZ6A 3LGJA 1DOLA 2GA4B 2JXMB 4DV3L 4B3SL 4ZQ3A 1PH5A 1ENFA 1IKMA 2JA6B 1Y1WB 4A3DG 3SK4A 3KOJA 1CHQD 3E0JA 3KK7A 1QNKA 5IWAL 1PHJA 1PRTF 3CCSA 4GLVB 5T1GA 4DAMA 4BBSB 4IUPA 4JI2Q 3AQQA 2XRSD 4C3IG 5DNFA 4AYBG 1G91A 4ODGA 2DGYA 1KRTA 1G6PA 3BS1A 4BY7G 4A3KG 2IX0A 4QJFA 3K58A 3H6MA 2KHIA 4HJAA 2PPBC 2EY2A 3HOUB 2F0FA 3JC66 4DV3Q 2E2DC 4B3SQ 2OCEA 1TWGH 3T53B 3PSIA 1DXMA 2EJGC 2E5LL 2YU9B 1PLFA 5IWAQ 1J6QA 1L0XB 2F0WA 1V1QA 4HIMA 4XQNA 2F3WA 1ASYA 2PQAB 1AFPA 1SNCA 1VQOA 5A2QL 2F0JA 1ET6A 3TZUA 4GOPB 2DY7A 4QMGA 3GTKB 1RHPA 2CH4W 4LF4Q 1S5BD 3S1MH 4IFDH 1LTID 4NW2A 2O2LD 4TSSA 4B9WA 2E5LQ 4RA8A 1C8CA 3URYA 2A73B 1Q82C 3G4SA 1U4PA 3FVQA 1JWMD 4G7OC 4WJ3M 2CWPA 1A6XA 4QCLA 2K50A 2FFKB 4KY7A 1E2VA 3M85A 1VQNA 1XX8A 4DR5L 1CQFA 2KVMA 1VQJA 2KHJA 5EKIA 2Q2HA 1I4QA 1R9TH 3QWNA 1O78A 1BNZA 2EY1A 3RZOH 2SNSA 4OELB 3UDXA 3NBIA 3I4MG 5M5WH 3CW2C 1ILQA 2NUCA 3GTPH 4YHHQ 1CI3M 4MTNA 3S17H 2R61A 1XPRA 3TDQA 3KLRA 4A3FG 1QVCA 1E1TA 1QB5D 1UWVA 4YWLA 4RFBA 1PH2A 4LF9L 5JJIA 3ITPA 4XQQA 2JA5H 5M5XH 1H95A 4AQYL 4UY8C 2EPBA 4DR5Q 4JI8L 2B63H 3G7LA 1CUKA 3R8BA 4F88A 1GM5A 5M3FH 5IGBA 3A54A 3D0FA 4DXFA 1WVLA 4QQBX 4UHVA 4KHVA 5M5YB 1EQTA 5CV9A 5C4HA 1JORA 1LM0A 3MHBA 1FNWA 2XWBB 4NXML 4P73A 1DYQA 2NZOA 1CSPA 5C0XG 4MIUA 1QZHA 1EOVA 4X65L 5KNDA 3MFGA 1IXRA 3L7ZC 1STGA 4AQYQ 4IPDA 4BS9A 4ALPA 2ENBA 3G6JB 3P7JA 3RZDH 2GVAA 3W3AA 3TS0A 4MTKA 3CCMA 3U4ZA 3S1QH 5KNBA 3A8IE 4DV5L 1Y8NB 4B3TQ 4WJWA 2CVRA 4JV5L 2EDGA 4NKLA 3BDCA 4CDFC 5C4ZA 4ULLA 4OO1I 3MXPA 4UAIA 3HG9A 5FJ8G 1I6HH 4JI4L 1M4VA 4NXMQ 1LT3D 1VF7A 4X65Q 3D4WA 5C44H 4DAPA 5GAHC 3VR2A 3M3YB 3GTOB 2A5HA 1J5EL 4KMUC 1T5EA 2F0LA 1PRTD 1O7IA 1R4PB 3ULJA 1H9SA 1K3BC 4A3CH 3KF6A 3Q0AA 4DV5Q 3K7AH 1CKNA 1WJJA 2WIIB 3SEBA 2A74C 4QY7A 2JA8B 2UXBL 4CBVA 2K1BA 1LTGD 4DFAA 3JAML 4OGQC 4JI4Q 3P20A 4A3EB 5IGGA 2AKWB 4KKTA 1B53A 2XGTA 1KLGD 2MO1A 4LFCQ 3E0EA 2R7DA 3CCEA 2JEAI 1PZKD 3BJUA 5ELEA 2EXDA 3TZDA 1JWSD 2QGQA 2R6GA 3IAYA 1J5EQ 3EBEA 5C4XB 1MKHA 1J9OA 4HMJA 5E4XA 1D8LA 1CKMA 1SNPA 4OONA 1SYGA 2CQAA 1AH9A 3M4QA 1WD1A 4FP5D 1WTWA 4GZYC 3DLLA 2QDLA 4YWMA 1A0IA 1XJVA 1G291 3CCUA 3F2UA 1ILPA 1SSOA 3SK8A 3I4OA 1FL0A 1BUVT 1PZID 1XTDA 1YHBA 3WDNA 4KHPL 3LWUA 1M8AA 4YCUA 3GTMB 3NEMA 1A3VA 5EBDA 4JI7L 3VA7A 2DJGC 1SDFA 4K6LA 4LAAA 1WI5A 1PH7A 3BU2A 3KDFA 3G48A 4I65A 3HOXB 1CZGA 1S5DD 4JG2A 1X3QA 3CC4A 2DNEA 3VDYA 2NYZD 1TS5A 2AQ1B 3D6CA 1SYFA 3NP8A 3AYHB 1HFNA 1C7YA 1I94Q 1EYGA 4DV4L 4BBRB 1D7QA 4KHPQ 2NN6G 1AE2A 3RUZA 2MP1A 3SVMA 1V9PA 2M2LA 5D14A 4HN7A 3CCLA 4JI7Q 5DLQE 4RCNA 1WTRA 4KHZA 2VUMG 1VQGA 1AN8A 4HIDA 3VYUA 4CJ1B 2IJ0A 1W3SA 5CC4A 3HOWH 4KN7C 1A63A 2BE5D 2VZAA 1SYBA 3K0XA 1D5MC 1VQEA 4DPGA 3J80c 4OO1H 2SDFA 1JR0D 5IGFA 1PFSA 2PZUA 4V190 1TWCB 1EZ6A 5CR3A 3D6WA 1G8ZD 1QOHA 1PFMA 3K7UC 4K14A 4A93B 1RIPA 4FF3A 1MJEA 4DV4Q 1DZ1A 1IKLA 4HJ9A 2SEBD 1B4OA 1IHZA 4UP7A 4BY1G 3MEFA 1NE3A 2UUCL 5FK9C 1WFQA 3HP3A 4OXPA 3S2DB 3MAQA 3I4LA 1K9MC 1TWFB 2R92B 3ER0A 4RHRA 1N36L 1SE8A 2WB1E 3RLNA 2Q2IA 5IYDH 4PV1C 2E74C 1A15A 1LTAD 5AJ3Q 4GLXA 1STBA 1VF5C 1N33L 4C3JG 3UE0A 4IZ8A 5IT9L 1DOMA 3NTKA 2Q8TA 3K5LA 1EY8A 1BCPC 3MEHA 3I2ZA 5KIXA 2UUCQ 5KEEA 1HNXL 1L2FA 1JE5A 2R93H 4LJZC 1EY6A 1SRUA 3SGIA 1D5ZC 3E9HA 2OTLA 1QJOA 3CP0A 3TP5A 1HZ9A 3FPPA 2AWOA 4E6IA 1TWGB 4A3IH 1RTNA 1FGBD 5I9OA 2B8GA 1N33Q 5IGDA 2B2WA 2FMCA 2JK8A 1EL0A 1STEA 4LF5L 3J81L 4WRDA 1O7ZA 3OIPA 2I5HA 1TY2A 1BCPD 4B9XA 3QB3A 1HTLD 4RGTA 5IGEA 4QUFA 1MD2D 2A19A 4O42A 2ZXOA 4C56C 3VR6A 4KN4C 4A4IA 4P71A 3K80C 5BN3A 1Y8OB 3O13A 2OXPA 1G51A 5C4JB 4RH6A 1SBBB 2VNUD 3I70A 4XXEA 3S1MB 1C4QA 2RDFA 1QNUA 3X3MA 2ASBA 4C3HH 3DMUA 1ZEQX 4PQXA 4KKUA 1LABA 1YJ9A 4N8X1 2BDNA 2L4NA 1S5ED 3EVQA 3TSSA 5TSSA 1SJED 4DK3C 3H0GG 2L5TA 4LF5Q 5EPKA 4G7HC 4HMIA 4PZ6A 4DNRB 1HFGA 1BF4A 1PTOC 1V1PA 2F3IA 2N8NA 4QB4A 2HD3A 1VS0A 5BN5A 1R9TB 1Q1EA 1OXVA 3NHHA 2K7VA 1S72A 4FXKC 5IYCG 1S4ZA 3SK5A 2K28A 2F0NA 4L5TA 3NBHB 3HKZB 3I56A 3RZOB 5JVG3 1O80A 1MJCA 5M3MG 5M5WB 3SXHA 3GTPB 4ME3A 3CCJA 1UE1A 3EFXD 1CA5A 1GKHA 3S17B 1STYA 4IUQA 2FJ2A 2K5DA 1K8MA 2EYPA 2HIVA 3S1RB 3T13A 4FO2A 2JA5B 3OMCA 3CCQA 1NAPA 5M5XB 1JJCB 1EIHA 1TKWB 1EFWA 4UP8A 5ELDA 1EY5A 4DKAC 4JCVE 2OWOA 1JICA 4LFAL 3NTHA 1YITA 3K5OA 2L55A 2UUBQ 5C3XA 2WB1G 4HCEA 3S24A 2YTXA 3BZKA 1TXYA 5GROA 3V2TA 3PIPA 2AQ2B 3HOZG 2D0PA 2Y0SG 3W2DA 2B2WC 1HUMA 2F0HA 4KD4A 1AZQA 5C5LA 4C1NI 2AQ3B 2Z8LA 2IPKD 5KYLA 2XRQD 3RZDB 1ESFA 1UEAB 4IURA 4APVA 2VXWA 1IL8A 1XPOA 2WV6D 4LFAQ 4KY5A 4DAVA 3HOVH 4H13C 2I0QA 2OTJA 1QVFA 4K6DA 2F0MA 4ZLTF 4OWTB 1HA6A 2JE6I 1Q12A 1VQBA 1YNND 3BZDB 4XT1B 1PTOH 1SYCA 2EYLA 1U4LA 2QW7A 1WTOA 1I6HB 4RWSC 4B3RQ 2F0PA 1IYJB 2L9HA 1CQVA 4K0KL 3PO2G 1KL9A 3U58A 5C44B 5CORA 1F9QA 2OF1A 3UDGA 4DR4L 1LTLA 1OXSC 2E76C 5D65A 5H1SE 3J81j 1JOKA 2LFNA 1PFBA 2YTVA 1OXUA 1CM9A 3C1FA 3W1BA 3K7AB 2H5XA 4GKJL 3PF5A 2CH4A 4MZ9A 4A3JG 3T1YL 5LMNL 2BA0A 2R7ZG 1STAA 2KCNA 4GLAC 3S2DH 1N9WA 3ND9A 3OMGA 3H94A 4DV1L 2R92H 3MXNA 3KLWA 1L1OA 3A8JE 1YNXA 1SFOH 4C2MH 4QUCA 5LMUL 3I8ZA 2ZTDA 2IL8A 1RDPD 2ZXPA 3R3OA 4DR1Q 3A0JA 4FDBA 3DEPA 4QIWE 3PQIA 4DR4Q 1K0SA 4X6AH 3VYSA 3F2DA 4BXXG 3FKIG 4L8JA 3KUPA 1L0WA 5I6WA 4TQUS 1PH3A 2IW3A 4HJ5A 1FNUA 4GNXA 4C1NK 4GKJQ 4PZ8A 2B29A 2JEBI 2KJXA 3T1YQ 4KV6A 4OX9L 5JJKA 4R4TA 5BR8Q 4A3DH 1HH2P 3HKSA 3STBD 1KRSA 3AFPA 5IP7G 2BDOA 4HTHA 1EZ8A 2EIFA 5HY6A 3RLOA 1HNZL 5C0XI 4FF2A 5IP9G 1RF2D 3JAMc 1SE2A 2Z9HA 1EQRA 3HRZC 5LMUQ 1PDQA 4C3IH 4ZKBB 3BG3A 5K36G 4ZUIA 1D1KA 4IFDJ 5DM63 1CFMA 4BY7H 4A3KH 1EQQA 2KECA 1B3QA 2CFMA 3FP9A 2N88A 3N52A 4K2LA 5CYUA 3J80i 2PZTA 4L5QA 4R8NA 4JI5L 2HHHL 1EWHA 1BO0A 3F2CA 1FGUA 4OX9Q 2PI2A 1D5XC 2N78A 3P1HA 1KXLA 4XT3B 2I46A 2C9OA 4IJLA 1HNZQ 5C4JH 1ENAA 3DM1A 1PH9A 4JOIA 4Y52H 1Y1VG 3RR5A 3QIAA 1I5FA 2YV5A 1VQKA 3I4NG 3RNUA 1BKBA 4NPSA 2GN5A 5JJLA 4EQ5A 1I6VC 1LV9A 4XYQA 1KLUD 3HOWB 5M9OA 4JI5Q 1XNQL 2M9VA 2HHHQ 1A3TA 3OOCA 5E7NA 2F4VL 1SEBD 2PI2E 3PO3G 1PH8A 3X3NA 3HOYG 3NTIA 3CXCA 3NWTA 2IY5B 3S16B 1SROA 1F9RA 1GXDC 1UE5A 2JA7G 4U673 3Q6SA 1L1OC 4A76A 4LF8L 1B9MA 4Y7NH 2ZXRA 3D31A 4YCVA 1HA5A 1II3A 1PH4A 4G7ZC 4FF4A 3ERSX 4OIKA 1HHVA 1Q3LA 3PIP3 4FNFA 3VR5A 1K8OA 3OHXC 4GOPA 2KCMA 2VQEL 1ICWA 2KCTA 3S1RH 4ZCKA 1QUQA 2MO0A 2RA4A 4RKBA 1Q86C 1XNQQ 1X55A 5C5MA 1VMCA 3CF5A 2EZVA 3ONAB 4GNXC 1FNVA 3I4MH 4A3GG 3VYRA 2UU9L 1X9NA 2RSOA 1AE3A 2CWAA 4Z9CB 1BBUA 3J80E 2NVXH 4A3MG 1WTQA 3NWSA 4JI6L 2KUMA 4A3FH 4DXGA 3DXJC 1IBLL 3L3OC 3UDIA 4LF8Q 4KD3A 3BVGA 3DHQA 4DUZL 4CDEC 5ELCA 1C0AA 5HGQA 4KY6A 1HQRD 4ZUJA 3A56A 3A8KE 4OWXB 2R93B 1N32L 3NQTA 1PFNA 1TIID 4A3MH 1ESRA 4J15A 2VQEQ 2X6LA 1EY7A 1R4QB 4C3JB 4LF9Q 1V8QA 2RHSB 2WP8J 4FYDA 1CTMA 1M1KC 1VQ7A 2UU9Q 4JI8Q 2NTSA 1PRTC 3RMHA 5F2DA 5C3EG 4A3IB 2MFIA 5IIFA 1YNJD 2NWGA 2F1MA 3RN2A 5C0XH 4JI6Q 3KF6B 1LTSD 2X69A 3C2PA 1YVCA 1IBLQ 1FVIA 2NN6I 4DA2A 3J7AF 5ELBA 2KOLA 5CGKA 4DV7L 4DUZQ 4DR7L 4RKLA 4DR3L 1PMRA 1STHA 2AUKA 3U9OA 1DJRD 2Q8RE 5IT9c 2PCFB 3UI2A 4V0BA 3OSOA 4OL7A 1N32Q 4A3BG 1KNAA 3C1EA 2NBFA 1TR5A 1WCMG 4KTAA 3WWVA 4WJ4A 1VQPA 4UP9A 4XYOA 5FJ8H 3S1NH 4C3HB 3TREA 1HTPA 4K5VA 3VYTA 1G6ZA 2JN4A 3CC7A 5IE8A 1K83H 1WYDA 2PMZE 2QEJC 4JV5Q 3KF8B 2QILA 4JBJA 4H7BA 1C48A 1PV4A 1IYUA 4R4OA 4K5WA 4DR3Q 3OW2A 1XWEA 2OT2A 3H3VC 2F0IA 2K01A 2XN9C 4P74A 1SMXA 1VQHA 3J81c 2R7FA 1E1OA 1Z47A 2Q2UA 1VMPA 5ELNA 3C3LA 3E9IA 1KQSA 3TRZA 2K14A 2JA6G 1Y1WG 1BCPB 3U4VA 3EN2A 1XMOL 4TRDA 1Y69U 2VS1A 3TS2A 2NVTB 3BDOA 2O5IC 3FDTA 3B6YA 4BBSG 3F8TA 3A5ZB 4O2DA 4P75A 3KDFB 4O0AA 4DU9A 3M7GA 4EVOA 5CV6A 5IYBG 2MGSA 1EEID 2X6GA 2DY8A 2UXBQ 1PH6A 1FD7D 2EE1A 3PUVA 4L63B 5LMNW 5M3MB 1KTKA 4L5SA 3OWFA 2DNCA 3CPWA 3A55A 2F4IA 2K5NA 3HOUG 2Z4HA 3CKIB 2B2YA 2KHSA 2E2HH 2J4XA 2NVQH 3NK9A 2PYKA 1EQVA 1XMOQ 1A8VA 1SN8A 1U9RA 1I4RA 3NSWA 5A2QE 4RG1A 2XVSA 1ZXTA 3D3RA 5KRUA 2BE5C 1PH1A 1EUJA 1U0LA 2AHOB 1G2SA 2WB1B 1EY4A 2F0KA 1LYLA 3J7YW 2Z6KA 5JEAJ 1IBML 2VB2X 5EGTA 5J1ZA 1PZJD 5GQOA 3HOVB 4J6HA 3S9WA 1NSNS 1P8LA 4EGVA 2FXQA 1X6OA 3H3VH 1PTOB 1Q7YC 5G3LF 1NNXA 1SAPA 2DUDA 1W6JA 2Z1CA 1G2TA 1S5CD 1ENCA 1VQDA 4J1MA 2NN6H 4LK1C 4UDUC 3S16H 1SJHD 4YIJA 4DGZA 4GKKL 4OEMB 4LF6L 1Y8PB 1BVSA 1TT2A 3PUWA 2FHTA 5FO8B 4OWWB 5JEAG 1GD7A 2VUMH 1MHWC 2XIWA 3A74A 1KDBA 4DUYL 2BA1A 1QZGA 3I90A 3ULLA 1TWAB 3T56B 5A35A 5JJZA 4FVMA 4L5RC 2IT1A 5K5PA 1Y14B 1KAWA 3I7FA 3JAMi 3OIQA 4IUTA 1DM0B 2J7ZA 1SFOB 4C2MB 1LACA 2K5QA 2H4OA 2PW5A 2ZTCA 1E2ZA 4BY1H 3K5NA 1TU2B 2WINB 4GKKQ 4IOCA 3K81C 5JPMC 1ZYRD 4IUVA 1H9RA 2Y0SE 1OXTA 1EYDA 3PGZA
chains in the Genus database with same CATH topology
4DNTB 2B2YC 2A68C 3QJYA 1QG7A 4A3DB 1GUOA 1JCKB 2EVBA 1RD9D 2JSOA 3FMCA 4DAYA 2D2CC 1Z7TA 1HPCA 1TQOA 2ZT9C 4IQZA 4C3IB 1HRJA 4AYBB 2O4XA 4K5XA 4BY7B 4A3KB 2TSSA 3CRLC 4RGMA 5ISRA 1OO9B 3DWQA 3T4AC 1TS4A 2A68D 5COYA 5ELFA 2Q8IB 3AB9A 4ILWA 4FXDA 1RODA 2BOSA 2M00A 3OPOA 2L0CA 1RTOA 3L9AX 2SNMA 4IN3A 1F2YA 4MHEA 1BDOA 1JC7A 3JAME 1SE3A 1RCVD 2EYMA 4H0LC 5EJWA 1Y1VB 3WOFA 2HCCA 4BA1I 5KGUA 1AEXA 1W6KA 1KNEA 2EYFA 4NP5A 1XTCD 5EPJA 2ICIA 4HAEA 5J22A 4Y7NB 4KJOA 2VB3X 1IW7D 2QF7A 1D2BA 4HR7B 2G9DA 5C3WA 5JOBA 2K05A 3D4RA 1GJXA 3CQZB 1VCIA 4FF1A 2A6HC 5CMDA 1U4RA 2L12A 1KDAA 3I4MB 1NR4A 1GUNA 3SR1A 2KQ3A 3NQIA 2NVXB 5NUCA 1U4MA 4I7ZC 3PMFA 4A3FB 5G3LD 2F0GA 1O7LA 1EU4A 1YNNC 2EOTA 3FEWX 4NDXA 4ID6A 5E3FA 5LHY1 1BOSA 1O7YA 4R8IA 1SE4A 4A3MB 2RDGA 2CW0C 2N55A 2A6HD 4EQPA 5IOCA 1NCVA 3M4OB 4MN3A 4CKCA 4J8QA 1F9SA 2DN8A 3PUYA 1EIGA 1CHPD 1IYVA 2QKIC 2SOBA 2OEOA 4RGNA 1V43A 1QILA 3KLSA 2CW0D 2NB0A 3CU7A 5BN4A 1JQYD 3MWYW 3S1NB 2PQEA 1WTPA 1MGSA 5D3DA 1K83B 3R2TA 3E6ZX 3MA2B 3KBXA 3VR3A 2B2VA 3IL8A 5FOBB 4CJ0B 4H44C 3I73A 5JPNC 3BYYB 1BBXC 4HSVA 5IODA 4IALA 1SYDA 1I4XA 5IT9E 5E1FA 2EY6A 1I4PA 2EJMA 3MTSA 1GUGA 4X3KA 1LLRD 3QO2A 5JVH3 2BCOA 1RKNA 4FXGC 5EQ0A 3KBGA 1E2WA 4K8JA 5I4DA 3QOLA 1PRTB 2NZ1D 5FLXL 4KI0A 1TY0A 3FPUB 1SNOA 2WACA 5FO7B 1D6EC 3I72A 3J81E 2E2HB 2NVQB 5T1IA 5C6AA 1DOKA 2C5CA 2K32A 3S14B 3EQLC 5I2XA 4ZK9B 3IFDA 1JWUD 1BXTA 1OXXK 4RGOS 3WOEA 1HUNA 5K36H 3K6OA 4ZRZA 5I6YA 4DK0A 2QDBA 5CV5A 5E4WC 1B1ZA 4KKSA 3M4YA 4N9TA 2F0QA 4PNYA 5HURA 2AWNA 2A6EC 4IFDG 2F0VA 4N9PA 2V4DA 2D9UA 2A69C 4IUUA 1ET9A 2ICEC 5AFWA 2YYZA 3RD4A 3R2IA 2PNRC 1A2TA 1UNSA 4LMQD 2D62A 1Q90A 3M7NA 2B2VC 2EYHA 5EKKA 3R93A 2VUMB 3GV6A 2B8FA 3MXGA 3C46A 1ZKOA 2A6ED 1JE4A 1GHJA 1NUCA 1LT4D 3TP6A 3SE0A 1WD0A 5EKLA 1EYCA 2A69D 2LY7A 4CKEA 3SDZA 2FINB 1I3QB 4F8MA 1TS3A 3GO5A 5I2YA 1Q8IA 2XWJB 1LT6D 5CBAE 4TKOB 4BY1B 2I07B 3ERQA 3TBIB 3A7LA 3T16A 1YNJC 2IX1A 1H9KA 1XYIA 1EYAA 2L1BA 5C0XJ 1L0YB 1LO5D 2MPMA 3K57A 2PMZB 1AP0A 4B08A 3OW7A 2B2UA 3IFTA 3LWEA 5FKAC 1B44D 3MVVA 3EA6A 3AMUA 2RQXA 3SK6A 1UAPA 1CK1A 1H9SB 2PO4A 5CBEE 1DONA 4XIGS 4KK7A 4DN4M 2F0OA 1AW7A 3E5SA 4ZKCB 2F0EA 5DM73 2HUGA 3DWPA 1DCZA 2KEDA 4WORA 1QE6A 1RJTA 5DAUA 1NR2A 1KDCA 1H9JA 2PW7A 3DWAA 2HCIA 4CGYB 4WFN3 3GP7A 1F2MA 3MC0B 3VR4A 2F0SA 3BYTB 1A3UA 4RHSA 1HQMC 2K33A 4Q0FA 2D5DA 4KJNA 3GTJB 3I91A 3H0GB 4PMCA 1LTRD 2K6AA 3AU7A 4M8AA 3GTQB 3D8GA 5KYIA 3NE5B 4EQOA 1BCPF 1VDZA 2HQEA 5FLXE 1JOOA 3J7AV 3HEJA 1MBYA 1MSGA 1T5XD 2B2UC 1F9PA 3KF8A 1LT5D 4K2KA 2CHBD 4NMZA 1ML0D 5CV4A 3U9SA 4ME5A 1X3PA 3LX0A 4QF4A 3MXUA 2MJ8A 4PMWA 3PIO3 2E2JB 1KABA 3I3CA 1MSHA 3MFYA 1JOQA 3S2HB 2FMMA 4XTCS 2F3VA 4DK1A 3GV3A 3HS0C 3HOZB 2NTTA 3ND8A 2Y0SB 1CA6A 3DUZA 3OWEB 2O5JC 1UUPA 2JYOA 1PTOF 3NUCA 4RCOA 2KA7A 1B3AA 2JP1A 2WAQB 3V96A 4OO1G 1Q1BA 3BVMA 3PV0A 1ZYRC 3V05A 2ID0A 2E75C 1E0BA 1PYWD 1F2LA 2IWHA 3PO2B 1LTTD 1ONLA 3ZYYX 1B50A 1FR3A 3BDLA 3CHBD 3GTLB 1BR9A 3A7AB 1QWYA 1TS2A 3QG1A 3DEOA 5JEAH 1KAAA 3Q22A 2QCPX 2B2TA 5LL6S 4CJ2C 5LL6X 3Q23A 1Z6HA 1SNDA 5CV7A 4JBWA 1SYEA 2H1EA 4A3JB 1PXUA 1EOTA 2R7ZB 3S15B 4G57A 3Q24A 1FYCA 1F2ZA 1EU3A 2EYOA 4CHTB 1QCBD 5J39A 3FKIB 2HDMA 2EY5A 1SNQA 5I9PA 4K8IA 3TMEA 3KLSX 2E2IB 3EJIA 2WKCA 1EY0A 1GUWA 2RSNA 4ZYSA 1I4GA 1S5FD 3NPPA 2K03A 3QOJA 3K59A 3K0YA 1GUSA 1EFID 1V1PB 2RVLA 4EQNA 4P2CB 2TMPA 4F7XA 5JAVA 1B9NA 4S3SA 4C3HG 1BQQT 1GUTA 1GOZA 1IW7C 5EBCA 2XNAC 5IGCA 5EPLA 1STNA 2F0UA 2B39A 1EY9A 1EWCA 1MI2A 4XDXA 4JK1C 4OHJA 1D1IA 3TP7A 3D4DA 5HGTA 3I4NB 2B2TC 1I50B 4IUNA 1SXTA 4X3SA 1SMYC 2PZWA 1J8IA 1HXYD 3PO3B 3TN2A 3HOYB 3NXWA 1CT1D 2IX3A 1AZPA 4CKBA 2Z4IA 2JA7B 2F0TA 1TVXA 4X3UA 3HZXA 3HGBA 2LS01 4DF7A 3GD7A 3K5MA 3P75A 1SNMA 2EXZA 4G4KA 2K04A 2LKVA 4XQJA 4BWGB 1SMYD 2L11A 4Q5VA 4PMBA 2F03A 4X3TA 4A3GB 2HDLA 1PTOD 3CRKC 4R9WA 1EEFD 2XSCA 1A2UA 3MZ5A 1I4HA 2B63B 1CZWA 1LTBD 3NBHA 1WTVA 5M3FB 5DEHA 3LNNA 1DD2A 3FRPB 1HCZA 4OIJA 5KNCA 4U68A 4ZAIA 5D3IB 3J80L 2KEEA 3N6RA 4QIWB 1JB3A 2F0DA 2K5WA 4M1UB 4F87A 2LMCB 4O1NA 1F77A 5FO9B 1WTXA 2EJFC 2KCCA 4IFDI 3H91A 5C3EB 3TP8A 3IKJA 1B2TA 3S1QB 2J0TD 2RKSA 4BA2I 4HCSA 5CV8A 3GTGB 3T51B 4HEDA 1V1OA 1GHKA 4ABNA 4A3BB 3H09A 2AUJD 2R3ZA 2RBMA 3PUXA 2MHVA 1WCMB 1XXGA 2MUYA 3EROA 2WKDA 4RAUC 3SHLA 2EYJA 1TWHB 2RDHA 3BVZA 4HSPA 2G9HD 3GQBA 3PUZA 1X32A 2NVYB 3VA5A 4L6TB 3RLFA 1H9MA 1DOLA 2GA4B 2JXMB 4ZQ3A 1ENFA 1IKMA 2JA6B 1Y1WB 3SK4A 1CHQD 3E0JA 3KK7A 1QNKA 1PRTF 5T1GA 4BBSB 4IUPA 2XRSD 4C3IG 5DNFA 1G91A 4ODGA 3BS1A 2IX0A 3K58A 3H6MA 2PPBC 2EY2A 3HOUB 2F0FA 2E2DC 3T53B 1DXMA 2EJGC 2YU9B 1PLFA 1L0XB 2F0WA 4XQNA 2F3WA 1AFPA 1SNCA 5A2QL 2F0JA 3TZUA 1ET6A 2DY7A 4QMGA 3GTKB 1RHPA 1S5BD 4IFDH 1LTID 4NW2A 2O2LD 4TSSA 4B9WA 4RA8A 1C8CA 3URYA 2A73B 1U4PA 3FVQA 1JWMD 4G7OC 1A6XA 4QCLA 2FFKB 4KY7A 1E2VA 3M85A 1XX8A 1CQFA 2KVMA 5EKIA 1I4QA 3QWNA 1O78A 1BNZA 2EY1A 2SNSA 3NBIA 1ILQA 2NUCA 1CI3M 2R61A 3TDQA 3KLRA 1QB5D 4RFBA 3ITPA 4XQQA 2EPBA 3G7LA 3R8BA 4F88A 5IGBA 3A54A 4DXFA 1WVLA 4KHVA 5M5YB 1EQTA 5CV9A 5C4HA 1JORA 3MHBA 1FNWA 2XWBB 1DYQA 5C0XG 4MIUA 5KNDA 3MFGA 3L7ZC 1STGA 4BS9A 2ENBA 3G6JB 3P7JA 3W3AA 5KNBA 3A8IE 1Y8NB 4WJWA 2CVRA 2EDGA 4NKLA 3BDCA 5C4ZA 4ULLA 4OO1I 3MXPA 4UAIA 3HG9A 1M4VA 1LT3D 1VF7A 3D4WA 4DAPA 3VR2A 3M3YB 3GTOB 2A5HA 4KMUC 1T5EA 2F0LA 1PRTD 1R4PB 1H9SA 3Q0AA 2WIIB 3SEBA 2A74C 2JA8B 4CBVA 2K1BA 1LTGD 4DFAA 3JAML 4OGQC 3P20A 4A3EB 5IGGA 4KKTA 1B53A 1KLGD 2JEAI 1PZKD 5ELEA 3TZDA 1JWSD 2R6GA 3IAYA 5C4XB 1J9OA 4HMJA 5E4XA 1SNPA 1SYGA 2CQAA 1WD1A 4FP5D 1WTWA 4GZYC 1G291 3F2UA 1ILPA 1SSOA 3SK8A 1BUVT 1PZID 3WDNA 3LWUA 1M8AA 3GTMB 1A3VA 5EBDA 3VA7A 1SDFA 4K6LA 4LAAA 4I65A 3HOXB 1CZGA 1S5DD 1X3QA 2DNEA 2NYZD 1TS5A 2AQ1B 3D6CA 1SYFA 3NP8A 1HFNA 4BBRB 2NN6G 3RUZA 2MP1A 3SVMA 2M2LA 5D14A 4HN7A 4RCNA 1WTRA 4KHZA 1AN8A 3VYUA 4CJ1B 2IJ0A 5CC4A 4KN7C 2BE5D 1SYBA 1D5MC 4OO1H 2SDFA 1JR0D 5IGFA 2PZUA 4V190 1TWCB 1EZ6A 5CR3A 3D6WA 1G8ZD 1QOHA 1PFMA 4K14A 4A93B 4FF3A 1DZ1A 1IKLA 2SEBD 1B4OA 1IHZA 5FK9C 3HP3A 3S2DB 3MAQA 3I4LA 1TWFB 2R92B 4RHRA 4PV1C 2E74C 1A15A 1LTAD 1STBA 1VF5C 4C3JG 4IZ8A 5IT9L 1DOMA 3NTKA 2Q8TA 3K5LA 1EY8A 1BCPC 3MEHA 5KIXA 5KEEA 4LJZC 1EY6A 1D5ZC 1QJOA 3TP5A 3FPPA 2AWOA 4E6IA 1TWGB 1RTNA 1FGBD 5I9OA 2B8GA 5IGDA 2B2WA 2FMCA 1EL0A 1STEA 3J81L 4WRDA 1O7ZA 3OIPA 1TY2A 1BCPD 4B9XA 3QB3A 1HTLD 4RGTA 5IGEA 4QUFA 1MD2D 4O42A 2ZXOA 4C56C 3VR6A 4KN4C 5BN3A 1Y8OB 3O13A 2OXPA 5C4JB 4RH6A 1SBBB 2VNUD 3I70A 4XXEA 3S1MB 1C4QA 2RDFA 1QNUA 3X3MA 3DMUA 1ZEQX 4PQXA 4KKUA 1LABA 2BDNA 2L4NA 1S5ED 3EVQA 3TSSA 5TSSA 1SJED 2L5TA 5EPKA 4G7HC 4HMIA 4DNRB 1HFGA 1BF4A 1PTOC 1V1PA 4QB4A 5BN5A 1R9TB 1Q1EA 1OXVA 3NHHA 2K7VA 4FXKC 1S4ZA 3SK5A 2K28A 2F0NA 3HKZB 3RZOB 5JVG3 1O80A 5M5WB 3SXHA 3GTPB 3EFXD 1CA5A 3S17B 1STYA 4IUQA 2FJ2A 2K5DA 1K8MA 2EYPA 3S1RB 3T13A 4FO2A 2JA5B 3OMCA 1EIHA 1NAPA 5M5XB 1TKWB 5ELDA 1EY5A 1JICA 3NTHA 3K5OA 2L55A 5C3XA 4HCEA 3V2TA 2AQ2B 3W2DA 2B2WC 1HUMA 2F0HA 4KD4A 1AZQA 5C5LA 4C1NI 2AQ3B 2Z8LA 2IPKD 5KYLA 2XRQD 3RZDB 1ESFA 1UEAB 4IURA 2VXWA 1IL8A 2WV6D 4KY5A 4DAVA 4H13C 4K6DA 2F0MA 4ZLTF 1HA6A 2JE6I 1Q12A 1YNND 3BZDB 4XT1B 1PTOH 1SYCA 2EYLA 1U4LA 1WTOA 1I6HB 4RWSC 2F0PA 2L9HA 1CQVA 5C44B 5CORA 1F9QA 2OF1A 1OXSC 2E76C 5D65A 1JOKA 2LFNA 1PFBA 1OXUA 1CM9A 3C1FA 3K7AB 2BA0A 1STAA 2KCNA 3ND9A 3OMGA 3H94A 3MXNA 3A8JE 4QUCA 3I8ZA 2IL8A 1RDPD 2ZXPA 3R3OA 3DEPA 3VYSA 4L8JA 3KUPA 5I6WA 4TQUS 2IW3A 1FNUA 4C1NK 2JEBI 2KJXA 4KV6A 2BDOA 4HTHA 1EZ8A 5C0XI 4FF2A 1RF2D 1SE2A 3HRZC 1PDQA 4ZKBB 3BG3A 5K36G 4ZUIA 1D1KA 4IFDJ 5DM63 1CFMA 2KECA 4K2LA 2N88A 3N52A 5CYUA 2PZTA 4R8NA 1EWHA 1BO0A 1D5XC 3P1HA 4XT3B 2I46A 2C9OA 1ENAA 3DM1A 3QIAA 1I6VC 1LV9A 4XYQA 1KLUD 3HOWB 5M9OA 2M9VA 1A3TA 3OOCA 1SEBD 3X3NA 3NTIA 3NWTA 3S16B 1F9RA 1GXDC 4U673 3Q6SA 1B9MA 2ZXRA 3D31A 1HA5A 1II3A 4FF4A 4G7ZC 4OIKA 1HHVA 1Q3LA 3PIP3 4FNFA 3VR5A 1K8OA 3OHXC 1ICWA 2RA4A 4RKBA 5C5MA 1VMCA 2EZVA 3ONAB 1FNVA 3VYRA 2RSOA 4Z9CB 3J80E 1WTQA 3NWSA 2KUMA 4DXGA 3DXJC 3L3OC 4KD3A 3BVGA 3DHQA 5ELCA 4KY6A 1HQRD 4ZUJA 3A56A 3A8KE 2R93B 3NQTA 1PFNA 1TIID 1ESRA 2X6LA 1EY7A 1R4QB 4C3JB 1V8QA 4FYDA 2WP8J 1CTMA 2NTSA 1PRTC 3RMHA 5F2DA 4A3IB 5IIFA 1YNJD 2NWGA 2F1MA 5C0XH 1LTSD 2X69A 3C2PA 2NN6I 4DA2A 3J7AF 5ELBA 2KOLA 5CGKA 4RKLA 1PMRA 1STHA 2AUKA 3U9OA 1DJRD 2Q8RE 2PCFB 3UI2A 4V0BA 3OSOA 4OL7A 1KNAA 3C1EA 2NBFA 1TR5A 4KTAA 4XYOA 4C3HB 1HTPA 4K5VA 3VYTA 1G6ZA 2QEJC 2QILA 4H7BA 1C48A 1IYUA 4K5WA 1XWEA 2OT2A 3H3VC 2F0IA 2K01A 2XN9C 1Z47A 1VMPA 3C3LA 1BCPB 4TRDA 1Y69U 2NVTB 3BDOA 2O5IC 3FDTA 4EVOA 4DU9A 3M7GA 5CV6A 2MGSA 1EEID 2X6GA 2DY8A 1FD7D 2EE1A 3PUVA 4L63B 5M3MB 1KTKA 3OWFA 2DNCA 3A55A 2F4IA 2Z4HA 3CKIB 2B2YA 2KHSA 2J4XA 3NK9A 2PYKA 1EQVA 1U9RA 1I4RA 3NSWA 5A2QE 2XVSA 1ZXTA 3D3RA 5KRUA 2BE5C 1G2SA 2WB1B 1EY4A 2F0KA 3J7YW 5JEAJ 2VB2X 5EGTA 5J1ZA 1PZJD 3HOVB 4J6HA 3S9WA 1NSNS 4EGVA 1PTOB 5G3LF 1SAPA 1W6JA 2Z1CA 1G2TA 1S5CD 1ENCA 4J1MA 2NN6H 4LK1C 4UDUC 1SJHD 4YIJA 4DGZA 1Y8PB 5FO8B 1TT2A 3PUWA 2FHTA 5JEAG 2XIWA 1KDBA 2BA1A 3I90A 1TWAB 3T56B 5A35A 5JJZA 4FVMA 2IT1A 5K5PA 3OIQA 4IUTA 1DM0B 2J7ZA 1SFOB 4C2MB 1LACA 2K5QA 2H4OA 2PW5A 1E2ZA 3K5NA 1TU2B 2WINB 5JPMC 1ZYRD 4IUVA 1H9RA 1OXTA 1EYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H C;  2LY7 A;  3GTK B;  3H0G B;  1I3Q B;  3I4M B;  3GTL B;  3I4N B;  4A3B B;  2R93 B;  2A68 C;  3GTQ B;  1I50 B;  2NVX B;  1SMY C;  4BBR B;  4A3D B;  4C3J B;  1WCM B;  3RZD B;  4A3F B;  4BY1 B;  3TBI B;  4KN4 C;  3PO3 B;  1YNJ C;  3HOY B;  4G7O C;  1TWH B;  3M3Y B;  4A3I B;  1YNN C;  3GTO B;  4A3J B;  4KMU C;  2BE5 C;  4C3I B;  5C4J B;  2R7Z B;  4AYB B;  3S15 B;  4KN7 C;  2JA7 B;  3S1M B;  1I6H B;  2PMZ B;  4BY7 B;  4A3K B;  4A3M B;  2E2H B;  2NVY B;  2WB1 B;  2CW0 C;  2NVQ B;  3S14 B;  1TWC B;  3EQL C;  2JA8 B;  5C44 B;  3HOV B;  3M4O B;  4G7H C;  4A93 B;  4A3E B;  1I6V C;  3FKI B;  3WOE A;  1Y1W B;  2JA6 B;  3HOW B;  4A3G B;  4C3H B;  3K7A B;  2E2I B;  1R9T B;  4BBS B;  3S16 B;  2B63 B;  3S2D B;  2E2J B;  5C4X B;  3HKZ B;  1TWF B;  3RZO B;  2R92 B;  4LK1 C;  3PO2 B;  5M3F B;  5M5W B;  2A6E C;  3GTP B;  3S2H B;  3S17 B;  3HOZ B;  4GZY C;  3H3V C;  2Y0S B;  4G7Z C;  2A69 C;  2PPB C;  5M5Y B;  4QIW B;  3HOU B;  3S1N B;  1Y1V B;  3WOF A;  3S1R B;  2O5J C;  1TWA B;  2JA5 B;  5M5X B;  1K83 B;  2YU9 B;  3GTM B;  2WAQ B;  2NVT B;  5C3E B;  4Y7N B;  2VUM B;  4LJZ C;  2O5I C;  1IW7 C;  1SFO B;  4C2M B;  1ZYR C;  3S1Q B;  3DXJ C;  3HOX B;  1HQM C;  4JK1 C;  1TWG B;  5M3M B;  3GTG B;  3CQZ B;  3GTJ B; 
#chains in the Genus database with same CATH topology
 2K52 A;  4A3L G;  4DNT B;  2B2Y C;  2A68 C;  3QJY A;  1QG7 A;  4A3D B;  2C35 B;  1C9O A;  1GUO A;  1JCK B;  2EVB A;  2WAQ E;  1RD9 D;  2JSO A;  3FMC A;  4DAY A;  4C3J H;  1EWI A;  2D2C C;  3A5U A;  1Z7T A;  1HPC A;  1HNW L;  1N36 Q;  4JVZ A;  1TQO A;  2ZT9 C;  4IQZ A;  4C3I B;  3KJO A;  1HRJ A;  4AYB B;  4JW0 A;  3E3X A;  1JMC A;  2O4X A;  4K5X A;  1WOC A;  4BY7 B;  4A3K B;  3W1G A;  1VQF A;  2TSS A;  3CRL C;  4RGM A;  5ISR A;  1OO9 B;  3DWQ A;  3T4A C;  1TS4 A;  2A68 D;  5COY A;  1HNX Q;  5ELF A;  2Q8I B;  3AB9 A;  4ILW A;  2VQF L;  4FXD A;  1ROD A;  2BOS A;  1P16 A;  2M00 A;  1E7Z A;  3OPO A;  2L0C A;  1HNW Q;  1RTO A;  3NEN A;  4JC0 A;  1K73 C;  3L9A X;  3OTO L;  2SNM A;  4IN3 A;  1F2Y A;  1VQL A;  4MHE A;  1BDO A;  2IHE A;  1JC7 A;  3JAM E;  2IHF A;  3CCV A;  1SE3 A;  1RCV D;  2EYM A;  2I5L X;  4H0L C;  5EJW A;  2JA8 G;  4NXN L;  1Y1V B;  3WOF A;  2HCC A;  4PG3 A;  3EIV A;  4EX5 A;  4A3E G;  2VQF Q;  4BA1 I;  5KGU A;  1AEX A;  1W6K A;  1KNE A;  2EYF A;  3KFU A;  3GTJ H;  4NP5 A;  3PF4 A;  1XTC D;  5EPJ A;  3H0G H;  1VQ4 A;  2ICI A;  4HAE A;  5J22 A;  4Y7N B;  4KJO A;  3F1Z A;  3OTO Q;  2VB3 X;  3GTQ H;  2D0O A;  2A8V A;  4I7A A;  5C4X G;  2NVT H;  2EQS A;  1IW7 D;  2QF7 A;  1D2B A;  4HR7 B;  2G9D A;  5C3W A;  5JOB A;  2K05 A;  3D4R A;  5IYC H;  1GJX A;  3CQZ B;  1VCI A;  4DR6 L;  4FF1 A;  2A6H C;  2L12 A;  1U4R A;  3K8A A;  5CMD A;  4NXN Q;  1KDA A;  2WFW A;  4YWK A;  5M3M H;  1NR4 A;  1S40 A;  1M90 C;  3I4M B;  1GUN A;  3SR1 A;  2KQ3 A;  3NQI A;  2NVX B;  5NUC A;  3ULP A;  1U4M A;  4I7Z C;  4CDC C;  3PMF A;  1UE6 A;  4A3F B;  3IRB A;  3KYH C;  1W2B A;  5G3L D;  2F0G A;  1O7L A;  1EU4 A;  1YNN C;  1K8G A;  2EOT A;  3FEW X;  4NDX A;  4ID6 A;  5E3F A;  5LHY 1;  1BOS A;  1O7Y A;  2DJF C;  4R8I A;  3HOX G;  3U50 C;  5FLM G;  2JJQ A;  1SE4 A;  4A3M B;  5EAY A;  2RDG A;  2CW0 C;  2N55 A;  4DR6 Q;  2A6H D;  2E2J H;  4EQP A;  5IOC A;  1NCV A;  1YEZ A;  4R4I A;  3DM3 A;  3M4O B;  3S2H H;  4MN3 A;  4CKC A;  4J8Q A;  1F9S A;  2DN8 A;  4BBR G;  3HOZ H;  3PUY A;  2WAQ G;  4X64 L;  1KC8 C;  1EIG A;  1CHP D;  1IYV A;  2E8G A;  2QKI C;  2V1C C;  2SOB A;  3J81 i;  1E3P A;  4LF7 L;  2OEO A;  4RGN A;  1V43 A;  1QIL A;  3KLS A;  1ASZ A;  2CW0 D;  1OTC A;  2NB0 A;  3CU7 A;  5BN4 A;  2RCF A;  1VQC A;  1JQY D;  3MWY W;  3S1N B;  2PQE A;  1WTP A;  4A93 G;  1MGS A;  5D3D A;  4X64 Q;  1K83 B;  3PO2 H;  3R2T A;  2CQO A;  1TWA H;  4GN5 A;  1GO3 E;  3E6Z X;  3MA2 B;  3KBX A;  3VR3 A;  1PYS B;  2B2V A;  3IL8 A;  5FOB B;  4GNX B;  3GTL H;  4CJ0 B;  1ICF B;  4H44 C;  3STB C;  1VQ5 A;  1HZB A;  3I73 A;  4MNO A;  5JPN C;  3BYY B;  4LF7 Q;  1BBX C;  4HSV A;  5IOD A;  4IAL A;  1SYD A;  3NEL A;  4K0K Q;  1I4X A;  5IT9 E;  5E1F A;  3CC2 A;  2EY6 A;  5GAG C;  4A3J H;  1X3F A;  1I4P A;  4DNI A;  3J7A 5;  2EJM A;  2R7Z H;  3MTS A;  3S15 H;  2ALY B;  1IL2 A;  1K8A C;  1GUG A;  4X3K A;  1LLR D;  1YI2 A;  1VQA A;  3QO2 A;  5JVH 3;  2BCO A;  1RKN A;  4FXG C;  5EQ0 A;  3KBG A;  4PZ7 A;  1E2W A;  5LMN Q;  4K8J A;  5I4D A;  3QOL A;  1PRT B;  3T1H L;  4DV1 Q;  2NZ1 D;  5FLX L;  2VY3 A;  4BXX H;  4KI0 A;  1TY0 A;  3FKI H;  3FPU B;  1JT8 A;  1SNO A;  1X3G A;  2WAC A;  5FO7 B;  1D6E C;  3I72 A;  3J81 E;  2E2H B;  2E2I H;  1NTG A;  2NVQ B;  5T1I A;  5C6A A;  1DOK A;  2C5C A;  2K32 A;  3S14 B;  1JB7 A;  3EQL C;  2JQO A;  3CD6 A;  5I2X A;  5IP7 H;  4ZK9 B;  3IFD A;  1JWU D;  4GN4 B;  1VQ6 A;  1BXT A;  4IO9 A;  5IP9 H;  1OXX K;  4RGO S;  4LF4 L;  3WOE A;  3CAM A;  3F2B A;  1HUN A;  5K36 H;  3K6O A;  4ZRZ A;  4JBM A;  5I6Y A;  4DK0 A;  2QDB A;  5CV5 A;  3T1H Q;  1U5K A;  2XTI A;  1B1Z A;  5E4W C;  4QL5 A;  4KKS A;  2K75 A;  3M4Y A;  4N9T A;  4H02 A;  2F0Q A;  4PNY A;  5HUR A;  2AWN A;  2A6E C;  1JJ2 A;  4IFD G;  2F0V A;  4N9P A;  2B3G A;  2JA9 A;  3OYY A;  3G71 A;  3FHW A;  2BH8 A;  2V4D A;  5GAD C;  1Z9F A;  2D9U A;  2A69 C;  1NY4 A;  4IUU A;  1ET9 A;  2QA4 A;  4JI0 L;  3J7Z C;  2ICE C;  5AFW A;  2YYZ A;  3RD4 A;  4IPG A;  1Y1V H;  3R2I A;  1QUQ B;  1A2T A;  1UNS A;  2PNR C;  4LMQ D;  2D62 A;  1Q90 A;  3M7N A;  2ZTE A;  3PIO A;  2B2V C;  4JPB W;  4DV0 L;  4YHH L;  3QR8 A;  3I4N H;  2EYH A;  5EKK A;  3R93 A;  2VUM B;  3GV6 A;  1I50 H;  2B8F A;  1YJW A;  2N49 A;  3MXG A;  3C46 A;  3HKZ G;  4LWC A;  1ZKO A;  2A6E D;  1JE4 A;  1GHJ A;  1NUC A;  1LT4 D;  2PQA A;  3TP6 A;  3SE0 A;  1WD0 A;  3HOY H;  3PO3 H;  5EKL A;  1EYC A;  2A69 D;  2LY7 A;  4CKE A;  3SDZ A;  2FIN B;  4JI0 Q;  1I3Q B;  4F8M A;  3CQZ H;  2JA7 H;  1TS3 A;  3GO5 A;  1Q8I A;  2XWJ B;  5CBA E;  1LT6 D;  2KBN A;  4TKO B;  5I2Y A;  2QEX A;  2F4V Q;  2JA5 G;  2Z6B A;  4HJ7 A;  2ZJP A;  4BY1 B;  2I07 B;  4DV0 Q;  3ERQ A;  2B63 G;  3TBI B;  3A7L A;  3T16 A;  1YNJ C;  1FJG L;  1H9K A;  1XYI A;  2IX1 A;  5M3F G;  4YY3 L;  1EYA A;  2L1B A;  5C0X J;  1L0Y B;  2UXC L;  1LO5 D;  1XPU A;  2MPM A;  3K57 A;  2PMZ B;  4A3G H;  1AP0 A;  4B08 A;  3OW7 A;  2B2U A;  3IFT A;  3L0O A;  3RN5 A;  4YCW A;  1Q46 A;  1YBY A;  3LWE A;  1HR0 W;  4B3T L;  5FKA C;  1B44 D;  3MVV A;  3EA6 A;  3AMU A;  3M4O H;  2RQX A;  3SK6 A;  1UAP A;  3H3V I;  1CK1 A;  1H9S B;  1FJG Q;  1CSQ A;  2PO4 A;  2MNA A;  2CKZ B;  5CBE E;  4YY3 Q;  4NB3 A;  1DON A;  4JOI C;  4XIG S;  1CKN B;  1HZC A;  4KK7 A;  2UXC Q;  3Q8D A;  4POG A;  4DN4 M;  1UEB A;  2F0O A;  3CCR A;  1AW7 A;  3E5S A;  5C3E H;  3CPF A;  4ZKC B;  4LUZ A;  2F0E A;  5DM7 3;  4HIK A;  5C44 G;  1WTH A;  3GDE A;  2HUG A;  3DWP A;  1DCZ A;  3GTG H;  2KED A;  4WOR A;  1QE6 A;  1RJT A;  1SR3 A;  4A3C G;  5DAU A;  2RHQ B;  1NR2 A;  2CCZ A;  1KDC A;  1H9J A;  4X66 L;  4A3B H;  4LFC L;  2PW7 A;  3DWA A;  2HCI A;  4CGY B;  1CKO A;  4WFN 3;  4DV7 Q;  4DR7 Q;  3GP7 A;  1F2M A;  1WCM H;  3MC0 B;  2RF4 A;  3VR4 A;  2F0S A;  3BYT B;  2ATW A;  1UE7 A;  1A3U A;  2G5D A;  4RHS A;  1HQM C;  4CDD C;  1TWH H;  2K33 A;  4Q0F A;  2D5D A;  4KJN A;  4GOP C;  3GTJ B;  3I91 A;  2HIX A;  1VQM A;  3H0G B;  3M4P A;  4PMC A;  1LTR D;  1K3R A;  2K6A A;  3AU7 A;  4M8A A;  3GTQ B;  2NVY H;  3D8G A;  5GAE C;  1B70 B;  4N8F A;  5KYI A;  3NE5 B;  1XMQ L;  4EQO A;  1BCP F;  1VDZ A;  2HQE A;  5FLX E;  1JOO A;  3J7A V;  2RCN A;  3HEJ A;  4X66 Q;  2JA6 H;  1MBY A;  1Y1W H;  1GVP A;  1MSG A;  1T5X D;  2LXJ A;  2B2U C;  1F9P A;  4BBS H;  1S3O A;  2ES2 A;  3KF8 A;  5IYB H;  1B8A A;  1LT5 D;  4K2K A;  3S14 H;  2I5M X;  2CHB D;  1Q81 C;  4NMZ A;  1K28 A;  1ML0 D;  5CV4 A;  1XMQ Q;  1I94 L;  3U9S A;  2GVB A;  1X3P A;  3LX0 A;  4ME5 A;  3HOU H;  4QF4 A;  3MXU A;  1LUZ A;  2LXK A;  2MJ8 A;  4PMW A;  3PIO 3;  4IPC A;  2E2J B;  1HJP A;  1JJG A;  4DR2 L;  4IJH A;  1KAB A;  3I3C A;  2K4K A;  3TEH B;  3ZJY C;  1MSH A;  2YU9 H;  2ZM6 L;  4UPA A;  4JI3 L;  3MFY A;  1JOQ A;  3UDF A;  3S2H B;  2FMM A;  4XTC S;  2F3V A;  2F52 A;  4DK1 A;  3GV3 A;  3HS0 C;  4AIM A;  3HOZ B;  2NTT A;  3ND8 A;  2Y0S B;  1B7Y B;  1CA6 A;  3DUZ A;  2A1A A;  4IPH A;  1A62 A;  4R4C A;  3OWE B;  2O5J C;  1UUP A;  2JYO A;  2PNH A;  3HFZ B;  2KEN A;  1PTO F;  3NUC A;  1NJI C;  4RCO A;  2KA7 A;  3HOW G;  3GTK H;  1B3A A;  4HIO A;  2L15 A;  2JP1 A;  2WAQ B;  3V96 A;  4OO1 G;  1E22 A;  1Q1B A;  3BVM A;  3I55 A;  4DR2 Q;  1QVG A;  3L2P A;  1XNR L;  3PV0 A;  1ZYR C;  2ZM6 Q;  3V05 A;  4JI3 Q;  2ID0 A;  1X56 A;  1IBM Q;  2E75 C;  1E0B A;  4AH6 A;  1PYW D;  1F2L A;  3UE1 A;  2IWH A;  3PO2 B;  1LTT D;  5IY0 A;  1ONL A;  3ZYY X;  1B50 A;  1FR3 A;  3BDL A;  3CHB D;  3GTL B;  1BR9 A;  3A7A B;  1QWY A;  1TS2 A;  1NBW A;  3QG1 A;  4QGU A;  3DEO A;  5AJ3 L;  1I3Q H;  5JEA H;  1KAA A;  3Q22 A;  2QCP X;  2B2T A;  4R4Q A;  5LL6 S;  4CJ2 C;  2OQ0 A;  3W5O A;  3M9B A;  5LL6 X;  3CMA A;  3Q23 A;  1Z6H A;  4DAY B;  1SND A;  1Q8K A;  5CV7 A;  4JBW A;  5IYD G;  2Q2T A;  1SYE A;  2H1E A;  4LF6 Q;  4A3J B;  1PXU A;  1EOT A;  1XNR Q;  1PYB A;  1PA6 A;  2R7Z B;  2K5H A;  4LUV A;  3S15 B;  4G57 A;  4DUY Q;  1X3E A;  3Q24 A;  5L37 A;  1FYC A;  1F2Z A;  1EU3 A;  2EYO A;  2HT1 A;  1IZ6 A;  4CHT B;  1N34 L;  1QCB D;  1KD1 C;  2R93 G;  1RL2 A;  5J39 A;  3FKI B;  2HDM A;  2EY5 A;  4DV6 L;  1SNQ A;  5I9P A;  4K8I A;  4A3L H;  4JYA L;  5M5Y H;  3TME A;  3KLS X;  2BH2 A;  2E2I B;  3EJI A;  1MIU A;  4KLK A;  2WKC A;  4A3I G;  1EY0 A;  1GUW A;  5J3B A;  4LUO A;  2RSN A;  4DK6 C;  4ZYS A;  2Z6K C;  1I4G A;  1S5F D;  4RMF A;  3NPP A;  2YTY A;  2OQK A;  2K03 A;  1T9H A;  3CME A;  3QOJ A;  4GN3 B;  3K59 A;  3K0Y A;  1GUS A;  1EFI D;  1EIF A;  1V1P B;  1K0R A;  1N34 Q;  2RVL A;  4EQN A;  4P2C B;  2TMP A;  4DV6 Q;  4F7X A;  5JAV A;  4JYA Q;  5FLX c;  4P72 A;  4A75 A;  4TVA B;  1VQI A;  1B9N A;  4S3S A;  4IOA A;  4C3H G;  1BQQ T;  1GUT A;  1KHI A;  2MQH A;  1GOZ A;  1IW7 C;  5EBC A;  2XNA C;  5IGC A;  5EPL A;  1STN A;  2F0U A;  1KIX A;  2B39 A;  1EY9 A;  2Z0S A;  1EWC A;  1MI2 A;  4DV2 L;  4XDX A;  3AEV A;  4JK1 C;  4OHJ A;  3M3Y H;  3GTO H;  3AFQ A;  1D1I A;  3TP7 A;  3D4D A;  5HGT A;  3I4N B;  2B2T C;  1I50 B;  4IUN A;  1SXT A;  3ICE A;  4X3S A;  1SMY C;  2PZW A;  1IBK L;  4X62 L;  1J8I A;  2ZJQ A;  1BBW A;  2JA8 H;  1HXY D;  3PO3 B;  3TN2 A;  2ZJR A;  2N3S A;  3HOY B;  3NXW A;  4A3E H;  1SLJ A;  1CT1 D;  2IX3 A;  2UUA L;  1HR0 L;  1AZP A;  2LSS A;  4HJ8 A;  1PVO A;  4CKB A;  2Z4I A;  4DV2 Q;  2JA7 B;  4AYB E;  2F0T A;  1TVX A;  4X3U A;  2AMC B;  3HZX A;  2UUB L;  1X65 A;  1DGS A;  3HGB A;  2LS0 1;  4DF7 A;  3GD7 A;  5C4X H;  3K5M A;  3P75 A;  1SNM A;  2EXZ A;  1HZA A;  4G4K A;  1YHQ A;  2K04 A;  3KJP A;  2LKV A;  4XQJ A;  4BWG B;  1SMY D;  1YJN A;  2L11 A;  4X62 Q;  1IBK Q;  4Q5V A;  4PMB A;  2F03 A;  4X3T A;  3G6E A;  4A3G B;  2HDL A;  2VW9 A;  1PTO D;  3CRK C;  4R9W A;  1EEF D;  2XSC A;  1A2U A;  3MZ5 A;  3H15 A;  1I4H A;  2UXD L;  2B63 B;  1CZW A;  3BZC A;  1LTB D;  3NBH A;  2UUA Q;  1HR0 Q;  1WTV A;  5M3F B;  5DEH A;  4B3M L;  3GTM H;  3LNN A;  1DD2 A;  3FRP B;  1HCZ A;  4OIJ A;  4GS3 A;  5KNC A;  3PCO B;  4U68 A;  4ZAI A;  5D3I B;  3J80 L;  2KEE A;  3N6R A;  4B3R L;  4QIW B;  3HOX H;  1JB3 A;  2F0D A;  2K5W A;  4M1U B;  3TQY A;  4F87 A;  5FLM H;  4LFB L;  2LMC B;  4O1N A;  3HOV G;  5ELO A;  1EIY B;  1F77 A;  5FO9 B;  1WTX A;  2EJF C;  2KCC A;  4LNQ A;  4IFD I;  4JI1 L;  3H91 A;  4R1J A;  5C3E B;  4LW1 A;  3HKZ E;  2UXD Q;  3TP8 A;  3MXN B;  1L1O B;  4BBR H;  3IKJ A;  1B2T A;  2NZH A;  3S1Q B;  2J0T D;  2K5V A;  2RKS A;  4B3M Q;  4BA2 I;  4JBK A;  4HCS A;  5CV8 A;  2VL6 A;  1N8R C;  3GTG B;  3T51 B;  1NMG A;  4HED A;  2P5Z X;  1V1O A;  1VQ8 A;  4LFB Q;  1GHK A;  4ABN A;  4POF A;  4A3B B;  1E24 A;  3H09 A;  2AUJ D;  2R3Z A;  2RBM A;  3PUX A;  2MHV A;  1WCM B;  1XXG A;  2MUY A;  3ERO A;  1TWC H;  2WKD A;  4DR1 L;  4JI1 Q;  4RAU C;  3SHL A;  2R92 G;  1YHA A;  2EYJ A;  1TWH B;  2RDH A;  4A93 H;  3BVZ A;  4JI2 L;  2HQL A;  4HSP A;  2G9H D;  3GQB A;  3PUZ A;  1X54 A;  1X32 A;  1YIJ A;  2NVY B;  1VQ9 A;  5BR8 L;  1NMF A;  3VA5 A;  1TWF H;  4L6T B;  3RLF A;  1H9M A;  1YZ6 A;  3LGJ A;  1DOL A;  2GA4 B;  2JXM B;  4DV3 L;  4B3S L;  4ZQ3 A;  1PH5 A;  1ENF A;  1IKM A;  2JA6 B;  1Y1W B;  4A3D G;  3SK4 A;  3KOJ A;  1CHQ D;  3E0J A;  3KK7 A;  1QNK A;  5IWA L;  1PHJ A;  1PRT F;  3CCS A;  4GLV B;  5T1G A;  4DAM A;  4BBS B;  4IUP A;  4JI2 Q;  3AQQ A;  2XRS D;  4C3I G;  5DNF A;  4AYB G;  1G91 A;  4ODG A;  2DGY A;  1KRT A;  1G6P A;  3BS1 A;  4BY7 G;  4A3K G;  2IX0 A;  4QJF A;  3K58 A;  3H6M A;  2KHI A;  4HJA A;  2PPB C;  2EY2 A;  3HOU B;  2F0F A;  3JC6 6;  4DV3 Q;  2E2D C;  4B3S Q;  2OCE A;  1TWG H;  3T53 B;  3PSI A;  1DXM A;  2EJG C;  2E5L L;  2YU9 B;  1PLF A;  5IWA Q;  1J6Q A;  1L0X B;  2F0W A;  1V1Q A;  4HIM A;  4XQN A;  2F3W A;  1ASY A;  2PQA B;  1AFP A;  1SNC A;  1VQO A;  5A2Q L;  2F0J A;  1ET6 A;  3TZU A;  4GOP B;  2DY7 A;  4QMG A;  3GTK B;  1RHP A;  2CH4 W;  4LF4 Q;  1S5B D;  3S1M H;  4IFD H;  1LTI D;  4NW2 A;  2O2L D;  4TSS A;  4B9W A;  2E5L Q;  4RA8 A;  1C8C A;  3URY A;  2A73 B;  1Q82 C;  3G4S A;  1U4P A;  3FVQ A;  1JWM D;  4G7O C;  4WJ3 M;  2CWP A;  1A6X A;  4QCL A;  2K50 A;  2FFK B;  4KY7 A;  1E2V A;  3M85 A;  1VQN A;  1XX8 A;  4DR5 L;  1CQF A;  2KVM A;  1VQJ A;  2KHJ A;  5EKI A;  2Q2H A;  1I4Q A;  1R9T H;  3QWN A;  1O78 A;  1BNZ A;  2EY1 A;  3RZO H;  2SNS A;  4OEL B;  3UDX A;  3NBI A;  3I4M G;  5M5W H;  3CW2 C;  1ILQ A;  2NUC A;  3GTP H;  4YHH Q;  1CI3 M;  4MTN A;  3S17 H;  2R61 A;  1XPR A;  3TDQ A;  3KLR A;  4A3F G;  1QVC A;  1E1T A;  1QB5 D;  1UWV A;  4YWL A;  4RFB A;  1PH2 A;  4LF9 L;  5JJI A;  3ITP A;  4XQQ A;  2JA5 H;  5M5X H;  1H95 A;  4AQY L;  4UY8 C;  2EPB A;  4DR5 Q;  4JI8 L;  2B63 H;  3G7L A;  1CUK A;  3R8B A;  4F88 A;  1GM5 A;  5M3F H;  5IGB A;  3A54 A;  3D0F A;  4DXF A;  1WVL A;  4QQB X;  4UHV A;  4KHV A;  5M5Y B;  1EQT A;  5CV9 A;  5C4H A;  1JOR A;  1LM0 A;  3MHB A;  1FNW A;  2XWB B;  4NXM L;  4P73 A;  1DYQ A;  2NZO A;  1CSP A;  5C0X G;  4MIU A;  1QZH A;  1EOV A;  4X65 L;  5KND A;  3MFG A;  1IXR A;  3L7Z C;  1STG A;  4AQY Q;  4IPD A;  4BS9 A;  4ALP A;  2ENB A;  3G6J B;  3P7J A;  3RZD H;  2GVA A;  3W3A A;  3TS0 A;  4MTK A;  3CCM A;  3U4Z A;  3S1Q H;  5KNB A;  3A8I E;  4DV5 L;  1Y8N B;  4B3T Q;  4WJW A;  2CVR A;  4JV5 L;  2EDG A;  4NKL A;  3BDC A;  4CDF C;  5C4Z A;  4ULL A;  4OO1 I;  3MXP A;  4UAI A;  3HG9 A;  5FJ8 G;  1I6H H;  4JI4 L;  1M4V A;  4NXM Q;  1LT3 D;  1VF7 A;  4X65 Q;  3D4W A;  5C44 H;  4DAP A;  5GAH C;  3VR2 A;  3M3Y B;  3GTO B;  2A5H A;  1J5E L;  4KMU C;  1T5E A;  2F0L A;  1PRT D;  1O7I A;  1R4P B;  3ULJ A;  1H9S A;  1K3B C;  4A3C H;  3KF6 A;  3Q0A A;  4DV5 Q;  3K7A H;  1CKN A;  1WJJ A;  2WII B;  3SEB A;  2A74 C;  4QY7 A;  2JA8 B;  2UXB L;  4CBV A;  2K1B A;  1LTG D;  4DFA A;  3JAM L;  4OGQ C;  4JI4 Q;  3P20 A;  4A3E B;  5IGG A;  2AKW B;  4KKT A;  1B53 A;  2XGT A;  1KLG D;  2MO1 A;  4LFC Q;  3E0E A;  2R7D A;  3CCE A;  2JEA I;  1PZK D;  3BJU A;  5ELE A;  2EXD A;  3TZD A;  1JWS D;  2QGQ A;  2R6G A;  3IAY A;  1J5E Q;  3EBE A;  5C4X B;  1MKH A;  1J9O A;  4HMJ A;  5E4X A;  1D8L A;  1CKM A;  1SNP A;  4OON A;  1SYG A;  2CQA A;  1AH9 A;  3M4Q A;  1WD1 A;  4FP5 D;  1WTW A;  4GZY C;  3DLL A;  2QDL A;  4YWM A;  1A0I A;  1XJV A;  1G29 1;  3CCU A;  3F2U A;  1ILP A;  1SSO A;  3SK8 A;  3I4O A;  1FL0 A;  1BUV T;  1PZI D;  1XTD A;  1YHB A;  3WDN A;  4KHP L;  3LWU A;  1M8A A;  4YCU A;  3GTM B;  3NEM A;  1A3V A;  5EBD A;  4JI7 L;  3VA7 A;  2DJG C;  1SDF A;  4K6L A;  4LAA A;  1WI5 A;  1PH7 A;  3BU2 A;  3KDF A;  3G48 A;  4I65 A;  3HOX B;  1CZG A;  1S5D D;  4JG2 A;  1X3Q A;  3CC4 A;  2DNE A;  3VDY A;  2NYZ D;  1TS5 A;  2AQ1 B;  3D6C A;  1SYF A;  3NP8 A;  3AYH B;  1HFN A;  1C7Y A;  1I94 Q;  1EYG A;  4DV4 L;  4BBR B;  1D7Q A;  4KHP Q;  2NN6 G;  1AE2 A;  3RUZ A;  2MP1 A;  3SVM A;  1V9P A;  2M2L A;  5D14 A;  4HN7 A;  3CCL A;  4JI7 Q;  5DLQ E;  4RCN A;  1WTR A;  4KHZ A;  2VUM G;  1VQG A;  1AN8 A;  4HID A;  3VYU A;  4CJ1 B;  2IJ0 A;  1W3S A;  5CC4 A;  3HOW H;  4KN7 C;  1A63 A;  2BE5 D;  2VZA A;  1SYB A;  3K0X A;  1D5M C;  1VQE A;  4DPG A;  3J80 c;  4OO1 H;  2SDF A;  1JR0 D;  5IGF A;  1PFS A;  2PZU A;  4V19 0;  1TWC B;  1EZ6 A;  5CR3 A;  3D6W A;  1G8Z D;  1QOH A;  1PFM A;  3K7U C;  4K14 A;  4A93 B;  1RIP A;  4FF3 A;  1MJE A;  4DV4 Q;  1DZ1 A;  1IKL A;  4HJ9 A;  2SEB D;  1B4O A;  1IHZ A;  4UP7 A;  4BY1 G;  3MEF A;  1NE3 A;  2UUC L;  5FK9 C;  1WFQ A;  3HP3 A;  4OXP A;  3S2D B;  3MAQ A;  3I4L A;  1K9M C;  1TWF B;  2R92 B;  3ER0 A;  4RHR A;  1N36 L;  1SE8 A;  2WB1 E;  3RLN A;  2Q2I A;  5IYD H;  4PV1 C;  2E74 C;  1A15 A;  1LTA D;  5AJ3 Q;  4GLX A;  1STB A;  1VF5 C;  1N33 L;  4C3J G;  3UE0 A;  4IZ8 A;  5IT9 L;  1DOM A;  3NTK A;  2Q8T A;  3K5L A;  1EY8 A;  1BCP C;  3MEH A;  3I2Z A;  5KIX A;  2UUC Q;  5KEE A;  1HNX L;  1L2F A;  1JE5 A;  2R93 H;  4LJZ C;  1EY6 A;  1SRU A;  3SGI A;  1D5Z C;  3E9H A;  2OTL A;  1QJO A;  3CP0 A;  3TP5 A;  1HZ9 A;  3FPP A;  2AWO A;  4E6I A;  1TWG B;  4A3I H;  1RTN A;  1FGB D;  5I9O A;  2B8G A;  1N33 Q;  5IGD A;  2B2W A;  2FMC A;  2JK8 A;  1EL0 A;  1STE A;  4LF5 L;  3J81 L;  4WRD A;  1O7Z A;  3OIP A;  2I5H A;  1TY2 A;  1BCP D;  4B9X A;  3QB3 A;  1HTL D;  4RGT A;  5IGE A;  4QUF A;  1MD2 D;  2A19 A;  4O42 A;  2ZXO A;  4C56 C;  3VR6 A;  4KN4 C;  4A4I A;  4P71 A;  3K80 C;  5BN3 A;  1Y8O B;  3O13 A;  2OXP A;  1G51 A;  5C4J B;  4RH6 A;  1SBB B;  2VNU D;  3I70 A;  4XXE A;  3S1M B;  1C4Q A;  2RDF A;  1QNU A;  3X3M A;  2ASB A;  4C3H H;  3DMU A;  1ZEQ X;  4PQX A;  4KKU A;  1LAB A;  1YJ9 A;  4N8X 1;  2BDN A;  2L4N A;  1S5E D;  3EVQ A;  3TSS A;  5TSS A;  1SJE D;  4DK3 C;  3H0G G;  2L5T A;  4LF5 Q;  5EPK A;  4G7H C;  4HMI A;  4PZ6 A;  4DNR B;  1HFG A;  1BF4 A;  1PTO C;  1V1P A;  2F3I A;  2N8N A;  4QB4 A;  2HD3 A;  1VS0 A;  5BN5 A;  1R9T B;  1Q1E A;  1OXV A;  3NHH A;  2K7V A;  1S72 A;  4FXK C;  5IYC G;  1S4Z A;  3SK5 A;  2K28 A;  2F0N A;  4L5T A;  3NBH B;  3HKZ B;  3I56 A;  3RZO B;  5JVG 3;  1O80 A;  1MJC A;  5M3M G;  5M5W B;  3SXH A;  3GTP B;  4ME3 A;  3CCJ A;  1UE1 A;  3EFX D;  1CA5 A;  1GKH A;  3S17 B;  1STY A;  4IUQ A;  2FJ2 A;  2K5D A;  1K8M A;  2EYP A;  2HIV A;  3S1R B;  3T13 A;  4FO2 A;  2JA5 B;  3OMC A;  3CCQ A;  1NAP A;  5M5X B;  1JJC B;  1EIH A;  1TKW B;  1EFW A;  4UP8 A;  5ELD A;  1EY5 A;  4DKA C;  4JCV E;  2OWO A;  1JIC A;  4LFA L;  3NTH A;  1YIT A;  3K5O A;  2L55 A;  2UUB Q;  5C3X A;  2WB1 G;  4HCE A;  3S24 A;  2YTX A;  3BZK A;  1TXY A;  5GRO A;  3V2T A;  3PIP A;  2AQ2 B;  3HOZ G;  2D0P A;  2Y0S G;  3W2D A;  2B2W C;  1HUM A;  2F0H A;  4KD4 A;  1AZQ A;  5C5L A;  4C1N I;  2AQ3 B;  2Z8L A;  2IPK D;  5KYL A;  2XRQ D;  3RZD B;  1ESF A;  1UEA B;  4IUR A;  4APV A;  2VXW A;  1IL8 A;  1XPO A;  2WV6 D;  4LFA Q;  4KY5 A;  4DAV A;  3HOV H;  4H13 C;  2I0Q A;  2OTJ A;  1QVF A;  4K6D A;  2F0M A;  4ZLT F;  4OWT B;  1HA6 A;  2JE6 I;  1Q12 A;  1VQB A;  1YNN D;  3BZD B;  4XT1 B;  1PTO H;  1SYC A;  2EYL A;  1U4L A;  2QW7 A;  1WTO A;  1I6H B;  4RWS C;  4B3R Q;  2F0P A;  1IYJ B;  2L9H A;  1CQV A;  4K0K L;  3PO2 G;  1KL9 A;  3U58 A;  5C44 B;  5COR A;  1F9Q A;  2OF1 A;  3UDG A;  4DR4 L;  1LTL A;  1OXS C;  2E76 C;  5D65 A;  5H1S E;  3J81 j;  1JOK A;  2LFN A;  1PFB A;  2YTV A;  1OXU A;  1CM9 A;  3C1F A;  3W1B A;  3K7A B;  2H5X A;  4GKJ L;  3PF5 A;  2CH4 A;  4MZ9 A;  4A3J G;  3T1Y L;  5LMN L;  2BA0 A;  2R7Z G;  1STA A;  2KCN A;  4GLA C;  3S2D H;  1N9W A;  3ND9 A;  3OMG A;  3H94 A;  4DV1 L;  2R92 H;  3MXN A;  3KLW A;  1L1O A;  3A8J E;  1YNX A;  1SFO H;  4C2M H;  4QUC A;  5LMU L;  3I8Z A;  2ZTD A;  2IL8 A;  1RDP D;  2ZXP A;  3R3O A;  4DR1 Q;  3A0J A;  4FDB A;  3DEP A;  4QIW E;  3PQI A;  4DR4 Q;  1K0S A;  4X6A H;  3VYS A;  3F2D A;  4BXX G;  3FKI G;  4L8J A;  3KUP A;  1L0W A;  5I6W A;  4TQU S;  1PH3 A;  2IW3 A;  4HJ5 A;  1FNU A;  4GNX A;  4C1N K;  4GKJ Q;  4PZ8 A;  2B29 A;  2JEB I;  2KJX A;  3T1Y Q;  4KV6 A;  4OX9 L;  5JJK A;  4R4T A;  5BR8 Q;  4A3D H;  1HH2 P;  3HKS A;  3STB D;  1KRS A;  3AFP A;  5IP7 G;  2BDO A;  4HTH A;  1EZ8 A;  2EIF A;  5HY6 A;  3RLO A;  1HNZ L;  5C0X I;  4FF2 A;  5IP9 G;  1RF2 D;  3JAM c;  1SE2 A;  2Z9H A;  1EQR A;  3HRZ C;  5LMU Q;  1PDQ A;  4C3I H;  4ZKB B;  3BG3 A;  5K36 G;  4ZUI A;  1D1K A;  4IFD J;  5DM6 3;  1CFM A;  4BY7 H;  4A3K H;  1EQQ A;  2KEC A;  1B3Q A;  2CFM A;  3FP9 A;  2N88 A;  3N52 A;  4K2L A;  5CYU A;  3J80 i;  2PZT A;  4L5Q A;  4R8N A;  4JI5 L;  2HHH L;  1EWH A;  1BO0 A;  3F2C A;  1FGU A;  4OX9 Q;  2PI2 A;  1D5X C;  2N78 A;  3P1H A;  1KXL A;  4XT3 B;  2I46 A;  2C9O A;  4IJL A;  1HNZ Q;  5C4J H;  1ENA A;  3DM1 A;  1PH9 A;  4JOI A;  4Y52 H;  1Y1V G;  3RR5 A;  3QIA A;  1I5F A;  2YV5 A;  1VQK A;  3I4N G;  3RNU A;  1BKB A;  4NPS A;  2GN5 A;  5JJL A;  4EQ5 A;  1I6V C;  1LV9 A;  4XYQ A;  1KLU D;  3HOW B;  5M9O A;  4JI5 Q;  1XNQ L;  2M9V A;  2HHH Q;  1A3T A;  3OOC A;  5E7N A;  2F4V L;  1SEB D;  2PI2 E;  3PO3 G;  1PH8 A;  3X3N A;  3HOY G;  3NTI A;  3CXC A;  3NWT A;  2IY5 B;  3S16 B;  1SRO A;  1F9R A;  1GXD C;  1UE5 A;  2JA7 G;  4U67 3;  3Q6S A;  1L1O C;  4A76 A;  4LF8 L;  1B9M A;  4Y7N H;  2ZXR A;  3D31 A;  4YCV A;  1HA5 A;  1II3 A;  1PH4 A;  4G7Z C;  4FF4 A;  3ERS X;  4OIK A;  1HHV A;  1Q3L A;  3PIP 3;  4FNF A;  3VR5 A;  1K8O A;  3OHX C;  4GOP A;  2KCM A;  2VQE L;  1ICW A;  2KCT A;  3S1R H;  4ZCK A;  1QUQ A;  2MO0 A;  2RA4 A;  4RKB A;  1Q86 C;  1XNQ Q;  1X55 A;  5C5M A;  1VMC A;  3CF5 A;  2EZV A;  3ONA B;  4GNX C;  1FNV A;  3I4M H;  4A3G G;  3VYR A;  2UU9 L;  1X9N A;  2RSO A;  1AE3 A;  2CWA A;  4Z9C B;  1BBU A;  3J80 E;  2NVX H;  4A3M G;  1WTQ A;  3NWS A;  4JI6 L;  2KUM A;  4A3F H;  4DXG A;  3DXJ C;  1IBL L;  3L3O C;  3UDI A;  4LF8 Q;  4KD3 A;  3BVG A;  3DHQ A;  4DUZ L;  4CDE C;  5ELC A;  1C0A A;  5HGQ A;  4KY6 A;  1HQR D;  4ZUJ A;  3A56 A;  3A8K E;  4OWX B;  2R93 B;  1N32 L;  3NQT A;  1PFN A;  1TII D;  4A3M H;  1ESR A;  4J15 A;  2VQE Q;  2X6L A;  1EY7 A;  1R4Q B;  4C3J B;  4LF9 Q;  1V8Q A;  2RHS B;  2WP8 J;  4FYD A;  1CTM A;  1M1K C;  1VQ7 A;  2UU9 Q;  4JI8 Q;  2NTS A;  1PRT C;  3RMH A;  5F2D A;  5C3E G;  4A3I B;  2MFI A;  5IIF A;  1YNJ D;  2NWG A;  2F1M A;  3RN2 A;  5C0X H;  4JI6 Q;  3KF6 B;  1LTS D;  2X69 A;  3C2P A;  1YVC A;  1IBL Q;  1FVI A;  2NN6 I;  4DA2 A;  3J7A F;  5ELB A;  2KOL A;  5CGK A;  4DV7 L;  4DUZ Q;  4DR7 L;  4RKL A;  4DR3 L;  1PMR A;  1STH A;  2AUK A;  3U9O A;  1DJR D;  2Q8R E;  5IT9 c;  2PCF B;  3UI2 A;  4V0B A;  3OSO A;  4OL7 A;  1N32 Q;  4A3B G;  1KNA A;  3C1E A;  2NBF A;  1TR5 A;  1WCM G;  4KTA A;  3WWV A;  4WJ4 A;  1VQP A;  4UP9 A;  4XYO A;  5FJ8 H;  3S1N H;  4C3H B;  3TRE A;  1HTP A;  4K5V A;  3VYT A;  1G6Z A;  2JN4 A;  3CC7 A;  5IE8 A;  1K83 H;  1WYD A;  2PMZ E;  2QEJ C;  4JV5 Q;  3KF8 B;  2QIL A;  4JBJ A;  4H7B A;  1C48 A;  1PV4 A;  1IYU A;  4R4O A;  4K5W A;  4DR3 Q;  3OW2 A;  1XWE A;  2OT2 A;  3H3V C;  2F0I A;  2K01 A;  2XN9 C;  4P74 A;  1SMX A;  1VQH A;  3J81 c;  2R7F A;  1E1O A;  1Z47 A;  2Q2U A;  1VMP A;  5ELN A;  3C3L A;  3E9I A;  1KQS A;  3TRZ A;  2K14 A;  2JA6 G;  1Y1W G;  1BCP B;  3U4V A;  3EN2 A;  1XMO L;  4TRD A;  1Y69 U;  2VS1 A;  3TS2 A;  2NVT B;  3BDO A;  2O5I C;  3FDT A;  3B6Y A;  4BBS G;  3F8T A;  3A5Z B;  4O2D A;  4P75 A;  3KDF B;  4O0A A;  4DU9 A;  3M7G A;  4EVO A;  5CV6 A;  5IYB G;  2MGS A;  1EEI D;  2X6G A;  2DY8 A;  2UXB Q;  1PH6 A;  1FD7 D;  2EE1 A;  3PUV A;  4L63 B;  5LMN W;  5M3M B;  1KTK A;  4L5S A;  3OWF A;  2DNC A;  3CPW A;  3A55 A;  2F4I A;  2K5N A;  3HOU G;  2Z4H A;  3CKI B;  2B2Y A;  2KHS A;  2E2H H;  2J4X A;  2NVQ H;  3NK9 A;  2PYK A;  1EQV A;  1XMO Q;  1A8V A;  1SN8 A;  1U9R A;  1I4R A;  3NSW A;  5A2Q E;  4RG1 A;  2XVS A;  1ZXT A;  3D3R A;  5KRU A;  2BE5 C;  1PH1 A;  1EUJ A;  1U0L A;  2AHO B;  1G2S A;  2WB1 B;  1EY4 A;  2F0K A;  1LYL A;  3J7Y W;  2Z6K A;  5JEA J;  1IBM L;  2VB2 X;  5EGT A;  5J1Z A;  1PZJ D;  5GQO A;  3HOV B;  4J6H A;  3S9W A;  1NSN S;  1P8L A;  4EGV A;  2FXQ A;  1X6O A;  3H3V H;  1PTO B;  1Q7Y C;  5G3L F;  1NNX A;  1SAP A;  2DUD A;  1W6J A;  2Z1C A;  1G2T A;  1S5C D;  1ENC A;  1VQD A;  4J1M A;  2NN6 H;  4LK1 C;  4UDU C;  3S16 H;  1SJH D;  4YIJ A;  4DGZ A;  4GKK L;  4OEM B;  4LF6 L;  1Y8P B;  1BVS A;  1TT2 A;  3PUW A;  2FHT A;  5FO8 B;  4OWW B;  5JEA G;  1GD7 A;  2VUM H;  1MHW C;  2XIW A;  3A74 A;  1KDB A;  4DUY L;  2BA1 A;  1QZG A;  3I90 A;  3ULL A;  1TWA B;  3T56 B;  5A35 A;  5JJZ A;  4FVM A;  4L5R C;  2IT1 A;  5K5P A;  1Y14 B;  1KAW A;  3I7F A;  3JAM i;  3OIQ A;  4IUT A;  1DM0 B;  2J7Z A;  1SFO B;  4C2M B;  1LAC A;  2K5Q A;  2H4O A;  2PW5 A;  2ZTC A;  1E2Z A;  4BY1 H;  3K5N A;  1TU2 B;  2WIN B;  4GKK Q;  4IOC A;  3K81 C;  5JPM C;  1ZYR D;  4IUV A;  1H9R A;  2Y0S E;  1OXT A;  1EYD A;  3PGZ A; 
#chains in the Genus database with same CATH homology
 4DNT B;  2B2Y C;  2A68 C;  3QJY A;  1QG7 A;  4A3D B;  1GUO A;  1JCK B;  2EVB A;  1RD9 D;  2JSO A;  3FMC A;  4DAY A;  2D2C C;  1Z7T A;  1HPC A;  1TQO A;  2ZT9 C;  4IQZ A;  4C3I B;  1HRJ A;  4AYB B;  2O4X A;  4K5X A;  4BY7 B;  4A3K B;  2TSS A;  3CRL C;  4RGM A;  5ISR A;  1OO9 B;  3DWQ A;  3T4A C;  1TS4 A;  2A68 D;  5COY A;  5ELF A;  2Q8I B;  3AB9 A;  4ILW A;  4FXD A;  1ROD A;  2BOS A;  2M00 A;  3OPO A;  2L0C A;  1RTO A;  3L9A X;  2SNM A;  4IN3 A;  1F2Y A;  4MHE A;  1BDO A;  1JC7 A;  3JAM E;  1SE3 A;  1RCV D;  2EYM A;  4H0L C;  5EJW A;  1Y1V B;  3WOF A;  2HCC A;  4BA1 I;  5KGU A;  1AEX A;  1W6K A;  1KNE A;  2EYF A;  4NP5 A;  1XTC D;  5EPJ A;  2ICI A;  4HAE A;  5J22 A;  4Y7N B;  4KJO A;  2VB3 X;  1IW7 D;  2QF7 A;  1D2B A;  4HR7 B;  2G9D A;  5C3W A;  5JOB A;  2K05 A;  3D4R A;  1GJX A;  3CQZ B;  1VCI A;  4FF1 A;  2A6H C;  5CMD A;  1U4R A;  2L12 A;  1KDA A;  3I4M B;  1NR4 A;  1GUN A;  3SR1 A;  2KQ3 A;  3NQI A;  2NVX B;  5NUC A;  1U4M A;  4I7Z C;  3PMF A;  4A3F B;  5G3L D;  2F0G A;  1O7L A;  1EU4 A;  1YNN C;  2EOT A;  3FEW X;  4NDX A;  4ID6 A;  5E3F A;  5LHY 1;  1BOS A;  1O7Y A;  4R8I A;  1SE4 A;  4A3M B;  2RDG A;  2CW0 C;  2N55 A;  2A6H D;  4EQP A;  5IOC A;  1NCV A;  3M4O B;  4MN3 A;  4CKC A;  4J8Q A;  1F9S A;  2DN8 A;  3PUY A;  1EIG A;  1CHP D;  1IYV A;  2QKI C;  2SOB A;  2OEO A;  4RGN A;  1V43 A;  1QIL A;  3KLS A;  2CW0 D;  2NB0 A;  3CU7 A;  5BN4 A;  1JQY D;  3MWY W;  3S1N B;  2PQE A;  1WTP A;  1MGS A;  5D3D A;  1K83 B;  3R2T A;  3E6Z X;  3MA2 B;  3KBX A;  3VR3 A;  2B2V A;  3IL8 A;  5FOB B;  4CJ0 B;  4H44 C;  3I73 A;  5JPN C;  3BYY B;  1BBX C;  4HSV A;  5IOD A;  4IAL A;  1SYD A;  1I4X A;  5IT9 E;  5E1F A;  2EY6 A;  1I4P A;  2EJM A;  3MTS A;  1GUG A;  4X3K A;  1LLR D;  3QO2 A;  5JVH 3;  2BCO A;  1RKN A;  4FXG C;  5EQ0 A;  3KBG A;  1E2W A;  4K8J A;  5I4D A;  3QOL A;  1PRT B;  2NZ1 D;  5FLX L;  4KI0 A;  1TY0 A;  3FPU B;  1SNO A;  2WAC A;  5FO7 B;  1D6E C;  3I72 A;  3J81 E;  2E2H B;  2NVQ B;  5T1I A;  5C6A A;  1DOK A;  2C5C A;  2K32 A;  3S14 B;  3EQL C;  5I2X A;  4ZK9 B;  3IFD A;  1JWU D;  1BXT A;  1OXX K;  4RGO S;  3WOE A;  1HUN A;  5K36 H;  3K6O A;  4ZRZ A;  5I6Y A;  4DK0 A;  2QDB A;  5CV5 A;  5E4W C;  1B1Z A;  4KKS A;  3M4Y A;  4N9T A;  2F0Q A;  4PNY A;  5HUR A;  2AWN A;  2A6E C;  4IFD G;  2F0V A;  4N9P A;  2V4D A;  2D9U A;  2A69 C;  4IUU A;  1ET9 A;  2ICE C;  5AFW A;  2YYZ A;  3RD4 A;  3R2I A;  2PNR C;  1A2T A;  1UNS A;  4LMQ D;  2D62 A;  1Q90 A;  3M7N A;  2B2V C;  2EYH A;  5EKK A;  3R93 A;  2VUM B;  3GV6 A;  2B8F A;  3MXG A;  3C46 A;  1ZKO A;  2A6E D;  1JE4 A;  1GHJ A;  1NUC A;  1LT4 D;  3TP6 A;  3SE0 A;  1WD0 A;  5EKL A;  1EYC A;  2A69 D;  2LY7 A;  4CKE A;  3SDZ A;  2FIN B;  1I3Q B;  4F8M A;  1TS3 A;  3GO5 A;  5I2Y A;  1Q8I A;  2XWJ B;  1LT6 D;  5CBA E;  4TKO B;  4BY1 B;  2I07 B;  3ERQ A;  3TBI B;  3A7L A;  3T16 A;  1YNJ C;  2IX1 A;  1H9K A;  1XYI A;  1EYA A;  2L1B A;  5C0X J;  1L0Y B;  1LO5 D;  2MPM A;  3K57 A;  2PMZ B;  1AP0 A;  4B08 A;  3OW7 A;  2B2U A;  3IFT A;  3LWE A;  5FKA C;  1B44 D;  3MVV A;  3EA6 A;  3AMU A;  2RQX A;  3SK6 A;  1UAP A;  1CK1 A;  1H9S B;  2PO4 A;  5CBE E;  1DON A;  4XIG S;  4KK7 A;  4DN4 M;  2F0O A;  1AW7 A;  3E5S A;  4ZKC B;  2F0E A;  5DM7 3;  2HUG A;  3DWP A;  1DCZ A;  2KED A;  4WOR A;  1QE6 A;  1RJT A;  5DAU A;  1NR2 A;  1KDC A;  1H9J A;  2PW7 A;  3DWA A;  2HCI A;  4CGY B;  4WFN 3;  3GP7 A;  1F2M A;  3MC0 B;  3VR4 A;  2F0S A;  3BYT B;  1A3U A;  4RHS A;  1HQM C;  2K33 A;  4Q0F A;  2D5D A;  4KJN A;  3GTJ B;  3I91 A;  3H0G B;  4PMC A;  1LTR D;  2K6A A;  3AU7 A;  4M8A A;  3GTQ B;  3D8G A;  5KYI A;  3NE5 B;  4EQO A;  1BCP F;  1VDZ A;  2HQE A;  5FLX E;  1JOO A;  3J7A V;  3HEJ A;  1MBY A;  1MSG A;  1T5X D;  2B2U C;  1F9P A;  3KF8 A;  1LT5 D;  4K2K A;  2CHB D;  4NMZ A;  1ML0 D;  5CV4 A;  3U9S A;  4ME5 A;  1X3P A;  3LX0 A;  4QF4 A;  3MXU A;  2MJ8 A;  4PMW A;  3PIO 3;  2E2J B;  1KAB A;  3I3C A;  1MSH A;  3MFY A;  1JOQ A;  3S2H B;  2FMM A;  4XTC S;  2F3V A;  4DK1 A;  3GV3 A;  3HS0 C;  3HOZ B;  2NTT A;  3ND8 A;  2Y0S B;  1CA6 A;  3DUZ A;  3OWE B;  2O5J C;  1UUP A;  2JYO A;  1PTO F;  3NUC A;  4RCO A;  2KA7 A;  1B3A A;  2JP1 A;  2WAQ B;  3V96 A;  4OO1 G;  1Q1B A;  3BVM A;  3PV0 A;  1ZYR C;  3V05 A;  2ID0 A;  2E75 C;  1E0B A;  1PYW D;  1F2L A;  2IWH A;  3PO2 B;  1LTT D;  1ONL A;  3ZYY X;  1B50 A;  1FR3 A;  3BDL A;  3CHB D;  3GTL B;  1BR9 A;  3A7A B;  1QWY A;  1TS2 A;  3QG1 A;  3DEO A;  5JEA H;  1KAA A;  3Q22 A;  2QCP X;  2B2T A;  5LL6 S;  4CJ2 C;  5LL6 X;  3Q23 A;  1Z6H A;  1SND A;  5CV7 A;  4JBW A;  1SYE A;  2H1E A;  4A3J B;  1PXU A;  1EOT A;  2R7Z B;  3S15 B;  4G57 A;  3Q24 A;  1FYC A;  1F2Z A;  1EU3 A;  2EYO A;  4CHT B;  1QCB D;  5J39 A;  3FKI B;  2HDM A;  2EY5 A;  1SNQ A;  5I9P A;  4K8I A;  3TME A;  3KLS X;  2E2I B;  3EJI A;  2WKC A;  1EY0 A;  1GUW A;  2RSN A;  4ZYS A;  1I4G A;  1S5F D;  3NPP A;  2K03 A;  3QOJ A;  3K59 A;  3K0Y A;  1GUS A;  1EFI D;  1V1P B;  2RVL A;  4EQN A;  4P2C B;  2TMP A;  4F7X A;  5JAV A;  1B9N A;  4S3S A;  4C3H G;  1BQQ T;  1GUT A;  1GOZ A;  1IW7 C;  5EBC A;  2XNA C;  5IGC A;  5EPL A;  1STN A;  2F0U A;  2B39 A;  1EY9 A;  1EWC A;  1MI2 A;  4XDX A;  4JK1 C;  4OHJ A;  1D1I A;  3TP7 A;  3D4D A;  5HGT A;  3I4N B;  2B2T C;  1I50 B;  4IUN A;  1SXT A;  4X3S A;  1SMY C;  2PZW A;  1J8I A;  1HXY D;  3PO3 B;  3TN2 A;  3HOY B;  3NXW A;  1CT1 D;  2IX3 A;  1AZP A;  4CKB A;  2Z4I A;  2JA7 B;  2F0T A;  1TVX A;  4X3U A;  3HZX A;  3HGB A;  2LS0 1;  4DF7 A;  3GD7 A;  3K5M A;  3P75 A;  1SNM A;  2EXZ A;  4G4K A;  2K04 A;  2LKV A;  4XQJ A;  4BWG B;  1SMY D;  2L11 A;  4Q5V A;  4PMB A;  2F03 A;  4X3T A;  4A3G B;  2HDL A;  1PTO D;  3CRK C;  4R9W A;  1EEF D;  2XSC A;  1A2U A;  3MZ5 A;  1I4H A;  2B63 B;  1CZW A;  1LTB D;  3NBH A;  1WTV A;  5M3F B;  5DEH A;  3LNN A;  1DD2 A;  3FRP B;  1HCZ A;  4OIJ A;  5KNC A;  4U68 A;  4ZAI A;  5D3I B;  3J80 L;  2KEE A;  3N6R A;  4QIW B;  1JB3 A;  2F0D A;  2K5W A;  4M1U B;  4F87 A;  2LMC B;  4O1N A;  1F77 A;  5FO9 B;  1WTX A;  2EJF C;  2KCC A;  4IFD I;  3H91 A;  5C3E B;  3TP8 A;  3IKJ A;  1B2T A;  3S1Q B;  2J0T D;  2RKS A;  4BA2 I;  4HCS A;  5CV8 A;  3GTG B;  3T51 B;  4HED A;  1V1O A;  1GHK A;  4ABN A;  4A3B B;  3H09 A;  2AUJ D;  2R3Z A;  2RBM A;  3PUX A;  2MHV A;  1WCM B;  1XXG A;  2MUY A;  3ERO A;  2WKD A;  4RAU C;  3SHL A;  2EYJ A;  1TWH B;  2RDH A;  3BVZ A;  4HSP A;  2G9H D;  3GQB A;  3PUZ A;  1X32 A;  2NVY B;  3VA5 A;  4L6T B;  3RLF A;  1H9M A;  1DOL A;  2GA4 B;  2JXM B;  4ZQ3 A;  1ENF A;  1IKM A;  2JA6 B;  1Y1W B;  3SK4 A;  1CHQ D;  3E0J A;  3KK7 A;  1QNK A;  1PRT F;  5T1G A;  4BBS B;  4IUP A;  2XRS D;  4C3I G;  5DNF A;  1G91 A;  4ODG A;  3BS1 A;  2IX0 A;  3K58 A;  3H6M A;  2PPB C;  2EY2 A;  3HOU B;  2F0F A;  2E2D C;  3T53 B;  1DXM A;  2EJG C;  2YU9 B;  1PLF A;  1L0X B;  2F0W A;  4XQN A;  2F3W A;  1AFP A;  1SNC A;  5A2Q L;  2F0J A;  3TZU A;  1ET6 A;  2DY7 A;  4QMG A;  3GTK B;  1RHP A;  1S5B D;  4IFD H;  1LTI D;  4NW2 A;  2O2L D;  4TSS A;  4B9W A;  4RA8 A;  1C8C A;  3URY A;  2A73 B;  1U4P A;  3FVQ A;  1JWM D;  4G7O C;  1A6X A;  4QCL A;  2FFK B;  4KY7 A;  1E2V A;  3M85 A;  1XX8 A;  1CQF A;  2KVM A;  5EKI A;  1I4Q A;  3QWN A;  1O78 A;  1BNZ A;  2EY1 A;  2SNS A;  3NBI A;  1ILQ A;  2NUC A;  1CI3 M;  2R61 A;  3TDQ A;  3KLR A;  1QB5 D;  4RFB A;  3ITP A;  4XQQ A;  2EPB A;  3G7L A;  3R8B A;  4F88 A;  5IGB A;  3A54 A;  4DXF A;  1WVL A;  4KHV A;  5M5Y B;  1EQT A;  5CV9 A;  5C4H A;  1JOR A;  3MHB A;  1FNW A;  2XWB B;  1DYQ A;  5C0X G;  4MIU A;  5KND A;  3MFG A;  3L7Z C;  1STG A;  4BS9 A;  2ENB A;  3G6J B;  3P7J A;  3W3A A;  5KNB A;  3A8I E;  1Y8N B;  4WJW A;  2CVR A;  2EDG A;  4NKL A;  3BDC A;  5C4Z A;  4ULL A;  4OO1 I;  3MXP A;  4UAI A;  3HG9 A;  1M4V A;  1LT3 D;  1VF7 A;  3D4W A;  4DAP A;  3VR2 A;  3M3Y B;  3GTO B;  2A5H A;  4KMU C;  1T5E A;  2F0L A;  1PRT D;  1R4P B;  1H9S A;  3Q0A A;  2WII B;  3SEB A;  2A74 C;  2JA8 B;  4CBV A;  2K1B A;  1LTG D;  4DFA A;  3JAM L;  4OGQ C;  3P20 A;  4A3E B;  5IGG A;  4KKT A;  1B53 A;  1KLG D;  2JEA I;  1PZK D;  5ELE A;  3TZD A;  1JWS D;  2R6G A;  3IAY A;  5C4X B;  1J9O A;  4HMJ A;  5E4X A;  1SNP A;  1SYG A;  2CQA A;  1WD1 A;  4FP5 D;  1WTW A;  4GZY C;  1G29 1;  3F2U A;  1ILP A;  1SSO A;  3SK8 A;  1BUV T;  1PZI D;  3WDN A;  3LWU A;  1M8A A;  3GTM B;  1A3V A;  5EBD A;  3VA7 A;  1SDF A;  4K6L A;  4LAA A;  4I65 A;  3HOX B;  1CZG A;  1S5D D;  1X3Q A;  2DNE A;  2NYZ D;  1TS5 A;  2AQ1 B;  3D6C A;  1SYF A;  3NP8 A;  1HFN A;  4BBR B;  2NN6 G;  3RUZ A;  2MP1 A;  3SVM A;  2M2L A;  5D14 A;  4HN7 A;  4RCN A;  1WTR A;  4KHZ A;  1AN8 A;  3VYU A;  4CJ1 B;  2IJ0 A;  5CC4 A;  4KN7 C;  2BE5 D;  1SYB A;  1D5M C;  4OO1 H;  2SDF A;  1JR0 D;  5IGF A;  2PZU A;  4V19 0;  1TWC B;  1EZ6 A;  5CR3 A;  3D6W A;  1G8Z D;  1QOH A;  1PFM A;  4K14 A;  4A93 B;  4FF3 A;  1DZ1 A;  1IKL A;  2SEB D;  1B4O A;  1IHZ A;  5FK9 C;  3HP3 A;  3S2D B;  3MAQ A;  3I4L A;  1TWF B;  2R92 B;  4RHR A;  4PV1 C;  2E74 C;  1A15 A;  1LTA D;  1STB A;  1VF5 C;  4C3J G;  4IZ8 A;  5IT9 L;  1DOM A;  3NTK A;  2Q8T A;  3K5L A;  1EY8 A;  1BCP C;  3MEH A;  5KIX A;  5KEE A;  4LJZ C;  1EY6 A;  1D5Z C;  1QJO A;  3TP5 A;  3FPP A;  2AWO A;  4E6I A;  1TWG B;  1RTN A;  1FGB D;  5I9O A;  2B8G A;  5IGD A;  2B2W A;  2FMC A;  1EL0 A;  1STE A;  3J81 L;  4WRD A;  1O7Z A;  3OIP A;  1TY2 A;  1BCP D;  4B9X A;  3QB3 A;  1HTL D;  4RGT A;  5IGE A;  4QUF A;  1MD2 D;  4O42 A;  2ZXO A;  4C56 C;  3VR6 A;  4KN4 C;  5BN3 A;  1Y8O B;  3O13 A;  2OXP A;  5C4J B;  4RH6 A;  1SBB B;  2VNU D;  3I70 A;  4XXE A;  3S1M B;  1C4Q A;  2RDF A;  1QNU A;  3X3M A;  3DMU A;  1ZEQ X;  4PQX A;  4KKU A;  1LAB A;  2BDN A;  2L4N A;  1S5E D;  3EVQ A;  3TSS A;  5TSS A;  1SJE D;  2L5T A;  5EPK A;  4G7H C;  4HMI A;  4DNR B;  1HFG A;  1BF4 A;  1PTO C;  1V1P A;  4QB4 A;  5BN5 A;  1R9T B;  1Q1E A;  1OXV A;  3NHH A;  2K7V A;  4FXK C;  1S4Z A;  3SK5 A;  2K28 A;  2F0N A;  3HKZ B;  3RZO B;  5JVG 3;  1O80 A;  5M5W B;  3SXH A;  3GTP B;  3EFX D;  1CA5 A;  3S17 B;  1STY A;  4IUQ A;  2FJ2 A;  2K5D A;  1K8M A;  2EYP A;  3S1R B;  3T13 A;  4FO2 A;  2JA5 B;  3OMC A;  1EIH A;  1NAP A;  5M5X B;  1TKW B;  5ELD A;  1EY5 A;  1JIC A;  3NTH A;  3K5O A;  2L55 A;  5C3X A;  4HCE A;  3V2T A;  2AQ2 B;  3W2D A;  2B2W C;  1HUM A;  2F0H A;  4KD4 A;  1AZQ A;  5C5L A;  4C1N I;  2AQ3 B;  2Z8L A;  2IPK D;  5KYL A;  2XRQ D;  3RZD B;  1ESF A;  1UEA B;  4IUR A;  2VXW A;  1IL8 A;  2WV6 D;  4KY5 A;  4DAV A;  4H13 C;  4K6D A;  2F0M A;  4ZLT F;  1HA6 A;  2JE6 I;  1Q12 A;  1YNN D;  3BZD B;  4XT1 B;  1PTO H;  1SYC A;  2EYL A;  1U4L A;  1WTO A;  1I6H B;  4RWS C;  2F0P A;  2L9H A;  1CQV A;  5C44 B;  5COR A;  1F9Q A;  2OF1 A;  1OXS C;  2E76 C;  5D65 A;  1JOK A;  2LFN A;  1PFB A;  1OXU A;  1CM9 A;  3C1F A;  3K7A B;  2BA0 A;  1STA A;  2KCN A;  3ND9 A;  3OMG A;  3H94 A;  3MXN A;  3A8J E;  4QUC A;  3I8Z A;  2IL8 A;  1RDP D;  2ZXP A;  3R3O A;  3DEP A;  3VYS A;  4L8J A;  3KUP A;  5I6W A;  4TQU S;  2IW3 A;  1FNU A;  4C1N K;  2JEB I;  2KJX A;  4KV6 A;  2BDO A;  4HTH A;  1EZ8 A;  5C0X I;  4FF2 A;  1RF2 D;  1SE2 A;  3HRZ C;  1PDQ A;  4ZKB B;  3BG3 A;  5K36 G;  4ZUI A;  1D1K A;  4IFD J;  5DM6 3;  1CFM A;  2KEC A;  4K2L A;  2N88 A;  3N52 A;  5CYU A;  2PZT A;  4R8N A;  1EWH A;  1BO0 A;  1D5X C;  3P1H A;  4XT3 B;  2I46 A;  2C9O A;  1ENA A;  3DM1 A;  3QIA A;  1I6V C;  1LV9 A;  4XYQ A;  1KLU D;  3HOW B;  5M9O A;  2M9V A;  1A3T A;  3OOC A;  1SEB D;  3X3N A;  3NTI A;  3NWT A;  3S16 B;  1F9R A;  1GXD C;  4U67 3;  3Q6S A;  1B9M A;  2ZXR A;  3D31 A;  1HA5 A;  1II3 A;  4FF4 A;  4G7Z C;  4OIK A;  1HHV A;  1Q3L A;  3PIP 3;  4FNF A;  3VR5 A;  1K8O A;  3OHX C;  1ICW A;  2RA4 A;  4RKB A;  5C5M A;  1VMC A;  2EZV A;  3ONA B;  1FNV A;  3VYR A;  2RSO A;  4Z9C B;  3J80 E;  1WTQ A;  3NWS A;  2KUM A;  4DXG A;  3DXJ C;  3L3O C;  4KD3 A;  3BVG A;  3DHQ A;  5ELC A;  4KY6 A;  1HQR D;  4ZUJ A;  3A56 A;  3A8K E;  2R93 B;  3NQT A;  1PFN A;  1TII D;  1ESR A;  2X6L A;  1EY7 A;  1R4Q B;  4C3J B;  1V8Q A;  4FYD A;  2WP8 J;  1CTM A;  2NTS A;  1PRT C;  3RMH A;  5F2D A;  4A3I B;  5IIF A;  1YNJ D;  2NWG A;  2F1M A;  5C0X H;  1LTS D;  2X69 A;  3C2P A;  2NN6 I;  4DA2 A;  3J7A F;  5ELB A;  2KOL A;  5CGK A;  4RKL A;  1PMR A;  1STH A;  2AUK A;  3U9O A;  1DJR D;  2Q8R E;  2PCF B;  3UI2 A;  4V0B A;  3OSO A;  4OL7 A;  1KNA A;  3C1E A;  2NBF A;  1TR5 A;  4KTA A;  4XYO A;  4C3H B;  1HTP A;  4K5V A;  3VYT A;  1G6Z A;  2QEJ C;  2QIL A;  4H7B A;  1C48 A;  1IYU A;  4K5W A;  1XWE A;  2OT2 A;  3H3V C;  2F0I A;  2K01 A;  2XN9 C;  1Z47 A;  1VMP A;  3C3L A;  1BCP B;  4TRD A;  1Y69 U;  2NVT B;  3BDO A;  2O5I C;  3FDT A;  4EVO A;  4DU9 A;  3M7G A;  5CV6 A;  2MGS A;  1EEI D;  2X6G A;  2DY8 A;  1FD7 D;  2EE1 A;  3PUV A;  4L63 B;  5M3M B;  1KTK A;  3OWF A;  2DNC A;  3A55 A;  2F4I A;  2Z4H A;  3CKI B;  2B2Y A;  2KHS A;  2J4X A;  3NK9 A;  2PYK A;  1EQV A;  1U9R A;  1I4R A;  3NSW A;  5A2Q E;  2XVS A;  1ZXT A;  3D3R A;  5KRU A;  2BE5 C;  1G2S A;  2WB1 B;  1EY4 A;  2F0K A;  3J7Y W;  5JEA J;  2VB2 X;  5EGT A;  5J1Z A;  1PZJ D;  3HOV B;  4J6H A;  3S9W A;  1NSN S;  4EGV A;  1PTO B;  5G3L F;  1SAP A;  1W6J A;  2Z1C A;  1G2T A;  1S5C D;  1ENC A;  4J1M A;  2NN6 H;  4LK1 C;  4UDU C;  1SJH D;  4YIJ A;  4DGZ A;  1Y8P B;  5FO8 B;  1TT2 A;  3PUW A;  2FHT A;  5JEA G;  2XIW A;  1KDB A;  2BA1 A;  3I90 A;  1TWA B;  3T56 B;  5A35 A;  5JJZ A;  4FVM A;  2IT1 A;  5K5P A;  3OIQ A;  4IUT A;  1DM0 B;  2J7Z A;  1SFO B;  4C2M B;  1LAC A;  2K5Q A;  2H4O A;  2PW5 A;  1E2Z A;  3K5N A;  1TU2 B;  2WIN B;  5JPM C;  1ZYR D;  4IUV A;  1H9R A;  1OXT A;  1EYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...