2F52A

Solution structure of cold shock protein cspb from bacillus subtilis in complex with heptathymidine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/transcription
molecule keywords Cold shock protein cspB
publication title Recognition of T-rich single-stranded DNA by the cold shock protein Bs-CspB in solution.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f52A00
2NN6I 2RCNA 4BY7H 2KHIA 3AFQA 2ATWA 1K8AC 5M5YH 2D62A 5C0XG 1S40A 5IP7G 1X54A 2BH8A 3RLNA 4BXXH 1WYDA 1I94L 1M90C 4LF9L 4JI6Q 4P74A 4DR3L 1JB7A 1WCMG 1CKMA 4QGUA 4A93G 3L2PA 2NVXH 3HKZE 5C4XH 1JT8A 4QIWE 4LF4L 2NVQH 3E0EA 2HIXA 3BZKA 3PUVA 4JI1Q 4GNXB 1YHQA 1IBMQ 4DK3C 1VQEA 1FJGL 1Q8KA 3GD7A 1XPOA 4X66L 4JI2Q 1VQGA 4BBRH 4A3KH 1J5EQ 2CFMA 2YTYA 3DM3A 2D0PA 4NB3A 1J6QA 4NXMQ 1B8AA 2PMZE 2XTIA 3GTKH 5AJ3L 3GTQH 4A3CG 1U5KA 1YJWA 4GOPB 3I4MG 1VQPA 1EOVA 5GQOA 2YU9H 1VQBA 2HQLA 4O2DA 3CPWA 1N33Q 4LF5L 4NXNQ 4YCVA 3CD6A 3EBEA 4OXPA 1BBWA 5E7NA 2HIVA 2K50A 3KF8B 3T1HQ 1PH8A 2GN5A 2LSSA 2NN6G 3GTJH 2A1AA 3NENA 4P75A 1WI5A 1Z47A 1X55A 4JG2A 1Q46A 5C44H 3HKZG 4LFBL 3UDXA 4HJ5A 3WWVA 1BVSA 5IYCH 1LM0A 4HIMA 1CUKA 3UE0A 4OONA 4X62Q 1Q81C 1HNXL 3JAMi 1NE3A 4DUZQ 4BY7G 4A3DH 3ULPA 3NEMA 1R9TH 2JEBI 1XMQQ 4BXXG 3M4PA 1TWFH 1PVOA 4DV7L 2JA5H 3M85A 1N36Q 4GS3A 2KBNA 1EFWA 2BA0A 4DV1L 1VQ6A 1D8LA 2QEXA 1D7QA 5C4XG 1YHAA 2IX0A 4GLXA 2E5LQ 1A8VA 2DGYA 4GNXA 3S14H 2D0OA 4K0KQ 3RLFA 2E2HH 2K52A 3F2DA 3HOXH 3CMAA 2CWAA 1X9NA 1IBLQ 4JI0L 2MFIA 3HOZH 4H02A 1XMOQ 2UXDL 4R1JA 4BBRG 2ASBA 4A3KG 4KLKA 2N49A 1Q1EA 5IWAQ 1BKBA 1HR0L 3TRZA 1MIUA 3I2ZA 4YWLA 4JI8L 1YITA 2CWPA 2ZJPA 2Y0SE 2I0QA 2GVAA 4JBMA 4GOPA 3A0JA 2N3SA 5IYDG 4YHHQ 3CP0A 4DUYL 1HZBA 1U0LA 3Q8DA 4DV0L 2JEAI 3TS2A 2H5XA 1H95A 4IOAA 1KIXA 3U58A 5LMNL 2PQAB 2AHOB 4JI3Q 4B3MQ 5M3MH 2HT1A 3W1BA 1M1KC 3I55A 4C2MH 1EQRA 5C44G 3STBD 3PIPA 3H15A 4JBKA 2UUAQ 1XPUA 3S1NH 2JK8A 2Z0SA 4JI7L 5IYCG 2ZTCA 2UUBL 3HOWH 4BA2I 1VQCA 4WJ3M 1HR0W 4A3DG 2N8NA 2PI2E 4UP7A 4JI4L 4JI5L 3KJOA 3GTLH 4A3IH 1SRUA 2Y0SG 4R4TA 1A62A 3KOJA 2UUCQ 3GO5A 2OCEA 2JA5G 4DR2L 1KQSA 1XTDA 4O0AA 4DV2Q 1SROA 5LMNW 4NPSA 3G71A 3K81C 3KF6B 1L2FA 3HOXG 2VQFL 3J81c 2UXCL 3HOZG 2R7FA 4DV3Q 1XNQQ 1W3SA 1N34Q 3CCRA 1K3RA 1DGSA 2EQSA 2HHHQ 2V1CC 3PF4A 4DR4L 4LUZA 1VQLA 2VQEL 1IXRA 4B3SL 2VUMH 3T1YL 4LFCQ 1VCIA 3SGIA 2LXKA 1UWVA 5IY0A 3GTPH 1MJCA 2PQAA 5FLMG 4ALPA 4BY1H 1TWAH 3M4QA 4IPHA 1BBUA 1EYGA 1Z9FA 1SLJA 1WFQA 1WJJA 5M3MG 3CXCA 4A3LH 4EQ5A 3F1ZA 4YY3Q 2CQOA 1X56A 3RLOA 4J15A 1T9HA 4YWMA 4DR6Q 3PGZA 3PCOB 3U4ZA 2AMCB 1PH3A 2JA6H 1GM5A 3HFZB 4LW1A 4P72A 3BU2A 3U50C 4OO1I 4UPAA 3HOYH 1YNXA 4A3IG 2VS1A 1V43A 4OX9Q 2JE6I 3D31A 2CCZA 3I7FA 3GDEA 3AFPA 4DV5L 3LGJA 1UE7A 3BZCA 3TREA 2RF4A 4PZ8A 1K73C 1NJIC 4L5SA 2JA7H 2IHEA 3S17H 1JJCB 4KHPQ 2MQHA 3UDGA 2WAQE 1QUQB 4DV6L 1JJ2A 3KF6A 2Q2HA 1VQNA 3M4OH 1E7ZA 1TXYA 1VQ5A 1K8GA 4LUOA 4TQUS 2UXBQ 1X6OA 1PFSA 4KHZA 1XJVA 1K9MC 4POGA 4HIOA 4GN4B 2R7ZH 2B63H 3W1GA 2DUDA 4A3MH 1N32L 1NMGA 4JOIA 4IO9A 5GAEC 3AQQA 1B70B 1KD1C 2XGTA 2K14A 1P16A 2YYZA 3RR5A 3TEHB 3S1RH 2VUMG 4JV5Q 4X6AH 1SR3A 1V1QA 1VQ9A 5JJIA 1HNWL 1HZCA 3G6EA 3S15H 4DR7L 2WP8J 5ELNA 3CCEA 2K5HA 3K8AA 4BY1G 3E9HA 1IL2A 1EIYB 2Q2IA 1TWGH 2Z6KC 4XIGS 2F4VQ 4A3LG 4OO1G 4GN5A 2WAQG 4JC0A 1HNZQ 1OTCA 4HIKA 3T1YQ 1Y1VH 4IPGA 1PV4A 1AH9A 1Q7YC 2JA6G 3CC7A 2IT1A 4GKJQ 3HOYG 4B3RL 1XNRQ 2R93H 3J80i 4YCWA 3JAMc 4A4IA 3GTGH 1PYSB 4QY7A 4AYBE 5M3FH 1IBKQ 3RN5A 4LF6Q 2JA7G 5C4JH 2R92H 3PO3H 4X65Q 4AIMA 4JYAL 5GROA 1QUQA 1UE5A 3CCUA 1KHIA 2UU9L 4B3TQ 1X3EA 3RNUA 3RN2A 3CCSA 5LMUQ 5LMUL 4AQYL 1QVCA 2F3IA 1KAWA 3OTOL 1VQHA 5EAYA 3A5UA 1GO3E 2AKWB 4GOPC 1MJEA 2B63G 2R7ZG 3CCMA 4LFAL 1VQIA 1V9PA 2ALYB 2ZJRA 1N8RC 3GTOH 5JEAJ 2E2IH 1I94Q 2I5MX 4GKKL 4LF9Q 1HZAA 2OQKA 4YCUA 2MNAA 2B29A 4DR5L 1EUJA 1C9OA 4DR3Q 3ULLA 4LF8L 1YIJA 1NBWA 2A19A 4X64L 5M5XH 1LUZA 2KCMA 1B7YB 4LF4Q 1QVGA 1GD7A 4LNQA 2K4KA 3STBC 5BR8L 4AYBG 4DV4L 3PSIA 1KRTA 1FJGQ 2IY5B 4X66Q 1Q82C 2EXDA 3AYHB 5IYBH 5GADC 1OXXK 2WFWA 3CCJA 4LF7L 1E24A 4A3EH 1AE3A 3RZDH 2VNUD 3PO2H 2JQOA 1X3GA 1Q12A 4JBJA 4APVA 5AJ3Q 1PH5A 2JA8H 1S72A 4DR1L 1VQMA 1Y1VG 1QZHA 1VQ4A 4UY8C 2CKZB 4AH6A 1RL2A 1QZGA 4LF5Q 4BBSH 2R93G 2Q2UA 1VQJA 1KC8C 1S3OA 4BA1I 5M3FG 1IYJB 4L5RC 3PO3G 3ERSX 4DNIA 3W5OA 2FXQA 4IFDI 1L1OC 3TS0A 1LTLA 2PI2A 4LFBQ 4A75A 3BJUA 1VQDA 4DKAC 3L7ZC 4RMFA 3FKIH 3D0FA 1EIFA 2L15A 2QA4A 1SE8A 5C3EH 1I3QH 1HNXQ 4JI6L 3I4OA 1TWHH 1X65A 3B6YA 3NBHB 3ZJYC 3PIOA 3S24A 4JI1L 4QQBX 1IBML 1SN8A 1JE5A 4DV7Q 4JI2L 4MZ9A 2OTJA 2PNHA 4DV1Q 5J3BA 1VQOA 1QVFA 4A3JH 5IE8A 4NXML 3KLWA 4OWTB 2LXJA 4JI0Q 3VDYA 3CC4A 1WCMH 4LWCA 2UXDQ 3UDIA 2ZM6L 1W2BA 3PUXA 1HR0Q 4NXNL 4HJ8A 1N33L 3ICEA 4A3EG 3I4NH 4JI8Q 3K80C 3PO2G 3T1HL 2N78A 2JA8G 4QJFA 4PZ7A 3KJPA 4DAYB 4IFDG 4DUYQ 1GKHA 3HOWG 5IT9c 1FGUA 2AWOA 4DV0Q 3KYHC 4BBSG 5LMNQ 4GLAC 1HZ9A 3A74A 4PZ6A 4P71A 3S16H 2F52A 3NELA 3JC66 3HOUH 4DPGA 4DUZL 1G51A 2QGQA 4XTCS 1XMQL 3K7AH 3G4SA 1PH1A 1PA6A 4JI7Q 3CCVA 1ASYA 4A3BH 3S1QH 4IFDJ 2YTVA 4HJ9A 3FKIG 2UUBQ 4JOIC 3MEFA 1N36L 1FL0A 1NY4A 2KENA 5C3EG 2OQ0A 3M9BA 3K7UC 4JI4Q 4JI5Q 1GVPA 4K0KL 4WJ4A 2YV5A 4IJHA 5M5WH 1IBLL 1XPRA 1YHBA 1XMOL 4HJAA 5ELOA 1SFOH 4DR2Q 4IJLA 3UDFA 3M7NA 5GAHC 5IWAL 4A3JG 4GLVB 2R6GA 2ES2A 4OWWB 3A5ZB 4C3HH 2UXCQ 2VQFQ 3PUYA 3PUWA 2ID0A 4IPDA 1CKNB 4YHHL 3CAMA 1OXTA 4R4QA 1VS0A 3UE1A 3H0GH 4MTNA 4R4OA 1VQFA 5HY6A 3U4VA 3I4NG 1YI2A 4DR4Q 4JI3L 1PH4A 1RIPA 5C0XJ 2VQEQ 4B3ML 4B3SQ 1E22A 3I56A 2RHSB 2NZOA 3OYYA 1PYBA 1WOCA 2UUAL 1OXSC 1EQQA 2VZAA 4UP8A 2I5HA 5JJKA 3ULJA 2IX1A 1KRSA 4IPCA 3J7A5 1JMCA 2EIFA 1Y1WH 5IYDH 3J80c 2ZM6Q 4HJ7A 3CF5A 3HOUG 4GNXC 3S1MH 1JJGA 4HIDA 3TQYA 4PMWA 4UP9A 5JEAG 1NMFA 2KHJA 3H3VH 1A63A 3CCQA 4A3BG 5FLXc 3OW2A 2RHQB 3G48A 1AE2A 2UUCL 4A3GH 1I6HH 1MKHA 3HKSA 4L5QA 4DV2L 4A3MG 1PH7A 2Z6KA 1X3FA 1G6PA 3H3VI 1C0AA 2ZTDA 3KDFB 5JJLA 4C3JH 4DV5Q 4DV3L 1XNQL 1N34L 1EWIA 4DAMA 2HHHL 3AEVA 4DV6Q 1C7YA 3RZOH 1OXUA 1OXVA 3K0XA 3FP9A 2I5LX 1CKNA 4LFCL 3HOVH 1VQ7A 4GN3B 1UE6A 2VY3A 2MO1A 3F2CA 1N32Q 4YWKA 2BA1A 1E1OA 2JJQA 3H0GG 3PV0A 4R4IA 4POFA 4JBWA 4ME3A 3F8TA 1L1OB 4PG3A 4JCVE 1UE1A 4P73A 4QL5A 4EX5A 3MXNB 3EIVA 1VQKA 1HH2P 2BH2A 1YVCA 1HNWQ 4C3IH 4YY3L 4OWXB 4DR7Q 1I50H 3CCLA 3L0OA 4DR6L 2GVBA 4FDBA 4RG1A 5FJ8H 2VW9A 3CMEA 1Y1WG 1PH2A 3S2HH 3IRBA 2R92G 3E9IA 3CC2A 1E3PA 1G291 4OX9L 1UEBA 5FLMH 2K5NA 2VL6A 5IP9H 1Y14B 3PF5A 1K0RA 1L0WA 4A3FH 4KHPL 4A3GG 1YEZA 5HGQA 4B3RQ 3J81j 1YJ9A 4MNOA 1ASZA 1CSQA 1YZ6A 3KDFA 4IOCA 3S2DH 2WB1E 2UXBL 1N9WA 4JYAQ 1CKOA 3CPFA 1P8LA 1Q1BA 2C35B 4L5TA 3DLLA 4TVAB 1J5EL 4A76A 1VQ8A 2UU9Q 3M3YH 1E1TA 5H1SE 5IP7H 1HJPA 2NZHA 4DK6C 2ZJQA 4JV5L 5GAGC 4AQYQ 3HOVG 4Y7NH 1Q86C 3OTOQ 2NVTH 5IYBG 1LYLA 4A93H 4LFAQ 3J81i 3J7ZC 2R7DA 5C0XI 5K36G 1L1OA 1A0IA 1NTGA 1YJNA 2B3GA 1PH6A 4GKKQ 4Y52H 4DR5Q 2F4VL 2K5VA 4LF8Q 3PUZA 1VQAA 2MO0A 4KI0A 1K83H 4X64Q 1HNZL 2YTXA 3F2BA 2OTLA 4A3CH 5BR8Q 4DV4Q 3CQZH 2WB1G 5FJ8G 3I4MH 1KXLA 1IZ6A 1TWCH 1KL9A 2IHFA 4X62L 2E2JH 2NVYH 4LF7Q 1YBYA 1PH9A 1FVIA 4LUVA 4GKJL 3FHWA 1XNRL 2JA9A 1PHJA 2AWNA 5IP9G 4DR1Q 4LF6L 1IBKL 3GTMH 4A3FG 2Q2TA 1O7IA 4X65L 1CSPA 2K75A 4R4CA 3CW2C 4B3TL 2A8VA 3EN2A 3ER0A 2E8GA 5DLQE 2OWOA 2E5LL 1I5FA 1SMXA 2KCTA 3KFUA 2ZTEA
chains in the Genus database with same CATH superfamily
2K5WA 1VMCA 1TS5A 2F0TA 1CFMA 2KHIA 3K59A 2EVBA 4IURA 1KLUD 1X54A 3TP6A 3NQTA 3TN2A 1M90C 1EOTA 1CKMA 2R92B 1EY7A 5C4XH 1PTOC 5C4JB 3BVGA 2BOSA 4O42A 1EY8A 4HMIA 4RKBA 1VQGA 4A3KH 3WOEA 2D0PA 4NXMQ 1DJRD 3GTKH 2XTIA 3QO2A 1SE2A 4A3CG 1T5XD 3R3OA 4GOPB 3L3OC 2E2IB 3LX0A 3SXHA 3MHBA 4IUTA 4PMCA 1NNXA 1CZWA 2HIVA 3GTJH 4LK1C 2A1AA 1WI5A 4OHJA 2HQEA 2L4NA 3NPPA 3HKZG 3UDXA 1UUPA 5IYCH 1A3UA 1F2ZA 4A3EB 2PQEA 3PO2B 3OIPA 4A3DH 1NE3A 3ULPA 4J8QA 4RAUC 1XMQQ 1EFWA 3S2HB 2BDNA 1D8LA 2QEXA 1D7QA 5C4XG 2IX0A 2DGYA 2F0QA 1QJOA 4K0KQ 2E2HH 1WD1A 1X3PA 2CWAA 1IBLQ 4JI0L 3D3RA 4NP5A 4R1JA 1EZ8A 4A3KG 4RHSA 2ASBA 4KLKA 5IWAQ 4WFN3 1I3QB 1MIUA 1YITA 2CWPA 2GVAA 1G2SA 3HG9A 1U9RA 3K5NA 4YHHQ 3TS2A 2JN4A 2K33A 2H5XA 1IYUA 1KIXA 5LMNL 4B3MQ 5M3MH 1RTNA 3I55A 1EQRA 3D6CA 1VF7A 1WCMB 2UUAQ 2JK8A 4RGMA 1I4PA 1S5BD 3DWQA 5IYCG 2ZTCA 2LY7A 1EEFD 3HOWH 1VQCA 1HR0W 4A3DG 2N8NA 2C5CA 2A68D 4TKOB 2CW0C 2R61A 1SRUA 2Y0SG 4R4TA 5M9OA 1A62A 4OGQC 4X3UA 4O1NA 5CR3A 3I4MB 4M8AA 4O0AA 1D1KA 1PZJD 1DXMA 1SROA 2NVYB 4NPSA 1Y8NB 2VQFL 3X3NA 4DV3Q 3CCRA 2KUMA 1DGSA 2V1CC 3KLRA 3PF4A 3RD4A 4DR4L 1OO9B 1GUOA 1U4RA 1IXRA 2VUMH 4LFCQ 5J22A 4CKBA 3RUZA 1UWVA 3BDLA 5IY0A 1HQMC 3GTPH 4KJNA 3T51B 4BY1H 4B9XA 3M4QA 4IPHA 5M3MG 2VXWA 4Q5VA 4EQ5A 2JSOA 3F1ZA 4KN4C 2A6EC 2F0WA 3RLOA 3H0GB 5LL6S 5I4DA 1PFMA 1PTOB 1SNOA 4LW1A 3U50C 1SNDA 5KYIA 4UPAA 1HTPA 1YNXA 2VS1A 2F1MA 4OX9Q 1B9MA 1Z7TA 2F0FA 2F0IA 2FMMA 3LGJA 2RF4A 4PZ8A 3TREA 4L5SA 1Y1WB 2MQHA 3UDGA 1QUQB 1JJ2A 1BCPB 1VQNA 4ZQ3A 2A73B 1E7ZA 1K8GA 5IGFA 1YNND 5IGBA 1WTPA 3MFYA 2B63H 1N32L 2DUDA 1NAPA 4ZKCB 5GAEC 1KD1C 1B70B 1SYEA 3TEHB 2VUMG 2EY5A 1LTID 1QNKA 1VQ9A 1V1QA 1HZCA 5FLXL 2WP8J 1ENFA 2EYMA 2L55A 4BY1G 4IUNA 2F0KA 3P1HA 1TWFB 4L63B 4GN5A 4ZUJA 1HNZQ 1QG7A 4NDXA 5DM63 1Y1VH 1AH9A 2AQ2B 5D3IB 3HOXB 1SYCA 4B3RL 2AUKA 4CHTB 2R93H 5ELCA 1D6EC 1D5MC 4C3IB 5M3FH 4X65Q 1BCPD 2WACA 3CCUA 3EROA 1K8OA 3CCSA 4G7HC 2QDBA 2B2VA 1HA6A 1K0SA 4JPBW 1KAWA 2XRSD 1VQHA 3C1FA 5EAYA 3A5UA 2NTTA 3V2TA 1MJEA 2B63G 4N9PA 3I72A 1VQIA 4H44C 1V9PA 1I94Q 1B50A 4GKKL 4YCUA 3RZOH 2B29A 4LF8L 3ULLA 1YIJA 1NBWA 1TY0A 3VYTA 3VR5A 2KCMA 1B7YB 4LF4Q 3GTLB 5FO9B 1SXTA 3M3YB 1J9OA 3DEOA 5IYBH 2WFWA 3CCJA 1A15A 3ND8A 4XT1B 3TP7A 1X3GA 1Q12A 5AJ3Q 1CK1A 2JA8H 4DR1L 1FGBD 1Y1VG 1VQ4A 1QZHA 2EYHA 1LV9A 1QZGA 4LF5Q 4BBSH 2R93G 1K83B 5EPJA 1S3OA 5CV9A 5E4WC 5M3FG 3W5OA 3ERQA 3CQZB 3TS0A 1Q8IA 2NB0A 3DUZA 4FP5D 3WDNA 2L12A 2QA4A 1HNXQ 2JYOA 1O7ZA 3I4OA 1X65A 1MSHA 3ZJYC 4RA8A 1H9JA 3H94A 2PNHA 1QVFA 1C48A 3I70A 2WKDA 1HTLD 2F0UA 2LFNA 2HDMA 1W2BA 3PUXA 2EJFC 4NXNL 4K5XA 1N33L 3ND9A 3I4NH 2JA8G 4PZ7A 1V1PA 4DV0Q 3BDOA 1B1ZA 4BBRB 4BBSG 4GLAC 4ZCKA 4PZ6A 1Y8PB 3S16H 3GV6A 3JC66 2XWBB 1QCBD 1DCZA 5JEAH 4XTCS 2J7ZA 2SEBD 2NN6H 4XDXA 3SEBA 3MEFA 1FL0A 1NY4A 4BS9A 4K5WA 1EYAA 3M9BA 3K7UC 4NMZA 2YV5A 4IJHA 5M5WH 1YHBA 3NHHA 4WJWA 1SNMA 4JK1C 5GAHC 4OWWB 2ID0A 3CAMA 4TSSA 1H9MA 5CBEE 3I4NG 1SSOA 4CBVA 1HFNA 4DAYA 5C0XJ 3GV3A 5KEEA 2NZOA 1PYBA 4V0BA 1EQQA 4UDUC 1GHKA 2I5HA 3EVQA 4PV1C 1EQVA 1DOMA 3MXGA 3GTOB 3J80c 2ZM6Q 3CF5A 4GNXC 1JJGA 1CTMA 5JEAG 1JB3A 1NMFA 1A63A 3H3VH 3CCQA 1JQYD 4ME5A 1AE2A 3PMFA 1I6HH 2JXMB 4DV2L 1LTTD 1NSNS 2XSCA 2F0DA 1PH7A 1G6PA 1X3FA 1G6ZA 3H3VI 2ZTDA 4DN4M 3S1NB 4C3JH 4B9WA 1XNQL 4DAMA 4DV6Q 1C7YA 5T1GA 3G6JB 4RH6A 1YNJC 1HRJA 2VY3A 2NZ1D 3J7AV 5FK9C 1PDQA 5K36H 4R4IA 2IX3A 4JBWA 5CV7A 4IZ8A 3KK7A 5KRUA 2TMPA 1HNWQ 4DR7Q 2MHVA 1I50H 2EY2A 1SMYC 4DR6L 2XWJB 3I4LA 2P5ZX 1KDAA 3E9IA 4A3JB 1LT5D 2E74C 5HGTA 2VL6A 1K0RA 1MSGA 2J4XA 1EZ6A 1WTRA 1DOKA 4MNOA 1TR5A 2WAQB 2LKVA 4C3JG 2UXBL 4JYAQ 1CKOA 4L5TA 3DLLA 3I91A 2F0OA 5H1SE 5IP7H 5I2XA 4AQYQ 3AB9A 3EQLC 3OW7A 2OXPA 4A93H 5CYUA 3J81i 2KHSA 5DM73 5K36G 1GXDC 1B3AA 1NTGA 5EBCA 2F4VL 4XYQA 4X64Q 2OTLA 2GA4B 1MI2A 1KXLA 1EY0A 1IZ6A 1TWCH 1KL9A 2R3ZA 4LF7Q 1YBYA 4CDFC 4LUVA 3FHWA 1XNRL 2JA9A 4DF7A 1JOOA 1IBKL 1D5XC 2OF1A 2Q2TA 4NKLA 4PQXA 2K75A 3CW2C 4B3TL 1TWGB 3EN2A 5DLQE 2SNSA 2OWOA 3NTHA 1KNEA 4CKEA 4HMJA 5IP7G 4BXXH 1S5CD 4RGOS 2QW7A 3T13A 4K5VA 1JB7A 4N8X1 3GTGB 1LTAD 4A93G 3HKZE 1JT8A 5CV8A 3PUVA 2HIXA 3BZKA 4JI1Q 4GNXB 1YHQA 2E75C 4DK3C 2A6HD 1TIID 3GD7A 4X66L 1J5EQ 4UAIA 3T56B 4Q0FA 2HCCA 3NXWA 3BS1A 1U5KA 1YJWA 2K04A 5GQOA 2HQLA 3Q24A 3CPWA 2BE5D 3NENA 4B08A 3A7LA 4RGTA 5C44H 1ILPA 5FO7B 2KQ3A 1BVSA 1CUKA 4OONA 4S3SA 2PZTA 2LS01 4X62Q 3JAMi 1SDFA 1R9TH 2JEBI 1XXGA 3CRLC 1STEA 4BXXG 1L0YB 1N36Q 2OT2A 1VQ6A 1IW7C 5TSSA 4QUCA 4GLXA 2E5LQ 1A8VA 3S14H 1QE6A 3RLFA 2K52A 5ELFA 3HOZH 2UXDL 1HR0L 1FYCA 2N49A 1BKBA 3I2ZA 4JI8L 1ZXTA 2Y0SE 1STNA 2F0VA 4DUYL 4KKSA 2EOTA 1U0LA 1LTRD 3Q8DA 4QB4A 1H95A 1JR0D 2G5DA 2QEJC 4JI3Q 2C9OA 3W1BA 2HT1A 5C44G 1ICWA 4JBKA 4HCSA 5G3LD 4E6IA 1H9RA 4EQPA 2QCPX 3NWTA 5BN4A 4BA2I 1EY4A 4HAEA 2PI2E 4JVZA 2KA7A 4OIJA 4JI4L 4A3IH 3KOJA 2CQAA 2UUCQ 2OCEA 3C2PA 3O13A 5BN3A 1FNVA 1XTDA 4HEDA 3G71A 3KF6B 1F9SA 2UXCL 5COYA 3HOZG 1N34Q 1K3RA 3W3AA 2CHBD 2EQSA 2HHHQ 5J1ZA 4ZAIA 1X3QA 3HKZB 1WTXA 1LT3D 4B3SL 2F0LA 3SGIA 3EJIA 2PQAA 3J80E 5FLMG 4ALPA 1TWAH 5KGUA 1SLJA 4H0LC 4A3LH 1SE4A 4UHVA 5A2QE 1QILA 5C4XB 2G9DA 4ID6A 4GZYC 2JA6H 4KY7A 2TSSA 3BU2A 4A3KB 4A3IG 4RCNA 2JE6I 3E6ZX 2RDGA 3D31A 3MXUA 3I7FA 3GTKB 4RKLA 4DV5L 3BZCA 5IIFA 2B2UA 1ZKOA 3BYTB 4KHPQ 1JJCB 4KD3A 3M4OH 2KVMA 3S1MB 1II3A 4TQUS 3GTJB 1H9KA 1PFSA 4KHZA 1XJVA 4KKUA 4HIOA 3W1GA 4A3MH 4IO9A 3J80L 2XGTA 3NK9A 2ZXPA 3SVMA 4A3DB 1EWHA 1EWCA 3S15H 5A2QL 4I7ZC 2Y0SB 2PW5A 1KAAA 1EIYB 2Z6KC 4A3LG 1WTVA 4G57A 3C3LA 1BCPF 1KNAA 5ISRA 4DK1A 4IPGA 2EYFA 2JA6G 3CC7A 3OMGA 2KECA 1UAPA 2ZXOA 3HZXA 4A4IA 2Q8IB 4YIJA 1PYSB 4LF6Q 2R92H 5C4JH 2UU9L 3DXJC 1KHIA 1X3EA 4XYOA 5LMUQ 3OTOL 2AKWB 4LFAL 4A3FB 2E2IH 3OWEB 4LF9Q 1HZAA 2OQKA 4DR5L 1EUJA 3BDCA 4DR3Q 1V1OA 1PRTB 3MWYW 5T1IA 1GD7A 3OWFA 4LNQA 3STBC 4KKTA 1FJGQ 4FYDA 1FD7D 2IY5B 2EXDA 2B2TA 5GADC 1OXXK 1K8MA 1E24A 4Y7NB 2RQXA 4A3EH 3M7GA 3PO2H 2JQOA 4APVA 3SR1A 3ZYYX 1EIGA 1VQMA 1V8QA 5C4ZA 3MC0B 4FVMA 1RL2A 3MVVA 2M9VA 1VQJA 2HCIA 4BA1I 4ZKBB 1SYDA 4DNIA 2VUMB 2FXQA 1LTLA 4LFBQ 3BJUA 3MZ5A 2E2JB 3D0FA 1EIFA 1I3QH 5EGTA 3NBHB 3GTMB 2PO4A 4QQBX 3HS0C 1JE5A 4DV7Q 3H91A 1PRTD 4FXKC 4DV1Q 5IE8A 1W6JA 4NXML 3KLWA 3FDTA 4HR7B 2A69D 4OWTB 2LXJA 1WCMH 2PPBC 1B9NA 3ICEA 4A3EG 5FLXE 3K80C 3PO2G 2NVXB 2O5JC 4QJFA 1EEID 3HOWG 5IT9c 1SBBB 1S5ED 5EKIA 2B63B 4KMUC 4RGNA 3A74A 4K2KA 2F52A 2H1EA 3NELA 2X6LA 4RHRA 3HOUH 3GTQB 1G51A 5CBAE 2QGQA 1XMQL 1PH1A 3G4SA 4JI7Q 1PA6A 1O7LA 1VDZA 2YTVA 4HJ9A 2UUBQ 1KTKA 2CH4A 2EE1A 2FMCA 1JOKA 4ZUIA 3P75A 4JI5Q 5CV6A 1B44D 4K0KL 3QWNA 1IBLL 4HJAA 4DR2Q 3UDFA 2BDOA 5JVG3 5IWAL 4GLVB 1NUCA 1A3VA 5F2DA 3A5ZB 4C3HH 5IOCA 2I46A 3PUYA 3VYRA 2QILA 4U68A 4YHHL 5M3FB 1VS0A 3UE1A 3H0GH 4R4OA 3LNNA 2JA5B 1X32A 1G8ZD 4QUFA 3K58A 1RODA 2WKCA 3IFDA 1RIPA 2VQEQ 1PTOD 4B3ML 1HFGA 3OYYA 2UUAL 3T4AC 1O7YA 1AFPA 2J0TD 3ULJA 2IX1A 1KRSA 1IKLA 3J7A5 1Y1WH 5IYDH 3X3MA 3HOUG 3H3VC 3RZOB 3TQYA 4PMWA 4RCOA 4UP9A 1RDPD 2ZXRA 2IL8A 1Z6HA 1K28A 3G48A 3A8JE 5C5MA 4A3GH 1MKHA 3HKSA 2RCFA 4C2MB 1LO5D 1C0AA 1BOSA 5JJLA 4DV3L 2JA8B 1UEAB 2ICEC 3E3XA 2B2TC 1GUWA 1OXVA 4C3HG 3K0XA 3FP9A 3F2UA 1CKNA 4LFCL 2MO1A 1JWMD 3D4RA 3H0GG 2JJQA 4I7AA 3PV0A 3QB3A 4POFA 4PG3A 4P73A 3NQIA 4J1MA 4JCVE 4QL5A 4EX5A 3MXNB 2BH2A 1YVCA 4C3IH 4MTKA 3CCLA 3L0OA 4DXGA 2GVBA 4RG1A 5FJ8H 1Y1WG 1PH2A 2EPBA 3IRBA 1RF2D 3NTKA 1AN8A 2K1BA 1GJXA 4XQQA 2L1BA 4OX9L 1UEBA 2F03A 5ELBA 2F3WA 4A3GG 5HGQA 4PMBA 1XYIA 1YJ9A 1ASZA 1CSQA 1K3BC 3A56A 3KDFA 4IOCA 3I4NB 1N9WA 1P8LA 1Q1BA 2C35B 4A76A 1VQ8A 1LACA 3M3YH 5C0XH 1E1TA 2CVRA 4DK6C 4EQNA 2CW0D 2NVTH 3S16B 3IFTA 5IYBG 1LYLA 5C0XI 1A0IA 1L1OA 1YJNA 2IWHA 3SDZA 3VR4A 2MO0A 5I9OA 1K83H 4C3IG 1HNZL 1H9SA 2EXZA 4I65A 2R7ZB 2BCOA 5BR8Q 4DV4Q 3CQZH 2WB1G 5FJ8G 2IHFA 5BN5A 3S1RB 3K5LA 1PHJA 5CC4A 3D6WA 2AWNA 5D14A 3TP8A 5C6AA 1QB5D 1SNQA 1O7IA 1TS4A 5ELDA 4X65L 1E0BA 2D2CC 3ER0A 5CORA 2KCTA 2ZTEA 3I90A 2NN6I 2D9UA 2RCNA 4BY7H 1STYA 3AFQA 2B2WA 1D1IA 5CV4A 5M5YH 2D62A 5C0XG 1S40A 1WYDA 1I4RA 1CZGA 3DWPA 1I94L 4JI6Q 4P74A 4QGUA 1M8AA 3L2PA 4LF4L 2NVQH 2EJMA 1IBMQ 4KHVA 2DY7A 1Q8KA 1XPOA 4JI2Q 4MHEA 4C1NK 4BBRH 2YTYA 1GHJA 4MIUA 1I6HB 4NB3A 4U673 1J6QA 2WV6D 1WVLA 2PMZE 5AJ3L 2VB2X 3N52A 1B2TA 2YU9H 1VQBA 1MGSA 2B2VC 4LF5L 4YCVA 2ICIA 4OXPA 3CD6A 2RDFA 1ZYRC 2K50A 3KF8B 3T1HQ 1PH8A 1U4MA 2LSSA 2NN6G 5FKAC 4P75A 3IAYA 3NBIA 5DEHA 5KIXA 1U4PA 2K7VA 1LM0A 4HIMA 3UE0A 4M1UB 1IHZA 1Q81C 1HNXL 4BY7G 4DUZQ 1GUSA 3NEMA 4EGVA 3M4PA 3EFXD 2Z4HA 1BXTA 4KTAA 3M85A 2KBNA 2HDLA 3VA5A 1CQVA 2Z8LA 3F2DA 3CMAA 2KEEA 4H02A 2HUGA 1XMOQ 4BBRG 1QOHA 4KD4A 4YWLA 2ZJPA 2I0QA 5KNDA 3DMUA 3KLSA 3A0JA 4GOPA 3TP5A 5G3LF 2KJXA 1Y69U 1HZBA 4DV0L 1VF5C 2L0CA 3U58A 2QF7A 2AHOB 1EQTA 1M1KC 3H15A 5KYLA 1XPUA 3S1NH 2Z0SA 1PFNA 2DJGC 4WJ3M 1SYFA 4UP7A 3KJOA 1EIHA 3TZDA 1RKNA 2I07B 3DWAA 4V190 1TVXA 1KQSA 1STGA 3K81C 2L9HA 4IUVA 3K7AB 5IT9L 4A3BB 2R7FA 2SNMA 1W3SA 2X69A 1JORA 4KK7A 5K5PA 1LT6D 4LUZA 3T1YL 1VCIA 4CKCA 1G91A 1PXUA 1MJCA 4HCEA 2PMZB 1SAPA 1BBUA 1Z9FA 1WJJA 5L37A 4OO1H 4IN3A 3J7YW 3VR2A 4YY3Q 1HHVA 4J15A 1T9HA 1MBYA 3MEHA 3PCOB 1R4QB 1PH3A 3C46A 4G4KA 1E2VA 1GM5A 3VA7A 4OO1I 3LWEA 3HOYH 1V43A 2M2LA 2CCZA 3BYYB 3GDEA 4F87A 5C3WA 1UE7A 1WTOA 2JA7H 1NJIC 4N9TA 2IHEA 3S17H 1BF4A 3FPPA 4DV6L 1TXYA 1VQ5A 1ESRA 2XN9C 1K9MC 1QNUA 5KNBA 4JOIA 5IGCA 3R2IA 4JV5Q 5EJWA 2O2LD 3RR5A 4HSVA 4X6AH 1HNWL 4CJ2C 3G6EA 4DR7L 5ELNA 4LMQD 1RD9D 3K8AA 3TSSA 1CHPD 1IL2A 1A2UA 2K03A 1TWGH 3CU7A 3BVMA 4OO1G 2WAQG 3NUCA 2KEDA 3TBIB 4RFBA 3HOVB 4X3TA 1IYVA 1OTCA 3HGBA 4HIKA 3HOZB 2H4OA 2DJFC 4QF4A 3HOYG 4GKJQ 5I9PA 3J80i 2Z9HA 2EJGC 1JCKB 1NCVA 3GTGH 1LT4D 1CHQD 3PO3H 2JA7G 4JYAL 1I4HA 2RVLA 4K6DA 5GROA 1QUQA 3Q6SA 1CT1D 4QMGA 4AQYL 1QVCA 4EVOA 2F3IA 1CA6A 1GO3E 4LJZC 4GOPC 3CCMA 4R8IA 2CH4W 2ALYB 2ZJRA 2MPMA 1S5FD 5AFWA 3R93A 2D5DA 2MNAA 2F0PA 3OOCA 2F0NA 4XQNA 2A19A 5JOBA 4X64L 5M5XH 1LUZA 3S2DB 1SE3A 1QVGA 4K2LA 4ZLTF 4A3IB 2K4KA 4AYBG 3PSIA 3CHBD 1Q82C 4K8IA 4XT3B 4LF7L 3HRZC 1Q90A 1YNJD 1AE3A 5E4XA 3RZDH 2VNUD 1PH5A 2A68C 1V1PB 2CKZB 4AH6A 1PZID 3IKJA 2Q2UA 1FNWA 1KC8C 1SNPA 4NW2A 3D4WA 3DM1A 4L5RC 2L11A 5E3FA 3PO3G 3ERSX 1TT2A 1SMYD 3J81L 4A75A 1PRTF 1VQDA 4DKAC 3PQIA 3FKIH 1HQRD 2KCCA 5C3EH 1TWAB 1ENAA 1TWHH 3B6YA 4TRDA 4JI1L 1SN8A 4XQJA 1ICFB 2XNAC 4MZ9A 1VQOA 2F0SA 3DEPA 1ESFA 3FPUB 3C1EA 1F2LA 1ML0D 4JI0Q 1CQFA 3CC4A 3UDIA 1CI3M 4HJ8A 3M4OB 2N78A 3KJPA 4DAYB 1GKHA 4K6LA 1FGUA 4OELB 5LMNQ 1HZ9A 4L8JA 4ZRZA 1Y8OB 4ILWA 1E2WA 1YNNC 4G7OC 2KCNA 3S1QH 3CCVA 1ASYA 3FKIG 2XRQD 3Q0AA 4JOIC 3GQBA 1N36L 5C3EG 2PNRC 2OQ0A 3K0YA 1Q3LA 1L0XB 3HEJA 1XPRA 5ELOA 2FINB 3QOLA 5IGGA 4IJLA 1SFOH 3M7NA 1PTOF 1MHWC 3A55A 1I4XA 3SK6A 2K5DA 2R6GA 1LTBD 3BVZA 2VQFQ 3NTIA 3PUWA 1OXTA 1FR3A 4R4QA 4MTNA 5NUCA 1VQFA 5HY6A 1KABA 3U4VA 4CDEC 1YI2A 4DR4Q 4JI3L 1GOZA 2E2HB 3KLSX 3JAML 5IGDA 3MXPA 1OXSC 2NYZD 2VZAA 2DNEA 1LTGD 4IPCA 1BCPC 1XWEA 3S1MH 2KOLA 4DFAA 4HIDA 2OEOA 4EQOA 2KHJA 1EY5A 2SOBA 3QIAA 2UUCL 3P20A 3AU7A 1EL0A 4L5QA 3VR3A 2SDFA 5M3MB 4A3MG 2O5IC 1ET9A 2AQ1B 1EY6A 3MFGA 4F7XA 3J7AF 3D4DA 1N34L 1DZ1A 2K32A 4DNTB 3HOWB 2HHHL 1XX8A 5ELEA 2PYKA 1HXYD 1TQOA 4IUUA 2I5LX 3QJYA 3F2CA 1N32Q 4YWKA 1E1OA 3I73A 2NUCA 4H7BA 3F8TA 1IW7D 3EIVA 5IGEA 1VQKA 2EDGA 2NWGA 2RBMA 3OMCA 3OSOA 4DAPA 4DA2A 3CMEA 2B39A 3S2HH 4X3KA 3NP8A 2Z6BA 2R92G 4KJOA 3KF8A 1EYDA 1G291 1W6KA 3GTPB 3PF5A 1PFBA 2FFKB 4DXFA 1HUMA 4A3FH 4KHPL 4BY1B 5CV5A 1YEZA 3T53B 5KNCA 4B3RQ 2DY8A 2WB1E 4FXDA 3CPFA 1HPCA 4TVAB 1PZKD 4J6HA 5JAVA 3Q22A 1A6XA 1HJPA 5C5LA 1NR2A 2B8GA 5HURA 3BG3A 2ZJQA 3R2TA 5JPMC 5GAGC 4ZK9B 3E0JA 4Y7NH 1Q86C 3HOUB 4OIKA 2F0JA 3J7ZC 2R7DA 5JVH3 4ZYSA 1SYGA 4K8JA 1PH6A 4GKKQ 4Y52H 2QKIC 4LF8Q 4KI0A 4DAVA 1BR9A 3OPOA 3W2DA 3F2BA 2B2UC 1LTSD 3I4MH 1M4VA 3SK8A 2E2JH 2NVYH 2N88A 4KY6A 3SE0A 1PH9A 1S4ZA 1EFID 4FF4A 3KBGA 4DR1Q 4LF6L 4C3HB 3GTMH 1J8IA 2E2DC 2K05A 4A3FG 5J39A 1CSPA 3A54A 2B8FA 1CM9A 4K14A 4DU9A 5LMUL 4X3SA 1STHA 2ATWA 2A74C 1Y1VB 1K8AC 2BH8A 3RLNA 3G7LA 1LLRD 2R93B 4LF9L 4PNYA 4IUQA 1F9QA 4DR3L 1WCMG 2NVXH 2NBFA 1JWSD 4QIWE 4FO2A 2E76C 3E0EA 1PTOH 3V96A 3VYUA 1DOLA 1VQEA 1FJGL 2CFMA 1DM0B 4A3GB 3DM3A 3K6OA 1JWUD 3L9AX 1B8AA 4DGZA 3GTQH 3SK5A 1EYCA 4KV6A 3I4MG 1VQPA 1EOVA 3N6RA 1D5ZC 4O2DA 1N33Q 4NXNQ 4WORA 3EBEA 4KY5A 1BBWA 5E7NA 2GN5A 4MN3A 3RMHA 1Z47A 1X55A 4JG2A 1Q46A 4LFBL 4HJ5A 3WWVA 3OHXC 1EU3A 4G7ZC 2IJ0A 4CDCC 1TWFH 2M00A 4BBSB 3R8BA 4DV7L 2JA5H 1PVOA 2WB1B 4GS3A 2BA0A 4DV1L 1PLFA 1YHAA 4GNXA 4FNFA 2D0OA 4C56C 1F2YA 3KUPA 3U9SA 3HOXH 1X9NA 2MFIA 2K5QA 1Q1EA 3TRZA 3EA6A 4JBMA 2N3SA 2PCFB 5JJZA 1ENCA 5IYDG 2AUJD 3CP0A 4CGYB 2JEAI 2N55A 4IOAA 4CJ1B 2QDLA 2PQAB 5CMDA 2EYPA 3E5SA 4C2MH 3MA2B 3STBD 3PIPA 2NVTB 1TY2A 4ULLA 4JI7L 2A5HA 3FVQA 3QR8A 2UUBL 1O80A 1B3QA 3GTLH 1U4LA 1T5EA 4JI5L 1AZQA 1ONLA 1GUTA 5EPLA 3NWSA 4FF2A 3GO5A 1B4OA 2JA5G 4DR2L 4CJ0B 1HCZA 2Q8TA 4DV2Q 1SNCA 3T16A 5LMNW 4OEMB 1VMPA 5D3DA 3V05A 1KDBA 1L2FA 3HOXG 3J81c 5FOBB 3A8IE 1XNQQ 4R9WA 1STAA 4QIWB 3OIQA 4N8FA 2RSNA 3QG1A 1VQLA 2VQEL 3U9OA 5M5WB 2LXKA 4BY7B 4XXEA 1QWYA 1WD0A 2XIWA 5M5YB 1EYGA 1JE4A 1WFQA 3CXCA 4P2CB 1G2TA 2CQOA 1X56A 1I4QA 4YWMA 1WTWA 4DR6Q 2NVQB 3M4YA 3PGZA 3U4ZA 1R4PB 2AMCB 2A6ED 1CA5A 3HFZB 4P72A 1PYWD 3AFPA 2G9HD 5DAUA 1D2BA 2NTSA 1K73C 1AZPA 1STBA 5C3XA 5C4HA 2WAQE 2A6HC 2YU9B 3KF6A 2Q2HA 2Z1CA 2DN8A 4LUOA 4RWSC 3KBXA 2UXBQ 1X6OA 4POGA 2R7ZH 4GN4B 1NMGA 3AQQA 2K14A 1P16A 2BE5C 1F77A 2EY1A 2O4XA 2YYZA 3NSWA 3S1RH 1SR3A 5JJIA 4C3JB 3CCEA 2K5HA 2PW7A 2F0HA 3E9HA 2PZWA 2F4VQ 2Q2IA 4XIGS 2F4IA 1DYQA 4JC0A 2JP1A 1EU4A 3T1YQ 1PV4A 1Q7YC 1PMRA 3FRPB 2IW3A 2IT1A 1XNRQ 1BUVT 4YCWA 3JAMc 2F0MA 4IQZA 1UNSA 3CRKC 4FXGC 1I50B 4QY7A 4AYBE 4CDDC 3RN5A 1IBKQ 3I3CA 4AIMA 2IPKD 3D8GA 1UE5A 4B3TQ 3RNUA 3RN2A 1O78A 4IALA 2R7ZG 4FF3A 3CKIB 1N8RC 3GTOH 5JEAJ 4BWGB 1BBXC 2I5MX 1HA5A 2MP1A 5IT9E 1C9OA 2V4DA 1TS3A 2MJ8A 1ZEQX 2XVSA 4HN7A 5BR8L 3PIP3 3Q23A 4DV4L 1KRTA 1GUGA 4X66Q 3AYHB 3NE5B 2L5TA 4FF1A 1RJTA 2VB3X 3FEWX 4JBJA 4A93B 1JOQA 1S72A 4UY8C 4H13C 4IFDH 2HD3A 1A2TA 2MUYA 1IYJB 4IFDI 1L1OC 1TKWB 2PI2A 1FNUA 1TWCB 1WTHA 3L7ZC 4RMFA 2EZVA 3GP7A 2L15A 1SE8A 4JW0A 4JI6L 1C4QA 3PIOA 1XTCD 2RDHA 3S24A 1A3TA 5EPKA 2RSOA 1IBML 3A7AB 4JI2L 2OTJA 5J3BA 5A35A 4R8NA 4A3JH 3HOYB 3VDYA 2K01A 4LWCA 2UXDQ 5LL6X 2X6GA 2JA7B 2ZM6L 1HR0Q 1F9RA 3S17B 1GUNA 5LHY1 4JI8Q 2LMCB 3FMCA 3T1HL 4KN7C 2B2WC 4F8MA 1F9PA 1EY9A 4IFDG 4DUYQ 2AWOA 3KYHC 3HP3A 3K5MA 4DNRB 4P71A 1RCVD 3ONAB 5CGKA 4DPGA 4DUZL 4DK0A 1JICA 3K7AH 4A3BH 1B53A 4IFDJ 1C8CA 2B2YA 5EKLA 2KENA 4AYBB 4IUPA 3NBHA 4C1NI 4JI4Q 1GVPA 4ODGA 5C44B 4WJ4A 3VR6A 1XMOL 3VYSA 3SHLA 4A3JG 5JPNC 2ES2A 2ENBA 1R9TB 2Q8RE 2UXCQ 5I2YA 2WIIB 1IKMA 4OL7A 4IPDA 1CKNB 3PO3B 1S5DD 3SK4A 5FO8B 1BNZA 5I6YA 1NR4A 3IL8A 5IODA 1PH4A 4B3SQ 3S14B 1E22A 3I56A 1JC7A 3A8KE 2RHSB 2K6AA 4Z9CB 1WOCA 1MD2D 4UP8A 2RA4A 5JJKA 5D65A 4HTHA 1I6VC 1JMCA 2EIFA 1BO0A 1F2MA 4HJ7A 1LABA 5M5XB 4A3BG 3TZUA 5FLXc 3OW2A 3TDQA 2RHQB 1RHPA 3K5OA 1ZYRD 1WTQA 3TMEA 3S9WA 2EY6A 2Z6KA 2ZT9C 3J81E 3UI2A 1RTOA 3RZDB 3KDFB 2EYOA 4DV5Q 3I8ZA 3ITPA 1EWIA 3AEVA 1DD2A 5EBDA 3H6MA 1OXUA 2AQ3B 4L6TB 1TS2A 1BDOA 3P7JA 3HOVH 2FJ2A 4GN3B 1VQ7A 1UE6A 2WINB 2BA1A 2Z4IA 3DHQA 1SJED 1IL8A 4ME3A 5EQ0A 1L1OB 1UE1A 4QCLA 2F0GA 1HH2P 3FKIB 1KLGD 5C3EB 4YY3L 4OWXB 1TWHB 3URYA 3H09A 1H9SB 4LAAA 4FDBA 3K57A 2VW9A 3CC2A 2MGSA 1E3PA 5FLMH 1AEXA 3PIO3 2K5NA 5IP9H 3WOFA 1KDCA 1Y14B 3LWUA 1L0WA 5DNFA 3J81j 1YZ6A 1PRTC 4ABNA 3S2DH 5EKKA 3AMUA 2PZUA 1J5EL 2A69C 2FHTA 2UU9Q 2JA6B 2NZHA 1TU2B 4JV5L 1ILQA 1ET6A 3BZDB 3HOVG 3OTOQ 2RKSA 4WRDA 4LFAQ 4F88A 5I6WA 2F3VA 1DONA 2B3GA 3MTSA 3MXNA 3S1QB 4DR5Q 1SEBD 2K5VA 1BQQT 3PUZA 1VQAA 2DNCA 2EYLA 1AP0A 5E1FA 2YTXA 4A3MB 4A3CH 2F0EA 4X62L 2K28A 3JAME 1I4GA 1SFOB 1FVIA 4GKJL 2B2YC 1SJHD 3S15B 5IP9G 3QOJA 2EYJA 4HSPA 1AW7A 1E2ZA 1HUNA 4R4CA 2A8VA 3MAQA 2E8GA 2E5LL 1I5FA 1SMXA 3KFUA 1SYBA
chains in the Genus database with same CATH topology
2NN6I 2RCNA 4BY7H 2KHIA 3AFQA 2ATWA 1K8AC 5M5YH 2D62A 5C0XG 1S40A 5IP7G 1X54A 2BH8A 3RLNA 4BXXH 1WYDA 1I94L 1M90C 4LF9L 4JI6Q 4P74A 4DR3L 1JB7A 1WCMG 1CKMA 4QGUA 4A93G 3L2PA 2NVXH 3HKZE 5C4XH 1JT8A 4QIWE 4LF4L 2NVQH 3E0EA 2HIXA 3BZKA 3PUVA 4JI1Q 4GNXB 1YHQA 1IBMQ 4DK3C 1VQEA 1FJGL 1Q8KA 3GD7A 1XPOA 4X66L 4JI2Q 1VQGA 4BBRH 4A3KH 1J5EQ 2CFMA 2YTYA 3DM3A 2D0PA 4NB3A 1J6QA 4NXMQ 1B8AA 2PMZE 2XTIA 3GTKH 5AJ3L 3GTQH 4A3CG 1U5KA 1YJWA 4GOPB 3I4MG 1VQPA 1EOVA 5GQOA 2YU9H 1VQBA 2HQLA 4O2DA 3CPWA 1N33Q 4LF5L 4NXNQ 4YCVA 3CD6A 3EBEA 4OXPA 1BBWA 5E7NA 2HIVA 2K50A 3KF8B 3T1HQ 1PH8A 2GN5A 2LSSA 2NN6G 3GTJH 2A1AA 3NENA 4P75A 1WI5A 1Z47A 1X55A 4JG2A 1Q46A 5C44H 3HKZG 4LFBL 3UDXA 4HJ5A 3WWVA 1BVSA 5IYCH 1LM0A 4HIMA 1CUKA 3UE0A 4OONA 4X62Q 1Q81C 1HNXL 3JAMi 1NE3A 4DUZQ 4BY7G 4A3DH 3ULPA 3NEMA 1R9TH 2JEBI 1XMQQ 4BXXG 3M4PA 1TWFH 1PVOA 4DV7L 2JA5H 3M85A 1N36Q 4GS3A 2KBNA 1EFWA 2BA0A 4DV1L 1VQ6A 1D8LA 2QEXA 1D7QA 5C4XG 1YHAA 2IX0A 4GLXA 2E5LQ 1A8VA 2DGYA 4GNXA 3S14H 2D0OA 4K0KQ 3RLFA 2E2HH 2K52A 3F2DA 3HOXH 3CMAA 2CWAA 1X9NA 1IBLQ 4JI0L 2MFIA 3HOZH 4H02A 1XMOQ 2UXDL 4R1JA 4BBRG 2ASBA 4A3KG 4KLKA 2N49A 1Q1EA 5IWAQ 1BKBA 1HR0L 3TRZA 1MIUA 3I2ZA 4YWLA 4JI8L 1YITA 2CWPA 2ZJPA 2Y0SE 2I0QA 2GVAA 4JBMA 4GOPA 3A0JA 2N3SA 5IYDG 4YHHQ 3CP0A 4DUYL 1HZBA 1U0LA 3Q8DA 4DV0L 2JEAI 3TS2A 2H5XA 1H95A 4IOAA 1KIXA 3U58A 5LMNL 2PQAB 2AHOB 4JI3Q 4B3MQ 5M3MH 2HT1A 3W1BA 1M1KC 3I55A 4C2MH 1EQRA 5C44G 3STBD 3PIPA 3H15A 4JBKA 2UUAQ 1XPUA 3S1NH 2JK8A 2Z0SA 4JI7L 5IYCG 2ZTCA 2UUBL 3HOWH 4BA2I 1VQCA 4WJ3M 1HR0W 4A3DG 2N8NA 2PI2E 4UP7A 4JI4L 4JI5L 3KJOA 3GTLH 4A3IH 1SRUA 2Y0SG 4R4TA 1A62A 3KOJA 2UUCQ 3GO5A 2OCEA 2JA5G 4DR2L 1KQSA 1XTDA 4O0AA 4DV2Q 1SROA 5LMNW 4NPSA 3G71A 3K81C 3KF6B 1L2FA 3HOXG 2VQFL 3J81c 2UXCL 3HOZG 2R7FA 4DV3Q 1XNQQ 1W3SA 1N34Q 3CCRA 1K3RA 1DGSA 2EQSA 2HHHQ 2V1CC 3PF4A 4DR4L 4LUZA 1VQLA 2VQEL 1IXRA 4B3SL 2VUMH 3T1YL 4LFCQ 1VCIA 3SGIA 2LXKA 1UWVA 5IY0A 3GTPH 1MJCA 2PQAA 5FLMG 4ALPA 4BY1H 1TWAH 3M4QA 4IPHA 1BBUA 1EYGA 1Z9FA 1SLJA 1WFQA 1WJJA 5M3MG 3CXCA 4A3LH 4EQ5A 3F1ZA 4YY3Q 2CQOA 1X56A 3RLOA 4J15A 1T9HA 4YWMA 4DR6Q 3PGZA 3PCOB 3U4ZA 2AMCB 1PH3A 2JA6H 1GM5A 3HFZB 4LW1A 4P72A 3BU2A 3U50C 4OO1I 4UPAA 3HOYH 1YNXA 4A3IG 2VS1A 1V43A 4OX9Q 2JE6I 3D31A 2CCZA 3I7FA 3GDEA 3AFPA 4DV5L 3LGJA 1UE7A 3BZCA 3TREA 2RF4A 4PZ8A 1K73C 1NJIC 4L5SA 2JA7H 2IHEA 3S17H 1JJCB 4KHPQ 2MQHA 3UDGA 2WAQE 1QUQB 4DV6L 1JJ2A 3KF6A 2Q2HA 1VQNA 3M4OH 1E7ZA 1TXYA 1VQ5A 1K8GA 4LUOA 4TQUS 2UXBQ 1X6OA 1PFSA 4KHZA 1XJVA 1K9MC 4POGA 4HIOA 4GN4B 2R7ZH 2B63H 3W1GA 2DUDA 4A3MH 1N32L 1NMGA 4JOIA 4IO9A 5GAEC 3AQQA 1B70B 1KD1C 2XGTA 2K14A 1P16A 2YYZA 3RR5A 3TEHB 3S1RH 2VUMG 4JV5Q 4X6AH 1SR3A 1V1QA 1VQ9A 5JJIA 1HNWL 1HZCA 3G6EA 3S15H 4DR7L 2WP8J 5ELNA 3CCEA 2K5HA 3K8AA 4BY1G 3E9HA 1IL2A 1EIYB 2Q2IA 1TWGH 2Z6KC 4XIGS 2F4VQ 4A3LG 4OO1G 4GN5A 2WAQG 4JC0A 1HNZQ 1OTCA 4HIKA 3T1YQ 1Y1VH 4IPGA 1PV4A 1AH9A 1Q7YC 2JA6G 3CC7A 2IT1A 4GKJQ 3HOYG 4B3RL 1XNRQ 2R93H 3J80i 4YCWA 3JAMc 4A4IA 3GTGH 1PYSB 4QY7A 4AYBE 5M3FH 1IBKQ 3RN5A 4LF6Q 2JA7G 5C4JH 2R92H 3PO3H 4X65Q 4AIMA 4JYAL 5GROA 1QUQA 1UE5A 3CCUA 1KHIA 2UU9L 4B3TQ 1X3EA 3RNUA 3RN2A 3CCSA 5LMUQ 5LMUL 4AQYL 1QVCA 2F3IA 1KAWA 3OTOL 1VQHA 5EAYA 3A5UA 1GO3E 2AKWB 4GOPC 1MJEA 2B63G 2R7ZG 3CCMA 4LFAL 1VQIA 1V9PA 2ALYB 2ZJRA 1N8RC 3GTOH 5JEAJ 2E2IH 1I94Q 2I5MX 4GKKL 4LF9Q 1HZAA 2OQKA 4YCUA 2MNAA 2B29A 4DR5L 1EUJA 1C9OA 4DR3Q 3ULLA 4LF8L 1YIJA 1NBWA 2A19A 4X64L 5M5XH 1LUZA 2KCMA 1B7YB 4LF4Q 1QVGA 1GD7A 4LNQA 2K4KA 3STBC 5BR8L 4AYBG 4DV4L 3PSIA 1KRTA 1FJGQ 2IY5B 4X66Q 1Q82C 2EXDA 3AYHB 5IYBH 5GADC 1OXXK 2WFWA 3CCJA 4LF7L 1E24A 4A3EH 1AE3A 3RZDH 2VNUD 3PO2H 2JQOA 1X3GA 1Q12A 4JBJA 4APVA 5AJ3Q 1PH5A 2JA8H 1S72A 4DR1L 1VQMA 1Y1VG 1QZHA 1VQ4A 4UY8C 2CKZB 4AH6A 1RL2A 1QZGA 4LF5Q 4BBSH 2R93G 2Q2UA 1VQJA 1KC8C 1S3OA 4BA1I 5M3FG 1IYJB 4L5RC 3PO3G 3ERSX 4DNIA 3W5OA 2FXQA 4IFDI 1L1OC 3TS0A 1LTLA 2PI2A 4LFBQ 4A75A 3BJUA 1VQDA 4DKAC 3L7ZC 4RMFA 3FKIH 3D0FA 1EIFA 2L15A 2QA4A 1SE8A 5C3EH 1I3QH 1HNXQ 4JI6L 3I4OA 1TWHH 1X65A 3B6YA 3NBHB 3ZJYC 3PIOA 3S24A 4JI1L 4QQBX 1IBML 1SN8A 1JE5A 4DV7Q 4JI2L 4MZ9A 2OTJA 2PNHA 4DV1Q 5J3BA 1VQOA 1QVFA 4A3JH 5IE8A 4NXML 3KLWA 4OWTB 2LXJA 4JI0Q 3VDYA 3CC4A 1WCMH 4LWCA 2UXDQ 3UDIA 2ZM6L 1W2BA 3PUXA 1HR0Q 4NXNL 4HJ8A 1N33L 3ICEA 4A3EG 3I4NH 4JI8Q 3K80C 3PO2G 3T1HL 2N78A 2JA8G 4QJFA 4PZ7A 3KJPA 4DAYB 4IFDG 4DUYQ 1GKHA 3HOWG 5IT9c 1FGUA 2AWOA 4DV0Q 3KYHC 4BBSG 5LMNQ 4GLAC 1HZ9A 3A74A 4PZ6A 4P71A 3S16H 2F52A 3NELA 3JC66 3HOUH 4DPGA 4DUZL 1G51A 2QGQA 4XTCS 1XMQL 3K7AH 3G4SA 1PH1A 1PA6A 4JI7Q 3CCVA 1ASYA 4A3BH 3S1QH 4IFDJ 2YTVA 4HJ9A 3FKIG 2UUBQ 4JOIC 3MEFA 1N36L 1FL0A 1NY4A 2KENA 5C3EG 2OQ0A 3M9BA 3K7UC 4JI4Q 4JI5Q 1GVPA 4K0KL 4WJ4A 2YV5A 4IJHA 5M5WH 1IBLL 1XPRA 1YHBA 1XMOL 4HJAA 5ELOA 1SFOH 4DR2Q 4IJLA 3UDFA 3M7NA 5GAHC 5IWAL 4A3JG 4GLVB 2R6GA 2ES2A 4OWWB 3A5ZB 4C3HH 2UXCQ 2VQFQ 3PUYA 3PUWA 2ID0A 4IPDA 1CKNB 4YHHL 3CAMA 1OXTA 4R4QA 1VS0A 3UE1A 3H0GH 4MTNA 4R4OA 1VQFA 5HY6A 3U4VA 3I4NG 1YI2A 4DR4Q 4JI3L 1PH4A 1RIPA 5C0XJ 2VQEQ 4B3ML 4B3SQ 1E22A 3I56A 2RHSB 2NZOA 3OYYA 1PYBA 1WOCA 2UUAL 1OXSC 1EQQA 2VZAA 4UP8A 2I5HA 5JJKA 3ULJA 2IX1A 1KRSA 4IPCA 3J7A5 1JMCA 2EIFA 1Y1WH 5IYDH 3J80c 2ZM6Q 4HJ7A 3CF5A 3HOUG 4GNXC 3S1MH 1JJGA 4HIDA 3TQYA 4PMWA 4UP9A 5JEAG 1NMFA 2KHJA 3H3VH 1A63A 3CCQA 4A3BG 5FLXc 3OW2A 2RHQB 3G48A 1AE2A 2UUCL 4A3GH 1I6HH 1MKHA 3HKSA 4L5QA 4DV2L 4A3MG 1PH7A 2Z6KA 1X3FA 1G6PA 3H3VI 1C0AA 2ZTDA 3KDFB 5JJLA 4C3JH 4DV5Q 4DV3L 1XNQL 1N34L 1EWIA 4DAMA 2HHHL 3AEVA 4DV6Q 1C7YA 3RZOH 1OXUA 1OXVA 3K0XA 3FP9A 2I5LX 1CKNA 4LFCL 3HOVH 1VQ7A 4GN3B 1UE6A 2VY3A 2MO1A 3F2CA 1N32Q 4YWKA 2BA1A 1E1OA 2JJQA 3H0GG 3PV0A 4R4IA 4POFA 4JBWA 4ME3A 3F8TA 1L1OB 4PG3A 4JCVE 1UE1A 4P73A 4QL5A 4EX5A 3MXNB 3EIVA 1VQKA 1HH2P 2BH2A 1YVCA 1HNWQ 4C3IH 4YY3L 4OWXB 4DR7Q 1I50H 3CCLA 3L0OA 4DR6L 2GVBA 4FDBA 4RG1A 5FJ8H 2VW9A 3CMEA 1Y1WG 1PH2A 3S2HH 3IRBA 2R92G 3E9IA 3CC2A 1E3PA 1G291 4OX9L 1UEBA 5FLMH 2K5NA 2VL6A 5IP9H 1Y14B 3PF5A 1K0RA 1L0WA 4A3FH 4KHPL 4A3GG 1YEZA 5HGQA 4B3RQ 3J81j 1YJ9A 4MNOA 1ASZA 1CSQA 1YZ6A 3KDFA 4IOCA 3S2DH 2WB1E 2UXBL 1N9WA 4JYAQ 1CKOA 3CPFA 1P8LA 1Q1BA 2C35B 4L5TA 3DLLA 4TVAB 1J5EL 4A76A 1VQ8A 2UU9Q 3M3YH 1E1TA 5H1SE 5IP7H 1HJPA 2NZHA 4DK6C 2ZJQA 4JV5L 5GAGC 4AQYQ 3HOVG 4Y7NH 1Q86C 3OTOQ 2NVTH 5IYBG 1LYLA 4A93H 4LFAQ 3J81i 3J7ZC 2R7DA 5C0XI 5K36G 1L1OA 1A0IA 1NTGA 1YJNA 2B3GA 1PH6A 4GKKQ 4Y52H 4DR5Q 2F4VL 2K5VA 4LF8Q 3PUZA 1VQAA 2MO0A 4KI0A 1K83H 4X64Q 1HNZL 2YTXA 3F2BA 2OTLA 4A3CH 5BR8Q 4DV4Q 3CQZH 2WB1G 5FJ8G 3I4MH 1KXLA 1IZ6A 1TWCH 1KL9A 2IHFA 4X62L 2E2JH 2NVYH 4LF7Q 1YBYA 1PH9A 1FVIA 4LUVA 4GKJL 3FHWA 1XNRL 2JA9A 1PHJA 2AWNA 5IP9G 4DR1Q 4LF6L 1IBKL 3GTMH 4A3FG 2Q2TA 1O7IA 4X65L 1CSPA 2K75A 4R4CA 3CW2C 4B3TL 2A8VA 3EN2A 3ER0A 2E8GA 5DLQE 2OWOA 2E5LL 1I5FA 1SMXA 2KCTA 3KFUA 2ZTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  2RCN A;  4BY7 H;  2KHI A;  3AFQ A;  2ATW A;  1K8A C;  5M5Y H;  2D62 A;  5C0X G;  1S40 A;  5IP7 G;  1X54 A;  2BH8 A;  3RLN A;  4BXX H;  1WYD A;  1I94 L;  1M90 C;  4LF9 L;  4JI6 Q;  4P74 A;  4DR3 L;  1JB7 A;  1WCM G;  1CKM A;  4QGU A;  4A93 G;  3L2P A;  2NVX H;  3HKZ E;  5C4X H;  1JT8 A;  4QIW E;  4LF4 L;  2NVQ H;  3E0E A;  2HIX A;  3BZK A;  3PUV A;  4JI1 Q;  4GNX B;  1YHQ A;  1IBM Q;  4DK3 C;  1VQE A;  1FJG L;  1Q8K A;  3GD7 A;  1XPO A;  4X66 L;  4JI2 Q;  1VQG A;  4BBR H;  4A3K H;  1J5E Q;  2CFM A;  2YTY A;  3DM3 A;  2D0P A;  4NB3 A;  1J6Q A;  4NXM Q;  1B8A A;  2PMZ E;  2XTI A;  3GTK H;  5AJ3 L;  3GTQ H;  4A3C G;  1U5K A;  1YJW A;  4GOP B;  3I4M G;  1VQP A;  1EOV A;  5GQO A;  2YU9 H;  1VQB A;  2HQL A;  4O2D A;  3CPW A;  1N33 Q;  4LF5 L;  4NXN Q;  4YCV A;  3CD6 A;  3EBE A;  4OXP A;  1BBW A;  5E7N A;  2HIV A;  2K50 A;  3KF8 B;  3T1H Q;  1PH8 A;  2GN5 A;  2LSS A;  2NN6 G;  3GTJ H;  2A1A A;  3NEN A;  4P75 A;  1WI5 A;  1Z47 A;  1X55 A;  4JG2 A;  1Q46 A;  5C44 H;  3HKZ G;  4LFB L;  3UDX A;  4HJ5 A;  3WWV A;  1BVS A;  5IYC H;  1LM0 A;  4HIM A;  1CUK A;  3UE0 A;  4OON A;  4X62 Q;  1Q81 C;  1HNX L;  3JAM i;  1NE3 A;  4DUZ Q;  4BY7 G;  4A3D H;  3ULP A;  3NEM A;  1R9T H;  2JEB I;  1XMQ Q;  4BXX G;  3M4P A;  1TWF H;  1PVO A;  4DV7 L;  2JA5 H;  3M85 A;  1N36 Q;  4GS3 A;  2KBN A;  1EFW A;  2BA0 A;  4DV1 L;  1VQ6 A;  1D8L A;  2QEX A;  1D7Q A;  5C4X G;  1YHA A;  2IX0 A;  4GLX A;  2E5L Q;  1A8V A;  2DGY A;  4GNX A;  3S14 H;  2D0O A;  4K0K Q;  3RLF A;  2E2H H;  2K52 A;  3F2D A;  3HOX H;  3CMA A;  2CWA A;  1X9N A;  1IBL Q;  4JI0 L;  2MFI A;  3HOZ H;  4H02 A;  1XMO Q;  2UXD L;  4R1J A;  4BBR G;  2ASB A;  4A3K G;  4KLK A;  2N49 A;  1Q1E A;  5IWA Q;  1BKB A;  1HR0 L;  3TRZ A;  1MIU A;  3I2Z A;  4YWL A;  4JI8 L;  1YIT A;  2CWP A;  2ZJP A;  2Y0S E;  2I0Q A;  2GVA A;  4JBM A;  4GOP A;  3A0J A;  2N3S A;  5IYD G;  4YHH Q;  3CP0 A;  4DUY L;  1HZB A;  1U0L A;  3Q8D A;  4DV0 L;  2JEA I;  3TS2 A;  2H5X A;  1H95 A;  4IOA A;  1KIX A;  3U58 A;  5LMN L;  2PQA B;  2AHO B;  4JI3 Q;  4B3M Q;  5M3M H;  2HT1 A;  3W1B A;  1M1K C;  3I55 A;  4C2M H;  1EQR A;  5C44 G;  3STB D;  3PIP A;  3H15 A;  4JBK A;  2UUA Q;  1XPU A;  3S1N H;  2JK8 A;  2Z0S A;  4JI7 L;  5IYC G;  2ZTC A;  2UUB L;  3HOW H;  4BA2 I;  1VQC A;  4WJ3 M;  1HR0 W;  4A3D G;  2N8N A;  2PI2 E;  4UP7 A;  4JI4 L;  4JI5 L;  3KJO A;  3GTL H;  4A3I H;  1SRU A;  2Y0S G;  4R4T A;  1A62 A;  3KOJ A;  2UUC Q;  3GO5 A;  2OCE A;  2JA5 G;  4DR2 L;  1KQS A;  1XTD A;  4O0A A;  4DV2 Q;  1SRO A;  5LMN W;  4NPS A;  3G71 A;  3K81 C;  3KF6 B;  1L2F A;  3HOX G;  2VQF L;  3J81 c;  2UXC L;  3HOZ G;  2R7F A;  4DV3 Q;  1XNQ Q;  1W3S A;  1N34 Q;  3CCR A;  1K3R A;  1DGS A;  2EQS A;  2HHH Q;  2V1C C;  3PF4 A;  4DR4 L;  4LUZ A;  1VQL A;  2VQE L;  1IXR A;  4B3S L;  2VUM H;  3T1Y L;  4LFC Q;  1VCI A;  3SGI A;  2LXK A;  1UWV A;  5IY0 A;  3GTP H;  1MJC A;  2PQA A;  5FLM G;  4ALP A;  4BY1 H;  1TWA H;  3M4Q A;  4IPH A;  1BBU A;  1EYG A;  1Z9F A;  1SLJ A;  1WFQ A;  1WJJ A;  5M3M G;  3CXC A;  4A3L H;  4EQ5 A;  3F1Z A;  4YY3 Q;  2CQO A;  1X56 A;  3RLO A;  4J15 A;  1T9H A;  4YWM A;  4DR6 Q;  3PGZ A;  3PCO B;  3U4Z A;  2AMC B;  1PH3 A;  2JA6 H;  1GM5 A;  3HFZ B;  4LW1 A;  4P72 A;  3BU2 A;  3U50 C;  4OO1 I;  4UPA A;  3HOY H;  1YNX A;  4A3I G;  2VS1 A;  1V43 A;  4OX9 Q;  2JE6 I;  3D31 A;  2CCZ A;  3I7F A;  3GDE A;  3AFP A;  4DV5 L;  3LGJ A;  1UE7 A;  3BZC A;  3TRE A;  2RF4 A;  4PZ8 A;  1K73 C;  1NJI C;  4L5S A;  2JA7 H;  2IHE A;  3S17 H;  1JJC B;  4KHP Q;  2MQH A;  3UDG A;  2WAQ E;  1QUQ B;  4DV6 L;  1JJ2 A;  3KF6 A;  2Q2H A;  1VQN A;  3M4O H;  1E7Z A;  1TXY A;  1VQ5 A;  1K8G A;  4LUO A;  4TQU S;  2UXB Q;  1X6O A;  1PFS A;  4KHZ A;  1XJV A;  1K9M C;  4POG A;  4HIO A;  4GN4 B;  2R7Z H;  2B63 H;  3W1G A;  2DUD A;  4A3M H;  1N32 L;  1NMG A;  4JOI A;  4IO9 A;  5GAE C;  3AQQ A;  1B70 B;  1KD1 C;  2XGT A;  2K14 A;  1P16 A;  2YYZ A;  3RR5 A;  3TEH B;  3S1R H;  2VUM G;  4JV5 Q;  4X6A H;  1SR3 A;  1V1Q A;  1VQ9 A;  5JJI A;  1HNW L;  1HZC A;  3G6E A;  3S15 H;  4DR7 L;  2WP8 J;  5ELN A;  3CCE A;  2K5H A;  3K8A A;  4BY1 G;  3E9H A;  1IL2 A;  1EIY B;  2Q2I A;  1TWG H;  2Z6K C;  4XIG S;  2F4V Q;  4A3L G;  4OO1 G;  4GN5 A;  2WAQ G;  4JC0 A;  1HNZ Q;  1OTC A;  4HIK A;  3T1Y Q;  1Y1V H;  4IPG A;  1PV4 A;  1AH9 A;  1Q7Y C;  2JA6 G;  3CC7 A;  2IT1 A;  4GKJ Q;  3HOY G;  4B3R L;  1XNR Q;  2R93 H;  3J80 i;  4YCW A;  3JAM c;  4A4I A;  3GTG H;  1PYS B;  4QY7 A;  4AYB E;  5M3F H;  1IBK Q;  3RN5 A;  4LF6 Q;  2JA7 G;  5C4J H;  2R92 H;  3PO3 H;  4X65 Q;  4AIM A;  4JYA L;  5GRO A;  1QUQ A;  1UE5 A;  3CCU A;  1KHI A;  2UU9 L;  4B3T Q;  1X3E A;  3RNU A;  3RN2 A;  3CCS A;  5LMU Q;  5LMU L;  4AQY L;  1QVC A;  2F3I A;  1KAW A;  3OTO L;  1VQH A;  5EAY A;  3A5U A;  1GO3 E;  2AKW B;  4GOP C;  1MJE A;  2B63 G;  2R7Z G;  3CCM A;  4LFA L;  1VQI A;  1V9P A;  2ALY B;  2ZJR A;  1N8R C;  3GTO H;  5JEA J;  2E2I H;  1I94 Q;  2I5M X;  4GKK L;  4LF9 Q;  1HZA A;  2OQK A;  4YCU A;  2MNA A;  2B29 A;  4DR5 L;  1EUJ A;  1C9O A;  4DR3 Q;  3ULL A;  4LF8 L;  1YIJ A;  1NBW A;  2A19 A;  4X64 L;  5M5X H;  1LUZ A;  2KCM A;  1B7Y B;  4LF4 Q;  1QVG A;  1GD7 A;  4LNQ A;  2K4K A;  3STB C;  5BR8 L;  4AYB G;  4DV4 L;  3PSI A;  1KRT A;  1FJG Q;  2IY5 B;  4X66 Q;  1Q82 C;  2EXD A;  3AYH B;  5IYB H;  5GAD C;  1OXX K;  2WFW A;  3CCJ A;  4LF7 L;  1E24 A;  4A3E H;  1AE3 A;  3RZD H;  2VNU D;  3PO2 H;  2JQO A;  1X3G A;  1Q12 A;  4JBJ A;  4APV A;  5AJ3 Q;  1PH5 A;  2JA8 H;  1S72 A;  4DR1 L;  1VQM A;  1Y1V G;  1QZH A;  1VQ4 A;  4UY8 C;  2CKZ B;  4AH6 A;  1RL2 A;  1QZG A;  4LF5 Q;  4BBS H;  2R93 G;  2Q2U A;  1VQJ A;  1KC8 C;  1S3O A;  4BA1 I;  5M3F G;  1IYJ B;  4L5R C;  3PO3 G;  3ERS X;  4DNI A;  3W5O A;  2FXQ A;  4IFD I;  1L1O C;  3TS0 A;  1LTL A;  2PI2 A;  4LFB Q;  4A75 A;  3BJU A;  1VQD A;  4DKA C;  3L7Z C;  4RMF A;  3FKI H;  3D0F A;  1EIF A;  2L15 A;  2QA4 A;  1SE8 A;  5C3E H;  1I3Q H;  1HNX Q;  4JI6 L;  3I4O A;  1TWH H;  1X65 A;  3B6Y A;  3NBH B;  3ZJY C;  3PIO A;  3S24 A;  4JI1 L;  4QQB X;  1IBM L;  1SN8 A;  1JE5 A;  4DV7 Q;  4JI2 L;  4MZ9 A;  2OTJ A;  2PNH A;  4DV1 Q;  5J3B A;  1VQO A;  1QVF A;  4A3J H;  5IE8 A;  4NXM L;  3KLW A;  4OWT B;  2LXJ A;  4JI0 Q;  3VDY A;  3CC4 A;  1WCM H;  4LWC A;  2UXD Q;  3UDI A;  2ZM6 L;  1W2B A;  3PUX A;  1HR0 Q;  4NXN L;  4HJ8 A;  1N33 L;  3ICE A;  4A3E G;  3I4N H;  4JI8 Q;  3K80 C;  3PO2 G;  3T1H L;  2N78 A;  2JA8 G;  4QJF A;  4PZ7 A;  3KJP A;  4DAY B;  4IFD G;  4DUY Q;  1GKH A;  3HOW G;  5IT9 c;  1FGU A;  2AWO A;  4DV0 Q;  3KYH C;  4BBS G;  5LMN Q;  4GLA C;  1HZ9 A;  3A74 A;  4PZ6 A;  4P71 A;  3S16 H;  2F52 A;  3NEL A;  3JC6 6;  3HOU H;  4DPG A;  4DUZ L;  1G51 A;  2QGQ A;  4XTC S;  1XMQ L;  3K7A H;  3G4S A;  1PH1 A;  1PA6 A;  4JI7 Q;  3CCV A;  1ASY A;  4A3B H;  3S1Q H;  4IFD J;  2YTV A;  4HJ9 A;  3FKI G;  2UUB Q;  4JOI C;  3MEF A;  1N36 L;  1FL0 A;  1NY4 A;  2KEN A;  5C3E G;  2OQ0 A;  3M9B A;  3K7U C;  4JI4 Q;  4JI5 Q;  1GVP A;  4K0K L;  4WJ4 A;  2YV5 A;  4IJH A;  5M5W H;  1IBL L;  1XPR A;  1YHB A;  1XMO L;  4HJA A;  5ELO A;  1SFO H;  4DR2 Q;  4IJL A;  3UDF A;  3M7N A;  5GAH C;  5IWA L;  4A3J G;  4GLV B;  2R6G A;  2ES2 A;  4OWW B;  3A5Z B;  4C3H H;  2UXC Q;  2VQF Q;  3PUY A;  3PUW A;  2ID0 A;  4IPD A;  1CKN B;  4YHH L;  3CAM A;  1OXT A;  4R4Q A;  1VS0 A;  3UE1 A;  3H0G H;  4MTN A;  4R4O A;  1VQF A;  5HY6 A;  3U4V A;  3I4N G;  1YI2 A;  4DR4 Q;  4JI3 L;  1PH4 A;  1RIP A;  5C0X J;  2VQE Q;  4B3M L;  4B3S Q;  1E22 A;  3I56 A;  2RHS B;  2NZO A;  3OYY A;  1PYB A;  1WOC A;  2UUA L;  1OXS C;  1EQQ A;  2VZA A;  4UP8 A;  2I5H A;  5JJK A;  3ULJ A;  2IX1 A;  1KRS A;  4IPC A;  3J7A 5;  1JMC A;  2EIF A;  1Y1W H;  5IYD H;  3J80 c;  2ZM6 Q;  4HJ7 A;  3CF5 A;  3HOU G;  4GNX C;  3S1M H;  1JJG A;  4HID A;  3TQY A;  4PMW A;  4UP9 A;  5JEA G;  1NMF A;  2KHJ A;  3H3V H;  1A63 A;  3CCQ A;  4A3B G;  5FLX c;  3OW2 A;  2RHQ B;  3G48 A;  1AE2 A;  2UUC L;  4A3G H;  1I6H H;  1MKH A;  3HKS A;  4L5Q A;  4DV2 L;  4A3M G;  1PH7 A;  2Z6K A;  1X3F A;  1G6P A;  3H3V I;  1C0A A;  2ZTD A;  3KDF B;  5JJL A;  4C3J H;  4DV5 Q;  4DV3 L;  1XNQ L;  1N34 L;  1EWI A;  4DAM A;  2HHH L;  3AEV A;  4DV6 Q;  1C7Y A;  3RZO H;  1OXU A;  1OXV A;  3K0X A;  3FP9 A;  2I5L X;  1CKN A;  4LFC L;  3HOV H;  1VQ7 A;  4GN3 B;  1UE6 A;  2VY3 A;  2MO1 A;  3F2C A;  1N32 Q;  4YWK A;  2BA1 A;  1E1O A;  2JJQ A;  3H0G G;  3PV0 A;  4R4I A;  4POF A;  4JBW A;  4ME3 A;  3F8T A;  1L1O B;  4PG3 A;  4JCV E;  1UE1 A;  4P73 A;  4QL5 A;  4EX5 A;  3MXN B;  3EIV A;  1VQK A;  1HH2 P;  2BH2 A;  1YVC A;  1HNW Q;  4C3I H;  4YY3 L;  4OWX B;  4DR7 Q;  1I50 H;  3CCL A;  3L0O A;  4DR6 L;  2GVB A;  4FDB A;  4RG1 A;  5FJ8 H;  2VW9 A;  3CME A;  1Y1W G;  1PH2 A;  3S2H H;  3IRB A;  2R92 G;  3E9I A;  3CC2 A;  1E3P A;  1G29 1;  4OX9 L;  1UEB A;  5FLM H;  2K5N A;  2VL6 A;  5IP9 H;  1Y14 B;  3PF5 A;  1K0R A;  1L0W A;  4A3F H;  4KHP L;  4A3G G;  1YEZ A;  5HGQ A;  4B3R Q;  3J81 j;  1YJ9 A;  4MNO A;  1ASZ A;  1CSQ A;  1YZ6 A;  3KDF A;  4IOC A;  3S2D H;  2WB1 E;  2UXB L;  1N9W A;  4JYA Q;  1CKO A;  3CPF A;  1P8L A;  1Q1B A;  2C35 B;  4L5T A;  3DLL A;  4TVA B;  1J5E L;  4A76 A;  1VQ8 A;  2UU9 Q;  3M3Y H;  1E1T A;  5H1S E;  5IP7 H;  1HJP A;  2NZH A;  4DK6 C;  2ZJQ A;  4JV5 L;  5GAG C;  4AQY Q;  3HOV G;  4Y7N H;  1Q86 C;  3OTO Q;  2NVT H;  5IYB G;  1LYL A;  4A93 H;  4LFA Q;  3J81 i;  3J7Z C;  2R7D A;  5C0X I;  5K36 G;  1L1O A;  1A0I A;  1NTG A;  1YJN A;  2B3G A;  1PH6 A;  4GKK Q;  4Y52 H;  4DR5 Q;  2F4V L;  2K5V A;  4LF8 Q;  3PUZ A;  1VQA A;  2MO0 A;  4KI0 A;  1K83 H;  4X64 Q;  1HNZ L;  2YTX A;  3F2B A;  2OTL A;  4A3C H;  5BR8 Q;  4DV4 Q;  3CQZ H;  2WB1 G;  5FJ8 G;  3I4M H;  1KXL A;  1IZ6 A;  1TWC H;  1KL9 A;  2IHF A;  4X62 L;  2E2J H;  2NVY H;  4LF7 Q;  1YBY A;  1PH9 A;  1FVI A;  4LUV A;  4GKJ L;  3FHW A;  1XNR L;  2JA9 A;  1PHJ A;  2AWN A;  5IP9 G;  4DR1 Q;  4LF6 L;  1IBK L;  3GTM H;  4A3F G;  2Q2T A;  1O7I A;  4X65 L;  1CSP A;  2K75 A;  4R4C A;  3CW2 C;  4B3T L;  2A8V A;  3EN2 A;  3ER0 A;  2E8G A;  5DLQ E;  2OWO A;  2E5L L;  1I5F A;  1SMX A;  2KCT A;  3KFU A;  2ZTE A; 
#chains in the Genus database with same CATH topology
 2K5W A;  1VMC A;  1TS5 A;  2F0T A;  1CFM A;  2KHI A;  3K59 A;  2EVB A;  4IUR A;  1KLU D;  1X54 A;  3TP6 A;  3NQT A;  3TN2 A;  1M90 C;  1EOT A;  1CKM A;  2R92 B;  1EY7 A;  5C4X H;  1PTO C;  5C4J B;  3BVG A;  2BOS A;  4O42 A;  1EY8 A;  4HMI A;  4RKB A;  1VQG A;  4A3K H;  3WOE A;  2D0P A;  4NXM Q;  1DJR D;  3GTK H;  2XTI A;  3QO2 A;  1SE2 A;  4A3C G;  1T5X D;  3R3O A;  4GOP B;  3L3O C;  2E2I B;  3LX0 A;  3SXH A;  3MHB A;  4IUT A;  4PMC A;  1NNX A;  1CZW A;  2HIV A;  3GTJ H;  4LK1 C;  2A1A A;  1WI5 A;  4OHJ A;  2HQE A;  2L4N A;  3NPP A;  3HKZ G;  3UDX A;  1UUP A;  5IYC H;  1A3U A;  1F2Z A;  4A3E B;  2PQE A;  3PO2 B;  3OIP A;  4A3D H;  1NE3 A;  3ULP A;  4J8Q A;  4RAU C;  1XMQ Q;  1EFW A;  3S2H B;  2BDN A;  1D8L A;  2QEX A;  1D7Q A;  5C4X G;  2IX0 A;  2DGY A;  2F0Q A;  1QJO A;  4K0K Q;  2E2H H;  1WD1 A;  1X3P A;  2CWA A;  1IBL Q;  4JI0 L;  3D3R A;  4NP5 A;  4R1J A;  1EZ8 A;  4A3K G;  4RHS A;  2ASB A;  4KLK A;  5IWA Q;  4WFN 3;  1I3Q B;  1MIU A;  1YIT A;  2CWP A;  2GVA A;  1G2S A;  3HG9 A;  1U9R A;  3K5N A;  4YHH Q;  3TS2 A;  2JN4 A;  2K33 A;  2H5X A;  1IYU A;  1KIX A;  5LMN L;  4B3M Q;  5M3M H;  1RTN A;  3I55 A;  1EQR A;  3D6C A;  1VF7 A;  1WCM B;  2UUA Q;  2JK8 A;  4RGM A;  1I4P A;  1S5B D;  3DWQ A;  5IYC G;  2ZTC A;  2LY7 A;  1EEF D;  3HOW H;  1VQC A;  1HR0 W;  4A3D G;  2N8N A;  2C5C A;  2A68 D;  4TKO B;  2CW0 C;  2R61 A;  1SRU A;  2Y0S G;  4R4T A;  5M9O A;  1A62 A;  4OGQ C;  4X3U A;  4O1N A;  5CR3 A;  3I4M B;  4M8A A;  4O0A A;  1D1K A;  1PZJ D;  1DXM A;  1SRO A;  2NVY B;  4NPS A;  1Y8N B;  2VQF L;  3X3N A;  4DV3 Q;  3CCR A;  2KUM A;  1DGS A;  2V1C C;  3KLR A;  3PF4 A;  3RD4 A;  4DR4 L;  1OO9 B;  1GUO A;  1U4R A;  1IXR A;  2VUM H;  4LFC Q;  5J22 A;  4CKB A;  3RUZ A;  1UWV A;  3BDL A;  5IY0 A;  1HQM C;  3GTP H;  4KJN A;  3T51 B;  4BY1 H;  4B9X A;  3M4Q A;  4IPH A;  5M3M G;  2VXW A;  4Q5V A;  4EQ5 A;  2JSO A;  3F1Z A;  4KN4 C;  2A6E C;  2F0W A;  3RLO A;  3H0G B;  5LL6 S;  5I4D A;  1PFM A;  1PTO B;  1SNO A;  4LW1 A;  3U50 C;  1SND A;  5KYI A;  4UPA A;  1HTP A;  1YNX A;  2VS1 A;  2F1M A;  4OX9 Q;  1B9M A;  1Z7T A;  2F0F A;  2F0I A;  2FMM A;  3LGJ A;  2RF4 A;  4PZ8 A;  3TRE A;  4L5S A;  1Y1W B;  2MQH A;  3UDG A;  1QUQ B;  1JJ2 A;  1BCP B;  1VQN A;  4ZQ3 A;  2A73 B;  1E7Z A;  1K8G A;  5IGF A;  1YNN D;  5IGB A;  1WTP A;  3MFY A;  2B63 H;  1N32 L;  2DUD A;  1NAP A;  4ZKC B;  5GAE C;  1KD1 C;  1B70 B;  1SYE A;  3TEH B;  2VUM G;  2EY5 A;  1LTI D;  1QNK A;  1VQ9 A;  1V1Q A;  1HZC A;  5FLX L;  2WP8 J;  1ENF A;  2EYM A;  2L55 A;  4BY1 G;  4IUN A;  2F0K A;  3P1H A;  1TWF B;  4L63 B;  4GN5 A;  4ZUJ A;  1HNZ Q;  1QG7 A;  4NDX A;  5DM6 3;  1Y1V H;  1AH9 A;  2AQ2 B;  5D3I B;  3HOX B;  1SYC A;  4B3R L;  2AUK A;  4CHT B;  2R93 H;  5ELC A;  1D6E C;  1D5M C;  4C3I B;  5M3F H;  4X65 Q;  1BCP D;  2WAC A;  3CCU A;  3ERO A;  1K8O A;  3CCS A;  4G7H C;  2QDB A;  2B2V A;  1HA6 A;  1K0S A;  4JPB W;  1KAW A;  2XRS D;  1VQH A;  3C1F A;  5EAY A;  3A5U A;  2NTT A;  3V2T A;  1MJE A;  2B63 G;  4N9P A;  3I72 A;  1VQI A;  4H44 C;  1V9P A;  1I94 Q;  1B50 A;  4GKK L;  4YCU A;  3RZO H;  2B29 A;  4LF8 L;  3ULL A;  1YIJ A;  1NBW A;  1TY0 A;  3VYT A;  3VR5 A;  2KCM A;  1B7Y B;  4LF4 Q;  3GTL B;  5FO9 B;  1SXT A;  3M3Y B;  1J9O A;  3DEO A;  5IYB H;  2WFW A;  3CCJ A;  1A15 A;  3ND8 A;  4XT1 B;  3TP7 A;  1X3G A;  1Q12 A;  5AJ3 Q;  1CK1 A;  2JA8 H;  4DR1 L;  1FGB D;  1Y1V G;  1VQ4 A;  1QZH A;  2EYH A;  1LV9 A;  1QZG A;  4LF5 Q;  4BBS H;  2R93 G;  1K83 B;  5EPJ A;  1S3O A;  5CV9 A;  5E4W C;  5M3F G;  3W5O A;  3ERQ A;  3CQZ B;  3TS0 A;  1Q8I A;  2NB0 A;  3DUZ A;  4FP5 D;  3WDN A;  2L12 A;  2QA4 A;  1HNX Q;  2JYO A;  1O7Z A;  3I4O A;  1X65 A;  1MSH A;  3ZJY C;  4RA8 A;  1H9J A;  3H94 A;  2PNH A;  1QVF A;  1C48 A;  3I70 A;  2WKD A;  1HTL D;  2F0U A;  2LFN A;  2HDM A;  1W2B A;  3PUX A;  2EJF C;  4NXN L;  4K5X A;  1N33 L;  3ND9 A;  3I4N H;  2JA8 G;  4PZ7 A;  1V1P A;  4DV0 Q;  3BDO A;  1B1Z A;  4BBR B;  4BBS G;  4GLA C;  4ZCK A;  4PZ6 A;  1Y8P B;  3S16 H;  3GV6 A;  3JC6 6;  2XWB B;  1QCB D;  1DCZ A;  5JEA H;  4XTC S;  2J7Z A;  2SEB D;  2NN6 H;  4XDX A;  3SEB A;  3MEF A;  1FL0 A;  1NY4 A;  4BS9 A;  4K5W A;  1EYA A;  3M9B A;  3K7U C;  4NMZ A;  2YV5 A;  4IJH A;  5M5W H;  1YHB A;  3NHH A;  4WJW A;  1SNM A;  4JK1 C;  5GAH C;  4OWW B;  2ID0 A;  3CAM A;  4TSS A;  1H9M A;  5CBE E;  3I4N G;  1SSO A;  4CBV A;  1HFN A;  4DAY A;  5C0X J;  3GV3 A;  5KEE A;  2NZO A;  1PYB A;  4V0B A;  1EQQ A;  4UDU C;  1GHK A;  2I5H A;  3EVQ A;  4PV1 C;  1EQV A;  1DOM A;  3MXG A;  3GTO B;  3J80 c;  2ZM6 Q;  3CF5 A;  4GNX C;  1JJG A;  1CTM A;  5JEA G;  1JB3 A;  1NMF A;  1A63 A;  3H3V H;  3CCQ A;  1JQY D;  4ME5 A;  1AE2 A;  3PMF A;  1I6H H;  2JXM B;  4DV2 L;  1LTT D;  1NSN S;  2XSC A;  2F0D A;  1PH7 A;  1G6P A;  1X3F A;  1G6Z A;  3H3V I;  2ZTD A;  4DN4 M;  3S1N B;  4C3J H;  4B9W A;  1XNQ L;  4DAM A;  4DV6 Q;  1C7Y A;  5T1G A;  3G6J B;  4RH6 A;  1YNJ C;  1HRJ A;  2VY3 A;  2NZ1 D;  3J7A V;  5FK9 C;  1PDQ A;  5K36 H;  4R4I A;  2IX3 A;  4JBW A;  5CV7 A;  4IZ8 A;  3KK7 A;  5KRU A;  2TMP A;  1HNW Q;  4DR7 Q;  2MHV A;  1I50 H;  2EY2 A;  1SMY C;  4DR6 L;  2XWJ B;  3I4L A;  2P5Z X;  1KDA A;  3E9I A;  4A3J B;  1LT5 D;  2E74 C;  5HGT A;  2VL6 A;  1K0R A;  1MSG A;  2J4X A;  1EZ6 A;  1WTR A;  1DOK A;  4MNO A;  1TR5 A;  2WAQ B;  2LKV A;  4C3J G;  2UXB L;  4JYA Q;  1CKO A;  4L5T A;  3DLL A;  3I91 A;  2F0O A;  5H1S E;  5IP7 H;  5I2X A;  4AQY Q;  3AB9 A;  3EQL C;  3OW7 A;  2OXP A;  4A93 H;  5CYU A;  3J81 i;  2KHS A;  5DM7 3;  5K36 G;  1GXD C;  1B3A A;  1NTG A;  5EBC A;  2F4V L;  4XYQ A;  4X64 Q;  2OTL A;  2GA4 B;  1MI2 A;  1KXL A;  1EY0 A;  1IZ6 A;  1TWC H;  1KL9 A;  2R3Z A;  4LF7 Q;  1YBY A;  4CDF C;  4LUV A;  3FHW A;  1XNR L;  2JA9 A;  4DF7 A;  1JOO A;  1IBK L;  1D5X C;  2OF1 A;  2Q2T A;  4NKL A;  4PQX A;  2K75 A;  3CW2 C;  4B3T L;  1TWG B;  3EN2 A;  5DLQ E;  2SNS A;  2OWO A;  3NTH A;  1KNE A;  4CKE A;  4HMJ A;  5IP7 G;  4BXX H;  1S5C D;  4RGO S;  2QW7 A;  3T13 A;  4K5V A;  1JB7 A;  4N8X 1;  3GTG B;  1LTA D;  4A93 G;  3HKZ E;  1JT8 A;  5CV8 A;  3PUV A;  2HIX A;  3BZK A;  4JI1 Q;  4GNX B;  1YHQ A;  2E75 C;  4DK3 C;  2A6H D;  1TII D;  3GD7 A;  4X66 L;  1J5E Q;  4UAI A;  3T56 B;  4Q0F A;  2HCC A;  3NXW A;  3BS1 A;  1U5K A;  1YJW A;  2K04 A;  5GQO A;  2HQL A;  3Q24 A;  3CPW A;  2BE5 D;  3NEN A;  4B08 A;  3A7L A;  4RGT A;  5C44 H;  1ILP A;  5FO7 B;  2KQ3 A;  1BVS A;  1CUK A;  4OON A;  4S3S A;  2PZT A;  2LS0 1;  4X62 Q;  3JAM i;  1SDF A;  1R9T H;  2JEB I;  1XXG A;  3CRL C;  1STE A;  4BXX G;  1L0Y B;  1N36 Q;  2OT2 A;  1VQ6 A;  1IW7 C;  5TSS A;  4QUC A;  4GLX A;  2E5L Q;  1A8V A;  3S14 H;  1QE6 A;  3RLF A;  2K52 A;  5ELF A;  3HOZ H;  2UXD L;  1HR0 L;  1FYC A;  2N49 A;  1BKB A;  3I2Z A;  4JI8 L;  1ZXT A;  2Y0S E;  1STN A;  2F0V A;  4DUY L;  4KKS A;  2EOT A;  1U0L A;  1LTR D;  3Q8D A;  4QB4 A;  1H95 A;  1JR0 D;  2G5D A;  2QEJ C;  4JI3 Q;  2C9O A;  3W1B A;  2HT1 A;  5C44 G;  1ICW A;  4JBK A;  4HCS A;  5G3L D;  4E6I A;  1H9R A;  4EQP A;  2QCP X;  3NWT A;  5BN4 A;  4BA2 I;  1EY4 A;  4HAE A;  2PI2 E;  4JVZ A;  2KA7 A;  4OIJ A;  4JI4 L;  4A3I H;  3KOJ A;  2CQA A;  2UUC Q;  2OCE A;  3C2P A;  3O13 A;  5BN3 A;  1FNV A;  1XTD A;  4HED A;  3G71 A;  3KF6 B;  1F9S A;  2UXC L;  5COY A;  3HOZ G;  1N34 Q;  1K3R A;  3W3A A;  2CHB D;  2EQS A;  2HHH Q;  5J1Z A;  4ZAI A;  1X3Q A;  3HKZ B;  1WTX A;  1LT3 D;  4B3S L;  2F0L A;  3SGI A;  3EJI A;  2PQA A;  3J80 E;  5FLM G;  4ALP A;  1TWA H;  5KGU A;  1SLJ A;  4H0L C;  4A3L H;  1SE4 A;  4UHV A;  5A2Q E;  1QIL A;  5C4X B;  2G9D A;  4ID6 A;  4GZY C;  2JA6 H;  4KY7 A;  2TSS A;  3BU2 A;  4A3K B;  4A3I G;  4RCN A;  2JE6 I;  3E6Z X;  2RDG A;  3D31 A;  3MXU A;  3I7F A;  3GTK B;  4RKL A;  4DV5 L;  3BZC A;  5IIF A;  2B2U A;  1ZKO A;  3BYT B;  4KHP Q;  1JJC B;  4KD3 A;  3M4O H;  2KVM A;  3S1M B;  1II3 A;  4TQU S;  3GTJ B;  1H9K A;  1PFS A;  4KHZ A;  1XJV A;  4KKU A;  4HIO A;  3W1G A;  4A3M H;  4IO9 A;  3J80 L;  2XGT A;  3NK9 A;  2ZXP A;  3SVM A;  4A3D B;  1EWH A;  1EWC A;  3S15 H;  5A2Q L;  4I7Z C;  2Y0S B;  2PW5 A;  1KAA A;  1EIY B;  2Z6K C;  4A3L G;  1WTV A;  4G57 A;  3C3L A;  1BCP F;  1KNA A;  5ISR A;  4DK1 A;  4IPG A;  2EYF A;  2JA6 G;  3CC7 A;  3OMG A;  2KEC A;  1UAP A;  2ZXO A;  3HZX A;  4A4I A;  2Q8I B;  4YIJ A;  1PYS B;  4LF6 Q;  2R92 H;  5C4J H;  2UU9 L;  3DXJ C;  1KHI A;  1X3E A;  4XYO A;  5LMU Q;  3OTO L;  2AKW B;  4LFA L;  4A3F B;  2E2I H;  3OWE B;  4LF9 Q;  1HZA A;  2OQK A;  4DR5 L;  1EUJ A;  3BDC A;  4DR3 Q;  1V1O A;  1PRT B;  3MWY W;  5T1I A;  1GD7 A;  3OWF A;  4LNQ A;  3STB C;  4KKT A;  1FJG Q;  4FYD A;  1FD7 D;  2IY5 B;  2EXD A;  2B2T A;  5GAD C;  1OXX K;  1K8M A;  1E24 A;  4Y7N B;  2RQX A;  4A3E H;  3M7G A;  3PO2 H;  2JQO A;  4APV A;  3SR1 A;  3ZYY X;  1EIG A;  1VQM A;  1V8Q A;  5C4Z A;  3MC0 B;  4FVM A;  1RL2 A;  3MVV A;  2M9V A;  1VQJ A;  2HCI A;  4BA1 I;  4ZKB B;  1SYD A;  4DNI A;  2VUM B;  2FXQ A;  1LTL A;  4LFB Q;  3BJU A;  3MZ5 A;  2E2J B;  3D0F A;  1EIF A;  1I3Q H;  5EGT A;  3NBH B;  3GTM B;  2PO4 A;  4QQB X;  3HS0 C;  1JE5 A;  4DV7 Q;  3H91 A;  1PRT D;  4FXK C;  4DV1 Q;  5IE8 A;  1W6J A;  4NXM L;  3KLW A;  3FDT A;  4HR7 B;  2A69 D;  4OWT B;  2LXJ A;  1WCM H;  2PPB C;  1B9N A;  3ICE A;  4A3E G;  5FLX E;  3K80 C;  3PO2 G;  2NVX B;  2O5J C;  4QJF A;  1EEI D;  3HOW G;  5IT9 c;  1SBB B;  1S5E D;  5EKI A;  2B63 B;  4KMU C;  4RGN A;  3A74 A;  4K2K A;  2F52 A;  2H1E A;  3NEL A;  2X6L A;  4RHR A;  3HOU H;  3GTQ B;  1G51 A;  5CBA E;  2QGQ A;  1XMQ L;  1PH1 A;  3G4S A;  4JI7 Q;  1PA6 A;  1O7L A;  1VDZ A;  2YTV A;  4HJ9 A;  2UUB Q;  1KTK A;  2CH4 A;  2EE1 A;  2FMC A;  1JOK A;  4ZUI A;  3P75 A;  4JI5 Q;  5CV6 A;  1B44 D;  4K0K L;  3QWN A;  1IBL L;  4HJA A;  4DR2 Q;  3UDF A;  2BDO A;  5JVG 3;  5IWA L;  4GLV B;  1NUC A;  1A3V A;  5F2D A;  3A5Z B;  4C3H H;  5IOC A;  2I46 A;  3PUY A;  3VYR A;  2QIL A;  4U68 A;  4YHH L;  5M3F B;  1VS0 A;  3UE1 A;  3H0G H;  4R4O A;  3LNN A;  2JA5 B;  1X32 A;  1G8Z D;  4QUF A;  3K58 A;  1ROD A;  2WKC A;  3IFD A;  1RIP A;  2VQE Q;  1PTO D;  4B3M L;  1HFG A;  3OYY A;  2UUA L;  3T4A C;  1O7Y A;  1AFP A;  2J0T D;  3ULJ A;  2IX1 A;  1KRS A;  1IKL A;  3J7A 5;  1Y1W H;  5IYD H;  3X3M A;  3HOU G;  3H3V C;  3RZO B;  3TQY A;  4PMW A;  4RCO A;  4UP9 A;  1RDP D;  2ZXR A;  2IL8 A;  1Z6H A;  1K28 A;  3G48 A;  3A8J E;  5C5M A;  4A3G H;  1MKH A;  3HKS A;  2RCF A;  4C2M B;  1LO5 D;  1C0A A;  1BOS A;  5JJL A;  4DV3 L;  2JA8 B;  1UEA B;  2ICE C;  3E3X A;  2B2T C;  1GUW A;  1OXV A;  4C3H G;  3K0X A;  3FP9 A;  3F2U A;  1CKN A;  4LFC L;  2MO1 A;  1JWM D;  3D4R A;  3H0G G;  2JJQ A;  4I7A A;  3PV0 A;  3QB3 A;  4POF A;  4PG3 A;  4P73 A;  3NQI A;  4J1M A;  4JCV E;  4QL5 A;  4EX5 A;  3MXN B;  2BH2 A;  1YVC A;  4C3I H;  4MTK A;  3CCL A;  3L0O A;  4DXG A;  2GVB A;  4RG1 A;  5FJ8 H;  1Y1W G;  1PH2 A;  2EPB A;  3IRB A;  1RF2 D;  3NTK A;  1AN8 A;  2K1B A;  1GJX A;  4XQQ A;  2L1B A;  4OX9 L;  1UEB A;  2F03 A;  5ELB A;  2F3W A;  4A3G G;  5HGQ A;  4PMB A;  1XYI A;  1YJ9 A;  1ASZ A;  1CSQ A;  1K3B C;  3A56 A;  3KDF A;  4IOC A;  3I4N B;  1N9W A;  1P8L A;  1Q1B A;  2C35 B;  4A76 A;  1VQ8 A;  1LAC A;  3M3Y H;  5C0X H;  1E1T A;  2CVR A;  4DK6 C;  4EQN A;  2CW0 D;  2NVT H;  3S16 B;  3IFT A;  5IYB G;  1LYL A;  5C0X I;  1A0I A;  1L1O A;  1YJN A;  2IWH A;  3SDZ A;  3VR4 A;  2MO0 A;  5I9O A;  1K83 H;  4C3I G;  1HNZ L;  1H9S A;  2EXZ A;  4I65 A;  2R7Z B;  2BCO A;  5BR8 Q;  4DV4 Q;  3CQZ H;  2WB1 G;  5FJ8 G;  2IHF A;  5BN5 A;  3S1R B;  3K5L A;  1PHJ A;  5CC4 A;  3D6W A;  2AWN A;  5D14 A;  3TP8 A;  5C6A A;  1QB5 D;  1SNQ A;  1O7I A;  1TS4 A;  5ELD A;  4X65 L;  1E0B A;  2D2C C;  3ER0 A;  5COR A;  2KCT A;  2ZTE A;  3I90 A;  2NN6 I;  2D9U A;  2RCN A;  4BY7 H;  1STY A;  3AFQ A;  2B2W A;  1D1I A;  5CV4 A;  5M5Y H;  2D62 A;  5C0X G;  1S40 A;  1WYD A;  1I4R A;  1CZG A;  3DWP A;  1I94 L;  4JI6 Q;  4P74 A;  4QGU A;  1M8A A;  3L2P A;  4LF4 L;  2NVQ H;  2EJM A;  1IBM Q;  4KHV A;  2DY7 A;  1Q8K A;  1XPO A;  4JI2 Q;  4MHE A;  4C1N K;  4BBR H;  2YTY A;  1GHJ A;  4MIU A;  1I6H B;  4NB3 A;  4U67 3;  1J6Q A;  2WV6 D;  1WVL A;  2PMZ E;  5AJ3 L;  2VB2 X;  3N52 A;  1B2T A;  2YU9 H;  1VQB A;  1MGS A;  2B2V C;  4LF5 L;  4YCV A;  2ICI A;  4OXP A;  3CD6 A;  2RDF A;  1ZYR C;  2K50 A;  3KF8 B;  3T1H Q;  1PH8 A;  1U4M A;  2LSS A;  2NN6 G;  5FKA C;  4P75 A;  3IAY A;  3NBI A;  5DEH A;  5KIX A;  1U4P A;  2K7V A;  1LM0 A;  4HIM A;  3UE0 A;  4M1U B;  1IHZ A;  1Q81 C;  1HNX L;  4BY7 G;  4DUZ Q;  1GUS A;  3NEM A;  4EGV A;  3M4P A;  3EFX D;  2Z4H A;  1BXT A;  4KTA A;  3M85 A;  2KBN A;  2HDL A;  3VA5 A;  1CQV A;  2Z8L A;  3F2D A;  3CMA A;  2KEE A;  4H02 A;  2HUG A;  1XMO Q;  4BBR G;  1QOH A;  4KD4 A;  4YWL A;  2ZJP A;  2I0Q A;  5KND A;  3DMU A;  3KLS A;  3A0J A;  4GOP A;  3TP5 A;  5G3L F;  2KJX A;  1Y69 U;  1HZB A;  4DV0 L;  1VF5 C;  2L0C A;  3U58 A;  2QF7 A;  2AHO B;  1EQT A;  1M1K C;  3H15 A;  5KYL A;  1XPU A;  3S1N H;  2Z0S A;  1PFN A;  2DJG C;  4WJ3 M;  1SYF A;  4UP7 A;  3KJO A;  1EIH A;  3TZD A;  1RKN A;  2I07 B;  3DWA A;  4V19 0;  1TVX A;  1KQS A;  1STG A;  3K81 C;  2L9H A;  4IUV A;  3K7A B;  5IT9 L;  4A3B B;  2R7F A;  2SNM A;  1W3S A;  2X69 A;  1JOR A;  4KK7 A;  5K5P A;  1LT6 D;  4LUZ A;  3T1Y L;  1VCI A;  4CKC A;  1G91 A;  1PXU A;  1MJC A;  4HCE A;  2PMZ B;  1SAP A;  1BBU A;  1Z9F A;  1WJJ A;  5L37 A;  4OO1 H;  4IN3 A;  3J7Y W;  3VR2 A;  4YY3 Q;  1HHV A;  4J15 A;  1T9H A;  1MBY A;  3MEH A;  3PCO B;  1R4Q B;  1PH3 A;  3C46 A;  4G4K A;  1E2V A;  1GM5 A;  3VA7 A;  4OO1 I;  3LWE A;  3HOY H;  1V43 A;  2M2L A;  2CCZ A;  3BYY B;  3GDE A;  4F87 A;  5C3W A;  1UE7 A;  1WTO A;  2JA7 H;  1NJI C;  4N9T A;  2IHE A;  3S17 H;  1BF4 A;  3FPP A;  4DV6 L;  1TXY A;  1VQ5 A;  1ESR A;  2XN9 C;  1K9M C;  1QNU A;  5KNB A;  4JOI A;  5IGC A;  3R2I A;  4JV5 Q;  5EJW A;  2O2L D;  3RR5 A;  4HSV A;  4X6A H;  1HNW L;  4CJ2 C;  3G6E A;  4DR7 L;  5ELN A;  4LMQ D;  1RD9 D;  3K8A A;  3TSS A;  1CHP D;  1IL2 A;  1A2U A;  2K03 A;  1TWG H;  3CU7 A;  3BVM A;  4OO1 G;  2WAQ G;  3NUC A;  2KED A;  3TBI B;  4RFB A;  3HOV B;  4X3T A;  1IYV A;  1OTC A;  3HGB A;  4HIK A;  3HOZ B;  2H4O A;  2DJF C;  4QF4 A;  3HOY G;  4GKJ Q;  5I9P A;  3J80 i;  2Z9H A;  2EJG C;  1JCK B;  1NCV A;  3GTG H;  1LT4 D;  1CHQ D;  3PO3 H;  2JA7 G;  4JYA L;  1I4H A;  2RVL A;  4K6D A;  5GRO A;  1QUQ A;  3Q6S A;  1CT1 D;  4QMG A;  4AQY L;  1QVC A;  4EVO A;  2F3I A;  1CA6 A;  1GO3 E;  4LJZ C;  4GOP C;  3CCM A;  4R8I A;  2CH4 W;  2ALY B;  2ZJR A;  2MPM A;  1S5F D;  5AFW A;  3R93 A;  2D5D A;  2MNA A;  2F0P A;  3OOC A;  2F0N A;  4XQN A;  2A19 A;  5JOB A;  4X64 L;  5M5X H;  1LUZ A;  3S2D B;  1SE3 A;  1QVG A;  4K2L A;  4ZLT F;  4A3I B;  2K4K A;  4AYB G;  3PSI A;  3CHB D;  1Q82 C;  4K8I A;  4XT3 B;  4LF7 L;  3HRZ C;  1Q90 A;  1YNJ D;  1AE3 A;  5E4X A;  3RZD H;  2VNU D;  1PH5 A;  2A68 C;  1V1P B;  2CKZ B;  4AH6 A;  1PZI D;  3IKJ A;  2Q2U A;  1FNW A;  1KC8 C;  1SNP A;  4NW2 A;  3D4W A;  3DM1 A;  4L5R C;  2L11 A;  5E3F A;  3PO3 G;  3ERS X;  1TT2 A;  1SMY D;  3J81 L;  4A75 A;  1PRT F;  1VQD A;  4DKA C;  3PQI A;  3FKI H;  1HQR D;  2KCC A;  5C3E H;  1TWA B;  1ENA A;  1TWH H;  3B6Y A;  4TRD A;  4JI1 L;  1SN8 A;  4XQJ A;  1ICF B;  2XNA C;  4MZ9 A;  1VQO A;  2F0S A;  3DEP A;  1ESF A;  3FPU B;  3C1E A;  1F2L A;  1ML0 D;  4JI0 Q;  1CQF A;  3CC4 A;  3UDI A;  1CI3 M;  4HJ8 A;  3M4O B;  2N78 A;  3KJP A;  4DAY B;  1GKH A;  4K6L A;  1FGU A;  4OEL B;  5LMN Q;  1HZ9 A;  4L8J A;  4ZRZ A;  1Y8O B;  4ILW A;  1E2W A;  1YNN C;  4G7O C;  2KCN A;  3S1Q H;  3CCV A;  1ASY A;  3FKI G;  2XRQ D;  3Q0A A;  4JOI C;  3GQB A;  1N36 L;  5C3E G;  2PNR C;  2OQ0 A;  3K0Y A;  1Q3L A;  1L0X B;  3HEJ A;  1XPR A;  5ELO A;  2FIN B;  3QOL A;  5IGG A;  4IJL A;  1SFO H;  3M7N A;  1PTO F;  1MHW C;  3A55 A;  1I4X A;  3SK6 A;  2K5D A;  2R6G A;  1LTB D;  3BVZ A;  2VQF Q;  3NTI A;  3PUW A;  1OXT A;  1FR3 A;  4R4Q A;  4MTN A;  5NUC A;  1VQF A;  5HY6 A;  1KAB A;  3U4V A;  4CDE C;  1YI2 A;  4DR4 Q;  4JI3 L;  1GOZ A;  2E2H B;  3KLS X;  3JAM L;  5IGD A;  3MXP A;  1OXS C;  2NYZ D;  2VZA A;  2DNE A;  1LTG D;  4IPC A;  1BCP C;  1XWE A;  3S1M H;  2KOL A;  4DFA A;  4HID A;  2OEO A;  4EQO A;  2KHJ A;  1EY5 A;  2SOB A;  3QIA A;  2UUC L;  3P20 A;  3AU7 A;  1EL0 A;  4L5Q A;  3VR3 A;  2SDF A;  5M3M B;  4A3M G;  2O5I C;  1ET9 A;  2AQ1 B;  1EY6 A;  3MFG A;  4F7X A;  3J7A F;  3D4D A;  1N34 L;  1DZ1 A;  2K32 A;  4DNT B;  3HOW B;  2HHH L;  1XX8 A;  5ELE A;  2PYK A;  1HXY D;  1TQO A;  4IUU A;  2I5L X;  3QJY A;  3F2C A;  1N32 Q;  4YWK A;  1E1O A;  3I73 A;  2NUC A;  4H7B A;  3F8T A;  1IW7 D;  3EIV A;  5IGE A;  1VQK A;  2EDG A;  2NWG A;  2RBM A;  3OMC A;  3OSO A;  4DAP A;  4DA2 A;  3CME A;  2B39 A;  3S2H H;  4X3K A;  3NP8 A;  2Z6B A;  2R92 G;  4KJO A;  3KF8 A;  1EYD A;  1G29 1;  1W6K A;  3GTP B;  3PF5 A;  1PFB A;  2FFK B;  4DXF A;  1HUM A;  4A3F H;  4KHP L;  4BY1 B;  5CV5 A;  1YEZ A;  3T53 B;  5KNC A;  4B3R Q;  2DY8 A;  2WB1 E;  4FXD A;  3CPF A;  1HPC A;  4TVA B;  1PZK D;  4J6H A;  5JAV A;  3Q22 A;  1A6X A;  1HJP A;  5C5L A;  1NR2 A;  2B8G A;  5HUR A;  3BG3 A;  2ZJQ A;  3R2T A;  5JPM C;  5GAG C;  4ZK9 B;  3E0J A;  4Y7N H;  1Q86 C;  3HOU B;  4OIK A;  2F0J A;  3J7Z C;  2R7D A;  5JVH 3;  4ZYS A;  1SYG A;  4K8J A;  1PH6 A;  4GKK Q;  4Y52 H;  2QKI C;  4LF8 Q;  4KI0 A;  4DAV A;  1BR9 A;  3OPO A;  3W2D A;  3F2B A;  2B2U C;  1LTS D;  3I4M H;  1M4V A;  3SK8 A;  2E2J H;  2NVY H;  2N88 A;  4KY6 A;  3SE0 A;  1PH9 A;  1S4Z A;  1EFI D;  4FF4 A;  3KBG A;  4DR1 Q;  4LF6 L;  4C3H B;  3GTM H;  1J8I A;  2E2D C;  2K05 A;  4A3F G;  5J39 A;  1CSP A;  3A54 A;  2B8F A;  1CM9 A;  4K14 A;  4DU9 A;  5LMU L;  4X3S A;  1STH A;  2ATW A;  2A74 C;  1Y1V B;  1K8A C;  2BH8 A;  3RLN A;  3G7L A;  1LLR D;  2R93 B;  4LF9 L;  4PNY A;  4IUQ A;  1F9Q A;  4DR3 L;  1WCM G;  2NVX H;  2NBF A;  1JWS D;  4QIW E;  4FO2 A;  2E76 C;  3E0E A;  1PTO H;  3V96 A;  3VYU A;  1DOL A;  1VQE A;  1FJG L;  2CFM A;  1DM0 B;  4A3G B;  3DM3 A;  3K6O A;  1JWU D;  3L9A X;  1B8A A;  4DGZ A;  3GTQ H;  3SK5 A;  1EYC A;  4KV6 A;  3I4M G;  1VQP A;  1EOV A;  3N6R A;  1D5Z C;  4O2D A;  1N33 Q;  4NXN Q;  4WOR A;  3EBE A;  4KY5 A;  1BBW A;  5E7N A;  2GN5 A;  4MN3 A;  3RMH A;  1Z47 A;  1X55 A;  4JG2 A;  1Q46 A;  4LFB L;  4HJ5 A;  3WWV A;  3OHX C;  1EU3 A;  4G7Z C;  2IJ0 A;  4CDC C;  1TWF H;  2M00 A;  4BBS B;  3R8B A;  4DV7 L;  2JA5 H;  1PVO A;  2WB1 B;  4GS3 A;  2BA0 A;  4DV1 L;  1PLF A;  1YHA A;  4GNX A;  4FNF A;  2D0O A;  4C56 C;  1F2Y A;  3KUP A;  3U9S A;  3HOX H;  1X9N A;  2MFI A;  2K5Q A;  1Q1E A;  3TRZ A;  3EA6 A;  4JBM A;  2N3S A;  2PCF B;  5JJZ A;  1ENC A;  5IYD G;  2AUJ D;  3CP0 A;  4CGY B;  2JEA I;  2N55 A;  4IOA A;  4CJ1 B;  2QDL A;  2PQA B;  5CMD A;  2EYP A;  3E5S A;  4C2M H;  3MA2 B;  3STB D;  3PIP A;  2NVT B;  1TY2 A;  4ULL A;  4JI7 L;  2A5H A;  3FVQ A;  3QR8 A;  2UUB L;  1O80 A;  1B3Q A;  3GTL H;  1U4L A;  1T5E A;  4JI5 L;  1AZQ A;  1ONL A;  1GUT A;  5EPL A;  3NWS A;  4FF2 A;  3GO5 A;  1B4O A;  2JA5 G;  4DR2 L;  4CJ0 B;  1HCZ A;  2Q8T A;  4DV2 Q;  1SNC A;  3T16 A;  5LMN W;  4OEM B;  1VMP A;  5D3D A;  3V05 A;  1KDB A;  1L2F A;  3HOX G;  3J81 c;  5FOB B;  3A8I E;  1XNQ Q;  4R9W A;  1STA A;  4QIW B;  3OIQ A;  4N8F A;  2RSN A;  3QG1 A;  1VQL A;  2VQE L;  3U9O A;  5M5W B;  2LXK A;  4BY7 B;  4XXE A;  1QWY A;  1WD0 A;  2XIW A;  5M5Y B;  1EYG A;  1JE4 A;  1WFQ A;  3CXC A;  4P2C B;  1G2T A;  2CQO A;  1X56 A;  1I4Q A;  4YWM A;  1WTW A;  4DR6 Q;  2NVQ B;  3M4Y A;  3PGZ A;  3U4Z A;  1R4P B;  2AMC B;  2A6E D;  1CA5 A;  3HFZ B;  4P72 A;  1PYW D;  3AFP A;  2G9H D;  5DAU A;  1D2B A;  2NTS A;  1K73 C;  1AZP A;  1STB A;  5C3X A;  5C4H A;  2WAQ E;  2A6H C;  2YU9 B;  3KF6 A;  2Q2H A;  2Z1C A;  2DN8 A;  4LUO A;  4RWS C;  3KBX A;  2UXB Q;  1X6O A;  4POG A;  2R7Z H;  4GN4 B;  1NMG A;  3AQQ A;  2K14 A;  1P16 A;  2BE5 C;  1F77 A;  2EY1 A;  2O4X A;  2YYZ A;  3NSW A;  3S1R H;  1SR3 A;  5JJI A;  4C3J B;  3CCE A;  2K5H A;  2PW7 A;  2F0H A;  3E9H A;  2PZW A;  2F4V Q;  2Q2I A;  4XIG S;  2F4I A;  1DYQ A;  4JC0 A;  2JP1 A;  1EU4 A;  3T1Y Q;  1PV4 A;  1Q7Y C;  1PMR A;  3FRP B;  2IW3 A;  2IT1 A;  1XNR Q;  1BUV T;  4YCW A;  3JAM c;  2F0M A;  4IQZ A;  1UNS A;  3CRK C;  4FXG C;  1I50 B;  4QY7 A;  4AYB E;  4CDD C;  3RN5 A;  1IBK Q;  3I3C A;  4AIM A;  2IPK D;  3D8G A;  1UE5 A;  4B3T Q;  3RNU A;  3RN2 A;  1O78 A;  4IAL A;  2R7Z G;  4FF3 A;  3CKI B;  1N8R C;  3GTO H;  5JEA J;  4BWG B;  1BBX C;  2I5M X;  1HA5 A;  2MP1 A;  5IT9 E;  1C9O A;  2V4D A;  1TS3 A;  2MJ8 A;  1ZEQ X;  2XVS A;  4HN7 A;  5BR8 L;  3PIP 3;  3Q23 A;  4DV4 L;  1KRT A;  1GUG A;  4X66 Q;  3AYH B;  3NE5 B;  2L5T A;  4FF1 A;  1RJT A;  2VB3 X;  3FEW X;  4JBJ A;  4A93 B;  1JOQ A;  1S72 A;  4UY8 C;  4H13 C;  4IFD H;  2HD3 A;  1A2T A;  2MUY A;  1IYJ B;  4IFD I;  1L1O C;  1TKW B;  2PI2 A;  1FNU A;  1TWC B;  1WTH A;  3L7Z C;  4RMF A;  2EZV A;  3GP7 A;  2L15 A;  1SE8 A;  4JW0 A;  4JI6 L;  1C4Q A;  3PIO A;  1XTC D;  2RDH A;  3S24 A;  1A3T A;  5EPK A;  2RSO A;  1IBM L;  3A7A B;  4JI2 L;  2OTJ A;  5J3B A;  5A35 A;  4R8N A;  4A3J H;  3HOY B;  3VDY A;  2K01 A;  4LWC A;  2UXD Q;  5LL6 X;  2X6G A;  2JA7 B;  2ZM6 L;  1HR0 Q;  1F9R A;  3S17 B;  1GUN A;  5LHY 1;  4JI8 Q;  2LMC B;  3FMC A;  3T1H L;  4KN7 C;  2B2W C;  4F8M A;  1F9P A;  1EY9 A;  4IFD G;  4DUY Q;  2AWO A;  3KYH C;  3HP3 A;  3K5M A;  4DNR B;  4P71 A;  1RCV D;  3ONA B;  5CGK A;  4DPG A;  4DUZ L;  4DK0 A;  1JIC A;  3K7A H;  4A3B H;  1B53 A;  4IFD J;  1C8C A;  2B2Y A;  5EKL A;  2KEN A;  4AYB B;  4IUP A;  3NBH A;  4C1N I;  4JI4 Q;  1GVP A;  4ODG A;  5C44 B;  4WJ4 A;  3VR6 A;  1XMO L;  3VYS A;  3SHL A;  4A3J G;  5JPN C;  2ES2 A;  2ENB A;  1R9T B;  2Q8R E;  2UXC Q;  5I2Y A;  2WII B;  1IKM A;  4OL7 A;  4IPD A;  1CKN B;  3PO3 B;  1S5D D;  3SK4 A;  5FO8 B;  1BNZ A;  5I6Y A;  1NR4 A;  3IL8 A;  5IOD A;  1PH4 A;  4B3S Q;  3S14 B;  1E22 A;  3I56 A;  1JC7 A;  3A8K E;  2RHS B;  2K6A A;  4Z9C B;  1WOC A;  1MD2 D;  4UP8 A;  2RA4 A;  5JJK A;  5D65 A;  4HTH A;  1I6V C;  1JMC A;  2EIF A;  1BO0 A;  1F2M A;  4HJ7 A;  1LAB A;  5M5X B;  4A3B G;  3TZU A;  5FLX c;  3OW2 A;  3TDQ A;  2RHQ B;  1RHP A;  3K5O A;  1ZYR D;  1WTQ A;  3TME A;  3S9W A;  2EY6 A;  2Z6K A;  2ZT9 C;  3J81 E;  3UI2 A;  1RTO A;  3RZD B;  3KDF B;  2EYO A;  4DV5 Q;  3I8Z A;  3ITP A;  1EWI A;  3AEV A;  1DD2 A;  5EBD A;  3H6M A;  1OXU A;  2AQ3 B;  4L6T B;  1TS2 A;  1BDO A;  3P7J A;  3HOV H;  2FJ2 A;  4GN3 B;  1VQ7 A;  1UE6 A;  2WIN B;  2BA1 A;  2Z4I A;  3DHQ A;  1SJE D;  1IL8 A;  4ME3 A;  5EQ0 A;  1L1O B;  1UE1 A;  4QCL A;  2F0G A;  1HH2 P;  3FKI B;  1KLG D;  5C3E B;  4YY3 L;  4OWX B;  1TWH B;  3URY A;  3H09 A;  1H9S B;  4LAA A;  4FDB A;  3K57 A;  2VW9 A;  3CC2 A;  2MGS A;  1E3P A;  5FLM H;  1AEX A;  3PIO 3;  2K5N A;  5IP9 H;  3WOF A;  1KDC A;  1Y14 B;  3LWU A;  1L0W A;  5DNF A;  3J81 j;  1YZ6 A;  1PRT C;  4ABN A;  3S2D H;  5EKK A;  3AMU A;  2PZU A;  1J5E L;  2A69 C;  2FHT A;  2UU9 Q;  2JA6 B;  2NZH A;  1TU2 B;  4JV5 L;  1ILQ A;  1ET6 A;  3BZD B;  3HOV G;  3OTO Q;  2RKS A;  4WRD A;  4LFA Q;  4F88 A;  5I6W A;  2F3V A;  1DON A;  2B3G A;  3MTS A;  3MXN A;  3S1Q B;  4DR5 Q;  1SEB D;  2K5V A;  1BQQ T;  3PUZ A;  1VQA A;  2DNC A;  2EYL A;  1AP0 A;  5E1F A;  2YTX A;  4A3M B;  4A3C H;  2F0E A;  4X62 L;  2K28 A;  3JAM E;  1I4G A;  1SFO B;  1FVI A;  4GKJ L;  2B2Y C;  1SJH D;  3S15 B;  5IP9 G;  3QOJ A;  2EYJ A;  4HSP A;  1AW7 A;  1E2Z A;  1HUN A;  4R4C A;  2A8V A;  3MAQ A;  2E8G A;  2E5L L;  1I5F A;  1SMX A;  3KFU A;  1SYB A; 
#chains in the Genus database with same CATH homology
 2NN6 I;  2RCN A;  4BY7 H;  2KHI A;  3AFQ A;  2ATW A;  1K8A C;  5M5Y H;  2D62 A;  5C0X G;  1S40 A;  5IP7 G;  1X54 A;  2BH8 A;  3RLN A;  4BXX H;  1WYD A;  1I94 L;  1M90 C;  4LF9 L;  4JI6 Q;  4P74 A;  4DR3 L;  1JB7 A;  1WCM G;  1CKM A;  4QGU A;  4A93 G;  3L2P A;  2NVX H;  3HKZ E;  5C4X H;  1JT8 A;  4QIW E;  4LF4 L;  2NVQ H;  3E0E A;  2HIX A;  3BZK A;  3PUV A;  4JI1 Q;  4GNX B;  1YHQ A;  1IBM Q;  4DK3 C;  1VQE A;  1FJG L;  1Q8K A;  3GD7 A;  1XPO A;  4X66 L;  4JI2 Q;  1VQG A;  4BBR H;  4A3K H;  1J5E Q;  2CFM A;  2YTY A;  3DM3 A;  2D0P A;  4NB3 A;  1J6Q A;  4NXM Q;  1B8A A;  2PMZ E;  2XTI A;  3GTK H;  5AJ3 L;  3GTQ H;  4A3C G;  1U5K A;  1YJW A;  4GOP B;  3I4M G;  1VQP A;  1EOV A;  5GQO A;  2YU9 H;  1VQB A;  2HQL A;  4O2D A;  3CPW A;  1N33 Q;  4LF5 L;  4NXN Q;  4YCV A;  3CD6 A;  3EBE A;  4OXP A;  1BBW A;  5E7N A;  2HIV A;  2K50 A;  3KF8 B;  3T1H Q;  1PH8 A;  2GN5 A;  2LSS A;  2NN6 G;  3GTJ H;  2A1A A;  3NEN A;  4P75 A;  1WI5 A;  1Z47 A;  1X55 A;  4JG2 A;  1Q46 A;  5C44 H;  3HKZ G;  4LFB L;  3UDX A;  4HJ5 A;  3WWV A;  1BVS A;  5IYC H;  1LM0 A;  4HIM A;  1CUK A;  3UE0 A;  4OON A;  4X62 Q;  1Q81 C;  1HNX L;  3JAM i;  1NE3 A;  4DUZ Q;  4BY7 G;  4A3D H;  3ULP A;  3NEM A;  1R9T H;  2JEB I;  1XMQ Q;  4BXX G;  3M4P A;  1TWF H;  1PVO A;  4DV7 L;  2JA5 H;  3M85 A;  1N36 Q;  4GS3 A;  2KBN A;  1EFW A;  2BA0 A;  4DV1 L;  1VQ6 A;  1D8L A;  2QEX A;  1D7Q A;  5C4X G;  1YHA A;  2IX0 A;  4GLX A;  2E5L Q;  1A8V A;  2DGY A;  4GNX A;  3S14 H;  2D0O A;  4K0K Q;  3RLF A;  2E2H H;  2K52 A;  3F2D A;  3HOX H;  3CMA A;  2CWA A;  1X9N A;  1IBL Q;  4JI0 L;  2MFI A;  3HOZ H;  4H02 A;  1XMO Q;  2UXD L;  4R1J A;  4BBR G;  2ASB A;  4A3K G;  4KLK A;  2N49 A;  1Q1E A;  5IWA Q;  1BKB A;  1HR0 L;  3TRZ A;  1MIU A;  3I2Z A;  4YWL A;  4JI8 L;  1YIT A;  2CWP A;  2ZJP A;  2Y0S E;  2I0Q A;  2GVA A;  4JBM A;  4GOP A;  3A0J A;  2N3S A;  5IYD G;  4YHH Q;  3CP0 A;  4DUY L;  1HZB A;  1U0L A;  3Q8D A;  4DV0 L;  2JEA I;  3TS2 A;  2H5X A;  1H95 A;  4IOA A;  1KIX A;  3U58 A;  5LMN L;  2PQA B;  2AHO B;  4JI3 Q;  4B3M Q;  5M3M H;  2HT1 A;  3W1B A;  1M1K C;  3I55 A;  4C2M H;  1EQR A;  5C44 G;  3STB D;  3PIP A;  3H15 A;  4JBK A;  2UUA Q;  1XPU A;  3S1N H;  2JK8 A;  2Z0S A;  4JI7 L;  5IYC G;  2ZTC A;  2UUB L;  3HOW H;  4BA2 I;  1VQC A;  4WJ3 M;  1HR0 W;  4A3D G;  2N8N A;  2PI2 E;  4UP7 A;  4JI4 L;  4JI5 L;  3KJO A;  3GTL H;  4A3I H;  1SRU A;  2Y0S G;  4R4T A;  1A62 A;  3KOJ A;  2UUC Q;  3GO5 A;  2OCE A;  2JA5 G;  4DR2 L;  1KQS A;  1XTD A;  4O0A A;  4DV2 Q;  1SRO A;  5LMN W;  4NPS A;  3G71 A;  3K81 C;  3KF6 B;  1L2F A;  3HOX G;  2VQF L;  3J81 c;  2UXC L;  3HOZ G;  2R7F A;  4DV3 Q;  1XNQ Q;  1W3S A;  1N34 Q;  3CCR A;  1K3R A;  1DGS A;  2EQS A;  2HHH Q;  2V1C C;  3PF4 A;  4DR4 L;  4LUZ A;  1VQL A;  2VQE L;  1IXR A;  4B3S L;  2VUM H;  3T1Y L;  4LFC Q;  1VCI A;  3SGI A;  2LXK A;  1UWV A;  5IY0 A;  3GTP H;  1MJC A;  2PQA A;  5FLM G;  4ALP A;  4BY1 H;  1TWA H;  3M4Q A;  4IPH A;  1BBU A;  1EYG A;  1Z9F A;  1SLJ A;  1WFQ A;  1WJJ A;  5M3M G;  3CXC A;  4A3L H;  4EQ5 A;  3F1Z A;  4YY3 Q;  2CQO A;  1X56 A;  3RLO A;  4J15 A;  1T9H A;  4YWM A;  4DR6 Q;  3PGZ A;  3PCO B;  3U4Z A;  2AMC B;  1PH3 A;  2JA6 H;  1GM5 A;  3HFZ B;  4LW1 A;  4P72 A;  3BU2 A;  3U50 C;  4OO1 I;  4UPA A;  3HOY H;  1YNX A;  4A3I G;  2VS1 A;  1V43 A;  4OX9 Q;  2JE6 I;  3D31 A;  2CCZ A;  3I7F A;  3GDE A;  3AFP A;  4DV5 L;  3LGJ A;  1UE7 A;  3BZC A;  3TRE A;  2RF4 A;  4PZ8 A;  1K73 C;  1NJI C;  4L5S A;  2JA7 H;  2IHE A;  3S17 H;  1JJC B;  4KHP Q;  2MQH A;  3UDG A;  2WAQ E;  1QUQ B;  4DV6 L;  1JJ2 A;  3KF6 A;  2Q2H A;  1VQN A;  3M4O H;  1E7Z A;  1TXY A;  1VQ5 A;  1K8G A;  4LUO A;  4TQU S;  2UXB Q;  1X6O A;  1PFS A;  4KHZ A;  1XJV A;  1K9M C;  4POG A;  4HIO A;  4GN4 B;  2R7Z H;  2B63 H;  3W1G A;  2DUD A;  4A3M H;  1N32 L;  1NMG A;  4JOI A;  4IO9 A;  5GAE C;  3AQQ A;  1B70 B;  1KD1 C;  2XGT A;  2K14 A;  1P16 A;  2YYZ A;  3RR5 A;  3TEH B;  3S1R H;  2VUM G;  4JV5 Q;  4X6A H;  1SR3 A;  1V1Q A;  1VQ9 A;  5JJI A;  1HNW L;  1HZC A;  3G6E A;  3S15 H;  4DR7 L;  2WP8 J;  5ELN A;  3CCE A;  2K5H A;  3K8A A;  4BY1 G;  3E9H A;  1IL2 A;  1EIY B;  2Q2I A;  1TWG H;  2Z6K C;  4XIG S;  2F4V Q;  4A3L G;  4OO1 G;  4GN5 A;  2WAQ G;  4JC0 A;  1HNZ Q;  1OTC A;  4HIK A;  3T1Y Q;  1Y1V H;  4IPG A;  1PV4 A;  1AH9 A;  1Q7Y C;  2JA6 G;  3CC7 A;  2IT1 A;  4GKJ Q;  3HOY G;  4B3R L;  1XNR Q;  2R93 H;  3J80 i;  4YCW A;  3JAM c;  4A4I A;  3GTG H;  1PYS B;  4QY7 A;  4AYB E;  5M3F H;  1IBK Q;  3RN5 A;  4LF6 Q;  2JA7 G;  5C4J H;  2R92 H;  3PO3 H;  4X65 Q;  4AIM A;  4JYA L;  5GRO A;  1QUQ A;  1UE5 A;  3CCU A;  1KHI A;  2UU9 L;  4B3T Q;  1X3E A;  3RNU A;  3RN2 A;  3CCS A;  5LMU Q;  5LMU L;  4AQY L;  1QVC A;  2F3I A;  1KAW A;  3OTO L;  1VQH A;  5EAY A;  3A5U A;  1GO3 E;  2AKW B;  4GOP C;  1MJE A;  2B63 G;  2R7Z G;  3CCM A;  4LFA L;  1VQI A;  1V9P A;  2ALY B;  2ZJR A;  1N8R C;  3GTO H;  5JEA J;  2E2I H;  1I94 Q;  2I5M X;  4GKK L;  4LF9 Q;  1HZA A;  2OQK A;  4YCU A;  2MNA A;  2B29 A;  4DR5 L;  1EUJ A;  1C9O A;  4DR3 Q;  3ULL A;  4LF8 L;  1YIJ A;  1NBW A;  2A19 A;  4X64 L;  5M5X H;  1LUZ A;  2KCM A;  1B7Y B;  4LF4 Q;  1QVG A;  1GD7 A;  4LNQ A;  2K4K A;  3STB C;  5BR8 L;  4AYB G;  4DV4 L;  3PSI A;  1KRT A;  1FJG Q;  2IY5 B;  4X66 Q;  1Q82 C;  2EXD A;  3AYH B;  5IYB H;  5GAD C;  1OXX K;  2WFW A;  3CCJ A;  4LF7 L;  1E24 A;  4A3E H;  1AE3 A;  3RZD H;  2VNU D;  3PO2 H;  2JQO A;  1X3G A;  1Q12 A;  4JBJ A;  4APV A;  5AJ3 Q;  1PH5 A;  2JA8 H;  1S72 A;  4DR1 L;  1VQM A;  1Y1V G;  1QZH A;  1VQ4 A;  4UY8 C;  2CKZ B;  4AH6 A;  1RL2 A;  1QZG A;  4LF5 Q;  4BBS H;  2R93 G;  2Q2U A;  1VQJ A;  1KC8 C;  1S3O A;  4BA1 I;  5M3F G;  1IYJ B;  4L5R C;  3PO3 G;  3ERS X;  4DNI A;  3W5O A;  2FXQ A;  4IFD I;  1L1O C;  3TS0 A;  1LTL A;  2PI2 A;  4LFB Q;  4A75 A;  3BJU A;  1VQD A;  4DKA C;  3L7Z C;  4RMF A;  3FKI H;  3D0F A;  1EIF A;  2L15 A;  2QA4 A;  1SE8 A;  5C3E H;  1I3Q H;  1HNX Q;  4JI6 L;  3I4O A;  1TWH H;  1X65 A;  3B6Y A;  3NBH B;  3ZJY C;  3PIO A;  3S24 A;  4JI1 L;  4QQB X;  1IBM L;  1SN8 A;  1JE5 A;  4DV7 Q;  4JI2 L;  4MZ9 A;  2OTJ A;  2PNH A;  4DV1 Q;  5J3B A;  1VQO A;  1QVF A;  4A3J H;  5IE8 A;  4NXM L;  3KLW A;  4OWT B;  2LXJ A;  4JI0 Q;  3VDY A;  3CC4 A;  1WCM H;  4LWC A;  2UXD Q;  3UDI A;  2ZM6 L;  1W2B A;  3PUX A;  1HR0 Q;  4NXN L;  4HJ8 A;  1N33 L;  3ICE A;  4A3E G;  3I4N H;  4JI8 Q;  3K80 C;  3PO2 G;  3T1H L;  2N78 A;  2JA8 G;  4QJF A;  4PZ7 A;  3KJP A;  4DAY B;  4IFD G;  4DUY Q;  1GKH A;  3HOW G;  5IT9 c;  1FGU A;  2AWO A;  4DV0 Q;  3KYH C;  4BBS G;  5LMN Q;  4GLA C;  1HZ9 A;  3A74 A;  4PZ6 A;  4P71 A;  3S16 H;  2F52 A;  3NEL A;  3JC6 6;  3HOU H;  4DPG A;  4DUZ L;  1G51 A;  2QGQ A;  4XTC S;  1XMQ L;  3K7A H;  3G4S A;  1PH1 A;  1PA6 A;  4JI7 Q;  3CCV A;  1ASY A;  4A3B H;  3S1Q H;  4IFD J;  2YTV A;  4HJ9 A;  3FKI G;  2UUB Q;  4JOI C;  3MEF A;  1N36 L;  1FL0 A;  1NY4 A;  2KEN A;  5C3E G;  2OQ0 A;  3M9B A;  3K7U C;  4JI4 Q;  4JI5 Q;  1GVP A;  4K0K L;  4WJ4 A;  2YV5 A;  4IJH A;  5M5W H;  1IBL L;  1XPR A;  1YHB A;  1XMO L;  4HJA A;  5ELO A;  1SFO H;  4DR2 Q;  4IJL A;  3UDF A;  3M7N A;  5GAH C;  5IWA L;  4A3J G;  4GLV B;  2R6G A;  2ES2 A;  4OWW B;  3A5Z B;  4C3H H;  2UXC Q;  2VQF Q;  3PUY A;  3PUW A;  2ID0 A;  4IPD A;  1CKN B;  4YHH L;  3CAM A;  1OXT A;  4R4Q A;  1VS0 A;  3UE1 A;  3H0G H;  4MTN A;  4R4O A;  1VQF A;  5HY6 A;  3U4V A;  3I4N G;  1YI2 A;  4DR4 Q;  4JI3 L;  1PH4 A;  1RIP A;  5C0X J;  2VQE Q;  4B3M L;  4B3S Q;  1E22 A;  3I56 A;  2RHS B;  2NZO A;  3OYY A;  1PYB A;  1WOC A;  2UUA L;  1OXS C;  1EQQ A;  2VZA A;  4UP8 A;  2I5H A;  5JJK A;  3ULJ A;  2IX1 A;  1KRS A;  4IPC A;  3J7A 5;  1JMC A;  2EIF A;  1Y1W H;  5IYD H;  3J80 c;  2ZM6 Q;  4HJ7 A;  3CF5 A;  3HOU G;  4GNX C;  3S1M H;  1JJG A;  4HID A;  3TQY A;  4PMW A;  4UP9 A;  5JEA G;  1NMF A;  2KHJ A;  3H3V H;  1A63 A;  3CCQ A;  4A3B G;  5FLX c;  3OW2 A;  2RHQ B;  3G48 A;  1AE2 A;  2UUC L;  4A3G H;  1I6H H;  1MKH A;  3HKS A;  4L5Q A;  4DV2 L;  4A3M G;  1PH7 A;  2Z6K A;  1X3F A;  1G6P A;  3H3V I;  1C0A A;  2ZTD A;  3KDF B;  5JJL A;  4C3J H;  4DV5 Q;  4DV3 L;  1XNQ L;  1N34 L;  1EWI A;  4DAM A;  2HHH L;  3AEV A;  4DV6 Q;  1C7Y A;  3RZO H;  1OXU A;  1OXV A;  3K0X A;  3FP9 A;  2I5L X;  1CKN A;  4LFC L;  3HOV H;  1VQ7 A;  4GN3 B;  1UE6 A;  2VY3 A;  2MO1 A;  3F2C A;  1N32 Q;  4YWK A;  2BA1 A;  1E1O A;  2JJQ A;  3H0G G;  3PV0 A;  4R4I A;  4POF A;  4JBW A;  4ME3 A;  3F8T A;  1L1O B;  4PG3 A;  4JCV E;  1UE1 A;  4P73 A;  4QL5 A;  4EX5 A;  3MXN B;  3EIV A;  1VQK A;  1HH2 P;  2BH2 A;  1YVC A;  1HNW Q;  4C3I H;  4YY3 L;  4OWX B;  4DR7 Q;  1I50 H;  3CCL A;  3L0O A;  4DR6 L;  2GVB A;  4FDB A;  4RG1 A;  5FJ8 H;  2VW9 A;  3CME A;  1Y1W G;  1PH2 A;  3S2H H;  3IRB A;  2R92 G;  3E9I A;  3CC2 A;  1E3P A;  1G29 1;  4OX9 L;  1UEB A;  5FLM H;  2K5N A;  2VL6 A;  5IP9 H;  1Y14 B;  3PF5 A;  1K0R A;  1L0W A;  4A3F H;  4KHP L;  4A3G G;  1YEZ A;  5HGQ A;  4B3R Q;  3J81 j;  1YJ9 A;  4MNO A;  1ASZ A;  1CSQ A;  1YZ6 A;  3KDF A;  4IOC A;  3S2D H;  2WB1 E;  2UXB L;  1N9W A;  4JYA Q;  1CKO A;  3CPF A;  1P8L A;  1Q1B A;  2C35 B;  4L5T A;  3DLL A;  4TVA B;  1J5E L;  4A76 A;  1VQ8 A;  2UU9 Q;  3M3Y H;  1E1T A;  5H1S E;  5IP7 H;  1HJP A;  2NZH A;  4DK6 C;  2ZJQ A;  4JV5 L;  5GAG C;  4AQY Q;  3HOV G;  4Y7N H;  1Q86 C;  3OTO Q;  2NVT H;  5IYB G;  1LYL A;  4A93 H;  4LFA Q;  3J81 i;  3J7Z C;  2R7D A;  5C0X I;  5K36 G;  1L1O A;  1A0I A;  1NTG A;  1YJN A;  2B3G A;  1PH6 A;  4GKK Q;  4Y52 H;  4DR5 Q;  2F4V L;  2K5V A;  4LF8 Q;  3PUZ A;  1VQA A;  2MO0 A;  4KI0 A;  1K83 H;  4X64 Q;  1HNZ L;  2YTX A;  3F2B A;  2OTL A;  4A3C H;  5BR8 Q;  4DV4 Q;  3CQZ H;  2WB1 G;  5FJ8 G;  3I4M H;  1KXL A;  1IZ6 A;  1TWC H;  1KL9 A;  2IHF A;  4X62 L;  2E2J H;  2NVY H;  4LF7 Q;  1YBY A;  1PH9 A;  1FVI A;  4LUV A;  4GKJ L;  3FHW A;  1XNR L;  2JA9 A;  1PHJ A;  2AWN A;  5IP9 G;  4DR1 Q;  4LF6 L;  1IBK L;  3GTM H;  4A3F G;  2Q2T A;  1O7I A;  4X65 L;  1CSP A;  2K75 A;  4R4C A;  3CW2 C;  4B3T L;  2A8V A;  3EN2 A;  3ER0 A;  2E8G A;  5DLQ E;  2OWO A;  2E5L L;  1I5F A;  1SMX A;  2KCT A;  3KFU A;  2ZTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...