2F52A

Solution structure of cold shock protein cspb from bacillus subtilis in complex with heptathymidine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein cspB
publication title Recognition of T-rich single-stranded DNA by the cold shock protein Bs-CspB in solution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein/transcription
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f52A00
1EQRA 3L2PA 4HJ9A 4LF9Q 1EUJA 4LW1A 2MQHA 3G4SA 3J81c 3BJUA 4UP9A 1EWIA 1S3OA 4BBSH 5IYCH 4A3CG 2PI2E 4ALPA 4IJLA 5ELOA 2K14A 2WFWA 1HR0L 1IBLQ 2I0QA 3A5ZB 2KENA 4DR3L 1K3RA 1B70B 3GTQH 5IYBH 3JAMc 4A3BH 4HIMA 3Q8DA 1LYLA 3PO2H 2ALYB 2YTVA 2DUDA 5JEAJ 3OTOL 4LFCQ 4HJ5A 1YZ6A 4UY8C 1X65A 4JG2A 3M4PA 4O2DA 4A93G 1IYJB 1KQSA 1GD7A 2DGYA 3J80c 4DAYB 3L0OA 1PHJA 2ES2A 4A3GG 1V1QA 1NMGA 1Y14B 4DUZL 4O0AA 4DV6Q 4UP7A 2R92H 4J15A 2R6GA 1XMOL 4JOIC 3KF6B 1GM5A 4XIGS 3L7ZC 5FJ8G 1IL2A 3I55A 2HHHL 1E3PA 2JA5G 1C9OA 4L5QA 3I7FA 1YVCA 2HIXA 4JI4Q 4DV0L 1OXVA 3M4OH 3GTLH 3T1YL 3ER0A 4KHPL 1V43A 1VQNA 1NY4A 2CWPA 2JQOA 4LUVA 4OXPA 1CSQA 3UDGA 4DV3L 1QVGA 1HR0Q 4B3TL 4JBMA 4JBWA 3F2DA 4C3HH 2B63G 3K81C 5IP9G 3S16H 1WCMH 3EN2A 3MEFA 1FVIA 1EIYB 1N36Q 4X65L 4YCWA 3NELA 4RMFA 2NVXH 4APVA 1YBYA 2A1AA 3UDIA 2VQFL 3IRBA 1EFWA 4IPCA 2UUCQ 1CSPA 2KHIA 2F4VL 4DUZQ 3PO3G 3H3VH 4JYAQ 1A62A 1AE2A 1GO3E 1K8AC 2KCMA 1SLJA 4JI6Q 1VQ6A 2IY5B 1AH9A 4YHHQ 3AFPA 3RZOH 3S15H 1U0LA 1HNZQ 4YWKA 4A3MG 2E8GA 4BY1G 1PH5A 1PH7A 1U5KA 2FXQA 1QUQB 3HKSA 4DV0Q 1XPOA 3W5OA 1HNWL 4IOCA 3H0GH 1VQCA 2K5HA 5GAGC 1IZ6A 4KHPQ 3HOXH 2YTYA 3AYHB 1XPRA 2ZJQA 1QZGA 3HOUH 2GVBA 4X6AH 4B3TQ 4JI1L 2QEXA 1VQPA 4DK6C 3UDFA 3EIVA 2H5XA 2ASBA 2QA4A 4IPHA 1D7QA 1PYBA 1OTCA 1AE3A 4LUOA 4MNOA 1L2FA 5IT9c 1L1OA 1OXSC 5JEAG 1Q7YC 3CPFA 1CKMA 3RLOA 5C44G 2YTXA 4A3LH 3FP9A 3AQQA 4YWLA 3STBC 4IO9A 2R93G 5HGQA 1VQOA 1Q1BA 3ICEA 4GNXB 2F4VQ 2VQEL 4DV1L 4R4CA 3FHWA 1QVFA 3STBD 4Y7NH 1KC8C 2CCZA 4JI7L 2JA6H 2ZM6L 5IYDH 4GOPB 3KJPA 1X56A 1PH3A 5JJIA 3TREA 4DV2L 4GLXA 4P73A 4YY3Q 4R4QA 3AEVA 1VCIA 3GO5A 1PH4A 2JEAI 4JI0L 2E5LL 1XNRL 1PFSA 3FKIH 3NBHB 4DR5Q 3CD6A 2VZAA 3K7AH 5FLMG 2ZJPA 2D62A 5IP7G 4HJ7A 1XJVA 4PZ6A 3CP0A 3BZKA 3F2CA 4LFBL 2JE6I 1LM0A 4BXXH 1EOVA 4X62Q 4DR6L 1JMCA 4JI3L 5LMNL 1QVCA 2UXBQ 4JOIA 1NTGA 4NXNL 4OWTB 2ZJRA 4DR2L 4DV1Q 1YITA 1MJEA 4B3RQ 3KLWA 2VNUD 3CMAA 4LF4L 5BR8Q 2LSSA 4JBJA 3RZDH 3J81j 2Q2IA 3H15A 4WJ4A 2KCTA 1S40A 2WAQG 4DKAC 5HY6A 2F3IA 4JI0Q 2A19A 2E5LQ 1VQDA 4DUYL 2CWAA 2R7DA 1XNRQ 2NVQH 3HOYH 3D31A 3UDXA 3B6YA 4IPGA 2R7ZG 1N34L 1BBUA 3PUVA 2R7ZH 4BY7H 4IFDG 2E2HH 2JA8H 1LTLA 2WAQE 2ZTCA 4LFBQ 1KAWA 2UXDL 2YV5A 1Z9FA 4A3EG 3I2ZA 5GROA 3ULPA 1UE1A 2IX0A 1Q81C 2UU9L 5GADC 1N33Q 3W1GA 2PQAA 2QGQA 3M4QA 4A4IA 4JI8Q 4C2MH 3ERSX 4AQYL 1Q12A 1VQGA 4LF6Q 4OX9L 4HIDA 4DR2Q 4FDBA 4JI5Q 4NXNQ 1XNQQ 2NZOA 4X64L 3CC7A 2AWOA 2XTIA 4LF8L 2CKZB 5C0XG 4A3CH 2CFMA 1EIFA 3VDYA 3RNUA 2K50A 1YJ9A 4LF5L 3NENA 2JK8A 1I3QH 3CF5A 4DUYQ 3F1ZA 1O7IA 2UUAL 2K75A 3TRZA 1JJCB 4OONA 4BA2I 1KRSA 1YNXA 1N34Q 1JT8A 4A3KG 4GKKL 3TEHB 3J81i 1J5EL 1Q46A 3KDFA 1X6OA 2BA1A 2JA7G 4A3GH 2UXDQ 2AHOB 4DR3Q 2MO1A 1VQ8A 1SR3A 1N32L 3T1HL 2YU9H 2ID0A 1FJGL 3WWVA 4P71A 4BA1I 4X66L 3JAMi 1Q86C 3CCUA 3S2HH 4YCUA 3OTOQ 4POFA 4AQYQ 1WOCA 3I4OA 5FJ8H 4DV5L 1XMQL 1UE5A 4OX9Q 2JA5H 3CCJA 5M3FG 2NN6I 3PUWA 3S1MH 3S1NH 1SN8A 4A3IG 3J80i 4A3DG 1KIXA 4QQBX 1EQQA 4GOPC 4LF8Q 1NBWA 2BA0A 3HOZG 1D8LA 3E9IA 4P72A 1SROA 3HOVG 3PF4A 1XMOQ 4LUZA 1K0RA 1BKBA 5EAYA 4OWXB 4DPGA 3J7ZC 2VL6A 3CMEA 2OWOA 2B63H 3KFUA 4TVAB 2HHHQ 5C4XG 5IP9H 3CCMA 1Z47A 3OW2A 1VQ4A 2IHEA 5C3EG 3I4MG 4R4IA 1CKOA 1CKNB 2N8NA 2A8VA 1VQFA 3T1YQ 3E9HA 1VQEA 5AJ3L 3CCQA 1RL2A 3PF5A 1JB7A 4R1JA 2E2IH 3M85A 1X9NA 4DV3Q 3DLLA 4B3ML 3PO3H 2MNAA 1VQAA 2MFIA 1MIUA 3RR5A 2HIVA 2LXKA 3T1HQ 2OTLA 3M9BA 2Q2TA 3GTMH 3A74A 5GAHC 4X66Q 1PH1A 4IJHA 4LFAL 2VUMG 2B3GA 3KF6A 3U50C 4A3MH 1WI5A 1X3GA 4X65Q 4BY1H 3G48A 1H95A 2VQFQ 2OQKA 1JJ2A 1G291 4AYBG 1K9MC 1K73C 2R7FA 3HOWG 3I4NG 4DV4L 1FGUA 4JV5L 5IE8A 4DK3C 3KF8B 5C4JH 5LMUL 1WYDA 1OXXK 1Y1WG 3K0XA 4C3JH 4OWWB 4GKJL 3BU2A 4AYBE 1NE3A 1HNWQ 4LWCA 2NN6G 1NMFA 4MZ9A 4OO1I 4A3FG 5C44H 1HZAA 5ELNA 4NXML 3GD7A 1R9TH 1YHBA 4BBRG 2R93H 1VQBA 5IWAL 2D0PA 4JI1Q 4B3MQ 2I5HA 2RCNA 2K5VA 4KLKA 2C35B 4LF7L 1W3SA 3TS0A 2ZTDA 4UPAA 2VY3A 5M3MG 1RIPA 2IHFA 3CW2C 3RN2A 4POGA 3S1QH 1HJPA 1X54A 3U4ZA 1S72A 4C3IH 1HNXL 3M7NA 2NVYH 2YYZA 3CPWA 4QIWE 2EQSA 1QUQA 1I94L 4JI8L 2VQEQ 5FLMH 4DV4Q 1SFOH 1YEZA 5IP7H 1HR0W 4JI7Q 1MKHA 2ZM6Q 4EQ5A 3MXNB 2EIFA 1VQIA 4GKJQ 4DV2Q 1V9PA 3NEMA 3RN5A 4A3JG 1Y1VG 3U58A 3G6EA 3CCRA 4A76A 5E7NA 2E2JH 3S24A 1I5FA 1GVPA 1YJWA 1IBLL 2Q2UA 2IX1A 3CC2A 1PV4A 1SMXA 3OYYA 4DV7L 3HOYG 4NXMQ 3M3YH 2VS1A 2KHJA 1TWHH 1I6HH 4K0KL 1X55A 2I5LX 5IWAQ 1TXYA 3S17H 4LFCL 1E1TA 5M5XH 5JJKA 3F2BA 4GNXA 5IYCG 4BBSG 1GKHA 1TWCH 2IT1A 2EXDA 4KHZA 3H3VI 4L5TA 4YWMA 4JI3Q 4GLAC 4GOPA 1X3EA 4AH6A 5IYBG 5LMNQ 2BH2A 1N8RC 4A3BG 4QL5A 1HNXQ 3K8AA 1OXUA 4QJFA 4PZ7A 4XTCS 3UE0A 2I5MX 3K80C 3RLFA 3PO2G 4OO1G 1P16A 1Q82C 2WB1E 4GLVB 4ME3A 5M5YH 2B29A 4UP8A 1G51A 4HJAA 2JEBI 3AFQA 4JI4L 4LF4Q 1UE7A 3GTPH 2GN5A 2Y0SG 4JC0A 1KHIA 5GQOA 1IBML 3PCOB 1VQ7A 2R92G 2PNHA 3PV0A 1CUKA 4A3EH 1PH9A 4YCVA 1VS0A 1UE6A 3A0JA 3RLNA 3I56A 2JJQA 4DV7Q 4A75A 5FLXc 1YJNA 1WFQA 1JJGA 1E22A 1P8LA 2Y0SE 3PIPA 1VQ9A 4A93H 4K0KQ 1SE8A 1C0AA 3S14H 4NB3A 5GAEC 3GTJH 1KRTA 1VQJA 2N3SA 3PUYA 1N36L 3S2DH 1A63A 2UU9Q 4DR4L 2UUCL 3GTGH 1E7ZA 3PUZA 3KJOA 1QZHA 4P75A 4R4OA 3CXCA 3ULJA 3GDEA 4JYAL 2Q2HA 4JI6L 4EX5A 1WCMG 4GNXC 2MO0A 1XPUA 4YHHL 3S1RH 1L1OB 1X3FA 4PG3A 2VW9A 1A0IA 1HNZL 3PSIA 4QY7A 4X64Q 1PA6A 1KD1C 1N9WA 3CCEA 4A3KH 2UUBL 1IXRA 3CCSA 3TQYA 4DR1L 1PYSB 2Z0SA 4B3SL 2UXCL 4PZ8A 1IBMQ 2JA7H 1A8VA 4LF5Q 2CQOA 1YHAA 1JE5A 4L5SA 1B7YB 3GTKH 2K4KA 1KXLA 3SGIA 1BVSA 2UUAQ 5J3BA 3CC4A 1K83H 2RF4A 4GKKQ 4DAMA 4DR6Q 4HIOA 1J5EQ 5M3FH 3H0GG 1T9HA 1TWAH 4A3IH 2AMCB 3HOXG 1VQ5A 4KI0A 2AKWB 2K52A 4HJ8A 1YHQA 4A3DH 4LNQA 3HOZH 1N32Q 3HOUG 1UEBA 1C7YA 3D0FA 1YI2A 3CCLA 3HOVH 4DR4Q 1FJGQ 1TWGH 2AWNA 3J7A5 1XMQQ 2WP8J 1TWFH 4DV5Q 1W2BA 2XGTA 5C4XH 2L15A 4JCVE 2HT1A 4AIMA 1L0WA 5H1SE 4GN3B 5M5WH 5C3EH 4YY3L 2UUBQ 3I4MH 3K7UC 4A3LG 4DR1Q 1M1KC 4B3SQ 2BH8A 4GN4B 3DM3A 4RG1A 3U4VA 4JI2L 1UWVA 2UXCQ 4DR5L 4QGUA 1EYGA 1WJJA 3CAMA 2V1CC 4IFDJ 4IPDA 2JA6G 5IYDG 3HKZG 4TQUS 5LMNW 1PH6A 3PUXA 1VQKA 2NVTH 2VUMH 3W1BA 2D0OA 3TS2A 1E1OA 4HIKA 5AJ3Q 3PGZA 4X62L 3GTOH 1OXTA 1NJIC 5K36G 3FKIG 2LXJA 2KBNA 2Z6KA 2K5NA 3ULLA 3HOWH 3HKZE 3I4NH 2UXBL 1Q8KA 1B8AA 3ZJYC 5DLQE 1E24A 2RHSB 2GVAA 1PH2A 4IFDI 4B3RL 3KYHC 1I50H 4LFAQ 5C0XJ 4DR7L 4Y52H 4GN5A 1SRUA 3UE1A 1KL9A 1YIJA 1VQHA 1Y1WH 4BXXG 5BR8L 4WJ3M 2PQAB 1VQMA 1ASYA 4NPSA 3BZCA 2PMZE 1HZ9A 1IBKL 1CKNA 5IY0A 3LGJA 4JI2Q 4A3FH 4JBKA 2NZHA 4LF9L 4JV5Q 1G6PA 4BBRH 1DGSA 3CQZH 5JJLA 2OQ0A 3G71A 5LMUQ 1PVOA 2ATWA 2OTJA 5C0XI 2F52A 2RHQB 3A5UA 4P74A 1PH8A 4DNIA 3JC66 5M3MH 1HZBA 1HZCA 3PIOA 1N33L 1XTDA 2OCEA 1J6QA 1HH2P 2ZTEA 4H02A 4PMWA 4GS3A 4L5RC 3E0EA 2N49A 1FL0A 3HFZB 1LUZA 2HQLA 4LF6L 4BY7G 4LF7Q 3KDFB 1K8GA 2JA8G 2WB1G 4JI5L 2PI2A 1XNQL 4DR7Q 3F8TA 1L1OC 1ASZA 2Z6KC 4MTNA 4A3JH 1Q1EA 1Y1VH 3EBEA 3KOJA 4DV6L 1VQLA 2JA9A 3CCVA 1MJCA 2N78A 1M90C 1IBKQ 4IOAA 1I94Q 1BBWA 4R4TA
chains in the Genus database with same CATH superfamily
2PW7A 5K5PA 2MQHA 1QNKA 1PFBA 1KDAA 1SXTA 3K5NA 3A54A 1HR0L 1IBLQ 3K0YA 3JAMc 3A55A 1MSGA 2IWHA 2JXMB 4KJOA 4U68A 2DUDA 5JEAJ 3OTOL 1WD0A 3M4PA 4DNTB 1KQSA 5EBDA 1BCPB 1CHPD 4DAYB 1NMGA 3N52A 3X3NA 3NTHA 4O0AA 4DV6Q 4UP7A 1XMOL 4JOIC 5G3LD 3L7ZC 5FJ8G 5KNDA 3BDLA 1IL2A 3FEWX 2HHHL 3KLSA 4DV0L 1L0YB 3M4OH 3GTLH 3T1YL 5FO9B 1JC7A 1CA5A 1VQNA 2CWPA 1SDFA 1O7LA 2EYLA 1H9SA 1KTKA 4C3HH 2E2DC 5IP9G 3S16H 2CHBD 1PFNA 1WCMH 1ICFB 4QIWB 1IW7D 3VYRA 4X65L 5M3MB 1K3BC 2A1AA 3BYYB 1CSPA 2XVSA 4DFAA 1VQ6A 5C6AA 1HNZQ 1PH5A 1SEBD 3M7GA 1DM0B 3I70A 4IOCA 1SYFA 1Y1VB 5ISRA 4R8IA 5F2DA 3HOXH 3HOUH 4X6AH 2NB0A 3HP3A 3HOYB 2H5XA 3MFYA 3S9WA 2QA4A 1B53A 1PYBA 1PMRA 4MNOA 1L2FA 2A6HD 1AP0A 1DOMA 3RLOA 5C44G 1PTOF 2AQ2B 1CQVA 4IO9A 2JP1A 4DV1L 4FF3A 3STBD 2DJGC 3K5MA 4JI7L 4HN7A 1X56A 1LABA 3KJPA 1EZ6A 3UI2A 2D5DA 4YY3Q 2EJGC 1Y8PB 1PH4A 1SBBB 3NBHB 1ILQA 3TP5A 3I90A 3K7AH 1VF5C 2D62A 5IP7G 1GXDC 1BF4A 3CP0A 1QE6A 4CBVA 1A2UA 4BXXH 1EOVA 4GZYC 4DR6L 1SMYD 4JI3L 2QILA 1CQFA 1NTGA 2ZJRA 1EY4A 3KLWA 4RKBA 3CMAA 1XYIA 4EVOA 2NVXB 3H15A 2KCTA 1I4QA 5HY6A 1CM9A 3CKIB 4DUYL 1XNRQ 4KMUC 2NVQH 3J7AV 1TS3A 3NSWA 3UDXA 2R7ZG 1B3QA 4IFDG 1LTLA 4IURA 1D1IA 1IKLA 2WAQE 1WVLA 2M9VA 1PRTB 5GROA 3ULPA 1UE1A 2CW0C 2UU9L 4C2MH 1J8IA 4OX9L 1AEXA 2ZXPA 4FDBA 4CKCA 3W3AA 3VYUA 4H0LC 1EIFA 2F1MA 1YJ9A 2FMCA 3DWAA 5EPLA 2UUAL 1O7IA 3TRZA 4EGVA 3V05A 4Y7NB 2JA6B 1N34Q 4GKKL 3VR3A 4DK1A 2UXDQ 5I6WA 1VQ8A 3VA5A 1MHWC 3T1HL 2YU9H 4OELB 3JAMi 1E2WA 4POFA 5JOBA 1WOCA 5FJ8H 4DV5L 1TVXA 2NN6I 5M3FG 3FPUB 3PUWA 2CVRA 1KIXA 4FF4A 1EQQA 1XX8A 2BA0A 4NDXA 2JYOA 4P72A 5J39A 3CRLC 1BKBA 1ZYRD 4OWXB 3CMEA 3KFUA 1UAPA 3RUZA 4TVAB 4RCOA 5IP9H 5IGFA 1D6EC 1Z47A 1VQ4A 1SE3A 1G91A 1CKOA 2N8NA 5IT9L 1VQEA 4MIUA 4R1JA 1TS2A 2HCIA 2K04A 4DV3Q 5IGGA 1QB5D 2MFIA 1MIUA 2Q2TA 5G3LF 5COYA 2Z1CA 4ZCKA 4F87A 4RA8A 1QJOA 1PH1A 1BQQT 4BY7B 2B3GA 2E2HB 2J7ZA 5J22A 3SK4A 3CU7A 1EY8A 1EOTA 5IE8A 1PTOB 4DK3C 2F0VA 5LMUL 1WYDA 4ULLA 1X3QA 2CH4W 4OWWB 4CJ1B 4AYBE 4KTAA 2NN6G 4OO1I 5C44H 4NXML 4X3TA 1YHBA 4G57A 5IWAL 2D0PA 4B3MQ 1JOOA 4IUQA 1B2TA 3C46A 4A93B 3SK8A 2VY3A 4PMCA 5ELDA 5M3MG 1F77A 2A68D 2IHFA 2F0GA 3S1QH 1X54A 1S72A 4A3GB 1HFGA 2RKSA 1D1KA 2NVYH 2YYZA 3CPWA 1AN8A 5ELCA 4JI8L 2VQEQ 2EJFC 4NKLA 5IP7H 1HR0W 4TKOB 1MKHA 1BUVT 4EQ5A 2JA5B 1YNNC 4GKJQ 4G4KA 2IX3A 1A2TA 1Y1VG 1WTVA 4A76A 3Q22A 2E2JH 1IBLL 1JB3A 1EIGA 3NTIA 3CC2A 4DV7L 1FGBD 3HOYG 3M3YH 2KHJA 1I6HH 4K0KL 2EE1A 2KEDA 1E1TA 5JJKA 2CH4A 1LTGD 3KLRA 1GKHA 3H3VI 3OMGA 1TY2A 3BS1A 2BH2A 4K2KA 1X3EA 5IYBG 2L11A 4ZUJA 4XTCS 1HPCA 1CK1A 2I5MX 3K80C 4OO1G 2TSSA 2R7ZH 2LKVA 3AFQA 1HA6A 4IFDH 3TZDA 5GQOA 3PCOB 1GHJA 4YCVA 1VS0A 2MP1A 3A0JA 3RLNA 1Q90A 3I8ZA 1JJGA 5FLXc 2HDMA 3TMEA 2NTSA 2ZXRA 1P8LA 5C4JB 4WJWA 3S14H 5C4ZA 5GAEC 3DMUA 1VMPA 2N3SA 3PUYA 1KRTA 5DAUA 5IODA 3JAME 1E7ZA 1EQVA 3KJOA 2F0WA 2L1BA 2Z8LA 4F88A 5I9OA 4Q5VA 3ULJA 2Q2HA 3EQLC 2MO0A 1XPUA 3S1RH 1L1OB 3G7LA 1NR2A 2A74C 4PG3A 1HNZL 1A0IA 1PA6A 1N9WA 3CCEA 4DR1L 4B3SL 1PYSB 1VF7A 3FPPA 3K5OA 2MUYA 4PZ8A 1U9RA 2HCCA 1SNQA 3PIP3 1A8VA 4L5SA 1JE5A 4ZQ3A 1BVSA 5J3BA 1S5BD 3CC4A 2HDLA 3T51B 3LWEA 4O42A 1J5EQ 5M3FH 4XYQA 2BOSA 1T9HA 2AKWB 2KHSA 1YHQA 1B9NA 1N32Q 4DR4Q 3Q6SA 2AWNA 1UEAB 3S17B 3I72A 2WP8J 3GQBA 2WIIB 3E6ZX 1RJTA 5EBCA 2L15A 2DJFC 5EJWA 4V190 1L0WA 1TWCB 3MAQA 4K5VA 4YY3L 2UUBQ 4A3LG 1GUGA 1M1KC 4GN4B 3U4VA 1IHZA 2QKIC 2EY1A 1EYGA 4XXEA 2B2UC 2AUKA 1DOLA 3DWQA 4IPDA 4HMJA 2JA6G 1HTPA 5M5YB 3GTPB 2V4DA 1O7ZA 3HGBA 5AJ3Q 3PGZA 3MVVA 5HURA 3QOLA 3VYTA 2Z6KA 4C56C 4CKEA 4HR7B 1B8AA 5CBAE 2RHSB 5C0XJ 2F3VA 1YIJA 1VQHA 3MHBA 3ONAB 1ASYA 4RAUC 3S2DB 2HD3A 3BZCA 4ILWA 1IBKL 2NN6H 1HFNA 4JI2Q 1QNUA 3G71A 5LHY1 4A3KB 5M3MH 5I2XA 1HZBA 1HZCA 2PCFB 4H02A 2A6EC 2B2TA 3GTKB 1U4RA 3E0EA 2XIWA 2N49A 2RDHA 3NE5B 1TT2A 1EL0A 4BY7G 2A73B 2ZXOA 2DNEA 2Z6KC 3MA2B 2IJ0A 1TWAB 1Y1VH 4PQXA 3KUPA 4A3DB 3IFDA 3U9OA 3NQTA 2RA4A 1BBWA 3JAML 1EQRA 1TWGB 3G6JB 3L2PA 4HJ9A 4LF9Q 3G4SA 1SJED 1TWFB 2SOBA 2E74C 5IGDA 2F0LA 3C2PA 4UP9A 5C4XB 5FK9C 3I4MB 5C3EB 2RVLA 2K14A 1PZKD 1D5XC 2EY2A 1C8CA 3A5ZB 2KENA 2I0QA 4FVMA 1K3RA 4KKUA 5IYBH 1LT5D 1LYLA 2YTVA 4OO1H 4BS9A 4HJ5A 4UY8C 4A93G 4EQOA 2PPBC 1GD7A 3J80c 1D2BA 3L0OA 2ES2A 4A3GG 3O13A 1EU4A 2RDFA 4QB4A 4DUZL 3KF6B 1EWHA 1R4QB 2N55A 4OGQC 2JA5G 4I65A 1C9OA 4L5QA 1YVCA 2HIXA 2F0EA 2BDOA 1TKWB 4OEMB 1Y1WB 4KHPL 1V43A 3H91A 2JQOA 4LUVA 1CSQA 4DV3L 4B3TL 4JBMA 3F2DA 1A3VA 2G9DA 3K81C 2G5DA 1EYCA 2NTTA 2VXWA 4K6LA 1FVIA 4HEDA 3Q23A 2NVXH 3TDQA 5J1ZA 3UDIA 2EDGA 3IRBA 4IPCA 2EZVA 3FMCA 3NUCA 5CGKA 3H3VH 2A69C 1K8AC 2F0HA 1SLJA 2IY5B 1ESRA 3ND9A 5BN3A 2R3ZA 1NSNS 1F9RA 1QUQB 3HKSA 1XPOA 4CJ0B 4G7HC 1VQCA 2K5HA 1MGSA 1IZ6A 3AYHB 2ENBA 2GVBA 2PQEA 3HG9A 2RSOA 2ASBA 4IPHA 1CZGA 1W6KA 1OXSC 3CPFA 4A3LH 3LNNA 3FP9A 5HGQA 1Q1BA 4GNXB 1PXUA 2F4VQ 1CHQD 2VQEL 1U4LA 3H6MA 4R4CA 2AQ3B 1QVFA 4Y7NH 2JA6H 4GOPB 1FR3A 1PH3A 2NWGA 4GLXA 1SE2A 1VCIA 1M8AA 2Y0SB 2JEAI 5IGEA 1PFSA 3CD6A 1E2VA 4HJ7A 1O7YA 4PZ6A 1SNDA 4HSVA 1GUTA 1QVCA 1S5CD 1CT1D 3FVQA 4JOIA 4DN4M 4NXNL 4OWTB 1ET9A 5BR8Q 2LSSA 2Q8RE 3D3RA 3MC0B 4LJZC 4DU9A 3SHLA 3PMFA 4DKAC 2F3IA 4JI0Q 1YNND 1BXTA 2E5LQ 2B8FA 3B6YA 1HRJA 3RZOB 4I7ZC 2XRSD 4BY7H 4J1MA 2E2HH 2ZTCA 4LFBQ 1KAWA 4NW2A 3H0GB 3I2ZA 1Q81C 4CGYB 1MBYA 3W1GA 5LL6X 2PQAA 5GADC 2QGQA 2Q8IB 4AQYL 1DJRD 1PTOH 2DN8A 1VQGA 1DCZA 3TP6A 5CV4A 4DR2Q 1XNQQ 1NNXA 5C0XG 4RFBA 1MD2D 2J4XA 3IKJA 2K50A 3NENA 2JK8A 4RGNA 4OONA 1STAA 4A3KG 2FINB 1J5EL 3RD4A 3F2UA 1MI2A 2BA1A 3KDFA 3QO2A 4A3GH 1PFMA 2MO1A 2RCFA 2XNAC 1N32L 1S4ZA 2PW5A 3ERQA 5FLXE 2ID0A 2TMPA 3WWVA 4XT3B 4KN7C 2I07B 5ELEA 2JA5H 3DUZA 3J80i 4A3DG 3X3MA 4LF8Q 1IL8A 1NBWA 3E9IA 1SROA 3SE0A 3SK5A 1PZJD 4JK1C 5NUCA 5C4XG 3CCMA 2IHEA 5C3EG 3I4MG 2M00A 1CKNB 1WTQA 3RZDB 4RCNA 5AJ3L 5EKLA 2BCOA 3D4WA 3DLLA 1PZID 2MNAA 1VQAA 3QJYA 2LXKA 5GAHC 4X66Q 3SDZA 5FO7B 1Y69U 2JA8B 2WB1B 1X3GA 2Z6BA 3G48A 2QEJC 2VQFQ 2OQKA 4FF2A 1G291 2R7FA 2K05A 1I4RA 2KEEA 4M1UB 2MHVA 5C4JH 3KF8B 1OXXK 1Y1WG 3BU2A 1NMFA 1QG7A 1PDQA 1ICWA 1PRTC 1I3QB 1VQBA 5CV7A 1ONLA 4UDUC 4KLKA 1Y8NB 2EYJA 3RMHA 1RIPA 4POGA 1SNMA 1STNA 1HJPA 1HNXL 4QIWE 2EQSA 2F0DA 1FNVA 4DV4Q 4OHJA 3PQIA 1VQIA 4DV2Q 3S1MB 4FYDA 3E3XA 3D4RA 5E7NA 1I5FA 1YJWA 5CV9A 2F03A 1PV4A 3OYYA 2RDGA 1FD7D 1DONA 2VS1A 1U4MA 2X69A 3S17H 2BE5C 1A15A 2AUJD 3F2BA 5IYCG 1TWCH 2A6ED 1DOKA 1EEFD 4KHZA 1H9SB 4YWMA 2XN9C 4AH6A 3K8AA 3PO3B 1I6VC 2HQEA 5JJZA 1JWSD 5FLXL 2WB1E 4GLVB 3OMCA 5M5YH 3K6OA 3GTPH 1G51A 3U9SA 1UE7A 4ID6A 1BNZA 2GN5A 2Y0SG 3PIO3 4A3MB 4JC0A 1KHIA 2P5ZX 3QWNA 1IBML 1U4PA 1RD9D 3N6RA 2PNHA 3T16A 1SYEA 3PV0A 1CUKA 1PH9A 1RF2D 4H7BA 5EPJA 3I56A 1YJNA 1WFQA 1E22A 3PIPA 1VQ9A 1SE8A 3D6CA 4K8IA 3TSSA 1Q3LA 4X3SA 1STHA 4B9WA 5C0XH 1WD1A 3S2DH 3EJIA 2L9HA 1D5MC 4R4OA 1R9TB 2R93B 4EX5A 2WACA 1X3FA 3J80E 2VW9A 4QY7A 1KD1C 1PTOC 1HCZA 4A3KH 4G7OC 3CCSA 3TQYA 1RTNA 3D4DA 4C3IB 2KA7A 2O4XA 1GUSA 2A5HA 3GTKH 1KXLA 3MEHA 1SFOB 3BVMA 2RF4A 3AU7A 4H13C 3H0GG 1TWAH 2AMCB 4A3DH 4KI0A 4DGZA 4LNQA 4P2CB 4KKTA 3D0FA 1YI2A 1EIHA 2E76C 1TWGH 1TWHB 3J7A5 1C4QA 4CDFC 1TWFH 5M5XB 1SAPA 5C4XH 3BYTB 4AIMA 3R3OA 3I4MH 5C3EH 1JQYD 3J7AF 3DM3A 2UXCQ 2VB2X 5BN5A 2K1BA 1AZPA 2O2LD 2V1CC 2O5JC 1E1OA 4HIKA 4L6TB 1OXTA 1NJIC 5K36G 2KBNA 5M9OA 4A3EB 1Q8KA 3EFXD 2GVAA 1QILA 1Z7TA 2GA4B 4LFAQ 4DR7L 4GN5A 1KL9A 4WJ3M 1Y1WH 5BR8L 3K59A 3GTJB 2OXPA 1VQMA 1AW7A 4NPSA 4HMIA 1HZ9A 1RKNA 3GTGB 3LGJA 1BOSA 1FNWA 4JBKA 4JV5Q 1LTBD 1DGSA 2K7VA 4E6IA 3K58A 2ATWA 2OTJA 1LT6D 2F52A 2RHQB 4P74A 2JSOA 4K2LA 3J7YW 5DM63 5DEHA 2EY5A 1EZ8A 2ZTEA 2MGSA 4FNFA 1EU3A 4QUCA 4PMWA 4L5RC 3HFZB 1FL0A 1LUZA 1EY0A 1NCVA 4LF7Q 1JOKA 2JA8G 1K83B 2WB1G 1XNQL 1L1OC 1V1PA 4K5WA 3EBEA 4A3IB 4DV6L 1VQLA 2EYMA 3HOZB 1I94Q 1FYCA 1WTHA 1SSOA 2XWBB 4K5XA 1I4HA 4LW1A 5IIFA 3I73A 3BJUA 1EWIA 2F3WA 1EY7A 5IYCH 3J80L 5M5WB 4A3CG 4ALPA 5I6YA 5E1FA 1B70B 2L4NA 1II3A 3MXUA 5ELFA 5CYUA 3Q8DA 1YZ6A 4O2DA 4JG2A 1WTRA 4PMBA 2VUMB 2NVTB 3K5LA 4J6HA 1SNOA 1Y14B 3GTOB 1EY6A 3MXNA 4ZKBB 4QF4A 4OL7A 2MJ8A 2DNCA 4HCEA 1G2SA 2NBFA 2B2UA 1E3PA 4IUVA 3I7FA 1TIID 5CMDA 4KY7A 3ER0A 1NY4A 4OXPA 1HR0Q 3A7LA 2RQXA 4JBWA 1H9KA 4MTKA 4BWGB 3DEOA 3EN2A 3NPPA 1FNUA 3MEFA 2EYHA 1ILPA 1QCBD 3GV6A 1N36Q 4APVA 2VQFL 2KHIA 4C1NI 3PO3G 4JYAQ 1A62A 2KCMA 1RCVD 5I4DA 1IYUA 1STGA 3RZOH 2MPMA 1U0LA 4A3MG 4YIJA 1U5KA 4DV0Q 1BO0A 5E3FA 4MHEA 3W5OA 3H0GH 5GAGC 4A3JB 1A3TA 1GHKA 2N88A 3R93A 2QEXA 1VQPA 4G7ZC 3EIVA 2A6HC 2WKCA 2EYPA 1SNPA 3HRZC 4KJNA 1OTCA 1AE3A 4BBSB 5IT9c 1F2LA 2YTXA 3AQQA 4YWLA 3STBC 3GTQB 2R93G 1VQOA 4A3BB 3PO2B 2CCZA 4Z9CB 1T5XD 3P1HA 2FFKB 4QMGA 1H9MA 5JJIA 1F2YA 3TREA 4DV2L 1HHVA 4P73A 4R4QA 4C3IG 2C5CA 2EY6A 3GO5A 5EGTA 5K36H 1XNRL 2R92B 2VZAA 5FLMG 2ZJPA 3AMUA 2F0FA 1WTPA 2PNRC 4CKBA 3BZKA 3F2CA 1LTAD 2JE6I 1ZXTA 4ZRZA 1E2ZA 3W2DA 1GUWA 2UXBQ 1HXYD 4CDEC 1MJEA 4DV1Q 4ZYSA 4JBJA 3RZDH 1PYWD 3J81j 2Q2IA 4F8MA 1IYVA 4F7XA 4WJ4A 1TU2B 2PYKA 3HOYH 3WOEA 4IPGA 3OHXC 1N34L 3S15B 1BBUA 3PUVA 4V0BA 4ZAIA 2JA8H 5C3XA 5C5LA 1B4OA 2EOTA 2UXDL 2BE5D 4A3EG 1N33Q 4DR6Q 2ICIA 2IX0A 3TP7A 5D65A 1ESFA 3ZYYX 2CW0D 4LF6Q 3NK9A 4HIDA 2NZOA 5KEEA 3CC7A 1F2ZA 2CKZB 1B9MA 4A3CH 3RNUA 3NP8A 2F0UA 1I3QH 3CF5A 4DUYQ 3QR8A 3T56B 4KY5A 4QUFA 3OIPA 3HKZB 1Q46A 1X6OA 1ML0D 2EYOA 4DR3Q 1SR3A 4N9PA 3FKIB 4CDCC 2EJMA 4BA1I 1Q86C 2QDBA 2PMZB 1F9SA 4OX9Q 3BVZA 3CCJA 1BDOA 3S1MH 1SN8A 4A3IG 2LY7A 5FOBB 4GOPC 3MFGA 3HOZG 2SDFA 5I2YA 1W6JA 5EAYA 3J7ZC 3C1EA 2VL6A 4KN4C 1B50A 1J9OA 3BG3A 3GP7A 5KNBA 2A8VA 5CORA 1VQFA 3E9HA 3PF5A 3CCQA 1X9NA 4DAYA 4B3ML 5CC4A 3PO3H 1STBA 3T1HQ 2HIVA 1RHPA 4JPBW 3QG1A 3M9BA 1F9PA 2WKDA 2B2WC 4LFAL 2VUMG 4N9TA 5FO8B 3BVGA 3U50C 1B44D 4A3MH 5CBEE 1WI5A 4X3KA 1K9MC 3EVQA 2OT2A 1FGUA 4JV5L 4RGMA 4ZKCB 4OIKA 4WRDA 3C3LA 3K0XA 4GKJL 1KDBA 4XT1B 5KYLA 2K03A 1HNWQ 4MZ9A 1HZAA 3GD7A 1R9TH 2R93H 4JI1Q 3OWEB 2A68C 2SNMA 4LF7L 4UPAA 2X6GA 1BCPC 4DAVA 1IKMA 1C48A 2B2VA 4C3IH 3M7NA 1A6XA 1I94L 2H4OA 3S2HB 5FLMH 1SFOH 1ENFA 4ABNA 3V96A 2ZM6Q 3RN5A 3S1NB 3NEMA 5CR3A 4A3JG 4OIJA 1AZQA 2Q2UA 3S24A 2PZTA 2IX1A 1CTMA 2O5IC 1SMXA 4Q0FA 3R2TA 4NXMQ 1TWHH 2B63B 2I5LX 5IWAQ 1Q8IA 5M5XH 1EYAA 4BBSG 2F0NA 2IT1A 1K8MA 3P75A 3URYA 4HTHA 2E2IB 5LMNQ 1JCKB 4L8JA 5EQ0A 4A3BG 1OXUA 4QJFA 4PZ7A 3UE0A 1CZWA 3PO2G 3DHQA 1DXMA 3GTMB 4ME3A 3NBHA 1D5ZC 2PO4A 5E4XA 3AB9A 5T1IA 4HJAA 2JEBI 4LF4Q 3FDTA 2B2VC 1PRTF 4BY1B 2XWJB 4FO2A 3I4LA 1VQ7A 2R92G 4A3EH 2Z9HA 5T1GA 3CRKC 3LX0A 1UE6A 2CQAA 2JJQA 4DV7Q 4A75A 1KDCA 4N8FA 2Y0SE 4A93H 1C0AA 2E75C 4K0KQ 1LTRD 4C3JB 2PZUA 4NB3A 5FKAC 3GTJH 1VQJA 1N36L 1X3PA 1EWCA 2F0KA 4DR4L 3H09A 3GTGH 1EY5A 3PUZA 3I91A 4P75A 4JYAL 3CXCA 4LK1C 5KIXA 2B2YA 1NUCA 3NWSA 5JAVA 1Z6HA 4X64Q 2UUBL 3OWFA 1EQTA 3ITPA 1H9RA 4KK7A 4B9XA 1JWUD 4LF5Q 1YHAA 1B7YB 2K4KA 3SGIA 1JICA 5D3IB 4K6DA 2Z4IA 1K83H 4DAMA 4HIOA 1QOHA 1SYCA 2I46A 4R9WA 2SEBD 4A3IH 2K52A 4HJ8A 3TP8A 3HOZH 3ND8A 4CJ2C 4KY6A 4RGTA 1NR4A 4LAAA 4ME5A 1EFID 1FJGQ 1LTSD 4NP5A 4R8NA 3TBIB 4ODGA 2QW7A 1XMQQ 1W2BA 1HA5A 2HT1A 2RSNA 5H1SE 5M5WH 4GN3B 3K7UC 4RHRA 4DR1Q 4B3SQ 2BH8A 4RG1A 4JI2L 1UWVA 2B2YC 1WJJA 2WAQB 1LTID 5JPMC 3H3VC 5IYDG 3HKZG 4TQUS 1XTCD 4FXGC 1PH6A 3PUXA 1VQKA 2NVTH 3KBGA 2VUMH 2D0OA 3WDNA 4FF1A 4WORA 3GTOH 3FKIG 2LXJA 5TSSA 2UXBL 3ZJYC 1GJXA 1X32A 1E24A 2L0CA 4IFDI 5HGTA 3KYHC 4Y52H 3GV3A 4RWSC 2EVBA 1SRUA 3UE1A 4DA2A 5IT9E 2PQAB 4L63B 3VA7A 4LF9L 1G6PA 3NQIA 3L9AX 1EEID 4DNIA 3MTSA 2WV6D 1N33L 2JA7B 3NTKA 1J6QA 1HUNA 5DNFA 2HQLA 4LF6L 1M4VA 3KDFB 1V8QA 3OSOA 4I7AA 1ENAA 5A35A 3F8TA 1ASZA 4XQJA 1Y8OB 5KRUA 4A3JH 1Q1EA 4DNRB 4IOAA 1IBKQ 1BBXC 3HOVB 4KD4A 4R4TA 1EUJA 2K5DA 3EA6A 3J81c 2QF7A 1CI3M 1S3OA 4BBSH 2OF1A 1DD2A 5KGUA 5IOCA 2PI2E 4RKLA 4IJLA 5ELOA 2WFWA 4DR3L 4EQNA 3GTQH 4A3BH 2D9UA 2DY7A 4HIMA 3PO2H 2ALYB 4LFCQ 1X65A 1IYJB 2FMMA 2K5QA 2DGYA 3NBIA 4LMQD 3NWTA 1PHJA 1MSHA 1B3AA 1V1QA 3SXHA 1KNEA 3LWUA 2ICEC 3SR1A 2R92H 1SNCA 1I4GA 4J15A 2R6GA 4AYBB 3I4NB 3HOWB 1EY9A 1GM5A 4XIGS 5LL6S 3I55A 1I50B 2VB3X 4JI4Q 1HQRD 3IAYA 1OXVA 5A2QE 1STYA 2B8GA 3OW7A 1JR0D 2KQ3A 1QVGA 3UDGA 1YNJC 4FP5D 3V2TA 1S5ED 4A3FB 2B63G 1EYDA 4RH6A 2WINB 4BBRB 3CQZB 5D14A 2LMCB 1I4XA 1EIYB 4B08A 4YCWA 3NELA 3NXWA 4RMFA 1YBYA 1EFWA 2UUCQ 2BDNA 2F4VL 4DUZQ 3NHHA 2K6AA 1AE2A 1GO3E 4JI6Q 1AH9A 4YHHQ 3AFPA 1R4PB 3S15H 1K28A 2F0SA 1VDZA 4YWKA 2A69D 2NUCA 2E8GA 1DYQA 3MXGA 4BY1G 2K33A 1PH7A 1SJHD 1KABA 2FXQA 3CHBD 1TY0A 1HNWL 2AQ1B 1KNAA 4KHPQ 1JWMD 2YTYA 4CDDC 1XPRA 4KV6A 1QZGA 2ZJQA 1H9JA 4ZK9B 4B3TQ 4JI1L 3P20A 2JN4A 4DK6C 3UDFA 4C3JG 4EQPA 1D7QA 4LUOA 1L1OA 1LLRD 5JEAG 3SVMA 1Q7YC 1CKMA 3ICEA 3IFTA 4S3SA 2KJXA 2IW3A 2KUMA 3FHWA 3HS0C 1KC8C 2ZM6L 5IYDH 1KLGD 4ZUIA 1LACA 1JORA 3AEVA 3FRPB 4MN3A 2IPKD 3VR4A 4JI0L 2R61A 2E5LL 3FKIH 4DR5Q 1G6ZA 1WTOA 2EXZA 1XJVA 5L37A 4LFBL 2OEOA 3T53B 1LM0A 3M4OB 4X62Q 3GTLB 1JMCA 1TS4A 4JW0A 3T4AC 5LMNL 3C1FA 2L55A 3HEJA 4KHVA 1G8ZD 1BCPD 4C3HB 1YITA 4DR2L 1SYBA 3A8JE 3S16B 4B3RQ 1WCMB 1B1ZA 1S5FD 4NMZA 5KYIA 2VNUD 4LF4L 4TSSA 2QDLA 5I9PA 1LT3D 1S40A 3DEPA 2WAQG 3TZUA 4M8AA 2A19A 1VQDA 2X6LA 2CWAA 2R7DA 3M4YA 2F0MA 3D31A 4HSPA 3E5SA 4PV1C 4KKSA 3VYSA 2YV5A 1RTOA 1Z9FA 3A8IE 3HOXB 4H44C 1KAAA 3MZ5A 4HCSA 1HUMA 3M4QA 5A2QL 4A4IA 3HOUB 3ERSX 3QIAA 3IL8A 1Q12A 1G2TA 3TN2A 1F9QA 4JI5Q 4NXNQ 4IALA 1RDPD 3OPOA 4X64L 2AWOA 2XTIA 4LF8L 5CV8A 3BZDB 2CFMA 3VDYA 5BN4A 3KBXA 4LF5L 2XSCA 3KK7A 3H94A 3F1ZA 3QB3A 4KD3A 2K75A 1JJCB 4BA2I 1BR9A 3A56A 1KRSA 1YNXA 4IUTA 1JT8A 4K8JA 5JPNC 3TEHB 3J81i 1GUOA 4XQNA 1VMCA 2JA7G 3MWYW 2EPBA 3T13A 1E0BA 2AHOB 1L0XB 3HZXA 3VR6A 2F0PA 1IW7C 2J0TD 2K5WA 3K7AB 1FJGL 4P71A 3S2HH 4X66L 3CCUA 3OIQA 4YCUA 5CV5A 3OTOQ 4AQYQ 3I4OA 1XMQL 2EYFA 1UE5A 2XRQD 2Z4HA 5DM73 3S1NH 4N8X1 4QQBX 2C9OA 3BDCA 1D8LA 3HOVG 3PF4A 2M2LA 1XMOQ 5EKIA 4LUZA 1ZEQX 4RGOS 1K0RA 4DPGA 2OWOA 2B63H 2HHHQ 3OW2A 4R4IA 3T1YQ 4IQZA 3DM1A 1RL2A 1JB7A 2E2IH 3M85A 5EPKA 2NVQB 3RR5A 2OTLA 1SYDA 3GTMH 2F0JA 3A74A 4DK0A 4IJHA 4PNYA 3KF6A 3Q0AA 2D2CC 4X65Q 4BY1H 1H95A 1K0SA 2NYZD 3DXJC 1JJ2A 4AYBG 3I4NG 1K73C 3HOWG 1SE4A 3OOCA 4DV4L 4WFN3 4C2MB 1V1PB 1RODA 1ET6A 1UNSA 2F0QA 3EROA 4C3JH 4IUNA 5C4HA 4XYOA 1NE3A 2KOLA 4LWCA 1T5EA 5JEAH 4DXFA 4A3FG 2F4IA 5ELNA 4O1NA 4BBRG 4X3UA 4UHVA 2I5HA 2RCNA 2K5VA 1A3UA 3R2IA 1SMYC 2C35B 1W3SA 1PRTD 3TS0A 2ZTDA 4FXKC 3CW2C 4HAEA 3RN2A 1UUPA 1AFPA 3U4ZA 4IN3A 1I4PA 2ZT9C 1QUQA 2YU9B 1DZ1A 3P7JA 1YEZA 4JI7Q 5EKKA 3MXNB 2EIFA 1V9PA 2KVMA 2F0TA 3U58A 3G6EA 3L3OC 3CCRA 4IUUA 1GVPA 1JE4A 2K28A 1ENCA 1TS5A 1X55A 1TXYA 4LFCL 5CV6A 4GNXA 2EXDA 1GOZA 4L5TA 5E4WC 4JI3Q 2L12A 4GLAC 4GOPA 1N8RC 2KCNA 4QL5A 1XWEA 1HNXQ 1PLFA 2L5TA 4IZ8A 2HUGA 3RLFA 1P16A 1Q82C 4ZLTF 2B29A 4UP8A 4JI4L 1SYGA 3KLSX 1GUNA 3I3CA 4CHTB 5IGCA 3D6WA 1BCPF 5IGBA 3J81E 1CFMA 1S5DD 2B2WA 4JVZA 3QOJA 4UAIA 3Q24A 1A63A 1LO5D 3A8KE 2F0OA 2UUCL 1CA6A 2UU9Q 1QZHA 4RHSA 2B2TC 4C3HG 5C44B 3GDEA 2QCPX 1HQMC 4JI6L 1WCMG 4GNXC 4YHHL 1K8OA 2FJ2A 1WTWA 2IL8A 3PSIA 2H1EA 1IXRA 1ZYRC 2Z0SA 3S1QB 4QCLA 2UXCL 1ZKOA 2NZ1D 1IBMQ 1PTOD 2JA7H 5C5MA 2CQOA 2NVYB 4DAPA 1F2MA 1NAPA 1O78A 2KECA 2UUAQ 3E0JA 3DWPA 1HTLD 4DF7A 2FHTA 1YNJD 4GKKQ 1STEA 1TQOA 1VQ5A 3HOXG 2E2JB 3HOUG 1UEBA 1C7YA 3HOVH 3CCLA 3M3YB 3VR5A 1I6HB 3SK6A 2B39A 4DV5Q 2XGTA 4JCVE 4C1NK 3MXPA 1WTXA 4DR5L 1QWYA 4QGUA 1V1OA 3CAMA 5D3DA 3VR2A 4IFDJ 4DXGA 2RBMA 3BDOA 3WOFA 5LMNW 4K14A 2R7ZB 1LV9A 3TS2A 4J8QA 1OO9B 5AFWA 4X62L 4XQQA 2LS01 2K5NA 3ULLA 3HOWH 3HKZE 3R8BA 3I4NH 1LT4D 2KCCA 5DLQE 1PH2A 4B3RL 1I50H 2Q8TA 5JVG3 3SEBA 3S14B 4BXXG 2F0IA 2PMZE 5C3WA 1CKNA 5IY0A 4A3FH 3K57A 1KLUD 5ELBA 2NZHA 4BBRH 3CQZH 5JJLA 2OQ0A 5LMUQ 1PVOA 1XXGA 3S1RB 4XDXA 5KNCA 2DY8A 5C0XI 3A5UA 2K01A 5JVH3 1PH8A 3JC66 4IUPA 4TRDA 3PIOA 3D8GA 1XTDA 2OCEA 2LFNA 1LTTD 1HH2P 4GS3A 2G9HD 1TR5A 2SNSA 1K8GA 4JI5L 4FXDA 2PI2A 1O80A 4DR7Q 3J81L 5M3FB 3KF8A 4MTNA 3KOJA 1JOQA 2JA9A 3A7AB 3CCVA 2PZWA 1MJCA 2N78A 1M90C 4JI8Q 4U673 2K32A 3W1BA
chains in the Genus database with same CATH topology
1EQRA 3L2PA 4HJ9A 4LF9Q 1EUJA 4LW1A 2MQHA 3G4SA 3J81c 3BJUA 4UP9A 1EWIA 1S3OA 4BBSH 5IYCH 4A3CG 2PI2E 4ALPA 4IJLA 5ELOA 2K14A 2WFWA 1HR0L 1IBLQ 2I0QA 3A5ZB 2KENA 4DR3L 1K3RA 1B70B 3GTQH 5IYBH 3JAMc 4A3BH 4HIMA 3Q8DA 1LYLA 3PO2H 2ALYB 2YTVA 2DUDA 5JEAJ 3OTOL 4LFCQ 4HJ5A 1YZ6A 4UY8C 1X65A 4JG2A 3M4PA 4O2DA 4A93G 1IYJB 1KQSA 1GD7A 2DGYA 3J80c 4DAYB 3L0OA 1PHJA 2ES2A 4A3GG 1V1QA 1NMGA 1Y14B 4DUZL 4O0AA 4DV6Q 4UP7A 2R92H 4J15A 2R6GA 1XMOL 4JOIC 3KF6B 1GM5A 4XIGS 3L7ZC 5FJ8G 1IL2A 3I55A 2HHHL 1E3PA 2JA5G 1C9OA 4L5QA 3I7FA 1YVCA 2HIXA 4JI4Q 4DV0L 1OXVA 3M4OH 3GTLH 3T1YL 3ER0A 4KHPL 1V43A 1VQNA 1NY4A 2CWPA 2JQOA 4LUVA 4OXPA 1CSQA 3UDGA 4DV3L 1QVGA 1HR0Q 4B3TL 4JBMA 4JBWA 3F2DA 4C3HH 2B63G 3K81C 5IP9G 3S16H 1WCMH 3EN2A 3MEFA 1FVIA 1EIYB 1N36Q 4X65L 4YCWA 3NELA 4RMFA 2NVXH 4APVA 1YBYA 2A1AA 3UDIA 2VQFL 3IRBA 1EFWA 4IPCA 2UUCQ 1CSPA 2KHIA 2F4VL 4DUZQ 3PO3G 3H3VH 4JYAQ 1A62A 1AE2A 1GO3E 1K8AC 2KCMA 1SLJA 4JI6Q 1VQ6A 2IY5B 1AH9A 4YHHQ 3AFPA 3RZOH 3S15H 1U0LA 1HNZQ 4YWKA 4A3MG 2E8GA 4BY1G 1PH5A 1PH7A 1U5KA 2FXQA 1QUQB 3HKSA 4DV0Q 1XPOA 3W5OA 1HNWL 4IOCA 3H0GH 1VQCA 2K5HA 5GAGC 1IZ6A 4KHPQ 3HOXH 2YTYA 3AYHB 1XPRA 2ZJQA 1QZGA 3HOUH 2GVBA 4X6AH 4B3TQ 4JI1L 2QEXA 1VQPA 4DK6C 3UDFA 3EIVA 2H5XA 2ASBA 2QA4A 4IPHA 1D7QA 1PYBA 1OTCA 1AE3A 4LUOA 4MNOA 1L2FA 5IT9c 1L1OA 1OXSC 5JEAG 1Q7YC 3CPFA 1CKMA 3RLOA 5C44G 2YTXA 4A3LH 3FP9A 3AQQA 4YWLA 3STBC 4IO9A 2R93G 5HGQA 1VQOA 1Q1BA 3ICEA 4GNXB 2F4VQ 2VQEL 4DV1L 4R4CA 3FHWA 1QVFA 3STBD 4Y7NH 1KC8C 2CCZA 4JI7L 2JA6H 2ZM6L 5IYDH 4GOPB 3KJPA 1X56A 1PH3A 5JJIA 3TREA 4DV2L 4GLXA 4P73A 4YY3Q 4R4QA 3AEVA 1VCIA 3GO5A 1PH4A 2JEAI 4JI0L 2E5LL 1XNRL 1PFSA 3FKIH 3NBHB 4DR5Q 3CD6A 2VZAA 3K7AH 5FLMG 2ZJPA 2D62A 5IP7G 4HJ7A 1XJVA 4PZ6A 3CP0A 3BZKA 3F2CA 4LFBL 2JE6I 1LM0A 4BXXH 1EOVA 4X62Q 4DR6L 1JMCA 4JI3L 5LMNL 1QVCA 2UXBQ 4JOIA 1NTGA 4NXNL 4OWTB 2ZJRA 4DR2L 4DV1Q 1YITA 1MJEA 4B3RQ 3KLWA 2VNUD 3CMAA 4LF4L 5BR8Q 2LSSA 4JBJA 3RZDH 3J81j 2Q2IA 3H15A 4WJ4A 2KCTA 1S40A 2WAQG 4DKAC 5HY6A 2F3IA 4JI0Q 2A19A 2E5LQ 1VQDA 4DUYL 2CWAA 2R7DA 1XNRQ 2NVQH 3HOYH 3D31A 3UDXA 3B6YA 4IPGA 2R7ZG 1N34L 1BBUA 3PUVA 2R7ZH 4BY7H 4IFDG 2E2HH 2JA8H 1LTLA 2WAQE 2ZTCA 4LFBQ 1KAWA 2UXDL 2YV5A 1Z9FA 4A3EG 3I2ZA 5GROA 3ULPA 1UE1A 2IX0A 1Q81C 2UU9L 5GADC 1N33Q 3W1GA 2PQAA 2QGQA 3M4QA 4A4IA 4JI8Q 4C2MH 3ERSX 4AQYL 1Q12A 1VQGA 4LF6Q 4OX9L 4HIDA 4DR2Q 4FDBA 4JI5Q 4NXNQ 1XNQQ 2NZOA 4X64L 3CC7A 2AWOA 2XTIA 4LF8L 2CKZB 5C0XG 4A3CH 2CFMA 1EIFA 3VDYA 3RNUA 2K50A 1YJ9A 4LF5L 3NENA 2JK8A 1I3QH 3CF5A 4DUYQ 3F1ZA 1O7IA 2UUAL 2K75A 3TRZA 1JJCB 4OONA 4BA2I 1KRSA 1YNXA 1N34Q 1JT8A 4A3KG 4GKKL 3TEHB 3J81i 1J5EL 1Q46A 3KDFA 1X6OA 2BA1A 2JA7G 4A3GH 2UXDQ 2AHOB 4DR3Q 2MO1A 1VQ8A 1SR3A 1N32L 3T1HL 2YU9H 2ID0A 1FJGL 3WWVA 4P71A 4BA1I 4X66L 3JAMi 1Q86C 3CCUA 3S2HH 4YCUA 3OTOQ 4POFA 4AQYQ 1WOCA 3I4OA 5FJ8H 4DV5L 1XMQL 1UE5A 4OX9Q 2JA5H 3CCJA 5M3FG 2NN6I 3PUWA 3S1MH 3S1NH 1SN8A 4A3IG 3J80i 4A3DG 1KIXA 4QQBX 1EQQA 4GOPC 4LF8Q 1NBWA 2BA0A 3HOZG 1D8LA 3E9IA 4P72A 1SROA 3HOVG 3PF4A 1XMOQ 4LUZA 1K0RA 1BKBA 5EAYA 4OWXB 4DPGA 3J7ZC 2VL6A 3CMEA 2OWOA 2B63H 3KFUA 4TVAB 2HHHQ 5C4XG 5IP9H 3CCMA 1Z47A 3OW2A 1VQ4A 2IHEA 5C3EG 3I4MG 4R4IA 1CKOA 1CKNB 2N8NA 2A8VA 1VQFA 3T1YQ 3E9HA 1VQEA 5AJ3L 3CCQA 1RL2A 3PF5A 1JB7A 4R1JA 2E2IH 3M85A 1X9NA 4DV3Q 3DLLA 4B3ML 3PO3H 2MNAA 1VQAA 2MFIA 1MIUA 3RR5A 2HIVA 2LXKA 3T1HQ 2OTLA 3M9BA 2Q2TA 3GTMH 3A74A 5GAHC 4X66Q 1PH1A 4IJHA 4LFAL 2VUMG 2B3GA 3KF6A 3U50C 4A3MH 1WI5A 1X3GA 4X65Q 4BY1H 3G48A 1H95A 2VQFQ 2OQKA 1JJ2A 1G291 4AYBG 1K9MC 1K73C 2R7FA 3HOWG 3I4NG 4DV4L 1FGUA 4JV5L 5IE8A 4DK3C 3KF8B 5C4JH 5LMUL 1WYDA 1OXXK 1Y1WG 3K0XA 4C3JH 4OWWB 4GKJL 3BU2A 4AYBE 1NE3A 1HNWQ 4LWCA 2NN6G 1NMFA 4MZ9A 4OO1I 4A3FG 5C44H 1HZAA 5ELNA 4NXML 3GD7A 1R9TH 1YHBA 4BBRG 2R93H 1VQBA 5IWAL 2D0PA 4JI1Q 4B3MQ 2I5HA 2RCNA 2K5VA 4KLKA 2C35B 4LF7L 1W3SA 3TS0A 2ZTDA 4UPAA 2VY3A 5M3MG 1RIPA 2IHFA 3CW2C 3RN2A 4POGA 3S1QH 1HJPA 1X54A 3U4ZA 1S72A 4C3IH 1HNXL 3M7NA 2NVYH 2YYZA 3CPWA 4QIWE 2EQSA 1QUQA 1I94L 4JI8L 2VQEQ 5FLMH 4DV4Q 1SFOH 1YEZA 5IP7H 1HR0W 4JI7Q 1MKHA 2ZM6Q 4EQ5A 3MXNB 2EIFA 1VQIA 4GKJQ 4DV2Q 1V9PA 3NEMA 3RN5A 4A3JG 1Y1VG 3U58A 3G6EA 3CCRA 4A76A 5E7NA 2E2JH 3S24A 1I5FA 1GVPA 1YJWA 1IBLL 2Q2UA 2IX1A 3CC2A 1PV4A 1SMXA 3OYYA 4DV7L 3HOYG 4NXMQ 3M3YH 2VS1A 2KHJA 1TWHH 1I6HH 4K0KL 1X55A 2I5LX 5IWAQ 1TXYA 3S17H 4LFCL 1E1TA 5M5XH 5JJKA 3F2BA 4GNXA 5IYCG 4BBSG 1GKHA 1TWCH 2IT1A 2EXDA 4KHZA 3H3VI 4L5TA 4YWMA 4JI3Q 4GLAC 4GOPA 1X3EA 4AH6A 5IYBG 5LMNQ 2BH2A 1N8RC 4A3BG 4QL5A 1HNXQ 3K8AA 1OXUA 4QJFA 4PZ7A 4XTCS 3UE0A 2I5MX 3K80C 3RLFA 3PO2G 4OO1G 1P16A 1Q82C 2WB1E 4GLVB 4ME3A 5M5YH 2B29A 4UP8A 1G51A 4HJAA 2JEBI 3AFQA 4JI4L 4LF4Q 1UE7A 3GTPH 2GN5A 2Y0SG 4JC0A 1KHIA 5GQOA 1IBML 3PCOB 1VQ7A 2R92G 2PNHA 3PV0A 1CUKA 4A3EH 1PH9A 4YCVA 1VS0A 1UE6A 3A0JA 3RLNA 3I56A 2JJQA 4DV7Q 4A75A 5FLXc 1YJNA 1WFQA 1JJGA 1E22A 1P8LA 2Y0SE 3PIPA 1VQ9A 4A93H 4K0KQ 1SE8A 1C0AA 3S14H 4NB3A 5GAEC 3GTJH 1KRTA 1VQJA 2N3SA 3PUYA 1N36L 3S2DH 1A63A 2UU9Q 4DR4L 2UUCL 3GTGH 1E7ZA 3PUZA 3KJOA 1QZHA 4P75A 4R4OA 3CXCA 3ULJA 3GDEA 4JYAL 2Q2HA 4JI6L 4EX5A 1WCMG 4GNXC 2MO0A 1XPUA 4YHHL 3S1RH 1L1OB 1X3FA 4PG3A 2VW9A 1A0IA 1HNZL 3PSIA 4QY7A 4X64Q 1PA6A 1KD1C 1N9WA 3CCEA 4A3KH 2UUBL 1IXRA 3CCSA 3TQYA 4DR1L 1PYSB 2Z0SA 4B3SL 2UXCL 4PZ8A 1IBMQ 2JA7H 1A8VA 4LF5Q 2CQOA 1YHAA 1JE5A 4L5SA 1B7YB 3GTKH 2K4KA 1KXLA 3SGIA 1BVSA 2UUAQ 5J3BA 3CC4A 1K83H 2RF4A 4GKKQ 4DAMA 4DR6Q 4HIOA 1J5EQ 5M3FH 3H0GG 1T9HA 1TWAH 4A3IH 2AMCB 3HOXG 1VQ5A 4KI0A 2AKWB 2K52A 4HJ8A 1YHQA 4A3DH 4LNQA 3HOZH 1N32Q 3HOUG 1UEBA 1C7YA 3D0FA 1YI2A 3CCLA 3HOVH 4DR4Q 1FJGQ 1TWGH 2AWNA 3J7A5 1XMQQ 2WP8J 1TWFH 4DV5Q 1W2BA 2XGTA 5C4XH 2L15A 4JCVE 2HT1A 4AIMA 1L0WA 5H1SE 4GN3B 5M5WH 5C3EH 4YY3L 2UUBQ 3I4MH 3K7UC 4A3LG 4DR1Q 1M1KC 4B3SQ 2BH8A 4GN4B 3DM3A 4RG1A 3U4VA 4JI2L 1UWVA 2UXCQ 4DR5L 4QGUA 1EYGA 1WJJA 3CAMA 2V1CC 4IFDJ 4IPDA 2JA6G 5IYDG 3HKZG 4TQUS 5LMNW 1PH6A 3PUXA 1VQKA 2NVTH 2VUMH 3W1BA 2D0OA 3TS2A 1E1OA 4HIKA 5AJ3Q 3PGZA 4X62L 3GTOH 1OXTA 1NJIC 5K36G 3FKIG 2LXJA 2KBNA 2Z6KA 2K5NA 3ULLA 3HOWH 3HKZE 3I4NH 2UXBL 1Q8KA 1B8AA 3ZJYC 5DLQE 1E24A 2RHSB 2GVAA 1PH2A 4IFDI 4B3RL 3KYHC 1I50H 4LFAQ 5C0XJ 4DR7L 4Y52H 4GN5A 1SRUA 3UE1A 1KL9A 1YIJA 1VQHA 1Y1WH 4BXXG 5BR8L 4WJ3M 2PQAB 1VQMA 1ASYA 4NPSA 3BZCA 2PMZE 1HZ9A 1IBKL 1CKNA 5IY0A 3LGJA 4JI2Q 4A3FH 4JBKA 2NZHA 4LF9L 4JV5Q 1G6PA 4BBRH 1DGSA 3CQZH 5JJLA 2OQ0A 3G71A 5LMUQ 1PVOA 2ATWA 2OTJA 5C0XI 2F52A 2RHQB 3A5UA 4P74A 1PH8A 4DNIA 3JC66 5M3MH 1HZBA 1HZCA 3PIOA 1N33L 1XTDA 2OCEA 1J6QA 1HH2P 2ZTEA 4H02A 4PMWA 4GS3A 4L5RC 3E0EA 2N49A 1FL0A 3HFZB 1LUZA 2HQLA 4LF6L 4BY7G 4LF7Q 3KDFB 1K8GA 2JA8G 2WB1G 4JI5L 2PI2A 1XNQL 4DR7Q 3F8TA 1L1OC 1ASZA 2Z6KC 4MTNA 4A3JH 1Q1EA 1Y1VH 3EBEA 3KOJA 4DV6L 1VQLA 2JA9A 3CCVA 1MJCA 2N78A 1M90C 1IBKQ 4IOAA 1I94Q 1BBWA 4R4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQR A;  3L2P A;  4HJ9 A;  4LF9 Q;  1EUJ A;  4LW1 A;  2MQH A;  3G4S A;  3J81 c;  3BJU A;  4UP9 A;  1EWI A;  1S3O A;  4BBS H;  5IYC H;  4A3C G;  2PI2 E;  4ALP A;  4IJL A;  5ELO A;  2K14 A;  2WFW A;  1HR0 L;  1IBL Q;  2I0Q A;  3A5Z B;  2KEN A;  4DR3 L;  1K3R A;  1B70 B;  3GTQ H;  5IYB H;  3JAM c;  4A3B H;  4HIM A;  3Q8D A;  1LYL A;  3PO2 H;  2ALY B;  2YTV A;  2DUD A;  5JEA J;  3OTO L;  4LFC Q;  4HJ5 A;  1YZ6 A;  4UY8 C;  1X65 A;  4JG2 A;  3M4P A;  4O2D A;  4A93 G;  1IYJ B;  1KQS A;  1GD7 A;  2DGY A;  3J80 c;  4DAY B;  3L0O A;  1PHJ A;  2ES2 A;  4A3G G;  1V1Q A;  1NMG A;  1Y14 B;  4DUZ L;  4O0A A;  4DV6 Q;  4UP7 A;  2R92 H;  4J15 A;  2R6G A;  1XMO L;  4JOI C;  3KF6 B;  1GM5 A;  4XIG S;  3L7Z C;  5FJ8 G;  1IL2 A;  3I55 A;  2HHH L;  1E3P A;  2JA5 G;  1C9O A;  4L5Q A;  3I7F A;  1YVC A;  2HIX A;  4JI4 Q;  4DV0 L;  1OXV A;  3M4O H;  3GTL H;  3T1Y L;  3ER0 A;  4KHP L;  1V43 A;  1VQN A;  1NY4 A;  2CWP A;  2JQO A;  4LUV A;  4OXP A;  1CSQ A;  3UDG A;  4DV3 L;  1QVG A;  1HR0 Q;  4B3T L;  4JBM A;  4JBW A;  3F2D A;  4C3H H;  2B63 G;  3K81 C;  5IP9 G;  3S16 H;  1WCM H;  3EN2 A;  3MEF A;  1FVI A;  1EIY B;  1N36 Q;  4X65 L;  4YCW A;  3NEL A;  4RMF A;  2NVX H;  4APV A;  1YBY A;  2A1A A;  3UDI A;  2VQF L;  3IRB A;  1EFW A;  4IPC A;  2UUC Q;  1CSP A;  2KHI A;  2F4V L;  4DUZ Q;  3PO3 G;  3H3V H;  4JYA Q;  1A62 A;  1AE2 A;  1GO3 E;  1K8A C;  2KCM A;  1SLJ A;  4JI6 Q;  1VQ6 A;  2IY5 B;  1AH9 A;  4YHH Q;  3AFP A;  3RZO H;  3S15 H;  1U0L A;  1HNZ Q;  4YWK A;  4A3M G;  2E8G A;  4BY1 G;  1PH5 A;  1PH7 A;  1U5K A;  2FXQ A;  1QUQ B;  3HKS A;  4DV0 Q;  1XPO A;  3W5O A;  1HNW L;  4IOC A;  3H0G H;  1VQC A;  2K5H A;  5GAG C;  1IZ6 A;  4KHP Q;  3HOX H;  2YTY A;  3AYH B;  1XPR A;  2ZJQ A;  1QZG A;  3HOU H;  2GVB A;  4X6A H;  4B3T Q;  4JI1 L;  2QEX A;  1VQP A;  4DK6 C;  3UDF A;  3EIV A;  2H5X A;  2ASB A;  2QA4 A;  4IPH A;  1D7Q A;  1PYB A;  1OTC A;  1AE3 A;  4LUO A;  4MNO A;  1L2F A;  5IT9 c;  1L1O A;  1OXS C;  5JEA G;  1Q7Y C;  3CPF A;  1CKM A;  3RLO A;  5C44 G;  2YTX A;  4A3L H;  3FP9 A;  3AQQ A;  4YWL A;  3STB C;  4IO9 A;  2R93 G;  5HGQ A;  1VQO A;  1Q1B A;  3ICE A;  4GNX B;  2F4V Q;  2VQE L;  4DV1 L;  4R4C A;  3FHW A;  1QVF A;  3STB D;  4Y7N H;  1KC8 C;  2CCZ A;  4JI7 L;  2JA6 H;  2ZM6 L;  5IYD H;  4GOP B;  3KJP A;  1X56 A;  1PH3 A;  5JJI A;  3TRE A;  4DV2 L;  4GLX A;  4P73 A;  4YY3 Q;  4R4Q A;  3AEV A;  1VCI A;  3GO5 A;  1PH4 A;  2JEA I;  4JI0 L;  2E5L L;  1XNR L;  1PFS A;  3FKI H;  3NBH B;  4DR5 Q;  3CD6 A;  2VZA A;  3K7A H;  5FLM G;  2ZJP A;  2D62 A;  5IP7 G;  4HJ7 A;  1XJV A;  4PZ6 A;  3CP0 A;  3BZK A;  3F2C A;  4LFB L;  2JE6 I;  1LM0 A;  4BXX H;  1EOV A;  4X62 Q;  4DR6 L;  1JMC A;  4JI3 L;  5LMN L;  1QVC A;  2UXB Q;  4JOI A;  1NTG A;  4NXN L;  4OWT B;  2ZJR A;  4DR2 L;  4DV1 Q;  1YIT A;  1MJE A;  4B3R Q;  3KLW A;  2VNU D;  3CMA A;  4LF4 L;  5BR8 Q;  2LSS A;  4JBJ A;  3RZD H;  3J81 j;  2Q2I A;  3H15 A;  4WJ4 A;  2KCT A;  1S40 A;  2WAQ G;  4DKA C;  5HY6 A;  2F3I A;  4JI0 Q;  2A19 A;  2E5L Q;  1VQD A;  4DUY L;  2CWA A;  2R7D A;  1XNR Q;  2NVQ H;  3HOY H;  3D31 A;  3UDX A;  3B6Y A;  4IPG A;  2R7Z G;  1N34 L;  1BBU A;  3PUV A;  2R7Z H;  4BY7 H;  4IFD G;  2E2H H;  2JA8 H;  1LTL A;  2WAQ E;  2ZTC A;  4LFB Q;  1KAW A;  2UXD L;  2YV5 A;  1Z9F A;  4A3E G;  3I2Z A;  5GRO A;  3ULP A;  1UE1 A;  2IX0 A;  1Q81 C;  2UU9 L;  5GAD C;  1N33 Q;  3W1G A;  2PQA A;  2QGQ A;  3M4Q A;  4A4I A;  4JI8 Q;  4C2M H;  3ERS X;  4AQY L;  1Q12 A;  1VQG A;  4LF6 Q;  4OX9 L;  4HID A;  4DR2 Q;  4FDB A;  4JI5 Q;  4NXN Q;  1XNQ Q;  2NZO A;  4X64 L;  3CC7 A;  2AWO A;  2XTI A;  4LF8 L;  2CKZ B;  5C0X G;  4A3C H;  2CFM A;  1EIF A;  3VDY A;  3RNU A;  2K50 A;  1YJ9 A;  4LF5 L;  3NEN A;  2JK8 A;  1I3Q H;  3CF5 A;  4DUY Q;  3F1Z A;  1O7I A;  2UUA L;  2K75 A;  3TRZ A;  1JJC B;  4OON A;  4BA2 I;  1KRS A;  1YNX A;  1N34 Q;  1JT8 A;  4A3K G;  4GKK L;  3TEH B;  3J81 i;  1J5E L;  1Q46 A;  3KDF A;  1X6O A;  2BA1 A;  2JA7 G;  4A3G H;  2UXD Q;  2AHO B;  4DR3 Q;  2MO1 A;  1VQ8 A;  1SR3 A;  1N32 L;  3T1H L;  2YU9 H;  2ID0 A;  1FJG L;  3WWV A;  4P71 A;  4BA1 I;  4X66 L;  3JAM i;  1Q86 C;  3CCU A;  3S2H H;  4YCU A;  3OTO Q;  4POF A;  4AQY Q;  1WOC A;  3I4O A;  5FJ8 H;  4DV5 L;  1XMQ L;  1UE5 A;  4OX9 Q;  2JA5 H;  3CCJ A;  5M3F G;  2NN6 I;  3PUW A;  3S1M H;  3S1N H;  1SN8 A;  4A3I G;  3J80 i;  4A3D G;  1KIX A;  4QQB X;  1EQQ A;  4GOP C;  4LF8 Q;  1NBW A;  2BA0 A;  3HOZ G;  1D8L A;  3E9I A;  4P72 A;  1SRO A;  3HOV G;  3PF4 A;  1XMO Q;  4LUZ A;  1K0R A;  1BKB A;  5EAY A;  4OWX B;  4DPG A;  3J7Z C;  2VL6 A;  3CME A;  2OWO A;  2B63 H;  3KFU A;  4TVA B;  2HHH Q;  5C4X G;  5IP9 H;  3CCM A;  1Z47 A;  3OW2 A;  1VQ4 A;  2IHE A;  5C3E G;  3I4M G;  4R4I A;  1CKO A;  1CKN B;  2N8N A;  2A8V A;  1VQF A;  3T1Y Q;  3E9H A;  1VQE A;  5AJ3 L;  3CCQ A;  1RL2 A;  3PF5 A;  1JB7 A;  4R1J A;  2E2I H;  3M85 A;  1X9N A;  4DV3 Q;  3DLL A;  4B3M L;  3PO3 H;  2MNA A;  1VQA A;  2MFI A;  1MIU A;  3RR5 A;  2HIV A;  2LXK A;  3T1H Q;  2OTL A;  3M9B A;  2Q2T A;  3GTM H;  3A74 A;  5GAH C;  4X66 Q;  1PH1 A;  4IJH A;  4LFA L;  2VUM G;  2B3G A;  3KF6 A;  3U50 C;  4A3M H;  1WI5 A;  1X3G A;  4X65 Q;  4BY1 H;  3G48 A;  1H95 A;  2VQF Q;  2OQK A;  1JJ2 A;  1G29 1;  4AYB G;  1K9M C;  1K73 C;  2R7F A;  3HOW G;  3I4N G;  4DV4 L;  1FGU A;  4JV5 L;  5IE8 A;  4DK3 C;  3KF8 B;  5C4J H;  5LMU L;  1WYD A;  1OXX K;  1Y1W G;  3K0X A;  4C3J H;  4OWW B;  4GKJ L;  3BU2 A;  4AYB E;  1NE3 A;  1HNW Q;  4LWC A;  2NN6 G;  1NMF A;  4MZ9 A;  4OO1 I;  4A3F G;  5C44 H;  1HZA A;  5ELN A;  4NXM L;  3GD7 A;  1R9T H;  1YHB A;  4BBR G;  2R93 H;  1VQB A;  5IWA L;  2D0P A;  4JI1 Q;  4B3M Q;  2I5H A;  2RCN A;  2K5V A;  4KLK A;  2C35 B;  4LF7 L;  1W3S A;  3TS0 A;  2ZTD A;  4UPA A;  2VY3 A;  5M3M G;  1RIP A;  2IHF A;  3CW2 C;  3RN2 A;  4POG A;  3S1Q H;  1HJP A;  1X54 A;  3U4Z A;  1S72 A;  4C3I H;  1HNX L;  3M7N A;  2NVY H;  2YYZ A;  3CPW A;  4QIW E;  2EQS A;  1QUQ A;  1I94 L;  4JI8 L;  2VQE Q;  5FLM H;  4DV4 Q;  1SFO H;  1YEZ A;  5IP7 H;  1HR0 W;  4JI7 Q;  1MKH A;  2ZM6 Q;  4EQ5 A;  3MXN B;  2EIF A;  1VQI A;  4GKJ Q;  4DV2 Q;  1V9P A;  3NEM A;  3RN5 A;  4A3J G;  1Y1V G;  3U58 A;  3G6E A;  3CCR A;  4A76 A;  5E7N A;  2E2J H;  3S24 A;  1I5F A;  1GVP A;  1YJW A;  1IBL L;  2Q2U A;  2IX1 A;  3CC2 A;  1PV4 A;  1SMX A;  3OYY A;  4DV7 L;  3HOY G;  4NXM Q;  3M3Y H;  2VS1 A;  2KHJ A;  1TWH H;  1I6H H;  4K0K L;  1X55 A;  2I5L X;  5IWA Q;  1TXY A;  3S17 H;  4LFC L;  1E1T A;  5M5X H;  5JJK A;  3F2B A;  4GNX A;  5IYC G;  4BBS G;  1GKH A;  1TWC H;  2IT1 A;  2EXD A;  4KHZ A;  3H3V I;  4L5T A;  4YWM A;  4JI3 Q;  4GLA C;  4GOP A;  1X3E A;  4AH6 A;  5IYB G;  5LMN Q;  2BH2 A;  1N8R C;  4A3B G;  4QL5 A;  1HNX Q;  3K8A A;  1OXU A;  4QJF A;  4PZ7 A;  4XTC S;  3UE0 A;  2I5M X;  3K80 C;  3RLF A;  3PO2 G;  4OO1 G;  1P16 A;  1Q82 C;  2WB1 E;  4GLV B;  4ME3 A;  5M5Y H;  2B29 A;  4UP8 A;  1G51 A;  4HJA A;  2JEB I;  3AFQ A;  4JI4 L;  4LF4 Q;  1UE7 A;  3GTP H;  2GN5 A;  2Y0S G;  4JC0 A;  1KHI A;  5GQO A;  1IBM L;  3PCO B;  1VQ7 A;  2R92 G;  2PNH A;  3PV0 A;  1CUK A;  4A3E H;  1PH9 A;  4YCV A;  1VS0 A;  1UE6 A;  3A0J A;  3RLN A;  3I56 A;  2JJQ A;  4DV7 Q;  4A75 A;  5FLX c;  1YJN A;  1WFQ A;  1JJG A;  1E22 A;  1P8L A;  2Y0S E;  3PIP A;  1VQ9 A;  4A93 H;  4K0K Q;  1SE8 A;  1C0A A;  3S14 H;  4NB3 A;  5GAE C;  3GTJ H;  1KRT A;  1VQJ A;  2N3S A;  3PUY A;  1N36 L;  3S2D H;  1A63 A;  2UU9 Q;  4DR4 L;  2UUC L;  3GTG H;  1E7Z A;  3PUZ A;  3KJO A;  1QZH A;  4P75 A;  4R4O A;  3CXC A;  3ULJ A;  3GDE A;  4JYA L;  2Q2H A;  4JI6 L;  4EX5 A;  1WCM G;  4GNX C;  2MO0 A;  1XPU A;  4YHH L;  3S1R H;  1L1O B;  1X3F A;  4PG3 A;  2VW9 A;  1A0I A;  1HNZ L;  3PSI A;  4QY7 A;  4X64 Q;  1PA6 A;  1KD1 C;  1N9W A;  3CCE A;  4A3K H;  2UUB L;  1IXR A;  3CCS A;  3TQY A;  4DR1 L;  1PYS B;  2Z0S A;  4B3S L;  2UXC L;  4PZ8 A;  1IBM Q;  2JA7 H;  1A8V A;  4LF5 Q;  2CQO A;  1YHA A;  1JE5 A;  4L5S A;  1B7Y B;  3GTK H;  2K4K A;  1KXL A;  3SGI A;  1BVS A;  2UUA Q;  5J3B A;  3CC4 A;  1K83 H;  2RF4 A;  4GKK Q;  4DAM A;  4DR6 Q;  4HIO A;  1J5E Q;  5M3F H;  3H0G G;  1T9H A;  1TWA H;  4A3I H;  2AMC B;  3HOX G;  1VQ5 A;  4KI0 A;  2AKW B;  2K52 A;  4HJ8 A;  1YHQ A;  4A3D H;  4LNQ A;  3HOZ H;  1N32 Q;  3HOU G;  1UEB A;  1C7Y A;  3D0F A;  1YI2 A;  3CCL A;  3HOV H;  4DR4 Q;  1FJG Q;  1TWG H;  2AWN A;  3J7A 5;  1XMQ Q;  2WP8 J;  1TWF H;  4DV5 Q;  1W2B A;  2XGT A;  5C4X H;  2L15 A;  4JCV E;  2HT1 A;  4AIM A;  1L0W A;  5H1S E;  4GN3 B;  5M5W H;  5C3E H;  4YY3 L;  2UUB Q;  3I4M H;  3K7U C;  4A3L G;  4DR1 Q;  1M1K C;  4B3S Q;  2BH8 A;  4GN4 B;  3DM3 A;  4RG1 A;  3U4V A;  4JI2 L;  1UWV A;  2UXC Q;  4DR5 L;  4QGU A;  1EYG A;  1WJJ A;  3CAM A;  2V1C C;  4IFD J;  4IPD A;  2JA6 G;  5IYD G;  3HKZ G;  4TQU S;  5LMN W;  1PH6 A;  3PUX A;  1VQK A;  2NVT H;  2VUM H;  3W1B A;  2D0O A;  3TS2 A;  1E1O A;  4HIK A;  5AJ3 Q;  3PGZ A;  4X62 L;  3GTO H;  1OXT A;  1NJI C;  5K36 G;  3FKI G;  2LXJ A;  2KBN A;  2Z6K A;  2K5N A;  3ULL A;  3HOW H;  3HKZ E;  3I4N H;  2UXB L;  1Q8K A;  1B8A A;  3ZJY C;  5DLQ E;  1E24 A;  2RHS B;  2GVA A;  1PH2 A;  4IFD I;  4B3R L;  3KYH C;  1I50 H;  4LFA Q;  5C0X J;  4DR7 L;  4Y52 H;  4GN5 A;  1SRU A;  3UE1 A;  1KL9 A;  1YIJ A;  1VQH A;  1Y1W H;  4BXX G;  5BR8 L;  4WJ3 M;  2PQA B;  1VQM A;  1ASY A;  4NPS A;  3BZC A;  2PMZ E;  1HZ9 A;  1IBK L;  1CKN A;  5IY0 A;  3LGJ A;  4JI2 Q;  4A3F H;  4JBK A;  2NZH A;  4LF9 L;  4JV5 Q;  1G6P A;  4BBR H;  1DGS A;  3CQZ H;  5JJL A;  2OQ0 A;  3G71 A;  5LMU Q;  1PVO A;  2ATW A;  2OTJ A;  5C0X I;  2F52 A;  2RHQ B;  3A5U A;  4P74 A;  1PH8 A;  4DNI A;  3JC6 6;  5M3M H;  1HZB A;  1HZC A;  3PIO A;  1N33 L;  1XTD A;  2OCE A;  1J6Q A;  1HH2 P;  2ZTE A;  4H02 A;  4PMW A;  4GS3 A;  4L5R C;  3E0E A;  2N49 A;  1FL0 A;  3HFZ B;  1LUZ A;  2HQL A;  4LF6 L;  4BY7 G;  4LF7 Q;  3KDF B;  1K8G A;  2JA8 G;  2WB1 G;  4JI5 L;  2PI2 A;  1XNQ L;  4DR7 Q;  3F8T A;  1L1O C;  1ASZ A;  2Z6K C;  4MTN A;  4A3J H;  1Q1E A;  1Y1V H;  3EBE A;  3KOJ A;  4DV6 L;  1VQL A;  2JA9 A;  3CCV A;  1MJC A;  2N78 A;  1M90 C;  1IBK Q;  4IOA A;  1I94 Q;  1BBW A;  4R4T A; 
#chains in the Genus database with same CATH topology
 2PW7 A;  5K5P A;  2MQH A;  1QNK A;  1PFB A;  1KDA A;  1SXT A;  3K5N A;  3A54 A;  1HR0 L;  1IBL Q;  3K0Y A;  3JAM c;  3A55 A;  1MSG A;  2IWH A;  2JXM B;  4KJO A;  4U68 A;  2DUD A;  5JEA J;  3OTO L;  1WD0 A;  3M4P A;  4DNT B;  1KQS A;  5EBD A;  1BCP B;  1CHP D;  4DAY B;  1NMG A;  3N52 A;  3X3N A;  3NTH A;  4O0A A;  4DV6 Q;  4UP7 A;  1XMO L;  4JOI C;  5G3L D;  3L7Z C;  5FJ8 G;  5KND A;  3BDL A;  1IL2 A;  3FEW X;  2HHH L;  3KLS A;  4DV0 L;  1L0Y B;  3M4O H;  3GTL H;  3T1Y L;  5FO9 B;  1JC7 A;  1CA5 A;  1VQN A;  2CWP A;  1SDF A;  1O7L A;  2EYL A;  1H9S A;  1KTK A;  4C3H H;  2E2D C;  5IP9 G;  3S16 H;  2CHB D;  1PFN A;  1WCM H;  1ICF B;  4QIW B;  1IW7 D;  3VYR A;  4X65 L;  5M3M B;  1K3B C;  2A1A A;  3BYY B;  1CSP A;  2XVS A;  4DFA A;  1VQ6 A;  5C6A A;  1HNZ Q;  1PH5 A;  1SEB D;  3M7G A;  1DM0 B;  3I70 A;  4IOC A;  1SYF A;  1Y1V B;  5ISR A;  4R8I A;  5F2D A;  3HOX H;  3HOU H;  4X6A H;  2NB0 A;  3HP3 A;  3HOY B;  2H5X A;  3MFY A;  3S9W A;  2QA4 A;  1B53 A;  1PYB A;  1PMR A;  4MNO A;  1L2F A;  2A6H D;  1AP0 A;  1DOM A;  3RLO A;  5C44 G;  1PTO F;  2AQ2 B;  1CQV A;  4IO9 A;  2JP1 A;  4DV1 L;  4FF3 A;  3STB D;  2DJG C;  3K5M A;  4JI7 L;  4HN7 A;  1X56 A;  1LAB A;  3KJP A;  1EZ6 A;  3UI2 A;  2D5D A;  4YY3 Q;  2EJG C;  1Y8P B;  1PH4 A;  1SBB B;  3NBH B;  1ILQ A;  3TP5 A;  3I90 A;  3K7A H;  1VF5 C;  2D62 A;  5IP7 G;  1GXD C;  1BF4 A;  3CP0 A;  1QE6 A;  4CBV A;  1A2U A;  4BXX H;  1EOV A;  4GZY C;  4DR6 L;  1SMY D;  4JI3 L;  2QIL A;  1CQF A;  1NTG A;  2ZJR A;  1EY4 A;  3KLW A;  4RKB A;  3CMA A;  1XYI A;  4EVO A;  2NVX B;  3H15 A;  2KCT A;  1I4Q A;  5HY6 A;  1CM9 A;  3CKI B;  4DUY L;  1XNR Q;  4KMU C;  2NVQ H;  3J7A V;  1TS3 A;  3NSW A;  3UDX A;  2R7Z G;  1B3Q A;  4IFD G;  1LTL A;  4IUR A;  1D1I A;  1IKL A;  2WAQ E;  1WVL A;  2M9V A;  1PRT B;  5GRO A;  3ULP A;  1UE1 A;  2CW0 C;  2UU9 L;  4C2M H;  1J8I A;  4OX9 L;  1AEX A;  2ZXP A;  4FDB A;  4CKC A;  3W3A A;  3VYU A;  4H0L C;  1EIF A;  2F1M A;  1YJ9 A;  2FMC A;  3DWA A;  5EPL A;  2UUA L;  1O7I A;  3TRZ A;  4EGV A;  3V05 A;  4Y7N B;  2JA6 B;  1N34 Q;  4GKK L;  3VR3 A;  4DK1 A;  2UXD Q;  5I6W A;  1VQ8 A;  3VA5 A;  1MHW C;  3T1H L;  2YU9 H;  4OEL B;  3JAM i;  1E2W A;  4POF A;  5JOB A;  1WOC A;  5FJ8 H;  4DV5 L;  1TVX A;  2NN6 I;  5M3F G;  3FPU B;  3PUW A;  2CVR A;  1KIX A;  4FF4 A;  1EQQ A;  1XX8 A;  2BA0 A;  4NDX A;  2JYO A;  4P72 A;  5J39 A;  3CRL C;  1BKB A;  1ZYR D;  4OWX B;  3CME A;  3KFU A;  1UAP A;  3RUZ A;  4TVA B;  4RCO A;  5IP9 H;  5IGF A;  1D6E C;  1Z47 A;  1VQ4 A;  1SE3 A;  1G91 A;  1CKO A;  2N8N A;  5IT9 L;  1VQE A;  4MIU A;  4R1J A;  1TS2 A;  2HCI A;  2K04 A;  4DV3 Q;  5IGG A;  1QB5 D;  2MFI A;  1MIU A;  2Q2T A;  5G3L F;  5COY A;  2Z1C A;  4ZCK A;  4F87 A;  4RA8 A;  1QJO A;  1PH1 A;  1BQQ T;  4BY7 B;  2B3G A;  2E2H B;  2J7Z A;  5J22 A;  3SK4 A;  3CU7 A;  1EY8 A;  1EOT A;  5IE8 A;  1PTO B;  4DK3 C;  2F0V A;  5LMU L;  1WYD A;  4ULL A;  1X3Q A;  2CH4 W;  4OWW B;  4CJ1 B;  4AYB E;  4KTA A;  2NN6 G;  4OO1 I;  5C44 H;  4NXM L;  4X3T A;  1YHB A;  4G57 A;  5IWA L;  2D0P A;  4B3M Q;  1JOO A;  4IUQ A;  1B2T A;  3C46 A;  4A93 B;  3SK8 A;  2VY3 A;  4PMC A;  5ELD A;  5M3M G;  1F77 A;  2A68 D;  2IHF A;  2F0G A;  3S1Q H;  1X54 A;  1S72 A;  4A3G B;  1HFG A;  2RKS A;  1D1K A;  2NVY H;  2YYZ A;  3CPW A;  1AN8 A;  5ELC A;  4JI8 L;  2VQE Q;  2EJF C;  4NKL A;  5IP7 H;  1HR0 W;  4TKO B;  1MKH A;  1BUV T;  4EQ5 A;  2JA5 B;  1YNN C;  4GKJ Q;  4G4K A;  2IX3 A;  1A2T A;  1Y1V G;  1WTV A;  4A76 A;  3Q22 A;  2E2J H;  1IBL L;  1JB3 A;  1EIG A;  3NTI A;  3CC2 A;  4DV7 L;  1FGB D;  3HOY G;  3M3Y H;  2KHJ A;  1I6H H;  4K0K L;  2EE1 A;  2KED A;  1E1T A;  5JJK A;  2CH4 A;  1LTG D;  3KLR A;  1GKH A;  3H3V I;  3OMG A;  1TY2 A;  3BS1 A;  2BH2 A;  4K2K A;  1X3E A;  5IYB G;  2L11 A;  4ZUJ A;  4XTC S;  1HPC A;  1CK1 A;  2I5M X;  3K80 C;  4OO1 G;  2TSS A;  2R7Z H;  2LKV A;  3AFQ A;  1HA6 A;  4IFD H;  3TZD A;  5GQO A;  3PCO B;  1GHJ A;  4YCV A;  1VS0 A;  2MP1 A;  3A0J A;  3RLN A;  1Q90 A;  3I8Z A;  1JJG A;  5FLX c;  2HDM A;  3TME A;  2NTS A;  2ZXR A;  1P8L A;  5C4J B;  4WJW A;  3S14 H;  5C4Z A;  5GAE C;  3DMU A;  1VMP A;  2N3S A;  3PUY A;  1KRT A;  5DAU A;  5IOD A;  3JAM E;  1E7Z A;  1EQV A;  3KJO A;  2F0W A;  2L1B A;  2Z8L A;  4F88 A;  5I9O A;  4Q5V A;  3ULJ A;  2Q2H A;  3EQL C;  2MO0 A;  1XPU A;  3S1R H;  1L1O B;  3G7L A;  1NR2 A;  2A74 C;  4PG3 A;  1HNZ L;  1A0I A;  1PA6 A;  1N9W A;  3CCE A;  4DR1 L;  4B3S L;  1PYS B;  1VF7 A;  3FPP A;  3K5O A;  2MUY A;  4PZ8 A;  1U9R A;  2HCC A;  1SNQ A;  3PIP 3;  1A8V A;  4L5S A;  1JE5 A;  4ZQ3 A;  1BVS A;  5J3B A;  1S5B D;  3CC4 A;  2HDL A;  3T51 B;  3LWE A;  4O42 A;  1J5E Q;  5M3F H;  4XYQ A;  2BOS A;  1T9H A;  2AKW B;  2KHS A;  1YHQ A;  1B9N A;  1N32 Q;  4DR4 Q;  3Q6S A;  2AWN A;  1UEA B;  3S17 B;  3I72 A;  2WP8 J;  3GQB A;  2WII B;  3E6Z X;  1RJT A;  5EBC A;  2L15 A;  2DJF C;  5EJW A;  4V19 0;  1L0W A;  1TWC B;  3MAQ A;  4K5V A;  4YY3 L;  2UUB Q;  4A3L G;  1GUG A;  1M1K C;  4GN4 B;  3U4V A;  1IHZ A;  2QKI C;  2EY1 A;  1EYG A;  4XXE A;  2B2U C;  2AUK A;  1DOL A;  3DWQ A;  4IPD A;  4HMJ A;  2JA6 G;  1HTP A;  5M5Y B;  3GTP B;  2V4D A;  1O7Z A;  3HGB A;  5AJ3 Q;  3PGZ A;  3MVV A;  5HUR A;  3QOL A;  3VYT A;  2Z6K A;  4C56 C;  4CKE A;  4HR7 B;  1B8A A;  5CBA E;  2RHS B;  5C0X J;  2F3V A;  1YIJ A;  1VQH A;  3MHB A;  3ONA B;  1ASY A;  4RAU C;  3S2D B;  2HD3 A;  3BZC A;  4ILW A;  1IBK L;  2NN6 H;  1HFN A;  4JI2 Q;  1QNU A;  3G71 A;  5LHY 1;  4A3K B;  5M3M H;  5I2X A;  1HZB A;  1HZC A;  2PCF B;  4H02 A;  2A6E C;  2B2T A;  3GTK B;  1U4R A;  3E0E A;  2XIW A;  2N49 A;  2RDH A;  3NE5 B;  1TT2 A;  1EL0 A;  4BY7 G;  2A73 B;  2ZXO A;  2DNE A;  2Z6K C;  3MA2 B;  2IJ0 A;  1TWA B;  1Y1V H;  4PQX A;  3KUP A;  4A3D B;  3IFD A;  3U9O A;  3NQT A;  2RA4 A;  1BBW A;  3JAM L;  1EQR A;  1TWG B;  3G6J B;  3L2P A;  4HJ9 A;  4LF9 Q;  3G4S A;  1SJE D;  1TWF B;  2SOB A;  2E74 C;  5IGD A;  2F0L A;  3C2P A;  4UP9 A;  5C4X B;  5FK9 C;  3I4M B;  5C3E B;  2RVL A;  2K14 A;  1PZK D;  1D5X C;  2EY2 A;  1C8C A;  3A5Z B;  2KEN A;  2I0Q A;  4FVM A;  1K3R A;  4KKU A;  5IYB H;  1LT5 D;  1LYL A;  2YTV A;  4OO1 H;  4BS9 A;  4HJ5 A;  4UY8 C;  4A93 G;  4EQO A;  2PPB C;  1GD7 A;  3J80 c;  1D2B A;  3L0O A;  2ES2 A;  4A3G G;  3O13 A;  1EU4 A;  2RDF A;  4QB4 A;  4DUZ L;  3KF6 B;  1EWH A;  1R4Q B;  2N55 A;  4OGQ C;  2JA5 G;  4I65 A;  1C9O A;  4L5Q A;  1YVC A;  2HIX A;  2F0E A;  2BDO A;  1TKW B;  4OEM B;  1Y1W B;  4KHP L;  1V43 A;  3H91 A;  2JQO A;  4LUV A;  1CSQ A;  4DV3 L;  4B3T L;  4JBM A;  3F2D A;  1A3V A;  2G9D A;  3K81 C;  2G5D A;  1EYC A;  2NTT A;  2VXW A;  4K6L A;  1FVI A;  4HED A;  3Q23 A;  2NVX H;  3TDQ A;  5J1Z A;  3UDI A;  2EDG A;  3IRB A;  4IPC A;  2EZV A;  3FMC A;  3NUC A;  5CGK A;  3H3V H;  2A69 C;  1K8A C;  2F0H A;  1SLJ A;  2IY5 B;  1ESR A;  3ND9 A;  5BN3 A;  2R3Z A;  1NSN S;  1F9R A;  1QUQ B;  3HKS A;  1XPO A;  4CJ0 B;  4G7H C;  1VQC A;  2K5H A;  1MGS A;  1IZ6 A;  3AYH B;  2ENB A;  2GVB A;  2PQE A;  3HG9 A;  2RSO A;  2ASB A;  4IPH A;  1CZG A;  1W6K A;  1OXS C;  3CPF A;  4A3L H;  3LNN A;  3FP9 A;  5HGQ A;  1Q1B A;  4GNX B;  1PXU A;  2F4V Q;  1CHQ D;  2VQE L;  1U4L A;  3H6M A;  4R4C A;  2AQ3 B;  1QVF A;  4Y7N H;  2JA6 H;  4GOP B;  1FR3 A;  1PH3 A;  2NWG A;  4GLX A;  1SE2 A;  1VCI A;  1M8A A;  2Y0S B;  2JEA I;  5IGE A;  1PFS A;  3CD6 A;  1E2V A;  4HJ7 A;  1O7Y A;  4PZ6 A;  1SND A;  4HSV A;  1GUT A;  1QVC A;  1S5C D;  1CT1 D;  3FVQ A;  4JOI A;  4DN4 M;  4NXN L;  4OWT B;  1ET9 A;  5BR8 Q;  2LSS A;  2Q8R E;  3D3R A;  3MC0 B;  4LJZ C;  4DU9 A;  3SHL A;  3PMF A;  4DKA C;  2F3I A;  4JI0 Q;  1YNN D;  1BXT A;  2E5L Q;  2B8F A;  3B6Y A;  1HRJ A;  3RZO B;  4I7Z C;  2XRS D;  4BY7 H;  4J1M A;  2E2H H;  2ZTC A;  4LFB Q;  1KAW A;  4NW2 A;  3H0G B;  3I2Z A;  1Q81 C;  4CGY B;  1MBY A;  3W1G A;  5LL6 X;  2PQA A;  5GAD C;  2QGQ A;  2Q8I B;  4AQY L;  1DJR D;  1PTO H;  2DN8 A;  1VQG A;  1DCZ A;  3TP6 A;  5CV4 A;  4DR2 Q;  1XNQ Q;  1NNX A;  5C0X G;  4RFB A;  1MD2 D;  2J4X A;  3IKJ A;  2K50 A;  3NEN A;  2JK8 A;  4RGN A;  4OON A;  1STA A;  4A3K G;  2FIN B;  1J5E L;  3RD4 A;  3F2U A;  1MI2 A;  2BA1 A;  3KDF A;  3QO2 A;  4A3G H;  1PFM A;  2MO1 A;  2RCF A;  2XNA C;  1N32 L;  1S4Z A;  2PW5 A;  3ERQ A;  5FLX E;  2ID0 A;  2TMP A;  3WWV A;  4XT3 B;  4KN7 C;  2I07 B;  5ELE A;  2JA5 H;  3DUZ A;  3J80 i;  4A3D G;  3X3M A;  4LF8 Q;  1IL8 A;  1NBW A;  3E9I A;  1SRO A;  3SE0 A;  3SK5 A;  1PZJ D;  4JK1 C;  5NUC A;  5C4X G;  3CCM A;  2IHE A;  5C3E G;  3I4M G;  2M00 A;  1CKN B;  1WTQ A;  3RZD B;  4RCN A;  5AJ3 L;  5EKL A;  2BCO A;  3D4W A;  3DLL A;  1PZI D;  2MNA A;  1VQA A;  3QJY A;  2LXK A;  5GAH C;  4X66 Q;  3SDZ A;  5FO7 B;  1Y69 U;  2JA8 B;  2WB1 B;  1X3G A;  2Z6B A;  3G48 A;  2QEJ C;  2VQF Q;  2OQK A;  4FF2 A;  1G29 1;  2R7F A;  2K05 A;  1I4R A;  2KEE A;  4M1U B;  2MHV A;  5C4J H;  3KF8 B;  1OXX K;  1Y1W G;  3BU2 A;  1NMF A;  1QG7 A;  1PDQ A;  1ICW A;  1PRT C;  1I3Q B;  1VQB A;  5CV7 A;  1ONL A;  4UDU C;  4KLK A;  1Y8N B;  2EYJ A;  3RMH A;  1RIP A;  4POG A;  1SNM A;  1STN A;  1HJP A;  1HNX L;  4QIW E;  2EQS A;  2F0D A;  1FNV A;  4DV4 Q;  4OHJ A;  3PQI A;  1VQI A;  4DV2 Q;  3S1M B;  4FYD A;  3E3X A;  3D4R A;  5E7N A;  1I5F A;  1YJW A;  5CV9 A;  2F03 A;  1PV4 A;  3OYY A;  2RDG A;  1FD7 D;  1DON A;  2VS1 A;  1U4M A;  2X69 A;  3S17 H;  2BE5 C;  1A15 A;  2AUJ D;  3F2B A;  5IYC G;  1TWC H;  2A6E D;  1DOK A;  1EEF D;  4KHZ A;  1H9S B;  4YWM A;  2XN9 C;  4AH6 A;  3K8A A;  3PO3 B;  1I6V C;  2HQE A;  5JJZ A;  1JWS D;  5FLX L;  2WB1 E;  4GLV B;  3OMC A;  5M5Y H;  3K6O A;  3GTP H;  1G51 A;  3U9S A;  1UE7 A;  4ID6 A;  1BNZ A;  2GN5 A;  2Y0S G;  3PIO 3;  4A3M B;  4JC0 A;  1KHI A;  2P5Z X;  3QWN A;  1IBM L;  1U4P A;  1RD9 D;  3N6R A;  2PNH A;  3T16 A;  1SYE A;  3PV0 A;  1CUK A;  1PH9 A;  1RF2 D;  4H7B A;  5EPJ A;  3I56 A;  1YJN A;  1WFQ A;  1E22 A;  3PIP A;  1VQ9 A;  1SE8 A;  3D6C A;  4K8I A;  3TSS A;  1Q3L A;  4X3S A;  1STH A;  4B9W A;  5C0X H;  1WD1 A;  3S2D H;  3EJI A;  2L9H A;  1D5M C;  4R4O A;  1R9T B;  2R93 B;  4EX5 A;  2WAC A;  1X3F A;  3J80 E;  2VW9 A;  4QY7 A;  1KD1 C;  1PTO C;  1HCZ A;  4A3K H;  4G7O C;  3CCS A;  3TQY A;  1RTN A;  3D4D A;  4C3I B;  2KA7 A;  2O4X A;  1GUS A;  2A5H A;  3GTK H;  1KXL A;  3MEH A;  1SFO B;  3BVM A;  2RF4 A;  3AU7 A;  4H13 C;  3H0G G;  1TWA H;  2AMC B;  4A3D H;  4KI0 A;  4DGZ A;  4LNQ A;  4P2C B;  4KKT A;  3D0F A;  1YI2 A;  1EIH A;  2E76 C;  1TWG H;  1TWH B;  3J7A 5;  1C4Q A;  4CDF C;  1TWF H;  5M5X B;  1SAP A;  5C4X H;  3BYT B;  4AIM A;  3R3O A;  3I4M H;  5C3E H;  1JQY D;  3J7A F;  3DM3 A;  2UXC Q;  2VB2 X;  5BN5 A;  2K1B A;  1AZP A;  2O2L D;  2V1C C;  2O5J C;  1E1O A;  4HIK A;  4L6T B;  1OXT A;  1NJI C;  5K36 G;  2KBN A;  5M9O A;  4A3E B;  1Q8K A;  3EFX D;  2GVA A;  1QIL A;  1Z7T A;  2GA4 B;  4LFA Q;  4DR7 L;  4GN5 A;  1KL9 A;  4WJ3 M;  1Y1W H;  5BR8 L;  3K59 A;  3GTJ B;  2OXP A;  1VQM A;  1AW7 A;  4NPS A;  4HMI A;  1HZ9 A;  1RKN A;  3GTG B;  3LGJ A;  1BOS A;  1FNW A;  4JBK A;  4JV5 Q;  1LTB D;  1DGS A;  2K7V A;  4E6I A;  3K58 A;  2ATW A;  2OTJ A;  1LT6 D;  2F52 A;  2RHQ B;  4P74 A;  2JSO A;  4K2L A;  3J7Y W;  5DM6 3;  5DEH A;  2EY5 A;  1EZ8 A;  2ZTE A;  2MGS A;  4FNF A;  1EU3 A;  4QUC A;  4PMW A;  4L5R C;  3HFZ B;  1FL0 A;  1LUZ A;  1EY0 A;  1NCV A;  4LF7 Q;  1JOK A;  2JA8 G;  1K83 B;  2WB1 G;  1XNQ L;  1L1O C;  1V1P A;  4K5W A;  3EBE A;  4A3I B;  4DV6 L;  1VQL A;  2EYM A;  3HOZ B;  1I94 Q;  1FYC A;  1WTH A;  1SSO A;  2XWB B;  4K5X A;  1I4H A;  4LW1 A;  5IIF A;  3I73 A;  3BJU A;  1EWI A;  2F3W A;  1EY7 A;  5IYC H;  3J80 L;  5M5W B;  4A3C G;  4ALP A;  5I6Y A;  5E1F A;  1B70 B;  2L4N A;  1II3 A;  3MXU A;  5ELF A;  5CYU A;  3Q8D A;  1YZ6 A;  4O2D A;  4JG2 A;  1WTR A;  4PMB A;  2VUM B;  2NVT B;  3K5L A;  4J6H A;  1SNO A;  1Y14 B;  3GTO B;  1EY6 A;  3MXN A;  4ZKB B;  4QF4 A;  4OL7 A;  2MJ8 A;  2DNC A;  4HCE A;  1G2S A;  2NBF A;  2B2U A;  1E3P A;  4IUV A;  3I7F A;  1TII D;  5CMD A;  4KY7 A;  3ER0 A;  1NY4 A;  4OXP A;  1HR0 Q;  3A7L A;  2RQX A;  4JBW A;  1H9K A;  4MTK A;  4BWG B;  3DEO A;  3EN2 A;  3NPP A;  1FNU A;  3MEF A;  2EYH A;  1ILP A;  1QCB D;  3GV6 A;  1N36 Q;  4APV A;  2VQF L;  2KHI A;  4C1N I;  3PO3 G;  4JYA Q;  1A62 A;  2KCM A;  1RCV D;  5I4D A;  1IYU A;  1STG A;  3RZO H;  2MPM A;  1U0L A;  4A3M G;  4YIJ A;  1U5K A;  4DV0 Q;  1BO0 A;  5E3F A;  4MHE A;  3W5O A;  3H0G H;  5GAG C;  4A3J B;  1A3T A;  1GHK A;  2N88 A;  3R93 A;  2QEX A;  1VQP A;  4G7Z C;  3EIV A;  2A6H C;  2WKC A;  2EYP A;  1SNP A;  3HRZ C;  4KJN A;  1OTC A;  1AE3 A;  4BBS B;  5IT9 c;  1F2L A;  2YTX A;  3AQQ A;  4YWL A;  3STB C;  3GTQ B;  2R93 G;  1VQO A;  4A3B B;  3PO2 B;  2CCZ A;  4Z9C B;  1T5X D;  3P1H A;  2FFK B;  4QMG A;  1H9M A;  5JJI A;  1F2Y A;  3TRE A;  4DV2 L;  1HHV A;  4P73 A;  4R4Q A;  4C3I G;  2C5C A;  2EY6 A;  3GO5 A;  5EGT A;  5K36 H;  1XNR L;  2R92 B;  2VZA A;  5FLM G;  2ZJP A;  3AMU A;  2F0F A;  1WTP A;  2PNR C;  4CKB A;  3BZK A;  3F2C A;  1LTA D;  2JE6 I;  1ZXT A;  4ZRZ A;  1E2Z A;  3W2D A;  1GUW A;  2UXB Q;  1HXY D;  4CDE C;  1MJE A;  4DV1 Q;  4ZYS A;  4JBJ A;  3RZD H;  1PYW D;  3J81 j;  2Q2I A;  4F8M A;  1IYV A;  4F7X A;  4WJ4 A;  1TU2 B;  2PYK A;  3HOY H;  3WOE A;  4IPG A;  3OHX C;  1N34 L;  3S15 B;  1BBU A;  3PUV A;  4V0B A;  4ZAI A;  2JA8 H;  5C3X A;  5C5L A;  1B4O A;  2EOT A;  2UXD L;  2BE5 D;  4A3E G;  1N33 Q;  4DR6 Q;  2ICI A;  2IX0 A;  3TP7 A;  5D65 A;  1ESF A;  3ZYY X;  2CW0 D;  4LF6 Q;  3NK9 A;  4HID A;  2NZO A;  5KEE A;  3CC7 A;  1F2Z A;  2CKZ B;  1B9M A;  4A3C H;  3RNU A;  3NP8 A;  2F0U A;  1I3Q H;  3CF5 A;  4DUY Q;  3QR8 A;  3T56 B;  4KY5 A;  4QUF A;  3OIP A;  3HKZ B;  1Q46 A;  1X6O A;  1ML0 D;  2EYO A;  4DR3 Q;  1SR3 A;  4N9P A;  3FKI B;  4CDC C;  2EJM A;  4BA1 I;  1Q86 C;  2QDB A;  2PMZ B;  1F9S A;  4OX9 Q;  3BVZ A;  3CCJ A;  1BDO A;  3S1M H;  1SN8 A;  4A3I G;  2LY7 A;  5FOB B;  4GOP C;  3MFG A;  3HOZ G;  2SDF A;  5I2Y A;  1W6J A;  5EAY A;  3J7Z C;  3C1E A;  2VL6 A;  4KN4 C;  1B50 A;  1J9O A;  3BG3 A;  3GP7 A;  5KNB A;  2A8V A;  5COR A;  1VQF A;  3E9H A;  3PF5 A;  3CCQ A;  1X9N A;  4DAY A;  4B3M L;  5CC4 A;  3PO3 H;  1STB A;  3T1H Q;  2HIV A;  1RHP A;  4JPB W;  3QG1 A;  3M9B A;  1F9P A;  2WKD A;  2B2W C;  4LFA L;  2VUM G;  4N9T A;  5FO8 B;  3BVG A;  3U50 C;  1B44 D;  4A3M H;  5CBE E;  1WI5 A;  4X3K A;  1K9M C;  3EVQ A;  2OT2 A;  1FGU A;  4JV5 L;  4RGM A;  4ZKC B;  4OIK A;  4WRD A;  3C3L A;  3K0X A;  4GKJ L;  1KDB A;  4XT1 B;  5KYL A;  2K03 A;  1HNW Q;  4MZ9 A;  1HZA A;  3GD7 A;  1R9T H;  2R93 H;  4JI1 Q;  3OWE B;  2A68 C;  2SNM A;  4LF7 L;  4UPA A;  2X6G A;  1BCP C;  4DAV A;  1IKM A;  1C48 A;  2B2V A;  4C3I H;  3M7N A;  1A6X A;  1I94 L;  2H4O A;  3S2H B;  5FLM H;  1SFO H;  1ENF A;  4ABN A;  3V96 A;  2ZM6 Q;  3RN5 A;  3S1N B;  3NEM A;  5CR3 A;  4A3J G;  4OIJ A;  1AZQ A;  2Q2U A;  3S24 A;  2PZT A;  2IX1 A;  1CTM A;  2O5I C;  1SMX A;  4Q0F A;  3R2T A;  4NXM Q;  1TWH H;  2B63 B;  2I5L X;  5IWA Q;  1Q8I A;  5M5X H;  1EYA A;  4BBS G;  2F0N A;  2IT1 A;  1K8M A;  3P75 A;  3URY A;  4HTH A;  2E2I B;  5LMN Q;  1JCK B;  4L8J A;  5EQ0 A;  4A3B G;  1OXU A;  4QJF A;  4PZ7 A;  3UE0 A;  1CZW A;  3PO2 G;  3DHQ A;  1DXM A;  3GTM B;  4ME3 A;  3NBH A;  1D5Z C;  2PO4 A;  5E4X A;  3AB9 A;  5T1I A;  4HJA A;  2JEB I;  4LF4 Q;  3FDT A;  2B2V C;  1PRT F;  4BY1 B;  2XWJ B;  4FO2 A;  3I4L A;  1VQ7 A;  2R92 G;  4A3E H;  2Z9H A;  5T1G A;  3CRK C;  3LX0 A;  1UE6 A;  2CQA A;  2JJQ A;  4DV7 Q;  4A75 A;  1KDC A;  4N8F A;  2Y0S E;  4A93 H;  1C0A A;  2E75 C;  4K0K Q;  1LTR D;  4C3J B;  2PZU A;  4NB3 A;  5FKA C;  3GTJ H;  1VQJ A;  1N36 L;  1X3P A;  1EWC A;  2F0K A;  4DR4 L;  3H09 A;  3GTG H;  1EY5 A;  3PUZ A;  3I91 A;  4P75 A;  4JYA L;  3CXC A;  4LK1 C;  5KIX A;  2B2Y A;  1NUC A;  3NWS A;  5JAV A;  1Z6H A;  4X64 Q;  2UUB L;  3OWF A;  1EQT A;  3ITP A;  1H9R A;  4KK7 A;  4B9X A;  1JWU D;  4LF5 Q;  1YHA A;  1B7Y B;  2K4K A;  3SGI A;  1JIC A;  5D3I B;  4K6D A;  2Z4I A;  1K83 H;  4DAM A;  4HIO A;  1QOH A;  1SYC A;  2I46 A;  4R9W A;  2SEB D;  4A3I H;  2K52 A;  4HJ8 A;  3TP8 A;  3HOZ H;  3ND8 A;  4CJ2 C;  4KY6 A;  4RGT A;  1NR4 A;  4LAA A;  4ME5 A;  1EFI D;  1FJG Q;  1LTS D;  4NP5 A;  4R8N A;  3TBI B;  4ODG A;  2QW7 A;  1XMQ Q;  1W2B A;  1HA5 A;  2HT1 A;  2RSN A;  5H1S E;  5M5W H;  4GN3 B;  3K7U C;  4RHR A;  4DR1 Q;  4B3S Q;  2BH8 A;  4RG1 A;  4JI2 L;  1UWV A;  2B2Y C;  1WJJ A;  2WAQ B;  1LTI D;  5JPM C;  3H3V C;  5IYD G;  3HKZ G;  4TQU S;  1XTC D;  4FXG C;  1PH6 A;  3PUX A;  1VQK A;  2NVT H;  3KBG A;  2VUM H;  2D0O A;  3WDN A;  4FF1 A;  4WOR A;  3GTO H;  3FKI G;  2LXJ A;  5TSS A;  2UXB L;  3ZJY C;  1GJX A;  1X32 A;  1E24 A;  2L0C A;  4IFD I;  5HGT A;  3KYH C;  4Y52 H;  3GV3 A;  4RWS C;  2EVB A;  1SRU A;  3UE1 A;  4DA2 A;  5IT9 E;  2PQA B;  4L63 B;  3VA7 A;  4LF9 L;  1G6P A;  3NQI A;  3L9A X;  1EEI D;  4DNI A;  3MTS A;  2WV6 D;  1N33 L;  2JA7 B;  3NTK A;  1J6Q A;  1HUN A;  5DNF A;  2HQL A;  4LF6 L;  1M4V A;  3KDF B;  1V8Q A;  3OSO A;  4I7A A;  1ENA A;  5A35 A;  3F8T A;  1ASZ A;  4XQJ A;  1Y8O B;  5KRU A;  4A3J H;  1Q1E A;  4DNR B;  4IOA A;  1IBK Q;  1BBX C;  3HOV B;  4KD4 A;  4R4T A;  1EUJ A;  2K5D A;  3EA6 A;  3J81 c;  2QF7 A;  1CI3 M;  1S3O A;  4BBS H;  2OF1 A;  1DD2 A;  5KGU A;  5IOC A;  2PI2 E;  4RKL A;  4IJL A;  5ELO A;  2WFW A;  4DR3 L;  4EQN A;  3GTQ H;  4A3B H;  2D9U A;  2DY7 A;  4HIM A;  3PO2 H;  2ALY B;  4LFC Q;  1X65 A;  1IYJ B;  2FMM A;  2K5Q A;  2DGY A;  3NBI A;  4LMQ D;  3NWT A;  1PHJ A;  1MSH A;  1B3A A;  1V1Q A;  3SXH A;  1KNE A;  3LWU A;  2ICE C;  3SR1 A;  2R92 H;  1SNC A;  1I4G A;  4J15 A;  2R6G A;  4AYB B;  3I4N B;  3HOW B;  1EY9 A;  1GM5 A;  4XIG S;  5LL6 S;  3I55 A;  1I50 B;  2VB3 X;  4JI4 Q;  1HQR D;  3IAY A;  1OXV A;  5A2Q E;  1STY A;  2B8G A;  3OW7 A;  1JR0 D;  2KQ3 A;  1QVG A;  3UDG A;  1YNJ C;  4FP5 D;  3V2T A;  1S5E D;  4A3F B;  2B63 G;  1EYD A;  4RH6 A;  2WIN B;  4BBR B;  3CQZ B;  5D14 A;  2LMC B;  1I4X A;  1EIY B;  4B08 A;  4YCW A;  3NEL A;  3NXW A;  4RMF A;  1YBY A;  1EFW A;  2UUC Q;  2BDN A;  2F4V L;  4DUZ Q;  3NHH A;  2K6A A;  1AE2 A;  1GO3 E;  4JI6 Q;  1AH9 A;  4YHH Q;  3AFP A;  1R4P B;  3S15 H;  1K28 A;  2F0S A;  1VDZ A;  4YWK A;  2A69 D;  2NUC A;  2E8G A;  1DYQ A;  3MXG A;  4BY1 G;  2K33 A;  1PH7 A;  1SJH D;  1KAB A;  2FXQ A;  3CHB D;  1TY0 A;  1HNW L;  2AQ1 B;  1KNA A;  4KHP Q;  1JWM D;  2YTY A;  4CDD C;  1XPR A;  4KV6 A;  1QZG A;  2ZJQ A;  1H9J A;  4ZK9 B;  4B3T Q;  4JI1 L;  3P20 A;  2JN4 A;  4DK6 C;  3UDF A;  4C3J G;  4EQP A;  1D7Q A;  4LUO A;  1L1O A;  1LLR D;  5JEA G;  3SVM A;  1Q7Y C;  1CKM A;  3ICE A;  3IFT A;  4S3S A;  2KJX A;  2IW3 A;  2KUM A;  3FHW A;  3HS0 C;  1KC8 C;  2ZM6 L;  5IYD H;  1KLG D;  4ZUI A;  1LAC A;  1JOR A;  3AEV A;  3FRP B;  4MN3 A;  2IPK D;  3VR4 A;  4JI0 L;  2R61 A;  2E5L L;  3FKI H;  4DR5 Q;  1G6Z A;  1WTO A;  2EXZ A;  1XJV A;  5L37 A;  4LFB L;  2OEO A;  3T53 B;  1LM0 A;  3M4O B;  4X62 Q;  3GTL B;  1JMC A;  1TS4 A;  4JW0 A;  3T4A C;  5LMN L;  3C1F A;  2L55 A;  3HEJ A;  4KHV A;  1G8Z D;  1BCP D;  4C3H B;  1YIT A;  4DR2 L;  1SYB A;  3A8J E;  3S16 B;  4B3R Q;  1WCM B;  1B1Z A;  1S5F D;  4NMZ A;  5KYI A;  2VNU D;  4LF4 L;  4TSS A;  2QDL A;  5I9P A;  1LT3 D;  1S40 A;  3DEP A;  2WAQ G;  3TZU A;  4M8A A;  2A19 A;  1VQD A;  2X6L A;  2CWA A;  2R7D A;  3M4Y A;  2F0M A;  3D31 A;  4HSP A;  3E5S A;  4PV1 C;  4KKS A;  3VYS A;  2YV5 A;  1RTO A;  1Z9F A;  3A8I E;  3HOX B;  4H44 C;  1KAA A;  3MZ5 A;  4HCS A;  1HUM A;  3M4Q A;  5A2Q L;  4A4I A;  3HOU B;  3ERS X;  3QIA A;  3IL8 A;  1Q12 A;  1G2T A;  3TN2 A;  1F9Q A;  4JI5 Q;  4NXN Q;  4IAL A;  1RDP D;  3OPO A;  4X64 L;  2AWO A;  2XTI A;  4LF8 L;  5CV8 A;  3BZD B;  2CFM A;  3VDY A;  5BN4 A;  3KBX A;  4LF5 L;  2XSC A;  3KK7 A;  3H94 A;  3F1Z A;  3QB3 A;  4KD3 A;  2K75 A;  1JJC B;  4BA2 I;  1BR9 A;  3A56 A;  1KRS A;  1YNX A;  4IUT A;  1JT8 A;  4K8J A;  5JPN C;  3TEH B;  3J81 i;  1GUO A;  4XQN A;  1VMC A;  2JA7 G;  3MWY W;  2EPB A;  3T13 A;  1E0B A;  2AHO B;  1L0X B;  3HZX A;  3VR6 A;  2F0P A;  1IW7 C;  2J0T D;  2K5W A;  3K7A B;  1FJG L;  4P71 A;  3S2H H;  4X66 L;  3CCU A;  3OIQ A;  4YCU A;  5CV5 A;  3OTO Q;  4AQY Q;  3I4O A;  1XMQ L;  2EYF A;  1UE5 A;  2XRQ D;  2Z4H A;  5DM7 3;  3S1N H;  4N8X 1;  4QQB X;  2C9O A;  3BDC A;  1D8L A;  3HOV G;  3PF4 A;  2M2L A;  1XMO Q;  5EKI A;  4LUZ A;  1ZEQ X;  4RGO S;  1K0R A;  4DPG A;  2OWO A;  2B63 H;  2HHH Q;  3OW2 A;  4R4I A;  3T1Y Q;  4IQZ A;  3DM1 A;  1RL2 A;  1JB7 A;  2E2I H;  3M85 A;  5EPK A;  2NVQ B;  3RR5 A;  2OTL A;  1SYD A;  3GTM H;  2F0J A;  3A74 A;  4DK0 A;  4IJH A;  4PNY A;  3KF6 A;  3Q0A A;  2D2C C;  4X65 Q;  4BY1 H;  1H95 A;  1K0S A;  2NYZ D;  3DXJ C;  1JJ2 A;  4AYB G;  3I4N G;  1K73 C;  3HOW G;  1SE4 A;  3OOC A;  4DV4 L;  4WFN 3;  4C2M B;  1V1P B;  1ROD A;  1ET6 A;  1UNS A;  2F0Q A;  3ERO A;  4C3J H;  4IUN A;  5C4H A;  4XYO A;  1NE3 A;  2KOL A;  4LWC A;  1T5E A;  5JEA H;  4DXF A;  4A3F G;  2F4I A;  5ELN A;  4O1N A;  4BBR G;  4X3U A;  4UHV A;  2I5H A;  2RCN A;  2K5V A;  1A3U A;  3R2I A;  1SMY C;  2C35 B;  1W3S A;  1PRT D;  3TS0 A;  2ZTD A;  4FXK C;  3CW2 C;  4HAE A;  3RN2 A;  1UUP A;  1AFP A;  3U4Z A;  4IN3 A;  1I4P A;  2ZT9 C;  1QUQ A;  2YU9 B;  1DZ1 A;  3P7J A;  1YEZ A;  4JI7 Q;  5EKK A;  3MXN B;  2EIF A;  1V9P A;  2KVM A;  2F0T A;  3U58 A;  3G6E A;  3L3O C;  3CCR A;  4IUU A;  1GVP A;  1JE4 A;  2K28 A;  1ENC A;  1TS5 A;  1X55 A;  1TXY A;  4LFC L;  5CV6 A;  4GNX A;  2EXD A;  1GOZ A;  4L5T A;  5E4W C;  4JI3 Q;  2L12 A;  4GLA C;  4GOP A;  1N8R C;  2KCN A;  4QL5 A;  1XWE A;  1HNX Q;  1PLF A;  2L5T A;  4IZ8 A;  2HUG A;  3RLF A;  1P16 A;  1Q82 C;  4ZLT F;  2B29 A;  4UP8 A;  4JI4 L;  1SYG A;  3KLS X;  1GUN A;  3I3C A;  4CHT B;  5IGC A;  3D6W A;  1BCP F;  5IGB A;  3J81 E;  1CFM A;  1S5D D;  2B2W A;  4JVZ A;  3QOJ A;  4UAI A;  3Q24 A;  1A63 A;  1LO5 D;  3A8K E;  2F0O A;  2UUC L;  1CA6 A;  2UU9 Q;  1QZH A;  4RHS A;  2B2T C;  4C3H G;  5C44 B;  3GDE A;  2QCP X;  1HQM C;  4JI6 L;  1WCM G;  4GNX C;  4YHH L;  1K8O A;  2FJ2 A;  1WTW A;  2IL8 A;  3PSI A;  2H1E A;  1IXR A;  1ZYR C;  2Z0S A;  3S1Q B;  4QCL A;  2UXC L;  1ZKO A;  2NZ1 D;  1IBM Q;  1PTO D;  2JA7 H;  5C5M A;  2CQO A;  2NVY B;  4DAP A;  1F2M A;  1NAP A;  1O78 A;  2KEC A;  2UUA Q;  3E0J A;  3DWP A;  1HTL D;  4DF7 A;  2FHT A;  1YNJ D;  4GKK Q;  1STE A;  1TQO A;  1VQ5 A;  3HOX G;  2E2J B;  3HOU G;  1UEB A;  1C7Y A;  3HOV H;  3CCL A;  3M3Y B;  3VR5 A;  1I6H B;  3SK6 A;  2B39 A;  4DV5 Q;  2XGT A;  4JCV E;  4C1N K;  3MXP A;  1WTX A;  4DR5 L;  1QWY A;  4QGU A;  1V1O A;  3CAM A;  5D3D A;  3VR2 A;  4IFD J;  4DXG A;  2RBM A;  3BDO A;  3WOF A;  5LMN W;  4K14 A;  2R7Z B;  1LV9 A;  3TS2 A;  4J8Q A;  1OO9 B;  5AFW A;  4X62 L;  4XQQ A;  2LS0 1;  2K5N A;  3ULL A;  3HOW H;  3HKZ E;  3R8B A;  3I4N H;  1LT4 D;  2KCC A;  5DLQ E;  1PH2 A;  4B3R L;  1I50 H;  2Q8T A;  5JVG 3;  3SEB A;  3S14 B;  4BXX G;  2F0I A;  2PMZ E;  5C3W A;  1CKN A;  5IY0 A;  4A3F H;  3K57 A;  1KLU D;  5ELB A;  2NZH A;  4BBR H;  3CQZ H;  5JJL A;  2OQ0 A;  5LMU Q;  1PVO A;  1XXG A;  3S1R B;  4XDX A;  5KNC A;  2DY8 A;  5C0X I;  3A5U A;  2K01 A;  5JVH 3;  1PH8 A;  3JC6 6;  4IUP A;  4TRD A;  3PIO A;  3D8G A;  1XTD A;  2OCE A;  2LFN A;  1LTT D;  1HH2 P;  4GS3 A;  2G9H D;  1TR5 A;  2SNS A;  1K8G A;  4JI5 L;  4FXD A;  2PI2 A;  1O80 A;  4DR7 Q;  3J81 L;  5M3F B;  3KF8 A;  4MTN A;  3KOJ A;  1JOQ A;  2JA9 A;  3A7A B;  3CCV A;  2PZW A;  1MJC A;  2N78 A;  1M90 C;  4JI8 Q;  4U67 3;  2K32 A;  3W1B A; 
#chains in the Genus database with same CATH homology
 1EQR A;  3L2P A;  4HJ9 A;  4LF9 Q;  1EUJ A;  4LW1 A;  2MQH A;  3G4S A;  3J81 c;  3BJU A;  4UP9 A;  1EWI A;  1S3O A;  4BBS H;  5IYC H;  4A3C G;  2PI2 E;  4ALP A;  4IJL A;  5ELO A;  2K14 A;  2WFW A;  1HR0 L;  1IBL Q;  2I0Q A;  3A5Z B;  2KEN A;  4DR3 L;  1K3R A;  1B70 B;  3GTQ H;  5IYB H;  3JAM c;  4A3B H;  4HIM A;  3Q8D A;  1LYL A;  3PO2 H;  2ALY B;  2YTV A;  2DUD A;  5JEA J;  3OTO L;  4LFC Q;  4HJ5 A;  1YZ6 A;  4UY8 C;  1X65 A;  4JG2 A;  3M4P A;  4O2D A;  4A93 G;  1IYJ B;  1KQS A;  1GD7 A;  2DGY A;  3J80 c;  4DAY B;  3L0O A;  1PHJ A;  2ES2 A;  4A3G G;  1V1Q A;  1NMG A;  1Y14 B;  4DUZ L;  4O0A A;  4DV6 Q;  4UP7 A;  2R92 H;  4J15 A;  2R6G A;  1XMO L;  4JOI C;  3KF6 B;  1GM5 A;  4XIG S;  3L7Z C;  5FJ8 G;  1IL2 A;  3I55 A;  2HHH L;  1E3P A;  2JA5 G;  1C9O A;  4L5Q A;  3I7F A;  1YVC A;  2HIX A;  4JI4 Q;  4DV0 L;  1OXV A;  3M4O H;  3GTL H;  3T1Y L;  3ER0 A;  4KHP L;  1V43 A;  1VQN A;  1NY4 A;  2CWP A;  2JQO A;  4LUV A;  4OXP A;  1CSQ A;  3UDG A;  4DV3 L;  1QVG A;  1HR0 Q;  4B3T L;  4JBM A;  4JBW A;  3F2D A;  4C3H H;  2B63 G;  3K81 C;  5IP9 G;  3S16 H;  1WCM H;  3EN2 A;  3MEF A;  1FVI A;  1EIY B;  1N36 Q;  4X65 L;  4YCW A;  3NEL A;  4RMF A;  2NVX H;  4APV A;  1YBY A;  2A1A A;  3UDI A;  2VQF L;  3IRB A;  1EFW A;  4IPC A;  2UUC Q;  1CSP A;  2KHI A;  2F4V L;  4DUZ Q;  3PO3 G;  3H3V H;  4JYA Q;  1A62 A;  1AE2 A;  1GO3 E;  1K8A C;  2KCM A;  1SLJ A;  4JI6 Q;  1VQ6 A;  2IY5 B;  1AH9 A;  4YHH Q;  3AFP A;  3RZO H;  3S15 H;  1U0L A;  1HNZ Q;  4YWK A;  4A3M G;  2E8G A;  4BY1 G;  1PH5 A;  1PH7 A;  1U5K A;  2FXQ A;  1QUQ B;  3HKS A;  4DV0 Q;  1XPO A;  3W5O A;  1HNW L;  4IOC A;  3H0G H;  1VQC A;  2K5H A;  5GAG C;  1IZ6 A;  4KHP Q;  3HOX H;  2YTY A;  3AYH B;  1XPR A;  2ZJQ A;  1QZG A;  3HOU H;  2GVB A;  4X6A H;  4B3T Q;  4JI1 L;  2QEX A;  1VQP A;  4DK6 C;  3UDF A;  3EIV A;  2H5X A;  2ASB A;  2QA4 A;  4IPH A;  1D7Q A;  1PYB A;  1OTC A;  1AE3 A;  4LUO A;  4MNO A;  1L2F A;  5IT9 c;  1L1O A;  1OXS C;  5JEA G;  1Q7Y C;  3CPF A;  1CKM A;  3RLO A;  5C44 G;  2YTX A;  4A3L H;  3FP9 A;  3AQQ A;  4YWL A;  3STB C;  4IO9 A;  2R93 G;  5HGQ A;  1VQO A;  1Q1B A;  3ICE A;  4GNX B;  2F4V Q;  2VQE L;  4DV1 L;  4R4C A;  3FHW A;  1QVF A;  3STB D;  4Y7N H;  1KC8 C;  2CCZ A;  4JI7 L;  2JA6 H;  2ZM6 L;  5IYD H;  4GOP B;  3KJP A;  1X56 A;  1PH3 A;  5JJI A;  3TRE A;  4DV2 L;  4GLX A;  4P73 A;  4YY3 Q;  4R4Q A;  3AEV A;  1VCI A;  3GO5 A;  1PH4 A;  2JEA I;  4JI0 L;  2E5L L;  1XNR L;  1PFS A;  3FKI H;  3NBH B;  4DR5 Q;  3CD6 A;  2VZA A;  3K7A H;  5FLM G;  2ZJP A;  2D62 A;  5IP7 G;  4HJ7 A;  1XJV A;  4PZ6 A;  3CP0 A;  3BZK A;  3F2C A;  4LFB L;  2JE6 I;  1LM0 A;  4BXX H;  1EOV A;  4X62 Q;  4DR6 L;  1JMC A;  4JI3 L;  5LMN L;  1QVC A;  2UXB Q;  4JOI A;  1NTG A;  4NXN L;  4OWT B;  2ZJR A;  4DR2 L;  4DV1 Q;  1YIT A;  1MJE A;  4B3R Q;  3KLW A;  2VNU D;  3CMA A;  4LF4 L;  5BR8 Q;  2LSS A;  4JBJ A;  3RZD H;  3J81 j;  2Q2I A;  3H15 A;  4WJ4 A;  2KCT A;  1S40 A;  2WAQ G;  4DKA C;  5HY6 A;  2F3I A;  4JI0 Q;  2A19 A;  2E5L Q;  1VQD A;  4DUY L;  2CWA A;  2R7D A;  1XNR Q;  2NVQ H;  3HOY H;  3D31 A;  3UDX A;  3B6Y A;  4IPG A;  2R7Z G;  1N34 L;  1BBU A;  3PUV A;  2R7Z H;  4BY7 H;  4IFD G;  2E2H H;  2JA8 H;  1LTL A;  2WAQ E;  2ZTC A;  4LFB Q;  1KAW A;  2UXD L;  2YV5 A;  1Z9F A;  4A3E G;  3I2Z A;  5GRO A;  3ULP A;  1UE1 A;  2IX0 A;  1Q81 C;  2UU9 L;  5GAD C;  1N33 Q;  3W1G A;  2PQA A;  2QGQ A;  3M4Q A;  4A4I A;  4JI8 Q;  4C2M H;  3ERS X;  4AQY L;  1Q12 A;  1VQG A;  4LF6 Q;  4OX9 L;  4HID A;  4DR2 Q;  4FDB A;  4JI5 Q;  4NXN Q;  1XNQ Q;  2NZO A;  4X64 L;  3CC7 A;  2AWO A;  2XTI A;  4LF8 L;  2CKZ B;  5C0X G;  4A3C H;  2CFM A;  1EIF A;  3VDY A;  3RNU A;  2K50 A;  1YJ9 A;  4LF5 L;  3NEN A;  2JK8 A;  1I3Q H;  3CF5 A;  4DUY Q;  3F1Z A;  1O7I A;  2UUA L;  2K75 A;  3TRZ A;  1JJC B;  4OON A;  4BA2 I;  1KRS A;  1YNX A;  1N34 Q;  1JT8 A;  4A3K G;  4GKK L;  3TEH B;  3J81 i;  1J5E L;  1Q46 A;  3KDF A;  1X6O A;  2BA1 A;  2JA7 G;  4A3G H;  2UXD Q;  2AHO B;  4DR3 Q;  2MO1 A;  1VQ8 A;  1SR3 A;  1N32 L;  3T1H L;  2YU9 H;  2ID0 A;  1FJG L;  3WWV A;  4P71 A;  4BA1 I;  4X66 L;  3JAM i;  1Q86 C;  3CCU A;  3S2H H;  4YCU A;  3OTO Q;  4POF A;  4AQY Q;  1WOC A;  3I4O A;  5FJ8 H;  4DV5 L;  1XMQ L;  1UE5 A;  4OX9 Q;  2JA5 H;  3CCJ A;  5M3F G;  2NN6 I;  3PUW A;  3S1M H;  3S1N H;  1SN8 A;  4A3I G;  3J80 i;  4A3D G;  1KIX A;  4QQB X;  1EQQ A;  4GOP C;  4LF8 Q;  1NBW A;  2BA0 A;  3HOZ G;  1D8L A;  3E9I A;  4P72 A;  1SRO A;  3HOV G;  3PF4 A;  1XMO Q;  4LUZ A;  1K0R A;  1BKB A;  5EAY A;  4OWX B;  4DPG A;  3J7Z C;  2VL6 A;  3CME A;  2OWO A;  2B63 H;  3KFU A;  4TVA B;  2HHH Q;  5C4X G;  5IP9 H;  3CCM A;  1Z47 A;  3OW2 A;  1VQ4 A;  2IHE A;  5C3E G;  3I4M G;  4R4I A;  1CKO A;  1CKN B;  2N8N A;  2A8V A;  1VQF A;  3T1Y Q;  3E9H A;  1VQE A;  5AJ3 L;  3CCQ A;  1RL2 A;  3PF5 A;  1JB7 A;  4R1J A;  2E2I H;  3M85 A;  1X9N A;  4DV3 Q;  3DLL A;  4B3M L;  3PO3 H;  2MNA A;  1VQA A;  2MFI A;  1MIU A;  3RR5 A;  2HIV A;  2LXK A;  3T1H Q;  2OTL A;  3M9B A;  2Q2T A;  3GTM H;  3A74 A;  5GAH C;  4X66 Q;  1PH1 A;  4IJH A;  4LFA L;  2VUM G;  2B3G A;  3KF6 A;  3U50 C;  4A3M H;  1WI5 A;  1X3G A;  4X65 Q;  4BY1 H;  3G48 A;  1H95 A;  2VQF Q;  2OQK A;  1JJ2 A;  1G29 1;  4AYB G;  1K9M C;  1K73 C;  2R7F A;  3HOW G;  3I4N G;  4DV4 L;  1FGU A;  4JV5 L;  5IE8 A;  4DK3 C;  3KF8 B;  5C4J H;  5LMU L;  1WYD A;  1OXX K;  1Y1W G;  3K0X A;  4C3J H;  4OWW B;  4GKJ L;  3BU2 A;  4AYB E;  1NE3 A;  1HNW Q;  4LWC A;  2NN6 G;  1NMF A;  4MZ9 A;  4OO1 I;  4A3F G;  5C44 H;  1HZA A;  5ELN A;  4NXM L;  3GD7 A;  1R9T H;  1YHB A;  4BBR G;  2R93 H;  1VQB A;  5IWA L;  2D0P A;  4JI1 Q;  4B3M Q;  2I5H A;  2RCN A;  2K5V A;  4KLK A;  2C35 B;  4LF7 L;  1W3S A;  3TS0 A;  2ZTD A;  4UPA A;  2VY3 A;  5M3M G;  1RIP A;  2IHF A;  3CW2 C;  3RN2 A;  4POG A;  3S1Q H;  1HJP A;  1X54 A;  3U4Z A;  1S72 A;  4C3I H;  1HNX L;  3M7N A;  2NVY H;  2YYZ A;  3CPW A;  4QIW E;  2EQS A;  1QUQ A;  1I94 L;  4JI8 L;  2VQE Q;  5FLM H;  4DV4 Q;  1SFO H;  1YEZ A;  5IP7 H;  1HR0 W;  4JI7 Q;  1MKH A;  2ZM6 Q;  4EQ5 A;  3MXN B;  2EIF A;  1VQI A;  4GKJ Q;  4DV2 Q;  1V9P A;  3NEM A;  3RN5 A;  4A3J G;  1Y1V G;  3U58 A;  3G6E A;  3CCR A;  4A76 A;  5E7N A;  2E2J H;  3S24 A;  1I5F A;  1GVP A;  1YJW A;  1IBL L;  2Q2U A;  2IX1 A;  3CC2 A;  1PV4 A;  1SMX A;  3OYY A;  4DV7 L;  3HOY G;  4NXM Q;  3M3Y H;  2VS1 A;  2KHJ A;  1TWH H;  1I6H H;  4K0K L;  1X55 A;  2I5L X;  5IWA Q;  1TXY A;  3S17 H;  4LFC L;  1E1T A;  5M5X H;  5JJK A;  3F2B A;  4GNX A;  5IYC G;  4BBS G;  1GKH A;  1TWC H;  2IT1 A;  2EXD A;  4KHZ A;  3H3V I;  4L5T A;  4YWM A;  4JI3 Q;  4GLA C;  4GOP A;  1X3E A;  4AH6 A;  5IYB G;  5LMN Q;  2BH2 A;  1N8R C;  4A3B G;  4QL5 A;  1HNX Q;  3K8A A;  1OXU A;  4QJF A;  4PZ7 A;  4XTC S;  3UE0 A;  2I5M X;  3K80 C;  3RLF A;  3PO2 G;  4OO1 G;  1P16 A;  1Q82 C;  2WB1 E;  4GLV B;  4ME3 A;  5M5Y H;  2B29 A;  4UP8 A;  1G51 A;  4HJA A;  2JEB I;  3AFQ A;  4JI4 L;  4LF4 Q;  1UE7 A;  3GTP H;  2GN5 A;  2Y0S G;  4JC0 A;  1KHI A;  5GQO A;  1IBM L;  3PCO B;  1VQ7 A;  2R92 G;  2PNH A;  3PV0 A;  1CUK A;  4A3E H;  1PH9 A;  4YCV A;  1VS0 A;  1UE6 A;  3A0J A;  3RLN A;  3I56 A;  2JJQ A;  4DV7 Q;  4A75 A;  5FLX c;  1YJN A;  1WFQ A;  1JJG A;  1E22 A;  1P8L A;  2Y0S E;  3PIP A;  1VQ9 A;  4A93 H;  4K0K Q;  1SE8 A;  1C0A A;  3S14 H;  4NB3 A;  5GAE C;  3GTJ H;  1KRT A;  1VQJ A;  2N3S A;  3PUY A;  1N36 L;  3S2D H;  1A63 A;  2UU9 Q;  4DR4 L;  2UUC L;  3GTG H;  1E7Z A;  3PUZ A;  3KJO A;  1QZH A;  4P75 A;  4R4O A;  3CXC A;  3ULJ A;  3GDE A;  4JYA L;  2Q2H A;  4JI6 L;  4EX5 A;  1WCM G;  4GNX C;  2MO0 A;  1XPU A;  4YHH L;  3S1R H;  1L1O B;  1X3F A;  4PG3 A;  2VW9 A;  1A0I A;  1HNZ L;  3PSI A;  4QY7 A;  4X64 Q;  1PA6 A;  1KD1 C;  1N9W A;  3CCE A;  4A3K H;  2UUB L;  1IXR A;  3CCS A;  3TQY A;  4DR1 L;  1PYS B;  2Z0S A;  4B3S L;  2UXC L;  4PZ8 A;  1IBM Q;  2JA7 H;  1A8V A;  4LF5 Q;  2CQO A;  1YHA A;  1JE5 A;  4L5S A;  1B7Y B;  3GTK H;  2K4K A;  1KXL A;  3SGI A;  1BVS A;  2UUA Q;  5J3B A;  3CC4 A;  1K83 H;  2RF4 A;  4GKK Q;  4DAM A;  4DR6 Q;  4HIO A;  1J5E Q;  5M3F H;  3H0G G;  1T9H A;  1TWA H;  4A3I H;  2AMC B;  3HOX G;  1VQ5 A;  4KI0 A;  2AKW B;  2K52 A;  4HJ8 A;  1YHQ A;  4A3D H;  4LNQ A;  3HOZ H;  1N32 Q;  3HOU G;  1UEB A;  1C7Y A;  3D0F A;  1YI2 A;  3CCL A;  3HOV H;  4DR4 Q;  1FJG Q;  1TWG H;  2AWN A;  3J7A 5;  1XMQ Q;  2WP8 J;  1TWF H;  4DV5 Q;  1W2B A;  2XGT A;  5C4X H;  2L15 A;  4JCV E;  2HT1 A;  4AIM A;  1L0W A;  5H1S E;  4GN3 B;  5M5W H;  5C3E H;  4YY3 L;  2UUB Q;  3I4M H;  3K7U C;  4A3L G;  4DR1 Q;  1M1K C;  4B3S Q;  2BH8 A;  4GN4 B;  3DM3 A;  4RG1 A;  3U4V A;  4JI2 L;  1UWV A;  2UXC Q;  4DR5 L;  4QGU A;  1EYG A;  1WJJ A;  3CAM A;  2V1C C;  4IFD J;  4IPD A;  2JA6 G;  5IYD G;  3HKZ G;  4TQU S;  5LMN W;  1PH6 A;  3PUX A;  1VQK A;  2NVT H;  2VUM H;  3W1B A;  2D0O A;  3TS2 A;  1E1O A;  4HIK A;  5AJ3 Q;  3PGZ A;  4X62 L;  3GTO H;  1OXT A;  1NJI C;  5K36 G;  3FKI G;  2LXJ A;  2KBN A;  2Z6K A;  2K5N A;  3ULL A;  3HOW H;  3HKZ E;  3I4N H;  2UXB L;  1Q8K A;  1B8A A;  3ZJY C;  5DLQ E;  1E24 A;  2RHS B;  2GVA A;  1PH2 A;  4IFD I;  4B3R L;  3KYH C;  1I50 H;  4LFA Q;  5C0X J;  4DR7 L;  4Y52 H;  4GN5 A;  1SRU A;  3UE1 A;  1KL9 A;  1YIJ A;  1VQH A;  1Y1W H;  4BXX G;  5BR8 L;  4WJ3 M;  2PQA B;  1VQM A;  1ASY A;  4NPS A;  3BZC A;  2PMZ E;  1HZ9 A;  1IBK L;  1CKN A;  5IY0 A;  3LGJ A;  4JI2 Q;  4A3F H;  4JBK A;  2NZH A;  4LF9 L;  4JV5 Q;  1G6P A;  4BBR H;  1DGS A;  3CQZ H;  5JJL A;  2OQ0 A;  3G71 A;  5LMU Q;  1PVO A;  2ATW A;  2OTJ A;  5C0X I;  2F52 A;  2RHQ B;  3A5U A;  4P74 A;  1PH8 A;  4DNI A;  3JC6 6;  5M3M H;  1HZB A;  1HZC A;  3PIO A;  1N33 L;  1XTD A;  2OCE A;  1J6Q A;  1HH2 P;  2ZTE A;  4H02 A;  4PMW A;  4GS3 A;  4L5R C;  3E0E A;  2N49 A;  1FL0 A;  3HFZ B;  1LUZ A;  2HQL A;  4LF6 L;  4BY7 G;  4LF7 Q;  3KDF B;  1K8G A;  2JA8 G;  2WB1 G;  4JI5 L;  2PI2 A;  1XNQ L;  4DR7 Q;  3F8T A;  1L1O C;  1ASZ A;  2Z6K C;  4MTN A;  4A3J H;  1Q1E A;  1Y1V H;  3EBE A;  3KOJ A;  4DV6 L;  1VQL A;  2JA9 A;  3CCV A;  1MJC A;  2N78 A;  1M90 C;  1IBK Q;  4IOA A;  1I94 Q;  1BBW A;  4R4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...