1NNXA

Structure of the hypothetical protein ygiw from e. coli.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
93
Chain Sequence
QGGFSGPSGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein ygiW
publication title Structure of the hypothetical protein ygiW from E. coli.
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 19
structure length 93
sequence length 106
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04076 BOF Bacterial OB fold (BOF) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.200 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Bacterial OB-fold 1nnxA00
1NNXA
chains in the Genus database with same CATH superfamily
2KHSA 5M5WH 3HOWH 1TWFH 1TWAH 4ODGA 1G291 1Q12A 2FJ2A 2UUBQ 4QQBX 2PYKA 5FKAC 3OYYA 3BJUA 2AUJD 3DLLA 3HFZB 4JK1C 3RD4A 4CKBA 5K36G 1IYJB 4R8IA 1EOVA 3NTKA 1N34Q 1STGA 4LF5Q 4MTKA 3SR1A 4L5QA 5CMDA 3OOCA 3I4NH 1EQQA 3P7JA 1V1PB 1LACA 2B2TC 1UE1A 4CDDC 1UNSA 2RQXA 4X3KA 4QJFA 2PQAA 3T51B 1I4HA 2KHJA 4G7ZC 4RHRA 4DK0A 3VA7A 4LUOA 4HJ8A 2F4VL 2JA6G 1AW7A 2L5TA 1SNPA 1KABA 1WTWA 2SNSA 3CXCA 1BBUA 4TQUS 5C5MA 3M3YH 4IN3A 4KLKA 2PW5A 2PI2E 1ML0D 1EQVA 5IGDA 4C2MH 2GVAA 4WJ4A 4DK3C 3H94A 4FDBA 4RGMA 3H09A 4CJ0B 4GN5A 3MHBA 1SN8A 2D2CC 3CAMA 1YHBA 1BVSA 3IAYA 2R92H 3PO2B 3HGBA 4KN7C 4RCOA 3OW2A 3PO3B 1H9JA 1M8AA 2L15A 1V1PA 1PV4A 3K8AA 1PZKD 2Y0SG 4OWXB 1JORA 5E1FA 2X69A 4OIJA 3MXGA 2Q8IB 2LSSA 2CH4A 3A7AB 3Q22A 1AZPA 3H0GB 4LF6Q 1LTSD 2NYZD 3S2DB 4ZYSA 4N9TA 5EKIA 1ICWA 1A3TA 2YYZA 4AYBB 3SDZA 5JEAJ 4OGQC 1VQ9A 1L0YB 5JPMC 1UE7A 2EXZA 4ID6A 3K5LA 2O2LD 4LF4L 1A0IA 1AP0A 1CSQA 1RL2A 2F0UA 1Z47A 4J15A 5ELBA 2KJXA 2M00A 2QA4A 1X54A 4IOCA 3G48A 1MBYA 4OHJA 5LMUQ 4C3JG 3H15A 2OF1A 1A8VA 1L0XB 2ENBA 3TQYA 2Z4HA 5KYIA 1KLGD 2VNUD 4BY1B 2F1MA 1YJ9A 4GKKL 1HTPA 4RGTA 1WD0A 3QWNA 1JC7A 4NB3A 4K2KA 5I9PA 1EOTA 1Q82C 4DV6L 3L9AX 4K8IA 3KFUA 3BU2A 4DAYB 4MIUA 4DV7Q 1LO5D 3LNNA 5C44B 4KK7A 4UDUC 1VQCA 1QVGA 4OXPA 1EL0A 3ICEA 3CHBD 5KGUA 3T1HL 4N8X1 3J7ZC 3IRBA 1HZCA 3SVMA 1JWSD 3GTLB 4DUYL 3W2DA 2KOLA 2RCFA 2QF7A 4DXGA 1AN8A 4EGVA 2Q8RE 3S15B 5IT9E 1CM9A 4P73A 5I2XA 3L2PA 1IBML 3K80C 4A3MG 3IFDA 1PRTB 4IZ8A 1BCPF 5C4XB 1CKOA 2R7ZB 2KEEA 1CI3M 1HTLD 3VYRA 2AWOA 2A6EC 1Y8NB 2MPMA 2A6HC 1PHJA 2L55A 1I6VC 5FLXL 2OT2A 4N8FA 5IGCA 3CCVA 4DAYA 3KF6B 4R4QA 4X64L 3OIQA 4HIMA 4LF4Q 5H1SE 3K5MA 2A8VA 2JA7H 3G71A 4CJ1B 1K83B 3A8IE 1E2ZA 1TR5A 2HDMA 4X66L 4A3CH 4NMZA 1T9HA 1SR3A 1QWYA 4L6TB 3J7A5 4FF1A 2BE5D 1CFMA 4XIGS 2J7ZA 1HXYD 3GP7A 4IJHA 4ZKBB 2E2IH 4UPAA 3DHQA 4A3DH 4ZQ3A 2N55A 1QG7A 5LHY1 1XXGA 1EWIA 3J80L 2K1BA 3HOZB 2IL8A 5JAVA 1STHA 2QW7A 1YNXA 1W6KA 1EFWA 4UP9A 2KCTA 2G9HD 5D14A 2F03A 1HQRD 4BY7H 4O0AA 3OWFA 4L63B 4A3BG 1JOOA 3GQBA 4KY5A 1B50A 1B3QA 1WTXA 5FK9C 3RLNA 3GO5A 3I56A 1W6JA 3STBD 3CCMA 1Q7YC 1N33L 1GHJA 3A74A 3PV0A 1J5EQ 1QVFA 4OL7A 4ZCKA 3O13A 4A3JG 2IHFA 5J3BA 4LK1C 4IFDH 5C3EB 4K5WA 4Q5VA 4FNFA 1Y69U 3Q8DA 1HZAA 1E7ZA 1Y1WH 1TQOA 2UUCL 4FXGC 4IOAA 4IFDJ 2LXJA 4WFN3 5G3LD 2F0GA 2RHSB 4XDXA 3EROA 2K50A 3OTOQ 2VQFL 3MXUA 1WYDA 3FKIG 3Q23A 4C3IB 5C4JH 2AUKA 2N49A 4X66Q 1U5KA 2J0TD 1N9WA 3KLWA 4YWLA 2R93H 2KCMA 1SRUA 4KJOA 3J81L 1PH9A 3HOVG 4NP5A 3VR5A 2ZJPA 4HJ9A 1N32L 3FRPB 3Q6SA 4JI0L 1RKNA 1SEBD 1YZ6A 2PMZE 3C46A 3KOJA 4P72A 1K73C 5JJKA 4A3KB 4F87A 3MFGA 1C9OA 3DXJC 1M90C 1QNUA 5IGFA 2E74C 1IKLA 4B3RQ 3HOWG 1GUOA 4RKLA 2Z1CA 1J9OA 2YTVA 5LL6S 1S5CD 2RSOA 5M3MH 3E9HA 2QDBA 1KD1C 1SYFA 1G51A 3H91A 4GNXB 5EAYA 1KAWA 4DV3Q 4KMUC 4QIWB 2UUAL 4LFAL 1E1OA 1HR0W 4LF8Q 4HIDA 3J7AV 4MZ9A 3FEWX 4XQQA 3I4NG 3HOXB 3I8ZA 3RMHA 3CCEA 2AQ2B 1Q8IA 4RG1A 4I7ZC 1GVPA 1VMPA 3DEPA 4X65Q 2UUCQ 3CP0A 4R9WA 3AFPA 1Q81C 3GTOH 2KQ3A 4XT1B 2ZTCA 3A0JA 1S5FD 1LM0A 3KF8A 4N9PA 5CV5A 3AMUA 2CHBD 3HP3A 2A69C 5GAGC 2NWGA 3MC0B 3K57A 1QZGA 2A74C 3KUPA 1HUMA 4CDCC 1ICFB 5I6WA 4QB4A 4GNXA 2XRQD 3ND9A 1TWGB 1PH8A 1KDBA 4YHHL 2F0VA 2CW0D 5FOBB 1TU2B 3UDFA 2R92G 2DJFC 3S1MB 4A93B 2YU9H 3MA2B 2M2LA 5IP9H 1R4PB 3RZOH 1G6ZA 3CCJA 1EU3A 1IBKL 4ZUJA 3GTPH 1D6EC 3LX0A 4ME3A 5EQ0A 1TY0A 1JE4A 2F0HA 1BBWA 4ME5A 3GTKH 4CDEC 3ULLA 4JI7L 2JP1A 5C4ZA 3D4DA 1WTPA 3E0EA 1LT4D 2FXQA 3Q0AA 2ASBA 2N88A 2NVQB 1K28A 2EVBA 2PNHA 1WCMH 2WKDA 1PTOD 1XTCD 3W1GA 1RTOA 1CZWA 3VA5A 4A3GB 2OTLA 5E4WC 3PUZA 3ERSX 1HNZQ 2E2JH 2KECA 2NVYB 1LLRD 4QL5A 1VF7A 2EYOA 1VQBA 1LABA 1RJTA 2QKIC 3BZCA 2BA1A 3EVQA 2NTSA 3TP8A 3QG1A 5FO9B 3FPUB 1SJED 3LWUA 2JA5H 1QNKA 2F3WA 3CQZH 3NBIA 3BS1A 2B2UA 1NUCA 3RUZA 2F4IA 3RR5A 1SBBB 2EPBA 2AQ3B 3D8GA 1NE3A 2ICEC 1HJPA 4IURA 5KRUA 1T5XD 3U9OA 3RZDB 2I07B 1EIFA 3A8KE 1F2YA 1CUKA 2X6LA 5FJ8H 5JJZA 2UXCL 1HZ9A 1FNVA 2MO0A 5GADC 1X56A 3CU7A 1BO0A 4I65A 4KD3A 2CWAA 4X3UA 4JI5L 1ZKOA 1SXTA 1EZ8A 2Z0SA 1I4RA 3W1BA 5IGEA 1NBWA 5IWAQ 1IBLL 1N36Q 2FMCA 1FL0A 5T1GA 5BN5A 3Q24A 1SNCA 1WTHA 2OWOA 2TSSA 1X3PA 3UDGA 4YCVA 1HR0Q 1S4ZA 1UEAB 4PQXA 5FO7B 1B1ZA 2L9HA 4B3SL 3C3LA 4IPCA 1NMFA 3PUVA 3BDLA 4HJ5A 3GTMH 3GD7A 1R9TH 2UU9L 2PQEA 3GTGB 3A55A 1PTOH 2JA7G 2B63B 3S1NB 1WTVA 2NN6H 2VY3A 4S3SA 5CYUA 4R4IA 4A3CG 1CSPA 3MWYW 1ASZA 4F8MA 3ZYYX 1LTBD 1HFNA 2H1EA 2MUYA 1I6HH 3NEMA 3RN5A 1FJGQ 5ISRA 5D3IB 1EWHA 4DV1Q 1IL2A 4A3DG 1B44D 1BQQT 4PMCA 1I3QB 4R8NA 4DR4L 1GO3E 1OO9B 1VQGA 4WJWA 3BYTB 1PYWD 1S3OA 3R2TA 4GN4B 4IPGA 3K7AB 4KY7A 1XNQL 1RD9D 1KRTA 4XT3B 3CCLA 3KLSA 5FLMH 4A3FB 1O78A 3H3VH 4BY7G 1LT6D 4QMGA 3N6RA 1HFGA 4DUZL 4LF7Q 1XX8A 2QGQA 1KXLA 3RNUA 5ELEA 1KNAA 3ZJYC 1HNXL 4A3IH 5M5XH 1F9RA 2QILA 3FMCA 4MHEA 2CVRA 1RDPD 4IFDG 3CPFA 2ZM6L 4XQNA 3V96A 2YTYA 4A3LH 1VQ8A 4KV6A 4DV0L 4RGNA 1Y1WG 1GOZA 5GAEC 1OXSC 3QOLA 3J7AF 3SE0A 2LMCB 1Y1VG 4YY3Q 5JJIA 3NQIA 1NSNS 3GV6A 1WVLA 1F9QA 1STAA 1DXMA 1PH3A 2JA6B 2UU9Q 5AJ3L 3CD6A 4P74A 1TS2A 2CFMA 3TP6A 1UE6A 4UP8A 2C5CA 4K0KQ 1E1TA 4P2CB 3J80i 1F9PA 3VYSA 4GKJQ 4JI1Q 1BOSA 3E5SA 5BN3A 1LTGD 3I3CA 2F0OA 1DGSA 4NXMQ 1SFOH 5E7NA 3LWEA 1LTID 4ZK9B 1AH9A 4JI4L 4OEMB 4K6DA 2VW9A 1A3UA 4JBKA 1JJCB 4Y7NB 2DNCA 2Y0SB 3T13A 2L11A 2MGSA 4POFA 2XSCA 2BOSA 4DR5Q 3GTQB 5M3MG 2PCFB 2Q2IA 4DUZQ 5IIFA 1IYUA 4H44C 5KNDA 1Z6HA 1PZID 4BBRH 1H9SB 1VDZA 5C3WA 1TKWB 1QUQB 1ZEQX 1KC8C 1PH7A 4CBVA 2O5JC 4OX9L 4R4CA 2PZWA 2A6ED 3NWTA 2A6HD 4J6HA 2F0SA 3CC7A 2YTXA 1B7YB 4DGZA 1O7LA 4X62Q 1STEA 2N8NA 1T5EA 1YNJC 1DOLA 5I2YA 5EBCA 2D0PA 4HSPA 2K7VA 2KA7A 5IOCA 2XN9C 1PTOF 3S16H 3CW2C 1TWCH 4QUCA 5DM63 4NXNQ 5D65A 4H13C 1XWEA 1UUPA 3SK5A 3U9SA 3S1RH 3DWQA 1U9RA 4I7AA 3J81i 4AQYL 1PRTC 3CKIB 2QCPX 1ASYA 3FVQA 5GAHC 3UE0A 1NJIC 3EA6A 2F0MA 1TWHB 3CC2A 1VQLA 5DM73 1H9SA 1S5BD 4LFBQ 1K3BC 2D0OA 4R1JA 4G4KA 3SK4A 3AU7A 1QUQA 4AYBE 2GVBA 1PVOA 5A2QE 2UXBL 4XQJA 4LWCA 4JYAQ 5IP9G 1MD2D 4GZYC 5LMNL 4ZAIA 3KBXA 2VUMH 5EBDA 2EY1A 5BR8Q 1U0LA 2AWNA 1VQJA 3NTIA 1I5FA 4KI0A 1MGSA 3R8BA 2HQLA 4A3EH 4Q0FA 3NQTA 4RH6A 4ABNA 5JEAH 4OIKA 2QEXA 2JA9A 2N78A 2LXKA 4IUQA 1TS4A 2K5NA 4A3MB 1Z7TA 2RSNA 2PPBC 2M9VA 2RDFA 2XWBB 2B2YA 4KN4C 3M4OB 1WCMG 1ONLA 3UDIA 2KVMA 1HQMC 1GUNA 2HT1A 1HHVA 5EPLA 4FXDA 3VR4A 1XPUA 1EQRA 2LY7A 4BS9A 3I4MB 4IFDI 1GUWA 3NK9A 3HZXA 1TS3A 2D9UA 4HJ7A 1ZXTA 2VQEL 4TKOB 2F4VQ 2EY5A 3S17B 5CV9A 2Z8LA 1KLUD 1U4PA 4O2DA 4DR2L 2JA5G 1JWMD 1TS5A 2WKCA 1IZ6A 5M5YH 1D5ZC 4B3ML 1G6PA 1BF4A 5IY0A 3ULJA 3D3RA 2EJGC 1DOMA 1YITA 3A56A 4IALA 1SMYC 2UXBQ 1SSOA 1Q1BA 2EDGA 4JC0A 4A3BB 5FJ8G 3SK6A 4V0BA 2KUMA 4QF4A 5HGQA 1XPOA 2WB1E 5LMNQ 1HRJA 1I50B 1C7YA 1ZYRC 1EIHA 4KJNA 4V190 1E2VA 2Z4IA 2O5IC 4C1NI 1PFSA 2HIVA 2IHEA 4A3JB 2AQ1B 2F0TA 4JI8L 2OTJA 5EJWA 1F77A 3AYHB 5ELNA 1NY4A 1SMXA 1C4QA 3C2PA 4RMFA 1GM5A 3HOUH 1VQFA 1WJJA 4PMWA 1U4RA 2WAQB 3TZDA 3M4QA 3LGJA 3V2TA 2K33A 1FGUA 2NVTH 3QB3A 2L0CA 1LV9A 1JR0D 5CV8A 2JA8H 1VQEA 2NN6G 1SNQA 3FKIB 3UDXA 4GNXC 2ALYB 2A69D 3MXNB 3R2IA 3KYHC 3X3MA 1PDQA 2Q2UA 2ES2A 5ELCA 3M4PA 1HCZA 4X3TA 2SDFA 5EPKA 3U58A 5M3FB 4DU9A 1I94L 3KJOA 3HOVB 4GKKQ 2NZOA 2NZHA 1HA6A 1GJXA 3AFQA 2QEJC 3HOYH 4JVZA 2WFWA 3MAQA 4DV6Q 5FLMG 3SEBA 4F88A 1B9MA 2N3SA 4F7XA 1PA6A 3S2HB 2R7DA 2I46A 4DR7L 5M5WB 1IW7C 3HOWB 1TWFB 2TMPA 4MN3A 1EU4A 1TWAB 4PMBA 4RWSC 3CC4A 2F52A 3KF6A 4DF7A 3DM3A 3T1HQ 4FXKC 1OXUA 5I9OA 4A3IG 4DUYQ 2IW3A 1BCPB 1WFQA 4RKBA 2SNMA 2B2WA 2XTIA 3MXNA 2ZXOA 3CRLC 2G9DA 3M7GA 4CGYB 1VQHA 1IBMQ 1LTAD 4DN4M 4H02A 4A3LG 3I4NB 1SAPA 4JI8Q 2CH4W 5IODA 3NBHB 3NPPA 5CV7A 3RZDH 1TT2A 1CK1A 1DZ1A 1DYQA 2OEOA 1UEBA 1Y1VH 1STYA 4JI6L 1FVIA 2Q2HA 2EYLA 3D31A 4DK1A 4X64Q 4C3HH 3NP8A 3GTJH 2B2UC 4GLVB 3M3YB 2E5LL 2BH8A 1PFNA 2B29A 3J81j 1IXRA 4DFAA 4FF3A 3OWEB 4C2MB 5IYCH 4A76A 4FYDA 2WB1G 3W3AA 4KHPL 1ET9A 2BH2A 2XNAC 2IWHA 4JCVE 3A5ZB 2R92B 4C1NK 1YNNC 2K28A 4QIWE 1CKNB 3I4OA 1EY6A 3BZKA 3NBHA 1VQIA 4HCEA 5HURA 2EZVA 1XMOL 1EYCA 1LYLA 4AH6A 4O1NA 4B9WA 2K75A 3G6JB 1N8RC 4EQPA 3CMAA 3JAMc 1SE2A 1Q86C 4KTAA 2HHHL 1HNWL 3FDTA 1B8AA 4BBRG 2ZTEA 4CKEA 3S1QH 1HH2P 5KIXA 5DLQE 1D1KA 3BG3A 1PXUA 5E3FA 1N33Q 2MQHA 1LT5D 4EX5A 4DR3L 4JI2L 2NVXH 4KHVA 4H7BA 3FPPA 4IJLA 3WOEA 2A68C 2BCOA 1CZGA 3T53B 4CDFC 1ILQA 1K0SA 4IUUA 2PMZB 1PYSB 1E2WA 1Y8PB 2VQFQ 1A2UA 3HS0C 3TZUA 5C3EG 2ATWA 1UWVA 1KDCA 2NUCA 3OMGA 1YBYA 2RHQB 2NN6I 3NSWA 3M7NA 3E3XA 5CR3A 1TVXA 2IJ0A 1KRSA 4BBSH 2E2HH 5C0XH 2HDLA 2IY5B 3TS0A 4KHPQ 4BA2I 2EQSA 1N32Q 4JI0Q 2VUMG 5C0XJ 1IL8A 1G8ZD 3M9BA 3TP7A 2B2VA 1EIGA 2ICIA 3E6ZX 3WWVA 5A2QL 3IFTA 1XMOQ 3T1YL 4A3EG 5JEAG 3X3NA 3EJIA 2R3ZA 3TEHB 2L4NA 2MO1A 3H3VI 3M4YA 2EYFA 3D6WA 1PLFA 2JYOA 4H0LC 4E6IA 5F2DA 2FHTA 1WTQA 2ZXRA 1D2BA 4LFAQ 1OXTA 2UUAQ 4KD4A 1AZQA 3CCSA 2I0QA 2RBMA 4QGUA 4OO1H 1JE5A 3PQIA 1B3AA 4DA2A 2JA7B 5CV4A 3V05A 2F0JA 2Z6KA 4L5TA 1JICA 1ENFA 1VQ7A 2A1AA 3K59A 1ENCA 2K52A 3PIPA 4DNIA 3EBEA 2E2IB 4A3DB 4HIOA 4LW1A 2EY2A 1NMGA 3G6EA 1GKHA 4JI3L 1HUNA 2K5DA 2X6GA 4PZ8A 4R4TA 5IYDH 1EY9A 3NHHA 4G57A 4RGOS 3VYTA 3F1ZA 4DV2L 4BY7B 2FFKB 1MHWC 1BXTA 1SE3A 1TXYA 4YHHQ 2JN4A 1U4LA 1P16A 3NELA 1QCBD 3EN2A 4GS3A 1CTMA 2E2DC 5EKLA 1JB7A 2JJQA 4IPDA 1IBKQ 1X3GA 3G4SA 1KQSA 3JAME 3PSIA 3DUZA 1B70B 1VQNA 4GOPB 2K14A 4CKCA 1VQOA 1K3RA 4JI7Q 4GLXA 1M4VA 2H5XA 5DAUA 3HOUG 3PO2H 3FHWA 1DM0B 1Y1WB 2JQOA 3PO3H 2XVSA 2MNAA 1YNJD 4HCSA 4TVAB 5T1IA 1CQFA 3F8TA 4K5VA 4DV4L 2JA8G 1XMQL 4G7OC 4L5SA 4LF9L 3H0GH 1X55A 3QR8A 1U4MA 5G3LF 5C4JB 4DR6L 5J1ZA 3S2DH 1PRTD 3KBGA 2EYMA 3ND8A 4IQZA 3K58A 1LUZA 4K5XA 2R93B 3OHXC 1OXXK 1EUJA 1VQDA 3N52A 1MSHA 1EEID 1IHZA 4UHVA 5LL6X 3OPOA 1K8MA 2L12A 1JOQA 3D4RA 3VR3A 3K5NA 4B3TL 1CA6A 3HOYG 1EFID 4GOPA 3HKZB 3EQLC 1J8IA 4OWTB 3BDOA 4OWWB 3WOFA 2RDGA 5COYA 2E76C 3VYUA 3ER0A 1D5MC 3F2BA 2QDLA 5EGTA 4BY1H 5M3MB 2HCCA 1A3VA 2B2YC 5BN4A 4OELB 1CT1D 4ZRZA 5IYBH 2K4KA 5JPNC 2UXCQ 4R4OA 4BA1I 3F2DA 2B8FA 1I4QA 2A73B 2KHIA 4LFCL 4JI5Q 4HMJA 2JEBI 1IBLQ 1L0WA 1V43A 5C44H 4BXXH 4EVOA 1Q90A 4X3SA 1ESFA 4FP5D 1A63A 2B8GA 2UUBL 2XRSD 1C0AA 4L8JA 4ALPA 4UY8C 4B3SQ 3GTLH 3GTOB 5J22A 1EYGA 2EE1A 3ONAB 1YHAA 4XXEA 4JG2A 2IPKD 3S15H 1XMQQ 4C3HG 1BUVT 4PG3A 2K5VA 1O80A 3KDFB 1QJOA 5C4XH 4DK6C 2R7ZH 1NTGA 1GUTA 2Q8TA 5IYCG 5CBAE 3AQQA 1LTLA 1EY5A 2C35B 2EYPA 3NXWA 3SGIA 4LJZC 3U50C 1XYIA 1L1OB 2YU9B 4DR4Q 2VZAA 1K9MC 5IE8A 1SMYD 3RZOB 3D0FA 1K83H 4DNRB 3GTPB 1J6QA 1VMCA 1XNQQ 1VF5C 2NZ1D 5LMNW 1ZYRD 3GTKB 3BVMA 4XYQA 1JB3A 4LMQD 3OSOA 2FMMA 3L7ZC 2WINB 1HNXQ 4GN3B 5KNBA 2MJ8A 1VQ4A 3HOZH 2PQAB 1F2ZA 3FP9A 1D5XC 1FNUA 3MVVA 3VR2A 3L0OA 4FF4A 3F2UA 2B3GA 2IT1A 4LF6L 2GN5A 5IT9c 2ZM6Q 1YJNA 2IX0A 1QOHA 4KKUA 4YCUA 2CQAA 1WI5A 4DV0Q 1VQ5A 4JW0A 1L1OA 1Q1EA 1MSGA 1Q46A 1AEXA 4XYOA 2E2JB 1PH2A 1YI2A 3TBIB 1II3A 4C3JB 2HCIA 2MFIA 2R6GA 2VB3X 2KCCA 4UP7A 2PNRC 1PMRA 3TP5A 5AJ3Q 3OW7A 2JA5B 3WDNA 1VQPA 1S40A 3CQZB 5C3EH 1F2LA 1SYGA 4BBSG 2RVLA 4P71A 5LMUL 5C0XG 4BWGB 3K0YA 2NB0A 3PF5A 1W3SA 1WOCA 1IYVA 3PF4A 5E4XA 1EY4A 4OONA 5KEEA 4JI4Q 4LUVA 2F0LA 2AHOB 1IW7D 2B2WC 4CJ2C 4C3IH 2LS01 2YV5A 1F9SA 1DD2A 4POGA 1I4GA 4DV7L 3PIOA 3E9IA 1TY2A 2SOBA 4RAUC 1D7QA 4IUPA 1G91A 1UE5A 2JE6I 4ZKCB 4RHSA 2ZTDA 3MXPA 2H4OA 4A3KH 3DEOA 3P75A 3I70A 4OX9Q 1V9PA 1MJCA 4OO1G 3GTMB 2VL6A 1R9TB 1X9NA 1PTOB 2F0QA 1QE6A 1SROA 2EJFC 3MEHA 5DNFA 1BCPC 1EY7A 1WTRA 1O7ZA 2HQEA 1I6HB 2MP1A 4DR1L 3K0XA 1PRTF 1WD1A 2E8GA 1LTRD 1PH4A 1H95A 1E24A 4AQYQ 2ZT9C 3MTSA 4QCLA 1MIUA 5I4DA 1Y8OB 3HOXH 5L37A 1MKHA 2LKVA 4IO9A 2OQKA 3RN2A 2I5HA 5IYDG 3PCOB 1SE4A 4HR7B 1RODA 3VDYA 3K81C 3PUYA 1YNND 2JSOA 3J7YW 1VQKA 3QOJA 1CKMA 4NPSA 2DUDA 1YVCA 3TS2A 1B9NA 4X6AH 2GA4B 4YIJA 3CCQA 4RFBA 4NDXA 2WAQE 3QO2A 4C56C 1M1KC 2DJGC 1JMCA 2PI2A 4A3IB 5M5XB 3S14B 1V1OA 1BDOA 4DXFA 3B6YA 1TWGH 3TRZA 1V1QA 4YWMA 2VS1A 3A5UA 4IUNA 1EYAA 1V8QA 1NNXA 4L5RC 4DAVA 3PO2G 3S1MH 2EYJA 4A93H 3G7LA 3JAML 3PO3G 2R7FA 3HRZC 1EY8A 2A68D 1SNMA 1KHIA 1SDFA 1DOKA 4JOIA 4PZ6A 3T4AC 3EIVA 4J8QA 1MI2A 3H0GG 1J5EL 1CHPD 2RCNA 3I7FA 3H6MA 2F0IA 3HEJA 4KHZA 2K05A 3I72A 1DJRD 2WACA 4AYBG 3CCRA 1XPRA 3PIP3 1KTKA 1LT3D 4KKSA 5C5LA 4HJAA 1W2BA 2Q2TA 4RCNA 4G7HC 2HD3A 2IX3A 4DR1Q 1YHQA 1H9MA 4QY7A 2VQEQ 2WB1B 1VCIA 3R93A 1SFOB 3AEVA 2NVQH 3OTOL 5ELFA 4DR2Q 2B2VC 4B3MQ 4K14A 1HZBA 3W5OA 3I4MG 4A3GH 1Y14B 4EQOA 1JCKB 4U68A 5IP7H 1FD7D 2B2TA 2NVYH 4BY1G 2PW7A 5C0XI 1SLJA 5IYBG 4BBRB 3K7UC 5NUCA 3ERQA 1TIID 3TREA 4O42A 1XTDA 3JC66 3S9WA 3CMEA 1ENAA 4WJ3M 2K32A 5C44G 4BXXG 4B3RL 1PH5A 2Z6KC 3K6OA 2LFNA 2DGYA 4WRDA 2WP8J 3A7LA 2I5LX 3SXHA 3VR6A 2DN8A 1FNWA 3IKJA 4YWKA 2K6AA 2PO4A 4TRDA 2F3IA 4LUZA 3S16B 4DV3L 1OXVA 1TWCB 2G5DA 4PZ7A 3URYA 2CWPA 4IPHA 4DKAC 1FR3A 3S1RB 1KDAA 2CQOA 4LF8L 1RIPA 1JJ2A 4HTHA 1STBA 5C4XG 4OO1I 1EYDA 3U4ZA 1C48A 2R7ZG 5IGBA 2F0DA 4FF2A 4HIKA 1ESRA 2K5HA 3QIAA 1YIJA 3M85A 4X65L 2WAQG 4GLAC 1FYCA 3UI2A 1BNZA 2FINB 1G2SA 2XWJB 3NENA 1I94Q 1GUGA 1QZHA 1R4QB 2EIFA 4IUTA 1D8LA 5M9OA 3GTGH 1VQAA 2B63H 3S1NH 2VUMB 4ZUIA 3EFXD 3OMCA 5JVG3 4B08A 1IKMA 3RLOA 2BDOA 2JXMB 1EIYB 1XJVA 3ITPA 1XNRL 4A3EB 1F2MA 2DY8A 4DR7Q 3CF5A 5M3FG 3NE5B 3P1HA 4PNYA 1I3QH 4HEDA 1RCVD 4LAAA 3A8JE 3HOZG 2WIIB 2VB2X 4KKTA 2F0NA 2PZUA 2K03A 3TSSA 4A4IA 3K7AH 3C1EA 2RDHA 2SEBD 1YJWA 1S72A 3KF8B 2C9OA 4A3FH 2K5QA 4HN7A 1KIXA 2A19A 1O7YA 3C1FA 2KEDA 5HGTA 2KCNA 3TMEA 5FLXc 2MHVA 1FGBD 3DWPA 1GUSA 1A2TA 5I6YA 1CKNA 1S5DD 3DWAA 1SYEA 4JI6Q 1Z9FA 5K36H 4GOPC 2OCEA 4Y52H 2RA4A 2D62A 1K8GA 3IL8A 3I55A 2K04A 5M5YB 2UXDL 3KLSX 2E5LQ 3I2ZA 3D6CA 1QVCA 3NTHA 4JBWA 4CHTB 1I4PA 5DEHA 1VS0A 4DAPA 1HNZL 1VQ6A 2A5HA 3OIPA 1JQYD 5ELDA 2DNEA 2KBNA 2L1BA 1NR2A 3J80c 1WTOA 1A62A 2XGTA 2JA6H 2ZXPA 1K0RA 5IGGA 1SYBA 4C3IG 2F0EA 4AIMA 1X3QA 4LNQA 2BE5C 5FO8B 3BVZA 2NBFA 3BDCA 1AE3A 4NW2A 2Z6BA 4PV1C 1XNRQ 3S24A 3GV3A 1PZJD 1GXDC 4TSSA 2HHHQ 1HNWQ 2E75C 2V1CC 5AFWA 1RHPA 2EY6A 5CGKA 2EYHA 1SJHD 1A6XA 1K8AC 2IX1A 3HOUB 5JJLA 4A3KG 1O7IA 4DV5L 3SHLA 3MFYA 4Y7NH 2NVTB 3BVGA 1I4XA 3PUXA 3AB9A 2RF4A 4DR3Q 4JI2Q 2JA8B 5IWAL 5CBEE 1N36L 1BKBA 1D1IA 2BDNA 3GTQH 1STNA 2HIXA 3STBC 1HR0L 4JV5L 5CORA 4JBJA 3PMFA 1ET6A 2K01A 5GROA 4B9XA 1B2TA 2P5ZX 3GDEA 4HMIA 4UAIA 3CRKC 1KL9A 3A54A 4A75A 3L3OC 5J39A 2BA0A 3HOXG 3HOYB 2UXDQ 3PGZA 3KJPA 2DY7A 4DPGA 3J81c 1PFMA 3NWSA 1GHKA 3SK8A 2AMCB 4C3JH 1LTTD 1FJGL 4DV1L 2EJMA 2V4DA 4HSVA 2ZJQA 5A35A 4U673 1OTCA 1VQMA 1Q3LA 2D5DA 1HA5A 1E0BA 2OXPA 1JJGA 1TWHH 4ULLA 3PIO3 4MNOA 1Q8KA 3T1YQ 2F3VA 4K2LA 2F0KA 3DMUA 2PZTA 4KY6A 5HY6A 1L2FA 5CC4A 1L1OC 1JOKA 3U4VA 4DNTB 5JVH3 4LF7L 5KNCA 1SE8A 4A93G 3QJYA 2HUGA 1E22A 2XIWA 4MTNA 1P8LA 5ELOA 4DV5Q 1RF2D 4RA8A 1Y1VB 1PH6A 3I91A 3P20A 3HKZE 3D4WA 1QB5D 1EEFD 4P75A 4C3HB 3GTJB 2F0WA 4YCWA 5FLXE 1RTNA 1H9KA 3CPWA 4A3MH 1ILPA 2O4XA 5IT9L 4JV5Q 1KAAA 4HAEA 2NTTA 3M4OH 4IUVA 4YY3L 3R3OA 1A15A 2ZJRA 3CCUA 3BYYB 2KENA 1NCVA 2F0PA 1NR4A 4JI3Q 3UE1A 4A3GG 4K0KL 3I4MH 1MJEA 1BBXC 5IP7G 4GKJL 3TN2A 4JI1L 4XTCS 1EY0A 3BZDB 2K5WA 1H9RA 3I4LA 3J80E 1X3FA 2VXWA 4M1UB 4DV2Q 4NXML 1G2TA 3NUCA 3KK7A 3S17H 1B53A 5CV6A 2B39A 3S1QB 2ID0A 5C4HA 4JBMA 2EOTA 2J4XA 4NKLA 3JAMi 3I90A 4ZLTF 2F0FA 4QUFA 2CW0C 1E3PA 4EQ5A 1UAPA 1X65A 4ILWA 1B4OA 4J1MA 5JOBA 2NVXB 4DR5L 5K5PA 1X32A 3RLFA 1X3EA 2Z9HA 1CHQD 1DONA 4A3BH 1PYBA 1HPCA 3T16A 1I50H 3MZ5A 3ULPA 3S14H 1BCPD 5D3DA 1BR9A 4DV4Q 1N34L 4LF5L 4LF9Q 2OQ0A 1EQTA 3E0JA 4FO2A 1GD7A 3I73A 4WORA 5EKKA 1S5ED 1CA5A 2Y0SE 4A3JH 4X62L 4DR6Q 4K8JA 1PH1A 5KYLA 1JT8A 4JPBW 2CCZA 4EQNA 1YEZA 4BBSB 1AE2A 1SYDA 1DCZA 2E2HB 1SNOA 1NAPA 3KLRA 4NXNL 5TSSA 4DAMA 1PTOC 1KNEA 2CKZB 4B3TQ 2EXDA 2B63G 1JWUD 2I5MX 5C6AA 1CQVA 2JK8A 4FVMA 1SNDA 3J81E 1AFPA 3TDQA 5C3XA 3FKIH 1C8CA 3T56B 1K8OA 2R93G 2AKWB 4LFBL 4K6LA 5GQOA 3K5OA 3PUWA 3DM1A 4M8AA 1PFBA 3HG9A 1EZ6A 3HOVH 5M3FH 4JYAL 3HKSA 3KDFA 3HKZG 4JOIC 1EWCA 5BR8L 2JEAI 2R61A 1QILA 4Z9CB 3F2CA 3H3VC 4APVA 4LFCQ 1SYCA 2WV6D 4A3FG 2RKSA 1WCMB 3S2HH 1X6OA 5EPJA 3MEFA
chains in the Genus database with same CATH topology
1NNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNX A; 
#chains in the Genus database with same CATH topology
 2KHS A;  5M5W H;  3HOW H;  1TWF H;  1TWA H;  4ODG A;  1G29 1;  1Q12 A;  2FJ2 A;  2UUB Q;  4QQB X;  2PYK A;  5FKA C;  3OYY A;  3BJU A;  2AUJ D;  3DLL A;  3HFZ B;  4JK1 C;  3RD4 A;  4CKB A;  5K36 G;  1IYJ B;  4R8I A;  1EOV A;  3NTK A;  1N34 Q;  1STG A;  4LF5 Q;  4MTK A;  3SR1 A;  4L5Q A;  5CMD A;  3OOC A;  3I4N H;  1EQQ A;  3P7J A;  1V1P B;  1LAC A;  2B2T C;  1UE1 A;  4CDD C;  1UNS A;  2RQX A;  4X3K A;  4QJF A;  2PQA A;  3T51 B;  1I4H A;  2KHJ A;  4G7Z C;  4RHR A;  4DK0 A;  3VA7 A;  4LUO A;  4HJ8 A;  2F4V L;  2JA6 G;  1AW7 A;  2L5T A;  1SNP A;  1KAB A;  1WTW A;  2SNS A;  3CXC A;  1BBU A;  4TQU S;  5C5M A;  3M3Y H;  4IN3 A;  4KLK A;  2PW5 A;  2PI2 E;  1ML0 D;  1EQV A;  5IGD A;  4C2M H;  2GVA A;  4WJ4 A;  4DK3 C;  3H94 A;  4FDB A;  4RGM A;  3H09 A;  4CJ0 B;  4GN5 A;  3MHB A;  1SN8 A;  2D2C C;  3CAM A;  1YHB A;  1BVS A;  3IAY A;  2R92 H;  3PO2 B;  3HGB A;  4KN7 C;  4RCO A;  3OW2 A;  3PO3 B;  1H9J A;  1M8A A;  2L15 A;  1V1P A;  1PV4 A;  3K8A A;  1PZK D;  2Y0S G;  4OWX B;  1JOR A;  5E1F A;  2X69 A;  4OIJ A;  3MXG A;  2Q8I B;  2LSS A;  2CH4 A;  3A7A B;  3Q22 A;  1AZP A;  3H0G B;  4LF6 Q;  1LTS D;  2NYZ D;  3S2D B;  4ZYS A;  4N9T A;  5EKI A;  1ICW A;  1A3T A;  2YYZ A;  4AYB B;  3SDZ A;  5JEA J;  4OGQ C;  1VQ9 A;  1L0Y B;  5JPM C;  1UE7 A;  2EXZ A;  4ID6 A;  3K5L A;  2O2L D;  4LF4 L;  1A0I A;  1AP0 A;  1CSQ A;  1RL2 A;  2F0U A;  1Z47 A;  4J15 A;  5ELB A;  2KJX A;  2M00 A;  2QA4 A;  1X54 A;  4IOC A;  3G48 A;  1MBY A;  4OHJ A;  5LMU Q;  4C3J G;  3H15 A;  2OF1 A;  1A8V A;  1L0X B;  2ENB A;  3TQY A;  2Z4H A;  5KYI A;  1KLG D;  2VNU D;  4BY1 B;  2F1M A;  1YJ9 A;  4GKK L;  1HTP A;  4RGT A;  1WD0 A;  3QWN A;  1JC7 A;  4NB3 A;  4K2K A;  5I9P A;  1EOT A;  1Q82 C;  4DV6 L;  3L9A X;  4K8I A;  3KFU A;  3BU2 A;  4DAY B;  4MIU A;  4DV7 Q;  1LO5 D;  3LNN A;  5C44 B;  4KK7 A;  4UDU C;  1VQC A;  1QVG A;  4OXP A;  1EL0 A;  3ICE A;  3CHB D;  5KGU A;  3T1H L;  4N8X 1;  3J7Z C;  3IRB A;  1HZC A;  3SVM A;  1JWS D;  3GTL B;  4DUY L;  3W2D A;  2KOL A;  2RCF A;  2QF7 A;  4DXG A;  1AN8 A;  4EGV A;  2Q8R E;  3S15 B;  5IT9 E;  1CM9 A;  4P73 A;  5I2X A;  3L2P A;  1IBM L;  3K80 C;  4A3M G;  3IFD A;  1PRT B;  4IZ8 A;  1BCP F;  5C4X B;  1CKO A;  2R7Z B;  2KEE A;  1CI3 M;  1HTL D;  3VYR A;  2AWO A;  2A6E C;  1Y8N B;  2MPM A;  2A6H C;  1PHJ A;  2L55 A;  1I6V C;  5FLX L;  2OT2 A;  4N8F A;  5IGC A;  3CCV A;  4DAY A;  3KF6 B;  4R4Q A;  4X64 L;  3OIQ A;  4HIM A;  4LF4 Q;  5H1S E;  3K5M A;  2A8V A;  2JA7 H;  3G71 A;  4CJ1 B;  1K83 B;  3A8I E;  1E2Z A;  1TR5 A;  2HDM A;  4X66 L;  4A3C H;  4NMZ A;  1T9H A;  1SR3 A;  1QWY A;  4L6T B;  3J7A 5;  4FF1 A;  2BE5 D;  1CFM A;  4XIG S;  2J7Z A;  1HXY D;  3GP7 A;  4IJH A;  4ZKB B;  2E2I H;  4UPA A;  3DHQ A;  4A3D H;  4ZQ3 A;  2N55 A;  1QG7 A;  5LHY 1;  1XXG A;  1EWI A;  3J80 L;  2K1B A;  3HOZ B;  2IL8 A;  5JAV A;  1STH A;  2QW7 A;  1YNX A;  1W6K A;  1EFW A;  4UP9 A;  2KCT A;  2G9H D;  5D14 A;  2F03 A;  1HQR D;  4BY7 H;  4O0A A;  3OWF A;  4L63 B;  4A3B G;  1JOO A;  3GQB A;  4KY5 A;  1B50 A;  1B3Q A;  1WTX A;  5FK9 C;  3RLN A;  3GO5 A;  3I56 A;  1W6J A;  3STB D;  3CCM A;  1Q7Y C;  1N33 L;  1GHJ A;  3A74 A;  3PV0 A;  1J5E Q;  1QVF A;  4OL7 A;  4ZCK A;  3O13 A;  4A3J G;  2IHF A;  5J3B A;  4LK1 C;  4IFD H;  5C3E B;  4K5W A;  4Q5V A;  4FNF A;  1Y69 U;  3Q8D A;  1HZA A;  1E7Z A;  1Y1W H;  1TQO A;  2UUC L;  4FXG C;  4IOA A;  4IFD J;  2LXJ A;  4WFN 3;  5G3L D;  2F0G A;  2RHS B;  4XDX A;  3ERO A;  2K50 A;  3OTO Q;  2VQF L;  3MXU A;  1WYD A;  3FKI G;  3Q23 A;  4C3I B;  5C4J H;  2AUK A;  2N49 A;  4X66 Q;  1U5K A;  2J0T D;  1N9W A;  3KLW A;  4YWL A;  2R93 H;  2KCM A;  1SRU A;  4KJO A;  3J81 L;  1PH9 A;  3HOV G;  4NP5 A;  3VR5 A;  2ZJP A;  4HJ9 A;  1N32 L;  3FRP B;  3Q6S A;  4JI0 L;  1RKN A;  1SEB D;  1YZ6 A;  2PMZ E;  3C46 A;  3KOJ A;  4P72 A;  1K73 C;  5JJK A;  4A3K B;  4F87 A;  3MFG A;  1C9O A;  3DXJ C;  1M90 C;  1QNU A;  5IGF A;  2E74 C;  1IKL A;  4B3R Q;  3HOW G;  1GUO A;  4RKL A;  2Z1C A;  1J9O A;  2YTV A;  5LL6 S;  1S5C D;  2RSO A;  5M3M H;  3E9H A;  2QDB A;  1KD1 C;  1SYF A;  1G51 A;  3H91 A;  4GNX B;  5EAY A;  1KAW A;  4DV3 Q;  4KMU C;  4QIW B;  2UUA L;  4LFA L;  1E1O A;  1HR0 W;  4LF8 Q;  4HID A;  3J7A V;  4MZ9 A;  3FEW X;  4XQQ A;  3I4N G;  3HOX B;  3I8Z A;  3RMH A;  3CCE A;  2AQ2 B;  1Q8I A;  4RG1 A;  4I7Z C;  1GVP A;  1VMP A;  3DEP A;  4X65 Q;  2UUC Q;  3CP0 A;  4R9W A;  3AFP A;  1Q81 C;  3GTO H;  2KQ3 A;  4XT1 B;  2ZTC A;  3A0J A;  1S5F D;  1LM0 A;  3KF8 A;  4N9P A;  5CV5 A;  3AMU A;  2CHB D;  3HP3 A;  2A69 C;  5GAG C;  2NWG A;  3MC0 B;  3K57 A;  1QZG A;  2A74 C;  3KUP A;  1HUM A;  4CDC C;  1ICF B;  5I6W A;  4QB4 A;  4GNX A;  2XRQ D;  3ND9 A;  1TWG B;  1PH8 A;  1KDB A;  4YHH L;  2F0V A;  2CW0 D;  5FOB B;  1TU2 B;  3UDF A;  2R92 G;  2DJF C;  3S1M B;  4A93 B;  2YU9 H;  3MA2 B;  2M2L A;  5IP9 H;  1R4P B;  3RZO H;  1G6Z A;  3CCJ A;  1EU3 A;  1IBK L;  4ZUJ A;  3GTP H;  1D6E C;  3LX0 A;  4ME3 A;  5EQ0 A;  1TY0 A;  1JE4 A;  2F0H A;  1BBW A;  4ME5 A;  3GTK H;  4CDE C;  3ULL A;  4JI7 L;  2JP1 A;  5C4Z A;  3D4D A;  1WTP A;  3E0E A;  1LT4 D;  2FXQ A;  3Q0A A;  2ASB A;  2N88 A;  2NVQ B;  1K28 A;  2EVB A;  2PNH A;  1WCM H;  2WKD A;  1PTO D;  1XTC D;  3W1G A;  1RTO A;  1CZW A;  3VA5 A;  4A3G B;  2OTL A;  5E4W C;  3PUZ A;  3ERS X;  1HNZ Q;  2E2J H;  2KEC A;  2NVY B;  1LLR D;  4QL5 A;  1VF7 A;  2EYO A;  1VQB A;  1LAB A;  1RJT A;  2QKI C;  3BZC A;  2BA1 A;  3EVQ A;  2NTS A;  3TP8 A;  3QG1 A;  5FO9 B;  3FPU B;  1SJE D;  3LWU A;  2JA5 H;  1QNK A;  2F3W A;  3CQZ H;  3NBI A;  3BS1 A;  2B2U A;  1NUC A;  3RUZ A;  2F4I A;  3RR5 A;  1SBB B;  2EPB A;  2AQ3 B;  3D8G A;  1NE3 A;  2ICE C;  1HJP A;  4IUR A;  5KRU A;  1T5X D;  3U9O A;  3RZD B;  2I07 B;  1EIF A;  3A8K E;  1F2Y A;  1CUK A;  2X6L A;  5FJ8 H;  5JJZ A;  2UXC L;  1HZ9 A;  1FNV A;  2MO0 A;  5GAD C;  1X56 A;  3CU7 A;  1BO0 A;  4I65 A;  4KD3 A;  2CWA A;  4X3U A;  4JI5 L;  1ZKO A;  1SXT A;  1EZ8 A;  2Z0S A;  1I4R A;  3W1B A;  5IGE A;  1NBW A;  5IWA Q;  1IBL L;  1N36 Q;  2FMC A;  1FL0 A;  5T1G A;  5BN5 A;  3Q24 A;  1SNC A;  1WTH A;  2OWO A;  2TSS A;  1X3P A;  3UDG A;  4YCV A;  1HR0 Q;  1S4Z A;  1UEA B;  4PQX A;  5FO7 B;  1B1Z A;  2L9H A;  4B3S L;  3C3L A;  4IPC A;  1NMF A;  3PUV A;  3BDL A;  4HJ5 A;  3GTM H;  3GD7 A;  1R9T H;  2UU9 L;  2PQE A;  3GTG B;  3A55 A;  1PTO H;  2JA7 G;  2B63 B;  3S1N B;  1WTV A;  2NN6 H;  2VY3 A;  4S3S A;  5CYU A;  4R4I A;  4A3C G;  1CSP A;  3MWY W;  1ASZ A;  4F8M A;  3ZYY X;  1LTB D;  1HFN A;  2H1E A;  2MUY A;  1I6H H;  3NEM A;  3RN5 A;  1FJG Q;  5ISR A;  5D3I B;  1EWH A;  4DV1 Q;  1IL2 A;  4A3D G;  1B44 D;  1BQQ T;  4PMC A;  1I3Q B;  4R8N A;  4DR4 L;  1GO3 E;  1OO9 B;  1VQG A;  4WJW A;  3BYT B;  1PYW D;  1S3O A;  3R2T A;  4GN4 B;  4IPG A;  3K7A B;  4KY7 A;  1XNQ L;  1RD9 D;  1KRT A;  4XT3 B;  3CCL A;  3KLS A;  5FLM H;  4A3F B;  1O78 A;  3H3V H;  4BY7 G;  1LT6 D;  4QMG A;  3N6R A;  1HFG A;  4DUZ L;  4LF7 Q;  1XX8 A;  2QGQ A;  1KXL A;  3RNU A;  5ELE A;  1KNA A;  3ZJY C;  1HNX L;  4A3I H;  5M5X H;  1F9R A;  2QIL A;  3FMC A;  4MHE A;  2CVR A;  1RDP D;  4IFD G;  3CPF A;  2ZM6 L;  4XQN A;  3V96 A;  2YTY A;  4A3L H;  1VQ8 A;  4KV6 A;  4DV0 L;  4RGN A;  1Y1W G;  1GOZ A;  5GAE C;  1OXS C;  3QOL A;  3J7A F;  3SE0 A;  2LMC B;  1Y1V G;  4YY3 Q;  5JJI A;  3NQI A;  1NSN S;  3GV6 A;  1WVL A;  1F9Q A;  1STA A;  1DXM A;  1PH3 A;  2JA6 B;  2UU9 Q;  5AJ3 L;  3CD6 A;  4P74 A;  1TS2 A;  2CFM A;  3TP6 A;  1UE6 A;  4UP8 A;  2C5C A;  4K0K Q;  1E1T A;  4P2C B;  3J80 i;  1F9P A;  3VYS A;  4GKJ Q;  4JI1 Q;  1BOS A;  3E5S A;  5BN3 A;  1LTG D;  3I3C A;  2F0O A;  1DGS A;  4NXM Q;  1SFO H;  5E7N A;  3LWE A;  1LTI D;  4ZK9 B;  1AH9 A;  4JI4 L;  4OEM B;  4K6D A;  2VW9 A;  1A3U A;  4JBK A;  1JJC B;  4Y7N B;  2DNC A;  2Y0S B;  3T13 A;  2L11 A;  2MGS A;  4POF A;  2XSC A;  2BOS A;  4DR5 Q;  3GTQ B;  5M3M G;  2PCF B;  2Q2I A;  4DUZ Q;  5IIF A;  1IYU A;  4H44 C;  5KND A;  1Z6H A;  1PZI D;  4BBR H;  1H9S B;  1VDZ A;  5C3W A;  1TKW B;  1QUQ B;  1ZEQ X;  1KC8 C;  1PH7 A;  4CBV A;  2O5J C;  4OX9 L;  4R4C A;  2PZW A;  2A6E D;  3NWT A;  2A6H D;  4J6H A;  2F0S A;  3CC7 A;  2YTX A;  1B7Y B;  4DGZ A;  1O7L A;  4X62 Q;  1STE A;  2N8N A;  1T5E A;  1YNJ C;  1DOL A;  5I2Y A;  5EBC A;  2D0P A;  4HSP A;  2K7V A;  2KA7 A;  5IOC A;  2XN9 C;  1PTO F;  3S16 H;  3CW2 C;  1TWC H;  4QUC A;  5DM6 3;  4NXN Q;  5D65 A;  4H13 C;  1XWE A;  1UUP A;  3SK5 A;  3U9S A;  3S1R H;  3DWQ A;  1U9R A;  4I7A A;  3J81 i;  4AQY L;  1PRT C;  3CKI B;  2QCP X;  1ASY A;  3FVQ A;  5GAH C;  3UE0 A;  1NJI C;  3EA6 A;  2F0M A;  1TWH B;  3CC2 A;  1VQL A;  5DM7 3;  1H9S A;  1S5B D;  4LFB Q;  1K3B C;  2D0O A;  4R1J A;  4G4K A;  3SK4 A;  3AU7 A;  1QUQ A;  4AYB E;  2GVB A;  1PVO A;  5A2Q E;  2UXB L;  4XQJ A;  4LWC A;  4JYA Q;  5IP9 G;  1MD2 D;  4GZY C;  5LMN L;  4ZAI A;  3KBX A;  2VUM H;  5EBD A;  2EY1 A;  5BR8 Q;  1U0L A;  2AWN A;  1VQJ A;  3NTI A;  1I5F A;  4KI0 A;  1MGS A;  3R8B A;  2HQL A;  4A3E H;  4Q0F A;  3NQT A;  4RH6 A;  4ABN A;  5JEA H;  4OIK A;  2QEX A;  2JA9 A;  2N78 A;  2LXK A;  4IUQ A;  1TS4 A;  2K5N A;  4A3M B;  1Z7T A;  2RSN A;  2PPB C;  2M9V A;  2RDF A;  2XWB B;  2B2Y A;  4KN4 C;  3M4O B;  1WCM G;  1ONL A;  3UDI A;  2KVM A;  1HQM C;  1GUN A;  2HT1 A;  1HHV A;  5EPL A;  4FXD A;  3VR4 A;  1XPU A;  1EQR A;  2LY7 A;  4BS9 A;  3I4M B;  4IFD I;  1GUW A;  3NK9 A;  3HZX A;  1TS3 A;  2D9U A;  4HJ7 A;  1ZXT A;  2VQE L;  4TKO B;  2F4V Q;  2EY5 A;  3S17 B;  5CV9 A;  2Z8L A;  1KLU D;  1U4P A;  4O2D A;  4DR2 L;  2JA5 G;  1JWM D;  1TS5 A;  2WKC A;  1IZ6 A;  5M5Y H;  1D5Z C;  4B3M L;  1G6P A;  1BF4 A;  5IY0 A;  3ULJ A;  3D3R A;  2EJG C;  1DOM A;  1YIT A;  3A56 A;  4IAL A;  1SMY C;  2UXB Q;  1SSO A;  1Q1B A;  2EDG A;  4JC0 A;  4A3B B;  5FJ8 G;  3SK6 A;  4V0B A;  2KUM A;  4QF4 A;  5HGQ A;  1XPO A;  2WB1 E;  5LMN Q;  1HRJ A;  1I50 B;  1C7Y A;  1ZYR C;  1EIH A;  4KJN A;  4V19 0;  1E2V A;  2Z4I A;  2O5I C;  4C1N I;  1PFS A;  2HIV A;  2IHE A;  4A3J B;  2AQ1 B;  2F0T A;  4JI8 L;  2OTJ A;  5EJW A;  1F77 A;  3AYH B;  5ELN A;  1NY4 A;  1SMX A;  1C4Q A;  3C2P A;  4RMF A;  1GM5 A;  3HOU H;  1VQF A;  1WJJ A;  4PMW A;  1U4R A;  2WAQ B;  3TZD A;  3M4Q A;  3LGJ A;  3V2T A;  2K33 A;  1FGU A;  2NVT H;  3QB3 A;  2L0C A;  1LV9 A;  1JR0 D;  5CV8 A;  2JA8 H;  1VQE A;  2NN6 G;  1SNQ A;  3FKI B;  3UDX A;  4GNX C;  2ALY B;  2A69 D;  3MXN B;  3R2I A;  3KYH C;  3X3M A;  1PDQ A;  2Q2U A;  2ES2 A;  5ELC A;  3M4P A;  1HCZ A;  4X3T A;  2SDF A;  5EPK A;  3U58 A;  5M3F B;  4DU9 A;  1I94 L;  3KJO A;  3HOV B;  4GKK Q;  2NZO A;  2NZH A;  1HA6 A;  1GJX A;  3AFQ A;  2QEJ C;  3HOY H;  4JVZ A;  2WFW A;  3MAQ A;  4DV6 Q;  5FLM G;  3SEB A;  4F88 A;  1B9M A;  2N3S A;  4F7X A;  1PA6 A;  3S2H B;  2R7D A;  2I46 A;  4DR7 L;  5M5W B;  1IW7 C;  3HOW B;  1TWF B;  2TMP A;  4MN3 A;  1EU4 A;  1TWA B;  4PMB A;  4RWS C;  3CC4 A;  2F52 A;  3KF6 A;  4DF7 A;  3DM3 A;  3T1H Q;  4FXK C;  1OXU A;  5I9O A;  4A3I G;  4DUY Q;  2IW3 A;  1BCP B;  1WFQ A;  4RKB A;  2SNM A;  2B2W A;  2XTI A;  3MXN A;  2ZXO A;  3CRL C;  2G9D A;  3M7G A;  4CGY B;  1VQH A;  1IBM Q;  1LTA D;  4DN4 M;  4H02 A;  4A3L G;  3I4N B;  1SAP A;  4JI8 Q;  2CH4 W;  5IOD A;  3NBH B;  3NPP A;  5CV7 A;  3RZD H;  1TT2 A;  1CK1 A;  1DZ1 A;  1DYQ A;  2OEO A;  1UEB A;  1Y1V H;  1STY A;  4JI6 L;  1FVI A;  2Q2H A;  2EYL A;  3D31 A;  4DK1 A;  4X64 Q;  4C3H H;  3NP8 A;  3GTJ H;  2B2U C;  4GLV B;  3M3Y B;  2E5L L;  2BH8 A;  1PFN A;  2B29 A;  3J81 j;  1IXR A;  4DFA A;  4FF3 A;  3OWE B;  4C2M B;  5IYC H;  4A76 A;  4FYD A;  2WB1 G;  3W3A A;  4KHP L;  1ET9 A;  2BH2 A;  2XNA C;  2IWH A;  4JCV E;  3A5Z B;  2R92 B;  4C1N K;  1YNN C;  2K28 A;  4QIW E;  1CKN B;  3I4O A;  1EY6 A;  3BZK A;  3NBH A;  1VQI A;  4HCE A;  5HUR A;  2EZV A;  1XMO L;  1EYC A;  1LYL A;  4AH6 A;  4O1N A;  4B9W A;  2K75 A;  3G6J B;  1N8R C;  4EQP A;  3CMA A;  3JAM c;  1SE2 A;  1Q86 C;  4KTA A;  2HHH L;  1HNW L;  3FDT A;  1B8A A;  4BBR G;  2ZTE A;  4CKE A;  3S1Q H;  1HH2 P;  5KIX A;  5DLQ E;  1D1K A;  3BG3 A;  1PXU A;  5E3F A;  1N33 Q;  2MQH A;  1LT5 D;  4EX5 A;  4DR3 L;  4JI2 L;  2NVX H;  4KHV A;  4H7B A;  3FPP A;  4IJL A;  3WOE A;  2A68 C;  2BCO A;  1CZG A;  3T53 B;  4CDF C;  1ILQ A;  1K0S A;  4IUU A;  2PMZ B;  1PYS B;  1E2W A;  1Y8P B;  2VQF Q;  1A2U A;  3HS0 C;  3TZU A;  5C3E G;  2ATW A;  1UWV A;  1KDC A;  2NUC A;  3OMG A;  1YBY A;  2RHQ B;  2NN6 I;  3NSW A;  3M7N A;  3E3X A;  5CR3 A;  1TVX A;  2IJ0 A;  1KRS A;  4BBS H;  2E2H H;  5C0X H;  2HDL A;  2IY5 B;  3TS0 A;  4KHP Q;  4BA2 I;  2EQS A;  1N32 Q;  4JI0 Q;  2VUM G;  5C0X J;  1IL8 A;  1G8Z D;  3M9B A;  3TP7 A;  2B2V A;  1EIG A;  2ICI A;  3E6Z X;  3WWV A;  5A2Q L;  3IFT A;  1XMO Q;  3T1Y L;  4A3E G;  5JEA G;  3X3N A;  3EJI A;  2R3Z A;  3TEH B;  2L4N A;  2MO1 A;  3H3V I;  3M4Y A;  2EYF A;  3D6W A;  1PLF A;  2JYO A;  4H0L C;  4E6I A;  5F2D A;  2FHT A;  1WTQ A;  2ZXR A;  1D2B A;  4LFA Q;  1OXT A;  2UUA Q;  4KD4 A;  1AZQ A;  3CCS A;  2I0Q A;  2RBM A;  4QGU A;  4OO1 H;  1JE5 A;  3PQI A;  1B3A A;  4DA2 A;  2JA7 B;  5CV4 A;  3V05 A;  2F0J A;  2Z6K A;  4L5T A;  1JIC A;  1ENF A;  1VQ7 A;  2A1A A;  3K59 A;  1ENC A;  2K52 A;  3PIP A;  4DNI A;  3EBE A;  2E2I B;  4A3D B;  4HIO A;  4LW1 A;  2EY2 A;  1NMG A;  3G6E A;  1GKH A;  4JI3 L;  1HUN A;  2K5D A;  2X6G A;  4PZ8 A;  4R4T A;  5IYD H;  1EY9 A;  3NHH A;  4G57 A;  4RGO S;  3VYT A;  3F1Z A;  4DV2 L;  4BY7 B;  2FFK B;  1MHW C;  1BXT A;  1SE3 A;  1TXY A;  4YHH Q;  2JN4 A;  1U4L A;  1P16 A;  3NEL A;  1QCB D;  3EN2 A;  4GS3 A;  1CTM A;  2E2D C;  5EKL A;  1JB7 A;  2JJQ A;  4IPD A;  1IBK Q;  1X3G A;  3G4S A;  1KQS A;  3JAM E;  3PSI A;  3DUZ A;  1B70 B;  1VQN A;  4GOP B;  2K14 A;  4CKC A;  1VQO A;  1K3R A;  4JI7 Q;  4GLX A;  1M4V A;  2H5X A;  5DAU A;  3HOU G;  3PO2 H;  3FHW A;  1DM0 B;  1Y1W B;  2JQO A;  3PO3 H;  2XVS A;  2MNA A;  1YNJ D;  4HCS A;  4TVA B;  5T1I A;  1CQF A;  3F8T A;  4K5V A;  4DV4 L;  2JA8 G;  1XMQ L;  4G7O C;  4L5S A;  4LF9 L;  3H0G H;  1X55 A;  3QR8 A;  1U4M A;  5G3L F;  5C4J B;  4DR6 L;  5J1Z A;  3S2D H;  1PRT D;  3KBG A;  2EYM A;  3ND8 A;  4IQZ A;  3K58 A;  1LUZ A;  4K5X A;  2R93 B;  3OHX C;  1OXX K;  1EUJ A;  1VQD A;  3N52 A;  1MSH A;  1EEI D;  1IHZ A;  4UHV A;  5LL6 X;  3OPO A;  1K8M A;  2L12 A;  1JOQ A;  3D4R A;  3VR3 A;  3K5N A;  4B3T L;  1CA6 A;  3HOY G;  1EFI D;  4GOP A;  3HKZ B;  3EQL C;  1J8I A;  4OWT B;  3BDO A;  4OWW B;  3WOF A;  2RDG A;  5COY A;  2E76 C;  3VYU A;  3ER0 A;  1D5M C;  3F2B A;  2QDL A;  5EGT A;  4BY1 H;  5M3M B;  2HCC A;  1A3V A;  2B2Y C;  5BN4 A;  4OEL B;  1CT1 D;  4ZRZ A;  5IYB H;  2K4K A;  5JPN C;  2UXC Q;  4R4O A;  4BA1 I;  3F2D A;  2B8F A;  1I4Q A;  2A73 B;  2KHI A;  4LFC L;  4JI5 Q;  4HMJ A;  2JEB I;  1IBL Q;  1L0W A;  1V43 A;  5C44 H;  4BXX H;  4EVO A;  1Q90 A;  4X3S A;  1ESF A;  4FP5 D;  1A63 A;  2B8G A;  2UUB L;  2XRS D;  1C0A A;  4L8J A;  4ALP A;  4UY8 C;  4B3S Q;  3GTL H;  3GTO B;  5J22 A;  1EYG A;  2EE1 A;  3ONA B;  1YHA A;  4XXE A;  4JG2 A;  2IPK D;  3S15 H;  1XMQ Q;  4C3H G;  1BUV T;  4PG3 A;  2K5V A;  1O80 A;  3KDF B;  1QJO A;  5C4X H;  4DK6 C;  2R7Z H;  1NTG A;  1GUT A;  2Q8T A;  5IYC G;  5CBA E;  3AQQ A;  1LTL A;  1EY5 A;  2C35 B;  2EYP A;  3NXW A;  3SGI A;  4LJZ C;  3U50 C;  1XYI A;  1L1O B;  2YU9 B;  4DR4 Q;  2VZA A;  1K9M C;  5IE8 A;  1SMY D;  3RZO B;  3D0F A;  1K83 H;  4DNR B;  3GTP B;  1J6Q A;  1VMC A;  1XNQ Q;  1VF5 C;  2NZ1 D;  5LMN W;  1ZYR D;  3GTK B;  3BVM A;  4XYQ A;  1JB3 A;  4LMQ D;  3OSO A;  2FMM A;  3L7Z C;  2WIN B;  1HNX Q;  4GN3 B;  5KNB A;  2MJ8 A;  1VQ4 A;  3HOZ H;  2PQA B;  1F2Z A;  3FP9 A;  1D5X C;  1FNU A;  3MVV A;  3VR2 A;  3L0O A;  4FF4 A;  3F2U A;  2B3G A;  2IT1 A;  4LF6 L;  2GN5 A;  5IT9 c;  2ZM6 Q;  1YJN A;  2IX0 A;  1QOH A;  4KKU A;  4YCU A;  2CQA A;  1WI5 A;  4DV0 Q;  1VQ5 A;  4JW0 A;  1L1O A;  1Q1E A;  1MSG A;  1Q46 A;  1AEX A;  4XYO A;  2E2J B;  1PH2 A;  1YI2 A;  3TBI B;  1II3 A;  4C3J B;  2HCI A;  2MFI A;  2R6G A;  2VB3 X;  2KCC A;  4UP7 A;  2PNR C;  1PMR A;  3TP5 A;  5AJ3 Q;  3OW7 A;  2JA5 B;  3WDN A;  1VQP A;  1S40 A;  3CQZ B;  5C3E H;  1F2L A;  1SYG A;  4BBS G;  2RVL A;  4P71 A;  5LMU L;  5C0X G;  4BWG B;  3K0Y A;  2NB0 A;  3PF5 A;  1W3S A;  1WOC A;  1IYV A;  3PF4 A;  5E4X A;  1EY4 A;  4OON A;  5KEE A;  4JI4 Q;  4LUV A;  2F0L A;  2AHO B;  1IW7 D;  2B2W C;  4CJ2 C;  4C3I H;  2LS0 1;  2YV5 A;  1F9S A;  1DD2 A;  4POG A;  1I4G A;  4DV7 L;  3PIO A;  3E9I A;  1TY2 A;  2SOB A;  4RAU C;  1D7Q A;  4IUP A;  1G91 A;  1UE5 A;  2JE6 I;  4ZKC B;  4RHS A;  2ZTD A;  3MXP A;  2H4O A;  4A3K H;  3DEO A;  3P75 A;  3I70 A;  4OX9 Q;  1V9P A;  1MJC A;  4OO1 G;  3GTM B;  2VL6 A;  1R9T B;  1X9N A;  1PTO B;  2F0Q A;  1QE6 A;  1SRO A;  2EJF C;  3MEH A;  5DNF A;  1BCP C;  1EY7 A;  1WTR A;  1O7Z A;  2HQE A;  1I6H B;  2MP1 A;  4DR1 L;  3K0X A;  1PRT F;  1WD1 A;  2E8G A;  1LTR D;  1PH4 A;  1H95 A;  1E24 A;  4AQY Q;  2ZT9 C;  3MTS A;  4QCL A;  1MIU A;  5I4D A;  1Y8O B;  3HOX H;  5L37 A;  1MKH A;  2LKV A;  4IO9 A;  2OQK A;  3RN2 A;  2I5H A;  5IYD G;  3PCO B;  1SE4 A;  4HR7 B;  1ROD A;  3VDY A;  3K81 C;  3PUY A;  1YNN D;  2JSO A;  3J7Y W;  1VQK A;  3QOJ A;  1CKM A;  4NPS A;  2DUD A;  1YVC A;  3TS2 A;  1B9N A;  4X6A H;  2GA4 B;  4YIJ A;  3CCQ A;  4RFB A;  4NDX A;  2WAQ E;  3QO2 A;  4C56 C;  1M1K C;  2DJG C;  1JMC A;  2PI2 A;  4A3I B;  5M5X B;  3S14 B;  1V1O A;  1BDO A;  4DXF A;  3B6Y A;  1TWG H;  3TRZ A;  1V1Q A;  4YWM A;  2VS1 A;  3A5U A;  4IUN A;  1EYA A;  1V8Q A;  1NNX A;  4L5R C;  4DAV A;  3PO2 G;  3S1M H;  2EYJ A;  4A93 H;  3G7L A;  3JAM L;  3PO3 G;  2R7F A;  3HRZ C;  1EY8 A;  2A68 D;  1SNM A;  1KHI A;  1SDF A;  1DOK A;  4JOI A;  4PZ6 A;  3T4A C;  3EIV A;  4J8Q A;  1MI2 A;  3H0G G;  1J5E L;  1CHP D;  2RCN A;  3I7F A;  3H6M A;  2F0I A;  3HEJ A;  4KHZ A;  2K05 A;  3I72 A;  1DJR D;  2WAC A;  4AYB G;  3CCR A;  1XPR A;  3PIP 3;  1KTK A;  1LT3 D;  4KKS A;  5C5L A;  4HJA A;  1W2B A;  2Q2T A;  4RCN A;  4G7H C;  2HD3 A;  2IX3 A;  4DR1 Q;  1YHQ A;  1H9M A;  4QY7 A;  2VQE Q;  2WB1 B;  1VCI A;  3R93 A;  1SFO B;  3AEV A;  2NVQ H;  3OTO L;  5ELF A;  4DR2 Q;  2B2V C;  4B3M Q;  4K14 A;  1HZB A;  3W5O A;  3I4M G;  4A3G H;  1Y14 B;  4EQO A;  1JCK B;  4U68 A;  5IP7 H;  1FD7 D;  2B2T A;  2NVY H;  4BY1 G;  2PW7 A;  5C0X I;  1SLJ A;  5IYB G;  4BBR B;  3K7U C;  5NUC A;  3ERQ A;  1TII D;  3TRE A;  4O42 A;  1XTD A;  3JC6 6;  3S9W A;  3CME A;  1ENA A;  4WJ3 M;  2K32 A;  5C44 G;  4BXX G;  4B3R L;  1PH5 A;  2Z6K C;  3K6O A;  2LFN A;  2DGY A;  4WRD A;  2WP8 J;  3A7L A;  2I5L X;  3SXH A;  3VR6 A;  2DN8 A;  1FNW A;  3IKJ A;  4YWK A;  2K6A A;  2PO4 A;  4TRD A;  2F3I A;  4LUZ A;  3S16 B;  4DV3 L;  1OXV A;  1TWC B;  2G5D A;  4PZ7 A;  3URY A;  2CWP A;  4IPH A;  4DKA C;  1FR3 A;  3S1R B;  1KDA A;  2CQO A;  4LF8 L;  1RIP A;  1JJ2 A;  4HTH A;  1STB A;  5C4X G;  4OO1 I;  1EYD A;  3U4Z A;  1C48 A;  2R7Z G;  5IGB A;  2F0D A;  4FF2 A;  4HIK A;  1ESR A;  2K5H A;  3QIA A;  1YIJ A;  3M85 A;  4X65 L;  2WAQ G;  4GLA C;  1FYC A;  3UI2 A;  1BNZ A;  2FIN B;  1G2S A;  2XWJ B;  3NEN A;  1I94 Q;  1GUG A;  1QZH A;  1R4Q B;  2EIF A;  4IUT A;  1D8L A;  5M9O A;  3GTG H;  1VQA A;  2B63 H;  3S1N H;  2VUM B;  4ZUI A;  3EFX D;  3OMC A;  5JVG 3;  4B08 A;  1IKM A;  3RLO A;  2BDO A;  2JXM B;  1EIY B;  1XJV A;  3ITP A;  1XNR L;  4A3E B;  1F2M A;  2DY8 A;  4DR7 Q;  3CF5 A;  5M3F G;  3NE5 B;  3P1H A;  4PNY A;  1I3Q H;  4HED A;  1RCV D;  4LAA A;  3A8J E;  3HOZ G;  2WII B;  2VB2 X;  4KKT A;  2F0N A;  2PZU A;  2K03 A;  3TSS A;  4A4I A;  3K7A H;  3C1E A;  2RDH A;  2SEB D;  1YJW A;  1S72 A;  3KF8 B;  2C9O A;  4A3F H;  2K5Q A;  4HN7 A;  1KIX A;  2A19 A;  1O7Y A;  3C1F A;  2KED A;  5HGT A;  2KCN A;  3TME A;  5FLX c;  2MHV A;  1FGB D;  3DWP A;  1GUS A;  1A2T A;  5I6Y A;  1CKN A;  1S5D D;  3DWA A;  1SYE A;  4JI6 Q;  1Z9F A;  5K36 H;  4GOP C;  2OCE A;  4Y52 H;  2RA4 A;  2D62 A;  1K8G A;  3IL8 A;  3I55 A;  2K04 A;  5M5Y B;  2UXD L;  3KLS X;  2E5L Q;  3I2Z A;  3D6C A;  1QVC A;  3NTH A;  4JBW A;  4CHT B;  1I4P A;  5DEH A;  1VS0 A;  4DAP A;  1HNZ L;  1VQ6 A;  2A5H A;  3OIP A;  1JQY D;  5ELD A;  2DNE A;  2KBN A;  2L1B A;  1NR2 A;  3J80 c;  1WTO A;  1A62 A;  2XGT A;  2JA6 H;  2ZXP A;  1K0R A;  5IGG A;  1SYB A;  4C3I G;  2F0E A;  4AIM A;  1X3Q A;  4LNQ A;  2BE5 C;  5FO8 B;  3BVZ A;  2NBF A;  3BDC A;  1AE3 A;  4NW2 A;  2Z6B A;  4PV1 C;  1XNR Q;  3S24 A;  3GV3 A;  1PZJ D;  1GXD C;  4TSS A;  2HHH Q;  1HNW Q;  2E75 C;  2V1C C;  5AFW A;  1RHP A;  2EY6 A;  5CGK A;  2EYH A;  1SJH D;  1A6X A;  1K8A C;  2IX1 A;  3HOU B;  5JJL A;  4A3K G;  1O7I A;  4DV5 L;  3SHL A;  3MFY A;  4Y7N H;  2NVT B;  3BVG A;  1I4X A;  3PUX A;  3AB9 A;  2RF4 A;  4DR3 Q;  4JI2 Q;  2JA8 B;  5IWA L;  5CBE E;  1N36 L;  1BKB A;  1D1I A;  2BDN A;  3GTQ H;  1STN A;  2HIX A;  3STB C;  1HR0 L;  4JV5 L;  5COR A;  4JBJ A;  3PMF A;  1ET6 A;  2K01 A;  5GRO A;  4B9X A;  1B2T A;  2P5Z X;  3GDE A;  4HMI A;  4UAI A;  3CRK C;  1KL9 A;  3A54 A;  4A75 A;  3L3O C;  5J39 A;  2BA0 A;  3HOX G;  3HOY B;  2UXD Q;  3PGZ A;  3KJP A;  2DY7 A;  4DPG A;  3J81 c;  1PFM A;  3NWS A;  1GHK A;  3SK8 A;  2AMC B;  4C3J H;  1LTT D;  1FJG L;  4DV1 L;  2EJM A;  2V4D A;  4HSV A;  2ZJQ A;  5A35 A;  4U67 3;  1OTC A;  1VQM A;  1Q3L A;  2D5D A;  1HA5 A;  1E0B A;  2OXP A;  1JJG A;  1TWH H;  4ULL A;  3PIO 3;  4MNO A;  1Q8K A;  3T1Y Q;  2F3V A;  4K2L A;  2F0K A;  3DMU A;  2PZT A;  4KY6 A;  5HY6 A;  1L2F A;  5CC4 A;  1L1O C;  1JOK A;  3U4V A;  4DNT B;  5JVH 3;  4LF7 L;  5KNC A;  1SE8 A;  4A93 G;  3QJY A;  2HUG A;  1E22 A;  2XIW A;  4MTN A;  1P8L A;  5ELO A;  4DV5 Q;  1RF2 D;  4RA8 A;  1Y1V B;  1PH6 A;  3I91 A;  3P20 A;  3HKZ E;  3D4W A;  1QB5 D;  1EEF D;  4P75 A;  4C3H B;  3GTJ B;  2F0W A;  4YCW A;  5FLX E;  1RTN A;  1H9K A;  3CPW A;  4A3M H;  1ILP A;  2O4X A;  5IT9 L;  4JV5 Q;  1KAA A;  4HAE A;  2NTT A;  3M4O H;  4IUV A;  4YY3 L;  3R3O A;  1A15 A;  2ZJR A;  3CCU A;  3BYY B;  2KEN A;  1NCV A;  2F0P A;  1NR4 A;  4JI3 Q;  3UE1 A;  4A3G G;  4K0K L;  3I4M H;  1MJE A;  1BBX C;  5IP7 G;  4GKJ L;  3TN2 A;  4JI1 L;  4XTC S;  1EY0 A;  3BZD B;  2K5W A;  1H9R A;  3I4L A;  3J80 E;  1X3F A;  2VXW A;  4M1U B;  4DV2 Q;  4NXM L;  1G2T A;  3NUC A;  3KK7 A;  3S17 H;  1B53 A;  5CV6 A;  2B39 A;  3S1Q B;  2ID0 A;  5C4H A;  4JBM A;  2EOT A;  2J4X A;  4NKL A;  3JAM i;  3I90 A;  4ZLT F;  2F0F A;  4QUF A;  2CW0 C;  1E3P A;  4EQ5 A;  1UAP A;  1X65 A;  4ILW A;  1B4O A;  4J1M A;  5JOB A;  2NVX B;  4DR5 L;  5K5P A;  1X32 A;  3RLF A;  1X3E A;  2Z9H A;  1CHQ D;  1DON A;  4A3B H;  1PYB A;  1HPC A;  3T16 A;  1I50 H;  3MZ5 A;  3ULP A;  3S14 H;  1BCP D;  5D3D A;  1BR9 A;  4DV4 Q;  1N34 L;  4LF5 L;  4LF9 Q;  2OQ0 A;  1EQT A;  3E0J A;  4FO2 A;  1GD7 A;  3I73 A;  4WOR A;  5EKK A;  1S5E D;  1CA5 A;  2Y0S E;  4A3J H;  4X62 L;  4DR6 Q;  4K8J A;  1PH1 A;  5KYL A;  1JT8 A;  4JPB W;  2CCZ A;  4EQN A;  1YEZ A;  4BBS B;  1AE2 A;  1SYD A;  1DCZ A;  2E2H B;  1SNO A;  1NAP A;  3KLR A;  4NXN L;  5TSS A;  4DAM A;  1PTO C;  1KNE A;  2CKZ B;  4B3T Q;  2EXD A;  2B63 G;  1JWU D;  2I5M X;  5C6A A;  1CQV A;  2JK8 A;  4FVM A;  1SND A;  3J81 E;  1AFP A;  3TDQ A;  5C3X A;  3FKI H;  1C8C A;  3T56 B;  1K8O A;  2R93 G;  2AKW B;  4LFB L;  4K6L A;  5GQO A;  3K5O A;  3PUW A;  3DM1 A;  4M8A A;  1PFB A;  3HG9 A;  1EZ6 A;  3HOV H;  5M3F H;  4JYA L;  3HKS A;  3KDF A;  3HKZ G;  4JOI C;  1EWC A;  5BR8 L;  2JEA I;  2R61 A;  1QIL A;  4Z9C B;  3F2C A;  3H3V C;  4APV A;  4LFC Q;  1SYC A;  2WV6 D;  4A3F G;  2RKS A;  1WCM B;  3S2H H;  1X6O A;  5EPJ A;  3MEF A; 
#chains in the Genus database with same CATH homology
 1NNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...