1NNXA

Structure of the hypothetical protein ygiw from e. coli.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
93
Chain Sequence
QGGFSGPSGSVTTVESAKSLRDDTWVTLRGNIVERISDDLYVFKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVDKDWNSVEIDVKQIRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein ygiW
publication title Structure of the hypothetical protein ygiW from E. coli.
rcsb
source organism Escherichia coli
total genus 19
structure length 93
sequence length 106
ec nomenclature
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04076 BOF Bacterial OB fold (BOF) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.200 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Bacterial OB-fold 1nnxA00
1NNXA
chains in the Genus database with same CATH superfamily
4FF4A 3KF8B 1TWHB 3HOZB 3I72A 2IHEA 5KNDA 1NSNS 4IQZA 2QA4A 5C0XG 4LF5L 1KLUD 1O7YA 1S5CD 4A76A 4DV6Q 3HOZG 1I4XA 3P7JA 1PH8A 2IY5B 3A8JE 2CWAA 5D14A 1PVOA 2OTLA 4DXGA 1UEBA 4C2MB 2N78A 4QB4A 1ENFA 1D2BA 2IW3A 1KNAA 2KCNA 1J5EL 3I4NH 1KC8C 1TS2A 1M1KC 1OXVA 4CGYB 3J81j 3H3VC 3IFTA 1ZEQX 1I3QH 2L9HA 1PFBA 3TSSA 2AUJD 3TRZA 5FO9B 5DEHA 2AWNA 4DNRB 1TS3A 3WDNA 3K8AA 5JJKA 1EY5A 3E6ZX 4DV7L 2N3SA 3S15B 1DM0B 4X62L 5D65A 2KQ3A 3MZ5A 2NVYH 1Y8PB 3QWNA 1HZAA 4JI8L 3TS0A 4DK0A 4JI6L 1HZ9A 1V1PB 2PCFB 3S1MB 2EYLA 1A15A 5I6WA 1SE4A 1JWUD 3S2HH 3QB3A 2Q2IA 3C2PA 3W2DA 3D6CA 4A3BH 4GKKQ 5KNBA 4CDDC 1YVCA 4MTKA 5EBCA 3C46A 4RGOS 4OWXB 1VQ4A 5M5XH 3D4RA 4FXKC 1H9KA 1X3FA 4XQQA 3E3XA 4K0KQ 4EQNA 2KOLA 3KBXA 2MUYA 1C0AA 3CF5A 2B63H 1PTOD 5EKIA 1AZPA 1B8AA 4IUNA 1NUCA 1SNMA 1TWAH 2PYKA 3UDFA 5C4XB 2CQOA 4UHVA 4A3DG 3J81L 4GLAC 1FJGQ 3KYHC 2I5LX 1EY4A 4JBKA 3F1ZA 2UXCQ 5FJ8H 4ME3A 5IT9L 2F0KA 1E7ZA 1PTOB 3I4OA 2IL8A 2PZTA 2HCCA 4X6AH 1PZJD 5JEAG 3PO3H 2KEEA 1CKNA 1EEID 4NP5A 3HEJA 2RSNA 3STBD 1CZWA 4IJHA 4UAIA 3CPFA 3I90A 4K2LA 1G91A 1BF4A 3DEPA 4KY5A 2Q8IB 4C3JG 2ZXRA 1HHVA 1ZYRC 1LLRD 1B9NA 4GN5A 2SNMA 4A3GG 3M3YH 2K5VA 1TIID 1B7YB 2MQHA 4X3SA 1WOCA 4X3KA 2BCOA 5LHY1 3F2DA 4ID6A 4HMIA 3DM3A 3OPOA 4KHPQ 4JC0A 2ZXPA 4IJLA 5F2DA 1STNA 4UP8A 1JJCB 5E4WC 1EU4A 1ASZA 1BKBA 5EPLA 1MIUA 3KUPA 2K5WA 3SVMA 5M3FB 2WFWA 1X55A 2M2LA 1R9TB 3M4PA 3S9WA 1N36Q 4B3TL 1UWVA 2MHVA 1IYVA 1KDBA 2UXDQ 2A6ED 1L1OC 1H9MA 2NTSA 4IALA 3PUWA 4TQUS 2R6GA 3J80c 2A69C 1XMOQ 5A2QE 1U9RA 2JP1A 3HOVH 4XIGS 5T1GA 1GHJA 4OWWB 1JWMD 4G57A 4WORA 1TWGH 2B2YA 4DUYL 2V1CC 3NENA 4QQBX 1WCMH 3ZJYC 3OW2A 2NVTH 4RCOA 1ET9A 2HHHQ 3G4SA 1FVIA 1WTQA 4XDXA 1BXTA 4H13C 3OOCA 2VUMH 1EFWA 4G4KA 4IFDH 1SMXA 2EYFA 2AWOA 1CSQA 2E5LQ 4LFBL 3RZDH 4MNOA 4AQYQ 3F2BA 5IYCG 4DR4L 3FPPA 3S16B 1Y8NB 4DV1L 3KLSA 2PQAB 1X3GA 4JVZA 3OHXC 3I55A 1RDPD 2Y0SB 3HGBA 2NVQB 4RGMA 1WD0A 3DXJC 5IODA 5FLMG 3K58A 5DAUA 2ATWA 3QJYA 1TWFB 1H9SA 1BNZA 3A7AB 1UE6A 1IL2A 4QUCA 2F0OA 2Z6KA 1EY7A 2F0FA 3L3OC 3DWQA 1STYA 4XQNA 2N88A 5H1SE 2R3ZA 4DAVA 3CC7A 1SROA 1VQKA 3RNUA 4OWTB 1GXDC 1JORA 4IUQA 1S4ZA 1F2ZA 4ZAIA 4PV1C 2VW9A 2KA7A 2E2DC 2B39A 2O5IC 4IPGA 3C1EA 2CH4W 1SE8A 4BBRH 3PO2B 4KKUA 3X3MA 4C3HG 4B3RL 3ZYYX 4YHHL 3EVQA 1N33L 5AJ3Q 2EIFA 3DWAA 1K9MC 2UXBQ 5FO7B 1SE3A 3HFZB 1HTPA 5KEEA 2ZJQA 4A75A 3JAME 1MSGA 2CCZA 4DR7Q 5NUCA 1F9PA 1GUTA 1HUMA 1LTLA 4K8JA 5C0XH 3HOUG 1TWHH 2LMCB 1QILA 5EGTA 3HOZH 3MA2B 2C35B 3HKZE 2I07B 1F9RA 5ELNA 3TZDA 3BVZA 1MJCA 4KV6A 1KQSA 3RLOA 5CR3A 3ITPA 2FFKB 3AQQA 4BXXH 3BZCA 4C2MH 1Q12A 2Z4IA 2Z6KC 4N8FA 1EY8A 5CYUA 1PH3A 4DF7A 4DV5L 4JBWA 2RHQB 2OTJA 3CRLC 4A3FB 4M8AA 2CFMA 4FYDA 2QEXA 5ELOA 2L55A 4LNQA 3ULLA 1EEFD 4JI2Q 3SEBA 4JI7L 4FVMA 2YTYA 3FMCA 4JI4Q 1H95A 1A3UA 1Q1EA 5IWAL 1K8AC 3GTPH 3PF5A 4ULLA 1LO5D 4C3IG 3S15H 2Z6BA 1IYJB 4O42A 3M4YA 1X6OA 4GKJQ 3FHWA 4YWLA 1EIFA 2NBFA 1VQMA 1PRTD 3K6OA 2K28A 4NKLA 1QUQB 3S1MH 4GOPB 1DCZA 5EBDA 3RN5A 3H15A 4A3MG 1BO0A 4WFN3 1I94Q 1SFOB 3RN2A 1PRTB 2LXKA 3IRBA 2ZTCA 5C3WA 5ELCA 4LK1C 1JE5A 3NEMA 3BJUA 3G6JB 5A35A 1C7YA 4A3KG 1STGA 3L2PA 3F2UA 3F2CA 3HOYB 4DAPA 3JAMi 4L5RC 3HOYG 1B53A 4IPHA 2MP1A 3J81E 3NWSA 4DKAC 1X3PA 3D0FA 3KJOA 1FNUA 4TVAB 1HZCA 1E2ZA 4J15A 4V0BA 4JCVE 5IT9E 5JEAH 1PTOH 1N34L 1K0SA 4CDEC 3CMEA 1Q82C 5BR8Q 1XNQQ 2A68C 1EQTA 1PYSB 1NTGA 2F0NA 4LWCA 4A4IA 5JPNC 4V190 4QGUA 3LX0A 4OHJA 5FLXc 1LTBD 3D6WA 4B9XA 1K28A 2EJGC 2Q2HA 1MBYA 2HIVA 2QCPX 5J3BA 2OWOA 5ELFA 1SJHD 4QJFA 1EQRA 4JW0A 1S72A 3Q22A 2K4KA 1ZXTA 4XT1B 1SLJA 3WOFA 1SR3A 4UP9A 3UDIA 1SNQA 1DOLA 4RHRA 4F8MA 4APVA 1FGBD 3BDCA 5IYDG 5KNCA 5M5WB 2VXWA 2F0GA 2A1AA 1KAAA 1BCPF 2BH2A 3CCRA 2HD3A 4RH6A 2K04A 4OL7A 5C44B 1R9TH 4LF6L 1CHQD 2E75C 5C44G 2F0UA 2DJFC 1EUJA 2K5DA 1B9MA 2B8GA 2QEJC 3CPWA 1SRUA 1YJNA 3OMGA 4P75A 1K8OA 2UUBL 4LF8Q 4IURA 2DNCA 5T1IA 1CI3M 4IO9A 4BA1I 3GTQB 1AFPA 4I7ZC 1IBLQ 4RA8A 2J4XA 5EJWA 2B8FA 4K5XA 1IBKL 2E2JB 2PMZB 3S2DH 1LT3D 3F8TA 3CCQA 3ULJA 2VQFL 1OXXK 3MXPA 1ESRA 3SXHA 2I5MX 4DFAA 4CKCA 5IYCH 4HR7B 5GROA 1X3QA 3CXCA 1MKHA 2NYZD 1N9WA 2NN6I 1VQ5A 2J7ZA 4AH6A 1HR0Q 2R61A 2RDGA 4K5VA 1G2TA 3S16H 2E2HB 1E2WA 2E2IB 5FLMH 4RKLA 4OX9L 2F03A 1CA6A 5CBAE 2NVQH 3A7LA 1VMCA 2VB2X 1TWFH 4KK7A 5HY6A 4DR5Q 3K7UC 2D0PA 4HN7A 4Q5VA 2FMCA 1JJGA 3NBHB 4LMQD 4XQJA 2Q2UA 1PXUA 3B6YA 3GP7A 3NTHA 5CC4A 3KDFB 2N8NA 1HZBA 1XPUA 1BDOA 3A5ZB 3CCSA 4DR3L 3N6RA 4LF9L 2WB1B 1LM0A 4A3IB 1PZKD 3J7AV 1O7IA 3K5NA 1XPOA 3AMUA 4JI3Q 1YI2A 1OO9B 1E0BA 1UE5A 2KVMA 4CJ2C 1QJOA 5A2QL 1TY2A 4C3HH 3GTKB 4DV6L 3S14B 2C9OA 5C5MA 3CC4A 4L63B 2AQ1B 1AH9A 3PO2H 1CTMA 4JI5Q 4RCNA 1ML0D 2B2TA 1LT6D 1SAPA 4DV0Q 5CV7A 2YU9H 2ZJRA 4DUZQ 3MC0B 4NB3A 3NSWA 4QIWB 5IGDA 4DAYA 1KAWA 4YWKA 4AYBG 1SDFA 2VUMG 3T4AC 1PHJA 4K6LA 3W1GA 4IFDG 2AQ3B 3NTIA 3OTOQ 2K6AA 1E2VA 1D5MC 1QZHA 5JJLA 2A6HC 2NUCA 4GS3A 5GAGC 1TR5A 1XMQQ 1SNOA 4DR6Q 1T5EA 3QR8A 4IUUA 2PNHA 3R2TA 1CQFA 1ET6A 4PMWA 2WKCA 3HZXA 4A3FH 2F0QA 1ZYRD 2FMMA 4R9WA 3OIPA 2IJ0A 1PDQA 1LTAD 3LGJA 3HKZG 4KMUC 3UDGA 1C8CA 2Z4HA 1EY0A 3S1NB 4C3IH 1IW7C 5E3FA 2NZHA 1VQ7A 1B3QA 2EVBA 2B2TC 2AQ2B 4K0KL 2IPKD 4BBRG 3CRKC 3LWUA 4R1JA 2UUAL 2L12A 3CW2C 1XPRA 1EOVA 3PUXA 3VA7A 1YJWA 3RR5A 3NK9A 3T1HQ 2Z9HA 3W5OA 1Z9FA 1SSOA 2RBMA 5J39A 4IPCA 1FJGL 4EVOA 1EIYB 3S17B 1IZ6A 2NVXB 2UXCL 2PO4A 1EYGA 3DMUA 1SFOH 2B29A 4IZ8A 3VDYA 3Q6SA 1U5KA 3T13A 4OIJA 1STAA 3EBEA 4A3KH 2NZOA 2ENBA 2F1MA 3PMFA 1JWSD 1L0YB 3E9HA 1JCKB 2KHJA 1HPCA 3HOYH 4BXXG 1GUSA 4ILWA 1GD7A 1XNRQ 3I2ZA 1HNWQ 1R4QB 3H3VI 1Q8IA 1CKNB 1W3SA 4JBMA 3CCLA 1KXLA 1BCPD 2ASBA 2A19A 4JYAQ 1EQQA 1HR0W 3R3OA 1NR4A 4KJNA 4A3JB 1CSPA 2EDGA 3UE0A 3K5MA 1YNNC 3BYTB 4H0LC 2CH4A 5HGTA 1J9OA 2BDOA 1IBMQ 1W6KA 5M3MB 4MTNA 4LFAQ 1WTOA 4A3JG 1D1IA 4KHPL 3NXWA 2K50A 1BCPB 2YTVA 5IGCA 1LABA 3L9AX 2K7VA 5JVH3 2PPBC 4WJ3M 1S5FD 1N36L 1EU3A 2L11A 2UXDL 5IYDH 3FP9A 1HCZA 4I7AA 1EY9A 4DR3Q 4DV3Q 2JSOA 3I3CA 4N9PA 5I9PA 4F7XA 5GAHC 1X54A 2ZTDA 5M5WH 4GN4B 1W2BA 1WTWA 1HA5A 2ICEC 3HRZC 4MN3A 1TQOA 2MNAA 4FXGC 3U58A 2K5QA 1FR3A 2NZ1D 2PW7A 2M00A 1KRTA 2HHHL 5C44H 2F4VQ 2XSCA 4Y7NB 1HH2P 3GD7A 3K7AH 2I0QA 2JA5B 4X3UA 3CU7A 2E5LL 5KYLA 1Q1BA 2F0LA 2Z1CA 2HIXA 1KHIA 3ND8A 1PRTF 4AQYL 5C4XG 4L8JA 1L1OA 1ASYA 5FLXL 3GTQH 5M5YH 2EY2A 2F0TA 1QG7A 5IGFA 1A63A 3KK7A 3RUZA 2E2JH 5ISRA 4BY7B 2CW0D 2OF1A 1TVXA 1Q8KA 3CQZB 1QNUA 3U9SA 1J8IA 1AE3A 3CKIB 1NMFA 4K2KA 5CV5A 1TKWB 3I7FA 2F0EA 5JAVA 1H9SB 4GNXC 1EZ8A 2L5TA 1D7QA 2L4NA 2OCEA 2E2HH 1T9HA 2E2IH 3I4MB 1YZ6A 3G7LA 5KGUA 2R7ZB 3BVMA 2EYJA 2JK8A 4RHSA 2ZM6Q 1NY4A 1VDZA 4IOAA 1EL0A 2PMZE 3RLNA 2L0CA 4ZYSA 5AJ3L 2PZUA 3DEOA 1LACA 2UXBL 1E22A 3J80E 2LS01 4A3LH 1PFMA 4DR7L 1V9PA 1RODA 5M3FG 4IUPA 1YNXA 1HXYD 1LT4D 4A3IH 2EYPA 3SGIA 1M8AA 4DV4Q 5C0XI 4YWMA 3M7GA 3HOWB 3PSIA 3GTKH 3S14H 3HP3A 5EKKA 2DY8A 4BWGB 4HCEA 3HOWG 1GUOA 1UNSA 3PQIA 1VQLA 1LTTD 3VR5A 2PI2A 1B44D 4DR1Q 1UE7A 3MEFA 4KLKA 1S5ED 3NQTA 1PH2A 2VY3A 1OTCA 1AN8A 2KEDA 3V2TA 1VCIA 4PMBA 1D1KA 5J1ZA 5DM63 1G6ZA 1EZ6A 3H0GB 5C5LA 4JI2L 1GHKA 2PZWA 4JI4L 1BVSA 5D3DA 1VQPA 1DD2A 1BBWA 2EYMA 2G5DA 1LYLA 3I4LA 2Y0SG 1PLFA 4KI0A 2ALYB 5ELBA 5IP9H 4NXMQ 4B3MQ 3AEVA 2A68D 4GKJL 4RG1A 4ZRZA 2WACA 3MHBA 3GTLB 2K1BA 1KLGD 2D2CC 2P5ZX 4G7OC 4M1UB 3P20A 4AYBE 4YIJA 4JBJA 4QIWE 4LF4Q 3E5SA 1DYQA 2OQ0A 5IGGA 2JEAI 1FNWA 3WWVA 1I94L 5C4ZA 2SDFA 1PH5A 4HIKA 2FINB 3M85A 3S1NH 2ZXOA 1B50A 5IE8A 2A8VA 4JI1Q 1U4MA 3W1BA 2KHSA 1Y8OB 2OEOA 3NTKA 1VQ9A 2RKSA 3NHHA 4DK1A 3QO2A 3PO2G 2RVLA 4XXEA 2O4XA 3K5LA 5C3EB 1GKHA 2H5XA 1E24A 1Z7TA 2E74C 2RA4A 1CHPD 2F0SA 1YBYA 1SYFA 3GV3A 4R4CA 1ILPA 2FJ2A 5CGKA 2QDBA 1JJ2A 1QVGA 2NVXH 3S17H 2GVAA 1HNZQ 2RCNA 3G48A 4JOIA 5J22A 3ERQA 1K73C 1LV9A 5M9OA 1AZQA 1L0XB 4XTCS 5BR8L 5D3IB 2WP8J 3CP0A 1XNQL 4DK6C 1F9SA 4DV2Q 2HDMA 1Y1WB 4YCVA 4YCWA 2HUGA 3E9IA 2B3GA 1XWEA 3Q24A 3EQLC 4JI0L 3JAMc 4H02A 1XYIA 3GTJB 1Q3LA 5I9OA 2MO1A 1A6XA 3CC2A 4L5QA 1OXTA 2AMCB 4A3FG 3MTSA 3STBC 2UUCQ 4KD3A 2WKDA 4A3JH 2VB3X 2JJQA 4NXNQ 1SEBD 1PFNA 5M3MH 2JN4A 4RWSC 1UE1A 3NQIA 1X32A 1IHZA 4R4OA 2NN6G 3PCOB 5CMDA 5JPMC 5LMNQ 4FF2A 2UU9Q 3FRPB 5FKAC 2MFIA 4HJ5A 1F77A 1I6VC 4QCLA 4E6IA 4ZKCB 4TSSA 2Q8RE 4JOIC 2HT1A 1VF5C 3CCVA 2QILA 1YEZA 1WFQA 4R8IA 2EY6A 3D3RA 3GTOB 4KTAA 5K5PA 3UE1A 4HTHA 3G6EA 1BOSA 2EJFC 4WRDA 1TWCB 2B2WA 5LMUL 1EWCA 1O7LA 1WVLA 2K75A 4POFA 2V4DA 5LL6S 1JE4A 4Y7NH 3IKJA 1NE3A 4OELB 4B9WA 5C4XH 2A5HA 3TREA 3E0EA 4K14A 1HR0L 1UEAB 3R2IA 4ME5A 1TT2A 5FLXE 4A3EB 1Y1VB 5C3XA 3MXNB 2C5CA 1L0WA 1K8MA 4DR5L 1TY0A 1GUNA 3NP8A 3GQBA 4POGA 4G7ZC 3A74A 1HNXQ 2M9VA 3J7AF 2KENA 1NR2A 2O2LD 4JG2A 4IN3A 4ABNA 4BBSB 3ONAB 1SE2A 4CDCC 1WTRA 3I56A 3J81c 1F2LA 4BBSG 4JI3L 1SBBB 1C9OA 3QG1A 5EQ0A 5DM73 1VS0A 1X65A 5JVG3 3W3AA 1TU2B 3I4MH 5IT9c 3I91A 2D9UA 2R7ZH 4YY3Q 4RAUC 1QE6A 2HQLA 5JJZA 3CMAA 1UAPA 4JI5L 1S5BD 2K05A 3SHLA 4X66Q 2B2WC 1A3VA 2F0DA 3FVQA 1QVFA 2HCIA 1HA6A 4DV0L 2ZTEA 3ULPA 4J1MA 1MSHA 3X3NA 2E8GA 4Z9CB 3GO5A 5M3FH 4ZCKA 4DUZL 1PH9A 1N32Q 1RTNA 1KABA 4K8IA 3MFGA 1K83B 2DUDA 3BG3A 2RCFA 2I46A 4X3TA 1Q86C 4S3SA 1EYAA 4MZ9A 4DAMA 3OTOL 3HOWH 1IYUA 1FGUA 2F0JA 4KD4A 4DAYB 1LTID 3BU2A 3BYYB 4HJ8A 1VQ6A 4CKEA 1XMQL 4DR6L 1YNJC 3I8ZA 1D5XC 3EN2A 1GM5A 2A73B 1PFSA 2F0HA 5CV4A 1U0LA 1JOKA 4OO1I 2K03A 4B3SQ 3J81i 3BZDB 4FNFA 1CKMA 3VYUA 3K0XA 4HAEA 1I4QA 4O1NA 4MIUA 2QW7A 2LY7A 3PO3B 1V43A 3BDOA 5CV6A 4P2CB 2B2VA 4KKSA 4F87A 1YITA 3L0OA 3P1HA 4BS9A 5GAEC 4HIOA 4OEMB 3SR1A 3ERSX 4B08A 1IKMA 3NUCA 3K80C 3IL8A 2IX0A 1M4VA 3GTLH 3J80L 1E3PA 2Z8LA 1KRSA 3T1HL 1JC7A 4NDXA 3A5UA 3T1YQ 4A3LG 4CJ1B 3H6MA 4LFCQ 4LAAA 3CCJA 5IGEA 3C1FA 4OGQC 3O13A 2K33A 2WB1G 4A3IG 4PZ8A 1Y14B 4UDUC 1K3BC 1FYCA 1VQEA 3I70A 1VQ8A 2JA6B 3LNNA 1XTCD 4DR2Q 1Z6HA 4N9TA 1EQVA 2Y0SE 4QF4A 2F3WA 3MXUA 1WTPA 2Q8TA 3V05A 2MGSA 1I4HA 3IFDA 2PQEA 1QZGA 1H9JA 1X56A 2XGTA 5EPKA 1XNRL 2PW5A 1C48A 1HFGA 2L15A 3HS0C 3EA6A 2ZJPA 5KIXA 1RCVD 2H4OA 1HNWL 3QOLA 2VS1A 2PNRC 3N52A 5FO8B 4A93B 1OXUA 1KL9A 2CQAA 1VQFA 3TMEA 4JYAL 1VQDA 3AFQA 2B2VC 4A93G 5CV9A 2R93B 2SEBD 1BBUA 4LF7Q 2KBNA 1IBML 3I73A 1VQNA 4LFAL 1KIXA 3M7NA 4G7HC 2F0WA 2JE6I 4HJ9A 4LF6Q 4LUVA 5E4XA 1SMYC 3L7ZC 5IP9G 4BY1B 2D0OA 3D4DA 2OT2A 1JT8A 1U4RA 1B4OA 1O7ZA 4XYOA 4H44C 2JA8B 3EIVA 5C4HA 1O80A 1EIHA 2EY1A 1KTKA 2QDLA 3S24A 4HJ7A 2VZAA 4GKKL 2BDNA 3K59A 4JPBW 1WTHA 4X64Q 1W6JA 2EOTA 4KY7A 1BBXC 1SYGA 1PA6A 3TP8A 4XYQA 3T51B 1I6HB 4RGTA 3CCUA 2NN6H 2XNAC 5ELDA 1HJPA 1WTXA 2SNSA 2YYZA 2F4VL 1IXRA 1CQVA 2MPMA 3J7ZC 3SK6A 1QOHA 3G71A 5K36H 4X65Q 4U68A 1TS5A 1Q90A 1WJJA 4EQ5A 1VQOA 1DXMA 1DJRD 3MXGA 3TEHB 3KF6A 2A69D 2RQXA 2Z0SA 1KDCA 4R8NA 1A3TA 3GTOH 1Q81C 3MWYW 4P74A 1TWCH 1L1OB 1JOOA 4LF9Q 3VA5A 1XXGA 4GLXA 4GZYC 3OWFA 2B2UC 2LKVA 1BR9A 2WAQB 5G3LF 2MJ8A 1UUPA 3P75A 5HURA 4A3EH 1Y1VH 2WAQG 3VR6A 3CCMA 4R4TA 1N8RC 2R92B 2ZT9C 2ZM6L 1JOQA 1STBA 2K5HA 2R92G 3H94A 5M3MG 4Q0FA 2BE5C 3JC66 3EJIA 2XTIA 3V96A 1GJXA 4BBSH 1EYCA 3D8GA 2DN8A 1I50B 3U4ZA 4ZQ3A 3GTPB 4OONA 4GNXA 1G51A 4DV4L 1A0IA 1YIJA 4TKOB 3M9BA 2K5NA 1X9NA 1XMOL 4CKBA 4JV5Q 5I6YA 3DLLA 1AEXA 5TSSA 5DLQE 4BA2I 4DR1L 3PIPA 1I4GA 1S5DD 2VQEQ 1TXYA 2KCTA 3PIP3 3BZKA 3VYSA 1FD7D 2QF7A 2EJMA 5EAYA 3RZOB 4RKBA 1K83H 2H1EA 4IFDI 4C1NK 2GN5A 2JA5G 5CBEE 3RMHA 2F4IA 1PH1A 1FNVA 2EXZA 3KF8A 3K5OA 4L5TA 5BN4A 1MD2D 1KD1C 2X69A 2UUAQ 2ICIA 4TRDA 5L37A 4A3DB 4IFDJ 2WV6D 1PMRA 1CKOA 2RHSB 4NXML 4B3ML 1AE2A 2EZVA 2YV5A 2RSOA 3SE0A 4BY7G 2MO0A 1QWYA 1RIPA 4ALPA 1RD9D 4LF5Q 3QIAA 4PG3A 4KN7C 1SXTA 4LF4L 3S1RB 1P16A 3Q23A 1F9QA 3M4OB 5HGQA 2KHIA 3QOJA 1SYEA 1Z47A 3HKSA 2JA7B 1LUZA 2D5DA 4YCUA 3TP6A 1BUVT 4C3JB 4ZUIA 4CDFC 4KN4C 2BOSA 4JI1L 1OXSC 2JA7G 3I4MG 1MJEA 1DGSA 2OXPA 4DN4M 4ZKBB 1J5EQ 3AYHB 3UDXA 2Q2TA 2R7FA 3H3VH 2R7ZG 2OQKA 4ZK9B 3ER0A 1HRJA 5C6AA 1WTVA 4A3GB 3J7A5 3OW7A 5IY0A 4DGZA 4WJWA 4ODGA 1A2TA 4LUOA 1XX8A 1F2MA 4PNYA 3K57A 2TSSA 2JA9A 5KRUA 1CT1D 1VQAA 1V1PA 4A3CG 4DV7Q 1HNZL 1JB3A 4X62Q 2EY5A 2I5HA 2EE1A 3NE5B 3CCEA 3TP5A 2IX1A 1WYDA 1ZKOA 1SNCA 2JA6H 3TZUA 4RFBA 2G9HD 4JI8Q 2JQOA 4JI6Q 4UPAA 5C0XJ 4DK3C 1ICFB 4DV2L 4FF1A 1QB5D 3PIOA 2KCCA 2XVSA 5IIFA 3Q0AA 3U9OA 1EWHA 3PIO3 3MVVA 1PH7A 2XWJB 2GVBA 3GTMB 2A74C 2AKWB 3WOEA 3HOXB 3VR3A 2BH8A 4A93H 3S2DB 3U4VA 1A2UA 2KECA 2WB1E 3RLFA 3DHQA 3HOXG 2UUCL 3H0GG 2WINB 1KDAA 2IWHA 3AFPA 3S1QB 3D31A 2R93H 1I5FA 4NXNL 1GUGA 4ZUJA 1G6PA 3FPUB 1CA5A 4DNIA 5DNFA 3A0JA 1IKLA 3NBIA 4J6HA 3SK4A 1BCPC 4FDBA 3OMCA 4BY1H 2K01A 5LMNL 2EXDA 2UU9L 2RF4A 4EGVA 4EX5A 1VQGA 3TS2A 2JA8H 1HTLD 2CWPA 1D8LA 3PGZA 3VYRA 3T56B 2AHOB 1D6EC 4L5SA 1KNEA 3FKIB 1GUWA 1SJED 4OXPA 1NNXA 4LW1A 1I6HH 3FKIG 1K0RA 4OIKA 5JOBA 4HMJA 3J80i 1EY6A 1EFID 4I65A 5JJIA 1AW7A 5G3LD 5ELEA 5C3EG 3H09A 1MHWC 4EQOA 4Y52H 4C3HB 1QCBD 3U50C 2B2YC 2WIIB 1I4RA 4PMCA 2JYOA 2F0IA 3OSOA 3CHBD 5IP7H 3BDLA 1SNDA 2G9DA 1STHA 3DM1A 1DONA 1PTOC 2YU9B 4K5WA 1YJ9A 2RDFA 4R4IA 1QNKA 3HOUB 1D5ZC 3VYTA 4C56C 4B3TQ 2KCMA 4CHTB 1AP0A 3E0JA 3VR4A 4KY6A 1HNXL 1Q46A 5C4JB 5IYBG 2BA1A 1YNJD 1RF2D 5JEAJ 1LTSD 1G8ZD 4NW2A 1Y1WG 1CUKA 3M4QA 4CBVA 3BS1A 2SOBA 3PUVA 1VQIA 4P71A 2XN9C 2CW0C 1GVPA 3DWPA 4QUFA 4DUYQ 1ICWA 1SYDA 4NPSA 5IGBA 2R92H 2PQAA 1VMPA 2VNUD 4YY3L 1ENCA 1II3A 2KUMA 4FP5D 2ES2A 4X66L 4OO1G 2ID0A 1C4QA 1SNPA 3GDEA 3KBGA 3C3LA 4LFBQ 1GO3E 2LSSA 2QKIC 4RGNA 2IX3A 4DR4Q 2FXQA 1N32L 4DV1Q 1MGSA 4C3IB 1NBWA 3KLRA 1I50H 5IOCA 2NB0A 5K36G 3GTGB 4LF8L 4KJOA 2WAQE 1DOMA 3A56A 1J6QA 4HSVA 1FL0A 1IBLL 2D62A 5BN3A 3J7YW 1B3AA 3PUZA 1EIGA 4A3MB 5BN5A 2A6EC 3BVGA 3CD6A 2EQSA 3OWEB 1SYCA 4P73A 4B3SL 3SK5A 2JA5H 1PYWD 3CAMA 4FXDA 3ND9A 3UI2A 2DGYA 3RZOH 4KHZA 1BQQT 1VQBA 3KOJA 4A3KB 4DA2A 4B3RQ 4YHHQ 1N33Q 2IT1A 1VQJA 4LUZA 4FF3A 4K6DA 4HCSA 4A3EG 1Y1VG 4A3DH 2A6HD 1EOTA 1RL2A 2NTTA 3ICEA 3I4NB 4BY7H 4J8QA 2K32A 3LWEA 3CQZH 3I4NG 1LT5D 1I3QB 4ZLTF 4IUTA 1HFNA 1YHQA 3AU7A 1ONLA 1SMYD 5FK9C 1V8QA 3T1YL 2F0MA 1Q7YC 3MAQA 3S1RH 4HIDA 3OIQA 4LFCL 3M4OH 1Y69U 1SYBA 1ENAA 5EPJA 1TS4A 3VR2A 5FOBB 2JA7H 1YHAA 2PI2E 2N49A 2NVYB 2XRSD 4C3JH 4DR2L 1RKNA 2F3VA 1IW7D 1T5XD 1L2FA 5GQOA 1QVCA 4DV5Q 4DPGA 4IOCA 3T53B 1VQCA 4JI0Q 4DXFA 3IAYA 3S2HB 4A3GH 2VL6A 3TBIB 4NMZA 3FDTA 4A3BB 1HQMC 4O2DA 1DOKA 3TP7A 4JI7Q 1JICA 5GADC 4LJZC 4A3CH 1CM9A 5I2XA 4A3BG 5EKLA 5IWAQ 5M5XB 1QUQA 2E76C 4GOPA 2RDHA 5KYIA 3NPPA 4PZ7A 1E1TA 4LF7L 3TDQA 2K14A 2B63B 3KLWA 2KJXA 1DZ1A 3K7AB 1TWAB 3K0YA 2B63G 2F0VA 1HUNA 3K81C 1CFMA 2LFNA 1E1OA 1NCVA 4WJ4A 1LTRD 4XT3B 1V1QA 5CORA 5M5YB 3GTMH 5FJ8G 3OYYA 3HOXH 1IL8A 1HQRD 3H0GH 1ILQA 1XTDA 2K52A 1B1ZA 4PQXA 3A8KE 1NJIC 5LMUQ 4X64L 3S1QH 3PO3G 3AB9A 5AFWA 3A55A 5I2YA 2N55A 4HSPA 1YNND 2HDLA 2JXMB 3MXNA 4HEDA 1B2TA 1XJVA 3KJPA 5COYA 3RD4A 4QY7A 2CVRA 3DUZA 1ESFA 3KFUA 1LTGD 2DNEA 1WD1A 1VF7A 4C1NI 1PTOF 1G2SA 2BE5D 4HIMA 3M3YB 4FO2A 1EYDA 5LMNW 4KKTA 1PH6A 1N34Q 4X65L 4GOPC 4IPDA 4DNTB 3MEHA 1F2YA 1U4PA 2LXJA 4AIMA 3A54A 3TQYA 2TMPA 1RJTA 2JEBI 3PUYA 3FKIH 1PRTC 1PYBA 3T16A 4R4QA 3H91A 2JA6G 4QMGA 1I4PA 1B70B 5C3EH 2GA4B 3NELA 1A62A 5LL6X 1JB7A 2QGQA 1P8LA 3KF6B 2CKZB 2F3IA 1R4PB 4O0AA 3HOVB 2XRQD 1NAPA 2XIWA 1K3RA 3NWTA 4F88A 1TWGB 4MHEA 1YHBA 1K8GA 1H9RA 1RTOA 3HOVG 1EWIA 1WCMB 4EQPA 1WI5A 2NVTB 1JR0D 2YTXA 1V1OA 2FHTA 1MI2A 1PZID 2DJGC 3URYA 3EFXD 4QL5A 3PV0A 4IUVA 2HQEA 1WCMG 4AYBB 5E1FA 2VUMB 2R93G 4RMFA 5IYBH 3HOUH 1GOZA 3EROA 3GV6A 3HG9A 2L1BA 3SK8A 3RZDB 5E7NA 1O78A 3SDZA 2EYOA 1Y1WH 5C4JH 2EYHA 4CJ0B 2O5JC 5I4DA 2UUBQ 1U4LA 3MFYA 4L6TB 4BY1G 2B2UA 3GTJH 1SN8A 1X3EA 4UY8C 2F52A 1IBKQ 3KLSX 1VQHA 2BA0A 4JK1C 2JA8G 3FEWX 2F0PA 3R93A 4DV3L 1G291 1M90C 3PF4A 2CHBD 2EPBA 3A8IE 4HJAA 4OO1H 2IHFA 2VQFQ 1NMGA 4JV5L 3TN2A 4GN3B 2XWBB 4GLVB 3Q8DA 4GNXB 1STEA 2VQEL 2NWGA 4H7BA 3HKZB 1CZGA 2DY7A 2R7DA 3NBHA 1JQYD 2X6LA 4OX9Q 2J0TD 4U673 1RHPA 2AUKA 1PH4A 3KDFA 4P72A 4KHVA 3R8BA 4BBRB 4UP7A 3GTGH 4DU9A 1S40A 4N8X1 5CV8A 5IP7G 1A8VA 2X6GA 1JMCA 4PZ6A 3JAML 1PV4A 4A3MH 1S3OA 3D4WA 1CK1A
chains in the Genus database with same CATH topology
1NNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNX A; 
#chains in the Genus database with same CATH topology
 4FF4 A;  3KF8 B;  1TWH B;  3HOZ B;  3I72 A;  2IHE A;  5KND A;  1NSN S;  4IQZ A;  2QA4 A;  5C0X G;  4LF5 L;  1KLU D;  1O7Y A;  1S5C D;  4A76 A;  4DV6 Q;  3HOZ G;  1I4X A;  3P7J A;  1PH8 A;  2IY5 B;  3A8J E;  2CWA A;  5D14 A;  1PVO A;  2OTL A;  4DXG A;  1UEB A;  4C2M B;  2N78 A;  4QB4 A;  1ENF A;  1D2B A;  2IW3 A;  1KNA A;  2KCN A;  1J5E L;  3I4N H;  1KC8 C;  1TS2 A;  1M1K C;  1OXV A;  4CGY B;  3J81 j;  3H3V C;  3IFT A;  1ZEQ X;  1I3Q H;  2L9H A;  1PFB A;  3TSS A;  2AUJ D;  3TRZ A;  5FO9 B;  5DEH A;  2AWN A;  4DNR B;  1TS3 A;  3WDN A;  3K8A A;  5JJK A;  1EY5 A;  3E6Z X;  4DV7 L;  2N3S A;  3S15 B;  1DM0 B;  4X62 L;  5D65 A;  2KQ3 A;  3MZ5 A;  2NVY H;  1Y8P B;  3QWN A;  1HZA A;  4JI8 L;  3TS0 A;  4DK0 A;  4JI6 L;  1HZ9 A;  1V1P B;  2PCF B;  3S1M B;  2EYL A;  1A15 A;  5I6W A;  1SE4 A;  1JWU D;  3S2H H;  3QB3 A;  2Q2I A;  3C2P A;  3W2D A;  3D6C A;  4A3B H;  4GKK Q;  5KNB A;  4CDD C;  1YVC A;  4MTK A;  5EBC A;  3C46 A;  4RGO S;  4OWX B;  1VQ4 A;  5M5X H;  3D4R A;  4FXK C;  1H9K A;  1X3F A;  4XQQ A;  3E3X A;  4K0K Q;  4EQN A;  2KOL A;  3KBX A;  2MUY A;  1C0A A;  3CF5 A;  2B63 H;  1PTO D;  5EKI A;  1AZP A;  1B8A A;  4IUN A;  1NUC A;  1SNM A;  1TWA H;  2PYK A;  3UDF A;  5C4X B;  2CQO A;  4UHV A;  4A3D G;  3J81 L;  4GLA C;  1FJG Q;  3KYH C;  2I5L X;  1EY4 A;  4JBK A;  3F1Z A;  2UXC Q;  5FJ8 H;  4ME3 A;  5IT9 L;  2F0K A;  1E7Z A;  1PTO B;  3I4O A;  2IL8 A;  2PZT A;  2HCC A;  4X6A H;  1PZJ D;  5JEA G;  3PO3 H;  2KEE A;  1CKN A;  1EEI D;  4NP5 A;  3HEJ A;  2RSN A;  3STB D;  1CZW A;  4IJH A;  4UAI A;  3CPF A;  3I90 A;  4K2L A;  1G91 A;  1BF4 A;  3DEP A;  4KY5 A;  2Q8I B;  4C3J G;  2ZXR A;  1HHV A;  1ZYR C;  1LLR D;  1B9N A;  4GN5 A;  2SNM A;  4A3G G;  3M3Y H;  2K5V A;  1TII D;  1B7Y B;  2MQH A;  4X3S A;  1WOC A;  4X3K A;  2BCO A;  5LHY 1;  3F2D A;  4ID6 A;  4HMI A;  3DM3 A;  3OPO A;  4KHP Q;  4JC0 A;  2ZXP A;  4IJL A;  5F2D A;  1STN A;  4UP8 A;  1JJC B;  5E4W C;  1EU4 A;  1ASZ A;  1BKB A;  5EPL A;  1MIU A;  3KUP A;  2K5W A;  3SVM A;  5M3F B;  2WFW A;  1X55 A;  2M2L A;  1R9T B;  3M4P A;  3S9W A;  1N36 Q;  4B3T L;  1UWV A;  2MHV A;  1IYV A;  1KDB A;  2UXD Q;  2A6E D;  1L1O C;  1H9M A;  2NTS A;  4IAL A;  3PUW A;  4TQU S;  2R6G A;  3J80 c;  2A69 C;  1XMO Q;  5A2Q E;  1U9R A;  2JP1 A;  3HOV H;  4XIG S;  5T1G A;  1GHJ A;  4OWW B;  1JWM D;  4G57 A;  4WOR A;  1TWG H;  2B2Y A;  4DUY L;  2V1C C;  3NEN A;  4QQB X;  1WCM H;  3ZJY C;  3OW2 A;  2NVT H;  4RCO A;  1ET9 A;  2HHH Q;  3G4S A;  1FVI A;  1WTQ A;  4XDX A;  1BXT A;  4H13 C;  3OOC A;  2VUM H;  1EFW A;  4G4K A;  4IFD H;  1SMX A;  2EYF A;  2AWO A;  1CSQ A;  2E5L Q;  4LFB L;  3RZD H;  4MNO A;  4AQY Q;  3F2B A;  5IYC G;  4DR4 L;  3FPP A;  3S16 B;  1Y8N B;  4DV1 L;  3KLS A;  2PQA B;  1X3G A;  4JVZ A;  3OHX C;  3I55 A;  1RDP D;  2Y0S B;  3HGB A;  2NVQ B;  4RGM A;  1WD0 A;  3DXJ C;  5IOD A;  5FLM G;  3K58 A;  5DAU A;  2ATW A;  3QJY A;  1TWF B;  1H9S A;  1BNZ A;  3A7A B;  1UE6 A;  1IL2 A;  4QUC A;  2F0O A;  2Z6K A;  1EY7 A;  2F0F A;  3L3O C;  3DWQ A;  1STY A;  4XQN A;  2N88 A;  5H1S E;  2R3Z A;  4DAV A;  3CC7 A;  1SRO A;  1VQK A;  3RNU A;  4OWT B;  1GXD C;  1JOR A;  4IUQ A;  1S4Z A;  1F2Z A;  4ZAI A;  4PV1 C;  2VW9 A;  2KA7 A;  2E2D C;  2B39 A;  2O5I C;  4IPG A;  3C1E A;  2CH4 W;  1SE8 A;  4BBR H;  3PO2 B;  4KKU A;  3X3M A;  4C3H G;  4B3R L;  3ZYY X;  4YHH L;  3EVQ A;  1N33 L;  5AJ3 Q;  2EIF A;  3DWA A;  1K9M C;  2UXB Q;  5FO7 B;  1SE3 A;  3HFZ B;  1HTP A;  5KEE A;  2ZJQ A;  4A75 A;  3JAM E;  1MSG A;  2CCZ A;  4DR7 Q;  5NUC A;  1F9P A;  1GUT A;  1HUM A;  1LTL A;  4K8J A;  5C0X H;  3HOU G;  1TWH H;  2LMC B;  1QIL A;  5EGT A;  3HOZ H;  3MA2 B;  2C35 B;  3HKZ E;  2I07 B;  1F9R A;  5ELN A;  3TZD A;  3BVZ A;  1MJC A;  4KV6 A;  1KQS A;  3RLO A;  5CR3 A;  3ITP A;  2FFK B;  3AQQ A;  4BXX H;  3BZC A;  4C2M H;  1Q12 A;  2Z4I A;  2Z6K C;  4N8F A;  1EY8 A;  5CYU A;  1PH3 A;  4DF7 A;  4DV5 L;  4JBW A;  2RHQ B;  2OTJ A;  3CRL C;  4A3F B;  4M8A A;  2CFM A;  4FYD A;  2QEX A;  5ELO A;  2L55 A;  4LNQ A;  3ULL A;  1EEF D;  4JI2 Q;  3SEB A;  4JI7 L;  4FVM A;  2YTY A;  3FMC A;  4JI4 Q;  1H95 A;  1A3U A;  1Q1E A;  5IWA L;  1K8A C;  3GTP H;  3PF5 A;  4ULL A;  1LO5 D;  4C3I G;  3S15 H;  2Z6B A;  1IYJ B;  4O42 A;  3M4Y A;  1X6O A;  4GKJ Q;  3FHW A;  4YWL A;  1EIF A;  2NBF A;  1VQM A;  1PRT D;  3K6O A;  2K28 A;  4NKL A;  1QUQ B;  3S1M H;  4GOP B;  1DCZ A;  5EBD A;  3RN5 A;  3H15 A;  4A3M G;  1BO0 A;  4WFN 3;  1I94 Q;  1SFO B;  3RN2 A;  1PRT B;  2LXK A;  3IRB A;  2ZTC A;  5C3W A;  5ELC A;  4LK1 C;  1JE5 A;  3NEM A;  3BJU A;  3G6J B;  5A35 A;  1C7Y A;  4A3K G;  1STG A;  3L2P A;  3F2U A;  3F2C A;  3HOY B;  4DAP A;  3JAM i;  4L5R C;  3HOY G;  1B53 A;  4IPH A;  2MP1 A;  3J81 E;  3NWS A;  4DKA C;  1X3P A;  3D0F A;  3KJO A;  1FNU A;  4TVA B;  1HZC A;  1E2Z A;  4J15 A;  4V0B A;  4JCV E;  5IT9 E;  5JEA H;  1PTO H;  1N34 L;  1K0S A;  4CDE C;  3CME A;  1Q82 C;  5BR8 Q;  1XNQ Q;  2A68 C;  1EQT A;  1PYS B;  1NTG A;  2F0N A;  4LWC A;  4A4I A;  5JPN C;  4V19 0;  4QGU A;  3LX0 A;  4OHJ A;  5FLX c;  1LTB D;  3D6W A;  4B9X A;  1K28 A;  2EJG C;  2Q2H A;  1MBY A;  2HIV A;  2QCP X;  5J3B A;  2OWO A;  5ELF A;  1SJH D;  4QJF A;  1EQR A;  4JW0 A;  1S72 A;  3Q22 A;  2K4K A;  1ZXT A;  4XT1 B;  1SLJ A;  3WOF A;  1SR3 A;  4UP9 A;  3UDI A;  1SNQ A;  1DOL A;  4RHR A;  4F8M A;  4APV A;  1FGB D;  3BDC A;  5IYD G;  5KNC A;  5M5W B;  2VXW A;  2F0G A;  2A1A A;  1KAA A;  1BCP F;  2BH2 A;  3CCR A;  2HD3 A;  4RH6 A;  2K04 A;  4OL7 A;  5C44 B;  1R9T H;  4LF6 L;  1CHQ D;  2E75 C;  5C44 G;  2F0U A;  2DJF C;  1EUJ A;  2K5D A;  1B9M A;  2B8G A;  2QEJ C;  3CPW A;  1SRU A;  1YJN A;  3OMG A;  4P75 A;  1K8O A;  2UUB L;  4LF8 Q;  4IUR A;  2DNC A;  5T1I A;  1CI3 M;  4IO9 A;  4BA1 I;  3GTQ B;  1AFP A;  4I7Z C;  1IBL Q;  4RA8 A;  2J4X A;  5EJW A;  2B8F A;  4K5X A;  1IBK L;  2E2J B;  2PMZ B;  3S2D H;  1LT3 D;  3F8T A;  3CCQ A;  3ULJ A;  2VQF L;  1OXX K;  3MXP A;  1ESR A;  3SXH A;  2I5M X;  4DFA A;  4CKC A;  5IYC H;  4HR7 B;  5GRO A;  1X3Q A;  3CXC A;  1MKH A;  2NYZ D;  1N9W A;  2NN6 I;  1VQ5 A;  2J7Z A;  4AH6 A;  1HR0 Q;  2R61 A;  2RDG A;  4K5V A;  1G2T A;  3S16 H;  2E2H B;  1E2W A;  2E2I B;  5FLM H;  4RKL A;  4OX9 L;  2F03 A;  1CA6 A;  5CBA E;  2NVQ H;  3A7L A;  1VMC A;  2VB2 X;  1TWF H;  4KK7 A;  5HY6 A;  4DR5 Q;  3K7U C;  2D0P A;  4HN7 A;  4Q5V A;  2FMC A;  1JJG A;  3NBH B;  4LMQ D;  4XQJ A;  2Q2U A;  1PXU A;  3B6Y A;  3GP7 A;  3NTH A;  5CC4 A;  3KDF B;  2N8N A;  1HZB A;  1XPU A;  1BDO A;  3A5Z B;  3CCS A;  4DR3 L;  3N6R A;  4LF9 L;  2WB1 B;  1LM0 A;  4A3I B;  1PZK D;  3J7A V;  1O7I A;  3K5N A;  1XPO A;  3AMU A;  4JI3 Q;  1YI2 A;  1OO9 B;  1E0B A;  1UE5 A;  2KVM A;  4CJ2 C;  1QJO A;  5A2Q L;  1TY2 A;  4C3H H;  3GTK B;  4DV6 L;  3S14 B;  2C9O A;  5C5M A;  3CC4 A;  4L63 B;  2AQ1 B;  1AH9 A;  3PO2 H;  1CTM A;  4JI5 Q;  4RCN A;  1ML0 D;  2B2T A;  1LT6 D;  1SAP A;  4DV0 Q;  5CV7 A;  2YU9 H;  2ZJR A;  4DUZ Q;  3MC0 B;  4NB3 A;  3NSW A;  4QIW B;  5IGD A;  4DAY A;  1KAW A;  4YWK A;  4AYB G;  1SDF A;  2VUM G;  3T4A C;  1PHJ A;  4K6L A;  3W1G A;  4IFD G;  2AQ3 B;  3NTI A;  3OTO Q;  2K6A A;  1E2V A;  1D5M C;  1QZH A;  5JJL A;  2A6H C;  2NUC A;  4GS3 A;  5GAG C;  1TR5 A;  1XMQ Q;  1SNO A;  4DR6 Q;  1T5E A;  3QR8 A;  4IUU A;  2PNH A;  3R2T A;  1CQF A;  1ET6 A;  4PMW A;  2WKC A;  3HZX A;  4A3F H;  2F0Q A;  1ZYR D;  2FMM A;  4R9W A;  3OIP A;  2IJ0 A;  1PDQ A;  1LTA D;  3LGJ A;  3HKZ G;  4KMU C;  3UDG A;  1C8C A;  2Z4H A;  1EY0 A;  3S1N B;  4C3I H;  1IW7 C;  5E3F A;  2NZH A;  1VQ7 A;  1B3Q A;  2EVB A;  2B2T C;  2AQ2 B;  4K0K L;  2IPK D;  4BBR G;  3CRK C;  3LWU A;  4R1J A;  2UUA L;  2L12 A;  3CW2 C;  1XPR A;  1EOV A;  3PUX A;  3VA7 A;  1YJW A;  3RR5 A;  3NK9 A;  3T1H Q;  2Z9H A;  3W5O A;  1Z9F A;  1SSO A;  2RBM A;  5J39 A;  4IPC A;  1FJG L;  4EVO A;  1EIY B;  3S17 B;  1IZ6 A;  2NVX B;  2UXC L;  2PO4 A;  1EYG A;  3DMU A;  1SFO H;  2B29 A;  4IZ8 A;  3VDY A;  3Q6S A;  1U5K A;  3T13 A;  4OIJ A;  1STA A;  3EBE A;  4A3K H;  2NZO A;  2ENB A;  2F1M A;  3PMF A;  1JWS D;  1L0Y B;  3E9H A;  1JCK B;  2KHJ A;  1HPC A;  3HOY H;  4BXX G;  1GUS A;  4ILW A;  1GD7 A;  1XNR Q;  3I2Z A;  1HNW Q;  1R4Q B;  3H3V I;  1Q8I A;  1CKN B;  1W3S A;  4JBM A;  3CCL A;  1KXL A;  1BCP D;  2ASB A;  2A19 A;  4JYA Q;  1EQQ A;  1HR0 W;  3R3O A;  1NR4 A;  4KJN A;  4A3J B;  1CSP A;  2EDG A;  3UE0 A;  3K5M A;  1YNN C;  3BYT B;  4H0L C;  2CH4 A;  5HGT A;  1J9O A;  2BDO A;  1IBM Q;  1W6K A;  5M3M B;  4MTN A;  4LFA Q;  1WTO A;  4A3J G;  1D1I A;  4KHP L;  3NXW A;  2K50 A;  1BCP B;  2YTV A;  5IGC A;  1LAB A;  3L9A X;  2K7V A;  5JVH 3;  2PPB C;  4WJ3 M;  1S5F D;  1N36 L;  1EU3 A;  2L11 A;  2UXD L;  5IYD H;  3FP9 A;  1HCZ A;  4I7A A;  1EY9 A;  4DR3 Q;  4DV3 Q;  2JSO A;  3I3C A;  4N9P A;  5I9P A;  4F7X A;  5GAH C;  1X54 A;  2ZTD A;  5M5W H;  4GN4 B;  1W2B A;  1WTW A;  1HA5 A;  2ICE C;  3HRZ C;  4MN3 A;  1TQO A;  2MNA A;  4FXG C;  3U58 A;  2K5Q A;  1FR3 A;  2NZ1 D;  2PW7 A;  2M00 A;  1KRT A;  2HHH L;  5C44 H;  2F4V Q;  2XSC A;  4Y7N B;  1HH2 P;  3GD7 A;  3K7A H;  2I0Q A;  2JA5 B;  4X3U A;  3CU7 A;  2E5L L;  5KYL A;  1Q1B A;  2F0L A;  2Z1C A;  2HIX A;  1KHI A;  3ND8 A;  1PRT F;  4AQY L;  5C4X G;  4L8J A;  1L1O A;  1ASY A;  5FLX L;  3GTQ H;  5M5Y H;  2EY2 A;  2F0T A;  1QG7 A;  5IGF A;  1A63 A;  3KK7 A;  3RUZ A;  2E2J H;  5ISR A;  4BY7 B;  2CW0 D;  2OF1 A;  1TVX A;  1Q8K A;  3CQZ B;  1QNU A;  3U9S A;  1J8I A;  1AE3 A;  3CKI B;  1NMF A;  4K2K A;  5CV5 A;  1TKW B;  3I7F A;  2F0E A;  5JAV A;  1H9S B;  4GNX C;  1EZ8 A;  2L5T A;  1D7Q A;  2L4N A;  2OCE A;  2E2H H;  1T9H A;  2E2I H;  3I4M B;  1YZ6 A;  3G7L A;  5KGU A;  2R7Z B;  3BVM A;  2EYJ A;  2JK8 A;  4RHS A;  2ZM6 Q;  1NY4 A;  1VDZ A;  4IOA A;  1EL0 A;  2PMZ E;  3RLN A;  2L0C A;  4ZYS A;  5AJ3 L;  2PZU A;  3DEO A;  1LAC A;  2UXB L;  1E22 A;  3J80 E;  2LS0 1;  4A3L H;  1PFM A;  4DR7 L;  1V9P A;  1ROD A;  5M3F G;  4IUP A;  1YNX A;  1HXY D;  1LT4 D;  4A3I H;  2EYP A;  3SGI A;  1M8A A;  4DV4 Q;  5C0X I;  4YWM A;  3M7G A;  3HOW B;  3PSI A;  3GTK H;  3S14 H;  3HP3 A;  5EKK A;  2DY8 A;  4BWG B;  4HCE A;  3HOW G;  1GUO A;  1UNS A;  3PQI A;  1VQL A;  1LTT D;  3VR5 A;  2PI2 A;  1B44 D;  4DR1 Q;  1UE7 A;  3MEF A;  4KLK A;  1S5E D;  3NQT A;  1PH2 A;  2VY3 A;  1OTC A;  1AN8 A;  2KED A;  3V2T A;  1VCI A;  4PMB A;  1D1K A;  5J1Z A;  5DM6 3;  1G6Z A;  1EZ6 A;  3H0G B;  5C5L A;  4JI2 L;  1GHK A;  2PZW A;  4JI4 L;  1BVS A;  5D3D A;  1VQP A;  1DD2 A;  1BBW A;  2EYM A;  2G5D A;  1LYL A;  3I4L A;  2Y0S G;  1PLF A;  4KI0 A;  2ALY B;  5ELB A;  5IP9 H;  4NXM Q;  4B3M Q;  3AEV A;  2A68 D;  4GKJ L;  4RG1 A;  4ZRZ A;  2WAC A;  3MHB A;  3GTL B;  2K1B A;  1KLG D;  2D2C C;  2P5Z X;  4G7O C;  4M1U B;  3P20 A;  4AYB E;  4YIJ A;  4JBJ A;  4QIW E;  4LF4 Q;  3E5S A;  1DYQ A;  2OQ0 A;  5IGG A;  2JEA I;  1FNW A;  3WWV A;  1I94 L;  5C4Z A;  2SDF A;  1PH5 A;  4HIK A;  2FIN B;  3M85 A;  3S1N H;  2ZXO A;  1B50 A;  5IE8 A;  2A8V A;  4JI1 Q;  1U4M A;  3W1B A;  2KHS A;  1Y8O B;  2OEO A;  3NTK A;  1VQ9 A;  2RKS A;  3NHH A;  4DK1 A;  3QO2 A;  3PO2 G;  2RVL A;  4XXE A;  2O4X A;  3K5L A;  5C3E B;  1GKH A;  2H5X A;  1E24 A;  1Z7T A;  2E74 C;  2RA4 A;  1CHP D;  2F0S A;  1YBY A;  1SYF A;  3GV3 A;  4R4C A;  1ILP A;  2FJ2 A;  5CGK A;  2QDB A;  1JJ2 A;  1QVG A;  2NVX H;  3S17 H;  2GVA A;  1HNZ Q;  2RCN A;  3G48 A;  4JOI A;  5J22 A;  3ERQ A;  1K73 C;  1LV9 A;  5M9O A;  1AZQ A;  1L0X B;  4XTC S;  5BR8 L;  5D3I B;  2WP8 J;  3CP0 A;  1XNQ L;  4DK6 C;  1F9S A;  4DV2 Q;  2HDM A;  1Y1W B;  4YCV A;  4YCW A;  2HUG A;  3E9I A;  2B3G A;  1XWE A;  3Q24 A;  3EQL C;  4JI0 L;  3JAM c;  4H02 A;  1XYI A;  3GTJ B;  1Q3L A;  5I9O A;  2MO1 A;  1A6X A;  3CC2 A;  4L5Q A;  1OXT A;  2AMC B;  4A3F G;  3MTS A;  3STB C;  2UUC Q;  4KD3 A;  2WKD A;  4A3J H;  2VB3 X;  2JJQ A;  4NXN Q;  1SEB D;  1PFN A;  5M3M H;  2JN4 A;  4RWS C;  1UE1 A;  3NQI A;  1X32 A;  1IHZ A;  4R4O A;  2NN6 G;  3PCO B;  5CMD A;  5JPM C;  5LMN Q;  4FF2 A;  2UU9 Q;  3FRP B;  5FKA C;  2MFI A;  4HJ5 A;  1F77 A;  1I6V C;  4QCL A;  4E6I A;  4ZKC B;  4TSS A;  2Q8R E;  4JOI C;  2HT1 A;  1VF5 C;  3CCV A;  2QIL A;  1YEZ A;  1WFQ A;  4R8I A;  2EY6 A;  3D3R A;  3GTO B;  4KTA A;  5K5P A;  3UE1 A;  4HTH A;  3G6E A;  1BOS A;  2EJF C;  4WRD A;  1TWC B;  2B2W A;  5LMU L;  1EWC A;  1O7L A;  1WVL A;  2K75 A;  4POF A;  2V4D A;  5LL6 S;  1JE4 A;  4Y7N H;  3IKJ A;  1NE3 A;  4OEL B;  4B9W A;  5C4X H;  2A5H A;  3TRE A;  3E0E A;  4K14 A;  1HR0 L;  1UEA B;  3R2I A;  4ME5 A;  1TT2 A;  5FLX E;  4A3E B;  1Y1V B;  5C3X A;  3MXN B;  2C5C A;  1L0W A;  1K8M A;  4DR5 L;  1TY0 A;  1GUN A;  3NP8 A;  3GQB A;  4POG A;  4G7Z C;  3A74 A;  1HNX Q;  2M9V A;  3J7A F;  2KEN A;  1NR2 A;  2O2L D;  4JG2 A;  4IN3 A;  4ABN A;  4BBS B;  3ONA B;  1SE2 A;  4CDC C;  1WTR A;  3I56 A;  3J81 c;  1F2L A;  4BBS G;  4JI3 L;  1SBB B;  1C9O A;  3QG1 A;  5EQ0 A;  5DM7 3;  1VS0 A;  1X65 A;  5JVG 3;  3W3A A;  1TU2 B;  3I4M H;  5IT9 c;  3I91 A;  2D9U A;  2R7Z H;  4YY3 Q;  4RAU C;  1QE6 A;  2HQL A;  5JJZ A;  3CMA A;  1UAP A;  4JI5 L;  1S5B D;  2K05 A;  3SHL A;  4X66 Q;  2B2W C;  1A3V A;  2F0D A;  3FVQ A;  1QVF A;  2HCI A;  1HA6 A;  4DV0 L;  2ZTE A;  3ULP A;  4J1M A;  1MSH A;  3X3N A;  2E8G A;  4Z9C B;  3GO5 A;  5M3F H;  4ZCK A;  4DUZ L;  1PH9 A;  1N32 Q;  1RTN A;  1KAB A;  4K8I A;  3MFG A;  1K83 B;  2DUD A;  3BG3 A;  2RCF A;  2I46 A;  4X3T A;  1Q86 C;  4S3S A;  1EYA A;  4MZ9 A;  4DAM A;  3OTO L;  3HOW H;  1IYU A;  1FGU A;  2F0J A;  4KD4 A;  4DAY B;  1LTI D;  3BU2 A;  3BYY B;  4HJ8 A;  1VQ6 A;  4CKE A;  1XMQ L;  4DR6 L;  1YNJ C;  3I8Z A;  1D5X C;  3EN2 A;  1GM5 A;  2A73 B;  1PFS A;  2F0H A;  5CV4 A;  1U0L A;  1JOK A;  4OO1 I;  2K03 A;  4B3S Q;  3J81 i;  3BZD B;  4FNF A;  1CKM A;  3VYU A;  3K0X A;  4HAE A;  1I4Q A;  4O1N A;  4MIU A;  2QW7 A;  2LY7 A;  3PO3 B;  1V43 A;  3BDO A;  5CV6 A;  4P2C B;  2B2V A;  4KKS A;  4F87 A;  1YIT A;  3L0O A;  3P1H A;  4BS9 A;  5GAE C;  4HIO A;  4OEM B;  3SR1 A;  3ERS X;  4B08 A;  1IKM A;  3NUC A;  3K80 C;  3IL8 A;  2IX0 A;  1M4V A;  3GTL H;  3J80 L;  1E3P A;  2Z8L A;  1KRS A;  3T1H L;  1JC7 A;  4NDX A;  3A5U A;  3T1Y Q;  4A3L G;  4CJ1 B;  3H6M A;  4LFC Q;  4LAA A;  3CCJ A;  5IGE A;  3C1F A;  4OGQ C;  3O13 A;  2K33 A;  2WB1 G;  4A3I G;  4PZ8 A;  1Y14 B;  4UDU C;  1K3B C;  1FYC A;  1VQE A;  3I70 A;  1VQ8 A;  2JA6 B;  3LNN A;  1XTC D;  4DR2 Q;  1Z6H A;  4N9T A;  1EQV A;  2Y0S E;  4QF4 A;  2F3W A;  3MXU A;  1WTP A;  2Q8T A;  3V05 A;  2MGS A;  1I4H A;  3IFD A;  2PQE A;  1QZG A;  1H9J A;  1X56 A;  2XGT A;  5EPK A;  1XNR L;  2PW5 A;  1C48 A;  1HFG A;  2L15 A;  3HS0 C;  3EA6 A;  2ZJP A;  5KIX A;  1RCV D;  2H4O A;  1HNW L;  3QOL A;  2VS1 A;  2PNR C;  3N52 A;  5FO8 B;  4A93 B;  1OXU A;  1KL9 A;  2CQA A;  1VQF A;  3TME A;  4JYA L;  1VQD A;  3AFQ A;  2B2V C;  4A93 G;  5CV9 A;  2R93 B;  2SEB D;  1BBU A;  4LF7 Q;  2KBN A;  1IBM L;  3I73 A;  1VQN A;  4LFA L;  1KIX A;  3M7N A;  4G7H C;  2F0W A;  2JE6 I;  4HJ9 A;  4LF6 Q;  4LUV A;  5E4X A;  1SMY C;  3L7Z C;  5IP9 G;  4BY1 B;  2D0O A;  3D4D A;  2OT2 A;  1JT8 A;  1U4R A;  1B4O A;  1O7Z A;  4XYO A;  4H44 C;  2JA8 B;  3EIV A;  5C4H A;  1O80 A;  1EIH A;  2EY1 A;  1KTK A;  2QDL A;  3S24 A;  4HJ7 A;  2VZA A;  4GKK L;  2BDN A;  3K59 A;  4JPB W;  1WTH A;  4X64 Q;  1W6J A;  2EOT A;  4KY7 A;  1BBX C;  1SYG A;  1PA6 A;  3TP8 A;  4XYQ A;  3T51 B;  1I6H B;  4RGT A;  3CCU A;  2NN6 H;  2XNA C;  5ELD A;  1HJP A;  1WTX A;  2SNS A;  2YYZ A;  2F4V L;  1IXR A;  1CQV A;  2MPM A;  3J7Z C;  3SK6 A;  1QOH A;  3G71 A;  5K36 H;  4X65 Q;  4U68 A;  1TS5 A;  1Q90 A;  1WJJ A;  4EQ5 A;  1VQO A;  1DXM A;  1DJR D;  3MXG A;  3TEH B;  3KF6 A;  2A69 D;  2RQX A;  2Z0S A;  1KDC A;  4R8N A;  1A3T A;  3GTO H;  1Q81 C;  3MWY W;  4P74 A;  1TWC H;  1L1O B;  1JOO A;  4LF9 Q;  3VA5 A;  1XXG A;  4GLX A;  4GZY C;  3OWF A;  2B2U C;  2LKV A;  1BR9 A;  2WAQ B;  5G3L F;  2MJ8 A;  1UUP A;  3P75 A;  5HUR A;  4A3E H;  1Y1V H;  2WAQ G;  3VR6 A;  3CCM A;  4R4T A;  1N8R C;  2R92 B;  2ZT9 C;  2ZM6 L;  1JOQ A;  1STB A;  2K5H A;  2R92 G;  3H94 A;  5M3M G;  4Q0F A;  2BE5 C;  3JC6 6;  3EJI A;  2XTI A;  3V96 A;  1GJX A;  4BBS H;  1EYC A;  3D8G A;  2DN8 A;  1I50 B;  3U4Z A;  4ZQ3 A;  3GTP B;  4OON A;  4GNX A;  1G51 A;  4DV4 L;  1A0I A;  1YIJ A;  4TKO B;  3M9B A;  2K5N A;  1X9N A;  1XMO L;  4CKB A;  4JV5 Q;  5I6Y A;  3DLL A;  1AEX A;  5TSS A;  5DLQ E;  4BA2 I;  4DR1 L;  3PIP A;  1I4G A;  1S5D D;  2VQE Q;  1TXY A;  2KCT A;  3PIP 3;  3BZK A;  3VYS A;  1FD7 D;  2QF7 A;  2EJM A;  5EAY A;  3RZO B;  4RKB A;  1K83 H;  2H1E A;  4IFD I;  4C1N K;  2GN5 A;  2JA5 G;  5CBE E;  3RMH A;  2F4I A;  1PH1 A;  1FNV A;  2EXZ A;  3KF8 A;  3K5O A;  4L5T A;  5BN4 A;  1MD2 D;  1KD1 C;  2X69 A;  2UUA Q;  2ICI A;  4TRD A;  5L37 A;  4A3D B;  4IFD J;  2WV6 D;  1PMR A;  1CKO A;  2RHS B;  4NXM L;  4B3M L;  1AE2 A;  2EZV A;  2YV5 A;  2RSO A;  3SE0 A;  4BY7 G;  2MO0 A;  1QWY A;  1RIP A;  4ALP A;  1RD9 D;  4LF5 Q;  3QIA A;  4PG3 A;  4KN7 C;  1SXT A;  4LF4 L;  3S1R B;  1P16 A;  3Q23 A;  1F9Q A;  3M4O B;  5HGQ A;  2KHI A;  3QOJ A;  1SYE A;  1Z47 A;  3HKS A;  2JA7 B;  1LUZ A;  2D5D A;  4YCU A;  3TP6 A;  1BUV T;  4C3J B;  4ZUI A;  4CDF C;  4KN4 C;  2BOS A;  4JI1 L;  1OXS C;  2JA7 G;  3I4M G;  1MJE A;  1DGS A;  2OXP A;  4DN4 M;  4ZKB B;  1J5E Q;  3AYH B;  3UDX A;  2Q2T A;  2R7F A;  3H3V H;  2R7Z G;  2OQK A;  4ZK9 B;  3ER0 A;  1HRJ A;  5C6A A;  1WTV A;  4A3G B;  3J7A 5;  3OW7 A;  5IY0 A;  4DGZ A;  4WJW A;  4ODG A;  1A2T A;  4LUO A;  1XX8 A;  1F2M A;  4PNY A;  3K57 A;  2TSS A;  2JA9 A;  5KRU A;  1CT1 D;  1VQA A;  1V1P A;  4A3C G;  4DV7 Q;  1HNZ L;  1JB3 A;  4X62 Q;  2EY5 A;  2I5H A;  2EE1 A;  3NE5 B;  3CCE A;  3TP5 A;  2IX1 A;  1WYD A;  1ZKO A;  1SNC A;  2JA6 H;  3TZU A;  4RFB A;  2G9H D;  4JI8 Q;  2JQO A;  4JI6 Q;  4UPA A;  5C0X J;  4DK3 C;  1ICF B;  4DV2 L;  4FF1 A;  1QB5 D;  3PIO A;  2KCC A;  2XVS A;  5IIF A;  3Q0A A;  3U9O A;  1EWH A;  3PIO 3;  3MVV A;  1PH7 A;  2XWJ B;  2GVB A;  3GTM B;  2A74 C;  2AKW B;  3WOE A;  3HOX B;  3VR3 A;  2BH8 A;  4A93 H;  3S2D B;  3U4V A;  1A2U A;  2KEC A;  2WB1 E;  3RLF A;  3DHQ A;  3HOX G;  2UUC L;  3H0G G;  2WIN B;  1KDA A;  2IWH A;  3AFP A;  3S1Q B;  3D31 A;  2R93 H;  1I5F A;  4NXN L;  1GUG A;  4ZUJ A;  1G6P A;  3FPU B;  1CA5 A;  4DNI A;  5DNF A;  3A0J A;  1IKL A;  3NBI A;  4J6H A;  3SK4 A;  1BCP C;  4FDB A;  3OMC A;  4BY1 H;  2K01 A;  5LMN L;  2EXD A;  2UU9 L;  2RF4 A;  4EGV A;  4EX5 A;  1VQG A;  3TS2 A;  2JA8 H;  1HTL D;  2CWP A;  1D8L A;  3PGZ A;  3VYR A;  3T56 B;  2AHO B;  1D6E C;  4L5S A;  1KNE A;  3FKI B;  1GUW A;  1SJE D;  4OXP A;  1NNX A;  4LW1 A;  1I6H H;  3FKI G;  1K0R A;  4OIK A;  5JOB A;  4HMJ A;  3J80 i;  1EY6 A;  1EFI D;  4I65 A;  5JJI A;  1AW7 A;  5G3L D;  5ELE A;  5C3E G;  3H09 A;  1MHW C;  4EQO A;  4Y52 H;  4C3H B;  1QCB D;  3U50 C;  2B2Y C;  2WII B;  1I4R A;  4PMC A;  2JYO A;  2F0I A;  3OSO A;  3CHB D;  5IP7 H;  3BDL A;  1SND A;  2G9D A;  1STH A;  3DM1 A;  1DON A;  1PTO C;  2YU9 B;  4K5W A;  1YJ9 A;  2RDF A;  4R4I A;  1QNK A;  3HOU B;  1D5Z C;  3VYT A;  4C56 C;  4B3T Q;  2KCM A;  4CHT B;  1AP0 A;  3E0J A;  3VR4 A;  4KY6 A;  1HNX L;  1Q46 A;  5C4J B;  5IYB G;  2BA1 A;  1YNJ D;  1RF2 D;  5JEA J;  1LTS D;  1G8Z D;  4NW2 A;  1Y1W G;  1CUK A;  3M4Q A;  4CBV A;  3BS1 A;  2SOB A;  3PUV A;  1VQI A;  4P71 A;  2XN9 C;  2CW0 C;  1GVP A;  3DWP A;  4QUF A;  4DUY Q;  1ICW A;  1SYD A;  4NPS A;  5IGB A;  2R92 H;  2PQA A;  1VMP A;  2VNU D;  4YY3 L;  1ENC A;  1II3 A;  2KUM A;  4FP5 D;  2ES2 A;  4X66 L;  4OO1 G;  2ID0 A;  1C4Q A;  1SNP A;  3GDE A;  3KBG A;  3C3L A;  4LFB Q;  1GO3 E;  2LSS A;  2QKI C;  4RGN A;  2IX3 A;  4DR4 Q;  2FXQ A;  1N32 L;  4DV1 Q;  1MGS A;  4C3I B;  1NBW A;  3KLR A;  1I50 H;  5IOC A;  2NB0 A;  5K36 G;  3GTG B;  4LF8 L;  4KJO A;  2WAQ E;  1DOM A;  3A56 A;  1J6Q A;  4HSV A;  1FL0 A;  1IBL L;  2D62 A;  5BN3 A;  3J7Y W;  1B3A A;  3PUZ A;  1EIG A;  4A3M B;  5BN5 A;  2A6E C;  3BVG A;  3CD6 A;  2EQS A;  3OWE B;  1SYC A;  4P73 A;  4B3S L;  3SK5 A;  2JA5 H;  1PYW D;  3CAM A;  4FXD A;  3ND9 A;  3UI2 A;  2DGY A;  3RZO H;  4KHZ A;  1BQQ T;  1VQB A;  3KOJ A;  4A3K B;  4DA2 A;  4B3R Q;  4YHH Q;  1N33 Q;  2IT1 A;  1VQJ A;  4LUZ A;  4FF3 A;  4K6D A;  4HCS A;  4A3E G;  1Y1V G;  4A3D H;  2A6H D;  1EOT A;  1RL2 A;  2NTT A;  3ICE A;  3I4N B;  4BY7 H;  4J8Q A;  2K32 A;  3LWE A;  3CQZ H;  3I4N G;  1LT5 D;  1I3Q B;  4ZLT F;  4IUT A;  1HFN A;  1YHQ A;  3AU7 A;  1ONL A;  1SMY D;  5FK9 C;  1V8Q A;  3T1Y L;  2F0M A;  1Q7Y C;  3MAQ A;  3S1R H;  4HID A;  3OIQ A;  4LFC L;  3M4O H;  1Y69 U;  1SYB A;  1ENA A;  5EPJ A;  1TS4 A;  3VR2 A;  5FOB B;  2JA7 H;  1YHA A;  2PI2 E;  2N49 A;  2NVY B;  2XRS D;  4C3J H;  4DR2 L;  1RKN A;  2F3V A;  1IW7 D;  1T5X D;  1L2F A;  5GQO A;  1QVC A;  4DV5 Q;  4DPG A;  4IOC A;  3T53 B;  1VQC A;  4JI0 Q;  4DXF A;  3IAY A;  3S2H B;  4A3G H;  2VL6 A;  3TBI B;  4NMZ A;  3FDT A;  4A3B B;  1HQM C;  4O2D A;  1DOK A;  3TP7 A;  4JI7 Q;  1JIC A;  5GAD C;  4LJZ C;  4A3C H;  1CM9 A;  5I2X A;  4A3B G;  5EKL A;  5IWA Q;  5M5X B;  1QUQ A;  2E76 C;  4GOP A;  2RDH A;  5KYI A;  3NPP A;  4PZ7 A;  1E1T A;  4LF7 L;  3TDQ A;  2K14 A;  2B63 B;  3KLW A;  2KJX A;  1DZ1 A;  3K7A B;  1TWA B;  3K0Y A;  2B63 G;  2F0V A;  1HUN A;  3K81 C;  1CFM A;  2LFN A;  1E1O A;  1NCV A;  4WJ4 A;  1LTR D;  4XT3 B;  1V1Q A;  5COR A;  5M5Y B;  3GTM H;  5FJ8 G;  3OYY A;  3HOX H;  1IL8 A;  1HQR D;  3H0G H;  1ILQ A;  1XTD A;  2K52 A;  1B1Z A;  4PQX A;  3A8K E;  1NJI C;  5LMU Q;  4X64 L;  3S1Q H;  3PO3 G;  3AB9 A;  5AFW A;  3A55 A;  5I2Y A;  2N55 A;  4HSP A;  1YNN D;  2HDL A;  2JXM B;  3MXN A;  4HED A;  1B2T A;  1XJV A;  3KJP A;  5COY A;  3RD4 A;  4QY7 A;  2CVR A;  3DUZ A;  1ESF A;  3KFU A;  1LTG D;  2DNE A;  1WD1 A;  1VF7 A;  4C1N I;  1PTO F;  1G2S A;  2BE5 D;  4HIM A;  3M3Y B;  4FO2 A;  1EYD A;  5LMN W;  4KKT A;  1PH6 A;  1N34 Q;  4X65 L;  4GOP C;  4IPD A;  4DNT B;  3MEH A;  1F2Y A;  1U4P A;  2LXJ A;  4AIM A;  3A54 A;  3TQY A;  2TMP A;  1RJT A;  2JEB I;  3PUY A;  3FKI H;  1PRT C;  1PYB A;  3T16 A;  4R4Q A;  3H91 A;  2JA6 G;  4QMG A;  1I4P A;  1B70 B;  5C3E H;  2GA4 B;  3NEL A;  1A62 A;  5LL6 X;  1JB7 A;  2QGQ A;  1P8L A;  3KF6 B;  2CKZ B;  2F3I A;  1R4P B;  4O0A A;  3HOV B;  2XRQ D;  1NAP A;  2XIW A;  1K3R A;  3NWT A;  4F88 A;  1TWG B;  4MHE A;  1YHB A;  1K8G A;  1H9R A;  1RTO A;  3HOV G;  1EWI A;  1WCM B;  4EQP A;  1WI5 A;  2NVT B;  1JR0 D;  2YTX A;  1V1O A;  2FHT A;  1MI2 A;  1PZI D;  2DJG C;  3URY A;  3EFX D;  4QL5 A;  3PV0 A;  4IUV A;  2HQE A;  1WCM G;  4AYB B;  5E1F A;  2VUM B;  2R93 G;  4RMF A;  5IYB H;  3HOU H;  1GOZ A;  3ERO A;  3GV6 A;  3HG9 A;  2L1B A;  3SK8 A;  3RZD B;  5E7N A;  1O78 A;  3SDZ A;  2EYO A;  1Y1W H;  5C4J H;  2EYH A;  4CJ0 B;  2O5J C;  5I4D A;  2UUB Q;  1U4L A;  3MFY A;  4L6T B;  4BY1 G;  2B2U A;  3GTJ H;  1SN8 A;  1X3E A;  4UY8 C;  2F52 A;  1IBK Q;  3KLS X;  1VQH A;  2BA0 A;  4JK1 C;  2JA8 G;  3FEW X;  2F0P A;  3R93 A;  4DV3 L;  1G29 1;  1M90 C;  3PF4 A;  2CHB D;  2EPB A;  3A8I E;  4HJA A;  4OO1 H;  2IHF A;  2VQF Q;  1NMG A;  4JV5 L;  3TN2 A;  4GN3 B;  2XWB B;  4GLV B;  3Q8D A;  4GNX B;  1STE A;  2VQE L;  2NWG A;  4H7B A;  3HKZ B;  1CZG A;  2DY7 A;  2R7D A;  3NBH A;  1JQY D;  2X6L A;  4OX9 Q;  2J0T D;  4U67 3;  1RHP A;  2AUK A;  1PH4 A;  3KDF A;  4P72 A;  4KHV A;  3R8B A;  4BBR B;  4UP7 A;  3GTG H;  4DU9 A;  1S40 A;  4N8X 1;  5CV8 A;  5IP7 G;  1A8V A;  2X6G A;  1JMC A;  4PZ6 A;  3JAM L;  1PV4 A;  4A3M H;  1S3O A;  3D4W A;  1CK1 A; 
#chains in the Genus database with same CATH homology
 1NNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...