1KNAA

Chromo domain of hp1 complexed with histone h3 tail containing dimethyllysine 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HETEROCHROMATIN PROTEIN 1
publication title Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Structural protein
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1knaA00
1JICA 3GV3A 4MHEA 4CJ2C 1RTOA 1QNKA 1Q3LA 1SAPA 1O7YA 3I90A 1WTPA 2RSNA 1HUMA 2NYZD 1G2SA 2K03A 5EKIA 1J9OA 1RJTA 1WD0A 4OIKA 1EIGA 1QE6A 4XT1B 5EJWA 1WTOA 2MPMA 4IUTA 5EQ0A 1BNZA 5AFWA 1G91A 2X69A 3MTSA 1HRJA 1SSOA 1F9QA 1U4PA 1BO0A 2K05A 4ZKCB 1XX8A 1E0BA 5COYA 4IUQA 2IL8A 1X3PA 2FMMA 1TVXA 1IKMA 1LV9A 5CBAE 1IL8A 1U4LA 1BBXC 1F2LA 3KUPA 2X6GA 4ZK9B 2L9HA 1RHPA 2X6LA 3TN2A 1WTRA 1MSGA 2K28A 3IFDA 4O42A 1WTQA 1WTXA 1MI2A 1QG7A 1WVLA 1U4RA 2KVMA 1ICWA 1O80A 3G7LA 1CA5A 1U4MA 2KECA 2CVRA 2HCCA 2SDFA 1AZQA 1HA6A 1ML0D 5EPLA 2JYOA 1HFGA 4XT3B 1WD1A 2L1BA 1C8CA 1B2TA 1X32A 4NW2A 3R93A 1EL0A 2RSOA 1O7ZA 1WTWA 1HUNA 5D65A 4QUFA 3I91A 1PFMA 1PLFA 2H1EA 1JE4A 2KOLA 1AP0A 5CORA 4R8IA 2MJ8A 3GV6A 2Q8TA 3TZDA 4CJ0B 1NAPA 2N55A 4RWSC 1WTVA 2DY8A 1G6ZA 2EPBA 2D9UA 1GUWA 3FPUB 3I8ZA 1RODA 1F9SA 3HP3A 3ONAB 2B2VA 1VMCA 2NWGA 2L12A 5T1IA 1EOTA 1DOLA 4CJ1B 4MN3A 4XDXA 2HCIA 1PFNA 5EPJA 1DOMA 4IURA 3DEPA 2EOTA 1NR4A 2MGSA 3UI2A 5CMDA 1XYIA 1BF4A 4HSVA 1DZ1A 3N52A 3H91A 4RA8A 2NZ1D 4ZKBB 2J7ZA 4U68A 3D6WA 1ILQA 2RVLA 1B4OA 2HUGA 1CA6A 1EIHA 5E4XA 2JP1A 4X3SA 1AZPA 1G2TA 2XIWA 4X3KA 2RA4A 2L11A 1DONA 2B2VC 3DM1A 1CM9A 2FHTA 3SVMA 2VXWA 1F9PA 1B53A 4ZAIA 2HDLA 4RAUC 2B2UA 1J8IA 1KNEA 5DNFA 2KEDA 3KBXA 5T1GA 1VMPA 2BDNA 2B2TA 3I3CA 4IUUA 4HEDA 2K1BA 1S4ZA 4HAEA 4X3UA 1ESRA 1B50A 5E4WC 4R9WA 1HHVA 4HCSA 1KNAA 2Q8RE 1ILPA 3F2UA 4LMQD 2MP1A 4DN4M 2N88A 2B2WC 2FINB 1MGSA 4IUVA 4ZLTF 2B2YC 1SDFA 1ZXTA 1M8AA 1IKLA 2B2UC 3Q6SA 1EQTA 2DY7A 3FDTA 3LWEA 2B2TC 4IUPA 3IL8A 1X3QA 1F9RA 1NCVA 2EE1A 1NR2A 3P7JA 5D14A 1DOKA 1PFBA 2B2WA 2K01A 2KUMA 2R3ZA 4X3TA 1A15A 5CBEE 1HFNA 2KEEA 1RTNA 2K04A 2L4NA 3DEOA 4OIJA 2B2YA 1MSHA 3QO2A 5JJZA 2FFKB 1PDQA 5EPKA 4UAIA 1B3AA 3MWYW 2HDMA 2FJ2A 4QUCA 2M2LA
chains in the Genus database with same CATH superfamily
1I5FA 1RTOA 4PZ6A 2ZM6Q 1ET6A 5C44G 1BBWA 4JI1Q 4Z9CB 1GM5A 1QUQA 4RCOA 2ASBA 1SSOA 4NXNL 1EIYB 4JI3Q 1YBYA 4B3ML 3OIQA 1V8QA 1OXSC 3UDGA 1WTRA 4B3TL 2BH8A 3MEFA 3VYTA 2B63H 1KC8C 5JJIA 3BDCA 4ZYSA 2EYLA 3G7LA 2JE6I 5IGDA 4P74A 1BBUA 4GLVB 3E5SA 1HFGA 4LUVA 4DK3C 1SN8A 5LMNL 4JI7L 1CZWA 4ME5A 3QB3A 4DU9A 2VUMG 1A3UA 1EY8A 4X65L 3HOZH 5GADC 1PFMA 1ASYA 1WCMH 1D1IA 3U9OA 4KV6A 1EYAA 3J81i 2N55A 2Y0SB 1SE2A 5JJLA 5C5LA 4K6LA 4JK1C 3HOVH 3TSSA 4P71A 4QMGA 3CRLC 2RQXA 2F0MA 1GOZA 1CHQD 5EKLA 4A75A 3K57A 3QIAA 3HKZE 1B7YB 1LTAD 4L5QA 4IZ8A 1EWCA 3CQZH 2JA5B 2SNMA 1SYCA 3OOCA 2NZHA 5CV5A 3K5OA 3A8KE 2BDNA 1CQVA 5A2QE 2GVBA 3EFXD 2RCFA 5I9PA 2IX1A 2Q8RE 3K80C 2H4OA 4HJ8A 4L5TA 3S2HH 1KLUD 3HOZB 1H9MA 1WCMB 1SYDA 4CDCC 1ZXTA 2K32A 1YJWA 3BYYB 3F2DA 2JSOA 4UY8C 3S15H 2F0UA 3IL8A 3CCVA 2A6EC 2UXBQ 4K5VA 1BXTA 5IP7G 2L4NA 2YTXA 2E75C 3MFGA 3Q8DA 2F1MA 2Z0SA 1Z6HA 1PZID 3GTQH 1UE6A 2XTIA 2PPBC 1LTGD 1HR0W 3RD4A 3I4NH 4BBRH 4KJNA 3VA5A 1R4QB 1T5XD 1HUMA 2G5DA 3MXUA 2FXQA 4GN3B 3STBD 2C9OA 2R93G 1BNZA 1G91A 3FMCA 2OF1A 1MJEA 5ELBA 2NZOA 4K8JA 2IL8A 1B1ZA 2BDOA 5J1ZA 1U4LA 4LFAL 4BY7B 3NTIA 1N33L 1MSGA 3A5ZB 4CKBA 1H9SA 2ES2A 2IX0A 3TREA 4C3JG 4A3JB 1MI2A 1YNJC 1WVLA 3CPWA 2JA6H 4JC0A 5M5WH 2KECA 1XNQL 3S15B 4A3GH 3CCQA 1E2VA 2AQ3B 1WD1A 4DAMA 4HJ5A 1K0RA 3R93A 1EL0A 4HMIA 2LXKA 4DGZA 1TQOA 1IZ6A 1PZKD 2PNRC 3AYHB 3U4ZA 1XNRL 4GN5A 3GTQB 4LAAA 1PLFA 3K0YA 3JAML 2M9VA 3GV6A 1W3SA 5JJKA 4C1NI 1WTHA 1TWHH 4C2MH 3NSWA 3ICEA 1IW7D 1LO5D 4HTHA 2HT1A 4K14A 1Y1VB 1UE1A 3W1BA 3S14H 1XYIA 2PMZE 1HNZL 1STNA 4B3RQ 3RZOB 2OTLA 2K7VA 1A2TA 4HIKA 4DF7A 4DV3Q 1R9TH 1AZPA 3D4RA 4FYDA 1SE8A 3PO2B 1I6HB 5KNCA 4RGMA 2FMCA 2KHIA 4LNQA 2WACA 1Y8PB 3J80c 2IX3A 5DEHA 2JA6B 2F0QA 4BA2I 2UXDL 1ESFA 3CC4A 2E5LL 4YHHQ 1L0XB 2VB2X 5E4WC 2JA9A 4R9WA 2E2JH 2DNEA 3BYTB 2JJQA 4X64L 1VF7A 4F87A 3M3YB 2RDGA 1VQNA 1VQ6A 4EQNA 2I5MX 5C3XA 3CC2A 2JA7G 1CKNB 4A3KH 4A93G 4ZRZA 3BZCA 1STGA 4PZ7A 5M5YH 3LNNA 4X3TA 1PVOA 1TIID 3KJPA 1RTNA 3VR2A 1SYFA 2YTVA 2F0FA 2F0DA 3PMFA 2B39A 2MO1A 1QJOA 1RCVD 5C44H 2E2HB 4YWMA 4K5WA 1KTKA 1HZ9A 3PUYA 4RCNA 4FNFA 3D4DA 2VZAA 2BE5C 4JV5Q 2EXZA 3BJUA 1G6PA 1LV9A 3GD7A 4TQUS 3DWPA 5GROA 1CQFA 4FXGC 2CQOA 2LKVA 4BXXG 1XMQL 3P1HA 2R92G 4A3KB 1VQDA 2K14A 1AZQA 2GN5A 3S9WA 5M5YB 2JYOA 1PTOH 1MD2D 2VUMH 3L7ZC 1V1OA 4R4IA 2HHHQ 3I56A 4QUFA 5JPMC 3GTGH 1TWAH 3C1FA 4BY1H 4DK0A 2WB1G 1KAWA 2KCCA 4IOCA 2I0QA 2O2LD 3J7AV 5CV9A 1JB7A 3I8ZA 1F9SA 1Q8KA 4JBJA 4NDXA 1B3QA 3H3VC 1VQJA 4LF8L 3CCUA 3EJIA 1HTPA 4IPCA 4TKOB 4OX9L 4UDUC 3ZJYC 1DZ1A 2RCNA 3N52A 1S5FD 1QCBD 1VQ4A 3H94A 1TY0A 4CKCA 4G57A 1IYVA 4R4TA 2NVTH 2RA4A 2Z6BA 1KRTA 3L3OC 2OTJA 3SVMA 1M90C 3RLFA 4RMFA 1B53A 4QF4A 3HOYH 1DJRD 1EWHA 1EOVA 2AQ1B 1CHPD 4FDBA 4JOIA 1DGSA 4DR1Q 2P5ZX 3Q22A 1I4RA 1QZGA 2DJGC 4IN3A 5IYBG 3H15A 4BY1B 4LUOA 1UEAB 5CV7A 2KA7A 4AYBG 1PFBA 5ELEA 2NUCA 5IYCG 2PW5A 2JQOA 1C48A 5E1FA 4RFBA 3GTPH 1WD0A 3UDFA 4K5XA 1Q81C 1AN8A 4TSSA 1PTOD 1I4XA 2AWNA 5FJ8G 1HQRD 3FPPA 3ULJA 4DR5Q 1CUKA 2NVTB 2RSNA 4AQYL 1YJNA 2R93H 2QCPX 4OWXB 3J81j 4AH6A 1KL9A 1SMYD 1YNNC 3HOYB 4IFDI 1EU3A 4MIUA 4OWTB 1PYBA 1BO0A 2O5IC 1IKMA 4YWLA 1IL8A 1Q82C 1GXDC 1STAA 1HQMC 4OO1G 4J8QA 4C3JH 4RGOS 5DAUA 2KCMA 2F0TA 4RHSA 4ZUJA 5H1SE 1LTBD 1U4MA 4A3FG 3MEHA 2A8VA 4XT3B 3H09A 4G7HC 4RGNA 5IGBA 2VQFQ 2EDGA 2RSOA 1HNXL 3TP8A 1JE4A 4G4KA 5IY0A 1FJGQ 2AKWB 1Y1WG 4JYAL 4X62Q 5HGQA 2NVQH 3P75A 1ET9A 2MJ8A 1WTVA 1PH9A 1QNUA 5IP9G 2F0HA 2A68D 2NWGA 1X9NA 2L12A 4DR2Q 2F03A 3M4OH 4DV6Q 1CKMA 2HIVA 2ENBA 1DOMA 1OXVA 1NR4A 2HIXA 2PW7A 3H91A 2RBMA 3U50C 2ZT9C 1YHQA 2UUAL 1BR9A 2RVLA 1B4OA 2PI2E 1TWCH 1EFWA 4A3BB 1U0LA 1PYSB 4GZYC 1HZAA 4DUZQ 1H9RA 3CF5A 2RF4A 1Q8IA 1MKHA 1VMPA 4FXKC 2LY7A 1JOOA 3VR5A 1EFID 1K0SA 1FNUA 1SBBB 4LF4L 1LM0A 2QDLA 4XIGS 5C3WA 3M85A 2H5XA 2IW3A 5ELFA 4DK1A 4B9XA 2K5HA 3NPPA 1SNOA 3RNUA 2JA7H 1VQMA 4RH6A 4A93H 3LWUA 4G7ZC 4JOIC 5CBEE 1HFNA 3M4OB 1QWYA 2EJMA 3C1EA 4QGUA 2ID0A 1II3A 3GTMB 3T1YL 1N32Q 3MFYA 2FJ2A 1HR0L 4GKJQ 4QUCA 2ICIA 2X69A 1XMOQ 1TT2A 4MHEA 3KDFA 4LF7Q 1SYBA 2RHSB 3M9BA 1H9JA 4JI4Q 1UUPA 1TWCB 1WTPA 5BN4A 1DXMA 1B8AA 2E2IB 1IBKL 4JI6Q 3D4WA 5IYDG 1VF5C 4LFBQ 2D62A 1TWGB 3CMAA 5LMUQ 2UU9L 1TWFH 2YU9H 4ZKCB 2OQ0A 1RKNA 4ZCKA 3D8GA 5CBAE 1SR3A 3E0JA 4K6DA 1RHPA 4BS9A 1L1OB 4GKKL 5TSSA 4PV1C 5ELDA 4O42A 2UUBL 3U9SA 3AU7A 3MHBA 3E3XA 2KCTA 3RMHA 1PRTC 1O80A 1QILA 1LTTD 4KY6A 2OXPA 4X66L 4WRDA 2L1BA 1ENFA 3ERQA 3PV0A 3V2TA 1L0YB 3KF8B 1WTWA 4KD4A 1JC7A 5FLXL 1A2UA 2WB1E 4NXNQ 3OW2A 4PG3A 4BBSB 1Q46A 4KHVA 4NKLA 4HN7A 4RG1A 1JWMD 1NAPA 4B3MQ 1KRSA 1VQBA 2N49A 4DAYA 5KIXA 4HJAA 3I4MG 5C3EB 4Q5VA 3H0GH 5AJ3Q 3A8IE 5C0XJ 1Q90A 2CH4W 4QIWB 5ELOA 1BQQT 4KY7A 5LMNQ 2F0KA 4LK1C 4JI7Q 1PFSA 3OTOL 2ZTEA 4X65Q 2F4VL 4FF4A 5CGKA 2RHQB 2AWOA 2RKSA 3W1GA 4R4OA 4HIDA 1NUCA 2B2TA 1A3VA 4IUUA 3EA6A 1C9OA 1S40A 3EN2A 1VQ7A 3G6EA 3PF4A 4FF3A 4KHPQ 4MTNA 1EZ8A 4DR3L 1K28A 3E9HA 1GO3E 4C3IG 1JMCA 1D6EC 1I4QA 5IT9L 2KHSA 3UDIA 3PO3B 5IYCH 3C46A 4OIJA 3PSIA 3MZ5A 3QO2A 4V0BA 5FO7B 2HQEA 2ALYB 3H0GB 4LJZC 3IRBA 5CV8A 3CRKC 5CR3A 2UXCL 4L6TB 1LT4D 4JI8L 1QNKA 4NXML 3CCSA 2VY3A 2K03A 1J9OA 2MPMA 4IUTA 4M8AA 2XSCA 2DJFC 1U4PA 4MZ9A 3W5OA 1XX8A 4OELB 5IWAL 4OO1H 4CBVA 4ZK9B 3TN2A 2WAQB 2IJ0A 2HQLA 3U4VA 4IOAA 2Z1CA 1JE5A 3K7AH 2R61A 3NTKA 2NVXH 2MFIA 4A3FH 5HURA 1VQGA 4A3IG 1HA6A 3WDNA 1RL2A 3TP5A 3JAME 1XXGA 4DV1L 1X32A 2CW0C 1ASZA 3TS2A 1Z7TA 4JPBW 1Q1EA 2ZXRA 2XRQD 3NBHA 4FXDA 4JI5L 3T51B 2E2DC 3OSOA 4A3CG 1J5EL 3SK6A 2DY8A 1JJGA 4LFAQ 5IP9H 1KDAA 1S5DD 3FPUB 2EZVA 1SNQA 1RODA 1N33Q 4N8X1 2L15A 1EOTA 5G3LF 4MN3A 1DD2A 3G48A 4UP7A 4WORA 5M5XH 4DK6C 1NJIC 3C2PA 2WIIB 1XNQQ 3FKIG 3WWVA 1XPUA 1EIHA 4X3SA 5JEAG 4YIJA 1Q86C 4GNXB 3GTOH 3S16H 1XNRQ 3OMGA 3K7AB 2WV6D 4DA2A 4C3HH 2IT1A 3BVZA 3MXGA 1G291 1OXTA 3F2CA 3P20A 4P2CB 2DNCA 2R6GA 3J81c 2F0WA 4DFAA 4WJ4A 3OWFA 4IPHA 3MVVA 1O7IA 1M8AA 1HNZQ 4GLXA 3CPFA 3ULPA 2B2TC 1IBML 1JT8A 2B8FA 2KUMA 3K5MA 4WJ3M 1U5KA 2QGQA 3URYA 2B63B 1FNWA 4LF6L 2FFKB 2NBFA 3KLSA 1A3TA 5D3IB 1PRTF 2UXDQ 2M2LA 2E5LQ 3GV3A 1TY2A 4LW1A 1O7LA 1Q3LA 3PUZA 3I90A 4X64Q 5IGCA 1IYJB 5IYDH 5M3FG 3GTOB 2BA1A 3KOJA 5EJWA 1WTOA 2SNSA 5EQ0A 2EQSA 3ZYYX 3NQTA 1F9QA 4P73A 4RKLA 5DM73 3ER0A 4C3HB 4IUQA 1X3PA 4B08A 1ICFB 3K81C 3L0OA 3HOVB 2VW9A 3IFDA 1STBA 2ZJQA 3IFTA 2SEBD 3HKZB 1YJ9A 3NTHA 2A73B 1HCZA 2WP8J 5M3MG 3PIO3 3TEHB 2MUYA 3CQZB 1BCPD 4LWCA 1YNXA 1OO9B 1HZBA 3KBGA 4UHVA 3I91A 3F1ZA 4J1MA 5FO8B 1VQPA 1DCZA 3V96A 1MJCA 3MA2B 3DXJC 3S2HB 2K33A 3HP3A 1VMCA 4K0KL 3TDQA 2Z6KC 4JI1L 2HCIA 4JI2L 1XMQQ 3LGJA 2Z8LA 2QF7A 4EQ5A 2XWBB 2PZTA 1GUOA 1KIXA 1GUSA 2F0SA 1UNSA 3I7FA 1NBWA 2EIFA 2RDHA 3KF6B 2IWHA 1CSQA 3I4NB 4BBRB 2WINB 3TP7A 3J80L 4PQXA 2NTTA 3PGZA 4UPAA 3T53B 2NN6I 1E24A 3VYUA 3OWEB 2FINB 4LF8Q 5KNBA 1SRUA 5FLMG 1X6OA 3ERSX 5JAVA 3OMCA 4DXGA 4OX9Q 4FO2A 2CHBD 1T5EA 3FP9A 4DAPA 2MO0A 3S17H 3SK4A 1U9RA 3NEMA 2F52A 5EGTA 1LABA 3DMUA 2CH4A 1PDQA 5EPKA 3JAMi 4UAIA 3HKSA 4S3SA 5M5WB 4DR4L 4A3GB 1QVGA 2R7FA 1G8ZD 1PH3A 2I46A 4OL7A 4LF9L 4IPGA 1SAPA 1O7YA 3OPOA 1TS3A 1D1KA 4DV2L 4HMJA 1RJTA 3S1QH 1EY5A 4PMCA 5CV6A 5J39A 4BA1I 1OXUA 3I70A 5IGEA 1TWHB 1XPOA 2E74C 4C2MB 1LT3D 5C0XH 2AMCB 3QJYA 1JR0D 2PMZB 3S14B 4JG2A 4YWKA 4POGA 4L8JA 2HCCA 1A63A 1OXXK 1R9TB 1IXRA 4GNXC 4AQYQ 1HXYD 5D65A 2KQ3A 4DV0L 2KOLA 4OONA 1K8OA 4A3CH 1P16A 3BG3A 4EQPA 5KNDA 2E2JB 1PH7A 5EKKA 2LSSA 1C0AA 3W3AA 1KXLA 4A3EG 1DOLA 1E1TA 3UE0A 3GTLH 1I50H 1IYUA 1LLRD 2N78A 3I55A 1BF4A 2K4KA 1PH1A 5D3DA 3ULLA 3FKIH 2K6AA 3TZUA 4X3KA 4JI0L 4ME3A 2FHTA 1HNXQ 4V190 1CKNA 1JCKB 2F4IA 4IJHA 1JJCB 4JYAQ 4O2DA 5DNFA 2TSSA 5C44B 5C4JH 2ZJPA 3VR3A 1B50A 3STBC 4BWGB 1TS2A 4I7ZC 1DYQA 4F7XA 4A3DG 3Q6SA 3T56B 1D8LA 3C3LA 4A3LG 2UUAQ 2G9HD 3V05A 5D14A 1NR2A 1LUZA 3SHLA 2K01A 4DNRB 2CQAA 1JORA 2A6HD 3DWQA 2A74C 2HDMA 2R7ZG 1JICA 1GHJA 1PTOB 3HOXG 3PIPA 4KMUC 4UP9A 4B3RL 1G51A 1LTSD 2VUMB 4LF4Q 4GOPB 5M3FH 4DR6L 3TRZA 3GTGB 1TWAB 5BR8L 1HRJA 2XRSD 2XGTA 4JBWA 5IIFA 4CGYB 5IP7H 1AFPA 1TU2B 4U673 1YIJA 1IW7C 5GQOA 4N9TA 1B44D 3N6RA 2L9HA 1XTCD 3HEJA 1SROA 4R4CA 2WFWA 4Y7NH 3T1YQ 2I5LX 1HR0Q 4WFN3 5JPNC 5M3MH 2NVYH 1HNWQ 5FLXE 4B3SL 4OEMB 1ZKOA 2J0TD 1IBKQ 1F77A 5NUCA 3TBIB 4IUNA 4LF5L 3I4OA 3NQIA 2UU9Q 3KYHC 4R8IA 1I4HA 2Q8TA 4CJ0B 5BN5A 5I6YA 1N36L 2ICEC 2CCZA 1IL2A 4F88A 1HA5A 4CJ1B 2UUBQ 2QA4A 2A69D 4YCWA 5EPJA 4IURA 3DEPA 1ZEQX 4FVMA 3NE5B 4U68A 3AFPA 2HUGA 4X66Q 2IHEA 1E1OA 3IKJA 4TRDA 1CM9A 5KYIA 1LTLA 3GP7A 5BN3A 3AMUA 3WOFA 2PQAB 2HDLA 2JXMB 3GTPB 3QWNA 5T1GA 1UEBA 3CAMA 2ZTCA 4OWWB 1CZGA 2K1BA 3FRPB 3L9AX 3NHHA 4YCUA 1QB5D 1STEA 4HCSA 2R93B 5IT9E 1ZYRD 2Y0SG 1B70B 2B2WC 5LL6S 5FLMH 2CKZB 4IUVA 3CW2C 4JCVE 3S1NH 1IKLA 1N34L 3SK8A 3HGBA 2D2CC 2IHFA 1DOKA 1NE3A 2R3ZA 3OTOQ 4C3JB 2KEEA 2K04A 1VQCA 2Z4HA 3NWTA 4H7BA 2F4VQ 2PO4A 1E2WA 2JK8A 3S1RH 2JA5G 3GTJH 3S1MH 2NB0A 4DR7L 4H13C 2CFMA 2NYZD 3K6OA 3KK7A 1I4PA 4DR3Q 1S5ED 4IFDJ 2LMCB 2NVQB 3HOZG 1Y14B 1V1PB 3GTKH 2EY5A 2PQAA 4KY5A 3HFZB 3BVMA 5ELNA 3EIVA 3S1NB 3M4YA 5KRUA 2UXCQ 4PZ8A 2CVRA 1Q7YC 4JI8Q 2F0JA 4NXMQ 1A6XA 2A5HA 4NB3A 5C0XI 4PNYA 1O7ZA 4DV4L 1X65A 1KQSA 2N8NA 5IGGA 3S1RB 2ZTDA 3D31A 5IWAQ 3S1MB 3PUXA 3A5UA 1I4GA 2EPBA 4TVAB 4LUZA 3AEVA 1EY0A 1Q1BA 4A3EH 5C4ZA 4DUYL 5T1IA 1KHIA 4BXXH 4BY7G 1QVCA 2R92H 1NSNS 2JA7B 5EBCA 4DKAC 4XQQA 1QOHA 4A93B 1VQ5A 4ZKBB 1B9MA 5J3BA 1HJPA 3L2PA 4A3JG 3T1HL 1NTGA 1JOKA 3D6CA 3NUCA 3RZDH 1NNXA 5K5PA 2K5QA 2JN4A 5E4XA 4DV1Q 3GTKB 1DONA 1K8MA 1PYWD 4QIWE 1PH6A 4HIOA 2F0IA 4JI5Q 2Q2UA 1EIFA 1PTOC 3BVGA 1CFMA 1J5EQ 1Z9FA 4IFDG 1S4ZA 4HAEA 1ESRA 1GUNA 4GOPC 2EVBA 4B3TQ 4QL5A 1SMYC 2N88A 3CU7A 2QEJC 1SLJA 2YYZA 3BS1A 4ZLTF 1UE5A 1HTLD 1TWFB 2B2YC 2YU9B 1GJXA 4A3LH 1Y1VG 3WOEA 1B9NA 3BZDB 2F0OA 3D3RA 4A3EB 3VR6A 5JJZA 2PQEA 2R92B 4P75A 4DR2L 2R7ZH 1PZJD 3PO2G 2KHJA 4DV6L 1CI3M 1SE3A 3HOXH 1K9MC 1W6KA 4KKUA 1K73C 1L1OA 3CC7A 3RZDB 5IYBH 3NP8A 2JA6G 5E3FA 2VB3X 4IQZA 2WB1B 1SE4A 4XT1B 3QG1A 5FO9B 3RLOA 2O4XA 1PH2A 2K05A 1IBMQ 5K36G 3KF8A 3A74A 4UP8A 2A68C 1BBXC 1F2LA 1JB3A 2EY2A 3KUPA 1PH5A 2UUCL 2OEOA 2A6ED 2K5WA 4LF6Q 3VYRA 3Q0AA 4IALA 5JEAJ 2QW7A 5FJ8H 2F0NA 1T9HA 1QUQB 4NPSA 4DV5L 1FVIA 1C8CA 2GVAA 1TS5A 2PZUA 1EQQA 3A7AB 2Q2HA 1RIPA 1IBLL 4H0LC 1LACA 5DM63 1JJ2A 2H1EA 1N32L 4GKJL 4HSPA 2ZXPA 1L0WA 1YZ6A 3S24A 3HG9A 1QVFA 3NK9A 4QCLA 1Z47A 2Q8IB 1LYLA 1C7YA 5CMDA 3M7GA 4AYBB 1GKHA 1D7QA 2I5HA 4RA8A 1YNJD 1EU4A 4LFCL 5FK9C 5EBDA 4A3KG 1VQOA 2Z6KA 3J80E 5GAGC 1Y1WH 1F9PA 1KD1C 1M4VA 4HEDA 4ALPA 1VCIA 3VR4A 2F0PA 3KJOA 4K0KQ 2Y0SE 3DWAA 4KN4C 1I94L 1TKWB 3CCLA 1SEBD 4P72A 4A3MG 3RN2A 4JI2Q 1SDFA 2F3IA 5L37A 4JVZA 3J81L 5ELCA 2K5VA 1PH8A 2XNAC 4YCVA 3DLLA 2EY6A 3DEOA 4DV7L 2B8GA 2XVSA 5FKAC 2NVXB 1LTRD 4A3FB 4F8MA 1PMRA 2JA5H 1SNMA 1X3GA 5CC4A 2MNAA 3SGIA 5AJ3L 3DUZA 1S72A 3G6JB 1EEID 2F0VA 1PXUA 4E6IA 4EGVA 1Y1WB 1EIGA 5A35A 1GHKA 3CKIB 4CDEC 3H3VH 3K5LA 5KEEA 4L63B 2BA0A 2V4DA 4BY1G 3RR5A 1L1OC 4RHRA 3K58A 1S5CD 4G7OC 3ND8A 3SDZA 2BOSA 1UWVA 1K8GA 2CWAA 3RN5A 4RKBA 2K28A 4POFA 3SR1A 3G4SA 4KHPL 5M5XB 4DR4Q 3PF5A 2QKIC 2Q2TA 3TS0A 1CA5A 2SDFA 1YHAA 4LF9Q 3IAYA 1MBYA 1RDPD 3F2BA 2K50A 4OXPA 2EYMA 1S5BD 1BCPB 4DV2Q 3S16B 1TS4A 1X54A 1JWSD 1LT6D 4YY3L 2VQEL 1PTOF 2PNHA 1H9SB 5I9OA 1G6ZA 3AQQA 4GNXA 3HOYG 2BE5D 3ONAB 4BY7H 4MTKA 4QB4A 2PZWA 2YV5A 1PFNA 4PMWA 5I2XA 2D0OA 1VQ9A 4A3JH 4IO9A 2IY5B 2O5JC 2EYJA 1VQIA 5J22A 4JBMA 1G2TA 3ITPA 3BU2A 5CV4A 4CDFC 3K8AA 3CD6A 4DV0Q 1C4QA 2F0GA 1MIUA 1V43A 1J8IA 3KFUA 4IFDH 4J15A 3I3CA 3SE0A 2ZM6L 1HHVA 5JOBA 3K5NA 2L0CA 1XPRA 3I4MH 4FF1A 1RF2D 1K3RA 1M1KC 1GD7A 1Y1VH 1SJHD 2VNUD 2EE1A 3RZOH 2C35B 2BH2A 4JI3L 4JI0Q 2A1AA 2KBNA 3D0FA 3CCRA 3VA7A 1I6HH 3PO2H 3SXHA 1EY4A 4ID6A 4A3BG 1B3AA 5FOBB 3E6ZX 4H02A 2K5DA 5C5MA 5GAHC 5E7NA 2IPKD 4CJ2C 3A8JE 3BDLA 2WKCA 3HOWG 1F2MA 2G9DA 4A4IA 2Z9HA 1SFOH 1YI2A 4N8FA 3QOJA 4C3IH 4HCEA 2ZJRA 5EKIA 4NMZA 1XTDA 1A8VA 3M3YH 1Q12A 2D5DA 2J4XA 1SYGA 3MC0B 4OHJA 5K36H 3NENA 4O1NA 1E0BA 4ULLA 2AHOB 4ILWA 4PMBA 5KYLA 1ONLA 3I4MB 2K52A 2QILA 1WTXA 1H95A 1QG7A 2KVMA 1IHZA 4KD3A 3J80i 2TMPA 3J7A5 5EPLA 5LL6X 4DR6Q 4NW2A 3JAMc 1HPCA 4XTCS 1R4PB 2E2HH 5BR8Q 3T4AC 2OQKA 5CYUA 1D5ZC 1YNND 3TZDA 1BUVT 4CDDC 4EVOA 1FNVA 1S3OA 2D9UA 3KF6A 1GUWA 1SFOB 1STYA 2B2VA 2A19A 4C3IB 3QOLA 1Y69U 4A3IH 2EOTA 2MGSA 1GVPA 1XJVA 1EYDA 4KKTA 1X56A 3LX0A 2JA8G 1WI5A 3S17B 3TMEA 2K75A 4OO1I 3TQYA 4B3SQ 1YVCA 2UXBL 3TP6A 2LFNA 1AE3A 2C5CA 2OCEA 5ISRA 1BVSA 3DM1A 1N9WA 2F3VA 4LF5Q 3K0XA 1UAPA 2LS01 3X3NA 1EYCA 1AW7A 1KNEA 4KTAA 4X3UA 1FGUA 1VQ8A 5KGUA 4BBSG 1N36Q 1KNAA 3GDEA 3CCJA 3HOUG 3S1QB 1YEZA 3HS0C 3T13A 3NELA 4A3MH 1I3QH 5A2QL 4KHZA 4KLKA 1XWEA 3UE1A 1EQTA 4GS3A 3LWEA 5C3EG 5JEAH 5I4DA 1K83H 1NCVA 1X3QA 5C6AA 4QQBX 2B2WA 4XYQA 2DN8A 3EQLC 1CKOA 3MWYW 3OIPA 4A3IB 4DNTB 1SXTA 4RGTA 1FYCA 1TR5A 1UE7A 1BCPC 1LT5D 4WJWA 3S2DH 4OIKA 4CHTB 5AFWA 1CT1D 3MTSA 1SNDA 4Q0FA 5G3LD 1N34Q 1Y8NB 3E9IA 2FMMA 1TVXA 3CCMA 4C56C 2XWJB 2JEAI 3GO5A 2QEXA 2F0LA 5C4HA 4FF2A 5IGFA 4HJ7A 3PO3G 1AE2A 1SNPA 1I50B 3GTLB 4A3MB 1I3QB 4N9PA 1WTQA 1FR3A 5C4XG 2N3SA 4DAVA 2EJGC 1D5MC 1U4RA 1SNCA 1ICWA 2XN9C 2KJXA 3FKIB 4K2LA 4XQNA 3H3VI 1HH2P 3H0GG 4R4QA 1K83B 1ML0D 3SEBA 4DR7Q 4J6HA 1PRTB 4DV3L 4EX5A 2NN6G 1NMGA 2E8GA 1PH4A 5LMNW 1EQRA 2MQHA 2B3GA 3EROA 4XQJA 1VQFA 3MXNB 5C4JB 2BCOA 1EEFD 1N8RC 4YHHL 4HIMA 4IPDA 4DXFA 1VQEA 1BDOA 3S2DB 1PV4A 1EY6A 2DGYA 4XDXA 1FL0A 2WAQG 3A56A 3E0EA 1H9KA 5I2YA 1JOQA 1ILQA 1EY9A 1A62A 1PRTD 4JW0A 4GN4B 4L5RC 2XIWA 3U58A 2L11A 2EJFC 4DNIA 4L5SA 2B2VC 4DV4Q 5F2DA 3QR8A 3M7NA 4ZAIA 4RAUC 2DUDA 2B2UA 3R2TA 4I65A 2KEDA 3KBXA 4APVA 5M3FB 3B6YA 3A54A 3HZXA 4GKKQ 4DUYQ 1SJED 1CTMA 2MP1A 3F2UA 2EXDA 1KAAA 2EYPA 3R3OA 4K8IA 2PYKA 2OT2A 3O13A 2YTYA 4GOPA 3CHBD 3T1HQ 4JV5L 4R1JA 1F9RA 3P7JA 1F2YA 2L5TA 4Y7NB 5GAEC 3X3MA 2KENA 5JVG3 1ENCA 1MSHA 2B2YA 1EQVA 4A3BH 3MXNA 1STHA 3G71A 5M3MB 3PCOB 3J7YW 3CCEA 3NBIA 2NVYB 3HOWH 1GUTA 4Y52H 3GQBA 4KKSA 5EAYA 1G2SA 5HGTA 5M9OA 1X3EA 2HHHL 4KN7C 3KLWA 1FD7D 4H44C 3R2IA 2SOBA 5COYA 3H6MA 4ZUIA 1SYEA 2X6GA 1KDBA 1JQYD 1BOSA 3KDFB 2HD3A 4NP5A 1KABA 4HJ9A 2B63G 3GTMH 1AEXA 1D5XC 1B2TA 1GUGA 3OYYA 2WKDA 4AIMA 2E2IH 2L55A 1EYGA 1NY4A 2F3WA 2ZXOA 1TWGH 1WCMG 5CORA 3HOWB 4GLAC 4RWSC 2RDFA 3DM3A 1VQKA 1W2BA 4DR1L 1E22A 4C3HG 2UUCQ 3CMEA 2K5NA 3JC66 1VQHA 1WFQA 1V9PA 4XXEA 3A55A 3HOVG 2PCFB 1VS0A 3PQIA 3UI2A 3I4LA 4HSVA 2JA8H 1J6QA 2JEBI 2NZ1D 1WOCA 2J7ZA 3AFQA 5DLQE 3M4PA 3FHWA 1KLGD 4DV5Q 4M1UB 1CA6A 2A6HC 2Z4IA 4KK7A 2JP1A 3HKZG 5HY6A 1EUJA 1ENAA 2E76C 1IBLQ 1F2ZA 2CW0D 2VXWA 1FGBD 3HRZC 1V1QA 3Q24A 3GTJB 2M00A 4DAYB 1A0IA 3ND9A 1EY7A 4BBSH 1RD9D 1CSPA 1BCPF 3VYSA 3HOUH 3DHQA 5IODA 4DR5L 5I6WA 1HNWL 1ILPA 3J81E 2EY1A 2CWPA 2MHVA 4ODGA 3J7AF 1K3BC 1K8AC 2AQ2B 3PUWA 1MGSA 2F0EA 3VDYA 2I07B 3PIP3 1BKBA 2B2UC 5C3EH 2DY7A 1CK1A 4IUPA 4LFCQ 4EQOA 3MAQA 1DM0B 4A76A 1MHWC 1VQAA 3KLSX 4KJOA 1W6JA 1V1PA 3T16A 4R8NA 4ABNA 3Q23A 3PUVA 4O0AA 4XYOA 3BDOA 1SMXA 2JA8B 2EYFA 3M4QA 3I4NG 1X55A 4BBRG 1L2FA 2D0PA 4FP5D 1QZHA 1I94Q 4A3DH 2PI2A 3CXCA 2VQFL 1YITA 3K59A 1QE6A 3KLRA 3NWSA 4KI0A 3FEWX 1FJGL 4MNOA 4CKEA 2EYHA 4X62L 2AUJD 3RLNA 1AH9A 1D2BA 1EZ6A 5LHY1 3F8TA 2EYOA 1PHJA 3HOUB 3PO3H 1WJJA 4DV7Q 2A69C 2X6LA 5C4XH 3I72A 3EBEA 1KDCA 1Y8OB 3K7UC 2GA4B 4A3GG 2AUKA 2NN6H 2NTSA 5FLXc 2VL6A 3CP0A 4QY7A 1VQLA 1E3PA 1HUNA 4I7AA 1P8LA 1HZCA 1JWUD 1VDZA 3J7ZC 4DUZL 1AP0A 1NMFA 3I73A 5JVH3 1O78A 1I6VC 1ZYRC 3MXPA 2V1CC 4HR7B 1OTCA 1TXYA 4A3DB 3PIOA 4ZQ3A 2WAQE 3RUZA 3D6WA 3NBHB 3NXWA 1E2ZA 1WYDA 4AYBE 3FVQA 2R7ZB 4DPGA 5C4XB 2R7DA 3EVQA 4YY3Q 2VQEQ 3HOXB 2B29A 1XMOL 2ATWA 1E7ZA 3I2ZA 3UDXA 4LF7L 4JI4L 2Q2IA 1LTID 3BZKA 4LMQD 4DN4M 4B9WA 1EWIA 3OW7A 5IT9c 1PA6A 4JI6L 1X3FA 4JBKA 3W2DA 4OGQC 4LFBL 2QDBA 3AB9A 5LMUL 4X6AH 3FDTA 3SK5A 2VS1A 4K2KA 2LXJA 4QJFA 5IE8A 4IJLA 1YHBA 3A0JA 1A15A 2OWOA 3A7LA 3R8BA 4C1NK 5C0XG 2KCNA 3OHXC 5IOCA
chains in the Genus database with same CATH topology
1RTOA 1ET6A 4Z9CB 4RCOA 1SSOA 3OIQA 1V8QA 1OXSC 1WTRA 3VYTA 3BDCA 4ZYSA 2EYLA 3G7LA 2JE6I 5IGDA 3E5SA 1HFGA 1CZWA 4ME5A 3QB3A 4DU9A 1A3UA 1EY8A 1PFMA 1D1IA 3U9OA 4KV6A 1EYAA 2N55A 2Y0SB 1SE2A 5C5LA 4K6LA 4JK1C 3TSSA 4QMGA 3CRLC 2RQXA 2F0MA 1GOZA 1CHQD 5EKLA 3K57A 3QIAA 1LTAD 4IZ8A 1EWCA 2JA5B 2SNMA 1SYCA 3OOCA 5CV5A 3K5OA 3A8KE 2BDNA 1CQVA 5A2QE 3EFXD 5I9PA 2IX1A 2Q8RE 2H4OA 1KLUD 3HOZB 1H9MA 1WCMB 1SYDA 1ZXTA 2K32A 3BYYB 2JSOA 2F0UA 3IL8A 2A6EC 4K5VA 1BXTA 2L4NA 2E75C 3MFGA 2F1MA 1Z6HA 1PZID 2PPBC 1LTGD 3RD4A 4KJNA 3VA5A 1R4QB 1T5XD 1HUMA 3MXUA 2C9OA 1BNZA 1G91A 3FMCA 2OF1A 5ELBA 4K8JA 2IL8A 1B1ZA 2BDOA 5J1ZA 1U4LA 4BY7B 3NTIA 1MSGA 4CKBA 1H9SA 2IX0A 4C3JG 4A3JB 1MI2A 1YNJC 1WVLA 2KECA 3S15B 1E2VA 2AQ3B 1WD1A 3R93A 1EL0A 4HMIA 4DGZA 1TQOA 1PZKD 2PNRC 3GTQB 4LAAA 1PLFA 3K0YA 3JAML 2M9VA 3GV6A 4C1NI 3NSWA 1IW7D 1LO5D 4HTHA 4K14A 1Y1VB 1XYIA 1STNA 3RZOB 2K7VA 1A2TA 4DF7A 1AZPA 3D4RA 4FYDA 1I6HB 3PO2B 5KNCA 4RGMA 2FMCA 2WACA 1Y8PB 2IX3A 5DEHA 2JA6B 2F0QA 4BA2I 1ESFA 1L0XB 2VB2X 5E4WC 4R9WA 2DNEA 3BYTB 1VF7A 4F87A 3M3YB 2RDGA 4EQNA 5C3XA 4ZRZA 1STGA 3LNNA 4X3TA 1TIID 1RTNA 3VR2A 1SYFA 2F0FA 2F0DA 3PMFA 2B39A 1QJOA 1RCVD 2E2HB 4K5WA 1KTKA 4RCNA 3PUYA 4FNFA 3D4DA 2BE5C 2EXZA 1LV9A 3GD7A 4TQUS 3DWPA 1CQFA 4FXGC 2LKVA 3P1HA 4A3KB 1AZQA 3S9WA 5M5YB 2JYOA 1PTOH 1MD2D 3L7ZC 1V1OA 4QUFA 5JPMC 3C1FA 4DK0A 2KCCA 2O2LD 3J7AV 5CV9A 3I8ZA 1F9SA 4NDXA 3H3VC 3EJIA 1HTPA 4TKOB 4UDUC 1DZ1A 3N52A 1S5FD 1QCBD 3H94A 1TY0A 4CKCA 4G57A 1IYVA 2RA4A 3L3OC 3SVMA 3RLFA 1B53A 4QF4A 1DJRD 1EWHA 2AQ1B 1CHPD 3Q22A 1I4RA 4IN3A 4BY1B 1UEAB 5CV7A 2KA7A 1PFBA 5ELEA 2NUCA 2PW5A 1C48A 5E1FA 4RFBA 1WD0A 4K5XA 1AN8A 4TSSA 1PTOD 1I4XA 2AWNA 1HQRD 3FPPA 2NVTB 2RSNA 2QCPX 1SMYD 1YNNC 3HOYB 4IFDI 1EU3A 4MIUA 1BO0A 2O5IC 1IKMA 1IL8A 1GXDC 1STAA 1HQMC 4OO1G 4J8QA 4RGOS 5DAUA 2F0TA 4RHSA 4ZUJA 1LTBD 1U4MA 3MEHA 4XT3B 3H09A 4G7HC 4RGNA 5IGBA 2EDGA 2RSOA 3TP8A 1JE4A 4G4KA 3P75A 1ET9A 2MJ8A 1WTVA 1QNUA 2F0HA 2A68D 2NWGA 2L12A 2F03A 2ENBA 1DOMA 1OXVA 1NR4A 2PW7A 3H91A 2RBMA 2ZT9C 1BR9A 2RVLA 1B4OA 4A3BB 4GZYC 1H9RA 4FXKC 1Q8IA 1VMPA 2LY7A 1JOOA 3VR5A 1EFID 1FNUA 1SBBB 4XIGS 5C3WA 3M85A 2IW3A 5ELFA 4DK1A 4B9XA 3NPPA 1SNOA 4RH6A 3LWUA 4G7ZC 5CBEE 1HFNA 3M4OB 1QWYA 2EJMA 3C1EA 2ID0A 1II3A 3GTMB 3MFYA 2FJ2A 4QUCA 2ICIA 2X69A 1TT2A 4MHEA 1SYBA 1H9JA 1UUPA 1TWCB 1WTPA 5BN4A 1DXMA 2E2IB 3D4WA 1VF5C 2D62A 1TWGB 4ZKCB 1RKNA 3D8GA 5CBAE 3E0JA 4K6DA 1RHPA 4BS9A 5TSSA 4PV1C 5ELDA 4O42A 3U9SA 3AU7A 3MHBA 3RMHA 1PRTC 1O80A 1QILA 1LTTD 4KY6A 2OXPA 4WRDA 2L1BA 1ENFA 3ERQA 3PV0A 3V2TA 1L0YB 1WTWA 4KD4A 1JC7A 5FLXL 1A2UA 4BBSB 4KHVA 4NKLA 4HN7A 1JWMD 1NAPA 4DAYA 5KIXA 5C3EB 4Q5VA 3A8IE 5C0XJ 1Q90A 4QIWB 1BQQT 4KY7A 2F0KA 4LK1C 4FF4A 5CGKA 2AWOA 2RKSA 1NUCA 2B2TA 1A3VA 4IUUA 3EA6A 4FF3A 1EZ8A 4C3IG 1D6EC 1I4QA 5IT9L 2KHSA 3PO3B 3C46A 4OIJA 3MZ5A 3QO2A 4V0BA 5FO7B 2HQEA 3H0GB 4LJZC 5CV8A 3CRKC 5CR3A 4L6TB 1LT4D 1QNKA 2K03A 1J9OA 2MPMA 4IUTA 4M8AA 2XSCA 1U4PA 1XX8A 4OO1H 4CBVA 4ZK9B 3TN2A 2WAQB 2IJ0A 2Z1CA 3NTKA 2R61A 5HURA 1HA6A 3WDNA 3TP5A 3JAME 1XXGA 1X32A 2CW0C 1Z7TA 1Q1EA 2ZXRA 2XRQD 3NBHA 4FXDA 3T51B 2E2DC 3OSOA 3SK6A 2DY8A 1KDAA 1S5DD 3FPUB 2EZVA 1SNQA 1RODA 1EOTA 5G3LF 4MN3A 1DD2A 4WORA 3C2PA 2WIIB 1EIHA 4X3SA 5JEAG 4YIJA 3OMGA 3K7AB 2WV6D 4DA2A 2IT1A 3BVZA 3MXGA 1G291 1OXTA 3P20A 4P2CB 2DNCA 2R6GA 2F0WA 4DFAA 3OWFA 3MVVA 1M8AA 2B2TC 2B8FA 2KUMA 3K5MA 3URYA 2B63B 1FNWA 2FFKB 2NBFA 3KLSA 1A3TA 5D3IB 1PRTF 2M2LA 3GV3A 1TY2A 1O7LA 1Q3LA 3PUZA 3I90A 5IGCA 3GTOB 2BA1A 5EJWA 1WTOA 2SNSA 5EQ0A 3ZYYX 3NQTA 1F9QA 4RKLA 5DM73 4C3HB 4IUQA 1X3PA 4B08A 3HOVB 3IFDA 1STBA 3IFTA 2SEBD 3HKZB 3NTHA 2A73B 1HCZA 2WP8J 3PIO3 2MUYA 3CQZB 1BCPD 1OO9B 3KBGA 3I91A 4J1MA 5FO8B 1DCZA 3V96A 3MA2B 3DXJC 3S2HB 2K33A 3HP3A 1VMCA 3TDQA 2HCIA 2Z8LA 2QF7A 2XWBB 2PZTA 1GUOA 1GUSA 2F0SA 1UNSA 2RDHA 2IWHA 3I4NB 4BBRB 2WINB 3TP7A 3J80L 4PQXA 2NTTA 3T53B 2NN6I 3VYUA 3OWEB 2FINB 5KNBA 5JAVA 3OMCA 4DXGA 4FO2A 2CHBD 1T5EA 4DAPA 3SK4A 1U9RA 5EGTA 1LABA 3DMUA 1PDQA 5EPKA 4UAIA 4S3SA 5M5WB 4A3GB 1G8ZD 2I46A 4OL7A 1SAPA 1O7YA 3OPOA 1TS3A 1D1KA 4HMJA 1RJTA 1EY5A 4PMCA 5CV6A 5J39A 4BA1I 1OXUA 3I70A 5IGEA 1TWHB 2E74C 4C2MB 1LT3D 5C0XH 3QJYA 1JR0D 2PMZB 3S14B 4L8JA 2HCCA 1OXXK 1R9TB 1HXYD 5D65A 2KQ3A 2KOLA 1K8OA 3BG3A 4EQPA 5KNDA 2E2JB 5EKKA 3W3AA 1DOLA 1IYUA 1LLRD 1BF4A 5D3DA 2K6AA 3TZUA 4X3KA 2FHTA 4V190 1JCKB 2F4IA 5DNFA 2TSSA 5C44B 3VR3A 1B50A 4BWGB 1TS2A 4I7ZC 1DYQA 4F7XA 3Q6SA 3T56B 3C3LA 2G9HD 3V05A 5D14A 1NR2A 3SHLA 2K01A 4DNRB 2CQAA 1JORA 2A6HD 3DWQA 2A74C 2HDMA 1JICA 1GHJA 1PTOB 4KMUC 1LTSD 2VUMB 3GTGB 1TWAB 1HRJA 2XRSD 4JBWA 5IIFA 4CGYB 1AFPA 1TU2B 4U673 1IW7C 4N9TA 1B44D 3N6RA 2L9HA 1XTCD 3HEJA 4WFN3 5JPNC 5FLXE 1ZKOA 2J0TD 1F77A 5NUCA 3TBIB 4IUNA 3NQIA 4R8IA 1I4HA 2Q8TA 4CJ0B 5BN5A 5I6YA 2ICEC 4F88A 1HA5A 4CJ1B 2A69D 5EPJA 4IURA 3DEPA 1ZEQX 4FVMA 3NE5B 4U68A 2HUGA 3IKJA 4TRDA 1CM9A 5KYIA 3GP7A 5BN3A 3AMUA 3WOFA 3GTPB 2HDLA 2JXMB 3QWNA 5T1GA 1CZGA 2K1BA 3FRPB 3L9AX 3NHHA 1QB5D 1STEA 4HCSA 2R93B 5IT9E 1ZYRD 2B2WC 5LL6S 4IUVA 1IKLA 3SK8A 3HGBA 2D2CC 1DOKA 2R3ZA 4C3JB 2KEEA 2K04A 2Z4HA 3NWTA 4H7BA 2PO4A 1E2WA 2NB0A 4H13C 2NYZD 3K6OA 3KK7A 1I4PA 1S5ED 4IFDJ 2LMCB 2NVQB 1V1PB 2EY5A 4KY5A 3BVMA 3S1NB 3M4YA 5KRUA 2CVRA 2F0JA 1A6XA 2A5HA 5C0XI 4PNYA 1O7ZA 5IGGA 3S1RB 3D31A 3S1MB 3PUXA 1I4GA 2EPBA 1EY0A 1Q1BA 5C4ZA 5T1IA 1NSNS 2JA7B 5EBCA 4XQQA 1QOHA 4A93B 4ZKBB 1B9MA 1JOKA 3D6CA 3NUCA 5K5PA 2K5QA 5E4XA 3GTKB 1DONA 1K8MA 1PYWD 2F0IA 1PTOC 3BVGA 1CFMA 4IFDG 1S4ZA 4HAEA 1ESRA 1GUNA 2EVBA 1SMYC 2N88A 3CU7A 2QEJC 2YYZA 3BS1A 4ZLTF 1HTLD 1TWFB 2B2YC 2YU9B 1GJXA 3WOEA 1B9NA 3BZDB 2F0OA 3D3RA 4A3EB 3VR6A 5JJZA 2PQEA 2R92B 1PZJD 1CI3M 1SE3A 1W6KA 4KKUA 3RZDB 3NP8A 5E3FA 2VB3X 4IQZA 2WB1B 1SE4A 4XT1B 3QG1A 5FO9B 2O4XA 2K05A 5K36G 3KF8A 2A68C 1BBXC 1F2LA 1JB3A 2EY2A 3KUPA 2OEOA 2A6ED 2K5WA 3VYRA 3Q0AA 4IALA 5JEAJ 2F0NA 1C8CA 1TS5A 2PZUA 3A7AB 4H0LC 1LACA 5DM63 2H1EA 4HSPA 2ZXPA 3HG9A 3NK9A 4QCLA 1Z47A 2Q8IB 5CMDA 3M7GA 4AYBB 4RA8A 1YNJD 1EU4A 5FK9C 5EBDA 3J80E 1F9PA 1M4VA 4HEDA 1VCIA 3VR4A 2F0PA 4KN4C 3DWAA 1TKWB 1SEBD 1SDFA 3J81L 5ELCA 2XNAC 2EY6A 3DEOA 2B8GA 2XVSA 5FKAC 2NVXB 1LTRD 4A3FB 4F8MA 1PMRA 1SNMA 5CC4A 3DUZA 1EEID 2F0VA 3G6JB 1PXUA 4E6IA 4EGVA 1Y1WB 1EIGA 5A35A 1GHKA 3CKIB 3K5LA 5KEEA 4L63B 2BA0A 2V4DA 4RHRA 3K58A 1S5CD 4G7OC 3ND8A 3SDZA 2BOSA 4RKBA 2K28A 3SR1A 5M5XB 2QKIC 1CA5A 2SDFA 3IAYA 1MBYA 1RDPD 2EYMA 1S5BD 1BCPB 3S16B 1TS4A 1JWSD 1LT6D 1PTOF 1H9SB 5I9OA 1G6ZA 2BE5D 3ONAB 4QB4A 2PZWA 1PFNA 4PMWA 5I2XA 2O5JC 2EYJA 5J22A 1G2TA 3ITPA 5CV4A 1C4QA 2F0GA 1V43A 1J8IA 4IFDH 3I3CA 3SE0A 1HHVA 5JOBA 3K5NA 2L0CA 4FF1A 1RF2D 1SJHD 2VNUD 2EE1A 3VA7A 3SXHA 1EY4A 4ID6A 1B3AA 5FOBB 3E6ZX 2K5DA 5C5MA 2IPKD 4CJ2C 3A8JE 3BDLA 2WKCA 1F2MA 2G9DA 3QOJA 4HCEA 5EKIA 4NMZA 1Q12A 2D5DA 2J4XA 1SYGA 3MC0B 4OHJA 5K36H 4O1NA 1E0BA 4ULLA 4ILWA 4PMBA 5KYLA 1ONLA 3I4MB 2QILA 1WTXA 1QG7A 2KVMA 1IHZA 4KD3A 2TMPA 5EPLA 5LL6X 4NW2A 1HPCA 4XTCS 1R4PB 3T4AC 5CYUA 1D5ZC 1YNND 3TZDA 1BUVT 4EVOA 1FNVA 2D9UA 1GUWA 1SFOB 1STYA 2B2VA 4C3IB 3QOLA 1Y69U 2EOTA 2MGSA 1EYDA 4KKTA 3LX0A 3S17B 3TMEA 4OO1I 3TP6A 2LFNA 2C5CA 5ISRA 3DM1A 2F3VA 1UAPA 2LS01 3X3NA 1EYCA 1AW7A 1KNEA 4KTAA 4X3UA 5KGUA 1KNAA 3S1QB 3HS0C 3T13A 5A2QL 4KHZA 1XWEA 1EQTA 3LWEA 5JEAH 5I4DA 1NCVA 1X3QA 5C6AA 2B2WA 4XYQA 2DN8A 3EQLC 3MWYW 3OIPA 4A3IB 4DNTB 1SXTA 4RGTA 1FYCA 1TR5A 1BCPC 1LT5D 4WJWA 4OIKA 4CHTB 5AFWA 1CT1D 3MTSA 1SNDA 4Q0FA 5G3LD 1Y8NB 2FMMA 1TVXA 4C56C 2XWJB 2JEAI 3GO5A 2F0LA 5C4HA 4FF2A 5IGFA 1SNPA 1I50B 3GTLB 4A3MB 1I3QB 4N9PA 1WTQA 1FR3A 4DAVA 2EJGC 1D5MC 1U4RA 1SNCA 1ICWA 2XN9C 2KJXA 3FKIB 4K2LA 4XQNA 1K83B 1ML0D 3SEBA 4J6HA 1PRTB 2NN6G 3EROA 4XQJA 5C4JB 2BCOA 1EEFD 4DXFA 1BDOA 3S2DB 1EY6A 4XDXA 3A56A 1H9KA 5I2YA 1JOQA 1ILQA 1EY9A 1PRTD 2XIWA 2L11A 2EJFC 2B2VC 5F2DA 3M7NA 4ZAIA 4RAUC 2B2UA 3R2TA 4I65A 2KEDA 3KBXA 5M3FB 3A54A 3HZXA 1SJED 1CTMA 2MP1A 3F2UA 1KAAA 2EYPA 3R3OA 4K8IA 2PYKA 2OT2A 3O13A 3CHBD 1F9RA 3P7JA 1F2YA 2L5TA 4Y7NB 3X3MA 5JVG3 1ENCA 1MSHA 2B2YA 1EQVA 3MXNA 1STHA 5M3MB 3J7YW 3NBIA 2NVYB 1GUTA 3GQBA 4KKSA 1G2SA 5HGTA 5M9OA 4KN7C 1FD7D 4H44C 3R2IA 2SOBA 5COYA 3H6MA 4ZUIA 1SYEA 2X6GA 1KDBA 1JQYD 1BOSA 4NP5A 1KABA 1AEXA 1D5XC 1B2TA 1GUGA 2WKDA 2L55A 2F3WA 2ZXOA 5CORA 3HOWB 4RWSC 2RDFA 4C3HG 4XXEA 3A55A 2PCFB 3UI2A 3I4LA 4HSVA 2JEBI 2NZ1D 2J7ZA 1KLGD 4M1UB 1CA6A 2A6HC 2Z4IA 4KK7A 2JP1A 1ENAA 2E76C 1F2ZA 2CW0D 2VXWA 1FGBD 3HRZC 3Q24A 3GTJB 2M00A 3ND9A 1EY7A 1RD9D 1BCPF 3VYSA 3DHQA 5IODA 5I6WA 1ILPA 3J81E 2EY1A 2MHVA 4ODGA 3J7AF 2AQ2B 3PUWA 1MGSA 2F0EA 2I07B 3PIP3 2B2UC 2DY7A 1CK1A 4IUPA 4EQOA 3MAQA 1DM0B 3KLSX 4KJOA 1W6JA 3T16A 1V1PA 4R8NA 4ABNA 3Q23A 3PUVA 4XYOA 3BDOA 2JA8B 2EYFA 4FP5D 3K59A 1QE6A 3KLRA 3NWSA 4KI0A 3FEWX 4CKEA 2EYHA 2AUJD 1D2BA 1EZ6A 5LHY1 2EYOA 3HOUB 2A69C 2X6LA 3I72A 1KDCA 1Y8OB 2GA4B 2AUKA 2NN6H 2NTSA 1HUNA 1JWUD 1VDZA 1AP0A 3I73A 5JVH3 1O78A 1I6VC 1ZYRC 3MXPA 4HR7B 4A3DB 4ZQ3A 3RUZA 3D6WA 3NXWA 1E2ZA 3FVQA 2R7ZB 5C4XB 3EVQA 3HOXB 1LTID 4LMQD 4DN4M 4B9WA 3OW7A 3W2DA 4OGQC 2QDBA 3AB9A 3FDTA 3SK5A 4K2KA 1A15A 3A7LA 3R8BA 4C1NK 5C0XG 2KCNA 3OHXC 5IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JIC A;  3GV3 A;  4MHE A;  4CJ2 C;  1RTO A;  1QNK A;  1Q3L A;  1SAP A;  1O7Y A;  3I90 A;  1WTP A;  2RSN A;  1HUM A;  2NYZ D;  1G2S A;  2K03 A;  5EKI A;  1J9O A;  1RJT A;  1WD0 A;  4OIK A;  1EIG A;  1QE6 A;  4XT1 B;  5EJW A;  1WTO A;  2MPM A;  4IUT A;  5EQ0 A;  1BNZ A;  5AFW A;  1G91 A;  2X69 A;  3MTS A;  1HRJ A;  1SSO A;  1F9Q A;  1U4P A;  1BO0 A;  2K05 A;  4ZKC B;  1XX8 A;  1E0B A;  5COY A;  4IUQ A;  2IL8 A;  1X3P A;  2FMM A;  1TVX A;  1IKM A;  1LV9 A;  5CBA E;  1IL8 A;  1U4L A;  1BBX C;  1F2L A;  3KUP A;  2X6G A;  4ZK9 B;  2L9H A;  1RHP A;  2X6L A;  3TN2 A;  1WTR A;  1MSG A;  2K28 A;  3IFD A;  4O42 A;  1WTQ A;  1WTX A;  1MI2 A;  1QG7 A;  1WVL A;  1U4R A;  2KVM A;  1ICW A;  1O80 A;  3G7L A;  1CA5 A;  1U4M A;  2KEC A;  2CVR A;  2HCC A;  2SDF A;  1AZQ A;  1HA6 A;  1ML0 D;  5EPL A;  2JYO A;  1HFG A;  4XT3 B;  1WD1 A;  2L1B A;  1C8C A;  1B2T A;  1X32 A;  4NW2 A;  3R93 A;  1EL0 A;  2RSO A;  1O7Z A;  1WTW A;  1HUN A;  5D65 A;  4QUF A;  3I91 A;  1PFM A;  1PLF A;  2H1E A;  1JE4 A;  2KOL A;  1AP0 A;  5COR A;  4R8I A;  2MJ8 A;  3GV6 A;  2Q8T A;  3TZD A;  4CJ0 B;  1NAP A;  2N55 A;  4RWS C;  1WTV A;  2DY8 A;  1G6Z A;  2EPB A;  2D9U A;  1GUW A;  3FPU B;  3I8Z A;  1ROD A;  1F9S A;  3HP3 A;  3ONA B;  2B2V A;  1VMC A;  2NWG A;  2L12 A;  5T1I A;  1EOT A;  1DOL A;  4CJ1 B;  4MN3 A;  4XDX A;  2HCI A;  1PFN A;  5EPJ A;  1DOM A;  4IUR A;  3DEP A;  2EOT A;  1NR4 A;  2MGS A;  3UI2 A;  5CMD A;  1XYI A;  1BF4 A;  4HSV A;  1DZ1 A;  3N52 A;  3H91 A;  4RA8 A;  2NZ1 D;  4ZKB B;  2J7Z A;  4U68 A;  3D6W A;  1ILQ A;  2RVL A;  1B4O A;  2HUG A;  1CA6 A;  1EIH A;  5E4X A;  2JP1 A;  4X3S A;  1AZP A;  1G2T A;  2XIW A;  4X3K A;  2RA4 A;  2L11 A;  1DON A;  2B2V C;  3DM1 A;  1CM9 A;  2FHT A;  3SVM A;  2VXW A;  1F9P A;  1B53 A;  4ZAI A;  2HDL A;  4RAU C;  2B2U A;  1J8I A;  1KNE A;  5DNF A;  2KED A;  3KBX A;  5T1G A;  1VMP A;  2BDN A;  2B2T A;  3I3C A;  4IUU A;  4HED A;  2K1B A;  1S4Z A;  4HAE A;  4X3U A;  1ESR A;  1B50 A;  5E4W C;  4R9W A;  1HHV A;  4HCS A;  1KNA A;  2Q8R E;  1ILP A;  3F2U A;  4LMQ D;  2MP1 A;  4DN4 M;  2N88 A;  2B2W C;  2FIN B;  1MGS A;  4IUV A;  4ZLT F;  2B2Y C;  1SDF A;  1ZXT A;  1M8A A;  1IKL A;  2B2U C;  3Q6S A;  1EQT A;  2DY7 A;  3FDT A;  3LWE A;  2B2T C;  4IUP A;  3IL8 A;  1X3Q A;  1F9R A;  1NCV A;  2EE1 A;  1NR2 A;  3P7J A;  5D14 A;  1DOK A;  1PFB A;  2B2W A;  2K01 A;  2KUM A;  2R3Z A;  4X3T A;  1A15 A;  5CBE E;  1HFN A;  2KEE A;  1RTN A;  2K04 A;  2L4N A;  3DEO A;  4OIJ A;  2B2Y A;  1MSH A;  3QO2 A;  5JJZ A;  2FFK B;  1PDQ A;  5EPK A;  4UAI A;  1B3A A;  3MWY W;  2HDM A;  2FJ2 A;  4QUC A;  2M2L A; 
#chains in the Genus database with same CATH topology
 1I5F A;  1RTO A;  4PZ6 A;  2ZM6 Q;  1ET6 A;  5C44 G;  1BBW A;  4JI1 Q;  4Z9C B;  1GM5 A;  1QUQ A;  4RCO A;  2ASB A;  1SSO A;  4NXN L;  1EIY B;  4JI3 Q;  1YBY A;  4B3M L;  3OIQ A;  1V8Q A;  1OXS C;  3UDG A;  1WTR A;  4B3T L;  2BH8 A;  3MEF A;  3VYT A;  2B63 H;  1KC8 C;  5JJI A;  3BDC A;  4ZYS A;  2EYL A;  3G7L A;  2JE6 I;  5IGD A;  4P74 A;  1BBU A;  4GLV B;  3E5S A;  1HFG A;  4LUV A;  4DK3 C;  1SN8 A;  5LMN L;  4JI7 L;  1CZW A;  4ME5 A;  3QB3 A;  4DU9 A;  2VUM G;  1A3U A;  1EY8 A;  4X65 L;  3HOZ H;  5GAD C;  1PFM A;  1ASY A;  1WCM H;  1D1I A;  3U9O A;  4KV6 A;  1EYA A;  3J81 i;  2N55 A;  2Y0S B;  1SE2 A;  5JJL A;  5C5L A;  4K6L A;  4JK1 C;  3HOV H;  3TSS A;  4P71 A;  4QMG A;  3CRL C;  2RQX A;  2F0M A;  1GOZ A;  1CHQ D;  5EKL A;  4A75 A;  3K57 A;  3QIA A;  3HKZ E;  1B7Y B;  1LTA D;  4L5Q A;  4IZ8 A;  1EWC A;  3CQZ H;  2JA5 B;  2SNM A;  1SYC A;  3OOC A;  2NZH A;  5CV5 A;  3K5O A;  3A8K E;  2BDN A;  1CQV A;  5A2Q E;  2GVB A;  3EFX D;  2RCF A;  5I9P A;  2IX1 A;  2Q8R E;  3K80 C;  2H4O A;  4HJ8 A;  4L5T A;  3S2H H;  1KLU D;  3HOZ B;  1H9M A;  1WCM B;  1SYD A;  4CDC C;  1ZXT A;  2K32 A;  1YJW A;  3BYY B;  3F2D A;  2JSO A;  4UY8 C;  3S15 H;  2F0U A;  3IL8 A;  3CCV A;  2A6E C;  2UXB Q;  4K5V A;  1BXT A;  5IP7 G;  2L4N A;  2YTX A;  2E75 C;  3MFG A;  3Q8D A;  2F1M A;  2Z0S A;  1Z6H A;  1PZI D;  3GTQ H;  1UE6 A;  2XTI A;  2PPB C;  1LTG D;  1HR0 W;  3RD4 A;  3I4N H;  4BBR H;  4KJN A;  3VA5 A;  1R4Q B;  1T5X D;  1HUM A;  2G5D A;  3MXU A;  2FXQ A;  4GN3 B;  3STB D;  2C9O A;  2R93 G;  1BNZ A;  1G91 A;  3FMC A;  2OF1 A;  1MJE A;  5ELB A;  2NZO A;  4K8J A;  2IL8 A;  1B1Z A;  2BDO A;  5J1Z A;  1U4L A;  4LFA L;  4BY7 B;  3NTI A;  1N33 L;  1MSG A;  3A5Z B;  4CKB A;  1H9S A;  2ES2 A;  2IX0 A;  3TRE A;  4C3J G;  4A3J B;  1MI2 A;  1YNJ C;  1WVL A;  3CPW A;  2JA6 H;  4JC0 A;  5M5W H;  2KEC A;  1XNQ L;  3S15 B;  4A3G H;  3CCQ A;  1E2V A;  2AQ3 B;  1WD1 A;  4DAM A;  4HJ5 A;  1K0R A;  3R93 A;  1EL0 A;  4HMI A;  2LXK A;  4DGZ A;  1TQO A;  1IZ6 A;  1PZK D;  2PNR C;  3AYH B;  3U4Z A;  1XNR L;  4GN5 A;  3GTQ B;  4LAA A;  1PLF A;  3K0Y A;  3JAM L;  2M9V A;  3GV6 A;  1W3S A;  5JJK A;  4C1N I;  1WTH A;  1TWH H;  4C2M H;  3NSW A;  3ICE A;  1IW7 D;  1LO5 D;  4HTH A;  2HT1 A;  4K14 A;  1Y1V B;  1UE1 A;  3W1B A;  3S14 H;  1XYI A;  2PMZ E;  1HNZ L;  1STN A;  4B3R Q;  3RZO B;  2OTL A;  2K7V A;  1A2T A;  4HIK A;  4DF7 A;  4DV3 Q;  1R9T H;  1AZP A;  3D4R A;  4FYD A;  1SE8 A;  3PO2 B;  1I6H B;  5KNC A;  4RGM A;  2FMC A;  2KHI A;  4LNQ A;  2WAC A;  1Y8P B;  3J80 c;  2IX3 A;  5DEH A;  2JA6 B;  2F0Q A;  4BA2 I;  2UXD L;  1ESF A;  3CC4 A;  2E5L L;  4YHH Q;  1L0X B;  2VB2 X;  5E4W C;  2JA9 A;  4R9W A;  2E2J H;  2DNE A;  3BYT B;  2JJQ A;  4X64 L;  1VF7 A;  4F87 A;  3M3Y B;  2RDG A;  1VQN A;  1VQ6 A;  4EQN A;  2I5M X;  5C3X A;  3CC2 A;  2JA7 G;  1CKN B;  4A3K H;  4A93 G;  4ZRZ A;  3BZC A;  1STG A;  4PZ7 A;  5M5Y H;  3LNN A;  4X3T A;  1PVO A;  1TII D;  3KJP A;  1RTN A;  3VR2 A;  1SYF A;  2YTV A;  2F0F A;  2F0D A;  3PMF A;  2B39 A;  2MO1 A;  1QJO A;  1RCV D;  5C44 H;  2E2H B;  4YWM A;  4K5W A;  1KTK A;  1HZ9 A;  3PUY A;  4RCN A;  4FNF A;  3D4D A;  2VZA A;  2BE5 C;  4JV5 Q;  2EXZ A;  3BJU A;  1G6P A;  1LV9 A;  3GD7 A;  4TQU S;  3DWP A;  5GRO A;  1CQF A;  4FXG C;  2CQO A;  2LKV A;  4BXX G;  1XMQ L;  3P1H A;  2R92 G;  4A3K B;  1VQD A;  2K14 A;  1AZQ A;  2GN5 A;  3S9W A;  5M5Y B;  2JYO A;  1PTO H;  1MD2 D;  2VUM H;  3L7Z C;  1V1O A;  4R4I A;  2HHH Q;  3I56 A;  4QUF A;  5JPM C;  3GTG H;  1TWA H;  3C1F A;  4BY1 H;  4DK0 A;  2WB1 G;  1KAW A;  2KCC A;  4IOC A;  2I0Q A;  2O2L D;  3J7A V;  5CV9 A;  1JB7 A;  3I8Z A;  1F9S A;  1Q8K A;  4JBJ A;  4NDX A;  1B3Q A;  3H3V C;  1VQJ A;  4LF8 L;  3CCU A;  3EJI A;  1HTP A;  4IPC A;  4TKO B;  4OX9 L;  4UDU C;  3ZJY C;  1DZ1 A;  2RCN A;  3N52 A;  1S5F D;  1QCB D;  1VQ4 A;  3H94 A;  1TY0 A;  4CKC A;  4G57 A;  1IYV A;  4R4T A;  2NVT H;  2RA4 A;  2Z6B A;  1KRT A;  3L3O C;  2OTJ A;  3SVM A;  1M90 C;  3RLF A;  4RMF A;  1B53 A;  4QF4 A;  3HOY H;  1DJR D;  1EWH A;  1EOV A;  2AQ1 B;  1CHP D;  4FDB A;  4JOI A;  1DGS A;  4DR1 Q;  2P5Z X;  3Q22 A;  1I4R A;  1QZG A;  2DJG C;  4IN3 A;  5IYB G;  3H15 A;  4BY1 B;  4LUO A;  1UEA B;  5CV7 A;  2KA7 A;  4AYB G;  1PFB A;  5ELE A;  2NUC A;  5IYC G;  2PW5 A;  2JQO A;  1C48 A;  5E1F A;  4RFB A;  3GTP H;  1WD0 A;  3UDF A;  4K5X A;  1Q81 C;  1AN8 A;  4TSS A;  1PTO D;  1I4X A;  2AWN A;  5FJ8 G;  1HQR D;  3FPP A;  3ULJ A;  4DR5 Q;  1CUK A;  2NVT B;  2RSN A;  4AQY L;  1YJN A;  2R93 H;  2QCP X;  4OWX B;  3J81 j;  4AH6 A;  1KL9 A;  1SMY D;  1YNN C;  3HOY B;  4IFD I;  1EU3 A;  4MIU A;  4OWT B;  1PYB A;  1BO0 A;  2O5I C;  1IKM A;  4YWL A;  1IL8 A;  1Q82 C;  1GXD C;  1STA A;  1HQM C;  4OO1 G;  4J8Q A;  4C3J H;  4RGO S;  5DAU A;  2KCM A;  2F0T A;  4RHS A;  4ZUJ A;  5H1S E;  1LTB D;  1U4M A;  4A3F G;  3MEH A;  2A8V A;  4XT3 B;  3H09 A;  4G7H C;  4RGN A;  5IGB A;  2VQF Q;  2EDG A;  2RSO A;  1HNX L;  3TP8 A;  1JE4 A;  4G4K A;  5IY0 A;  1FJG Q;  2AKW B;  1Y1W G;  4JYA L;  4X62 Q;  5HGQ A;  2NVQ H;  3P75 A;  1ET9 A;  2MJ8 A;  1WTV A;  1PH9 A;  1QNU A;  5IP9 G;  2F0H A;  2A68 D;  2NWG A;  1X9N A;  2L12 A;  4DR2 Q;  2F03 A;  3M4O H;  4DV6 Q;  1CKM A;  2HIV A;  2ENB A;  1DOM A;  1OXV A;  1NR4 A;  2HIX A;  2PW7 A;  3H91 A;  2RBM A;  3U50 C;  2ZT9 C;  1YHQ A;  2UUA L;  1BR9 A;  2RVL A;  1B4O A;  2PI2 E;  1TWC H;  1EFW A;  4A3B B;  1U0L A;  1PYS B;  4GZY C;  1HZA A;  4DUZ Q;  1H9R A;  3CF5 A;  2RF4 A;  1Q8I A;  1MKH A;  1VMP A;  4FXK C;  2LY7 A;  1JOO A;  3VR5 A;  1EFI D;  1K0S A;  1FNU A;  1SBB B;  4LF4 L;  1LM0 A;  2QDL A;  4XIG S;  5C3W A;  3M85 A;  2H5X A;  2IW3 A;  5ELF A;  4DK1 A;  4B9X A;  2K5H A;  3NPP A;  1SNO A;  3RNU A;  2JA7 H;  1VQM A;  4RH6 A;  4A93 H;  3LWU A;  4G7Z C;  4JOI C;  5CBE E;  1HFN A;  3M4O B;  1QWY A;  2EJM A;  3C1E A;  4QGU A;  2ID0 A;  1II3 A;  3GTM B;  3T1Y L;  1N32 Q;  3MFY A;  2FJ2 A;  1HR0 L;  4GKJ Q;  4QUC A;  2ICI A;  2X69 A;  1XMO Q;  1TT2 A;  4MHE A;  3KDF A;  4LF7 Q;  1SYB A;  2RHS B;  3M9B A;  1H9J A;  4JI4 Q;  1UUP A;  1TWC B;  1WTP A;  5BN4 A;  1DXM A;  1B8A A;  2E2I B;  1IBK L;  4JI6 Q;  3D4W A;  5IYD G;  1VF5 C;  4LFB Q;  2D62 A;  1TWG B;  3CMA A;  5LMU Q;  2UU9 L;  1TWF H;  2YU9 H;  4ZKC B;  2OQ0 A;  1RKN A;  4ZCK A;  3D8G A;  5CBA E;  1SR3 A;  3E0J A;  4K6D A;  1RHP A;  4BS9 A;  1L1O B;  4GKK L;  5TSS A;  4PV1 C;  5ELD A;  4O42 A;  2UUB L;  3U9S A;  3AU7 A;  3MHB A;  3E3X A;  2KCT A;  3RMH A;  1PRT C;  1O80 A;  1QIL A;  1LTT D;  4KY6 A;  2OXP A;  4X66 L;  4WRD A;  2L1B A;  1ENF A;  3ERQ A;  3PV0 A;  3V2T A;  1L0Y B;  3KF8 B;  1WTW A;  4KD4 A;  1JC7 A;  5FLX L;  1A2U A;  2WB1 E;  4NXN Q;  3OW2 A;  4PG3 A;  4BBS B;  1Q46 A;  4KHV A;  4NKL A;  4HN7 A;  4RG1 A;  1JWM D;  1NAP A;  4B3M Q;  1KRS A;  1VQB A;  2N49 A;  4DAY A;  5KIX A;  4HJA A;  3I4M G;  5C3E B;  4Q5V A;  3H0G H;  5AJ3 Q;  3A8I E;  5C0X J;  1Q90 A;  2CH4 W;  4QIW B;  5ELO A;  1BQQ T;  4KY7 A;  5LMN Q;  2F0K A;  4LK1 C;  4JI7 Q;  1PFS A;  3OTO L;  2ZTE A;  4X65 Q;  2F4V L;  4FF4 A;  5CGK A;  2RHQ B;  2AWO A;  2RKS A;  3W1G A;  4R4O A;  4HID A;  1NUC A;  2B2T A;  1A3V A;  4IUU A;  3EA6 A;  1C9O A;  1S40 A;  3EN2 A;  1VQ7 A;  3G6E A;  3PF4 A;  4FF3 A;  4KHP Q;  4MTN A;  1EZ8 A;  4DR3 L;  1K28 A;  3E9H A;  1GO3 E;  4C3I G;  1JMC A;  1D6E C;  1I4Q A;  5IT9 L;  2KHS A;  3UDI A;  3PO3 B;  5IYC H;  3C46 A;  4OIJ A;  3PSI A;  3MZ5 A;  3QO2 A;  4V0B A;  5FO7 B;  2HQE A;  2ALY B;  3H0G B;  4LJZ C;  3IRB A;  5CV8 A;  3CRK C;  5CR3 A;  2UXC L;  4L6T B;  1LT4 D;  4JI8 L;  1QNK A;  4NXM L;  3CCS A;  2VY3 A;  2K03 A;  1J9O A;  2MPM A;  4IUT A;  4M8A A;  2XSC A;  2DJF C;  1U4P A;  4MZ9 A;  3W5O A;  1XX8 A;  4OEL B;  5IWA L;  4OO1 H;  4CBV A;  4ZK9 B;  3TN2 A;  2WAQ B;  2IJ0 A;  2HQL A;  3U4V A;  4IOA A;  2Z1C A;  1JE5 A;  3K7A H;  2R61 A;  3NTK A;  2NVX H;  2MFI A;  4A3F H;  5HUR A;  1VQG A;  4A3I G;  1HA6 A;  3WDN A;  1RL2 A;  3TP5 A;  3JAM E;  1XXG A;  4DV1 L;  1X32 A;  2CW0 C;  1ASZ A;  3TS2 A;  1Z7T A;  4JPB W;  1Q1E A;  2ZXR A;  2XRQ D;  3NBH A;  4FXD A;  4JI5 L;  3T51 B;  2E2D C;  3OSO A;  4A3C G;  1J5E L;  3SK6 A;  2DY8 A;  1JJG A;  4LFA Q;  5IP9 H;  1KDA A;  1S5D D;  3FPU B;  2EZV A;  1SNQ A;  1ROD A;  1N33 Q;  4N8X 1;  2L15 A;  1EOT A;  5G3L F;  4MN3 A;  1DD2 A;  3G48 A;  4UP7 A;  4WOR A;  5M5X H;  4DK6 C;  1NJI C;  3C2P A;  2WII B;  1XNQ Q;  3FKI G;  3WWV A;  1XPU A;  1EIH A;  4X3S A;  5JEA G;  4YIJ A;  1Q86 C;  4GNX B;  3GTO H;  3S16 H;  1XNR Q;  3OMG A;  3K7A B;  2WV6 D;  4DA2 A;  4C3H H;  2IT1 A;  3BVZ A;  3MXG A;  1G29 1;  1OXT A;  3F2C A;  3P20 A;  4P2C B;  2DNC A;  2R6G A;  3J81 c;  2F0W A;  4DFA A;  4WJ4 A;  3OWF A;  4IPH A;  3MVV A;  1O7I A;  1M8A A;  1HNZ Q;  4GLX A;  3CPF A;  3ULP A;  2B2T C;  1IBM L;  1JT8 A;  2B8F A;  2KUM A;  3K5M A;  4WJ3 M;  1U5K A;  2QGQ A;  3URY A;  2B63 B;  1FNW A;  4LF6 L;  2FFK B;  2NBF A;  3KLS A;  1A3T A;  5D3I B;  1PRT F;  2UXD Q;  2M2L A;  2E5L Q;  3GV3 A;  1TY2 A;  4LW1 A;  1O7L A;  1Q3L A;  3PUZ A;  3I90 A;  4X64 Q;  5IGC A;  1IYJ B;  5IYD H;  5M3F G;  3GTO B;  2BA1 A;  3KOJ A;  5EJW A;  1WTO A;  2SNS A;  5EQ0 A;  2EQS A;  3ZYY X;  3NQT A;  1F9Q A;  4P73 A;  4RKL A;  5DM7 3;  3ER0 A;  4C3H B;  4IUQ A;  1X3P A;  4B08 A;  1ICF B;  3K81 C;  3L0O A;  3HOV B;  2VW9 A;  3IFD A;  1STB A;  2ZJQ A;  3IFT A;  2SEB D;  3HKZ B;  1YJ9 A;  3NTH A;  2A73 B;  1HCZ A;  2WP8 J;  5M3M G;  3PIO 3;  3TEH B;  2MUY A;  3CQZ B;  1BCP D;  4LWC A;  1YNX A;  1OO9 B;  1HZB A;  3KBG A;  4UHV A;  3I91 A;  3F1Z A;  4J1M A;  5FO8 B;  1VQP A;  1DCZ A;  3V96 A;  1MJC A;  3MA2 B;  3DXJ C;  3S2H B;  2K33 A;  3HP3 A;  1VMC A;  4K0K L;  3TDQ A;  2Z6K C;  4JI1 L;  2HCI A;  4JI2 L;  1XMQ Q;  3LGJ A;  2Z8L A;  2QF7 A;  4EQ5 A;  2XWB B;  2PZT A;  1GUO A;  1KIX A;  1GUS A;  2F0S A;  1UNS A;  3I7F A;  1NBW A;  2EIF A;  2RDH A;  3KF6 B;  2IWH A;  1CSQ A;  3I4N B;  4BBR B;  2WIN B;  3TP7 A;  3J80 L;  4PQX A;  2NTT A;  3PGZ A;  4UPA A;  3T53 B;  2NN6 I;  1E24 A;  3VYU A;  3OWE B;  2FIN B;  4LF8 Q;  5KNB A;  1SRU A;  5FLM G;  1X6O A;  3ERS X;  5JAV A;  3OMC A;  4DXG A;  4OX9 Q;  4FO2 A;  2CHB D;  1T5E A;  3FP9 A;  4DAP A;  2MO0 A;  3S17 H;  3SK4 A;  1U9R A;  3NEM A;  2F52 A;  5EGT A;  1LAB A;  3DMU A;  2CH4 A;  1PDQ A;  5EPK A;  3JAM i;  4UAI A;  3HKS A;  4S3S A;  5M5W B;  4DR4 L;  4A3G B;  1QVG A;  2R7F A;  1G8Z D;  1PH3 A;  2I46 A;  4OL7 A;  4LF9 L;  4IPG A;  1SAP A;  1O7Y A;  3OPO A;  1TS3 A;  1D1K A;  4DV2 L;  4HMJ A;  1RJT A;  3S1Q H;  1EY5 A;  4PMC A;  5CV6 A;  5J39 A;  4BA1 I;  1OXU A;  3I70 A;  5IGE A;  1TWH B;  1XPO A;  2E74 C;  4C2M B;  1LT3 D;  5C0X H;  2AMC B;  3QJY A;  1JR0 D;  2PMZ B;  3S14 B;  4JG2 A;  4YWK A;  4POG A;  4L8J A;  2HCC A;  1A63 A;  1OXX K;  1R9T B;  1IXR A;  4GNX C;  4AQY Q;  1HXY D;  5D65 A;  2KQ3 A;  4DV0 L;  2KOL A;  4OON A;  1K8O A;  4A3C H;  1P16 A;  3BG3 A;  4EQP A;  5KND A;  2E2J B;  1PH7 A;  5EKK A;  2LSS A;  1C0A A;  3W3A A;  1KXL A;  4A3E G;  1DOL A;  1E1T A;  3UE0 A;  3GTL H;  1I50 H;  1IYU A;  1LLR D;  2N78 A;  3I55 A;  1BF4 A;  2K4K A;  1PH1 A;  5D3D A;  3ULL A;  3FKI H;  2K6A A;  3TZU A;  4X3K A;  4JI0 L;  4ME3 A;  2FHT A;  1HNX Q;  4V19 0;  1CKN A;  1JCK B;  2F4I A;  4IJH A;  1JJC B;  4JYA Q;  4O2D A;  5DNF A;  2TSS A;  5C44 B;  5C4J H;  2ZJP A;  3VR3 A;  1B50 A;  3STB C;  4BWG B;  1TS2 A;  4I7Z C;  1DYQ A;  4F7X A;  4A3D G;  3Q6S A;  3T56 B;  1D8L A;  3C3L A;  4A3L G;  2UUA Q;  2G9H D;  3V05 A;  5D14 A;  1NR2 A;  1LUZ A;  3SHL A;  2K01 A;  4DNR B;  2CQA A;  1JOR A;  2A6H D;  3DWQ A;  2A74 C;  2HDM A;  2R7Z G;  1JIC A;  1GHJ A;  1PTO B;  3HOX G;  3PIP A;  4KMU C;  4UP9 A;  4B3R L;  1G51 A;  1LTS D;  2VUM B;  4LF4 Q;  4GOP B;  5M3F H;  4DR6 L;  3TRZ A;  3GTG B;  1TWA B;  5BR8 L;  1HRJ A;  2XRS D;  2XGT A;  4JBW A;  5IIF A;  4CGY B;  5IP7 H;  1AFP A;  1TU2 B;  4U67 3;  1YIJ A;  1IW7 C;  5GQO A;  4N9T A;  1B44 D;  3N6R A;  2L9H A;  1XTC D;  3HEJ A;  1SRO A;  4R4C A;  2WFW A;  4Y7N H;  3T1Y Q;  2I5L X;  1HR0 Q;  4WFN 3;  5JPN C;  5M3M H;  2NVY H;  1HNW Q;  5FLX E;  4B3S L;  4OEM B;  1ZKO A;  2J0T D;  1IBK Q;  1F77 A;  5NUC A;  3TBI B;  4IUN A;  4LF5 L;  3I4O A;  3NQI A;  2UU9 Q;  3KYH C;  4R8I A;  1I4H A;  2Q8T A;  4CJ0 B;  5BN5 A;  5I6Y A;  1N36 L;  2ICE C;  2CCZ A;  1IL2 A;  4F88 A;  1HA5 A;  4CJ1 B;  2UUB Q;  2QA4 A;  2A69 D;  4YCW A;  5EPJ A;  4IUR A;  3DEP A;  1ZEQ X;  4FVM A;  3NE5 B;  4U68 A;  3AFP A;  2HUG A;  4X66 Q;  2IHE A;  1E1O A;  3IKJ A;  4TRD A;  1CM9 A;  5KYI A;  1LTL A;  3GP7 A;  5BN3 A;  3AMU A;  3WOF A;  2PQA B;  2HDL A;  2JXM B;  3GTP B;  3QWN A;  5T1G A;  1UEB A;  3CAM A;  2ZTC A;  4OWW B;  1CZG A;  2K1B A;  3FRP B;  3L9A X;  3NHH A;  4YCU A;  1QB5 D;  1STE A;  4HCS A;  2R93 B;  5IT9 E;  1ZYR D;  2Y0S G;  1B70 B;  2B2W C;  5LL6 S;  5FLM H;  2CKZ B;  4IUV A;  3CW2 C;  4JCV E;  3S1N H;  1IKL A;  1N34 L;  3SK8 A;  3HGB A;  2D2C C;  2IHF A;  1DOK A;  1NE3 A;  2R3Z A;  3OTO Q;  4C3J B;  2KEE A;  2K04 A;  1VQC A;  2Z4H A;  3NWT A;  4H7B A;  2F4V Q;  2PO4 A;  1E2W A;  2JK8 A;  3S1R H;  2JA5 G;  3GTJ H;  3S1M H;  2NB0 A;  4DR7 L;  4H13 C;  2CFM A;  2NYZ D;  3K6O A;  3KK7 A;  1I4P A;  4DR3 Q;  1S5E D;  4IFD J;  2LMC B;  2NVQ B;  3HOZ G;  1Y14 B;  1V1P B;  3GTK H;  2EY5 A;  2PQA A;  4KY5 A;  3HFZ B;  3BVM A;  5ELN A;  3EIV A;  3S1N B;  3M4Y A;  5KRU A;  2UXC Q;  4PZ8 A;  2CVR A;  1Q7Y C;  4JI8 Q;  2F0J A;  4NXM Q;  1A6X A;  2A5H A;  4NB3 A;  5C0X I;  4PNY A;  1O7Z A;  4DV4 L;  1X65 A;  1KQS A;  2N8N A;  5IGG A;  3S1R B;  2ZTD A;  3D31 A;  5IWA Q;  3S1M B;  3PUX A;  3A5U A;  1I4G A;  2EPB A;  4TVA B;  4LUZ A;  3AEV A;  1EY0 A;  1Q1B A;  4A3E H;  5C4Z A;  4DUY L;  5T1I A;  1KHI A;  4BXX H;  4BY7 G;  1QVC A;  2R92 H;  1NSN S;  2JA7 B;  5EBC A;  4DKA C;  4XQQ A;  1QOH A;  4A93 B;  1VQ5 A;  4ZKB B;  1B9M A;  5J3B A;  1HJP A;  3L2P A;  4A3J G;  3T1H L;  1NTG A;  1JOK A;  3D6C A;  3NUC A;  3RZD H;  1NNX A;  5K5P A;  2K5Q A;  2JN4 A;  5E4X A;  4DV1 Q;  3GTK B;  1DON A;  1K8M A;  1PYW D;  4QIW E;  1PH6 A;  4HIO A;  2F0I A;  4JI5 Q;  2Q2U A;  1EIF A;  1PTO C;  3BVG A;  1CFM A;  1J5E Q;  1Z9F A;  4IFD G;  1S4Z A;  4HAE A;  1ESR A;  1GUN A;  4GOP C;  2EVB A;  4B3T Q;  4QL5 A;  1SMY C;  2N88 A;  3CU7 A;  2QEJ C;  1SLJ A;  2YYZ A;  3BS1 A;  4ZLT F;  1UE5 A;  1HTL D;  1TWF B;  2B2Y C;  2YU9 B;  1GJX A;  4A3L H;  1Y1V G;  3WOE A;  1B9N A;  3BZD B;  2F0O A;  3D3R A;  4A3E B;  3VR6 A;  5JJZ A;  2PQE A;  2R92 B;  4P75 A;  4DR2 L;  2R7Z H;  1PZJ D;  3PO2 G;  2KHJ A;  4DV6 L;  1CI3 M;  1SE3 A;  3HOX H;  1K9M C;  1W6K A;  4KKU A;  1K73 C;  1L1O A;  3CC7 A;  3RZD B;  5IYB H;  3NP8 A;  2JA6 G;  5E3F A;  2VB3 X;  4IQZ A;  2WB1 B;  1SE4 A;  4XT1 B;  3QG1 A;  5FO9 B;  3RLO A;  2O4X A;  1PH2 A;  2K05 A;  1IBM Q;  5K36 G;  3KF8 A;  3A74 A;  4UP8 A;  2A68 C;  1BBX C;  1F2L A;  1JB3 A;  2EY2 A;  3KUP A;  1PH5 A;  2UUC L;  2OEO A;  2A6E D;  2K5W A;  4LF6 Q;  3VYR A;  3Q0A A;  4IAL A;  5JEA J;  2QW7 A;  5FJ8 H;  2F0N A;  1T9H A;  1QUQ B;  4NPS A;  4DV5 L;  1FVI A;  1C8C A;  2GVA A;  1TS5 A;  2PZU A;  1EQQ A;  3A7A B;  2Q2H A;  1RIP A;  1IBL L;  4H0L C;  1LAC A;  5DM6 3;  1JJ2 A;  2H1E A;  1N32 L;  4GKJ L;  4HSP A;  2ZXP A;  1L0W A;  1YZ6 A;  3S24 A;  3HG9 A;  1QVF A;  3NK9 A;  4QCL A;  1Z47 A;  2Q8I B;  1LYL A;  1C7Y A;  5CMD A;  3M7G A;  4AYB B;  1GKH A;  1D7Q A;  2I5H A;  4RA8 A;  1YNJ D;  1EU4 A;  4LFC L;  5FK9 C;  5EBD A;  4A3K G;  1VQO A;  2Z6K A;  3J80 E;  5GAG C;  1Y1W H;  1F9P A;  1KD1 C;  1M4V A;  4HED A;  4ALP A;  1VCI A;  3VR4 A;  2F0P A;  3KJO A;  4K0K Q;  2Y0S E;  3DWA A;  4KN4 C;  1I94 L;  1TKW B;  3CCL A;  1SEB D;  4P72 A;  4A3M G;  3RN2 A;  4JI2 Q;  1SDF A;  2F3I A;  5L37 A;  4JVZ A;  3J81 L;  5ELC A;  2K5V A;  1PH8 A;  2XNA C;  4YCV A;  3DLL A;  2EY6 A;  3DEO A;  4DV7 L;  2B8G A;  2XVS A;  5FKA C;  2NVX B;  1LTR D;  4A3F B;  4F8M A;  1PMR A;  2JA5 H;  1SNM A;  1X3G A;  5CC4 A;  2MNA A;  3SGI A;  5AJ3 L;  3DUZ A;  1S72 A;  3G6J B;  1EEI D;  2F0V A;  1PXU A;  4E6I A;  4EGV A;  1Y1W B;  1EIG A;  5A35 A;  1GHK A;  3CKI B;  4CDE C;  3H3V H;  3K5L A;  5KEE A;  4L63 B;  2BA0 A;  2V4D A;  4BY1 G;  3RR5 A;  1L1O C;  4RHR A;  3K58 A;  1S5C D;  4G7O C;  3ND8 A;  3SDZ A;  2BOS A;  1UWV A;  1K8G A;  2CWA A;  3RN5 A;  4RKB A;  2K28 A;  4POF A;  3SR1 A;  3G4S A;  4KHP L;  5M5X B;  4DR4 Q;  3PF5 A;  2QKI C;  2Q2T A;  3TS0 A;  1CA5 A;  2SDF A;  1YHA A;  4LF9 Q;  3IAY A;  1MBY A;  1RDP D;  3F2B A;  2K50 A;  4OXP A;  2EYM A;  1S5B D;  1BCP B;  4DV2 Q;  3S16 B;  1TS4 A;  1X54 A;  1JWS D;  1LT6 D;  4YY3 L;  2VQE L;  1PTO F;  2PNH A;  1H9S B;  5I9O A;  1G6Z A;  3AQQ A;  4GNX A;  3HOY G;  2BE5 D;  3ONA B;  4BY7 H;  4MTK A;  4QB4 A;  2PZW A;  2YV5 A;  1PFN A;  4PMW A;  5I2X A;  2D0O A;  1VQ9 A;  4A3J H;  4IO9 A;  2IY5 B;  2O5J C;  2EYJ A;  1VQI A;  5J22 A;  4JBM A;  1G2T A;  3ITP A;  3BU2 A;  5CV4 A;  4CDF C;  3K8A A;  3CD6 A;  4DV0 Q;  1C4Q A;  2F0G A;  1MIU A;  1V43 A;  1J8I A;  3KFU A;  4IFD H;  4J15 A;  3I3C A;  3SE0 A;  2ZM6 L;  1HHV A;  5JOB A;  3K5N A;  2L0C A;  1XPR A;  3I4M H;  4FF1 A;  1RF2 D;  1K3R A;  1M1K C;  1GD7 A;  1Y1V H;  1SJH D;  2VNU D;  2EE1 A;  3RZO H;  2C35 B;  2BH2 A;  4JI3 L;  4JI0 Q;  2A1A A;  2KBN A;  3D0F A;  3CCR A;  3VA7 A;  1I6H H;  3PO2 H;  3SXH A;  1EY4 A;  4ID6 A;  4A3B G;  1B3A A;  5FOB B;  3E6Z X;  4H02 A;  2K5D A;  5C5M A;  5GAH C;  5E7N A;  2IPK D;  4CJ2 C;  3A8J E;  3BDL A;  2WKC A;  3HOW G;  1F2M A;  2G9D A;  4A4I A;  2Z9H A;  1SFO H;  1YI2 A;  4N8F A;  3QOJ A;  4C3I H;  4HCE A;  2ZJR A;  5EKI A;  4NMZ A;  1XTD A;  1A8V A;  3M3Y H;  1Q12 A;  2D5D A;  2J4X A;  1SYG A;  3MC0 B;  4OHJ A;  5K36 H;  3NEN A;  4O1N A;  1E0B A;  4ULL A;  2AHO B;  4ILW A;  4PMB A;  5KYL A;  1ONL A;  3I4M B;  2K52 A;  2QIL A;  1WTX A;  1H95 A;  1QG7 A;  2KVM A;  1IHZ A;  4KD3 A;  3J80 i;  2TMP A;  3J7A 5;  5EPL A;  5LL6 X;  4DR6 Q;  4NW2 A;  3JAM c;  1HPC A;  4XTC S;  1R4P B;  2E2H H;  5BR8 Q;  3T4A C;  2OQK A;  5CYU A;  1D5Z C;  1YNN D;  3TZD A;  1BUV T;  4CDD C;  4EVO A;  1FNV A;  1S3O A;  2D9U A;  3KF6 A;  1GUW A;  1SFO B;  1STY A;  2B2V A;  2A19 A;  4C3I B;  3QOL A;  1Y69 U;  4A3I H;  2EOT A;  2MGS A;  1GVP A;  1XJV A;  1EYD A;  4KKT A;  1X56 A;  3LX0 A;  2JA8 G;  1WI5 A;  3S17 B;  3TME A;  2K75 A;  4OO1 I;  3TQY A;  4B3S Q;  1YVC A;  2UXB L;  3TP6 A;  2LFN A;  1AE3 A;  2C5C A;  2OCE A;  5ISR A;  1BVS A;  3DM1 A;  1N9W A;  2F3V A;  4LF5 Q;  3K0X A;  1UAP A;  2LS0 1;  3X3N A;  1EYC A;  1AW7 A;  1KNE A;  4KTA A;  4X3U A;  1FGU A;  1VQ8 A;  5KGU A;  4BBS G;  1N36 Q;  1KNA A;  3GDE A;  3CCJ A;  3HOU G;  3S1Q B;  1YEZ A;  3HS0 C;  3T13 A;  3NEL A;  4A3M H;  1I3Q H;  5A2Q L;  4KHZ A;  4KLK A;  1XWE A;  3UE1 A;  1EQT A;  4GS3 A;  3LWE A;  5C3E G;  5JEA H;  5I4D A;  1K83 H;  1NCV A;  1X3Q A;  5C6A A;  4QQB X;  2B2W A;  4XYQ A;  2DN8 A;  3EQL C;  1CKO A;  3MWY W;  3OIP A;  4A3I B;  4DNT B;  1SXT A;  4RGT A;  1FYC A;  1TR5 A;  1UE7 A;  1BCP C;  1LT5 D;  4WJW A;  3S2D H;  4OIK A;  4CHT B;  5AFW A;  1CT1 D;  3MTS A;  1SND A;  4Q0F A;  5G3L D;  1N34 Q;  1Y8N B;  3E9I A;  2FMM A;  1TVX A;  3CCM A;  4C56 C;  2XWJ B;  2JEA I;  3GO5 A;  2QEX A;  2F0L A;  5C4H A;  4FF2 A;  5IGF A;  4HJ7 A;  3PO3 G;  1AE2 A;  1SNP A;  1I50 B;  3GTL B;  4A3M B;  1I3Q B;  4N9P A;  1WTQ A;  1FR3 A;  5C4X G;  2N3S A;  4DAV A;  2EJG C;  1D5M C;  1U4R A;  1SNC A;  1ICW A;  2XN9 C;  2KJX A;  3FKI B;  4K2L A;  4XQN A;  3H3V I;  1HH2 P;  3H0G G;  4R4Q A;  1K83 B;  1ML0 D;  3SEB A;  4DR7 Q;  4J6H A;  1PRT B;  4DV3 L;  4EX5 A;  2NN6 G;  1NMG A;  2E8G A;  1PH4 A;  5LMN W;  1EQR A;  2MQH A;  2B3G A;  3ERO A;  4XQJ A;  1VQF A;  3MXN B;  5C4J B;  2BCO A;  1EEF D;  1N8R C;  4YHH L;  4HIM A;  4IPD A;  4DXF A;  1VQE A;  1BDO A;  3S2D B;  1PV4 A;  1EY6 A;  2DGY A;  4XDX A;  1FL0 A;  2WAQ G;  3A56 A;  3E0E A;  1H9K A;  5I2Y A;  1JOQ A;  1ILQ A;  1EY9 A;  1A62 A;  1PRT D;  4JW0 A;  4GN4 B;  4L5R C;  2XIW A;  3U58 A;  2L11 A;  2EJF C;  4DNI A;  4L5S A;  2B2V C;  4DV4 Q;  5F2D A;  3QR8 A;  3M7N A;  4ZAI A;  4RAU C;  2DUD A;  2B2U A;  3R2T A;  4I65 A;  2KED A;  3KBX A;  4APV A;  5M3F B;  3B6Y A;  3A54 A;  3HZX A;  4GKK Q;  4DUY Q;  1SJE D;  1CTM A;  2MP1 A;  3F2U A;  2EXD A;  1KAA A;  2EYP A;  3R3O A;  4K8I A;  2PYK A;  2OT2 A;  3O13 A;  2YTY A;  4GOP A;  3CHB D;  3T1H Q;  4JV5 L;  4R1J A;  1F9R A;  3P7J A;  1F2Y A;  2L5T A;  4Y7N B;  5GAE C;  3X3M A;  2KEN A;  5JVG 3;  1ENC A;  1MSH A;  2B2Y A;  1EQV A;  4A3B H;  3MXN A;  1STH A;  3G71 A;  5M3M B;  3PCO B;  3J7Y W;  3CCE A;  3NBI A;  2NVY B;  3HOW H;  1GUT A;  4Y52 H;  3GQB A;  4KKS A;  5EAY A;  1G2S A;  5HGT A;  5M9O A;  1X3E A;  2HHH L;  4KN7 C;  3KLW A;  1FD7 D;  4H44 C;  3R2I A;  2SOB A;  5COY A;  3H6M A;  4ZUI A;  1SYE A;  2X6G A;  1KDB A;  1JQY D;  1BOS A;  3KDF B;  2HD3 A;  4NP5 A;  1KAB A;  4HJ9 A;  2B63 G;  3GTM H;  1AEX A;  1D5X C;  1B2T A;  1GUG A;  3OYY A;  2WKD A;  4AIM A;  2E2I H;  2L55 A;  1EYG A;  1NY4 A;  2F3W A;  2ZXO A;  1TWG H;  1WCM G;  5COR A;  3HOW B;  4GLA C;  4RWS C;  2RDF A;  3DM3 A;  1VQK A;  1W2B A;  4DR1 L;  1E22 A;  4C3H G;  2UUC Q;  3CME A;  2K5N A;  3JC6 6;  1VQH A;  1WFQ A;  1V9P A;  4XXE A;  3A55 A;  3HOV G;  2PCF B;  1VS0 A;  3PQI A;  3UI2 A;  3I4L A;  4HSV A;  2JA8 H;  1J6Q A;  2JEB I;  2NZ1 D;  1WOC A;  2J7Z A;  3AFQ A;  5DLQ E;  3M4P A;  3FHW A;  1KLG D;  4DV5 Q;  4M1U B;  1CA6 A;  2A6H C;  2Z4I A;  4KK7 A;  2JP1 A;  3HKZ G;  5HY6 A;  1EUJ A;  1ENA A;  2E76 C;  1IBL Q;  1F2Z A;  2CW0 D;  2VXW A;  1FGB D;  3HRZ C;  1V1Q A;  3Q24 A;  3GTJ B;  2M00 A;  4DAY B;  1A0I A;  3ND9 A;  1EY7 A;  4BBS H;  1RD9 D;  1CSP A;  1BCP F;  3VYS A;  3HOU H;  3DHQ A;  5IOD A;  4DR5 L;  5I6W A;  1HNW L;  1ILP A;  3J81 E;  2EY1 A;  2CWP A;  2MHV A;  4ODG A;  3J7A F;  1K3B C;  1K8A C;  2AQ2 B;  3PUW A;  1MGS A;  2F0E A;  3VDY A;  2I07 B;  3PIP 3;  1BKB A;  2B2U C;  5C3E H;  2DY7 A;  1CK1 A;  4IUP A;  4LFC Q;  4EQO A;  3MAQ A;  1DM0 B;  4A76 A;  1MHW C;  1VQA A;  3KLS X;  4KJO A;  1W6J A;  1V1P A;  3T16 A;  4R8N A;  4ABN A;  3Q23 A;  3PUV A;  4O0A A;  4XYO A;  3BDO A;  1SMX A;  2JA8 B;  2EYF A;  3M4Q A;  3I4N G;  1X55 A;  4BBR G;  1L2F A;  2D0P A;  4FP5 D;  1QZH A;  1I94 Q;  4A3D H;  2PI2 A;  3CXC A;  2VQF L;  1YIT A;  3K59 A;  1QE6 A;  3KLR A;  3NWS A;  4KI0 A;  3FEW X;  1FJG L;  4MNO A;  4CKE A;  2EYH A;  4X62 L;  2AUJ D;  3RLN A;  1AH9 A;  1D2B A;  1EZ6 A;  5LHY 1;  3F8T A;  2EYO A;  1PHJ A;  3HOU B;  3PO3 H;  1WJJ A;  4DV7 Q;  2A69 C;  2X6L A;  5C4X H;  3I72 A;  3EBE A;  1KDC A;  1Y8O B;  3K7U C;  2GA4 B;  4A3G G;  2AUK A;  2NN6 H;  2NTS A;  5FLX c;  2VL6 A;  3CP0 A;  4QY7 A;  1VQL A;  1E3P A;  1HUN A;  4I7A A;  1P8L A;  1HZC A;  1JWU D;  1VDZ A;  3J7Z C;  4DUZ L;  1AP0 A;  1NMF A;  3I73 A;  5JVH 3;  1O78 A;  1I6V C;  1ZYR C;  3MXP A;  2V1C C;  4HR7 B;  1OTC A;  1TXY A;  4A3D B;  3PIO A;  4ZQ3 A;  2WAQ E;  3RUZ A;  3D6W A;  3NBH B;  3NXW A;  1E2Z A;  1WYD A;  4AYB E;  3FVQ A;  2R7Z B;  4DPG A;  5C4X B;  2R7D A;  3EVQ A;  4YY3 Q;  2VQE Q;  3HOX B;  2B29 A;  1XMO L;  2ATW A;  1E7Z A;  3I2Z A;  3UDX A;  4LF7 L;  4JI4 L;  2Q2I A;  1LTI D;  3BZK A;  4LMQ D;  4DN4 M;  4B9W A;  1EWI A;  3OW7 A;  5IT9 c;  1PA6 A;  4JI6 L;  1X3F A;  4JBK A;  3W2D A;  4OGQ C;  4LFB L;  2QDB A;  3AB9 A;  5LMU L;  4X6A H;  3FDT A;  3SK5 A;  2VS1 A;  4K2K A;  2LXJ A;  4QJF A;  5IE8 A;  4IJL A;  1YHB A;  3A0J A;  1A15 A;  2OWO A;  3A7L A;  3R8B A;  4C1N K;  5C0X G;  2KCN A;  3OHX C;  5IOC A; 
#chains in the Genus database with same CATH homology
 1RTO A;  1ET6 A;  4Z9C B;  4RCO A;  1SSO A;  3OIQ A;  1V8Q A;  1OXS C;  1WTR A;  3VYT A;  3BDC A;  4ZYS A;  2EYL A;  3G7L A;  2JE6 I;  5IGD A;  3E5S A;  1HFG A;  1CZW A;  4ME5 A;  3QB3 A;  4DU9 A;  1A3U A;  1EY8 A;  1PFM A;  1D1I A;  3U9O A;  4KV6 A;  1EYA A;  2N55 A;  2Y0S B;  1SE2 A;  5C5L A;  4K6L A;  4JK1 C;  3TSS A;  4QMG A;  3CRL C;  2RQX A;  2F0M A;  1GOZ A;  1CHQ D;  5EKL A;  3K57 A;  3QIA A;  1LTA D;  4IZ8 A;  1EWC A;  2JA5 B;  2SNM A;  1SYC A;  3OOC A;  5CV5 A;  3K5O A;  3A8K E;  2BDN A;  1CQV A;  5A2Q E;  3EFX D;  5I9P A;  2IX1 A;  2Q8R E;  2H4O A;  1KLU D;  3HOZ B;  1H9M A;  1WCM B;  1SYD A;  1ZXT A;  2K32 A;  3BYY B;  2JSO A;  2F0U A;  3IL8 A;  2A6E C;  4K5V A;  1BXT A;  2L4N A;  2E75 C;  3MFG A;  2F1M A;  1Z6H A;  1PZI D;  2PPB C;  1LTG D;  3RD4 A;  4KJN A;  3VA5 A;  1R4Q B;  1T5X D;  1HUM A;  3MXU A;  2C9O A;  1BNZ A;  1G91 A;  3FMC A;  2OF1 A;  5ELB A;  4K8J A;  2IL8 A;  1B1Z A;  2BDO A;  5J1Z A;  1U4L A;  4BY7 B;  3NTI A;  1MSG A;  4CKB A;  1H9S A;  2IX0 A;  4C3J G;  4A3J B;  1MI2 A;  1YNJ C;  1WVL A;  2KEC A;  3S15 B;  1E2V A;  2AQ3 B;  1WD1 A;  3R93 A;  1EL0 A;  4HMI A;  4DGZ A;  1TQO A;  1PZK D;  2PNR C;  3GTQ B;  4LAA A;  1PLF A;  3K0Y A;  3JAM L;  2M9V A;  3GV6 A;  4C1N I;  3NSW A;  1IW7 D;  1LO5 D;  4HTH A;  4K14 A;  1Y1V B;  1XYI A;  1STN A;  3RZO B;  2K7V A;  1A2T A;  4DF7 A;  1AZP A;  3D4R A;  4FYD A;  1I6H B;  3PO2 B;  5KNC A;  4RGM A;  2FMC A;  2WAC A;  1Y8P B;  2IX3 A;  5DEH A;  2JA6 B;  2F0Q A;  4BA2 I;  1ESF A;  1L0X B;  2VB2 X;  5E4W C;  4R9W A;  2DNE A;  3BYT B;  1VF7 A;  4F87 A;  3M3Y B;  2RDG A;  4EQN A;  5C3X A;  4ZRZ A;  1STG A;  3LNN A;  4X3T A;  1TII D;  1RTN A;  3VR2 A;  1SYF A;  2F0F A;  2F0D A;  3PMF A;  2B39 A;  1QJO A;  1RCV D;  2E2H B;  4K5W A;  1KTK A;  4RCN A;  3PUY A;  4FNF A;  3D4D A;  2BE5 C;  2EXZ A;  1LV9 A;  3GD7 A;  4TQU S;  3DWP A;  1CQF A;  4FXG C;  2LKV A;  3P1H A;  4A3K B;  1AZQ A;  3S9W A;  5M5Y B;  2JYO A;  1PTO H;  1MD2 D;  3L7Z C;  1V1O A;  4QUF A;  5JPM C;  3C1F A;  4DK0 A;  2KCC A;  2O2L D;  3J7A V;  5CV9 A;  3I8Z A;  1F9S A;  4NDX A;  3H3V C;  3EJI A;  1HTP A;  4TKO B;  4UDU C;  1DZ1 A;  3N52 A;  1S5F D;  1QCB D;  3H94 A;  1TY0 A;  4CKC A;  4G57 A;  1IYV A;  2RA4 A;  3L3O C;  3SVM A;  3RLF A;  1B53 A;  4QF4 A;  1DJR D;  1EWH A;  2AQ1 B;  1CHP D;  3Q22 A;  1I4R A;  4IN3 A;  4BY1 B;  1UEA B;  5CV7 A;  2KA7 A;  1PFB A;  5ELE A;  2NUC A;  2PW5 A;  1C48 A;  5E1F A;  4RFB A;  1WD0 A;  4K5X A;  1AN8 A;  4TSS A;  1PTO D;  1I4X A;  2AWN A;  1HQR D;  3FPP A;  2NVT B;  2RSN A;  2QCP X;  1SMY D;  1YNN C;  3HOY B;  4IFD I;  1EU3 A;  4MIU A;  1BO0 A;  2O5I C;  1IKM A;  1IL8 A;  1GXD C;  1STA A;  1HQM C;  4OO1 G;  4J8Q A;  4RGO S;  5DAU A;  2F0T A;  4RHS A;  4ZUJ A;  1LTB D;  1U4M A;  3MEH A;  4XT3 B;  3H09 A;  4G7H C;  4RGN A;  5IGB A;  2EDG A;  2RSO A;  3TP8 A;  1JE4 A;  4G4K A;  3P75 A;  1ET9 A;  2MJ8 A;  1WTV A;  1QNU A;  2F0H A;  2A68 D;  2NWG A;  2L12 A;  2F03 A;  2ENB A;  1DOM A;  1OXV A;  1NR4 A;  2PW7 A;  3H91 A;  2RBM A;  2ZT9 C;  1BR9 A;  2RVL A;  1B4O A;  4A3B B;  4GZY C;  1H9R A;  4FXK C;  1Q8I A;  1VMP A;  2LY7 A;  1JOO A;  3VR5 A;  1EFI D;  1FNU A;  1SBB B;  4XIG S;  5C3W A;  3M85 A;  2IW3 A;  5ELF A;  4DK1 A;  4B9X A;  3NPP A;  1SNO A;  4RH6 A;  3LWU A;  4G7Z C;  5CBE E;  1HFN A;  3M4O B;  1QWY A;  2EJM A;  3C1E A;  2ID0 A;  1II3 A;  3GTM B;  3MFY A;  2FJ2 A;  4QUC A;  2ICI A;  2X69 A;  1TT2 A;  4MHE A;  1SYB A;  1H9J A;  1UUP A;  1TWC B;  1WTP A;  5BN4 A;  1DXM A;  2E2I B;  3D4W A;  1VF5 C;  2D62 A;  1TWG B;  4ZKC B;  1RKN A;  3D8G A;  5CBA E;  3E0J A;  4K6D A;  1RHP A;  4BS9 A;  5TSS A;  4PV1 C;  5ELD A;  4O42 A;  3U9S A;  3AU7 A;  3MHB A;  3RMH A;  1PRT C;  1O80 A;  1QIL A;  1LTT D;  4KY6 A;  2OXP A;  4WRD A;  2L1B A;  1ENF A;  3ERQ A;  3PV0 A;  3V2T A;  1L0Y B;  1WTW A;  4KD4 A;  1JC7 A;  5FLX L;  1A2U A;  4BBS B;  4KHV A;  4NKL A;  4HN7 A;  1JWM D;  1NAP A;  4DAY A;  5KIX A;  5C3E B;  4Q5V A;  3A8I E;  5C0X J;  1Q90 A;  4QIW B;  1BQQ T;  4KY7 A;  2F0K A;  4LK1 C;  4FF4 A;  5CGK A;  2AWO A;  2RKS A;  1NUC A;  2B2T A;  1A3V A;  4IUU A;  3EA6 A;  4FF3 A;  1EZ8 A;  4C3I G;  1D6E C;  1I4Q A;  5IT9 L;  2KHS A;  3PO3 B;  3C46 A;  4OIJ A;  3MZ5 A;  3QO2 A;  4V0B A;  5FO7 B;  2HQE A;  3H0G B;  4LJZ C;  5CV8 A;  3CRK C;  5CR3 A;  4L6T B;  1LT4 D;  1QNK A;  2K03 A;  1J9O A;  2MPM A;  4IUT A;  4M8A A;  2XSC A;  1U4P A;  1XX8 A;  4OO1 H;  4CBV A;  4ZK9 B;  3TN2 A;  2WAQ B;  2IJ0 A;  2Z1C A;  3NTK A;  2R61 A;  5HUR A;  1HA6 A;  3WDN A;  3TP5 A;  3JAM E;  1XXG A;  1X32 A;  2CW0 C;  1Z7T A;  1Q1E A;  2ZXR A;  2XRQ D;  3NBH A;  4FXD A;  3T51 B;  2E2D C;  3OSO A;  3SK6 A;  2DY8 A;  1KDA A;  1S5D D;  3FPU B;  2EZV A;  1SNQ A;  1ROD A;  1EOT A;  5G3L F;  4MN3 A;  1DD2 A;  4WOR A;  3C2P A;  2WII B;  1EIH A;  4X3S A;  5JEA G;  4YIJ A;  3OMG A;  3K7A B;  2WV6 D;  4DA2 A;  2IT1 A;  3BVZ A;  3MXG A;  1G29 1;  1OXT A;  3P20 A;  4P2C B;  2DNC A;  2R6G A;  2F0W A;  4DFA A;  3OWF A;  3MVV A;  1M8A A;  2B2T C;  2B8F A;  2KUM A;  3K5M A;  3URY A;  2B63 B;  1FNW A;  2FFK B;  2NBF A;  3KLS A;  1A3T A;  5D3I B;  1PRT F;  2M2L A;  3GV3 A;  1TY2 A;  1O7L A;  1Q3L A;  3PUZ A;  3I90 A;  5IGC A;  3GTO B;  2BA1 A;  5EJW A;  1WTO A;  2SNS A;  5EQ0 A;  3ZYY X;  3NQT A;  1F9Q A;  4RKL A;  5DM7 3;  4C3H B;  4IUQ A;  1X3P A;  4B08 A;  3HOV B;  3IFD A;  1STB A;  3IFT A;  2SEB D;  3HKZ B;  3NTH A;  2A73 B;  1HCZ A;  2WP8 J;  3PIO 3;  2MUY A;  3CQZ B;  1BCP D;  1OO9 B;  3KBG A;  3I91 A;  4J1M A;  5FO8 B;  1DCZ A;  3V96 A;  3MA2 B;  3DXJ C;  3S2H B;  2K33 A;  3HP3 A;  1VMC A;  3TDQ A;  2HCI A;  2Z8L A;  2QF7 A;  2XWB B;  2PZT A;  1GUO A;  1GUS A;  2F0S A;  1UNS A;  2RDH A;  2IWH A;  3I4N B;  4BBR B;  2WIN B;  3TP7 A;  3J80 L;  4PQX A;  2NTT A;  3T53 B;  2NN6 I;  3VYU A;  3OWE B;  2FIN B;  5KNB A;  5JAV A;  3OMC A;  4DXG A;  4FO2 A;  2CHB D;  1T5E A;  4DAP A;  3SK4 A;  1U9R A;  5EGT A;  1LAB A;  3DMU A;  1PDQ A;  5EPK A;  4UAI A;  4S3S A;  5M5W B;  4A3G B;  1G8Z D;  2I46 A;  4OL7 A;  1SAP A;  1O7Y A;  3OPO A;  1TS3 A;  1D1K A;  4HMJ A;  1RJT A;  1EY5 A;  4PMC A;  5CV6 A;  5J39 A;  4BA1 I;  1OXU A;  3I70 A;  5IGE A;  1TWH B;  2E74 C;  4C2M B;  1LT3 D;  5C0X H;  3QJY A;  1JR0 D;  2PMZ B;  3S14 B;  4L8J A;  2HCC A;  1OXX K;  1R9T B;  1HXY D;  5D65 A;  2KQ3 A;  2KOL A;  1K8O A;  3BG3 A;  4EQP A;  5KND A;  2E2J B;  5EKK A;  3W3A A;  1DOL A;  1IYU A;  1LLR D;  1BF4 A;  5D3D A;  2K6A A;  3TZU A;  4X3K A;  2FHT A;  4V19 0;  1JCK B;  2F4I A;  5DNF A;  2TSS A;  5C44 B;  3VR3 A;  1B50 A;  4BWG B;  1TS2 A;  4I7Z C;  1DYQ A;  4F7X A;  3Q6S A;  3T56 B;  3C3L A;  2G9H D;  3V05 A;  5D14 A;  1NR2 A;  3SHL A;  2K01 A;  4DNR B;  2CQA A;  1JOR A;  2A6H D;  3DWQ A;  2A74 C;  2HDM A;  1JIC A;  1GHJ A;  1PTO B;  4KMU C;  1LTS D;  2VUM B;  3GTG B;  1TWA B;  1HRJ A;  2XRS D;  4JBW A;  5IIF A;  4CGY B;  1AFP A;  1TU2 B;  4U67 3;  1IW7 C;  4N9T A;  1B44 D;  3N6R A;  2L9H A;  1XTC D;  3HEJ A;  4WFN 3;  5JPN C;  5FLX E;  1ZKO A;  2J0T D;  1F77 A;  5NUC A;  3TBI B;  4IUN A;  3NQI A;  4R8I A;  1I4H A;  2Q8T A;  4CJ0 B;  5BN5 A;  5I6Y A;  2ICE C;  4F88 A;  1HA5 A;  4CJ1 B;  2A69 D;  5EPJ A;  4IUR A;  3DEP A;  1ZEQ X;  4FVM A;  3NE5 B;  4U68 A;  2HUG A;  3IKJ A;  4TRD A;  1CM9 A;  5KYI A;  3GP7 A;  5BN3 A;  3AMU A;  3WOF A;  3GTP B;  2HDL A;  2JXM B;  3QWN A;  5T1G A;  1CZG A;  2K1B A;  3FRP B;  3L9A X;  3NHH A;  1QB5 D;  1STE A;  4HCS A;  2R93 B;  5IT9 E;  1ZYR D;  2B2W C;  5LL6 S;  4IUV A;  1IKL A;  3SK8 A;  3HGB A;  2D2C C;  1DOK A;  2R3Z A;  4C3J B;  2KEE A;  2K04 A;  2Z4H A;  3NWT A;  4H7B A;  2PO4 A;  1E2W A;  2NB0 A;  4H13 C;  2NYZ D;  3K6O A;  3KK7 A;  1I4P A;  1S5E D;  4IFD J;  2LMC B;  2NVQ B;  1V1P B;  2EY5 A;  4KY5 A;  3BVM A;  3S1N B;  3M4Y A;  5KRU A;  2CVR A;  2F0J A;  1A6X A;  2A5H A;  5C0X I;  4PNY A;  1O7Z A;  5IGG A;  3S1R B;  3D31 A;  3S1M B;  3PUX A;  1I4G A;  2EPB A;  1EY0 A;  1Q1B A;  5C4Z A;  5T1I A;  1NSN S;  2JA7 B;  5EBC A;  4XQQ A;  1QOH A;  4A93 B;  4ZKB B;  1B9M A;  1JOK A;  3D6C A;  3NUC A;  5K5P A;  2K5Q A;  5E4X A;  3GTK B;  1DON A;  1K8M A;  1PYW D;  2F0I A;  1PTO C;  3BVG A;  1CFM A;  4IFD G;  1S4Z A;  4HAE A;  1ESR A;  1GUN A;  2EVB A;  1SMY C;  2N88 A;  3CU7 A;  2QEJ C;  2YYZ A;  3BS1 A;  4ZLT F;  1HTL D;  1TWF B;  2B2Y C;  2YU9 B;  1GJX A;  3WOE A;  1B9N A;  3BZD B;  2F0O A;  3D3R A;  4A3E B;  3VR6 A;  5JJZ A;  2PQE A;  2R92 B;  1PZJ D;  1CI3 M;  1SE3 A;  1W6K A;  4KKU A;  3RZD B;  3NP8 A;  5E3F A;  2VB3 X;  4IQZ A;  2WB1 B;  1SE4 A;  4XT1 B;  3QG1 A;  5FO9 B;  2O4X A;  2K05 A;  5K36 G;  3KF8 A;  2A68 C;  1BBX C;  1F2L A;  1JB3 A;  2EY2 A;  3KUP A;  2OEO A;  2A6E D;  2K5W A;  3VYR A;  3Q0A A;  4IAL A;  5JEA J;  2F0N A;  1C8C A;  1TS5 A;  2PZU A;  3A7A B;  4H0L C;  1LAC A;  5DM6 3;  2H1E A;  4HSP A;  2ZXP A;  3HG9 A;  3NK9 A;  4QCL A;  1Z47 A;  2Q8I B;  5CMD A;  3M7G A;  4AYB B;  4RA8 A;  1YNJ D;  1EU4 A;  5FK9 C;  5EBD A;  3J80 E;  1F9P A;  1M4V A;  4HED A;  1VCI A;  3VR4 A;  2F0P A;  4KN4 C;  3DWA A;  1TKW B;  1SEB D;  1SDF A;  3J81 L;  5ELC A;  2XNA C;  2EY6 A;  3DEO A;  2B8G A;  2XVS A;  5FKA C;  2NVX B;  1LTR D;  4A3F B;  4F8M A;  1PMR A;  1SNM A;  5CC4 A;  3DUZ A;  1EEI D;  2F0V A;  3G6J B;  1PXU A;  4E6I A;  4EGV A;  1Y1W B;  1EIG A;  5A35 A;  1GHK A;  3CKI B;  3K5L A;  5KEE A;  4L63 B;  2BA0 A;  2V4D A;  4RHR A;  3K58 A;  1S5C D;  4G7O C;  3ND8 A;  3SDZ A;  2BOS A;  4RKB A;  2K28 A;  3SR1 A;  5M5X B;  2QKI C;  1CA5 A;  2SDF A;  3IAY A;  1MBY A;  1RDP D;  2EYM A;  1S5B D;  1BCP B;  3S16 B;  1TS4 A;  1JWS D;  1LT6 D;  1PTO F;  1H9S B;  5I9O A;  1G6Z A;  2BE5 D;  3ONA B;  4QB4 A;  2PZW A;  1PFN A;  4PMW A;  5I2X A;  2O5J C;  2EYJ A;  5J22 A;  1G2T A;  3ITP A;  5CV4 A;  1C4Q A;  2F0G A;  1V43 A;  1J8I A;  4IFD H;  3I3C A;  3SE0 A;  1HHV A;  5JOB A;  3K5N A;  2L0C A;  4FF1 A;  1RF2 D;  1SJH D;  2VNU D;  2EE1 A;  3VA7 A;  3SXH A;  1EY4 A;  4ID6 A;  1B3A A;  5FOB B;  3E6Z X;  2K5D A;  5C5M A;  2IPK D;  4CJ2 C;  3A8J E;  3BDL A;  2WKC A;  1F2M A;  2G9D A;  3QOJ A;  4HCE A;  5EKI A;  4NMZ A;  1Q12 A;  2D5D A;  2J4X A;  1SYG A;  3MC0 B;  4OHJ A;  5K36 H;  4O1N A;  1E0B A;  4ULL A;  4ILW A;  4PMB A;  5KYL A;  1ONL A;  3I4M B;  2QIL A;  1WTX A;  1QG7 A;  2KVM A;  1IHZ A;  4KD3 A;  2TMP A;  5EPL A;  5LL6 X;  4NW2 A;  1HPC A;  4XTC S;  1R4P B;  3T4A C;  5CYU A;  1D5Z C;  1YNN D;  3TZD A;  1BUV T;  4EVO A;  1FNV A;  2D9U A;  1GUW A;  1SFO B;  1STY A;  2B2V A;  4C3I B;  3QOL A;  1Y69 U;  2EOT A;  2MGS A;  1EYD A;  4KKT A;  3LX0 A;  3S17 B;  3TME A;  4OO1 I;  3TP6 A;  2LFN A;  2C5C A;  5ISR A;  3DM1 A;  2F3V A;  1UAP A;  2LS0 1;  3X3N A;  1EYC A;  1AW7 A;  1KNE A;  4KTA A;  4X3U A;  5KGU A;  1KNA A;  3S1Q B;  3HS0 C;  3T13 A;  5A2Q L;  4KHZ A;  1XWE A;  1EQT A;  3LWE A;  5JEA H;  5I4D A;  1NCV A;  1X3Q A;  5C6A A;  2B2W A;  4XYQ A;  2DN8 A;  3EQL C;  3MWY W;  3OIP A;  4A3I B;  4DNT B;  1SXT A;  4RGT A;  1FYC A;  1TR5 A;  1BCP C;  1LT5 D;  4WJW A;  4OIK A;  4CHT B;  5AFW A;  1CT1 D;  3MTS A;  1SND A;  4Q0F A;  5G3L D;  1Y8N B;  2FMM A;  1TVX A;  4C56 C;  2XWJ B;  2JEA I;  3GO5 A;  2F0L A;  5C4H A;  4FF2 A;  5IGF A;  1SNP A;  1I50 B;  3GTL B;  4A3M B;  1I3Q B;  4N9P A;  1WTQ A;  1FR3 A;  4DAV A;  2EJG C;  1D5M C;  1U4R A;  1SNC A;  1ICW A;  2XN9 C;  2KJX A;  3FKI B;  4K2L A;  4XQN A;  1K83 B;  1ML0 D;  3SEB A;  4J6H A;  1PRT B;  2NN6 G;  3ERO A;  4XQJ A;  5C4J B;  2BCO A;  1EEF D;  4DXF A;  1BDO A;  3S2D B;  1EY6 A;  4XDX A;  3A56 A;  1H9K A;  5I2Y A;  1JOQ A;  1ILQ A;  1EY9 A;  1PRT D;  2XIW A;  2L11 A;  2EJF C;  2B2V C;  5F2D A;  3M7N A;  4ZAI A;  4RAU C;  2B2U A;  3R2T A;  4I65 A;  2KED A;  3KBX A;  5M3F B;  3A54 A;  3HZX A;  1SJE D;  1CTM A;  2MP1 A;  3F2U A;  1KAA A;  2EYP A;  3R3O A;  4K8I A;  2PYK A;  2OT2 A;  3O13 A;  3CHB D;  1F9R A;  3P7J A;  1F2Y A;  2L5T A;  4Y7N B;  3X3M A;  5JVG 3;  1ENC A;  1MSH A;  2B2Y A;  1EQV A;  3MXN A;  1STH A;  5M3M B;  3J7Y W;  3NBI A;  2NVY B;  1GUT A;  3GQB A;  4KKS A;  1G2S A;  5HGT A;  5M9O A;  4KN7 C;  1FD7 D;  4H44 C;  3R2I A;  2SOB A;  5COY A;  3H6M A;  4ZUI A;  1SYE A;  2X6G A;  1KDB A;  1JQY D;  1BOS A;  4NP5 A;  1KAB A;  1AEX A;  1D5X C;  1B2T A;  1GUG A;  2WKD A;  2L55 A;  2F3W A;  2ZXO A;  5COR A;  3HOW B;  4RWS C;  2RDF A;  4C3H G;  4XXE A;  3A55 A;  2PCF B;  3UI2 A;  3I4L A;  4HSV A;  2JEB I;  2NZ1 D;  2J7Z A;  1KLG D;  4M1U B;  1CA6 A;  2A6H C;  2Z4I A;  4KK7 A;  2JP1 A;  1ENA A;  2E76 C;  1F2Z A;  2CW0 D;  2VXW A;  1FGB D;  3HRZ C;  3Q24 A;  3GTJ B;  2M00 A;  3ND9 A;  1EY7 A;  1RD9 D;  1BCP F;  3VYS A;  3DHQ A;  5IOD A;  5I6W A;  1ILP A;  3J81 E;  2EY1 A;  2MHV A;  4ODG A;  3J7A F;  2AQ2 B;  3PUW A;  1MGS A;  2F0E A;  2I07 B;  3PIP 3;  2B2U C;  2DY7 A;  1CK1 A;  4IUP A;  4EQO A;  3MAQ A;  1DM0 B;  3KLS X;  4KJO A;  1W6J A;  3T16 A;  1V1P A;  4R8N A;  4ABN A;  3Q23 A;  3PUV A;  4XYO A;  3BDO A;  2JA8 B;  2EYF A;  4FP5 D;  3K59 A;  1QE6 A;  3KLR A;  3NWS A;  4KI0 A;  3FEW X;  4CKE A;  2EYH A;  2AUJ D;  1D2B A;  1EZ6 A;  5LHY 1;  2EYO A;  3HOU B;  2A69 C;  2X6L A;  3I72 A;  1KDC A;  1Y8O B;  2GA4 B;  2AUK A;  2NN6 H;  2NTS A;  1HUN A;  1JWU D;  1VDZ A;  1AP0 A;  3I73 A;  5JVH 3;  1O78 A;  1I6V C;  1ZYR C;  3MXP A;  4HR7 B;  4A3D B;  4ZQ3 A;  3RUZ A;  3D6W A;  3NXW A;  1E2Z A;  3FVQ A;  2R7Z B;  5C4X B;  3EVQ A;  3HOX B;  1LTI D;  4LMQ D;  4DN4 M;  4B9W A;  3OW7 A;  3W2D A;  4OGQ C;  2QDB A;  3AB9 A;  3FDT A;  3SK5 A;  4K2K A;  1A15 A;  3A7L A;  3R8B A;  4C1N K;  5C0X G;  2KCN A;  3OHX C;  5IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...