1KNAA

Chromo domain of hp1 complexed with histone h3 tail containing dimethyllysine 9.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
52
structure length
52
Chain Sequence
EYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords HETEROCHROMATIN PROTEIN 1
publication title Structure of HP1 chromodomain bound to a lysine 9-methylated histone H3 tail.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1knaA00
1KNEA 2L9HA 5JJZA 5D65A 1WTVA 1WTQA 2B2VC 4OIJA 1U4RA 4ZKCB 1RHPA 1SDFA 1ICWA 2FFKB 3KBXA 3KUPA 3D6WA 3I3CA 1BF4A 1F9PA 1G91A 1MI2A 2NZ1D 3FPUB 3IL8A 5T1GA 1Q3LA 1G2SA 1SSOA 2RSOA 4RAUC 2X6GA 1ESRA 1F9SA 1QE6A 1JICA 1BBXC 4IUTA 1NR2A 1PLFA 4ZLTF 1KNAA 3HP3A 2XIWA 1NAPA 1NR4A 2KECA 2RA4A 1CA5A 5AFWA 3N52A 5CMDA 4R8IA 1QNKA 1E0BA 2EPBA 3SVMA 1WTRA 3P7JA 1WD0A 5EPKA 1B2TA 1IL8A 1B4OA 2N88A 2SDFA 1M8AA 3H91A 3MWYW 1HUNA 5EPLA 2MP1A 4X3TA 1A15A 2B2UA 2B2UC 2X6LA 4OIKA 4U68A 3G7LA 1WTXA 1HA6A 1F9RA 2Q8TA 1PFBA 1AZPA 2KEDA 2NWGA 1ILPA 1AP0A 4CJ1B 4UAIA 1DOKA 5EKIA 5E4WC 2KVMA 4MN3A 1VMPA 2L4NA 2K28A 3TZDA 1GUWA 1IKMA 4IUUA 4NW2A 2B2TA 2FHTA 4CJ0B 2RSNA 1G6ZA 2K04A 1EIGA 1PFMA 2RVLA 2VXWA 2JYOA 4ZK9B 2L1BA 5COYA 2KEEA 1X32A 2MJ8A 2H1EA 1HHVA 2M2LA 4X3SA 4DN4M 3I90A 1NCVA 1F2LA 2EE1A 2HUGA 2IL8A 3ONAB 4IUVA 1C8CA 2HDLA 2J7ZA 2L12A 5CBEE 1WVLA 4ZAIA 1CM9A 3FDTA 3Q6SA 1MGSA 4RA8A 4RWSC 4XT1B 4HAEA 1ILQA 1PFNA 1B3AA 4HCSA 1O7ZA 4ZKBB 1QG7A 4HEDA 4X3UA 5CORA 1F9QA 1JE4A 1CA6A 1J9OA 1XX8A 2R3ZA 1HFGA 1X3QA 4LMQD 3F2UA 2FINB 5EQ0A 1MSGA 1BNZA 1WD1A 5DNFA 3GV3A 2L11A 1B53A 1EOTA 2B2WA 2MGSA 2B2WC 2N55A 2KUMA 1O80A 3I8ZA 3MTSA 4R9WA 2JP1A 3I91A 1EL0A 1HUMA 1HRJA 1X3PA 2K05A 3DM1A 4IURA 3TN2A 2BDNA 2B2TC 3DEOA 4MHEA 1HFNA 1SAPA 1DOLA 1U4MA 4IUQA 4XDXA 1PDQA 1LV9A 2KOLA 1AZQA 1BO0A 1G2TA 3IFDA 2HCIA 1RJTA 1TVXA 2D9UA 2DY7A 1ZXTA 2B2VA 2FJ2A 2K03A 1RODA 1U4LA 2HCCA 2MPMA 2X69A 1B50A 1J8IA 4QUCA 3DEPA 4X3KA 1MSHA 1XYIA 3GV6A 3R93A 1DONA 5T1IA 1IKLA 1DOMA 4QUFA 3UI2A 1U4PA 4HSVA 1EIHA 1O7YA 2HDMA 5EPJA 5CBAE 4IUPA 1RTOA 3QO2A 1RTNA 3LWEA 1VMCA 2DY8A 4XT3B 5EJWA 1WTPA 1DZ1A 2K01A 2Q8RE 1WTWA 1EQTA 2CVRA 4CJ2C 2B2YA 1ML0D 2B2YC 2NYZD 2EOTA 5E4XA 1WTOA 4O42A 5D14A 2K1BA 2FMMA 1S4ZA
chains in the Genus database with same CATH superfamily
2ALYB 5D3DA 1QUQB 3OW2A 4XYOA 1MD2D 1RHPA 1WFQA 2MQHA 1TS3A 4IJLA 3D4RA 1K73C 3D6WA 1N32L 1TIID 5I9PA 1AE2A 5IT9L 1A0IA 2D62A 2Z6KA 4A3KG 4HJ7A 1ESRA 1SNDA 1PVOA 3DLLA 3L7ZC 2NVQH 3X3MA 1H9RA 1RCVD 4OWXB 2VS1A 2TMPA 3K0YA 4UHVA 4RKBA 3TDQA 1WD0A 4JI5Q 3A74A 1UUPA 1M8AA 3MWYW 3RN5A 3M7NA 5HURA 1Y8OB 4RGMA 4A4IA 2B2UA 5IYDH 1YNXA 2BE5C 2PNRC 1M1KC 1I4QA 3S1MB 2OT2A 4JPBW 3GTJB 4I7AA 2ZJRA 3K8AA 4V190 2R92B 2R6GA 4C3IG 3LWUA 1LLRD 4TSSA 3ONAB 4QB4A 4GNXB 4FP5D 5A2QL 1I4RA 1C9OA 2K5VA 3FDTA 3HZXA 4NKLA 5IWAL 2CFMA 5C0XG 1B3AA 1CHQD 1D7QA 1VQLA 2K52A 3CQZH 3PO3B 3GTLH 2YU9H 4EQNA 4Q0FA 4ZQ3A 3F2UA 4LAAA 4BBRH 3TS2A 1L2FA 1TY2A 4DV4Q 4OGQC 3A8KE 3MTSA 2B63B 1O7IA 2KUMA 1CKMA 1HRJA 4DR1Q 1IXRA 4FF4A 3TN2A 1HFNA 2AUKA 5C5LA 1BOSA 5C6AA 1SJHD 3PGZA 1AZQA 2KCTA 3NPPA 3DWQA 2K03A 1U4LA 1UE1A 3ITPA 3OWFA 4BY1G 3DEPA 1JC7A 3Q23A 1X9NA 4WFN3 1V43A 1MIUA 4PZ6A 1G291 5M3FB 1Q82C 4BY7G 1W6KA 2XWJB 3CCUA 4DR3Q 3U4VA 3TRZA 4GOPB 3K7UC 1YVCA 2JA8G 4AYBE 3HOXG 4S3SA 1BKBA 3G6JB 3J80E 1PH6A 4ILWA 1L1OA 2LXJA 1FNUA 1YBYA 2L9HA 1LTRD 4DR7L 4HMJA 4A3IH 5BR8L 3BVMA 1F9PA 2WFWA 5JVH3 1HR0Q 3M4OB 3FPUB 2A6ED 4DAYB 1SSOA 4AIMA 2DUDA 2X6GA 5C0XJ 3FMCA 3CMEA 5JVG3 1PMRA 5HGQA 4JI0L 1AN8A 1SYEA 2EXZA 1KAWA 4KMUC 4KLKA 1R4PB 1SRUA 3QWNA 1R4QB 1VQHA 5C4HA 2O5JC 4JBJA 4X3TA 4U673 2E2IH 1Q8IA 3CCQA 5C4XB 4ZUJA 5KYLA 1QVCA 1Z7TA 1KIXA 1H9KA 2WAQB 4QQBX 1NY4A 4RFBA 4A3LG 2I5LX 3KF6A 1EY4A 2A74C 3NSWA 1LTID 2OXPA 1WYDA 4M1UB 2UUBL 4B3SQ 3D4WA 5COYA 4CKEA 4DV4L 3BDCA 1CK1A 1YEZA 2QW7A 4LF8Q 4DR1L 2F0DA 1PFNA 5CORA 4FVMA 2VQFL 2JE6I 4Y7NB 3D3RA 4CBVA 5J39A 3D0FA 5FO7B 3CCMA 5NUCA 5FLMG 1WCMB 2BDNA 3MAQA 3HOZG 3DWPA 1NTGA 3F1ZA 5C3EG 1JR0D 4DR3L 1RJTA 1KRSA 1XTDA 2HQEA 2DY7A 1CSQA 1RKNA 4A3CH 1CKNA 1UE5A 2X69A 4NMZA 1ASYA 1LT5D 1TWFH 4A3GB 3DWAA 5JJIA 3M3YB 1TWHH 3H0GH 1VDZA 1DOMA 1W3SA 2Z1CA 4ZRZA 2A73B 5CBAE 3FKIB 2K33A 3WWVA 1HR0L 4DUZQ 1EOVA 1HTPA 4C56C 2UXDQ 3VR4A 1XWEA 1XJVA 2A69D 4O1NA 1LACA 3SGIA 3PF5A 1VQIA 3NHHA 4YWLA 4A3FG 3U58A 1PZKD 4JW0A 5I6YA 2ES2A 3PQIA 1X54A 3QB3A 2DJGC 2F3WA 2CW0D 4R1JA 5ISRA 1E2WA 1GHJA 3W1GA 1S5CD 4DGZA 5M5WH 4FNFA 4YWKA 3AFQA 3CCVA 2JEAI 3I4MH 4KHPQ 3IKJA 4A3EB 2F0HA 5DLQE 2B2UC 3DM3A 1ASZA 3NXWA 1EY9A 3QJYA 2CQOA 3AB9A 4IPGA 3BZKA 5E4WC 4LF8L 3TP5A 3SK6A 4GNXA 3E5SA 4OELB 4A3JG 4LNQA 1B8AA 4IUUA 1NNXA 3V05A 3CD6A 1EIGA 4JYAL 3HFZB 5IT9c 4RGNA 3I4OA 4IJHA 2NN6G 5LMUQ 1KXLA 1STBA 5C3XA 1T9HA 2F0LA 4DR5Q 1F9QA 2RCNA 1K8GA 2PNHA 1K8MA 1Y1VG 3MC0B 4DR4L 4EQPA 2L11A 3G48A 2MGSA 5IE8A 1EIHA 4C3HB 1DXMA 2UUAQ 5KNCA 3BG3A 3DEOA 5FJ8G 4DV1Q 4MHEA 1SAPA 2NBFA 4PZ8A 4KY6A 1ZXTA 5FKAC 5JEAH 1Z6HA 4DUZL 5IP7G 2UXDL 4NDXA 2PMZB 2WAQE 2PI2A 4NXNQ 3J81E 2JA7B 3A56A 4LFCQ 3H3VH 1I94Q 2UXCQ 2A68C 2XRQD 4HSPA 2EJFC 4I7ZC 2IY5B 3JAMc 3QO2A 3EA6A 4X6AH 2DY8A 3AFPA 1VQ9A 1U9RA 1PYSB 4LFAL 4HIMA 1L1OC 1CSPA 3SR1A 4DV6Q 3R2TA 3M85A 1XPUA 1STYA 1IYUA 1ICWA 3KUPA 3NP8A 4PNYA 1ICFB 3NWTA 4IOAA 4LF4L 3ULLA 3LNNA 1F9SA 1QE6A 3S1MH 1ZKOA 1NR2A 1V1PA 4K5VA 4A93B 3LX0A 3GTJH 5KNBA 3HP3A 1PFSA 2R92H 5IYDG 5AFWA 1C7YA 1U0LA 1M90C 2AHOB 3BU2A 1JORA 3KK7A 2WB1G 3OTOQ 3EIVA 5EAYA 1QVGA 2QKIC 3U50C 1FVIA 5M9OA 4TRDA 5IGBA 2E76C 3PO3H 5LMUL 1TS5A 1PFBA 1GXDC 2BA1A 5IGCA 1D1IA 2B63H 5FO9B 2IT1A 4A3BB 1Z47A 3T4AC 4DR5L 2WACA 3I55A 2JK8A 4CJ0B 1Z9FA 4UDUC 3VYRA 2LSSA 2H4OA 3HOWB 1KRTA 4X3SA 4IUVA 4AQYQ 4LUVA 4BBRG 2UUAL 2KENA 1OO9B 1KLGD 1A8VA 1I4PA 4WJ4A 4DV1L 3UDFA 1V1QA 4A3IB 5M3FH 2NTTA 4GKJQ 3HKZG 5JJLA 2F0TA 4RGTA 4UP8A 2JA6G 4JVZA 5BN4A 3PIP3 5IYBH 4NXNL 1HNWQ 2HIXA 3I2ZA 1O80A 3A8JE 2PQEA 4LFCL 1JQYD 4IURA 1I94L 2UXCL 4HTHA 2Y0SB 1DOLA 1CT1D 5IGGA 1G2TA 1S5BD 2Z4IA 3K5OA 2Z8LA 4I65A 4KHVA 1FYCA 2EQSA 1DJRD 1Q12A 1XPRA 3M4OH 1XNQL 2RCFA 3PUYA 2E2IB 3K6OA 1D6EC 3MZ5A 5DEHA 3CW2C 3FEWX 2K01A 3D6CA 1R9TH 1Y1WB 4WJ3M 4K2LA 1ENCA 4JCVE 4KKTA 5ELEA 4DAMA 3I4NB 3A5ZB 2ZT9C 2AQ2B 4K0KQ 2B2VC 4DK6C 3ICEA 3CC7A 2VQEQ 5CYUA 1ET9A 1SDFA 5A35A 5C4XH 1BF4A 1PZJD 2VB3X 2HHHL 4J6HA 5T1GA 1DM0B 4J15A 1G2SA 3SK5A 1S5DD 3T56B 3G71A 2DNCA 2KBNA 4JI2Q 4RGOS 5C44G 1V1OA 1KDAA 3J7ZC 3S17B 3S2HB 3VDYA 2EPBA 4HJ9A 2PMZE 4O2DA 1JMCA 1H95A 3K80C 1GVPA 1KL9A 4XQNA 2MP1A 1HTLD 1I4XA 4Y7NH 1TWCB 1ILPA 1NE3A 1B1ZA 4JI3Q 1K3RA 1SE4A 1DOKA 3H0GB 1H9SA 4GNXC 1K0SA 4PQXA 3Q0AA 2VUMG 1G8ZD 2VXWA 4ZK9B 4GKJL 2JYOA 1JB3A 2EY2A 1VQAA 4BBSB 1X32A 1HHVA 4YCUA 1YNJC 3BJUA 3RD4A 1ET6A 1N32Q 2IHEA 1HNWL 1I6HB 4JI1Q 4DNTB 4RA8A 4A3GH 4XQJA 1PH7A 3KBGA 1TS2A 3M3YH 4HMIA 2IX3A 1QZGA 1QNUA 1J9OA 1EY8A 3HKSA 3K57A 3FKIH 2PW7A 3WDNA 3I8ZA 3NTIA 3PUWA 1C48A 1C0AA 4XDXA 5H1SE 1I50B 1BR9A 2FJ2A 1N36Q 2PYKA 3T51B 5EKKA 3KF6B 3TBIB 4E6IA 4DXGA 1JWSD 5K5PA 4B3ML 2R93B 2Q2TA 4GOPC 1X6OA 1PH8A 1VF5C 2ZM6L 1WOCA 4MNOA 5FLXL 1F2ZA 4K0KL 3UI2A 1TU2B 2HDMA 1QILA 4L8JA 1YHQA 5CV4A 4IFDI 2GVBA 4JI7Q 3TP8A 5K36H 2F0KA 1QWYA 1CQVA 4NP5A 1YNNC 2EOTA 1YHBA 2VZAA 5IWAQ 1I5FA 4G7ZC 4CKCA 2DJFC 4JI2L 3MHBA 1KNEA 4OXPA 3F2BA 4OO1G 1PRTB 3UDGA 1OXTA 2PZWA 3KBXA 3RLOA 4GN5A 1JJGA 4JBMA 1Q3LA 2EYMA 3CPWA 3I4MG 1AE3A 4A3DB 1CKNB 1BBXC 2Y0SE 4IUTA 1MKHA 1N33L 4DV7Q 1STNA 2C9OA 1DCZA 3BYYB 2K7VA 3I72A 4OEMB 4JBKA 2CWPA 1E0BA 2A6HD 1MJCA 1AW7A 4FF2A 2BA0A 1ZYRD 2SDFA 4K6LA 1YJWA 1LT6D 3RLNA 3KLWA 2CWAA 3S24A 3PF4A 1DYQA 1E2VA 1VQFA 3BS1A 4POFA 4JI1L 1JT8A 4C3HH 4R4IA 3OWEB 4CGYB 4GLXA 1GUWA 3S16B 4WJWA 5ELNA 4PMWA 4DF7A 4DR7Q 4FXGC 2L1BA 2WP8J 2K4KA 2KEEA 5BR8Q 2XVSA 1D8LA 4DN4M 5IODA 1QJOA 1CM9A 3Q6SA 1MGSA 2WINB 2LS01 1GHKA 5LMNW 2JA7H 1LTLA 2NVXB 3W3AA 4JI0Q 1XMOQ 2CHBD 3BDOA 3VR6A 4C3IB 1N36L 3HOVG 1MSGA 4O0AA 4UPAA 4GKKQ 2JQOA 1TKWB 3CP0A 4JI4Q 1CHPD 2MUYA 1Q46A 2EIFA 2F1MA 1VQOA 1OTCA 3W5OA 3RZOB 2SOBA 5M5YB 5D3IB 2D9UA 4JI7L 1A6XA 1RIPA 1KABA 4RKLA 4FF1A 4C3JB 3CCSA 5E7NA 3STBD 2Q2IA 4WORA 3MVVA 4DV0Q 2UUBQ 1JOOA 5I4DA 4IOCA 5EBDA 4JI6Q 4A93H 1WTPA 4OWWB 2A6EC 2VB2X 4EQ5A 5C4JB 4BY1B 5E4XA 2BH8A 1JE5A 2UUCL 4Z9CB 2QEJC 5D14A 2RSOA 2E75C 4BY7B 2A19A 1H9MA 1LTSD 3FHWA 2VQFQ 1PHJA 3GTKB 3PUZA 4DV7L 4R8NA 1STEA 2H5XA 2FFKB 4HIDA 2XSCA 4RCNA 2O2LD 3HOXB 3HEJA 2A1AA 2RBMA 3H09A 2J0TD 5GADC 4A3BH 1BXTA 1JJCB 1F2MA 3BZDB 1Q1EA 1SROA 1SXTA 4DV2Q 4MZ9A 3J7AV 2YTXA 1E1OA 2I07B 3RMHA 3HOWH 2F0PA 1PH2A 3R2IA 5JEAJ 4ME3A 3AEVA 5LMNL 2G9DA 2N88A 1X3GA 2BE5D 3H6MA 2X6LA 1A3TA 3G7LA 1LABA 4BA1I 2Q8TA 1AZPA 1UNSA 3A5UA 3GTGB 2CCZA 3DXJC 3C1FA 5JAVA 1CQFA 1LTTD 3CHBD 1XMOL 2K04A 5M3FG 4JBWA 3S1RB 1R9TB 3NTHA 1BQQT 4GKKL 5KIXA 2M2LA 4P71A 4JI4L 2GN5A 1VQ8A 2E2HB 1V1PB 4RWSC 4B08A 4HAEA 4HCSA 4N8FA 1VQGA 4X62Q 2R3ZA 1XNRQ 5EQ0A 4JV5Q 1BNZA 2IX1A 1A3VA 2JEBI 2B2WA 1Y1WH 1D5ZC 2JP1A 4K2KA 1EL0A 3S9WA 3I4NH 1VQ6A 2NUCA 2NVYB 5GQOA 4DV0L 4JI6L 3HGBA 2HCIA 2K5HA 3GTOB 4PG3A 2K14A 3MFYA 4CDDC 3CRLC 5CV6A 3CCRA 3RR5A 2A69C 1HZBA 3CMAA 4HCEA 5C3EB 4JYAQ 4KN7C 2QCPX 2E2DC 4XT3B 1EY5A 2F03A 4DK1A 4KHZA 4XIGS 4A75A 1WTWA 3DHQA 4FXDA 2YTYA 2ZTEA 3S17H 2B2YA 4AH6A 3KJPA 1GM5A 1A2TA 3S2HH 2CW0C 2WAQG 3W1BA 4KKSA 1A2UA 2B8FA 3CCEA 3A54A 3CRKC 5FK9C 4DV2L 1SYCA 3GTPB 5M5XB 3IRBA 1TWCH 4DR4Q 1ONLA 1Q90A 3J80i 2OTJA 2JA5B 3SK8A 1EQRA 4R4CA 1I6VC 1JICA 2AWOA 1PLFA 5BN5A 3V96A 2A8VA 5JPNC 2KECA 1B7YB 4BBSH 2RA4A 5FLXc 3R8BA 1CA5A 1WTRA 1I4HA 1BUVT 5BN3A 2QGQA 1IL8A 1I6HH 1FR3A 2CQAA 4B9XA 2WKDA 2ZXRA 3MEFA 1WCMG 4N8X1 2IJ0A 1OXUA 1HA6A 1HZ9A 2Z6BA 1EZ6A 1N34L 3GQBA 4RHRA 4Q5VA 4LFAQ 2Z6KC 2L4NA 1IW7C 2K28A 4A3GG 1FGUA 1TR5A 2ICEC 4DUYL 5CV7A 1SNQA 1BDOA 3OPOA 4X62L 3S2DB 1XNRL 1I50H 1M4VA 4JV5L 2MJ8A 2KCNA 2K50A 3EVQA 1MBYA 1WI5A 3KYHC 1KD1C 3PO2G 3FKIG 1BCPC 3F8TA 5GROA 2DN8A 2R93H 2OEOA 3J81j 4LF4Q 4XT1B 4B3RQ 1ILQA 5J22A 3OMCA 3Q24A 5IP9H 1CA6A 1HFGA 2PI2E 3NE5B 2JXMB 1OXVA 3X3NA 3S1QH 2WIIB 5GAEC 2M00A 1EY7A 1CUKA 1I3QB 3IFDA 1TVXA 4A3MG 1H9SB 2MPMA 3M4YA 5K36G 2R7ZG 1IYVA 4UP9A 4A3DH 1U4PA 4A3EG 4DV5Q 2Z4HA 3NK9A 2XGTA 1HH2P 3T1HL 4J1MA 2YV5A 1GUSA 2PZTA 1S4ZA 1K83B 1P16A 1BBUA 4JC0A 2KHIA 4KY7A 4TQUS 5D65A 1JOQA 1YZ6A 2PO4A 1PH5A 1IYJB 4CHTB 1SBBB 2BDOA 1XMQQ 1GUOA 4NB3A 3K5MA 3S16H 1B9MA 5IT9E 3MEHA 4ZYSA 5KNDA 2AKWB 5M3MB 3OMGA 2G5DA 5CMDA 3MXNA 1A63A 1XNQQ 2EDGA 1WTHA 1PTOC 3RNUA 1KC8C 2D2CC 4KD3A 4FO2A 1L0WA 1SYBA 4U68A 1EYDA 2NVXH 1W2BA 5JOBA 3ULJA 4C3IH 3EJIA 3GP7A 2KEDA 2C35B 5FO8B 2PQAA 4IALA 4B3RL 2WB1B 5C0XH 2LFNA 1IKMA 3J7A5 2B2TA 3ERQA 1P8LA 1T5XD 4UP7A 5M5YH 3RZOH 1EUJA 1NCVA 2HHHQ 4LFBQ 2HDLA 3ERSX 5IGFA 4C3JH 2RKSA 4RCOA 3T53B 3UE0A 4EVOA 5A2QE 3JAME 3HOUB 1EEID 3K5NA 2F0SA 2EYOA 4KV6A 1IHZA 5C4JH 4BY1H 2B2WC 3TEHB 4DR2Q 3VA5A 4BA2I 5EBCA 2CKZB 2K05A 3K7AB 1EEFD 3PIOA 4LUOA 4BY7H 1BO0A 4DV5L 3GTQB 3GTKH 3TP7A 3HKZB 2MHVA 2JA6B 1N9WA 2RF4A 3MXUA 2A68D 3SHLA 1B50A 4QUCA 2EVBA 3HOXH 4RG1A 4K5WA 3G4SA 1VQBA 2OQKA 1BCPB 4IUPA 1VMCA 1LT3D 3J80L 1DD2A 1Y14B 1PRTC 4CJ2C 3J81i 1B44D 2B2YC 2NYZD 2OCEA 2K5DA 4QIWB 1XMQL 1KAAA 4B9WA 3I4LA 2NZHA 3NENA 1K8OA 4GLAC 1JCKB 4EQOA 3P75A 3TREA 3UDIA 4YY3Q 4GZYC 4CKBA 4R4TA 4DA2A 3RZDB 1K8AC 1EWCA 3HOWG 3A7LA 1D2BA 2PZUA 3GTGH 3BVGA 3M4PA 2HT1A 4KY5A 4RAUC 2AQ1B 4H02A 3MXPA 2QF7A 3FRPB 1KNAA 4A3IG 3C3LA 2VY3A 3S1RH 2BCOA 2NVTB 3OW7A 2MO0A 2AMCB 1AH9A 4B3MQ 2B39A 1VQEA 4QF4A 5EPKA 4IFDH 3OOCA 4KKUA 2ZM6Q 1SFOH 5E3FA 2E2HH 4LK1C 1I4GA 4A3LH 1SNMA 5EPLA 4OIKA 1TWGB 5C44B 3F2DA 3I70A 3T13A 1F9RA 5C0XI 4DNRB 4LFBL 4FXKC 3C46A 2XWBB 1Q8KA 1GKHA 3FPPA 2NVYH 1STAA 3JAMi 2RSNA 1PFMA 3KLSA 1SYGA 3NEMA 3CF5A 4H7BA 3GTOH 2WV6D 3HOYB 3L3OC 1C8CA 2EE1A 1X3EA 2HUGA 2KHJA 5HGTA 5FLMH 4DR2L 1WVLA 1AFPA 3I4NG 1KQSA 4DPGA 4MIUA 4HEDA 2VUMB 3SK4A 3E0EA 5C3EH 2SEBD 1N33Q 1CTMA 1FL0A 4K6DA 1Y69U 1PTOB 3A55A 5ELFA 1ENFA 2K5WA 2N55A 1EFWA 2B29A 5JJKA 2F0FA 1HUMA 1NMFA 3EFXD 1EWIA 2LMCB 3KDFA 5TSSA 1SMYC 1KDCA 1UWVA 2E5LQ 2O4XA 3O13A 3GTPH 2KA7A 5M5XH 1EIFA 1D5XC 4GS3A 1H9JA 2JA5H 4C1NK 2WB1E 1MSHA 4H0LC 1XYIA 3MFGA 2KQ3A 1DONA 3T1YQ 4QUFA 1O7YA 4YY3L 4A3CG 1RTNA 4FYDA 2EY1A 3AYHB 3EQLC 1EIYB 3H0GG 1LUZA 1EY0A 4XYQA 3VYUA 4KTAA 1YIJA 1LTAD 3M7GA 1WTVA 3CC2A 3I7FA 5I2XA 1QZHA 4DV3Q 1TWAB 2F0IA 4G7HC 2KJXA 2OTLA 2QEXA 4TVAB 2UXBL 2NZOA 4K14A 3L2PA 3S2DH 1L0YB 3S1QB 2VL6A 3HKZE 3S1NB 4GN3B 1HZAA 5F2DA 5DM73 3AU7A 5IGEA 4EX5A 4A76A 2O5IC 2J4XA 1VQ5A 4RHSA 4B3TQ 2ZJPA 3A7AB 2LKVA 3HS0C 2HQLA 4DK0A 4CDFC 4AYBG 1GO3E 1B70B 2KVMA 1VQ7A 2UUCQ 2XNAC 4JG2A 2R93G 2XRSD 4QIWE 1YNJD 2WKCA 3VYTA 4DAPA 2OWOA 1I3QH 1FNWA 1II3A 4LW1A 1X65A 2N49A 2IL8A 3GO5A 1EQVA 2J7ZA 3CU7A 4KJOA 1LYLA 4A3KB 1JWMD 1JOKA 1NBWA 2GVAA 5AJ3Q 1GJXA 1JE4A 2E5LL 2E2JB 1X3QA 3HG9A 4DFAA 1D1KA 5ELBA 1WD1A 5IP7H 5LMNQ 1E3PA 1X3PA 3T1YL 4OWTB 3SEBA 4H13C 1U4MA 1YJ9A 1K83H 2EXDA 2QDBA 3SE0A 2SNMA 2HCCA 2L15A 3HOVB 3J81L 2KCCA 4ME5A 4HJ8A 3NQTA 3H15A 2PPBC 3WOEA 1VQCA 2D0OA 3KJOA 2G9HD 2EY5A 2DGYA 2RDGA 4HSVA 1YNND 2IHFA 2RHQB 1VQJA 5CR3A 3P20A 4DV3L 1GUTA 5JEAG 5EJWA 4DKAC 5M3MH 1EQTA 4QGUA 2M9VA 4O42A 1O7LA 3OHXC 5LHY1 2BH2A 1NMGA 3E6ZX 2K75A 4OIJA 3ULPA 1G91A 3E9IA 4QMGA 1ZEQX 4B3TL 2C5CA 3U4ZA 3TS0A 2D5DA 2AQ3B 1HNZL 4ZLTF 2ID0A 4BS9A 4C2MH 4L5RC 1VQPA 4CDEC 1EWHA 4IO9A 4FDBA 3JAML 3PUXA 3J80c 2NN6I 2IW3A 2RDHA 4PV1C 5ELCA 3JC66 2IX0A 5J1ZA 2R92G 4QL5A 1SNPA 2L5TA 2JA8B 1J5EQ 3HOUH 1J6QA 1VMPA 5CGKA 4C3JG 3K7AH 3U9OA 4NW2A 5AJ3L 2FHTA 2FMCA 1VCIA 3PO3G 3HRZC 5IYCH 2DNEA 2F0WA 1STGA 3GTQH 4XQQA 4QJFA 1VS0A 5KGUA 2JA6H 1Y8NB 2B63G 1HZCA 4P73A 2Q8IB 4IN3A 1LT4D 1IBLL 1FGBD 2ZXPA 3OYYA 3B6YA 4ID6A 2R7FA 4LWCA 3VR3A 2MFIA 4KN4C 3PMFA 3MXNB 4C1NI 3CKIB 2FINB 2RDFA 4YCWA 1PV4A 4HN7A 3M9BA 5J3BA 4X66Q 2N3SA 1S72A 1AEXA 2N8NA 1LV9A 1HA5A 2PQAB 4HIKA 3OIPA 1X3FA 1B3QA 2ENBA 5IYBG 1E2ZA 1N34Q 1SFOB 3QR8A 3RZDH 4POGA 3NTKA 1HXYD 4JI5L 4HJ5A 1YI2A 4DUYQ 3ZYYX 1HCZA 1LM0A 1PH1A 1G51A 3WOFA 1QVFA 3AMUA 3D8GA 3S15B 2ZXOA 3L9AX 4K5XA 1DGSA 2NVTH 4YIJA 1HNXQ 4K8IA 1V9PA 2K5NA 3CAMA 5C3WA 1QOHA 3BZCA 3NELA 1HR0W 1CZWA 2F3VA 4CDCC 2F0OA 1QB5D 4XTCS 5C44H 1TWGH 2HIVA 4ABNA 1K9MC 1X55A 3NQIA 3I56A 1SLJA 3E0JA 3HOZB 4IFDG 4MTNA 3CCJA 1KTKA 3EBEA 1SEBD 1E22A 1J5EL 1NAPA 3CC4A 5C4XG 2EZVA 2EYLA 3HOYH 3FP9A 2B3GA 4L63B 1GD7A 4LUZA 2RQXA 1LTGD 1TS4A 3FVQA 4YCVA 4R4OA 3GTMB 2JA9A 1A15A 2VUMH 1E1TA 3C1EA 4ULLA 5IY0A 2I5MX 1NSNS 1NUCA 2NWGA 4PZ7A 4NPSA 4HJAA 3T1HQ 1AP0A 3J7YW 3PUVA 4UAIA 1PTOH 4IPHA 3GD7A 4MN3A 1CI3M 1XPOA 1SE2A 5IGDA 2IPKD 4BXXH 4BWGB 1SE8A 4A3FB 3VA7A 2D0PA 1WJJA 2H1EA 1MJEA 2I46A 1F2LA 2I5HA 3NBHA 4GLVB 4JK1C 5CV8A 4X66L 2SNSA 1F2YA 1S3OA 1EQQA 2QDLA 3RUZA 3UE1A 2A5HA 1YITA 1QG7A 1VQNA 1GUGA 3TQYA 1G6PA 2JN4A 3PO2B 1VF7A 1QUQA 4P72A 4R9WA 4PMCA 2JA5G 2CH4A 2NB0A 5ELOA 4IFDJ 4ALPA 1PDQA 1GUNA 3K59A 1PXUA 2XTIA 3LGJA 2B2VA 4WRDA 1RODA 5KRUA 3H94A 1TWAH 1HNXL 1BVSA 4G57A 3CXCA 1FJGQ 4A3JB 2EY6A 1RDPD 2VW9A 4L5QA 4A3MB 5FLXE 2K5QA 4OO1H 4TKOB 3S1NH 4F7XA 4DXFA 3KFUA 2ZTDA 2Q2HA 1ML0D 3S14B 2R7ZB 1VQDA 2KCMA 2QA4A 3KLSX 4CJ1B 4MTKA 1L0XB 1EZ8A 1Y1VB 1WTQA 4FF3A 1NJIC 1YJNA 3CCLA 4B3SL 1UEBA 4ZKCB 4NXMQ 1K0RA 3RN2A 3KDFB 3IL8A 1E24A 2ZTCA 1TQOA 5I2YA 2EYJA 5I6WA 3J81c 2V1CC 2QILA 3URYA 1EYCA 1NR4A 2Z9HA 4R4QA 3N52A 4YWMA 1UE7A 3SVMA 5I9OA 4HIOA 3MXGA 5CV5A 4A3KH 1B4OA 1Q1BA 1Q81C 4UY8C 3ND8A 3KF8B 3QG1A 4LJZC 2ZJQA 1JB7A 3N6RA 3U9SA 5GAHC 1IW7D 1V8QA 1RF2D 2E2JH 2OF1A 2AUJD 5EKIA 1TT2A 1PH3A 2PW5A 2NVQB 3E3XA 1BCPD 2P5ZX 1CFMA 3K5LA 1G6ZA 2GA4B 2RVLA 2F0EA 2FXQA 1TY0A 4JI8Q 4OL7A 1VQKA 4KI0A 3HOVH 3I90A 2E8GA 3KOJA 1VQMA 1KLUD 3DUZA 4C3HG 4ZAIA 1ENAA 2HD3A 1X56A 2E74C 4GOPA 3TMEA 3TP6A 4K8JA 5CC4A 1B9NA 1HQMC 4IPCA 1STHA 5DNFA 3GV3A 2ICIA 2KHSA 4OHJA 1FJGL 1RD9D 1EFID 4DR6Q 2EYHA 5KYIA 2JA7G 4LF5Q 1SNCA 1XXGA 4DAYA 5L37A 4YHHQ 3QOJA 1K28A 4C2MB 2JSOA 1IL2A 4ODGA 3MA2B 2IWHA 1Y8PB 5M3MG 3PIPA 4X3KA 1YHAA 4KHPL 1EY6A 3GV6A 4OO1I 4LF6Q 1RL2A 1FD7D 3CQZB 3Q8DA 5T1IA 3GTLB 2F52A 2YU9B 5IIFA 4OX9Q 3R3OA 4NXML 4BBRB 5EGTA 5CV9A 2Q8RE 1CZGA 4F88A 3TSSA 4DK3C 1WTOA 5ELDA 2F0GA 2FMMA 2MO1A 3KLRA 4JOIA 4J8QA 4A93G 1SYFA 1S5ED 2AWNA 3RLFA 1U4RA 3PCOB 2JA8H 2F0UA 3D4DA 3J7AF 3NWSA 1MI2A 4P74A 3P1HA 4M8AA 2F0JA 4L5TA 1IBMQ 2L0CA 4LF7Q 1F77A 2XIWA 5EKLA 3F2CA 1PTOD 1PA6A 4R8IA 3HOUG 4DU9A 2RHSB 3ND9A 1B2TA 2CH4W 1PYBA 2BOSA 3VR2A 1SMXA 4A3BG 1BCPF 1E7ZA 1S5FD 4EGVA 1WTXA 4JI8L 5IYCG 2F4VQ 2NTSA 4KD4A 4V0BA 5G3LD 5LL6S 2R61A 2PCFB 3ZJYC 3NBIA 2XN9C 3K0XA 4L5SA 4G7OC 4Y52H 1JJ2A 2JJQA 3K81C 2F0MA 1PH9A 1SR3A 1SE3A 2I0QA 5GAGC 3H3VI 3OIQA 4DR6L 2F3IA 1MHWC 4N9TA 2EJMA 1GOZA 3IFTA 3PIO3 4LF5L 1O7ZA 2UXBQ 3VYSA 4DV6L 2Y0SG 1O78A 3M4QA 1IBKQ 2K32A 4YHHL 5HY6A 4DNIA 2TSSA 1XX8A 3QIAA 4IPDA 2YTVA 3S15H 4IQZA 2F0QA 1EOTA 2F0VA 3I91A 4LF6L 3GDEA 4X65Q 4IUQA 3DMUA 4OX9L 1UAPA 3H3VC 1SJED 3T16A 3IAYA 2N78A 1XTCD 1Y1WG 3K58A 4XXEA 3OTOL 4P2CB 3EN2A 3HOZH 2UU9Q 1IKLA 1PRTD 3VR5A 3UDXA 4F87A 3BVZA 3BDLA 1PYWD 3LWEA 2ASBA 5LL6X 2F0NA 1W6JA 5C4ZA 4H44C 1U5KA 1SYDA 2MNAA 4ZCKA 1IBML 4KK7A 4RMFA 4LF7L 5JJZA 1Q7YC 2Q2UA 3GTMH 1PTOF 1TWFB 3CPFA 3I3CA 4AQYL 1L1OB 2ATWA 2NZ1D 2OQ0A 3HOYG 1SNOA 1TWHB 1LO5D 3SXHA 5IOCA 4LF9Q 2Z0SA 1EU4A 2R7DA 1FNVA 4IUNA 4X64Q 3ER0A 1IZ6A 1K3BC 1WCMH 1UE6A 3AQQA 3KF8A 4A3FH 1S40A 2F4VL 3PSIA 3NUCA 1BBWA 5G3LF 1QNKA 3P7JA 4KJNA 1HQRD 2EYFA 1LTBD 2L55A 2LY7A 4BXXG 3H91A 1HUNA 1N8RC 1EYAA 3EROA 2A6HC 2LXKA 4BBSG 1ZYRC 1TXYA 1SN8A 3SDZA 3PO2H 4QCLA 5JPMC 2YYZA 3BYTB 4IZ8A 1HPCA 3TZDA 1IBKL 1KHIA 4DAVA 4GN4B 5KEEA 4APVA 5M5WB 4AYBB 1CKOA 2L12A 5CBEE 3I4MB 1EU3A 2EJGC 5DM63 4X65L 1A3UA 5C5MA 4A3JH 3I73A 1HNZQ 4ZKBB 4X3UA 3TZUA 1QCBD 1PZID 4HR7B 2NN6H 2VNUD 2VQEL 4LMQD 4A3MH 4QY7A 1ESFA 3V2TA 1B53A 1SMYD 3OSOA 1D5MC 3S14H 2UU9L 2EYPA 3DM1A 1PRTF 1C4QA 2R7ZH 2B2TC 2K6AA 4P75A 1JWUD 4PMBA 5IP9G 2B8GA 2KOLA 1HJPA 4F8MA 1A62A 5E1FA 1KDBA 1Y1VH 3A8IE 5FOBB 4A3EH 3A0JA 3QOLA 1J8IA 1OXSC 3D31A 4N9PA 4G4KA 4ZUIA 3PV0A 1OXXK 4L6TB 5FJ8H 1T5EA 4OONA 3R93A 1Q86C 1UEAB 3E9HA 4RH6A 3W2DA 1PH4A 3NBHB 1VQ4A 1EYGA 5EPJA 1RTOA 3Q22A 2V4DA 3L0OA 3C2PA 3STBC 1DZ1A 2CVRA 4JI3L 3G6EA 4LF9L 1IBLQ 5DAUA 2F4IA 2K1BA 4A3DG 4X64L 4JOIC
chains in the Genus database with same CATH topology
5D3DA 4XYOA 1MD2D 1RHPA 1TS3A 3D4RA 3D6WA 1TIID 5I9PA 5IT9L 2D62A 1ESRA 1SNDA 3L7ZC 3X3MA 1H9RA 1RCVD 2TMPA 3K0YA 3TDQA 4RKBA 1WD0A 1UUPA 1M8AA 3MWYW 3M7NA 5HURA 1Y8OB 4RGMA 2B2UA 2BE5C 2PNRC 1I4QA 3S1MB 2OT2A 3GTJB 4V190 2R92B 2R6GA 4C3IG 3LWUA 1LLRD 4TSSA 3ONAB 4QB4A 4FP5D 5A2QL 1I4RA 3HZXA 3FDTA 5C0XG 4NKLA 1B3AA 1CHQD 3PO3B 4EQNA 4Q0FA 4ZQ3A 3F2UA 4LAAA 1TY2A 4OGQC 3A8KE 3MTSA 2B63B 2KUMA 1HRJA 4FF4A 3TN2A 1HFNA 2AUKA 5C5LA 1BOSA 5C6AA 1SJHD 1AZQA 3NPPA 3DWQA 2K03A 1U4LA 3ITPA 3OWFA 3DEPA 1JC7A 3Q23A 4WFN3 1V43A 1G291 5M3FB 1W6KA 2XWJB 4S3SA 3G6JB 3J80E 4ILWA 1FNUA 2L9HA 1LTRD 4HMJA 3BVMA 1F9PA 5JVH3 3M4OB 3FPUB 2A6ED 1SSOA 2X6GA 5C0XJ 3FMCA 5JVG3 1PMRA 1AN8A 1SYEA 2EXZA 4KMUC 1R4PB 3QWNA 1R4QB 5C4HA 2O5JC 4X3TA 4U673 1Q8IA 5C4XB 4ZUJA 5KYLA 1Z7TA 1H9KA 2WAQB 4RFBA 1EY4A 2A74C 1LTID 2OXPA 3NSWA 4M1UB 3D4WA 5COYA 4CKEA 3BDCA 1CK1A 2F0DA 1PFNA 5CORA 4FVMA 2JE6I 4Y7NB 3D3RA 4CBVA 5J39A 5FO7B 5NUCA 1WCMB 2BDNA 3MAQA 3DWPA 1JR0D 1RJTA 2HQEA 2DY7A 1RKNA 2X69A 4NMZA 1LT5D 4A3GB 3DWAA 3M3YB 1VDZA 1DOMA 2Z1CA 4ZRZA 2A73B 5CBAE 3FKIB 2K33A 1HTPA 4C56C 3VR4A 1XWEA 2A69D 4O1NA 1LACA 3NHHA 1PZKD 5I6YA 3QB3A 2F3WA 2CW0D 5ISRA 1E2WA 1GHJA 1S5CD 4DGZA 4FNFA 2JEAI 3IKJA 4A3EB 2F0HA 2B2UC 3NXWA 1EY9A 3QJYA 3AB9A 5E4WC 3TP5A 3SK6A 3E5SA 4IUUA 3V05A 1EIGA 4RGNA 2NN6G 1STBA 5C3XA 2F0LA 1F9QA 1K8MA 3MC0B 4EQPA 2L11A 1EIHA 2MGSA 4C3HB 1DXMA 5KNCA 3BG3A 3DEOA 4MHEA 1SAPA 2NBFA 4KY6A 1ZXTA 5FKAC 5JEAH 1Z6HA 4NDXA 2PMZB 3J81E 2JA7B 3A56A 2A68C 2XRQD 4HSPA 2EJFC 4I7ZC 3QO2A 3EA6A 2DY8A 1U9RA 3SR1A 3R2TA 3M85A 1STYA 1IYUA 1ICWA 3KUPA 3NP8A 4PNYA 3NWTA 3LNNA 1F9SA 1QE6A 1ZKOA 1NR2A 1V1PA 4K5VA 4A93B 3LX0A 5KNBA 3HP3A 5AFWA 1JORA 3KK7A 2QKIC 5M9OA 4TRDA 5IGBA 2E76C 1TS5A 1PFBA 1GXDC 2BA1A 5IGCA 1D1IA 5FO9B 2IT1A 4A3BB 1Z47A 3T4AC 2WACA 4CJ0B 4UDUC 3VYRA 2H4OA 3HOWB 4X3SA 4IUVA 1OO9B 1KLGD 1I4PA 4A3IB 2NTTA 2F0TA 4RGTA 5BN4A 3PIP3 1O80A 3A8JE 2PQEA 1JQYD 4IURA 4HTHA 2Y0SB 1DOLA 1CT1D 5IGGA 1G2TA 1S5BD 2Z4IA 3K5OA 2Z8LA 4I65A 4KHVA 1FYCA 1DJRD 1Q12A 3PUYA 2E2IB 3K6OA 1D6EC 3MZ5A 5DEHA 3FEWX 2K01A 3D6CA 1Y1WB 4K2LA 1ENCA 4KKTA 5ELEA 3I4NB 2ZT9C 2AQ2B 2B2VC 5CYUA 1ET9A 1SDFA 5A35A 1BF4A 1PZJD 2VB3X 4J6HA 5T1GA 1DM0B 3SK5A 1G2SA 1S5DD 3T56B 2DNCA 4RGOS 1V1OA 1KDAA 3S17B 3S2HB 2EPBA 4XQNA 2MP1A 1HTLD 1I4XA 1TWCB 1ILPA 1B1ZA 1SE4A 1DOKA 3H0GB 1H9SA 4PQXA 3Q0AA 1G8ZD 2VXWA 4ZK9B 2JYOA 1JB3A 2EY2A 4BBSB 1X32A 1HHVA 1YNJC 3RD4A 1ET6A 1I6HB 4DNTB 4RA8A 4XQJA 3KBGA 1TS2A 4HMIA 2IX3A 1QNUA 1J9OA 1EY8A 3K57A 2PW7A 3WDNA 3I8ZA 3NTIA 3PUWA 1C48A 4XDXA 1I50B 1BR9A 2FJ2A 2PYKA 3T51B 5EKKA 3TBIB 4E6IA 4DXGA 1JWSD 5K5PA 2R93B 1VF5C 5FLXL 1F2ZA 3UI2A 1TU2B 2HDMA 1QILA 4L8JA 5CV4A 4IFDI 3TP8A 5K36H 2F0KA 1QWYA 1CQVA 4NP5A 1YNNC 2EOTA 4G7ZC 4CKCA 3MHBA 1KNEA 4OO1G 1PRTB 1OXTA 2PZWA 3KBXA 1Q3LA 2EYMA 4A3DB 1BBXC 4IUTA 1STNA 2C9OA 1DCZA 3BYYB 2K7VA 3I72A 1E0BA 2A6HD 1AW7A 4FF2A 2BA0A 1ZYRD 2SDFA 4K6LA 1LT6D 1DYQA 1E2VA 3BS1A 3OWEB 4CGYB 1GUWA 3S16B 4WJWA 4PMWA 4DF7A 4FXGC 2L1BA 2WP8J 2KEEA 2XVSA 4DN4M 5IODA 1QJOA 1CM9A 3Q6SA 1MGSA 2WINB 2LS01 1GHKA 2NVXB 3W3AA 2CHBD 3BDOA 3VR6A 4C3IB 1MSGA 1TKWB 1CHPD 2MUYA 2F1MA 3RZOB 2SOBA 5M5YB 5D3IB 2D9UA 1A6XA 1KABA 4RKLA 4FF1A 4C3JB 4WORA 3MVVA 1JOOA 5I4DA 5EBDA 1WTPA 2A6EC 2VB2X 5C4JB 4BY1B 5E4XA 4Z9CB 2QEJC 5D14A 2RSOA 2E75C 4BY7B 1H9MA 1LTSD 3GTKB 3PUZA 4R8NA 1STEA 2FFKB 2XSCA 4RCNA 2O2LD 3HOXB 3HEJA 2RBMA 3H09A 2J0TD 1BXTA 1F2MA 3BZDB 1Q1EA 1SXTA 3J7AV 3RMHA 2I07B 2F0PA 3R2IA 5JEAJ 2G9DA 2N88A 2BE5D 3H6MA 2X6LA 1A3TA 3G7LA 1LABA 4BA1I 2Q8TA 1AZPA 1UNSA 3GTGB 3DXJC 3C1FA 5JAVA 1CQFA 1LTTD 3CHBD 2K04A 4JBWA 3S1RB 1R9TB 3NTHA 1BQQT 5KIXA 2M2LA 2E2HB 1V1PB 4RWSC 4B08A 4HAEA 4HCSA 2R3ZA 5EQ0A 1BNZA 2IX1A 1A3VA 2JEBI 2B2WA 1D5ZC 2JP1A 4K2KA 1EL0A 3S9WA 2NUCA 2NVYB 3HGBA 2HCIA 3GTOB 3MFYA 3CRLC 5CV6A 2A69C 4HCEA 5C3EB 4KN7C 2QCPX 2E2DC 4XT3B 1EY5A 2F03A 4DK1A 4KHZA 4XIGS 1WTWA 3DHQA 4FXDA 2B2YA 1A2TA 2CW0C 4KKSA 1A2UA 2B8FA 3A54A 3CRKC 5FK9C 3GTPB 1SYCA 5M5XB 1ONLA 1Q90A 2JA5B 3SK8A 1I6VC 1JICA 2AWOA 1PLFA 5BN5A 3V96A 5JPNC 2KECA 2RA4A 1CA5A 3R8BA 1WTRA 1I4HA 5BN3A 1BUVT 1IL8A 1FR3A 2CQAA 4B9XA 2WKDA 2ZXRA 2IJ0A 1OXUA 1HA6A 1EZ6A 3GQBA 4RHRA 4Q5VA 2L4NA 1IW7C 2K28A 1TR5A 2ICEC 5CV7A 1SNQA 1BDOA 3OPOA 3S2DB 1M4VA 2MJ8A 2KCNA 3EVQA 1MBYA 1BCPC 2DN8A 2OEOA 4XT1B 1ILQA 5J22A 3OMCA 3Q24A 1CA6A 1HFGA 3NE5B 2JXMB 1OXVA 3X3NA 2WIIB 2M00A 1EY7A 1I3QB 3IFDA 1TVXA 1H9SB 2MPMA 3M4YA 5K36G 1IYVA 1U4PA 2Z4HA 3NK9A 4J1MA 1GUSA 2PZTA 1S4ZA 1K83B 4KY7A 4TQUS 5D65A 1JOQA 2PO4A 4CHTB 1SBBB 2BDOA 1GUOA 3K5MA 1B9MA 5IT9E 3MEHA 4ZYSA 5KNDA 5M3MB 3OMGA 5CMDA 3MXNA 2EDGA 1PTOC 2D2CC 4KD3A 4FO2A 1SYBA 4U68A 1EYDA 5JOBA 3EJIA 3GP7A 2KEDA 5FO8B 4IALA 2WB1B 5C0XH 2LFNA 1IKMA 2B2TA 3ERQA 1T5XD 1NCVA 2HDLA 5IGFA 2RKSA 4RCOA 3T53B 4EVOA 5A2QE 3JAME 3HOUB 1EEID 3K5NA 2F0SA 2EYOA 4KV6A 1IHZA 2B2WC 3VA5A 4BA2I 5EBCA 2K05A 3K7AB 1EEFD 1BO0A 3GTQB 3TP7A 3HKZB 2MHVA 2JA6B 3MXUA 2A68D 3SHLA 1B50A 4QUCA 2EVBA 4K5WA 1BCPB 4IUPA 1VMCA 1LT3D 3J80L 1DD2A 1PRTC 4CJ2C 1B44D 2B2YC 2NYZD 2K5DA 4QIWB 1KAAA 4B9WA 3I4LA 1K8OA 4EQOA 1JCKB 3P75A 4GZYC 4CKBA 4DA2A 3RZDB 1EWCA 3A7LA 1D2BA 2PZUA 3BVGA 4KY5A 4RAUC 2AQ1B 3MXPA 2QF7A 3FRPB 1KNAA 3C3LA 2BCOA 2NVTB 3OW7A 2B39A 4QF4A 5EPKA 4IFDH 3OOCA 4KKUA 5E3FA 4LK1C 1I4GA 1SNMA 5EPLA 4OIKA 1TWGB 5C44B 3I70A 3T13A 1F9RA 5C0XI 4DNRB 4FXKC 3C46A 2XWBB 3FPPA 1STAA 2RSNA 1PFMA 3KLSA 1SYGA 4H7BA 2WV6D 3HOYB 3L3OC 1C8CA 2EE1A 2HUGA 5HGTA 1WVLA 1AFPA 4MIUA 4HEDA 2VUMB 3SK4A 2SEBD 1CTMA 4K6DA 1Y69U 1PTOB 3A55A 5ELFA 1ENFA 2K5WA 2N55A 2F0FA 1HUMA 3EFXD 2LMCB 5TSSA 1SMYC 1KDCA 2O4XA 3O13A 2KA7A 1D5XC 1H9JA 4C1NK 1MSHA 4H0LC 1XYIA 3MFGA 2KQ3A 1DONA 4QUFA 1O7YA 1RTNA 4FYDA 2EY1A 3EQLC 1EY0A 4XYQA 3VYUA 4KTAA 1LTAD 3M7GA 1WTVA 5I2XA 1TWAB 2F0IA 4G7HC 2KJXA 4K14A 1L0YB 3S1QB 3S1NB 5F2DA 5DM73 3AU7A 5IGEA 2O5IC 2J4XA 4RHSA 3A7AB 2LKVA 3HS0C 4DK0A 2KVMA 2XNAC 2XRSD 1YNJD 2WKCA 3VYTA 4DAPA 1FNWA 1II3A 2IL8A 3GO5A 1EQVA 2J7ZA 3CU7A 4KJOA 4A3KB 1JWMD 1JOKA 1GJXA 1JE4A 2E2JB 1X3QA 3HG9A 4DFAA 1D1KA 5ELBA 1WD1A 1X3PA 3SEBA 4H13C 1U4MA 2QDBA 3SE0A 2SNMA 2HCCA 3HOVB 3J81L 2KCCA 4ME5A 3NQTA 2PPBC 3WOEA 2G9HD 2EY5A 2RDGA 4HSVA 1YNND 5CR3A 3P20A 1GUTA 5JEAG 5EJWA 1EQTA 2M9VA 4O42A 1O7LA 3OHXC 5LHY1 3E6ZX 4OIJA 1G91A 4QMGA 1ZEQX 2C5CA 2D5DA 2AQ3B 4ZLTF 2ID0A 4BS9A 1EWHA 3JAML 3PUXA 2NN6I 2IW3A 2RDHA 4PV1C 5ELCA 2IX0A 5J1ZA 1SNPA 2L5TA 2JA8B 1VMPA 5CGKA 4C3JG 3U9OA 4NW2A 2FHTA 2FMCA 1VCIA 3HRZC 2DNEA 2F0WA 1STGA 4XQQA 5KGUA 1Y8NB 2Q8IB 4IN3A 1LT4D 1FGBD 2ZXPA 4ID6A 3VR3A 4KN4C 3PMFA 4C1NI 3CKIB 2FINB 2RDFA 4HN7A 1AEXA 1LV9A 1HA5A 3OIPA 2ENBA 1SFOB 1E2ZA 3NTKA 1HXYD 3ZYYX 1HCZA 3WOFA 3AMUA 3D8GA 3S15B 2ZXOA 3L9AX 4K5XA 4YIJA 4K8IA 5C3WA 1QOHA 1CZWA 2F3VA 2F0OA 1QB5D 4XTCS 4ABNA 3NQIA 3E0JA 3HOZB 4IFDG 1KTKA 1SEBD 1NAPA 2EZVA 2EYLA 4L63B 2RQXA 1LTGD 1TS4A 3FVQA 3GTMB 1A15A 3C1EA 4ULLA 1NSNS 1NUCA 2NWGA 1AP0A 3J7YW 3PUVA 4UAIA 1PTOH 3GD7A 4MN3A 1CI3M 1SE2A 5IGDA 2IPKD 4BWGB 4A3FB 3VA7A 2H1EA 2I46A 1F2LA 3NBHA 4JK1C 5CV8A 2SNSA 1F2YA 3RUZA 2A5HA 1QG7A 1GUGA 3PO2B 1VF7A 4R9WA 4PMCA 2NB0A 4IFDJ 1PDQA 1GUNA 3K59A 1PXUA 2B2VA 4WRDA 1RODA 5KRUA 3H94A 4G57A 4A3JB 2EY6A 1RDPD 4A3MB 5FLXE 2K5QA 4OO1H 4TKOB 4F7XA 4DXFA 1ML0D 3S14B 2R7ZB 3KLSX 4CJ1B 1L0XB 1EZ8A 1Y1VB 1WTQA 4FF3A 4ZKCB 3IL8A 1TQOA 5I2YA 2EYJA 5I6WA 2QILA 3URYA 1EYCA 1NR4A 3N52A 3SVMA 5I9OA 3MXGA 5CV5A 1B4OA 1Q1BA 3ND8A 3QG1A 4LJZC 3N6RA 3U9SA 1IW7D 1V8QA 1RF2D 2OF1A 2AUJD 5EKIA 1TT2A 2PW5A 2NVQB 1BCPD 1CFMA 3K5LA 1G6ZA 2GA4B 2RVLA 2F0EA 1TY0A 4OL7A 4KI0A 3I90A 1KLUD 3DUZA 4C3HG 4ZAIA 1ENAA 2E74C 3TMEA 3TP6A 4K8JA 5CC4A 1B9NA 1HQMC 1STHA 5DNFA 3GV3A 2ICIA 2KHSA 4OHJA 1RD9D 1EFID 2EYHA 5KYIA 1SNCA 1XXGA 4DAYA 3QOJA 4C2MB 2JSOA 4ODGA 3MA2B 2IWHA 1Y8PB 4X3KA 1EY6A 3GV6A 4OO1I 3CQZB 1FD7D 5T1IA 3GTLB 2YU9B 5IIFA 3R3OA 4BBRB 5EGTA 5CV9A 2Q8RE 1CZGA 4F88A 3TSSA 1WTOA 5ELDA 2F0GA 2FMMA 3KLRA 4J8QA 1SYFA 1S5ED 2AWNA 3RLFA 1U4RA 2F0UA 3D4DA 3J7AF 3NWSA 1MI2A 3P1HA 4M8AA 2F0JA 2L0CA 1F77A 2XIWA 5EKLA 1PTOD 4R8IA 4DU9A 3ND9A 1B2TA 2BOSA 3VR2A 1BCPF 1S5FD 4EGVA 1WTXA 2NTSA 4KD4A 4V0BA 5G3LD 5LL6S 2R61A 2PCFB 3NBIA 2XN9C 4G7OC 2F0MA 1SE3A 3OIQA 4N9TA 2EJMA 1GOZA 3IFTA 3PIO3 1O7ZA 3VYSA 1O78A 2K32A 2TSSA 1XX8A 3QIAA 4IQZA 2F0QA 1EOTA 2F0VA 3I91A 4IUQA 3DMUA 1UAPA 3H3VC 1SJED 3T16A 3IAYA 1XTCD 3K58A 4XXEA 4P2CB 1IKLA 1PRTD 3VR5A 4F87A 3BVZA 3BDLA 1PYWD 3LWEA 5LL6X 2F0NA 1W6JA 5C4ZA 4H44C 1SYDA 4KK7A 5JJZA 1PTOF 1TWFB 3I3CA 2NZ1D 1SNOA 1TWHB 1LO5D 3SXHA 5IOCA 1EU4A 4IUNA 1FNVA 3KF8A 3NUCA 5G3LF 1QNKA 3P7JA 4KJNA 1HQRD 2EYFA 1LTBD 2L55A 2LY7A 3H91A 1HUNA 1EYAA 3EROA 2A6HC 1ZYRC 3SDZA 4QCLA 5JPMC 2YYZA 3BYTB 4IZ8A 1HPCA 3TZDA 4DAVA 5KEEA 5M5WB 4AYBB 2L12A 5CBEE 3I4MB 1EU3A 2EJGC 5DM63 5C5MA 1A3UA 3I73A 4ZKBB 4X3UA 3TZUA 1QCBD 1PZID 4HR7B 2NN6H 2VNUD 4LMQD 1ESFA 3V2TA 1B53A 1SMYD 3OSOA 1D5MC 2EYPA 3DM1A 1PRTF 1C4QA 2B2TC 2K6AA 1JWUD 4PMBA 2B8GA 2KOLA 4F8MA 5E1FA 1KDBA 3A8IE 5FOBB 3QOLA 1J8IA 1OXSC 3D31A 4N9PA 4G4KA 4ZUIA 3PV0A 1OXXK 4L6TB 1T5EA 3R93A 1UEAB 4RH6A 3W2DA 5EPJA 1RTOA 3Q22A 2V4DA 1DZ1A 3C2PA 2CVRA 5DAUA 2F4IA 2K1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNE A;  2L9H A;  5JJZ A;  5D65 A;  1WTV A;  1WTQ A;  2B2V C;  4OIJ A;  1U4R A;  4ZKC B;  1RHP A;  1SDF A;  1ICW A;  2FFK B;  3KBX A;  3KUP A;  3D6W A;  3I3C A;  1BF4 A;  1F9P A;  1G91 A;  1MI2 A;  2NZ1 D;  3FPU B;  3IL8 A;  5T1G A;  1Q3L A;  1G2S A;  1SSO A;  2RSO A;  4RAU C;  2X6G A;  1ESR A;  1F9S A;  1QE6 A;  1JIC A;  1BBX C;  4IUT A;  1NR2 A;  1PLF A;  4ZLT F;  1KNA A;  3HP3 A;  2XIW A;  1NAP A;  1NR4 A;  2KEC A;  2RA4 A;  1CA5 A;  5AFW A;  3N52 A;  5CMD A;  4R8I A;  1QNK A;  1E0B A;  2EPB A;  3SVM A;  1WTR A;  3P7J A;  1WD0 A;  5EPK A;  1B2T A;  1IL8 A;  1B4O A;  2N88 A;  2SDF A;  1M8A A;  3H91 A;  3MWY W;  1HUN A;  5EPL A;  2MP1 A;  4X3T A;  1A15 A;  2B2U A;  2B2U C;  2X6L A;  4OIK A;  4U68 A;  3G7L A;  1WTX A;  1HA6 A;  1F9R A;  2Q8T A;  1PFB A;  1AZP A;  2KED A;  2NWG A;  1ILP A;  1AP0 A;  4CJ1 B;  4UAI A;  1DOK A;  5EKI A;  5E4W C;  2KVM A;  4MN3 A;  1VMP A;  2L4N A;  2K28 A;  3TZD A;  1GUW A;  1IKM A;  4IUU A;  4NW2 A;  2B2T A;  2FHT A;  4CJ0 B;  2RSN A;  1G6Z A;  2K04 A;  1EIG A;  1PFM A;  2RVL A;  2VXW A;  2JYO A;  4ZK9 B;  2L1B A;  5COY A;  2KEE A;  1X32 A;  2MJ8 A;  2H1E A;  1HHV A;  2M2L A;  4X3S A;  4DN4 M;  3I90 A;  1NCV A;  1F2L A;  2EE1 A;  2HUG A;  2IL8 A;  3ONA B;  4IUV A;  1C8C A;  2HDL A;  2J7Z A;  2L12 A;  5CBE E;  1WVL A;  4ZAI A;  1CM9 A;  3FDT A;  3Q6S A;  1MGS A;  4RA8 A;  4RWS C;  4XT1 B;  4HAE A;  1ILQ A;  1PFN A;  1B3A A;  4HCS A;  1O7Z A;  4ZKB B;  1QG7 A;  4HED A;  4X3U A;  5COR A;  1F9Q A;  1JE4 A;  1CA6 A;  1J9O A;  1XX8 A;  2R3Z A;  1HFG A;  1X3Q A;  4LMQ D;  3F2U A;  2FIN B;  5EQ0 A;  1MSG A;  1BNZ A;  1WD1 A;  5DNF A;  3GV3 A;  2L11 A;  1B53 A;  1EOT A;  2B2W A;  2MGS A;  2B2W C;  2N55 A;  2KUM A;  1O80 A;  3I8Z A;  3MTS A;  4R9W A;  2JP1 A;  3I91 A;  1EL0 A;  1HUM A;  1HRJ A;  1X3P A;  2K05 A;  3DM1 A;  4IUR A;  3TN2 A;  2BDN A;  2B2T C;  3DEO A;  4MHE A;  1HFN A;  1SAP A;  1DOL A;  1U4M A;  4IUQ A;  4XDX A;  1PDQ A;  1LV9 A;  2KOL A;  1AZQ A;  1BO0 A;  1G2T A;  3IFD A;  2HCI A;  1RJT A;  1TVX A;  2D9U A;  2DY7 A;  1ZXT A;  2B2V A;  2FJ2 A;  2K03 A;  1ROD A;  1U4L A;  2HCC A;  2MPM A;  2X69 A;  1B50 A;  1J8I A;  4QUC A;  3DEP A;  4X3K A;  1MSH A;  1XYI A;  3GV6 A;  3R93 A;  1DON A;  5T1I A;  1IKL A;  1DOM A;  4QUF A;  3UI2 A;  1U4P A;  4HSV A;  1EIH A;  1O7Y A;  2HDM A;  5EPJ A;  5CBA E;  4IUP A;  1RTO A;  3QO2 A;  1RTN A;  3LWE A;  1VMC A;  2DY8 A;  4XT3 B;  5EJW A;  1WTP A;  1DZ1 A;  2K01 A;  2Q8R E;  1WTW A;  1EQT A;  2CVR A;  4CJ2 C;  2B2Y A;  1ML0 D;  2B2Y C;  2NYZ D;  2EOT A;  5E4X A;  1WTO A;  4O42 A;  5D14 A;  2K1B A;  2FMM A;  1S4Z A; 
#chains in the Genus database with same CATH topology
 2ALY B;  5D3D A;  1QUQ B;  3OW2 A;  4XYO A;  1MD2 D;  1RHP A;  1WFQ A;  2MQH A;  1TS3 A;  4IJL A;  3D4R A;  1K73 C;  3D6W A;  1N32 L;  1TII D;  5I9P A;  1AE2 A;  5IT9 L;  1A0I A;  2D62 A;  2Z6K A;  4A3K G;  4HJ7 A;  1ESR A;  1SND A;  1PVO A;  3DLL A;  3L7Z C;  2NVQ H;  3X3M A;  1H9R A;  1RCV D;  4OWX B;  2VS1 A;  2TMP A;  3K0Y A;  4UHV A;  4RKB A;  3TDQ A;  1WD0 A;  4JI5 Q;  3A74 A;  1UUP A;  1M8A A;  3MWY W;  3RN5 A;  3M7N A;  5HUR A;  1Y8O B;  4RGM A;  4A4I A;  2B2U A;  5IYD H;  1YNX A;  2BE5 C;  2PNR C;  1M1K C;  1I4Q A;  3S1M B;  2OT2 A;  4JPB W;  3GTJ B;  4I7A A;  2ZJR A;  3K8A A;  4V19 0;  2R92 B;  2R6G A;  4C3I G;  3LWU A;  1LLR D;  4TSS A;  3ONA B;  4QB4 A;  4GNX B;  4FP5 D;  5A2Q L;  1I4R A;  1C9O A;  2K5V A;  3FDT A;  3HZX A;  4NKL A;  5IWA L;  2CFM A;  5C0X G;  1B3A A;  1CHQ D;  1D7Q A;  1VQL A;  2K52 A;  3CQZ H;  3PO3 B;  3GTL H;  2YU9 H;  4EQN A;  4Q0F A;  4ZQ3 A;  3F2U A;  4LAA A;  4BBR H;  3TS2 A;  1L2F A;  1TY2 A;  4DV4 Q;  4OGQ C;  3A8K E;  3MTS A;  2B63 B;  1O7I A;  2KUM A;  1CKM A;  1HRJ A;  4DR1 Q;  1IXR A;  4FF4 A;  3TN2 A;  1HFN A;  2AUK A;  5C5L A;  1BOS A;  5C6A A;  1SJH D;  3PGZ A;  1AZQ A;  2KCT A;  3NPP A;  3DWQ A;  2K03 A;  1U4L A;  1UE1 A;  3ITP A;  3OWF A;  4BY1 G;  3DEP A;  1JC7 A;  3Q23 A;  1X9N A;  4WFN 3;  1V43 A;  1MIU A;  4PZ6 A;  1G29 1;  5M3F B;  1Q82 C;  4BY7 G;  1W6K A;  2XWJ B;  3CCU A;  4DR3 Q;  3U4V A;  3TRZ A;  4GOP B;  3K7U C;  1YVC A;  2JA8 G;  4AYB E;  3HOX G;  4S3S A;  1BKB A;  3G6J B;  3J80 E;  1PH6 A;  4ILW A;  1L1O A;  2LXJ A;  1FNU A;  1YBY A;  2L9H A;  1LTR D;  4DR7 L;  4HMJ A;  4A3I H;  5BR8 L;  3BVM A;  1F9P A;  2WFW A;  5JVH 3;  1HR0 Q;  3M4O B;  3FPU B;  2A6E D;  4DAY B;  1SSO A;  4AIM A;  2DUD A;  2X6G A;  5C0X J;  3FMC A;  3CME A;  5JVG 3;  1PMR A;  5HGQ A;  4JI0 L;  1AN8 A;  1SYE A;  2EXZ A;  1KAW A;  4KMU C;  4KLK A;  1R4P B;  1SRU A;  3QWN A;  1R4Q B;  1VQH A;  5C4H A;  2O5J C;  4JBJ A;  4X3T A;  4U67 3;  2E2I H;  1Q8I A;  3CCQ A;  5C4X B;  4ZUJ A;  5KYL A;  1QVC A;  1Z7T A;  1KIX A;  1H9K A;  2WAQ B;  4QQB X;  1NY4 A;  4RFB A;  4A3L G;  2I5L X;  3KF6 A;  1EY4 A;  2A74 C;  3NSW A;  1LTI D;  2OXP A;  1WYD A;  4M1U B;  2UUB L;  4B3S Q;  3D4W A;  5COY A;  4CKE A;  4DV4 L;  3BDC A;  1CK1 A;  1YEZ A;  2QW7 A;  4LF8 Q;  4DR1 L;  2F0D A;  1PFN A;  5COR A;  4FVM A;  2VQF L;  2JE6 I;  4Y7N B;  3D3R A;  4CBV A;  5J39 A;  3D0F A;  5FO7 B;  3CCM A;  5NUC A;  5FLM G;  1WCM B;  2BDN A;  3MAQ A;  3HOZ G;  3DWP A;  1NTG A;  3F1Z A;  5C3E G;  1JR0 D;  4DR3 L;  1RJT A;  1KRS A;  1XTD A;  2HQE A;  2DY7 A;  1CSQ A;  1RKN A;  4A3C H;  1CKN A;  1UE5 A;  2X69 A;  4NMZ A;  1ASY A;  1LT5 D;  1TWF H;  4A3G B;  3DWA A;  5JJI A;  3M3Y B;  1TWH H;  3H0G H;  1VDZ A;  1DOM A;  1W3S A;  2Z1C A;  4ZRZ A;  2A73 B;  5CBA E;  3FKI B;  2K33 A;  3WWV A;  1HR0 L;  4DUZ Q;  1EOV A;  1HTP A;  4C56 C;  2UXD Q;  3VR4 A;  1XWE A;  1XJV A;  2A69 D;  4O1N A;  1LAC A;  3SGI A;  3PF5 A;  1VQI A;  3NHH A;  4YWL A;  4A3F G;  3U58 A;  1PZK D;  4JW0 A;  5I6Y A;  2ES2 A;  3PQI A;  1X54 A;  3QB3 A;  2DJG C;  2F3W A;  2CW0 D;  4R1J A;  5ISR A;  1E2W A;  1GHJ A;  3W1G A;  1S5C D;  4DGZ A;  5M5W H;  4FNF A;  4YWK A;  3AFQ A;  3CCV A;  2JEA I;  3I4M H;  4KHP Q;  3IKJ A;  4A3E B;  2F0H A;  5DLQ E;  2B2U C;  3DM3 A;  1ASZ A;  3NXW A;  1EY9 A;  3QJY A;  2CQO A;  3AB9 A;  4IPG A;  3BZK A;  5E4W C;  4LF8 L;  3TP5 A;  3SK6 A;  4GNX A;  3E5S A;  4OEL B;  4A3J G;  4LNQ A;  1B8A A;  4IUU A;  1NNX A;  3V05 A;  3CD6 A;  1EIG A;  4JYA L;  3HFZ B;  5IT9 c;  4RGN A;  3I4O A;  4IJH A;  2NN6 G;  5LMU Q;  1KXL A;  1STB A;  5C3X A;  1T9H A;  2F0L A;  4DR5 Q;  1F9Q A;  2RCN A;  1K8G A;  2PNH A;  1K8M A;  1Y1V G;  3MC0 B;  4DR4 L;  4EQP A;  2L11 A;  3G48 A;  2MGS A;  5IE8 A;  1EIH A;  4C3H B;  1DXM A;  2UUA Q;  5KNC A;  3BG3 A;  3DEO A;  5FJ8 G;  4DV1 Q;  4MHE A;  1SAP A;  2NBF A;  4PZ8 A;  4KY6 A;  1ZXT A;  5FKA C;  5JEA H;  1Z6H A;  4DUZ L;  5IP7 G;  2UXD L;  4NDX A;  2PMZ B;  2WAQ E;  2PI2 A;  4NXN Q;  3J81 E;  2JA7 B;  3A56 A;  4LFC Q;  3H3V H;  1I94 Q;  2UXC Q;  2A68 C;  2XRQ D;  4HSP A;  2EJF C;  4I7Z C;  2IY5 B;  3JAM c;  3QO2 A;  3EA6 A;  4X6A H;  2DY8 A;  3AFP A;  1VQ9 A;  1U9R A;  1PYS B;  4LFA L;  4HIM A;  1L1O C;  1CSP A;  3SR1 A;  4DV6 Q;  3R2T A;  3M85 A;  1XPU A;  1STY A;  1IYU A;  1ICW A;  3KUP A;  3NP8 A;  4PNY A;  1ICF B;  3NWT A;  4IOA A;  4LF4 L;  3ULL A;  3LNN A;  1F9S A;  1QE6 A;  3S1M H;  1ZKO A;  1NR2 A;  1V1P A;  4K5V A;  4A93 B;  3LX0 A;  3GTJ H;  5KNB A;  3HP3 A;  1PFS A;  2R92 H;  5IYD G;  5AFW A;  1C7Y A;  1U0L A;  1M90 C;  2AHO B;  3BU2 A;  1JOR A;  3KK7 A;  2WB1 G;  3OTO Q;  3EIV A;  5EAY A;  1QVG A;  2QKI C;  3U50 C;  1FVI A;  5M9O A;  4TRD A;  5IGB A;  2E76 C;  3PO3 H;  5LMU L;  1TS5 A;  1PFB A;  1GXD C;  2BA1 A;  5IGC A;  1D1I A;  2B63 H;  5FO9 B;  2IT1 A;  4A3B B;  1Z47 A;  3T4A C;  4DR5 L;  2WAC A;  3I55 A;  2JK8 A;  4CJ0 B;  1Z9F A;  4UDU C;  3VYR A;  2LSS A;  2H4O A;  3HOW B;  1KRT A;  4X3S A;  4IUV A;  4AQY Q;  4LUV A;  4BBR G;  2UUA L;  2KEN A;  1OO9 B;  1KLG D;  1A8V A;  1I4P A;  4WJ4 A;  4DV1 L;  3UDF A;  1V1Q A;  4A3I B;  5M3F H;  2NTT A;  4GKJ Q;  3HKZ G;  5JJL A;  2F0T A;  4RGT A;  4UP8 A;  2JA6 G;  4JVZ A;  5BN4 A;  3PIP 3;  5IYB H;  4NXN L;  1HNW Q;  2HIX A;  3I2Z A;  1O80 A;  3A8J E;  2PQE A;  4LFC L;  1JQY D;  4IUR A;  1I94 L;  2UXC L;  4HTH A;  2Y0S B;  1DOL A;  1CT1 D;  5IGG A;  1G2T A;  1S5B D;  2Z4I A;  3K5O A;  2Z8L A;  4I65 A;  4KHV A;  1FYC A;  2EQS A;  1DJR D;  1Q12 A;  1XPR A;  3M4O H;  1XNQ L;  2RCF A;  3PUY A;  2E2I B;  3K6O A;  1D6E C;  3MZ5 A;  5DEH A;  3CW2 C;  3FEW X;  2K01 A;  3D6C A;  1R9T H;  1Y1W B;  4WJ3 M;  4K2L A;  1ENC A;  4JCV E;  4KKT A;  5ELE A;  4DAM A;  3I4N B;  3A5Z B;  2ZT9 C;  2AQ2 B;  4K0K Q;  2B2V C;  4DK6 C;  3ICE A;  3CC7 A;  2VQE Q;  5CYU A;  1ET9 A;  1SDF A;  5A35 A;  5C4X H;  1BF4 A;  1PZJ D;  2VB3 X;  2HHH L;  4J6H A;  5T1G A;  1DM0 B;  4J15 A;  1G2S A;  3SK5 A;  1S5D D;  3T56 B;  3G71 A;  2DNC A;  2KBN A;  4JI2 Q;  4RGO S;  5C44 G;  1V1O A;  1KDA A;  3J7Z C;  3S17 B;  3S2H B;  3VDY A;  2EPB A;  4HJ9 A;  2PMZ E;  4O2D A;  1JMC A;  1H95 A;  3K80 C;  1GVP A;  1KL9 A;  4XQN A;  2MP1 A;  1HTL D;  1I4X A;  4Y7N H;  1TWC B;  1ILP A;  1NE3 A;  1B1Z A;  4JI3 Q;  1K3R A;  1SE4 A;  1DOK A;  3H0G B;  1H9S A;  4GNX C;  1K0S A;  4PQX A;  3Q0A A;  2VUM G;  1G8Z D;  2VXW A;  4ZK9 B;  4GKJ L;  2JYO A;  1JB3 A;  2EY2 A;  1VQA A;  4BBS B;  1X32 A;  1HHV A;  4YCU A;  1YNJ C;  3BJU A;  3RD4 A;  1ET6 A;  1N32 Q;  2IHE A;  1HNW L;  1I6H B;  4JI1 Q;  4DNT B;  4RA8 A;  4A3G H;  4XQJ A;  1PH7 A;  3KBG A;  1TS2 A;  3M3Y H;  4HMI A;  2IX3 A;  1QZG A;  1QNU A;  1J9O A;  1EY8 A;  3HKS A;  3K57 A;  3FKI H;  2PW7 A;  3WDN A;  3I8Z A;  3NTI A;  3PUW A;  1C48 A;  1C0A A;  4XDX A;  5H1S E;  1I50 B;  1BR9 A;  2FJ2 A;  1N36 Q;  2PYK A;  3T51 B;  5EKK A;  3KF6 B;  3TBI B;  4E6I A;  4DXG A;  1JWS D;  5K5P A;  4B3M L;  2R93 B;  2Q2T A;  4GOP C;  1X6O A;  1PH8 A;  1VF5 C;  2ZM6 L;  1WOC A;  4MNO A;  5FLX L;  1F2Z A;  4K0K L;  3UI2 A;  1TU2 B;  2HDM A;  1QIL A;  4L8J A;  1YHQ A;  5CV4 A;  4IFD I;  2GVB A;  4JI7 Q;  3TP8 A;  5K36 H;  2F0K A;  1QWY A;  1CQV A;  4NP5 A;  1YNN C;  2EOT A;  1YHB A;  2VZA A;  5IWA Q;  1I5F A;  4G7Z C;  4CKC A;  2DJF C;  4JI2 L;  3MHB A;  1KNE A;  4OXP A;  3F2B A;  4OO1 G;  1PRT B;  3UDG A;  1OXT A;  2PZW A;  3KBX A;  3RLO A;  4GN5 A;  1JJG A;  4JBM A;  1Q3L A;  2EYM A;  3CPW A;  3I4M G;  1AE3 A;  4A3D B;  1CKN B;  1BBX C;  2Y0S E;  4IUT A;  1MKH A;  1N33 L;  4DV7 Q;  1STN A;  2C9O A;  1DCZ A;  3BYY B;  2K7V A;  3I72 A;  4OEM B;  4JBK A;  2CWP A;  1E0B A;  2A6H D;  1MJC A;  1AW7 A;  4FF2 A;  2BA0 A;  1ZYR D;  2SDF A;  4K6L A;  1YJW A;  1LT6 D;  3RLN A;  3KLW A;  2CWA A;  3S24 A;  3PF4 A;  1DYQ A;  1E2V A;  1VQF A;  3BS1 A;  4POF A;  4JI1 L;  1JT8 A;  4C3H H;  4R4I A;  3OWE B;  4CGY B;  4GLX A;  1GUW A;  3S16 B;  4WJW A;  5ELN A;  4PMW A;  4DF7 A;  4DR7 Q;  4FXG C;  2L1B A;  2WP8 J;  2K4K A;  2KEE A;  5BR8 Q;  2XVS A;  1D8L A;  4DN4 M;  5IOD A;  1QJO A;  1CM9 A;  3Q6S A;  1MGS A;  2WIN B;  2LS0 1;  1GHK A;  5LMN W;  2JA7 H;  1LTL A;  2NVX B;  3W3A A;  4JI0 Q;  1XMO Q;  2CHB D;  3BDO A;  3VR6 A;  4C3I B;  1N36 L;  3HOV G;  1MSG A;  4O0A A;  4UPA A;  4GKK Q;  2JQO A;  1TKW B;  3CP0 A;  4JI4 Q;  1CHP D;  2MUY A;  1Q46 A;  2EIF A;  2F1M A;  1VQO A;  1OTC A;  3W5O A;  3RZO B;  2SOB A;  5M5Y B;  5D3I B;  2D9U A;  4JI7 L;  1A6X A;  1RIP A;  1KAB A;  4RKL A;  4FF1 A;  4C3J B;  3CCS A;  5E7N A;  3STB D;  2Q2I A;  4WOR A;  3MVV A;  4DV0 Q;  2UUB Q;  1JOO A;  5I4D A;  4IOC A;  5EBD A;  4JI6 Q;  4A93 H;  1WTP A;  4OWW B;  2A6E C;  2VB2 X;  4EQ5 A;  5C4J B;  4BY1 B;  5E4X A;  2BH8 A;  1JE5 A;  2UUC L;  4Z9C B;  2QEJ C;  5D14 A;  2RSO A;  2E75 C;  4BY7 B;  2A19 A;  1H9M A;  1LTS D;  3FHW A;  2VQF Q;  1PHJ A;  3GTK B;  3PUZ A;  4DV7 L;  4R8N A;  1STE A;  2H5X A;  2FFK B;  4HID A;  2XSC A;  4RCN A;  2O2L D;  3HOX B;  3HEJ A;  2A1A A;  2RBM A;  3H09 A;  2J0T D;  5GAD C;  4A3B H;  1BXT A;  1JJC B;  1F2M A;  3BZD B;  1Q1E A;  1SRO A;  1SXT A;  4DV2 Q;  4MZ9 A;  3J7A V;  2YTX A;  1E1O A;  2I07 B;  3RMH A;  3HOW H;  2F0P A;  1PH2 A;  3R2I A;  5JEA J;  4ME3 A;  3AEV A;  5LMN L;  2G9D A;  2N88 A;  1X3G A;  2BE5 D;  3H6M A;  2X6L A;  1A3T A;  3G7L A;  1LAB A;  4BA1 I;  2Q8T A;  1AZP A;  1UNS A;  3A5U A;  3GTG B;  2CCZ A;  3DXJ C;  3C1F A;  5JAV A;  1CQF A;  1LTT D;  3CHB D;  1XMO L;  2K04 A;  5M3F G;  4JBW A;  3S1R B;  1R9T B;  3NTH A;  1BQQ T;  4GKK L;  5KIX A;  2M2L A;  4P71 A;  4JI4 L;  2GN5 A;  1VQ8 A;  2E2H B;  1V1P B;  4RWS C;  4B08 A;  4HAE A;  4HCS A;  4N8F A;  1VQG A;  4X62 Q;  2R3Z A;  1XNR Q;  5EQ0 A;  4JV5 Q;  1BNZ A;  2IX1 A;  1A3V A;  2JEB I;  2B2W A;  1Y1W H;  1D5Z C;  2JP1 A;  4K2K A;  1EL0 A;  3S9W A;  3I4N H;  1VQ6 A;  2NUC A;  2NVY B;  5GQO A;  4DV0 L;  4JI6 L;  3HGB A;  2HCI A;  2K5H A;  3GTO B;  4PG3 A;  2K14 A;  3MFY A;  4CDD C;  3CRL C;  5CV6 A;  3CCR A;  3RR5 A;  2A69 C;  1HZB A;  3CMA A;  4HCE A;  5C3E B;  4JYA Q;  4KN7 C;  2QCP X;  2E2D C;  4XT3 B;  1EY5 A;  2F03 A;  4DK1 A;  4KHZ A;  4XIG S;  4A75 A;  1WTW A;  3DHQ A;  4FXD A;  2YTY A;  2ZTE A;  3S17 H;  2B2Y A;  4AH6 A;  3KJP A;  1GM5 A;  1A2T A;  3S2H H;  2CW0 C;  2WAQ G;  3W1B A;  4KKS A;  1A2U A;  2B8F A;  3CCE A;  3A54 A;  3CRK C;  5FK9 C;  4DV2 L;  1SYC A;  3GTP B;  5M5X B;  3IRB A;  1TWC H;  4DR4 Q;  1ONL A;  1Q90 A;  3J80 i;  2OTJ A;  2JA5 B;  3SK8 A;  1EQR A;  4R4C A;  1I6V C;  1JIC A;  2AWO A;  1PLF A;  5BN5 A;  3V96 A;  2A8V A;  5JPN C;  2KEC A;  1B7Y B;  4BBS H;  2RA4 A;  5FLX c;  3R8B A;  1CA5 A;  1WTR A;  1I4H A;  1BUV T;  5BN3 A;  2QGQ A;  1IL8 A;  1I6H H;  1FR3 A;  2CQA A;  4B9X A;  2WKD A;  2ZXR A;  3MEF A;  1WCM G;  4N8X 1;  2IJ0 A;  1OXU A;  1HA6 A;  1HZ9 A;  2Z6B A;  1EZ6 A;  1N34 L;  3GQB A;  4RHR A;  4Q5V A;  4LFA Q;  2Z6K C;  2L4N A;  1IW7 C;  2K28 A;  4A3G G;  1FGU A;  1TR5 A;  2ICE C;  4DUY L;  5CV7 A;  1SNQ A;  1BDO A;  3OPO A;  4X62 L;  3S2D B;  1XNR L;  1I50 H;  1M4V A;  4JV5 L;  2MJ8 A;  2KCN A;  2K50 A;  3EVQ A;  1MBY A;  1WI5 A;  3KYH C;  1KD1 C;  3PO2 G;  3FKI G;  1BCP C;  3F8T A;  5GRO A;  2DN8 A;  2R93 H;  2OEO A;  3J81 j;  4LF4 Q;  4XT1 B;  4B3R Q;  1ILQ A;  5J22 A;  3OMC A;  3Q24 A;  5IP9 H;  1CA6 A;  1HFG A;  2PI2 E;  3NE5 B;  2JXM B;  1OXV A;  3X3N A;  3S1Q H;  2WII B;  5GAE C;  2M00 A;  1EY7 A;  1CUK A;  1I3Q B;  3IFD A;  1TVX A;  4A3M G;  1H9S B;  2MPM A;  3M4Y A;  5K36 G;  2R7Z G;  1IYV A;  4UP9 A;  4A3D H;  1U4P A;  4A3E G;  4DV5 Q;  2Z4H A;  3NK9 A;  2XGT A;  1HH2 P;  3T1H L;  4J1M A;  2YV5 A;  1GUS A;  2PZT A;  1S4Z A;  1K83 B;  1P16 A;  1BBU A;  4JC0 A;  2KHI A;  4KY7 A;  4TQU S;  5D65 A;  1JOQ A;  1YZ6 A;  2PO4 A;  1PH5 A;  1IYJ B;  4CHT B;  1SBB B;  2BDO A;  1XMQ Q;  1GUO A;  4NB3 A;  3K5M A;  3S16 H;  1B9M A;  5IT9 E;  3MEH A;  4ZYS A;  5KND A;  2AKW B;  5M3M B;  3OMG A;  2G5D A;  5CMD A;  3MXN A;  1A63 A;  1XNQ Q;  2EDG A;  1WTH A;  1PTO C;  3RNU A;  1KC8 C;  2D2C C;  4KD3 A;  4FO2 A;  1L0W A;  1SYB A;  4U68 A;  1EYD A;  2NVX H;  1W2B A;  5JOB A;  3ULJ A;  4C3I H;  3EJI A;  3GP7 A;  2KED A;  2C35 B;  5FO8 B;  2PQA A;  4IAL A;  4B3R L;  2WB1 B;  5C0X H;  2LFN A;  1IKM A;  3J7A 5;  2B2T A;  3ERQ A;  1P8L A;  1T5X D;  4UP7 A;  5M5Y H;  3RZO H;  1EUJ A;  1NCV A;  2HHH Q;  4LFB Q;  2HDL A;  3ERS X;  5IGF A;  4C3J H;  2RKS A;  4RCO A;  3T53 B;  3UE0 A;  4EVO A;  5A2Q E;  3JAM E;  3HOU B;  1EEI D;  3K5N A;  2F0S A;  2EYO A;  4KV6 A;  1IHZ A;  5C4J H;  4BY1 H;  2B2W C;  3TEH B;  4DR2 Q;  3VA5 A;  4BA2 I;  5EBC A;  2CKZ B;  2K05 A;  3K7A B;  1EEF D;  3PIO A;  4LUO A;  4BY7 H;  1BO0 A;  4DV5 L;  3GTQ B;  3GTK H;  3TP7 A;  3HKZ B;  2MHV A;  2JA6 B;  1N9W A;  2RF4 A;  3MXU A;  2A68 D;  3SHL A;  1B50 A;  4QUC A;  2EVB A;  3HOX H;  4RG1 A;  4K5W A;  3G4S A;  1VQB A;  2OQK A;  1BCP B;  4IUP A;  1VMC A;  1LT3 D;  3J80 L;  1DD2 A;  1Y14 B;  1PRT C;  4CJ2 C;  3J81 i;  1B44 D;  2B2Y C;  2NYZ D;  2OCE A;  2K5D A;  4QIW B;  1XMQ L;  1KAA A;  4B9W A;  3I4L A;  2NZH A;  3NEN A;  1K8O A;  4GLA C;  1JCK B;  4EQO A;  3P75 A;  3TRE A;  3UDI A;  4YY3 Q;  4GZY C;  4CKB A;  4R4T A;  4DA2 A;  3RZD B;  1K8A C;  1EWC A;  3HOW G;  3A7L A;  1D2B A;  2PZU A;  3GTG H;  3BVG A;  3M4P A;  2HT1 A;  4KY5 A;  4RAU C;  2AQ1 B;  4H02 A;  3MXP A;  2QF7 A;  3FRP B;  1KNA A;  4A3I G;  3C3L A;  2VY3 A;  3S1R H;  2BCO A;  2NVT B;  3OW7 A;  2MO0 A;  2AMC B;  1AH9 A;  4B3M Q;  2B39 A;  1VQE A;  4QF4 A;  5EPK A;  4IFD H;  3OOC A;  4KKU A;  2ZM6 Q;  1SFO H;  5E3F A;  2E2H H;  4LK1 C;  1I4G A;  4A3L H;  1SNM A;  5EPL A;  4OIK A;  1TWG B;  5C44 B;  3F2D A;  3I70 A;  3T13 A;  1F9R A;  5C0X I;  4DNR B;  4LFB L;  4FXK C;  3C46 A;  2XWB B;  1Q8K A;  1GKH A;  3FPP A;  2NVY H;  1STA A;  3JAM i;  2RSN A;  1PFM A;  3KLS A;  1SYG A;  3NEM A;  3CF5 A;  4H7B A;  3GTO H;  2WV6 D;  3HOY B;  3L3O C;  1C8C A;  2EE1 A;  1X3E A;  2HUG A;  2KHJ A;  5HGT A;  5FLM H;  4DR2 L;  1WVL A;  1AFP A;  3I4N G;  1KQS A;  4DPG A;  4MIU A;  4HED A;  2VUM B;  3SK4 A;  3E0E A;  5C3E H;  2SEB D;  1N33 Q;  1CTM A;  1FL0 A;  4K6D A;  1Y69 U;  1PTO B;  3A55 A;  5ELF A;  1ENF A;  2K5W A;  2N55 A;  1EFW A;  2B29 A;  5JJK A;  2F0F A;  1HUM A;  1NMF A;  3EFX D;  1EWI A;  2LMC B;  3KDF A;  5TSS A;  1SMY C;  1KDC A;  1UWV A;  2E5L Q;  2O4X A;  3O13 A;  3GTP H;  2KA7 A;  5M5X H;  1EIF A;  1D5X C;  4GS3 A;  1H9J A;  2JA5 H;  4C1N K;  2WB1 E;  1MSH A;  4H0L C;  1XYI A;  3MFG A;  2KQ3 A;  1DON A;  3T1Y Q;  4QUF A;  1O7Y A;  4YY3 L;  4A3C G;  1RTN A;  4FYD A;  2EY1 A;  3AYH B;  3EQL C;  1EIY B;  3H0G G;  1LUZ A;  1EY0 A;  4XYQ A;  3VYU A;  4KTA A;  1YIJ A;  1LTA D;  3M7G A;  1WTV A;  3CC2 A;  3I7F A;  5I2X A;  1QZH A;  4DV3 Q;  1TWA B;  2F0I A;  4G7H C;  2KJX A;  2OTL A;  2QEX A;  4TVA B;  2UXB L;  2NZO A;  4K14 A;  3L2P A;  3S2D H;  1L0Y B;  3S1Q B;  2VL6 A;  3HKZ E;  3S1N B;  4GN3 B;  1HZA A;  5F2D A;  5DM7 3;  3AU7 A;  5IGE A;  4EX5 A;  4A76 A;  2O5I C;  2J4X A;  1VQ5 A;  4RHS A;  4B3T Q;  2ZJP A;  3A7A B;  2LKV A;  3HS0 C;  2HQL A;  4DK0 A;  4CDF C;  4AYB G;  1GO3 E;  1B70 B;  2KVM A;  1VQ7 A;  2UUC Q;  2XNA C;  4JG2 A;  2R93 G;  2XRS D;  4QIW E;  1YNJ D;  2WKC A;  3VYT A;  4DAP A;  2OWO A;  1I3Q H;  1FNW A;  1II3 A;  4LW1 A;  1X65 A;  2N49 A;  2IL8 A;  3GO5 A;  1EQV A;  2J7Z A;  3CU7 A;  4KJO A;  1LYL A;  4A3K B;  1JWM D;  1JOK A;  1NBW A;  2GVA A;  5AJ3 Q;  1GJX A;  1JE4 A;  2E5L L;  2E2J B;  1X3Q A;  3HG9 A;  4DFA A;  1D1K A;  5ELB A;  1WD1 A;  5IP7 H;  5LMN Q;  1E3P A;  1X3P A;  3T1Y L;  4OWT B;  3SEB A;  4H13 C;  1U4M A;  1YJ9 A;  1K83 H;  2EXD A;  2QDB A;  3SE0 A;  2SNM A;  2HCC A;  2L15 A;  3HOV B;  3J81 L;  2KCC A;  4ME5 A;  4HJ8 A;  3NQT A;  3H15 A;  2PPB C;  3WOE A;  1VQC A;  2D0O A;  3KJO A;  2G9H D;  2EY5 A;  2DGY A;  2RDG A;  4HSV A;  1YNN D;  2IHF A;  2RHQ B;  1VQJ A;  5CR3 A;  3P20 A;  4DV3 L;  1GUT A;  5JEA G;  5EJW A;  4DKA C;  5M3M H;  1EQT A;  4QGU A;  2M9V A;  4O42 A;  1O7L A;  3OHX C;  5LHY 1;  2BH2 A;  1NMG A;  3E6Z X;  2K75 A;  4OIJ A;  3ULP A;  1G91 A;  3E9I A;  4QMG A;  1ZEQ X;  4B3T L;  2C5C A;  3U4Z A;  3TS0 A;  2D5D A;  2AQ3 B;  1HNZ L;  4ZLT F;  2ID0 A;  4BS9 A;  4C2M H;  4L5R C;  1VQP A;  4CDE C;  1EWH A;  4IO9 A;  4FDB A;  3JAM L;  3PUX A;  3J80 c;  2NN6 I;  2IW3 A;  2RDH A;  4PV1 C;  5ELC A;  3JC6 6;  2IX0 A;  5J1Z A;  2R92 G;  4QL5 A;  1SNP A;  2L5T A;  2JA8 B;  1J5E Q;  3HOU H;  1J6Q A;  1VMP A;  5CGK A;  4C3J G;  3K7A H;  3U9O A;  4NW2 A;  5AJ3 L;  2FHT A;  2FMC A;  1VCI A;  3PO3 G;  3HRZ C;  5IYC H;  2DNE A;  2F0W A;  1STG A;  3GTQ H;  4XQQ A;  4QJF A;  1VS0 A;  5KGU A;  2JA6 H;  1Y8N B;  2B63 G;  1HZC A;  4P73 A;  2Q8I B;  4IN3 A;  1LT4 D;  1IBL L;  1FGB D;  2ZXP A;  3OYY A;  3B6Y A;  4ID6 A;  2R7F A;  4LWC A;  3VR3 A;  2MFI A;  4KN4 C;  3PMF A;  3MXN B;  4C1N I;  3CKI B;  2FIN B;  2RDF A;  4YCW A;  1PV4 A;  4HN7 A;  3M9B A;  5J3B A;  4X66 Q;  2N3S A;  1S72 A;  1AEX A;  2N8N A;  1LV9 A;  1HA5 A;  2PQA B;  4HIK A;  3OIP A;  1X3F A;  1B3Q A;  2ENB A;  5IYB G;  1E2Z A;  1N34 Q;  1SFO B;  3QR8 A;  3RZD H;  4POG A;  3NTK A;  1HXY D;  4JI5 L;  4HJ5 A;  1YI2 A;  4DUY Q;  3ZYY X;  1HCZ A;  1LM0 A;  1PH1 A;  1G51 A;  3WOF A;  1QVF A;  3AMU A;  3D8G A;  3S15 B;  2ZXO A;  3L9A X;  4K5X A;  1DGS A;  2NVT H;  4YIJ A;  1HNX Q;  4K8I A;  1V9P A;  2K5N A;  3CAM A;  5C3W A;  1QOH A;  3BZC A;  3NEL A;  1HR0 W;  1CZW A;  2F3V A;  4CDC C;  2F0O A;  1QB5 D;  4XTC S;  5C44 H;  1TWG H;  2HIV A;  4ABN A;  1K9M C;  1X55 A;  3NQI A;  3I56 A;  1SLJ A;  3E0J A;  3HOZ B;  4IFD G;  4MTN A;  3CCJ A;  1KTK A;  3EBE A;  1SEB D;  1E22 A;  1J5E L;  1NAP A;  3CC4 A;  5C4X G;  2EZV A;  2EYL A;  3HOY H;  3FP9 A;  2B3G A;  4L63 B;  1GD7 A;  4LUZ A;  2RQX A;  1LTG D;  1TS4 A;  3FVQ A;  4YCV A;  4R4O A;  3GTM B;  2JA9 A;  1A15 A;  2VUM H;  1E1T A;  3C1E A;  4ULL A;  5IY0 A;  2I5M X;  1NSN S;  1NUC A;  2NWG A;  4PZ7 A;  4NPS A;  4HJA A;  3T1H Q;  1AP0 A;  3J7Y W;  3PUV A;  4UAI A;  1PTO H;  4IPH A;  3GD7 A;  4MN3 A;  1CI3 M;  1XPO A;  1SE2 A;  5IGD A;  2IPK D;  4BXX H;  4BWG B;  1SE8 A;  4A3F B;  3VA7 A;  2D0P A;  1WJJ A;  2H1E A;  1MJE A;  2I46 A;  1F2L A;  2I5H A;  3NBH A;  4GLV B;  4JK1 C;  5CV8 A;  4X66 L;  2SNS A;  1F2Y A;  1S3O A;  1EQQ A;  2QDL A;  3RUZ A;  3UE1 A;  2A5H A;  1YIT A;  1QG7 A;  1VQN A;  1GUG A;  3TQY A;  1G6P A;  2JN4 A;  3PO2 B;  1VF7 A;  1QUQ A;  4P72 A;  4R9W A;  4PMC A;  2JA5 G;  2CH4 A;  2NB0 A;  5ELO A;  4IFD J;  4ALP A;  1PDQ A;  1GUN A;  3K59 A;  1PXU A;  2XTI A;  3LGJ A;  2B2V A;  4WRD A;  1ROD A;  5KRU A;  3H94 A;  1TWA H;  1HNX L;  1BVS A;  4G57 A;  3CXC A;  1FJG Q;  4A3J B;  2EY6 A;  1RDP D;  2VW9 A;  4L5Q A;  4A3M B;  5FLX E;  2K5Q A;  4OO1 H;  4TKO B;  3S1N H;  4F7X A;  4DXF A;  3KFU A;  2ZTD A;  2Q2H A;  1ML0 D;  3S14 B;  2R7Z B;  1VQD A;  2KCM A;  2QA4 A;  3KLS X;  4CJ1 B;  4MTK A;  1L0X B;  1EZ8 A;  1Y1V B;  1WTQ A;  4FF3 A;  1NJI C;  1YJN A;  3CCL A;  4B3S L;  1UEB A;  4ZKC B;  4NXM Q;  1K0R A;  3RN2 A;  3KDF B;  3IL8 A;  1E24 A;  2ZTC A;  1TQO A;  5I2Y A;  2EYJ A;  5I6W A;  3J81 c;  2V1C C;  2QIL A;  3URY A;  1EYC A;  1NR4 A;  2Z9H A;  4R4Q A;  3N52 A;  4YWM A;  1UE7 A;  3SVM A;  5I9O A;  4HIO A;  3MXG A;  5CV5 A;  4A3K H;  1B4O A;  1Q1B A;  1Q81 C;  4UY8 C;  3ND8 A;  3KF8 B;  3QG1 A;  4LJZ C;  2ZJQ A;  1JB7 A;  3N6R A;  3U9S A;  5GAH C;  1IW7 D;  1V8Q A;  1RF2 D;  2E2J H;  2OF1 A;  2AUJ D;  5EKI A;  1TT2 A;  1PH3 A;  2PW5 A;  2NVQ B;  3E3X A;  1BCP D;  2P5Z X;  1CFM A;  3K5L A;  1G6Z A;  2GA4 B;  2RVL A;  2F0E A;  2FXQ A;  1TY0 A;  4JI8 Q;  4OL7 A;  1VQK A;  4KI0 A;  3HOV H;  3I90 A;  2E8G A;  3KOJ A;  1VQM A;  1KLU D;  3DUZ A;  4C3H G;  4ZAI A;  1ENA A;  2HD3 A;  1X56 A;  2E74 C;  4GOP A;  3TME A;  3TP6 A;  4K8J A;  5CC4 A;  1B9N A;  1HQM C;  4IPC A;  1STH A;  5DNF A;  3GV3 A;  2ICI A;  2KHS A;  4OHJ A;  1FJG L;  1RD9 D;  1EFI D;  4DR6 Q;  2EYH A;  5KYI A;  2JA7 G;  4LF5 Q;  1SNC A;  1XXG A;  4DAY A;  5L37 A;  4YHH Q;  3QOJ A;  1K28 A;  4C2M B;  2JSO A;  1IL2 A;  4ODG A;  3MA2 B;  2IWH A;  1Y8P B;  5M3M G;  3PIP A;  4X3K A;  1YHA A;  4KHP L;  1EY6 A;  3GV6 A;  4OO1 I;  4LF6 Q;  1RL2 A;  1FD7 D;  3CQZ B;  3Q8D A;  5T1I A;  3GTL B;  2F52 A;  2YU9 B;  5IIF A;  4OX9 Q;  3R3O A;  4NXM L;  4BBR B;  5EGT A;  5CV9 A;  2Q8R E;  1CZG A;  4F88 A;  3TSS A;  4DK3 C;  1WTO A;  5ELD A;  2F0G A;  2FMM A;  2MO1 A;  3KLR A;  4JOI A;  4J8Q A;  4A93 G;  1SYF A;  1S5E D;  2AWN A;  3RLF A;  1U4R A;  3PCO B;  2JA8 H;  2F0U A;  3D4D A;  3J7A F;  3NWS A;  1MI2 A;  4P74 A;  3P1H A;  4M8A A;  2F0J A;  4L5T A;  1IBM Q;  2L0C A;  4LF7 Q;  1F77 A;  2XIW A;  5EKL A;  3F2C A;  1PTO D;  1PA6 A;  4R8I A;  3HOU G;  4DU9 A;  2RHS B;  3ND9 A;  1B2T A;  2CH4 W;  1PYB A;  2BOS A;  3VR2 A;  1SMX A;  4A3B G;  1BCP F;  1E7Z A;  1S5F D;  4EGV A;  1WTX A;  4JI8 L;  5IYC G;  2F4V Q;  2NTS A;  4KD4 A;  4V0B A;  5G3L D;  5LL6 S;  2R61 A;  2PCF B;  3ZJY C;  3NBI A;  2XN9 C;  3K0X A;  4L5S A;  4G7O C;  4Y52 H;  1JJ2 A;  2JJQ A;  3K81 C;  2F0M A;  1PH9 A;  1SR3 A;  1SE3 A;  2I0Q A;  5GAG C;  3H3V I;  3OIQ A;  4DR6 L;  2F3I A;  1MHW C;  4N9T A;  2EJM A;  1GOZ A;  3IFT A;  3PIO 3;  4LF5 L;  1O7Z A;  2UXB Q;  3VYS A;  4DV6 L;  2Y0S G;  1O78 A;  3M4Q A;  1IBK Q;  2K32 A;  4YHH L;  5HY6 A;  4DNI A;  2TSS A;  1XX8 A;  3QIA A;  4IPD A;  2YTV A;  3S15 H;  4IQZ A;  2F0Q A;  1EOT A;  2F0V A;  3I91 A;  4LF6 L;  3GDE A;  4X65 Q;  4IUQ A;  3DMU A;  4OX9 L;  1UAP A;  3H3V C;  1SJE D;  3T16 A;  3IAY A;  2N78 A;  1XTC D;  1Y1W G;  3K58 A;  4XXE A;  3OTO L;  4P2C B;  3EN2 A;  3HOZ H;  2UU9 Q;  1IKL A;  1PRT D;  3VR5 A;  3UDX A;  4F87 A;  3BVZ A;  3BDL A;  1PYW D;  3LWE A;  2ASB A;  5LL6 X;  2F0N A;  1W6J A;  5C4Z A;  4H44 C;  1U5K A;  1SYD A;  2MNA A;  4ZCK A;  1IBM L;  4KK7 A;  4RMF A;  4LF7 L;  5JJZ A;  1Q7Y C;  2Q2U A;  3GTM H;  1PTO F;  1TWF B;  3CPF A;  3I3C A;  4AQY L;  1L1O B;  2ATW A;  2NZ1 D;  2OQ0 A;  3HOY G;  1SNO A;  1TWH B;  1LO5 D;  3SXH A;  5IOC A;  4LF9 Q;  2Z0S A;  1EU4 A;  2R7D A;  1FNV A;  4IUN A;  4X64 Q;  3ER0 A;  1IZ6 A;  1K3B C;  1WCM H;  1UE6 A;  3AQQ A;  3KF8 A;  4A3F H;  1S40 A;  2F4V L;  3PSI A;  3NUC A;  1BBW A;  5G3L F;  1QNK A;  3P7J A;  4KJN A;  1HQR D;  2EYF A;  1LTB D;  2L55 A;  2LY7 A;  4BXX G;  3H91 A;  1HUN A;  1N8R C;  1EYA A;  3ERO A;  2A6H C;  2LXK A;  4BBS G;  1ZYR C;  1TXY A;  1SN8 A;  3SDZ A;  3PO2 H;  4QCL A;  5JPM C;  2YYZ A;  3BYT B;  4IZ8 A;  1HPC A;  3TZD A;  1IBK L;  1KHI A;  4DAV A;  4GN4 B;  5KEE A;  4APV A;  5M5W B;  4AYB B;  1CKO A;  2L12 A;  5CBE E;  3I4M B;  1EU3 A;  2EJG C;  5DM6 3;  4X65 L;  1A3U A;  5C5M A;  4A3J H;  3I73 A;  1HNZ Q;  4ZKB B;  4X3U A;  3TZU A;  1QCB D;  1PZI D;  4HR7 B;  2NN6 H;  2VNU D;  2VQE L;  4LMQ D;  4A3M H;  4QY7 A;  1ESF A;  3V2T A;  1B53 A;  1SMY D;  3OSO A;  1D5M C;  3S14 H;  2UU9 L;  2EYP A;  3DM1 A;  1PRT F;  1C4Q A;  2R7Z H;  2B2T C;  2K6A A;  4P75 A;  1JWU D;  4PMB A;  5IP9 G;  2B8G A;  2KOL A;  1HJP A;  4F8M A;  1A62 A;  5E1F A;  1KDB A;  1Y1V H;  3A8I E;  5FOB B;  4A3E H;  3A0J A;  3QOL A;  1J8I A;  1OXS C;  3D31 A;  4N9P A;  4G4K A;  4ZUI A;  3PV0 A;  1OXX K;  4L6T B;  5FJ8 H;  1T5E A;  4OON A;  3R93 A;  1Q86 C;  1UEA B;  3E9H A;  4RH6 A;  3W2D A;  1PH4 A;  3NBH B;  1VQ4 A;  1EYG A;  5EPJ A;  1RTO A;  3Q22 A;  2V4D A;  3L0O A;  3C2P A;  3STB C;  1DZ1 A;  2CVR A;  4JI3 L;  3G6E A;  4LF9 L;  1IBL Q;  5DAU A;  2F4I A;  2K1B A;  4A3D G;  4X64 L;  4JOI C; 
#chains in the Genus database with same CATH homology
 5D3D A;  4XYO A;  1MD2 D;  1RHP A;  1TS3 A;  3D4R A;  3D6W A;  1TII D;  5I9P A;  5IT9 L;  2D62 A;  1ESR A;  1SND A;  3L7Z C;  3X3M A;  1H9R A;  1RCV D;  2TMP A;  3K0Y A;  3TDQ A;  4RKB A;  1WD0 A;  1UUP A;  1M8A A;  3MWY W;  3M7N A;  5HUR A;  1Y8O B;  4RGM A;  2B2U A;  2BE5 C;  2PNR C;  1I4Q A;  3S1M B;  2OT2 A;  3GTJ B;  4V19 0;  2R92 B;  2R6G A;  4C3I G;  3LWU A;  1LLR D;  4TSS A;  3ONA B;  4QB4 A;  4FP5 D;  5A2Q L;  1I4R A;  3HZX A;  3FDT A;  5C0X G;  4NKL A;  1B3A A;  1CHQ D;  3PO3 B;  4EQN A;  4Q0F A;  4ZQ3 A;  3F2U A;  4LAA A;  1TY2 A;  4OGQ C;  3A8K E;  3MTS A;  2B63 B;  2KUM A;  1HRJ A;  4FF4 A;  3TN2 A;  1HFN A;  2AUK A;  5C5L A;  1BOS A;  5C6A A;  1SJH D;  1AZQ A;  3NPP A;  3DWQ A;  2K03 A;  1U4L A;  3ITP A;  3OWF A;  3DEP A;  1JC7 A;  3Q23 A;  4WFN 3;  1V43 A;  1G29 1;  5M3F B;  1W6K A;  2XWJ B;  4S3S A;  3G6J B;  3J80 E;  4ILW A;  1FNU A;  2L9H A;  1LTR D;  4HMJ A;  3BVM A;  1F9P A;  5JVH 3;  3M4O B;  3FPU B;  2A6E D;  1SSO A;  2X6G A;  5C0X J;  3FMC A;  5JVG 3;  1PMR A;  1AN8 A;  1SYE A;  2EXZ A;  4KMU C;  1R4P B;  3QWN A;  1R4Q B;  5C4H A;  2O5J C;  4X3T A;  4U67 3;  1Q8I A;  5C4X B;  4ZUJ A;  5KYL A;  1Z7T A;  1H9K A;  2WAQ B;  4RFB A;  1EY4 A;  2A74 C;  1LTI D;  2OXP A;  3NSW A;  4M1U B;  3D4W A;  5COY A;  4CKE A;  3BDC A;  1CK1 A;  2F0D A;  1PFN A;  5COR A;  4FVM A;  2JE6 I;  4Y7N B;  3D3R A;  4CBV A;  5J39 A;  5FO7 B;  5NUC A;  1WCM B;  2BDN A;  3MAQ A;  3DWP A;  1JR0 D;  1RJT A;  2HQE A;  2DY7 A;  1RKN A;  2X69 A;  4NMZ A;  1LT5 D;  4A3G B;  3DWA A;  3M3Y B;  1VDZ A;  1DOM A;  2Z1C A;  4ZRZ A;  2A73 B;  5CBA E;  3FKI B;  2K33 A;  1HTP A;  4C56 C;  3VR4 A;  1XWE A;  2A69 D;  4O1N A;  1LAC A;  3NHH A;  1PZK D;  5I6Y A;  3QB3 A;  2F3W A;  2CW0 D;  5ISR A;  1E2W A;  1GHJ A;  1S5C D;  4DGZ A;  4FNF A;  2JEA I;  3IKJ A;  4A3E B;  2F0H A;  2B2U C;  3NXW A;  1EY9 A;  3QJY A;  3AB9 A;  5E4W C;  3TP5 A;  3SK6 A;  3E5S A;  4IUU A;  3V05 A;  1EIG A;  4RGN A;  2NN6 G;  1STB A;  5C3X A;  2F0L A;  1F9Q A;  1K8M A;  3MC0 B;  4EQP A;  2L11 A;  1EIH A;  2MGS A;  4C3H B;  1DXM A;  5KNC A;  3BG3 A;  3DEO A;  4MHE A;  1SAP A;  2NBF A;  4KY6 A;  1ZXT A;  5FKA C;  5JEA H;  1Z6H A;  4NDX A;  2PMZ B;  3J81 E;  2JA7 B;  3A56 A;  2A68 C;  2XRQ D;  4HSP A;  2EJF C;  4I7Z C;  3QO2 A;  3EA6 A;  2DY8 A;  1U9R A;  3SR1 A;  3R2T A;  3M85 A;  1STY A;  1IYU A;  1ICW A;  3KUP A;  3NP8 A;  4PNY A;  3NWT A;  3LNN A;  1F9S A;  1QE6 A;  1ZKO A;  1NR2 A;  1V1P A;  4K5V A;  4A93 B;  3LX0 A;  5KNB A;  3HP3 A;  5AFW A;  1JOR A;  3KK7 A;  2QKI C;  5M9O A;  4TRD A;  5IGB A;  2E76 C;  1TS5 A;  1PFB A;  1GXD C;  2BA1 A;  5IGC A;  1D1I A;  5FO9 B;  2IT1 A;  4A3B B;  1Z47 A;  3T4A C;  2WAC A;  4CJ0 B;  4UDU C;  3VYR A;  2H4O A;  3HOW B;  4X3S A;  4IUV A;  1OO9 B;  1KLG D;  1I4P A;  4A3I B;  2NTT A;  2F0T A;  4RGT A;  5BN4 A;  3PIP 3;  1O80 A;  3A8J E;  2PQE A;  1JQY D;  4IUR A;  4HTH A;  2Y0S B;  1DOL A;  1CT1 D;  5IGG A;  1G2T A;  1S5B D;  2Z4I A;  3K5O A;  2Z8L A;  4I65 A;  4KHV A;  1FYC A;  1DJR D;  1Q12 A;  3PUY A;  2E2I B;  3K6O A;  1D6E C;  3MZ5 A;  5DEH A;  3FEW X;  2K01 A;  3D6C A;  1Y1W B;  4K2L A;  1ENC A;  4KKT A;  5ELE A;  3I4N B;  2ZT9 C;  2AQ2 B;  2B2V C;  5CYU A;  1ET9 A;  1SDF A;  5A35 A;  1BF4 A;  1PZJ D;  2VB3 X;  4J6H A;  5T1G A;  1DM0 B;  3SK5 A;  1G2S A;  1S5D D;  3T56 B;  2DNC A;  4RGO S;  1V1O A;  1KDA A;  3S17 B;  3S2H B;  2EPB A;  4XQN A;  2MP1 A;  1HTL D;  1I4X A;  1TWC B;  1ILP A;  1B1Z A;  1SE4 A;  1DOK A;  3H0G B;  1H9S A;  4PQX A;  3Q0A A;  1G8Z D;  2VXW A;  4ZK9 B;  2JYO A;  1JB3 A;  2EY2 A;  4BBS B;  1X32 A;  1HHV A;  1YNJ C;  3RD4 A;  1ET6 A;  1I6H B;  4DNT B;  4RA8 A;  4XQJ A;  3KBG A;  1TS2 A;  4HMI A;  2IX3 A;  1QNU A;  1J9O A;  1EY8 A;  3K57 A;  2PW7 A;  3WDN A;  3I8Z A;  3NTI A;  3PUW A;  1C48 A;  4XDX A;  1I50 B;  1BR9 A;  2FJ2 A;  2PYK A;  3T51 B;  5EKK A;  3TBI B;  4E6I A;  4DXG A;  1JWS D;  5K5P A;  2R93 B;  1VF5 C;  5FLX L;  1F2Z A;  3UI2 A;  1TU2 B;  2HDM A;  1QIL A;  4L8J A;  5CV4 A;  4IFD I;  3TP8 A;  5K36 H;  2F0K A;  1QWY A;  1CQV A;  4NP5 A;  1YNN C;  2EOT A;  4G7Z C;  4CKC A;  3MHB A;  1KNE A;  4OO1 G;  1PRT B;  1OXT A;  2PZW A;  3KBX A;  1Q3L A;  2EYM A;  4A3D B;  1BBX C;  4IUT A;  1STN A;  2C9O A;  1DCZ A;  3BYY B;  2K7V A;  3I72 A;  1E0B A;  2A6H D;  1AW7 A;  4FF2 A;  2BA0 A;  1ZYR D;  2SDF A;  4K6L A;  1LT6 D;  1DYQ A;  1E2V A;  3BS1 A;  3OWE B;  4CGY B;  1GUW A;  3S16 B;  4WJW A;  4PMW A;  4DF7 A;  4FXG C;  2L1B A;  2WP8 J;  2KEE A;  2XVS A;  4DN4 M;  5IOD A;  1QJO A;  1CM9 A;  3Q6S A;  1MGS A;  2WIN B;  2LS0 1;  1GHK A;  2NVX B;  3W3A A;  2CHB D;  3BDO A;  3VR6 A;  4C3I B;  1MSG A;  1TKW B;  1CHP D;  2MUY A;  2F1M A;  3RZO B;  2SOB A;  5M5Y B;  5D3I B;  2D9U A;  1A6X A;  1KAB A;  4RKL A;  4FF1 A;  4C3J B;  4WOR A;  3MVV A;  1JOO A;  5I4D A;  5EBD A;  1WTP A;  2A6E C;  2VB2 X;  5C4J B;  4BY1 B;  5E4X A;  4Z9C B;  2QEJ C;  5D14 A;  2RSO A;  2E75 C;  4BY7 B;  1H9M A;  1LTS D;  3GTK B;  3PUZ A;  4R8N A;  1STE A;  2FFK B;  2XSC A;  4RCN A;  2O2L D;  3HOX B;  3HEJ A;  2RBM A;  3H09 A;  2J0T D;  1BXT A;  1F2M A;  3BZD B;  1Q1E A;  1SXT A;  3J7A V;  3RMH A;  2I07 B;  2F0P A;  3R2I A;  5JEA J;  2G9D A;  2N88 A;  2BE5 D;  3H6M A;  2X6L A;  1A3T A;  3G7L A;  1LAB A;  4BA1 I;  2Q8T A;  1AZP A;  1UNS A;  3GTG B;  3DXJ C;  3C1F A;  5JAV A;  1CQF A;  1LTT D;  3CHB D;  2K04 A;  4JBW A;  3S1R B;  1R9T B;  3NTH A;  1BQQ T;  5KIX A;  2M2L A;  2E2H B;  1V1P B;  4RWS C;  4B08 A;  4HAE A;  4HCS A;  2R3Z A;  5EQ0 A;  1BNZ A;  2IX1 A;  1A3V A;  2JEB I;  2B2W A;  1D5Z C;  2JP1 A;  4K2K A;  1EL0 A;  3S9W A;  2NUC A;  2NVY B;  3HGB A;  2HCI A;  3GTO B;  3MFY A;  3CRL C;  5CV6 A;  2A69 C;  4HCE A;  5C3E B;  4KN7 C;  2QCP X;  2E2D C;  4XT3 B;  1EY5 A;  2F03 A;  4DK1 A;  4KHZ A;  4XIG S;  1WTW A;  3DHQ A;  4FXD A;  2B2Y A;  1A2T A;  2CW0 C;  4KKS A;  1A2U A;  2B8F A;  3A54 A;  3CRK C;  5FK9 C;  3GTP B;  1SYC A;  5M5X B;  1ONL A;  1Q90 A;  2JA5 B;  3SK8 A;  1I6V C;  1JIC A;  2AWO A;  1PLF A;  5BN5 A;  3V96 A;  5JPN C;  2KEC A;  2RA4 A;  1CA5 A;  3R8B A;  1WTR A;  1I4H A;  5BN3 A;  1BUV T;  1IL8 A;  1FR3 A;  2CQA A;  4B9X A;  2WKD A;  2ZXR A;  2IJ0 A;  1OXU A;  1HA6 A;  1EZ6 A;  3GQB A;  4RHR A;  4Q5V A;  2L4N A;  1IW7 C;  2K28 A;  1TR5 A;  2ICE C;  5CV7 A;  1SNQ A;  1BDO A;  3OPO A;  3S2D B;  1M4V A;  2MJ8 A;  2KCN A;  3EVQ A;  1MBY A;  1BCP C;  2DN8 A;  2OEO A;  4XT1 B;  1ILQ A;  5J22 A;  3OMC A;  3Q24 A;  1CA6 A;  1HFG A;  3NE5 B;  2JXM B;  1OXV A;  3X3N A;  2WII B;  2M00 A;  1EY7 A;  1I3Q B;  3IFD A;  1TVX A;  1H9S B;  2MPM A;  3M4Y A;  5K36 G;  1IYV A;  1U4P A;  2Z4H A;  3NK9 A;  4J1M A;  1GUS A;  2PZT A;  1S4Z A;  1K83 B;  4KY7 A;  4TQU S;  5D65 A;  1JOQ A;  2PO4 A;  4CHT B;  1SBB B;  2BDO A;  1GUO A;  3K5M A;  1B9M A;  5IT9 E;  3MEH A;  4ZYS A;  5KND A;  5M3M B;  3OMG A;  5CMD A;  3MXN A;  2EDG A;  1PTO C;  2D2C C;  4KD3 A;  4FO2 A;  1SYB A;  4U68 A;  1EYD A;  5JOB A;  3EJI A;  3GP7 A;  2KED A;  5FO8 B;  4IAL A;  2WB1 B;  5C0X H;  2LFN A;  1IKM A;  2B2T A;  3ERQ A;  1T5X D;  1NCV A;  2HDL A;  5IGF A;  2RKS A;  4RCO A;  3T53 B;  4EVO A;  5A2Q E;  3JAM E;  3HOU B;  1EEI D;  3K5N A;  2F0S A;  2EYO A;  4KV6 A;  1IHZ A;  2B2W C;  3VA5 A;  4BA2 I;  5EBC A;  2K05 A;  3K7A B;  1EEF D;  1BO0 A;  3GTQ B;  3TP7 A;  3HKZ B;  2MHV A;  2JA6 B;  3MXU A;  2A68 D;  3SHL A;  1B50 A;  4QUC A;  2EVB A;  4K5W A;  1BCP B;  4IUP A;  1VMC A;  1LT3 D;  3J80 L;  1DD2 A;  1PRT C;  4CJ2 C;  1B44 D;  2B2Y C;  2NYZ D;  2K5D A;  4QIW B;  1KAA A;  4B9W A;  3I4L A;  1K8O A;  4EQO A;  1JCK B;  3P75 A;  4GZY C;  4CKB A;  4DA2 A;  3RZD B;  1EWC A;  3A7L A;  1D2B A;  2PZU A;  3BVG A;  4KY5 A;  4RAU C;  2AQ1 B;  3MXP A;  2QF7 A;  3FRP B;  1KNA A;  3C3L A;  2BCO A;  2NVT B;  3OW7 A;  2B39 A;  4QF4 A;  5EPK A;  4IFD H;  3OOC A;  4KKU A;  5E3F A;  4LK1 C;  1I4G A;  1SNM A;  5EPL A;  4OIK A;  1TWG B;  5C44 B;  3I70 A;  3T13 A;  1F9R A;  5C0X I;  4DNR B;  4FXK C;  3C46 A;  2XWB B;  3FPP A;  1STA A;  2RSN A;  1PFM A;  3KLS A;  1SYG A;  4H7B A;  2WV6 D;  3HOY B;  3L3O C;  1C8C A;  2EE1 A;  2HUG A;  5HGT A;  1WVL A;  1AFP A;  4MIU A;  4HED A;  2VUM B;  3SK4 A;  2SEB D;  1CTM A;  4K6D A;  1Y69 U;  1PTO B;  3A55 A;  5ELF A;  1ENF A;  2K5W A;  2N55 A;  2F0F A;  1HUM A;  3EFX D;  2LMC B;  5TSS A;  1SMY C;  1KDC A;  2O4X A;  3O13 A;  2KA7 A;  1D5X C;  1H9J A;  4C1N K;  1MSH A;  4H0L C;  1XYI A;  3MFG A;  2KQ3 A;  1DON A;  4QUF A;  1O7Y A;  1RTN A;  4FYD A;  2EY1 A;  3EQL C;  1EY0 A;  4XYQ A;  3VYU A;  4KTA A;  1LTA D;  3M7G A;  1WTV A;  5I2X A;  1TWA B;  2F0I A;  4G7H C;  2KJX A;  4K14 A;  1L0Y B;  3S1Q B;  3S1N B;  5F2D A;  5DM7 3;  3AU7 A;  5IGE A;  2O5I C;  2J4X A;  4RHS A;  3A7A B;  2LKV A;  3HS0 C;  4DK0 A;  2KVM A;  2XNA C;  2XRS D;  1YNJ D;  2WKC A;  3VYT A;  4DAP A;  1FNW A;  1II3 A;  2IL8 A;  3GO5 A;  1EQV A;  2J7Z A;  3CU7 A;  4KJO A;  4A3K B;  1JWM D;  1JOK A;  1GJX A;  1JE4 A;  2E2J B;  1X3Q A;  3HG9 A;  4DFA A;  1D1K A;  5ELB A;  1WD1 A;  1X3P A;  3SEB A;  4H13 C;  1U4M A;  2QDB A;  3SE0 A;  2SNM A;  2HCC A;  3HOV B;  3J81 L;  2KCC A;  4ME5 A;  3NQT A;  2PPB C;  3WOE A;  2G9H D;  2EY5 A;  2RDG A;  4HSV A;  1YNN D;  5CR3 A;  3P20 A;  1GUT A;  5JEA G;  5EJW A;  1EQT A;  2M9V A;  4O42 A;  1O7L A;  3OHX C;  5LHY 1;  3E6Z X;  4OIJ A;  1G91 A;  4QMG A;  1ZEQ X;  2C5C A;  2D5D A;  2AQ3 B;  4ZLT F;  2ID0 A;  4BS9 A;  1EWH A;  3JAM L;  3PUX A;  2NN6 I;  2IW3 A;  2RDH A;  4PV1 C;  5ELC A;  2IX0 A;  5J1Z A;  1SNP A;  2L5T A;  2JA8 B;  1VMP A;  5CGK A;  4C3J G;  3U9O A;  4NW2 A;  2FHT A;  2FMC A;  1VCI A;  3HRZ C;  2DNE A;  2F0W A;  1STG A;  4XQQ A;  5KGU A;  1Y8N B;  2Q8I B;  4IN3 A;  1LT4 D;  1FGB D;  2ZXP A;  4ID6 A;  3VR3 A;  4KN4 C;  3PMF A;  4C1N I;  3CKI B;  2FIN B;  2RDF A;  4HN7 A;  1AEX A;  1LV9 A;  1HA5 A;  3OIP A;  2ENB A;  1SFO B;  1E2Z A;  3NTK A;  1HXY D;  3ZYY X;  1HCZ A;  3WOF A;  3AMU A;  3D8G A;  3S15 B;  2ZXO A;  3L9A X;  4K5X A;  4YIJ A;  4K8I A;  5C3W A;  1QOH A;  1CZW A;  2F3V A;  2F0O A;  1QB5 D;  4XTC S;  4ABN A;  3NQI A;  3E0J A;  3HOZ B;  4IFD G;  1KTK A;  1SEB D;  1NAP A;  2EZV A;  2EYL A;  4L63 B;  2RQX A;  1LTG D;  1TS4 A;  3FVQ A;  3GTM B;  1A15 A;  3C1E A;  4ULL A;  1NSN S;  1NUC A;  2NWG A;  1AP0 A;  3J7Y W;  3PUV A;  4UAI A;  1PTO H;  3GD7 A;  4MN3 A;  1CI3 M;  1SE2 A;  5IGD A;  2IPK D;  4BWG B;  4A3F B;  3VA7 A;  2H1E A;  2I46 A;  1F2L A;  3NBH A;  4JK1 C;  5CV8 A;  2SNS A;  1F2Y A;  3RUZ A;  2A5H A;  1QG7 A;  1GUG A;  3PO2 B;  1VF7 A;  4R9W A;  4PMC A;  2NB0 A;  4IFD J;  1PDQ A;  1GUN A;  3K59 A;  1PXU A;  2B2V A;  4WRD A;  1ROD A;  5KRU A;  3H94 A;  4G57 A;  4A3J B;  2EY6 A;  1RDP D;  4A3M B;  5FLX E;  2K5Q A;  4OO1 H;  4TKO B;  4F7X A;  4DXF A;  1ML0 D;  3S14 B;  2R7Z B;  3KLS X;  4CJ1 B;  1L0X B;  1EZ8 A;  1Y1V B;  1WTQ A;  4FF3 A;  4ZKC B;  3IL8 A;  1TQO A;  5I2Y A;  2EYJ A;  5I6W A;  2QIL A;  3URY A;  1EYC A;  1NR4 A;  3N52 A;  3SVM A;  5I9O A;  3MXG A;  5CV5 A;  1B4O A;  1Q1B A;  3ND8 A;  3QG1 A;  4LJZ C;  3N6R A;  3U9S A;  1IW7 D;  1V8Q A;  1RF2 D;  2OF1 A;  2AUJ D;  5EKI A;  1TT2 A;  2PW5 A;  2NVQ B;  1BCP D;  1CFM A;  3K5L A;  1G6Z A;  2GA4 B;  2RVL A;  2F0E A;  1TY0 A;  4OL7 A;  4KI0 A;  3I90 A;  1KLU D;  3DUZ A;  4C3H G;  4ZAI A;  1ENA A;  2E74 C;  3TME A;  3TP6 A;  4K8J A;  5CC4 A;  1B9N A;  1HQM C;  1STH A;  5DNF A;  3GV3 A;  2ICI A;  2KHS A;  4OHJ A;  1RD9 D;  1EFI D;  2EYH A;  5KYI A;  1SNC A;  1XXG A;  4DAY A;  3QOJ A;  4C2M B;  2JSO A;  4ODG A;  3MA2 B;  2IWH A;  1Y8P B;  4X3K A;  1EY6 A;  3GV6 A;  4OO1 I;  3CQZ B;  1FD7 D;  5T1I A;  3GTL B;  2YU9 B;  5IIF A;  3R3O A;  4BBR B;  5EGT A;  5CV9 A;  2Q8R E;  1CZG A;  4F88 A;  3TSS A;  1WTO A;  5ELD A;  2F0G A;  2FMM A;  3KLR A;  4J8Q A;  1SYF A;  1S5E D;  2AWN A;  3RLF A;  1U4R A;  2F0U A;  3D4D A;  3J7A F;  3NWS A;  1MI2 A;  3P1H A;  4M8A A;  2F0J A;  2L0C A;  1F77 A;  2XIW A;  5EKL A;  1PTO D;  4R8I A;  4DU9 A;  3ND9 A;  1B2T A;  2BOS A;  3VR2 A;  1BCP F;  1S5F D;  4EGV A;  1WTX A;  2NTS A;  4KD4 A;  4V0B A;  5G3L D;  5LL6 S;  2R61 A;  2PCF B;  3NBI A;  2XN9 C;  4G7O C;  2F0M A;  1SE3 A;  3OIQ A;  4N9T A;  2EJM A;  1GOZ A;  3IFT A;  3PIO 3;  1O7Z A;  3VYS A;  1O78 A;  2K32 A;  2TSS A;  1XX8 A;  3QIA A;  4IQZ A;  2F0Q A;  1EOT A;  2F0V A;  3I91 A;  4IUQ A;  3DMU A;  1UAP A;  3H3V C;  1SJE D;  3T16 A;  3IAY A;  1XTC D;  3K58 A;  4XXE A;  4P2C B;  1IKL A;  1PRT D;  3VR5 A;  4F87 A;  3BVZ A;  3BDL A;  1PYW D;  3LWE A;  5LL6 X;  2F0N A;  1W6J A;  5C4Z A;  4H44 C;  1SYD A;  4KK7 A;  5JJZ A;  1PTO F;  1TWF B;  3I3C A;  2NZ1 D;  1SNO A;  1TWH B;  1LO5 D;  3SXH A;  5IOC A;  1EU4 A;  4IUN A;  1FNV A;  3KF8 A;  3NUC A;  5G3L F;  1QNK A;  3P7J A;  4KJN A;  1HQR D;  2EYF A;  1LTB D;  2L55 A;  2LY7 A;  3H91 A;  1HUN A;  1EYA A;  3ERO A;  2A6H C;  1ZYR C;  3SDZ A;  4QCL A;  5JPM C;  2YYZ A;  3BYT B;  4IZ8 A;  1HPC A;  3TZD A;  4DAV A;  5KEE A;  5M5W B;  4AYB B;  2L12 A;  5CBE E;  3I4M B;  1EU3 A;  2EJG C;  5DM6 3;  5C5M A;  1A3U A;  3I73 A;  4ZKB B;  4X3U A;  3TZU A;  1QCB D;  1PZI D;  4HR7 B;  2NN6 H;  2VNU D;  4LMQ D;  1ESF A;  3V2T A;  1B53 A;  1SMY D;  3OSO A;  1D5M C;  2EYP A;  3DM1 A;  1PRT F;  1C4Q A;  2B2T C;  2K6A A;  1JWU D;  4PMB A;  2B8G A;  2KOL A;  4F8M A;  5E1F A;  1KDB A;  3A8I E;  5FOB B;  3QOL A;  1J8I A;  1OXS C;  3D31 A;  4N9P A;  4G4K A;  4ZUI A;  3PV0 A;  1OXX K;  4L6T B;  1T5E A;  3R93 A;  1UEA B;  4RH6 A;  3W2D A;  5EPJ A;  1RTO A;  3Q22 A;  2V4D A;  1DZ1 A;  3C2P A;  2CVR A;  5DAU A;  2F4I A;  2K1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...