5EKLA

Crystal structure of staphylococcal nuclease variant delta+phs t62d/n100e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eklA00
1EYCA 3MHBA 5CC4A 5M9OA 3PMFA 5F2DA 1JOQA 2OF1A 3T13A 1STHA 2KQ3A 1EQVA 4J6HA 3VA5A 5I6YA 1SNQA 1SNMA 3D6CA 3QOLA 4HTHA 4KHVA 3ERQA 3OMCA 5C5LA 3SK5A 3SK8A 2F0KA 5C4ZA 1JORA 1EY5A 1A2TA 2F0UA 2EYMA 4N9PA 3SK4A 1F2ZA 3D4DA 3TP6A 1KABA 4QF4A 2O4XA 3NHHA 1SYBA 3P75A 5EKLA 5IODA 4ME5A 4G57A 5C5MA 5IGDA 2PZTA 2F0FA 2PW7A 4KY7A 4EQOA 1F2MA 1SNPA 3NK9A 5I9OA 5IGEA 4NMZA 4K14A 5KRUA 2F0QA 4NDXA 2F3VA 5KEEA 5KYLA 4RKBA 1ENCA 2PQEA 2SNSA 4TRDA 1KDCA 3D4WA 5IIFA 3NXWA 4J1MA 4KY6A 4PMCA 2EYJA 1JOOA 2F3WA 5E3FA 1EY6A 4K5XA 4PNYA 1JOKA 3TMEA 5DEHA 3MZ5A 4LAAA 2F0MA 3E5SA 4F8MA 5IGGA 3NQTA 4HMJA 5C4HA 2F0SA 3OWFA 5KIXA 2RKSA 2F0IA 4K5WA 2F0NA 4KD4A 4MIUA 2EY1A 2EYHA 4YIJA 1AEXA 4EVOA 4ZQ3A 3C1EA 3EJIA 4R8NA 3MVVA 2EYFA 1EYDA 4KY5A 1RKNA 2RBMA 3SK6A 3T16A 3ITPA 2F0WA 2F0GA 4N9TA 3EVQA 4K2KA 4QB4A 1EY0A 2F0EA 4K2LA 5IGCA 2SOBA 5CV8A 4WRDA 2F0JA 2OEOA 4S3SA 4ODGA 5KGUA 3RUZA 2RDFA 4ZUIA 1SYDA 4NP5A 5JOBA 5J39A 1STYA 5CV6A 3C1FA 2F0TA 4B9XA 4NKLA 3S9WA 5ISRA 1EZ8A 1A3TA 3H6MA 1TQOA 4KV6A 3D8GA 2KHSA 1A3VA 5J22A 2M00A 3NP8A 4I65A 4IALA 5K5PA 5CV4A 4RKLA 3SXHA 1EYAA 3NUCA 4K5VA 1KDBA 4K6DA 4B9WA 5IGFA 2PZWA 3P1HA 4ZUJA 3TP7A 2HQEA 3TP5A 4DF7A 5CV7A 5C6AA 3U9OA 4IUNA 3DMUA 2F0HA 3HZXA 1NUCA 2SNMA 3OMGA 3DHQA 2OXPA 5NUCA 4DU9A 5I9PA 1KAAA 3HEJA 1IHZA 4QMGA 2EYPA 5IGBA 1ENAA 2NUCA 4H7BA 2PYKA 3R3OA 1TR5A 4KJNA 4ID6A 2QDBA 4KTAA 5DAUA 5CV9A 1STNA 3SHLA 1U9RA 3OSOA 4KJOA 1EY8A 5J1ZA 3QOJA 5HGTA 5C3WA 3EROA 5EGTA 4DFAA 4IZ8A 1TT2A 2F0PA 4PMBA 2EYOA 5CGKA 5IOCA 4EQNA 1SYEA 2EYLA 4F7XA 2WACA 3LX0A 4K8JA 1NSNS 1SNDA 2F0OA 1STAA 5C3XA 2PW5A 2EY6A 2F0LA 5E1FA 1II3A 1SNOA 2EY2A 2EXZA 1KDAA 1STGA 3BDCA 4OL7A 3SR1A 1SYGA 5JAVA 2F0VA 1STBA 2F0DA 1F2YA 3MXPA 5CV5A 3TP8A 4DGZA 1SYFA 4HMIA 5CR3A 4EQPA 2ENBA 1A3UA 5KYIA 1SNCA 1EY9A 2EY5A 2LKVA 1SYCA 3QB3A 4KD3A 5I6WA 1EZ6A 1EY7A 2PZUA 3BDLA 4WORA 4K8IA 4E6IA 5HURA 5EKKA 3MEHA 1A2UA 1EY4A 3V2TA
chains in the Genus database with same CATH superfamily
3RNUA 2R92H 3CW2C 3HKSA 1HTLD 3DM3A 2AQ2B 2I5MX 3CCVA 2P5ZX 2AUKA 1EQVA 5EPLA 1PHJA 1CA5A 3U58A 1JJ2A 4DR5Q 4DR6L 2XN9C 1JWMD 4R1JA 2CW0C 4OX9L 4JVZA 1ASZA 2XWJB 3N6RA 1SMYD 2K5NA 2PZTA 1EUJA 3ER0A 3K8AA 5IT9c 2HCCA 4X3SA 1MJEA 2E74C 4TRDA 4YWLA 3WWVA 3GV3A 3L7ZC 2JSOA 3CCQA 3UE1A 3GV6A 1WTPA 4A3MH 1EY6A 5HGQA 5C3EG 4BY1B 4M1UB 3E5SA 1J6QA 1UE6A 1PRTC 4MIUA 4JCVE 4DR4Q 4R8NA 2FMMA 3NE5B 2F0GA 4K2KA 4BY1H 1S5DD 2UXCQ 2F0EA 1NTGA 1YBYA 1PTOC 1B2TA 1TWFB 4OHJA 2CKZB 4ZUIA 3C46A 1O78A 3S9WA 5H1SE 1PH9A 1HA5A 4UP7A 3AB9A 5D3DA 4JYAL 2ES2A 5BN4A 4IQZA 3U4VA 2CVRA 4K5VA 2EDGA 3P1HA 3SE0A 2R7ZH 1EIYB 2HQEA 1HR0L 1YNND 1LT4D 4X66L 5IE8A 5NUCA 3LWUA 2B63H 2ZM6L 1IHZA 2N3SA 2NUCA 4KTAA 3S1NH 1SJHD 2B2TA 2BOSA 1LO5D 1EY8A 1T5EA 4DUZL 2CCZA 5CYUA 4JI1Q 1BNZA 3RN2A 1PZID 1K28A 5I4DA 2NVTH 1EIHA 1E1TA 4JBJA 4F7XA 1NY4A 4NXML 3M7GA 2UXDQ 3H0GH 4TSSA 2K28A 1CHPD 4DV1Q 1I4PA 1KRSA 3VR6A 4IUTA 1D8LA 3PO3B 3K5OA 1D7QA 1VQEA 1K3RA 2JQOA 2L11A 1PH8A 1G2SA 1NCVA 5T1IA 4P74A 1WTRA 3CCUA 1S40A 3EQLC 3K5MA 2NVQB 4DV2L 1SMYC 1AZPA 3HOUH 4LK1C 3VR3A 1DZ1A 1I4QA 4AYBG 1CSPA 3CRKC 4OONA 4UP8A 1SFOB 4DR6Q 1JOQA 3W2DA 4C3JH 2OF1A 5L37A 1Y1WH 4X3KA 4OX9Q 2LFNA 1UEAB 1GUTA 3S17B 3LNNA 4JI2L 2FHTA 4LMQD 4A3DB 2NVQH 5DM73 4CHTB 3D4DA 4F87A 1VQBA 4QQBX 4UAIA 1BCPF 2F3IA 3BYYB 4JI8L 3I4MG 2B2WA 2F3VA 4IURA 3U50C 1Q46A 3CF5A 1EYGA 3U4ZA 4OWXB 4IUVA 5BN5A 1TS2A 4J1MA 4LF9L 2ZTEA 2EOTA 5A35A 4PNYA 2OTLA 4NXNL 1D6EC 2A6HD 4LAAA 2ZTCA 3K6OA 5C4HA 1Q81C 1AEXA 3K5NA 4ZQ3A 2EPBA 4IUQA 4OEMB 1ICFB 2F0JA 3R8BA 5K36G 2QF7A 2K1BA 4RCNA 3NQIA 1YNNC 2MHVA 4JYAQ 1G91A 1IYJB 5M5WB 4IFDJ 1YNXA 1K73C 3GTOB 1EZ8A 3CCLA 1Z9FA 1HA6A 1XNQL 5LMUL 3G6JB 1HR0Q 1X9NA 2D0PA 1JB3A 4X66Q 3ONAB 1QNKA 2IW3A 2FFKB 4DF7A 5C6AA 2ZM6Q 2PQAA 3MEFA 4B3MQ 2EVBA 4JOIA 3OMGA 4IUPA 4DUZQ 2PYKA 3JAME 2YU9H 3EIVA 3J7ZC 4NXMQ 1T9HA 3QOJA 3IL8A 3HGBA 1Z47A 3J80c 3GTGB 2ASBA 1JJCB 1SNDA 2F0OA 4DV4L 3L3OC 2X69A 3BZKA 1MSGA 2JA6G 2K52A 3IFDA 2HQLA 2KCMA 5EKIA 2B2VC 1VQ6A 1AZQA 1I3QB 3M4QA 4MN3A 2VL6A 2UUCL 2EY5A 3PIP3 3M3YB 4DV2Q 1NNXA 5HURA 1X56A 1WTHA 4C3IH 1KLGD 5GROA 1M90C 1I3QH 1WFQA 1PH6A 1X32A 4JI2Q 2R3ZA 2FXQA 4MTNA 4LF6L 1R4QB 1Q8IA 2WV6D 3PGZA 4KMUC 4N9PA 2DUDA 4JI8Q 1WVLA 3RR5A 2A6HC 1KABA 3HOWB 3JAMc 3WOEA 3F2DA 5IODA 2MFIA 5IGEA 2NB0A 4ZKCB 4X62L 1NBWA 1EQRA 4LF9Q 2AWNA 2F0QA 2NN6G 1PH4A 5KEEA 2Q8RE 1F77A 4A3IG 4NXNQ 4R4OA 1QVCA 1XJVA 3NXWA 2MPMA 4CKEA 1PVOA 2EYJA 5ELDA 1L0WA 3L0OA 1AE2A 4F8MA 3MA2B 2B39A 1PH2A 4GLXA 2EYHA 2ICIA 5EBDA 3I56A 3NENA 2WFWA 3SK6A 4OO1G 2A74C 3HOZG 4CKCA 3ZJYC 1WI5A 2ZJQA 2MO1A 3NTKA 1XMOQ 1I5FA 4IFDI 1XNQQ 5LMUQ 1HUMA 2HDLA 4NKLA 5ISRA 5M5XH 1TY0A 1QZHA 1SR3A 4G7HC 3NTHA 2M00A 3NP8A 1Y1VH 2BH8A 3E0JA 4IALA 4L5QA 1DOMA 2NYZD 1Q1EA 4GZYC 3KOJA 3U9OA 1HXYD 3H3VI 2Y0SE 4IPHA 4N8X1 3ND8A 3K58A 2EIFA 3PQIA 4BBRG 4DV4Q 3GTJB 1PRTF 1CI3M 5FKAC 3UE0A 1X54A 3LX0A 4C1NK 1SMXA 5C3XA 4X3UA 4A3BB 4ZKBB 4R4IA 2OQKA 1MI2A 4UP9A 3BZDB 2UUCQ 3GTJH 2ALYB 1SYCA 1JCKB 4PG3A 2VB2X 4HEDA 3FHWA 3K81C 1B53A 3AQQA 4A3BH 3MEHA 1O7LA 4B3SL 2ZJRA 4LF6Q 1BCPB 3RZOB 4BXXH 4GS3A 4JV5L 2V1CC 2XRSD 2MP1A 3DXJC 3FKIG 1STEA 1WJJA 5IYBH 2I46A 5M9OA 4TVAB 3RN5A 2A68D 4IN3A 1TS4A 3RZOH 4QL5A 1RHPA 1BCPD 3K80C 2B8FA 1KXLA 1SNPA 3NK9A 1VQLA 1PH1A 4K14A 1VMPA 2OWOA 4RKBA 2PQAB 2K5QA 1HZBA 1AW7A 4DR2L 2CH4A 1JOOA 1MD2D 1K8OA 2KBNA 5E3FA 3PV0A 3TMEA 5E4WC 2B2TC 3J80i 5JEAH 2RDHA 1M1KC 3M7NA 2VB3X 1HNWL 3ICEA 4WJ4A 3E6ZX 1TWCB 3CKIB 5KIXA 1GUWA 4KD4A 4XT3B 4I7ZC 3KF6B 5KNCA 1YJNA 1Q90A 1BKBA 3B6YA 4BA1I 2JA8G 2WB1E 4Y7NH 3VYRA 1YJWA 4WRDA 4RH6A 4S3SA 4OWTB 1BUVT 1SYDA 5C4JH 3G6EA 4JBMA 2OTJA 4LWCA 3HOYH 3I4NB 1VQFA 3KK7A 1HQMC 5ELNA 1E24A 3J81c 4A93B 1VS0A 3T51B 1GHKA 5AFWA 1KLUD 3I4NH 1IL8A 3V96A 3JAMi 1F9PA 1ENAA 2QDBA 3VA7A 1NMFA 3ULJA 4LF7L 4A93H 4ILWA 3V05A 3BVZA 3TQYA 1IL2A 2B2WC 4CJ2C 2Q8TA 1EFWA 1U0LA 4DV6L 1J5EL 2EY2A 2Z1CA 4LUOA 1VQ5A 4A3FB 1P16A 2ICEC 1F2YA 3NELA 4X65L 1EFID 1QE6A 2WAQB 3HOXB 4JBKA 2LKVA 4C56C 3F8TA 2JEBI 4B3SQ 3HOVG 1Q82C 2Y0SG 3Q8DA 1FNVA 2JA9A 3V2TA 4A3FG 1BCPC 3S2DB 3A54A 1Y8OB 1SN8A 5A2QL 2C35B 2WAQG 4H0LC 2K6AA 1H9JA 2K4KA 1ZEQX 2IJ0A 1B9NA 4DAYA 4B08A 2Q8IB 4OGQC 3TP6A 5DLQE 1IYVA 1V1PB 4DXFA 4G57A 4L8JA 3DWPA 5I9OA 4DR2Q 3L2PA 4A3JG 4NDXA 1E2WA 1KDCA 4BWGB 4IJHA 4FXKC 1HNWQ 1V1OA 5FJ8G 3S16H 3NBIA 3BJUA 1PMRA 1LTID 1EOVA 3Q22A 5C4XB 4UPAA 4GN5A 2UUBL 1PFBA 5M5YH 1H9MA 4KKTA 4EQ5A 1U5KA 1EU4A 2MO0A 2RCFA 4RHSA 3QJYA 3W3AA 3I4LA 4A3EB 4Y52H 1LTGD 4IPCA 1CM9A 2HHHL 4GN3B 5BR8L 5C4XH 5KGUA 2JA5G 4YWMA 3X3NA 4XDXA 1QUQB 4MHEA 2RSOA 4BY7H 1CTMA 2NVYB 4IPGA 4A3EH 4FXDA 3T56B 3CCJA 1B1ZA 1K8AC 1EWCA 1Q3LA 1VQMA 1MKHA 2K33A 3QIAA 3UDGA 1IKLA 3HZXA 1PRTB 1VQDA 3FVQA 1CUKA 2HIVA 3HEJA 2RQXA 3Q6SA 3R3OA 4RAUC 5CV9A 3MFYA 1EU3A 3FDTA 3PUYA 3EROA 5EGTA 4PMBA 5DNFA 4DV6Q 2XGTA 4H02A 4A3GH 1JT8A 2EYLA 4IFDH 1J5EQ 3H15A 2PW5A 1II3A 2IHEA 3FMCA 4YWKA 4OL7A 2WKDA 4DK3C 1HR0W 3J7YW 1PZJD 4DAVA 2L15A 2X6GA 3OHXC 4HMIA 4GOPA 3G48A 1HJPA 4CGYB 4LF5L 3IFTA 4LFCL 4MZ9A 4YY3L 4X64L 4PV1C 1T5XD 4WORA 2Z9HA 2A5HA 1D1KA 4K6LA 5E4XA 4WFN3 3UDIA 5JVH3 1Q7YC 1TWHB 4HSPA 3MXGA 2BDOA 5IP7H 1WCMB 3D6CA 3A74A 1VQ8A 1BVSA 4RCOA 1DJRD 1AE3A 2RF4A 3SGIA 3ZYYX 1N8RC 4QF4A 4HJ9A 1PH7A 1SYBA 2R92B 1TWHH 4APVA 2V4DA 4GKKL 1NR2A 4I7AA 2A8VA 5FLMG 4RWSC 2YV5A 5JPMC 4G7OC 4JPBW 1TU2B 4CDFC 2NTSA 5JPNC 2UUBQ 2DY7A 3PO2G 3BDOA 1PLFA 2RKSA 4K0KQ 4OELB 1VQOA 2EJGC 4HJ5A 2RDGA 2D2CC 3IAYA 3GP7A 2HHHQ 5BR8Q 4KLKA 4A3MB 2I5HA 4JI5L 1A8VA 2R61A 4YCUA 2SOBA 3S1RH 4GNXA 4P72A 1KTKA 3A8KE 3VR4A 3VDYA 3I72A 1STYA 2QA4A 4DN4M 3MXNA 4DK1A 3CRLC 1B44D 5K5PA 3KF8B 3RD4A 1I4GA 3BVMA 4PZ6A 5JVG3 1LTRD 3TP5A 2Z4IA 2ATWA 3BVGA 2J0TD 4CBVA 2KEEA 4AH6A 1DYQA 2BE5D 2EYPA 4BY1G 4H7BA 2PO4A 3SHLA 4ID6A 3ULPA 4P75A 1IBML 2R7ZB 3IKJA 1YEZA 3WOFA 2DNCA 1ESFA 1IYUA 5C3EH 4GN4B 1ASYA 2ZXOA 1OXTA 3H3VC 4Q0FA 2AQ1B 2B63B 4R4CA 1QCBD 1STAA 3S24A 2F0LA 1XYIA 3S1NB 5D65A 1XPUA 2CFMA 2RA4A 4LFCQ 4X64Q 4YY3Q 5A2QE 2ID0A 2NVTB 5AJ3L 2NWGA 1NMGA 2OCEA 4P71A 3H0GB 2B63G 2E2DC 1EY7A 3IRBA 1L2FA 1E0BA 1GUSA 3PIPA 4B3RL 1CK1A 3S14H 5F2DA 1O80A 2PMZB 4G7ZC 3VA5A 1E2ZA 4HTHA 4KHVA 4GKKQ 3OMCA 4IUUA 4QUCA 2KJXA 4B3TL 5M3FH 1F2ZA 2SEBD 5EAYA 3GTQH 3HOUB 4BBSH 2PW7A 1IZ6A 4NMZA 4C3JB 1Y1WB 3CD6A 2SNSA 2WKCA 1H9SA 3PO3G 1SE8A 3ULLA 1BBWA 3TZDA 2F3WA 4K5XA 1N34L 4UHVA 1ONLA 1SRUA 1PH5A 5J3BA 4LUVA 1WTWA 2A19A 5LL6X 4EVOA 3EJIA 5ELFA 1TKWB 3Q23A 3X3MA 4N9TA 4IOAA 4TQUS 2OT2A 3SEBA 1PFMA 3F2BA 1DOLA 3BG3A 1BDOA 4GOPB 1UAPA 4A3DG 2IL8A 2BE5C 3OWEB 4AQYL 1X65A 4IJLA 3J80E 3J81L 4J15A 4ZUJA 1EIGA 1JWUD 2F1MA 3G71A 4Q5VA 3I4MH 3OTOL 4JI4L 1IBMQ 5DAUA 3R2IA 2D0OA 4DUYL 1HZCA 2JEAI 4DPGA 1C48A 1A6XA 2LXKA 3BYTB 4JI7L 2YTVA 4JG2A 5ELEA 3HG9A 1D2BA 5FOBB 3QG1A 2YU9B 2EXZA 5AJ3Q 1STGA 2F03A 2K50A 4DGZA 2MQHA 3TP8A 5CR3A 2I5LX 5K36H 2X6LA 3CXCA 4O0AA 5GAGC 4L5RC 4FF1A 1KHIA 4B3RQ 2MUYA 1ENFA 4RG1A 2CQAA 5CC4A 4YCVA 3PMFA 3FRPB 3OIQA 2Z4HA 3P20A 4B3TQ 2GA4B 4J6HA 2IX1A 4DK6C 4OXPA 4Z9CB 3SK4A 4C3IB 2EYMA 5LMNL 1HRJA 1A62A 3NHHA 1HTPA 3P75A 4DNIA 2D9UA 3KJPA 3RLOA 5FO7B 2N49A 2LSSA 2SDFA 2E2JH 3DM1A 1GD7A 1GUOA 3D6WA 3M4YA 4C1NI 1IW7D 1HNXL 2F0MA 3NQTA 1G291 2IX0A 2DGYA 3SDZA 3KFUA 1C8CA 4K5WA 2JXMB 4R4TA 2L0CA 1TVXA 2QKIC 5C0XG 1CZGA 2UXBL 2RBMA 3RLNA 4QY7A 2QILA 1D5MC 2KECA 4UY8C 1SJED 3O13A 1GKHA 1PFSA 1QNUA 1TS3A 3D0FA 4GOPC 4AQYQ 4DA2A 1HZAA 4KV6A 2MGSA 1YITA 3HOWG 3D8GA 1XX8A 4HIDA 1OXXK 4RKLA 3SXHA 1EYAA 3F2CA 4DR1L 4K6DA 3KDFA 2DJFC 3OTOQ 4JI4Q 1CKNA 4X6AH 4EGVA 5M5XB 2OXPA 3M4OB 1KAAA 2XWBB 4H44C 4KJNA 1BQQT 1Y1VB 2F52A 3ERSX 1SDFA 1V1QA 5IY0A 1F9RA 4CDEC 2RSNA 1EWHA 5LHY1 4CDCC 3M4OH 2H4OA 2K7VA 2A6ED 3GTKB 2CWPA 1GOZA 1V43A 4OO1H 3OPOA 1BXTA 1KIXA 1JB7A 2EXDA 3MXPA 4LF4L 1L1OA 1LM0A 1A3UA 1A0IA 3MXUA 3NBHA 5KYIA 2NVXH 4DAMA 1JICA 3CHBD 1TWAH 3GTKH 3D31A 2NZHA 3S15H 2L12A 4KN4C 3FEWX 4NPSA 2UU9L 1EY4A 1MHWC 2WAQE 5I2YA 3I7FA 4GNXC 2KUMA 3I4OA 1SAPA 4RHRA 1XTDA 5LMNQ 1J8IA 3QOLA 2B2UA 5C4ZA 3DWAA 4A3LG 2XSCA 1IW7C 3TDQA 1U4MA 2R93B 4HIMA 4CDDC 2BCOA 1X3EA 1YI2A 1I4RA 5LL6S 4BBRH 5GQOA 1E3PA 1XWEA 5IIFA 1HNXQ 4LF8L 3ND9A 4A3BG 4FO2A 1SE3A 3TS2A 5C44B 4PZ8A 4BXXG 3MZ5A 2R93H 1FGBD 1RIPA 2UXBQ 3STBD 3NTIA 1PZKD 1VDZA 4ME3A 1LT3D 2KVMA 1K8GA 2LXJA 1Y14B 1A15A 3J7AF 4X62Q 3SVMA 2O5JC 3VYSA 5C44H 1YJ9A 2B2YA 1B9MA 3J81E 3R2TA 2C9OA 2K5DA 5CMDA 1DONA 1X55A 5CV8A 3TBIB 1QILA 3K57A 4DV3L 2RDFA 2YTYA 3EFXD 4TKOB 1WTXA 1UNSA 1AN8A 3I8ZA 1XMQL 4KHPL 3E3XA 4DR1Q 1A3TA 1BO0A 5ELOA 3I3CA 3Q24A 1SE4A 5JEAG 3NUCA 4Y7NB 5E7NA 1O7YA 3HKZB 5CORA 1CSQA 1AP0A 5C4JB 1RJTA 3CCRA 2A6EC 3NWSA 3HOYB 4FF3A 5IGBA 3GD7A 1JJGA 1STNA 1DCZA 4LJZC 2K14A 4DFAA 2F0PA 1GUNA 4GKJL 5IYCG 2Q2TA 1KAWA 1NAPA 1SYEA 2KOLA 2RCNA 5FLXc 1EQTA 1S5CD 3HOYG 1NSNS 2NBFA 3C3LA 3CPFA 1ZKOA 5M3MB 4HJ8A 4LF4Q 1I6HB 3R93A 1CQFA 1OO9B 3SR1A 1OTCA 3GQBA 2OQ0A 2PNHA 4N8FA 1B50A 1BOSA 3GTMH 3BZCA 1FNWA 2JA8H 2XIWA 2I07B 3I4NG 1EEFD 3CC7A 4A75A 2UU9Q 3J7A5 2CWAA 2QCPX 4QIWB 5M3MH 1I6HH 2JA7B 3MFGA 1XNRL 4OWWB 3DLLA 1K0SA 4A93G 3MHBA 4FF2A 1LYLA 3A8IE 3GTLH 5I6YA 2JA7H 1A63A 1YHBA 2F0KA 4XYOA 1A2TA 1MSHA 1Z6HA 1N36L 4MNOA 2AWOA 3W5OA 2H5XA 3KDFB 2QGQA 3AU7A 3STBC 3TN2A 2VQFL 4LF8Q 1JC7A 1ICWA 1CKNB 2A68C 4JI6L 2PQEA 1UUPA 1ILPA 2VUMB 4JV5Q 4KY6A 5IP9G 1AFPA 3GO5A 2BA0A 1RF2D 3TREA 4CKBA 1PYWD 5IGGA 3HOXG 1CZWA 5EPJA 1Y69U 2KEDA 2UUAL 1D5ZC 3CC4A 2VUMH 3C1EA 3MVVA 3EVQA 4R9WA 3S16B 1RDPD 1R4PB 1DXMA 1FD7D 1XMQQ 4KHPQ 4ODGA 1XPOA 4DR7L 1X3FA 4JOIC 1L1OB 2E2HH 4B9XA 3NBHB 3VYTA 4RMFA 5M5YB 4JBWA 5J22A 5CV4A 5C0XJ 3NEMA 2YYZA 3VR5A 3T4AC 2ZXPA 4XQJA 3T1YL 1B3AA 1H9RA 3DHQA 3H94A 1HFNA 4A3JH 2F4VL 1QB5D 4BY7B 4GKJQ 1TR5A 1LTAD 5C4XG 5FJ8H 4A3KB 2N88A 1J9OA 1TT2A 2DNEA 4EQNA 2PI2E 1E2VA 3E9IA 5IYDG 2G5DA 4BY7G 4A3EG 4OIJA 1GUGA 4A3KH 2AQ3B 2Z6BA 2IY5B 4DR5L 1XNRQ 4A3GB 2Z6KA 1SNCA 3I2ZA 4LF7Q 1W2BA 1PYBA 4FP5D 3CAMA 3CMAA 1X3GA 3K7AH 1CKOA 1C9OA 1G6PA 1GHJA 3RZDH 3MC0B 4YCWA 3M85A 5BN3A 5CBAE 1N36Q 4X65Q 4DKAC 2MJ8A 3A8JE 2NZOA 4YHHL 3UI2A 1KL9A 2B3GA 1LUZA 2PMZE 4ME5A 4JI6Q 1VQ9A 1S5FD 2F0FA 2HD3A 4KY7A 1VQPA 2N78A 2RVLA 1S5BD 4P2CB 5KNBA 1VQIA 4AIMA 1ENCA 5GAHC 4M8AA 1R9TB 4ZK9B 3D4WA 3GTPB 2FINB 1DGSA 1F9SA 2LS01 4HAEA 4LFBL 3OW2A 2UUAQ 2A73B 1SE2A 2MNAA 4C3HB 2HT1A 2L55A 4HMJA 1RCVD 1K83H 2F0SA 4ABNA 1DD2A 4U68A 3TZUA 1R9TH 3K59A 4YIJA 3GTPH 3J81i 3H09A 3E0EA 3CCEA 1I50H 4C3HH 2OEOA 1XXGA 1WTQA 2CQOA 4DXGA 1L1OC 2FMCA 3KLSX 1WCMG 4A3CH 1K3BC 1TXYA 2JJQA 2K03A 3OOCA 4KI0A 5CV6A 1F9QA 3KLWA 2ZXRA 3H6MA 1TQOA 4JI1L 2KHSA 2R92G 5C0XI 2I0QA 5JJZA 3D3RA 3AFQA 1NR4A 3S1RB 2UXDL 3T1YQ 4O42A 3CU7A 4DV1L 2F4VQ 2NN6I 2SNMA 3FP9A 3TS0A 3S2HH 4QMGA 5FLMH 2B2UC 1CKMA 4XQNA 1B4OA 1LT5D 4JI3L 2N8NA 3FPPA 3S1QH 1EL0A 2WIIB 5JEAJ 1ET6A 5D14A 3QWNA 3PO2H 4A3MG 3J81j 4IPDA 2EQSA 2EY6A 4OO1I 1SNOA 5D3IB 4XQQA 3PF5A 2R6GA 2F0VA 1STBA 2VNUD 5C3EB 4EQPA 1FR3A 2ENBA 3A7AB 5FO8B 1G2TA 5I6WA 1VQGA 4R8IA 2Z0SA 4DAYB 2B2YC 1A2UA 1E22A 1KNEA 2K32A 4LW1A 3MTSA 2BH2A 2E2IB 2QEJC 3OYYA 4DNTB 1BBUA 1B70B 1PV4A 4DNRB 4YHHQ 3KYHC 1KRTA 4CJ0B 5C5LA 1GJXA 1H95A 3ERQA 1JORA 1K0RA 4X3TA 2F0UA 4LF5Q 2R7ZG 1Q86C 3PIO3 2E2IH 2L4NA 2L9HA 3DUZA 5IGDA 3S14B 3KLSA 3I55A 2EJFC 1RL2A 5KYLA 5CBEE 4POGA 2R7FA 4KHZA 3WDNA 4LFBQ 2Q2IA 1YVCA 4PMCA 4P73A 1F2LA 4LNQA 3D4RA 5M3FB 3GTQB 4ZYSA 3G4SA 4BBSB 1TWFH 3H0GG 3OWFA 2CH4W 2G9HD 4HIKA 2EY1A 5LMNW 3UDFA 2J4XA 1JQYD 4KY5A 4O2DA 5M3FG 4DV0L 1PFNA 4IOCA 1IBLL 1B3QA 4DV7L 4B3ML 5IGCA 4BBSG 1CT1D 3NWTA 2GVAA 4ZRZA 2O5IC 1MIUA 1FNUA 3GDEA 4HN7A 1VQKA 2K5VA 1VQ7A 3KUPA 3K7UC 3C1FA 1I4HA 2E76C 3PUWA 3NPPA 2RHQB 1QZGA 4L5TA 3HOUG 3C2PA 4I65A 4XIGS 5IGFA 4C3JG 1Y1WG 1OXUA 2D5DA 1MJCA 1L0YB 4JW0A 4AYBB 4POFA 4JI5Q 2F0HA 1M4VA 5JJLA 4F88A 4JI3Q 1VMCA 4HIOA 3TEHB 1AH9A 1U4RA 1FJGL 2D62A 2GN5A 4XXEA 4HJAA 4G4KA 4LUZA 3MAQA 3PO3H 3I90A 2EYOA 4A76A 1Q8KA 5FLXL 2E5LL 1IBKL 4CJ1B 2B8GA 3I4MB 2A69D 3T53B 1K9MC 1Y8PB 1GM5A 5FO9B 2XRQD 3F2UA 1K8MA 1DM0B 1LABA 1LTSD 2R7DA 4JI0L 3KBGA 1SFOH 1E7ZA 4XYQA 1TWGB 4R4QA 3S17H 3G7LA 1VF5C 4E6IA 4L5SA 1I6VC 4A3DH 2XVSA 2VS1A 2IT1A 5HY6A 1QVFA 1BF4A 4UDUC 2KQ3A 1TWGH 1VQAA 3A0JA 1GO3E 4XT1B 4RGOS 3UDXA 3A5UA 4HCSA 1RD9D 2O4XA 2H1EA 1NE3A 1CHQD 1F2MA 1HCZA 1M8AA 5G3LF 2IPKD 4EX5A 2PCFB 5T1GA 3DEPA 2L5TA 1LTBD 1VQNA 1BR9A 1XMOL 1N9WA 1W6JA 3A5ZB 1XPRA 5DEHA 1Y8NB 1TS5A 4J8QA 4GNXB 4QCLA 1LV9A 1ZXTA 4DV0Q 1IBLQ 4U673 5M5WH 4DV7Q 1VQ4A 4RGNA 2E2JB 4FNFA 4OIKA 3GTOH 3MXNB 1X3PA 3ITPA 4QB4A 2VZAA 1PYSB 3LWEA 2JA6B 1JR0D 1OXVA 2ZJPA 2Z6KC 2VQEL 4NP5A 2IHFA 1U4LA 1HPCA 1N34Q 2C5CA 4C3IG 1CQVA 2Q2HA 1WD1A 3KF6A 3AEVA 1A3VA 2Z8LA 1EQQA 1KDBA 2JA6H 3MWYW 4KN7C 5I2XA 3N52A 2A69C 3GTGH 1C4QA 4NB3A 1FJGQ 4FDBA 1S3OA 4IO9A 4ZAIA 3HKZE 1RTOA 1FYCA 2E5LQ 2KHIA 1IBKQ 1VCIA 5J1ZA 3M9BA 5CGKA 1KC8C 1N33L 4DR3L 1D1IA 3M3YH 1EEID 4A3IB 4JI0Q 5EBCA 5C0XH 2ZTDA 3W1GA 2CHBD 2DY8A 2F0DA 1UEBA 1GXDC 3HRZC 1MGSA 5CV5A 1SYFA 1RODA 3CP0A 2BA1A 1HQRD 1D5XC 4DUYQ 3DEOA 1C7YA 2XTIA 2NN6H 3J7AV 3AYHB 4KD3A 4A3IH 4K8IA 1V9PA 1XTCD 1B8AA 1EOTA 1WOCA 3HOWH 3HOZB 4JI7Q 1EYCA 1SROA 4QIWE 2FJ2A 1OXSC 2M9VA 3T13A 2NVXB 5GAEC 1TWAB 1SNMA 1Y1VG 3SK8A 3S15B 3EA6A 1H9SB 1EY5A 3U9SA 1UWVA 3HOZH 2IWHA 2HUGA 4FXGC 1LTTD 2WINB 4JK1C 2HIXA 3JC66 4C2MB 4BS9A 1JOKA 1V1PA 1SBBB 1V8QA 2JN4A 2E8GA 2NTTA 4BBRB 1PA6A 3LGJA 4C2MH 2HDMA 2EYFA 3CPWA 1RKNA 3S1MB 1G6ZA 2F4IA 2F0WA 3A55A 4HSVA 3DWQA 1RTNA 3Q0AA 4DV5L 2KHJA 2VQEQ 1HHVA 3PSIA 1N32L 3RUZA 3I70A 3TRZA 2K75A 5JOBA 1QJOA 3S1MH 4DAPA 2VW9A 4B9WA 2R93G 4H13C 4A3LH 4NW2A 2GVBA 1PTOF 5FLXE 3HS0C 3PUVA 5IYBG 1EWIA 5IWAL 4IUNA 4ZLTF 1QUQA 3FKIB 4DU9A 3K0XA 2K5HA 5EJWA 5C44G 1L0XB 2N55A 1I94L 3HFZB 2PPBC 3OW7A 4O1NA 4KJOA 2Q2UA 1N33Q 4DR3Q 2LMCB 2A1AA 1YNJD 4ZCKA 4DK0A 5IOCA 4FVMA 1BBXC 1VQJA 5GADC 3FKIH 1HH2P 4K8JA 4KK7A 4PQXA 3BDCA 3AFPA 1SYGA 5JAVA 1O7ZA 2B29A 3VR2A 3F1ZA 1G8ZD 1IXRA 2J7ZA 3NSWA 5IT9L 1LT6D 1CFMA 3AMUA 3VYUA 1E1OA 1PDQA 1S5ED 3BDLA 2PZUA 3PCOB 5EKKA 4QJFA 2G9DA 1UE5A 2O2LD 2QDLA 3HKZG 4MTKA 2HCIA 3CMEA 3GTMB 2JA8B 5ELCA 1NJIC 1STHA 1GVPA 4WJ3M 1SNQA 3SK5A 4V190 1WD0A 1QG7A 3W1BA 2AHOB 3CCSA 1JE4A 1X6OA 1WTOA 1B7YB 4EQOA 3I91A 1TWCH 5KRUA 5G3LD 2LY7A 5M3MG 3GTLB 3QO2A 5IYCH 4L6TB 4RGTA 3T1HL 1PH3A 1YHAA 2QEXA 1HNZL 3K5LA 3EBEA 5KNDA 3P7JA 1QVGA 1U4PA 2VY3A 2PNRC 1LTLA 2F0IA 4A4IA 2F0NA 3A56A 2JA7G 4DV5Q 2KENA 3T16A 1EYDA 1JWSD 2KCCA 2XNAC 1N32Q 3A7LA 5JJKA 2TSSA 1ZYRD 1EY0A 4K2LA 4L63B 1SSOA 3URYA 2JYOA 4RFBA 1HZ9A 2DN8A 2M2LA 5JJIA 2F0TA 1JE5A 1WTVA 1KQSA 3HOVB 1EIFA 5IWAQ 2Y0SB 2PZWA 2L1BA 1YNJC 3TP7A 1UE7A 3TSSA 3QR8A 2K04A 2VUMG 2E2HB 3DMUA 1WYDA 1NUCA 1I94Q 5I9PA 2DJGC 4DV3Q 3HOVH 4FF4A 2IX3A 2EE1A 4LFAL 1TY2A 2AKWB 5FK9C 3KF8A 5IP9H 4A3FH 3RMHA 5HGTA 5C3WA 2JE6I 1KNAA 3HP3A 1CA6A 1S4ZA 3HOXH 4HCEA 1YIJA 4KKUA 4A3JB 3L9AX 5DM63 2PI2A 1QOHA 1S72A 1KDAA 1MBYA 5EPKA 3S2DH 1W6KA 1SXTA 1EY9A 1FVIA 1G51A 2KA7A 1HUNA 1VQHA 1LLRD 1IKMA 1TIID 3CC2A 3RLFA 3KJOA 4BA2I 5ELBA 2JA5B 3EN2A 3PUXA 4V0BA 3K7AB 4K0KL 4A3KG 3BS1A 3RZDB 5EKLA 5C5MA 4ULLA 1ESRA 4KKSA 4PMWA 1Z7TA 4PZ7A 3CQZB 2JA5H 3PIOA 3T1HQ 1HNZQ 3CCMA 3M4PA 5IYDH 1ZYRC 2E75C 2CW0D 1ILQA 5TSSA 4HR7B 2WP8J 1HFGA 1I4XA 4A3GG 4IFDG 1FGUA 2B2VA 3CQZH 2YTXA 1JMCA 2WB1B 3H91A 3KBXA 4QGUA 4ALPA 4HJ7A 1DOKA 2VQFQ 1YHQA 2NVYH 1Q1BA 1SLJA 4DR4L 1C0AA 3PF4A 4JC0A 2AMCB 3J80L 1K83B 1X3QA 1PTOB 2K01A 2WB1G 4WJWA 2UXCL 3I73A 1ML0D 5J39A 2AUJD 1PRTD 3K0YA 2QW7A 1QWYA 4RA8A 2K5WA 1YZ6A 3FPUB 1SEBD 1I50B 2KCNA 2ZT9C 1PTOH 3PUZA 1PTOD 5IP7G 2EJMA 5CV7A 5COYA 4LFAQ 2K05A 1PXUA 2TMPA 2RHSB 3H3VH 4DR7Q 2BDNA 4RGMA 4C3HG 1U9RA 4AYBE 1H9KA 3OSOA 4QUFA 1VF7A 4IZ8A 5IT9E 4A3CG 4GLAC 2NZ1D 4FYDA 2KCTA 2WACA 5EQ0A 2JP1A 3S2HB 1FL0A 3KLRA 1LACA 1UE1A 5E1FA 1P8LA 3JAML 4GLVB 2VXWA 3S1QB 3OIPA 1VQCA 2JK8A 3PO2B 1KD1C 3QB3A 4XTCS 1Q12A 1WCMH 1O7IA 1EZ6A 3E9HA 3BU2A 2EZVA 1W3SA 1ET9A
chains in the Genus database with same CATH topology
1HTLD 2AQ2B 2AUKA 1EQVA 5EPLA 1CA5A 2XN9C 1JWMD 2CW0C 2XWJB 3N6RA 1SMYD 2PZTA 2HCCA 4X3SA 2E74C 4TRDA 3GV3A 3L7ZC 2JSOA 3GV6A 1WTPA 1EY6A 4BY1B 4M1UB 3E5SA 1PRTC 4MIUA 4R8NA 2FMMA 3NE5B 2F0GA 4K2KA 1S5DD 2F0EA 1PTOC 1B2TA 1TWFB 4OHJA 4ZUIA 3C46A 1O78A 3S9WA 1HA5A 5D3DA 3AB9A 5BN4A 4IQZA 2CVRA 4K5VA 2EDGA 3P1HA 3SE0A 2HQEA 1YNND 1LT4D 5NUCA 3LWUA 1IHZA 2NUCA 4KTAA 1SJHD 2B2TA 2BOSA 1LO5D 1EY8A 1T5EA 5CYUA 1BNZA 1PZID 5I4DA 1EIHA 4F7XA 3M7GA 4TSSA 2K28A 1CHPD 1I4PA 3VR6A 4IUTA 3PO3B 3K5OA 2L11A 1G2SA 1NCVA 5T1IA 1WTRA 3EQLC 3K5MA 2NVQB 1SMYC 1AZPA 4LK1C 3VR3A 1DZ1A 1I4QA 3CRKC 1SFOB 1JOQA 3W2DA 2OF1A 4X3KA 2LFNA 1UEAB 1GUTA 3S17B 3LNNA 2FHTA 4LMQD 4A3DB 5DM73 4CHTB 3D4DA 4F87A 4UAIA 1BCPF 3BYYB 2B2WA 2F3VA 4IURA 4IUVA 5BN5A 1TS2A 4J1MA 2EOTA 5A35A 4PNYA 1D6EC 2A6HD 4LAAA 3K6OA 5C4HA 1AEXA 3K5NA 4ZQ3A 2EPBA 4IUQA 3R8BA 2F0JA 5K36G 2QF7A 2K1BA 4RCNA 3NQIA 1YNNC 2MHVA 1G91A 5M5WB 4IFDJ 3GTOB 1EZ8A 1HA6A 3G6JB 1JB3A 3ONAB 1QNKA 2IW3A 2FFKB 4DF7A 5C6AA 2EVBA 3OMGA 4IUPA 2PYKA 3JAME 3QOJA 3IL8A 3HGBA 1Z47A 3GTGB 1SNDA 2F0OA 3L3OC 2X69A 1MSGA 3IFDA 5EKIA 2B2VC 1AZQA 1I3QB 4MN3A 2EY5A 3PIP3 3M3YB 5HURA 1KLGD 1X32A 2R3ZA 1R4QB 1Q8IA 2WV6D 4KMUC 4N9PA 1WVLA 2A6HC 1KABA 3HOWB 3WOEA 5IODA 5IGEA 2NB0A 4ZKCB 2AWNA 2F0QA 2NN6G 5KEEA 2Q8RE 1F77A 3NXWA 2MPMA 4CKEA 2EYJA 5ELDA 4F8MA 3MA2B 2B39A 2EYHA 2ICIA 5EBDA 3SK6A 4OO1G 2A74C 4CKCA 3NTKA 4IFDI 1HUMA 2HDLA 4NKLA 5ISRA 1TY0A 4G7HC 3NTHA 2M00A 3NP8A 3E0JA 4IALA 1DOMA 2NYZD 1Q1EA 4GZYC 3U9OA 1HXYD 3ND8A 3K58A 3GTJB 1PRTF 1CI3M 5FKAC 3LX0A 4C1NK 5C3XA 4X3UA 4A3BB 4ZKBB 1MI2A 3BZDB 1SYCA 1JCKB 2VB2X 4HEDA 1B53A 3MEHA 1O7LA 1BCPB 3RZOB 2XRSD 2MP1A 3DXJC 1STEA 2I46A 5M9OA 2A68D 4IN3A 1TS4A 1RHPA 1BCPD 2B8FA 1SNPA 3NK9A 4K14A 1VMPA 4RKBA 2K5QA 1AW7A 1JOOA 1MD2D 1K8OA 5E3FA 3PV0A 3TMEA 5E4WC 2B2TC 5JEAH 2RDHA 3M7NA 2VB3X 3E6ZX 1TWCB 3CKIB 5KIXA 1GUWA 4KD4A 4XT3B 4I7ZC 5KNCA 1Q90A 4BA1I 3VYRA 4WRDA 4RH6A 4S3SA 1BUVT 1SYDA 3I4NB 3KK7A 1HQMC 4A93B 3T51B 1GHKA 5AFWA 1KLUD 1IL8A 3V96A 1F9PA 1ENAA 2QDBA 3VA7A 4ILWA 3V05A 3BVZA 2B2WC 4CJ2C 2Q8TA 2EY2A 2Z1CA 4A3FB 2ICEC 1F2YA 1EFID 1QE6A 2WAQB 3HOXB 2LKVA 4C56C 2JEBI 1FNVA 3V2TA 1BCPC 3S2DB 3A54A 1Y8OB 5A2QL 4H0LC 2K6AA 1H9JA 1ZEQX 2IJ0A 1B9NA 4DAYA 4B08A 2Q8IB 4OGQC 3TP6A 1IYVA 1V1PB 4DXFA 4G57A 4L8JA 3DWPA 5I9OA 4NDXA 1E2WA 1KDCA 4BWGB 4FXKC 1V1OA 3NBIA 1PMRA 1LTID 3Q22A 5C4XB 1PFBA 1H9MA 4KKTA 1EU4A 4A3EB 4RHSA 3QJYA 3W3AA 3I4LA 1LTGD 1CM9A 5KGUA 3X3NA 4XDXA 4MHEA 2RSOA 1CTMA 2NVYB 4FXDA 3T56B 1B1ZA 1EWCA 1Q3LA 2K33A 3QIAA 1IKLA 3HZXA 1PRTB 3FVQA 3HEJA 2RQXA 3Q6SA 3R3OA 4RAUC 5CV9A 3MFYA 1EU3A 3FDTA 3PUYA 3EROA 5EGTA 4PMBA 5DNFA 2EYLA 4IFDH 2PW5A 1II3A 3FMCA 4OL7A 2WKDA 3J7YW 1PZJD 4DAVA 2X6GA 3OHXC 4HMIA 4CGYB 3IFTA 4PV1C 1T5XD 4WORA 2A5HA 1D1KA 4K6LA 5E4XA 4WFN3 5JVH3 1TWHB 4HSPA 3MXGA 2BDOA 1WCMB 3D6CA 4RCOA 1DJRD 3ZYYX 4QF4A 1SYBA 2R92B 2V4DA 1NR2A 4RWSC 5JPMC 4G7OC 1TU2B 2NTSA 5JPNC 2DY7A 3BDOA 1PLFA 2RKSA 2EJGC 2RDGA 2D2CC 3IAYA 3GP7A 4A3MB 2R61A 2SOBA 1KTKA 3A8KE 3VR4A 3I72A 1STYA 4DN4M 3MXNA 4DK1A 3CRLC 1B44D 5K5PA 3RD4A 1I4GA 3BVMA 5JVG3 1LTRD 3TP5A 2Z4IA 3BVGA 2J0TD 4CBVA 2KEEA 1DYQA 2BE5D 2EYPA 4H7BA 2PO4A 3SHLA 4ID6A 2R7ZB 3IKJA 3WOFA 2DNCA 1ESFA 1IYUA 2ZXOA 1OXTA 3H3VC 4Q0FA 2AQ1B 2B63B 1QCBD 1STAA 2F0LA 1XYIA 3S1NB 5D65A 2RA4A 5A2QE 2ID0A 2NVTB 2NWGA 3H0GB 2E2DC 1EY7A 1E0BA 1GUSA 1CK1A 5F2DA 1O80A 2PMZB 4G7ZC 3VA5A 1E2ZA 4HTHA 4KHVA 3OMCA 4IUUA 4QUCA 2KJXA 1F2ZA 2SEBD 3HOUB 2PW7A 4NMZA 4C3JB 1Y1WB 2SNSA 2WKCA 1H9SA 3TZDA 2F3WA 4K5XA 1ONLA 1WTWA 5LL6X 4EVOA 3EJIA 5ELFA 1TKWB 3Q23A 3X3MA 4N9TA 4TQUS 2OT2A 3SEBA 1PFMA 1DOLA 3BG3A 1BDOA 1UAPA 2IL8A 2BE5C 3OWEB 3J80E 3J81L 4ZUJA 1EIGA 1JWUD 2F1MA 4Q5VA 5DAUA 3R2IA 2JEAI 1C48A 1A6XA 3BYTB 5ELEA 3HG9A 1D2BA 5FOBB 3QG1A 2YU9B 2EXZA 1STGA 2F03A 4DGZA 3TP8A 5CR3A 5K36H 2X6LA 4FF1A 2MUYA 1ENFA 2CQAA 5CC4A 3PMFA 3FRPB 3OIQA 2Z4HA 3P20A 2GA4B 4J6HA 2IX1A 4Z9CB 3SK4A 4C3IB 2EYMA 1HRJA 1HTPA 3NHHA 3P75A 2D9UA 5FO7B 2SDFA 3DM1A 1GUOA 3D6WA 3M4YA 4C1NI 1IW7D 2F0MA 3NQTA 1G291 2IX0A 3SDZA 1C8CA 4K5WA 2JXMB 2L0CA 1TVXA 2QKIC 5C0XG 1CZGA 2RBMA 2QILA 1D5MC 2KECA 1SJED 3O13A 1QNUA 1TS3A 4DA2A 4KV6A 2MGSA 3D8GA 1XX8A 1OXXK 4RKLA 3SXHA 1EYAA 4K6DA 4EGVA 5M5XB 2OXPA 3M4OB 1KAAA 2XWBB 4H44C 4KJNA 1BQQT 1Y1VB 1SDFA 1F9RA 2RSNA 1EWHA 5LHY1 2H4OA 2K7VA 2A6ED 3GTKB 1GOZA 1V43A 4OO1H 3OPOA 1BXTA 3MXPA 1A3UA 3MXUA 3NBHA 5KYIA 1JICA 3CHBD 3D31A 2L12A 4KN4C 3FEWX 1EY4A 5I2YA 2KUMA 1SAPA 4RHRA 1J8IA 3QOLA 2B2UA 5C4ZA 3DWAA 2XSCA 1IW7C 3TDQA 1U4MA 2R93B 2BCOA 1I4RA 5LL6S 1XWEA 5IIFA 3ND9A 4FO2A 1SE3A 5C44B 3MZ5A 1FGBD 3NTIA 1PZKD 1VDZA 1LT3D 2KVMA 1A15A 3J7AF 3SVMA 2O5JC 3VYSA 2B2YA 1B9MA 3J81E 3R2TA 2C9OA 2K5DA 5CMDA 1DONA 5CV8A 3TBIB 1QILA 3K57A 2RDFA 3EFXD 4TKOB 1WTXA 1UNSA 1AN8A 3I8ZA 1A3TA 1BO0A 3I3CA 3Q24A 1SE4A 5JEAG 3NUCA 4Y7NB 1O7YA 3HKZB 5CORA 1AP0A 5C4JB 1RJTA 2A6EC 3NWSA 3HOYB 4FF3A 5IGBA 3GD7A 1STNA 1DCZA 4LJZC 4DFAA 2F0PA 1GUNA 1SYEA 1NAPA 2KOLA 1EQTA 1S5CD 1NSNS 2NBFA 3C3LA 1ZKOA 5M3MB 1I6HB 3R93A 1CQFA 1OO9B 3SR1A 3GQBA 1B50A 1BOSA 1FNWA 2XIWA 2I07B 1EEFD 2QCPX 4QIWB 2JA7B 3MFGA 3MHBA 4FF2A 3A8IE 5I6YA 2F0KA 4XYOA 1A2TA 1MSHA 1Z6HA 2AWOA 3AU7A 3TN2A 1JC7A 1ICWA 2A68C 2PQEA 1UUPA 1ILPA 2VUMB 4KY6A 1AFPA 3GO5A 2BA0A 1RF2D 4CKBA 1PYWD 5IGGA 1CZWA 5EPJA 1Y69U 2KEDA 1D5ZC 3C1EA 3MVVA 3EVQA 4R9WA 3S16B 1RDPD 1R4PB 1DXMA 1FD7D 4ODGA 4B9XA 3VYTA 5M5YB 4JBWA 5J22A 5CV4A 5C0XJ 2YYZA 3VR5A 3T4AC 2ZXPA 4XQJA 1B3AA 1H9RA 3DHQA 3H94A 1HFNA 4BY7B 1QB5D 1TR5A 1LTAD 4A3KB 2N88A 1J9OA 1TT2A 2DNEA 4EQNA 1E2VA 4OIJA 1GUGA 2AQ3B 4A3GB 1SNCA 4FP5D 1GHJA 3MC0B 3M85A 5BN3A 5CBAE 2MJ8A 3A8JE 3UI2A 4ME5A 1S5FD 2F0FA 4KY7A 2RVLA 1S5BD 4P2CB 5KNBA 1ENCA 4M8AA 1R9TB 4ZK9B 3D4WA 3GTPB 2FINB 1F9SA 2LS01 4HAEA 2A73B 1SE2A 4C3HB 2L55A 4HMJA 1RCVD 2F0SA 4ABNA 1DD2A 4U68A 3TZUA 3K59A 4YIJA 3H09A 2OEOA 1XXGA 1WTQA 4DXGA 2FMCA 3KLSX 3OOCA 2K03A 4KI0A 5CV6A 1F9QA 2ZXRA 3H6MA 1TQOA 2KHSA 5C0XI 5JJZA 3D3RA 1NR4A 3S1RB 4O42A 3CU7A 2NN6I 2SNMA 4QMGA 2B2UC 4XQNA 1B4OA 1LT5D 3FPPA 1EL0A 2WIIB 5JEAJ 1ET6A 5D14A 3QWNA 2EY6A 4OO1I 1SNOA 5D3IB 4XQQA 2R6GA 2F0VA 1STBA 2VNUD 5C3EB 4EQPA 1FR3A 2ENBA 3A7AB 5FO8B 1G2TA 5I6WA 4R8IA 2B2YC 1A2UA 2K32A 1KNEA 3MTSA 2E2IB 2QEJC 4DNTB 4DNRB 4CJ0B 5C5LA 1GJXA 3ERQA 1JORA 4X3TA 2F0UA 3PIO3 2L4NA 2L9HA 3DUZA 5IGDA 3S14B 3KLSA 2EJFC 5KYLA 5CBEE 4KHZA 3WDNA 4PMCA 1F2LA 3D4RA 5M3FB 3GTQB 4ZYSA 4BBSB 3OWFA 2G9HD 2EY1A 2J4XA 1JQYD 4KY5A 1PFNA 5IGCA 1CT1D 3NWTA 4ZRZA 2O5IC 1FNUA 4HN7A 3KUPA 3C1FA 1I4HA 2E76C 3PUWA 3NPPA 3C2PA 4I65A 4XIGS 5IGFA 4C3JG 1OXUA 2D5DA 1L0YB 4AYBB 2F0HA 1M4VA 4F88A 1VMCA 1U4RA 2D62A 4XXEA 4G4KA 3MAQA 3I90A 2EYOA 5FLXL 4CJ1B 2B8GA 3I4MB 2A69D 3T53B 1Y8PB 5FO9B 2XRQD 3F2UA 1K8MA 1DM0B 1LABA 1LTSD 3KBGA 4XYQA 1TWGB 3G7LA 1VF5C 4E6IA 1I6VC 2XVSA 2IT1A 1BF4A 4UDUC 2KQ3A 4XT1B 4RGOS 4HCSA 1RD9D 2O4XA 2H1EA 1CHQD 1F2MA 1HCZA 1M8AA 5G3LF 2IPKD 2PCFB 5T1GA 3DEPA 2L5TA 1LTBD 1BR9A 1W6JA 5DEHA 1Y8NB 1TS5A 4J8QA 4QCLA 1LV9A 1ZXTA 4U673 4RGNA 2E2JB 4FNFA 4OIKA 1X3PA 3ITPA 4QB4A 3LWEA 2JA6B 1JR0D 1OXVA 4NP5A 1U4LA 1HPCA 2C5CA 4C3IG 1CQVA 1WD1A 1A3VA 2Z8LA 1KDBA 3MWYW 4KN7C 5I2XA 3N52A 2A69C 1C4QA 4ZAIA 1RTOA 1FYCA 1VCIA 5J1ZA 5CGKA 1D1IA 1EEID 4A3IB 5EBCA 5C0XH 2CHBD 2DY8A 2F0DA 1GXDC 1MGSA 3HRZC 5CV5A 1SYFA 1RODA 2BA1A 1HQRD 1D5XC 3DEOA 2NN6H 3J7AV 4KD3A 4K8IA 1XTCD 1EOTA 3HOZB 1EYCA 2FJ2A 1OXSC 2M9VA 3T13A 2NVXB 1TWAB 1SNMA 3SK8A 3S15B 3EA6A 1H9SB 1EY5A 3U9SA 2IWHA 2HUGA 4FXGC 1LTTD 2WINB 4JK1C 4C2MB 4BS9A 1JOKA 1V1PA 1SBBB 1V8QA 2NTTA 4BBRB 2HDMA 2EYFA 1RKNA 3S1MB 1G6ZA 2F4IA 2F0WA 3A55A 4HSVA 3DWQA 1RTNA 3Q0AA 1HHVA 3RUZA 3I70A 5JOBA 1QJOA 4DAPA 4B9WA 4H13C 4NW2A 1PTOF 5FLXE 3HS0C 3PUVA 4IUNA 4ZLTF 3FKIB 4DU9A 5EJWA 1L0XB 2N55A 2PPBC 3OW7A 4O1NA 4KJOA 2LMCB 5IOCA 1YNJD 4DK0A 4FVMA 1BBXC 4K8JA 4KK7A 4PQXA 3BDCA 1SYGA 5JAVA 1O7ZA 3VR2A 1G8ZD 2J7ZA 3NSWA 5IT9L 1LT6D 1CFMA 3AMUA 3VYUA 1PDQA 1S5ED 3BDLA 2PZUA 5EKKA 2G9DA 2O2LD 2HCIA 3GTMB 2JA8B 5ELCA 1STHA 1SNQA 3SK5A 4V190 1WD0A 1QG7A 1JE4A 1WTOA 4EQOA 3I91A 5KRUA 5G3LD 2LY7A 3GTLB 3QO2A 4L6TB 4RGTA 3K5LA 5KNDA 3P7JA 1U4PA 2PNRC 2F0IA 2F0NA 3A56A 3T16A 1EYDA 1JWSD 2KCCA 2XNAC 3A7LA 2TSSA 1ZYRD 1EY0A 4K2LA 4L63B 1SSOA 3URYA 2JYOA 4RFBA 2DN8A 2M2LA 2F0TA 1WTVA 3HOVB 2Y0SB 2PZWA 2L1BA 1YNJC 3TP7A 3TSSA 2K04A 2E2HB 3DMUA 1NUCA 5I9PA 4FF4A 2IX3A 2EE1A 1TY2A 5FK9C 3KF8A 3RMHA 5HGTA 5C3WA 2JE6I 1KNAA 3HP3A 1CA6A 1S4ZA 4HCEA 4KKUA 4A3JB 3L9AX 5DM63 1QOHA 1KDAA 1MBYA 5EPKA 1W6KA 1SXTA 1EY9A 2KA7A 1HUNA 1LLRD 1IKMA 1TIID 3RLFA 4BA2I 5ELBA 2JA5B 3PUXA 4V0BA 3K7AB 3BS1A 3RZDB 5EKLA 5C5MA 4ULLA 1ESRA 4KKSA 4PMWA 1Z7TA 3CQZB 1ZYRC 2E75C 2CW0D 1ILQA 5TSSA 4HR7B 2WP8J 1HFGA 1I4XA 4IFDG 2B2VA 2WB1B 3H91A 3KBXA 1DOKA 1Q1BA 3J80L 1K83B 1X3QA 1PTOB 2K01A 4WJWA 3I73A 1ML0D 5J39A 2AUJD 1PRTD 3K0YA 1QWYA 4RA8A 2K5WA 3FPUB 1SEBD 1I50B 2KCNA 2ZT9C 1PTOH 3PUZA 1PTOD 2EJMA 5CV7A 5COYA 2K05A 1PXUA 2TMPA 2BDNA 4RGMA 4C3HG 1U9RA 1H9KA 3OSOA 4QUFA 1VF7A 4IZ8A 5IT9E 2NZ1D 4FYDA 2WACA 5EQ0A 2JP1A 3S2HB 3KLRA 1LACA 5E1FA 3JAML 2VXWA 3S1QB 3OIPA 3PO2B 3QB3A 4XTCS 1Q12A 1EZ6A 2EZVA 1ET9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  3MHB A;  5CC4 A;  5M9O A;  3PMF A;  5F2D A;  1JOQ A;  2OF1 A;  3T13 A;  1STH A;  2KQ3 A;  1EQV A;  4J6H A;  3VA5 A;  5I6Y A;  1SNQ A;  1SNM A;  3D6C A;  3QOL A;  4HTH A;  4KHV A;  3ERQ A;  3OMC A;  5C5L A;  3SK5 A;  3SK8 A;  2F0K A;  5C4Z A;  1JOR A;  1EY5 A;  1A2T A;  2F0U A;  2EYM A;  4N9P A;  3SK4 A;  1F2Z A;  3D4D A;  3TP6 A;  1KAB A;  4QF4 A;  2O4X A;  3NHH A;  1SYB A;  3P75 A;  5EKL A;  5IOD A;  4ME5 A;  4G57 A;  5C5M A;  5IGD A;  2PZT A;  2F0F A;  2PW7 A;  4KY7 A;  4EQO A;  1F2M A;  1SNP A;  3NK9 A;  5I9O A;  5IGE A;  4NMZ A;  4K14 A;  5KRU A;  2F0Q A;  4NDX A;  2F3V A;  5KEE A;  5KYL A;  4RKB A;  1ENC A;  2PQE A;  2SNS A;  4TRD A;  1KDC A;  3D4W A;  5IIF A;  3NXW A;  4J1M A;  4KY6 A;  4PMC A;  2EYJ A;  1JOO A;  2F3W A;  5E3F A;  1EY6 A;  4K5X A;  4PNY A;  1JOK A;  3TME A;  5DEH A;  3MZ5 A;  4LAA A;  2F0M A;  3E5S A;  4F8M A;  5IGG A;  3NQT A;  4HMJ A;  5C4H A;  2F0S A;  3OWF A;  5KIX A;  2RKS A;  2F0I A;  4K5W A;  2F0N A;  4KD4 A;  4MIU A;  2EY1 A;  2EYH A;  4YIJ A;  1AEX A;  4EVO A;  4ZQ3 A;  3C1E A;  3EJI A;  4R8N A;  3MVV A;  2EYF A;  1EYD A;  4KY5 A;  1RKN A;  2RBM A;  3SK6 A;  3T16 A;  3ITP A;  2F0W A;  2F0G A;  4N9T A;  3EVQ A;  4K2K A;  4QB4 A;  1EY0 A;  2F0E A;  4K2L A;  5IGC A;  2SOB A;  5CV8 A;  4WRD A;  2F0J A;  2OEO A;  4S3S A;  4ODG A;  5KGU A;  3RUZ A;  2RDF A;  4ZUI A;  1SYD A;  4NP5 A;  5JOB A;  5J39 A;  1STY A;  5CV6 A;  3C1F A;  2F0T A;  4B9X A;  4NKL A;  3S9W A;  5ISR A;  1EZ8 A;  1A3T A;  3H6M A;  1TQO A;  4KV6 A;  3D8G A;  2KHS A;  1A3V A;  5J22 A;  2M00 A;  3NP8 A;  4I65 A;  4IAL A;  5K5P A;  5CV4 A;  4RKL A;  3SXH A;  1EYA A;  3NUC A;  4K5V A;  1KDB A;  4K6D A;  4B9W A;  5IGF A;  2PZW A;  3P1H A;  4ZUJ A;  3TP7 A;  2HQE A;  3TP5 A;  4DF7 A;  5CV7 A;  5C6A A;  3U9O A;  4IUN A;  3DMU A;  2F0H A;  3HZX A;  1NUC A;  2SNM A;  3OMG A;  3DHQ A;  2OXP A;  5NUC A;  4DU9 A;  5I9P A;  1KAA A;  3HEJ A;  1IHZ A;  4QMG A;  2EYP A;  5IGB A;  1ENA A;  2NUC A;  4H7B A;  2PYK A;  3R3O A;  1TR5 A;  4KJN A;  4ID6 A;  2QDB A;  4KTA A;  5DAU A;  5CV9 A;  1STN A;  3SHL A;  1U9R A;  3OSO A;  4KJO A;  1EY8 A;  5J1Z A;  3QOJ A;  5HGT A;  5C3W A;  3ERO A;  5EGT A;  4DFA A;  4IZ8 A;  1TT2 A;  2F0P A;  4PMB A;  2EYO A;  5CGK A;  5IOC A;  4EQN A;  1SYE A;  2EYL A;  4F7X A;  2WAC A;  3LX0 A;  4K8J A;  1NSN S;  1SND A;  2F0O A;  1STA A;  5C3X A;  2PW5 A;  2EY6 A;  2F0L A;  5E1F A;  1II3 A;  1SNO A;  2EY2 A;  2EXZ A;  1KDA A;  1STG A;  3BDC A;  4OL7 A;  3SR1 A;  1SYG A;  5JAV A;  2F0V A;  1STB A;  2F0D A;  1F2Y A;  3MXP A;  5CV5 A;  3TP8 A;  4DGZ A;  1SYF A;  4HMI A;  5CR3 A;  4EQP A;  2ENB A;  1A3U A;  5KYI A;  1SNC A;  1EY9 A;  2EY5 A;  2LKV A;  1SYC A;  3QB3 A;  4KD3 A;  5I6W A;  1EZ6 A;  1EY7 A;  2PZU A;  3BDL A;  4WOR A;  4K8I A;  4E6I A;  5HUR A;  5EKK A;  3MEH A;  1A2U A;  1EY4 A;  3V2T A; 
#chains in the Genus database with same CATH topology
 3RNU A;  2R92 H;  3CW2 C;  3HKS A;  1HTL D;  3DM3 A;  2AQ2 B;  2I5M X;  3CCV A;  2P5Z X;  2AUK A;  1EQV A;  5EPL A;  1PHJ A;  1CA5 A;  3U58 A;  1JJ2 A;  4DR5 Q;  4DR6 L;  2XN9 C;  1JWM D;  4R1J A;  2CW0 C;  4OX9 L;  4JVZ A;  1ASZ A;  2XWJ B;  3N6R A;  1SMY D;  2K5N A;  2PZT A;  1EUJ A;  3ER0 A;  3K8A A;  5IT9 c;  2HCC A;  4X3S A;  1MJE A;  2E74 C;  4TRD A;  4YWL A;  3WWV A;  3GV3 A;  3L7Z C;  2JSO A;  3CCQ A;  3UE1 A;  3GV6 A;  1WTP A;  4A3M H;  1EY6 A;  5HGQ A;  5C3E G;  4BY1 B;  4M1U B;  3E5S A;  1J6Q A;  1UE6 A;  1PRT C;  4MIU A;  4JCV E;  4DR4 Q;  4R8N A;  2FMM A;  3NE5 B;  2F0G A;  4K2K A;  4BY1 H;  1S5D D;  2UXC Q;  2F0E A;  1NTG A;  1YBY A;  1PTO C;  1B2T A;  1TWF B;  4OHJ A;  2CKZ B;  4ZUI A;  3C46 A;  1O78 A;  3S9W A;  5H1S E;  1PH9 A;  1HA5 A;  4UP7 A;  3AB9 A;  5D3D A;  4JYA L;  2ES2 A;  5BN4 A;  4IQZ A;  3U4V A;  2CVR A;  4K5V A;  2EDG A;  3P1H A;  3SE0 A;  2R7Z H;  1EIY B;  2HQE A;  1HR0 L;  1YNN D;  1LT4 D;  4X66 L;  5IE8 A;  5NUC A;  3LWU A;  2B63 H;  2ZM6 L;  1IHZ A;  2N3S A;  2NUC A;  4KTA A;  3S1N H;  1SJH D;  2B2T A;  2BOS A;  1LO5 D;  1EY8 A;  1T5E A;  4DUZ L;  2CCZ A;  5CYU A;  4JI1 Q;  1BNZ A;  3RN2 A;  1PZI D;  1K28 A;  5I4D A;  2NVT H;  1EIH A;  1E1T A;  4JBJ A;  4F7X A;  1NY4 A;  4NXM L;  3M7G A;  2UXD Q;  3H0G H;  4TSS A;  2K28 A;  1CHP D;  4DV1 Q;  1I4P A;  1KRS A;  3VR6 A;  4IUT A;  1D8L A;  3PO3 B;  3K5O A;  1D7Q A;  1VQE A;  1K3R A;  2JQO A;  2L11 A;  1PH8 A;  1G2S A;  1NCV A;  5T1I A;  4P74 A;  1WTR A;  3CCU A;  1S40 A;  3EQL C;  3K5M A;  2NVQ B;  4DV2 L;  1SMY C;  1AZP A;  3HOU H;  4LK1 C;  3VR3 A;  1DZ1 A;  1I4Q A;  4AYB G;  1CSP A;  3CRK C;  4OON A;  4UP8 A;  1SFO B;  4DR6 Q;  1JOQ A;  3W2D A;  4C3J H;  2OF1 A;  5L37 A;  1Y1W H;  4X3K A;  4OX9 Q;  2LFN A;  1UEA B;  1GUT A;  3S17 B;  3LNN A;  4JI2 L;  2FHT A;  4LMQ D;  4A3D B;  2NVQ H;  5DM7 3;  4CHT B;  3D4D A;  4F87 A;  1VQB A;  4QQB X;  4UAI A;  1BCP F;  2F3I A;  3BYY B;  4JI8 L;  3I4M G;  2B2W A;  2F3V A;  4IUR A;  3U50 C;  1Q46 A;  3CF5 A;  1EYG A;  3U4Z A;  4OWX B;  4IUV A;  5BN5 A;  1TS2 A;  4J1M A;  4LF9 L;  2ZTE A;  2EOT A;  5A35 A;  4PNY A;  2OTL A;  4NXN L;  1D6E C;  2A6H D;  4LAA A;  2ZTC A;  3K6O A;  5C4H A;  1Q81 C;  1AEX A;  3K5N A;  4ZQ3 A;  2EPB A;  4IUQ A;  4OEM B;  1ICF B;  2F0J A;  3R8B A;  5K36 G;  2QF7 A;  2K1B A;  4RCN A;  3NQI A;  1YNN C;  2MHV A;  4JYA Q;  1G91 A;  1IYJ B;  5M5W B;  4IFD J;  1YNX A;  1K73 C;  3GTO B;  1EZ8 A;  3CCL A;  1Z9F A;  1HA6 A;  1XNQ L;  5LMU L;  3G6J B;  1HR0 Q;  1X9N A;  2D0P A;  1JB3 A;  4X66 Q;  3ONA B;  1QNK A;  2IW3 A;  2FFK B;  4DF7 A;  5C6A A;  2ZM6 Q;  2PQA A;  3MEF A;  4B3M Q;  2EVB A;  4JOI A;  3OMG A;  4IUP A;  4DUZ Q;  2PYK A;  3JAM E;  2YU9 H;  3EIV A;  3J7Z C;  4NXM Q;  1T9H A;  3QOJ A;  3IL8 A;  3HGB A;  1Z47 A;  3J80 c;  3GTG B;  2ASB A;  1JJC B;  1SND A;  2F0O A;  4DV4 L;  3L3O C;  2X69 A;  3BZK A;  1MSG A;  2JA6 G;  2K52 A;  3IFD A;  2HQL A;  2KCM A;  5EKI A;  2B2V C;  1VQ6 A;  1AZQ A;  1I3Q B;  3M4Q A;  4MN3 A;  2VL6 A;  2UUC L;  2EY5 A;  3PIP 3;  3M3Y B;  4DV2 Q;  1NNX A;  5HUR A;  1X56 A;  1WTH A;  4C3I H;  1KLG D;  5GRO A;  1M90 C;  1I3Q H;  1WFQ A;  1PH6 A;  1X32 A;  4JI2 Q;  2R3Z A;  2FXQ A;  4MTN A;  4LF6 L;  1R4Q B;  1Q8I A;  2WV6 D;  3PGZ A;  4KMU C;  4N9P A;  2DUD A;  4JI8 Q;  1WVL A;  3RR5 A;  2A6H C;  1KAB A;  3HOW B;  3JAM c;  3WOE A;  3F2D A;  5IOD A;  2MFI A;  5IGE A;  2NB0 A;  4ZKC B;  4X62 L;  1NBW A;  1EQR A;  4LF9 Q;  2AWN A;  2F0Q A;  2NN6 G;  1PH4 A;  5KEE A;  2Q8R E;  1F77 A;  4A3I G;  4NXN Q;  4R4O A;  1QVC A;  1XJV A;  3NXW A;  2MPM A;  4CKE A;  1PVO A;  2EYJ A;  5ELD A;  1L0W A;  3L0O A;  1AE2 A;  4F8M A;  3MA2 B;  2B39 A;  1PH2 A;  4GLX A;  2EYH A;  2ICI A;  5EBD A;  3I56 A;  3NEN A;  2WFW A;  3SK6 A;  4OO1 G;  2A74 C;  3HOZ G;  4CKC A;  3ZJY C;  1WI5 A;  2ZJQ A;  2MO1 A;  3NTK A;  1XMO Q;  1I5F A;  4IFD I;  1XNQ Q;  5LMU Q;  1HUM A;  2HDL A;  4NKL A;  5ISR A;  5M5X H;  1TY0 A;  1QZH A;  1SR3 A;  4G7H C;  3NTH A;  2M00 A;  3NP8 A;  1Y1V H;  2BH8 A;  3E0J A;  4IAL A;  4L5Q A;  1DOM A;  2NYZ D;  1Q1E A;  4GZY C;  3KOJ A;  3U9O A;  1HXY D;  3H3V I;  2Y0S E;  4IPH A;  4N8X 1;  3ND8 A;  3K58 A;  2EIF A;  3PQI A;  4BBR G;  4DV4 Q;  3GTJ B;  1PRT F;  1CI3 M;  5FKA C;  3UE0 A;  1X54 A;  3LX0 A;  4C1N K;  1SMX A;  5C3X A;  4X3U A;  4A3B B;  4ZKB B;  4R4I A;  2OQK A;  1MI2 A;  4UP9 A;  3BZD B;  2UUC Q;  3GTJ H;  2ALY B;  1SYC A;  1JCK B;  4PG3 A;  2VB2 X;  4HED A;  3FHW A;  3K81 C;  1B53 A;  3AQQ A;  4A3B H;  3MEH A;  1O7L A;  4B3S L;  2ZJR A;  4LF6 Q;  1BCP B;  3RZO B;  4BXX H;  4GS3 A;  4JV5 L;  2V1C C;  2XRS D;  2MP1 A;  3DXJ C;  3FKI G;  1STE A;  1WJJ A;  5IYB H;  2I46 A;  5M9O A;  4TVA B;  3RN5 A;  2A68 D;  4IN3 A;  1TS4 A;  3RZO H;  4QL5 A;  1RHP A;  1BCP D;  3K80 C;  2B8F A;  1KXL A;  1SNP A;  3NK9 A;  1VQL A;  1PH1 A;  4K14 A;  1VMP A;  2OWO A;  4RKB A;  2PQA B;  2K5Q A;  1HZB A;  1AW7 A;  4DR2 L;  2CH4 A;  1JOO A;  1MD2 D;  1K8O A;  2KBN A;  5E3F A;  3PV0 A;  3TME A;  5E4W C;  2B2T C;  3J80 i;  5JEA H;  2RDH A;  1M1K C;  3M7N A;  2VB3 X;  1HNW L;  3ICE A;  4WJ4 A;  3E6Z X;  1TWC B;  3CKI B;  5KIX A;  1GUW A;  4KD4 A;  4XT3 B;  4I7Z C;  3KF6 B;  5KNC A;  1YJN A;  1Q90 A;  1BKB A;  3B6Y A;  4BA1 I;  2JA8 G;  2WB1 E;  4Y7N H;  3VYR A;  1YJW A;  4WRD A;  4RH6 A;  4S3S A;  4OWT B;  1BUV T;  1SYD A;  5C4J H;  3G6E A;  4JBM A;  2OTJ A;  4LWC A;  3HOY H;  3I4N B;  1VQF A;  3KK7 A;  1HQM C;  5ELN A;  1E24 A;  3J81 c;  4A93 B;  1VS0 A;  3T51 B;  1GHK A;  5AFW A;  1KLU D;  3I4N H;  1IL8 A;  3V96 A;  3JAM i;  1F9P A;  1ENA A;  2QDB A;  3VA7 A;  1NMF A;  3ULJ A;  4LF7 L;  4A93 H;  4ILW A;  3V05 A;  3BVZ A;  3TQY A;  1IL2 A;  2B2W C;  4CJ2 C;  2Q8T A;  1EFW A;  1U0L A;  4DV6 L;  1J5E L;  2EY2 A;  2Z1C A;  4LUO A;  1VQ5 A;  4A3F B;  1P16 A;  2ICE C;  1F2Y A;  3NEL A;  4X65 L;  1EFI D;  1QE6 A;  2WAQ B;  3HOX B;  4JBK A;  2LKV A;  4C56 C;  3F8T A;  2JEB I;  4B3S Q;  3HOV G;  1Q82 C;  2Y0S G;  3Q8D A;  1FNV A;  2JA9 A;  3V2T A;  4A3F G;  1BCP C;  3S2D B;  3A54 A;  1Y8O B;  1SN8 A;  5A2Q L;  2C35 B;  2WAQ G;  4H0L C;  2K6A A;  1H9J A;  2K4K A;  1ZEQ X;  2IJ0 A;  1B9N A;  4DAY A;  4B08 A;  2Q8I B;  4OGQ C;  3TP6 A;  5DLQ E;  1IYV A;  1V1P B;  4DXF A;  4G57 A;  4L8J A;  3DWP A;  5I9O A;  4DR2 Q;  3L2P A;  4A3J G;  4NDX A;  1E2W A;  1KDC A;  4BWG B;  4IJH A;  4FXK C;  1HNW Q;  1V1O A;  5FJ8 G;  3S16 H;  3NBI A;  3BJU A;  1PMR A;  1LTI D;  1EOV A;  3Q22 A;  5C4X B;  4UPA A;  4GN5 A;  2UUB L;  1PFB A;  5M5Y H;  1H9M A;  4KKT A;  4EQ5 A;  1U5K A;  1EU4 A;  2MO0 A;  2RCF A;  4RHS A;  3QJY A;  3W3A A;  3I4L A;  4A3E B;  4Y52 H;  1LTG D;  4IPC A;  1CM9 A;  2HHH L;  4GN3 B;  5BR8 L;  5C4X H;  5KGU A;  2JA5 G;  4YWM A;  3X3N A;  4XDX A;  1QUQ B;  4MHE A;  2RSO A;  4BY7 H;  1CTM A;  2NVY B;  4IPG A;  4A3E H;  4FXD A;  3T56 B;  3CCJ A;  1B1Z A;  1K8A C;  1EWC A;  1Q3L A;  1VQM A;  1MKH A;  2K33 A;  3QIA A;  3UDG A;  1IKL A;  3HZX A;  1PRT B;  1VQD A;  3FVQ A;  1CUK A;  2HIV A;  3HEJ A;  2RQX A;  3Q6S A;  3R3O A;  4RAU C;  5CV9 A;  3MFY A;  1EU3 A;  3FDT A;  3PUY A;  3ERO A;  5EGT A;  4PMB A;  5DNF A;  4DV6 Q;  2XGT A;  4H02 A;  4A3G H;  1JT8 A;  2EYL A;  4IFD H;  1J5E Q;  3H15 A;  2PW5 A;  1II3 A;  2IHE A;  3FMC A;  4YWK A;  4OL7 A;  2WKD A;  4DK3 C;  1HR0 W;  3J7Y W;  1PZJ D;  4DAV A;  2L15 A;  2X6G A;  3OHX C;  4HMI A;  4GOP A;  3G48 A;  1HJP A;  4CGY B;  4LF5 L;  3IFT A;  4LFC L;  4MZ9 A;  4YY3 L;  4X64 L;  4PV1 C;  1T5X D;  4WOR A;  2Z9H A;  2A5H A;  1D1K A;  4K6L A;  5E4X A;  4WFN 3;  3UDI A;  5JVH 3;  1Q7Y C;  1TWH B;  4HSP A;  3MXG A;  2BDO A;  5IP7 H;  1WCM B;  3D6C A;  3A74 A;  1VQ8 A;  1BVS A;  4RCO A;  1DJR D;  1AE3 A;  2RF4 A;  3SGI A;  3ZYY X;  1N8R C;  4QF4 A;  4HJ9 A;  1PH7 A;  1SYB A;  2R92 B;  1TWH H;  4APV A;  2V4D A;  4GKK L;  1NR2 A;  4I7A A;  2A8V A;  5FLM G;  4RWS C;  2YV5 A;  5JPM C;  4G7O C;  4JPB W;  1TU2 B;  4CDF C;  2NTS A;  5JPN C;  2UUB Q;  2DY7 A;  3PO2 G;  3BDO A;  1PLF A;  2RKS A;  4K0K Q;  4OEL B;  1VQO A;  2EJG C;  4HJ5 A;  2RDG A;  2D2C C;  3IAY A;  3GP7 A;  2HHH Q;  5BR8 Q;  4KLK A;  4A3M B;  2I5H A;  4JI5 L;  1A8V A;  2R61 A;  4YCU A;  2SOB A;  3S1R H;  4GNX A;  4P72 A;  1KTK A;  3A8K E;  3VR4 A;  3VDY A;  3I72 A;  1STY A;  2QA4 A;  4DN4 M;  3MXN A;  4DK1 A;  3CRL C;  1B44 D;  5K5P A;  3KF8 B;  3RD4 A;  1I4G A;  3BVM A;  4PZ6 A;  5JVG 3;  1LTR D;  3TP5 A;  2Z4I A;  2ATW A;  3BVG A;  2J0T D;  4CBV A;  2KEE A;  4AH6 A;  1DYQ A;  2BE5 D;  2EYP A;  4BY1 G;  4H7B A;  2PO4 A;  3SHL A;  4ID6 A;  3ULP A;  4P75 A;  1IBM L;  2R7Z B;  3IKJ A;  1YEZ A;  3WOF A;  2DNC A;  1ESF A;  1IYU A;  5C3E H;  4GN4 B;  1ASY A;  2ZXO A;  1OXT A;  3H3V C;  4Q0F A;  2AQ1 B;  2B63 B;  4R4C A;  1QCB D;  1STA A;  3S24 A;  2F0L A;  1XYI A;  3S1N B;  5D65 A;  1XPU A;  2CFM A;  2RA4 A;  4LFC Q;  4X64 Q;  4YY3 Q;  5A2Q E;  2ID0 A;  2NVT B;  5AJ3 L;  2NWG A;  1NMG A;  2OCE A;  4P71 A;  3H0G B;  2B63 G;  2E2D C;  1EY7 A;  3IRB A;  1L2F A;  1E0B A;  1GUS A;  3PIP A;  4B3R L;  1CK1 A;  3S14 H;  5F2D A;  1O80 A;  2PMZ B;  4G7Z C;  3VA5 A;  1E2Z A;  4HTH A;  4KHV A;  4GKK Q;  3OMC A;  4IUU A;  4QUC A;  2KJX A;  4B3T L;  5M3F H;  1F2Z A;  2SEB D;  5EAY A;  3GTQ H;  3HOU B;  4BBS H;  2PW7 A;  1IZ6 A;  4NMZ A;  4C3J B;  1Y1W B;  3CD6 A;  2SNS A;  2WKC A;  1H9S A;  3PO3 G;  1SE8 A;  3ULL A;  1BBW A;  3TZD A;  2F3W A;  4K5X A;  1N34 L;  4UHV A;  1ONL A;  1SRU A;  1PH5 A;  5J3B A;  4LUV A;  1WTW A;  2A19 A;  5LL6 X;  4EVO A;  3EJI A;  5ELF A;  1TKW B;  3Q23 A;  3X3M A;  4N9T A;  4IOA A;  4TQU S;  2OT2 A;  3SEB A;  1PFM A;  3F2B A;  1DOL A;  3BG3 A;  1BDO A;  4GOP B;  1UAP A;  4A3D G;  2IL8 A;  2BE5 C;  3OWE B;  4AQY L;  1X65 A;  4IJL A;  3J80 E;  3J81 L;  4J15 A;  4ZUJ A;  1EIG A;  1JWU D;  2F1M A;  3G71 A;  4Q5V A;  3I4M H;  3OTO L;  4JI4 L;  1IBM Q;  5DAU A;  3R2I A;  2D0O A;  4DUY L;  1HZC A;  2JEA I;  4DPG A;  1C48 A;  1A6X A;  2LXK A;  3BYT B;  4JI7 L;  2YTV A;  4JG2 A;  5ELE A;  3HG9 A;  1D2B A;  5FOB B;  3QG1 A;  2YU9 B;  2EXZ A;  5AJ3 Q;  1STG A;  2F03 A;  2K50 A;  4DGZ A;  2MQH A;  3TP8 A;  5CR3 A;  2I5L X;  5K36 H;  2X6L A;  3CXC A;  4O0A A;  5GAG C;  4L5R C;  4FF1 A;  1KHI A;  4B3R Q;  2MUY A;  1ENF A;  4RG1 A;  2CQA A;  5CC4 A;  4YCV A;  3PMF A;  3FRP B;  3OIQ A;  2Z4H A;  3P20 A;  4B3T Q;  2GA4 B;  4J6H A;  2IX1 A;  4DK6 C;  4OXP A;  4Z9C B;  3SK4 A;  4C3I B;  2EYM A;  5LMN L;  1HRJ A;  1A62 A;  3NHH A;  1HTP A;  3P75 A;  4DNI A;  2D9U A;  3KJP A;  3RLO A;  5FO7 B;  2N49 A;  2LSS A;  2SDF A;  2E2J H;  3DM1 A;  1GD7 A;  1GUO A;  3D6W A;  3M4Y A;  4C1N I;  1IW7 D;  1HNX L;  2F0M A;  3NQT A;  1G29 1;  2IX0 A;  2DGY A;  3SDZ A;  3KFU A;  1C8C A;  4K5W A;  2JXM B;  4R4T A;  2L0C A;  1TVX A;  2QKI C;  5C0X G;  1CZG A;  2UXB L;  2RBM A;  3RLN A;  4QY7 A;  2QIL A;  1D5M C;  2KEC A;  4UY8 C;  1SJE D;  3O13 A;  1GKH A;  1PFS A;  1QNU A;  1TS3 A;  3D0F A;  4GOP C;  4AQY Q;  4DA2 A;  1HZA A;  4KV6 A;  2MGS A;  1YIT A;  3HOW G;  3D8G A;  1XX8 A;  4HID A;  1OXX K;  4RKL A;  3SXH A;  1EYA A;  3F2C A;  4DR1 L;  4K6D A;  3KDF A;  2DJF C;  3OTO Q;  4JI4 Q;  1CKN A;  4X6A H;  4EGV A;  5M5X B;  2OXP A;  3M4O B;  1KAA A;  2XWB B;  4H44 C;  4KJN A;  1BQQ T;  1Y1V B;  2F52 A;  3ERS X;  1SDF A;  1V1Q A;  5IY0 A;  1F9R A;  4CDE C;  2RSN A;  1EWH A;  5LHY 1;  4CDC C;  3M4O H;  2H4O A;  2K7V A;  2A6E D;  3GTK B;  2CWP A;  1GOZ A;  1V43 A;  4OO1 H;  3OPO A;  1BXT A;  1KIX A;  1JB7 A;  2EXD A;  3MXP A;  4LF4 L;  1L1O A;  1LM0 A;  1A3U A;  1A0I A;  3MXU A;  3NBH A;  5KYI A;  2NVX H;  4DAM A;  1JIC A;  3CHB D;  1TWA H;  3GTK H;  3D31 A;  2NZH A;  3S15 H;  2L12 A;  4KN4 C;  3FEW X;  4NPS A;  2UU9 L;  1EY4 A;  1MHW C;  2WAQ E;  5I2Y A;  3I7F A;  4GNX C;  2KUM A;  3I4O A;  1SAP A;  4RHR A;  1XTD A;  5LMN Q;  1J8I A;  3QOL A;  2B2U A;  5C4Z A;  3DWA A;  4A3L G;  2XSC A;  1IW7 C;  3TDQ A;  1U4M A;  2R93 B;  4HIM A;  4CDD C;  2BCO A;  1X3E A;  1YI2 A;  1I4R A;  5LL6 S;  4BBR H;  5GQO A;  1E3P A;  1XWE A;  5IIF A;  1HNX Q;  4LF8 L;  3ND9 A;  4A3B G;  4FO2 A;  1SE3 A;  3TS2 A;  5C44 B;  4PZ8 A;  4BXX G;  3MZ5 A;  2R93 H;  1FGB D;  1RIP A;  2UXB Q;  3STB D;  3NTI A;  1PZK D;  1VDZ A;  4ME3 A;  1LT3 D;  2KVM A;  1K8G A;  2LXJ A;  1Y14 B;  1A15 A;  3J7A F;  4X62 Q;  3SVM A;  2O5J C;  3VYS A;  5C44 H;  1YJ9 A;  2B2Y A;  1B9M A;  3J81 E;  3R2T A;  2C9O A;  2K5D A;  5CMD A;  1DON A;  1X55 A;  5CV8 A;  3TBI B;  1QIL A;  3K57 A;  4DV3 L;  2RDF A;  2YTY A;  3EFX D;  4TKO B;  1WTX A;  1UNS A;  1AN8 A;  3I8Z A;  1XMQ L;  4KHP L;  3E3X A;  4DR1 Q;  1A3T A;  1BO0 A;  5ELO A;  3I3C A;  3Q24 A;  1SE4 A;  5JEA G;  3NUC A;  4Y7N B;  5E7N A;  1O7Y A;  3HKZ B;  5COR A;  1CSQ A;  1AP0 A;  5C4J B;  1RJT A;  3CCR A;  2A6E C;  3NWS A;  3HOY B;  4FF3 A;  5IGB A;  3GD7 A;  1JJG A;  1STN A;  1DCZ A;  4LJZ C;  2K14 A;  4DFA A;  2F0P A;  1GUN A;  4GKJ L;  5IYC G;  2Q2T A;  1KAW A;  1NAP A;  1SYE A;  2KOL A;  2RCN A;  5FLX c;  1EQT A;  1S5C D;  3HOY G;  1NSN S;  2NBF A;  3C3L A;  3CPF A;  1ZKO A;  5M3M B;  4HJ8 A;  4LF4 Q;  1I6H B;  3R93 A;  1CQF A;  1OO9 B;  3SR1 A;  1OTC A;  3GQB A;  2OQ0 A;  2PNH A;  4N8F A;  1B50 A;  1BOS A;  3GTM H;  3BZC A;  1FNW A;  2JA8 H;  2XIW A;  2I07 B;  3I4N G;  1EEF D;  3CC7 A;  4A75 A;  2UU9 Q;  3J7A 5;  2CWA A;  2QCP X;  4QIW B;  5M3M H;  1I6H H;  2JA7 B;  3MFG A;  1XNR L;  4OWW B;  3DLL A;  1K0S A;  4A93 G;  3MHB A;  4FF2 A;  1LYL A;  3A8I E;  3GTL H;  5I6Y A;  2JA7 H;  1A63 A;  1YHB A;  2F0K A;  4XYO A;  1A2T A;  1MSH A;  1Z6H A;  1N36 L;  4MNO A;  2AWO A;  3W5O A;  2H5X A;  3KDF B;  2QGQ A;  3AU7 A;  3STB C;  3TN2 A;  2VQF L;  4LF8 Q;  1JC7 A;  1ICW A;  1CKN B;  2A68 C;  4JI6 L;  2PQE A;  1UUP A;  1ILP A;  2VUM B;  4JV5 Q;  4KY6 A;  5IP9 G;  1AFP A;  3GO5 A;  2BA0 A;  1RF2 D;  3TRE A;  4CKB A;  1PYW D;  5IGG A;  3HOX G;  1CZW A;  5EPJ A;  1Y69 U;  2KED A;  2UUA L;  1D5Z C;  3CC4 A;  2VUM H;  3C1E A;  3MVV A;  3EVQ A;  4R9W A;  3S16 B;  1RDP D;  1R4P B;  1DXM A;  1FD7 D;  1XMQ Q;  4KHP Q;  4ODG A;  1XPO A;  4DR7 L;  1X3F A;  4JOI C;  1L1O B;  2E2H H;  4B9X A;  3NBH B;  3VYT A;  4RMF A;  5M5Y B;  4JBW A;  5J22 A;  5CV4 A;  5C0X J;  3NEM A;  2YYZ A;  3VR5 A;  3T4A C;  2ZXP A;  4XQJ A;  3T1Y L;  1B3A A;  1H9R A;  3DHQ A;  3H94 A;  1HFN A;  4A3J H;  2F4V L;  1QB5 D;  4BY7 B;  4GKJ Q;  1TR5 A;  1LTA D;  5C4X G;  5FJ8 H;  4A3K B;  2N88 A;  1J9O A;  1TT2 A;  2DNE A;  4EQN A;  2PI2 E;  1E2V A;  3E9I A;  5IYD G;  2G5D A;  4BY7 G;  4A3E G;  4OIJ A;  1GUG A;  4A3K H;  2AQ3 B;  2Z6B A;  2IY5 B;  4DR5 L;  1XNR Q;  4A3G B;  2Z6K A;  1SNC A;  3I2Z A;  4LF7 Q;  1W2B A;  1PYB A;  4FP5 D;  3CAM A;  3CMA A;  1X3G A;  3K7A H;  1CKO A;  1C9O A;  1G6P A;  1GHJ A;  3RZD H;  3MC0 B;  4YCW A;  3M85 A;  5BN3 A;  5CBA E;  1N36 Q;  4X65 Q;  4DKA C;  2MJ8 A;  3A8J E;  2NZO A;  4YHH L;  3UI2 A;  1KL9 A;  2B3G A;  1LUZ A;  2PMZ E;  4ME5 A;  4JI6 Q;  1VQ9 A;  1S5F D;  2F0F A;  2HD3 A;  4KY7 A;  1VQP A;  2N78 A;  2RVL A;  1S5B D;  4P2C B;  5KNB A;  1VQI A;  4AIM A;  1ENC A;  5GAH C;  4M8A A;  1R9T B;  4ZK9 B;  3D4W A;  3GTP B;  2FIN B;  1DGS A;  1F9S A;  2LS0 1;  4HAE A;  4LFB L;  3OW2 A;  2UUA Q;  2A73 B;  1SE2 A;  2MNA A;  4C3H B;  2HT1 A;  2L55 A;  4HMJ A;  1RCV D;  1K83 H;  2F0S A;  4ABN A;  1DD2 A;  4U68 A;  3TZU A;  1R9T H;  3K59 A;  4YIJ A;  3GTP H;  3J81 i;  3H09 A;  3E0E A;  3CCE A;  1I50 H;  4C3H H;  2OEO A;  1XXG A;  1WTQ A;  2CQO A;  4DXG A;  1L1O C;  2FMC A;  3KLS X;  1WCM G;  4A3C H;  1K3B C;  1TXY A;  2JJQ A;  2K03 A;  3OOC A;  4KI0 A;  5CV6 A;  1F9Q A;  3KLW A;  2ZXR A;  3H6M A;  1TQO A;  4JI1 L;  2KHS A;  2R92 G;  5C0X I;  2I0Q A;  5JJZ A;  3D3R A;  3AFQ A;  1NR4 A;  3S1R B;  2UXD L;  3T1Y Q;  4O42 A;  3CU7 A;  4DV1 L;  2F4V Q;  2NN6 I;  2SNM A;  3FP9 A;  3TS0 A;  3S2H H;  4QMG A;  5FLM H;  2B2U C;  1CKM A;  4XQN A;  1B4O A;  1LT5 D;  4JI3 L;  2N8N A;  3FPP A;  3S1Q H;  1EL0 A;  2WII B;  5JEA J;  1ET6 A;  5D14 A;  3QWN A;  3PO2 H;  4A3M G;  3J81 j;  4IPD A;  2EQS A;  2EY6 A;  4OO1 I;  1SNO A;  5D3I B;  4XQQ A;  3PF5 A;  2R6G A;  2F0V A;  1STB A;  2VNU D;  5C3E B;  4EQP A;  1FR3 A;  2ENB A;  3A7A B;  5FO8 B;  1G2T A;  5I6W A;  1VQG A;  4R8I A;  2Z0S A;  4DAY B;  2B2Y C;  1A2U A;  1E22 A;  1KNE A;  2K32 A;  4LW1 A;  3MTS A;  2BH2 A;  2E2I B;  2QEJ C;  3OYY A;  4DNT B;  1BBU A;  1B70 B;  1PV4 A;  4DNR B;  4YHH Q;  3KYH C;  1KRT A;  4CJ0 B;  5C5L A;  1GJX A;  1H95 A;  3ERQ A;  1JOR A;  1K0R A;  4X3T A;  2F0U A;  4LF5 Q;  2R7Z G;  1Q86 C;  3PIO 3;  2E2I H;  2L4N A;  2L9H A;  3DUZ A;  5IGD A;  3S14 B;  3KLS A;  3I55 A;  2EJF C;  1RL2 A;  5KYL A;  5CBE E;  4POG A;  2R7F A;  4KHZ A;  3WDN A;  4LFB Q;  2Q2I A;  1YVC A;  4PMC A;  4P73 A;  1F2L A;  4LNQ A;  3D4R A;  5M3F B;  3GTQ B;  4ZYS A;  3G4S A;  4BBS B;  1TWF H;  3H0G G;  3OWF A;  2CH4 W;  2G9H D;  4HIK A;  2EY1 A;  5LMN W;  3UDF A;  2J4X A;  1JQY D;  4KY5 A;  4O2D A;  5M3F G;  4DV0 L;  1PFN A;  4IOC A;  1IBL L;  1B3Q A;  4DV7 L;  4B3M L;  5IGC A;  4BBS G;  1CT1 D;  3NWT A;  2GVA A;  4ZRZ A;  2O5I C;  1MIU A;  1FNU A;  3GDE A;  4HN7 A;  1VQK A;  2K5V A;  1VQ7 A;  3KUP A;  3K7U C;  3C1F A;  1I4H A;  2E76 C;  3PUW A;  3NPP A;  2RHQ B;  1QZG A;  4L5T A;  3HOU G;  3C2P A;  4I65 A;  4XIG S;  5IGF A;  4C3J G;  1Y1W G;  1OXU A;  2D5D A;  1MJC A;  1L0Y B;  4JW0 A;  4AYB B;  4POF A;  4JI5 Q;  2F0H A;  1M4V A;  5JJL A;  4F88 A;  4JI3 Q;  1VMC A;  4HIO A;  3TEH B;  1AH9 A;  1U4R A;  1FJG L;  2D62 A;  2GN5 A;  4XXE A;  4HJA A;  4G4K A;  4LUZ A;  3MAQ A;  3PO3 H;  3I90 A;  2EYO A;  4A76 A;  1Q8K A;  5FLX L;  2E5L L;  1IBK L;  4CJ1 B;  2B8G A;  3I4M B;  2A69 D;  3T53 B;  1K9M C;  1Y8P B;  1GM5 A;  5FO9 B;  2XRQ D;  3F2U A;  1K8M A;  1DM0 B;  1LAB A;  1LTS D;  2R7D A;  4JI0 L;  3KBG A;  1SFO H;  1E7Z A;  4XYQ A;  1TWG B;  4R4Q A;  3S17 H;  3G7L A;  1VF5 C;  4E6I A;  4L5S A;  1I6V C;  4A3D H;  2XVS A;  2VS1 A;  2IT1 A;  5HY6 A;  1QVF A;  1BF4 A;  4UDU C;  2KQ3 A;  1TWG H;  1VQA A;  3A0J A;  1GO3 E;  4XT1 B;  4RGO S;  3UDX A;  3A5U A;  4HCS A;  1RD9 D;  2O4X A;  2H1E A;  1NE3 A;  1CHQ D;  1F2M A;  1HCZ A;  1M8A A;  5G3L F;  2IPK D;  4EX5 A;  2PCF B;  5T1G A;  3DEP A;  2L5T A;  1LTB D;  1VQN A;  1BR9 A;  1XMO L;  1N9W A;  1W6J A;  3A5Z B;  1XPR A;  5DEH A;  1Y8N B;  1TS5 A;  4J8Q A;  4GNX B;  4QCL A;  1LV9 A;  1ZXT A;  4DV0 Q;  1IBL Q;  4U67 3;  5M5W H;  4DV7 Q;  1VQ4 A;  4RGN A;  2E2J B;  4FNF A;  4OIK A;  3GTO H;  3MXN B;  1X3P A;  3ITP A;  4QB4 A;  2VZA A;  1PYS B;  3LWE A;  2JA6 B;  1JR0 D;  1OXV A;  2ZJP A;  2Z6K C;  2VQE L;  4NP5 A;  2IHF A;  1U4L A;  1HPC A;  1N34 Q;  2C5C A;  4C3I G;  1CQV A;  2Q2H A;  1WD1 A;  3KF6 A;  3AEV A;  1A3V A;  2Z8L A;  1EQQ A;  1KDB A;  2JA6 H;  3MWY W;  4KN7 C;  5I2X A;  3N52 A;  2A69 C;  3GTG H;  1C4Q A;  4NB3 A;  1FJG Q;  4FDB A;  1S3O A;  4IO9 A;  4ZAI A;  3HKZ E;  1RTO A;  1FYC A;  2E5L Q;  2KHI A;  1IBK Q;  1VCI A;  5J1Z A;  3M9B A;  5CGK A;  1KC8 C;  1N33 L;  4DR3 L;  1D1I A;  3M3Y H;  1EEI D;  4A3I B;  4JI0 Q;  5EBC A;  5C0X H;  2ZTD A;  3W1G A;  2CHB D;  2DY8 A;  2F0D A;  1UEB A;  1GXD C;  3HRZ C;  1MGS A;  5CV5 A;  1SYF A;  1ROD A;  3CP0 A;  2BA1 A;  1HQR D;  1D5X C;  4DUY Q;  3DEO A;  1C7Y A;  2XTI A;  2NN6 H;  3J7A V;  3AYH B;  4KD3 A;  4A3I H;  4K8I A;  1V9P A;  1XTC D;  1B8A A;  1EOT A;  1WOC A;  3HOW H;  3HOZ B;  4JI7 Q;  1EYC A;  1SRO A;  4QIW E;  2FJ2 A;  1OXS C;  2M9V A;  3T13 A;  2NVX B;  5GAE C;  1TWA B;  1SNM A;  1Y1V G;  3SK8 A;  3S15 B;  3EA6 A;  1H9S B;  1EY5 A;  3U9S A;  1UWV A;  3HOZ H;  2IWH A;  2HUG A;  4FXG C;  1LTT D;  2WIN B;  4JK1 C;  2HIX A;  3JC6 6;  4C2M B;  4BS9 A;  1JOK A;  1V1P A;  1SBB B;  1V8Q A;  2JN4 A;  2E8G A;  2NTT A;  4BBR B;  1PA6 A;  3LGJ A;  4C2M H;  2HDM A;  2EYF A;  3CPW A;  1RKN A;  3S1M B;  1G6Z A;  2F4I A;  2F0W A;  3A55 A;  4HSV A;  3DWQ A;  1RTN A;  3Q0A A;  4DV5 L;  2KHJ A;  2VQE Q;  1HHV A;  3PSI A;  1N32 L;  3RUZ A;  3I70 A;  3TRZ A;  2K75 A;  5JOB A;  1QJO A;  3S1M H;  4DAP A;  2VW9 A;  4B9W A;  2R93 G;  4H13 C;  4A3L H;  4NW2 A;  2GVB A;  1PTO F;  5FLX E;  3HS0 C;  3PUV A;  5IYB G;  1EWI A;  5IWA L;  4IUN A;  4ZLT F;  1QUQ A;  3FKI B;  4DU9 A;  3K0X A;  2K5H A;  5EJW A;  5C44 G;  1L0X B;  2N55 A;  1I94 L;  3HFZ B;  2PPB C;  3OW7 A;  4O1N A;  4KJO A;  2Q2U A;  1N33 Q;  4DR3 Q;  2LMC B;  2A1A A;  1YNJ D;  4ZCK A;  4DK0 A;  5IOC A;  4FVM A;  1BBX C;  1VQJ A;  5GAD C;  3FKI H;  1HH2 P;  4K8J A;  4KK7 A;  4PQX A;  3BDC A;  3AFP A;  1SYG A;  5JAV A;  1O7Z A;  2B29 A;  3VR2 A;  3F1Z A;  1G8Z D;  1IXR A;  2J7Z A;  3NSW A;  5IT9 L;  1LT6 D;  1CFM A;  3AMU A;  3VYU A;  1E1O A;  1PDQ A;  1S5E D;  3BDL A;  2PZU A;  3PCO B;  5EKK A;  4QJF A;  2G9D A;  1UE5 A;  2O2L D;  2QDL A;  3HKZ G;  4MTK A;  2HCI A;  3CME A;  3GTM B;  2JA8 B;  5ELC A;  1NJI C;  1STH A;  1GVP A;  4WJ3 M;  1SNQ A;  3SK5 A;  4V19 0;  1WD0 A;  1QG7 A;  3W1B A;  2AHO B;  3CCS A;  1JE4 A;  1X6O A;  1WTO A;  1B7Y B;  4EQO A;  3I91 A;  1TWC H;  5KRU A;  5G3L D;  2LY7 A;  5M3M G;  3GTL B;  3QO2 A;  5IYC H;  4L6T B;  4RGT A;  3T1H L;  1PH3 A;  1YHA A;  2QEX A;  1HNZ L;  3K5L A;  3EBE A;  5KND A;  3P7J A;  1QVG A;  1U4P A;  2VY3 A;  2PNR C;  1LTL A;  2F0I A;  4A4I A;  2F0N A;  3A56 A;  2JA7 G;  4DV5 Q;  2KEN A;  3T16 A;  1EYD A;  1JWS D;  2KCC A;  2XNA C;  1N32 Q;  3A7L A;  5JJK A;  2TSS A;  1ZYR D;  1EY0 A;  4K2L A;  4L63 B;  1SSO A;  3URY A;  2JYO A;  4RFB A;  1HZ9 A;  2DN8 A;  2M2L A;  5JJI A;  2F0T A;  1JE5 A;  1WTV A;  1KQS A;  3HOV B;  1EIF A;  5IWA Q;  2Y0S B;  2PZW A;  2L1B A;  1YNJ C;  3TP7 A;  1UE7 A;  3TSS A;  3QR8 A;  2K04 A;  2VUM G;  2E2H B;  3DMU A;  1WYD A;  1NUC A;  1I94 Q;  5I9P A;  2DJG C;  4DV3 Q;  3HOV H;  4FF4 A;  2IX3 A;  2EE1 A;  4LFA L;  1TY2 A;  2AKW B;  5FK9 C;  3KF8 A;  5IP9 H;  4A3F H;  3RMH A;  5HGT A;  5C3W A;  2JE6 I;  1KNA A;  3HP3 A;  1CA6 A;  1S4Z A;  3HOX H;  4HCE A;  1YIJ A;  4KKU A;  4A3J B;  3L9A X;  5DM6 3;  2PI2 A;  1QOH A;  1S72 A;  1KDA A;  1MBY A;  5EPK A;  3S2D H;  1W6K A;  1SXT A;  1EY9 A;  1FVI A;  1G51 A;  2KA7 A;  1HUN A;  1VQH A;  1LLR D;  1IKM A;  1TII D;  3CC2 A;  3RLF A;  3KJO A;  4BA2 I;  5ELB A;  2JA5 B;  3EN2 A;  3PUX A;  4V0B A;  3K7A B;  4K0K L;  4A3K G;  3BS1 A;  3RZD B;  5EKL A;  5C5M A;  4ULL A;  1ESR A;  4KKS A;  4PMW A;  1Z7T A;  4PZ7 A;  3CQZ B;  2JA5 H;  3PIO A;  3T1H Q;  1HNZ Q;  3CCM A;  3M4P A;  5IYD H;  1ZYR C;  2E75 C;  2CW0 D;  1ILQ A;  5TSS A;  4HR7 B;  2WP8 J;  1HFG A;  1I4X A;  4A3G G;  4IFD G;  1FGU A;  2B2V A;  3CQZ H;  2YTX A;  1JMC A;  2WB1 B;  3H91 A;  3KBX A;  4QGU A;  4ALP A;  4HJ7 A;  1DOK A;  2VQF Q;  1YHQ A;  2NVY H;  1Q1B A;  1SLJ A;  4DR4 L;  1C0A A;  3PF4 A;  4JC0 A;  2AMC B;  3J80 L;  1K83 B;  1X3Q A;  1PTO B;  2K01 A;  2WB1 G;  4WJW A;  2UXC L;  3I73 A;  1ML0 D;  5J39 A;  2AUJ D;  1PRT D;  3K0Y A;  2QW7 A;  1QWY A;  4RA8 A;  2K5W A;  1YZ6 A;  3FPU B;  1SEB D;  1I50 B;  2KCN A;  2ZT9 C;  1PTO H;  3PUZ A;  1PTO D;  5IP7 G;  2EJM A;  5CV7 A;  5COY A;  4LFA Q;  2K05 A;  1PXU A;  2TMP A;  2RHS B;  3H3V H;  4DR7 Q;  2BDN A;  4RGM A;  4C3H G;  1U9R A;  4AYB E;  1H9K A;  3OSO A;  4QUF A;  1VF7 A;  4IZ8 A;  5IT9 E;  4A3C G;  4GLA C;  2NZ1 D;  4FYD A;  2KCT A;  2WAC A;  5EQ0 A;  2JP1 A;  3S2H B;  1FL0 A;  3KLR A;  1LAC A;  1UE1 A;  5E1F A;  1P8L A;  3JAM L;  4GLV B;  2VXW A;  3S1Q B;  3OIP A;  1VQC A;  2JK8 A;  3PO2 B;  1KD1 C;  3QB3 A;  4XTC S;  1Q12 A;  1WCM H;  1O7I A;  1EZ6 A;  3E9H A;  3BU2 A;  2EZV A;  1W3S A;  1ET9 A; 
#chains in the Genus database with same CATH homology
 1HTL D;  2AQ2 B;  2AUK A;  1EQV A;  5EPL A;  1CA5 A;  2XN9 C;  1JWM D;  2CW0 C;  2XWJ B;  3N6R A;  1SMY D;  2PZT A;  2HCC A;  4X3S A;  2E74 C;  4TRD A;  3GV3 A;  3L7Z C;  2JSO A;  3GV6 A;  1WTP A;  1EY6 A;  4BY1 B;  4M1U B;  3E5S A;  1PRT C;  4MIU A;  4R8N A;  2FMM A;  3NE5 B;  2F0G A;  4K2K A;  1S5D D;  2F0E A;  1PTO C;  1B2T A;  1TWF B;  4OHJ A;  4ZUI A;  3C46 A;  1O78 A;  3S9W A;  1HA5 A;  5D3D A;  3AB9 A;  5BN4 A;  4IQZ A;  2CVR A;  4K5V A;  2EDG A;  3P1H A;  3SE0 A;  2HQE A;  1YNN D;  1LT4 D;  5NUC A;  3LWU A;  1IHZ A;  2NUC A;  4KTA A;  1SJH D;  2B2T A;  2BOS A;  1LO5 D;  1EY8 A;  1T5E A;  5CYU A;  1BNZ A;  1PZI D;  5I4D A;  1EIH A;  4F7X A;  3M7G A;  4TSS A;  2K28 A;  1CHP D;  1I4P A;  3VR6 A;  4IUT A;  3PO3 B;  3K5O A;  2L11 A;  1G2S A;  1NCV A;  5T1I A;  1WTR A;  3EQL C;  3K5M A;  2NVQ B;  1SMY C;  1AZP A;  4LK1 C;  3VR3 A;  1DZ1 A;  1I4Q A;  3CRK C;  1SFO B;  1JOQ A;  3W2D A;  2OF1 A;  4X3K A;  2LFN A;  1UEA B;  1GUT A;  3S17 B;  3LNN A;  2FHT A;  4LMQ D;  4A3D B;  5DM7 3;  4CHT B;  3D4D A;  4F87 A;  4UAI A;  1BCP F;  3BYY B;  2B2W A;  2F3V A;  4IUR A;  4IUV A;  5BN5 A;  1TS2 A;  4J1M A;  2EOT A;  5A35 A;  4PNY A;  1D6E C;  2A6H D;  4LAA A;  3K6O A;  5C4H A;  1AEX A;  3K5N A;  4ZQ3 A;  2EPB A;  4IUQ A;  3R8B A;  2F0J A;  5K36 G;  2QF7 A;  2K1B A;  4RCN A;  3NQI A;  1YNN C;  2MHV A;  1G91 A;  5M5W B;  4IFD J;  3GTO B;  1EZ8 A;  1HA6 A;  3G6J B;  1JB3 A;  3ONA B;  1QNK A;  2IW3 A;  2FFK B;  4DF7 A;  5C6A A;  2EVB A;  3OMG A;  4IUP A;  2PYK A;  3JAM E;  3QOJ A;  3IL8 A;  3HGB A;  1Z47 A;  3GTG B;  1SND A;  2F0O A;  3L3O C;  2X69 A;  1MSG A;  3IFD A;  5EKI A;  2B2V C;  1AZQ A;  1I3Q B;  4MN3 A;  2EY5 A;  3PIP 3;  3M3Y B;  5HUR A;  1KLG D;  1X32 A;  2R3Z A;  1R4Q B;  1Q8I A;  2WV6 D;  4KMU C;  4N9P A;  1WVL A;  2A6H C;  1KAB A;  3HOW B;  3WOE A;  5IOD A;  5IGE A;  2NB0 A;  4ZKC B;  2AWN A;  2F0Q A;  2NN6 G;  5KEE A;  2Q8R E;  1F77 A;  3NXW A;  2MPM A;  4CKE A;  2EYJ A;  5ELD A;  4F8M A;  3MA2 B;  2B39 A;  2EYH A;  2ICI A;  5EBD A;  3SK6 A;  4OO1 G;  2A74 C;  4CKC A;  3NTK A;  4IFD I;  1HUM A;  2HDL A;  4NKL A;  5ISR A;  1TY0 A;  4G7H C;  3NTH A;  2M00 A;  3NP8 A;  3E0J A;  4IAL A;  1DOM A;  2NYZ D;  1Q1E A;  4GZY C;  3U9O A;  1HXY D;  3ND8 A;  3K58 A;  3GTJ B;  1PRT F;  1CI3 M;  5FKA C;  3LX0 A;  4C1N K;  5C3X A;  4X3U A;  4A3B B;  4ZKB B;  1MI2 A;  3BZD B;  1SYC A;  1JCK B;  2VB2 X;  4HED A;  1B53 A;  3MEH A;  1O7L A;  1BCP B;  3RZO B;  2XRS D;  2MP1 A;  3DXJ C;  1STE A;  2I46 A;  5M9O A;  2A68 D;  4IN3 A;  1TS4 A;  1RHP A;  1BCP D;  2B8F A;  1SNP A;  3NK9 A;  4K14 A;  1VMP A;  4RKB A;  2K5Q A;  1AW7 A;  1JOO A;  1MD2 D;  1K8O A;  5E3F A;  3PV0 A;  3TME A;  5E4W C;  2B2T C;  5JEA H;  2RDH A;  3M7N A;  2VB3 X;  3E6Z X;  1TWC B;  3CKI B;  5KIX A;  1GUW A;  4KD4 A;  4XT3 B;  4I7Z C;  5KNC A;  1Q90 A;  4BA1 I;  3VYR A;  4WRD A;  4RH6 A;  4S3S A;  1BUV T;  1SYD A;  3I4N B;  3KK7 A;  1HQM C;  4A93 B;  3T51 B;  1GHK A;  5AFW A;  1KLU D;  1IL8 A;  3V96 A;  1F9P A;  1ENA A;  2QDB A;  3VA7 A;  4ILW A;  3V05 A;  3BVZ A;  2B2W C;  4CJ2 C;  2Q8T A;  2EY2 A;  2Z1C A;  4A3F B;  2ICE C;  1F2Y A;  1EFI D;  1QE6 A;  2WAQ B;  3HOX B;  2LKV A;  4C56 C;  2JEB I;  1FNV A;  3V2T A;  1BCP C;  3S2D B;  3A54 A;  1Y8O B;  5A2Q L;  4H0L C;  2K6A A;  1H9J A;  1ZEQ X;  2IJ0 A;  1B9N A;  4DAY A;  4B08 A;  2Q8I B;  4OGQ C;  3TP6 A;  1IYV A;  1V1P B;  4DXF A;  4G57 A;  4L8J A;  3DWP A;  5I9O A;  4NDX A;  1E2W A;  1KDC A;  4BWG B;  4FXK C;  1V1O A;  3NBI A;  1PMR A;  1LTI D;  3Q22 A;  5C4X B;  1PFB A;  1H9M A;  4KKT A;  1EU4 A;  4A3E B;  4RHS A;  3QJY A;  3W3A A;  3I4L A;  1LTG D;  1CM9 A;  5KGU A;  3X3N A;  4XDX A;  4MHE A;  2RSO A;  1CTM A;  2NVY B;  4FXD A;  3T56 B;  1B1Z A;  1EWC A;  1Q3L A;  2K33 A;  3QIA A;  1IKL A;  3HZX A;  1PRT B;  3FVQ A;  3HEJ A;  2RQX A;  3Q6S A;  3R3O A;  4RAU C;  5CV9 A;  3MFY A;  1EU3 A;  3FDT A;  3PUY A;  3ERO A;  5EGT A;  4PMB A;  5DNF A;  2EYL A;  4IFD H;  2PW5 A;  1II3 A;  3FMC A;  4OL7 A;  2WKD A;  3J7Y W;  1PZJ D;  4DAV A;  2X6G A;  3OHX C;  4HMI A;  4CGY B;  3IFT A;  4PV1 C;  1T5X D;  4WOR A;  2A5H A;  1D1K A;  4K6L A;  5E4X A;  4WFN 3;  5JVH 3;  1TWH B;  4HSP A;  3MXG A;  2BDO A;  1WCM B;  3D6C A;  4RCO A;  1DJR D;  3ZYY X;  4QF4 A;  1SYB A;  2R92 B;  2V4D A;  1NR2 A;  4RWS C;  5JPM C;  4G7O C;  1TU2 B;  2NTS A;  5JPN C;  2DY7 A;  3BDO A;  1PLF A;  2RKS A;  2EJG C;  2RDG A;  2D2C C;  3IAY A;  3GP7 A;  4A3M B;  2R61 A;  2SOB A;  1KTK A;  3A8K E;  3VR4 A;  3I72 A;  1STY A;  4DN4 M;  3MXN A;  4DK1 A;  3CRL C;  1B44 D;  5K5P A;  3RD4 A;  1I4G A;  3BVM A;  5JVG 3;  1LTR D;  3TP5 A;  2Z4I A;  3BVG A;  2J0T D;  4CBV A;  2KEE A;  1DYQ A;  2BE5 D;  2EYP A;  4H7B A;  2PO4 A;  3SHL A;  4ID6 A;  2R7Z B;  3IKJ A;  3WOF A;  2DNC A;  1ESF A;  1IYU A;  2ZXO A;  1OXT A;  3H3V C;  4Q0F A;  2AQ1 B;  2B63 B;  1QCB D;  1STA A;  2F0L A;  1XYI A;  3S1N B;  5D65 A;  2RA4 A;  5A2Q E;  2ID0 A;  2NVT B;  2NWG A;  3H0G B;  2E2D C;  1EY7 A;  1E0B A;  1GUS A;  1CK1 A;  5F2D A;  1O80 A;  2PMZ B;  4G7Z C;  3VA5 A;  1E2Z A;  4HTH A;  4KHV A;  3OMC A;  4IUU A;  4QUC A;  2KJX A;  1F2Z A;  2SEB D;  3HOU B;  2PW7 A;  4NMZ A;  4C3J B;  1Y1W B;  2SNS A;  2WKC A;  1H9S A;  3TZD A;  2F3W A;  4K5X A;  1ONL A;  1WTW A;  5LL6 X;  4EVO A;  3EJI A;  5ELF A;  1TKW B;  3Q23 A;  3X3M A;  4N9T A;  4TQU S;  2OT2 A;  3SEB A;  1PFM A;  1DOL A;  3BG3 A;  1BDO A;  1UAP A;  2IL8 A;  2BE5 C;  3OWE B;  3J80 E;  3J81 L;  4ZUJ A;  1EIG A;  1JWU D;  2F1M A;  4Q5V A;  5DAU A;  3R2I A;  2JEA I;  1C48 A;  1A6X A;  3BYT B;  5ELE A;  3HG9 A;  1D2B A;  5FOB B;  3QG1 A;  2YU9 B;  2EXZ A;  1STG A;  2F03 A;  4DGZ A;  3TP8 A;  5CR3 A;  5K36 H;  2X6L A;  4FF1 A;  2MUY A;  1ENF A;  2CQA A;  5CC4 A;  3PMF A;  3FRP B;  3OIQ A;  2Z4H A;  3P20 A;  2GA4 B;  4J6H A;  2IX1 A;  4Z9C B;  3SK4 A;  4C3I B;  2EYM A;  1HRJ A;  1HTP A;  3NHH A;  3P75 A;  2D9U A;  5FO7 B;  2SDF A;  3DM1 A;  1GUO A;  3D6W A;  3M4Y A;  4C1N I;  1IW7 D;  2F0M A;  3NQT A;  1G29 1;  2IX0 A;  3SDZ A;  1C8C A;  4K5W A;  2JXM B;  2L0C A;  1TVX A;  2QKI C;  5C0X G;  1CZG A;  2RBM A;  2QIL A;  1D5M C;  2KEC A;  1SJE D;  3O13 A;  1QNU A;  1TS3 A;  4DA2 A;  4KV6 A;  2MGS A;  3D8G A;  1XX8 A;  1OXX K;  4RKL A;  3SXH A;  1EYA A;  4K6D A;  4EGV A;  5M5X B;  2OXP A;  3M4O B;  1KAA A;  2XWB B;  4H44 C;  4KJN A;  1BQQ T;  1Y1V B;  1SDF A;  1F9R A;  2RSN A;  1EWH A;  5LHY 1;  2H4O A;  2K7V A;  2A6E D;  3GTK B;  1GOZ A;  1V43 A;  4OO1 H;  3OPO A;  1BXT A;  3MXP A;  1A3U A;  3MXU A;  3NBH A;  5KYI A;  1JIC A;  3CHB D;  3D31 A;  2L12 A;  4KN4 C;  3FEW X;  1EY4 A;  5I2Y A;  2KUM A;  1SAP A;  4RHR A;  1J8I A;  3QOL A;  2B2U A;  5C4Z A;  3DWA A;  2XSC A;  1IW7 C;  3TDQ A;  1U4M A;  2R93 B;  2BCO A;  1I4R A;  5LL6 S;  1XWE A;  5IIF A;  3ND9 A;  4FO2 A;  1SE3 A;  5C44 B;  3MZ5 A;  1FGB D;  3NTI A;  1PZK D;  1VDZ A;  1LT3 D;  2KVM A;  1A15 A;  3J7A F;  3SVM A;  2O5J C;  3VYS A;  2B2Y A;  1B9M A;  3J81 E;  3R2T A;  2C9O A;  2K5D A;  5CMD A;  1DON A;  5CV8 A;  3TBI B;  1QIL A;  3K57 A;  2RDF A;  3EFX D;  4TKO B;  1WTX A;  1UNS A;  1AN8 A;  3I8Z A;  1A3T A;  1BO0 A;  3I3C A;  3Q24 A;  1SE4 A;  5JEA G;  3NUC A;  4Y7N B;  1O7Y A;  3HKZ B;  5COR A;  1AP0 A;  5C4J B;  1RJT A;  2A6E C;  3NWS A;  3HOY B;  4FF3 A;  5IGB A;  3GD7 A;  1STN A;  1DCZ A;  4LJZ C;  4DFA A;  2F0P A;  1GUN A;  1SYE A;  1NAP A;  2KOL A;  1EQT A;  1S5C D;  1NSN S;  2NBF A;  3C3L A;  1ZKO A;  5M3M B;  1I6H B;  3R93 A;  1CQF A;  1OO9 B;  3SR1 A;  3GQB A;  1B50 A;  1BOS A;  1FNW A;  2XIW A;  2I07 B;  1EEF D;  2QCP X;  4QIW B;  2JA7 B;  3MFG A;  3MHB A;  4FF2 A;  3A8I E;  5I6Y A;  2F0K A;  4XYO A;  1A2T A;  1MSH A;  1Z6H A;  2AWO A;  3AU7 A;  3TN2 A;  1JC7 A;  1ICW A;  2A68 C;  2PQE A;  1UUP A;  1ILP A;  2VUM B;  4KY6 A;  1AFP A;  3GO5 A;  2BA0 A;  1RF2 D;  4CKB A;  1PYW D;  5IGG A;  1CZW A;  5EPJ A;  1Y69 U;  2KED A;  1D5Z C;  3C1E A;  3MVV A;  3EVQ A;  4R9W A;  3S16 B;  1RDP D;  1R4P B;  1DXM A;  1FD7 D;  4ODG A;  4B9X A;  3VYT A;  5M5Y B;  4JBW A;  5J22 A;  5CV4 A;  5C0X J;  2YYZ A;  3VR5 A;  3T4A C;  2ZXP A;  4XQJ A;  1B3A A;  1H9R A;  3DHQ A;  3H94 A;  1HFN A;  4BY7 B;  1QB5 D;  1TR5 A;  1LTA D;  4A3K B;  2N88 A;  1J9O A;  1TT2 A;  2DNE A;  4EQN A;  1E2V A;  4OIJ A;  1GUG A;  2AQ3 B;  4A3G B;  1SNC A;  4FP5 D;  1GHJ A;  3MC0 B;  3M85 A;  5BN3 A;  5CBA E;  2MJ8 A;  3A8J E;  3UI2 A;  4ME5 A;  1S5F D;  2F0F A;  4KY7 A;  2RVL A;  1S5B D;  4P2C B;  5KNB A;  1ENC A;  4M8A A;  1R9T B;  4ZK9 B;  3D4W A;  3GTP B;  2FIN B;  1F9S A;  2LS0 1;  4HAE A;  2A73 B;  1SE2 A;  4C3H B;  2L55 A;  4HMJ A;  1RCV D;  2F0S A;  4ABN A;  1DD2 A;  4U68 A;  3TZU A;  3K59 A;  4YIJ A;  3H09 A;  2OEO A;  1XXG A;  1WTQ A;  4DXG A;  2FMC A;  3KLS X;  3OOC A;  2K03 A;  4KI0 A;  5CV6 A;  1F9Q A;  2ZXR A;  3H6M A;  1TQO A;  2KHS A;  5C0X I;  5JJZ A;  3D3R A;  1NR4 A;  3S1R B;  4O42 A;  3CU7 A;  2NN6 I;  2SNM A;  4QMG A;  2B2U C;  4XQN A;  1B4O A;  1LT5 D;  3FPP A;  1EL0 A;  2WII B;  5JEA J;  1ET6 A;  5D14 A;  3QWN A;  2EY6 A;  4OO1 I;  1SNO A;  5D3I B;  4XQQ A;  2R6G A;  2F0V A;  1STB A;  2VNU D;  5C3E B;  4EQP A;  1FR3 A;  2ENB A;  3A7A B;  5FO8 B;  1G2T A;  5I6W A;  4R8I A;  2B2Y C;  1A2U A;  2K32 A;  1KNE A;  3MTS A;  2E2I B;  2QEJ C;  4DNT B;  4DNR B;  4CJ0 B;  5C5L A;  1GJX A;  3ERQ A;  1JOR A;  4X3T A;  2F0U A;  3PIO 3;  2L4N A;  2L9H A;  3DUZ A;  5IGD A;  3S14 B;  3KLS A;  2EJF C;  5KYL A;  5CBE E;  4KHZ A;  3WDN A;  4PMC A;  1F2L A;  3D4R A;  5M3F B;  3GTQ B;  4ZYS A;  4BBS B;  3OWF A;  2G9H D;  2EY1 A;  2J4X A;  1JQY D;  4KY5 A;  1PFN A;  5IGC A;  1CT1 D;  3NWT A;  4ZRZ A;  2O5I C;  1FNU A;  4HN7 A;  3KUP A;  3C1F A;  1I4H A;  2E76 C;  3PUW A;  3NPP A;  3C2P A;  4I65 A;  4XIG S;  5IGF A;  4C3J G;  1OXU A;  2D5D A;  1L0Y B;  4AYB B;  2F0H A;  1M4V A;  4F88 A;  1VMC A;  1U4R A;  2D62 A;  4XXE A;  4G4K A;  3MAQ A;  3I90 A;  2EYO A;  5FLX L;  4CJ1 B;  2B8G A;  3I4M B;  2A69 D;  3T53 B;  1Y8P B;  5FO9 B;  2XRQ D;  3F2U A;  1K8M A;  1DM0 B;  1LAB A;  1LTS D;  3KBG A;  4XYQ A;  1TWG B;  3G7L A;  1VF5 C;  4E6I A;  1I6V C;  2XVS A;  2IT1 A;  1BF4 A;  4UDU C;  2KQ3 A;  4XT1 B;  4RGO S;  4HCS A;  1RD9 D;  2O4X A;  2H1E A;  1CHQ D;  1F2M A;  1HCZ A;  1M8A A;  5G3L F;  2IPK D;  2PCF B;  5T1G A;  3DEP A;  2L5T A;  1LTB D;  1BR9 A;  1W6J A;  5DEH A;  1Y8N B;  1TS5 A;  4J8Q A;  4QCL A;  1LV9 A;  1ZXT A;  4U67 3;  4RGN A;  2E2J B;  4FNF A;  4OIK A;  1X3P A;  3ITP A;  4QB4 A;  3LWE A;  2JA6 B;  1JR0 D;  1OXV A;  4NP5 A;  1U4L A;  1HPC A;  2C5C A;  4C3I G;  1CQV A;  1WD1 A;  1A3V A;  2Z8L A;  1KDB A;  3MWY W;  4KN7 C;  5I2X A;  3N52 A;  2A69 C;  1C4Q A;  4ZAI A;  1RTO A;  1FYC A;  1VCI A;  5J1Z A;  5CGK A;  1D1I A;  1EEI D;  4A3I B;  5EBC A;  5C0X H;  2CHB D;  2DY8 A;  2F0D A;  1GXD C;  1MGS A;  3HRZ C;  5CV5 A;  1SYF A;  1ROD A;  2BA1 A;  1HQR D;  1D5X C;  3DEO A;  2NN6 H;  3J7A V;  4KD3 A;  4K8I A;  1XTC D;  1EOT A;  3HOZ B;  1EYC A;  2FJ2 A;  1OXS C;  2M9V A;  3T13 A;  2NVX B;  1TWA B;  1SNM A;  3SK8 A;  3S15 B;  3EA6 A;  1H9S B;  1EY5 A;  3U9S A;  2IWH A;  2HUG A;  4FXG C;  1LTT D;  2WIN B;  4JK1 C;  4C2M B;  4BS9 A;  1JOK A;  1V1P A;  1SBB B;  1V8Q A;  2NTT A;  4BBR B;  2HDM A;  2EYF A;  1RKN A;  3S1M B;  1G6Z A;  2F4I A;  2F0W A;  3A55 A;  4HSV A;  3DWQ A;  1RTN A;  3Q0A A;  1HHV A;  3RUZ A;  3I70 A;  5JOB A;  1QJO A;  4DAP A;  4B9W A;  4H13 C;  4NW2 A;  1PTO F;  5FLX E;  3HS0 C;  3PUV A;  4IUN A;  4ZLT F;  3FKI B;  4DU9 A;  5EJW A;  1L0X B;  2N55 A;  2PPB C;  3OW7 A;  4O1N A;  4KJO A;  2LMC B;  5IOC A;  1YNJ D;  4DK0 A;  4FVM A;  1BBX C;  4K8J A;  4KK7 A;  4PQX A;  3BDC A;  1SYG A;  5JAV A;  1O7Z A;  3VR2 A;  1G8Z D;  2J7Z A;  3NSW A;  5IT9 L;  1LT6 D;  1CFM A;  3AMU A;  3VYU A;  1PDQ A;  1S5E D;  3BDL A;  2PZU A;  5EKK A;  2G9D A;  2O2L D;  2HCI A;  3GTM B;  2JA8 B;  5ELC A;  1STH A;  1SNQ A;  3SK5 A;  4V19 0;  1WD0 A;  1QG7 A;  1JE4 A;  1WTO A;  4EQO A;  3I91 A;  5KRU A;  5G3L D;  2LY7 A;  3GTL B;  3QO2 A;  4L6T B;  4RGT A;  3K5L A;  5KND A;  3P7J A;  1U4P A;  2PNR C;  2F0I A;  2F0N A;  3A56 A;  3T16 A;  1EYD A;  1JWS D;  2KCC A;  2XNA C;  3A7L A;  2TSS A;  1ZYR D;  1EY0 A;  4K2L A;  4L63 B;  1SSO A;  3URY A;  2JYO A;  4RFB A;  2DN8 A;  2M2L A;  2F0T A;  1WTV A;  3HOV B;  2Y0S B;  2PZW A;  2L1B A;  1YNJ C;  3TP7 A;  3TSS A;  2K04 A;  2E2H B;  3DMU A;  1NUC A;  5I9P A;  4FF4 A;  2IX3 A;  2EE1 A;  1TY2 A;  5FK9 C;  3KF8 A;  3RMH A;  5HGT A;  5C3W A;  2JE6 I;  1KNA A;  3HP3 A;  1CA6 A;  1S4Z A;  4HCE A;  4KKU A;  4A3J B;  3L9A X;  5DM6 3;  1QOH A;  1KDA A;  1MBY A;  5EPK A;  1W6K A;  1SXT A;  1EY9 A;  2KA7 A;  1HUN A;  1LLR D;  1IKM A;  1TII D;  3RLF A;  4BA2 I;  5ELB A;  2JA5 B;  3PUX A;  4V0B A;  3K7A B;  3BS1 A;  3RZD B;  5EKL A;  5C5M A;  4ULL A;  1ESR A;  4KKS A;  4PMW A;  1Z7T A;  3CQZ B;  1ZYR C;  2E75 C;  2CW0 D;  1ILQ A;  5TSS A;  4HR7 B;  2WP8 J;  1HFG A;  1I4X A;  4IFD G;  2B2V A;  2WB1 B;  3H91 A;  3KBX A;  1DOK A;  1Q1B A;  3J80 L;  1K83 B;  1X3Q A;  1PTO B;  2K01 A;  4WJW A;  3I73 A;  1ML0 D;  5J39 A;  2AUJ D;  1PRT D;  3K0Y A;  1QWY A;  4RA8 A;  2K5W A;  3FPU B;  1SEB D;  1I50 B;  2KCN A;  2ZT9 C;  1PTO H;  3PUZ A;  1PTO D;  2EJM A;  5CV7 A;  5COY A;  2K05 A;  1PXU A;  2TMP A;  2BDN A;  4RGM A;  4C3H G;  1U9R A;  1H9K A;  3OSO A;  4QUF A;  1VF7 A;  4IZ8 A;  5IT9 E;  2NZ1 D;  4FYD A;  2WAC A;  5EQ0 A;  2JP1 A;  3S2H B;  3KLR A;  1LAC A;  5E1F A;  3JAM L;  2VXW A;  3S1Q B;  3OIP A;  3PO2 B;  3QB3 A;  4XTC S;  1Q12 A;  1EZ6 A;  2EZV A;  1ET9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...