5EKLA

Crystal structure of staphylococcal nuclease variant delta+phs t62d/n100e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eklA00
4K14A 1F2YA 3C1FA 4HMIA 4KTAA 2PZWA 4KJOA 4PMBA 1U9RA 5CV7A 2F0MA 3QB3A 4KY5A 2F0PA 4KV6A 5E1FA 1STGA 2F0UA 2RBMA 1EY5A 4DF7A 2F0LA 2PW5A 3EROA 2EYFA 3OWFA 5CV8A 1JOKA 5EGTA 5C3WA 4K8IA 1EY6A 3BDLA 3D6CA 5C4HA 2KHSA 3NHHA 1STYA 5DAUA 2EYHA 3MHBA 5I6YA 1A3UA 1SYEA 5IGFA 1JOQA 1EQVA 1KDAA 3SK8A 4IUNA 3SHLA 5IGEA 3P75A 1TQOA 1A2UA 4KY7A 4YIJA 4ZUJA 2F0QA 4NKLA 4NP5A 2PZTA 2EY6A 2EYPA 2NUCA 3OMGA 2PYKA 4EQPA 3E5SA 2F0WA 1JORA 4QB4A 2F3VA 3QOLA 1EY4A 4K5XA 1F2ZA 1JOOA 3D8GA 1EYAA 2EY5A 1SYBA 4KHVA 4B9XA 2SOBA 4IZ8A 5IGCA 2EXZA 4I65A 1STNA 4B9WA 1SYCA 3VA5A 1SNDA 1KDBA 4WRDA 3S9WA 3SR1A 4MIUA 5ISRA 1SNMA 2F0VA 1EY7A 3OSOA 4RKLA 5J39A 5IGDA 2F0SA 2OF1A 3HEJA 2EYOA 1AEXA 1ENCA 2RDFA 5C6AA 3TMEA 5KIXA 5KRUA 3P1HA 5CV6A 3H6MA 5IIFA 1A2TA 4HTHA 5C3XA 3C1EA 5C4ZA 1EZ6A 3EVQA 1ENAA 3TP5A 3MEHA 5JAVA 2SNSA 1TR5A 4KD3A 1EY8A 5CR3A 2F0FA 1TT2A 3TP6A 5IGBA 5EKLA 3LX0A 5DEHA 3DHQA 4ODGA 3T16A 2HQEA 1NUCA 4K8JA 3D4WA 5IODA 4NMZA 5CC4A 1NSNS 2PW7A 3NP8A 2F0DA 3QOJA 5J22A 3SXHA 3NXWA 4LAAA 3SK4A 1F2MA 4PNYA 4H7BA 4S3SA 1SNOA 3MZ5A 3NQTA 3OMCA 4N9TA 5E3FA 4E6IA 4ID6A 3TP7A 2F0HA 2SNMA 3SK5A 4IALA 2PQEA 3BDCA 4J1MA 4RKBA 4EQNA 3R3OA 4F8MA 2M00A 1IHZA 1STBA 4ZUIA 5I9OA 1A3VA 2F0GA 1STHA 4K2KA 4KD4A 2OEOA 3RUZA 4DFAA 3NUCA 3V2TA 4G57A 1A3TA 2F3WA 2EY1A 4KY6A 3MXPA 5CV5A 5F2DA 5M9OA 1RKNA 1SNQA 4TRDA 1EYCA 1SNCA 4OL7A 3T13A 4DGZA 3U9OA 4N9PA 1EY9A 3MVVA 1KDCA 5KEEA 3ERQA 5KYLA 4K2LA 4ZQ3A 3DMUA 2F0OA 2RKSA 3SK6A 5KYIA 4K6DA 2F0KA 2EYLA 1EZ8A 2F0IA 4F7XA 1SNPA 1EYDA 5J1ZA 1KABA 2QDBA 3PMFA 3ITPA 4EQOA 1II3A 1KAAA 5IGGA 3TP8A 2WACA 2F0JA 5EKKA 5I6WA 1EY0A 4QMGA 2F0TA 2EY2A 5JOBA 2LKVA 2O4XA 5KGUA 4ME5A 3HZXA 2F0NA 2PZUA 5HGTA 2KQ3A 3D4DA 5I9PA 5CV4A 4WORA 5C5MA 2F0EA 4KJNA 5IOCA 5HURA 3NK9A 4K5VA 4PMCA 4R8NA 5K5PA 5CV9A 4J6HA 4DU9A 2EYMA 4QF4A 1SYFA 2OXPA 4EVOA 4HMJA 5CGKA 4K5WA 3EJIA 4NDXA 1SYDA 5C5LA 2EYJA 1SYGA 1STAA 5NUCA 2ENBA
chains in the Genus database with same CATH superfamily
2NN6H 4JI7Q 1PH7A 1RDPD 2F0MA 4Q0FA 4BY1B 1XJVA 4FF1A 3BYTB 1WCMH 3IFTA 1YJWA 4RWSC 2GVAA 1GUGA 5M3MB 3J81L 4OGQC 1B1ZA 2A5HA 4JC0A 4C3HB 3I4LA 1BBUA 1I3QB 1DYQA 1BXTA 1E2WA 1ESFA 3MC0B 3BG3A 2PYKA 3J81E 3CCSA 1VQMA 4DAMA 2OT2A 1I4GA 4M8AA 4A93H 2RHSB 2B2VA 3CP0A 4R4QA 3M7NA 1JMCA 1LM0A 4RG1A 4NXNL 2O5IC 3Q24A 2OTJA 3CCLA 4DR3Q 1D1IA 1LTLA 1TY2A 4JOIA 1ICWA 1TS3A 2A6ED 1DGSA 3JAMi 2ZXPA 1PDQA 2ZXOA 5C4ZA 3OTOL 1BF4A 3T1HQ 1IBMQ 5IYDG 1UE7A 1X54A 3G4SA 1GUSA 3J81j 1SXTA 5EQ0A 2SEBD 4IO9A 4KN7C 2A73B 2XRQD 3QOJA 4IUVA 1PRTF 1X3GA 3J7YW 3LWEA 5I4DA 4OX9L 3RNUA 3VR2A 2NVXB 1G91A 1PXUA 4ZYSA 4X64L 1Z47A 4DR7L 3H0GH 2K14A 5C4XH 3NELA 3R3OA 1ILQA 1TS5A 2HT1A 1NY4A 3I4NH 3GTMB 1BNZA 2UXDQ 3I70A 1KLGD 3KF8B 4DR5Q 2OWOA 1ICFB 4OL7A 2PCFB 4LF4Q 4JI4L 4JVZA 5CORA 2CQOA 2F0KA 1WTOA 5HY6A 1KABA 1IKLA 3NSWA 2MHVA 3KBXA 3ULJA 2ZJRA 5IWAL 1HNXL 5C44G 3HOXB 2F4VQ 4LF9L 5LHY1 5M3MH 5I2YA 3K5OA 1DD2A 4DN4M 2EZVA 1PFBA 3NWSA 4K5VA 3HS0C 2VW9A 1D6EC 1I3QH 3C46A 4DAYB 4HMJA 1ET6A 5LMNQ 2KVMA 3OOCA 3F8TA 1BO0A 4P75A 2TSSA 1F2YA 4HMIA 4YWLA 1G8ZD 4XTCS 3OIPA 3S15H 3FPPA 2F0UA 4YCWA 3N52A 4DV3L 1SE8A 3ERSX 4HN7A 2VUMB 4DK6C 1TQOA 4L5TA 1HTPA 3X3NA 1PA6A 4ZLTF 4V190 4GKKL 1YITA 3J80L 3E3XA 4O1NA 2JE6I 4OWTB 2EJGC 2AWNA 4A3BH 2K33A 4B3SL 2L4NA 2P5ZX 1EL0A 1PYBA 3H94A 4FF4A 1NE3A 1SR3A 3S1RH 4JOIC 2JA8G 3T56B 3GTGB 1V1QA 3J80E 2NB0A 3NE5B 2VS1A 4NXML 3K59A 4BBSG 1VQ6A 3P1HA 3HKZB 1K83B 4RCNA 4A3EH 3PUZA 1XPOA 3HOYG 1EQRA 5DEHA 3MA2B 4IJHA 3V05A 1V1PA 4QIWB 5EKIA 1WI5A 3KOJA 5IODA 4NMZA 5BN3A 3NP8A 2F0DA 4JI5L 5AJ3L 1CHPD 3MZ5A 3SEBA 2XN9C 1LO5D 3HOXH 4JV5Q 4HCSA 3EN2A 3T4AC 4K2KA 4NW2A 4GLXA 1JB3A 4TRDA 2R93G 2NTSA 1VQHA 2E2DC 4FDBA 2L9HA 4R1JA 1HNWL 4HR7B 4MTNA 1L0YB 2EYLA 2YTXA 2WKCA 3CC2A 5EPJA 2D0PA 1OXVA 2WKDA 4B08A 4GLVB 5JOBA 2L55A 2QKIC 2KCNA 3GTLB 4ME5A 4C1NI 4IUTA 2LMCB 2VUMH 5IOCA 4LWCA 3ND8A 1LT4D 4PZ6A 2A8VA 1BOSA 4A3GG 1TWGH 1JT8A 3PF5A 1Y1VG 4ZKBB 1STAA 5NUCA 1KRSA 3K5MA 1WFQA 2DJFC 3TBIB 2NBFA 2ZM6L 3KK7A 1CA6A 2PW5A 1JCKB 1M8AA 2EYFA 1RCVD 4KKTA 3KBGA 1L1OA 1T5XD 3JAMc 3GTGH 4GNXC 5IP9G 1CQFA 2Q2IA 2ZJPA 4P73A 1A3UA 1JICA 5GAGC 4TQUS 2B3GA 4B3TL 4ZUJA 4A3CG 1Q46A 2D0OA 3GTPB 2MGSA 2PPBC 1MI2A 3BZKA 1EOTA 4GOPA 1VQ5A 1R9TH 1CKMA 1SYBA 1HPCA 4DK0A 3KLWA 3D31A 1MJEA 4B9WA 4WJWA 3G71A 1KAWA 2LS01 2Y0SE 4C3IG 2UXBQ 1QJOA 1EWIA 5KIXA 2A69C 1QVFA 3HOWB 2WB1B 3E0EA 1SSOA 1CI3M 1WTQA 1XPUA 3TP6A 2F0FA 2QGQA 3U58A 3C2PA 3HOVG 4G7HC 1NUCA 1S5CD 2KHJA 5CC4A 1STEA 3T51B 4LFCQ 3NXWA 5C44H 1GVPA 1M1KC 2HHHQ 3LNNA 2A68C 4ULLA 5DNFA 3GTLH 1YBYA 3D6WA 3BVZA 1STBA 3PUWA 2YYZA 4XT3B 1RHPA 1D8LA 1AN8A 3CQZB 4ILWA 4KY6A 4KN4C 1SNCA 4BS9A 1PHJA 3Q0AA 4ZQ3A 4H02A 2F0OA 3AFQA 4F7XA 3QO2A 1OXUA 3WDNA 2N78A 2WACA 2AQ1B 1C7YA 1QUQA 1PH3A 1B53A 2Q8RE 1J6QA 2L12A 1RJTA 2I0QA 1MBYA 4HIOA 1I6VC 1QCBD 4EVOA 3GTPH 1YNXA 3ICEA 4RCOA 2KJXA 1JJGA 1SYDA 1HXYD 1SYGA 2KBNA 3CCEA 5CV7A 5JPMC 5E1FA 4LF6L 1AP0A 1DM0B 2PQAA 2Y0SB 4DV7L 4XYQA 3PO3G 3M4PA 4PG3A 3MXNA 4K8IA 4RFBA 5C4HA 1GJXA 2K4KA 2L11A 5CBAE 1N36L 3CAMA 2PMZB 2JEBI 3A7LA 1CSPA 1FD7D 1YHAA 3HOYH 3I90A 1Z7TA 1ILPA 3F2CA 1AZPA 5E4XA 2KCCA 1IZ6A 1I6HH 3J7ZC 3KF6B 3STBC 5M5YB 4DUYQ 3S1MB 4LF8Q 4ZRZA 2XGTA 2PI2A 3W5OA 1Z9FA 2R7DA 2A69D 3SR1A 1K8MA 1PTOC 2MJ8A 3U4VA 3OSOA 3KDFA 2N88A 4HJ5A 1VQPA 2F0SA 3NTKA 1ENCA 4BBRG 3CCQA 3CQZH 2H5XA 1BR9A 1H9RA 3TP5A 5C4JH 3VR4A 3A8KE 3DWAA 5ELBA 1HNZL 3IRBA 1QWYA 1E7ZA 2A68D 4DR3L 4A3KG 1IL2A 3I55A 2EJFC 3U9SA 1W6KA 1FNWA 4X3KA 3J7AV 3K80C 3SXHA 3QR8A 1IBML 2QA4A 5D3DA 2MO1A 1SNOA 4G7ZC 4A3IB 1M4VA 1ESRA 1H9SB 3Q22A 4DV5Q 2PQEA 2R61A 3R2TA 5FK9C 5DM63 4HIKA 2F0GA 3A8IE 4DFAA 3V2TA 4A3GH 4JI0Q 4FXKC 5D65A 1V1OA 1ONLA 4L63B 1DOLA 2RKSA 4LFAQ 2NVYH 3BDOA 4DR4Q 1VQLA 2RDHA 1IXRA 4A3LH 1W3SA 1KAAA 2UXDL 2IHFA 4JI2Q 1A6XA 3V96A 1BCPB 1XXGA 4OO1I 3NTHA 5IP9H 1G6ZA 1P16A 3AMUA 5CV4A 1SEBD 2F0EA 4KJNA 4C3JG 5HURA 1F77A 4A3CH 1B2TA 1VQNA 4B3RQ 3WOEA 1H9KA 4ZCKA 1TIID 1QB5D 1GXDC 4DV6L 4FVMA 2B63B 1I5FA 2F4VL 4HIDA 1LTSD 5C5LA 1KIXA 1CA5A 1CUKA 5M5YH 2R92G 5C3EG 3TS0A 3MXGA 3S1MH 1EEFD 2UUAQ 3OWFA 3A54A 3F2DA 1W2BA 3DWQA 5LMNL 1PYWD 4CGYB 4MZ9A 4JG2A 1W6JA 5FLMH 1KDAA 1S40A 4OHJA 2Z6KC 4EGVA 3GTKB 2ES2A 3DWPA 1WD1A 1SLJA 3FMCA 3STBD 1WTRA 2PNRC 1LT5D 2CCZA 5IT9c 4X62Q 4K5XA 1GM5A 3BJUA 4LUOA 5AFWA 3NQIA 1IW7D 1PTOD 3RZDB 4A3DG 3RN2A 3GP7A 2D9UA 3QIAA 4AQYQ 4LFBQ 5JEAG 1SE2A 2E2JB 1JJ2A 4Y7NH 4ALPA 2XRSD 3EVQA 3NEMA 2NZOA 4DK1A 4R4CA 1RODA 5CR3A 1HFGA 4IOAA 4DV1L 1VQCA 2XVSA 1K73C 3DHQA 1DOKA 2EVBA 3DEPA 3PGZA 5EBDA 1CZGA 1WTPA 1K8OA 1LT6D 2WAQG 1NSNS 3TQYA 1VQ7A 4XIGS 2FXQA 3SK4A 1HJPA 3CU7A 4N9TA 4E6IA 4CHTB 3QWNA 4DXFA 1Q86C 3K58A 1B70B 1NJIC 2OEOA 3IL8A 4QL5A 5EBCA 1Q3LA 3IKJA 2B63H 3S2DB 1Y1WB 4AYBG 1EYDA 1I4QA 3PSIA 1II3A 2WAQE 1IL8A 4A93B 2MUYA 3A5UA 1NMGA 2Z9HA 5J3BA 2FMMA 1VQFA 2MNAA 4JI6Q 1TWCB 2FHTA 4JI8Q 5IYBG 2IY5B 4P71A 3OWEB 5JEAJ 2MQHA 3VR5A 4M1UB 1E2VA 1HQMC 3BYYB 2K28A 3DM1A 5GQOA 2EYJA 4RKBA 2ZT9C 1UNSA 3M7GA 1GUOA 4U68A 4KTAA 3GQBA 3RZDH 2E2HB 1WTWA 1PTOF 3QB3A 2C5CA 2F4IA 5GROA 1B8AA 4CJ2C 3CMAA 3E9HA 4BBRH 2KENA 2OCEA 1C4QA 1WOCA 2E2JH 3HKSA 1N34Q 2B2TC 4KY7A 1XMOQ 1TWHB 2I5MX 3FHWA 4A3KH 1HR0Q 4YWMA 4A3FB 2NYZD 4U673 2F0WA 1JWUD 2CHBD 1K3RA 1KNAA 4JI3Q 1H9JA 1HZCA 1FNVA 1V1PB 5JJKA 1YIJA 2E2IH 2J7ZA 1I4XA 1KDBA 3L2PA 2DY8A 1SAPA 4CDEC 5FLXL 2N49A 4IFDI 2R7ZG 5CV6A 3FKIG 4POGA 1ENAA 3MEHA 5FLXE 3S2DH 2B2UC 2VNUD 1Y1WH 3E0JA 2X6LA 3K57A 1ASZA 4I7ZC 1MJCA 1EU3A 5LL6S 3CF5A 3K6OA 1D5XC 2DGYA 3S15B 3TP7A 2MPMA 3SK5A 1TWCH 4C3JH 3NPPA 4ZUIA 3C3LA 2E5LL 5K36G 1QVCA 3NUCA 1I4HA 4LFCL 1GO3E 3CCVA 2Z4IA 1EYCA 2ICIA 1CM9A 3DMUA 5C0XI 3EQLC 1CHQD 4PZ8A 2R92H 1LTAD 1GUNA 4QUCA 3VR6A 1Y8PB 5FO9B 4B3MQ 2GN5A 4LNQA 5BN4A 2E2HH 4XQJA 4OO1G 4FXGC 4A3BB 4TKOB 2NVQB 1Y8NB 1G2TA 4ME3A 2D62A 3HRZC 1X3QA 1J8IA 3U50C 2DJGC 3K7AB 3S1RB 1YNJC 3DXJC 1L1OB 1EUJA 1PH1A 2AUKA 1SYFA 1X6OA 2L15A 1TWHH 3ULPA 4DUZL 2WFWA 4A3FH 4A3EB 2B29A 2F03A 2ENBA 4OEMB 4RHSA 4A3DH 4GOPB 1QNKA 1U9RA 2RBMA 4KK7A 1N8RC 1HZAA 2MO0A 5C3WA 1XPRA 1GHJA 1SDFA 2NWGA 4IUNA 4XQQA 3PIPA 1TXYA 4YIJA 2F0QA 1AZQA 4BA2I 4GKJQ 5FJ8G 4QGUA 1YHQA 1SJHD 1F2LA 4EX5A 1TS4A 2CH4A 3QOLA 1F2ZA 5D14A 4CKCA 3I2ZA 1D2BA 3PO2G 4G7OC 1Q1BA 3QG1A 4GS3A 1SJED 3OPOA 5T1GA 3I4OA 4H13C 3GD7A 2AHOB 2IHEA 2R6GA 2K52A 2OF1A 1FVIA 3ZYYX 4HSPA 1CKOA 5C6AA 1LV9A 4DR2L 2PI2E 1KQSA 4GNXA 4PMWA 4LF8L 4NPSA 2JSOA 2SNSA 1UUPA 1EY8A 1TWGB 4XYOA 3JAML 3VYRA 4RH6A 3J81c 2HCCA 5A2QL 3DUZA 5TSSA 4K8JA 1X32A 1JR0D 4A3JG 1XX8A 1ZEQX 2NVQH 3OMCA 4XDXA 3DLLA 5M3FG 1QILA 1S72A 3HOUG 3K7AH 3EIVA 3L9AX 1QUQB 4KHPQ 5EAYA 3NENA 1BDOA 4OIKA 2ASBA 1CTMA 1Y14B 1J5EQ 2FMCA 3ERQA 2K5HA 1IBKL 1TWAH 1XNQQ 2XIWA 4CKBA 5J1ZA 1LUZA 3ITPA 1R9TB 3TS2A 3TP8A 4JI0L 1YNJD 5I6WA 1UEAB 3HZXA 3H15A 1HQRD 2Q2UA 5HGTA 3AQQA 2PQAB 4DR4L 3L7ZC 5C5MA 3MXNB 4PMCA 4DR1Q 4JI2L 2YTVA 2EYMA 1XMQQ 1SE4A 1PTOH 4YCUA 4IPGA 1PRTB 4DPGA 1MSGA 4P74A 3CC4A 5CGKA 1J9OA 1RL2A 2OQKA 4C2MB 3BZCA 4B3RL 2ALYB 1XTDA 1Q1EA 5C44B 2JK8A 1DZ1A 2JYOA 1NMFA 3BVGA 3UDXA 3KJPA 5EGTA 2K01A 4UP7A 3M3YB 2D2CC 1PFSA 2V1CC 1I50B 2ZTDA 3MHBA 4F87A 3KDFB 1QZHA 1A2UA 2UUAL 3MEFA 3GO5A 1T5EA 2EY6A 2NZ1D 4MHEA 5BR8Q 4EQPA 3KYHC 2UXCQ 4GN4B 2OQ0A 1PH9A 1LYLA 2E76C 3W3AA 4DR6L 1N9WA 1YEZA 1EFWA 3TRZA 1V8QA 2E75C 3LGJA 1HH2P 1FR3A 1U4RA 2L1BA 4RGNA 4IFDG 4X62L 1PZKD 1WYDA 2K1BA 1DXMA 4IJLA 3PIOA 5IYDH 1HRJA 5JAVA 5H1SE 1TR5A 4JBMA 1VMPA 1VQDA 4LFBL 4OO1H 1V9PA 1PVOA 2Z4HA 1L0WA 4PNYA 4S3SA 1HA5A 1VQGA 1KC8C 2OTLA 2JA8B 3H09A 3S2HB 4J1MA 1EYGA 5I9OA 2ATWA 2I5LX 1LT3D 4BBSB 4O2DA 3J80c 3A8JE 2JEAI 4ZKCB 4X3TA 5CV5A 5JJZA 3L0OA 2DNEA 2A74C 4WJ3M 3HOYB 1Q8KA 5C0XG 2EJMA 4PV1C 2CWAA 4R4OA 2IW3A 1WD0A 3IFDA 1I6HB 2M2LA 4C2MH 2YTYA 4YHHL 4A3MG 1IKMA 2F0JA 2EY2A 1KL9A 1E1TA 2HIXA 4OXPA 1S5FD 1PFNA 3M3YH 5EJWA 4Q5VA 2F52A 3D4DA 3RR5A 1BVSA 1I50H 4IFDJ 1SN8A 1VQJA 5FJ8H 3R93A 3AEVA 2R93B 1JJCB 2IL8A 4RA8A 5CMDA 4NXNQ 2JA7G 4JI6L 5C4JB 3I4MG 3M4YA 2K5NA 3CD6A 5ELFA 4JI8L 2N55A 1K0RA 1IYVA 1MD2D 2KCTA 3I8ZA 2F0PA 3MAQA 4L8JA 3MXUA 2F0LA 1P8LA 3F2BA 4L5SA 2BA0A 3BDLA 1IYUA 1VQBA 4OIJA 3K5LA 1JOQA 3WWVA 4RGTA 5IE8A 1EOVA 1KTKA 4A3GB 3GTOB 4DR7Q 1Y1VB 4A4IA 2EYPA 3ULLA 4FF3A 3A0JA 5GAHC 5C0XJ 2NVYB 2IWHA 2LXJA 1EYAA 1BBXC 1N34L 3DEOA 3PCOB 1N33Q 2IX1A 4L5QA 2JA8H 2QEJC 2JP1A 3A56A 5ELNA 1HR0L 3S2HH 2FINB 1NTGA 2RHQB 4YWKA 2CVRA 4N8FA 4BBSH 1LTRD 4WJ4A 4JBJA 4JI3L 3TMEA 1HTLD 4QCLA 4ABNA 2LFNA 4R4TA 4JI7L 4OWWB 5DLQE 1HNXQ 1EEID 2Z6KA 3F2UA 1M90C 4LF9Q 1X3PA 5IYCG 1F9RA 1K8GA 2J0TD 2AMCB 3T16A 4C56C 1HR0W 3D4WA 3FEWX 3A74A 1JQYD 5EPKA 1EIGA 1Y8OB 4C3IB 1PH2A 4EQNA 1JE5A 1NAPA 1IW7C 3AFPA 3MTSA 1OTCA 2KA7A 2F3WA 2R93H 3T13A 1EY9A 4X3UA 1KDCA 2LSSA 5KYLA 3HOVB 2JA9A 5KYIA 1LABA 4IQZA 3PQIA 1CQVA 3T53B 1SNPA 1ET9A 1O7LA 1Q90A 2JA6G 2B8FA 2FJ2A 3NWTA 4DV4Q 3T1HL 2O4XA 2B8GA 2I46A 2B39A 3HOZG 5LL6X 4JI1Q 2B2WC 4B3ML 3VDYA 3NK9A 5K5PA 4HAEA 2AUJD 1S5DD 2XWBB 4Y7NB 3GTOH 1TY0A 3S17B 2XWJB 1Y1VH 3UDIA 1K8AC 2CW0C 2C35B 1Q8IA 4K14A 1QNUA 3C1FA 4HCEA 3KUPA 4DR5L 3CPFA 4ZAIA 4LF4L 2WP8J 1WCMG 3D6CA 1B3QA 1AFPA 2GVBA 1SFOH 3GTQB 3HGBA 1EQVA 4I7AA 3G48A 4A75A 3T1YQ 5AJ3Q 3DM3A 1A0IA 3EA6A 1GUTA 1FGBD 2A1AA 4YY3Q 2RDGA 4JW0A 5ELEA 2SOBA 1VF5C 3RLFA 3PO3B 4GKJL 2KHIA 3KLRA 1I94Q 1HNWQ 4C3IH 2A19A 2F0VA 1YZ6A 3URYA 3HEJA 3Q6SA 1K9MC 4X66Q 1O7YA 1TKWB 5C0XH 1EWHA 1EZ6A 3UDFA 1D5MC 4QY7A 4DK3C 2B2TA 3HOVH 5JVG3 2R3ZA 4FNFA 1WTXA 5EPLA 4UAIA 5HGQA 4KKSA 4TVAB 2D5DA 2BE5C 1PFMA 3W2DA 3EFXD 4BXXG 2F0HA 3BDCA 3H0GG 1E24A 4QUFA 5M5WB 5C4XG 4BBRB 3I4NG 3I4MH 2EY1A 2F3IA 5F2DA 4X6AH 3S17H 1RKNA 1SNQA 2H4OA 4DGZA 2F1MA 4K2LA 4A3KB 1UAPA 4K6DA 4IPDA 1ZKOA 1S3OA 5A35A 4KHPL 1WTHA 2QDBA 2K6AA 2B2UA 4B3TQ 1U4PA 2SDFA 4L6TB 4CDDC 1EIYB 2KEEA 1SMXA 3NBHA 3CPWA 4BY1G 1J5EL 3HOZB 3S1QH 2E2IB 3HG9A 3S16B 4C1NK 3U4ZA 2KQ3A 5I9PA 1KNEA 1LLRD 2G9HD 1XNQL 4UP8A 2NZHA 1NNXA 4IURA 5M3MG 3GTQH 2CW0D 4YCVA 3L3OC 1UWVA 1CT1D 2L0CA 4C3HG 3CRLC 2UUBQ 2OXPA 1QZGA 4OWXB 4OONA 4JV5L 5JJLA 3OW7A 1C48A 3D3RA 3ONAB 1MKHA 4FP5D 2PZWA 4IUPA 4DR1L 3G6EA 2NTTA 1E0BA 2RA4A 1XMQL 3PO3H 3J81i 1H9MA 1MHWC 2UU9Q 1Q7YC 2PO4A 2UUCQ 5J39A 4C3JB 3NHHA 5DAUA 4H0LC 5D3IB 2AQ3B 1OXSC 3SK8A 2HQLA 4P2CB 1FYCA 5IGEA 3JC66 2XTIA 1HUMA 4NKLA 5IYCH 4GNXB 1TS2A 3NBIA 2LY7A 1UEBA 1ZYRC 2F3VA 2LXKA 1I4RA 2R92B 5C3EB 1E1OA 4AYBE 2MFIA 5DM73 4KHVA 3RMHA 4B9XA 2BH8A 4XT1B 1HFNA 3I91A 4IN3A 4LF7Q 5FKAC 2PNHA 3K0XA 4GLAC 4MIUA 5BR8L 2IPKD 1HCZA 1SNMA 2UXCL 5M5WH 2VZAA 1AE2A 2ZXRA 3MWYW 1VMCA 1A2TA 4HTHA 1IYJB 1VDZA 4KD3A 4H44C 5IGBA 1FJGQ 1TVXA 2BE5D 1YVCA 4KI0A 1NR4A 4A3DB 3GTJB 3VYTA 1IBLQ 2RF4A 2EOTA 1HZ9A 4H7BA 3NQTA 3HOZH 5E3FA 3OHXC 3S16H 2SNMA 4PQXA 4IOCA 1RD9D 3HOXG 2IT1A 2M00A 5BN5A 1A3VA 3S14B 2K50A 2GA4B 1HZBA 3S1NB 4KD4A 3RUZA 4LF6Q 1CKNA 4G57A 4MTKA 1YHBA 4AH6A 3G7LA 2WAQB 2UXBL 3KFUA 3FP9A 4LF5Q 1EY0A 4QMGA 1DOMA 1Q12A 5LMUQ 1DCZA 1X3FA 1FNUA 2KCMA 3TSSA 1NBWA 2VUMG 5CV9A 4DU9A 2E8GA 2WINB 2HHHL 3CRKC 3EBEA 4AYBB 4CJ1B 2HDLA 5C3EH 1N32Q 4UDUC 2AKWB 3G6JB 2CKZB 1KRTA 4PMBA 1B4OA 1KLUD 4UHVA 4KV6A 1K3BC 1EY5A 1Q82C 1HNZQ 1SMYD 1TWFB 1LTBD 1HA6A 1XNRQ 4J8QA 2KHSA 3HP3A 2HIVA 3W1GA 3SHLA 3P75A 1ZYRD 1BUVT 1S4ZA 3RN5A 1FL0A 2PZTA 3HKZG 2V4DA 3E6ZX 3J80i 2IX0A 1PMRA 4FO2A 4UP9A 1TWAB 3D8GA 4CDFC 3GTJH 3M85A 4IZ8A 4BXXH 2BCOA 2O2LD 1H95A 2X69A 5IP7G 4J15A 2WV6D 5JEAH 1EY7A 3J7AF 2K04A 3S14H 4LUVA 5IGDA 2IX3A 2RDFA 3S1NH 2QW7A 1I4PA 5M5XB 3CCUA 1N33L 1PTOB 1HHVA 1O80A 3HKZE 4N8X1 1XTCD 2I5HA 2HQEA 4DAPA 1Z6HA 4DNRB 1PZJD 5JPNC 2VB2X 2PW7A 4QIWE 4BY1H 4DKAC 1F2MA 4DV6Q 1E3PA 1AW7A 2AQ2B 3NTIA 4ID6A 2H1EA 1QVGA 1F9SA 2R7ZB 3FKIB 4C3HH 1A3TA 5FOBB 4DUYL 2K5VA 4JPBW 4CDCC 3U9OA 3I7FA 3MVVA 1BCPC 2VL6A 2QDLA 3WOFA 5FLXc 2L5TA 4RAUC 5IGGA 3RLNA 4K0KQ 2JXMB 3H3VI 1B50A 3ER0A 1B9NA 3VYSA 4X65Q 3JAME 4WFN3 1TWFH 2F0NA 5IYBH 5A2QE 3K5NA 1Y69U 1PH5A 1VQAA 1ASYA 1YJNA 2BDNA 3H3VC 5IY0A 1VQOA 5JVH3 4DV4L 2QCPX 4DV5L 4K5WA 2B2VC 4FF2A 4JI1L 2BDOA 4L5RC 4KJOA 2NVXH 4KY5A 4DV0Q 2K7VA 4LUZA 1G291 3EROA 3VYUA 4DV1Q 1U4MA 4LW1A 4CJ0B 2MP1A 4Z9CB 3P7JA 4LFAL 1STYA 4GN3B 5IGFA 3GTMH 1SYEA 5M5XH 1SE3A 2Z8LA 3I56A 3HOWG 2WB1G 2FFKB 3K7UC 4JYAQ 4FXDA 3CCJA 2DNCA 4JK1C 1CZWA 1JORA 5KNDA 2HUGA 4JBWA 2O5JC 3KLSA 3T1YL 1EIHA 4I65A 1YI2A 4DAVA 1B7YB 2NN6I 4IUQA 3S9WA 2AWOA 2VQFQ 5ISRA 4YY3L 4EQ5A 2R7ZH 1EQTA 3FKIH 4LMQD 3W1BA 4HJAA 3S24A 2Q8IB 3C1EA 2Z0SA 1I94L 2WB1E 2RCNA 1X65A 1S5ED 2ZTCA 2VQEQ 1TT2A 5GAEC 1EQQA 3LX0A 3TDQA 4ODGA 3PO2B 4R9WA 2A6HC 4X66L 1VQEA 5J22A 1RTNA 2EPBA 2ID0A 1X55A 1WVLA 3TZUA 3B6YA 4AIMA 3A55A 1OXTA 1G6PA 2DY7A 1IHZA 1O78A 5K36H 3H91A 3N6RA 1BCPD 1STHA 2JJQA 4GN5A 5CYUA 3O13A 4A76A 1C9OA 1RIPA 4AQYL 1LACA 3QJYA 1TU2B 3PV0A 4A3JB 4A3LG 5ELOA 1A15A 2HCIA 3RZOB 4DV2Q 1GD7A 2F0TA 2RVLA 4RHRA 5M3FB 5GADC 1UE1A 2Y0SG 4PZ7A 2K5DA 3HOUB 4WORA 4X3SA 2HDMA 3KF8A 1VS0A 2JQOA 1K83H 1VF7A 4R4IA 1UE6A 1JC7A 4BWGB 2KOLA 2DUDA 3EJIA 4NDXA 1K0SA 4XQNA 3PF4A 1C0AA 5IP7H 1LTID 2UUBL 4DNIA 2Q8TA 1RF2D 1O7ZA 3UI2A 1HUNA 1PYSB 1YNNC 4LJZC 4DAYA 2WIIB 1VQ8A 2ICEC 1ML0D 5FLMG 2JA5G 2PMZE 1AE3A 2JN4A 2B2WA 1KD1C 3PUYA 2UU9L 1FGUA 5FO8B 3SGIA 3OMGA 2UUCL 1UE5A 4UY8C 5T1IA 2E5LQ 1EY4A 3PO2H 2KEDA 3I3CA 3M4QA 2EXZA 4HJ9A 3OTOQ 4ZK9B 1C8CA 3VR3A 3SE0A 4A3IG 4DNTB 4MN3A 2EYOA 1G2SA 3F1ZA 5ELCA 1BCPF 4OX9Q 4LF7L 4UPAA 3K0YA 3ZJYC 4X64Q 2A6HD 1QOHA 1PH8A 5KNCA 1QE6A 4R8IA 4A3JH 3RZOH 1NR2A 3BZDB 3KLSX 4LAAA 4DUZQ 2B2YA 5M3FH 4IPCA 1XMOL 4JI4Q 1GUWA 3HOUH 3D0FA 4F8MA 3NBHB 1MSHA 4JCVE 1FJGL 4V0BA 1XYIA 2YV5A 3AB9A 3R8BA 1PH4A 1SFOB 4K6LA 1IBLL 2YU9B 3CMEA 5IWAQ 5L37A 4N9PA 5KEEA 4Y52H 3SK6A 2B63G 1U0LA 1CFMA 2I07B 4DA2A 2Z6BA 3PMFA 3GV3A 2QEXA 2VY3A 1L1OC 2G5DA 5KGUA 3AU7A 5FO7B 4QQBX 5G3LD 4XXEA 2PZUA 1V43A 3GDEA 2EIFA 5IT9L 1JE4A 3HOWH 3PIP3 3M4OB 4LF5L 1ENFA 1JWSD 4QF4A 3GV6A 2IJ0A 3CCRA 4GOPC 2RSOA 5LMUL 1LTTD 3I73A 5IT9E 3BU2A 4KKUA 4A3MB 3UE1A 4DV3Q 3PUXA 4APVA 1BKBA 4DR2Q 1R4PB 1F9QA 1YNND 5M9OA 3X3MA 4DF7A 1VQIA 1D7QA 1B3AA 1WTVA 5CV8A 3VA7A 2K03A 3KJOA 4GKKQ 1PH6A 1N32L 4BY7G 1BBWA 2JA5B 1KXLA 1Q81C 3RLOA 1L0XB 4B3SQ 3I4MB 4NP5A 2JA7B 1X3EA 4HIMA 3FVQA 4G4KA 2RCFA 2EQSA 2EE1A 2QF7A 1XNRL 1X56A 1OO9B 3OIQA 4NXMQ 1A8VA 4IPHA 5ELDA 2NN6G 1SYCA 3VA5A 2VXWA 5CBEE 4WRDA 4IFDH 1IBKQ 3S1QB 4RGOS 4RKLA 1JB7A 1U4LA 1AEXA 2K32A 5E7NA 5IIFA 4KMUC 4P72A 5C3XA 4JI5Q 2YU9H 2Q2HA 1SRUA 1B44D 1CKNB 2ZJQA 4QJFA 2CFMA 2EDGA 2K5QA 1Y1WG 4HJ8A 2QILA 3CXCA 2B2YC 2KECA 1AH9A 4LK1C 4HSVA 3FDTA 4A93G 3RD4A 3K8AA 1PZID 3MFGA 4DXGA 5JJIA 3TEHB 4GZYC 3FPUB 1BQQT 5G3LF 3MFYA 3I72A 3M4OH 5I2XA 3MXPA 4BA1I 4RGMA 2RSNA 2HD3A 1RTOA 3BVMA 2K75A 2F0IA 4A3MH 2ZTEA 2C9OA 1XWEA 4EQOA 1E2ZA 3A5ZB 5KNBA 2DN8A 2LKVA 1LTGD 3SVMA 1PRTC 1B9MA 1K28A 2CH4W 4CBVA 2JA5H 3TREA 1YJ9A 4R8NA 4DR6Q 4J6HA 4K0KL 1O7IA 2XSCA 2JA7H 2ZM6Q 3CHBD 4NB3A 4CKEA 4X65L 3BS1A 3UDGA 4JBKA 1SROA 1PLFA 1ZXTA 2E74C 4A3FG 3UE0A 5LMNW 2JA6B 3LWUA 4OELB 1NCVA 3TZDA 1DJRD 3OYYA 1QG7A 2X6GA 2BOSA 4A3IH 1STGA 1JOKA 3P20A 4BY7B 1OXXK 1EY6A 4POFA 2NVTB 2G9DA 2EYHA 5I6YA 3J7A5 1S5BD 1EU4A 4O42A 3PIO3 4HJ7A 4DV0L 5E4WC 3E9IA 1R4QB 4FYDA 2NUCA 1JWMD 2RQXA 1MIUA 3D4RA 3E5SA 1VCIA 4QB4A 1X9NA 1JOOA 2EY5A 5IGCA 1GKHA 4F88A 1STNA 2XNAC 4JYAL 1D5ZC 1DONA 1SNDA 1CK1A 1WCMB 3CKIB 4IUUA 4YHHQ 3K81C 1EIFA 3CC7A 2J4XA 1MGSA 1WJJA 3H6MA 3CW2C 1CSQA 1SMYC 3A7AB 3Q23A 1PV4A 2CQAA 3FRPB 4HEDA 3ND9A 2VQFL 4KLKA 5EKLA 3KF6A 2A6EC 3H3VH 1EFID 3TN2A 1L2FA 1SBBB 1E22A 1VQKA 3IAYA 4RMFA 1EWCA 4A3BG 2VB3X 1VQ4A 2VQEL 5KRUA 4IALA 3AYHB 1T9HA 2N3SA 3M9BA 4KHZA 3CCMA 1A63A 2Q2TA 3GTKH 3R2IA 1U5KA 2KUMA 1VQ9A 4TSSA 1GHKA 4A3EG 1EZ8A 2K5WA 1G51A 2JA6H 3OW2A 2BA1A 1PRTD 2TMPA 3HFZB 1GOZA 3Q8DA 1A62A 3SDZA 1H9SA 2N8NA 5EKKA 3H0GB 5COYA 4BY7H 5C4XB 1D1KA 2NVTH 3I4NB 2K05A 3PUVA 2BH2A 4MNOA 4DV2L 1KHIA 4DV7Q 4O0AA 2EXDA 2M9VA 2Z1CA 1F9PA 2CWPA 2R7FA 1N36Q
chains in the Genus database with same CATH topology
2NN6H 1RDPD 2F0MA 4Q0FA 4BY1B 4FF1A 3BYTB 3IFTA 4RWSC 1GUGA 5M3MB 3J81L 4OGQC 1B1ZA 2A5HA 4C3HB 3I4LA 1I3QB 1DYQA 1BXTA 1E2WA 1ESFA 3MC0B 3BG3A 2PYKA 3J81E 2OT2A 1I4GA 4M8AA 2B2VA 3M7NA 2O5IC 3Q24A 1D1IA 1TY2A 1ICWA 1TS3A 2A6ED 1BF4A 2ZXPA 1PDQA 2ZXOA 5C4ZA 1GUSA 1SXTA 5EQ0A 2SEBD 4KN7C 2A73B 2XRQD 3QOJA 4IUVA 1PRTF 3J7YW 3LWEA 5I4DA 3VR2A 2NVXB 1G91A 4ZYSA 1PXUA 1Z47A 3R3OA 1ILQA 1TS5A 3GTMB 1BNZA 3I70A 1KLGD 4OL7A 2PCFB 5CORA 2F0KA 1WTOA 1KABA 1IKLA 3NSWA 2MHVA 3KBXA 3HOXB 5LHY1 5I2YA 3K5OA 1DD2A 4DN4M 2EZVA 1PFBA 3NWSA 4K5VA 3HS0C 1D6EC 3C46A 4HMJA 1ET6A 2KVMA 3OOCA 1BO0A 2TSSA 1F2YA 4HMIA 1G8ZD 4XTCS 3OIPA 3FPPA 2F0UA 3N52A 4HN7A 2VUMB 1TQOA 1HTPA 3X3NA 4ZLTF 4V190 3J80L 4O1NA 2JE6I 2EJGC 2AWNA 2K33A 2L4NA 1EL0A 3H94A 4FF4A 3T56B 3GTGB 3J80E 2NB0A 3NE5B 3K59A 3P1HA 3HKZB 1K83B 4RCNA 3PUZA 5DEHA 3MA2B 3V05A 1V1PA 4QIWB 5EKIA 5IODA 4NMZA 5BN3A 3NP8A 2F0DA 1CHPD 3MZ5A 3SEBA 2XN9C 1LO5D 4HCSA 3T4AC 4K2KA 4NW2A 1JB3A 4TRDA 2NTSA 2E2DC 2L9HA 4HR7B 1L0YB 2EYLA 2WKCA 5EPJA 1OXVA 2WKDA 4B08A 5JOBA 2L55A 2QKIC 2KCNA 3GTLB 4ME5A 4C1NI 4IUTA 2LMCB 5IOCA 3ND8A 1LT4D 1BOSA 4ZKBB 1STAA 5NUCA 3K5MA 3TBIB 2NBFA 3KK7A 1CA6A 2PW5A 1JCKB 1M8AA 2EYFA 1RCVD 4KKTA 3KBGA 1T5XD 1CQFA 1A3UA 1JICA 4TQUS 4ZUJA 3GTPB 2MGSA 2PPBC 1MI2A 1EOTA 1SYBA 1HPCA 4DK0A 3D31A 4B9WA 4WJWA 2LS01 4C3IG 1QJOA 5KIXA 2A69C 3HOWB 2WB1B 1SSOA 1CI3M 1WTQA 3TP6A 2F0FA 3C2PA 4G7HC 1NUCA 1S5CD 5CC4A 1STEA 3T51B 3NXWA 3LNNA 2A68C 4ULLA 5DNFA 3D6WA 3BVZA 1STBA 3PUWA 2YYZA 4XT3B 1RHPA 1AN8A 3CQZB 4ILWA 4KY6A 4KN4C 1SNCA 4BS9A 3Q0AA 4ZQ3A 2F0OA 4F7XA 3QO2A 1OXUA 3WDNA 2WACA 2AQ1B 1B53A 2Q8RE 2L12A 1RJTA 1MBYA 1I6VC 1QCBD 4EVOA 4RCOA 2KJXA 1SYDA 1HXYD 1SYGA 5CV7A 5JPMC 5E1FA 1AP0A 1DM0B 2Y0SB 4XYQA 3MXNA 4K8IA 4RFBA 5C4HA 1GJXA 2L11A 5CBAE 2PMZB 2JEBI 3A7LA 1FD7D 3I90A 1Z7TA 1ILPA 1AZPA 5E4XA 2KCCA 5M5YB 3S1MB 4ZRZA 2A69D 3SR1A 1K8MA 1PTOC 2MJ8A 3OSOA 2N88A 2F0SA 3NTKA 1ENCA 1BR9A 1H9RA 3TP5A 3VR4A 3A8KE 3DWAA 5ELBA 1QWYA 2A68D 2EJFC 3U9SA 1W6KA 1FNWA 4X3KA 3J7AV 3SXHA 5D3DA 1SNOA 4G7ZC 4A3IB 1M4VA 1ESRA 1H9SB 3Q22A 2PQEA 2R61A 3R2TA 5FK9C 5DM63 2F0GA 3A8IE 4DFAA 3V2TA 4FXKC 5D65A 1V1OA 1ONLA 4L63B 1DOLA 2RKSA 3BDOA 2RDHA 1KAAA 1A6XA 3V96A 1BCPB 1XXGA 4OO1I 3NTHA 1G6ZA 3AMUA 5CV4A 1SEBD 2F0EA 4KJNA 4C3JG 5HURA 1F77A 1B2TA 3WOEA 1H9KA 1TIID 1QB5D 1GXDC 4FVMA 2B63B 1LTSD 5C5LA 1CA5A 3MXGA 1EEFD 3OWFA 3A54A 3DWQA 1PYWD 4CGYB 1W6JA 1KDAA 4OHJA 4EGVA 3GTKB 3DWPA 1WD1A 3FMCA 1WTRA 2PNRC 1LT5D 4K5XA 5AFWA 3NQIA 1IW7D 1PTOD 3RZDB 3GP7A 2D9UA 3QIAA 5JEAG 1SE2A 2E2JB 2XRSD 3EVQA 4DK1A 5CR3A 1RODA 1HFGA 2XVSA 3DHQA 1DOKA 2EVBA 3DEPA 5EBDA 1WTPA 1CZGA 1K8OA 1LT6D 1NSNS 4XIGS 3SK4A 3CU7A 4N9TA 4E6IA 4CHTB 3QWNA 4DXFA 3K58A 2OEOA 3IL8A 5EBCA 1Q3LA 3IKJA 3S2DB 1Y1WB 1EYDA 1I4QA 1II3A 1IL8A 4A93B 2MUYA 2FMMA 1TWCB 2FHTA 3OWEB 5JEAJ 3VR5A 4M1UB 1E2VA 1HQMC 3BYYB 2K28A 3DM1A 2EYJA 4RKBA 2ZT9C 1UNSA 3M7GA 1GUOA 4U68A 4KTAA 3GQBA 2E2HB 1WTWA 1PTOF 3QB3A 2C5CA 2F4IA 4CJ2C 1C4QA 2B2TC 4KY7A 1TWHB 4A3FB 2NYZD 4U673 2F0WA 1JWUD 2CHBD 1KNAA 1H9JA 1FNVA 1V1PB 2J7ZA 1I4XA 1KDBA 2DY8A 1SAPA 5FLXL 4IFDI 5CV6A 1ENAA 3MEHA 5FLXE 2B2UC 2VNUD 3E0JA 2X6LA 3K57A 4I7ZC 1EU3A 5LL6S 3K6OA 1D5XC 3S15B 3TP7A 2MPMA 3SK5A 3NPPA 4ZUIA 3C3LA 5K36G 3NUCA 1I4HA 2Z4IA 1EYCA 2ICIA 1CM9A 3DMUA 5C0XI 3EQLC 1CHQD 1LTAD 1GUNA 4QUCA 3VR6A 1Y8PB 5FO9B 5BN4A 4XQJA 4OO1G 4FXGC 4A3BB 4TKOB 2NVQB 1Y8NB 1G2TA 2D62A 3HRZC 1X3QA 1J8IA 3K7AB 3S1RB 1YNJC 3DXJC 2AUKA 1SYFA 4A3EB 2F03A 2ENBA 4RHSA 1QNKA 1U9RA 2RBMA 4KK7A 5C3WA 1GHJA 1SDFA 2NWGA 4IUNA 4XQQA 4YIJA 2F0QA 1AZQA 4BA2I 1SJHD 1F2LA 1TS4A 3QOLA 1F2ZA 5D14A 4CKCA 1D2BA 4G7OC 1Q1BA 3QG1A 1SJED 3OPOA 5T1GA 4H13C 3GD7A 2R6GA 2OF1A 3ZYYX 4HSPA 5C6AA 1LV9A 4PMWA 2JSOA 2SNSA 1UUPA 1EY8A 1TWGB 4XYOA 3JAML 3VYRA 4RH6A 2HCCA 5A2QL 3DUZA 5TSSA 4K8JA 1X32A 1JR0D 1XX8A 1ZEQX 3OMCA 4XDXA 1QILA 3L9AX 1BDOA 4OIKA 1CTMA 2FMCA 3ERQA 2XIWA 4CKBA 5J1ZA 3ITPA 1R9TB 3TP8A 1YNJD 5I6WA 1UEAB 3HZXA 1HQRD 5HGTA 3L7ZC 5C5MA 4PMCA 2EYMA 1SE4A 1PTOH 1PRTB 1MSGA 5CGKA 1J9OA 4C2MB 1Q1EA 5C44B 1DZ1A 2JYOA 3BVGA 5EGTA 2K01A 3M3YB 2D2CC 1I50B 3MHBA 4F87A 1A2UA 3GO5A 1T5EA 2EY6A 2NZ1D 4MHEA 4EQPA 2E76C 3W3AA 1V8QA 2E75C 1FR3A 1U4RA 2L1BA 4RGNA 4IFDG 1PZKD 2K1BA 1DXMA 1HRJA 5JAVA 1TR5A 1VMPA 4OO1H 2Z4HA 4PNYA 4S3SA 1HA5A 2JA8B 3H09A 3S2HB 4J1MA 5I9OA 1LT3D 4BBSB 3A8JE 2JEAI 4ZKCB 4X3TA 5CV5A 5JJZA 2DNEA 2A74C 3HOYB 5C0XG 2EJMA 4PV1C 2IW3A 1WD0A 3IFDA 1I6HB 2M2LA 1IKMA 2F0JA 2EY2A 1S5FD 1PFNA 5EJWA 4Q5VA 3D4DA 4IFDJ 3R93A 2R93B 2IL8A 4RA8A 5CMDA 5C4JB 3M4YA 5ELFA 2N55A 1IYVA 1MD2D 3I8ZA 2F0PA 3MAQA 4L8JA 3MXUA 2F0LA 2BA0A 3BDLA 1IYUA 4OIJA 3K5LA 1JOQA 4RGTA 1KTKA 4A3GB 3GTOB 1Y1VB 2EYPA 4FF3A 5C0XJ 2NVYB 2IWHA 1EYAA 1BBXC 3DEOA 2IX1A 2QEJC 2JP1A 3A56A 2FINB 2CVRA 1LTRD 3TMEA 1HTLD 4QCLA 4ABNA 2LFNA 1EEID 3F2UA 1X3PA 1F9RA 2J0TD 3T16A 4C56C 3D4WA 3FEWX 1JQYD 5EPKA 1EIGA 1Y8OB 4C3IB 4EQNA 1NAPA 1IW7C 3MTSA 2KA7A 2F3WA 3T13A 1EY9A 4X3UA 1KDCA 5KYLA 3HOVB 5KYIA 1LABA 4IQZA 1CQVA 3T53B 1SNPA 1ET9A 1O7LA 1Q90A 2B8FA 2FJ2A 3NWTA 2O4XA 2B8GA 2I46A 2B39A 5LL6X 2B2WC 3NK9A 5K5PA 4HAEA 2AUJD 1S5DD 2XWBB 4Y7NB 3S17B 1TY0A 2XWJB 2CW0C 1Q8IA 4K14A 1QNUA 3C1FA 4HCEA 3KUPA 4ZAIA 2WP8J 3D6CA 1AFPA 3GTQB 3HGBA 1EQVA 3EA6A 1GUTA 1FGBD 2RDGA 5ELEA 2SOBA 1VF5C 3RLFA 3PO3B 3KLRA 2F0VA 3URYA 3HEJA 3Q6SA 1O7YA 1TKWB 5C0XH 1EWHA 1EZ6A 1D5MC 2B2TA 5JVG3 2R3ZA 4FNFA 1WTXA 5EPLA 4UAIA 4KKSA 2D5DA 2BE5C 1PFMA 3W2DA 3EFXD 2F0HA 3BDCA 4QUFA 5M5WB 4BBRB 2EY1A 5F2DA 1RKNA 1SNQA 2H4OA 4DGZA 2F1MA 4K2LA 4A3KB 1UAPA 4K6DA 1ZKOA 5A35A 2QDBA 2K6AA 2B2UA 1U4PA 2SDFA 4L6TB 2KEEA 3NBHA 3HOZB 2E2IB 3HG9A 3S16B 4C1NK 2KQ3A 5I9PA 1KNEA 1LLRD 2G9HD 4IURA 2CW0D 3L3OC 1CT1D 2L0CA 4C3HG 3CRLC 2OXPA 3OW7A 1C48A 3D3RA 3ONAB 4FP5D 2PZWA 4IUPA 2NTTA 1E0BA 2RA4A 1H9MA 2PO4A 5J39A 4C3JB 3NHHA 5DAUA 4H0LC 5D3IB 2AQ3B 1OXSC 3SK8A 4P2CB 1FYCA 5IGEA 1HUMA 4NKLA 1TS2A 3NBIA 2LY7A 1ZYRC 2F3VA 1I4RA 2R92B 5C3EB 5DM73 4KHVA 3RMHA 4B9XA 4XT1B 1HFNA 3I91A 4IN3A 5FKAC 4MIUA 2IPKD 1HCZA 1SNMA 2ZXRA 3MWYW 1VMCA 1A2TA 4HTHA 1VDZA 4KD3A 4H44C 5IGBA 1TVXA 2BE5D 4KI0A 1NR4A 4A3DB 3GTJB 3VYTA 2EOTA 4H7BA 3NQTA 5E3FA 3OHXC 2SNMA 4PQXA 1RD9D 2IT1A 2M00A 5BN5A 1A3VA 3S14B 2GA4B 3S1NB 4KD4A 3RUZA 4G57A 3G7LA 2WAQB 1EY0A 4QMGA 1DOMA 1Q12A 1DCZA 1FNUA 3TSSA 5CV9A 4DU9A 2WINB 3CRKC 4AYBB 4CJ1B 2HDLA 4UDUC 3G6JB 4PMBA 1B4OA 1KLUD 4KV6A 1EY5A 1SMYD 1TWFB 1LTBD 1HA6A 4J8QA 2KHSA 3HP3A 3SHLA 3P75A 1ZYRD 1BUVT 1S4ZA 2PZTA 2V4DA 3E6ZX 2IX0A 1PMRA 4FO2A 1TWAB 3D8GA 3M85A 4IZ8A 2BCOA 2O2LD 2X69A 2WV6D 5JEAH 1EY7A 3J7AF 2K04A 5IGDA 2IX3A 2RDFA 1I4PA 5M5XB 1PTOB 1HHVA 1O80A 1XTCD 2HQEA 4DAPA 1Z6HA 4DNRB 1PZJD 5JPNC 2VB2X 2PW7A 1F2MA 1AW7A 2AQ2B 3NTIA 4ID6A 2H1EA 1F9SA 2R7ZB 3FKIB 1A3TA 5FOBB 3U9OA 3MVVA 1BCPC 3WOFA 2L5TA 4RAUC 5IGGA 2JXMB 1B50A 1B9NA 3VYSA 3JAME 4WFN3 2F0NA 5A2QE 3K5NA 1Y69U 2BDNA 3H3VC 5JVH3 2QCPX 4K5WA 2B2VC 4FF2A 2BDOA 4KJOA 4KY5A 2K7VA 1G291 3EROA 3VYUA 1U4MA 4CJ0B 2MP1A 4Z9CB 3P7JA 1STYA 5IGFA 1SYEA 1SE3A 2Z8LA 2FFKB 4FXDA 2DNCA 4JK1C 1CZWA 1JORA 5KNDA 2HUGA 4JBWA 2O5JC 3KLSA 1EIHA 4I65A 4DAVA 2NN6I 4IUQA 3S9WA 2AWOA 5ISRA 1EQTA 4LMQD 2Q8IB 3C1EA 1S5ED 1TT2A 3LX0A 3TDQA 4ODGA 3PO2B 4R9WA 2A6HC 5J22A 1RTNA 2EPBA 2ID0A 1WVLA 3TZUA 3A55A 1OXTA 2DY7A 1IHZA 1O78A 5K36H 3H91A 3N6RA 1BCPD 1STHA 5CYUA 3O13A 1LACA 3QJYA 1TU2B 3PV0A 4A3JB 3RZOB 1A15A 2HCIA 2F0TA 2RVLA 4RHRA 5M3FB 2K5DA 3HOUB 4WORA 4X3SA 2HDMA 3KF8A 1VF7A 1JC7A 4BWGB 2KOLA 3EJIA 4NDXA 4XQNA 1LTID 2Q8TA 1RF2D 1O7ZA 3UI2A 1HUNA 1YNNC 4LJZC 4DAYA 2WIIB 2ICEC 1ML0D 2B2WA 3PUYA 5FO8B 3OMGA 5T1IA 1EY4A 2KEDA 3I3CA 2EXZA 4ZK9B 1C8CA 3VR3A 3SE0A 4DNTB 4MN3A 2EYOA 1G2SA 5ELCA 1BCPF 3K0YA 2A6HD 1QOHA 5KNCA 1QE6A 4R8IA 1NR2A 3BZDB 3KLSX 4LAAA 2B2YA 1GUWA 4F8MA 1MSHA 4V0BA 1XYIA 3AB9A 3R8BA 1SFOB 4K6LA 2YU9B 4N9PA 5KEEA 3SK6A 1CFMA 2I07B 4DA2A 3PMFA 3GV3A 5KGUA 3AU7A 5FO7B 5G3LD 4XXEA 2PZUA 1V43A 5IT9L 1JE4A 3PIP3 3M4OB 1ENFA 1JWSD 4QF4A 3GV6A 2IJ0A 2RSOA 1LTTD 3I73A 5IT9E 4KKUA 4A3MB 3PUXA 1R4PB 1F9QA 1YNND 5M9OA 3X3MA 4DF7A 1B3AA 1WTVA 5CV8A 3VA7A 2K03A 2JA5B 1L0XB 3I4MB 4NP5A 2JA7B 3FVQA 4G4KA 2EE1A 2QF7A 1OO9B 3OIQA 5ELDA 2NN6G 1SYCA 3VA5A 2VXWA 5CBEE 4WRDA 4IFDH 3S1QB 4RGOS 4RKLA 1U4LA 1AEXA 2K32A 5IIFA 4KMUC 5C3XA 1B44D 2EDGA 2K5QA 2QILA 2B2YC 2KECA 4LK1C 4HSVA 3FDTA 3RD4A 1PZID 3MFGA 4DXGA 4GZYC 3FPUB 1BQQT 5G3LF 3MFYA 3I72A 5I2XA 3MXPA 4BA1I 4RGMA 2RSNA 1RTOA 3BVMA 2F0IA 2C9OA 1XWEA 4EQOA 1E2ZA 5KNBA 2DN8A 2LKVA 1LTGD 3SVMA 1PRTC 1B9MA 4CBVA 4R8NA 4J6HA 2XSCA 3CHBD 4CKEA 3BS1A 1PLFA 1ZXTA 2E74C 2JA6B 3LWUA 1NCVA 3TZDA 1DJRD 1QG7A 2X6GA 2BOSA 1STGA 1JOKA 3P20A 4BY7B 1OXXK 1EY6A 2NVTB 2G9DA 2EYHA 5I6YA 1S5BD 1EU4A 4O42A 3PIO3 5E4WC 1R4QB 4FYDA 2NUCA 1JWMD 2RQXA 3D4RA 3E5SA 1VCIA 4QB4A 1JOOA 2EY5A 5IGCA 4F88A 1STNA 2XNAC 1DONA 1D5ZC 1SNDA 1CK1A 1WCMB 3CKIB 4IUUA 2J4XA 1MGSA 3H6MA 1SMYC 3A7AB 3Q23A 2CQAA 3FRPB 4HEDA 3ND9A 5EKLA 2A6EC 1EFID 3TN2A 1SBBB 3IAYA 1EWCA 2VB3X 5KRUA 4IALA 4KHZA 3R2IA 2KUMA 4TSSA 1GHKA 1EZ8A 2K5WA 2BA1A 1PRTD 2TMPA 3SDZA 1GOZA 1H9SA 5EKKA 3H0GB 5COYA 5C4XB 1D1KA 3I4NB 2K05A 3PUVA 2M9VA 2Z1CA 1F9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K14 A;  1F2Y A;  3C1F A;  4HMI A;  4KTA A;  2PZW A;  4KJO A;  4PMB A;  1U9R A;  5CV7 A;  2F0M A;  3QB3 A;  4KY5 A;  2F0P A;  4KV6 A;  5E1F A;  1STG A;  2F0U A;  2RBM A;  1EY5 A;  4DF7 A;  2F0L A;  2PW5 A;  3ERO A;  2EYF A;  3OWF A;  5CV8 A;  1JOK A;  5EGT A;  5C3W A;  4K8I A;  1EY6 A;  3BDL A;  3D6C A;  5C4H A;  2KHS A;  3NHH A;  1STY A;  5DAU A;  2EYH A;  3MHB A;  5I6Y A;  1A3U A;  1SYE A;  5IGF A;  1JOQ A;  1EQV A;  1KDA A;  3SK8 A;  4IUN A;  3SHL A;  5IGE A;  3P75 A;  1TQO A;  1A2U A;  4KY7 A;  4YIJ A;  4ZUJ A;  2F0Q A;  4NKL A;  4NP5 A;  2PZT A;  2EY6 A;  2EYP A;  2NUC A;  3OMG A;  2PYK A;  4EQP A;  3E5S A;  2F0W A;  1JOR A;  4QB4 A;  2F3V A;  3QOL A;  1EY4 A;  4K5X A;  1F2Z A;  1JOO A;  3D8G A;  1EYA A;  2EY5 A;  1SYB A;  4KHV A;  4B9X A;  2SOB A;  4IZ8 A;  5IGC A;  2EXZ A;  4I65 A;  1STN A;  4B9W A;  1SYC A;  3VA5 A;  1SND A;  1KDB A;  4WRD A;  3S9W A;  3SR1 A;  4MIU A;  5ISR A;  1SNM A;  2F0V A;  1EY7 A;  3OSO A;  4RKL A;  5J39 A;  5IGD A;  2F0S A;  2OF1 A;  3HEJ A;  2EYO A;  1AEX A;  1ENC A;  2RDF A;  5C6A A;  3TME A;  5KIX A;  5KRU A;  3P1H A;  5CV6 A;  3H6M A;  5IIF A;  1A2T A;  4HTH A;  5C3X A;  3C1E A;  5C4Z A;  1EZ6 A;  3EVQ A;  1ENA A;  3TP5 A;  3MEH A;  5JAV A;  2SNS A;  1TR5 A;  4KD3 A;  1EY8 A;  5CR3 A;  2F0F A;  1TT2 A;  3TP6 A;  5IGB A;  5EKL A;  3LX0 A;  5DEH A;  3DHQ A;  4ODG A;  3T16 A;  2HQE A;  1NUC A;  4K8J A;  3D4W A;  5IOD A;  4NMZ A;  5CC4 A;  1NSN S;  2PW7 A;  3NP8 A;  2F0D A;  3QOJ A;  5J22 A;  3SXH A;  3NXW A;  4LAA A;  3SK4 A;  1F2M A;  4PNY A;  4H7B A;  4S3S A;  1SNO A;  3MZ5 A;  3NQT A;  3OMC A;  4N9T A;  5E3F A;  4E6I A;  4ID6 A;  3TP7 A;  2F0H A;  2SNM A;  3SK5 A;  4IAL A;  2PQE A;  3BDC A;  4J1M A;  4RKB A;  4EQN A;  3R3O A;  4F8M A;  2M00 A;  1IHZ A;  1STB A;  4ZUI A;  5I9O A;  1A3V A;  2F0G A;  1STH A;  4K2K A;  4KD4 A;  2OEO A;  3RUZ A;  4DFA A;  3NUC A;  3V2T A;  4G57 A;  1A3T A;  2F3W A;  2EY1 A;  4KY6 A;  3MXP A;  5CV5 A;  5F2D A;  5M9O A;  1RKN A;  1SNQ A;  4TRD A;  1EYC A;  1SNC A;  4OL7 A;  3T13 A;  4DGZ A;  3U9O A;  4N9P A;  1EY9 A;  3MVV A;  1KDC A;  5KEE A;  3ERQ A;  5KYL A;  4K2L A;  4ZQ3 A;  3DMU A;  2F0O A;  2RKS A;  3SK6 A;  5KYI A;  4K6D A;  2F0K A;  2EYL A;  1EZ8 A;  2F0I A;  4F7X A;  1SNP A;  1EYD A;  5J1Z A;  1KAB A;  2QDB A;  3PMF A;  3ITP A;  4EQO A;  1II3 A;  1KAA A;  5IGG A;  3TP8 A;  2WAC A;  2F0J A;  5EKK A;  5I6W A;  1EY0 A;  4QMG A;  2F0T A;  2EY2 A;  5JOB A;  2LKV A;  2O4X A;  5KGU A;  4ME5 A;  3HZX A;  2F0N A;  2PZU A;  5HGT A;  2KQ3 A;  3D4D A;  5I9P A;  5CV4 A;  4WOR A;  5C5M A;  2F0E A;  4KJN A;  5IOC A;  5HUR A;  3NK9 A;  4K5V A;  4PMC A;  4R8N A;  5K5P A;  5CV9 A;  4J6H A;  4DU9 A;  2EYM A;  4QF4 A;  1SYF A;  2OXP A;  4EVO A;  4HMJ A;  5CGK A;  4K5W A;  3EJI A;  4NDX A;  1SYD A;  5C5L A;  2EYJ A;  1SYG A;  1STA A;  5NUC A;  2ENB A; 
#chains in the Genus database with same CATH topology
 2NN6 H;  4JI7 Q;  1PH7 A;  1RDP D;  2F0M A;  4Q0F A;  4BY1 B;  1XJV A;  4FF1 A;  3BYT B;  1WCM H;  3IFT A;  1YJW A;  4RWS C;  2GVA A;  1GUG A;  5M3M B;  3J81 L;  4OGQ C;  1B1Z A;  2A5H A;  4JC0 A;  4C3H B;  3I4L A;  1BBU A;  1I3Q B;  1DYQ A;  1BXT A;  1E2W A;  1ESF A;  3MC0 B;  3BG3 A;  2PYK A;  3J81 E;  3CCS A;  1VQM A;  4DAM A;  2OT2 A;  1I4G A;  4M8A A;  4A93 H;  2RHS B;  2B2V A;  3CP0 A;  4R4Q A;  3M7N A;  1JMC A;  1LM0 A;  4RG1 A;  4NXN L;  2O5I C;  3Q24 A;  2OTJ A;  3CCL A;  4DR3 Q;  1D1I A;  1LTL A;  1TY2 A;  4JOI A;  1ICW A;  1TS3 A;  2A6E D;  1DGS A;  3JAM i;  2ZXP A;  1PDQ A;  2ZXO A;  5C4Z A;  3OTO L;  1BF4 A;  3T1H Q;  1IBM Q;  5IYD G;  1UE7 A;  1X54 A;  3G4S A;  1GUS A;  3J81 j;  1SXT A;  5EQ0 A;  2SEB D;  4IO9 A;  4KN7 C;  2A73 B;  2XRQ D;  3QOJ A;  4IUV A;  1PRT F;  1X3G A;  3J7Y W;  3LWE A;  5I4D A;  4OX9 L;  3RNU A;  3VR2 A;  2NVX B;  1G91 A;  1PXU A;  4ZYS A;  4X64 L;  1Z47 A;  4DR7 L;  3H0G H;  2K14 A;  5C4X H;  3NEL A;  3R3O A;  1ILQ A;  1TS5 A;  2HT1 A;  1NY4 A;  3I4N H;  3GTM B;  1BNZ A;  2UXD Q;  3I70 A;  1KLG D;  3KF8 B;  4DR5 Q;  2OWO A;  1ICF B;  4OL7 A;  2PCF B;  4LF4 Q;  4JI4 L;  4JVZ A;  5COR A;  2CQO A;  2F0K A;  1WTO A;  5HY6 A;  1KAB A;  1IKL A;  3NSW A;  2MHV A;  3KBX A;  3ULJ A;  2ZJR A;  5IWA L;  1HNX L;  5C44 G;  3HOX B;  2F4V Q;  4LF9 L;  5LHY 1;  5M3M H;  5I2Y A;  3K5O A;  1DD2 A;  4DN4 M;  2EZV A;  1PFB A;  3NWS A;  4K5V A;  3HS0 C;  2VW9 A;  1D6E C;  1I3Q H;  3C46 A;  4DAY B;  4HMJ A;  1ET6 A;  5LMN Q;  2KVM A;  3OOC A;  3F8T A;  1BO0 A;  4P75 A;  2TSS A;  1F2Y A;  4HMI A;  4YWL A;  1G8Z D;  4XTC S;  3OIP A;  3S15 H;  3FPP A;  2F0U A;  4YCW A;  3N52 A;  4DV3 L;  1SE8 A;  3ERS X;  4HN7 A;  2VUM B;  4DK6 C;  1TQO A;  4L5T A;  1HTP A;  3X3N A;  1PA6 A;  4ZLT F;  4V19 0;  4GKK L;  1YIT A;  3J80 L;  3E3X A;  4O1N A;  2JE6 I;  4OWT B;  2EJG C;  2AWN A;  4A3B H;  2K33 A;  4B3S L;  2L4N A;  2P5Z X;  1EL0 A;  1PYB A;  3H94 A;  4FF4 A;  1NE3 A;  1SR3 A;  3S1R H;  4JOI C;  2JA8 G;  3T56 B;  3GTG B;  1V1Q A;  3J80 E;  2NB0 A;  3NE5 B;  2VS1 A;  4NXM L;  3K59 A;  4BBS G;  1VQ6 A;  3P1H A;  3HKZ B;  1K83 B;  4RCN A;  4A3E H;  3PUZ A;  1XPO A;  3HOY G;  1EQR A;  5DEH A;  3MA2 B;  4IJH A;  3V05 A;  1V1P A;  4QIW B;  5EKI A;  1WI5 A;  3KOJ A;  5IOD A;  4NMZ A;  5BN3 A;  3NP8 A;  2F0D A;  4JI5 L;  5AJ3 L;  1CHP D;  3MZ5 A;  3SEB A;  2XN9 C;  1LO5 D;  3HOX H;  4JV5 Q;  4HCS A;  3EN2 A;  3T4A C;  4K2K A;  4NW2 A;  4GLX A;  1JB3 A;  4TRD A;  2R93 G;  2NTS A;  1VQH A;  2E2D C;  4FDB A;  2L9H A;  4R1J A;  1HNW L;  4HR7 B;  4MTN A;  1L0Y B;  2EYL A;  2YTX A;  2WKC A;  3CC2 A;  5EPJ A;  2D0P A;  1OXV A;  2WKD A;  4B08 A;  4GLV B;  5JOB A;  2L55 A;  2QKI C;  2KCN A;  3GTL B;  4ME5 A;  4C1N I;  4IUT A;  2LMC B;  2VUM H;  5IOC A;  4LWC A;  3ND8 A;  1LT4 D;  4PZ6 A;  2A8V A;  1BOS A;  4A3G G;  1TWG H;  1JT8 A;  3PF5 A;  1Y1V G;  4ZKB B;  1STA A;  5NUC A;  1KRS A;  3K5M A;  1WFQ A;  2DJF C;  3TBI B;  2NBF A;  2ZM6 L;  3KK7 A;  1CA6 A;  2PW5 A;  1JCK B;  1M8A A;  2EYF A;  1RCV D;  4KKT A;  3KBG A;  1L1O A;  1T5X D;  3JAM c;  3GTG H;  4GNX C;  5IP9 G;  1CQF A;  2Q2I A;  2ZJP A;  4P73 A;  1A3U A;  1JIC A;  5GAG C;  4TQU S;  2B3G A;  4B3T L;  4ZUJ A;  4A3C G;  1Q46 A;  2D0O A;  3GTP B;  2MGS A;  2PPB C;  1MI2 A;  3BZK A;  1EOT A;  4GOP A;  1VQ5 A;  1R9T H;  1CKM A;  1SYB A;  1HPC A;  4DK0 A;  3KLW A;  3D31 A;  1MJE A;  4B9W A;  4WJW A;  3G71 A;  1KAW A;  2LS0 1;  2Y0S E;  4C3I G;  2UXB Q;  1QJO A;  1EWI A;  5KIX A;  2A69 C;  1QVF A;  3HOW B;  2WB1 B;  3E0E A;  1SSO A;  1CI3 M;  1WTQ A;  1XPU A;  3TP6 A;  2F0F A;  2QGQ A;  3U58 A;  3C2P A;  3HOV G;  4G7H C;  1NUC A;  1S5C D;  2KHJ A;  5CC4 A;  1STE A;  3T51 B;  4LFC Q;  3NXW A;  5C44 H;  1GVP A;  1M1K C;  2HHH Q;  3LNN A;  2A68 C;  4ULL A;  5DNF A;  3GTL H;  1YBY A;  3D6W A;  3BVZ A;  1STB A;  3PUW A;  2YYZ A;  4XT3 B;  1RHP A;  1D8L A;  1AN8 A;  3CQZ B;  4ILW A;  4KY6 A;  4KN4 C;  1SNC A;  4BS9 A;  1PHJ A;  3Q0A A;  4ZQ3 A;  4H02 A;  2F0O A;  3AFQ A;  4F7X A;  3QO2 A;  1OXU A;  3WDN A;  2N78 A;  2WAC A;  2AQ1 B;  1C7Y A;  1QUQ A;  1PH3 A;  1B53 A;  2Q8R E;  1J6Q A;  2L12 A;  1RJT A;  2I0Q A;  1MBY A;  4HIO A;  1I6V C;  1QCB D;  4EVO A;  3GTP H;  1YNX A;  3ICE A;  4RCO A;  2KJX A;  1JJG A;  1SYD A;  1HXY D;  1SYG A;  2KBN A;  3CCE A;  5CV7 A;  5JPM C;  5E1F A;  4LF6 L;  1AP0 A;  1DM0 B;  2PQA A;  2Y0S B;  4DV7 L;  4XYQ A;  3PO3 G;  3M4P A;  4PG3 A;  3MXN A;  4K8I A;  4RFB A;  5C4H A;  1GJX A;  2K4K A;  2L11 A;  5CBA E;  1N36 L;  3CAM A;  2PMZ B;  2JEB I;  3A7L A;  1CSP A;  1FD7 D;  1YHA A;  3HOY H;  3I90 A;  1Z7T A;  1ILP A;  3F2C A;  1AZP A;  5E4X A;  2KCC A;  1IZ6 A;  1I6H H;  3J7Z C;  3KF6 B;  3STB C;  5M5Y B;  4DUY Q;  3S1M B;  4LF8 Q;  4ZRZ A;  2XGT A;  2PI2 A;  3W5O A;  1Z9F A;  2R7D A;  2A69 D;  3SR1 A;  1K8M A;  1PTO C;  2MJ8 A;  3U4V A;  3OSO A;  3KDF A;  2N88 A;  4HJ5 A;  1VQP A;  2F0S A;  3NTK A;  1ENC A;  4BBR G;  3CCQ A;  3CQZ H;  2H5X A;  1BR9 A;  1H9R A;  3TP5 A;  5C4J H;  3VR4 A;  3A8K E;  3DWA A;  5ELB A;  1HNZ L;  3IRB A;  1QWY A;  1E7Z A;  2A68 D;  4DR3 L;  4A3K G;  1IL2 A;  3I55 A;  2EJF C;  3U9S A;  1W6K A;  1FNW A;  4X3K A;  3J7A V;  3K80 C;  3SXH A;  3QR8 A;  1IBM L;  2QA4 A;  5D3D A;  2MO1 A;  1SNO A;  4G7Z C;  4A3I B;  1M4V A;  1ESR A;  1H9S B;  3Q22 A;  4DV5 Q;  2PQE A;  2R61 A;  3R2T A;  5FK9 C;  5DM6 3;  4HIK A;  2F0G A;  3A8I E;  4DFA A;  3V2T A;  4A3G H;  4JI0 Q;  4FXK C;  5D65 A;  1V1O A;  1ONL A;  4L63 B;  1DOL A;  2RKS A;  4LFA Q;  2NVY H;  3BDO A;  4DR4 Q;  1VQL A;  2RDH A;  1IXR A;  4A3L H;  1W3S A;  1KAA A;  2UXD L;  2IHF A;  4JI2 Q;  1A6X A;  3V96 A;  1BCP B;  1XXG A;  4OO1 I;  3NTH A;  5IP9 H;  1G6Z A;  1P16 A;  3AMU A;  5CV4 A;  1SEB D;  2F0E A;  4KJN A;  4C3J G;  5HUR A;  1F77 A;  4A3C H;  1B2T A;  1VQN A;  4B3R Q;  3WOE A;  1H9K A;  4ZCK A;  1TII D;  1QB5 D;  1GXD C;  4DV6 L;  4FVM A;  2B63 B;  1I5F A;  2F4V L;  4HID A;  1LTS D;  5C5L A;  1KIX A;  1CA5 A;  1CUK A;  5M5Y H;  2R92 G;  5C3E G;  3TS0 A;  3MXG A;  3S1M H;  1EEF D;  2UUA Q;  3OWF A;  3A54 A;  3F2D A;  1W2B A;  3DWQ A;  5LMN L;  1PYW D;  4CGY B;  4MZ9 A;  4JG2 A;  1W6J A;  5FLM H;  1KDA A;  1S40 A;  4OHJ A;  2Z6K C;  4EGV A;  3GTK B;  2ES2 A;  3DWP A;  1WD1 A;  1SLJ A;  3FMC A;  3STB D;  1WTR A;  2PNR C;  1LT5 D;  2CCZ A;  5IT9 c;  4X62 Q;  4K5X A;  1GM5 A;  3BJU A;  4LUO A;  5AFW A;  3NQI A;  1IW7 D;  1PTO D;  3RZD B;  4A3D G;  3RN2 A;  3GP7 A;  2D9U A;  3QIA A;  4AQY Q;  4LFB Q;  5JEA G;  1SE2 A;  2E2J B;  1JJ2 A;  4Y7N H;  4ALP A;  2XRS D;  3EVQ A;  3NEM A;  2NZO A;  4DK1 A;  4R4C A;  1ROD A;  5CR3 A;  1HFG A;  4IOA A;  4DV1 L;  1VQC A;  2XVS A;  1K73 C;  3DHQ A;  1DOK A;  2EVB A;  3DEP A;  3PGZ A;  5EBD A;  1CZG A;  1WTP A;  1K8O A;  1LT6 D;  2WAQ G;  1NSN S;  3TQY A;  1VQ7 A;  4XIG S;  2FXQ A;  3SK4 A;  1HJP A;  3CU7 A;  4N9T A;  4E6I A;  4CHT B;  3QWN A;  4DXF A;  1Q86 C;  3K58 A;  1B70 B;  1NJI C;  2OEO A;  3IL8 A;  4QL5 A;  5EBC A;  1Q3L A;  3IKJ A;  2B63 H;  3S2D B;  1Y1W B;  4AYB G;  1EYD A;  1I4Q A;  3PSI A;  1II3 A;  2WAQ E;  1IL8 A;  4A93 B;  2MUY A;  3A5U A;  1NMG A;  2Z9H A;  5J3B A;  2FMM A;  1VQF A;  2MNA A;  4JI6 Q;  1TWC B;  2FHT A;  4JI8 Q;  5IYB G;  2IY5 B;  4P71 A;  3OWE B;  5JEA J;  2MQH A;  3VR5 A;  4M1U B;  1E2V A;  1HQM C;  3BYY B;  2K28 A;  3DM1 A;  5GQO A;  2EYJ A;  4RKB A;  2ZT9 C;  1UNS A;  3M7G A;  1GUO A;  4U68 A;  4KTA A;  3GQB A;  3RZD H;  2E2H B;  1WTW A;  1PTO F;  3QB3 A;  2C5C A;  2F4I A;  5GRO A;  1B8A A;  4CJ2 C;  3CMA A;  3E9H A;  4BBR H;  2KEN A;  2OCE A;  1C4Q A;  1WOC A;  2E2J H;  3HKS A;  1N34 Q;  2B2T C;  4KY7 A;  1XMO Q;  1TWH B;  2I5M X;  3FHW A;  4A3K H;  1HR0 Q;  4YWM A;  4A3F B;  2NYZ D;  4U67 3;  2F0W A;  1JWU D;  2CHB D;  1K3R A;  1KNA A;  4JI3 Q;  1H9J A;  1HZC A;  1FNV A;  1V1P B;  5JJK A;  1YIJ A;  2E2I H;  2J7Z A;  1I4X A;  1KDB A;  3L2P A;  2DY8 A;  1SAP A;  4CDE C;  5FLX L;  2N49 A;  4IFD I;  2R7Z G;  5CV6 A;  3FKI G;  4POG A;  1ENA A;  3MEH A;  5FLX E;  3S2D H;  2B2U C;  2VNU D;  1Y1W H;  3E0J A;  2X6L A;  3K57 A;  1ASZ A;  4I7Z C;  1MJC A;  1EU3 A;  5LL6 S;  3CF5 A;  3K6O A;  1D5X C;  2DGY A;  3S15 B;  3TP7 A;  2MPM A;  3SK5 A;  1TWC H;  4C3J H;  3NPP A;  4ZUI A;  3C3L A;  2E5L L;  5K36 G;  1QVC A;  3NUC A;  1I4H A;  4LFC L;  1GO3 E;  3CCV A;  2Z4I A;  1EYC A;  2ICI A;  1CM9 A;  3DMU A;  5C0X I;  3EQL C;  1CHQ D;  4PZ8 A;  2R92 H;  1LTA D;  1GUN A;  4QUC A;  3VR6 A;  1Y8P B;  5FO9 B;  4B3M Q;  2GN5 A;  4LNQ A;  5BN4 A;  2E2H H;  4XQJ A;  4OO1 G;  4FXG C;  4A3B B;  4TKO B;  2NVQ B;  1Y8N B;  1G2T A;  4ME3 A;  2D62 A;  3HRZ C;  1X3Q A;  1J8I A;  3U50 C;  2DJG C;  3K7A B;  3S1R B;  1YNJ C;  3DXJ C;  1L1O B;  1EUJ A;  1PH1 A;  2AUK A;  1SYF A;  1X6O A;  2L15 A;  1TWH H;  3ULP A;  4DUZ L;  2WFW A;  4A3F H;  4A3E B;  2B29 A;  2F03 A;  2ENB A;  4OEM B;  4RHS A;  4A3D H;  4GOP B;  1QNK A;  1U9R A;  2RBM A;  4KK7 A;  1N8R C;  1HZA A;  2MO0 A;  5C3W A;  1XPR A;  1GHJ A;  1SDF A;  2NWG A;  4IUN A;  4XQQ A;  3PIP A;  1TXY A;  4YIJ A;  2F0Q A;  1AZQ A;  4BA2 I;  4GKJ Q;  5FJ8 G;  4QGU A;  1YHQ A;  1SJH D;  1F2L A;  4EX5 A;  1TS4 A;  2CH4 A;  3QOL A;  1F2Z A;  5D14 A;  4CKC A;  3I2Z A;  1D2B A;  3PO2 G;  4G7O C;  1Q1B A;  3QG1 A;  4GS3 A;  1SJE D;  3OPO A;  5T1G A;  3I4O A;  4H13 C;  3GD7 A;  2AHO B;  2IHE A;  2R6G A;  2K52 A;  2OF1 A;  1FVI A;  3ZYY X;  4HSP A;  1CKO A;  5C6A A;  1LV9 A;  4DR2 L;  2PI2 E;  1KQS A;  4GNX A;  4PMW A;  4LF8 L;  4NPS A;  2JSO A;  2SNS A;  1UUP A;  1EY8 A;  1TWG B;  4XYO A;  3JAM L;  3VYR A;  4RH6 A;  3J81 c;  2HCC A;  5A2Q L;  3DUZ A;  5TSS A;  4K8J A;  1X32 A;  1JR0 D;  4A3J G;  1XX8 A;  1ZEQ X;  2NVQ H;  3OMC A;  4XDX A;  3DLL A;  5M3F G;  1QIL A;  1S72 A;  3HOU G;  3K7A H;  3EIV A;  3L9A X;  1QUQ B;  4KHP Q;  5EAY A;  3NEN A;  1BDO A;  4OIK A;  2ASB A;  1CTM A;  1Y14 B;  1J5E Q;  2FMC A;  3ERQ A;  2K5H A;  1IBK L;  1TWA H;  1XNQ Q;  2XIW A;  4CKB A;  5J1Z A;  1LUZ A;  3ITP A;  1R9T B;  3TS2 A;  3TP8 A;  4JI0 L;  1YNJ D;  5I6W A;  1UEA B;  3HZX A;  3H15 A;  1HQR D;  2Q2U A;  5HGT A;  3AQQ A;  2PQA B;  4DR4 L;  3L7Z C;  5C5M A;  3MXN B;  4PMC A;  4DR1 Q;  4JI2 L;  2YTV A;  2EYM A;  1XMQ Q;  1SE4 A;  1PTO H;  4YCU A;  4IPG A;  1PRT B;  4DPG A;  1MSG A;  4P74 A;  3CC4 A;  5CGK A;  1J9O A;  1RL2 A;  2OQK A;  4C2M B;  3BZC A;  4B3R L;  2ALY B;  1XTD A;  1Q1E A;  5C44 B;  2JK8 A;  1DZ1 A;  2JYO A;  1NMF A;  3BVG A;  3UDX A;  3KJP A;  5EGT A;  2K01 A;  4UP7 A;  3M3Y B;  2D2C C;  1PFS A;  2V1C C;  1I50 B;  2ZTD A;  3MHB A;  4F87 A;  3KDF B;  1QZH A;  1A2U A;  2UUA L;  3MEF A;  3GO5 A;  1T5E A;  2EY6 A;  2NZ1 D;  4MHE A;  5BR8 Q;  4EQP A;  3KYH C;  2UXC Q;  4GN4 B;  2OQ0 A;  1PH9 A;  1LYL A;  2E76 C;  3W3A A;  4DR6 L;  1N9W A;  1YEZ A;  1EFW A;  3TRZ A;  1V8Q A;  2E75 C;  3LGJ A;  1HH2 P;  1FR3 A;  1U4R A;  2L1B A;  4RGN A;  4IFD G;  4X62 L;  1PZK D;  1WYD A;  2K1B A;  1DXM A;  4IJL A;  3PIO A;  5IYD H;  1HRJ A;  5JAV A;  5H1S E;  1TR5 A;  4JBM A;  1VMP A;  1VQD A;  4LFB L;  4OO1 H;  1V9P A;  1PVO A;  2Z4H A;  1L0W A;  4PNY A;  4S3S A;  1HA5 A;  1VQG A;  1KC8 C;  2OTL A;  2JA8 B;  3H09 A;  3S2H B;  4J1M A;  1EYG A;  5I9O A;  2ATW A;  2I5L X;  1LT3 D;  4BBS B;  4O2D A;  3J80 c;  3A8J E;  2JEA I;  4ZKC B;  4X3T A;  5CV5 A;  5JJZ A;  3L0O A;  2DNE A;  2A74 C;  4WJ3 M;  3HOY B;  1Q8K A;  5C0X G;  2EJM A;  4PV1 C;  2CWA A;  4R4O A;  2IW3 A;  1WD0 A;  3IFD A;  1I6H B;  2M2L A;  4C2M H;  2YTY A;  4YHH L;  4A3M G;  1IKM A;  2F0J A;  2EY2 A;  1KL9 A;  1E1T A;  2HIX A;  4OXP A;  1S5F D;  1PFN A;  3M3Y H;  5EJW A;  4Q5V A;  2F52 A;  3D4D A;  3RR5 A;  1BVS A;  1I50 H;  4IFD J;  1SN8 A;  1VQJ A;  5FJ8 H;  3R93 A;  3AEV A;  2R93 B;  1JJC B;  2IL8 A;  4RA8 A;  5CMD A;  4NXN Q;  2JA7 G;  4JI6 L;  5C4J B;  3I4M G;  3M4Y A;  2K5N A;  3CD6 A;  5ELF A;  4JI8 L;  2N55 A;  1K0R A;  1IYV A;  1MD2 D;  2KCT A;  3I8Z A;  2F0P A;  3MAQ A;  4L8J A;  3MXU A;  2F0L A;  1P8L A;  3F2B A;  4L5S A;  2BA0 A;  3BDL A;  1IYU A;  1VQB A;  4OIJ A;  3K5L A;  1JOQ A;  3WWV A;  4RGT A;  5IE8 A;  1EOV A;  1KTK A;  4A3G B;  3GTO B;  4DR7 Q;  1Y1V B;  4A4I A;  2EYP A;  3ULL A;  4FF3 A;  3A0J A;  5GAH C;  5C0X J;  2NVY B;  2IWH A;  2LXJ A;  1EYA A;  1BBX C;  1N34 L;  3DEO A;  3PCO B;  1N33 Q;  2IX1 A;  4L5Q A;  2JA8 H;  2QEJ C;  2JP1 A;  3A56 A;  5ELN A;  1HR0 L;  3S2H H;  2FIN B;  1NTG A;  2RHQ B;  4YWK A;  2CVR A;  4N8F A;  4BBS H;  1LTR D;  4WJ4 A;  4JBJ A;  4JI3 L;  3TME A;  1HTL D;  4QCL A;  4ABN A;  2LFN A;  4R4T A;  4JI7 L;  4OWW B;  5DLQ E;  1HNX Q;  1EEI D;  2Z6K A;  3F2U A;  1M90 C;  4LF9 Q;  1X3P A;  5IYC G;  1F9R A;  1K8G A;  2J0T D;  2AMC B;  3T16 A;  4C56 C;  1HR0 W;  3D4W A;  3FEW X;  3A74 A;  1JQY D;  5EPK A;  1EIG A;  1Y8O B;  4C3I B;  1PH2 A;  4EQN A;  1JE5 A;  1NAP A;  1IW7 C;  3AFP A;  3MTS A;  1OTC A;  2KA7 A;  2F3W A;  2R93 H;  3T13 A;  1EY9 A;  4X3U A;  1KDC A;  2LSS A;  5KYL A;  3HOV B;  2JA9 A;  5KYI A;  1LAB A;  4IQZ A;  3PQI A;  1CQV A;  3T53 B;  1SNP A;  1ET9 A;  1O7L A;  1Q90 A;  2JA6 G;  2B8F A;  2FJ2 A;  3NWT A;  4DV4 Q;  3T1H L;  2O4X A;  2B8G A;  2I46 A;  2B39 A;  3HOZ G;  5LL6 X;  4JI1 Q;  2B2W C;  4B3M L;  3VDY A;  3NK9 A;  5K5P A;  4HAE A;  2AUJ D;  1S5D D;  2XWB B;  4Y7N B;  3GTO H;  1TY0 A;  3S17 B;  2XWJ B;  1Y1V H;  3UDI A;  1K8A C;  2CW0 C;  2C35 B;  1Q8I A;  4K14 A;  1QNU A;  3C1F A;  4HCE A;  3KUP A;  4DR5 L;  3CPF A;  4ZAI A;  4LF4 L;  2WP8 J;  1WCM G;  3D6C A;  1B3Q A;  1AFP A;  2GVB A;  1SFO H;  3GTQ B;  3HGB A;  1EQV A;  4I7A A;  3G48 A;  4A75 A;  3T1Y Q;  5AJ3 Q;  3DM3 A;  1A0I A;  3EA6 A;  1GUT A;  1FGB D;  2A1A A;  4YY3 Q;  2RDG A;  4JW0 A;  5ELE A;  2SOB A;  1VF5 C;  3RLF A;  3PO3 B;  4GKJ L;  2KHI A;  3KLR A;  1I94 Q;  1HNW Q;  4C3I H;  2A19 A;  2F0V A;  1YZ6 A;  3URY A;  3HEJ A;  3Q6S A;  1K9M C;  4X66 Q;  1O7Y A;  1TKW B;  5C0X H;  1EWH A;  1EZ6 A;  3UDF A;  1D5M C;  4QY7 A;  4DK3 C;  2B2T A;  3HOV H;  5JVG 3;  2R3Z A;  4FNF A;  1WTX A;  5EPL A;  4UAI A;  5HGQ A;  4KKS A;  4TVA B;  2D5D A;  2BE5 C;  1PFM A;  3W2D A;  3EFX D;  4BXX G;  2F0H A;  3BDC A;  3H0G G;  1E24 A;  4QUF A;  5M5W B;  5C4X G;  4BBR B;  3I4N G;  3I4M H;  2EY1 A;  2F3I A;  5F2D A;  4X6A H;  3S17 H;  1RKN A;  1SNQ A;  2H4O A;  4DGZ A;  2F1M A;  4K2L A;  4A3K B;  1UAP A;  4K6D A;  4IPD A;  1ZKO A;  1S3O A;  5A35 A;  4KHP L;  1WTH A;  2QDB A;  2K6A A;  2B2U A;  4B3T Q;  1U4P A;  2SDF A;  4L6T B;  4CDD C;  1EIY B;  2KEE A;  1SMX A;  3NBH A;  3CPW A;  4BY1 G;  1J5E L;  3HOZ B;  3S1Q H;  2E2I B;  3HG9 A;  3S16 B;  4C1N K;  3U4Z A;  2KQ3 A;  5I9P A;  1KNE A;  1LLR D;  2G9H D;  1XNQ L;  4UP8 A;  2NZH A;  1NNX A;  4IUR A;  5M3M G;  3GTQ H;  2CW0 D;  4YCV A;  3L3O C;  1UWV A;  1CT1 D;  2L0C A;  4C3H G;  3CRL C;  2UUB Q;  2OXP A;  1QZG A;  4OWX B;  4OON A;  4JV5 L;  5JJL A;  3OW7 A;  1C48 A;  3D3R A;  3ONA B;  1MKH A;  4FP5 D;  2PZW A;  4IUP A;  4DR1 L;  3G6E A;  2NTT A;  1E0B A;  2RA4 A;  1XMQ L;  3PO3 H;  3J81 i;  1H9M A;  1MHW C;  2UU9 Q;  1Q7Y C;  2PO4 A;  2UUC Q;  5J39 A;  4C3J B;  3NHH A;  5DAU A;  4H0L C;  5D3I B;  2AQ3 B;  1OXS C;  3SK8 A;  2HQL A;  4P2C B;  1FYC A;  5IGE A;  3JC6 6;  2XTI A;  1HUM A;  4NKL A;  5IYC H;  4GNX B;  1TS2 A;  3NBI A;  2LY7 A;  1UEB A;  1ZYR C;  2F3V A;  2LXK A;  1I4R A;  2R92 B;  5C3E B;  1E1O A;  4AYB E;  2MFI A;  5DM7 3;  4KHV A;  3RMH A;  4B9X A;  2BH8 A;  4XT1 B;  1HFN A;  3I91 A;  4IN3 A;  4LF7 Q;  5FKA C;  2PNH A;  3K0X A;  4GLA C;  4MIU A;  5BR8 L;  2IPK D;  1HCZ A;  1SNM A;  2UXC L;  5M5W H;  2VZA A;  1AE2 A;  2ZXR A;  3MWY W;  1VMC A;  1A2T A;  4HTH A;  1IYJ B;  1VDZ A;  4KD3 A;  4H44 C;  5IGB A;  1FJG Q;  1TVX A;  2BE5 D;  1YVC A;  4KI0 A;  1NR4 A;  4A3D B;  3GTJ B;  3VYT A;  1IBL Q;  2RF4 A;  2EOT A;  1HZ9 A;  4H7B A;  3NQT A;  3HOZ H;  5E3F A;  3OHX C;  3S16 H;  2SNM A;  4PQX A;  4IOC A;  1RD9 D;  3HOX G;  2IT1 A;  2M00 A;  5BN5 A;  1A3V A;  3S14 B;  2K50 A;  2GA4 B;  1HZB A;  3S1N B;  4KD4 A;  3RUZ A;  4LF6 Q;  1CKN A;  4G57 A;  4MTK A;  1YHB A;  4AH6 A;  3G7L A;  2WAQ B;  2UXB L;  3KFU A;  3FP9 A;  4LF5 Q;  1EY0 A;  4QMG A;  1DOM A;  1Q12 A;  5LMU Q;  1DCZ A;  1X3F A;  1FNU A;  2KCM A;  3TSS A;  1NBW A;  2VUM G;  5CV9 A;  4DU9 A;  2E8G A;  2WIN B;  2HHH L;  3CRK C;  3EBE A;  4AYB B;  4CJ1 B;  2HDL A;  5C3E H;  1N32 Q;  4UDU C;  2AKW B;  3G6J B;  2CKZ B;  1KRT A;  4PMB A;  1B4O A;  1KLU D;  4UHV A;  4KV6 A;  1K3B C;  1EY5 A;  1Q82 C;  1HNZ Q;  1SMY D;  1TWF B;  1LTB D;  1HA6 A;  1XNR Q;  4J8Q A;  2KHS A;  3HP3 A;  2HIV A;  3W1G A;  3SHL A;  3P75 A;  1ZYR D;  1BUV T;  1S4Z A;  3RN5 A;  1FL0 A;  2PZT A;  3HKZ G;  2V4D A;  3E6Z X;  3J80 i;  2IX0 A;  1PMR A;  4FO2 A;  4UP9 A;  1TWA B;  3D8G A;  4CDF C;  3GTJ H;  3M85 A;  4IZ8 A;  4BXX H;  2BCO A;  2O2L D;  1H95 A;  2X69 A;  5IP7 G;  4J15 A;  2WV6 D;  5JEA H;  1EY7 A;  3J7A F;  2K04 A;  3S14 H;  4LUV A;  5IGD A;  2IX3 A;  2RDF A;  3S1N H;  2QW7 A;  1I4P A;  5M5X B;  3CCU A;  1N33 L;  1PTO B;  1HHV A;  1O80 A;  3HKZ E;  4N8X 1;  1XTC D;  2I5H A;  2HQE A;  4DAP A;  1Z6H A;  4DNR B;  1PZJ D;  5JPN C;  2VB2 X;  2PW7 A;  4QIW E;  4BY1 H;  4DKA C;  1F2M A;  4DV6 Q;  1E3P A;  1AW7 A;  2AQ2 B;  3NTI A;  4ID6 A;  2H1E A;  1QVG A;  1F9S A;  2R7Z B;  3FKI B;  4C3H H;  1A3T A;  5FOB B;  4DUY L;  2K5V A;  4JPB W;  4CDC C;  3U9O A;  3I7F A;  3MVV A;  1BCP C;  2VL6 A;  2QDL A;  3WOF A;  5FLX c;  2L5T A;  4RAU C;  5IGG A;  3RLN A;  4K0K Q;  2JXM B;  3H3V I;  1B50 A;  3ER0 A;  1B9N A;  3VYS A;  4X65 Q;  3JAM E;  4WFN 3;  1TWF H;  2F0N A;  5IYB H;  5A2Q E;  3K5N A;  1Y69 U;  1PH5 A;  1VQA A;  1ASY A;  1YJN A;  2BDN A;  3H3V C;  5IY0 A;  1VQO A;  5JVH 3;  4DV4 L;  2QCP X;  4DV5 L;  4K5W A;  2B2V C;  4FF2 A;  4JI1 L;  2BDO A;  4L5R C;  4KJO A;  2NVX H;  4KY5 A;  4DV0 Q;  2K7V A;  4LUZ A;  1G29 1;  3ERO A;  3VYU A;  4DV1 Q;  1U4M A;  4LW1 A;  4CJ0 B;  2MP1 A;  4Z9C B;  3P7J A;  4LFA L;  1STY A;  4GN3 B;  5IGF A;  3GTM H;  1SYE A;  5M5X H;  1SE3 A;  2Z8L A;  3I56 A;  3HOW G;  2WB1 G;  2FFK B;  3K7U C;  4JYA Q;  4FXD A;  3CCJ A;  2DNC A;  4JK1 C;  1CZW A;  1JOR A;  5KND A;  2HUG A;  4JBW A;  2O5J C;  3KLS A;  3T1Y L;  1EIH A;  4I65 A;  1YI2 A;  4DAV A;  1B7Y B;  2NN6 I;  4IUQ A;  3S9W A;  2AWO A;  2VQF Q;  5ISR A;  4YY3 L;  4EQ5 A;  2R7Z H;  1EQT A;  3FKI H;  4LMQ D;  3W1B A;  4HJA A;  3S24 A;  2Q8I B;  3C1E A;  2Z0S A;  1I94 L;  2WB1 E;  2RCN A;  1X65 A;  1S5E D;  2ZTC A;  2VQE Q;  1TT2 A;  5GAE C;  1EQQ A;  3LX0 A;  3TDQ A;  4ODG A;  3PO2 B;  4R9W A;  2A6H C;  4X66 L;  1VQE A;  5J22 A;  1RTN A;  2EPB A;  2ID0 A;  1X55 A;  1WVL A;  3TZU A;  3B6Y A;  4AIM A;  3A55 A;  1OXT A;  1G6P A;  2DY7 A;  1IHZ A;  1O78 A;  5K36 H;  3H91 A;  3N6R A;  1BCP D;  1STH A;  2JJQ A;  4GN5 A;  5CYU A;  3O13 A;  4A76 A;  1C9O A;  1RIP A;  4AQY L;  1LAC A;  3QJY A;  1TU2 B;  3PV0 A;  4A3J B;  4A3L G;  5ELO A;  1A15 A;  2HCI A;  3RZO B;  4DV2 Q;  1GD7 A;  2F0T A;  2RVL A;  4RHR A;  5M3F B;  5GAD C;  1UE1 A;  2Y0S G;  4PZ7 A;  2K5D A;  3HOU B;  4WOR A;  4X3S A;  2HDM A;  3KF8 A;  1VS0 A;  2JQO A;  1K83 H;  1VF7 A;  4R4I A;  1UE6 A;  1JC7 A;  4BWG B;  2KOL A;  2DUD A;  3EJI A;  4NDX A;  1K0S A;  4XQN A;  3PF4 A;  1C0A A;  5IP7 H;  1LTI D;  2UUB L;  4DNI A;  2Q8T A;  1RF2 D;  1O7Z A;  3UI2 A;  1HUN A;  1PYS B;  1YNN C;  4LJZ C;  4DAY A;  2WII B;  1VQ8 A;  2ICE C;  1ML0 D;  5FLM G;  2JA5 G;  2PMZ E;  1AE3 A;  2JN4 A;  2B2W A;  1KD1 C;  3PUY A;  2UU9 L;  1FGU A;  5FO8 B;  3SGI A;  3OMG A;  2UUC L;  1UE5 A;  4UY8 C;  5T1I A;  2E5L Q;  1EY4 A;  3PO2 H;  2KED A;  3I3C A;  3M4Q A;  2EXZ A;  4HJ9 A;  3OTO Q;  4ZK9 B;  1C8C A;  3VR3 A;  3SE0 A;  4A3I G;  4DNT B;  4MN3 A;  2EYO A;  1G2S A;  3F1Z A;  5ELC A;  1BCP F;  4OX9 Q;  4LF7 L;  4UPA A;  3K0Y A;  3ZJY C;  4X64 Q;  2A6H D;  1QOH A;  1PH8 A;  5KNC A;  1QE6 A;  4R8I A;  4A3J H;  3RZO H;  1NR2 A;  3BZD B;  3KLS X;  4LAA A;  4DUZ Q;  2B2Y A;  5M3F H;  4IPC A;  1XMO L;  4JI4 Q;  1GUW A;  3HOU H;  3D0F A;  4F8M A;  3NBH B;  1MSH A;  4JCV E;  1FJG L;  4V0B A;  1XYI A;  2YV5 A;  3AB9 A;  3R8B A;  1PH4 A;  1SFO B;  4K6L A;  1IBL L;  2YU9 B;  3CME A;  5IWA Q;  5L37 A;  4N9P A;  5KEE A;  4Y52 H;  3SK6 A;  2B63 G;  1U0L A;  1CFM A;  2I07 B;  4DA2 A;  2Z6B A;  3PMF A;  3GV3 A;  2QEX A;  2VY3 A;  1L1O C;  2G5D A;  5KGU A;  3AU7 A;  5FO7 B;  4QQB X;  5G3L D;  4XXE A;  2PZU A;  1V43 A;  3GDE A;  2EIF A;  5IT9 L;  1JE4 A;  3HOW H;  3PIP 3;  3M4O B;  4LF5 L;  1ENF A;  1JWS D;  4QF4 A;  3GV6 A;  2IJ0 A;  3CCR A;  4GOP C;  2RSO A;  5LMU L;  1LTT D;  3I73 A;  5IT9 E;  3BU2 A;  4KKU A;  4A3M B;  3UE1 A;  4DV3 Q;  3PUX A;  4APV A;  1BKB A;  4DR2 Q;  1R4P B;  1F9Q A;  1YNN D;  5M9O A;  3X3M A;  4DF7 A;  1VQI A;  1D7Q A;  1B3A A;  1WTV A;  5CV8 A;  3VA7 A;  2K03 A;  3KJO A;  4GKK Q;  1PH6 A;  1N32 L;  4BY7 G;  1BBW A;  2JA5 B;  1KXL A;  1Q81 C;  3RLO A;  1L0X B;  4B3S Q;  3I4M B;  4NP5 A;  2JA7 B;  1X3E A;  4HIM A;  3FVQ A;  4G4K A;  2RCF A;  2EQS A;  2EE1 A;  2QF7 A;  1XNR L;  1X56 A;  1OO9 B;  3OIQ A;  4NXM Q;  1A8V A;  4IPH A;  5ELD A;  2NN6 G;  1SYC A;  3VA5 A;  2VXW A;  5CBE E;  4WRD A;  4IFD H;  1IBK Q;  3S1Q B;  4RGO S;  4RKL A;  1JB7 A;  1U4L A;  1AEX A;  2K32 A;  5E7N A;  5IIF A;  4KMU C;  4P72 A;  5C3X A;  4JI5 Q;  2YU9 H;  2Q2H A;  1SRU A;  1B44 D;  1CKN B;  2ZJQ A;  4QJF A;  2CFM A;  2EDG A;  2K5Q A;  1Y1W G;  4HJ8 A;  2QIL A;  3CXC A;  2B2Y C;  2KEC A;  1AH9 A;  4LK1 C;  4HSV A;  3FDT A;  4A93 G;  3RD4 A;  3K8A A;  1PZI D;  3MFG A;  4DXG A;  5JJI A;  3TEH B;  4GZY C;  3FPU B;  1BQQ T;  5G3L F;  3MFY A;  3I72 A;  3M4O H;  5I2X A;  3MXP A;  4BA1 I;  4RGM A;  2RSN A;  2HD3 A;  1RTO A;  3BVM A;  2K75 A;  2F0I A;  4A3M H;  2ZTE A;  2C9O A;  1XWE A;  4EQO A;  1E2Z A;  3A5Z B;  5KNB A;  2DN8 A;  2LKV A;  1LTG D;  3SVM A;  1PRT C;  1B9M A;  1K28 A;  2CH4 W;  4CBV A;  2JA5 H;  3TRE A;  1YJ9 A;  4R8N A;  4DR6 Q;  4J6H A;  4K0K L;  1O7I A;  2XSC A;  2JA7 H;  2ZM6 Q;  3CHB D;  4NB3 A;  4CKE A;  4X65 L;  3BS1 A;  3UDG A;  4JBK A;  1SRO A;  1PLF A;  1ZXT A;  2E74 C;  4A3F G;  3UE0 A;  5LMN W;  2JA6 B;  3LWU A;  4OEL B;  1NCV A;  3TZD A;  1DJR D;  3OYY A;  1QG7 A;  2X6G A;  2BOS A;  4A3I H;  1STG A;  1JOK A;  3P20 A;  4BY7 B;  1OXX K;  1EY6 A;  4POF A;  2NVT B;  2G9D A;  2EYH A;  5I6Y A;  3J7A 5;  1S5B D;  1EU4 A;  4O42 A;  3PIO 3;  4HJ7 A;  4DV0 L;  5E4W C;  3E9I A;  1R4Q B;  4FYD A;  2NUC A;  1JWM D;  2RQX A;  1MIU A;  3D4R A;  3E5S A;  1VCI A;  4QB4 A;  1X9N A;  1JOO A;  2EY5 A;  5IGC A;  1GKH A;  4F88 A;  1STN A;  2XNA C;  4JYA L;  1D5Z C;  1DON A;  1SND A;  1CK1 A;  1WCM B;  3CKI B;  4IUU A;  4YHH Q;  3K81 C;  1EIF A;  3CC7 A;  2J4X A;  1MGS A;  1WJJ A;  3H6M A;  3CW2 C;  1CSQ A;  1SMY C;  3A7A B;  3Q23 A;  1PV4 A;  2CQA A;  3FRP B;  4HED A;  3ND9 A;  2VQF L;  4KLK A;  5EKL A;  3KF6 A;  2A6E C;  3H3V H;  1EFI D;  3TN2 A;  1L2F A;  1SBB B;  1E22 A;  1VQK A;  3IAY A;  4RMF A;  1EWC A;  4A3B G;  2VB3 X;  1VQ4 A;  2VQE L;  5KRU A;  4IAL A;  3AYH B;  1T9H A;  2N3S A;  3M9B A;  4KHZ A;  3CCM A;  1A63 A;  2Q2T A;  3GTK H;  3R2I A;  1U5K A;  2KUM A;  1VQ9 A;  4TSS A;  1GHK A;  4A3E G;  1EZ8 A;  2K5W A;  1G51 A;  2JA6 H;  3OW2 A;  2BA1 A;  1PRT D;  2TMP A;  3HFZ B;  1GOZ A;  3Q8D A;  1A62 A;  3SDZ A;  1H9S A;  2N8N A;  5EKK A;  3H0G B;  5COY A;  4BY7 H;  5C4X B;  1D1K A;  2NVT H;  3I4N B;  2K05 A;  3PUV A;  2BH2 A;  4MNO A;  4DV2 L;  1KHI A;  4DV7 Q;  4O0A A;  2EXD A;  2M9V A;  2Z1C A;  1F9P A;  2CWP A;  2R7F A;  1N36 Q; 
#chains in the Genus database with same CATH homology
 2NN6 H;  1RDP D;  2F0M A;  4Q0F A;  4BY1 B;  4FF1 A;  3BYT B;  3IFT A;  4RWS C;  1GUG A;  5M3M B;  3J81 L;  4OGQ C;  1B1Z A;  2A5H A;  4C3H B;  3I4L A;  1I3Q B;  1DYQ A;  1BXT A;  1E2W A;  1ESF A;  3MC0 B;  3BG3 A;  2PYK A;  3J81 E;  2OT2 A;  1I4G A;  4M8A A;  2B2V A;  3M7N A;  2O5I C;  3Q24 A;  1D1I A;  1TY2 A;  1ICW A;  1TS3 A;  2A6E D;  1BF4 A;  2ZXP A;  1PDQ A;  2ZXO A;  5C4Z A;  1GUS A;  1SXT A;  5EQ0 A;  2SEB D;  4KN7 C;  2A73 B;  2XRQ D;  3QOJ A;  4IUV A;  1PRT F;  3J7Y W;  3LWE A;  5I4D A;  3VR2 A;  2NVX B;  1G91 A;  4ZYS A;  1PXU A;  1Z47 A;  3R3O A;  1ILQ A;  1TS5 A;  3GTM B;  1BNZ A;  3I70 A;  1KLG D;  4OL7 A;  2PCF B;  5COR A;  2F0K A;  1WTO A;  1KAB A;  1IKL A;  3NSW A;  2MHV A;  3KBX A;  3HOX B;  5LHY 1;  5I2Y A;  3K5O A;  1DD2 A;  4DN4 M;  2EZV A;  1PFB A;  3NWS A;  4K5V A;  3HS0 C;  1D6E C;  3C46 A;  4HMJ A;  1ET6 A;  2KVM A;  3OOC A;  1BO0 A;  2TSS A;  1F2Y A;  4HMI A;  1G8Z D;  4XTC S;  3OIP A;  3FPP A;  2F0U A;  3N52 A;  4HN7 A;  2VUM B;  1TQO A;  1HTP A;  3X3N A;  4ZLT F;  4V19 0;  3J80 L;  4O1N A;  2JE6 I;  2EJG C;  2AWN A;  2K33 A;  2L4N A;  1EL0 A;  3H94 A;  4FF4 A;  3T56 B;  3GTG B;  3J80 E;  2NB0 A;  3NE5 B;  3K59 A;  3P1H A;  3HKZ B;  1K83 B;  4RCN A;  3PUZ A;  5DEH A;  3MA2 B;  3V05 A;  1V1P A;  4QIW B;  5EKI A;  5IOD A;  4NMZ A;  5BN3 A;  3NP8 A;  2F0D A;  1CHP D;  3MZ5 A;  3SEB A;  2XN9 C;  1LO5 D;  4HCS A;  3T4A C;  4K2K A;  4NW2 A;  1JB3 A;  4TRD A;  2NTS A;  2E2D C;  2L9H A;  4HR7 B;  1L0Y B;  2EYL A;  2WKC A;  5EPJ A;  1OXV A;  2WKD A;  4B08 A;  5JOB A;  2L55 A;  2QKI C;  2KCN A;  3GTL B;  4ME5 A;  4C1N I;  4IUT A;  2LMC B;  5IOC A;  3ND8 A;  1LT4 D;  1BOS A;  4ZKB B;  1STA A;  5NUC A;  3K5M A;  3TBI B;  2NBF A;  3KK7 A;  1CA6 A;  2PW5 A;  1JCK B;  1M8A A;  2EYF A;  1RCV D;  4KKT A;  3KBG A;  1T5X D;  1CQF A;  1A3U A;  1JIC A;  4TQU S;  4ZUJ A;  3GTP B;  2MGS A;  2PPB C;  1MI2 A;  1EOT A;  1SYB A;  1HPC A;  4DK0 A;  3D31 A;  4B9W A;  4WJW A;  2LS0 1;  4C3I G;  1QJO A;  5KIX A;  2A69 C;  3HOW B;  2WB1 B;  1SSO A;  1CI3 M;  1WTQ A;  3TP6 A;  2F0F A;  3C2P A;  4G7H C;  1NUC A;  1S5C D;  5CC4 A;  1STE A;  3T51 B;  3NXW A;  3LNN A;  2A68 C;  4ULL A;  5DNF A;  3D6W A;  3BVZ A;  1STB A;  3PUW A;  2YYZ A;  4XT3 B;  1RHP A;  1AN8 A;  3CQZ B;  4ILW A;  4KY6 A;  4KN4 C;  1SNC A;  4BS9 A;  3Q0A A;  4ZQ3 A;  2F0O A;  4F7X A;  3QO2 A;  1OXU A;  3WDN A;  2WAC A;  2AQ1 B;  1B53 A;  2Q8R E;  2L12 A;  1RJT A;  1MBY A;  1I6V C;  1QCB D;  4EVO A;  4RCO A;  2KJX A;  1SYD A;  1HXY D;  1SYG A;  5CV7 A;  5JPM C;  5E1F A;  1AP0 A;  1DM0 B;  2Y0S B;  4XYQ A;  3MXN A;  4K8I A;  4RFB A;  5C4H A;  1GJX A;  2L11 A;  5CBA E;  2PMZ B;  2JEB I;  3A7L A;  1FD7 D;  3I90 A;  1Z7T A;  1ILP A;  1AZP A;  5E4X A;  2KCC A;  5M5Y B;  3S1M B;  4ZRZ A;  2A69 D;  3SR1 A;  1K8M A;  1PTO C;  2MJ8 A;  3OSO A;  2N88 A;  2F0S A;  3NTK A;  1ENC A;  1BR9 A;  1H9R A;  3TP5 A;  3VR4 A;  3A8K E;  3DWA A;  5ELB A;  1QWY A;  2A68 D;  2EJF C;  3U9S A;  1W6K A;  1FNW A;  4X3K A;  3J7A V;  3SXH A;  5D3D A;  1SNO A;  4G7Z C;  4A3I B;  1M4V A;  1ESR A;  1H9S B;  3Q22 A;  2PQE A;  2R61 A;  3R2T A;  5FK9 C;  5DM6 3;  2F0G A;  3A8I E;  4DFA A;  3V2T A;  4FXK C;  5D65 A;  1V1O A;  1ONL A;  4L63 B;  1DOL A;  2RKS A;  3BDO A;  2RDH A;  1KAA A;  1A6X A;  3V96 A;  1BCP B;  1XXG A;  4OO1 I;  3NTH A;  1G6Z A;  3AMU A;  5CV4 A;  1SEB D;  2F0E A;  4KJN A;  4C3J G;  5HUR A;  1F77 A;  1B2T A;  3WOE A;  1H9K A;  1TII D;  1QB5 D;  1GXD C;  4FVM A;  2B63 B;  1LTS D;  5C5L A;  1CA5 A;  3MXG A;  1EEF D;  3OWF A;  3A54 A;  3DWQ A;  1PYW D;  4CGY B;  1W6J A;  1KDA A;  4OHJ A;  4EGV A;  3GTK B;  3DWP A;  1WD1 A;  3FMC A;  1WTR A;  2PNR C;  1LT5 D;  4K5X A;  5AFW A;  3NQI A;  1IW7 D;  1PTO D;  3RZD B;  3GP7 A;  2D9U A;  3QIA A;  5JEA G;  1SE2 A;  2E2J B;  2XRS D;  3EVQ A;  4DK1 A;  5CR3 A;  1ROD A;  1HFG A;  2XVS A;  3DHQ A;  1DOK A;  2EVB A;  3DEP A;  5EBD A;  1WTP A;  1CZG A;  1K8O A;  1LT6 D;  1NSN S;  4XIG S;  3SK4 A;  3CU7 A;  4N9T A;  4E6I A;  4CHT B;  3QWN A;  4DXF A;  3K58 A;  2OEO A;  3IL8 A;  5EBC A;  1Q3L A;  3IKJ A;  3S2D B;  1Y1W B;  1EYD A;  1I4Q A;  1II3 A;  1IL8 A;  4A93 B;  2MUY A;  2FMM A;  1TWC B;  2FHT A;  3OWE B;  5JEA J;  3VR5 A;  4M1U B;  1E2V A;  1HQM C;  3BYY B;  2K28 A;  3DM1 A;  2EYJ A;  4RKB A;  2ZT9 C;  1UNS A;  3M7G A;  1GUO A;  4U68 A;  4KTA A;  3GQB A;  2E2H B;  1WTW A;  1PTO F;  3QB3 A;  2C5C A;  2F4I A;  4CJ2 C;  1C4Q A;  2B2T C;  4KY7 A;  1TWH B;  4A3F B;  2NYZ D;  4U67 3;  2F0W A;  1JWU D;  2CHB D;  1KNA A;  1H9J A;  1FNV A;  1V1P B;  2J7Z A;  1I4X A;  1KDB A;  2DY8 A;  1SAP A;  5FLX L;  4IFD I;  5CV6 A;  1ENA A;  3MEH A;  5FLX E;  2B2U C;  2VNU D;  3E0J A;  2X6L A;  3K57 A;  4I7Z C;  1EU3 A;  5LL6 S;  3K6O A;  1D5X C;  3S15 B;  3TP7 A;  2MPM A;  3SK5 A;  3NPP A;  4ZUI A;  3C3L A;  5K36 G;  3NUC A;  1I4H A;  2Z4I A;  1EYC A;  2ICI A;  1CM9 A;  3DMU A;  5C0X I;  3EQL C;  1CHQ D;  1LTA D;  1GUN A;  4QUC A;  3VR6 A;  1Y8P B;  5FO9 B;  5BN4 A;  4XQJ A;  4OO1 G;  4FXG C;  4A3B B;  4TKO B;  2NVQ B;  1Y8N B;  1G2T A;  2D62 A;  3HRZ C;  1X3Q A;  1J8I A;  3K7A B;  3S1R B;  1YNJ C;  3DXJ C;  2AUK A;  1SYF A;  4A3E B;  2F03 A;  2ENB A;  4RHS A;  1QNK A;  1U9R A;  2RBM A;  4KK7 A;  5C3W A;  1GHJ A;  1SDF A;  2NWG A;  4IUN A;  4XQQ A;  4YIJ A;  2F0Q A;  1AZQ A;  4BA2 I;  1SJH D;  1F2L A;  1TS4 A;  3QOL A;  1F2Z A;  5D14 A;  4CKC A;  1D2B A;  4G7O C;  1Q1B A;  3QG1 A;  1SJE D;  3OPO A;  5T1G A;  4H13 C;  3GD7 A;  2R6G A;  2OF1 A;  3ZYY X;  4HSP A;  5C6A A;  1LV9 A;  4PMW A;  2JSO A;  2SNS A;  1UUP A;  1EY8 A;  1TWG B;  4XYO A;  3JAM L;  3VYR A;  4RH6 A;  2HCC A;  5A2Q L;  3DUZ A;  5TSS A;  4K8J A;  1X32 A;  1JR0 D;  1XX8 A;  1ZEQ X;  3OMC A;  4XDX A;  1QIL A;  3L9A X;  1BDO A;  4OIK A;  1CTM A;  2FMC A;  3ERQ A;  2XIW A;  4CKB A;  5J1Z A;  3ITP A;  1R9T B;  3TP8 A;  1YNJ D;  5I6W A;  1UEA B;  3HZX A;  1HQR D;  5HGT A;  3L7Z C;  5C5M A;  4PMC A;  2EYM A;  1SE4 A;  1PTO H;  1PRT B;  1MSG A;  5CGK A;  1J9O A;  4C2M B;  1Q1E A;  5C44 B;  1DZ1 A;  2JYO A;  3BVG A;  5EGT A;  2K01 A;  3M3Y B;  2D2C C;  1I50 B;  3MHB A;  4F87 A;  1A2U A;  3GO5 A;  1T5E A;  2EY6 A;  2NZ1 D;  4MHE A;  4EQP A;  2E76 C;  3W3A A;  1V8Q A;  2E75 C;  1FR3 A;  1U4R A;  2L1B A;  4RGN A;  4IFD G;  1PZK D;  2K1B A;  1DXM A;  1HRJ A;  5JAV A;  1TR5 A;  1VMP A;  4OO1 H;  2Z4H A;  4PNY A;  4S3S A;  1HA5 A;  2JA8 B;  3H09 A;  3S2H B;  4J1M A;  5I9O A;  1LT3 D;  4BBS B;  3A8J E;  2JEA I;  4ZKC B;  4X3T A;  5CV5 A;  5JJZ A;  2DNE A;  2A74 C;  3HOY B;  5C0X G;  2EJM A;  4PV1 C;  2IW3 A;  1WD0 A;  3IFD A;  1I6H B;  2M2L A;  1IKM A;  2F0J A;  2EY2 A;  1S5F D;  1PFN A;  5EJW A;  4Q5V A;  3D4D A;  4IFD J;  3R93 A;  2R93 B;  2IL8 A;  4RA8 A;  5CMD A;  5C4J B;  3M4Y A;  5ELF A;  2N55 A;  1IYV A;  1MD2 D;  3I8Z A;  2F0P A;  3MAQ A;  4L8J A;  3MXU A;  2F0L A;  2BA0 A;  3BDL A;  1IYU A;  4OIJ A;  3K5L A;  1JOQ A;  4RGT A;  1KTK A;  4A3G B;  3GTO B;  1Y1V B;  2EYP A;  4FF3 A;  5C0X J;  2NVY B;  2IWH A;  1EYA A;  1BBX C;  3DEO A;  2IX1 A;  2QEJ C;  2JP1 A;  3A56 A;  2FIN B;  2CVR A;  1LTR D;  3TME A;  1HTL D;  4QCL A;  4ABN A;  2LFN A;  1EEI D;  3F2U A;  1X3P A;  1F9R A;  2J0T D;  3T16 A;  4C56 C;  3D4W A;  3FEW X;  1JQY D;  5EPK A;  1EIG A;  1Y8O B;  4C3I B;  4EQN A;  1NAP A;  1IW7 C;  3MTS A;  2KA7 A;  2F3W A;  3T13 A;  1EY9 A;  4X3U A;  1KDC A;  5KYL A;  3HOV B;  5KYI A;  1LAB A;  4IQZ A;  1CQV A;  3T53 B;  1SNP A;  1ET9 A;  1O7L A;  1Q90 A;  2B8F A;  2FJ2 A;  3NWT A;  2O4X A;  2B8G A;  2I46 A;  2B39 A;  5LL6 X;  2B2W C;  3NK9 A;  5K5P A;  4HAE A;  2AUJ D;  1S5D D;  2XWB B;  4Y7N B;  3S17 B;  1TY0 A;  2XWJ B;  2CW0 C;  1Q8I A;  4K14 A;  1QNU A;  3C1F A;  4HCE A;  3KUP A;  4ZAI A;  2WP8 J;  3D6C A;  1AFP A;  3GTQ B;  3HGB A;  1EQV A;  3EA6 A;  1GUT A;  1FGB D;  2RDG A;  5ELE A;  2SOB A;  1VF5 C;  3RLF A;  3PO3 B;  3KLR A;  2F0V A;  3URY A;  3HEJ A;  3Q6S A;  1O7Y A;  1TKW B;  5C0X H;  1EWH A;  1EZ6 A;  1D5M C;  2B2T A;  5JVG 3;  2R3Z A;  4FNF A;  1WTX A;  5EPL A;  4UAI A;  4KKS A;  2D5D A;  2BE5 C;  1PFM A;  3W2D A;  3EFX D;  2F0H A;  3BDC A;  4QUF A;  5M5W B;  4BBR B;  2EY1 A;  5F2D A;  1RKN A;  1SNQ A;  2H4O A;  4DGZ A;  2F1M A;  4K2L A;  4A3K B;  1UAP A;  4K6D A;  1ZKO A;  5A35 A;  2QDB A;  2K6A A;  2B2U A;  1U4P A;  2SDF A;  4L6T B;  2KEE A;  3NBH A;  3HOZ B;  2E2I B;  3HG9 A;  3S16 B;  4C1N K;  2KQ3 A;  5I9P A;  1KNE A;  1LLR D;  2G9H D;  4IUR A;  2CW0 D;  3L3O C;  1CT1 D;  2L0C A;  4C3H G;  3CRL C;  2OXP A;  3OW7 A;  1C48 A;  3D3R A;  3ONA B;  4FP5 D;  2PZW A;  4IUP A;  2NTT A;  1E0B A;  2RA4 A;  1H9M A;  2PO4 A;  5J39 A;  4C3J B;  3NHH A;  5DAU A;  4H0L C;  5D3I B;  2AQ3 B;  1OXS C;  3SK8 A;  4P2C B;  1FYC A;  5IGE A;  1HUM A;  4NKL A;  1TS2 A;  3NBI A;  2LY7 A;  1ZYR C;  2F3V A;  1I4R A;  2R92 B;  5C3E B;  5DM7 3;  4KHV A;  3RMH A;  4B9X A;  4XT1 B;  1HFN A;  3I91 A;  4IN3 A;  5FKA C;  4MIU A;  2IPK D;  1HCZ A;  1SNM A;  2ZXR A;  3MWY W;  1VMC A;  1A2T A;  4HTH A;  1VDZ A;  4KD3 A;  4H44 C;  5IGB A;  1TVX A;  2BE5 D;  4KI0 A;  1NR4 A;  4A3D B;  3GTJ B;  3VYT A;  2EOT A;  4H7B A;  3NQT A;  5E3F A;  3OHX C;  2SNM A;  4PQX A;  1RD9 D;  2IT1 A;  2M00 A;  5BN5 A;  1A3V A;  3S14 B;  2GA4 B;  3S1N B;  4KD4 A;  3RUZ A;  4G57 A;  3G7L A;  2WAQ B;  1EY0 A;  4QMG A;  1DOM A;  1Q12 A;  1DCZ A;  1FNU A;  3TSS A;  5CV9 A;  4DU9 A;  2WIN B;  3CRK C;  4AYB B;  4CJ1 B;  2HDL A;  4UDU C;  3G6J B;  4PMB A;  1B4O A;  1KLU D;  4KV6 A;  1EY5 A;  1SMY D;  1TWF B;  1LTB D;  1HA6 A;  4J8Q A;  2KHS A;  3HP3 A;  3SHL A;  3P75 A;  1ZYR D;  1BUV T;  1S4Z A;  2PZT A;  2V4D A;  3E6Z X;  2IX0 A;  1PMR A;  4FO2 A;  1TWA B;  3D8G A;  3M85 A;  4IZ8 A;  2BCO A;  2O2L D;  2X69 A;  2WV6 D;  5JEA H;  1EY7 A;  3J7A F;  2K04 A;  5IGD A;  2IX3 A;  2RDF A;  1I4P A;  5M5X B;  1PTO B;  1HHV A;  1O80 A;  1XTC D;  2HQE A;  4DAP A;  1Z6H A;  4DNR B;  1PZJ D;  5JPN C;  2VB2 X;  2PW7 A;  1F2M A;  1AW7 A;  2AQ2 B;  3NTI A;  4ID6 A;  2H1E A;  1F9S A;  2R7Z B;  3FKI B;  1A3T A;  5FOB B;  3U9O A;  3MVV A;  1BCP C;  3WOF A;  2L5T A;  4RAU C;  5IGG A;  2JXM B;  1B50 A;  1B9N A;  3VYS A;  3JAM E;  4WFN 3;  2F0N A;  5A2Q E;  3K5N A;  1Y69 U;  2BDN A;  3H3V C;  5JVH 3;  2QCP X;  4K5W A;  2B2V C;  4FF2 A;  2BDO A;  4KJO A;  4KY5 A;  2K7V A;  1G29 1;  3ERO A;  3VYU A;  1U4M A;  4CJ0 B;  2MP1 A;  4Z9C B;  3P7J A;  1STY A;  5IGF A;  1SYE A;  1SE3 A;  2Z8L A;  2FFK B;  4FXD A;  2DNC A;  4JK1 C;  1CZW A;  1JOR A;  5KND A;  2HUG A;  4JBW A;  2O5J C;  3KLS A;  1EIH A;  4I65 A;  4DAV A;  2NN6 I;  4IUQ A;  3S9W A;  2AWO A;  5ISR A;  1EQT A;  4LMQ D;  2Q8I B;  3C1E A;  1S5E D;  1TT2 A;  3LX0 A;  3TDQ A;  4ODG A;  3PO2 B;  4R9W A;  2A6H C;  5J22 A;  1RTN A;  2EPB A;  2ID0 A;  1WVL A;  3TZU A;  3A55 A;  1OXT A;  2DY7 A;  1IHZ A;  1O78 A;  5K36 H;  3H91 A;  3N6R A;  1BCP D;  1STH A;  5CYU A;  3O13 A;  1LAC A;  3QJY A;  1TU2 B;  3PV0 A;  4A3J B;  3RZO B;  1A15 A;  2HCI A;  2F0T A;  2RVL A;  4RHR A;  5M3F B;  2K5D A;  3HOU B;  4WOR A;  4X3S A;  2HDM A;  3KF8 A;  1VF7 A;  1JC7 A;  4BWG B;  2KOL A;  3EJI A;  4NDX A;  4XQN A;  1LTI D;  2Q8T A;  1RF2 D;  1O7Z A;  3UI2 A;  1HUN A;  1YNN C;  4LJZ C;  4DAY A;  2WII B;  2ICE C;  1ML0 D;  2B2W A;  3PUY A;  5FO8 B;  3OMG A;  5T1I A;  1EY4 A;  2KED A;  3I3C A;  2EXZ A;  4ZK9 B;  1C8C A;  3VR3 A;  3SE0 A;  4DNT B;  4MN3 A;  2EYO A;  1G2S A;  5ELC A;  1BCP F;  3K0Y A;  2A6H D;  1QOH A;  5KNC A;  1QE6 A;  4R8I A;  1NR2 A;  3BZD B;  3KLS X;  4LAA A;  2B2Y A;  1GUW A;  4F8M A;  1MSH A;  4V0B A;  1XYI A;  3AB9 A;  3R8B A;  1SFO B;  4K6L A;  2YU9 B;  4N9P A;  5KEE A;  3SK6 A;  1CFM A;  2I07 B;  4DA2 A;  3PMF A;  3GV3 A;  5KGU A;  3AU7 A;  5FO7 B;  5G3L D;  4XXE A;  2PZU A;  1V43 A;  5IT9 L;  1JE4 A;  3PIP 3;  3M4O B;  1ENF A;  1JWS D;  4QF4 A;  3GV6 A;  2IJ0 A;  2RSO A;  1LTT D;  3I73 A;  5IT9 E;  4KKU A;  4A3M B;  3PUX A;  1R4P B;  1F9Q A;  1YNN D;  5M9O A;  3X3M A;  4DF7 A;  1B3A A;  1WTV A;  5CV8 A;  3VA7 A;  2K03 A;  2JA5 B;  1L0X B;  3I4M B;  4NP5 A;  2JA7 B;  3FVQ A;  4G4K A;  2EE1 A;  2QF7 A;  1OO9 B;  3OIQ A;  5ELD A;  2NN6 G;  1SYC A;  3VA5 A;  2VXW A;  5CBE E;  4WRD A;  4IFD H;  3S1Q B;  4RGO S;  4RKL A;  1U4L A;  1AEX A;  2K32 A;  5IIF A;  4KMU C;  5C3X A;  1B44 D;  2EDG A;  2K5Q A;  2QIL A;  2B2Y C;  2KEC A;  4LK1 C;  4HSV A;  3FDT A;  3RD4 A;  1PZI D;  3MFG A;  4DXG A;  4GZY C;  3FPU B;  1BQQ T;  5G3L F;  3MFY A;  3I72 A;  5I2X A;  3MXP A;  4BA1 I;  4RGM A;  2RSN A;  1RTO A;  3BVM A;  2F0I A;  2C9O A;  1XWE A;  4EQO A;  1E2Z A;  5KNB A;  2DN8 A;  2LKV A;  1LTG D;  3SVM A;  1PRT C;  1B9M A;  4CBV A;  4R8N A;  4J6H A;  2XSC A;  3CHB D;  4CKE A;  3BS1 A;  1PLF A;  1ZXT A;  2E74 C;  2JA6 B;  3LWU A;  1NCV A;  3TZD A;  1DJR D;  1QG7 A;  2X6G A;  2BOS A;  1STG A;  1JOK A;  3P20 A;  4BY7 B;  1OXX K;  1EY6 A;  2NVT B;  2G9D A;  2EYH A;  5I6Y A;  1S5B D;  1EU4 A;  4O42 A;  3PIO 3;  5E4W C;  1R4Q B;  4FYD A;  2NUC A;  1JWM D;  2RQX A;  3D4R A;  3E5S A;  1VCI A;  4QB4 A;  1JOO A;  2EY5 A;  5IGC A;  4F88 A;  1STN A;  2XNA C;  1DON A;  1D5Z C;  1SND A;  1CK1 A;  1WCM B;  3CKI B;  4IUU A;  2J4X A;  1MGS A;  3H6M A;  1SMY C;  3A7A B;  3Q23 A;  2CQA A;  3FRP B;  4HED A;  3ND9 A;  5EKL A;  2A6E C;  1EFI D;  3TN2 A;  1SBB B;  3IAY A;  1EWC A;  2VB3 X;  5KRU A;  4IAL A;  4KHZ A;  3R2I A;  2KUM A;  4TSS A;  1GHK A;  1EZ8 A;  2K5W A;  2BA1 A;  1PRT D;  2TMP A;  3SDZ A;  1GOZ A;  1H9S A;  5EKK A;  3H0G B;  5COY A;  5C4X B;  1D1K A;  3I4N B;  2K05 A;  3PUV A;  2M9V A;  2Z1C A;  1F9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...