5EKLA

Crystal structure of staphylococcal nuclease variant delta+phs t62d/n100e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eklA00
2EYJA 5JOBA 4DFAA 1STGA 3D6CA 1KDCA 2EY5A 2RBMA 1II3A 3EJIA 2EY1A 2F0OA 3PMFA 2PW5A 4TRDA 3RUZA 3SK8A 2EYPA 1U9RA 5I9PA 3MEHA 5KRUA 3MZ5A 2F0SA 1SNQA 1SNOA 5IGFA 3D4DA 2M00A 2F0FA 4F7XA 2EY6A 3NP8A 4K8JA 4E6IA 1ENAA 1EZ6A 3NUCA 4HMIA 5IOCA 4EQPA 5I6WA 5ISRA 1NSNS 4ME5A 2F0GA 3T13A 2EY2A 2F3VA 4KD3A 1STYA 2F0JA 2F0IA 2ENBA 4ZUIA 3NK9A 2OEOA 2EYFA 5KYIA 4EQNA 5KGUA 1EYDA 2O4XA 3TP5A 5CV8A 1SNPA 4H7BA 1TT2A 2F0MA 4K5VA 4KY5A 5IGDA 5KYLA 3C1FA 4KHVA 2NUCA 4G57A 1EZ8A 5DAUA 3OWFA 3SK6A 5C4ZA 3E5SA 3SXHA 1JORA 4IZ8A 1TQOA 3P75A 2EYHA 3S9WA 1EY6A 4F8MA 4ID6A 5KIXA 5NUCA 4PMBA 2F0DA 4R8NA 1SYDA 5CV7A 3EVQA 5CV6A 1EY7A 4HTHA 4KJOA 3D4WA 2F0QA 3OMGA 5C6AA 2EYLA 1TR5A 2WACA 5C4HA 5CV4A 5IGCA 1SNMA 2PZWA 3BDCA 2F3WA 4QF4A 3V2TA 2QDBA 5HGTA 1SYEA 1EY4A 1SYCA 3NXWA 5E3FA 4IALA 3OSOA 4IUNA 4RKLA 5M9OA 1IHZA 2EYMA 4J6HA 5F2DA 4NMZA 1STNA 3OMCA 4ZUJA 2LKVA 5IIFA 5IODA 4HMJA 4PMCA 3QB3A 1F2ZA 2RKSA 4NP5A 4KY7A 4MIUA 4ODGA 5CR3A 4S3SA 4KTAA 1F2YA 2EXZA 3R3OA 3SK5A 4ZQ3A 1KAAA 4KD4A 2F0EA 1JOOA 3H6MA 4LAAA 4N9TA 2F0TA 3SK4A 4B9XA 1A3VA 5CGKA 5KEEA 2F0UA 3HEJA 3NQTA 5IGBA 1EY8A 1STBA 2HQEA 1NUCA 5C3XA 4KJNA 4N9PA 5E1FA 5IGGA 4WORA 5J22A 3D8GA 3U9OA 5J39A 3ERQA 3ITPA 5CC4A 2PZUA 3EROA 3TP6A 1EQVA 4B9WA 2F0HA 3NHHA 3VA5A 5C5MA 3MVVA 5JAVA 3BDLA 5I6YA 5DEHA 2F0KA 4KV6A 4KY6A 5EKKA 2KQ3A 4K5XA 3MHBA 3HZXA 5CV9A 1AEXA 2KHSA 3QOJA 3TP8A 4EVOA 4NKLA 3SR1A 3TMEA 3TP7A 3SHLA 3T16A 1JOKA 4RKBA 1EY0A 1STAA 2RDFA 1EY9A 4EQOA 4OL7A 1EYCA 4K5WA 1A2TA 3P1HA 4DF7A 3C1EA 2F0LA 4J1MA 2SNMA 3DMUA 1SYBA 1STHA 4K6DA 4NDXA 4I65A 3LX0A 1A2UA 2F0NA 5CV5A 2F0VA 4QMGA 4DGZA 4K14A 2F0PA 1SNDA 5IGEA 1SYFA 1KDBA 2PZTA 5J1ZA 5C3WA 4K8IA 1KABA 4DU9A 5HURA 5K5PA 1JOQA 2PYKA 3DHQA 2OF1A 2SNSA 1F2MA 1A3UA 1EY5A 2F0WA 1SNCA 2SOBA 5C5LA 4QB4A 1ENCA 1A3TA 1EYAA 4K2KA 4YIJA 2PQEA 5EGTA 5I9OA 4PNYA 2OXPA 1KDAA 2EYOA 5EKLA 1SYGA 4WRDA 2PW7A 4K2LA 3QOLA 1RKNA 3MXPA
chains in the Genus database with same CATH superfamily
4FYDA 2Y0SB 2F4VQ 1I3QH 3MEFA 2ES2A 2NTSA 1SNQA 1SNOA 1N34Q 3PF4A 3S1QH 3HFZB 1OXSC 4JW0A 1PRTF 5CBEE 3PUVA 4RWSC 4CJ1B 1YVCA 4ME5A 3K0YA 3KDFA 3J80i 2I5HA 1ZXTA 1JB3A 4PMWA 1PH2A 3J7ZC 3FMCA 1EU3A 3TP5A 4K5VA 2CHBD 5HGQA 1CKNB 3GDEA 1JJGA 4DV1Q 4IUVA 2NVTB 4LF6Q 3E5SA 5IWAQ 3I91A 2KHIA 1OO9B 1QCBD 1F9RA 2MO1A 3AQQA 4OO1G 2Q8IB 1VQEA 2UUAQ 3CCQA 1Q8IA 1TR5A 2B2TC 3CMEA 4CKCA 1S5DD 5FK9C 2F3WA 4OX9L 3K5NA 1V1QA 3OIPA 3VR3A 3GTOB 1M1KC 1ESRA 3OMCA 1VF5C 1HH2P 1YZ6A 2E2JB 1WVLA 4A75A 3F2CA 4L5RC 1I4PA 3Q8DA 4N9TA 2R93H 2QA4A 3S24A 1STBA 5IYCH 2OWOA 3T1YQ 3DEPA 1PZJD 3PUYA 3OW7A 1HNWQ 2DNEA 1MKHA 3EROA 1X32A 4JI1Q 1V1PB 1BBXC 5JAVA 4LFBL 5I6YA 2LY7A 3HKZG 4DR1Q 3CRLC 2QKIC 2LXKA 3H09A 3TMEA 5A35A 3RMHA 1I50H 2L1BA 4RKBA 1IW7C 3I4LA 4ZCKA 2R3ZA 1WCMB 4A3FG 1SYBA 1PMRA 2R7ZH 4BA1I 2F0VA 4DGZA 1JORA 4N8X1 1L0WA 1SNDA 3VR4A 1S5BD 5C3WA 1UEBA 4O42A 5D14A 2F4IA 3RZDB 4LFCL 2SNSA 1E1TA 3FDTA 4DR5Q 3J7YW 3HOXB 4QB4A 4YIJA 3TQYA 2JA7H 5EKLA 4X66L 3CPFA 4RGNA 4A3DH 3KJPA 1Y8NB 1SE2A 2YTVA 5EAYA 1MSGA 5IYDG 4GOPC 4C1NK 4U68A 4KMUC 1HA6A 3GV3A 1H9KA 2R61A 4JBJA 2R7DA 4QIWE 3LNNA 4JYAL 3BVZA 4A3BG 3I4MH 2NWGA 2L11A 3IRBA 4UAIA 1DOKA 2A6HD 1X6OA 2BCOA 2B63H 2KECA 2C35B 1EYDA 4JI3L 4P74A 4AIMA 3VR6A 1GUGA 5M5WH 2Q2IA 1EEFD 5IYBH 2JE6I 3RZOH 3HOVG 1MJCA 4DR2L 1YITA 2JA8G 4IZ8A 1KNAA 1BQQT 2D0OA 2Q8TA 3MFGA 5C6AA 2NBFA 1UE6A 1D8LA 5EJWA 4A3IB 2XN9C 4PZ6A 1SYCA 1VQAA 3HRZC 1IHZA 2YTXA 4R4CA 2AWOA 1GUSA 1CTMA 1RDPD 3FVQA 2IWHA 3W1GA 4BY1G 4A3EG 1SAPA 3CHBD 2L9HA 1HR0W 4S3SA 2RHQB 1F2YA 2EXZA 1PRTD 4ZQ3A 1PH1A 2I46A 4XT1B 1JMCA 3RN2A 3MTSA 3LWUA 3NQTA 2ZM6L 3NWSA 4DNIA 3I4NH 2PQAA 1BOSA 1E3PA 3DWAA 2F0HA 3SE0A 2B2VA 3BS1A 3M4QA 3PV0A 4DV3L 1Y1WG 2AMCB 5C3EG 3U9SA 1ILPA 1PLFA 1PA6A 4WJ3M 3CC7A 3H0GG 4A3JG 2Y0SE 3U4VA 4MN3A 3PO3G 3K6OA 3NBHB 3E3XA 1X9NA 1B7YB 4C3IB 1V43A 4DK6C 4AQYL 1T5XD 4KN4C 4QMGA 4RCOA 4MTNA 3FRPB 4GOPA 4K8IA 1FVIA 2DJGC 4DU9A 1B53A 3DHQA 1QWYA 2JQOA 2SOBA 4IUUA 5K36G 5EPKA 2PQEA 4IPCA 4A3KG 4K2LA 1GHKA 4FVMA 1FNWA 5GROA 1PTOB 1WJJA 3PMFA 4PG3A 3RUZA 5FO9B 5BR8L 3I70A 4L8JA 1P8LA 2WP8J 1N36L 3H3VI 4F7XA 1B9MA 3AU7A 1BF4A 4LF4Q 4GZYC 4HMIA 1X3FA 4TQUS 5CYUA 2EPBA 2NVYH 5M5YH 1X3QA 1TWAH 2XWJB 2DUDA 1HA5A 3JC66 4OO1H 1I94Q 2KUMA 4GKJL 1RJTA 3TDQA 4J8QA 1JQYD 1QVCA 3EN2A 3SK6A 1TU2B 1K0SA 3NENA 1HQMC 1E2ZA 2ZXPA 3CC2A 4APVA 3KOJA 4JV5L 4I7ZC 2QDBA 3J81L 3Q22A 1A6XA 3MA2B 4XTCS 2IHFA 2K14A 4KY7A 1J5EQ 1Y69U 2MUYA 2HUGA 4PZ8A 2BH2A 2HDLA 2X69A 4B9XA 3J7AV 1DZ1A 5EKIA 4UPAA 1MI2A 4CDDC 1S4ZA 2UXBQ 3KDFB 1ZEQX 2KJXA 3ZJYC 4JI7L 4A93B 3A55A 4A3FH 1CQFA 3JAML 3MVVA 1YNJD 2OTJA 2A68D 3UDXA 3NBIA 1YHAA 4JCVE 3TP7A 2BE5C 3SHLA 4PQXA 5IE8A 4K0KQ 2RDFA 2YU9H 2NTTA 2FJ2A 1STHA 1PH5A 5I2YA 4TSSA 5GAHC 1Y8OB 1G291 3FP9A 3PIP3 4P2CB 5IYDH 2HD3A 1JCKB 4IUPA 4GLXA 5C5LA 1F77A 2I5MX 4A3BH 3GTJB 3GTPH 1VQ6A 2PW7A 3KLRA 2RQXA 1RKNA 2FMCA 4B3MQ 1DXMA 2F0OA 5TSSA 3MZ5A 5M3FB 4DUYQ 1ENAA 2PI2E 1C8CA 2E2IH 1YHQA 3HOVH 5C0XI 4Q5VA 1KLGD 2JA8H 1PFSA 2ENBA 1EUJA 1QUQA 3S1MH 4CDCC 5AJ3L 1GUNA 1U4LA 3I8ZA 2O5IC 3T1HQ 5CORA 1B4OA 1IXRA 4XQJA 1TWHB 1EZ8A 4BBSB 5C4ZA 1YJWA 1CA5A 2HIVA 1PVOA 1JT8A 3F2UA 2KEDA 3P75A 4HCSA 4DKAC 5JPMC 3FKIB 4PMBA 3URYA 1FNUA 1XPUA 4NXMQ 2OTLA 2HIXA 4A3EH 4BY1H 4BY7G 1GOZA 2EZVA 4V190 2P5ZX 1LT6D 4IALA 1NMGA 1Z7TA 4KHZA 3TSSA 1M8AA 1HNXL 2UUCQ 3WDNA 1HZCA 4U673 1Y1WH 4FF3A 4C3HG 5C3EH 5CGKA 4I7AA 4BBRG 1A3VA 2GVBA 3H0GH 4A3JH 1AP0A 1BVSA 3I4OA 2JA6B 3CXCA 4YY3Q 1D5ZC 1VDZA 3PO3H 2IX1A 3QO2A 1KLUD 3KBXA 5DEHA 3GTLH 4IOCA 1QVFA 3QOJA 4OIKA 3A56A 1U5KA 4A3GB 3I55A 2WB1B 1QG7A 1LACA 4GLAC 5K36H 1O78A 1L0XB 2Q8RE 1SJHD 3FPPA 2VW9A 4A3KH 1R4PB 2CQAA 5CBAE 1JB7A 2F0PA 3P7JA 1QE6A 2XIWA 3LGJA 1BR9A 2OF1A 2E76C 3CCSA 1PTOC 2XGTA 1X3GA 4POFA 2OXPA 3J7AF 4WRDA 4DR6L 3BZCA 4UDUC 3S17B 4JI4L 3D6CA 4KKUA 2HHHL 2EY5A 3W1BA 2C9OA 3NEMA 1KD1C 1V1OA 2QEJC 5FLXL 3OW2A 1VQPA 4OX9Q 2A6HC 1PH4A 1NBWA 2KVMA 1PH6A 2D5DA 1HXYD 4Y52H 2A6ED 2IT1A 1JWUD 2PQAB 3QJYA 3X3NA 1WCMG 1KNEA 3UDFA 3LWEA 2XVSA 1VQLA 4DV7L 5LMNQ 3E0JA 4LFBQ 3L0OA 4L5SA 4DUZL 3EA6A 2R92G 5M3MB 1RIPA 3FPUB 4GOPB 3EVQA 2KCMA 4Z9CB 1QNKA 3OMGA 4G7HC 4IFDJ 1CUKA 3S15H 1EWIA 1SMYD 3V2TA 1E2VA 1LT5D 2N88A 4IUNA 3D6WA 2B2WC 1Z6HA 3G6EA 3ND9A 1XWEA 1PRTC 2H5XA 2A73B 1JWMD 2KA7A 4RCNA 4LFCQ 3CQZH 3K5OA 1G91A 5KEEA 1CKMA 1LTLA 2F0TA 4L6TB 3VDYA 4X66Q 1E24A 5IGBA 4QIWB 3J81i 4KJNA 4RFBA 3D8GA 3PGZA 2MFIA 4HIKA 3GTQH 3KUPA 4B9WA 4JYAQ 3HOWB 4BWGB 4Q0FA 1ASZA 3MXUA 3M4OB 1HR0L 1STAA 2LSSA 4HJ5A 3A8KE 5C4JH 1Q3LA 1FR3A 4A3IG 1VQ4A 3BYTB 4OEMB 4L63B 3JAMi 1SFOB 4ME3A 3OPOA 4LF5L 5IT9E 3ERSX 4LUOA 4DR2Q 1EY5A 4DAPA 4RGTA 1IYVA 2E2HB 1ENCA 5I9OA 1TWCB 2K52A 3G7LA 2F03A 3GTGB 3MXPA 3S2HB 2V1CC 3DWQA 2DN8A 1B70B 2A1AA 4DV2L 2LFNA 2M00A 4DV5L 3M3YH 3A74A 1IL8A 1ZYRD 1BCPD 4KLKA 3B6YA 3K7AB 1TWGB 4B08A 2ALYB 1O80A 2N8NA 1WTQA 3V05A 3CCUA 4K6LA 1O7YA 5KYIA 4EQNA 3PO2B 2IHEA 4NPSA 2H4OA 4A4IA 1EWCA 1XMOL 1WTXA 2ZM6Q 4BY7H 1UEAB 2TSSA 1E22A 5JJIA 5ELDA 1D6EC 4DV3Q 1Y1VB 4QL5A 2L5TA 1X3PA 4RG1A 3FHWA 2B2WA 4OONA 2B3GA 1TIID 2MGSA 4BS9A 1CSQA 4AYBG 4F87A 3PUWA 3D4WA 3KJOA 4C3HH 1D1IA 3PIO3 4R1JA 3E9IA 3NE5B 4BBRH 3VR5A 4JI2L 1FJGL 5HGTA 1HUNA 5M9OA 1B9NA 4A3CG 1CZGA 4AQYQ 4DR7L 3WOFA 2JXMB 1C0AA 3L7ZC 2LKVA 2KCNA 2WB1E 5IIFA 1I3QB 2HT1A 2CWPA 5DLQE 1TWFB 4HAEA 4RGOS 3R3OA 3A5UA 2B8FA 3NPPA 3HOUB 2F0EA 2EJFC 1L1OC 1BNZA 1UAPA 2FXQA 5J22A 5IGGA 1YNJC 1PDQA 1W2BA 1K9MC 5BR8Q 2QCPX 1QUQB 3Q6SA 3D0FA 1HZAA 1N36Q 1NY4A 2KQ3A 3MXGA 2EJMA 2ZTEA 4B3SL 3VYRA 2VS1A 3GTOH 4YWMA 1A15A 3KF8A 1X55A 1RTNA 1JOKA 2RDGA 5AFWA 5C44G 1IZ6A 3IL8A 1D2BA 4J1MA 2Z0SA 1SJED 3IFTA 3LX0A 1A2UA 1I4QA 5G3LF 5KNDA 4Y7NH 3SDZA 3CKIB 2K33A 5FO7B 4GKJQ 1RTOA 4EX5A 5C0XG 1F2MA 3HG9A 3G71A 5EGTA 1VF7A 1D5MC 5CMDA 2K5HA 4DA2A 2ZJQA 5ELNA 2EYJA 3J81E 3PQIA 1J8IA 1CSPA 2X6LA 4JV5Q 1Q8KA 1TY2A 4GN3B 1GXDC 1VQCA 5I9PA 4B3TL 3P20A 4A93G 1QB5D 1WCMH 2JP1A 3U50C 2R93B 1PH3A 4DV0Q 4DAYA 1LTGD 2B2VC 1HPCA 4JVZA 1UE1A 1IKLA 1Q86C 1EEID 1ML0D 2ICEC 5ISRA 3CRKC 2ZJRA 2F0GA 4XYOA 3RZDH 4R9WA 1PXUA 2R92H 5CV8A 1SNPA 3JAME 1CKOA 3I7FA 1HTPA 4X62L 5BN5A 1I50B 4JI7Q 4JBWA 2PMZE 5DAUA 1QZGA 4OXPA 4NXNL 3SXHA 1SRUA 1DOLA 2E5LL 4POGA 4MHEA 2R7ZB 4X6AH 2AUJD 4J15A 4KK7A 3N52A 2JJQA 3PIPA 1N8RC 4RHSA 1MSHA 3S1NB 1NTGA 2JA7B 2VB3X 4DR3Q 1XNQL 1AFPA 1L1OA 4A3DB 4YY3L 2BH8A 2EYMA 3F2BA 1EYGA 3K8AA 1U4MA 1I4RA 1L0YB 1L2FA 1YBYA 3TZUA 4DPGA 4LJZC 2LXJA 1ET9A 3CW2C 3KLSX 1CZWA 1XMQL 3K0XA 1G6PA 4R8IA 2F0UA 2EIFA 5L37A 1IYUA 1ESFA 1XPRA 4A3LG 4ZK9B 1HCZA 3S1RB 2PPBC 4X64L 4R4OA 5M5XB 2B63B 3GTMH 3H3VH 1UE7A 5JVG3 4JI5L 4A3IH 3BDLA 2B8GA 1B2TA 2E74C 5EKKA 4DV4L 2Z8LA 2VXWA 3S16H 5M5WB 1FGUA 3FKIG 3MAQA 1LV9A 5EPLA 4HIMA 5HY6A 3RZOB 5EBDA 4LF7L 4UP9A 1V9PA 4OL7A 2VQEL 4H13C 3C1EA 3J80E 3MWYW 2QGQA 2ZTCA 4K6DA 5AJ3Q 1JE4A 4C1NI 1ICFB 1EU4A 3A7AB 4MTKA 1Q81C 1LT3D 2L55A 2BA0A 2NVXH 4DK3C 1W6KA 4DV6L 5E4WC 1SYGA 4JBMA 1DJRD 2VL6A 5DM63 2KCTA 3QOLA 5JJLA 1VMPA 3A7LA 5JEAG 3BG3A 3AB9A 1LTBD 1B3AA 1DM0B 5IGFA 4FNFA 3TEHB 1BBWA 2EY6A 2A6EC 4ZAIA 3NUCA 4EQPA 3I4NB 3C46A 3HP3A 1XTCD 2YYZA 1HNXQ 3T13A 2K5WA 4KD3A 2JEBI 2F0JA 3U58A 2KENA 2OEOA 1PHJA 4JI6L 4FDBA 1E2WA 1R4QB 4H7BA 1FYCA 4UP7A 2QEXA 2VNUD 3E9HA 1V8QA 4GKKL 1IKMA 1VCIA 1VQ8A 4BXXG 2Z9HA 5G3LD 4A3CH 2EYHA 5CV7A 3ONAB 3NTKA 1SMYC 3Q0AA 2K1BA 1PH8A 4DV1L 2VUMG 1K83H 2UXCL 3QIAA 4LF6L 1I4XA 2DNCA 1EIFA 2UUBL 1PH9A 1T5EA 1JC7A 3CPWA 3W5OA 1WTVA 3GV6A 4NMZA 1STNA 3AYHB 5IODA 2TMPA 4NP5A 2A69D 4ZRZA 4XYQA 3SK5A 3H6MA 4HSVA 1BO0A 2AUKA 1I6VC 4ULLA 4OWXB 2VZAA 4DR6Q 5E1FA 5FLXE 4WORA 5M5YB 4JI4Q 1HFGA 2HHHQ 1Q12A 1U0LA 5C44H 1QNUA 1TWAB 3A5ZB 2I5LX 2F0KA 4KV6A 2ZXOA 3DM1A 2M2LA 4C3JG 1WFQA 4H02A 4IPDA 5C0XH 3G6JB 3T16A 1EY0A 1JJCB 4JI8L 1S40A 4L5TA 5IP7G 5T1GA 1X3EA 3EBEA 4AH6A 2PO4A 4KKTA 4I65A 1PRTB 1KQSA 3PF5A 2G5DA 2CFMA 2NN6I 3W2DA 1HNZL 1A3UA 4A93H 2EE1A 4DV7Q 2LS01 4LFAL 1YJNA 2KBNA 1YEZA 4LF9Q 4DUZQ 5JOBA 3AFQA 1Q7YC 1KDCA 1II3A 2EY1A 3RNUA 4IFDI 2RVLA 3HKZB 5IY0A 5KRUA 1ZYRC 1KXLA 1QILA 3WWVA 4O0AA 4RH6A 1PZKD 5IOCA 3HOWG 1EWHA 1VQFA 2K4KA 3OYYA 2R6GA 4A3FB 1WTOA 3OOCA 4FP5D 3BVMA 1ZKOA 3UDIA 3PCOB 5FJ8G 3E6ZX 5LMUQ 1Z47A 2GA4B 3NELA 3DXJC 4FXDA 1SMXA 1SROA 3KF8B 2LMCB 2YU9B 1IYJB 3CAMA 4PZ7A 1MD2D 2L0CA 2WKDA 1GUOA 3DEOA 2ZXRA 1KC8C 1RHPA 5NUCA 1X56A 4R8NA 1N33L 1HZBA 1HFNA 1RCVD 1HUMA 1B8AA 1HR0Q 2EYLA 4X3TA 4A3BB 2WFWA 1UUPA 5E3FA 3NXWA 1W3SA 3AEVA 4A3LH 2L12A 2NZ1D 2G9HD 4LF5Q 4QJFA 2B39A 1TWHH 1CFMA 4YWKA 4IJHA 4KTAA 1AN8A 4KD4A 2B2UC 1JOOA 4P71A 4DAYB 2E2IB 3FKIH 2DY8A 4CKBA 1EL0A 5KNCA 3HOVB 2OQKA 1KHIA 2JA8B 5IT9c 3CD6A 2PZUA 2Z6KC 2Y0SG 3M4PA 4DV2Q 4BA2I 3S1MB 5EBCA 4WFN3 4YHHL 4LMQD 4DV5Q 4IN3A 4HJ9A 2IW3A 1AEXA 1LT4D 4LNQA 1H9RA 5A2QL 1HZ9A 1PYWD 2UU9L 4ZLTF 3KBGA 2WAQB 4X3KA 2DJFC 3H3VC 1T9HA 4UY8C 1K8OA 4BY1B 5JEAH 2N55A 4A3EB 2H1EA 2AQ1B 4IURA 3EIVA 3H91A 2K5DA 2GN5A 2MO0A 1PFBA 4XT3B 1BCPF 1WTWA 1L1OB 4JI0L 3HOUG 4M1UB 1Y14B 2CVRA 4DFAA 3BVGA 2D0PA 2PW5A 1D1KA 1Y1WB 3EQLC 2JEAI 2EYPA 1GM5A 5C3EB 2F0SA 4JI2Q 1FJGQ 3H0GB 4A3JB 1BBUA 1TVXA 1F9SA 3PO3B 1NSNS 5LL6S 4HR7B 2EY2A 4BXXH 4HIOA 4KI0A 4UHVA 1G2SA 1K8MA 4MZ9A 1KAWA 2D62A 2M9VA 4X3SA 2VUMH 3C1FA 1XYIA 1DGSA 2NUCA 2OQ0A 1EQRA 1S3OA 2FMMA 1TXYA 4A3KB 1XJVA 3F8TA 2MQHA 1RF2D 4RA8A 4ID6A 3PSIA 1I94L 1SYDA 4B3SQ 2HCCA 1SLJA 2D2CC 2F0QA 1VQJA 2B2UA 1N32L 2XWBB 1Q82C 3IAYA 2JYOA 1GUWA 1PYSB 1H95A 3S14H 2Z6KA 1C7YA 3QB3A 1FD7D 3AFPA 5I2XA 3TRZA 2OT2A 1S5ED 1R9TH 1CM9A 4RHRA 3HOXG 1CT1D 4CHTB 5GAGC 4C3JH 1JJ2A 2JA5B 1CK1A 1B3QA 1SSOA 4C2MH 2E75C 4HJAA 5IP7H 3A54A 3G4SA 1VQ5A 1Q1BA 4B3TQ 4IJLA 3ER0A 1A0IA 3HZXA 1GO3E 3TP8A 2R7ZG 3GTKH 4EVOA 2ASBA 1QJOA 4NKLA 5GQOA 4IO9A 3J81c 3V96A 1E0BA 3HKZE 4K5WA 3P1HA 4CDFC 1A62A 2PMZB 3UI2A 2JA7G 5EPJA 3ZYYX 1Y8PB 3OTOL 1TS2A 2MHVA 1ICWA 2L4NA 4X62Q 1CHQD 1UWVA 2KOLA 2K5NA 3U4ZA 1MGSA 1SNCA 4NXNQ 2KHJA 5ELOA 2E5LQ 1KDAA 2OCEA 1EQTA 3HOWH 3A8JE 4O2DA 4HEDA 1HHVA 2G9DA 4ALPA 5C4HA 5FJ8H 2IL8A 2A19A 1A8VA 1U9RA 1KL9A 3MEHA 1IBKL 2A5HA 3NP8A 2B2YC 1LLRD 2NVQB 4JI3Q 1G8ZD 4WJ4A 1O7IA 3HOYB 3OWEB 3K7UC 1KTKA 1LTSD 4YCWA 4JPBW 1KRSA 3NK9A 4LF8L 1K0RA 3VA7A 5C4XB 1PFMA 2NZHA 2F0MA 4KY5A 5KYLA 2QF7A 1HJPA 2EDGA 2N78A 5C0XJ 3MXNA 2ID0A 1EQQA 4X64Q 5JVH3 1D5XC 1I6HH 1K73C 2SEBD 5FKAC 4DNRB 5C4JB 4V0BA 2KCCA 4JI5Q 2RCFA 3S9WA 4DV4Q 1WTPA 3K7AH 4KJOA 4RMFA 3GQBA 1STEA 4LF7Q 4R4TA 3BU2A 4DAMA 2VQEQ 5D3DA 3BDCA 5COYA 1EY4A 1LTAD 3OSOA 4RKLA 4C3IG 3I56A 2A69C 4ZYSA 1NJIC 1H9SA 3S2DB 1OXVA 4C56C 3HOZB 1IBLL 3PUXA 3Q23A 1F2ZA 2WAQE 2VQFL 1LYLA 1K3BC 3CP0A 4QQBX 2K5VA 1SE8A 4DV6Q 1GUTA 2J0TD 3SK4A 3J80c 4FO2A 3M3YB 4A3MB 1FGBD 3HEJA 4QUFA 1YJ9A 4OIJA 1NUCA 1CA6A 3VYUA 2ATWA 2EXDA 2NN6G 5J39A 1EOVA 3TP6A 1ET6A 4K5XA 3MHBA 4TKOB 4GN4B 2ZJPA 3RR5A 2E2DC 3I73A 3CCLA 1WD1A 4IFDG 1EY9A 2AWNA 4B3RL 2MNAA 1TWFH 1XPOA 2NVTH 2RCNA 3HOUH 3S1QB 4JI6Q 3DM3A 1S72A 3G48A 3CCMA 2AHOB 4HJ7A 3HKSA 4N8FA 2MPMA 4GKKQ 2PYKA 4C3HB 2A68C 2F0WA 4BBRB 4QCLA 1A3TA 4K2KA 4X3UA 2B2YA 5ELFA 1WOCA 1SN8A 4KHPL 2UXCQ 2E2JH 2Q2HA 1I4HA 3CMAA 2UUBQ 2BDNA 2FFKB 3AMUA 4H0LC 3ND8A 2RHSB 3SEBA 3NTIA 2B29A 2EYFA 1B44D 1F2LA 2O4XA 2XNAC 1UE5A 2YV5A 4NW2A 3K57A 1TS5A 4XQQA 3WOEA 4KHVA 4IOAA 2HCIA 3M7GA 1YNXA 2A74C 2Q2TA 1M4VA 4QY7A 3A0JA 3RD4A 2GVAA 4Y7NB 2J4XA 1LTTD 5JEAJ 2F3IA 1H9JA 5CV6A 4CDEC 1PFNA 5FLXc 2QW7A 5LMNL 1BCPB 4JI8Q 1DOMA 1VQBA 3HOXH 5EQ0A 4IUQA 1GD7A 4DR4L 3CCRA 4HMJA 1PV4A 2JSOA 4X65L 1HNZQ 3OHXC 2EQSA 4LFAQ 2CW0D 1TS3A 4NB3A 1W6JA 2NZOA 1EIYB 4P73A 1PZID 1EQVA 4QUCA 4LK1C 4GNXB 3S1NH 3O13A 3VYSA 4DK0A 4KY6A 2R92B 1SE4A 4IPGA 5M3FG 5CV9A 1PTOD 1SBBB 2I0QA 1HQRD 1XNRL 2WV6D 3TBIB 4P75A 5ELEA 1NR4A 1EYCA 1PH7A 2RSOA 4NDXA 4GLVB 2QILA 2CH4W 3I4MB 1U4RA 1YI2A 1OXXK 1SYFA 5FO8B 4FF2A 5HURA 3S1RH 2N3SA 3I3CA 5M5XH 3K80C 4XXEA 1OXUA 1YIJA 4A76A 1VQ9A 2VY3A 4BBSG 3OIQA 4CJ2C 1VQDA 2B2TA 4R4IA 2IX0A 2RDHA 2WKCA 2K7VA 1N33Q 2RBMA 3SK8A 2CWAA 3CC4A 1JICA 5IT9L 3D4DA 1IBML 1VQ7A 2WIIB 1EZ6A 4IPHA 4FXGC 4DXGA 1XX8A 1K3RA 3GTMB 3Q24A 1AH9A 3ULLA 2F0IA 1YNND 1DYQA 3IKJA 3KF6A 2K04A 2WAQG 1WTRA 5KGUA 3S16B 1BUVT 3M7NA 5KNBA 1IL2A 2AQ3B 2JA6G 5D65A 1S5CD 2FHTA 1ILQA 5A2QE 5JJKA 2O2LD 5IP9G 4YHHQ 1KIXA 4C3IH 4F8MA 2UXDL 4G7ZC 2XSCA 2UU9Q 2F4VL 2DGYA 2QDLA 2NVXB 2AQ2B 4A3GG 2WB1G 3QWNA 5IGCA 1BXTA 1N34L 3A8IE 5GAEC 3BDOA 3SGIA 3R8BA 3K5MA 1OTCA 2NN6H 4YCVA 2NB0A 5ELCA 4ZUJA 1NNXA 3KYHC 2A8VA 1F9QA 1PTOH 2K32A 4ODGA 1C4QA 4LAAA 3M9BA 5LHY1 1PYBA 4JI0Q 3J81j 2SDFA 5C3XA 1B50A 1TS4A 4IFDH 1DCZA 2WINB 3ITPA 5JJZA 5IWAL 4AYBB 3KK7A 1NR2A 2RSNA 1AE2A 2E8GA 4ZKBB 5FLMG 2UUAL 3DWPA 3MXNB 4OHJA 3C2PA 1LTID 4DN4M 3T53B 2SNMA 1TY0A 1O7ZA 3TN2A 5CV5A 2L15A 4FXKC 1XTDA 5GADC 2PZTA 2Z4HA 3CCJA 1K83B 3T56B 2NVYB 1MBYA 1N9WA 2K6AA 1K28A 1S5FD 4MNOA 2ZTDA 4YWLA 4IUTA 4ABNA 2Q2UA 5H1SE 2EYOA 3HGBA 1QZHA 1GVPA 4GN5A 4GS3A 1H9SB 2MP1A 3T1YL 3VR2A 2JA5G 1J9OA 1STGA 1RD9D 1HNWL 5M3MG 3UE0A 3K58A 4QGUA 4JI1L 3STBD 1N32Q 3R2IA 4DR1L 1P16A 1ASYA 3L9AX 5I6WA 1UNSA 2K75A 4KKSA 4RGMA 2K01A 4FF1A 5C44B 4HCEA 2F3VA 1KRTA 1LO5D 4DV0L 1RL2A 4JBKA 1X65A 2AKWB 1NE3A 1WTHA 2EJGC 2XRQD 1HRJA 2K03A 5DNFA 4PV1C 4DR5L 4G57A 4DAVA 3PUZA 1TQOA 4CKEA 1LABA 1BCPC 1EY6A 2N49A 4CJ0B 2IX3A 1LUZA 4HTHA 1EOTA 4L5QA 5BN4A 4EQ5A 1SNMA 5LMNW 1MIUA 1SYEA 3IFDA 1CQVA 5T1IA 3GTJH 3OTOQ 3TS2A 4KN7C 3NQIA 5F2DA 4P72A 1VS0A 3ICEA 2K5QA 3K81C 3HOYG 4MIUA 5CR3A 3NTHA 4DR3L 3TZDA 2Z1CA 5M3FH 1NAPA 1Q46A 3H94A 4GNXC 5C4XG 1G2TA 1U4PA 3CCVA 3CF5A 4N9PA 1CHPD 4OO1I 3DUZA 1GJXA 1RODA 3ERQA 3RLFA 3VA5A 1IBKQ 3KLSA 4OWTB 2YTYA 3GTPB 1XXGA 4CBVA 1CI3M 4LWCA 3K5LA 2JK8A 2K28A 3KFUA 1CKNA 2K50A 4YCUA 5J3BA 1O7LA 2F0LA 4BBSH 4LF8Q 3DMUA 3NWTA 3J7A5 4TVAB 1DD2A 1IW7D 3PO2G 4K14A 5IGEA 4ILWA 4G4KA 3HOZG 3RLOA 1B1ZA 3D31A 1GKHA 5I4DA 4PNYA 1Y1VG 4A3MG 4JC0A 3J80L 2HDMA 3I72A 3EJIA 4G7OC 1VMCA 2F1MA 3FEWX 3M85A 4DNTB 1TKWB 4DK1A 2F0FA 4F88A 3D3RA 2Z4IA 1LTRD 3BYYB 1XMOQ 2JA6H 3D4RA 3QG1A 4EGVA 3W3AA 2RA4A 1IBLQ 4DXFA 2VQFQ 2D9UA 4ZUIA 5IP9H 1V1PA 3PIOA 3E0EA 1I5FA 3TREA 5IGDA 1JR0D 1VQIA 2Z6BA 3C3LA 4HN7A 4A3GH 1MHWC 3CCEA 1HTLD 3F1ZA 2HQLA 2FINB 2F0DA 4OELB 4JK1C 4DR7Q 2CCZA 1C9OA 2CH4A 1OXTA 2WACA 4B3RQ 2NYZD 5CV4A 4LUVA 2PZWA 4QF4A 5E7NA 3ULPA 4LW1A 1Z9FA 3UE1A 4XQNA 4GNXA 4AYBE 4LF4L 3GTLB 3KLWA 4J6HA 3I90A 4HSPA 1GHJA 2CW0C 1EFWA 1F9PA 3S17H 2BOSA 4JOIC 1MJEA 3VYTA 4HJ8A 1BDOA 3GP7A 2J7ZA 4JG2A 2EOTA 3R2TA 5FLMH 1VQKA 2I07B 1D7QA 3UDGA 3L3OC 3U9OA 4KHPQ 3M4YA 2KEEA 3NHHA 3KF6B 5C5MA 3R93A 1E7ZA 5FOBB 1EIGA 2R7FA 1H9MA 1G6ZA 2KHSA 1VQNA 2R93G 2VUMB 2ZT9C 2ICIA 5IYCG 1EIHA 3F2DA 3HS0C 4R4QA 4DF7A 1A2TA 1BKBA 1G51A 3MC0B 1AW7A 4H44C 2JA5H 1AE3A 2F0NA 2BA1A 2XRSD 2PI2A 1KDBA 5K5PA 1VQHA 5J1ZA 5M3MH 3T51B 2VB2X 2BDOA 1NMFA 4M8AA 3BZDB 3SVMA 1K8AC 1J5EL 4LUZA 2IJ0A 1EYAA 4IQZA 3S14B 4O1NA 2X6GA 2UXBL 2K05A 1SEBD 1SDFA 5BN3A 4FF4A 3ULJA 4TRDA 1R9TB 4C3JB 4LF9L 1WI5A 4K8JA 3T4AC 4E6IA 5LL6X 1JWSD 1SXTA 1YNNC 4C2MB 1E1OA 1I4GA 4A3DG 1FNVA 3X3MA 4DR4Q 4K0KL 4X65Q 3L2PA 1STYA 3BZKA 3S15B 4RAUC 2MJ8A 3RN5A 1AZQA 3GTKB 1TT2A 4HIDA 3I4MG 3GD7A 3JAMc 3TS0A 1C48A 1J6QA 3M4OH 2DY7A 3CQZB 3OWFA 3NBHA 2B63G 1WD0A 2CKZB 5LMUL 5KIXA 1XNQQ 5DM73 2NVQH 2F52A 4B3ML 1X54A 1SFOH 3HOYH 1EY7A 4JOIA 2CQOA 5IYBG 3H15A 1XNRQ 1SR3A 2JA9A 3K59A 3GTQB 2V4DA 2XTIA 2PNRC 4OWWB 1ENFA 1Q90A 1LM0A 1QOHA 2IPKD 5C4XH 4OGQC 4DUYL 2E2HH 3DLLA 1TWCH 1XMQQ 4UP8A 2C5CA 4ZKCB 1SE3A 1AZPA 3GTGH 3S2HH 1EFID 4PMCA 1QVGA 2JN4A 2RKSA 1PTOF 3CU7A 4WJWA 1KAAA 1ONLA 5D3IB 1EY8A 2HQEA 3T1HL 1K8GA 5JPNC 1VQOA 1A63A 3I2ZA 5CC4A 1FL0A 1TWGH 2O5JC 3EFXD 3QR8A 1Q1EA 1IBMQ 4XIGS 3PO2H 3N6RA 4CGYB 3SR1A 4NXML 3S2DH 3GO5A 3HOZH 4XDXA 2IY5B 5E4XA 1I6HB 3I4NG 4EQOA 2RF4A 2BE5D 1Y1VH 4A3MH 1NCVA 3NSWA 1M90C 5ELBA 2PNHA 1JOQA 1KABA 3RLNA 2EVBA 2UUCL 3MFYA 1VQGA 3BJUA 1YHBA 1WYDA 1VQMA 1DONA 2UXDQ 1JE5A 4BY7B 3STBC 2PCFB
chains in the Genus database with same CATH topology
4FYDA 2Y0SB 2NTSA 1SNQA 1SNOA 1OXSC 1PRTF 5CBEE 3PUVA 4RWSC 4CJ1B 4ME5A 3K0YA 1ZXTA 1JB3A 4PMWA 3FMCA 1EU3A 3TP5A 4K5VA 2CHBD 4IUVA 2NVTB 3E5SA 3I91A 1OO9B 1QCBD 1F9RA 4OO1G 2Q8IB 1Q8IA 1TR5A 2B2TC 4CKCA 1S5DD 5FK9C 2F3WA 3K5NA 3OIPA 3VR3A 3GTOB 1ESRA 3OMCA 1VF5C 2E2JB 1WVLA 1I4PA 4N9TA 1STBA 3DEPA 1PZJD 3PUYA 3OW7A 2DNEA 3EROA 1X32A 1V1PB 1BBXC 5JAVA 5I6YA 2LY7A 3CRLC 2QKIC 3H09A 3TMEA 5A35A 3RMHA 2L1BA 4RKBA 1IW7C 3I4LA 2R3ZA 1WCMB 1SYBA 1PMRA 4BA1I 2F0VA 4DGZA 1JORA 1SNDA 3VR4A 1S5BD 5C3WA 4O42A 5D14A 2F4IA 3RZDB 2SNSA 3FDTA 3J7YW 3HOXB 4QB4A 4YIJA 5EKLA 4RGNA 1Y8NB 1SE2A 1MSGA 4C1NK 4U68A 4KMUC 1HA6A 3GV3A 1H9KA 2R61A 3LNNA 3BVZA 2NWGA 2L11A 4UAIA 1DOKA 2A6HD 2BCOA 2KECA 1EYDA 3VR6A 1GUGA 1EEFD 2JE6I 4IZ8A 1KNAA 1BQQT 2Q8TA 3MFGA 5C6AA 2NBFA 5EJWA 4A3IB 2XN9C 1SYCA 3HRZC 1IHZA 2AWOA 1GUSA 1CTMA 1RDPD 3FVQA 2IWHA 1SAPA 3CHBD 2L9HA 4S3SA 1F2YA 2EXZA 1PRTD 4ZQ3A 2I46A 4XT1B 3MTSA 3LWUA 3NQTA 3NWSA 1BOSA 3DWAA 2F0HA 3SE0A 2B2VA 3BS1A 3PV0A 1ILPA 3U9SA 1PLFA 4MN3A 3K6OA 4C3IB 1V43A 1T5XD 4KN4C 4QMGA 4RCOA 3FRPB 4K8IA 4DU9A 1B53A 3DHQA 1QWYA 2SOBA 4IUUA 5K36G 5EPKA 2PQEA 4K2LA 1GHKA 4FVMA 1FNWA 1PTOB 3PMFA 3RUZA 5FO9B 3I70A 4L8JA 2WP8J 4F7XA 1B9MA 3AU7A 1BF4A 4GZYC 4HMIA 4TQUS 5CYUA 2EPBA 1X3QA 2XWJB 1HA5A 4OO1H 2KUMA 1RJTA 3TDQA 4J8QA 1JQYD 3SK6A 1TU2B 1HQMC 1E2ZA 2ZXPA 4I7ZC 2QDBA 3J81L 3Q22A 1A6XA 3MA2B 4XTCS 4KY7A 1Y69U 2MUYA 2HUGA 2HDLA 2X69A 4B9XA 3J7AV 1DZ1A 5EKIA 1MI2A 1S4ZA 1ZEQX 2KJXA 4A93B 3A55A 1CQFA 3JAML 3MVVA 1YNJD 2A68D 3NBIA 3TP7A 2BE5C 3SHLA 4PQXA 2RDFA 2NTTA 2FJ2A 1STHA 5I2YA 4TSSA 1Y8OB 1G291 3PIP3 4P2CB 1JCKB 4IUPA 5C5LA 1F77A 3GTJB 2PW7A 3KLRA 2RQXA 1RKNA 2FMCA 1DXMA 2F0OA 5TSSA 3MZ5A 5M3FB 1ENAA 1C8CA 5C0XI 4Q5VA 1KLGD 2ENBA 1GUNA 1U4LA 3I8ZA 2O5IC 5CORA 1B4OA 4XQJA 1TWHB 1EZ8A 4BBSB 5C4ZA 1CA5A 3F2UA 2KEDA 3P75A 4HCSA 5JPMC 3FKIB 4PMBA 3URYA 1FNUA 1GOZA 2EZVA 4V190 1LT6D 4IALA 1Z7TA 4KHZA 3TSSA 1M8AA 3WDNA 4U673 4FF3A 4C3HG 5CGKA 1A3VA 1AP0A 2JA6B 1D5ZC 1VDZA 2IX1A 3QO2A 1KLUD 3KBXA 5DEHA 3QOJA 4OIKA 3A56A 4A3GB 2WB1B 1QG7A 1LACA 5K36H 1O78A 1L0XB 2Q8RE 1SJHD 3FPPA 1R4PB 2CQAA 5CBAE 2F0PA 3P7JA 1QE6A 2XIWA 1BR9A 2OF1A 2E76C 1PTOC 2OXPA 3J7AF 4WRDA 4UDUC 3S17B 3D6CA 4KKUA 2EY5A 2C9OA 1V1OA 2QEJC 5FLXL 2A6HC 2KVMA 2D5DA 1HXYD 2A6ED 2IT1A 1JWUD 3QJYA 3X3NA 1KNEA 3LWEA 2XVSA 3E0JA 3EA6A 5M3MB 3FPUB 3EVQA 4Z9CB 1QNKA 3OMGA 4G7HC 4IFDJ 1SMYD 3V2TA 1E2VA 1LT5D 2N88A 4IUNA 3D6WA 2B2WC 1Z6HA 3ND9A 1XWEA 1PRTC 2A73B 1JWMD 2KA7A 4RCNA 3K5OA 1G91A 5KEEA 2F0TA 4L6TB 5IGBA 4QIWB 4KJNA 4RFBA 3D8GA 3KUPA 4B9WA 3HOWB 4BWGB 4Q0FA 3MXUA 3M4OB 1STAA 3A8KE 1Q3LA 1FR3A 3BYTB 4L63B 1SFOB 3OPOA 5IT9E 1EY5A 4DAPA 4RGTA 1IYVA 2E2HB 1ENCA 5I9OA 1TWCB 3G7LA 2F03A 3GTGB 3MXPA 3S2HB 3DWQA 2DN8A 2LFNA 2M00A 1IL8A 1ZYRD 1BCPD 3K7AB 1TWGB 4B08A 1O80A 1WTQA 3V05A 4K6LA 1O7YA 5KYIA 4EQNA 3PO2B 2H4OA 1EWCA 1WTXA 1UEAB 2TSSA 5ELDA 1D6EC 1Y1VB 2L5TA 1X3PA 2B2WA 1TIID 2MGSA 4BS9A 4F87A 3PUWA 3D4WA 1D1IA 3PIO3 3NE5B 3VR5A 5HGTA 1HUNA 5M9OA 1B9NA 1CZGA 3WOFA 2JXMB 3L7ZC 2LKVA 2KCNA 5IIFA 1I3QB 1TWFB 4HAEA 4RGOS 3R3OA 2B8FA 3NPPA 3HOUB 2F0EA 2EJFC 1BNZA 1UAPA 5J22A 5IGGA 1YNJC 1PDQA 2QCPX 3Q6SA 2KQ3A 3MXGA 2EJMA 3VYRA 1A15A 3KF8A 1RTNA 1JOKA 2RDGA 5AFWA 3IL8A 1D2BA 4J1MA 1SJED 3IFTA 3LX0A 1A2UA 5G3LF 1I4QA 5KNDA 3SDZA 3CKIB 2K33A 5FO7B 1RTOA 5C0XG 1F2MA 3HG9A 5EGTA 1VF7A 1D5MC 5CMDA 4DA2A 2EYJA 3J81E 1J8IA 2X6LA 1TY2A 1GXDC 5I9PA 3P20A 1QB5D 2JP1A 2R93B 4DAYA 1LTGD 2B2VC 1HPCA 1IKLA 1EEID 1ML0D 2ICEC 5ISRA 3CRKC 2F0GA 4XYOA 4R9WA 1PXUA 5CV8A 1SNPA 3JAME 1HTPA 5BN5A 1I50B 4JBWA 5DAUA 3SXHA 1DOLA 4MHEA 2R7ZB 2AUJD 4KK7A 3N52A 4RHSA 1MSHA 3S1NB 2JA7B 2VB3X 1AFPA 4A3DB 2EYMA 1U4MA 1I4RA 1L0YB 3TZUA 4LJZC 1ET9A 3KLSX 1CZWA 4R8IA 2F0UA 1IYUA 1ESFA 4ZK9B 1HCZA 3S1RB 2PPBC 2B63B 5M5XB 5JVG3 3BDLA 2B8GA 1B2TA 2E74C 5EKKA 2Z8LA 2VXWA 5M5WB 3MAQA 1LV9A 5EPLA 3RZOB 5EBDA 4OL7A 4H13C 3C1EA 3J80E 3MWYW 4K6DA 1JE4A 4C1NI 1EU4A 3A7AB 1LT3D 2L55A 2BA0A 1W6KA 5E4WC 1SYGA 1DJRD 5DM63 3QOLA 1VMPA 3A7LA 5JEAG 3BG3A 3AB9A 1LTBD 1B3AA 1DM0B 5IGFA 4FNFA 2EY6A 2A6EC 4ZAIA 3NUCA 4EQPA 3I4NB 3C46A 3HP3A 1XTCD 2YYZA 3T13A 2K5WA 4KD3A 2JEBI 2F0JA 2OEOA 1E2WA 1R4QB 4H7BA 1FYCA 2VNUD 1V8QA 1IKMA 1VCIA 5G3LD 2EYHA 5CV7A 3ONAB 3NTKA 1SMYC 3Q0AA 2K1BA 3QIAA 1I4XA 2DNCA 1T5EA 1JC7A 1WTVA 3GV6A 4NMZA 1STNA 5IODA 2TMPA 4NP5A 2A69D 4ZRZA 4XYQA 3SK5A 3H6MA 4HSVA 1BO0A 2AUKA 1I6VC 4ULLA 5E1FA 5FLXE 4WORA 5M5YB 1HFGA 1Q12A 1QNUA 1TWAB 2F0KA 4KV6A 2ZXOA 3DM1A 2M2LA 4C3JG 5C0XH 3G6JB 3T16A 1EY0A 5T1GA 2PO4A 4KKTA 4I65A 1PRTB 2NN6I 3W2DA 1A3UA 2EE1A 2LS01 5JOBA 1KDCA 1II3A 2EY1A 4IFDI 2RVLA 3HKZB 5KRUA 1ZYRC 1QILA 4RH6A 1PZKD 5IOCA 1EWHA 2R6GA 4A3FB 1WTOA 3OOCA 4FP5D 3BVMA 1ZKOA 3E6ZX 1Z47A 2GA4B 3DXJC 4FXDA 2LMCB 2YU9B 1MD2D 2L0CA 2WKDA 1GUOA 3DEOA 2ZXRA 1RHPA 5NUCA 4R8NA 1HFNA 1RCVD 1HUMA 2EYLA 4X3TA 4A3BB 1UUPA 5E3FA 3NXWA 2L12A 2NZ1D 2G9HD 2B39A 1CFMA 4KTAA 1AN8A 4KD4A 2B2UC 1JOOA 2E2IB 2DY8A 4CKBA 1EL0A 5KNCA 3HOVB 2JA8B 2PZUA 4BA2I 3S1MB 5EBCA 4WFN3 4LMQD 4IN3A 2IW3A 1AEXA 1LT4D 1H9RA 5A2QL 1PYWD 4ZLTF 3KBGA 2WAQB 4X3KA 3H3VC 1K8OA 4BY1B 5JEAH 2N55A 4A3EB 2H1EA 2AQ1B 4IURA 3H91A 2K5DA 4XT3B 1PFBA 1BCPF 1WTWA 4M1UB 2CVRA 4DFAA 3BVGA 2PW5A 1D1KA 1Y1WB 3EQLC 2JEAI 2EYPA 5C3EB 2F0SA 3H0GB 4A3JB 1TVXA 1F9SA 3PO3B 1NSNS 5LL6S 4HR7B 2EY2A 4KI0A 1G2SA 1K8MA 2D62A 2M9VA 4X3SA 3C1FA 1XYIA 2NUCA 2FMMA 4A3KB 1RF2D 4RA8A 4ID6A 1SYDA 2HCCA 2D2CC 2F0QA 2B2UA 2XWBB 3IAYA 2JYOA 1GUWA 3QB3A 1FD7D 5I2XA 2OT2A 1S5ED 1CM9A 4RHRA 1CT1D 4CHTB 2JA5B 1CK1A 1SSOA 2E75C 3A54A 1Q1BA 3HZXA 3TP8A 4EVOA 1QJOA 4NKLA 3V96A 1E0BA 4K5WA 3P1HA 2PMZB 3UI2A 5EPJA 3ZYYX 1Y8PB 1TS2A 2MHVA 1ICWA 2L4NA 1CHQD 2KOLA 1MGSA 1SNCA 1KDAA 1EQTA 3A8JE 4HEDA 1HHVA 2G9DA 5C4HA 2IL8A 1U9RA 3MEHA 2A5HA 3NP8A 2B2YC 1LLRD 2NVQB 1G8ZD 3HOYB 3OWEB 1KTKA 1LTSD 3NK9A 3VA7A 5C4XB 1PFMA 2F0MA 4KY5A 5KYLA 2QF7A 2EDGA 5C0XJ 3MXNA 2ID0A 5JVH3 1D5XC 2SEBD 5FKAC 4DNRB 5C4JB 4V0BA 2KCCA 3S9WA 1WTPA 4KJOA 3GQBA 1STEA 5D3DA 3BDCA 5COYA 1EY4A 1LTAD 3OSOA 4RKLA 4C3IG 2A69C 4ZYSA 1H9SA 3S2DB 1OXVA 4C56C 3HOZB 3PUXA 3Q23A 1F2ZA 1GUTA 2J0TD 3SK4A 3M3YB 4FO2A 4A3MB 1FGBD 3HEJA 4QUFA 4OIJA 1NUCA 1CA6A 3VYUA 2NN6G 5J39A 3TP6A 1ET6A 4K5XA 3MHBA 4TKOB 2E2DC 3I73A 1WD1A 4IFDG 1EY9A 2AWNA 3S1QB 2MPMA 2PYKA 4C3HB 2A68C 2F0WA 4BBRB 4QCLA 1A3TA 4K2KA 4X3UA 2B2YA 5ELFA 1I4HA 2BDNA 2FFKB 3AMUA 4H0LC 3ND8A 3SEBA 3NTIA 2EYFA 1B44D 1F2LA 2O4XA 2XNAC 4NW2A 3K57A 1TS5A 4XQQA 3WOEA 4KHVA 2HCIA 3M7GA 2A74C 1M4VA 3RD4A 4Y7NB 2J4XA 1LTTD 5JEAJ 5CV6A 1H9JA 1PFNA 1BCPB 1DOMA 5EQ0A 4IUQA 4HMJA 2JSOA 3OHXC 2CW0D 1TS3A 1W6JA 1PZID 1EQVA 4QUCA 4LK1C 3O13A 3VYSA 4DK0A 4KY6A 2R92B 1SE4A 5CV9A 1PTOD 1SBBB 1HQRD 2WV6D 3TBIB 5ELEA 1NR4A 1EYCA 2RSOA 4NDXA 3I4MB 2QILA 1U4RA 1OXXK 1SYFA 5FO8B 4FF2A 5HURA 3I3CA 4XXEA 1OXUA 3OIQA 4CJ2C 2B2TA 2IX0A 2RDHA 2WKCA 2K7VA 2RBMA 3SK8A 1JICA 5IT9L 3D4DA 2WIIB 1EZ6A 4FXGC 4DXGA 1XX8A 3GTMB 3Q24A 2F0IA 1YNND 1DYQA 3IKJA 2K04A 1WTRA 5KGUA 3S16B 1BUVT 3M7NA 5KNBA 2AQ3B 5D65A 1S5CD 2FHTA 1ILQA 5A2QE 2O2LD 4F8MA 4G7ZC 2XSCA 2NVXB 2AQ2B 3QWNA 5IGCA 1BXTA 3A8IE 3BDOA 3R8BA 3K5MA 2NN6H 5ELCA 2NB0A 4ZUJA 1F9QA 1PTOH 2K32A 4ODGA 1C4QA 4LAAA 5LHY1 2SDFA 5C3XA 1B50A 1TS4A 4IFDH 1DCZA 2WINB 3ITPA 5JJZA 4AYBB 3KK7A 1NR2A 2RSNA 4ZKBB 3DWPA 4OHJA 3C2PA 1LTID 4DN4M 3T53B 2SNMA 1TY0A 1O7ZA 3TN2A 5CV5A 4FXKC 2PZTA 2Z4HA 1K83B 3T56B 2NVYB 1MBYA 2K6AA 1S5FD 4IUTA 4ABNA 2EYOA 3HGBA 1H9SB 2MP1A 3VR2A 1J9OA 1STGA 1RD9D 3K58A 3R2IA 3L9AX 5I6WA 1UNSA 4KKSA 4RGMA 2K01A 4FF1A 5C44B 4HCEA 2F3VA 1LO5D 2EJGC 2XRQD 1HRJA 2K03A 5DNFA 4PV1C 4G57A 4DAVA 3PUZA 1TQOA 4CKEA 1LABA 1BCPC 1EY6A 4CJ0B 2IX3A 4HTHA 1EOTA 5BN4A 1SNMA 1SYEA 3IFDA 1CQVA 5T1IA 4KN7C 3NQIA 5F2DA 2K5QA 4MIUA 5CR3A 3NTHA 3TZDA 2Z1CA 1NAPA 3H94A 1G2TA 1U4PA 4N9PA 1CHPD 4OO1I 3DUZA 1GJXA 1RODA 3ERQA 3RLFA 3VA5A 3KLSA 3GTPB 1XXGA 4CBVA 1CI3M 3K5LA 2K28A 1O7LA 2F0LA 3DMUA 3NWTA 1DD2A 1IW7D 4K14A 5IGEA 4ILWA 4G4KA 1B1ZA 3D31A 5I4DA 4PNYA 3J80L 2HDMA 3I72A 3EJIA 4G7OC 1VMCA 2F1MA 3FEWX 3M85A 4DNTB 1TKWB 4DK1A 2F0FA 4F88A 3D3RA 2Z4IA 1LTRD 3BYYB 3D4RA 3QG1A 4EGVA 3W3AA 2RA4A 4DXFA 2D9UA 4ZUIA 1V1PA 5IGDA 1JR0D 3C3LA 4HN7A 1HTLD 2FINB 2F0DA 4JK1C 1OXTA 2WACA 2NYZD 5CV4A 2PZWA 4QF4A 4XQNA 3GTLB 4J6HA 3I90A 4HSPA 1GHJA 2CW0C 1F9PA 2BOSA 3VYTA 1BDOA 3GP7A 2J7ZA 2EOTA 3R2TA 2I07B 3L3OC 3U9OA 3M4YA 2KEEA 3NHHA 5C5MA 3R93A 5FOBB 1EIGA 1H9MA 1G6ZA 2KHSA 2VUMB 2ZT9C 2ICIA 1EIHA 3HS0C 4DF7A 1A2TA 3MC0B 1AW7A 4H44C 2F0NA 2BA1A 2XRSD 1KDBA 5K5PA 5J1ZA 3T51B 2VB2X 2BDOA 4M8AA 3BZDB 3SVMA 2IJ0A 1EYAA 4IQZA 3S14B 4O1NA 2X6GA 2K05A 1SEBD 1SDFA 5BN3A 4FF4A 4TRDA 1R9TB 4C3JB 4K8JA 3T4AC 4E6IA 5LL6X 1JWSD 1SXTA 1YNNC 4C2MB 1I4GA 1FNVA 3X3MA 1STYA 3S15B 4RAUC 2MJ8A 1AZQA 3GTKB 1TT2A 3GD7A 1C48A 2DY7A 3CQZB 3OWFA 3NBHA 1WD0A 5KIXA 5DM73 1EY7A 3GTQB 3K59A 2V4DA 2PNRC 1ENFA 1Q90A 1QOHA 2IPKD 4OGQC 4ZKCB 2C5CA 1SE3A 1AZPA 1EFID 4PMCA 2RKSA 1PTOF 3CU7A 4WJWA 1KAAA 1ONLA 5D3IB 1EY8A 2HQEA 5JPNC 5CC4A 2O5JC 3EFXD 1Q1EA 4XIGS 3N6RA 4CGYB 3SR1A 3GO5A 4XDXA 5E4XA 1I6HB 4EQOA 2BE5D 1NCVA 3NSWA 5ELBA 1JOQA 1KABA 2EVBA 3MFYA 1DONA 4BY7B 2PCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYJ A;  5JOB A;  4DFA A;  1STG A;  3D6C A;  1KDC A;  2EY5 A;  2RBM A;  1II3 A;  3EJI A;  2EY1 A;  2F0O A;  3PMF A;  2PW5 A;  4TRD A;  3RUZ A;  3SK8 A;  2EYP A;  1U9R A;  5I9P A;  3MEH A;  5KRU A;  3MZ5 A;  2F0S A;  1SNQ A;  1SNO A;  5IGF A;  3D4D A;  2M00 A;  2F0F A;  4F7X A;  2EY6 A;  3NP8 A;  4K8J A;  4E6I A;  1ENA A;  1EZ6 A;  3NUC A;  4HMI A;  5IOC A;  4EQP A;  5I6W A;  5ISR A;  1NSN S;  4ME5 A;  2F0G A;  3T13 A;  2EY2 A;  2F3V A;  4KD3 A;  1STY A;  2F0J A;  2F0I A;  2ENB A;  4ZUI A;  3NK9 A;  2OEO A;  2EYF A;  5KYI A;  4EQN A;  5KGU A;  1EYD A;  2O4X A;  3TP5 A;  5CV8 A;  1SNP A;  4H7B A;  1TT2 A;  2F0M A;  4K5V A;  4KY5 A;  5IGD A;  5KYL A;  3C1F A;  4KHV A;  2NUC A;  4G57 A;  1EZ8 A;  5DAU A;  3OWF A;  3SK6 A;  5C4Z A;  3E5S A;  3SXH A;  1JOR A;  4IZ8 A;  1TQO A;  3P75 A;  2EYH A;  3S9W A;  1EY6 A;  4F8M A;  4ID6 A;  5KIX A;  5NUC A;  4PMB A;  2F0D A;  4R8N A;  1SYD A;  5CV7 A;  3EVQ A;  5CV6 A;  1EY7 A;  4HTH A;  4KJO A;  3D4W A;  2F0Q A;  3OMG A;  5C6A A;  2EYL A;  1TR5 A;  2WAC A;  5C4H A;  5CV4 A;  5IGC A;  1SNM A;  2PZW A;  3BDC A;  2F3W A;  4QF4 A;  3V2T A;  2QDB A;  5HGT A;  1SYE A;  1EY4 A;  1SYC A;  3NXW A;  5E3F A;  4IAL A;  3OSO A;  4IUN A;  4RKL A;  5M9O A;  1IHZ A;  2EYM A;  4J6H A;  5F2D A;  4NMZ A;  1STN A;  3OMC A;  4ZUJ A;  2LKV A;  5IIF A;  5IOD A;  4HMJ A;  4PMC A;  3QB3 A;  1F2Z A;  2RKS A;  4NP5 A;  4KY7 A;  4MIU A;  4ODG A;  5CR3 A;  4S3S A;  4KTA A;  1F2Y A;  2EXZ A;  3R3O A;  3SK5 A;  4ZQ3 A;  1KAA A;  4KD4 A;  2F0E A;  1JOO A;  3H6M A;  4LAA A;  4N9T A;  2F0T A;  3SK4 A;  4B9X A;  1A3V A;  5CGK A;  5KEE A;  2F0U A;  3HEJ A;  3NQT A;  5IGB A;  1EY8 A;  1STB A;  2HQE A;  1NUC A;  5C3X A;  4KJN A;  4N9P A;  5E1F A;  5IGG A;  4WOR A;  5J22 A;  3D8G A;  3U9O A;  5J39 A;  3ERQ A;  3ITP A;  5CC4 A;  2PZU A;  3ERO A;  3TP6 A;  1EQV A;  4B9W A;  2F0H A;  3NHH A;  3VA5 A;  5C5M A;  3MVV A;  5JAV A;  3BDL A;  5I6Y A;  5DEH A;  2F0K A;  4KV6 A;  4KY6 A;  5EKK A;  2KQ3 A;  4K5X A;  3MHB A;  3HZX A;  5CV9 A;  1AEX A;  2KHS A;  3QOJ A;  3TP8 A;  4EVO A;  4NKL A;  3SR1 A;  3TME A;  3TP7 A;  3SHL A;  3T16 A;  1JOK A;  4RKB A;  1EY0 A;  1STA A;  2RDF A;  1EY9 A;  4EQO A;  4OL7 A;  1EYC A;  4K5W A;  1A2T A;  3P1H A;  4DF7 A;  3C1E A;  2F0L A;  4J1M A;  2SNM A;  3DMU A;  1SYB A;  1STH A;  4K6D A;  4NDX A;  4I65 A;  3LX0 A;  1A2U A;  2F0N A;  5CV5 A;  2F0V A;  4QMG A;  4DGZ A;  4K14 A;  2F0P A;  1SND A;  5IGE A;  1SYF A;  1KDB A;  2PZT A;  5J1Z A;  5C3W A;  4K8I A;  1KAB A;  4DU9 A;  5HUR A;  5K5P A;  1JOQ A;  2PYK A;  3DHQ A;  2OF1 A;  2SNS A;  1F2M A;  1A3U A;  1EY5 A;  2F0W A;  1SNC A;  2SOB A;  5C5L A;  4QB4 A;  1ENC A;  1A3T A;  1EYA A;  4K2K A;  4YIJ A;  2PQE A;  5EGT A;  5I9O A;  4PNY A;  2OXP A;  1KDA A;  2EYO A;  5EKL A;  1SYG A;  4WRD A;  2PW7 A;  4K2L A;  3QOL A;  1RKN A;  3MXP A; 
#chains in the Genus database with same CATH topology
 4FYD A;  2Y0S B;  2F4V Q;  1I3Q H;  3MEF A;  2ES2 A;  2NTS A;  1SNQ A;  1SNO A;  1N34 Q;  3PF4 A;  3S1Q H;  3HFZ B;  1OXS C;  4JW0 A;  1PRT F;  5CBE E;  3PUV A;  4RWS C;  4CJ1 B;  1YVC A;  4ME5 A;  3K0Y A;  3KDF A;  3J80 i;  2I5H A;  1ZXT A;  1JB3 A;  4PMW A;  1PH2 A;  3J7Z C;  3FMC A;  1EU3 A;  3TP5 A;  4K5V A;  2CHB D;  5HGQ A;  1CKN B;  3GDE A;  1JJG A;  4DV1 Q;  4IUV A;  2NVT B;  4LF6 Q;  3E5S A;  5IWA Q;  3I91 A;  2KHI A;  1OO9 B;  1QCB D;  1F9R A;  2MO1 A;  3AQQ A;  4OO1 G;  2Q8I B;  1VQE A;  2UUA Q;  3CCQ A;  1Q8I A;  1TR5 A;  2B2T C;  3CME A;  4CKC A;  1S5D D;  5FK9 C;  2F3W A;  4OX9 L;  3K5N A;  1V1Q A;  3OIP A;  3VR3 A;  3GTO B;  1M1K C;  1ESR A;  3OMC A;  1VF5 C;  1HH2 P;  1YZ6 A;  2E2J B;  1WVL A;  4A75 A;  3F2C A;  4L5R C;  1I4P A;  3Q8D A;  4N9T A;  2R93 H;  2QA4 A;  3S24 A;  1STB A;  5IYC H;  2OWO A;  3T1Y Q;  3DEP A;  1PZJ D;  3PUY A;  3OW7 A;  1HNW Q;  2DNE A;  1MKH A;  3ERO A;  1X32 A;  4JI1 Q;  1V1P B;  1BBX C;  5JAV A;  4LFB L;  5I6Y A;  2LY7 A;  3HKZ G;  4DR1 Q;  3CRL C;  2QKI C;  2LXK A;  3H09 A;  3TME A;  5A35 A;  3RMH A;  1I50 H;  2L1B A;  4RKB A;  1IW7 C;  3I4L A;  4ZCK A;  2R3Z A;  1WCM B;  4A3F G;  1SYB A;  1PMR A;  2R7Z H;  4BA1 I;  2F0V A;  4DGZ A;  1JOR A;  4N8X 1;  1L0W A;  1SND A;  3VR4 A;  1S5B D;  5C3W A;  1UEB A;  4O42 A;  5D14 A;  2F4I A;  3RZD B;  4LFC L;  2SNS A;  1E1T A;  3FDT A;  4DR5 Q;  3J7Y W;  3HOX B;  4QB4 A;  4YIJ A;  3TQY A;  2JA7 H;  5EKL A;  4X66 L;  3CPF A;  4RGN A;  4A3D H;  3KJP A;  1Y8N B;  1SE2 A;  2YTV A;  5EAY A;  1MSG A;  5IYD G;  4GOP C;  4C1N K;  4U68 A;  4KMU C;  1HA6 A;  3GV3 A;  1H9K A;  2R61 A;  4JBJ A;  2R7D A;  4QIW E;  3LNN A;  4JYA L;  3BVZ A;  4A3B G;  3I4M H;  2NWG A;  2L11 A;  3IRB A;  4UAI A;  1DOK A;  2A6H D;  1X6O A;  2BCO A;  2B63 H;  2KEC A;  2C35 B;  1EYD A;  4JI3 L;  4P74 A;  4AIM A;  3VR6 A;  1GUG A;  5M5W H;  2Q2I A;  1EEF D;  5IYB H;  2JE6 I;  3RZO H;  3HOV G;  1MJC A;  4DR2 L;  1YIT A;  2JA8 G;  4IZ8 A;  1KNA A;  1BQQ T;  2D0O A;  2Q8T A;  3MFG A;  5C6A A;  2NBF A;  1UE6 A;  1D8L A;  5EJW A;  4A3I B;  2XN9 C;  4PZ6 A;  1SYC A;  1VQA A;  3HRZ C;  1IHZ A;  2YTX A;  4R4C A;  2AWO A;  1GUS A;  1CTM A;  1RDP D;  3FVQ A;  2IWH A;  3W1G A;  4BY1 G;  4A3E G;  1SAP A;  3CHB D;  2L9H A;  1HR0 W;  4S3S A;  2RHQ B;  1F2Y A;  2EXZ A;  1PRT D;  4ZQ3 A;  1PH1 A;  2I46 A;  4XT1 B;  1JMC A;  3RN2 A;  3MTS A;  3LWU A;  3NQT A;  2ZM6 L;  3NWS A;  4DNI A;  3I4N H;  2PQA A;  1BOS A;  1E3P A;  3DWA A;  2F0H A;  3SE0 A;  2B2V A;  3BS1 A;  3M4Q A;  3PV0 A;  4DV3 L;  1Y1W G;  2AMC B;  5C3E G;  3U9S A;  1ILP A;  1PLF A;  1PA6 A;  4WJ3 M;  3CC7 A;  3H0G G;  4A3J G;  2Y0S E;  3U4V A;  4MN3 A;  3PO3 G;  3K6O A;  3NBH B;  3E3X A;  1X9N A;  1B7Y B;  4C3I B;  1V43 A;  4DK6 C;  4AQY L;  1T5X D;  4KN4 C;  4QMG A;  4RCO A;  4MTN A;  3FRP B;  4GOP A;  4K8I A;  1FVI A;  2DJG C;  4DU9 A;  1B53 A;  3DHQ A;  1QWY A;  2JQO A;  2SOB A;  4IUU A;  5K36 G;  5EPK A;  2PQE A;  4IPC A;  4A3K G;  4K2L A;  1GHK A;  4FVM A;  1FNW A;  5GRO A;  1PTO B;  1WJJ A;  3PMF A;  4PG3 A;  3RUZ A;  5FO9 B;  5BR8 L;  3I70 A;  4L8J A;  1P8L A;  2WP8 J;  1N36 L;  3H3V I;  4F7X A;  1B9M A;  3AU7 A;  1BF4 A;  4LF4 Q;  4GZY C;  4HMI A;  1X3F A;  4TQU S;  5CYU A;  2EPB A;  2NVY H;  5M5Y H;  1X3Q A;  1TWA H;  2XWJ B;  2DUD A;  1HA5 A;  3JC6 6;  4OO1 H;  1I94 Q;  2KUM A;  4GKJ L;  1RJT A;  3TDQ A;  4J8Q A;  1JQY D;  1QVC A;  3EN2 A;  3SK6 A;  1TU2 B;  1K0S A;  3NEN A;  1HQM C;  1E2Z A;  2ZXP A;  3CC2 A;  4APV A;  3KOJ A;  4JV5 L;  4I7Z C;  2QDB A;  3J81 L;  3Q22 A;  1A6X A;  3MA2 B;  4XTC S;  2IHF A;  2K14 A;  4KY7 A;  1J5E Q;  1Y69 U;  2MUY A;  2HUG A;  4PZ8 A;  2BH2 A;  2HDL A;  2X69 A;  4B9X A;  3J7A V;  1DZ1 A;  5EKI A;  4UPA A;  1MI2 A;  4CDD C;  1S4Z A;  2UXB Q;  3KDF B;  1ZEQ X;  2KJX A;  3ZJY C;  4JI7 L;  4A93 B;  3A55 A;  4A3F H;  1CQF A;  3JAM L;  3MVV A;  1YNJ D;  2OTJ A;  2A68 D;  3UDX A;  3NBI A;  1YHA A;  4JCV E;  3TP7 A;  2BE5 C;  3SHL A;  4PQX A;  5IE8 A;  4K0K Q;  2RDF A;  2YU9 H;  2NTT A;  2FJ2 A;  1STH A;  1PH5 A;  5I2Y A;  4TSS A;  5GAH C;  1Y8O B;  1G29 1;  3FP9 A;  3PIP 3;  4P2C B;  5IYD H;  2HD3 A;  1JCK B;  4IUP A;  4GLX A;  5C5L A;  1F77 A;  2I5M X;  4A3B H;  3GTJ B;  3GTP H;  1VQ6 A;  2PW7 A;  3KLR A;  2RQX A;  1RKN A;  2FMC A;  4B3M Q;  1DXM A;  2F0O A;  5TSS A;  3MZ5 A;  5M3F B;  4DUY Q;  1ENA A;  2PI2 E;  1C8C A;  2E2I H;  1YHQ A;  3HOV H;  5C0X I;  4Q5V A;  1KLG D;  2JA8 H;  1PFS A;  2ENB A;  1EUJ A;  1QUQ A;  3S1M H;  4CDC C;  5AJ3 L;  1GUN A;  1U4L A;  3I8Z A;  2O5I C;  3T1H Q;  5COR A;  1B4O A;  1IXR A;  4XQJ A;  1TWH B;  1EZ8 A;  4BBS B;  5C4Z A;  1YJW A;  1CA5 A;  2HIV A;  1PVO A;  1JT8 A;  3F2U A;  2KED A;  3P75 A;  4HCS A;  4DKA C;  5JPM C;  3FKI B;  4PMB A;  3URY A;  1FNU A;  1XPU A;  4NXM Q;  2OTL A;  2HIX A;  4A3E H;  4BY1 H;  4BY7 G;  1GOZ A;  2EZV A;  4V19 0;  2P5Z X;  1LT6 D;  4IAL A;  1NMG A;  1Z7T A;  4KHZ A;  3TSS A;  1M8A A;  1HNX L;  2UUC Q;  3WDN A;  1HZC A;  4U67 3;  1Y1W H;  4FF3 A;  4C3H G;  5C3E H;  5CGK A;  4I7A A;  4BBR G;  1A3V A;  2GVB A;  3H0G H;  4A3J H;  1AP0 A;  1BVS A;  3I4O A;  2JA6 B;  3CXC A;  4YY3 Q;  1D5Z C;  1VDZ A;  3PO3 H;  2IX1 A;  3QO2 A;  1KLU D;  3KBX A;  5DEH A;  3GTL H;  4IOC A;  1QVF A;  3QOJ A;  4OIK A;  3A56 A;  1U5K A;  4A3G B;  3I55 A;  2WB1 B;  1QG7 A;  1LAC A;  4GLA C;  5K36 H;  1O78 A;  1L0X B;  2Q8R E;  1SJH D;  3FPP A;  2VW9 A;  4A3K H;  1R4P B;  2CQA A;  5CBA E;  1JB7 A;  2F0P A;  3P7J A;  1QE6 A;  2XIW A;  3LGJ A;  1BR9 A;  2OF1 A;  2E76 C;  3CCS A;  1PTO C;  2XGT A;  1X3G A;  4POF A;  2OXP A;  3J7A F;  4WRD A;  4DR6 L;  3BZC A;  4UDU C;  3S17 B;  4JI4 L;  3D6C A;  4KKU A;  2HHH L;  2EY5 A;  3W1B A;  2C9O A;  3NEM A;  1KD1 C;  1V1O A;  2QEJ C;  5FLX L;  3OW2 A;  1VQP A;  4OX9 Q;  2A6H C;  1PH4 A;  1NBW A;  2KVM A;  1PH6 A;  2D5D A;  1HXY D;  4Y52 H;  2A6E D;  2IT1 A;  1JWU D;  2PQA B;  3QJY A;  3X3N A;  1WCM G;  1KNE A;  3UDF A;  3LWE A;  2XVS A;  1VQL A;  4DV7 L;  5LMN Q;  3E0J A;  4LFB Q;  3L0O A;  4L5S A;  4DUZ L;  3EA6 A;  2R92 G;  5M3M B;  1RIP A;  3FPU B;  4GOP B;  3EVQ A;  2KCM A;  4Z9C B;  1QNK A;  3OMG A;  4G7H C;  4IFD J;  1CUK A;  3S15 H;  1EWI A;  1SMY D;  3V2T A;  1E2V A;  1LT5 D;  2N88 A;  4IUN A;  3D6W A;  2B2W C;  1Z6H A;  3G6E A;  3ND9 A;  1XWE A;  1PRT C;  2H5X A;  2A73 B;  1JWM D;  2KA7 A;  4RCN A;  4LFC Q;  3CQZ H;  3K5O A;  1G91 A;  5KEE A;  1CKM A;  1LTL A;  2F0T A;  4L6T B;  3VDY A;  4X66 Q;  1E24 A;  5IGB A;  4QIW B;  3J81 i;  4KJN A;  4RFB A;  3D8G A;  3PGZ A;  2MFI A;  4HIK A;  3GTQ H;  3KUP A;  4B9W A;  4JYA Q;  3HOW B;  4BWG B;  4Q0F A;  1ASZ A;  3MXU A;  3M4O B;  1HR0 L;  1STA A;  2LSS A;  4HJ5 A;  3A8K E;  5C4J H;  1Q3L A;  1FR3 A;  4A3I G;  1VQ4 A;  3BYT B;  4OEM B;  4L63 B;  3JAM i;  1SFO B;  4ME3 A;  3OPO A;  4LF5 L;  5IT9 E;  3ERS X;  4LUO A;  4DR2 Q;  1EY5 A;  4DAP A;  4RGT A;  1IYV A;  2E2H B;  1ENC A;  5I9O A;  1TWC B;  2K52 A;  3G7L A;  2F03 A;  3GTG B;  3MXP A;  3S2H B;  2V1C C;  3DWQ A;  2DN8 A;  1B70 B;  2A1A A;  4DV2 L;  2LFN A;  2M00 A;  4DV5 L;  3M3Y H;  3A74 A;  1IL8 A;  1ZYR D;  1BCP D;  4KLK A;  3B6Y A;  3K7A B;  1TWG B;  4B08 A;  2ALY B;  1O80 A;  2N8N A;  1WTQ A;  3V05 A;  3CCU A;  4K6L A;  1O7Y A;  5KYI A;  4EQN A;  3PO2 B;  2IHE A;  4NPS A;  2H4O A;  4A4I A;  1EWC A;  1XMO L;  1WTX A;  2ZM6 Q;  4BY7 H;  1UEA B;  2TSS A;  1E22 A;  5JJI A;  5ELD A;  1D6E C;  4DV3 Q;  1Y1V B;  4QL5 A;  2L5T A;  1X3P A;  4RG1 A;  3FHW A;  2B2W A;  4OON A;  2B3G A;  1TII D;  2MGS A;  4BS9 A;  1CSQ A;  4AYB G;  4F87 A;  3PUW A;  3D4W A;  3KJO A;  4C3H H;  1D1I A;  3PIO 3;  4R1J A;  3E9I A;  3NE5 B;  4BBR H;  3VR5 A;  4JI2 L;  1FJG L;  5HGT A;  1HUN A;  5M9O A;  1B9N A;  4A3C G;  1CZG A;  4AQY Q;  4DR7 L;  3WOF A;  2JXM B;  1C0A A;  3L7Z C;  2LKV A;  2KCN A;  2WB1 E;  5IIF A;  1I3Q B;  2HT1 A;  2CWP A;  5DLQ E;  1TWF B;  4HAE A;  4RGO S;  3R3O A;  3A5U A;  2B8F A;  3NPP A;  3HOU B;  2F0E A;  2EJF C;  1L1O C;  1BNZ A;  1UAP A;  2FXQ A;  5J22 A;  5IGG A;  1YNJ C;  1PDQ A;  1W2B A;  1K9M C;  5BR8 Q;  2QCP X;  1QUQ B;  3Q6S A;  3D0F A;  1HZA A;  1N36 Q;  1NY4 A;  2KQ3 A;  3MXG A;  2EJM A;  2ZTE A;  4B3S L;  3VYR A;  2VS1 A;  3GTO H;  4YWM A;  1A15 A;  3KF8 A;  1X55 A;  1RTN A;  1JOK A;  2RDG A;  5AFW A;  5C44 G;  1IZ6 A;  3IL8 A;  1D2B A;  4J1M A;  2Z0S A;  1SJE D;  3IFT A;  3LX0 A;  1A2U A;  1I4Q A;  5G3L F;  5KND A;  4Y7N H;  3SDZ A;  3CKI B;  2K33 A;  5FO7 B;  4GKJ Q;  1RTO A;  4EX5 A;  5C0X G;  1F2M A;  3HG9 A;  3G71 A;  5EGT A;  1VF7 A;  1D5M C;  5CMD A;  2K5H A;  4DA2 A;  2ZJQ A;  5ELN A;  2EYJ A;  3J81 E;  3PQI A;  1J8I A;  1CSP A;  2X6L A;  4JV5 Q;  1Q8K A;  1TY2 A;  4GN3 B;  1GXD C;  1VQC A;  5I9P A;  4B3T L;  3P20 A;  4A93 G;  1QB5 D;  1WCM H;  2JP1 A;  3U50 C;  2R93 B;  1PH3 A;  4DV0 Q;  4DAY A;  1LTG D;  2B2V C;  1HPC A;  4JVZ A;  1UE1 A;  1IKL A;  1Q86 C;  1EEI D;  1ML0 D;  2ICE C;  5ISR A;  3CRK C;  2ZJR A;  2F0G A;  4XYO A;  3RZD H;  4R9W A;  1PXU A;  2R92 H;  5CV8 A;  1SNP A;  3JAM E;  1CKO A;  3I7F A;  1HTP A;  4X62 L;  5BN5 A;  1I50 B;  4JI7 Q;  4JBW A;  2PMZ E;  5DAU A;  1QZG A;  4OXP A;  4NXN L;  3SXH A;  1SRU A;  1DOL A;  2E5L L;  4POG A;  4MHE A;  2R7Z B;  4X6A H;  2AUJ D;  4J15 A;  4KK7 A;  3N52 A;  2JJQ A;  3PIP A;  1N8R C;  4RHS A;  1MSH A;  3S1N B;  1NTG A;  2JA7 B;  2VB3 X;  4DR3 Q;  1XNQ L;  1AFP A;  1L1O A;  4A3D B;  4YY3 L;  2BH8 A;  2EYM A;  3F2B A;  1EYG A;  3K8A A;  1U4M A;  1I4R A;  1L0Y B;  1L2F A;  1YBY A;  3TZU A;  4DPG A;  4LJZ C;  2LXJ A;  1ET9 A;  3CW2 C;  3KLS X;  1CZW A;  1XMQ L;  3K0X A;  1G6P A;  4R8I A;  2F0U A;  2EIF A;  5L37 A;  1IYU A;  1ESF A;  1XPR A;  4A3L G;  4ZK9 B;  1HCZ A;  3S1R B;  2PPB C;  4X64 L;  4R4O A;  5M5X B;  2B63 B;  3GTM H;  3H3V H;  1UE7 A;  5JVG 3;  4JI5 L;  4A3I H;  3BDL A;  2B8G A;  1B2T A;  2E74 C;  5EKK A;  4DV4 L;  2Z8L A;  2VXW A;  3S16 H;  5M5W B;  1FGU A;  3FKI G;  3MAQ A;  1LV9 A;  5EPL A;  4HIM A;  5HY6 A;  3RZO B;  5EBD A;  4LF7 L;  4UP9 A;  1V9P A;  4OL7 A;  2VQE L;  4H13 C;  3C1E A;  3J80 E;  3MWY W;  2QGQ A;  2ZTC A;  4K6D A;  5AJ3 Q;  1JE4 A;  4C1N I;  1ICF B;  1EU4 A;  3A7A B;  4MTK A;  1Q81 C;  1LT3 D;  2L55 A;  2BA0 A;  2NVX H;  4DK3 C;  1W6K A;  4DV6 L;  5E4W C;  1SYG A;  4JBM A;  1DJR D;  2VL6 A;  5DM6 3;  2KCT A;  3QOL A;  5JJL A;  1VMP A;  3A7L A;  5JEA G;  3BG3 A;  3AB9 A;  1LTB D;  1B3A A;  1DM0 B;  5IGF A;  4FNF A;  3TEH B;  1BBW A;  2EY6 A;  2A6E C;  4ZAI A;  3NUC A;  4EQP A;  3I4N B;  3C46 A;  3HP3 A;  1XTC D;  2YYZ A;  1HNX Q;  3T13 A;  2K5W A;  4KD3 A;  2JEB I;  2F0J A;  3U58 A;  2KEN A;  2OEO A;  1PHJ A;  4JI6 L;  4FDB A;  1E2W A;  1R4Q B;  4H7B A;  1FYC A;  4UP7 A;  2QEX A;  2VNU D;  3E9H A;  1V8Q A;  4GKK L;  1IKM A;  1VCI A;  1VQ8 A;  4BXX G;  2Z9H A;  5G3L D;  4A3C H;  2EYH A;  5CV7 A;  3ONA B;  3NTK A;  1SMY C;  3Q0A A;  2K1B A;  1PH8 A;  4DV1 L;  2VUM G;  1K83 H;  2UXC L;  3QIA A;  4LF6 L;  1I4X A;  2DNC A;  1EIF A;  2UUB L;  1PH9 A;  1T5E A;  1JC7 A;  3CPW A;  3W5O A;  1WTV A;  3GV6 A;  4NMZ A;  1STN A;  3AYH B;  5IOD A;  2TMP A;  4NP5 A;  2A69 D;  4ZRZ A;  4XYQ A;  3SK5 A;  3H6M A;  4HSV A;  1BO0 A;  2AUK A;  1I6V C;  4ULL A;  4OWX B;  2VZA A;  4DR6 Q;  5E1F A;  5FLX E;  4WOR A;  5M5Y B;  4JI4 Q;  1HFG A;  2HHH Q;  1Q12 A;  1U0L A;  5C44 H;  1QNU A;  1TWA B;  3A5Z B;  2I5L X;  2F0K A;  4KV6 A;  2ZXO A;  3DM1 A;  2M2L A;  4C3J G;  1WFQ A;  4H02 A;  4IPD A;  5C0X H;  3G6J B;  3T16 A;  1EY0 A;  1JJC B;  4JI8 L;  1S40 A;  4L5T A;  5IP7 G;  5T1G A;  1X3E A;  3EBE A;  4AH6 A;  2PO4 A;  4KKT A;  4I65 A;  1PRT B;  1KQS A;  3PF5 A;  2G5D A;  2CFM A;  2NN6 I;  3W2D A;  1HNZ L;  1A3U A;  4A93 H;  2EE1 A;  4DV7 Q;  2LS0 1;  4LFA L;  1YJN A;  2KBN A;  1YEZ A;  4LF9 Q;  4DUZ Q;  5JOB A;  3AFQ A;  1Q7Y C;  1KDC A;  1II3 A;  2EY1 A;  3RNU A;  4IFD I;  2RVL A;  3HKZ B;  5IY0 A;  5KRU A;  1ZYR C;  1KXL A;  1QIL A;  3WWV A;  4O0A A;  4RH6 A;  1PZK D;  5IOC A;  3HOW G;  1EWH A;  1VQF A;  2K4K A;  3OYY A;  2R6G A;  4A3F B;  1WTO A;  3OOC A;  4FP5 D;  3BVM A;  1ZKO A;  3UDI A;  3PCO B;  5FJ8 G;  3E6Z X;  5LMU Q;  1Z47 A;  2GA4 B;  3NEL A;  3DXJ C;  4FXD A;  1SMX A;  1SRO A;  3KF8 B;  2LMC B;  2YU9 B;  1IYJ B;  3CAM A;  4PZ7 A;  1MD2 D;  2L0C A;  2WKD A;  1GUO A;  3DEO A;  2ZXR A;  1KC8 C;  1RHP A;  5NUC A;  1X56 A;  4R8N A;  1N33 L;  1HZB A;  1HFN A;  1RCV D;  1HUM A;  1B8A A;  1HR0 Q;  2EYL A;  4X3T A;  4A3B B;  2WFW A;  1UUP A;  5E3F A;  3NXW A;  1W3S A;  3AEV A;  4A3L H;  2L12 A;  2NZ1 D;  2G9H D;  4LF5 Q;  4QJF A;  2B39 A;  1TWH H;  1CFM A;  4YWK A;  4IJH A;  4KTA A;  1AN8 A;  4KD4 A;  2B2U C;  1JOO A;  4P71 A;  4DAY B;  2E2I B;  3FKI H;  2DY8 A;  4CKB A;  1EL0 A;  5KNC A;  3HOV B;  2OQK A;  1KHI A;  2JA8 B;  5IT9 c;  3CD6 A;  2PZU A;  2Z6K C;  2Y0S G;  3M4P A;  4DV2 Q;  4BA2 I;  3S1M B;  5EBC A;  4WFN 3;  4YHH L;  4LMQ D;  4DV5 Q;  4IN3 A;  4HJ9 A;  2IW3 A;  1AEX A;  1LT4 D;  4LNQ A;  1H9R A;  5A2Q L;  1HZ9 A;  1PYW D;  2UU9 L;  4ZLT F;  3KBG A;  2WAQ B;  4X3K A;  2DJF C;  3H3V C;  1T9H A;  4UY8 C;  1K8O A;  4BY1 B;  5JEA H;  2N55 A;  4A3E B;  2H1E A;  2AQ1 B;  4IUR A;  3EIV A;  3H91 A;  2K5D A;  2GN5 A;  2MO0 A;  1PFB A;  4XT3 B;  1BCP F;  1WTW A;  1L1O B;  4JI0 L;  3HOU G;  4M1U B;  1Y14 B;  2CVR A;  4DFA A;  3BVG A;  2D0P A;  2PW5 A;  1D1K A;  1Y1W B;  3EQL C;  2JEA I;  2EYP A;  1GM5 A;  5C3E B;  2F0S A;  4JI2 Q;  1FJG Q;  3H0G B;  4A3J B;  1BBU A;  1TVX A;  1F9S A;  3PO3 B;  1NSN S;  5LL6 S;  4HR7 B;  2EY2 A;  4BXX H;  4HIO A;  4KI0 A;  4UHV A;  1G2S A;  1K8M A;  4MZ9 A;  1KAW A;  2D62 A;  2M9V A;  4X3S A;  2VUM H;  3C1F A;  1XYI A;  1DGS A;  2NUC A;  2OQ0 A;  1EQR A;  1S3O A;  2FMM A;  1TXY A;  4A3K B;  1XJV A;  3F8T A;  2MQH A;  1RF2 D;  4RA8 A;  4ID6 A;  3PSI A;  1I94 L;  1SYD A;  4B3S Q;  2HCC A;  1SLJ A;  2D2C C;  2F0Q A;  1VQJ A;  2B2U A;  1N32 L;  2XWB B;  1Q82 C;  3IAY A;  2JYO A;  1GUW A;  1PYS B;  1H95 A;  3S14 H;  2Z6K A;  1C7Y A;  3QB3 A;  1FD7 D;  3AFP A;  5I2X A;  3TRZ A;  2OT2 A;  1S5E D;  1R9T H;  1CM9 A;  4RHR A;  3HOX G;  1CT1 D;  4CHT B;  5GAG C;  4C3J H;  1JJ2 A;  2JA5 B;  1CK1 A;  1B3Q A;  1SSO A;  4C2M H;  2E75 C;  4HJA A;  5IP7 H;  3A54 A;  3G4S A;  1VQ5 A;  1Q1B A;  4B3T Q;  4IJL A;  3ER0 A;  1A0I A;  3HZX A;  1GO3 E;  3TP8 A;  2R7Z G;  3GTK H;  4EVO A;  2ASB A;  1QJO A;  4NKL A;  5GQO A;  4IO9 A;  3J81 c;  3V96 A;  1E0B A;  3HKZ E;  4K5W A;  3P1H A;  4CDF C;  1A62 A;  2PMZ B;  3UI2 A;  2JA7 G;  5EPJ A;  3ZYY X;  1Y8P B;  3OTO L;  1TS2 A;  2MHV A;  1ICW A;  2L4N A;  4X62 Q;  1CHQ D;  1UWV A;  2KOL A;  2K5N A;  3U4Z A;  1MGS A;  1SNC A;  4NXN Q;  2KHJ A;  5ELO A;  2E5L Q;  1KDA A;  2OCE A;  1EQT A;  3HOW H;  3A8J E;  4O2D A;  4HED A;  1HHV A;  2G9D A;  4ALP A;  5C4H A;  5FJ8 H;  2IL8 A;  2A19 A;  1A8V A;  1U9R A;  1KL9 A;  3MEH A;  1IBK L;  2A5H A;  3NP8 A;  2B2Y C;  1LLR D;  2NVQ B;  4JI3 Q;  1G8Z D;  4WJ4 A;  1O7I A;  3HOY B;  3OWE B;  3K7U C;  1KTK A;  1LTS D;  4YCW A;  4JPB W;  1KRS A;  3NK9 A;  4LF8 L;  1K0R A;  3VA7 A;  5C4X B;  1PFM A;  2NZH A;  2F0M A;  4KY5 A;  5KYL A;  2QF7 A;  1HJP A;  2EDG A;  2N78 A;  5C0X J;  3MXN A;  2ID0 A;  1EQQ A;  4X64 Q;  5JVH 3;  1D5X C;  1I6H H;  1K73 C;  2SEB D;  5FKA C;  4DNR B;  5C4J B;  4V0B A;  2KCC A;  4JI5 Q;  2RCF A;  3S9W A;  4DV4 Q;  1WTP A;  3K7A H;  4KJO A;  4RMF A;  3GQB A;  1STE A;  4LF7 Q;  4R4T A;  3BU2 A;  4DAM A;  2VQE Q;  5D3D A;  3BDC A;  5COY A;  1EY4 A;  1LTA D;  3OSO A;  4RKL A;  4C3I G;  3I56 A;  2A69 C;  4ZYS A;  1NJI C;  1H9S A;  3S2D B;  1OXV A;  4C56 C;  3HOZ B;  1IBL L;  3PUX A;  3Q23 A;  1F2Z A;  2WAQ E;  2VQF L;  1LYL A;  1K3B C;  3CP0 A;  4QQB X;  2K5V A;  1SE8 A;  4DV6 Q;  1GUT A;  2J0T D;  3SK4 A;  3J80 c;  4FO2 A;  3M3Y B;  4A3M B;  1FGB D;  3HEJ A;  4QUF A;  1YJ9 A;  4OIJ A;  1NUC A;  1CA6 A;  3VYU A;  2ATW A;  2EXD A;  2NN6 G;  5J39 A;  1EOV A;  3TP6 A;  1ET6 A;  4K5X A;  3MHB A;  4TKO B;  4GN4 B;  2ZJP A;  3RR5 A;  2E2D C;  3I73 A;  3CCL A;  1WD1 A;  4IFD G;  1EY9 A;  2AWN A;  4B3R L;  2MNA A;  1TWF H;  1XPO A;  2NVT H;  2RCN A;  3HOU H;  3S1Q B;  4JI6 Q;  3DM3 A;  1S72 A;  3G48 A;  3CCM A;  2AHO B;  4HJ7 A;  3HKS A;  4N8F A;  2MPM A;  4GKK Q;  2PYK A;  4C3H B;  2A68 C;  2F0W A;  4BBR B;  4QCL A;  1A3T A;  4K2K A;  4X3U A;  2B2Y A;  5ELF A;  1WOC A;  1SN8 A;  4KHP L;  2UXC Q;  2E2J H;  2Q2H A;  1I4H A;  3CMA A;  2UUB Q;  2BDN A;  2FFK B;  3AMU A;  4H0L C;  3ND8 A;  2RHS B;  3SEB A;  3NTI A;  2B29 A;  2EYF A;  1B44 D;  1F2L A;  2O4X A;  2XNA C;  1UE5 A;  2YV5 A;  4NW2 A;  3K57 A;  1TS5 A;  4XQQ A;  3WOE A;  4KHV A;  4IOA A;  2HCI A;  3M7G A;  1YNX A;  2A74 C;  2Q2T A;  1M4V A;  4QY7 A;  3A0J A;  3RD4 A;  2GVA A;  4Y7N B;  2J4X A;  1LTT D;  5JEA J;  2F3I A;  1H9J A;  5CV6 A;  4CDE C;  1PFN A;  5FLX c;  2QW7 A;  5LMN L;  1BCP B;  4JI8 Q;  1DOM A;  1VQB A;  3HOX H;  5EQ0 A;  4IUQ A;  1GD7 A;  4DR4 L;  3CCR A;  4HMJ A;  1PV4 A;  2JSO A;  4X65 L;  1HNZ Q;  3OHX C;  2EQS A;  4LFA Q;  2CW0 D;  1TS3 A;  4NB3 A;  1W6J A;  2NZO A;  1EIY B;  4P73 A;  1PZI D;  1EQV A;  4QUC A;  4LK1 C;  4GNX B;  3S1N H;  3O13 A;  3VYS A;  4DK0 A;  4KY6 A;  2R92 B;  1SE4 A;  4IPG A;  5M3F G;  5CV9 A;  1PTO D;  1SBB B;  2I0Q A;  1HQR D;  1XNR L;  2WV6 D;  3TBI B;  4P75 A;  5ELE A;  1NR4 A;  1EYC A;  1PH7 A;  2RSO A;  4NDX A;  4GLV B;  2QIL A;  2CH4 W;  3I4M B;  1U4R A;  1YI2 A;  1OXX K;  1SYF A;  5FO8 B;  4FF2 A;  5HUR A;  3S1R H;  2N3S A;  3I3C A;  5M5X H;  3K80 C;  4XXE A;  1OXU A;  1YIJ A;  4A76 A;  1VQ9 A;  2VY3 A;  4BBS G;  3OIQ A;  4CJ2 C;  1VQD A;  2B2T A;  4R4I A;  2IX0 A;  2RDH A;  2WKC A;  2K7V A;  1N33 Q;  2RBM A;  3SK8 A;  2CWA A;  3CC4 A;  1JIC A;  5IT9 L;  3D4D A;  1IBM L;  1VQ7 A;  2WII B;  1EZ6 A;  4IPH A;  4FXG C;  4DXG A;  1XX8 A;  1K3R A;  3GTM B;  3Q24 A;  1AH9 A;  3ULL A;  2F0I A;  1YNN D;  1DYQ A;  3IKJ A;  3KF6 A;  2K04 A;  2WAQ G;  1WTR A;  5KGU A;  3S16 B;  1BUV T;  3M7N A;  5KNB A;  1IL2 A;  2AQ3 B;  2JA6 G;  5D65 A;  1S5C D;  2FHT A;  1ILQ A;  5A2Q E;  5JJK A;  2O2L D;  5IP9 G;  4YHH Q;  1KIX A;  4C3I H;  4F8M A;  2UXD L;  4G7Z C;  2XSC A;  2UU9 Q;  2F4V L;  2DGY A;  2QDL A;  2NVX B;  2AQ2 B;  4A3G G;  2WB1 G;  3QWN A;  5IGC A;  1BXT A;  1N34 L;  3A8I E;  5GAE C;  3BDO A;  3SGI A;  3R8B A;  3K5M A;  1OTC A;  2NN6 H;  4YCV A;  2NB0 A;  5ELC A;  4ZUJ A;  1NNX A;  3KYH C;  2A8V A;  1F9Q A;  1PTO H;  2K32 A;  4ODG A;  1C4Q A;  4LAA A;  3M9B A;  5LHY 1;  1PYB A;  4JI0 Q;  3J81 j;  2SDF A;  5C3X A;  1B50 A;  1TS4 A;  4IFD H;  1DCZ A;  2WIN B;  3ITP A;  5JJZ A;  5IWA L;  4AYB B;  3KK7 A;  1NR2 A;  2RSN A;  1AE2 A;  2E8G A;  4ZKB B;  5FLM G;  2UUA L;  3DWP A;  3MXN B;  4OHJ A;  3C2P A;  1LTI D;  4DN4 M;  3T53 B;  2SNM A;  1TY0 A;  1O7Z A;  3TN2 A;  5CV5 A;  2L15 A;  4FXK C;  1XTD A;  5GAD C;  2PZT A;  2Z4H A;  3CCJ A;  1K83 B;  3T56 B;  2NVY B;  1MBY A;  1N9W A;  2K6A A;  1K28 A;  1S5F D;  4MNO A;  2ZTD A;  4YWL A;  4IUT A;  4ABN A;  2Q2U A;  5H1S E;  2EYO A;  3HGB A;  1QZH A;  1GVP A;  4GN5 A;  4GS3 A;  1H9S B;  2MP1 A;  3T1Y L;  3VR2 A;  2JA5 G;  1J9O A;  1STG A;  1RD9 D;  1HNW L;  5M3M G;  3UE0 A;  3K58 A;  4QGU A;  4JI1 L;  3STB D;  1N32 Q;  3R2I A;  4DR1 L;  1P16 A;  1ASY A;  3L9A X;  5I6W A;  1UNS A;  2K75 A;  4KKS A;  4RGM A;  2K01 A;  4FF1 A;  5C44 B;  4HCE A;  2F3V A;  1KRT A;  1LO5 D;  4DV0 L;  1RL2 A;  4JBK A;  1X65 A;  2AKW B;  1NE3 A;  1WTH A;  2EJG C;  2XRQ D;  1HRJ A;  2K03 A;  5DNF A;  4PV1 C;  4DR5 L;  4G57 A;  4DAV A;  3PUZ A;  1TQO A;  4CKE A;  1LAB A;  1BCP C;  1EY6 A;  2N49 A;  4CJ0 B;  2IX3 A;  1LUZ A;  4HTH A;  1EOT A;  4L5Q A;  5BN4 A;  4EQ5 A;  1SNM A;  5LMN W;  1MIU A;  1SYE A;  3IFD A;  1CQV A;  5T1I A;  3GTJ H;  3OTO Q;  3TS2 A;  4KN7 C;  3NQI A;  5F2D A;  4P72 A;  1VS0 A;  3ICE A;  2K5Q A;  3K81 C;  3HOY G;  4MIU A;  5CR3 A;  3NTH A;  4DR3 L;  3TZD A;  2Z1C A;  5M3F H;  1NAP A;  1Q46 A;  3H94 A;  4GNX C;  5C4X G;  1G2T A;  1U4P A;  3CCV A;  3CF5 A;  4N9P A;  1CHP D;  4OO1 I;  3DUZ A;  1GJX A;  1ROD A;  3ERQ A;  3RLF A;  3VA5 A;  1IBK Q;  3KLS A;  4OWT B;  2YTY A;  3GTP B;  1XXG A;  4CBV A;  1CI3 M;  4LWC A;  3K5L A;  2JK8 A;  2K28 A;  3KFU A;  1CKN A;  2K50 A;  4YCU A;  5J3B A;  1O7L A;  2F0L A;  4BBS H;  4LF8 Q;  3DMU A;  3NWT A;  3J7A 5;  4TVA B;  1DD2 A;  1IW7 D;  3PO2 G;  4K14 A;  5IGE A;  4ILW A;  4G4K A;  3HOZ G;  3RLO A;  1B1Z A;  3D31 A;  1GKH A;  5I4D A;  4PNY A;  1Y1V G;  4A3M G;  4JC0 A;  3J80 L;  2HDM A;  3I72 A;  3EJI A;  4G7O C;  1VMC A;  2F1M A;  3FEW X;  3M85 A;  4DNT B;  1TKW B;  4DK1 A;  2F0F A;  4F88 A;  3D3R A;  2Z4I A;  1LTR D;  3BYY B;  1XMO Q;  2JA6 H;  3D4R A;  3QG1 A;  4EGV A;  3W3A A;  2RA4 A;  1IBL Q;  4DXF A;  2VQF Q;  2D9U A;  4ZUI A;  5IP9 H;  1V1P A;  3PIO A;  3E0E A;  1I5F A;  3TRE A;  5IGD A;  1JR0 D;  1VQI A;  2Z6B A;  3C3L A;  4HN7 A;  4A3G H;  1MHW C;  3CCE A;  1HTL D;  3F1Z A;  2HQL A;  2FIN B;  2F0D A;  4OEL B;  4JK1 C;  4DR7 Q;  2CCZ A;  1C9O A;  2CH4 A;  1OXT A;  2WAC A;  4B3R Q;  2NYZ D;  5CV4 A;  4LUV A;  2PZW A;  4QF4 A;  5E7N A;  3ULP A;  4LW1 A;  1Z9F A;  3UE1 A;  4XQN A;  4GNX A;  4AYB E;  4LF4 L;  3GTL B;  3KLW A;  4J6H A;  3I90 A;  4HSP A;  1GHJ A;  2CW0 C;  1EFW A;  1F9P A;  3S17 H;  2BOS A;  4JOI C;  1MJE A;  3VYT A;  4HJ8 A;  1BDO A;  3GP7 A;  2J7Z A;  4JG2 A;  2EOT A;  3R2T A;  5FLM H;  1VQK A;  2I07 B;  1D7Q A;  3UDG A;  3L3O C;  3U9O A;  4KHP Q;  3M4Y A;  2KEE A;  3NHH A;  3KF6 B;  5C5M A;  3R93 A;  1E7Z A;  5FOB B;  1EIG A;  2R7F A;  1H9M A;  1G6Z A;  2KHS A;  1VQN A;  2R93 G;  2VUM B;  2ZT9 C;  2ICI A;  5IYC G;  1EIH A;  3F2D A;  3HS0 C;  4R4Q A;  4DF7 A;  1A2T A;  1BKB A;  1G51 A;  3MC0 B;  1AW7 A;  4H44 C;  2JA5 H;  1AE3 A;  2F0N A;  2BA1 A;  2XRS D;  2PI2 A;  1KDB A;  5K5P A;  1VQH A;  5J1Z A;  5M3M H;  3T51 B;  2VB2 X;  2BDO A;  1NMF A;  4M8A A;  3BZD B;  3SVM A;  1K8A C;  1J5E L;  4LUZ A;  2IJ0 A;  1EYA A;  4IQZ A;  3S14 B;  4O1N A;  2X6G A;  2UXB L;  2K05 A;  1SEB D;  1SDF A;  5BN3 A;  4FF4 A;  3ULJ A;  4TRD A;  1R9T B;  4C3J B;  4LF9 L;  1WI5 A;  4K8J A;  3T4A C;  4E6I A;  5LL6 X;  1JWS D;  1SXT A;  1YNN C;  4C2M B;  1E1O A;  1I4G A;  4A3D G;  1FNV A;  3X3M A;  4DR4 Q;  4K0K L;  4X65 Q;  3L2P A;  1STY A;  3BZK A;  3S15 B;  4RAU C;  2MJ8 A;  3RN5 A;  1AZQ A;  3GTK B;  1TT2 A;  4HID A;  3I4M G;  3GD7 A;  3JAM c;  3TS0 A;  1C48 A;  1J6Q A;  3M4O H;  2DY7 A;  3CQZ B;  3OWF A;  3NBH A;  2B63 G;  1WD0 A;  2CKZ B;  5LMU L;  5KIX A;  1XNQ Q;  5DM7 3;  2NVQ H;  2F52 A;  4B3M L;  1X54 A;  1SFO H;  3HOY H;  1EY7 A;  4JOI A;  2CQO A;  5IYB G;  3H15 A;  1XNR Q;  1SR3 A;  2JA9 A;  3K59 A;  3GTQ B;  2V4D A;  2XTI A;  2PNR C;  4OWW B;  1ENF A;  1Q90 A;  1LM0 A;  1QOH A;  2IPK D;  5C4X H;  4OGQ C;  4DUY L;  2E2H H;  3DLL A;  1TWC H;  1XMQ Q;  4UP8 A;  2C5C A;  4ZKC B;  1SE3 A;  1AZP A;  3GTG H;  3S2H H;  1EFI D;  4PMC A;  1QVG A;  2JN4 A;  2RKS A;  1PTO F;  3CU7 A;  4WJW A;  1KAA A;  1ONL A;  5D3I B;  1EY8 A;  2HQE A;  3T1H L;  1K8G A;  5JPN C;  1VQO A;  1A63 A;  3I2Z A;  5CC4 A;  1FL0 A;  1TWG H;  2O5J C;  3EFX D;  3QR8 A;  1Q1E A;  1IBM Q;  4XIG S;  3PO2 H;  3N6R A;  4CGY B;  3SR1 A;  4NXM L;  3S2D H;  3GO5 A;  3HOZ H;  4XDX A;  2IY5 B;  5E4X A;  1I6H B;  3I4N G;  4EQO A;  2RF4 A;  2BE5 D;  1Y1V H;  4A3M H;  1NCV A;  3NSW A;  1M90 C;  5ELB A;  2PNH A;  1JOQ A;  1KAB A;  3RLN A;  2EVB A;  2UUC L;  3MFY A;  1VQG A;  3BJU A;  1YHB A;  1WYD A;  1VQM A;  1DON A;  2UXD Q;  1JE5 A;  4BY7 B;  3STB C;  2PCF B; 
#chains in the Genus database with same CATH homology
 4FYD A;  2Y0S B;  2NTS A;  1SNQ A;  1SNO A;  1OXS C;  1PRT F;  5CBE E;  3PUV A;  4RWS C;  4CJ1 B;  4ME5 A;  3K0Y A;  1ZXT A;  1JB3 A;  4PMW A;  3FMC A;  1EU3 A;  3TP5 A;  4K5V A;  2CHB D;  4IUV A;  2NVT B;  3E5S A;  3I91 A;  1OO9 B;  1QCB D;  1F9R A;  4OO1 G;  2Q8I B;  1Q8I A;  1TR5 A;  2B2T C;  4CKC A;  1S5D D;  5FK9 C;  2F3W A;  3K5N A;  3OIP A;  3VR3 A;  3GTO B;  1ESR A;  3OMC A;  1VF5 C;  2E2J B;  1WVL A;  1I4P A;  4N9T A;  1STB A;  3DEP A;  1PZJ D;  3PUY A;  3OW7 A;  2DNE A;  3ERO A;  1X32 A;  1V1P B;  1BBX C;  5JAV A;  5I6Y A;  2LY7 A;  3CRL C;  2QKI C;  3H09 A;  3TME A;  5A35 A;  3RMH A;  2L1B A;  4RKB A;  1IW7 C;  3I4L A;  2R3Z A;  1WCM B;  1SYB A;  1PMR A;  4BA1 I;  2F0V A;  4DGZ A;  1JOR A;  1SND A;  3VR4 A;  1S5B D;  5C3W A;  4O42 A;  5D14 A;  2F4I A;  3RZD B;  2SNS A;  3FDT A;  3J7Y W;  3HOX B;  4QB4 A;  4YIJ A;  5EKL A;  4RGN A;  1Y8N B;  1SE2 A;  1MSG A;  4C1N K;  4U68 A;  4KMU C;  1HA6 A;  3GV3 A;  1H9K A;  2R61 A;  3LNN A;  3BVZ A;  2NWG A;  2L11 A;  4UAI A;  1DOK A;  2A6H D;  2BCO A;  2KEC A;  1EYD A;  3VR6 A;  1GUG A;  1EEF D;  2JE6 I;  4IZ8 A;  1KNA A;  1BQQ T;  2Q8T A;  3MFG A;  5C6A A;  2NBF A;  5EJW A;  4A3I B;  2XN9 C;  1SYC A;  3HRZ C;  1IHZ A;  2AWO A;  1GUS A;  1CTM A;  1RDP D;  3FVQ A;  2IWH A;  1SAP A;  3CHB D;  2L9H A;  4S3S A;  1F2Y A;  2EXZ A;  1PRT D;  4ZQ3 A;  2I46 A;  4XT1 B;  3MTS A;  3LWU A;  3NQT A;  3NWS A;  1BOS A;  3DWA A;  2F0H A;  3SE0 A;  2B2V A;  3BS1 A;  3PV0 A;  1ILP A;  3U9S A;  1PLF A;  4MN3 A;  3K6O A;  4C3I B;  1V43 A;  1T5X D;  4KN4 C;  4QMG A;  4RCO A;  3FRP B;  4K8I A;  4DU9 A;  1B53 A;  3DHQ A;  1QWY A;  2SOB A;  4IUU A;  5K36 G;  5EPK A;  2PQE A;  4K2L A;  1GHK A;  4FVM A;  1FNW A;  1PTO B;  3PMF A;  3RUZ A;  5FO9 B;  3I70 A;  4L8J A;  2WP8 J;  4F7X A;  1B9M A;  3AU7 A;  1BF4 A;  4GZY C;  4HMI A;  4TQU S;  5CYU A;  2EPB A;  1X3Q A;  2XWJ B;  1HA5 A;  4OO1 H;  2KUM A;  1RJT A;  3TDQ A;  4J8Q A;  1JQY D;  3SK6 A;  1TU2 B;  1HQM C;  1E2Z A;  2ZXP A;  4I7Z C;  2QDB A;  3J81 L;  3Q22 A;  1A6X A;  3MA2 B;  4XTC S;  4KY7 A;  1Y69 U;  2MUY A;  2HUG A;  2HDL A;  2X69 A;  4B9X A;  3J7A V;  1DZ1 A;  5EKI A;  1MI2 A;  1S4Z A;  1ZEQ X;  2KJX A;  4A93 B;  3A55 A;  1CQF A;  3JAM L;  3MVV A;  1YNJ D;  2A68 D;  3NBI A;  3TP7 A;  2BE5 C;  3SHL A;  4PQX A;  2RDF A;  2NTT A;  2FJ2 A;  1STH A;  5I2Y A;  4TSS A;  1Y8O B;  1G29 1;  3PIP 3;  4P2C B;  1JCK B;  4IUP A;  5C5L A;  1F77 A;  3GTJ B;  2PW7 A;  3KLR A;  2RQX A;  1RKN A;  2FMC A;  1DXM A;  2F0O A;  5TSS A;  3MZ5 A;  5M3F B;  1ENA A;  1C8C A;  5C0X I;  4Q5V A;  1KLG D;  2ENB A;  1GUN A;  1U4L A;  3I8Z A;  2O5I C;  5COR A;  1B4O A;  4XQJ A;  1TWH B;  1EZ8 A;  4BBS B;  5C4Z A;  1CA5 A;  3F2U A;  2KED A;  3P75 A;  4HCS A;  5JPM C;  3FKI B;  4PMB A;  3URY A;  1FNU A;  1GOZ A;  2EZV A;  4V19 0;  1LT6 D;  4IAL A;  1Z7T A;  4KHZ A;  3TSS A;  1M8A A;  3WDN A;  4U67 3;  4FF3 A;  4C3H G;  5CGK A;  1A3V A;  1AP0 A;  2JA6 B;  1D5Z C;  1VDZ A;  2IX1 A;  3QO2 A;  1KLU D;  3KBX A;  5DEH A;  3QOJ A;  4OIK A;  3A56 A;  4A3G B;  2WB1 B;  1QG7 A;  1LAC A;  5K36 H;  1O78 A;  1L0X B;  2Q8R E;  1SJH D;  3FPP A;  1R4P B;  2CQA A;  5CBA E;  2F0P A;  3P7J A;  1QE6 A;  2XIW A;  1BR9 A;  2OF1 A;  2E76 C;  1PTO C;  2OXP A;  3J7A F;  4WRD A;  4UDU C;  3S17 B;  3D6C A;  4KKU A;  2EY5 A;  2C9O A;  1V1O A;  2QEJ C;  5FLX L;  2A6H C;  2KVM A;  2D5D A;  1HXY D;  2A6E D;  2IT1 A;  1JWU D;  3QJY A;  3X3N A;  1KNE A;  3LWE A;  2XVS A;  3E0J A;  3EA6 A;  5M3M B;  3FPU B;  3EVQ A;  4Z9C B;  1QNK A;  3OMG A;  4G7H C;  4IFD J;  1SMY D;  3V2T A;  1E2V A;  1LT5 D;  2N88 A;  4IUN A;  3D6W A;  2B2W C;  1Z6H A;  3ND9 A;  1XWE A;  1PRT C;  2A73 B;  1JWM D;  2KA7 A;  4RCN A;  3K5O A;  1G91 A;  5KEE A;  2F0T A;  4L6T B;  5IGB A;  4QIW B;  4KJN A;  4RFB A;  3D8G A;  3KUP A;  4B9W A;  3HOW B;  4BWG B;  4Q0F A;  3MXU A;  3M4O B;  1STA A;  3A8K E;  1Q3L A;  1FR3 A;  3BYT B;  4L63 B;  1SFO B;  3OPO A;  5IT9 E;  1EY5 A;  4DAP A;  4RGT A;  1IYV A;  2E2H B;  1ENC A;  5I9O A;  1TWC B;  3G7L A;  2F03 A;  3GTG B;  3MXP A;  3S2H B;  3DWQ A;  2DN8 A;  2LFN A;  2M00 A;  1IL8 A;  1ZYR D;  1BCP D;  3K7A B;  1TWG B;  4B08 A;  1O80 A;  1WTQ A;  3V05 A;  4K6L A;  1O7Y A;  5KYI A;  4EQN A;  3PO2 B;  2H4O A;  1EWC A;  1WTX A;  1UEA B;  2TSS A;  5ELD A;  1D6E C;  1Y1V B;  2L5T A;  1X3P A;  2B2W A;  1TII D;  2MGS A;  4BS9 A;  4F87 A;  3PUW A;  3D4W A;  1D1I A;  3PIO 3;  3NE5 B;  3VR5 A;  5HGT A;  1HUN A;  5M9O A;  1B9N A;  1CZG A;  3WOF A;  2JXM B;  3L7Z C;  2LKV A;  2KCN A;  5IIF A;  1I3Q B;  1TWF B;  4HAE A;  4RGO S;  3R3O A;  2B8F A;  3NPP A;  3HOU B;  2F0E A;  2EJF C;  1BNZ A;  1UAP A;  5J22 A;  5IGG A;  1YNJ C;  1PDQ A;  2QCP X;  3Q6S A;  2KQ3 A;  3MXG A;  2EJM A;  3VYR A;  1A15 A;  3KF8 A;  1RTN A;  1JOK A;  2RDG A;  5AFW A;  3IL8 A;  1D2B A;  4J1M A;  1SJE D;  3IFT A;  3LX0 A;  1A2U A;  5G3L F;  1I4Q A;  5KND A;  3SDZ A;  3CKI B;  2K33 A;  5FO7 B;  1RTO A;  5C0X G;  1F2M A;  3HG9 A;  5EGT A;  1VF7 A;  1D5M C;  5CMD A;  4DA2 A;  2EYJ A;  3J81 E;  1J8I A;  2X6L A;  1TY2 A;  1GXD C;  5I9P A;  3P20 A;  1QB5 D;  2JP1 A;  2R93 B;  4DAY A;  1LTG D;  2B2V C;  1HPC A;  1IKL A;  1EEI D;  1ML0 D;  2ICE C;  5ISR A;  3CRK C;  2F0G A;  4XYO A;  4R9W A;  1PXU A;  5CV8 A;  1SNP A;  3JAM E;  1HTP A;  5BN5 A;  1I50 B;  4JBW A;  5DAU A;  3SXH A;  1DOL A;  4MHE A;  2R7Z B;  2AUJ D;  4KK7 A;  3N52 A;  4RHS A;  1MSH A;  3S1N B;  2JA7 B;  2VB3 X;  1AFP A;  4A3D B;  2EYM A;  1U4M A;  1I4R A;  1L0Y B;  3TZU A;  4LJZ C;  1ET9 A;  3KLS X;  1CZW A;  4R8I A;  2F0U A;  1IYU A;  1ESF A;  4ZK9 B;  1HCZ A;  3S1R B;  2PPB C;  2B63 B;  5M5X B;  5JVG 3;  3BDL A;  2B8G A;  1B2T A;  2E74 C;  5EKK A;  2Z8L A;  2VXW A;  5M5W B;  3MAQ A;  1LV9 A;  5EPL A;  3RZO B;  5EBD A;  4OL7 A;  4H13 C;  3C1E A;  3J80 E;  3MWY W;  4K6D A;  1JE4 A;  4C1N I;  1EU4 A;  3A7A B;  1LT3 D;  2L55 A;  2BA0 A;  1W6K A;  5E4W C;  1SYG A;  1DJR D;  5DM6 3;  3QOL A;  1VMP A;  3A7L A;  5JEA G;  3BG3 A;  3AB9 A;  1LTB D;  1B3A A;  1DM0 B;  5IGF A;  4FNF A;  2EY6 A;  2A6E C;  4ZAI A;  3NUC A;  4EQP A;  3I4N B;  3C46 A;  3HP3 A;  1XTC D;  2YYZ A;  3T13 A;  2K5W A;  4KD3 A;  2JEB I;  2F0J A;  2OEO A;  1E2W A;  1R4Q B;  4H7B A;  1FYC A;  2VNU D;  1V8Q A;  1IKM A;  1VCI A;  5G3L D;  2EYH A;  5CV7 A;  3ONA B;  3NTK A;  1SMY C;  3Q0A A;  2K1B A;  3QIA A;  1I4X A;  2DNC A;  1T5E A;  1JC7 A;  1WTV A;  3GV6 A;  4NMZ A;  1STN A;  5IOD A;  2TMP A;  4NP5 A;  2A69 D;  4ZRZ A;  4XYQ A;  3SK5 A;  3H6M A;  4HSV A;  1BO0 A;  2AUK A;  1I6V C;  4ULL A;  5E1F A;  5FLX E;  4WOR A;  5M5Y B;  1HFG A;  1Q12 A;  1QNU A;  1TWA B;  2F0K A;  4KV6 A;  2ZXO A;  3DM1 A;  2M2L A;  4C3J G;  5C0X H;  3G6J B;  3T16 A;  1EY0 A;  5T1G A;  2PO4 A;  4KKT A;  4I65 A;  1PRT B;  2NN6 I;  3W2D A;  1A3U A;  2EE1 A;  2LS0 1;  5JOB A;  1KDC A;  1II3 A;  2EY1 A;  4IFD I;  2RVL A;  3HKZ B;  5KRU A;  1ZYR C;  1QIL A;  4RH6 A;  1PZK D;  5IOC A;  1EWH A;  2R6G A;  4A3F B;  1WTO A;  3OOC A;  4FP5 D;  3BVM A;  1ZKO A;  3E6Z X;  1Z47 A;  2GA4 B;  3DXJ C;  4FXD A;  2LMC B;  2YU9 B;  1MD2 D;  2L0C A;  2WKD A;  1GUO A;  3DEO A;  2ZXR A;  1RHP A;  5NUC A;  4R8N A;  1HFN A;  1RCV D;  1HUM A;  2EYL A;  4X3T A;  4A3B B;  1UUP A;  5E3F A;  3NXW A;  2L12 A;  2NZ1 D;  2G9H D;  2B39 A;  1CFM A;  4KTA A;  1AN8 A;  4KD4 A;  2B2U C;  1JOO A;  2E2I B;  2DY8 A;  4CKB A;  1EL0 A;  5KNC A;  3HOV B;  2JA8 B;  2PZU A;  4BA2 I;  3S1M B;  5EBC A;  4WFN 3;  4LMQ D;  4IN3 A;  2IW3 A;  1AEX A;  1LT4 D;  1H9R A;  5A2Q L;  1PYW D;  4ZLT F;  3KBG A;  2WAQ B;  4X3K A;  3H3V C;  1K8O A;  4BY1 B;  5JEA H;  2N55 A;  4A3E B;  2H1E A;  2AQ1 B;  4IUR A;  3H91 A;  2K5D A;  4XT3 B;  1PFB A;  1BCP F;  1WTW A;  4M1U B;  2CVR A;  4DFA A;  3BVG A;  2PW5 A;  1D1K A;  1Y1W B;  3EQL C;  2JEA I;  2EYP A;  5C3E B;  2F0S A;  3H0G B;  4A3J B;  1TVX A;  1F9S A;  3PO3 B;  1NSN S;  5LL6 S;  4HR7 B;  2EY2 A;  4KI0 A;  1G2S A;  1K8M A;  2D62 A;  2M9V A;  4X3S A;  3C1F A;  1XYI A;  2NUC A;  2FMM A;  4A3K B;  1RF2 D;  4RA8 A;  4ID6 A;  1SYD A;  2HCC A;  2D2C C;  2F0Q A;  2B2U A;  2XWB B;  3IAY A;  2JYO A;  1GUW A;  3QB3 A;  1FD7 D;  5I2X A;  2OT2 A;  1S5E D;  1CM9 A;  4RHR A;  1CT1 D;  4CHT B;  2JA5 B;  1CK1 A;  1SSO A;  2E75 C;  3A54 A;  1Q1B A;  3HZX A;  3TP8 A;  4EVO A;  1QJO A;  4NKL A;  3V96 A;  1E0B A;  4K5W A;  3P1H A;  2PMZ B;  3UI2 A;  5EPJ A;  3ZYY X;  1Y8P B;  1TS2 A;  2MHV A;  1ICW A;  2L4N A;  1CHQ D;  2KOL A;  1MGS A;  1SNC A;  1KDA A;  1EQT A;  3A8J E;  4HED A;  1HHV A;  2G9D A;  5C4H A;  2IL8 A;  1U9R A;  3MEH A;  2A5H A;  3NP8 A;  2B2Y C;  1LLR D;  2NVQ B;  1G8Z D;  3HOY B;  3OWE B;  1KTK A;  1LTS D;  3NK9 A;  3VA7 A;  5C4X B;  1PFM A;  2F0M A;  4KY5 A;  5KYL A;  2QF7 A;  2EDG A;  5C0X J;  3MXN A;  2ID0 A;  5JVH 3;  1D5X C;  2SEB D;  5FKA C;  4DNR B;  5C4J B;  4V0B A;  2KCC A;  3S9W A;  1WTP A;  4KJO A;  3GQB A;  1STE A;  5D3D A;  3BDC A;  5COY A;  1EY4 A;  1LTA D;  3OSO A;  4RKL A;  4C3I G;  2A69 C;  4ZYS A;  1H9S A;  3S2D B;  1OXV A;  4C56 C;  3HOZ B;  3PUX A;  3Q23 A;  1F2Z A;  1GUT A;  2J0T D;  3SK4 A;  3M3Y B;  4FO2 A;  4A3M B;  1FGB D;  3HEJ A;  4QUF A;  4OIJ A;  1NUC A;  1CA6 A;  3VYU A;  2NN6 G;  5J39 A;  3TP6 A;  1ET6 A;  4K5X A;  3MHB A;  4TKO B;  2E2D C;  3I73 A;  1WD1 A;  4IFD G;  1EY9 A;  2AWN A;  3S1Q B;  2MPM A;  2PYK A;  4C3H B;  2A68 C;  2F0W A;  4BBR B;  4QCL A;  1A3T A;  4K2K A;  4X3U A;  2B2Y A;  5ELF A;  1I4H A;  2BDN A;  2FFK B;  3AMU A;  4H0L C;  3ND8 A;  3SEB A;  3NTI A;  2EYF A;  1B44 D;  1F2L A;  2O4X A;  2XNA C;  4NW2 A;  3K57 A;  1TS5 A;  4XQQ A;  3WOE A;  4KHV A;  2HCI A;  3M7G A;  2A74 C;  1M4V A;  3RD4 A;  4Y7N B;  2J4X A;  1LTT D;  5JEA J;  5CV6 A;  1H9J A;  1PFN A;  1BCP B;  1DOM A;  5EQ0 A;  4IUQ A;  4HMJ A;  2JSO A;  3OHX C;  2CW0 D;  1TS3 A;  1W6J A;  1PZI D;  1EQV A;  4QUC A;  4LK1 C;  3O13 A;  3VYS A;  4DK0 A;  4KY6 A;  2R92 B;  1SE4 A;  5CV9 A;  1PTO D;  1SBB B;  1HQR D;  2WV6 D;  3TBI B;  5ELE A;  1NR4 A;  1EYC A;  2RSO A;  4NDX A;  3I4M B;  2QIL A;  1U4R A;  1OXX K;  1SYF A;  5FO8 B;  4FF2 A;  5HUR A;  3I3C A;  4XXE A;  1OXU A;  3OIQ A;  4CJ2 C;  2B2T A;  2IX0 A;  2RDH A;  2WKC A;  2K7V A;  2RBM A;  3SK8 A;  1JIC A;  5IT9 L;  3D4D A;  2WII B;  1EZ6 A;  4FXG C;  4DXG A;  1XX8 A;  3GTM B;  3Q24 A;  2F0I A;  1YNN D;  1DYQ A;  3IKJ A;  2K04 A;  1WTR A;  5KGU A;  3S16 B;  1BUV T;  3M7N A;  5KNB A;  2AQ3 B;  5D65 A;  1S5C D;  2FHT A;  1ILQ A;  5A2Q E;  2O2L D;  4F8M A;  4G7Z C;  2XSC A;  2NVX B;  2AQ2 B;  3QWN A;  5IGC A;  1BXT A;  3A8I E;  3BDO A;  3R8B A;  3K5M A;  2NN6 H;  5ELC A;  2NB0 A;  4ZUJ A;  1F9Q A;  1PTO H;  2K32 A;  4ODG A;  1C4Q A;  4LAA A;  5LHY 1;  2SDF A;  5C3X A;  1B50 A;  1TS4 A;  4IFD H;  1DCZ A;  2WIN B;  3ITP A;  5JJZ A;  4AYB B;  3KK7 A;  1NR2 A;  2RSN A;  4ZKB B;  3DWP A;  4OHJ A;  3C2P A;  1LTI D;  4DN4 M;  3T53 B;  2SNM A;  1TY0 A;  1O7Z A;  3TN2 A;  5CV5 A;  4FXK C;  2PZT A;  2Z4H A;  1K83 B;  3T56 B;  2NVY B;  1MBY A;  2K6A A;  1S5F D;  4IUT A;  4ABN A;  2EYO A;  3HGB A;  1H9S B;  2MP1 A;  3VR2 A;  1J9O A;  1STG A;  1RD9 D;  3K58 A;  3R2I A;  3L9A X;  5I6W A;  1UNS A;  4KKS A;  4RGM A;  2K01 A;  4FF1 A;  5C44 B;  4HCE A;  2F3V A;  1LO5 D;  2EJG C;  2XRQ D;  1HRJ A;  2K03 A;  5DNF A;  4PV1 C;  4G57 A;  4DAV A;  3PUZ A;  1TQO A;  4CKE A;  1LAB A;  1BCP C;  1EY6 A;  4CJ0 B;  2IX3 A;  4HTH A;  1EOT A;  5BN4 A;  1SNM A;  1SYE A;  3IFD A;  1CQV A;  5T1I A;  4KN7 C;  3NQI A;  5F2D A;  2K5Q A;  4MIU A;  5CR3 A;  3NTH A;  3TZD A;  2Z1C A;  1NAP A;  3H94 A;  1G2T A;  1U4P A;  4N9P A;  1CHP D;  4OO1 I;  3DUZ A;  1GJX A;  1ROD A;  3ERQ A;  3RLF A;  3VA5 A;  3KLS A;  3GTP B;  1XXG A;  4CBV A;  1CI3 M;  3K5L A;  2K28 A;  1O7L A;  2F0L A;  3DMU A;  3NWT A;  1DD2 A;  1IW7 D;  4K14 A;  5IGE A;  4ILW A;  4G4K A;  1B1Z A;  3D31 A;  5I4D A;  4PNY A;  3J80 L;  2HDM A;  3I72 A;  3EJI A;  4G7O C;  1VMC A;  2F1M A;  3FEW X;  3M85 A;  4DNT B;  1TKW B;  4DK1 A;  2F0F A;  4F88 A;  3D3R A;  2Z4I A;  1LTR D;  3BYY B;  3D4R A;  3QG1 A;  4EGV A;  3W3A A;  2RA4 A;  4DXF A;  2D9U A;  4ZUI A;  1V1P A;  5IGD A;  1JR0 D;  3C3L A;  4HN7 A;  1HTL D;  2FIN B;  2F0D A;  4JK1 C;  1OXT A;  2WAC A;  2NYZ D;  5CV4 A;  2PZW A;  4QF4 A;  4XQN A;  3GTL B;  4J6H A;  3I90 A;  4HSP A;  1GHJ A;  2CW0 C;  1F9P A;  2BOS A;  3VYT A;  1BDO A;  3GP7 A;  2J7Z A;  2EOT A;  3R2T A;  2I07 B;  3L3O C;  3U9O A;  3M4Y A;  2KEE A;  3NHH A;  5C5M A;  3R93 A;  5FOB B;  1EIG A;  1H9M A;  1G6Z A;  2KHS A;  2VUM B;  2ZT9 C;  2ICI A;  1EIH A;  3HS0 C;  4DF7 A;  1A2T A;  3MC0 B;  1AW7 A;  4H44 C;  2F0N A;  2BA1 A;  2XRS D;  1KDB A;  5K5P A;  5J1Z A;  3T51 B;  2VB2 X;  2BDO A;  4M8A A;  3BZD B;  3SVM A;  2IJ0 A;  1EYA A;  4IQZ A;  3S14 B;  4O1N A;  2X6G A;  2K05 A;  1SEB D;  1SDF A;  5BN3 A;  4FF4 A;  4TRD A;  1R9T B;  4C3J B;  4K8J A;  3T4A C;  4E6I A;  5LL6 X;  1JWS D;  1SXT A;  1YNN C;  4C2M B;  1I4G A;  1FNV A;  3X3M A;  1STY A;  3S15 B;  4RAU C;  2MJ8 A;  1AZQ A;  3GTK B;  1TT2 A;  3GD7 A;  1C48 A;  2DY7 A;  3CQZ B;  3OWF A;  3NBH A;  1WD0 A;  5KIX A;  5DM7 3;  1EY7 A;  3GTQ B;  3K59 A;  2V4D A;  2PNR C;  1ENF A;  1Q90 A;  1QOH A;  2IPK D;  4OGQ C;  4ZKC B;  2C5C A;  1SE3 A;  1AZP A;  1EFI D;  4PMC A;  2RKS A;  1PTO F;  3CU7 A;  4WJW A;  1KAA A;  1ONL A;  5D3I B;  1EY8 A;  2HQE A;  5JPN C;  5CC4 A;  2O5J C;  3EFX D;  1Q1E A;  4XIG S;  3N6R A;  4CGY B;  3SR1 A;  3GO5 A;  4XDX A;  5E4X A;  1I6H B;  4EQO A;  2BE5 D;  1NCV A;  3NSW A;  5ELB A;  1JOQ A;  1KAB A;  2EVB A;  3MFY A;  1DON A;  4BY7 B;  2PCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...