5EKLA

Crystal structure of staphylococcal nuclease variant delta+phs t62d/n100e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eklA00
3E5SA 1SNPA 1KDAA 5IOCA 1SYBA 3P1HA 4KJNA 5C4ZA 4EQPA 3TP5A 1EZ8A 2F0JA 1EYAA 4EVOA 4B9WA 5M9OA 2QDBA 4K8IA 4K14A 5C5LA 5CV5A 3TP6A 3P75A 4F8MA 1U9RA 1EYDA 3OMGA 4H7BA 5CV4A 1A3UA 1TR5A 1TT2A 3MVVA 3T16A 1F2ZA 2OF1A 3NP8A 3QOLA 4NDXA 4K5VA 3NQTA 4KY5A 4S3SA 3ERQA 4ZQ3A 5IODA 3BDLA 4HMJA 4NMZA 4DGZA 1EY4A 4WRDA 5I6YA 5F2DA 4F7XA 4KD3A 5KEEA 1KDCA 5K5PA 2F0OA 1AEXA 2EYHA 3MZ5A 1SNQA 4IUNA 1SYGA 1EY0A 4RKBA 5JAVA 2EY2A 4J1MA 3MEHA 2PW7A 3NUCA 3OMCA 4K2LA 5CV6A 3RUZA 5IGDA 2F0EA 5KGUA 2F0FA 3EVQA 3SK4A 1JOOA 4KD4A 4LAAA 1SYCA 4EQNA 2EYFA 3NK9A 4PMBA 5IIFA 3LX0A 1SNCA 2SNSA 3NXWA 2KQ3A 1F2MA 3BDCA 4DU9A 2F0WA 2F0DA 3D4WA 1KAAA 3DHQA 4K8JA 1EQVA 2RDFA 4N9TA 5EGTA 3SR1A 3V2TA 4YIJA 2F0IA 3C1EA 2EY5A 1IHZA 1STHA 4HTHA 4KHVA 4I65A 2F0QA 4RKLA 5C3XA 4G57A 5JOBA 5KYIA 4N9PA 4QMGA 4K2KA 1SNOA 5HURA 5CC4A 4KY6A 1SNMA 3SK5A 2EYPA 5IGCA 5HGTA 2ENBA 1SYEA 4EQOA 2OXPA 2O4XA 1ENCA 2PYKA 4KJOA 1STAA 2WACA 3R3OA 2EYMA 5CR3A 5IGGA 4ME5A 3MHBA 2EY6A 2EYOA 3TP7A 1EY9A 3TP8A 5CV8A 5C4HA 2F0NA 2EYJA 5ISRA 2SOBA 5I9PA 1EY8A 2OEOA 5E1FA 2F0KA 4KTAA 4J6HA 4NP5A 1EY5A 2M00A 4IALA 1STBA 4MIUA 1SYDA 3TMEA 1F2YA 1NUCA 2NUCA 3H6MA 1JOKA 2F0SA 5I6WA 5IGBA 3D8GA 3T13A 1STGA 4KY7A 1EZ6A 2PZUA 3OSOA 4QB4A 4R8NA 1A3VA 3SHLA 5EKKA 4B9XA 5CV7A 2F0TA 1KABA 4WORA 1JOQA 5KYLA 5EKLA 5J1ZA 4KV6A 1A2UA 1EY7A 1ENAA 5E3FA 3NHHA 1SYFA 3D4DA 4OL7A 3HZXA 1A3TA 3OWFA 4K6DA 5C3WA 1EYCA 2F0LA 4ODGA 3QB3A 5DEHA 4NKLA 3D6CA 4IZ8A 3SK6A 2PW5A 2F0MA 3C1FA 3HEJA 2F0GA 1KDBA 2F0UA 3EJIA 4DFAA 4QF4A 5CV9A 3MXPA 1JORA 2PZWA 3EROA 5KIXA 5KRUA 5J39A 3DMUA 4E6IA 5C6AA 5IGFA 1II3A 3QOJA 3U9OA 2F3VA 2KHSA 4HMIA 4PMCA 5C5MA 2F0VA 2PZTA 3VA5A 5J22A 2RBMA 2HQEA 5I9OA 3SK8A 2SNMA 3ITPA 1A2TA 4ID6A 4K5WA 4ZUIA 5CGKA 5NUCA 3S9WA 1NSNS 1STYA 5IGEA 4PNYA 2F0PA 2PQEA 5DAUA 3SXHA 4DF7A 4K5XA 1SNDA 1RKNA 1TQOA 2EY1A 2F0HA 1STNA 4TRDA 2EXZA 2EYLA 1EY6A 2RKSA 2F3WA 3PMFA 2LKVA 4ZUJA
chains in the Genus database with same CATH superfamily
2X69A 3PO3B 1CSQA 4B9WA 1YBYA 4K14A 2IPKD 3WDNA 1U9RA 4DR4Q 3LGJA 4IPDA 3AEVA 1K3BC 3FEWX 3CPFA 2QGQA 1LTRD 4S3SA 4KKSA 1EEFD 1U4LA 1WYDA 3AB9A 3BZCA 3TZUA 2UXBL 1A0IA 4IUNA 4IPGA 3FPPA 1XWEA 4J1MA 3J80c 3N6RA 2D2CC 3AFPA 4DK0A 4CKBA 5C44H 1EU3A 1HR0W 5IP9H 4DAYA 3CCUA 1F2MA 3BVMA 5JAVA 1G2SA 1RTOA 3TDQA 2O5JC 3PIP3 4R9WA 1JR0D 1NMGA 2EYPA 1D5ZC 1PVOA 1WCMH 2R92G 4B08A 5FJ8G 2UUCL 4JV5L 1I4HA 4DV3Q 4HJ9A 5IGGA 3HOZG 4KHZA 4IFDG 1W6JA 4FP5D 3QR8A 2ZXOA 4RGOS 1Q7YC 1EOTA 1G8ZD 5M5WH 1UWVA 1VQ6A 3MXNB 2JA7H 3I55A 2B2VC 3HOWH 4DR5L 4B3SQ 3GO5A 4BWGB 4A3KB 1DZ1A 3P7JA 3OWFA 3MAQA 4OEMB 2XWBB 2QA4A 5HGQA 4IZ8A 4UPAA 3P20A 1QUQB 1XMOL 3B6YA 5I2XA 1VF7A 2ZJPA 2D0OA 3PGZA 1F2LA 3F2BA 5C5MA 3F2UA 3A5UA 4JI0L 1RIPA 2RBMA 2HHHQ 5M5WB 2B2YA 4IUTA 2NVQH 4ZYSA 2NZ1D 1VQNA 1BVSA 1PH2A 5LMNW 2Q2TA 3M4QA 2Y0SB 4LWCA 1S5ED 3Q23A 4J8QA 5IP9G 1AZQA 3VA7A 1S4ZA 4OX9Q 4CJ2C 4A3LG 4UAIA 3T1YQ 4JBMA 1U4PA 1BBUA 2QDBA 4OO1H 5CV5A 2AMCB 1KIXA 1EWCA 3NTKA 4HJ7A 2B63B 2CW0C 1VQ7A 1HTPA 1TIID 2NB0A 2QW7A 1KRTA 1O80A 5JJIA 3J81i 2JK8A 2Q2UA 3S2DH 2A6HC 4L5QA 1HUNA 4KHPQ 1YHQA 5FJ8H 4RKBA 1HZCA 2IY5B 2EY2A 1ICWA 3HOZH 3U4VA 1XPOA 3ND8A 3RUZA 2EJFC 2PNRC 4O1NA 4RHSA 4G4KA 4IFDJ 1H9KA 1GO3E 2NVXB 2AQ1B 3A8IE 1CT1D 5C44B 3HFZB 4TKOB 5I2YA 1CA6A 3I72A 1K8MA 1JWSD 2AHOB 1O78A 2BE5D 4UHVA 4XTCS 2F0DA 2LXJA 1KXLA 3S1QB 2RSOA 1DONA 1IHZA 5JJLA 1QG7A 3VDYA 4RH6A 1BCPF 3HS0C 3IL8A 1I4RA 3SK5A 1XJVA 2ENBA 3CC4A 3I4MH 4NXMQ 3I90A 1FGBD 5C4XH 5I9PA 1NR2A 3CP0A 1XNRL 2B3GA 4LFBQ 2MGSA 4DV6Q 1EY5A 1ZEQX 4IALA 1SYDA 1YNJC 3RLNA 4JI1Q 3PO2H 1EZ6A 1CFMA 1GXDC 5IE8A 1JB3A 1Y1VH 2B2UC 5GAEC 3SGIA 4DV4Q 4DUYL 1NBWA 4QGUA 3A0JA 1Q86C 1A8VA 2BOSA 1DOKA 4OO1G 3W5OA 5E4XA 3H3VC 1D8LA 5CV9A 1MI2A 1PFNA 1M4VA 2EXDA 5J39A 1BCPD 1Y1WG 4BY1B 3KLWA 2Z0SA 1K73C 3PV0A 3KOJA 2IL8A 3UDIA 1NSNS 5BN5A 4A3EG 2JA8B 4DF7A 4DK6C 1F77A 3BZKA 4DNIA 4C3JB 2B63G 2R7FA 4AIMA 3AYHB 3MXNA 4RHRA 4XIGS 4O2DA 5EPLA 1LT6D 4EQPA 2AQ3B 3FDTA 4YHHL 2X6LA 3HKSA 1UE1A 4C3JH 2ES2A 4JPBW 4A3BG 3E3XA 3LWUA 1Y8NB 2UXBQ 4DR7Q 1W6KA 2ICEC 4P2CB 4X3UA 2E2DC 4DUZQ 3PO2B 4KD3A 1B9MA 4IJHA 1X3QA 1T9HA 3MEHA 3NUCA 3DEPA 3CQZH 2KECA 5C3EG 3H3VI 2Y0SE 1FR3A 3D31A 5M3FH 1EUJA 4G7ZC 1SE3A 2CFMA 4P75A 2SNSA 3S17B 2KQ3A 3CHBD 5LMNQ 1QVGA 1M90C 2E2IH 3BYYB 3K5LA 3V2TA 2Z8LA 3QWNA 2F0IA 2WKCA 1VCIA 1SFOH 1PTOB 2NN6H 3SE0A 2VQEQ 1BQQT 4X65L 2PYKA 3DM3A 1QZGA 2KCMA 3R3OA 3JAML 5CR3A 2HUGA 3KYHC 2B2UA 1S5CD 3FP9A 1IBKQ 3A7LA 3J80L 4YCUA 1SSOA 4H02A 3PF5A 2ZM6Q 4YCWA 2RDGA 1E2VA 1TS5A 2XTIA 2LFNA 4A3JG 1KLUD 1HR0L 5BR8Q 4QB4A 3SHLA 4C3IB 3K7AH 2B63H 2M9VA 5KYLA 1SR3A 3LNNA 1S72A 3DLLA 2NVXH 1A3TA 3J7ZC 1K9MC 4L5RC 3ULLA 1NY4A 3BVGA 4A3BH 4LFCL 4N8X1 4IUUA 2KHSA 4L8JA 2E2JB 3K5NA 3S14B 1LT4D 3PO3G 1NCVA 2HQEA 4LF6Q 1PRTD 4ID6A 5IYDG 5M5XB 4OIJA 3RD4A 4NW2A 4BY7B 1XMQQ 5C3EH 4OO1I 1R9TH 1WI5A 3R8BA 1KD1C 3NEMA 4A3FH 3BG3A 4XQJA 1PH1A 2MHVA 3E5SA 2NVYB 4QUCA 3T53B 4GS3A 1Q8IA 2F0JA 1EYAA 1WTQA 1B4OA 1UAPA 2KCTA 2NVQB 1WTOA 3OMGA 1ICFB 2JA7B 1Y69U 5AFWA 4DR6L 4GOPB 1EY4A 2EJMA 5G3LF 4DA2A 2CHBD 1KQSA 1QJOA 1QOHA 3CRLC 4OELB 2KOLA 5DNFA 4ZKCB 4HR7B 3AFQA 1I4XA 2DUDA 2F0FA 5D3IB 2O2LD 2EYFA 1NNXA 3CU7A 3S1RB 4HIDA 1D6EC 4IUQA 1PYBA 4JI6L 1WTXA 2F4IA 2PI2A 3D0FA 4JI7Q 4APVA 3RZOH 4G57A 2LXKA 5KYIA 4ZAIA 2B8FA 2DY8A 4RCOA 4RFBA 2L9HA 2F03A 1V8QA 4C3IG 1SAPA 1PH6A 5E1FA 4NP5A 3TS0A 2R92B 2XSCA 3S1MB 1I4PA 1MD2D 5CBEE 3I3CA 4IPCA 4CHTB 1A62A 1NJIC 1O7ZA 5EKKA 4CDDC 1L0WA 3M4OH 1JE4A 4YY3Q 1PH8A 4X62Q 3C46A 5ELDA 1RODA 3I4MB 1VQMA 1PDQA 5FO8B 2ZJQA 3D4DA 4LW1A 1BXTA 4GLAC 5DLQE 1N36L 1WD0A 3K0YA 5C4JB 1YNND 3OWEB 1PH4A 1VQKA 4FF2A 1N9WA 4ZUIA 1I6VC 1STYA 3SXHA 2XVSA 5FLXE 3OHXC 4IURA 4NXML 1EIFA 4JI4Q 4JI0Q 5JPNC 2RKSA 1Y1VG 1SNPA 5IOCA 1X3EA 5JEAH 2ICIA 1R4PB 1ASZA 1Q8KA 4WFN3 4DKAC 3HOUB 4IJLA 3AMUA 3K58A 4FXKC 3R2IA 1A3UA 4QCLA 3L9AX 4H0LC 2EE1A 1HNXQ 4PV1C 2RCFA 2JEBI 1STEA 3HRZC 1Y1WH 3S17H 2JSOA 3BU2A 5C44G 1VQ9A 1AEXA 2EYHA 3MZ5A 2V1CC 1GJXA 2PW7A 2QF7A 2HCIA 4G7OC 1SYCA 2JA8G 1B44D 3HOYH 1TVXA 1TXYA 1J5EL 3K80C 1LO5D 4NB3A 4C3JG 4G7HC 2K5VA 4RA8A 3DHQA 4N9TA 3IAYA 3BVZA 3WOFA 1JJCB 1Y8OB 4WJWA 3C1EA 3H0GB 1V1PA 2G9HD 4NXNL 5JOBA 4EGVA 1CSPA 1W3SA 1SNMA 5IGCA 1GD7A 3CCJA 2K5QA 1PH9A 2JJQA 2I5MX 1ENCA 2FMCA 2WACA 4GNXA 1VQHA 3GTJB 1MHWC 2AWNA 1L0YB 3RMHA 3C3LA 1LM0A 1S5FD 2KEEA 5LMUL 4OGQC 4OONA 1UUPA 2PNHA 5I6WA 3T13A 4B9XA 5EBDA 1HQRD 1PYSB 2VZAA 3KFUA 2K33A 5JVH3 2I5LX 4Z9CB 1MSHA 4ABNA 1BCPB 3M3YH 1B7YB 2J4XA 2FFKB 3TBIB 5IT9c 3DXJC 4BXXG 4I7AA 4MTKA 1ZXTA 4QL5A 2E74C 1V1OA 1E22A 4H13C 4A4IA 5LMNL 3JAMc 3GTMH 1IW7D 2KVMA 4LK1C 4EQ5A 2WP8J 5C0XG 5E4WC 5E7NA 4Y52H 1IBLL 4AQYL 4HMIA 2L5TA 1OXSC 1SE4A 4DR1Q 2Z6KA 4JI2L 1A2TA 2KCCA 1VQFA 4M1UB 2N49A 2PQAB 2F3WA 3ZYYX 2LKVA 2VY3A 5JPMC 3HOYG 2NBFA 2GVAA 1Q1EA 4A93G 4EVOA 4BA2I 1BCPC 1ENFA 1Y8PB 4JC0A 4Y7NB 2EOTA 4X66Q 1H9JA 1F2ZA 4ZQ3A 4P72A 5IODA 5LMUQ 4WRDA 1K0SA 4F7XA 3PO3H 3I8ZA 4B3RQ 4BBRB 1PTOC 4JOIA 5IYDH 1JICA 2MO1A 1RF2D 3Q0AA 3TS2A 3OMCA 4O0AA 5CV6A 3M4OB 2L15A 2F0EA 1JJGA 5KGUA 1SFOB 2C5CA 3SK4A 2TMPA 4F88A 4DV2L 3GTLB 1KNAA 2H1EA 2VQFL 1I3QB 2Y0SG 3UI2A 1QUQA 5FO9B 4JVZA 5FLXL 1JMCA 4FO2A 5C3XA 1A15A 4CDCC 5C4XG 1AN8A 3D6WA 3CKIB 1IYVA 1JT8A 4C1NI 4POGA 2UUBQ 3S24A 3S1NB 4GKJL 1S3OA 1TS2A 3DM1A 3A55A 5C0XH 1Q3LA 3S15H 1F9QA 1RL2A 5GAGC 1H9MA 3NBIA 5A2QE 1LTGD 2M00A 1NTGA 4C3HG 1XPRA 1F2YA 4X3SA 3OW2A 2YU9B 1VMCA 4B3TQ 1LTID 1STGA 1JB7A 1N33L 2HQLA 1CKNB 3TEHB 1N32L 3W3AA 1JCKB 1JE5A 4DV0L 1GUSA 3H0GH 1TWAB 3GQBA 4JYAQ 4DAYB 4A3CG 5M5YH 3KF8A 2ASBA 3RNUA 4DR3L 4NKLA 4RG1A 2L11A 3V96A 1WTVA 2F0GA 3DWAA 1T5EA 2F0UA 1FGUA 3EJIA 1AW7A 1ZYRC 4E6IA 5GQOA 1GUOA 2PI2E 3PF4A 4BY7H 4TQUS 4LFCQ 2SDFA 1YNJD 1HZ9A 4LF5L 3CCVA 4BBSG 1BDOA 4JBWA 3A7AB 2RCNA 2PO4A 4XQNA 2PPBC 4OX9L 3MXGA 5JEAJ 3T1YL 1UE6A 4PZ8A 1MGSA 4ZUJA 5C4ZA 1H9RA 4DV3L 4XT3B 1X3PA 3QIAA 4DXGA 1TWGB 4XYQA 1X3GA 1LTBD 1SMXA 4KHPL 3I4LA 1TR5A 4L6TB 3T16A 3NE5B 3NP8A 1X55A 1TS3A 2NYZD 4HMJA 2XGTA 5M3FG 5KEEA 3K59A 4DR4L 5K5PA 4XDXA 3CAMA 1U5KA 4PG3A 2JEAI 3GTOB 3EN2A 3E0EA 1QB5D 4DR5Q 4H44C 1JOOA 3S1QH 4HJ5A 4FVMA 4V0BA 4NXNQ 2XNAC 3VR3A 2KUMA 1HTLD 5EGTA 2RDFA 3Q8DA 1BOSA 2A69D 2QCPX 2PCFB 3TQYA 3PIO3 4RKLA 2B2VA 3TREA 1XX8A 2H4OA 3GTKB 4K6LA 1AZPA 4IUVA 2YTYA 1JWMD 4YWMA 4CJ1B 3NELA 2IX1A 1Q82C 1LYLA 4HSVA 3CMEA 4ME5A 3MHBA 2D5DA 1QILA 1VMPA 2ALYB 5C4HA 2WKDA 3T56B 1HA6A 4J15A 4ILWA 1C9OA 4R1JA 3G6EA 4BY7G 2MNAA 4X3KA 2VB3X 4TVAB 1SJED 2PMZB 3PIOA 2R61A 5J3BA 4IPHA 5JJKA 1X65A 1CZGA 2GA4B 5ELOA 1SMYC 4R4QA 1TWCB 3K6OA 2N55A 3CMAA 2AUKA 1IYJB 4L63B 2OT2A 3HZXA 4CBVA 2EPBA 5BN4A 4KI0A 4WJ4A 1ZKOA 3PUVA 1CZWA 1A63A 3HEJA 3ONAB 2FMMA 4HCSA 3EROA 2K14A 1X54A 1WD1A 2BDOA 1DGSA 1CQVA 3VA5A 4IOCA 4FF3A 3CXCA 1SDFA 4FYDA 1LV9A 5IYCH 5IT9E 1RKNA 2RSNA 2B2YC 1DOMA 4C2MH 1UE7A 3GTPH 1HZAA 4A3MG 1JC7A 1GUGA 1TWCH 1GHKA 3H09A 2R93G 1EYGA 5FOBB 2G5DA 5IWAQ 4LF7L 3UDGA 2L1BA 1JJ2A 1YJNA 4POFA 4LFBL 3QJYA 1VQ4A 4JI8L 3NQTA 4IQZA 3ERQA 1ET9A 3ULPA 1X56A 3KJOA 3BYTB 1E1OA 5ELFA 2QEXA 1WJJA 2NTSA 2H5XA 5IGDA 4K2LA 3S14H 3CRKC 2A6HD 2E75C 1FYCA 1Q90A 4IOAA 3NK9A 2DNEA 5IIFA 3NTIA 2VUMH 2R7ZH 3KBGA 5ELCA 2OWOA 4U673 2F0WA 1PRTF 1I94Q 5EAYA 1VQPA 1DYQA 1SRUA 2RVLA 2I07B 5FKAC 2EY5A 2OTJA 1MBYA 1B3QA 4C3IH 4GOPC 4ME3A 5HGTA 3S2HH 1PZID 4KJOA 4A3GH 3IFTA 4JG2A 1H9SB 1EIYB 2EYMA 3J7AF 5K36H 5T1IA 4BY1G 2IHEA 1EY9A 3EBEA 3H15A 4LF8L 5CV8A 5HY6A 3NPPA 1DXMA 1RCVD 3MFGA 1LABA 1BBXC 1IKMA 2XWJB 3J80E 2VS1A 3D8GA 4B3RL 3S2DB 3VR4A 1Q12A 1TWGH 2PZUA 4KY7A 2K52A 3U50C 2R6GA 2L4NA 2C35B 4GOPA 1EEID 1KABA 3J81c 1G291 4DUZL 5J1ZA 3T4AC 3FHWA 2QILA 3M7GA 2O5IC 1SYFA 2UU9L 1WTPA 2TSSA 4L5TA 4ODGA 4XXEA 3QB3A 2A68D 2F0MA 4EX5A 1K83H 1KDBA 1PMRA 4KLKA 3N52A 4QF4A 5GADC 1HH2P 5IGFA 3HKZB 2JA6H 2BH2A 5AJ3Q 3L2PA 3ITPA 4DV1L 2K28A 1Z9FA 2IT1A 1RTNA 4A3LH 1SNDA 3JAME 4DV7Q 4OWXB 4JI2Q 1EY6A 2EJGC 3H0GG 2RA4A 3DWQA 3TP5A 4A75A 4KMUC 1ML0D 2WAQE 2A5HA 3I7FA 1IBMQ 4A3DG 1BNZA 1Z7TA 3HKZE 1FNVA 5T1GA 1GHJA 2R3ZA 2ZTCA 2ZM6L 1CTMA 1N33Q 2OF1A 1L2FA 3I91A 3HOYB 3G48A 5H1SE 1HCZA 2JA8H 4A3GG 2WAQG 3STBD 4X66L 1UE5A 3IRBA 1A6XA 3JC66 3CC2A 4BY1H 3E6ZX 2IWHA 1U0LA 3PQIA 2CWPA 1XMOQ 5CORA 2I0QA 4PMBA 2ZTDA 3I73A 1ET6A 2DY7A 1V43A 2KEDA 3CW2C 2GN5A 4LF5Q 4GLXA 1Y1VB 1IL2A 4GZYC 1STHA 3PUXA 2E2JH 1O7LA 1UEAB 2ZXPA 3WWVA 1B2TA 2G9DA 4QMGA 4K2KA 4P74A 4KY6A 5LL6X 2F4VQ 2CQAA 4RCNA 5ELEA 2N78A 4CKCA 3HOUH 4JI5Q 1PFMA 1YNNC 3TP7A 1S40A 1F9SA 3PO2G 4BBRH 4KKTA 2EYJA 2WINB 4KTAA 2CH4A 5C4XB 3K7AB 4MIUA 4MZ9A 2F0SA 4Y7NH 1KAWA 2KBNA 5TSSA 4RGMA 2WV6D 5EKLA 4KV6A 1M8AA 1E24A 1HZBA 4B3TL 3J81j 2A19A 1HUMA 1HJPA 3G4SA 1RHPA 1B70B 3RLFA 4A3EB 2PW5A 4PQXA 5DM73 1C8CA 2AUJD 2CW0D 4FF4A 3FRPB 4A76A 2OQ0A 1SJHD 4DAMA 1KHIA 2F3VA 4JI4L 3HOZB 3S16H 1K8AC 2OCEA 1EU4A 1YNXA 5IGEA 1TS4A 1PZKD 1PH3A 2JP1A 1VQLA 2JA5B 2F4VL 3M3YB 1JQYD 4LF7Q 1BKBA 2ZJRA 2XIWA 2A74C 3RZOB 3X3NA 1WTRA 3TP6A 3UE1A 2JE6I 1NAPA 1EYDA 4AYBB 2KHIA 3W2DA 1SE8A 3GTPB 3H94A 2FINB 3BZDB 1SNQA 3HOUG 4ZCKA 4DUYQ 2F52A 3PUWA 4RWSC 3T1HL 1VQAA 2SEBD 2VXWA 3KF8B 1OXXK 3M9BA 1AFPA 4A3MH 3W1BA 2WAQB 4CJ0B 2NN6G 1AH9A 4AYBE 2Z6KC 5CMDA 1KAAA 2Q2IA 4YIJA 4KHVA 2WIIB 5FK9C 1NMFA 1K8OA 4OWTB 3F8TA 3OW7A 4YWLA 3U9SA 3DEOA 4B3MQ 1N34Q 4LFAL 3FKIB 1FVIA 4I7ZC 1XYIA 4A3JB 3FVQA 3BS1A 3KLSX 5A2QL 1KTKA 1SEBD 1MKHA 1PYWD 3EFXD 1X32A 4LUZA 3I2ZA 2F3IA 4MN3A 1PTOF 3HGBA 4L5SA 3PUYA 1EFID 4F87A 1RDPD 2R7ZG 3UDFA 3BDOA 3I4OA 2B2WA 3RLOA 1NR4A 5M5XH 4IFDH 3OSOA 1E3PA 4OHJA 2Q8IB 1IYUA 4A3DB 2A1AA 4WORA 4FDBA 5D65A 1VQCA 3U58A 4GN4B 5E3FA 3NHHA 1PV4A 1K28A 4OL7A 4K6DA 2YYZA 4DAVA 4UY8C 2WFWA 5DEHA 3RZDB 5K36G 5LL6S 2YV5A 5GROA 3ULJA 3HOWG 4CDEC 1IL8A 2MUYA 4V190 1JORA 1EWIA 2ZXRA 1AE2A 3U9OA 1HNZQ 4YWKA 2F0VA 5C4JH 3S2HB 1SN8A 1MJEA 4K5WA 1SLJA 5ELNA 1MJCA 3MTSA 1DM0B 4C3HB 1LTLA 1EY7A 2EYLA 1IBKL 1SMYD 1KDAA 3KDFA 5CYUA 2VUMB 5M9OA 1TY0A 3MWYW 5EPKA 1CK1A 1WTHA 4F8MA 1B53A 2E2IB 3CCEA 1GVPA 2JA5G 2CQOA 2CKZB 4NMZA 4JI1L 4GKKL 1RJTA 1LLRD 1D5XC 1SYGA 3HKZG 5L37A 1HNXL 1E1TA 2IHFA 2K04A 1QCBD 3JAMi 4EQNA 2Z6BA 1KRSA 3NENA 4WJ3M 1XTCD 2IW3A 4A3DH 4LF9L 2KHJA 3K81C 3FKIH 3SR1A 4DV1Q 1IW7C 2NTTA 4XQQA 4CGYB 4I65A 2F0QA 2MJ8A 3PSIA 1TWHB 4P73A 1G51A 5HURA 1VQ8A 2B8GA 2A68C 4IUPA 1SYEA 2OXPA 1STAA 1FJGQ 1GUNA 1BBWA 3TP8A 2UXCL 5ISRA 2MPMA 2QDLA 4C2MB 3I4MG 1B1ZA 1E7ZA 4FXGC 2KENA 1D7QA 2YTXA 5LHY1 4DR6Q 3D4RA 4R8NA 1E0BA 4A93B 2F0TA 1DJRD 4DXFA 3I56A 3KUPA 3UE0A 3W1GA 1LTAD 4A3FB 1Y1WB 2JXMB 4PZ7A 4LUOA 1B9NA 3SK6A 1D1IA 3KDFB 2XRSD 1CI3M 4BBRG 2JA5H 5IYCG 1XXGA 4DNRB 1II3A 1O7YA 4XYOA 4JI7L 2QKIC 2NVTB 4JI3L 3URYA 4DNTB 5CGKA 2F0PA 1CQFA 1BR9A 2PQEA 3VR6A 4K5XA 3MFYA 2UUCQ 4JV5Q 3MC0B 4A3BB 2R93H 1PRTC 4HIMA 2LS01 1EOVA 4DR1L 4FXDA 4IN3A 3STBC 1PLFA 4A3EH 1SE2A 5EKIA 4R8IA 2N8NA 1H9SA 3M7NA 4GNXB 2CWAA 3KLSA 3FKIG 1PHJA 2UXCQ 2M2LA 5M3MB 3I4NH 3SDZA 1MIUA 2HDMA 4DGZA 3PIPA 3E0JA 1BO0A 1HA5A 5F2DA 2JN4A 2OQKA 4X62L 1KDCA 2VUMG 1VQBA 2Z4HA 5G3LD 1EQRA 1N36Q 4DV0Q 1EQQA 1N8RC 1LT3D 3HG9A 4KD4A 4LAAA 3S1MH 1GKHA 4JYAL 1PRTB 5CBAE 4HEDA 3SEBA 1P16A 4K8JA 2Z9HA 4JCVE 2E76C 1H95A 4GNXC 3RN2A 4X64Q 1PFBA 1Q81C 1KLGD 1V1QA 1SNOA 4JI3Q 1Z6HA 2MFIA 2HCCA 4QQBX 5ELBA 3M4YA 2IJ0A 3NQIA 2K75A 3CF5A 4KK7A 3CQZB 3L3OC 1BUVT 3BJUA 2EY6A 2NWGA 5FLMG 2F0NA 2PQAA 5A35A 4GKJQ 2OEOA 2F0KA 1L1OC 2XN9C 5EPJA 2MQHA 3T51B 1VQIA 5M5YB 1NUCA 2NUCA 4GN5A 3IKJA 1L0XB 3K8AA 3CCRA 1EFWA 5GAHC 4BXXH 2FXQA 4LF4L 1J9OA 1ESRA 4MTNA 2D62A 4A3KH 3T1HQ 4A3JH 1SROA 1ENAA 5I4DA 1QE6A 3MA2B 2JA6G 1N32Q 2F0LA 1J5EQ 1LACA 1GUWA 3Q6SA 3C2PA 3L7ZC 1MSGA 4LMQD 3J80i 4B3SL 3ERSX 4DN4M 4K0KL 1YJ9A 2OTLA 3I4NG 5C6AA 4DK3C 4DR3Q 4R4TA 1FD7D 2L12A 3RN5A 2B2WC 4A3MB 4HN7A 2JYOA 4KKUA 4PNYA 3TSSA 4M8AA 2MO0A 3WOEA 3GTQH 2HHHL 1STNA 1Y14B 2EXZA 3GV6A 4ZK9B 1ILQA 2E5LL 3S15B 2K32A 1E2ZA 2LSSA 3VYRA 3F2CA 1XNRQ 1HHVA 1J6QA 4JI8Q 3OYYA 2K05A 1YZ6A 4K8IA 1OO9B 3KLRA 2RHQB 1B8AA 2WB1B 1GUTA 3M4PA 3TN2A 1TT2A 1YHBA 3K5OA 4TRDA 1CUKA 3G71A 4OXPA 1F9PA 1QNUA 2E2HB 5I6YA 1CM9A 1XPUA 2IX0A 3OTOQ 1SXTA 4JW0A 3OOCA 1Q46A 4DV5Q 1PZJD 4LF4Q 3VR5A 1CKNA 4YY3L 3EA6A 1DCZA 1I3QH 2L0CA 4GN3B 3VYUA 2HT1A 3J7A5 3GTLH 4BBSB 2B2TA 5JVG3 2NZOA 1L1OA 1SNCA 3NXWA 1LTTD 2WB1E 3R93A 2E8GA 3BDCA 4KN7C 4AQYQ 4ZRZA 2FHTA 2IX3A 3OPOA 4PZ6A 2Z1CA 4LUVA 4K0KQ 4X65Q 4UDUC 4KN4C 3CD6A 3Q24A 1QZHA 1HNWL 3HOVG 2KJXA 2WB1G 4UP9A 4HJ8A 4X6AH 2BH8A 3TRZA 1K3RA 1TKWB 2BA1A 3NBHA 4C3HH 4B3ML 4HSPA 4HIKA 4Q0FA 1HR0Q 3GTMB 4A3GB 4P71A 1WCMG 2R92H 4DR7L 3SVMA 3H3VH 3KF6A 2Z4IA 1U4RA 4TSSA 2CVRA 2K7VA 4RAUC 3AU7A 4A3CH 3R2TA 2UU9Q 1ESFA 2R93B 1HFNA 2LMCB 1EIGA 3FPUB 4GLVB 2HDLA 1DD2A 1A2UA 2R7ZB 2DJFC 2BCOA 4DV5L 2J7ZA 1EYCA 5EBCA 2K6AA 1PXUA 3FMCA 3O13A 4DFAA 1OXTA 4LF6L 3NSWA 1V1PB 2F1MA 2VL6A 2PZWA 5KIXA 2I46A 4XT1B 1K0RA 1I94L 1F9RA 3SK8A 2Q8TA 4BA1I 2A6EC 5NUCA 1VQOA 2HIXA 2K03A 2ID0A 1IBML 2EY1A 2P5ZX 3X3MA 2I5HA 1QWYA 1SYBA 3P1HA 5KNDA 1EZ8A 1IZ6A 3J81E 3K5MA 1PH5A 4JK1C 5JJZA 5KNCA 4A3IG 1D1KA 3PCOB 3H91A 3MVVA 3QOLA 4QJFA 5JEAG 3HOVH 1EWHA 1GOZA 1I50B 2HD3A 3CCQA 2NVYH 1VQDA 1HQMC 2B29A 3GTGH 1EY0A 2UXDQ 1WOCA 4DAPA 3QG1A 3PUZA 4HCEA 3EVQA 4GKKQ 3CC7A 3NWTA 1FNUA 3VYTA 4OIKA 2LY7A 1PA6A 4JI6Q 1FNWA 2UUAQ 3U4ZA 1C48A 1LTSD 2YTVA 3RR5A 2A69C 1KNEA 3D4WA 3TZDA 3IFDA 2VW9A 1D2BA 2RDHA 4HTHA 4YCVA 5AJ3L 4JI5L 1XMQL 5D14A 2K5DA 2L55A 5CC4A 1CHPD 1ILPA 1VF5C 1GM5A 1JWUD 2O4XA 1YJWA 3K57A 2ATWA 4AH6A 1NE3A 5IP7G 4DV7L 2NN6I 1XNQQ 3KK7A 3OIPA 1EY8A 1T5XD 3A5ZB 5DM63 1FJGL 4J6HA 1C7YA 3GDEA 1W2BA 3TMEA 1VQ5A 2B2TC 4X3TA 2NZHA 4HIOA 1HXYD 1JOKA 4OWWB 2V4DA 5BN3A 5C0XI 5C0XJ 3DWPA 5BR8L 4NPSA 4CKEA 5C3WA 1DOLA 2DGYA 2XRQD 3ER0A 2R7DA 1G6PA 2K5HA 5IY0A 4DV2Q 4A3IH 3MXPA 2EZVA 3EIVA 3DMUA 5IT9L 3QOJA 2N88A 2K50A 3UDXA 3G7LA 1LT5D 5J22A 3VYSA 1CKMA 3S9WA 1WVLA 4DR2L 3HP3A 2E5LQ 1I6HB 3KF6B 1S5DD 5DAUA 2K5WA 1D5MC 2A6ED 1TQOA 1YEZA 1G91A 1PTOD 5IYBG 3PMFA 3V05A 4KJNA 2NVTH 3NTHA 1UEBA 4JBJA 3M85A 1TWAH 5CV4A 4H7BA 1PH7A 3NWSA 1I50H 3GTQB 4KY5A 4A93H 3BDLA 3F1ZA 1Q1BA 2K4KA 3HOWB 1IXRA 1OXVA 1M1KC 3HOXB 3QO2A 3MXUA 1OTCA 4MNOA 1E2WA 3S1RH 4AYBG 1WTWA 4JBKA 5M3MG 1X3FA 1YHAA 4O42A 5COYA 2A73B 1QVCA 4JOIC 3CCMA 1HPCA 2KA7A 1EIHA 3J7YW 4ULLA 4DU9A 1EL0A 1N34L 1ONLA 3HOXH 3A8JE 1EQVA 2Q8RE 1VS0A 1R9TB 2YU9H 2Q2HA 2AKWB 4N9PA 3ICEA 3E9HA 2ZTEA 3A56A 4X64L 4RGTA 4N8FA 5FLXc 1QVFA 5KNBA 2K5NA 1I6HH 1O7IA 1LUZA 1G6ZA 1HFGA 1U4MA 2SOBA 3ZJYC 1X9NA 2CH4W 3S1NH 4HAEA 4RGNA 1STBA 5C3EB 3J81L 4FF1A 2JA6B 3OIQA 3GD7A 3K0XA 1KL9A 3GV3A 1CHQD 2JQOA 1A3VA 1K8GA 1KC8C 1AP0A 1I4QA 5IYBH 3EQLC 3G6JB 4A3IB 1I5FA 3L0OA 2B39A 3GTKH 3I70A 3F2DA 1Z47A 3K7UC 2CCZA 3Q22A 1EQTA 4C1NK 2ZT9C 2RF4A 1FL0A 2D0PA 2FJ2A 5D3DA 1J8IA 1ZYRD 3DUZA 4PMCA 4QY7A 4ZLTF 5FO7B 2HIVA 3VR2A 4CDFC 2SNMA 1C0AA 1B3AA 2EVBA 1PTOH 2RHSB 3GTOH 4LFAQ 5M3MH 3I4NB 1TWFH 4LF8Q 1S5BD 1QNKA 4BBSH 1P8LA 3AQQA 2D9UA 3MEFA 4LNQA 1C4QA 3CPWA 3A74A 3RZDH 1IKLA 1VQGA 3HOXG 1ASYA 2K1BA 5C5LA 4IFDI 1B50A 2J0TD 2EQSA 3P75A 4A3FG 2E2HH 4PMWA 4NDXA 4K5VA 2PMZE 3NBHB 4HJAA 1V9PA 2F0OA 4UP8A 1BF4A 4U68A 2UUAL 2DNCA 2EDGA 2VQFQ 2QEJC 1I4GA 3CCLA 3E9IA 2DN8A 3OTOL 3GTJH 4DV4L 3LX0A 3HOVB 5M3FB 3A54A 4BS9A 1IBLQ 4C56C 4R4IA 2VB2X 3GTGB 2VQEL 4DPGA 2RQXA 2UUBL 2BE5C 2BDNA 2EIFA 4QIWB 2KCNA 4DK1A 1HNZL 1SBBB 1WFQA 5FLMH 4FNFA 4RMFA 1OXUA 3KJPA 1XNQL 4ZKBB 4EQOA 4Q5VA 1UNSA 2AWOA 4MHEA 1HNWQ 2EYOA 1YVCA 3J7AV 1TY2A 4YHHQ 1R4QB 1CKOA 2GVBA 5EJWA 1HRJA 4A3KG 4QIWE 1AE3A 4R4OA 5IWAL 3H6MA 1CA5A 4R4CA 5IGBA 2MP1A 2X6GA 3A8KE 4IO9A 2UXDL 1TU2B 4DV6L 5CV7A 1TWHH 2AQ2B 1JOQA 1WCMB 2BA0A 1XTDA 4ALPA 2C9OA 2A8VA 2JA9A 3ND9A 3D6CA 4LJZC 2VNUD 3C1FA 1YI2A 5IP7H 3LWEA 1PFSA 1X6OA 5KRUA 1RD9D 4DR2Q 1G2TA 1K83B 2K01A 3CCSA 1L1OB 1VDZA 3GP7A 2PZTA 4LF9Q 3KBXA 2N3SA 5I9OA 1VQJA 1TWFB 3S16B 1VQEA 3D3RA 4QUFA 5EQ0A 2F0HA 1YIJA 4UP7A 1YITA 2JA7G 2DJGC
chains in the Genus database with same CATH topology
2X69A 3PO3B 4B9WA 4K14A 2IPKD 3WDNA 1U9RA 3FEWX 1LTRD 4S3SA 4KKSA 1EEFD 1U4LA 3TZUA 3AB9A 4IUNA 3FPPA 1XWEA 4J1MA 3N6RA 2D2CC 4DK0A 4CKBA 1EU3A 4DAYA 1F2MA 3BVMA 5JAVA 1G2SA 1RTOA 3TDQA 2O5JC 3PIP3 4R9WA 1JR0D 2EYPA 1D5ZC 4B08A 1I4HA 5IGGA 4KHZA 4IFDG 1W6JA 4FP5D 2ZXOA 4RGOS 1EOTA 1G8ZD 2B2VC 3GO5A 4BWGB 4A3KB 1DZ1A 3P7JA 3OWFA 3MAQA 2XWBB 4IZ8A 3P20A 5I2XA 1VF7A 1F2LA 5C5MA 3F2UA 2RBMA 5M5WB 2B2YA 4IUTA 4ZYSA 2NZ1D 2Y0SB 1S5ED 3Q23A 4J8QA 1AZQA 3VA7A 1S4ZA 4CJ2C 4UAIA 1U4PA 2QDBA 4OO1H 5CV5A 1EWCA 3NTKA 2B63B 2CW0C 1HTPA 1TIID 2NB0A 1O80A 2A6HC 1HUNA 4RKBA 2EY2A 1ICWA 3ND8A 3RUZA 2EJFC 2PNRC 4O1NA 4RHSA 4G4KA 4IFDJ 1H9KA 2NVXB 2AQ1B 3A8IE 1CT1D 5C44B 4TKOB 5I2YA 1CA6A 3I72A 1K8MA 1JWSD 4XTCS 1O78A 2BE5D 2F0DA 3S1QB 2RSOA 1DONA 1IHZA 1QG7A 4RH6A 1BCPF 3HS0C 3IL8A 1I4RA 3SK5A 2ENBA 3I90A 1FGBD 5I9PA 1NR2A 2MGSA 1EY5A 1ZEQX 4IALA 1SYDA 1YNJC 1EZ6A 1CFMA 1GXDC 1JB3A 2B2UC 2BOSA 1DOKA 4OO1G 3H3VC 5E4XA 5CV9A 1MI2A 1PFNA 1M4VA 5J39A 1BCPD 4BY1B 3PV0A 2IL8A 2JA8B 1NSNS 5BN5A 4DF7A 1F77A 4C3JB 3MXNA 4RHRA 4XIGS 5EPLA 4EQPA 1LT6D 2AQ3B 3FDTA 2X6LA 3LWUA 1Y8NB 1W6KA 2ICEC 4P2CB 4X3UA 2E2DC 3PO2B 4KD3A 1B9MA 1X3QA 3MEHA 3NUCA 3DEPA 2KECA 1FR3A 3D31A 4G7ZC 1SE3A 2SNSA 3S17B 2KQ3A 3CHBD 3BYYB 3K5LA 3V2TA 2Z8LA 3QWNA 2F0IA 2WKCA 1VCIA 1PTOB 2NN6H 3SE0A 1BQQT 2PYKA 3R3OA 3JAML 5CR3A 2HUGA 2B2UA 1S5CD 3A7LA 3J80L 1SSOA 2RDGA 1E2VA 1TS5A 2LFNA 1KLUD 4QB4A 3SHLA 4C3IB 2M9VA 5KYLA 3LNNA 1A3TA 3BVGA 4IUUA 2KHSA 4L8JA 2E2JB 3K5NA 3S14B 1LT4D 1NCVA 2HQEA 1PRTD 4ID6A 5M5XB 4OIJA 3RD4A 4NW2A 4BY7B 4OO1I 3R8BA 3BG3A 4XQJA 2MHVA 3E5SA 2NVYB 4QUCA 3T53B 1Q8IA 2F0JA 1EYAA 1WTQA 1B4OA 1UAPA 2NVQB 1WTOA 3OMGA 2JA7B 1Y69U 5AFWA 1EY4A 2EJMA 5G3LF 4DA2A 2CHBD 1QJOA 1QOHA 3CRLC 2KOLA 5DNFA 4ZKCB 4HR7B 1I4XA 2F0FA 5D3IB 2O2LD 2EYFA 3CU7A 3S1RB 1D6EC 4IUQA 1WTXA 2F4IA 4G57A 5KYIA 4ZAIA 2B8FA 2DY8A 4RCOA 4RFBA 2L9HA 2F03A 1V8QA 4C3IG 1SAPA 5E1FA 4NP5A 2R92B 2XSCA 3S1MB 1I4PA 1MD2D 5CBEE 3I3CA 4CHTB 1O7ZA 5EKKA 1JE4A 3C46A 5ELDA 1RODA 3I4MB 1PDQA 5FO8B 3D4DA 1BXTA 1WD0A 3K0YA 5C4JB 1YNND 3OWEB 4FF2A 4ZUIA 1I6VC 1STYA 3SXHA 2XVSA 5FLXE 3OHXC 4IURA 5JPNC 2RKSA 1SNPA 5IOCA 5JEAH 2ICIA 1R4PB 4WFN3 3HOUB 3AMUA 3K58A 4FXKC 3R2IA 1A3UA 4QCLA 3L9AX 4H0LC 2EE1A 4PV1C 2JEBI 1STEA 3HRZC 2JSOA 1AEXA 2EYHA 3MZ5A 1GJXA 2PW7A 2QF7A 2HCIA 4G7OC 1SYCA 1B44D 1TVXA 1LO5D 4C3JG 4G7HC 4RA8A 3DHQA 4N9TA 3IAYA 3BVZA 3WOFA 4WJWA 1Y8OB 3C1EA 3H0GB 1V1PA 2G9HD 5JOBA 4EGVA 1SNMA 5IGCA 2K5QA 1ENCA 2FMCA 2WACA 3GTJB 2AWNA 1L0YB 3RMHA 3C3LA 1S5FD 2KEEA 4OGQC 1UUPA 5I6WA 3T13A 4B9XA 5EBDA 1HQRD 2K33A 5JVH3 4Z9CB 1MSHA 4ABNA 1BCPB 2J4XA 2FFKB 3TBIB 3DXJC 1ZXTA 2E74C 1V1OA 4H13C 1IW7D 2KVMA 4LK1C 2WP8J 5C0XG 5E4WC 4HMIA 2L5TA 1OXSC 1SE4A 1A2TA 2KCCA 4M1UB 2F3WA 3ZYYX 2LKVA 5JPMC 2NBFA 1Q1EA 4EVOA 4BA2I 1BCPC 1ENFA 1Y8PB 4Y7NB 2EOTA 1H9JA 1F2ZA 4ZQ3A 5IODA 4WRDA 4F7XA 3I8ZA 4BBRB 1PTOC 1JICA 1RF2D 3Q0AA 3OMCA 5CV6A 3M4OB 2F0EA 5KGUA 1SFOB 2C5CA 3SK4A 2TMPA 4F88A 3GTLB 1KNAA 2H1EA 1I3QB 3UI2A 5FO9B 5FLXL 4FO2A 5C3XA 1A15A 1AN8A 3D6WA 3CKIB 1IYVA 4C1NI 3S1NB 1TS2A 3DM1A 3A55A 5C0XH 1Q3LA 1F9QA 1H9MA 3NBIA 5A2QE 1LTGD 2M00A 4C3HG 1F2YA 4X3SA 2YU9B 1VMCA 1LTID 1STGA 3W3AA 1JCKB 1GUSA 1TWAB 3GQBA 3KF8A 4NKLA 2L11A 3V96A 1WTVA 2F0GA 3DWAA 1T5EA 2F0UA 3EJIA 1AW7A 1ZYRC 4E6IA 1GUOA 4TQUS 2SDFA 1YNJD 1BDOA 4JBWA 3A7AB 2PO4A 4XQNA 2PPBC 3MXGA 5JEAJ 1MGSA 4ZUJA 5C4ZA 1H9RA 4XT3B 1X3PA 3QIAA 4DXGA 1TWGB 4XYQA 1LTBD 3I4LA 1TR5A 4L6TB 3T16A 3NE5B 3NP8A 1TS3A 2NYZD 4HMJA 5KEEA 3K59A 5K5PA 4XDXA 2JEAI 3GTOB 1QB5D 4H44C 1JOOA 4FVMA 4V0BA 2XNAC 3VR3A 2KUMA 1HTLD 5EGTA 2RDFA 1BOSA 2A69D 2QCPX 2PCFB 3PIO3 4RKLA 2B2VA 1XX8A 2H4OA 3GTKB 4K6LA 1AZPA 4IUVA 1JWMD 4CJ1B 2IX1A 4HSVA 4ME5A 3MHBA 2D5DA 1QILA 1VMPA 5C4HA 2WKDA 3T56B 1HA6A 4ILWA 4X3KA 2VB3X 1SJED 2PMZB 2R61A 1CZGA 2GA4B 1SMYC 1TWCB 3K6OA 2N55A 2AUKA 4L63B 2OT2A 3HZXA 4CBVA 2EPBA 5BN4A 4KI0A 1ZKOA 3PUVA 1CZWA 3HEJA 3ONAB 2FMMA 4HCSA 3EROA 1WD1A 2BDOA 1CQVA 3VA5A 4FF3A 4FYDA 1SDFA 1LV9A 5IT9E 1RKNA 2RSNA 2B2YC 1DOMA 1JC7A 1GUGA 1GHKA 3H09A 5FOBB 2L1BA 3QJYA 3NQTA 4IQZA 3ERQA 1ET9A 3BYTB 5ELFA 2NTSA 5IGDA 4K2LA 3CRKC 2A6HD 2E75C 1FYCA 1Q90A 3NK9A 2DNEA 5IIFA 3NTIA 3KBGA 5ELCA 4U673 2F0WA 1PRTF 1DYQA 2RVLA 2I07B 5FKAC 2EY5A 1MBYA 5HGTA 1PZID 4KJOA 3IFTA 1H9SB 2EYMA 3J7AF 5K36H 5T1IA 1EY9A 5CV8A 3NPPA 1DXMA 1RCVD 3MFGA 1LABA 1BBXC 1IKMA 2XWJB 3J80E 3D8GA 3S2DB 3VR4A 1Q12A 4KY7A 2PZUA 2R6GA 2L4NA 1EEID 1KABA 1G291 5J1ZA 3T4AC 2QILA 3M7GA 2O5IC 1SYFA 1WTPA 2TSSA 4ODGA 4XXEA 3QB3A 2A68D 2F0MA 1KDBA 1PMRA 4QF4A 3N52A 5IGFA 3HKZB 3ITPA 2K28A 2IT1A 1RTNA 1SNDA 3JAME 1EY6A 2EJGC 2RA4A 3DWQA 3TP5A 4KMUC 1ML0D 2A5HA 1BNZA 1Z7TA 1FNVA 5T1GA 1GHJA 2R3ZA 1CTMA 2OF1A 3I91A 3HOYB 1HCZA 1A6XA 3E6ZX 2IWHA 5CORA 4PMBA 3I73A 1ET6A 2DY7A 1V43A 2KEDA 1Y1VB 4GZYC 1STHA 3PUXA 1O7LA 1UEAB 2ZXPA 1B2TA 2G9DA 4QMGA 4K2KA 4KY6A 5LL6X 2CQAA 4RCNA 5ELEA 4CKCA 1PFMA 1YNNC 3TP7A 1F9SA 4KKTA 2EYJA 2WINB 4KTAA 5C4XB 3K7AB 4MIUA 2F0SA 5TSSA 4RGMA 2WV6D 5EKLA 4KV6A 1M8AA 1HUMA 1RHPA 3RLFA 4A3EB 2PW5A 4PQXA 5DM73 1C8CA 2AUJD 2CW0D 4FF4A 3FRPB 1SJHD 2F3VA 3HOZB 1EU4A 5IGEA 1TS4A 1PZKD 2JP1A 2JA5B 3M3YB 1JQYD 2XIWA 2A74C 3RZOB 3X3NA 1WTRA 3TP6A 2JE6I 1NAPA 1EYDA 4AYBB 3W2DA 3GTPB 3H94A 2FINB 3BZDB 1SNQA 3PUWA 4RWSC 2SEBD 2VXWA 1OXXK 1AFPA 2WAQB 4CJ0B 2NN6G 5CMDA 1KAAA 4YIJA 4KHVA 2WIIB 5FK9C 1K8OA 3OW7A 3U9SA 3DEOA 3FKIB 4I7ZC 1XYIA 4A3JB 3FVQA 3BS1A 3KLSX 5A2QL 1KTKA 1SEBD 1PYWD 3EFXD 1X32A 4MN3A 1PTOF 3HGBA 3PUYA 1EFID 4F87A 1RDPD 3BDOA 2B2WA 1NR4A 4IFDH 3OSOA 4OHJA 2Q8IB 1IYUA 4A3DB 4WORA 5D65A 5E3FA 3NHHA 4OL7A 4K6DA 2YYZA 4DAVA 5DEHA 3RZDB 5K36G 5LL6S 1IL8A 2MUYA 4V190 1JORA 2ZXRA 3U9OA 2F0VA 3S2HB 4K5WA 3MTSA 1DM0B 4C3HB 1EY7A 2EYLA 1SMYD 1KDAA 5CYUA 2VUMB 5M9OA 1TY0A 3MWYW 5EPKA 1CK1A 4F8MA 1B53A 2E2IB 4NMZA 1RJTA 1LLRD 1D5XC 1SYGA 2K04A 1QCBD 4EQNA 1XTCD 2IW3A 3SR1A 1IW7C 2NTTA 4XQQA 4CGYB 4I65A 2F0QA 2MJ8A 1TWHB 5HURA 2B8GA 2A68C 4IUPA 1SYEA 2OXPA 1STAA 1GUNA 3TP8A 5ISRA 2MPMA 4C2MB 1B1ZA 4FXGC 5LHY1 3D4RA 4R8NA 1E0BA 4A93B 2F0TA 1DJRD 4DXFA 3KUPA 1LTAD 4A3FB 1Y1WB 2JXMB 1B9NA 3SK6A 1D1IA 2XRSD 1CI3M 1XXGA 4DNRB 1II3A 1O7YA 4XYOA 2QKIC 2NVTB 3URYA 4DNTB 5CGKA 2F0PA 1CQFA 1BR9A 2PQEA 3VR6A 4K5XA 3MFYA 4A3BB 3MC0B 1PRTC 2LS01 4FXDA 4IN3A 1PLFA 1SE2A 5EKIA 4R8IA 1H9SA 3M7NA 3KLSA 2M2LA 5M3MB 3SDZA 2HDMA 4DGZA 3E0JA 1BO0A 1HA5A 5F2DA 1KDCA 2Z4HA 5G3LD 1LT3D 3HG9A 4KD4A 4LAAA 1PRTB 5CBAE 4HEDA 3SEBA 4K8JA 2E76C 1PFBA 1KLGD 1SNOA 1Z6HA 2HCCA 5ELBA 3M4YA 2IJ0A 3NQIA 4KK7A 3CQZB 3L3OC 1BUVT 2EY6A 2NWGA 2F0NA 5A35A 2OEOA 2F0KA 2XN9C 5EPJA 3T51B 5M5YB 1NUCA 2NUCA 3IKJA 1L0XB 1J9OA 1ESRA 2D62A 1ENAA 5I4DA 1QE6A 3MA2B 2F0LA 1LACA 1GUWA 3Q6SA 3C2PA 3L7ZC 1MSGA 4LMQD 4DN4M 5C6AA 1FD7D 2L12A 2B2WC 4A3MB 4HN7A 2JYOA 4KKUA 4PNYA 3TSSA 4M8AA 3WOEA 1STNA 2EXZA 3GV6A 4ZK9B 1ILQA 3S15B 2K32A 1E2ZA 3VYRA 1HHVA 2K05A 4K8IA 1OO9B 3KLRA 2WB1B 1GUTA 3TN2A 1TT2A 3K5OA 4TRDA 1F9PA 1QNUA 2E2HB 5I6YA 1CM9A 2IX0A 1SXTA 3OOCA 1PZJD 3VR5A 3EA6A 1DCZA 2L0CA 3VYUA 4BBSB 2B2TA 5JVG3 1SNCA 3NXWA 1LTTD 3R93A 3BDCA 4KN7C 4ZRZA 2FHTA 2IX3A 3OPOA 2Z1CA 4UDUC 4KN4C 3Q24A 2KJXA 1TKWB 2BA1A 3NBHA 4HSPA 4Q0FA 3GTMB 4A3GB 3SVMA 2Z4IA 1U4RA 4TSSA 2CVRA 2K7VA 4RAUC 3AU7A 3R2TA 1ESFA 2R93B 1HFNA 2LMCB 1EIGA 3FPUB 1DD2A 2HDLA 1A2UA 2R7ZB 2BCOA 2J7ZA 1EYCA 5EBCA 2K6AA 1PXUA 3FMCA 3O13A 4DFAA 1OXTA 3NSWA 1V1PB 2F1MA 2PZWA 5KIXA 2I46A 4XT1B 1F9RA 3SK8A 2Q8TA 4BA1I 2A6EC 5NUCA 2K03A 2ID0A 2EY1A 3X3MA 1QWYA 1SYBA 3P1HA 5KNDA 1EZ8A 3J81E 3K5MA 4JK1C 5JJZA 5KNCA 1D1KA 3H91A 3MVVA 3QOLA 5JEAG 1EWHA 1GOZA 1I50B 1HQMC 1EY0A 4DAPA 3QG1A 3PUZA 4HCEA 3EVQA 3NWTA 1FNUA 3VYTA 4OIKA 2LY7A 1FNWA 1C48A 1LTSD 2A69C 1KNEA 3D4WA 3TZDA 3IFDA 1D2BA 2RDHA 4HTHA 5D14A 2K5DA 2L55A 5CC4A 1CHPD 1ILPA 1VF5C 1JWUD 2O4XA 3K57A 2NN6I 3KK7A 3OIPA 1EY8A 1T5XD 5DM63 4J6HA 3TMEA 2B2TC 4X3TA 1HXYD 1JOKA 2V4DA 5BN3A 5C0XI 5C0XJ 3DWPA 4CKEA 5C3WA 1DOLA 2XRQD 3MXPA 2EZVA 3DMUA 5IT9L 3QOJA 2N88A 3G7LA 1LT5D 5J22A 3VYSA 3S9WA 1WVLA 3HP3A 1I6HB 1S5DD 5DAUA 2K5WA 1D5MC 2A6ED 1TQOA 1G91A 1PTOD 3PMFA 3V05A 4KJNA 3NTHA 3M85A 5CV4A 4H7BA 3NWSA 3GTQB 4KY5A 3BDLA 1Q1BA 3HOWB 1OXVA 3HOXB 3QO2A 3MXUA 1E2WA 1WTWA 4O42A 5COYA 2A73B 1HPCA 2KA7A 1EIHA 3J7YW 4ULLA 4DU9A 1EL0A 1ONLA 3A8JE 1EQVA 2Q8RE 1R9TB 4N9PA 3A56A 4RGTA 5KNBA 1G6ZA 1HFGA 1U4MA 2SOBA 4HAEA 4RGNA 1STBA 5C3EB 3J81L 4FF1A 2JA6B 3OIQA 3GD7A 3GV3A 1CHQD 1A3VA 1AP0A 1I4QA 3EQLC 3G6JB 4A3IB 2B39A 3I70A 1Z47A 3Q22A 1EQTA 4C1NK 2ZT9C 2FJ2A 5D3DA 1J8IA 1ZYRD 3DUZA 4PMCA 4ZLTF 5FO7B 3VR2A 2SNMA 1B3AA 2EVBA 1PTOH 3I4NB 1S5BD 1QNKA 2D9UA 1C4QA 1IKLA 2K1BA 5C5LA 4IFDI 1B50A 2J0TD 3P75A 4PMWA 4NDXA 4K5VA 1BF4A 2F0OA 4U68A 2DNCA 2EDGA 2QEJC 1I4GA 2DN8A 3LX0A 3HOVB 5M3FB 3A54A 4BS9A 4C56C 2VB2X 3GTGB 2RQXA 2BE5C 2BDNA 4DK1A 4QIWB 2KCNA 1SBBB 4FNFA 1OXUA 4ZKBB 4EQOA 4Q5VA 1UNSA 2AWOA 4MHEA 2EYOA 3J7AV 1TY2A 1R4QB 5EJWA 1HRJA 1CA5A 3H6MA 5IGBA 2MP1A 2X6GA 3A8KE 1TU2B 5CV7A 2AQ2B 1JOQA 1WCMB 2BA0A 2C9OA 3ND9A 3D6CA 4LJZC 2VNUD 3C1FA 3LWEA 5KRUA 1RD9D 1G2TA 1K83B 2K01A 1VDZA 3GP7A 2PZTA 3KBXA 5I9OA 1TWFB 3S16B 3D3RA 4QUFA 5EQ0A 2F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5S A;  1SNP A;  1KDA A;  5IOC A;  1SYB A;  3P1H A;  4KJN A;  5C4Z A;  4EQP A;  3TP5 A;  1EZ8 A;  2F0J A;  1EYA A;  4EVO A;  4B9W A;  5M9O A;  2QDB A;  4K8I A;  4K14 A;  5C5L A;  5CV5 A;  3TP6 A;  3P75 A;  4F8M A;  1U9R A;  1EYD A;  3OMG A;  4H7B A;  5CV4 A;  1A3U A;  1TR5 A;  1TT2 A;  3MVV A;  3T16 A;  1F2Z A;  2OF1 A;  3NP8 A;  3QOL A;  4NDX A;  4K5V A;  3NQT A;  4KY5 A;  4S3S A;  3ERQ A;  4ZQ3 A;  5IOD A;  3BDL A;  4HMJ A;  4NMZ A;  4DGZ A;  1EY4 A;  4WRD A;  5I6Y A;  5F2D A;  4F7X A;  4KD3 A;  5KEE A;  1KDC A;  5K5P A;  2F0O A;  1AEX A;  2EYH A;  3MZ5 A;  1SNQ A;  4IUN A;  1SYG A;  1EY0 A;  4RKB A;  5JAV A;  2EY2 A;  4J1M A;  3MEH A;  2PW7 A;  3NUC A;  3OMC A;  4K2L A;  5CV6 A;  3RUZ A;  5IGD A;  2F0E A;  5KGU A;  2F0F A;  3EVQ A;  3SK4 A;  1JOO A;  4KD4 A;  4LAA A;  1SYC A;  4EQN A;  2EYF A;  3NK9 A;  4PMB A;  5IIF A;  3LX0 A;  1SNC A;  2SNS A;  3NXW A;  2KQ3 A;  1F2M A;  3BDC A;  4DU9 A;  2F0W A;  2F0D A;  3D4W A;  1KAA A;  3DHQ A;  4K8J A;  1EQV A;  2RDF A;  4N9T A;  5EGT A;  3SR1 A;  3V2T A;  4YIJ A;  2F0I A;  3C1E A;  2EY5 A;  1IHZ A;  1STH A;  4HTH A;  4KHV A;  4I65 A;  2F0Q A;  4RKL A;  5C3X A;  4G57 A;  5JOB A;  5KYI A;  4N9P A;  4QMG A;  4K2K A;  1SNO A;  5HUR A;  5CC4 A;  4KY6 A;  1SNM A;  3SK5 A;  2EYP A;  5IGC A;  5HGT A;  2ENB A;  1SYE A;  4EQO A;  2OXP A;  2O4X A;  1ENC A;  2PYK A;  4KJO A;  1STA A;  2WAC A;  3R3O A;  2EYM A;  5CR3 A;  5IGG A;  4ME5 A;  3MHB A;  2EY6 A;  2EYO A;  3TP7 A;  1EY9 A;  3TP8 A;  5CV8 A;  5C4H A;  2F0N A;  2EYJ A;  5ISR A;  2SOB A;  5I9P A;  1EY8 A;  2OEO A;  5E1F A;  2F0K A;  4KTA A;  4J6H A;  4NP5 A;  1EY5 A;  2M00 A;  4IAL A;  1STB A;  4MIU A;  1SYD A;  3TME A;  1F2Y A;  1NUC A;  2NUC A;  3H6M A;  1JOK A;  2F0S A;  5I6W A;  5IGB A;  3D8G A;  3T13 A;  1STG A;  4KY7 A;  1EZ6 A;  2PZU A;  3OSO A;  4QB4 A;  4R8N A;  1A3V A;  3SHL A;  5EKK A;  4B9X A;  5CV7 A;  2F0T A;  1KAB A;  4WOR A;  1JOQ A;  5KYL A;  5EKL A;  5J1Z A;  4KV6 A;  1A2U A;  1EY7 A;  1ENA A;  5E3F A;  3NHH A;  1SYF A;  3D4D A;  4OL7 A;  3HZX A;  1A3T A;  3OWF A;  4K6D A;  5C3W A;  1EYC A;  2F0L A;  4ODG A;  3QB3 A;  5DEH A;  4NKL A;  3D6C A;  4IZ8 A;  3SK6 A;  2PW5 A;  2F0M A;  3C1F A;  3HEJ A;  2F0G A;  1KDB A;  2F0U A;  3EJI A;  4DFA A;  4QF4 A;  5CV9 A;  3MXP A;  1JOR A;  2PZW A;  3ERO A;  5KIX A;  5KRU A;  5J39 A;  3DMU A;  4E6I A;  5C6A A;  5IGF A;  1II3 A;  3QOJ A;  3U9O A;  2F3V A;  2KHS A;  4HMI A;  4PMC A;  5C5M A;  2F0V A;  2PZT A;  3VA5 A;  5J22 A;  2RBM A;  2HQE A;  5I9O A;  3SK8 A;  2SNM A;  3ITP A;  1A2T A;  4ID6 A;  4K5W A;  4ZUI A;  5CGK A;  5NUC A;  3S9W A;  1NSN S;  1STY A;  5IGE A;  4PNY A;  2F0P A;  2PQE A;  5DAU A;  3SXH A;  4DF7 A;  4K5X A;  1SND A;  1RKN A;  1TQO A;  2EY1 A;  2F0H A;  1STN A;  4TRD A;  2EXZ A;  2EYL A;  1EY6 A;  2RKS A;  2F3W A;  3PMF A;  2LKV A;  4ZUJ A; 
#chains in the Genus database with same CATH topology
 2X69 A;  3PO3 B;  1CSQ A;  4B9W A;  1YBY A;  4K14 A;  2IPK D;  3WDN A;  1U9R A;  4DR4 Q;  3LGJ A;  4IPD A;  3AEV A;  1K3B C;  3FEW X;  3CPF A;  2QGQ A;  1LTR D;  4S3S A;  4KKS A;  1EEF D;  1U4L A;  1WYD A;  3AB9 A;  3BZC A;  3TZU A;  2UXB L;  1A0I A;  4IUN A;  4IPG A;  3FPP A;  1XWE A;  4J1M A;  3J80 c;  3N6R A;  2D2C C;  3AFP A;  4DK0 A;  4CKB A;  5C44 H;  1EU3 A;  1HR0 W;  5IP9 H;  4DAY A;  3CCU A;  1F2M A;  3BVM A;  5JAV A;  1G2S A;  1RTO A;  3TDQ A;  2O5J C;  3PIP 3;  4R9W A;  1JR0 D;  1NMG A;  2EYP A;  1D5Z C;  1PVO A;  1WCM H;  2R92 G;  4B08 A;  5FJ8 G;  2UUC L;  4JV5 L;  1I4H A;  4DV3 Q;  4HJ9 A;  5IGG A;  3HOZ G;  4KHZ A;  4IFD G;  1W6J A;  4FP5 D;  3QR8 A;  2ZXO A;  4RGO S;  1Q7Y C;  1EOT A;  1G8Z D;  5M5W H;  1UWV A;  1VQ6 A;  3MXN B;  2JA7 H;  3I55 A;  2B2V C;  3HOW H;  4DR5 L;  4B3S Q;  3GO5 A;  4BWG B;  4A3K B;  1DZ1 A;  3P7J A;  3OWF A;  3MAQ A;  4OEM B;  2XWB B;  2QA4 A;  5HGQ A;  4IZ8 A;  4UPA A;  3P20 A;  1QUQ B;  1XMO L;  3B6Y A;  5I2X A;  1VF7 A;  2ZJP A;  2D0O A;  3PGZ A;  1F2L A;  3F2B A;  5C5M A;  3F2U A;  3A5U A;  4JI0 L;  1RIP A;  2RBM A;  2HHH Q;  5M5W B;  2B2Y A;  4IUT A;  2NVQ H;  4ZYS A;  2NZ1 D;  1VQN A;  1BVS A;  1PH2 A;  5LMN W;  2Q2T A;  3M4Q A;  2Y0S B;  4LWC A;  1S5E D;  3Q23 A;  4J8Q A;  5IP9 G;  1AZQ A;  3VA7 A;  1S4Z A;  4OX9 Q;  4CJ2 C;  4A3L G;  4UAI A;  3T1Y Q;  4JBM A;  1U4P A;  1BBU A;  2QDB A;  4OO1 H;  5CV5 A;  2AMC B;  1KIX A;  1EWC A;  3NTK A;  4HJ7 A;  2B63 B;  2CW0 C;  1VQ7 A;  1HTP A;  1TII D;  2NB0 A;  2QW7 A;  1KRT A;  1O80 A;  5JJI A;  3J81 i;  2JK8 A;  2Q2U A;  3S2D H;  2A6H C;  4L5Q A;  1HUN A;  4KHP Q;  1YHQ A;  5FJ8 H;  4RKB A;  1HZC A;  2IY5 B;  2EY2 A;  1ICW A;  3HOZ H;  3U4V A;  1XPO A;  3ND8 A;  3RUZ A;  2EJF C;  2PNR C;  4O1N A;  4RHS A;  4G4K A;  4IFD J;  1H9K A;  1GO3 E;  2NVX B;  2AQ1 B;  3A8I E;  1CT1 D;  5C44 B;  3HFZ B;  4TKO B;  5I2Y A;  1CA6 A;  3I72 A;  1K8M A;  1JWS D;  2AHO B;  1O78 A;  2BE5 D;  4UHV A;  4XTC S;  2F0D A;  2LXJ A;  1KXL A;  3S1Q B;  2RSO A;  1DON A;  1IHZ A;  5JJL A;  1QG7 A;  3VDY A;  4RH6 A;  1BCP F;  3HS0 C;  3IL8 A;  1I4R A;  3SK5 A;  1XJV A;  2ENB A;  3CC4 A;  3I4M H;  4NXM Q;  3I90 A;  1FGB D;  5C4X H;  5I9P A;  1NR2 A;  3CP0 A;  1XNR L;  2B3G A;  4LFB Q;  2MGS A;  4DV6 Q;  1EY5 A;  1ZEQ X;  4IAL A;  1SYD A;  1YNJ C;  3RLN A;  4JI1 Q;  3PO2 H;  1EZ6 A;  1CFM A;  1GXD C;  5IE8 A;  1JB3 A;  1Y1V H;  2B2U C;  5GAE C;  3SGI A;  4DV4 Q;  4DUY L;  1NBW A;  4QGU A;  3A0J A;  1Q86 C;  1A8V A;  2BOS A;  1DOK A;  4OO1 G;  3W5O A;  5E4X A;  3H3V C;  1D8L A;  5CV9 A;  1MI2 A;  1PFN A;  1M4V A;  2EXD A;  5J39 A;  1BCP D;  1Y1W G;  4BY1 B;  3KLW A;  2Z0S A;  1K73 C;  3PV0 A;  3KOJ A;  2IL8 A;  3UDI A;  1NSN S;  5BN5 A;  4A3E G;  2JA8 B;  4DF7 A;  4DK6 C;  1F77 A;  3BZK A;  4DNI A;  4C3J B;  2B63 G;  2R7F A;  4AIM A;  3AYH B;  3MXN A;  4RHR A;  4XIG S;  4O2D A;  5EPL A;  1LT6 D;  4EQP A;  2AQ3 B;  3FDT A;  4YHH L;  2X6L A;  3HKS A;  1UE1 A;  4C3J H;  2ES2 A;  4JPB W;  4A3B G;  3E3X A;  3LWU A;  1Y8N B;  2UXB Q;  4DR7 Q;  1W6K A;  2ICE C;  4P2C B;  4X3U A;  2E2D C;  4DUZ Q;  3PO2 B;  4KD3 A;  1B9M A;  4IJH A;  1X3Q A;  1T9H A;  3MEH A;  3NUC A;  3DEP A;  3CQZ H;  2KEC A;  5C3E G;  3H3V I;  2Y0S E;  1FR3 A;  3D31 A;  5M3F H;  1EUJ A;  4G7Z C;  1SE3 A;  2CFM A;  4P75 A;  2SNS A;  3S17 B;  2KQ3 A;  3CHB D;  5LMN Q;  1QVG A;  1M90 C;  2E2I H;  3BYY B;  3K5L A;  3V2T A;  2Z8L A;  3QWN A;  2F0I A;  2WKC A;  1VCI A;  1SFO H;  1PTO B;  2NN6 H;  3SE0 A;  2VQE Q;  1BQQ T;  4X65 L;  2PYK A;  3DM3 A;  1QZG A;  2KCM A;  3R3O A;  3JAM L;  5CR3 A;  2HUG A;  3KYH C;  2B2U A;  1S5C D;  3FP9 A;  1IBK Q;  3A7L A;  3J80 L;  4YCU A;  1SSO A;  4H02 A;  3PF5 A;  2ZM6 Q;  4YCW A;  2RDG A;  1E2V A;  1TS5 A;  2XTI A;  2LFN A;  4A3J G;  1KLU D;  1HR0 L;  5BR8 Q;  4QB4 A;  3SHL A;  4C3I B;  3K7A H;  2B63 H;  2M9V A;  5KYL A;  1SR3 A;  3LNN A;  1S72 A;  3DLL A;  2NVX H;  1A3T A;  3J7Z C;  1K9M C;  4L5R C;  3ULL A;  1NY4 A;  3BVG A;  4A3B H;  4LFC L;  4N8X 1;  4IUU A;  2KHS A;  4L8J A;  2E2J B;  3K5N A;  3S14 B;  1LT4 D;  3PO3 G;  1NCV A;  2HQE A;  4LF6 Q;  1PRT D;  4ID6 A;  5IYD G;  5M5X B;  4OIJ A;  3RD4 A;  4NW2 A;  4BY7 B;  1XMQ Q;  5C3E H;  4OO1 I;  1R9T H;  1WI5 A;  3R8B A;  1KD1 C;  3NEM A;  4A3F H;  3BG3 A;  4XQJ A;  1PH1 A;  2MHV A;  3E5S A;  2NVY B;  4QUC A;  3T53 B;  4GS3 A;  1Q8I A;  2F0J A;  1EYA A;  1WTQ A;  1B4O A;  1UAP A;  2KCT A;  2NVQ B;  1WTO A;  3OMG A;  1ICF B;  2JA7 B;  1Y69 U;  5AFW A;  4DR6 L;  4GOP B;  1EY4 A;  2EJM A;  5G3L F;  4DA2 A;  2CHB D;  1KQS A;  1QJO A;  1QOH A;  3CRL C;  4OEL B;  2KOL A;  5DNF A;  4ZKC B;  4HR7 B;  3AFQ A;  1I4X A;  2DUD A;  2F0F A;  5D3I B;  2O2L D;  2EYF A;  1NNX A;  3CU7 A;  3S1R B;  4HID A;  1D6E C;  4IUQ A;  1PYB A;  4JI6 L;  1WTX A;  2F4I A;  2PI2 A;  3D0F A;  4JI7 Q;  4APV A;  3RZO H;  4G57 A;  2LXK A;  5KYI A;  4ZAI A;  2B8F A;  2DY8 A;  4RCO A;  4RFB A;  2L9H A;  2F03 A;  1V8Q A;  4C3I G;  1SAP A;  1PH6 A;  5E1F A;  4NP5 A;  3TS0 A;  2R92 B;  2XSC A;  3S1M B;  1I4P A;  1MD2 D;  5CBE E;  3I3C A;  4IPC A;  4CHT B;  1A62 A;  1NJI C;  1O7Z A;  5EKK A;  4CDD C;  1L0W A;  3M4O H;  1JE4 A;  4YY3 Q;  1PH8 A;  4X62 Q;  3C46 A;  5ELD A;  1ROD A;  3I4M B;  1VQM A;  1PDQ A;  5FO8 B;  2ZJQ A;  3D4D A;  4LW1 A;  1BXT A;  4GLA C;  5DLQ E;  1N36 L;  1WD0 A;  3K0Y A;  5C4J B;  1YNN D;  3OWE B;  1PH4 A;  1VQK A;  4FF2 A;  1N9W A;  4ZUI A;  1I6V C;  1STY A;  3SXH A;  2XVS A;  5FLX E;  3OHX C;  4IUR A;  4NXM L;  1EIF A;  4JI4 Q;  4JI0 Q;  5JPN C;  2RKS A;  1Y1V G;  1SNP A;  5IOC A;  1X3E A;  5JEA H;  2ICI A;  1R4P B;  1ASZ A;  1Q8K A;  4WFN 3;  4DKA C;  3HOU B;  4IJL A;  3AMU A;  3K58 A;  4FXK C;  3R2I A;  1A3U A;  4QCL A;  3L9A X;  4H0L C;  2EE1 A;  1HNX Q;  4PV1 C;  2RCF A;  2JEB I;  1STE A;  3HRZ C;  1Y1W H;  3S17 H;  2JSO A;  3BU2 A;  5C44 G;  1VQ9 A;  1AEX A;  2EYH A;  3MZ5 A;  2V1C C;  1GJX A;  2PW7 A;  2QF7 A;  2HCI A;  4G7O C;  1SYC A;  2JA8 G;  1B44 D;  3HOY H;  1TVX A;  1TXY A;  1J5E L;  3K80 C;  1LO5 D;  4NB3 A;  4C3J G;  4G7H C;  2K5V A;  4RA8 A;  3DHQ A;  4N9T A;  3IAY A;  3BVZ A;  3WOF A;  1JJC B;  1Y8O B;  4WJW A;  3C1E A;  3H0G B;  1V1P A;  2G9H D;  4NXN L;  5JOB A;  4EGV A;  1CSP A;  1W3S A;  1SNM A;  5IGC A;  1GD7 A;  3CCJ A;  2K5Q A;  1PH9 A;  2JJQ A;  2I5M X;  1ENC A;  2FMC A;  2WAC A;  4GNX A;  1VQH A;  3GTJ B;  1MHW C;  2AWN A;  1L0Y B;  3RMH A;  3C3L A;  1LM0 A;  1S5F D;  2KEE A;  5LMU L;  4OGQ C;  4OON A;  1UUP A;  2PNH A;  5I6W A;  3T13 A;  4B9X A;  5EBD A;  1HQR D;  1PYS B;  2VZA A;  3KFU A;  2K33 A;  5JVH 3;  2I5L X;  4Z9C B;  1MSH A;  4ABN A;  1BCP B;  3M3Y H;  1B7Y B;  2J4X A;  2FFK B;  3TBI B;  5IT9 c;  3DXJ C;  4BXX G;  4I7A A;  4MTK A;  1ZXT A;  4QL5 A;  2E74 C;  1V1O A;  1E22 A;  4H13 C;  4A4I A;  5LMN L;  3JAM c;  3GTM H;  1IW7 D;  2KVM A;  4LK1 C;  4EQ5 A;  2WP8 J;  5C0X G;  5E4W C;  5E7N A;  4Y52 H;  1IBL L;  4AQY L;  4HMI A;  2L5T A;  1OXS C;  1SE4 A;  4DR1 Q;  2Z6K A;  4JI2 L;  1A2T A;  2KCC A;  1VQF A;  4M1U B;  2N49 A;  2PQA B;  2F3W A;  3ZYY X;  2LKV A;  2VY3 A;  5JPM C;  3HOY G;  2NBF A;  2GVA A;  1Q1E A;  4A93 G;  4EVO A;  4BA2 I;  1BCP C;  1ENF A;  1Y8P B;  4JC0 A;  4Y7N B;  2EOT A;  4X66 Q;  1H9J A;  1F2Z A;  4ZQ3 A;  4P72 A;  5IOD A;  5LMU Q;  4WRD A;  1K0S A;  4F7X A;  3PO3 H;  3I8Z A;  4B3R Q;  4BBR B;  1PTO C;  4JOI A;  5IYD H;  1JIC A;  2MO1 A;  1RF2 D;  3Q0A A;  3TS2 A;  3OMC A;  4O0A A;  5CV6 A;  3M4O B;  2L15 A;  2F0E A;  1JJG A;  5KGU A;  1SFO B;  2C5C A;  3SK4 A;  2TMP A;  4F88 A;  4DV2 L;  3GTL B;  1KNA A;  2H1E A;  2VQF L;  1I3Q B;  2Y0S G;  3UI2 A;  1QUQ A;  5FO9 B;  4JVZ A;  5FLX L;  1JMC A;  4FO2 A;  5C3X A;  1A15 A;  4CDC C;  5C4X G;  1AN8 A;  3D6W A;  3CKI B;  1IYV A;  1JT8 A;  4C1N I;  4POG A;  2UUB Q;  3S24 A;  3S1N B;  4GKJ L;  1S3O A;  1TS2 A;  3DM1 A;  3A55 A;  5C0X H;  1Q3L A;  3S15 H;  1F9Q A;  1RL2 A;  5GAG C;  1H9M A;  3NBI A;  5A2Q E;  1LTG D;  2M00 A;  1NTG A;  4C3H G;  1XPR A;  1F2Y A;  4X3S A;  3OW2 A;  2YU9 B;  1VMC A;  4B3T Q;  1LTI D;  1STG A;  1JB7 A;  1N33 L;  2HQL A;  1CKN B;  3TEH B;  1N32 L;  3W3A A;  1JCK B;  1JE5 A;  4DV0 L;  1GUS A;  3H0G H;  1TWA B;  3GQB A;  4JYA Q;  4DAY B;  4A3C G;  5M5Y H;  3KF8 A;  2ASB A;  3RNU A;  4DR3 L;  4NKL A;  4RG1 A;  2L11 A;  3V96 A;  1WTV A;  2F0G A;  3DWA A;  1T5E A;  2F0U A;  1FGU A;  3EJI A;  1AW7 A;  1ZYR C;  4E6I A;  5GQO A;  1GUO A;  2PI2 E;  3PF4 A;  4BY7 H;  4TQU S;  4LFC Q;  2SDF A;  1YNJ D;  1HZ9 A;  4LF5 L;  3CCV A;  4BBS G;  1BDO A;  4JBW A;  3A7A B;  2RCN A;  2PO4 A;  4XQN A;  2PPB C;  4OX9 L;  3MXG A;  5JEA J;  3T1Y L;  1UE6 A;  4PZ8 A;  1MGS A;  4ZUJ A;  5C4Z A;  1H9R A;  4DV3 L;  4XT3 B;  1X3P A;  3QIA A;  4DXG A;  1TWG B;  4XYQ A;  1X3G A;  1LTB D;  1SMX A;  4KHP L;  3I4L A;  1TR5 A;  4L6T B;  3T16 A;  3NE5 B;  3NP8 A;  1X55 A;  1TS3 A;  2NYZ D;  4HMJ A;  2XGT A;  5M3F G;  5KEE A;  3K59 A;  4DR4 L;  5K5P A;  4XDX A;  3CAM A;  1U5K A;  4PG3 A;  2JEA I;  3GTO B;  3EN2 A;  3E0E A;  1QB5 D;  4DR5 Q;  4H44 C;  1JOO A;  3S1Q H;  4HJ5 A;  4FVM A;  4V0B A;  4NXN Q;  2XNA C;  3VR3 A;  2KUM A;  1HTL D;  5EGT A;  2RDF A;  3Q8D A;  1BOS A;  2A69 D;  2QCP X;  2PCF B;  3TQY A;  3PIO 3;  4RKL A;  2B2V A;  3TRE A;  1XX8 A;  2H4O A;  3GTK B;  4K6L A;  1AZP A;  4IUV A;  2YTY A;  1JWM D;  4YWM A;  4CJ1 B;  3NEL A;  2IX1 A;  1Q82 C;  1LYL A;  4HSV A;  3CME A;  4ME5 A;  3MHB A;  2D5D A;  1QIL A;  1VMP A;  2ALY B;  5C4H A;  2WKD A;  3T56 B;  1HA6 A;  4J15 A;  4ILW A;  1C9O A;  4R1J A;  3G6E A;  4BY7 G;  2MNA A;  4X3K A;  2VB3 X;  4TVA B;  1SJE D;  2PMZ B;  3PIO A;  2R61 A;  5J3B A;  4IPH A;  5JJK A;  1X65 A;  1CZG A;  2GA4 B;  5ELO A;  1SMY C;  4R4Q A;  1TWC B;  3K6O A;  2N55 A;  3CMA A;  2AUK A;  1IYJ B;  4L63 B;  2OT2 A;  3HZX A;  4CBV A;  2EPB A;  5BN4 A;  4KI0 A;  4WJ4 A;  1ZKO A;  3PUV A;  1CZW A;  1A63 A;  3HEJ A;  3ONA B;  2FMM A;  4HCS A;  3ERO A;  2K14 A;  1X54 A;  1WD1 A;  2BDO A;  1DGS A;  1CQV A;  3VA5 A;  4IOC A;  4FF3 A;  3CXC A;  1SDF A;  4FYD A;  1LV9 A;  5IYC H;  5IT9 E;  1RKN A;  2RSN A;  2B2Y C;  1DOM A;  4C2M H;  1UE7 A;  3GTP H;  1HZA A;  4A3M G;  1JC7 A;  1GUG A;  1TWC H;  1GHK A;  3H09 A;  2R93 G;  1EYG A;  5FOB B;  2G5D A;  5IWA Q;  4LF7 L;  3UDG A;  2L1B A;  1JJ2 A;  1YJN A;  4POF A;  4LFB L;  3QJY A;  1VQ4 A;  4JI8 L;  3NQT A;  4IQZ A;  3ERQ A;  1ET9 A;  3ULP A;  1X56 A;  3KJO A;  3BYT B;  1E1O A;  5ELF A;  2QEX A;  1WJJ A;  2NTS A;  2H5X A;  5IGD A;  4K2L A;  3S14 H;  3CRK C;  2A6H D;  2E75 C;  1FYC A;  1Q90 A;  4IOA A;  3NK9 A;  2DNE A;  5IIF A;  3NTI A;  2VUM H;  2R7Z H;  3KBG A;  5ELC A;  2OWO A;  4U67 3;  2F0W A;  1PRT F;  1I94 Q;  5EAY A;  1VQP A;  1DYQ A;  1SRU A;  2RVL A;  2I07 B;  5FKA C;  2EY5 A;  2OTJ A;  1MBY A;  1B3Q A;  4C3I H;  4GOP C;  4ME3 A;  5HGT A;  3S2H H;  1PZI D;  4KJO A;  4A3G H;  3IFT A;  4JG2 A;  1H9S B;  1EIY B;  2EYM A;  3J7A F;  5K36 H;  5T1I A;  4BY1 G;  2IHE A;  1EY9 A;  3EBE A;  3H15 A;  4LF8 L;  5CV8 A;  5HY6 A;  3NPP A;  1DXM A;  1RCV D;  3MFG A;  1LAB A;  1BBX C;  1IKM A;  2XWJ B;  3J80 E;  2VS1 A;  3D8G A;  4B3R L;  3S2D B;  3VR4 A;  1Q12 A;  1TWG H;  2PZU A;  4KY7 A;  2K52 A;  3U50 C;  2R6G A;  2L4N A;  2C35 B;  4GOP A;  1EEI D;  1KAB A;  3J81 c;  1G29 1;  4DUZ L;  5J1Z A;  3T4A C;  3FHW A;  2QIL A;  3M7G A;  2O5I C;  1SYF A;  2UU9 L;  1WTP A;  2TSS A;  4L5T A;  4ODG A;  4XXE A;  3QB3 A;  2A68 D;  2F0M A;  4EX5 A;  1K83 H;  1KDB A;  1PMR A;  4KLK A;  3N52 A;  4QF4 A;  5GAD C;  1HH2 P;  5IGF A;  3HKZ B;  2JA6 H;  2BH2 A;  5AJ3 Q;  3L2P A;  3ITP A;  4DV1 L;  2K28 A;  1Z9F A;  2IT1 A;  1RTN A;  4A3L H;  1SND A;  3JAM E;  4DV7 Q;  4OWX B;  4JI2 Q;  1EY6 A;  2EJG C;  3H0G G;  2RA4 A;  3DWQ A;  3TP5 A;  4A75 A;  4KMU C;  1ML0 D;  2WAQ E;  2A5H A;  3I7F A;  1IBM Q;  4A3D G;  1BNZ A;  1Z7T A;  3HKZ E;  1FNV A;  5T1G A;  1GHJ A;  2R3Z A;  2ZTC A;  2ZM6 L;  1CTM A;  1N33 Q;  2OF1 A;  1L2F A;  3I91 A;  3HOY B;  3G48 A;  5H1S E;  1HCZ A;  2JA8 H;  4A3G G;  2WAQ G;  3STB D;  4X66 L;  1UE5 A;  3IRB A;  1A6X A;  3JC6 6;  3CC2 A;  4BY1 H;  3E6Z X;  2IWH A;  1U0L A;  3PQI A;  2CWP A;  1XMO Q;  5COR A;  2I0Q A;  4PMB A;  2ZTD A;  3I73 A;  1ET6 A;  2DY7 A;  1V43 A;  2KED A;  3CW2 C;  2GN5 A;  4LF5 Q;  4GLX A;  1Y1V B;  1IL2 A;  4GZY C;  1STH A;  3PUX A;  2E2J H;  1O7L A;  1UEA B;  2ZXP A;  3WWV A;  1B2T A;  2G9D A;  4QMG A;  4K2K A;  4P74 A;  4KY6 A;  5LL6 X;  2F4V Q;  2CQA A;  4RCN A;  5ELE A;  2N78 A;  4CKC A;  3HOU H;  4JI5 Q;  1PFM A;  1YNN C;  3TP7 A;  1S40 A;  1F9S A;  3PO2 G;  4BBR H;  4KKT A;  2EYJ A;  2WIN B;  4KTA A;  2CH4 A;  5C4X B;  3K7A B;  4MIU A;  4MZ9 A;  2F0S A;  4Y7N H;  1KAW A;  2KBN A;  5TSS A;  4RGM A;  2WV6 D;  5EKL A;  4KV6 A;  1M8A A;  1E24 A;  1HZB A;  4B3T L;  3J81 j;  2A19 A;  1HUM A;  1HJP A;  3G4S A;  1RHP A;  1B70 B;  3RLF A;  4A3E B;  2PW5 A;  4PQX A;  5DM7 3;  1C8C A;  2AUJ D;  2CW0 D;  4FF4 A;  3FRP B;  4A76 A;  2OQ0 A;  1SJH D;  4DAM A;  1KHI A;  2F3V A;  4JI4 L;  3HOZ B;  3S16 H;  1K8A C;  2OCE A;  1EU4 A;  1YNX A;  5IGE A;  1TS4 A;  1PZK D;  1PH3 A;  2JP1 A;  1VQL A;  2JA5 B;  2F4V L;  3M3Y B;  1JQY D;  4LF7 Q;  1BKB A;  2ZJR A;  2XIW A;  2A74 C;  3RZO B;  3X3N A;  1WTR A;  3TP6 A;  3UE1 A;  2JE6 I;  1NAP A;  1EYD A;  4AYB B;  2KHI A;  3W2D A;  1SE8 A;  3GTP B;  3H94 A;  2FIN B;  3BZD B;  1SNQ A;  3HOU G;  4ZCK A;  4DUY Q;  2F52 A;  3PUW A;  4RWS C;  3T1H L;  1VQA A;  2SEB D;  2VXW A;  3KF8 B;  1OXX K;  3M9B A;  1AFP A;  4A3M H;  3W1B A;  2WAQ B;  4CJ0 B;  2NN6 G;  1AH9 A;  4AYB E;  2Z6K C;  5CMD A;  1KAA A;  2Q2I A;  4YIJ A;  4KHV A;  2WII B;  5FK9 C;  1NMF A;  1K8O A;  4OWT B;  3F8T A;  3OW7 A;  4YWL A;  3U9S A;  3DEO A;  4B3M Q;  1N34 Q;  4LFA L;  3FKI B;  1FVI A;  4I7Z C;  1XYI A;  4A3J B;  3FVQ A;  3BS1 A;  3KLS X;  5A2Q L;  1KTK A;  1SEB D;  1MKH A;  1PYW D;  3EFX D;  1X32 A;  4LUZ A;  3I2Z A;  2F3I A;  4MN3 A;  1PTO F;  3HGB A;  4L5S A;  3PUY A;  1EFI D;  4F87 A;  1RDP D;  2R7Z G;  3UDF A;  3BDO A;  3I4O A;  2B2W A;  3RLO A;  1NR4 A;  5M5X H;  4IFD H;  3OSO A;  1E3P A;  4OHJ A;  2Q8I B;  1IYU A;  4A3D B;  2A1A A;  4WOR A;  4FDB A;  5D65 A;  1VQC A;  3U58 A;  4GN4 B;  5E3F A;  3NHH A;  1PV4 A;  1K28 A;  4OL7 A;  4K6D A;  2YYZ A;  4DAV A;  4UY8 C;  2WFW A;  5DEH A;  3RZD B;  5K36 G;  5LL6 S;  2YV5 A;  5GRO A;  3ULJ A;  3HOW G;  4CDE C;  1IL8 A;  2MUY A;  4V19 0;  1JOR A;  1EWI A;  2ZXR A;  1AE2 A;  3U9O A;  1HNZ Q;  4YWK A;  2F0V A;  5C4J H;  3S2H B;  1SN8 A;  1MJE A;  4K5W A;  1SLJ A;  5ELN A;  1MJC A;  3MTS A;  1DM0 B;  4C3H B;  1LTL A;  1EY7 A;  2EYL A;  1IBK L;  1SMY D;  1KDA A;  3KDF A;  5CYU A;  2VUM B;  5M9O A;  1TY0 A;  3MWY W;  5EPK A;  1CK1 A;  1WTH A;  4F8M A;  1B53 A;  2E2I B;  3CCE A;  1GVP A;  2JA5 G;  2CQO A;  2CKZ B;  4NMZ A;  4JI1 L;  4GKK L;  1RJT A;  1LLR D;  1D5X C;  1SYG A;  3HKZ G;  5L37 A;  1HNX L;  1E1T A;  2IHF A;  2K04 A;  1QCB D;  3JAM i;  4EQN A;  2Z6B A;  1KRS A;  3NEN A;  4WJ3 M;  1XTC D;  2IW3 A;  4A3D H;  4LF9 L;  2KHJ A;  3K81 C;  3FKI H;  3SR1 A;  4DV1 Q;  1IW7 C;  2NTT A;  4XQQ A;  4CGY B;  4I65 A;  2F0Q A;  2MJ8 A;  3PSI A;  1TWH B;  4P73 A;  1G51 A;  5HUR A;  1VQ8 A;  2B8G A;  2A68 C;  4IUP A;  1SYE A;  2OXP A;  1STA A;  1FJG Q;  1GUN A;  1BBW A;  3TP8 A;  2UXC L;  5ISR A;  2MPM A;  2QDL A;  4C2M B;  3I4M G;  1B1Z A;  1E7Z A;  4FXG C;  2KEN A;  1D7Q A;  2YTX A;  5LHY 1;  4DR6 Q;  3D4R A;  4R8N A;  1E0B A;  4A93 B;  2F0T A;  1DJR D;  4DXF A;  3I56 A;  3KUP A;  3UE0 A;  3W1G A;  1LTA D;  4A3F B;  1Y1W B;  2JXM B;  4PZ7 A;  4LUO A;  1B9N A;  3SK6 A;  1D1I A;  3KDF B;  2XRS D;  1CI3 M;  4BBR G;  2JA5 H;  5IYC G;  1XXG A;  4DNR B;  1II3 A;  1O7Y A;  4XYO A;  4JI7 L;  2QKI C;  2NVT B;  4JI3 L;  3URY A;  4DNT B;  5CGK A;  2F0P A;  1CQF A;  1BR9 A;  2PQE A;  3VR6 A;  4K5X A;  3MFY A;  2UUC Q;  4JV5 Q;  3MC0 B;  4A3B B;  2R93 H;  1PRT C;  4HIM A;  2LS0 1;  1EOV A;  4DR1 L;  4FXD A;  4IN3 A;  3STB C;  1PLF A;  4A3E H;  1SE2 A;  5EKI A;  4R8I A;  2N8N A;  1H9S A;  3M7N A;  4GNX B;  2CWA A;  3KLS A;  3FKI G;  1PHJ A;  2UXC Q;  2M2L A;  5M3M B;  3I4N H;  3SDZ A;  1MIU A;  2HDM A;  4DGZ A;  3PIP A;  3E0J A;  1BO0 A;  1HA5 A;  5F2D A;  2JN4 A;  2OQK A;  4X62 L;  1KDC A;  2VUM G;  1VQB A;  2Z4H A;  5G3L D;  1EQR A;  1N36 Q;  4DV0 Q;  1EQQ A;  1N8R C;  1LT3 D;  3HG9 A;  4KD4 A;  4LAA A;  3S1M H;  1GKH A;  4JYA L;  1PRT B;  5CBA E;  4HED A;  3SEB A;  1P16 A;  4K8J A;  2Z9H A;  4JCV E;  2E76 C;  1H95 A;  4GNX C;  3RN2 A;  4X64 Q;  1PFB A;  1Q81 C;  1KLG D;  1V1Q A;  1SNO A;  4JI3 Q;  1Z6H A;  2MFI A;  2HCC A;  4QQB X;  5ELB A;  3M4Y A;  2IJ0 A;  3NQI A;  2K75 A;  3CF5 A;  4KK7 A;  3CQZ B;  3L3O C;  1BUV T;  3BJU A;  2EY6 A;  2NWG A;  5FLM G;  2F0N A;  2PQA A;  5A35 A;  4GKJ Q;  2OEO A;  2F0K A;  1L1O C;  2XN9 C;  5EPJ A;  2MQH A;  3T51 B;  1VQI A;  5M5Y B;  1NUC A;  2NUC A;  4GN5 A;  3IKJ A;  1L0X B;  3K8A A;  3CCR A;  1EFW A;  5GAH C;  4BXX H;  2FXQ A;  4LF4 L;  1J9O A;  1ESR A;  4MTN A;  2D62 A;  4A3K H;  3T1H Q;  4A3J H;  1SRO A;  1ENA A;  5I4D A;  1QE6 A;  3MA2 B;  2JA6 G;  1N32 Q;  2F0L A;  1J5E Q;  1LAC A;  1GUW A;  3Q6S A;  3C2P A;  3L7Z C;  1MSG A;  4LMQ D;  3J80 i;  4B3S L;  3ERS X;  4DN4 M;  4K0K L;  1YJ9 A;  2OTL A;  3I4N G;  5C6A A;  4DK3 C;  4DR3 Q;  4R4T A;  1FD7 D;  2L12 A;  3RN5 A;  2B2W C;  4A3M B;  4HN7 A;  2JYO A;  4KKU A;  4PNY A;  3TSS A;  4M8A A;  2MO0 A;  3WOE A;  3GTQ H;  2HHH L;  1STN A;  1Y14 B;  2EXZ A;  3GV6 A;  4ZK9 B;  1ILQ A;  2E5L L;  3S15 B;  2K32 A;  1E2Z A;  2LSS A;  3VYR A;  3F2C A;  1XNR Q;  1HHV A;  1J6Q A;  4JI8 Q;  3OYY A;  2K05 A;  1YZ6 A;  4K8I A;  1OO9 B;  3KLR A;  2RHQ B;  1B8A A;  2WB1 B;  1GUT A;  3M4P A;  3TN2 A;  1TT2 A;  1YHB A;  3K5O A;  4TRD A;  1CUK A;  3G71 A;  4OXP A;  1F9P A;  1QNU A;  2E2H B;  5I6Y A;  1CM9 A;  1XPU A;  2IX0 A;  3OTO Q;  1SXT A;  4JW0 A;  3OOC A;  1Q46 A;  4DV5 Q;  1PZJ D;  4LF4 Q;  3VR5 A;  1CKN A;  4YY3 L;  3EA6 A;  1DCZ A;  1I3Q H;  2L0C A;  4GN3 B;  3VYU A;  2HT1 A;  3J7A 5;  3GTL H;  4BBS B;  2B2T A;  5JVG 3;  2NZO A;  1L1O A;  1SNC A;  3NXW A;  1LTT D;  2WB1 E;  3R93 A;  2E8G A;  3BDC A;  4KN7 C;  4AQY Q;  4ZRZ A;  2FHT A;  2IX3 A;  3OPO A;  4PZ6 A;  2Z1C A;  4LUV A;  4K0K Q;  4X65 Q;  4UDU C;  4KN4 C;  3CD6 A;  3Q24 A;  1QZH A;  1HNW L;  3HOV G;  2KJX A;  2WB1 G;  4UP9 A;  4HJ8 A;  4X6A H;  2BH8 A;  3TRZ A;  1K3R A;  1TKW B;  2BA1 A;  3NBH A;  4C3H H;  4B3M L;  4HSP A;  4HIK A;  4Q0F A;  1HR0 Q;  3GTM B;  4A3G B;  4P71 A;  1WCM G;  2R92 H;  4DR7 L;  3SVM A;  3H3V H;  3KF6 A;  2Z4I A;  1U4R A;  4TSS A;  2CVR A;  2K7V A;  4RAU C;  3AU7 A;  4A3C H;  3R2T A;  2UU9 Q;  1ESF A;  2R93 B;  1HFN A;  2LMC B;  1EIG A;  3FPU B;  4GLV B;  2HDL A;  1DD2 A;  1A2U A;  2R7Z B;  2DJF C;  2BCO A;  4DV5 L;  2J7Z A;  1EYC A;  5EBC A;  2K6A A;  1PXU A;  3FMC A;  3O13 A;  4DFA A;  1OXT A;  4LF6 L;  3NSW A;  1V1P B;  2F1M A;  2VL6 A;  2PZW A;  5KIX A;  2I46 A;  4XT1 B;  1K0R A;  1I94 L;  1F9R A;  3SK8 A;  2Q8T A;  4BA1 I;  2A6E C;  5NUC A;  1VQO A;  2HIX A;  2K03 A;  2ID0 A;  1IBM L;  2EY1 A;  2P5Z X;  3X3M A;  2I5H A;  1QWY A;  1SYB A;  3P1H A;  5KND A;  1EZ8 A;  1IZ6 A;  3J81 E;  3K5M A;  1PH5 A;  4JK1 C;  5JJZ A;  5KNC A;  4A3I G;  1D1K A;  3PCO B;  3H91 A;  3MVV A;  3QOL A;  4QJF A;  5JEA G;  3HOV H;  1EWH A;  1GOZ A;  1I50 B;  2HD3 A;  3CCQ A;  2NVY H;  1VQD A;  1HQM C;  2B29 A;  3GTG H;  1EY0 A;  2UXD Q;  1WOC A;  4DAP A;  3QG1 A;  3PUZ A;  4HCE A;  3EVQ A;  4GKK Q;  3CC7 A;  3NWT A;  1FNU A;  3VYT A;  4OIK A;  2LY7 A;  1PA6 A;  4JI6 Q;  1FNW A;  2UUA Q;  3U4Z A;  1C48 A;  1LTS D;  2YTV A;  3RR5 A;  2A69 C;  1KNE A;  3D4W A;  3TZD A;  3IFD A;  2VW9 A;  1D2B A;  2RDH A;  4HTH A;  4YCV A;  5AJ3 L;  4JI5 L;  1XMQ L;  5D14 A;  2K5D A;  2L55 A;  5CC4 A;  1CHP D;  1ILP A;  1VF5 C;  1GM5 A;  1JWU D;  2O4X A;  1YJW A;  3K57 A;  2ATW A;  4AH6 A;  1NE3 A;  5IP7 G;  4DV7 L;  2NN6 I;  1XNQ Q;  3KK7 A;  3OIP A;  1EY8 A;  1T5X D;  3A5Z B;  5DM6 3;  1FJG L;  4J6H A;  1C7Y A;  3GDE A;  1W2B A;  3TME A;  1VQ5 A;  2B2T C;  4X3T A;  2NZH A;  4HIO A;  1HXY D;  1JOK A;  4OWW B;  2V4D A;  5BN3 A;  5C0X I;  5C0X J;  3DWP A;  5BR8 L;  4NPS A;  4CKE A;  5C3W A;  1DOL A;  2DGY A;  2XRQ D;  3ER0 A;  2R7D A;  1G6P A;  2K5H A;  5IY0 A;  4DV2 Q;  4A3I H;  3MXP A;  2EZV A;  3EIV A;  3DMU A;  5IT9 L;  3QOJ A;  2N88 A;  2K50 A;  3UDX A;  3G7L A;  1LT5 D;  5J22 A;  3VYS A;  1CKM A;  3S9W A;  1WVL A;  4DR2 L;  3HP3 A;  2E5L Q;  1I6H B;  3KF6 B;  1S5D D;  5DAU A;  2K5W A;  1D5M C;  2A6E D;  1TQO A;  1YEZ A;  1G91 A;  1PTO D;  5IYB G;  3PMF A;  3V05 A;  4KJN A;  2NVT H;  3NTH A;  1UEB A;  4JBJ A;  3M85 A;  1TWA H;  5CV4 A;  4H7B A;  1PH7 A;  3NWS A;  1I50 H;  3GTQ B;  4KY5 A;  4A93 H;  3BDL A;  3F1Z A;  1Q1B A;  2K4K A;  3HOW B;  1IXR A;  1OXV A;  1M1K C;  3HOX B;  3QO2 A;  3MXU A;  1OTC A;  4MNO A;  1E2W A;  3S1R H;  4AYB G;  1WTW A;  4JBK A;  5M3M G;  1X3F A;  1YHA A;  4O42 A;  5COY A;  2A73 B;  1QVC A;  4JOI C;  3CCM A;  1HPC A;  2KA7 A;  1EIH A;  3J7Y W;  4ULL A;  4DU9 A;  1EL0 A;  1N34 L;  1ONL A;  3HOX H;  3A8J E;  1EQV A;  2Q8R E;  1VS0 A;  1R9T B;  2YU9 H;  2Q2H A;  2AKW B;  4N9P A;  3ICE A;  3E9H A;  2ZTE A;  3A56 A;  4X64 L;  4RGT A;  4N8F A;  5FLX c;  1QVF A;  5KNB A;  2K5N A;  1I6H H;  1O7I A;  1LUZ A;  1G6Z A;  1HFG A;  1U4M A;  2SOB A;  3ZJY C;  1X9N A;  2CH4 W;  3S1N H;  4HAE A;  4RGN A;  1STB A;  5C3E B;  3J81 L;  4FF1 A;  2JA6 B;  3OIQ A;  3GD7 A;  3K0X A;  1KL9 A;  3GV3 A;  1CHQ D;  2JQO A;  1A3V A;  1K8G A;  1KC8 C;  1AP0 A;  1I4Q A;  5IYB H;  3EQL C;  3G6J B;  4A3I B;  1I5F A;  3L0O A;  2B39 A;  3GTK H;  3I70 A;  3F2D A;  1Z47 A;  3K7U C;  2CCZ A;  3Q22 A;  1EQT A;  4C1N K;  2ZT9 C;  2RF4 A;  1FL0 A;  2D0P A;  2FJ2 A;  5D3D A;  1J8I A;  1ZYR D;  3DUZ A;  4PMC A;  4QY7 A;  4ZLT F;  5FO7 B;  2HIV A;  3VR2 A;  4CDF C;  2SNM A;  1C0A A;  1B3A A;  2EVB A;  1PTO H;  2RHS B;  3GTO H;  4LFA Q;  5M3M H;  3I4N B;  1TWF H;  4LF8 Q;  1S5B D;  1QNK A;  4BBS H;  1P8L A;  3AQQ A;  2D9U A;  3MEF A;  4LNQ A;  1C4Q A;  3CPW A;  3A74 A;  3RZD H;  1IKL A;  1VQG A;  3HOX G;  1ASY A;  2K1B A;  5C5L A;  4IFD I;  1B50 A;  2J0T D;  2EQS A;  3P75 A;  4A3F G;  2E2H H;  4PMW A;  4NDX A;  4K5V A;  2PMZ E;  3NBH B;  4HJA A;  1V9P A;  2F0O A;  4UP8 A;  1BF4 A;  4U68 A;  2UUA L;  2DNC A;  2EDG A;  2VQF Q;  2QEJ C;  1I4G A;  3CCL A;  3E9I A;  2DN8 A;  3OTO L;  3GTJ H;  4DV4 L;  3LX0 A;  3HOV B;  5M3F B;  3A54 A;  4BS9 A;  1IBL Q;  4C56 C;  4R4I A;  2VB2 X;  3GTG B;  2VQE L;  4DPG A;  2RQX A;  2UUB L;  2BE5 C;  2BDN A;  2EIF A;  4QIW B;  2KCN A;  4DK1 A;  1HNZ L;  1SBB B;  1WFQ A;  5FLM H;  4FNF A;  4RMF A;  1OXU A;  3KJP A;  1XNQ L;  4ZKB B;  4EQO A;  4Q5V A;  1UNS A;  2AWO A;  4MHE A;  1HNW Q;  2EYO A;  1YVC A;  3J7A V;  1TY2 A;  4YHH Q;  1R4Q B;  1CKO A;  2GVB A;  5EJW A;  1HRJ A;  4A3K G;  4QIW E;  1AE3 A;  4R4O A;  5IWA L;  3H6M A;  1CA5 A;  4R4C A;  5IGB A;  2MP1 A;  2X6G A;  3A8K E;  4IO9 A;  2UXD L;  1TU2 B;  4DV6 L;  5CV7 A;  1TWH H;  2AQ2 B;  1JOQ A;  1WCM B;  2BA0 A;  1XTD A;  4ALP A;  2C9O A;  2A8V A;  2JA9 A;  3ND9 A;  3D6C A;  4LJZ C;  2VNU D;  3C1F A;  1YI2 A;  5IP7 H;  3LWE A;  1PFS A;  1X6O A;  5KRU A;  1RD9 D;  4DR2 Q;  1G2T A;  1K83 B;  2K01 A;  3CCS A;  1L1O B;  1VDZ A;  3GP7 A;  2PZT A;  4LF9 Q;  3KBX A;  2N3S A;  5I9O A;  1VQJ A;  1TWF B;  3S16 B;  1VQE A;  3D3R A;  4QUF A;  5EQ0 A;  2F0H A;  1YIJ A;  4UP7 A;  1YIT A;  2JA7 G;  2DJG C; 
#chains in the Genus database with same CATH homology
 2X69 A;  3PO3 B;  4B9W A;  4K14 A;  2IPK D;  3WDN A;  1U9R A;  3FEW X;  1LTR D;  4S3S A;  4KKS A;  1EEF D;  1U4L A;  3TZU A;  3AB9 A;  4IUN A;  3FPP A;  1XWE A;  4J1M A;  3N6R A;  2D2C C;  4DK0 A;  4CKB A;  1EU3 A;  4DAY A;  1F2M A;  3BVM A;  5JAV A;  1G2S A;  1RTO A;  3TDQ A;  2O5J C;  3PIP 3;  4R9W A;  1JR0 D;  2EYP A;  1D5Z C;  4B08 A;  1I4H A;  5IGG A;  4KHZ A;  4IFD G;  1W6J A;  4FP5 D;  2ZXO A;  4RGO S;  1EOT A;  1G8Z D;  2B2V C;  3GO5 A;  4BWG B;  4A3K B;  1DZ1 A;  3P7J A;  3OWF A;  3MAQ A;  2XWB B;  4IZ8 A;  3P20 A;  5I2X A;  1VF7 A;  1F2L A;  5C5M A;  3F2U A;  2RBM A;  5M5W B;  2B2Y A;  4IUT A;  4ZYS A;  2NZ1 D;  2Y0S B;  1S5E D;  3Q23 A;  4J8Q A;  1AZQ A;  3VA7 A;  1S4Z A;  4CJ2 C;  4UAI A;  1U4P A;  2QDB A;  4OO1 H;  5CV5 A;  1EWC A;  3NTK A;  2B63 B;  2CW0 C;  1HTP A;  1TII D;  2NB0 A;  1O80 A;  2A6H C;  1HUN A;  4RKB A;  2EY2 A;  1ICW A;  3ND8 A;  3RUZ A;  2EJF C;  2PNR C;  4O1N A;  4RHS A;  4G4K A;  4IFD J;  1H9K A;  2NVX B;  2AQ1 B;  3A8I E;  1CT1 D;  5C44 B;  4TKO B;  5I2Y A;  1CA6 A;  3I72 A;  1K8M A;  1JWS D;  4XTC S;  1O78 A;  2BE5 D;  2F0D A;  3S1Q B;  2RSO A;  1DON A;  1IHZ A;  1QG7 A;  4RH6 A;  1BCP F;  3HS0 C;  3IL8 A;  1I4R A;  3SK5 A;  2ENB A;  3I90 A;  1FGB D;  5I9P A;  1NR2 A;  2MGS A;  1EY5 A;  1ZEQ X;  4IAL A;  1SYD A;  1YNJ C;  1EZ6 A;  1CFM A;  1GXD C;  1JB3 A;  2B2U C;  2BOS A;  1DOK A;  4OO1 G;  3H3V C;  5E4X A;  5CV9 A;  1MI2 A;  1PFN A;  1M4V A;  5J39 A;  1BCP D;  4BY1 B;  3PV0 A;  2IL8 A;  2JA8 B;  1NSN S;  5BN5 A;  4DF7 A;  1F77 A;  4C3J B;  3MXN A;  4RHR A;  4XIG S;  5EPL A;  4EQP A;  1LT6 D;  2AQ3 B;  3FDT A;  2X6L A;  3LWU A;  1Y8N B;  1W6K A;  2ICE C;  4P2C B;  4X3U A;  2E2D C;  3PO2 B;  4KD3 A;  1B9M A;  1X3Q A;  3MEH A;  3NUC A;  3DEP A;  2KEC A;  1FR3 A;  3D31 A;  4G7Z C;  1SE3 A;  2SNS A;  3S17 B;  2KQ3 A;  3CHB D;  3BYY B;  3K5L A;  3V2T A;  2Z8L A;  3QWN A;  2F0I A;  2WKC A;  1VCI A;  1PTO B;  2NN6 H;  3SE0 A;  1BQQ T;  2PYK A;  3R3O A;  3JAM L;  5CR3 A;  2HUG A;  2B2U A;  1S5C D;  3A7L A;  3J80 L;  1SSO A;  2RDG A;  1E2V A;  1TS5 A;  2LFN A;  1KLU D;  4QB4 A;  3SHL A;  4C3I B;  2M9V A;  5KYL A;  3LNN A;  1A3T A;  3BVG A;  4IUU A;  2KHS A;  4L8J A;  2E2J B;  3K5N A;  3S14 B;  1LT4 D;  1NCV A;  2HQE A;  1PRT D;  4ID6 A;  5M5X B;  4OIJ A;  3RD4 A;  4NW2 A;  4BY7 B;  4OO1 I;  3R8B A;  3BG3 A;  4XQJ A;  2MHV A;  3E5S A;  2NVY B;  4QUC A;  3T53 B;  1Q8I A;  2F0J A;  1EYA A;  1WTQ A;  1B4O A;  1UAP A;  2NVQ B;  1WTO A;  3OMG A;  2JA7 B;  1Y69 U;  5AFW A;  1EY4 A;  2EJM A;  5G3L F;  4DA2 A;  2CHB D;  1QJO A;  1QOH A;  3CRL C;  2KOL A;  5DNF A;  4ZKC B;  4HR7 B;  1I4X A;  2F0F A;  5D3I B;  2O2L D;  2EYF A;  3CU7 A;  3S1R B;  1D6E C;  4IUQ A;  1WTX A;  2F4I A;  4G57 A;  5KYI A;  4ZAI A;  2B8F A;  2DY8 A;  4RCO A;  4RFB A;  2L9H A;  2F03 A;  1V8Q A;  4C3I G;  1SAP A;  5E1F A;  4NP5 A;  2R92 B;  2XSC A;  3S1M B;  1I4P A;  1MD2 D;  5CBE E;  3I3C A;  4CHT B;  1O7Z A;  5EKK A;  1JE4 A;  3C46 A;  5ELD A;  1ROD A;  3I4M B;  1PDQ A;  5FO8 B;  3D4D A;  1BXT A;  1WD0 A;  3K0Y A;  5C4J B;  1YNN D;  3OWE B;  4FF2 A;  4ZUI A;  1I6V C;  1STY A;  3SXH A;  2XVS A;  5FLX E;  3OHX C;  4IUR A;  5JPN C;  2RKS A;  1SNP A;  5IOC A;  5JEA H;  2ICI A;  1R4P B;  4WFN 3;  3HOU B;  3AMU A;  3K58 A;  4FXK C;  3R2I A;  1A3U A;  4QCL A;  3L9A X;  4H0L C;  2EE1 A;  4PV1 C;  2JEB I;  1STE A;  3HRZ C;  2JSO A;  1AEX A;  2EYH A;  3MZ5 A;  1GJX A;  2PW7 A;  2QF7 A;  2HCI A;  4G7O C;  1SYC A;  1B44 D;  1TVX A;  1LO5 D;  4C3J G;  4G7H C;  4RA8 A;  3DHQ A;  4N9T A;  3IAY A;  3BVZ A;  3WOF A;  4WJW A;  1Y8O B;  3C1E A;  3H0G B;  1V1P A;  2G9H D;  5JOB A;  4EGV A;  1SNM A;  5IGC A;  2K5Q A;  1ENC A;  2FMC A;  2WAC A;  3GTJ B;  2AWN A;  1L0Y B;  3RMH A;  3C3L A;  1S5F D;  2KEE A;  4OGQ C;  1UUP A;  5I6W A;  3T13 A;  4B9X A;  5EBD A;  1HQR D;  2K33 A;  5JVH 3;  4Z9C B;  1MSH A;  4ABN A;  1BCP B;  2J4X A;  2FFK B;  3TBI B;  3DXJ C;  1ZXT A;  2E74 C;  1V1O A;  4H13 C;  1IW7 D;  2KVM A;  4LK1 C;  2WP8 J;  5C0X G;  5E4W C;  4HMI A;  2L5T A;  1OXS C;  1SE4 A;  1A2T A;  2KCC A;  4M1U B;  2F3W A;  3ZYY X;  2LKV A;  5JPM C;  2NBF A;  1Q1E A;  4EVO A;  4BA2 I;  1BCP C;  1ENF A;  1Y8P B;  4Y7N B;  2EOT A;  1H9J A;  1F2Z A;  4ZQ3 A;  5IOD A;  4WRD A;  4F7X A;  3I8Z A;  4BBR B;  1PTO C;  1JIC A;  1RF2 D;  3Q0A A;  3OMC A;  5CV6 A;  3M4O B;  2F0E A;  5KGU A;  1SFO B;  2C5C A;  3SK4 A;  2TMP A;  4F88 A;  3GTL B;  1KNA A;  2H1E A;  1I3Q B;  3UI2 A;  5FO9 B;  5FLX L;  4FO2 A;  5C3X A;  1A15 A;  1AN8 A;  3D6W A;  3CKI B;  1IYV A;  4C1N I;  3S1N B;  1TS2 A;  3DM1 A;  3A55 A;  5C0X H;  1Q3L A;  1F9Q A;  1H9M A;  3NBI A;  5A2Q E;  1LTG D;  2M00 A;  4C3H G;  1F2Y A;  4X3S A;  2YU9 B;  1VMC A;  1LTI D;  1STG A;  3W3A A;  1JCK B;  1GUS A;  1TWA B;  3GQB A;  3KF8 A;  4NKL A;  2L11 A;  3V96 A;  1WTV A;  2F0G A;  3DWA A;  1T5E A;  2F0U A;  3EJI A;  1AW7 A;  1ZYR C;  4E6I A;  1GUO A;  4TQU S;  2SDF A;  1YNJ D;  1BDO A;  4JBW A;  3A7A B;  2PO4 A;  4XQN A;  2PPB C;  3MXG A;  5JEA J;  1MGS A;  4ZUJ A;  5C4Z A;  1H9R A;  4XT3 B;  1X3P A;  3QIA A;  4DXG A;  1TWG B;  4XYQ A;  1LTB D;  3I4L A;  1TR5 A;  4L6T B;  3T16 A;  3NE5 B;  3NP8 A;  1TS3 A;  2NYZ D;  4HMJ A;  5KEE A;  3K59 A;  5K5P A;  4XDX A;  2JEA I;  3GTO B;  1QB5 D;  4H44 C;  1JOO A;  4FVM A;  4V0B A;  2XNA C;  3VR3 A;  2KUM A;  1HTL D;  5EGT A;  2RDF A;  1BOS A;  2A69 D;  2QCP X;  2PCF B;  3PIO 3;  4RKL A;  2B2V A;  1XX8 A;  2H4O A;  3GTK B;  4K6L A;  1AZP A;  4IUV A;  1JWM D;  4CJ1 B;  2IX1 A;  4HSV A;  4ME5 A;  3MHB A;  2D5D A;  1QIL A;  1VMP A;  5C4H A;  2WKD A;  3T56 B;  1HA6 A;  4ILW A;  4X3K A;  2VB3 X;  1SJE D;  2PMZ B;  2R61 A;  1CZG A;  2GA4 B;  1SMY C;  1TWC B;  3K6O A;  2N55 A;  2AUK A;  4L63 B;  2OT2 A;  3HZX A;  4CBV A;  2EPB A;  5BN4 A;  4KI0 A;  1ZKO A;  3PUV A;  1CZW A;  3HEJ A;  3ONA B;  2FMM A;  4HCS A;  3ERO A;  1WD1 A;  2BDO A;  1CQV A;  3VA5 A;  4FF3 A;  4FYD A;  1SDF A;  1LV9 A;  5IT9 E;  1RKN A;  2RSN A;  2B2Y C;  1DOM A;  1JC7 A;  1GUG A;  1GHK A;  3H09 A;  5FOB B;  2L1B A;  3QJY A;  3NQT A;  4IQZ A;  3ERQ A;  1ET9 A;  3BYT B;  5ELF A;  2NTS A;  5IGD A;  4K2L A;  3CRK C;  2A6H D;  2E75 C;  1FYC A;  1Q90 A;  3NK9 A;  2DNE A;  5IIF A;  3NTI A;  3KBG A;  5ELC A;  4U67 3;  2F0W A;  1PRT F;  1DYQ A;  2RVL A;  2I07 B;  5FKA C;  2EY5 A;  1MBY A;  5HGT A;  1PZI D;  4KJO A;  3IFT A;  1H9S B;  2EYM A;  3J7A F;  5K36 H;  5T1I A;  1EY9 A;  5CV8 A;  3NPP A;  1DXM A;  1RCV D;  3MFG A;  1LAB A;  1BBX C;  1IKM A;  2XWJ B;  3J80 E;  3D8G A;  3S2D B;  3VR4 A;  1Q12 A;  4KY7 A;  2PZU A;  2R6G A;  2L4N A;  1EEI D;  1KAB A;  1G29 1;  5J1Z A;  3T4A C;  2QIL A;  3M7G A;  2O5I C;  1SYF A;  1WTP A;  2TSS A;  4ODG A;  4XXE A;  3QB3 A;  2A68 D;  2F0M A;  1KDB A;  1PMR A;  4QF4 A;  3N52 A;  5IGF A;  3HKZ B;  3ITP A;  2K28 A;  2IT1 A;  1RTN A;  1SND A;  3JAM E;  1EY6 A;  2EJG C;  2RA4 A;  3DWQ A;  3TP5 A;  4KMU C;  1ML0 D;  2A5H A;  1BNZ A;  1Z7T A;  1FNV A;  5T1G A;  1GHJ A;  2R3Z A;  1CTM A;  2OF1 A;  3I91 A;  3HOY B;  1HCZ A;  1A6X A;  3E6Z X;  2IWH A;  5COR A;  4PMB A;  3I73 A;  1ET6 A;  2DY7 A;  1V43 A;  2KED A;  1Y1V B;  4GZY C;  1STH A;  3PUX A;  1O7L A;  1UEA B;  2ZXP A;  1B2T A;  2G9D A;  4QMG A;  4K2K A;  4KY6 A;  5LL6 X;  2CQA A;  4RCN A;  5ELE A;  4CKC A;  1PFM A;  1YNN C;  3TP7 A;  1F9S A;  4KKT A;  2EYJ A;  2WIN B;  4KTA A;  5C4X B;  3K7A B;  4MIU A;  2F0S A;  5TSS A;  4RGM A;  2WV6 D;  5EKL A;  4KV6 A;  1M8A A;  1HUM A;  1RHP A;  3RLF A;  4A3E B;  2PW5 A;  4PQX A;  5DM7 3;  1C8C A;  2AUJ D;  2CW0 D;  4FF4 A;  3FRP B;  1SJH D;  2F3V A;  3HOZ B;  1EU4 A;  5IGE A;  1TS4 A;  1PZK D;  2JP1 A;  2JA5 B;  3M3Y B;  1JQY D;  2XIW A;  2A74 C;  3RZO B;  3X3N A;  1WTR A;  3TP6 A;  2JE6 I;  1NAP A;  1EYD A;  4AYB B;  3W2D A;  3GTP B;  3H94 A;  2FIN B;  3BZD B;  1SNQ A;  3PUW A;  4RWS C;  2SEB D;  2VXW A;  1OXX K;  1AFP A;  2WAQ B;  4CJ0 B;  2NN6 G;  5CMD A;  1KAA A;  4YIJ A;  4KHV A;  2WII B;  5FK9 C;  1K8O A;  3OW7 A;  3U9S A;  3DEO A;  3FKI B;  4I7Z C;  1XYI A;  4A3J B;  3FVQ A;  3BS1 A;  3KLS X;  5A2Q L;  1KTK A;  1SEB D;  1PYW D;  3EFX D;  1X32 A;  4MN3 A;  1PTO F;  3HGB A;  3PUY A;  1EFI D;  4F87 A;  1RDP D;  3BDO A;  2B2W A;  1NR4 A;  4IFD H;  3OSO A;  4OHJ A;  2Q8I B;  1IYU A;  4A3D B;  4WOR A;  5D65 A;  5E3F A;  3NHH A;  4OL7 A;  4K6D A;  2YYZ A;  4DAV A;  5DEH A;  3RZD B;  5K36 G;  5LL6 S;  1IL8 A;  2MUY A;  4V19 0;  1JOR A;  2ZXR A;  3U9O A;  2F0V A;  3S2H B;  4K5W A;  3MTS A;  1DM0 B;  4C3H B;  1EY7 A;  2EYL A;  1SMY D;  1KDA A;  5CYU A;  2VUM B;  5M9O A;  1TY0 A;  3MWY W;  5EPK A;  1CK1 A;  4F8M A;  1B53 A;  2E2I B;  4NMZ A;  1RJT A;  1LLR D;  1D5X C;  1SYG A;  2K04 A;  1QCB D;  4EQN A;  1XTC D;  2IW3 A;  3SR1 A;  1IW7 C;  2NTT A;  4XQQ A;  4CGY B;  4I65 A;  2F0Q A;  2MJ8 A;  1TWH B;  5HUR A;  2B8G A;  2A68 C;  4IUP A;  1SYE A;  2OXP A;  1STA A;  1GUN A;  3TP8 A;  5ISR A;  2MPM A;  4C2M B;  1B1Z A;  4FXG C;  5LHY 1;  3D4R A;  4R8N A;  1E0B A;  4A93 B;  2F0T A;  1DJR D;  4DXF A;  3KUP A;  1LTA D;  4A3F B;  1Y1W B;  2JXM B;  1B9N A;  3SK6 A;  1D1I A;  2XRS D;  1CI3 M;  1XXG A;  4DNR B;  1II3 A;  1O7Y A;  4XYO A;  2QKI C;  2NVT B;  3URY A;  4DNT B;  5CGK A;  2F0P A;  1CQF A;  1BR9 A;  2PQE A;  3VR6 A;  4K5X A;  3MFY A;  4A3B B;  3MC0 B;  1PRT C;  2LS0 1;  4FXD A;  4IN3 A;  1PLF A;  1SE2 A;  5EKI A;  4R8I A;  1H9S A;  3M7N A;  3KLS A;  2M2L A;  5M3M B;  3SDZ A;  2HDM A;  4DGZ A;  3E0J A;  1BO0 A;  1HA5 A;  5F2D A;  1KDC A;  2Z4H A;  5G3L D;  1LT3 D;  3HG9 A;  4KD4 A;  4LAA A;  1PRT B;  5CBA E;  4HED A;  3SEB A;  4K8J A;  2E76 C;  1PFB A;  1KLG D;  1SNO A;  1Z6H A;  2HCC A;  5ELB A;  3M4Y A;  2IJ0 A;  3NQI A;  4KK7 A;  3CQZ B;  3L3O C;  1BUV T;  2EY6 A;  2NWG A;  2F0N A;  5A35 A;  2OEO A;  2F0K A;  2XN9 C;  5EPJ A;  3T51 B;  5M5Y B;  1NUC A;  2NUC A;  3IKJ A;  1L0X B;  1J9O A;  1ESR A;  2D62 A;  1ENA A;  5I4D A;  1QE6 A;  3MA2 B;  2F0L A;  1LAC A;  1GUW A;  3Q6S A;  3C2P A;  3L7Z C;  1MSG A;  4LMQ D;  4DN4 M;  5C6A A;  1FD7 D;  2L12 A;  2B2W C;  4A3M B;  4HN7 A;  2JYO A;  4KKU A;  4PNY A;  3TSS A;  4M8A A;  3WOE A;  1STN A;  2EXZ A;  3GV6 A;  4ZK9 B;  1ILQ A;  3S15 B;  2K32 A;  1E2Z A;  3VYR A;  1HHV A;  2K05 A;  4K8I A;  1OO9 B;  3KLR A;  2WB1 B;  1GUT A;  3TN2 A;  1TT2 A;  3K5O A;  4TRD A;  1F9P A;  1QNU A;  2E2H B;  5I6Y A;  1CM9 A;  2IX0 A;  1SXT A;  3OOC A;  1PZJ D;  3VR5 A;  3EA6 A;  1DCZ A;  2L0C A;  3VYU A;  4BBS B;  2B2T A;  5JVG 3;  1SNC A;  3NXW A;  1LTT D;  3R93 A;  3BDC A;  4KN7 C;  4ZRZ A;  2FHT A;  2IX3 A;  3OPO A;  2Z1C A;  4UDU C;  4KN4 C;  3Q24 A;  2KJX A;  1TKW B;  2BA1 A;  3NBH A;  4HSP A;  4Q0F A;  3GTM B;  4A3G B;  3SVM A;  2Z4I A;  1U4R A;  4TSS A;  2CVR A;  2K7V A;  4RAU C;  3AU7 A;  3R2T A;  1ESF A;  2R93 B;  1HFN A;  2LMC B;  1EIG A;  3FPU B;  1DD2 A;  2HDL A;  1A2U A;  2R7Z B;  2BCO A;  2J7Z A;  1EYC A;  5EBC A;  2K6A A;  1PXU A;  3FMC A;  3O13 A;  4DFA A;  1OXT A;  3NSW A;  1V1P B;  2F1M A;  2PZW A;  5KIX A;  2I46 A;  4XT1 B;  1F9R A;  3SK8 A;  2Q8T A;  4BA1 I;  2A6E C;  5NUC A;  2K03 A;  2ID0 A;  2EY1 A;  3X3M A;  1QWY A;  1SYB A;  3P1H A;  5KND A;  1EZ8 A;  3J81 E;  3K5M A;  4JK1 C;  5JJZ A;  5KNC A;  1D1K A;  3H91 A;  3MVV A;  3QOL A;  5JEA G;  1EWH A;  1GOZ A;  1I50 B;  1HQM C;  1EY0 A;  4DAP A;  3QG1 A;  3PUZ A;  4HCE A;  3EVQ A;  3NWT A;  1FNU A;  3VYT A;  4OIK A;  2LY7 A;  1FNW A;  1C48 A;  1LTS D;  2A69 C;  1KNE A;  3D4W A;  3TZD A;  3IFD A;  1D2B A;  2RDH A;  4HTH A;  5D14 A;  2K5D A;  2L55 A;  5CC4 A;  1CHP D;  1ILP A;  1VF5 C;  1JWU D;  2O4X A;  3K57 A;  2NN6 I;  3KK7 A;  3OIP A;  1EY8 A;  1T5X D;  5DM6 3;  4J6H A;  3TME A;  2B2T C;  4X3T A;  1HXY D;  1JOK A;  2V4D A;  5BN3 A;  5C0X I;  5C0X J;  3DWP A;  4CKE A;  5C3W A;  1DOL A;  2XRQ D;  3MXP A;  2EZV A;  3DMU A;  5IT9 L;  3QOJ A;  2N88 A;  3G7L A;  1LT5 D;  5J22 A;  3VYS A;  3S9W A;  1WVL A;  3HP3 A;  1I6H B;  1S5D D;  5DAU A;  2K5W A;  1D5M C;  2A6E D;  1TQO A;  1G91 A;  1PTO D;  3PMF A;  3V05 A;  4KJN A;  3NTH A;  3M85 A;  5CV4 A;  4H7B A;  3NWS A;  3GTQ B;  4KY5 A;  3BDL A;  1Q1B A;  3HOW B;  1OXV A;  3HOX B;  3QO2 A;  3MXU A;  1E2W A;  1WTW A;  4O42 A;  5COY A;  2A73 B;  1HPC A;  2KA7 A;  1EIH A;  3J7Y W;  4ULL A;  4DU9 A;  1EL0 A;  1ONL A;  3A8J E;  1EQV A;  2Q8R E;  1R9T B;  4N9P A;  3A56 A;  4RGT A;  5KNB A;  1G6Z A;  1HFG A;  1U4M A;  2SOB A;  4HAE A;  4RGN A;  1STB A;  5C3E B;  3J81 L;  4FF1 A;  2JA6 B;  3OIQ A;  3GD7 A;  3GV3 A;  1CHQ D;  1A3V A;  1AP0 A;  1I4Q A;  3EQL C;  3G6J B;  4A3I B;  2B39 A;  3I70 A;  1Z47 A;  3Q22 A;  1EQT A;  4C1N K;  2ZT9 C;  2FJ2 A;  5D3D A;  1J8I A;  1ZYR D;  3DUZ A;  4PMC A;  4ZLT F;  5FO7 B;  3VR2 A;  2SNM A;  1B3A A;  2EVB A;  1PTO H;  3I4N B;  1S5B D;  1QNK A;  2D9U A;  1C4Q A;  1IKL A;  2K1B A;  5C5L A;  4IFD I;  1B50 A;  2J0T D;  3P75 A;  4PMW A;  4NDX A;  4K5V A;  1BF4 A;  2F0O A;  4U68 A;  2DNC A;  2EDG A;  2QEJ C;  1I4G A;  2DN8 A;  3LX0 A;  3HOV B;  5M3F B;  3A54 A;  4BS9 A;  4C56 C;  2VB2 X;  3GTG B;  2RQX A;  2BE5 C;  2BDN A;  4DK1 A;  4QIW B;  2KCN A;  1SBB B;  4FNF A;  1OXU A;  4ZKB B;  4EQO A;  4Q5V A;  1UNS A;  2AWO A;  4MHE A;  2EYO A;  3J7A V;  1TY2 A;  1R4Q B;  5EJW A;  1HRJ A;  1CA5 A;  3H6M A;  5IGB A;  2MP1 A;  2X6G A;  3A8K E;  1TU2 B;  5CV7 A;  2AQ2 B;  1JOQ A;  1WCM B;  2BA0 A;  2C9O A;  3ND9 A;  3D6C A;  4LJZ C;  2VNU D;  3C1F A;  3LWE A;  5KRU A;  1RD9 D;  1G2T A;  1K83 B;  2K01 A;  1VDZ A;  3GP7 A;  2PZT A;  3KBX A;  5I9O A;  1TWF B;  3S16 B;  3D3R A;  4QUF A;  5EQ0 A;  2F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...