5EKLA

Crystal structure of staphylococcal nuclease variant delta+phs t62d/n100e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eklA00
1STBA 3DHQA 3SK6A 3EJIA 5KIXA 1F2ZA 1STHA 2F0SA 4IALA 1EZ8A 5EKKA 3TP5A 1EYDA 5M9OA 4K2KA 3NQTA 2PZUA 1EY4A 3D4WA 1EY8A 4OL7A 2F0QA 4TRDA 2EXZA 4WRDA 5DAUA 3RUZA 5I9OA 3LX0A 4K14A 1KDCA 4IUNA 2ENBA 1SYGA 3MHBA 4H7BA 4N9PA 4RKBA 3T13A 1TR5A 1SYCA 4EQOA 5C3WA 2RKSA 3EROA 3D8GA 5CC4A 2EYMA 2O4XA 2EYPA 1EYAA 5CV4A 5JOBA 1IHZA 1STGA 3P75A 3OMCA 1A3VA 1II3A 2F0JA 2PZTA 4RKLA 2LKVA 5CV6A 4B9XA 3MEHA 5F2DA 1EY0A 2NUCA 2F0FA 3MVVA 1KAAA 2PW5A 4K5WA 1SYFA 4KJOA 3MZ5A 3ITPA 2OEOA 3BDCA 4ODGA 4ZQ3A 2OXPA 5JAVA 1KABA 4MIUA 4WORA 1EY5A 4I65A 5EKLA 3SXHA 4NP5A 4YIJA 4DGZA 5C6AA 1F2MA 5CV5A 3QOJA 4KY7A 5C4ZA 2F0VA 1EY9A 2RDFA 4R8NA 1SNQA 2F3WA 5NUCA 1ENCA 3D6CA 5KRUA 2F0GA 1SNDA 4J6HA 1TQOA 4K8JA 4K8IA 3C1FA 4KD4A 5EGTA 2SNMA 4PMBA 2EY1A 4DU9A 4F7XA 2EYJA 3SK8A 3T16A 4NKLA 1U9RA 4KV6A 4PNYA 4DF7A 1EZ6A 4N9TA 4K5XA 3H6MA 4EQNA 4KY5A 3SK4A 5IOCA 4KTAA 1STAA 1JORA 5IODA 5CV8A 1ENAA 2F0UA 2M00A 3OMGA 2F0IA 5CV7A 2PZWA 5KYLA 3OWFA 5ISRA 4KY6A 1SNMA 3MXPA 1A3TA 3DMUA 4QB4A 4DFAA 5J39A 2F0TA 5IGBA 5KGUA 4ME5A 3ERQA 5IGCA 1EYCA 1SNOA 4KD3A 2F0PA 1RKNA 1JOKA 4QF4A 4E6IA 4KJNA 1A3UA 3HZXA 4J1MA 2EYHA 1NSNS 3BDLA 3PMFA 2KQ3A 2KHSA 5CV9A 4B9WA 2F0WA 1EQVA 3V2TA 3HEJA 1AEXA 5C5MA 5DEHA 5KEEA 5HGTA 2F0DA 1SYEA 3P1HA 5J22A 5IGEA 4K5VA 2F0KA 1A2UA 3OSOA 3EVQA 2SNSA 3QOLA 4K6DA 3SHLA 2PQEA 5IGDA 2PYKA 1EY6A 4KHVA 1KDAA 4LAAA 3VA5A 5IGGA 5C3XA 2F0MA 5K5PA 2F0OA 1STYA 2SOBA 2EYFA 4IZ8A 2F0EA 2EY6A 1EY7A 2EYOA 2QDBA 4HMJA 3TP7A 5HURA 3C1EA 1A2TA 4ZUJA 5I6YA 1SYDA 5I9PA 4EVOA 4QMGA 5E1FA 4ZUIA 5C5LA 4NMZA 1SYBA 2F0LA 3TMEA 5C4HA 2F0HA 4PMCA 2EY2A 3S9WA 1JOQA 3QB3A 3NUCA 4G57A 5CR3A 5IGFA 2HQEA 2F0NA 2PW7A 4F8MA 2WACA 5KYIA 5CGKA 5J1ZA 2RBMA 5E3FA 3SK5A 1STNA 1TT2A 3NHHA 5IIFA 3NP8A 4HMIA 4NDXA 1KDBA 2F3VA 3D4DA 4K2LA 3SR1A 3E5SA 2OF1A 4EQPA 1SNPA 3R3OA 3TP8A 2EY5A 3TP6A 2EYLA 4HTHA 4S3SA 3NK9A 1NUCA 3NXWA 4ID6A 5I6WA 3U9OA 1SNCA 1JOOA 1F2YA
chains in the Genus database with same CATH superfamily
3DHQA 3TZDA 3KOJA 4RMFA 2VUMH 2Z9HA 3K5NA 2R61A 5DAUA 4FF2A 3T1YL 4ULLA 4AH6A 1PTOF 3GD7A 3BU2A 3NE5B 3J7YW 4HR7B 2UUBQ 3OHXC 1GUWA 3H0GH 2OQ0A 4A3IG 1PYSB 1N32L 1Y1WH 3MWYW 4FF3A 1IKLA 3STBD 2RDGA 3MEHA 4B9XA 2R92G 1N33Q 1Q12A 3AMUA 3ITPA 2IX1A 1TY0A 5CV5A 4R4IA 4LMQD 3V96A 4PQXA 2IX0A 2LXJA 1A15A 1CI3M 4DV1Q 2GVAA 4IFDI 3NBHB 4DV4Q 1XYIA 3SK4A 1Q81C 3OTOL 4X3TA 1TS3A 2ZXOA 1HHVA 1KQSA 1LLRD 1VQIA 2E5LQ 5I2XA 2UXBQ 2BE5C 3PO3H 3K7AB 2RVLA 3JAML 3AB9A 2GA4B 1TWFH 2KHSA 4B9WA 1EQVA 2NN6G 2JA7B 4CDCC 5HGTA 2F0DA 3J80i 4C3JH 4YHHL 2D9UA 5JVH3 2CVRA 1KDAA 1PVOA 1SE4A 1HZ9A 3Q23A 3T1YQ 3Q8DA 1VQ9A 4IFDH 1B3QA 4NXMQ 1XWEA 1BNZA 1SYDA 2D62A 2B8FA 2BCOA 3GTPH 3ULPA 4I7AA 4P74A 4A3EG 1B1ZA 1RIPA 3PIPA 1N32Q 1L1OA 4ZYSA 2QKIC 1JOQA 2AUKA 5T1GA 3AEVA 2WACA 2HD3A 4QIWE 5CGKA 1M90C 1LT3D 2B2VA 3D6WA 4CDDC 4DR4Q 4X6AH 2B2TA 1Q46A 4RFBA 2Z0SA 4DK3C 5IYBH 2DJFC 1YBYA 4GN3B 5LMNL 3FMCA 3BVGA 5IP9H 1PH4A 2KUMA 1F9PA 4BY1B 4A3LH 1D1IA 4JI2L 5A2QE 4A3JH 3OTOQ 5I9OA 4L5QA 2EXZA 2EZVA 3LWUA 4K14A 2HIXA 1PV4A 3UI2A 4DR2L 4LF9L 2Z6KA 3SEBA 1CK1A 4CKEA 4JI8Q 1EU4A 2YTXA 4A3IB 3RLNA 3WOFA 2RHSB 3UDXA 4I65A 2R92B 3K59A 4YHHQ 3MA2B 3HOXG 4R8NA 5G3LD 1QCBD 5GAHC 3RLOA 3BZDB 3UDFA 1FR3A 5M5WB 2K5HA 1LT4D 4CDFC 3G71A 1D5MC 1QVFA 1DONA 1L0XB 5FLXL 4HJ5A 1S4ZA 2DY7A 3S1QH 2KHIA 3U50C 4AYBB 5IOCA 2NVQB 3I72A 3QWNA 3PF4A 1MI2A 1O7YA 1TWHB 1YITA 1T5XD 1LACA 1A3TA 5EAYA 5C0XJ 3ERQA 3GTKB 2OQKA 1D6EC 5IYCH 1S72A 5BR8L 3EA6A 2E74C 1QOHA 2KECA 3BJUA 4MN3A 1TXYA 3S1RH 1AEXA 1PMRA 1UE7A 4K5VA 5LMNQ 3HOUH 3OSOA 1BBWA 1HA5A 1A8VA 4KHVA 4JI2Q 1O78A 1BCPD 5FLMG 4DV7L 4OX9L 1NAPA 1PFBA 5EPJA 3GTLH 4DR2Q 1SBBB 2RCFA 4LF9Q 1SYBA 2ZJRA 4DKAC 4IJLA 5C4HA 2K5QA 5M5YB 1AE3A 3N52A 1U4PA 1QNUA 4LUZA 2X6LA 2JA9A 1GO3E 4DV5L 4A3FH 4LF5Q 2BH8A 1FNVA 1PXUA 3KJOA 2HCIA 4DR5L 2Q2IA 2BA1A 4UP7A 3NTHA 4JBMA 3H3VC 4R4TA 2VNUD 4XQNA 5COYA 4LFBL 1STHA 1TWAB 3KJPA 3NQTA 4X62L 3CCJA 1EU3A 2IPKD 1NMFA 4ME3A 3VYRA 4OO1G 3PSIA 5C3WA 4Y7NB 5DNFA 2K01A 5KNCA 5C3EG 1TIID 4GNXA 4GNXB 1CKOA 1SE8A 3ZJYC 5BR8Q 4C2MH 1II3A 4RG1A 3U58A 3TZUA 1H9MA 1KIXA 3MVVA 1DZ1A 3T53B 1HZAA 2JE6I 4ODGA 4DNTB 1NCVA 1TS2A 2AQ2B 3S16H 1V1PA 5EQ0A 4DXFA 4DV3L 2RDFA 3CC7A 4ABNA 4A3DG 4NPSA 3HOXB 1CT1D 1I50H 2EY1A 4DV7Q 1LTGD 4OX9Q 2C35B 4IJHA 2LY7A 2L11A 3H94A 4I7ZC 5M5XH 1PRTD 4C3HG 1SN8A 4CKBA 1FGBD 2PI2E 1PH8A 4C3IG 5CV8A 1SNMA 1VQ4A 1F9RA 4JYAQ 5IGBA 3FVQA 3I7FA 4DV5Q 2JQOA 2ZTEA 2NTSA 3KLSX 2DN8A 3OYYA 1QZHA 4QF4A 1Q82C 1S5CD 1UEBA 2JK8A 4U673 1IYJB 3RLFA 2OT2A 5KEEA 3H3VI 4K6LA 2FMMA 2X69A 3P1HA 4DV0L 1EOTA 1DOKA 3K8AA 2PYKA 2ZJPA 4X62Q 3K7UC 1EUJA 3CCUA 2F0OA 1VQLA 2JEBI 4IZ8A 3RD4A 4A3KB 1YHAA 3D3RA 4HMJA 1D8LA 1YJNA 2WAQE 2K6AA 1HA6A 1CSQA 1B8AA 5A35A 1Z7TA 2KCMA 2A6HC 2VUMG 1HQMC 2MO0A 1SXTA 3D0FA 2KJXA 2Z4HA 3H91A 5J1ZA 4OEMB 1TT2A 1EQTA 1TKWB 2A5HA 3F8TA 4KKTA 4LF8L 2F3VA 4DNIA 1Y1WG 4JI7L 3H3VH 4MTNA 2NWGA 4CBVA 1QUQB 1AW7A 1BCPB 3S1NH 1M1KC 1YJ9A 5EKKA 1H95A 1EYDA 3MTSA 3V05A 1EY8A 3IAYA 1JCKB 1NE3A 1YIJA 4RCOA 2ENBA 1SMXA 3J7AF 4YWKA 3M4OB 4PV1C 1JWUD 3I4OA 3I73A 1IHZA 1XNQL 1PH2A 5C3EB 3HG9A 1UAPA 2F0FA 5GADC 1SMYC 1CKNB 3OWEB 2A8VA 4FXDA 4DN4M 3LGJA 4OWTB 4DV0Q 1V8QA 3LNNA 3EQLC 4UP9A 1SNQA 1A6XA 1PFSA 3SE0A 3GV6A 3HS0C 3GTQB 2F0GA 4KKSA 3WWVA 1LTTD 4K8IA 3PIP3 4C56C 1GXDC 1Y14B 2B2WA 3J81i 3CCRA 4A3DB 4IPCA 4JBJA 1PYWD 4KY5A 5GQOA 2PQAA 4ZRZA 1EIFA 4C3HB 5IODA 1FL0A 4IUQA 1G6PA 1RL2A 1YVCA 4C3IB 1J9OA 4N8FA 3RZOH 3AQQA 3PUZA 4FXKC 3M7GA 5IGCA 5HY6A 1K8AC 1BO0A 4LF8Q 4PZ8A 1A62A 3BDLA 1EFWA 4DAYB 3QIAA 3CPWA 3VR4A 3K5OA 2A1AA 4GZYC 2SNSA 3QOLA 2IL8A 5IY0A 5K36G 2NVTB 1PRTB 1OXXK 2ES2A 4NW2A 2I0QA 1IBMQ 3A56A 2LS01 1Y8OB 2E2HB 5IYBG 4A75A 1L0YB 1ASYA 2I5MX 3QO2A 4A3LG 1XNQQ 1X65A 5IT9E 4LFCQ 2VUMB 3G48A 5EBCA 1LT6D 2CW0C 2MP1A 3ER0A 3SK5A 4GOPA 3HP3A 3CD6A 5AFWA 2QEXA 4CGYB 4CDEC 3H0GB 1VQJA 3JAMi 4ALPA 1Y1WB 5HGQA 4IOAA 2UXDL 2ICIA 3DWPA 1HQRD 2BE5D 3UE1A 1U4RA 3R2IA 4H0LC 4IALA 1Q7YC 1VQPA 1YHBA 4DUZL 1ET9A 4OL7A 2UU9L 3RUZA 5M3MH 4V0BA 1LTSD 2XN9C 3MHBA 4LJZC 5KNDA 4B08A 1WTHA 1HNXL 1D7QA 1HR0L 1IYVA 5JOBA 4A93H 1G51A 2XNAC 3TEHB 4QGUA 1CQFA 1YNJC 4BA2I 5D14A 1TS4A 2EJMA 4X3KA 4LF6L 1MSGA 1BKBA 1Y8PB 3SXHA 3HFZB 5FO8B 1ZEQX 5JEAH 5JJZA 3CPFA 4RHRA 2N3SA 5IYCG 5LMNW 3HRZC 3VR5A 3W5OA 4K8JA 3TN2A 2RHQB 3IL8A 2ZM6Q 3CC2A 4DF7A 2WB1E 5IT9c 4FF4A 1TWFB 1VQEA 3HOUG 5C4JH 1VQ6A 2Z4IA 1PZKD 4C3JB 5CYUA 1IBKQ 1BXTA 4WFN3 1CKMA 4ME5A 4ZKBB 1CTMA 1SE3A 1JWMD 4E6IA 2TMPA 1AH9A 3HZXA 1IL8A 2PNHA 4MHEA 3Q0AA 2NB0A 2F0WA 3GTPB 1NMGA 5C5MA 3GTOH 2UXDQ 1Q1BA 5E7NA 5JPMC 4A3FG 3AFQA 3R2TA 2C9OA 1SJED 2PQEA 4O0AA 5IP7H 1VQNA 4DUZQ 1STYA 3KBGA 4L6TB 1B50A 5FJ8G 3VYSA 1MJCA 1A2TA 1XMQL 4ZUIA 1HNXQ 2WB1G 1HR0Q 4B3RL 3NTIA 4ZCKA 5E4WC 2HQEA 4A3JB 2HQLA 1G2SA 2RBMA 2XGTA 5E3FA 4PG3A 2V1CC 1NR2A 1N36Q 5C0XG 2Q2TA 3DEOA 4BBSG 2WP8J 3FDTA 2JA8H 4JI3L 3S17H 4JI1L 1HTLD 2EJFC 3EJIA 1F2ZA 1SE2A 4IO9A 1PH6A 3GTGH 4ILWA 3F2BA 2DY8A 3W2DA 1CA5A 4XYOA 1NBWA 2DGYA 1U0LA 4H7BA 2MUYA 3L2PA 1VF7A 1STGA 4O2DA 4CHTB 2F52A 1Q90A 4OWXB 3S24A 3S1QB 3NWTA 3CCEA 1XPOA 2PMZE 4YIJA 4DK0A 2A74C 5FO9B 2Z1CA 2AKWB 3PUYA 1R9TH 1MIUA 1SNDA 1C7YA 4UP8A 2L12A 4IFDJ 3S2HH 1QG7A 1XMQQ 3CF5A 2B63H 2JJQA 2KCNA 3S1RB 5FO7B 4B3RQ 1VQCA 4H44C 4EGVA 1E3PA 2F0UA 3HOUB 1E24A 1Y1VH 3S14H 1XX8A 4OHJA 1ILPA 1OXUA 3PUWA 1XNRL 4GLXA 3T4AC 4AIMA 3PMFA 1EQQA 2TSSA 2J4XA 2SDFA 4G7ZC 4JI3Q 2K5VA 4AYBG 4JOIC 1A2UA 3NBHA 3UDIA 3CU7A 1LTLA 4A3FB 1ZYRC 4OONA 3TQYA 3P7JA 3L0OA 1V1OA 3RN2A 3EIVA 1K9MC 3ND8A 3KBXA 3A7AB 2AUJD 5C44H 4XXEA 1YI2A 5ELNA 3CCVA 2R93H 2H5XA 4K0KQ 2WB1B 2EE1A 1DGSA 3KLWA 3HOVH 2PW7A 1IBLL 3QG1A 5KYIA 1OTCA 1EOVA 4DAVA 1PLFA 4IUUA 1SR3A 4R1JA 4DA2A 2FINB 4UPAA 1LT5D 3HGBA 3S15H 1O7IA 3E0JA 4BBSB 2N78A 3NXWA 1LYLA 4C2MB 1GD7A 1EY6A 2A6EC 1UE5A 4LAAA 1HRJA 4LFAL 2E2JH 4K2KA 2O2LD 1VMPA 1EY4A 3D4WA 3S16B 4WRDA 1I3QH 3A74A 1DOLA 2RF4A 2SEBD 3J80E 5IYDH 3EROA 1I50B 4R4OA 1XNRQ 4IPGA 2LMCB 5M5XB 5CV6A 1GKHA 4XTCS 3ND9A 3NPPA 1I4GA 2AWOA 3MZ5A 1KABA 2F4IA 2LXKA 1EY5A 2XTIA 4A3MH 3K6OA 5C6AA 2QILA 4ZLTF 2F3WA 2A6HD 2RSNA 3VR3A 2E2IB 3TMEA 4KD4A 1TQOA 1FJGL 4F7XA 2OWOA 1O80A 4PMBA 4HEDA 1QWYA 2EOTA 2JP1A 1KNAA 4QUFA 3TDQA 1TY2A 4OIJA 1Z6HA 4DR6L 2B29A 1HNWL 2PO4A 1HNZL 1K8GA 1KXLA 1I6VC 2ZTCA 1JT8A 1IBLQ 4LF7L 2BOSA 3CHBD 3GTMH 4DR7L 4NB3A 1X9NA 3NSWA 2A68C 3U4ZA 2RSOA 1KAWA 3AYHB 3PUVA 1SYEA 2MO1A 5M3FG 4Q5VA 2CQOA 3GQBA 5FOBB 4LFAQ 1X3EA 3J80c 3HOWG 3I4MH 1UE6A 1WI5A 2JYOA 2PMZB 4HIMA 4HIDA 1CM9A 1SMYD 3I8ZA 3H09A 4NXNL 4C1NK 1L1OC 4EVOA 1D5XC 1LTBD 4JVZA 3K0XA 4TQUS 2L15A 2EQSA 1EEID 2Q8IB 3S1NB 3Q6SA 2I46A 2B2VC 3OIQA 1A63A 3RR5A 2F0NA 4C1NI 1B44D 1Q86C 3G6EA 5LHY1 3URYA 2PNRC 1PTOC 5EBDA 2B2TC 4JG2A 2B2UA 1K8OA 1KDBA 4A3KG 2C5CA 4APVA 3E9HA 4A93G 4LNQA 3BVMA 1FJGQ 1R4QB 1I4HA 4JI0L 5G3LF 1S40A 3O13A 3DUZA 5JEAG 2BDNA 3CRLC 2EXDA 2F3IA 4DR6Q 3LX0A 4HCEA 5I4DA 2Z6KC 1HNWQ 3KDFB 3T13A 3DM3A 4GN4B 3W1BA 1HNZQ 1Y69U 1ENFA 2O4XA 3A5ZB 1O7LA 1EYAA 4DR7Q 3RMHA 1GUOA 1UE1A 2B3GA 4A3BH 4KJOA 4B3TL 5JAVA 4GLVB 1F2MA 1NNXA 1BQQT 4OGQC 1D1KA 3M7NA 3PV0A 3D6CA 1WYDA 2FMCA 4G4KA 1YNNC 2IJ0A 1RHPA 3I56A 4L63B 1EFID 3N6RA 4H02A 1EZ6A 4LWCA 4K5XA 1BCPF 4A4IA 4L5SA 5JJIA 2E8GA 4ZKCB 5IP7G 2J0TD 1HR0W 2G9HD 2PZWA 1F77A 4OIKA 4DPGA 4F87A 1UNSA 3DMUA 1X3FA 3WDNA 4QJFA 3BDOA 3DLLA 3TSSA 3VR2A 1JOKA 2MFIA 4P2CB 2Z8LA 2EYHA 3ZYYX 4QIWB 3ULLA 3HOYH 1LUZA 5TSSA 4LW1A 2YTVA 1KLUD 4UDUC 2K5NA 1W3SA 3VA5A 3NELA 3J81j 2V4DA 2I5LX 3U4VA 5M3FB 3J7AV 1YNJD 2EYFA 2JA8G 1JQYD 2EY6A 4KMUC 3HOWB 3TP7A 1ONLA 4YCUA 3T51B 2VS1A 4P71A 4XT3B 5BN5A 4OWWB 4GLAC 2ID0A 1QVCA 2EVBA 2X6GA 2UUAL 4DR5Q 3F2CA 1PZID 2IW3A 2YYZA 1UUPA 3FKIH 1PTOH 3PUXA 1FVIA 1BBUA 4DK6C 1WTRA 2IY5B 4IUPA 4LFBQ 1EIHA 1E7ZA 1WTXA 4BY1H 2F03A 1Q8IA 1VMCA 4XQQA 4FF1A 4A93B 3OIPA 1SNCA 2KOLA 4UY8C 2F0SA 3GV3A 1QNKA 2F0QA 1X32A 1CFMA 1PRTF 2ZT9C 4CKCA 2LSSA 3DEPA 5A2QL 4P72A 2I07B 1K0RA 1O7ZA 2K1BA 3H0GG 2B8GA 2VZAA 4DV3Q 1G91A 3RNUA 3M4YA 2GVBA 2NN6I 1ICWA 1KAAA 2AWNA 4ZQ3A 1QUQA 1Y1VG 4MIUA 1HXYD 3TBIB 4DNRB 1GM5A 2AHOB 5NUCA 4HJ8A 1ENCA 3I3CA 4RH6A 3RZDH 3PIOA 1DOMA 3K81C 3C1FA 2XRQD 3E6ZX 2SNMA 3GP7A 3FPUB 1LM0A 4POGA 1U9RA 2PCFB 5CBAE 2WAQG 2K32A 2HCCA 2IHFA 2N88A 2J7ZA 1XMOL 3GTKH 5ELDA 2HT1A 1OXVA 2NVXH 3BYYB 2VY3A 1CKNA 3S1MB 4H13C 1W6KA 1JE5A 1C48A 1SEBD 1V43A 3PO3G 1CUKA 4JI4L 1P16A 4J1MA 2R93G 2NN6H 1H9SA 1H9SB 2M2LA 2K05A 2NYZD 3HOVG 2YV5A 2WKDA 4C3JG 1IW7C 1G8ZD 5BN4A 1VDZA 4WJ4A 5C3XA 4GS3A 3A0JA 1X6OA 4A3EH 4IFDG 1VF5C 2YTYA 2JA8B 5JJLA 1LTRD 2K50A 3KYHC 2E76C 3KUPA 2DNEA 3GDEA 4X64L 3S17B 1NY4A 3MC0B 3AFPA 4KI0A 4HJ9A 4JI7Q 4R4QA 4G7OC 3E0EA 4HIOA 3GTGB 4DAYA 5L37A 1RJTA 1ESFA 3J81E 5IYDG 4IUVA 3MXGA 4NDXA 5JEAJ 3SDZA 1WTQA 1S5BD 2XRSD 3SR1A 3TP8A 3J7ZC 1ICFB 2BH2A 3A8IE 2L9HA 2QDBA 1JOOA 3RN5A 2HDMA 5M9OA 5IP9G 1AN8A 3BYTB 5ELFA 1XMOQ 3D31A 1J6QA 4A3JG 3KK7A 2IWHA 4N9PA 1R9TB 1TWCH 1SYCA 2H4OA 5JVG3 3D8GA 2EYPA 1E2VA 2DNCA 1FNWA 1AZPA 3S2HB 1HFNA 1G2TA 1IXRA 2F0JA 1ZYRD 3FPPA 4JI4Q 2B63B 4A3GH 2VB3X 2PW5A 1LTAD 4J8QA 1ZKOA 2EPBA 3S2DH 1WCMH 1SDFA 2ZXPA 5FKAC 3M85A 1Y1VB 2L55A 3S14B 2HDLA 1VQMA 1SFOH 2JA6H 2B2WC 1LV9A 2Q2HA 3X3NA 2H1EA 5EGTA 4DXGA 4DV2L 4FO2A 4NKLA 1XTDA 1GUTA 2QEJC 3I91A 1Q1EA 2YU9H 3KF8A 3KF8B 1HTPA 2B2YA 4YWMA 1JJGA 1QILA 2NVYH 1STAA 1JC7A 4DK1A 3J81c 4BY7H 4YCVA 3DWQA 1A0IA 2WAQB 1TWGH 2M00A 2K04A 5JPNC 3KLSA 5ISRA 1NR4A 2K7VA 3VYUA 2A6ED 2IT1A 1ML0D 2QW7A 1SNOA 4HN7A 3R93A 3I4LA 4CJ1B 1L0WA 2L4NA 3V2TA 5C44B 3PO3B 1QVGA 1SROA 2R93B 1GJXA 2F0KA 1WVLA 3VR6A 1D2BA 2CQAA 5FLMH 1NJIC 5IWAL 4LF4L 3HOVB 4CJ0B 4FYDA 5KNBA 2F0EA 2R6GA 4IPDA 3NEMA 2FFKB 4RGTA 5CBEE 2UUCL 2VXWA 2RQXA 3S15B 1I6HH 1JB7A 1K83H 3CC4A 1YZ6A 3M3YH 1EEFD 3FP9A 4F88A 1MJEA 4QUCA 1B9NA 4G57A 2NZ1D 4LK1C 4GOPC 2E2JB 1V9PA 4RHSA 1PFMA 2PPBC 4YCWA 4A3CH 1I3QB 3VDYA 1STNA 3KFUA 3NHHA 2KHJA 3QJYA 3HOZH 1CHPD 2K5DA 1DXMA 4S3SA 2UU9Q 1T9HA 1WD1A 4A3BG 4DV2Q 1TU2B 3CXCA 3OPOA 1IYUA 5KIXA 3JAMc 2A68D 4TRDA 1XTCD 5C4XH 2K5WA 1TR5A 1C9OA 4LF6Q 3EBEA 1HUNA 1KRTA 4IQZA 4KN7C 2VQEL 2K4KA 5CV4A 5D65A 1A3VA 1Z9FA 2PZTA 4RKLA 5DM73 1YNXA 4IN3A 1IL2A 3TRZA 1GUNA 4CJ2C 4K5WA 2VQFL 1I5FA 2VB2X 2UUBL 2OXPA 4RCNA 3GTQH 3X3MA 3CCLA 4DGZA 2HIVA 1I4XA 3VYTA 3QOJA 1JJCB 4KY7A 5FLXE 1X56A 3FHWA 4MNOA 2KVMA 1KL9A 2MJ8A 3B6YA 5IWAQ 4A76A 1ET6A 4LF4Q 2G5DA 1N33L 3GTMB 5JJKA 2XWJB 1TVXA 2ASBA 3Q22A 3T16A 2CH4W 4C3HH 3GTJH 4X66L 3UDGA 1PTOD 2UUCQ 2R7ZH 3PCOB 4MZ9A 3TREA 2AQ3B 4KTAA 1K28A 2QDLA 1F9QA 2F4VL 2JA5H 4DV1L 1XPUA 1YHQA 3MXPA 4LUVA 3I4MB 3I4NH 3AU7A 5GAGC 1XJVA 4BBRH 1EQRA 4L8JA 5D3DA 1VQ7A 1B9MA 1SSOA 3MAQA 3BG3A 2Q2UA 1WFQA 1RTNA 1OO9B 2UXBL 3FKIG 4PMWA 1J8IA 1B7YB 2E2HH 1JE4A 2MHVA 1QJOA 1F2LA 2SOBA 1PH7A 2Z6BA 3K80C 1JICA 2WINB 3CQZH 3W1GA 5I6YA 1JB3A 5E1FA 2XIWA 3KF6A 3KF6B 2RDHA 3CW2C 1MGSA 2VQEQ 3A55A 3BS1A 1YNND 5FLXc 3GTLB 1NTGA 4IPHA 4NXML 3PIO3 5CR3A 2VQFQ 4POFA 4HIKA 1BBXC 4GN5A 4JI1Q 1FD7D 3A7LA 5IIFA 4DAMA 1AE2A 4HMIA 1VQGA 3D4DA 1ZXTA 3T56B 5IT9L 4X65L 4YY3L 2QA4A 2FJ2A 1SNPA 3R3OA 5BN3A 4G7HC 1E0BA 3TP6A 2EYLA 4O1NA 3R8BA 4TVAB 4X66Q 1I4QA 4A3BB 2FHTA 5EPKA 4DR4L 1K8MA 1P8LA 2P5ZX 4O42A 2F4VQ 4HSVA 2D0OA 1SYGA 3ERSX 2OTJA 4RGMA 5ELBA 2KCTA 5CMDA 2A69C 3OMCA 3CRKC 2MQHA 2N55A 3A54A 3IRBA 4X3UA 1M4VA 2K03A 2CCZA 4XT1B 3C3LA 3PQIA 2F1MA 4JI8L 3SVMA 5LMUL 1DYQA 2KEDA 2QCPX 4BA1I 1YJWA 2RA4A 4HCSA 2EYJA 1U5KA 1U4LA 3SK8A 1PZJD 4KN4C 3HOYB 1VCIA 2R7FA 4DR1L 2R7DA 2A73B 4P75A 3HKZE 5CV7A 1KLGD 1I4RA 3MEFA 2L1BA 4UAIA 3G4SA 4HJAA 2WKCA 1L1OB 1PYBA 1A3UA 4KLKA 4X65Q 4YY3Q 5CV9A 1EIYB 4RGOS 4M8AA 3HEJA 1FYCA 4V190 3CCSA 1B3AA 1OXSC 5J22A 2N8NA 4HAEA 5K36H 4BXXH 1XXGA 3SHLA 4RWSC 2JN4A 3FKIB 1PTOB 4M1UB 2G9DA 4FVMA 1VQAA 4XQJA 1MD2D 3PO2H 4KK7A 1LTID 5C5LA 3MXUA 4IUTA 4NMZA 1WOCA 1X3PA 2MNAA 4DV6L 1DD2A 2GN5A 2EY2A 4KHPL 3HKZG 3NUCA 4ZAIA 4JV5L 5IGFA 4Q0FA 2K28A 2CH4A 2Y0SE 3OOCA 5LMUQ 1FGUA 4DR3L 1IKMA 1U4MA 1I4PA 1PH1A 4PZ6A 5IE8A 4A3GG 2L5TA 3PGZA 2LFNA 3SGIA 5ELCA 5I6WA 4LF5L 1STBA 2CHBD 1CSPA 4IURA 5LL6S 4MTKA 3ULJA 1WCMG 2VL6A 1EYGA 4DR1Q 5D3IB 2JA6G 2HHHL 1RDPD 2QF7A 1JMCA 2ZXRA 4RKBA 5M3MG 1EWCA 4FXGC 3RZDB 2KBNA 3A8JE 2B39A 2EJGC 1SAPA 1IW7D 4FDBA 4XIGS 2L0CA 2E75C 4JI6L 1PA6A 4BY7G 3M4PA 1EY0A 1B4OA 2JXMB 1B53A 2OEOA 1EWIA 1RF2D 1X54A 2NVXB 5C4ZA 2Y0SG 2R3ZA 1KC8C 1CZGA 3G7LA 4Y52H 1HCZA 2ICEC 3KDFA 4BS9A 1VQOA 1KD1C 1PDQA 3CCMA 3CKIB 4N9TA 3I55A 4LF7Q 4EQNA 4DV6Q 1F9SA 2NBFA 4GKKL 5FK9C 1ENAA 4RAUC 5KYLA 4KHPQ 1X55A 3TS2A 4JV5Q 2O5IC 4HSPA 1R4PB 5KGUA 5C0XI 4KD3A 2F0PA 3VA7A 3G6JB 4DR3Q 1HUMA 2MGSA 4A3EB 3RZOB 1ASZA 3KLRA 1HZCA 4JYAL 1SRUA 3TS0A 4NXNQ 4UHVA 2CW0D 4A3CG 4K6DA 1N8RC 1HH2P 2F0MA 5FJ8H 1WTPA 3HOZG 3STBC 4RGNA 2HHHQ 2E2DC 3UE0A 3K7AH 1KRSA 4ZUJA 2JSOA 5LL6X 3Q24A 5AJ3L 2JA7H 1SLJA 3CCQA 4PMCA 4YWLA 4JI6Q 1X3QA 3QB3A 1G291 4X3SA 1EWHA 5H1SE 2B2UC 4JI0Q 3HKZB 5C0XH 5C4XG 4KHZA 4BBSH 2K33A 2OCEA 1TWCB 1VQ5A 2NZOA 4XDXA 1GOZA 1F2YA 1V1PB 1HJPA 4A3GB 1PH3A 4U68A 3LWEA 4WJWA 3S2DB 3L3OC 1HFGA 1WCMB 1PH9A 4GKKQ 1STEA 4IUNA 1I94L 1SFOB 2JA6B 4B3TQ 1IZ6A 1W6JA 2EYMA 4J15A 3NTKA 4AQYL 2R7ZG 5M3MB 3P75A 1XPRA 5CORA 2LKVA 2YU9B 2JA5G 3J80L 4DFAA 3H15A 2NVYB 3BDCA 4TKOB 2RCNA 2E2IH 4BY7B 1V1QA 4NP5A 1TWGB 3NWSA 1H9RA 1K3BC 3I4NG 1EY9A 3K0YA 4BBRG 3A5UA 3SK6A 3L7ZC 1VQKA 2K52A 1N9WA 4WJ3M 2Y0SB 4DU9A 3MXNA 3MXNB 1J5EL 2QGQA 4GNXC 1QE6A 1JJ2A 2ZTDA 3GO5A 4A3IH 4JPBW 5AJ3Q 2B63G 2UXCL 4OXPA 1JORA 3D4RA 2R92H 4QCLA 3OMGA 2F0IA 4FP5D 2KENA 3FEWX 4IOCA 1MHWC 5EPLA 5C4JB 1LO5D 5M5WH 4KKUA 3DWAA 2KCCA 1RKNA 4KJNA 1H9JA 1S5ED 2CWPA 4LUOA 1NSNS 1I6HB 1CA6A 1OXTA 5DEHA 3M9BA 2NVQH 1T5EA 1K83B 3M3YB 1AP0A 1C4QA 1TWHH 2D5DA 4R8IA 3GTOB 5IGGA 5K5PA 3F1ZA 2UUAQ 2EYOA 5HURA 3C1EA 5EKIA 1I94Q 1S5DD 3HOZB 5I9PA 4RA8A 4DAPA 3C46A 1BOSA 3OW2A 1JR0D 2MPMA 4AQYQ 4L5TA 1ILQA 4EX5A 1MBYA 4B3ML 5C44G 1IBML 3F2UA 3NQIA 1WTVA 3T1HL 1S5FD 1DCZA 3NP8A 1K73C 5C4XB 1GVPA 3E5SA 2WFWA 3NBIA 3K58A 4LFCL 4HJ7A 1LABA 2A19A 3NK9A 1J5EQ 3U9OA 5M5YH 4K2LA 1BUVT 2EDGA 2EIFA 2K75A 1EZ8A 3TP5A 1BVSA 1HPCA 1KTKA 1K3RA 2UXCQ 2Q8RE 1KDCA 4JBWA 4FNFA 2D2CC 1HZBA 2KEEA 5CC4A 1M8AA 4L5RC 2PQAB 3K5MA 4JBKA 1E2WA 3GTJB 5E4XA 4ZK9B 1CQVA 3E3XA 2Q8TA 2R7ZB 2NUCA 1WTOA 1W2BA 1BCPC 1E1OA 1QB5D 1RCVD 1TWAH 2ALYB 4WORA 5EKLA 3MFYA 2JA5B 1TS5A 1VQBA 4A3MG 1KHIA 2F0VA 4Y7NH 5KRUA 1FNUA 3I4NB 4J6HA 1B2TA 2AQ1B 2NTTA 1GHKA 1Q8KA 4JC0A 4BBRB 2NZHA 2PI2A 1G6ZA 1Y8NB 3QR8A 4DUYL 2JEAI 4Z9CB 4BXXG 4EQ5A 4B3MQ 1DM0B 2ZM6L 3L9AX 3OWFA 2OTLA 4QB4A 1WTWA 3PO2G 3T1HQ 3HOXH 1VQDA 2CKZB 3CQZB 4PZ7A 2ATWA 2FXQA 2DJGC 2WV6D 2KQ3A 1IBKL 5I2YA 3CAMA 5DLQE 1BR9A 5M3FH 2I5HA 5IGEA 4GOPB 3HOWH 3U9SA 3EVQA 1EL0A 2A69D 1QZGA 2K14A 4X64Q 3I4MG 1N34L 3I70A 3CMAA 5T1IA 4OELB 3A8KE 5DM63 3JAME 1Z47A 2KA7A 2F0LA 1SJHD 1RD9D 3E9IA 3S9WA 2IHEA 2WIIB 3IKJA 4JI5L 1H9KA 3J7A5 1PRTC 4A3KH 4QY7A 4N8X1 3NENA 2OF1A 4EQPA 1YEZA 2IX3A 3CMEA 2EY5A 4OO1I 3PF5A 1NUCA 1JWSD 3DM1A 3W3AA 3JC66 4JCVE 2XWBB 1K0SA 1N36L 4B3SL 3BZCA 3CP0A 2AMCB 5GROA 4DUYQ 2PZUA 3OW7A 1BF4A 1DJRD 1MKHA 2HUGA 4EQOA 1C0AA 2RKSA 4GKJL 3ICEA 1RODA 3EFXD 1PHJA 4P73A 5F2DA 1SYFA 4JK1C 3HKSA 5ELEA 1RTOA 2O5JC 3FRPB 3BZKA 3K5LA 4QQBX 1GUGA 1Q3LA 3M4OH 4OO1H 4A3MB 2B2YC 1N34Q 1WJJA 5C3EH 4KV6A 4PNYA 5J3BA 1CZWA 3F2DA 2BDOA 3H6MA 5ELOA 3S1MH 2CFMA 1E22A 4R9WA 1L2FA 2XVSA 4KY6A 4JI5Q 1PFNA 3M4QA 1AFPA 5J39A 2F0TA 5GAEC 1GUSA 1EYCA 1WD0A 1KNEA 2JA7G 3PO2B 4A3DH 3ONAB 3IFDA 1B70B 3P20A 1VQ8A 1VQHA 5EJWA 2XSCA 3HOYG 3C2PA 4JW0A 1VQFA 2BA0A 2DUDA 2VW9A 2ZJQA 4B3SQ 4C3IH 5IGDA 1S3OA 1C8CA 1CHQD 4JOIA 4QL5A 3I2ZA 1EY7A 1PH5A 4QMGA 1ESRA 4DV4L 1BDOA 1D5ZC 4GKJQ 2F0HA 3K57A 1MSHA 1X3GA 1UWVA 4TSSA 1EIGA 1GHJA 3WOEA 2NVTH 4F8MA 2N49A 3BVZA 4R4CA 2E5LL 3MFGA 3I90A 4BWGB 1E2ZA 1E1TA 2M9VA 4K0KL 3EN2A 3DXJC 1VS0A 3IFTA 1UEAB 1AZQA 4HTHA 2CWAA 3J81L 4ID6A 4AYBE 4BY1G 4XYQA 2D0PA
chains in the Genus database with same CATH topology
3DHQA 3TZDA 3K5NA 2R61A 5DAUA 4FF2A 4ULLA 1PTOF 3GD7A 3NE5B 3J7YW 4HR7B 3OHXC 1GUWA 4FF3A 3MWYW 1IKLA 2RDGA 3MEHA 4B9XA 3AMUA 1Q12A 3ITPA 2IX1A 1TY0A 5CV5A 4LMQD 3V96A 4PQXA 2IX0A 1A15A 1CI3M 4IFDI 1XYIA 3SK4A 4X3TA 1TS3A 2ZXOA 1HHVA 1LLRD 5I2XA 2BE5C 3K7AB 2RVLA 3JAML 3AB9A 2GA4B 2KHSA 4B9WA 1EQVA 2NN6G 2JA7B 5HGTA 2F0DA 2D9UA 5JVH3 2CVRA 1KDAA 1SE4A 3Q23A 4IFDH 1XWEA 1BNZA 1SYDA 2D62A 2B8FA 2BCOA 1B1ZA 4ZYSA 2QKIC 1JOQA 2AUKA 5T1GA 2WACA 5CGKA 1LT3D 2B2VA 3D6WA 2B2TA 4RFBA 3FMCA 3BVGA 2KUMA 1F9PA 4BY1B 1D1IA 5A2QE 5I9OA 2EXZA 2EZVA 3LWUA 4K14A 3UI2A 3SEBA 1CK1A 4CKEA 1EU4A 4A3IB 3WOFA 4I65A 2R92B 3K59A 3MA2B 4R8NA 5G3LD 1QCBD 3BZDB 5M5WB 1FR3A 1LT4D 1D5MC 1DONA 1L0XB 5FLXL 1S4ZA 2DY7A 4AYBB 5IOCA 2NVQB 3I72A 3QWNA 1MI2A 1O7YA 1TWHB 1T5XD 1LACA 1A3TA 5C0XJ 3ERQA 3GTKB 1D6EC 3EA6A 2E74C 1QOHA 2KECA 4MN3A 1AEXA 1PMRA 4K5VA 3OSOA 1HA5A 4KHVA 1O78A 1BCPD 1NAPA 1PFBA 5EPJA 1SBBB 1SYBA 5C4HA 2K5QA 5M5YB 3N52A 1U4PA 1QNUA 2X6LA 1PXUA 1FNVA 2HCIA 2BA1A 3NTHA 3H3VC 2VNUD 4XQNA 5COYA 1STHA 1TWAB 3NQTA 1EU3A 2IPKD 3VYRA 4OO1G 5C3WA 4Y7NB 5DNFA 2K01A 5KNCA 1TIID 1II3A 3TZUA 1H9MA 3MVVA 1DZ1A 3T53B 2JE6I 4ODGA 4DNTB 1NCVA 1TS2A 2AQ2B 1V1PA 5EQ0A 4DXFA 2RDFA 4ABNA 3HOXB 1CT1D 2EY1A 1LTGD 2LY7A 2L11A 3H94A 4I7ZC 1PRTD 4C3HG 4CKBA 1FGBD 4C3IG 5CV8A 1SNMA 1F9RA 5IGBA 3FVQA 2NTSA 3KLSX 2DN8A 4QF4A 1S5CD 4U673 3RLFA 2OT2A 5KEEA 4K6LA 2FMMA 2X69A 3P1HA 1EOTA 1DOKA 2PYKA 2F0OA 2JEBI 4IZ8A 3RD4A 4A3KB 3D3RA 4HMJA 2K6AA 1HA6A 5A35A 1Z7TA 2A6HC 1HQMC 1SXTA 2KJXA 2Z4HA 3H91A 5J1ZA 1TT2A 1EQTA 1TKWB 2A5HA 4KKTA 2F3VA 2NWGA 4CBVA 1AW7A 1BCPB 5EKKA 1EYDA 3MTSA 3V05A 1EY8A 3IAYA 1JCKB 4RCOA 2ENBA 3J7AF 3M4OB 4PV1C 1JWUD 3I73A 1IHZA 5C3EB 3HG9A 1UAPA 2F0FA 1SMYC 3OWEB 4FXDA 4DN4M 1V8QA 3LNNA 3EQLC 1SNQA 1A6XA 3SE0A 3GV6A 3HS0C 3GTQB 2F0GA 4KKSA 3PIP3 1LTTD 4K8IA 4C56C 1GXDC 2B2WA 4A3DB 1PYWD 4KY5A 4ZRZA 4C3HB 5IODA 4IUQA 4C3IB 1J9OA 3PUZA 4FXKC 3M7GA 5IGCA 1BO0A 3BDLA 3QIAA 3VR4A 3K5OA 4GZYC 2SNSA 3QOLA 2IL8A 5K36G 2NVTB 1PRTB 1OXXK 4NW2A 3A56A 2LS01 1Y8OB 2E2HB 1L0YB 3QO2A 5IT9E 2VUMB 5EBCA 1LT6D 2CW0C 2MP1A 3SK5A 3HP3A 5AFWA 4CGYB 3H0GB 1Y1WB 2ICIA 3DWPA 1HQRD 2BE5D 1U4RA 3R2IA 4H0LC 4IALA 1ET9A 4OL7A 3RUZA 4V0BA 1LTSD 2XN9C 3MHBA 4LJZC 5KNDA 4B08A 1IYVA 5JOBA 2XNAC 1CQFA 1YNJC 4BA2I 5D14A 1TS4A 2EJMA 4X3KA 1MSGA 1Y8PB 3SXHA 5FO8B 1ZEQX 5JEAH 5JJZA 4RHRA 3HRZC 3VR5A 4K8JA 3TN2A 3IL8A 4DF7A 4FF4A 1TWFB 2Z4IA 1PZKD 4C3JB 5CYUA 1BXTA 4WFN3 4ME5A 4ZKBB 1CTMA 1SE3A 1JWMD 4E6IA 2TMPA 3HZXA 1IL8A 4MHEA 3Q0AA 2NB0A 2F0WA 3GTPB 5C5MA 1Q1BA 5JPMC 3R2TA 2C9OA 1SJED 2PQEA 1STYA 3KBGA 4L6TB 1B50A 3VYSA 1A2TA 4ZUIA 3NTIA 5E4WC 2HQEA 4A3JB 1G2SA 2RBMA 5E3FA 1NR2A 5C0XG 3DEOA 2WP8J 3FDTA 1HTLD 2EJFC 3EJIA 1F2ZA 1SE2A 4ILWA 2DY8A 3W2DA 1CA5A 4XYOA 4H7BA 2MUYA 1VF7A 1STGA 4CHTB 1Q90A 3S1QB 3NWTA 4YIJA 4DK0A 2A74C 5FO9B 2Z1CA 3PUYA 1SNDA 2L12A 4IFDJ 1QG7A 2KCNA 3S1RB 5FO7B 4H44C 4EGVA 2F0UA 3HOUB 1ILPA 1XX8A 4OHJA 1OXUA 3PUWA 3T4AC 3PMFA 2TSSA 2J4XA 2SDFA 4G7ZC 1A2UA 3NBHA 3CU7A 4A3FB 1ZYRC 3P7JA 1V1OA 3ND8A 3KBXA 3A7AB 2AUJD 4XXEA 2WB1B 2EE1A 2PW7A 3QG1A 5KYIA 4DAVA 1PLFA 4IUUA 4DA2A 2FINB 1LT5D 3HGBA 3E0JA 4BBSB 3NXWA 4C2MB 1EY6A 2A6EC 4LAAA 1HRJA 4K2KA 2O2LD 1VMPA 1EY4A 3D4WA 3S16B 4WRDA 1DOLA 2SEBD 3J80E 3EROA 1I50B 2LMCB 5M5XB 5CV6A 4XTCS 3ND9A 3NPPA 1I4GA 2AWOA 3MZ5A 1KABA 2F4IA 1EY5A 3K6OA 5C6AA 2QILA 4ZLTF 2F3WA 2A6HD 2RSNA 3VR3A 2E2IB 3TMEA 4KD4A 1TQOA 4F7XA 1O80A 4PMBA 4HEDA 1QWYA 2EOTA 2JP1A 1KNAA 4QUFA 3TDQA 1TY2A 4OIJA 1Z6HA 2PO4A 1I6VC 2BOSA 3CHBD 3NSWA 2A68C 2RSOA 3PUVA 1SYEA 4Q5VA 3GQBA 5FOBB 2JYOA 2PMZB 1CM9A 1SMYD 3I8ZA 3H09A 4C1NK 4EVOA 1D5XC 1LTBD 4TQUS 1EEID 2Q8IB 3S1NB 3Q6SA 2I46A 2B2VC 3OIQA 4C1NI 2F0NA 1B44D 5LHY1 3URYA 2PNRC 1PTOC 5EBDA 2B2TC 1K8OA 2B2UA 1KDBA 2C5CA 3BVMA 1R4QB 1I4HA 5G3LF 3O13A 3DUZA 5JEAG 2BDNA 3CRLC 3LX0A 4HCEA 5I4DA 3T13A 1Y69U 1ENFA 2O4XA 1O7LA 1EYAA 3RMHA 1GUOA 4KJOA 5JAVA 1F2MA 1BQQT 4OGQC 1D1KA 3M7NA 3PV0A 3D6CA 2FMCA 4G4KA 1YNNC 2IJ0A 1RHPA 4L63B 1EFID 3N6RA 1EZ6A 4K5XA 1BCPF 4ZKCB 2J0TD 2G9HD 2PZWA 1F77A 4OIKA 4F87A 1UNSA 3DMUA 3WDNA 3BDOA 3TSSA 3VR2A 1JOKA 4P2CB 2Z8LA 2EYHA 3ZYYX 4QIWB 5TSSA 1KLUD 4UDUC 3VA5A 5M3FB 2V4DA 3J7AV 1YNJD 2EYFA 1JQYD 2EY6A 4KMUC 3HOWB 3TP7A 1ONLA 3T51B 4XT3B 5BN5A 2ID0A 2EVBA 2X6GA 1PZID 2IW3A 2YYZA 1UUPA 1PTOH 3PUXA 1WTRA 4IUPA 1EIHA 1WTXA 2F03A 1Q8IA 1VMCA 4XQQA 4FF1A 4A93B 3OIPA 1SNCA 2KOLA 2F0SA 3GV3A 1QNKA 2F0QA 1X32A 1CFMA 1PRTF 2ZT9C 4CKCA 3DEPA 5A2QL 2I07B 1O7ZA 2K1BA 2B8GA 1G91A 3M4YA 2NN6I 1ICWA 1KAAA 2AWNA 4ZQ3A 4MIUA 1HXYD 3TBIB 4DNRB 5NUCA 1ENCA 3I3CA 4RH6A 1DOMA 3C1FA 2XRQD 3E6ZX 2SNMA 3GP7A 3FPUB 1U9RA 2PCFB 5CBAE 2K32A 2HCCA 2N88A 2J7ZA 5ELDA 1OXVA 3BYYB 3S1MB 4H13C 1W6KA 1C48A 1SEBD 1V43A 4J1MA 2NN6H 1H9SA 1H9SB 2M2LA 2K05A 2NYZD 2WKDA 4C3JG 1IW7C 1G8ZD 5BN4A 1VDZA 5C3XA 4IFDG 1VF5C 2JA8B 1LTRD 2E76C 3KUPA 2DNEA 3S17B 3MC0B 4KI0A 4G7OC 3GTGB 4DAYA 1RJTA 1ESFA 3J81E 4IUVA 3MXGA 4NDXA 5JEAJ 3SDZA 1WTQA 1S5BD 2XRSD 3SR1A 3TP8A 3A8IE 2L9HA 2QDBA 1JOOA 2HDMA 5M9OA 1AN8A 3BYTB 5ELFA 3D31A 3KK7A 2IWHA 4N9PA 1R9TB 1SYCA 2H4OA 5JVG3 3D8GA 2EYPA 1E2VA 2DNCA 1FNWA 1AZPA 3S2HB 1HFNA 1G2TA 2F0JA 1ZYRD 3FPPA 2B63B 2VB3X 2PW5A 1LTAD 4J8QA 1ZKOA 2EPBA 1SDFA 2ZXPA 5FKAC 3M85A 1Y1VB 2L55A 3S14B 2HDLA 2B2WC 1LV9A 3X3NA 2H1EA 5EGTA 4DXGA 4FO2A 4NKLA 1GUTA 2QEJC 3I91A 1Q1EA 3KF8A 1HTPA 2B2YA 1QILA 1STAA 1JC7A 4DK1A 3DWQA 2WAQB 2M00A 2K04A 5JPNC 3KLSA 5ISRA 1NR4A 2K7VA 3VYUA 2A6ED 2IT1A 1ML0D 1SNOA 4HN7A 3R93A 3I4LA 4CJ1B 2L4NA 3V2TA 5C44B 3PO3B 2R93B 1GJXA 2F0KA 1WVLA 3VR6A 1D2BA 2CQAA 3HOVB 4CJ0B 4FYDA 5KNBA 2F0EA 2R6GA 2FFKB 4RGTA 5CBEE 2VXWA 2RQXA 3S15B 1EEFD 4F88A 4QUCA 1B9NA 4G57A 2NZ1D 4LK1C 2E2JB 4RHSA 1PFMA 2PPBC 1I3QB 1STNA 3NHHA 3QJYA 1CHPD 2K5DA 1DXMA 4S3SA 1WD1A 1TU2B 3OPOA 1IYUA 5KIXA 2A68D 4TRDA 1XTCD 2K5WA 1TR5A 1HUNA 4IQZA 4KN7C 5CV4A 5D65A 1A3VA 2PZTA 5DM73 4RKLA 4IN3A 1GUNA 4CJ2C 4K5WA 2VB2X 2OXPA 4RCNA 3X3MA 4DGZA 1I4XA 3VYTA 3QOJA 4KY7A 5FLXE 2KVMA 2MJ8A 1ET6A 3GTMB 2XWJB 1TVXA 3Q22A 3T16A 1PTOD 2AQ3B 4KTAA 1F9QA 3MXPA 3I4MB 3AU7A 4L8JA 5D3DA 1B9MA 1SSOA 3MAQA 3BG3A 1RTNA 1OO9B 4PMWA 1J8IA 1JE4A 2MHVA 1QJOA 1F2LA 2SOBA 1JICA 2WINB 5I6YA 1JB3A 5E1FA 2XIWA 2RDHA 1MGSA 3A55A 3BS1A 1YNND 3GTLB 3PIO3 5CR3A 1BBXC 1FD7D 3A7LA 5IIFA 4HMIA 3D4DA 1ZXTA 3T56B 5IT9L 2FJ2A 5BN3A 1SNPA 3R3OA 4G7HC 1E0BA 3TP6A 2EYLA 4O1NA 3R8BA 1I4QA 4A3BB 2FHTA 5EPKA 1K8MA 4O42A 4HSVA 1SYGA 4RGMA 5ELBA 5CMDA 2A69C 3OMCA 3CRKC 2N55A 3A54A 4X3UA 1M4VA 2K03A 4XT1B 3C3LA 2F1MA 3SVMA 1DYQA 2KEDA 2QCPX 4BA1I 2RA4A 4HCSA 2EYJA 3SK8A 1U4LA 1PZJD 4KN4C 3HOYB 1VCIA 2A73B 5CV7A 1KLGD 1I4RA 2L1BA 4UAIA 2WKCA 1A3UA 5CV9A 4RGOS 4M8AA 3HEJA 1FYCA 4V190 1B3AA 1OXSC 5J22A 4HAEA 5K36H 1XXGA 3SHLA 4RWSC 3FKIB 1PTOB 4M1UB 2G9DA 4FVMA 4XQJA 1MD2D 4KK7A 1LTID 5C5LA 3MXUA 4IUTA 4NMZA 1X3PA 1DD2A 2EY2A 3NUCA 4ZAIA 5IGFA 4Q0FA 2K28A 3OOCA 1IKMA 1U4MA 1I4PA 2L5TA 2LFNA 5ELCA 5I6WA 1STBA 2CHBD 5LL6S 4IURA 5D3IB 1RDPD 2QF7A 2ZXRA 4RKBA 1EWCA 4FXGC 3RZDB 3A8JE 2B39A 2EJGC 1SAPA 1IW7D 4XIGS 2L0CA 2E75C 1EY0A 1B4OA 2JXMB 1B53A 2OEOA 1RF2D 2NVXB 5C4ZA 2R3ZA 1CZGA 3G7LA 1HCZA 2ICEC 4BS9A 1PDQA 3CKIB 4N9TA 4EQNA 1F9SA 2NBFA 5FK9C 1ENAA 4RAUC 5KYLA 2O5IC 4HSPA 1R4PB 5KGUA 5C0XI 4KD3A 2F0PA 3VA7A 3G6JB 1HUMA 2MGSA 4A3EB 3RZOB 3KLRA 2CW0D 4K6DA 2F0MA 1WTPA 4RGNA 2E2DC 4ZUJA 2JSOA 5LL6X 3Q24A 4PMCA 1X3QA 3QB3A 1G291 4X3SA 1EWHA 2B2UC 3HKZB 5C0XH 4KHZA 2K33A 1TWCB 4XDXA 1GOZA 1F2YA 1V1PB 4A3GB 4U68A 3LWEA 4WJWA 3S2DB 3L3OC 1HFGA 1WCMB 1STEA 4IUNA 1SFOB 2JA6B 1W6JA 2EYMA 3NTKA 5M3MB 3P75A 5CORA 2LKVA 2YU9B 3J80L 4DFAA 2NVYB 3BDCA 4TKOB 4BY7B 4NP5A 1TWGB 3NWSA 1H9RA 1EY9A 3K0YA 3SK6A 3L7ZC 2Y0SB 4DU9A 3MXNA 1QE6A 3GO5A 1JORA 3D4RA 4QCLA 3OMGA 2F0IA 4FP5D 3FEWX 5EPLA 5C4JB 1LO5D 4KKUA 3DWAA 2KCCA 1RKNA 4KJNA 1H9JA 1S5ED 1NSNS 1I6HB 1CA6A 1OXTA 5DEHA 1T5EA 1K83B 3M3YB 1AP0A 1C4QA 2D5DA 4R8IA 3GTOB 5IGGA 5K5PA 2EYOA 5HURA 3C1EA 5EKIA 3HOZB 1S5DD 5I9PA 4RA8A 4DAPA 3C46A 1BOSA 1JR0D 2MPMA 1ILQA 1MBYA 3F2UA 3NQIA 1WTVA 1S5FD 1DCZA 3NP8A 5C4XB 3E5SA 3NBIA 3K58A 1LABA 3NK9A 3U9OA 4K2LA 1BUVT 2EDGA 1EZ8A 3TP5A 1HPCA 1KTKA 2Q8RE 1KDCA 4JBWA 4FNFA 2D2CC 2KEEA 5CC4A 1M8AA 3K5MA 1E2WA 3GTJB 5E4XA 4ZK9B 1CQVA 2Q8TA 2R7ZB 2NUCA 1WTOA 1BCPC 1QB5D 1RCVD 4WORA 5EKLA 3MFYA 2JA5B 1TS5A 2F0VA 1B2TA 5KRUA 1FNUA 3I4NB 4J6HA 1GHKA 2AQ1B 2NTTA 4BBRB 1G6ZA 1Y8NB 2JEAI 4Z9CB 1DM0B 3L9AX 3OWFA 4QB4A 1WTWA 3CQZB 2WV6D 2KQ3A 5I2YA 1BR9A 5IGEA 3U9SA 3EVQA 1EL0A 2A69D 3I70A 5T1IA 3A8KE 5DM63 3JAME 1Z47A 2KA7A 2F0LA 1SJHD 1RD9D 3S9WA 2WIIB 3IKJA 1H9KA 1PRTC 2OF1A 4EQPA 2IX3A 2EY5A 4OO1I 1NUCA 1JWSD 3DM1A 3W3AA 2XWBB 2PZUA 3OW7A 1BF4A 1DJRD 2HUGA 4EQOA 2RKSA 1RODA 3EFXD 5F2DA 1SYFA 4JK1C 5ELEA 1RTOA 2O5JC 3FRPB 3K5LA 1GUGA 1Q3LA 4OO1H 4A3MB 2B2YC 4KV6A 4PNYA 1CZWA 2BDOA 3H6MA 4R9WA 2XVSA 4KY6A 1PFNA 1AFPA 5J39A 2F0TA 1GUSA 1EYCA 1WD0A 1KNEA 3PO2B 3ONAB 3IFDA 3P20A 5EJWA 2XSCA 3C2PA 2BA0A 5IGDA 1C8CA 1CHQD 1EY7A 4QMGA 1ESRA 1BDOA 1D5ZC 2F0HA 3K57A 1MSHA 4TSSA 1EIGA 1GHJA 3WOEA 4F8MA 3BVZA 3MFGA 3I90A 4BWGB 1E2ZA 2M9VA 3DXJC 3IFTA 1UEAB 1AZQA 4HTHA 3J81L 4ID6A 4XYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STB A;  3DHQ A;  3SK6 A;  3EJI A;  5KIX A;  1F2Z A;  1STH A;  2F0S A;  4IAL A;  1EZ8 A;  5EKK A;  3TP5 A;  1EYD A;  5M9O A;  4K2K A;  3NQT A;  2PZU A;  1EY4 A;  3D4W A;  1EY8 A;  4OL7 A;  2F0Q A;  4TRD A;  2EXZ A;  4WRD A;  5DAU A;  3RUZ A;  5I9O A;  3LX0 A;  4K14 A;  1KDC A;  4IUN A;  2ENB A;  1SYG A;  3MHB A;  4H7B A;  4N9P A;  4RKB A;  3T13 A;  1TR5 A;  1SYC A;  4EQO A;  5C3W A;  2RKS A;  3ERO A;  3D8G A;  5CC4 A;  2EYM A;  2O4X A;  2EYP A;  1EYA A;  5CV4 A;  5JOB A;  1IHZ A;  1STG A;  3P75 A;  3OMC A;  1A3V A;  1II3 A;  2F0J A;  2PZT A;  4RKL A;  2LKV A;  5CV6 A;  4B9X A;  3MEH A;  5F2D A;  1EY0 A;  2NUC A;  2F0F A;  3MVV A;  1KAA A;  2PW5 A;  4K5W A;  1SYF A;  4KJO A;  3MZ5 A;  3ITP A;  2OEO A;  3BDC A;  4ODG A;  4ZQ3 A;  2OXP A;  5JAV A;  1KAB A;  4MIU A;  4WOR A;  1EY5 A;  4I65 A;  5EKL A;  3SXH A;  4NP5 A;  4YIJ A;  4DGZ A;  5C6A A;  1F2M A;  5CV5 A;  3QOJ A;  4KY7 A;  5C4Z A;  2F0V A;  1EY9 A;  2RDF A;  4R8N A;  1SNQ A;  2F3W A;  5NUC A;  1ENC A;  3D6C A;  5KRU A;  2F0G A;  1SND A;  4J6H A;  1TQO A;  4K8J A;  4K8I A;  3C1F A;  4KD4 A;  5EGT A;  2SNM A;  4PMB A;  2EY1 A;  4DU9 A;  4F7X A;  2EYJ A;  3SK8 A;  3T16 A;  4NKL A;  1U9R A;  4KV6 A;  4PNY A;  4DF7 A;  1EZ6 A;  4N9T A;  4K5X A;  3H6M A;  4EQN A;  4KY5 A;  3SK4 A;  5IOC A;  4KTA A;  1STA A;  1JOR A;  5IOD A;  5CV8 A;  1ENA A;  2F0U A;  2M00 A;  3OMG A;  2F0I A;  5CV7 A;  2PZW A;  5KYL A;  3OWF A;  5ISR A;  4KY6 A;  1SNM A;  3MXP A;  1A3T A;  3DMU A;  4QB4 A;  4DFA A;  5J39 A;  2F0T A;  5IGB A;  5KGU A;  4ME5 A;  3ERQ A;  5IGC A;  1EYC A;  1SNO A;  4KD3 A;  2F0P A;  1RKN A;  1JOK A;  4QF4 A;  4E6I A;  4KJN A;  1A3U A;  3HZX A;  4J1M A;  2EYH A;  1NSN S;  3BDL A;  3PMF A;  2KQ3 A;  2KHS A;  5CV9 A;  4B9W A;  2F0W A;  1EQV A;  3V2T A;  3HEJ A;  1AEX A;  5C5M A;  5DEH A;  5KEE A;  5HGT A;  2F0D A;  1SYE A;  3P1H A;  5J22 A;  5IGE A;  4K5V A;  2F0K A;  1A2U A;  3OSO A;  3EVQ A;  2SNS A;  3QOL A;  4K6D A;  3SHL A;  2PQE A;  5IGD A;  2PYK A;  1EY6 A;  4KHV A;  1KDA A;  4LAA A;  3VA5 A;  5IGG A;  5C3X A;  2F0M A;  5K5P A;  2F0O A;  1STY A;  2SOB A;  2EYF A;  4IZ8 A;  2F0E A;  2EY6 A;  1EY7 A;  2EYO A;  2QDB A;  4HMJ A;  3TP7 A;  5HUR A;  3C1E A;  1A2T A;  4ZUJ A;  5I6Y A;  1SYD A;  5I9P A;  4EVO A;  4QMG A;  5E1F A;  4ZUI A;  5C5L A;  4NMZ A;  1SYB A;  2F0L A;  3TME A;  5C4H A;  2F0H A;  4PMC A;  2EY2 A;  3S9W A;  1JOQ A;  3QB3 A;  3NUC A;  4G57 A;  5CR3 A;  5IGF A;  2HQE A;  2F0N A;  2PW7 A;  4F8M A;  2WAC A;  5KYI A;  5CGK A;  5J1Z A;  2RBM A;  5E3F A;  3SK5 A;  1STN A;  1TT2 A;  3NHH A;  5IIF A;  3NP8 A;  4HMI A;  4NDX A;  1KDB A;  2F3V A;  3D4D A;  4K2L A;  3SR1 A;  3E5S A;  2OF1 A;  4EQP A;  1SNP A;  3R3O A;  3TP8 A;  2EY5 A;  3TP6 A;  2EYL A;  4HTH A;  4S3S A;  3NK9 A;  1NUC A;  3NXW A;  4ID6 A;  5I6W A;  3U9O A;  1SNC A;  1JOO A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 3DHQ A;  3TZD A;  3KOJ A;  4RMF A;  2VUM H;  2Z9H A;  3K5N A;  2R61 A;  5DAU A;  4FF2 A;  3T1Y L;  4ULL A;  4AH6 A;  1PTO F;  3GD7 A;  3BU2 A;  3NE5 B;  3J7Y W;  4HR7 B;  2UUB Q;  3OHX C;  1GUW A;  3H0G H;  2OQ0 A;  4A3I G;  1PYS B;  1N32 L;  1Y1W H;  3MWY W;  4FF3 A;  1IKL A;  3STB D;  2RDG A;  3MEH A;  4B9X A;  2R92 G;  1N33 Q;  1Q12 A;  3AMU A;  3ITP A;  2IX1 A;  1TY0 A;  5CV5 A;  4R4I A;  4LMQ D;  3V96 A;  4PQX A;  2IX0 A;  2LXJ A;  1A15 A;  1CI3 M;  4DV1 Q;  2GVA A;  4IFD I;  3NBH B;  4DV4 Q;  1XYI A;  3SK4 A;  1Q81 C;  3OTO L;  4X3T A;  1TS3 A;  2ZXO A;  1HHV A;  1KQS A;  1LLR D;  1VQI A;  2E5L Q;  5I2X A;  2UXB Q;  2BE5 C;  3PO3 H;  3K7A B;  2RVL A;  3JAM L;  3AB9 A;  2GA4 B;  1TWF H;  2KHS A;  4B9W A;  1EQV A;  2NN6 G;  2JA7 B;  4CDC C;  5HGT A;  2F0D A;  3J80 i;  4C3J H;  4YHH L;  2D9U A;  5JVH 3;  2CVR A;  1KDA A;  1PVO A;  1SE4 A;  1HZ9 A;  3Q23 A;  3T1Y Q;  3Q8D A;  1VQ9 A;  4IFD H;  1B3Q A;  4NXM Q;  1XWE A;  1BNZ A;  1SYD A;  2D62 A;  2B8F A;  2BCO A;  3GTP H;  3ULP A;  4I7A A;  4P74 A;  4A3E G;  1B1Z A;  1RIP A;  3PIP A;  1N32 Q;  1L1O A;  4ZYS A;  2QKI C;  1JOQ A;  2AUK A;  5T1G A;  3AEV A;  2WAC A;  2HD3 A;  4QIW E;  5CGK A;  1M90 C;  1LT3 D;  2B2V A;  3D6W A;  4CDD C;  4DR4 Q;  4X6A H;  2B2T A;  1Q46 A;  4RFB A;  2Z0S A;  4DK3 C;  5IYB H;  2DJF C;  1YBY A;  4GN3 B;  5LMN L;  3FMC A;  3BVG A;  5IP9 H;  1PH4 A;  2KUM A;  1F9P A;  4BY1 B;  4A3L H;  1D1I A;  4JI2 L;  5A2Q E;  4A3J H;  3OTO Q;  5I9O A;  4L5Q A;  2EXZ A;  2EZV A;  3LWU A;  4K14 A;  2HIX A;  1PV4 A;  3UI2 A;  4DR2 L;  4LF9 L;  2Z6K A;  3SEB A;  1CK1 A;  4CKE A;  4JI8 Q;  1EU4 A;  2YTX A;  4A3I B;  3RLN A;  3WOF A;  2RHS B;  3UDX A;  4I65 A;  2R92 B;  3K59 A;  4YHH Q;  3MA2 B;  3HOX G;  4R8N A;  5G3L D;  1QCB D;  5GAH C;  3RLO A;  3BZD B;  3UDF A;  1FR3 A;  5M5W B;  2K5H A;  1LT4 D;  4CDF C;  3G71 A;  1D5M C;  1QVF A;  1DON A;  1L0X B;  5FLX L;  4HJ5 A;  1S4Z A;  2DY7 A;  3S1Q H;  2KHI A;  3U50 C;  4AYB B;  5IOC A;  2NVQ B;  3I72 A;  3QWN A;  3PF4 A;  1MI2 A;  1O7Y A;  1TWH B;  1YIT A;  1T5X D;  1LAC A;  1A3T A;  5EAY A;  5C0X J;  3ERQ A;  3GTK B;  2OQK A;  1D6E C;  5IYC H;  1S72 A;  5BR8 L;  3EA6 A;  2E74 C;  1QOH A;  2KEC A;  3BJU A;  4MN3 A;  1TXY A;  3S1R H;  1AEX A;  1PMR A;  1UE7 A;  4K5V A;  5LMN Q;  3HOU H;  3OSO A;  1BBW A;  1HA5 A;  1A8V A;  4KHV A;  4JI2 Q;  1O78 A;  1BCP D;  5FLM G;  4DV7 L;  4OX9 L;  1NAP A;  1PFB A;  5EPJ A;  3GTL H;  4DR2 Q;  1SBB B;  2RCF A;  4LF9 Q;  1SYB A;  2ZJR A;  4DKA C;  4IJL A;  5C4H A;  2K5Q A;  5M5Y B;  1AE3 A;  3N52 A;  1U4P A;  1QNU A;  4LUZ A;  2X6L A;  2JA9 A;  1GO3 E;  4DV5 L;  4A3F H;  4LF5 Q;  2BH8 A;  1FNV A;  1PXU A;  3KJO A;  2HCI A;  4DR5 L;  2Q2I A;  2BA1 A;  4UP7 A;  3NTH A;  4JBM A;  3H3V C;  4R4T A;  2VNU D;  4XQN A;  5COY A;  4LFB L;  1STH A;  1TWA B;  3KJP A;  3NQT A;  4X62 L;  3CCJ A;  1EU3 A;  2IPK D;  1NMF A;  4ME3 A;  3VYR A;  4OO1 G;  3PSI A;  5C3W A;  4Y7N B;  5DNF A;  2K01 A;  5KNC A;  5C3E G;  1TII D;  4GNX A;  4GNX B;  1CKO A;  1SE8 A;  3ZJY C;  5BR8 Q;  4C2M H;  1II3 A;  4RG1 A;  3U58 A;  3TZU A;  1H9M A;  1KIX A;  3MVV A;  1DZ1 A;  3T53 B;  1HZA A;  2JE6 I;  4ODG A;  4DNT B;  1NCV A;  1TS2 A;  2AQ2 B;  3S16 H;  1V1P A;  5EQ0 A;  4DXF A;  4DV3 L;  2RDF A;  3CC7 A;  4ABN A;  4A3D G;  4NPS A;  3HOX B;  1CT1 D;  1I50 H;  2EY1 A;  4DV7 Q;  1LTG D;  4OX9 Q;  2C35 B;  4IJH A;  2LY7 A;  2L11 A;  3H94 A;  4I7Z C;  5M5X H;  1PRT D;  4C3H G;  1SN8 A;  4CKB A;  1FGB D;  2PI2 E;  1PH8 A;  4C3I G;  5CV8 A;  1SNM A;  1VQ4 A;  1F9R A;  4JYA Q;  5IGB A;  3FVQ A;  3I7F A;  4DV5 Q;  2JQO A;  2ZTE A;  2NTS A;  3KLS X;  2DN8 A;  3OYY A;  1QZH A;  4QF4 A;  1Q82 C;  1S5C D;  1UEB A;  2JK8 A;  4U67 3;  1IYJ B;  3RLF A;  2OT2 A;  5KEE A;  3H3V I;  4K6L A;  2FMM A;  2X69 A;  3P1H A;  4DV0 L;  1EOT A;  1DOK A;  3K8A A;  2PYK A;  2ZJP A;  4X62 Q;  3K7U C;  1EUJ A;  3CCU A;  2F0O A;  1VQL A;  2JEB I;  4IZ8 A;  3RD4 A;  4A3K B;  1YHA A;  3D3R A;  4HMJ A;  1D8L A;  1YJN A;  2WAQ E;  2K6A A;  1HA6 A;  1CSQ A;  1B8A A;  5A35 A;  1Z7T A;  2KCM A;  2A6H C;  2VUM G;  1HQM C;  2MO0 A;  1SXT A;  3D0F A;  2KJX A;  2Z4H A;  3H91 A;  5J1Z A;  4OEM B;  1TT2 A;  1EQT A;  1TKW B;  2A5H A;  3F8T A;  4KKT A;  4LF8 L;  2F3V A;  4DNI A;  1Y1W G;  4JI7 L;  3H3V H;  4MTN A;  2NWG A;  4CBV A;  1QUQ B;  1AW7 A;  1BCP B;  3S1N H;  1M1K C;  1YJ9 A;  5EKK A;  1H95 A;  1EYD A;  3MTS A;  3V05 A;  1EY8 A;  3IAY A;  1JCK B;  1NE3 A;  1YIJ A;  4RCO A;  2ENB A;  1SMX A;  3J7A F;  4YWK A;  3M4O B;  4PV1 C;  1JWU D;  3I4O A;  3I73 A;  1IHZ A;  1XNQ L;  1PH2 A;  5C3E B;  3HG9 A;  1UAP A;  2F0F A;  5GAD C;  1SMY C;  1CKN B;  3OWE B;  2A8V A;  4FXD A;  4DN4 M;  3LGJ A;  4OWT B;  4DV0 Q;  1V8Q A;  3LNN A;  3EQL C;  4UP9 A;  1SNQ A;  1A6X A;  1PFS A;  3SE0 A;  3GV6 A;  3HS0 C;  3GTQ B;  2F0G A;  4KKS A;  3WWV A;  1LTT D;  4K8I A;  3PIP 3;  4C56 C;  1GXD C;  1Y14 B;  2B2W A;  3J81 i;  3CCR A;  4A3D B;  4IPC A;  4JBJ A;  1PYW D;  4KY5 A;  5GQO A;  2PQA A;  4ZRZ A;  1EIF A;  4C3H B;  5IOD A;  1FL0 A;  4IUQ A;  1G6P A;  1RL2 A;  1YVC A;  4C3I B;  1J9O A;  4N8F A;  3RZO H;  3AQQ A;  3PUZ A;  4FXK C;  3M7G A;  5IGC A;  5HY6 A;  1K8A C;  1BO0 A;  4LF8 Q;  4PZ8 A;  1A62 A;  3BDL A;  1EFW A;  4DAY B;  3QIA A;  3CPW A;  3VR4 A;  3K5O A;  2A1A A;  4GZY C;  2SNS A;  3QOL A;  2IL8 A;  5IY0 A;  5K36 G;  2NVT B;  1PRT B;  1OXX K;  2ES2 A;  4NW2 A;  2I0Q A;  1IBM Q;  3A56 A;  2LS0 1;  1Y8O B;  2E2H B;  5IYB G;  4A75 A;  1L0Y B;  1ASY A;  2I5M X;  3QO2 A;  4A3L G;  1XNQ Q;  1X65 A;  5IT9 E;  4LFC Q;  2VUM B;  3G48 A;  5EBC A;  1LT6 D;  2CW0 C;  2MP1 A;  3ER0 A;  3SK5 A;  4GOP A;  3HP3 A;  3CD6 A;  5AFW A;  2QEX A;  4CGY B;  4CDE C;  3H0G B;  1VQJ A;  3JAM i;  4ALP A;  1Y1W B;  5HGQ A;  4IOA A;  2UXD L;  2ICI A;  3DWP A;  1HQR D;  2BE5 D;  3UE1 A;  1U4R A;  3R2I A;  4H0L C;  4IAL A;  1Q7Y C;  1VQP A;  1YHB A;  4DUZ L;  1ET9 A;  4OL7 A;  2UU9 L;  3RUZ A;  5M3M H;  4V0B A;  1LTS D;  2XN9 C;  3MHB A;  4LJZ C;  5KND A;  4B08 A;  1WTH A;  1HNX L;  1D7Q A;  1HR0 L;  1IYV A;  5JOB A;  4A93 H;  1G51 A;  2XNA C;  3TEH B;  4QGU A;  1CQF A;  1YNJ C;  4BA2 I;  5D14 A;  1TS4 A;  2EJM A;  4X3K A;  4LF6 L;  1MSG A;  1BKB A;  1Y8P B;  3SXH A;  3HFZ B;  5FO8 B;  1ZEQ X;  5JEA H;  5JJZ A;  3CPF A;  4RHR A;  2N3S A;  5IYC G;  5LMN W;  3HRZ C;  3VR5 A;  3W5O A;  4K8J A;  3TN2 A;  2RHQ B;  3IL8 A;  2ZM6 Q;  3CC2 A;  4DF7 A;  2WB1 E;  5IT9 c;  4FF4 A;  1TWF B;  1VQE A;  3HOU G;  5C4J H;  1VQ6 A;  2Z4I A;  1PZK D;  4C3J B;  5CYU A;  1IBK Q;  1BXT A;  4WFN 3;  1CKM A;  4ME5 A;  4ZKB B;  1CTM A;  1SE3 A;  1JWM D;  4E6I A;  2TMP A;  1AH9 A;  3HZX A;  1IL8 A;  2PNH A;  4MHE A;  3Q0A A;  2NB0 A;  2F0W A;  3GTP B;  1NMG A;  5C5M A;  3GTO H;  2UXD Q;  1Q1B A;  5E7N A;  5JPM C;  4A3F G;  3AFQ A;  3R2T A;  2C9O A;  1SJE D;  2PQE A;  4O0A A;  5IP7 H;  1VQN A;  4DUZ Q;  1STY A;  3KBG A;  4L6T B;  1B50 A;  5FJ8 G;  3VYS A;  1MJC A;  1A2T A;  1XMQ L;  4ZUI A;  1HNX Q;  2WB1 G;  1HR0 Q;  4B3R L;  3NTI A;  4ZCK A;  5E4W C;  2HQE A;  4A3J B;  2HQL A;  1G2S A;  2RBM A;  2XGT A;  5E3F A;  4PG3 A;  2V1C C;  1NR2 A;  1N36 Q;  5C0X G;  2Q2T A;  3DEO A;  4BBS G;  2WP8 J;  3FDT A;  2JA8 H;  4JI3 L;  3S17 H;  4JI1 L;  1HTL D;  2EJF C;  3EJI A;  1F2Z A;  1SE2 A;  4IO9 A;  1PH6 A;  3GTG H;  4ILW A;  3F2B A;  2DY8 A;  3W2D A;  1CA5 A;  4XYO A;  1NBW A;  2DGY A;  1U0L A;  4H7B A;  2MUY A;  3L2P A;  1VF7 A;  1STG A;  4O2D A;  4CHT B;  2F52 A;  1Q90 A;  4OWX B;  3S24 A;  3S1Q B;  3NWT A;  3CCE A;  1XPO A;  2PMZ E;  4YIJ A;  4DK0 A;  2A74 C;  5FO9 B;  2Z1C A;  2AKW B;  3PUY A;  1R9T H;  1MIU A;  1SND A;  1C7Y A;  4UP8 A;  2L12 A;  4IFD J;  3S2H H;  1QG7 A;  1XMQ Q;  3CF5 A;  2B63 H;  2JJQ A;  2KCN A;  3S1R B;  5FO7 B;  4B3R Q;  1VQC A;  4H44 C;  4EGV A;  1E3P A;  2F0U A;  3HOU B;  1E24 A;  1Y1V H;  3S14 H;  1XX8 A;  4OHJ A;  1ILP A;  1OXU A;  3PUW A;  1XNR L;  4GLX A;  3T4A C;  4AIM A;  3PMF A;  1EQQ A;  2TSS A;  2J4X A;  2SDF A;  4G7Z C;  4JI3 Q;  2K5V A;  4AYB G;  4JOI C;  1A2U A;  3NBH A;  3UDI A;  3CU7 A;  1LTL A;  4A3F B;  1ZYR C;  4OON A;  3TQY A;  3P7J A;  3L0O A;  1V1O A;  3RN2 A;  3EIV A;  1K9M C;  3ND8 A;  3KBX A;  3A7A B;  2AUJ D;  5C44 H;  4XXE A;  1YI2 A;  5ELN A;  3CCV A;  2R93 H;  2H5X A;  4K0K Q;  2WB1 B;  2EE1 A;  1DGS A;  3KLW A;  3HOV H;  2PW7 A;  1IBL L;  3QG1 A;  5KYI A;  1OTC A;  1EOV A;  4DAV A;  1PLF A;  4IUU A;  1SR3 A;  4R1J A;  4DA2 A;  2FIN B;  4UPA A;  1LT5 D;  3HGB A;  3S15 H;  1O7I A;  3E0J A;  4BBS B;  2N78 A;  3NXW A;  1LYL A;  4C2M B;  1GD7 A;  1EY6 A;  2A6E C;  1UE5 A;  4LAA A;  1HRJ A;  4LFA L;  2E2J H;  4K2K A;  2O2L D;  1VMP A;  1EY4 A;  3D4W A;  3S16 B;  4WRD A;  1I3Q H;  3A74 A;  1DOL A;  2RF4 A;  2SEB D;  3J80 E;  5IYD H;  3ERO A;  1I50 B;  4R4O A;  1XNR Q;  4IPG A;  2LMC B;  5M5X B;  5CV6 A;  1GKH A;  4XTC S;  3ND9 A;  3NPP A;  1I4G A;  2AWO A;  3MZ5 A;  1KAB A;  2F4I A;  2LXK A;  1EY5 A;  2XTI A;  4A3M H;  3K6O A;  5C6A A;  2QIL A;  4ZLT F;  2F3W A;  2A6H D;  2RSN A;  3VR3 A;  2E2I B;  3TME A;  4KD4 A;  1TQO A;  1FJG L;  4F7X A;  2OWO A;  1O80 A;  4PMB A;  4HED A;  1QWY A;  2EOT A;  2JP1 A;  1KNA A;  4QUF A;  3TDQ A;  1TY2 A;  4OIJ A;  1Z6H A;  4DR6 L;  2B29 A;  1HNW L;  2PO4 A;  1HNZ L;  1K8G A;  1KXL A;  1I6V C;  2ZTC A;  1JT8 A;  1IBL Q;  4LF7 L;  2BOS A;  3CHB D;  3GTM H;  4DR7 L;  4NB3 A;  1X9N A;  3NSW A;  2A68 C;  3U4Z A;  2RSO A;  1KAW A;  3AYH B;  3PUV A;  1SYE A;  2MO1 A;  5M3F G;  4Q5V A;  2CQO A;  3GQB A;  5FOB B;  4LFA Q;  1X3E A;  3J80 c;  3HOW G;  3I4M H;  1UE6 A;  1WI5 A;  2JYO A;  2PMZ B;  4HIM A;  4HID A;  1CM9 A;  1SMY D;  3I8Z A;  3H09 A;  4NXN L;  4C1N K;  1L1O C;  4EVO A;  1D5X C;  1LTB D;  4JVZ A;  3K0X A;  4TQU S;  2L15 A;  2EQS A;  1EEI D;  2Q8I B;  3S1N B;  3Q6S A;  2I46 A;  2B2V C;  3OIQ A;  1A63 A;  3RR5 A;  2F0N A;  4C1N I;  1B44 D;  1Q86 C;  3G6E A;  5LHY 1;  3URY A;  2PNR C;  1PTO C;  5EBD A;  2B2T C;  4JG2 A;  2B2U A;  1K8O A;  1KDB A;  4A3K G;  2C5C A;  4APV A;  3E9H A;  4A93 G;  4LNQ A;  3BVM A;  1FJG Q;  1R4Q B;  1I4H A;  4JI0 L;  5G3L F;  1S40 A;  3O13 A;  3DUZ A;  5JEA G;  2BDN A;  3CRL C;  2EXD A;  2F3I A;  4DR6 Q;  3LX0 A;  4HCE A;  5I4D A;  2Z6K C;  1HNW Q;  3KDF B;  3T13 A;  3DM3 A;  4GN4 B;  3W1B A;  1HNZ Q;  1Y69 U;  1ENF A;  2O4X A;  3A5Z B;  1O7L A;  1EYA A;  4DR7 Q;  3RMH A;  1GUO A;  1UE1 A;  2B3G A;  4A3B H;  4KJO A;  4B3T L;  5JAV A;  4GLV B;  1F2M A;  1NNX A;  1BQQ T;  4OGQ C;  1D1K A;  3M7N A;  3PV0 A;  3D6C A;  1WYD A;  2FMC A;  4G4K A;  1YNN C;  2IJ0 A;  1RHP A;  3I56 A;  4L63 B;  1EFI D;  3N6R A;  4H02 A;  1EZ6 A;  4LWC A;  4K5X A;  1BCP F;  4A4I A;  4L5S A;  5JJI A;  2E8G A;  4ZKC B;  5IP7 G;  2J0T D;  1HR0 W;  2G9H D;  2PZW A;  1F77 A;  4OIK A;  4DPG A;  4F87 A;  1UNS A;  3DMU A;  1X3F A;  3WDN A;  4QJF A;  3BDO A;  3DLL A;  3TSS A;  3VR2 A;  1JOK A;  2MFI A;  4P2C B;  2Z8L A;  2EYH A;  3ZYY X;  4QIW B;  3ULL A;  3HOY H;  1LUZ A;  5TSS A;  4LW1 A;  2YTV A;  1KLU D;  4UDU C;  2K5N A;  1W3S A;  3VA5 A;  3NEL A;  3J81 j;  2V4D A;  2I5L X;  3U4V A;  5M3F B;  3J7A V;  1YNJ D;  2EYF A;  2JA8 G;  1JQY D;  2EY6 A;  4KMU C;  3HOW B;  3TP7 A;  1ONL A;  4YCU A;  3T51 B;  2VS1 A;  4P71 A;  4XT3 B;  5BN5 A;  4OWW B;  4GLA C;  2ID0 A;  1QVC A;  2EVB A;  2X6G A;  2UUA L;  4DR5 Q;  3F2C A;  1PZI D;  2IW3 A;  2YYZ A;  1UUP A;  3FKI H;  1PTO H;  3PUX A;  1FVI A;  1BBU A;  4DK6 C;  1WTR A;  2IY5 B;  4IUP A;  4LFB Q;  1EIH A;  1E7Z A;  1WTX A;  4BY1 H;  2F03 A;  1Q8I A;  1VMC A;  4XQQ A;  4FF1 A;  4A93 B;  3OIP A;  1SNC A;  2KOL A;  4UY8 C;  2F0S A;  3GV3 A;  1QNK A;  2F0Q A;  1X32 A;  1CFM A;  1PRT F;  2ZT9 C;  4CKC A;  2LSS A;  3DEP A;  5A2Q L;  4P72 A;  2I07 B;  1K0R A;  1O7Z A;  2K1B A;  3H0G G;  2B8G A;  2VZA A;  4DV3 Q;  1G91 A;  3RNU A;  3M4Y A;  2GVB A;  2NN6 I;  1ICW A;  1KAA A;  2AWN A;  4ZQ3 A;  1QUQ A;  1Y1V G;  4MIU A;  1HXY D;  3TBI B;  4DNR B;  1GM5 A;  2AHO B;  5NUC A;  4HJ8 A;  1ENC A;  3I3C A;  4RH6 A;  3RZD H;  3PIO A;  1DOM A;  3K81 C;  3C1F A;  2XRQ D;  3E6Z X;  2SNM A;  3GP7 A;  3FPU B;  1LM0 A;  4POG A;  1U9R A;  2PCF B;  5CBA E;  2WAQ G;  2K32 A;  2HCC A;  2IHF A;  2N88 A;  2J7Z A;  1XMO L;  3GTK H;  5ELD A;  2HT1 A;  1OXV A;  2NVX H;  3BYY B;  2VY3 A;  1CKN A;  3S1M B;  4H13 C;  1W6K A;  1JE5 A;  1C48 A;  1SEB D;  1V43 A;  3PO3 G;  1CUK A;  4JI4 L;  1P16 A;  4J1M A;  2R93 G;  2NN6 H;  1H9S A;  1H9S B;  2M2L A;  2K05 A;  2NYZ D;  3HOV G;  2YV5 A;  2WKD A;  4C3J G;  1IW7 C;  1G8Z D;  5BN4 A;  1VDZ A;  4WJ4 A;  5C3X A;  4GS3 A;  3A0J A;  1X6O A;  4A3E H;  4IFD G;  1VF5 C;  2YTY A;  2JA8 B;  5JJL A;  1LTR D;  2K50 A;  3KYH C;  2E76 C;  3KUP A;  2DNE A;  3GDE A;  4X64 L;  3S17 B;  1NY4 A;  3MC0 B;  3AFP A;  4KI0 A;  4HJ9 A;  4JI7 Q;  4R4Q A;  4G7O C;  3E0E A;  4HIO A;  3GTG B;  4DAY A;  5L37 A;  1RJT A;  1ESF A;  3J81 E;  5IYD G;  4IUV A;  3MXG A;  4NDX A;  5JEA J;  3SDZ A;  1WTQ A;  1S5B D;  2XRS D;  3SR1 A;  3TP8 A;  3J7Z C;  1ICF B;  2BH2 A;  3A8I E;  2L9H A;  2QDB A;  1JOO A;  3RN5 A;  2HDM A;  5M9O A;  5IP9 G;  1AN8 A;  3BYT B;  5ELF A;  1XMO Q;  3D31 A;  1J6Q A;  4A3J G;  3KK7 A;  2IWH A;  4N9P A;  1R9T B;  1TWC H;  1SYC A;  2H4O A;  5JVG 3;  3D8G A;  2EYP A;  1E2V A;  2DNC A;  1FNW A;  1AZP A;  3S2H B;  1HFN A;  1G2T A;  1IXR A;  2F0J A;  1ZYR D;  3FPP A;  4JI4 Q;  2B63 B;  4A3G H;  2VB3 X;  2PW5 A;  1LTA D;  4J8Q A;  1ZKO A;  2EPB A;  3S2D H;  1WCM H;  1SDF A;  2ZXP A;  5FKA C;  3M85 A;  1Y1V B;  2L55 A;  3S14 B;  2HDL A;  1VQM A;  1SFO H;  2JA6 H;  2B2W C;  1LV9 A;  2Q2H A;  3X3N A;  2H1E A;  5EGT A;  4DXG A;  4DV2 L;  4FO2 A;  4NKL A;  1XTD A;  1GUT A;  2QEJ C;  3I91 A;  1Q1E A;  2YU9 H;  3KF8 A;  3KF8 B;  1HTP A;  2B2Y A;  4YWM A;  1JJG A;  1QIL A;  2NVY H;  1STA A;  1JC7 A;  4DK1 A;  3J81 c;  4BY7 H;  4YCV A;  3DWQ A;  1A0I A;  2WAQ B;  1TWG H;  2M00 A;  2K04 A;  5JPN C;  3KLS A;  5ISR A;  1NR4 A;  2K7V A;  3VYU A;  2A6E D;  2IT1 A;  1ML0 D;  2QW7 A;  1SNO A;  4HN7 A;  3R93 A;  3I4L A;  4CJ1 B;  1L0W A;  2L4N A;  3V2T A;  5C44 B;  3PO3 B;  1QVG A;  1SRO A;  2R93 B;  1GJX A;  2F0K A;  1WVL A;  3VR6 A;  1D2B A;  2CQA A;  5FLM H;  1NJI C;  5IWA L;  4LF4 L;  3HOV B;  4CJ0 B;  4FYD A;  5KNB A;  2F0E A;  2R6G A;  4IPD A;  3NEM A;  2FFK B;  4RGT A;  5CBE E;  2UUC L;  2VXW A;  2RQX A;  3S15 B;  1I6H H;  1JB7 A;  1K83 H;  3CC4 A;  1YZ6 A;  3M3Y H;  1EEF D;  3FP9 A;  4F88 A;  1MJE A;  4QUC A;  1B9N A;  4G57 A;  2NZ1 D;  4LK1 C;  4GOP C;  2E2J B;  1V9P A;  4RHS A;  1PFM A;  2PPB C;  4YCW A;  4A3C H;  1I3Q B;  3VDY A;  1STN A;  3KFU A;  3NHH A;  2KHJ A;  3QJY A;  3HOZ H;  1CHP D;  2K5D A;  1DXM A;  4S3S A;  2UU9 Q;  1T9H A;  1WD1 A;  4A3B G;  4DV2 Q;  1TU2 B;  3CXC A;  3OPO A;  1IYU A;  5KIX A;  3JAM c;  2A68 D;  4TRD A;  1XTC D;  5C4X H;  2K5W A;  1TR5 A;  1C9O A;  4LF6 Q;  3EBE A;  1HUN A;  1KRT A;  4IQZ A;  4KN7 C;  2VQE L;  2K4K A;  5CV4 A;  5D65 A;  1A3V A;  1Z9F A;  2PZT A;  4RKL A;  5DM7 3;  1YNX A;  4IN3 A;  1IL2 A;  3TRZ A;  1GUN A;  4CJ2 C;  4K5W A;  2VQF L;  1I5F A;  2VB2 X;  2UUB L;  2OXP A;  4RCN A;  3GTQ H;  3X3M A;  3CCL A;  4DGZ A;  2HIV A;  1I4X A;  3VYT A;  3QOJ A;  1JJC B;  4KY7 A;  5FLX E;  1X56 A;  3FHW A;  4MNO A;  2KVM A;  1KL9 A;  2MJ8 A;  3B6Y A;  5IWA Q;  4A76 A;  1ET6 A;  4LF4 Q;  2G5D A;  1N33 L;  3GTM B;  5JJK A;  2XWJ B;  1TVX A;  2ASB A;  3Q22 A;  3T16 A;  2CH4 W;  4C3H H;  3GTJ H;  4X66 L;  3UDG A;  1PTO D;  2UUC Q;  2R7Z H;  3PCO B;  4MZ9 A;  3TRE A;  2AQ3 B;  4KTA A;  1K28 A;  2QDL A;  1F9Q A;  2F4V L;  2JA5 H;  4DV1 L;  1XPU A;  1YHQ A;  3MXP A;  4LUV A;  3I4M B;  3I4N H;  3AU7 A;  5GAG C;  1XJV A;  4BBR H;  1EQR A;  4L8J A;  5D3D A;  1VQ7 A;  1B9M A;  1SSO A;  3MAQ A;  3BG3 A;  2Q2U A;  1WFQ A;  1RTN A;  1OO9 B;  2UXB L;  3FKI G;  4PMW A;  1J8I A;  1B7Y B;  2E2H H;  1JE4 A;  2MHV A;  1QJO A;  1F2L A;  2SOB A;  1PH7 A;  2Z6B A;  3K80 C;  1JIC A;  2WIN B;  3CQZ H;  3W1G A;  5I6Y A;  1JB3 A;  5E1F A;  2XIW A;  3KF6 A;  3KF6 B;  2RDH A;  3CW2 C;  1MGS A;  2VQE Q;  3A55 A;  3BS1 A;  1YNN D;  5FLX c;  3GTL B;  1NTG A;  4IPH A;  4NXM L;  3PIO 3;  5CR3 A;  2VQF Q;  4POF A;  4HIK A;  1BBX C;  4GN5 A;  4JI1 Q;  1FD7 D;  3A7L A;  5IIF A;  4DAM A;  1AE2 A;  4HMI A;  1VQG A;  3D4D A;  1ZXT A;  3T56 B;  5IT9 L;  4X65 L;  4YY3 L;  2QA4 A;  2FJ2 A;  1SNP A;  3R3O A;  5BN3 A;  4G7H C;  1E0B A;  3TP6 A;  2EYL A;  4O1N A;  3R8B A;  4TVA B;  4X66 Q;  1I4Q A;  4A3B B;  2FHT A;  5EPK A;  4DR4 L;  1K8M A;  1P8L A;  2P5Z X;  4O42 A;  2F4V Q;  4HSV A;  2D0O A;  1SYG A;  3ERS X;  2OTJ A;  4RGM A;  5ELB A;  2KCT A;  5CMD A;  2A69 C;  3OMC A;  3CRK C;  2MQH A;  2N55 A;  3A54 A;  3IRB A;  4X3U A;  1M4V A;  2K03 A;  2CCZ A;  4XT1 B;  3C3L A;  3PQI A;  2F1M A;  4JI8 L;  3SVM A;  5LMU L;  1DYQ A;  2KED A;  2QCP X;  4BA1 I;  1YJW A;  2RA4 A;  4HCS A;  2EYJ A;  1U5K A;  1U4L A;  3SK8 A;  1PZJ D;  4KN4 C;  3HOY B;  1VCI A;  2R7F A;  4DR1 L;  2R7D A;  2A73 B;  4P75 A;  3HKZ E;  5CV7 A;  1KLG D;  1I4R A;  3MEF A;  2L1B A;  4UAI A;  3G4S A;  4HJA A;  2WKC A;  1L1O B;  1PYB A;  1A3U A;  4KLK A;  4X65 Q;  4YY3 Q;  5CV9 A;  1EIY B;  4RGO S;  4M8A A;  3HEJ A;  1FYC A;  4V19 0;  3CCS A;  1B3A A;  1OXS C;  5J22 A;  2N8N A;  4HAE A;  5K36 H;  4BXX H;  1XXG A;  3SHL A;  4RWS C;  2JN4 A;  3FKI B;  1PTO B;  4M1U B;  2G9D A;  4FVM A;  1VQA A;  4XQJ A;  1MD2 D;  3PO2 H;  4KK7 A;  1LTI D;  5C5L A;  3MXU A;  4IUT A;  4NMZ A;  1WOC A;  1X3P A;  2MNA A;  4DV6 L;  1DD2 A;  2GN5 A;  2EY2 A;  4KHP L;  3HKZ G;  3NUC A;  4ZAI A;  4JV5 L;  5IGF A;  4Q0F A;  2K28 A;  2CH4 A;  2Y0S E;  3OOC A;  5LMU Q;  1FGU A;  4DR3 L;  1IKM A;  1U4M A;  1I4P A;  1PH1 A;  4PZ6 A;  5IE8 A;  4A3G G;  2L5T A;  3PGZ A;  2LFN A;  3SGI A;  5ELC A;  5I6W A;  4LF5 L;  1STB A;  2CHB D;  1CSP A;  4IUR A;  5LL6 S;  4MTK A;  3ULJ A;  1WCM G;  2VL6 A;  1EYG A;  4DR1 Q;  5D3I B;  2JA6 G;  2HHH L;  1RDP D;  2QF7 A;  1JMC A;  2ZXR A;  4RKB A;  5M3M G;  1EWC A;  4FXG C;  3RZD B;  2KBN A;  3A8J E;  2B39 A;  2EJG C;  1SAP A;  1IW7 D;  4FDB A;  4XIG S;  2L0C A;  2E75 C;  4JI6 L;  1PA6 A;  4BY7 G;  3M4P A;  1EY0 A;  1B4O A;  2JXM B;  1B53 A;  2OEO A;  1EWI A;  1RF2 D;  1X54 A;  2NVX B;  5C4Z A;  2Y0S G;  2R3Z A;  1KC8 C;  1CZG A;  3G7L A;  4Y52 H;  1HCZ A;  2ICE C;  3KDF A;  4BS9 A;  1VQO A;  1KD1 C;  1PDQ A;  3CCM A;  3CKI B;  4N9T A;  3I55 A;  4LF7 Q;  4EQN A;  4DV6 Q;  1F9S A;  2NBF A;  4GKK L;  5FK9 C;  1ENA A;  4RAU C;  5KYL A;  4KHP Q;  1X55 A;  3TS2 A;  4JV5 Q;  2O5I C;  4HSP A;  1R4P B;  5KGU A;  5C0X I;  4KD3 A;  2F0P A;  3VA7 A;  3G6J B;  4DR3 Q;  1HUM A;  2MGS A;  4A3E B;  3RZO B;  1ASZ A;  3KLR A;  1HZC A;  4JYA L;  1SRU A;  3TS0 A;  4NXN Q;  4UHV A;  2CW0 D;  4A3C G;  4K6D A;  1N8R C;  1HH2 P;  2F0M A;  5FJ8 H;  1WTP A;  3HOZ G;  3STB C;  4RGN A;  2HHH Q;  2E2D C;  3UE0 A;  3K7A H;  1KRS A;  4ZUJ A;  2JSO A;  5LL6 X;  3Q24 A;  5AJ3 L;  2JA7 H;  1SLJ A;  3CCQ A;  4PMC A;  4YWL A;  4JI6 Q;  1X3Q A;  3QB3 A;  1G29 1;  4X3S A;  1EWH A;  5H1S E;  2B2U C;  4JI0 Q;  3HKZ B;  5C0X H;  5C4X G;  4KHZ A;  4BBS H;  2K33 A;  2OCE A;  1TWC B;  1VQ5 A;  2NZO A;  4XDX A;  1GOZ A;  1F2Y A;  1V1P B;  1HJP A;  4A3G B;  1PH3 A;  4U68 A;  3LWE A;  4WJW A;  3S2D B;  3L3O C;  1HFG A;  1WCM B;  1PH9 A;  4GKK Q;  1STE A;  4IUN A;  1I94 L;  1SFO B;  2JA6 B;  4B3T Q;  1IZ6 A;  1W6J A;  2EYM A;  4J15 A;  3NTK A;  4AQY L;  2R7Z G;  5M3M B;  3P75 A;  1XPR A;  5COR A;  2LKV A;  2YU9 B;  2JA5 G;  3J80 L;  4DFA A;  3H15 A;  2NVY B;  3BDC A;  4TKO B;  2RCN A;  2E2I H;  4BY7 B;  1V1Q A;  4NP5 A;  1TWG B;  3NWS A;  1H9R A;  1K3B C;  3I4N G;  1EY9 A;  3K0Y A;  4BBR G;  3A5U A;  3SK6 A;  3L7Z C;  1VQK A;  2K52 A;  1N9W A;  4WJ3 M;  2Y0S B;  4DU9 A;  3MXN A;  3MXN B;  1J5E L;  2QGQ A;  4GNX C;  1QE6 A;  1JJ2 A;  2ZTD A;  3GO5 A;  4A3I H;  4JPB W;  5AJ3 Q;  2B63 G;  2UXC L;  4OXP A;  1JOR A;  3D4R A;  2R92 H;  4QCL A;  3OMG A;  2F0I A;  4FP5 D;  2KEN A;  3FEW X;  4IOC A;  1MHW C;  5EPL A;  5C4J B;  1LO5 D;  5M5W H;  4KKU A;  3DWA A;  2KCC A;  1RKN A;  4KJN A;  1H9J A;  1S5E D;  2CWP A;  4LUO A;  1NSN S;  1I6H B;  1CA6 A;  1OXT A;  5DEH A;  3M9B A;  2NVQ H;  1T5E A;  1K83 B;  3M3Y B;  1AP0 A;  1C4Q A;  1TWH H;  2D5D A;  4R8I A;  3GTO B;  5IGG A;  5K5P A;  3F1Z A;  2UUA Q;  2EYO A;  5HUR A;  3C1E A;  5EKI A;  1I94 Q;  1S5D D;  3HOZ B;  5I9P A;  4RA8 A;  4DAP A;  3C46 A;  1BOS A;  3OW2 A;  1JR0 D;  2MPM A;  4AQY Q;  4L5T A;  1ILQ A;  4EX5 A;  1MBY A;  4B3M L;  5C44 G;  1IBM L;  3F2U A;  3NQI A;  1WTV A;  3T1H L;  1S5F D;  1DCZ A;  3NP8 A;  1K73 C;  5C4X B;  1GVP A;  3E5S A;  2WFW A;  3NBI A;  3K58 A;  4LFC L;  4HJ7 A;  1LAB A;  2A19 A;  3NK9 A;  1J5E Q;  3U9O A;  5M5Y H;  4K2L A;  1BUV T;  2EDG A;  2EIF A;  2K75 A;  1EZ8 A;  3TP5 A;  1BVS A;  1HPC A;  1KTK A;  1K3R A;  2UXC Q;  2Q8R E;  1KDC A;  4JBW A;  4FNF A;  2D2C C;  1HZB A;  2KEE A;  5CC4 A;  1M8A A;  4L5R C;  2PQA B;  3K5M A;  4JBK A;  1E2W A;  3GTJ B;  5E4X A;  4ZK9 B;  1CQV A;  3E3X A;  2Q8T A;  2R7Z B;  2NUC A;  1WTO A;  1W2B A;  1BCP C;  1E1O A;  1QB5 D;  1RCV D;  1TWA H;  2ALY B;  4WOR A;  5EKL A;  3MFY A;  2JA5 B;  1TS5 A;  1VQB A;  4A3M G;  1KHI A;  2F0V A;  4Y7N H;  5KRU A;  1FNU A;  3I4N B;  4J6H A;  1B2T A;  2AQ1 B;  2NTT A;  1GHK A;  1Q8K A;  4JC0 A;  4BBR B;  2NZH A;  2PI2 A;  1G6Z A;  1Y8N B;  3QR8 A;  4DUY L;  2JEA I;  4Z9C B;  4BXX G;  4EQ5 A;  4B3M Q;  1DM0 B;  2ZM6 L;  3L9A X;  3OWF A;  2OTL A;  4QB4 A;  1WTW A;  3PO2 G;  3T1H Q;  3HOX H;  1VQD A;  2CKZ B;  3CQZ B;  4PZ7 A;  2ATW A;  2FXQ A;  2DJG C;  2WV6 D;  2KQ3 A;  1IBK L;  5I2Y A;  3CAM A;  5DLQ E;  1BR9 A;  5M3F H;  2I5H A;  5IGE A;  4GOP B;  3HOW H;  3U9S A;  3EVQ A;  1EL0 A;  2A69 D;  1QZG A;  2K14 A;  4X64 Q;  3I4M G;  1N34 L;  3I70 A;  3CMA A;  5T1I A;  4OEL B;  3A8K E;  5DM6 3;  3JAM E;  1Z47 A;  2KA7 A;  2F0L A;  1SJH D;  1RD9 D;  3E9I A;  3S9W A;  2IHE A;  2WII B;  3IKJ A;  4JI5 L;  1H9K A;  3J7A 5;  1PRT C;  4A3K H;  4QY7 A;  4N8X 1;  3NEN A;  2OF1 A;  4EQP A;  1YEZ A;  2IX3 A;  3CME A;  2EY5 A;  4OO1 I;  3PF5 A;  1NUC A;  1JWS D;  3DM1 A;  3W3A A;  3JC6 6;  4JCV E;  2XWB B;  1K0S A;  1N36 L;  4B3S L;  3BZC A;  3CP0 A;  2AMC B;  5GRO A;  4DUY Q;  2PZU A;  3OW7 A;  1BF4 A;  1DJR D;  1MKH A;  2HUG A;  4EQO A;  1C0A A;  2RKS A;  4GKJ L;  3ICE A;  1ROD A;  3EFX D;  1PHJ A;  4P73 A;  5F2D A;  1SYF A;  4JK1 C;  3HKS A;  5ELE A;  1RTO A;  2O5J C;  3FRP B;  3BZK A;  3K5L A;  4QQB X;  1GUG A;  1Q3L A;  3M4O H;  4OO1 H;  4A3M B;  2B2Y C;  1N34 Q;  1WJJ A;  5C3E H;  4KV6 A;  4PNY A;  5J3B A;  1CZW A;  3F2D A;  2BDO A;  3H6M A;  5ELO A;  3S1M H;  2CFM A;  1E22 A;  4R9W A;  1L2F A;  2XVS A;  4KY6 A;  4JI5 Q;  1PFN A;  3M4Q A;  1AFP A;  5J39 A;  2F0T A;  5GAE C;  1GUS A;  1EYC A;  1WD0 A;  1KNE A;  2JA7 G;  3PO2 B;  4A3D H;  3ONA B;  3IFD A;  1B70 B;  3P20 A;  1VQ8 A;  1VQH A;  5EJW A;  2XSC A;  3HOY G;  3C2P A;  4JW0 A;  1VQF A;  2BA0 A;  2DUD A;  2VW9 A;  2ZJQ A;  4B3S Q;  4C3I H;  5IGD A;  1S3O A;  1C8C A;  1CHQ D;  4JOI A;  4QL5 A;  3I2Z A;  1EY7 A;  1PH5 A;  4QMG A;  1ESR A;  4DV4 L;  1BDO A;  1D5Z C;  4GKJ Q;  2F0H A;  3K57 A;  1MSH A;  1X3G A;  1UWV A;  4TSS A;  1EIG A;  1GHJ A;  3WOE A;  2NVT H;  4F8M A;  2N49 A;  3BVZ A;  4R4C A;  2E5L L;  3MFG A;  3I90 A;  4BWG B;  1E2Z A;  1E1T A;  2M9V A;  4K0K L;  3EN2 A;  3DXJ C;  1VS0 A;  3IFT A;  1UEA B;  1AZQ A;  4HTH A;  2CWA A;  3J81 L;  4ID6 A;  4AYB E;  4BY1 G;  4XYQ A;  2D0P A; 
#chains in the Genus database with same CATH homology
 3DHQ A;  3TZD A;  3K5N A;  2R61 A;  5DAU A;  4FF2 A;  4ULL A;  1PTO F;  3GD7 A;  3NE5 B;  3J7Y W;  4HR7 B;  3OHX C;  1GUW A;  4FF3 A;  3MWY W;  1IKL A;  2RDG A;  3MEH A;  4B9X A;  3AMU A;  1Q12 A;  3ITP A;  2IX1 A;  1TY0 A;  5CV5 A;  4LMQ D;  3V96 A;  4PQX A;  2IX0 A;  1A15 A;  1CI3 M;  4IFD I;  1XYI A;  3SK4 A;  4X3T A;  1TS3 A;  2ZXO A;  1HHV A;  1LLR D;  5I2X A;  2BE5 C;  3K7A B;  2RVL A;  3JAM L;  3AB9 A;  2GA4 B;  2KHS A;  4B9W A;  1EQV A;  2NN6 G;  2JA7 B;  5HGT A;  2F0D A;  2D9U A;  5JVH 3;  2CVR A;  1KDA A;  1SE4 A;  3Q23 A;  4IFD H;  1XWE A;  1BNZ A;  1SYD A;  2D62 A;  2B8F A;  2BCO A;  1B1Z A;  4ZYS A;  2QKI C;  1JOQ A;  2AUK A;  5T1G A;  2WAC A;  5CGK A;  1LT3 D;  2B2V A;  3D6W A;  2B2T A;  4RFB A;  3FMC A;  3BVG A;  2KUM A;  1F9P A;  4BY1 B;  1D1I A;  5A2Q E;  5I9O A;  2EXZ A;  2EZV A;  3LWU A;  4K14 A;  3UI2 A;  3SEB A;  1CK1 A;  4CKE A;  1EU4 A;  4A3I B;  3WOF A;  4I65 A;  2R92 B;  3K59 A;  3MA2 B;  4R8N A;  5G3L D;  1QCB D;  3BZD B;  5M5W B;  1FR3 A;  1LT4 D;  1D5M C;  1DON A;  1L0X B;  5FLX L;  1S4Z A;  2DY7 A;  4AYB B;  5IOC A;  2NVQ B;  3I72 A;  3QWN A;  1MI2 A;  1O7Y A;  1TWH B;  1T5X D;  1LAC A;  1A3T A;  5C0X J;  3ERQ A;  3GTK B;  1D6E C;  3EA6 A;  2E74 C;  1QOH A;  2KEC A;  4MN3 A;  1AEX A;  1PMR A;  4K5V A;  3OSO A;  1HA5 A;  4KHV A;  1O78 A;  1BCP D;  1NAP A;  1PFB A;  5EPJ A;  1SBB B;  1SYB A;  5C4H A;  2K5Q A;  5M5Y B;  3N52 A;  1U4P A;  1QNU A;  2X6L A;  1PXU A;  1FNV A;  2HCI A;  2BA1 A;  3NTH A;  3H3V C;  2VNU D;  4XQN A;  5COY A;  1STH A;  1TWA B;  3NQT A;  1EU3 A;  2IPK D;  3VYR A;  4OO1 G;  5C3W A;  4Y7N B;  5DNF A;  2K01 A;  5KNC A;  1TII D;  1II3 A;  3TZU A;  1H9M A;  3MVV A;  1DZ1 A;  3T53 B;  2JE6 I;  4ODG A;  4DNT B;  1NCV A;  1TS2 A;  2AQ2 B;  1V1P A;  5EQ0 A;  4DXF A;  2RDF A;  4ABN A;  3HOX B;  1CT1 D;  2EY1 A;  1LTG D;  2LY7 A;  2L11 A;  3H94 A;  4I7Z C;  1PRT D;  4C3H G;  4CKB A;  1FGB D;  4C3I G;  5CV8 A;  1SNM A;  1F9R A;  5IGB A;  3FVQ A;  2NTS A;  3KLS X;  2DN8 A;  4QF4 A;  1S5C D;  4U67 3;  3RLF A;  2OT2 A;  5KEE A;  4K6L A;  2FMM A;  2X69 A;  3P1H A;  1EOT A;  1DOK A;  2PYK A;  2F0O A;  2JEB I;  4IZ8 A;  3RD4 A;  4A3K B;  3D3R A;  4HMJ A;  2K6A A;  1HA6 A;  5A35 A;  1Z7T A;  2A6H C;  1HQM C;  1SXT A;  2KJX A;  2Z4H A;  3H91 A;  5J1Z A;  1TT2 A;  1EQT A;  1TKW B;  2A5H A;  4KKT A;  2F3V A;  2NWG A;  4CBV A;  1AW7 A;  1BCP B;  5EKK A;  1EYD A;  3MTS A;  3V05 A;  1EY8 A;  3IAY A;  1JCK B;  4RCO A;  2ENB A;  3J7A F;  3M4O B;  4PV1 C;  1JWU D;  3I73 A;  1IHZ A;  5C3E B;  3HG9 A;  1UAP A;  2F0F A;  1SMY C;  3OWE B;  4FXD A;  4DN4 M;  1V8Q A;  3LNN A;  3EQL C;  1SNQ A;  1A6X A;  3SE0 A;  3GV6 A;  3HS0 C;  3GTQ B;  2F0G A;  4KKS A;  3PIP 3;  1LTT D;  4K8I A;  4C56 C;  1GXD C;  2B2W A;  4A3D B;  1PYW D;  4KY5 A;  4ZRZ A;  4C3H B;  5IOD A;  4IUQ A;  4C3I B;  1J9O A;  3PUZ A;  4FXK C;  3M7G A;  5IGC A;  1BO0 A;  3BDL A;  3QIA A;  3VR4 A;  3K5O A;  4GZY C;  2SNS A;  3QOL A;  2IL8 A;  5K36 G;  2NVT B;  1PRT B;  1OXX K;  4NW2 A;  3A56 A;  2LS0 1;  1Y8O B;  2E2H B;  1L0Y B;  3QO2 A;  5IT9 E;  2VUM B;  5EBC A;  1LT6 D;  2CW0 C;  2MP1 A;  3SK5 A;  3HP3 A;  5AFW A;  4CGY B;  3H0G B;  1Y1W B;  2ICI A;  3DWP A;  1HQR D;  2BE5 D;  1U4R A;  3R2I A;  4H0L C;  4IAL A;  1ET9 A;  4OL7 A;  3RUZ A;  4V0B A;  1LTS D;  2XN9 C;  3MHB A;  4LJZ C;  5KND A;  4B08 A;  1IYV A;  5JOB A;  2XNA C;  1CQF A;  1YNJ C;  4BA2 I;  5D14 A;  1TS4 A;  2EJM A;  4X3K A;  1MSG A;  1Y8P B;  3SXH A;  5FO8 B;  1ZEQ X;  5JEA H;  5JJZ A;  4RHR A;  3HRZ C;  3VR5 A;  4K8J A;  3TN2 A;  3IL8 A;  4DF7 A;  4FF4 A;  1TWF B;  2Z4I A;  1PZK D;  4C3J B;  5CYU A;  1BXT A;  4WFN 3;  4ME5 A;  4ZKB B;  1CTM A;  1SE3 A;  1JWM D;  4E6I A;  2TMP A;  3HZX A;  1IL8 A;  4MHE A;  3Q0A A;  2NB0 A;  2F0W A;  3GTP B;  5C5M A;  1Q1B A;  5JPM C;  3R2T A;  2C9O A;  1SJE D;  2PQE A;  1STY A;  3KBG A;  4L6T B;  1B50 A;  3VYS A;  1A2T A;  4ZUI A;  3NTI A;  5E4W C;  2HQE A;  4A3J B;  1G2S A;  2RBM A;  5E3F A;  1NR2 A;  5C0X G;  3DEO A;  2WP8 J;  3FDT A;  1HTL D;  2EJF C;  3EJI A;  1F2Z A;  1SE2 A;  4ILW A;  2DY8 A;  3W2D A;  1CA5 A;  4XYO A;  4H7B A;  2MUY A;  1VF7 A;  1STG A;  4CHT B;  1Q90 A;  3S1Q B;  3NWT A;  4YIJ A;  4DK0 A;  2A74 C;  5FO9 B;  2Z1C A;  3PUY A;  1SND A;  2L12 A;  4IFD J;  1QG7 A;  2KCN A;  3S1R B;  5FO7 B;  4H44 C;  4EGV A;  2F0U A;  3HOU B;  1ILP A;  1XX8 A;  4OHJ A;  1OXU A;  3PUW A;  3T4A C;  3PMF A;  2TSS A;  2J4X A;  2SDF A;  4G7Z C;  1A2U A;  3NBH A;  3CU7 A;  4A3F B;  1ZYR C;  3P7J A;  1V1O A;  3ND8 A;  3KBX A;  3A7A B;  2AUJ D;  4XXE A;  2WB1 B;  2EE1 A;  2PW7 A;  3QG1 A;  5KYI A;  4DAV A;  1PLF A;  4IUU A;  4DA2 A;  2FIN B;  1LT5 D;  3HGB A;  3E0J A;  4BBS B;  3NXW A;  4C2M B;  1EY6 A;  2A6E C;  4LAA A;  1HRJ A;  4K2K A;  2O2L D;  1VMP A;  1EY4 A;  3D4W A;  3S16 B;  4WRD A;  1DOL A;  2SEB D;  3J80 E;  3ERO A;  1I50 B;  2LMC B;  5M5X B;  5CV6 A;  4XTC S;  3ND9 A;  3NPP A;  1I4G A;  2AWO A;  3MZ5 A;  1KAB A;  2F4I A;  1EY5 A;  3K6O A;  5C6A A;  2QIL A;  4ZLT F;  2F3W A;  2A6H D;  2RSN A;  3VR3 A;  2E2I B;  3TME A;  4KD4 A;  1TQO A;  4F7X A;  1O80 A;  4PMB A;  4HED A;  1QWY A;  2EOT A;  2JP1 A;  1KNA A;  4QUF A;  3TDQ A;  1TY2 A;  4OIJ A;  1Z6H A;  2PO4 A;  1I6V C;  2BOS A;  3CHB D;  3NSW A;  2A68 C;  2RSO A;  3PUV A;  1SYE A;  4Q5V A;  3GQB A;  5FOB B;  2JYO A;  2PMZ B;  1CM9 A;  1SMY D;  3I8Z A;  3H09 A;  4C1N K;  4EVO A;  1D5X C;  1LTB D;  4TQU S;  1EEI D;  2Q8I B;  3S1N B;  3Q6S A;  2I46 A;  2B2V C;  3OIQ A;  4C1N I;  2F0N A;  1B44 D;  5LHY 1;  3URY A;  2PNR C;  1PTO C;  5EBD A;  2B2T C;  1K8O A;  2B2U A;  1KDB A;  2C5C A;  3BVM A;  1R4Q B;  1I4H A;  5G3L F;  3O13 A;  3DUZ A;  5JEA G;  2BDN A;  3CRL C;  3LX0 A;  4HCE A;  5I4D A;  3T13 A;  1Y69 U;  1ENF A;  2O4X A;  1O7L A;  1EYA A;  3RMH A;  1GUO A;  4KJO A;  5JAV A;  1F2M A;  1BQQ T;  4OGQ C;  1D1K A;  3M7N A;  3PV0 A;  3D6C A;  2FMC A;  4G4K A;  1YNN C;  2IJ0 A;  1RHP A;  4L63 B;  1EFI D;  3N6R A;  1EZ6 A;  4K5X A;  1BCP F;  4ZKC B;  2J0T D;  2G9H D;  2PZW A;  1F77 A;  4OIK A;  4F87 A;  1UNS A;  3DMU A;  3WDN A;  3BDO A;  3TSS A;  3VR2 A;  1JOK A;  4P2C B;  2Z8L A;  2EYH A;  3ZYY X;  4QIW B;  5TSS A;  1KLU D;  4UDU C;  3VA5 A;  5M3F B;  2V4D A;  3J7A V;  1YNJ D;  2EYF A;  1JQY D;  2EY6 A;  4KMU C;  3HOW B;  3TP7 A;  1ONL A;  3T51 B;  4XT3 B;  5BN5 A;  2ID0 A;  2EVB A;  2X6G A;  1PZI D;  2IW3 A;  2YYZ A;  1UUP A;  1PTO H;  3PUX A;  1WTR A;  4IUP A;  1EIH A;  1WTX A;  2F03 A;  1Q8I A;  1VMC A;  4XQQ A;  4FF1 A;  4A93 B;  3OIP A;  1SNC A;  2KOL A;  2F0S A;  3GV3 A;  1QNK A;  2F0Q A;  1X32 A;  1CFM A;  1PRT F;  2ZT9 C;  4CKC A;  3DEP A;  5A2Q L;  2I07 B;  1O7Z A;  2K1B A;  2B8G A;  1G91 A;  3M4Y A;  2NN6 I;  1ICW A;  1KAA A;  2AWN A;  4ZQ3 A;  4MIU A;  1HXY D;  3TBI B;  4DNR B;  5NUC A;  1ENC A;  3I3C A;  4RH6 A;  1DOM A;  3C1F A;  2XRQ D;  3E6Z X;  2SNM A;  3GP7 A;  3FPU B;  1U9R A;  2PCF B;  5CBA E;  2K32 A;  2HCC A;  2N88 A;  2J7Z A;  5ELD A;  1OXV A;  3BYY B;  3S1M B;  4H13 C;  1W6K A;  1C48 A;  1SEB D;  1V43 A;  4J1M A;  2NN6 H;  1H9S A;  1H9S B;  2M2L A;  2K05 A;  2NYZ D;  2WKD A;  4C3J G;  1IW7 C;  1G8Z D;  5BN4 A;  1VDZ A;  5C3X A;  4IFD G;  1VF5 C;  2JA8 B;  1LTR D;  2E76 C;  3KUP A;  2DNE A;  3S17 B;  3MC0 B;  4KI0 A;  4G7O C;  3GTG B;  4DAY A;  1RJT A;  1ESF A;  3J81 E;  4IUV A;  3MXG A;  4NDX A;  5JEA J;  3SDZ A;  1WTQ A;  1S5B D;  2XRS D;  3SR1 A;  3TP8 A;  3A8I E;  2L9H A;  2QDB A;  1JOO A;  2HDM A;  5M9O A;  1AN8 A;  3BYT B;  5ELF A;  3D31 A;  3KK7 A;  2IWH A;  4N9P A;  1R9T B;  1SYC A;  2H4O A;  5JVG 3;  3D8G A;  2EYP A;  1E2V A;  2DNC A;  1FNW A;  1AZP A;  3S2H B;  1HFN A;  1G2T A;  2F0J A;  1ZYR D;  3FPP A;  2B63 B;  2VB3 X;  2PW5 A;  1LTA D;  4J8Q A;  1ZKO A;  2EPB A;  1SDF A;  2ZXP A;  5FKA C;  3M85 A;  1Y1V B;  2L55 A;  3S14 B;  2HDL A;  2B2W C;  1LV9 A;  3X3N A;  2H1E A;  5EGT A;  4DXG A;  4FO2 A;  4NKL A;  1GUT A;  2QEJ C;  3I91 A;  1Q1E A;  3KF8 A;  1HTP A;  2B2Y A;  1QIL A;  1STA A;  1JC7 A;  4DK1 A;  3DWQ A;  2WAQ B;  2M00 A;  2K04 A;  5JPN C;  3KLS A;  5ISR A;  1NR4 A;  2K7V A;  3VYU A;  2A6E D;  2IT1 A;  1ML0 D;  1SNO A;  4HN7 A;  3R93 A;  3I4L A;  4CJ1 B;  2L4N A;  3V2T A;  5C44 B;  3PO3 B;  2R93 B;  1GJX A;  2F0K A;  1WVL A;  3VR6 A;  1D2B A;  2CQA A;  3HOV B;  4CJ0 B;  4FYD A;  5KNB A;  2F0E A;  2R6G A;  2FFK B;  4RGT A;  5CBE E;  2VXW A;  2RQX A;  3S15 B;  1EEF D;  4F88 A;  4QUC A;  1B9N A;  4G57 A;  2NZ1 D;  4LK1 C;  2E2J B;  4RHS A;  1PFM A;  2PPB C;  1I3Q B;  1STN A;  3NHH A;  3QJY A;  1CHP D;  2K5D A;  1DXM A;  4S3S A;  1WD1 A;  1TU2 B;  3OPO A;  1IYU A;  5KIX A;  2A68 D;  4TRD A;  1XTC D;  2K5W A;  1TR5 A;  1HUN A;  4IQZ A;  4KN7 C;  5CV4 A;  5D65 A;  1A3V A;  2PZT A;  5DM7 3;  4RKL A;  4IN3 A;  1GUN A;  4CJ2 C;  4K5W A;  2VB2 X;  2OXP A;  4RCN A;  3X3M A;  4DGZ A;  1I4X A;  3VYT A;  3QOJ A;  4KY7 A;  5FLX E;  2KVM A;  2MJ8 A;  1ET6 A;  3GTM B;  2XWJ B;  1TVX A;  3Q22 A;  3T16 A;  1PTO D;  2AQ3 B;  4KTA A;  1F9Q A;  3MXP A;  3I4M B;  3AU7 A;  4L8J A;  5D3D A;  1B9M A;  1SSO A;  3MAQ A;  3BG3 A;  1RTN A;  1OO9 B;  4PMW A;  1J8I A;  1JE4 A;  2MHV A;  1QJO A;  1F2L A;  2SOB A;  1JIC A;  2WIN B;  5I6Y A;  1JB3 A;  5E1F A;  2XIW A;  2RDH A;  1MGS A;  3A55 A;  3BS1 A;  1YNN D;  3GTL B;  3PIO 3;  5CR3 A;  1BBX C;  1FD7 D;  3A7L A;  5IIF A;  4HMI A;  3D4D A;  1ZXT A;  3T56 B;  5IT9 L;  2FJ2 A;  5BN3 A;  1SNP A;  3R3O A;  4G7H C;  1E0B A;  3TP6 A;  2EYL A;  4O1N A;  3R8B A;  1I4Q A;  4A3B B;  2FHT A;  5EPK A;  1K8M A;  4O42 A;  4HSV A;  1SYG A;  4RGM A;  5ELB A;  5CMD A;  2A69 C;  3OMC A;  3CRK C;  2N55 A;  3A54 A;  4X3U A;  1M4V A;  2K03 A;  4XT1 B;  3C3L A;  2F1M A;  3SVM A;  1DYQ A;  2KED A;  2QCP X;  4BA1 I;  2RA4 A;  4HCS A;  2EYJ A;  3SK8 A;  1U4L A;  1PZJ D;  4KN4 C;  3HOY B;  1VCI A;  2A73 B;  5CV7 A;  1KLG D;  1I4R A;  2L1B A;  4UAI A;  2WKC A;  1A3U A;  5CV9 A;  4RGO S;  4M8A A;  3HEJ A;  1FYC A;  4V19 0;  1B3A A;  1OXS C;  5J22 A;  4HAE A;  5K36 H;  1XXG A;  3SHL A;  4RWS C;  3FKI B;  1PTO B;  4M1U B;  2G9D A;  4FVM A;  4XQJ A;  1MD2 D;  4KK7 A;  1LTI D;  5C5L A;  3MXU A;  4IUT A;  4NMZ A;  1X3P A;  1DD2 A;  2EY2 A;  3NUC A;  4ZAI A;  5IGF A;  4Q0F A;  2K28 A;  3OOC A;  1IKM A;  1U4M A;  1I4P A;  2L5T A;  2LFN A;  5ELC A;  5I6W A;  1STB A;  2CHB D;  5LL6 S;  4IUR A;  5D3I B;  1RDP D;  2QF7 A;  2ZXR A;  4RKB A;  1EWC A;  4FXG C;  3RZD B;  3A8J E;  2B39 A;  2EJG C;  1SAP A;  1IW7 D;  4XIG S;  2L0C A;  2E75 C;  1EY0 A;  1B4O A;  2JXM B;  1B53 A;  2OEO A;  1RF2 D;  2NVX B;  5C4Z A;  2R3Z A;  1CZG A;  3G7L A;  1HCZ A;  2ICE C;  4BS9 A;  1PDQ A;  3CKI B;  4N9T A;  4EQN A;  1F9S A;  2NBF A;  5FK9 C;  1ENA A;  4RAU C;  5KYL A;  2O5I C;  4HSP A;  1R4P B;  5KGU A;  5C0X I;  4KD3 A;  2F0P A;  3VA7 A;  3G6J B;  1HUM A;  2MGS A;  4A3E B;  3RZO B;  3KLR A;  2CW0 D;  4K6D A;  2F0M A;  1WTP A;  4RGN A;  2E2D C;  4ZUJ A;  2JSO A;  5LL6 X;  3Q24 A;  4PMC A;  1X3Q A;  3QB3 A;  1G29 1;  4X3S A;  1EWH A;  2B2U C;  3HKZ B;  5C0X H;  4KHZ A;  2K33 A;  1TWC B;  4XDX A;  1GOZ A;  1F2Y A;  1V1P B;  4A3G B;  4U68 A;  3LWE A;  4WJW A;  3S2D B;  3L3O C;  1HFG A;  1WCM B;  1STE A;  4IUN A;  1SFO B;  2JA6 B;  1W6J A;  2EYM A;  3NTK A;  5M3M B;  3P75 A;  5COR A;  2LKV A;  2YU9 B;  3J80 L;  4DFA A;  2NVY B;  3BDC A;  4TKO B;  4BY7 B;  4NP5 A;  1TWG B;  3NWS A;  1H9R A;  1EY9 A;  3K0Y A;  3SK6 A;  3L7Z C;  2Y0S B;  4DU9 A;  3MXN A;  1QE6 A;  3GO5 A;  1JOR A;  3D4R A;  4QCL A;  3OMG A;  2F0I A;  4FP5 D;  3FEW X;  5EPL A;  5C4J B;  1LO5 D;  4KKU A;  3DWA A;  2KCC A;  1RKN A;  4KJN A;  1H9J A;  1S5E D;  1NSN S;  1I6H B;  1CA6 A;  1OXT A;  5DEH A;  1T5E A;  1K83 B;  3M3Y B;  1AP0 A;  1C4Q A;  2D5D A;  4R8I A;  3GTO B;  5IGG A;  5K5P A;  2EYO A;  5HUR A;  3C1E A;  5EKI A;  3HOZ B;  1S5D D;  5I9P A;  4RA8 A;  4DAP A;  3C46 A;  1BOS A;  1JR0 D;  2MPM A;  1ILQ A;  1MBY A;  3F2U A;  3NQI A;  1WTV A;  1S5F D;  1DCZ A;  3NP8 A;  5C4X B;  3E5S A;  3NBI A;  3K58 A;  1LAB A;  3NK9 A;  3U9O A;  4K2L A;  1BUV T;  2EDG A;  1EZ8 A;  3TP5 A;  1HPC A;  1KTK A;  2Q8R E;  1KDC A;  4JBW A;  4FNF A;  2D2C C;  2KEE A;  5CC4 A;  1M8A A;  3K5M A;  1E2W A;  3GTJ B;  5E4X A;  4ZK9 B;  1CQV A;  2Q8T A;  2R7Z B;  2NUC A;  1WTO A;  1BCP C;  1QB5 D;  1RCV D;  4WOR A;  5EKL A;  3MFY A;  2JA5 B;  1TS5 A;  2F0V A;  1B2T A;  5KRU A;  1FNU A;  3I4N B;  4J6H A;  1GHK A;  2AQ1 B;  2NTT A;  4BBR B;  1G6Z A;  1Y8N B;  2JEA I;  4Z9C B;  1DM0 B;  3L9A X;  3OWF A;  4QB4 A;  1WTW A;  3CQZ B;  2WV6 D;  2KQ3 A;  5I2Y A;  1BR9 A;  5IGE A;  3U9S A;  3EVQ A;  1EL0 A;  2A69 D;  3I70 A;  5T1I A;  3A8K E;  5DM6 3;  3JAM E;  1Z47 A;  2KA7 A;  2F0L A;  1SJH D;  1RD9 D;  3S9W A;  2WII B;  3IKJ A;  1H9K A;  1PRT C;  2OF1 A;  4EQP A;  2IX3 A;  2EY5 A;  4OO1 I;  1NUC A;  1JWS D;  3DM1 A;  3W3A A;  2XWB B;  2PZU A;  3OW7 A;  1BF4 A;  1DJR D;  2HUG A;  4EQO A;  2RKS A;  1ROD A;  3EFX D;  5F2D A;  1SYF A;  4JK1 C;  5ELE A;  1RTO A;  2O5J C;  3FRP B;  3K5L A;  1GUG A;  1Q3L A;  4OO1 H;  4A3M B;  2B2Y C;  4KV6 A;  4PNY A;  1CZW A;  2BDO A;  3H6M A;  4R9W A;  2XVS A;  4KY6 A;  1PFN A;  1AFP A;  5J39 A;  2F0T A;  1GUS A;  1EYC A;  1WD0 A;  1KNE A;  3PO2 B;  3ONA B;  3IFD A;  3P20 A;  5EJW A;  2XSC A;  3C2P A;  2BA0 A;  5IGD A;  1C8C A;  1CHQ D;  1EY7 A;  4QMG A;  1ESR A;  1BDO A;  1D5Z C;  2F0H A;  3K57 A;  1MSH A;  4TSS A;  1EIG A;  1GHJ A;  3WOE A;  4F8M A;  3BVZ A;  3MFG A;  3I90 A;  4BWG B;  1E2Z A;  2M9V A;  3DXJ C;  3IFT A;  1UEA B;  1AZQ A;  4HTH A;  3J81 L;  4ID6 A;  4XYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...