1N36L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36L00
2F52A 3S1RH 4PG3A 4P75A 4DV1Q 4A3IG 1IBMQ 1KD1C 2Y0SG 1C7YA 1T9HA 1N9WA 3J81c 4HJ7A 1XNRQ 2PQAA 3PO3H 2I5LX 3I4NG 3M4QA 3CW2C 4IFDG 4XIGS 1KAWA 5FJ8G 4JI6Q 2R7ZH 4DV7Q 3GTOH 1VCIA 4B3RQ 2VNUD 1BBUA 2PI2E 3KF6A 2E8GA 2LSSA 3GO5A 1B70B 4LW1A 3G4SA 4LF4L 1EUJA 4GN4B 4X66L 2PMZE 2UUCQ 1VQGA 4LUOA 4POGA 4GLXA 4A3EH 4K0KL 5LMUL 1QVGA 1L2FA 1TWCH 3CXCA 2H5XA 3M4OH 5IP7H 1Q82C 1EFWA 4GKJL 1W2BA 5JJKA 2MFIA 2B63H 3RLNA 1K3RA 1VQNA 2UXDL 2NN6I 4OWTB 1TWHH 1FL0A 3AQQA 2E5LQ 3CQZH 4HJ9A 1VQ6A 3PCOB 2ZJPA 3SGIA 1XPOA 1QVCA 2UXBL 5M3MG 2UXCL 4TQUS 3T1YL 5GROA 1K8AC 5ELOA 5GAHC 5LMNQ 2ZTEA 3PO3G 2YV5A 1E1OA 4NXMQ 2K75A 2JA6H 1K8GA 2R7ZG 1MIUA 4B3TQ 1XMQL 4KI0A 3HOUH 3TS0A 1YEZA 4LUVA 4X62L 1PH1A 3E9IA 3A5UA 4A3DH 4LFBL 1VQJA 1UEBA 1OXSC 2HQLA 3KLWA 1J5EL 4YCUA 4DAMA 4JCVE 4J15A 3HKZE 4UP8A 1A8VA 4DR7L 3ZJYC 2XGTA 4LF4Q 1QVFA 2UUAL 4X66Q 4JOIC 1JT8A 2AWNA 3GTPH 4K0KQ 5IYCH 3KFUA 5LMUQ 1G6PA 1PH9A 1X54A 3H0GG 1XPUA 4IJHA 1PH4A 4GKJQ 1RL2A 3HOVH 3M9BA 2JA6G 1QUQB 3PV0A 2UXDQ 3S2DH 1HNZL 1ASZA 4LF8L 3KDFB 2ZTDA 1G291 3HOUG 3UE1A 1YJWA 1YJNA 4A3DG 2NN6G 3HKZG 2Z6KC 2JA9A 1CKMA 1MJCA 2UXBQ 2UXCQ 3T1YQ 1HZAA 3J7A5 3K8AA 2HIXA 3CPFA 4HIMA 1XMQQ 2NVXH 4YCVA 4GOPB 4C2MH 4DUYL 2F3IA 3HOZH 1QUQA 3UDXA 4EQ5A 5C4XH 4X62Q 3J81j 4A3JH 2KENA 4LFBQ 1BKBA 3KDFA 5IYCG 1J5EQ 3GDEA 2ID0A 1AH9A 4IOCA 1IYJB 1U5KA 4L5QA 3NENA 3TREA 4X64L 2K5HA 4R4QA 2A8VA 5LMNW 3BJUA 3DM3A 4DR7Q 4JG2A 4IO9A 4BY1H 3PUWA 4A3GH 2B3GA 1S40A 1CKOA 1UE6A 4NPSA 3ULPA 1E22A 1WI5A 1Q81C 2UUAQ 4GOPA 3H15A 4X6AH 3K0XA 3CC4A 2A1AA 4BXXG 4DR4L 3A0JA 1OXXK 1UE7A 4JI8L 5C0XI 1PHJA 4JYAL 4O2DA 2VZAA 3OW2A 4RG1A 4QGUA 3BZCA 2VQEL 1HNZQ 4A3KH 4LF8Q 1IXRA 3HOZG 1EOVA 4JI3L 1FJGL 5C4XG 3CP0A 1HZ9A 4A3JG 2MQHA 3CC2A 2N49A 3T1HL 1VQ7A 1VS0A 2NVTH 3S15H 5IWAL 5IYBH 3CCMA 1PH5A 3FHWA 1NJIC 2KHJA 1D8LA 3J80c 5FLMG 4JI1L 3A5ZB 2XTIA 3I4MH 2EQSA 4DUYQ 4A3GG 2C35B 5J3BA 2R92H 2EXDA 4DV6L 1L0WA 1X55A 4BA2I 3RZDH 1I3QH 4X64Q 2OWOA 1VQEA 3AFPA 2R6GA 3UDIA 1YIJA 4ALPA 1D7QA 3S1MH 3HOWH 3GTLH 2V1CC 3MEFA 4A3KG 4LF9L 2CQOA 4BY7G 1YJ9A 2OQ0A 2ZM6L 4A3BG 2AKWB 1JJCB 1WJJA 2IT1A 4NXNL 2VQFL 4JI8Q 4DV4L 1EQQA 4DR4Q 4NXML 4JYAQ 4JV5L 4IPHA 3GTMH 1HZBA 5IYBG 3PUVA 1KRTA 2VQEQ 1KHIA 1VQBA 1PH8A 4LF7L 2OTJA 4HJAA 3CCRA 4QIWE 4HJ8A 3AYHB 1OXVA 3I4MG 1HR0W 4JI3Q 1FJGQ 2R92G 1WCMG 5FLXc 4L5RC 4DKAC 3EIVA 3T1HQ 5M5XH 1VQOA 2YTXA 4GKKL 5JEAG 1MKHA 2N3SA 5IWAQ 5C3EH 3CD6A 4BBSH 4A3CH 1X56A 2D62A 2QEXA 4JI1Q 3Q8DA 1W3SA 3M85A 3FKIG 5JJIA 3F1ZA 1RIPA 5C4JH 1N8RC 2A19A 3PSIA 3TQYA 3S1QH 1JB7A 4DV6Q 2ZTCA 5IP9H 4B3SL 1YHBA 1HNWL 3JAMi 2JK8A 1K9MC 4IPCA 3E0EA 1PYBA 1FVIA 1IBLL 3CMEA 1SFOH 3S24A 1NY4A 1P8LA 5M3FG 3D31A 3HKSA 4A3MH 4JI2L 4LF9Q 4UY8C 4C3IH 2ZM6Q 2JJQA 4R4TA 2VQFQ 4NXNQ 4DV4Q 1PFSA 4GN3B 4JV5Q 1V9PA 4DV3L 3I7FA 3NEMA 2R7FA 2IY5B 3J81i 4LF7Q 4OX9L 5C44H 1VQHA 4BBSG 4A3CG 1IZ6A 1Q1EA 4DNIA 5GAEC 3I2ZA 1CSPA 3F8TA 3CF5A 4A3EG 2R93H 3RZOH 4IPDA 2D0PA 1VQMA 5IP7G 1PH3A 4GKKQ 4JBMA 1A62A 3E9HA 2B63G 3S14H 1EYGA 4KLKA 1YHAA 5M5YH 3OYYA 3CPWA 2UUCL 4L5SA 2Q2UA 2OQKA 4YHHL 2F4VL 5EAYA 3HOYH 2N78A 4DV2Q 4B3SQ 3LGJA 4LF6L 1HNWQ 1NE3A 2Q2HA 3CCEA 3G71A 3J7ZC 1M1KC 4R4OA 2K5NA 1GVPA 4QQBX 1X6OA 3TRZA 3U4ZA 1IBLQ 1L1OC 5C44G 1GKHA 4JI2Q 4QL5A 4XTCS 4A93H 4C3JH 1EQRA 2Z0SA 2DGYA 2EIFA 2R93G 1OXTA 2VUMH 2BH8A 1I6HH 3W1GA 4DV3Q 4HIDA 2PNHA 3ER0A 3PGZA 2RF4A 4OX9Q 4KHPL 4EX5A 1KC8C 1GM5A 4GN5A 2WB1E 1SR3A 2IX0A 4RMFA 1VQIA 1E7ZA 5GAGC 2JA7H 3TS2A 2GVBA 1JE5A 2D0OA 1DGSA 3HOYG 4HIOA 4GNXB 2MO0A 4R1JA 4DAYB 2KBNA 4DR1L 2HHHL 1NMGA 4PZ8A 3HOVG 2JQOA 4DR6L 4YWLA 2E2HH 2WFWA 2HT1A 1GD7A 3BU2A 3TEHB 4A93G 4YHHQ 1A0IA 2F4VQ 5IYDH 4A3LH 1PH2A 4LNQA 2YYZA 4YCWA 4MNOA 3GTQH 2WB1G 4LF6Q 1J6QA 4C3HH 1Y1WH 1EIYB 4GNXA 4AQYL 4DV0L 1S3OA 1Q7YC 4OWXB 4DV5L 1I5FA 5GQOA 4AIMA 1VQ5A 1N32L 2JA7G 5HGQA 2K4KA 3M4PA 3K7UC 1LYLA 1N33L 4A3FH 1K73C 1Q1BA 2NVQH 4IFDJ 2BA1A 5JEAJ 4A4IA 1YITA 2Q2TA 2N8NA 4WJ3M 2VL6A 5IT9c 4HJ5A 2NVYH 1V1QA 3RNUA 2IHEA 2AWOA 4JI7L 3S16H 3S2HH 3L0OA 4KHPQ 4BY1G 2Q2IA 2VW9A 4DUZL 1WYDA 5IYDG 3M3YH 2I5MX 4BBRH 1N34L 4A3LG 2OTLA 1HNXL 1M90C 1KL9A 3PIPA 4MZ9A 4AYBE 4DR1Q 2HHHQ 2RHQB 4OONA 3NBHB 4BA1I 1VQDA 1SE8A 4R4IA 1X3GA 4GOPC 4DR6Q 5AJ3L 2ASBA 3GD7A 3ULLA 3CCUA 3OTOL 4LF5L 1Q46A 2ATWA 3RLOA 1VQCA 4YY3L 4A3FG 1PH7A 2ZJQA 3I4OA 3CC7A 1BVSA 4PMWA 1IBKL 1E24A 2KCMA 4AQYQ 4PZ6A 4HIKA 4PZ7A 5C0XG 4DV0Q 3RN5A 3GTGH 2L15A 1QZGA 3K80C 1I50H 4GLVB 3EBEA 4DV5Q 3KJOA 1HH2P 1N32Q 4TVAB 1V43A 3JC66 1N33Q 3KOJA 2QGQA 4O0AA 3ULJA 1SN8A 1PA6A 3HOWG 5BR8L 3JAMc 4JI7Q 1N36L 1X9NA 4DUZQ 1QZHA 1EWIA 4X65L 3L2PA 4APVA 3DLLA 1TWGH 4DV2L 1N34Q 1HNXQ 3G48A 3AEVA 5JJLA 2RHSB 1KRSA 1YVCA 3BZKA 2I5HA 4UP9A 1KIXA 2K5VA 3MXNB 1OTCA 2HIVA 3D0FA 1OXUA 4AH6A 4DPGA 2VS1A 4UP7A 3G6EA 4P73A 4QJFA 5AJ3Q 5M3MH 1KXLA 3PIOA 1K83H 3CCSA 3CCLA 2YU9H 1E1TA 3OTOQ 1SMXA 2GN5A 3UDFA 3I56A 4LF5Q 4YY3Q 5IY0A 1Q8KA 3HFZB 3UE0A 2YTVA 1IBKQ 5E7NA 1L1OB 1BBWA 3ICEA 5C3EG 4A76A 3EN2A 4NB3A 1Q86C 2R7DA 1Y1VH 1XMOL 2NZHA 4UPAA 3U58A 1UE1A 4JOIA 1CSQA 3PO2H 4JI5L 3WWVA 4H02A 5IP9G 1Q12A 4R4CA 1VQLA 3AFQA 2UU9L 1VQAA 1YNXA 4OWWB 4DR5L 1YHQA 4P74A 2CWAA 4FDBA 3U50C 4LWCA 1B8AA 2VY3A 2FXQA 5BR8Q 3CCVA 3RN2A 2OCEA 1L1OA 4A3MG 1N36Q 2DUDA 2IX1A 1P16A 2QA4A 3H0GH 4X65Q 3S1NH 4P72A 2Z6KA 3K7AH 4A75A 1R9TH 3PUXA 2UUBL 1LTLA 1Y14B 4JBKA 1VQKA 1FGUA 2JE6I 3KF8B 4YWKA 1NMFA 3KYHC 1PYSB 3CMAA 2WP8J 2YTYA 1JJ2A 4B3ML 1Y1VG 3GTKH 1SLJA 1U0LA 3PF5A 1SRUA 1G51A 1VQFA 2JA5H 3PO2G 3I55A 3M7NA 1HR0L 4IPGA 4LFCL 5M5WH 1IL2A 1WOCA 1O7IA 4WJ4A 4YWMA 2LXJA 5ELNA 1VQ4A 1XMOQ 5HY6A 2BA0A 4LFAL 4QY7A 1JJGA 1XNQL 4KHZA 4OXPA 1Z47A 1I94L 2KCTA 1C0AA 1HJPA 4JI5Q 2UU9Q 3RLFA 4POFA 1WFQA 3W5OA 2PI2A 4DR5Q 3VDYA 4JI0L 4DR2L 1YI2A 2CCZA 1EIFA 3F2DA 1KQSA 4JC0A 4BXXH 1AE3A 2ZJRA 3A74A 4GLAC 2KHIA 2JA5G 3NELA 1GO3E 3F2BA 2UUBQ 2MO1A 2VUMG 1CUKA 5C0XJ 2K50A 3GTJH 3PF4A 4JBWA 4JI4L 2JA8H 2NZOA 1X3EA 1X65A 4ME3A 3W1BA 5IE8A 3CCQA 1TWAH 1XJVA 4B3MQ 1XTDA 3UDGA 2B29A 5GADC 1VQ8A 3IRBA 5FLMH 1HR0Q 2ES2A 4LFCQ 2GVAA 4L5TA 2CWPA 3RR5A 1TXYA 1C9OA 1TWFH 2AHOB 2CFMA 1VQPA 1X3FA 4OO1I 1H95A 4LFAQ 3ERSX 1LM0A 1XNQQ 3HOXH 4P71A 1I94Q 2JEBI 3U4VA 4DR3L 3FP9A 1PH6A 3L7ZC 1Y1WG 1VQ9A 4DK6C 4JI0Q 4DR2Q 1B7YB 1Z9FA 2JA8G 1E3PA 4DV1L 4BY7H 2MNAA 1IBML 4IFDI 4A3BH 3H3VI 1A63A 1AE2A 2K52A 2K14A 1PV4A 1XNRL 4LUZA 3KJPA 4GNXC 4JI6L 4Y7NH 4DV7L 1YBYA 5K36G 3S17H 1LUZA 4B3RL 2ALYB 3CCJA 2JEAI 4MTNA 1SROA 1MJEA 1PVOA 5DLQE 2WAQE 4JI4Q 4IJLA 1CKNB 1WCMH 4A3IH 4AYBG 2CKZB 3J80i 3I4NH 2LXKA 3STBC 1JMCA 4BBRG 5FJ8H 3H3VH 3STBD 3HOXG 2E2JH 3PUZA 2BH2A 1YZ6A 1NTGA 3CAMA 2Y0SE 2E5LL 1K0RA 3FKIH 5H1SE 1UE5A 2E2IH 2PQAB 3PUYA 4DK3C 3K81C 1UWVA 5LMNL 2WAQG 4JBJA 1CKNA 2AMCB 3KF6B 4Y52H 3F2CA 1HZCA 1ASYA 4OO1G 2IHFA 4DR3Q 3B6YA 2RCNA 1XPRA 1S72A 2I0QA 4B3TL 4IOAA 4GS3A 5M3FH 1NBWA
chains in the Genus database with same CATH superfamily
2F52A 4K5VA 4PG3A 4P75A 4DV1Q 3IFDA 3R93A 1N9WA 2PQAA 2KCCA 1WVLA 3CW2C 1F9SA 3M7GA 5FJ8G 4DV7Q 1VCIA 4B3RQ 1I4PA 2PI2E 3GO5A 3KF6A 4HCEA 5E4XA 1VQGA 2K1BA 1Q3LA 2A6HC 4KY7A 1L2FA 1KLGD 1SYGA 1Q82C 1KLUD 1SBBB 1W2BA 2OF1A 1EFWA 3RLNA 3GV6A 1VQNA 1TWHH 1VQ6A 1STBA 3PCOB 1EY6A 4G7HC 1F9QA 1UNSA 3T16A 1F2ZA 3HRZC 3T1YL 5GROA 5LMNQ 4HSPA 2HQEA 3KLSX 1E1OA 4C56C 5IODA 2E76C 1K8GA 2R7ZG 1EQVA 1H9RA 1PRTF 2PW5A 4IUPA 1Q90A 3FEWX 1W6JA 2RDHA 3E9IA 1GHJA 1VQJA 4FXGC 3BS1A 5M3FB 4S3SA 4YCUA 1O7ZA 4J15A 4NMZA 2Q8RE 5M9OA 2EY2A 1LTID 2F1MA 3SDZA 4X66Q 4JOIC 2TSSA 1STYA 3KFUA 5LMUQ 4KKSA 2JA6G 1PZKD 1G291 5IT9E 1SMYD 1EY9A 4A3DG 2NN6G 2UXBQ 1RD9D 1CKMA 1QNKA 2UXCQ 1ENCA 3J7A5 4R8NA 1XMQQ 3J80L 4C2MH 3HOZH 2F3IA 3UDXA 3J81j 4LFBQ 1BKBA 3PIO3 1J5EQ 3GDEA 5JAVA 1BDOA 2A8VA 1EEFD 4HN7A 1ZEQX 3DM3A 1EYAA 4IO9A 3T53B 4BY1H 1S40A 2UUCQ 1CKOA 4NPSA 4X3SA 4H7BA 1E22A 2UUAQ 5M5YB 2A1AA 3A0JA 1PHJA 1UE7A 5C0XI 1DYQA 4O2DA 4RGOS 5FLXE 3OW2A 4RG1A 3BZCA 4N9TA 3DWQA 5CBEE 5C4XG 1FJGL 1JWUD 4A93B 3SVMA 2EOTA 5IWAL 3SEBA 1ENFA 3FHWA 1NJIC 4F88A 3I4MH 2C35B 1Y8NB 2R92H 3MWYW 5IGEA 1L0WA 4EQPA 3RZDH 1I3QH 2PZTA 1VQEA 3NTKA 2EXZA 3EQLC 3S1MH 3HOWH 4KTAA 5EKLA 3VYSA 2RCFA 4A3KG 2QDBA 2AKWB 4NXNL 2PZUA 4JI8Q 1U4LA 4JYAQ 4B9WA 2RSNA 2PYKA 5CV8A 2AQ3B 1PH8A 2OTJA 2HDMA 4HJ8A 2KEEA 5C3WA 1KNEA 1CK1A 2J0TD 1U4PA 1ZXTA 5JOBA 3QOJA 4J8QA 5C3EH 4BBSH 2EYPA 3R2IA 2QEXA 2ICIA 3EJIA 1CTMA 3FKIG 2K5WA 1RIPA 2A19A 2QEJC 3TQYA 3S1QH 3VR3A 2ZTCA 5IP9H 3G7LA 3JAMi 3HS0C 1PFBA 1P8LA 4A3MH 2JSOA 3SK4A 4LF9Q 3E3XA 1FNWA 4K14A 4C3IH 1WTXA 2DJGC 4R4TA 3ND9A 1PFSA 3MHBA 4DV3L 1GUOA 4XT1B 2R7FA 4LF7Q 1AZQA 4A3CG 1Q1EA 1CSPA 2KQ3A 4XT3B 2Z1CA 1HA5A 2CW0C 2R93H 2ZT9C 2XIWA 1TY0A 5FO9B 5IP7G 4GKKQ 3S14H 3W3AA 1EYGA 1J9OA 2PCFB 1EWHA 3TMEA 1YHAA 3CPWA 2OQKA 5C3EB 4YHHL 4RWSC 3HOYH 2PO4A 1TVXA 4HSVA 3AMUA 3J7ZC 4R4OA 4QQBX 3E6ZX 3NE5B 3U4ZA 1NUCA 5C44G 2XN9C 4QL5A 2DGYA 5KIXA 4A3MB 4F87A 1K83B 1OXTA 2VUMH 3W1GA 4HIDA 4OX9Q 4FYDA 4GN5A 4RMFA 5GAGC 2K6AA 2GVBA 2EE1A 1XTCD 3NXWA 4DAYB 2HHHL 3HOVG 3MZ5A 2JQOA 4YWLA 5KRUA 2E2HH 3S14B 1GD7A 3BU2A 3TEHB 5A2QL 2F4VQ 5IYDH 2DY8A 1PH2A 4LNQA 1XXGA 2YYZA 4YCWA 2F3VA 3GTQH 1FR3A 1RTNA 2WB1G 5G3LD 1J6QA 3S1NB 1EWCA 3EA6A 3QB3A 1S3OA 3T13A 5J1ZA 2EYHA 4DV5L 1GOZA 3FRPB 4A3FH 4KK7A 1U4MA 3V96A 2HCIA 4E6IA 5IT9c 4OL7A 2VUMB 4KHPQ 2AWOA 3L0OA 1HFNA 4DUZL 4ZCKA 1D1IA 3M3YH 4BBRH 3RMHA 1M90C 2AQ2B 2LKVA 4MZ9A 4AYBE 1OO9B 4BA1I 4DR6Q 1SNDA 4XDXA 1IKMA 3GD7A 2J4XA 3OTOL 1O80A 2ZJQA 1M4VA 1GUGA 1MSHA 1TT2A 1BVSA 3DUZA 3NBIA 4OIKA 3CC7A 1K0SA 1SAPA 2M00A 1E24A 1PZJD 4AQYQ 1T5XD 3RN5A 3NBHA 4IALA 2BCOA 2QKIC 2RSOA 5C4ZA 2K04A 3DXJC 1CHQD 5FK9C 1N33Q 2QCPX 3HP3A 1JCKB 1PRTB 3RUZA 1RKNA 2PZWA 1SNCA 1YNJC 2F0TA 2HD3A 4Q0FA 1X9NA 3DLLA 1TWGH 1JB3A 1HNXQ 3MAQA 2RHSB 1KRSA 2B39A 4UP9A 3M3YB 3VA5A 2HIVA 1QE6A 4DPGA 1AN8A 5AJ3Q 1VDZA 1QB5D 2WAQB 2R3ZA 3HFZB 3UE0A 2YTVA 1O7LA 4RFBA 4Y7NB 1BBWA 4A76A 2B2YA 1Y1VH 3TP8A 3WWVA 1VQLA 1Q12A 4R4CA 1RJTA 2FHTA 2CHBD 1GUSA 1FYCA 2V4DA 5EPLA 3SK8A 2DUDA 2IX1A 3J7YW 1S5BD 2A69C 2ZXOA 2Z6KA 4RCOA 2JP1A 1Y14B 4MTKA 2JE6I 4DK1A 3KYHC 2D5DA 1PYSB 4CKBA 4IUVA 1NNXA 3H91A 2FFKB 1DOLA 3GTKH 2EJFC 4DXFA 2JA5H 1STAA 3PO2G 1JOQA 4LFCL 4B9XA 4CDDC 3IFTA 1B9NA 1WOCA 5ELFA 2R7ZB 5I9OA 4FNFA 1MBYA 1D2BA 3I73A 3E5SA 5IGDA 4OXPA 1R4PB 2F0JA 4JI5Q 2UU9Q 3A8JE 1TWCB 4JI0L 4DR2L 2CCZA 2B63B 1G2SA 4U68A 4TRDA 4KD3A 1AE3A 4GLAC 3NELA 1B4OA 4QB4A 5EJWA 3AU7A 4BS9A 2JA6B 2JA8H 2NZOA 5HURA 3N52A 2EJMA 5IE8A 4X3TA 1XJVA 4B3MQ 1R4QB 1XTDA 4A3DB 4CKEA 5A35A 2B29A 3P7JA 3IRBA 4H13C 4I7AA 4IURA 2GVAA 2CWPA 3BDCA 3RR5A 4OO1I 1VQPA 2KA7A 1WTRA 2H4OA 1I94Q 3U4VA 2BE5C 5EGTA 4DR3L 3OIPA 2EYJA 1E3PA 3DEPA 3R8BA 4DV1L 1A63A 1AE2A 2RVLA 1PV4A 2WINB 3J81L 1LV9A 4DV7L 5K36G 3S17H 4B3RL 3I8ZA 3CCJA 1SROA 1MJEA 5DLQE 2WAQE 2JN4A 4AYBG 3D6WA 2I07B 5C4XB 4IFDH 2K05A 3H3VH 3HOXG 1ZYRC 2KHSA 1K0RA 3FKIH 5IGCA 4CDEC 1UWVA 5LMNL 1CKNA 1ASYA 2I0QA 1U9RA 2O5JC 1HRJA 5I2XA 4A3IG 4A3KB 5CC4A 1C7YA 4HJ7A 5TSSA 3I4NG 4XIGS 4JI6Q 5AFWA 2E8GA 2AUJD 1B70B 5EQ0A 4X66L 2E75C 4LUOA 1B44D 2XSCA 4GLXA 4POGA 5LMUL 4M1UB 2H5XA 4CBVA 5IP7H 3CHBD 2MFIA 1LT5D 4OWTB 4DXGA 1FL0A 3AQQA 2ZJPA 3DM1A 2UXBL 3FKIB 3GTLB 2UXCL 1Y69U 1K8AC 2ZTEA 3PO3G 2F0UA 4NXMQ 1XMQL 3I3CA 2NUCA 3HOUH 3TS0A 2HDLA 4LUVA 4LFBL 2EYMA 1BBXC 2HQLA 1J5EL 3K59A 5KNDA 2E2DC 3OSOA 2B2YC 5M5XB 3ZJYC 2XGTA 1S5DD 2UUAL 2F3WA 1SXTA 3GTPH 1EIHA 1KABA 2A73B 1X54A 1M8AA 4IJHA 3NUCA 1DM0B 3HOVH 4GKJQ 1ASZA 1SMYC 2ZXPA 3MC0B 1PFNA 4JK1C 1YJNA 1DZ1A 4IUNA 2Z6KC 1MJCA 1HZAA 3K8AA 1PXUA 2CH4W 3KLSA 3CPFA 4KV6A 4HIMA 2NVXH 1QNUA 3DWAA 1QUQA 3KDFA 5C44B 1G8ZD 5IYCG 1AH9A 1IKLA 2B2VA 5BN5A 4RA8A 4R4QA 1B2TA 1F2MA 2WACA 3PUWA 4A3GH 2B3GA 2EY5A 1Q81C 4X6AH 4GOPA 3WOFA 2IPKD 4BXXG 1OXXK 4JI8L 4JYAL 1PTOC 5KYIA 4QGUA 1EIGA 2EYFA 1HNZQ 5L37A 3HOVB 4A3JG 1H9SB 2N49A 1I4RA 3P75A 1VQ7A 3TSSA 5IYBH 1PH5A 4KY5A 2WB1B 2KHJA 3J80c 2IX3A 2RQXA 2EQSA 1D1KA 5J3BA 2NVXB 3A54A 1EY4A 1EQTA 1I6VC 4X64Q 1HHVA 2R6GA 2B2UA 3TZDA 4ALPA 3NQTA 2F0NA 5JVH3 4LF9L 1KNAA 4BY7G 2B2WC 4EQOA 4DR4Q 1HPCA 2IL8A 4IPHA 1BCPC 1NR4A 1C4QA 2MPMA 1CHPD 1KRTA 1VQBA 4LF7L 3CCRA 5EBDA 3AYHB 2KECA 4L5RC 3EIVA 3U9OA 1VQOA 3BVZA 4GKKL 2L55A 3CD6A 1X56A 1KDCA 3Q8DA 3M85A 3PSIA 4DV6Q 1YHBA 3A55A 3HGBA 2JK8A 3I4LA 1K9MC 2F0KA 4ZYSA 1E0BA 3OMCA 2VQFQ 2F0EA 4GN3B 1S4ZA 1V9PA 3NEMA 2IY5B 4OX9L 4FXKC 1IZ6A 1RF2D 1CZGA 2XRSD 4XQJA 2XRQD 2B63G 2EYLA 4CJ2C 4QUFA 1SEBD 5M5YH 3OYYA 2F4VL 2P5ZX 2N78A 4DV2Q 3VR5A 3LGJA 5LL6X 4DN4M 3CCEA 3OMGA 1M1KC 1GVPA 3O13A 1X6OA 4KKUA 4IN3A 3WDNA 1L1OC 1CQVA 4JI2Q 5DNFA 1STEA 4XTCS 4A93H 2Z0SA 4RHRA 1PTOB 1ICFB 2BH8A 1PFMA 1V1OA 3ER0A 3PGZA 2RF4A 4KHPL 2A5HA 2WB1E 3TS2A 3K0YA 1E7ZA 1JE5A 2D0OA 5CGKA 1TQOA 4GNXB 3PO2B 2B2TC 2HUGA 4DR6L 1XWEA 3CRKC 5JJZA 1STGA 1SYBA 4A3LH 3L9AX 1F9PA 1DJRD 4LF6Q 4AQYL 3ITPA 1R9TB 5LL6S 1Q7YC 1I5FA 2JA7G 5HGQA 3M4PA 5CMDA 1N33L 3BVGA 5JEAJ 2Q2TA 1BCPB 2N8NA 3VYRA 4LK1C 2A6EC 4XQNA 1V1QA 3RNUA 2IHEA 3T56B 3S2HH 3JAML 2B2VC 2K03A 2OEOA 4XQQA 2NBFA 4DFAA 1HNXL 1KL9A 1DCZA 3EFXD 4C3HG 4H44C 1SE8A 4GOPC 4PMCA 5AJ3L 1SNOA 1WD1A 3ULLA 2ATWA 5IIFA 4PMWA 2Q8IB 2F0LA 1HA6A 4PZ6A 4HIKA 4PZ7A 4DV0Q 2L15A 1LABA 1QZGA 1J8IA 3EBEA 3A7LA 4EVOA 1RTOA 4TVAB 2F03A 1TWAB 2J7ZA 4RHSA 4O0AA 3OWEB 3CRLC 1PMRA 1PA6A 2SNSA 4APVA 1LLRD 3S2HB 3R2TA 4AYBB 1N34Q 2K33A 1YVCA 3BZKA 1KIXA 3K58A 3MXNB 3HOXB 2VS1A 1IYVA 1KXLA 1K83H 3I70A 4B08A 3I56A 4LF5Q 2GN5A 2Z8LA 4YY3Q 1Q8KA 3K5LA 3FPUB 1L1OB 3EN2A 2KEDA 4NB3A 1Q86C 2F0PA 4G4KA 1LTTD 2A6HD 3MVVA 1SDFA 4A3IB 4JI5L 2UU9L 4PV1C 4MN3A 5D3IB 3SHLA 3I4NB 1YHQA 3HEJA 1AZPA 2CWAA 4FDBA 3OHXC 5BR8Q 1N36Q 1P16A 3S1NH 3PUXA 1LTLA 3KF8B 4YWKA 3SXHA 2YTYA 4DK0A 4B3ML 1SLJA 1WTQA 1ET6A 3A56A 4K5XA 3MFYA 3PO3B 2PMZB 4IPGA 5M5WH 3BG3A 1O7IA 3GTOB 4WJ4A 3GP7A 4YWMA 3A8KE 1BOSA 3BZDB 2F0IA 2BA0A 3D4WA 1JJGA 2L5TA 1I94L 1C0AA 1RDPD 4QF4A 4POFA 3W5OA 3M4OB 4JPBW 2PI2A 3A7AB 4KY6A 1YI2A 3F2DA 1KQSA 1DOMA 3CQZB 4BXXH 4I65A 2ZJRA 1I4HA 1V1PA 1GO3E 2VXWA 5C0XJ 2K50A 3N6RA 1AFPA 2L0CA 4KJNA 3W1BA 5C6AA 1EFID 1HQRD 2K5DA 1SJHD 2O2LD 3LNNA 2ES2A 1K8MA 1ILQA 5BN4A 4WJWA 5I6WA 4L5TA 1ESFA 5M5WB 1EY0A 4C1NI 1X3FA 1H95A 4LFAQ 5CV4A 3ERSX 1XNQQ 5JVG3 2PNRC 2JEBI 1LT6D 4DK6C 2K28A 1SJED 4BY7H 3S2DB 4IFDI 3CKIB 4K6LA 3H3VI 2K52A 4JI6L 4Y7NH 1YBYA 1LUZA 2ALYB 4ZAIA 2JEAI 1T5EA 3QO2A 4JI4Q 1LT3D 3TN2A 2CKZB 1F77A 4DNTB 2LXKA 4A3JB 5FJ8H 3VR4A 3PUZA 1YZ6A 4PNYA 3CAMA 5H1SE 1UE5A 2PQAB 3PUYA 4ZUIA 3W2DA 4JBJA 1S5ED 2AMCB 3KF6B 4RH6A 1HZCA 4OO1G 4JW0A 1HQMC 4GS3A 4IZ8A 1LTAD 1PDQA 3S1RH 2SEBD 1KD1C 1TS5A 1XNRQ 3J81c 4BY7B 2I5LX 3ZYYX 3M4QA 1QJOA 1KAWA 2R7ZH 2VNUD 1BBUA 3TZUA 2NVTB 4LW1A 3G4SA 3J7AF 3S15B 5D65A 1EUJA 4RGTA 2PMZE 2F0MA 3URYA 1QVGA 2SNMA 1TWCH 3CXCA 4ZKCB 4GKJL 5JJKA 2B8GA 4IUQA 2B63H 1K3RA 4HJ9A 2LMCB 3SGIA 1XPOA 4TQUS 3L3OC 2YV5A 2JA6H 1MIUA 1PRTD 1YEZA 3A5UA 4A3DH 2NN6H 4WFN3 1OXSC 3KLWA 3BDOA 4PMBA 3S1RB 4UAIA 1A6XA 2KCNA 1A3TA 5KYLA 4UP8A 1A8VA 4LF4Q 1JT8A 2AWNA 4K0KQ 2FJ2A 1IW7D 2F0OA 1PH9A 5C4JB 3H0GG 1XPUA 1PH4A 1RL2A 1HTLD 3DHQA 2OT2A 3PV0A 4L8JA 2UXDQ 1HNZL 3ONAB 2QDLA 3J80E 1L0XB 3HKZG 5JPNC 1SFOB 2JA9A 1ML0D 2HIXA 3FVQA 1SNQA 1VMPA 1X3QA 4J1MA 5BN3A 4HAEA 1B53A 5C4XH 4X62Q 2KENA 2K01A 2F0GA 2ID0A 1IYJB 1U5KA 4L5QA 3NENA 4IUTA 4X64L 1CA6A 1EY5A 2K5HA 5LMNW 3RZOB 3BJUA 3OIQA 4DR7Q 3ULPA 1UE6A 1LT4D 3NK9A 4DR4L 3FDTA 1PTOF 2EY6A 4XXEA 2A68D 4A3KH 4LF8Q 1IXRA 2NB0A 3HOZG 1EOVA 3HZXA 4K5WA 1ILPA 1HZ9A 1NAPA 5FLXL 1VS0A 1LTGD 1SYDA 3CCMA 3QR8A 1I6HB 2O5IC 3A5ZB 2XTIA 4YIJA 4DUYQ 4ZUJA 4DV6L 1I4XA 2JA7B 1IYUA 1Z7TA 1X55A 3ND8A 4BA2I 3AFPA 3UDIA 1YIJA 1BF4A 3GTLH 2V1CC 3D8GA 5KEEA 2CQOA 5CBAE 2JXMB 4A3BG 1JJCB 2BDNA 2IT1A 2VQFL 1BCPF 3GTMH 2PQEA 3PUVA 2VQEQ 1KHIA 1X3PA 5I4DA 4CKCA 4HJAA 4C3HB 1Y1WB 3I4MG 1OXVA 1HR0W 1NR2A 4JI3Q 2R92G 1WCMG 2CVRA 3T1HQ 5M5XH 2YTXA 2NVQB 5JEAG 1MKHA 4A3CH 4JI1Q 4DAPA 1W3SA 1EZ8A 5HGTA 1RODA 3F1ZA 5JJIA 1YNJD 2NVYB 1N8RC 5ELBA 3S16B 2Q8TA 4GZYC 3F2UA 4IPCA 2KVMA 1PYBA 1EYDA 3S24A 3U9SA 1H9KA 3HKSA 4JI2L 4UY8C 2OXPA 2ZM6Q 3QIAA 4DV4Q 5CORA 4JV5Q 2E74C 3H09A 2RKSA 3J81i 3G6JB 4BBSG 1ENAA 5C44H 2L1BA 2LY7A 4DNIA 5GAEC 3GTMB 2CH4A 3CF5A 4A3EG 1I4GA 4G57A 3BDLA 4IPDA 1PH3A 2EVBA 2IJ0A 3E9HA 1SE2A 4ODGA 1IL8A 4KLKA 5J39A 2NTTA 3I90A 4TSSA 2UUCL 4L5SA 1EY7A 4DA2A 5EAYA 1EL0A 1GXDC 4C3IG 4B3SQ 4LF6L 1HNWQ 3G71A 2ENBA 2WKDA 1X32A 4RAUC 1IBLQ 5C4HA 4LAAA 1GKHA 1EQRA 3KLRA 5DM63 2R93G 4J6HA 4K2KA 4CDFC 2G9HD 2YU9B 1QILA 1JE4A 4EX5A 1KC8C 1SR3A 2C9OA 1DGSA 3HOYG 4HIOA 5A2QE 2MO0A 5T1GA 5CV7A 1H9MA 2DY7A 3NTIA 3S9WA 2WFWA 2SOBA 4LMQD 5G3LF 4MNOA 3K5NA 4ULLA 5ELCA 5E1FA 3K7AB 1U4RA 4DV0L 2X6GA 1TS4A 1EY8A 2KUMA 1RHPA 3BYYB 4AIMA 1VQ5A 1LACA 5IOCA 5CV6A 5LHY1 2K4KA 1TU2B 1MHWC 3K7UC 4EQNA 2Z9HA 2BA1A 4A4IA 1YITA 3C2PA 1MSGA 2IW3A 2Q2IA 3D6CA 2VW9A 1WYDA 5IYDG 5D14A 1N34L 2BE5D 4IQZA 4O1NA 4DR1Q 1QWYA 3NBHB 1A2TA 4XYQA 3OWFA 4R4IA 2ASBA 4K8IA 3CCUA 4LF5L 1Q46A 1VQCA 4HMIA 4YY3L 4A3FG 4N8X1 1STNA 2VB3X 4KN7C 2KCMA 3I72A 5C0XG 3GTGH 3K80C 1I50H 3GTJB 3GV3A 1Y8PB 1HH2P 3NQIA 1WTOA 1N32Q 1V43A 3OPOA 1XYIA 4X3KA 1ET9A 5EKKA 1O7YA 1JORA 1JQYD 4FF3A 3ULJA 1SN8A 2NYZD 5BR8L 3JAMc 5KGUA 4JI7Q 1N36L 4OELB 2XWBB 1EWIA 5FO8B 3G48A 5E4WC 3AEVA 2I5HA 2K5VA 1OTCA 1K3BC 3D0FA 3QOLA 3WOEA 1OXUA 3IKJA 4UP7A 2H1EA 4P73A 4UHVA 1PTOH 3CCLA 1SMXA 4RGNA 3UDFA 5IY0A 1TY2A 1IBKQ 5E7NA 5ELDA 2ICEC 1MD2D 1A3UA 4ZLTF 3P1HA 4CHTB 2R7DA 3DWPA 2BOSA 4UPAA 3GTGB 4DGZA 1UE1A 1I50B 1CSQA 3PO2H 1JOOA 1VQAA 2E2JB 4L63B 3U50C 4LWCA 1B8AA 2FXQA 3RN2A 2PW7A 3H0GH 4X65Q 2E2IB 4P72A 1R9TH 3PIP3 1SYEA 2F0DA 1NMFA 3CMAA 1EZ6A 2CQAA 3NP8A 1Y1VG 1EOTA 1JWSD 1U0LA 1G91A 1VMCA 1G51A 1SNPA 3FPPA 1HUNA 4I7ZC 3SR1A 1XX8A 3FMCA 2RDFA 4BWGB 1VF7A 1WTHA 1NCVA 1ESRA 1JC7A 2LXJA 1VQ4A 1XMOQ 5HY6A 1K28A 4LFAL 4QY7A 1XNQL 1PZID 1Z47A 4K6DA 1HJPA 3RLFA 1WFQA 4DR5Q 3VDYA 1A3VA 3IAYA 2QILA 1TWHB 4JC0A 4L6TB 1TIID 1MGSA 4C3JG 2KHIA 2JA5G 3TDQA 1W6KA 1UAPA 2UUBQ 2MO1A 3H0GB 1CUKA 1SSOA 4JBWA 4JI4L 4HR7B 3TBIB 1X3EA 1X65A 4ME3A 3EVQA 3CCQA 1TWAH 3K5OA 1PLFA 1SYFA 4R8IA 1TS3A 4JVZA 3HKZB 4ILWA 1FGBD 5K36H 2Z6BA 3PMFA 5GADC 2KOLA 4Q5VA 2KJXA 1HR0Q 1HUMA 4KD4A 4NW2A 5KNBA 2FMCA 2XVSA 3D3RA 4FF2A 2EY1A 1C9OA 1TWFH 2AHOB 1FNVA 3BYTB 1STHA 3NSWA 1LM0A 1YNND 4P71A 3HOXH 1PTOD 3J81E 2DNEA 3FP9A 1PH6A 3L7ZC 1Y1WG 1VQ9A 4RGMA 1Z6HA 1Z9FA 2JA8G 4HCSA 4A3BH 2MHVA 1XNRL 2AQ1B 4LUZA 2G5DA 4FXDA 2XWJB 4ZK9B 1PVOA 4MTNA 2M9VA 1EU4A 2FINB 1CKNB 1WCMH 4IJLA 5IGFA 4FO2A 4A3IH 3SE0A 4C2MB 3HOZB 3J80i 3I4NH 1JMCA 1SNMA 3STBD 5JEAH 1JICA 3V2TA 2R61A 4RCNA 2DNCA 1JOKA 3H94A 2SDFA 4BY1B 4HEDA 1D5XC 4WORA 5C3XA 4Y52H 1TWFB 3F2CA 2B2UC 2IHFA 3B6YA 1QCBD 2RCNA 1S72A 5DAUA 2DJFC 4IOAA 1BCPD 1C48A 3K0XA 1NBWA 3K5MA 5CYUA 2NWGA 3D4RA 1IBMQ 2Y0SG 1T9HA 3I91A 4OEMB 3PO3H 4QMGA 4IFDG 4A3BB 3GTOH 3SK6A 1WTWA 2LSSA 1QOHA 1LTSD 3NPPA 4LF4L 4GN4B 3M4YA 4K0KL 4A3EH 5EPKA 2F0HA 3I4MB 1GUTA 3M4OH 1BUVT 2R92B 1WCMB 2UXDL 2NN6I 3RZDB 1I3QB 3LWEA 3CQZH 2E5LQ 3MXUA 4G7ZC 4MHEA 4N9PA 3GQBA 3MXGA 1QVCA 4ZQ3A 4V0BA 3HOWB 3S1MB 5M3MG 1V8QA 1LTRD 5ELOA 5GAHC 4KMUC 2K75A 4QIWB 4B3TQ 3Q6SA 4KI0A 1S5CD 1PRTC 2EDGA 3Q22A 4N8FA 1B9MA 4X62L 5F2DA 1PH1A 5I2YA 3UI2A 1UEBA 2K5QA 2LS01 1F9RA 2M2LA 2RA4A 4DAMA 4JCVE 1WTVA 1EYCA 3HKZE 4DR7L 1E2WA 1B50A 1HFGA 1QVFA 4BBSB 1IW7C 3DEOA 5IGBA 5FKAC 5IYCH 4OGQC 1G6PA 4A3EB 3S1QB 3M9BA 1QUQB 3S2DH 4QCLA 3MXPA 3KDFB 4LF8L 2ZTDA 3HOUG 3UE1A 1YJWA 3MEHA 1ZKOA 2G9DA 3T1YQ 3TP6A 2MJ8A 4C3IB 3OW7A 4YCVA 4GOPB 4DUYL 4C1NK 4EQ5A 4A3JH 4IOCA 3TREA 1CT1D 2R93B 1LTBD 4NDXA 4KJOA 4JG2A 4RKBA 2L4NA 1WI5A 3H15A 3CC4A 4ABNA 2B8FA 1F2LA 4HMJA 2ZXRA 4HTHA 3QG1A 3TP7A 1A2UA 2VZAA 3Q0AA 3HOYB 1JWMD 2VQEL 2A68C 1GUWA 5J22A 1CI3M 3A8IE 4LJZC 1JR0D 4JI3L 3CP0A 3LWUA 2MQHA 3CC2A 1PYWD 2Z4IA 4NKLA 3T1HL 4X3UA 2NVTH 3S15H 2PPBC 3PQIA 1SE4A 5DEHA 1Y8OB 2A74C 1D8LA 5KNCA 5C0XH 5FLMG 3C46A 4JI1L 2A6ED 4FVMA 4A3GG 2I46A 4UDUC 2EXDA 1II3A 3IL8A 1H9SA 2OWOA 1K8OA 1D7QA 3EROA 3MEFA 3MA2B 1YJ9A 2OQ0A 2ZM6L 2F0WA 3CU7A 2EYOA 1IHZA 1WJJA 2E2HB 4DV4L 1EQQA 4JV5L 2F0QA 4NXML 3X3MA 1E2ZA 1HZBA 5IYBG 3GTQB 4MIUA 3DMUA 4QIWE 1ONLA 2F0VA 1FJGQ 5FLXc 3T4AC 3OOCA 2EZVA 4DKAC 1GHKA 5CR3A 2TMPA 4A3FB 3C1EA 2N3SA 4OHJA 5IWAQ 2D62A 1D5ZC 3AB9A 5C4JH 1EU3A 3BVMA 1JB7A 1DONA 4B3SL 1HNWL 1WTPA 4FP5D 3NWTA 4BBRB 3E0EA 1FVIA 4CJ0B 1IBLL 3CMEA 1SFOH 5M3FG 1NY4A 1QG7A 3D31A 1HXYD 1KDBA 2JJQA 4NXNQ 5FO7B 5EKIA 3I7FA 1MI2A 1B3AA 1E2VA 1VQHA 2N55A 4ZKBB 3I2ZA 3ERQA 5IGGA 3F8TA 3MFGA 1CQFA 1AEXA 2CW0D 3RZOH 2D0PA 1VQMA 4WRDA 4JBMA 1A62A 5ISRA 1EEID 2K7VA 3R3OA 2Q2UA 2GA4B 1BR9A 4U673 4CDCC 1ICWA 1NE3A 2Q2HA 1TWGB 3E0JA 3J7AV 1TKWB 2K5NA 1B1ZA 3TRZA 4K2LA 1D6EC 4DU9A 3KUPA 1L0YB 4C3JH 2EIFA 1NSNS 2F0FA 4G7OC 2EJGC 2NZ1D 1I6HH 4KHVA 4KN4C 5D3DA 4DV3Q 5IT9L 2PNHA 4Z9CB 1WD0A 3H3VC 4F7XA 2WKCA 1GM5A 1C8CA 1UUPA 2IX0A 2D9UA 1VQIA 2JA7H 3QJYA 1Y1VB 3MTSA 4R1JA 3KBXA 2KBNA 4DR1L 1NMGA 4PZ8A 2N88A 5T1IA 2HT1A 3VA7A 4YHHQ 1A0IA 4A93G 3K6OA 5CV5A 4C3HH 1EIYB 1Y1WH 2IWHA 3X3NA 4GNXA 5C5MA 4KKTA 5I6YA 4OWXB 2Z4HA 5GQOA 1N32L 1FNUA 4FF4A 3JAME 1LYLA 2NVQH 1K73C 1Q1BA 4IFDJ 5ELEA 3GTKB 4C3JB 4WJ3M 2VL6A 2MP1A 4HJ5A 2JA5B 2NVYH 4K8JA 2VB2X 1B3QA 4JI7L 3S16H 4BY1G 2L12A 4XYOA 3NTHA 4CJ1B 2I5MX 4RKLA 4A3LG 2OTLA 1O78A 2B2WA 3PIPA 2HHHQ 2RHQB 4OONA 5FOBB 1VQDA 1CA5A 1X3GA 5E3FA 1FD7D 1HTPA 4EGVA 5JPMC 3C1FA 2K32A 3RLOA 1PH7A 3I4OA 1IBKL 2X6LA 4GLVB 4DV5Q 4M8AA 3KJOA 2JA8B 5C5LA 1UEAB 3JC66 4P2CB 2L11A 3KOJA 2QGQA 4R9WA 3RD4A 2QW7A 3HOWG 4DUZQ 1QZHA 3L2PA 4X65L 1HCZA 2BDOA 1GUNA 4DV2L 2F0SA 5JJLA 3NHHA 3LX0A 4ZRZA 4AH6A 3G6EA 4QJFA 2AUKA 5M3MH 3PIOA 1TS2A 3CCSA 2YU9H 1E1TA 3OTOQ 3KK7A 2F4IA 3ICEA 2C5CA 5C3EG 3S17B 1G2TA 3MXNA 1XMOL 2NZHA 3U58A 3V05A 4JOIA 2Y0SB 1BQQT 2FMMA 4H0LC 4H02A 5IP9G 3AFQA 4OWWB 1YNXA 1CM9A 4DR5L 4P74A 2MUYA 1DOKA 1H9JA 2VY3A 2LFNA 3NWSA 3CCVA 2OCEA 1L1OA 4A3MG 1SE3A 1DXMA 1A15A 2QA4A 2A69D 3K7AH 4A75A 2UUBL 5NUCA 4JBKA 1SYCA 1VQKA 1FGUA 1TR5A 4DF7A 2WP8J 2RBMA 1JJ2A 1AW7A 2XNAC 4QUCA 3PF5A 1SRUA 2HCCA 5M3MB 1VQFA 3I55A 3M7NA 5K5PA 3VYTA 1HR0L 1IL2A 2JYOA 3VR2A 3KF8A 2DN8A 2B2TA 1F2YA 5ELNA 3HG9A 1V1PB 1BNZA 1D5MC 2D2CC 4V190 4KHZA 2KCTA 2WV6D 1RCVD 3TP5A 1DD2A 1S5FD 5COYA 1EIFA 4CGYB 4DNRB 3A74A 3F2BA 3P20A 2VUMG 3PF4A 3GTJH 2EPBA 1KDAA 4DAYA 3HOUB 3UDGA 4NP5A 3VR6A 3D4DA 1VQ8A 4O42A 1AP0A 5FLMH 2X69A 4LFCQ 1LO5D 5EPJA 4DAVA 1TXYA 5CV9A 1KTKA 1BO0A 2CFMA 1YNNC 2L9HA 3Q24A 3GTPB 3K57A 1CZWA 2O4XA 1BXTA 4JI0Q 4DR2Q 1B7YB 4FF1A 2MNAA 1IBML 2NTSA 3SK5A 2K14A 3KJPA 1G6ZA 4GNXC 4OO1H 1GJXA 4OIJA 4TKOB 4ID6A 2WIIB 3QWNA 3Q23A 3H6MA 3T51B 1I4QA 2MGSA 3STBC 1VF5C 2QF7A 3VYUA 4BBRG 2E2JH 2BH2A 1NTGA 1ZYRD 2Y0SE 2E5LL 4F8MA 4ME5A 4IUUA 2E2IH 5I9PA 4DK3C 3KBGA 4PQXA 3C3LA 4A3GB 1Q8IA 3K81C 1CFMA 2WAQG 5DM73 2RDGA 4DR3Q 1XPRA 4B3TL 1KAAA 5M3FH 5EBCA
chains in the Genus database with same CATH topology
2F52A 3S1RH 4PG3A 4P75A 4DV1Q 4A3IG 1IBMQ 1KD1C 2Y0SG 1C7YA 1T9HA 1N9WA 3J81c 4HJ7A 1XNRQ 2PQAA 3PO3H 2I5LX 3I4NG 3M4QA 3CW2C 4IFDG 4XIGS 1KAWA 5FJ8G 4JI6Q 2R7ZH 4DV7Q 3GTOH 1VCIA 4B3RQ 2VNUD 1BBUA 2PI2E 3KF6A 2E8GA 2LSSA 3GO5A 1B70B 4LW1A 3G4SA 4LF4L 1EUJA 4GN4B 4X66L 2PMZE 2UUCQ 1VQGA 4LUOA 4POGA 4GLXA 4A3EH 4K0KL 5LMUL 1QVGA 1L2FA 1TWCH 3CXCA 2H5XA 3M4OH 5IP7H 1Q82C 1EFWA 4GKJL 1W2BA 5JJKA 2MFIA 2B63H 3RLNA 1K3RA 1VQNA 2UXDL 2NN6I 4OWTB 1TWHH 1FL0A 3AQQA 2E5LQ 3CQZH 4HJ9A 1VQ6A 3PCOB 2ZJPA 3SGIA 1XPOA 1QVCA 2UXBL 5M3MG 2UXCL 4TQUS 3T1YL 5GROA 1K8AC 5ELOA 5GAHC 5LMNQ 2ZTEA 3PO3G 2YV5A 1E1OA 4NXMQ 2K75A 2JA6H 1K8GA 2R7ZG 1MIUA 4B3TQ 1XMQL 4KI0A 3HOUH 3TS0A 1YEZA 4LUVA 4X62L 1PH1A 3E9IA 3A5UA 4A3DH 4LFBL 1VQJA 1UEBA 1OXSC 2HQLA 3KLWA 1J5EL 4YCUA 4DAMA 4JCVE 4J15A 3HKZE 4UP8A 1A8VA 4DR7L 3ZJYC 2XGTA 4LF4Q 1QVFA 2UUAL 4X66Q 4JOIC 1JT8A 2AWNA 3GTPH 4K0KQ 5IYCH 3KFUA 5LMUQ 1G6PA 1PH9A 1X54A 3H0GG 1XPUA 4IJHA 1PH4A 4GKJQ 1RL2A 3HOVH 3M9BA 2JA6G 1QUQB 3PV0A 2UXDQ 3S2DH 1HNZL 1ASZA 4LF8L 3KDFB 2ZTDA 1G291 3HOUG 3UE1A 1YJWA 1YJNA 4A3DG 2NN6G 3HKZG 2Z6KC 2JA9A 1CKMA 1MJCA 2UXBQ 2UXCQ 3T1YQ 1HZAA 3J7A5 3K8AA 2HIXA 3CPFA 4HIMA 1XMQQ 2NVXH 4YCVA 4GOPB 4C2MH 4DUYL 2F3IA 3HOZH 1QUQA 3UDXA 4EQ5A 5C4XH 4X62Q 3J81j 4A3JH 2KENA 4LFBQ 1BKBA 3KDFA 5IYCG 1J5EQ 3GDEA 2ID0A 1AH9A 4IOCA 1IYJB 1U5KA 4L5QA 3NENA 3TREA 4X64L 2K5HA 4R4QA 2A8VA 5LMNW 3BJUA 3DM3A 4DR7Q 4JG2A 4IO9A 4BY1H 3PUWA 4A3GH 2B3GA 1S40A 1CKOA 1UE6A 4NPSA 3ULPA 1E22A 1WI5A 1Q81C 2UUAQ 4GOPA 3H15A 4X6AH 3K0XA 3CC4A 2A1AA 4BXXG 4DR4L 3A0JA 1OXXK 1UE7A 4JI8L 5C0XI 1PHJA 4JYAL 4O2DA 2VZAA 3OW2A 4RG1A 4QGUA 3BZCA 2VQEL 1HNZQ 4A3KH 4LF8Q 1IXRA 3HOZG 1EOVA 4JI3L 1FJGL 5C4XG 3CP0A 1HZ9A 4A3JG 2MQHA 3CC2A 2N49A 3T1HL 1VQ7A 1VS0A 2NVTH 3S15H 5IWAL 5IYBH 3CCMA 1PH5A 3FHWA 1NJIC 2KHJA 1D8LA 3J80c 5FLMG 4JI1L 3A5ZB 2XTIA 3I4MH 2EQSA 4DUYQ 4A3GG 2C35B 5J3BA 2R92H 2EXDA 4DV6L 1L0WA 1X55A 4BA2I 3RZDH 1I3QH 4X64Q 2OWOA 1VQEA 3AFPA 2R6GA 3UDIA 1YIJA 4ALPA 1D7QA 3S1MH 3HOWH 3GTLH 2V1CC 3MEFA 4A3KG 4LF9L 2CQOA 4BY7G 1YJ9A 2OQ0A 2ZM6L 4A3BG 2AKWB 1JJCB 1WJJA 2IT1A 4NXNL 2VQFL 4JI8Q 4DV4L 1EQQA 4DR4Q 4NXML 4JYAQ 4JV5L 4IPHA 3GTMH 1HZBA 5IYBG 3PUVA 1KRTA 2VQEQ 1KHIA 1VQBA 1PH8A 4LF7L 2OTJA 4HJAA 3CCRA 4QIWE 4HJ8A 3AYHB 1OXVA 3I4MG 1HR0W 4JI3Q 1FJGQ 2R92G 1WCMG 5FLXc 4L5RC 4DKAC 3EIVA 3T1HQ 5M5XH 1VQOA 2YTXA 4GKKL 5JEAG 1MKHA 2N3SA 5IWAQ 5C3EH 3CD6A 4BBSH 4A3CH 1X56A 2D62A 2QEXA 4JI1Q 3Q8DA 1W3SA 3M85A 3FKIG 5JJIA 3F1ZA 1RIPA 5C4JH 1N8RC 2A19A 3PSIA 3TQYA 3S1QH 1JB7A 4DV6Q 2ZTCA 5IP9H 4B3SL 1YHBA 1HNWL 3JAMi 2JK8A 1K9MC 4IPCA 3E0EA 1PYBA 1FVIA 1IBLL 3CMEA 1SFOH 3S24A 1NY4A 1P8LA 5M3FG 3D31A 3HKSA 4A3MH 4JI2L 4LF9Q 4UY8C 4C3IH 2ZM6Q 2JJQA 4R4TA 2VQFQ 4NXNQ 4DV4Q 1PFSA 4GN3B 4JV5Q 1V9PA 4DV3L 3I7FA 3NEMA 2R7FA 2IY5B 3J81i 4LF7Q 4OX9L 5C44H 1VQHA 4BBSG 4A3CG 1IZ6A 1Q1EA 4DNIA 5GAEC 3I2ZA 1CSPA 3F8TA 3CF5A 4A3EG 2R93H 3RZOH 4IPDA 2D0PA 1VQMA 5IP7G 1PH3A 4GKKQ 4JBMA 1A62A 3E9HA 2B63G 3S14H 1EYGA 4KLKA 1YHAA 5M5YH 3OYYA 3CPWA 2UUCL 4L5SA 2Q2UA 2OQKA 4YHHL 2F4VL 5EAYA 3HOYH 2N78A 4DV2Q 4B3SQ 3LGJA 4LF6L 1HNWQ 1NE3A 2Q2HA 3CCEA 3G71A 3J7ZC 1M1KC 4R4OA 2K5NA 1GVPA 4QQBX 1X6OA 3TRZA 3U4ZA 1IBLQ 1L1OC 5C44G 1GKHA 4JI2Q 4QL5A 4XTCS 4A93H 4C3JH 1EQRA 2Z0SA 2DGYA 2EIFA 2R93G 1OXTA 2VUMH 2BH8A 1I6HH 3W1GA 4DV3Q 4HIDA 2PNHA 3ER0A 3PGZA 2RF4A 4OX9Q 4KHPL 4EX5A 1KC8C 1GM5A 4GN5A 2WB1E 1SR3A 2IX0A 4RMFA 1VQIA 1E7ZA 5GAGC 2JA7H 3TS2A 2GVBA 1JE5A 2D0OA 1DGSA 3HOYG 4HIOA 4GNXB 2MO0A 4R1JA 4DAYB 2KBNA 4DR1L 2HHHL 1NMGA 4PZ8A 3HOVG 2JQOA 4DR6L 4YWLA 2E2HH 2WFWA 2HT1A 1GD7A 3BU2A 3TEHB 4A93G 4YHHQ 1A0IA 2F4VQ 5IYDH 4A3LH 1PH2A 4LNQA 2YYZA 4YCWA 4MNOA 3GTQH 2WB1G 4LF6Q 1J6QA 4C3HH 1Y1WH 1EIYB 4GNXA 4AQYL 4DV0L 1S3OA 1Q7YC 4OWXB 4DV5L 1I5FA 5GQOA 4AIMA 1VQ5A 1N32L 2JA7G 5HGQA 2K4KA 3M4PA 3K7UC 1LYLA 1N33L 4A3FH 1K73C 1Q1BA 2NVQH 4IFDJ 2BA1A 5JEAJ 4A4IA 1YITA 2Q2TA 2N8NA 4WJ3M 2VL6A 5IT9c 4HJ5A 2NVYH 1V1QA 3RNUA 2IHEA 2AWOA 4JI7L 3S16H 3S2HH 3L0OA 4KHPQ 4BY1G 2Q2IA 2VW9A 4DUZL 1WYDA 5IYDG 3M3YH 2I5MX 4BBRH 1N34L 4A3LG 2OTLA 1HNXL 1M90C 1KL9A 3PIPA 4MZ9A 4AYBE 4DR1Q 2HHHQ 2RHQB 4OONA 3NBHB 4BA1I 1VQDA 1SE8A 4R4IA 1X3GA 4GOPC 4DR6Q 5AJ3L 2ASBA 3GD7A 3ULLA 3CCUA 3OTOL 4LF5L 1Q46A 2ATWA 3RLOA 1VQCA 4YY3L 4A3FG 1PH7A 2ZJQA 3I4OA 3CC7A 1BVSA 4PMWA 1IBKL 1E24A 2KCMA 4AQYQ 4PZ6A 4HIKA 4PZ7A 5C0XG 4DV0Q 3RN5A 3GTGH 2L15A 1QZGA 3K80C 1I50H 4GLVB 3EBEA 4DV5Q 3KJOA 1HH2P 1N32Q 4TVAB 1V43A 3JC66 1N33Q 3KOJA 2QGQA 4O0AA 3ULJA 1SN8A 1PA6A 3HOWG 5BR8L 3JAMc 4JI7Q 1N36L 1X9NA 4DUZQ 1QZHA 1EWIA 4X65L 3L2PA 4APVA 3DLLA 1TWGH 4DV2L 1N34Q 1HNXQ 3G48A 3AEVA 5JJLA 2RHSB 1KRSA 1YVCA 3BZKA 2I5HA 4UP9A 1KIXA 2K5VA 3MXNB 1OTCA 2HIVA 3D0FA 1OXUA 4AH6A 4DPGA 2VS1A 4UP7A 3G6EA 4P73A 4QJFA 5AJ3Q 5M3MH 1KXLA 3PIOA 1K83H 3CCSA 3CCLA 2YU9H 1E1TA 3OTOQ 1SMXA 2GN5A 3UDFA 3I56A 4LF5Q 4YY3Q 5IY0A 1Q8KA 3HFZB 3UE0A 2YTVA 1IBKQ 5E7NA 1L1OB 1BBWA 3ICEA 5C3EG 4A76A 3EN2A 4NB3A 1Q86C 2R7DA 1Y1VH 1XMOL 2NZHA 4UPAA 3U58A 1UE1A 4JOIA 1CSQA 3PO2H 4JI5L 3WWVA 4H02A 5IP9G 1Q12A 4R4CA 1VQLA 3AFQA 2UU9L 1VQAA 1YNXA 4OWWB 4DR5L 1YHQA 4P74A 2CWAA 4FDBA 3U50C 4LWCA 1B8AA 2VY3A 2FXQA 5BR8Q 3CCVA 3RN2A 2OCEA 1L1OA 4A3MG 1N36Q 2DUDA 2IX1A 1P16A 2QA4A 3H0GH 4X65Q 3S1NH 4P72A 2Z6KA 3K7AH 4A75A 1R9TH 3PUXA 2UUBL 1LTLA 1Y14B 4JBKA 1VQKA 1FGUA 2JE6I 3KF8B 4YWKA 1NMFA 3KYHC 1PYSB 3CMAA 2WP8J 2YTYA 1JJ2A 4B3ML 1Y1VG 3GTKH 1SLJA 1U0LA 3PF5A 1SRUA 1G51A 1VQFA 2JA5H 3PO2G 3I55A 3M7NA 1HR0L 4IPGA 4LFCL 5M5WH 1IL2A 1WOCA 1O7IA 4WJ4A 4YWMA 2LXJA 5ELNA 1VQ4A 1XMOQ 5HY6A 2BA0A 4LFAL 4QY7A 1JJGA 1XNQL 4KHZA 4OXPA 1Z47A 1I94L 2KCTA 1C0AA 1HJPA 4JI5Q 2UU9Q 3RLFA 4POFA 1WFQA 3W5OA 2PI2A 4DR5Q 3VDYA 4JI0L 4DR2L 1YI2A 2CCZA 1EIFA 3F2DA 1KQSA 4JC0A 4BXXH 1AE3A 2ZJRA 3A74A 4GLAC 2KHIA 2JA5G 3NELA 1GO3E 3F2BA 2UUBQ 2MO1A 2VUMG 1CUKA 5C0XJ 2K50A 3GTJH 3PF4A 4JBWA 4JI4L 2JA8H 2NZOA 1X3EA 1X65A 4ME3A 3W1BA 5IE8A 3CCQA 1TWAH 1XJVA 4B3MQ 1XTDA 3UDGA 2B29A 5GADC 1VQ8A 3IRBA 5FLMH 1HR0Q 2ES2A 4LFCQ 2GVAA 4L5TA 2CWPA 3RR5A 1TXYA 1C9OA 1TWFH 2AHOB 2CFMA 1VQPA 1X3FA 4OO1I 1H95A 4LFAQ 3ERSX 1LM0A 1XNQQ 3HOXH 4P71A 1I94Q 2JEBI 3U4VA 4DR3L 3FP9A 1PH6A 3L7ZC 1Y1WG 1VQ9A 4DK6C 4JI0Q 4DR2Q 1B7YB 1Z9FA 2JA8G 1E3PA 4DV1L 4BY7H 2MNAA 1IBML 4IFDI 4A3BH 3H3VI 1A63A 1AE2A 2K52A 2K14A 1PV4A 1XNRL 4LUZA 3KJPA 4GNXC 4JI6L 4Y7NH 4DV7L 1YBYA 5K36G 3S17H 1LUZA 4B3RL 2ALYB 3CCJA 2JEAI 4MTNA 1SROA 1MJEA 1PVOA 5DLQE 2WAQE 4JI4Q 4IJLA 1CKNB 1WCMH 4A3IH 4AYBG 2CKZB 3J80i 3I4NH 2LXKA 3STBC 1JMCA 4BBRG 5FJ8H 3H3VH 3STBD 3HOXG 2E2JH 3PUZA 2BH2A 1YZ6A 1NTGA 3CAMA 2Y0SE 2E5LL 1K0RA 3FKIH 5H1SE 1UE5A 2E2IH 2PQAB 3PUYA 4DK3C 3K81C 1UWVA 5LMNL 2WAQG 4JBJA 1CKNA 2AMCB 3KF6B 4Y52H 3F2CA 1HZCA 1ASYA 4OO1G 2IHFA 4DR3Q 3B6YA 2RCNA 1XPRA 1S72A 2I0QA 4B3TL 4IOAA 4GS3A 5M3FH 1NBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F52 A;  3S1R H;  4PG3 A;  4P75 A;  4DV1 Q;  4A3I G;  1IBM Q;  1KD1 C;  2Y0S G;  1C7Y A;  1T9H A;  1N9W A;  3J81 c;  4HJ7 A;  1XNR Q;  2PQA A;  3PO3 H;  2I5L X;  3I4N G;  3M4Q A;  3CW2 C;  4IFD G;  4XIG S;  1KAW A;  5FJ8 G;  4JI6 Q;  2R7Z H;  4DV7 Q;  3GTO H;  1VCI A;  4B3R Q;  2VNU D;  1BBU A;  2PI2 E;  3KF6 A;  2E8G A;  2LSS A;  3GO5 A;  1B70 B;  4LW1 A;  3G4S A;  4LF4 L;  1EUJ A;  4GN4 B;  4X66 L;  2PMZ E;  2UUC Q;  1VQG A;  4LUO A;  4POG A;  4GLX A;  4A3E H;  4K0K L;  5LMU L;  1QVG A;  1L2F A;  1TWC H;  3CXC A;  2H5X A;  3M4O H;  5IP7 H;  1Q82 C;  1EFW A;  4GKJ L;  1W2B A;  5JJK A;  2MFI A;  2B63 H;  3RLN A;  1K3R A;  1VQN A;  2UXD L;  2NN6 I;  4OWT B;  1TWH H;  1FL0 A;  3AQQ A;  2E5L Q;  3CQZ H;  4HJ9 A;  1VQ6 A;  3PCO B;  2ZJP A;  3SGI A;  1XPO A;  1QVC A;  2UXB L;  5M3M G;  2UXC L;  4TQU S;  3T1Y L;  5GRO A;  1K8A C;  5ELO A;  5GAH C;  5LMN Q;  2ZTE A;  3PO3 G;  2YV5 A;  1E1O A;  4NXM Q;  2K75 A;  2JA6 H;  1K8G A;  2R7Z G;  1MIU A;  4B3T Q;  1XMQ L;  4KI0 A;  3HOU H;  3TS0 A;  1YEZ A;  4LUV A;  4X62 L;  1PH1 A;  3E9I A;  3A5U A;  4A3D H;  4LFB L;  1VQJ A;  1UEB A;  1OXS C;  2HQL A;  3KLW A;  1J5E L;  4YCU A;  4DAM A;  4JCV E;  4J15 A;  3HKZ E;  4UP8 A;  1A8V A;  4DR7 L;  3ZJY C;  2XGT A;  4LF4 Q;  1QVF A;  2UUA L;  4X66 Q;  4JOI C;  1JT8 A;  2AWN A;  3GTP H;  4K0K Q;  5IYC H;  3KFU A;  5LMU Q;  1G6P A;  1PH9 A;  1X54 A;  3H0G G;  1XPU A;  4IJH A;  1PH4 A;  4GKJ Q;  1RL2 A;  3HOV H;  3M9B A;  2JA6 G;  1QUQ B;  3PV0 A;  2UXD Q;  3S2D H;  1HNZ L;  1ASZ A;  4LF8 L;  3KDF B;  2ZTD A;  1G29 1;  3HOU G;  3UE1 A;  1YJW A;  1YJN A;  4A3D G;  2NN6 G;  3HKZ G;  2Z6K C;  2JA9 A;  1CKM A;  1MJC A;  2UXB Q;  2UXC Q;  3T1Y Q;  1HZA A;  3J7A 5;  3K8A A;  2HIX A;  3CPF A;  4HIM A;  1XMQ Q;  2NVX H;  4YCV A;  4GOP B;  4C2M H;  4DUY L;  2F3I A;  3HOZ H;  1QUQ A;  3UDX A;  4EQ5 A;  5C4X H;  4X62 Q;  3J81 j;  4A3J H;  2KEN A;  4LFB Q;  1BKB A;  3KDF A;  5IYC G;  1J5E Q;  3GDE A;  2ID0 A;  1AH9 A;  4IOC A;  1IYJ B;  1U5K A;  4L5Q A;  3NEN A;  3TRE A;  4X64 L;  2K5H A;  4R4Q A;  2A8V A;  5LMN W;  3BJU A;  3DM3 A;  4DR7 Q;  4JG2 A;  4IO9 A;  4BY1 H;  3PUW A;  4A3G H;  2B3G A;  1S40 A;  1CKO A;  1UE6 A;  4NPS A;  3ULP A;  1E22 A;  1WI5 A;  1Q81 C;  2UUA Q;  4GOP A;  3H15 A;  4X6A H;  3K0X A;  3CC4 A;  2A1A A;  4BXX G;  4DR4 L;  3A0J A;  1OXX K;  1UE7 A;  4JI8 L;  5C0X I;  1PHJ A;  4JYA L;  4O2D A;  2VZA A;  3OW2 A;  4RG1 A;  4QGU A;  3BZC A;  2VQE L;  1HNZ Q;  4A3K H;  4LF8 Q;  1IXR A;  3HOZ G;  1EOV A;  4JI3 L;  1FJG L;  5C4X G;  3CP0 A;  1HZ9 A;  4A3J G;  2MQH A;  3CC2 A;  2N49 A;  3T1H L;  1VQ7 A;  1VS0 A;  2NVT H;  3S15 H;  5IWA L;  5IYB H;  3CCM A;  1PH5 A;  3FHW A;  1NJI C;  2KHJ A;  1D8L A;  3J80 c;  5FLM G;  4JI1 L;  3A5Z B;  2XTI A;  3I4M H;  2EQS A;  4DUY Q;  4A3G G;  2C35 B;  5J3B A;  2R92 H;  2EXD A;  4DV6 L;  1L0W A;  1X55 A;  4BA2 I;  3RZD H;  1I3Q H;  4X64 Q;  2OWO A;  1VQE A;  3AFP A;  2R6G A;  3UDI A;  1YIJ A;  4ALP A;  1D7Q A;  3S1M H;  3HOW H;  3GTL H;  2V1C C;  3MEF A;  4A3K G;  4LF9 L;  2CQO A;  4BY7 G;  1YJ9 A;  2OQ0 A;  2ZM6 L;  4A3B G;  2AKW B;  1JJC B;  1WJJ A;  2IT1 A;  4NXN L;  2VQF L;  4JI8 Q;  4DV4 L;  1EQQ A;  4DR4 Q;  4NXM L;  4JYA Q;  4JV5 L;  4IPH A;  3GTM H;  1HZB A;  5IYB G;  3PUV A;  1KRT A;  2VQE Q;  1KHI A;  1VQB A;  1PH8 A;  4LF7 L;  2OTJ A;  4HJA A;  3CCR A;  4QIW E;  4HJ8 A;  3AYH B;  1OXV A;  3I4M G;  1HR0 W;  4JI3 Q;  1FJG Q;  2R92 G;  1WCM G;  5FLX c;  4L5R C;  4DKA C;  3EIV A;  3T1H Q;  5M5X H;  1VQO A;  2YTX A;  4GKK L;  5JEA G;  1MKH A;  2N3S A;  5IWA Q;  5C3E H;  3CD6 A;  4BBS H;  4A3C H;  1X56 A;  2D62 A;  2QEX A;  4JI1 Q;  3Q8D A;  1W3S A;  3M85 A;  3FKI G;  5JJI A;  3F1Z A;  1RIP A;  5C4J H;  1N8R C;  2A19 A;  3PSI A;  3TQY A;  3S1Q H;  1JB7 A;  4DV6 Q;  2ZTC A;  5IP9 H;  4B3S L;  1YHB A;  1HNW L;  3JAM i;  2JK8 A;  1K9M C;  4IPC A;  3E0E A;  1PYB A;  1FVI A;  1IBL L;  3CME A;  1SFO H;  3S24 A;  1NY4 A;  1P8L A;  5M3F G;  3D31 A;  3HKS A;  4A3M H;  4JI2 L;  4LF9 Q;  4UY8 C;  4C3I H;  2ZM6 Q;  2JJQ A;  4R4T A;  2VQF Q;  4NXN Q;  4DV4 Q;  1PFS A;  4GN3 B;  4JV5 Q;  1V9P A;  4DV3 L;  3I7F A;  3NEM A;  2R7F A;  2IY5 B;  3J81 i;  4LF7 Q;  4OX9 L;  5C44 H;  1VQH A;  4BBS G;  4A3C G;  1IZ6 A;  1Q1E A;  4DNI A;  5GAE C;  3I2Z A;  1CSP A;  3F8T A;  3CF5 A;  4A3E G;  2R93 H;  3RZO H;  4IPD A;  2D0P A;  1VQM A;  5IP7 G;  1PH3 A;  4GKK Q;  4JBM A;  1A62 A;  3E9H A;  2B63 G;  3S14 H;  1EYG A;  4KLK A;  1YHA A;  5M5Y H;  3OYY A;  3CPW A;  2UUC L;  4L5S A;  2Q2U A;  2OQK A;  4YHH L;  2F4V L;  5EAY A;  3HOY H;  2N78 A;  4DV2 Q;  4B3S Q;  3LGJ A;  4LF6 L;  1HNW Q;  1NE3 A;  2Q2H A;  3CCE A;  3G71 A;  3J7Z C;  1M1K C;  4R4O A;  2K5N A;  1GVP A;  4QQB X;  1X6O A;  3TRZ A;  3U4Z A;  1IBL Q;  1L1O C;  5C44 G;  1GKH A;  4JI2 Q;  4QL5 A;  4XTC S;  4A93 H;  4C3J H;  1EQR A;  2Z0S A;  2DGY A;  2EIF A;  2R93 G;  1OXT A;  2VUM H;  2BH8 A;  1I6H H;  3W1G A;  4DV3 Q;  4HID A;  2PNH A;  3ER0 A;  3PGZ A;  2RF4 A;  4OX9 Q;  4KHP L;  4EX5 A;  1KC8 C;  1GM5 A;  4GN5 A;  2WB1 E;  1SR3 A;  2IX0 A;  4RMF A;  1VQI A;  1E7Z A;  5GAG C;  2JA7 H;  3TS2 A;  2GVB A;  1JE5 A;  2D0O A;  1DGS A;  3HOY G;  4HIO A;  4GNX B;  2MO0 A;  4R1J A;  4DAY B;  2KBN A;  4DR1 L;  2HHH L;  1NMG A;  4PZ8 A;  3HOV G;  2JQO A;  4DR6 L;  4YWL A;  2E2H H;  2WFW A;  2HT1 A;  1GD7 A;  3BU2 A;  3TEH B;  4A93 G;  4YHH Q;  1A0I A;  2F4V Q;  5IYD H;  4A3L H;  1PH2 A;  4LNQ A;  2YYZ A;  4YCW A;  4MNO A;  3GTQ H;  2WB1 G;  4LF6 Q;  1J6Q A;  4C3H H;  1Y1W H;  1EIY B;  4GNX A;  4AQY L;  4DV0 L;  1S3O A;  1Q7Y C;  4OWX B;  4DV5 L;  1I5F A;  5GQO A;  4AIM A;  1VQ5 A;  1N32 L;  2JA7 G;  5HGQ A;  2K4K A;  3M4P A;  3K7U C;  1LYL A;  1N33 L;  4A3F H;  1K73 C;  1Q1B A;  2NVQ H;  4IFD J;  2BA1 A;  5JEA J;  4A4I A;  1YIT A;  2Q2T A;  2N8N A;  4WJ3 M;  2VL6 A;  5IT9 c;  4HJ5 A;  2NVY H;  1V1Q A;  3RNU A;  2IHE A;  2AWO A;  4JI7 L;  3S16 H;  3S2H H;  3L0O A;  4KHP Q;  4BY1 G;  2Q2I A;  2VW9 A;  4DUZ L;  1WYD A;  5IYD G;  3M3Y H;  2I5M X;  4BBR H;  1N34 L;  4A3L G;  2OTL A;  1HNX L;  1M90 C;  1KL9 A;  3PIP A;  4MZ9 A;  4AYB E;  4DR1 Q;  2HHH Q;  2RHQ B;  4OON A;  3NBH B;  4BA1 I;  1VQD A;  1SE8 A;  4R4I A;  1X3G A;  4GOP C;  4DR6 Q;  5AJ3 L;  2ASB A;  3GD7 A;  3ULL A;  3CCU A;  3OTO L;  4LF5 L;  1Q46 A;  2ATW A;  3RLO A;  1VQC A;  4YY3 L;  4A3F G;  1PH7 A;  2ZJQ A;  3I4O A;  3CC7 A;  1BVS A;  4PMW A;  1IBK L;  1E24 A;  2KCM A;  4AQY Q;  4PZ6 A;  4HIK A;  4PZ7 A;  5C0X G;  4DV0 Q;  3RN5 A;  3GTG H;  2L15 A;  1QZG A;  3K80 C;  1I50 H;  4GLV B;  3EBE A;  4DV5 Q;  3KJO A;  1HH2 P;  1N32 Q;  4TVA B;  1V43 A;  3JC6 6;  1N33 Q;  3KOJ A;  2QGQ A;  4O0A A;  3ULJ A;  1SN8 A;  1PA6 A;  3HOW G;  5BR8 L;  3JAM c;  4JI7 Q;  1N36 L;  1X9N A;  4DUZ Q;  1QZH A;  1EWI A;  4X65 L;  3L2P A;  4APV A;  3DLL A;  1TWG H;  4DV2 L;  1N34 Q;  1HNX Q;  3G48 A;  3AEV A;  5JJL A;  2RHS B;  1KRS A;  1YVC A;  3BZK A;  2I5H A;  4UP9 A;  1KIX A;  2K5V A;  3MXN B;  1OTC A;  2HIV A;  3D0F A;  1OXU A;  4AH6 A;  4DPG A;  2VS1 A;  4UP7 A;  3G6E A;  4P73 A;  4QJF A;  5AJ3 Q;  5M3M H;  1KXL A;  3PIO A;  1K83 H;  3CCS A;  3CCL A;  2YU9 H;  1E1T A;  3OTO Q;  1SMX A;  2GN5 A;  3UDF A;  3I56 A;  4LF5 Q;  4YY3 Q;  5IY0 A;  1Q8K A;  3HFZ B;  3UE0 A;  2YTV A;  1IBK Q;  5E7N A;  1L1O B;  1BBW A;  3ICE A;  5C3E G;  4A76 A;  3EN2 A;  4NB3 A;  1Q86 C;  2R7D A;  1Y1V H;  1XMO L;  2NZH A;  4UPA A;  3U58 A;  1UE1 A;  4JOI A;  1CSQ A;  3PO2 H;  4JI5 L;  3WWV A;  4H02 A;  5IP9 G;  1Q12 A;  4R4C A;  1VQL A;  3AFQ A;  2UU9 L;  1VQA A;  1YNX A;  4OWW B;  4DR5 L;  1YHQ A;  4P74 A;  2CWA A;  4FDB A;  3U50 C;  4LWC A;  1B8A A;  2VY3 A;  2FXQ A;  5BR8 Q;  3CCV A;  3RN2 A;  2OCE A;  1L1O A;  4A3M G;  1N36 Q;  2DUD A;  2IX1 A;  1P16 A;  2QA4 A;  3H0G H;  4X65 Q;  3S1N H;  4P72 A;  2Z6K A;  3K7A H;  4A75 A;  1R9T H;  3PUX A;  2UUB L;  1LTL A;  1Y14 B;  4JBK A;  1VQK A;  1FGU A;  2JE6 I;  3KF8 B;  4YWK A;  1NMF A;  3KYH C;  1PYS B;  3CMA A;  2WP8 J;  2YTY A;  1JJ2 A;  4B3M L;  1Y1V G;  3GTK H;  1SLJ A;  1U0L A;  3PF5 A;  1SRU A;  1G51 A;  1VQF A;  2JA5 H;  3PO2 G;  3I55 A;  3M7N A;  1HR0 L;  4IPG A;  4LFC L;  5M5W H;  1IL2 A;  1WOC A;  1O7I A;  4WJ4 A;  4YWM A;  2LXJ A;  5ELN A;  1VQ4 A;  1XMO Q;  5HY6 A;  2BA0 A;  4LFA L;  4QY7 A;  1JJG A;  1XNQ L;  4KHZ A;  4OXP A;  1Z47 A;  1I94 L;  2KCT A;  1C0A A;  1HJP A;  4JI5 Q;  2UU9 Q;  3RLF A;  4POF A;  1WFQ A;  3W5O A;  2PI2 A;  4DR5 Q;  3VDY A;  4JI0 L;  4DR2 L;  1YI2 A;  2CCZ A;  1EIF A;  3F2D A;  1KQS A;  4JC0 A;  4BXX H;  1AE3 A;  2ZJR A;  3A74 A;  4GLA C;  2KHI A;  2JA5 G;  3NEL A;  1GO3 E;  3F2B A;  2UUB Q;  2MO1 A;  2VUM G;  1CUK A;  5C0X J;  2K50 A;  3GTJ H;  3PF4 A;  4JBW A;  4JI4 L;  2JA8 H;  2NZO A;  1X3E A;  1X65 A;  4ME3 A;  3W1B A;  5IE8 A;  3CCQ A;  1TWA H;  1XJV A;  4B3M Q;  1XTD A;  3UDG A;  2B29 A;  5GAD C;  1VQ8 A;  3IRB A;  5FLM H;  1HR0 Q;  2ES2 A;  4LFC Q;  2GVA A;  4L5T A;  2CWP A;  3RR5 A;  1TXY A;  1C9O A;  1TWF H;  2AHO B;  2CFM A;  1VQP A;  1X3F A;  4OO1 I;  1H95 A;  4LFA Q;  3ERS X;  1LM0 A;  1XNQ Q;  3HOX H;  4P71 A;  1I94 Q;  2JEB I;  3U4V A;  4DR3 L;  3FP9 A;  1PH6 A;  3L7Z C;  1Y1W G;  1VQ9 A;  4DK6 C;  4JI0 Q;  4DR2 Q;  1B7Y B;  1Z9F A;  2JA8 G;  1E3P A;  4DV1 L;  4BY7 H;  2MNA A;  1IBM L;  4IFD I;  4A3B H;  3H3V I;  1A63 A;  1AE2 A;  2K52 A;  2K14 A;  1PV4 A;  1XNR L;  4LUZ A;  3KJP A;  4GNX C;  4JI6 L;  4Y7N H;  4DV7 L;  1YBY A;  5K36 G;  3S17 H;  1LUZ A;  4B3R L;  2ALY B;  3CCJ A;  2JEA I;  4MTN A;  1SRO A;  1MJE A;  1PVO A;  5DLQ E;  2WAQ E;  4JI4 Q;  4IJL A;  1CKN B;  1WCM H;  4A3I H;  4AYB G;  2CKZ B;  3J80 i;  3I4N H;  2LXK A;  3STB C;  1JMC A;  4BBR G;  5FJ8 H;  3H3V H;  3STB D;  3HOX G;  2E2J H;  3PUZ A;  2BH2 A;  1YZ6 A;  1NTG A;  3CAM A;  2Y0S E;  2E5L L;  1K0R A;  3FKI H;  5H1S E;  1UE5 A;  2E2I H;  2PQA B;  3PUY A;  4DK3 C;  3K81 C;  1UWV A;  5LMN L;  2WAQ G;  4JBJ A;  1CKN A;  2AMC B;  3KF6 B;  4Y52 H;  3F2C A;  1HZC A;  1ASY A;  4OO1 G;  2IHF A;  4DR3 Q;  3B6Y A;  2RCN A;  1XPR A;  1S72 A;  2I0Q A;  4B3T L;  4IOA A;  4GS3 A;  5M3F H;  1NBW A; 
#chains in the Genus database with same CATH topology
 2F52 A;  4K5V A;  4PG3 A;  4P75 A;  4DV1 Q;  3IFD A;  3R93 A;  1N9W A;  2PQA A;  2KCC A;  1WVL A;  3CW2 C;  1F9S A;  3M7G A;  5FJ8 G;  4DV7 Q;  1VCI A;  4B3R Q;  1I4P A;  2PI2 E;  3GO5 A;  3KF6 A;  4HCE A;  5E4X A;  1VQG A;  2K1B A;  1Q3L A;  2A6H C;  4KY7 A;  1L2F A;  1KLG D;  1SYG A;  1Q82 C;  1KLU D;  1SBB B;  1W2B A;  2OF1 A;  1EFW A;  3RLN A;  3GV6 A;  1VQN A;  1TWH H;  1VQ6 A;  1STB A;  3PCO B;  1EY6 A;  4G7H C;  1F9Q A;  1UNS A;  3T16 A;  1F2Z A;  3HRZ C;  3T1Y L;  5GRO A;  5LMN Q;  4HSP A;  2HQE A;  3KLS X;  1E1O A;  4C56 C;  5IOD A;  2E76 C;  1K8G A;  2R7Z G;  1EQV A;  1H9R A;  1PRT F;  2PW5 A;  4IUP A;  1Q90 A;  3FEW X;  1W6J A;  2RDH A;  3E9I A;  1GHJ A;  1VQJ A;  4FXG C;  3BS1 A;  5M3F B;  4S3S A;  4YCU A;  1O7Z A;  4J15 A;  4NMZ A;  2Q8R E;  5M9O A;  2EY2 A;  1LTI D;  2F1M A;  3SDZ A;  4X66 Q;  4JOI C;  2TSS A;  1STY A;  3KFU A;  5LMU Q;  4KKS A;  2JA6 G;  1PZK D;  1G29 1;  5IT9 E;  1SMY D;  1EY9 A;  4A3D G;  2NN6 G;  2UXB Q;  1RD9 D;  1CKM A;  1QNK A;  2UXC Q;  1ENC A;  3J7A 5;  4R8N A;  1XMQ Q;  3J80 L;  4C2M H;  3HOZ H;  2F3I A;  3UDX A;  3J81 j;  4LFB Q;  1BKB A;  3PIO 3;  1J5E Q;  3GDE A;  5JAV A;  1BDO A;  2A8V A;  1EEF D;  4HN7 A;  1ZEQ X;  3DM3 A;  1EYA A;  4IO9 A;  3T53 B;  4BY1 H;  1S40 A;  2UUC Q;  1CKO A;  4NPS A;  4X3S A;  4H7B A;  1E22 A;  2UUA Q;  5M5Y B;  2A1A A;  3A0J A;  1PHJ A;  1UE7 A;  5C0X I;  1DYQ A;  4O2D A;  4RGO S;  5FLX E;  3OW2 A;  4RG1 A;  3BZC A;  4N9T A;  3DWQ A;  5CBE E;  5C4X G;  1FJG L;  1JWU D;  4A93 B;  3SVM A;  2EOT A;  5IWA L;  3SEB A;  1ENF A;  3FHW A;  1NJI C;  4F88 A;  3I4M H;  2C35 B;  1Y8N B;  2R92 H;  3MWY W;  5IGE A;  1L0W A;  4EQP A;  3RZD H;  1I3Q H;  2PZT A;  1VQE A;  3NTK A;  2EXZ A;  3EQL C;  3S1M H;  3HOW H;  4KTA A;  5EKL A;  3VYS A;  2RCF A;  4A3K G;  2QDB A;  2AKW B;  4NXN L;  2PZU A;  4JI8 Q;  1U4L A;  4JYA Q;  4B9W A;  2RSN A;  2PYK A;  5CV8 A;  2AQ3 B;  1PH8 A;  2OTJ A;  2HDM A;  4HJ8 A;  2KEE A;  5C3W A;  1KNE A;  1CK1 A;  2J0T D;  1U4P A;  1ZXT A;  5JOB A;  3QOJ A;  4J8Q A;  5C3E H;  4BBS H;  2EYP A;  3R2I A;  2QEX A;  2ICI A;  3EJI A;  1CTM A;  3FKI G;  2K5W A;  1RIP A;  2A19 A;  2QEJ C;  3TQY A;  3S1Q H;  3VR3 A;  2ZTC A;  5IP9 H;  3G7L A;  3JAM i;  3HS0 C;  1PFB A;  1P8L A;  4A3M H;  2JSO A;  3SK4 A;  4LF9 Q;  3E3X A;  1FNW A;  4K14 A;  4C3I H;  1WTX A;  2DJG C;  4R4T A;  3ND9 A;  1PFS A;  3MHB A;  4DV3 L;  1GUO A;  4XT1 B;  2R7F A;  4LF7 Q;  1AZQ A;  4A3C G;  1Q1E A;  1CSP A;  2KQ3 A;  4XT3 B;  2Z1C A;  1HA5 A;  2CW0 C;  2R93 H;  2ZT9 C;  2XIW A;  1TY0 A;  5FO9 B;  5IP7 G;  4GKK Q;  3S14 H;  3W3A A;  1EYG A;  1J9O A;  2PCF B;  1EWH A;  3TME A;  1YHA A;  3CPW A;  2OQK A;  5C3E B;  4YHH L;  4RWS C;  3HOY H;  2PO4 A;  1TVX A;  4HSV A;  3AMU A;  3J7Z C;  4R4O A;  4QQB X;  3E6Z X;  3NE5 B;  3U4Z A;  1NUC A;  5C44 G;  2XN9 C;  4QL5 A;  2DGY A;  5KIX A;  4A3M B;  4F87 A;  1K83 B;  1OXT A;  2VUM H;  3W1G A;  4HID A;  4OX9 Q;  4FYD A;  4GN5 A;  4RMF A;  5GAG C;  2K6A A;  2GVB A;  2EE1 A;  1XTC D;  3NXW A;  4DAY B;  2HHH L;  3HOV G;  3MZ5 A;  2JQO A;  4YWL A;  5KRU A;  2E2H H;  3S14 B;  1GD7 A;  3BU2 A;  3TEH B;  5A2Q L;  2F4V Q;  5IYD H;  2DY8 A;  1PH2 A;  4LNQ A;  1XXG A;  2YYZ A;  4YCW A;  2F3V A;  3GTQ H;  1FR3 A;  1RTN A;  2WB1 G;  5G3L D;  1J6Q A;  3S1N B;  1EWC A;  3EA6 A;  3QB3 A;  1S3O A;  3T13 A;  5J1Z A;  2EYH A;  4DV5 L;  1GOZ A;  3FRP B;  4A3F H;  4KK7 A;  1U4M A;  3V96 A;  2HCI A;  4E6I A;  5IT9 c;  4OL7 A;  2VUM B;  4KHP Q;  2AWO A;  3L0O A;  1HFN A;  4DUZ L;  4ZCK A;  1D1I A;  3M3Y H;  4BBR H;  3RMH A;  1M90 C;  2AQ2 B;  2LKV A;  4MZ9 A;  4AYB E;  1OO9 B;  4BA1 I;  4DR6 Q;  1SND A;  4XDX A;  1IKM A;  3GD7 A;  2J4X A;  3OTO L;  1O80 A;  2ZJQ A;  1M4V A;  1GUG A;  1MSH A;  1TT2 A;  1BVS A;  3DUZ A;  3NBI A;  4OIK A;  3CC7 A;  1K0S A;  1SAP A;  2M00 A;  1E24 A;  1PZJ D;  4AQY Q;  1T5X D;  3RN5 A;  3NBH A;  4IAL A;  2BCO A;  2QKI C;  2RSO A;  5C4Z A;  2K04 A;  3DXJ C;  1CHQ D;  5FK9 C;  1N33 Q;  2QCP X;  3HP3 A;  1JCK B;  1PRT B;  3RUZ A;  1RKN A;  2PZW A;  1SNC A;  1YNJ C;  2F0T A;  2HD3 A;  4Q0F A;  1X9N A;  3DLL A;  1TWG H;  1JB3 A;  1HNX Q;  3MAQ A;  2RHS B;  1KRS A;  2B39 A;  4UP9 A;  3M3Y B;  3VA5 A;  2HIV A;  1QE6 A;  4DPG A;  1AN8 A;  5AJ3 Q;  1VDZ A;  1QB5 D;  2WAQ B;  2R3Z A;  3HFZ B;  3UE0 A;  2YTV A;  1O7L A;  4RFB A;  4Y7N B;  1BBW A;  4A76 A;  2B2Y A;  1Y1V H;  3TP8 A;  3WWV A;  1VQL A;  1Q12 A;  4R4C A;  1RJT A;  2FHT A;  2CHB D;  1GUS A;  1FYC A;  2V4D A;  5EPL A;  3SK8 A;  2DUD A;  2IX1 A;  3J7Y W;  1S5B D;  2A69 C;  2ZXO A;  2Z6K A;  4RCO A;  2JP1 A;  1Y14 B;  4MTK A;  2JE6 I;  4DK1 A;  3KYH C;  2D5D A;  1PYS B;  4CKB A;  4IUV A;  1NNX A;  3H91 A;  2FFK B;  1DOL A;  3GTK H;  2EJF C;  4DXF A;  2JA5 H;  1STA A;  3PO2 G;  1JOQ A;  4LFC L;  4B9X A;  4CDD C;  3IFT A;  1B9N A;  1WOC A;  5ELF A;  2R7Z B;  5I9O A;  4FNF A;  1MBY A;  1D2B A;  3I73 A;  3E5S A;  5IGD A;  4OXP A;  1R4P B;  2F0J A;  4JI5 Q;  2UU9 Q;  3A8J E;  1TWC B;  4JI0 L;  4DR2 L;  2CCZ A;  2B63 B;  1G2S A;  4U68 A;  4TRD A;  4KD3 A;  1AE3 A;  4GLA C;  3NEL A;  1B4O A;  4QB4 A;  5EJW A;  3AU7 A;  4BS9 A;  2JA6 B;  2JA8 H;  2NZO A;  5HUR A;  3N52 A;  2EJM A;  5IE8 A;  4X3T A;  1XJV A;  4B3M Q;  1R4Q B;  1XTD A;  4A3D B;  4CKE A;  5A35 A;  2B29 A;  3P7J A;  3IRB A;  4H13 C;  4I7A A;  4IUR A;  2GVA A;  2CWP A;  3BDC A;  3RR5 A;  4OO1 I;  1VQP A;  2KA7 A;  1WTR A;  2H4O A;  1I94 Q;  3U4V A;  2BE5 C;  5EGT A;  4DR3 L;  3OIP A;  2EYJ A;  1E3P A;  3DEP A;  3R8B A;  4DV1 L;  1A63 A;  1AE2 A;  2RVL A;  1PV4 A;  2WIN B;  3J81 L;  1LV9 A;  4DV7 L;  5K36 G;  3S17 H;  4B3R L;  3I8Z A;  3CCJ A;  1SRO A;  1MJE A;  5DLQ E;  2WAQ E;  2JN4 A;  4AYB G;  3D6W A;  2I07 B;  5C4X B;  4IFD H;  2K05 A;  3H3V H;  3HOX G;  1ZYR C;  2KHS A;  1K0R A;  3FKI H;  5IGC A;  4CDE C;  1UWV A;  5LMN L;  1CKN A;  1ASY A;  2I0Q A;  1U9R A;  2O5J C;  1HRJ A;  5I2X A;  4A3I G;  4A3K B;  5CC4 A;  1C7Y A;  4HJ7 A;  5TSS A;  3I4N G;  4XIG S;  4JI6 Q;  5AFW A;  2E8G A;  2AUJ D;  1B70 B;  5EQ0 A;  4X66 L;  2E75 C;  4LUO A;  1B44 D;  2XSC A;  4GLX A;  4POG A;  5LMU L;  4M1U B;  2H5X A;  4CBV A;  5IP7 H;  3CHB D;  2MFI A;  1LT5 D;  4OWT B;  4DXG A;  1FL0 A;  3AQQ A;  2ZJP A;  3DM1 A;  2UXB L;  3FKI B;  3GTL B;  2UXC L;  1Y69 U;  1K8A C;  2ZTE A;  3PO3 G;  2F0U A;  4NXM Q;  1XMQ L;  3I3C A;  2NUC A;  3HOU H;  3TS0 A;  2HDL A;  4LUV A;  4LFB L;  2EYM A;  1BBX C;  2HQL A;  1J5E L;  3K59 A;  5KND A;  2E2D C;  3OSO A;  2B2Y C;  5M5X B;  3ZJY C;  2XGT A;  1S5D D;  2UUA L;  2F3W A;  1SXT A;  3GTP H;  1EIH A;  1KAB A;  2A73 B;  1X54 A;  1M8A A;  4IJH A;  3NUC A;  1DM0 B;  3HOV H;  4GKJ Q;  1ASZ A;  1SMY C;  2ZXP A;  3MC0 B;  1PFN A;  4JK1 C;  1YJN A;  1DZ1 A;  4IUN A;  2Z6K C;  1MJC A;  1HZA A;  3K8A A;  1PXU A;  2CH4 W;  3KLS A;  3CPF A;  4KV6 A;  4HIM A;  2NVX H;  1QNU A;  3DWA A;  1QUQ A;  3KDF A;  5C44 B;  1G8Z D;  5IYC G;  1AH9 A;  1IKL A;  2B2V A;  5BN5 A;  4RA8 A;  4R4Q A;  1B2T A;  1F2M A;  2WAC A;  3PUW A;  4A3G H;  2B3G A;  2EY5 A;  1Q81 C;  4X6A H;  4GOP A;  3WOF A;  2IPK D;  4BXX G;  1OXX K;  4JI8 L;  4JYA L;  1PTO C;  5KYI A;  4QGU A;  1EIG A;  2EYF A;  1HNZ Q;  5L37 A;  3HOV B;  4A3J G;  1H9S B;  2N49 A;  1I4R A;  3P75 A;  1VQ7 A;  3TSS A;  5IYB H;  1PH5 A;  4KY5 A;  2WB1 B;  2KHJ A;  3J80 c;  2IX3 A;  2RQX A;  2EQS A;  1D1K A;  5J3B A;  2NVX B;  3A54 A;  1EY4 A;  1EQT A;  1I6V C;  4X64 Q;  1HHV A;  2R6G A;  2B2U A;  3TZD A;  4ALP A;  3NQT A;  2F0N A;  5JVH 3;  4LF9 L;  1KNA A;  4BY7 G;  2B2W C;  4EQO A;  4DR4 Q;  1HPC A;  2IL8 A;  4IPH A;  1BCP C;  1NR4 A;  1C4Q A;  2MPM A;  1CHP D;  1KRT A;  1VQB A;  4LF7 L;  3CCR A;  5EBD A;  3AYH B;  2KEC A;  4L5R C;  3EIV A;  3U9O A;  1VQO A;  3BVZ A;  4GKK L;  2L55 A;  3CD6 A;  1X56 A;  1KDC A;  3Q8D A;  3M85 A;  3PSI A;  4DV6 Q;  1YHB A;  3A55 A;  3HGB A;  2JK8 A;  3I4L A;  1K9M C;  2F0K A;  4ZYS A;  1E0B A;  3OMC A;  2VQF Q;  2F0E A;  4GN3 B;  1S4Z A;  1V9P A;  3NEM A;  2IY5 B;  4OX9 L;  4FXK C;  1IZ6 A;  1RF2 D;  1CZG A;  2XRS D;  4XQJ A;  2XRQ D;  2B63 G;  2EYL A;  4CJ2 C;  4QUF A;  1SEB D;  5M5Y H;  3OYY A;  2F4V L;  2P5Z X;  2N78 A;  4DV2 Q;  3VR5 A;  3LGJ A;  5LL6 X;  4DN4 M;  3CCE A;  3OMG A;  1M1K C;  1GVP A;  3O13 A;  1X6O A;  4KKU A;  4IN3 A;  3WDN A;  1L1O C;  1CQV A;  4JI2 Q;  5DNF A;  1STE A;  4XTC S;  4A93 H;  2Z0S A;  4RHR A;  1PTO B;  1ICF B;  2BH8 A;  1PFM A;  1V1O A;  3ER0 A;  3PGZ A;  2RF4 A;  4KHP L;  2A5H A;  2WB1 E;  3TS2 A;  3K0Y A;  1E7Z A;  1JE5 A;  2D0O A;  5CGK A;  1TQO A;  4GNX B;  3PO2 B;  2B2T C;  2HUG A;  4DR6 L;  1XWE A;  3CRK C;  5JJZ A;  1STG A;  1SYB A;  4A3L H;  3L9A X;  1F9P A;  1DJR D;  4LF6 Q;  4AQY L;  3ITP A;  1R9T B;  5LL6 S;  1Q7Y C;  1I5F A;  2JA7 G;  5HGQ A;  3M4P A;  5CMD A;  1N33 L;  3BVG A;  5JEA J;  2Q2T A;  1BCP B;  2N8N A;  3VYR A;  4LK1 C;  2A6E C;  4XQN A;  1V1Q A;  3RNU A;  2IHE A;  3T56 B;  3S2H H;  3JAM L;  2B2V C;  2K03 A;  2OEO A;  4XQQ A;  2NBF A;  4DFA A;  1HNX L;  1KL9 A;  1DCZ A;  3EFX D;  4C3H G;  4H44 C;  1SE8 A;  4GOP C;  4PMC A;  5AJ3 L;  1SNO A;  1WD1 A;  3ULL A;  2ATW A;  5IIF A;  4PMW A;  2Q8I B;  2F0L A;  1HA6 A;  4PZ6 A;  4HIK A;  4PZ7 A;  4DV0 Q;  2L15 A;  1LAB A;  1QZG A;  1J8I A;  3EBE A;  3A7L A;  4EVO A;  1RTO A;  4TVA B;  2F03 A;  1TWA B;  2J7Z A;  4RHS A;  4O0A A;  3OWE B;  3CRL C;  1PMR A;  1PA6 A;  2SNS A;  4APV A;  1LLR D;  3S2H B;  3R2T A;  4AYB B;  1N34 Q;  2K33 A;  1YVC A;  3BZK A;  1KIX A;  3K58 A;  3MXN B;  3HOX B;  2VS1 A;  1IYV A;  1KXL A;  1K83 H;  3I70 A;  4B08 A;  3I56 A;  4LF5 Q;  2GN5 A;  2Z8L A;  4YY3 Q;  1Q8K A;  3K5L A;  3FPU B;  1L1O B;  3EN2 A;  2KED A;  4NB3 A;  1Q86 C;  2F0P A;  4G4K A;  1LTT D;  2A6H D;  3MVV A;  1SDF A;  4A3I B;  4JI5 L;  2UU9 L;  4PV1 C;  4MN3 A;  5D3I B;  3SHL A;  3I4N B;  1YHQ A;  3HEJ A;  1AZP A;  2CWA A;  4FDB A;  3OHX C;  5BR8 Q;  1N36 Q;  1P16 A;  3S1N H;  3PUX A;  1LTL A;  3KF8 B;  4YWK A;  3SXH A;  2YTY A;  4DK0 A;  4B3M L;  1SLJ A;  1WTQ A;  1ET6 A;  3A56 A;  4K5X A;  3MFY A;  3PO3 B;  2PMZ B;  4IPG A;  5M5W H;  3BG3 A;  1O7I A;  3GTO B;  4WJ4 A;  3GP7 A;  4YWM A;  3A8K E;  1BOS A;  3BZD B;  2F0I A;  2BA0 A;  3D4W A;  1JJG A;  2L5T A;  1I94 L;  1C0A A;  1RDP D;  4QF4 A;  4POF A;  3W5O A;  3M4O B;  4JPB W;  2PI2 A;  3A7A B;  4KY6 A;  1YI2 A;  3F2D A;  1KQS A;  1DOM A;  3CQZ B;  4BXX H;  4I65 A;  2ZJR A;  1I4H A;  1V1P A;  1GO3 E;  2VXW A;  5C0X J;  2K50 A;  3N6R A;  1AFP A;  2L0C A;  4KJN A;  3W1B A;  5C6A A;  1EFI D;  1HQR D;  2K5D A;  1SJH D;  2O2L D;  3LNN A;  2ES2 A;  1K8M A;  1ILQ A;  5BN4 A;  4WJW A;  5I6W A;  4L5T A;  1ESF A;  5M5W B;  1EY0 A;  4C1N I;  1X3F A;  1H95 A;  4LFA Q;  5CV4 A;  3ERS X;  1XNQ Q;  5JVG 3;  2PNR C;  2JEB I;  1LT6 D;  4DK6 C;  2K28 A;  1SJE D;  4BY7 H;  3S2D B;  4IFD I;  3CKI B;  4K6L A;  3H3V I;  2K52 A;  4JI6 L;  4Y7N H;  1YBY A;  1LUZ A;  2ALY B;  4ZAI A;  2JEA I;  1T5E A;  3QO2 A;  4JI4 Q;  1LT3 D;  3TN2 A;  2CKZ B;  1F77 A;  4DNT B;  2LXK A;  4A3J B;  5FJ8 H;  3VR4 A;  3PUZ A;  1YZ6 A;  4PNY A;  3CAM A;  5H1S E;  1UE5 A;  2PQA B;  3PUY A;  4ZUI A;  3W2D A;  4JBJ A;  1S5E D;  2AMC B;  3KF6 B;  4RH6 A;  1HZC A;  4OO1 G;  4JW0 A;  1HQM C;  4GS3 A;  4IZ8 A;  1LTA D;  1PDQ A;  3S1R H;  2SEB D;  1KD1 C;  1TS5 A;  1XNR Q;  3J81 c;  4BY7 B;  2I5L X;  3ZYY X;  3M4Q A;  1QJO A;  1KAW A;  2R7Z H;  2VNU D;  1BBU A;  3TZU A;  2NVT B;  4LW1 A;  3G4S A;  3J7A F;  3S15 B;  5D65 A;  1EUJ A;  4RGT A;  2PMZ E;  2F0M A;  3URY A;  1QVG A;  2SNM A;  1TWC H;  3CXC A;  4ZKC B;  4GKJ L;  5JJK A;  2B8G A;  4IUQ A;  2B63 H;  1K3R A;  4HJ9 A;  2LMC B;  3SGI A;  1XPO A;  4TQU S;  3L3O C;  2YV5 A;  2JA6 H;  1MIU A;  1PRT D;  1YEZ A;  3A5U A;  4A3D H;  2NN6 H;  4WFN 3;  1OXS C;  3KLW A;  3BDO A;  4PMB A;  3S1R B;  4UAI A;  1A6X A;  2KCN A;  1A3T A;  5KYL A;  4UP8 A;  1A8V A;  4LF4 Q;  1JT8 A;  2AWN A;  4K0K Q;  2FJ2 A;  1IW7 D;  2F0O A;  1PH9 A;  5C4J B;  3H0G G;  1XPU A;  1PH4 A;  1RL2 A;  1HTL D;  3DHQ A;  2OT2 A;  3PV0 A;  4L8J A;  2UXD Q;  1HNZ L;  3ONA B;  2QDL A;  3J80 E;  1L0X B;  3HKZ G;  5JPN C;  1SFO B;  2JA9 A;  1ML0 D;  2HIX A;  3FVQ A;  1SNQ A;  1VMP A;  1X3Q A;  4J1M A;  5BN3 A;  4HAE A;  1B53 A;  5C4X H;  4X62 Q;  2KEN A;  2K01 A;  2F0G A;  2ID0 A;  1IYJ B;  1U5K A;  4L5Q A;  3NEN A;  4IUT A;  4X64 L;  1CA6 A;  1EY5 A;  2K5H A;  5LMN W;  3RZO B;  3BJU A;  3OIQ A;  4DR7 Q;  3ULP A;  1UE6 A;  1LT4 D;  3NK9 A;  4DR4 L;  3FDT A;  1PTO F;  2EY6 A;  4XXE A;  2A68 D;  4A3K H;  4LF8 Q;  1IXR A;  2NB0 A;  3HOZ G;  1EOV A;  3HZX A;  4K5W A;  1ILP A;  1HZ9 A;  1NAP A;  5FLX L;  1VS0 A;  1LTG D;  1SYD A;  3CCM A;  3QR8 A;  1I6H B;  2O5I C;  3A5Z B;  2XTI A;  4YIJ A;  4DUY Q;  4ZUJ A;  4DV6 L;  1I4X A;  2JA7 B;  1IYU A;  1Z7T A;  1X55 A;  3ND8 A;  4BA2 I;  3AFP A;  3UDI A;  1YIJ A;  1BF4 A;  3GTL H;  2V1C C;  3D8G A;  5KEE A;  2CQO A;  5CBA E;  2JXM B;  4A3B G;  1JJC B;  2BDN A;  2IT1 A;  2VQF L;  1BCP F;  3GTM H;  2PQE A;  3PUV A;  2VQE Q;  1KHI A;  1X3P A;  5I4D A;  4CKC A;  4HJA A;  4C3H B;  1Y1W B;  3I4M G;  1OXV A;  1HR0 W;  1NR2 A;  4JI3 Q;  2R92 G;  1WCM G;  2CVR A;  3T1H Q;  5M5X H;  2YTX A;  2NVQ B;  5JEA G;  1MKH A;  4A3C H;  4JI1 Q;  4DAP A;  1W3S A;  1EZ8 A;  5HGT A;  1ROD A;  3F1Z A;  5JJI A;  1YNJ D;  2NVY B;  1N8R C;  5ELB A;  3S16 B;  2Q8T A;  4GZY C;  3F2U A;  4IPC A;  2KVM A;  1PYB A;  1EYD A;  3S24 A;  3U9S A;  1H9K A;  3HKS A;  4JI2 L;  4UY8 C;  2OXP A;  2ZM6 Q;  3QIA A;  4DV4 Q;  5COR A;  4JV5 Q;  2E74 C;  3H09 A;  2RKS A;  3J81 i;  3G6J B;  4BBS G;  1ENA A;  5C44 H;  2L1B A;  2LY7 A;  4DNI A;  5GAE C;  3GTM B;  2CH4 A;  3CF5 A;  4A3E G;  1I4G A;  4G57 A;  3BDL A;  4IPD A;  1PH3 A;  2EVB A;  2IJ0 A;  3E9H A;  1SE2 A;  4ODG A;  1IL8 A;  4KLK A;  5J39 A;  2NTT A;  3I90 A;  4TSS A;  2UUC L;  4L5S A;  1EY7 A;  4DA2 A;  5EAY A;  1EL0 A;  1GXD C;  4C3I G;  4B3S Q;  4LF6 L;  1HNW Q;  3G71 A;  2ENB A;  2WKD A;  1X32 A;  4RAU C;  1IBL Q;  5C4H A;  4LAA A;  1GKH A;  1EQR A;  3KLR A;  5DM6 3;  2R93 G;  4J6H A;  4K2K A;  4CDF C;  2G9H D;  2YU9 B;  1QIL A;  1JE4 A;  4EX5 A;  1KC8 C;  1SR3 A;  2C9O A;  1DGS A;  3HOY G;  4HIO A;  5A2Q E;  2MO0 A;  5T1G A;  5CV7 A;  1H9M A;  2DY7 A;  3NTI A;  3S9W A;  2WFW A;  2SOB A;  4LMQ D;  5G3L F;  4MNO A;  3K5N A;  4ULL A;  5ELC A;  5E1F A;  3K7A B;  1U4R A;  4DV0 L;  2X6G A;  1TS4 A;  1EY8 A;  2KUM A;  1RHP A;  3BYY B;  4AIM A;  1VQ5 A;  1LAC A;  5IOC A;  5CV6 A;  5LHY 1;  2K4K A;  1TU2 B;  1MHW C;  3K7U C;  4EQN A;  2Z9H A;  2BA1 A;  4A4I A;  1YIT A;  3C2P A;  1MSG A;  2IW3 A;  2Q2I A;  3D6C A;  2VW9 A;  1WYD A;  5IYD G;  5D14 A;  1N34 L;  2BE5 D;  4IQZ A;  4O1N A;  4DR1 Q;  1QWY A;  3NBH B;  1A2T A;  4XYQ A;  3OWF A;  4R4I A;  2ASB A;  4K8I A;  3CCU A;  4LF5 L;  1Q46 A;  1VQC A;  4HMI A;  4YY3 L;  4A3F G;  4N8X 1;  1STN A;  2VB3 X;  4KN7 C;  2KCM A;  3I72 A;  5C0X G;  3GTG H;  3K80 C;  1I50 H;  3GTJ B;  3GV3 A;  1Y8P B;  1HH2 P;  3NQI A;  1WTO A;  1N32 Q;  1V43 A;  3OPO A;  1XYI A;  4X3K A;  1ET9 A;  5EKK A;  1O7Y A;  1JOR A;  1JQY D;  4FF3 A;  3ULJ A;  1SN8 A;  2NYZ D;  5BR8 L;  3JAM c;  5KGU A;  4JI7 Q;  1N36 L;  4OEL B;  2XWB B;  1EWI A;  5FO8 B;  3G48 A;  5E4W C;  3AEV A;  2I5H A;  2K5V A;  1OTC A;  1K3B C;  3D0F A;  3QOL A;  3WOE A;  1OXU A;  3IKJ A;  4UP7 A;  2H1E A;  4P73 A;  4UHV A;  1PTO H;  3CCL A;  1SMX A;  4RGN A;  3UDF A;  5IY0 A;  1TY2 A;  1IBK Q;  5E7N A;  5ELD A;  2ICE C;  1MD2 D;  1A3U A;  4ZLT F;  3P1H A;  4CHT B;  2R7D A;  3DWP A;  2BOS A;  4UPA A;  3GTG B;  4DGZ A;  1UE1 A;  1I50 B;  1CSQ A;  3PO2 H;  1JOO A;  1VQA A;  2E2J B;  4L63 B;  3U50 C;  4LWC A;  1B8A A;  2FXQ A;  3RN2 A;  2PW7 A;  3H0G H;  4X65 Q;  2E2I B;  4P72 A;  1R9T H;  3PIP 3;  1SYE A;  2F0D A;  1NMF A;  3CMA A;  1EZ6 A;  2CQA A;  3NP8 A;  1Y1V G;  1EOT A;  1JWS D;  1U0L A;  1G91 A;  1VMC A;  1G51 A;  1SNP A;  3FPP A;  1HUN A;  4I7Z C;  3SR1 A;  1XX8 A;  3FMC A;  2RDF A;  4BWG B;  1VF7 A;  1WTH A;  1NCV A;  1ESR A;  1JC7 A;  2LXJ A;  1VQ4 A;  1XMO Q;  5HY6 A;  1K28 A;  4LFA L;  4QY7 A;  1XNQ L;  1PZI D;  1Z47 A;  4K6D A;  1HJP A;  3RLF A;  1WFQ A;  4DR5 Q;  3VDY A;  1A3V A;  3IAY A;  2QIL A;  1TWH B;  4JC0 A;  4L6T B;  1TII D;  1MGS A;  4C3J G;  2KHI A;  2JA5 G;  3TDQ A;  1W6K A;  1UAP A;  2UUB Q;  2MO1 A;  3H0G B;  1CUK A;  1SSO A;  4JBW A;  4JI4 L;  4HR7 B;  3TBI B;  1X3E A;  1X65 A;  4ME3 A;  3EVQ A;  3CCQ A;  1TWA H;  3K5O A;  1PLF A;  1SYF A;  4R8I A;  1TS3 A;  4JVZ A;  3HKZ B;  4ILW A;  1FGB D;  5K36 H;  2Z6B A;  3PMF A;  5GAD C;  2KOL A;  4Q5V A;  2KJX A;  1HR0 Q;  1HUM A;  4KD4 A;  4NW2 A;  5KNB A;  2FMC A;  2XVS A;  3D3R A;  4FF2 A;  2EY1 A;  1C9O A;  1TWF H;  2AHO B;  1FNV A;  3BYT B;  1STH A;  3NSW A;  1LM0 A;  1YNN D;  4P71 A;  3HOX H;  1PTO D;  3J81 E;  2DNE A;  3FP9 A;  1PH6 A;  3L7Z C;  1Y1W G;  1VQ9 A;  4RGM A;  1Z6H A;  1Z9F A;  2JA8 G;  4HCS A;  4A3B H;  2MHV A;  1XNR L;  2AQ1 B;  4LUZ A;  2G5D A;  4FXD A;  2XWJ B;  4ZK9 B;  1PVO A;  4MTN A;  2M9V A;  1EU4 A;  2FIN B;  1CKN B;  1WCM H;  4IJL A;  5IGF A;  4FO2 A;  4A3I H;  3SE0 A;  4C2M B;  3HOZ B;  3J80 i;  3I4N H;  1JMC A;  1SNM A;  3STB D;  5JEA H;  1JIC A;  3V2T A;  2R61 A;  4RCN A;  2DNC A;  1JOK A;  3H94 A;  2SDF A;  4BY1 B;  4HED A;  1D5X C;  4WOR A;  5C3X A;  4Y52 H;  1TWF B;  3F2C A;  2B2U C;  2IHF A;  3B6Y A;  1QCB D;  2RCN A;  1S72 A;  5DAU A;  2DJF C;  4IOA A;  1BCP D;  1C48 A;  3K0X A;  1NBW A;  3K5M A;  5CYU A;  2NWG A;  3D4R A;  1IBM Q;  2Y0S G;  1T9H A;  3I91 A;  4OEM B;  3PO3 H;  4QMG A;  4IFD G;  4A3B B;  3GTO H;  3SK6 A;  1WTW A;  2LSS A;  1QOH A;  1LTS D;  3NPP A;  4LF4 L;  4GN4 B;  3M4Y A;  4K0K L;  4A3E H;  5EPK A;  2F0H A;  3I4M B;  1GUT A;  3M4O H;  1BUV T;  2R92 B;  1WCM B;  2UXD L;  2NN6 I;  3RZD B;  1I3Q B;  3LWE A;  3CQZ H;  2E5L Q;  3MXU A;  4G7Z C;  4MHE A;  4N9P A;  3GQB A;  3MXG A;  1QVC A;  4ZQ3 A;  4V0B A;  3HOW B;  3S1M B;  5M3M G;  1V8Q A;  1LTR D;  5ELO A;  5GAH C;  4KMU C;  2K75 A;  4QIW B;  4B3T Q;  3Q6S A;  4KI0 A;  1S5C D;  1PRT C;  2EDG A;  3Q22 A;  4N8F A;  1B9M A;  4X62 L;  5F2D A;  1PH1 A;  5I2Y A;  3UI2 A;  1UEB A;  2K5Q A;  2LS0 1;  1F9R A;  2M2L A;  2RA4 A;  4DAM A;  4JCV E;  1WTV A;  1EYC A;  3HKZ E;  4DR7 L;  1E2W A;  1B50 A;  1HFG A;  1QVF A;  4BBS B;  1IW7 C;  3DEO A;  5IGB A;  5FKA C;  5IYC H;  4OGQ C;  1G6P A;  4A3E B;  3S1Q B;  3M9B A;  1QUQ B;  3S2D H;  4QCL A;  3MXP A;  3KDF B;  4LF8 L;  2ZTD A;  3HOU G;  3UE1 A;  1YJW A;  3MEH A;  1ZKO A;  2G9D A;  3T1Y Q;  3TP6 A;  2MJ8 A;  4C3I B;  3OW7 A;  4YCV A;  4GOP B;  4DUY L;  4C1N K;  4EQ5 A;  4A3J H;  4IOC A;  3TRE A;  1CT1 D;  2R93 B;  1LTB D;  4NDX A;  4KJO A;  4JG2 A;  4RKB A;  2L4N A;  1WI5 A;  3H15 A;  3CC4 A;  4ABN A;  2B8F A;  1F2L A;  4HMJ A;  2ZXR A;  4HTH A;  3QG1 A;  3TP7 A;  1A2U A;  2VZA A;  3Q0A A;  3HOY B;  1JWM D;  2VQE L;  2A68 C;  1GUW A;  5J22 A;  1CI3 M;  3A8I E;  4LJZ C;  1JR0 D;  4JI3 L;  3CP0 A;  3LWU A;  2MQH A;  3CC2 A;  1PYW D;  2Z4I A;  4NKL A;  3T1H L;  4X3U A;  2NVT H;  3S15 H;  2PPB C;  3PQI A;  1SE4 A;  5DEH A;  1Y8O B;  2A74 C;  1D8L A;  5KNC A;  5C0X H;  5FLM G;  3C46 A;  4JI1 L;  2A6E D;  4FVM A;  4A3G G;  2I46 A;  4UDU C;  2EXD A;  1II3 A;  3IL8 A;  1H9S A;  2OWO A;  1K8O A;  1D7Q A;  3ERO A;  3MEF A;  3MA2 B;  1YJ9 A;  2OQ0 A;  2ZM6 L;  2F0W A;  3CU7 A;  2EYO A;  1IHZ A;  1WJJ A;  2E2H B;  4DV4 L;  1EQQ A;  4JV5 L;  2F0Q A;  4NXM L;  3X3M A;  1E2Z A;  1HZB A;  5IYB G;  3GTQ B;  4MIU A;  3DMU A;  4QIW E;  1ONL A;  2F0V A;  1FJG Q;  5FLX c;  3T4A C;  3OOC A;  2EZV A;  4DKA C;  1GHK A;  5CR3 A;  2TMP A;  4A3F B;  3C1E A;  2N3S A;  4OHJ A;  5IWA Q;  2D62 A;  1D5Z C;  3AB9 A;  5C4J H;  1EU3 A;  3BVM A;  1JB7 A;  1DON A;  4B3S L;  1HNW L;  1WTP A;  4FP5 D;  3NWT A;  4BBR B;  3E0E A;  1FVI A;  4CJ0 B;  1IBL L;  3CME A;  1SFO H;  5M3F G;  1NY4 A;  1QG7 A;  3D31 A;  1HXY D;  1KDB A;  2JJQ A;  4NXN Q;  5FO7 B;  5EKI A;  3I7F A;  1MI2 A;  1B3A A;  1E2V A;  1VQH A;  2N55 A;  4ZKB B;  3I2Z A;  3ERQ A;  5IGG A;  3F8T A;  3MFG A;  1CQF A;  1AEX A;  2CW0 D;  3RZO H;  2D0P A;  1VQM A;  4WRD A;  4JBM A;  1A62 A;  5ISR A;  1EEI D;  2K7V A;  3R3O A;  2Q2U A;  2GA4 B;  1BR9 A;  4U67 3;  4CDC C;  1ICW A;  1NE3 A;  2Q2H A;  1TWG B;  3E0J A;  3J7A V;  1TKW B;  2K5N A;  1B1Z A;  3TRZ A;  4K2L A;  1D6E C;  4DU9 A;  3KUP A;  1L0Y B;  4C3J H;  2EIF A;  1NSN S;  2F0F A;  4G7O C;  2EJG C;  2NZ1 D;  1I6H H;  4KHV A;  4KN4 C;  5D3D A;  4DV3 Q;  5IT9 L;  2PNH A;  4Z9C B;  1WD0 A;  3H3V C;  4F7X A;  2WKC A;  1GM5 A;  1C8C A;  1UUP A;  2IX0 A;  2D9U A;  1VQI A;  2JA7 H;  3QJY A;  1Y1V B;  3MTS A;  4R1J A;  3KBX A;  2KBN A;  4DR1 L;  1NMG A;  4PZ8 A;  2N88 A;  5T1I A;  2HT1 A;  3VA7 A;  4YHH Q;  1A0I A;  4A93 G;  3K6O A;  5CV5 A;  4C3H H;  1EIY B;  1Y1W H;  2IWH A;  3X3N A;  4GNX A;  5C5M A;  4KKT A;  5I6Y A;  4OWX B;  2Z4H A;  5GQO A;  1N32 L;  1FNU A;  4FF4 A;  3JAM E;  1LYL A;  2NVQ H;  1K73 C;  1Q1B A;  4IFD J;  5ELE A;  3GTK B;  4C3J B;  4WJ3 M;  2VL6 A;  2MP1 A;  4HJ5 A;  2JA5 B;  2NVY H;  4K8J A;  2VB2 X;  1B3Q A;  4JI7 L;  3S16 H;  4BY1 G;  2L12 A;  4XYO A;  3NTH A;  4CJ1 B;  2I5M X;  4RKL A;  4A3L G;  2OTL A;  1O78 A;  2B2W A;  3PIP A;  2HHH Q;  2RHQ B;  4OON A;  5FOB B;  1VQD A;  1CA5 A;  1X3G A;  5E3F A;  1FD7 D;  1HTP A;  4EGV A;  5JPM C;  3C1F A;  2K32 A;  3RLO A;  1PH7 A;  3I4O A;  1IBK L;  2X6L A;  4GLV B;  4DV5 Q;  4M8A A;  3KJO A;  2JA8 B;  5C5L A;  1UEA B;  3JC6 6;  4P2C B;  2L11 A;  3KOJ A;  2QGQ A;  4R9W A;  3RD4 A;  2QW7 A;  3HOW G;  4DUZ Q;  1QZH A;  3L2P A;  4X65 L;  1HCZ A;  2BDO A;  1GUN A;  4DV2 L;  2F0S A;  5JJL A;  3NHH A;  3LX0 A;  4ZRZ A;  4AH6 A;  3G6E A;  4QJF A;  2AUK A;  5M3M H;  3PIO A;  1TS2 A;  3CCS A;  2YU9 H;  1E1T A;  3OTO Q;  3KK7 A;  2F4I A;  3ICE A;  2C5C A;  5C3E G;  3S17 B;  1G2T A;  3MXN A;  1XMO L;  2NZH A;  3U58 A;  3V05 A;  4JOI A;  2Y0S B;  1BQQ T;  2FMM A;  4H0L C;  4H02 A;  5IP9 G;  3AFQ A;  4OWW B;  1YNX A;  1CM9 A;  4DR5 L;  4P74 A;  2MUY A;  1DOK A;  1H9J A;  2VY3 A;  2LFN A;  3NWS A;  3CCV A;  2OCE A;  1L1O A;  4A3M G;  1SE3 A;  1DXM A;  1A15 A;  2QA4 A;  2A69 D;  3K7A H;  4A75 A;  2UUB L;  5NUC A;  4JBK A;  1SYC A;  1VQK A;  1FGU A;  1TR5 A;  4DF7 A;  2WP8 J;  2RBM A;  1JJ2 A;  1AW7 A;  2XNA C;  4QUC A;  3PF5 A;  1SRU A;  2HCC A;  5M3M B;  1VQF A;  3I55 A;  3M7N A;  5K5P A;  3VYT A;  1HR0 L;  1IL2 A;  2JYO A;  3VR2 A;  3KF8 A;  2DN8 A;  2B2T A;  1F2Y A;  5ELN A;  3HG9 A;  1V1P B;  1BNZ A;  1D5M C;  2D2C C;  4V19 0;  4KHZ A;  2KCT A;  2WV6 D;  1RCV D;  3TP5 A;  1DD2 A;  1S5F D;  5COY A;  1EIF A;  4CGY B;  4DNR B;  3A74 A;  3F2B A;  3P20 A;  2VUM G;  3PF4 A;  3GTJ H;  2EPB A;  1KDA A;  4DAY A;  3HOU B;  3UDG A;  4NP5 A;  3VR6 A;  3D4D A;  1VQ8 A;  4O42 A;  1AP0 A;  5FLM H;  2X69 A;  4LFC Q;  1LO5 D;  5EPJ A;  4DAV A;  1TXY A;  5CV9 A;  1KTK A;  1BO0 A;  2CFM A;  1YNN C;  2L9H A;  3Q24 A;  3GTP B;  3K57 A;  1CZW A;  2O4X A;  1BXT A;  4JI0 Q;  4DR2 Q;  1B7Y B;  4FF1 A;  2MNA A;  1IBM L;  2NTS A;  3SK5 A;  2K14 A;  3KJP A;  1G6Z A;  4GNX C;  4OO1 H;  1GJX A;  4OIJ A;  4TKO B;  4ID6 A;  2WII B;  3QWN A;  3Q23 A;  3H6M A;  3T51 B;  1I4Q A;  2MGS A;  3STB C;  1VF5 C;  2QF7 A;  3VYU A;  4BBR G;  2E2J H;  2BH2 A;  1NTG A;  1ZYR D;  2Y0S E;  2E5L L;  4F8M A;  4ME5 A;  4IUU A;  2E2I H;  5I9P A;  4DK3 C;  3KBG A;  4PQX A;  3C3L A;  4A3G B;  1Q8I A;  3K81 C;  1CFM A;  2WAQ G;  5DM7 3;  2RDG A;  4DR3 Q;  1XPR A;  4B3T L;  1KAA A;  5M3F H;  5EBC A; 
#chains in the Genus database with same CATH homology
 2F52 A;  3S1R H;  4PG3 A;  4P75 A;  4DV1 Q;  4A3I G;  1IBM Q;  1KD1 C;  2Y0S G;  1C7Y A;  1T9H A;  1N9W A;  3J81 c;  4HJ7 A;  1XNR Q;  2PQA A;  3PO3 H;  2I5L X;  3I4N G;  3M4Q A;  3CW2 C;  4IFD G;  4XIG S;  1KAW A;  5FJ8 G;  4JI6 Q;  2R7Z H;  4DV7 Q;  3GTO H;  1VCI A;  4B3R Q;  2VNU D;  1BBU A;  2PI2 E;  3KF6 A;  2E8G A;  2LSS A;  3GO5 A;  1B70 B;  4LW1 A;  3G4S A;  4LF4 L;  1EUJ A;  4GN4 B;  4X66 L;  2PMZ E;  2UUC Q;  1VQG A;  4LUO A;  4POG A;  4GLX A;  4A3E H;  4K0K L;  5LMU L;  1QVG A;  1L2F A;  1TWC H;  3CXC A;  2H5X A;  3M4O H;  5IP7 H;  1Q82 C;  1EFW A;  4GKJ L;  1W2B A;  5JJK A;  2MFI A;  2B63 H;  3RLN A;  1K3R A;  1VQN A;  2UXD L;  2NN6 I;  4OWT B;  1TWH H;  1FL0 A;  3AQQ A;  2E5L Q;  3CQZ H;  4HJ9 A;  1VQ6 A;  3PCO B;  2ZJP A;  3SGI A;  1XPO A;  1QVC A;  2UXB L;  5M3M G;  2UXC L;  4TQU S;  3T1Y L;  5GRO A;  1K8A C;  5ELO A;  5GAH C;  5LMN Q;  2ZTE A;  3PO3 G;  2YV5 A;  1E1O A;  4NXM Q;  2K75 A;  2JA6 H;  1K8G A;  2R7Z G;  1MIU A;  4B3T Q;  1XMQ L;  4KI0 A;  3HOU H;  3TS0 A;  1YEZ A;  4LUV A;  4X62 L;  1PH1 A;  3E9I A;  3A5U A;  4A3D H;  4LFB L;  1VQJ A;  1UEB A;  1OXS C;  2HQL A;  3KLW A;  1J5E L;  4YCU A;  4DAM A;  4JCV E;  4J15 A;  3HKZ E;  4UP8 A;  1A8V A;  4DR7 L;  3ZJY C;  2XGT A;  4LF4 Q;  1QVF A;  2UUA L;  4X66 Q;  4JOI C;  1JT8 A;  2AWN A;  3GTP H;  4K0K Q;  5IYC H;  3KFU A;  5LMU Q;  1G6P A;  1PH9 A;  1X54 A;  3H0G G;  1XPU A;  4IJH A;  1PH4 A;  4GKJ Q;  1RL2 A;  3HOV H;  3M9B A;  2JA6 G;  1QUQ B;  3PV0 A;  2UXD Q;  3S2D H;  1HNZ L;  1ASZ A;  4LF8 L;  3KDF B;  2ZTD A;  1G29 1;  3HOU G;  3UE1 A;  1YJW A;  1YJN A;  4A3D G;  2NN6 G;  3HKZ G;  2Z6K C;  2JA9 A;  1CKM A;  1MJC A;  2UXB Q;  2UXC Q;  3T1Y Q;  1HZA A;  3J7A 5;  3K8A A;  2HIX A;  3CPF A;  4HIM A;  1XMQ Q;  2NVX H;  4YCV A;  4GOP B;  4C2M H;  4DUY L;  2F3I A;  3HOZ H;  1QUQ A;  3UDX A;  4EQ5 A;  5C4X H;  4X62 Q;  3J81 j;  4A3J H;  2KEN A;  4LFB Q;  1BKB A;  3KDF A;  5IYC G;  1J5E Q;  3GDE A;  2ID0 A;  1AH9 A;  4IOC A;  1IYJ B;  1U5K A;  4L5Q A;  3NEN A;  3TRE A;  4X64 L;  2K5H A;  4R4Q A;  2A8V A;  5LMN W;  3BJU A;  3DM3 A;  4DR7 Q;  4JG2 A;  4IO9 A;  4BY1 H;  3PUW A;  4A3G H;  2B3G A;  1S40 A;  1CKO A;  1UE6 A;  4NPS A;  3ULP A;  1E22 A;  1WI5 A;  1Q81 C;  2UUA Q;  4GOP A;  3H15 A;  4X6A H;  3K0X A;  3CC4 A;  2A1A A;  4BXX G;  4DR4 L;  3A0J A;  1OXX K;  1UE7 A;  4JI8 L;  5C0X I;  1PHJ A;  4JYA L;  4O2D A;  2VZA A;  3OW2 A;  4RG1 A;  4QGU A;  3BZC A;  2VQE L;  1HNZ Q;  4A3K H;  4LF8 Q;  1IXR A;  3HOZ G;  1EOV A;  4JI3 L;  1FJG L;  5C4X G;  3CP0 A;  1HZ9 A;  4A3J G;  2MQH A;  3CC2 A;  2N49 A;  3T1H L;  1VQ7 A;  1VS0 A;  2NVT H;  3S15 H;  5IWA L;  5IYB H;  3CCM A;  1PH5 A;  3FHW A;  1NJI C;  2KHJ A;  1D8L A;  3J80 c;  5FLM G;  4JI1 L;  3A5Z B;  2XTI A;  3I4M H;  2EQS A;  4DUY Q;  4A3G G;  2C35 B;  5J3B A;  2R92 H;  2EXD A;  4DV6 L;  1L0W A;  1X55 A;  4BA2 I;  3RZD H;  1I3Q H;  4X64 Q;  2OWO A;  1VQE A;  3AFP A;  2R6G A;  3UDI A;  1YIJ A;  4ALP A;  1D7Q A;  3S1M H;  3HOW H;  3GTL H;  2V1C C;  3MEF A;  4A3K G;  4LF9 L;  2CQO A;  4BY7 G;  1YJ9 A;  2OQ0 A;  2ZM6 L;  4A3B G;  2AKW B;  1JJC B;  1WJJ A;  2IT1 A;  4NXN L;  2VQF L;  4JI8 Q;  4DV4 L;  1EQQ A;  4DR4 Q;  4NXM L;  4JYA Q;  4JV5 L;  4IPH A;  3GTM H;  1HZB A;  5IYB G;  3PUV A;  1KRT A;  2VQE Q;  1KHI A;  1VQB A;  1PH8 A;  4LF7 L;  2OTJ A;  4HJA A;  3CCR A;  4QIW E;  4HJ8 A;  3AYH B;  1OXV A;  3I4M G;  1HR0 W;  4JI3 Q;  1FJG Q;  2R92 G;  1WCM G;  5FLX c;  4L5R C;  4DKA C;  3EIV A;  3T1H Q;  5M5X H;  1VQO A;  2YTX A;  4GKK L;  5JEA G;  1MKH A;  2N3S A;  5IWA Q;  5C3E H;  3CD6 A;  4BBS H;  4A3C H;  1X56 A;  2D62 A;  2QEX A;  4JI1 Q;  3Q8D A;  1W3S A;  3M85 A;  3FKI G;  5JJI A;  3F1Z A;  1RIP A;  5C4J H;  1N8R C;  2A19 A;  3PSI A;  3TQY A;  3S1Q H;  1JB7 A;  4DV6 Q;  2ZTC A;  5IP9 H;  4B3S L;  1YHB A;  1HNW L;  3JAM i;  2JK8 A;  1K9M C;  4IPC A;  3E0E A;  1PYB A;  1FVI A;  1IBL L;  3CME A;  1SFO H;  3S24 A;  1NY4 A;  1P8L A;  5M3F G;  3D31 A;  3HKS A;  4A3M H;  4JI2 L;  4LF9 Q;  4UY8 C;  4C3I H;  2ZM6 Q;  2JJQ A;  4R4T A;  2VQF Q;  4NXN Q;  4DV4 Q;  1PFS A;  4GN3 B;  4JV5 Q;  1V9P A;  4DV3 L;  3I7F A;  3NEM A;  2R7F A;  2IY5 B;  3J81 i;  4LF7 Q;  4OX9 L;  5C44 H;  1VQH A;  4BBS G;  4A3C G;  1IZ6 A;  1Q1E A;  4DNI A;  5GAE C;  3I2Z A;  1CSP A;  3F8T A;  3CF5 A;  4A3E G;  2R93 H;  3RZO H;  4IPD A;  2D0P A;  1VQM A;  5IP7 G;  1PH3 A;  4GKK Q;  4JBM A;  1A62 A;  3E9H A;  2B63 G;  3S14 H;  1EYG A;  4KLK A;  1YHA A;  5M5Y H;  3OYY A;  3CPW A;  2UUC L;  4L5S A;  2Q2U A;  2OQK A;  4YHH L;  2F4V L;  5EAY A;  3HOY H;  2N78 A;  4DV2 Q;  4B3S Q;  3LGJ A;  4LF6 L;  1HNW Q;  1NE3 A;  2Q2H A;  3CCE A;  3G71 A;  3J7Z C;  1M1K C;  4R4O A;  2K5N A;  1GVP A;  4QQB X;  1X6O A;  3TRZ A;  3U4Z A;  1IBL Q;  1L1O C;  5C44 G;  1GKH A;  4JI2 Q;  4QL5 A;  4XTC S;  4A93 H;  4C3J H;  1EQR A;  2Z0S A;  2DGY A;  2EIF A;  2R93 G;  1OXT A;  2VUM H;  2BH8 A;  1I6H H;  3W1G A;  4DV3 Q;  4HID A;  2PNH A;  3ER0 A;  3PGZ A;  2RF4 A;  4OX9 Q;  4KHP L;  4EX5 A;  1KC8 C;  1GM5 A;  4GN5 A;  2WB1 E;  1SR3 A;  2IX0 A;  4RMF A;  1VQI A;  1E7Z A;  5GAG C;  2JA7 H;  3TS2 A;  2GVB A;  1JE5 A;  2D0O A;  1DGS A;  3HOY G;  4HIO A;  4GNX B;  2MO0 A;  4R1J A;  4DAY B;  2KBN A;  4DR1 L;  2HHH L;  1NMG A;  4PZ8 A;  3HOV G;  2JQO A;  4DR6 L;  4YWL A;  2E2H H;  2WFW A;  2HT1 A;  1GD7 A;  3BU2 A;  3TEH B;  4A93 G;  4YHH Q;  1A0I A;  2F4V Q;  5IYD H;  4A3L H;  1PH2 A;  4LNQ A;  2YYZ A;  4YCW A;  4MNO A;  3GTQ H;  2WB1 G;  4LF6 Q;  1J6Q A;  4C3H H;  1Y1W H;  1EIY B;  4GNX A;  4AQY L;  4DV0 L;  1S3O A;  1Q7Y C;  4OWX B;  4DV5 L;  1I5F A;  5GQO A;  4AIM A;  1VQ5 A;  1N32 L;  2JA7 G;  5HGQ A;  2K4K A;  3M4P A;  3K7U C;  1LYL A;  1N33 L;  4A3F H;  1K73 C;  1Q1B A;  2NVQ H;  4IFD J;  2BA1 A;  5JEA J;  4A4I A;  1YIT A;  2Q2T A;  2N8N A;  4WJ3 M;  2VL6 A;  5IT9 c;  4HJ5 A;  2NVY H;  1V1Q A;  3RNU A;  2IHE A;  2AWO A;  4JI7 L;  3S16 H;  3S2H H;  3L0O A;  4KHP Q;  4BY1 G;  2Q2I A;  2VW9 A;  4DUZ L;  1WYD A;  5IYD G;  3M3Y H;  2I5M X;  4BBR H;  1N34 L;  4A3L G;  2OTL A;  1HNX L;  1M90 C;  1KL9 A;  3PIP A;  4MZ9 A;  4AYB E;  4DR1 Q;  2HHH Q;  2RHQ B;  4OON A;  3NBH B;  4BA1 I;  1VQD A;  1SE8 A;  4R4I A;  1X3G A;  4GOP C;  4DR6 Q;  5AJ3 L;  2ASB A;  3GD7 A;  3ULL A;  3CCU A;  3OTO L;  4LF5 L;  1Q46 A;  2ATW A;  3RLO A;  1VQC A;  4YY3 L;  4A3F G;  1PH7 A;  2ZJQ A;  3I4O A;  3CC7 A;  1BVS A;  4PMW A;  1IBK L;  1E24 A;  2KCM A;  4AQY Q;  4PZ6 A;  4HIK A;  4PZ7 A;  5C0X G;  4DV0 Q;  3RN5 A;  3GTG H;  2L15 A;  1QZG A;  3K80 C;  1I50 H;  4GLV B;  3EBE A;  4DV5 Q;  3KJO A;  1HH2 P;  1N32 Q;  4TVA B;  1V43 A;  3JC6 6;  1N33 Q;  3KOJ A;  2QGQ A;  4O0A A;  3ULJ A;  1SN8 A;  1PA6 A;  3HOW G;  5BR8 L;  3JAM c;  4JI7 Q;  1N36 L;  1X9N A;  4DUZ Q;  1QZH A;  1EWI A;  4X65 L;  3L2P A;  4APV A;  3DLL A;  1TWG H;  4DV2 L;  1N34 Q;  1HNX Q;  3G48 A;  3AEV A;  5JJL A;  2RHS B;  1KRS A;  1YVC A;  3BZK A;  2I5H A;  4UP9 A;  1KIX A;  2K5V A;  3MXN B;  1OTC A;  2HIV A;  3D0F A;  1OXU A;  4AH6 A;  4DPG A;  2VS1 A;  4UP7 A;  3G6E A;  4P73 A;  4QJF A;  5AJ3 Q;  5M3M H;  1KXL A;  3PIO A;  1K83 H;  3CCS A;  3CCL A;  2YU9 H;  1E1T A;  3OTO Q;  1SMX A;  2GN5 A;  3UDF A;  3I56 A;  4LF5 Q;  4YY3 Q;  5IY0 A;  1Q8K A;  3HFZ B;  3UE0 A;  2YTV A;  1IBK Q;  5E7N A;  1L1O B;  1BBW A;  3ICE A;  5C3E G;  4A76 A;  3EN2 A;  4NB3 A;  1Q86 C;  2R7D A;  1Y1V H;  1XMO L;  2NZH A;  4UPA A;  3U58 A;  1UE1 A;  4JOI A;  1CSQ A;  3PO2 H;  4JI5 L;  3WWV A;  4H02 A;  5IP9 G;  1Q12 A;  4R4C A;  1VQL A;  3AFQ A;  2UU9 L;  1VQA A;  1YNX A;  4OWW B;  4DR5 L;  1YHQ A;  4P74 A;  2CWA A;  4FDB A;  3U50 C;  4LWC A;  1B8A A;  2VY3 A;  2FXQ A;  5BR8 Q;  3CCV A;  3RN2 A;  2OCE A;  1L1O A;  4A3M G;  1N36 Q;  2DUD A;  2IX1 A;  1P16 A;  2QA4 A;  3H0G H;  4X65 Q;  3S1N H;  4P72 A;  2Z6K A;  3K7A H;  4A75 A;  1R9T H;  3PUX A;  2UUB L;  1LTL A;  1Y14 B;  4JBK A;  1VQK A;  1FGU A;  2JE6 I;  3KF8 B;  4YWK A;  1NMF A;  3KYH C;  1PYS B;  3CMA A;  2WP8 J;  2YTY A;  1JJ2 A;  4B3M L;  1Y1V G;  3GTK H;  1SLJ A;  1U0L A;  3PF5 A;  1SRU A;  1G51 A;  1VQF A;  2JA5 H;  3PO2 G;  3I55 A;  3M7N A;  1HR0 L;  4IPG A;  4LFC L;  5M5W H;  1IL2 A;  1WOC A;  1O7I A;  4WJ4 A;  4YWM A;  2LXJ A;  5ELN A;  1VQ4 A;  1XMO Q;  5HY6 A;  2BA0 A;  4LFA L;  4QY7 A;  1JJG A;  1XNQ L;  4KHZ A;  4OXP A;  1Z47 A;  1I94 L;  2KCT A;  1C0A A;  1HJP A;  4JI5 Q;  2UU9 Q;  3RLF A;  4POF A;  1WFQ A;  3W5O A;  2PI2 A;  4DR5 Q;  3VDY A;  4JI0 L;  4DR2 L;  1YI2 A;  2CCZ A;  1EIF A;  3F2D A;  1KQS A;  4JC0 A;  4BXX H;  1AE3 A;  2ZJR A;  3A74 A;  4GLA C;  2KHI A;  2JA5 G;  3NEL A;  1GO3 E;  3F2B A;  2UUB Q;  2MO1 A;  2VUM G;  1CUK A;  5C0X J;  2K50 A;  3GTJ H;  3PF4 A;  4JBW A;  4JI4 L;  2JA8 H;  2NZO A;  1X3E A;  1X65 A;  4ME3 A;  3W1B A;  5IE8 A;  3CCQ A;  1TWA H;  1XJV A;  4B3M Q;  1XTD A;  3UDG A;  2B29 A;  5GAD C;  1VQ8 A;  3IRB A;  5FLM H;  1HR0 Q;  2ES2 A;  4LFC Q;  2GVA A;  4L5T A;  2CWP A;  3RR5 A;  1TXY A;  1C9O A;  1TWF H;  2AHO B;  2CFM A;  1VQP A;  1X3F A;  4OO1 I;  1H95 A;  4LFA Q;  3ERS X;  1LM0 A;  1XNQ Q;  3HOX H;  4P71 A;  1I94 Q;  2JEB I;  3U4V A;  4DR3 L;  3FP9 A;  1PH6 A;  3L7Z C;  1Y1W G;  1VQ9 A;  4DK6 C;  4JI0 Q;  4DR2 Q;  1B7Y B;  1Z9F A;  2JA8 G;  1E3P A;  4DV1 L;  4BY7 H;  2MNA A;  1IBM L;  4IFD I;  4A3B H;  3H3V I;  1A63 A;  1AE2 A;  2K52 A;  2K14 A;  1PV4 A;  1XNR L;  4LUZ A;  3KJP A;  4GNX C;  4JI6 L;  4Y7N H;  4DV7 L;  1YBY A;  5K36 G;  3S17 H;  1LUZ A;  4B3R L;  2ALY B;  3CCJ A;  2JEA I;  4MTN A;  1SRO A;  1MJE A;  1PVO A;  5DLQ E;  2WAQ E;  4JI4 Q;  4IJL A;  1CKN B;  1WCM H;  4A3I H;  4AYB G;  2CKZ B;  3J80 i;  3I4N H;  2LXK A;  3STB C;  1JMC A;  4BBR G;  5FJ8 H;  3H3V H;  3STB D;  3HOX G;  2E2J H;  3PUZ A;  2BH2 A;  1YZ6 A;  1NTG A;  3CAM A;  2Y0S E;  2E5L L;  1K0R A;  3FKI H;  5H1S E;  1UE5 A;  2E2I H;  2PQA B;  3PUY A;  4DK3 C;  3K81 C;  1UWV A;  5LMN L;  2WAQ G;  4JBJ A;  1CKN A;  2AMC B;  3KF6 B;  4Y52 H;  3F2C A;  1HZC A;  1ASY A;  4OO1 G;  2IHF A;  4DR3 Q;  3B6Y A;  2RCN A;  1XPR A;  1S72 A;  2I0Q A;  4B3T L;  4IOA A;  4GS3 A;  5M3F H;  1NBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...