1N36L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36L00
4A3BG 2VY3A 4A3GG 2H5XA 3AYHB 3GTGH 4DR4L 1D8LA 1EQRA 2IT1A 3KYHC 3NENA 1X3GA 4PZ7A 4DV0Q 2WFWA 1OTCA 3GO5A 4DV6Q 4JI2L 3DM3A 1B7YB 4DR1Q 4OX9L 3VDYA 3I4NH 2WB1E 4K0KQ 4C2MH 5IWAL 1JJ2A 2JA6H 4DR6Q 2NN6I 2BA0A 2EQSA 4X64Q 4UP9A 1ASZA 1J5EL 2ALYB 3CCVA 2I5MX 3HOUH 3CCUA 1SE8A 3S14H 1VQDA 1Y14B 4DV1Q 4GLVB 1KXLA 1VQMA 1N33L 1FL0A 4WJ3M 1EOVA 3CAMA 4QY7A 4A3CH 3HFZB 3LGJA 4UP8A 4LFCL 4P75A 3S1MH 3PO2G 1PVOA 1CUKA 3STBC 3HOZH 4GNXA 3BU2A 1FGUA 1K0RA 3I2ZA 2UUAL 3AFQA 1JE5A 4DR3L 1XPOA 2RF4A 4X65Q 1S40A 2OTLA 4HJ7A 4B3MQ 4A3CG 1Z47A 2R92G 1E24A 4HJ5A 3CP0A 5FJ8H 4DV5Q 1N32Q 1VQCA 4GOPB 4LF7L 4GKKQ 1WJJA 3STBD 1IBML 3BZCA 1Q1BA 3D0FA 4MZ9A 4QGUA 2Q2TA 3HOWH 3CCLA 3CW2C 4LF7Q 4DV5L 1PYBA 2R93H 1UE1A 1GKHA 1PYSB 1FJGL 4GLXA 5FJ8G 4NB3A 1X3FA 4OWXB 2A8VA 2Z6KC 3PO3H 4JI7Q 2NVYH 4GN3B 1YHBA 4NXNQ 2YV5A 1GVPA 4JI2Q 4EX5A 4JBMA 2MO1A 3S1QH 2CKZB 2VQEL 4LF6Q 4JG2A 1N9WA 3F1ZA 1L1OC 3L7ZC 4NXNL 4GOPA 4LF5L 2JA7H 4DR7L 1QVCA 1LUZA 2JA9A 3D31A 2B3GA 4O2DA 4R4TA 4LUZA 5IYBH 4OWTB 2DUDA 1HZCA 5M5XH 3ICEA 2VQEQ 4LF6L 1WFQA 4QJFA 4DR5Q 4JI8Q 2JK8A 4JCVE 1EQQA 3G71A 4JI1Q 5HY6A 4JV5L 5GROA 1Z9FA 4DNIA 3TS2A 4A3LH 4C3HH 3DLLA 4AIMA 1A0IA 1IBKQ 3TRZA 3UE1A 2N8NA 4A3EH 3TEHB 5JJKA 4A3IG 2MQHA 4BA1I 4YHHL 3HOXG 3T1HQ 4DK3C 2NN6G 1Q86C 2KHJA 4AQYQ 2OQ0A 3PF5A 1OXTA 1QZHA 4UY8C 1Q82C 4JI6L 3ULPA 3T1HL 1L0WA 4NXMQ 4YHHQ 3TREA 3CPWA 4GKJL 2UXBL 4A3EG 5K36G 2AHOB 3FKIH 4A3DH 5IP7H 4IOCA 1GM5A 5JEAJ 1P16A 2Z6KA 3BZKA 3HKZE 3W1GA 4JC0A 5AJ3Q 3CCJA 3RLNA 2E5LL 4LF8Q 3M85A 1PV4A 2ASBA 3T1YQ 3JC66 2R7DA 1M1KC 2GVBA 1MIUA 3UDGA 4QQBX 2ZTDA 4OX9Q 2ZJPA 1Q1EA 3H0GH 4DPGA 1VQ8A 2R7ZG 1WCMH 4IPGA 4O0AA 4P71A 2Y0SG 2PMZE 3PUXA 4GN4B 4DR2L 1VQJA 3WWVA 3S17H 5HGQA 3RN2A 4JOIC 1SRUA 2R7ZH 3H0GG 1K9MC 4DV2L 3JAMc 3UDFA 4JI8L 4IJLA 1XMQL 4A75A 4A3BH 1CSPA 5IT9c 4DV0L 5EAYA 1Q81C 2HQLA 1QUQA 3SGIA 3PO2H 4R4OA 3A74A 4A4IA 1NE3A 2UXDL 4C3JH 3CCSA 4B3SQ 2Z0SA 1PH8A 2OQKA 3A0JA 2K14A 4H02A 1Y1WG 2JA7G 5IYDG 1U0LA 1HNWQ 1WYDA 2LXKA 4LF9Q 2UUCQ 2ES2A 4LUOA 5ELOA 1VQEA 3E9IA 4WJ4A 1VQ7A 4IFDJ 4PZ8A 1TWHH 1XNRL 1XNQQ 4HIDA 1R9TH 3TS0A 4JI7L 1LM0A 4OO1I 2JA5H 1HNXL 2JEAI 3OTOL 1YVCA 1J6QA 1FJGQ 2OTJA 1UEBA 2E8GA 1YHAA 1WCMG 1TWCH 3KF6B 3GD7A 2BH8A 3I55A 1XMOQ 2F4VL 1Y1VG 4HIOA 3PO3G 1VS0A 3HOVG 2IHEA 2UU9L 4MNOA 1XPRA 1I50H 3Q8DA 3CCRA 1LTLA 5M5YH 2Q2HA 4LUVA 2B63H 2XGTA 4KLKA 3J81i 3HKSA 3CQZH 1S72A 1HR0Q 4X6AH 3F8TA 2K5NA 2MFIA 2ZTCA 4RG1A 1QUQB 3OW2A 2HHHQ 2B63G 1XMQQ 5GQOA 3KF6A 1YITA 1RL2A 1I94L 2IHFA 4A3FH 1A62A 1HJPA 4B3TL 3M4QA 3G4SA 1TWAH 2CQOA 1NBWA 2XTIA 3ULLA 4HJ9A 1BBWA 3NELA 2VW9A 1EYGA 3PV0A 4YY3Q 4JBWA 1WOCA 2YYZA 1X9NA 2HT1A 1DGSA 4P74A 4JI3L 5IP9G 4X64L 4HJAA 1HNZQ 4JBJA 3KDFB 4A3GH 3KJPA 5IWAQ 2KCTA 2I0QA 5GAEC 4R4IA 3NEMA 3CC4A 2N78A 2K52A 5LMNW 2PQAA 5M3FG 1I94Q 1VQLA 3M3YH 2DGYA 4IPHA 4C3IH 4GNXC 3J80c 2GVAA 5AJ3L 5C44G 4APVA 4BY1G 3PUWA 3KLWA 1T9HA 4NXML 4HIMA 3M4PA 5M3FH 5IP7G 5BR8L 4KHPQ 1CKMA 3TQYA 4DK6C 4PMWA 1KQSA 1JJCB 2ZTEA 4IO9A 1Y1WH 1KIXA 4DAMA 4UPAA 1UE5A 2VS1A 4DV1L 2VZAA 2FXQA 3RN5A 3NBHB 3S2HH 3PGZA 3CC2A 4LF4L 3K7AH 2A19A 1VQ6A 3S16H 1IZ6A 4JI3Q 1GO3E 4A93H 1TWFH 4JI5L 1CKNA 4A3KG 4A3JH 2PQAB 1AE2A 1N34Q 4ALPA 2YTVA 4PZ6A 1X3EA 4DV6L 1B70B 1VQHA 1EUJA 2K50A 3J81c 4LF9L 4OWWB 3J7ZC 3HOWG 3J80i 1IL2A 1UE7A 5C3EH 1E1TA 4JOIA 2YTYA 1NMGA 4JI0Q 1KAWA 5ELNA 5M3MH 4LWCA 4B3TQ 2VUMG 5LMUL 4DR7Q 3KFUA 2Q2IA 1XTDA 4J15A 4DUYL 3ERSX 4R4QA 5IYDH 1UWVA 4MTNA 1W2BA 2CCZA 2F52A 2JJQA 1K8AC 1VQBA 3GTKH 1TWGH 1VQFA 4BXXG 4DUYQ 3B6YA 4YCVA 2K75A 3CCMA 3CC7A 4DV3L 4DV7L 4DUZL 3PUYA 1YZ6A 3I4NG 1HR0L 3CXCA 4HJ8A 4JI0L 5C4JH 3GTJH 2ATWA 3GDEA 3RLFA 3H3VI 4LFBL 1K73C 2WAQE 4LW1A 2VNUD 4LFAL 2MNAA 3AEVA 2D62A 5IY0A 1SROA 4JYAL 1VQ5A 4XIGS 3S1NH 4YWLA 1N36Q 1Y1VH 4AYBE 4L5SA 3HOVH 2LSSA 2OWOA 4GKKL 1PA6A 3RLOA 5C0XG 1JMCA 1V43A 2PNHA 3UE0A 4EQ5A 2AKWB 1E1OA 2ZM6Q 4IOAA 4DV4Q 5JEAG 1OXUA 1L1OB 4X65L 2UUAQ 1V1QA 3AFPA 1Q46A 2N49A 1KD1C 1BBUA 4JBKA 4GKJQ 2UXBQ 3U4ZA 2BA1A 1PH1A 4A76A 2HIVA 1VQOA 1PH9A 2QA4A 1JB7A 3I4MG 1HR0W 5C44H 1MKHA 3GTLH 2WAQG 1BKBA 1HZAA 3L2PA 1PH7A 3I4OA 4QIWE 3E0EA 5J3BA 4TQUS 1VQ4A 3CD6A 1H95A 4OO1G 4ME3A 2ZJQA 1IXRA 1B8AA 4P73A 4POGA 3EIVA 2NZOA 2NVQH 3HOUG 3HKZG 2K4KA 2NVXH 2UXCQ 4GNXB 2UUBL 1VCIA 4GLAC 1HNZL 1E3PA 1YEZA 5FLXc 2YU9H 4LFBQ 1X6OA 2K5VA 4OXPA 4DR6L 4JV5Q 4Y52H 2EIFA 4K0KL 5H1SE 2LXJA 3A5ZB 1E7ZA 4A3JG 1S3OA 1QZGA 4R1JA 4KI0A 3EN2A 3H3VH 2HHHL 4YWMA 2UXCL 2C35B 2UUBQ 4DR4Q 2JA5G 1D7QA 1YJWA 1KHIA 1I6HH 4IPCA 2V1CC 1KL9A 1K8GA 3K7UC 3HOXH 4LF5Q 4JI6Q 2QGQA 5IYBG 1PHJA 2CFMA 4Y7NH 4A3MG 1FVIA 1G51A 2AWNA 5BR8Q 3PIOA 4KHPL 3K0XA 4NPSA 4X66Q 3M4OH 3M9BA 5JJIA 5JJLA 2KCMA 1N34L 3I56A 1SN8A 2JEBI 4GN5A 5IE8A 2AWOA 2JA8G 2ZJRA 1NTGA 4A93G 2E2JH 3PUVA 4DV4L 4A3KH 2ZM6L 1VQ9A 5LMNQ 5C4XH 4OONA 2UU9Q 3PSIA 3J81j 1EIFA 4DV3Q 3E9HA 2PI2E 3K8AA 2R7FA 5IYCH 2QEXA 1YJNA 1N36L 2B29A 1QVFA 5LMNL 1AH9A 4FDBA 1P8LA 2UUCL 4LFAQ 3U4VA 1VQNA 2JE6I 1PH2A 4P72A 1CKNB 3KJOA 4BBSH 4DR5L 4DV7Q 2CWAA 3ER0A 1SFOH 4X66L 1NMFA 3PIPA 4KHZA 3HOYG 1PH3A 4TVAB 3PUZA 2R6GA 1EIYB 4DV2Q 1YI2A 1VQAA 2Y0SE 1OXSC 1OXXK 1I5FA 3BJUA 4AYBG 4B3RQ 4X62L 4BBSG 1N8RC 2PI2A 2N3SA 2E2IH 1AE3A 4JI4Q 1NY4A 1MJCA 2IX0A 1W3SA 3K81C 4XTCS 2ID0A 1X54A 4A3IH 1U5KA 4IPDA 1PH4A 3CCEA 1A8VA 2VQFL 1SLJA 2EXDA 1VQKA 1PFSA 4DR1L 3JAMi 1L1OA 4R4CA 4GOPC 1X56A 2KBNA 3CMEA 3T1YL 3MXNB 4L5QA 4A3FG 4BY7H 4IFDG 3ULJA 3KOJA 1C0AA 1JT8A 4YWKA 2R92H 1KRTA 1OXVA 2E5LQ 4B3ML 4AH6A 4LF8L 4BXXH 5C0XI 2WP8J 3FKIG 4YCWA 2I5HA 5FLMG 1K3RA 2L15A 2OCEA 3CCQA 4X62Q 3I4MH 4BY7G 2IY5B 1G6PA 2WB1G 3S2DH 1YNXA 2RCNA 1IBLL 3W1BA 4LFCQ 3GTQH 2IX1A 4AQYL 1SMXA 1I3QH 4PG3A 1Q8KA 4BBRH 3GTMH 2A1AA 3G48A 1IBLQ 3GTPH 2KENA 2GN5A 3FHWA 1HZBA 4POFA 1V9PA 2I5LX 2RHQB 3CF5A 1IBKL 1VQGA 2UXDQ 1C9OA 1CSQA 3U58A 2F3IA 3OYYA 5GADC 1C7YA 1VQIA 3S1RH 1HNXQ 1M90C 1VQPA 2JA6G 2VQFQ 1LYLA 3F2BA 1XJVA 1X65A 1K83H 4DKAC 1J5EQ 5C4XG 1KC8C 1BVSA 2NZHA 1UE6A 4DR2Q 2E2HH 2R93G 3IRBA 5DLQE 5IYCG 4YY3L 1YIJA 2D0PA 1HNWL 4DAYB 1PH5A 4JI4L 4A3DG 2AMCB 3RR5A 3PF4A 3UDXA 4B3RL 1O7IA 4IJHA 3EBEA 1MJEA 1PH6A 1EWIA 3F2DA 1EFWA 4BA2I 4B3SL 2KHIA 5FLMH 5E7NA 3W5OA 1HZ9A 4A3MH 3KF8B 3RZDH 1G291 3J7A5 2JQOA 3CPFA 1X55A 3A5UA 4BY1H 2YTXA 1YHQA 3RNUA 2D0OA 3GTOH 1IYJB 1WI5A 3H15A 1RIPA 2F4VQ 4L5TA 5C3EG 1GD7A 2MO0A 3AQQA 5C0XJ 1JJGA 2VUMH 5IP9H 3U50C 3CMAA 3F2CA 4L5RC 2K5HA 4RMFA 1IBMQ 5M5WH 1XNQL 1A63A 3PCOB 2CWPA 3G6EA 1YJ9A 3L0OA 1XNRQ 1XMOL 1SR3A 4JYAQ 1Q12A 4A3LG 4JI5Q 4HIKA 3OTOQ 2VL6A 1Q7YC 1XPUA 3S15H 2RHSB 1NJIC 4DR3Q 4GS3A 4LF4Q 3RZOH 3M7NA 4JI1L 1L2FA 4DUZQ 1HH2P 1ASYA 4QL5A 1QVGA 3FP9A 3I7FA 3KDFA 4LNQA 3HOZG 3ZJYC 1N32L 2JA8H 4IFDI 2HIXA 1YBYA 3UDIA 4UP7A 3HOYH 5GAHC 2Q2UA 2NVTH 1N33Q 1KRSA 3K80C 5GAGC 1CKOA 1TXYA 4YCUA 5LMUQ 2BH2A 5M3MG 3MEFA 4BBRG 1E22A 3S24A
chains in the Genus database with same CATH superfamily
1XTCD 4X3KA 1X32A 2IL8A 1II3A 4DR4L 2IT1A 3KYHC 1X3GA 1ENAA 4PZ7A 3GO5A 1ESFA 4DR1Q 3MFYA 2LKVA 2QDLA 2EQSA 4H13C 4X64Q 2PW7A 2F3WA 1J5EL 5I9OA 3KF8A 1SE8A 1D5ZC 1Y14B 1LT3D 1HRJA 3BVGA 3K7AB 3LGJA 1CUKA 4DNTB 3HOZH 1HUNA 2WINB 2OF1A 1B9NA 3BU2A 1FGUA 1K0RA 3AFQA 1GUTA 1I4RA 2RF4A 4X65Q 2OTLA 4A3CG 2R92G 5FJ8H 5EPJA 1JORA 3S1QB 1S5DD 1QOHA 3T4AC 3KLSA 1SNDA 2M9VA 1IBML 3D0FA 3S1MB 4LF7Q 3CW2C 1VDZA 4DV5L 3TP7A 2EYMA 1X3FA 2Z6KC 4GN3B 1YHBA 3Q6SA 3J80E 1ICFB 1GVPA 4JBMA 1MHWC 2MO1A 1STEA 2CKZB 4LF6Q 4DA2A 4EQNA 3M7GA 4JG2A 3F1ZA 5C5LA 1Y1VB 3L7ZC 1TY2A 4NXNL 4C56C 4A3JB 4BWGB 4LF5L 4O2DA 3D31A 1I4GA 2B3GA 2TMPA 5IYBH 2A6HD 4OWTB 1ML0D 1HZCA 2DUDA 5LL6S 3NE5B 1NUCA 4JI8Q 4DFAA 4JCVE 3SVMA 5T1IA 3VR5A 3WDNA 5JEAH 3KK7A 1Z9FA 4CJ1B 3TS2A 4A3LH 1I3QB 5IGFA 3DLLA 4U68A 4N8X1 3GTOB 3N52A 1A0IA 1IBKQ 2K5WA 3Q22A 5J39A 5K36H 2RSNA 3VR2A 4HMJA 4AQYQ 4EGVA 3S1NB 3DWAA 5K36G 1Q8IA 3FKIH 4IOCA 2GA4B 2R7ZB 2Z6KA 3HKZE 3CU7A 2R7DA 3S9WA 1MIUA 1Q1EA 1LLRD 4IPGA 5FK9C 5IGGA 3GTMB 2F0DA 5HGQA 3S17H 3K5MA 1SRUA 2EXZA 2QCPX 3H0GG 4C3HG 1K9MC 4CHTB 4DV2L 4IZ8A 1Q81C 1EQVA 3A74A 4A4IA 1NE3A 5DM63 1F2ZA 1H9RA 2L0CA 2K14A 4ZUJA 1Y1WG 1U0LA 1MSHA 1BCPC 2O5JC 3E9IA 2ZT9C 1TWHH 1XNRL 4JI7L 2CQAA 2JEAI 4HSVA 1SJHD 5I9PA 1F2YA 2E8GA 3AU7A 3KF6B 4K8IA 1F9RA 4MNOA 1I50H 1LTLA 4LUVA 4HEDA 4KLKA 4K14A 1DOLA 1EWHA 2JA5B 2RVLA 3I4NB 3OMGA 3HG9A 4PQXA 4K5XA 5ELEA 2KVMA 2MFIA 2I07B 1QUQB 3OW2A 4KJNA 3HEJA 2D2CC 1RL2A 1I94L 4A3FH 3M4QA 1TWAH 1L0YB 2XVSA 3S2DB 3NELA 4ZCKA 2HQEA 4I65A 5IP9G 3KDFB 3QR8A 2KCTA 3CC4A 1HQRD 4R4IA 2N78A 3OHXC 3M3YH 4C3IH 3J80c 2GVAA 2IPKD 2NYZD 2RA4A 5I2YA 4CDFC 4A93B 3NQIA 4JPBW 1QNUA 4IUNA 4NXML 1J8IA 4C3IG 1SNCA 2N55A 4CKCA 2IW3A 1JE4A 1KDBA 1Y1WH 3NBIA 1FNUA 4K5VA 4XT1B 2FXQA 3NBHB 3OW7A 5G3LD 3CC2A 4LF4L 1QJOA 4OL7A 4R9WA 2A19A 1VQ6A 3DWPA 1IZ6A 4JI3Q 2Z8LA 1B1ZA 2A6ED 5JVH3 4PZ6A 4DV6L 3J81c 4LF9L 3J7ZC 3J80i 1IL2A 1E1TA 3BYYB 4JOIA 5ELNA 1G6ZA 3R8BA 1IYUA 2Q2IA 3V2TA 1TS5A 2L55A 1GJXA 3H6MA 1W2BA 2RDFA 1SBBB 3A8IE 1VQFA 2K75A 3CC7A 3D8GA 5J1ZA 2PNRC 4OIJA 4LFBL 3H3VI 2MNAA 2F3VA 3T51B 4IQZA 1MI2A 3S1NH 4YWLA 1N36Q 1QE6A 3AMUA 4AYBE 2AUKA 3FKIB 1PA6A 4GKKL 5NUCA 2FHTA 1V43A 2PNHA 4EQ5A 2AKWB 5JEAG 1R9TB 2NTTA 1V1QA 2UUAQ 1KD1C 1KAAA 1BBUA 3U4ZA 2BA1A 5E3FA 1BDOA 5JPNC 5C44H 4IUQA 3QB3A 4IUVA 3L2PA 2QF7A 2EYFA 1RF2D 5J3BA 4U673 1ZEQX 4IUPA 1NCVA 1QG7A 4POGA 4M1UB 4MHEA 2NWGA 1I6HB 4LJZC 3OPOA 4GNXB 1VCIA 1YNJC 2H4OA 4OXPA 5JPMC 5H1SE 3HP3A 1DYQA 3DXJC 1ICWA 1L0XB 4R1JA 1TS2A 3EN2A 3H3VH 1WD1A 1B50A 3J81E 2C35B 2PW5A 1D7QA 1DM0B 2NVXB 3UI2A 1EZ8A 5CBAE 1BBXC 3SK8A 5IYBG 3URYA 1PHJA 1EWCA 2AWNA 5BR8Q 3PIOA 4KHPL 3K0XA 3GV6A 1WTVA 5JJIA 2B2YA 3OOCA 1I50B 2ZXRA 2JEBI 1GUSA 4HN7A 3OIPA 3PUVA 2RDHA 1V1PB 3RD4A 2ZM6L 4KKSA 1U4PA 5C4XH 1EIFA 3E9HA 4RAUC 3K8AA 5BN3A 5IYCH 4Y7NB 2QEXA 1N36L 1B3QA 5LMNL 4V190 3BZDB 1AH9A 1Y1WB 2JP1A 2B2UC 3AB9A 3K59A 1LO5D 1CTMA 2Z9HA 4LFAQ 4ILWA 2F0FA 1LT5D 4C1NK 3C1FA 4OHJA 4DV7Q 2C9OA 1TWFB 3PIPA 3VR6A 4V0BA 1LTRD 3PUZA 2NZ1D 4B08A 1YI2A 2Y0SE 1I5FA 3BJUA 2Y0SB 4B3RQ 3PIP3 1N8RC 5DEHA 1H9SB 4JI4Q 2SNMA 1NY4A 1MJCA 3P20A 3J81L 4BBSB 2ID0A 4A3IH 1WD0A 2R3ZA 2HCIA 4BBRB 3JAMi 1KTKA 4KN7C 2CH4W 4BY7H 1IW7C 2R92H 1KRTA 1KLUD 2KHSA 4YCWA 2I5HA 2E2IB 2OCEA 2ICEC 1G6PA 2WB1G 3I72A 5EPKA 1SYBA 1FYCA 3BS1A 1Q8KA 1IBLQ 1G8ZD 2C5CA 2EYJA 4XYQA 2GN5A 4Z9CB 1C9OA 5GADC 1WTHA 5JJZA 1C7YA 1VQIA 4FVMA 4KN4C 1LYLA 1K83H 1X3PA 5M3FB 1J5EQ 5C4XG 1HHVA 1IHZA 4FF1A 1HNWL 1PH5A 4A3DG 4DAPA 2RSOA 4B3RL 2L1BA 1EFWA 3VYTA 2K04A 3GTJB 4BA2I 2XRSD 2KHIA 3S1RB 4A3MH 1HZ9A 1Y8NB 1G291 1TWCB 2QEJC 1YHQA 3QWNA 1RIPA 5C3EG 2K1BA 2NUCA 2VUMH 3F2CA 1NNXA 2K5HA 4RMFA 4C3JB 1SR3A 4HTHA 1LABA 4JYAQ 1Q12A 1RKNA 1CA5A 3S15H 4A3DB 3ZYYX 2EY6A 3M7NA 1HH2P 4QL5A 1D2BA 3EFXD 4UAIA 1N32L 2JA8H 2HIXA 3HRZC 4UP7A 1SYCA 3EA6A 3K80C 5GAGC 5CV7A 1E22A 4X62L 1EYAA 2VY3A 4LAAA 1GXDC 3GTGH 4KV6A 3NENA 4DV0Q 2SEBD 2WFWA 1U4MA 2KJXA 4OX9L 2WB1E 1YNJD 5IWAL 2F0MA 2E74C 4DR6Q 4UHVA 2WV6D 1HFGA 5FO9B 4KTAA 1ASZA 3MEHA 3GP7A 4DV1Q 2MUYA 4GLVB 4R8IA 3WOEA 1FL0A 2Z6BA 3EROA 1EOVA 3CAMA 4YIJA 4DAVA 4UP8A 3PO2G 4P75A 3MA2B 1PVOA 3K0YA 1EU3A 5E4WC 2JA6B 4F87A 2UUAL 1JE5A 4RWSC 1LTGD 4B3MQ 1E24A 4HJ5A 1WTPA 1N32Q 1VQCA 1D5MC 3CRKC 4GKKQ 3STBD 3MXPA 4MZ9A 2Q2TA 3HOWH 5KIXA 3CCLA 2XN9C 1RODA 3ITPA 5IGCA 1FJGL 4GLXA 2A74C 1JOOA 4FXKC 3PO3H 1U4LA 4IUTA 3LNNA 1B2TA 2ZXPA 4A3FB 4EX5A 2F0QA 1LT4D 3IL8A 2VQEL 1G2TA 5I6YA 2JA7H 1SDFA 1K83B 2IX3A 4BY7B 2AQ1B 1GHJA 2KUMA 4LUZA 1IKMA 1EY4A 2JK8A 2ICIA 3G71A 4A3MB 2K28A 3GTLB 4ZKBB 1U4RA 1ET9A 5JJKA 2N8NA 3Q0AA 5D65A 4A3IG 3NP8A 4BA1I 3HOXG 4DK3C 1Q86C 3BG3A 1GUWA 1QZHA 2OQ0A 3H91A 1OXTA 3PF5A 1Q82C 4JI6L 4KMUC 1L0WA 4NXMQ 3TREA 3S15B 4A3DH 4L5RC 5AJ3Q 3NHHA 2ASBA 2EY5A 1EEFD 1PV4A 2EZVA 4A3EB 3FVQA 2GVBA 4QQBX 2ZJPA 2R7ZG 4DPGA 1VQ8A 1EYDA 1WCMH 3HGBA 4GN4B 3TMEA 1LACA 4IURA 4AYBB 3DWQA 1STBA 4X3TA 2FJ2A 4CJ2C 5FO8B 1PRTF 3KBXA 1ZKOA 2B2TA 5IT9c 4A75A 1LT6D 2NVQB 3BDLA 4R4OA 3H0GB 5CMDA 2CW0C 3CCSA 1ZYRD 3DEPA 1TS3A 1PH8A 1NSNS 2OQKA 2K33A 2Q8IB 5IYDG 1WYDA 2TSSA 2E2HB 2ES2A 4CDCC 4P2CB 5ELOA 1XWEA 4C1NI 4IFDJ 1SE3A 1I4HA 1B44D 4NDXA 3V05A 1R9TH 1R4PB 1LM0A 1SE2A 1HNXL 5ISRA 1EY7A 3K5NA 1FJGQ 2OTJA 1YHAA 1EFID 4RKLA 1EIHA 2BH8A 4RA8A 2F4VL 3PO3G 1B4OA 1VS0A 1JOQA 1PRTB 3R2IA 1TIID 3I4LA 3CCRA 5IGBA 1BR9A 4H7BA 3CQZH 3VYSA 2J0TD 4G7HC 2K5NA 3I70A 1PTOH 1XYIA 1W6KA 2VXWA 2B63G 3M3YB 3TDQA 5KNBA 4B9XA 2B2TC 3G4SA 1HUMA 1NBWA 2CQOA 3ULLA 4HJ9A 3MAQA 5M5YB 2VW9A 3PMFA 4DN4M 3MTSA 4P74A 2DJFC 1ET6A 1K3BC 2EJGC 4JBJA 4A3GH 3KJPA 5IWAQ 5C4HA 5D3IB 2E2DC 1YNNC 4UDUC 1VQLA 3S2HB 5EKKA 1Z6HA 4I7ZC 1EY8A 4BY1G 3CRLC 4DF7A 2EPBA 4FP5D 5IP7G 5BR8L 4KHPQ 2DY7A 4K5WA 1JJCB 1NR4A 4DAMA 2F0WA 1D6EC 4KY7A 1SEBD 2HD3A 2VS1A 4IFDH 2BE5D 4DV1L 3RN5A 2L12A 4J8QA 4LMQD 3NTKA 2PPBC 1SFOB 1TWFH 1CKNA 1E0BA 2G9DA 1Q3LA 3A56A 4A3JH 1SE4A 1AE2A 1H9KA 2YTVA 1X3EA 3JAME 1B70B 1VQHA 1EUJA 3MC0B 1UE7A 4LK1C 3A7LA 4DXGA 2VUMG 4DR7Q 5IYDH 1UWVA 4MTNA 2CCZA 1E2VA 3GTKH 1TWGH 2PZUA 5C3XA 4DV3L 3I4NG 1HR0L 4QCLA 5C4JH 1SNPA 2ATWA 3GDEA 4RFBA 2WAQE 3AEVA 5M9OA 4JYAL 1VQ5A 5FKAC 1Y1VH 3NBHA 4L5SA 2OWOA 1JMCA 1A2UA 1E1OA 4X65L 1OXUA 1VF5C 4JBKA 1Q46A 2Q8TA 2F0TA 3I4MG 1WCMB 2HIVA 1VQOA 2DJGC 4XT3B 4ID6A 2WAQG 1BKBA 4QIWB 2FFKB 3I4OA 1VQ4A 3S17B 1H95A 2B2UA 1IXRA 1STHA 5EPLA 1AFPA 4F8MA 1R4QB 2UXCQ 2K05A 3ND9A 1O7LA 2UUBL 1HNZL 1YEZA 2YU9H 1X6OA 2K5VA 2NVTB 1EYCA 5CYUA 4K0KL 2LXJA 1GUOA 1E7ZA 4R8NA 1S3OA 4IUUA 3NTHA 2AQ3B 4YWMA 4RCNA 2UUBQ 2DY8A 1EY6A 1LV9A 2RBMA 4IN3A 2V1CC 3EQLC 3HOXH 4JI6Q 4FYDA 2QGQA 4Y7NH 3Q23A 3M4OH 3M9BA 5JJLA 1CHPD 1SN8A 4GN5A 1ILQA 2E2JH 2JA8B 2BDOA 2B39A 5LMNQ 4OONA 3G6JB 3J81j 4DV3Q 1QVFA 2R7FA 1S5ED 2Q8RE 3SK4A 2EYOA 1PH2A 3NQTA 4P72A 4BBSH 2PZTA 4DU9A 4DR5L 1SFOH 3ER0A 1GUGA 4C2MB 3HOYG 1PH3A 4A3GB 1IL8A 4DV2Q 1Q90A 1VQAA 1OXXK 5EBCA 1SNQA 4BBSG 5CBEE 1TVXA 3H09A 3S14B 5ELFA 2N3SA 2E2IH 1AE3A 4KD3A 2IX0A 2L11A 3K81C 4XTCS 4NP5A 5DAUA 5KRUA 3CCEA 2FMCA 2VQFL 1PFSA 1L1OA 4GOPC 2QKIC 1W6JA 1Y8OB 1JT8A 4IFDG 4ULLA 3O13A 1B3AA 3NPPA 2E5LQ 4B3ML 1KDAA 4LF8L 4BXXH 2WP8J 4X62Q 3I4MH 1CM9A 3TBIB 1YNXA 5KNDA 1X3QA 3NWTA 3GTMH 3G48A 4DGZA 1HZBA 4POFA 1V9PA 2I5LX 4WRDA 1C48A 2K7VA 2SOBA 2MGSA 2F3IA 3A55A 1HNXQ 1M90C 4ZRZA 1EY9A 4DAYA 3EJIA 5C5MA 3IFDA 3OWFA 3SDZA 1JICA 3GTPB 4NW2A 1BVSA 2NZHA 4CDEC 1KC8C 2RCFA 2MHVA 3IRBA 4N9TA 5DLQE 2D0PA 1BCPF 1O7IA 4IJHA 3J7AV 2B2WC 1PH6A 4ZYSA 4QB4A 2A5HA 5FLMH 5E7NA 1EIGA 3FEWX 3W5OA 3J7A5 2K5DA 2F0LA 4H0LC 1TS4A 3A5UA 4BY1H 1CQVA 2EVBA 2YTXA 2F4VQ 1K8OA 2HDLA 2MO0A 3E5SA 4A3BB 3OSOA 5C0XJ 1K28A 3J80L 4FF3A 1BXTA 1EQTA 3I3CA 5C3EB 3G6EA 5C44B 1XMOL 2B8GA 4A3LG 1Q7YC 1BCPB 2VL6A 3NTIA 4WJWA 4MTKA 1NJIC 3GTGB 4LF4Q 3RZOH 1G91A 3FP9A 3I7FA 3P7JA 2KEEA 4LNQA 2ZXOA 4IFDI 1YBYA 3UDIA 1F9QA 4PMBA 2G9HD 2NVTH 1HPCA 1KRSA 2QW7A 1CKOA 1TXYA 4YCUA 5M3MG 4JK1C 2B2VA 1SYGA 2F0UA 3S24A 4A3BG 4A3GG 5BN4A 1D8LA 2XSCA 1RTNA 1SAPA 4DNRB 4DV6Q 1OTCA 2B2VC 3DM3A 4K0KQ 3QG1A 1AZPA 2L5TA 2WB1B 4C2MH 1JJ2A 5F2DA 2PZWA 2BA0A 4UP9A 2ALYB 4NKLA 3CCVA 4ZLTF 2I5MX 3HOUH 3S14H 1VQDA 1KXLA 1VQMA 1N33L 3VA7A 4ZAIA 4QY7A 4A3CH 3HFZB 1LTBD 2XRQD 3S1MH 3STBC 1SNMA 5D14A 4DXFA 1S40A 4DR3L 3A8KE 1XPOA 3PO3B 2VB3X 5C3WA 5KGUA 3CP0A 4XQNA 3LX0A 3DM1A 4GOPB 1JWSD 2J4XA 1NR2A 1WJJA 1CA6A 3BZCA 1Q1BA 4QGUA 1PLFA 1PYBA 4B9WA 1IYVA 1MD2D 4NB3A 2BDNA 4OWXB 2WACA 2L9HA 2NBFA 4JI7Q 1LTID 1O7YA 2AUJD 4RGNA 4EQOA 1DD2A 3KLRA 5FO7B 3S1QH 3WOFA 2V4DA 4O42A 5FLXE 2F0HA 5C4XB 4OO1H 4DR7L 2R93B 1PFNA 1QVCA 1LUZA 2JA9A 3KBGA 1B53A 1Y69U 1EY0A 2VQEQ 4QJFA 4JI1Q 4PV1C 3RMHA 3D4WA 3H3VC 4XXEA 4C3HH 3ND8A 1D1IA 5HGTA 4L63B 1F2LA 3IKJA 1UEAB 4A3EH 3TEHB 4YHHL 2M00A 5CV4A 3T1HQ 3MXNA 2KHJA 1MSGA 3K5OA 1PDQA 4UY8C 3T1HL 4A3IB 4YHHQ 2F03A 1JWMD 4A3EG 2AHOB 4ZKCB 5IP7H 1GM5A 5JEAJ 2RKSA 3BZKA 3C3LA 3W1GA 2E5LL 4LF8Q 1SNOA 3M85A 4J1MA 1BCPD 1ZYRC 2ZTDA 4OX9Q 3FMCA 4P71A 3HOYB 2Y0SG 3R2TA 3PUXA 2F0EA 4DR2L 1PTOF 4FO2A 1VQJA 2WKCA 3WWVA 3RN2A 5G3LF 2KECA 3T16A 4CDDC 4G57A 4JI8L 1TY0A 2F0OA 1XMQL 1HTLD 3BVZA 4DV0L 5EAYA 1CI3M 3PO2H 3SGIA 3X3MA 3KUPA 1OO9B 4C3JH 2XWJB 2Z0SA 5C4ZA 1G2SA 5IT9L 1HNWQ 4LF9Q 3HOUB 2UUCQ 1NAPA 4LUOA 2F0KA 1VQ7A 1DOKA 3TS0A 2EYPA 4QMGA 2JA5H 2A69C 3OTOL 2XIWA 1YVCA 2ENBA 1TWCH 3GD7A 3I55A 1STGA 3HOVG 2IHEA 1BO0A 2UU9L 3Q8DA 2WKDA 1TWHB 2Q2HA 2EE1A 2EYLA 2XGTA 1S72A 4X6AH 3F8TA 2ZTCA 3IFTA 1YITA 3KLSX 1C8CA 4B3TL 2XTIA 1EYGA 4YY3Q 4JBWA 1WOCA 2YYZA 1X9NA 2HT1A 4JI3L 4X64L 4HJAA 1HNZQ 2PYKA 2Z4HA 2I0QA 5GAEC 3NEMA 1AP0A 2HDMA 2K52A 2PQAA 2A6EC 1I94Q 4IPHA 4GNXC 1PZID 1TWAB 5AJ3L 4HAEA 5C44G 4APVA 3PUWA 2NTSA 1T9HA 3KLWA 4HIMA 4C3JG 2VB2X 4XQQA 3MFGA 2ZTEA 4IO9A 2JXMB 1KIXA 3MXUA 4UPAA 1FGBD 5AFWA 2VZAA 3PGZA 3K7AH 4A93H 2CHBD 3S16H 1GO3E 3TSSA 1UAPA 5CV8A 5CC4A 4ALPA 3SK5A 1S5CD 2M2LA 2VUMB 1PMRA 2K50A 1GUNA 3HOWG 4G7ZC 1JR0D 5M3MH 4B3TQ 5LMUL 1A3TA 4DUYL 1A15A 5CR3A 2JJQA 1RD9D 4S3SA 1K8AC 3U9SA 2Z4IA 4YCVA 4DV7L 3X3NA 4DUZL 3M4YA 3CXCA 3I90A 4JI0L 2VNUD 4LW1A 3DMUA 4LFAL 5IY0A 1SROA 3RZDB 4XIGS 2JA7B 1RHPA 2KEDA 2LSSA 3RLOA 1V1PA 2OEOA 2ZM6Q 2Z1CA 4IOAA 4QUFA 1L1OB 1F9SA 3CKIB 3AFPA 2N49A 5CORA 1PH1A 4WJ4A 1V1OA 1JB7A 5L37A 1HR0W 3GTLH 5FLXL 4QIWE 1DJRD 3E0EA 4RGTA 4TQUS 3HKZB 2EY2A 3CD6A 4GZYC 4OO1G 2JN4A 2ZJQA 1EZ6A 1QCBD 3IAYA 3EIVA 2NZOA 4RH6A 1DOMA 1M8AA 1SXTA 2F0GA 2NVXH 2NVQH 4GLAC 4HSPA 4L6TB 5FLXc 4LFBQ 5HURA 4BS9A 4DR6L 5I2XA 4OIKA 1STAA 2EDGA 1D5XC 4KI0A 2HHHL 2QILA 3DUZA 1HQMC 1YJWA 1KHIA 1GHKA 4IPCA 1K8GA 3SR1A 3K7UC 4LF5Q 2J7ZA 3TZDA 1TU2B 2CFMA 4A3MG 1FVIA 1G51A 3C1EA 3LWEA 4NPSA 2DN8A 2OXPA 3I56A 4WORA 5CV5A 2AWOA 2JA8G 2ZJRA 1IKLA 2EOTA 5KNCA 1PFBA 2A69D 3PSIA 2QDBA 1IBMQ 3TRZA 1PTOB 2PI2E 1S5BD 2JYOA 2B29A 1WTOA 1P8LA 1C4QA 5A35A 3TP8A 3PIO3 3U4VA 4HMIA 4OELB 2JE6I 1CKNB 1JOKA 3KJOA 1HA6A 2IJ0A 3D6WA 4CBVA 2CWAA 3BYTB 4X66L 1NMFA 2B8FA 4TVAB 1QILA 2R6GA 1RTOA 4JW0A 2BCOA 2A6HC 4AYBG 3W3AA 3ONAB 1W3SA 1LTSD 1ENCA 3FPPA 2MPMA 1SMYD 3VR3A 1PH4A 3VYRA 1H9SA 2EXDA 1LTTD 4DR1L 4R4CA 1H9JA 1X56A 3CMEA 3T1YL 3MXNB 2KA7A 4L5QA 4XQJA 4EVOA 2F0NA 2MP1A 4NMZA 4YWKA 3FDTA 5JOBA 1OXVA 3HS0C 2X6LA 4AH6A 3FKIG 3NWSA 1B9MA 5A2QE 4TRDA 3S2DH 2RCNA 1IBLL 3W1BA 3S16B 3ERQA 2HCCA 1JB3A 1SMXA 1I3QH 3L3OC 4PG3A 4BBRH 3HOVB 3K5LA 2PQEA 2D5DA 2WIIB 3GTPH 1PFMA 2KENA 4QUCA 1KNEA 3FHWA 1HTPA 3OIQA 5E4XA 4FF2A 3QOJA 3CF5A 4TKOB 1SYFA 1PRTD 2UXDQ 2NVYB 1XXGA 1A2TA 2F0VA 1ESRA 3U58A 3S1RH 1YNND 1WTQA 1VQPA 1IW7D 1JCKB 2F0SA 1SMYC 3F2BA 1X65A 4DKAC 2E2HH 2R93G 1YIJA 5IYCG 4YY3L 4JI4L 2AMCB 3RR5A 5M5XB 1DZ1A 3UDXA 3N6RA 3EBEA 2DNEA 1MJEA 1EWIA 3F2DA 2R61A 3E6ZX 3K58A 1JQYD 3NK9A 3NUCA 1X55A 4KJOA 1I4QA 2D0OA 1WI5A 1GD7A 4F88A 3AQQA 2NN6H 5LHY1 2EY1A 5IP9H 1HXYD 3CMAA 3I73A 4XDXA 5M5WH 2RQXA 3PCOB 2CWPA 1YJ9A 1XNRQ 3L0OA 4JI5Q 4HIKA 4TSSA 3OTOQ 1XPUA 2PO4A 4CGYB 1ASYA 1QVGA 3GQBA 3HOZG 3ZJYC 2LS01 4ODGA 4RHRA 3HOYH 1CZWA 3VA5A 2Q2UA 4G4KA 1FNWA 1TT2A 1BF4A 4O1NA 1CHQD 2BH2A 2CW0D 5D3DA 3MEFA 1S4ZA 2H5XA 3AYHB 2K32A 4C3IB 1EQRA 3K57A 4H44C 4RKBA 4JVZA 1Y8PB 4JI2L 5IIFA 1B7YB 3VDYA 1KDCA 1DXMA 3I4NH 5I4DA 2JA6H 2NN6I 3F2UA 1FNVA 1UNSA 3CCUA 4PMCA 3I91A 1CT1D 4WJ3M 3HOWB 4LFCL 4OGQC 5EQ0A 1STNA 4GNXA 3I2ZA 2XWBB 4HJ7A 2E75C 3NSWA 1Z47A 4DV5Q 3G7LA 4LF7L 3TP6A 1A3UA 2FMMA 2D9UA 2KCCA 2R93H 1UE1A 1GKHA 1PYSB 4RCOA 5FJ8G 5CGKA 2A8VA 4N8FA 2NVYH 3NXWA 1AW7A 4NXNQ 2YV5A 4JI2Q 1E2WA 2F1MA 3CHBD 1N9WA 1L1OC 5ELDA 4GOPA 3E0JA 3OWEB 3A54A 4ME5A 1A3VA 4R4TA 2AQ2B 1WTRA 1T5EA 5M5XH 5C6AA 3ICEA 4LF6L 1WFQA 4DR5Q 3I4MB 2O4XA 1EQQA 1CQFA 2SNSA 5HY6A 1SYEA 3QO2A 4JV5L 1DCZA 5GROA 3R3OA 3H94A 4DNIA 1QB5D 3VYUA 4AIMA 1CK1A 5EKLA 3MXGA 1F2MA 1ILPA 3BVMA 4G7OC 3UE1A 4FXGC 2MQHA 2NN6G 4ABNA 4KKTA 2YU9B 3ULPA 3PQIA 3CPWA 4GKJL 2UXBL 1O7ZA 1RJTA 5IODA 1A6XA 1P16A 4JC0A 3CCJA 5J22A 3RLNA 5EBDA 3D3RA 3T1YQ 2A73B 2IWHA 1M1KC 1TKWB 3UDGA 3H0GH 5EJWA 1V8QA 4O0AA 1J9OA 5ELCA 2PMZE 5CV9A 2K6AA 4HCSA 2XNAC 4ZK9B 3M4OB 4JOIC 2R7ZH 5FOBB 3W2DA 4K6DA 3JAMc 3UDFA 4A3BH 4IJLA 1KLGD 2F0PA 1CSPA 5IT9E 2HQLA 1QUQA 4Q0FA 1F77A 3P75A 2UXDL 4KKUA 4B3SQ 3A7AB 5KYIA 2F0IA 3A0JA 4H02A 2MJ8A 5C0XH 2JA7G 3MZ5A 2LXKA 4FXDA 1T5XD 1VQEA 1CZGA 4PZ8A 1S5FD 4DK1A 5KYLA 5CV6A 2X6GA 4HIDA 1XNQQ 1SSOA 1WTXA 4OO1I 3CQZB 2OT2A 3TP5A 1J6QA 1UEBA 1PXUA 1WCMG 1XMOQ 3D4RA 1Y1VG 2LMCB 3BDCA 4HIOA 3EVQA 2O5IC 1XPRA 3D4DA 5M5YH 2B63H 3T13A 3J81i 3HKSA 1HR0Q 3MVVA 1VMPA 4FNFA 2DNCA 2KQ3A 3JAML 2K03A 3E3XA 4RG1A 2R92B 2HHHQ 3GV3A 1XMQQ 3FRPB 3KF6A 5ELBA 5GQOA 1AZQA 2IHFA 4BY7G 1A62A 1HJPA 3RZOB 1D1KA 1AEXA 1BBWA 1H9MA 3PV0A 2PMZB 1DGSA 4CJ0B 1VMCA 3QOLA 3V96A 2K5QA 4RGMA 3TZUA 4Q5VA 5LMNW 1I4PA 1STYA 5M3FG 3SE0A 2DGYA 4DK0A 4I7AA 1U9RA 2EJMA 1UUPA 4WFN3 1ENFA 1E2ZA 2O2LD 5EGTA 3M4PA 5M3FH 2X69A 1CKMA 3TQYA 4RHSA 4PMWA 4DK6C 4KD4A 5JVG3 1KQSA 3MWYW 4KY6A 1UE5A 3RUZA 2H1EA 3OMCA 1HA5A 3S2HH 1FD7D 5M3MB 4JI5L 4A3KG 2PQAB 4M8AA 4CKBA 4BY1B 1N34Q 3I8ZA 1TWGB 3DHQA 4X3SA 2RDGA 4OWWB 5C4JB 5C3EH 4JI0Q 5K5PA 2YTYA 1NMGA 3P1HA 3J7AF 1KAWA 1BUVT 2KOLA 4LWCA 3KFUA 1GOZA 1XTDA 4J15A 3ERSX 4R4QA 3J7YW 3K6OA 1BOSA 3T53B 2F52A 5TSSA 1VQBA 4BXXG 4DUYQ 3B6YA 4K6LA 3CCMA 1QWYA 3BDOA 3PUYA 1YZ6A 4HJ8A 3SK6A 1CFMA 2F0JA 3GTJH 3RLFA 3U9OA 5IGDA 1F9PA 1K73C 2D62A 4X3UA 4PNYA 3GTQB 3HOVH 4N9PA 5I6WA 5C0XG 3GTKB 3UE0A 1K8MA 4DV4Q 1MBYA 1O78A 1A63A 4J6HA 4GKJQ 2UXBQ 1PH9A 4A76A 2QA4A 4QF4A 1MKHA 2KCNA 2N88A 5COYA 5KEEA 1PH7A 1HZAA 4OEMB 1QNKA 4ME3A 1B8AA 4P73A 2B63B 5DM73 2P5ZX 1EL0A 2EJFC 3HOUG 3HKZG 2K4KA 1EEID 1PZJD 1E3PA 4ZUIA 1EY5A 4JV5Q 4Y52H 2EIFA 3FPUB 2B2WA 3A5ZB 4KK7A 4A3JG 1QZGA 4RGOS 3TN2A 2UXCL 1Z7TA 4DR4Q 2JA5G 3D6CA 1I6HH 1TR5A 1KL9A 1SYDA 3QIAA 3R93A 4X66Q 4K8JA 3C46A 1PRTC 2K01A 2KCMA 1N34L 4CKEA 5IE8A 1NTGA 4A93G 4DV4L 4A3KH 3L9AX 1VQ9A 3HOXB 5E1FA 2UU9Q 2CH4A 1YJNA 2A68C 1XX8A 1VF7A 1SJED 4FDBA 2UUCL 4IALA 2F4IA 1KABA 4K2LA 1VQNA 4L8JA 3HZXA 1BQQT 2E2JB 1EOTA 2HUGA 4KHZA 4C3HB 1EIYB 1OXSC 1JC7A 2NB0A 3VR4A 5EKIA 2PI2A 1LTAD 3T56B 4K2KA 1ZXTA 1TQOA 1X54A 2L4NA 1U5KA 4IPDA 1ONLA 4HCEA 1A8VA 1SLJA 1I4XA 1VQKA 2JSOA 1K0SA 3HOZB 5IGEA 2KBNA 1KNAA 4A3FG 3ULJA 3KOJA 4KY5A 1C0AA 4E6IA 2A68D 5C0XI 4MN3A 1FR3A 5FLMG 1K3RA 2L15A 3CCQA 2IY5B 5LL6X 3GTQH 4LFCQ 2IX1A 4AQYL 5JAVA 2A1AA 4XYOA 1HCZA 2I46A 2SDFA 1M4VA 2RHQB 1IBKL 1VQGA 4KHVA 1JWUD 3A8JE 5A2QL 2LY7A 1CSQA 3PO2B 3QJYA 3OYYA 2JA6G 2WAQB 1EU4A 2E76C 2VQFQ 1XJVA 1AN8A 1RCVD 1UE6A 4DR2Q 4DAYB 3PF4A 3DEOA 2LFNA 4MIUA 4B3SL 1PZKD 5M5WB 3MHBA 3KF8B 3RZDH 2JQOA 3C2PA 2EYHA 5BN5A 3CPFA 1MGSA 3RNUA 3GTOH 4ZQ3A 1IYJB 1O80A 3H15A 3Q24A 4L5TA 3SXHA 1JJGA 3U50C 1BNZA 1PTOD 1XNQL 2BOSA 1DONA 3LWUA 1PYWD 5IOCA 4F7XA 2BE5C 1WTWA 2CVRA 2RHSB 3SHLA 1RDPD 4GS3A 2FINB 2B2YC 4DR3Q 1PTOC 4JI1L 1L2FA 4DUZQ 1WVLA 3KDFA 4A3KB 2PCFB 5DNFA 4EQPA 5GAHC 4HR7B 1N33Q 5T1GA 4FF4A 1I6VC 5LMUQ 2G5DA 3SEBA 1HFNA 4BBRG 3JC66
chains in the Genus database with same CATH topology
4A3BG 2VY3A 4A3GG 2H5XA 3AYHB 3GTGH 4DR4L 1D8LA 1EQRA 2IT1A 3KYHC 3NENA 1X3GA 4PZ7A 4DV0Q 2WFWA 1OTCA 3GO5A 4DV6Q 4JI2L 3DM3A 1B7YB 4DR1Q 4OX9L 3VDYA 3I4NH 2WB1E 4K0KQ 4C2MH 5IWAL 1JJ2A 2JA6H 4DR6Q 2NN6I 2BA0A 2EQSA 4X64Q 4UP9A 1ASZA 1J5EL 2ALYB 3CCVA 2I5MX 3HOUH 3CCUA 1SE8A 3S14H 1VQDA 1Y14B 4DV1Q 4GLVB 1KXLA 1VQMA 1N33L 1FL0A 4WJ3M 1EOVA 3CAMA 4QY7A 4A3CH 3HFZB 3LGJA 4UP8A 4LFCL 4P75A 3S1MH 3PO2G 1PVOA 1CUKA 3STBC 3HOZH 4GNXA 3BU2A 1FGUA 1K0RA 3I2ZA 2UUAL 3AFQA 1JE5A 4DR3L 1XPOA 2RF4A 4X65Q 1S40A 2OTLA 4HJ7A 4B3MQ 4A3CG 1Z47A 2R92G 1E24A 4HJ5A 3CP0A 5FJ8H 4DV5Q 1N32Q 1VQCA 4GOPB 4LF7L 4GKKQ 1WJJA 3STBD 1IBML 3BZCA 1Q1BA 3D0FA 4MZ9A 4QGUA 2Q2TA 3HOWH 3CCLA 3CW2C 4LF7Q 4DV5L 1PYBA 2R93H 1UE1A 1GKHA 1PYSB 1FJGL 4GLXA 5FJ8G 4NB3A 1X3FA 4OWXB 2A8VA 2Z6KC 3PO3H 4JI7Q 2NVYH 4GN3B 1YHBA 4NXNQ 2YV5A 1GVPA 4JI2Q 4EX5A 4JBMA 2MO1A 3S1QH 2CKZB 2VQEL 4LF6Q 4JG2A 1N9WA 3F1ZA 1L1OC 3L7ZC 4NXNL 4GOPA 4LF5L 2JA7H 4DR7L 1QVCA 1LUZA 2JA9A 3D31A 2B3GA 4O2DA 4R4TA 4LUZA 5IYBH 4OWTB 2DUDA 1HZCA 5M5XH 3ICEA 2VQEQ 4LF6L 1WFQA 4QJFA 4DR5Q 4JI8Q 2JK8A 4JCVE 1EQQA 3G71A 4JI1Q 5HY6A 4JV5L 5GROA 1Z9FA 4DNIA 3TS2A 4A3LH 4C3HH 3DLLA 4AIMA 1A0IA 1IBKQ 3TRZA 3UE1A 2N8NA 4A3EH 3TEHB 5JJKA 4A3IG 2MQHA 4BA1I 4YHHL 3HOXG 3T1HQ 4DK3C 2NN6G 1Q86C 2KHJA 4AQYQ 2OQ0A 3PF5A 1OXTA 1QZHA 4UY8C 1Q82C 4JI6L 3ULPA 3T1HL 1L0WA 4NXMQ 4YHHQ 3TREA 3CPWA 4GKJL 2UXBL 4A3EG 5K36G 2AHOB 3FKIH 4A3DH 5IP7H 4IOCA 1GM5A 5JEAJ 1P16A 2Z6KA 3BZKA 3HKZE 3W1GA 4JC0A 5AJ3Q 3CCJA 3RLNA 2E5LL 4LF8Q 3M85A 1PV4A 2ASBA 3T1YQ 3JC66 2R7DA 1M1KC 2GVBA 1MIUA 3UDGA 4QQBX 2ZTDA 4OX9Q 2ZJPA 1Q1EA 3H0GH 4DPGA 1VQ8A 2R7ZG 1WCMH 4IPGA 4O0AA 4P71A 2Y0SG 2PMZE 3PUXA 4GN4B 4DR2L 1VQJA 3WWVA 3S17H 5HGQA 3RN2A 4JOIC 1SRUA 2R7ZH 3H0GG 1K9MC 4DV2L 3JAMc 3UDFA 4JI8L 4IJLA 1XMQL 4A75A 4A3BH 1CSPA 5IT9c 4DV0L 5EAYA 1Q81C 2HQLA 1QUQA 3SGIA 3PO2H 4R4OA 3A74A 4A4IA 1NE3A 2UXDL 4C3JH 3CCSA 4B3SQ 2Z0SA 1PH8A 2OQKA 3A0JA 2K14A 4H02A 1Y1WG 2JA7G 5IYDG 1U0LA 1HNWQ 1WYDA 2LXKA 4LF9Q 2UUCQ 2ES2A 4LUOA 5ELOA 1VQEA 3E9IA 4WJ4A 1VQ7A 4IFDJ 4PZ8A 1TWHH 1XNRL 1XNQQ 4HIDA 1R9TH 3TS0A 4JI7L 1LM0A 4OO1I 2JA5H 1HNXL 2JEAI 3OTOL 1YVCA 1J6QA 1FJGQ 2OTJA 1UEBA 2E8GA 1YHAA 1WCMG 1TWCH 3KF6B 3GD7A 2BH8A 3I55A 1XMOQ 2F4VL 1Y1VG 4HIOA 3PO3G 1VS0A 3HOVG 2IHEA 2UU9L 4MNOA 1XPRA 1I50H 3Q8DA 3CCRA 1LTLA 5M5YH 2Q2HA 4LUVA 2B63H 2XGTA 4KLKA 3J81i 3HKSA 3CQZH 1S72A 1HR0Q 4X6AH 3F8TA 2K5NA 2MFIA 2ZTCA 4RG1A 1QUQB 3OW2A 2HHHQ 2B63G 1XMQQ 5GQOA 3KF6A 1YITA 1RL2A 1I94L 2IHFA 4A3FH 1A62A 1HJPA 4B3TL 3M4QA 3G4SA 1TWAH 2CQOA 1NBWA 2XTIA 3ULLA 4HJ9A 1BBWA 3NELA 2VW9A 1EYGA 3PV0A 4YY3Q 4JBWA 1WOCA 2YYZA 1X9NA 2HT1A 1DGSA 4P74A 4JI3L 5IP9G 4X64L 4HJAA 1HNZQ 4JBJA 3KDFB 4A3GH 3KJPA 5IWAQ 2KCTA 2I0QA 5GAEC 4R4IA 3NEMA 3CC4A 2N78A 2K52A 5LMNW 2PQAA 5M3FG 1I94Q 1VQLA 3M3YH 2DGYA 4IPHA 4C3IH 4GNXC 3J80c 2GVAA 5AJ3L 5C44G 4APVA 4BY1G 3PUWA 3KLWA 1T9HA 4NXML 4HIMA 3M4PA 5M3FH 5IP7G 5BR8L 4KHPQ 1CKMA 3TQYA 4DK6C 4PMWA 1KQSA 1JJCB 2ZTEA 4IO9A 1Y1WH 1KIXA 4DAMA 4UPAA 1UE5A 2VS1A 4DV1L 2VZAA 2FXQA 3RN5A 3NBHB 3S2HH 3PGZA 3CC2A 4LF4L 3K7AH 2A19A 1VQ6A 3S16H 1IZ6A 4JI3Q 1GO3E 4A93H 1TWFH 4JI5L 1CKNA 4A3KG 4A3JH 2PQAB 1AE2A 1N34Q 4ALPA 2YTVA 4PZ6A 1X3EA 4DV6L 1B70B 1VQHA 1EUJA 2K50A 3J81c 4LF9L 4OWWB 3J7ZC 3HOWG 3J80i 1IL2A 1UE7A 5C3EH 1E1TA 4JOIA 2YTYA 1NMGA 4JI0Q 1KAWA 5ELNA 5M3MH 4LWCA 4B3TQ 2VUMG 5LMUL 4DR7Q 3KFUA 2Q2IA 1XTDA 4J15A 4DUYL 3ERSX 4R4QA 5IYDH 1UWVA 4MTNA 1W2BA 2CCZA 2F52A 2JJQA 1K8AC 1VQBA 3GTKH 1TWGH 1VQFA 4BXXG 4DUYQ 3B6YA 4YCVA 2K75A 3CCMA 3CC7A 4DV3L 4DV7L 4DUZL 3PUYA 1YZ6A 3I4NG 1HR0L 3CXCA 4HJ8A 4JI0L 5C4JH 3GTJH 2ATWA 3GDEA 3RLFA 3H3VI 4LFBL 1K73C 2WAQE 4LW1A 2VNUD 4LFAL 2MNAA 3AEVA 2D62A 5IY0A 1SROA 4JYAL 1VQ5A 4XIGS 3S1NH 4YWLA 1N36Q 1Y1VH 4AYBE 4L5SA 3HOVH 2LSSA 2OWOA 4GKKL 1PA6A 3RLOA 5C0XG 1JMCA 1V43A 2PNHA 3UE0A 4EQ5A 2AKWB 1E1OA 2ZM6Q 4IOAA 4DV4Q 5JEAG 1OXUA 1L1OB 4X65L 2UUAQ 1V1QA 3AFPA 1Q46A 2N49A 1KD1C 1BBUA 4JBKA 4GKJQ 2UXBQ 3U4ZA 2BA1A 1PH1A 4A76A 2HIVA 1VQOA 1PH9A 2QA4A 1JB7A 3I4MG 1HR0W 5C44H 1MKHA 3GTLH 2WAQG 1BKBA 1HZAA 3L2PA 1PH7A 3I4OA 4QIWE 3E0EA 5J3BA 4TQUS 1VQ4A 3CD6A 1H95A 4OO1G 4ME3A 2ZJQA 1IXRA 1B8AA 4P73A 4POGA 3EIVA 2NZOA 2NVQH 3HOUG 3HKZG 2K4KA 2NVXH 2UXCQ 4GNXB 2UUBL 1VCIA 4GLAC 1HNZL 1E3PA 1YEZA 5FLXc 2YU9H 4LFBQ 1X6OA 2K5VA 4OXPA 4DR6L 4JV5Q 4Y52H 2EIFA 4K0KL 5H1SE 2LXJA 3A5ZB 1E7ZA 4A3JG 1S3OA 1QZGA 4R1JA 4KI0A 3EN2A 3H3VH 2HHHL 4YWMA 2UXCL 2C35B 2UUBQ 4DR4Q 2JA5G 1D7QA 1YJWA 1KHIA 1I6HH 4IPCA 2V1CC 1KL9A 1K8GA 3K7UC 3HOXH 4LF5Q 4JI6Q 2QGQA 5IYBG 1PHJA 2CFMA 4Y7NH 4A3MG 1FVIA 1G51A 2AWNA 5BR8Q 3PIOA 4KHPL 3K0XA 4NPSA 4X66Q 3M4OH 3M9BA 5JJIA 5JJLA 2KCMA 1N34L 3I56A 1SN8A 2JEBI 4GN5A 5IE8A 2AWOA 2JA8G 2ZJRA 1NTGA 4A93G 2E2JH 3PUVA 4DV4L 4A3KH 2ZM6L 1VQ9A 5LMNQ 5C4XH 4OONA 2UU9Q 3PSIA 3J81j 1EIFA 4DV3Q 3E9HA 2PI2E 3K8AA 2R7FA 5IYCH 2QEXA 1YJNA 1N36L 2B29A 1QVFA 5LMNL 1AH9A 4FDBA 1P8LA 2UUCL 4LFAQ 3U4VA 1VQNA 2JE6I 1PH2A 4P72A 1CKNB 3KJOA 4BBSH 4DR5L 4DV7Q 2CWAA 3ER0A 1SFOH 4X66L 1NMFA 3PIPA 4KHZA 3HOYG 1PH3A 4TVAB 3PUZA 2R6GA 1EIYB 4DV2Q 1YI2A 1VQAA 2Y0SE 1OXSC 1OXXK 1I5FA 3BJUA 4AYBG 4B3RQ 4X62L 4BBSG 1N8RC 2PI2A 2N3SA 2E2IH 1AE3A 4JI4Q 1NY4A 1MJCA 2IX0A 1W3SA 3K81C 4XTCS 2ID0A 1X54A 4A3IH 1U5KA 4IPDA 1PH4A 3CCEA 1A8VA 2VQFL 1SLJA 2EXDA 1VQKA 1PFSA 4DR1L 3JAMi 1L1OA 4R4CA 4GOPC 1X56A 2KBNA 3CMEA 3T1YL 3MXNB 4L5QA 4A3FG 4BY7H 4IFDG 3ULJA 3KOJA 1C0AA 1JT8A 4YWKA 2R92H 1KRTA 1OXVA 2E5LQ 4B3ML 4AH6A 4LF8L 4BXXH 5C0XI 2WP8J 3FKIG 4YCWA 2I5HA 5FLMG 1K3RA 2L15A 2OCEA 3CCQA 4X62Q 3I4MH 4BY7G 2IY5B 1G6PA 2WB1G 3S2DH 1YNXA 2RCNA 1IBLL 3W1BA 4LFCQ 3GTQH 2IX1A 4AQYL 1SMXA 1I3QH 4PG3A 1Q8KA 4BBRH 3GTMH 2A1AA 3G48A 1IBLQ 3GTPH 2KENA 2GN5A 3FHWA 1HZBA 4POFA 1V9PA 2I5LX 2RHQB 3CF5A 1IBKL 1VQGA 2UXDQ 1C9OA 1CSQA 3U58A 2F3IA 3OYYA 5GADC 1C7YA 1VQIA 3S1RH 1HNXQ 1M90C 1VQPA 2JA6G 2VQFQ 1LYLA 3F2BA 1XJVA 1X65A 1K83H 4DKAC 1J5EQ 5C4XG 1KC8C 1BVSA 2NZHA 1UE6A 4DR2Q 2E2HH 2R93G 3IRBA 5DLQE 5IYCG 4YY3L 1YIJA 2D0PA 1HNWL 4DAYB 1PH5A 4JI4L 4A3DG 2AMCB 3RR5A 3PF4A 3UDXA 4B3RL 1O7IA 4IJHA 3EBEA 1MJEA 1PH6A 1EWIA 3F2DA 1EFWA 4BA2I 4B3SL 2KHIA 5FLMH 5E7NA 3W5OA 1HZ9A 4A3MH 3KF8B 3RZDH 1G291 3J7A5 2JQOA 3CPFA 1X55A 3A5UA 4BY1H 2YTXA 1YHQA 3RNUA 2D0OA 3GTOH 1IYJB 1WI5A 3H15A 1RIPA 2F4VQ 4L5TA 5C3EG 1GD7A 2MO0A 3AQQA 5C0XJ 1JJGA 2VUMH 5IP9H 3U50C 3CMAA 3F2CA 4L5RC 2K5HA 4RMFA 1IBMQ 5M5WH 1XNQL 1A63A 3PCOB 2CWPA 3G6EA 1YJ9A 3L0OA 1XNRQ 1XMOL 1SR3A 4JYAQ 1Q12A 4A3LG 4JI5Q 4HIKA 3OTOQ 2VL6A 1Q7YC 1XPUA 3S15H 2RHSB 1NJIC 4DR3Q 4GS3A 4LF4Q 3RZOH 3M7NA 4JI1L 1L2FA 4DUZQ 1HH2P 1ASYA 4QL5A 1QVGA 3FP9A 3I7FA 3KDFA 4LNQA 3HOZG 3ZJYC 1N32L 2JA8H 4IFDI 2HIXA 1YBYA 3UDIA 4UP7A 3HOYH 5GAHC 2Q2UA 2NVTH 1N33Q 1KRSA 3K80C 5GAGC 1CKOA 1TXYA 4YCUA 5LMUQ 2BH2A 5M3MG 3MEFA 4BBRG 1E22A 3S24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B G;  2VY3 A;  4A3G G;  2H5X A;  3AYH B;  3GTG H;  4DR4 L;  1D8L A;  1EQR A;  2IT1 A;  3KYH C;  3NEN A;  1X3G A;  4PZ7 A;  4DV0 Q;  2WFW A;  1OTC A;  3GO5 A;  4DV6 Q;  4JI2 L;  3DM3 A;  1B7Y B;  4DR1 Q;  4OX9 L;  3VDY A;  3I4N H;  2WB1 E;  4K0K Q;  4C2M H;  5IWA L;  1JJ2 A;  2JA6 H;  4DR6 Q;  2NN6 I;  2BA0 A;  2EQS A;  4X64 Q;  4UP9 A;  1ASZ A;  1J5E L;  2ALY B;  3CCV A;  2I5M X;  3HOU H;  3CCU A;  1SE8 A;  3S14 H;  1VQD A;  1Y14 B;  4DV1 Q;  4GLV B;  1KXL A;  1VQM A;  1N33 L;  1FL0 A;  4WJ3 M;  1EOV A;  3CAM A;  4QY7 A;  4A3C H;  3HFZ B;  3LGJ A;  4UP8 A;  4LFC L;  4P75 A;  3S1M H;  3PO2 G;  1PVO A;  1CUK A;  3STB C;  3HOZ H;  4GNX A;  3BU2 A;  1FGU A;  1K0R A;  3I2Z A;  2UUA L;  3AFQ A;  1JE5 A;  4DR3 L;  1XPO A;  2RF4 A;  4X65 Q;  1S40 A;  2OTL A;  4HJ7 A;  4B3M Q;  4A3C G;  1Z47 A;  2R92 G;  1E24 A;  4HJ5 A;  3CP0 A;  5FJ8 H;  4DV5 Q;  1N32 Q;  1VQC A;  4GOP B;  4LF7 L;  4GKK Q;  1WJJ A;  3STB D;  1IBM L;  3BZC A;  1Q1B A;  3D0F A;  4MZ9 A;  4QGU A;  2Q2T A;  3HOW H;  3CCL A;  3CW2 C;  4LF7 Q;  4DV5 L;  1PYB A;  2R93 H;  1UE1 A;  1GKH A;  1PYS B;  1FJG L;  4GLX A;  5FJ8 G;  4NB3 A;  1X3F A;  4OWX B;  2A8V A;  2Z6K C;  3PO3 H;  4JI7 Q;  2NVY H;  4GN3 B;  1YHB A;  4NXN Q;  2YV5 A;  1GVP A;  4JI2 Q;  4EX5 A;  4JBM A;  2MO1 A;  3S1Q H;  2CKZ B;  2VQE L;  4LF6 Q;  4JG2 A;  1N9W A;  3F1Z A;  1L1O C;  3L7Z C;  4NXN L;  4GOP A;  4LF5 L;  2JA7 H;  4DR7 L;  1QVC A;  1LUZ A;  2JA9 A;  3D31 A;  2B3G A;  4O2D A;  4R4T A;  4LUZ A;  5IYB H;  4OWT B;  2DUD A;  1HZC A;  5M5X H;  3ICE A;  2VQE Q;  4LF6 L;  1WFQ A;  4QJF A;  4DR5 Q;  4JI8 Q;  2JK8 A;  4JCV E;  1EQQ A;  3G71 A;  4JI1 Q;  5HY6 A;  4JV5 L;  5GRO A;  1Z9F A;  4DNI A;  3TS2 A;  4A3L H;  4C3H H;  3DLL A;  4AIM A;  1A0I A;  1IBK Q;  3TRZ A;  3UE1 A;  2N8N A;  4A3E H;  3TEH B;  5JJK A;  4A3I G;  2MQH A;  4BA1 I;  4YHH L;  3HOX G;  3T1H Q;  4DK3 C;  2NN6 G;  1Q86 C;  2KHJ A;  4AQY Q;  2OQ0 A;  3PF5 A;  1OXT A;  1QZH A;  4UY8 C;  1Q82 C;  4JI6 L;  3ULP A;  3T1H L;  1L0W A;  4NXM Q;  4YHH Q;  3TRE A;  3CPW A;  4GKJ L;  2UXB L;  4A3E G;  5K36 G;  2AHO B;  3FKI H;  4A3D H;  5IP7 H;  4IOC A;  1GM5 A;  5JEA J;  1P16 A;  2Z6K A;  3BZK A;  3HKZ E;  3W1G A;  4JC0 A;  5AJ3 Q;  3CCJ A;  3RLN A;  2E5L L;  4LF8 Q;  3M85 A;  1PV4 A;  2ASB A;  3T1Y Q;  3JC6 6;  2R7D A;  1M1K C;  2GVB A;  1MIU A;  3UDG A;  4QQB X;  2ZTD A;  4OX9 Q;  2ZJP A;  1Q1E A;  3H0G H;  4DPG A;  1VQ8 A;  2R7Z G;  1WCM H;  4IPG A;  4O0A A;  4P71 A;  2Y0S G;  2PMZ E;  3PUX A;  4GN4 B;  4DR2 L;  1VQJ A;  3WWV A;  3S17 H;  5HGQ A;  3RN2 A;  4JOI C;  1SRU A;  2R7Z H;  3H0G G;  1K9M C;  4DV2 L;  3JAM c;  3UDF A;  4JI8 L;  4IJL A;  1XMQ L;  4A75 A;  4A3B H;  1CSP A;  5IT9 c;  4DV0 L;  5EAY A;  1Q81 C;  2HQL A;  1QUQ A;  3SGI A;  3PO2 H;  4R4O A;  3A74 A;  4A4I A;  1NE3 A;  2UXD L;  4C3J H;  3CCS A;  4B3S Q;  2Z0S A;  1PH8 A;  2OQK A;  3A0J A;  2K14 A;  4H02 A;  1Y1W G;  2JA7 G;  5IYD G;  1U0L A;  1HNW Q;  1WYD A;  2LXK A;  4LF9 Q;  2UUC Q;  2ES2 A;  4LUO A;  5ELO A;  1VQE A;  3E9I A;  4WJ4 A;  1VQ7 A;  4IFD J;  4PZ8 A;  1TWH H;  1XNR L;  1XNQ Q;  4HID A;  1R9T H;  3TS0 A;  4JI7 L;  1LM0 A;  4OO1 I;  2JA5 H;  1HNX L;  2JEA I;  3OTO L;  1YVC A;  1J6Q A;  1FJG Q;  2OTJ A;  1UEB A;  2E8G A;  1YHA A;  1WCM G;  1TWC H;  3KF6 B;  3GD7 A;  2BH8 A;  3I55 A;  1XMO Q;  2F4V L;  1Y1V G;  4HIO A;  3PO3 G;  1VS0 A;  3HOV G;  2IHE A;  2UU9 L;  4MNO A;  1XPR A;  1I50 H;  3Q8D A;  3CCR A;  1LTL A;  5M5Y H;  2Q2H A;  4LUV A;  2B63 H;  2XGT A;  4KLK A;  3J81 i;  3HKS A;  3CQZ H;  1S72 A;  1HR0 Q;  4X6A H;  3F8T A;  2K5N A;  2MFI A;  2ZTC A;  4RG1 A;  1QUQ B;  3OW2 A;  2HHH Q;  2B63 G;  1XMQ Q;  5GQO A;  3KF6 A;  1YIT A;  1RL2 A;  1I94 L;  2IHF A;  4A3F H;  1A62 A;  1HJP A;  4B3T L;  3M4Q A;  3G4S A;  1TWA H;  2CQO A;  1NBW A;  2XTI A;  3ULL A;  4HJ9 A;  1BBW A;  3NEL A;  2VW9 A;  1EYG A;  3PV0 A;  4YY3 Q;  4JBW A;  1WOC A;  2YYZ A;  1X9N A;  2HT1 A;  1DGS A;  4P74 A;  4JI3 L;  5IP9 G;  4X64 L;  4HJA A;  1HNZ Q;  4JBJ A;  3KDF B;  4A3G H;  3KJP A;  5IWA Q;  2KCT A;  2I0Q A;  5GAE C;  4R4I A;  3NEM A;  3CC4 A;  2N78 A;  2K52 A;  5LMN W;  2PQA A;  5M3F G;  1I94 Q;  1VQL A;  3M3Y H;  2DGY A;  4IPH A;  4C3I H;  4GNX C;  3J80 c;  2GVA A;  5AJ3 L;  5C44 G;  4APV A;  4BY1 G;  3PUW A;  3KLW A;  1T9H A;  4NXM L;  4HIM A;  3M4P A;  5M3F H;  5IP7 G;  5BR8 L;  4KHP Q;  1CKM A;  3TQY A;  4DK6 C;  4PMW A;  1KQS A;  1JJC B;  2ZTE A;  4IO9 A;  1Y1W H;  1KIX A;  4DAM A;  4UPA A;  1UE5 A;  2VS1 A;  4DV1 L;  2VZA A;  2FXQ A;  3RN5 A;  3NBH B;  3S2H H;  3PGZ A;  3CC2 A;  4LF4 L;  3K7A H;  2A19 A;  1VQ6 A;  3S16 H;  1IZ6 A;  4JI3 Q;  1GO3 E;  4A93 H;  1TWF H;  4JI5 L;  1CKN A;  4A3K G;  4A3J H;  2PQA B;  1AE2 A;  1N34 Q;  4ALP A;  2YTV A;  4PZ6 A;  1X3E A;  4DV6 L;  1B70 B;  1VQH A;  1EUJ A;  2K50 A;  3J81 c;  4LF9 L;  4OWW B;  3J7Z C;  3HOW G;  3J80 i;  1IL2 A;  1UE7 A;  5C3E H;  1E1T A;  4JOI A;  2YTY A;  1NMG A;  4JI0 Q;  1KAW A;  5ELN A;  5M3M H;  4LWC A;  4B3T Q;  2VUM G;  5LMU L;  4DR7 Q;  3KFU A;  2Q2I A;  1XTD A;  4J15 A;  4DUY L;  3ERS X;  4R4Q A;  5IYD H;  1UWV A;  4MTN A;  1W2B A;  2CCZ A;  2F52 A;  2JJQ A;  1K8A C;  1VQB A;  3GTK H;  1TWG H;  1VQF A;  4BXX G;  4DUY Q;  3B6Y A;  4YCV A;  2K75 A;  3CCM A;  3CC7 A;  4DV3 L;  4DV7 L;  4DUZ L;  3PUY A;  1YZ6 A;  3I4N G;  1HR0 L;  3CXC A;  4HJ8 A;  4JI0 L;  5C4J H;  3GTJ H;  2ATW A;  3GDE A;  3RLF A;  3H3V I;  4LFB L;  1K73 C;  2WAQ E;  4LW1 A;  2VNU D;  4LFA L;  2MNA A;  3AEV A;  2D62 A;  5IY0 A;  1SRO A;  4JYA L;  1VQ5 A;  4XIG S;  3S1N H;  4YWL A;  1N36 Q;  1Y1V H;  4AYB E;  4L5S A;  3HOV H;  2LSS A;  2OWO A;  4GKK L;  1PA6 A;  3RLO A;  5C0X G;  1JMC A;  1V43 A;  2PNH A;  3UE0 A;  4EQ5 A;  2AKW B;  1E1O A;  2ZM6 Q;  4IOA A;  4DV4 Q;  5JEA G;  1OXU A;  1L1O B;  4X65 L;  2UUA Q;  1V1Q A;  3AFP A;  1Q46 A;  2N49 A;  1KD1 C;  1BBU A;  4JBK A;  4GKJ Q;  2UXB Q;  3U4Z A;  2BA1 A;  1PH1 A;  4A76 A;  2HIV A;  1VQO A;  1PH9 A;  2QA4 A;  1JB7 A;  3I4M G;  1HR0 W;  5C44 H;  1MKH A;  3GTL H;  2WAQ G;  1BKB A;  1HZA A;  3L2P A;  1PH7 A;  3I4O A;  4QIW E;  3E0E A;  5J3B A;  4TQU S;  1VQ4 A;  3CD6 A;  1H95 A;  4OO1 G;  4ME3 A;  2ZJQ A;  1IXR A;  1B8A A;  4P73 A;  4POG A;  3EIV A;  2NZO A;  2NVQ H;  3HOU G;  3HKZ G;  2K4K A;  2NVX H;  2UXC Q;  4GNX B;  2UUB L;  1VCI A;  4GLA C;  1HNZ L;  1E3P A;  1YEZ A;  5FLX c;  2YU9 H;  4LFB Q;  1X6O A;  2K5V A;  4OXP A;  4DR6 L;  4JV5 Q;  4Y52 H;  2EIF A;  4K0K L;  5H1S E;  2LXJ A;  3A5Z B;  1E7Z A;  4A3J G;  1S3O A;  1QZG A;  4R1J A;  4KI0 A;  3EN2 A;  3H3V H;  2HHH L;  4YWM A;  2UXC L;  2C35 B;  2UUB Q;  4DR4 Q;  2JA5 G;  1D7Q A;  1YJW A;  1KHI A;  1I6H H;  4IPC A;  2V1C C;  1KL9 A;  1K8G A;  3K7U C;  3HOX H;  4LF5 Q;  4JI6 Q;  2QGQ A;  5IYB G;  1PHJ A;  2CFM A;  4Y7N H;  4A3M G;  1FVI A;  1G51 A;  2AWN A;  5BR8 Q;  3PIO A;  4KHP L;  3K0X A;  4NPS A;  4X66 Q;  3M4O H;  3M9B A;  5JJI A;  5JJL A;  2KCM A;  1N34 L;  3I56 A;  1SN8 A;  2JEB I;  4GN5 A;  5IE8 A;  2AWO A;  2JA8 G;  2ZJR A;  1NTG A;  4A93 G;  2E2J H;  3PUV A;  4DV4 L;  4A3K H;  2ZM6 L;  1VQ9 A;  5LMN Q;  5C4X H;  4OON A;  2UU9 Q;  3PSI A;  3J81 j;  1EIF A;  4DV3 Q;  3E9H A;  2PI2 E;  3K8A A;  2R7F A;  5IYC H;  2QEX A;  1YJN A;  1N36 L;  2B29 A;  1QVF A;  5LMN L;  1AH9 A;  4FDB A;  1P8L A;  2UUC L;  4LFA Q;  3U4V A;  1VQN A;  2JE6 I;  1PH2 A;  4P72 A;  1CKN B;  3KJO A;  4BBS H;  4DR5 L;  4DV7 Q;  2CWA A;  3ER0 A;  1SFO H;  4X66 L;  1NMF A;  3PIP A;  4KHZ A;  3HOY G;  1PH3 A;  4TVA B;  3PUZ A;  2R6G A;  1EIY B;  4DV2 Q;  1YI2 A;  1VQA A;  2Y0S E;  1OXS C;  1OXX K;  1I5F A;  3BJU A;  4AYB G;  4B3R Q;  4X62 L;  4BBS G;  1N8R C;  2PI2 A;  2N3S A;  2E2I H;  1AE3 A;  4JI4 Q;  1NY4 A;  1MJC A;  2IX0 A;  1W3S A;  3K81 C;  4XTC S;  2ID0 A;  1X54 A;  4A3I H;  1U5K A;  4IPD A;  1PH4 A;  3CCE A;  1A8V A;  2VQF L;  1SLJ A;  2EXD A;  1VQK A;  1PFS A;  4DR1 L;  3JAM i;  1L1O A;  4R4C A;  4GOP C;  1X56 A;  2KBN A;  3CME A;  3T1Y L;  3MXN B;  4L5Q A;  4A3F G;  4BY7 H;  4IFD G;  3ULJ A;  3KOJ A;  1C0A A;  1JT8 A;  4YWK A;  2R92 H;  1KRT A;  1OXV A;  2E5L Q;  4B3M L;  4AH6 A;  4LF8 L;  4BXX H;  5C0X I;  2WP8 J;  3FKI G;  4YCW A;  2I5H A;  5FLM G;  1K3R A;  2L15 A;  2OCE A;  3CCQ A;  4X62 Q;  3I4M H;  4BY7 G;  2IY5 B;  1G6P A;  2WB1 G;  3S2D H;  1YNX A;  2RCN A;  1IBL L;  3W1B A;  4LFC Q;  3GTQ H;  2IX1 A;  4AQY L;  1SMX A;  1I3Q H;  4PG3 A;  1Q8K A;  4BBR H;  3GTM H;  2A1A A;  3G48 A;  1IBL Q;  3GTP H;  2KEN A;  2GN5 A;  3FHW A;  1HZB A;  4POF A;  1V9P A;  2I5L X;  2RHQ B;  3CF5 A;  1IBK L;  1VQG A;  2UXD Q;  1C9O A;  1CSQ A;  3U58 A;  2F3I A;  3OYY A;  5GAD C;  1C7Y A;  1VQI A;  3S1R H;  1HNX Q;  1M90 C;  1VQP A;  2JA6 G;  2VQF Q;  1LYL A;  3F2B A;  1XJV A;  1X65 A;  1K83 H;  4DKA C;  1J5E Q;  5C4X G;  1KC8 C;  1BVS A;  2NZH A;  1UE6 A;  4DR2 Q;  2E2H H;  2R93 G;  3IRB A;  5DLQ E;  5IYC G;  4YY3 L;  1YIJ A;  2D0P A;  1HNW L;  4DAY B;  1PH5 A;  4JI4 L;  4A3D G;  2AMC B;  3RR5 A;  3PF4 A;  3UDX A;  4B3R L;  1O7I A;  4IJH A;  3EBE A;  1MJE A;  1PH6 A;  1EWI A;  3F2D A;  1EFW A;  4BA2 I;  4B3S L;  2KHI A;  5FLM H;  5E7N A;  3W5O A;  1HZ9 A;  4A3M H;  3KF8 B;  3RZD H;  1G29 1;  3J7A 5;  2JQO A;  3CPF A;  1X55 A;  3A5U A;  4BY1 H;  2YTX A;  1YHQ A;  3RNU A;  2D0O A;  3GTO H;  1IYJ B;  1WI5 A;  3H15 A;  1RIP A;  2F4V Q;  4L5T A;  5C3E G;  1GD7 A;  2MO0 A;  3AQQ A;  5C0X J;  1JJG A;  2VUM H;  5IP9 H;  3U50 C;  3CMA A;  3F2C A;  4L5R C;  2K5H A;  4RMF A;  1IBM Q;  5M5W H;  1XNQ L;  1A63 A;  3PCO B;  2CWP A;  3G6E A;  1YJ9 A;  3L0O A;  1XNR Q;  1XMO L;  1SR3 A;  4JYA Q;  1Q12 A;  4A3L G;  4JI5 Q;  4HIK A;  3OTO Q;  2VL6 A;  1Q7Y C;  1XPU A;  3S15 H;  2RHS B;  1NJI C;  4DR3 Q;  4GS3 A;  4LF4 Q;  3RZO H;  3M7N A;  4JI1 L;  1L2F A;  4DUZ Q;  1HH2 P;  1ASY A;  4QL5 A;  1QVG A;  3FP9 A;  3I7F A;  3KDF A;  4LNQ A;  3HOZ G;  3ZJY C;  1N32 L;  2JA8 H;  4IFD I;  2HIX A;  1YBY A;  3UDI A;  4UP7 A;  3HOY H;  5GAH C;  2Q2U A;  2NVT H;  1N33 Q;  1KRS A;  3K80 C;  5GAG C;  1CKO A;  1TXY A;  4YCU A;  5LMU Q;  2BH2 A;  5M3M G;  3MEF A;  4BBR G;  1E22 A;  3S24 A; 
#chains in the Genus database with same CATH topology
 1XTC D;  4X3K A;  1X32 A;  2IL8 A;  1II3 A;  4DR4 L;  2IT1 A;  3KYH C;  1X3G A;  1ENA A;  4PZ7 A;  3GO5 A;  1ESF A;  4DR1 Q;  3MFY A;  2LKV A;  2QDL A;  2EQS A;  4H13 C;  4X64 Q;  2PW7 A;  2F3W A;  1J5E L;  5I9O A;  3KF8 A;  1SE8 A;  1D5Z C;  1Y14 B;  1LT3 D;  1HRJ A;  3BVG A;  3K7A B;  3LGJ A;  1CUK A;  4DNT B;  3HOZ H;  1HUN A;  2WIN B;  2OF1 A;  1B9N A;  3BU2 A;  1FGU A;  1K0R A;  3AFQ A;  1GUT A;  1I4R A;  2RF4 A;  4X65 Q;  2OTL A;  4A3C G;  2R92 G;  5FJ8 H;  5EPJ A;  1JOR A;  3S1Q B;  1S5D D;  1QOH A;  3T4A C;  3KLS A;  1SND A;  2M9V A;  1IBM L;  3D0F A;  3S1M B;  4LF7 Q;  3CW2 C;  1VDZ A;  4DV5 L;  3TP7 A;  2EYM A;  1X3F A;  2Z6K C;  4GN3 B;  1YHB A;  3Q6S A;  3J80 E;  1ICF B;  1GVP A;  4JBM A;  1MHW C;  2MO1 A;  1STE A;  2CKZ B;  4LF6 Q;  4DA2 A;  4EQN A;  3M7G A;  4JG2 A;  3F1Z A;  5C5L A;  1Y1V B;  3L7Z C;  1TY2 A;  4NXN L;  4C56 C;  4A3J B;  4BWG B;  4LF5 L;  4O2D A;  3D31 A;  1I4G A;  2B3G A;  2TMP A;  5IYB H;  2A6H D;  4OWT B;  1ML0 D;  1HZC A;  2DUD A;  5LL6 S;  3NE5 B;  1NUC A;  4JI8 Q;  4DFA A;  4JCV E;  3SVM A;  5T1I A;  3VR5 A;  3WDN A;  5JEA H;  3KK7 A;  1Z9F A;  4CJ1 B;  3TS2 A;  4A3L H;  1I3Q B;  5IGF A;  3DLL A;  4U68 A;  4N8X 1;  3GTO B;  3N52 A;  1A0I A;  1IBK Q;  2K5W A;  3Q22 A;  5J39 A;  5K36 H;  2RSN A;  3VR2 A;  4HMJ A;  4AQY Q;  4EGV A;  3S1N B;  3DWA A;  5K36 G;  1Q8I A;  3FKI H;  4IOC A;  2GA4 B;  2R7Z B;  2Z6K A;  3HKZ E;  3CU7 A;  2R7D A;  3S9W A;  1MIU A;  1Q1E A;  1LLR D;  4IPG A;  5FK9 C;  5IGG A;  3GTM B;  2F0D A;  5HGQ A;  3S17 H;  3K5M A;  1SRU A;  2EXZ A;  2QCP X;  3H0G G;  4C3H G;  1K9M C;  4CHT B;  4DV2 L;  4IZ8 A;  1Q81 C;  1EQV A;  3A74 A;  4A4I A;  1NE3 A;  5DM6 3;  1F2Z A;  1H9R A;  2L0C A;  2K14 A;  4ZUJ A;  1Y1W G;  1U0L A;  1MSH A;  1BCP C;  2O5J C;  3E9I A;  2ZT9 C;  1TWH H;  1XNR L;  4JI7 L;  2CQA A;  2JEA I;  4HSV A;  1SJH D;  5I9P A;  1F2Y A;  2E8G A;  3AU7 A;  3KF6 B;  4K8I A;  1F9R A;  4MNO A;  1I50 H;  1LTL A;  4LUV A;  4HED A;  4KLK A;  4K14 A;  1DOL A;  1EWH A;  2JA5 B;  2RVL A;  3I4N B;  3OMG A;  3HG9 A;  4PQX A;  4K5X A;  5ELE A;  2KVM A;  2MFI A;  2I07 B;  1QUQ B;  3OW2 A;  4KJN A;  3HEJ A;  2D2C C;  1RL2 A;  1I94 L;  4A3F H;  3M4Q A;  1TWA H;  1L0Y B;  2XVS A;  3S2D B;  3NEL A;  4ZCK A;  2HQE A;  4I65 A;  5IP9 G;  3KDF B;  3QR8 A;  2KCT A;  3CC4 A;  1HQR D;  4R4I A;  2N78 A;  3OHX C;  3M3Y H;  4C3I H;  3J80 c;  2GVA A;  2IPK D;  2NYZ D;  2RA4 A;  5I2Y A;  4CDF C;  4A93 B;  3NQI A;  4JPB W;  1QNU A;  4IUN A;  4NXM L;  1J8I A;  4C3I G;  1SNC A;  2N55 A;  4CKC A;  2IW3 A;  1JE4 A;  1KDB A;  1Y1W H;  3NBI A;  1FNU A;  4K5V A;  4XT1 B;  2FXQ A;  3NBH B;  3OW7 A;  5G3L D;  3CC2 A;  4LF4 L;  1QJO A;  4OL7 A;  4R9W A;  2A19 A;  1VQ6 A;  3DWP A;  1IZ6 A;  4JI3 Q;  2Z8L A;  1B1Z A;  2A6E D;  5JVH 3;  4PZ6 A;  4DV6 L;  3J81 c;  4LF9 L;  3J7Z C;  3J80 i;  1IL2 A;  1E1T A;  3BYY B;  4JOI A;  5ELN A;  1G6Z A;  3R8B A;  1IYU A;  2Q2I A;  3V2T A;  1TS5 A;  2L55 A;  1GJX A;  3H6M A;  1W2B A;  2RDF A;  1SBB B;  3A8I E;  1VQF A;  2K75 A;  3CC7 A;  3D8G A;  5J1Z A;  2PNR C;  4OIJ A;  4LFB L;  3H3V I;  2MNA A;  2F3V A;  3T51 B;  4IQZ A;  1MI2 A;  3S1N H;  4YWL A;  1N36 Q;  1QE6 A;  3AMU A;  4AYB E;  2AUK A;  3FKI B;  1PA6 A;  4GKK L;  5NUC A;  2FHT A;  1V43 A;  2PNH A;  4EQ5 A;  2AKW B;  5JEA G;  1R9T B;  2NTT A;  1V1Q A;  2UUA Q;  1KD1 C;  1KAA A;  1BBU A;  3U4Z A;  2BA1 A;  5E3F A;  1BDO A;  5JPN C;  5C44 H;  4IUQ A;  3QB3 A;  4IUV A;  3L2P A;  2QF7 A;  2EYF A;  1RF2 D;  5J3B A;  4U67 3;  1ZEQ X;  4IUP A;  1NCV A;  1QG7 A;  4POG A;  4M1U B;  4MHE A;  2NWG A;  1I6H B;  4LJZ C;  3OPO A;  4GNX B;  1VCI A;  1YNJ C;  2H4O A;  4OXP A;  5JPM C;  5H1S E;  3HP3 A;  1DYQ A;  3DXJ C;  1ICW A;  1L0X B;  4R1J A;  1TS2 A;  3EN2 A;  3H3V H;  1WD1 A;  1B50 A;  3J81 E;  2C35 B;  2PW5 A;  1D7Q A;  1DM0 B;  2NVX B;  3UI2 A;  1EZ8 A;  5CBA E;  1BBX C;  3SK8 A;  5IYB G;  3URY A;  1PHJ A;  1EWC A;  2AWN A;  5BR8 Q;  3PIO A;  4KHP L;  3K0X A;  3GV6 A;  1WTV A;  5JJI A;  2B2Y A;  3OOC A;  1I50 B;  2ZXR A;  2JEB I;  1GUS A;  4HN7 A;  3OIP A;  3PUV A;  2RDH A;  1V1P B;  3RD4 A;  2ZM6 L;  4KKS A;  1U4P A;  5C4X H;  1EIF A;  3E9H A;  4RAU C;  3K8A A;  5BN3 A;  5IYC H;  4Y7N B;  2QEX A;  1N36 L;  1B3Q A;  5LMN L;  4V19 0;  3BZD B;  1AH9 A;  1Y1W B;  2JP1 A;  2B2U C;  3AB9 A;  3K59 A;  1LO5 D;  1CTM A;  2Z9H A;  4LFA Q;  4ILW A;  2F0F A;  1LT5 D;  4C1N K;  3C1F A;  4OHJ A;  4DV7 Q;  2C9O A;  1TWF B;  3PIP A;  3VR6 A;  4V0B A;  1LTR D;  3PUZ A;  2NZ1 D;  4B08 A;  1YI2 A;  2Y0S E;  1I5F A;  3BJU A;  2Y0S B;  4B3R Q;  3PIP 3;  1N8R C;  5DEH A;  1H9S B;  4JI4 Q;  2SNM A;  1NY4 A;  1MJC A;  3P20 A;  3J81 L;  4BBS B;  2ID0 A;  4A3I H;  1WD0 A;  2R3Z A;  2HCI A;  4BBR B;  3JAM i;  1KTK A;  4KN7 C;  2CH4 W;  4BY7 H;  1IW7 C;  2R92 H;  1KRT A;  1KLU D;  2KHS A;  4YCW A;  2I5H A;  2E2I B;  2OCE A;  2ICE C;  1G6P A;  2WB1 G;  3I72 A;  5EPK A;  1SYB A;  1FYC A;  3BS1 A;  1Q8K A;  1IBL Q;  1G8Z D;  2C5C A;  2EYJ A;  4XYQ A;  2GN5 A;  4Z9C B;  1C9O A;  5GAD C;  1WTH A;  5JJZ A;  1C7Y A;  1VQI A;  4FVM A;  4KN4 C;  1LYL A;  1K83 H;  1X3P A;  5M3F B;  1J5E Q;  5C4X G;  1HHV A;  1IHZ A;  4FF1 A;  1HNW L;  1PH5 A;  4A3D G;  4DAP A;  2RSO A;  4B3R L;  2L1B A;  1EFW A;  3VYT A;  2K04 A;  3GTJ B;  4BA2 I;  2XRS D;  2KHI A;  3S1R B;  4A3M H;  1HZ9 A;  1Y8N B;  1G29 1;  1TWC B;  2QEJ C;  1YHQ A;  3QWN A;  1RIP A;  5C3E G;  2K1B A;  2NUC A;  2VUM H;  3F2C A;  1NNX A;  2K5H A;  4RMF A;  4C3J B;  1SR3 A;  4HTH A;  1LAB A;  4JYA Q;  1Q12 A;  1RKN A;  1CA5 A;  3S15 H;  4A3D B;  3ZYY X;  2EY6 A;  3M7N A;  1HH2 P;  4QL5 A;  1D2B A;  3EFX D;  4UAI A;  1N32 L;  2JA8 H;  2HIX A;  3HRZ C;  4UP7 A;  1SYC A;  3EA6 A;  3K80 C;  5GAG C;  5CV7 A;  1E22 A;  4X62 L;  1EYA A;  2VY3 A;  4LAA A;  1GXD C;  3GTG H;  4KV6 A;  3NEN A;  4DV0 Q;  2SEB D;  2WFW A;  1U4M A;  2KJX A;  4OX9 L;  2WB1 E;  1YNJ D;  5IWA L;  2F0M A;  2E74 C;  4DR6 Q;  4UHV A;  2WV6 D;  1HFG A;  5FO9 B;  4KTA A;  1ASZ A;  3MEH A;  3GP7 A;  4DV1 Q;  2MUY A;  4GLV B;  4R8I A;  3WOE A;  1FL0 A;  2Z6B A;  3ERO A;  1EOV A;  3CAM A;  4YIJ A;  4DAV A;  4UP8 A;  3PO2 G;  4P75 A;  3MA2 B;  1PVO A;  3K0Y A;  1EU3 A;  5E4W C;  2JA6 B;  4F87 A;  2UUA L;  1JE5 A;  4RWS C;  1LTG D;  4B3M Q;  1E24 A;  4HJ5 A;  1WTP A;  1N32 Q;  1VQC A;  1D5M C;  3CRK C;  4GKK Q;  3STB D;  3MXP A;  4MZ9 A;  2Q2T A;  3HOW H;  5KIX A;  3CCL A;  2XN9 C;  1ROD A;  3ITP A;  5IGC A;  1FJG L;  4GLX A;  2A74 C;  1JOO A;  4FXK C;  3PO3 H;  1U4L A;  4IUT A;  3LNN A;  1B2T A;  2ZXP A;  4A3F B;  4EX5 A;  2F0Q A;  1LT4 D;  3IL8 A;  2VQE L;  1G2T A;  5I6Y A;  2JA7 H;  1SDF A;  1K83 B;  2IX3 A;  4BY7 B;  2AQ1 B;  1GHJ A;  2KUM A;  4LUZ A;  1IKM A;  1EY4 A;  2JK8 A;  2ICI A;  3G71 A;  4A3M B;  2K28 A;  3GTL B;  4ZKB B;  1U4R A;  1ET9 A;  5JJK A;  2N8N A;  3Q0A A;  5D65 A;  4A3I G;  3NP8 A;  4BA1 I;  3HOX G;  4DK3 C;  1Q86 C;  3BG3 A;  1GUW A;  1QZH A;  2OQ0 A;  3H91 A;  1OXT A;  3PF5 A;  1Q82 C;  4JI6 L;  4KMU C;  1L0W A;  4NXM Q;  3TRE A;  3S15 B;  4A3D H;  4L5R C;  5AJ3 Q;  3NHH A;  2ASB A;  2EY5 A;  1EEF D;  1PV4 A;  2EZV A;  4A3E B;  3FVQ A;  2GVB A;  4QQB X;  2ZJP A;  2R7Z G;  4DPG A;  1VQ8 A;  1EYD A;  1WCM H;  3HGB A;  4GN4 B;  3TME A;  1LAC A;  4IUR A;  4AYB B;  3DWQ A;  1STB A;  4X3T A;  2FJ2 A;  4CJ2 C;  5FO8 B;  1PRT F;  3KBX A;  1ZKO A;  2B2T A;  5IT9 c;  4A75 A;  1LT6 D;  2NVQ B;  3BDL A;  4R4O A;  3H0G B;  5CMD A;  2CW0 C;  3CCS A;  1ZYR D;  3DEP A;  1TS3 A;  1PH8 A;  1NSN S;  2OQK A;  2K33 A;  2Q8I B;  5IYD G;  1WYD A;  2TSS A;  2E2H B;  2ES2 A;  4CDC C;  4P2C B;  5ELO A;  1XWE A;  4C1N I;  4IFD J;  1SE3 A;  1I4H A;  1B44 D;  4NDX A;  3V05 A;  1R9T H;  1R4P B;  1LM0 A;  1SE2 A;  1HNX L;  5ISR A;  1EY7 A;  3K5N A;  1FJG Q;  2OTJ A;  1YHA A;  1EFI D;  4RKL A;  1EIH A;  2BH8 A;  4RA8 A;  2F4V L;  3PO3 G;  1B4O A;  1VS0 A;  1JOQ A;  1PRT B;  3R2I A;  1TII D;  3I4L A;  3CCR A;  5IGB A;  1BR9 A;  4H7B A;  3CQZ H;  3VYS A;  2J0T D;  4G7H C;  2K5N A;  3I70 A;  1PTO H;  1XYI A;  1W6K A;  2VXW A;  2B63 G;  3M3Y B;  3TDQ A;  5KNB A;  4B9X A;  2B2T C;  3G4S A;  1HUM A;  1NBW A;  2CQO A;  3ULL A;  4HJ9 A;  3MAQ A;  5M5Y B;  2VW9 A;  3PMF A;  4DN4 M;  3MTS A;  4P74 A;  2DJF C;  1ET6 A;  1K3B C;  2EJG C;  4JBJ A;  4A3G H;  3KJP A;  5IWA Q;  5C4H A;  5D3I B;  2E2D C;  1YNN C;  4UDU C;  1VQL A;  3S2H B;  5EKK A;  1Z6H A;  4I7Z C;  1EY8 A;  4BY1 G;  3CRL C;  4DF7 A;  2EPB A;  4FP5 D;  5IP7 G;  5BR8 L;  4KHP Q;  2DY7 A;  4K5W A;  1JJC B;  1NR4 A;  4DAM A;  2F0W A;  1D6E C;  4KY7 A;  1SEB D;  2HD3 A;  2VS1 A;  4IFD H;  2BE5 D;  4DV1 L;  3RN5 A;  2L12 A;  4J8Q A;  4LMQ D;  3NTK A;  2PPB C;  1SFO B;  1TWF H;  1CKN A;  1E0B A;  2G9D A;  1Q3L A;  3A56 A;  4A3J H;  1SE4 A;  1AE2 A;  1H9K A;  2YTV A;  1X3E A;  3JAM E;  1B70 B;  1VQH A;  1EUJ A;  3MC0 B;  1UE7 A;  4LK1 C;  3A7L A;  4DXG A;  2VUM G;  4DR7 Q;  5IYD H;  1UWV A;  4MTN A;  2CCZ A;  1E2V A;  3GTK H;  1TWG H;  2PZU A;  5C3X A;  4DV3 L;  3I4N G;  1HR0 L;  4QCL A;  5C4J H;  1SNP A;  2ATW A;  3GDE A;  4RFB A;  2WAQ E;  3AEV A;  5M9O A;  4JYA L;  1VQ5 A;  5FKA C;  1Y1V H;  3NBH A;  4L5S A;  2OWO A;  1JMC A;  1A2U A;  1E1O A;  4X65 L;  1OXU A;  1VF5 C;  4JBK A;  1Q46 A;  2Q8T A;  2F0T A;  3I4M G;  1WCM B;  2HIV A;  1VQO A;  2DJG C;  4XT3 B;  4ID6 A;  2WAQ G;  1BKB A;  4QIW B;  2FFK B;  3I4O A;  1VQ4 A;  3S17 B;  1H95 A;  2B2U A;  1IXR A;  1STH A;  5EPL A;  1AFP A;  4F8M A;  1R4Q B;  2UXC Q;  2K05 A;  3ND9 A;  1O7L A;  2UUB L;  1HNZ L;  1YEZ A;  2YU9 H;  1X6O A;  2K5V A;  2NVT B;  1EYC A;  5CYU A;  4K0K L;  2LXJ A;  1GUO A;  1E7Z A;  4R8N A;  1S3O A;  4IUU A;  3NTH A;  2AQ3 B;  4YWM A;  4RCN A;  2UUB Q;  2DY8 A;  1EY6 A;  1LV9 A;  2RBM A;  4IN3 A;  2V1C C;  3EQL C;  3HOX H;  4JI6 Q;  4FYD A;  2QGQ A;  4Y7N H;  3Q23 A;  3M4O H;  3M9B A;  5JJL A;  1CHP D;  1SN8 A;  4GN5 A;  1ILQ A;  2E2J H;  2JA8 B;  2BDO A;  2B39 A;  5LMN Q;  4OON A;  3G6J B;  3J81 j;  4DV3 Q;  1QVF A;  2R7F A;  1S5E D;  2Q8R E;  3SK4 A;  2EYO A;  1PH2 A;  3NQT A;  4P72 A;  4BBS H;  2PZT A;  4DU9 A;  4DR5 L;  1SFO H;  3ER0 A;  1GUG A;  4C2M B;  3HOY G;  1PH3 A;  4A3G B;  1IL8 A;  4DV2 Q;  1Q90 A;  1VQA A;  1OXX K;  5EBC A;  1SNQ A;  4BBS G;  5CBE E;  1TVX A;  3H09 A;  3S14 B;  5ELF A;  2N3S A;  2E2I H;  1AE3 A;  4KD3 A;  2IX0 A;  2L11 A;  3K81 C;  4XTC S;  4NP5 A;  5DAU A;  5KRU A;  3CCE A;  2FMC A;  2VQF L;  1PFS A;  1L1O A;  4GOP C;  2QKI C;  1W6J A;  1Y8O B;  1JT8 A;  4IFD G;  4ULL A;  3O13 A;  1B3A A;  3NPP A;  2E5L Q;  4B3M L;  1KDA A;  4LF8 L;  4BXX H;  2WP8 J;  4X62 Q;  3I4M H;  1CM9 A;  3TBI B;  1YNX A;  5KND A;  1X3Q A;  3NWT A;  3GTM H;  3G48 A;  4DGZ A;  1HZB A;  4POF A;  1V9P A;  2I5L X;  4WRD A;  1C48 A;  2K7V A;  2SOB A;  2MGS A;  2F3I A;  3A55 A;  1HNX Q;  1M90 C;  4ZRZ A;  1EY9 A;  4DAY A;  3EJI A;  5C5M A;  3IFD A;  3OWF A;  3SDZ A;  1JIC A;  3GTP B;  4NW2 A;  1BVS A;  2NZH A;  4CDE C;  1KC8 C;  2RCF A;  2MHV A;  3IRB A;  4N9T A;  5DLQ E;  2D0P A;  1BCP F;  1O7I A;  4IJH A;  3J7A V;  2B2W C;  1PH6 A;  4ZYS A;  4QB4 A;  2A5H A;  5FLM H;  5E7N A;  1EIG A;  3FEW X;  3W5O A;  3J7A 5;  2K5D A;  2F0L A;  4H0L C;  1TS4 A;  3A5U A;  4BY1 H;  1CQV A;  2EVB A;  2YTX A;  2F4V Q;  1K8O A;  2HDL A;  2MO0 A;  3E5S A;  4A3B B;  3OSO A;  5C0X J;  1K28 A;  3J80 L;  4FF3 A;  1BXT A;  1EQT A;  3I3C A;  5C3E B;  3G6E A;  5C44 B;  1XMO L;  2B8G A;  4A3L G;  1Q7Y C;  1BCP B;  2VL6 A;  3NTI A;  4WJW A;  4MTK A;  1NJI C;  3GTG B;  4LF4 Q;  3RZO H;  1G91 A;  3FP9 A;  3I7F A;  3P7J A;  2KEE A;  4LNQ A;  2ZXO A;  4IFD I;  1YBY A;  3UDI A;  1F9Q A;  4PMB A;  2G9H D;  2NVT H;  1HPC A;  1KRS A;  2QW7 A;  1CKO A;  1TXY A;  4YCU A;  5M3M G;  4JK1 C;  2B2V A;  1SYG A;  2F0U A;  3S24 A;  4A3B G;  4A3G G;  5BN4 A;  1D8L A;  2XSC A;  1RTN A;  1SAP A;  4DNR B;  4DV6 Q;  1OTC A;  2B2V C;  3DM3 A;  4K0K Q;  3QG1 A;  1AZP A;  2L5T A;  2WB1 B;  4C2M H;  1JJ2 A;  5F2D A;  2PZW A;  2BA0 A;  4UP9 A;  2ALY B;  4NKL A;  3CCV A;  4ZLT F;  2I5M X;  3HOU H;  3S14 H;  1VQD A;  1KXL A;  1VQM A;  1N33 L;  3VA7 A;  4ZAI A;  4QY7 A;  4A3C H;  3HFZ B;  1LTB D;  2XRQ D;  3S1M H;  3STB C;  1SNM A;  5D14 A;  4DXF A;  1S40 A;  4DR3 L;  3A8K E;  1XPO A;  3PO3 B;  2VB3 X;  5C3W A;  5KGU A;  3CP0 A;  4XQN A;  3LX0 A;  3DM1 A;  4GOP B;  1JWS D;  2J4X A;  1NR2 A;  1WJJ A;  1CA6 A;  3BZC A;  1Q1B A;  4QGU A;  1PLF A;  1PYB A;  4B9W A;  1IYV A;  1MD2 D;  4NB3 A;  2BDN A;  4OWX B;  2WAC A;  2L9H A;  2NBF A;  4JI7 Q;  1LTI D;  1O7Y A;  2AUJ D;  4RGN A;  4EQO A;  1DD2 A;  3KLR A;  5FO7 B;  3S1Q H;  3WOF A;  2V4D A;  4O42 A;  5FLX E;  2F0H A;  5C4X B;  4OO1 H;  4DR7 L;  2R93 B;  1PFN A;  1QVC A;  1LUZ A;  2JA9 A;  3KBG A;  1B53 A;  1Y69 U;  1EY0 A;  2VQE Q;  4QJF A;  4JI1 Q;  4PV1 C;  3RMH A;  3D4W A;  3H3V C;  4XXE A;  4C3H H;  3ND8 A;  1D1I A;  5HGT A;  4L63 B;  1F2L A;  3IKJ A;  1UEA B;  4A3E H;  3TEH B;  4YHH L;  2M00 A;  5CV4 A;  3T1H Q;  3MXN A;  2KHJ A;  1MSG A;  3K5O A;  1PDQ A;  4UY8 C;  3T1H L;  4A3I B;  4YHH Q;  2F03 A;  1JWM D;  4A3E G;  2AHO B;  4ZKC B;  5IP7 H;  1GM5 A;  5JEA J;  2RKS A;  3BZK A;  3C3L A;  3W1G A;  2E5L L;  4LF8 Q;  1SNO A;  3M85 A;  4J1M A;  1BCP D;  1ZYR C;  2ZTD A;  4OX9 Q;  3FMC A;  4P71 A;  3HOY B;  2Y0S G;  3R2T A;  3PUX A;  2F0E A;  4DR2 L;  1PTO F;  4FO2 A;  1VQJ A;  2WKC A;  3WWV A;  3RN2 A;  5G3L F;  2KEC A;  3T16 A;  4CDD C;  4G57 A;  4JI8 L;  1TY0 A;  2F0O A;  1XMQ L;  1HTL D;  3BVZ A;  4DV0 L;  5EAY A;  1CI3 M;  3PO2 H;  3SGI A;  3X3M A;  3KUP A;  1OO9 B;  4C3J H;  2XWJ B;  2Z0S A;  5C4Z A;  1G2S A;  5IT9 L;  1HNW Q;  4LF9 Q;  3HOU B;  2UUC Q;  1NAP A;  4LUO A;  2F0K A;  1VQ7 A;  1DOK A;  3TS0 A;  2EYP A;  4QMG A;  2JA5 H;  2A69 C;  3OTO L;  2XIW A;  1YVC A;  2ENB A;  1TWC H;  3GD7 A;  3I55 A;  1STG A;  3HOV G;  2IHE A;  1BO0 A;  2UU9 L;  3Q8D A;  2WKD A;  1TWH B;  2Q2H A;  2EE1 A;  2EYL A;  2XGT A;  1S72 A;  4X6A H;  3F8T A;  2ZTC A;  3IFT A;  1YIT A;  3KLS X;  1C8C A;  4B3T L;  2XTI A;  1EYG A;  4YY3 Q;  4JBW A;  1WOC A;  2YYZ A;  1X9N A;  2HT1 A;  4JI3 L;  4X64 L;  4HJA A;  1HNZ Q;  2PYK A;  2Z4H A;  2I0Q A;  5GAE C;  3NEM A;  1AP0 A;  2HDM A;  2K52 A;  2PQA A;  2A6E C;  1I94 Q;  4IPH A;  4GNX C;  1PZI D;  1TWA B;  5AJ3 L;  4HAE A;  5C44 G;  4APV A;  3PUW A;  2NTS A;  1T9H A;  3KLW A;  4HIM A;  4C3J G;  2VB2 X;  4XQQ A;  3MFG A;  2ZTE A;  4IO9 A;  2JXM B;  1KIX A;  3MXU A;  4UPA A;  1FGB D;  5AFW A;  2VZA A;  3PGZ A;  3K7A H;  4A93 H;  2CHB D;  3S16 H;  1GO3 E;  3TSS A;  1UAP A;  5CV8 A;  5CC4 A;  4ALP A;  3SK5 A;  1S5C D;  2M2L A;  2VUM B;  1PMR A;  2K50 A;  1GUN A;  3HOW G;  4G7Z C;  1JR0 D;  5M3M H;  4B3T Q;  5LMU L;  1A3T A;  4DUY L;  1A15 A;  5CR3 A;  2JJQ A;  1RD9 D;  4S3S A;  1K8A C;  3U9S A;  2Z4I A;  4YCV A;  4DV7 L;  3X3N A;  4DUZ L;  3M4Y A;  3CXC A;  3I90 A;  4JI0 L;  2VNU D;  4LW1 A;  3DMU A;  4LFA L;  5IY0 A;  1SRO A;  3RZD B;  4XIG S;  2JA7 B;  1RHP A;  2KED A;  2LSS A;  3RLO A;  1V1P A;  2OEO A;  2ZM6 Q;  2Z1C A;  4IOA A;  4QUF A;  1L1O B;  1F9S A;  3CKI B;  3AFP A;  2N49 A;  5COR A;  1PH1 A;  4WJ4 A;  1V1O A;  1JB7 A;  5L37 A;  1HR0 W;  3GTL H;  5FLX L;  4QIW E;  1DJR D;  3E0E A;  4RGT A;  4TQU S;  3HKZ B;  2EY2 A;  3CD6 A;  4GZY C;  4OO1 G;  2JN4 A;  2ZJQ A;  1EZ6 A;  1QCB D;  3IAY A;  3EIV A;  2NZO A;  4RH6 A;  1DOM A;  1M8A A;  1SXT A;  2F0G A;  2NVX H;  2NVQ H;  4GLA C;  4HSP A;  4L6T B;  5FLX c;  4LFB Q;  5HUR A;  4BS9 A;  4DR6 L;  5I2X A;  4OIK A;  1STA A;  2EDG A;  1D5X C;  4KI0 A;  2HHH L;  2QIL A;  3DUZ A;  1HQM C;  1YJW A;  1KHI A;  1GHK A;  4IPC A;  1K8G A;  3SR1 A;  3K7U C;  4LF5 Q;  2J7Z A;  3TZD A;  1TU2 B;  2CFM A;  4A3M G;  1FVI A;  1G51 A;  3C1E A;  3LWE A;  4NPS A;  2DN8 A;  2OXP A;  3I56 A;  4WOR A;  5CV5 A;  2AWO A;  2JA8 G;  2ZJR A;  1IKL A;  2EOT A;  5KNC A;  1PFB A;  2A69 D;  3PSI A;  2QDB A;  1IBM Q;  3TRZ A;  1PTO B;  2PI2 E;  1S5B D;  2JYO A;  2B29 A;  1WTO A;  1P8L A;  1C4Q A;  5A35 A;  3TP8 A;  3PIO 3;  3U4V A;  4HMI A;  4OEL B;  2JE6 I;  1CKN B;  1JOK A;  3KJO A;  1HA6 A;  2IJ0 A;  3D6W A;  4CBV A;  2CWA A;  3BYT B;  4X66 L;  1NMF A;  2B8F A;  4TVA B;  1QIL A;  2R6G A;  1RTO A;  4JW0 A;  2BCO A;  2A6H C;  4AYB G;  3W3A A;  3ONA B;  1W3S A;  1LTS D;  1ENC A;  3FPP A;  2MPM A;  1SMY D;  3VR3 A;  1PH4 A;  3VYR A;  1H9S A;  2EXD A;  1LTT D;  4DR1 L;  4R4C A;  1H9J A;  1X56 A;  3CME A;  3T1Y L;  3MXN B;  2KA7 A;  4L5Q A;  4XQJ A;  4EVO A;  2F0N A;  2MP1 A;  4NMZ A;  4YWK A;  3FDT A;  5JOB A;  1OXV A;  3HS0 C;  2X6L A;  4AH6 A;  3FKI G;  3NWS A;  1B9M A;  5A2Q E;  4TRD A;  3S2D H;  2RCN A;  1IBL L;  3W1B A;  3S16 B;  3ERQ A;  2HCC A;  1JB3 A;  1SMX A;  1I3Q H;  3L3O C;  4PG3 A;  4BBR H;  3HOV B;  3K5L A;  2PQE A;  2D5D A;  2WII B;  3GTP H;  1PFM A;  2KEN A;  4QUC A;  1KNE A;  3FHW A;  1HTP A;  3OIQ A;  5E4X A;  4FF2 A;  3QOJ A;  3CF5 A;  4TKO B;  1SYF A;  1PRT D;  2UXD Q;  2NVY B;  1XXG A;  1A2T A;  2F0V A;  1ESR A;  3U58 A;  3S1R H;  1YNN D;  1WTQ A;  1VQP A;  1IW7 D;  1JCK B;  2F0S A;  1SMY C;  3F2B A;  1X65 A;  4DKA C;  2E2H H;  2R93 G;  1YIJ A;  5IYC G;  4YY3 L;  4JI4 L;  2AMC B;  3RR5 A;  5M5X B;  1DZ1 A;  3UDX A;  3N6R A;  3EBE A;  2DNE A;  1MJE A;  1EWI A;  3F2D A;  2R61 A;  3E6Z X;  3K58 A;  1JQY D;  3NK9 A;  3NUC A;  1X55 A;  4KJO A;  1I4Q A;  2D0O A;  1WI5 A;  1GD7 A;  4F88 A;  3AQQ A;  2NN6 H;  5LHY 1;  2EY1 A;  5IP9 H;  1HXY D;  3CMA A;  3I73 A;  4XDX A;  5M5W H;  2RQX A;  3PCO B;  2CWP A;  1YJ9 A;  1XNR Q;  3L0O A;  4JI5 Q;  4HIK A;  4TSS A;  3OTO Q;  1XPU A;  2PO4 A;  4CGY B;  1ASY A;  1QVG A;  3GQB A;  3HOZ G;  3ZJY C;  2LS0 1;  4ODG A;  4RHR A;  3HOY H;  1CZW A;  3VA5 A;  2Q2U A;  4G4K A;  1FNW A;  1TT2 A;  1BF4 A;  4O1N A;  1CHQ D;  2BH2 A;  2CW0 D;  5D3D A;  3MEF A;  1S4Z A;  2H5X A;  3AYH B;  2K32 A;  4C3I B;  1EQR A;  3K57 A;  4H44 C;  4RKB A;  4JVZ A;  1Y8P B;  4JI2 L;  5IIF A;  1B7Y B;  3VDY A;  1KDC A;  1DXM A;  3I4N H;  5I4D A;  2JA6 H;  2NN6 I;  3F2U A;  1FNV A;  1UNS A;  3CCU A;  4PMC A;  3I91 A;  1CT1 D;  4WJ3 M;  3HOW B;  4LFC L;  4OGQ C;  5EQ0 A;  1STN A;  4GNX A;  3I2Z A;  2XWB B;  4HJ7 A;  2E75 C;  3NSW A;  1Z47 A;  4DV5 Q;  3G7L A;  4LF7 L;  3TP6 A;  1A3U A;  2FMM A;  2D9U A;  2KCC A;  2R93 H;  1UE1 A;  1GKH A;  1PYS B;  4RCO A;  5FJ8 G;  5CGK A;  2A8V A;  4N8F A;  2NVY H;  3NXW A;  1AW7 A;  4NXN Q;  2YV5 A;  4JI2 Q;  1E2W A;  2F1M A;  3CHB D;  1N9W A;  1L1O C;  5ELD A;  4GOP A;  3E0J A;  3OWE B;  3A54 A;  4ME5 A;  1A3V A;  4R4T A;  2AQ2 B;  1WTR A;  1T5E A;  5M5X H;  5C6A A;  3ICE A;  4LF6 L;  1WFQ A;  4DR5 Q;  3I4M B;  2O4X A;  1EQQ A;  1CQF A;  2SNS A;  5HY6 A;  1SYE A;  3QO2 A;  4JV5 L;  1DCZ A;  5GRO A;  3R3O A;  3H94 A;  4DNI A;  1QB5 D;  3VYU A;  4AIM A;  1CK1 A;  5EKL A;  3MXG A;  1F2M A;  1ILP A;  3BVM A;  4G7O C;  3UE1 A;  4FXG C;  2MQH A;  2NN6 G;  4ABN A;  4KKT A;  2YU9 B;  3ULP A;  3PQI A;  3CPW A;  4GKJ L;  2UXB L;  1O7Z A;  1RJT A;  5IOD A;  1A6X A;  1P16 A;  4JC0 A;  3CCJ A;  5J22 A;  3RLN A;  5EBD A;  3D3R A;  3T1Y Q;  2A73 B;  2IWH A;  1M1K C;  1TKW B;  3UDG A;  3H0G H;  5EJW A;  1V8Q A;  4O0A A;  1J9O A;  5ELC A;  2PMZ E;  5CV9 A;  2K6A A;  4HCS A;  2XNA C;  4ZK9 B;  3M4O B;  4JOI C;  2R7Z H;  5FOB B;  3W2D A;  4K6D A;  3JAM c;  3UDF A;  4A3B H;  4IJL A;  1KLG D;  2F0P A;  1CSP A;  5IT9 E;  2HQL A;  1QUQ A;  4Q0F A;  1F77 A;  3P75 A;  2UXD L;  4KKU A;  4B3S Q;  3A7A B;  5KYI A;  2F0I A;  3A0J A;  4H02 A;  2MJ8 A;  5C0X H;  2JA7 G;  3MZ5 A;  2LXK A;  4FXD A;  1T5X D;  1VQE A;  1CZG A;  4PZ8 A;  1S5F D;  4DK1 A;  5KYL A;  5CV6 A;  2X6G A;  4HID A;  1XNQ Q;  1SSO A;  1WTX A;  4OO1 I;  3CQZ B;  2OT2 A;  3TP5 A;  1J6Q A;  1UEB A;  1PXU A;  1WCM G;  1XMO Q;  3D4R A;  1Y1V G;  2LMC B;  3BDC A;  4HIO A;  3EVQ A;  2O5I C;  1XPR A;  3D4D A;  5M5Y H;  2B63 H;  3T13 A;  3J81 i;  3HKS A;  1HR0 Q;  3MVV A;  1VMP A;  4FNF A;  2DNC A;  2KQ3 A;  3JAM L;  2K03 A;  3E3X A;  4RG1 A;  2R92 B;  2HHH Q;  3GV3 A;  1XMQ Q;  3FRP B;  3KF6 A;  5ELB A;  5GQO A;  1AZQ A;  2IHF A;  4BY7 G;  1A62 A;  1HJP A;  3RZO B;  1D1K A;  1AEX A;  1BBW A;  1H9M A;  3PV0 A;  2PMZ B;  1DGS A;  4CJ0 B;  1VMC A;  3QOL A;  3V96 A;  2K5Q A;  4RGM A;  3TZU A;  4Q5V A;  5LMN W;  1I4P A;  1STY A;  5M3F G;  3SE0 A;  2DGY A;  4DK0 A;  4I7A A;  1U9R A;  2EJM A;  1UUP A;  4WFN 3;  1ENF A;  1E2Z A;  2O2L D;  5EGT A;  3M4P A;  5M3F H;  2X69 A;  1CKM A;  3TQY A;  4RHS A;  4PMW A;  4DK6 C;  4KD4 A;  5JVG 3;  1KQS A;  3MWY W;  4KY6 A;  1UE5 A;  3RUZ A;  2H1E A;  3OMC A;  1HA5 A;  3S2H H;  1FD7 D;  5M3M B;  4JI5 L;  4A3K G;  2PQA B;  4M8A A;  4CKB A;  4BY1 B;  1N34 Q;  3I8Z A;  1TWG B;  3DHQ A;  4X3S A;  2RDG A;  4OWW B;  5C4J B;  5C3E H;  4JI0 Q;  5K5P A;  2YTY A;  1NMG A;  3P1H A;  3J7A F;  1KAW A;  1BUV T;  2KOL A;  4LWC A;  3KFU A;  1GOZ A;  1XTD A;  4J15 A;  3ERS X;  4R4Q A;  3J7Y W;  3K6O A;  1BOS A;  3T53 B;  2F52 A;  5TSS A;  1VQB A;  4BXX G;  4DUY Q;  3B6Y A;  4K6L A;  3CCM A;  1QWY A;  3BDO A;  3PUY A;  1YZ6 A;  4HJ8 A;  3SK6 A;  1CFM A;  2F0J A;  3GTJ H;  3RLF A;  3U9O A;  5IGD A;  1F9P A;  1K73 C;  2D62 A;  4X3U A;  4PNY A;  3GTQ B;  3HOV H;  4N9P A;  5I6W A;  5C0X G;  3GTK B;  3UE0 A;  1K8M A;  4DV4 Q;  1MBY A;  1O78 A;  1A63 A;  4J6H A;  4GKJ Q;  2UXB Q;  1PH9 A;  4A76 A;  2QA4 A;  4QF4 A;  1MKH A;  2KCN A;  2N88 A;  5COY A;  5KEE A;  1PH7 A;  1HZA A;  4OEM B;  1QNK A;  4ME3 A;  1B8A A;  4P73 A;  2B63 B;  5DM7 3;  2P5Z X;  1EL0 A;  2EJF C;  3HOU G;  3HKZ G;  2K4K A;  1EEI D;  1PZJ D;  1E3P A;  4ZUI A;  1EY5 A;  4JV5 Q;  4Y52 H;  2EIF A;  3FPU B;  2B2W A;  3A5Z B;  4KK7 A;  4A3J G;  1QZG A;  4RGO S;  3TN2 A;  2UXC L;  1Z7T A;  4DR4 Q;  2JA5 G;  3D6C A;  1I6H H;  1TR5 A;  1KL9 A;  1SYD A;  3QIA A;  3R93 A;  4X66 Q;  4K8J A;  3C46 A;  1PRT C;  2K01 A;  2KCM A;  1N34 L;  4CKE A;  5IE8 A;  1NTG A;  4A93 G;  4DV4 L;  4A3K H;  3L9A X;  1VQ9 A;  3HOX B;  5E1F A;  2UU9 Q;  2CH4 A;  1YJN A;  2A68 C;  1XX8 A;  1VF7 A;  1SJE D;  4FDB A;  2UUC L;  4IAL A;  2F4I A;  1KAB A;  4K2L A;  1VQN A;  4L8J A;  3HZX A;  1BQQ T;  2E2J B;  1EOT A;  2HUG A;  4KHZ A;  4C3H B;  1EIY B;  1OXS C;  1JC7 A;  2NB0 A;  3VR4 A;  5EKI A;  2PI2 A;  1LTA D;  3T56 B;  4K2K A;  1ZXT A;  1TQO A;  1X54 A;  2L4N A;  1U5K A;  4IPD A;  1ONL A;  4HCE A;  1A8V A;  1SLJ A;  1I4X A;  1VQK A;  2JSO A;  1K0S A;  3HOZ B;  5IGE A;  2KBN A;  1KNA A;  4A3F G;  3ULJ A;  3KOJ A;  4KY5 A;  1C0A A;  4E6I A;  2A68 D;  5C0X I;  4MN3 A;  1FR3 A;  5FLM G;  1K3R A;  2L15 A;  3CCQ A;  2IY5 B;  5LL6 X;  3GTQ H;  4LFC Q;  2IX1 A;  4AQY L;  5JAV A;  2A1A A;  4XYO A;  1HCZ A;  2I46 A;  2SDF A;  1M4V A;  2RHQ B;  1IBK L;  1VQG A;  4KHV A;  1JWU D;  3A8J E;  5A2Q L;  2LY7 A;  1CSQ A;  3PO2 B;  3QJY A;  3OYY A;  2JA6 G;  2WAQ B;  1EU4 A;  2E76 C;  2VQF Q;  1XJV A;  1AN8 A;  1RCV D;  1UE6 A;  4DR2 Q;  4DAY B;  3PF4 A;  3DEO A;  2LFN A;  4MIU A;  4B3S L;  1PZK D;  5M5W B;  3MHB A;  3KF8 B;  3RZD H;  2JQO A;  3C2P A;  2EYH A;  5BN5 A;  3CPF A;  1MGS A;  3RNU A;  3GTO H;  4ZQ3 A;  1IYJ B;  1O80 A;  3H15 A;  3Q24 A;  4L5T A;  3SXH A;  1JJG A;  3U50 C;  1BNZ A;  1PTO D;  1XNQ L;  2BOS A;  1DON A;  3LWU A;  1PYW D;  5IOC A;  4F7X A;  2BE5 C;  1WTW A;  2CVR A;  2RHS B;  3SHL A;  1RDP D;  4GS3 A;  2FIN B;  2B2Y C;  4DR3 Q;  1PTO C;  4JI1 L;  1L2F A;  4DUZ Q;  1WVL A;  3KDF A;  4A3K B;  2PCF B;  5DNF A;  4EQP A;  5GAH C;  4HR7 B;  1N33 Q;  5T1G A;  4FF4 A;  1I6V C;  5LMU Q;  2G5D A;  3SEB A;  1HFN A;  4BBR G;  3JC6 6; 
#chains in the Genus database with same CATH homology
 4A3B G;  2VY3 A;  4A3G G;  2H5X A;  3AYH B;  3GTG H;  4DR4 L;  1D8L A;  1EQR A;  2IT1 A;  3KYH C;  3NEN A;  1X3G A;  4PZ7 A;  4DV0 Q;  2WFW A;  1OTC A;  3GO5 A;  4DV6 Q;  4JI2 L;  3DM3 A;  1B7Y B;  4DR1 Q;  4OX9 L;  3VDY A;  3I4N H;  2WB1 E;  4K0K Q;  4C2M H;  5IWA L;  1JJ2 A;  2JA6 H;  4DR6 Q;  2NN6 I;  2BA0 A;  2EQS A;  4X64 Q;  4UP9 A;  1ASZ A;  1J5E L;  2ALY B;  3CCV A;  2I5M X;  3HOU H;  3CCU A;  1SE8 A;  3S14 H;  1VQD A;  1Y14 B;  4DV1 Q;  4GLV B;  1KXL A;  1VQM A;  1N33 L;  1FL0 A;  4WJ3 M;  1EOV A;  3CAM A;  4QY7 A;  4A3C H;  3HFZ B;  3LGJ A;  4UP8 A;  4LFC L;  4P75 A;  3S1M H;  3PO2 G;  1PVO A;  1CUK A;  3STB C;  3HOZ H;  4GNX A;  3BU2 A;  1FGU A;  1K0R A;  3I2Z A;  2UUA L;  3AFQ A;  1JE5 A;  4DR3 L;  1XPO A;  2RF4 A;  4X65 Q;  1S40 A;  2OTL A;  4HJ7 A;  4B3M Q;  4A3C G;  1Z47 A;  2R92 G;  1E24 A;  4HJ5 A;  3CP0 A;  5FJ8 H;  4DV5 Q;  1N32 Q;  1VQC A;  4GOP B;  4LF7 L;  4GKK Q;  1WJJ A;  3STB D;  1IBM L;  3BZC A;  1Q1B A;  3D0F A;  4MZ9 A;  4QGU A;  2Q2T A;  3HOW H;  3CCL A;  3CW2 C;  4LF7 Q;  4DV5 L;  1PYB A;  2R93 H;  1UE1 A;  1GKH A;  1PYS B;  1FJG L;  4GLX A;  5FJ8 G;  4NB3 A;  1X3F A;  4OWX B;  2A8V A;  2Z6K C;  3PO3 H;  4JI7 Q;  2NVY H;  4GN3 B;  1YHB A;  4NXN Q;  2YV5 A;  1GVP A;  4JI2 Q;  4EX5 A;  4JBM A;  2MO1 A;  3S1Q H;  2CKZ B;  2VQE L;  4LF6 Q;  4JG2 A;  1N9W A;  3F1Z A;  1L1O C;  3L7Z C;  4NXN L;  4GOP A;  4LF5 L;  2JA7 H;  4DR7 L;  1QVC A;  1LUZ A;  2JA9 A;  3D31 A;  2B3G A;  4O2D A;  4R4T A;  4LUZ A;  5IYB H;  4OWT B;  2DUD A;  1HZC A;  5M5X H;  3ICE A;  2VQE Q;  4LF6 L;  1WFQ A;  4QJF A;  4DR5 Q;  4JI8 Q;  2JK8 A;  4JCV E;  1EQQ A;  3G71 A;  4JI1 Q;  5HY6 A;  4JV5 L;  5GRO A;  1Z9F A;  4DNI A;  3TS2 A;  4A3L H;  4C3H H;  3DLL A;  4AIM A;  1A0I A;  1IBK Q;  3TRZ A;  3UE1 A;  2N8N A;  4A3E H;  3TEH B;  5JJK A;  4A3I G;  2MQH A;  4BA1 I;  4YHH L;  3HOX G;  3T1H Q;  4DK3 C;  2NN6 G;  1Q86 C;  2KHJ A;  4AQY Q;  2OQ0 A;  3PF5 A;  1OXT A;  1QZH A;  4UY8 C;  1Q82 C;  4JI6 L;  3ULP A;  3T1H L;  1L0W A;  4NXM Q;  4YHH Q;  3TRE A;  3CPW A;  4GKJ L;  2UXB L;  4A3E G;  5K36 G;  2AHO B;  3FKI H;  4A3D H;  5IP7 H;  4IOC A;  1GM5 A;  5JEA J;  1P16 A;  2Z6K A;  3BZK A;  3HKZ E;  3W1G A;  4JC0 A;  5AJ3 Q;  3CCJ A;  3RLN A;  2E5L L;  4LF8 Q;  3M85 A;  1PV4 A;  2ASB A;  3T1Y Q;  3JC6 6;  2R7D A;  1M1K C;  2GVB A;  1MIU A;  3UDG A;  4QQB X;  2ZTD A;  4OX9 Q;  2ZJP A;  1Q1E A;  3H0G H;  4DPG A;  1VQ8 A;  2R7Z G;  1WCM H;  4IPG A;  4O0A A;  4P71 A;  2Y0S G;  2PMZ E;  3PUX A;  4GN4 B;  4DR2 L;  1VQJ A;  3WWV A;  3S17 H;  5HGQ A;  3RN2 A;  4JOI C;  1SRU A;  2R7Z H;  3H0G G;  1K9M C;  4DV2 L;  3JAM c;  3UDF A;  4JI8 L;  4IJL A;  1XMQ L;  4A75 A;  4A3B H;  1CSP A;  5IT9 c;  4DV0 L;  5EAY A;  1Q81 C;  2HQL A;  1QUQ A;  3SGI A;  3PO2 H;  4R4O A;  3A74 A;  4A4I A;  1NE3 A;  2UXD L;  4C3J H;  3CCS A;  4B3S Q;  2Z0S A;  1PH8 A;  2OQK A;  3A0J A;  2K14 A;  4H02 A;  1Y1W G;  2JA7 G;  5IYD G;  1U0L A;  1HNW Q;  1WYD A;  2LXK A;  4LF9 Q;  2UUC Q;  2ES2 A;  4LUO A;  5ELO A;  1VQE A;  3E9I A;  4WJ4 A;  1VQ7 A;  4IFD J;  4PZ8 A;  1TWH H;  1XNR L;  1XNQ Q;  4HID A;  1R9T H;  3TS0 A;  4JI7 L;  1LM0 A;  4OO1 I;  2JA5 H;  1HNX L;  2JEA I;  3OTO L;  1YVC A;  1J6Q A;  1FJG Q;  2OTJ A;  1UEB A;  2E8G A;  1YHA A;  1WCM G;  1TWC H;  3KF6 B;  3GD7 A;  2BH8 A;  3I55 A;  1XMO Q;  2F4V L;  1Y1V G;  4HIO A;  3PO3 G;  1VS0 A;  3HOV G;  2IHE A;  2UU9 L;  4MNO A;  1XPR A;  1I50 H;  3Q8D A;  3CCR A;  1LTL A;  5M5Y H;  2Q2H A;  4LUV A;  2B63 H;  2XGT A;  4KLK A;  3J81 i;  3HKS A;  3CQZ H;  1S72 A;  1HR0 Q;  4X6A H;  3F8T A;  2K5N A;  2MFI A;  2ZTC A;  4RG1 A;  1QUQ B;  3OW2 A;  2HHH Q;  2B63 G;  1XMQ Q;  5GQO A;  3KF6 A;  1YIT A;  1RL2 A;  1I94 L;  2IHF A;  4A3F H;  1A62 A;  1HJP A;  4B3T L;  3M4Q A;  3G4S A;  1TWA H;  2CQO A;  1NBW A;  2XTI A;  3ULL A;  4HJ9 A;  1BBW A;  3NEL A;  2VW9 A;  1EYG A;  3PV0 A;  4YY3 Q;  4JBW A;  1WOC A;  2YYZ A;  1X9N A;  2HT1 A;  1DGS A;  4P74 A;  4JI3 L;  5IP9 G;  4X64 L;  4HJA A;  1HNZ Q;  4JBJ A;  3KDF B;  4A3G H;  3KJP A;  5IWA Q;  2KCT A;  2I0Q A;  5GAE C;  4R4I A;  3NEM A;  3CC4 A;  2N78 A;  2K52 A;  5LMN W;  2PQA A;  5M3F G;  1I94 Q;  1VQL A;  3M3Y H;  2DGY A;  4IPH A;  4C3I H;  4GNX C;  3J80 c;  2GVA A;  5AJ3 L;  5C44 G;  4APV A;  4BY1 G;  3PUW A;  3KLW A;  1T9H A;  4NXM L;  4HIM A;  3M4P A;  5M3F H;  5IP7 G;  5BR8 L;  4KHP Q;  1CKM A;  3TQY A;  4DK6 C;  4PMW A;  1KQS A;  1JJC B;  2ZTE A;  4IO9 A;  1Y1W H;  1KIX A;  4DAM A;  4UPA A;  1UE5 A;  2VS1 A;  4DV1 L;  2VZA A;  2FXQ A;  3RN5 A;  3NBH B;  3S2H H;  3PGZ A;  3CC2 A;  4LF4 L;  3K7A H;  2A19 A;  1VQ6 A;  3S16 H;  1IZ6 A;  4JI3 Q;  1GO3 E;  4A93 H;  1TWF H;  4JI5 L;  1CKN A;  4A3K G;  4A3J H;  2PQA B;  1AE2 A;  1N34 Q;  4ALP A;  2YTV A;  4PZ6 A;  1X3E A;  4DV6 L;  1B70 B;  1VQH A;  1EUJ A;  2K50 A;  3J81 c;  4LF9 L;  4OWW B;  3J7Z C;  3HOW G;  3J80 i;  1IL2 A;  1UE7 A;  5C3E H;  1E1T A;  4JOI A;  2YTY A;  1NMG A;  4JI0 Q;  1KAW A;  5ELN A;  5M3M H;  4LWC A;  4B3T Q;  2VUM G;  5LMU L;  4DR7 Q;  3KFU A;  2Q2I A;  1XTD A;  4J15 A;  4DUY L;  3ERS X;  4R4Q A;  5IYD H;  1UWV A;  4MTN A;  1W2B A;  2CCZ A;  2F52 A;  2JJQ A;  1K8A C;  1VQB A;  3GTK H;  1TWG H;  1VQF A;  4BXX G;  4DUY Q;  3B6Y A;  4YCV A;  2K75 A;  3CCM A;  3CC7 A;  4DV3 L;  4DV7 L;  4DUZ L;  3PUY A;  1YZ6 A;  3I4N G;  1HR0 L;  3CXC A;  4HJ8 A;  4JI0 L;  5C4J H;  3GTJ H;  2ATW A;  3GDE A;  3RLF A;  3H3V I;  4LFB L;  1K73 C;  2WAQ E;  4LW1 A;  2VNU D;  4LFA L;  2MNA A;  3AEV A;  2D62 A;  5IY0 A;  1SRO A;  4JYA L;  1VQ5 A;  4XIG S;  3S1N H;  4YWL A;  1N36 Q;  1Y1V H;  4AYB E;  4L5S A;  3HOV H;  2LSS A;  2OWO A;  4GKK L;  1PA6 A;  3RLO A;  5C0X G;  1JMC A;  1V43 A;  2PNH A;  3UE0 A;  4EQ5 A;  2AKW B;  1E1O A;  2ZM6 Q;  4IOA A;  4DV4 Q;  5JEA G;  1OXU A;  1L1O B;  4X65 L;  2UUA Q;  1V1Q A;  3AFP A;  1Q46 A;  2N49 A;  1KD1 C;  1BBU A;  4JBK A;  4GKJ Q;  2UXB Q;  3U4Z A;  2BA1 A;  1PH1 A;  4A76 A;  2HIV A;  1VQO A;  1PH9 A;  2QA4 A;  1JB7 A;  3I4M G;  1HR0 W;  5C44 H;  1MKH A;  3GTL H;  2WAQ G;  1BKB A;  1HZA A;  3L2P A;  1PH7 A;  3I4O A;  4QIW E;  3E0E A;  5J3B A;  4TQU S;  1VQ4 A;  3CD6 A;  1H95 A;  4OO1 G;  4ME3 A;  2ZJQ A;  1IXR A;  1B8A A;  4P73 A;  4POG A;  3EIV A;  2NZO A;  2NVQ H;  3HOU G;  3HKZ G;  2K4K A;  2NVX H;  2UXC Q;  4GNX B;  2UUB L;  1VCI A;  4GLA C;  1HNZ L;  1E3P A;  1YEZ A;  5FLX c;  2YU9 H;  4LFB Q;  1X6O A;  2K5V A;  4OXP A;  4DR6 L;  4JV5 Q;  4Y52 H;  2EIF A;  4K0K L;  5H1S E;  2LXJ A;  3A5Z B;  1E7Z A;  4A3J G;  1S3O A;  1QZG A;  4R1J A;  4KI0 A;  3EN2 A;  3H3V H;  2HHH L;  4YWM A;  2UXC L;  2C35 B;  2UUB Q;  4DR4 Q;  2JA5 G;  1D7Q A;  1YJW A;  1KHI A;  1I6H H;  4IPC A;  2V1C C;  1KL9 A;  1K8G A;  3K7U C;  3HOX H;  4LF5 Q;  4JI6 Q;  2QGQ A;  5IYB G;  1PHJ A;  2CFM A;  4Y7N H;  4A3M G;  1FVI A;  1G51 A;  2AWN A;  5BR8 Q;  3PIO A;  4KHP L;  3K0X A;  4NPS A;  4X66 Q;  3M4O H;  3M9B A;  5JJI A;  5JJL A;  2KCM A;  1N34 L;  3I56 A;  1SN8 A;  2JEB I;  4GN5 A;  5IE8 A;  2AWO A;  2JA8 G;  2ZJR A;  1NTG A;  4A93 G;  2E2J H;  3PUV A;  4DV4 L;  4A3K H;  2ZM6 L;  1VQ9 A;  5LMN Q;  5C4X H;  4OON A;  2UU9 Q;  3PSI A;  3J81 j;  1EIF A;  4DV3 Q;  3E9H A;  2PI2 E;  3K8A A;  2R7F A;  5IYC H;  2QEX A;  1YJN A;  1N36 L;  2B29 A;  1QVF A;  5LMN L;  1AH9 A;  4FDB A;  1P8L A;  2UUC L;  4LFA Q;  3U4V A;  1VQN A;  2JE6 I;  1PH2 A;  4P72 A;  1CKN B;  3KJO A;  4BBS H;  4DR5 L;  4DV7 Q;  2CWA A;  3ER0 A;  1SFO H;  4X66 L;  1NMF A;  3PIP A;  4KHZ A;  3HOY G;  1PH3 A;  4TVA B;  3PUZ A;  2R6G A;  1EIY B;  4DV2 Q;  1YI2 A;  1VQA A;  2Y0S E;  1OXS C;  1OXX K;  1I5F A;  3BJU A;  4AYB G;  4B3R Q;  4X62 L;  4BBS G;  1N8R C;  2PI2 A;  2N3S A;  2E2I H;  1AE3 A;  4JI4 Q;  1NY4 A;  1MJC A;  2IX0 A;  1W3S A;  3K81 C;  4XTC S;  2ID0 A;  1X54 A;  4A3I H;  1U5K A;  4IPD A;  1PH4 A;  3CCE A;  1A8V A;  2VQF L;  1SLJ A;  2EXD A;  1VQK A;  1PFS A;  4DR1 L;  3JAM i;  1L1O A;  4R4C A;  4GOP C;  1X56 A;  2KBN A;  3CME A;  3T1Y L;  3MXN B;  4L5Q A;  4A3F G;  4BY7 H;  4IFD G;  3ULJ A;  3KOJ A;  1C0A A;  1JT8 A;  4YWK A;  2R92 H;  1KRT A;  1OXV A;  2E5L Q;  4B3M L;  4AH6 A;  4LF8 L;  4BXX H;  5C0X I;  2WP8 J;  3FKI G;  4YCW A;  2I5H A;  5FLM G;  1K3R A;  2L15 A;  2OCE A;  3CCQ A;  4X62 Q;  3I4M H;  4BY7 G;  2IY5 B;  1G6P A;  2WB1 G;  3S2D H;  1YNX A;  2RCN A;  1IBL L;  3W1B A;  4LFC Q;  3GTQ H;  2IX1 A;  4AQY L;  1SMX A;  1I3Q H;  4PG3 A;  1Q8K A;  4BBR H;  3GTM H;  2A1A A;  3G48 A;  1IBL Q;  3GTP H;  2KEN A;  2GN5 A;  3FHW A;  1HZB A;  4POF A;  1V9P A;  2I5L X;  2RHQ B;  3CF5 A;  1IBK L;  1VQG A;  2UXD Q;  1C9O A;  1CSQ A;  3U58 A;  2F3I A;  3OYY A;  5GAD C;  1C7Y A;  1VQI A;  3S1R H;  1HNX Q;  1M90 C;  1VQP A;  2JA6 G;  2VQF Q;  1LYL A;  3F2B A;  1XJV A;  1X65 A;  1K83 H;  4DKA C;  1J5E Q;  5C4X G;  1KC8 C;  1BVS A;  2NZH A;  1UE6 A;  4DR2 Q;  2E2H H;  2R93 G;  3IRB A;  5DLQ E;  5IYC G;  4YY3 L;  1YIJ A;  2D0P A;  1HNW L;  4DAY B;  1PH5 A;  4JI4 L;  4A3D G;  2AMC B;  3RR5 A;  3PF4 A;  3UDX A;  4B3R L;  1O7I A;  4IJH A;  3EBE A;  1MJE A;  1PH6 A;  1EWI A;  3F2D A;  1EFW A;  4BA2 I;  4B3S L;  2KHI A;  5FLM H;  5E7N A;  3W5O A;  1HZ9 A;  4A3M H;  3KF8 B;  3RZD H;  1G29 1;  3J7A 5;  2JQO A;  3CPF A;  1X55 A;  3A5U A;  4BY1 H;  2YTX A;  1YHQ A;  3RNU A;  2D0O A;  3GTO H;  1IYJ B;  1WI5 A;  3H15 A;  1RIP A;  2F4V Q;  4L5T A;  5C3E G;  1GD7 A;  2MO0 A;  3AQQ A;  5C0X J;  1JJG A;  2VUM H;  5IP9 H;  3U50 C;  3CMA A;  3F2C A;  4L5R C;  2K5H A;  4RMF A;  1IBM Q;  5M5W H;  1XNQ L;  1A63 A;  3PCO B;  2CWP A;  3G6E A;  1YJ9 A;  3L0O A;  1XNR Q;  1XMO L;  1SR3 A;  4JYA Q;  1Q12 A;  4A3L G;  4JI5 Q;  4HIK A;  3OTO Q;  2VL6 A;  1Q7Y C;  1XPU A;  3S15 H;  2RHS B;  1NJI C;  4DR3 Q;  4GS3 A;  4LF4 Q;  3RZO H;  3M7N A;  4JI1 L;  1L2F A;  4DUZ Q;  1HH2 P;  1ASY A;  4QL5 A;  1QVG A;  3FP9 A;  3I7F A;  3KDF A;  4LNQ A;  3HOZ G;  3ZJY C;  1N32 L;  2JA8 H;  4IFD I;  2HIX A;  1YBY A;  3UDI A;  4UP7 A;  3HOY H;  5GAH C;  2Q2U A;  2NVT H;  1N33 Q;  1KRS A;  3K80 C;  5GAG C;  1CKO A;  1TXY A;  4YCU A;  5LMU Q;  2BH2 A;  5M3M G;  3MEF A;  4BBR G;  1E22 A;  3S24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...