1N36L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36L00
2BH2A 3EBEA 3E9IA 3W1GA 5H1SE 1YITA 2GVBA 1SN8A 2PMZE 1PA6A 2ZTDA 1S40A 1QUQB 3PV0A 3H15A 2MQHA 1LTLA 2UXCQ 4LF4Q 3M3YH 1EQRA 1EWIA 4LFBL 3D31A 1KC8C 1HR0Q 4B3SL 4L5RC 1HZBA 2ES2A 3S17H 1J5EL 4B3RL 1B70B 3FP9A 4GLAC 4DUYQ 2NZOA 3UE1A 3ULLA 1A0IA 3LGJA 3AFPA 5GAHC 1WCMG 3PIOA 4DAYB 2K4KA 1IBKQ 3T1HL 1OXUA 5J3BA 3CP0A 4NB3A 1MKHA 3MEFA 2KHIA 2R7DA 2VUMG 4KLKA 5IWAQ 3S1QH 1P16A 1OXSC 3RLFA 3CF5A 3UDGA 1PH2A 2CCZA 4B3ML 4IJLA 1P8LA 1VQBA 3OW2A 4DR5L 2ZJRA 2YYZA 4YCVA 3I55A 1XMQQ 1LUZA 1I3QH 4R4QA 3PO3H 2VQFL 2H5XA 4A3CG 4LUZA 5LMUL 1NBWA 2K50A 4X62L 3NBHB 1FJGL 4YWMA 5IYBG 3M85A 1VQDA 4YHHQ 1Z9FA 1YJ9A 3W1BA 3HOXG 3S24A 2VQEL 1Q7YC 1X54A 2RCNA 1QVFA 4GKKL 1K8AC 3CAMA 2JA9A 3HOZH 1VS0A 5LMNL 1VQ6A 4DAMA 4YCUA 1T9HA 2E5LQ 1E24A 4A3IH 3BZKA 4DV4Q 2UXDL 2IY5B 5E7NA 4K0KQ 1JT8A 3HOXH 2JQOA 3G71A 5BR8L 3S2HH 3G6EA 3CMAA 3KYHC 4NXNL 2JA8G 1XNQQ 1B7YB 1Y1WH 2D62A 2WB1G 1SRUA 2PQAB 4DR7L 4LF5L 2WB1E 2NN6G 2ZTEA 5M5YH 4DR2Q 3E0EA 4HJ7A 4XIGS 2K5NA 5GADC 1IBML 3KLWA 2E8GA 4IPDA 3A74A 2Q2UA 4JI7Q 1N33L 3KJPA 2CFMA 1KL9A 4X66Q 4IFDG 2EQSA 4X65Q 3T1YL 1PH3A 2MFIA 4POGA 4UY8C 3NENA 3RN5A 2EIFA 2K52A 4A3LG 4IPCA 2CQOA 4R4TA 3UDFA 3A5UA 1D8LA 3TREA 2LXKA 1JJGA 1L2FA 2AKWB 1E3PA 1OXTA 3F8TA 3L0OA 1X55A 3RR5A 4B3TQ 4A3MG 4LF4L 2NVXH 2VL6A 4YWKA 1EOVA 2UXBL 1AE2A 4A3LH 1E1TA 2PI2E 2RHQB 5M3MH 3CCRA 3CW2C 1J5EQ 4B3RQ 2FXQA 3U4ZA 5JEAG 3GTKH 1UE5A 1XPUA 4JV5L 1L1OB 2N3SA 1WI5A 1IBKL 2BA0A 2Z0SA 2E2IH 3I7FA 1IYJB 2VW9A 3T1HQ 3KF8B 3G48A 5IWAL 4OXPA 3HOVH 2ALYB 1I6HH 2I0QA 1N36L 4DV6L 4B3MQ 3H0GG 5DLQE 4UP9A 5HY6A 3CCUA 3CD6A 5IE8A 4JBMA 4DV0Q 3I4NG 4DV2Q 3ERSX 4DR5Q 1IL2A 4FDBA 3ZJYC 4A3FG 2YTXA 4LF7L 3J80c 4A3BH 2Q2IA 2R93G 4L5TA 4LUOA 3KJOA 5JJIA 2LXJA 5LMUQ 2E2JH 2UUAQ 3G4SA 1VQ7A 4QIWE 1FL0A 1VQLA 5GAGC 3U4VA 2QEXA 3CPWA 5JEAJ 3AEVA 3PO2H 4TVAB 4A93H 2OQ0A 2HT1A 4DV5Q 1YVCA 4P74A 4R4OA 2ASBA 4GNXB 4K0KL 3DLLA 4PZ8A 4XTCS 3I4OA 2Y0SE 2B3GA 5C44H 1YZ6A 5M3FH 1X3GA 2JA5H 3KFUA 4A3GG 3M9BA 5IP7G 1N9WA 1VQIA 1HJPA 5IYDG 4JI0L 4IPHA 5BR8Q 1Q12A 1ASZA 1GM5A 1XNQL 3GTLH 4HJ8A 3HOUH 4NXNQ 4DV7Q 3H3VI 3HOZG 2R6GA 2WAQG 1CKMA 3PF4A 3M4PA 4P71A 3CCLA 4BXXH 1TWAH 3HOWH 2WAQE 1MJCA 4LWCA 4BBRG 1IBLQ 4LF5Q 2Q2HA 2JA6G 3I4MH 3L7ZC 3AFQA 4LFCL 1OXXK 2I5LX 4BY1G 2OTLA 3BJUA 2JEAI 3DM3A 4X66L 1N33Q 4X65L 2NN6I 3CXCA 3CQZH 1KQSA 3CC2A 1VQ4A 1PVOA 4POFA 2JA7H 2JA6H 3F2CA 1V1QA 3B6YA 4BY1H 1PH4A 2JE6I 3TRZA 1QZGA 4IPGA 4B3TL 3K0XA 5M5XH 4GS3A 1V43A 1PH8A 4YCWA 1YEZA 4DNIA 3RZOH 1TWHH 4IOAA 1G6PA 2UXBQ 3J7ZC 1K9MC 2JK8A 1TXYA 5FJ8H 5GQOA 1JJCB 4BA1I 4X64L 2IHFA 5M5WH 3CCVA 4HIKA 5HGQA 1WOCA 1PHJA 4R1JA 4JV5Q 4A76A 2QGQA 3S1NH 1BKBA 1Q8KA 1YNXA 1WYDA 2KCMA 1C9OA 1N36Q 1HNWQ 1LYLA 1YHQA 4DV6Q 4DV0L 1B8AA 1W2BA 4DV2L 2Q2TA 4DR6Q 4L5QA 1TWGH 4LF7Q 2K14A 1Y14B 4HIMA 1K73C 1PYBA 2NVYH 3PUZA 3ULPA 2UUAL 4L5SA 1X65A 2ATWA 4A3IG 2YV5A 3ER0A 3NEMA 5K36G 4GOPA 1Q46A 1X6OA 1YHAA 4JI4Q 3I56A 1AH9A 4RMFA 4JBJA 4BY7G 1WFQA 4GOPC 1HZCA 4DV5L 1YJWA 1HR0W 1PH7A 2HQLA 2JJQA 3GTJH 1Y1WG 4LFAL 1X3EA 3NELA 5C0XG 3GTQH 2OTJA 4BY7H 2K5HA 3J81c 3K81C 1UE7A 4HJAA 4JI0Q 1PH9A 4DV7L 2BH8A 4LF6Q 4OWWB 4JCVE 2YTVA 1KXLA 2MO0A 1IBLL 2B63H 1QZHA 2IX1A 4BA2I 2Z6KA 3A0JA 2ZJQA 4YY3L 4RG1A 4LFCQ 2Z6KC 1FGUA 1UE1A 4DR4Q 3RNUA 3HKZG 1D7QA 3UE0A 1CKNA 4X6AH 1JE5A 3HKZE 3PSIA 1YJNA 3BU2A 3ICEA 5ELNA 5M3MG 5IYCH 4JBKA 2VS1A 4PZ6A 2BA1A 3Q8DA 2RHSB 4OWTB 4PZ7A 5C0XJ 3E9HA 4MZ9A 4HIOA 1EQQA 1NJIC 4LF8Q 1XNRL 1VQJA 3CCMA 1NTGA 1W3SA 1KIXA 3EN2A 2IX0A 4A3KH 1SFOH 4QJFA 4X64Q 3HOVG 1WJJA 4AQYQ 4WJ4A 3GTGH 1VQKA 2V1CC 1U5KA 4BXXG 3U58A 2PNHA 1X3FA 4A3DH 4IFDJ 1Q82C 4C3JH 4GLVB 3S14H 4KHPQ 1HNWL 4A3BG 4DK3C 2VZAA 1XMOL 3F2DA 4DR6L 4A3JH 2IT1A 3I2ZA 3TQYA 4HIDA 5EAYA 4A93G 3PO2G 1SR3A 2ZM6Q 1CSQA 1UWVA 1VQAA 3AYHB 2R7ZH 4JI4L 5C44G 2DUDA 5FLMH 5M3FG 1Q81C 3GTMH 1CUKA 3MXNB 1HNZL 2JA5G 3S15H 4OO1G 4ME3A 3JAMc 2R7FA 1SROA 1BBWA 3HOUG 4EQ5A 4JI1Q 1VQ8A 3GD7A 4C2MH 1NY4A 2JEBI 1NMFA 4BBSH 4R4CA 4LFAQ 3GDEA 1PH1A 3HOWG 2I5HA 4LF6L 2XGTA 3M4OH 3I4MG 3PCOB 3J81i 1KRSA 3FKIG 1X9NA 1N8RC 3PUXA 1Z47A 2E2HH 1RIPA 3STBC 3S16H 4JI6Q 2JA7G 1Q86C 1XPOA 3TEHB 1UEBA 2XTIA 1NE3A 4O0AA 4NXML 4YY3Q 3GTOH 3TS2A 3FKIH 3EIVA 1HZ9A 3KDFA 1U0LA 3ULJA 1S3OA 1XPRA 1VQHA 2L15A 4JI5Q 3HOYH 4DV3L 1MIUA 1VQNA 2HIXA 3WWVA 1GKHA 4MNOA 4A3EH 4IFDI 5FJ8G 1PH5A 1HH2P 4LF8L 3K80C 1L0WA 1QUQA 3CCJA 1YIJA 4DR1Q 1XNRQ 3UDXA 2MNAA 3KF6A 5LMNW 1EYGA 1JMCA 2ZJPA 1C7YA 1VQ5A 1SE8A 2C35B 4IO9A 2AMCB 2PI2A 4AIMA 4DR3Q 2RF4A 3PUYA 1JB7A 4JI8Q 1A8VA 1PFSA 4JI3L 4AQYL 1GO3E 1VQMA 4OX9L 3CCQA 4DK6C 2VNUD 4ALPA 1OTCA 2UU9L 2KCTA 1X56A 1VQPA 4P72A 4JG2A 4JI2Q 1A62A 4KHPL 3K7UC 5C4JH 3GTPH 2VY3A 4PMWA 1IXRA 3S1RH 3M4QA 2CKZB 1XMOQ 4GN5A 4H02A 1XTDA 2GN5A 5IP9H 1Y1VH 3FHWA 2K75A 3F1ZA 3KF6B 1EUJA 1O7IA 1MJEA 2ZM6L 4HJ9A 1V9PA 3J80i 3S2DH 1NMGA 4LUVA 3PGZA 1FVIA 2UUCL 1A63A 2UUBL 1YBYA 3TS0A 3PUWA 5IY0A 2KHJA 1R9TH 1HNZQ 1UE6A 1BVSA 2N49A 2AWOA 4JI1L 1Q1BA 3SGIA 3JAMi 1VQOA 3IRBA 4OO1I 1N34Q 1DGSA 4JYAL 1WCMH 2WP8J 1QVCA 2CWAA 4PG3A 4QL5A 5C4XG 5FLXc 2B63G 4P75A 2I5MX 1SMXA 1VQCA 3UDIA 5ELOA 1VQFA 2VUMH 1N32Q 5C3EG 3CC4A 2HHHL 4LF9Q 1SLJA 2KBNA 2PQAA 4DPGA 5C4XH 2AHOB 1K3RA 4JI6L 1I94Q 3OYYA 4UPAA 4DR4L 3AQQA 3M7NA 5C3EH 2ZTCA 4GOPB 1PH6A 5IYCG 4AYBG 2QA4A 4NXMQ 4A3CH 4GKJL 2CWPA 2HIVA 4JI5L 4AYBE 3S1MH 4DUZL 1PYSB 1VQGA 5IYBH 3OTOQ 2K5VA 1XJVA 4JBWA 4DV1Q 4DV3Q 1ASYA 3D0FA 3J81j 4P73A 4A3KG 4NPSA 4DR1L 1TWCH 1HZAA 4AH6A 1VQEA 3H3VH 1K0RA 1HNXL 3RN2A 3JC66 4C3IH 4DR3L 1E22A 4JI8L 2JA8H 4A3DG 1BBUA 1L1OA 1LM0A 1KD1C 1J6QA 1OXVA 4JI3Q 4OX9Q 3CC7A 3K8AA 3RLNA 4QY7A 5AJ3L 4IOCA 1L1OC 2EXDA 1CKNB 4A3JG 4JI2L 2F4VQ 4KHZA 2UU9Q 5GAEC 4JC0A 2GVAA 2MO1A 2ID0A 4KI0A 2UXCL 2R7ZG 3GO5A 1G291 1TWFH 1AE3A 4C3HH 5FLMG 1HR0L 3PO3G 4GLXA 4A75A 5JJKA 2B29A 4LFBQ 5IT9c 4B3SQ 4DUYL 1PV4A 4O2DA 3L2PA 1VQ9A 4A3MH 1YHBA 4QGUA 4BBSG 1E7ZA 2UUCQ 4LNQA 2R92G 1M90C 1M1KC 1CSPA 1I50H 2UUBQ 1K83H 4APVA 1RL2A 1IZ6A 4GNXA 1N34L 1EIFA 1GVPA 2KENA 2AWNA 2R92H 1Q1EA 4JYAQ 3CMEA 2D0PA 4GNXC 3J7A5 1VCIA 4WJ3M 3PF5A 3A5ZB 4Y7NH 3BZCA 1XMQL 1N32L 1GD7A 2YTYA 3U50C 3CCEA 1KHIA 4LF9L 2UXDQ 5C0XI 2OWOA 3PUVA 1CKOA 2VQFQ 2HHHQ 2N78A 1QVGA 5JJLA 3H0GH 2IHEA 3VDYA 1K8GA 1I94L 2DGYA 4X62Q 3HOYG 4YHHL 2NVTH 4Y52H 3I4NH 1FJGQ 3CPFA 2A8VA 4DKAC 4A3FH 2VQEQ 4A3EG 4TQUS 4GKKQ 2R93H 3RZDH 4GN4B 4UP8A 2E5LL 1KAWA 4GKJQ 4DV4L 2YU9H 2Y0SG 5LMNQ 3OTOL 2NVQH 2OCEA 4DV1L 4UP7A 4YWLA 4GN3B 4DUZQ 4JOIA 4LW1A 4J15A 1G51A 4A4IA 1C0AA 1EFWA 1H95A 1YI2A 4JOIC 4HJ5A 2A1AA 4IJHA 1EIYB 2F52A 3W5OA 1I5FA 2OQKA 3HFZB 2D0OA 2N8NA 3STBD 4EX5A 1JJ2A 4OONA 3KOJA 3RLOA 5IP7H 1HNXQ 4A3GH 4QQBX 5IYDH 2WFWA 2NZHA 1E1OA 3K7AH 1KRTA 4DR2L 4DR7Q 1S72A 4OWXB 4MTNA 4JI7L 3HKSA 5GROA 1IBMQ 4R4IA 2LSSA 3F2BA 2F3IA 3KDFB 2F4VL 4BBRH 5AJ3Q 3CCSA 5IP9G 3T1YQ 1Y1VG 3PIPA 2A19A
chains in the Genus database with same CATH superfamily
2D5DA 1G6ZA 3OSOA 2D2CC 4K5VA 3W1GA 1YITA 2GVBA 3QIAA 2PMZE 4JW0A 2NVXB 3H15A 2MQHA 4LFBL 5I2XA 3S17H 1B70B 4GLAC 3UE1A 4QCLA 3LGJA 1DCZA 3P7JA 3TN2A 1NCVA 2PZWA 2R7DA 2VUMG 4KLKA 5IWAQ 1GUWA 1OXSC 1HUMA 4R8IA 2Q8TA 4B3ML 1H9KA 5IODA 4I7ZC 1P8LA 1R4PB 3OW2A 3NWTA 4QMGA 4R4QA 1I3QH 1S5CD 2VQFL 1LO5D 4LUZA 3H0GB 1NBWA 1SYDA 1VQDA 4YHHQ 1F2LA 5ELBA 4A3FB 3S24A 1Q7YC 1X54A 2O2LD 5LMNL 1V8QA 5FOBB 1VQ6A 2NVQB 4YCUA 1T9HA 2IY5B 4A3IH 1JT8A 1PRTF 4K0KQ 3HOXH 2JQOA 3S2HH 2N55A 2Y0SB 1X32A 4NXNL 2EYFA 2JA8G 1XNQQ 1B7YB 2EPBA 1SE2A 1KDAA 3K7AB 4F8MA 4LF5L 1LT5D 2ZTEA 1JWSD 4MHEA 3A7LA 3E0EA 4XIGS 2K5NA 5GADC 2GA4B 3KLWA 3SXHA 4X66Q 4BBRB 1MD2D 3VR4A 2CH4A 5M9OA 1JC7A 5T1IA 2JYOA 2EIFA 2A68C 4IPCA 4JK1C 5M5XB 1OXTA 1RTOA 5FO8B 4B3TQ 1SSOA 4DU9A 3K5OA 4YWKA 1KNEA 5M3MH 2QKIC 2PZTA 1J5EQ 1EWCA 1UE5A 3C1EA 2B2VC 1XPUA 1ML0D 4JV5L 1WI5A 1HTLD 5IWAL 2QW7A 2I0QA 3RD4A 2F0HA 3H0GG 4HMIA 1B3AA 4DR5Q 1SEBD 1IL2A 4A3FG 2YTXA 4QF4A 5I2YA 4L5TA 4LUOA 1MBYA 2IL8A 4QIWE 1JWUD 5GAGC 2NWGA 2WKDA 2EYLA 2QEXA 4FP5D 5IGDA 4R4OA 2K05A 4K5WA 4U673 4GNXB 4K0KL 3I91A 5JJZA 4BY7B 1VQIA 1XNQL 2ICEC 4HJ8A 3H3VI 4BXXH 4FF3A 1STAA 4LWCA 4BBRG 1IBLQ 4X66L 1LTID 3CXCA 1KQSA 2K01A 1EY0A 4RA8A 2JA7H 3D6CA 2F0QA 3TRZA 4B3TL 2F0EA 1V43A 1PH8A 1YEZA 1I4QA 3WOEA 1K9MC 2A69D 1JJCB 3OIPA 2KCNA 1ZXTA 2CW0D 3GTKB 3CCVA 4R1JA 4A76A 3F2UA 4ODGA 1T5EA 4UAIA 3I90A 2A5HA 4BWGB 4DV6Q 5A2QE 4L5QA 4X3UA 4A3BB 3NE5B 2NVYH 4L5SA 5FO9B 5C3XA 2ATWA 5D14A 4C1NK 4GOPA 1U9RA 1X6OA 4A93B 3PO2B 4BY7G 1WFQA 4DAPA 2L0CA 4WORA 2E76C 5C44B 4LFAL 1LTGD 3NELA 5C0XG 3HOUB 5K5PA 2YTVA 3Q22A 3QG1A 4O1NA 1TWAB 3HOWB 1IBLL 1QZHA 1IYUA 4K6DA 3FKIB 4LFCQ 2Z6KC 1I4XA 1S5ED 4FO2A 2JA6B 3PSIA 3I4LA 3BU2A 3ICEA 2CVRA 2B2WC 5E4WC 4JBKA 4J6HA 4LF8Q 3E9HA 1LACA 1VQJA 4IUNA 1RKNA 1W3SA 2QEJC 2B2TC 5IT9L 5CYUA 2RDFA 5FO7B 1JCKB 1WJJA 4MN3A 4KKUA 4WJ4A 3SK8A 3GTGH 2V1CC 2A68D 2PNHA 1RF2D 1X3FA 4A3DH 3QWNA 3S14H 4A3BG 4ID6A 4IQZA 3F2DA 1F2MA 4A3JH 1TWGB 4KY6A 5EAYA 4DK1A 4A93G 3PO2G 4KV6A 5EKIA 5C44G 3PO3H 4OO1G 1KAAA 3MXNB 4Z9CB 3BYYB 3K57A 1HNZL 1HCZA 2EVBA 3S15H 2R7FA 2HDMA 3VR3A 3IAYA 3HOUG 2VB3X 3GTJB 1NY4A 4J8QA 4OHJA 1HPCA 1CFMA 3GTQB 3GDEA 1PH1A 3TMEA 3HOWG 1OO9B 2NZ1D 3M4OH 2PW7A 2F3VA 3PCOB 5KIXA 3KLRA 3N52A 2H4OA 3FKIG 3PUXA 1I6VC 1RIPA 3STBC 3S16H 2A6EC 5CV7A 4DR4Q 1NE3A 4G57A 1HZ9A 3KDFA 3ULJA 2WACA 1S3OA 3X3MA 2L15A 3HOYH 5COYA 1RDPD 1VQNA 3WWVA 4MNOA 3SK5A 5FJ8G 1HH2P 4LF8L 3CCJA 1QUQA 1YIJA 5DM73 3BDOA 2MNAA 5J39A 3KF6A 1EYGA 1JMCA 2XWBB 2F0NA 1A3VA 4AIMA 1B9MA 1A8VA 3J80E 3CCQA 4DAYA 4FF1A 1PFMA 4C3JB 4NW2A 4JI2Q 5C4JH 4U68A 2VY3A 4PMWA 1BXTA 1Y8OB 4H02A 1XMOQ 2A6HC 3SDZA 5IP9H 3FHWA 2RSOA 3D4RA 3F1ZA 3H6MA 1EFID 5KEEA 5EPKA 4CHTB 1B9NA 1BF4A 2R7ZB 4PV1C 1F9SA 3FMCA 1WD1A 2UUBL 1YBYA 2KHJA 2OF1A 1ET6A 1LT3D 2N49A 3SGIA 1Q1BA 4QL5A 5C4XG 5FLXc 4YIJA 1CZGA 2VUMH 2LS01 1G2TA 2J7ZA 5KNBA 1SLJA 2KBNA 4DPGA 1QCBD 1LTSD 2MGSA 2PO4A 3P20A 1CZWA 4DR4L 1M4VA 3GTOB 5C3EH 2ZTCA 5ISRA 1BQQT 1PYSB 1VQGA 2PQEA 5HURA 2BDOA 3WDNA 4JBWA 2L5TA 3SE0A 3J81j 4A3EB 4P73A 3KBGA 3RMHA 1EEID 4QUCA 1JOKA 4C56C 1QJOA 4GZYC 1GUSA 4AH6A 4R8NA 1HNXL 3KBXA 2M2LA 3LWEA 2JA8H 3FRPB 1KLUD 4C3JG 3ONAB 1JQYD 3I73A 1J6QA 2K1BA 4QY7A 4FXDA 3BVGA 3KF8A 2F4VQ 2LFNA 1CKNB 4JI2L 1DJRD 1K8MA 3VYRA 1S5FD 1VF5C 3J7YW 4JC0A 1RD9D 1BUVT 4N8FA 1Y1VB 2R7ZG 1MSGA 2EY5A 5FLMG 3K59A 5JVH3 1PV4A 1HUNA 3MXGA 5D3IB 1VQ9A 3JAML 3VYTA 1EIFA 1WCMB 5CV5A 3UI2A 1Q1EA 3T13A 4GNXC 3J7A5 1K8OA 1SE3A 1VCIA 4RAUC 4PQXA 1E2ZA 1GD7A 2N88A 2YTYA 3U50C 1KHIA 3H91A 1DOMA 2HCIA 2QDLA 2HHHQ 5JJLA 2R61A 3H0GH 4ULLA 1K28A 3VDYA 2NTTA 2A8VA 1KDBA 2G9DA 4A3FH 1D5ZC 2VQEQ 4A3EG 4GKKQ 4GKJQ 2NVQH 2OT2A 4IZ8A 2MPMA 4JOIA 4J15A 2SDFA 1C0AA 1H95A 2XN9C 3MA2B 5JPMC 1EIYB 3W5OA 1I5FA 3HFZB 3STBD 1JJ2A 2A6ED 4QQBX 2A73B 3K7AH 3OPOA 4LMQD 1S72A 3HKSA 1PXUA 1IBMQ 2LSSA 3U9OA 2F4VL 4KN7C 4BBRH 3CCSA 4RKLA 2DNCA 3T1YQ 1Y1VG 3PIPA 4IUPA 3EBEA 2XIWA 3E9IA 4TSSA 4FVMA 3PV0A 2UXCQ 1B4OA 4LF4Q 3D4DA 1IW7C 1EWIA 1C4QA 3D31A 3OHXC 4L5RC 4B3RL 4A3MB 1A0IA 5GAHC 1WCMG 1EY9A 1K83B 3PIOA 2K4KA 2EOTA 1MKHA 2KA7A 3NQIA 2KHSA 3RLFA 1O7ZA 1PTOB 1Q90A 2Z4HA 3BDLA 3UDGA 1VMCA 1ENCA 1J8IA 1STGA 4YCVA 1XMQQ 1LUZA 4A3CG 3MEHA 5JPNC 4JVZA 3NBHB 3I4NB 1B53A 4YWMA 4KMUC 5IYBG 1WTXA 3W1BA 2VQEL 4GKKL 1E0BA 2R93B 1Z7TA 1K8AC 1ESFA 1VS0A 2F0SA 4WJ3M 1TS5A 5ELFA 2Z1CA 3G6EA 3OMGA 3CMAA 1QNKA 4HSPA 3AB9A 2D62A 1H9MA 3DWAA 4G7HC 4A3GB 1AZQA 5C0XH 3HEJA 4DR2Q 1UEAB 1IBML 4IPDA 4CDEC 4JI7Q 3VR6A 1RTNA 2EQSA 3A8JE 2K32A 3T1YL 1B50A 4POGA 4BY1B 3RN5A 2NYZD 4A3LG 4R4TA 3A5UA 3UDFA 4V190 4IFDH 4JPBW 1EQVA 1L2FA 2AKWB 3F8TA 2PZUA 3R3OA 1TWHB 3RR5A 2KCCA 3I8ZA 4A3MG 1V1PA 5KGUA 4LF4L 2UXBL 2I07B 3CCRA 2B2VA 2WKCA 3CW2C 3C3LA 1II3A 3U4ZA 3GTKH 4OEMB 1L1OB 2N3SA 3D3RA 3I7FA 2VW9A 1LABA 1LTBD 4OXPA 2ALYB 1I4PA 1TY0A 4B3MQ 3DMUA 1STHA 5DLQE 4M1UB 5JOBA 5HY6A 1X3PA 2NTSA 3CD6A 3I4NG 5C4HA 4LF7L 2FHTA 4A3BH 2R93G 1SNOA 1F9QA 2E2JH 5CORA 4RH6A 3R2IA 3VA5A 1K3BC 5JEAJ 3PO2H 4A93H 2KOLA 2LY7A 1YVCA 4P74A 2ASBA 1EL0A 3DLLA 2KVMA 5C44H 2Y0SE 2B3GA 4OO1H 1X3GA 4A3GG 3M9BA 1N9WA 5IYDG 4JI0L 3K5NA 1A6XA 5G3LD 5HGTA 3HOUH 1GUGA 3SK6A 1Y1WB 4NXNQ 2RCFA 1CKMA 1RODA 3M4PA 1TWAH 3HOWH 1G2SA 1MJCA 1TY2A 4LF5Q 2Q2HA 3L7ZC 4BY1G 1UUPA 3MFGA 5CV8A 4M8AA 2NN6I 4L8JA 2JA6H 4Q5VA 3F2CA 3B6YA 1PH4A 2JE6I 1IYVA 1QZGA 3HKZB 5IGBA 2PPBC 4YCWA 4DNIA 2JK8A 1TXYA 5FJ8H 4FXKC 5GQOA 4BA1I 4X64L 1DYQA 1IHZA 1HHVA 1ET9A 5M5WH 4HIKA 3T16A 4HMJA 3TZUA 4JV5Q 4E6IA 2O5IC 2QGQA 1BKBA 4XYOA 1I6HB 2FFKB 5FLXL 1LYLA 2C9OA 1FNVA 2XRQD 1STNA 1W2BA 4DR6Q 1TWGH 4IUUA 1Y14B 1WD0A 3PUZA 2KECA 1X65A 5I6YA 3QO2A 5J22A 2CQAA 3ER0A 5IGEA 5K36G 1Q46A 4JI4Q 3I56A 4JBJA 2F0IA 1YJWA 3K5LA 2JJQA 5M3FB 3GTJH 1Y1WG 4QUFA 3GTQH 1TS3A 3J81c 4H0LC 4LF6Q 4K8JA 5CBAE 2KJXA 2MO0A 4HR7B 4BA2I 2Z6KA 3I4MB 2ZJQA 4YY3L 1FGUA 1D7QA 3CQZB 3HKZG 3QJYA 1MSHA 2B2WA 1SYFA 5ELNA 3W2DA 1RJTA 1EIGA 1TU2B 4KD4A 3RZOB 3Q8DA 2B2TA 1EQQA 4MZ9A 4HIOA 4TKOB 3CCMA 1NTGA 5C5MA 3SHLA 1H9SA 1KIXA 3OWFA 3EN2A 1L0XB 2IX0A 4DFAA 4QJFA 2AQ3B 3DEOA 5E4XA 3NUCA 4KY7A 4CDFC 4C3JH 2KEEA 2HQEA 2NB0A 3LNNA 3S1RB 2BDNA 5BN4A 3KUPA 4DR6L 2BE5C 2IT1A 3I70A 1SJED 4EQOA 2R7ZH 4JI4L 5FLMH 5M3FG 1Q81C 3JAMc 4RHRA 1SROA 3ND9A 1AFPA 4G7ZC 4JI1Q 5D3DA 2SOBA 2JEBI 4R4CA 4LFAQ 5G3LF 1J9OA 2F3WA 4LF6L 2FMCA 1EYCA 1GUNA 1W6KA 3I4MG 3J81i 1KRSA 2B63B 2K7VA 1NR4A 2F0OA 4ZAIA 4X3KA 1XPOA 3TEHB 1UEBA 4O0AA 3GTOH 1JOQA 2B2UC 4XQJA 1CQFA 4Q0FA 3K58A 3S1MB 5DM63 3TDQA 1MIUA 4AYBB 1GKHA 4A3EH 4RGTA 4DNTB 1PH5A 3HS0C 1TWCB 5F2DA 3UDXA 5LMNW 3J7AF 1HFNA 3DM1A 3CKIB 4A3KB 3PUYA 1LT6D 1JB7A 3EROA 1GO3E 4DK6C 2JSOA 2F0MA 2KCTA 3CU7A 4JG2A 3FDTA 1A62A 1LV9A 3MTSA 1SAPA 3GTPH 2AQ2B 3C1FA 1PTOC 3VR2A 1Y1VH 1Y8NB 4WRDA 3KF6B 1EUJA 5BN3A 1O7IA 2RDGA 1MJEA 2AUKA 2UUCL 4L63B 2RBMA 5IY0A 2EY2A 1HNZQ 1BVSA 3MHBA 4HEDA 4JI1L 3MFYA 3JAMi 3BG3A 2ZXRA 3FPPA 4C2MB 1WTHA 3DHQA 4L6TB 1WCMH 2WP8J 1QVCA 4PG3A 2B63G 3UDIA 5ELOA 2L55A 3OW7A 1DXMA 1N32Q 2C5CA 3CC4A 2F0PA 1K3RA 2X6GA 3OYYA 1JE4A 2L4NA 4DA2A 5IYCG 2ENBA 4AYBG 4A3CH 1SYBA 3VR5A 5IYBH 1SXTA 4LAAA 1SDFA 1EY8A 4A3KG 4NPSA 4H44C 1VQEA 4RFBA 1K0RA 4WJWA 3RN2A 1ICFB 1E22A 2ICIA 3K0YA 1LM0A 1KD1C 1OXVA 1STYA 4DGZA 4XDXA 3I3CA 4IOCA 1L1OC 5GAEC 4KJOA 4CKCA 4HCEA 3BVZA 3J7AV 1GXDC 1G291 4C3HH 1G91A 1HR0L 2EYHA 2B29A 4DUYL 3CRKC 4EGVA 4O2DA 2EJGC 4A3MH 3QOJA 2F0WA 4QGUA 1R9TB 1F77A 1M90C 2UUBQ 1K83H 5C6AA 4GNXA 1CM9A 3PQIA 5EKLA 2R92H 4K2LA 2BE5D 5I9OA 1PTOH 3CMEA 3D8GA 5J1ZA 3A5ZB 4Y7NH 1N32L 1U4PA 5C4XB 1TS4A 1Y8PB 2N78A 1QVGA 2IHEA 2J4XA 1K8GA 2DGYA 4X62Q 1T5XD 1FJGQ 3I4NH 5CMDA 3HGBA 1EU4A 4MTKA 2R93H 3GQBA 2PYKA 4GN4B 4UP8A 2E5LL 1KAWA 4DV4L 1WVLA 2OCEA 3HOXB 4GN3B 1QNUA 1EFWA 2MUYA 1PFBA 4DNRB 2F52A 3DEPA 2D0OA 4OONA 4A3GH 1HNXQ 5IYDH 2WFWA 3NBIA 4DR7Q 1EY4A 4OWXB 2WB1B 4R4IA 3HRZC 1KDCA 2F3IA 2RDHA 3EFXD 2EY1A 4KTAA 4LK1C 1EOTA 1YNJC 3AU7A 1SN8A 2ZTDA 1TWFB 3PMFA 2KQ3A 1AEXA 1D2BA 1KC8C 5ELDA 1JWMD 2ES2A 2WIIB 3HP3A 2Z6BA 3ULLA 4KKSA 1I50B 1JOOA 1IBKQ 3T1HL 2K33A 3CP0A 4FYDA 1SJHD 2KHIA 3MEFA 2EE1A 4K2KA 2E75C 1ZEQX 3CF5A 3EQLC 1PH2A 3HZXA 5EBCA 3J81L 2TSSA 4FXGC 1VQBA 3A54A 2ZJRA 3I55A 1EEFD 1TQOA 1W6JA 5EQ0A 3K5MA 5LMUL 3OOCA 2PNRC 4X62L 1L0YB 5IGCA 1FJGL 4CKEA 1SYCA 3KLSA 1Z9FA 3HOXG 1HA6A 3BYTB 1TKWB 2JA9A 2YU9B 3KK7A 1E24A 3BZKA 2UXDL 2CH4W 1TS2A 5K36H 5CBEE 2RVLA 2XSCA 1ICWA 4ILWA 3G71A 5BR8L 1BNZA 3KYHC 2PW5A 4DN4M 1Y1WH 2WB1G 1SRUA 2PQAB 3GV6A 4DR7L 1ENAA 4HJ7A 2HUGA 2WAQB 4DXFA 1N33L 3R93A 2CFMA 2ZXPA 2B2YC 4ZUIA 1FGBD 1PH3A 1B44D 2CQOA 1O78A 1D8LA 3TREA 5DAUA 1E3PA 2FMMA 3D4WA 2NVXH 2VL6A 3M3YB 4RGOS 2IX3A 1E1TA 1O7YA 2BOSA 2PI2E 5DNFA 1WTVA 1O80A 3A55A 1EY6A 4G4KA 3BZDB 3M4YA 3RUZA 4B3RQ 2FXQA 3IFDA 1F9RA 3MXNA 1IBKL 1IYJB 3NTKA 3G48A 3S1QB 3A7AB 2X69A 1AW7A 1I6HH 5KYIA 1PDQA 1N36L 3NK9A 1LTAD 4IN3A 3CCUA 2KEDA 3NHHA 5IE8A 4JBMA 3ERSX 4FDBA 1QOHA 3ZJYC 3J80c 2L9HA 1VQLA 3U4VA 3HOZB 3CPWA 3E0JA 4DV5Q 1BBXC 4PZ8A 4XTCS 5M3FH 3KFUA 4BXXG 1KTKA 2KUMA 1HJPA 4IPHA 1NR2A 1GM5A 2R6GA 1F2YA 2WAQG 3CCLA 1PMRA 5M5YB 2VXWA 3I4MH 3AFQA 2OTLA 2JEAI 3DM3A 5IT9E 2M9VA 4MIUA 3GV3A 3CQZH 1VQ4A 4POFA 2F4IA 2K28A 1HFGA 1UNSA 4IPGA 4IURA 1F9PA 3K0XA 5M5XH 1XXGA 3TP5A 4GS3A 1G6PA 1EU3A 3RZOH 1STBA 1I4RA 2UXBQ 4K8IA 2QF7A 1A3UA 1GHKA 4IUTA 1H9RA 2SNSA 2R3ZA 2Z4IA 1WOCA 5HGQA 2E2IB 2JXMB 1TIID 2EJFC 4X3TA 2G5DA 1O7LA 2F0VA 1CHQD 1PTOF 1YNJD 1YNXA 3HOVB 1WYDA 2KCMA 2A6HD 1YHQA 3O13A 1B8AA 2Q2TA 1LTRD 4LF7Q 1CTMA 2G9HD 4ABNA 4HIMA 1K73C 3HOZG 2YV5A 4CBVA 1SBBB 4P2CB 1AH9A 2F0DA 1HZCA 4DV5L 1PH7A 2HQLA 4H13C 3NTHA 4CJ2C 2JA5B 1X3EA 3CHBD 1IL8A 4BY7H 3GTLB 4JI0Q 4HJAA 3M4OB 1PH9A 2BH8A 1U4LA 4KY5A 4OWWB 4JCVE 1BOSA 2B63H 1F2ZA 5C4ZA 1MI2A 2EYOA 3A0JA 1BR9A 4RG1A 5CV9A 1JB3A 1WTQA 3RNUA 1CKNA 2SEBD 4X6AH 2QCPX 1JE5A 3HKZE 1LLRD 2L1BA 3FVQA 3QOLA 5IYCH 4PZ6A 1H9JA 1LTTD 4OWTB 2RHSB 4PZ7A 5C0XJ 1XNRL 1EYAA 1Z6HA 1NNXA 3PIP3 3SEBA 4A3KH 4X64Q 2K04A 2EDGA 4N9PA 3HOVG 4AQYQ 2DJFC 3S1NB 2IJ0A 4IFDJ 1Q82C 4GLVB 4KHPQ 4RKBA 4DK3C 2VZAA 4K5XA 3TZDA 4CDDC 4ZLTF 3TQYA 4HIDA 4IUVA 5BN5A 1SR3A 2ZM6Q 1UWVA 3MAQA 3AYHB 2FINB 4HCSA 1EQTA 1CUKA 2JA5G 2Z8LA 4ME3A 4DK0A 4N8X1 5IIFA 1BBWA 4EQ5A 4OIKA 5A2QL 3GD7A 4C2MH 1NMFA 4RHSA 1E2WA 4RCNA 4XYQA 2I5HA 3NPPA 1GJXA 2XGTA 1N8RC 3H3VC 2B2UA 4JI6Q 3V05A 1BCPB 3OMCA 4CGYB 5C3EB 3QB3A 4LJZC 4IALA 2HCCA 2ZT9C 4YY3Q 4NXML 3TS2A 3FKIH 3EIVA 1DZ1A 1XPRA 1U0LA 4N9TA 4ZKCB 3VYSA 4DV3L 2DY8A 1TVXA 1A2TA 3T4AC 2HIXA 4IFDI 1E2VA 3K80C 4ZUJA 1L0WA 4DR1Q 5KYLA 2ZJPA 1C7YA 1SE8A 3M7GA 2AMCB 2AUJD 2F0JA 2IW3A 2PI2A 2RF4A 1SFOB 1KLGD 4OX9L 4JI3L 4AQYL 2A69C 1QG7A 1OTCA 2LKVA 1RCVD 2UU9L 1X56A 1VQPA 1I4HA 2M00A 4P72A 2H1EA 4KHPL 3MC0B 3Q6SA 1G8ZD 1IKLA 3JAME 2RQXA 1IXRA 3M4QA 1IW7D 4GN5A 4J1MA 1XTDA 3TP7A 1JR0D 2ZM6L 3E3XA 4HJ9A 3NBHA 1NMGA 4LUVA 3PGZA 1FVIA 4NDXA 4CDCC 3GTMB 4KKTA 2F0LA 3TS0A 1R9TH 3X3NA 2A74C 4X3SA 1XTCD 2NUCA 1VQOA 3IRBA 4OO1I 4BBSB 4JYAL 4C1NI 1DOLA 4P75A 1VQCA 1CA6A 1VQFA 5C3EG 5EPJA 2D9UA 5KRUA 5C4XH 3DWPA 2E2HB 2AHOB 1ILPA 4RCOA 4JI6L 2K5WA 1I94Q 4F7XA 4UPAA 1X3QA 3VA7A 4GOPB 2QA4A 2FJ2A 2CWPA 2HIVA 1MHWC 4AYBE 4DUZL 1NAPA 3OTOQ 4V0BA 1ASYA 3D0FA 1PRTB 3P75A 5LL6X 4DR1L 1WTRA 1HZAA 3H3VH 1EY5A 1EIHA 4EQPA 1S5BD 1ZYRC 4NKLA 1JICA 1BBUA 3A8IE 4H7BA 3NP8A 2F0TA 1L1OA 2HD3A 3CC7A 2MP1A 3RLNA 5AJ3L 2EXDA 3BS1A 5AFWA 1SYEA 1ILQA 1QE6A 2X6LA 2TMPA 4F88A 2GVAA 2MO1A 2IWHA 1TWFH 2PMZB 3J80L 4B3SQ 1GUOA 3S2DB 4BBSG 1E7ZA 2UUCQ 1M1KC 1CSPA 1I50H 1RL2A 4K6LA 1FD7D 3MZ5A 1U4MA 1TT2A 2OWOA 1K0SA 1SNCA 1I94L 1DM0B 4YHHL 4B9XA 2WV6D 5I6WA 4XQQA 3A56A 1B1ZA 2YU9H 2Y0SG 3OTOL 4UP7A 1TR5A 2F03A 4LW1A 3ZYYX 1DD2A 2MJ8A 3Q24A 2OXPA 3LX0A 4HJ5A 4K14A 3NWSA 2OQKA 2N8NA 2Z9HA 4EX5A 5I4DA 4C3IB 1SNMA 2AQ1B 1DONA 1KRTA 2NZHA 3ND8A 5LL6S 3H94A 5GROA 1EYDA 3KDFB 2F0KA 1EZ6A 3DUZA 2A19A 3IFTA 2BH2A 1KNAA 5H1SE 1PA6A 1S40A 1QUQB 1WTOA 1CT1D 1LTLA 2BCOA 3M3YH 1EQRA 1KXLA 4B3SL 1HR0Q 1PZID 1HZBA 3DWQA 1J5EL 4PMBA 3FP9A 4DUYQ 2L11A 2NZOA 4R9WA 3AFPA 3TP8A 3L9AX 4ZYSA 4DAYB 1OXUA 5J3BA 4NB3A 4XXEA 2WINB 3S1QH 1Q8IA 1P16A 2CCZA 2B8GA 4IJLA 1B2TA 5C3WA 1VF7A 1EY7A 3TBIB 4DR5L 1EZ8A 2DNEA 2YYZA 3NQTA 4DF7A 1ESRA 2H5XA 2E74C 2Q8IB 2E2JB 2K50A 4HN7A 2NVTB 3M85A 1YJ9A 1VMPA 2RCNA 1QVFA 4QIWB 3CAMA 3RZDB 3GP7A 3HOZH 4RGMA 1S5DD 2CHBD 4DAMA 4DAVA 2E5LQ 5JVG3 4DV4Q 1D5MC 5E7NA 1NUCA 5LHY1 5L37A 1RHPA 4C3IG 2L12A 1PZJD 3H09A 1NSNS 3A8KE 1STEA 2B8FA 4XT1B 4OELB 3E5SA 2WB1E 2NN6G 5M5YH 2B2YA 4HTHA 2E8GA 3A74A 2Q2UA 5IOCA 3KJPA 3V96A 5ELCA 1KL9A 4IFDG 4FNFA 2QDBA 3MVVA 1IKMA 4X65Q 2MFIA 5E3FA 1CA5A 4UY8C 3T56B 3NENA 2K52A 2EYMA 3SR1A 2LXKA 4I7AA 1JJGA 1FYCA 3L0OA 1X55A 4QB4A 5IGFA 4KK7A 1ZYRD 1EOVA 1AE2A 1HXYD 4A3LH 2RHQB 5FLXE 3S17B 2F0GA 3R2TA 1FR3A 2NBFA 5M5WB 1XX8A 5JEAG 4HAEA 5E1FA 3NXWA 2BA0A 2Z0SA 5DEHA 2EYJA 2E2IH 3T1HQ 2JN4A 3KF8B 5EGTA 4OL7A 3C2PA 1FNUA 3HOVH 1AZPA 4DV6L 1A15A 2B39A 4UP9A 1HRJA 4DV0Q 1I3QB 1B3QA 4DV2Q 3BVMA 1PFNA 5ELEA 3MWYW 2Q2IA 3KJOA 5JJIA 2LXJA 5LMUQ 2UUAQ 3G4SA 1VQ7A 1I4GA 1FL0A 1YNNC 3EA6A 4KHVA 4F87A 1BCPC 3AEVA 4TVAB 2OQ0A 4UHVA 4A3IB 2HT1A 1SNPA 3FPUB 1XYIA 2UXDQ 3I4OA 2DJGC 1QB5D 1YZ6A 2JA5H 1AP0A 3S2HB 5IP7G 5BR8Q 1ASZA 1Q12A 3GTLH 2SNMA 4DV7Q 1ZKOA 2XWJB 3PF4A 4P71A 2E2DC 2WAQE 4PMCA 2K03A 2JA6G 4LFCL 3V2TA 1OXXK 2I5LX 2PCFB 3BJUA 3NTIA 4RGNA 1N33Q 2F0FA 4X65L 3CC2A 1PVOA 1V1QA 3P1HA 4BY1H 3SK4A 4KD3A 4HSVA 1TWHH 4IOAA 5M3MB 4OGQC 3J7ZC 3MXPA 2F0UA 1VDZA 2EJMA 2IHFA 2K5DA 1M8AA 2RSNA 1PHJA 5A35A 3S1NH 5CR3A 1Q8KA 4EVOA 4B08A 4WFN3 1PTOD 3ITPA 1C9OA 1N36Q 1HNWQ 3OIQA 4ZQ3A 4DV0L 2XRSD 4DV2L 3D6WA 1GUTA 2K14A 5CV6A 1PYBA 3ULPA 2UUAL 3L3OC 5T1GA 4A3IG 2P5ZX 3NEMA 4KN4C 1YHAA 3MXUA 4RMFA 4GOPC 1HR0W 2F1MA 1ONLA 4UDUC 2OTJA 2K5HA 3K81C 1UE7A 5D65A 4ZRZA 4DV7L 1ENFA 1PRTC 3G6JB 5EBDA 1HA5A 5JAVA 3LWUA 3N6RA 4FF2A 2IX1A 3NSWA 4DXGA 1UE1A 4XT3B 3UE0A 2JA7B 2HDLA 1YJNA 3Q23A 5EKKA 5M3MG 2VS1A 1Y69U 2BA1A 3K6OA 2K5QA 1NJIC 1CI3M 3I72A 2DN8A 1SFOH 5C5LA 3ERQA 1HTPA 1VQKA 1U5KA 3U58A 5CV4A 3GTPB 5I9PA 4BS9A 1Q3LA 1HNWL 1A2UA 1SNDA 1PLFA 1XMOL 4FF4A 4ZK9B 1V1PB 3I2ZA 1XWEA 2NVYB 1CSQA 1VQAA 2JP1A 1WTWA 2DUDA 2EYPA 3VYUA 1AN8A 1SMYC 3GTMH 1BO0A 5IGGA 2RKSA 3E6ZX 1VQ8A 3QR8A 4BBSH 1FNWA 4ZKBB 1QILA 2QILA 2DY7A 1YNND 1X9NA 2EXZA 1Z47A 5NUCA 2E2HH 1PZKD 1BCPD 2JA7G 1Q86C 2XTIA 3FEWX 2O4XA 1UAPA 1DOKA 1VQHA 2ZXOA 1EWHA 4JI5Q 4G7OC 1HQRD 1V1OA 4TRDA 5KNDA 1XNRQ 1VQ5A 3W3AA 1CK1A 2C35B 1LT4D 4IO9A 1CQVA 4DR3Q 1KABA 2EY6A 1A3TA 4JI8Q 1PFSA 4XQNA 1VQMA 3GTGB 2VNUD 4ALPA 2OEOA 3T51B 2O5JC 4A3DB 2J0TD 3K7UC 5KNCA 3S14B 3S1RH 2CKZB 4A3JB 2GN5A 4C3HB 3U9SA 2K75A 4IUQA 1HQMC 3URYA 1V9PA 3J80i 3S2DH 3PO3B 1A63A 3S15B 1SE4A 3PUWA 5CC4A 1SYGA 1UE6A 2AWOA 2IPKD 2Q8RE 1N34Q 2R92B 1DGSA 2CWAA 1WTPA 1GOZA 2I5MX 1SMXA 4ME5A 4Y7NB 5TSSA 2RA4A 2HHHL 4LF9Q 2PQAA 3HG9A 1D1KA 3S16B 3SVMA 3AQQA 3M7NA 1PH6A 2V4DA 4NXMQ 4GKJL 4ZCKA 4JI5L 3HOYB 3S1MH 4CJ1B 2K5VA 1XJVA 4DV1Q 4DV3Q 1PRTD 4CKBA 1TWCH 3JC66 5CGKA 5EJWA 4C3IH 4DR3L 4JI8L 3IKJA 4A3DG 5FKAC 4OX9Q 4JI3Q 2XVSA 5EPLA 2LMCB 3K8AA 2XNAC 2NN6H 4RWSC 4A3JG 4KHZA 2UU9Q 4CJ0B 3C46A 4C3HG 5C4JB 1JORA 1QWYA 3IL8A 2ID0A 4I65A 3PIO3 4KI0A 2UXCL 3DXJC 3GO5A 3CRLC 3PO3G 1AE3A 5JJKA 4GLXA 4A75A 3TSSA 4LFBQ 1PYWD 3EVQA 5IT9c 1H9SB 3J81E 3L2PA 1C8CA 1YHBA 4LNQA 1GHJA 1MGSA 2R92G 4PNYA 4APVA 3TP6A 2MHVA 1IZ6A 1N34L 1SNQA 3OWEB 1GVPA 2KENA 5JEAH 2AWNA 3R8BA 4JYAQ 2D0PA 1U4RA 1D6EC 3PF5A 2VUMB 1CHPD 3BZCA 1XMQL 1S4ZA 1C48A 3CCEA 3WOFA 4LF9L 5C0XI 3PUVA 1CKOA 4NP5A 2VQFQ 1BCPF 1SMYD 3HOYG 2NVTH 4Y52H 3CPFA 3BDCA 4EQNA 4DKAC 4B9WA 3T53B 2I46A 4TQUS 3S9WA 1R4QB 3RZDH 3KLSX 2VB2X 5LMNQ 4DV1L 3G7LA 4YWLA 4DUZQ 1G51A 2EZVA 4A4IA 1YI2A 4JOIC 4KJNA 3EJIA 2A1AA 4IJHA 1D1IA 5FK9C 4OIJA 4S3SA 3KOJA 3RLOA 5IP7H 1BDOA 1E1OA 4DR2L 3AMUA 2JA8B 4O42A 4MTNA 4JI7L 4NMZA 3F2BA 1D5XC 2CW0C 3Q0AA 5AJ3Q 2K6AA 5IP9G
chains in the Genus database with same CATH topology
2BH2A 3EBEA 3E9IA 3W1GA 5H1SE 1YITA 2GVBA 1SN8A 2PMZE 1PA6A 2ZTDA 1S40A 1QUQB 3PV0A 3H15A 2MQHA 1LTLA 2UXCQ 4LF4Q 3M3YH 1EQRA 1EWIA 4LFBL 3D31A 1KC8C 1HR0Q 4B3SL 4L5RC 1HZBA 2ES2A 3S17H 1J5EL 4B3RL 1B70B 3FP9A 4GLAC 4DUYQ 2NZOA 3UE1A 3ULLA 1A0IA 3LGJA 3AFPA 5GAHC 1WCMG 3PIOA 4DAYB 2K4KA 1IBKQ 3T1HL 1OXUA 5J3BA 3CP0A 4NB3A 1MKHA 3MEFA 2KHIA 2R7DA 2VUMG 4KLKA 5IWAQ 3S1QH 1P16A 1OXSC 3RLFA 3CF5A 3UDGA 1PH2A 2CCZA 4B3ML 4IJLA 1P8LA 1VQBA 3OW2A 4DR5L 2ZJRA 2YYZA 4YCVA 3I55A 1XMQQ 1LUZA 1I3QH 4R4QA 3PO3H 2VQFL 2H5XA 4A3CG 4LUZA 5LMUL 1NBWA 2K50A 4X62L 3NBHB 1FJGL 4YWMA 5IYBG 3M85A 1VQDA 4YHHQ 1Z9FA 1YJ9A 3W1BA 3HOXG 3S24A 2VQEL 1Q7YC 1X54A 2RCNA 1QVFA 4GKKL 1K8AC 3CAMA 2JA9A 3HOZH 1VS0A 5LMNL 1VQ6A 4DAMA 4YCUA 1T9HA 2E5LQ 1E24A 4A3IH 3BZKA 4DV4Q 2UXDL 2IY5B 5E7NA 4K0KQ 1JT8A 3HOXH 2JQOA 3G71A 5BR8L 3S2HH 3G6EA 3CMAA 3KYHC 4NXNL 2JA8G 1XNQQ 1B7YB 1Y1WH 2D62A 2WB1G 1SRUA 2PQAB 4DR7L 4LF5L 2WB1E 2NN6G 2ZTEA 5M5YH 4DR2Q 3E0EA 4HJ7A 4XIGS 2K5NA 5GADC 1IBML 3KLWA 2E8GA 4IPDA 3A74A 2Q2UA 4JI7Q 1N33L 3KJPA 2CFMA 1KL9A 4X66Q 4IFDG 2EQSA 4X65Q 3T1YL 1PH3A 2MFIA 4POGA 4UY8C 3NENA 3RN5A 2EIFA 2K52A 4A3LG 4IPCA 2CQOA 4R4TA 3UDFA 3A5UA 1D8LA 3TREA 2LXKA 1JJGA 1L2FA 2AKWB 1E3PA 1OXTA 3F8TA 3L0OA 1X55A 3RR5A 4B3TQ 4A3MG 4LF4L 2NVXH 2VL6A 4YWKA 1EOVA 2UXBL 1AE2A 4A3LH 1E1TA 2PI2E 2RHQB 5M3MH 3CCRA 3CW2C 1J5EQ 4B3RQ 2FXQA 3U4ZA 5JEAG 3GTKH 1UE5A 1XPUA 4JV5L 1L1OB 2N3SA 1WI5A 1IBKL 2BA0A 2Z0SA 2E2IH 3I7FA 1IYJB 2VW9A 3T1HQ 3KF8B 3G48A 5IWAL 4OXPA 3HOVH 2ALYB 1I6HH 2I0QA 1N36L 4DV6L 4B3MQ 3H0GG 5DLQE 4UP9A 5HY6A 3CCUA 3CD6A 5IE8A 4JBMA 4DV0Q 3I4NG 4DV2Q 3ERSX 4DR5Q 1IL2A 4FDBA 3ZJYC 4A3FG 2YTXA 4LF7L 3J80c 4A3BH 2Q2IA 2R93G 4L5TA 4LUOA 3KJOA 5JJIA 2LXJA 5LMUQ 2E2JH 2UUAQ 3G4SA 1VQ7A 4QIWE 1FL0A 1VQLA 5GAGC 3U4VA 2QEXA 3CPWA 5JEAJ 3AEVA 3PO2H 4TVAB 4A93H 2OQ0A 2HT1A 4DV5Q 1YVCA 4P74A 4R4OA 2ASBA 4GNXB 4K0KL 3DLLA 4PZ8A 4XTCS 3I4OA 2Y0SE 2B3GA 5C44H 1YZ6A 5M3FH 1X3GA 2JA5H 3KFUA 4A3GG 3M9BA 5IP7G 1N9WA 1VQIA 1HJPA 5IYDG 4JI0L 4IPHA 5BR8Q 1Q12A 1ASZA 1GM5A 1XNQL 3GTLH 4HJ8A 3HOUH 4NXNQ 4DV7Q 3H3VI 3HOZG 2R6GA 2WAQG 1CKMA 3PF4A 3M4PA 4P71A 3CCLA 4BXXH 1TWAH 3HOWH 2WAQE 1MJCA 4LWCA 4BBRG 1IBLQ 4LF5Q 2Q2HA 2JA6G 3I4MH 3L7ZC 3AFQA 4LFCL 1OXXK 2I5LX 4BY1G 2OTLA 3BJUA 2JEAI 3DM3A 4X66L 1N33Q 4X65L 2NN6I 3CXCA 3CQZH 1KQSA 3CC2A 1VQ4A 1PVOA 4POFA 2JA7H 2JA6H 3F2CA 1V1QA 3B6YA 4BY1H 1PH4A 2JE6I 3TRZA 1QZGA 4IPGA 4B3TL 3K0XA 5M5XH 4GS3A 1V43A 1PH8A 4YCWA 1YEZA 4DNIA 3RZOH 1TWHH 4IOAA 1G6PA 2UXBQ 3J7ZC 1K9MC 2JK8A 1TXYA 5FJ8H 5GQOA 1JJCB 4BA1I 4X64L 2IHFA 5M5WH 3CCVA 4HIKA 5HGQA 1WOCA 1PHJA 4R1JA 4JV5Q 4A76A 2QGQA 3S1NH 1BKBA 1Q8KA 1YNXA 1WYDA 2KCMA 1C9OA 1N36Q 1HNWQ 1LYLA 1YHQA 4DV6Q 4DV0L 1B8AA 1W2BA 4DV2L 2Q2TA 4DR6Q 4L5QA 1TWGH 4LF7Q 2K14A 1Y14B 4HIMA 1K73C 1PYBA 2NVYH 3PUZA 3ULPA 2UUAL 4L5SA 1X65A 2ATWA 4A3IG 2YV5A 3ER0A 3NEMA 5K36G 4GOPA 1Q46A 1X6OA 1YHAA 4JI4Q 3I56A 1AH9A 4RMFA 4JBJA 4BY7G 1WFQA 4GOPC 1HZCA 4DV5L 1YJWA 1HR0W 1PH7A 2HQLA 2JJQA 3GTJH 1Y1WG 4LFAL 1X3EA 3NELA 5C0XG 3GTQH 2OTJA 4BY7H 2K5HA 3J81c 3K81C 1UE7A 4HJAA 4JI0Q 1PH9A 4DV7L 2BH8A 4LF6Q 4OWWB 4JCVE 2YTVA 1KXLA 2MO0A 1IBLL 2B63H 1QZHA 2IX1A 4BA2I 2Z6KA 3A0JA 2ZJQA 4YY3L 4RG1A 4LFCQ 2Z6KC 1FGUA 1UE1A 4DR4Q 3RNUA 3HKZG 1D7QA 3UE0A 1CKNA 4X6AH 1JE5A 3HKZE 3PSIA 1YJNA 3BU2A 3ICEA 5ELNA 5M3MG 5IYCH 4JBKA 2VS1A 4PZ6A 2BA1A 3Q8DA 2RHSB 4OWTB 4PZ7A 5C0XJ 3E9HA 4MZ9A 4HIOA 1EQQA 1NJIC 4LF8Q 1XNRL 1VQJA 3CCMA 1NTGA 1W3SA 1KIXA 3EN2A 2IX0A 4A3KH 1SFOH 4QJFA 4X64Q 3HOVG 1WJJA 4AQYQ 4WJ4A 3GTGH 1VQKA 2V1CC 1U5KA 4BXXG 3U58A 2PNHA 1X3FA 4A3DH 4IFDJ 1Q82C 4C3JH 4GLVB 3S14H 4KHPQ 1HNWL 4A3BG 4DK3C 2VZAA 1XMOL 3F2DA 4DR6L 4A3JH 2IT1A 3I2ZA 3TQYA 4HIDA 5EAYA 4A93G 3PO2G 1SR3A 2ZM6Q 1CSQA 1UWVA 1VQAA 3AYHB 2R7ZH 4JI4L 5C44G 2DUDA 5FLMH 5M3FG 1Q81C 3GTMH 1CUKA 3MXNB 1HNZL 2JA5G 3S15H 4OO1G 4ME3A 3JAMc 2R7FA 1SROA 1BBWA 3HOUG 4EQ5A 4JI1Q 1VQ8A 3GD7A 4C2MH 1NY4A 2JEBI 1NMFA 4BBSH 4R4CA 4LFAQ 3GDEA 1PH1A 3HOWG 2I5HA 4LF6L 2XGTA 3M4OH 3I4MG 3PCOB 3J81i 1KRSA 3FKIG 1X9NA 1N8RC 3PUXA 1Z47A 2E2HH 1RIPA 3STBC 3S16H 4JI6Q 2JA7G 1Q86C 1XPOA 3TEHB 1UEBA 2XTIA 1NE3A 4O0AA 4NXML 4YY3Q 3GTOH 3TS2A 3FKIH 3EIVA 1HZ9A 3KDFA 1U0LA 3ULJA 1S3OA 1XPRA 1VQHA 2L15A 4JI5Q 3HOYH 4DV3L 1MIUA 1VQNA 2HIXA 3WWVA 1GKHA 4MNOA 4A3EH 4IFDI 5FJ8G 1PH5A 1HH2P 4LF8L 3K80C 1L0WA 1QUQA 3CCJA 1YIJA 4DR1Q 1XNRQ 3UDXA 2MNAA 3KF6A 5LMNW 1EYGA 1JMCA 2ZJPA 1C7YA 1VQ5A 1SE8A 2C35B 4IO9A 2AMCB 2PI2A 4AIMA 4DR3Q 2RF4A 3PUYA 1JB7A 4JI8Q 1A8VA 1PFSA 4JI3L 4AQYL 1GO3E 1VQMA 4OX9L 3CCQA 4DK6C 2VNUD 4ALPA 1OTCA 2UU9L 2KCTA 1X56A 1VQPA 4P72A 4JG2A 4JI2Q 1A62A 4KHPL 3K7UC 5C4JH 3GTPH 2VY3A 4PMWA 1IXRA 3S1RH 3M4QA 2CKZB 1XMOQ 4GN5A 4H02A 1XTDA 2GN5A 5IP9H 1Y1VH 3FHWA 2K75A 3F1ZA 3KF6B 1EUJA 1O7IA 1MJEA 2ZM6L 4HJ9A 1V9PA 3J80i 3S2DH 1NMGA 4LUVA 3PGZA 1FVIA 2UUCL 1A63A 2UUBL 1YBYA 3TS0A 3PUWA 5IY0A 2KHJA 1R9TH 1HNZQ 1UE6A 1BVSA 2N49A 2AWOA 4JI1L 1Q1BA 3SGIA 3JAMi 1VQOA 3IRBA 4OO1I 1N34Q 1DGSA 4JYAL 1WCMH 2WP8J 1QVCA 2CWAA 4PG3A 4QL5A 5C4XG 5FLXc 2B63G 4P75A 2I5MX 1SMXA 1VQCA 3UDIA 5ELOA 1VQFA 2VUMH 1N32Q 5C3EG 3CC4A 2HHHL 4LF9Q 1SLJA 2KBNA 2PQAA 4DPGA 5C4XH 2AHOB 1K3RA 4JI6L 1I94Q 3OYYA 4UPAA 4DR4L 3AQQA 3M7NA 5C3EH 2ZTCA 4GOPB 1PH6A 5IYCG 4AYBG 2QA4A 4NXMQ 4A3CH 4GKJL 2CWPA 2HIVA 4JI5L 4AYBE 3S1MH 4DUZL 1PYSB 1VQGA 5IYBH 3OTOQ 2K5VA 1XJVA 4JBWA 4DV1Q 4DV3Q 1ASYA 3D0FA 3J81j 4P73A 4A3KG 4NPSA 4DR1L 1TWCH 1HZAA 4AH6A 1VQEA 3H3VH 1K0RA 1HNXL 3RN2A 3JC66 4C3IH 4DR3L 1E22A 4JI8L 2JA8H 4A3DG 1BBUA 1L1OA 1LM0A 1KD1C 1J6QA 1OXVA 4JI3Q 4OX9Q 3CC7A 3K8AA 3RLNA 4QY7A 5AJ3L 4IOCA 1L1OC 2EXDA 1CKNB 4A3JG 4JI2L 2F4VQ 4KHZA 2UU9Q 5GAEC 4JC0A 2GVAA 2MO1A 2ID0A 4KI0A 2UXCL 2R7ZG 3GO5A 1G291 1TWFH 1AE3A 4C3HH 5FLMG 1HR0L 3PO3G 4GLXA 4A75A 5JJKA 2B29A 4LFBQ 5IT9c 4B3SQ 4DUYL 1PV4A 4O2DA 3L2PA 1VQ9A 4A3MH 1YHBA 4QGUA 4BBSG 1E7ZA 2UUCQ 4LNQA 2R92G 1M90C 1M1KC 1CSPA 1I50H 2UUBQ 1K83H 4APVA 1RL2A 1IZ6A 4GNXA 1N34L 1EIFA 1GVPA 2KENA 2AWNA 2R92H 1Q1EA 4JYAQ 3CMEA 2D0PA 4GNXC 3J7A5 1VCIA 4WJ3M 3PF5A 3A5ZB 4Y7NH 3BZCA 1XMQL 1N32L 1GD7A 2YTYA 3U50C 3CCEA 1KHIA 4LF9L 2UXDQ 5C0XI 2OWOA 3PUVA 1CKOA 2VQFQ 2HHHQ 2N78A 1QVGA 5JJLA 3H0GH 2IHEA 3VDYA 1K8GA 1I94L 2DGYA 4X62Q 3HOYG 4YHHL 2NVTH 4Y52H 3I4NH 1FJGQ 3CPFA 2A8VA 4DKAC 4A3FH 2VQEQ 4A3EG 4TQUS 4GKKQ 2R93H 3RZDH 4GN4B 4UP8A 2E5LL 1KAWA 4GKJQ 4DV4L 2YU9H 2Y0SG 5LMNQ 3OTOL 2NVQH 2OCEA 4DV1L 4UP7A 4YWLA 4GN3B 4DUZQ 4JOIA 4LW1A 4J15A 1G51A 4A4IA 1C0AA 1EFWA 1H95A 1YI2A 4JOIC 4HJ5A 2A1AA 4IJHA 1EIYB 2F52A 3W5OA 1I5FA 2OQKA 3HFZB 2D0OA 2N8NA 3STBD 4EX5A 1JJ2A 4OONA 3KOJA 3RLOA 5IP7H 1HNXQ 4A3GH 4QQBX 5IYDH 2WFWA 2NZHA 1E1OA 3K7AH 1KRTA 4DR2L 4DR7Q 1S72A 4OWXB 4MTNA 4JI7L 3HKSA 5GROA 1IBMQ 4R4IA 2LSSA 3F2BA 2F3IA 3KDFB 2F4VL 4BBRH 5AJ3Q 3CCSA 5IP9G 3T1YQ 1Y1VG 3PIPA 2A19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH2 A;  3EBE A;  3E9I A;  3W1G A;  5H1S E;  1YIT A;  2GVB A;  1SN8 A;  2PMZ E;  1PA6 A;  2ZTD A;  1S40 A;  1QUQ B;  3PV0 A;  3H15 A;  2MQH A;  1LTL A;  2UXC Q;  4LF4 Q;  3M3Y H;  1EQR A;  1EWI A;  4LFB L;  3D31 A;  1KC8 C;  1HR0 Q;  4B3S L;  4L5R C;  1HZB A;  2ES2 A;  3S17 H;  1J5E L;  4B3R L;  1B70 B;  3FP9 A;  4GLA C;  4DUY Q;  2NZO A;  3UE1 A;  3ULL A;  1A0I A;  3LGJ A;  3AFP A;  5GAH C;  1WCM G;  3PIO A;  4DAY B;  2K4K A;  1IBK Q;  3T1H L;  1OXU A;  5J3B A;  3CP0 A;  4NB3 A;  1MKH A;  3MEF A;  2KHI A;  2R7D A;  2VUM G;  4KLK A;  5IWA Q;  3S1Q H;  1P16 A;  1OXS C;  3RLF A;  3CF5 A;  3UDG A;  1PH2 A;  2CCZ A;  4B3M L;  4IJL A;  1P8L A;  1VQB A;  3OW2 A;  4DR5 L;  2ZJR A;  2YYZ A;  4YCV A;  3I55 A;  1XMQ Q;  1LUZ A;  1I3Q H;  4R4Q A;  3PO3 H;  2VQF L;  2H5X A;  4A3C G;  4LUZ A;  5LMU L;  1NBW A;  2K50 A;  4X62 L;  3NBH B;  1FJG L;  4YWM A;  5IYB G;  3M85 A;  1VQD A;  4YHH Q;  1Z9F A;  1YJ9 A;  3W1B A;  3HOX G;  3S24 A;  2VQE L;  1Q7Y C;  1X54 A;  2RCN A;  1QVF A;  4GKK L;  1K8A C;  3CAM A;  2JA9 A;  3HOZ H;  1VS0 A;  5LMN L;  1VQ6 A;  4DAM A;  4YCU A;  1T9H A;  2E5L Q;  1E24 A;  4A3I H;  3BZK A;  4DV4 Q;  2UXD L;  2IY5 B;  5E7N A;  4K0K Q;  1JT8 A;  3HOX H;  2JQO A;  3G71 A;  5BR8 L;  3S2H H;  3G6E A;  3CMA A;  3KYH C;  4NXN L;  2JA8 G;  1XNQ Q;  1B7Y B;  1Y1W H;  2D62 A;  2WB1 G;  1SRU A;  2PQA B;  4DR7 L;  4LF5 L;  2WB1 E;  2NN6 G;  2ZTE A;  5M5Y H;  4DR2 Q;  3E0E A;  4HJ7 A;  4XIG S;  2K5N A;  5GAD C;  1IBM L;  3KLW A;  2E8G A;  4IPD A;  3A74 A;  2Q2U A;  4JI7 Q;  1N33 L;  3KJP A;  2CFM A;  1KL9 A;  4X66 Q;  4IFD G;  2EQS A;  4X65 Q;  3T1Y L;  1PH3 A;  2MFI A;  4POG A;  4UY8 C;  3NEN A;  3RN5 A;  2EIF A;  2K52 A;  4A3L G;  4IPC A;  2CQO A;  4R4T A;  3UDF A;  3A5U A;  1D8L A;  3TRE A;  2LXK A;  1JJG A;  1L2F A;  2AKW B;  1E3P A;  1OXT A;  3F8T A;  3L0O A;  1X55 A;  3RR5 A;  4B3T Q;  4A3M G;  4LF4 L;  2NVX H;  2VL6 A;  4YWK A;  1EOV A;  2UXB L;  1AE2 A;  4A3L H;  1E1T A;  2PI2 E;  2RHQ B;  5M3M H;  3CCR A;  3CW2 C;  1J5E Q;  4B3R Q;  2FXQ A;  3U4Z A;  5JEA G;  3GTK H;  1UE5 A;  1XPU A;  4JV5 L;  1L1O B;  2N3S A;  1WI5 A;  1IBK L;  2BA0 A;  2Z0S A;  2E2I H;  3I7F A;  1IYJ B;  2VW9 A;  3T1H Q;  3KF8 B;  3G48 A;  5IWA L;  4OXP A;  3HOV H;  2ALY B;  1I6H H;  2I0Q A;  1N36 L;  4DV6 L;  4B3M Q;  3H0G G;  5DLQ E;  4UP9 A;  5HY6 A;  3CCU A;  3CD6 A;  5IE8 A;  4JBM A;  4DV0 Q;  3I4N G;  4DV2 Q;  3ERS X;  4DR5 Q;  1IL2 A;  4FDB A;  3ZJY C;  4A3F G;  2YTX A;  4LF7 L;  3J80 c;  4A3B H;  2Q2I A;  2R93 G;  4L5T A;  4LUO A;  3KJO A;  5JJI A;  2LXJ A;  5LMU Q;  2E2J H;  2UUA Q;  3G4S A;  1VQ7 A;  4QIW E;  1FL0 A;  1VQL A;  5GAG C;  3U4V A;  2QEX A;  3CPW A;  5JEA J;  3AEV A;  3PO2 H;  4TVA B;  4A93 H;  2OQ0 A;  2HT1 A;  4DV5 Q;  1YVC A;  4P74 A;  4R4O A;  2ASB A;  4GNX B;  4K0K L;  3DLL A;  4PZ8 A;  4XTC S;  3I4O A;  2Y0S E;  2B3G A;  5C44 H;  1YZ6 A;  5M3F H;  1X3G A;  2JA5 H;  3KFU A;  4A3G G;  3M9B A;  5IP7 G;  1N9W A;  1VQI A;  1HJP A;  5IYD G;  4JI0 L;  4IPH A;  5BR8 Q;  1Q12 A;  1ASZ A;  1GM5 A;  1XNQ L;  3GTL H;  4HJ8 A;  3HOU H;  4NXN Q;  4DV7 Q;  3H3V I;  3HOZ G;  2R6G A;  2WAQ G;  1CKM A;  3PF4 A;  3M4P A;  4P71 A;  3CCL A;  4BXX H;  1TWA H;  3HOW H;  2WAQ E;  1MJC A;  4LWC A;  4BBR G;  1IBL Q;  4LF5 Q;  2Q2H A;  2JA6 G;  3I4M H;  3L7Z C;  3AFQ A;  4LFC L;  1OXX K;  2I5L X;  4BY1 G;  2OTL A;  3BJU A;  2JEA I;  3DM3 A;  4X66 L;  1N33 Q;  4X65 L;  2NN6 I;  3CXC A;  3CQZ H;  1KQS A;  3CC2 A;  1VQ4 A;  1PVO A;  4POF A;  2JA7 H;  2JA6 H;  3F2C A;  1V1Q A;  3B6Y A;  4BY1 H;  1PH4 A;  2JE6 I;  3TRZ A;  1QZG A;  4IPG A;  4B3T L;  3K0X A;  5M5X H;  4GS3 A;  1V43 A;  1PH8 A;  4YCW A;  1YEZ A;  4DNI A;  3RZO H;  1TWH H;  4IOA A;  1G6P A;  2UXB Q;  3J7Z C;  1K9M C;  2JK8 A;  1TXY A;  5FJ8 H;  5GQO A;  1JJC B;  4BA1 I;  4X64 L;  2IHF A;  5M5W H;  3CCV A;  4HIK A;  5HGQ A;  1WOC A;  1PHJ A;  4R1J A;  4JV5 Q;  4A76 A;  2QGQ A;  3S1N H;  1BKB A;  1Q8K A;  1YNX A;  1WYD A;  2KCM A;  1C9O A;  1N36 Q;  1HNW Q;  1LYL A;  1YHQ A;  4DV6 Q;  4DV0 L;  1B8A A;  1W2B A;  4DV2 L;  2Q2T A;  4DR6 Q;  4L5Q A;  1TWG H;  4LF7 Q;  2K14 A;  1Y14 B;  4HIM A;  1K73 C;  1PYB A;  2NVY H;  3PUZ A;  3ULP A;  2UUA L;  4L5S A;  1X65 A;  2ATW A;  4A3I G;  2YV5 A;  3ER0 A;  3NEM A;  5K36 G;  4GOP A;  1Q46 A;  1X6O A;  1YHA A;  4JI4 Q;  3I56 A;  1AH9 A;  4RMF A;  4JBJ A;  4BY7 G;  1WFQ A;  4GOP C;  1HZC A;  4DV5 L;  1YJW A;  1HR0 W;  1PH7 A;  2HQL A;  2JJQ A;  3GTJ H;  1Y1W G;  4LFA L;  1X3E A;  3NEL A;  5C0X G;  3GTQ H;  2OTJ A;  4BY7 H;  2K5H A;  3J81 c;  3K81 C;  1UE7 A;  4HJA A;  4JI0 Q;  1PH9 A;  4DV7 L;  2BH8 A;  4LF6 Q;  4OWW B;  4JCV E;  2YTV A;  1KXL A;  2MO0 A;  1IBL L;  2B63 H;  1QZH A;  2IX1 A;  4BA2 I;  2Z6K A;  3A0J A;  2ZJQ A;  4YY3 L;  4RG1 A;  4LFC Q;  2Z6K C;  1FGU A;  1UE1 A;  4DR4 Q;  3RNU A;  3HKZ G;  1D7Q A;  3UE0 A;  1CKN A;  4X6A H;  1JE5 A;  3HKZ E;  3PSI A;  1YJN A;  3BU2 A;  3ICE A;  5ELN A;  5M3M G;  5IYC H;  4JBK A;  2VS1 A;  4PZ6 A;  2BA1 A;  3Q8D A;  2RHS B;  4OWT B;  4PZ7 A;  5C0X J;  3E9H A;  4MZ9 A;  4HIO A;  1EQQ A;  1NJI C;  4LF8 Q;  1XNR L;  1VQJ A;  3CCM A;  1NTG A;  1W3S A;  1KIX A;  3EN2 A;  2IX0 A;  4A3K H;  1SFO H;  4QJF A;  4X64 Q;  3HOV G;  1WJJ A;  4AQY Q;  4WJ4 A;  3GTG H;  1VQK A;  2V1C C;  1U5K A;  4BXX G;  3U58 A;  2PNH A;  1X3F A;  4A3D H;  4IFD J;  1Q82 C;  4C3J H;  4GLV B;  3S14 H;  4KHP Q;  1HNW L;  4A3B G;  4DK3 C;  2VZA A;  1XMO L;  3F2D A;  4DR6 L;  4A3J H;  2IT1 A;  3I2Z A;  3TQY A;  4HID A;  5EAY A;  4A93 G;  3PO2 G;  1SR3 A;  2ZM6 Q;  1CSQ A;  1UWV A;  1VQA A;  3AYH B;  2R7Z H;  4JI4 L;  5C44 G;  2DUD A;  5FLM H;  5M3F G;  1Q81 C;  3GTM H;  1CUK A;  3MXN B;  1HNZ L;  2JA5 G;  3S15 H;  4OO1 G;  4ME3 A;  3JAM c;  2R7F A;  1SRO A;  1BBW A;  3HOU G;  4EQ5 A;  4JI1 Q;  1VQ8 A;  3GD7 A;  4C2M H;  1NY4 A;  2JEB I;  1NMF A;  4BBS H;  4R4C A;  4LFA Q;  3GDE A;  1PH1 A;  3HOW G;  2I5H A;  4LF6 L;  2XGT A;  3M4O H;  3I4M G;  3PCO B;  3J81 i;  1KRS A;  3FKI G;  1X9N A;  1N8R C;  3PUX A;  1Z47 A;  2E2H H;  1RIP A;  3STB C;  3S16 H;  4JI6 Q;  2JA7 G;  1Q86 C;  1XPO A;  3TEH B;  1UEB A;  2XTI A;  1NE3 A;  4O0A A;  4NXM L;  4YY3 Q;  3GTO H;  3TS2 A;  3FKI H;  3EIV A;  1HZ9 A;  3KDF A;  1U0L A;  3ULJ A;  1S3O A;  1XPR A;  1VQH A;  2L15 A;  4JI5 Q;  3HOY H;  4DV3 L;  1MIU A;  1VQN A;  2HIX A;  3WWV A;  1GKH A;  4MNO A;  4A3E H;  4IFD I;  5FJ8 G;  1PH5 A;  1HH2 P;  4LF8 L;  3K80 C;  1L0W A;  1QUQ A;  3CCJ A;  1YIJ A;  4DR1 Q;  1XNR Q;  3UDX A;  2MNA A;  3KF6 A;  5LMN W;  1EYG A;  1JMC A;  2ZJP A;  1C7Y A;  1VQ5 A;  1SE8 A;  2C35 B;  4IO9 A;  2AMC B;  2PI2 A;  4AIM A;  4DR3 Q;  2RF4 A;  3PUY A;  1JB7 A;  4JI8 Q;  1A8V A;  1PFS A;  4JI3 L;  4AQY L;  1GO3 E;  1VQM A;  4OX9 L;  3CCQ A;  4DK6 C;  2VNU D;  4ALP A;  1OTC A;  2UU9 L;  2KCT A;  1X56 A;  1VQP A;  4P72 A;  4JG2 A;  4JI2 Q;  1A62 A;  4KHP L;  3K7U C;  5C4J H;  3GTP H;  2VY3 A;  4PMW A;  1IXR A;  3S1R H;  3M4Q A;  2CKZ B;  1XMO Q;  4GN5 A;  4H02 A;  1XTD A;  2GN5 A;  5IP9 H;  1Y1V H;  3FHW A;  2K75 A;  3F1Z A;  3KF6 B;  1EUJ A;  1O7I A;  1MJE A;  2ZM6 L;  4HJ9 A;  1V9P A;  3J80 i;  3S2D H;  1NMG A;  4LUV A;  3PGZ A;  1FVI A;  2UUC L;  1A63 A;  2UUB L;  1YBY A;  3TS0 A;  3PUW A;  5IY0 A;  2KHJ A;  1R9T H;  1HNZ Q;  1UE6 A;  1BVS A;  2N49 A;  2AWO A;  4JI1 L;  1Q1B A;  3SGI A;  3JAM i;  1VQO A;  3IRB A;  4OO1 I;  1N34 Q;  1DGS A;  4JYA L;  1WCM H;  2WP8 J;  1QVC A;  2CWA A;  4PG3 A;  4QL5 A;  5C4X G;  5FLX c;  2B63 G;  4P75 A;  2I5M X;  1SMX A;  1VQC A;  3UDI A;  5ELO A;  1VQF A;  2VUM H;  1N32 Q;  5C3E G;  3CC4 A;  2HHH L;  4LF9 Q;  1SLJ A;  2KBN A;  2PQA A;  4DPG A;  5C4X H;  2AHO B;  1K3R A;  4JI6 L;  1I94 Q;  3OYY A;  4UPA A;  4DR4 L;  3AQQ A;  3M7N A;  5C3E H;  2ZTC A;  4GOP B;  1PH6 A;  5IYC G;  4AYB G;  2QA4 A;  4NXM Q;  4A3C H;  4GKJ L;  2CWP A;  2HIV A;  4JI5 L;  4AYB E;  3S1M H;  4DUZ L;  1PYS B;  1VQG A;  5IYB H;  3OTO Q;  2K5V A;  1XJV A;  4JBW A;  4DV1 Q;  4DV3 Q;  1ASY A;  3D0F A;  3J81 j;  4P73 A;  4A3K G;  4NPS A;  4DR1 L;  1TWC H;  1HZA A;  4AH6 A;  1VQE A;  3H3V H;  1K0R A;  1HNX L;  3RN2 A;  3JC6 6;  4C3I H;  4DR3 L;  1E22 A;  4JI8 L;  2JA8 H;  4A3D G;  1BBU A;  1L1O A;  1LM0 A;  1KD1 C;  1J6Q A;  1OXV A;  4JI3 Q;  4OX9 Q;  3CC7 A;  3K8A A;  3RLN A;  4QY7 A;  5AJ3 L;  4IOC A;  1L1O C;  2EXD A;  1CKN B;  4A3J G;  4JI2 L;  2F4V Q;  4KHZ A;  2UU9 Q;  5GAE C;  4JC0 A;  2GVA A;  2MO1 A;  2ID0 A;  4KI0 A;  2UXC L;  2R7Z G;  3GO5 A;  1G29 1;  1TWF H;  1AE3 A;  4C3H H;  5FLM G;  1HR0 L;  3PO3 G;  4GLX A;  4A75 A;  5JJK A;  2B29 A;  4LFB Q;  5IT9 c;  4B3S Q;  4DUY L;  1PV4 A;  4O2D A;  3L2P A;  1VQ9 A;  4A3M H;  1YHB A;  4QGU A;  4BBS G;  1E7Z A;  2UUC Q;  4LNQ A;  2R92 G;  1M90 C;  1M1K C;  1CSP A;  1I50 H;  2UUB Q;  1K83 H;  4APV A;  1RL2 A;  1IZ6 A;  4GNX A;  1N34 L;  1EIF A;  1GVP A;  2KEN A;  2AWN A;  2R92 H;  1Q1E A;  4JYA Q;  3CME A;  2D0P A;  4GNX C;  3J7A 5;  1VCI A;  4WJ3 M;  3PF5 A;  3A5Z B;  4Y7N H;  3BZC A;  1XMQ L;  1N32 L;  1GD7 A;  2YTY A;  3U50 C;  3CCE A;  1KHI A;  4LF9 L;  2UXD Q;  5C0X I;  2OWO A;  3PUV A;  1CKO A;  2VQF Q;  2HHH Q;  2N78 A;  1QVG A;  5JJL A;  3H0G H;  2IHE A;  3VDY A;  1K8G A;  1I94 L;  2DGY A;  4X62 Q;  3HOY G;  4YHH L;  2NVT H;  4Y52 H;  3I4N H;  1FJG Q;  3CPF A;  2A8V A;  4DKA C;  4A3F H;  2VQE Q;  4A3E G;  4TQU S;  4GKK Q;  2R93 H;  3RZD H;  4GN4 B;  4UP8 A;  2E5L L;  1KAW A;  4GKJ Q;  4DV4 L;  2YU9 H;  2Y0S G;  5LMN Q;  3OTO L;  2NVQ H;  2OCE A;  4DV1 L;  4UP7 A;  4YWL A;  4GN3 B;  4DUZ Q;  4JOI A;  4LW1 A;  4J15 A;  1G51 A;  4A4I A;  1C0A A;  1EFW A;  1H95 A;  1YI2 A;  4JOI C;  4HJ5 A;  2A1A A;  4IJH A;  1EIY B;  2F52 A;  3W5O A;  1I5F A;  2OQK A;  3HFZ B;  2D0O A;  2N8N A;  3STB D;  4EX5 A;  1JJ2 A;  4OON A;  3KOJ A;  3RLO A;  5IP7 H;  1HNX Q;  4A3G H;  4QQB X;  5IYD H;  2WFW A;  2NZH A;  1E1O A;  3K7A H;  1KRT A;  4DR2 L;  4DR7 Q;  1S72 A;  4OWX B;  4MTN A;  4JI7 L;  3HKS A;  5GRO A;  1IBM Q;  4R4I A;  2LSS A;  3F2B A;  2F3I A;  3KDF B;  2F4V L;  4BBR H;  5AJ3 Q;  3CCS A;  5IP9 G;  3T1Y Q;  1Y1V G;  3PIP A;  2A19 A; 
#chains in the Genus database with same CATH topology
 2D5D A;  1G6Z A;  3OSO A;  2D2C C;  4K5V A;  3W1G A;  1YIT A;  2GVB A;  3QIA A;  2PMZ E;  4JW0 A;  2NVX B;  3H15 A;  2MQH A;  4LFB L;  5I2X A;  3S17 H;  1B70 B;  4GLA C;  3UE1 A;  4QCL A;  3LGJ A;  1DCZ A;  3P7J A;  3TN2 A;  1NCV A;  2PZW A;  2R7D A;  2VUM G;  4KLK A;  5IWA Q;  1GUW A;  1OXS C;  1HUM A;  4R8I A;  2Q8T A;  4B3M L;  1H9K A;  5IOD A;  4I7Z C;  1P8L A;  1R4P B;  3OW2 A;  3NWT A;  4QMG A;  4R4Q A;  1I3Q H;  1S5C D;  2VQF L;  1LO5 D;  4LUZ A;  3H0G B;  1NBW A;  1SYD A;  1VQD A;  4YHH Q;  1F2L A;  5ELB A;  4A3F B;  3S24 A;  1Q7Y C;  1X54 A;  2O2L D;  5LMN L;  1V8Q A;  5FOB B;  1VQ6 A;  2NVQ B;  4YCU A;  1T9H A;  2IY5 B;  4A3I H;  1JT8 A;  1PRT F;  4K0K Q;  3HOX H;  2JQO A;  3S2H H;  2N55 A;  2Y0S B;  1X32 A;  4NXN L;  2EYF A;  2JA8 G;  1XNQ Q;  1B7Y B;  2EPB A;  1SE2 A;  1KDA A;  3K7A B;  4F8M A;  4LF5 L;  1LT5 D;  2ZTE A;  1JWS D;  4MHE A;  3A7L A;  3E0E A;  4XIG S;  2K5N A;  5GAD C;  2GA4 B;  3KLW A;  3SXH A;  4X66 Q;  4BBR B;  1MD2 D;  3VR4 A;  2CH4 A;  5M9O A;  1JC7 A;  5T1I A;  2JYO A;  2EIF A;  2A68 C;  4IPC A;  4JK1 C;  5M5X B;  1OXT A;  1RTO A;  5FO8 B;  4B3T Q;  1SSO A;  4DU9 A;  3K5O A;  4YWK A;  1KNE A;  5M3M H;  2QKI C;  2PZT A;  1J5E Q;  1EWC A;  1UE5 A;  3C1E A;  2B2V C;  1XPU A;  1ML0 D;  4JV5 L;  1WI5 A;  1HTL D;  5IWA L;  2QW7 A;  2I0Q A;  3RD4 A;  2F0H A;  3H0G G;  4HMI A;  1B3A A;  4DR5 Q;  1SEB D;  1IL2 A;  4A3F G;  2YTX A;  4QF4 A;  5I2Y A;  4L5T A;  4LUO A;  1MBY A;  2IL8 A;  4QIW E;  1JWU D;  5GAG C;  2NWG A;  2WKD A;  2EYL A;  2QEX A;  4FP5 D;  5IGD A;  4R4O A;  2K05 A;  4K5W A;  4U67 3;  4GNX B;  4K0K L;  3I91 A;  5JJZ A;  4BY7 B;  1VQI A;  1XNQ L;  2ICE C;  4HJ8 A;  3H3V I;  4BXX H;  4FF3 A;  1STA A;  4LWC A;  4BBR G;  1IBL Q;  4X66 L;  1LTI D;  3CXC A;  1KQS A;  2K01 A;  1EY0 A;  4RA8 A;  2JA7 H;  3D6C A;  2F0Q A;  3TRZ A;  4B3T L;  2F0E A;  1V43 A;  1PH8 A;  1YEZ A;  1I4Q A;  3WOE A;  1K9M C;  2A69 D;  1JJC B;  3OIP A;  2KCN A;  1ZXT A;  2CW0 D;  3GTK B;  3CCV A;  4R1J A;  4A76 A;  3F2U A;  4ODG A;  1T5E A;  4UAI A;  3I90 A;  2A5H A;  4BWG B;  4DV6 Q;  5A2Q E;  4L5Q A;  4X3U A;  4A3B B;  3NE5 B;  2NVY H;  4L5S A;  5FO9 B;  5C3X A;  2ATW A;  5D14 A;  4C1N K;  4GOP A;  1U9R A;  1X6O A;  4A93 B;  3PO2 B;  4BY7 G;  1WFQ A;  4DAP A;  2L0C A;  4WOR A;  2E76 C;  5C44 B;  4LFA L;  1LTG D;  3NEL A;  5C0X G;  3HOU B;  5K5P A;  2YTV A;  3Q22 A;  3QG1 A;  4O1N A;  1TWA B;  3HOW B;  1IBL L;  1QZH A;  1IYU A;  4K6D A;  3FKI B;  4LFC Q;  2Z6K C;  1I4X A;  1S5E D;  4FO2 A;  2JA6 B;  3PSI A;  3I4L A;  3BU2 A;  3ICE A;  2CVR A;  2B2W C;  5E4W C;  4JBK A;  4J6H A;  4LF8 Q;  3E9H A;  1LAC A;  1VQJ A;  4IUN A;  1RKN A;  1W3S A;  2QEJ C;  2B2T C;  5IT9 L;  5CYU A;  2RDF A;  5FO7 B;  1JCK B;  1WJJ A;  4MN3 A;  4KKU A;  4WJ4 A;  3SK8 A;  3GTG H;  2V1C C;  2A68 D;  2PNH A;  1RF2 D;  1X3F A;  4A3D H;  3QWN A;  3S14 H;  4A3B G;  4ID6 A;  4IQZ A;  3F2D A;  1F2M A;  4A3J H;  1TWG B;  4KY6 A;  5EAY A;  4DK1 A;  4A93 G;  3PO2 G;  4KV6 A;  5EKI A;  5C44 G;  3PO3 H;  4OO1 G;  1KAA A;  3MXN B;  4Z9C B;  3BYY B;  3K57 A;  1HNZ L;  1HCZ A;  2EVB A;  3S15 H;  2R7F A;  2HDM A;  3VR3 A;  3IAY A;  3HOU G;  2VB3 X;  3GTJ B;  1NY4 A;  4J8Q A;  4OHJ A;  1HPC A;  1CFM A;  3GTQ B;  3GDE A;  1PH1 A;  3TME A;  3HOW G;  1OO9 B;  2NZ1 D;  3M4O H;  2PW7 A;  2F3V A;  3PCO B;  5KIX A;  3KLR A;  3N52 A;  2H4O A;  3FKI G;  3PUX A;  1I6V C;  1RIP A;  3STB C;  3S16 H;  2A6E C;  5CV7 A;  4DR4 Q;  1NE3 A;  4G57 A;  1HZ9 A;  3KDF A;  3ULJ A;  2WAC A;  1S3O A;  3X3M A;  2L15 A;  3HOY H;  5COY A;  1RDP D;  1VQN A;  3WWV A;  4MNO A;  3SK5 A;  5FJ8 G;  1HH2 P;  4LF8 L;  3CCJ A;  1QUQ A;  1YIJ A;  5DM7 3;  3BDO A;  2MNA A;  5J39 A;  3KF6 A;  1EYG A;  1JMC A;  2XWB B;  2F0N A;  1A3V A;  4AIM A;  1B9M A;  1A8V A;  3J80 E;  3CCQ A;  4DAY A;  4FF1 A;  1PFM A;  4C3J B;  4NW2 A;  4JI2 Q;  5C4J H;  4U68 A;  2VY3 A;  4PMW A;  1BXT A;  1Y8O B;  4H02 A;  1XMO Q;  2A6H C;  3SDZ A;  5IP9 H;  3FHW A;  2RSO A;  3D4R A;  3F1Z A;  3H6M A;  1EFI D;  5KEE A;  5EPK A;  4CHT B;  1B9N A;  1BF4 A;  2R7Z B;  4PV1 C;  1F9S A;  3FMC A;  1WD1 A;  2UUB L;  1YBY A;  2KHJ A;  2OF1 A;  1ET6 A;  1LT3 D;  2N49 A;  3SGI A;  1Q1B A;  4QL5 A;  5C4X G;  5FLX c;  4YIJ A;  1CZG A;  2VUM H;  2LS0 1;  1G2T A;  2J7Z A;  5KNB A;  1SLJ A;  2KBN A;  4DPG A;  1QCB D;  1LTS D;  2MGS A;  2PO4 A;  3P20 A;  1CZW A;  4DR4 L;  1M4V A;  3GTO B;  5C3E H;  2ZTC A;  5ISR A;  1BQQ T;  1PYS B;  1VQG A;  2PQE A;  5HUR A;  2BDO A;  3WDN A;  4JBW A;  2L5T A;  3SE0 A;  3J81 j;  4A3E B;  4P73 A;  3KBG A;  3RMH A;  1EEI D;  4QUC A;  1JOK A;  4C56 C;  1QJO A;  4GZY C;  1GUS A;  4AH6 A;  4R8N A;  1HNX L;  3KBX A;  2M2L A;  3LWE A;  2JA8 H;  3FRP B;  1KLU D;  4C3J G;  3ONA B;  1JQY D;  3I73 A;  1J6Q A;  2K1B A;  4QY7 A;  4FXD A;  3BVG A;  3KF8 A;  2F4V Q;  2LFN A;  1CKN B;  4JI2 L;  1DJR D;  1K8M A;  3VYR A;  1S5F D;  1VF5 C;  3J7Y W;  4JC0 A;  1RD9 D;  1BUV T;  4N8F A;  1Y1V B;  2R7Z G;  1MSG A;  2EY5 A;  5FLM G;  3K59 A;  5JVH 3;  1PV4 A;  1HUN A;  3MXG A;  5D3I B;  1VQ9 A;  3JAM L;  3VYT A;  1EIF A;  1WCM B;  5CV5 A;  3UI2 A;  1Q1E A;  3T13 A;  4GNX C;  3J7A 5;  1K8O A;  1SE3 A;  1VCI A;  4RAU C;  4PQX A;  1E2Z A;  1GD7 A;  2N88 A;  2YTY A;  3U50 C;  1KHI A;  3H91 A;  1DOM A;  2HCI A;  2QDL A;  2HHH Q;  5JJL A;  2R61 A;  3H0G H;  4ULL A;  1K28 A;  3VDY A;  2NTT A;  2A8V A;  1KDB A;  2G9D A;  4A3F H;  1D5Z C;  2VQE Q;  4A3E G;  4GKK Q;  4GKJ Q;  2NVQ H;  2OT2 A;  4IZ8 A;  2MPM A;  4JOI A;  4J15 A;  2SDF A;  1C0A A;  1H95 A;  2XN9 C;  3MA2 B;  5JPM C;  1EIY B;  3W5O A;  1I5F A;  3HFZ B;  3STB D;  1JJ2 A;  2A6E D;  4QQB X;  2A73 B;  3K7A H;  3OPO A;  4LMQ D;  1S72 A;  3HKS A;  1PXU A;  1IBM Q;  2LSS A;  3U9O A;  2F4V L;  4KN7 C;  4BBR H;  3CCS A;  4RKL A;  2DNC A;  3T1Y Q;  1Y1V G;  3PIP A;  4IUP A;  3EBE A;  2XIW A;  3E9I A;  4TSS A;  4FVM A;  3PV0 A;  2UXC Q;  1B4O A;  4LF4 Q;  3D4D A;  1IW7 C;  1EWI A;  1C4Q A;  3D31 A;  3OHX C;  4L5R C;  4B3R L;  4A3M B;  1A0I A;  5GAH C;  1WCM G;  1EY9 A;  1K83 B;  3PIO A;  2K4K A;  2EOT A;  1MKH A;  2KA7 A;  3NQI A;  2KHS A;  3RLF A;  1O7Z A;  1PTO B;  1Q90 A;  2Z4H A;  3BDL A;  3UDG A;  1VMC A;  1ENC A;  1J8I A;  1STG A;  4YCV A;  1XMQ Q;  1LUZ A;  4A3C G;  3MEH A;  5JPN C;  4JVZ A;  3NBH B;  3I4N B;  1B53 A;  4YWM A;  4KMU C;  5IYB G;  1WTX A;  3W1B A;  2VQE L;  4GKK L;  1E0B A;  2R93 B;  1Z7T A;  1K8A C;  1ESF A;  1VS0 A;  2F0S A;  4WJ3 M;  1TS5 A;  5ELF A;  2Z1C A;  3G6E A;  3OMG A;  3CMA A;  1QNK A;  4HSP A;  3AB9 A;  2D62 A;  1H9M A;  3DWA A;  4G7H C;  4A3G B;  1AZQ A;  5C0X H;  3HEJ A;  4DR2 Q;  1UEA B;  1IBM L;  4IPD A;  4CDE C;  4JI7 Q;  3VR6 A;  1RTN A;  2EQS A;  3A8J E;  2K32 A;  3T1Y L;  1B50 A;  4POG A;  4BY1 B;  3RN5 A;  2NYZ D;  4A3L G;  4R4T A;  3A5U A;  3UDF A;  4V19 0;  4IFD H;  4JPB W;  1EQV A;  1L2F A;  2AKW B;  3F8T A;  2PZU A;  3R3O A;  1TWH B;  3RR5 A;  2KCC A;  3I8Z A;  4A3M G;  1V1P A;  5KGU A;  4LF4 L;  2UXB L;  2I07 B;  3CCR A;  2B2V A;  2WKC A;  3CW2 C;  3C3L A;  1II3 A;  3U4Z A;  3GTK H;  4OEM B;  1L1O B;  2N3S A;  3D3R A;  3I7F A;  2VW9 A;  1LAB A;  1LTB D;  4OXP A;  2ALY B;  1I4P A;  1TY0 A;  4B3M Q;  3DMU A;  1STH A;  5DLQ E;  4M1U B;  5JOB A;  5HY6 A;  1X3P A;  2NTS A;  3CD6 A;  3I4N G;  5C4H A;  4LF7 L;  2FHT A;  4A3B H;  2R93 G;  1SNO A;  1F9Q A;  2E2J H;  5COR A;  4RH6 A;  3R2I A;  3VA5 A;  1K3B C;  5JEA J;  3PO2 H;  4A93 H;  2KOL A;  2LY7 A;  1YVC A;  4P74 A;  2ASB A;  1EL0 A;  3DLL A;  2KVM A;  5C44 H;  2Y0S E;  2B3G A;  4OO1 H;  1X3G A;  4A3G G;  3M9B A;  1N9W A;  5IYD G;  4JI0 L;  3K5N A;  1A6X A;  5G3L D;  5HGT A;  3HOU H;  1GUG A;  3SK6 A;  1Y1W B;  4NXN Q;  2RCF A;  1CKM A;  1ROD A;  3M4P A;  1TWA H;  3HOW H;  1G2S A;  1MJC A;  1TY2 A;  4LF5 Q;  2Q2H A;  3L7Z C;  4BY1 G;  1UUP A;  3MFG A;  5CV8 A;  4M8A A;  2NN6 I;  4L8J A;  2JA6 H;  4Q5V A;  3F2C A;  3B6Y A;  1PH4 A;  2JE6 I;  1IYV A;  1QZG A;  3HKZ B;  5IGB A;  2PPB C;  4YCW A;  4DNI A;  2JK8 A;  1TXY A;  5FJ8 H;  4FXK C;  5GQO A;  4BA1 I;  4X64 L;  1DYQ A;  1IHZ A;  1HHV A;  1ET9 A;  5M5W H;  4HIK A;  3T16 A;  4HMJ A;  3TZU A;  4JV5 Q;  4E6I A;  2O5I C;  2QGQ A;  1BKB A;  4XYO A;  1I6H B;  2FFK B;  5FLX L;  1LYL A;  2C9O A;  1FNV A;  2XRQ D;  1STN A;  1W2B A;  4DR6 Q;  1TWG H;  4IUU A;  1Y14 B;  1WD0 A;  3PUZ A;  2KEC A;  1X65 A;  5I6Y A;  3QO2 A;  5J22 A;  2CQA A;  3ER0 A;  5IGE A;  5K36 G;  1Q46 A;  4JI4 Q;  3I56 A;  4JBJ A;  2F0I A;  1YJW A;  3K5L A;  2JJQ A;  5M3F B;  3GTJ H;  1Y1W G;  4QUF A;  3GTQ H;  1TS3 A;  3J81 c;  4H0L C;  4LF6 Q;  4K8J A;  5CBA E;  2KJX A;  2MO0 A;  4HR7 B;  4BA2 I;  2Z6K A;  3I4M B;  2ZJQ A;  4YY3 L;  1FGU A;  1D7Q A;  3CQZ B;  3HKZ G;  3QJY A;  1MSH A;  2B2W A;  1SYF A;  5ELN A;  3W2D A;  1RJT A;  1EIG A;  1TU2 B;  4KD4 A;  3RZO B;  3Q8D A;  2B2T A;  1EQQ A;  4MZ9 A;  4HIO A;  4TKO B;  3CCM A;  1NTG A;  5C5M A;  3SHL A;  1H9S A;  1KIX A;  3OWF A;  3EN2 A;  1L0X B;  2IX0 A;  4DFA A;  4QJF A;  2AQ3 B;  3DEO A;  5E4X A;  3NUC A;  4KY7 A;  4CDF C;  4C3J H;  2KEE A;  2HQE A;  2NB0 A;  3LNN A;  3S1R B;  2BDN A;  5BN4 A;  3KUP A;  4DR6 L;  2BE5 C;  2IT1 A;  3I70 A;  1SJE D;  4EQO A;  2R7Z H;  4JI4 L;  5FLM H;  5M3F G;  1Q81 C;  3JAM c;  4RHR A;  1SRO A;  3ND9 A;  1AFP A;  4G7Z C;  4JI1 Q;  5D3D A;  2SOB A;  2JEB I;  4R4C A;  4LFA Q;  5G3L F;  1J9O A;  2F3W A;  4LF6 L;  2FMC A;  1EYC A;  1GUN A;  1W6K A;  3I4M G;  3J81 i;  1KRS A;  2B63 B;  2K7V A;  1NR4 A;  2F0O A;  4ZAI A;  4X3K A;  1XPO A;  3TEH B;  1UEB A;  4O0A A;  3GTO H;  1JOQ A;  2B2U C;  4XQJ A;  1CQF A;  4Q0F A;  3K58 A;  3S1M B;  5DM6 3;  3TDQ A;  1MIU A;  4AYB B;  1GKH A;  4A3E H;  4RGT A;  4DNT B;  1PH5 A;  3HS0 C;  1TWC B;  5F2D A;  3UDX A;  5LMN W;  3J7A F;  1HFN A;  3DM1 A;  3CKI B;  4A3K B;  3PUY A;  1LT6 D;  1JB7 A;  3ERO A;  1GO3 E;  4DK6 C;  2JSO A;  2F0M A;  2KCT A;  3CU7 A;  4JG2 A;  3FDT A;  1A62 A;  1LV9 A;  3MTS A;  1SAP A;  3GTP H;  2AQ2 B;  3C1F A;  1PTO C;  3VR2 A;  1Y1V H;  1Y8N B;  4WRD A;  3KF6 B;  1EUJ A;  5BN3 A;  1O7I A;  2RDG A;  1MJE A;  2AUK A;  2UUC L;  4L63 B;  2RBM A;  5IY0 A;  2EY2 A;  1HNZ Q;  1BVS A;  3MHB A;  4HED A;  4JI1 L;  3MFY A;  3JAM i;  3BG3 A;  2ZXR A;  3FPP A;  4C2M B;  1WTH A;  3DHQ A;  4L6T B;  1WCM H;  2WP8 J;  1QVC A;  4PG3 A;  2B63 G;  3UDI A;  5ELO A;  2L55 A;  3OW7 A;  1DXM A;  1N32 Q;  2C5C A;  3CC4 A;  2F0P A;  1K3R A;  2X6G A;  3OYY A;  1JE4 A;  2L4N A;  4DA2 A;  5IYC G;  2ENB A;  4AYB G;  4A3C H;  1SYB A;  3VR5 A;  5IYB H;  1SXT A;  4LAA A;  1SDF A;  1EY8 A;  4A3K G;  4NPS A;  4H44 C;  1VQE A;  4RFB A;  1K0R A;  4WJW A;  3RN2 A;  1ICF B;  1E22 A;  2ICI A;  3K0Y A;  1LM0 A;  1KD1 C;  1OXV A;  1STY A;  4DGZ A;  4XDX A;  3I3C A;  4IOC A;  1L1O C;  5GAE C;  4KJO A;  4CKC A;  4HCE A;  3BVZ A;  3J7A V;  1GXD C;  1G29 1;  4C3H H;  1G91 A;  1HR0 L;  2EYH A;  2B29 A;  4DUY L;  3CRK C;  4EGV A;  4O2D A;  2EJG C;  4A3M H;  3QOJ A;  2F0W A;  4QGU A;  1R9T B;  1F77 A;  1M90 C;  2UUB Q;  1K83 H;  5C6A A;  4GNX A;  1CM9 A;  3PQI A;  5EKL A;  2R92 H;  4K2L A;  2BE5 D;  5I9O A;  1PTO H;  3CME A;  3D8G A;  5J1Z A;  3A5Z B;  4Y7N H;  1N32 L;  1U4P A;  5C4X B;  1TS4 A;  1Y8P B;  2N78 A;  1QVG A;  2IHE A;  2J4X A;  1K8G A;  2DGY A;  4X62 Q;  1T5X D;  1FJG Q;  3I4N H;  5CMD A;  3HGB A;  1EU4 A;  4MTK A;  2R93 H;  3GQB A;  2PYK A;  4GN4 B;  4UP8 A;  2E5L L;  1KAW A;  4DV4 L;  1WVL A;  2OCE A;  3HOX B;  4GN3 B;  1QNU A;  1EFW A;  2MUY A;  1PFB A;  4DNR B;  2F52 A;  3DEP A;  2D0O A;  4OON A;  4A3G H;  1HNX Q;  5IYD H;  2WFW A;  3NBI A;  4DR7 Q;  1EY4 A;  4OWX B;  2WB1 B;  4R4I A;  3HRZ C;  1KDC A;  2F3I A;  2RDH A;  3EFX D;  2EY1 A;  4KTA A;  4LK1 C;  1EOT A;  1YNJ C;  3AU7 A;  1SN8 A;  2ZTD A;  1TWF B;  3PMF A;  2KQ3 A;  1AEX A;  1D2B A;  1KC8 C;  5ELD A;  1JWM D;  2ES2 A;  2WII B;  3HP3 A;  2Z6B A;  3ULL A;  4KKS A;  1I50 B;  1JOO A;  1IBK Q;  3T1H L;  2K33 A;  3CP0 A;  4FYD A;  1SJH D;  2KHI A;  3MEF A;  2EE1 A;  4K2K A;  2E75 C;  1ZEQ X;  3CF5 A;  3EQL C;  1PH2 A;  3HZX A;  5EBC A;  3J81 L;  2TSS A;  4FXG C;  1VQB A;  3A54 A;  2ZJR A;  3I55 A;  1EEF D;  1TQO A;  1W6J A;  5EQ0 A;  3K5M A;  5LMU L;  3OOC A;  2PNR C;  4X62 L;  1L0Y B;  5IGC A;  1FJG L;  4CKE A;  1SYC A;  3KLS A;  1Z9F A;  3HOX G;  1HA6 A;  3BYT B;  1TKW B;  2JA9 A;  2YU9 B;  3KK7 A;  1E24 A;  3BZK A;  2UXD L;  2CH4 W;  1TS2 A;  5K36 H;  5CBE E;  2RVL A;  2XSC A;  1ICW A;  4ILW A;  3G71 A;  5BR8 L;  1BNZ A;  3KYH C;  2PW5 A;  4DN4 M;  1Y1W H;  2WB1 G;  1SRU A;  2PQA B;  3GV6 A;  4DR7 L;  1ENA A;  4HJ7 A;  2HUG A;  2WAQ B;  4DXF A;  1N33 L;  3R93 A;  2CFM A;  2ZXP A;  2B2Y C;  4ZUI A;  1FGB D;  1PH3 A;  1B44 D;  2CQO A;  1O78 A;  1D8L A;  3TRE A;  5DAU A;  1E3P A;  2FMM A;  3D4W A;  2NVX H;  2VL6 A;  3M3Y B;  4RGO S;  2IX3 A;  1E1T A;  1O7Y A;  2BOS A;  2PI2 E;  5DNF A;  1WTV A;  1O80 A;  3A55 A;  1EY6 A;  4G4K A;  3BZD B;  3M4Y A;  3RUZ A;  4B3R Q;  2FXQ A;  3IFD A;  1F9R A;  3MXN A;  1IBK L;  1IYJ B;  3NTK A;  3G48 A;  3S1Q B;  3A7A B;  2X69 A;  1AW7 A;  1I6H H;  5KYI A;  1PDQ A;  1N36 L;  3NK9 A;  1LTA D;  4IN3 A;  3CCU A;  2KED A;  3NHH A;  5IE8 A;  4JBM A;  3ERS X;  4FDB A;  1QOH A;  3ZJY C;  3J80 c;  2L9H A;  1VQL A;  3U4V A;  3HOZ B;  3CPW A;  3E0J A;  4DV5 Q;  1BBX C;  4PZ8 A;  4XTC S;  5M3F H;  3KFU A;  4BXX G;  1KTK A;  2KUM A;  1HJP A;  4IPH A;  1NR2 A;  1GM5 A;  2R6G A;  1F2Y A;  2WAQ G;  3CCL A;  1PMR A;  5M5Y B;  2VXW A;  3I4M H;  3AFQ A;  2OTL A;  2JEA I;  3DM3 A;  5IT9 E;  2M9V A;  4MIU A;  3GV3 A;  3CQZ H;  1VQ4 A;  4POF A;  2F4I A;  2K28 A;  1HFG A;  1UNS A;  4IPG A;  4IUR A;  1F9P A;  3K0X A;  5M5X H;  1XXG A;  3TP5 A;  4GS3 A;  1G6P A;  1EU3 A;  3RZO H;  1STB A;  1I4R A;  2UXB Q;  4K8I A;  2QF7 A;  1A3U A;  1GHK A;  4IUT A;  1H9R A;  2SNS A;  2R3Z A;  2Z4I A;  1WOC A;  5HGQ A;  2E2I B;  2JXM B;  1TII D;  2EJF C;  4X3T A;  2G5D A;  1O7L A;  2F0V A;  1CHQ D;  1PTO F;  1YNJ D;  1YNX A;  3HOV B;  1WYD A;  2KCM A;  2A6H D;  1YHQ A;  3O13 A;  1B8A A;  2Q2T A;  1LTR D;  4LF7 Q;  1CTM A;  2G9H D;  4ABN A;  4HIM A;  1K73 C;  3HOZ G;  2YV5 A;  4CBV A;  1SBB B;  4P2C B;  1AH9 A;  2F0D A;  1HZC A;  4DV5 L;  1PH7 A;  2HQL A;  4H13 C;  3NTH A;  4CJ2 C;  2JA5 B;  1X3E A;  3CHB D;  1IL8 A;  4BY7 H;  3GTL B;  4JI0 Q;  4HJA A;  3M4O B;  1PH9 A;  2BH8 A;  1U4L A;  4KY5 A;  4OWW B;  4JCV E;  1BOS A;  2B63 H;  1F2Z A;  5C4Z A;  1MI2 A;  2EYO A;  3A0J A;  1BR9 A;  4RG1 A;  5CV9 A;  1JB3 A;  1WTQ A;  3RNU A;  1CKN A;  2SEB D;  4X6A H;  2QCP X;  1JE5 A;  3HKZ E;  1LLR D;  2L1B A;  3FVQ A;  3QOL A;  5IYC H;  4PZ6 A;  1H9J A;  1LTT D;  4OWT B;  2RHS B;  4PZ7 A;  5C0X J;  1XNR L;  1EYA A;  1Z6H A;  1NNX A;  3PIP 3;  3SEB A;  4A3K H;  4X64 Q;  2K04 A;  2EDG A;  4N9P A;  3HOV G;  4AQY Q;  2DJF C;  3S1N B;  2IJ0 A;  4IFD J;  1Q82 C;  4GLV B;  4KHP Q;  4RKB A;  4DK3 C;  2VZA A;  4K5X A;  3TZD A;  4CDD C;  4ZLT F;  3TQY A;  4HID A;  4IUV A;  5BN5 A;  1SR3 A;  2ZM6 Q;  1UWV A;  3MAQ A;  3AYH B;  2FIN B;  4HCS A;  1EQT A;  1CUK A;  2JA5 G;  2Z8L A;  4ME3 A;  4DK0 A;  4N8X 1;  5IIF A;  1BBW A;  4EQ5 A;  4OIK A;  5A2Q L;  3GD7 A;  4C2M H;  1NMF A;  4RHS A;  1E2W A;  4RCN A;  4XYQ A;  2I5H A;  3NPP A;  1GJX A;  2XGT A;  1N8R C;  3H3V C;  2B2U A;  4JI6 Q;  3V05 A;  1BCP B;  3OMC A;  4CGY B;  5C3E B;  3QB3 A;  4LJZ C;  4IAL A;  2HCC A;  2ZT9 C;  4YY3 Q;  4NXM L;  3TS2 A;  3FKI H;  3EIV A;  1DZ1 A;  1XPR A;  1U0L A;  4N9T A;  4ZKC B;  3VYS A;  4DV3 L;  2DY8 A;  1TVX A;  1A2T A;  3T4A C;  2HIX A;  4IFD I;  1E2V A;  3K80 C;  4ZUJ A;  1L0W A;  4DR1 Q;  5KYL A;  2ZJP A;  1C7Y A;  1SE8 A;  3M7G A;  2AMC B;  2AUJ D;  2F0J A;  2IW3 A;  2PI2 A;  2RF4 A;  1SFO B;  1KLG D;  4OX9 L;  4JI3 L;  4AQY L;  2A69 C;  1QG7 A;  1OTC A;  2LKV A;  1RCV D;  2UU9 L;  1X56 A;  1VQP A;  1I4H A;  2M00 A;  4P72 A;  2H1E A;  4KHP L;  3MC0 B;  3Q6S A;  1G8Z D;  1IKL A;  3JAM E;  2RQX A;  1IXR A;  3M4Q A;  1IW7 D;  4GN5 A;  4J1M A;  1XTD A;  3TP7 A;  1JR0 D;  2ZM6 L;  3E3X A;  4HJ9 A;  3NBH A;  1NMG A;  4LUV A;  3PGZ A;  1FVI A;  4NDX A;  4CDC C;  3GTM B;  4KKT A;  2F0L A;  3TS0 A;  1R9T H;  3X3N A;  2A74 C;  4X3S A;  1XTC D;  2NUC A;  1VQO A;  3IRB A;  4OO1 I;  4BBS B;  4JYA L;  4C1N I;  1DOL A;  4P75 A;  1VQC A;  1CA6 A;  1VQF A;  5C3E G;  5EPJ A;  2D9U A;  5KRU A;  5C4X H;  3DWP A;  2E2H B;  2AHO B;  1ILP A;  4RCO A;  4JI6 L;  2K5W A;  1I94 Q;  4F7X A;  4UPA A;  1X3Q A;  3VA7 A;  4GOP B;  2QA4 A;  2FJ2 A;  2CWP A;  2HIV A;  1MHW C;  4AYB E;  4DUZ L;  1NAP A;  3OTO Q;  4V0B A;  1ASY A;  3D0F A;  1PRT B;  3P75 A;  5LL6 X;  4DR1 L;  1WTR A;  1HZA A;  3H3V H;  1EY5 A;  1EIH A;  4EQP A;  1S5B D;  1ZYR C;  4NKL A;  1JIC A;  1BBU A;  3A8I E;  4H7B A;  3NP8 A;  2F0T A;  1L1O A;  2HD3 A;  3CC7 A;  2MP1 A;  3RLN A;  5AJ3 L;  2EXD A;  3BS1 A;  5AFW A;  1SYE A;  1ILQ A;  1QE6 A;  2X6L A;  2TMP A;  4F88 A;  2GVA A;  2MO1 A;  2IWH A;  1TWF H;  2PMZ B;  3J80 L;  4B3S Q;  1GUO A;  3S2D B;  4BBS G;  1E7Z A;  2UUC Q;  1M1K C;  1CSP A;  1I50 H;  1RL2 A;  4K6L A;  1FD7 D;  3MZ5 A;  1U4M A;  1TT2 A;  2OWO A;  1K0S A;  1SNC A;  1I94 L;  1DM0 B;  4YHH L;  4B9X A;  2WV6 D;  5I6W A;  4XQQ A;  3A56 A;  1B1Z A;  2YU9 H;  2Y0S G;  3OTO L;  4UP7 A;  1TR5 A;  2F03 A;  4LW1 A;  3ZYY X;  1DD2 A;  2MJ8 A;  3Q24 A;  2OXP A;  3LX0 A;  4HJ5 A;  4K14 A;  3NWS A;  2OQK A;  2N8N A;  2Z9H A;  4EX5 A;  5I4D A;  4C3I B;  1SNM A;  2AQ1 B;  1DON A;  1KRT A;  2NZH A;  3ND8 A;  5LL6 S;  3H94 A;  5GRO A;  1EYD A;  3KDF B;  2F0K A;  1EZ6 A;  3DUZ A;  2A19 A;  3IFT A;  2BH2 A;  1KNA A;  5H1S E;  1PA6 A;  1S40 A;  1QUQ B;  1WTO A;  1CT1 D;  1LTL A;  2BCO A;  3M3Y H;  1EQR A;  1KXL A;  4B3S L;  1HR0 Q;  1PZI D;  1HZB A;  3DWQ A;  1J5E L;  4PMB A;  3FP9 A;  4DUY Q;  2L11 A;  2NZO A;  4R9W A;  3AFP A;  3TP8 A;  3L9A X;  4ZYS A;  4DAY B;  1OXU A;  5J3B A;  4NB3 A;  4XXE A;  2WIN B;  3S1Q H;  1Q8I A;  1P16 A;  2CCZ A;  2B8G A;  4IJL A;  1B2T A;  5C3W A;  1VF7 A;  1EY7 A;  3TBI B;  4DR5 L;  1EZ8 A;  2DNE A;  2YYZ A;  3NQT A;  4DF7 A;  1ESR A;  2H5X A;  2E74 C;  2Q8I B;  2E2J B;  2K50 A;  4HN7 A;  2NVT B;  3M85 A;  1YJ9 A;  1VMP A;  2RCN A;  1QVF A;  4QIW B;  3CAM A;  3RZD B;  3GP7 A;  3HOZ H;  4RGM A;  1S5D D;  2CHB D;  4DAM A;  4DAV A;  2E5L Q;  5JVG 3;  4DV4 Q;  1D5M C;  5E7N A;  1NUC A;  5LHY 1;  5L37 A;  1RHP A;  4C3I G;  2L12 A;  1PZJ D;  3H09 A;  1NSN S;  3A8K E;  1STE A;  2B8F A;  4XT1 B;  4OEL B;  3E5S A;  2WB1 E;  2NN6 G;  5M5Y H;  2B2Y A;  4HTH A;  2E8G A;  3A74 A;  2Q2U A;  5IOC A;  3KJP A;  3V96 A;  5ELC A;  1KL9 A;  4IFD G;  4FNF A;  2QDB A;  3MVV A;  1IKM A;  4X65 Q;  2MFI A;  5E3F A;  1CA5 A;  4UY8 C;  3T56 B;  3NEN A;  2K52 A;  2EYM A;  3SR1 A;  2LXK A;  4I7A A;  1JJG A;  1FYC A;  3L0O A;  1X55 A;  4QB4 A;  5IGF A;  4KK7 A;  1ZYR D;  1EOV A;  1AE2 A;  1HXY D;  4A3L H;  2RHQ B;  5FLX E;  3S17 B;  2F0G A;  3R2T A;  1FR3 A;  2NBF A;  5M5W B;  1XX8 A;  5JEA G;  4HAE A;  5E1F A;  3NXW A;  2BA0 A;  2Z0S A;  5DEH A;  2EYJ A;  2E2I H;  3T1H Q;  2JN4 A;  3KF8 B;  5EGT A;  4OL7 A;  3C2P A;  1FNU A;  3HOV H;  1AZP A;  4DV6 L;  1A15 A;  2B39 A;  4UP9 A;  1HRJ A;  4DV0 Q;  1I3Q B;  1B3Q A;  4DV2 Q;  3BVM A;  1PFN A;  5ELE A;  3MWY W;  2Q2I A;  3KJO A;  5JJI A;  2LXJ A;  5LMU Q;  2UUA Q;  3G4S A;  1VQ7 A;  1I4G A;  1FL0 A;  1YNN C;  3EA6 A;  4KHV A;  4F87 A;  1BCP C;  3AEV A;  4TVA B;  2OQ0 A;  4UHV A;  4A3I B;  2HT1 A;  1SNP A;  3FPU B;  1XYI A;  2UXD Q;  3I4O A;  2DJG C;  1QB5 D;  1YZ6 A;  2JA5 H;  1AP0 A;  3S2H B;  5IP7 G;  5BR8 Q;  1ASZ A;  1Q12 A;  3GTL H;  2SNM A;  4DV7 Q;  1ZKO A;  2XWJ B;  3PF4 A;  4P71 A;  2E2D C;  2WAQ E;  4PMC A;  2K03 A;  2JA6 G;  4LFC L;  3V2T A;  1OXX K;  2I5L X;  2PCF B;  3BJU A;  3NTI A;  4RGN A;  1N33 Q;  2F0F A;  4X65 L;  3CC2 A;  1PVO A;  1V1Q A;  3P1H A;  4BY1 H;  3SK4 A;  4KD3 A;  4HSV A;  1TWH H;  4IOA A;  5M3M B;  4OGQ C;  3J7Z C;  3MXP A;  2F0U A;  1VDZ A;  2EJM A;  2IHF A;  2K5D A;  1M8A A;  2RSN A;  1PHJ A;  5A35 A;  3S1N H;  5CR3 A;  1Q8K A;  4EVO A;  4B08 A;  4WFN 3;  1PTO D;  3ITP A;  1C9O A;  1N36 Q;  1HNW Q;  3OIQ A;  4ZQ3 A;  4DV0 L;  2XRS D;  4DV2 L;  3D6W A;  1GUT A;  2K14 A;  5CV6 A;  1PYB A;  3ULP A;  2UUA L;  3L3O C;  5T1G A;  4A3I G;  2P5Z X;  3NEM A;  4KN4 C;  1YHA A;  3MXU A;  4RMF A;  4GOP C;  1HR0 W;  2F1M A;  1ONL A;  4UDU C;  2OTJ A;  2K5H A;  3K81 C;  1UE7 A;  5D65 A;  4ZRZ A;  4DV7 L;  1ENF A;  1PRT C;  3G6J B;  5EBD A;  1HA5 A;  5JAV A;  3LWU A;  3N6R A;  4FF2 A;  2IX1 A;  3NSW A;  4DXG A;  1UE1 A;  4XT3 B;  3UE0 A;  2JA7 B;  2HDL A;  1YJN A;  3Q23 A;  5EKK A;  5M3M G;  2VS1 A;  1Y69 U;  2BA1 A;  3K6O A;  2K5Q A;  1NJI C;  1CI3 M;  3I72 A;  2DN8 A;  1SFO H;  5C5L A;  3ERQ A;  1HTP A;  1VQK A;  1U5K A;  3U58 A;  5CV4 A;  3GTP B;  5I9P A;  4BS9 A;  1Q3L A;  1HNW L;  1A2U A;  1SND A;  1PLF A;  1XMO L;  4FF4 A;  4ZK9 B;  1V1P B;  3I2Z A;  1XWE A;  2NVY B;  1CSQ A;  1VQA A;  2JP1 A;  1WTW A;  2DUD A;  2EYP A;  3VYU A;  1AN8 A;  1SMY C;  3GTM H;  1BO0 A;  5IGG A;  2RKS A;  3E6Z X;  1VQ8 A;  3QR8 A;  4BBS H;  1FNW A;  4ZKB B;  1QIL A;  2QIL A;  2DY7 A;  1YNN D;  1X9N A;  2EXZ A;  1Z47 A;  5NUC A;  2E2H H;  1PZK D;  1BCP D;  2JA7 G;  1Q86 C;  2XTI A;  3FEW X;  2O4X A;  1UAP A;  1DOK A;  1VQH A;  2ZXO A;  1EWH A;  4JI5 Q;  4G7O C;  1HQR D;  1V1O A;  4TRD A;  5KND A;  1XNR Q;  1VQ5 A;  3W3A A;  1CK1 A;  2C35 B;  1LT4 D;  4IO9 A;  1CQV A;  4DR3 Q;  1KAB A;  2EY6 A;  1A3T A;  4JI8 Q;  1PFS A;  4XQN A;  1VQM A;  3GTG B;  2VNU D;  4ALP A;  2OEO A;  3T51 B;  2O5J C;  4A3D B;  2J0T D;  3K7U C;  5KNC A;  3S14 B;  3S1R H;  2CKZ B;  4A3J B;  2GN5 A;  4C3H B;  3U9S A;  2K75 A;  4IUQ A;  1HQM C;  3URY A;  1V9P A;  3J80 i;  3S2D H;  3PO3 B;  1A63 A;  3S15 B;  1SE4 A;  3PUW A;  5CC4 A;  1SYG A;  1UE6 A;  2AWO A;  2IPK D;  2Q8R E;  1N34 Q;  2R92 B;  1DGS A;  2CWA A;  1WTP A;  1GOZ A;  2I5M X;  1SMX A;  4ME5 A;  4Y7N B;  5TSS A;  2RA4 A;  2HHH L;  4LF9 Q;  2PQA A;  3HG9 A;  1D1K A;  3S16 B;  3SVM A;  3AQQ A;  3M7N A;  1PH6 A;  2V4D A;  4NXM Q;  4GKJ L;  4ZCK A;  4JI5 L;  3HOY B;  3S1M H;  4CJ1 B;  2K5V A;  1XJV A;  4DV1 Q;  4DV3 Q;  1PRT D;  4CKB A;  1TWC H;  3JC6 6;  5CGK A;  5EJW A;  4C3I H;  4DR3 L;  4JI8 L;  3IKJ A;  4A3D G;  5FKA C;  4OX9 Q;  4JI3 Q;  2XVS A;  5EPL A;  2LMC B;  3K8A A;  2XNA C;  2NN6 H;  4RWS C;  4A3J G;  4KHZ A;  2UU9 Q;  4CJ0 B;  3C46 A;  4C3H G;  5C4J B;  1JOR A;  1QWY A;  3IL8 A;  2ID0 A;  4I65 A;  3PIO 3;  4KI0 A;  2UXC L;  3DXJ C;  3GO5 A;  3CRL C;  3PO3 G;  1AE3 A;  5JJK A;  4GLX A;  4A75 A;  3TSS A;  4LFB Q;  1PYW D;  3EVQ A;  5IT9 c;  1H9S B;  3J81 E;  3L2P A;  1C8C A;  1YHB A;  4LNQ A;  1GHJ A;  1MGS A;  2R92 G;  4PNY A;  4APV A;  3TP6 A;  2MHV A;  1IZ6 A;  1N34 L;  1SNQ A;  3OWE B;  1GVP A;  2KEN A;  5JEA H;  2AWN A;  3R8B A;  4JYA Q;  2D0P A;  1U4R A;  1D6E C;  3PF5 A;  2VUM B;  1CHP D;  3BZC A;  1XMQ L;  1S4Z A;  1C48 A;  3CCE A;  3WOF A;  4LF9 L;  5C0X I;  3PUV A;  1CKO A;  4NP5 A;  2VQF Q;  1BCP F;  1SMY D;  3HOY G;  2NVT H;  4Y52 H;  3CPF A;  3BDC A;  4EQN A;  4DKA C;  4B9W A;  3T53 B;  2I46 A;  4TQU S;  3S9W A;  1R4Q B;  3RZD H;  3KLS X;  2VB2 X;  5LMN Q;  4DV1 L;  3G7L A;  4YWL A;  4DUZ Q;  1G51 A;  2EZV A;  4A4I A;  1YI2 A;  4JOI C;  4KJN A;  3EJI A;  2A1A A;  4IJH A;  1D1I A;  5FK9 C;  4OIJ A;  4S3S A;  3KOJ A;  3RLO A;  5IP7 H;  1BDO A;  1E1O A;  4DR2 L;  3AMU A;  2JA8 B;  4O42 A;  4MTN A;  4JI7 L;  4NMZ A;  3F2B A;  1D5X C;  2CW0 C;  3Q0A A;  5AJ3 Q;  2K6A A;  5IP9 G; 
#chains in the Genus database with same CATH homology
 2BH2 A;  3EBE A;  3E9I A;  3W1G A;  5H1S E;  1YIT A;  2GVB A;  1SN8 A;  2PMZ E;  1PA6 A;  2ZTD A;  1S40 A;  1QUQ B;  3PV0 A;  3H15 A;  2MQH A;  1LTL A;  2UXC Q;  4LF4 Q;  3M3Y H;  1EQR A;  1EWI A;  4LFB L;  3D31 A;  1KC8 C;  1HR0 Q;  4B3S L;  4L5R C;  1HZB A;  2ES2 A;  3S17 H;  1J5E L;  4B3R L;  1B70 B;  3FP9 A;  4GLA C;  4DUY Q;  2NZO A;  3UE1 A;  3ULL A;  1A0I A;  3LGJ A;  3AFP A;  5GAH C;  1WCM G;  3PIO A;  4DAY B;  2K4K A;  1IBK Q;  3T1H L;  1OXU A;  5J3B A;  3CP0 A;  4NB3 A;  1MKH A;  3MEF A;  2KHI A;  2R7D A;  2VUM G;  4KLK A;  5IWA Q;  3S1Q H;  1P16 A;  1OXS C;  3RLF A;  3CF5 A;  3UDG A;  1PH2 A;  2CCZ A;  4B3M L;  4IJL A;  1P8L A;  1VQB A;  3OW2 A;  4DR5 L;  2ZJR A;  2YYZ A;  4YCV A;  3I55 A;  1XMQ Q;  1LUZ A;  1I3Q H;  4R4Q A;  3PO3 H;  2VQF L;  2H5X A;  4A3C G;  4LUZ A;  5LMU L;  1NBW A;  2K50 A;  4X62 L;  3NBH B;  1FJG L;  4YWM A;  5IYB G;  3M85 A;  1VQD A;  4YHH Q;  1Z9F A;  1YJ9 A;  3W1B A;  3HOX G;  3S24 A;  2VQE L;  1Q7Y C;  1X54 A;  2RCN A;  1QVF A;  4GKK L;  1K8A C;  3CAM A;  2JA9 A;  3HOZ H;  1VS0 A;  5LMN L;  1VQ6 A;  4DAM A;  4YCU A;  1T9H A;  2E5L Q;  1E24 A;  4A3I H;  3BZK A;  4DV4 Q;  2UXD L;  2IY5 B;  5E7N A;  4K0K Q;  1JT8 A;  3HOX H;  2JQO A;  3G71 A;  5BR8 L;  3S2H H;  3G6E A;  3CMA A;  3KYH C;  4NXN L;  2JA8 G;  1XNQ Q;  1B7Y B;  1Y1W H;  2D62 A;  2WB1 G;  1SRU A;  2PQA B;  4DR7 L;  4LF5 L;  2WB1 E;  2NN6 G;  2ZTE A;  5M5Y H;  4DR2 Q;  3E0E A;  4HJ7 A;  4XIG S;  2K5N A;  5GAD C;  1IBM L;  3KLW A;  2E8G A;  4IPD A;  3A74 A;  2Q2U A;  4JI7 Q;  1N33 L;  3KJP A;  2CFM A;  1KL9 A;  4X66 Q;  4IFD G;  2EQS A;  4X65 Q;  3T1Y L;  1PH3 A;  2MFI A;  4POG A;  4UY8 C;  3NEN A;  3RN5 A;  2EIF A;  2K52 A;  4A3L G;  4IPC A;  2CQO A;  4R4T A;  3UDF A;  3A5U A;  1D8L A;  3TRE A;  2LXK A;  1JJG A;  1L2F A;  2AKW B;  1E3P A;  1OXT A;  3F8T A;  3L0O A;  1X55 A;  3RR5 A;  4B3T Q;  4A3M G;  4LF4 L;  2NVX H;  2VL6 A;  4YWK A;  1EOV A;  2UXB L;  1AE2 A;  4A3L H;  1E1T A;  2PI2 E;  2RHQ B;  5M3M H;  3CCR A;  3CW2 C;  1J5E Q;  4B3R Q;  2FXQ A;  3U4Z A;  5JEA G;  3GTK H;  1UE5 A;  1XPU A;  4JV5 L;  1L1O B;  2N3S A;  1WI5 A;  1IBK L;  2BA0 A;  2Z0S A;  2E2I H;  3I7F A;  1IYJ B;  2VW9 A;  3T1H Q;  3KF8 B;  3G48 A;  5IWA L;  4OXP A;  3HOV H;  2ALY B;  1I6H H;  2I0Q A;  1N36 L;  4DV6 L;  4B3M Q;  3H0G G;  5DLQ E;  4UP9 A;  5HY6 A;  3CCU A;  3CD6 A;  5IE8 A;  4JBM A;  4DV0 Q;  3I4N G;  4DV2 Q;  3ERS X;  4DR5 Q;  1IL2 A;  4FDB A;  3ZJY C;  4A3F G;  2YTX A;  4LF7 L;  3J80 c;  4A3B H;  2Q2I A;  2R93 G;  4L5T A;  4LUO A;  3KJO A;  5JJI A;  2LXJ A;  5LMU Q;  2E2J H;  2UUA Q;  3G4S A;  1VQ7 A;  4QIW E;  1FL0 A;  1VQL A;  5GAG C;  3U4V A;  2QEX A;  3CPW A;  5JEA J;  3AEV A;  3PO2 H;  4TVA B;  4A93 H;  2OQ0 A;  2HT1 A;  4DV5 Q;  1YVC A;  4P74 A;  4R4O A;  2ASB A;  4GNX B;  4K0K L;  3DLL A;  4PZ8 A;  4XTC S;  3I4O A;  2Y0S E;  2B3G A;  5C44 H;  1YZ6 A;  5M3F H;  1X3G A;  2JA5 H;  3KFU A;  4A3G G;  3M9B A;  5IP7 G;  1N9W A;  1VQI A;  1HJP A;  5IYD G;  4JI0 L;  4IPH A;  5BR8 Q;  1Q12 A;  1ASZ A;  1GM5 A;  1XNQ L;  3GTL H;  4HJ8 A;  3HOU H;  4NXN Q;  4DV7 Q;  3H3V I;  3HOZ G;  2R6G A;  2WAQ G;  1CKM A;  3PF4 A;  3M4P A;  4P71 A;  3CCL A;  4BXX H;  1TWA H;  3HOW H;  2WAQ E;  1MJC A;  4LWC A;  4BBR G;  1IBL Q;  4LF5 Q;  2Q2H A;  2JA6 G;  3I4M H;  3L7Z C;  3AFQ A;  4LFC L;  1OXX K;  2I5L X;  4BY1 G;  2OTL A;  3BJU A;  2JEA I;  3DM3 A;  4X66 L;  1N33 Q;  4X65 L;  2NN6 I;  3CXC A;  3CQZ H;  1KQS A;  3CC2 A;  1VQ4 A;  1PVO A;  4POF A;  2JA7 H;  2JA6 H;  3F2C A;  1V1Q A;  3B6Y A;  4BY1 H;  1PH4 A;  2JE6 I;  3TRZ A;  1QZG A;  4IPG A;  4B3T L;  3K0X A;  5M5X H;  4GS3 A;  1V43 A;  1PH8 A;  4YCW A;  1YEZ A;  4DNI A;  3RZO H;  1TWH H;  4IOA A;  1G6P A;  2UXB Q;  3J7Z C;  1K9M C;  2JK8 A;  1TXY A;  5FJ8 H;  5GQO A;  1JJC B;  4BA1 I;  4X64 L;  2IHF A;  5M5W H;  3CCV A;  4HIK A;  5HGQ A;  1WOC A;  1PHJ A;  4R1J A;  4JV5 Q;  4A76 A;  2QGQ A;  3S1N H;  1BKB A;  1Q8K A;  1YNX A;  1WYD A;  2KCM A;  1C9O A;  1N36 Q;  1HNW Q;  1LYL A;  1YHQ A;  4DV6 Q;  4DV0 L;  1B8A A;  1W2B A;  4DV2 L;  2Q2T A;  4DR6 Q;  4L5Q A;  1TWG H;  4LF7 Q;  2K14 A;  1Y14 B;  4HIM A;  1K73 C;  1PYB A;  2NVY H;  3PUZ A;  3ULP A;  2UUA L;  4L5S A;  1X65 A;  2ATW A;  4A3I G;  2YV5 A;  3ER0 A;  3NEM A;  5K36 G;  4GOP A;  1Q46 A;  1X6O A;  1YHA A;  4JI4 Q;  3I56 A;  1AH9 A;  4RMF A;  4JBJ A;  4BY7 G;  1WFQ A;  4GOP C;  1HZC A;  4DV5 L;  1YJW A;  1HR0 W;  1PH7 A;  2HQL A;  2JJQ A;  3GTJ H;  1Y1W G;  4LFA L;  1X3E A;  3NEL A;  5C0X G;  3GTQ H;  2OTJ A;  4BY7 H;  2K5H A;  3J81 c;  3K81 C;  1UE7 A;  4HJA A;  4JI0 Q;  1PH9 A;  4DV7 L;  2BH8 A;  4LF6 Q;  4OWW B;  4JCV E;  2YTV A;  1KXL A;  2MO0 A;  1IBL L;  2B63 H;  1QZH A;  2IX1 A;  4BA2 I;  2Z6K A;  3A0J A;  2ZJQ A;  4YY3 L;  4RG1 A;  4LFC Q;  2Z6K C;  1FGU A;  1UE1 A;  4DR4 Q;  3RNU A;  3HKZ G;  1D7Q A;  3UE0 A;  1CKN A;  4X6A H;  1JE5 A;  3HKZ E;  3PSI A;  1YJN A;  3BU2 A;  3ICE A;  5ELN A;  5M3M G;  5IYC H;  4JBK A;  2VS1 A;  4PZ6 A;  2BA1 A;  3Q8D A;  2RHS B;  4OWT B;  4PZ7 A;  5C0X J;  3E9H A;  4MZ9 A;  4HIO A;  1EQQ A;  1NJI C;  4LF8 Q;  1XNR L;  1VQJ A;  3CCM A;  1NTG A;  1W3S A;  1KIX A;  3EN2 A;  2IX0 A;  4A3K H;  1SFO H;  4QJF A;  4X64 Q;  3HOV G;  1WJJ A;  4AQY Q;  4WJ4 A;  3GTG H;  1VQK A;  2V1C C;  1U5K A;  4BXX G;  3U58 A;  2PNH A;  1X3F A;  4A3D H;  4IFD J;  1Q82 C;  4C3J H;  4GLV B;  3S14 H;  4KHP Q;  1HNW L;  4A3B G;  4DK3 C;  2VZA A;  1XMO L;  3F2D A;  4DR6 L;  4A3J H;  2IT1 A;  3I2Z A;  3TQY A;  4HID A;  5EAY A;  4A93 G;  3PO2 G;  1SR3 A;  2ZM6 Q;  1CSQ A;  1UWV A;  1VQA A;  3AYH B;  2R7Z H;  4JI4 L;  5C44 G;  2DUD A;  5FLM H;  5M3F G;  1Q81 C;  3GTM H;  1CUK A;  3MXN B;  1HNZ L;  2JA5 G;  3S15 H;  4OO1 G;  4ME3 A;  3JAM c;  2R7F A;  1SRO A;  1BBW A;  3HOU G;  4EQ5 A;  4JI1 Q;  1VQ8 A;  3GD7 A;  4C2M H;  1NY4 A;  2JEB I;  1NMF A;  4BBS H;  4R4C A;  4LFA Q;  3GDE A;  1PH1 A;  3HOW G;  2I5H A;  4LF6 L;  2XGT A;  3M4O H;  3I4M G;  3PCO B;  3J81 i;  1KRS A;  3FKI G;  1X9N A;  1N8R C;  3PUX A;  1Z47 A;  2E2H H;  1RIP A;  3STB C;  3S16 H;  4JI6 Q;  2JA7 G;  1Q86 C;  1XPO A;  3TEH B;  1UEB A;  2XTI A;  1NE3 A;  4O0A A;  4NXM L;  4YY3 Q;  3GTO H;  3TS2 A;  3FKI H;  3EIV A;  1HZ9 A;  3KDF A;  1U0L A;  3ULJ A;  1S3O A;  1XPR A;  1VQH A;  2L15 A;  4JI5 Q;  3HOY H;  4DV3 L;  1MIU A;  1VQN A;  2HIX A;  3WWV A;  1GKH A;  4MNO A;  4A3E H;  4IFD I;  5FJ8 G;  1PH5 A;  1HH2 P;  4LF8 L;  3K80 C;  1L0W A;  1QUQ A;  3CCJ A;  1YIJ A;  4DR1 Q;  1XNR Q;  3UDX A;  2MNA A;  3KF6 A;  5LMN W;  1EYG A;  1JMC A;  2ZJP A;  1C7Y A;  1VQ5 A;  1SE8 A;  2C35 B;  4IO9 A;  2AMC B;  2PI2 A;  4AIM A;  4DR3 Q;  2RF4 A;  3PUY A;  1JB7 A;  4JI8 Q;  1A8V A;  1PFS A;  4JI3 L;  4AQY L;  1GO3 E;  1VQM A;  4OX9 L;  3CCQ A;  4DK6 C;  2VNU D;  4ALP A;  1OTC A;  2UU9 L;  2KCT A;  1X56 A;  1VQP A;  4P72 A;  4JG2 A;  4JI2 Q;  1A62 A;  4KHP L;  3K7U C;  5C4J H;  3GTP H;  2VY3 A;  4PMW A;  1IXR A;  3S1R H;  3M4Q A;  2CKZ B;  1XMO Q;  4GN5 A;  4H02 A;  1XTD A;  2GN5 A;  5IP9 H;  1Y1V H;  3FHW A;  2K75 A;  3F1Z A;  3KF6 B;  1EUJ A;  1O7I A;  1MJE A;  2ZM6 L;  4HJ9 A;  1V9P A;  3J80 i;  3S2D H;  1NMG A;  4LUV A;  3PGZ A;  1FVI A;  2UUC L;  1A63 A;  2UUB L;  1YBY A;  3TS0 A;  3PUW A;  5IY0 A;  2KHJ A;  1R9T H;  1HNZ Q;  1UE6 A;  1BVS A;  2N49 A;  2AWO A;  4JI1 L;  1Q1B A;  3SGI A;  3JAM i;  1VQO A;  3IRB A;  4OO1 I;  1N34 Q;  1DGS A;  4JYA L;  1WCM H;  2WP8 J;  1QVC A;  2CWA A;  4PG3 A;  4QL5 A;  5C4X G;  5FLX c;  2B63 G;  4P75 A;  2I5M X;  1SMX A;  1VQC A;  3UDI A;  5ELO A;  1VQF A;  2VUM H;  1N32 Q;  5C3E G;  3CC4 A;  2HHH L;  4LF9 Q;  1SLJ A;  2KBN A;  2PQA A;  4DPG A;  5C4X H;  2AHO B;  1K3R A;  4JI6 L;  1I94 Q;  3OYY A;  4UPA A;  4DR4 L;  3AQQ A;  3M7N A;  5C3E H;  2ZTC A;  4GOP B;  1PH6 A;  5IYC G;  4AYB G;  2QA4 A;  4NXM Q;  4A3C H;  4GKJ L;  2CWP A;  2HIV A;  4JI5 L;  4AYB E;  3S1M H;  4DUZ L;  1PYS B;  1VQG A;  5IYB H;  3OTO Q;  2K5V A;  1XJV A;  4JBW A;  4DV1 Q;  4DV3 Q;  1ASY A;  3D0F A;  3J81 j;  4P73 A;  4A3K G;  4NPS A;  4DR1 L;  1TWC H;  1HZA A;  4AH6 A;  1VQE A;  3H3V H;  1K0R A;  1HNX L;  3RN2 A;  3JC6 6;  4C3I H;  4DR3 L;  1E22 A;  4JI8 L;  2JA8 H;  4A3D G;  1BBU A;  1L1O A;  1LM0 A;  1KD1 C;  1J6Q A;  1OXV A;  4JI3 Q;  4OX9 Q;  3CC7 A;  3K8A A;  3RLN A;  4QY7 A;  5AJ3 L;  4IOC A;  1L1O C;  2EXD A;  1CKN B;  4A3J G;  4JI2 L;  2F4V Q;  4KHZ A;  2UU9 Q;  5GAE C;  4JC0 A;  2GVA A;  2MO1 A;  2ID0 A;  4KI0 A;  2UXC L;  2R7Z G;  3GO5 A;  1G29 1;  1TWF H;  1AE3 A;  4C3H H;  5FLM G;  1HR0 L;  3PO3 G;  4GLX A;  4A75 A;  5JJK A;  2B29 A;  4LFB Q;  5IT9 c;  4B3S Q;  4DUY L;  1PV4 A;  4O2D A;  3L2P A;  1VQ9 A;  4A3M H;  1YHB A;  4QGU A;  4BBS G;  1E7Z A;  2UUC Q;  4LNQ A;  2R92 G;  1M90 C;  1M1K C;  1CSP A;  1I50 H;  2UUB Q;  1K83 H;  4APV A;  1RL2 A;  1IZ6 A;  4GNX A;  1N34 L;  1EIF A;  1GVP A;  2KEN A;  2AWN A;  2R92 H;  1Q1E A;  4JYA Q;  3CME A;  2D0P A;  4GNX C;  3J7A 5;  1VCI A;  4WJ3 M;  3PF5 A;  3A5Z B;  4Y7N H;  3BZC A;  1XMQ L;  1N32 L;  1GD7 A;  2YTY A;  3U50 C;  3CCE A;  1KHI A;  4LF9 L;  2UXD Q;  5C0X I;  2OWO A;  3PUV A;  1CKO A;  2VQF Q;  2HHH Q;  2N78 A;  1QVG A;  5JJL A;  3H0G H;  2IHE A;  3VDY A;  1K8G A;  1I94 L;  2DGY A;  4X62 Q;  3HOY G;  4YHH L;  2NVT H;  4Y52 H;  3I4N H;  1FJG Q;  3CPF A;  2A8V A;  4DKA C;  4A3F H;  2VQE Q;  4A3E G;  4TQU S;  4GKK Q;  2R93 H;  3RZD H;  4GN4 B;  4UP8 A;  2E5L L;  1KAW A;  4GKJ Q;  4DV4 L;  2YU9 H;  2Y0S G;  5LMN Q;  3OTO L;  2NVQ H;  2OCE A;  4DV1 L;  4UP7 A;  4YWL A;  4GN3 B;  4DUZ Q;  4JOI A;  4LW1 A;  4J15 A;  1G51 A;  4A4I A;  1C0A A;  1EFW A;  1H95 A;  1YI2 A;  4JOI C;  4HJ5 A;  2A1A A;  4IJH A;  1EIY B;  2F52 A;  3W5O A;  1I5F A;  2OQK A;  3HFZ B;  2D0O A;  2N8N A;  3STB D;  4EX5 A;  1JJ2 A;  4OON A;  3KOJ A;  3RLO A;  5IP7 H;  1HNX Q;  4A3G H;  4QQB X;  5IYD H;  2WFW A;  2NZH A;  1E1O A;  3K7A H;  1KRT A;  4DR2 L;  4DR7 Q;  1S72 A;  4OWX B;  4MTN A;  4JI7 L;  3HKS A;  5GRO A;  1IBM Q;  4R4I A;  2LSS A;  3F2B A;  2F3I A;  3KDF B;  2F4V L;  4BBR H;  5AJ3 Q;  3CCS A;  5IP9 G;  3T1Y Q;  1Y1V G;  3PIP A;  2A19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...