1N36L

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n36L00
1KAWA 2K5NA 4YY3L 2ES2A 3CMAA 2RHQB 4QL5A 2Z6KA 3BZCA 4DV6Q 4A3EH 5JJIA 3NENA 2K52A 4KHPQ 2VS1A 3NBHB 3L2PA 4A93H 4NXNQ 2YTYA 1PH8A 1XNRL 1H95A 4OO1G 1VS0A 4X65L 4A3DH 4BXXG 4DR7L 3J81c 2ZJRA 3NEMA 4R4IA 1XPRA 2NN6G 4B3ML 3GO5A 1LTLA 1E1TA 2HIVA 4HIDA 4LFBQ 1HH2P 4IOAA 1KRTA 2K75A 1D8LA 5M3FH 4YCWA 1L1OA 2VZAA 4X66Q 1QVFA 3GTMH 2VW9A 1J5EQ 1G291 1V9PA 1KD1C 3OW2A 4IJHA 3K80C 3PO2G 1BVSA 1K8AC 2K5VA 5FJ8H 4A3JH 1PH2A 2JA8G 1DGSA 3I7FA 1KXLA 4DR4L 1VQDA 3BZKA 4DK3C 1N34Q 2BA0A 1IXRA 2UXBL 1IBKQ 1PYSB 3KDFB 1C9OA 4DR5L 1KC8C 4B3RL 2PMZE 3CCUA 4AYBG 3K8AA 1E22A 2ATWA 2QEXA 3HOVH 1K3RA 3RLNA 5LMUL 3RLFA 3KF8B 4IPCA 1M1KC 4LF6Q 3J81j 4IPHA 2BH2A 1VQEA 1I3QH 1YJNA 4DUZQ 3JC66 3RZDH 1NBWA 4LF9Q 1XNQL 1N8RC 2LSSA 1HNXQ 2UUAQ 4OO1I 3M4QA 1V1QA 4A76A 2ZM6Q 1N33Q 1CUKA 3KFUA 3T1YQ 4BBSH 2NN6I 2JA7G 1Y1VH 3CCMA 1YHBA 3J80c 3S24A 4A3KH 5EAYA 3G71A 1TWAH 2Y0SE 3ERSX 1EIFA 4LF7Q 4FDBA 4JI1Q 3G4SA 3STBC 5ELNA 1SRUA 4JI3L 4DAYB 1YNXA 1G6PA 1SR3A 3EIVA 2KENA 4LUZA 1PH1A 1NMGA 1TWHH 1RIPA 5IYBH 1YHQA 4JG2A 4P74A 4LF5L 2LXJA 3I55A 2ZJPA 4GNXB 1QZGA 2D0PA 4DV4Q 1C7YA 2VNUD 4JI0L 1E1OA 3J7ZC 4Y52H 3BU2A 4LW1A 2AKWB 1HR0Q 4B3SL 4GN4B 3M4PA 2IHEA 4DV7L 1JJCB 4HJ7A 3PUZA 1W3SA 3GTQH 1VQPA 3HOZH 2B3GA 4LFCQ 4YCUA 1X3GA 4RMFA 4DV0Q 1O7IA 1EIYB 1JMCA 5BR8Q 4YHHQ 3I4OA 1UE1A 4APVA 3PIOA 4BBRH 4A3GG 3PF5A 2PI2E 4DPGA 5FJ8G 3OTOL 1N36L 1TWFH 1VQ5A 4JI6Q 5IY0A 3AFPA 3HOWH 3GTPH 2UXDQ 4A3IH 1JE5A 4WJ3M 4UP9A 2Y0SG 1IBML 1YVCA 4L5TA 4P73A 4B3TL 2VL6A 3CPWA 1PH4A 3S1MH 3UDXA 1OXXK 3F2DA 1PVOA 3FKIH 5AJ3L 2JEAI 3UE0A 3GTGH 3D31A 4A3LG 4GKJQ 1XTDA 5IE8A 1S3OA 2LXKA 1VQCA 3ER0A 2K4KA 5GADC 5C0XG 4JI8L 4EX5A 1VQBA 5GAHC 4OWWB 4A3BG 1HNWL 5K36G 4GLAC 1EQQA 2UUCL 3TS0A 4JBMA 3GTOH 4IFDG 1HZ9A 2OWOA 2NZHA 3HOUH 3RZOH 5C44H 4MTNA 1VQ4A 1EWIA 1Q86C 4DV1L 3PV0A 2CCZA 2AWOA 4POGA 4AQYL 4ME3A 4HIMA 4JBJA 2IX1A 4LWCA 3CMEA 1B8AA 3HKZG 2JA5H 4DV3Q 3PCOB 3EBEA 5IP9G 1XMOQ 1GO3E 2ALYB 2N49A 4JI2Q 4X62Q 1AH9A 1GD7A 3H3VI 3KLWA 1QUQB 4PG3A 3IRBA 3HOXH 1VQHA 5FLXc 1WFQA 4IFDJ 2N78A 1IBLL 4JI4Q 2F52A 1FJGQ 3K81C 4YWKA 1NY4A 2R7DA 1MJEA 5IYBG 3CC4A 3HOYH 3M85A 2Z0SA 4JYAQ 1YZ6A 4WJ4A 2UUBL 2OCEA 3CCJA 1N32L 2Q2HA 2JE6I 3F2BA 1X56A 2VQEQ 2R7FA 3T1HQ 2EXDA 4BY1G 3UDFA 3I4NH 2XTIA 2IT1A 4DV6L 4HJ9A 1YITA 4O2DA 1QVGA 2F4VQ 2MQHA 5JJKA 5JEAG 1K8GA 2R6GA 4H02A 1X54A 4NXNL 2CFMA 3CF5A 1X3FA 3STBD 4LFAQ 4GLXA 5IYCH 2VUMG 4LF4Q 2I0QA 1KHIA 4DR3Q 3PGZA 2YV5A 1VCIA 4POFA 4YY3Q 4DR2Q 5GAGC 2JA6H 3BJUA 2WP8J 3HOWG 4LFBL 2D0OA 5JEAJ 4X66L 1GM5A 1XPOA 3K7AH 2E2HH 4A3MH 5IYDH 1HJPA 1XNRQ 1UEBA 2WB1E 3W1BA 4X65Q 1UE7A 3CQZH 4OWXB 4GOPC 2R7ZG 4DR7Q 2K50A 5IT9c 1Q7YC 2BA1A 2L15A 3JAMi 1XJVA 4EQ5A 4IPGA 4K0KQ 2UXCQ 1VQIA 4UP8A 4DNIA 3PO3G 3ULPA 2NZOA 3CW2C 4BA1I 3S2HH 2NVXH 4DR6L 5C4XH 1L1OB 1OXVA 5IWAL 3CP0A 2RCNA 4YWMA 2KCTA 5M3MG 2DGYA 1JB7A 3H3VH 1KRSA 5FLMG 2F3IA 5IP7G 4DAMA 4IOCA 3HOUG 3M9BA 4JBWA 3EN2A 3K0XA 4DR4Q 4QQBX 2R92H 1TWCH 3GTJH 5JJLA 2I5MX 4QIWE 3CAMA 4JOIC 2CKZB 4PZ8A 1YJ9A 2UXBQ 5LMNL 4QJFA 1VQ6A 4OWTB 4QY7A 5HGQA 3I2ZA 4OX9L 4B3RQ 2AWNA 1HNXL 1AE2A 3L7ZC 2B63H 4DR1Q 3S17H 3KJOA 2D62A 2N8NA 3CCEA 5E7NA 5M5YH 3HOYG 1LUZA 1UE6A 2JQOA 3F8TA 3I4MH 1AE3A 1A63A 2K5HA 1GVPA 2PI2A 2WB1G 1Q46A 3GD7A 2A19A 4NXMQ 4HIOA 2GN5A 1I6HH 3CXCA 3S15H 4LF7L 4A3EG 4GOPA 1XNQQ 1B7YB 3NELA 4JI7L 2CWAA 4A93G 2AHOB 2VQFL 1Y1WH 3PUXA 1EFWA 4TQUS 1WCMH 1Q1EA 3J80i 1FGUA 1VQ8A 1MJCA 5GROA 4Y7NH 3TS2A 4A3DG 1HZAA 2NVTH 1VQNA 2A8VA 1WJJA 5IYCG 4DV4L 4X6AH 2KHJA 4YCVA 1OXTA 3CCSA 4JCVE 4J15A 1Z47A 4X64L 2DUDA 2JA9A 1Z9FA 5M3FG 4C3HH 4DV2Q 1KIXA 4JI3Q 4L5SA 2JA6G 1JJGA 1WI5A 5C3EH 2R93H 1BBWA 1CKNA 1VQJA 2ZTEA 1XMQQ 3MXNB 4JOIA 4O0AA 4LFCL 4R4TA 4C3IH 4DV0L 4A3FH 4DKAC 1QZHA 4A3JG 2UU9L 3E0EA 2OTJA 2E5LQ 1X3EA 1U5KA 4HJAA 4JI0Q 2HIXA 1PH3A 1I94Q 4B3SQ 1TXYA 4DV7Q 1Q81C 1SMXA 2K14A 2UXDL 2YU9H 3AQQA 2MO0A 1YI2A 1N9WA 4P71A 3CD6A 3PSIA 1OTCA 3PUWA 3HOVG 1PFSA 1A0IA 4UPAA 3UDGA 2JEBI 2PQAA 1YHAA 3ICEA 4A3CH 2A1AA 3KF6A 4XTCS 4BXXH 1SN8A 1Q8KA 1N36Q 3LGJA 1WYDA 1Q1BA 4A75A 4LNQA 2RF4A 5M5XH 3S2DH 1OXSC 4IO9A 1A8VA 3L0OA 1RL2A 4DV5L 4JV5Q 1UE5A 2I5LX 1EOVA 3PUVA 3AFQA 3PUYA 4DUYL 1HNZL 2NVQH 1P16A 3PO2H 4BBSG 1LM0A 2JJQA 3CCLA 5C0XJ 3U4ZA 1Y1VG 5AJ3Q 2IX0A 2JA8H 3DLLA 4A3KG 1Y14B 3ULLA 1NMFA 1QVCA 2E2IH 4BA2I 4GN3B 1YJWA 4GKKL 4MZ9A 2KHIA 4JI8Q 3A5ZB 1Q82C 3H15A 4PMWA 1HNWQ 4KHZA 3Q8DA 3ULJA 4LF8L 2UUCQ 1SLJA 1EQRA 4OONA 3S1NH 2EIFA 1E7ZA 1NE3A 3AYHB 3RN2A 1NJIC 4GLVB 2XGTA 1ASYA 1FJGL 1C0AA 2HHHL 3GDEA 4JI5L 5ELOA 2ASBA 1CSQA 3H0GH 1K73C 4R1JA 3U4VA 1PH5A 1PHJA 2Q2TA 4LF4L 2VQEL 1L1OC 1HR0L 1SE8A 3UE1A 3A74A 3HOZG 4ALPA 2WFWA 1VQAA 4KHPL 2KCMA 1IBLQ 2QA4A 1YEZA 3U50C 5C0XI 4LUOA 4DK6C 4BBRG 1PH6A 2JA7H 3TEHB 3F1ZA 2RHSB 5C4JH 3RN5A 4PZ6A 3SGIA 4L5RC 2MFIA 4IFDI 4A3IG 4DR3L 3RR5A 4BY7H 4DR2L 1S40A 1J5EL 1PYBA 4AYBE 3KYHC 1X6OA 2FXQA 2C35B 1EYGA 1SFOH 1VQFA 2AMCB 2CWPA 2OQ0A 4IJLA 2GVBA 1L0WA 3J81i 3FKIG 3W5OA 1LYLA 2JK8A 3K7UC 1E3PA 1X65A 4A4IA 4B3MQ 3M3YH 4A3CG 4UP7A 1J6QA 4AIMA 1V43A 1N34L 3B6YA 1VQMA 2QGQA 4K0KL 3KDFA 3FP9A 4GNXC 1IBKL 2GVAA 2UXCL 1PA6A 1JT8A 4QGUA 4GS3A 3JAMc 1VQLA 1VQOA 1VQ9A 1G51A 2E2JH 1K83H 5C44G 3S1RH 3CC2A 4IPDA 1SROA 2H5XA 1FL0A 4NB3A 4A3GH 1D7QA 4LF6L 3AEVA 2JA5G 3CC7A 3HFZB 4DUZL 1BBUA 4NPSA 4TVAB 4HJ5A 1K0RA 4DR5Q 3HOXG 3RNUA 3CCQA 2UUAL 4LF9L 3CCRA 4DR6Q 4R4CA 1FVIA 2ZM6L 5IWAQ 3MEFA 5LMUQ 1N33L 4LUVA 2N3SA 3T1YL 3HKSA 4P75A 2YTXA 2OQKA 2CQOA 3S16H 4DR1L 5LMNW 4A3LH 1P8LA 3H0GG 4JI1L 1L2FA 4NXML 1VQKA 4R4QA 3I4NG 3J7A5 4A3BH 3W1GA 4GN5A 5LMNQ 2Q2IA 4OX9Q 2B29A 3TREA 3TQYA 3ZJYC 1N32Q 4GNXA 3PF4A 2ID0A 2EQSA 3M7NA 3KOJA 1TWGH 1UWVA 3TRZA 4L5QA 5H1SE 4JC0A 1T9HA 3RLOA 3S1QH 2YTVA 4C2MH 5IP9H 3KJPA 1M90C 3D0FA 4BY7G 4DV2L 4GOPB 4JI7Q 1NTGA 4LF5Q 2VQFQ 5GQOA 1OXUA 4P72A 5BR8L 4YHHL 1HR0W 5IYDG 1XMQL 4A3MG 3GTKH 1HZBA 2ZTCA 1A62A 2PNHA 2E5LL 3FHWA 3I56A 4JI6L 2Q2UA 2MNAA 5M5WH 2I5HA 1YBYA 1I94L 4X64Q 1WOCA 1W2BA 4BY1H 3S14H 4KLKA 4AH6A 3A5UA 5C4XG 4HJ8A 2V1CC 1PV4A 3DM3A 3F2CA 1CKOA 1CKNB 1GKHA 3A0JA 1KL9A 5GAEC 2UU9Q 3OTOQ 4GKJL 4MNOA 1IYJB 3GTLH 1CSPA 1U0LA 3HKZE 2VUMH 2MO1A 4HIKA 4UY8C 4C3JH 1S72A 2R92G 1IBMQ 4B3TQ 3UDIA 3OYYA 4KI0A 1VQ7A 1JJ2A 2WAQE 3WWVA 4JV5L 1I5FA 5DLQE 2B63G 2IHFA 2VY3A 1BKBA 2NVYH 2BH8A 4R4OA 3CCVA 1K9MC 1ASZA 3I4MG 2IY5B 2Z6KC 2PQAB 2HT1A 2R7ZH 5J3BA 3KF6B 4YWLA 4DV3L 1XMOL 4RG1A 1MKHA 1QUQA 1X55A 4X62L 4JI2L 3PO3H 3G48A 2ZJQA 4JBKA 4DV5Q 3CPFA 4JI4L 2YYZA 1Y1WG 3E9HA 5HY6A 3M4OH 3U58A 1WCMG 4DUYQ 4DV1Q 1R9TH 1B70B 1HNZQ 4JYAL 1IZ6A 2HQLA 5M3MH 4AQYQ 1KQSA 5FLMH 5IP7H 1XPUA 4OXPA 1CKMA 1I50H 2KBNA 1YIJA 1X9NA 1VQGA 3PIPA 3T1HL 4GKKQ 3G6EA 3VDYA 2E8GA 2OTLA 1EUJA 1HZCA 5C3EG 2R93G 1E24A 2F4VL 4LF8Q 1PH7A 4A3FG 1MIUA 1IL2A 4PZ7A 2UUBQ 2WAQG 4XIGS 2ZTDA 4LFAL 1Q12A 2HHHQ 4JI5Q 1PH9A 3E9IA
chains in the Genus database with same CATH superfamily
3D4RA 4JK1C 2WB1B 3CMAA 1LT3D 2Z6KA 4ZYSA 4A3EB 3NENA 4KHPQ 3L2PA 1V1OA 4A93B 3SE0A 4NXNQ 1SE3A 1EY7A 4IUQA 4UHVA 2YTYA 1PH8A 4J6HA 5I2YA 2IL8A 4B3ML 2NBFA 1LTLA 1E1TA 4HIDA 3SK6A 1KRTA 3GTMH 1D8LA 2VZAA 1QG7A 3KBXA 1VMCA 5E4WC 2PO4A 4OEMB 1DXMA 1K8AC 2M2LA 2K5VA 1PH2A 2JA8G 3I7FA 3BVGA 2PQEA 4DK3C 3DHQA 2BA0A 2AQ1B 2F1MA 3T16A 1PYSB 5ELFA 1A6XA 1SXTA 3K8AA 3RLNA 1U4RA 1FR3A 5D14A 5C0XH 3ITPA 5EGTA 1YJNA 4DUZQ 1NBWA 4ZCKA 1XNQL 4R9WA 4B08A 1N8RC 4K2KA 3Q6SA 2XWBB 4BBSB 4KY7A 2F0DA 5LHY1 1Y1VB 1F2LA 3CCMA 5EAYA 1B50A 1QE6A 3OWEB 4FDBA 5ELNA 4JI3L 1YNXA 2LY7A 4RGMA 1SR3A 3X3MA 4XQJA 2KENA 2A68D 1G6PA 1PH1A 1YHQA 5IYBH 2K6AA 5A35A 1TU2B 2LXJA 1A2UA 5T1GA 1QJOA 5EQ0A 4Y52H 2F0IA 4LW1A 1ENAA 5IT9E 4B3SL 4GN4B 2KEDA 4HJ7A 3HOZH 1VQPA 3GTQB 1RTOA 2B3GA 3K5OA 1A3UA 4YCUA 4DV0Q 3A7AB 1JMCA 2NTTA 5BR8Q 4APVA 3PIOA 2WKDA 4BBRB 4A3FB 1H9SA 3PF5A 1D5ZC 1N36L 1TWFH 2EYOA 4JI6Q 5IY0A 3AFPA 3GTPB 4K5XA 5JVH3 1WTQA 1DOKA 2PYKA 3V05A 4EQPA 3S1MH 2D5DA 1PVOA 3D31A 1EZ6A 4A3LG 2LXKA 3ER0A 3LNNA 2K4KA 1STHA 1WD1A 1HNWL 2M9VA 1EQQA 3TS0A 2Z9HA 1HZ9A 3RZOH 2F0TA 1RHPA 1SNQA 2K1BA 5IGBA 3MFGA 4JBJA 1SYEA 3CMEA 1B8AA 2JA5H 4DV3Q 3PCOB 4JI2Q 4X62Q 3I3CA 3H3VI 3HOXB 1VQHA 2PZUA 2N78A 1IBLL 2KQ3A 2EJGC 4FF3A 1FJGQ 2B2UC 1S5FD 1NY4A 2HDMA 1B1ZA 1YZ6A 2EZVA 2L5TA 2VB2X 3T1HQ 1SMYD 2XTIA 4HAEA 3NBHA 1QVGA 3P20A 4KY6A 2R6GA 2B8GA 2ICEC 1AW7A 5BN4A 1LT6D 3O13A 3V2TA 1DM0B 4BS9A 5IYCH 1G2TA 2I0QA 5M9OA 1A3TA 3CU7A 4C3JG 4DF7A 4YY3Q 5BN3A 5GAGC 2RSNA 5CV9A 2JA6H 2WP8J 4LFBL 4BY7B 2RQXA 1U4LA 1PRTC 1SFOB 1XNRQ 2B8FA 3FPPA 3CQZH 2R7ZG 4DR7Q 1GHJA 2K50A 2L15A 4K0KQ 2UXCQ 3PO3G 1XXGA 3MA2B 1QNKA 2B2WA 3S2HB 1FNVA 4DR6L 2RDHA 5C4XH 1OXVA 3CP0A 1ML0D 1O7ZA 2RCNA 1ILPA 3NBIA 1WTWA 3CRLC 4DR4Q 2R61A 3GTJH 4JOIC 5J22A 2CKZB 4LAAA 4X3SA 4OWTB 2EE1A 4QY7A 2B2VC 4B3RQ 2B63B 1BCPF 3DUZA 4DR1Q 3KJOA 1F2ZA 1STBA 4RKBA 1I4PA 1CFMA 5EBDA 3I4MH 2EYFA 1RD9D 5AFWA 4MN3A 2PI2A 3KBGA 2WB1G 3GD7A 3Q0AA 2A19A 4DNRB 2GN5A 4HIOA 1I6HB 3H09A 4LF7L 4A3EG 3QWNA 5EPLA 1JWUD 1ENFA 3FEWX 4A93G 5EBCA 2VQFL 1Y1WH 3PUXA 3BS1A 5GROA 3E6ZX 3W3AA 4CDCC 4IZ8A 1HZAA 1SYGA 3NXWA 4RGNA 1TWGB 4X6AH 4EVOA 4YCVA 3CCSA 1MJEA 4X64L 1Z47A 4DV2Q 1Z9FA 4C3HB 1JJGA 1NSNS 5C3EH 1U4PA 2R93H 2KCNA 2ZTEA 3MXNB 1GUNA 4A3JG 1RODA 2WAQB 2OTJA 2E5LQ 1T5EA 2QW7A 1TS2A 1EY8A 3OWFA 4HJAA 2HIXA 3IFTA 1TXYA 1CZGA 3AQQA 4BY1B 3S14B 5IIFA 3PSIA 4KD3A 2RDGA 3R93A 4CBVA 1KABA 1LV9A 3LGJA 1BUVT 2G9DA 4LNQA 2XSCA 5M5XB 2KOLA 1A8VA 3L0OA 4DV5L 1BNZA 3TSSA 1EOVA 3PUYA 3AFQA 1HNZL 2NVQH 1P16A 4BBSG 2JJQA 3U4ZA 1Y1VG 5AJ3Q 2JA8H 3DLLA 2NYZD 3DMUA 3ULLA 1QVCA 2E2IH 2HQEA 4GN3B 4GKKL 4JI8Q 3J81L 1CHPD 4RGTA 3H15A 1Y8PB 3Q8DA 4L6TB 3ULJA 4AYBB 1SLJA 1EQRA 4OONA 4DA2A 2EIFA 1E7ZA 1NE3A 3I70A 4GLVB 1C0AA 2HHHL 3GDEA 1CSQA 4R1JA 3BYYB 1PHJA 2VQEL 4HEDA 1SE8A 3URYA 4JPBW 1YEZA 3U50C 4KN7C 3DM1A 4BBRG 1PH6A 1JB3A 4ID6A 1DD2A 1PMRA 3DEOA 2F0LA 3HEJA 2MFIA 3RR5A 1LT4D 1S40A 2F0EA 1J5EL 1X6OA 2FXQA 3J81i 1H9JA 2CWPA 2R3ZA 2GVBA 4CDEC 3K7UC 1B4OA 1E3PA 1X65A 1BO0A 4BWGB 5LL6S 4A4IA 3M3YH 4ILWA 3E0JA 1V43A 1N34L 1VQMA 5E3FA 1IYUA 3EJIA 1IBKL 1CK1A 4QUFA 2E76C 1VQ9A 4ZAIA 3S1RH 5CORA 1I4GA 1NCVA 4I7AA 4M8AA 1STYA 3OOCA 4ZUIA 5I6WA 4DR5Q 1UNSA 3HOXG 2CHBD 4R4CA 2ZM6L 2OQKA 3S16B 1Q8IA 4A3LH 3KLSX 3TZUA 4X3KA 1G2SA 1WTHA 4NXML 1I3QB 3I73A 1DONA 2B39A 3NSWA 4OX9Q 4R8NA 4GNXA 2AUKA 5JPMC 2BDOA 3M7NA 3WOFA 1UWVA 1EY5A 3SEBA 2K5WA 5H1SE 1T9HA 3HKZB 4BY7G 5KIXA 1B2TA 3JAME 3NP8A 1SNPA 1TIID 4YHHL 1XMQL 1HZBA 5FO9B 2JXMB 2PZTA 3CHBD 3I56A 2G5DA 2Q2UA 2EPBA 4KN4C 2I5HA 1F2YA 1YBYA 3NWSA 1I94L 3FDTA 3T51B 3MZ5A 1F77A 1PV4A 3DM3A 5IGDA 3BDLA 5C3WA 3GTLB 4C3JH 3MVVA 3HOWB 3OYYA 1VQ7A 1JJ2A 4DN4M 2B63G 1EWCA 1R4QB 2CW0D 2IHFA 2WIIB 1EL0A 1BKBA 1K9MC 2R7ZH 1XMOL 1ESRA 3K5NA 1Q90A 2D9UA 3PO3H 2KVMA 3CPFA 1C8CA 2LMCB 5A2QE 1R9TH 4FF4A 2A68C 5M3MB 3HOUB 3BVZA 3N6RA 2SOBA 3A54A 3VYSA 1YIJA 4K14A 1X9NA 1HUMA 1V8QA 3TBIB 3KK7A 4C3HG 2PPBC 1MHWC 3A8IE 3W2DA 1NR4A 1PH7A 1VDZA 2WAQG 1B44D 1PTOD 2ZTDA 1Q12A 3ONAB 1PH9A 4JI5Q 4LF4L 1KAWA 2L1BA 2K5NA 3R2IA 4QL5A 4XXEA 4A3EH 1GUOA 2VS1A 3I4NB 4A93H 2FMMA 2L12A 1L0YB 4OO1G 4X65L 4UAIA 4R4IA 2E2DC 4C1NI 2IWHA 3M4YA 1HH2P 4IOAA 3TMEA 4YCWA 4X66Q 4TRDA 1LABA 3ND9A 2WINB 1G291 1V9PA 3IAYA 1BVSA 1K8MA 5BN5A 3H94A 4G7HC 5FJ8H 4A3JH 2PW5A 4XQNA 4PMBA 3BDCA 2UXBL 2K01A 3NK9A 2K05A 1OO9B 4IUNA 4AYBG 1E22A 1EY6A 5LMUL 3KF8B 4LF6Q 2D2CC 3J81j 1XYIA 2BH2A 3JC66 3RZDB 2E74C 4LF9Q 3V96A 4OO1I 4F88A 1N33Q 3RUZA 1ZYRD 3T1YQ 4BBSH 1SMYC 4FP5D 4FF2A 1Y1VH 1EU3A 4KK7A 3S24A 1PRTB 2Y0SE 5M5YB 1FNUA 4G57A 4JI1Q 3G4SA 4CJ2C 1EIGA 2L9HA 3PIO3 5ISRA 4LUZA 4ZLTF 1TWHB 1PFNA 4OIKA 5CBAE 1QZGA 2VNUD 4JI0L 3BU2A 5G3LF 2AKWB 2NVTB 2IHEA 4DXFA 4DV7L 1LTRD 3GTQH 3SK5A 4LFCQ 4RMFA 1LTID 1O7IA 4IN3A 1EIYB 1TR5A 3I4OA 5J1ZA 1ENCA 4C3IB 4BBRH 2PI2E 3OTOL 1VQ5A 3GTPH 1JE5A 5EPJA 2F3WA 4A3IB 1YVCA 2HUGA 4B3TL 2VL6A 1PFBA 1PTOB 2BE5D 1IHZA 4GKJQ 4H44C 3VR2A 1S3OA 1JE4A 1VQCA 3GV3A 2VB3X 2PNRC 4WRDA 1F9PA 4EX5A 4OWWB 2P5ZX 4MIUA 4GLAC 5JPNC 3EROA 2QDBA 2NZHA 1AH9A 1VQ4A 5NUCA 1IYVA 4Z9CB 5DM63 4AQYL 2TMPA 2IX1A 1F2MA 3HKZG 2F0OA 3KLWA 1QUQB 2Z8LA 1FD7D 3IRBA 3HOXH 5FLXc 4IFDJ 2NTSA 4PV1C 3VYUA 3HOYH 1F9SA 3JAML 3M85A 3S1NB 3IFDA 2ZXRA 3K59A 2UUBL 2B2YC 2Q2HA 2JE6I 3F2BA 4KY5A 2R7FA 3H0GB 3MC0B 1EYAA 2EXDA 1HPCA 1HTLD 1KNEA 1UUPA 1CM9A 2IT1A 1AP0A 1YITA 2F4VQ 2MQHA 1K8GA 3K5LA 4NXNL 1NR2A 1TS5A 3CF5A 2L4NA 1CHQD 4LFAQ 3STBD 1D5MC 1KHIA 5C4JB 2MGSA 3HOWG 1U4MA 4QIWB 2D0OA 5JEAJ 4RCOA 1WVLA 1XPOA 1E2WA 2E2HB 5FO7B 1HJPA 1UEBA 4I65A 3NUCA 1Q7YC 1XJVA 3JAMi 1EQVA 3ULPA 2NZOA 5K5PA 3S2HH 2NVXB 5IWAL 4YWMA 5M3MG 4P2CB 1SNCA 1JB7A 1AEXA 3HOUG 5A2QL 2ZXOA 4JBWA 3A8KE 1O7YA 1TWCH 1AZPA 5KRUA 3CAMA 4PZ8A 1YJ9A 5LMNL 1SNMA 1VQ6A 3C46A 2SEBD 4IUPA 2AWNA 2VXWA 1AE2A 3L7ZC 2B63H 3S17B 4OL7A 2LKVA 2D62A 3CCEA 1UE6A 2JQOA 3F8TA 1AE3A 3BVMA 4KTAA 1LTSD 1I6HH 3CXCA 4GOPA 1XNQQ 3SXHA 1B7YB 3J7YW 4A3BB 2AHOB 4ULLA 5TSSA 1EFWA 1WCMB 1HXYD 1MSGA 1Y8OB 1SJHD 4HMIA 4Y7NB 2QF7A 1WD0A 1VQNA 1WJJA 1WTVA 4HMJA 1AN8A 1JR0D 2J7ZA 1KIXA 4JI3Q 2JA9A 4C3HH 3VR6A 1CKNA 2QKIC 3DWPA 4R4TA 4DV0L 1QZHA 2UU9L 1V1PA 3L9AX 2A74C 4B3SQ 1HA6A 5KEEA 1SMXA 5FO8B 2YU9H 4H0LC 1YI2A 4NKLA 1N9WA 3MWYW 3CD6A 3FRPB 1OTCA 3HOVG 2HD3A 3EFXD 1KNAA 2JEBI 4OO1H 2PQAA 3GP7A 1YHAA 1D6EC 3KF6A 4XTCS 1H9SB 2PZWA 1Q8KA 1N36Q 1WYDA 1PDQA 2K5QA 3SR1A 1Q1BA 1DZ1A 4A75A 5M5XH 3S2DH 4IO9A 4JV5Q 1KDBA 1SEBD 1MI2A 4KV6A 5CV6A 1IKLA 1LM0A 2LS01 4A3KG 1NMFA 4BA2I 3QOJA 1GUSA 3A5ZB 3R8BA 4HSVA 2JP1A 1GJXA 1K28A 4PMWA 1HNWQ 4Q0FA 2DNEA 4KHZA 3T13A 4MHEA 3EA6A 3RN2A 1NJIC 1ICFB 2F0HA 1ASYA 2AUJD 1FJGL 3IKJA 3T53B 1PH5A 2BCOA 1VF5C 3UE1A 4ALPA 1IBLQ 2QA4A 5KNDA 3T4AC 2JA7B 4DFAA 5FK9C 4A3IG 1JORA 1QILA 1PYBA 4NP5A 2AMCB 2OQ0A 5JOBA 1BOSA 2BDNA 2OF1A 4B9XA 5JJZA 2CW0C 2Q8RE 4A3CG 1J6QA 1PFMA 2EOTA 4CKEA 4K0KL 3KDFA 2UXCL 2QEJC 1PA6A 4JW0A 3ERQA 1VQLA 1G51A 2XIWA 1K83B 3CC2A 1EEFD 4IPDA 1FL0A 4A3GB 3AEVA 3TP6A 1QB5D 3HFZB 1GUWA 1PZKD 2F0KA 3CRKC 4IALA 1K0RA 2Y0SB 2Q8TA 2UUAL 5EJWA 4DR6Q 3ZYYX 1DJRD 2B2TC 4LUVA 5JVG3 1SYCA 3S16H 4DR1L 2FFKB 1P8LA 3QB3A 4DAYA 3H0GG 1PTOC 1SAPA 3J7A5 3W1GA 4GN5A 2Q2IA 5C4ZA 4RH6A 2B29A 4V190 1HUNA 2J0TD 2X6LA 2EQSA 4FYDA 3TRZA 4ZRZA 3RLOA 3S1QB 1CQFA 2CH4W 4DV2L 4DAPA 1NTGA 4LF5Q 2VQFQ 2C5CA 5ELBA 4P72A 1HR0W 5IYDG 2QCPX 2ZTCA 3MXGA 1M4VA 1ET6A 2E5LL 3SHLA 1UEAB 2MNAA 4OELB 5M5WB 4X64Q 1B3QA 1TQOA 2XRQD 4QF4A 2DY8A 2F3VA 2QILA 4Q5VA 1BF4A 5GAEC 3GV6A 1IYJB 3GTLH 2EYPA 1CSPA 1U0LA 2MO1A 4HIKA 4UY8C 1IBMQ 2IW3A 2JN4A 4X3UA 3UDIA 4KI0A 2CQAA 5DLQE 5C3XA 2NVYB 1O80A 3CCVA 1B9NA 3I72A 2IY5B 2Z6KC 2NUCA 3BG3A 1ZYRC 4RG1A 1X55A 4J1MA 3G48A 1MSHA 4JBKA 4DV5Q 3K58A 4JI4L 2YYZA 5HY6A 1WCMG 1HNZQ 4DV1Q 4JYAL 1IZ6A 5M3MH 5DAUA 1XPUA 4OXPA 1I50H 3R3OA 4GKKQ 5IT9L 5IGCA 3G6EA 3VDYA 2E8GA 2F0WA 1HZCA 4OIJA 4A3FG 1IL2A 1LO5D 1EU4A 2HHHQ 3E9IA 4CKCA 1HA5A 4DV6Q 2DNCA 2K52A 1MD2D 2ENBA 2K04A 4NDXA 2X6GA 5I2XA 4KMUC 4A3DB 1XWEA 4BXXG 2BE5C 3J81c 5DNFA 3NEMA 2ZJRA 3DWAA 5ELEA 2F0QA 3GO5A 1SNOA 5M3FB 1L1OA 2JA6B 4KKTA 1J5EQ 1SNDA 5D3DA 4IJHA 3K80C 4RA8A 4N9PA 3SK8A 2WACA 1J8IA 1G6ZA 4RKLA 5CBEE 4XYOA 3BZKA 3DXJC 3D6WA 1N34Q 1IXRA 1IBKQ 2A69D 4DR5L 1KC8C 5FLXE 3E5SA 2PMZE 2EY5A 3A56A 3CCUA 2QEXA 3HOVH 2EYMA 4IPCA 1DOLA 1M1KC 4IPHA 1VQEA 3RZDH 4CDFC 1RKNA 2DN8A 3GTJB 4O1NA 1HNXQ 1ET9A 1V1QA 4A76A 2ZM6Q 1CUKA 3KFUA 4K5WA 3Q24A 2JA7G 3J80c 4A3KH 1TWAH 3T56B 3ERSX 1EIFA 1IL8A 3STBC 1SRUA 4K5VA 1T5XD 1TWHH 1EOTA 4JG2A 4P74A 5JAVA 3I55A 2ZJPA 4GNXB 2FJ2A 4HN7A 2D0PA 4DV4Q 1C7YA 1E1OA 4F8MA 3P7JA 1HR0Q 3F2UA 1WTOA 4RCNA 3M4PA 2CVRA 1JJCB 4FNFA 3PUZA 1I6VC 1S5DD 2XRSD 4I7ZC 4YHHQ 1I4QA 1UE1A 3D6CA 4A3GG 4DPGA 3NHHA 2O2LD 1QNUA 2UXDQ 4A3IH 2SDFA 4WJ3M 4UP9A 2Y0SG 2F4IA 4L5TA 4WFN3 4HCEA 4P73A 4CGYB 1AZQA 3PIP3 4GZYC 1M8AA 3FKIB 2JEAI 2NB0A 3UE0A 1D5XC 3GTGB 4ZKCB 1XTDA 2EY1A 5GADC 1FGBD 3OIQA 5C0XG 2IPKD 5COYA 5GAHC 1RJTA 2CH4A 2UUCL 4JBMA 3GTOB 4IFDG 1BQQT 5C44B 2CCZA 1EWIA 1Q86C 3PV0A 2AWOA 4POGA 1STNA 2JA8B 1K8OA 4LWCA 4RGOS 1XMOQ 1GO3E 2ALYB 2N49A 5IGEA 3U9SA 1PXUA 1GD7A 2IX3A 3E3XA 4K6LA 1A2TA 2KA7A 2F52A 2OEOA 2R7DA 5IYBG 3CC4A 1X3PA 3CCJA 2RSOA 3DEPA 1X56A 2B2WC 1HHVA 4BY1G 3G6JB 3UDFA 4WORA 1BCPD 5JEAG 4H02A 4C1NK 1X54A 2CFMA 1X3FA 1QWYA 4KJNA 4IUTA 5J39A 4LF4Q 5CR3A 4DR3Q 2YV5A 1PYWD 4DR2Q 4IUUA 1ZXTA 1LTTD 4DAVA 3A8JE 4X66L 1K3BC 3LWEA 1S5BD 3MTSA 1GM5A 4N8FA 2E2HH 3K7AB 5IYDH 4A3MB 3W1BA 4X65Q 1UE7A 3D8GA 2B2UA 3M7GA 4ME5A 3HP3A 2BA1A 4ZKBB 1VQIA 4UP8A 4DNIA 1CTMA 3U9OA 3CW2C 3L3OC 4BA1I 2NVXH 2HCIA 2C9OA 5D3IB 2DGYA 5FLMG 4N8X1 2F3IA 5IP7G 1Q3LA 4IOCA 3MHBA 3EN2A 3K0XA 4QQBX 4U673 2R92B 4ZQ3A 5JJLA 2I5MX 2UXBQ 4LK1C 5IGFA 3I2ZA 1N32L 3S17H 1JICA 2N8NA 1YNND 3TDQA 4UDUC 3NPPA 1ESFA 1SJED 2K5HA 1GVPA 1Q46A 2JYOA 4X3TA 1I4XA 1S5ED 4L8JA 3S15B 1E2VA 2MJ8A 4JI7L 4DK1A 1PZID 4TQUS 1WCMH 1Q1EA 1XX8A 1FGUA 1MJCA 1SYBA 1CA5A 4Y7NH 3TS2A 4A3DG 2A8VA 5IYCG 4B9WA 2KHJA 2OXPA 4J15A 2DUDA 3PMFA 5M3FG 2JA6G 2DJFC 4RHSA 2EY2A 1VQJA 2I46A 4JOIA 4LFCL 4A3FH 4DKAC 5LL6X 1SBBB 2XNAC 2B2VA 3C3LA 2L11A 4JI0Q 4FXDA 2FMCA 3QO2A 4KHVA 1UAPA 4DV7Q 1D1KA 1ILQA 2BOSA 4P71A 1BDOA 5KGUA 1PFSA 2NZ1D 4UPAA 3UDGA 3ICEA 1JWSD 4BXXH 1RF2D 2RF4A 1KAAA 1NNXA 1OXSC 1BBXC 1RL2A 1BCPB 1EQTA 4K8IA 1UE5A 2I5LX 4HR7B 3PUVA 2EYJA 1W6KA 4DUYL 3PO2B 4S3SA 4XQQA 1R4PB 2M00A 5CMDA 5C0XJ 2IX0A 1S5CD 5I9OA 2ZXPA 3R2TA 4MZ9A 5ELDA 2R7ZB 1HCZA 1Q82C 2F0UA 5CGKA 4LF8L 3AYHB 2AQ2B 1CI3M 1K73C 3X3NA 3TP7A 2EYHA 3FVQA 1L1OC 1YNJD 3A74A 2WFWA 1VQAA 4KHPL 1Z7TA 4CJ1B 2JA7H 5FKAC 3TEHB 1SSOA 3F1ZA 4XT3B 2RHSB 3RN5A 4L5RC 4BY7H 2MPMA 2F0NA 1KDAA 3C2PA 4AYBE 3KYHC 1STGA 3C1EA 3PQIA 1KDCA 2C35B 1EYGA 1SFOH 4IJLA 3FKIG 2SNSA 1G8ZD 2PMZB 2FINB 2JK8A 3IL8A 4B3MQ 2ZT9C 2H4OA 2QGQA 4GNXC 3FP9A 4FVMA 2GVAA 4DU9A 1ZKOA 4QGUA 4GS3A 3QG1A 3JAMc 5D65A 1VQOA 2E2JB 1K83H 5C44G 1ICWA 1SROA 2H5XA 4A3GH 4NB3A 1RCVD 1D7QA 4A3JB 4R8IA 4H13C 4DUZL 1BBUA 4F87A 4HJ5A 4KD4A 1AFPA 3CCRA 4HSPA 1DYQA 5IWAQ 3MEFA 3KLRA 4CJ0B 2N3SA 4P75A 2YTXA 2CQOA 1JOOA 1E2ZA 2KJXA 1TY0A 3AU7A 1GUTA 1VQKA 3I4NG 5LMNQ 2EJFC 1XTCD 1I4RA 3ZJYC 3TQYA 4IFDH 5E1FA 3PF4A 3OHXC 1EY4A 1TWGH 1TVXA 4L5QA 3RMHA 1S4ZA 3SVMA 3J81E 4JC0A 3S1QH 2YTVA 4C2MB 3K0YA 4PQXA 3D0FA 1M90C 3OMGA 4ZK9B 4GOPB 4QB4A 5GQOA 4ODGA 3D3RA 3OW7A 5BR8L 4A3MG 3GTKB 2K33A 1A62A 3WOEA 4JI6L 1JWMD 2F0JA 1WTXA 2F03A 5M5WH 3WDNA 2PW7A 1CQVA 3K6OA 1WOCA 1W2BA 4BY1H 1SE4A 3S14H 4KLKA 3A5UA 3NE5B 5HURA 2V1CC 5JEAH 1GKHA 1CKNB 3D4DA 3A0JA 2A69C 2UU9Q 4MNOA 4K8JA 4RFBA 1V1PB 3HKZE 2N55A 2VUMB 1S72A 2R92G 1JOKA 4LJZC 3HG9A 5EKLA 1KTKA 3WWVA 4JV5L 3VYTA 2OT2A 2VY3A 2NVYH 4R4OA 4HCSA 1HQRD 3EQLC 1ASZA 3J80E 2PQAB 4KKSA 3KF6B 4YWLA 2KECA 2K7VA 4DV3L 1MKHA 4JI2L 4X62L 1HQMC 2ZJQA 2A6ED 3P75A 1A3VA 3M4OB 2F0GA 2HQLA 1KQSA 4DNTB 5FLMH 5IP7H 2KBNA 1VQGA 3T1HL 2OTLA 3H3VC 1E24A 4C3IG 1MIUA 4J8QA 2E75C 3KUPA 4XIGS 2Z4HA 3H6MA 3HOYB 1Z6HA 3K57A 4YY3L 2ES2A 1RTNA 2DJGC 1PRTF 2RHQB 3BZCA 5JJIA 3NBHB 3VYRA 1FNWA 2A6HD 1KLGD 2O4XA 4XYQA 1XNRL 1H95A 2EDGA 1VS0A 5L37A 4A3DH 1IW7D 4DR7L 1XPRA 2NN6G 2XN9C 4YIJA 2HIVA 5EKKA 4LFBQ 2Z4IA 1QOHA 2K75A 1O7LA 3S9WA 5M3FH 1QVFA 3GTMB 2VW9A 1KD1C 3OW2A 3PO2G 1MGSA 1EYDA 4IUVA 1DGSA 5CV8A 1KXLA 4EGVA 5G3LD 2A73B 4DR4L 1VQDA 2L55A 3KDFB 1C9OA 3FPUB 4B3RL 1LTBD 4O42A 4G7ZC 5C6AA 3NQTA 2ATWA 4JVZA 1K3RA 3RLFA 1PTOF 1II3A 4H7BA 1I3QH 4G4KA 2F0SA 3QOLA 1TWCB 1LLRD 2UUAQ 2LSSA 4TKOB 4WJWA 3M4QA 1TT2A 1I4HA 1BR9A 3EVQA 2NN6I 2Z1CA 1YHBA 4OGQC 4DGZA 1BCPC 3G71A 2MHVA 3OIPA 2F0FA 4LF7Q 2K32A 4DAYB 1NAPA 4RWSC 3EIVA 3D4WA 3G7LA 3MXNA 1NMGA 1RIPA 4LF5L 2L0CA 3FMCA 1EWHA 1ZEQX 4KJOA 3J7ZC 2Q8IB 1CT1D 1Y69U 4LMQD 4CHTB 1W3SA 3HOZB 2K28A 1X3GA 1G91A 1JC7A 5CV4A 3C1FA 5FJ8G 2DY7A 1TWFB 5KYIA 3HOWH 4L63B 5C4HA 2Z6BA 1X32A 1IBML 2YU9B 3VA5A 4K6DA 3CPWA 1HFNA 1PH4A 3UDXA 3S1MB 1OXXK 3F2DA 1B53A 3FKIH 5AJ3L 3GTGH 5IE8A 5CV7A 2SNMA 1B3AA 3BZDB 4IURA 2X69A 1YNNC 4JI8L 1VQBA 3DWQA 4A3BG 3TP8A 5K36G 3HS0C 3S2DB 4QMGA 3GTOH 4HTHA 1H9KA 2OWOA 3HOUH 3RZOB 5C44H 4MTNA 5C5LA 4DV1L 3H91A 4ME3A 4HIMA 1QCBD 2JA5B 3EBEA 5IP9G 1GHKA 1F9RA 4PG3A 3KLSA 1WFQA 4JI4Q 3VA7A 3K81C 4YWKA 4WJ4A 4JYAQ 2Z0SA 2JSOA 2OCEA 3MFYA 4C56C 4EQNA 1LACA 2VQEQ 2EJMA 3I4NH 2ICIA 4DV6L 4HJ9A 4O2DA 5JJKA 1TKWB 3HZXA 3SK4A 3MXPA 5IODA 4GLXA 2AQ3B 4FF1A 2VUMG 3HRZC 3PGZA 1VCIA 4POFA 1U9RA 3BJUA 5KNCA 2FHTA 1J9OA 1EY0A 3UI2A 3K7AH 4FO2A 4A3MH 2WB1E 4OWXB 3CQZB 4GOPC 5IT9c 4EQ5A 4IPGA 2RBMA 4M1UB 1PZJD 2B2YA 3J80L 3QR8A 4FXKC 4K2LA 5C4XB 1L1OB 4PNYA 2KCTA 3AB9A 3H3VH 1KRSA 4XT1B 1SE2A 4DAMA 3M9BA 4KKUA 2R92H 4PMCA 4QIWE 2TSSA 1LT5D 2RDFA 4QJFA 1B9MA 4OX9L 5HGQA 1HNXL 1YNJC 1RDPD 5E7NA 5M5YH 3HOYG 1LUZA 3I4MB 1A63A 4QUCA 4NXMQ 4RAUC 2NWGA 3S15H 4N9TA 3I4LA 2KEEA 5I9PA 1JCKB 3NELA 2CWAA 1Y1WB 4ABNA 1F9QA 3VR4A 3J80i 1VQ8A 1VF7A 2XWJB 3AMUA 2NVTH 4QCLA 2LFNA 4DV4L 3CKIB 1OXTA 1HR0L 4JCVE 1IKMA 1BXTA 1SYFA 4L5SA 1WI5A 5C3EB 2R93B 1BBWA 3ND8A 1XMQQ 4O0AA 4C3IH 1LTAD 1H9MA 3E0EA 1X3EA 1U5KA 1STEA 1PH3A 1PLFA 1I94Q 5IGGA 4EQOA 1Q81C 1WTPA 2K14A 2UXDL 1WTRA 2MO0A 2KCCA 1PTOH 3A7LA 3NWTA 5I6YA 1HFGA 1SYDA 1HRJA 1GUGA 3PUWA 1VMPA 1A0IA 2N88A 4A3CH 2A1AA 2WV6D 1SN8A 2K5DA 2NN6H 3MXUA 1PRTD 5DEHA 1NUCA 2G9HD 4CKBA 1DCZA 4U68A 2NVQB 3PO2H 1EY9A 2O5JC 1DOMA 3BYTB 4NW2A 3CCLA 1Y14B 3VR5A 1JOQA 2E2IB 5DM73 1YJWA 5HGTA 2KHIA 1H9RA 4IQZA 1E0BA 2F0MA 2F0VA 3I90A 3I8ZA 4MTKA 1KLUD 2J4XA 3Q23A 2UUCQ 3S1NH 5CC4A 2XGTA 5ELCA 4JI5L 2WKCA 5ELOA 2ASBA 3H0GH 1TY2A 5FOBB 3QIAA 3U4VA 2Q2TA 1I50B 1EIHA 3HOZG 4G7OC 3SDZA 2KCMA 3OMCA 2K03A 5C0XI 1CZWA 4LUOA 2H1EA 5CV5A 4DK6C 5T1IA 3QJYA 5C4JH 4PZ6A 3SGIA 4IFDI 5EKIA 3BDOA 4DR3L 4DR2L 2F0PA 1FYCA 4FXGC 2IJ0A 2KHSA 5KNBA 1VQFA 1L0WA 3W5OA 5I4DA 1C4QA 1LYLA 3M3YB 1Y8NB 4UP7A 3LX0A 4AIMA 3A55A 3TZDA 3B6YA 3RD4A 1JT8A 1EEID 2HDLA 3HGBA 2EVBA 2E2JH 3KF8A 4XDXA 3K5MA 2A6EC 3S1RB 1O78A 5KYLA 4LF6L 2JA5G 3NTHA 3CC7A 3GQBA 2RKSA 4NPSA 4TVAB 3RNUA 4LF9L 3CCQA 3TP5A 1FVIA 2GA4B 1N33L 5LMUQ 2RVLA 1LTGD 3I91A 3T1YL 1D1IA 3HKSA 4OHJA 5F2DA 3NTIA 5LMNW 3HOVB 1C48A 1EFID 1EYCA 5CYUA 4JI1L 2EXZA 1L2FA 3MEHA 4R4QA 4A3BH 5EPKA 5K36H 3P1HA 3TREA 1N32Q 1K0SA 1CA6A 3MAQA 3NTKA 2PCFB 2ID0A 2MP1A 1GXDC 3KOJA 2A6HC 4DXGA 5IOCA 4A3KB 1X3QA 4C2MH 1TWAB 5IP9H 3KJPA 1IW7C 4V0BA 2RA4A 4JI7Q 1OXUA 3LWUA 3Q22A 2O5IC 3GTKH 4CDDC 2PNHA 3J7AV 2B2TA 2MUYA 3FHWA 4E6IA 1MBYA 3N52A 2HCCA 4AH6A 5C4XG 4HJ8A 2A5HA 3F2CA 1CKOA 5FLXL 1KL9A 3OTOQ 4GKJL 3OSOA 2QDLA 2VUMH 2I07B 4C3JB 1ONLA 4B3TQ 1JQYD 1D2BA 1HTPA 2WAQE 1I5FA 4TSSA 2V4DA 1STAA 1W6JA 2BH8A 3I4MG 2RCFA 2HT1A 1GOZA 5J3BA 1SDFA 1QUQA 1TS3A 1EZ8A 3PO3B 5C5MA 3TN2A 1A15A 3VR3A 1TS4A 4ZUJA 2XVSA 3E9HA 1Y1WG 3U58A 3M4OH 4DUYQ 3NQIA 1R9TB 1B70B 4AQYQ 1CKMA 4RHRA 4DK0A 3PIPA 5E4XA 1EUJA 3OPOA 5C3EG 2R93G 2EY6A 4F7XA 2F4VL 4LF8Q 1L0XB 4PZ7A 2UUBQ 4LFAL 2KUMA 2EYLA 4NMZA 3J7AF
chains in the Genus database with same CATH topology
1KAWA 2K5NA 4YY3L 2ES2A 3CMAA 2RHQB 4QL5A 2Z6KA 3BZCA 4DV6Q 4A3EH 5JJIA 3NENA 2K52A 4KHPQ 2VS1A 3NBHB 3L2PA 4A93H 4NXNQ 2YTYA 1PH8A 1XNRL 1H95A 4OO1G 1VS0A 4X65L 4A3DH 4BXXG 4DR7L 3J81c 2ZJRA 3NEMA 4R4IA 1XPRA 2NN6G 4B3ML 3GO5A 1LTLA 1E1TA 2HIVA 4HIDA 4LFBQ 1HH2P 4IOAA 1KRTA 2K75A 1D8LA 5M3FH 4YCWA 1L1OA 2VZAA 4X66Q 1QVFA 3GTMH 2VW9A 1J5EQ 1G291 1V9PA 1KD1C 3OW2A 4IJHA 3K80C 3PO2G 1BVSA 1K8AC 2K5VA 5FJ8H 4A3JH 1PH2A 2JA8G 1DGSA 3I7FA 1KXLA 4DR4L 1VQDA 3BZKA 4DK3C 1N34Q 2BA0A 1IXRA 2UXBL 1IBKQ 1PYSB 3KDFB 1C9OA 4DR5L 1KC8C 4B3RL 2PMZE 3CCUA 4AYBG 3K8AA 1E22A 2ATWA 2QEXA 3HOVH 1K3RA 3RLNA 5LMUL 3RLFA 3KF8B 4IPCA 1M1KC 4LF6Q 3J81j 4IPHA 2BH2A 1VQEA 1I3QH 1YJNA 4DUZQ 3JC66 3RZDH 1NBWA 4LF9Q 1XNQL 1N8RC 2LSSA 1HNXQ 2UUAQ 4OO1I 3M4QA 1V1QA 4A76A 2ZM6Q 1N33Q 1CUKA 3KFUA 3T1YQ 4BBSH 2NN6I 2JA7G 1Y1VH 3CCMA 1YHBA 3J80c 3S24A 4A3KH 5EAYA 3G71A 1TWAH 2Y0SE 3ERSX 1EIFA 4LF7Q 4FDBA 4JI1Q 3G4SA 3STBC 5ELNA 1SRUA 4JI3L 4DAYB 1YNXA 1G6PA 1SR3A 3EIVA 2KENA 4LUZA 1PH1A 1NMGA 1TWHH 1RIPA 5IYBH 1YHQA 4JG2A 4P74A 4LF5L 2LXJA 3I55A 2ZJPA 4GNXB 1QZGA 2D0PA 4DV4Q 1C7YA 2VNUD 4JI0L 1E1OA 3J7ZC 4Y52H 3BU2A 4LW1A 2AKWB 1HR0Q 4B3SL 4GN4B 3M4PA 2IHEA 4DV7L 1JJCB 4HJ7A 3PUZA 1W3SA 3GTQH 1VQPA 3HOZH 2B3GA 4LFCQ 4YCUA 1X3GA 4RMFA 4DV0Q 1O7IA 1EIYB 1JMCA 5BR8Q 4YHHQ 3I4OA 1UE1A 4APVA 3PIOA 4BBRH 4A3GG 3PF5A 2PI2E 4DPGA 5FJ8G 3OTOL 1N36L 1TWFH 1VQ5A 4JI6Q 5IY0A 3AFPA 3HOWH 3GTPH 2UXDQ 4A3IH 1JE5A 4WJ3M 4UP9A 2Y0SG 1IBML 1YVCA 4L5TA 4P73A 4B3TL 2VL6A 3CPWA 1PH4A 3S1MH 3UDXA 1OXXK 3F2DA 1PVOA 3FKIH 5AJ3L 2JEAI 3UE0A 3GTGH 3D31A 4A3LG 4GKJQ 1XTDA 5IE8A 1S3OA 2LXKA 1VQCA 3ER0A 2K4KA 5GADC 5C0XG 4JI8L 4EX5A 1VQBA 5GAHC 4OWWB 4A3BG 1HNWL 5K36G 4GLAC 1EQQA 2UUCL 3TS0A 4JBMA 3GTOH 4IFDG 1HZ9A 2OWOA 2NZHA 3HOUH 3RZOH 5C44H 4MTNA 1VQ4A 1EWIA 1Q86C 4DV1L 3PV0A 2CCZA 2AWOA 4POGA 4AQYL 4ME3A 4HIMA 4JBJA 2IX1A 4LWCA 3CMEA 1B8AA 3HKZG 2JA5H 4DV3Q 3PCOB 3EBEA 5IP9G 1XMOQ 1GO3E 2ALYB 2N49A 4JI2Q 4X62Q 1AH9A 1GD7A 3H3VI 3KLWA 1QUQB 4PG3A 3IRBA 3HOXH 1VQHA 5FLXc 1WFQA 4IFDJ 2N78A 1IBLL 4JI4Q 2F52A 1FJGQ 3K81C 4YWKA 1NY4A 2R7DA 1MJEA 5IYBG 3CC4A 3HOYH 3M85A 2Z0SA 4JYAQ 1YZ6A 4WJ4A 2UUBL 2OCEA 3CCJA 1N32L 2Q2HA 2JE6I 3F2BA 1X56A 2VQEQ 2R7FA 3T1HQ 2EXDA 4BY1G 3UDFA 3I4NH 2XTIA 2IT1A 4DV6L 4HJ9A 1YITA 4O2DA 1QVGA 2F4VQ 2MQHA 5JJKA 5JEAG 1K8GA 2R6GA 4H02A 1X54A 4NXNL 2CFMA 3CF5A 1X3FA 3STBD 4LFAQ 4GLXA 5IYCH 2VUMG 4LF4Q 2I0QA 1KHIA 4DR3Q 3PGZA 2YV5A 1VCIA 4POFA 4YY3Q 4DR2Q 5GAGC 2JA6H 3BJUA 2WP8J 3HOWG 4LFBL 2D0OA 5JEAJ 4X66L 1GM5A 1XPOA 3K7AH 2E2HH 4A3MH 5IYDH 1HJPA 1XNRQ 1UEBA 2WB1E 3W1BA 4X65Q 1UE7A 3CQZH 4OWXB 4GOPC 2R7ZG 4DR7Q 2K50A 5IT9c 1Q7YC 2BA1A 2L15A 3JAMi 1XJVA 4EQ5A 4IPGA 4K0KQ 2UXCQ 1VQIA 4UP8A 4DNIA 3PO3G 3ULPA 2NZOA 3CW2C 4BA1I 3S2HH 2NVXH 4DR6L 5C4XH 1L1OB 1OXVA 5IWAL 3CP0A 2RCNA 4YWMA 2KCTA 5M3MG 2DGYA 1JB7A 3H3VH 1KRSA 5FLMG 2F3IA 5IP7G 4DAMA 4IOCA 3HOUG 3M9BA 4JBWA 3EN2A 3K0XA 4DR4Q 4QQBX 2R92H 1TWCH 3GTJH 5JJLA 2I5MX 4QIWE 3CAMA 4JOIC 2CKZB 4PZ8A 1YJ9A 2UXBQ 5LMNL 4QJFA 1VQ6A 4OWTB 4QY7A 5HGQA 3I2ZA 4OX9L 4B3RQ 2AWNA 1HNXL 1AE2A 3L7ZC 2B63H 4DR1Q 3S17H 3KJOA 2D62A 2N8NA 3CCEA 5E7NA 5M5YH 3HOYG 1LUZA 1UE6A 2JQOA 3F8TA 3I4MH 1AE3A 1A63A 2K5HA 1GVPA 2PI2A 2WB1G 1Q46A 3GD7A 2A19A 4NXMQ 4HIOA 2GN5A 1I6HH 3CXCA 3S15H 4LF7L 4A3EG 4GOPA 1XNQQ 1B7YB 3NELA 4JI7L 2CWAA 4A93G 2AHOB 2VQFL 1Y1WH 3PUXA 1EFWA 4TQUS 1WCMH 1Q1EA 3J80i 1FGUA 1VQ8A 1MJCA 5GROA 4Y7NH 3TS2A 4A3DG 1HZAA 2NVTH 1VQNA 2A8VA 1WJJA 5IYCG 4DV4L 4X6AH 2KHJA 4YCVA 1OXTA 3CCSA 4JCVE 4J15A 1Z47A 4X64L 2DUDA 2JA9A 1Z9FA 5M3FG 4C3HH 4DV2Q 1KIXA 4JI3Q 4L5SA 2JA6G 1JJGA 1WI5A 5C3EH 2R93H 1BBWA 1CKNA 1VQJA 2ZTEA 1XMQQ 3MXNB 4JOIA 4O0AA 4LFCL 4R4TA 4C3IH 4DV0L 4A3FH 4DKAC 1QZHA 4A3JG 2UU9L 3E0EA 2OTJA 2E5LQ 1X3EA 1U5KA 4HJAA 4JI0Q 2HIXA 1PH3A 1I94Q 4B3SQ 1TXYA 4DV7Q 1Q81C 1SMXA 2K14A 2UXDL 2YU9H 3AQQA 2MO0A 1YI2A 1N9WA 4P71A 3CD6A 3PSIA 1OTCA 3PUWA 3HOVG 1PFSA 1A0IA 4UPAA 3UDGA 2JEBI 2PQAA 1YHAA 3ICEA 4A3CH 2A1AA 3KF6A 4XTCS 4BXXH 1SN8A 1Q8KA 1N36Q 3LGJA 1WYDA 1Q1BA 4A75A 4LNQA 2RF4A 5M5XH 3S2DH 1OXSC 4IO9A 1A8VA 3L0OA 1RL2A 4DV5L 4JV5Q 1UE5A 2I5LX 1EOVA 3PUVA 3AFQA 3PUYA 4DUYL 1HNZL 2NVQH 1P16A 3PO2H 4BBSG 1LM0A 2JJQA 3CCLA 5C0XJ 3U4ZA 1Y1VG 5AJ3Q 2IX0A 2JA8H 3DLLA 4A3KG 1Y14B 3ULLA 1NMFA 1QVCA 2E2IH 4BA2I 4GN3B 1YJWA 4GKKL 4MZ9A 2KHIA 4JI8Q 3A5ZB 1Q82C 3H15A 4PMWA 1HNWQ 4KHZA 3Q8DA 3ULJA 4LF8L 2UUCQ 1SLJA 1EQRA 4OONA 3S1NH 2EIFA 1E7ZA 1NE3A 3AYHB 3RN2A 1NJIC 4GLVB 2XGTA 1ASYA 1FJGL 1C0AA 2HHHL 3GDEA 4JI5L 5ELOA 2ASBA 1CSQA 3H0GH 1K73C 4R1JA 3U4VA 1PH5A 1PHJA 2Q2TA 4LF4L 2VQEL 1L1OC 1HR0L 1SE8A 3UE1A 3A74A 3HOZG 4ALPA 2WFWA 1VQAA 4KHPL 2KCMA 1IBLQ 2QA4A 1YEZA 3U50C 5C0XI 4LUOA 4DK6C 4BBRG 1PH6A 2JA7H 3TEHB 3F1ZA 2RHSB 5C4JH 3RN5A 4PZ6A 3SGIA 4L5RC 2MFIA 4IFDI 4A3IG 4DR3L 3RR5A 4BY7H 4DR2L 1S40A 1J5EL 1PYBA 4AYBE 3KYHC 1X6OA 2FXQA 2C35B 1EYGA 1SFOH 1VQFA 2AMCB 2CWPA 2OQ0A 4IJLA 2GVBA 1L0WA 3J81i 3FKIG 3W5OA 1LYLA 2JK8A 3K7UC 1E3PA 1X65A 4A4IA 4B3MQ 3M3YH 4A3CG 4UP7A 1J6QA 4AIMA 1V43A 1N34L 3B6YA 1VQMA 2QGQA 4K0KL 3KDFA 3FP9A 4GNXC 1IBKL 2GVAA 2UXCL 1PA6A 1JT8A 4QGUA 4GS3A 3JAMc 1VQLA 1VQOA 1VQ9A 1G51A 2E2JH 1K83H 5C44G 3S1RH 3CC2A 4IPDA 1SROA 2H5XA 1FL0A 4NB3A 4A3GH 1D7QA 4LF6L 3AEVA 2JA5G 3CC7A 3HFZB 4DUZL 1BBUA 4NPSA 4TVAB 4HJ5A 1K0RA 4DR5Q 3HOXG 3RNUA 3CCQA 2UUAL 4LF9L 3CCRA 4DR6Q 4R4CA 1FVIA 2ZM6L 5IWAQ 3MEFA 5LMUQ 1N33L 4LUVA 2N3SA 3T1YL 3HKSA 4P75A 2YTXA 2OQKA 2CQOA 3S16H 4DR1L 5LMNW 4A3LH 1P8LA 3H0GG 4JI1L 1L2FA 4NXML 1VQKA 4R4QA 3I4NG 3J7A5 4A3BH 3W1GA 4GN5A 5LMNQ 2Q2IA 4OX9Q 2B29A 3TREA 3TQYA 3ZJYC 1N32Q 4GNXA 3PF4A 2ID0A 2EQSA 3M7NA 3KOJA 1TWGH 1UWVA 3TRZA 4L5QA 5H1SE 4JC0A 1T9HA 3RLOA 3S1QH 2YTVA 4C2MH 5IP9H 3KJPA 1M90C 3D0FA 4BY7G 4DV2L 4GOPB 4JI7Q 1NTGA 4LF5Q 2VQFQ 5GQOA 1OXUA 4P72A 5BR8L 4YHHL 1HR0W 5IYDG 1XMQL 4A3MG 3GTKH 1HZBA 2ZTCA 1A62A 2PNHA 2E5LL 3FHWA 3I56A 4JI6L 2Q2UA 2MNAA 5M5WH 2I5HA 1YBYA 1I94L 4X64Q 1WOCA 1W2BA 4BY1H 3S14H 4KLKA 4AH6A 3A5UA 5C4XG 4HJ8A 2V1CC 1PV4A 3DM3A 3F2CA 1CKOA 1CKNB 1GKHA 3A0JA 1KL9A 5GAEC 2UU9Q 3OTOQ 4GKJL 4MNOA 1IYJB 3GTLH 1CSPA 1U0LA 3HKZE 2VUMH 2MO1A 4HIKA 4UY8C 4C3JH 1S72A 2R92G 1IBMQ 4B3TQ 3UDIA 3OYYA 4KI0A 1VQ7A 1JJ2A 2WAQE 3WWVA 4JV5L 1I5FA 5DLQE 2B63G 2IHFA 2VY3A 1BKBA 2NVYH 2BH8A 4R4OA 3CCVA 1K9MC 1ASZA 3I4MG 2IY5B 2Z6KC 2PQAB 2HT1A 2R7ZH 5J3BA 3KF6B 4YWLA 4DV3L 1XMOL 4RG1A 1MKHA 1QUQA 1X55A 4X62L 4JI2L 3PO3H 3G48A 2ZJQA 4JBKA 4DV5Q 3CPFA 4JI4L 2YYZA 1Y1WG 3E9HA 5HY6A 3M4OH 3U58A 1WCMG 4DUYQ 4DV1Q 1R9TH 1B70B 1HNZQ 4JYAL 1IZ6A 2HQLA 5M3MH 4AQYQ 1KQSA 5FLMH 5IP7H 1XPUA 4OXPA 1CKMA 1I50H 2KBNA 1YIJA 1X9NA 1VQGA 3PIPA 3T1HL 4GKKQ 3G6EA 3VDYA 2E8GA 2OTLA 1EUJA 1HZCA 5C3EG 2R93G 1E24A 2F4VL 4LF8Q 1PH7A 4A3FG 1MIUA 1IL2A 4PZ7A 2UUBQ 2WAQG 4XIGS 2ZTDA 4LFAL 1Q12A 2HHHQ 4JI5Q 1PH9A 3E9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAW A;  2K5N A;  4YY3 L;  2ES2 A;  3CMA A;  2RHQ B;  4QL5 A;  2Z6K A;  3BZC A;  4DV6 Q;  4A3E H;  5JJI A;  3NEN A;  2K52 A;  4KHP Q;  2VS1 A;  3NBH B;  3L2P A;  4A93 H;  4NXN Q;  2YTY A;  1PH8 A;  1XNR L;  1H95 A;  4OO1 G;  1VS0 A;  4X65 L;  4A3D H;  4BXX G;  4DR7 L;  3J81 c;  2ZJR A;  3NEM A;  4R4I A;  1XPR A;  2NN6 G;  4B3M L;  3GO5 A;  1LTL A;  1E1T A;  2HIV A;  4HID A;  4LFB Q;  1HH2 P;  4IOA A;  1KRT A;  2K75 A;  1D8L A;  5M3F H;  4YCW A;  1L1O A;  2VZA A;  4X66 Q;  1QVF A;  3GTM H;  2VW9 A;  1J5E Q;  1G29 1;  1V9P A;  1KD1 C;  3OW2 A;  4IJH A;  3K80 C;  3PO2 G;  1BVS A;  1K8A C;  2K5V A;  5FJ8 H;  4A3J H;  1PH2 A;  2JA8 G;  1DGS A;  3I7F A;  1KXL A;  4DR4 L;  1VQD A;  3BZK A;  4DK3 C;  1N34 Q;  2BA0 A;  1IXR A;  2UXB L;  1IBK Q;  1PYS B;  3KDF B;  1C9O A;  4DR5 L;  1KC8 C;  4B3R L;  2PMZ E;  3CCU A;  4AYB G;  3K8A A;  1E22 A;  2ATW A;  2QEX A;  3HOV H;  1K3R A;  3RLN A;  5LMU L;  3RLF A;  3KF8 B;  4IPC A;  1M1K C;  4LF6 Q;  3J81 j;  4IPH A;  2BH2 A;  1VQE A;  1I3Q H;  1YJN A;  4DUZ Q;  3JC6 6;  3RZD H;  1NBW A;  4LF9 Q;  1XNQ L;  1N8R C;  2LSS A;  1HNX Q;  2UUA Q;  4OO1 I;  3M4Q A;  1V1Q A;  4A76 A;  2ZM6 Q;  1N33 Q;  1CUK A;  3KFU A;  3T1Y Q;  4BBS H;  2NN6 I;  2JA7 G;  1Y1V H;  3CCM A;  1YHB A;  3J80 c;  3S24 A;  4A3K H;  5EAY A;  3G71 A;  1TWA H;  2Y0S E;  3ERS X;  1EIF A;  4LF7 Q;  4FDB A;  4JI1 Q;  3G4S A;  3STB C;  5ELN A;  1SRU A;  4JI3 L;  4DAY B;  1YNX A;  1G6P A;  1SR3 A;  3EIV A;  2KEN A;  4LUZ A;  1PH1 A;  1NMG A;  1TWH H;  1RIP A;  5IYB H;  1YHQ A;  4JG2 A;  4P74 A;  4LF5 L;  2LXJ A;  3I55 A;  2ZJP A;  4GNX B;  1QZG A;  2D0P A;  4DV4 Q;  1C7Y A;  2VNU D;  4JI0 L;  1E1O A;  3J7Z C;  4Y52 H;  3BU2 A;  4LW1 A;  2AKW B;  1HR0 Q;  4B3S L;  4GN4 B;  3M4P A;  2IHE A;  4DV7 L;  1JJC B;  4HJ7 A;  3PUZ A;  1W3S A;  3GTQ H;  1VQP A;  3HOZ H;  2B3G A;  4LFC Q;  4YCU A;  1X3G A;  4RMF A;  4DV0 Q;  1O7I A;  1EIY B;  1JMC A;  5BR8 Q;  4YHH Q;  3I4O A;  1UE1 A;  4APV A;  3PIO A;  4BBR H;  4A3G G;  3PF5 A;  2PI2 E;  4DPG A;  5FJ8 G;  3OTO L;  1N36 L;  1TWF H;  1VQ5 A;  4JI6 Q;  5IY0 A;  3AFP A;  3HOW H;  3GTP H;  2UXD Q;  4A3I H;  1JE5 A;  4WJ3 M;  4UP9 A;  2Y0S G;  1IBM L;  1YVC A;  4L5T A;  4P73 A;  4B3T L;  2VL6 A;  3CPW A;  1PH4 A;  3S1M H;  3UDX A;  1OXX K;  3F2D A;  1PVO A;  3FKI H;  5AJ3 L;  2JEA I;  3UE0 A;  3GTG H;  3D31 A;  4A3L G;  4GKJ Q;  1XTD A;  5IE8 A;  1S3O A;  2LXK A;  1VQC A;  3ER0 A;  2K4K A;  5GAD C;  5C0X G;  4JI8 L;  4EX5 A;  1VQB A;  5GAH C;  4OWW B;  4A3B G;  1HNW L;  5K36 G;  4GLA C;  1EQQ A;  2UUC L;  3TS0 A;  4JBM A;  3GTO H;  4IFD G;  1HZ9 A;  2OWO A;  2NZH A;  3HOU H;  3RZO H;  5C44 H;  4MTN A;  1VQ4 A;  1EWI A;  1Q86 C;  4DV1 L;  3PV0 A;  2CCZ A;  2AWO A;  4POG A;  4AQY L;  4ME3 A;  4HIM A;  4JBJ A;  2IX1 A;  4LWC A;  3CME A;  1B8A A;  3HKZ G;  2JA5 H;  4DV3 Q;  3PCO B;  3EBE A;  5IP9 G;  1XMO Q;  1GO3 E;  2ALY B;  2N49 A;  4JI2 Q;  4X62 Q;  1AH9 A;  1GD7 A;  3H3V I;  3KLW A;  1QUQ B;  4PG3 A;  3IRB A;  3HOX H;  1VQH A;  5FLX c;  1WFQ A;  4IFD J;  2N78 A;  1IBL L;  4JI4 Q;  2F52 A;  1FJG Q;  3K81 C;  4YWK A;  1NY4 A;  2R7D A;  1MJE A;  5IYB G;  3CC4 A;  3HOY H;  3M85 A;  2Z0S A;  4JYA Q;  1YZ6 A;  4WJ4 A;  2UUB L;  2OCE A;  3CCJ A;  1N32 L;  2Q2H A;  2JE6 I;  3F2B A;  1X56 A;  2VQE Q;  2R7F A;  3T1H Q;  2EXD A;  4BY1 G;  3UDF A;  3I4N H;  2XTI A;  2IT1 A;  4DV6 L;  4HJ9 A;  1YIT A;  4O2D A;  1QVG A;  2F4V Q;  2MQH A;  5JJK A;  5JEA G;  1K8G A;  2R6G A;  4H02 A;  1X54 A;  4NXN L;  2CFM A;  3CF5 A;  1X3F A;  3STB D;  4LFA Q;  4GLX A;  5IYC H;  2VUM G;  4LF4 Q;  2I0Q A;  1KHI A;  4DR3 Q;  3PGZ A;  2YV5 A;  1VCI A;  4POF A;  4YY3 Q;  4DR2 Q;  5GAG C;  2JA6 H;  3BJU A;  2WP8 J;  3HOW G;  4LFB L;  2D0O A;  5JEA J;  4X66 L;  1GM5 A;  1XPO A;  3K7A H;  2E2H H;  4A3M H;  5IYD H;  1HJP A;  1XNR Q;  1UEB A;  2WB1 E;  3W1B A;  4X65 Q;  1UE7 A;  3CQZ H;  4OWX B;  4GOP C;  2R7Z G;  4DR7 Q;  2K50 A;  5IT9 c;  1Q7Y C;  2BA1 A;  2L15 A;  3JAM i;  1XJV A;  4EQ5 A;  4IPG A;  4K0K Q;  2UXC Q;  1VQI A;  4UP8 A;  4DNI A;  3PO3 G;  3ULP A;  2NZO A;  3CW2 C;  4BA1 I;  3S2H H;  2NVX H;  4DR6 L;  5C4X H;  1L1O B;  1OXV A;  5IWA L;  3CP0 A;  2RCN A;  4YWM A;  2KCT A;  5M3M G;  2DGY A;  1JB7 A;  3H3V H;  1KRS A;  5FLM G;  2F3I A;  5IP7 G;  4DAM A;  4IOC A;  3HOU G;  3M9B A;  4JBW A;  3EN2 A;  3K0X A;  4DR4 Q;  4QQB X;  2R92 H;  1TWC H;  3GTJ H;  5JJL A;  2I5M X;  4QIW E;  3CAM A;  4JOI C;  2CKZ B;  4PZ8 A;  1YJ9 A;  2UXB Q;  5LMN L;  4QJF A;  1VQ6 A;  4OWT B;  4QY7 A;  5HGQ A;  3I2Z A;  4OX9 L;  4B3R Q;  2AWN A;  1HNX L;  1AE2 A;  3L7Z C;  2B63 H;  4DR1 Q;  3S17 H;  3KJO A;  2D62 A;  2N8N A;  3CCE A;  5E7N A;  5M5Y H;  3HOY G;  1LUZ A;  1UE6 A;  2JQO A;  3F8T A;  3I4M H;  1AE3 A;  1A63 A;  2K5H A;  1GVP A;  2PI2 A;  2WB1 G;  1Q46 A;  3GD7 A;  2A19 A;  4NXM Q;  4HIO A;  2GN5 A;  1I6H H;  3CXC A;  3S15 H;  4LF7 L;  4A3E G;  4GOP A;  1XNQ Q;  1B7Y B;  3NEL A;  4JI7 L;  2CWA A;  4A93 G;  2AHO B;  2VQF L;  1Y1W H;  3PUX A;  1EFW A;  4TQU S;  1WCM H;  1Q1E A;  3J80 i;  1FGU A;  1VQ8 A;  1MJC A;  5GRO A;  4Y7N H;  3TS2 A;  4A3D G;  1HZA A;  2NVT H;  1VQN A;  2A8V A;  1WJJ A;  5IYC G;  4DV4 L;  4X6A H;  2KHJ A;  4YCV A;  1OXT A;  3CCS A;  4JCV E;  4J15 A;  1Z47 A;  4X64 L;  2DUD A;  2JA9 A;  1Z9F A;  5M3F G;  4C3H H;  4DV2 Q;  1KIX A;  4JI3 Q;  4L5S A;  2JA6 G;  1JJG A;  1WI5 A;  5C3E H;  2R93 H;  1BBW A;  1CKN A;  1VQJ A;  2ZTE A;  1XMQ Q;  3MXN B;  4JOI A;  4O0A A;  4LFC L;  4R4T A;  4C3I H;  4DV0 L;  4A3F H;  4DKA C;  1QZH A;  4A3J G;  2UU9 L;  3E0E A;  2OTJ A;  2E5L Q;  1X3E A;  1U5K A;  4HJA A;  4JI0 Q;  2HIX A;  1PH3 A;  1I94 Q;  4B3S Q;  1TXY A;  4DV7 Q;  1Q81 C;  1SMX A;  2K14 A;  2UXD L;  2YU9 H;  3AQQ A;  2MO0 A;  1YI2 A;  1N9W A;  4P71 A;  3CD6 A;  3PSI A;  1OTC A;  3PUW A;  3HOV G;  1PFS A;  1A0I A;  4UPA A;  3UDG A;  2JEB I;  2PQA A;  1YHA A;  3ICE A;  4A3C H;  2A1A A;  3KF6 A;  4XTC S;  4BXX H;  1SN8 A;  1Q8K A;  1N36 Q;  3LGJ A;  1WYD A;  1Q1B A;  4A75 A;  4LNQ A;  2RF4 A;  5M5X H;  3S2D H;  1OXS C;  4IO9 A;  1A8V A;  3L0O A;  1RL2 A;  4DV5 L;  4JV5 Q;  1UE5 A;  2I5L X;  1EOV A;  3PUV A;  3AFQ A;  3PUY A;  4DUY L;  1HNZ L;  2NVQ H;  1P16 A;  3PO2 H;  4BBS G;  1LM0 A;  2JJQ A;  3CCL A;  5C0X J;  3U4Z A;  1Y1V G;  5AJ3 Q;  2IX0 A;  2JA8 H;  3DLL A;  4A3K G;  1Y14 B;  3ULL A;  1NMF A;  1QVC A;  2E2I H;  4BA2 I;  4GN3 B;  1YJW A;  4GKK L;  4MZ9 A;  2KHI A;  4JI8 Q;  3A5Z B;  1Q82 C;  3H15 A;  4PMW A;  1HNW Q;  4KHZ A;  3Q8D A;  3ULJ A;  4LF8 L;  2UUC Q;  1SLJ A;  1EQR A;  4OON A;  3S1N H;  2EIF A;  1E7Z A;  1NE3 A;  3AYH B;  3RN2 A;  1NJI C;  4GLV B;  2XGT A;  1ASY A;  1FJG L;  1C0A A;  2HHH L;  3GDE A;  4JI5 L;  5ELO A;  2ASB A;  1CSQ A;  3H0G H;  1K73 C;  4R1J A;  3U4V A;  1PH5 A;  1PHJ A;  2Q2T A;  4LF4 L;  2VQE L;  1L1O C;  1HR0 L;  1SE8 A;  3UE1 A;  3A74 A;  3HOZ G;  4ALP A;  2WFW A;  1VQA A;  4KHP L;  2KCM A;  1IBL Q;  2QA4 A;  1YEZ A;  3U50 C;  5C0X I;  4LUO A;  4DK6 C;  4BBR G;  1PH6 A;  2JA7 H;  3TEH B;  3F1Z A;  2RHS B;  5C4J H;  3RN5 A;  4PZ6 A;  3SGI A;  4L5R C;  2MFI A;  4IFD I;  4A3I G;  4DR3 L;  3RR5 A;  4BY7 H;  4DR2 L;  1S40 A;  1J5E L;  1PYB A;  4AYB E;  3KYH C;  1X6O A;  2FXQ A;  2C35 B;  1EYG A;  1SFO H;  1VQF A;  2AMC B;  2CWP A;  2OQ0 A;  4IJL A;  2GVB A;  1L0W A;  3J81 i;  3FKI G;  3W5O A;  1LYL A;  2JK8 A;  3K7U C;  1E3P A;  1X65 A;  4A4I A;  4B3M Q;  3M3Y H;  4A3C G;  4UP7 A;  1J6Q A;  4AIM A;  1V43 A;  1N34 L;  3B6Y A;  1VQM A;  2QGQ A;  4K0K L;  3KDF A;  3FP9 A;  4GNX C;  1IBK L;  2GVA A;  2UXC L;  1PA6 A;  1JT8 A;  4QGU A;  4GS3 A;  3JAM c;  1VQL A;  1VQO A;  1VQ9 A;  1G51 A;  2E2J H;  1K83 H;  5C44 G;  3S1R H;  3CC2 A;  4IPD A;  1SRO A;  2H5X A;  1FL0 A;  4NB3 A;  4A3G H;  1D7Q A;  4LF6 L;  3AEV A;  2JA5 G;  3CC7 A;  3HFZ B;  4DUZ L;  1BBU A;  4NPS A;  4TVA B;  4HJ5 A;  1K0R A;  4DR5 Q;  3HOX G;  3RNU A;  3CCQ A;  2UUA L;  4LF9 L;  3CCR A;  4DR6 Q;  4R4C A;  1FVI A;  2ZM6 L;  5IWA Q;  3MEF A;  5LMU Q;  1N33 L;  4LUV A;  2N3S A;  3T1Y L;  3HKS A;  4P75 A;  2YTX A;  2OQK A;  2CQO A;  3S16 H;  4DR1 L;  5LMN W;  4A3L H;  1P8L A;  3H0G G;  4JI1 L;  1L2F A;  4NXM L;  1VQK A;  4R4Q A;  3I4N G;  3J7A 5;  4A3B H;  3W1G A;  4GN5 A;  5LMN Q;  2Q2I A;  4OX9 Q;  2B29 A;  3TRE A;  3TQY A;  3ZJY C;  1N32 Q;  4GNX A;  3PF4 A;  2ID0 A;  2EQS A;  3M7N A;  3KOJ A;  1TWG H;  1UWV A;  3TRZ A;  4L5Q A;  5H1S E;  4JC0 A;  1T9H A;  3RLO A;  3S1Q H;  2YTV A;  4C2M H;  5IP9 H;  3KJP A;  1M90 C;  3D0F A;  4BY7 G;  4DV2 L;  4GOP B;  4JI7 Q;  1NTG A;  4LF5 Q;  2VQF Q;  5GQO A;  1OXU A;  4P72 A;  5BR8 L;  4YHH L;  1HR0 W;  5IYD G;  1XMQ L;  4A3M G;  3GTK H;  1HZB A;  2ZTC A;  1A62 A;  2PNH A;  2E5L L;  3FHW A;  3I56 A;  4JI6 L;  2Q2U A;  2MNA A;  5M5W H;  2I5H A;  1YBY A;  1I94 L;  4X64 Q;  1WOC A;  1W2B A;  4BY1 H;  3S14 H;  4KLK A;  4AH6 A;  3A5U A;  5C4X G;  4HJ8 A;  2V1C C;  1PV4 A;  3DM3 A;  3F2C A;  1CKO A;  1CKN B;  1GKH A;  3A0J A;  1KL9 A;  5GAE C;  2UU9 Q;  3OTO Q;  4GKJ L;  4MNO A;  1IYJ B;  3GTL H;  1CSP A;  1U0L A;  3HKZ E;  2VUM H;  2MO1 A;  4HIK A;  4UY8 C;  4C3J H;  1S72 A;  2R92 G;  1IBM Q;  4B3T Q;  3UDI A;  3OYY A;  4KI0 A;  1VQ7 A;  1JJ2 A;  2WAQ E;  3WWV A;  4JV5 L;  1I5F A;  5DLQ E;  2B63 G;  2IHF A;  2VY3 A;  1BKB A;  2NVY H;  2BH8 A;  4R4O A;  3CCV A;  1K9M C;  1ASZ A;  3I4M G;  2IY5 B;  2Z6K C;  2PQA B;  2HT1 A;  2R7Z H;  5J3B A;  3KF6 B;  4YWL A;  4DV3 L;  1XMO L;  4RG1 A;  1MKH A;  1QUQ A;  1X55 A;  4X62 L;  4JI2 L;  3PO3 H;  3G48 A;  2ZJQ A;  4JBK A;  4DV5 Q;  3CPF A;  4JI4 L;  2YYZ A;  1Y1W G;  3E9H A;  5HY6 A;  3M4O H;  3U58 A;  1WCM G;  4DUY Q;  4DV1 Q;  1R9T H;  1B70 B;  1HNZ Q;  4JYA L;  1IZ6 A;  2HQL A;  5M3M H;  4AQY Q;  1KQS A;  5FLM H;  5IP7 H;  1XPU A;  4OXP A;  1CKM A;  1I50 H;  2KBN A;  1YIJ A;  1X9N A;  1VQG A;  3PIP A;  3T1H L;  4GKK Q;  3G6E A;  3VDY A;  2E8G A;  2OTL A;  1EUJ A;  1HZC A;  5C3E G;  2R93 G;  1E24 A;  2F4V L;  4LF8 Q;  1PH7 A;  4A3F G;  1MIU A;  1IL2 A;  4PZ7 A;  2UUB Q;  2WAQ G;  4XIG S;  2ZTD A;  4LFA L;  1Q12 A;  2HHH Q;  4JI5 Q;  1PH9 A;  3E9I A; 
#chains in the Genus database with same CATH topology
 3D4R A;  4JK1 C;  2WB1 B;  3CMA A;  1LT3 D;  2Z6K A;  4ZYS A;  4A3E B;  3NEN A;  4KHP Q;  3L2P A;  1V1O A;  4A93 B;  3SE0 A;  4NXN Q;  1SE3 A;  1EY7 A;  4IUQ A;  4UHV A;  2YTY A;  1PH8 A;  4J6H A;  5I2Y A;  2IL8 A;  4B3M L;  2NBF A;  1LTL A;  1E1T A;  4HID A;  3SK6 A;  1KRT A;  3GTM H;  1D8L A;  2VZA A;  1QG7 A;  3KBX A;  1VMC A;  5E4W C;  2PO4 A;  4OEM B;  1DXM A;  1K8A C;  2M2L A;  2K5V A;  1PH2 A;  2JA8 G;  3I7F A;  3BVG A;  2PQE A;  4DK3 C;  3DHQ A;  2BA0 A;  2AQ1 B;  2F1M A;  3T16 A;  1PYS B;  5ELF A;  1A6X A;  1SXT A;  3K8A A;  3RLN A;  1U4R A;  1FR3 A;  5D14 A;  5C0X H;  3ITP A;  5EGT A;  1YJN A;  4DUZ Q;  1NBW A;  4ZCK A;  1XNQ L;  4R9W A;  4B08 A;  1N8R C;  4K2K A;  3Q6S A;  2XWB B;  4BBS B;  4KY7 A;  2F0D A;  5LHY 1;  1Y1V B;  1F2L A;  3CCM A;  5EAY A;  1B50 A;  1QE6 A;  3OWE B;  4FDB A;  5ELN A;  4JI3 L;  1YNX A;  2LY7 A;  4RGM A;  1SR3 A;  3X3M A;  4XQJ A;  2KEN A;  2A68 D;  1G6P A;  1PH1 A;  1YHQ A;  5IYB H;  2K6A A;  5A35 A;  1TU2 B;  2LXJ A;  1A2U A;  5T1G A;  1QJO A;  5EQ0 A;  4Y52 H;  2F0I A;  4LW1 A;  1ENA A;  5IT9 E;  4B3S L;  4GN4 B;  2KED A;  4HJ7 A;  3HOZ H;  1VQP A;  3GTQ B;  1RTO A;  2B3G A;  3K5O A;  1A3U A;  4YCU A;  4DV0 Q;  3A7A B;  1JMC A;  2NTT A;  5BR8 Q;  4APV A;  3PIO A;  2WKD A;  4BBR B;  4A3F B;  1H9S A;  3PF5 A;  1D5Z C;  1N36 L;  1TWF H;  2EYO A;  4JI6 Q;  5IY0 A;  3AFP A;  3GTP B;  4K5X A;  5JVH 3;  1WTQ A;  1DOK A;  2PYK A;  3V05 A;  4EQP A;  3S1M H;  2D5D A;  1PVO A;  3D31 A;  1EZ6 A;  4A3L G;  2LXK A;  3ER0 A;  3LNN A;  2K4K A;  1STH A;  1WD1 A;  1HNW L;  2M9V A;  1EQQ A;  3TS0 A;  2Z9H A;  1HZ9 A;  3RZO H;  2F0T A;  1RHP A;  1SNQ A;  2K1B A;  5IGB A;  3MFG A;  4JBJ A;  1SYE A;  3CME A;  1B8A A;  2JA5 H;  4DV3 Q;  3PCO B;  4JI2 Q;  4X62 Q;  3I3C A;  3H3V I;  3HOX B;  1VQH A;  2PZU A;  2N78 A;  1IBL L;  2KQ3 A;  2EJG C;  4FF3 A;  1FJG Q;  2B2U C;  1S5F D;  1NY4 A;  2HDM A;  1B1Z A;  1YZ6 A;  2EZV A;  2L5T A;  2VB2 X;  3T1H Q;  1SMY D;  2XTI A;  4HAE A;  3NBH A;  1QVG A;  3P20 A;  4KY6 A;  2R6G A;  2B8G A;  2ICE C;  1AW7 A;  5BN4 A;  1LT6 D;  3O13 A;  3V2T A;  1DM0 B;  4BS9 A;  5IYC H;  1G2T A;  2I0Q A;  5M9O A;  1A3T A;  3CU7 A;  4C3J G;  4DF7 A;  4YY3 Q;  5BN3 A;  5GAG C;  2RSN A;  5CV9 A;  2JA6 H;  2WP8 J;  4LFB L;  4BY7 B;  2RQX A;  1U4L A;  1PRT C;  1SFO B;  1XNR Q;  2B8F A;  3FPP A;  3CQZ H;  2R7Z G;  4DR7 Q;  1GHJ A;  2K50 A;  2L15 A;  4K0K Q;  2UXC Q;  3PO3 G;  1XXG A;  3MA2 B;  1QNK A;  2B2W A;  3S2H B;  1FNV A;  4DR6 L;  2RDH A;  5C4X H;  1OXV A;  3CP0 A;  1ML0 D;  1O7Z A;  2RCN A;  1ILP A;  3NBI A;  1WTW A;  3CRL C;  4DR4 Q;  2R61 A;  3GTJ H;  4JOI C;  5J22 A;  2CKZ B;  4LAA A;  4X3S A;  4OWT B;  2EE1 A;  4QY7 A;  2B2V C;  4B3R Q;  2B63 B;  1BCP F;  3DUZ A;  4DR1 Q;  3KJO A;  1F2Z A;  1STB A;  4RKB A;  1I4P A;  1CFM A;  5EBD A;  3I4M H;  2EYF A;  1RD9 D;  5AFW A;  4MN3 A;  2PI2 A;  3KBG A;  2WB1 G;  3GD7 A;  3Q0A A;  2A19 A;  4DNR B;  2GN5 A;  4HIO A;  1I6H B;  3H09 A;  4LF7 L;  4A3E G;  3QWN A;  5EPL A;  1JWU D;  1ENF A;  3FEW X;  4A93 G;  5EBC A;  2VQF L;  1Y1W H;  3PUX A;  3BS1 A;  5GRO A;  3E6Z X;  3W3A A;  4CDC C;  4IZ8 A;  1HZA A;  1SYG A;  3NXW A;  4RGN A;  1TWG B;  4X6A H;  4EVO A;  4YCV A;  3CCS A;  1MJE A;  4X64 L;  1Z47 A;  4DV2 Q;  1Z9F A;  4C3H B;  1JJG A;  1NSN S;  5C3E H;  1U4P A;  2R93 H;  2KCN A;  2ZTE A;  3MXN B;  1GUN A;  4A3J G;  1ROD A;  2WAQ B;  2OTJ A;  2E5L Q;  1T5E A;  2QW7 A;  1TS2 A;  1EY8 A;  3OWF A;  4HJA A;  2HIX A;  3IFT A;  1TXY A;  1CZG A;  3AQQ A;  4BY1 B;  3S14 B;  5IIF A;  3PSI A;  4KD3 A;  2RDG A;  3R93 A;  4CBV A;  1KAB A;  1LV9 A;  3LGJ A;  1BUV T;  2G9D A;  4LNQ A;  2XSC A;  5M5X B;  2KOL A;  1A8V A;  3L0O A;  4DV5 L;  1BNZ A;  3TSS A;  1EOV A;  3PUY A;  3AFQ A;  1HNZ L;  2NVQ H;  1P16 A;  4BBS G;  2JJQ A;  3U4Z A;  1Y1V G;  5AJ3 Q;  2JA8 H;  3DLL A;  2NYZ D;  3DMU A;  3ULL A;  1QVC A;  2E2I H;  2HQE A;  4GN3 B;  4GKK L;  4JI8 Q;  3J81 L;  1CHP D;  4RGT A;  3H15 A;  1Y8P B;  3Q8D A;  4L6T B;  3ULJ A;  4AYB B;  1SLJ A;  1EQR A;  4OON A;  4DA2 A;  2EIF A;  1E7Z A;  1NE3 A;  3I70 A;  4GLV B;  1C0A A;  2HHH L;  3GDE A;  1CSQ A;  4R1J A;  3BYY B;  1PHJ A;  2VQE L;  4HED A;  1SE8 A;  3URY A;  4JPB W;  1YEZ A;  3U50 C;  4KN7 C;  3DM1 A;  4BBR G;  1PH6 A;  1JB3 A;  4ID6 A;  1DD2 A;  1PMR A;  3DEO A;  2F0L A;  3HEJ A;  2MFI A;  3RR5 A;  1LT4 D;  1S40 A;  2F0E A;  1J5E L;  1X6O A;  2FXQ A;  3J81 i;  1H9J A;  2CWP A;  2R3Z A;  2GVB A;  4CDE C;  3K7U C;  1B4O A;  1E3P A;  1X65 A;  1BO0 A;  4BWG B;  5LL6 S;  4A4I A;  3M3Y H;  4ILW A;  3E0J A;  1V43 A;  1N34 L;  1VQM A;  5E3F A;  1IYU A;  3EJI A;  1IBK L;  1CK1 A;  4QUF A;  2E76 C;  1VQ9 A;  4ZAI A;  3S1R H;  5COR A;  1I4G A;  1NCV A;  4I7A A;  4M8A A;  1STY A;  3OOC A;  4ZUI A;  5I6W A;  4DR5 Q;  1UNS A;  3HOX G;  2CHB D;  4R4C A;  2ZM6 L;  2OQK A;  3S16 B;  1Q8I A;  4A3L H;  3KLS X;  3TZU A;  4X3K A;  1G2S A;  1WTH A;  4NXM L;  1I3Q B;  3I73 A;  1DON A;  2B39 A;  3NSW A;  4OX9 Q;  4R8N A;  4GNX A;  2AUK A;  5JPM C;  2BDO A;  3M7N A;  3WOF A;  1UWV A;  1EY5 A;  3SEB A;  2K5W A;  5H1S E;  1T9H A;  3HKZ B;  4BY7 G;  5KIX A;  1B2T A;  3JAM E;  3NP8 A;  1SNP A;  1TII D;  4YHH L;  1XMQ L;  1HZB A;  5FO9 B;  2JXM B;  2PZT A;  3CHB D;  3I56 A;  2G5D A;  2Q2U A;  2EPB A;  4KN4 C;  2I5H A;  1F2Y A;  1YBY A;  3NWS A;  1I94 L;  3FDT A;  3T51 B;  3MZ5 A;  1F77 A;  1PV4 A;  3DM3 A;  5IGD A;  3BDL A;  5C3W A;  3GTL B;  4C3J H;  3MVV A;  3HOW B;  3OYY A;  1VQ7 A;  1JJ2 A;  4DN4 M;  2B63 G;  1EWC A;  1R4Q B;  2CW0 D;  2IHF A;  2WII B;  1EL0 A;  1BKB A;  1K9M C;  2R7Z H;  1XMO L;  1ESR A;  3K5N A;  1Q90 A;  2D9U A;  3PO3 H;  2KVM A;  3CPF A;  1C8C A;  2LMC B;  5A2Q E;  1R9T H;  4FF4 A;  2A68 C;  5M3M B;  3HOU B;  3BVZ A;  3N6R A;  2SOB A;  3A54 A;  3VYS A;  1YIJ A;  4K14 A;  1X9N A;  1HUM A;  1V8Q A;  3TBI B;  3KK7 A;  4C3H G;  2PPB C;  1MHW C;  3A8I E;  3W2D A;  1NR4 A;  1PH7 A;  1VDZ A;  2WAQ G;  1B44 D;  1PTO D;  2ZTD A;  1Q12 A;  3ONA B;  1PH9 A;  4JI5 Q;  4LF4 L;  1KAW A;  2L1B A;  2K5N A;  3R2I A;  4QL5 A;  4XXE A;  4A3E H;  1GUO A;  2VS1 A;  3I4N B;  4A93 H;  2FMM A;  2L12 A;  1L0Y B;  4OO1 G;  4X65 L;  4UAI A;  4R4I A;  2E2D C;  4C1N I;  2IWH A;  3M4Y A;  1HH2 P;  4IOA A;  3TME A;  4YCW A;  4X66 Q;  4TRD A;  1LAB A;  3ND9 A;  2WIN B;  1G29 1;  1V9P A;  3IAY A;  1BVS A;  1K8M A;  5BN5 A;  3H94 A;  4G7H C;  5FJ8 H;  4A3J H;  2PW5 A;  4XQN A;  4PMB A;  3BDC A;  2UXB L;  2K01 A;  3NK9 A;  2K05 A;  1OO9 B;  4IUN A;  4AYB G;  1E22 A;  1EY6 A;  5LMU L;  3KF8 B;  4LF6 Q;  2D2C C;  3J81 j;  1XYI A;  2BH2 A;  3JC6 6;  3RZD B;  2E74 C;  4LF9 Q;  3V96 A;  4OO1 I;  4F88 A;  1N33 Q;  3RUZ A;  1ZYR D;  3T1Y Q;  4BBS H;  1SMY C;  4FP5 D;  4FF2 A;  1Y1V H;  1EU3 A;  4KK7 A;  3S24 A;  1PRT B;  2Y0S E;  5M5Y B;  1FNU A;  4G57 A;  4JI1 Q;  3G4S A;  4CJ2 C;  1EIG A;  2L9H A;  3PIO 3;  5ISR A;  4LUZ A;  4ZLT F;  1TWH B;  1PFN A;  4OIK A;  5CBA E;  1QZG A;  2VNU D;  4JI0 L;  3BU2 A;  5G3L F;  2AKW B;  2NVT B;  2IHE A;  4DXF A;  4DV7 L;  1LTR D;  3GTQ H;  3SK5 A;  4LFC Q;  4RMF A;  1LTI D;  1O7I A;  4IN3 A;  1EIY B;  1TR5 A;  3I4O A;  5J1Z A;  1ENC A;  4C3I B;  4BBR H;  2PI2 E;  3OTO L;  1VQ5 A;  3GTP H;  1JE5 A;  5EPJ A;  2F3W A;  4A3I B;  1YVC A;  2HUG A;  4B3T L;  2VL6 A;  1PFB A;  1PTO B;  2BE5 D;  1IHZ A;  4GKJ Q;  4H44 C;  3VR2 A;  1S3O A;  1JE4 A;  1VQC A;  3GV3 A;  2VB3 X;  2PNR C;  4WRD A;  1F9P A;  4EX5 A;  4OWW B;  2P5Z X;  4MIU A;  4GLA C;  5JPN C;  3ERO A;  2QDB A;  2NZH A;  1AH9 A;  1VQ4 A;  5NUC A;  1IYV A;  4Z9C B;  5DM6 3;  4AQY L;  2TMP A;  2IX1 A;  1F2M A;  3HKZ G;  2F0O A;  3KLW A;  1QUQ B;  2Z8L A;  1FD7 D;  3IRB A;  3HOX H;  5FLX c;  4IFD J;  2NTS A;  4PV1 C;  3VYU A;  3HOY H;  1F9S A;  3JAM L;  3M85 A;  3S1N B;  3IFD A;  2ZXR A;  3K59 A;  2UUB L;  2B2Y C;  2Q2H A;  2JE6 I;  3F2B A;  4KY5 A;  2R7F A;  3H0G B;  3MC0 B;  1EYA A;  2EXD A;  1HPC A;  1HTL D;  1KNE A;  1UUP A;  1CM9 A;  2IT1 A;  1AP0 A;  1YIT A;  2F4V Q;  2MQH A;  1K8G A;  3K5L A;  4NXN L;  1NR2 A;  1TS5 A;  3CF5 A;  2L4N A;  1CHQ D;  4LFA Q;  3STB D;  1D5M C;  1KHI A;  5C4J B;  2MGS A;  3HOW G;  1U4M A;  4QIW B;  2D0O A;  5JEA J;  4RCO A;  1WVL A;  1XPO A;  1E2W A;  2E2H B;  5FO7 B;  1HJP A;  1UEB A;  4I65 A;  3NUC A;  1Q7Y C;  1XJV A;  3JAM i;  1EQV A;  3ULP A;  2NZO A;  5K5P A;  3S2H H;  2NVX B;  5IWA L;  4YWM A;  5M3M G;  4P2C B;  1SNC A;  1JB7 A;  1AEX A;  3HOU G;  5A2Q L;  2ZXO A;  4JBW A;  3A8K E;  1O7Y A;  1TWC H;  1AZP A;  5KRU A;  3CAM A;  4PZ8 A;  1YJ9 A;  5LMN L;  1SNM A;  1VQ6 A;  3C46 A;  2SEB D;  4IUP A;  2AWN A;  2VXW A;  1AE2 A;  3L7Z C;  2B63 H;  3S17 B;  4OL7 A;  2LKV A;  2D62 A;  3CCE A;  1UE6 A;  2JQO A;  3F8T A;  1AE3 A;  3BVM A;  4KTA A;  1LTS D;  1I6H H;  3CXC A;  4GOP A;  1XNQ Q;  3SXH A;  1B7Y B;  3J7Y W;  4A3B B;  2AHO B;  4ULL A;  5TSS A;  1EFW A;  1WCM B;  1HXY D;  1MSG A;  1Y8O B;  1SJH D;  4HMI A;  4Y7N B;  2QF7 A;  1WD0 A;  1VQN A;  1WJJ A;  1WTV A;  4HMJ A;  1AN8 A;  1JR0 D;  2J7Z A;  1KIX A;  4JI3 Q;  2JA9 A;  4C3H H;  3VR6 A;  1CKN A;  2QKI C;  3DWP A;  4R4T A;  4DV0 L;  1QZH A;  2UU9 L;  1V1P A;  3L9A X;  2A74 C;  4B3S Q;  1HA6 A;  5KEE A;  1SMX A;  5FO8 B;  2YU9 H;  4H0L C;  1YI2 A;  4NKL A;  1N9W A;  3MWY W;  3CD6 A;  3FRP B;  1OTC A;  3HOV G;  2HD3 A;  3EFX D;  1KNA A;  2JEB I;  4OO1 H;  2PQA A;  3GP7 A;  1YHA A;  1D6E C;  3KF6 A;  4XTC S;  1H9S B;  2PZW A;  1Q8K A;  1N36 Q;  1WYD A;  1PDQ A;  2K5Q A;  3SR1 A;  1Q1B A;  1DZ1 A;  4A75 A;  5M5X H;  3S2D H;  4IO9 A;  4JV5 Q;  1KDB A;  1SEB D;  1MI2 A;  4KV6 A;  5CV6 A;  1IKL A;  1LM0 A;  2LS0 1;  4A3K G;  1NMF A;  4BA2 I;  3QOJ A;  1GUS A;  3A5Z B;  3R8B A;  4HSV A;  2JP1 A;  1GJX A;  1K28 A;  4PMW A;  1HNW Q;  4Q0F A;  2DNE A;  4KHZ A;  3T13 A;  4MHE A;  3EA6 A;  3RN2 A;  1NJI C;  1ICF B;  2F0H A;  1ASY A;  2AUJ D;  1FJG L;  3IKJ A;  3T53 B;  1PH5 A;  2BCO A;  1VF5 C;  3UE1 A;  4ALP A;  1IBL Q;  2QA4 A;  5KND A;  3T4A C;  2JA7 B;  4DFA A;  5FK9 C;  4A3I G;  1JOR A;  1QIL A;  1PYB A;  4NP5 A;  2AMC B;  2OQ0 A;  5JOB A;  1BOS A;  2BDN A;  2OF1 A;  4B9X A;  5JJZ A;  2CW0 C;  2Q8R E;  4A3C G;  1J6Q A;  1PFM A;  2EOT A;  4CKE A;  4K0K L;  3KDF A;  2UXC L;  2QEJ C;  1PA6 A;  4JW0 A;  3ERQ A;  1VQL A;  1G51 A;  2XIW A;  1K83 B;  3CC2 A;  1EEF D;  4IPD A;  1FL0 A;  4A3G B;  3AEV A;  3TP6 A;  1QB5 D;  3HFZ B;  1GUW A;  1PZK D;  2F0K A;  3CRK C;  4IAL A;  1K0R A;  2Y0S B;  2Q8T A;  2UUA L;  5EJW A;  4DR6 Q;  3ZYY X;  1DJR D;  2B2T C;  4LUV A;  5JVG 3;  1SYC A;  3S16 H;  4DR1 L;  2FFK B;  1P8L A;  3QB3 A;  4DAY A;  3H0G G;  1PTO C;  1SAP A;  3J7A 5;  3W1G A;  4GN5 A;  2Q2I A;  5C4Z A;  4RH6 A;  2B29 A;  4V19 0;  1HUN A;  2J0T D;  2X6L A;  2EQS A;  4FYD A;  3TRZ A;  4ZRZ A;  3RLO A;  3S1Q B;  1CQF A;  2CH4 W;  4DV2 L;  4DAP A;  1NTG A;  4LF5 Q;  2VQF Q;  2C5C A;  5ELB A;  4P72 A;  1HR0 W;  5IYD G;  2QCP X;  2ZTC A;  3MXG A;  1M4V A;  1ET6 A;  2E5L L;  3SHL A;  1UEA B;  2MNA A;  4OEL B;  5M5W B;  4X64 Q;  1B3Q A;  1TQO A;  2XRQ D;  4QF4 A;  2DY8 A;  2F3V A;  2QIL A;  4Q5V A;  1BF4 A;  5GAE C;  3GV6 A;  1IYJ B;  3GTL H;  2EYP A;  1CSP A;  1U0L A;  2MO1 A;  4HIK A;  4UY8 C;  1IBM Q;  2IW3 A;  2JN4 A;  4X3U A;  3UDI A;  4KI0 A;  2CQA A;  5DLQ E;  5C3X A;  2NVY B;  1O80 A;  3CCV A;  1B9N A;  3I72 A;  2IY5 B;  2Z6K C;  2NUC A;  3BG3 A;  1ZYR C;  4RG1 A;  1X55 A;  4J1M A;  3G48 A;  1MSH A;  4JBK A;  4DV5 Q;  3K58 A;  4JI4 L;  2YYZ A;  5HY6 A;  1WCM G;  1HNZ Q;  4DV1 Q;  4JYA L;  1IZ6 A;  5M3M H;  5DAU A;  1XPU A;  4OXP A;  1I50 H;  3R3O A;  4GKK Q;  5IT9 L;  5IGC A;  3G6E A;  3VDY A;  2E8G A;  2F0W A;  1HZC A;  4OIJ A;  4A3F G;  1IL2 A;  1LO5 D;  1EU4 A;  2HHH Q;  3E9I A;  4CKC A;  1HA5 A;  4DV6 Q;  2DNC A;  2K52 A;  1MD2 D;  2ENB A;  2K04 A;  4NDX A;  2X6G A;  5I2X A;  4KMU C;  4A3D B;  1XWE A;  4BXX G;  2BE5 C;  3J81 c;  5DNF A;  3NEM A;  2ZJR A;  3DWA A;  5ELE A;  2F0Q A;  3GO5 A;  1SNO A;  5M3F B;  1L1O A;  2JA6 B;  4KKT A;  1J5E Q;  1SND A;  5D3D A;  4IJH A;  3K80 C;  4RA8 A;  4N9P A;  3SK8 A;  2WAC A;  1J8I A;  1G6Z A;  4RKL A;  5CBE E;  4XYO A;  3BZK A;  3DXJ C;  3D6W A;  1N34 Q;  1IXR A;  1IBK Q;  2A69 D;  4DR5 L;  1KC8 C;  5FLX E;  3E5S A;  2PMZ E;  2EY5 A;  3A56 A;  3CCU A;  2QEX A;  3HOV H;  2EYM A;  4IPC A;  1DOL A;  1M1K C;  4IPH A;  1VQE A;  3RZD H;  4CDF C;  1RKN A;  2DN8 A;  3GTJ B;  4O1N A;  1HNX Q;  1ET9 A;  1V1Q A;  4A76 A;  2ZM6 Q;  1CUK A;  3KFU A;  4K5W A;  3Q24 A;  2JA7 G;  3J80 c;  4A3K H;  1TWA H;  3T56 B;  3ERS X;  1EIF A;  1IL8 A;  3STB C;  1SRU A;  4K5V A;  1T5X D;  1TWH H;  1EOT A;  4JG2 A;  4P74 A;  5JAV A;  3I55 A;  2ZJP A;  4GNX B;  2FJ2 A;  4HN7 A;  2D0P A;  4DV4 Q;  1C7Y A;  1E1O A;  4F8M A;  3P7J A;  1HR0 Q;  3F2U A;  1WTO A;  4RCN A;  3M4P A;  2CVR A;  1JJC B;  4FNF A;  3PUZ A;  1I6V C;  1S5D D;  2XRS D;  4I7Z C;  4YHH Q;  1I4Q A;  1UE1 A;  3D6C A;  4A3G G;  4DPG A;  3NHH A;  2O2L D;  1QNU A;  2UXD Q;  4A3I H;  2SDF A;  4WJ3 M;  4UP9 A;  2Y0S G;  2F4I A;  4L5T A;  4WFN 3;  4HCE A;  4P73 A;  4CGY B;  1AZQ A;  3PIP 3;  4GZY C;  1M8A A;  3FKI B;  2JEA I;  2NB0 A;  3UE0 A;  1D5X C;  3GTG B;  4ZKC B;  1XTD A;  2EY1 A;  5GAD C;  1FGB D;  3OIQ A;  5C0X G;  2IPK D;  5COY A;  5GAH C;  1RJT A;  2CH4 A;  2UUC L;  4JBM A;  3GTO B;  4IFD G;  1BQQ T;  5C44 B;  2CCZ A;  1EWI A;  1Q86 C;  3PV0 A;  2AWO A;  4POG A;  1STN A;  2JA8 B;  1K8O A;  4LWC A;  4RGO S;  1XMO Q;  1GO3 E;  2ALY B;  2N49 A;  5IGE A;  3U9S A;  1PXU A;  1GD7 A;  2IX3 A;  3E3X A;  4K6L A;  1A2T A;  2KA7 A;  2F52 A;  2OEO A;  2R7D A;  5IYB G;  3CC4 A;  1X3P A;  3CCJ A;  2RSO A;  3DEP A;  1X56 A;  2B2W C;  1HHV A;  4BY1 G;  3G6J B;  3UDF A;  4WOR A;  1BCP D;  5JEA G;  4H02 A;  4C1N K;  1X54 A;  2CFM A;  1X3F A;  1QWY A;  4KJN A;  4IUT A;  5J39 A;  4LF4 Q;  5CR3 A;  4DR3 Q;  2YV5 A;  1PYW D;  4DR2 Q;  4IUU A;  1ZXT A;  1LTT D;  4DAV A;  3A8J E;  4X66 L;  1K3B C;  3LWE A;  1S5B D;  3MTS A;  1GM5 A;  4N8F A;  2E2H H;  3K7A B;  5IYD H;  4A3M B;  3W1B A;  4X65 Q;  1UE7 A;  3D8G A;  2B2U A;  3M7G A;  4ME5 A;  3HP3 A;  2BA1 A;  4ZKB B;  1VQI A;  4UP8 A;  4DNI A;  1CTM A;  3U9O A;  3CW2 C;  3L3O C;  4BA1 I;  2NVX H;  2HCI A;  2C9O A;  5D3I B;  2DGY A;  5FLM G;  4N8X 1;  2F3I A;  5IP7 G;  1Q3L A;  4IOC A;  3MHB A;  3EN2 A;  3K0X A;  4QQB X;  4U67 3;  2R92 B;  4ZQ3 A;  5JJL A;  2I5M X;  2UXB Q;  4LK1 C;  5IGF A;  3I2Z A;  1N32 L;  3S17 H;  1JIC A;  2N8N A;  1YNN D;  3TDQ A;  4UDU C;  3NPP A;  1ESF A;  1SJE D;  2K5H A;  1GVP A;  1Q46 A;  2JYO A;  4X3T A;  1I4X A;  1S5E D;  4L8J A;  3S15 B;  1E2V A;  2MJ8 A;  4JI7 L;  4DK1 A;  1PZI D;  4TQU S;  1WCM H;  1Q1E A;  1XX8 A;  1FGU A;  1MJC A;  1SYB A;  1CA5 A;  4Y7N H;  3TS2 A;  4A3D G;  2A8V A;  5IYC G;  4B9W A;  2KHJ A;  2OXP A;  4J15 A;  2DUD A;  3PMF A;  5M3F G;  2JA6 G;  2DJF C;  4RHS A;  2EY2 A;  1VQJ A;  2I46 A;  4JOI A;  4LFC L;  4A3F H;  4DKA C;  5LL6 X;  1SBB B;  2XNA C;  2B2V A;  3C3L A;  2L11 A;  4JI0 Q;  4FXD A;  2FMC A;  3QO2 A;  4KHV A;  1UAP A;  4DV7 Q;  1D1K A;  1ILQ A;  2BOS A;  4P71 A;  1BDO A;  5KGU A;  1PFS A;  2NZ1 D;  4UPA A;  3UDG A;  3ICE A;  1JWS D;  4BXX H;  1RF2 D;  2RF4 A;  1KAA A;  1NNX A;  1OXS C;  1BBX C;  1RL2 A;  1BCP B;  1EQT A;  4K8I A;  1UE5 A;  2I5L X;  4HR7 B;  3PUV A;  2EYJ A;  1W6K A;  4DUY L;  3PO2 B;  4S3S A;  4XQQ A;  1R4P B;  2M00 A;  5CMD A;  5C0X J;  2IX0 A;  1S5C D;  5I9O A;  2ZXP A;  3R2T A;  4MZ9 A;  5ELD A;  2R7Z B;  1HCZ A;  1Q82 C;  2F0U A;  5CGK A;  4LF8 L;  3AYH B;  2AQ2 B;  1CI3 M;  1K73 C;  3X3N A;  3TP7 A;  2EYH A;  3FVQ A;  1L1O C;  1YNJ D;  3A74 A;  2WFW A;  1VQA A;  4KHP L;  1Z7T A;  4CJ1 B;  2JA7 H;  5FKA C;  3TEH B;  1SSO A;  3F1Z A;  4XT3 B;  2RHS B;  3RN5 A;  4L5R C;  4BY7 H;  2MPM A;  2F0N A;  1KDA A;  3C2P A;  4AYB E;  3KYH C;  1STG A;  3C1E A;  3PQI A;  1KDC A;  2C35 B;  1EYG A;  1SFO H;  4IJL A;  3FKI G;  2SNS A;  1G8Z D;  2PMZ B;  2FIN B;  2JK8 A;  3IL8 A;  4B3M Q;  2ZT9 C;  2H4O A;  2QGQ A;  4GNX C;  3FP9 A;  4FVM A;  2GVA A;  4DU9 A;  1ZKO A;  4QGU A;  4GS3 A;  3QG1 A;  3JAM c;  5D65 A;  1VQO A;  2E2J B;  1K83 H;  5C44 G;  1ICW A;  1SRO A;  2H5X A;  4A3G H;  4NB3 A;  1RCV D;  1D7Q A;  4A3J B;  4R8I A;  4H13 C;  4DUZ L;  1BBU A;  4F87 A;  4HJ5 A;  4KD4 A;  1AFP A;  3CCR A;  4HSP A;  1DYQ A;  5IWA Q;  3MEF A;  3KLR A;  4CJ0 B;  2N3S A;  4P75 A;  2YTX A;  2CQO A;  1JOO A;  1E2Z A;  2KJX A;  1TY0 A;  3AU7 A;  1GUT A;  1VQK A;  3I4N G;  5LMN Q;  2EJF C;  1XTC D;  1I4R A;  3ZJY C;  3TQY A;  4IFD H;  5E1F A;  3PF4 A;  3OHX C;  1EY4 A;  1TWG H;  1TVX A;  4L5Q A;  3RMH A;  1S4Z A;  3SVM A;  3J81 E;  4JC0 A;  3S1Q H;  2YTV A;  4C2M B;  3K0Y A;  4PQX A;  3D0F A;  1M90 C;  3OMG A;  4ZK9 B;  4GOP B;  4QB4 A;  5GQO A;  4ODG A;  3D3R A;  3OW7 A;  5BR8 L;  4A3M G;  3GTK B;  2K33 A;  1A62 A;  3WOE A;  4JI6 L;  1JWM D;  2F0J A;  1WTX A;  2F03 A;  5M5W H;  3WDN A;  2PW7 A;  1CQV A;  3K6O A;  1WOC A;  1W2B A;  4BY1 H;  1SE4 A;  3S14 H;  4KLK A;  3A5U A;  3NE5 B;  5HUR A;  2V1C C;  5JEA H;  1GKH A;  1CKN B;  3D4D A;  3A0J A;  2A69 C;  2UU9 Q;  4MNO A;  4K8J A;  4RFB A;  1V1P B;  3HKZ E;  2N55 A;  2VUM B;  1S72 A;  2R92 G;  1JOK A;  4LJZ C;  3HG9 A;  5EKL A;  1KTK A;  3WWV A;  4JV5 L;  3VYT A;  2OT2 A;  2VY3 A;  2NVY H;  4R4O A;  4HCS A;  1HQR D;  3EQL C;  1ASZ A;  3J80 E;  2PQA B;  4KKS A;  3KF6 B;  4YWL A;  2KEC A;  2K7V A;  4DV3 L;  1MKH A;  4JI2 L;  4X62 L;  1HQM C;  2ZJQ A;  2A6E D;  3P75 A;  1A3V A;  3M4O B;  2F0G A;  2HQL A;  1KQS A;  4DNT B;  5FLM H;  5IP7 H;  2KBN A;  1VQG A;  3T1H L;  2OTL A;  3H3V C;  1E24 A;  4C3I G;  1MIU A;  4J8Q A;  2E75 C;  3KUP A;  4XIG S;  2Z4H A;  3H6M A;  3HOY B;  1Z6H A;  3K57 A;  4YY3 L;  2ES2 A;  1RTN A;  2DJG C;  1PRT F;  2RHQ B;  3BZC A;  5JJI A;  3NBH B;  3VYR A;  1FNW A;  2A6H D;  1KLG D;  2O4X A;  4XYQ A;  1XNR L;  1H95 A;  2EDG A;  1VS0 A;  5L37 A;  4A3D H;  1IW7 D;  4DR7 L;  1XPR A;  2NN6 G;  2XN9 C;  4YIJ A;  2HIV A;  5EKK A;  4LFB Q;  2Z4I A;  1QOH A;  2K75 A;  1O7L A;  3S9W A;  5M3F H;  1QVF A;  3GTM B;  2VW9 A;  1KD1 C;  3OW2 A;  3PO2 G;  1MGS A;  1EYD A;  4IUV A;  1DGS A;  5CV8 A;  1KXL A;  4EGV A;  5G3L D;  2A73 B;  4DR4 L;  1VQD A;  2L55 A;  3KDF B;  1C9O A;  3FPU B;  4B3R L;  1LTB D;  4O42 A;  4G7Z C;  5C6A A;  3NQT A;  2ATW A;  4JVZ A;  1K3R A;  3RLF A;  1PTO F;  1II3 A;  4H7B A;  1I3Q H;  4G4K A;  2F0S A;  3QOL A;  1TWC B;  1LLR D;  2UUA Q;  2LSS A;  4TKO B;  4WJW A;  3M4Q A;  1TT2 A;  1I4H A;  1BR9 A;  3EVQ A;  2NN6 I;  2Z1C A;  1YHB A;  4OGQ C;  4DGZ A;  1BCP C;  3G71 A;  2MHV A;  3OIP A;  2F0F A;  4LF7 Q;  2K32 A;  4DAY B;  1NAP A;  4RWS C;  3EIV A;  3D4W A;  3G7L A;  3MXN A;  1NMG A;  1RIP A;  4LF5 L;  2L0C A;  3FMC A;  1EWH A;  1ZEQ X;  4KJO A;  3J7Z C;  2Q8I B;  1CT1 D;  1Y69 U;  4LMQ D;  4CHT B;  1W3S A;  3HOZ B;  2K28 A;  1X3G A;  1G91 A;  1JC7 A;  5CV4 A;  3C1F A;  5FJ8 G;  2DY7 A;  1TWF B;  5KYI A;  3HOW H;  4L63 B;  5C4H A;  2Z6B A;  1X32 A;  1IBM L;  2YU9 B;  3VA5 A;  4K6D A;  3CPW A;  1HFN A;  1PH4 A;  3UDX A;  3S1M B;  1OXX K;  3F2D A;  1B53 A;  3FKI H;  5AJ3 L;  3GTG H;  5IE8 A;  5CV7 A;  2SNM A;  1B3A A;  3BZD B;  4IUR A;  2X69 A;  1YNN C;  4JI8 L;  1VQB A;  3DWQ A;  4A3B G;  3TP8 A;  5K36 G;  3HS0 C;  3S2D B;  4QMG A;  3GTO H;  4HTH A;  1H9K A;  2OWO A;  3HOU H;  3RZO B;  5C44 H;  4MTN A;  5C5L A;  4DV1 L;  3H91 A;  4ME3 A;  4HIM A;  1QCB D;  2JA5 B;  3EBE A;  5IP9 G;  1GHK A;  1F9R A;  4PG3 A;  3KLS A;  1WFQ A;  4JI4 Q;  3VA7 A;  3K81 C;  4YWK A;  4WJ4 A;  4JYA Q;  2Z0S A;  2JSO A;  2OCE A;  3MFY A;  4C56 C;  4EQN A;  1LAC A;  2VQE Q;  2EJM A;  3I4N H;  2ICI A;  4DV6 L;  4HJ9 A;  4O2D A;  5JJK A;  1TKW B;  3HZX A;  3SK4 A;  3MXP A;  5IOD A;  4GLX A;  2AQ3 B;  4FF1 A;  2VUM G;  3HRZ C;  3PGZ A;  1VCI A;  4POF A;  1U9R A;  3BJU A;  5KNC A;  2FHT A;  1J9O A;  1EY0 A;  3UI2 A;  3K7A H;  4FO2 A;  4A3M H;  2WB1 E;  4OWX B;  3CQZ B;  4GOP C;  5IT9 c;  4EQ5 A;  4IPG A;  2RBM A;  4M1U B;  1PZJ D;  2B2Y A;  3J80 L;  3QR8 A;  4FXK C;  4K2L A;  5C4X B;  1L1O B;  4PNY A;  2KCT A;  3AB9 A;  3H3V H;  1KRS A;  4XT1 B;  1SE2 A;  4DAM A;  3M9B A;  4KKU A;  2R92 H;  4PMC A;  4QIW E;  2TSS A;  1LT5 D;  2RDF A;  4QJF A;  1B9M A;  4OX9 L;  5HGQ A;  1HNX L;  1YNJ C;  1RDP D;  5E7N A;  5M5Y H;  3HOY G;  1LUZ A;  3I4M B;  1A63 A;  4QUC A;  4NXM Q;  4RAU C;  2NWG A;  3S15 H;  4N9T A;  3I4L A;  2KEE A;  5I9P A;  1JCK B;  3NEL A;  2CWA A;  1Y1W B;  4ABN A;  1F9Q A;  3VR4 A;  3J80 i;  1VQ8 A;  1VF7 A;  2XWJ B;  3AMU A;  2NVT H;  4QCL A;  2LFN A;  4DV4 L;  3CKI B;  1OXT A;  1HR0 L;  4JCV E;  1IKM A;  1BXT A;  1SYF A;  4L5S A;  1WI5 A;  5C3E B;  2R93 B;  1BBW A;  3ND8 A;  1XMQ Q;  4O0A A;  4C3I H;  1LTA D;  1H9M A;  3E0E A;  1X3E A;  1U5K A;  1STE A;  1PH3 A;  1PLF A;  1I94 Q;  5IGG A;  4EQO A;  1Q81 C;  1WTP A;  2K14 A;  2UXD L;  1WTR A;  2MO0 A;  2KCC A;  1PTO H;  3A7L A;  3NWT A;  5I6Y A;  1HFG A;  1SYD A;  1HRJ A;  1GUG A;  3PUW A;  1VMP A;  1A0I A;  2N88 A;  4A3C H;  2A1A A;  2WV6 D;  1SN8 A;  2K5D A;  2NN6 H;  3MXU A;  1PRT D;  5DEH A;  1NUC A;  2G9H D;  4CKB A;  1DCZ A;  4U68 A;  2NVQ B;  3PO2 H;  1EY9 A;  2O5J C;  1DOM A;  3BYT B;  4NW2 A;  3CCL A;  1Y14 B;  3VR5 A;  1JOQ A;  2E2I B;  5DM7 3;  1YJW A;  5HGT A;  2KHI A;  1H9R A;  4IQZ A;  1E0B A;  2F0M A;  2F0V A;  3I90 A;  3I8Z A;  4MTK A;  1KLU D;  2J4X A;  3Q23 A;  2UUC Q;  3S1N H;  5CC4 A;  2XGT A;  5ELC A;  4JI5 L;  2WKC A;  5ELO A;  2ASB A;  3H0G H;  1TY2 A;  5FOB B;  3QIA A;  3U4V A;  2Q2T A;  1I50 B;  1EIH A;  3HOZ G;  4G7O C;  3SDZ A;  2KCM A;  3OMC A;  2K03 A;  5C0X I;  1CZW A;  4LUO A;  2H1E A;  5CV5 A;  4DK6 C;  5T1I A;  3QJY A;  5C4J H;  4PZ6 A;  3SGI A;  4IFD I;  5EKI A;  3BDO A;  4DR3 L;  4DR2 L;  2F0P A;  1FYC A;  4FXG C;  2IJ0 A;  2KHS A;  5KNB A;  1VQF A;  1L0W A;  3W5O A;  5I4D A;  1C4Q A;  1LYL A;  3M3Y B;  1Y8N B;  4UP7 A;  3LX0 A;  4AIM A;  3A55 A;  3TZD A;  3B6Y A;  3RD4 A;  1JT8 A;  1EEI D;  2HDL A;  3HGB A;  2EVB A;  2E2J H;  3KF8 A;  4XDX A;  3K5M A;  2A6E C;  3S1R B;  1O78 A;  5KYL A;  4LF6 L;  2JA5 G;  3NTH A;  3CC7 A;  3GQB A;  2RKS A;  4NPS A;  4TVA B;  3RNU A;  4LF9 L;  3CCQ A;  3TP5 A;  1FVI A;  2GA4 B;  1N33 L;  5LMU Q;  2RVL A;  1LTG D;  3I91 A;  3T1Y L;  1D1I A;  3HKS A;  4OHJ A;  5F2D A;  3NTI A;  5LMN W;  3HOV B;  1C48 A;  1EFI D;  1EYC A;  5CYU A;  4JI1 L;  2EXZ A;  1L2F A;  3MEH A;  4R4Q A;  4A3B H;  5EPK A;  5K36 H;  3P1H A;  3TRE A;  1N32 Q;  1K0S A;  1CA6 A;  3MAQ A;  3NTK A;  2PCF B;  2ID0 A;  2MP1 A;  1GXD C;  3KOJ A;  2A6H C;  4DXG A;  5IOC A;  4A3K B;  1X3Q A;  4C2M H;  1TWA B;  5IP9 H;  3KJP A;  1IW7 C;  4V0B A;  2RA4 A;  4JI7 Q;  1OXU A;  3LWU A;  3Q22 A;  2O5I C;  3GTK H;  4CDD C;  2PNH A;  3J7A V;  2B2T A;  2MUY A;  3FHW A;  4E6I A;  1MBY A;  3N52 A;  2HCC A;  4AH6 A;  5C4X G;  4HJ8 A;  2A5H A;  3F2C A;  1CKO A;  5FLX L;  1KL9 A;  3OTO Q;  4GKJ L;  3OSO A;  2QDL A;  2VUM H;  2I07 B;  4C3J B;  1ONL A;  4B3T Q;  1JQY D;  1D2B A;  1HTP A;  2WAQ E;  1I5F A;  4TSS A;  2V4D A;  1STA A;  1W6J A;  2BH8 A;  3I4M G;  2RCF A;  2HT1 A;  1GOZ A;  5J3B A;  1SDF A;  1QUQ A;  1TS3 A;  1EZ8 A;  3PO3 B;  5C5M A;  3TN2 A;  1A15 A;  3VR3 A;  1TS4 A;  4ZUJ A;  2XVS A;  3E9H A;  1Y1W G;  3U58 A;  3M4O H;  4DUY Q;  3NQI A;  1R9T B;  1B70 B;  4AQY Q;  1CKM A;  4RHR A;  4DK0 A;  3PIP A;  5E4X A;  1EUJ A;  3OPO A;  5C3E G;  2R93 G;  2EY6 A;  4F7X A;  2F4V L;  4LF8 Q;  1L0X B;  4PZ7 A;  2UUB Q;  4LFA L;  2KUM A;  2EYL A;  4NMZ A;  3J7A F; 
#chains in the Genus database with same CATH homology
 1KAW A;  2K5N A;  4YY3 L;  2ES2 A;  3CMA A;  2RHQ B;  4QL5 A;  2Z6K A;  3BZC A;  4DV6 Q;  4A3E H;  5JJI A;  3NEN A;  2K52 A;  4KHP Q;  2VS1 A;  3NBH B;  3L2P A;  4A93 H;  4NXN Q;  2YTY A;  1PH8 A;  1XNR L;  1H95 A;  4OO1 G;  1VS0 A;  4X65 L;  4A3D H;  4BXX G;  4DR7 L;  3J81 c;  2ZJR A;  3NEM A;  4R4I A;  1XPR A;  2NN6 G;  4B3M L;  3GO5 A;  1LTL A;  1E1T A;  2HIV A;  4HID A;  4LFB Q;  1HH2 P;  4IOA A;  1KRT A;  2K75 A;  1D8L A;  5M3F H;  4YCW A;  1L1O A;  2VZA A;  4X66 Q;  1QVF A;  3GTM H;  2VW9 A;  1J5E Q;  1G29 1;  1V9P A;  1KD1 C;  3OW2 A;  4IJH A;  3K80 C;  3PO2 G;  1BVS A;  1K8A C;  2K5V A;  5FJ8 H;  4A3J H;  1PH2 A;  2JA8 G;  1DGS A;  3I7F A;  1KXL A;  4DR4 L;  1VQD A;  3BZK A;  4DK3 C;  1N34 Q;  2BA0 A;  1IXR A;  2UXB L;  1IBK Q;  1PYS B;  3KDF B;  1C9O A;  4DR5 L;  1KC8 C;  4B3R L;  2PMZ E;  3CCU A;  4AYB G;  3K8A A;  1E22 A;  2ATW A;  2QEX A;  3HOV H;  1K3R A;  3RLN A;  5LMU L;  3RLF A;  3KF8 B;  4IPC A;  1M1K C;  4LF6 Q;  3J81 j;  4IPH A;  2BH2 A;  1VQE A;  1I3Q H;  1YJN A;  4DUZ Q;  3JC6 6;  3RZD H;  1NBW A;  4LF9 Q;  1XNQ L;  1N8R C;  2LSS A;  1HNX Q;  2UUA Q;  4OO1 I;  3M4Q A;  1V1Q A;  4A76 A;  2ZM6 Q;  1N33 Q;  1CUK A;  3KFU A;  3T1Y Q;  4BBS H;  2NN6 I;  2JA7 G;  1Y1V H;  3CCM A;  1YHB A;  3J80 c;  3S24 A;  4A3K H;  5EAY A;  3G71 A;  1TWA H;  2Y0S E;  3ERS X;  1EIF A;  4LF7 Q;  4FDB A;  4JI1 Q;  3G4S A;  3STB C;  5ELN A;  1SRU A;  4JI3 L;  4DAY B;  1YNX A;  1G6P A;  1SR3 A;  3EIV A;  2KEN A;  4LUZ A;  1PH1 A;  1NMG A;  1TWH H;  1RIP A;  5IYB H;  1YHQ A;  4JG2 A;  4P74 A;  4LF5 L;  2LXJ A;  3I55 A;  2ZJP A;  4GNX B;  1QZG A;  2D0P A;  4DV4 Q;  1C7Y A;  2VNU D;  4JI0 L;  1E1O A;  3J7Z C;  4Y52 H;  3BU2 A;  4LW1 A;  2AKW B;  1HR0 Q;  4B3S L;  4GN4 B;  3M4P A;  2IHE A;  4DV7 L;  1JJC B;  4HJ7 A;  3PUZ A;  1W3S A;  3GTQ H;  1VQP A;  3HOZ H;  2B3G A;  4LFC Q;  4YCU A;  1X3G A;  4RMF A;  4DV0 Q;  1O7I A;  1EIY B;  1JMC A;  5BR8 Q;  4YHH Q;  3I4O A;  1UE1 A;  4APV A;  3PIO A;  4BBR H;  4A3G G;  3PF5 A;  2PI2 E;  4DPG A;  5FJ8 G;  3OTO L;  1N36 L;  1TWF H;  1VQ5 A;  4JI6 Q;  5IY0 A;  3AFP A;  3HOW H;  3GTP H;  2UXD Q;  4A3I H;  1JE5 A;  4WJ3 M;  4UP9 A;  2Y0S G;  1IBM L;  1YVC A;  4L5T A;  4P73 A;  4B3T L;  2VL6 A;  3CPW A;  1PH4 A;  3S1M H;  3UDX A;  1OXX K;  3F2D A;  1PVO A;  3FKI H;  5AJ3 L;  2JEA I;  3UE0 A;  3GTG H;  3D31 A;  4A3L G;  4GKJ Q;  1XTD A;  5IE8 A;  1S3O A;  2LXK A;  1VQC A;  3ER0 A;  2K4K A;  5GAD C;  5C0X G;  4JI8 L;  4EX5 A;  1VQB A;  5GAH C;  4OWW B;  4A3B G;  1HNW L;  5K36 G;  4GLA C;  1EQQ A;  2UUC L;  3TS0 A;  4JBM A;  3GTO H;  4IFD G;  1HZ9 A;  2OWO A;  2NZH A;  3HOU H;  3RZO H;  5C44 H;  4MTN A;  1VQ4 A;  1EWI A;  1Q86 C;  4DV1 L;  3PV0 A;  2CCZ A;  2AWO A;  4POG A;  4AQY L;  4ME3 A;  4HIM A;  4JBJ A;  2IX1 A;  4LWC A;  3CME A;  1B8A A;  3HKZ G;  2JA5 H;  4DV3 Q;  3PCO B;  3EBE A;  5IP9 G;  1XMO Q;  1GO3 E;  2ALY B;  2N49 A;  4JI2 Q;  4X62 Q;  1AH9 A;  1GD7 A;  3H3V I;  3KLW A;  1QUQ B;  4PG3 A;  3IRB A;  3HOX H;  1VQH A;  5FLX c;  1WFQ A;  4IFD J;  2N78 A;  1IBL L;  4JI4 Q;  2F52 A;  1FJG Q;  3K81 C;  4YWK A;  1NY4 A;  2R7D A;  1MJE A;  5IYB G;  3CC4 A;  3HOY H;  3M85 A;  2Z0S A;  4JYA Q;  1YZ6 A;  4WJ4 A;  2UUB L;  2OCE A;  3CCJ A;  1N32 L;  2Q2H A;  2JE6 I;  3F2B A;  1X56 A;  2VQE Q;  2R7F A;  3T1H Q;  2EXD A;  4BY1 G;  3UDF A;  3I4N H;  2XTI A;  2IT1 A;  4DV6 L;  4HJ9 A;  1YIT A;  4O2D A;  1QVG A;  2F4V Q;  2MQH A;  5JJK A;  5JEA G;  1K8G A;  2R6G A;  4H02 A;  1X54 A;  4NXN L;  2CFM A;  3CF5 A;  1X3F A;  3STB D;  4LFA Q;  4GLX A;  5IYC H;  2VUM G;  4LF4 Q;  2I0Q A;  1KHI A;  4DR3 Q;  3PGZ A;  2YV5 A;  1VCI A;  4POF A;  4YY3 Q;  4DR2 Q;  5GAG C;  2JA6 H;  3BJU A;  2WP8 J;  3HOW G;  4LFB L;  2D0O A;  5JEA J;  4X66 L;  1GM5 A;  1XPO A;  3K7A H;  2E2H H;  4A3M H;  5IYD H;  1HJP A;  1XNR Q;  1UEB A;  2WB1 E;  3W1B A;  4X65 Q;  1UE7 A;  3CQZ H;  4OWX B;  4GOP C;  2R7Z G;  4DR7 Q;  2K50 A;  5IT9 c;  1Q7Y C;  2BA1 A;  2L15 A;  3JAM i;  1XJV A;  4EQ5 A;  4IPG A;  4K0K Q;  2UXC Q;  1VQI A;  4UP8 A;  4DNI A;  3PO3 G;  3ULP A;  2NZO A;  3CW2 C;  4BA1 I;  3S2H H;  2NVX H;  4DR6 L;  5C4X H;  1L1O B;  1OXV A;  5IWA L;  3CP0 A;  2RCN A;  4YWM A;  2KCT A;  5M3M G;  2DGY A;  1JB7 A;  3H3V H;  1KRS A;  5FLM G;  2F3I A;  5IP7 G;  4DAM A;  4IOC A;  3HOU G;  3M9B A;  4JBW A;  3EN2 A;  3K0X A;  4DR4 Q;  4QQB X;  2R92 H;  1TWC H;  3GTJ H;  5JJL A;  2I5M X;  4QIW E;  3CAM A;  4JOI C;  2CKZ B;  4PZ8 A;  1YJ9 A;  2UXB Q;  5LMN L;  4QJF A;  1VQ6 A;  4OWT B;  4QY7 A;  5HGQ A;  3I2Z A;  4OX9 L;  4B3R Q;  2AWN A;  1HNX L;  1AE2 A;  3L7Z C;  2B63 H;  4DR1 Q;  3S17 H;  3KJO A;  2D62 A;  2N8N A;  3CCE A;  5E7N A;  5M5Y H;  3HOY G;  1LUZ A;  1UE6 A;  2JQO A;  3F8T A;  3I4M H;  1AE3 A;  1A63 A;  2K5H A;  1GVP A;  2PI2 A;  2WB1 G;  1Q46 A;  3GD7 A;  2A19 A;  4NXM Q;  4HIO A;  2GN5 A;  1I6H H;  3CXC A;  3S15 H;  4LF7 L;  4A3E G;  4GOP A;  1XNQ Q;  1B7Y B;  3NEL A;  4JI7 L;  2CWA A;  4A93 G;  2AHO B;  2VQF L;  1Y1W H;  3PUX A;  1EFW A;  4TQU S;  1WCM H;  1Q1E A;  3J80 i;  1FGU A;  1VQ8 A;  1MJC A;  5GRO A;  4Y7N H;  3TS2 A;  4A3D G;  1HZA A;  2NVT H;  1VQN A;  2A8V A;  1WJJ A;  5IYC G;  4DV4 L;  4X6A H;  2KHJ A;  4YCV A;  1OXT A;  3CCS A;  4JCV E;  4J15 A;  1Z47 A;  4X64 L;  2DUD A;  2JA9 A;  1Z9F A;  5M3F G;  4C3H H;  4DV2 Q;  1KIX A;  4JI3 Q;  4L5S A;  2JA6 G;  1JJG A;  1WI5 A;  5C3E H;  2R93 H;  1BBW A;  1CKN A;  1VQJ A;  2ZTE A;  1XMQ Q;  3MXN B;  4JOI A;  4O0A A;  4LFC L;  4R4T A;  4C3I H;  4DV0 L;  4A3F H;  4DKA C;  1QZH A;  4A3J G;  2UU9 L;  3E0E A;  2OTJ A;  2E5L Q;  1X3E A;  1U5K A;  4HJA A;  4JI0 Q;  2HIX A;  1PH3 A;  1I94 Q;  4B3S Q;  1TXY A;  4DV7 Q;  1Q81 C;  1SMX A;  2K14 A;  2UXD L;  2YU9 H;  3AQQ A;  2MO0 A;  1YI2 A;  1N9W A;  4P71 A;  3CD6 A;  3PSI A;  1OTC A;  3PUW A;  3HOV G;  1PFS A;  1A0I A;  4UPA A;  3UDG A;  2JEB I;  2PQA A;  1YHA A;  3ICE A;  4A3C H;  2A1A A;  3KF6 A;  4XTC S;  4BXX H;  1SN8 A;  1Q8K A;  1N36 Q;  3LGJ A;  1WYD A;  1Q1B A;  4A75 A;  4LNQ A;  2RF4 A;  5M5X H;  3S2D H;  1OXS C;  4IO9 A;  1A8V A;  3L0O A;  1RL2 A;  4DV5 L;  4JV5 Q;  1UE5 A;  2I5L X;  1EOV A;  3PUV A;  3AFQ A;  3PUY A;  4DUY L;  1HNZ L;  2NVQ H;  1P16 A;  3PO2 H;  4BBS G;  1LM0 A;  2JJQ A;  3CCL A;  5C0X J;  3U4Z A;  1Y1V G;  5AJ3 Q;  2IX0 A;  2JA8 H;  3DLL A;  4A3K G;  1Y14 B;  3ULL A;  1NMF A;  1QVC A;  2E2I H;  4BA2 I;  4GN3 B;  1YJW A;  4GKK L;  4MZ9 A;  2KHI A;  4JI8 Q;  3A5Z B;  1Q82 C;  3H15 A;  4PMW A;  1HNW Q;  4KHZ A;  3Q8D A;  3ULJ A;  4LF8 L;  2UUC Q;  1SLJ A;  1EQR A;  4OON A;  3S1N H;  2EIF A;  1E7Z A;  1NE3 A;  3AYH B;  3RN2 A;  1NJI C;  4GLV B;  2XGT A;  1ASY A;  1FJG L;  1C0A A;  2HHH L;  3GDE A;  4JI5 L;  5ELO A;  2ASB A;  1CSQ A;  3H0G H;  1K73 C;  4R1J A;  3U4V A;  1PH5 A;  1PHJ A;  2Q2T A;  4LF4 L;  2VQE L;  1L1O C;  1HR0 L;  1SE8 A;  3UE1 A;  3A74 A;  3HOZ G;  4ALP A;  2WFW A;  1VQA A;  4KHP L;  2KCM A;  1IBL Q;  2QA4 A;  1YEZ A;  3U50 C;  5C0X I;  4LUO A;  4DK6 C;  4BBR G;  1PH6 A;  2JA7 H;  3TEH B;  3F1Z A;  2RHS B;  5C4J H;  3RN5 A;  4PZ6 A;  3SGI A;  4L5R C;  2MFI A;  4IFD I;  4A3I G;  4DR3 L;  3RR5 A;  4BY7 H;  4DR2 L;  1S40 A;  1J5E L;  1PYB A;  4AYB E;  3KYH C;  1X6O A;  2FXQ A;  2C35 B;  1EYG A;  1SFO H;  1VQF A;  2AMC B;  2CWP A;  2OQ0 A;  4IJL A;  2GVB A;  1L0W A;  3J81 i;  3FKI G;  3W5O A;  1LYL A;  2JK8 A;  3K7U C;  1E3P A;  1X65 A;  4A4I A;  4B3M Q;  3M3Y H;  4A3C G;  4UP7 A;  1J6Q A;  4AIM A;  1V43 A;  1N34 L;  3B6Y A;  1VQM A;  2QGQ A;  4K0K L;  3KDF A;  3FP9 A;  4GNX C;  1IBK L;  2GVA A;  2UXC L;  1PA6 A;  1JT8 A;  4QGU A;  4GS3 A;  3JAM c;  1VQL A;  1VQO A;  1VQ9 A;  1G51 A;  2E2J H;  1K83 H;  5C44 G;  3S1R H;  3CC2 A;  4IPD A;  1SRO A;  2H5X A;  1FL0 A;  4NB3 A;  4A3G H;  1D7Q A;  4LF6 L;  3AEV A;  2JA5 G;  3CC7 A;  3HFZ B;  4DUZ L;  1BBU A;  4NPS A;  4TVA B;  4HJ5 A;  1K0R A;  4DR5 Q;  3HOX G;  3RNU A;  3CCQ A;  2UUA L;  4LF9 L;  3CCR A;  4DR6 Q;  4R4C A;  1FVI A;  2ZM6 L;  5IWA Q;  3MEF A;  5LMU Q;  1N33 L;  4LUV A;  2N3S A;  3T1Y L;  3HKS A;  4P75 A;  2YTX A;  2OQK A;  2CQO A;  3S16 H;  4DR1 L;  5LMN W;  4A3L H;  1P8L A;  3H0G G;  4JI1 L;  1L2F A;  4NXM L;  1VQK A;  4R4Q A;  3I4N G;  3J7A 5;  4A3B H;  3W1G A;  4GN5 A;  5LMN Q;  2Q2I A;  4OX9 Q;  2B29 A;  3TRE A;  3TQY A;  3ZJY C;  1N32 Q;  4GNX A;  3PF4 A;  2ID0 A;  2EQS A;  3M7N A;  3KOJ A;  1TWG H;  1UWV A;  3TRZ A;  4L5Q A;  5H1S E;  4JC0 A;  1T9H A;  3RLO A;  3S1Q H;  2YTV A;  4C2M H;  5IP9 H;  3KJP A;  1M90 C;  3D0F A;  4BY7 G;  4DV2 L;  4GOP B;  4JI7 Q;  1NTG A;  4LF5 Q;  2VQF Q;  5GQO A;  1OXU A;  4P72 A;  5BR8 L;  4YHH L;  1HR0 W;  5IYD G;  1XMQ L;  4A3M G;  3GTK H;  1HZB A;  2ZTC A;  1A62 A;  2PNH A;  2E5L L;  3FHW A;  3I56 A;  4JI6 L;  2Q2U A;  2MNA A;  5M5W H;  2I5H A;  1YBY A;  1I94 L;  4X64 Q;  1WOC A;  1W2B A;  4BY1 H;  3S14 H;  4KLK A;  4AH6 A;  3A5U A;  5C4X G;  4HJ8 A;  2V1C C;  1PV4 A;  3DM3 A;  3F2C A;  1CKO A;  1CKN B;  1GKH A;  3A0J A;  1KL9 A;  5GAE C;  2UU9 Q;  3OTO Q;  4GKJ L;  4MNO A;  1IYJ B;  3GTL H;  1CSP A;  1U0L A;  3HKZ E;  2VUM H;  2MO1 A;  4HIK A;  4UY8 C;  4C3J H;  1S72 A;  2R92 G;  1IBM Q;  4B3T Q;  3UDI A;  3OYY A;  4KI0 A;  1VQ7 A;  1JJ2 A;  2WAQ E;  3WWV A;  4JV5 L;  1I5F A;  5DLQ E;  2B63 G;  2IHF A;  2VY3 A;  1BKB A;  2NVY H;  2BH8 A;  4R4O A;  3CCV A;  1K9M C;  1ASZ A;  3I4M G;  2IY5 B;  2Z6K C;  2PQA B;  2HT1 A;  2R7Z H;  5J3B A;  3KF6 B;  4YWL A;  4DV3 L;  1XMO L;  4RG1 A;  1MKH A;  1QUQ A;  1X55 A;  4X62 L;  4JI2 L;  3PO3 H;  3G48 A;  2ZJQ A;  4JBK A;  4DV5 Q;  3CPF A;  4JI4 L;  2YYZ A;  1Y1W G;  3E9H A;  5HY6 A;  3M4O H;  3U58 A;  1WCM G;  4DUY Q;  4DV1 Q;  1R9T H;  1B70 B;  1HNZ Q;  4JYA L;  1IZ6 A;  2HQL A;  5M3M H;  4AQY Q;  1KQS A;  5FLM H;  5IP7 H;  1XPU A;  4OXP A;  1CKM A;  1I50 H;  2KBN A;  1YIJ A;  1X9N A;  1VQG A;  3PIP A;  3T1H L;  4GKK Q;  3G6E A;  3VDY A;  2E8G A;  2OTL A;  1EUJ A;  1HZC A;  5C3E G;  2R93 G;  1E24 A;  2F4V L;  4LF8 Q;  1PH7 A;  4A3F G;  1MIU A;  1IL2 A;  4PZ7 A;  2UUB Q;  2WAQ G;  4XIG S;  2ZTD A;  4LFA L;  1Q12 A;  2HHH Q;  4JI5 Q;  1PH9 A;  3E9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...