4B3SL

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sL00
1PH9A 3AEVA 4OONA 3CCVA 4OWWB 4DR7Q 2C35B 4DUYL 3J81c 3KJPA 1ASZA 5GQOA 2A1AA 3PO2H 1Y1WH 4WJ4A 5IY0A 1VQAA 3RN2A 3KOJA 4LF4L 2WFWA 1Y1VG 4X66Q 2CWPA 4GOPC 1HNXQ 1VQIA 2B29A 1JB7A 1VQFA 2Z0SA 1PA6A 1WJJA 3GTPH 2CCZA 3PF4A 4JYAL 1KC8C 1WCMH 3J7ZC 4GNXB 1XNQL 1VQDA 4HJ7A 1QZGA 5FLXc 4LUZA 2B63H 1SLJA 3S1QH 2WAQG 1PH4A 1VQ7A 2UXBQ 2YTYA 2ZTCA 2HQLA 3AQQA 3G48A 4A3KH 1YJWA 1EWIA 3RNUA 4JI8L 4DV3L 4EQ5A 1IBLQ 3EN2A 3FHWA 3HOWG 5IP9H 3CPWA 4AQYQ 2BH2A 1SR3A 1L0WA 1U5KA 4A3IG 1UE7A 1FGUA 4DR2L 1GM5A 1Y1VH 5IYBG 1FVIA 2LSSA 4YCVA 5IP7G 1VQ8A 1L1OC 1YIJA 2D0OA 4JI5Q 2WB1E 2JA5H 5M5WH 4YWLA 2A8VA 1M90C 4A3FG 1SROA 4NXMQ 3HOUG 3OTOQ 3J81j 4DUZL 3U4ZA 4JV5L 2R7FA 3ULLA 3UE1A 1VQ9A 3L7ZC 2UU9Q 1JJGA 3GTQH 2H5XA 3HOWH 3RZOH 2NZHA 2CQOA 3J80i 4DV7Q 4HIKA 5BR8Q 2AMCB 3F1ZA 2QEXA 1M1KC 4NXNL 3BZCA 5IYBH 2KBNA 5M3FH 4DV2Q 4OO1G 4GNXA 4DR6L 5IP7H 4A75A 3PGZA 4IJLA 4JBJA 1VQBA 5IWAL 4X62Q 4A76A 1PH5A 3I56A 3KF6A 3TQYA 4LW1A 5C4JH 1PHJA 3SGIA 3G6EA 1B8AA 4BY1G 2VQFQ 3CMEA 3PO3G 4A3DG 1MKHA 4BXXG 3HOZH 4ME3A 2K5NA 3STBC 4RG1A 1MJEA 4B3ML 4YCWA 3UDFA 4LF6L 3A74A 4QGUA 1LTLA 2JA8H 4A3JH 1S40A 3BU2A 4DK3C 2PMZE 4B3TL 4QJFA 2R92G 1YEZA 1HZ9A 4IPCA 1UE5A 3K8AA 5LMNL 4P71A 3CCMA 4R4OA 1Q81C 1IYJB 1Q8KA 1EUJA 3PUVA 5C44G 1EOVA 1EIFA 2N8NA 1TWCH 1YBYA 2OQ0A 3PUXA 4X65Q 2ASBA 4P73A 4IOCA 5H1SE 4BY1H 3PO3H 1T9HA 4A3DH 2IT1A 4BXXH 3MEFA 3T1HL 1R9TH 3CQZH 2UXDQ 3CW2C 4LF7L 1BVSA 4X64Q 1W2BA 4B3SL 1FJGL 4A4IA 4JI4Q 2WB1G 2Q2TA 4LF5Q 3VDYA 1HJPA 1J6QA 3I4OA 1XPOA 1VS0A 2JE6I 4A3GG 4A3MH 4K0KL 1C7YA 4OXPA 2R92H 4H02A 1IL2A 1JJ2A 3I7FA 5C44H 1RIPA 2VZAA 3CCRA 3OW2A 1Z47A 1MJCA 1S72A 1N34L 2UUAQ 1N32Q 2Z6KA 4LFCL 3DLLA 1NBWA 1CUKA 3F2CA 3S14H 2NZOA 4LF8Q 4TVAB 3RR5A 4IO9A 3KJOA 3E9HA 1HNWQ 1AE2A 2E5LQ 4A3GH 3A0JA 1XMQQ 3S24A 3UDXA 4C3HH 1BKBA 1E3PA 2ZJPA 2FXQA 5IE8A 1AE3A 1V9PA 3E9IA 2K5HA 3GTLH 4UP8A 3J80c 3ICEA 3CAMA 1YVCA 4AIMA 2KHJA 1O7IA 3F8TA 1QUQB 1JE5A 1TWHH 5IT9c 4HJ9A 3H0GH 3JAMi 2Y0SE 1BBUA 4DV1Q 4L5QA 2EIFA 2QA4A 2UUCQ 4OWTB 1G51A 1PYSB 4JI0Q 1YZ6A 4P72A 4GKJQ 2UXCL 3I4NG 1VQGA 1E22A 3ULPA 4GNXC 2K75A 4DR1L 2F4VL 4POFA 1PH1A 4JI6L 2ZTEA 1K9MC 1HR0Q 1HZBA 1KXLA 4DV4Q 1LUZA 3UDGA 4DR5Q 1XMOQ 3U4VA 1PV4A 1I50H 3A5ZB 4GLVB 4P74A 4XIGS 1OXUA 3PF5A 1CKNB 3TEHB 2NN6I 3ULJA 1WFQA 4O0AA 4DR3L 1VQPA 1KRSA 1IBKQ 3I55A 4GN5A 4A3CG 1A8VA 2K14A 3ZJYC 3GTJH 2EXDA 2VUMH 5FJ8G 3I4NH 5AJ3Q 2XTIA 4BBRG 1XNQQ 4BY7H 1X65A 2CFMA 4YY3L 2R7ZG 1E1TA 4LF9Q 4LUVA 5HY6A 2R93H 1H95A 4DR7L 4MZ9A 3EIVA 1HH2P 3KF6B 5GAGC 3KDFB 5GAHC 1UWVA 1KHIA 3W5OA 1CSQA 4OWXB 4DAMA 1XNRQ 1QUQA 3H15A 1X3GA 4TQUS 4L5TA 2WP8J 1VQ6A 1K83H 4R4IA 3KYHC 4X66L 1HNXL 4BA2I 1DGSA 5M5YH 3S2DH 1NTGA 1JT8A 2EQSA 2RHQB 3KLWA 1KAWA 4PMWA 2K50A 5FJ8H 4UY8C 1V1QA 2Q2HA 1HR0W 3EBEA 1JMCA 4BBRH 2JA6G 2R7ZH 3L2PA 2UXBL 3ERSX 4A3BG 4DV5Q 2B3GA 1VQ4A 1MIUA 4IOAA 4JV5Q 1IBLL 2Z6KC 1GD7A 4AQYL 1CKNA 1E24A 1OXTA 2Y0SG 4L5RC 1PYBA 3RLOA 1UE1A 4GLAC 4JOIA 3ER0A 3CP0A 4PZ6A 4A3IH 4JI3L 3K0XA 3HOYG 4BBSH 3KF8B 1K0RA 4IFDJ 3LGJA 4YHHL 2N49A 4NXNQ 2BA1A 2ZJRA 4DR6Q 5C0XJ 1E7ZA 4DV0Q 1OXSC 2ATWA 4A3FH 5JJKA 2Q2UA 1G291 3HOUH 3K80C 4B3RL 2LXKA 3JAMc 3KDFA 3GO5A 3GD7A 3AYHB 1QVGA 3M9BA 3IRBA 4OO1I 4GN4B 1QZHA 3PUWA 4JC0A 1CKOA 1Q82C 1A63A 2DUDA 4DV7L 5M5XH 4LF6Q 3HOYH 4LUOA 1P8LA 1Y14B 2I5MX 3K81C 5J3BA 4C2MH 5LMUL 4JI7Q 4QY7A 3I2ZA 1X9NA 4GKKQ 4IFDG 3CD6A 1J5EL 2NVTH 4R4TA 4DPGA 4GS3A 4X62L 3M4PA 5C0XG 3F2BA 1TXYA 2YTXA 3NEMA 3T1YL 1VQHA 1IBMQ 3FKIG 4HIMA 3CC7A 1HZAA 1TWFH 3MXNB 2ZM6Q 2DGYA 1G6PA 2ZJQA 4KHPQ 1YHQA 1N8RC 2RHSB 4MNOA 2GVBA 4JI1Q 4JBMA 3G71A 4GOPA 4B3SQ 1WI5A 1FJGQ 1X3EA 1KIXA 2MO0A 4KHZA 5IYDG 2IX0A 1L2FA 4OX9Q 3HOVG 1N33Q 3TRZA 4POGA 3M4OH 2JEAI 3U50C 5C3EG 3M85A 1SN8A 3OYYA 5IYCG 4EX5A 4A3EG 3L0OA 3FKIH 4X65L 1LM0A 3UE0A 3CCQA 4HJAA 1N34Q 5GAEC 4Y52H 2MO1A 1SMXA 4IPGA 4LFCQ 1I5FA 2UXDL 3S1NH 4MTNA 4X64L 4JBKA 2RF4A 4JI4L 4LF5L 2Q2IA 3CC4A 2VQEL 3CC2A 3A5UA 4LFBL 3HOVH 4JI2Q 1P16A 2WAQE 4GN3B 2ID0A 5GADC 5C3EH 2VL6A 2HT1A 4A3EH 1YJ9A 2ZTDA 2OCEA 1IXRA 2UUAL 5K36G 1D7QA 3CMAA 4DR4L 2IHEA 1VQ5A 1U0LA 4L5SA 1ASYA 2R6GA 3PUYA 1N36Q 1I94Q 4XTCS 1GKHA 2AWOA 4JOIC 4DV6Q 2HHHQ 3S17H 2IHFA 1KD1C 1HNZQ 4X6AH 4LF8L 4LFAQ 2OWOA 2UXCQ 3TREA 5JEAG 2I5LX 2F52A 1HNWL 4A93G 5M3MG 1VQKA 3AFPA 4JI6Q 4QL5A 2RCNA 4QQBX 1QVCA 2E8GA 3CCSA 3GTMH 2K52A 4FDBA 4YWMA 3HOXG 1E1OA 1Q1EA 2UUBL 5JJLA 4DUYQ 4DAYB 4KI0A 4LWCA 3GDEA 4HIDA 2YYZA 1YHAA 1Y1WG 3PO2G 1VQEA 3J7A5 3U58A 2IY5B 2I5HA 1B70B 3PV0A 2MFIA 1XJVA 1WYDA 2VW9A 4LF4Q 1GO3E 3PSIA 1SE8A 2UUCL 4JI0L 1K3RA 1W3SA 4JYAQ 2OQKA 4IPHA 1EFWA 1K8GA 4UPAA 4WJ3M 2KENA 5EAYA 4A93H 2BH8A 3BJUA 5M3MH 1HR0L 1KL9A 3HKSA 1PH7A 4A3KG 4DV4L 1NMGA 2PQAA 3RLFA 2MNAA 4JI8Q 3HOXH 4DR5L 4DV3Q 1XMOL 1K8AC 4JBWA 2JA7G 5IP9G 3HKZE 2JK8A 2HIXA 3S15H 1B7YB 2E2HH 1IBKL 4DR2Q 2MQHA 2GN5A 2JA9A 2KCTA 4A3CH 2NVYH 2AHOB 1VCIA 4UP9A 5FLMG 5JJIA 4R4QA 1YJNA 1PH2A 2JA5G 5AJ3L 3S1RH 1SFOH 1CKMA 4JCVE 3TS0A 4LF9L 2K5VA 1A62A 4DUZQ 4R4CA 1X3FA 3WWVA 4DNIA 2A19A 3F2DA 3NENA 4KLKA 2JA7H 1XNRL 4O2DA 2ES2A 1RL2A 3CF5A 4GOPB 2JJQA 2E2IH 4RMFA 5M3FG 1CSPA 1FL0A 2E2JH 4JI3Q 1VQJA 4YHHQ 4JI5L 4R1JA 1UEBA 5FLMH 3W1BA 2VY3A 3K7UC 5IWAQ 3NELA 1D8LA 1Q7YC 3FP9A 1PH6A 3OTOL 2PI2A 4NXML 2JA6H 4J15A 3GTGH 3I4MG 1Q12A 2NVQH 4B3RQ 4DV5L 4YWKA 4A3BH 1Q46A 4Y7NH 3TS2A 3PCOB 2UU9L 4ALPA 3Q8DA 3HOZG 2R7DA 2OTLA 4B3MQ 1PVOA 1WOCA 5BR8L 4C3JH 2JA8G 1LYLA 4A3JG 3PIPA 1YITA 4DV2L 3PIOA 5LMUQ 2KCMA 4LNQA 2N78A 1EYGA 1L1OB 3K7AH 4B3TQ 2CKZB 1I3QH 3CCJA 1XTDA 4DV0L 1J5EQ 2L15A 4C3IH 3S1MH 5LMNQ 4APVA 2AWNA 1VQOA 3I4MH 3NBHB 4IPDA 3T1YQ 3HKZG 1VQMA 1GVPA 4DKAC 2QGQA 2VQFL 1NE3A 1VQLA 1UE6A 3M7NA 3CPFA 3CCEA 3RLNA 3W1GA 2JQOA 3J81i 4IFDI 3T1HQ 3G4SA 1XPUA 3BZKA 1PFSA 3UDIA 4LF7Q 4JI7L 2D0PA 5C0XI 4IJHA 1YI2A 5C4XG 4GKKL 3S16H 4AYBE 4A3MG 2PI2E 4K0KQ 1JJCB 1HZCA 3B6YA 4YCUA 3D31A 2VS1A 4GLXA 2JEBI 1IBML 3GTKH 1NMFA 2OTJA 1YNXA 1TWGH 3AFQA 2ZM6L 1C9OA 3S2HH 5HGQA 2AKWB 2BA0A 2LXJA 1EQQA 4PZ8A 1XPRA 4KHPL 2ALYB 4AH6A 1A0IA 3M3YH 2V1CC 4JI1L 5JEAJ 1X54A 2PNHA 3CCUA 4BBSG 3KFUA 4UP7A 1PH3A 2NVXH 1L1OA 1S3OA 4PG3A 3STBD 5C4XH 2K4KA 4OX9L 5IYDH 2XGTA 2VQEQ 1N33L 1Z9FA 1SRUA 5LMNW 4A3LG 4LFBQ 1OXXK 2PQAB 3D0FA 4DK6C 1Q86C 3M4QA 5IYCH 4PZ7A 3HFZB 2CWAA 1K73C 1IZ6A 1N32L 1KRTA 4QIWE 4HIOA 3PUZA 5E7NA 1OTCA 1YHBA 4DR4Q 1X6OA 3DM3A 3H0GG 3CXCA 5DLQE 1VQNA 1TWAH 1QVFA 4HJ5A 1X56A 2GVAA 1VQCA 4HJ8A 4NB3A 3E0EA 4DR1Q 1NY4A 2E5LL 3CCLA 4P75A 2F4VQ 4BA1I 1XMQL 1EIYB 1PH8A 1AH9A 2F3IA 2HIVA 3GTOH 4JI2L 1EQRA 5ELNA 1OXVA 4A3LH 2IX1A 3JC66 1BBWA 2UUBQ 2YV5A 1V43A 2I0QA 1I6HH 1NJIC 4JG2A 3RZDH 1N36L 1I94L 4DV1L 4DR3Q 5ELOA 4DV6L 2HHHL 3H3VI 2YU9H 2N3SA 1X55A 1N9WA 1HNZL 4GKJL 1WCMG 4LFAL 2NN6G 2VNUD 2VUMG 4AYBG 2YTVA 1Q1BA 4BY7G 2D62A 1KQSA 5GROA 2B63G 3H3VH 1C0AA 4YY3Q 2KHIA 2R93G 4NPSA 3RN5A
chains in the Genus database with same CATH superfamily
4A93B 5M3MB 1ASZA 1CQFA 4KJNA 1YNND 2F3WA 3P7JA 1S5BD 1SJHD 4J8QA 3VYRA 3KOJA 4LF4L 3NTIA 2WFWA 3PO2B 3GTPH 3S15B 1VQIA 4JYAL 2Z0SA 3TZUA 5A35A 2FINB 4EVOA 2EOTA 2K03A 4LUZA 3CRKC 3S1QH 2UXBQ 3AQQA 3G48A 3RNUA 4NW2A 1STNA 4XYOA 4AQYQ 2QILA 2A5HA 1U5KA 4DR2L 4FXDA 1FVIA 1JOQA 2A69C 2A8VA 1O78A 1M90C 4PQXA 5LL6X 3J81j 1HUNA 1HRJA 2KUMA 3GTGB 3E5SA 3D6CA 4HSPA 2Y0SB 2QEXA 1M1KC 4NXNL 4OO1G 2BDNA 2O5JC 3PGZA 3R2TA 1PH5A 4ZLTF 3I56A 5C4JH 1SEBD 3N52A 2EY6A 2CH4A 3G6EA 2VQFQ 3CMEA 3PO3G 1C8CA 4BXXG 4ME3A 1ESFA 2WACA 4RG1A 4B3ML 3EJIA 4QGUA 2BE5D 3BU2A 5I2YA 5DEHA 3ND8A 2R92G 2F0MA 1UNSA 4IPCA 5J39A 1IYJB 1HCZA 1Q8KA 3PUVA 1EIFA 1TWCH 2RVLA 2AQ2B 3GV6A 4IOCA 3PO3H 3J81E 3J7AF 4X3SA 4BXXH 5BN5A 1R9TH 1KLUD 1W2BA 4B3SL 4JI4Q 2WB1G 2Q2TA 1HJPA 1VS0A 1RTNA 2F0GA 3D3RA 4A3MH 4K0KL 2CW0C 4OXPA 4C3HG 2R92H 3A8KE 4DNRB 1J8IA 5HGTA 2KHSA 2PO4A 1RIPA 1LTGD 4KK7A 3LX0A 3CCRA 1MJCA 3OW2A 1S72A 1N34L 4XYQA 3MFYA 4UAIA 4TVAB 5FO8B 1EY5A 3A0JA 3V2TA 3S24A 3UDXA 1QWYA 2X69A 4C3HH 1BKBA 3H3VC 4X3TA 1UEAB 2XN9C 3VYTA 3CAMA 4K5XA 3F8TA 5IT9c 4HJ9A 3ITPA 4MIUA 3H0GH 4DV1Q 1BBUA 3RZDB 4OWTB 4GKJQ 1VQGA 3ULPA 4GNXC 2F4VL 2B2UC 4POFA 2ZTEA 1K9MC 1HZBA 1KLGD 2A6EC 2NYZD 1LUZA 1DM0B 4DR5Q 1PV4A 1I50H 3A5ZB 3D4DA 3MWYW 5EKIA 2L11A 5JVH3 1WTPA 1CKNB 2PQEA 3TEHB 4G7ZC 2IWHA 1D2BA 1VQPA 1DOLA 1IBKQ 2CVRA 3P75A 1PDQA 2K14A 3ZJYC 3GTJH 1XNQQ 2NB0A 4YY3L 1WCMB 2L55A 5FKAC 1HH2P 2B63B 1LO5D 1F9PA 1UWVA 1Z7TA 2EY5A 4A3KB 1CSQA 2F0DA 2PNRC 1QUQA 1X3GA 4F88A 1PTOC 3P1HA 4X66L 3KYHC 5I9OA 1SNCA 2F0SA 3HEJA 4BA2I 3Q0AA 1KAWA 2K50A 4UY8C 4GZYC 1KABA 2GA4B 3EBEA 1EFID 1SJED 2ICIA 3L2PA 3GP7A 2B8GA 3OWFA 4JV5Q 1MIUA 2R61A 1IBLL 4CKCA 1PYBA 4H7BA 4GLAC 4C3JG 4A3IH 3GTQB 1CZGA 2K5QA 2LMCB 4WRDA 4RKLA 4V190 2I07B 2N49A 4O1NA 1ET6A 4DR6Q 1E7ZA 4DV0Q 5JJKA 1G291 1BCPB 3K80C 1TS5A 3JAMc 3NQTA 3DEOA 2TMPA 1E2ZA 3AYHB 1QVGA 3IRBA 1BCPD 4GN4B 4OO1I 1S5FD 3PUWA 2DUDA 1CT1D 3J80E 4LF6Q 4JI7Q 3HOZB 2CQAA 2IL8A 1QILA 1UAPA 4IURA 5KYIA 4IFDG 3CD6A 3F2UA 1B4OA 4GS3A 2L5TA 4IUTA 5C0XG 1KTKA 2YTXA 4K6LA 4U673 2MHVA 3BG3A 3H94A 1I4HA 4HIMA 4CHTB 3G7LA 2H4OA 3MXNB 1G6PA 2DGYA 4F8MA 4KHPQ 2GVBA 4A3DB 1EU3A 3VR3A 4EGVA 4RKBA 4JVZA 2MO0A 1SYCA 2KECA 2A68C 2QCPX 5IYDG 3M4OH 3QB3A 5C3EG 1JWUD 5C0XH 3OYYA 1F77A 4A3EG 3L0OA 4ZAIA 4X65L 3UE0A 3CCQA 1CTMA 1NSNS 3ZYYX 5GAEC 3NWTA 4Y52H 1BO0A 2B2VC 1I4QA 1ZXTA 3S1NH 4JBKA 2RF4A 3S14B 3CC2A 2F0LA 1JE4A 2FHTA 4QUCA 2FMMA 5J1ZA 4A3GB 5C3EH 5GADC 2HT1A 4A3EH 1EZ8A 1D7QA 5K36G 3CMAA 4DR4L 2IHEA 3SE0A 3GTLB 4IUVA 1STBA 1N36Q 5BN4A 4IUQA 4DV6Q 3S17H 4IUUA 1BXTA 4LFAQ 1WTVA 2OWOA 1SNOA 1HA6A 1HNWL 4A93G 5M3MG 4R8NA 1R4PB 4YWMA 3VR4A 4LWCA 1H9JA 3PO2G 2YYZA 1Y1WG 3I91A 3PV0A 3IAYA 4LF4Q 1TIID 2UUCL 4JI0L 4JYAQ 2OQKA 5ELFA 5C5LA 4WJ3M 4X3KA 2K28A 1RDPD 4TKOB 1AFPA 4A93H 5M3MH 1HR0L 1EYDA 4DV4L 1NMGA 2A73B 2PQAA 4WFN3 2MNAA 1KDCA 2R93B 1XMOL 5CV9A 4DGZA 1WD1A 3S15H 1SSOA 4DR2Q 3C3LA 1K83B 1YJNA 1PH2A 5AJ3L 1R4QB 2VB2X 5M5YB 4EQOA 5DM63 1JICA 1PFNA 3S1RB 4BBRB 4XT1B 2SOBA 1HPCA 4KLKA 2M9VA 3R2IA 1XNRL 2XWBB 2ES2A 3MA2B 4JI3Q 1KAAA 3A8IE 5CC4A 1BNZA 1Y69U 1VMCA 2PZUA 1UEBA 4L8JA 3T56B 3FP9A 3GTGH 1UUPA 4CDFC 3A54A 4DV5L 4MTKA 2HQEA 5JOBA 4A3BB 1CHQD 2F0EA 2B2YA 1HTPA 4B3MQ 4IN3A 4A3JG 1O7ZA 2KCMA 3QO2A 5E3FA 5M5XB 3HOYB 4RFBA 4APVA 5IOCA 3A56A 1PXUA 4RCNA 4EQNA 5NUCA 3T1YQ 4HCEA 2VQFL 3CCEA 3RLNA 3J81i 4XQNA 4IFDI 3G4SA 3BZKA 1PFSA 2D0PA 5C0XI 4IJHA 1YI2A 4GKKL 1GHJA 4K0KQ 5D3IB 1SYFA 1DOMA 2F03A 1TWGH 2AUJD 3TBIB 1C9OA 3J81L 2BA0A 1Y8OB 1EQQA 3FPUB 4AH6A 1SXTA 1K8OA 1X54A 1CI3M 1SMYD 2PNHA 4UP7A 4G7HC 1VMPA 2XGTA 2VQEQ 2KVMA 2WB1B 4FNFA 5LMNW 1EOTA 1IYUA 3D0FA 1YNJD 3FVQA 5I9PA 3HFZB 5T1IA 1HXYD 5D14A 5E7NA 3DM3A 1VQNA 3RUZA 4HJ5A 1X56A 2M2LA 3FEWX 2F4VQ 1NY4A 4BA1I 2F0PA 4JI2L 1W6JA 1EQRA 1OXVA 2A74C 5ELCA 4G57A 2IX1A 1S5CD 3TDQA 1NJIC 1GHKA 1PFBA 3RZDH 1I94L 4DV1L 1N9WA 4GKJL 1WCMG 2VNUD 2VUMG 4AYBG 5JEAH 2OEOA 3TMEA 2B63G 5GROA 2XSCA 1G6ZA 2PMZB 4YY3Q 4R1JA 1PH9A 3AEVA 5FK9C 3TSSA 2C35B 4RGNA 1EZ6A 4F7XA 4KN7C 2EZVA 5IY0A 4L6TB 1ZKOA 2OXPA 4X66Q 1B9MA 2CWPA 1PA6A 4IZ8A 2CCZA 4QCLA 1KC8C 1WCMH 3J7ZC 1GUOA 1XNQL 1VQDA 1TT2A 4DXGA 5FLXc 1HUMA 2B63H 1SLJA 5IGFA 1VQ7A 2ZTCA 4A3KH 2O4XA 4DV3L 1IBLQ 5IODA 3CPWA 2BH2A 1EYAA 1L0WA 2JA7B 1GM5A 3I3CA 2HDLA 2LSSA 4YCVA 2F0NA 1VQ8A 2D0OA 2E2JB 4YWLA 4A3FG 2EY1A 4KY5A 2Q8RE 1RKNA 2MJ8A 4JV5L 2J0TD 4KJOA 1PRTB 1VQ9A 2BE5C 2UU9Q 3GTQH 4DN4M 5HURA 2X6LA 3AU7A 4ABNA 1RHPA 2K7VA 5E4WC 3J80i 5I6WA 2V4DA 3F1ZA 1GOZA 2KBNA 4GNXA 4C3JB 4KKUA 4DR6L 2B2UA 2F0KA 3A7LA 3O13A 1K28A 4C3IB 4LW1A 1EY0A 1JWMD 2E2DC 4A3DG 3K5OA 4RWSC 3HOZH 3J80L 3AMUA 3UDFA 4LF6L 1LTLA 2JA8H 1S40A 2AQ3B 4QJFA 4KV6A 1XTCD 3NTKA 1Q8IA 2QF7A 1Q81C 1EUJA 1G2SA 4FF4A 4I7AA 2HDMA 1LTBD 1K3BC 2N8NA 4X65Q 2K5WA 3H91A 2EYFA 5CR3A 3GTKB 1WTHA 4HCSA 4PV1C 4A3DH 2DN8A 3T1HL 4DK1A 4LF7L 4A4IA 1EQTA 4H0LC 2DY8A 1MSHA 3VDYA 1XPOA 4A3GG 3VYUA 3BDLA 4DK0A 1C7YA 4PMBA 1F2ZA 4H02A 3EVQA 1EQVA 3OSOA 3S14H 2A6HC 1I6VC 5I2XA 1TWAB 4CDDC 1HNWQ 4RHSA 2E5LQ 3TP8A 4A3GH 2EXZA 5IE8A 1AE3A 3E9IA 3GTLH 3MEHA 5EJWA 4RH6A 2F0IA 4AIMA 1O7IA 1QUQB 4RGTA 4ZUJA 3TZDA 1I6HB 2UUCQ 2EIFA 2QA4A 4JI0Q 1D5MC 1JR0D 1ZYRC 2YU9B 4DR1L 2B39A 3HS0C 1LABA 1PH1A 5CV8A 4HTHA 3NK9A 1HR0Q 4L63B 4KTAA 4DV4Q 4FF1A 2CH4W 1T5XD 2K32A 2F0HA 1XMOQ 4XIGS 2NTSA 3ULJA 4O0AA 1Y1WB 2PZWA 3I55A 1G8ZD 3K5NA 4GN5A 1C48A 1TY0A 5AJ3Q 2XTIA 4BBRG 4K8JA 5HY6A 2R93H 4CJ0B 4DR7L 3EIVA 3QOLA 3KF6B 1LT4D 4ODGA 2ENBA 1Q90A 2EYJA 3I90A 4OWXB 4DAMA 2G9HD 2SNMA 1XNRQ 4XQQA 1K83H 2B2VA 1HNXL 3KLRA 5M5YH 4ZYSA 1JT8A 1Y1VB 2EQSA 2RHQB 1V8QA 3DWQA 2Q2HA 5K5PA 4BBRH 5M5WB 3FRPB 4A3BG 4DV5Q 1VQ4A 2WAQB 1E24A 1LLRD 4L5RC 1V1OA 3RLOA 3K0YA 3HOYG 4PZ6A 4JI3L 3K0XA 3HOWB 1K0RA 4IFDJ 3LGJA 1IKLA 3CU7A 3MFGA 5C0XJ 3BZDB 2HCIA 1OXSC 1RD9D 4BS9A 2AUKA 3LWEA 1SE2A 2EVBA 3DM1A 2LXKA 1QNUA 3M9BA 4XXEA 4JC0A 5KNDA 1A63A 5EPJA 2K01A 5M5XH 3M7NA 3HOYH 1P8LA 1Y14B 2I5MX 3K81C 5J3BA 1ICFB 5IT9E 4OO1H 4QY7A 4CKBA 1EY8A 4GKKQ 4A3JB 4R4TA 3M4PA 2BOSA 3KBXA 3T1YL 1GXDC 2ZJQA 1F2LA 1YHQA 4JBMA 4GOPA 4Z9CB 1WI5A 1TKWB 4B9XA 1C4QA 1FJGQ 1KIXA 5CV6A 4POGA 2JEAI 4DU9A 3IKJA 1SN8A 5IYCG 1HTLD 2DJFC 2RDGA 5C44B 1E2WA 5COYA 2MO1A 1B53A 2KA7A 4LFCQ 1I5FA 4FF3A 4X64L 5EGTA 4LF5L 2KOLA 1Y8NB 2Q2IA 2VQEL 2BCOA 4K8IA 3FDTA 3A5UA 4JI2Q 3NXWA 1AP0A 1P16A 1WTOA 1YJ9A 5T1GA 2UUAL 3K57A 3SK6A 1A3VA 1I94Q 1GKHA 5EQ0A 1CQVA 2ZXPA 5I6YA 4JK1C 3AFPA 4HEDA 2RCNA 1VF7A 2K52A 1ZEQX 4ZKCB 3OW7A 1Q1EA 3S9WA 4KI0A 1LTID 3GDEA 1WTWA 1TS2A 4CKEA 3J7A5 4U68A 3U58A 2I5HA 1B70B 3JAME 1WYDA 3PSIA 2K5DA 1S5DD 1W3SA 3PQIA 5ELBA 2KENA 1EU4A 5EAYA 2VUMB 2R3ZA 4AYBB 3I4NB 1PH7A 3NE5B 4OEMB 2RCFA 1K8AC 1PZJD 4DV3Q 2JA7G 5IP9G 3HKZE 3L3OC 4BWGB 2HIXA 2ZXOA 1B7YB 3MAQA 1MI2A 4X3UA 2AHOB 5LHY1 5JJIA 1II3A 2JA5G 2O2LD 4KMUC 2NVYB 3S2DB 1CKMA 4JCVE 4LF9L 1A62A 4DAYA 2NZ1D 3F2DA 1CA5A 3NENA 2JA7H 4NDXA 2KEEA 2Q8TA 5IGEA 4RGOS 3C1FA 3CF5A 2JJQA 5M3FG 2E2JH 1FL0A 1F9RA 4FO2A 4C3IG 3NELA 4HMJA 3VR6A 4B3RQ 3C2PA 2EJGC 4NP5A 4YWKA 5IIFA 4A3FB 1B3AA 2UU9L 4Q5VA 2NVQB 3Q8DA 2R7DA 2OTLA 3QIAA 1PVOA 1IKMA 4C3JH 1LYLA 5LMUQ 2N78A 1EYGA 3TP7A 4C2MB 2CKZB 3CCJA 2HD3A 4C3IH 1IL8A 2RKSA 2A69D 4DKAC 3E3XA 2F1MA 1UE6A 3SK8A 2VXWA 3T1HQ 3UDIA 4LF7Q 4OHJA 1U9RA 3URYA 2FMCA 3K59A 1CA6A 3J7AV 4OL7A 4IFDH 4HMIA 1I4RA 3B6YA 4YCUA 3D31A 4J6HA 1K0SA 2JEBI 1IBML 3GTKH 1NMFA 2D2CC 2OTJA 5KEEA 3AFQA 4IUPA 2ZM6L 1G91A 5HGQA 3FKIB 1A0IA 2V1CC 5JEAJ 1AEXA 3DWAA 1I4XA 4P2CB 3E0JA 5IYDH 1OXXK 1PFMA 1Q86C 3M4QA 2WKDA 1D5XC 4PZ7A 2J7ZA 3HG9A 1NUCA 1GUGA 4KD4A 3QWNA 3CXCA 5DLQE 1TWAH 3HGBA 1H9KA 3T51B 1SNQA 3AB9A 2B2TC 3OPOA 4HJ8A 2E5LL 4DR1Q 3CCLA 2F3IA 1O80A 1S4ZA 3VR2A 2YV5A 3GTMB 5K36H 1I6HH 4Q0FA 3D4RA 3OHXC 1ONLA 5ELOA 3NTHA 2HHHL 2YU9H 2K04A 2N3SA 1A6XA 4JW0A 5CBEE 2NN6G 1ILQA 3SEBA 2YTVA 1Q1BA 3NBIA 2RSNA 2D62A 4BY7G 1C0AA 3Q24A 2KHIA 4DK3C 2R93G 1SDFA 5JAVA 4FXKC 2E76C 3CCVA 4DR7Q 2PYKA 4DUYL 2C9OA 2A1AA 3PO2H 1Y1WH 2F0QA 3P20A 3HOXB 3RN2A 1VQAA 4WJ4A 3DMUA 1Y1VG 1SE4A 1NCVA 3GV3A 3K5MA 4GOPC 1HNXQ 1JB7A 1VQFA 1TY2A 5FO9B 1WJJA 3VA5A 2E2HB 5KGUA 4GNXB 2NN6H 1LTAD 2WAQG 4N8FA 1YJWA 1EWIA 4EQ5A 3FHWA 3HOWG 1SNPA 1TQOA 4K2LA 3X3MA 2F0WA 1UE7A 1FGUA 5EKKA 1Y1VH 5EBDA 5IP7G 1L1OC 1YIJA 1EEFD 3NP8A 2E2IB 5M5WH 2EYOA 5EPKA 3D6WA 1BUVT 3MHBA 3HOUG 3U9OA 3OTOQ 4DUZL 4N8X1 2NWGA 2R7FA 3ULLA 3D8GA 3UE1A 1LT6D 3L7ZC 1SE3A 3M7GA 3HOWH 4I7ZC 1PTOB 4HIKA 5BR8Q 3BZCA 3BVZA 4JPBW 5IP7H 1PLFA 1QG7A 4IJLA 5IGDA 4JBJA 5IWAL 4A75A 1DJRD 2XWJB 4A76A 3K7AB 1NAPA 2WINB 1DXMA 1I3QB 3S1MB 2EJFC 3V05A 3I4MB 4H44C 3SGIA 4H13C 1X32A 4XT3B 2K5NA 3STBC 5CGKA 1MJEA 1QCBD 5IT9L 2JXMB 4A3JH 4G7OC 1H9SB 2N88A 1F2MA 3QG1A 4ZRZA 3SK4A 2HCCA 1HZ9A 3CRLC 3K8AA 5LMNL 4P71A 3S16B 5C44G 1SAPA 1EOVA 1STGA 3T53B 2B8FA 2OQ0A 3PUXA 2P5ZX 5H1SE 1WTRA 1PZID 1Z6HA 3DEPA 3S2HB 3A7AB 1BVSA 4X64Q 5DM73 1FJGL 5KYLA 3OIQA 4LF5Q 1A15A 4G4KA 2NVXB 1BCPF 4ULLA 1IL2A 3K6OA 1SBBB 2LKVA 3I7FA 3MVVA 5FLXE 5C44H 2VZAA 2UUAQ 1N32Q 4LFCL 1EYCA 3F2CA 4K2KA 3ND9A 4IALA 2EJMA 2K6AA 5C3WA 2G5DA 4RA8A 1YNNC 4BBSB 2D5DA 2FXQA 1V9PA 2K5HA 4UP8A 4K5WA 2A68D 1D5ZC 1YVCA 2KHJA 3W2DA 2JYOA 1JE5A 1HFGA 3L9AX 3U9SA 3JAMi 2Y0SE 5JPMC 2EPBA 1G51A 1EY9A 1PYSB 1YZ6A 1CHPD 1F2YA 3I4NG 2K75A 2IX3A 2JP1A 5DAUA 3VYSA 3UI2A 1I4GA 2AQ1B 3UDGA 2NUCA 1CFMA 3U4VA 4GLVB 5I4DA 3SHLA 3PF5A 3JAML 2NN6I 1WFQA 1BQQT 4LK1C 3TP5A 3HP3A 3QOJA 4I65A 4A3CG 4ZKBB 1AZQA 2EXDA 1T5EA 5FJ8G 2VUMH 3I4NH 1X65A 2CFMA 1HQRD 4LF9Q 2NTTA 4WORA 4MZ9A 5GAGC 5D65A 2BDOA 3W5OA 4ZQ3A 4DNTB 3H15A 4TQUS 1SYEA 2IJ0A 2F0FA 4LMQD 3HRZC 4R4IA 1VQ6A 3WDNA 3S2DH 3KK7A 3KLWA 4PMWA 1BBXC 5FJ8H 1V1QA 3OMGA 2KCNA 2JA6G 2JA5B 1JC7A 2RSOA 3K58A 4FYDA 1BR9A 2XRQD 4IOAA 2Z6KC 1GD7A 3VA7A 3LNNA 1PRTD 1U4MA 3ER0A 3RZOB 1A3UA 1EEID 1IW7D 1FR3A 2BA1A 2ZJRA 4A3IB 5M3FB 2SDFA 2ATWA 4A3FH 2QDLA 4B3RL 3KDFA 4OELB 3GO5A 3GD7A 1L0XB 1X3QA 4HSVA 3M4YA 5A2QE 4DV7L 4LUOA 4C2MH 4KD3A 5LMUL 3I2ZA 1X9NA 4DPGA 4X62L 3OOCA 3NEMA 1IBMQ 3FKIG 2G9DA 1HZAA 1GUNA 2ZM6Q 3QJYA 1N8RC 4MNOA 5F2DA 4BY1B 1RTOA 3KF8A 2F4IA 1D1KA 3CQZB 3TN2A 1L2FA 1ENAA 3U50C 5C5MA 1SYBA 5C6AA 1W6KA 3FKIH 4J1MA 5JVG3 4HJAA 1DD2A 3BDCA 5EKLA 2DNCA 1SMXA 1EY6A 4IPGA 3VR5A 2UXDL 4UDUC 1EIGA 1HQMC 3CC4A 3PIP3 3PIO3 5C4HA 1MGSA 2EY2A 2QEJC 3OMCA 4GN3B 2ID0A 2OT2A 2M00A 1IXRA 1FD7D 4RAUC 5KRUA 3DWPA 1ASYA 2EDGA 3PUYA 1V1PA 1CM9A 4XTCS 4JOIC 2HHHQ 3E6ZX 5KIXA 4X6AH 1KD1C 1TWHB 4LF8L 3IFDA 2UXCQ 1NR4A 2F52A 2I5LX 5C4ZA 4JI6Q 1TR5A 3NWSA 4QL5A 4CGYB 4QQBX 3CCSA 3GTMH 4FDBA 3HOXG 4KN4C 4DUYQ 4DAYB 1YHAA 1VQEA 2IY5B 1XJVA 2MFIA 5CV5A 2VW9A 3IL8A 5AFWA 1EFWA 4UPAA 1QB5D 4MHEA 3C46A 2KEDA 2BH8A 3BJUA 1KL9A 3HKSA 4ID6A 4R8IA 4BY7B 4QF4A 3RLFA 3HOXH 4JBWA 1PZKD 2RDFA 3SXHA 2RBMA 2JK8A 5FO7B 4FP5D 1PMRA 4IQZA 2E2HH 1LT5D 2GN5A 3NQIA 2F0JA 2KJXA 3LWUA 4IUNA 4ME5A 5FLMG 4UP9A 4C56C 3S1RH 2QDBA 5CMDA 4K14A 5ELEA 1S5ED 1BCPC 4DUZQ 3H6MA 3WWVA 4DNIA 2R7ZB 3Q22A 1B3QA 1GUTA 2A19A 2Z8LA 4V0BA 1M8AA 1FNUA 4O2DA 2J4XA 4DF7A 4PNYA 1LTSD 2ZXRA 2H1EA 1RL2A 4ZK9B 3CKIB 2E2IH 2B2TA 4RMFA 1EIHA 1CSPA 4YHHQ 5FLMH 2VY3A 3K7UC 5IWAQ 2FJ2A 4QUFA 3I4MG 1PH6A 3OTOL 4PMCA 3X3NA 2K1BA 4A3BH 1Q46A 4FXGC 2Q8IB 3HOUB 3PCOB 1PTOH 4ALPA 5BR8L 3K7AH 1I3QH 1XTDA 2EE1A 1J5EQ 3S1MH 5LMNQ 4XDXA 2AWNA 1VQOA 3R93A 3I4MH 2NVTB 4IPDA 3NSWA 2DNEA 3HKZG 3T16A 5BN3A 1GVPA 4DAVA 1VQMA 1B44D 1NE3A 5E1FA 2JQOA 1TWFB 2EYHA 3R8BA 1XPUA 5KNCA 3A8JE 1RF2D 2QW7A 3T4AC 4E6IA 3S16H 4A3MG 3I4LA 2PI2E 1JJCB 1HZCA 1AW7A 1DOKA 4O42A 2SNSA 1PRTF 1TU2B 3S2HH 3OWEB 2LS01 2AKWB 4PZ8A 5CV7A 1TWGB 2ALYB 3QR8A 4JI1L 1JOOA 4M1UB 4BBSG 3KFUA 1PH3A 2NVXH 1L1OA 4PG3A 4OX9L 1N33L 1Z9FA 4A3LG 4LFBQ 2PQAB 3NBHA 4DK6C 4B08A 5IYCH 5FLXL 3HOVB 5EPLA 2F0OA 2CWAA 1K73C 3G6JB 1IZ6A 1N32L 4QIWE 5J22A 1OTCA 1YHBA 3H0GG 1QVFA 1EWHA 4OIKA 2MP1A 2GVAA 4NB3A 1WTXA 4BBSH 4P75A 1EIYB 4LJZC 2K33A 4A3LH 1LT3D 1BBWA 2UUBQ 3WOEA 5G3LD 3EA6A 1V43A 1BOSA 4JG2A 3H3VI 1HNZL 3ERQA 5E4XA 3I8ZA 1KQSA 4DXFA 2A6HD 4NPSA 3SDZA 1G2TA 4NKLA 4OONA 4OWWB 3EQLC 4RHRA 3J81c 3KJPA 5GQOA 1JCKB 1F9SA 4EQPA 1LTRD 4OGQC 1QOHA 1JJGA 5ISRA 2B29A 3PF4A 1VDZA 2RDHA 1MSGA 4HJ7A 1QZGA 1B2TA 1U4PA 4TSSA 1PH4A 2YTYA 2HQLA 1ZYRD 1SFOB 4JI8L 3K5LA 3EN2A 5IP9H 1HFNA 1SR3A 1CK1A 4A3IG 5IYBG 2LFNA 3BYTB 2JN4A 3DHQA 4JI5Q 2WB1E 2JA5H 2LY7A 4ILWA 1SROA 4NXMQ 1AN8A 3U4ZA 3I72A 2JA6B 1AZPA 2H5XA 3A55A 4Y7NB 3RZOH 3MC0B 4C1NK 1LTTD 2NZHA 2CQOA 4DV7Q 3KLSX 1O7LA 4UHVA 2AMCB 1WD0A 5M3FH 1ENCA 5IYBH 4DV2Q 4K5VA 1MD2D 2IPKD 4KHVA 5CYUA 1VQBA 4X62Q 4F87A 3C1EA 3IFTA 2WIIB 4N9TA 3KF6A 3TQYA 1PHJA 1SMYC 1B8AA 4KKSA 4BY1G 1LACA 1MKHA 5A2QL 5IGCA 4YCWA 3A74A 1JWSD 1YNJC 2PMZE 1XXGA 4B3TL 3PMFA 2JA8B 1YEZA 4XQJA 3BVMA 1UE5A 3CCMA 4R4OA 1E2VA 2Z1CA 2WKCA 4KY6A 1YBYA 2Z9HA 1ESRA 2XRSD 2ASBA 4P73A 3DXJC 4BY1H 2ZT9C 1T9HA 2IT1A 3MEFA 3CQZH 2UXDQ 3CW2C 4HN7A 2RA4A 3M3YB 1J6QA 3I4OA 2JE6I 2KQ3A 3DUZA 4M8AA 1ENFA 5C4XB 1JJ2A 1Z47A 2NBFA 2Z6KA 3HZXA 2N55A 1NBWA 3DLLA 1CUKA 2NZOA 4LF8Q 3Q6SA 2L9HA 3RR5A 4IO9A 3KJOA 3E9HA 1AE2A 5M9OA 3MXPA 1XMQQ 1GJXA 1Q3LA 1FGBD 1E3PA 2ZJPA 2F3VA 3GTOB 3SR1A 2CW0D 3J80c 3ICEA 2L0CA 1STYA 1TWHH 1ET9A 4CDCC 4RCOA 4L5QA 3BVGA 1BDOA 4P72A 2UXCL 1E22A 4CJ1B 2XIWA 4OIJA 4JI6L 1RCVD 2DJGC 2K05A 4MN3A 1KXLA 1FNVA 2F0TA 4P74A 2O5IC 1OXUA 1A2TA 1LV9A 4DR3L 1KRSA 1U4RA 1X3PA 3WOFA 4CDEC 1A8VA 2L12A 3SK5A 3GTPB 4BY7H 2R7ZG 1E1TA 4LUVA 1H95A 1XX8A 3S1QB 3KDFB 5GAHC 1PRTC 1KHIA 1WTQA 2A6ED 2B2WA 4KKTA 1IW7C 5CV4A 4L5TA 2E74C 2WP8J 4YIJA 3H09A 2EYLA 1DGSA 1NTGA 1D1IA 1SYDA 4FVMA 4QMGA 5D3DA 1A3TA 1JB3A 5G3LF 1HR0W 1JMCA 2R7ZH 2UXBL 3ERSX 2RQXA 1ILPA 2B3GA 4AQYL 1CKNA 1OXTA 2SEBD 4WJWA 2Y0SG 2VB3X 1UE1A 4JOIA 4QIWB 3CP0A 2E75C 2F0UA 1IHZA 3KF8B 4YHHL 4NXNQ 3OIPA 1PTOD 1KDBA 1M4VA 2Q2UA 1XWEA 3HOUH 5C3XA 3N6RA 4DFAA 3MXGA 1TVXA 5C4JB 1QZHA 3CHBD 1CKOA 1Q82C 2PW7A 2PZTA 1STEA 5IGBA 4ZUIA 5EBCA 2D9UA 1JQYD 1J5EL 2NVTH 1EY4A 1TXYA 3F2BA 1NR2A 1VQHA 1QE6A 5IGGA 2XVSA 5ELDA 4K6DA 1TWFH 3CC7A 1GUSA 3HKZB 1I4PA 1V1PB 1TWCB 4NMZA 3SVMA 1F9QA 2RHSB 4JI1Q 3G71A 3PO3B 3MTSA 4B3SQ 3BDOA 1JOKA 1R9TB 1X3EA 4KHZA 2IX0A 4OX9Q 3HOVG 3TRZA 1N33Q 3NPPA 1DCZA 3V96A 3M85A 4A3MB 1OO9B 1DYQA 1Y8PB 4EX5A 2R92B 1NNXA 1LM0A 5CORA 2HUGA 5JPNC 1N34Q 2C5CA 1H9MA 1PYWD 1STAA 1A2UA 3KBGA 4MTNA 4JI4L 2KCCA 3I70A 2CHBD 3BYYB 1E0BA 4LFBL 3HOVH 2WAQE 2VL6A 3BS1A 4C3HB 2ZTDA 1ICWA 2OCEA 1QNKA 3MXNA 2XNAC 1U0LA 1VQ5A 4L5SA 2R6GA 1MBYA 2MUYA 1SNMA 2AWOA 2OF1A 1B1ZA 2PW5A 2IHFA 1HNZQ 3H0GB 2TSSA 2L1BA 5FOBB 3TREA 5JEAG 4B9WA 1K8MA 4FF2A 1VQKA 1O7YA 1D6EC 1QVCA 2E8GA 4DA2A 1KNAA 1E1OA 3MXUA 4KY7A 2UUBL 5JJLA 4HIDA 1I50B 1MHWC 1TS4A 1GO3E 3R3OA 1SE8A 1EY7A 1K3RA 4IPHA 1K8GA 4LAAA 4R9WA 2EYMA 5JJZA 3GTJB 4CJ2C 4DAPA 1BF4A 1GUWA 4A3KG 3KUPA 3ONAB 4JI8Q 4DR5L 1QJOA 2L4NA 1XYIA 5LL6S 5DNFA 3FPPA 4C1NI 1IBKL 2MQHA 2JA9A 2KCTA 1L0YB 4A3CH 2NVYH 3RD4A 1VCIA 3D4WA 3I73A 4HAEA 4R4QA 2QKIC 1SFOH 3TS0A 2K5VA 4R4CA 1X3FA 5CBAE 3EFXD 1JORA 2ICEC 4N9PA 1CZWA 2PCFB 3MZ5A 4GOPB 1HA5A 1VQJA 4JI5L 1B50A 1RODA 3W1BA 1ML0D 1D8LA 1Q7YC 4NXML 1U4LA 2PI2A 1VF5C 2JA6H 4J15A 3KLSA 1Q12A 2NVQH 4Y7NH 4RGMA 3TS2A 1H9RA 1SNDA 2IW3A 3HOZG 1DONA 4ZCKA 4TRDA 1WOCA 1FNWA 2FFKB 2JA8G 1YITA 3PIPA 2I46A 4DV2L 3PIOA 4LNQA 1L1OB 4B3TQ 2Z4IA 4DV0L 2L15A 3NBHB 3TP6A 3GQBA 2WV6D 1DZ1A 2QGQA 1VQLA 3CPFA 3Q23A 1TS3A 3W1GA 3EROA 2Z6BA 1FYCA 4JI7L 3NUCA 5TSSA 5C4XG 4AYBE 5KNBA 2VS1A 4S3SA 2F0VA 3M4OB 1YNXA 2Z4HA 2B2WC 4CBVA 1KDAA 1SYGA 4KHPL 2LXJA 1XPRA 3RMHA 1PTOF 3M3YH 1EWCA 3CCUA 3NHHA 1S3OA 3S1NB 2PPBC 3STBD 5C4XH 2K4KA 2X6GA 1SRUA 1EL0A 3J7YW 1WVLA 5C3EB 1KRTA 4HIOA 3PUZA 4DR4Q 4A3EB 1X6OA 1RJTA 3W3AA 3FMCA 1VQCA 3S17B 1H9SA 3E0EA 1AH9A 1XMQL 1PH8A 2HIVA 3GTOH 5ELNA 3JC66 3T13A 2MPMA 1B9NA 5L37A 2EYPA 2I0QA 1HHVA 1N36L 2B2YC 2JSOA 2MGSA 4QB4A 4DV6L 2DY7A 1J9OA 1KNEA 1STHA 4HR7B 4DR3Q 1X55A 4LFAL 3H3VH 1IYVA 4GLXA 3RN5A
chains in the Genus database with same CATH topology
1PH9A 3AEVA 4OONA 3CCVA 4OWWB 4DR7Q 2C35B 4DUYL 3J81c 3KJPA 1ASZA 5GQOA 2A1AA 3PO2H 1Y1WH 4WJ4A 5IY0A 1VQAA 3RN2A 3KOJA 4LF4L 2WFWA 1Y1VG 4X66Q 2CWPA 4GOPC 1HNXQ 1VQIA 2B29A 1JB7A 1VQFA 2Z0SA 1PA6A 1WJJA 3GTPH 2CCZA 3PF4A 4JYAL 1KC8C 1WCMH 3J7ZC 4GNXB 1XNQL 1VQDA 4HJ7A 1QZGA 5FLXc 4LUZA 2B63H 1SLJA 3S1QH 2WAQG 1PH4A 1VQ7A 2UXBQ 2YTYA 2ZTCA 2HQLA 3AQQA 3G48A 4A3KH 1YJWA 1EWIA 3RNUA 4JI8L 4DV3L 4EQ5A 1IBLQ 3EN2A 3FHWA 3HOWG 5IP9H 3CPWA 4AQYQ 2BH2A 1SR3A 1L0WA 1U5KA 4A3IG 1UE7A 1FGUA 4DR2L 1GM5A 1Y1VH 5IYBG 1FVIA 2LSSA 4YCVA 5IP7G 1VQ8A 1L1OC 1YIJA 2D0OA 4JI5Q 2WB1E 2JA5H 5M5WH 4YWLA 2A8VA 1M90C 4A3FG 1SROA 4NXMQ 3HOUG 3OTOQ 3J81j 4DUZL 3U4ZA 4JV5L 2R7FA 3ULLA 3UE1A 1VQ9A 3L7ZC 2UU9Q 1JJGA 3GTQH 2H5XA 3HOWH 3RZOH 2NZHA 2CQOA 3J80i 4DV7Q 4HIKA 5BR8Q 2AMCB 3F1ZA 2QEXA 1M1KC 4NXNL 3BZCA 5IYBH 2KBNA 5M3FH 4DV2Q 4OO1G 4GNXA 4DR6L 5IP7H 4A75A 3PGZA 4IJLA 4JBJA 1VQBA 5IWAL 4X62Q 4A76A 1PH5A 3I56A 3KF6A 3TQYA 4LW1A 5C4JH 1PHJA 3SGIA 3G6EA 1B8AA 4BY1G 2VQFQ 3CMEA 3PO3G 4A3DG 1MKHA 4BXXG 3HOZH 4ME3A 2K5NA 3STBC 4RG1A 1MJEA 4B3ML 4YCWA 3UDFA 4LF6L 3A74A 4QGUA 1LTLA 2JA8H 4A3JH 1S40A 3BU2A 4DK3C 2PMZE 4B3TL 4QJFA 2R92G 1YEZA 1HZ9A 4IPCA 1UE5A 3K8AA 5LMNL 4P71A 3CCMA 4R4OA 1Q81C 1IYJB 1Q8KA 1EUJA 3PUVA 5C44G 1EOVA 1EIFA 2N8NA 1TWCH 1YBYA 2OQ0A 3PUXA 4X65Q 2ASBA 4P73A 4IOCA 5H1SE 4BY1H 3PO3H 1T9HA 4A3DH 2IT1A 4BXXH 3MEFA 3T1HL 1R9TH 3CQZH 2UXDQ 3CW2C 4LF7L 1BVSA 4X64Q 1W2BA 4B3SL 1FJGL 4A4IA 4JI4Q 2WB1G 2Q2TA 4LF5Q 3VDYA 1HJPA 1J6QA 3I4OA 1XPOA 1VS0A 2JE6I 4A3GG 4A3MH 4K0KL 1C7YA 4OXPA 2R92H 4H02A 1IL2A 1JJ2A 3I7FA 5C44H 1RIPA 2VZAA 3CCRA 3OW2A 1Z47A 1MJCA 1S72A 1N34L 2UUAQ 1N32Q 2Z6KA 4LFCL 3DLLA 1NBWA 1CUKA 3F2CA 3S14H 2NZOA 4LF8Q 4TVAB 3RR5A 4IO9A 3KJOA 3E9HA 1HNWQ 1AE2A 2E5LQ 4A3GH 3A0JA 1XMQQ 3S24A 3UDXA 4C3HH 1BKBA 1E3PA 2ZJPA 2FXQA 5IE8A 1AE3A 1V9PA 3E9IA 2K5HA 3GTLH 4UP8A 3J80c 3ICEA 3CAMA 1YVCA 4AIMA 2KHJA 1O7IA 3F8TA 1QUQB 1JE5A 1TWHH 5IT9c 4HJ9A 3H0GH 3JAMi 2Y0SE 1BBUA 4DV1Q 4L5QA 2EIFA 2QA4A 2UUCQ 4OWTB 1G51A 1PYSB 4JI0Q 1YZ6A 4P72A 4GKJQ 2UXCL 3I4NG 1VQGA 1E22A 3ULPA 4GNXC 2K75A 4DR1L 2F4VL 4POFA 1PH1A 4JI6L 2ZTEA 1K9MC 1HR0Q 1HZBA 1KXLA 4DV4Q 1LUZA 3UDGA 4DR5Q 1XMOQ 3U4VA 1PV4A 1I50H 3A5ZB 4GLVB 4P74A 4XIGS 1OXUA 3PF5A 1CKNB 3TEHB 2NN6I 3ULJA 1WFQA 4O0AA 4DR3L 1VQPA 1KRSA 1IBKQ 3I55A 4GN5A 4A3CG 1A8VA 2K14A 3ZJYC 3GTJH 2EXDA 2VUMH 5FJ8G 3I4NH 5AJ3Q 2XTIA 4BBRG 1XNQQ 4BY7H 1X65A 2CFMA 4YY3L 2R7ZG 1E1TA 4LF9Q 4LUVA 5HY6A 2R93H 1H95A 4DR7L 4MZ9A 3EIVA 1HH2P 3KF6B 5GAGC 3KDFB 5GAHC 1UWVA 1KHIA 3W5OA 1CSQA 4OWXB 4DAMA 1XNRQ 1QUQA 3H15A 1X3GA 4TQUS 4L5TA 2WP8J 1VQ6A 1K83H 4R4IA 3KYHC 4X66L 1HNXL 4BA2I 1DGSA 5M5YH 3S2DH 1NTGA 1JT8A 2EQSA 2RHQB 3KLWA 1KAWA 4PMWA 2K50A 5FJ8H 4UY8C 1V1QA 2Q2HA 1HR0W 3EBEA 1JMCA 4BBRH 2JA6G 2R7ZH 3L2PA 2UXBL 3ERSX 4A3BG 4DV5Q 2B3GA 1VQ4A 1MIUA 4IOAA 4JV5Q 1IBLL 2Z6KC 1GD7A 4AQYL 1CKNA 1E24A 1OXTA 2Y0SG 4L5RC 1PYBA 3RLOA 1UE1A 4GLAC 4JOIA 3ER0A 3CP0A 4PZ6A 4A3IH 4JI3L 3K0XA 3HOYG 4BBSH 3KF8B 1K0RA 4IFDJ 3LGJA 4YHHL 2N49A 4NXNQ 2BA1A 2ZJRA 4DR6Q 5C0XJ 1E7ZA 4DV0Q 1OXSC 2ATWA 4A3FH 5JJKA 2Q2UA 1G291 3HOUH 3K80C 4B3RL 2LXKA 3JAMc 3KDFA 3GO5A 3GD7A 3AYHB 1QVGA 3M9BA 3IRBA 4OO1I 4GN4B 1QZHA 3PUWA 4JC0A 1CKOA 1Q82C 1A63A 2DUDA 4DV7L 5M5XH 4LF6Q 3HOYH 4LUOA 1P8LA 1Y14B 2I5MX 3K81C 5J3BA 4C2MH 5LMUL 4JI7Q 4QY7A 3I2ZA 1X9NA 4GKKQ 4IFDG 3CD6A 1J5EL 2NVTH 4R4TA 4DPGA 4GS3A 4X62L 3M4PA 5C0XG 3F2BA 1TXYA 2YTXA 3NEMA 3T1YL 1VQHA 1IBMQ 3FKIG 4HIMA 3CC7A 1HZAA 1TWFH 3MXNB 2ZM6Q 2DGYA 1G6PA 2ZJQA 4KHPQ 1YHQA 1N8RC 2RHSB 4MNOA 2GVBA 4JI1Q 4JBMA 3G71A 4GOPA 4B3SQ 1WI5A 1FJGQ 1X3EA 1KIXA 2MO0A 4KHZA 5IYDG 2IX0A 1L2FA 4OX9Q 3HOVG 1N33Q 3TRZA 4POGA 3M4OH 2JEAI 3U50C 5C3EG 3M85A 1SN8A 3OYYA 5IYCG 4EX5A 4A3EG 3L0OA 3FKIH 4X65L 1LM0A 3UE0A 3CCQA 4HJAA 1N34Q 5GAEC 4Y52H 2MO1A 1SMXA 4IPGA 4LFCQ 1I5FA 2UXDL 3S1NH 4MTNA 4X64L 4JBKA 2RF4A 4JI4L 4LF5L 2Q2IA 3CC4A 2VQEL 3CC2A 3A5UA 4LFBL 3HOVH 4JI2Q 1P16A 2WAQE 4GN3B 2ID0A 5GADC 5C3EH 2VL6A 2HT1A 4A3EH 1YJ9A 2ZTDA 2OCEA 1IXRA 2UUAL 5K36G 1D7QA 3CMAA 4DR4L 2IHEA 1VQ5A 1U0LA 4L5SA 1ASYA 2R6GA 3PUYA 1N36Q 1I94Q 4XTCS 1GKHA 2AWOA 4JOIC 4DV6Q 2HHHQ 3S17H 2IHFA 1KD1C 1HNZQ 4X6AH 4LF8L 4LFAQ 2OWOA 2UXCQ 3TREA 5JEAG 2I5LX 2F52A 1HNWL 4A93G 5M3MG 1VQKA 3AFPA 4JI6Q 4QL5A 2RCNA 4QQBX 1QVCA 2E8GA 3CCSA 3GTMH 2K52A 4FDBA 4YWMA 3HOXG 1E1OA 1Q1EA 2UUBL 5JJLA 4DUYQ 4DAYB 4KI0A 4LWCA 3GDEA 4HIDA 2YYZA 1YHAA 1Y1WG 3PO2G 1VQEA 3J7A5 3U58A 2IY5B 2I5HA 1B70B 3PV0A 2MFIA 1XJVA 1WYDA 2VW9A 4LF4Q 1GO3E 3PSIA 1SE8A 2UUCL 4JI0L 1K3RA 1W3SA 4JYAQ 2OQKA 4IPHA 1EFWA 1K8GA 4UPAA 4WJ3M 2KENA 5EAYA 4A93H 2BH8A 3BJUA 5M3MH 1HR0L 1KL9A 3HKSA 1PH7A 4A3KG 4DV4L 1NMGA 2PQAA 3RLFA 2MNAA 4JI8Q 3HOXH 4DR5L 4DV3Q 1XMOL 1K8AC 4JBWA 2JA7G 5IP9G 3HKZE 2JK8A 2HIXA 3S15H 1B7YB 2E2HH 1IBKL 4DR2Q 2MQHA 2GN5A 2JA9A 2KCTA 4A3CH 2NVYH 2AHOB 1VCIA 4UP9A 5FLMG 5JJIA 4R4QA 1YJNA 1PH2A 2JA5G 5AJ3L 3S1RH 1SFOH 1CKMA 4JCVE 3TS0A 4LF9L 2K5VA 1A62A 4DUZQ 4R4CA 1X3FA 3WWVA 4DNIA 2A19A 3F2DA 3NENA 4KLKA 2JA7H 1XNRL 4O2DA 2ES2A 1RL2A 3CF5A 4GOPB 2JJQA 2E2IH 4RMFA 5M3FG 1CSPA 1FL0A 2E2JH 4JI3Q 1VQJA 4YHHQ 4JI5L 4R1JA 1UEBA 5FLMH 3W1BA 2VY3A 3K7UC 5IWAQ 3NELA 1D8LA 1Q7YC 3FP9A 1PH6A 3OTOL 2PI2A 4NXML 2JA6H 4J15A 3GTGH 3I4MG 1Q12A 2NVQH 4B3RQ 4DV5L 4YWKA 4A3BH 1Q46A 4Y7NH 3TS2A 3PCOB 2UU9L 4ALPA 3Q8DA 3HOZG 2R7DA 2OTLA 4B3MQ 1PVOA 1WOCA 5BR8L 4C3JH 2JA8G 1LYLA 4A3JG 3PIPA 1YITA 4DV2L 3PIOA 5LMUQ 2KCMA 4LNQA 2N78A 1EYGA 1L1OB 3K7AH 4B3TQ 2CKZB 1I3QH 3CCJA 1XTDA 4DV0L 1J5EQ 2L15A 4C3IH 3S1MH 5LMNQ 4APVA 2AWNA 1VQOA 3I4MH 3NBHB 4IPDA 3T1YQ 3HKZG 1VQMA 1GVPA 4DKAC 2QGQA 2VQFL 1NE3A 1VQLA 1UE6A 3M7NA 3CPFA 3CCEA 3RLNA 3W1GA 2JQOA 3J81i 4IFDI 3T1HQ 3G4SA 1XPUA 3BZKA 1PFSA 3UDIA 4LF7Q 4JI7L 2D0PA 5C0XI 4IJHA 1YI2A 5C4XG 4GKKL 3S16H 4AYBE 4A3MG 2PI2E 4K0KQ 1JJCB 1HZCA 3B6YA 4YCUA 3D31A 2VS1A 4GLXA 2JEBI 1IBML 3GTKH 1NMFA 2OTJA 1YNXA 1TWGH 3AFQA 2ZM6L 1C9OA 3S2HH 5HGQA 2AKWB 2BA0A 2LXJA 1EQQA 4PZ8A 1XPRA 4KHPL 2ALYB 4AH6A 1A0IA 3M3YH 2V1CC 4JI1L 5JEAJ 1X54A 2PNHA 3CCUA 4BBSG 3KFUA 4UP7A 1PH3A 2NVXH 1L1OA 1S3OA 4PG3A 3STBD 5C4XH 2K4KA 4OX9L 5IYDH 2XGTA 2VQEQ 1N33L 1Z9FA 1SRUA 5LMNW 4A3LG 4LFBQ 1OXXK 2PQAB 3D0FA 4DK6C 1Q86C 3M4QA 5IYCH 4PZ7A 3HFZB 2CWAA 1K73C 1IZ6A 1N32L 1KRTA 4QIWE 4HIOA 3PUZA 5E7NA 1OTCA 1YHBA 4DR4Q 1X6OA 3DM3A 3H0GG 3CXCA 5DLQE 1VQNA 1TWAH 1QVFA 4HJ5A 1X56A 2GVAA 1VQCA 4HJ8A 4NB3A 3E0EA 4DR1Q 1NY4A 2E5LL 3CCLA 4P75A 2F4VQ 4BA1I 1XMQL 1EIYB 1PH8A 1AH9A 2F3IA 2HIVA 3GTOH 4JI2L 1EQRA 5ELNA 1OXVA 4A3LH 2IX1A 3JC66 1BBWA 2UUBQ 2YV5A 1V43A 2I0QA 1I6HH 1NJIC 4JG2A 3RZDH 1N36L 1I94L 4DV1L 4DR3Q 5ELOA 4DV6L 2HHHL 3H3VI 2YU9H 2N3SA 1X55A 1N9WA 1HNZL 4GKJL 1WCMG 4LFAL 2NN6G 2VNUD 2VUMG 4AYBG 2YTVA 1Q1BA 4BY7G 2D62A 1KQSA 5GROA 2B63G 3H3VH 1C0AA 4YY3Q 2KHIA 2R93G 4NPSA 3RN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH9 A;  3AEV A;  4OON A;  3CCV A;  4OWW B;  4DR7 Q;  2C35 B;  4DUY L;  3J81 c;  3KJP A;  1ASZ A;  5GQO A;  2A1A A;  3PO2 H;  1Y1W H;  4WJ4 A;  5IY0 A;  1VQA A;  3RN2 A;  3KOJ A;  4LF4 L;  2WFW A;  1Y1V G;  4X66 Q;  2CWP A;  4GOP C;  1HNX Q;  1VQI A;  2B29 A;  1JB7 A;  1VQF A;  2Z0S A;  1PA6 A;  1WJJ A;  3GTP H;  2CCZ A;  3PF4 A;  4JYA L;  1KC8 C;  1WCM H;  3J7Z C;  4GNX B;  1XNQ L;  1VQD A;  4HJ7 A;  1QZG A;  5FLX c;  4LUZ A;  2B63 H;  1SLJ A;  3S1Q H;  2WAQ G;  1PH4 A;  1VQ7 A;  2UXB Q;  2YTY A;  2ZTC A;  2HQL A;  3AQQ A;  3G48 A;  4A3K H;  1YJW A;  1EWI A;  3RNU A;  4JI8 L;  4DV3 L;  4EQ5 A;  1IBL Q;  3EN2 A;  3FHW A;  3HOW G;  5IP9 H;  3CPW A;  4AQY Q;  2BH2 A;  1SR3 A;  1L0W A;  1U5K A;  4A3I G;  1UE7 A;  1FGU A;  4DR2 L;  1GM5 A;  1Y1V H;  5IYB G;  1FVI A;  2LSS A;  4YCV A;  5IP7 G;  1VQ8 A;  1L1O C;  1YIJ A;  2D0O A;  4JI5 Q;  2WB1 E;  2JA5 H;  5M5W H;  4YWL A;  2A8V A;  1M90 C;  4A3F G;  1SRO A;  4NXM Q;  3HOU G;  3OTO Q;  3J81 j;  4DUZ L;  3U4Z A;  4JV5 L;  2R7F A;  3ULL A;  3UE1 A;  1VQ9 A;  3L7Z C;  2UU9 Q;  1JJG A;  3GTQ H;  2H5X A;  3HOW H;  3RZO H;  2NZH A;  2CQO A;  3J80 i;  4DV7 Q;  4HIK A;  5BR8 Q;  2AMC B;  3F1Z A;  2QEX A;  1M1K C;  4NXN L;  3BZC A;  5IYB H;  2KBN A;  5M3F H;  4DV2 Q;  4OO1 G;  4GNX A;  4DR6 L;  5IP7 H;  4A75 A;  3PGZ A;  4IJL A;  4JBJ A;  1VQB A;  5IWA L;  4X62 Q;  4A76 A;  1PH5 A;  3I56 A;  3KF6 A;  3TQY A;  4LW1 A;  5C4J H;  1PHJ A;  3SGI A;  3G6E A;  1B8A A;  4BY1 G;  2VQF Q;  3CME A;  3PO3 G;  4A3D G;  1MKH A;  4BXX G;  3HOZ H;  4ME3 A;  2K5N A;  3STB C;  4RG1 A;  1MJE A;  4B3M L;  4YCW A;  3UDF A;  4LF6 L;  3A74 A;  4QGU A;  1LTL A;  2JA8 H;  4A3J H;  1S40 A;  3BU2 A;  4DK3 C;  2PMZ E;  4B3T L;  4QJF A;  2R92 G;  1YEZ A;  1HZ9 A;  4IPC A;  1UE5 A;  3K8A A;  5LMN L;  4P71 A;  3CCM A;  4R4O A;  1Q81 C;  1IYJ B;  1Q8K A;  1EUJ A;  3PUV A;  5C44 G;  1EOV A;  1EIF A;  2N8N A;  1TWC H;  1YBY A;  2OQ0 A;  3PUX A;  4X65 Q;  2ASB A;  4P73 A;  4IOC A;  5H1S E;  4BY1 H;  3PO3 H;  1T9H A;  4A3D H;  2IT1 A;  4BXX H;  3MEF A;  3T1H L;  1R9T H;  3CQZ H;  2UXD Q;  3CW2 C;  4LF7 L;  1BVS A;  4X64 Q;  1W2B A;  4B3S L;  1FJG L;  4A4I A;  4JI4 Q;  2WB1 G;  2Q2T A;  4LF5 Q;  3VDY A;  1HJP A;  1J6Q A;  3I4O A;  1XPO A;  1VS0 A;  2JE6 I;  4A3G G;  4A3M H;  4K0K L;  1C7Y A;  4OXP A;  2R92 H;  4H02 A;  1IL2 A;  1JJ2 A;  3I7F A;  5C44 H;  1RIP A;  2VZA A;  3CCR A;  3OW2 A;  1Z47 A;  1MJC A;  1S72 A;  1N34 L;  2UUA Q;  1N32 Q;  2Z6K A;  4LFC L;  3DLL A;  1NBW A;  1CUK A;  3F2C A;  3S14 H;  2NZO A;  4LF8 Q;  4TVA B;  3RR5 A;  4IO9 A;  3KJO A;  3E9H A;  1HNW Q;  1AE2 A;  2E5L Q;  4A3G H;  3A0J A;  1XMQ Q;  3S24 A;  3UDX A;  4C3H H;  1BKB A;  1E3P A;  2ZJP A;  2FXQ A;  5IE8 A;  1AE3 A;  1V9P A;  3E9I A;  2K5H A;  3GTL H;  4UP8 A;  3J80 c;  3ICE A;  3CAM A;  1YVC A;  4AIM A;  2KHJ A;  1O7I A;  3F8T A;  1QUQ B;  1JE5 A;  1TWH H;  5IT9 c;  4HJ9 A;  3H0G H;  3JAM i;  2Y0S E;  1BBU A;  4DV1 Q;  4L5Q A;  2EIF A;  2QA4 A;  2UUC Q;  4OWT B;  1G51 A;  1PYS B;  4JI0 Q;  1YZ6 A;  4P72 A;  4GKJ Q;  2UXC L;  3I4N G;  1VQG A;  1E22 A;  3ULP A;  4GNX C;  2K75 A;  4DR1 L;  2F4V L;  4POF A;  1PH1 A;  4JI6 L;  2ZTE A;  1K9M C;  1HR0 Q;  1HZB A;  1KXL A;  4DV4 Q;  1LUZ A;  3UDG A;  4DR5 Q;  1XMO Q;  3U4V A;  1PV4 A;  1I50 H;  3A5Z B;  4GLV B;  4P74 A;  4XIG S;  1OXU A;  3PF5 A;  1CKN B;  3TEH B;  2NN6 I;  3ULJ A;  1WFQ A;  4O0A A;  4DR3 L;  1VQP A;  1KRS A;  1IBK Q;  3I55 A;  4GN5 A;  4A3C G;  1A8V A;  2K14 A;  3ZJY C;  3GTJ H;  2EXD A;  2VUM H;  5FJ8 G;  3I4N H;  5AJ3 Q;  2XTI A;  4BBR G;  1XNQ Q;  4BY7 H;  1X65 A;  2CFM A;  4YY3 L;  2R7Z G;  1E1T A;  4LF9 Q;  4LUV A;  5HY6 A;  2R93 H;  1H95 A;  4DR7 L;  4MZ9 A;  3EIV A;  1HH2 P;  3KF6 B;  5GAG C;  3KDF B;  5GAH C;  1UWV A;  1KHI A;  3W5O A;  1CSQ A;  4OWX B;  4DAM A;  1XNR Q;  1QUQ A;  3H15 A;  1X3G A;  4TQU S;  4L5T A;  2WP8 J;  1VQ6 A;  1K83 H;  4R4I A;  3KYH C;  4X66 L;  1HNX L;  4BA2 I;  1DGS A;  5M5Y H;  3S2D H;  1NTG A;  1JT8 A;  2EQS A;  2RHQ B;  3KLW A;  1KAW A;  4PMW A;  2K50 A;  5FJ8 H;  4UY8 C;  1V1Q A;  2Q2H A;  1HR0 W;  3EBE A;  1JMC A;  4BBR H;  2JA6 G;  2R7Z H;  3L2P A;  2UXB L;  3ERS X;  4A3B G;  4DV5 Q;  2B3G A;  1VQ4 A;  1MIU A;  4IOA A;  4JV5 Q;  1IBL L;  2Z6K C;  1GD7 A;  4AQY L;  1CKN A;  1E24 A;  1OXT A;  2Y0S G;  4L5R C;  1PYB A;  3RLO A;  1UE1 A;  4GLA C;  4JOI A;  3ER0 A;  3CP0 A;  4PZ6 A;  4A3I H;  4JI3 L;  3K0X A;  3HOY G;  4BBS H;  3KF8 B;  1K0R A;  4IFD J;  3LGJ A;  4YHH L;  2N49 A;  4NXN Q;  2BA1 A;  2ZJR A;  4DR6 Q;  5C0X J;  1E7Z A;  4DV0 Q;  1OXS C;  2ATW A;  4A3F H;  5JJK A;  2Q2U A;  1G29 1;  3HOU H;  3K80 C;  4B3R L;  2LXK A;  3JAM c;  3KDF A;  3GO5 A;  3GD7 A;  3AYH B;  1QVG A;  3M9B A;  3IRB A;  4OO1 I;  4GN4 B;  1QZH A;  3PUW A;  4JC0 A;  1CKO A;  1Q82 C;  1A63 A;  2DUD A;  4DV7 L;  5M5X H;  4LF6 Q;  3HOY H;  4LUO A;  1P8L A;  1Y14 B;  2I5M X;  3K81 C;  5J3B A;  4C2M H;  5LMU L;  4JI7 Q;  4QY7 A;  3I2Z A;  1X9N A;  4GKK Q;  4IFD G;  3CD6 A;  1J5E L;  2NVT H;  4R4T A;  4DPG A;  4GS3 A;  4X62 L;  3M4P A;  5C0X G;  3F2B A;  1TXY A;  2YTX A;  3NEM A;  3T1Y L;  1VQH A;  1IBM Q;  3FKI G;  4HIM A;  3CC7 A;  1HZA A;  1TWF H;  3MXN B;  2ZM6 Q;  2DGY A;  1G6P A;  2ZJQ A;  4KHP Q;  1YHQ A;  1N8R C;  2RHS B;  4MNO A;  2GVB A;  4JI1 Q;  4JBM A;  3G71 A;  4GOP A;  4B3S Q;  1WI5 A;  1FJG Q;  1X3E A;  1KIX A;  2MO0 A;  4KHZ A;  5IYD G;  2IX0 A;  1L2F A;  4OX9 Q;  3HOV G;  1N33 Q;  3TRZ A;  4POG A;  3M4O H;  2JEA I;  3U50 C;  5C3E G;  3M85 A;  1SN8 A;  3OYY A;  5IYC G;  4EX5 A;  4A3E G;  3L0O A;  3FKI H;  4X65 L;  1LM0 A;  3UE0 A;  3CCQ A;  4HJA A;  1N34 Q;  5GAE C;  4Y52 H;  2MO1 A;  1SMX A;  4IPG A;  4LFC Q;  1I5F A;  2UXD L;  3S1N H;  4MTN A;  4X64 L;  4JBK A;  2RF4 A;  4JI4 L;  4LF5 L;  2Q2I A;  3CC4 A;  2VQE L;  3CC2 A;  3A5U A;  4LFB L;  3HOV H;  4JI2 Q;  1P16 A;  2WAQ E;  4GN3 B;  2ID0 A;  5GAD C;  5C3E H;  2VL6 A;  2HT1 A;  4A3E H;  1YJ9 A;  2ZTD A;  2OCE A;  1IXR A;  2UUA L;  5K36 G;  1D7Q A;  3CMA A;  4DR4 L;  2IHE A;  1VQ5 A;  1U0L A;  4L5S A;  1ASY A;  2R6G A;  3PUY A;  1N36 Q;  1I94 Q;  4XTC S;  1GKH A;  2AWO A;  4JOI C;  4DV6 Q;  2HHH Q;  3S17 H;  2IHF A;  1KD1 C;  1HNZ Q;  4X6A H;  4LF8 L;  4LFA Q;  2OWO A;  2UXC Q;  3TRE A;  5JEA G;  2I5L X;  2F52 A;  1HNW L;  4A93 G;  5M3M G;  1VQK A;  3AFP A;  4JI6 Q;  4QL5 A;  2RCN A;  4QQB X;  1QVC A;  2E8G A;  3CCS A;  3GTM H;  2K52 A;  4FDB A;  4YWM A;  3HOX G;  1E1O A;  1Q1E A;  2UUB L;  5JJL A;  4DUY Q;  4DAY B;  4KI0 A;  4LWC A;  3GDE A;  4HID A;  2YYZ A;  1YHA A;  1Y1W G;  3PO2 G;  1VQE A;  3J7A 5;  3U58 A;  2IY5 B;  2I5H A;  1B70 B;  3PV0 A;  2MFI A;  1XJV A;  1WYD A;  2VW9 A;  4LF4 Q;  1GO3 E;  3PSI A;  1SE8 A;  2UUC L;  4JI0 L;  1K3R A;  1W3S A;  4JYA Q;  2OQK A;  4IPH A;  1EFW A;  1K8G A;  4UPA A;  4WJ3 M;  2KEN A;  5EAY A;  4A93 H;  2BH8 A;  3BJU A;  5M3M H;  1HR0 L;  1KL9 A;  3HKS A;  1PH7 A;  4A3K G;  4DV4 L;  1NMG A;  2PQA A;  3RLF A;  2MNA A;  4JI8 Q;  3HOX H;  4DR5 L;  4DV3 Q;  1XMO L;  1K8A C;  4JBW A;  2JA7 G;  5IP9 G;  3HKZ E;  2JK8 A;  2HIX A;  3S15 H;  1B7Y B;  2E2H H;  1IBK L;  4DR2 Q;  2MQH A;  2GN5 A;  2JA9 A;  2KCT A;  4A3C H;  2NVY H;  2AHO B;  1VCI A;  4UP9 A;  5FLM G;  5JJI A;  4R4Q A;  1YJN A;  1PH2 A;  2JA5 G;  5AJ3 L;  3S1R H;  1SFO H;  1CKM A;  4JCV E;  3TS0 A;  4LF9 L;  2K5V A;  1A62 A;  4DUZ Q;  4R4C A;  1X3F A;  3WWV A;  4DNI A;  2A19 A;  3F2D A;  3NEN A;  4KLK A;  2JA7 H;  1XNR L;  4O2D A;  2ES2 A;  1RL2 A;  3CF5 A;  4GOP B;  2JJQ A;  2E2I H;  4RMF A;  5M3F G;  1CSP A;  1FL0 A;  2E2J H;  4JI3 Q;  1VQJ A;  4YHH Q;  4JI5 L;  4R1J A;  1UEB A;  5FLM H;  3W1B A;  2VY3 A;  3K7U C;  5IWA Q;  3NEL A;  1D8L A;  1Q7Y C;  3FP9 A;  1PH6 A;  3OTO L;  2PI2 A;  4NXM L;  2JA6 H;  4J15 A;  3GTG H;  3I4M G;  1Q12 A;  2NVQ H;  4B3R Q;  4DV5 L;  4YWK A;  4A3B H;  1Q46 A;  4Y7N H;  3TS2 A;  3PCO B;  2UU9 L;  4ALP A;  3Q8D A;  3HOZ G;  2R7D A;  2OTL A;  4B3M Q;  1PVO A;  1WOC A;  5BR8 L;  4C3J H;  2JA8 G;  1LYL A;  4A3J G;  3PIP A;  1YIT A;  4DV2 L;  3PIO A;  5LMU Q;  2KCM A;  4LNQ A;  2N78 A;  1EYG A;  1L1O B;  3K7A H;  4B3T Q;  2CKZ B;  1I3Q H;  3CCJ A;  1XTD A;  4DV0 L;  1J5E Q;  2L15 A;  4C3I H;  3S1M H;  5LMN Q;  4APV A;  2AWN A;  1VQO A;  3I4M H;  3NBH B;  4IPD A;  3T1Y Q;  3HKZ G;  1VQM A;  1GVP A;  4DKA C;  2QGQ A;  2VQF L;  1NE3 A;  1VQL A;  1UE6 A;  3M7N A;  3CPF A;  3CCE A;  3RLN A;  3W1G A;  2JQO A;  3J81 i;  4IFD I;  3T1H Q;  3G4S A;  1XPU A;  3BZK A;  1PFS A;  3UDI A;  4LF7 Q;  4JI7 L;  2D0P A;  5C0X I;  4IJH A;  1YI2 A;  5C4X G;  4GKK L;  3S16 H;  4AYB E;  4A3M G;  2PI2 E;  4K0K Q;  1JJC B;  1HZC A;  3B6Y A;  4YCU A;  3D31 A;  2VS1 A;  4GLX A;  2JEB I;  1IBM L;  3GTK H;  1NMF A;  2OTJ A;  1YNX A;  1TWG H;  3AFQ A;  2ZM6 L;  1C9O A;  3S2H H;  5HGQ A;  2AKW B;  2BA0 A;  2LXJ A;  1EQQ A;  4PZ8 A;  1XPR A;  4KHP L;  2ALY B;  4AH6 A;  1A0I A;  3M3Y H;  2V1C C;  4JI1 L;  5JEA J;  1X54 A;  2PNH A;  3CCU A;  4BBS G;  3KFU A;  4UP7 A;  1PH3 A;  2NVX H;  1L1O A;  1S3O A;  4PG3 A;  3STB D;  5C4X H;  2K4K A;  4OX9 L;  5IYD H;  2XGT A;  2VQE Q;  1N33 L;  1Z9F A;  1SRU A;  5LMN W;  4A3L G;  4LFB Q;  1OXX K;  2PQA B;  3D0F A;  4DK6 C;  1Q86 C;  3M4Q A;  5IYC H;  4PZ7 A;  3HFZ B;  2CWA A;  1K73 C;  1IZ6 A;  1N32 L;  1KRT A;  4QIW E;  4HIO A;  3PUZ A;  5E7N A;  1OTC A;  1YHB A;  4DR4 Q;  1X6O A;  3DM3 A;  3H0G G;  3CXC A;  5DLQ E;  1VQN A;  1TWA H;  1QVF A;  4HJ5 A;  1X56 A;  2GVA A;  1VQC A;  4HJ8 A;  4NB3 A;  3E0E A;  4DR1 Q;  1NY4 A;  2E5L L;  3CCL A;  4P75 A;  2F4V Q;  4BA1 I;  1XMQ L;  1EIY B;  1PH8 A;  1AH9 A;  2F3I A;  2HIV A;  3GTO H;  4JI2 L;  1EQR A;  5ELN A;  1OXV A;  4A3L H;  2IX1 A;  3JC6 6;  1BBW A;  2UUB Q;  2YV5 A;  1V43 A;  2I0Q A;  1I6H H;  1NJI C;  4JG2 A;  3RZD H;  1N36 L;  1I94 L;  4DV1 L;  4DR3 Q;  5ELO A;  4DV6 L;  2HHH L;  3H3V I;  2YU9 H;  2N3S A;  1X55 A;  1N9W A;  1HNZ L;  4GKJ L;  1WCM G;  4LFA L;  2NN6 G;  2VNU D;  2VUM G;  4AYB G;  2YTV A;  1Q1B A;  4BY7 G;  2D62 A;  1KQS A;  5GRO A;  2B63 G;  3H3V H;  1C0A A;  4YY3 Q;  2KHI A;  2R93 G;  4NPS A;  3RN5 A; 
#chains in the Genus database with same CATH topology
 4A93 B;  5M3M B;  1ASZ A;  1CQF A;  4KJN A;  1YNN D;  2F3W A;  3P7J A;  1S5B D;  1SJH D;  4J8Q A;  3VYR A;  3KOJ A;  4LF4 L;  3NTI A;  2WFW A;  3PO2 B;  3GTP H;  3S15 B;  1VQI A;  4JYA L;  2Z0S A;  3TZU A;  5A35 A;  2FIN B;  4EVO A;  2EOT A;  2K03 A;  4LUZ A;  3CRK C;  3S1Q H;  2UXB Q;  3AQQ A;  3G48 A;  3RNU A;  4NW2 A;  1STN A;  4XYO A;  4AQY Q;  2QIL A;  2A5H A;  1U5K A;  4DR2 L;  4FXD A;  1FVI A;  1JOQ A;  2A69 C;  2A8V A;  1O78 A;  1M90 C;  4PQX A;  5LL6 X;  3J81 j;  1HUN A;  1HRJ A;  2KUM A;  3GTG B;  3E5S A;  3D6C A;  4HSP A;  2Y0S B;  2QEX A;  1M1K C;  4NXN L;  4OO1 G;  2BDN A;  2O5J C;  3PGZ A;  3R2T A;  1PH5 A;  4ZLT F;  3I56 A;  5C4J H;  1SEB D;  3N52 A;  2EY6 A;  2CH4 A;  3G6E A;  2VQF Q;  3CME A;  3PO3 G;  1C8C A;  4BXX G;  4ME3 A;  1ESF A;  2WAC A;  4RG1 A;  4B3M L;  3EJI A;  4QGU A;  2BE5 D;  3BU2 A;  5I2Y A;  5DEH A;  3ND8 A;  2R92 G;  2F0M A;  1UNS A;  4IPC A;  5J39 A;  1IYJ B;  1HCZ A;  1Q8K A;  3PUV A;  1EIF A;  1TWC H;  2RVL A;  2AQ2 B;  3GV6 A;  4IOC A;  3PO3 H;  3J81 E;  3J7A F;  4X3S A;  4BXX H;  5BN5 A;  1R9T H;  1KLU D;  1W2B A;  4B3S L;  4JI4 Q;  2WB1 G;  2Q2T A;  1HJP A;  1VS0 A;  1RTN A;  2F0G A;  3D3R A;  4A3M H;  4K0K L;  2CW0 C;  4OXP A;  4C3H G;  2R92 H;  3A8K E;  4DNR B;  1J8I A;  5HGT A;  2KHS A;  2PO4 A;  1RIP A;  1LTG D;  4KK7 A;  3LX0 A;  3CCR A;  1MJC A;  3OW2 A;  1S72 A;  1N34 L;  4XYQ A;  3MFY A;  4UAI A;  4TVA B;  5FO8 B;  1EY5 A;  3A0J A;  3V2T A;  3S24 A;  3UDX A;  1QWY A;  2X69 A;  4C3H H;  1BKB A;  3H3V C;  4X3T A;  1UEA B;  2XN9 C;  3VYT A;  3CAM A;  4K5X A;  3F8T A;  5IT9 c;  4HJ9 A;  3ITP A;  4MIU A;  3H0G H;  4DV1 Q;  1BBU A;  3RZD B;  4OWT B;  4GKJ Q;  1VQG A;  3ULP A;  4GNX C;  2F4V L;  2B2U C;  4POF A;  2ZTE A;  1K9M C;  1HZB A;  1KLG D;  2A6E C;  2NYZ D;  1LUZ A;  1DM0 B;  4DR5 Q;  1PV4 A;  1I50 H;  3A5Z B;  3D4D A;  3MWY W;  5EKI A;  2L11 A;  5JVH 3;  1WTP A;  1CKN B;  2PQE A;  3TEH B;  4G7Z C;  2IWH A;  1D2B A;  1VQP A;  1DOL A;  1IBK Q;  2CVR A;  3P75 A;  1PDQ A;  2K14 A;  3ZJY C;  3GTJ H;  1XNQ Q;  2NB0 A;  4YY3 L;  1WCM B;  2L55 A;  5FKA C;  1HH2 P;  2B63 B;  1LO5 D;  1F9P A;  1UWV A;  1Z7T A;  2EY5 A;  4A3K B;  1CSQ A;  2F0D A;  2PNR C;  1QUQ A;  1X3G A;  4F88 A;  1PTO C;  3P1H A;  4X66 L;  3KYH C;  5I9O A;  1SNC A;  2F0S A;  3HEJ A;  4BA2 I;  3Q0A A;  1KAW A;  2K50 A;  4UY8 C;  4GZY C;  1KAB A;  2GA4 B;  3EBE A;  1EFI D;  1SJE D;  2ICI A;  3L2P A;  3GP7 A;  2B8G A;  3OWF A;  4JV5 Q;  1MIU A;  2R61 A;  1IBL L;  4CKC A;  1PYB A;  4H7B A;  4GLA C;  4C3J G;  4A3I H;  3GTQ B;  1CZG A;  2K5Q A;  2LMC B;  4WRD A;  4RKL A;  4V19 0;  2I07 B;  2N49 A;  4O1N A;  1ET6 A;  4DR6 Q;  1E7Z A;  4DV0 Q;  5JJK A;  1G29 1;  1BCP B;  3K80 C;  1TS5 A;  3JAM c;  3NQT A;  3DEO A;  2TMP A;  1E2Z A;  3AYH B;  1QVG A;  3IRB A;  1BCP D;  4GN4 B;  4OO1 I;  1S5F D;  3PUW A;  2DUD A;  1CT1 D;  3J80 E;  4LF6 Q;  4JI7 Q;  3HOZ B;  2CQA A;  2IL8 A;  1QIL A;  1UAP A;  4IUR A;  5KYI A;  4IFD G;  3CD6 A;  3F2U A;  1B4O A;  4GS3 A;  2L5T A;  4IUT A;  5C0X G;  1KTK A;  2YTX A;  4K6L A;  4U67 3;  2MHV A;  3BG3 A;  3H94 A;  1I4H A;  4HIM A;  4CHT B;  3G7L A;  2H4O A;  3MXN B;  1G6P A;  2DGY A;  4F8M A;  4KHP Q;  2GVB A;  4A3D B;  1EU3 A;  3VR3 A;  4EGV A;  4RKB A;  4JVZ A;  2MO0 A;  1SYC A;  2KEC A;  2A68 C;  2QCP X;  5IYD G;  3M4O H;  3QB3 A;  5C3E G;  1JWU D;  5C0X H;  3OYY A;  1F77 A;  4A3E G;  3L0O A;  4ZAI A;  4X65 L;  3UE0 A;  3CCQ A;  1CTM A;  1NSN S;  3ZYY X;  5GAE C;  3NWT A;  4Y52 H;  1BO0 A;  2B2V C;  1I4Q A;  1ZXT A;  3S1N H;  4JBK A;  2RF4 A;  3S14 B;  3CC2 A;  2F0L A;  1JE4 A;  2FHT A;  4QUC A;  2FMM A;  5J1Z A;  4A3G B;  5C3E H;  5GAD C;  2HT1 A;  4A3E H;  1EZ8 A;  1D7Q A;  5K36 G;  3CMA A;  4DR4 L;  2IHE A;  3SE0 A;  3GTL B;  4IUV A;  1STB A;  1N36 Q;  5BN4 A;  4IUQ A;  4DV6 Q;  3S17 H;  4IUU A;  1BXT A;  4LFA Q;  1WTV A;  2OWO A;  1SNO A;  1HA6 A;  1HNW L;  4A93 G;  5M3M G;  4R8N A;  1R4P B;  4YWM A;  3VR4 A;  4LWC A;  1H9J A;  3PO2 G;  2YYZ A;  1Y1W G;  3I91 A;  3PV0 A;  3IAY A;  4LF4 Q;  1TII D;  2UUC L;  4JI0 L;  4JYA Q;  2OQK A;  5ELF A;  5C5L A;  4WJ3 M;  4X3K A;  2K28 A;  1RDP D;  4TKO B;  1AFP A;  4A93 H;  5M3M H;  1HR0 L;  1EYD A;  4DV4 L;  1NMG A;  2A73 B;  2PQA A;  4WFN 3;  2MNA A;  1KDC A;  2R93 B;  1XMO L;  5CV9 A;  4DGZ A;  1WD1 A;  3S15 H;  1SSO A;  4DR2 Q;  3C3L A;  1K83 B;  1YJN A;  1PH2 A;  5AJ3 L;  1R4Q B;  2VB2 X;  5M5Y B;  4EQO A;  5DM6 3;  1JIC A;  1PFN A;  3S1R B;  4BBR B;  4XT1 B;  2SOB A;  1HPC A;  4KLK A;  2M9V A;  3R2I A;  1XNR L;  2XWB B;  2ES2 A;  3MA2 B;  4JI3 Q;  1KAA A;  3A8I E;  5CC4 A;  1BNZ A;  1Y69 U;  1VMC A;  2PZU A;  1UEB A;  4L8J A;  3T56 B;  3FP9 A;  3GTG H;  1UUP A;  4CDF C;  3A54 A;  4DV5 L;  4MTK A;  2HQE A;  5JOB A;  4A3B B;  1CHQ D;  2F0E A;  2B2Y A;  1HTP A;  4B3M Q;  4IN3 A;  4A3J G;  1O7Z A;  2KCM A;  3QO2 A;  5E3F A;  5M5X B;  3HOY B;  4RFB A;  4APV A;  5IOC A;  3A56 A;  1PXU A;  4RCN A;  4EQN A;  5NUC A;  3T1Y Q;  4HCE A;  2VQF L;  3CCE A;  3RLN A;  3J81 i;  4XQN A;  4IFD I;  3G4S A;  3BZK A;  1PFS A;  2D0P A;  5C0X I;  4IJH A;  1YI2 A;  4GKK L;  1GHJ A;  4K0K Q;  5D3I B;  1SYF A;  1DOM A;  2F03 A;  1TWG H;  2AUJ D;  3TBI B;  1C9O A;  3J81 L;  2BA0 A;  1Y8O B;  1EQQ A;  3FPU B;  4AH6 A;  1SXT A;  1K8O A;  1X54 A;  1CI3 M;  1SMY D;  2PNH A;  4UP7 A;  4G7H C;  1VMP A;  2XGT A;  2VQE Q;  2KVM A;  2WB1 B;  4FNF A;  5LMN W;  1EOT A;  1IYU A;  3D0F A;  1YNJ D;  3FVQ A;  5I9P A;  3HFZ B;  5T1I A;  1HXY D;  5D14 A;  5E7N A;  3DM3 A;  1VQN A;  3RUZ A;  4HJ5 A;  1X56 A;  2M2L A;  3FEW X;  2F4V Q;  1NY4 A;  4BA1 I;  2F0P A;  4JI2 L;  1W6J A;  1EQR A;  1OXV A;  2A74 C;  5ELC A;  4G57 A;  2IX1 A;  1S5C D;  3TDQ A;  1NJI C;  1GHK A;  1PFB A;  3RZD H;  1I94 L;  4DV1 L;  1N9W A;  4GKJ L;  1WCM G;  2VNU D;  2VUM G;  4AYB G;  5JEA H;  2OEO A;  3TME A;  2B63 G;  5GRO A;  2XSC A;  1G6Z A;  2PMZ B;  4YY3 Q;  4R1J A;  1PH9 A;  3AEV A;  5FK9 C;  3TSS A;  2C35 B;  4RGN A;  1EZ6 A;  4F7X A;  4KN7 C;  2EZV A;  5IY0 A;  4L6T B;  1ZKO A;  2OXP A;  4X66 Q;  1B9M A;  2CWP A;  1PA6 A;  4IZ8 A;  2CCZ A;  4QCL A;  1KC8 C;  1WCM H;  3J7Z C;  1GUO A;  1XNQ L;  1VQD A;  1TT2 A;  4DXG A;  5FLX c;  1HUM A;  2B63 H;  1SLJ A;  5IGF A;  1VQ7 A;  2ZTC A;  4A3K H;  2O4X A;  4DV3 L;  1IBL Q;  5IOD A;  3CPW A;  2BH2 A;  1EYA A;  1L0W A;  2JA7 B;  1GM5 A;  3I3C A;  2HDL A;  2LSS A;  4YCV A;  2F0N A;  1VQ8 A;  2D0O A;  2E2J B;  4YWL A;  4A3F G;  2EY1 A;  4KY5 A;  2Q8R E;  1RKN A;  2MJ8 A;  4JV5 L;  2J0T D;  4KJO A;  1PRT B;  1VQ9 A;  2BE5 C;  2UU9 Q;  3GTQ H;  4DN4 M;  5HUR A;  2X6L A;  3AU7 A;  4ABN A;  1RHP A;  2K7V A;  5E4W C;  3J80 i;  5I6W A;  2V4D A;  3F1Z A;  1GOZ A;  2KBN A;  4GNX A;  4C3J B;  4KKU A;  4DR6 L;  2B2U A;  2F0K A;  3A7L A;  3O13 A;  1K28 A;  4C3I B;  4LW1 A;  1EY0 A;  1JWM D;  2E2D C;  4A3D G;  3K5O A;  4RWS C;  3HOZ H;  3J80 L;  3AMU A;  3UDF A;  4LF6 L;  1LTL A;  2JA8 H;  1S40 A;  2AQ3 B;  4QJF A;  4KV6 A;  1XTC D;  3NTK A;  1Q8I A;  2QF7 A;  1Q81 C;  1EUJ A;  1G2S A;  4FF4 A;  4I7A A;  2HDM A;  1LTB D;  1K3B C;  2N8N A;  4X65 Q;  2K5W A;  3H91 A;  2EYF A;  5CR3 A;  3GTK B;  1WTH A;  4HCS A;  4PV1 C;  4A3D H;  2DN8 A;  3T1H L;  4DK1 A;  4LF7 L;  4A4I A;  1EQT A;  4H0L C;  2DY8 A;  1MSH A;  3VDY A;  1XPO A;  4A3G G;  3VYU A;  3BDL A;  4DK0 A;  1C7Y A;  4PMB A;  1F2Z A;  4H02 A;  3EVQ A;  1EQV A;  3OSO A;  3S14 H;  2A6H C;  1I6V C;  5I2X A;  1TWA B;  4CDD C;  1HNW Q;  4RHS A;  2E5L Q;  3TP8 A;  4A3G H;  2EXZ A;  5IE8 A;  1AE3 A;  3E9I A;  3GTL H;  3MEH A;  5EJW A;  4RH6 A;  2F0I A;  4AIM A;  1O7I A;  1QUQ B;  4RGT A;  4ZUJ A;  3TZD A;  1I6H B;  2UUC Q;  2EIF A;  2QA4 A;  4JI0 Q;  1D5M C;  1JR0 D;  1ZYR C;  2YU9 B;  4DR1 L;  2B39 A;  3HS0 C;  1LAB A;  1PH1 A;  5CV8 A;  4HTH A;  3NK9 A;  1HR0 Q;  4L63 B;  4KTA A;  4DV4 Q;  4FF1 A;  2CH4 W;  1T5X D;  2K32 A;  2F0H A;  1XMO Q;  4XIG S;  2NTS A;  3ULJ A;  4O0A A;  1Y1W B;  2PZW A;  3I55 A;  1G8Z D;  3K5N A;  4GN5 A;  1C48 A;  1TY0 A;  5AJ3 Q;  2XTI A;  4BBR G;  4K8J A;  5HY6 A;  2R93 H;  4CJ0 B;  4DR7 L;  3EIV A;  3QOL A;  3KF6 B;  1LT4 D;  4ODG A;  2ENB A;  1Q90 A;  2EYJ A;  3I90 A;  4OWX B;  4DAM A;  2G9H D;  2SNM A;  1XNR Q;  4XQQ A;  1K83 H;  2B2V A;  1HNX L;  3KLR A;  5M5Y H;  4ZYS A;  1JT8 A;  1Y1V B;  2EQS A;  2RHQ B;  1V8Q A;  3DWQ A;  2Q2H A;  5K5P A;  4BBR H;  5M5W B;  3FRP B;  4A3B G;  4DV5 Q;  1VQ4 A;  2WAQ B;  1E24 A;  1LLR D;  4L5R C;  1V1O A;  3RLO A;  3K0Y A;  3HOY G;  4PZ6 A;  4JI3 L;  3K0X A;  3HOW B;  1K0R A;  4IFD J;  3LGJ A;  1IKL A;  3CU7 A;  3MFG A;  5C0X J;  3BZD B;  2HCI A;  1OXS C;  1RD9 D;  4BS9 A;  2AUK A;  3LWE A;  1SE2 A;  2EVB A;  3DM1 A;  2LXK A;  1QNU A;  3M9B A;  4XXE A;  4JC0 A;  5KND A;  1A63 A;  5EPJ A;  2K01 A;  5M5X H;  3M7N A;  3HOY H;  1P8L A;  1Y14 B;  2I5M X;  3K81 C;  5J3B A;  1ICF B;  5IT9 E;  4OO1 H;  4QY7 A;  4CKB A;  1EY8 A;  4GKK Q;  4A3J B;  4R4T A;  3M4P A;  2BOS A;  3KBX A;  3T1Y L;  1GXD C;  2ZJQ A;  1F2L A;  1YHQ A;  4JBM A;  4GOP A;  4Z9C B;  1WI5 A;  1TKW B;  4B9X A;  1C4Q A;  1FJG Q;  1KIX A;  5CV6 A;  4POG A;  2JEA I;  4DU9 A;  3IKJ A;  1SN8 A;  5IYC G;  1HTL D;  2DJF C;  2RDG A;  5C44 B;  1E2W A;  5COY A;  2MO1 A;  1B53 A;  2KA7 A;  4LFC Q;  1I5F A;  4FF3 A;  4X64 L;  5EGT A;  4LF5 L;  2KOL A;  1Y8N B;  2Q2I A;  2VQE L;  2BCO A;  4K8I A;  3FDT A;  3A5U A;  4JI2 Q;  3NXW A;  1AP0 A;  1P16 A;  1WTO A;  1YJ9 A;  5T1G A;  2UUA L;  3K57 A;  3SK6 A;  1A3V A;  1I94 Q;  1GKH A;  5EQ0 A;  1CQV A;  2ZXP A;  5I6Y A;  4JK1 C;  3AFP A;  4HED A;  2RCN A;  1VF7 A;  2K52 A;  1ZEQ X;  4ZKC B;  3OW7 A;  1Q1E A;  3S9W A;  4KI0 A;  1LTI D;  3GDE A;  1WTW A;  1TS2 A;  4CKE A;  3J7A 5;  4U68 A;  3U58 A;  2I5H A;  1B70 B;  3JAM E;  1WYD A;  3PSI A;  2K5D A;  1S5D D;  1W3S A;  3PQI A;  5ELB A;  2KEN A;  1EU4 A;  5EAY A;  2VUM B;  2R3Z A;  4AYB B;  3I4N B;  1PH7 A;  3NE5 B;  4OEM B;  2RCF A;  1K8A C;  1PZJ D;  4DV3 Q;  2JA7 G;  5IP9 G;  3HKZ E;  3L3O C;  4BWG B;  2HIX A;  2ZXO A;  1B7Y B;  3MAQ A;  1MI2 A;  4X3U A;  2AHO B;  5LHY 1;  5JJI A;  1II3 A;  2JA5 G;  2O2L D;  4KMU C;  2NVY B;  3S2D B;  1CKM A;  4JCV E;  4LF9 L;  1A62 A;  4DAY A;  2NZ1 D;  3F2D A;  1CA5 A;  3NEN A;  2JA7 H;  4NDX A;  2KEE A;  2Q8T A;  5IGE A;  4RGO S;  3C1F A;  3CF5 A;  2JJQ A;  5M3F G;  2E2J H;  1FL0 A;  1F9R A;  4FO2 A;  4C3I G;  3NEL A;  4HMJ A;  3VR6 A;  4B3R Q;  3C2P A;  2EJG C;  4NP5 A;  4YWK A;  5IIF A;  4A3F B;  1B3A A;  2UU9 L;  4Q5V A;  2NVQ B;  3Q8D A;  2R7D A;  2OTL A;  3QIA A;  1PVO A;  1IKM A;  4C3J H;  1LYL A;  5LMU Q;  2N78 A;  1EYG A;  3TP7 A;  4C2M B;  2CKZ B;  3CCJ A;  2HD3 A;  4C3I H;  1IL8 A;  2RKS A;  2A69 D;  4DKA C;  3E3X A;  2F1M A;  1UE6 A;  3SK8 A;  2VXW A;  3T1H Q;  3UDI A;  4LF7 Q;  4OHJ A;  1U9R A;  3URY A;  2FMC A;  3K59 A;  1CA6 A;  3J7A V;  4OL7 A;  4IFD H;  4HMI A;  1I4R A;  3B6Y A;  4YCU A;  3D31 A;  4J6H A;  1K0S A;  2JEB I;  1IBM L;  3GTK H;  1NMF A;  2D2C C;  2OTJ A;  5KEE A;  3AFQ A;  4IUP A;  2ZM6 L;  1G91 A;  5HGQ A;  3FKI B;  1A0I A;  2V1C C;  5JEA J;  1AEX A;  3DWA A;  1I4X A;  4P2C B;  3E0J A;  5IYD H;  1OXX K;  1PFM A;  1Q86 C;  3M4Q A;  2WKD A;  1D5X C;  4PZ7 A;  2J7Z A;  3HG9 A;  1NUC A;  1GUG A;  4KD4 A;  3QWN A;  3CXC A;  5DLQ E;  1TWA H;  3HGB A;  1H9K A;  3T51 B;  1SNQ A;  3AB9 A;  2B2T C;  3OPO A;  4HJ8 A;  2E5L L;  4DR1 Q;  3CCL A;  2F3I A;  1O80 A;  1S4Z A;  3VR2 A;  2YV5 A;  3GTM B;  5K36 H;  1I6H H;  4Q0F A;  3D4R A;  3OHX C;  1ONL A;  5ELO A;  3NTH A;  2HHH L;  2YU9 H;  2K04 A;  2N3S A;  1A6X A;  4JW0 A;  5CBE E;  2NN6 G;  1ILQ A;  3SEB A;  2YTV A;  1Q1B A;  3NBI A;  2RSN A;  2D62 A;  4BY7 G;  1C0A A;  3Q24 A;  2KHI A;  4DK3 C;  2R93 G;  1SDF A;  5JAV A;  4FXK C;  2E76 C;  3CCV A;  4DR7 Q;  2PYK A;  4DUY L;  2C9O A;  2A1A A;  3PO2 H;  1Y1W H;  2F0Q A;  3P20 A;  3HOX B;  3RN2 A;  1VQA A;  4WJ4 A;  3DMU A;  1Y1V G;  1SE4 A;  1NCV A;  3GV3 A;  3K5M A;  4GOP C;  1HNX Q;  1JB7 A;  1VQF A;  1TY2 A;  5FO9 B;  1WJJ A;  3VA5 A;  2E2H B;  5KGU A;  4GNX B;  2NN6 H;  1LTA D;  2WAQ G;  4N8F A;  1YJW A;  1EWI A;  4EQ5 A;  3FHW A;  3HOW G;  1SNP A;  1TQO A;  4K2L A;  3X3M A;  2F0W A;  1UE7 A;  1FGU A;  5EKK A;  1Y1V H;  5EBD A;  5IP7 G;  1L1O C;  1YIJ A;  1EEF D;  3NP8 A;  2E2I B;  5M5W H;  2EYO A;  5EPK A;  3D6W A;  1BUV T;  3MHB A;  3HOU G;  3U9O A;  3OTO Q;  4DUZ L;  4N8X 1;  2NWG A;  2R7F A;  3ULL A;  3D8G A;  3UE1 A;  1LT6 D;  3L7Z C;  1SE3 A;  3M7G A;  3HOW H;  4I7Z C;  1PTO B;  4HIK A;  5BR8 Q;  3BZC A;  3BVZ A;  4JPB W;  5IP7 H;  1PLF A;  1QG7 A;  4IJL A;  5IGD A;  4JBJ A;  5IWA L;  4A75 A;  1DJR D;  2XWJ B;  4A76 A;  3K7A B;  1NAP A;  2WIN B;  1DXM A;  1I3Q B;  3S1M B;  2EJF C;  3V05 A;  3I4M B;  4H44 C;  3SGI A;  4H13 C;  1X32 A;  4XT3 B;  2K5N A;  3STB C;  5CGK A;  1MJE A;  1QCB D;  5IT9 L;  2JXM B;  4A3J H;  4G7O C;  1H9S B;  2N88 A;  1F2M A;  3QG1 A;  4ZRZ A;  3SK4 A;  2HCC A;  1HZ9 A;  3CRL C;  3K8A A;  5LMN L;  4P71 A;  3S16 B;  5C44 G;  1SAP A;  1EOV A;  1STG A;  3T53 B;  2B8F A;  2OQ0 A;  3PUX A;  2P5Z X;  5H1S E;  1WTR A;  1PZI D;  1Z6H A;  3DEP A;  3S2H B;  3A7A B;  1BVS A;  4X64 Q;  5DM7 3;  1FJG L;  5KYL A;  3OIQ A;  4LF5 Q;  1A15 A;  4G4K A;  2NVX B;  1BCP F;  4ULL A;  1IL2 A;  3K6O A;  1SBB B;  2LKV A;  3I7F A;  3MVV A;  5FLX E;  5C44 H;  2VZA A;  2UUA Q;  1N32 Q;  4LFC L;  1EYC A;  3F2C A;  4K2K A;  3ND9 A;  4IAL A;  2EJM A;  2K6A A;  5C3W A;  2G5D A;  4RA8 A;  1YNN C;  4BBS B;  2D5D A;  2FXQ A;  1V9P A;  2K5H A;  4UP8 A;  4K5W A;  2A68 D;  1D5Z C;  1YVC A;  2KHJ A;  3W2D A;  2JYO A;  1JE5 A;  1HFG A;  3L9A X;  3U9S A;  3JAM i;  2Y0S E;  5JPM C;  2EPB A;  1G51 A;  1EY9 A;  1PYS B;  1YZ6 A;  1CHP D;  1F2Y A;  3I4N G;  2K75 A;  2IX3 A;  2JP1 A;  5DAU A;  3VYS A;  3UI2 A;  1I4G A;  2AQ1 B;  3UDG A;  2NUC A;  1CFM A;  3U4V A;  4GLV B;  5I4D A;  3SHL A;  3PF5 A;  3JAM L;  2NN6 I;  1WFQ A;  1BQQ T;  4LK1 C;  3TP5 A;  3HP3 A;  3QOJ A;  4I65 A;  4A3C G;  4ZKB B;  1AZQ A;  2EXD A;  1T5E A;  5FJ8 G;  2VUM H;  3I4N H;  1X65 A;  2CFM A;  1HQR D;  4LF9 Q;  2NTT A;  4WOR A;  4MZ9 A;  5GAG C;  5D65 A;  2BDO A;  3W5O A;  4ZQ3 A;  4DNT B;  3H15 A;  4TQU S;  1SYE A;  2IJ0 A;  2F0F A;  4LMQ D;  3HRZ C;  4R4I A;  1VQ6 A;  3WDN A;  3S2D H;  3KK7 A;  3KLW A;  4PMW A;  1BBX C;  5FJ8 H;  1V1Q A;  3OMG A;  2KCN A;  2JA6 G;  2JA5 B;  1JC7 A;  2RSO A;  3K58 A;  4FYD A;  1BR9 A;  2XRQ D;  4IOA A;  2Z6K C;  1GD7 A;  3VA7 A;  3LNN A;  1PRT D;  1U4M A;  3ER0 A;  3RZO B;  1A3U A;  1EEI D;  1IW7 D;  1FR3 A;  2BA1 A;  2ZJR A;  4A3I B;  5M3F B;  2SDF A;  2ATW A;  4A3F H;  2QDL A;  4B3R L;  3KDF A;  4OEL B;  3GO5 A;  3GD7 A;  1L0X B;  1X3Q A;  4HSV A;  3M4Y A;  5A2Q E;  4DV7 L;  4LUO A;  4C2M H;  4KD3 A;  5LMU L;  3I2Z A;  1X9N A;  4DPG A;  4X62 L;  3OOC A;  3NEM A;  1IBM Q;  3FKI G;  2G9D A;  1HZA A;  1GUN A;  2ZM6 Q;  3QJY A;  1N8R C;  4MNO A;  5F2D A;  4BY1 B;  1RTO A;  3KF8 A;  2F4I A;  1D1K A;  3CQZ B;  3TN2 A;  1L2F A;  1ENA A;  3U50 C;  5C5M A;  1SYB A;  5C6A A;  1W6K A;  3FKI H;  4J1M A;  5JVG 3;  4HJA A;  1DD2 A;  3BDC A;  5EKL A;  2DNC A;  1SMX A;  1EY6 A;  4IPG A;  3VR5 A;  2UXD L;  4UDU C;  1EIG A;  1HQM C;  3CC4 A;  3PIP 3;  3PIO 3;  5C4H A;  1MGS A;  2EY2 A;  2QEJ C;  3OMC A;  4GN3 B;  2ID0 A;  2OT2 A;  2M00 A;  1IXR A;  1FD7 D;  4RAU C;  5KRU A;  3DWP A;  1ASY A;  2EDG A;  3PUY A;  1V1P A;  1CM9 A;  4XTC S;  4JOI C;  2HHH Q;  3E6Z X;  5KIX A;  4X6A H;  1KD1 C;  1TWH B;  4LF8 L;  3IFD A;  2UXC Q;  1NR4 A;  2F52 A;  2I5L X;  5C4Z A;  4JI6 Q;  1TR5 A;  3NWS A;  4QL5 A;  4CGY B;  4QQB X;  3CCS A;  3GTM H;  4FDB A;  3HOX G;  4KN4 C;  4DUY Q;  4DAY B;  1YHA A;  1VQE A;  2IY5 B;  1XJV A;  2MFI A;  5CV5 A;  2VW9 A;  3IL8 A;  5AFW A;  1EFW A;  4UPA A;  1QB5 D;  4MHE A;  3C46 A;  2KED A;  2BH8 A;  3BJU A;  1KL9 A;  3HKS A;  4ID6 A;  4R8I A;  4BY7 B;  4QF4 A;  3RLF A;  3HOX H;  4JBW A;  1PZK D;  2RDF A;  3SXH A;  2RBM A;  2JK8 A;  5FO7 B;  4FP5 D;  1PMR A;  4IQZ A;  2E2H H;  1LT5 D;  2GN5 A;  3NQI A;  2F0J A;  2KJX A;  3LWU A;  4IUN A;  4ME5 A;  5FLM G;  4UP9 A;  4C56 C;  3S1R H;  2QDB A;  5CMD A;  4K14 A;  5ELE A;  1S5E D;  1BCP C;  4DUZ Q;  3H6M A;  3WWV A;  4DNI A;  2R7Z B;  3Q22 A;  1B3Q A;  1GUT A;  2A19 A;  2Z8L A;  4V0B A;  1M8A A;  1FNU A;  4O2D A;  2J4X A;  4DF7 A;  4PNY A;  1LTS D;  2ZXR A;  2H1E A;  1RL2 A;  4ZK9 B;  3CKI B;  2E2I H;  2B2T A;  4RMF A;  1EIH A;  1CSP A;  4YHH Q;  5FLM H;  2VY3 A;  3K7U C;  5IWA Q;  2FJ2 A;  4QUF A;  3I4M G;  1PH6 A;  3OTO L;  4PMC A;  3X3N A;  2K1B A;  4A3B H;  1Q46 A;  4FXG C;  2Q8I B;  3HOU B;  3PCO B;  1PTO H;  4ALP A;  5BR8 L;  3K7A H;  1I3Q H;  1XTD A;  2EE1 A;  1J5E Q;  3S1M H;  5LMN Q;  4XDX A;  2AWN A;  1VQO A;  3R93 A;  3I4M H;  2NVT B;  4IPD A;  3NSW A;  2DNE A;  3HKZ G;  3T16 A;  5BN3 A;  1GVP A;  4DAV A;  1VQM A;  1B44 D;  1NE3 A;  5E1F A;  2JQO A;  1TWF B;  2EYH A;  3R8B A;  1XPU A;  5KNC A;  3A8J E;  1RF2 D;  2QW7 A;  3T4A C;  4E6I A;  3S16 H;  4A3M G;  3I4L A;  2PI2 E;  1JJC B;  1HZC A;  1AW7 A;  1DOK A;  4O42 A;  2SNS A;  1PRT F;  1TU2 B;  3S2H H;  3OWE B;  2LS0 1;  2AKW B;  4PZ8 A;  5CV7 A;  1TWG B;  2ALY B;  3QR8 A;  4JI1 L;  1JOO A;  4M1U B;  4BBS G;  3KFU A;  1PH3 A;  2NVX H;  1L1O A;  4PG3 A;  4OX9 L;  1N33 L;  1Z9F A;  4A3L G;  4LFB Q;  2PQA B;  3NBH A;  4DK6 C;  4B08 A;  5IYC H;  5FLX L;  3HOV B;  5EPL A;  2F0O A;  2CWA A;  1K73 C;  3G6J B;  1IZ6 A;  1N32 L;  4QIW E;  5J22 A;  1OTC A;  1YHB A;  3H0G G;  1QVF A;  1EWH A;  4OIK A;  2MP1 A;  2GVA A;  4NB3 A;  1WTX A;  4BBS H;  4P75 A;  1EIY B;  4LJZ C;  2K33 A;  4A3L H;  1LT3 D;  1BBW A;  2UUB Q;  3WOE A;  5G3L D;  3EA6 A;  1V43 A;  1BOS A;  4JG2 A;  3H3V I;  1HNZ L;  3ERQ A;  5E4X A;  3I8Z A;  1KQS A;  4DXF A;  2A6H D;  4NPS A;  3SDZ A;  1G2T A;  4NKL A;  4OON A;  4OWW B;  3EQL C;  4RHR A;  3J81 c;  3KJP A;  5GQO A;  1JCK B;  1F9S A;  4EQP A;  1LTR D;  4OGQ C;  1QOH A;  1JJG A;  5ISR A;  2B29 A;  3PF4 A;  1VDZ A;  2RDH A;  1MSG A;  4HJ7 A;  1QZG A;  1B2T A;  1U4P A;  4TSS A;  1PH4 A;  2YTY A;  2HQL A;  1ZYR D;  1SFO B;  4JI8 L;  3K5L A;  3EN2 A;  5IP9 H;  1HFN A;  1SR3 A;  1CK1 A;  4A3I G;  5IYB G;  2LFN A;  3BYT B;  2JN4 A;  3DHQ A;  4JI5 Q;  2WB1 E;  2JA5 H;  2LY7 A;  4ILW A;  1SRO A;  4NXM Q;  1AN8 A;  3U4Z A;  3I72 A;  2JA6 B;  1AZP A;  2H5X A;  3A55 A;  4Y7N B;  3RZO H;  3MC0 B;  4C1N K;  1LTT D;  2NZH A;  2CQO A;  4DV7 Q;  3KLS X;  1O7L A;  4UHV A;  2AMC B;  1WD0 A;  5M3F H;  1ENC A;  5IYB H;  4DV2 Q;  4K5V A;  1MD2 D;  2IPK D;  4KHV A;  5CYU A;  1VQB A;  4X62 Q;  4F87 A;  3C1E A;  3IFT A;  2WII B;  4N9T A;  3KF6 A;  3TQY A;  1PHJ A;  1SMY C;  1B8A A;  4KKS A;  4BY1 G;  1LAC A;  1MKH A;  5A2Q L;  5IGC A;  4YCW A;  3A74 A;  1JWS D;  1YNJ C;  2PMZ E;  1XXG A;  4B3T L;  3PMF A;  2JA8 B;  1YEZ A;  4XQJ A;  3BVM A;  1UE5 A;  3CCM A;  4R4O A;  1E2V A;  2Z1C A;  2WKC A;  4KY6 A;  1YBY A;  2Z9H A;  1ESR A;  2XRS D;  2ASB A;  4P73 A;  3DXJ C;  4BY1 H;  2ZT9 C;  1T9H A;  2IT1 A;  3MEF A;  3CQZ H;  2UXD Q;  3CW2 C;  4HN7 A;  2RA4 A;  3M3Y B;  1J6Q A;  3I4O A;  2JE6 I;  2KQ3 A;  3DUZ A;  4M8A A;  1ENF A;  5C4X B;  1JJ2 A;  1Z47 A;  2NBF A;  2Z6K A;  3HZX A;  2N55 A;  1NBW A;  3DLL A;  1CUK A;  2NZO A;  4LF8 Q;  3Q6S A;  2L9H A;  3RR5 A;  4IO9 A;  3KJO A;  3E9H A;  1AE2 A;  5M9O A;  3MXP A;  1XMQ Q;  1GJX A;  1Q3L A;  1FGB D;  1E3P A;  2ZJP A;  2F3V A;  3GTO B;  3SR1 A;  2CW0 D;  3J80 c;  3ICE A;  2L0C A;  1STY A;  1TWH H;  1ET9 A;  4CDC C;  4RCO A;  4L5Q A;  3BVG A;  1BDO A;  4P72 A;  2UXC L;  1E22 A;  4CJ1 B;  2XIW A;  4OIJ A;  4JI6 L;  1RCV D;  2DJG C;  2K05 A;  4MN3 A;  1KXL A;  1FNV A;  2F0T A;  4P74 A;  2O5I C;  1OXU A;  1A2T A;  1LV9 A;  4DR3 L;  1KRS A;  1U4R A;  1X3P A;  3WOF A;  4CDE C;  1A8V A;  2L12 A;  3SK5 A;  3GTP B;  4BY7 H;  2R7Z G;  1E1T A;  4LUV A;  1H95 A;  1XX8 A;  3S1Q B;  3KDF B;  5GAH C;  1PRT C;  1KHI A;  1WTQ A;  2A6E D;  2B2W A;  4KKT A;  1IW7 C;  5CV4 A;  4L5T A;  2E74 C;  2WP8 J;  4YIJ A;  3H09 A;  2EYL A;  1DGS A;  1NTG A;  1D1I A;  1SYD A;  4FVM A;  4QMG A;  5D3D A;  1A3T A;  1JB3 A;  5G3L F;  1HR0 W;  1JMC A;  2R7Z H;  2UXB L;  3ERS X;  2RQX A;  1ILP A;  2B3G A;  4AQY L;  1CKN A;  1OXT A;  2SEB D;  4WJW A;  2Y0S G;  2VB3 X;  1UE1 A;  4JOI A;  4QIW B;  3CP0 A;  2E75 C;  2F0U A;  1IHZ A;  3KF8 B;  4YHH L;  4NXN Q;  3OIP A;  1PTO D;  1KDB A;  1M4V A;  2Q2U A;  1XWE A;  3HOU H;  5C3X A;  3N6R A;  4DFA A;  3MXG A;  1TVX A;  5C4J B;  1QZH A;  3CHB D;  1CKO A;  1Q82 C;  2PW7 A;  2PZT A;  1STE A;  5IGB A;  4ZUI A;  5EBC A;  2D9U A;  1JQY D;  1J5E L;  2NVT H;  1EY4 A;  1TXY A;  3F2B A;  1NR2 A;  1VQH A;  1QE6 A;  5IGG A;  2XVS A;  5ELD A;  4K6D A;  1TWF H;  3CC7 A;  1GUS A;  3HKZ B;  1I4P A;  1V1P B;  1TWC B;  4NMZ A;  3SVM A;  1F9Q A;  2RHS B;  4JI1 Q;  3G71 A;  3PO3 B;  3MTS A;  4B3S Q;  3BDO A;  1JOK A;  1R9T B;  1X3E A;  4KHZ A;  2IX0 A;  4OX9 Q;  3HOV G;  3TRZ A;  1N33 Q;  3NPP A;  1DCZ A;  3V96 A;  3M85 A;  4A3M B;  1OO9 B;  1DYQ A;  1Y8P B;  4EX5 A;  2R92 B;  1NNX A;  1LM0 A;  5COR A;  2HUG A;  5JPN C;  1N34 Q;  2C5C A;  1H9M A;  1PYW D;  1STA A;  1A2U A;  3KBG A;  4MTN A;  4JI4 L;  2KCC A;  3I70 A;  2CHB D;  3BYY B;  1E0B A;  4LFB L;  3HOV H;  2WAQ E;  2VL6 A;  3BS1 A;  4C3H B;  2ZTD A;  1ICW A;  2OCE A;  1QNK A;  3MXN A;  2XNA C;  1U0L A;  1VQ5 A;  4L5S A;  2R6G A;  1MBY A;  2MUY A;  1SNM A;  2AWO A;  2OF1 A;  1B1Z A;  2PW5 A;  2IHF A;  1HNZ Q;  3H0G B;  2TSS A;  2L1B A;  5FOB B;  3TRE A;  5JEA G;  4B9W A;  1K8M A;  4FF2 A;  1VQK A;  1O7Y A;  1D6E C;  1QVC A;  2E8G A;  4DA2 A;  1KNA A;  1E1O A;  3MXU A;  4KY7 A;  2UUB L;  5JJL A;  4HID A;  1I50 B;  1MHW C;  1TS4 A;  1GO3 E;  3R3O A;  1SE8 A;  1EY7 A;  1K3R A;  4IPH A;  1K8G A;  4LAA A;  4R9W A;  2EYM A;  5JJZ A;  3GTJ B;  4CJ2 C;  4DAP A;  1BF4 A;  1GUW A;  4A3K G;  3KUP A;  3ONA B;  4JI8 Q;  4DR5 L;  1QJO A;  2L4N A;  1XYI A;  5LL6 S;  5DNF A;  3FPP A;  4C1N I;  1IBK L;  2MQH A;  2JA9 A;  2KCT A;  1L0Y B;  4A3C H;  2NVY H;  3RD4 A;  1VCI A;  3D4W A;  3I73 A;  4HAE A;  4R4Q A;  2QKI C;  1SFO H;  3TS0 A;  2K5V A;  4R4C A;  1X3F A;  5CBA E;  3EFX D;  1JOR A;  2ICE C;  4N9P A;  1CZW A;  2PCF B;  3MZ5 A;  4GOP B;  1HA5 A;  1VQJ A;  4JI5 L;  1B50 A;  1ROD A;  3W1B A;  1ML0 D;  1D8L A;  1Q7Y C;  4NXM L;  1U4L A;  2PI2 A;  1VF5 C;  2JA6 H;  4J15 A;  3KLS A;  1Q12 A;  2NVQ H;  4Y7N H;  4RGM A;  3TS2 A;  1H9R A;  1SND A;  2IW3 A;  3HOZ G;  1DON A;  4ZCK A;  4TRD A;  1WOC A;  1FNW A;  2FFK B;  2JA8 G;  1YIT A;  3PIP A;  2I46 A;  4DV2 L;  3PIO A;  4LNQ A;  1L1O B;  4B3T Q;  2Z4I A;  4DV0 L;  2L15 A;  3NBH B;  3TP6 A;  3GQB A;  2WV6 D;  1DZ1 A;  2QGQ A;  1VQL A;  3CPF A;  3Q23 A;  1TS3 A;  3W1G A;  3ERO A;  2Z6B A;  1FYC A;  4JI7 L;  3NUC A;  5TSS A;  5C4X G;  4AYB E;  5KNB A;  2VS1 A;  4S3S A;  2F0V A;  3M4O B;  1YNX A;  2Z4H A;  2B2W C;  4CBV A;  1KDA A;  1SYG A;  4KHP L;  2LXJ A;  1XPR A;  3RMH A;  1PTO F;  3M3Y H;  1EWC A;  3CCU A;  3NHH A;  1S3O A;  3S1N B;  2PPB C;  3STB D;  5C4X H;  2K4K A;  2X6G A;  1SRU A;  1EL0 A;  3J7Y W;  1WVL A;  5C3E B;  1KRT A;  4HIO A;  3PUZ A;  4DR4 Q;  4A3E B;  1X6O A;  1RJT A;  3W3A A;  3FMC A;  1VQC A;  3S17 B;  1H9S A;  3E0E A;  1AH9 A;  1XMQ L;  1PH8 A;  2HIV A;  3GTO H;  5ELN A;  3JC6 6;  3T13 A;  2MPM A;  1B9N A;  5L37 A;  2EYP A;  2I0Q A;  1HHV A;  1N36 L;  2B2Y C;  2JSO A;  2MGS A;  4QB4 A;  4DV6 L;  2DY7 A;  1J9O A;  1KNE A;  1STH A;  4HR7 B;  4DR3 Q;  1X55 A;  4LFA L;  3H3V H;  1IYV A;  4GLX A;  3RN5 A; 
#chains in the Genus database with same CATH homology
 1PH9 A;  3AEV A;  4OON A;  3CCV A;  4OWW B;  4DR7 Q;  2C35 B;  4DUY L;  3J81 c;  3KJP A;  1ASZ A;  5GQO A;  2A1A A;  3PO2 H;  1Y1W H;  4WJ4 A;  5IY0 A;  1VQA A;  3RN2 A;  3KOJ A;  4LF4 L;  2WFW A;  1Y1V G;  4X66 Q;  2CWP A;  4GOP C;  1HNX Q;  1VQI A;  2B29 A;  1JB7 A;  1VQF A;  2Z0S A;  1PA6 A;  1WJJ A;  3GTP H;  2CCZ A;  3PF4 A;  4JYA L;  1KC8 C;  1WCM H;  3J7Z C;  4GNX B;  1XNQ L;  1VQD A;  4HJ7 A;  1QZG A;  5FLX c;  4LUZ A;  2B63 H;  1SLJ A;  3S1Q H;  2WAQ G;  1PH4 A;  1VQ7 A;  2UXB Q;  2YTY A;  2ZTC A;  2HQL A;  3AQQ A;  3G48 A;  4A3K H;  1YJW A;  1EWI A;  3RNU A;  4JI8 L;  4DV3 L;  4EQ5 A;  1IBL Q;  3EN2 A;  3FHW A;  3HOW G;  5IP9 H;  3CPW A;  4AQY Q;  2BH2 A;  1SR3 A;  1L0W A;  1U5K A;  4A3I G;  1UE7 A;  1FGU A;  4DR2 L;  1GM5 A;  1Y1V H;  5IYB G;  1FVI A;  2LSS A;  4YCV A;  5IP7 G;  1VQ8 A;  1L1O C;  1YIJ A;  2D0O A;  4JI5 Q;  2WB1 E;  2JA5 H;  5M5W H;  4YWL A;  2A8V A;  1M90 C;  4A3F G;  1SRO A;  4NXM Q;  3HOU G;  3OTO Q;  3J81 j;  4DUZ L;  3U4Z A;  4JV5 L;  2R7F A;  3ULL A;  3UE1 A;  1VQ9 A;  3L7Z C;  2UU9 Q;  1JJG A;  3GTQ H;  2H5X A;  3HOW H;  3RZO H;  2NZH A;  2CQO A;  3J80 i;  4DV7 Q;  4HIK A;  5BR8 Q;  2AMC B;  3F1Z A;  2QEX A;  1M1K C;  4NXN L;  3BZC A;  5IYB H;  2KBN A;  5M3F H;  4DV2 Q;  4OO1 G;  4GNX A;  4DR6 L;  5IP7 H;  4A75 A;  3PGZ A;  4IJL A;  4JBJ A;  1VQB A;  5IWA L;  4X62 Q;  4A76 A;  1PH5 A;  3I56 A;  3KF6 A;  3TQY A;  4LW1 A;  5C4J H;  1PHJ A;  3SGI A;  3G6E A;  1B8A A;  4BY1 G;  2VQF Q;  3CME A;  3PO3 G;  4A3D G;  1MKH A;  4BXX G;  3HOZ H;  4ME3 A;  2K5N A;  3STB C;  4RG1 A;  1MJE A;  4B3M L;  4YCW A;  3UDF A;  4LF6 L;  3A74 A;  4QGU A;  1LTL A;  2JA8 H;  4A3J H;  1S40 A;  3BU2 A;  4DK3 C;  2PMZ E;  4B3T L;  4QJF A;  2R92 G;  1YEZ A;  1HZ9 A;  4IPC A;  1UE5 A;  3K8A A;  5LMN L;  4P71 A;  3CCM A;  4R4O A;  1Q81 C;  1IYJ B;  1Q8K A;  1EUJ A;  3PUV A;  5C44 G;  1EOV A;  1EIF A;  2N8N A;  1TWC H;  1YBY A;  2OQ0 A;  3PUX A;  4X65 Q;  2ASB A;  4P73 A;  4IOC A;  5H1S E;  4BY1 H;  3PO3 H;  1T9H A;  4A3D H;  2IT1 A;  4BXX H;  3MEF A;  3T1H L;  1R9T H;  3CQZ H;  2UXD Q;  3CW2 C;  4LF7 L;  1BVS A;  4X64 Q;  1W2B A;  4B3S L;  1FJG L;  4A4I A;  4JI4 Q;  2WB1 G;  2Q2T A;  4LF5 Q;  3VDY A;  1HJP A;  1J6Q A;  3I4O A;  1XPO A;  1VS0 A;  2JE6 I;  4A3G G;  4A3M H;  4K0K L;  1C7Y A;  4OXP A;  2R92 H;  4H02 A;  1IL2 A;  1JJ2 A;  3I7F A;  5C44 H;  1RIP A;  2VZA A;  3CCR A;  3OW2 A;  1Z47 A;  1MJC A;  1S72 A;  1N34 L;  2UUA Q;  1N32 Q;  2Z6K A;  4LFC L;  3DLL A;  1NBW A;  1CUK A;  3F2C A;  3S14 H;  2NZO A;  4LF8 Q;  4TVA B;  3RR5 A;  4IO9 A;  3KJO A;  3E9H A;  1HNW Q;  1AE2 A;  2E5L Q;  4A3G H;  3A0J A;  1XMQ Q;  3S24 A;  3UDX A;  4C3H H;  1BKB A;  1E3P A;  2ZJP A;  2FXQ A;  5IE8 A;  1AE3 A;  1V9P A;  3E9I A;  2K5H A;  3GTL H;  4UP8 A;  3J80 c;  3ICE A;  3CAM A;  1YVC A;  4AIM A;  2KHJ A;  1O7I A;  3F8T A;  1QUQ B;  1JE5 A;  1TWH H;  5IT9 c;  4HJ9 A;  3H0G H;  3JAM i;  2Y0S E;  1BBU A;  4DV1 Q;  4L5Q A;  2EIF A;  2QA4 A;  2UUC Q;  4OWT B;  1G51 A;  1PYS B;  4JI0 Q;  1YZ6 A;  4P72 A;  4GKJ Q;  2UXC L;  3I4N G;  1VQG A;  1E22 A;  3ULP A;  4GNX C;  2K75 A;  4DR1 L;  2F4V L;  4POF A;  1PH1 A;  4JI6 L;  2ZTE A;  1K9M C;  1HR0 Q;  1HZB A;  1KXL A;  4DV4 Q;  1LUZ A;  3UDG A;  4DR5 Q;  1XMO Q;  3U4V A;  1PV4 A;  1I50 H;  3A5Z B;  4GLV B;  4P74 A;  4XIG S;  1OXU A;  3PF5 A;  1CKN B;  3TEH B;  2NN6 I;  3ULJ A;  1WFQ A;  4O0A A;  4DR3 L;  1VQP A;  1KRS A;  1IBK Q;  3I55 A;  4GN5 A;  4A3C G;  1A8V A;  2K14 A;  3ZJY C;  3GTJ H;  2EXD A;  2VUM H;  5FJ8 G;  3I4N H;  5AJ3 Q;  2XTI A;  4BBR G;  1XNQ Q;  4BY7 H;  1X65 A;  2CFM A;  4YY3 L;  2R7Z G;  1E1T A;  4LF9 Q;  4LUV A;  5HY6 A;  2R93 H;  1H95 A;  4DR7 L;  4MZ9 A;  3EIV A;  1HH2 P;  3KF6 B;  5GAG C;  3KDF B;  5GAH C;  1UWV A;  1KHI A;  3W5O A;  1CSQ A;  4OWX B;  4DAM A;  1XNR Q;  1QUQ A;  3H15 A;  1X3G A;  4TQU S;  4L5T A;  2WP8 J;  1VQ6 A;  1K83 H;  4R4I A;  3KYH C;  4X66 L;  1HNX L;  4BA2 I;  1DGS A;  5M5Y H;  3S2D H;  1NTG A;  1JT8 A;  2EQS A;  2RHQ B;  3KLW A;  1KAW A;  4PMW A;  2K50 A;  5FJ8 H;  4UY8 C;  1V1Q A;  2Q2H A;  1HR0 W;  3EBE A;  1JMC A;  4BBR H;  2JA6 G;  2R7Z H;  3L2P A;  2UXB L;  3ERS X;  4A3B G;  4DV5 Q;  2B3G A;  1VQ4 A;  1MIU A;  4IOA A;  4JV5 Q;  1IBL L;  2Z6K C;  1GD7 A;  4AQY L;  1CKN A;  1E24 A;  1OXT A;  2Y0S G;  4L5R C;  1PYB A;  3RLO A;  1UE1 A;  4GLA C;  4JOI A;  3ER0 A;  3CP0 A;  4PZ6 A;  4A3I H;  4JI3 L;  3K0X A;  3HOY G;  4BBS H;  3KF8 B;  1K0R A;  4IFD J;  3LGJ A;  4YHH L;  2N49 A;  4NXN Q;  2BA1 A;  2ZJR A;  4DR6 Q;  5C0X J;  1E7Z A;  4DV0 Q;  1OXS C;  2ATW A;  4A3F H;  5JJK A;  2Q2U A;  1G29 1;  3HOU H;  3K80 C;  4B3R L;  2LXK A;  3JAM c;  3KDF A;  3GO5 A;  3GD7 A;  3AYH B;  1QVG A;  3M9B A;  3IRB A;  4OO1 I;  4GN4 B;  1QZH A;  3PUW A;  4JC0 A;  1CKO A;  1Q82 C;  1A63 A;  2DUD A;  4DV7 L;  5M5X H;  4LF6 Q;  3HOY H;  4LUO A;  1P8L A;  1Y14 B;  2I5M X;  3K81 C;  5J3B A;  4C2M H;  5LMU L;  4JI7 Q;  4QY7 A;  3I2Z A;  1X9N A;  4GKK Q;  4IFD G;  3CD6 A;  1J5E L;  2NVT H;  4R4T A;  4DPG A;  4GS3 A;  4X62 L;  3M4P A;  5C0X G;  3F2B A;  1TXY A;  2YTX A;  3NEM A;  3T1Y L;  1VQH A;  1IBM Q;  3FKI G;  4HIM A;  3CC7 A;  1HZA A;  1TWF H;  3MXN B;  2ZM6 Q;  2DGY A;  1G6P A;  2ZJQ A;  4KHP Q;  1YHQ A;  1N8R C;  2RHS B;  4MNO A;  2GVB A;  4JI1 Q;  4JBM A;  3G71 A;  4GOP A;  4B3S Q;  1WI5 A;  1FJG Q;  1X3E A;  1KIX A;  2MO0 A;  4KHZ A;  5IYD G;  2IX0 A;  1L2F A;  4OX9 Q;  3HOV G;  1N33 Q;  3TRZ A;  4POG A;  3M4O H;  2JEA I;  3U50 C;  5C3E G;  3M85 A;  1SN8 A;  3OYY A;  5IYC G;  4EX5 A;  4A3E G;  3L0O A;  3FKI H;  4X65 L;  1LM0 A;  3UE0 A;  3CCQ A;  4HJA A;  1N34 Q;  5GAE C;  4Y52 H;  2MO1 A;  1SMX A;  4IPG A;  4LFC Q;  1I5F A;  2UXD L;  3S1N H;  4MTN A;  4X64 L;  4JBK A;  2RF4 A;  4JI4 L;  4LF5 L;  2Q2I A;  3CC4 A;  2VQE L;  3CC2 A;  3A5U A;  4LFB L;  3HOV H;  4JI2 Q;  1P16 A;  2WAQ E;  4GN3 B;  2ID0 A;  5GAD C;  5C3E H;  2VL6 A;  2HT1 A;  4A3E H;  1YJ9 A;  2ZTD A;  2OCE A;  1IXR A;  2UUA L;  5K36 G;  1D7Q A;  3CMA A;  4DR4 L;  2IHE A;  1VQ5 A;  1U0L A;  4L5S A;  1ASY A;  2R6G A;  3PUY A;  1N36 Q;  1I94 Q;  4XTC S;  1GKH A;  2AWO A;  4JOI C;  4DV6 Q;  2HHH Q;  3S17 H;  2IHF A;  1KD1 C;  1HNZ Q;  4X6A H;  4LF8 L;  4LFA Q;  2OWO A;  2UXC Q;  3TRE A;  5JEA G;  2I5L X;  2F52 A;  1HNW L;  4A93 G;  5M3M G;  1VQK A;  3AFP A;  4JI6 Q;  4QL5 A;  2RCN A;  4QQB X;  1QVC A;  2E8G A;  3CCS A;  3GTM H;  2K52 A;  4FDB A;  4YWM A;  3HOX G;  1E1O A;  1Q1E A;  2UUB L;  5JJL A;  4DUY Q;  4DAY B;  4KI0 A;  4LWC A;  3GDE A;  4HID A;  2YYZ A;  1YHA A;  1Y1W G;  3PO2 G;  1VQE A;  3J7A 5;  3U58 A;  2IY5 B;  2I5H A;  1B70 B;  3PV0 A;  2MFI A;  1XJV A;  1WYD A;  2VW9 A;  4LF4 Q;  1GO3 E;  3PSI A;  1SE8 A;  2UUC L;  4JI0 L;  1K3R A;  1W3S A;  4JYA Q;  2OQK A;  4IPH A;  1EFW A;  1K8G A;  4UPA A;  4WJ3 M;  2KEN A;  5EAY A;  4A93 H;  2BH8 A;  3BJU A;  5M3M H;  1HR0 L;  1KL9 A;  3HKS A;  1PH7 A;  4A3K G;  4DV4 L;  1NMG A;  2PQA A;  3RLF A;  2MNA A;  4JI8 Q;  3HOX H;  4DR5 L;  4DV3 Q;  1XMO L;  1K8A C;  4JBW A;  2JA7 G;  5IP9 G;  3HKZ E;  2JK8 A;  2HIX A;  3S15 H;  1B7Y B;  2E2H H;  1IBK L;  4DR2 Q;  2MQH A;  2GN5 A;  2JA9 A;  2KCT A;  4A3C H;  2NVY H;  2AHO B;  1VCI A;  4UP9 A;  5FLM G;  5JJI A;  4R4Q A;  1YJN A;  1PH2 A;  2JA5 G;  5AJ3 L;  3S1R H;  1SFO H;  1CKM A;  4JCV E;  3TS0 A;  4LF9 L;  2K5V A;  1A62 A;  4DUZ Q;  4R4C A;  1X3F A;  3WWV A;  4DNI A;  2A19 A;  3F2D A;  3NEN A;  4KLK A;  2JA7 H;  1XNR L;  4O2D A;  2ES2 A;  1RL2 A;  3CF5 A;  4GOP B;  2JJQ A;  2E2I H;  4RMF A;  5M3F G;  1CSP A;  1FL0 A;  2E2J H;  4JI3 Q;  1VQJ A;  4YHH Q;  4JI5 L;  4R1J A;  1UEB A;  5FLM H;  3W1B A;  2VY3 A;  3K7U C;  5IWA Q;  3NEL A;  1D8L A;  1Q7Y C;  3FP9 A;  1PH6 A;  3OTO L;  2PI2 A;  4NXM L;  2JA6 H;  4J15 A;  3GTG H;  3I4M G;  1Q12 A;  2NVQ H;  4B3R Q;  4DV5 L;  4YWK A;  4A3B H;  1Q46 A;  4Y7N H;  3TS2 A;  3PCO B;  2UU9 L;  4ALP A;  3Q8D A;  3HOZ G;  2R7D A;  2OTL A;  4B3M Q;  1PVO A;  1WOC A;  5BR8 L;  4C3J H;  2JA8 G;  1LYL A;  4A3J G;  3PIP A;  1YIT A;  4DV2 L;  3PIO A;  5LMU Q;  2KCM A;  4LNQ A;  2N78 A;  1EYG A;  1L1O B;  3K7A H;  4B3T Q;  2CKZ B;  1I3Q H;  3CCJ A;  1XTD A;  4DV0 L;  1J5E Q;  2L15 A;  4C3I H;  3S1M H;  5LMN Q;  4APV A;  2AWN A;  1VQO A;  3I4M H;  3NBH B;  4IPD A;  3T1Y Q;  3HKZ G;  1VQM A;  1GVP A;  4DKA C;  2QGQ A;  2VQF L;  1NE3 A;  1VQL A;  1UE6 A;  3M7N A;  3CPF A;  3CCE A;  3RLN A;  3W1G A;  2JQO A;  3J81 i;  4IFD I;  3T1H Q;  3G4S A;  1XPU A;  3BZK A;  1PFS A;  3UDI A;  4LF7 Q;  4JI7 L;  2D0P A;  5C0X I;  4IJH A;  1YI2 A;  5C4X G;  4GKK L;  3S16 H;  4AYB E;  4A3M G;  2PI2 E;  4K0K Q;  1JJC B;  1HZC A;  3B6Y A;  4YCU A;  3D31 A;  2VS1 A;  4GLX A;  2JEB I;  1IBM L;  3GTK H;  1NMF A;  2OTJ A;  1YNX A;  1TWG H;  3AFQ A;  2ZM6 L;  1C9O A;  3S2H H;  5HGQ A;  2AKW B;  2BA0 A;  2LXJ A;  1EQQ A;  4PZ8 A;  1XPR A;  4KHP L;  2ALY B;  4AH6 A;  1A0I A;  3M3Y H;  2V1C C;  4JI1 L;  5JEA J;  1X54 A;  2PNH A;  3CCU A;  4BBS G;  3KFU A;  4UP7 A;  1PH3 A;  2NVX H;  1L1O A;  1S3O A;  4PG3 A;  3STB D;  5C4X H;  2K4K A;  4OX9 L;  5IYD H;  2XGT A;  2VQE Q;  1N33 L;  1Z9F A;  1SRU A;  5LMN W;  4A3L G;  4LFB Q;  1OXX K;  2PQA B;  3D0F A;  4DK6 C;  1Q86 C;  3M4Q A;  5IYC H;  4PZ7 A;  3HFZ B;  2CWA A;  1K73 C;  1IZ6 A;  1N32 L;  1KRT A;  4QIW E;  4HIO A;  3PUZ A;  5E7N A;  1OTC A;  1YHB A;  4DR4 Q;  1X6O A;  3DM3 A;  3H0G G;  3CXC A;  5DLQ E;  1VQN A;  1TWA H;  1QVF A;  4HJ5 A;  1X56 A;  2GVA A;  1VQC A;  4HJ8 A;  4NB3 A;  3E0E A;  4DR1 Q;  1NY4 A;  2E5L L;  3CCL A;  4P75 A;  2F4V Q;  4BA1 I;  1XMQ L;  1EIY B;  1PH8 A;  1AH9 A;  2F3I A;  2HIV A;  3GTO H;  4JI2 L;  1EQR A;  5ELN A;  1OXV A;  4A3L H;  2IX1 A;  3JC6 6;  1BBW A;  2UUB Q;  2YV5 A;  1V43 A;  2I0Q A;  1I6H H;  1NJI C;  4JG2 A;  3RZD H;  1N36 L;  1I94 L;  4DV1 L;  4DR3 Q;  5ELO A;  4DV6 L;  2HHH L;  3H3V I;  2YU9 H;  2N3S A;  1X55 A;  1N9W A;  1HNZ L;  4GKJ L;  1WCM G;  4LFA L;  2NN6 G;  2VNU D;  2VUM G;  4AYB G;  2YTV A;  1Q1B A;  4BY7 G;  2D62 A;  1KQS A;  5GRO A;  2B63 G;  3H3V H;  1C0A A;  4YY3 Q;  2KHI A;  2R93 G;  4NPS A;  3RN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...