4B3SL

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sL00
2JA5H 3CC4A 4A3GG 2ZM6L 1G291 3UDFA 4DV4Q 4YHHL 1N36Q 4DPGA 2EXDA 4DR4L 3H3VI 3OYYA 4A3DG 3J80i 2GVAA 2JA8H 1SROA 1U5KA 2AWOA 4APVA 3CPFA 4HIOA 1L1OC 3CCQA 3PO3H 2KHIA 3PGZA 3TQYA 4WJ4A 1S3OA 3H0GG 1MIUA 4C3HH 4X64L 5C3EH 2CFMA 1ASZA 1X6OA 3B6YA 4YHHQ 1VQ9A 1E22A 2I5MX 3E9IA 4BY1H 4JYAL 4KLKA 3I4OA 4LF7L 4OWXB 2Q2TA 4AQYL 1WYDA 3EN2A 4DR5Q 3T1YL 2UXBL 1IXRA 1VQCA 4X66Q 3F2CA 3FHWA 3M85A 1JJ2A 3CCRA 4PZ6A 3IRBA 4GOPC 2AWNA 1Q86C 3A74A 1XNQQ 4JC0A 5IYBG 5IYCH 2PQAA 2NN6G 1U0LA 2DGYA 1TWHH 2DUDA 1S40A 1IBLQ 1IL2A 3I4NH 2ZTCA 4DV2Q 1X54A 4A3IH 4NXNQ 2JA9A 1N9WA 5GAEC 2R7DA 2VZAA 2WFWA 3AYHB 1GD7A 1J6QA 5J3BA 1VQ8A 4BXXH 3PUYA 3I4MG 3CCVA 1LYLA 2JEBI 4DUZL 1HZAA 1IYJB 5FLMH 1MJCA 1KC8C 4GKJQ 1W2BA 3S16H 3RLFA 3GTQH 1E1OA 1HZBA 5LMNL 4GLXA 2K5NA 1A62A 3CCMA 1R9TH 1L1OA 1VQMA 4NXML 3AFPA 4B3SQ 4JI4L 2BA1A 4YY3Q 5C44H 3J81i 1KIXA 2UUCQ 4B3RQ 2JE6I 3DLLA 4QIWE 4J15A 1L0WA 4X65Q 1HR0W 2I5LX 3CCUA 3L0OA 5FLMG 4UP8A 1NTGA 2AKWB 2D0OA 2ID0A 1QZHA 4DK6C 4JI8L 5EAYA 4L5SA 3HFZB 5IP9H 1JJCB 4HJAA 2FXQA 2IHEA 1Q81C 2ATWA 4LFBL 2WP8J 2NN6I 3OW2A 3KF6B 2UUCL 4X62L 1UE5A 5C0XI 2VW9A 4LFBQ 1SE8A 1A0IA 1VQGA 4YWLA 4NB3A 4DV7Q 1EYGA 2HHHQ 4B3SL 4A76A 2E8GA 1XPRA 4A3BH 4DV5L 4DR6Q 4YWKA 1IBMQ 5IWAQ 1XPUA 3I7FA 1HJPA 1XNRQ 3HKZE 2RF4A 1JE5A 1AE3A 3HOVH 4B3MQ 3CMEA 4C2MH 2UXCQ 3HOUH 2NVXH 4DV3Q 5GAGC 3E9HA 1GM5A 3HOVG 1JT8A 1VQHA 1FJGL 1OXSC 1Y1VG 3M9BA 2MO0A 2MQHA 2K52A 1EOVA 4A3BG 1QVCA 1PVOA 5M5YH 2MO1A 4AH6A 5BR8L 4HJ7A 4A3FG 3PIPA 1MJEA 4C3IH 2E5LQ 4QJFA 1E1TA 1OTCA 2KHJA 5LMUL 1G6PA 4B3TQ 2KENA 1PA6A 2NVTH 5LMUQ 4KI0A 3FKIH 4GOPB 1DGSA 5ELOA 4A3FH 2OTLA 3J7ZC 5M3FH 1QVFA 4JBWA 1XTDA 2N8NA 1SLJA 4IO9A 3PF4A 4PMWA 1X3FA 5C0XJ 3HOWG 1SMXA 3CW2C 5E7NA 3L2PA 4GKKQ 1PHJA 4OONA 1Y1WH 1VQEA 3BZKA 3E0EA 3K8AA 3UDXA 4JV5L 1LM0A 2JK8A 1MKHA 1VQPA 1M1KC 3AEVA 1HZ9A 1YZ6A 3UE0A 4OX9Q 4DR3L 2ZTDA 3FKIG 4IFDG 4HIKA 1I6HH 2RHQB 2E2JH 2VQFQ 1NMFA 2PI2E 2JA6H 4JBMA 3I55A 2WB1E 1OXTA 1UE7A 2XTIA 4P74A 4HJ8A 1TXYA 1YJWA 1Q12A 1YNXA 5FJ8G 1RL2A 4JI7L 4JV5Q 3I2ZA 3BJUA 3KF8B 3M7NA 4GS3A 2HQLA 1NBWA 1GVPA 4JG2A 1VQ6A 3G71A 4JOIA 2OWOA 3CC7A 4X65L 4A3EH 2B3GA 2F52A 1Q1EA 4JI1L 1SFOH 2VS1A 4OX9L 4IPDA 2BH2A 1WFQA 2JA7G 2PI2A 4DAMA 5IP9G 4B3TL 4LFAQ 1VQ5A 3GTJH 2E5LL 4GOPA 3M4QA 2Z0SA 1KHIA 1X3GA 2K5VA 1EUJA 1O7IA 4LF8Q 4HIDA 3HOZG 1I50H 5AJ3Q 3OTOL 1KQSA 4KHPL 1N32L 3NENA 4BY7G 4X66L 1QUQA 4TVAB 4DKAC 5C44G 2QEXA 4L5TA 2JJQA 2UU9Q 1IZ6A 5JJIA 2GVBA 1KXLA 3GDEA 2K14A 4LF4L 4JI6Q 4OO1I 4DUZQ 2XGTA 2HIVA 1K83H 3CCJA 1SR3A 1K8AC 4LF8L 1VQ4A 5IE8A 4DR3Q 3U4ZA 4GLAC 2N78A 1YEZA 2VNUD 2OQKA 2OCEA 3PUXA 1YITA 3I56A 1I94L 1G51A 3CP0A 4JI6L 2A19A 2WAQG 1KRTA 5JEAG 5IT9c 1N33Q 1VQNA 1WJJA 1EQQA 3GTOH 2I5HA 1TWAH 3FP9A 1HNWQ 3S1RH 1VQFA 3S1MH 2B29A 2QA4A 2R93G 2B63H 3RLOA 4K0KL 4GN5A 2ZJRA 2JEAI 3LGJA 4DV5Q 4DR6L 3K7AH 3RN2A 3HOYH 1D8LA 2Q2UA 1I94Q 1PYBA 3F1ZA 5M3MG 2HHHL 1BVSA 1XMQQ 3S15H 4OXPA 4A3EG 2VL6A 5AJ3L 3OTOQ 4KHPQ 3PV0A 4QGUA 2F3IA 1HH2P 4NPSA 3PUZA 3G4SA 2YU9H 1IBML 1B8AA 4DV0L 3I4NG 1QZGA 1K9MC 1C7YA 3GTMH 2YTYA 1Q1BA 4A3JH 3S14H 1E3PA 3CD6A 3TEHB 2E2HH 1WOCA 3CXCA 3PO2H 2EIFA 1JB7A 2KCTA 4DR7L 4B3ML 3BZCA 3GTKH 1XJVA 2NZHA 3AFQA 3KJOA 5JJKA 1XNRL 2UXDQ 3KYHC 1N34L 2N3SA 3J81c 4A3IG 4A3DH 4LFAL 1L2FA 4DV2L 1Y1VH 4JI3L 1Q82C 1E24A 2JA7H 4P73A 5IP7G 1PH2A 3PSIA 3W1BA 2ASBA 3ER0A 2WB1G 1NJIC 1N34Q 1K0RA 3EIVA 5BR8Q 1KL9A 2ALYB 2R7FA 4JI8Q 4O2DA 4A3LH 1YIJA 2PQAB 2MNAA 1VS0A 4X6AH 3S17H 1N33L 1XNQL 4GKKL 4XTCS 1FGUA 1H95A 4JI4Q 5JEAJ 2Y0SG 1FL0A 2VQFL 4LUVA 2Q2IA 1SN8A 4LUZA 4XIGS 4DV0Q 4LF6L 2Y0SE 2MFIA 3HOYG 5HY6A 2VUMH 3UE1A 3F2BA 4R4TA 1JJGA 4P75A 4DR5L 3T1YQ 1IBLL 1XMQL 3TRZA 1FJGQ 4X62Q 3NBHB 3JAMi 1OXVA 1PV4A 3K7UC 4DV3L 4BA1I 3S1QH 3KFUA 3DM3A 4JYAQ 4IFDJ 4JI5L 2UXCL 1YVCA 3KLWA 3PUWA 2YV5A 1N32Q 4EX5A 4BY7H 1VQBA 5IY0A 2JA8G 1BKBA 4R4OA 4BBRG 2NVYH 4JI7Q 1Y14B 1GKHA 4LFCL 5LMNW 2AHOB 1PH8A 3CCSA 1Q46A 2CQOA 1YI2A 1CKNA 1KAWA 1EFWA 2K75A 4BXXG 2JA6G 4UP7A 3HOUG 1HNXL 5IWAL 4JOIC 3KOJA 4DUYL 3RZDH 3J81j 5LMNQ 4IPGA 1M90C 1UEBA 3JC66 4A93H 2UXBQ 4GKJL 1QUQB 4GNXC 3U58A 5GAHC 2NZOA 3GO5A 1P8LA 4OWTB 2CWPA 1PH6A 5C0XG 1EIYB 1Z9FA 3RZOH 2R93H 2C35B 3EBEA 1YJNA 1I5FA 2IHFA 1VQ7A 1PH5A 1VCIA 3KF6A 4MZ9A 3CMAA 4AYBE 1TWCH 1X55A 1PH7A 2L15A 3A5ZB 2LXKA 1LUZA 3STBD 4DR1Q 1BBUA 4A3LG 1K3RA 4NXMQ 2E2IH 2Q2HA 4DV4L 1N36L 1J5EQ 4RMFA 3I4MH 4L5RC 1YBYA 4TQUS 1YJ9A 3HOWH 4IOAA 4IJHA 5C3EG 3GD7A 4QQBX 3CAMA 4ME3A 1A8VA 1V43A 3H15A 1K8GA 5K36G 3S24A 3U50C 4A3KH 2PNHA 4AQYQ 2R7ZH 4GN4B 1KRSA 3VDYA 4KHZA 2IT1A 1L1OB 1PH9A 1X65A 5C4JH 2HT1A 1Q7YC 2VUMG 2B63G 1RIPA 1KD1C 2I0QA 1K73C 4BA2I 4DR1L 1B7YB 3A5UA 3RN5A 4A3JG 3CPWA 4PZ7A 1X9NA 2YTVA 2IX1A 4DV7L 1E7ZA 1S72A 2ZTEA 4ALPA 4WJ3M 1C9OA 4YCWA 1PH4A 2UU9L 5M3FG 4LF7Q 4LWCA 3PIOA 2D0PA 3GTGH 2H5XA 2R6GA 3KJPA 2LSSA 2Z6KC 4DR2L 1C0AA 4DV6L 1N8RC 4P72A 1OXXK 1W3SA 5C4XH 3CF5A 2BA0A 4Y52H 4FDBA 4DUYQ 2V1CC 1CSPA 4YY3L 4AYBG 3T1HL 2IY5B 3HOZH 4A93G 4JI1Q 4LNQA 3T1HQ 4H02A 1EIFA 2ZJPA 3HKZG 4MTNA 4IJLA 2HIXA 2UUBL 4LF9Q 4DAYB 2KCMA 3NELA 4A3CH 5M3MH 4DR2Q 3KDFB 5GADC 3CQZH 1P16A 4RG1A 5H1SE 4HJ9A 3RLNA 1SRUA 1TWFH 5GQOA 4JI5Q 1J5EL 1NMGA 1HNZQ 4UY8C 4QL5A 1UE1A 1VQIA 1D7QA 3CC2A 4X64Q 2VQEL 4K0KQ 1T9HA 2ZJQA 1PH1A 3H0GH 1V1QA 2N49A 1A63A 2F4VL 2CCZA 3ULLA 1GO3E 5FLXc 2F4VQ 5M5WH 1VQJA 3S1NH 1WI5A 2VY3A 3AQQA 4JI0L 3TS2A 4DR4Q 4O0AA 2OQ0A 1HNZL 4JBJA 3J7A5 1VQDA 1B70B 5C4XG 2R7ZG 2EQSA 1V9PA 3PUVA 2UUAQ 3K81C 1X3EA 1VQOA 2IX0A 4BY1G 1NE3A 2K4KA 3K0XA 3MEFA 3KDFA 4UP9A 4JI2Q 1IBKL 1Z47A 3STBC 1HNXQ 3HOXH 1AE2A 3UDIA 4LF5Q 1FVIA 2BH8A 4BBRH 1HR0L 3CCEA 4A3CG 4JI3Q 3F8TA 4GN3B 4MNOA 1IBKQ 4JI2L 4LFCQ 3S2HH 2JA5G 4A3GH 3HKSA 1VQLA 3A0JA 2K50A 3WWVA 1X56A 3J80c 1JMCA 2RCNA 4AIMA 1WCMG 2WAQE 3BU2A 3M3YH 4DR7Q 1QVGA 4IPCA 4Y7NH 1TWGH 1YHBA 3W1GA 3ICEA 2K5HA 3D31A 3ZJYC 4BBSH 4GNXA 4DV1Q 1CSQA 1EWIA 4PG3A 3RR5A 2R92H 5M5XH 5IP7H 3F2DA 1I3QH 3K80C 1EQRA 1ASYA 3L7ZC 3M4PA 3PCOB 4DV6Q 4LF6Q 4DV1L 1YHQA 2GN5A 4OO1G 2QGQA 3TS0A 1BBWA 3G6EA 2ZM6Q 1AH9A 3MXNB 2CWAA 3Q8DA 1WCMH 2CKZB 1CKMA 2LXJA 5GROA 3W5OA 2A1AA 1Y1WG 3CCLA 2D62A 4A3MG 4B3RL 3UDGA 2R92G 1UWVA 4QY7A 3U4VA 1HNWL 1PYSB 2YYZA 4JCVE 4R4IA 3GTLH 4IPHA 2JQOA 3ULJA 5IYDH 4JBKA 4LF5L 4JI0Q 3G48A 1XPOA 1XMOQ 5JJLA 2ES2A 1VQKA 4UPAA 4GNXB 5IYDG 4OWWB 4IOCA 4L5QA 4A4IA 4EQ5A 1PFSA 5FJ8H 1UE6A 2UXDL 1CKOA 4R1JA 1NY4A 1HR0Q 2AMCB 4LUOA 1XMOL 4HJ5A 4YWMA 3M4OH 3PO2G 2UUAL 4DNIA 4POGA 4BBSG 4R4QA 4GLVB 4DK3C 5HGQA 4HIMA 3PO3G 4LF4Q 1VQAA 2A8VA 3NEMA 4YCVA 5IYBH 4YCUA 5IYCG 1YHAA 3TREA 4PZ8A 4A75A 2PMZE 2RHSB 3ERSX 4LW1A 4NXNL 3H3VH 4R4CA 1LTLA 1PH3A 4P71A 3SGIA 4C3JH 5ELNA 3ULPA 3JAMc 4POFA 3HOXG 1CUKA 3RNUA 5DLQE 4A3KG 3GTPH 4A3MH 1CKNB 2OTJA 3S2DH 1OXUA 2NVQH 3PF5A 2KBNA 4IFDI 2UUBQ 2Z6KA 1Q8KA 3D0FA 2YTXA 2VQEQ 4LF9L 1HZCA
chains in the Genus database with same CATH superfamily
1N36Q 4YHHL 1MBYA 2EXDA 3H3VI 3QIAA 5FOBB 1JB3A 1WD0A 3TQYA 3HRZC 4RCOA 4K0KL 1S5ED 1E22A 2I5MX 3E9IA 4BY1H 3GTLB 2Q2TA 4AQYL 4CKEA 4EGVA 4DR5Q 2UXBL 3SR1A 4NKLA 4ULLA 1I4PA 3M85A 2AWNA 5NUCA 4JC0A 1ZEQX 2PQAA 3HOZB 1S40A 3QOLA 1TWHH 2DUDA 1WD1A 5G3LF 4RGNA 4NXNQ 1T5EA 4J8QA 1N9WA 2R7DA 1I3QB 2VZAA 2WFWA 1GD7A 3AYHB 4F87A 1EU4A 5KNCA 5KYIA 3CCVA 4A3KB 4KY7A 4Y7NB 4DUZL 4KY5A 1TIID 2RSOA 4RAUC 1MJCA 1TVXA 1KC8C 4GKJQ 1W2BA 2ICIA 3S16H 2NN6H 1HZBA 1M4VA 3BVMA 2FJ2A 1A62A 5M5XB 1VQMA 4NXML 5ELFA 4QIWB 1RHPA 2JP1A 1CZWA 3R2IA 1SMYC 3F2UA 5ELEA 1HR0W 3CCUA 5FLMG 2F3VA 1PRTD 4UP8A 2D0OA 2ID0A 2ATWA 3A7LA 4QCLA 2NN6I 3OW2A 3I4LA 1SE8A 1VQGA 4DV7Q 1EYGA 5I2XA 2E8GA 4DV5L 4YWKA 4A3FB 1BNZA 4X3KA 1LTAD 3I7FA 1XNRQ 1BCPB 2A6HD 1AE3A 2DY8A 3CMEA 2UXCQ 3N52A 2NVXH 4DAYA 2EJMA 3I70A 1EWHA 4KD4A 4N9PA 3A8KE 4I7AA 3A7AB 3M9BA 2MO0A 2MQHA 2K52A 2NVQB 1EOVA 5BR8L 1STHA 1SYEA 4DK0A 4B3TQ 2KENA 2NVTH 4KI0A 4GOPB 1DGSA 1ESRA 2BE5D 5EKLA 2F0QA 1QVFA 1XTDA 2F0KA 3BS1A 1SLJA 2TSSA 1FD7D 1WTHA 1JC7A 3CW2C 5E7NA 3L2PA 1PHJA 5CV5A 1PZKD 2EY2A 3BZKA 4H44C 3VR2A 4CJ0B 1MKHA 1YZ6A 3FKIG 4IFDG 5EJWA 1GHKA 1E2WA 2VQFQ 1G91A 4JBMA 1XNQQ 2X69A 1RL2A 4JI7L 3BJUA 1ET6A 4M1UB 5JPMC 5M3MB 2K5QA 2EZVA 4FXKC 3WDNA 1C4QA 4IPDA 5ELDA 2BH2A 4B3TL 5IP9G 5JJZA 5IGCA 3A55A 3GTJH 3CRLC 4ID6A 1L0XB 2Z0SA 2SNMA 1X3GA 2PZWA 3NENA 1O7LA 1PMRA 1TS5A 2G9DA 4TVAB 3NBIA 4EVOA 2R93B 2EVBA 3AMUA 4DK1A 4LF8L 1K8AC 2IJ0A 2OXPA 4GLAC 5C5MA 4FYDA 2VNUD 2OQKA 5CMDA 2BCOA 1EY9A 1JORA 2KQ3A 2A19A 2L0CA 3HOYB 4DU9A 2B2TA 2FINB 1EQQA 1TWAH 4G7ZC 3S1RH 1VQFA 1A2TA 2QA4A 4OO1H 3RLOA 3LGJA 3RN2A 3HOYH 5KGUA 2Q2UA 2HHHL 3BG3A 1XMQQ 1WTPA 2FHTA 4A3EG 2VL6A 4KHPQ 4A3BB 4Z9CB 2K33A 5D14A 1CA6A 4DV0L 1K9MC 2E76C 1XWEA 3AU7A 3CD6A 1D6EC 2XNAC 3AFQA 5JJKA 4KV6A 3GQBA 1STBA 4PQXA 3SK5A 1QE6A 2N3SA 4A3DH 1EY8A 4CKCA 1FGBD 3SE0A 1DYQA 1BBXC 1ENAA 4G7OC 2ASBA 1DOKA 5CR3A 1SBBB 2PQAB 4MN3A 2A6ED 3E6ZX 1XNQL 2B2VA 4TRDA 4JI4Q 2Y0SG 3MWYW 2VQFL 4LUVA 2DN8A 2Q2IA 2EY5A 4LF6L 2NB0A 2VUMH 3F2BA 4P75A 2K32A 1IBLL 5C6AA 1FJGQ 4X62Q 1PV4A 3TSSA 4CDDC 4L8JA 1UNSA 2TMPA 3KBGA 3KLWA 4BY7H 1N32Q 5IY0A 1AN8A 1SYBA 1IHZA 3HOVB 1PFNA 1Y14B 1GKHA 2RQXA 2KHSA 5LMNW 1PH8A 3M3YB 1AEXA 2PO4A 2A69C 5FK9C 1B44D 2JA6G 3HOUG 5IGEA 3RZDH 3J81j 3U58A 1GJXA 2NZOA 3GO5A 1PH6A 5C0XG 1U4PA 4KKSA 3EBEA 1CI3M 1YJNA 4AYBB 5TSSA 3QWNA 1B9MA 1VCIA 3KF6A 3OMCA 4ZAIA 1PH7A 2N55A 3A5ZB 4HSVA 1KDBA 3S15B 1AZPA 2WV6D 1X3QA 3I3CA 4RMFA 4L5RC 3EQLC 4DXGA 3GD7A 3MC0B 3D8GA 4ME3A 1F2ZA 1V43A 5K36G 1YNNC 1B2TA 4A3KH 1ENFA 5EBDA 4GN4B 1SE3A 2HT1A 2E2HB 4G7HC 1U4MA 1KD1C 4B9WA 4BA2I 1B7YB 5CYUA 5CGKA 4IALA 1TWCB 4A3JG 5JEAH 2YTVA 2IX1A 1GUGA 1NNXA 3TP5A 1S72A 1C9OA 5M3FG 3Q6SA 4LWCA 3J80L 3PIOA 1XTCD 1VDZA 3WOEA 1JCKB 1B50A 1OXXK 1W3SA 3TP7A 5M3FB 4FDBA 1HUNA 4YY3L 2NBFA 2IY5B 3HOZH 1MHWC 1U9RA 2F4IA 4H02A 1EIFA 3V05A 3D6CA 2ZJPA 2EYFA 1H9JA 3CQZH 1W6JA 3FEWX 5M5WB 5IT9E 1SRUA 4QL5A 1D7QA 5KEEA 4XQJA 4K0KQ 3H0GH 2N49A 1A63A 4UHVA 3R2TA 5FLXc 4OHJA 2F4VQ 3DEOA 1PZJD 1VQJA 1PTOH 3IFTA 4XXEA 4M8AA 2OQ0A 1HNZL 1PRTB 5C4XG 3MEHA 2UUAQ 3K81C 1X3EA 1E2VA 3DHQA 3K0XA 2NTTA 1ICFB 3P75A 3O13A 3PO3B 3MEFA 1AW7A 1EQTA 1EU3A 3J81L 1Q90A 1HR0L 4WRDA 1IBKQ 4JI2L 4KHVA 2K5WA 4IUVA 2JA5G 4A3GH 1YNND 4KJOA 1T5XD 3HKSA 1EEFD 1JMCA 4CGYB 3M3YH 4DR7Q 4TSSA 3HKZB 4GNXA 1D1KA 1PXUA 2R92H 5T1IA 3NTKA 5IP7H 3LX0A 1TY0A 1EQRA 1V8QA 2WACA 1I6VC 2LMCB 1YHQA 3TS0A 3G6EA 3ONAB 1AH9A 2Z8LA 1WCMH 2XSCA 3Q8DA 4PV1C 4DNRB 3HOWB 4PMBA 2CKZB 1HPCA 3NE5B 5M9OA 1BF4A 2F0OA 3CCLA 1K0SA 1SYDA 2R7ZB 4ZK9B 1HNWL 5IYDH 4BY1B 3GTLH 4LF5L 3H0GB 3G48A 1SSOA 1XPOA 2E2DC 1Y69U 2ES2A 1VQKA 4UPAA 4OWWB 4A4IA 1CQFA 1PFSA 1UE6A 3M4OH 3PO2G 4LUOA 1PFBA 4R4QA 5HGQA 1VQAA 2A8VA 4YIJA 3T13A 1YHAA 4NXNL 2RHSB 3ERSX 4K5XA 4R4CA 1PH3A 4C3JH 1DOMA 5ELNA 4WJWA 4A3KG 3GTPH 4A3MH 2XRQD 1OXUA 1PZID 4P2CB 4IFDI 2Z6KA 2B39A 2XWBB 2JA5H 4A3GG 4DV4Q 1JOKA 4DPGA 4HMJA 1B53A 3OWFA 1SROA 2AWOA 2JA8H 4HTHA 4IUPA 3S1RB 2KHIA 3PGZA 1LTRD 4WJ4A 4CDCC 1RTOA 1SFOB 1S3OA 2CFMA 1ASZA 1X6OA 4YHHQ 5I2YA 1BO0A 3I4OA 5FKAC 4LF7L 5C4HA 1WYDA 4KN4C 5ISRA 2KEEA 4X66Q 2PPBC 4NW2A 3FHWA 1I50B 1JJ2A 4PZ6A 1Q86C 2DY7A 2DGYA 1IL2A 3I4NH 3FPPA 4BBSB 2EYJA 4N8X1 2ZTCA 3NQIA 5A35A 3I91A 5EPLA 4LJZC 3PUYA 3MZ5A 3I4MG 3K59A 1LYLA 2EOTA 2JEBI 1UEAB 1MGSA 1STEA 1IYJB 5C5LA 1CZGA 1EWCA 3NPPA 3RLFA 3I4MB 2VB2X 1E1OA 4MIUA 4GLXA 1LT4D 5IT9L 4A3DB 3OWEB 2BA1A 1LACA 2UUCQ 4B3RQ 3OMGA 3I72A 2CH4A 1NTGA 2AKWB 1QZHA 1LTBD 1S5BD 3HFZB 4HJAA 2WP8J 3FKIB 1PFMA 2H1EA 4X62L 1UE5A 5C0XI 1A0IA 4YWLA 2HHHQ 4NB3A 4B3SL 5COYA 4A3BH 4K5WA 1IBMQ 3Q23A 1HJPA 3VR5A 4C3JG 3HOVH 1LT6D 2EXZA 4B3MQ 1Y1VB 4FNFA 3KBXA 1F2YA 4XDXA 4DV3Q 4R8NA 5GAGC 3E9HA 1YNJD 4PMCA 1GM5A 1VQHA 1ML0D 1OXSC 1Y1VG 5EGTA 2F0WA 4ZYSA 3C1EA 1PVOA 4AH6A 4HJ7A 4C3IH 4CHTB 2E5LQ 1E1TA 1OTCA 3WOFA 4A3FH 4J1MA 1F9QA 3J7ZC 1DJRD 1QJOA 2FFKB 4R9WA 5M3FH 5J22A 2N8NA 4IO9A 1X3FA 2F0LA 2C5CA 5C0XJ 2E2JB 2IL8A 4JV5L 1VQEA 5CV6A 4DR3L 2QF7A 1ZKOA 1I6HH 1XXGA 5CBEE 1NMFA 2JA6H 2XTIA 3OOCA 1TXYA 1Q12A 1YNXA 5FJ8G 2CHBD 3KF8B 4KN7C 2WIIB 2ZXPA 1GVPA 2OWOA 2FMMA 2JA6B 2F52A 1SFOH 2K5DA 3BDCA 1WFQA 4DAMA 4LFAQ 4GOPA 3M4QA 3HEJA 1KHIA 1EUJA 4LF8Q 3OTOL 3S17B 1BXTA 4DA2A 4LF4L 5C4ZA 4DUZQ 2XGTA 3BDLA 4CBVA 1K83H 2B2UA 3J80E 1IYVA 3MXPA 1VQ4A 2N78A 1SNDA 4PNYA 3NWSA 1I94L 1JWUD 3CP0A 1VQNA 5IT9c 1HRJA 5IIFA 3S1MH 2B29A 2B63H 2ZXRA 3P1HA 4DV5Q 3K7AH 1PYBA 1BVSA 3NP8A 5AJ3L 3M4YA 3PV0A 2F3IA 3PUZA 4OIKA 2YU9H 2DNEA 1IBML 1B8AA 1QZGA 2HDLA 2JA7B 5IODA 2KVMA 1SE4A 1Q1BA 3S14H 1KDAA 1DXMA 3MHBA 3TEHB 2ZT9C 1WOCA 2F0UA 2DJFC 1XJVA 4RKLA 1GHJA 4HAEA 3VA5A 3KYHC 4L63B 2E75C 1L2FA 1HA6A 1KABA 1KLUD 3PSIA 3FMCA 5JAVA 3EIVA 5BR8Q 1NJIC 3J81E 1OO9B 4JI8Q 4JPBW 1YIJA 2Z1CA 1K8OA 2R61A 3S17H 1N33L 4GKKL 1FGUA 3K5LA 3IKJA 1FL0A 1I4RA 4CDFC 4DV0Q 1B3QA 1HHVA 3HOYG 3MXNA 2LS01 2GA4B 4U68A 2CW0D 4R4TA 5JVG3 4DR5L 5C3WA 1LO5D 1XMQL 2SNSA 1OXVA 3H6MA 3VR4A 4DV3L 4XT3B 3DM3A 4DF7A 2RKSA 1VQBA 1LTID 2JA8G 4DXFA 4BBRG 4LFCL 2AHOB 3DWQA 3D4DA 3CCSA 1ENCA 1Z7TA 3CRKC 1KAWA 5BN5A 1F9PA 1FNUA 1LABA 5F2DA 2SEBD 1HNXL 5IWAL 4JOIC 3KOJA 5HURA 4DUYL 3OHXC 4FP5D 1UEBA 4A93H 4IUQA 4LMQD 4GKJL 1TR5A 5GAHC 3MXGA 2CWPA 4ME5A 4R8IA 2F0NA 3LWUA 3GTPB 2OF1A 3VYTA 1A3VA 2IHFA 2KA7A 5A2QE 4MZ9A 4AYBE 1TWCH 2X6GA 3STBD 1GUWA 1K3RA 2E2IH 4TKOB 5E3FA 5E4XA 1YBYA 1YJ9A 4V0BA 3FDTA 3CAMA 2J7ZA 5CV9A 1A8VA 1D5ZC 2P5ZX 4AQYQ 2R7ZH 4KHZA 2IT1A 5C4JH 1Q7YC 4BS9A 2B63G 5A2QL 4FO2A 1UUPA 2B8GA 1K73C 2I0QA 4DR1L 3A5UA 3QO2A 1F2LA 2JYOA 4PZ7A 3GTQB 4RA8A 1HTLD 1PH4A 2UU9L 4LF7Q 4X3SA 4C3HG 3AB9A 2A68D 2H5XA 2R6GA 3KJPA 1G2TA 2LSSA 1LT5D 2Z6KC 1N8RC 5C4XH 2BA0A 1Q8IA 1CSPA 2QDLA 3D4WA 3BDOA 2BDNA 1K8MA 4CKBA 4MTNA 4IJLA 2HIXA 2QDBA 3NTHA 4DAYB 5EKKA 1J9OA 1HQRD 2IWHA 4DR2Q 3KDFB 3DWAA 5H1SE 4HJ9A 1IYUA 1TWFH 2J4XA 4MTKA 5GQOA 3K5NA 4JI5Q 5EKIA 1VQIA 1B1ZA 1PH1A 2AQ1B 1DZ1A 2VUMB 1JWSD 3TZDA 2VY3A 4JI0L 3PIO3 4DR4Q 4O0AA 3H09A 4IQZA 1VQDA 1B70B 5J39A 2R7ZG 3ZYYX 1DCZA 1NE3A 4BY1G 2V4DA 1DD2A 2EYOA 3NHHA 3STBC 1HNXQ 2F0JA 3HOXH 1AE2A 5JPNC 3SK6A 4RGMA 4LF5Q 1FVIA 4BBRH 4JI3Q 3F8TA 4MNOA 4LFCQ 3S2HH 1VQLA 3MTSA 3J80c 1EYAA 1NR4A 1X56A 2RCNA 2WAQE 2JXMB 4K6LA 3H3VC 5HGTA 4Y7NH 3W1GA 3ND9A 4PG3A 3VYUA 1I3QH 5KYLA 3QB3A 3L7ZC 3X3NA 4DV6Q 2O5JC 3QG1A 4UAIA 4OO1G 2QGQA 2ZM6Q 4CDEC 4F7XA 3E5SA 1A2UA 4J6HA 3W5OA 2B2YA 1JWMD 1TWFB 4A3MG 1GUOA 1UWVA 5IGBA 4QY7A 3U4VA 4Q5VA 2YYZA 1JQYD 2M2LA 2NUCA 1GUSA 2PNRC 3TMEA 3D6WA 1PTOC 3U9OA 5IYDG 2L1BA 4IOCA 1FNWA 1CKOA 1QILA 2UUAL 4HIMA 3PO3G 2L11A 2HQEA 2RA4A 5IYBH 2JA7H 3TREA 1PRTC 3HOXB 3S1MB 4N9TA 1SAPA 2B8FA 3U9SA 4P71A 1STAA 1BQQT 1NAPA 3K7AB 4HCSA 3JAMc 3HOXG 5DLQE 4DFAA 4RHRA 4Q0FA 2EYMA 2EDGA 2F03A 1HZCA 3CC4A 2ZM6L 1G291 3UDFA 2KECA 1EZ8A 2RSNA 1LT3D 3OYYA 2ZXOA 3J80i 2GVAA 1BDOA 3CPFA 4ABNA 1L1OC 3SK8A 1ZYRD 4IURA 4X64L 1MIUA 4C3HH 5C3EH 1HFNA 3OIQA 4JYAL 4KLKA 2NVXB 5C3XA 3EN2A 1IXRA 1VQCA 2MPMA 2MHVA 3IRBA 4GOPC 4HSPA 4XYQA 4X3TA 5IYCH 5CC4A 2NN6G 1U0LA 4O1NA 1IBLQ 3CKIB 1JR0D 5D65A 1X54A 3EA6A 4ZLTF 5I6YA 4DV2Q 4A3IH 3EROA 2JA9A 2B2WA 5GAEC 5J3BA 2L55A 4BXXH 2XRSD 2F0DA 2F0SA 5L37A 2LY7A 5FLMH 4F8MA 2RBMA 2X6LA 3EFXD 5LMNL 4F88A 2RVLA 3CCMA 1L1OA 4KJNA 4QMGA 4YY3Q 4KKUA 2MUYA 3J81i 2JE6I 3DLLA 2PZUA 4J15A 1Y8NB 2I5LX 3IFDA 3L0OA 5BN3A 5I9PA 1FR3A 3K58A 4DK6C 2K05A 5EAYA 4JI8L 5IP9H 4L5SA 1JJCB 3HZXA 1ICWA 2FXQA 3MFYA 1NCVA 1NUCA 4OELB 3KF6B 2AUJD 4LFBQ 1EY0A 4IFDJ 1TWAB 1KTKA 1XPRA 2WAQB 4EQPA 5IWAQ 1V1PA 3HKZE 3TZUA 1EEID 2RDGA 4C2MH 1EY4A 2NWGA 2MGSA 3HOVG 1JT8A 1FJGL 5LL6X 3SDZA 1QNUA 1S5CD 4A3GB 1A15A 1QVCA 3J7AV 3W3AA 4A3FG 4QJFA 3URYA 2XN9C 2PYKA 3VYSA 5LMUQ 3NTIA 3FKIH 4IFDH 1EYCA 1K83B 4JBWA 2KOLA 2B2YC 3SVMA 3T51B 1LLRD 4FF4A 1SMXA 2B2TC 4GKKQ 2EYHA 3A56A 4JW0A 4H0LC 4KKTA 3E0EA 3K8AA 4EQOA 2JK8A 1VQPA 1M1KC 3FVQA 1HZ9A 2D9UA 4OX9Q 3J7YW 2ZTDA 4HIKA 4C3IB 5FO9B 1EFID 3I55A 2WB1E 1OXTA 1UE7A 2HDMA 4P74A 5G3LD 4HJ8A 1YJWA 4LK1C 3I2ZA 3DMUA 2HQLA 1NBWA 3A54A 3G71A 2NTSA 1SNCA 3CC7A 4X65L 2M00A 2B3GA 2SDFA 1Q1EA 4JI1L 4H7BA 2Q8RE 1H9KA 2PI2A 3BVZA 1F9RA 4KMUC 5IOCA 1HTPA 4ZUIA 3DXJC 4HIDA 1KQSA 5AJ3Q 4BY7G 4X66L 1EY5A 5EPJA 2QEXA 3H94A 4L5TA 3TN2A 3GDEA 4OO1I 3HGBA 2HIVA 1HCZA 2A68C 3CCJA 5IE8A 4DR3Q 3U4ZA 1YEZA 1QG7A 4QF4A 2Q8IB 1TQOA 1V1PB 3I56A 1G51A 1N33Q 2D2CC 3Q0AA 3C1FA 2I5HA 1B4OA 3FP9A 1HA5A 4ZKBB 2R93G 3T4AC 4GN5A 4E6IA 3T16A 2ZJRA 3VA7A 1QOHA 4DR6L 1CHQD 4OL7A 1E2ZA 3S15H 1CA5A 1U4RA 3S2DB 3OTOQ 1TWHB 4QGUA 3TBIB 2K28A 1HH2P 1SYGA 3I4NG 1C7YA 3GTMH 2EY6A 3BYYB 4XQNA 4A3JH 2E2HH 1FYCA 2ICEC 4B3ML 3KJOA 2O2LD 2QEJC 2JSOA 1MI2A 1N34L 3J81c 5DNFA 4DV2L 2EPBA 4JI3L 1Q82C 1PH2A 3ER0A 3SHLA 3OW7A 1KL9A 3L9AX 2ALYB 4DN4M 1EOTA 4O2DA 3MA2B 2HCCA 1WTRA 2MNAA 1VS0A 1S4ZA 1WTQA 4KK7A 2IPKD 1TWGB 1L0YB 4XTCS 1H95A 4U673 4ILWA 5DAUA 2Y0SE 2MFIA 4A93B 5HY6A 2L9HA 4ZCKA 3UE1A 3V96A 3T1YQ 1RTNA 1VMCA 1YNJC 5IGGA 5C4JB 3K7UC 4I7ZC 4BA1I 3S1QH 3KFUA 4JI5L 2UXCL 2YV5A 4EX5A 3N6RA 1EY6A 5K5PA 3NQTA 4JI7Q 3D3RA 2PCFB 1YI2A 2J0TD 2A5HA 1STNA 3A8JE 1PTOD 1SNOA 3X3MA 4JVZA 5AFWA 3R3OA 2L12A 3JC66 1QUQB 1M8AA 1EY7A 1BCPF 1STYA 2O4XA 4CJ1B 2R93H 2EYPA 1I5FA 5C44B 4RWSC 1VQ7A 1EIHA 1ZYRC 1PH5A 5D3IB 2Z4IA 3CMAA 1K28A 1X55A 3HOUB 2L15A 2H4OA 1O7YA 1LUZA 4DR1Q 5CBAE 4CJ2C 3OIPA 4DV4L 3MAQA 3KF8A 3HOWH 2CVRA 4QQBX 5C3EG 4NDXA 3H15A 1K8GA 3E0JA 3S24A 2PNHA 1SNMA 4K5VA 1KRSA 1H9RA 1X65A 2VUMG 1KNEA 1A3TA 1STGA 4QB4A 3NXWA 3CPWA 1X9NA 3CU7A 1O80A 4DV7L 1C48A 1Y1WB 2ZTEA 4ALPA 4WJ3M 4YCWA 3S14B 2OT2A 2E74C 2D0PA 2F3WA 3GTGH 3LWEA 2IW3A 3KK7A 1C0AA 3OSOA 4RCNA 5ELBA 3TDQA 1H9SB 3E3XA 3CF5A 2RCFA 4DUYQ 2F0TA 4ZQ3A 4K2KA 3GV3A 4B9XA 3T1HL 1MSHA 1SEBD 2F0EA 1S5FD 4JI1Q 3T1HQ 4LNQA 3T56B 4A3IB 3S16B 1JOOA 3HKZG 4LF9Q 3SK4A 2KCMA 4C2MB 4A3CH 3MXUA 5GADC 4RG1A 2NVTB 3RLNA 1JOQA 5I6WA 2F0HA 1WTXA 2E2IB 4UY8C 1JE4A 4X64Q 1T9HA 2JA8B 1NR2A 4BBRB 2A6HC 3HS0C 3ULLA 2K6AA 5M5WH 3G6JB 3S1NH 1WI5A 3AQQA 4C1NI 3TS2A 3J7A5 4A3JB 1RKNA 1V9PA 1SMYD 2K4KA 5FLXE 1ESFA 2A73B 1HFGA 5C0XH 3KDFA 4UP9A 4JI2Q 3SEBA 1IBKL 3UDIA 5FLXL 3TP8A 1PRTF 2K03A 2IX3A 5C4XB 4RGOS 1D5MC 3KLSX 2K50A 3WWVA 1WCMG 5KNDA 3EJIA 1KLGD 4IPCA 1R4QB 3ICEA 3K0YA 2K5HA 4HCEA 4BBSH 1Z6HA 4DV1Q 1CSQA 1WCMB 4DAPA 5M5XH 1E0BA 2LFNA 1ASYA 3PCOB 4LF6Q 2GN5A 3FPUB 2G5DA 3MXNB 3GTKB 3PO2B 1CKMA 2BE5C 2D62A 5FO7B 2R92G 1PYSB 4IPHA 2JQOA 4JBKA 1KDCA 1H9MA 1A3UA 1XMOQ 2SOBA 1I4HA 1ZXTA 4L5QA 4EQ5A 3L3OC 5KIXA 1HR0Q 1NY4A 2G9HD 4HJ5A 4YWMA 3CHBD 2CW0C 4DNIA 1TKWB 4LF4Q 2Z6BA 1HXYD 1SE2A 3NEMA 4YCVA 5IYCG 4A75A 4PZ8A 2PMZE 4LW1A 3M7GA 2EJFC 2HCIA 2ENBA 1LTLA 2L5TA 2F0GA 2HUGA 5T1GA 5EPKA 4DAVA 4S3SA 3ULPA 3LNNA 1LTTD 4POFA 3GTGB 3RNUA 1SDFA 1CKNB 3C2PA 2OTJA 3S2DH 3PF5A 3I90A 2UUBQ 3D0FA 1TT2A 3P20A 1PTOB 3CQZB 1AZQA 1D1IA 1K3BC 2RDFA 2DJGC 3VR6A 4ZKCB 4DR4L 4A3DG 2QW7A 1U5KA 4APVA 1O7ZA 4HIOA 3CCQA 1D2BA 4OEMB 3QJYA 1S5DD 1ET9A 5J1ZA 3H0GG 2AQ2B 1C8CA 2PQEA 3JAME 3B6YA 1VQ9A 2NVYB 1XYIA 3K57A 4OWXB 3EVQA 3ITPA 3T1YL 1CT1D 3F2CA 5DEHA 3CCRA 2M9VA 3A74A 1B3AA 5IYBG 1GUNA 5EBCA 2N88A 1QWYA 4RHSA 4G4KA 1Y8PB 2KEDA 2F0PA 1J6QA 4NP5A 1VQ8A 2B2UC 3Q24A 1HZAA 1W6KA 1XX8A 2XVSA 3GTQH 1PYWD 3K5OA 1R9TH 2K5NA 3BZDB 1I6HB 2B2WC 4GZYC 2D5DA 2F0IA 5JOBA 3Q22A 4KTAA 1ILPA 5D3DA 3AFPA 4B3SQ 4JI4L 1JICA 5C44H 2WKDA 3I8ZA 1KIXA 4QIWE 4DGZA 1L0WA 4X65Q 4RH6A 1LTSD 1CQVA 1GUTA 5IGDA 2IHEA 1Q81C 4L6TB 1CHPD 2UUCL 2VW9A 1G8ZD 5DM73 4A76A 2K04A 2WINB 1IKLA 4DR6Q 1AP0A 1DONA 1Q3LA 1QNKA 1XPUA 2RF4A 1JE5A 3IAYA 3HOUH 1HQMC 4KY6A 4QUFA 1VF7A 3V2TA 4IUUA 4A3BG 1F9SA 5M5YH 2MO1A 1MJEA 4FF3A 3T53B 3PIPA 1V1OA 2KHJA 4C3JB 5LMUL 1G6PA 4FF2A 4WFN3 1PA6A 1A6XA 3W2DA 5ELOA 2OTLA 2FMCA 2AQ3B 3PF4A 3NBHA 2F1MA 4PMWA 4FXDA 1I4QA 3HOWG 1CFMA 1EIGA 1KAAA 4OONA 1I4GA 1Y1WH 3UDXA 1LM0A 1UAPA 3AEVA 2Z4HA 3FRPB 3UE0A 2AUKA 2RHQB 2E2JH 1Y8OB 5CV7A 2PI2E 4A3EB 4LFBL 4JV5Q 1RODA 3M7NA 1SJED 2PW5A 3VYRA 4GS3A 1SYFA 3R8BA 4JG2A 1VQ6A 4JOIA 4ODGA 5EQ0A 3UI2A 3RUZA 3S2HB 4A3EH 3GTMB 4OX9L 2VS1A 3H91A 3P7JA 2JA7G 2Z9HA 3MFGA 3I4NB 5LHY1 5CORA 4HMIA 1VQ5A 2BDOA 2E5LL 4FF1A 1KNAA 3PO3H 4ZUJA 1HUMA 2K5VA 1O7IA 3HOZG 1I50H 4KHPL 1N32L 5KRUA 5I9OA 5C44G 1QUQA 1TU2B 4DKAC 4C1NK 3S9WA 2JJQA 4EQNA 1IZ6A 3BVGA 2UU9Q 2GVBA 5JJIA 1KXLA 2K14A 4JI6Q 2C9OA 2QILA 1WTWA 3GTOB 5IGFA 1SR3A 3DEPA 1F77A 5C3EB 2Y0SB 2OCEA 3PUXA 1YITA 4JI6L 3RZOB 1J8IA 2I07B 2WAQG 1KRTA 5JEAG 3GTOH 1WJJA 5LL6S 2L4NA 1HNWQ 1IW7C 2PMZB 2JEAI 4I65A 3QR8A 4KD3A 1D8LA 1F2MA 1I94Q 3F1ZA 5M3MG 1IKMA 2F0FA 4B08A 4OXPA 4K14A 4MHEA 2CQAA 4NPSA 3G4SA 1ONLA 4IZ8A 3PQIA 3NWTA 2YTYA 1RCVD 1E3PA 5CV4A 3CXCA 3PO2H 3GTJB 2EIFA 1JB7A 2KCTA 4DR7L 1RF2D 3BZCA 3GTKH 2NZHA 3DM1A 3M4OB 1SNQA 1XNRL 2UXDQ 2KCNA 1U4LA 2WB1B 4A3IG 3NK9A 4LFAL 1Y1VH 3KLSA 2O5IC 1E24A 3DWPA 4P73A 5IP7G 3W1BA 2WB1G 1N34Q 1K0RA 4C3IG 4RGTA 5KNBA 2R7FA 4A3LH 2HD3A 4X6AH 3VR3A 3TP6A 5JEAJ 1LV9A 1SN8A 4LUZA 4XIGS 1WTOA 2F0VA 3KLRA 1JJGA 3GP7A 3TRZA 1CK1A 2R3ZA 3NBHB 3JAMi 1SJHD 3HP3A 2DNCA 1G6ZA 3SXHA 4A3MB 4JYAQ 1GXDC 3PUWA 1YVCA 1TY2A 3C3LA 2B63B 4IUNA 4BWGB 4NMZA 1BKBA 2K01A 4HN7A 4R4OA 2NVYH 2OEOA 5JVH3 1GOZA 2CQOA 1Q46A 2KUMA 1CKNA 1EFWA 3BYTB 2K75A 3QOJA 4BXXG 4UP7A 2JN4A 5LMNQ 1M90C 4IPGA 3A8IE 2UXBQ 1II3A 4QUCA 4GNXC 4OWTB 1P8LA 1SNPA 1EIYB 3RZOH 1VMPA 1Z9FA 1SYCA 2C35B 4XQQA 2KCCA 4V190 5I4DA 3ND8A 4N8FA 4LAAA 2K1BA 4FVMA 1G2SA 3JAML 5FO8B 2LXKA 4A3LG 4C56C 1TS3A 1BBUA 2B2VC 2PW7A 4NXMQ 2EY1A 2Q2HA 1N36L 1J5EQ 3I4MH 4JK1C 4IOAA 4TQUS 1WVLA 1RDPD 4IJHA 5CV8A 3U50C 3HG9A 1RD9D 3VDYA 1L1OB 1PH9A 3S1QB 1RIPA 1VF5C 1AFPA 3RN5A 2LKVA 1QCBD 1O78A 1WTVA 1E7ZA 4DNTB 3PIP3 1EQVA 3PMFA 4HR7B 1QB5D 4DR2L 4DV6L 4P72A 4ZRZA 2YU9B 3S1NB 4Y52H 2V1CC 2RDHA 3RD4A 4AYBG 2XWJB 1X3PA 4A93G 5K36H 2K7VA 3NUCA 2UUBL 5M5YB 4RKBA 3NELA 5M3MH 3DUZA 4RFBA 1P16A 3G7LA 2MP1A 1J5EL 1NMGA 1HNZQ 1UE1A 1CM9A 3CC2A 1BCPD 1CTMA 2VQEL 1NSNS 2VXWA 4OIJA 2ZJQA 1V1QA 2F4VL 2CCZA 2CH4W 1GO3E 1DOLA 2NZ1D 1PTOF 3ERQA 5ELCA 4JBJA 4IN3A 2MJ8A 2R92B 2EQSA 3PUVA 4IUTA 1VQOA 2IX0A 1EL0A 1TS2A 1FNVA 4WORA 2BOSA 3K6OA 2EYLA 3R93A 1Z47A 4C3HB 2XIWA 1EZ6A 4K8IA 1PDQA 5E1FA 1R4PB 2NYZD 2BH8A 3CCEA 4A3CG 1BOSA 4X3UA 3KUPA 4GN3B 1X32A 1LTGD 4UDUC 3A0JA 4AIMA 3BU2A 1QVGA 1H9SA 1TWGH 2QKIC 1YHBA 2Q8TA 3D31A 2PZTA 3ZJYC 1RJTA 2EJGC 2KJXA 1EWIA 2VB3X 3RR5A 1I4XA 1R9TB 3F2DA 4G57A 4HEDA 1IL8A 3K80C 1MSGA 2QCPX 3M4PA 4DV1L 3GV6A 1BBWA 2CWAA 4H13C 5DM63 3MVVA 2LXJA 5GROA 1DM0B 2A1AA 1D5XC 3OPOA 4K8JA 1Y1WG 3I73A 1EYDA 4FXGC 5BN4A 4B3RL 3UDGA 2A6EC 2A69D 4JCVE 4R4IA 3ULJA 3D4RA 4JI0Q 1B9NA 5JJLA 3C46A 4GNXB 1PLFA 5FJ8H 5E4WC 4K2LA 2UXDL 4O42A 4R1JA 2AMCB 1XMOL 2A74C 3K5MA 4POGA 4BBSG 2I46A 4GLVB 4DK3C 1ILQA 1BR9A 4XYOA 2JA5B 1BCPC 3RMHA 4OGQC 3J7AF 4XT1B 4YCUA 1TS4A 3RZDB 1SXTA 3H3VH 3SGIA 4BY7B 1IW7D 1CUKA 1BUVT 1MD2D 2F0MA 4K6DA 2WKCA 2NVQH 3IL8A 2KBNA 4LF9L 2EE1A 1Q8KA 3NSWA 2YTXA 2VQEQ
chains in the Genus database with same CATH topology
2JA5H 3CC4A 4A3GG 2ZM6L 1G291 3UDFA 4DV4Q 4YHHL 1N36Q 4DPGA 2EXDA 4DR4L 3H3VI 3OYYA 4A3DG 3J80i 2GVAA 2JA8H 1SROA 1U5KA 2AWOA 4APVA 3CPFA 4HIOA 1L1OC 3CCQA 3PO3H 2KHIA 3PGZA 3TQYA 4WJ4A 1S3OA 3H0GG 1MIUA 4C3HH 4X64L 5C3EH 2CFMA 1ASZA 1X6OA 3B6YA 4YHHQ 1VQ9A 1E22A 2I5MX 3E9IA 4BY1H 4JYAL 4KLKA 3I4OA 4LF7L 4OWXB 2Q2TA 4AQYL 1WYDA 3EN2A 4DR5Q 3T1YL 2UXBL 1IXRA 1VQCA 4X66Q 3F2CA 3FHWA 3M85A 1JJ2A 3CCRA 4PZ6A 3IRBA 4GOPC 2AWNA 1Q86C 3A74A 1XNQQ 4JC0A 5IYBG 5IYCH 2PQAA 2NN6G 1U0LA 2DGYA 1TWHH 2DUDA 1S40A 1IBLQ 1IL2A 3I4NH 2ZTCA 4DV2Q 1X54A 4A3IH 4NXNQ 2JA9A 1N9WA 5GAEC 2R7DA 2VZAA 2WFWA 3AYHB 1GD7A 1J6QA 5J3BA 1VQ8A 4BXXH 3PUYA 3I4MG 3CCVA 1LYLA 2JEBI 4DUZL 1HZAA 1IYJB 5FLMH 1MJCA 1KC8C 4GKJQ 1W2BA 3S16H 3RLFA 3GTQH 1E1OA 1HZBA 5LMNL 4GLXA 2K5NA 1A62A 3CCMA 1R9TH 1L1OA 1VQMA 4NXML 3AFPA 4B3SQ 4JI4L 2BA1A 4YY3Q 5C44H 3J81i 1KIXA 2UUCQ 4B3RQ 2JE6I 3DLLA 4QIWE 4J15A 1L0WA 4X65Q 1HR0W 2I5LX 3CCUA 3L0OA 5FLMG 4UP8A 1NTGA 2AKWB 2D0OA 2ID0A 1QZHA 4DK6C 4JI8L 5EAYA 4L5SA 3HFZB 5IP9H 1JJCB 4HJAA 2FXQA 2IHEA 1Q81C 2ATWA 4LFBL 2WP8J 2NN6I 3OW2A 3KF6B 2UUCL 4X62L 1UE5A 5C0XI 2VW9A 4LFBQ 1SE8A 1A0IA 1VQGA 4YWLA 4NB3A 4DV7Q 1EYGA 2HHHQ 4B3SL 4A76A 2E8GA 1XPRA 4A3BH 4DV5L 4DR6Q 4YWKA 1IBMQ 5IWAQ 1XPUA 3I7FA 1HJPA 1XNRQ 3HKZE 2RF4A 1JE5A 1AE3A 3HOVH 4B3MQ 3CMEA 4C2MH 2UXCQ 3HOUH 2NVXH 4DV3Q 5GAGC 3E9HA 1GM5A 3HOVG 1JT8A 1VQHA 1FJGL 1OXSC 1Y1VG 3M9BA 2MO0A 2MQHA 2K52A 1EOVA 4A3BG 1QVCA 1PVOA 5M5YH 2MO1A 4AH6A 5BR8L 4HJ7A 4A3FG 3PIPA 1MJEA 4C3IH 2E5LQ 4QJFA 1E1TA 1OTCA 2KHJA 5LMUL 1G6PA 4B3TQ 2KENA 1PA6A 2NVTH 5LMUQ 4KI0A 3FKIH 4GOPB 1DGSA 5ELOA 4A3FH 2OTLA 3J7ZC 5M3FH 1QVFA 4JBWA 1XTDA 2N8NA 1SLJA 4IO9A 3PF4A 4PMWA 1X3FA 5C0XJ 3HOWG 1SMXA 3CW2C 5E7NA 3L2PA 4GKKQ 1PHJA 4OONA 1Y1WH 1VQEA 3BZKA 3E0EA 3K8AA 3UDXA 4JV5L 1LM0A 2JK8A 1MKHA 1VQPA 1M1KC 3AEVA 1HZ9A 1YZ6A 3UE0A 4OX9Q 4DR3L 2ZTDA 3FKIG 4IFDG 4HIKA 1I6HH 2RHQB 2E2JH 2VQFQ 1NMFA 2PI2E 2JA6H 4JBMA 3I55A 2WB1E 1OXTA 1UE7A 2XTIA 4P74A 4HJ8A 1TXYA 1YJWA 1Q12A 1YNXA 5FJ8G 1RL2A 4JI7L 4JV5Q 3I2ZA 3BJUA 3KF8B 3M7NA 4GS3A 2HQLA 1NBWA 1GVPA 4JG2A 1VQ6A 3G71A 4JOIA 2OWOA 3CC7A 4X65L 4A3EH 2B3GA 2F52A 1Q1EA 4JI1L 1SFOH 2VS1A 4OX9L 4IPDA 2BH2A 1WFQA 2JA7G 2PI2A 4DAMA 5IP9G 4B3TL 4LFAQ 1VQ5A 3GTJH 2E5LL 4GOPA 3M4QA 2Z0SA 1KHIA 1X3GA 2K5VA 1EUJA 1O7IA 4LF8Q 4HIDA 3HOZG 1I50H 5AJ3Q 3OTOL 1KQSA 4KHPL 1N32L 3NENA 4BY7G 4X66L 1QUQA 4TVAB 4DKAC 5C44G 2QEXA 4L5TA 2JJQA 2UU9Q 1IZ6A 5JJIA 2GVBA 1KXLA 3GDEA 2K14A 4LF4L 4JI6Q 4OO1I 4DUZQ 2XGTA 2HIVA 1K83H 3CCJA 1SR3A 1K8AC 4LF8L 1VQ4A 5IE8A 4DR3Q 3U4ZA 4GLAC 2N78A 1YEZA 2VNUD 2OQKA 2OCEA 3PUXA 1YITA 3I56A 1I94L 1G51A 3CP0A 4JI6L 2A19A 2WAQG 1KRTA 5JEAG 5IT9c 1N33Q 1VQNA 1WJJA 1EQQA 3GTOH 2I5HA 1TWAH 3FP9A 1HNWQ 3S1RH 1VQFA 3S1MH 2B29A 2QA4A 2R93G 2B63H 3RLOA 4K0KL 4GN5A 2ZJRA 2JEAI 3LGJA 4DV5Q 4DR6L 3K7AH 3RN2A 3HOYH 1D8LA 2Q2UA 1I94Q 1PYBA 3F1ZA 5M3MG 2HHHL 1BVSA 1XMQQ 3S15H 4OXPA 4A3EG 2VL6A 5AJ3L 3OTOQ 4KHPQ 3PV0A 4QGUA 2F3IA 1HH2P 4NPSA 3PUZA 3G4SA 2YU9H 1IBML 1B8AA 4DV0L 3I4NG 1QZGA 1K9MC 1C7YA 3GTMH 2YTYA 1Q1BA 4A3JH 3S14H 1E3PA 3CD6A 3TEHB 2E2HH 1WOCA 3CXCA 3PO2H 2EIFA 1JB7A 2KCTA 4DR7L 4B3ML 3BZCA 3GTKH 1XJVA 2NZHA 3AFQA 3KJOA 5JJKA 1XNRL 2UXDQ 3KYHC 1N34L 2N3SA 3J81c 4A3IG 4A3DH 4LFAL 1L2FA 4DV2L 1Y1VH 4JI3L 1Q82C 1E24A 2JA7H 4P73A 5IP7G 1PH2A 3PSIA 3W1BA 2ASBA 3ER0A 2WB1G 1NJIC 1N34Q 1K0RA 3EIVA 5BR8Q 1KL9A 2ALYB 2R7FA 4JI8Q 4O2DA 4A3LH 1YIJA 2PQAB 2MNAA 1VS0A 4X6AH 3S17H 1N33L 1XNQL 4GKKL 4XTCS 1FGUA 1H95A 4JI4Q 5JEAJ 2Y0SG 1FL0A 2VQFL 4LUVA 2Q2IA 1SN8A 4LUZA 4XIGS 4DV0Q 4LF6L 2Y0SE 2MFIA 3HOYG 5HY6A 2VUMH 3UE1A 3F2BA 4R4TA 1JJGA 4P75A 4DR5L 3T1YQ 1IBLL 1XMQL 3TRZA 1FJGQ 4X62Q 3NBHB 3JAMi 1OXVA 1PV4A 3K7UC 4DV3L 4BA1I 3S1QH 3KFUA 3DM3A 4JYAQ 4IFDJ 4JI5L 2UXCL 1YVCA 3KLWA 3PUWA 2YV5A 1N32Q 4EX5A 4BY7H 1VQBA 5IY0A 2JA8G 1BKBA 4R4OA 4BBRG 2NVYH 4JI7Q 1Y14B 1GKHA 4LFCL 5LMNW 2AHOB 1PH8A 3CCSA 1Q46A 2CQOA 1YI2A 1CKNA 1KAWA 1EFWA 2K75A 4BXXG 2JA6G 4UP7A 3HOUG 1HNXL 5IWAL 4JOIC 3KOJA 4DUYL 3RZDH 3J81j 5LMNQ 4IPGA 1M90C 1UEBA 3JC66 4A93H 2UXBQ 4GKJL 1QUQB 4GNXC 3U58A 5GAHC 2NZOA 3GO5A 1P8LA 4OWTB 2CWPA 1PH6A 5C0XG 1EIYB 1Z9FA 3RZOH 2R93H 2C35B 3EBEA 1YJNA 1I5FA 2IHFA 1VQ7A 1PH5A 1VCIA 3KF6A 4MZ9A 3CMAA 4AYBE 1TWCH 1X55A 1PH7A 2L15A 3A5ZB 2LXKA 1LUZA 3STBD 4DR1Q 1BBUA 4A3LG 1K3RA 4NXMQ 2E2IH 2Q2HA 4DV4L 1N36L 1J5EQ 4RMFA 3I4MH 4L5RC 1YBYA 4TQUS 1YJ9A 3HOWH 4IOAA 4IJHA 5C3EG 3GD7A 4QQBX 3CAMA 4ME3A 1A8VA 1V43A 3H15A 1K8GA 5K36G 3S24A 3U50C 4A3KH 2PNHA 4AQYQ 2R7ZH 4GN4B 1KRSA 3VDYA 4KHZA 2IT1A 1L1OB 1PH9A 1X65A 5C4JH 2HT1A 1Q7YC 2VUMG 2B63G 1RIPA 1KD1C 2I0QA 1K73C 4BA2I 4DR1L 1B7YB 3A5UA 3RN5A 4A3JG 3CPWA 4PZ7A 1X9NA 2YTVA 2IX1A 4DV7L 1E7ZA 1S72A 2ZTEA 4ALPA 4WJ3M 1C9OA 4YCWA 1PH4A 2UU9L 5M3FG 4LF7Q 4LWCA 3PIOA 2D0PA 3GTGH 2H5XA 2R6GA 3KJPA 2LSSA 2Z6KC 4DR2L 1C0AA 4DV6L 1N8RC 4P72A 1OXXK 1W3SA 5C4XH 3CF5A 2BA0A 4Y52H 4FDBA 4DUYQ 2V1CC 1CSPA 4YY3L 4AYBG 3T1HL 2IY5B 3HOZH 4A93G 4JI1Q 4LNQA 3T1HQ 4H02A 1EIFA 2ZJPA 3HKZG 4MTNA 4IJLA 2HIXA 2UUBL 4LF9Q 4DAYB 2KCMA 3NELA 4A3CH 5M3MH 4DR2Q 3KDFB 5GADC 3CQZH 1P16A 4RG1A 5H1SE 4HJ9A 3RLNA 1SRUA 1TWFH 5GQOA 4JI5Q 1J5EL 1NMGA 1HNZQ 4UY8C 4QL5A 1UE1A 1VQIA 1D7QA 3CC2A 4X64Q 2VQEL 4K0KQ 1T9HA 2ZJQA 1PH1A 3H0GH 1V1QA 2N49A 1A63A 2F4VL 2CCZA 3ULLA 1GO3E 5FLXc 2F4VQ 5M5WH 1VQJA 3S1NH 1WI5A 2VY3A 3AQQA 4JI0L 3TS2A 4DR4Q 4O0AA 2OQ0A 1HNZL 4JBJA 3J7A5 1VQDA 1B70B 5C4XG 2R7ZG 2EQSA 1V9PA 3PUVA 2UUAQ 3K81C 1X3EA 1VQOA 2IX0A 4BY1G 1NE3A 2K4KA 3K0XA 3MEFA 3KDFA 4UP9A 4JI2Q 1IBKL 1Z47A 3STBC 1HNXQ 3HOXH 1AE2A 3UDIA 4LF5Q 1FVIA 2BH8A 4BBRH 1HR0L 3CCEA 4A3CG 4JI3Q 3F8TA 4GN3B 4MNOA 1IBKQ 4JI2L 4LFCQ 3S2HH 2JA5G 4A3GH 3HKSA 1VQLA 3A0JA 2K50A 3WWVA 1X56A 3J80c 1JMCA 2RCNA 4AIMA 1WCMG 2WAQE 3BU2A 3M3YH 4DR7Q 1QVGA 4IPCA 4Y7NH 1TWGH 1YHBA 3W1GA 3ICEA 2K5HA 3D31A 3ZJYC 4BBSH 4GNXA 4DV1Q 1CSQA 1EWIA 4PG3A 3RR5A 2R92H 5M5XH 5IP7H 3F2DA 1I3QH 3K80C 1EQRA 1ASYA 3L7ZC 3M4PA 3PCOB 4DV6Q 4LF6Q 4DV1L 1YHQA 2GN5A 4OO1G 2QGQA 3TS0A 1BBWA 3G6EA 2ZM6Q 1AH9A 3MXNB 2CWAA 3Q8DA 1WCMH 2CKZB 1CKMA 2LXJA 5GROA 3W5OA 2A1AA 1Y1WG 3CCLA 2D62A 4A3MG 4B3RL 3UDGA 2R92G 1UWVA 4QY7A 3U4VA 1HNWL 1PYSB 2YYZA 4JCVE 4R4IA 3GTLH 4IPHA 2JQOA 3ULJA 5IYDH 4JBKA 4LF5L 4JI0Q 3G48A 1XPOA 1XMOQ 5JJLA 2ES2A 1VQKA 4UPAA 4GNXB 5IYDG 4OWWB 4IOCA 4L5QA 4A4IA 4EQ5A 1PFSA 5FJ8H 1UE6A 2UXDL 1CKOA 4R1JA 1NY4A 1HR0Q 2AMCB 4LUOA 1XMOL 4HJ5A 4YWMA 3M4OH 3PO2G 2UUAL 4DNIA 4POGA 4BBSG 4R4QA 4GLVB 4DK3C 5HGQA 4HIMA 3PO3G 4LF4Q 1VQAA 2A8VA 3NEMA 4YCVA 5IYBH 4YCUA 5IYCG 1YHAA 3TREA 4PZ8A 4A75A 2PMZE 2RHSB 3ERSX 4LW1A 4NXNL 3H3VH 4R4CA 1LTLA 1PH3A 4P71A 3SGIA 4C3JH 5ELNA 3ULPA 3JAMc 4POFA 3HOXG 1CUKA 3RNUA 5DLQE 4A3KG 3GTPH 4A3MH 1CKNB 2OTJA 3S2DH 1OXUA 2NVQH 3PF5A 2KBNA 4IFDI 2UUBQ 2Z6KA 1Q8KA 3D0FA 2YTXA 2VQEQ 4LF9L 1HZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 H;  3CC4 A;  4A3G G;  2ZM6 L;  1G29 1;  3UDF A;  4DV4 Q;  4YHH L;  1N36 Q;  4DPG A;  2EXD A;  4DR4 L;  3H3V I;  3OYY A;  4A3D G;  3J80 i;  2GVA A;  2JA8 H;  1SRO A;  1U5K A;  2AWO A;  4APV A;  3CPF A;  4HIO A;  1L1O C;  3CCQ A;  3PO3 H;  2KHI A;  3PGZ A;  3TQY A;  4WJ4 A;  1S3O A;  3H0G G;  1MIU A;  4C3H H;  4X64 L;  5C3E H;  2CFM A;  1ASZ A;  1X6O A;  3B6Y A;  4YHH Q;  1VQ9 A;  1E22 A;  2I5M X;  3E9I A;  4BY1 H;  4JYA L;  4KLK A;  3I4O A;  4LF7 L;  4OWX B;  2Q2T A;  4AQY L;  1WYD A;  3EN2 A;  4DR5 Q;  3T1Y L;  2UXB L;  1IXR A;  1VQC A;  4X66 Q;  3F2C A;  3FHW A;  3M85 A;  1JJ2 A;  3CCR A;  4PZ6 A;  3IRB A;  4GOP C;  2AWN A;  1Q86 C;  3A74 A;  1XNQ Q;  4JC0 A;  5IYB G;  5IYC H;  2PQA A;  2NN6 G;  1U0L A;  2DGY A;  1TWH H;  2DUD A;  1S40 A;  1IBL Q;  1IL2 A;  3I4N H;  2ZTC A;  4DV2 Q;  1X54 A;  4A3I H;  4NXN Q;  2JA9 A;  1N9W A;  5GAE C;  2R7D A;  2VZA A;  2WFW A;  3AYH B;  1GD7 A;  1J6Q A;  5J3B A;  1VQ8 A;  4BXX H;  3PUY A;  3I4M G;  3CCV A;  1LYL A;  2JEB I;  4DUZ L;  1HZA A;  1IYJ B;  5FLM H;  1MJC A;  1KC8 C;  4GKJ Q;  1W2B A;  3S16 H;  3RLF A;  3GTQ H;  1E1O A;  1HZB A;  5LMN L;  4GLX A;  2K5N A;  1A62 A;  3CCM A;  1R9T H;  1L1O A;  1VQM A;  4NXM L;  3AFP A;  4B3S Q;  4JI4 L;  2BA1 A;  4YY3 Q;  5C44 H;  3J81 i;  1KIX A;  2UUC Q;  4B3R Q;  2JE6 I;  3DLL A;  4QIW E;  4J15 A;  1L0W A;  4X65 Q;  1HR0 W;  2I5L X;  3CCU A;  3L0O A;  5FLM G;  4UP8 A;  1NTG A;  2AKW B;  2D0O A;  2ID0 A;  1QZH A;  4DK6 C;  4JI8 L;  5EAY A;  4L5S A;  3HFZ B;  5IP9 H;  1JJC B;  4HJA A;  2FXQ A;  2IHE A;  1Q81 C;  2ATW A;  4LFB L;  2WP8 J;  2NN6 I;  3OW2 A;  3KF6 B;  2UUC L;  4X62 L;  1UE5 A;  5C0X I;  2VW9 A;  4LFB Q;  1SE8 A;  1A0I A;  1VQG A;  4YWL A;  4NB3 A;  4DV7 Q;  1EYG A;  2HHH Q;  4B3S L;  4A76 A;  2E8G A;  1XPR A;  4A3B H;  4DV5 L;  4DR6 Q;  4YWK A;  1IBM Q;  5IWA Q;  1XPU A;  3I7F A;  1HJP A;  1XNR Q;  3HKZ E;  2RF4 A;  1JE5 A;  1AE3 A;  3HOV H;  4B3M Q;  3CME A;  4C2M H;  2UXC Q;  3HOU H;  2NVX H;  4DV3 Q;  5GAG C;  3E9H A;  1GM5 A;  3HOV G;  1JT8 A;  1VQH A;  1FJG L;  1OXS C;  1Y1V G;  3M9B A;  2MO0 A;  2MQH A;  2K52 A;  1EOV A;  4A3B G;  1QVC A;  1PVO A;  5M5Y H;  2MO1 A;  4AH6 A;  5BR8 L;  4HJ7 A;  4A3F G;  3PIP A;  1MJE A;  4C3I H;  2E5L Q;  4QJF A;  1E1T A;  1OTC A;  2KHJ A;  5LMU L;  1G6P A;  4B3T Q;  2KEN A;  1PA6 A;  2NVT H;  5LMU Q;  4KI0 A;  3FKI H;  4GOP B;  1DGS A;  5ELO A;  4A3F H;  2OTL A;  3J7Z C;  5M3F H;  1QVF A;  4JBW A;  1XTD A;  2N8N A;  1SLJ A;  4IO9 A;  3PF4 A;  4PMW A;  1X3F A;  5C0X J;  3HOW G;  1SMX A;  3CW2 C;  5E7N A;  3L2P A;  4GKK Q;  1PHJ A;  4OON A;  1Y1W H;  1VQE A;  3BZK A;  3E0E A;  3K8A A;  3UDX A;  4JV5 L;  1LM0 A;  2JK8 A;  1MKH A;  1VQP A;  1M1K C;  3AEV A;  1HZ9 A;  1YZ6 A;  3UE0 A;  4OX9 Q;  4DR3 L;  2ZTD A;  3FKI G;  4IFD G;  4HIK A;  1I6H H;  2RHQ B;  2E2J H;  2VQF Q;  1NMF A;  2PI2 E;  2JA6 H;  4JBM A;  3I55 A;  2WB1 E;  1OXT A;  1UE7 A;  2XTI A;  4P74 A;  4HJ8 A;  1TXY A;  1YJW A;  1Q12 A;  1YNX A;  5FJ8 G;  1RL2 A;  4JI7 L;  4JV5 Q;  3I2Z A;  3BJU A;  3KF8 B;  3M7N A;  4GS3 A;  2HQL A;  1NBW A;  1GVP A;  4JG2 A;  1VQ6 A;  3G71 A;  4JOI A;  2OWO A;  3CC7 A;  4X65 L;  4A3E H;  2B3G A;  2F52 A;  1Q1E A;  4JI1 L;  1SFO H;  2VS1 A;  4OX9 L;  4IPD A;  2BH2 A;  1WFQ A;  2JA7 G;  2PI2 A;  4DAM A;  5IP9 G;  4B3T L;  4LFA Q;  1VQ5 A;  3GTJ H;  2E5L L;  4GOP A;  3M4Q A;  2Z0S A;  1KHI A;  1X3G A;  2K5V A;  1EUJ A;  1O7I A;  4LF8 Q;  4HID A;  3HOZ G;  1I50 H;  5AJ3 Q;  3OTO L;  1KQS A;  4KHP L;  1N32 L;  3NEN A;  4BY7 G;  4X66 L;  1QUQ A;  4TVA B;  4DKA C;  5C44 G;  2QEX A;  4L5T A;  2JJQ A;  2UU9 Q;  1IZ6 A;  5JJI A;  2GVB A;  1KXL A;  3GDE A;  2K14 A;  4LF4 L;  4JI6 Q;  4OO1 I;  4DUZ Q;  2XGT A;  2HIV A;  1K83 H;  3CCJ A;  1SR3 A;  1K8A C;  4LF8 L;  1VQ4 A;  5IE8 A;  4DR3 Q;  3U4Z A;  4GLA C;  2N78 A;  1YEZ A;  2VNU D;  2OQK A;  2OCE A;  3PUX A;  1YIT A;  3I56 A;  1I94 L;  1G51 A;  3CP0 A;  4JI6 L;  2A19 A;  2WAQ G;  1KRT A;  5JEA G;  5IT9 c;  1N33 Q;  1VQN A;  1WJJ A;  1EQQ A;  3GTO H;  2I5H A;  1TWA H;  3FP9 A;  1HNW Q;  3S1R H;  1VQF A;  3S1M H;  2B29 A;  2QA4 A;  2R93 G;  2B63 H;  3RLO A;  4K0K L;  4GN5 A;  2ZJR A;  2JEA I;  3LGJ A;  4DV5 Q;  4DR6 L;  3K7A H;  3RN2 A;  3HOY H;  1D8L A;  2Q2U A;  1I94 Q;  1PYB A;  3F1Z A;  5M3M G;  2HHH L;  1BVS A;  1XMQ Q;  3S15 H;  4OXP A;  4A3E G;  2VL6 A;  5AJ3 L;  3OTO Q;  4KHP Q;  3PV0 A;  4QGU A;  2F3I A;  1HH2 P;  4NPS A;  3PUZ A;  3G4S A;  2YU9 H;  1IBM L;  1B8A A;  4DV0 L;  3I4N G;  1QZG A;  1K9M C;  1C7Y A;  3GTM H;  2YTY A;  1Q1B A;  4A3J H;  3S14 H;  1E3P A;  3CD6 A;  3TEH B;  2E2H H;  1WOC A;  3CXC A;  3PO2 H;  2EIF A;  1JB7 A;  2KCT A;  4DR7 L;  4B3M L;  3BZC A;  3GTK H;  1XJV A;  2NZH A;  3AFQ A;  3KJO A;  5JJK A;  1XNR L;  2UXD Q;  3KYH C;  1N34 L;  2N3S A;  3J81 c;  4A3I G;  4A3D H;  4LFA L;  1L2F A;  4DV2 L;  1Y1V H;  4JI3 L;  1Q82 C;  1E24 A;  2JA7 H;  4P73 A;  5IP7 G;  1PH2 A;  3PSI A;  3W1B A;  2ASB A;  3ER0 A;  2WB1 G;  1NJI C;  1N34 Q;  1K0R A;  3EIV A;  5BR8 Q;  1KL9 A;  2ALY B;  2R7F A;  4JI8 Q;  4O2D A;  4A3L H;  1YIJ A;  2PQA B;  2MNA A;  1VS0 A;  4X6A H;  3S17 H;  1N33 L;  1XNQ L;  4GKK L;  4XTC S;  1FGU A;  1H95 A;  4JI4 Q;  5JEA J;  2Y0S G;  1FL0 A;  2VQF L;  4LUV A;  2Q2I A;  1SN8 A;  4LUZ A;  4XIG S;  4DV0 Q;  4LF6 L;  2Y0S E;  2MFI A;  3HOY G;  5HY6 A;  2VUM H;  3UE1 A;  3F2B A;  4R4T A;  1JJG A;  4P75 A;  4DR5 L;  3T1Y Q;  1IBL L;  1XMQ L;  3TRZ A;  1FJG Q;  4X62 Q;  3NBH B;  3JAM i;  1OXV A;  1PV4 A;  3K7U C;  4DV3 L;  4BA1 I;  3S1Q H;  3KFU A;  3DM3 A;  4JYA Q;  4IFD J;  4JI5 L;  2UXC L;  1YVC A;  3KLW A;  3PUW A;  2YV5 A;  1N32 Q;  4EX5 A;  4BY7 H;  1VQB A;  5IY0 A;  2JA8 G;  1BKB A;  4R4O A;  4BBR G;  2NVY H;  4JI7 Q;  1Y14 B;  1GKH A;  4LFC L;  5LMN W;  2AHO B;  1PH8 A;  3CCS A;  1Q46 A;  2CQO A;  1YI2 A;  1CKN A;  1KAW A;  1EFW A;  2K75 A;  4BXX G;  2JA6 G;  4UP7 A;  3HOU G;  1HNX L;  5IWA L;  4JOI C;  3KOJ A;  4DUY L;  3RZD H;  3J81 j;  5LMN Q;  4IPG A;  1M90 C;  1UEB A;  3JC6 6;  4A93 H;  2UXB Q;  4GKJ L;  1QUQ B;  4GNX C;  3U58 A;  5GAH C;  2NZO A;  3GO5 A;  1P8L A;  4OWT B;  2CWP A;  1PH6 A;  5C0X G;  1EIY B;  1Z9F A;  3RZO H;  2R93 H;  2C35 B;  3EBE A;  1YJN A;  1I5F A;  2IHF A;  1VQ7 A;  1PH5 A;  1VCI A;  3KF6 A;  4MZ9 A;  3CMA A;  4AYB E;  1TWC H;  1X55 A;  1PH7 A;  2L15 A;  3A5Z B;  2LXK A;  1LUZ A;  3STB D;  4DR1 Q;  1BBU A;  4A3L G;  1K3R A;  4NXM Q;  2E2I H;  2Q2H A;  4DV4 L;  1N36 L;  1J5E Q;  4RMF A;  3I4M H;  4L5R C;  1YBY A;  4TQU S;  1YJ9 A;  3HOW H;  4IOA A;  4IJH A;  5C3E G;  3GD7 A;  4QQB X;  3CAM A;  4ME3 A;  1A8V A;  1V43 A;  3H15 A;  1K8G A;  5K36 G;  3S24 A;  3U50 C;  4A3K H;  2PNH A;  4AQY Q;  2R7Z H;  4GN4 B;  1KRS A;  3VDY A;  4KHZ A;  2IT1 A;  1L1O B;  1PH9 A;  1X65 A;  5C4J H;  2HT1 A;  1Q7Y C;  2VUM G;  2B63 G;  1RIP A;  1KD1 C;  2I0Q A;  1K73 C;  4BA2 I;  4DR1 L;  1B7Y B;  3A5U A;  3RN5 A;  4A3J G;  3CPW A;  4PZ7 A;  1X9N A;  2YTV A;  2IX1 A;  4DV7 L;  1E7Z A;  1S72 A;  2ZTE A;  4ALP A;  4WJ3 M;  1C9O A;  4YCW A;  1PH4 A;  2UU9 L;  5M3F G;  4LF7 Q;  4LWC A;  3PIO A;  2D0P A;  3GTG H;  2H5X A;  2R6G A;  3KJP A;  2LSS A;  2Z6K C;  4DR2 L;  1C0A A;  4DV6 L;  1N8R C;  4P72 A;  1OXX K;  1W3S A;  5C4X H;  3CF5 A;  2BA0 A;  4Y52 H;  4FDB A;  4DUY Q;  2V1C C;  1CSP A;  4YY3 L;  4AYB G;  3T1H L;  2IY5 B;  3HOZ H;  4A93 G;  4JI1 Q;  4LNQ A;  3T1H Q;  4H02 A;  1EIF A;  2ZJP A;  3HKZ G;  4MTN A;  4IJL A;  2HIX A;  2UUB L;  4LF9 Q;  4DAY B;  2KCM A;  3NEL A;  4A3C H;  5M3M H;  4DR2 Q;  3KDF B;  5GAD C;  3CQZ H;  1P16 A;  4RG1 A;  5H1S E;  4HJ9 A;  3RLN A;  1SRU A;  1TWF H;  5GQO A;  4JI5 Q;  1J5E L;  1NMG A;  1HNZ Q;  4UY8 C;  4QL5 A;  1UE1 A;  1VQI A;  1D7Q A;  3CC2 A;  4X64 Q;  2VQE L;  4K0K Q;  1T9H A;  2ZJQ A;  1PH1 A;  3H0G H;  1V1Q A;  2N49 A;  1A63 A;  2F4V L;  2CCZ A;  3ULL A;  1GO3 E;  5FLX c;  2F4V Q;  5M5W H;  1VQJ A;  3S1N H;  1WI5 A;  2VY3 A;  3AQQ A;  4JI0 L;  3TS2 A;  4DR4 Q;  4O0A A;  2OQ0 A;  1HNZ L;  4JBJ A;  3J7A 5;  1VQD A;  1B70 B;  5C4X G;  2R7Z G;  2EQS A;  1V9P A;  3PUV A;  2UUA Q;  3K81 C;  1X3E A;  1VQO A;  2IX0 A;  4BY1 G;  1NE3 A;  2K4K A;  3K0X A;  3MEF A;  3KDF A;  4UP9 A;  4JI2 Q;  1IBK L;  1Z47 A;  3STB C;  1HNX Q;  3HOX H;  1AE2 A;  3UDI A;  4LF5 Q;  1FVI A;  2BH8 A;  4BBR H;  1HR0 L;  3CCE A;  4A3C G;  4JI3 Q;  3F8T A;  4GN3 B;  4MNO A;  1IBK Q;  4JI2 L;  4LFC Q;  3S2H H;  2JA5 G;  4A3G H;  3HKS A;  1VQL A;  3A0J A;  2K50 A;  3WWV A;  1X56 A;  3J80 c;  1JMC A;  2RCN A;  4AIM A;  1WCM G;  2WAQ E;  3BU2 A;  3M3Y H;  4DR7 Q;  1QVG A;  4IPC A;  4Y7N H;  1TWG H;  1YHB A;  3W1G A;  3ICE A;  2K5H A;  3D31 A;  3ZJY C;  4BBS H;  4GNX A;  4DV1 Q;  1CSQ A;  1EWI A;  4PG3 A;  3RR5 A;  2R92 H;  5M5X H;  5IP7 H;  3F2D A;  1I3Q H;  3K80 C;  1EQR A;  1ASY A;  3L7Z C;  3M4P A;  3PCO B;  4DV6 Q;  4LF6 Q;  4DV1 L;  1YHQ A;  2GN5 A;  4OO1 G;  2QGQ A;  3TS0 A;  1BBW A;  3G6E A;  2ZM6 Q;  1AH9 A;  3MXN B;  2CWA A;  3Q8D A;  1WCM H;  2CKZ B;  1CKM A;  2LXJ A;  5GRO A;  3W5O A;  2A1A A;  1Y1W G;  3CCL A;  2D62 A;  4A3M G;  4B3R L;  3UDG A;  2R92 G;  1UWV A;  4QY7 A;  3U4V A;  1HNW L;  1PYS B;  2YYZ A;  4JCV E;  4R4I A;  3GTL H;  4IPH A;  2JQO A;  3ULJ A;  5IYD H;  4JBK A;  4LF5 L;  4JI0 Q;  3G48 A;  1XPO A;  1XMO Q;  5JJL A;  2ES2 A;  1VQK A;  4UPA A;  4GNX B;  5IYD G;  4OWW B;  4IOC A;  4L5Q A;  4A4I A;  4EQ5 A;  1PFS A;  5FJ8 H;  1UE6 A;  2UXD L;  1CKO A;  4R1J A;  1NY4 A;  1HR0 Q;  2AMC B;  4LUO A;  1XMO L;  4HJ5 A;  4YWM A;  3M4O H;  3PO2 G;  2UUA L;  4DNI A;  4POG A;  4BBS G;  4R4Q A;  4GLV B;  4DK3 C;  5HGQ A;  4HIM A;  3PO3 G;  4LF4 Q;  1VQA A;  2A8V A;  3NEM A;  4YCV A;  5IYB H;  4YCU A;  5IYC G;  1YHA A;  3TRE A;  4PZ8 A;  4A75 A;  2PMZ E;  2RHS B;  3ERS X;  4LW1 A;  4NXN L;  3H3V H;  4R4C A;  1LTL A;  1PH3 A;  4P71 A;  3SGI A;  4C3J H;  5ELN A;  3ULP A;  3JAM c;  4POF A;  3HOX G;  1CUK A;  3RNU A;  5DLQ E;  4A3K G;  3GTP H;  4A3M H;  1CKN B;  2OTJ A;  3S2D H;  1OXU A;  2NVQ H;  3PF5 A;  2KBN A;  4IFD I;  2UUB Q;  2Z6K A;  1Q8K A;  3D0F A;  2YTX A;  2VQE Q;  4LF9 L;  1HZC A; 
#chains in the Genus database with same CATH topology
 1N36 Q;  4YHH L;  1MBY A;  2EXD A;  3H3V I;  3QIA A;  5FOB B;  1JB3 A;  1WD0 A;  3TQY A;  3HRZ C;  4RCO A;  4K0K L;  1S5E D;  1E22 A;  2I5M X;  3E9I A;  4BY1 H;  3GTL B;  2Q2T A;  4AQY L;  4CKE A;  4EGV A;  4DR5 Q;  2UXB L;  3SR1 A;  4NKL A;  4ULL A;  1I4P A;  3M85 A;  2AWN A;  5NUC A;  4JC0 A;  1ZEQ X;  2PQA A;  3HOZ B;  1S40 A;  3QOL A;  1TWH H;  2DUD A;  1WD1 A;  5G3L F;  4RGN A;  4NXN Q;  1T5E A;  4J8Q A;  1N9W A;  2R7D A;  1I3Q B;  2VZA A;  2WFW A;  1GD7 A;  3AYH B;  4F87 A;  1EU4 A;  5KNC A;  5KYI A;  3CCV A;  4A3K B;  4KY7 A;  4Y7N B;  4DUZ L;  4KY5 A;  1TII D;  2RSO A;  4RAU C;  1MJC A;  1TVX A;  1KC8 C;  4GKJ Q;  1W2B A;  2ICI A;  3S16 H;  2NN6 H;  1HZB A;  1M4V A;  3BVM A;  2FJ2 A;  1A62 A;  5M5X B;  1VQM A;  4NXM L;  5ELF A;  4QIW B;  1RHP A;  2JP1 A;  1CZW A;  3R2I A;  1SMY C;  3F2U A;  5ELE A;  1HR0 W;  3CCU A;  5FLM G;  2F3V A;  1PRT D;  4UP8 A;  2D0O A;  2ID0 A;  2ATW A;  3A7L A;  4QCL A;  2NN6 I;  3OW2 A;  3I4L A;  1SE8 A;  1VQG A;  4DV7 Q;  1EYG A;  5I2X A;  2E8G A;  4DV5 L;  4YWK A;  4A3F B;  1BNZ A;  4X3K A;  1LTA D;  3I7F A;  1XNR Q;  1BCP B;  2A6H D;  1AE3 A;  2DY8 A;  3CME A;  2UXC Q;  3N52 A;  2NVX H;  4DAY A;  2EJM A;  3I70 A;  1EWH A;  4KD4 A;  4N9P A;  3A8K E;  4I7A A;  3A7A B;  3M9B A;  2MO0 A;  2MQH A;  2K52 A;  2NVQ B;  1EOV A;  5BR8 L;  1STH A;  1SYE A;  4DK0 A;  4B3T Q;  2KEN A;  2NVT H;  4KI0 A;  4GOP B;  1DGS A;  1ESR A;  2BE5 D;  5EKL A;  2F0Q A;  1QVF A;  1XTD A;  2F0K A;  3BS1 A;  1SLJ A;  2TSS A;  1FD7 D;  1WTH A;  1JC7 A;  3CW2 C;  5E7N A;  3L2P A;  1PHJ A;  5CV5 A;  1PZK D;  2EY2 A;  3BZK A;  4H44 C;  3VR2 A;  4CJ0 B;  1MKH A;  1YZ6 A;  3FKI G;  4IFD G;  5EJW A;  1GHK A;  1E2W A;  2VQF Q;  1G91 A;  4JBM A;  1XNQ Q;  2X69 A;  1RL2 A;  4JI7 L;  3BJU A;  1ET6 A;  4M1U B;  5JPM C;  5M3M B;  2K5Q A;  2EZV A;  4FXK C;  3WDN A;  1C4Q A;  4IPD A;  5ELD A;  2BH2 A;  4B3T L;  5IP9 G;  5JJZ A;  5IGC A;  3A55 A;  3GTJ H;  3CRL C;  4ID6 A;  1L0X B;  2Z0S A;  2SNM A;  1X3G A;  2PZW A;  3NEN A;  1O7L A;  1PMR A;  1TS5 A;  2G9D A;  4TVA B;  3NBI A;  4EVO A;  2R93 B;  2EVB A;  3AMU A;  4DK1 A;  4LF8 L;  1K8A C;  2IJ0 A;  2OXP A;  4GLA C;  5C5M A;  4FYD A;  2VNU D;  2OQK A;  5CMD A;  2BCO A;  1EY9 A;  1JOR A;  2KQ3 A;  2A19 A;  2L0C A;  3HOY B;  4DU9 A;  2B2T A;  2FIN B;  1EQQ A;  1TWA H;  4G7Z C;  3S1R H;  1VQF A;  1A2T A;  2QA4 A;  4OO1 H;  3RLO A;  3LGJ A;  3RN2 A;  3HOY H;  5KGU A;  2Q2U A;  2HHH L;  3BG3 A;  1XMQ Q;  1WTP A;  2FHT A;  4A3E G;  2VL6 A;  4KHP Q;  4A3B B;  4Z9C B;  2K33 A;  5D14 A;  1CA6 A;  4DV0 L;  1K9M C;  2E76 C;  1XWE A;  3AU7 A;  3CD6 A;  1D6E C;  2XNA C;  3AFQ A;  5JJK A;  4KV6 A;  3GQB A;  1STB A;  4PQX A;  3SK5 A;  1QE6 A;  2N3S A;  4A3D H;  1EY8 A;  4CKC A;  1FGB D;  3SE0 A;  1DYQ A;  1BBX C;  1ENA A;  4G7O C;  2ASB A;  1DOK A;  5CR3 A;  1SBB B;  2PQA B;  4MN3 A;  2A6E D;  3E6Z X;  1XNQ L;  2B2V A;  4TRD A;  4JI4 Q;  2Y0S G;  3MWY W;  2VQF L;  4LUV A;  2DN8 A;  2Q2I A;  2EY5 A;  4LF6 L;  2NB0 A;  2VUM H;  3F2B A;  4P75 A;  2K32 A;  1IBL L;  5C6A A;  1FJG Q;  4X62 Q;  1PV4 A;  3TSS A;  4CDD C;  4L8J A;  1UNS A;  2TMP A;  3KBG A;  3KLW A;  4BY7 H;  1N32 Q;  5IY0 A;  1AN8 A;  1SYB A;  1IHZ A;  3HOV B;  1PFN A;  1Y14 B;  1GKH A;  2RQX A;  2KHS A;  5LMN W;  1PH8 A;  3M3Y B;  1AEX A;  2PO4 A;  2A69 C;  5FK9 C;  1B44 D;  2JA6 G;  3HOU G;  5IGE A;  3RZD H;  3J81 j;  3U58 A;  1GJX A;  2NZO A;  3GO5 A;  1PH6 A;  5C0X G;  1U4P A;  4KKS A;  3EBE A;  1CI3 M;  1YJN A;  4AYB B;  5TSS A;  3QWN A;  1B9M A;  1VCI A;  3KF6 A;  3OMC A;  4ZAI A;  1PH7 A;  2N55 A;  3A5Z B;  4HSV A;  1KDB A;  3S15 B;  1AZP A;  2WV6 D;  1X3Q A;  3I3C A;  4RMF A;  4L5R C;  3EQL C;  4DXG A;  3GD7 A;  3MC0 B;  3D8G A;  4ME3 A;  1F2Z A;  1V43 A;  5K36 G;  1YNN C;  1B2T A;  4A3K H;  1ENF A;  5EBD A;  4GN4 B;  1SE3 A;  2HT1 A;  2E2H B;  4G7H C;  1U4M A;  1KD1 C;  4B9W A;  4BA2 I;  1B7Y B;  5CYU A;  5CGK A;  4IAL A;  1TWC B;  4A3J G;  5JEA H;  2YTV A;  2IX1 A;  1GUG A;  1NNX A;  3TP5 A;  1S72 A;  1C9O A;  5M3F G;  3Q6S A;  4LWC A;  3J80 L;  3PIO A;  1XTC D;  1VDZ A;  3WOE A;  1JCK B;  1B50 A;  1OXX K;  1W3S A;  3TP7 A;  5M3F B;  4FDB A;  1HUN A;  4YY3 L;  2NBF A;  2IY5 B;  3HOZ H;  1MHW C;  1U9R A;  2F4I A;  4H02 A;  1EIF A;  3V05 A;  3D6C A;  2ZJP A;  2EYF A;  1H9J A;  3CQZ H;  1W6J A;  3FEW X;  5M5W B;  5IT9 E;  1SRU A;  4QL5 A;  1D7Q A;  5KEE A;  4XQJ A;  4K0K Q;  3H0G H;  2N49 A;  1A63 A;  4UHV A;  3R2T A;  5FLX c;  4OHJ A;  2F4V Q;  3DEO A;  1PZJ D;  1VQJ A;  1PTO H;  3IFT A;  4XXE A;  4M8A A;  2OQ0 A;  1HNZ L;  1PRT B;  5C4X G;  3MEH A;  2UUA Q;  3K81 C;  1X3E A;  1E2V A;  3DHQ A;  3K0X A;  2NTT A;  1ICF B;  3P75 A;  3O13 A;  3PO3 B;  3MEF A;  1AW7 A;  1EQT A;  1EU3 A;  3J81 L;  1Q90 A;  1HR0 L;  4WRD A;  1IBK Q;  4JI2 L;  4KHV A;  2K5W A;  4IUV A;  2JA5 G;  4A3G H;  1YNN D;  4KJO A;  1T5X D;  3HKS A;  1EEF D;  1JMC A;  4CGY B;  3M3Y H;  4DR7 Q;  4TSS A;  3HKZ B;  4GNX A;  1D1K A;  1PXU A;  2R92 H;  5T1I A;  3NTK A;  5IP7 H;  3LX0 A;  1TY0 A;  1EQR A;  1V8Q A;  2WAC A;  1I6V C;  2LMC B;  1YHQ A;  3TS0 A;  3G6E A;  3ONA B;  1AH9 A;  2Z8L A;  1WCM H;  2XSC A;  3Q8D A;  4PV1 C;  4DNR B;  3HOW B;  4PMB A;  2CKZ B;  1HPC A;  3NE5 B;  5M9O A;  1BF4 A;  2F0O A;  3CCL A;  1K0S A;  1SYD A;  2R7Z B;  4ZK9 B;  1HNW L;  5IYD H;  4BY1 B;  3GTL H;  4LF5 L;  3H0G B;  3G48 A;  1SSO A;  1XPO A;  2E2D C;  1Y69 U;  2ES2 A;  1VQK A;  4UPA A;  4OWW B;  4A4I A;  1CQF A;  1PFS A;  1UE6 A;  3M4O H;  3PO2 G;  4LUO A;  1PFB A;  4R4Q A;  5HGQ A;  1VQA A;  2A8V A;  4YIJ A;  3T13 A;  1YHA A;  4NXN L;  2RHS B;  3ERS X;  4K5X A;  4R4C A;  1PH3 A;  4C3J H;  1DOM A;  5ELN A;  4WJW A;  4A3K G;  3GTP H;  4A3M H;  2XRQ D;  1OXU A;  1PZI D;  4P2C B;  4IFD I;  2Z6K A;  2B39 A;  2XWB B;  2JA5 H;  4A3G G;  4DV4 Q;  1JOK A;  4DPG A;  4HMJ A;  1B53 A;  3OWF A;  1SRO A;  2AWO A;  2JA8 H;  4HTH A;  4IUP A;  3S1R B;  2KHI A;  3PGZ A;  1LTR D;  4WJ4 A;  4CDC C;  1RTO A;  1SFO B;  1S3O A;  2CFM A;  1ASZ A;  1X6O A;  4YHH Q;  5I2Y A;  1BO0 A;  3I4O A;  5FKA C;  4LF7 L;  5C4H A;  1WYD A;  4KN4 C;  5ISR A;  2KEE A;  4X66 Q;  2PPB C;  4NW2 A;  3FHW A;  1I50 B;  1JJ2 A;  4PZ6 A;  1Q86 C;  2DY7 A;  2DGY A;  1IL2 A;  3I4N H;  3FPP A;  4BBS B;  2EYJ A;  4N8X 1;  2ZTC A;  3NQI A;  5A35 A;  3I91 A;  5EPL A;  4LJZ C;  3PUY A;  3MZ5 A;  3I4M G;  3K59 A;  1LYL A;  2EOT A;  2JEB I;  1UEA B;  1MGS A;  1STE A;  1IYJ B;  5C5L A;  1CZG A;  1EWC A;  3NPP A;  3RLF A;  3I4M B;  2VB2 X;  1E1O A;  4MIU A;  4GLX A;  1LT4 D;  5IT9 L;  4A3D B;  3OWE B;  2BA1 A;  1LAC A;  2UUC Q;  4B3R Q;  3OMG A;  3I72 A;  2CH4 A;  1NTG A;  2AKW B;  1QZH A;  1LTB D;  1S5B D;  3HFZ B;  4HJA A;  2WP8 J;  3FKI B;  1PFM A;  2H1E A;  4X62 L;  1UE5 A;  5C0X I;  1A0I A;  4YWL A;  2HHH Q;  4NB3 A;  4B3S L;  5COY A;  4A3B H;  4K5W A;  1IBM Q;  3Q23 A;  1HJP A;  3VR5 A;  4C3J G;  3HOV H;  1LT6 D;  2EXZ A;  4B3M Q;  1Y1V B;  4FNF A;  3KBX A;  1F2Y A;  4XDX A;  4DV3 Q;  4R8N A;  5GAG C;  3E9H A;  1YNJ D;  4PMC A;  1GM5 A;  1VQH A;  1ML0 D;  1OXS C;  1Y1V G;  5EGT A;  2F0W A;  4ZYS A;  3C1E A;  1PVO A;  4AH6 A;  4HJ7 A;  4C3I H;  4CHT B;  2E5L Q;  1E1T A;  1OTC A;  3WOF A;  4A3F H;  4J1M A;  1F9Q A;  3J7Z C;  1DJR D;  1QJO A;  2FFK B;  4R9W A;  5M3F H;  5J22 A;  2N8N A;  4IO9 A;  1X3F A;  2F0L A;  2C5C A;  5C0X J;  2E2J B;  2IL8 A;  4JV5 L;  1VQE A;  5CV6 A;  4DR3 L;  2QF7 A;  1ZKO A;  1I6H H;  1XXG A;  5CBE E;  1NMF A;  2JA6 H;  2XTI A;  3OOC A;  1TXY A;  1Q12 A;  1YNX A;  5FJ8 G;  2CHB D;  3KF8 B;  4KN7 C;  2WII B;  2ZXP A;  1GVP A;  2OWO A;  2FMM A;  2JA6 B;  2F52 A;  1SFO H;  2K5D A;  3BDC A;  1WFQ A;  4DAM A;  4LFA Q;  4GOP A;  3M4Q A;  3HEJ A;  1KHI A;  1EUJ A;  4LF8 Q;  3OTO L;  3S17 B;  1BXT A;  4DA2 A;  4LF4 L;  5C4Z A;  4DUZ Q;  2XGT A;  3BDL A;  4CBV A;  1K83 H;  2B2U A;  3J80 E;  1IYV A;  3MXP A;  1VQ4 A;  2N78 A;  1SND A;  4PNY A;  3NWS A;  1I94 L;  1JWU D;  3CP0 A;  1VQN A;  5IT9 c;  1HRJ A;  5IIF A;  3S1M H;  2B29 A;  2B63 H;  2ZXR A;  3P1H A;  4DV5 Q;  3K7A H;  1PYB A;  1BVS A;  3NP8 A;  5AJ3 L;  3M4Y A;  3PV0 A;  2F3I A;  3PUZ A;  4OIK A;  2YU9 H;  2DNE A;  1IBM L;  1B8A A;  1QZG A;  2HDL A;  2JA7 B;  5IOD A;  2KVM A;  1SE4 A;  1Q1B A;  3S14 H;  1KDA A;  1DXM A;  3MHB A;  3TEH B;  2ZT9 C;  1WOC A;  2F0U A;  2DJF C;  1XJV A;  4RKL A;  1GHJ A;  4HAE A;  3VA5 A;  3KYH C;  4L63 B;  2E75 C;  1L2F A;  1HA6 A;  1KAB A;  1KLU D;  3PSI A;  3FMC A;  5JAV A;  3EIV A;  5BR8 Q;  1NJI C;  3J81 E;  1OO9 B;  4JI8 Q;  4JPB W;  1YIJ A;  2Z1C A;  1K8O A;  2R61 A;  3S17 H;  1N33 L;  4GKK L;  1FGU A;  3K5L A;  3IKJ A;  1FL0 A;  1I4R A;  4CDF C;  4DV0 Q;  1B3Q A;  1HHV A;  3HOY G;  3MXN A;  2LS0 1;  2GA4 B;  4U68 A;  2CW0 D;  4R4T A;  5JVG 3;  4DR5 L;  5C3W A;  1LO5 D;  1XMQ L;  2SNS A;  1OXV A;  3H6M A;  3VR4 A;  4DV3 L;  4XT3 B;  3DM3 A;  4DF7 A;  2RKS A;  1VQB A;  1LTI D;  2JA8 G;  4DXF A;  4BBR G;  4LFC L;  2AHO B;  3DWQ A;  3D4D A;  3CCS A;  1ENC A;  1Z7T A;  3CRK C;  1KAW A;  5BN5 A;  1F9P A;  1FNU A;  1LAB A;  5F2D A;  2SEB D;  1HNX L;  5IWA L;  4JOI C;  3KOJ A;  5HUR A;  4DUY L;  3OHX C;  4FP5 D;  1UEB A;  4A93 H;  4IUQ A;  4LMQ D;  4GKJ L;  1TR5 A;  5GAH C;  3MXG A;  2CWP A;  4ME5 A;  4R8I A;  2F0N A;  3LWU A;  3GTP B;  2OF1 A;  3VYT A;  1A3V A;  2IHF A;  2KA7 A;  5A2Q E;  4MZ9 A;  4AYB E;  1TWC H;  2X6G A;  3STB D;  1GUW A;  1K3R A;  2E2I H;  4TKO B;  5E3F A;  5E4X A;  1YBY A;  1YJ9 A;  4V0B A;  3FDT A;  3CAM A;  2J7Z A;  5CV9 A;  1A8V A;  1D5Z C;  2P5Z X;  4AQY Q;  2R7Z H;  4KHZ A;  2IT1 A;  5C4J H;  1Q7Y C;  4BS9 A;  2B63 G;  5A2Q L;  4FO2 A;  1UUP A;  2B8G A;  1K73 C;  2I0Q A;  4DR1 L;  3A5U A;  3QO2 A;  1F2L A;  2JYO A;  4PZ7 A;  3GTQ B;  4RA8 A;  1HTL D;  1PH4 A;  2UU9 L;  4LF7 Q;  4X3S A;  4C3H G;  3AB9 A;  2A68 D;  2H5X A;  2R6G A;  3KJP A;  1G2T A;  2LSS A;  1LT5 D;  2Z6K C;  1N8R C;  5C4X H;  2BA0 A;  1Q8I A;  1CSP A;  2QDL A;  3D4W A;  3BDO A;  2BDN A;  1K8M A;  4CKB A;  4MTN A;  4IJL A;  2HIX A;  2QDB A;  3NTH A;  4DAY B;  5EKK A;  1J9O A;  1HQR D;  2IWH A;  4DR2 Q;  3KDF B;  3DWA A;  5H1S E;  4HJ9 A;  1IYU A;  1TWF H;  2J4X A;  4MTK A;  5GQO A;  3K5N A;  4JI5 Q;  5EKI A;  1VQI A;  1B1Z A;  1PH1 A;  2AQ1 B;  1DZ1 A;  2VUM B;  1JWS D;  3TZD A;  2VY3 A;  4JI0 L;  3PIO 3;  4DR4 Q;  4O0A A;  3H09 A;  4IQZ A;  1VQD A;  1B70 B;  5J39 A;  2R7Z G;  3ZYY X;  1DCZ A;  1NE3 A;  4BY1 G;  2V4D A;  1DD2 A;  2EYO A;  3NHH A;  3STB C;  1HNX Q;  2F0J A;  3HOX H;  1AE2 A;  5JPN C;  3SK6 A;  4RGM A;  4LF5 Q;  1FVI A;  4BBR H;  4JI3 Q;  3F8T A;  4MNO A;  4LFC Q;  3S2H H;  1VQL A;  3MTS A;  3J80 c;  1EYA A;  1NR4 A;  1X56 A;  2RCN A;  2WAQ E;  2JXM B;  4K6L A;  3H3V C;  5HGT A;  4Y7N H;  3W1G A;  3ND9 A;  4PG3 A;  3VYU A;  1I3Q H;  5KYL A;  3QB3 A;  3L7Z C;  3X3N A;  4DV6 Q;  2O5J C;  3QG1 A;  4UAI A;  4OO1 G;  2QGQ A;  2ZM6 Q;  4CDE C;  4F7X A;  3E5S A;  1A2U A;  4J6H A;  3W5O A;  2B2Y A;  1JWM D;  1TWF B;  4A3M G;  1GUO A;  1UWV A;  5IGB A;  4QY7 A;  3U4V A;  4Q5V A;  2YYZ A;  1JQY D;  2M2L A;  2NUC A;  1GUS A;  2PNR C;  3TME A;  3D6W A;  1PTO C;  3U9O A;  5IYD G;  2L1B A;  4IOC A;  1FNW A;  1CKO A;  1QIL A;  2UUA L;  4HIM A;  3PO3 G;  2L11 A;  2HQE A;  2RA4 A;  5IYB H;  2JA7 H;  3TRE A;  1PRT C;  3HOX B;  3S1M B;  4N9T A;  1SAP A;  2B8F A;  3U9S A;  4P71 A;  1STA A;  1BQQ T;  1NAP A;  3K7A B;  4HCS A;  3JAM c;  3HOX G;  5DLQ E;  4DFA A;  4RHR A;  4Q0F A;  2EYM A;  2EDG A;  2F03 A;  1HZC A;  3CC4 A;  2ZM6 L;  1G29 1;  3UDF A;  2KEC A;  1EZ8 A;  2RSN A;  1LT3 D;  3OYY A;  2ZXO A;  3J80 i;  2GVA A;  1BDO A;  3CPF A;  4ABN A;  1L1O C;  3SK8 A;  1ZYR D;  4IUR A;  4X64 L;  1MIU A;  4C3H H;  5C3E H;  1HFN A;  3OIQ A;  4JYA L;  4KLK A;  2NVX B;  5C3X A;  3EN2 A;  1IXR A;  1VQC A;  2MPM A;  2MHV A;  3IRB A;  4GOP C;  4HSP A;  4XYQ A;  4X3T A;  5IYC H;  5CC4 A;  2NN6 G;  1U0L A;  4O1N A;  1IBL Q;  3CKI B;  1JR0 D;  5D65 A;  1X54 A;  3EA6 A;  4ZLT F;  5I6Y A;  4DV2 Q;  4A3I H;  3ERO A;  2JA9 A;  2B2W A;  5GAE C;  5J3B A;  2L55 A;  4BXX H;  2XRS D;  2F0D A;  2F0S A;  5L37 A;  2LY7 A;  5FLM H;  4F8M A;  2RBM A;  2X6L A;  3EFX D;  5LMN L;  4F88 A;  2RVL A;  3CCM A;  1L1O A;  4KJN A;  4QMG A;  4YY3 Q;  4KKU A;  2MUY A;  3J81 i;  2JE6 I;  3DLL A;  2PZU A;  4J15 A;  1Y8N B;  2I5L X;  3IFD A;  3L0O A;  5BN3 A;  5I9P A;  1FR3 A;  3K58 A;  4DK6 C;  2K05 A;  5EAY A;  4JI8 L;  5IP9 H;  4L5S A;  1JJC B;  3HZX A;  1ICW A;  2FXQ A;  3MFY A;  1NCV A;  1NUC A;  4OEL B;  3KF6 B;  2AUJ D;  4LFB Q;  1EY0 A;  4IFD J;  1TWA B;  1KTK A;  1XPR A;  2WAQ B;  4EQP A;  5IWA Q;  1V1P A;  3HKZ E;  3TZU A;  1EEI D;  2RDG A;  4C2M H;  1EY4 A;  2NWG A;  2MGS A;  3HOV G;  1JT8 A;  1FJG L;  5LL6 X;  3SDZ A;  1QNU A;  1S5C D;  4A3G B;  1A15 A;  1QVC A;  3J7A V;  3W3A A;  4A3F G;  4QJF A;  3URY A;  2XN9 C;  2PYK A;  3VYS A;  5LMU Q;  3NTI A;  3FKI H;  4IFD H;  1EYC A;  1K83 B;  4JBW A;  2KOL A;  2B2Y C;  3SVM A;  3T51 B;  1LLR D;  4FF4 A;  1SMX A;  2B2T C;  4GKK Q;  2EYH A;  3A56 A;  4JW0 A;  4H0L C;  4KKT A;  3E0E A;  3K8A A;  4EQO A;  2JK8 A;  1VQP A;  1M1K C;  3FVQ A;  1HZ9 A;  2D9U A;  4OX9 Q;  3J7Y W;  2ZTD A;  4HIK A;  4C3I B;  5FO9 B;  1EFI D;  3I55 A;  2WB1 E;  1OXT A;  1UE7 A;  2HDM A;  4P74 A;  5G3L D;  4HJ8 A;  1YJW A;  4LK1 C;  3I2Z A;  3DMU A;  2HQL A;  1NBW A;  3A54 A;  3G71 A;  2NTS A;  1SNC A;  3CC7 A;  4X65 L;  2M00 A;  2B3G A;  2SDF A;  1Q1E A;  4JI1 L;  4H7B A;  2Q8R E;  1H9K A;  2PI2 A;  3BVZ A;  1F9R A;  4KMU C;  5IOC A;  1HTP A;  4ZUI A;  3DXJ C;  4HID A;  1KQS A;  5AJ3 Q;  4BY7 G;  4X66 L;  1EY5 A;  5EPJ A;  2QEX A;  3H94 A;  4L5T A;  3TN2 A;  3GDE A;  4OO1 I;  3HGB A;  2HIV A;  1HCZ A;  2A68 C;  3CCJ A;  5IE8 A;  4DR3 Q;  3U4Z A;  1YEZ A;  1QG7 A;  4QF4 A;  2Q8I B;  1TQO A;  1V1P B;  3I56 A;  1G51 A;  1N33 Q;  2D2C C;  3Q0A A;  3C1F A;  2I5H A;  1B4O A;  3FP9 A;  1HA5 A;  4ZKB B;  2R93 G;  3T4A C;  4GN5 A;  4E6I A;  3T16 A;  2ZJR A;  3VA7 A;  1QOH A;  4DR6 L;  1CHQ D;  4OL7 A;  1E2Z A;  3S15 H;  1CA5 A;  1U4R A;  3S2D B;  3OTO Q;  1TWH B;  4QGU A;  3TBI B;  2K28 A;  1HH2 P;  1SYG A;  3I4N G;  1C7Y A;  3GTM H;  2EY6 A;  3BYY B;  4XQN A;  4A3J H;  2E2H H;  1FYC A;  2ICE C;  4B3M L;  3KJO A;  2O2L D;  2QEJ C;  2JSO A;  1MI2 A;  1N34 L;  3J81 c;  5DNF A;  4DV2 L;  2EPB A;  4JI3 L;  1Q82 C;  1PH2 A;  3ER0 A;  3SHL A;  3OW7 A;  1KL9 A;  3L9A X;  2ALY B;  4DN4 M;  1EOT A;  4O2D A;  3MA2 B;  2HCC A;  1WTR A;  2MNA A;  1VS0 A;  1S4Z A;  1WTQ A;  4KK7 A;  2IPK D;  1TWG B;  1L0Y B;  4XTC S;  1H95 A;  4U67 3;  4ILW A;  5DAU A;  2Y0S E;  2MFI A;  4A93 B;  5HY6 A;  2L9H A;  4ZCK A;  3UE1 A;  3V96 A;  3T1Y Q;  1RTN A;  1VMC A;  1YNJ C;  5IGG A;  5C4J B;  3K7U C;  4I7Z C;  4BA1 I;  3S1Q H;  3KFU A;  4JI5 L;  2UXC L;  2YV5 A;  4EX5 A;  3N6R A;  1EY6 A;  5K5P A;  3NQT A;  4JI7 Q;  3D3R A;  2PCF B;  1YI2 A;  2J0T D;  2A5H A;  1STN A;  3A8J E;  1PTO D;  1SNO A;  3X3M A;  4JVZ A;  5AFW A;  3R3O A;  2L12 A;  3JC6 6;  1QUQ B;  1M8A A;  1EY7 A;  1BCP F;  1STY A;  2O4X A;  4CJ1 B;  2R93 H;  2EYP A;  1I5F A;  5C44 B;  4RWS C;  1VQ7 A;  1EIH A;  1ZYR C;  1PH5 A;  5D3I B;  2Z4I A;  3CMA A;  1K28 A;  1X55 A;  3HOU B;  2L15 A;  2H4O A;  1O7Y A;  1LUZ A;  4DR1 Q;  5CBA E;  4CJ2 C;  3OIP A;  4DV4 L;  3MAQ A;  3KF8 A;  3HOW H;  2CVR A;  4QQB X;  5C3E G;  4NDX A;  3H15 A;  1K8G A;  3E0J A;  3S24 A;  2PNH A;  1SNM A;  4K5V A;  1KRS A;  1H9R A;  1X65 A;  2VUM G;  1KNE A;  1A3T A;  1STG A;  4QB4 A;  3NXW A;  3CPW A;  1X9N A;  3CU7 A;  1O80 A;  4DV7 L;  1C48 A;  1Y1W B;  2ZTE A;  4ALP A;  4WJ3 M;  4YCW A;  3S14 B;  2OT2 A;  2E74 C;  2D0P A;  2F3W A;  3GTG H;  3LWE A;  2IW3 A;  3KK7 A;  1C0A A;  3OSO A;  4RCN A;  5ELB A;  3TDQ A;  1H9S B;  3E3X A;  3CF5 A;  2RCF A;  4DUY Q;  2F0T A;  4ZQ3 A;  4K2K A;  3GV3 A;  4B9X A;  3T1H L;  1MSH A;  1SEB D;  2F0E A;  1S5F D;  4JI1 Q;  3T1H Q;  4LNQ A;  3T56 B;  4A3I B;  3S16 B;  1JOO A;  3HKZ G;  4LF9 Q;  3SK4 A;  2KCM A;  4C2M B;  4A3C H;  3MXU A;  5GAD C;  4RG1 A;  2NVT B;  3RLN A;  1JOQ A;  5I6W A;  2F0H A;  1WTX A;  2E2I B;  4UY8 C;  1JE4 A;  4X64 Q;  1T9H A;  2JA8 B;  1NR2 A;  4BBR B;  2A6H C;  3HS0 C;  3ULL A;  2K6A A;  5M5W H;  3G6J B;  3S1N H;  1WI5 A;  3AQQ A;  4C1N I;  3TS2 A;  3J7A 5;  4A3J B;  1RKN A;  1V9P A;  1SMY D;  2K4K A;  5FLX E;  1ESF A;  2A73 B;  1HFG A;  5C0X H;  3KDF A;  4UP9 A;  4JI2 Q;  3SEB A;  1IBK L;  3UDI A;  5FLX L;  3TP8 A;  1PRT F;  2K03 A;  2IX3 A;  5C4X B;  4RGO S;  1D5M C;  3KLS X;  2K50 A;  3WWV A;  1WCM G;  5KND A;  3EJI A;  1KLG D;  4IPC A;  1R4Q B;  3ICE A;  3K0Y A;  2K5H A;  4HCE A;  4BBS H;  1Z6H A;  4DV1 Q;  1CSQ A;  1WCM B;  4DAP A;  5M5X H;  1E0B A;  2LFN A;  1ASY A;  3PCO B;  4LF6 Q;  2GN5 A;  3FPU B;  2G5D A;  3MXN B;  3GTK B;  3PO2 B;  1CKM A;  2BE5 C;  2D62 A;  5FO7 B;  2R92 G;  1PYS B;  4IPH A;  2JQO A;  4JBK A;  1KDC A;  1H9M A;  1A3U A;  1XMO Q;  2SOB A;  1I4H A;  1ZXT A;  4L5Q A;  4EQ5 A;  3L3O C;  5KIX A;  1HR0 Q;  1NY4 A;  2G9H D;  4HJ5 A;  4YWM A;  3CHB D;  2CW0 C;  4DNI A;  1TKW B;  4LF4 Q;  2Z6B A;  1HXY D;  1SE2 A;  3NEM A;  4YCV A;  5IYC G;  4A75 A;  4PZ8 A;  2PMZ E;  4LW1 A;  3M7G A;  2EJF C;  2HCI A;  2ENB A;  1LTL A;  2L5T A;  2F0G A;  2HUG A;  5T1G A;  5EPK A;  4DAV A;  4S3S A;  3ULP A;  3LNN A;  1LTT D;  4POF A;  3GTG B;  3RNU A;  1SDF A;  1CKN B;  3C2P A;  2OTJ A;  3S2D H;  3PF5 A;  3I90 A;  2UUB Q;  3D0F A;  1TT2 A;  3P20 A;  1PTO B;  3CQZ B;  1AZQ A;  1D1I A;  1K3B C;  2RDF A;  2DJG C;  3VR6 A;  4ZKC B;  4DR4 L;  4A3D G;  2QW7 A;  1U5K A;  4APV A;  1O7Z A;  4HIO A;  3CCQ A;  1D2B A;  4OEM B;  3QJY A;  1S5D D;  1ET9 A;  5J1Z A;  3H0G G;  2AQ2 B;  1C8C A;  2PQE A;  3JAM E;  3B6Y A;  1VQ9 A;  2NVY B;  1XYI A;  3K57 A;  4OWX B;  3EVQ A;  3ITP A;  3T1Y L;  1CT1 D;  3F2C A;  5DEH A;  3CCR A;  2M9V A;  3A74 A;  1B3A A;  5IYB G;  1GUN A;  5EBC A;  2N88 A;  1QWY A;  4RHS A;  4G4K A;  1Y8P B;  2KED A;  2F0P A;  1J6Q A;  4NP5 A;  1VQ8 A;  2B2U C;  3Q24 A;  1HZA A;  1W6K A;  1XX8 A;  2XVS A;  3GTQ H;  1PYW D;  3K5O A;  1R9T H;  2K5N A;  3BZD B;  1I6H B;  2B2W C;  4GZY C;  2D5D A;  2F0I A;  5JOB A;  3Q22 A;  4KTA A;  1ILP A;  5D3D A;  3AFP A;  4B3S Q;  4JI4 L;  1JIC A;  5C44 H;  2WKD A;  3I8Z A;  1KIX A;  4QIW E;  4DGZ A;  1L0W A;  4X65 Q;  4RH6 A;  1LTS D;  1CQV A;  1GUT A;  5IGD A;  2IHE A;  1Q81 C;  4L6T B;  1CHP D;  2UUC L;  2VW9 A;  1G8Z D;  5DM7 3;  4A76 A;  2K04 A;  2WIN B;  1IKL A;  4DR6 Q;  1AP0 A;  1DON A;  1Q3L A;  1QNK A;  1XPU A;  2RF4 A;  1JE5 A;  3IAY A;  3HOU H;  1HQM C;  4KY6 A;  4QUF A;  1VF7 A;  3V2T A;  4IUU A;  4A3B G;  1F9S A;  5M5Y H;  2MO1 A;  1MJE A;  4FF3 A;  3T53 B;  3PIP A;  1V1O A;  2KHJ A;  4C3J B;  5LMU L;  1G6P A;  4FF2 A;  4WFN 3;  1PA6 A;  1A6X A;  3W2D A;  5ELO A;  2OTL A;  2FMC A;  2AQ3 B;  3PF4 A;  3NBH A;  2F1M A;  4PMW A;  4FXD A;  1I4Q A;  3HOW G;  1CFM A;  1EIG A;  1KAA A;  4OON A;  1I4G A;  1Y1W H;  3UDX A;  1LM0 A;  1UAP A;  3AEV A;  2Z4H A;  3FRP B;  3UE0 A;  2AUK A;  2RHQ B;  2E2J H;  1Y8O B;  5CV7 A;  2PI2 E;  4A3E B;  4LFB L;  4JV5 Q;  1ROD A;  3M7N A;  1SJE D;  2PW5 A;  3VYR A;  4GS3 A;  1SYF A;  3R8B A;  4JG2 A;  1VQ6 A;  4JOI A;  4ODG A;  5EQ0 A;  3UI2 A;  3RUZ A;  3S2H B;  4A3E H;  3GTM B;  4OX9 L;  2VS1 A;  3H91 A;  3P7J A;  2JA7 G;  2Z9H A;  3MFG A;  3I4N B;  5LHY 1;  5COR A;  4HMI A;  1VQ5 A;  2BDO A;  2E5L L;  4FF1 A;  1KNA A;  3PO3 H;  4ZUJ A;  1HUM A;  2K5V A;  1O7I A;  3HOZ G;  1I50 H;  4KHP L;  1N32 L;  5KRU A;  5I9O A;  5C44 G;  1QUQ A;  1TU2 B;  4DKA C;  4C1N K;  3S9W A;  2JJQ A;  4EQN A;  1IZ6 A;  3BVG A;  2UU9 Q;  2GVB A;  5JJI A;  1KXL A;  2K14 A;  4JI6 Q;  2C9O A;  2QIL A;  1WTW A;  3GTO B;  5IGF A;  1SR3 A;  3DEP A;  1F77 A;  5C3E B;  2Y0S B;  2OCE A;  3PUX A;  1YIT A;  4JI6 L;  3RZO B;  1J8I A;  2I07 B;  2WAQ G;  1KRT A;  5JEA G;  3GTO H;  1WJJ A;  5LL6 S;  2L4N A;  1HNW Q;  1IW7 C;  2PMZ B;  2JEA I;  4I65 A;  3QR8 A;  4KD3 A;  1D8L A;  1F2M A;  1I94 Q;  3F1Z A;  5M3M G;  1IKM A;  2F0F A;  4B08 A;  4OXP A;  4K14 A;  4MHE A;  2CQA A;  4NPS A;  3G4S A;  1ONL A;  4IZ8 A;  3PQI A;  3NWT A;  2YTY A;  1RCV D;  1E3P A;  5CV4 A;  3CXC A;  3PO2 H;  3GTJ B;  2EIF A;  1JB7 A;  2KCT A;  4DR7 L;  1RF2 D;  3BZC A;  3GTK H;  2NZH A;  3DM1 A;  3M4O B;  1SNQ A;  1XNR L;  2UXD Q;  2KCN A;  1U4L A;  2WB1 B;  4A3I G;  3NK9 A;  4LFA L;  1Y1V H;  3KLS A;  2O5I C;  1E24 A;  3DWP A;  4P73 A;  5IP7 G;  3W1B A;  2WB1 G;  1N34 Q;  1K0R A;  4C3I G;  4RGT A;  5KNB A;  2R7F A;  4A3L H;  2HD3 A;  4X6A H;  3VR3 A;  3TP6 A;  5JEA J;  1LV9 A;  1SN8 A;  4LUZ A;  4XIG S;  1WTO A;  2F0V A;  3KLR A;  1JJG A;  3GP7 A;  3TRZ A;  1CK1 A;  2R3Z A;  3NBH B;  3JAM i;  1SJH D;  3HP3 A;  2DNC A;  1G6Z A;  3SXH A;  4A3M B;  4JYA Q;  1GXD C;  3PUW A;  1YVC A;  1TY2 A;  3C3L A;  2B63 B;  4IUN A;  4BWG B;  4NMZ A;  1BKB A;  2K01 A;  4HN7 A;  4R4O A;  2NVY H;  2OEO A;  5JVH 3;  1GOZ A;  2CQO A;  1Q46 A;  2KUM A;  1CKN A;  1EFW A;  3BYT B;  2K75 A;  3QOJ A;  4BXX G;  4UP7 A;  2JN4 A;  5LMN Q;  1M90 C;  4IPG A;  3A8I E;  2UXB Q;  1II3 A;  4QUC A;  4GNX C;  4OWT B;  1P8L A;  1SNP A;  1EIY B;  3RZO H;  1VMP A;  1Z9F A;  1SYC A;  2C35 B;  4XQQ A;  2KCC A;  4V19 0;  5I4D A;  3ND8 A;  4N8F A;  4LAA A;  2K1B A;  4FVM A;  1G2S A;  3JAM L;  5FO8 B;  2LXK A;  4A3L G;  4C56 C;  1TS3 A;  1BBU A;  2B2V C;  2PW7 A;  4NXM Q;  2EY1 A;  2Q2H A;  1N36 L;  1J5E Q;  3I4M H;  4JK1 C;  4IOA A;  4TQU S;  1WVL A;  1RDP D;  4IJH A;  5CV8 A;  3U50 C;  3HG9 A;  1RD9 D;  3VDY A;  1L1O B;  1PH9 A;  3S1Q B;  1RIP A;  1VF5 C;  1AFP A;  3RN5 A;  2LKV A;  1QCB D;  1O78 A;  1WTV A;  1E7Z A;  4DNT B;  3PIP 3;  1EQV A;  3PMF A;  4HR7 B;  1QB5 D;  4DR2 L;  4DV6 L;  4P72 A;  4ZRZ A;  2YU9 B;  3S1N B;  4Y52 H;  2V1C C;  2RDH A;  3RD4 A;  4AYB G;  2XWJ B;  1X3P A;  4A93 G;  5K36 H;  2K7V A;  3NUC A;  2UUB L;  5M5Y B;  4RKB A;  3NEL A;  5M3M H;  3DUZ A;  4RFB A;  1P16 A;  3G7L A;  2MP1 A;  1J5E L;  1NMG A;  1HNZ Q;  1UE1 A;  1CM9 A;  3CC2 A;  1BCP D;  1CTM A;  2VQE L;  1NSN S;  2VXW A;  4OIJ A;  2ZJQ A;  1V1Q A;  2F4V L;  2CCZ A;  2CH4 W;  1GO3 E;  1DOL A;  2NZ1 D;  1PTO F;  3ERQ A;  5ELC A;  4JBJ A;  4IN3 A;  2MJ8 A;  2R92 B;  2EQS A;  3PUV A;  4IUT A;  1VQO A;  2IX0 A;  1EL0 A;  1TS2 A;  1FNV A;  4WOR A;  2BOS A;  3K6O A;  2EYL A;  3R93 A;  1Z47 A;  4C3H B;  2XIW A;  1EZ6 A;  4K8I A;  1PDQ A;  5E1F A;  1R4P B;  2NYZ D;  2BH8 A;  3CCE A;  4A3C G;  1BOS A;  4X3U A;  3KUP A;  4GN3 B;  1X32 A;  1LTG D;  4UDU C;  3A0J A;  4AIM A;  3BU2 A;  1QVG A;  1H9S A;  1TWG H;  2QKI C;  1YHB A;  2Q8T A;  3D31 A;  2PZT A;  3ZJY C;  1RJT A;  2EJG C;  2KJX A;  1EWI A;  2VB3 X;  3RR5 A;  1I4X A;  1R9T B;  3F2D A;  4G57 A;  4HED A;  1IL8 A;  3K80 C;  1MSG A;  2QCP X;  3M4P A;  4DV1 L;  3GV6 A;  1BBW A;  2CWA A;  4H13 C;  5DM6 3;  3MVV A;  2LXJ A;  5GRO A;  1DM0 B;  2A1A A;  1D5X C;  3OPO A;  4K8J A;  1Y1W G;  3I73 A;  1EYD A;  4FXG C;  5BN4 A;  4B3R L;  3UDG A;  2A6E C;  2A69 D;  4JCV E;  4R4I A;  3ULJ A;  3D4R A;  4JI0 Q;  1B9N A;  5JJL A;  3C46 A;  4GNX B;  1PLF A;  5FJ8 H;  5E4W C;  4K2L A;  2UXD L;  4O42 A;  4R1J A;  2AMC B;  1XMO L;  2A74 C;  3K5M A;  4POG A;  4BBS G;  2I46 A;  4GLV B;  4DK3 C;  1ILQ A;  1BR9 A;  4XYO A;  2JA5 B;  1BCP C;  3RMH A;  4OGQ C;  3J7A F;  4XT1 B;  4YCU A;  1TS4 A;  3RZD B;  1SXT A;  3H3V H;  3SGI A;  4BY7 B;  1IW7 D;  1CUK A;  1BUV T;  1MD2 D;  2F0M A;  4K6D A;  2WKC A;  2NVQ H;  3IL8 A;  2KBN A;  4LF9 L;  2EE1 A;  1Q8K A;  3NSW A;  2YTX A;  2VQE Q; 
#chains in the Genus database with same CATH homology
 2JA5 H;  3CC4 A;  4A3G G;  2ZM6 L;  1G29 1;  3UDF A;  4DV4 Q;  4YHH L;  1N36 Q;  4DPG A;  2EXD A;  4DR4 L;  3H3V I;  3OYY A;  4A3D G;  3J80 i;  2GVA A;  2JA8 H;  1SRO A;  1U5K A;  2AWO A;  4APV A;  3CPF A;  4HIO A;  1L1O C;  3CCQ A;  3PO3 H;  2KHI A;  3PGZ A;  3TQY A;  4WJ4 A;  1S3O A;  3H0G G;  1MIU A;  4C3H H;  4X64 L;  5C3E H;  2CFM A;  1ASZ A;  1X6O A;  3B6Y A;  4YHH Q;  1VQ9 A;  1E22 A;  2I5M X;  3E9I A;  4BY1 H;  4JYA L;  4KLK A;  3I4O A;  4LF7 L;  4OWX B;  2Q2T A;  4AQY L;  1WYD A;  3EN2 A;  4DR5 Q;  3T1Y L;  2UXB L;  1IXR A;  1VQC A;  4X66 Q;  3F2C A;  3FHW A;  3M85 A;  1JJ2 A;  3CCR A;  4PZ6 A;  3IRB A;  4GOP C;  2AWN A;  1Q86 C;  3A74 A;  1XNQ Q;  4JC0 A;  5IYB G;  5IYC H;  2PQA A;  2NN6 G;  1U0L A;  2DGY A;  1TWH H;  2DUD A;  1S40 A;  1IBL Q;  1IL2 A;  3I4N H;  2ZTC A;  4DV2 Q;  1X54 A;  4A3I H;  4NXN Q;  2JA9 A;  1N9W A;  5GAE C;  2R7D A;  2VZA A;  2WFW A;  3AYH B;  1GD7 A;  1J6Q A;  5J3B A;  1VQ8 A;  4BXX H;  3PUY A;  3I4M G;  3CCV A;  1LYL A;  2JEB I;  4DUZ L;  1HZA A;  1IYJ B;  5FLM H;  1MJC A;  1KC8 C;  4GKJ Q;  1W2B A;  3S16 H;  3RLF A;  3GTQ H;  1E1O A;  1HZB A;  5LMN L;  4GLX A;  2K5N A;  1A62 A;  3CCM A;  1R9T H;  1L1O A;  1VQM A;  4NXM L;  3AFP A;  4B3S Q;  4JI4 L;  2BA1 A;  4YY3 Q;  5C44 H;  3J81 i;  1KIX A;  2UUC Q;  4B3R Q;  2JE6 I;  3DLL A;  4QIW E;  4J15 A;  1L0W A;  4X65 Q;  1HR0 W;  2I5L X;  3CCU A;  3L0O A;  5FLM G;  4UP8 A;  1NTG A;  2AKW B;  2D0O A;  2ID0 A;  1QZH A;  4DK6 C;  4JI8 L;  5EAY A;  4L5S A;  3HFZ B;  5IP9 H;  1JJC B;  4HJA A;  2FXQ A;  2IHE A;  1Q81 C;  2ATW A;  4LFB L;  2WP8 J;  2NN6 I;  3OW2 A;  3KF6 B;  2UUC L;  4X62 L;  1UE5 A;  5C0X I;  2VW9 A;  4LFB Q;  1SE8 A;  1A0I A;  1VQG A;  4YWL A;  4NB3 A;  4DV7 Q;  1EYG A;  2HHH Q;  4B3S L;  4A76 A;  2E8G A;  1XPR A;  4A3B H;  4DV5 L;  4DR6 Q;  4YWK A;  1IBM Q;  5IWA Q;  1XPU A;  3I7F A;  1HJP A;  1XNR Q;  3HKZ E;  2RF4 A;  1JE5 A;  1AE3 A;  3HOV H;  4B3M Q;  3CME A;  4C2M H;  2UXC Q;  3HOU H;  2NVX H;  4DV3 Q;  5GAG C;  3E9H A;  1GM5 A;  3HOV G;  1JT8 A;  1VQH A;  1FJG L;  1OXS C;  1Y1V G;  3M9B A;  2MO0 A;  2MQH A;  2K52 A;  1EOV A;  4A3B G;  1QVC A;  1PVO A;  5M5Y H;  2MO1 A;  4AH6 A;  5BR8 L;  4HJ7 A;  4A3F G;  3PIP A;  1MJE A;  4C3I H;  2E5L Q;  4QJF A;  1E1T A;  1OTC A;  2KHJ A;  5LMU L;  1G6P A;  4B3T Q;  2KEN A;  1PA6 A;  2NVT H;  5LMU Q;  4KI0 A;  3FKI H;  4GOP B;  1DGS A;  5ELO A;  4A3F H;  2OTL A;  3J7Z C;  5M3F H;  1QVF A;  4JBW A;  1XTD A;  2N8N A;  1SLJ A;  4IO9 A;  3PF4 A;  4PMW A;  1X3F A;  5C0X J;  3HOW G;  1SMX A;  3CW2 C;  5E7N A;  3L2P A;  4GKK Q;  1PHJ A;  4OON A;  1Y1W H;  1VQE A;  3BZK A;  3E0E A;  3K8A A;  3UDX A;  4JV5 L;  1LM0 A;  2JK8 A;  1MKH A;  1VQP A;  1M1K C;  3AEV A;  1HZ9 A;  1YZ6 A;  3UE0 A;  4OX9 Q;  4DR3 L;  2ZTD A;  3FKI G;  4IFD G;  4HIK A;  1I6H H;  2RHQ B;  2E2J H;  2VQF Q;  1NMF A;  2PI2 E;  2JA6 H;  4JBM A;  3I55 A;  2WB1 E;  1OXT A;  1UE7 A;  2XTI A;  4P74 A;  4HJ8 A;  1TXY A;  1YJW A;  1Q12 A;  1YNX A;  5FJ8 G;  1RL2 A;  4JI7 L;  4JV5 Q;  3I2Z A;  3BJU A;  3KF8 B;  3M7N A;  4GS3 A;  2HQL A;  1NBW A;  1GVP A;  4JG2 A;  1VQ6 A;  3G71 A;  4JOI A;  2OWO A;  3CC7 A;  4X65 L;  4A3E H;  2B3G A;  2F52 A;  1Q1E A;  4JI1 L;  1SFO H;  2VS1 A;  4OX9 L;  4IPD A;  2BH2 A;  1WFQ A;  2JA7 G;  2PI2 A;  4DAM A;  5IP9 G;  4B3T L;  4LFA Q;  1VQ5 A;  3GTJ H;  2E5L L;  4GOP A;  3M4Q A;  2Z0S A;  1KHI A;  1X3G A;  2K5V A;  1EUJ A;  1O7I A;  4LF8 Q;  4HID A;  3HOZ G;  1I50 H;  5AJ3 Q;  3OTO L;  1KQS A;  4KHP L;  1N32 L;  3NEN A;  4BY7 G;  4X66 L;  1QUQ A;  4TVA B;  4DKA C;  5C44 G;  2QEX A;  4L5T A;  2JJQ A;  2UU9 Q;  1IZ6 A;  5JJI A;  2GVB A;  1KXL A;  3GDE A;  2K14 A;  4LF4 L;  4JI6 Q;  4OO1 I;  4DUZ Q;  2XGT A;  2HIV A;  1K83 H;  3CCJ A;  1SR3 A;  1K8A C;  4LF8 L;  1VQ4 A;  5IE8 A;  4DR3 Q;  3U4Z A;  4GLA C;  2N78 A;  1YEZ A;  2VNU D;  2OQK A;  2OCE A;  3PUX A;  1YIT A;  3I56 A;  1I94 L;  1G51 A;  3CP0 A;  4JI6 L;  2A19 A;  2WAQ G;  1KRT A;  5JEA G;  5IT9 c;  1N33 Q;  1VQN A;  1WJJ A;  1EQQ A;  3GTO H;  2I5H A;  1TWA H;  3FP9 A;  1HNW Q;  3S1R H;  1VQF A;  3S1M H;  2B29 A;  2QA4 A;  2R93 G;  2B63 H;  3RLO A;  4K0K L;  4GN5 A;  2ZJR A;  2JEA I;  3LGJ A;  4DV5 Q;  4DR6 L;  3K7A H;  3RN2 A;  3HOY H;  1D8L A;  2Q2U A;  1I94 Q;  1PYB A;  3F1Z A;  5M3M G;  2HHH L;  1BVS A;  1XMQ Q;  3S15 H;  4OXP A;  4A3E G;  2VL6 A;  5AJ3 L;  3OTO Q;  4KHP Q;  3PV0 A;  4QGU A;  2F3I A;  1HH2 P;  4NPS A;  3PUZ A;  3G4S A;  2YU9 H;  1IBM L;  1B8A A;  4DV0 L;  3I4N G;  1QZG A;  1K9M C;  1C7Y A;  3GTM H;  2YTY A;  1Q1B A;  4A3J H;  3S14 H;  1E3P A;  3CD6 A;  3TEH B;  2E2H H;  1WOC A;  3CXC A;  3PO2 H;  2EIF A;  1JB7 A;  2KCT A;  4DR7 L;  4B3M L;  3BZC A;  3GTK H;  1XJV A;  2NZH A;  3AFQ A;  3KJO A;  5JJK A;  1XNR L;  2UXD Q;  3KYH C;  1N34 L;  2N3S A;  3J81 c;  4A3I G;  4A3D H;  4LFA L;  1L2F A;  4DV2 L;  1Y1V H;  4JI3 L;  1Q82 C;  1E24 A;  2JA7 H;  4P73 A;  5IP7 G;  1PH2 A;  3PSI A;  3W1B A;  2ASB A;  3ER0 A;  2WB1 G;  1NJI C;  1N34 Q;  1K0R A;  3EIV A;  5BR8 Q;  1KL9 A;  2ALY B;  2R7F A;  4JI8 Q;  4O2D A;  4A3L H;  1YIJ A;  2PQA B;  2MNA A;  1VS0 A;  4X6A H;  3S17 H;  1N33 L;  1XNQ L;  4GKK L;  4XTC S;  1FGU A;  1H95 A;  4JI4 Q;  5JEA J;  2Y0S G;  1FL0 A;  2VQF L;  4LUV A;  2Q2I A;  1SN8 A;  4LUZ A;  4XIG S;  4DV0 Q;  4LF6 L;  2Y0S E;  2MFI A;  3HOY G;  5HY6 A;  2VUM H;  3UE1 A;  3F2B A;  4R4T A;  1JJG A;  4P75 A;  4DR5 L;  3T1Y Q;  1IBL L;  1XMQ L;  3TRZ A;  1FJG Q;  4X62 Q;  3NBH B;  3JAM i;  1OXV A;  1PV4 A;  3K7U C;  4DV3 L;  4BA1 I;  3S1Q H;  3KFU A;  3DM3 A;  4JYA Q;  4IFD J;  4JI5 L;  2UXC L;  1YVC A;  3KLW A;  3PUW A;  2YV5 A;  1N32 Q;  4EX5 A;  4BY7 H;  1VQB A;  5IY0 A;  2JA8 G;  1BKB A;  4R4O A;  4BBR G;  2NVY H;  4JI7 Q;  1Y14 B;  1GKH A;  4LFC L;  5LMN W;  2AHO B;  1PH8 A;  3CCS A;  1Q46 A;  2CQO A;  1YI2 A;  1CKN A;  1KAW A;  1EFW A;  2K75 A;  4BXX G;  2JA6 G;  4UP7 A;  3HOU G;  1HNX L;  5IWA L;  4JOI C;  3KOJ A;  4DUY L;  3RZD H;  3J81 j;  5LMN Q;  4IPG A;  1M90 C;  1UEB A;  3JC6 6;  4A93 H;  2UXB Q;  4GKJ L;  1QUQ B;  4GNX C;  3U58 A;  5GAH C;  2NZO A;  3GO5 A;  1P8L A;  4OWT B;  2CWP A;  1PH6 A;  5C0X G;  1EIY B;  1Z9F A;  3RZO H;  2R93 H;  2C35 B;  3EBE A;  1YJN A;  1I5F A;  2IHF A;  1VQ7 A;  1PH5 A;  1VCI A;  3KF6 A;  4MZ9 A;  3CMA A;  4AYB E;  1TWC H;  1X55 A;  1PH7 A;  2L15 A;  3A5Z B;  2LXK A;  1LUZ A;  3STB D;  4DR1 Q;  1BBU A;  4A3L G;  1K3R A;  4NXM Q;  2E2I H;  2Q2H A;  4DV4 L;  1N36 L;  1J5E Q;  4RMF A;  3I4M H;  4L5R C;  1YBY A;  4TQU S;  1YJ9 A;  3HOW H;  4IOA A;  4IJH A;  5C3E G;  3GD7 A;  4QQB X;  3CAM A;  4ME3 A;  1A8V A;  1V43 A;  3H15 A;  1K8G A;  5K36 G;  3S24 A;  3U50 C;  4A3K H;  2PNH A;  4AQY Q;  2R7Z H;  4GN4 B;  1KRS A;  3VDY A;  4KHZ A;  2IT1 A;  1L1O B;  1PH9 A;  1X65 A;  5C4J H;  2HT1 A;  1Q7Y C;  2VUM G;  2B63 G;  1RIP A;  1KD1 C;  2I0Q A;  1K73 C;  4BA2 I;  4DR1 L;  1B7Y B;  3A5U A;  3RN5 A;  4A3J G;  3CPW A;  4PZ7 A;  1X9N A;  2YTV A;  2IX1 A;  4DV7 L;  1E7Z A;  1S72 A;  2ZTE A;  4ALP A;  4WJ3 M;  1C9O A;  4YCW A;  1PH4 A;  2UU9 L;  5M3F G;  4LF7 Q;  4LWC A;  3PIO A;  2D0P A;  3GTG H;  2H5X A;  2R6G A;  3KJP A;  2LSS A;  2Z6K C;  4DR2 L;  1C0A A;  4DV6 L;  1N8R C;  4P72 A;  1OXX K;  1W3S A;  5C4X H;  3CF5 A;  2BA0 A;  4Y52 H;  4FDB A;  4DUY Q;  2V1C C;  1CSP A;  4YY3 L;  4AYB G;  3T1H L;  2IY5 B;  3HOZ H;  4A93 G;  4JI1 Q;  4LNQ A;  3T1H Q;  4H02 A;  1EIF A;  2ZJP A;  3HKZ G;  4MTN A;  4IJL A;  2HIX A;  2UUB L;  4LF9 Q;  4DAY B;  2KCM A;  3NEL A;  4A3C H;  5M3M H;  4DR2 Q;  3KDF B;  5GAD C;  3CQZ H;  1P16 A;  4RG1 A;  5H1S E;  4HJ9 A;  3RLN A;  1SRU A;  1TWF H;  5GQO A;  4JI5 Q;  1J5E L;  1NMG A;  1HNZ Q;  4UY8 C;  4QL5 A;  1UE1 A;  1VQI A;  1D7Q A;  3CC2 A;  4X64 Q;  2VQE L;  4K0K Q;  1T9H A;  2ZJQ A;  1PH1 A;  3H0G H;  1V1Q A;  2N49 A;  1A63 A;  2F4V L;  2CCZ A;  3ULL A;  1GO3 E;  5FLX c;  2F4V Q;  5M5W H;  1VQJ A;  3S1N H;  1WI5 A;  2VY3 A;  3AQQ A;  4JI0 L;  3TS2 A;  4DR4 Q;  4O0A A;  2OQ0 A;  1HNZ L;  4JBJ A;  3J7A 5;  1VQD A;  1B70 B;  5C4X G;  2R7Z G;  2EQS A;  1V9P A;  3PUV A;  2UUA Q;  3K81 C;  1X3E A;  1VQO A;  2IX0 A;  4BY1 G;  1NE3 A;  2K4K A;  3K0X A;  3MEF A;  3KDF A;  4UP9 A;  4JI2 Q;  1IBK L;  1Z47 A;  3STB C;  1HNX Q;  3HOX H;  1AE2 A;  3UDI A;  4LF5 Q;  1FVI A;  2BH8 A;  4BBR H;  1HR0 L;  3CCE A;  4A3C G;  4JI3 Q;  3F8T A;  4GN3 B;  4MNO A;  1IBK Q;  4JI2 L;  4LFC Q;  3S2H H;  2JA5 G;  4A3G H;  3HKS A;  1VQL A;  3A0J A;  2K50 A;  3WWV A;  1X56 A;  3J80 c;  1JMC A;  2RCN A;  4AIM A;  1WCM G;  2WAQ E;  3BU2 A;  3M3Y H;  4DR7 Q;  1QVG A;  4IPC A;  4Y7N H;  1TWG H;  1YHB A;  3W1G A;  3ICE A;  2K5H A;  3D31 A;  3ZJY C;  4BBS H;  4GNX A;  4DV1 Q;  1CSQ A;  1EWI A;  4PG3 A;  3RR5 A;  2R92 H;  5M5X H;  5IP7 H;  3F2D A;  1I3Q H;  3K80 C;  1EQR A;  1ASY A;  3L7Z C;  3M4P A;  3PCO B;  4DV6 Q;  4LF6 Q;  4DV1 L;  1YHQ A;  2GN5 A;  4OO1 G;  2QGQ A;  3TS0 A;  1BBW A;  3G6E A;  2ZM6 Q;  1AH9 A;  3MXN B;  2CWA A;  3Q8D A;  1WCM H;  2CKZ B;  1CKM A;  2LXJ A;  5GRO A;  3W5O A;  2A1A A;  1Y1W G;  3CCL A;  2D62 A;  4A3M G;  4B3R L;  3UDG A;  2R92 G;  1UWV A;  4QY7 A;  3U4V A;  1HNW L;  1PYS B;  2YYZ A;  4JCV E;  4R4I A;  3GTL H;  4IPH A;  2JQO A;  3ULJ A;  5IYD H;  4JBK A;  4LF5 L;  4JI0 Q;  3G48 A;  1XPO A;  1XMO Q;  5JJL A;  2ES2 A;  1VQK A;  4UPA A;  4GNX B;  5IYD G;  4OWW B;  4IOC A;  4L5Q A;  4A4I A;  4EQ5 A;  1PFS A;  5FJ8 H;  1UE6 A;  2UXD L;  1CKO A;  4R1J A;  1NY4 A;  1HR0 Q;  2AMC B;  4LUO A;  1XMO L;  4HJ5 A;  4YWM A;  3M4O H;  3PO2 G;  2UUA L;  4DNI A;  4POG A;  4BBS G;  4R4Q A;  4GLV B;  4DK3 C;  5HGQ A;  4HIM A;  3PO3 G;  4LF4 Q;  1VQA A;  2A8V A;  3NEM A;  4YCV A;  5IYB H;  4YCU A;  5IYC G;  1YHA A;  3TRE A;  4PZ8 A;  4A75 A;  2PMZ E;  2RHS B;  3ERS X;  4LW1 A;  4NXN L;  3H3V H;  4R4C A;  1LTL A;  1PH3 A;  4P71 A;  3SGI A;  4C3J H;  5ELN A;  3ULP A;  3JAM c;  4POF A;  3HOX G;  1CUK A;  3RNU A;  5DLQ E;  4A3K G;  3GTP H;  4A3M H;  1CKN B;  2OTJ A;  3S2D H;  1OXU A;  2NVQ H;  3PF5 A;  2KBN A;  4IFD I;  2UUB Q;  2Z6K A;  1Q8K A;  3D0F A;  2YTX A;  2VQE Q;  4LF9 L;  1HZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...