4B3SL

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sL00
1XMOL 3CPWA 5JJLA 1IZ6A 3F2CA 5C0XJ 5IP7H 1VQ9A 5BR8Q 3K7UC 2YU9H 1VQNA 4FDBA 2CQOA 4A3IH 2B63G 3CP0A 3PSIA 4WJ3M 3S16H 2E8GA 4NXNQ 1EUJA 1TWGH 2PNHA 4LNQA 2XTIA 1U0LA 3GTLH 2YTYA 2YTVA 3BU2A 3OTOL 3CCQA 4LFCL 4DV0L 5DLQE 1HNZL 4XTCS 2UXBQ 4QL5A 1SR3A 5GAGC 4YCVA 4GKKL 4JI1Q 4B3RQ 3PUZA 1Q1EA 2UUCL 2RHQB 2JA6H 3HOWG 1HZCA 2IY5B 1HNZQ 4A3LG 4QGUA 5ELOA 4DR5Q 2A1AA 4IO9A 3HOVH 4JI3L 2WFWA 2UUCQ 1KRTA 3NBHB 2EQSA 1O7IA 3M4QA 1IYJB 4MTNA 1J5EL 3CCSA 2R7ZH 2WB1G 5C3EH 1KQSA 4BY7H 4UP7A 3S24A 3HOZG 2JJQA 3Q8DA 5M3MG 4JBWA 3PIOA 2UU9Q 1N33Q 2D0PA 1NTGA 1YI2A 1S72A 4IPHA 1L1OB 4IOCA 4LUZA 4X62Q 3I4NH 4GNXA 1EWIA 2K5VA 3HOXG 1X54A 3STBC 4LUOA 5C44G 3J7A5 4YHHL 4P71A 2ZTEA 1I5FA 4UP9A 5LMNL 3BJUA 2K4KA 1PH7A 3AFPA 5IP7G 1NJIC 5LMNQ 1UE7A 2BA1A 3CCVA 1IXRA 3J7ZC 2LXKA 4PZ6A 3KF6B 2ZJRA 4Y7NH 2ES2A 5ELNA 4AIMA 4A3EG 1YJ9A 1CKMA 4OONA 3CMEA 1G291 3EIVA 5IE8A 1L1OA 3HOYG 2ZTDA 3AQQA 4YY3L 4GKKQ 4X66L 1N32Q 4AH6A 2VL6A 2B63H 4UP8A 3G4SA 3CCJA 3HOZH 2WB1E 1WYDA 3AYHB 4DK3C 1WCMG 3UE0A 4AQYQ 2JA8H 3GDEA 4A3LH 1PH2A 2D0OA 4HJ8A 5IYDG 1CKNA 1T9HA 2HIXA 3ULJA 1B7YB 4A3DH 1PFSA 5LMNW 2NVYH 4BBSG 1XPUA 5FLXc 4DR3L 2Z0SA 2VQFL 2RCNA 4A3GG 3KF6A 1XMQQ 1KHIA 3I2ZA 3HKZE 3S1RH 4LF8Q 3HOUG 1TWCH 4L5SA 1N9WA 1OXVA 4PZ8A 2ZM6Q 3F2BA 1PYBA 2ZJQA 1N33L 3PO2H 1C0AA 4B3TL 4TVAB 4DV4L 4DR7Q 1TWFH 1X9NA 1SFOH 3RZOH 1KC8C 1PVOA 1YJWA 4KHPL 4B3TQ 1Q46A 3KJOA 5C3EG 1LUZA 2IHFA 5HGQA 1Q8KA 4KHPQ 2PMZE 3UDFA 4OWWB 1U5KA 3PO3H 2JA5G 4TQUS 3T1YQ 1GD7A 1SLJA 4R4CA 3J80i 1VQPA 3L0OA 4LF5L 1AE2A 4DR2Q 1XNQL 5IP9H 4B3SL 2VUMH 1I94L 3CQZH 4IFDI 1D7QA 4P73A 4XIGS 3KYHC 3H15A 3T1YL 4LF5Q 4BY7G 2JA9A 3S14H 3F8TA 1PYSB 2I5MX 4QIWE 4DV1Q 4P75A 3KDFB 4B3SQ 1A0IA 4B3MQ 1SROA 4PG3A 1KD1C 1IBLL 2PI2A 4RMFA 4X66Q 1OTCA 4A3KH 4BA1I 4GKJL 3CD6A 1HZBA 1MIUA 1VQFA 3WWVA 1KAWA 5H1SE 3A5UA 1YBYA 5C44H 3MEFA 4JG2A 4JBJA 3S15H 5C4XG 4GKJQ 1HNWQ 2VNUD 1QUQA 2VY3A 4A3IG 4GLVB 1SRUA 1VCIA 1XPOA 3CCEA 3NENA 4UY8C 4DR3Q 3CCUA 1ASZA 4JYAL 3T1HL 4A93G 4ME3A 2KCMA 4R4QA 1EIYB 3B6YA 1NMGA 2ZM6L 4OO1G 2RHSB 3KDFA 4IFDJ 1E3PA 1GO3E 3CF5A 4HIDA 4OX9Q 2HHHL 1IBMQ 1I50H 2IX1A 2IHEA 4DR7L 3JAMc 1D8LA 3KFUA 2MFIA 1NY4A 5IWAL 4LW1A 1C7YA 3HOUH 2EXDA 4L5TA 4DR4L 1C9OA 1UWVA 2VZAA 1X65A 2R93H 2UUBQ 3TS2A 5LMUL 1V1QA 4A93H 2A8VA 5EAYA 1A63A 3CPFA 3AFQA 5IP9G 3TS0A 2UUBL 1Z47A 3K80C 2L15A 4GOPA 3NELA 1K8GA 1WI5A 5IT9c 5FJ8G 1UEBA 1NMFA 3E0EA 1HJPA 2QEXA 1JJ2A 2KHIA 4BBRG 4NPSA 3I56A 3ZJYC 2DUDA 2GN5A 3S1MH 3DM3A 4IJLA 1KIXA 4LF4Q 4A3BG 4DV6Q 2B3GA 3KJPA 4A3DG 1A62A 2Q2TA 1QVCA 1B8AA 2MO0A 4BBSH 1PH9A 4JI5Q 4NXML 4A3FG 4JI4L 4BA2I 3H3VI 4L5QA 2AMCB 4DR6Q 2AWOA 3JAMi 4KI0A 5AJ3L 5JEAG 4GOPC 4X6AH 1V43A 1GM5A 1EOVA 3E9IA 4C2MH 4C3HH 3PO2G 4IPDA 1E24A 3G71A 1IBKQ 1K83H 1V9PA 1VQJA 3TQYA 1PHJA 3OYYA 2N8NA 4O2DA 5IY0A 1SE8A 4DR1L 4A3MH 2LXJA 4DAYB 4A3BH 3CAMA 3FHWA 3OW2A 1YIJA 1JE5A 2I5HA 2NZHA 1PH3A 2OWOA 2JA8G 1VQLA 2OCEA 4A4IA 4L5RC 5IYDH 1KRSA 2N3SA 4JI2Q 4JI1L 3PUWA 4HJAA 1Q82C 2K14A 4IOAA 2D62A 1K0RA 4JV5L 1I6HH 3KOJA 1TWAH 2CWPA 3K7AH 1HNWL 4JI0Q 4GN4B 3S2DH 3J81i 4DV7Q 1QVFA 5HY6A 3K8AA 3UDXA 1HZ9A 1Z9FA 3ICEA 3S2HH 1OXXK 1JJGA 3L2PA 4OXPA 4MZ9A 3ULPA 2JA7G 1UE1A 5JEAJ 3M3YH 2KBNA 3PUVA 3KLWA 2ZJPA 2HIVA 4JI8Q 4X64L 4KLKA 3BZCA 4C3JH 4QJFA 4X62L 2Q2UA 2R7DA 2Z6KA 2WAQE 4JOIA 1Y1WH 3PO3G 1VQKA 1CSQA 3D0FA 1HR0W 4JI8L 2MQHA 5BR8L 3TEHB 4ALPA 2K50A 3GTGH 3M7NA 1BKBA 1K3RA 4EX5A 1FVIA 1YHAA 5M3MH 1N34Q 3A5ZB 2R93G 2PQAA 1A8VA 1MJCA 1Y1VG 2F4VQ 4GLAC 3RN2A 1B70B 1PH5A 3I4NG 1CSPA 2JA7H 4GNXC 4IPCA 1PH8A 4JI7Q 1VS0A 3M85A 2CKZB 1E22A 4OWTB 5M3FH 4POFA 4A3KG 1P16A 2K5HA 3PIPA 4BY1H 1LM0A 3E9HA 5FLMH 4HJ7A 4BBRH 2I5LX 5C0XI 2OQKA 1VQAA 1WFQA 3I55A 4GNXB 1WOCA 2N78A 3GTQH 2R6GA 3SGIA 1I3QH 3PF4A 1N32L 1Q1BA 4DV0Q 2IX0A 5J3BA 1OXUA 4LFCQ 2NN6G 1Y1VH 4LF7L 2AWNA 1J5EQ 4MNOA 4AYBG 1N8RC 1HZAA 2Y0SG 1X55A 2H5XA 1DGSA 1JJCB 2JEBI 1TXYA 1HR0L 1HNXQ 3S1NH 4LF7Q 1TWHH 3UDIA 2E2IH 2OTJA 4IFDG 2OTLA 5FLMG 3CXCA 2UUAL 3GTKH 4LF8L 4LUVA 2Q2HA 1CKOA 4GLXA 2VW9A 4LFAL 2NVTH 3UDGA 1VQGA 1X3GA 4JC0A 4NB3A 2UUAQ 2MO1A 4DV4Q 4DV5L 1YEZA 4YCUA 2E5LL 2WAQG 4A3CH 4A3JH 4IJHA 4WJ4A 4DUZQ 2F3IA 5GAHC 1JB7A 3HOXH 1CKNB 3GO5A 2F4VL 1X6OA 4YHHQ 4DUZL 1KXLA 3TREA 3J81j 2JA6G 3HOWH 5IYCG 4O0AA 4NXNL 1I94Q 4GN3B 2HQLA 1YHQA 3J80c 1GVPA 3TRZA 2CWAA 3OTOQ 4R1JA 3W1GA 1FJGL 2JQOA 4BY1G 4UPAA 3CCLA 4B3ML 2UXBL 3CC7A 2RF4A 4R4OA 1QZHA 2R92H 4A3EH 2IT1A 4PMWA 4DKAC 4B3RL 1E1TA 2ATWA 1FJGQ 1KL9A 4YY3Q 2VQFQ 1NBWA 1PH1A 3GTOH 2ALYB 1XMQL 2K75A 4A76A 3U58A 4P72A 1HR0Q 1ASYA 3VDYA 3GTJH 5JJKA 2Y0SE 4HJ9A 4JYAQ 4AYBE 3S17H 2GVAA 3ER0A 1YJNA 3W5OA 2QA4A 2I0QA 4JBKA 1NE3A 2DGYA 5M3FG 3RZDH 1EIFA 1CUKA 3LGJA 1L2FA 2K5NA 3PGZA 2E5LQ 4P74A 1JMCA 1OXSC 1YHBA 2FXQA 3L7ZC 3F2DA 4A75A 5C4JH 3EN2A 1BVSA 1IL2A 4YCWA 3FKIH 2JA5H 1MKHA 1AH9A 1VQEA 4LF9L 1BBUA 3HOYH 3NEMA 5LMUQ 2BH8A 1BBWA 1UE6A 1EQRA 3CC4A 4PZ7A 3FP9A 3H0GH 4A3JG 1VQ8A 2ASBA 3U4ZA 1X56A 4DPGA 4LF9Q 1K73C 1WCMH 4EQ5A 3M9BA 4DV2Q 3PF5A 4DR2L 3CW2C 4GOPB 4C3IH 2NZOA 1XPRA 1VQDA 1W3SA 3J81c 4JOIC 4A3GH 2E2JH 4DV6L 4GN5A 3HFZB 4AQYL 3CCMA 4X65L 2UXDQ 1S3OA 1XTDA 4JI5L 5FJ8H 1LTLA 3CCRA 4DUYQ 1FGUA 3T1HQ 1Q7YC 5IYBH 3GTMH 3PUYA 3RNUA 1XNRL 1Q86C 4LFBL 1L0WA 5AJ3Q 1QZGA 5E7NA 4X65Q 2UXDL 5K36G 5GAEC 3UE1A 2R7FA 2KCTA 4YWLA 1RL2A 2BA0A 1IBML 4K0KQ 3U4VA 2JE6I 3IRBA 4APVA 4LFBQ 4A3CG 1E7ZA 2KHJA 1VQ5A 3D31A 4Y52H 1MJEA 2CFMA 1M1KC 1OXTA 4IPGA 1EYGA 4LF6Q 2V1CC 4KHZA 3EBEA 3I4MG 4BXXG 3CMAA 1YVCA 4R4TA 4J15A 3RLNA 3ULLA 5M5XH 2VQEL 4DR4Q 3GD7A 4HIOA 4QY7A 1VQHA 3HKZG 4OX9L 1QUQB 3K0XA 2E2HH 4POGA 4OO1I 4A3MG 2VQEQ 2YYZA 5IWAQ 1Q81C 2Q2IA 2MNAA 4DNIA 3H3VH 1J6QA 1HH2P 2C35B 3BZKA 2WP8J 1XNQQ 3F1ZA 2N49A 3HOVG 1P8LA 2GVBA 2HT1A 3RLOA 5C4XH 4HIKA 4DV2L 5GADC 5GROA 4DV1L 4LF4L 2YTXA 2NN6I 3S1QH 1VQMA 3U50C 4DV3Q 1IBLQ 2R7ZG 1H95A 3H0GG 1L1OC 1PH4A 1SN8A 2OQ0A 1LYLA 1FL0A 1RIPA 2K52A 3G6EA 1PH6A 2AHOB 1VQCA 4HJ5A 1K9MC 4QQBX 2VS1A 3FKIG 3RLFA 4DUYL 2B29A 4DV3L 3PUXA 1VQ6A 2QGQA 2UXCQ 1Y14B 1YZ6A 2KENA 5IYCH 1IBKL 5IYBG 4DAMA 1N34L 1XNRQ 4JBMA 1Q12A 3PCOB 4A3FH 2ZTCA 1JT8A 1PV4A 4NXMQ 4JI4Q 2PQAB 4GS3A 4K0KL 4DR6L 1VQBA 2Z6KC 3HKSA 4JI7L 1Y1WG 2R92G 4JI6Q 2PI2E 1QVGA 1K8AC 2ID0A 2JEAI 3GTPH 1AE3A 2AKWB 4YWMA 3K81C 4LF6L 1G51A 2HHHQ 3G48A 4JV5Q 1VQOA 1X3FA 4JI6L 1VQIA 5M5YH 1R9TH 4DR1Q 1N36L 2XGTA 1E1OA 4DV7L 2CCZA 3CC2A 5M5WH 4H02A 1X3EA 2NVXH 3MXNB 5GQOA 4DR5L 1N36Q 4JI2L 1S40A 3AEVA 4JI3Q 2LSSA 1YNXA 3I4OA 4DK6C 1SMXA 4BXXH 1EQQA 1EFWA 1G6PA 3I7FA 4JCVE 5C0XG 4RG1A 2A19A 3PV0A 1HNXL 3ERSX 4JI0L 4X64Q 1M90C 3M4OH 1PA6A 2BH2A 2EIFA 3JC66 4R4IA 1VQ7A 3RR5A 3W1BA 3A74A 5JJIA 3RN5A 2UU9L 1GKHA 2VUMG 4LFAQ 1W2BA 2JK8A 3STBD 4YWKA 2NVQH 3I4MH 1WJJA 2F52A 3A0JA 4DV5Q 4HIMA 1YITA 1XJVA 1XMOQ 3KF8B 2YV5A 4OWXB 3M4PA 3DLLA 2UXCL 1VQ4A 1UE5A 4LWCA
chains in the Genus database with same CATH superfamily
1QB5D 4DU9A 3AMUA 1EL0A 3C1FA 4A3IH 4WJ3M 1HFGA 1IYUA 5DM63 3R3OA 3TP8A 5M3MB 3GTLH 3BU2A 2YTVA 2F0PA 4DV0L 4IUUA 5DLQE 3PIO3 2HQEA 4XTCS 3GTMB 2NVTB 1SR3A 4EVOA 1O7ZA 2RHQB 3OOCA 3HOWG 1HZCA 4OHJA 1HNZQ 4QGUA 1I4QA 3M3YB 1TQOA 1IW7D 1LT6D 1KRTA 5CV8A 3EROA 1O7IA 2G5DA 3HS0C 2R7ZH 4BY7H 3S2DB 4UP7A 4I7ZC 1WTPA 3PIOA 2K7VA 2WV6D 2DY8A 3KF8A 1S72A 1JWMD 4IOCA 4LUZA 4X62Q 3CRLC 2ZXPA 2B2VC 2ZTEA 5LMNL 1H9SB 2EY5A 2K4KA 1PH7A 5JPMC 5IP7G 5LMNQ 1EWCA 2LXKA 2ZJRA 4OO1H 4AIMA 5CGKA 1G291 3HOYG 1TR5A 2ZTDA 4K6DA 2IJ0A 4X66L 5CC4A 1QG7A 4UP8A 3G4SA 2WB1E 4DK3C 1WCMG 3UE0A 2K33A 4A3LH 1K3BC 1BOSA 1SMYD 1VF5C 5IYDG 3VR2A 3KLSX 4X3TA 1PFSA 3V05A 4DR3L 4IUVA 3MTSA 1STBA 3NTKA 3S1RH 4LF8Q 3HOUG 1N9WA 2K28A 5EKLA 1N33L 1C0AA 3NHHA 4X3UA 1LTRD 4DR7Q 1SFOH 1BF4A 4A3IB 1KC8C 1PVOA 4KHPL 2MHVA 1MD2D 1Q46A 1LUZA 5KYIA 1Q90A 2IHFA 4TRDA 5CV7A 4KHPQ 2PMZE 2RBMA 1VQPA 4LF5L 1SLJA 4FF4A 1AE2A 2PZUA 2XNAC 3J7AF 3QOJA 5IP9H 5LL6X 2O2LD 1GUNA 1K28A 2L5TA 4XIGS 3KYHC 3H15A 1EYAA 4BY7G 2JA9A 3F8TA 4P75A 1SROA 1ET9A 1KD1C 4GKJL 2PI2A 4L63B 1IKLA 5JVG3 1HZBA 1MIUA 1VQFA 3WWVA 1KAWA 2K1BA 3SK5A 2KVMA 2HCCA 2VY3A 2EYHA 3T53B 3SE0A 3CCEA 3X3MA 4UY8C 4FXKC 3CCUA 1K8MA 1SNOA 3X3NA 4DF7A 2F0EA 4R4QA 1NMGA 2ZM6L 4OO1G 3KDFA 1FNWA 1GO3E 1B9MA 3D6CA 2IHEA 2ICIA 3JAMc 1EZ8A 1O7YA 1YNJC 2O5IC 2KCCA 1C9OA 1PTOD 1UWVA 4ILWA 1ET6A 1X65A 4DR4L 2XSCA 2N88A 1HQMC 3R2TA 4A93H 5EAYA 2NB0A 4E6IA 2I46A 3AFQA 2A68C 4KKSA 1PRTF 3NELA 1RCVD 1UEBA 2A74C 3E0EA 2KHIA 1QILA 4HCEA 3I56A 2DN8A 3NTHA 4OGQC 4PNYA 3SK8A 4LF4Q 3KLRA 4DV6Q 3BZDB 3KJPA 3J7AV 1F2YA 5LHY1 2EY6A 4A3FG 4JI4L 1VMPA 2AMCB 3HZXA 3P1HA 2AWOA 3JAMi 4GOPC 1V43A 4C3HH 4A3MB 5KNBA 1VQJA 1PHJA 3OYYA 1DOLA 4A3BH 3FHWA 4N9PA 5CV4A 1PH3A 1VQLA 4L5RC 1KRSA 2N3SA 3PUWA 2EJMA 4IOAA 1BCPB 2FHTA 2EYPA 4K5VA 1TWAH 4O1NA 3P20A 3J81i 5JVH3 1QVFA 3K8AA 3UDXA 1HZ9A 3Q23A 3ICEA 5C5LA 3E6ZX 3R93A 3L2PA 2B63B 4OXPA 2JA7G 4A3EB 5JEAJ 3M3YH 3KLWA 2HIVA 1STEA 4KLKA 4QJFA 3T51B 2Z6KA 3PO3G 1VQKA 5CV6A 3ND8A 1FVIA 2X69A 5M3MH 4WJWA 1RJTA 1Y1VG 3M7GA 1PH5A 1Y8NB 2WAQB 1CSPA 4IPCA 1TWFB 1PRTB 3QIAA 3NE5B 3M85A 2XWJB 2N55A 1T5EA 3DMUA 4BY1H 1X3PA 5FLMH 1WFQA 4ZKCB 3I55A 3GTQH 1N32L 3SGIA 3PF4A 4XDXA 4DV0Q 1IKMA 1CI3M 2QKIC 5DM73 1PZJD 1L0YB 1JJCB 1GUSA 1TXYA 2PCFB 5C5MA 1HNXQ 4C3HG 2K6AA 3CU7A 4Y7NB 3HOYB 5IOCA 2E5LL 4YCUA 1I4HA 4A3JH 2L9HA 2M2LA 2F3IA 4A3BB 5GAHC 1X6OA 4DUZL 1KXLA 4GZYC 2LFNA 4A3JB 1DM0B 4KKTA 3HOWH 3BDLA 4GN3B 2HQLA 4KD3A 2I07B 1U4LA 2F0VA 3CCLA 3EVQA 1C8CA 4PMWA 4B3RL 2ATWA 1I6VC 3KLSA 4YY3Q 2VQFQ 1NBWA 2NTTA 2ALYB 2CH4W 2K75A 1XMQL 3U58A 3BVMA 4P72A 1HR0Q 4L6TB 5JJKA 1JWSD 3S17H 3W5OA 2NN6H 4CJ1B 4HEDA 2QA4A 2EJGC 3RZDH 3C2PA 3GQBA 2JP1A 1CUKA 1EWHA 1MGSA 3PGZA 2SNSA 1JMCA 5C4JH 1BVSA 2VB3X 2WKCA 2ZXRA 4YCWA 4KD4A 3WOEA 1MKHA 1ZXTA 3I4LA 1QNUA 3I4NB 2AQ1B 4LF9L 3HOYH 1EY8A 1WTQA 2BH8A 1UE6A 4TSSA 1B50A 3U4ZA 1IL8A 3H94A 2RDFA 4LF9Q 1WCMH 4DV2Q 1LT4D 4HTHA 4FF1A 4KKUA 1S5BD 3CW2C 4GOPB 1SE2A 2EYFA 2NZOA 1VQDA 1W3SA 1ENAA 1W6JA 1B44D 1I3QB 3BDCA 1XTDA 4DUYQ 1FGUA 1NSNS 4KK7A 1Q86C 4LFBL 5K36G 2E2HB 5GAEC 3Q22A 2R7FA 1RL2A 2OEOA 3U4VA 4LFBQ 2CFMA 1M1KC 2B2YC 1EYGA 4BXXG 4KHZA 1CQFA 3ULLA 2F0NA 4HIOA 2PNRC 2XRSD 4OEMB 4OX9L 4C1NI 3IL8A 1WTHA 2YYZA 4IFDH 2Q2IA 4ZKBB 4OELB 3Q6SA 4RHRA 2WP8J 3AB9A 2HT1A 3RLOA 3IKJA 4EQNA 1Q3LA 4HIKA 1VQMA 3U50C 1PH4A 2OQ0A 1LYLA 1FL0A 1PH6A 1RTNA 4QQBX 2VUMB 2QGQA 1A3VA 2G9DA 4DAMA 4N8X1 1PV4A 1DD2A 1NCVA 3SDZA 4GS3A 4K0KL 2WB1B 3HKSA 5ELEA 4JI6Q 3MXPA 1LTBD 1QVGA 4C3HB 4YWMA 3K81C 3OHXC 1NR4A 4PMBA 1VQIA 1R9TH 4PQXA 1E1OA 4OIJA 5D65A 5M5WH 1EQVA 2OF1A 3MXNB 4NMZA 3S1MB 1N36Q 1YNXA 1TVXA 1G6PA 1HNXL 1EY7A 3HGBA 4JI0L 2J4XA 4C3IB 3RR5A 3A74A 5JJIA 1FGBD 3RN5A 1SNDA 4LFAQ 2RSOA 2AUKA 3A0JA 2ENBA 4HIMA 5K5PA 4N9TA 1XJVA 1XMOQ 2Z4IA 3H0GB 2YV5A 4OWXB 2KHSA 1C4QA 4G7HC 1XMOL 4DA2A 5E1FA 2E75C 1VQ9A 2Z6BA 3K7UC 2DY7A 4CDFC 3TZUA 5CMDA 2R3ZA 2CQOA 5I9OA 1VQNA 4NW2A 2YU9B 2PNHA 2XTIA 2YTYA 1EZ6A 3CCQA 1IHZA 4LFCL 1V1PB 1B3QA 1STAA 3D6WA 4JI1Q 3PUZA 5ELOA 4BS9A 2Y0SB 2A1AA 1D5ZC 4ZYSA 2C5CA 1PMRA 2Q8TA 2EQSA 3L3OC 1IYJB 4MTNA 3RMHA 5D3IB 2WB1G 5I9PA 3S24A 1UAPA 3HOZG 5M3MG 1TWAB 2D0PA 1FNUA 1YI2A 4IPHA 1XWEA 4GNXA 2K5VA 5CV5A 1Z6HA 3HOXG 5M5YB 2A5HA 2FFKB 4LUOA 2NUCA 2B2TC 3AFPA 1UE7A 2BA1A 3CCVA 3KF6B 1S4ZA 4R8NA 5ELNA 4A3EG 1A6XA 1CKMA 4OONA 5CBEE 3NXWA 3I3CA 3AQQA 4GKKQ 3FPPA 2B63H 3M4YA 2QEJC 5C3XA 1WYDA 2LKVA 3GDEA 2P5ZX 4B9WA 1PH2A 2D0OA 4HJ8A 3DWQA 1B4OA 3ULJA 4A3DH 1VDZA 4A3GG 3KF6A 1XMQQ 1KHIA 4WRDA 1TWCH 4PZ8A 2ZM6Q 1T5XD 3PO2H 4B3TL 2TSSA 1TWFH 2V4DA 2A69C 1PTOC 4B3TQ 5C3EG 5HGQA 2Z1CA 2B39A 3EA6A 3PO3H 5JEAH 2JA5G 4TQUS 1LTID 3T1YQ 5EKKA 1JICA 4DNTB 4P73A 4EQPA 3T1YL 2F3WA 3HOZH 4B3MQ 4B3SQ 3QWNA 3N6RA 3D4RA 1AZPA 4PG3A 1HNWL 4BA1I 3D8GA 4FO2A 4C3IG 3A5UA 1HNWQ 3HOZB 1VCIA 4QUCA 2CH4A 3NENA 4DR3Q 1SNPA 1ASZA 2D9UA 3GV3A 1C48A 2F3VA 3MHBA 1WD1A 1BDOA 4A93G 1UEAB 4ME3A 1KDAA 2KCMA 1EIYB 1FR3A 2RHSB 3MC0B 4IFDJ 3CF5A 1I50B 1TKWB 4RCOA 4KY5A 1LTAD 5IWAL 1B3AA 1HHVA 4L5TA 4ODGA 5D3DA 1AFPA 1OO9B 1Y69U 3TS2A 1V1QA 1QJOA 3ERQA 3FVQA 3S1RB 1UUPA 3DM1A 4RHSA 5IP9G 1HA6A 1Z47A 3NP8A 3GTJB 4GOPA 1HRJA 1WI5A 4A3DB 5IT9c 1NMFA 2MP1A 1DOMA 1B53A 4BBRG 1B9NA 3MA2B 2DUDA 1ILPA 4IJLA 1KIXA 3A54A 4A3BG 1E2VA 2D5DA 4A3DG 2Q2TA 1QVCA 2HD3A 4NKLA 3K5OA 3C3LA 1SBBB 2CW0C 4KI0A 5AJ3L 1EIHA 5JEAG 1EOVA 1HTPA 3K5NA 3PO2G 4IPDA 1E24A 1SYCA 3G71A 1STNA 1ZYRD 1V9PA 2E74C 3TQYA 4PMCA 4EQOA 2N8NA 3CHBD 1SE8A 3GP7A 4ZQ3A 1KAAA 2JYOA 3CAMA 2KEDA 1YIJA 2NZHA 1V8QA 2K05A 1E0BA 2A6EC 4JI1L 1Q82C 3MXGA 2D62A 4G7OC 1K0RA 4H7BA 4DGZA 2KEEA 2CWPA 3K7AH 3MAQA 4N8FA 4DV7Q 4DXGA 5I4DA 3S1QB 3NQIA 3SVMA 3VYSA 5C4XB 2RDHA 1HCZA 5LL6S 4DAYA 3KK7A 4LAAA 3FPUB 2BDOA 2BCOA 2EE1A 2L4NA 1ICWA 1GJXA 4V0BA 4X64L 4C3JH 4K5WA 5T1GA 2WAQE 4JOIA 4ZAIA 4C56C 4XT1B 5IGFA 1CSQA 4JI8L 4K8IA 1CT1D 1N34Q 3A5ZB 1KDBA 1A8VA 4ZUIA 4GLAC 3RN2A 1B70B 2NYZD 2ICEC 2A6ED 4IALA 1QWYA 2XRQD 2M00A 5M3FH 1ICFB 1LO5D 3BVGA 5KYLA 3E9HA 5C4HA 1WTRA 5IT9L 4BBRH 5C0XI 2OQKA 1PRTC 4GNXB 3K58A 3TP7A 5AFWA 1GHKA 5J3BA 3KBGA 4F88A 2CQAA 2AWNA 1J5EQ 1N8RC 4A3GB 1HZAA 2LY7A 3IAYA 3T56B 2K01A 1X55A 4IFDG 3VA5A 3CXCA 4LUVA 2EVBA 5EQ0A 3UDGA 4JC0A 4NB3A 1LTTD 4J8QA 2UUAQ 2IPKD 1TWGB 2A73B 1I4RA 1JB7A 5M9OA 3GO5A 1RKNA 2PZTA 1ONLA 3TREA 5ELDA 2B8FA 1A2UA 4K2KA 1YHQA 3C46A 3NPPA 3OTOQ 5ELCA 1FJGL 2JQOA 4BY1G 3GTKB 2IX3A 2IT1A 5E4XA 4XXEA 4C3JG 1PFMA 4DKAC 1FJGQ 2PO4A 1I4PA 2KOLA 4CKCA 2LS01 4R8IA 1SE4A 2Y0SE 2NVXB 1YJNA 3HRZC 3R8BA 3HOWB 2F0TA 1LACA 4JBKA 2DGYA 5M3FG 4XYQA 4P74A 1OXSC 1YHBA 2FXQA 2L1BA 1JORA 2BOSA 1CA5A 4S3SA 1BBWA 4PV1C 1K8OA 1JWUD 2OXPA 2NVQB 4EQ5A 5EBCA 3PF5A 4DAPA 2F0HA 4DR2L 3NTIA 3OMGA 1GXDC 2NBFA 3G6JB 1A2TA 4BWGB 4A3GH 2F0OA 5JJZA 3HFZB 3ITPA 2QCPX 3OIQA 3VR3A 4X65L 3CCMA 1S3OA 2UXDQ 1U4PA 3CCRA 1GUTA 1S5DD 5IYBH 1PTOH 1D1IA 3RNUA 2R61A 1L0WA 5E7NA 4X65Q 2UXDL 3UE1A 4YWLA 1D5MC 2JN4A 5IODA 1VQ5A 5IGCA 4Y52H 1G91A 5EGTA 2ZXOA 4DR4Q 4KHVA 2VQEL 1H9KA 3HKZG 2L0CA 4HSPA 2B2VA 2F0DA 3I72A 1VMCA 5IWAQ 2C35B 3BZKA 1YNNC 2HUGA 4K14A 1G2TA 2B8GA 5G3LD 5FOBB 4DV2L 2KJXA 5GROA 3A8JE 1CFMA 2MJ8A 4QCLA 4HMIA 1H95A 3H0GG 4DNRB 1SN8A 2O5JC 4ID6A 3G6EA 4FXGC 2AHOB 1K9MC 1ENFA 4DV3L 3BS1A 4DUYL 2F0SA 1TU2B 1II3A 2UXCQ 2KENA 1IBKL 1EIGA 1QNKA 1JT8A 2PQAB 2Z6KC 1Y1WG 2R92G 1SJHD 2KUMA 5FK9C 1SFOB 2HHHQ 5TSSA 2FMCA 1J8IA 4QF4A 3FEWX 4BBSB 5J39A 1X3EA 3U9SA 1O7LA 3K59A 5GQOA 4DR5L 1F2LA 2XVSA 1QCBD 1CTMA 4K2LA 1HPCA 3I7FA 5C0XG 3PV0A 1WTOA 3ERSX 4A3KB 1VQ7A 1LT3D 4CGYB 3OSOA 1SJED 1Y1VB 4YWKA 2NVQH 1SYFA 1WJJA 2F52A 2JA6B 4DV5Q 3DWPA 2AQ2B 3KF8B 5A2QE 2Z9HA 1TS4A 3BYTB 3M4PA 3TN2A 1AN8A 3DLLA 3E0JA 3T4AC 3P75A 1XYIA 3VR6A 4Z9CB 3F2CA 1TS2A 3HOXB 1O80A 5BR8Q 4KY7A 4IUTA 3NK9A 3PSIA 2PW5A 4NXNQ 1TWGH 1BNZA 1HFNA 1U0LA 3OTOL 3TBIB 3S9WA 1HNZL 2UXBQ 4QL5A 1RDPD 3I70A 5GAGC 4GKKL 2UUCL 3S15B 2IY5B 3K5LA 2X6GA 3L9AX 4HAEA 3GTOB 3HEJA 2UUCQ 5E4WC 3NBHB 4F87A 3C1EA 3M4QA 4CHTB 1J5EL 3MFGA 3CCSA 5HGTA 3CQZB 2JJQA 3Q8DA 3WDNA 2UU9Q 4JBWA 2B2WA 5M5WB 1L1OB 5EPJA 1EWIA 4X3SA 2RKSA 1R9TB 3J7A5 4HR7B 1RTOA 2HCIA 3H91A 2F0GA 3MEHA 3BJUA 4RCNA 1GOZA 2DJGC 5IGEA 4RWSC 4XYOA 3GTGB 3J7ZC 2K03A 1ILQA 4PZ6A 4DK0A 3J7YW 3Q0AA 5ELFA 1D2BA 5L37A 4Y7NH 2ES2A 4DN4M 1YJ9A 1F9SA 3CMEA 5IE8A 5C3EB 4FP5D 4YY3L 1N32Q 5I2XA 3CCJA 1NNXA 2K5WA 1H9SA 4RGMA 2HDMA 3OPOA 1CKNA 3D4DA 5LMNW 2NVYH 4BBSG 1F2ZA 2RCNA 4DXFA 3HKZE 2B2UA 5C6AA 2RDGA 2SEBD 2ZJQA 1SYEA 2PMZB 4TVAB 4FYDA 1NR2A 4HCSA 1X9NA 1YJWA 3KJOA 2PQEA 2F0MA 3UDFA 4OWWB 4OO1I 3J80i 3L0OA 4RH6A 5ISRA 4BY7B 1L0XB 3CQZH 1CZGA 1D7QA 1I4GA 4LF5Q 3SHLA 3S14H 4DV1Q 4QIWE 2EYOA 4IUPA 1A0IA 4RKLA 5HURA 1IBLL 3HOVB 2AUJD 3CD6A 2NWGA 4CDDC 1M8AA 1YBYA 4JG2A 4JBJA 5C4XG 4C1NK 4GKJQ 2QW7A 4GLVB 2H1EA 1XPOA 1RF2D 2F0IA 4JYAL 3T1HL 1CZWA 2RQXA 3HOUB 1KDCA 4OX9Q 4KMUC 2HHHL 1FYCA 1D8LA 4HSVA 1NY4A 1A3TA 1E2ZA 4LW1A 5KEEA 1SAPA 1TIID 1C7YA 3HOUH 1Y1WB 2R93H 1HTLD 4X3KA 5LMUL 2AQ3B 3I73A 1WVLA 4FXDA 2RA4A 3A55A 3K80C 2L15A 1K8GA 4DAVA 2WIIB 1JJ2A 4NPSA 3ZJYC 5FLXE 5IGGA 4RFBA 2B3GA 1A62A 1B8AA 4BBSH 1AZQA 4NXML 5CBAE 4Q0FA 2BE5D 4L5QA 4RGNA 3VA7A 1HA5A 1SE3A 3SR1A 3OWFA 3MZ5A 3OMCA 5M5XB 1IBKQ 1K83B 1K83H 4CJ0B 3K6OA 1A3UA 1GUOA 5IY0A 1SSOA 2DNCA 2LXJA 4DAYB 4XQQA 1JE5A 2I5HA 2JA8G 3QB3A 2OCEA 2XIWA 4A4IA 4JI2Q 4HJAA 1RHPA 5CR3A 3KOJA 1Y8PB 3TMEA 4JI0Q 1XXGA 3S2DH 1I4XA 3DUZA 1TT2A 2JXMB 3S2HH 3OW7A 1OXXK 5DNFA 5T1IA 2EDGA 1UE1A 2KBNA 1AP0A 1NUCA 2ZJPA 4QMGA 4JVZA 3V2TA 4X62L 1Y1WH 4K6LA 1EEFD 3D0FA 4BBRB 3TEHB 3MXNA 2NZ1D 2K50A 4ALPA 3GTGH 4LJZC 1VF7A 1BKBA 1K3RA 4EX5A 2R93G 2JA5B 2A6HC 1MJCA 2IL8A 1U9RA 3I4NG 4KJOA 4G7ZC 4GNXC 2A69D 1PH8A 1VS0A 1E22A 4OWTB 4A3KG 4POFA 2G9HD 2K5HA 1LM0A 1I6HB 4HJ7A 4FVMA 2B2YA 4RGTA 4KTAA 2N78A 2R6GA 2IX0A 2Z8LA 1OXUA 1EYDA 2NN6G 4FF3A 5F2DA 4LF7L 1GUWA 4MNOA 4AYBG 5EPKA 3NWTA 5D14A 4LMQD 1RD9D 2H5XA 1DGSA 2JEBI 1SNCA 4KY6A 3S1NH 4LF7Q 1TWHH 3UDIA 1PFBA 2OTJA 2R92B 1SYBA 3GTKH 4LF8L 2Q2HA 1CKOA 4GLXA 4LFAL 2EZVA 2L55A 1PZID 2MO1A 5EKIA 2WAQG 4IJHA 4DUZQ 5EJWA 1JOKA 2HDLA 3PMFA 1LT5D 1BBXC 1WTXA 3I91A 2F4VL 3A7AB 3J81j 3Q24A 1B2TA 3DEPA 1GVPA 3TRZA 2CWAA 2F0UA 4G57A 4R1JA 4UPAA 3CC7A 2R92H 4XQNA 4ZRZA 3A8IE 4OIKA 1F77A 1B1ZA 3DHQA 1HUNA 1KL9A 3NBHA 1UNSA 1U4MA 2B2WC 3N52A 3GTOH 3T16A 1ASYA 3VDYA 4HJ9A 1ZEQX 4M8AA 3TZDA 4JYAQ 1EYCA 4AYBE 3VR4A 1STHA 4H13C 4A93B 4NP5A 4QB4A 1MSHA 1X3QA 2RCFA 1L2FA 1SNQA 3A7LA 2WKDA 2LMCB 3F2DA 3L7ZC 3BG3A 3EN2A 2C9OA 2JA5H 1AH9A 3CRKC 2PW7A 3NEMA 5LMUQ 1JR0D 3CC4A 3FP9A 4A3JG 1PZKD 3QOLA 2R7ZB 1X56A 4DPGA 3NBIA 4EGVA 1EQTA 2E2IB 1IW7C 3QR8A 1DONA 2E76C 4C3IH 1BO0A 5C44B 1XPRA 2EY2A 4DFAA 3J81L 1BCPD 1H9MA 4DV6L 1DZ1A 4AQYL 3MFYA 5FJ8H 1LTLA 1HXYD 3LX0A 3GTMH 2L12A 2EYLA 1HQRD 2BA0A 1IBML 4APVA 2JE6I 3IRBA 1E7ZA 2KHJA 4ULLA 3RD4A 1MJEA 4LF6Q 2V1CC 3EBEA 4J15A 5FO7B 4CKEA 1DJRD 4QY7A 1TY0A 3JAML 1VQHA 1PLFA 1QUQB 3LNNA 3K0XA 4A3MG 1GUGA 2MNAA 1TWCB 4U68A 3H3VH 1J6QA 1HH2P 3S17B 1XNQQ 2F0LA 1PRTD 3F1ZA 2N49A 3HOVG 2GVBA 5C4XH 4K5XA 2H4OA 5GADC 2YTXA 3S1QH 5DEHA 4Q5VA 1DXMA 1L1OC 2VXWA 2EY1A 2K32A 1SYDA 1RIPA 2K52A 2M9VA 1VQCA 4JK1C 4HJ5A 1ENCA 3OWEB 3EQLC 1MHWC 1BCPF 1S5ED 1VQ6A 1Y14B 1YZ6A 3W3AA 3K57A 5IYCH 1G6ZA 5IYBG 4XT3B 1XNRQ 4JBMA 2L11A 3G7LA 3PCOB 4A3FH 1MSGA 4NXMQ 4ZK9B 1FNVA 4JI4Q 1X32A 3RUZA 2PI2E 4RAUC 2JEAI 1TY2A 2AKWB 1H9RA 1JOQA 5KIXA 1D6EC 4JV5Q 1VQOA 1X3FA 5BN4A 4JI6L 5KNCA 1N36L 2XGTA 3EJIA 5IGBA 4DV7L 2CCZA 3CC2A 2EJFC 1S5CD 1ESFA 3CKIB 1M4VA 4JI2L 1S40A 3AEVA 4BXXH 2LSSA 4DK6C 4JCVE 4RG1A 2E2DC 2A19A 2X6LA 3WOFA 1DYQA 4X64Q 1M90C 3M4OH 2BH2A 1KNEA 3JC66 4R4IA 1LV9A 3QO2A 1GKHA 2UU9L 1STYA 2FINB 4WFN3 2JK8A 5KNDA 3NWSA 1PTOF 1R4PB 3PO3B 2MPMA 2UXCL 1JCKB 1UE5A 4JW0A 3CPWA 1WD0A 5JJLA 1IZ6A 5C0XJ 5IP7H 2YU9H 4FDBA 3RZOB 2B63G 3CP0A 3S16H 2E8GA 1D5XC 2J7ZA 1EUJA 1G8ZD 2CW0D 4LNQA 4RA8A 1PTOB 5C3WA 3PQIA 1EU3A 1ZYRC 1QE6A 4YCVA 4B3RQ 1MBYA 1Q1EA 3H09A 2PZWA 2JA6H 3J80L 4IURA 3I4MB 1G2SA 4A3LG 5EBDA 4DR5Q 4UAIA 5E3FA 4IO9A 2BE5C 3HOVH 4JI3L 2WFWA 1BR9A 1PDQA 2JA8B 3E5SA 2F0KA 2A6HD 1Q8IA 2KECA 5COYA 1KQSA 5C3EH 3ND9A 3SK4A 1N33Q 1NTGA 2TMPA 2EYMA 1SDFA 4BY1B 3I4NH 3GTLB 1KABA 3O13A 1X54A 3STBC 3FKIB 3DWAA 3BDOA 5C44G 4J6HA 4YHHL 4P71A 1F9QA 1I5FA 4UP9A 1KLGD 3ZYYX 3VYTA 4CDEC 1NJIC 4QIWB 1IXRA 4MIUA 4TKOB 4CDCC 1KTKA 1R4QB 1V1PA 3EIVA 1L1OA 4FNFA 2MGSA 2RVLA 1DCZA 4AH6A 1TWHB 5C4ZA 2VL6A 3M4OB 3AYHB 2JA8H 4AQYQ 5IT9E 4MTKA 1T9HA 2HIXA 2OT2A 1B7YB 4ME5A 4I7AA 5FLXc 1XPUA 2Z0SA 2VQFL 5FO9B 3I2ZA 3KUPA 4L5SA 1OXVA 3F2BA 1PYBA 3LWUA 3J80E 4G4KA 4DV4L 3F2UA 2EXZA 3RZOH 5BN5A 1TS3A 1F2MA 4IZ8A 3VYUA 1Q8KA 4DK1A 1LLRD 2Q8IB 1U5KA 3T13A 1EY5A 1GD7A 4R4CA 4DR2Q 1XNQL 1WTWA 4B3SL 2VUMH 3VR5A 1I94L 4IFDI 1XX8A 2F4IA 1PYWD 1BUVT 1CA6A 4CJ2C 4YIJA 1PYSB 2I5MX 3KDFB 1E2WA 4RMFA 4X66Q 4A3KH 4OL7A 1OTCA 5CYUA 5H1SE 5C44H 1W6KA 3MEFA 3S15H 2EYJA 2VNUD 5I2YA 1QUQA 1Z7TA 5KGUA 4A3IG 1SRUA 1LABA 5M3FB 2GA4B 1TS5A 3KBXA 5NUCA 3BVZA 1S5FD 1SEBD 3B6YA 1E3PA 3D4WA 4HIDA 1IBMQ 1I50H 2IX1A 4DR7L 4L8JA 2MFIA 3KFUA 2QDLA 1LTSD 2EXDA 2FJ2A 2VZAA 2UUBQ 2A8VA 2SOBA 1A63A 3CPFA 3QG1A 5I6WA 3TS0A 2UUBL 4QUFA 5FJ8G 5IGDA 5G3LF 1HJPA 2QEXA 3MWYW 2IW3A 2PPBC 3AU7A 1WTVA 1XTCD 2GN5A 3S1MH 3DM3A 2DJFC 3S14B 2F1MA 4ABNA 2MO0A 3FMCA 1PH9A 4JI5Q 4BA2I 3H3VI 4DR6Q 3SEBA 4X6AH 1GM5A 3E9IA 4C2MH 3GTPB 1CK1A 2F0JA 3MXUA 1JB3A 3TSSA 2EOTA 4O2DA 4A3MH 4DR1L 3OW2A 3JAME 2OWOA 2D2CC 1PFNA 5IYDH 5FKAC 2K14A 4P2CB 4KN4C 4JV5L 5C0XH 1YNJD 4XQJA 4GN4B 5IIFA 4F7XA 5HY6A 1Z9FA 2QF7A 4O42A 3FDTA 1JJGA 1U4RA 3DEOA 3UI2A 1IYVA 4MZ9A 3ULPA 3PUVA 2WINB 4JI8Q 3J81E 3BZCA 2R93B 2Q2UA 1F9PA 2R7DA 2KQ3A 4MHEA 1HR0W 2FMMA 4H0LC 2MQHA 1CQVA 5J22A 5BR8L 1SMYC 3M7NA 1V1OA 5FLXL 1YHAA 2PQAA 2F4VQ 5C4JB 3OIPA 2JA7B 2JA7H 4JI7Q 2KA7A 1BXTA 1KNAA 2CKZB 5BN3A 3RZDB 1P16A 5CORA 1Y8OB 1H9JA 1FD7D 1MI2A 1ML0D 3PIPA 2I5LX 1VQAA 4F8MA 1GHJA 2F0QA 1WOCA 3I90A 1I3QH 1Q1BA 4LFCQ 3SXHA 4B08A 1Y1VH 2Z4HA 3S1NB 2Y0SG 5DAUA 3D3RA 1HR0L 2E2IH 1WCMB 2OTLA 5FLMG 2UUAL 3K5MA 4RKBA 3GTQB 3H6MA 4K8JA 2VW9A 2NVTH 3HP3A 1VQGA 1X3GA 2IWHA 1I6HH 4DV5L 4DV4Q 1YEZA 2NTSA 4WJ4A 5JAVA 4A3CH 5JPNC 3FRPB 2J0TD 3I8ZA 4HMJA 4KJNA 4WORA 2B2UC 5FO8B 3HOXH 1CKNB 1K0SA 1J9OA 1JOOA 4YHHQ 3SK6A 1EY6A 2JA6G 5IYCG 4O0AA 4NXNL 1I94Q 4IUQA 3J80c 3W1GA 1PXUA 4B3ML 2K5DA 2UXBL 1KLUD 2RF4A 4R4OA 2CHBD 1QZHA 4A3EH 4H44C 1E1TA 4RGOS 3DXJC 1RODA 4IQZA 2QDBA 3S2HB 1PH1A 4A76A 3GTJH 1HUMA 5KRUA 1JC7A 2GVAA 3ER0A 2B2TA 3TDQA 2I0QA 1NE3A 1EIFA 3PIP3 3LGJA 2K5QA 3A8KE 3NUCA 2K5NA 2E5LQ 1IL2A 1O78A 4A75A 1AEXA 2QILA 3FKIH 1VQEA 2F03A 4A3FB 1A15A 1BBUA 1EQRA 4PZ7A 3H0GH 2ASBA 1VQ8A 2WACA 3MVVA 2JSOA 3GV6A 1K73C 1EY0A 2XWBB 3M9BA 1SNMA 1EFID 1CM9A 3TP6A 2K04A 3V96A 3U9OA 3J81c 4JOIC 4CBVA 2EPBA 1SXTA 4CKBA 2KCNA 2E2JH 4GN5A 4I65A 3E3XA 4JI5L 3T1HQ 1AW7A 1Q7YC 4ZLTF 3PUYA 1ESRA 2XN9C 1XNRL 3LWEA 3HKZB 5AJ3Q 3NSWA 1QZGA 2A68D 1EU4A 1EEID 2KCTA 4K0KQ 3S16B 3QJYA 1CHPD 1CHQD 2F0WA 4A3CG 3D31A 1OXTA 4IPGA 1JQYD 3I4MG 4KV6A 3CMAA 1YVCA 4R4TA 3RLNA 5M5XH 4ZCKA 3GD7A 1LTGD 1D1KA 3HG9A 4KN7C 2E2HH 4POGA 3PO2B 2VQEQ 3H3VC 4C3JB 1Q81C 1QOHA 5K36H 2MUYA 3IFTA 4DNIA 5JOBA 4MN3A 3ONAB 3R2IA 1P8LA 2NVYB 1DOKA 5EPLA 4U673 3BYYB 3IFDA 4JPBW 4DV1L 4LF4L 2NN6I 4J1MA 3VYRA 5ELBA 4DV3Q 1IBLQ 2R7ZG 3K7AB 5CV9A 2Q8RE 5I6YA 5A2QL 4ZUJA 2VS1A 3FKIG 3RLFA 1SYGA 2B29A 3PUXA 3URYA 2ZT9C 1EOTA 1N34L 2BDNA 3EFXD 5A35A 1Q12A 2CVRA 2ZTCA 2F0FA 4DR6L 1VQBA 4JI7L 2SDFA 1BCPC 1K8AC 4IN3A 2ID0A 4C2MB 4M1UB 1AE3A 4V190 4LF6L 3GTPH 3NQTA 1G51A 3TP5A 3G48A 4HN7A 3A56A 5M5YH 2RSNA 4DR1Q 4UHVA 4FF2A 4AYBB 3K0YA 4H02A 1BQQT 1EY9A 2NVXH 3W2DA 1YNND 3I4OA 4NDXA 4JI3Q 1SMXA 1EQQA 1EFWA 4B9XA 2E2JB 1PA6A 4IUNA 2EIFA 1NAPA 3W1BA 4R9WA 2DNEA 2VUMG 1STGA 4LK1C 1W2BA 2O4XA 3STBD 2PYKA 3I4MH 1YITA 1ZKOA 1F9RA 1JE4A 2SNMA 4UDUC 3P7JA 1VQ4A 1EY4A 2VB2X 5J1ZA 4LWCA
chains in the Genus database with same CATH topology
1XMOL 3CPWA 5JJLA 1IZ6A 3F2CA 5C0XJ 5IP7H 1VQ9A 5BR8Q 3K7UC 2YU9H 1VQNA 4FDBA 2CQOA 4A3IH 2B63G 3CP0A 3PSIA 4WJ3M 3S16H 2E8GA 4NXNQ 1EUJA 1TWGH 2PNHA 4LNQA 2XTIA 1U0LA 3GTLH 2YTYA 2YTVA 3BU2A 3OTOL 3CCQA 4LFCL 4DV0L 5DLQE 1HNZL 4XTCS 2UXBQ 4QL5A 1SR3A 5GAGC 4YCVA 4GKKL 4JI1Q 4B3RQ 3PUZA 1Q1EA 2UUCL 2RHQB 2JA6H 3HOWG 1HZCA 2IY5B 1HNZQ 4A3LG 4QGUA 5ELOA 4DR5Q 2A1AA 4IO9A 3HOVH 4JI3L 2WFWA 2UUCQ 1KRTA 3NBHB 2EQSA 1O7IA 3M4QA 1IYJB 4MTNA 1J5EL 3CCSA 2R7ZH 2WB1G 5C3EH 1KQSA 4BY7H 4UP7A 3S24A 3HOZG 2JJQA 3Q8DA 5M3MG 4JBWA 3PIOA 2UU9Q 1N33Q 2D0PA 1NTGA 1YI2A 1S72A 4IPHA 1L1OB 4IOCA 4LUZA 4X62Q 3I4NH 4GNXA 1EWIA 2K5VA 3HOXG 1X54A 3STBC 4LUOA 5C44G 3J7A5 4YHHL 4P71A 2ZTEA 1I5FA 4UP9A 5LMNL 3BJUA 2K4KA 1PH7A 3AFPA 5IP7G 1NJIC 5LMNQ 1UE7A 2BA1A 3CCVA 1IXRA 3J7ZC 2LXKA 4PZ6A 3KF6B 2ZJRA 4Y7NH 2ES2A 5ELNA 4AIMA 4A3EG 1YJ9A 1CKMA 4OONA 3CMEA 1G291 3EIVA 5IE8A 1L1OA 3HOYG 2ZTDA 3AQQA 4YY3L 4GKKQ 4X66L 1N32Q 4AH6A 2VL6A 2B63H 4UP8A 3G4SA 3CCJA 3HOZH 2WB1E 1WYDA 3AYHB 4DK3C 1WCMG 3UE0A 4AQYQ 2JA8H 3GDEA 4A3LH 1PH2A 2D0OA 4HJ8A 5IYDG 1CKNA 1T9HA 2HIXA 3ULJA 1B7YB 4A3DH 1PFSA 5LMNW 2NVYH 4BBSG 1XPUA 5FLXc 4DR3L 2Z0SA 2VQFL 2RCNA 4A3GG 3KF6A 1XMQQ 1KHIA 3I2ZA 3HKZE 3S1RH 4LF8Q 3HOUG 1TWCH 4L5SA 1N9WA 1OXVA 4PZ8A 2ZM6Q 3F2BA 1PYBA 2ZJQA 1N33L 3PO2H 1C0AA 4B3TL 4TVAB 4DV4L 4DR7Q 1TWFH 1X9NA 1SFOH 3RZOH 1KC8C 1PVOA 1YJWA 4KHPL 4B3TQ 1Q46A 3KJOA 5C3EG 1LUZA 2IHFA 5HGQA 1Q8KA 4KHPQ 2PMZE 3UDFA 4OWWB 1U5KA 3PO3H 2JA5G 4TQUS 3T1YQ 1GD7A 1SLJA 4R4CA 3J80i 1VQPA 3L0OA 4LF5L 1AE2A 4DR2Q 1XNQL 5IP9H 4B3SL 2VUMH 1I94L 3CQZH 4IFDI 1D7QA 4P73A 4XIGS 3KYHC 3H15A 3T1YL 4LF5Q 4BY7G 2JA9A 3S14H 3F8TA 1PYSB 2I5MX 4QIWE 4DV1Q 4P75A 3KDFB 4B3SQ 1A0IA 4B3MQ 1SROA 4PG3A 1KD1C 1IBLL 2PI2A 4RMFA 4X66Q 1OTCA 4A3KH 4BA1I 4GKJL 3CD6A 1HZBA 1MIUA 1VQFA 3WWVA 1KAWA 5H1SE 3A5UA 1YBYA 5C44H 3MEFA 4JG2A 4JBJA 3S15H 5C4XG 4GKJQ 1HNWQ 2VNUD 1QUQA 2VY3A 4A3IG 4GLVB 1SRUA 1VCIA 1XPOA 3CCEA 3NENA 4UY8C 4DR3Q 3CCUA 1ASZA 4JYAL 3T1HL 4A93G 4ME3A 2KCMA 4R4QA 1EIYB 3B6YA 1NMGA 2ZM6L 4OO1G 2RHSB 3KDFA 4IFDJ 1E3PA 1GO3E 3CF5A 4HIDA 4OX9Q 2HHHL 1IBMQ 1I50H 2IX1A 2IHEA 4DR7L 3JAMc 1D8LA 3KFUA 2MFIA 1NY4A 5IWAL 4LW1A 1C7YA 3HOUH 2EXDA 4L5TA 4DR4L 1C9OA 1UWVA 2VZAA 1X65A 2R93H 2UUBQ 3TS2A 5LMUL 1V1QA 4A93H 2A8VA 5EAYA 1A63A 3CPFA 3AFQA 5IP9G 3TS0A 2UUBL 1Z47A 3K80C 2L15A 4GOPA 3NELA 1K8GA 1WI5A 5IT9c 5FJ8G 1UEBA 1NMFA 3E0EA 1HJPA 2QEXA 1JJ2A 2KHIA 4BBRG 4NPSA 3I56A 3ZJYC 2DUDA 2GN5A 3S1MH 3DM3A 4IJLA 1KIXA 4LF4Q 4A3BG 4DV6Q 2B3GA 3KJPA 4A3DG 1A62A 2Q2TA 1QVCA 1B8AA 2MO0A 4BBSH 1PH9A 4JI5Q 4NXML 4A3FG 4JI4L 4BA2I 3H3VI 4L5QA 2AMCB 4DR6Q 2AWOA 3JAMi 4KI0A 5AJ3L 5JEAG 4GOPC 4X6AH 1V43A 1GM5A 1EOVA 3E9IA 4C2MH 4C3HH 3PO2G 4IPDA 1E24A 3G71A 1IBKQ 1K83H 1V9PA 1VQJA 3TQYA 1PHJA 3OYYA 2N8NA 4O2DA 5IY0A 1SE8A 4DR1L 4A3MH 2LXJA 4DAYB 4A3BH 3CAMA 3FHWA 3OW2A 1YIJA 1JE5A 2I5HA 2NZHA 1PH3A 2OWOA 2JA8G 1VQLA 2OCEA 4A4IA 4L5RC 5IYDH 1KRSA 2N3SA 4JI2Q 4JI1L 3PUWA 4HJAA 1Q82C 2K14A 4IOAA 2D62A 1K0RA 4JV5L 1I6HH 3KOJA 1TWAH 2CWPA 3K7AH 1HNWL 4JI0Q 4GN4B 3S2DH 3J81i 4DV7Q 1QVFA 5HY6A 3K8AA 3UDXA 1HZ9A 1Z9FA 3ICEA 3S2HH 1OXXK 1JJGA 3L2PA 4OXPA 4MZ9A 3ULPA 2JA7G 1UE1A 5JEAJ 3M3YH 2KBNA 3PUVA 3KLWA 2ZJPA 2HIVA 4JI8Q 4X64L 4KLKA 3BZCA 4C3JH 4QJFA 4X62L 2Q2UA 2R7DA 2Z6KA 2WAQE 4JOIA 1Y1WH 3PO3G 1VQKA 1CSQA 3D0FA 1HR0W 4JI8L 2MQHA 5BR8L 3TEHB 4ALPA 2K50A 3GTGH 3M7NA 1BKBA 1K3RA 4EX5A 1FVIA 1YHAA 5M3MH 1N34Q 3A5ZB 2R93G 2PQAA 1A8VA 1MJCA 1Y1VG 2F4VQ 4GLAC 3RN2A 1B70B 1PH5A 3I4NG 1CSPA 2JA7H 4GNXC 4IPCA 1PH8A 4JI7Q 1VS0A 3M85A 2CKZB 1E22A 4OWTB 5M3FH 4POFA 4A3KG 1P16A 2K5HA 3PIPA 4BY1H 1LM0A 3E9HA 5FLMH 4HJ7A 4BBRH 2I5LX 5C0XI 2OQKA 1VQAA 1WFQA 3I55A 4GNXB 1WOCA 2N78A 3GTQH 2R6GA 3SGIA 1I3QH 3PF4A 1N32L 1Q1BA 4DV0Q 2IX0A 5J3BA 1OXUA 4LFCQ 2NN6G 1Y1VH 4LF7L 2AWNA 1J5EQ 4MNOA 4AYBG 1N8RC 1HZAA 2Y0SG 1X55A 2H5XA 1DGSA 1JJCB 2JEBI 1TXYA 1HR0L 1HNXQ 3S1NH 4LF7Q 1TWHH 3UDIA 2E2IH 2OTJA 4IFDG 2OTLA 5FLMG 3CXCA 2UUAL 3GTKH 4LF8L 4LUVA 2Q2HA 1CKOA 4GLXA 2VW9A 4LFAL 2NVTH 3UDGA 1VQGA 1X3GA 4JC0A 4NB3A 2UUAQ 2MO1A 4DV4Q 4DV5L 1YEZA 4YCUA 2E5LL 2WAQG 4A3CH 4A3JH 4IJHA 4WJ4A 4DUZQ 2F3IA 5GAHC 1JB7A 3HOXH 1CKNB 3GO5A 2F4VL 1X6OA 4YHHQ 4DUZL 1KXLA 3TREA 3J81j 2JA6G 3HOWH 5IYCG 4O0AA 4NXNL 1I94Q 4GN3B 2HQLA 1YHQA 3J80c 1GVPA 3TRZA 2CWAA 3OTOQ 4R1JA 3W1GA 1FJGL 2JQOA 4BY1G 4UPAA 3CCLA 4B3ML 2UXBL 3CC7A 2RF4A 4R4OA 1QZHA 2R92H 4A3EH 2IT1A 4PMWA 4DKAC 4B3RL 1E1TA 2ATWA 1FJGQ 1KL9A 4YY3Q 2VQFQ 1NBWA 1PH1A 3GTOH 2ALYB 1XMQL 2K75A 4A76A 3U58A 4P72A 1HR0Q 1ASYA 3VDYA 3GTJH 5JJKA 2Y0SE 4HJ9A 4JYAQ 4AYBE 3S17H 2GVAA 3ER0A 1YJNA 3W5OA 2QA4A 2I0QA 4JBKA 1NE3A 2DGYA 5M3FG 3RZDH 1EIFA 1CUKA 3LGJA 1L2FA 2K5NA 3PGZA 2E5LQ 4P74A 1JMCA 1OXSC 1YHBA 2FXQA 3L7ZC 3F2DA 4A75A 5C4JH 3EN2A 1BVSA 1IL2A 4YCWA 3FKIH 2JA5H 1MKHA 1AH9A 1VQEA 4LF9L 1BBUA 3HOYH 3NEMA 5LMUQ 2BH8A 1BBWA 1UE6A 1EQRA 3CC4A 4PZ7A 3FP9A 3H0GH 4A3JG 1VQ8A 2ASBA 3U4ZA 1X56A 4DPGA 4LF9Q 1K73C 1WCMH 4EQ5A 3M9BA 4DV2Q 3PF5A 4DR2L 3CW2C 4GOPB 4C3IH 2NZOA 1XPRA 1VQDA 1W3SA 3J81c 4JOIC 4A3GH 2E2JH 4DV6L 4GN5A 3HFZB 4AQYL 3CCMA 4X65L 2UXDQ 1S3OA 1XTDA 4JI5L 5FJ8H 1LTLA 3CCRA 4DUYQ 1FGUA 3T1HQ 1Q7YC 5IYBH 3GTMH 3PUYA 3RNUA 1XNRL 1Q86C 4LFBL 1L0WA 5AJ3Q 1QZGA 5E7NA 4X65Q 2UXDL 5K36G 5GAEC 3UE1A 2R7FA 2KCTA 4YWLA 1RL2A 2BA0A 1IBML 4K0KQ 3U4VA 2JE6I 3IRBA 4APVA 4LFBQ 4A3CG 1E7ZA 2KHJA 1VQ5A 3D31A 4Y52H 1MJEA 2CFMA 1M1KC 1OXTA 4IPGA 1EYGA 4LF6Q 2V1CC 4KHZA 3EBEA 3I4MG 4BXXG 3CMAA 1YVCA 4R4TA 4J15A 3RLNA 3ULLA 5M5XH 2VQEL 4DR4Q 3GD7A 4HIOA 4QY7A 1VQHA 3HKZG 4OX9L 1QUQB 3K0XA 2E2HH 4POGA 4OO1I 4A3MG 2VQEQ 2YYZA 5IWAQ 1Q81C 2Q2IA 2MNAA 4DNIA 3H3VH 1J6QA 1HH2P 2C35B 3BZKA 2WP8J 1XNQQ 3F1ZA 2N49A 3HOVG 1P8LA 2GVBA 2HT1A 3RLOA 5C4XH 4HIKA 4DV2L 5GADC 5GROA 4DV1L 4LF4L 2YTXA 2NN6I 3S1QH 1VQMA 3U50C 4DV3Q 1IBLQ 2R7ZG 1H95A 3H0GG 1L1OC 1PH4A 1SN8A 2OQ0A 1LYLA 1FL0A 1RIPA 2K52A 3G6EA 1PH6A 2AHOB 1VQCA 4HJ5A 1K9MC 4QQBX 2VS1A 3FKIG 3RLFA 4DUYL 2B29A 4DV3L 3PUXA 1VQ6A 2QGQA 2UXCQ 1Y14B 1YZ6A 2KENA 5IYCH 1IBKL 5IYBG 4DAMA 1N34L 1XNRQ 4JBMA 1Q12A 3PCOB 4A3FH 2ZTCA 1JT8A 1PV4A 4NXMQ 4JI4Q 2PQAB 4GS3A 4K0KL 4DR6L 1VQBA 2Z6KC 3HKSA 4JI7L 1Y1WG 2R92G 4JI6Q 2PI2E 1QVGA 1K8AC 2ID0A 2JEAI 3GTPH 1AE3A 2AKWB 4YWMA 3K81C 4LF6L 1G51A 2HHHQ 3G48A 4JV5Q 1VQOA 1X3FA 4JI6L 1VQIA 5M5YH 1R9TH 4DR1Q 1N36L 2XGTA 1E1OA 4DV7L 2CCZA 3CC2A 5M5WH 4H02A 1X3EA 2NVXH 3MXNB 5GQOA 4DR5L 1N36Q 4JI2L 1S40A 3AEVA 4JI3Q 2LSSA 1YNXA 3I4OA 4DK6C 1SMXA 4BXXH 1EQQA 1EFWA 1G6PA 3I7FA 4JCVE 5C0XG 4RG1A 2A19A 3PV0A 1HNXL 3ERSX 4JI0L 4X64Q 1M90C 3M4OH 1PA6A 2BH2A 2EIFA 3JC66 4R4IA 1VQ7A 3RR5A 3W1BA 3A74A 5JJIA 3RN5A 2UU9L 1GKHA 2VUMG 4LFAQ 1W2BA 2JK8A 3STBD 4YWKA 2NVQH 3I4MH 1WJJA 2F52A 3A0JA 4DV5Q 4HIMA 1YITA 1XJVA 1XMOQ 3KF8B 2YV5A 4OWXB 3M4PA 3DLLA 2UXCL 1VQ4A 1UE5A 4LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO L;  3CPW A;  5JJL A;  1IZ6 A;  3F2C A;  5C0X J;  5IP7 H;  1VQ9 A;  5BR8 Q;  3K7U C;  2YU9 H;  1VQN A;  4FDB A;  2CQO A;  4A3I H;  2B63 G;  3CP0 A;  3PSI A;  4WJ3 M;  3S16 H;  2E8G A;  4NXN Q;  1EUJ A;  1TWG H;  2PNH A;  4LNQ A;  2XTI A;  1U0L A;  3GTL H;  2YTY A;  2YTV A;  3BU2 A;  3OTO L;  3CCQ A;  4LFC L;  4DV0 L;  5DLQ E;  1HNZ L;  4XTC S;  2UXB Q;  4QL5 A;  1SR3 A;  5GAG C;  4YCV A;  4GKK L;  4JI1 Q;  4B3R Q;  3PUZ A;  1Q1E A;  2UUC L;  2RHQ B;  2JA6 H;  3HOW G;  1HZC A;  2IY5 B;  1HNZ Q;  4A3L G;  4QGU A;  5ELO A;  4DR5 Q;  2A1A A;  4IO9 A;  3HOV H;  4JI3 L;  2WFW A;  2UUC Q;  1KRT A;  3NBH B;  2EQS A;  1O7I A;  3M4Q A;  1IYJ B;  4MTN A;  1J5E L;  3CCS A;  2R7Z H;  2WB1 G;  5C3E H;  1KQS A;  4BY7 H;  4UP7 A;  3S24 A;  3HOZ G;  2JJQ A;  3Q8D A;  5M3M G;  4JBW A;  3PIO A;  2UU9 Q;  1N33 Q;  2D0P A;  1NTG A;  1YI2 A;  1S72 A;  4IPH A;  1L1O B;  4IOC A;  4LUZ A;  4X62 Q;  3I4N H;  4GNX A;  1EWI A;  2K5V A;  3HOX G;  1X54 A;  3STB C;  4LUO A;  5C44 G;  3J7A 5;  4YHH L;  4P71 A;  2ZTE A;  1I5F A;  4UP9 A;  5LMN L;  3BJU A;  2K4K A;  1PH7 A;  3AFP A;  5IP7 G;  1NJI C;  5LMN Q;  1UE7 A;  2BA1 A;  3CCV A;  1IXR A;  3J7Z C;  2LXK A;  4PZ6 A;  3KF6 B;  2ZJR A;  4Y7N H;  2ES2 A;  5ELN A;  4AIM A;  4A3E G;  1YJ9 A;  1CKM A;  4OON A;  3CME A;  1G29 1;  3EIV A;  5IE8 A;  1L1O A;  3HOY G;  2ZTD A;  3AQQ A;  4YY3 L;  4GKK Q;  4X66 L;  1N32 Q;  4AH6 A;  2VL6 A;  2B63 H;  4UP8 A;  3G4S A;  3CCJ A;  3HOZ H;  2WB1 E;  1WYD A;  3AYH B;  4DK3 C;  1WCM G;  3UE0 A;  4AQY Q;  2JA8 H;  3GDE A;  4A3L H;  1PH2 A;  2D0O A;  4HJ8 A;  5IYD G;  1CKN A;  1T9H A;  2HIX A;  3ULJ A;  1B7Y B;  4A3D H;  1PFS A;  5LMN W;  2NVY H;  4BBS G;  1XPU A;  5FLX c;  4DR3 L;  2Z0S A;  2VQF L;  2RCN A;  4A3G G;  3KF6 A;  1XMQ Q;  1KHI A;  3I2Z A;  3HKZ E;  3S1R H;  4LF8 Q;  3HOU G;  1TWC H;  4L5S A;  1N9W A;  1OXV A;  4PZ8 A;  2ZM6 Q;  3F2B A;  1PYB A;  2ZJQ A;  1N33 L;  3PO2 H;  1C0A A;  4B3T L;  4TVA B;  4DV4 L;  4DR7 Q;  1TWF H;  1X9N A;  1SFO H;  3RZO H;  1KC8 C;  1PVO A;  1YJW A;  4KHP L;  4B3T Q;  1Q46 A;  3KJO A;  5C3E G;  1LUZ A;  2IHF A;  5HGQ A;  1Q8K A;  4KHP Q;  2PMZ E;  3UDF A;  4OWW B;  1U5K A;  3PO3 H;  2JA5 G;  4TQU S;  3T1Y Q;  1GD7 A;  1SLJ A;  4R4C A;  3J80 i;  1VQP A;  3L0O A;  4LF5 L;  1AE2 A;  4DR2 Q;  1XNQ L;  5IP9 H;  4B3S L;  2VUM H;  1I94 L;  3CQZ H;  4IFD I;  1D7Q A;  4P73 A;  4XIG S;  3KYH C;  3H15 A;  3T1Y L;  4LF5 Q;  4BY7 G;  2JA9 A;  3S14 H;  3F8T A;  1PYS B;  2I5M X;  4QIW E;  4DV1 Q;  4P75 A;  3KDF B;  4B3S Q;  1A0I A;  4B3M Q;  1SRO A;  4PG3 A;  1KD1 C;  1IBL L;  2PI2 A;  4RMF A;  4X66 Q;  1OTC A;  4A3K H;  4BA1 I;  4GKJ L;  3CD6 A;  1HZB A;  1MIU A;  1VQF A;  3WWV A;  1KAW A;  5H1S E;  3A5U A;  1YBY A;  5C44 H;  3MEF A;  4JG2 A;  4JBJ A;  3S15 H;  5C4X G;  4GKJ Q;  1HNW Q;  2VNU D;  1QUQ A;  2VY3 A;  4A3I G;  4GLV B;  1SRU A;  1VCI A;  1XPO A;  3CCE A;  3NEN A;  4UY8 C;  4DR3 Q;  3CCU A;  1ASZ A;  4JYA L;  3T1H L;  4A93 G;  4ME3 A;  2KCM A;  4R4Q A;  1EIY B;  3B6Y A;  1NMG A;  2ZM6 L;  4OO1 G;  2RHS B;  3KDF A;  4IFD J;  1E3P A;  1GO3 E;  3CF5 A;  4HID A;  4OX9 Q;  2HHH L;  1IBM Q;  1I50 H;  2IX1 A;  2IHE A;  4DR7 L;  3JAM c;  1D8L A;  3KFU A;  2MFI A;  1NY4 A;  5IWA L;  4LW1 A;  1C7Y A;  3HOU H;  2EXD A;  4L5T A;  4DR4 L;  1C9O A;  1UWV A;  2VZA A;  1X65 A;  2R93 H;  2UUB Q;  3TS2 A;  5LMU L;  1V1Q A;  4A93 H;  2A8V A;  5EAY A;  1A63 A;  3CPF A;  3AFQ A;  5IP9 G;  3TS0 A;  2UUB L;  1Z47 A;  3K80 C;  2L15 A;  4GOP A;  3NEL A;  1K8G A;  1WI5 A;  5IT9 c;  5FJ8 G;  1UEB A;  1NMF A;  3E0E A;  1HJP A;  2QEX A;  1JJ2 A;  2KHI A;  4BBR G;  4NPS A;  3I56 A;  3ZJY C;  2DUD A;  2GN5 A;  3S1M H;  3DM3 A;  4IJL A;  1KIX A;  4LF4 Q;  4A3B G;  4DV6 Q;  2B3G A;  3KJP A;  4A3D G;  1A62 A;  2Q2T A;  1QVC A;  1B8A A;  2MO0 A;  4BBS H;  1PH9 A;  4JI5 Q;  4NXM L;  4A3F G;  4JI4 L;  4BA2 I;  3H3V I;  4L5Q A;  2AMC B;  4DR6 Q;  2AWO A;  3JAM i;  4KI0 A;  5AJ3 L;  5JEA G;  4GOP C;  4X6A H;  1V43 A;  1GM5 A;  1EOV A;  3E9I A;  4C2M H;  4C3H H;  3PO2 G;  4IPD A;  1E24 A;  3G71 A;  1IBK Q;  1K83 H;  1V9P A;  1VQJ A;  3TQY A;  1PHJ A;  3OYY A;  2N8N A;  4O2D A;  5IY0 A;  1SE8 A;  4DR1 L;  4A3M H;  2LXJ A;  4DAY B;  4A3B H;  3CAM A;  3FHW A;  3OW2 A;  1YIJ A;  1JE5 A;  2I5H A;  2NZH A;  1PH3 A;  2OWO A;  2JA8 G;  1VQL A;  2OCE A;  4A4I A;  4L5R C;  5IYD H;  1KRS A;  2N3S A;  4JI2 Q;  4JI1 L;  3PUW A;  4HJA A;  1Q82 C;  2K14 A;  4IOA A;  2D62 A;  1K0R A;  4JV5 L;  1I6H H;  3KOJ A;  1TWA H;  2CWP A;  3K7A H;  1HNW L;  4JI0 Q;  4GN4 B;  3S2D H;  3J81 i;  4DV7 Q;  1QVF A;  5HY6 A;  3K8A A;  3UDX A;  1HZ9 A;  1Z9F A;  3ICE A;  3S2H H;  1OXX K;  1JJG A;  3L2P A;  4OXP A;  4MZ9 A;  3ULP A;  2JA7 G;  1UE1 A;  5JEA J;  3M3Y H;  2KBN A;  3PUV A;  3KLW A;  2ZJP A;  2HIV A;  4JI8 Q;  4X64 L;  4KLK A;  3BZC A;  4C3J H;  4QJF A;  4X62 L;  2Q2U A;  2R7D A;  2Z6K A;  2WAQ E;  4JOI A;  1Y1W H;  3PO3 G;  1VQK A;  1CSQ A;  3D0F A;  1HR0 W;  4JI8 L;  2MQH A;  5BR8 L;  3TEH B;  4ALP A;  2K50 A;  3GTG H;  3M7N A;  1BKB A;  1K3R A;  4EX5 A;  1FVI A;  1YHA A;  5M3M H;  1N34 Q;  3A5Z B;  2R93 G;  2PQA A;  1A8V A;  1MJC A;  1Y1V G;  2F4V Q;  4GLA C;  3RN2 A;  1B70 B;  1PH5 A;  3I4N G;  1CSP A;  2JA7 H;  4GNX C;  4IPC A;  1PH8 A;  4JI7 Q;  1VS0 A;  3M85 A;  2CKZ B;  1E22 A;  4OWT B;  5M3F H;  4POF A;  4A3K G;  1P16 A;  2K5H A;  3PIP A;  4BY1 H;  1LM0 A;  3E9H A;  5FLM H;  4HJ7 A;  4BBR H;  2I5L X;  5C0X I;  2OQK A;  1VQA A;  1WFQ A;  3I55 A;  4GNX B;  1WOC A;  2N78 A;  3GTQ H;  2R6G A;  3SGI A;  1I3Q H;  3PF4 A;  1N32 L;  1Q1B A;  4DV0 Q;  2IX0 A;  5J3B A;  1OXU A;  4LFC Q;  2NN6 G;  1Y1V H;  4LF7 L;  2AWN A;  1J5E Q;  4MNO A;  4AYB G;  1N8R C;  1HZA A;  2Y0S G;  1X55 A;  2H5X A;  1DGS A;  1JJC B;  2JEB I;  1TXY A;  1HR0 L;  1HNX Q;  3S1N H;  4LF7 Q;  1TWH H;  3UDI A;  2E2I H;  2OTJ A;  4IFD G;  2OTL A;  5FLM G;  3CXC A;  2UUA L;  3GTK H;  4LF8 L;  4LUV A;  2Q2H A;  1CKO A;  4GLX A;  2VW9 A;  4LFA L;  2NVT H;  3UDG A;  1VQG A;  1X3G A;  4JC0 A;  4NB3 A;  2UUA Q;  2MO1 A;  4DV4 Q;  4DV5 L;  1YEZ A;  4YCU A;  2E5L L;  2WAQ G;  4A3C H;  4A3J H;  4IJH A;  4WJ4 A;  4DUZ Q;  2F3I A;  5GAH C;  1JB7 A;  3HOX H;  1CKN B;  3GO5 A;  2F4V L;  1X6O A;  4YHH Q;  4DUZ L;  1KXL A;  3TRE A;  3J81 j;  2JA6 G;  3HOW H;  5IYC G;  4O0A A;  4NXN L;  1I94 Q;  4GN3 B;  2HQL A;  1YHQ A;  3J80 c;  1GVP A;  3TRZ A;  2CWA A;  3OTO Q;  4R1J A;  3W1G A;  1FJG L;  2JQO A;  4BY1 G;  4UPA A;  3CCL A;  4B3M L;  2UXB L;  3CC7 A;  2RF4 A;  4R4O A;  1QZH A;  2R92 H;  4A3E H;  2IT1 A;  4PMW A;  4DKA C;  4B3R L;  1E1T A;  2ATW A;  1FJG Q;  1KL9 A;  4YY3 Q;  2VQF Q;  1NBW A;  1PH1 A;  3GTO H;  2ALY B;  1XMQ L;  2K75 A;  4A76 A;  3U58 A;  4P72 A;  1HR0 Q;  1ASY A;  3VDY A;  3GTJ H;  5JJK A;  2Y0S E;  4HJ9 A;  4JYA Q;  4AYB E;  3S17 H;  2GVA A;  3ER0 A;  1YJN A;  3W5O A;  2QA4 A;  2I0Q A;  4JBK A;  1NE3 A;  2DGY A;  5M3F G;  3RZD H;  1EIF A;  1CUK A;  3LGJ A;  1L2F A;  2K5N A;  3PGZ A;  2E5L Q;  4P74 A;  1JMC A;  1OXS C;  1YHB A;  2FXQ A;  3L7Z C;  3F2D A;  4A75 A;  5C4J H;  3EN2 A;  1BVS A;  1IL2 A;  4YCW A;  3FKI H;  2JA5 H;  1MKH A;  1AH9 A;  1VQE A;  4LF9 L;  1BBU A;  3HOY H;  3NEM A;  5LMU Q;  2BH8 A;  1BBW A;  1UE6 A;  1EQR A;  3CC4 A;  4PZ7 A;  3FP9 A;  3H0G H;  4A3J G;  1VQ8 A;  2ASB A;  3U4Z A;  1X56 A;  4DPG A;  4LF9 Q;  1K73 C;  1WCM H;  4EQ5 A;  3M9B A;  4DV2 Q;  3PF5 A;  4DR2 L;  3CW2 C;  4GOP B;  4C3I H;  2NZO A;  1XPR A;  1VQD A;  1W3S A;  3J81 c;  4JOI C;  4A3G H;  2E2J H;  4DV6 L;  4GN5 A;  3HFZ B;  4AQY L;  3CCM A;  4X65 L;  2UXD Q;  1S3O A;  1XTD A;  4JI5 L;  5FJ8 H;  1LTL A;  3CCR A;  4DUY Q;  1FGU A;  3T1H Q;  1Q7Y C;  5IYB H;  3GTM H;  3PUY A;  3RNU A;  1XNR L;  1Q86 C;  4LFB L;  1L0W A;  5AJ3 Q;  1QZG A;  5E7N A;  4X65 Q;  2UXD L;  5K36 G;  5GAE C;  3UE1 A;  2R7F A;  2KCT A;  4YWL A;  1RL2 A;  2BA0 A;  1IBM L;  4K0K Q;  3U4V A;  2JE6 I;  3IRB A;  4APV A;  4LFB Q;  4A3C G;  1E7Z A;  2KHJ A;  1VQ5 A;  3D31 A;  4Y52 H;  1MJE A;  2CFM A;  1M1K C;  1OXT A;  4IPG A;  1EYG A;  4LF6 Q;  2V1C C;  4KHZ A;  3EBE A;  3I4M G;  4BXX G;  3CMA A;  1YVC A;  4R4T A;  4J15 A;  3RLN A;  3ULL A;  5M5X H;  2VQE L;  4DR4 Q;  3GD7 A;  4HIO A;  4QY7 A;  1VQH A;  3HKZ G;  4OX9 L;  1QUQ B;  3K0X A;  2E2H H;  4POG A;  4OO1 I;  4A3M G;  2VQE Q;  2YYZ A;  5IWA Q;  1Q81 C;  2Q2I A;  2MNA A;  4DNI A;  3H3V H;  1J6Q A;  1HH2 P;  2C35 B;  3BZK A;  2WP8 J;  1XNQ Q;  3F1Z A;  2N49 A;  3HOV G;  1P8L A;  2GVB A;  2HT1 A;  3RLO A;  5C4X H;  4HIK A;  4DV2 L;  5GAD C;  5GRO A;  4DV1 L;  4LF4 L;  2YTX A;  2NN6 I;  3S1Q H;  1VQM A;  3U50 C;  4DV3 Q;  1IBL Q;  2R7Z G;  1H95 A;  3H0G G;  1L1O C;  1PH4 A;  1SN8 A;  2OQ0 A;  1LYL A;  1FL0 A;  1RIP A;  2K52 A;  3G6E A;  1PH6 A;  2AHO B;  1VQC A;  4HJ5 A;  1K9M C;  4QQB X;  2VS1 A;  3FKI G;  3RLF A;  4DUY L;  2B29 A;  4DV3 L;  3PUX A;  1VQ6 A;  2QGQ A;  2UXC Q;  1Y14 B;  1YZ6 A;  2KEN A;  5IYC H;  1IBK L;  5IYB G;  4DAM A;  1N34 L;  1XNR Q;  4JBM A;  1Q12 A;  3PCO B;  4A3F H;  2ZTC A;  1JT8 A;  1PV4 A;  4NXM Q;  4JI4 Q;  2PQA B;  4GS3 A;  4K0K L;  4DR6 L;  1VQB A;  2Z6K C;  3HKS A;  4JI7 L;  1Y1W G;  2R92 G;  4JI6 Q;  2PI2 E;  1QVG A;  1K8A C;  2ID0 A;  2JEA I;  3GTP H;  1AE3 A;  2AKW B;  4YWM A;  3K81 C;  4LF6 L;  1G51 A;  2HHH Q;  3G48 A;  4JV5 Q;  1VQO A;  1X3F A;  4JI6 L;  1VQI A;  5M5Y H;  1R9T H;  4DR1 Q;  1N36 L;  2XGT A;  1E1O A;  4DV7 L;  2CCZ A;  3CC2 A;  5M5W H;  4H02 A;  1X3E A;  2NVX H;  3MXN B;  5GQO A;  4DR5 L;  1N36 Q;  4JI2 L;  1S40 A;  3AEV A;  4JI3 Q;  2LSS A;  1YNX A;  3I4O A;  4DK6 C;  1SMX A;  4BXX H;  1EQQ A;  1EFW A;  1G6P A;  3I7F A;  4JCV E;  5C0X G;  4RG1 A;  2A19 A;  3PV0 A;  1HNX L;  3ERS X;  4JI0 L;  4X64 Q;  1M90 C;  3M4O H;  1PA6 A;  2BH2 A;  2EIF A;  3JC6 6;  4R4I A;  1VQ7 A;  3RR5 A;  3W1B A;  3A74 A;  5JJI A;  3RN5 A;  2UU9 L;  1GKH A;  2VUM G;  4LFA Q;  1W2B A;  2JK8 A;  3STB D;  4YWK A;  2NVQ H;  3I4M H;  1WJJ A;  2F52 A;  3A0J A;  4DV5 Q;  4HIM A;  1YIT A;  1XJV A;  1XMO Q;  3KF8 B;  2YV5 A;  4OWX B;  3M4P A;  3DLL A;  2UXC L;  1VQ4 A;  1UE5 A;  4LWC A; 
#chains in the Genus database with same CATH topology
 1QB5 D;  4DU9 A;  3AMU A;  1EL0 A;  3C1F A;  4A3I H;  4WJ3 M;  1HFG A;  1IYU A;  5DM6 3;  3R3O A;  3TP8 A;  5M3M B;  3GTL H;  3BU2 A;  2YTV A;  2F0P A;  4DV0 L;  4IUU A;  5DLQ E;  3PIO 3;  2HQE A;  4XTC S;  3GTM B;  2NVT B;  1SR3 A;  4EVO A;  1O7Z A;  2RHQ B;  3OOC A;  3HOW G;  1HZC A;  4OHJ A;  1HNZ Q;  4QGU A;  1I4Q A;  3M3Y B;  1TQO A;  1IW7 D;  1LT6 D;  1KRT A;  5CV8 A;  3ERO A;  1O7I A;  2G5D A;  3HS0 C;  2R7Z H;  4BY7 H;  3S2D B;  4UP7 A;  4I7Z C;  1WTP A;  3PIO A;  2K7V A;  2WV6 D;  2DY8 A;  3KF8 A;  1S72 A;  1JWM D;  4IOC A;  4LUZ A;  4X62 Q;  3CRL C;  2ZXP A;  2B2V C;  2ZTE A;  5LMN L;  1H9S B;  2EY5 A;  2K4K A;  1PH7 A;  5JPM C;  5IP7 G;  5LMN Q;  1EWC A;  2LXK A;  2ZJR A;  4OO1 H;  4AIM A;  5CGK A;  1G29 1;  3HOY G;  1TR5 A;  2ZTD A;  4K6D A;  2IJ0 A;  4X66 L;  5CC4 A;  1QG7 A;  4UP8 A;  3G4S A;  2WB1 E;  4DK3 C;  1WCM G;  3UE0 A;  2K33 A;  4A3L H;  1K3B C;  1BOS A;  1SMY D;  1VF5 C;  5IYD G;  3VR2 A;  3KLS X;  4X3T A;  1PFS A;  3V05 A;  4DR3 L;  4IUV A;  3MTS A;  1STB A;  3NTK A;  3S1R H;  4LF8 Q;  3HOU G;  1N9W A;  2K28 A;  5EKL A;  1N33 L;  1C0A A;  3NHH A;  4X3U A;  1LTR D;  4DR7 Q;  1SFO H;  1BF4 A;  4A3I B;  1KC8 C;  1PVO A;  4KHP L;  2MHV A;  1MD2 D;  1Q46 A;  1LUZ A;  5KYI A;  1Q90 A;  2IHF A;  4TRD A;  5CV7 A;  4KHP Q;  2PMZ E;  2RBM A;  1VQP A;  4LF5 L;  1SLJ A;  4FF4 A;  1AE2 A;  2PZU A;  2XNA C;  3J7A F;  3QOJ A;  5IP9 H;  5LL6 X;  2O2L D;  1GUN A;  1K28 A;  2L5T A;  4XIG S;  3KYH C;  3H15 A;  1EYA A;  4BY7 G;  2JA9 A;  3F8T A;  4P75 A;  1SRO A;  1ET9 A;  1KD1 C;  4GKJ L;  2PI2 A;  4L63 B;  1IKL A;  5JVG 3;  1HZB A;  1MIU A;  1VQF A;  3WWV A;  1KAW A;  2K1B A;  3SK5 A;  2KVM A;  2HCC A;  2VY3 A;  2EYH A;  3T53 B;  3SE0 A;  3CCE A;  3X3M A;  4UY8 C;  4FXK C;  3CCU A;  1K8M A;  1SNO A;  3X3N A;  4DF7 A;  2F0E A;  4R4Q A;  1NMG A;  2ZM6 L;  4OO1 G;  3KDF A;  1FNW A;  1GO3 E;  1B9M A;  3D6C A;  2IHE A;  2ICI A;  3JAM c;  1EZ8 A;  1O7Y A;  1YNJ C;  2O5I C;  2KCC A;  1C9O A;  1PTO D;  1UWV A;  4ILW A;  1ET6 A;  1X65 A;  4DR4 L;  2XSC A;  2N88 A;  1HQM C;  3R2T A;  4A93 H;  5EAY A;  2NB0 A;  4E6I A;  2I46 A;  3AFQ A;  2A68 C;  4KKS A;  1PRT F;  3NEL A;  1RCV D;  1UEB A;  2A74 C;  3E0E A;  2KHI A;  1QIL A;  4HCE A;  3I56 A;  2DN8 A;  3NTH A;  4OGQ C;  4PNY A;  3SK8 A;  4LF4 Q;  3KLR A;  4DV6 Q;  3BZD B;  3KJP A;  3J7A V;  1F2Y A;  5LHY 1;  2EY6 A;  4A3F G;  4JI4 L;  1VMP A;  2AMC B;  3HZX A;  3P1H A;  2AWO A;  3JAM i;  4GOP C;  1V43 A;  4C3H H;  4A3M B;  5KNB A;  1VQJ A;  1PHJ A;  3OYY A;  1DOL A;  4A3B H;  3FHW A;  4N9P A;  5CV4 A;  1PH3 A;  1VQL A;  4L5R C;  1KRS A;  2N3S A;  3PUW A;  2EJM A;  4IOA A;  1BCP B;  2FHT A;  2EYP A;  4K5V A;  1TWA H;  4O1N A;  3P20 A;  3J81 i;  5JVH 3;  1QVF A;  3K8A A;  3UDX A;  1HZ9 A;  3Q23 A;  3ICE A;  5C5L A;  3E6Z X;  3R93 A;  3L2P A;  2B63 B;  4OXP A;  2JA7 G;  4A3E B;  5JEA J;  3M3Y H;  3KLW A;  2HIV A;  1STE A;  4KLK A;  4QJF A;  3T51 B;  2Z6K A;  3PO3 G;  1VQK A;  5CV6 A;  3ND8 A;  1FVI A;  2X69 A;  5M3M H;  4WJW A;  1RJT A;  1Y1V G;  3M7G A;  1PH5 A;  1Y8N B;  2WAQ B;  1CSP A;  4IPC A;  1TWF B;  1PRT B;  3QIA A;  3NE5 B;  3M85 A;  2XWJ B;  2N55 A;  1T5E A;  3DMU A;  4BY1 H;  1X3P A;  5FLM H;  1WFQ A;  4ZKC B;  3I55 A;  3GTQ H;  1N32 L;  3SGI A;  3PF4 A;  4XDX A;  4DV0 Q;  1IKM A;  1CI3 M;  2QKI C;  5DM7 3;  1PZJ D;  1L0Y B;  1JJC B;  1GUS A;  1TXY A;  2PCF B;  5C5M A;  1HNX Q;  4C3H G;  2K6A A;  3CU7 A;  4Y7N B;  3HOY B;  5IOC A;  2E5L L;  4YCU A;  1I4H A;  4A3J H;  2L9H A;  2M2L A;  2F3I A;  4A3B B;  5GAH C;  1X6O A;  4DUZ L;  1KXL A;  4GZY C;  2LFN A;  4A3J B;  1DM0 B;  4KKT A;  3HOW H;  3BDL A;  4GN3 B;  2HQL A;  4KD3 A;  2I07 B;  1U4L A;  2F0V A;  3CCL A;  3EVQ A;  1C8C A;  4PMW A;  4B3R L;  2ATW A;  1I6V C;  3KLS A;  4YY3 Q;  2VQF Q;  1NBW A;  2NTT A;  2ALY B;  2CH4 W;  2K75 A;  1XMQ L;  3U58 A;  3BVM A;  4P72 A;  1HR0 Q;  4L6T B;  5JJK A;  1JWS D;  3S17 H;  3W5O A;  2NN6 H;  4CJ1 B;  4HED A;  2QA4 A;  2EJG C;  3RZD H;  3C2P A;  3GQB A;  2JP1 A;  1CUK A;  1EWH A;  1MGS A;  3PGZ A;  2SNS A;  1JMC A;  5C4J H;  1BVS A;  2VB3 X;  2WKC A;  2ZXR A;  4YCW A;  4KD4 A;  3WOE A;  1MKH A;  1ZXT A;  3I4L A;  1QNU A;  3I4N B;  2AQ1 B;  4LF9 L;  3HOY H;  1EY8 A;  1WTQ A;  2BH8 A;  1UE6 A;  4TSS A;  1B50 A;  3U4Z A;  1IL8 A;  3H94 A;  2RDF A;  4LF9 Q;  1WCM H;  4DV2 Q;  1LT4 D;  4HTH A;  4FF1 A;  4KKU A;  1S5B D;  3CW2 C;  4GOP B;  1SE2 A;  2EYF A;  2NZO A;  1VQD A;  1W3S A;  1ENA A;  1W6J A;  1B44 D;  1I3Q B;  3BDC A;  1XTD A;  4DUY Q;  1FGU A;  1NSN S;  4KK7 A;  1Q86 C;  4LFB L;  5K36 G;  2E2H B;  5GAE C;  3Q22 A;  2R7F A;  1RL2 A;  2OEO A;  3U4V A;  4LFB Q;  2CFM A;  1M1K C;  2B2Y C;  1EYG A;  4BXX G;  4KHZ A;  1CQF A;  3ULL A;  2F0N A;  4HIO A;  2PNR C;  2XRS D;  4OEM B;  4OX9 L;  4C1N I;  3IL8 A;  1WTH A;  2YYZ A;  4IFD H;  2Q2I A;  4ZKB B;  4OEL B;  3Q6S A;  4RHR A;  2WP8 J;  3AB9 A;  2HT1 A;  3RLO A;  3IKJ A;  4EQN A;  1Q3L A;  4HIK A;  1VQM A;  3U50 C;  1PH4 A;  2OQ0 A;  1LYL A;  1FL0 A;  1PH6 A;  1RTN A;  4QQB X;  2VUM B;  2QGQ A;  1A3V A;  2G9D A;  4DAM A;  4N8X 1;  1PV4 A;  1DD2 A;  1NCV A;  3SDZ A;  4GS3 A;  4K0K L;  2WB1 B;  3HKS A;  5ELE A;  4JI6 Q;  3MXP A;  1LTB D;  1QVG A;  4C3H B;  4YWM A;  3K81 C;  3OHX C;  1NR4 A;  4PMB A;  1VQI A;  1R9T H;  4PQX A;  1E1O A;  4OIJ A;  5D65 A;  5M5W H;  1EQV A;  2OF1 A;  3MXN B;  4NMZ A;  3S1M B;  1N36 Q;  1YNX A;  1TVX A;  1G6P A;  1HNX L;  1EY7 A;  3HGB A;  4JI0 L;  2J4X A;  4C3I B;  3RR5 A;  3A74 A;  5JJI A;  1FGB D;  3RN5 A;  1SND A;  4LFA Q;  2RSO A;  2AUK A;  3A0J A;  2ENB A;  4HIM A;  5K5P A;  4N9T A;  1XJV A;  1XMO Q;  2Z4I A;  3H0G B;  2YV5 A;  4OWX B;  2KHS A;  1C4Q A;  4G7H C;  1XMO L;  4DA2 A;  5E1F A;  2E75 C;  1VQ9 A;  2Z6B A;  3K7U C;  2DY7 A;  4CDF C;  3TZU A;  5CMD A;  2R3Z A;  2CQO A;  5I9O A;  1VQN A;  4NW2 A;  2YU9 B;  2PNH A;  2XTI A;  2YTY A;  1EZ6 A;  3CCQ A;  1IHZ A;  4LFC L;  1V1P B;  1B3Q A;  1STA A;  3D6W A;  4JI1 Q;  3PUZ A;  5ELO A;  4BS9 A;  2Y0S B;  2A1A A;  1D5Z C;  4ZYS A;  2C5C A;  1PMR A;  2Q8T A;  2EQS A;  3L3O C;  1IYJ B;  4MTN A;  3RMH A;  5D3I B;  2WB1 G;  5I9P A;  3S24 A;  1UAP A;  3HOZ G;  5M3M G;  1TWA B;  2D0P A;  1FNU A;  1YI2 A;  4IPH A;  1XWE A;  4GNX A;  2K5V A;  5CV5 A;  1Z6H A;  3HOX G;  5M5Y B;  2A5H A;  2FFK B;  4LUO A;  2NUC A;  2B2T C;  3AFP A;  1UE7 A;  2BA1 A;  3CCV A;  3KF6 B;  1S4Z A;  4R8N A;  5ELN A;  4A3E G;  1A6X A;  1CKM A;  4OON A;  5CBE E;  3NXW A;  3I3C A;  3AQQ A;  4GKK Q;  3FPP A;  2B63 H;  3M4Y A;  2QEJ C;  5C3X A;  1WYD A;  2LKV A;  3GDE A;  2P5Z X;  4B9W A;  1PH2 A;  2D0O A;  4HJ8 A;  3DWQ A;  1B4O A;  3ULJ A;  4A3D H;  1VDZ A;  4A3G G;  3KF6 A;  1XMQ Q;  1KHI A;  4WRD A;  1TWC H;  4PZ8 A;  2ZM6 Q;  1T5X D;  3PO2 H;  4B3T L;  2TSS A;  1TWF H;  2V4D A;  2A69 C;  1PTO C;  4B3T Q;  5C3E G;  5HGQ A;  2Z1C A;  2B39 A;  3EA6 A;  3PO3 H;  5JEA H;  2JA5 G;  4TQU S;  1LTI D;  3T1Y Q;  5EKK A;  1JIC A;  4DNT B;  4P73 A;  4EQP A;  3T1Y L;  2F3W A;  3HOZ H;  4B3M Q;  4B3S Q;  3QWN A;  3N6R A;  3D4R A;  1AZP A;  4PG3 A;  1HNW L;  4BA1 I;  3D8G A;  4FO2 A;  4C3I G;  3A5U A;  1HNW Q;  3HOZ B;  1VCI A;  4QUC A;  2CH4 A;  3NEN A;  4DR3 Q;  1SNP A;  1ASZ A;  2D9U A;  3GV3 A;  1C48 A;  2F3V A;  3MHB A;  1WD1 A;  1BDO A;  4A93 G;  1UEA B;  4ME3 A;  1KDA A;  2KCM A;  1EIY B;  1FR3 A;  2RHS B;  3MC0 B;  4IFD J;  3CF5 A;  1I50 B;  1TKW B;  4RCO A;  4KY5 A;  1LTA D;  5IWA L;  1B3A A;  1HHV A;  4L5T A;  4ODG A;  5D3D A;  1AFP A;  1OO9 B;  1Y69 U;  3TS2 A;  1V1Q A;  1QJO A;  3ERQ A;  3FVQ A;  3S1R B;  1UUP A;  3DM1 A;  4RHS A;  5IP9 G;  1HA6 A;  1Z47 A;  3NP8 A;  3GTJ B;  4GOP A;  1HRJ A;  1WI5 A;  4A3D B;  5IT9 c;  1NMF A;  2MP1 A;  1DOM A;  1B53 A;  4BBR G;  1B9N A;  3MA2 B;  2DUD A;  1ILP A;  4IJL A;  1KIX A;  3A54 A;  4A3B G;  1E2V A;  2D5D A;  4A3D G;  2Q2T A;  1QVC A;  2HD3 A;  4NKL A;  3K5O A;  3C3L A;  1SBB B;  2CW0 C;  4KI0 A;  5AJ3 L;  1EIH A;  5JEA G;  1EOV A;  1HTP A;  3K5N A;  3PO2 G;  4IPD A;  1E24 A;  1SYC A;  3G71 A;  1STN A;  1ZYR D;  1V9P A;  2E74 C;  3TQY A;  4PMC A;  4EQO A;  2N8N A;  3CHB D;  1SE8 A;  3GP7 A;  4ZQ3 A;  1KAA A;  2JYO A;  3CAM A;  2KED A;  1YIJ A;  2NZH A;  1V8Q A;  2K05 A;  1E0B A;  2A6E C;  4JI1 L;  1Q82 C;  3MXG A;  2D62 A;  4G7O C;  1K0R A;  4H7B A;  4DGZ A;  2KEE A;  2CWP A;  3K7A H;  3MAQ A;  4N8F A;  4DV7 Q;  4DXG A;  5I4D A;  3S1Q B;  3NQI A;  3SVM A;  3VYS A;  5C4X B;  2RDH A;  1HCZ A;  5LL6 S;  4DAY A;  3KK7 A;  4LAA A;  3FPU B;  2BDO A;  2BCO A;  2EE1 A;  2L4N A;  1ICW A;  1GJX A;  4V0B A;  4X64 L;  4C3J H;  4K5W A;  5T1G A;  2WAQ E;  4JOI A;  4ZAI A;  4C56 C;  4XT1 B;  5IGF A;  1CSQ A;  4JI8 L;  4K8I A;  1CT1 D;  1N34 Q;  3A5Z B;  1KDB A;  1A8V A;  4ZUI A;  4GLA C;  3RN2 A;  1B70 B;  2NYZ D;  2ICE C;  2A6E D;  4IAL A;  1QWY A;  2XRQ D;  2M00 A;  5M3F H;  1ICF B;  1LO5 D;  3BVG A;  5KYL A;  3E9H A;  5C4H A;  1WTR A;  5IT9 L;  4BBR H;  5C0X I;  2OQK A;  1PRT C;  4GNX B;  3K58 A;  3TP7 A;  5AFW A;  1GHK A;  5J3B A;  3KBG A;  4F88 A;  2CQA A;  2AWN A;  1J5E Q;  1N8R C;  4A3G B;  1HZA A;  2LY7 A;  3IAY A;  3T56 B;  2K01 A;  1X55 A;  4IFD G;  3VA5 A;  3CXC A;  4LUV A;  2EVB A;  5EQ0 A;  3UDG A;  4JC0 A;  4NB3 A;  1LTT D;  4J8Q A;  2UUA Q;  2IPK D;  1TWG B;  2A73 B;  1I4R A;  1JB7 A;  5M9O A;  3GO5 A;  1RKN A;  2PZT A;  1ONL A;  3TRE A;  5ELD A;  2B8F A;  1A2U A;  4K2K A;  1YHQ A;  3C46 A;  3NPP A;  3OTO Q;  5ELC A;  1FJG L;  2JQO A;  4BY1 G;  3GTK B;  2IX3 A;  2IT1 A;  5E4X A;  4XXE A;  4C3J G;  1PFM A;  4DKA C;  1FJG Q;  2PO4 A;  1I4P A;  2KOL A;  4CKC A;  2LS0 1;  4R8I A;  1SE4 A;  2Y0S E;  2NVX B;  1YJN A;  3HRZ C;  3R8B A;  3HOW B;  2F0T A;  1LAC A;  4JBK A;  2DGY A;  5M3F G;  4XYQ A;  4P74 A;  1OXS C;  1YHB A;  2FXQ A;  2L1B A;  1JOR A;  2BOS A;  1CA5 A;  4S3S A;  1BBW A;  4PV1 C;  1K8O A;  1JWU D;  2OXP A;  2NVQ B;  4EQ5 A;  5EBC A;  3PF5 A;  4DAP A;  2F0H A;  4DR2 L;  3NTI A;  3OMG A;  1GXD C;  2NBF A;  3G6J B;  1A2T A;  4BWG B;  4A3G H;  2F0O A;  5JJZ A;  3HFZ B;  3ITP A;  2QCP X;  3OIQ A;  3VR3 A;  4X65 L;  3CCM A;  1S3O A;  2UXD Q;  1U4P A;  3CCR A;  1GUT A;  1S5D D;  5IYB H;  1PTO H;  1D1I A;  3RNU A;  2R61 A;  1L0W A;  5E7N A;  4X65 Q;  2UXD L;  3UE1 A;  4YWL A;  1D5M C;  2JN4 A;  5IOD A;  1VQ5 A;  5IGC A;  4Y52 H;  1G91 A;  5EGT A;  2ZXO A;  4DR4 Q;  4KHV A;  2VQE L;  1H9K A;  3HKZ G;  2L0C A;  4HSP A;  2B2V A;  2F0D A;  3I72 A;  1VMC A;  5IWA Q;  2C35 B;  3BZK A;  1YNN C;  2HUG A;  4K14 A;  1G2T A;  2B8G A;  5G3L D;  5FOB B;  4DV2 L;  2KJX A;  5GRO A;  3A8J E;  1CFM A;  2MJ8 A;  4QCL A;  4HMI A;  1H95 A;  3H0G G;  4DNR B;  1SN8 A;  2O5J C;  4ID6 A;  3G6E A;  4FXG C;  2AHO B;  1K9M C;  1ENF A;  4DV3 L;  3BS1 A;  4DUY L;  2F0S A;  1TU2 B;  1II3 A;  2UXC Q;  2KEN A;  1IBK L;  1EIG A;  1QNK A;  1JT8 A;  2PQA B;  2Z6K C;  1Y1W G;  2R92 G;  1SJH D;  2KUM A;  5FK9 C;  1SFO B;  2HHH Q;  5TSS A;  2FMC A;  1J8I A;  4QF4 A;  3FEW X;  4BBS B;  5J39 A;  1X3E A;  3U9S A;  1O7L A;  3K59 A;  5GQO A;  4DR5 L;  1F2L A;  2XVS A;  1QCB D;  1CTM A;  4K2L A;  1HPC A;  3I7F A;  5C0X G;  3PV0 A;  1WTO A;  3ERS X;  4A3K B;  1VQ7 A;  1LT3 D;  4CGY B;  3OSO A;  1SJE D;  1Y1V B;  4YWK A;  2NVQ H;  1SYF A;  1WJJ A;  2F52 A;  2JA6 B;  4DV5 Q;  3DWP A;  2AQ2 B;  3KF8 B;  5A2Q E;  2Z9H A;  1TS4 A;  3BYT B;  3M4P A;  3TN2 A;  1AN8 A;  3DLL A;  3E0J A;  3T4A C;  3P75 A;  1XYI A;  3VR6 A;  4Z9C B;  3F2C A;  1TS2 A;  3HOX B;  1O80 A;  5BR8 Q;  4KY7 A;  4IUT A;  3NK9 A;  3PSI A;  2PW5 A;  4NXN Q;  1TWG H;  1BNZ A;  1HFN A;  1U0L A;  3OTO L;  3TBI B;  3S9W A;  1HNZ L;  2UXB Q;  4QL5 A;  1RDP D;  3I70 A;  5GAG C;  4GKK L;  2UUC L;  3S15 B;  2IY5 B;  3K5L A;  2X6G A;  3L9A X;  4HAE A;  3GTO B;  3HEJ A;  2UUC Q;  5E4W C;  3NBH B;  4F87 A;  3C1E A;  3M4Q A;  4CHT B;  1J5E L;  3MFG A;  3CCS A;  5HGT A;  3CQZ B;  2JJQ A;  3Q8D A;  3WDN A;  2UU9 Q;  4JBW A;  2B2W A;  5M5W B;  1L1O B;  5EPJ A;  1EWI A;  4X3S A;  2RKS A;  1R9T B;  3J7A 5;  4HR7 B;  1RTO A;  2HCI A;  3H91 A;  2F0G A;  3MEH A;  3BJU A;  4RCN A;  1GOZ A;  2DJG C;  5IGE A;  4RWS C;  4XYO A;  3GTG B;  3J7Z C;  2K03 A;  1ILQ A;  4PZ6 A;  4DK0 A;  3J7Y W;  3Q0A A;  5ELF A;  1D2B A;  5L37 A;  4Y7N H;  2ES2 A;  4DN4 M;  1YJ9 A;  1F9S A;  3CME A;  5IE8 A;  5C3E B;  4FP5 D;  4YY3 L;  1N32 Q;  5I2X A;  3CCJ A;  1NNX A;  2K5W A;  1H9S A;  4RGM A;  2HDM A;  3OPO A;  1CKN A;  3D4D A;  5LMN W;  2NVY H;  4BBS G;  1F2Z A;  2RCN A;  4DXF A;  3HKZ E;  2B2U A;  5C6A A;  2RDG A;  2SEB D;  2ZJQ A;  1SYE A;  2PMZ B;  4TVA B;  4FYD A;  1NR2 A;  4HCS A;  1X9N A;  1YJW A;  3KJO A;  2PQE A;  2F0M A;  3UDF A;  4OWW B;  4OO1 I;  3J80 i;  3L0O A;  4RH6 A;  5ISR A;  4BY7 B;  1L0X B;  3CQZ H;  1CZG A;  1D7Q A;  1I4G A;  4LF5 Q;  3SHL A;  3S14 H;  4DV1 Q;  4QIW E;  2EYO A;  4IUP A;  1A0I A;  4RKL A;  5HUR A;  1IBL L;  3HOV B;  2AUJ D;  3CD6 A;  2NWG A;  4CDD C;  1M8A A;  1YBY A;  4JG2 A;  4JBJ A;  5C4X G;  4C1N K;  4GKJ Q;  2QW7 A;  4GLV B;  2H1E A;  1XPO A;  1RF2 D;  2F0I A;  4JYA L;  3T1H L;  1CZW A;  2RQX A;  3HOU B;  1KDC A;  4OX9 Q;  4KMU C;  2HHH L;  1FYC A;  1D8L A;  4HSV A;  1NY4 A;  1A3T A;  1E2Z A;  4LW1 A;  5KEE A;  1SAP A;  1TII D;  1C7Y A;  3HOU H;  1Y1W B;  2R93 H;  1HTL D;  4X3K A;  5LMU L;  2AQ3 B;  3I73 A;  1WVL A;  4FXD A;  2RA4 A;  3A55 A;  3K80 C;  2L15 A;  1K8G A;  4DAV A;  2WII B;  1JJ2 A;  4NPS A;  3ZJY C;  5FLX E;  5IGG A;  4RFB A;  2B3G A;  1A62 A;  1B8A A;  4BBS H;  1AZQ A;  4NXM L;  5CBA E;  4Q0F A;  2BE5 D;  4L5Q A;  4RGN A;  3VA7 A;  1HA5 A;  1SE3 A;  3SR1 A;  3OWF A;  3MZ5 A;  3OMC A;  5M5X B;  1IBK Q;  1K83 B;  1K83 H;  4CJ0 B;  3K6O A;  1A3U A;  1GUO A;  5IY0 A;  1SSO A;  2DNC A;  2LXJ A;  4DAY B;  4XQQ A;  1JE5 A;  2I5H A;  2JA8 G;  3QB3 A;  2OCE A;  2XIW A;  4A4I A;  4JI2 Q;  4HJA A;  1RHP A;  5CR3 A;  3KOJ A;  1Y8P B;  3TME A;  4JI0 Q;  1XXG A;  3S2D H;  1I4X A;  3DUZ A;  1TT2 A;  2JXM B;  3S2H H;  3OW7 A;  1OXX K;  5DNF A;  5T1I A;  2EDG A;  1UE1 A;  2KBN A;  1AP0 A;  1NUC A;  2ZJP A;  4QMG A;  4JVZ A;  3V2T A;  4X62 L;  1Y1W H;  4K6L A;  1EEF D;  3D0F A;  4BBR B;  3TEH B;  3MXN A;  2NZ1 D;  2K50 A;  4ALP A;  3GTG H;  4LJZ C;  1VF7 A;  1BKB A;  1K3R A;  4EX5 A;  2R93 G;  2JA5 B;  2A6H C;  1MJC A;  2IL8 A;  1U9R A;  3I4N G;  4KJO A;  4G7Z C;  4GNX C;  2A69 D;  1PH8 A;  1VS0 A;  1E22 A;  4OWT B;  4A3K G;  4POF A;  2G9H D;  2K5H A;  1LM0 A;  1I6H B;  4HJ7 A;  4FVM A;  2B2Y A;  4RGT A;  4KTA A;  2N78 A;  2R6G A;  2IX0 A;  2Z8L A;  1OXU A;  1EYD A;  2NN6 G;  4FF3 A;  5F2D A;  4LF7 L;  1GUW A;  4MNO A;  4AYB G;  5EPK A;  3NWT A;  5D14 A;  4LMQ D;  1RD9 D;  2H5X A;  1DGS A;  2JEB I;  1SNC A;  4KY6 A;  3S1N H;  4LF7 Q;  1TWH H;  3UDI A;  1PFB A;  2OTJ A;  2R92 B;  1SYB A;  3GTK H;  4LF8 L;  2Q2H A;  1CKO A;  4GLX A;  4LFA L;  2EZV A;  2L55 A;  1PZI D;  2MO1 A;  5EKI A;  2WAQ G;  4IJH A;  4DUZ Q;  5EJW A;  1JOK A;  2HDL A;  3PMF A;  1LT5 D;  1BBX C;  1WTX A;  3I91 A;  2F4V L;  3A7A B;  3J81 j;  3Q24 A;  1B2T A;  3DEP A;  1GVP A;  3TRZ A;  2CWA A;  2F0U A;  4G57 A;  4R1J A;  4UPA A;  3CC7 A;  2R92 H;  4XQN A;  4ZRZ A;  3A8I E;  4OIK A;  1F77 A;  1B1Z A;  3DHQ A;  1HUN A;  1KL9 A;  3NBH A;  1UNS A;  1U4M A;  2B2W C;  3N52 A;  3GTO H;  3T16 A;  1ASY A;  3VDY A;  4HJ9 A;  1ZEQ X;  4M8A A;  3TZD A;  4JYA Q;  1EYC A;  4AYB E;  3VR4 A;  1STH A;  4H13 C;  4A93 B;  4NP5 A;  4QB4 A;  1MSH A;  1X3Q A;  2RCF A;  1L2F A;  1SNQ A;  3A7L A;  2WKD A;  2LMC B;  3F2D A;  3L7Z C;  3BG3 A;  3EN2 A;  2C9O A;  2JA5 H;  1AH9 A;  3CRK C;  2PW7 A;  3NEM A;  5LMU Q;  1JR0 D;  3CC4 A;  3FP9 A;  4A3J G;  1PZK D;  3QOL A;  2R7Z B;  1X56 A;  4DPG A;  3NBI A;  4EGV A;  1EQT A;  2E2I B;  1IW7 C;  3QR8 A;  1DON A;  2E76 C;  4C3I H;  1BO0 A;  5C44 B;  1XPR A;  2EY2 A;  4DFA A;  3J81 L;  1BCP D;  1H9M A;  4DV6 L;  1DZ1 A;  4AQY L;  3MFY A;  5FJ8 H;  1LTL A;  1HXY D;  3LX0 A;  3GTM H;  2L12 A;  2EYL A;  1HQR D;  2BA0 A;  1IBM L;  4APV A;  2JE6 I;  3IRB A;  1E7Z A;  2KHJ A;  4ULL A;  3RD4 A;  1MJE A;  4LF6 Q;  2V1C C;  3EBE A;  4J15 A;  5FO7 B;  4CKE A;  1DJR D;  4QY7 A;  1TY0 A;  3JAM L;  1VQH A;  1PLF A;  1QUQ B;  3LNN A;  3K0X A;  4A3M G;  1GUG A;  2MNA A;  1TWC B;  4U68 A;  3H3V H;  1J6Q A;  1HH2 P;  3S17 B;  1XNQ Q;  2F0L A;  1PRT D;  3F1Z A;  2N49 A;  3HOV G;  2GVB A;  5C4X H;  4K5X A;  2H4O A;  5GAD C;  2YTX A;  3S1Q H;  5DEH A;  4Q5V A;  1DXM A;  1L1O C;  2VXW A;  2EY1 A;  2K32 A;  1SYD A;  1RIP A;  2K52 A;  2M9V A;  1VQC A;  4JK1 C;  4HJ5 A;  1ENC A;  3OWE B;  3EQL C;  1MHW C;  1BCP F;  1S5E D;  1VQ6 A;  1Y14 B;  1YZ6 A;  3W3A A;  3K57 A;  5IYC H;  1G6Z A;  5IYB G;  4XT3 B;  1XNR Q;  4JBM A;  2L11 A;  3G7L A;  3PCO B;  4A3F H;  1MSG A;  4NXM Q;  4ZK9 B;  1FNV A;  4JI4 Q;  1X32 A;  3RUZ A;  2PI2 E;  4RAU C;  2JEA I;  1TY2 A;  2AKW B;  1H9R A;  1JOQ A;  5KIX A;  1D6E C;  4JV5 Q;  1VQO A;  1X3F A;  5BN4 A;  4JI6 L;  5KNC A;  1N36 L;  2XGT A;  3EJI A;  5IGB A;  4DV7 L;  2CCZ A;  3CC2 A;  2EJF C;  1S5C D;  1ESF A;  3CKI B;  1M4V A;  4JI2 L;  1S40 A;  3AEV A;  4BXX H;  2LSS A;  4DK6 C;  4JCV E;  4RG1 A;  2E2D C;  2A19 A;  2X6L A;  3WOF A;  1DYQ A;  4X64 Q;  1M90 C;  3M4O H;  2BH2 A;  1KNE A;  3JC6 6;  4R4I A;  1LV9 A;  3QO2 A;  1GKH A;  2UU9 L;  1STY A;  2FIN B;  4WFN 3;  2JK8 A;  5KND A;  3NWS A;  1PTO F;  1R4P B;  3PO3 B;  2MPM A;  2UXC L;  1JCK B;  1UE5 A;  4JW0 A;  3CPW A;  1WD0 A;  5JJL A;  1IZ6 A;  5C0X J;  5IP7 H;  2YU9 H;  4FDB A;  3RZO B;  2B63 G;  3CP0 A;  3S16 H;  2E8G A;  1D5X C;  2J7Z A;  1EUJ A;  1G8Z D;  2CW0 D;  4LNQ A;  4RA8 A;  1PTO B;  5C3W A;  3PQI A;  1EU3 A;  1ZYR C;  1QE6 A;  4YCV A;  4B3R Q;  1MBY A;  1Q1E A;  3H09 A;  2PZW A;  2JA6 H;  3J80 L;  4IUR A;  3I4M B;  1G2S A;  4A3L G;  5EBD A;  4DR5 Q;  4UAI A;  5E3F A;  4IO9 A;  2BE5 C;  3HOV H;  4JI3 L;  2WFW A;  1BR9 A;  1PDQ A;  2JA8 B;  3E5S A;  2F0K A;  2A6H D;  1Q8I A;  2KEC A;  5COY A;  1KQS A;  5C3E H;  3ND9 A;  3SK4 A;  1N33 Q;  1NTG A;  2TMP A;  2EYM A;  1SDF A;  4BY1 B;  3I4N H;  3GTL B;  1KAB A;  3O13 A;  1X54 A;  3STB C;  3FKI B;  3DWA A;  3BDO A;  5C44 G;  4J6H A;  4YHH L;  4P71 A;  1F9Q A;  1I5F A;  4UP9 A;  1KLG D;  3ZYY X;  3VYT A;  4CDE C;  1NJI C;  4QIW B;  1IXR A;  4MIU A;  4TKO B;  4CDC C;  1KTK A;  1R4Q B;  1V1P A;  3EIV A;  1L1O A;  4FNF A;  2MGS A;  2RVL A;  1DCZ A;  4AH6 A;  1TWH B;  5C4Z A;  2VL6 A;  3M4O B;  3AYH B;  2JA8 H;  4AQY Q;  5IT9 E;  4MTK A;  1T9H A;  2HIX A;  2OT2 A;  1B7Y B;  4ME5 A;  4I7A A;  5FLX c;  1XPU A;  2Z0S A;  2VQF L;  5FO9 B;  3I2Z A;  3KUP A;  4L5S A;  1OXV A;  3F2B A;  1PYB A;  3LWU A;  3J80 E;  4G4K A;  4DV4 L;  3F2U A;  2EXZ A;  3RZO H;  5BN5 A;  1TS3 A;  1F2M A;  4IZ8 A;  3VYU A;  1Q8K A;  4DK1 A;  1LLR D;  2Q8I B;  1U5K A;  3T13 A;  1EY5 A;  1GD7 A;  4R4C A;  4DR2 Q;  1XNQ L;  1WTW A;  4B3S L;  2VUM H;  3VR5 A;  1I94 L;  4IFD I;  1XX8 A;  2F4I A;  1PYW D;  1BUV T;  1CA6 A;  4CJ2 C;  4YIJ A;  1PYS B;  2I5M X;  3KDF B;  1E2W A;  4RMF A;  4X66 Q;  4A3K H;  4OL7 A;  1OTC A;  5CYU A;  5H1S E;  5C44 H;  1W6K A;  3MEF A;  3S15 H;  2EYJ A;  2VNU D;  5I2Y A;  1QUQ A;  1Z7T A;  5KGU A;  4A3I G;  1SRU A;  1LAB A;  5M3F B;  2GA4 B;  1TS5 A;  3KBX A;  5NUC A;  3BVZ A;  1S5F D;  1SEB D;  3B6Y A;  1E3P A;  3D4W A;  4HID A;  1IBM Q;  1I50 H;  2IX1 A;  4DR7 L;  4L8J A;  2MFI A;  3KFU A;  2QDL A;  1LTS D;  2EXD A;  2FJ2 A;  2VZA A;  2UUB Q;  2A8V A;  2SOB A;  1A63 A;  3CPF A;  3QG1 A;  5I6W A;  3TS0 A;  2UUB L;  4QUF A;  5FJ8 G;  5IGD A;  5G3L F;  1HJP A;  2QEX A;  3MWY W;  2IW3 A;  2PPB C;  3AU7 A;  1WTV A;  1XTC D;  2GN5 A;  3S1M H;  3DM3 A;  2DJF C;  3S14 B;  2F1M A;  4ABN A;  2MO0 A;  3FMC A;  1PH9 A;  4JI5 Q;  4BA2 I;  3H3V I;  4DR6 Q;  3SEB A;  4X6A H;  1GM5 A;  3E9I A;  4C2M H;  3GTP B;  1CK1 A;  2F0J A;  3MXU A;  1JB3 A;  3TSS A;  2EOT A;  4O2D A;  4A3M H;  4DR1 L;  3OW2 A;  3JAM E;  2OWO A;  2D2C C;  1PFN A;  5IYD H;  5FKA C;  2K14 A;  4P2C B;  4KN4 C;  4JV5 L;  5C0X H;  1YNJ D;  4XQJ A;  4GN4 B;  5IIF A;  4F7X A;  5HY6 A;  1Z9F A;  2QF7 A;  4O42 A;  3FDT A;  1JJG A;  1U4R A;  3DEO A;  3UI2 A;  1IYV A;  4MZ9 A;  3ULP A;  3PUV A;  2WIN B;  4JI8 Q;  3J81 E;  3BZC A;  2R93 B;  2Q2U A;  1F9P A;  2R7D A;  2KQ3 A;  4MHE A;  1HR0 W;  2FMM A;  4H0L C;  2MQH A;  1CQV A;  5J22 A;  5BR8 L;  1SMY C;  3M7N A;  1V1O A;  5FLX L;  1YHA A;  2PQA A;  2F4V Q;  5C4J B;  3OIP A;  2JA7 B;  2JA7 H;  4JI7 Q;  2KA7 A;  1BXT A;  1KNA A;  2CKZ B;  5BN3 A;  3RZD B;  1P16 A;  5COR A;  1Y8O B;  1H9J A;  1FD7 D;  1MI2 A;  1ML0 D;  3PIP A;  2I5L X;  1VQA A;  4F8M A;  1GHJ A;  2F0Q A;  1WOC A;  3I90 A;  1I3Q H;  1Q1B A;  4LFC Q;  3SXH A;  4B08 A;  1Y1V H;  2Z4H A;  3S1N B;  2Y0S G;  5DAU A;  3D3R A;  1HR0 L;  2E2I H;  1WCM B;  2OTL A;  5FLM G;  2UUA L;  3K5M A;  4RKB A;  3GTQ B;  3H6M A;  4K8J A;  2VW9 A;  2NVT H;  3HP3 A;  1VQG A;  1X3G A;  2IWH A;  1I6H H;  4DV5 L;  4DV4 Q;  1YEZ A;  2NTS A;  4WJ4 A;  5JAV A;  4A3C H;  5JPN C;  3FRP B;  2J0T D;  3I8Z A;  4HMJ A;  4KJN A;  4WOR A;  2B2U C;  5FO8 B;  3HOX H;  1CKN B;  1K0S A;  1J9O A;  1JOO A;  4YHH Q;  3SK6 A;  1EY6 A;  2JA6 G;  5IYC G;  4O0A A;  4NXN L;  1I94 Q;  4IUQ A;  3J80 c;  3W1G A;  1PXU A;  4B3M L;  2K5D A;  2UXB L;  1KLU D;  2RF4 A;  4R4O A;  2CHB D;  1QZH A;  4A3E H;  4H44 C;  1E1T A;  4RGO S;  3DXJ C;  1ROD A;  4IQZ A;  2QDB A;  3S2H B;  1PH1 A;  4A76 A;  3GTJ H;  1HUM A;  5KRU A;  1JC7 A;  2GVA A;  3ER0 A;  2B2T A;  3TDQ A;  2I0Q A;  1NE3 A;  1EIF A;  3PIP 3;  3LGJ A;  2K5Q A;  3A8K E;  3NUC A;  2K5N A;  2E5L Q;  1IL2 A;  1O78 A;  4A75 A;  1AEX A;  2QIL A;  3FKI H;  1VQE A;  2F03 A;  4A3F B;  1A15 A;  1BBU A;  1EQR A;  4PZ7 A;  3H0G H;  2ASB A;  1VQ8 A;  2WAC A;  3MVV A;  2JSO A;  3GV6 A;  1K73 C;  1EY0 A;  2XWB B;  3M9B A;  1SNM A;  1EFI D;  1CM9 A;  3TP6 A;  2K04 A;  3V96 A;  3U9O A;  3J81 c;  4JOI C;  4CBV A;  2EPB A;  1SXT A;  4CKB A;  2KCN A;  2E2J H;  4GN5 A;  4I65 A;  3E3X A;  4JI5 L;  3T1H Q;  1AW7 A;  1Q7Y C;  4ZLT F;  3PUY A;  1ESR A;  2XN9 C;  1XNR L;  3LWE A;  3HKZ B;  5AJ3 Q;  3NSW A;  1QZG A;  2A68 D;  1EU4 A;  1EEI D;  2KCT A;  4K0K Q;  3S16 B;  3QJY A;  1CHP D;  1CHQ D;  2F0W A;  4A3C G;  3D31 A;  1OXT A;  4IPG A;  1JQY D;  3I4M G;  4KV6 A;  3CMA A;  1YVC A;  4R4T A;  3RLN A;  5M5X H;  4ZCK A;  3GD7 A;  1LTG D;  1D1K A;  3HG9 A;  4KN7 C;  2E2H H;  4POG A;  3PO2 B;  2VQE Q;  3H3V C;  4C3J B;  1Q81 C;  1QOH A;  5K36 H;  2MUY A;  3IFT A;  4DNI A;  5JOB A;  4MN3 A;  3ONA B;  3R2I A;  1P8L A;  2NVY B;  1DOK A;  5EPL A;  4U67 3;  3BYY B;  3IFD A;  4JPB W;  4DV1 L;  4LF4 L;  2NN6 I;  4J1M A;  3VYR A;  5ELB A;  4DV3 Q;  1IBL Q;  2R7Z G;  3K7A B;  5CV9 A;  2Q8R E;  5I6Y A;  5A2Q L;  4ZUJ A;  2VS1 A;  3FKI G;  3RLF A;  1SYG A;  2B29 A;  3PUX A;  3URY A;  2ZT9 C;  1EOT A;  1N34 L;  2BDN A;  3EFX D;  5A35 A;  1Q12 A;  2CVR A;  2ZTC A;  2F0F A;  4DR6 L;  1VQB A;  4JI7 L;  2SDF A;  1BCP C;  1K8A C;  4IN3 A;  2ID0 A;  4C2M B;  4M1U B;  1AE3 A;  4V19 0;  4LF6 L;  3GTP H;  3NQT A;  1G51 A;  3TP5 A;  3G48 A;  4HN7 A;  3A56 A;  5M5Y H;  2RSN A;  4DR1 Q;  4UHV A;  4FF2 A;  4AYB B;  3K0Y A;  4H02 A;  1BQQ T;  1EY9 A;  2NVX H;  3W2D A;  1YNN D;  3I4O A;  4NDX A;  4JI3 Q;  1SMX A;  1EQQ A;  1EFW A;  4B9X A;  2E2J B;  1PA6 A;  4IUN A;  2EIF A;  1NAP A;  3W1B A;  4R9W A;  2DNE A;  2VUM G;  1STG A;  4LK1 C;  1W2B A;  2O4X A;  3STB D;  2PYK A;  3I4M H;  1YIT A;  1ZKO A;  1F9R A;  1JE4 A;  2SNM A;  4UDU C;  3P7J A;  1VQ4 A;  1EY4 A;  2VB2 X;  5J1Z A;  4LWC A; 
#chains in the Genus database with same CATH homology
 1XMO L;  3CPW A;  5JJL A;  1IZ6 A;  3F2C A;  5C0X J;  5IP7 H;  1VQ9 A;  5BR8 Q;  3K7U C;  2YU9 H;  1VQN A;  4FDB A;  2CQO A;  4A3I H;  2B63 G;  3CP0 A;  3PSI A;  4WJ3 M;  3S16 H;  2E8G A;  4NXN Q;  1EUJ A;  1TWG H;  2PNH A;  4LNQ A;  2XTI A;  1U0L A;  3GTL H;  2YTY A;  2YTV A;  3BU2 A;  3OTO L;  3CCQ A;  4LFC L;  4DV0 L;  5DLQ E;  1HNZ L;  4XTC S;  2UXB Q;  4QL5 A;  1SR3 A;  5GAG C;  4YCV A;  4GKK L;  4JI1 Q;  4B3R Q;  3PUZ A;  1Q1E A;  2UUC L;  2RHQ B;  2JA6 H;  3HOW G;  1HZC A;  2IY5 B;  1HNZ Q;  4A3L G;  4QGU A;  5ELO A;  4DR5 Q;  2A1A A;  4IO9 A;  3HOV H;  4JI3 L;  2WFW A;  2UUC Q;  1KRT A;  3NBH B;  2EQS A;  1O7I A;  3M4Q A;  1IYJ B;  4MTN A;  1J5E L;  3CCS A;  2R7Z H;  2WB1 G;  5C3E H;  1KQS A;  4BY7 H;  4UP7 A;  3S24 A;  3HOZ G;  2JJQ A;  3Q8D A;  5M3M G;  4JBW A;  3PIO A;  2UU9 Q;  1N33 Q;  2D0P A;  1NTG A;  1YI2 A;  1S72 A;  4IPH A;  1L1O B;  4IOC A;  4LUZ A;  4X62 Q;  3I4N H;  4GNX A;  1EWI A;  2K5V A;  3HOX G;  1X54 A;  3STB C;  4LUO A;  5C44 G;  3J7A 5;  4YHH L;  4P71 A;  2ZTE A;  1I5F A;  4UP9 A;  5LMN L;  3BJU A;  2K4K A;  1PH7 A;  3AFP A;  5IP7 G;  1NJI C;  5LMN Q;  1UE7 A;  2BA1 A;  3CCV A;  1IXR A;  3J7Z C;  2LXK A;  4PZ6 A;  3KF6 B;  2ZJR A;  4Y7N H;  2ES2 A;  5ELN A;  4AIM A;  4A3E G;  1YJ9 A;  1CKM A;  4OON A;  3CME A;  1G29 1;  3EIV A;  5IE8 A;  1L1O A;  3HOY G;  2ZTD A;  3AQQ A;  4YY3 L;  4GKK Q;  4X66 L;  1N32 Q;  4AH6 A;  2VL6 A;  2B63 H;  4UP8 A;  3G4S A;  3CCJ A;  3HOZ H;  2WB1 E;  1WYD A;  3AYH B;  4DK3 C;  1WCM G;  3UE0 A;  4AQY Q;  2JA8 H;  3GDE A;  4A3L H;  1PH2 A;  2D0O A;  4HJ8 A;  5IYD G;  1CKN A;  1T9H A;  2HIX A;  3ULJ A;  1B7Y B;  4A3D H;  1PFS A;  5LMN W;  2NVY H;  4BBS G;  1XPU A;  5FLX c;  4DR3 L;  2Z0S A;  2VQF L;  2RCN A;  4A3G G;  3KF6 A;  1XMQ Q;  1KHI A;  3I2Z A;  3HKZ E;  3S1R H;  4LF8 Q;  3HOU G;  1TWC H;  4L5S A;  1N9W A;  1OXV A;  4PZ8 A;  2ZM6 Q;  3F2B A;  1PYB A;  2ZJQ A;  1N33 L;  3PO2 H;  1C0A A;  4B3T L;  4TVA B;  4DV4 L;  4DR7 Q;  1TWF H;  1X9N A;  1SFO H;  3RZO H;  1KC8 C;  1PVO A;  1YJW A;  4KHP L;  4B3T Q;  1Q46 A;  3KJO A;  5C3E G;  1LUZ A;  2IHF A;  5HGQ A;  1Q8K A;  4KHP Q;  2PMZ E;  3UDF A;  4OWW B;  1U5K A;  3PO3 H;  2JA5 G;  4TQU S;  3T1Y Q;  1GD7 A;  1SLJ A;  4R4C A;  3J80 i;  1VQP A;  3L0O A;  4LF5 L;  1AE2 A;  4DR2 Q;  1XNQ L;  5IP9 H;  4B3S L;  2VUM H;  1I94 L;  3CQZ H;  4IFD I;  1D7Q A;  4P73 A;  4XIG S;  3KYH C;  3H15 A;  3T1Y L;  4LF5 Q;  4BY7 G;  2JA9 A;  3S14 H;  3F8T A;  1PYS B;  2I5M X;  4QIW E;  4DV1 Q;  4P75 A;  3KDF B;  4B3S Q;  1A0I A;  4B3M Q;  1SRO A;  4PG3 A;  1KD1 C;  1IBL L;  2PI2 A;  4RMF A;  4X66 Q;  1OTC A;  4A3K H;  4BA1 I;  4GKJ L;  3CD6 A;  1HZB A;  1MIU A;  1VQF A;  3WWV A;  1KAW A;  5H1S E;  3A5U A;  1YBY A;  5C44 H;  3MEF A;  4JG2 A;  4JBJ A;  3S15 H;  5C4X G;  4GKJ Q;  1HNW Q;  2VNU D;  1QUQ A;  2VY3 A;  4A3I G;  4GLV B;  1SRU A;  1VCI A;  1XPO A;  3CCE A;  3NEN A;  4UY8 C;  4DR3 Q;  3CCU A;  1ASZ A;  4JYA L;  3T1H L;  4A93 G;  4ME3 A;  2KCM A;  4R4Q A;  1EIY B;  3B6Y A;  1NMG A;  2ZM6 L;  4OO1 G;  2RHS B;  3KDF A;  4IFD J;  1E3P A;  1GO3 E;  3CF5 A;  4HID A;  4OX9 Q;  2HHH L;  1IBM Q;  1I50 H;  2IX1 A;  2IHE A;  4DR7 L;  3JAM c;  1D8L A;  3KFU A;  2MFI A;  1NY4 A;  5IWA L;  4LW1 A;  1C7Y A;  3HOU H;  2EXD A;  4L5T A;  4DR4 L;  1C9O A;  1UWV A;  2VZA A;  1X65 A;  2R93 H;  2UUB Q;  3TS2 A;  5LMU L;  1V1Q A;  4A93 H;  2A8V A;  5EAY A;  1A63 A;  3CPF A;  3AFQ A;  5IP9 G;  3TS0 A;  2UUB L;  1Z47 A;  3K80 C;  2L15 A;  4GOP A;  3NEL A;  1K8G A;  1WI5 A;  5IT9 c;  5FJ8 G;  1UEB A;  1NMF A;  3E0E A;  1HJP A;  2QEX A;  1JJ2 A;  2KHI A;  4BBR G;  4NPS A;  3I56 A;  3ZJY C;  2DUD A;  2GN5 A;  3S1M H;  3DM3 A;  4IJL A;  1KIX A;  4LF4 Q;  4A3B G;  4DV6 Q;  2B3G A;  3KJP A;  4A3D G;  1A62 A;  2Q2T A;  1QVC A;  1B8A A;  2MO0 A;  4BBS H;  1PH9 A;  4JI5 Q;  4NXM L;  4A3F G;  4JI4 L;  4BA2 I;  3H3V I;  4L5Q A;  2AMC B;  4DR6 Q;  2AWO A;  3JAM i;  4KI0 A;  5AJ3 L;  5JEA G;  4GOP C;  4X6A H;  1V43 A;  1GM5 A;  1EOV A;  3E9I A;  4C2M H;  4C3H H;  3PO2 G;  4IPD A;  1E24 A;  3G71 A;  1IBK Q;  1K83 H;  1V9P A;  1VQJ A;  3TQY A;  1PHJ A;  3OYY A;  2N8N A;  4O2D A;  5IY0 A;  1SE8 A;  4DR1 L;  4A3M H;  2LXJ A;  4DAY B;  4A3B H;  3CAM A;  3FHW A;  3OW2 A;  1YIJ A;  1JE5 A;  2I5H A;  2NZH A;  1PH3 A;  2OWO A;  2JA8 G;  1VQL A;  2OCE A;  4A4I A;  4L5R C;  5IYD H;  1KRS A;  2N3S A;  4JI2 Q;  4JI1 L;  3PUW A;  4HJA A;  1Q82 C;  2K14 A;  4IOA A;  2D62 A;  1K0R A;  4JV5 L;  1I6H H;  3KOJ A;  1TWA H;  2CWP A;  3K7A H;  1HNW L;  4JI0 Q;  4GN4 B;  3S2D H;  3J81 i;  4DV7 Q;  1QVF A;  5HY6 A;  3K8A A;  3UDX A;  1HZ9 A;  1Z9F A;  3ICE A;  3S2H H;  1OXX K;  1JJG A;  3L2P A;  4OXP A;  4MZ9 A;  3ULP A;  2JA7 G;  1UE1 A;  5JEA J;  3M3Y H;  2KBN A;  3PUV A;  3KLW A;  2ZJP A;  2HIV A;  4JI8 Q;  4X64 L;  4KLK A;  3BZC A;  4C3J H;  4QJF A;  4X62 L;  2Q2U A;  2R7D A;  2Z6K A;  2WAQ E;  4JOI A;  1Y1W H;  3PO3 G;  1VQK A;  1CSQ A;  3D0F A;  1HR0 W;  4JI8 L;  2MQH A;  5BR8 L;  3TEH B;  4ALP A;  2K50 A;  3GTG H;  3M7N A;  1BKB A;  1K3R A;  4EX5 A;  1FVI A;  1YHA A;  5M3M H;  1N34 Q;  3A5Z B;  2R93 G;  2PQA A;  1A8V A;  1MJC A;  1Y1V G;  2F4V Q;  4GLA C;  3RN2 A;  1B70 B;  1PH5 A;  3I4N G;  1CSP A;  2JA7 H;  4GNX C;  4IPC A;  1PH8 A;  4JI7 Q;  1VS0 A;  3M85 A;  2CKZ B;  1E22 A;  4OWT B;  5M3F H;  4POF A;  4A3K G;  1P16 A;  2K5H A;  3PIP A;  4BY1 H;  1LM0 A;  3E9H A;  5FLM H;  4HJ7 A;  4BBR H;  2I5L X;  5C0X I;  2OQK A;  1VQA A;  1WFQ A;  3I55 A;  4GNX B;  1WOC A;  2N78 A;  3GTQ H;  2R6G A;  3SGI A;  1I3Q H;  3PF4 A;  1N32 L;  1Q1B A;  4DV0 Q;  2IX0 A;  5J3B A;  1OXU A;  4LFC Q;  2NN6 G;  1Y1V H;  4LF7 L;  2AWN A;  1J5E Q;  4MNO A;  4AYB G;  1N8R C;  1HZA A;  2Y0S G;  1X55 A;  2H5X A;  1DGS A;  1JJC B;  2JEB I;  1TXY A;  1HR0 L;  1HNX Q;  3S1N H;  4LF7 Q;  1TWH H;  3UDI A;  2E2I H;  2OTJ A;  4IFD G;  2OTL A;  5FLM G;  3CXC A;  2UUA L;  3GTK H;  4LF8 L;  4LUV A;  2Q2H A;  1CKO A;  4GLX A;  2VW9 A;  4LFA L;  2NVT H;  3UDG A;  1VQG A;  1X3G A;  4JC0 A;  4NB3 A;  2UUA Q;  2MO1 A;  4DV4 Q;  4DV5 L;  1YEZ A;  4YCU A;  2E5L L;  2WAQ G;  4A3C H;  4A3J H;  4IJH A;  4WJ4 A;  4DUZ Q;  2F3I A;  5GAH C;  1JB7 A;  3HOX H;  1CKN B;  3GO5 A;  2F4V L;  1X6O A;  4YHH Q;  4DUZ L;  1KXL A;  3TRE A;  3J81 j;  2JA6 G;  3HOW H;  5IYC G;  4O0A A;  4NXN L;  1I94 Q;  4GN3 B;  2HQL A;  1YHQ A;  3J80 c;  1GVP A;  3TRZ A;  2CWA A;  3OTO Q;  4R1J A;  3W1G A;  1FJG L;  2JQO A;  4BY1 G;  4UPA A;  3CCL A;  4B3M L;  2UXB L;  3CC7 A;  2RF4 A;  4R4O A;  1QZH A;  2R92 H;  4A3E H;  2IT1 A;  4PMW A;  4DKA C;  4B3R L;  1E1T A;  2ATW A;  1FJG Q;  1KL9 A;  4YY3 Q;  2VQF Q;  1NBW A;  1PH1 A;  3GTO H;  2ALY B;  1XMQ L;  2K75 A;  4A76 A;  3U58 A;  4P72 A;  1HR0 Q;  1ASY A;  3VDY A;  3GTJ H;  5JJK A;  2Y0S E;  4HJ9 A;  4JYA Q;  4AYB E;  3S17 H;  2GVA A;  3ER0 A;  1YJN A;  3W5O A;  2QA4 A;  2I0Q A;  4JBK A;  1NE3 A;  2DGY A;  5M3F G;  3RZD H;  1EIF A;  1CUK A;  3LGJ A;  1L2F A;  2K5N A;  3PGZ A;  2E5L Q;  4P74 A;  1JMC A;  1OXS C;  1YHB A;  2FXQ A;  3L7Z C;  3F2D A;  4A75 A;  5C4J H;  3EN2 A;  1BVS A;  1IL2 A;  4YCW A;  3FKI H;  2JA5 H;  1MKH A;  1AH9 A;  1VQE A;  4LF9 L;  1BBU A;  3HOY H;  3NEM A;  5LMU Q;  2BH8 A;  1BBW A;  1UE6 A;  1EQR A;  3CC4 A;  4PZ7 A;  3FP9 A;  3H0G H;  4A3J G;  1VQ8 A;  2ASB A;  3U4Z A;  1X56 A;  4DPG A;  4LF9 Q;  1K73 C;  1WCM H;  4EQ5 A;  3M9B A;  4DV2 Q;  3PF5 A;  4DR2 L;  3CW2 C;  4GOP B;  4C3I H;  2NZO A;  1XPR A;  1VQD A;  1W3S A;  3J81 c;  4JOI C;  4A3G H;  2E2J H;  4DV6 L;  4GN5 A;  3HFZ B;  4AQY L;  3CCM A;  4X65 L;  2UXD Q;  1S3O A;  1XTD A;  4JI5 L;  5FJ8 H;  1LTL A;  3CCR A;  4DUY Q;  1FGU A;  3T1H Q;  1Q7Y C;  5IYB H;  3GTM H;  3PUY A;  3RNU A;  1XNR L;  1Q86 C;  4LFB L;  1L0W A;  5AJ3 Q;  1QZG A;  5E7N A;  4X65 Q;  2UXD L;  5K36 G;  5GAE C;  3UE1 A;  2R7F A;  2KCT A;  4YWL A;  1RL2 A;  2BA0 A;  1IBM L;  4K0K Q;  3U4V A;  2JE6 I;  3IRB A;  4APV A;  4LFB Q;  4A3C G;  1E7Z A;  2KHJ A;  1VQ5 A;  3D31 A;  4Y52 H;  1MJE A;  2CFM A;  1M1K C;  1OXT A;  4IPG A;  1EYG A;  4LF6 Q;  2V1C C;  4KHZ A;  3EBE A;  3I4M G;  4BXX G;  3CMA A;  1YVC A;  4R4T A;  4J15 A;  3RLN A;  3ULL A;  5M5X H;  2VQE L;  4DR4 Q;  3GD7 A;  4HIO A;  4QY7 A;  1VQH A;  3HKZ G;  4OX9 L;  1QUQ B;  3K0X A;  2E2H H;  4POG A;  4OO1 I;  4A3M G;  2VQE Q;  2YYZ A;  5IWA Q;  1Q81 C;  2Q2I A;  2MNA A;  4DNI A;  3H3V H;  1J6Q A;  1HH2 P;  2C35 B;  3BZK A;  2WP8 J;  1XNQ Q;  3F1Z A;  2N49 A;  3HOV G;  1P8L A;  2GVB A;  2HT1 A;  3RLO A;  5C4X H;  4HIK A;  4DV2 L;  5GAD C;  5GRO A;  4DV1 L;  4LF4 L;  2YTX A;  2NN6 I;  3S1Q H;  1VQM A;  3U50 C;  4DV3 Q;  1IBL Q;  2R7Z G;  1H95 A;  3H0G G;  1L1O C;  1PH4 A;  1SN8 A;  2OQ0 A;  1LYL A;  1FL0 A;  1RIP A;  2K52 A;  3G6E A;  1PH6 A;  2AHO B;  1VQC A;  4HJ5 A;  1K9M C;  4QQB X;  2VS1 A;  3FKI G;  3RLF A;  4DUY L;  2B29 A;  4DV3 L;  3PUX A;  1VQ6 A;  2QGQ A;  2UXC Q;  1Y14 B;  1YZ6 A;  2KEN A;  5IYC H;  1IBK L;  5IYB G;  4DAM A;  1N34 L;  1XNR Q;  4JBM A;  1Q12 A;  3PCO B;  4A3F H;  2ZTC A;  1JT8 A;  1PV4 A;  4NXM Q;  4JI4 Q;  2PQA B;  4GS3 A;  4K0K L;  4DR6 L;  1VQB A;  2Z6K C;  3HKS A;  4JI7 L;  1Y1W G;  2R92 G;  4JI6 Q;  2PI2 E;  1QVG A;  1K8A C;  2ID0 A;  2JEA I;  3GTP H;  1AE3 A;  2AKW B;  4YWM A;  3K81 C;  4LF6 L;  1G51 A;  2HHH Q;  3G48 A;  4JV5 Q;  1VQO A;  1X3F A;  4JI6 L;  1VQI A;  5M5Y H;  1R9T H;  4DR1 Q;  1N36 L;  2XGT A;  1E1O A;  4DV7 L;  2CCZ A;  3CC2 A;  5M5W H;  4H02 A;  1X3E A;  2NVX H;  3MXN B;  5GQO A;  4DR5 L;  1N36 Q;  4JI2 L;  1S40 A;  3AEV A;  4JI3 Q;  2LSS A;  1YNX A;  3I4O A;  4DK6 C;  1SMX A;  4BXX H;  1EQQ A;  1EFW A;  1G6P A;  3I7F A;  4JCV E;  5C0X G;  4RG1 A;  2A19 A;  3PV0 A;  1HNX L;  3ERS X;  4JI0 L;  4X64 Q;  1M90 C;  3M4O H;  1PA6 A;  2BH2 A;  2EIF A;  3JC6 6;  4R4I A;  1VQ7 A;  3RR5 A;  3W1B A;  3A74 A;  5JJI A;  3RN5 A;  2UU9 L;  1GKH A;  2VUM G;  4LFA Q;  1W2B A;  2JK8 A;  3STB D;  4YWK A;  2NVQ H;  3I4M H;  1WJJ A;  2F52 A;  3A0J A;  4DV5 Q;  4HIM A;  1YIT A;  1XJV A;  1XMO Q;  3KF8 B;  2YV5 A;  4OWX B;  3M4P A;  3DLL A;  2UXC L;  1VQ4 A;  1UE5 A;  4LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...