4B3SL

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sL00
2K52A 5C44G 1VQPA 1X3FA 4A3EH 3J80c 4LF4Q 1GD7A 1E24A 2YYZA 5IP9H 4JI4L 2DUDA 4X62Q 1N32Q 2CWPA 4GLAC 4DR6L 1HNWQ 3FP9A 4UY8C 2F3IA 4DV5L 3CCEA 3BJUA 3KOJA 4NPSA 3JAMc 2VQEL 2JEAI 4GS3A 3S1MH 5IYBH 4BA1I 4JYAQ 1H95A 4HIDA 1OXSC 1J6QA 1TXYA 2OQKA 3CCLA 1G6PA 1E1OA 2EIFA 4X66Q 2E5LQ 1A8VA 1SFOH 1I5FA 2IHEA 5BR8Q 5IWAL 4JI3Q 4K0KQ 2IY5B 4BXXG 1CKNA 2K5HA 2CFMA 4JCVE 4DK3C 3DLLA 1PHJA 1XNRL 2K50A 2YTVA 3F8TA 3G48A 3H0GG 3HOUG 1LUZA 4LF4L 3PO3H 1VQGA 4BY1G 5M3FG 1D7QA 4NXMQ 4X62L 1N32L 4JI1Q 1PYBA 1G291 4GNXC 1IBLQ 4IJHA 1HNWL 1R9TH 3RN5A 3CCMA 3F1ZA 3A5UA 3H3VH 4A3FG 4L5RC 4BA2I 4JYAL 2ZM6Q 4OWXB 3HOXH 1GO3E 1U5KA 3J7A5 5M3MH 4X66L 2E5LL 3GTQH 5ELNA 4JBJA 1RIPA 1FL0A 4KI0A 3CMAA 4JI3L 5BR8L 2WAQG 1VQKA 4C2MH 1SRUA 3S16H 2ATWA 4K0KL 4HJ5A 3CAMA 2R7ZH 5M5WH 1MIUA 4JG2A 4JI2Q 4HJAA 4IOCA 1YHQA 3HOZG 1UE6A 5AJ3Q 4JI6Q 3PUVA 4O0AA 4UPAA 3AQQA 4R4CA 4DV2Q 3ICEA 1N8RC 1NTGA 1YNXA 2UUAL 3H3VI 4NXML 3CD6A 2BA0A 1EWIA 3EBEA 4JI1L 4DAMA 1IBLL 3RLOA 2JA7H 1SE8A 4A3MH 3GD7A 1I50H 3MXNB 4UP9A 3UDIA 5IYCH 4GNXA 1EFWA 1X55A 2A1AA 3HOYH 4DK6C 4L5TA 2D0OA 2ZM6L 1KHIA 1CSPA 4C3JH 1B70B 1TWAH 1N9WA 1MJCA 4IPGA 3UDGA 3M4PA 3W1GA 2JE6I 4YCUA 3TS2A 1YJNA 2PQAB 1L2FA 5GADC 1YBYA 3I7FA 1U0LA 1NE3A 1N33Q 3CC2A 4NB3A 4DV4Q 3KLWA 2B63G 2CQOA 2NVQH 4DUYQ 3HKZE 1CSQA 4JI2L 1ASYA 1Y1VH 1YZ6A 3L7ZC 4LW1A 5AJ3L 4JI6L 4NXNQ 4DV2L 4O2DA 4HIMA 1V1QA 4KHPQ 4BBRG 1YEZA 5GQOA 3S14H 2E2IH 4GOPB 3U58A 4DR5Q 2UXCL 4IFDJ 2QGQA 4JBKA 4GLXA 5C0XI 5IYDG 2ZJRA 3BU2A 4IPCA 4A4IA 2MNAA 1KAWA 5C3EH 4A3KG 1K9MC 2VUMG 1L0WA 3RZDH 1JMCA 3AEVA 1L1OA 4DV4L 3PO2H 1UE7A 3RLFA 5FLMH 1HNZQ 4DUYL 1S72A 3I55A 3CW2C 4NXNL 3D0FA 3K8AA 3CQZH 5IY0A 1VQ9A 4KHPL 2JK8A 1WOCA 2JA8H 1Z47A 3TRZA 2VNUD 4PZ7A 2JA6G 2DGYA 3K0XA 3J80i 3GO5A 2PI2A 4PMWA 1PH6A 4POFA 4DR5L 1K8GA 4PZ6A 4YCVA 1PFSA 1WCMG 2MQHA 3ULLA 4TVAB 3JAMi 3TREA 3I4NH 3ER0A 3D31A 4J15A 1HZ9A 1LM0A 4B3MQ 4A3GG 1X54A 1C7YA 2Y0SE 2AWNA 1HZCA 4GKKQ 1IYJB 2OTJA 1OXUA 4QJFA 4A76A 1W2BA 3JC66 1HNZL 4BY7H 3S1NH 3I4MG 3TEHB 1DGSA 5J3BA 2HHHQ 1VQOA 2UXBQ 4OWWB 1IZ6A 4P72A 4LUVA 1O7IA 1AE3A 3CF5A 1NJIC 2CKZB 3RLNA 5IP7G 2L15A 4JV5Q 3FHWA 3OTOQ 4YWMA 4JI5Q 3U4ZA 4R4OA 1WI5A 3W1BA 3HFZB 2WB1G 3KDFB 5JJIA 2EQSA 1KQSA 3GTOH 4A3BG 1A63A 5EAYA 4DR3Q 4B3ML 3I56A 1JJCB 4DV7Q 2Q2IA 3PUZA 3VDYA 2Z0SA 4A3IG 4DPGA 4GKKL 1LTLA 2E8GA 3J7ZC 4BXXH 2JEBI 4BBSH 2EXDA 2OQ0A 4GOPC 1QUQA 2R6GA 4A3CG 4MZ9A 2HHHL 1KXLA 3HOVH 4GKJQ 2UXBL 1KL9A 3CCSA 2KCTA 1OTCA 2NVYH 5LMNW 2NZOA 2HQLA 1Q1EA 5JEAG 3A0JA 4A3DG 3E9HA 5K36G 4LUZA 3F2DA 4DR4Q 3OTOL 4AH6A 4P71A 1YI2A 4JV5L 2GVAA 3PGZA 1VQFA 2PI2E 3STBC 4AQYQ 1PH1A 4JI5L 3I2ZA 3NENA 5IP9G 4PG3A 3OYYA 3PF5A 1XPOA 1Q81C 3GTMH 1PH9A 2K4KA 3F2CA 4DR3L 2V1CC 5GAHC 4B3RQ 4DV7L 4GN4B 5LMNQ 3PF4A 1Q86C 4A3LH 3GTKH 5IYBG 1BVSA 2ZJQA 4Y7NH 1HZAA 1A0IA 3G71A 3TS0A 1VQBA 3T1HQ 2UXCQ 1VQ8A 1ASZA 3FKIH 3PSIA 4GKJL 1HNXQ 3PUYA 1KD1C 1EUJA 1UEBA 4P75A 4X65Q 3J81c 2B29A 5E7NA 1QVCA 1E1TA 1MJEA 1VQNA 1VQ4A 3W5OA 4JC0A 4QQBX 4DR4L 5GAEC 4OO1I 4P74A 4A75A 4AQYL 1QVFA 3KF6A 2PNHA 3PO3G 3RR5A 1GVPA 2N49A 2BH2A 3OW2A 4GLVB 1BBWA 3M7NA 4C3HH 4LF8Q 4B3RL 2K75A 4OO1G 2JA9A 3BZCA 2AKWB 4R1JA 5LMNL 2ZJPA 4DR1Q 2ZTCA 1HR0W 2E2HH 2RCNA 3CCVA 2A19A 1TWCH 1E3PA 3NELA 3T1HL 3HOXG 2R92G 5M3MG 3AFQA 2XTIA 1SMXA 2QEXA 2Q2UA 2ID0A 1HNXL 2GVBA 1KC8C 3HKSA 3S1QH 4X65L 4OXPA 2HIVA 3KYHC 1XJVA 4YWLA 3CPWA 3AYHB 1HR0Q 5FJ8H 4LF6Q 3GTPH 1XPUA 4Y52H 1CKNB 3KFUA 1EQRA 3GDEA 3UE1A 2OTLA 1IBKQ 1Q7YC 2IX0A 2VUMH 4LF8L 4HIKA 4L5QA 3G6EA 4A3MG 4IO9A 1K83H 2D62A 2IX1A 2NZHA 4DNIA 4DR1L 2LSSA 2I5MX 3RNUA 1G51A 2VS1A 1Y14B 3A5ZB 3KF8B 5C0XG 2IHFA 5C4XG 3E9IA 2JA5H 1N33L 2BH8A 1UE5A 1PH7A 1XPRA 1JB7A 2JA6H 2VW9A 4MTNA 3PCOB 3G4SA 1HR0L 4AYBG 4LF6L 1Y1VG 1Q46A 4R4TA 5IT9c 2MO0A 2JJQA 1K0RA 3EIVA 1IBKL 2F52A 5GROA 4POGA 1IXRA 4DV1Q 4FDBA 1FJGQ 3M4QA 1EYGA 5JEAJ 3WWVA 3T1YQ 4A3GH 2ES2A 2RF4A 1YVCA 1P8LA 2ZTDA 1C9OA 4P73A 4YWKA 2KBNA 1EIYB 1K73C 5C3EG 1Y1WG 1EQQA 1NY4A 4H02A 4RG1A 2R93G 1FGUA 4KLKA 4A93H 2OCEA 3LGJA 4XTCS 2D0PA 4EQ5A 4LWCA 3PO2G 4A3JH 1X56A 1YHBA 4GN3B 5FLMG 1QZHA 4LF5Q 4APVA 1VQIA 2H5XA 5C44H 2VQFQ 2VL6A 4UP8A 2IT1A 3J81j 2I0QA 1TWFH 3MEFA 5IP7H 1PV4A 4YCWA 1PH5A 2B3GA 1QVGA 2Q2HA 2JA8G 2N78A 2WB1E 1E7ZA 3ULJA 4DUZQ 1PH2A 1CUKA 3ERSX 4DV1L 5HGQA 1W3SA 1FJGL 4X6AH 3UE0A 3TQYA 3T1YL 4WJ3M 3U50C 1XNQQ 1T9HA 1D8LA 1KIXA 3CMEA 3GTLH 1V43A 3H15A 1UWVA 2FXQA 3KJPA 1YIJA 4JI7Q 3PUWA 2UUBQ 2WFWA 4A3CH 2MFIA 4IJLA 4IFDI 4HJ9A 2AWOA 4HJ8A 2KCMA 2YTXA 2QA4A 5M5YH 1I94Q 4OX9Q 4LF5L 2HIXA 2ASBA 2VQFL 3H0GH 2RHSB 3CCRA 4DV6Q 3STBD 3CCQA 1KRSA 3HOUH 1TWHH 4JI8Q 4A3DH 1L1OB 3HOWG 2KENA 1IBMQ 5M3FH 5DLQE 2I5LX 4XIGS 4BY1H 4DUZL 2R7DA 4LFCQ 4LUOA 1X65A 4EX5A 5FLXc 2Z6KC 4A3FH 1N36Q 3CCJA 1XNQL 1BBUA 3CPFA 1I3QH 2PQAA 3S24A 4A3EG 3UDFA 1S3OA 3IRBA 3S2DH 4JI7L 5LMUQ 4JOIC 1P16A 3L2PA 4HJ7A 2UUBL 3CC4A 2BA1A 2I5HA 4LF7Q 1BKBA 2WAQE 3KJOA 1QZGA 2ZTEA 3Q8DA 4MNOA 4JBMA 2F4VQ 3DM3A 2UXDQ 4DV3Q 2Q2TA 1MKHA 1RL2A 4X64Q 1I94L 4QY7A 4OX9L 3HOZH 3AFPA 4BBSG 1I6HH 4DV6L 5GAGC 5C0XJ 2C35B 4GOPA 1PVOA 1SROA 4JI8L 1VQJA 2KHIA 3HOVG 1X3EA 3CCUA 1IBML 1VQ5A 1VQEA 4QL5A 4DV0Q 4L5SA 3S1RH 1IL2A 4LFCL 3UDXA 3GTJH 3K7UC 2UUAQ 1YJ9A 4JI0Q 1N36L 3B6YA 1M1KC 4DR2Q 4WJ4A 2Z6KA 3K7AH 1PH8A 2UU9Q 2YTYA 3PIPA 4LFAQ 4DR7Q 2CWAA 4OWTB 2VZAA 5LMUL 3RZOH 4LF7L 2R92H 1PYSB 1B8AA 4JOIA 3M4OH 4B3SQ 2F4VL 1HH2P 1EOVA 2NVXH 5JJKA 2B63H 4A3LG 1XTDA 4DV3L 2LXKA 1X9NA 1VQLA 2UXDL 3K81C 4X64L 1E22A 1N34Q 2YU9H 3F2BA 2WP8J 3NEMA 1X6OA 3L0OA 2PMZE 2NN6I 1SR3A 3FKIG 1VQCA 4ME3A 4LNQA 1SN8A 1JE5A 4BBRH 3PV0A 2HT1A 4KHZA 1M90C 4DV0L 1VQHA 2R7ZG 1QUQB 1C0AA 3ZJYC 2NN6G 2CCZA 1JT8A 4JI0L 3PIOA 4DR2L 1WFQA 4B3TQ 3S15H 5IYDH 2UU9L 4LFAL 1WYDA 1Q82C 1NMGA 5ELOA 4A3KH 2JA7G 2NVTH 4DR7L 1YJWA 5IYCG 1X3GA 3PUXA 2LXJA 4B3SL 4GN5A 5C4XH 3HOYG 1JJGA 2GN5A 2VY3A 1L1OC 1J5EQ 4C3IH 3K80C 5C4JH 4AYBE 1N34L 2YV5A 3CXCA 1GKHA 4YY3Q 1OXTA 3M9BA 3M3YH 1XMOQ 1TWGH 2E2JH 4DKAC 1AH9A 1S40A 1WCMH 1VQAA 3HKZG 3KDFA 4R4IA 5FJ8G 4B3TL 4RMFA 2K5VA 4DAYB 1CKOA 2JQOA 1OXXK 4QIWE 1JJ2A 1NBWA 2OWOA 1VQ6A 1VQ7A 3S17H 1A62A 4HIOA 1Y1WH 1Q1BA 1VQDA 2K5NA 2N8NA 1HJPA 3KF6B 5M5XH 3M85A 4LF9Q 4YHHQ 5H1SE 1CKMA 1EIFA 1LYLA 4R4QA 1J5EL 4GNXB 2R93H 1SLJA 1Q12A 2AMCB 2ALYB 3U4VA 3CC7A 2R7FA 4ALPA 2UUCQ 3I4MH 1FVIA 2AHOB 4YY3L 3A74A 4PZ8A 2JA5G 1XMOL 2A8VA 1V9PA 4LFBQ 1B7YB 3EN2A 1XMQQ 1WJJA 4IPDA 3GTGH 1VQMA 1K8AC 4UP7A 3BZKA 4QGUA 2KHJA 1VS0A 1OXVA 1AE2A 1K3RA 3NBHB 3SGIA 5IE8A 3RN2A 4IPHA 2XGTA 1PA6A 4JI4Q 1PH4A 5HY6A 4A3BH 4DR6Q 5JJLA 1NMFA 4DV5Q 2K14A 1Z9FA 2VQEQ 4A3IH 3I4NG 4LF9L 4YHHL 1UE1A 1PH3A 1YITA 2UUCL 1GM5A 2N3SA 3I4OA 4TQUS 1HZBA 2MO1A 1Q8KA 3E0EA 2RHQB 3ULPA 2Y0SG 5IWAQ 3HOWH 3CP0A 1VCIA 3J81i 1XNRQ 4LFBL 1XMQL 1YHAA 4JBWA 1KRTA 4BY7G 3S2HH 4A93G 4IOAA 4A3JG 4AIMA 4IFDG 4OONA
chains in the Genus database with same CATH superfamily
4IN3A 1QE6A 5C44G 2YYZA 5D14A 2DUDA 5CV8A 3OWEB 3LX0A 3FP9A 1HNWQ 2F3IA 3S1MH 4EGVA 2LS01 2R61A 1H95A 2WKDA 1J6QA 2CW0C 1E1OA 2E5LQ 1A8VA 4FXDA 4Y7NB 3V2TA 4JI3Q 5IWAL 4CDFC 3HOZB 3PQIA 4OIJA 2YTVA 3EQLC 1EWCA 3F8TA 1ILQA 5ELBA 3HOUG 5EJWA 4XQQA 4L63B 1HTLD 2BDOA 2EOTA 2EDGA 3VYTA 1HNWL 3A5UA 3H3VH 4A3FG 4L5RC 2E75C 1GUWA 1GO3E 3ITPA 2E5LL 1RIPA 1FL0A 1I4XA 1ILPA 2NVXB 4HR7B 4JI3L 1SNMA 5M5WH 4JG2A 4IOCA 1YHQA 1IW7D 4DV2Q 4BBRB 1YNXA 1SE4A 3SK8A 2UUAL 2JA7H 2L4NA 5CV5A 1PDQA 1I50H 3UDIA 4GNXA 5ELFA 2A1AA 4FVMA 1CI3M 2D0OA 2NVTB 4NW2A 1MJCA 5C0XH 1YBYA 1U0LA 1F9RA 3QIAA 1NE3A 2O5JC 1N33Q 3CC2A 5DEHA 5C4JB 1SJHD 3KLWA 1CQVA 1BF4A 1YZ6A 4GZYC 5JVH3 4DV2L 4O2DA 1BCPB 5D3IB 1S5DD 5D65A 4GOPB 4IFDJ 3IL8A 2ZJRA 1CHPD 5FO8B 2L55A 4RCOA 3SVMA 1QCBD 1HA5A 1LT4D 1TS4A 3AEVA 4ZUIA 3PO2H 5FLMH 3O13A 1HNZQ 3VYRA 1G91A 3CKIB 3K8AA 3CQZH 3DMUA 4HMIA 1VQ9A 1WOCA 1Z47A 2DJFC 2RVLA 3K0XA 5EGTA 2PI2A 1WTOA 1S5ED 4WRDA 4PZ6A 3DHQA 3ULLA 4TVAB 3VR5A 3TREA 1O7YA 4P2CB 4A3BB 3D31A 3PIP3 2F0VA 1PRTD 1HZ9A 4A3GG 4B3MQ 4A3IB 1PLFA 1Z6HA 4CDDC 4H0LC 5NUCA 1IYJB 3A7AB 4QJFA 1IYVA 1SMYD 1HNZL 4BY7H 4FF4A 4TRDA 3I4MG 3TEHB 1VQOA 3VR4A 1EEFD 1EYDA 2X6LA 5C6AA 1AE3A 4X3KA 1NJIC 3NUCA 5IP7G 1B4OA 1EWHA 4PQXA 1H9MA 2H4OA 2WB1G 5JJIA 1EU4A 1JOQA 4B3ML 3I56A 4DV7Q 2Z0SA 4DPGA 1NUCA 1BCPC 1LTLA 2JEBI 2OQ0A 4GOPC 1F2MA 1SFOB 3TSSA 1ML0D 3MXNA 2F4IA 2NTTA 4DXFA 1EYAA 1L0YB 5LMNW 1CT1D 1TVXA 1K8OA 1STNA 4R9WA 3F2DA 4DR4Q 1VQFA 2JP1A 3I2ZA 3NENA 4JK1C 1Q81C 2ICEC 2A6HD 2F03A 4DV7L 5LMNQ 1V8QA 3PF4A 4A3LH 3GTKH 1G2SA 2L0CA 2F0GA 5M3MB 4KY7A 3K59A 1ZKOA 3PSIA 1FNWA 3H91A 4P75A 2F0KA 2B29A 3ONAB 5E7NA 4RHSA 1QVCA 1E1TA 3G7LA 1EQTA 3ND9A 4KD3A 1VQNA 3W5OA 1GUGA 3BZDB 2XRSD 5GAEC 4DR4L 3KK7A 1QVFA 1Y69U 3RR5A 4KKUA 3GTOB 3OW2A 3IAYA 4C3HH 3M7NA 1SNDA 2JA9A 3L9AX 5LMNL 3MWYW 5KYLA 4DR1Q 1TWAB 2R92G 2EY1A 3AFQA 2QEXA 4XDXA 4A3JG 2ID0A 1KC8C 1JOOA 5I6WA 1Z7TA 2OF1A 3KYHC 1XJVA 3AYHB 3GTPH 1XPUA 1I4GA 4Y52H 4XXEA 3UE1A 1ONLA 2E2IB 1Q7YC 2VUMH 4DFAA 2HUGA 3MC0B 2D62A 4DR1L 4DNIA 3NE5B 2LSSA 4ZKCB 5C3EB 1G51A 2VS1A 3NHHA 5C0XG 2IHFA 2Z4IA 3KLSX 2BH8A 1UE5A 2OXPA 1JB7A 4ZKBB 4MTNA 3G4SA 1HQRD 2JA8B 1K0SA 1MBYA 4IZ8A 1K0RA 4KV6A 4DV1Q 4FDBA 1E0BA 3BYYB 1K28A 3F2UA 3WWVA 1SEBD 2ZTDA 4Q5VA 4FF1A 5KIXA 1HCZA 2AQ3B 1EY6A 5CC4A 3Q0AA 1EQQA 4H02A 1LT6D 4K5XA 2F0QA 2R93G 1FGUA 1HA6A 4LWCA 3PO2G 5FLMG 1XXGA 2H5XA 2SDFA 3TP5A 1UAPA 3SEBA 3HOWB 2F3VA 3KLSA 1EY9A 1TWFH 1PH5A 5F2DA 5HURA 1QVGA 2Q2HA 2FINB 1EFID 3ULJA 4EQPA 3ERSX 4DV1L 4ULLA 5CR3A 3WOFA 1V43A 3H15A 1UWVA 2FXQA 2JN4A 2SNSA 3OMGA 4DK1A 3KJPA 3Q22A 3DWPA 3S1MB 2LKVA 2NTSA 4G57A 3CU7A 4HJ8A 4H7BA 3AU7A 2HDMA 5M5YH 2ASBA 3D4WA 1EEID 1UUPA 1BOSA 3STBD 4A3DH 1KLUD 1EY7A 1IBMQ 2NVYB 1EU3A 1X65A 4OEMB 3BVZA 3CCJA 2G9DA 1PZKD 2HDLA 2PQAA 3S24A 4A3EG 1HFGA 4IUNA 1B3AA 2KJXA 4JOIC 3TP7A 1HQMC 3L2PA 3CC4A 1BKBA 2EYHA 3M7GA 4MNOA 2AQ2B 1GUOA 2XVSA 4KD4A 3HOZH 5AFWA 4ZRZA 5C0XJ 1HRJA 3CCUA 1IBML 5M5WB 1WTQA 1SYCA 3QOJA 3K7UC 1MI2A 2N88A 1JE4A 3EVQA 1YJ9A 2WKCA 4JI0Q 5KGUA 1M1KC 1STYA 4K14A 3TBIB 1KAAA 1A6XA 1SXTA 3PIPA 4LFAQ 1BNZA 5EBCA 3NK9A 1EOVA 5CGKA 2NVXH 4A3LG 1XTDA 1VQLA 1ZYRD 3KBGA 1E22A 2WP8J 1BO0A 4BBRH 4ZQ3A 4WFN3 1VQHA 5CMDA 4F8MA 2R7ZG 1QUQB 1C0AA 1QILA 2RA4A 3K5OA 4JI0L 2QW7A 3PIOA 1D5ZC 1WFQA 3TZUA 1B3QA 4G7ZC 5EBDA 5IYDH 4LFAL 1Q82C 1NMGA 2NVTH 3NTIA 1RODA 2CVRA 3K5NA 1YJWA 1LTAD 1X3GA 4C3HG 5C4XH 1JJGA 2EPBA 1TS2A 5FOBB 1SAPA 1B9MA 3K80C 3LNNA 5C4JH 3OW7A 1C4QA 1GKHA 1JCKB 3M9BA 3HRZC 2KVMA 1S40A 3HKZG 2PZWA 4N9TA 1VQ7A 4BWGB 5IGEA 4XQJA 5CBEE 4G7HC 2K5NA 2K04A 4LF9Q 5JOBA 1EIFA 2KCNA 1F2YA 1SLJA 2ALYB 2NB0A 4QF4A 1C8CA 1FVIA 1DD2A 1WJJA 1SYBA 2ENBA 1VQMA 1LTBD 2RSNA 3BZKA 2KHJA 1VS0A 1K3RA 2PW5A 4IPHA 3NWTA 3D6CA 2A74C 1PA6A 3D8GA 3SHLA 2RSOA 5HY6A 4A3BH 4M1UB 1Z9FA 2R3ZA 1ZXTA 2VQEQ 4A3IH 3I4NG 3K6OA 3VR6A 4LF9L 1PH3A 4KKTA 2O2LD 1VDZA 2RCFA 3DUZA 1KABA 1Q8KA 2DJGC 3CP0A 1VCIA 4XYOA 4JBWA 2B2UC 3H0GB 2Z6BA 5K36H 1JC7A 1VQPA 5M3FB 1GHKA 3J80c 3HS0C 1E24A 3UI2A 4X62Q 2CWPA 4RH6A 3CCEA 1KDCA 3KOJA 1I3QB 2VQEL 1T5EA 4BA1I 4X66Q 2F0OA 1SFOH 1I5FA 4BXXG 4JCVE 3DLLA 1PHJA 2PQEA 2K50A 3G48A 3V05A 5CBAE 1FYCA 1D5MC 4F87A 3S1RB 5EKKA 2ZXRA 1TU2B 1E2WA 5FKAC 4X62L 4JI1Q 1G291 1IBLQ 4CJ1B 3RN5A 3CCMA 1AW7A 1NAPA 3K7AB 1PFBA 5M3MH 4RWSC 4X66L 4KI0A 2PPBC 2YU9B 4DAYA 3E6ZX 3HOZG 1UE6A 1A2TA 4O0AA 4UPAA 1WTPA 4R4CA 1NTGA 4JI1L 3GTOH 1IBLL 3RLOA 3NSWA 1SE8A 5IYCH 4L5TA 1KHIA 1CSPA 4C3JH 5FO9B 1TWAH 3UDGA 2ZXOA 4YCUA 1YJNA 5GADC 1WTWA 2B2WA 2XN9C 4WJWA 3NBHA 2B2YA 1AZPA 1SYEA 2EZVA 2MHVA 1ASYA 4LW1A 1F2ZA 3M3YB 5E4XA 1BUVT 5C5MA 3T56B 1V1QA 4KHPQ 4BBRG 1OO9B 3S14H 2E2IH 1EY0A 5T1GA 4C1NI 1WCMB 5DAUA 1G2TA 1CZWA 2RKSA 3NBIA 5IYDG 4FF2A 2MNAA 1KAWA 1QOHA 1S5FD 4XQNA 1SDFA 5C3EH 1K9MC 4KN7C 5A2QE 1J8IA 1CZGA 3RLFA 3R3OA 1S72A 3MHBA 3D0FA 1CK1A 5IY0A 4KHPL 2VNUD 2JK8A 2JA8H 1SYGA 3TDQA 2DGYA 4PMCA 3GO5A 5C3WA 1PXUA 4Q0FA 2RBMA 3JAMi 3C3LA 3ER0A 4O1NA 4J15A 1C7YA 1D1KA 1OXUA 1WVLA 1SYDA 3MXUA 4MTKA 1YNNC 1DGSA 2KHSA 1LTGD 4WORA 2WV6D 4P72A 2QDLA 3N6RA 4QUFA 4KY5A 4A3DB 3RLNA 2KEEA 2CW0D 3EJIA 3MFGA 4CKBA 1JWUD 2OEOA 2F0EA 1AN8A 3HFZB 1IYUA 4UHVA 4I7ZC 1KQSA 4A3BG 1QG7A 1PZID 2SEBD 1JJCB 3VDYA 3J7AF 3PUZA 3MVVA 4X3SA 4A3IG 3J7ZC 2M2LA 4A3CG 1GUTA 3CCSA 4ILWA 1R4QB 2NVYH 2HQLA 1Q1EA 5K36G 4C1NK 4LUZA 3PO3B 2GVAA 1PH1A 1STHA 2QF7A 3OYYA 1V1PB 1KDBA 1PH9A 3NQIA 1YNJC 2F1MA 2K4KA 5JPMC 2LY7A 2PNRC 1II3A 1Q86C 2DY7A 5IGDA 1BVSA 2D5DA 1A0IA 3HOXB 1EY5A 1WTHA 3R93A 3PUYA 1O80A 1MJEA 4QQBX 4FXGC 3KF6A 1NR2A 1GVPA 2BH2A 4R8NA 4JVZA 4RKLA 4A3MB 3I3CA 1Q90A 4LF8Q 1STEA 3BZCA 1SSOA 2ZTCA 2A19A 5C4XB 1R4PB 5BN5A 5I9PA 2DN8A 2XTIA 5M3MG 4TSSA 2Q2UA 2F0FA 4OXPA 2HIVA 2B2VC 1PRTB 1VMCA 3I72A 1EQRA 2JYOA 3TMEA 1QJOA 1IW7C 3AMUA 4LF8L 4L5QA 4IURA 4IO9A 2B2TC 2K5QA 4LJZC 3NTHA 3RNUA 1EY8A 1Y14B 3A5ZB 3KF8B 3RZDB 1N33L 1PH7A 1B53A 2JA6H 2RQXA 4G7OC 3PCOB 4AYBG 4IUUA 1F9PA 1Q46A 1A15A 2XWBB 1RKNA 3R2IA 4R4TA 4XT3B 2MO0A 2JJQA 5CORA 3J80E 5GROA 4POGA 1FJGQ 3M4QA 3ZYYX 1QNKA 2XNAC 4RAUC 3T1YQ 2ES2A 4R8IA 1S5BD 2RF4A 2K05A 1YVCA 2G9HD 1P8LA 4P73A 4RCNA 2BDNA 3WOEA 3SK6A 5C3EG 1NY4A 2Y0SB 1DOLA 4XTCS 2D0PA 3S1NB 3P75A 1QZHA 5JAVA 2BE5C 1AP0A 2VQFQ 2IT1A 3J81j 1PV4A 1SNQA 4YCWA 2B3GA 2JA8G 1QNUA 4DUZQ 1PH2A 1I6VC 5HGQA 1FJGL 3UE0A 3T1YL 3RUZA 4WJ3M 1TIID 3IFDA 3PUWA 1KLGD 1QB5D 5C5LA 1F77A 4IJLA 4OIKA 4IFDI 1PRTC 2AWOA 3I90A 1HUNA 4KY6A 4BBSB 1EZ6A 1FGBD 2YTXA 1NNXA 2QA4A 4OX9Q 2VQFL 3H0GH 2RHSB 4DV6Q 3CCQA 5JEAH 3HOWG 5M3FH 4CHTB 2I5LX 3MTSA 4N8X1 5IODA 2R7DA 4DUZL 4LFCQ 2F0PA 4EX5A 5FLXc 2Z6KC 1N36Q 1I3QH 3MA2B 3GTMB 1IKLA 3DM3A 1A3UA 4DV3Q 2Q2TA 3OIQA 1MKHA 1RL2A 3ERQA 4OX9L 3AFPA 3FKIB 5FO7B 4DV6L 2C35B 1PVOA 1SROA 4L5SA 4DV0Q 4ID6A 3S1RH 1ICWA 4LFCL 3UDXA 4FYDA 2TSSA 3B6YA 1N36L 4DR2Q 2KEDA 5KNCA 3K7AH 4DR7Q 4OWTB 1SYFA 2RDFA 2C5CA 2MP1A 5M9OA 2DNCA 3DWQA 4UAIA 4JOIA 5BN4A 1DJRD 4C3JB 4I7AA 4CKEA 3GV3A 4TKOB 2E2HB 4DV3L 2GA4B 3K81C 1PTOB 2YU9H 5BN3A 3NEMA 2FMMA 3RMHA 3S1QB 2F0UA 4LNQA 1WTVA 5KEEA 3BDCA 3OIPA 4DV0L 1JT8A 2B8FA 4DR2L 2HQEA 1F2LA 3S14B 5L37A 5EKLA 2Z1CA 5I2YA 1WYDA 2JA7G 4DR7L 1HPCA 3PUXA 5KNDA 1K83B 2GN5A 4Z9CB 1J5EQ 3C1FA 3IFTA 4YY3Q 3M3YH 2A73B 3GQBA 3K58A 4KKSA 4DKAC 4UDUC 1WCMH 1VQAA 3KDFA 1L0XB 5C4HA 1CKOA 1VF5C 3FMCA 5T1IA 2A6EC 2J0TD 1D2BA 4A3GB 4HIOA 1Y1WH 1VQDA 2N8NA 2MJ8A 4YHHQ 5EPKA 1CKMA 1LYLA 3T53B 1FNUA 1J5EL 5I9OA 1Q12A 4ALPA 4YY3L 2EJFC 4A93B 3DEOA 1V9PA 3C1EA 4LFBQ 1RJTA 3EN2A 4IPDA 3GTGH 1XWEA 1AE2A 1ENAA 4JI4Q 2WB1B 4EQNA 4DR6Q 3SK5A 1PTOC 3WDNA 4DV5Q 2K14A 5FLXL 1CHQD 2B39A 4YHHL 3JAML 4CDEC 2PCFB 1YITA 3I4OA 5D3DA 4TQUS 1HZBA 3E0EA 4B9WA 3QJYA 3KLRA 4LFBL 1YHAA 4BY7G 4IOAA 2K01A 1D5XC 1KNAA 4BY1B 3FEWX 4ZUJA 1X3FA 2DY8A 4K6LA 1GD7A 1UNSA 3Q6SA 2WIIB 5IP9H 2F3WA 4JI4L 4DR6L 4DV5L 2JEAI 4GS3A 1BXTA 4HIDA 1H9JA 2D9UA 1TXYA 3CCLA 2MGSA 2EIFA 1FNVA 2WAQB 2IHEA 4ODGA 4K0KQ 1CKNA 2K5HA 2A68C 1RF2D 3H0GG 3VYSA 1A3VA 3S9WA 1LUZA 2XIWA 3PO3H 1JR0D 5M3FG 4NXMQ 3SR1A 4L6TB 1PYBA 2HCCA 5C4ZA 4M8AA 1M4VA 3I73A 2ZM6Q 4OWXB 4PMBA 3HOXH 2WACA 3M4OB 3J7A5 5ELNA 4JBJA 2LMCB 2B63B 3BS1A 4K0KL 1IHZA 3D4RA 2L1BA 2Q8RE 3FVQA 5AJ3Q 4JI6Q 3PUVA 2PMZB 1TY2A 3ICEA 1MSGA 1N8RC 4KJOA 3H3VI 4NXML 4IQZA 1BCPF 2VB2X 1EWIA 4HSVA 4DAMA 1GOZA 3OSOA 3GD7A 4A3MH 2DNEA 1EFWA 3S15B 1X55A 3HOYH 4DK6C 1S4ZA 2EYMA 2ZM6L 2EYJA 4A3KB 4ABNA 3M4PA 3W1GA 3U9SA 3TS2A 2PQAB 3FDTA 1BR9A 3BVMA 3OWFA 4C3IB 4NB3A 1O7ZA 1Y8PB 3L7ZC 5AJ3L 4JI6L 4NXNQ 4LAAA 2JA6B 3P20A 1ZEQX 2BCOA 1TWGB 2E2JB 1YEZA 5KRUA 3J7AV 3U58A 4DN4M 4DR5Q 2QGQA 3VYUA 4NP5A 5C0XI 4IPCA 4A4IA 3S17B 5E3FA 1FR3A 4QIWB 1A3TA 2VUMG 1L0WA 3RZDH 1JMCA 2KCCA 5I2XA 3QR8A 1L1OA 2F0DA 4IUPA 3CW2C 4NXNL 1W6KA 4X3UA 1UEAB 2KQ3A 4NMZA 3TRZA 3I4LA 4DXGA 4PMWA 4HN7A 1PH6A 4DR5L 1K8GA 5FLXE 1WCMG 4DA2A 3BVGA 2QCPX 1WD0A 1VF7A 2CH4A 3HP3A 5K5PA 4OL7A 5A35A 5DM63 2Q8IB 1X54A 2Y0SE 1Y8OB 2AWNA 1XX8A 1HZCA 2OTJA 1W2BA 2Q8TA 2ICIA 3JC66 4O42A 4E6IA 3HGBA 3S1NH 2K03A 5J3BA 3CHBD 4OWWB 4LUVA 1O7IA 3CF5A 5LHY1 1LTTD 2L15A 4JV5Q 3FHWA 3OTOQ 4A3EB 5IOCA 3OMCA 4JI5Q 3U4ZA 4R4OA 3W1BA 4FF3A 2EQSA 2M00A 5EAYA 5IGBA 3D6WA 1H9SA 2Q2IA 2EYLA 2E8GA 1EOTA 4BBSH 1NCVA 4LK1C 4DGZA 1Q8IA 1OTCA 1RDPD 2NZOA 4CGYB 3TP8A 4A3DG 3E9HA 4RKBA 4JV5L 3OTOL 4P71A 4RGTA 2PI2E 4AQYQ 1KNEA 4JI5L 5IP9G 4OHJA 4PG3A 3GTMH 4K5VA 1B9NA 2F0LA 4MN3A 3F2CA 5IGFA 2V1CC 4B3RQ 4GN4B 1I4RA 1AFPA 3T13A 2ZJQA 2AQ1B 2F0JA 3GTQB 5CV9A 1MD2D 1VQ8A 1ASZA 1T5XD 3FKIH 4KHVA 1KD1C 1EUJA 1UEBA 4C2MB 3S16B 2R7ZB 2Z4HA 3X3MA 2PZTA 1ENFA 4OO1I 4AQYL 3TZDA 2PNHA 1DXMA 3NTKA 3PO3G 2LFNA 1SE3A 1BBWA 1JORA 4B3RL 2K75A 2B8GA 2AKWB 4R1JA 3FPUB 2ZJPA 1HR0W 2E2HH 2RCNA 2TMPA 1TS5A 1PTOH 3HOXG 1D1IA 5IGGA 1M8AA 3S1QH 3HKSA 2NVQB 4CJ2C 1Y1VB 3CPWA 3T4AC 1HR0Q 3HKZB 4LF6Q 5ELEA 3KFUA 2PW7A 3EA6A 2EJGC 1IBKQ 1BQQT 5IT9L 4KMUC 2IX0A 4A3MG 4ZLTF 1EL0A 1RCVD 2NBFA 1K83H 1MGSA 2IX1A 2NZHA 1B44D 1Y1WB 1U4PA 4QUCA 1WD1A 5C4XG 4CDCC 3K5LA 1TKWB 1XPRA 3KBXA 1C48A 1HR0L 4LF6L 2NYZD 4HSPA 2B2VA 4K8IA 1D6EC 4U673 2K32A 3SK4A 3GTGB 3H94A 3K5MA 2A69D 1IBKL 2F52A 2KOLA 4A3GH 2JSOA 1JWSD 4ZAIA 5I4DA 2FJ2A 4IUQA 3IKJA 2XSCA 4MIUA 4C56C 1C9OA 3N52A 2KBNA 1K73C 2I46A 2EYFA 4KLKA 4A93H 2OCEA 3LGJA 4EQ5A 4GN3B 1YHBA 4LF5Q 4APVA 1VQIA 5HGTA 1V1PA 3MEFA 5IP7H 1IKMA 2C9OA 1EIHA 2N78A 2WB1E 5ISRA 1CUKA 1W3SA 1ESRA 3SXHA 3QB3A 4PV1C 3TQYA 3U50C 1D8LA 3GTLH 1RHPA 4YIJA 3SDZA 5J39A 3H6MA 2MPMA 1EIGA 1TR5A 3J7YW 4JPBW 2UUBQ 2WFWA 2MFIA 4HJ9A 2NZ1D 3U9OA 1LT5D 1K3BC 2KCMA 4LF5L 2HIXA 3CCRA 3HOVB 1TWHH 4JI8Q 1I4QA 5LL6S 2KENA 4BY1H 4XIGS 1YNJD 2CH4W 4LUOA 3NXWA 2QDBA 1G8ZD 2V4DA 2D2CC 5LL6X 3G6JB 3UDFA 5LMUQ 1P16A 2UUBL 4HJ7A 2WINB 1Y8NB 1ET6A 4LF7Q 2WAQE 2ZTEA 3Q8DA 4JBMA 1WTXA 3R2TA 3Q23A 2UXDQ 2JXMB 1VMPA 4QY7A 3NWSA 4BBSG 4GOPA 3E5SA 4JI8L 4RFBA 1VQEA 1IL2A 2UUAQ 2MUYA 3GTJH 4RGNA 3CRLC 3QG1A 2Z6KA 1B1ZA 3CRKC 3KF8A 1PH8A 1LV9A 1V1OA 5C3XA 4F88A 2VZAA 5LMUL 4LF7L 2R92H 3HOYB 3M4OH 2B2WC 4B3SQ 2J7ZA 1HXYD 2B63H 2UXDL 5DNFA 1X9NA 2B2YC 3K0YA 1TWCB 1N34Q 1X6OA 3L0OA 1J9OA 2NN6I 1SR3A 2PMZE 2ZT9C 3HEJA 3FKIG 1VQCA 1SN8A 3T51B 1M90C 2NUCA 5IT9E 3A8KE 2FHTA 4ZYSA 3S15H 1HTPA 4K8JA 5CYUA 4A3KH 5ELOA 1JICA 4L8JA 5IYCG 2HD3A 2LXJA 4B3SL 4GN5A 2E2DC 2CHBD 4C3JG 1GJXA 1U4MA 4C3IH 2RDHA 2XWJB 2YV5A 4J8QA 5JPNC 1N34L 3TN2A 2JA5B 4DNRB 1XMOQ 4DU9A 1TWGH 1IL8A 5J1ZA 2E2JH 2K5DA 3L3OC 4R4IA 1JWMD 2K5VA 1GUSA 1U4LA 4QIWE 3S17H 1NBWA 1VQ6A 4FP5D 1A62A 1GHJA 1Q1BA 1HJPA 3KF6B 2EY6A 2BE5D 2EE1A 2F0TA 2I07B 2R93H 4GNXB 3CC7A 2AMCB 3U4VA 2R7FA 4PZ8A 1G6ZA 1XMOL 3DM1A 5EPJA 2A8VA 4A3JB 5C44B 1K8AC 5TSSA 3Q24A 3LWEA 4QGUA 1A2UA 1OXVA 3SGIA 3VR2A 3RN2A 2XGTA 1O78A 2BOSA 4J6HA 2K28A 1BCPD 1NMFA 2O4XA 1UE1A 2K6AA 4OELB 1LTRD 1CM9A 2N3SA 3URYA 2K5WA 2MO1A 1F9QA 2RHQB 4V0BA 3J81i 1XNRQ 2IY5B 4A93G 2CQAA 1KRTA 2IL8A 2E74C 3QWNA 4AIMA 2F0MA 3HOUB 2K52A 1SMYC 1SNCA 3MXPA 2IJ0A 3PIO3 4A3EH 4LF4Q 5FK9C 1N32Q 4GLAC 4A3FB 4UY8C 3BJUA 4NPSA 3JAMc 1LTSD 1B2TA 5IYBH 4JYAQ 3S2DB 1OXSC 1F9SA 3W2DA 2A5HA 2OQKA 1G6PA 2AUKA 3E0JA 5BR8Q 1XNRL 4DK3C 2CFMA 5G3LD 1I6HB 1QWYA 5E4WC 3A55A 1CQFA 4JW0A 5EPLA 1H9KA 4LF4L 1VQGA 4BY1G 1D7QA 1N32L 4GNXC 3D3RA 2PYKA 4IJHA 1R9TH 4OO1H 3F1ZA 4BA2I 4JYAL 4RHRA 3EROA 3RZOB 1U5KA 3GTQH 3MFYA 2A6HC 2L9HA 3CMAA 5BR8L 2WAQG 3OOCA 4C2MH 1SRUA 1VQKA 3C46A 2ATWA 4DK0A 4HJ5A 3CAMA 3S16H 2R7ZH 1MIUA 2KA7A 4JI2Q 4HJAA 4K2LA 4IFDG 3M4YA 3AQQA 4KN4C 4RA8A 3PMFA 3CD6A 2BA0A 4I65A 3A7LA 5ELDA 3EBEA 3LWUA 1LO5D 4CKCA 2UXCQ 1I4HA 3MXNB 4UP9A 4F7XA 2G5DA 4V190 1CFMA 1B70B 2RDGA 3E3XA 1N9WA 4IPGA 1DCZA 3V96A 2JE6I 3BG3A 1L2FA 3I7FA 2E76C 4DV4Q 2B63G 2NVQH 2N55A 2CQOA 4DUYQ 3HKZE 1CSQA 4JI2L 1Y1VH 4AYBB 3A54A 4HCEA 3A56A 3A8IE 2PZUA 4K6DA 4HIMA 1DOKA 2A6ED 5GQOA 1WTRA 2UXCL 4JBKA 4DAVA 4GLXA 2VXWA 4IALA 4KK7A 1W6JA 3BU2A 2XRQD 5ELCA 1ESFA 2J4XA 4A3KG 4ZK9B 1X3QA 5M5XB 1H9RA 4DV4L 1UE7A 1S5CD 4C3IG 5IIFA 4DUYL 3I4MB 4NKLA 1MSHA 3I55A 5CV4A 3TP6A 4EVOA 1KDAA 2L11A 1PTOD 4PZ7A 2JA6G 2Z9HA 1CTMA 3J80i 4POFA 3NP8A 4YCVA 1PFSA 2MQHA 1LLRD 3I4NH 1XTCD 5DM73 4U68A 4CJ0B 3GTLB 1LM0A 3MZ5A 1LACA 3RD4A 4GKKQ 1LTID 1STBA 1AZQA 4A76A 2AUJD 3DEPA 2F0WA 1CA6A 3BDLA 2HHHQ 2VB3X 2UXBQ 1IZ6A 3S2HB 3I70A 2M9VA 1TWHB 2CKZB 1K8MA 1EY4A 2EJMA 3HZXA 3BDOA 4YWMA 3ND8A 1WI5A 3KDFB 1A63A 4DR3Q 3VA5A 2A68D 4GKKL 4BXXH 1BDOA 2EXDA 1QUQA 2FFKB 4ME5A 2R6GA 2HCIA 4MZ9A 2HHHL 3HOVH 1BBXC 4GKJQ 2UXBL 3P7JA 1KXLA 1KL9A 3VR3A 1DM0B 2KCTA 2B2UA 1GUNA 1XYIA 3D4DA 5JEAG 3A0JA 4AH6A 1YI2A 3PGZA 3STBC 3GTJB 1I4PA 3PF5A 1XPOA 2P5ZX 4DR3L 5GAHC 2F0IA 5I6YA 2EXZA 4HEDA 3OPOA 4H44C 4K5WA 4S3SA 5IYBG 2F0HA 1HZAA 4Y7NH 5CV6A 2R92B 3NPPA 3G71A 3TS0A 1VQBA 3T1HQ 2IPKD 3GP7A 3FRPB 3OHXC 3P1HA 4GKJL 1HNXQ 4X65Q 2IX3A 1MHWC 3J81c 5KNBA 4PNYA 2NN6H 1VQ4A 4JC0A 4P74A 4A75A 1HFNA 1X32A 2N49A 1PRTF 2JA7B 4GLVB 1I50B 1EQVA 1FD7D 4OO1G 1TS3A 3W3AA 3MEHA 3CCVA 4G4KA 1TWCH 1E3PA 3NELA 3T1HL 1AEXA 1PZJD 1SMXA 1HNXL 2GVBA 4X65L 1U9RA 4YWLA 1ZYRC 5FJ8H 4RGOS 5COYA 1CKNB 4DAPA 3GDEA 2OTLA 4X3TA 1RD9D 4HIKA 3G6EA 1EZ8A 1TY0A 4FXKC 4IUVA 5JJZA 2I5MX 4N8FA 4QMGA 1B50A 4FO2A 3E9IA 2R93B 3SE0A 2JA5H 5G3LF 3PO2B 4HMJA 2O5IC 1PMRA 1X3PA 2VW9A 2K7VA 1PFNA 1Y1VG 3CQZB 3QO2A 3H3VC 5IT9c 4B9XA 1TT2A 1EYCA 3QOLA 3EIVA 1IXRA 1PYWD 4EQOA 5EQ0A 1EYGA 5JEAJ 5JVG3 3JAME 1DONA 1SNPA 2IW3A 4OGQC 4YWKA 2F0SA 1EIYB 1Y1WG 4RG1A 4KJNA 5A2QL 3I91A 4K2KA 4QCLA 1SJED 4BY7B 4A3JH 1X56A 4IFDH 1ET9A 5C44H 2VL6A 4UP8A 2I0QA 3H09A 1E7ZA 2KECA 4H13C 4X6AH 2IWHA 3VA7A 1SE2A 1XNQQ 1T9HA 1KIXA 3CMEA 3DXJC 1YIJA 1O7LA 4HCSA 4JI7Q 1RTOA 5CV7A 4A3CH 2K1BA 1PFMA 1I94Q 1HUMA 3HOUH 1KRSA 1E2VA 4XT1B 1L1OB 1DOMA 3BYTB 5DLQE 3J81L 4QB4A 2PO4A 4A3FH 1XNQL 1BBUA 3CPFA 1S3OA 3IRBA 1R9TB 2H1EA 4JI7L 3S2DH 2BA1A 2I5HA 2EVBA 2SOBA 3KJOA 1QZGA 2F4VQ 3GTKB 1U4RA 1JB3A 4X64Q 1I94L 1I6HH 2EY5A 2L5TA 5GAGC 1PTOF 1VQJA 2KHIA 3HOVG 1X3EA 1VQ5A 4QL5A 1SNOA 1STGA 2QEJC 4WJ4A 1LT3D 5J22A 3FPPA 1DZ1A 1STAA 2UU9Q 2QKIC 2X6GA 2YTYA 4ZCKA 2CWAA 2SNMA 4C3HB 1NSNS 4B08A 3RZOH 1PYSB 1B8AA 2F4VL 1HH2P 5JJKA 1JQYD 2LXKA 4X64L 3MAQA 1CA5A 3F2BA 5KYIA 1SBBB 1H9SB 2ZXPA 3NQTA 5IGCA 4ME3A 1JE5A 3PV0A 2HT1A 4KHZA 2Z8LA 4J1MA 2F0NA 3ZJYC 3GTPB 2NN6G 2CCZA 3KUPA 1ENCA 4B3TQ 2EYPA 2UU9L 4RGMA 1Q3LA 3T16A 2NWGA 2VUMB 1GXDC 3HOYG 2VY3A 1L1OC 4IUTA 4AYBE 3CXCA 2X69A 1OXTA 3X3NA 4DNTB 3I8ZA 1KTKA 1AH9A 3A8JE 2QILA 3AB9A 5FJ8G 4B3TL 4RMFA 3HG9A 1RTNA 4DAYB 1TQOA 2JQOA 1OXXK 4DF7A 1JJ2A 4HTHA 2OWOA 3I4NB 4NDXA 5M5XH 3M85A 1YNND 2B2TA 5H1SE 4R4QA 2KUMA 4MHEA 4LMQD 2UUCQ 3I4MH 2AHOB 4N9PA 2FMCA 3A74A 1NR4A 1HHVA 3MXGA 2JA5G 5E1FA 1B7YB 1XMQQ 2EYOA 4KTAA 4UP7A 2OT2A 3NBHB 1TWFB 4FNFA 5IE8A 3EFXD 4HAEA 3C2PA 1JOKA 1PH4A 5JJLA 2K33A 3R8BA 4CBVA 3J80L 2A69C 2EY2A 3K57A 2UUCL 1ICFB 5EKIA 4BS9A 1DYQA 1GM5A 2L12A 3ULPA 2Y0SG 4XYQA 5IWAQ 3HOWH 3J81E 1XMQL 3S2HH 5M5YB 1LABA 1E2ZA 3DWAA 3GV6A 4OONA
chains in the Genus database with same CATH topology
2K52A 5C44G 1VQPA 1X3FA 4A3EH 3J80c 4LF4Q 1GD7A 1E24A 2YYZA 5IP9H 4JI4L 2DUDA 4X62Q 1N32Q 2CWPA 4GLAC 4DR6L 1HNWQ 3FP9A 4UY8C 2F3IA 4DV5L 3CCEA 3BJUA 3KOJA 4NPSA 3JAMc 2VQEL 2JEAI 4GS3A 3S1MH 5IYBH 4BA1I 4JYAQ 1H95A 4HIDA 1OXSC 1J6QA 1TXYA 2OQKA 3CCLA 1G6PA 1E1OA 2EIFA 4X66Q 2E5LQ 1A8VA 1SFOH 1I5FA 2IHEA 5BR8Q 5IWAL 4JI3Q 4K0KQ 2IY5B 4BXXG 1CKNA 2K5HA 2CFMA 4JCVE 4DK3C 3DLLA 1PHJA 1XNRL 2K50A 2YTVA 3F8TA 3G48A 3H0GG 3HOUG 1LUZA 4LF4L 3PO3H 1VQGA 4BY1G 5M3FG 1D7QA 4NXMQ 4X62L 1N32L 4JI1Q 1PYBA 1G291 4GNXC 1IBLQ 4IJHA 1HNWL 1R9TH 3RN5A 3CCMA 3F1ZA 3A5UA 3H3VH 4A3FG 4L5RC 4BA2I 4JYAL 2ZM6Q 4OWXB 3HOXH 1GO3E 1U5KA 3J7A5 5M3MH 4X66L 2E5LL 3GTQH 5ELNA 4JBJA 1RIPA 1FL0A 4KI0A 3CMAA 4JI3L 5BR8L 2WAQG 1VQKA 4C2MH 1SRUA 3S16H 2ATWA 4K0KL 4HJ5A 3CAMA 2R7ZH 5M5WH 1MIUA 4JG2A 4JI2Q 4HJAA 4IOCA 1YHQA 3HOZG 1UE6A 5AJ3Q 4JI6Q 3PUVA 4O0AA 4UPAA 3AQQA 4R4CA 4DV2Q 3ICEA 1N8RC 1NTGA 1YNXA 2UUAL 3H3VI 4NXML 3CD6A 2BA0A 1EWIA 3EBEA 4JI1L 4DAMA 1IBLL 3RLOA 2JA7H 1SE8A 4A3MH 3GD7A 1I50H 3MXNB 4UP9A 3UDIA 5IYCH 4GNXA 1EFWA 1X55A 2A1AA 3HOYH 4DK6C 4L5TA 2D0OA 2ZM6L 1KHIA 1CSPA 4C3JH 1B70B 1TWAH 1N9WA 1MJCA 4IPGA 3UDGA 3M4PA 3W1GA 2JE6I 4YCUA 3TS2A 1YJNA 2PQAB 1L2FA 5GADC 1YBYA 3I7FA 1U0LA 1NE3A 1N33Q 3CC2A 4NB3A 4DV4Q 3KLWA 2B63G 2CQOA 2NVQH 4DUYQ 3HKZE 1CSQA 4JI2L 1ASYA 1Y1VH 1YZ6A 3L7ZC 4LW1A 5AJ3L 4JI6L 4NXNQ 4DV2L 4O2DA 4HIMA 1V1QA 4KHPQ 4BBRG 1YEZA 5GQOA 3S14H 2E2IH 4GOPB 3U58A 4DR5Q 2UXCL 4IFDJ 2QGQA 4JBKA 4GLXA 5C0XI 5IYDG 2ZJRA 3BU2A 4IPCA 4A4IA 2MNAA 1KAWA 5C3EH 4A3KG 1K9MC 2VUMG 1L0WA 3RZDH 1JMCA 3AEVA 1L1OA 4DV4L 3PO2H 1UE7A 3RLFA 5FLMH 1HNZQ 4DUYL 1S72A 3I55A 3CW2C 4NXNL 3D0FA 3K8AA 3CQZH 5IY0A 1VQ9A 4KHPL 2JK8A 1WOCA 2JA8H 1Z47A 3TRZA 2VNUD 4PZ7A 2JA6G 2DGYA 3K0XA 3J80i 3GO5A 2PI2A 4PMWA 1PH6A 4POFA 4DR5L 1K8GA 4PZ6A 4YCVA 1PFSA 1WCMG 2MQHA 3ULLA 4TVAB 3JAMi 3TREA 3I4NH 3ER0A 3D31A 4J15A 1HZ9A 1LM0A 4B3MQ 4A3GG 1X54A 1C7YA 2Y0SE 2AWNA 1HZCA 4GKKQ 1IYJB 2OTJA 1OXUA 4QJFA 4A76A 1W2BA 3JC66 1HNZL 4BY7H 3S1NH 3I4MG 3TEHB 1DGSA 5J3BA 2HHHQ 1VQOA 2UXBQ 4OWWB 1IZ6A 4P72A 4LUVA 1O7IA 1AE3A 3CF5A 1NJIC 2CKZB 3RLNA 5IP7G 2L15A 4JV5Q 3FHWA 3OTOQ 4YWMA 4JI5Q 3U4ZA 4R4OA 1WI5A 3W1BA 3HFZB 2WB1G 3KDFB 5JJIA 2EQSA 1KQSA 3GTOH 4A3BG 1A63A 5EAYA 4DR3Q 4B3ML 3I56A 1JJCB 4DV7Q 2Q2IA 3PUZA 3VDYA 2Z0SA 4A3IG 4DPGA 4GKKL 1LTLA 2E8GA 3J7ZC 4BXXH 2JEBI 4BBSH 2EXDA 2OQ0A 4GOPC 1QUQA 2R6GA 4A3CG 4MZ9A 2HHHL 1KXLA 3HOVH 4GKJQ 2UXBL 1KL9A 3CCSA 2KCTA 1OTCA 2NVYH 5LMNW 2NZOA 2HQLA 1Q1EA 5JEAG 3A0JA 4A3DG 3E9HA 5K36G 4LUZA 3F2DA 4DR4Q 3OTOL 4AH6A 4P71A 1YI2A 4JV5L 2GVAA 3PGZA 1VQFA 2PI2E 3STBC 4AQYQ 1PH1A 4JI5L 3I2ZA 3NENA 5IP9G 4PG3A 3OYYA 3PF5A 1XPOA 1Q81C 3GTMH 1PH9A 2K4KA 3F2CA 4DR3L 2V1CC 5GAHC 4B3RQ 4DV7L 4GN4B 5LMNQ 3PF4A 1Q86C 4A3LH 3GTKH 5IYBG 1BVSA 2ZJQA 4Y7NH 1HZAA 1A0IA 3G71A 3TS0A 1VQBA 3T1HQ 2UXCQ 1VQ8A 1ASZA 3FKIH 3PSIA 4GKJL 1HNXQ 3PUYA 1KD1C 1EUJA 1UEBA 4P75A 4X65Q 3J81c 2B29A 5E7NA 1QVCA 1E1TA 1MJEA 1VQNA 1VQ4A 3W5OA 4JC0A 4QQBX 4DR4L 5GAEC 4OO1I 4P74A 4A75A 4AQYL 1QVFA 3KF6A 2PNHA 3PO3G 3RR5A 1GVPA 2N49A 2BH2A 3OW2A 4GLVB 1BBWA 3M7NA 4C3HH 4LF8Q 4B3RL 2K75A 4OO1G 2JA9A 3BZCA 2AKWB 4R1JA 5LMNL 2ZJPA 4DR1Q 2ZTCA 1HR0W 2E2HH 2RCNA 3CCVA 2A19A 1TWCH 1E3PA 3NELA 3T1HL 3HOXG 2R92G 5M3MG 3AFQA 2XTIA 1SMXA 2QEXA 2Q2UA 2ID0A 1HNXL 2GVBA 1KC8C 3HKSA 3S1QH 4X65L 4OXPA 2HIVA 3KYHC 1XJVA 4YWLA 3CPWA 3AYHB 1HR0Q 5FJ8H 4LF6Q 3GTPH 1XPUA 4Y52H 1CKNB 3KFUA 1EQRA 3GDEA 3UE1A 2OTLA 1IBKQ 1Q7YC 2IX0A 2VUMH 4LF8L 4HIKA 4L5QA 3G6EA 4A3MG 4IO9A 1K83H 2D62A 2IX1A 2NZHA 4DNIA 4DR1L 2LSSA 2I5MX 3RNUA 1G51A 2VS1A 1Y14B 3A5ZB 3KF8B 5C0XG 2IHFA 5C4XG 3E9IA 2JA5H 1N33L 2BH8A 1UE5A 1PH7A 1XPRA 1JB7A 2JA6H 2VW9A 4MTNA 3PCOB 3G4SA 1HR0L 4AYBG 4LF6L 1Y1VG 1Q46A 4R4TA 5IT9c 2MO0A 2JJQA 1K0RA 3EIVA 1IBKL 2F52A 5GROA 4POGA 1IXRA 4DV1Q 4FDBA 1FJGQ 3M4QA 1EYGA 5JEAJ 3WWVA 3T1YQ 4A3GH 2ES2A 2RF4A 1YVCA 1P8LA 2ZTDA 1C9OA 4P73A 4YWKA 2KBNA 1EIYB 1K73C 5C3EG 1Y1WG 1EQQA 1NY4A 4H02A 4RG1A 2R93G 1FGUA 4KLKA 4A93H 2OCEA 3LGJA 4XTCS 2D0PA 4EQ5A 4LWCA 3PO2G 4A3JH 1X56A 1YHBA 4GN3B 5FLMG 1QZHA 4LF5Q 4APVA 1VQIA 2H5XA 5C44H 2VQFQ 2VL6A 4UP8A 2IT1A 3J81j 2I0QA 1TWFH 3MEFA 5IP7H 1PV4A 4YCWA 1PH5A 2B3GA 1QVGA 2Q2HA 2JA8G 2N78A 2WB1E 1E7ZA 3ULJA 4DUZQ 1PH2A 1CUKA 3ERSX 4DV1L 5HGQA 1W3SA 1FJGL 4X6AH 3UE0A 3TQYA 3T1YL 4WJ3M 3U50C 1XNQQ 1T9HA 1D8LA 1KIXA 3CMEA 3GTLH 1V43A 3H15A 1UWVA 2FXQA 3KJPA 1YIJA 4JI7Q 3PUWA 2UUBQ 2WFWA 4A3CH 2MFIA 4IJLA 4IFDI 4HJ9A 2AWOA 4HJ8A 2KCMA 2YTXA 2QA4A 5M5YH 1I94Q 4OX9Q 4LF5L 2HIXA 2ASBA 2VQFL 3H0GH 2RHSB 3CCRA 4DV6Q 3STBD 3CCQA 1KRSA 3HOUH 1TWHH 4JI8Q 4A3DH 1L1OB 3HOWG 2KENA 1IBMQ 5M3FH 5DLQE 2I5LX 4XIGS 4BY1H 4DUZL 2R7DA 4LFCQ 4LUOA 1X65A 4EX5A 5FLXc 2Z6KC 4A3FH 1N36Q 3CCJA 1XNQL 1BBUA 3CPFA 1I3QH 2PQAA 3S24A 4A3EG 3UDFA 1S3OA 3IRBA 3S2DH 4JI7L 5LMUQ 4JOIC 1P16A 3L2PA 4HJ7A 2UUBL 3CC4A 2BA1A 2I5HA 4LF7Q 1BKBA 2WAQE 3KJOA 1QZGA 2ZTEA 3Q8DA 4MNOA 4JBMA 2F4VQ 3DM3A 2UXDQ 4DV3Q 2Q2TA 1MKHA 1RL2A 4X64Q 1I94L 4QY7A 4OX9L 3HOZH 3AFPA 4BBSG 1I6HH 4DV6L 5GAGC 5C0XJ 2C35B 4GOPA 1PVOA 1SROA 4JI8L 1VQJA 2KHIA 3HOVG 1X3EA 3CCUA 1IBML 1VQ5A 1VQEA 4QL5A 4DV0Q 4L5SA 3S1RH 1IL2A 4LFCL 3UDXA 3GTJH 3K7UC 2UUAQ 1YJ9A 4JI0Q 1N36L 3B6YA 1M1KC 4DR2Q 4WJ4A 2Z6KA 3K7AH 1PH8A 2UU9Q 2YTYA 3PIPA 4LFAQ 4DR7Q 2CWAA 4OWTB 2VZAA 5LMUL 3RZOH 4LF7L 2R92H 1PYSB 1B8AA 4JOIA 3M4OH 4B3SQ 2F4VL 1HH2P 1EOVA 2NVXH 5JJKA 2B63H 4A3LG 1XTDA 4DV3L 2LXKA 1X9NA 1VQLA 2UXDL 3K81C 4X64L 1E22A 1N34Q 2YU9H 3F2BA 2WP8J 3NEMA 1X6OA 3L0OA 2PMZE 2NN6I 1SR3A 3FKIG 1VQCA 4ME3A 4LNQA 1SN8A 1JE5A 4BBRH 3PV0A 2HT1A 4KHZA 1M90C 4DV0L 1VQHA 2R7ZG 1QUQB 1C0AA 3ZJYC 2NN6G 2CCZA 1JT8A 4JI0L 3PIOA 4DR2L 1WFQA 4B3TQ 3S15H 5IYDH 2UU9L 4LFAL 1WYDA 1Q82C 1NMGA 5ELOA 4A3KH 2JA7G 2NVTH 4DR7L 1YJWA 5IYCG 1X3GA 3PUXA 2LXJA 4B3SL 4GN5A 5C4XH 3HOYG 1JJGA 2GN5A 2VY3A 1L1OC 1J5EQ 4C3IH 3K80C 5C4JH 4AYBE 1N34L 2YV5A 3CXCA 1GKHA 4YY3Q 1OXTA 3M9BA 3M3YH 1XMOQ 1TWGH 2E2JH 4DKAC 1AH9A 1S40A 1WCMH 1VQAA 3HKZG 3KDFA 4R4IA 5FJ8G 4B3TL 4RMFA 2K5VA 4DAYB 1CKOA 2JQOA 1OXXK 4QIWE 1JJ2A 1NBWA 2OWOA 1VQ6A 1VQ7A 3S17H 1A62A 4HIOA 1Y1WH 1Q1BA 1VQDA 2K5NA 2N8NA 1HJPA 3KF6B 5M5XH 3M85A 4LF9Q 4YHHQ 5H1SE 1CKMA 1EIFA 1LYLA 4R4QA 1J5EL 4GNXB 2R93H 1SLJA 1Q12A 2AMCB 2ALYB 3U4VA 3CC7A 2R7FA 4ALPA 2UUCQ 3I4MH 1FVIA 2AHOB 4YY3L 3A74A 4PZ8A 2JA5G 1XMOL 2A8VA 1V9PA 4LFBQ 1B7YB 3EN2A 1XMQQ 1WJJA 4IPDA 3GTGH 1VQMA 1K8AC 4UP7A 3BZKA 4QGUA 2KHJA 1VS0A 1OXVA 1AE2A 1K3RA 3NBHB 3SGIA 5IE8A 3RN2A 4IPHA 2XGTA 1PA6A 4JI4Q 1PH4A 5HY6A 4A3BH 4DR6Q 5JJLA 1NMFA 4DV5Q 2K14A 1Z9FA 2VQEQ 4A3IH 3I4NG 4LF9L 4YHHL 1UE1A 1PH3A 1YITA 2UUCL 1GM5A 2N3SA 3I4OA 4TQUS 1HZBA 2MO1A 1Q8KA 3E0EA 2RHQB 3ULPA 2Y0SG 5IWAQ 3HOWH 3CP0A 1VCIA 3J81i 1XNRQ 4LFBL 1XMQL 1YHAA 4JBWA 1KRTA 4BY7G 3S2HH 4A93G 4IOAA 4A3JG 4AIMA 4IFDG 4OONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K52 A;  5C44 G;  1VQP A;  1X3F A;  4A3E H;  3J80 c;  4LF4 Q;  1GD7 A;  1E24 A;  2YYZ A;  5IP9 H;  4JI4 L;  2DUD A;  4X62 Q;  1N32 Q;  2CWP A;  4GLA C;  4DR6 L;  1HNW Q;  3FP9 A;  4UY8 C;  2F3I A;  4DV5 L;  3CCE A;  3BJU A;  3KOJ A;  4NPS A;  3JAM c;  2VQE L;  2JEA I;  4GS3 A;  3S1M H;  5IYB H;  4BA1 I;  4JYA Q;  1H95 A;  4HID A;  1OXS C;  1J6Q A;  1TXY A;  2OQK A;  3CCL A;  1G6P A;  1E1O A;  2EIF A;  4X66 Q;  2E5L Q;  1A8V A;  1SFO H;  1I5F A;  2IHE A;  5BR8 Q;  5IWA L;  4JI3 Q;  4K0K Q;  2IY5 B;  4BXX G;  1CKN A;  2K5H A;  2CFM A;  4JCV E;  4DK3 C;  3DLL A;  1PHJ A;  1XNR L;  2K50 A;  2YTV A;  3F8T A;  3G48 A;  3H0G G;  3HOU G;  1LUZ A;  4LF4 L;  3PO3 H;  1VQG A;  4BY1 G;  5M3F G;  1D7Q A;  4NXM Q;  4X62 L;  1N32 L;  4JI1 Q;  1PYB A;  1G29 1;  4GNX C;  1IBL Q;  4IJH A;  1HNW L;  1R9T H;  3RN5 A;  3CCM A;  3F1Z A;  3A5U A;  3H3V H;  4A3F G;  4L5R C;  4BA2 I;  4JYA L;  2ZM6 Q;  4OWX B;  3HOX H;  1GO3 E;  1U5K A;  3J7A 5;  5M3M H;  4X66 L;  2E5L L;  3GTQ H;  5ELN A;  4JBJ A;  1RIP A;  1FL0 A;  4KI0 A;  3CMA A;  4JI3 L;  5BR8 L;  2WAQ G;  1VQK A;  4C2M H;  1SRU A;  3S16 H;  2ATW A;  4K0K L;  4HJ5 A;  3CAM A;  2R7Z H;  5M5W H;  1MIU A;  4JG2 A;  4JI2 Q;  4HJA A;  4IOC A;  1YHQ A;  3HOZ G;  1UE6 A;  5AJ3 Q;  4JI6 Q;  3PUV A;  4O0A A;  4UPA A;  3AQQ A;  4R4C A;  4DV2 Q;  3ICE A;  1N8R C;  1NTG A;  1YNX A;  2UUA L;  3H3V I;  4NXM L;  3CD6 A;  2BA0 A;  1EWI A;  3EBE A;  4JI1 L;  4DAM A;  1IBL L;  3RLO A;  2JA7 H;  1SE8 A;  4A3M H;  3GD7 A;  1I50 H;  3MXN B;  4UP9 A;  3UDI A;  5IYC H;  4GNX A;  1EFW A;  1X55 A;  2A1A A;  3HOY H;  4DK6 C;  4L5T A;  2D0O A;  2ZM6 L;  1KHI A;  1CSP A;  4C3J H;  1B70 B;  1TWA H;  1N9W A;  1MJC A;  4IPG A;  3UDG A;  3M4P A;  3W1G A;  2JE6 I;  4YCU A;  3TS2 A;  1YJN A;  2PQA B;  1L2F A;  5GAD C;  1YBY A;  3I7F A;  1U0L A;  1NE3 A;  1N33 Q;  3CC2 A;  4NB3 A;  4DV4 Q;  3KLW A;  2B63 G;  2CQO A;  2NVQ H;  4DUY Q;  3HKZ E;  1CSQ A;  4JI2 L;  1ASY A;  1Y1V H;  1YZ6 A;  3L7Z C;  4LW1 A;  5AJ3 L;  4JI6 L;  4NXN Q;  4DV2 L;  4O2D A;  4HIM A;  1V1Q A;  4KHP Q;  4BBR G;  1YEZ A;  5GQO A;  3S14 H;  2E2I H;  4GOP B;  3U58 A;  4DR5 Q;  2UXC L;  4IFD J;  2QGQ A;  4JBK A;  4GLX A;  5C0X I;  5IYD G;  2ZJR A;  3BU2 A;  4IPC A;  4A4I A;  2MNA A;  1KAW A;  5C3E H;  4A3K G;  1K9M C;  2VUM G;  1L0W A;  3RZD H;  1JMC A;  3AEV A;  1L1O A;  4DV4 L;  3PO2 H;  1UE7 A;  3RLF A;  5FLM H;  1HNZ Q;  4DUY L;  1S72 A;  3I55 A;  3CW2 C;  4NXN L;  3D0F A;  3K8A A;  3CQZ H;  5IY0 A;  1VQ9 A;  4KHP L;  2JK8 A;  1WOC A;  2JA8 H;  1Z47 A;  3TRZ A;  2VNU D;  4PZ7 A;  2JA6 G;  2DGY A;  3K0X A;  3J80 i;  3GO5 A;  2PI2 A;  4PMW A;  1PH6 A;  4POF A;  4DR5 L;  1K8G A;  4PZ6 A;  4YCV A;  1PFS A;  1WCM G;  2MQH A;  3ULL A;  4TVA B;  3JAM i;  3TRE A;  3I4N H;  3ER0 A;  3D31 A;  4J15 A;  1HZ9 A;  1LM0 A;  4B3M Q;  4A3G G;  1X54 A;  1C7Y A;  2Y0S E;  2AWN A;  1HZC A;  4GKK Q;  1IYJ B;  2OTJ A;  1OXU A;  4QJF A;  4A76 A;  1W2B A;  3JC6 6;  1HNZ L;  4BY7 H;  3S1N H;  3I4M G;  3TEH B;  1DGS A;  5J3B A;  2HHH Q;  1VQO A;  2UXB Q;  4OWW B;  1IZ6 A;  4P72 A;  4LUV A;  1O7I A;  1AE3 A;  3CF5 A;  1NJI C;  2CKZ B;  3RLN A;  5IP7 G;  2L15 A;  4JV5 Q;  3FHW A;  3OTO Q;  4YWM A;  4JI5 Q;  3U4Z A;  4R4O A;  1WI5 A;  3W1B A;  3HFZ B;  2WB1 G;  3KDF B;  5JJI A;  2EQS A;  1KQS A;  3GTO H;  4A3B G;  1A63 A;  5EAY A;  4DR3 Q;  4B3M L;  3I56 A;  1JJC B;  4DV7 Q;  2Q2I A;  3PUZ A;  3VDY A;  2Z0S A;  4A3I G;  4DPG A;  4GKK L;  1LTL A;  2E8G A;  3J7Z C;  4BXX H;  2JEB I;  4BBS H;  2EXD A;  2OQ0 A;  4GOP C;  1QUQ A;  2R6G A;  4A3C G;  4MZ9 A;  2HHH L;  1KXL A;  3HOV H;  4GKJ Q;  2UXB L;  1KL9 A;  3CCS A;  2KCT A;  1OTC A;  2NVY H;  5LMN W;  2NZO A;  2HQL A;  1Q1E A;  5JEA G;  3A0J A;  4A3D G;  3E9H A;  5K36 G;  4LUZ A;  3F2D A;  4DR4 Q;  3OTO L;  4AH6 A;  4P71 A;  1YI2 A;  4JV5 L;  2GVA A;  3PGZ A;  1VQF A;  2PI2 E;  3STB C;  4AQY Q;  1PH1 A;  4JI5 L;  3I2Z A;  3NEN A;  5IP9 G;  4PG3 A;  3OYY A;  3PF5 A;  1XPO A;  1Q81 C;  3GTM H;  1PH9 A;  2K4K A;  3F2C A;  4DR3 L;  2V1C C;  5GAH C;  4B3R Q;  4DV7 L;  4GN4 B;  5LMN Q;  3PF4 A;  1Q86 C;  4A3L H;  3GTK H;  5IYB G;  1BVS A;  2ZJQ A;  4Y7N H;  1HZA A;  1A0I A;  3G71 A;  3TS0 A;  1VQB A;  3T1H Q;  2UXC Q;  1VQ8 A;  1ASZ A;  3FKI H;  3PSI A;  4GKJ L;  1HNX Q;  3PUY A;  1KD1 C;  1EUJ A;  1UEB A;  4P75 A;  4X65 Q;  3J81 c;  2B29 A;  5E7N A;  1QVC A;  1E1T A;  1MJE A;  1VQN A;  1VQ4 A;  3W5O A;  4JC0 A;  4QQB X;  4DR4 L;  5GAE C;  4OO1 I;  4P74 A;  4A75 A;  4AQY L;  1QVF A;  3KF6 A;  2PNH A;  3PO3 G;  3RR5 A;  1GVP A;  2N49 A;  2BH2 A;  3OW2 A;  4GLV B;  1BBW A;  3M7N A;  4C3H H;  4LF8 Q;  4B3R L;  2K75 A;  4OO1 G;  2JA9 A;  3BZC A;  2AKW B;  4R1J A;  5LMN L;  2ZJP A;  4DR1 Q;  2ZTC A;  1HR0 W;  2E2H H;  2RCN A;  3CCV A;  2A19 A;  1TWC H;  1E3P A;  3NEL A;  3T1H L;  3HOX G;  2R92 G;  5M3M G;  3AFQ A;  2XTI A;  1SMX A;  2QEX A;  2Q2U A;  2ID0 A;  1HNX L;  2GVB A;  1KC8 C;  3HKS A;  3S1Q H;  4X65 L;  4OXP A;  2HIV A;  3KYH C;  1XJV A;  4YWL A;  3CPW A;  3AYH B;  1HR0 Q;  5FJ8 H;  4LF6 Q;  3GTP H;  1XPU A;  4Y52 H;  1CKN B;  3KFU A;  1EQR A;  3GDE A;  3UE1 A;  2OTL A;  1IBK Q;  1Q7Y C;  2IX0 A;  2VUM H;  4LF8 L;  4HIK A;  4L5Q A;  3G6E A;  4A3M G;  4IO9 A;  1K83 H;  2D62 A;  2IX1 A;  2NZH A;  4DNI A;  4DR1 L;  2LSS A;  2I5M X;  3RNU A;  1G51 A;  2VS1 A;  1Y14 B;  3A5Z B;  3KF8 B;  5C0X G;  2IHF A;  5C4X G;  3E9I A;  2JA5 H;  1N33 L;  2BH8 A;  1UE5 A;  1PH7 A;  1XPR A;  1JB7 A;  2JA6 H;  2VW9 A;  4MTN A;  3PCO B;  3G4S A;  1HR0 L;  4AYB G;  4LF6 L;  1Y1V G;  1Q46 A;  4R4T A;  5IT9 c;  2MO0 A;  2JJQ A;  1K0R A;  3EIV A;  1IBK L;  2F52 A;  5GRO A;  4POG A;  1IXR A;  4DV1 Q;  4FDB A;  1FJG Q;  3M4Q A;  1EYG A;  5JEA J;  3WWV A;  3T1Y Q;  4A3G H;  2ES2 A;  2RF4 A;  1YVC A;  1P8L A;  2ZTD A;  1C9O A;  4P73 A;  4YWK A;  2KBN A;  1EIY B;  1K73 C;  5C3E G;  1Y1W G;  1EQQ A;  1NY4 A;  4H02 A;  4RG1 A;  2R93 G;  1FGU A;  4KLK A;  4A93 H;  2OCE A;  3LGJ A;  4XTC S;  2D0P A;  4EQ5 A;  4LWC A;  3PO2 G;  4A3J H;  1X56 A;  1YHB A;  4GN3 B;  5FLM G;  1QZH A;  4LF5 Q;  4APV A;  1VQI A;  2H5X A;  5C44 H;  2VQF Q;  2VL6 A;  4UP8 A;  2IT1 A;  3J81 j;  2I0Q A;  1TWF H;  3MEF A;  5IP7 H;  1PV4 A;  4YCW A;  1PH5 A;  2B3G A;  1QVG A;  2Q2H A;  2JA8 G;  2N78 A;  2WB1 E;  1E7Z A;  3ULJ A;  4DUZ Q;  1PH2 A;  1CUK A;  3ERS X;  4DV1 L;  5HGQ A;  1W3S A;  1FJG L;  4X6A H;  3UE0 A;  3TQY A;  3T1Y L;  4WJ3 M;  3U50 C;  1XNQ Q;  1T9H A;  1D8L A;  1KIX A;  3CME A;  3GTL H;  1V43 A;  3H15 A;  1UWV A;  2FXQ A;  3KJP A;  1YIJ A;  4JI7 Q;  3PUW A;  2UUB Q;  2WFW A;  4A3C H;  2MFI A;  4IJL A;  4IFD I;  4HJ9 A;  2AWO A;  4HJ8 A;  2KCM A;  2YTX A;  2QA4 A;  5M5Y H;  1I94 Q;  4OX9 Q;  4LF5 L;  2HIX A;  2ASB A;  2VQF L;  3H0G H;  2RHS B;  3CCR A;  4DV6 Q;  3STB D;  3CCQ A;  1KRS A;  3HOU H;  1TWH H;  4JI8 Q;  4A3D H;  1L1O B;  3HOW G;  2KEN A;  1IBM Q;  5M3F H;  5DLQ E;  2I5L X;  4XIG S;  4BY1 H;  4DUZ L;  2R7D A;  4LFC Q;  4LUO A;  1X65 A;  4EX5 A;  5FLX c;  2Z6K C;  4A3F H;  1N36 Q;  3CCJ A;  1XNQ L;  1BBU A;  3CPF A;  1I3Q H;  2PQA A;  3S24 A;  4A3E G;  3UDF A;  1S3O A;  3IRB A;  3S2D H;  4JI7 L;  5LMU Q;  4JOI C;  1P16 A;  3L2P A;  4HJ7 A;  2UUB L;  3CC4 A;  2BA1 A;  2I5H A;  4LF7 Q;  1BKB A;  2WAQ E;  3KJO A;  1QZG A;  2ZTE A;  3Q8D A;  4MNO A;  4JBM A;  2F4V Q;  3DM3 A;  2UXD Q;  4DV3 Q;  2Q2T A;  1MKH A;  1RL2 A;  4X64 Q;  1I94 L;  4QY7 A;  4OX9 L;  3HOZ H;  3AFP A;  4BBS G;  1I6H H;  4DV6 L;  5GAG C;  5C0X J;  2C35 B;  4GOP A;  1PVO A;  1SRO A;  4JI8 L;  1VQJ A;  2KHI A;  3HOV G;  1X3E A;  3CCU A;  1IBM L;  1VQ5 A;  1VQE A;  4QL5 A;  4DV0 Q;  4L5S A;  3S1R H;  1IL2 A;  4LFC L;  3UDX A;  3GTJ H;  3K7U C;  2UUA Q;  1YJ9 A;  4JI0 Q;  1N36 L;  3B6Y A;  1M1K C;  4DR2 Q;  4WJ4 A;  2Z6K A;  3K7A H;  1PH8 A;  2UU9 Q;  2YTY A;  3PIP A;  4LFA Q;  4DR7 Q;  2CWA A;  4OWT B;  2VZA A;  5LMU L;  3RZO H;  4LF7 L;  2R92 H;  1PYS B;  1B8A A;  4JOI A;  3M4O H;  4B3S Q;  2F4V L;  1HH2 P;  1EOV A;  2NVX H;  5JJK A;  2B63 H;  4A3L G;  1XTD A;  4DV3 L;  2LXK A;  1X9N A;  1VQL A;  2UXD L;  3K81 C;  4X64 L;  1E22 A;  1N34 Q;  2YU9 H;  3F2B A;  2WP8 J;  3NEM A;  1X6O A;  3L0O A;  2PMZ E;  2NN6 I;  1SR3 A;  3FKI G;  1VQC A;  4ME3 A;  4LNQ A;  1SN8 A;  1JE5 A;  4BBR H;  3PV0 A;  2HT1 A;  4KHZ A;  1M90 C;  4DV0 L;  1VQH A;  2R7Z G;  1QUQ B;  1C0A A;  3ZJY C;  2NN6 G;  2CCZ A;  1JT8 A;  4JI0 L;  3PIO A;  4DR2 L;  1WFQ A;  4B3T Q;  3S15 H;  5IYD H;  2UU9 L;  4LFA L;  1WYD A;  1Q82 C;  1NMG A;  5ELO A;  4A3K H;  2JA7 G;  2NVT H;  4DR7 L;  1YJW A;  5IYC G;  1X3G A;  3PUX A;  2LXJ A;  4B3S L;  4GN5 A;  5C4X H;  3HOY G;  1JJG A;  2GN5 A;  2VY3 A;  1L1O C;  1J5E Q;  4C3I H;  3K80 C;  5C4J H;  4AYB E;  1N34 L;  2YV5 A;  3CXC A;  1GKH A;  4YY3 Q;  1OXT A;  3M9B A;  3M3Y H;  1XMO Q;  1TWG H;  2E2J H;  4DKA C;  1AH9 A;  1S40 A;  1WCM H;  1VQA A;  3HKZ G;  3KDF A;  4R4I A;  5FJ8 G;  4B3T L;  4RMF A;  2K5V A;  4DAY B;  1CKO A;  2JQO A;  1OXX K;  4QIW E;  1JJ2 A;  1NBW A;  2OWO A;  1VQ6 A;  1VQ7 A;  3S17 H;  1A62 A;  4HIO A;  1Y1W H;  1Q1B A;  1VQD A;  2K5N A;  2N8N A;  1HJP A;  3KF6 B;  5M5X H;  3M85 A;  4LF9 Q;  4YHH Q;  5H1S E;  1CKM A;  1EIF A;  1LYL A;  4R4Q A;  1J5E L;  4GNX B;  2R93 H;  1SLJ A;  1Q12 A;  2AMC B;  2ALY B;  3U4V A;  3CC7 A;  2R7F A;  4ALP A;  2UUC Q;  3I4M H;  1FVI A;  2AHO B;  4YY3 L;  3A74 A;  4PZ8 A;  2JA5 G;  1XMO L;  2A8V A;  1V9P A;  4LFB Q;  1B7Y B;  3EN2 A;  1XMQ Q;  1WJJ A;  4IPD A;  3GTG H;  1VQM A;  1K8A C;  4UP7 A;  3BZK A;  4QGU A;  2KHJ A;  1VS0 A;  1OXV A;  1AE2 A;  1K3R A;  3NBH B;  3SGI A;  5IE8 A;  3RN2 A;  4IPH A;  2XGT A;  1PA6 A;  4JI4 Q;  1PH4 A;  5HY6 A;  4A3B H;  4DR6 Q;  5JJL A;  1NMF A;  4DV5 Q;  2K14 A;  1Z9F A;  2VQE Q;  4A3I H;  3I4N G;  4LF9 L;  4YHH L;  1UE1 A;  1PH3 A;  1YIT A;  2UUC L;  1GM5 A;  2N3S A;  3I4O A;  4TQU S;  1HZB A;  2MO1 A;  1Q8K A;  3E0E A;  2RHQ B;  3ULP A;  2Y0S G;  5IWA Q;  3HOW H;  3CP0 A;  1VCI A;  3J81 i;  1XNR Q;  4LFB L;  1XMQ L;  1YHA A;  4JBW A;  1KRT A;  4BY7 G;  3S2H H;  4A93 G;  4IOA A;  4A3J G;  4AIM A;  4IFD G;  4OON A; 
#chains in the Genus database with same CATH topology
 4IN3 A;  1QE6 A;  5C44 G;  2YYZ A;  5D14 A;  2DUD A;  5CV8 A;  3OWE B;  3LX0 A;  3FP9 A;  1HNW Q;  2F3I A;  3S1M H;  4EGV A;  2LS0 1;  2R61 A;  1H95 A;  2WKD A;  1J6Q A;  2CW0 C;  1E1O A;  2E5L Q;  1A8V A;  4FXD A;  4Y7N B;  3V2T A;  4JI3 Q;  5IWA L;  4CDF C;  3HOZ B;  3PQI A;  4OIJ A;  2YTV A;  3EQL C;  1EWC A;  3F8T A;  1ILQ A;  5ELB A;  3HOU G;  5EJW A;  4XQQ A;  4L63 B;  1HTL D;  2BDO A;  2EOT A;  2EDG A;  3VYT A;  1HNW L;  3A5U A;  3H3V H;  4A3F G;  4L5R C;  2E75 C;  1GUW A;  1GO3 E;  3ITP A;  2E5L L;  1RIP A;  1FL0 A;  1I4X A;  1ILP A;  2NVX B;  4HR7 B;  4JI3 L;  1SNM A;  5M5W H;  4JG2 A;  4IOC A;  1YHQ A;  1IW7 D;  4DV2 Q;  4BBR B;  1YNX A;  1SE4 A;  3SK8 A;  2UUA L;  2JA7 H;  2L4N A;  5CV5 A;  1PDQ A;  1I50 H;  3UDI A;  4GNX A;  5ELF A;  2A1A A;  4FVM A;  1CI3 M;  2D0O A;  2NVT B;  4NW2 A;  1MJC A;  5C0X H;  1YBY A;  1U0L A;  1F9R A;  3QIA A;  1NE3 A;  2O5J C;  1N33 Q;  3CC2 A;  5DEH A;  5C4J B;  1SJH D;  3KLW A;  1CQV A;  1BF4 A;  1YZ6 A;  4GZY C;  5JVH 3;  4DV2 L;  4O2D A;  1BCP B;  5D3I B;  1S5D D;  5D65 A;  4GOP B;  4IFD J;  3IL8 A;  2ZJR A;  1CHP D;  5FO8 B;  2L55 A;  4RCO A;  3SVM A;  1QCB D;  1HA5 A;  1LT4 D;  1TS4 A;  3AEV A;  4ZUI A;  3PO2 H;  5FLM H;  3O13 A;  1HNZ Q;  3VYR A;  1G91 A;  3CKI B;  3K8A A;  3CQZ H;  3DMU A;  4HMI A;  1VQ9 A;  1WOC A;  1Z47 A;  2DJF C;  2RVL A;  3K0X A;  5EGT A;  2PI2 A;  1WTO A;  1S5E D;  4WRD A;  4PZ6 A;  3DHQ A;  3ULL A;  4TVA B;  3VR5 A;  3TRE A;  1O7Y A;  4P2C B;  4A3B B;  3D31 A;  3PIP 3;  2F0V A;  1PRT D;  1HZ9 A;  4A3G G;  4B3M Q;  4A3I B;  1PLF A;  1Z6H A;  4CDD C;  4H0L C;  5NUC A;  1IYJ B;  3A7A B;  4QJF A;  1IYV A;  1SMY D;  1HNZ L;  4BY7 H;  4FF4 A;  4TRD A;  3I4M G;  3TEH B;  1VQO A;  3VR4 A;  1EEF D;  1EYD A;  2X6L A;  5C6A A;  1AE3 A;  4X3K A;  1NJI C;  3NUC A;  5IP7 G;  1B4O A;  1EWH A;  4PQX A;  1H9M A;  2H4O A;  2WB1 G;  5JJI A;  1EU4 A;  1JOQ A;  4B3M L;  3I56 A;  4DV7 Q;  2Z0S A;  4DPG A;  1NUC A;  1BCP C;  1LTL A;  2JEB I;  2OQ0 A;  4GOP C;  1F2M A;  1SFO B;  3TSS A;  1ML0 D;  3MXN A;  2F4I A;  2NTT A;  4DXF A;  1EYA A;  1L0Y B;  5LMN W;  1CT1 D;  1TVX A;  1K8O A;  1STN A;  4R9W A;  3F2D A;  4DR4 Q;  1VQF A;  2JP1 A;  3I2Z A;  3NEN A;  4JK1 C;  1Q81 C;  2ICE C;  2A6H D;  2F03 A;  4DV7 L;  5LMN Q;  1V8Q A;  3PF4 A;  4A3L H;  3GTK H;  1G2S A;  2L0C A;  2F0G A;  5M3M B;  4KY7 A;  3K59 A;  1ZKO A;  3PSI A;  1FNW A;  3H91 A;  4P75 A;  2F0K A;  2B29 A;  3ONA B;  5E7N A;  4RHS A;  1QVC A;  1E1T A;  3G7L A;  1EQT A;  3ND9 A;  4KD3 A;  1VQN A;  3W5O A;  1GUG A;  3BZD B;  2XRS D;  5GAE C;  4DR4 L;  3KK7 A;  1QVF A;  1Y69 U;  3RR5 A;  4KKU A;  3GTO B;  3OW2 A;  3IAY A;  4C3H H;  3M7N A;  1SND A;  2JA9 A;  3L9A X;  5LMN L;  3MWY W;  5KYL A;  4DR1 Q;  1TWA B;  2R92 G;  2EY1 A;  3AFQ A;  2QEX A;  4XDX A;  4A3J G;  2ID0 A;  1KC8 C;  1JOO A;  5I6W A;  1Z7T A;  2OF1 A;  3KYH C;  1XJV A;  3AYH B;  3GTP H;  1XPU A;  1I4G A;  4Y52 H;  4XXE A;  3UE1 A;  1ONL A;  2E2I B;  1Q7Y C;  2VUM H;  4DFA A;  2HUG A;  3MC0 B;  2D62 A;  4DR1 L;  4DNI A;  3NE5 B;  2LSS A;  4ZKC B;  5C3E B;  1G51 A;  2VS1 A;  3NHH A;  5C0X G;  2IHF A;  2Z4I A;  3KLS X;  2BH8 A;  1UE5 A;  2OXP A;  1JB7 A;  4ZKB B;  4MTN A;  3G4S A;  1HQR D;  2JA8 B;  1K0S A;  1MBY A;  4IZ8 A;  1K0R A;  4KV6 A;  4DV1 Q;  4FDB A;  1E0B A;  3BYY B;  1K28 A;  3F2U A;  3WWV A;  1SEB D;  2ZTD A;  4Q5V A;  4FF1 A;  5KIX A;  1HCZ A;  2AQ3 B;  1EY6 A;  5CC4 A;  3Q0A A;  1EQQ A;  4H02 A;  1LT6 D;  4K5X A;  2F0Q A;  2R93 G;  1FGU A;  1HA6 A;  4LWC A;  3PO2 G;  5FLM G;  1XXG A;  2H5X A;  2SDF A;  3TP5 A;  1UAP A;  3SEB A;  3HOW B;  2F3V A;  3KLS A;  1EY9 A;  1TWF H;  1PH5 A;  5F2D A;  5HUR A;  1QVG A;  2Q2H A;  2FIN B;  1EFI D;  3ULJ A;  4EQP A;  3ERS X;  4DV1 L;  4ULL A;  5CR3 A;  3WOF A;  1V43 A;  3H15 A;  1UWV A;  2FXQ A;  2JN4 A;  2SNS A;  3OMG A;  4DK1 A;  3KJP A;  3Q22 A;  3DWP A;  3S1M B;  2LKV A;  2NTS A;  4G57 A;  3CU7 A;  4HJ8 A;  4H7B A;  3AU7 A;  2HDM A;  5M5Y H;  2ASB A;  3D4W A;  1EEI D;  1UUP A;  1BOS A;  3STB D;  4A3D H;  1KLU D;  1EY7 A;  1IBM Q;  2NVY B;  1EU3 A;  1X65 A;  4OEM B;  3BVZ A;  3CCJ A;  2G9D A;  1PZK D;  2HDL A;  2PQA A;  3S24 A;  4A3E G;  1HFG A;  4IUN A;  1B3A A;  2KJX A;  4JOI C;  3TP7 A;  1HQM C;  3L2P A;  3CC4 A;  1BKB A;  2EYH A;  3M7G A;  4MNO A;  2AQ2 B;  1GUO A;  2XVS A;  4KD4 A;  3HOZ H;  5AFW A;  4ZRZ A;  5C0X J;  1HRJ A;  3CCU A;  1IBM L;  5M5W B;  1WTQ A;  1SYC A;  3QOJ A;  3K7U C;  1MI2 A;  2N88 A;  1JE4 A;  3EVQ A;  1YJ9 A;  2WKC A;  4JI0 Q;  5KGU A;  1M1K C;  1STY A;  4K14 A;  3TBI B;  1KAA A;  1A6X A;  1SXT A;  3PIP A;  4LFA Q;  1BNZ A;  5EBC A;  3NK9 A;  1EOV A;  5CGK A;  2NVX H;  4A3L G;  1XTD A;  1VQL A;  1ZYR D;  3KBG A;  1E22 A;  2WP8 J;  1BO0 A;  4BBR H;  4ZQ3 A;  4WFN 3;  1VQH A;  5CMD A;  4F8M A;  2R7Z G;  1QUQ B;  1C0A A;  1QIL A;  2RA4 A;  3K5O A;  4JI0 L;  2QW7 A;  3PIO A;  1D5Z C;  1WFQ A;  3TZU A;  1B3Q A;  4G7Z C;  5EBD A;  5IYD H;  4LFA L;  1Q82 C;  1NMG A;  2NVT H;  3NTI A;  1ROD A;  2CVR A;  3K5N A;  1YJW A;  1LTA D;  1X3G A;  4C3H G;  5C4X H;  1JJG A;  2EPB A;  1TS2 A;  5FOB B;  1SAP A;  1B9M A;  3K80 C;  3LNN A;  5C4J H;  3OW7 A;  1C4Q A;  1GKH A;  1JCK B;  3M9B A;  3HRZ C;  2KVM A;  1S40 A;  3HKZ G;  2PZW A;  4N9T A;  1VQ7 A;  4BWG B;  5IGE A;  4XQJ A;  5CBE E;  4G7H C;  2K5N A;  2K04 A;  4LF9 Q;  5JOB A;  1EIF A;  2KCN A;  1F2Y A;  1SLJ A;  2ALY B;  2NB0 A;  4QF4 A;  1C8C A;  1FVI A;  1DD2 A;  1WJJ A;  1SYB A;  2ENB A;  1VQM A;  1LTB D;  2RSN A;  3BZK A;  2KHJ A;  1VS0 A;  1K3R A;  2PW5 A;  4IPH A;  3NWT A;  3D6C A;  2A74 C;  1PA6 A;  3D8G A;  3SHL A;  2RSO A;  5HY6 A;  4A3B H;  4M1U B;  1Z9F A;  2R3Z A;  1ZXT A;  2VQE Q;  4A3I H;  3I4N G;  3K6O A;  3VR6 A;  4LF9 L;  1PH3 A;  4KKT A;  2O2L D;  1VDZ A;  2RCF A;  3DUZ A;  1KAB A;  1Q8K A;  2DJG C;  3CP0 A;  1VCI A;  4XYO A;  4JBW A;  2B2U C;  3H0G B;  2Z6B A;  5K36 H;  1JC7 A;  1VQP A;  5M3F B;  1GHK A;  3J80 c;  3HS0 C;  1E24 A;  3UI2 A;  4X62 Q;  2CWP A;  4RH6 A;  3CCE A;  1KDC A;  3KOJ A;  1I3Q B;  2VQE L;  1T5E A;  4BA1 I;  4X66 Q;  2F0O A;  1SFO H;  1I5F A;  4BXX G;  4JCV E;  3DLL A;  1PHJ A;  2PQE A;  2K50 A;  3G48 A;  3V05 A;  5CBA E;  1FYC A;  1D5M C;  4F87 A;  3S1R B;  5EKK A;  2ZXR A;  1TU2 B;  1E2W A;  5FKA C;  4X62 L;  4JI1 Q;  1G29 1;  1IBL Q;  4CJ1 B;  3RN5 A;  3CCM A;  1AW7 A;  1NAP A;  3K7A B;  1PFB A;  5M3M H;  4RWS C;  4X66 L;  4KI0 A;  2PPB C;  2YU9 B;  4DAY A;  3E6Z X;  3HOZ G;  1UE6 A;  1A2T A;  4O0A A;  4UPA A;  1WTP A;  4R4C A;  1NTG A;  4JI1 L;  3GTO H;  1IBL L;  3RLO A;  3NSW A;  1SE8 A;  5IYC H;  4L5T A;  1KHI A;  1CSP A;  4C3J H;  5FO9 B;  1TWA H;  3UDG A;  2ZXO A;  4YCU A;  1YJN A;  5GAD C;  1WTW A;  2B2W A;  2XN9 C;  4WJW A;  3NBH A;  2B2Y A;  1AZP A;  1SYE A;  2EZV A;  2MHV A;  1ASY A;  4LW1 A;  1F2Z A;  3M3Y B;  5E4X A;  1BUV T;  5C5M A;  3T56 B;  1V1Q A;  4KHP Q;  4BBR G;  1OO9 B;  3S14 H;  2E2I H;  1EY0 A;  5T1G A;  4C1N I;  1WCM B;  5DAU A;  1G2T A;  1CZW A;  2RKS A;  3NBI A;  5IYD G;  4FF2 A;  2MNA A;  1KAW A;  1QOH A;  1S5F D;  4XQN A;  1SDF A;  5C3E H;  1K9M C;  4KN7 C;  5A2Q E;  1J8I A;  1CZG A;  3RLF A;  3R3O A;  1S72 A;  3MHB A;  3D0F A;  1CK1 A;  5IY0 A;  4KHP L;  2VNU D;  2JK8 A;  2JA8 H;  1SYG A;  3TDQ A;  2DGY A;  4PMC A;  3GO5 A;  5C3W A;  1PXU A;  4Q0F A;  2RBM A;  3JAM i;  3C3L A;  3ER0 A;  4O1N A;  4J15 A;  1C7Y A;  1D1K A;  1OXU A;  1WVL A;  1SYD A;  3MXU A;  4MTK A;  1YNN C;  1DGS A;  2KHS A;  1LTG D;  4WOR A;  2WV6 D;  4P72 A;  2QDL A;  3N6R A;  4QUF A;  4KY5 A;  4A3D B;  3RLN A;  2KEE A;  2CW0 D;  3EJI A;  3MFG A;  4CKB A;  1JWU D;  2OEO A;  2F0E A;  1AN8 A;  3HFZ B;  1IYU A;  4UHV A;  4I7Z C;  1KQS A;  4A3B G;  1QG7 A;  1PZI D;  2SEB D;  1JJC B;  3VDY A;  3J7A F;  3PUZ A;  3MVV A;  4X3S A;  4A3I G;  3J7Z C;  2M2L A;  4A3C G;  1GUT A;  3CCS A;  4ILW A;  1R4Q B;  2NVY H;  2HQL A;  1Q1E A;  5K36 G;  4C1N K;  4LUZ A;  3PO3 B;  2GVA A;  1PH1 A;  1STH A;  2QF7 A;  3OYY A;  1V1P B;  1KDB A;  1PH9 A;  3NQI A;  1YNJ C;  2F1M A;  2K4K A;  5JPM C;  2LY7 A;  2PNR C;  1II3 A;  1Q86 C;  2DY7 A;  5IGD A;  1BVS A;  2D5D A;  1A0I A;  3HOX B;  1EY5 A;  1WTH A;  3R93 A;  3PUY A;  1O80 A;  1MJE A;  4QQB X;  4FXG C;  3KF6 A;  1NR2 A;  1GVP A;  2BH2 A;  4R8N A;  4JVZ A;  4RKL A;  4A3M B;  3I3C A;  1Q90 A;  4LF8 Q;  1STE A;  3BZC A;  1SSO A;  2ZTC A;  2A19 A;  5C4X B;  1R4P B;  5BN5 A;  5I9P A;  2DN8 A;  2XTI A;  5M3M G;  4TSS A;  2Q2U A;  2F0F A;  4OXP A;  2HIV A;  2B2V C;  1PRT B;  1VMC A;  3I72 A;  1EQR A;  2JYO A;  3TME A;  1QJO A;  1IW7 C;  3AMU A;  4LF8 L;  4L5Q A;  4IUR A;  4IO9 A;  2B2T C;  2K5Q A;  4LJZ C;  3NTH A;  3RNU A;  1EY8 A;  1Y14 B;  3A5Z B;  3KF8 B;  3RZD B;  1N33 L;  1PH7 A;  1B53 A;  2JA6 H;  2RQX A;  4G7O C;  3PCO B;  4AYB G;  4IUU A;  1F9P A;  1Q46 A;  1A15 A;  2XWB B;  1RKN A;  3R2I A;  4R4T A;  4XT3 B;  2MO0 A;  2JJQ A;  5COR A;  3J80 E;  5GRO A;  4POG A;  1FJG Q;  3M4Q A;  3ZYY X;  1QNK A;  2XNA C;  4RAU C;  3T1Y Q;  2ES2 A;  4R8I A;  1S5B D;  2RF4 A;  2K05 A;  1YVC A;  2G9H D;  1P8L A;  4P73 A;  4RCN A;  2BDN A;  3WOE A;  3SK6 A;  5C3E G;  1NY4 A;  2Y0S B;  1DOL A;  4XTC S;  2D0P A;  3S1N B;  3P75 A;  1QZH A;  5JAV A;  2BE5 C;  1AP0 A;  2VQF Q;  2IT1 A;  3J81 j;  1PV4 A;  1SNQ A;  4YCW A;  2B3G A;  2JA8 G;  1QNU A;  4DUZ Q;  1PH2 A;  1I6V C;  5HGQ A;  1FJG L;  3UE0 A;  3T1Y L;  3RUZ A;  4WJ3 M;  1TII D;  3IFD A;  3PUW A;  1KLG D;  1QB5 D;  5C5L A;  1F77 A;  4IJL A;  4OIK A;  4IFD I;  1PRT C;  2AWO A;  3I90 A;  1HUN A;  4KY6 A;  4BBS B;  1EZ6 A;  1FGB D;  2YTX A;  1NNX A;  2QA4 A;  4OX9 Q;  2VQF L;  3H0G H;  2RHS B;  4DV6 Q;  3CCQ A;  5JEA H;  3HOW G;  5M3F H;  4CHT B;  2I5L X;  3MTS A;  4N8X 1;  5IOD A;  2R7D A;  4DUZ L;  4LFC Q;  2F0P A;  4EX5 A;  5FLX c;  2Z6K C;  1N36 Q;  1I3Q H;  3MA2 B;  3GTM B;  1IKL A;  3DM3 A;  1A3U A;  4DV3 Q;  2Q2T A;  3OIQ A;  1MKH A;  1RL2 A;  3ERQ A;  4OX9 L;  3AFP A;  3FKI B;  5FO7 B;  4DV6 L;  2C35 B;  1PVO A;  1SRO A;  4L5S A;  4DV0 Q;  4ID6 A;  3S1R H;  1ICW A;  4LFC L;  3UDX A;  4FYD A;  2TSS A;  3B6Y A;  1N36 L;  4DR2 Q;  2KED A;  5KNC A;  3K7A H;  4DR7 Q;  4OWT B;  1SYF A;  2RDF A;  2C5C A;  2MP1 A;  5M9O A;  2DNC A;  3DWQ A;  4UAI A;  4JOI A;  5BN4 A;  1DJR D;  4C3J B;  4I7A A;  4CKE A;  3GV3 A;  4TKO B;  2E2H B;  4DV3 L;  2GA4 B;  3K81 C;  1PTO B;  2YU9 H;  5BN3 A;  3NEM A;  2FMM A;  3RMH A;  3S1Q B;  2F0U A;  4LNQ A;  1WTV A;  5KEE A;  3BDC A;  3OIP A;  4DV0 L;  1JT8 A;  2B8F A;  4DR2 L;  2HQE A;  1F2L A;  3S14 B;  5L37 A;  5EKL A;  2Z1C A;  5I2Y A;  1WYD A;  2JA7 G;  4DR7 L;  1HPC A;  3PUX A;  5KND A;  1K83 B;  2GN5 A;  4Z9C B;  1J5E Q;  3C1F A;  3IFT A;  4YY3 Q;  3M3Y H;  2A73 B;  3GQB A;  3K58 A;  4KKS A;  4DKA C;  4UDU C;  1WCM H;  1VQA A;  3KDF A;  1L0X B;  5C4H A;  1CKO A;  1VF5 C;  3FMC A;  5T1I A;  2A6E C;  2J0T D;  1D2B A;  4A3G B;  4HIO A;  1Y1W H;  1VQD A;  2N8N A;  2MJ8 A;  4YHH Q;  5EPK A;  1CKM A;  1LYL A;  3T53 B;  1FNU A;  1J5E L;  5I9O A;  1Q12 A;  4ALP A;  4YY3 L;  2EJF C;  4A93 B;  3DEO A;  1V9P A;  3C1E A;  4LFB Q;  1RJT A;  3EN2 A;  4IPD A;  3GTG H;  1XWE A;  1AE2 A;  1ENA A;  4JI4 Q;  2WB1 B;  4EQN A;  4DR6 Q;  3SK5 A;  1PTO C;  3WDN A;  4DV5 Q;  2K14 A;  5FLX L;  1CHQ D;  2B39 A;  4YHH L;  3JAM L;  4CDE C;  2PCF B;  1YIT A;  3I4O A;  5D3D A;  4TQU S;  1HZB A;  3E0E A;  4B9W A;  3QJY A;  3KLR A;  4LFB L;  1YHA A;  4BY7 G;  4IOA A;  2K01 A;  1D5X C;  1KNA A;  4BY1 B;  3FEW X;  4ZUJ A;  1X3F A;  2DY8 A;  4K6L A;  1GD7 A;  1UNS A;  3Q6S A;  2WII B;  5IP9 H;  2F3W A;  4JI4 L;  4DR6 L;  4DV5 L;  2JEA I;  4GS3 A;  1BXT A;  4HID A;  1H9J A;  2D9U A;  1TXY A;  3CCL A;  2MGS A;  2EIF A;  1FNV A;  2WAQ B;  2IHE A;  4ODG A;  4K0K Q;  1CKN A;  2K5H A;  2A68 C;  1RF2 D;  3H0G G;  3VYS A;  1A3V A;  3S9W A;  1LUZ A;  2XIW A;  3PO3 H;  1JR0 D;  5M3F G;  4NXM Q;  3SR1 A;  4L6T B;  1PYB A;  2HCC A;  5C4Z A;  4M8A A;  1M4V A;  3I73 A;  2ZM6 Q;  4OWX B;  4PMB A;  3HOX H;  2WAC A;  3M4O B;  3J7A 5;  5ELN A;  4JBJ A;  2LMC B;  2B63 B;  3BS1 A;  4K0K L;  1IHZ A;  3D4R A;  2L1B A;  2Q8R E;  3FVQ A;  5AJ3 Q;  4JI6 Q;  3PUV A;  2PMZ B;  1TY2 A;  3ICE A;  1MSG A;  1N8R C;  4KJO A;  3H3V I;  4NXM L;  4IQZ A;  1BCP F;  2VB2 X;  1EWI A;  4HSV A;  4DAM A;  1GOZ A;  3OSO A;  3GD7 A;  4A3M H;  2DNE A;  1EFW A;  3S15 B;  1X55 A;  3HOY H;  4DK6 C;  1S4Z A;  2EYM A;  2ZM6 L;  2EYJ A;  4A3K B;  4ABN A;  3M4P A;  3W1G A;  3U9S A;  3TS2 A;  2PQA B;  3FDT A;  1BR9 A;  3BVM A;  3OWF A;  4C3I B;  4NB3 A;  1O7Z A;  1Y8P B;  3L7Z C;  5AJ3 L;  4JI6 L;  4NXN Q;  4LAA A;  2JA6 B;  3P20 A;  1ZEQ X;  2BCO A;  1TWG B;  2E2J B;  1YEZ A;  5KRU A;  3J7A V;  3U58 A;  4DN4 M;  4DR5 Q;  2QGQ A;  3VYU A;  4NP5 A;  5C0X I;  4IPC A;  4A4I A;  3S17 B;  5E3F A;  1FR3 A;  4QIW B;  1A3T A;  2VUM G;  1L0W A;  3RZD H;  1JMC A;  2KCC A;  5I2X A;  3QR8 A;  1L1O A;  2F0D A;  4IUP A;  3CW2 C;  4NXN L;  1W6K A;  4X3U A;  1UEA B;  2KQ3 A;  4NMZ A;  3TRZ A;  3I4L A;  4DXG A;  4PMW A;  4HN7 A;  1PH6 A;  4DR5 L;  1K8G A;  5FLX E;  1WCM G;  4DA2 A;  3BVG A;  2QCP X;  1WD0 A;  1VF7 A;  2CH4 A;  3HP3 A;  5K5P A;  4OL7 A;  5A35 A;  5DM6 3;  2Q8I B;  1X54 A;  2Y0S E;  1Y8O B;  2AWN A;  1XX8 A;  1HZC A;  2OTJ A;  1W2B A;  2Q8T A;  2ICI A;  3JC6 6;  4O42 A;  4E6I A;  3HGB A;  3S1N H;  2K03 A;  5J3B A;  3CHB D;  4OWW B;  4LUV A;  1O7I A;  3CF5 A;  5LHY 1;  1LTT D;  2L15 A;  4JV5 Q;  3FHW A;  3OTO Q;  4A3E B;  5IOC A;  3OMC A;  4JI5 Q;  3U4Z A;  4R4O A;  3W1B A;  4FF3 A;  2EQS A;  2M00 A;  5EAY A;  5IGB A;  3D6W A;  1H9S A;  2Q2I A;  2EYL A;  2E8G A;  1EOT A;  4BBS H;  1NCV A;  4LK1 C;  4DGZ A;  1Q8I A;  1OTC A;  1RDP D;  2NZO A;  4CGY B;  3TP8 A;  4A3D G;  3E9H A;  4RKB A;  4JV5 L;  3OTO L;  4P71 A;  4RGT A;  2PI2 E;  4AQY Q;  1KNE A;  4JI5 L;  5IP9 G;  4OHJ A;  4PG3 A;  3GTM H;  4K5V A;  1B9N A;  2F0L A;  4MN3 A;  3F2C A;  5IGF A;  2V1C C;  4B3R Q;  4GN4 B;  1I4R A;  1AFP A;  3T13 A;  2ZJQ A;  2AQ1 B;  2F0J A;  3GTQ B;  5CV9 A;  1MD2 D;  1VQ8 A;  1ASZ A;  1T5X D;  3FKI H;  4KHV A;  1KD1 C;  1EUJ A;  1UEB A;  4C2M B;  3S16 B;  2R7Z B;  2Z4H A;  3X3M A;  2PZT A;  1ENF A;  4OO1 I;  4AQY L;  3TZD A;  2PNH A;  1DXM A;  3NTK A;  3PO3 G;  2LFN A;  1SE3 A;  1BBW A;  1JOR A;  4B3R L;  2K75 A;  2B8G A;  2AKW B;  4R1J A;  3FPU B;  2ZJP A;  1HR0 W;  2E2H H;  2RCN A;  2TMP A;  1TS5 A;  1PTO H;  3HOX G;  1D1I A;  5IGG A;  1M8A A;  3S1Q H;  3HKS A;  2NVQ B;  4CJ2 C;  1Y1V B;  3CPW A;  3T4A C;  1HR0 Q;  3HKZ B;  4LF6 Q;  5ELE A;  3KFU A;  2PW7 A;  3EA6 A;  2EJG C;  1IBK Q;  1BQQ T;  5IT9 L;  4KMU C;  2IX0 A;  4A3M G;  4ZLT F;  1EL0 A;  1RCV D;  2NBF A;  1K83 H;  1MGS A;  2IX1 A;  2NZH A;  1B44 D;  1Y1W B;  1U4P A;  4QUC A;  1WD1 A;  5C4X G;  4CDC C;  3K5L A;  1TKW B;  1XPR A;  3KBX A;  1C48 A;  1HR0 L;  4LF6 L;  2NYZ D;  4HSP A;  2B2V A;  4K8I A;  1D6E C;  4U67 3;  2K32 A;  3SK4 A;  3GTG B;  3H94 A;  3K5M A;  2A69 D;  1IBK L;  2F52 A;  2KOL A;  4A3G H;  2JSO A;  1JWS D;  4ZAI A;  5I4D A;  2FJ2 A;  4IUQ A;  3IKJ A;  2XSC A;  4MIU A;  4C56 C;  1C9O A;  3N52 A;  2KBN A;  1K73 C;  2I46 A;  2EYF A;  4KLK A;  4A93 H;  2OCE A;  3LGJ A;  4EQ5 A;  4GN3 B;  1YHB A;  4LF5 Q;  4APV A;  1VQI A;  5HGT A;  1V1P A;  3MEF A;  5IP7 H;  1IKM A;  2C9O A;  1EIH A;  2N78 A;  2WB1 E;  5ISR A;  1CUK A;  1W3S A;  1ESR A;  3SXH A;  3QB3 A;  4PV1 C;  3TQY A;  3U50 C;  1D8L A;  3GTL H;  1RHP A;  4YIJ A;  3SDZ A;  5J39 A;  3H6M A;  2MPM A;  1EIG A;  1TR5 A;  3J7Y W;  4JPB W;  2UUB Q;  2WFW A;  2MFI A;  4HJ9 A;  2NZ1 D;  3U9O A;  1LT5 D;  1K3B C;  2KCM A;  4LF5 L;  2HIX A;  3CCR A;  3HOV B;  1TWH H;  4JI8 Q;  1I4Q A;  5LL6 S;  2KEN A;  4BY1 H;  4XIG S;  1YNJ D;  2CH4 W;  4LUO A;  3NXW A;  2QDB A;  1G8Z D;  2V4D A;  2D2C C;  5LL6 X;  3G6J B;  3UDF A;  5LMU Q;  1P16 A;  2UUB L;  4HJ7 A;  2WIN B;  1Y8N B;  1ET6 A;  4LF7 Q;  2WAQ E;  2ZTE A;  3Q8D A;  4JBM A;  1WTX A;  3R2T A;  3Q23 A;  2UXD Q;  2JXM B;  1VMP A;  4QY7 A;  3NWS A;  4BBS G;  4GOP A;  3E5S A;  4JI8 L;  4RFB A;  1VQE A;  1IL2 A;  2UUA Q;  2MUY A;  3GTJ H;  4RGN A;  3CRL C;  3QG1 A;  2Z6K A;  1B1Z A;  3CRK C;  3KF8 A;  1PH8 A;  1LV9 A;  1V1O A;  5C3X A;  4F88 A;  2VZA A;  5LMU L;  4LF7 L;  2R92 H;  3HOY B;  3M4O H;  2B2W C;  4B3S Q;  2J7Z A;  1HXY D;  2B63 H;  2UXD L;  5DNF A;  1X9N A;  2B2Y C;  3K0Y A;  1TWC B;  1N34 Q;  1X6O A;  3L0O A;  1J9O A;  2NN6 I;  1SR3 A;  2PMZ E;  2ZT9 C;  3HEJ A;  3FKI G;  1VQC A;  1SN8 A;  3T51 B;  1M90 C;  2NUC A;  5IT9 E;  3A8K E;  2FHT A;  4ZYS A;  3S15 H;  1HTP A;  4K8J A;  5CYU A;  4A3K H;  5ELO A;  1JIC A;  4L8J A;  5IYC G;  2HD3 A;  2LXJ A;  4B3S L;  4GN5 A;  2E2D C;  2CHB D;  4C3J G;  1GJX A;  1U4M A;  4C3I H;  2RDH A;  2XWJ B;  2YV5 A;  4J8Q A;  5JPN C;  1N34 L;  3TN2 A;  2JA5 B;  4DNR B;  1XMO Q;  4DU9 A;  1TWG H;  1IL8 A;  5J1Z A;  2E2J H;  2K5D A;  3L3O C;  4R4I A;  1JWM D;  2K5V A;  1GUS A;  1U4L A;  4QIW E;  3S17 H;  1NBW A;  1VQ6 A;  4FP5 D;  1A62 A;  1GHJ A;  1Q1B A;  1HJP A;  3KF6 B;  2EY6 A;  2BE5 D;  2EE1 A;  2F0T A;  2I07 B;  2R93 H;  4GNX B;  3CC7 A;  2AMC B;  3U4V A;  2R7F A;  4PZ8 A;  1G6Z A;  1XMO L;  3DM1 A;  5EPJ A;  2A8V A;  4A3J B;  5C44 B;  1K8A C;  5TSS A;  3Q24 A;  3LWE A;  4QGU A;  1A2U A;  1OXV A;  3SGI A;  3VR2 A;  3RN2 A;  2XGT A;  1O78 A;  2BOS A;  4J6H A;  2K28 A;  1BCP D;  1NMF A;  2O4X A;  1UE1 A;  2K6A A;  4OEL B;  1LTR D;  1CM9 A;  2N3S A;  3URY A;  2K5W A;  2MO1 A;  1F9Q A;  2RHQ B;  4V0B A;  3J81 i;  1XNR Q;  2IY5 B;  4A93 G;  2CQA A;  1KRT A;  2IL8 A;  2E74 C;  3QWN A;  4AIM A;  2F0M A;  3HOU B;  2K52 A;  1SMY C;  1SNC A;  3MXP A;  2IJ0 A;  3PIO 3;  4A3E H;  4LF4 Q;  5FK9 C;  1N32 Q;  4GLA C;  4A3F B;  4UY8 C;  3BJU A;  4NPS A;  3JAM c;  1LTS D;  1B2T A;  5IYB H;  4JYA Q;  3S2D B;  1OXS C;  1F9S A;  3W2D A;  2A5H A;  2OQK A;  1G6P A;  2AUK A;  3E0J A;  5BR8 Q;  1XNR L;  4DK3 C;  2CFM A;  5G3L D;  1I6H B;  1QWY A;  5E4W C;  3A55 A;  1CQF A;  4JW0 A;  5EPL A;  1H9K A;  4LF4 L;  1VQG A;  4BY1 G;  1D7Q A;  1N32 L;  4GNX C;  3D3R A;  2PYK A;  4IJH A;  1R9T H;  4OO1 H;  3F1Z A;  4BA2 I;  4JYA L;  4RHR A;  3ERO A;  3RZO B;  1U5K A;  3GTQ H;  3MFY A;  2A6H C;  2L9H A;  3CMA A;  5BR8 L;  2WAQ G;  3OOC A;  4C2M H;  1SRU A;  1VQK A;  3C46 A;  2ATW A;  4DK0 A;  4HJ5 A;  3CAM A;  3S16 H;  2R7Z H;  1MIU A;  2KA7 A;  4JI2 Q;  4HJA A;  4K2L A;  4IFD G;  3M4Y A;  3AQQ A;  4KN4 C;  4RA8 A;  3PMF A;  3CD6 A;  2BA0 A;  4I65 A;  3A7L A;  5ELD A;  3EBE A;  3LWU A;  1LO5 D;  4CKC A;  2UXC Q;  1I4H A;  3MXN B;  4UP9 A;  4F7X A;  2G5D A;  4V19 0;  1CFM A;  1B70 B;  2RDG A;  3E3X A;  1N9W A;  4IPG A;  1DCZ A;  3V96 A;  2JE6 I;  3BG3 A;  1L2F A;  3I7F A;  2E76 C;  4DV4 Q;  2B63 G;  2NVQ H;  2N55 A;  2CQO A;  4DUY Q;  3HKZ E;  1CSQ A;  4JI2 L;  1Y1V H;  4AYB B;  3A54 A;  4HCE A;  3A56 A;  3A8I E;  2PZU A;  4K6D A;  4HIM A;  1DOK A;  2A6E D;  5GQO A;  1WTR A;  2UXC L;  4JBK A;  4DAV A;  4GLX A;  2VXW A;  4IAL A;  4KK7 A;  1W6J A;  3BU2 A;  2XRQ D;  5ELC A;  1ESF A;  2J4X A;  4A3K G;  4ZK9 B;  1X3Q A;  5M5X B;  1H9R A;  4DV4 L;  1UE7 A;  1S5C D;  4C3I G;  5IIF A;  4DUY L;  3I4M B;  4NKL A;  1MSH A;  3I55 A;  5CV4 A;  3TP6 A;  4EVO A;  1KDA A;  2L11 A;  1PTO D;  4PZ7 A;  2JA6 G;  2Z9H A;  1CTM A;  3J80 i;  4POF A;  3NP8 A;  4YCV A;  1PFS A;  2MQH A;  1LLR D;  3I4N H;  1XTC D;  5DM7 3;  4U68 A;  4CJ0 B;  3GTL B;  1LM0 A;  3MZ5 A;  1LAC A;  3RD4 A;  4GKK Q;  1LTI D;  1STB A;  1AZQ A;  4A76 A;  2AUJ D;  3DEP A;  2F0W A;  1CA6 A;  3BDL A;  2HHH Q;  2VB3 X;  2UXB Q;  1IZ6 A;  3S2H B;  3I70 A;  2M9V A;  1TWH B;  2CKZ B;  1K8M A;  1EY4 A;  2EJM A;  3HZX A;  3BDO A;  4YWM A;  3ND8 A;  1WI5 A;  3KDF B;  1A63 A;  4DR3 Q;  3VA5 A;  2A68 D;  4GKK L;  4BXX H;  1BDO A;  2EXD A;  1QUQ A;  2FFK B;  4ME5 A;  2R6G A;  2HCI A;  4MZ9 A;  2HHH L;  3HOV H;  1BBX C;  4GKJ Q;  2UXB L;  3P7J A;  1KXL A;  1KL9 A;  3VR3 A;  1DM0 B;  2KCT A;  2B2U A;  1GUN A;  1XYI A;  3D4D A;  5JEA G;  3A0J A;  4AH6 A;  1YI2 A;  3PGZ A;  3STB C;  3GTJ B;  1I4P A;  3PF5 A;  1XPO A;  2P5Z X;  4DR3 L;  5GAH C;  2F0I A;  5I6Y A;  2EXZ A;  4HED A;  3OPO A;  4H44 C;  4K5W A;  4S3S A;  5IYB G;  2F0H A;  1HZA A;  4Y7N H;  5CV6 A;  2R92 B;  3NPP A;  3G71 A;  3TS0 A;  1VQB A;  3T1H Q;  2IPK D;  3GP7 A;  3FRP B;  3OHX C;  3P1H A;  4GKJ L;  1HNX Q;  4X65 Q;  2IX3 A;  1MHW C;  3J81 c;  5KNB A;  4PNY A;  2NN6 H;  1VQ4 A;  4JC0 A;  4P74 A;  4A75 A;  1HFN A;  1X32 A;  2N49 A;  1PRT F;  2JA7 B;  4GLV B;  1I50 B;  1EQV A;  1FD7 D;  4OO1 G;  1TS3 A;  3W3A A;  3MEH A;  3CCV A;  4G4K A;  1TWC H;  1E3P A;  3NEL A;  3T1H L;  1AEX A;  1PZJ D;  1SMX A;  1HNX L;  2GVB A;  4X65 L;  1U9R A;  4YWL A;  1ZYR C;  5FJ8 H;  4RGO S;  5COY A;  1CKN B;  4DAP A;  3GDE A;  2OTL A;  4X3T A;  1RD9 D;  4HIK A;  3G6E A;  1EZ8 A;  1TY0 A;  4FXK C;  4IUV A;  5JJZ A;  2I5M X;  4N8F A;  4QMG A;  1B50 A;  4FO2 A;  3E9I A;  2R93 B;  3SE0 A;  2JA5 H;  5G3L F;  3PO2 B;  4HMJ A;  2O5I C;  1PMR A;  1X3P A;  2VW9 A;  2K7V A;  1PFN A;  1Y1V G;  3CQZ B;  3QO2 A;  3H3V C;  5IT9 c;  4B9X A;  1TT2 A;  1EYC A;  3QOL A;  3EIV A;  1IXR A;  1PYW D;  4EQO A;  5EQ0 A;  1EYG A;  5JEA J;  5JVG 3;  3JAM E;  1DON A;  1SNP A;  2IW3 A;  4OGQ C;  4YWK A;  2F0S A;  1EIY B;  1Y1W G;  4RG1 A;  4KJN A;  5A2Q L;  3I91 A;  4K2K A;  4QCL A;  1SJE D;  4BY7 B;  4A3J H;  1X56 A;  4IFD H;  1ET9 A;  5C44 H;  2VL6 A;  4UP8 A;  2I0Q A;  3H09 A;  1E7Z A;  2KEC A;  4H13 C;  4X6A H;  2IWH A;  3VA7 A;  1SE2 A;  1XNQ Q;  1T9H A;  1KIX A;  3CME A;  3DXJ C;  1YIJ A;  1O7L A;  4HCS A;  4JI7 Q;  1RTO A;  5CV7 A;  4A3C H;  2K1B A;  1PFM A;  1I94 Q;  1HUM A;  3HOU H;  1KRS A;  1E2V A;  4XT1 B;  1L1O B;  1DOM A;  3BYT B;  5DLQ E;  3J81 L;  4QB4 A;  2PO4 A;  4A3F H;  1XNQ L;  1BBU A;  3CPF A;  1S3O A;  3IRB A;  1R9T B;  2H1E A;  4JI7 L;  3S2D H;  2BA1 A;  2I5H A;  2EVB A;  2SOB A;  3KJO A;  1QZG A;  2F4V Q;  3GTK B;  1U4R A;  1JB3 A;  4X64 Q;  1I94 L;  1I6H H;  2EY5 A;  2L5T A;  5GAG C;  1PTO F;  1VQJ A;  2KHI A;  3HOV G;  1X3E A;  1VQ5 A;  4QL5 A;  1SNO A;  1STG A;  2QEJ C;  4WJ4 A;  1LT3 D;  5J22 A;  3FPP A;  1DZ1 A;  1STA A;  2UU9 Q;  2QKI C;  2X6G A;  2YTY A;  4ZCK A;  2CWA A;  2SNM A;  4C3H B;  1NSN S;  4B08 A;  3RZO H;  1PYS B;  1B8A A;  2F4V L;  1HH2 P;  5JJK A;  1JQY D;  2LXK A;  4X64 L;  3MAQ A;  1CA5 A;  3F2B A;  5KYI A;  1SBB B;  1H9S B;  2ZXP A;  3NQT A;  5IGC A;  4ME3 A;  1JE5 A;  3PV0 A;  2HT1 A;  4KHZ A;  2Z8L A;  4J1M A;  2F0N A;  3ZJY C;  3GTP B;  2NN6 G;  2CCZ A;  3KUP A;  1ENC A;  4B3T Q;  2EYP A;  2UU9 L;  4RGM A;  1Q3L A;  3T16 A;  2NWG A;  2VUM B;  1GXD C;  3HOY G;  2VY3 A;  1L1O C;  4IUT A;  4AYB E;  3CXC A;  2X69 A;  1OXT A;  3X3N A;  4DNT B;  3I8Z A;  1KTK A;  1AH9 A;  3A8J E;  2QIL A;  3AB9 A;  5FJ8 G;  4B3T L;  4RMF A;  3HG9 A;  1RTN A;  4DAY B;  1TQO A;  2JQO A;  1OXX K;  4DF7 A;  1JJ2 A;  4HTH A;  2OWO A;  3I4N B;  4NDX A;  5M5X H;  3M85 A;  1YNN D;  2B2T A;  5H1S E;  4R4Q A;  2KUM A;  4MHE A;  4LMQ D;  2UUC Q;  3I4M H;  2AHO B;  4N9P A;  2FMC A;  3A74 A;  1NR4 A;  1HHV A;  3MXG A;  2JA5 G;  5E1F A;  1B7Y B;  1XMQ Q;  2EYO A;  4KTA A;  4UP7 A;  2OT2 A;  3NBH B;  1TWF B;  4FNF A;  5IE8 A;  3EFX D;  4HAE A;  3C2P A;  1JOK A;  1PH4 A;  5JJL A;  2K33 A;  3R8B A;  4CBV A;  3J80 L;  2A69 C;  2EY2 A;  3K57 A;  2UUC L;  1ICF B;  5EKI A;  4BS9 A;  1DYQ A;  1GM5 A;  2L12 A;  3ULP A;  2Y0S G;  4XYQ A;  5IWA Q;  3HOW H;  3J81 E;  1XMQ L;  3S2H H;  5M5Y B;  1LAB A;  1E2Z A;  3DWA A;  3GV6 A;  4OON A; 
#chains in the Genus database with same CATH homology
 2K52 A;  5C44 G;  1VQP A;  1X3F A;  4A3E H;  3J80 c;  4LF4 Q;  1GD7 A;  1E24 A;  2YYZ A;  5IP9 H;  4JI4 L;  2DUD A;  4X62 Q;  1N32 Q;  2CWP A;  4GLA C;  4DR6 L;  1HNW Q;  3FP9 A;  4UY8 C;  2F3I A;  4DV5 L;  3CCE A;  3BJU A;  3KOJ A;  4NPS A;  3JAM c;  2VQE L;  2JEA I;  4GS3 A;  3S1M H;  5IYB H;  4BA1 I;  4JYA Q;  1H95 A;  4HID A;  1OXS C;  1J6Q A;  1TXY A;  2OQK A;  3CCL A;  1G6P A;  1E1O A;  2EIF A;  4X66 Q;  2E5L Q;  1A8V A;  1SFO H;  1I5F A;  2IHE A;  5BR8 Q;  5IWA L;  4JI3 Q;  4K0K Q;  2IY5 B;  4BXX G;  1CKN A;  2K5H A;  2CFM A;  4JCV E;  4DK3 C;  3DLL A;  1PHJ A;  1XNR L;  2K50 A;  2YTV A;  3F8T A;  3G48 A;  3H0G G;  3HOU G;  1LUZ A;  4LF4 L;  3PO3 H;  1VQG A;  4BY1 G;  5M3F G;  1D7Q A;  4NXM Q;  4X62 L;  1N32 L;  4JI1 Q;  1PYB A;  1G29 1;  4GNX C;  1IBL Q;  4IJH A;  1HNW L;  1R9T H;  3RN5 A;  3CCM A;  3F1Z A;  3A5U A;  3H3V H;  4A3F G;  4L5R C;  4BA2 I;  4JYA L;  2ZM6 Q;  4OWX B;  3HOX H;  1GO3 E;  1U5K A;  3J7A 5;  5M3M H;  4X66 L;  2E5L L;  3GTQ H;  5ELN A;  4JBJ A;  1RIP A;  1FL0 A;  4KI0 A;  3CMA A;  4JI3 L;  5BR8 L;  2WAQ G;  1VQK A;  4C2M H;  1SRU A;  3S16 H;  2ATW A;  4K0K L;  4HJ5 A;  3CAM A;  2R7Z H;  5M5W H;  1MIU A;  4JG2 A;  4JI2 Q;  4HJA A;  4IOC A;  1YHQ A;  3HOZ G;  1UE6 A;  5AJ3 Q;  4JI6 Q;  3PUV A;  4O0A A;  4UPA A;  3AQQ A;  4R4C A;  4DV2 Q;  3ICE A;  1N8R C;  1NTG A;  1YNX A;  2UUA L;  3H3V I;  4NXM L;  3CD6 A;  2BA0 A;  1EWI A;  3EBE A;  4JI1 L;  4DAM A;  1IBL L;  3RLO A;  2JA7 H;  1SE8 A;  4A3M H;  3GD7 A;  1I50 H;  3MXN B;  4UP9 A;  3UDI A;  5IYC H;  4GNX A;  1EFW A;  1X55 A;  2A1A A;  3HOY H;  4DK6 C;  4L5T A;  2D0O A;  2ZM6 L;  1KHI A;  1CSP A;  4C3J H;  1B70 B;  1TWA H;  1N9W A;  1MJC A;  4IPG A;  3UDG A;  3M4P A;  3W1G A;  2JE6 I;  4YCU A;  3TS2 A;  1YJN A;  2PQA B;  1L2F A;  5GAD C;  1YBY A;  3I7F A;  1U0L A;  1NE3 A;  1N33 Q;  3CC2 A;  4NB3 A;  4DV4 Q;  3KLW A;  2B63 G;  2CQO A;  2NVQ H;  4DUY Q;  3HKZ E;  1CSQ A;  4JI2 L;  1ASY A;  1Y1V H;  1YZ6 A;  3L7Z C;  4LW1 A;  5AJ3 L;  4JI6 L;  4NXN Q;  4DV2 L;  4O2D A;  4HIM A;  1V1Q A;  4KHP Q;  4BBR G;  1YEZ A;  5GQO A;  3S14 H;  2E2I H;  4GOP B;  3U58 A;  4DR5 Q;  2UXC L;  4IFD J;  2QGQ A;  4JBK A;  4GLX A;  5C0X I;  5IYD G;  2ZJR A;  3BU2 A;  4IPC A;  4A4I A;  2MNA A;  1KAW A;  5C3E H;  4A3K G;  1K9M C;  2VUM G;  1L0W A;  3RZD H;  1JMC A;  3AEV A;  1L1O A;  4DV4 L;  3PO2 H;  1UE7 A;  3RLF A;  5FLM H;  1HNZ Q;  4DUY L;  1S72 A;  3I55 A;  3CW2 C;  4NXN L;  3D0F A;  3K8A A;  3CQZ H;  5IY0 A;  1VQ9 A;  4KHP L;  2JK8 A;  1WOC A;  2JA8 H;  1Z47 A;  3TRZ A;  2VNU D;  4PZ7 A;  2JA6 G;  2DGY A;  3K0X A;  3J80 i;  3GO5 A;  2PI2 A;  4PMW A;  1PH6 A;  4POF A;  4DR5 L;  1K8G A;  4PZ6 A;  4YCV A;  1PFS A;  1WCM G;  2MQH A;  3ULL A;  4TVA B;  3JAM i;  3TRE A;  3I4N H;  3ER0 A;  3D31 A;  4J15 A;  1HZ9 A;  1LM0 A;  4B3M Q;  4A3G G;  1X54 A;  1C7Y A;  2Y0S E;  2AWN A;  1HZC A;  4GKK Q;  1IYJ B;  2OTJ A;  1OXU A;  4QJF A;  4A76 A;  1W2B A;  3JC6 6;  1HNZ L;  4BY7 H;  3S1N H;  3I4M G;  3TEH B;  1DGS A;  5J3B A;  2HHH Q;  1VQO A;  2UXB Q;  4OWW B;  1IZ6 A;  4P72 A;  4LUV A;  1O7I A;  1AE3 A;  3CF5 A;  1NJI C;  2CKZ B;  3RLN A;  5IP7 G;  2L15 A;  4JV5 Q;  3FHW A;  3OTO Q;  4YWM A;  4JI5 Q;  3U4Z A;  4R4O A;  1WI5 A;  3W1B A;  3HFZ B;  2WB1 G;  3KDF B;  5JJI A;  2EQS A;  1KQS A;  3GTO H;  4A3B G;  1A63 A;  5EAY A;  4DR3 Q;  4B3M L;  3I56 A;  1JJC B;  4DV7 Q;  2Q2I A;  3PUZ A;  3VDY A;  2Z0S A;  4A3I G;  4DPG A;  4GKK L;  1LTL A;  2E8G A;  3J7Z C;  4BXX H;  2JEB I;  4BBS H;  2EXD A;  2OQ0 A;  4GOP C;  1QUQ A;  2R6G A;  4A3C G;  4MZ9 A;  2HHH L;  1KXL A;  3HOV H;  4GKJ Q;  2UXB L;  1KL9 A;  3CCS A;  2KCT A;  1OTC A;  2NVY H;  5LMN W;  2NZO A;  2HQL A;  1Q1E A;  5JEA G;  3A0J A;  4A3D G;  3E9H A;  5K36 G;  4LUZ A;  3F2D A;  4DR4 Q;  3OTO L;  4AH6 A;  4P71 A;  1YI2 A;  4JV5 L;  2GVA A;  3PGZ A;  1VQF A;  2PI2 E;  3STB C;  4AQY Q;  1PH1 A;  4JI5 L;  3I2Z A;  3NEN A;  5IP9 G;  4PG3 A;  3OYY A;  3PF5 A;  1XPO A;  1Q81 C;  3GTM H;  1PH9 A;  2K4K A;  3F2C A;  4DR3 L;  2V1C C;  5GAH C;  4B3R Q;  4DV7 L;  4GN4 B;  5LMN Q;  3PF4 A;  1Q86 C;  4A3L H;  3GTK H;  5IYB G;  1BVS A;  2ZJQ A;  4Y7N H;  1HZA A;  1A0I A;  3G71 A;  3TS0 A;  1VQB A;  3T1H Q;  2UXC Q;  1VQ8 A;  1ASZ A;  3FKI H;  3PSI A;  4GKJ L;  1HNX Q;  3PUY A;  1KD1 C;  1EUJ A;  1UEB A;  4P75 A;  4X65 Q;  3J81 c;  2B29 A;  5E7N A;  1QVC A;  1E1T A;  1MJE A;  1VQN A;  1VQ4 A;  3W5O A;  4JC0 A;  4QQB X;  4DR4 L;  5GAE C;  4OO1 I;  4P74 A;  4A75 A;  4AQY L;  1QVF A;  3KF6 A;  2PNH A;  3PO3 G;  3RR5 A;  1GVP A;  2N49 A;  2BH2 A;  3OW2 A;  4GLV B;  1BBW A;  3M7N A;  4C3H H;  4LF8 Q;  4B3R L;  2K75 A;  4OO1 G;  2JA9 A;  3BZC A;  2AKW B;  4R1J A;  5LMN L;  2ZJP A;  4DR1 Q;  2ZTC A;  1HR0 W;  2E2H H;  2RCN A;  3CCV A;  2A19 A;  1TWC H;  1E3P A;  3NEL A;  3T1H L;  3HOX G;  2R92 G;  5M3M G;  3AFQ A;  2XTI A;  1SMX A;  2QEX A;  2Q2U A;  2ID0 A;  1HNX L;  2GVB A;  1KC8 C;  3HKS A;  3S1Q H;  4X65 L;  4OXP A;  2HIV A;  3KYH C;  1XJV A;  4YWL A;  3CPW A;  3AYH B;  1HR0 Q;  5FJ8 H;  4LF6 Q;  3GTP H;  1XPU A;  4Y52 H;  1CKN B;  3KFU A;  1EQR A;  3GDE A;  3UE1 A;  2OTL A;  1IBK Q;  1Q7Y C;  2IX0 A;  2VUM H;  4LF8 L;  4HIK A;  4L5Q A;  3G6E A;  4A3M G;  4IO9 A;  1K83 H;  2D62 A;  2IX1 A;  2NZH A;  4DNI A;  4DR1 L;  2LSS A;  2I5M X;  3RNU A;  1G51 A;  2VS1 A;  1Y14 B;  3A5Z B;  3KF8 B;  5C0X G;  2IHF A;  5C4X G;  3E9I A;  2JA5 H;  1N33 L;  2BH8 A;  1UE5 A;  1PH7 A;  1XPR A;  1JB7 A;  2JA6 H;  2VW9 A;  4MTN A;  3PCO B;  3G4S A;  1HR0 L;  4AYB G;  4LF6 L;  1Y1V G;  1Q46 A;  4R4T A;  5IT9 c;  2MO0 A;  2JJQ A;  1K0R A;  3EIV A;  1IBK L;  2F52 A;  5GRO A;  4POG A;  1IXR A;  4DV1 Q;  4FDB A;  1FJG Q;  3M4Q A;  1EYG A;  5JEA J;  3WWV A;  3T1Y Q;  4A3G H;  2ES2 A;  2RF4 A;  1YVC A;  1P8L A;  2ZTD A;  1C9O A;  4P73 A;  4YWK A;  2KBN A;  1EIY B;  1K73 C;  5C3E G;  1Y1W G;  1EQQ A;  1NY4 A;  4H02 A;  4RG1 A;  2R93 G;  1FGU A;  4KLK A;  4A93 H;  2OCE A;  3LGJ A;  4XTC S;  2D0P A;  4EQ5 A;  4LWC A;  3PO2 G;  4A3J H;  1X56 A;  1YHB A;  4GN3 B;  5FLM G;  1QZH A;  4LF5 Q;  4APV A;  1VQI A;  2H5X A;  5C44 H;  2VQF Q;  2VL6 A;  4UP8 A;  2IT1 A;  3J81 j;  2I0Q A;  1TWF H;  3MEF A;  5IP7 H;  1PV4 A;  4YCW A;  1PH5 A;  2B3G A;  1QVG A;  2Q2H A;  2JA8 G;  2N78 A;  2WB1 E;  1E7Z A;  3ULJ A;  4DUZ Q;  1PH2 A;  1CUK A;  3ERS X;  4DV1 L;  5HGQ A;  1W3S A;  1FJG L;  4X6A H;  3UE0 A;  3TQY A;  3T1Y L;  4WJ3 M;  3U50 C;  1XNQ Q;  1T9H A;  1D8L A;  1KIX A;  3CME A;  3GTL H;  1V43 A;  3H15 A;  1UWV A;  2FXQ A;  3KJP A;  1YIJ A;  4JI7 Q;  3PUW A;  2UUB Q;  2WFW A;  4A3C H;  2MFI A;  4IJL A;  4IFD I;  4HJ9 A;  2AWO A;  4HJ8 A;  2KCM A;  2YTX A;  2QA4 A;  5M5Y H;  1I94 Q;  4OX9 Q;  4LF5 L;  2HIX A;  2ASB A;  2VQF L;  3H0G H;  2RHS B;  3CCR A;  4DV6 Q;  3STB D;  3CCQ A;  1KRS A;  3HOU H;  1TWH H;  4JI8 Q;  4A3D H;  1L1O B;  3HOW G;  2KEN A;  1IBM Q;  5M3F H;  5DLQ E;  2I5L X;  4XIG S;  4BY1 H;  4DUZ L;  2R7D A;  4LFC Q;  4LUO A;  1X65 A;  4EX5 A;  5FLX c;  2Z6K C;  4A3F H;  1N36 Q;  3CCJ A;  1XNQ L;  1BBU A;  3CPF A;  1I3Q H;  2PQA A;  3S24 A;  4A3E G;  3UDF A;  1S3O A;  3IRB A;  3S2D H;  4JI7 L;  5LMU Q;  4JOI C;  1P16 A;  3L2P A;  4HJ7 A;  2UUB L;  3CC4 A;  2BA1 A;  2I5H A;  4LF7 Q;  1BKB A;  2WAQ E;  3KJO A;  1QZG A;  2ZTE A;  3Q8D A;  4MNO A;  4JBM A;  2F4V Q;  3DM3 A;  2UXD Q;  4DV3 Q;  2Q2T A;  1MKH A;  1RL2 A;  4X64 Q;  1I94 L;  4QY7 A;  4OX9 L;  3HOZ H;  3AFP A;  4BBS G;  1I6H H;  4DV6 L;  5GAG C;  5C0X J;  2C35 B;  4GOP A;  1PVO A;  1SRO A;  4JI8 L;  1VQJ A;  2KHI A;  3HOV G;  1X3E A;  3CCU A;  1IBM L;  1VQ5 A;  1VQE A;  4QL5 A;  4DV0 Q;  4L5S A;  3S1R H;  1IL2 A;  4LFC L;  3UDX A;  3GTJ H;  3K7U C;  2UUA Q;  1YJ9 A;  4JI0 Q;  1N36 L;  3B6Y A;  1M1K C;  4DR2 Q;  4WJ4 A;  2Z6K A;  3K7A H;  1PH8 A;  2UU9 Q;  2YTY A;  3PIP A;  4LFA Q;  4DR7 Q;  2CWA A;  4OWT B;  2VZA A;  5LMU L;  3RZO H;  4LF7 L;  2R92 H;  1PYS B;  1B8A A;  4JOI A;  3M4O H;  4B3S Q;  2F4V L;  1HH2 P;  1EOV A;  2NVX H;  5JJK A;  2B63 H;  4A3L G;  1XTD A;  4DV3 L;  2LXK A;  1X9N A;  1VQL A;  2UXD L;  3K81 C;  4X64 L;  1E22 A;  1N34 Q;  2YU9 H;  3F2B A;  2WP8 J;  3NEM A;  1X6O A;  3L0O A;  2PMZ E;  2NN6 I;  1SR3 A;  3FKI G;  1VQC A;  4ME3 A;  4LNQ A;  1SN8 A;  1JE5 A;  4BBR H;  3PV0 A;  2HT1 A;  4KHZ A;  1M90 C;  4DV0 L;  1VQH A;  2R7Z G;  1QUQ B;  1C0A A;  3ZJY C;  2NN6 G;  2CCZ A;  1JT8 A;  4JI0 L;  3PIO A;  4DR2 L;  1WFQ A;  4B3T Q;  3S15 H;  5IYD H;  2UU9 L;  4LFA L;  1WYD A;  1Q82 C;  1NMG A;  5ELO A;  4A3K H;  2JA7 G;  2NVT H;  4DR7 L;  1YJW A;  5IYC G;  1X3G A;  3PUX A;  2LXJ A;  4B3S L;  4GN5 A;  5C4X H;  3HOY G;  1JJG A;  2GN5 A;  2VY3 A;  1L1O C;  1J5E Q;  4C3I H;  3K80 C;  5C4J H;  4AYB E;  1N34 L;  2YV5 A;  3CXC A;  1GKH A;  4YY3 Q;  1OXT A;  3M9B A;  3M3Y H;  1XMO Q;  1TWG H;  2E2J H;  4DKA C;  1AH9 A;  1S40 A;  1WCM H;  1VQA A;  3HKZ G;  3KDF A;  4R4I A;  5FJ8 G;  4B3T L;  4RMF A;  2K5V A;  4DAY B;  1CKO A;  2JQO A;  1OXX K;  4QIW E;  1JJ2 A;  1NBW A;  2OWO A;  1VQ6 A;  1VQ7 A;  3S17 H;  1A62 A;  4HIO A;  1Y1W H;  1Q1B A;  1VQD A;  2K5N A;  2N8N A;  1HJP A;  3KF6 B;  5M5X H;  3M85 A;  4LF9 Q;  4YHH Q;  5H1S E;  1CKM A;  1EIF A;  1LYL A;  4R4Q A;  1J5E L;  4GNX B;  2R93 H;  1SLJ A;  1Q12 A;  2AMC B;  2ALY B;  3U4V A;  3CC7 A;  2R7F A;  4ALP A;  2UUC Q;  3I4M H;  1FVI A;  2AHO B;  4YY3 L;  3A74 A;  4PZ8 A;  2JA5 G;  1XMO L;  2A8V A;  1V9P A;  4LFB Q;  1B7Y B;  3EN2 A;  1XMQ Q;  1WJJ A;  4IPD A;  3GTG H;  1VQM A;  1K8A C;  4UP7 A;  3BZK A;  4QGU A;  2KHJ A;  1VS0 A;  1OXV A;  1AE2 A;  1K3R A;  3NBH B;  3SGI A;  5IE8 A;  3RN2 A;  4IPH A;  2XGT A;  1PA6 A;  4JI4 Q;  1PH4 A;  5HY6 A;  4A3B H;  4DR6 Q;  5JJL A;  1NMF A;  4DV5 Q;  2K14 A;  1Z9F A;  2VQE Q;  4A3I H;  3I4N G;  4LF9 L;  4YHH L;  1UE1 A;  1PH3 A;  1YIT A;  2UUC L;  1GM5 A;  2N3S A;  3I4O A;  4TQU S;  1HZB A;  2MO1 A;  1Q8K A;  3E0E A;  2RHQ B;  3ULP A;  2Y0S G;  5IWA Q;  3HOW H;  3CP0 A;  1VCI A;  3J81 i;  1XNR Q;  4LFB L;  1XMQ L;  1YHA A;  4JBW A;  1KRT A;  4BY7 G;  3S2H H;  4A93 G;  4IOA A;  4A3J G;  4AIM A;  4IFD G;  4OON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...