4L63B

Apo form of ab5 holotoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECXA
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l63B00
2AQ1B 1TS4A 1ET6A 1PRTD 1PRTB 3R2IA 1PRTC 1SXTA 3BYYB 4OHJA 3BVZA 1TS5A 1QILA 1BCPD 1CQVA 1LT5D 1BCPB 1TS3A 3MC0B 1BCPC 1RCVD 1STEA 1EEFD 4O1NA 1UUPA 5TSSA 1M4VA 3DWAA 1KLUD 1SE4A 2NTSA 1S5FD 3BYTB 4L6TB 4RGMA 2ICIA 1HA5A 1SBBB 1UNSA 1JWUD 1LLRD 4L63B 1EU3A 4RGOS 1ENFA 1EEID 2SEBD 1EU4A 1CK1A 1RDPD 5ELCA 5ELBA 1LT4D 1PTOC 2NTTA 3EA6A 1MD2D 4RH6A 1JQYD 1SE3A 2IPKD 1JWSD 2XRSD 1L0YB 1EFID 3TSSA 1PZJD 1BXTA 2QEJC 4ZYSA 1HQRD 1JR0D 3DWQA 1FNWA 2R61A 4K6LA 5FKAC 1PZKD 1I4HA 4RGTA 1V1OA 1PRTF 1I4RA 1LT3D 1F77A 1CT1D 1V1PA 2AQ2B 2XN9C 1JWMD 1HTLD 1BCPF 4Z9CB 1SJHD 1LTBD 3R2TA 5ELFA 1KTKA 1PYWD 1ESFA 1B1ZA 2AQ3B 4BWGB 4DXFA 1PTOD 3OWEB 1T5XD 1PTOB 4DXGA 3R8BA 5FK9C 3W2DA 1D6EC 1LTAD 2QILA 3O13A 1AW7A 3CHBD 1CHPD 1LTSD 2G9HD 2IJ0A 1S5ED 4RGNA 5I4DA 1CHQD 1FGBD 1JCKB 3BZDB 1I4QA 4RCOA 1S5BD 1I4GA 1G8ZD 1I4PA 1FNUA 5ELDA 3BVMA 1LT6D 1PTOF 3MFGA 3DWPA 1GOZA 3GP7A 3BVGA 2J4XA 1B44D 4TSSA 5D3IB 1PTOH 1I4XA 1EWCA 2TSSA 3V05A 2XRQD 4RHSA 1LO5D 4RFBA 3EFXD 1XTCD 1PZID 2CHBD 3URYA 1ET9A 1SJED 2RDGA 2O2LD 1FD7D 1DYQA 1V1PB 2WV6D 2Z8LA 1TS2A 1S5DD 1TY2A 5ELEA 1RD9D 1S5CD 3KLSX 1D5XC 4RHRA 1KLGD 1D5ZC 1L0XB 1LTGD 1XXGA 1D5MC 2RDHA 2XNAC 5D3DA 4UDUC 4C56C 1LTID 1RF2D 1FNVA 3SEBA 1AN8A 1SE2A 1HXYD 1LTRD 1DJRD 1TY0A 1LTTD 1SEBD
chains in the Genus database with same CATH superfamily
2KCTA 4HJ9A 4ILWA 1OXVA 1RODA 3G4SA 1ZYRC 3JAME 1P16A 4IQZA 4LFCL 3S24A 4PZ8A 4OGQC 2FHTA 3JAML 4A3MB 1QILA 5KNBA 3BZKA 1STEA 1HNWQ 1H9KA 3NTHA 3U50C 3RZDB 3UDXA 2NZ1D 2AWNA 1WD1A 1E22A 4A3EB 1WTVA 2J0TD 1WFQA 1AZQA 1BBUA 4JOIC 5C0XJ 1N36L 2EYPA 3PQIA 3HKSA 2E75C 4MZ9A 3CCJA 5M5WB 1JC7A 1H9MA 2FMCA 3HKZG 3KUPA 5CORA 5FOBB 1DOMA 1O7YA 2NTTA 3FKIB 4DAYA 3PF4A 1MD2D 4Q0FA 1K8MA 3CC7A 2IPKD 2MFIA 4A3EG 3KOJA 3MA2B 1KNEA 3S1NB 4HJ8A 1FVIA 4CDCC 1TWHB 4XYOA 4DUYQ 1GD7A 4PV1C 3J80E 1I5FA 1EIHA 3FKIG 2N3SA 4FXDA 1SRUA 5BN4A 4BA2I 2IHEA 1LTBD 1AEXA 4GLXA 5M5YB 3OHXC 2B2VC 5I6WA 4EQOA 1BVSA 4IALA 1OTCA 4A3IH 2SNSA 3OTOQ 2XWBB 4RWSC 1STGA 4HCSA 1S5ED 2EYLA 4DK3C 2MGSA 3RLNA 1ZEQX 4HJ5A 3K5LA 2E74C 3Q0AA 2UUBQ 1S4ZA 3L3OC 4APVA 1H95A 4DR1L 5JJLA 4FF3A 1TWGH 5C0XI 2F0OA 2H5XA 4NKLA 1GOZA 4NXNQ 2PI2A 3G7LA 1X65A 2VS1A 1NE3A 1YBYA 4IUPA 3GV6A 3L2PA 4LF5Q 3TREA 3M3YH 2NUCA 1PHJA 3ER0A 3HOVB 1S5DD 3MXGA 4NXNL 1RD9D 2JA9A 4A3LG 4IJHA 4R4IA 3M7GA 3I90A 2K32A 1WOCA 4C56C 3TDQA 1RF2D 3VYUA 1FL0A 1PH6A 1TY0A 4DV4Q 2NN6H 5J1ZA 1F2MA 1RTOA 4AH6A 2Z0SA 4J15A 1G51A 1I3QB 2R92H 4KI0A 3P75A 4H02A 3TMEA 4JC0A 3RLOA 1HNZL 1J8IA 1UE7A 3EVQA 5HURA 4DV4L 1V43A 1X6OA 3H0GH 4X66Q 1KLUD 3I4MH 1VDZA 4FO2A 4WJWA 5CBEE 1UEBA 3A54A 1WYDA 4C3HB 5M3MB 1KHIA 1D1KA 1TXYA 2F1MA 1HA5A 4JBJA 1E24A 3M9BA 1YIJA 3H15A 2I0QA 4A3KB 4RGOS 1HCZA 1JE5A 4UP7A 1EY9A 4A3MH 1Q1BA 2F0NA 3H09A 1FGUA 3RZDH 3VR2A 1PH4A 1MBYA 3OW2A 1BXTA 3H6MA 4A3EH 1WTWA 2KCCA 2EYHA 2L11A 2XTIA 3FPPA 4PZ7A 1PYBA 1VQ8A 3V96A 3HFZB 4HN7A 1HZ9A 2RKSA 5IGEA 5M5WH 1IBLQ 1N9WA 2M9VA 3FKIH 3NQTA 5ELFA 3E5SA 2GVBA 1E3PA 4MIUA 3R8BA 3E6ZX 1B70B 4KY5A 5IYCG 3CHBD 3W3AA 3TP8A 4WORA 3S1NH 4DV7Q 1EQQA 2IJ0A 2E5LQ 4IJLA 1DZ1A 1IBLL 1TWHH 2OTJA 5F2DA 4DK0A 4X65L 2R7FA 3CD6A 4DGZA 1YJWA 1Y1WB 1ASZA 3T4AC 2VB3X 4DFAA 2DJGC 4DV7L 2E5LL 5M5YH 1ZKOA 1SNMA 1MI2A 5LMUQ 3KYHC 1MJEA 5AJ3L 3V05A 2XRQD 3NEMA 4RFBA 1AP0A 3CMAA 3PO3G 2SDFA 1ET9A 4DAPA 2E2JB 4DV0L 1TS2A 2VL6A 5JEAH 3DLLA 1CM9A 2AUKA 2JP1A 3UE1A 2ZJPA 4QF4A 5LMUL 2ENBA 4DR4L 4IO9A 4KTAA 1D5MC 3NWSA 2LFNA 4GNXB 3OMGA 4Q5VA 1CKNA 1ICWA 2AQ1B 5FLMH 4A3DG 1GO3E 2EXDA 2UUAL 4K8JA 3M4YA 3ERQA 3KF8A 3CCLA 4OWTB 3HOVH 5HGTA 3FEWX 3FRPB 1PFSA 4R8NA 2K28A 4PMCA 4CKBA 2JXMB 1PH7A 2K7VA 2KEDA 5BN3A 2F0WA 2JK8A 2OF1A 1UNSA 3K7AB 2L15A 1I3QH 3IAYA 1G2SA 1N8RC 4DV2Q 2A69D 3HP3A 3MEHA 1JQYD 5JJIA 1IL2A 4POFA 3DHQA 4H7BA 1QCBD 3GTPB 4C3HH 5LL6S 5M3MH 3HGBA 2EYJA 3W1GA 3CCUA 1I4HA 4DV2L 4IUUA 1EFWA 1QG7A 4A3KH 5A2QL 4QB4A 3M85A 2IX0A 1GJXA 1HTLD 1WCMG 4JI0L 3QJYA 1CI3M 1BBWA 2BE5D 3WOEA 2JA8G 4A3CG 3S9WA 1VQGA 2CQOA 3BS1A 1VQ4A 1XPOA 3PGZA 1CZWA 2JSOA 2F0KA 3GTJB 4P71A 4R9WA 1B9NA 1I4GA 1I4PA 4K5VA 4DNIA 1A3TA 1K73C 1EY6A 2A1AA 3QO2A 1VQBA 5IT9L 4CJ0B 2DN8A 2J4XA 3RNUA 3CW2C 1TVXA 5GAEC 2CH4W 1I4XA 4UPAA 1VMPA 4O42A 4KHVA 1K9MC 3OSOA 1X55A 3NBIA 2EPBA 4UY8C 1XNRQ 5CV4A 1DYQA 4A76A 3MHBA 2MNAA 3J7YW 1UE5A 1L2FA 3HOZB 3ITPA 4RAUC 1YHQA 4DF7A 3PF5A 1Y1WH 2R7DA 2NBFA 4BY7B 4IUNA 3AQQA 3RZOB 3I72A 4DR2Q 2G5DA 2A68C 4OIJA 4GNXC 3FP9A 1F9RA 3Q8DA 4G57A 1B9MA 3MEFA 1DJRD 3A8IE 4YWMA 3VR3A 2E8GA 5COYA 2EY1A 1PRTB 4XT1B 3HOZG 3MXNA 4DR2L 2EJGC 2M00A 4BY7G 3PMFA 4IPDA 4BXXG 3MXPA 1SYCA 4JYAQ 3F2CA 5LMNQ 3RN2A 2BCOA 3CRLC 3A74A 1S72A 2JQOA 4DR5Q 2EYOA 2NZOA 3RLFA 1HHVA 3J81i 2ICIA 5GAGC 3ULLA 3H3VC 2F0QA 4PQXA 1JWUD 5C4HA 3IFDA 5EKIA 4NPSA 4F8MA 5IP7G 5EPLA 4JYAL 5J3BA 3S1RB 1WTOA 3UDIA 5ELBA 1YI2A 4B08A 2PQAB 2KJXA 1N33Q 1X9NA 2B2WA 3TSSA 1B4OA 2OEOA 3QIAA 3F2DA 1JR0D 5FJ8G 3DWQA 1B3QA 5JVH3 1JOQA 3K7AH 3NHHA 1NUCA 2QA4A 5LMNW 1QZGA 4OO1I 2AMCB 1OO9B 2J7ZA 3CRKC 2YTXA 2HIVA 1L0WA 3R93A 2CCZA 4NXMQ 2B63G 4HIMA 3T1YQ 1RKNA 3GTPH 1ZXTA 1BOSA 3VDYA 2VXWA 4HTHA 4A3CH 1DOKA 4ZAIA 1E2VA 1PH5A 4ALPA 3GTLB 5EBCA 4GOPA 2GVAA 4NXML 2O5IC 1JMCA 1PH3A 2D0PA 5D3IB 1N34Q 2B2UA 4RHSA 3UI2A 2B2TC 3H3VI 2N49A 2F3IA 4XQNA 1FD7D 2DUDA 3GTJH 3KLSX 5IGFA 4RHRA 4JI5L 2H4OA 1L0XB 1N34L 5IP9G 1C4QA 1XXGA 3CPFA 4Y52H 4UDUC 3PUWA 5KRUA 3A55A 2ASBA 4HCEA 3SK8A 4A3FB 3SK4A 4EQPA 1PRTC 4DV1Q 2FMMA 1STBA 1E0BA 1IYUA 3CCSA 4G7ZC 4DV6L 1RCVD 3HOZH 2PMZB 1F2LA 2Q8IB 1IHZA 3NTIA 1EOVA 1JB7A 1M4VA 4BY7H 3RZOH 3A5ZB 1DOLA 4RGMA 1HFNA 1PH2A 4IFDG 3MWYW 4F88A 4DV1L 3K0YA 4KLKA 4OIKA 2R7ZG 4DR7L 4DNTB 4L5QA 1AE3A 5IGCA 1E2ZA 1JB3A 2MP1A 2OTLA 5IP7H 4K0KL 3EJIA 1SE3A 4DAMA 4OXPA 2EJFC 2NYZD 4X3TA 1PZJD 1U4PA 2JEAI 2DNEA 2Z9HA 4IZ8A 4LK1C 4YWKA 3K58A 3TS0A 1LUZA 4AYBB 4KHPQ 4XT3B 1R4PB 1PV4A 2PW5A 1J6QA 3S1RH 2B29A 2DNCA 3R2TA 4I7AA 3U58A 3C2PA 2AQ3B 4BWGB 3VA7A 4H0LC 1T5XD 3GO5A 4CDEC 4DK6C 1HUNA 2ZXPA 1CUKA 2B3GA 3KF6A 1NSNS 3K5MA 1LTAD 4TKOB 1VCIA 1AW7A 4AYBG 5IYBH 2YYZA 1VF7A 4ZLTF 1F2ZA 1YNND 4J6HA 1JCKB 2PNHA 1KDAA 2F0FA 2R3ZA 4YIJA 1XWEA 2RVLA 3F1ZA 1A8VA 3BDOA 5IT9c 4I65A 4R1JA 4LUVA 4KV6A 3Q6SA 5BN5A 2OT2A 3KFUA 1Z47A 1CSQA 1XTCD 4MN3A 1GVPA 1QUQB 4K8IA 1OXUA 5FLXc 4X62L 4JI3Q 3P1HA 5ELEA 4A3JB 3AFQA 2EZVA 3GTLH 4RMFA 2QF7A 4BBRG 1SNOA 2RDHA 2RCFA 2CKZB 4HJAA 3VYSA 3EBEA 2WP8J 3SVMA 5IP9H 3S1QB 2VQFL 1GUWA 3RD4A 5GADC 5E4WC 4A3JG 3BVZA 2KEEA 1YNXA 3R3OA 2KCMA 2WAQE 1BCPD 1HPCA 5IGGA 3GDEA 3SGIA 2EY2A 4OX9L 2L1BA 4IFDJ 1S5FD 2A74C 3AB9A 4L5RC 1IYJB 5E3FA 1PH8A 4KK7A 2Z6KA 1SBBB 4IFDH 2QGQA 4ZUJA 4A3FH 4HIOA 2KCNA 5M9OA 2WB1E 4BS9A 2TMPA 4GN3B 4MNOA 3C1FA 2A6HD 1DD2A 5D65A 4IN3A 4QIWB 4AQYQ 1BQQT 2B39A 4YWLA 3CC2A 1AFPA 1CKNB 3HKZB 4LFAQ 1G6PA 1LM0A 2CWPA 1CA5A 1VQ6A 2RDFA 1KRSA 1PZKD 4C2MB 2F0EA 4QL5A 3UE0A 4N8FA 4CKCA 1UEAB 4RG1A 1QVGA 1HNWL 3ND9A 4LFAL 2K05A 4R4OA 5I2XA 3PIOA 3A56A 1EY4A 4N9TA 1GUOA 5C0XH 4JI1Q 1W3SA 2QILA 1Y14B 2VB2X 2NB0A 1MIUA 1CHPD 4KD3A 2G9HD 1STNA 4IFDI 1HR0W 1SLJA 1YNJD 1QVFA 4C3IG 3N52A 1Y8PB 3TP6A 3J80L 3CPWA 5CV8A 4OONA 4BY1G 3HZXA 4DUYL 1SJED 1TT2A 2RDGA 5HY6A 1LABA 3I91A 4L5TA 1SROA 1HFGA 4B3MQ 1LTGD 1XPRA 1EY7A 5EJWA 1LYLA 2YV5A 4N8X1 4ZKBB 3MAQA 1HJPA 3NTKA 1HXYD 2LMCB 1JJGA 1SYDA 2O4XA 3OTOL 1SYFA 3D4WA 2F0GA 4NW2A 2GN5A 4P74A 3TEHB 4FXGC 2EOTA 2QEXA 4GLVB 4JBWA 5ELOA 1C48A 1RIPA 1TS5A 5DNFA 5EBDA 2UUBL 3MC0B 5C3EG 4A3JH 3GQBA 4P75A 1WTQA 3DM1A 3PIPA 2LSSA 3RN5A 1GKHA 1UE6A 1NJIC 3LWEA 2JN4A 2JE6I 3C46A 1KXLA 3S1QH 2F52A 2VZAA 1BNZA 4LF5L 1PFNA 3J81E 3CP0A 3HKZE 3KDFA 2AHOB 4GKKQ 3FHWA 1SDFA 2H1EA 2WINB 1HUMA 4P2CB 3HOWG 4GZYC 2EIFA 4FDBA 2OWOA 2KECA 1A62A 4POGA 4B3SQ 1XNQQ 2ZTDA 3SK5A 1I94Q 4GKKL 2F3WA 2XN9C 4JK1C 5EAYA 1JWMD 4BBSB 3L9AX 3EN2A 3AU7A 2K75A 2RF4A 3QG1A 4X66L 2CW0C 3HOXG 4A4IA 3NELA 1K83B 4C3JG 4B3SL 1XNQL 3S2DB 1I94L 2I07B 1QNUA 4RGNA 2Y0SB 1XTDA 2MO1A 1D8LA 1BUVT 4C2MH 4PMWA 4BBSG 1EY8A 3GD7A 4P73A 3IFTA 3D4RA 1H9SA 2KHSA 3A8KE 2PZUA 1JT8A 1KABA 2CW0D 1V8QA 2Y0SG 1EQRA 3A0JA 4FF1A 2ZT9C 4X6AH 3URYA 3S1MB 1T5EA 1EYGA 3NWTA 1B3AA 1Z7TA 1TWAB 2EYFA 5NUCA 4DR3Q 4U68A 1VQIA 1KLGD 1KRTA 1D5ZC 3PO3B 1GUTA 1C0AA 4J1MA 2PZTA 1VQ9A 2EY6A 4NMZA 1WI5A 3QR8A 4A75A 3GTQB 4FF4A 3AYHB 1MSHA 1ASYA 2B2YA 1BKBA 4ME5A 4OHJA 1JORA 1X3FA 4GOPB 2UUCQ 5GAHC 1LTLA 1S40A 4A3DB 4S3SA 1K3BC 2N55A 1HQMC 3W5OA 1EYDA 5DM73 2NTSA 3RUZA 4R8IA 1K8OA 3OW7A 2AWOA 3A7LA 4A3LH 3VR4A 2OQKA 3KJOA 1ENFA 5DEHA 4OO1G 3CAMA 1QVCA 3IKJA 1PTOC 1PDQA 1B2TA 1A3VA 3JAMc 1CZGA 2A69C 3HOYB 3NBHB 1VQOA 3NENA 1VQAA 4QCLA 2XRSD 3CF5A 3GTOB 5IOCA 3NUCA 3K6OA 4N9PA 1KQSA 1X56A 2I5MX 4XQJA 5J22A 1PRTF 3I3CA 4CHTB 1B50A 2BDNA 1V1PA 3KBGA 4LF9Q 3HOYG 3T1HQ 1SJHD 1LV9A 3D31A 1GHKA 1E7ZA 2WFWA 1PTOD 1PVOA 1S3OA 2BE5C 4XXEA 4LF8Q 1KNAA 1YZ6A 1WCMB 4B3TQ 2PNRC 1YEZA 2X69A 4LF9L 1CHQD 1DM0B 1RTNA 3T1HL 2JA8B 4YY3Q 4RCOA 5EPJA 3SR1A 2RSNA 3BVMA 2MUYA 4F7XA 3MFGA 5C3WA 4LF8L 2RQXA 2Z1CA 4BBSH 3BVGA 1CA6A 4IUVA 2C5CA 2B2WC 1V1QA 3K5OA 4P72A 1K83H 3S2DH 3U4ZA 1EQTA 2HD3A 2ZTEA 3K59A 2Q2HA 1W2BA 2Z4IA 3T53B 3TZDA 5IYCH 5CGKA 4HMIA 2BH8A 1UAPA 1LTID 4HEDA 3SEBA 2IHFA 3GV3A 1YHAA 2N78A 1XMOQ 2K33A 2DY7A 2JJQA 2K03A 2L5TA 3D3RA 1X3QA 4K6DA 4NP5A 2MPMA 3S1MH 3T16A 4UHVA 1EOTA 4GLAC 1G91A 1TWAH 4RKLA 4JCVE 1VF5C 5EQ0A 4GOPC 2HCIA 4WJ4A 5C4ZA 3PO3H 4DK1A 2BH2A 1YHBA 1VMCA 2K5WA 4L6TB 1HRJA 3S2HB 5CBAE 4DKAC 2K6AA 1AH9A 3GTQH 2KHIA 1NNXA 1QOHA 1XNRL 4L63B 3NP8A 2FFKB 2V4DA 2X6GA 1TQOA 1CFMA 1SE8A 5FLXE 2E2JH 4OO1H 5FO9B 2LY7A 4R4CA 5G3LD 4A3DH 2VQEQ 3HOUG 1IKLA 4FNFA 1HQRD 4JBKA 3BJUA 4K6LA 2KHJA 3HS0C 1VQMA 2RCNA 1GM5A 3GTGB 1NR2A 2F0SA 2VQEL 2UXCQ 5LMNL 2I5HA 2VUMG 3HOYH 4KJNA 2Z6BA 5FK9C 3TP7A 2UXDQ 4DR5L 1QJOA 4LW1A 3GTOH 1WTHA 1I50B 2NVQB 1F9QA 2UXBQ 4JVZA 3I4NG 1I4QA 3SDZA 3H3VH 4GKJQ 3M4OB 2MO0A 2B63B 5C4XB 1SYGA 2NVXB 1H9RA 2JA5B 3S17B 2EVBA 4TSSA 4LWCA 4JI2Q 1N33L 1HA6A 3V2TA 2NVYB 3EIVA 4IOAA 3I7FA 3H91A 1WCMH 3DEOA 2JA7B 1K0SA 2Z8LA 5C4XG 2M2LA 2JA8H 2OCEA 2JA6B 1SFOB 4PG3A 2JA5G 3K57A 1D7QA 4A3BG 5D3DA 1DCZA 1IBMQ 1FNVA 4DAYB 1V9PA 3M4QA 1YVCA 5IGBA 5T1GA 2CH4A 5C6AA 3S16B 3T1YL 1TS4A 2JA7G 3E0EA 1KL9A 2MJ8A 1Q8IA 3FDTA 3R2IA 1HZAA 3X3MA 3LGJA 2A6ED 2JA6G 3QWNA 5K36G 1EZ6A 1IBML 1BCPB 1C9OA 2F0IA 5IYDG 1JOOA 3DUZA 4X64Q 3K5NA 4EVOA 3BYTB 2O5JC 2K52A 5JOBA 4HSPA 2PW7A 4ZK9B 3AMUA 2YTVA 1LLRD 2K5HA 4ODGA 4CKEA 1JOKA 1EEID 3NQIA 1EU4A 1Y8NB 4R4TA 5LL6X 2R7ZB 1STHA 1GUGA 1Z6HA 2PYKA 2EDGA 3T51B 3DXJC 1Y1VB 2P5ZX 1L0YB 1SAPA 2ID0A 2KENA 2L12A 2R61A 2QDBA 2RHQB 4BXXH 3S2HH 5KYLA 3DMUA 2YTYA 3U4VA 3I4LA 1F77A 5JVG3 4YHHQ 4I7ZC 4Z9CB 5J39A 4CJ2C 1KTKA 5CYUA 5IGDA 4BA1I 1BF4A 1Y1VG 4DXGA 1SMYD 3TZUA 3ZYYX 2N8NA 4LAAA 1Z9FA 1VQ7A 2Z6KC 3WDNA 2XWJB 2ZJRA 1Q1EA 4CBVA 1KC8C 2E2DC 3SHLA 5K5PA 4A93G 3E0JA 1YNNC 3PV0A 2F0JA 1JE4A 4DV3Q 3KDFB 4ME3A 2A8VA 3E9IA 1Q7YC 3WWVA 3GTGH 4O0AA 1Q82C 4ABNA 5FJ8H 1OXTA 1IW7D 1NMFA 2HDMA 2K5NA 4OELB 1Y69U 2TSSA 4XDXA 4ZQ3A 1CQFA 3N6RA 2ZJQA 1UWVA 2L4NA 4TQUS 1NTGA 3EFXD 1N32Q 1PZID 1I50H 2NVQH 4KHPL 2F4VQ 1U0LA 5BR8Q 4XIGS 4ZCKA 2B63H 1SYBA 5C4XH 3STBC 3M4OH 2G9DA 5IWAQ 4DAVA 2NVXH 4XTCS 1N32L 3UDFA 2JA5H 3S17H 2K5QA 3B6YA 1SYEA 4G7OC 5BR8L 2NVYH 1Q81C 4BBRB 4JPBW 4E6IA 1TIID 4DR6Q 1T9HA 1XMQQ 2HQLA 1ENCA 2JA7H 5A35A 4GN5A 4QGUA 4GS3A 1L1OA 2WACA 1W6KA 2CWAA 1BCPC 1SN8A 4O1NA 1LACA 1SFOH 2JA6H 3J7AF 2BDOA 5K36H 4IPCA 2VW9A 1NCVA 3L7ZC 5M5XB 3STBD 1RHPA 3U9SA 3T13A 4DR6L 2MHVA 1GHJA 5KIXA 2K01A 1VQFA 3GTKB 3S16H 1F9SA 4FYDA 1SNCA 3SK6A 4IUTA 4JI7Q 4JI3L 2PMZE 3LWUA 3LX0A 4A3IG 1BBXC 2PI2E 2XVSA 4L5SA 3CCQA 2R93B 1CK1A 1EUJA 2PPBC 1LT4D 2HHHQ 4CDFC 1X32A 2A6HC 3BDLA 4CDDC 1PH9A 1VQCA 3CMEA 2K5DA 2I5LX 1M90C 1K0RA 3F8TA 4JI7L 2QEJC 4UAIA 1U5KA 2RBMA 1G2TA 4RGTA 5E7NA 3T56B 2HHHL 1V1OA 2R93G 1HZBA 4JI8Q 1IXRA 4MTNA 1Q12A 3HG9A 3QB3A 2R7ZH 4LFBQ 1FYCA 1K8GA 1YJNA 2IT1A 1HR0Q 5C5LA 1HNXQ 3J81j 3O13A 4ZUIA 4JI8L 1Y1VH 4AYBE 2IL8A 1Q8KA 4LFCQ 5JJZA 2PZWA 1EY5A 1IKMA 1DONA 1G8ZD 1YNJC 2NN6G 1GXDC 2PQAA 5ELDA 1PTOF 1HR0L 1HNXL 2B8GA 5AFWA 3KF8B 4FVMA 3GP7A 4AQYL 4Y7NB 1VS0A 4C3IB 5JAVA 2RHSB 1VQHA 4U673 3EROA 3J7A5 3RR5A 3H0GG 1N36Q 4AIMA 3I4MG 2O2LD 1V1PB 1J9OA 2JYOA 1DGSA 4YCUA 1AZPA 1D5XC 4BY1B 3ULJA 3K8AA 5CV5A 1PFBA 1FR3A 1AN8A 2EE1A 1SE2A 4A3MG 4JI1L 1ZYRD 3CCMA 5FO8B 1NR4A 3KLWA 1CQVA 3CCVA 1II3A 3RMHA 3D4DA 4DN4M 3D0FA 5TSSA 1VQLA 1NAPA 2C9OA 5I6YA 5C3EB 2CQAA 3PO2B 1WVLA 1X3GA 4BBRH 1KDBA 4DR1Q 2ATWA 4B3ML 2CFMA 4RH6A 5C5MA 4PMBA 4QMGA 3PO2G 4QY7A 1E2WA 2IY5B 5M5XH 2D62A 2GA4B 2EYMA 1B8AA 2DY8A 2R92G 1CKOA 3BDCA 2B2YC 3I8ZA 3GTKH 3IRBA 3QOLA 1LT3D 1O7IA 3PUXA 3HOWB 4QIWE 4IPGA 3J7ZC 2R93H 1U4RA 1Q86C 5G3LF 2IX1A 4WFN3 1B1ZA 1OXSC 2HDLA 3KLSA 1PTOB 2HUGA 4KKTA 5H1SE 3J81L 4MTKA 5JEAG 3J7AV 3MTSA 4B9WA 5D14A 1A63A 1LTSD 2K4KA 2ALYB 2WIIB 5EGTA 4RCNA 3HOXB 4ZRZA 1K28A 3CKIB 3G6EA 3OYYA 4G7HC 3I2ZA 1HNZQ 4C3JB 2ES2A 2KVMA 4RKBA 3DWPA 5FLMG 4EX5A 3MXNB 1O78A 5EKKA 4QUCA 1PA6A 1KAAA 2E2IB 3PUZA 3HOVG 3KK7A 3Q23A 5IY0A 4TRDA 2CHBD 2D9UA 3PSIA 4JOIA 4KHZA 1K3RA 1J5EQ 3A7AB 2AUJD 3FMCA 4JI4Q 3VR5A 1S5CD 2ZXRA 3CXCA 2A19A 5C44B 5CMDA 3OWFA 1ILPA 2XNAC 4B3RQ 1KDCA 3KJPA 1F2YA 4L8JA 5I2YA 4Y7NH 1A2UA 1J5EL 4C3IH 4XYQA 4OEMB 4JI4L 1ET6A 4KKSA 3BYYB 1YITA 5C44G 4KN4C 1NY4A 5IODA 2D0OA 4B3RL 4HSVA 3WOFA 4C3HG 5M3MG 1VQ5A 1JICA 4BY1H 1EEFD 4J8QA 1A6XA 5JJKA 2NN6I 1FJGQ 2B2VA 2C35B 4A3KG 1BR9A 1QUQA 1O80A 1MSGA 1WTPA 4EQNA 1R4QB 3I4OA 2HCCA 4DPGA 2PCFB 5CV9A 3CQZB 1R9TB 4A3GB 1EU3A 4X65Q 4DR3L 5KGUA 1FJGL 2KBNA 1K8AC 3NE5B 3EA6A 3NXWA 2LS01 1VQDA 3I56A 2OXPA 1G291 5AJ3Q 4CJ1B 5C3EH 3G71A 3PO2H 1IYVA 2KQ3A 5FKAC 3VYTA 4A3GG 4ZKCB 3C3LA 2L55A 4DV0Q 4OWXB 5LHY1 3EQLC 4DR4Q 2UUCL 2FJ2A 3G48A 3CCEA 1PYWD 5JEAJ 4DXFA 2V1CC 3W2DA 1I6HB 3LNNA 5L37A 1Y1WG 5I4DA 1X3PA 1DXMA 1MHWC 3OPOA 2UUAQ 1SMXA 2RA4A 3M7NA 2KA7A 3F2BA 3HOWH 1LT6D 2F3VA 2N88A 4ULLA 4YCWA 2QKIC 5M3FB 1STYA 1PTOH 1BO0A 3K0XA 2Y0SE 1Q46A 1LO5D 5FO7B 4K2KA 2QCPX 3TN2A 4QJFA 2F0TA 2IWHA 1TY2A 3NSWA 3SXHA 3HOXH 5CV6A 2SOBA 4C3JH 1U9RA 5M3FG 2EY5A 2VNUD 1EY0A 3I73A 3S14B 3HEJA 1M1KC 4QUFA 5IE8A 4K14A 1ONLA 3JAMi 1EIGA 3HRZC 2E2IH 2K50A 2KUMA 1SEBD 4B3TL 3J80c 1EYAA 1D2BA 4PNYA 2Q8RE 4YY3L 4LF7Q 1U4LA 2LXJA 2Q2UA 3VYRA 1LT5D 1EQVA 1QWYA 3K80C 3QOJA 4G4KA 5C44H 4LJZC 4JI0Q 2XSCA 5T1IA 4KKUA 4O2DA 4DA2A 3PIO3 5A2QE 1Y8OB 2L9HA 2L0CA 4LF7L 1EWIA 3FVQA 3KF6B 5KYIA 1SNDA 1HZCA 1I6VC 3BU2A 1KD1C 5KNDA 3PCOB 5CC4A 1E1TA 1GUSA 2X6LA 4FF2A 2BA0A 2YU9B 4K5WA 1JWSD 3JC66 4HIDA 1C7YA 3J80i 2E76C 1XMOL 4ZYSA 1ILQA 1G6ZA 2WKCA 5IT9E 2ZM6Q 4KD4A 2B2UC 1PH1A 1I4RA 1JJ2A 1L1OB 3CQZH 3MVVA 3OMCA 1R9TH 3HOUB 4A3GH 4KN7C 2Z4HA 4XQQA 2ZTCA 2K14A 1BCPF 3E9HA 2JEBI 1TU2B 2NVTB 2HIXA 3OWEB 1NBWA 5I9PA 3J81c 3DM3A 2ZM6L 3TQYA 1D6EC 5FLXL 4JG2A 2DJFC 4NB3A 3CCRA 3PUYA 1IBKQ 1FGBD 3L0OA 5IIFA 2VUMB 3KLRA 1PXUA 2Q2IA 1A15A 1O7ZA 1B7YB 3I55A 4K5XA 3OIQA 3I4NB 2F0MA 1WTXA 1MGSA 2VY3A 1IBKL 3PIP3 4LMQD 1I6HH 1EIFA 1XX8A 3C1EA 1TWCB 3G6JB 5EKLA 1HH2P 3X3NA 1A0IA 1QE6A 3ND8A 5CV7A 3CU7A 2AKWB 5ELNA 1XPUA 4H44C 2EJMA 2K1BA 4QQBX 1VQEA 2UXCL 3MZ5A 2A68D 3SE0A 1QZHA 5C4JB 4M1UB 4HJ7A 2UXDL 5M3FH 2FINB 5DLQE 4LUOA 1LTTD 1VQPA 4A3BB 3TP5A 2UXBL 4X3UA 1SXTA 3BZCA 3VA5A 1RL2A 2UU9Q 4GKJL 2A6EC 1TS3A 2F0UA 2R6GA 1UUPA 2K5VA 2LKVA 1SR3A 3D6WA 3NPPA 3S14H 4JI2L 2CVRA 3GTMB 1D1IA 4DNRB 3PUVA 4YCVA 4JW0A 4FP5D 3D6CA 2UU9L 4V190 4IOCA 1PFMA 4X3KA 1VQJA 5E1FA 3F2UA 2NWGA 5ELCA 2A73B 3UDGA 5IYBG 3IL8A 1A2TA 3W1BA 1SNQA 2Q8TA 2EQSA 2E2HB 3D8GA 1X3EA 4EGVA 4EQ5A 4C1NK 1VQNA 5HGQA 4CGYB 4LNQA 3BG3A 1EWHA 1GUNA 1M8AA 1CT1D 2IW3A 1MJCA 1L1OC 2DGYA 1A3UA 2F0DA 4OWWB 4JI5Q 2BA1A 4X64L 1MKHA 2HQEA 1TWFB 2D2CC 2WKDA 3H94A 3OIPA 4C1NI 5KEEA 2YU9H 4GNXA 1SMYC 5EPKA 2F03A 4JV5Q 1XJVA 1AE2A 4KY7A 2SNMA 2XGTA 3BZDB 2QDLA 1JJCB 1XYIA 3HOUH 3NBHA 4DV6Q 1UE1A 4KJOA 4A93B 4UP9A 5E4XA 2F0PA 3S15B 4HAEA 1IW7C 4JV5L 4LUZA 4JI6Q 2NVTH 3ERSX 1F9PA 1OXXK 2F4IA 1STAA 4IURA 5JPNC 3AFPA 3P7JA 5CR3A 5KNCA 1KAWA 1BDOA 1ML0D 4JBMA 1ICFB 4K2LA 4DU9A 4YHHL 5DM63 1E1OA 1U4MA 4HMJA 2VUMH 4JI6L 1VQKA 1PMRA 4K0KQ 3NK9A 2WAQB 3A8JE 3U9OA 4A3FG 3ICEA 1Q3LA 4NDXA 3MFYA 4M8AA 3I4NH 4UP8A 2I46A 3M4PA 4GN4B 2BOSA 1PRTD 4LF4Q 4LF6Q 5ISRA 1TWCH 1EYCA 1RJTA 1PLFA 3ONAB 4DV3L 4WRDA 5GROA 1EL0A 1TR5A 4IUQA 2WAQG 3VR6A 3TS2A 1CTMA 2PQEA 3KBXA 2WB1B 1QB5D 2F0HA 1B53A 3DWAA 4H13C 1SE4A 1IL8A 5C4JH 4LF4L 2LXKA 2FXQA 3E3XA 4LF6L 4DV5Q 3FPUB 3P20A 4F87A 2MQHA 2PO4A 1PYSB 1CKMA 2NZHA 2F4VL 4A3BH 1NMGA 5C0XG 5C3XA 1EZ8A 2QW7A 2SEBD 1RDPD 2WB1G 1ESRA 2EXZA 3K7UC 4RA8A 5IWAL 4IPHA 4DV5L 2ICEC 2KOLA 4A3IB 2F0VA 1H9SB 3I70A 4KY6A 3MXUA 1EFID 3Q22A 3GTMH 5IYDH 1FNWA 4B9XA 2B2TA 2HT1A 3CC4A 1QNKA 1XMQL 4X62Q 3TBIB 1Q90A 5I9OA 2AQ2B 1SSOA 4X3SA 1TWGB 2IX3A 1IZ6A 1ESFA 3ZJYC 2A5HA 2E2HH 2K04A 2VQFQ 1P8LA 3OOCA 4TVAB 1WTRA 3M3YB 1HTPA 1C8CA 1X54A 1YJ9A 4DUZQ 1S5BD 4OL7A 2Q2TA 1FNUA 2ZXOA 3A5UA 4HIKA 1ENAA 4OX9Q 4HR7B 2B8FA 1SNPA 1H9JA 1B44D 3ULPA 1TWFH 4PZ6A 3TRZA 1EWCA 4DUZL 4R4QA 3K81C 4DR7Q 2R92B 1WJJA 5JPMC 1CSPA 4ID6A 2WV6D 4MHEA 2RSOA 1EIYB 1KIXA 1TKWB 5DAUA 4FXKC 3H0GB 4WJ3M 3I4MB 4V0BA 4LFBL 1O7LA 2F0LA 3Q24A 1WD0A 2XIWA 1W6JA 3AEVA 2OQ0A 3DEPA 3S15H 4KMUC 4A93H 5GQOA 1LTRD 2D5DA
chains in the Genus database with same CATH topology
4ILWA 1OXVA 1RODA 1ZYRC 3JAME 4IQZA 4OGQC 2FHTA 3JAML 4A3MB 1QILA 5KNBA 1STEA 1H9KA 3NTHA 3RZDB 2NZ1D 2AWNA 1WD1A 4A3EB 1WTVA 2J0TD 1AZQA 5C0XJ 2EYPA 2E75C 5M5WB 1JC7A 1H9MA 2FMCA 3KUPA 5CORA 5FOBB 1DOMA 1O7YA 2NTTA 3FKIB 4DAYA 1MD2D 4Q0FA 1K8MA 2IPKD 3MA2B 1KNEA 3S1NB 1TWHB 4XYOA 4PV1C 3J80E 1EIHA 4FXDA 5BN4A 4BA2I 1LTBD 1AEXA 5M5YB 3OHXC 2B2VC 5I6WA 4EQOA 4IALA 2SNSA 2XWBB 4RWSC 1STGA 4HCSA 1S5ED 2EYLA 2MGSA 1ZEQX 3K5LA 2E74C 3Q0AA 1S4ZA 3L3OC 4FF3A 5C0XI 2F0OA 4NKLA 1GOZA 3G7LA 4IUPA 3GV6A 2NUCA 3HOVB 1S5DD 3MXGA 1RD9D 3M7GA 3I90A 2K32A 4C56C 3TDQA 1RF2D 3VYUA 1TY0A 2NN6H 5J1ZA 1F2MA 1RTOA 1I3QB 4KI0A 3P75A 3TMEA 1J8IA 3EVQA 5HURA 1V43A 1KLUD 1VDZA 4FO2A 4WJWA 5CBEE 3A54A 4C3HB 5M3MB 1D1KA 2F1MA 1HA5A 4A3KB 4RGOS 1HCZA 1EY9A 1Q1BA 2F0NA 3H09A 3VR2A 1MBYA 1BXTA 3H6MA 1WTWA 2KCCA 2EYHA 2L11A 3FPPA 3V96A 4HN7A 2RKSA 5IGEA 2M9VA 3NQTA 5ELFA 3E5SA 3R8BA 4MIUA 3E6ZX 4KY5A 3CHBD 3W3AA 3TP8A 4WORA 2IJ0A 1DZ1A 5F2DA 4DK0A 4DGZA 1Y1WB 3T4AC 2VB3X 4DFAA 1ZKOA 1SNMA 1MI2A 3V05A 2XRQD 4RFBA 1AP0A 2SDFA 1ET9A 4DAPA 2E2JB 1TS2A 5JEAH 1CM9A 2AUKA 2JP1A 4QF4A 2ENBA 4KTAA 1D5MC 3NWSA 2LFNA 3OMGA 4Q5VA 1ICWA 2AQ1B 4K8JA 3M4YA 3ERQA 3KF8A 5HGTA 3FEWX 3FRPB 4R8NA 2K28A 4PMCA 4CKBA 2JXMB 2K7VA 2KEDA 5BN3A 2F0WA 2OF1A 1UNSA 3K7AB 3IAYA 1G2SA 2A69D 3HP3A 3MEHA 1JQYD 3DHQA 4H7BA 1QCBD 3GTPB 5LL6S 3HGBA 2EYJA 1I4HA 4IUUA 1QG7A 5A2QL 4QB4A 3M85A 2IX0A 1GJXA 1HTLD 3QJYA 1CI3M 2BE5D 3WOEA 3S9WA 3BS1A 1CZWA 2JSOA 2F0KA 3GTJB 4R9WA 1B9NA 1I4GA 1I4PA 4K5VA 1A3TA 1EY6A 3QO2A 5IT9L 4CJ0B 2DN8A 2J4XA 1TVXA 1I4XA 1VMPA 4O42A 4KHVA 3OSOA 3NBIA 2EPBA 5CV4A 1DYQA 3MHBA 3J7YW 3HOZB 3ITPA 4RAUC 4DF7A 2NBFA 4BY7B 4IUNA 3RZOB 3I72A 2A68C 4OIJA 1F9RA 4G57A 3VR3A 1B9MA 1DJRD 3A8IE 5COYA 2EY1A 1PRTB 4XT1B 3MXNA 2EJGC 2M00A 3PMFA 3MXPA 1SYCA 2BCOA 3CRLC 2EYOA 3RLFA 1HHVA 2ICIA 3H3VC 2F0QA 4PQXA 1JWUD 5C4HA 3IFDA 5EKIA 4F8MA 5EPLA 3S1RB 1WTOA 5ELBA 4B08A 2KJXA 3TSSA 2B2WA 1B4OA 2OEOA 3QIAA 1JR0D 3DWQA 5JVH3 1JOQA 3NHHA 1NUCA 4OO1I 1OO9B 2J7ZA 3CRKC 3R93A 1RKNA 1ZXTA 1BOSA 2VXWA 4HTHA 1DOKA 4ZAIA 1E2VA 3GTLB 5EBCA 2O5IC 5D3IB 2B2UA 4RHSA 3UI2A 2B2TC 4XQNA 1FD7D 3KLSX 5IGFA 4RHRA 2H4OA 1L0XB 1C4QA 1XXGA 4UDUC 3PUWA 5KRUA 3A55A 4HCEA 3SK8A 4A3FB 3SK4A 4EQPA 1PRTC 2FMMA 1STBA 1E0BA 1IYUA 4G7ZC 1RCVD 2PMZB 1F2LA 2Q8IB 1IHZA 3NTIA 1M4VA 1DOLA 4RGMA 1HFNA 4IFDG 3MWYW 4F88A 3K0YA 4OIKA 4DNTB 5IGCA 1E2ZA 1JB3A 2MP1A 3EJIA 1SE3A 2EJFC 2NYZD 4X3TA 1PZJD 1U4PA 2JEAI 2DNEA 4IZ8A 3K58A 4LK1C 4AYBB 4XT3B 1R4PB 2PW5A 2DNCA 3R2TA 3C2PA 2AQ3B 4BWGB 3VA7A 4H0LC 1T5XD 3GO5A 1HUNA 2ZXPA 3K5MA 1NSNS 1LTAD 4TKOB 1VCIA 1AW7A 2YYZA 1VF7A 4ZLTF 1F2ZA 1YNND 4J6HA 1JCKB 1KDAA 2F0FA 2R3ZA 4YIJA 1XWEA 2RVLA 3BDOA 4I65A 4KV6A 3Q6SA 5BN5A 2OT2A 1Z47A 1XTCD 4MN3A 4K8IA 1OXUA 3P1HA 5ELEA 4A3JB 2EZVA 2QF7A 1SNOA 2RDHA 3VYSA 2WP8J 3SVMA 3S1QB 1GUWA 3RD4A 5E4WC 3BVZA 2KEEA 3R3OA 1BCPD 1HPCA 5IGGA 2EY2A 2L1BA 4IFDJ 1S5FD 2A74C 3AB9A 5E3FA 4KK7A 1SBBB 4IFDH 4ZUJA 2KCNA 5M9OA 4BS9A 2TMPA 3C1FA 2A6HD 1DD2A 5D65A 4IN3A 4QIWB 1BQQT 2B39A 1AFPA 3HKZB 1CA5A 2RDFA 1PZKD 4C2MB 2F0EA 4CKCA 1UEAB 3ND9A 2K05A 5I2XA 3A56A 1EY4A 4N9TA 1GUOA 5C0XH 2QILA 2VB2X 2NB0A 1CHPD 4KD3A 2G9HD 1STNA 4IFDI 1YNJD 4C3IG 3N52A 1Y8PB 3TP6A 3J80L 5CV8A 3HZXA 1SJED 1TT2A 2RDGA 1LABA 3I91A 1HFGA 1LTGD 1EY7A 5EJWA 4ZKBB 3MAQA 3NTKA 1HXYD 2LMCB 1SYDA 2O4XA 1SYFA 3D4WA 2F0GA 4NW2A 4FXGC 2EOTA 4JBWA 1C48A 1TS5A 5DNFA 5EBDA 3MC0B 3GQBA 1WTQA 3DM1A 3LWEA 2JE6I 3C46A 1BNZA 1PFNA 3J81E 1SDFA 2H1EA 2WINB 1HUMA 4P2CB 4GZYC 2KECA 3SK5A 2F3WA 2XN9C 4JK1C 1JWMD 4BBSB 3L9AX 3AU7A 3QG1A 2CW0C 1K83B 4C3JG 3S2DB 2I07B 1QNUA 4RGNA 2Y0SB 1BUVT 4PMWA 1EY8A 3GD7A 3IFTA 3D4RA 1H9SA 2KHSA 3A8KE 2PZUA 1KABA 2CW0D 1V8QA 4FF1A 2ZT9C 3URYA 3S1MB 1T5EA 1B3AA 3NWTA 1Z7TA 1TWAB 2EYFA 5NUCA 4U68A 1KLGD 1D5ZC 3PO3B 1GUTA 4J1MA 2PZTA 2EY6A 4NMZA 3GTQB 4FF4A 1MSHA 2B2YA 4ME5A 4OHJA 1JORA 4A3DB 4S3SA 2N55A 1HQMC 1EYDA 5DM73 2NTSA 3RUZA 4R8IA 1K8OA 3OW7A 2AWOA 3A7LA 3VR4A 1ENFA 5DEHA 4OO1G 3IKJA 1PTOC 1PDQA 1B2TA 1A3VA 1CZGA 2A69C 3HOYB 4QCLA 2XRSD 3GTOB 5IOCA 3NUCA 3K6OA 4N9PA 4XQJA 5J22A 1PRTF 3I3CA 4CHTB 1B50A 2BDNA 1V1PA 3KBGA 1SJHD 1LV9A 3D31A 1GHKA 1PTOD 2BE5C 4XXEA 1KNAA 1WCMB 2PNRC 2X69A 1CHQD 1DM0B 1RTNA 2JA8B 4RCOA 5EPJA 3SR1A 2RSNA 3BVMA 2MUYA 4F7XA 3MFGA 5C3WA 2RQXA 2Z1CA 3BVGA 1CA6A 4IUVA 2C5CA 2B2WC 3K5OA 1EQTA 3K59A 2Z4IA 3T53B 3TZDA 5CGKA 4HMIA 1UAPA 1LTID 4HEDA 3SEBA 3GV3A 2K33A 2DY7A 2K03A 3D3RA 2L5TA 4K6DA 1X3QA 4NP5A 2MPMA 3T16A 1EOTA 1G91A 4RKLA 1VF5C 5EQ0A 2HCIA 5C4ZA 4DK1A 2K5WA 1VMCA 4L6TB 1HRJA 3S2HB 5CBAE 2K6AA 1QOHA 4L63B 3NP8A 2FFKB 2V4DA 2X6GA 1TQOA 1CFMA 5FLXE 4OO1H 5FO9B 2LY7A 5G3LD 1IKLA 4FNFA 1HQRD 4K6LA 3HS0C 3GTGB 1NR2A 2F0SA 4KJNA 5FK9C 3TP7A 1QJOA 1I50B 2NVQB 1F9QA 1I4QA 3SDZA 3M4OB 2B63B 5C4XB 1SYGA 2NVXB 1H9RA 2JA5B 3S17B 2EVBA 4TSSA 1HA6A 3V2TA 2NVYB 3H91A 3DEOA 2JA7B 2Z8LA 2M2LA 2JA6B 1SFOB 3K57A 5D3DA 1DCZA 1FNVA 5IGBA 5T1GA 5C6AA 3S16B 1TS4A 2MJ8A 1Q8IA 3FDTA 3R2IA 3X3MA 2A6ED 3QWNA 5K36G 1EZ6A 1BCPB 2F0IA 1JOOA 3DUZA 3K5NA 4EVOA 3BYTB 2O5JC 5JOBA 4HSPA 2PW7A 4ZK9B 3AMUA 1LLRD 4ODGA 4CKEA 1JOKA 1EEID 3NQIA 1EU4A 1Y8NB 5LL6X 2R7ZB 1STHA 1GUGA 1Z6HA 2PYKA 2EDGA 3T51B 3DXJC 1Y1VB 1L0YB 1SAPA 2ID0A 2L12A 2R61A 2QDBA 5KYLA 3DMUA 3I4LA 1F77A 5JVG3 4I7ZC 4Z9CB 5J39A 4CJ2C 1KTKA 5CYUA 5IGDA 4BA1I 1BF4A 4DXGA 1SMYD 3TZUA 3ZYYX 4LAAA 3WDNA 2XWJB 1Q1EA 4CBVA 2E2DC 3SHLA 5K5PA 3E0JA 1YNNC 3PV0A 2F0JA 1JE4A 4ABNA 1OXTA 1IW7D 2HDMA 1Y69U 2TSSA 4XDXA 4ZQ3A 1CQFA 3N6RA 4TQUS 2L4NA 3EFXD 1PZID 4XIGS 1SYBA 2G9DA 4DAVA 4XTCS 2K5QA 1SYEA 4G7OC 4BBRB 4E6IA 1TIID 1ENCA 5A35A 2WACA 1W6KA 1BCPC 4O1NA 1LACA 3J7AF 2BDOA 5K36H 1NCVA 3L7ZC 5M5XB 1RHPA 3U9SA 3T13A 2MHVA 1GHJA 5KIXA 2K01A 3GTKB 1F9SA 4FYDA 1SNCA 3SK6A 4IUTA 3LWUA 1BBXC 3LX0A 2R93B 2XVSA 1CK1A 2PPBC 1LT4D 1X32A 2A6HC 3BDLA 2K5DA 2QEJC 4UAIA 2RBMA 1G2TA 4RGTA 3T56B 1V1OA 1Q12A 3HG9A 3QB3A 1FYCA 2IT1A 5C5LA 3O13A 4ZUIA 2IL8A 5JJZA 2PZWA 1EY5A 1IKMA 1DONA 1G8ZD 1YNJC 2NN6G 1GXDC 5ELDA 1PTOF 2B8GA 5AFWA 4FVMA 3GP7A 4Y7NB 4C3IB 5JAVA 4U673 3EROA 2O2LD 1V1PB 1J9OA 2JYOA 1AZPA 4BY1B 1D5XC 5CV5A 1PFBA 1FR3A 1AN8A 2EE1A 1SE2A 1ZYRD 5FO8B 1NR4A 1CQVA 1II3A 3RMHA 4DN4M 3D4DA 5TSSA 1NAPA 2C9OA 5I6YA 5C3EB 2CQAA 3PO2B 1WVLA 1KDBA 4RH6A 5C5MA 4PMBA 4QMGA 1E2WA 2D62A 2GA4B 2EYMA 2DY8A 3BDCA 2B2YC 3I8ZA 3QOLA 1LT3D 3PUXA 3HOWB 1U4RA 5G3LF 2IX1A 4WFN3 1B1ZA 1OXSC 2HDLA 3KLSA 1PTOB 2HUGA 4KKTA 3J81L 5JEAG 3J7AV 3MTSA 4B9WA 5D14A 1LTSD 2WIIB 5EGTA 4RCNA 3HOXB 4ZRZA 3CKIB 4G7HC 4C3JB 2KVMA 4RKBA 3DWPA 1O78A 5EKKA 4QUCA 1KAAA 2E2IB 3PUZA 3KK7A 3Q23A 4TRDA 2CHBD 2D9UA 4KHZA 3A7AB 2AUJD 3FMCA 3VR5A 1S5CD 2ZXRA 5C44B 5CMDA 3OWFA 1ILPA 2XNAC 1KDCA 1F2YA 4L8JA 5I2YA 1A2UA 4XYQA 1ET6A 4KKSA 3BYYB 4KN4C 5IODA 4HSVA 3WOFA 4C3HG 1JICA 1EEFD 4J8QA 1A6XA 2NN6I 2B2VA 1BR9A 1O80A 1MSGA 1WTPA 4EQNA 1R4QB 2HCCA 2PCFB 5CV9A 3CQZB 1R9TB 4A3GB 1EU3A 5KGUA 3NE5B 3EA6A 3NXWA 2LS01 2OXPA 1G291 4CJ1B 1IYVA 2KQ3A 5FKAC 3VYTA 4ZKCB 3C3LA 2L55A 5LHY1 3EQLC 2FJ2A 1PYWD 5JEAJ 4DXFA 1I6HB 3W2DA 3LNNA 5I4DA 1X3PA 1DXMA 3OPOA 2RA4A 3M7NA 2KA7A 1LT6D 2F3VA 2N88A 4ULLA 2QKIC 5M3FB 1STYA 1PTOH 1BO0A 1LO5D 5FO7B 4K2KA 2QCPX 3TN2A 2IWHA 2F0TA 3SXHA 1TY2A 3NSWA 5CV6A 2SOBA 1U9RA 2EY5A 2VNUD 1EY0A 3I73A 3S14B 3HEJA 4QUFA 4K14A 1ONLA 1EIGA 3HRZC 2KUMA 1SEBD 1EYAA 1D2BA 4PNYA 2Q8RE 1U4LA 3VYRA 1LT5D 1EQVA 1QWYA 3QOJA 4G4KA 4LJZC 2XSCA 5T1IA 4KKUA 4DA2A 3PIO3 5A2QE 1Y8OB 2L9HA 2L0CA 3FVQA 5KYIA 1SNDA 1I6VC 5KNDA 5CC4A 2X6LA 1GUSA 4FF2A 2BA0A 2YU9B 4K5WA 1JWSD 2E76C 4ZYSA 1ILQA 1G6ZA 2WKCA 5IT9E 4KD4A 2B2UC 1I4RA 3MVVA 3OMCA 3HOUB 4KN7C 2Z4HA 4XQQA 1BCPF 2JEBI 1TU2B 2NVTB 3OWEB 5I9PA 1D6EC 5FLXL 3PUYA 1FGBD 2VUMB 5IIFA 3KLRA 1PXUA 1A15A 1O7ZA 4K5XA 3OIQA 3I4NB 2F0MA 1WTXA 1MGSA 3PIP3 4LMQD 1XX8A 3C1EA 1TWCB 3G6JB 5EKLA 3X3NA 1QE6A 3ND8A 5CV7A 3CU7A 4H44C 2EJMA 2K1BA 3MZ5A 2A68D 3SE0A 5C4JB 4M1UB 2FINB 1LTTD 4A3BB 3TP5A 4X3UA 1SXTA 3VA5A 2A6EC 1TS3A 2F0UA 2R6GA 1UUPA 2LKVA 3D6WA 3NPPA 2CVRA 3GTMB 1D1IA 4DNRB 3PUVA 4FP5D 3D6CA 4V190 1PFMA 4X3KA 5E1FA 3F2UA 2NWGA 5ELCA 2A73B 3IL8A 1A2TA 1SNQA 2Q8TA 2E2HB 3D8GA 4EGVA 4C1NK 4CGYB 1EWHA 1GUNA 1M8AA 1CT1D 2IW3A 3BG3A 1A3UA 2F0DA 2BA1A 2HQEA 1TWFB 2D2CC 2WKDA 3H94A 3OIPA 4C1NI 5KEEA 1SMYC 5EPKA 2F03A 4KY7A 2SNMA 3BZDB 1XYIA 3NBHA 4KJOA 4A93B 5E4XA 2F0PA 3S15B 4HAEA 1IW7C 1F9PA 1OXXK 2F4IA 1STAA 4IURA 5JPNC 3P7JA 5CR3A 5KNCA 1BDOA 1ML0D 4K2LA 4DU9A 5DM63 4HMJA 1U4MA 1PMRA 3NK9A 2WAQB 3A8JE 3U9OA 1Q3LA 4NDXA 3MFYA 4M8AA 2I46A 2BOSA 1PRTD 5ISRA 1EYCA 1RJTA 1PLFA 3ONAB 1EL0A 4WRDA 1TR5A 4IUQA 3VR6A 1CTMA 2PQEA 3KBXA 2WB1B 1QB5D 2F0HA 1B53A 3DWAA 4H13C 1SE4A 1IL8A 3FPUB 3P20A 4F87A 2PO4A 5C0XG 5C3XA 1EZ8A 2SEBD 1RDPD 1ESRA 2EXZA 4RA8A 2ICEC 2KOLA 4A3IB 2F0VA 4KY6A 1H9SB 3I70A 3MXUA 1EFID 3Q22A 1FNWA 4B9XA 2B2TA 1QNKA 3TBIB 1Q90A 5I9OA 2AQ2B 1SSOA 4X3SA 1TWGB 2IX3A 1ESFA 2A5HA 2K04A 3OOCA 1WTRA 3M3YB 1HTPA 1C8CA 1S5BD 4OL7A 1FNUA 2ZXOA 1ENAA 4HR7B 2B8FA 1SNPA 1H9JA 1B44D 1EWCA 2R92B 5JPMC 4ID6A 2WV6D 4MHEA 2RSOA 1TKWB 5DAUA 4FXKC 3H0GB 3I4MB 4V0BA 1O7LA 2F0LA 3Q24A 1WD0A 2XIWA 1W6JA 3DEPA 4KMUC 1LTRD 2D5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQ1 B;  1TS4 A;  1ET6 A;  1PRT D;  1PRT B;  3R2I A;  1PRT C;  1SXT A;  3BYY B;  4OHJ A;  3BVZ A;  1TS5 A;  1QIL A;  1BCP D;  1CQV A;  1LT5 D;  1BCP B;  1TS3 A;  3MC0 B;  1BCP C;  1RCV D;  1STE A;  1EEF D;  4O1N A;  1UUP A;  5TSS A;  1M4V A;  3DWA A;  1KLU D;  1SE4 A;  2NTS A;  1S5F D;  3BYT B;  4L6T B;  4RGM A;  2ICI A;  1HA5 A;  1SBB B;  1UNS A;  1JWU D;  1LLR D;  4L63 B;  1EU3 A;  4RGO S;  1ENF A;  1EEI D;  2SEB D;  1EU4 A;  1CK1 A;  1RDP D;  5ELC A;  5ELB A;  1LT4 D;  1PTO C;  2NTT A;  3EA6 A;  1MD2 D;  4RH6 A;  1JQY D;  1SE3 A;  2IPK D;  1JWS D;  2XRS D;  1L0Y B;  1EFI D;  3TSS A;  1PZJ D;  1BXT A;  2QEJ C;  4ZYS A;  1HQR D;  1JR0 D;  3DWQ A;  1FNW A;  2R61 A;  4K6L A;  5FKA C;  1PZK D;  1I4H A;  4RGT A;  1V1O A;  1PRT F;  1I4R A;  1LT3 D;  1F77 A;  1CT1 D;  1V1P A;  2AQ2 B;  2XN9 C;  1JWM D;  1HTL D;  1BCP F;  4Z9C B;  1SJH D;  1LTB D;  3R2T A;  5ELF A;  1KTK A;  1PYW D;  1ESF A;  1B1Z A;  2AQ3 B;  4BWG B;  4DXF A;  1PTO D;  3OWE B;  1T5X D;  1PTO B;  4DXG A;  3R8B A;  5FK9 C;  3W2D A;  1D6E C;  1LTA D;  2QIL A;  3O13 A;  1AW7 A;  3CHB D;  1CHP D;  1LTS D;  2G9H D;  2IJ0 A;  1S5E D;  4RGN A;  5I4D A;  1CHQ D;  1FGB D;  1JCK B;  3BZD B;  1I4Q A;  4RCO A;  1S5B D;  1I4G A;  1G8Z D;  1I4P A;  1FNU A;  5ELD A;  3BVM A;  1LT6 D;  1PTO F;  3MFG A;  3DWP A;  1GOZ A;  3GP7 A;  3BVG A;  2J4X A;  1B44 D;  4TSS A;  5D3I B;  1PTO H;  1I4X A;  1EWC A;  2TSS A;  3V05 A;  2XRQ D;  4RHS A;  1LO5 D;  4RFB A;  3EFX D;  1XTC D;  1PZI D;  2CHB D;  3URY A;  1ET9 A;  1SJE D;  2RDG A;  2O2L D;  1FD7 D;  1DYQ A;  1V1P B;  2WV6 D;  2Z8L A;  1TS2 A;  1S5D D;  1TY2 A;  5ELE A;  1RD9 D;  1S5C D;  3KLS X;  1D5X C;  4RHR A;  1KLG D;  1D5Z C;  1L0X B;  1LTG D;  1XXG A;  1D5M C;  2RDH A;  2XNA C;  5D3D A;  4UDU C;  4C56 C;  1LTI D;  1RF2 D;  1FNV A;  3SEB A;  1AN8 A;  1SE2 A;  1HXY D;  1LTR D;  1DJR D;  1TY0 A;  1LTT D;  1SEB D; 
#chains in the Genus database with same CATH topology
 2KCT A;  4HJ9 A;  4ILW A;  1OXV A;  1ROD A;  3G4S A;  1ZYR C;  3JAM E;  1P16 A;  4IQZ A;  4LFC L;  3S24 A;  4PZ8 A;  4OGQ C;  2FHT A;  3JAM L;  4A3M B;  1QIL A;  5KNB A;  3BZK A;  1STE A;  1HNW Q;  1H9K A;  3NTH A;  3U50 C;  3RZD B;  3UDX A;  2NZ1 D;  2AWN A;  1WD1 A;  1E22 A;  4A3E B;  1WTV A;  2J0T D;  1WFQ A;  1AZQ A;  1BBU A;  4JOI C;  5C0X J;  1N36 L;  2EYP A;  3PQI A;  3HKS A;  2E75 C;  4MZ9 A;  3CCJ A;  5M5W B;  1JC7 A;  1H9M A;  2FMC A;  3HKZ G;  3KUP A;  5COR A;  5FOB B;  1DOM A;  1O7Y A;  2NTT A;  3FKI B;  4DAY A;  3PF4 A;  1MD2 D;  4Q0F A;  1K8M A;  3CC7 A;  2IPK D;  2MFI A;  4A3E G;  3KOJ A;  3MA2 B;  1KNE A;  3S1N B;  4HJ8 A;  1FVI A;  4CDC C;  1TWH B;  4XYO A;  4DUY Q;  1GD7 A;  4PV1 C;  3J80 E;  1I5F A;  1EIH A;  3FKI G;  2N3S A;  4FXD A;  1SRU A;  5BN4 A;  4BA2 I;  2IHE A;  1LTB D;  1AEX A;  4GLX A;  5M5Y B;  3OHX C;  2B2V C;  5I6W A;  4EQO A;  1BVS A;  4IAL A;  1OTC A;  4A3I H;  2SNS A;  3OTO Q;  2XWB B;  4RWS C;  1STG A;  4HCS A;  1S5E D;  2EYL A;  4DK3 C;  2MGS A;  3RLN A;  1ZEQ X;  4HJ5 A;  3K5L A;  2E74 C;  3Q0A A;  2UUB Q;  1S4Z A;  3L3O C;  4APV A;  1H95 A;  4DR1 L;  5JJL A;  4FF3 A;  1TWG H;  5C0X I;  2F0O A;  2H5X A;  4NKL A;  1GOZ A;  4NXN Q;  2PI2 A;  3G7L A;  1X65 A;  2VS1 A;  1NE3 A;  1YBY A;  4IUP A;  3GV6 A;  3L2P A;  4LF5 Q;  3TRE A;  3M3Y H;  2NUC A;  1PHJ A;  3ER0 A;  3HOV B;  1S5D D;  3MXG A;  4NXN L;  1RD9 D;  2JA9 A;  4A3L G;  4IJH A;  4R4I A;  3M7G A;  3I90 A;  2K32 A;  1WOC A;  4C56 C;  3TDQ A;  1RF2 D;  3VYU A;  1FL0 A;  1PH6 A;  1TY0 A;  4DV4 Q;  2NN6 H;  5J1Z A;  1F2M A;  1RTO A;  4AH6 A;  2Z0S A;  4J15 A;  1G51 A;  1I3Q B;  2R92 H;  4KI0 A;  3P75 A;  4H02 A;  3TME A;  4JC0 A;  3RLO A;  1HNZ L;  1J8I A;  1UE7 A;  3EVQ A;  5HUR A;  4DV4 L;  1V43 A;  1X6O A;  3H0G H;  4X66 Q;  1KLU D;  3I4M H;  1VDZ A;  4FO2 A;  4WJW A;  5CBE E;  1UEB A;  3A54 A;  1WYD A;  4C3H B;  5M3M B;  1KHI A;  1D1K A;  1TXY A;  2F1M A;  1HA5 A;  4JBJ A;  1E24 A;  3M9B A;  1YIJ A;  3H15 A;  2I0Q A;  4A3K B;  4RGO S;  1HCZ A;  1JE5 A;  4UP7 A;  1EY9 A;  4A3M H;  1Q1B A;  2F0N A;  3H09 A;  1FGU A;  3RZD H;  3VR2 A;  1PH4 A;  1MBY A;  3OW2 A;  1BXT A;  3H6M A;  4A3E H;  1WTW A;  2KCC A;  2EYH A;  2L11 A;  2XTI A;  3FPP A;  4PZ7 A;  1PYB A;  1VQ8 A;  3V96 A;  3HFZ B;  4HN7 A;  1HZ9 A;  2RKS A;  5IGE A;  5M5W H;  1IBL Q;  1N9W A;  2M9V A;  3FKI H;  3NQT A;  5ELF A;  3E5S A;  2GVB A;  1E3P A;  4MIU A;  3R8B A;  3E6Z X;  1B70 B;  4KY5 A;  5IYC G;  3CHB D;  3W3A A;  3TP8 A;  4WOR A;  3S1N H;  4DV7 Q;  1EQQ A;  2IJ0 A;  2E5L Q;  4IJL A;  1DZ1 A;  1IBL L;  1TWH H;  2OTJ A;  5F2D A;  4DK0 A;  4X65 L;  2R7F A;  3CD6 A;  4DGZ A;  1YJW A;  1Y1W B;  1ASZ A;  3T4A C;  2VB3 X;  4DFA A;  2DJG C;  4DV7 L;  2E5L L;  5M5Y H;  1ZKO A;  1SNM A;  1MI2 A;  5LMU Q;  3KYH C;  1MJE A;  5AJ3 L;  3V05 A;  2XRQ D;  3NEM A;  4RFB A;  1AP0 A;  3CMA A;  3PO3 G;  2SDF A;  1ET9 A;  4DAP A;  2E2J B;  4DV0 L;  1TS2 A;  2VL6 A;  5JEA H;  3DLL A;  1CM9 A;  2AUK A;  2JP1 A;  3UE1 A;  2ZJP A;  4QF4 A;  5LMU L;  2ENB A;  4DR4 L;  4IO9 A;  4KTA A;  1D5M C;  3NWS A;  2LFN A;  4GNX B;  3OMG A;  4Q5V A;  1CKN A;  1ICW A;  2AQ1 B;  5FLM H;  4A3D G;  1GO3 E;  2EXD A;  2UUA L;  4K8J A;  3M4Y A;  3ERQ A;  3KF8 A;  3CCL A;  4OWT B;  3HOV H;  5HGT A;  3FEW X;  3FRP B;  1PFS A;  4R8N A;  2K28 A;  4PMC A;  4CKB A;  2JXM B;  1PH7 A;  2K7V A;  2KED A;  5BN3 A;  2F0W A;  2JK8 A;  2OF1 A;  1UNS A;  3K7A B;  2L15 A;  1I3Q H;  3IAY A;  1G2S A;  1N8R C;  4DV2 Q;  2A69 D;  3HP3 A;  3MEH A;  1JQY D;  5JJI A;  1IL2 A;  4POF A;  3DHQ A;  4H7B A;  1QCB D;  3GTP B;  4C3H H;  5LL6 S;  5M3M H;  3HGB A;  2EYJ A;  3W1G A;  3CCU A;  1I4H A;  4DV2 L;  4IUU A;  1EFW A;  1QG7 A;  4A3K H;  5A2Q L;  4QB4 A;  3M85 A;  2IX0 A;  1GJX A;  1HTL D;  1WCM G;  4JI0 L;  3QJY A;  1CI3 M;  1BBW A;  2BE5 D;  3WOE A;  2JA8 G;  4A3C G;  3S9W A;  1VQG A;  2CQO A;  3BS1 A;  1VQ4 A;  1XPO A;  3PGZ A;  1CZW A;  2JSO A;  2F0K A;  3GTJ B;  4P71 A;  4R9W A;  1B9N A;  1I4G A;  1I4P A;  4K5V A;  4DNI A;  1A3T A;  1K73 C;  1EY6 A;  2A1A A;  3QO2 A;  1VQB A;  5IT9 L;  4CJ0 B;  2DN8 A;  2J4X A;  3RNU A;  3CW2 C;  1TVX A;  5GAE C;  2CH4 W;  1I4X A;  4UPA A;  1VMP A;  4O42 A;  4KHV A;  1K9M C;  3OSO A;  1X55 A;  3NBI A;  2EPB A;  4UY8 C;  1XNR Q;  5CV4 A;  1DYQ A;  4A76 A;  3MHB A;  2MNA A;  3J7Y W;  1UE5 A;  1L2F A;  3HOZ B;  3ITP A;  4RAU C;  1YHQ A;  4DF7 A;  3PF5 A;  1Y1W H;  2R7D A;  2NBF A;  4BY7 B;  4IUN A;  3AQQ A;  3RZO B;  3I72 A;  4DR2 Q;  2G5D A;  2A68 C;  4OIJ A;  4GNX C;  3FP9 A;  1F9R A;  3Q8D A;  4G57 A;  1B9M A;  3MEF A;  1DJR D;  3A8I E;  4YWM A;  3VR3 A;  2E8G A;  5COY A;  2EY1 A;  1PRT B;  4XT1 B;  3HOZ G;  3MXN A;  4DR2 L;  2EJG C;  2M00 A;  4BY7 G;  3PMF A;  4IPD A;  4BXX G;  3MXP A;  1SYC A;  4JYA Q;  3F2C A;  5LMN Q;  3RN2 A;  2BCO A;  3CRL C;  3A74 A;  1S72 A;  2JQO A;  4DR5 Q;  2EYO A;  2NZO A;  3RLF A;  1HHV A;  3J81 i;  2ICI A;  5GAG C;  3ULL A;  3H3V C;  2F0Q A;  4PQX A;  1JWU D;  5C4H A;  3IFD A;  5EKI A;  4NPS A;  4F8M A;  5IP7 G;  5EPL A;  4JYA L;  5J3B A;  3S1R B;  1WTO A;  3UDI A;  5ELB A;  1YI2 A;  4B08 A;  2PQA B;  2KJX A;  1N33 Q;  1X9N A;  2B2W A;  3TSS A;  1B4O A;  2OEO A;  3QIA A;  3F2D A;  1JR0 D;  5FJ8 G;  3DWQ A;  1B3Q A;  5JVH 3;  1JOQ A;  3K7A H;  3NHH A;  1NUC A;  2QA4 A;  5LMN W;  1QZG A;  4OO1 I;  2AMC B;  1OO9 B;  2J7Z A;  3CRK C;  2YTX A;  2HIV A;  1L0W A;  3R93 A;  2CCZ A;  4NXM Q;  2B63 G;  4HIM A;  3T1Y Q;  1RKN A;  3GTP H;  1ZXT A;  1BOS A;  3VDY A;  2VXW A;  4HTH A;  4A3C H;  1DOK A;  4ZAI A;  1E2V A;  1PH5 A;  4ALP A;  3GTL B;  5EBC A;  4GOP A;  2GVA A;  4NXM L;  2O5I C;  1JMC A;  1PH3 A;  2D0P A;  5D3I B;  1N34 Q;  2B2U A;  4RHS A;  3UI2 A;  2B2T C;  3H3V I;  2N49 A;  2F3I A;  4XQN A;  1FD7 D;  2DUD A;  3GTJ H;  3KLS X;  5IGF A;  4RHR A;  4JI5 L;  2H4O A;  1L0X B;  1N34 L;  5IP9 G;  1C4Q A;  1XXG A;  3CPF A;  4Y52 H;  4UDU C;  3PUW A;  5KRU A;  3A55 A;  2ASB A;  4HCE A;  3SK8 A;  4A3F B;  3SK4 A;  4EQP A;  1PRT C;  4DV1 Q;  2FMM A;  1STB A;  1E0B A;  1IYU A;  3CCS A;  4G7Z C;  4DV6 L;  1RCV D;  3HOZ H;  2PMZ B;  1F2L A;  2Q8I B;  1IHZ A;  3NTI A;  1EOV A;  1JB7 A;  1M4V A;  4BY7 H;  3RZO H;  3A5Z B;  1DOL A;  4RGM A;  1HFN A;  1PH2 A;  4IFD G;  3MWY W;  4F88 A;  4DV1 L;  3K0Y A;  4KLK A;  4OIK A;  2R7Z G;  4DR7 L;  4DNT B;  4L5Q A;  1AE3 A;  5IGC A;  1E2Z A;  1JB3 A;  2MP1 A;  2OTL A;  5IP7 H;  4K0K L;  3EJI A;  1SE3 A;  4DAM A;  4OXP A;  2EJF C;  2NYZ D;  4X3T A;  1PZJ D;  1U4P A;  2JEA I;  2DNE A;  2Z9H A;  4IZ8 A;  4LK1 C;  4YWK A;  3K58 A;  3TS0 A;  1LUZ A;  4AYB B;  4KHP Q;  4XT3 B;  1R4P B;  1PV4 A;  2PW5 A;  1J6Q A;  3S1R H;  2B29 A;  2DNC A;  3R2T A;  4I7A A;  3U58 A;  3C2P A;  2AQ3 B;  4BWG B;  3VA7 A;  4H0L C;  1T5X D;  3GO5 A;  4CDE C;  4DK6 C;  1HUN A;  2ZXP A;  1CUK A;  2B3G A;  3KF6 A;  1NSN S;  3K5M A;  1LTA D;  4TKO B;  1VCI A;  1AW7 A;  4AYB G;  5IYB H;  2YYZ A;  1VF7 A;  4ZLT F;  1F2Z A;  1YNN D;  4J6H A;  1JCK B;  2PNH A;  1KDA A;  2F0F A;  2R3Z A;  4YIJ A;  1XWE A;  2RVL A;  3F1Z A;  1A8V A;  3BDO A;  5IT9 c;  4I65 A;  4R1J A;  4LUV A;  4KV6 A;  3Q6S A;  5BN5 A;  2OT2 A;  3KFU A;  1Z47 A;  1CSQ A;  1XTC D;  4MN3 A;  1GVP A;  1QUQ B;  4K8I A;  1OXU A;  5FLX c;  4X62 L;  4JI3 Q;  3P1H A;  5ELE A;  4A3J B;  3AFQ A;  2EZV A;  3GTL H;  4RMF A;  2QF7 A;  4BBR G;  1SNO A;  2RDH A;  2RCF A;  2CKZ B;  4HJA A;  3VYS A;  3EBE A;  2WP8 J;  3SVM A;  5IP9 H;  3S1Q B;  2VQF L;  1GUW A;  3RD4 A;  5GAD C;  5E4W C;  4A3J G;  3BVZ A;  2KEE A;  1YNX A;  3R3O A;  2KCM A;  2WAQ E;  1BCP D;  1HPC A;  5IGG A;  3GDE A;  3SGI A;  2EY2 A;  4OX9 L;  2L1B A;  4IFD J;  1S5F D;  2A74 C;  3AB9 A;  4L5R C;  1IYJ B;  5E3F A;  1PH8 A;  4KK7 A;  2Z6K A;  1SBB B;  4IFD H;  2QGQ A;  4ZUJ A;  4A3F H;  4HIO A;  2KCN A;  5M9O A;  2WB1 E;  4BS9 A;  2TMP A;  4GN3 B;  4MNO A;  3C1F A;  2A6H D;  1DD2 A;  5D65 A;  4IN3 A;  4QIW B;  4AQY Q;  1BQQ T;  2B39 A;  4YWL A;  3CC2 A;  1AFP A;  1CKN B;  3HKZ B;  4LFA Q;  1G6P A;  1LM0 A;  2CWP A;  1CA5 A;  1VQ6 A;  2RDF A;  1KRS A;  1PZK D;  4C2M B;  2F0E A;  4QL5 A;  3UE0 A;  4N8F A;  4CKC A;  1UEA B;  4RG1 A;  1QVG A;  1HNW L;  3ND9 A;  4LFA L;  2K05 A;  4R4O A;  5I2X A;  3PIO A;  3A56 A;  1EY4 A;  4N9T A;  1GUO A;  5C0X H;  4JI1 Q;  1W3S A;  2QIL A;  1Y14 B;  2VB2 X;  2NB0 A;  1MIU A;  1CHP D;  4KD3 A;  2G9H D;  1STN A;  4IFD I;  1HR0 W;  1SLJ A;  1YNJ D;  1QVF A;  4C3I G;  3N52 A;  1Y8P B;  3TP6 A;  3J80 L;  3CPW A;  5CV8 A;  4OON A;  4BY1 G;  3HZX A;  4DUY L;  1SJE D;  1TT2 A;  2RDG A;  5HY6 A;  1LAB A;  3I91 A;  4L5T A;  1SRO A;  1HFG A;  4B3M Q;  1LTG D;  1XPR A;  1EY7 A;  5EJW A;  1LYL A;  2YV5 A;  4N8X 1;  4ZKB B;  3MAQ A;  1HJP A;  3NTK A;  1HXY D;  2LMC B;  1JJG A;  1SYD A;  2O4X A;  3OTO L;  1SYF A;  3D4W A;  2F0G A;  4NW2 A;  2GN5 A;  4P74 A;  3TEH B;  4FXG C;  2EOT A;  2QEX A;  4GLV B;  4JBW A;  5ELO A;  1C48 A;  1RIP A;  1TS5 A;  5DNF A;  5EBD A;  2UUB L;  3MC0 B;  5C3E G;  4A3J H;  3GQB A;  4P75 A;  1WTQ A;  3DM1 A;  3PIP A;  2LSS A;  3RN5 A;  1GKH A;  1UE6 A;  1NJI C;  3LWE A;  2JN4 A;  2JE6 I;  3C46 A;  1KXL A;  3S1Q H;  2F52 A;  2VZA A;  1BNZ A;  4LF5 L;  1PFN A;  3J81 E;  3CP0 A;  3HKZ E;  3KDF A;  2AHO B;  4GKK Q;  3FHW A;  1SDF A;  2H1E A;  2WIN B;  1HUM A;  4P2C B;  3HOW G;  4GZY C;  2EIF A;  4FDB A;  2OWO A;  2KEC A;  1A62 A;  4POG A;  4B3S Q;  1XNQ Q;  2ZTD A;  3SK5 A;  1I94 Q;  4GKK L;  2F3W A;  2XN9 C;  4JK1 C;  5EAY A;  1JWM D;  4BBS B;  3L9A X;  3EN2 A;  3AU7 A;  2K75 A;  2RF4 A;  3QG1 A;  4X66 L;  2CW0 C;  3HOX G;  4A4I A;  3NEL A;  1K83 B;  4C3J G;  4B3S L;  1XNQ L;  3S2D B;  1I94 L;  2I07 B;  1QNU A;  4RGN A;  2Y0S B;  1XTD A;  2MO1 A;  1D8L A;  1BUV T;  4C2M H;  4PMW A;  4BBS G;  1EY8 A;  3GD7 A;  4P73 A;  3IFT A;  3D4R A;  1H9S A;  2KHS A;  3A8K E;  2PZU A;  1JT8 A;  1KAB A;  2CW0 D;  1V8Q A;  2Y0S G;  1EQR A;  3A0J A;  4FF1 A;  2ZT9 C;  4X6A H;  3URY A;  3S1M B;  1T5E A;  1EYG A;  3NWT A;  1B3A A;  1Z7T A;  1TWA B;  2EYF A;  5NUC A;  4DR3 Q;  4U68 A;  1VQI A;  1KLG D;  1KRT A;  1D5Z C;  3PO3 B;  1GUT A;  1C0A A;  4J1M A;  2PZT A;  1VQ9 A;  2EY6 A;  4NMZ A;  1WI5 A;  3QR8 A;  4A75 A;  3GTQ B;  4FF4 A;  3AYH B;  1MSH A;  1ASY A;  2B2Y A;  1BKB A;  4ME5 A;  4OHJ A;  1JOR A;  1X3F A;  4GOP B;  2UUC Q;  5GAH C;  1LTL A;  1S40 A;  4A3D B;  4S3S A;  1K3B C;  2N55 A;  1HQM C;  3W5O A;  1EYD A;  5DM7 3;  2NTS A;  3RUZ A;  4R8I A;  1K8O A;  3OW7 A;  2AWO A;  3A7L A;  4A3L H;  3VR4 A;  2OQK A;  3KJO A;  1ENF A;  5DEH A;  4OO1 G;  3CAM A;  1QVC A;  3IKJ A;  1PTO C;  1PDQ A;  1B2T A;  1A3V A;  3JAM c;  1CZG A;  2A69 C;  3HOY B;  3NBH B;  1VQO A;  3NEN A;  1VQA A;  4QCL A;  2XRS D;  3CF5 A;  3GTO B;  5IOC A;  3NUC A;  3K6O A;  4N9P A;  1KQS A;  1X56 A;  2I5M X;  4XQJ A;  5J22 A;  1PRT F;  3I3C A;  4CHT B;  1B50 A;  2BDN A;  1V1P A;  3KBG A;  4LF9 Q;  3HOY G;  3T1H Q;  1SJH D;  1LV9 A;  3D31 A;  1GHK A;  1E7Z A;  2WFW A;  1PTO D;  1PVO A;  1S3O A;  2BE5 C;  4XXE A;  4LF8 Q;  1KNA A;  1YZ6 A;  1WCM B;  4B3T Q;  2PNR C;  1YEZ A;  2X69 A;  4LF9 L;  1CHQ D;  1DM0 B;  1RTN A;  3T1H L;  2JA8 B;  4YY3 Q;  4RCO A;  5EPJ A;  3SR1 A;  2RSN A;  3BVM A;  2MUY A;  4F7X A;  3MFG A;  5C3W A;  4LF8 L;  2RQX A;  2Z1C A;  4BBS H;  3BVG A;  1CA6 A;  4IUV A;  2C5C A;  2B2W C;  1V1Q A;  3K5O A;  4P72 A;  1K83 H;  3S2D H;  3U4Z A;  1EQT A;  2HD3 A;  2ZTE A;  3K59 A;  2Q2H A;  1W2B A;  2Z4I A;  3T53 B;  3TZD A;  5IYC H;  5CGK A;  4HMI A;  2BH8 A;  1UAP A;  1LTI D;  4HED A;  3SEB A;  2IHF A;  3GV3 A;  1YHA A;  2N78 A;  1XMO Q;  2K33 A;  2DY7 A;  2JJQ A;  2K03 A;  2L5T A;  3D3R A;  1X3Q A;  4K6D A;  4NP5 A;  2MPM A;  3S1M H;  3T16 A;  4UHV A;  1EOT A;  4GLA C;  1G91 A;  1TWA H;  4RKL A;  4JCV E;  1VF5 C;  5EQ0 A;  4GOP C;  2HCI A;  4WJ4 A;  5C4Z A;  3PO3 H;  4DK1 A;  2BH2 A;  1YHB A;  1VMC A;  2K5W A;  4L6T B;  1HRJ A;  3S2H B;  5CBA E;  4DKA C;  2K6A A;  1AH9 A;  3GTQ H;  2KHI A;  1NNX A;  1QOH A;  1XNR L;  4L63 B;  3NP8 A;  2FFK B;  2V4D A;  2X6G A;  1TQO A;  1CFM A;  1SE8 A;  5FLX E;  2E2J H;  4OO1 H;  5FO9 B;  2LY7 A;  4R4C A;  5G3L D;  4A3D H;  2VQE Q;  3HOU G;  1IKL A;  4FNF A;  1HQR D;  4JBK A;  3BJU A;  4K6L A;  2KHJ A;  3HS0 C;  1VQM A;  2RCN A;  1GM5 A;  3GTG B;  1NR2 A;  2F0S A;  2VQE L;  2UXC Q;  5LMN L;  2I5H A;  2VUM G;  3HOY H;  4KJN A;  2Z6B A;  5FK9 C;  3TP7 A;  2UXD Q;  4DR5 L;  1QJO A;  4LW1 A;  3GTO H;  1WTH A;  1I50 B;  2NVQ B;  1F9Q A;  2UXB Q;  4JVZ A;  3I4N G;  1I4Q A;  3SDZ A;  3H3V H;  4GKJ Q;  3M4O B;  2MO0 A;  2B63 B;  5C4X B;  1SYG A;  2NVX B;  1H9R A;  2JA5 B;  3S17 B;  2EVB A;  4TSS A;  4LWC A;  4JI2 Q;  1N33 L;  1HA6 A;  3V2T A;  2NVY B;  3EIV A;  4IOA A;  3I7F A;  3H91 A;  1WCM H;  3DEO A;  2JA7 B;  1K0S A;  2Z8L A;  5C4X G;  2M2L A;  2JA8 H;  2OCE A;  2JA6 B;  1SFO B;  4PG3 A;  2JA5 G;  3K57 A;  1D7Q A;  4A3B G;  5D3D A;  1DCZ A;  1IBM Q;  1FNV A;  4DAY B;  1V9P A;  3M4Q A;  1YVC A;  5IGB A;  5T1G A;  2CH4 A;  5C6A A;  3S16 B;  3T1Y L;  1TS4 A;  2JA7 G;  3E0E A;  1KL9 A;  2MJ8 A;  1Q8I A;  3FDT A;  3R2I A;  1HZA A;  3X3M A;  3LGJ A;  2A6E D;  2JA6 G;  3QWN A;  5K36 G;  1EZ6 A;  1IBM L;  1BCP B;  1C9O A;  2F0I A;  5IYD G;  1JOO A;  3DUZ A;  4X64 Q;  3K5N A;  4EVO A;  3BYT B;  2O5J C;  2K52 A;  5JOB A;  4HSP A;  2PW7 A;  4ZK9 B;  3AMU A;  2YTV A;  1LLR D;  2K5H A;  4ODG A;  4CKE A;  1JOK A;  1EEI D;  3NQI A;  1EU4 A;  1Y8N B;  4R4T A;  5LL6 X;  2R7Z B;  1STH A;  1GUG A;  1Z6H A;  2PYK A;  2EDG A;  3T51 B;  3DXJ C;  1Y1V B;  2P5Z X;  1L0Y B;  1SAP A;  2ID0 A;  2KEN A;  2L12 A;  2R61 A;  2QDB A;  2RHQ B;  4BXX H;  3S2H H;  5KYL A;  3DMU A;  2YTY A;  3U4V A;  3I4L A;  1F77 A;  5JVG 3;  4YHH Q;  4I7Z C;  4Z9C B;  5J39 A;  4CJ2 C;  1KTK A;  5CYU A;  5IGD A;  4BA1 I;  1BF4 A;  1Y1V G;  4DXG A;  1SMY D;  3TZU A;  3ZYY X;  2N8N A;  4LAA A;  1Z9F A;  1VQ7 A;  2Z6K C;  3WDN A;  2XWJ B;  2ZJR A;  1Q1E A;  4CBV A;  1KC8 C;  2E2D C;  3SHL A;  5K5P A;  4A93 G;  3E0J A;  1YNN C;  3PV0 A;  2F0J A;  1JE4 A;  4DV3 Q;  3KDF B;  4ME3 A;  2A8V A;  3E9I A;  1Q7Y C;  3WWV A;  3GTG H;  4O0A A;  1Q82 C;  4ABN A;  5FJ8 H;  1OXT A;  1IW7 D;  1NMF A;  2HDM A;  2K5N A;  4OEL B;  1Y69 U;  2TSS A;  4XDX A;  4ZQ3 A;  1CQF A;  3N6R A;  2ZJQ A;  1UWV A;  2L4N A;  4TQU S;  1NTG A;  3EFX D;  1N32 Q;  1PZI D;  1I50 H;  2NVQ H;  4KHP L;  2F4V Q;  1U0L A;  5BR8 Q;  4XIG S;  4ZCK A;  2B63 H;  1SYB A;  5C4X H;  3STB C;  3M4O H;  2G9D A;  5IWA Q;  4DAV A;  2NVX H;  4XTC S;  1N32 L;  3UDF A;  2JA5 H;  3S17 H;  2K5Q A;  3B6Y A;  1SYE A;  4G7O C;  5BR8 L;  2NVY H;  1Q81 C;  4BBR B;  4JPB W;  4E6I A;  1TII D;  4DR6 Q;  1T9H A;  1XMQ Q;  2HQL A;  1ENC A;  2JA7 H;  5A35 A;  4GN5 A;  4QGU A;  4GS3 A;  1L1O A;  2WAC A;  1W6K A;  2CWA A;  1BCP C;  1SN8 A;  4O1N A;  1LAC A;  1SFO H;  2JA6 H;  3J7A F;  2BDO A;  5K36 H;  4IPC A;  2VW9 A;  1NCV A;  3L7Z C;  5M5X B;  3STB D;  1RHP A;  3U9S A;  3T13 A;  4DR6 L;  2MHV A;  1GHJ A;  5KIX A;  2K01 A;  1VQF A;  3GTK B;  3S16 H;  1F9S A;  4FYD A;  1SNC A;  3SK6 A;  4IUT A;  4JI7 Q;  4JI3 L;  2PMZ E;  3LWU A;  3LX0 A;  4A3I G;  1BBX C;  2PI2 E;  2XVS A;  4L5S A;  3CCQ A;  2R93 B;  1CK1 A;  1EUJ A;  2PPB C;  1LT4 D;  2HHH Q;  4CDF C;  1X32 A;  2A6H C;  3BDL A;  4CDD C;  1PH9 A;  1VQC A;  3CME A;  2K5D A;  2I5L X;  1M90 C;  1K0R A;  3F8T A;  4JI7 L;  2QEJ C;  4UAI A;  1U5K A;  2RBM A;  1G2T A;  4RGT A;  5E7N A;  3T56 B;  2HHH L;  1V1O A;  2R93 G;  1HZB A;  4JI8 Q;  1IXR A;  4MTN A;  1Q12 A;  3HG9 A;  3QB3 A;  2R7Z H;  4LFB Q;  1FYC A;  1K8G A;  1YJN A;  2IT1 A;  1HR0 Q;  5C5L A;  1HNX Q;  3J81 j;  3O13 A;  4ZUI A;  4JI8 L;  1Y1V H;  4AYB E;  2IL8 A;  1Q8K A;  4LFC Q;  5JJZ A;  2PZW A;  1EY5 A;  1IKM A;  1DON A;  1G8Z D;  1YNJ C;  2NN6 G;  1GXD C;  2PQA A;  5ELD A;  1PTO F;  1HR0 L;  1HNX L;  2B8G A;  5AFW A;  3KF8 B;  4FVM A;  3GP7 A;  4AQY L;  4Y7N B;  1VS0 A;  4C3I B;  5JAV A;  2RHS B;  1VQH A;  4U67 3;  3ERO A;  3J7A 5;  3RR5 A;  3H0G G;  1N36 Q;  4AIM A;  3I4M G;  2O2L D;  1V1P B;  1J9O A;  2JYO A;  1DGS A;  4YCU A;  1AZP A;  1D5X C;  4BY1 B;  3ULJ A;  3K8A A;  5CV5 A;  1PFB A;  1FR3 A;  1AN8 A;  2EE1 A;  1SE2 A;  4A3M G;  4JI1 L;  1ZYR D;  3CCM A;  5FO8 B;  1NR4 A;  3KLW A;  1CQV A;  3CCV A;  1II3 A;  3RMH A;  3D4D A;  4DN4 M;  3D0F A;  5TSS A;  1VQL A;  1NAP A;  2C9O A;  5I6Y A;  5C3E B;  2CQA A;  3PO2 B;  1WVL A;  1X3G A;  4BBR H;  1KDB A;  4DR1 Q;  2ATW A;  4B3M L;  2CFM A;  4RH6 A;  5C5M A;  4PMB A;  4QMG A;  3PO2 G;  4QY7 A;  1E2W A;  2IY5 B;  5M5X H;  2D62 A;  2GA4 B;  2EYM A;  1B8A A;  2DY8 A;  2R92 G;  1CKO A;  3BDC A;  2B2Y C;  3I8Z A;  3GTK H;  3IRB A;  3QOL A;  1LT3 D;  1O7I A;  3PUX A;  3HOW B;  4QIW E;  4IPG A;  3J7Z C;  2R93 H;  1U4R A;  1Q86 C;  5G3L F;  2IX1 A;  4WFN 3;  1B1Z A;  1OXS C;  2HDL A;  3KLS A;  1PTO B;  2HUG A;  4KKT A;  5H1S E;  3J81 L;  4MTK A;  5JEA G;  3J7A V;  3MTS A;  4B9W A;  5D14 A;  1A63 A;  1LTS D;  2K4K A;  2ALY B;  2WII B;  5EGT A;  4RCN A;  3HOX B;  4ZRZ A;  1K28 A;  3CKI B;  3G6E A;  3OYY A;  4G7H C;  3I2Z A;  1HNZ Q;  4C3J B;  2ES2 A;  2KVM A;  4RKB A;  3DWP A;  5FLM G;  4EX5 A;  3MXN B;  1O78 A;  5EKK A;  4QUC A;  1PA6 A;  1KAA A;  2E2I B;  3PUZ A;  3HOV G;  3KK7 A;  3Q23 A;  5IY0 A;  4TRD A;  2CHB D;  2D9U A;  3PSI A;  4JOI A;  4KHZ A;  1K3R A;  1J5E Q;  3A7A B;  2AUJ D;  3FMC A;  4JI4 Q;  3VR5 A;  1S5C D;  2ZXR A;  3CXC A;  2A19 A;  5C44 B;  5CMD A;  3OWF A;  1ILP A;  2XNA C;  4B3R Q;  1KDC A;  3KJP A;  1F2Y A;  4L8J A;  5I2Y A;  4Y7N H;  1A2U A;  1J5E L;  4C3I H;  4XYQ A;  4OEM B;  4JI4 L;  1ET6 A;  4KKS A;  3BYY B;  1YIT A;  5C44 G;  4KN4 C;  1NY4 A;  5IOD A;  2D0O A;  4B3R L;  4HSV A;  3WOF A;  4C3H G;  5M3M G;  1VQ5 A;  1JIC A;  4BY1 H;  1EEF D;  4J8Q A;  1A6X A;  5JJK A;  2NN6 I;  1FJG Q;  2B2V A;  2C35 B;  4A3K G;  1BR9 A;  1QUQ A;  1O80 A;  1MSG A;  1WTP A;  4EQN A;  1R4Q B;  3I4O A;  2HCC A;  4DPG A;  2PCF B;  5CV9 A;  3CQZ B;  1R9T B;  4A3G B;  1EU3 A;  4X65 Q;  4DR3 L;  5KGU A;  1FJG L;  2KBN A;  1K8A C;  3NE5 B;  3EA6 A;  3NXW A;  2LS0 1;  1VQD A;  3I56 A;  2OXP A;  1G29 1;  5AJ3 Q;  4CJ1 B;  5C3E H;  3G71 A;  3PO2 H;  1IYV A;  2KQ3 A;  5FKA C;  3VYT A;  4A3G G;  4ZKC B;  3C3L A;  2L55 A;  4DV0 Q;  4OWX B;  5LHY 1;  3EQL C;  4DR4 Q;  2UUC L;  2FJ2 A;  3G48 A;  3CCE A;  1PYW D;  5JEA J;  4DXF A;  2V1C C;  3W2D A;  1I6H B;  3LNN A;  5L37 A;  1Y1W G;  5I4D A;  1X3P A;  1DXM A;  1MHW C;  3OPO A;  2UUA Q;  1SMX A;  2RA4 A;  3M7N A;  2KA7 A;  3F2B A;  3HOW H;  1LT6 D;  2F3V A;  2N88 A;  4ULL A;  4YCW A;  2QKI C;  5M3F B;  1STY A;  1PTO H;  1BO0 A;  3K0X A;  2Y0S E;  1Q46 A;  1LO5 D;  5FO7 B;  4K2K A;  2QCP X;  3TN2 A;  4QJF A;  2F0T A;  2IWH A;  1TY2 A;  3NSW A;  3SXH A;  3HOX H;  5CV6 A;  2SOB A;  4C3J H;  1U9R A;  5M3F G;  2EY5 A;  2VNU D;  1EY0 A;  3I73 A;  3S14 B;  3HEJ A;  1M1K C;  4QUF A;  5IE8 A;  4K14 A;  1ONL A;  3JAM i;  1EIG A;  3HRZ C;  2E2I H;  2K50 A;  2KUM A;  1SEB D;  4B3T L;  3J80 c;  1EYA A;  1D2B A;  4PNY A;  2Q8R E;  4YY3 L;  4LF7 Q;  1U4L A;  2LXJ A;  2Q2U A;  3VYR A;  1LT5 D;  1EQV A;  1QWY A;  3K80 C;  3QOJ A;  4G4K A;  5C44 H;  4LJZ C;  4JI0 Q;  2XSC A;  5T1I A;  4KKU A;  4O2D A;  4DA2 A;  3PIO 3;  5A2Q E;  1Y8O B;  2L9H A;  2L0C A;  4LF7 L;  1EWI A;  3FVQ A;  3KF6 B;  5KYI A;  1SND A;  1HZC A;  1I6V C;  3BU2 A;  1KD1 C;  5KND A;  3PCO B;  5CC4 A;  1E1T A;  1GUS A;  2X6L A;  4FF2 A;  2BA0 A;  2YU9 B;  4K5W A;  1JWS D;  3JC6 6;  4HID A;  1C7Y A;  3J80 i;  2E76 C;  1XMO L;  4ZYS A;  1ILQ A;  1G6Z A;  2WKC A;  5IT9 E;  2ZM6 Q;  4KD4 A;  2B2U C;  1PH1 A;  1I4R A;  1JJ2 A;  1L1O B;  3CQZ H;  3MVV A;  3OMC A;  1R9T H;  3HOU B;  4A3G H;  4KN7 C;  2Z4H A;  4XQQ A;  2ZTC A;  2K14 A;  1BCP F;  3E9H A;  2JEB I;  1TU2 B;  2NVT B;  2HIX A;  3OWE B;  1NBW A;  5I9P A;  3J81 c;  3DM3 A;  2ZM6 L;  3TQY A;  1D6E C;  5FLX L;  4JG2 A;  2DJF C;  4NB3 A;  3CCR A;  3PUY A;  1IBK Q;  1FGB D;  3L0O A;  5IIF A;  2VUM B;  3KLR A;  1PXU A;  2Q2I A;  1A15 A;  1O7Z A;  1B7Y B;  3I55 A;  4K5X A;  3OIQ A;  3I4N B;  2F0M A;  1WTX A;  1MGS A;  2VY3 A;  1IBK L;  3PIP 3;  4LMQ D;  1I6H H;  1EIF A;  1XX8 A;  3C1E A;  1TWC B;  3G6J B;  5EKL A;  1HH2 P;  3X3N A;  1A0I A;  1QE6 A;  3ND8 A;  5CV7 A;  3CU7 A;  2AKW B;  5ELN A;  1XPU A;  4H44 C;  2EJM A;  2K1B A;  4QQB X;  1VQE A;  2UXC L;  3MZ5 A;  2A68 D;  3SE0 A;  1QZH A;  5C4J B;  4M1U B;  4HJ7 A;  2UXD L;  5M3F H;  2FIN B;  5DLQ E;  4LUO A;  1LTT D;  1VQP A;  4A3B B;  3TP5 A;  2UXB L;  4X3U A;  1SXT A;  3BZC A;  3VA5 A;  1RL2 A;  2UU9 Q;  4GKJ L;  2A6E C;  1TS3 A;  2F0U A;  2R6G A;  1UUP A;  2K5V A;  2LKV A;  1SR3 A;  3D6W A;  3NPP A;  3S14 H;  4JI2 L;  2CVR A;  3GTM B;  1D1I A;  4DNR B;  3PUV A;  4YCV A;  4JW0 A;  4FP5 D;  3D6C A;  2UU9 L;  4V19 0;  4IOC A;  1PFM A;  4X3K A;  1VQJ A;  5E1F A;  3F2U A;  2NWG A;  5ELC A;  2A73 B;  3UDG A;  5IYB G;  3IL8 A;  1A2T A;  3W1B A;  1SNQ A;  2Q8T A;  2EQS A;  2E2H B;  3D8G A;  1X3E A;  4EGV A;  4EQ5 A;  4C1N K;  1VQN A;  5HGQ A;  4CGY B;  4LNQ A;  3BG3 A;  1EWH A;  1GUN A;  1M8A A;  1CT1 D;  2IW3 A;  1MJC A;  1L1O C;  2DGY A;  1A3U A;  2F0D A;  4OWW B;  4JI5 Q;  2BA1 A;  4X64 L;  1MKH A;  2HQE A;  1TWF B;  2D2C C;  2WKD A;  3H94 A;  3OIP A;  4C1N I;  5KEE A;  2YU9 H;  4GNX A;  1SMY C;  5EPK A;  2F03 A;  4JV5 Q;  1XJV A;  1AE2 A;  4KY7 A;  2SNM A;  2XGT A;  3BZD B;  2QDL A;  1JJC B;  1XYI A;  3HOU H;  3NBH A;  4DV6 Q;  1UE1 A;  4KJO A;  4A93 B;  4UP9 A;  5E4X A;  2F0P A;  3S15 B;  4HAE A;  1IW7 C;  4JV5 L;  4LUZ A;  4JI6 Q;  2NVT H;  3ERS X;  1F9P A;  1OXX K;  2F4I A;  1STA A;  4IUR A;  5JPN C;  3AFP A;  3P7J A;  5CR3 A;  5KNC A;  1KAW A;  1BDO A;  1ML0 D;  4JBM A;  1ICF B;  4K2L A;  4DU9 A;  4YHH L;  5DM6 3;  1E1O A;  1U4M A;  4HMJ A;  2VUM H;  4JI6 L;  1VQK A;  1PMR A;  4K0K Q;  3NK9 A;  2WAQ B;  3A8J E;  3U9O A;  4A3F G;  3ICE A;  1Q3L A;  4NDX A;  3MFY A;  4M8A A;  3I4N H;  4UP8 A;  2I46 A;  3M4P A;  4GN4 B;  2BOS A;  1PRT D;  4LF4 Q;  4LF6 Q;  5ISR A;  1TWC H;  1EYC A;  1RJT A;  1PLF A;  3ONA B;  4DV3 L;  4WRD A;  5GRO A;  1EL0 A;  1TR5 A;  4IUQ A;  2WAQ G;  3VR6 A;  3TS2 A;  1CTM A;  2PQE A;  3KBX A;  2WB1 B;  1QB5 D;  2F0H A;  1B53 A;  3DWA A;  4H13 C;  1SE4 A;  1IL8 A;  5C4J H;  4LF4 L;  2LXK A;  2FXQ A;  3E3X A;  4LF6 L;  4DV5 Q;  3FPU B;  3P20 A;  4F87 A;  2MQH A;  2PO4 A;  1PYS B;  1CKM A;  2NZH A;  2F4V L;  4A3B H;  1NMG A;  5C0X G;  5C3X A;  1EZ8 A;  2QW7 A;  2SEB D;  1RDP D;  2WB1 G;  1ESR A;  2EXZ A;  3K7U C;  4RA8 A;  5IWA L;  4IPH A;  4DV5 L;  2ICE C;  2KOL A;  4A3I B;  2F0V A;  1H9S B;  3I70 A;  4KY6 A;  3MXU A;  1EFI D;  3Q22 A;  3GTM H;  5IYD H;  1FNW A;  4B9X A;  2B2T A;  2HT1 A;  3CC4 A;  1QNK A;  1XMQ L;  4X62 Q;  3TBI B;  1Q90 A;  5I9O A;  2AQ2 B;  1SSO A;  4X3S A;  1TWG B;  2IX3 A;  1IZ6 A;  1ESF A;  3ZJY C;  2A5H A;  2E2H H;  2K04 A;  2VQF Q;  1P8L A;  3OOC A;  4TVA B;  1WTR A;  3M3Y B;  1HTP A;  1C8C A;  1X54 A;  1YJ9 A;  4DUZ Q;  1S5B D;  4OL7 A;  2Q2T A;  1FNU A;  2ZXO A;  3A5U A;  4HIK A;  1ENA A;  4OX9 Q;  4HR7 B;  2B8F A;  1SNP A;  1H9J A;  1B44 D;  3ULP A;  1TWF H;  4PZ6 A;  3TRZ A;  1EWC A;  4DUZ L;  4R4Q A;  3K81 C;  4DR7 Q;  2R92 B;  1WJJ A;  5JPM C;  1CSP A;  4ID6 A;  2WV6 D;  4MHE A;  2RSO A;  1EIY B;  1KIX A;  1TKW B;  5DAU A;  4FXK C;  3H0G B;  4WJ3 M;  3I4M B;  4V0B A;  4LFB L;  1O7L A;  2F0L A;  3Q24 A;  1WD0 A;  2XIW A;  1W6J A;  3AEV A;  2OQ0 A;  3DEP A;  3S15 H;  4KMU C;  4A93 H;  5GQO A;  1LTR D;  2D5D A; 
#chains in the Genus database with same CATH homology
 4ILW A;  1OXV A;  1ROD A;  1ZYR C;  3JAM E;  4IQZ A;  4OGQ C;  2FHT A;  3JAM L;  4A3M B;  1QIL A;  5KNB A;  1STE A;  1H9K A;  3NTH A;  3RZD B;  2NZ1 D;  2AWN A;  1WD1 A;  4A3E B;  1WTV A;  2J0T D;  1AZQ A;  5C0X J;  2EYP A;  2E75 C;  5M5W B;  1JC7 A;  1H9M A;  2FMC A;  3KUP A;  5COR A;  5FOB B;  1DOM A;  1O7Y A;  2NTT A;  3FKI B;  4DAY A;  1MD2 D;  4Q0F A;  1K8M A;  2IPK D;  3MA2 B;  1KNE A;  3S1N B;  1TWH B;  4XYO A;  4PV1 C;  3J80 E;  1EIH A;  4FXD A;  5BN4 A;  4BA2 I;  1LTB D;  1AEX A;  5M5Y B;  3OHX C;  2B2V C;  5I6W A;  4EQO A;  4IAL A;  2SNS A;  2XWB B;  4RWS C;  1STG A;  4HCS A;  1S5E D;  2EYL A;  2MGS A;  1ZEQ X;  3K5L A;  2E74 C;  3Q0A A;  1S4Z A;  3L3O C;  4FF3 A;  5C0X I;  2F0O A;  4NKL A;  1GOZ A;  3G7L A;  4IUP A;  3GV6 A;  2NUC A;  3HOV B;  1S5D D;  3MXG A;  1RD9 D;  3M7G A;  3I90 A;  2K32 A;  4C56 C;  3TDQ A;  1RF2 D;  3VYU A;  1TY0 A;  2NN6 H;  5J1Z A;  1F2M A;  1RTO A;  1I3Q B;  4KI0 A;  3P75 A;  3TME A;  1J8I A;  3EVQ A;  5HUR A;  1V43 A;  1KLU D;  1VDZ A;  4FO2 A;  4WJW A;  5CBE E;  3A54 A;  4C3H B;  5M3M B;  1D1K A;  2F1M A;  1HA5 A;  4A3K B;  4RGO S;  1HCZ A;  1EY9 A;  1Q1B A;  2F0N A;  3H09 A;  3VR2 A;  1MBY A;  1BXT A;  3H6M A;  1WTW A;  2KCC A;  2EYH A;  2L11 A;  3FPP A;  3V96 A;  4HN7 A;  2RKS A;  5IGE A;  2M9V A;  3NQT A;  5ELF A;  3E5S A;  3R8B A;  4MIU A;  3E6Z X;  4KY5 A;  3CHB D;  3W3A A;  3TP8 A;  4WOR A;  2IJ0 A;  1DZ1 A;  5F2D A;  4DK0 A;  4DGZ A;  1Y1W B;  3T4A C;  2VB3 X;  4DFA A;  1ZKO A;  1SNM A;  1MI2 A;  3V05 A;  2XRQ D;  4RFB A;  1AP0 A;  2SDF A;  1ET9 A;  4DAP A;  2E2J B;  1TS2 A;  5JEA H;  1CM9 A;  2AUK A;  2JP1 A;  4QF4 A;  2ENB A;  4KTA A;  1D5M C;  3NWS A;  2LFN A;  3OMG A;  4Q5V A;  1ICW A;  2AQ1 B;  4K8J A;  3M4Y A;  3ERQ A;  3KF8 A;  5HGT A;  3FEW X;  3FRP B;  4R8N A;  2K28 A;  4PMC A;  4CKB A;  2JXM B;  2K7V A;  2KED A;  5BN3 A;  2F0W A;  2OF1 A;  1UNS A;  3K7A B;  3IAY A;  1G2S A;  2A69 D;  3HP3 A;  3MEH A;  1JQY D;  3DHQ A;  4H7B A;  1QCB D;  3GTP B;  5LL6 S;  3HGB A;  2EYJ A;  1I4H A;  4IUU A;  1QG7 A;  5A2Q L;  4QB4 A;  3M85 A;  2IX0 A;  1GJX A;  1HTL D;  3QJY A;  1CI3 M;  2BE5 D;  3WOE A;  3S9W A;  3BS1 A;  1CZW A;  2JSO A;  2F0K A;  3GTJ B;  4R9W A;  1B9N A;  1I4G A;  1I4P A;  4K5V A;  1A3T A;  1EY6 A;  3QO2 A;  5IT9 L;  4CJ0 B;  2DN8 A;  2J4X A;  1TVX A;  1I4X A;  1VMP A;  4O42 A;  4KHV A;  3OSO A;  3NBI A;  2EPB A;  5CV4 A;  1DYQ A;  3MHB A;  3J7Y W;  3HOZ B;  3ITP A;  4RAU C;  4DF7 A;  2NBF A;  4BY7 B;  4IUN A;  3RZO B;  3I72 A;  2A68 C;  4OIJ A;  1F9R A;  4G57 A;  3VR3 A;  1B9M A;  1DJR D;  3A8I E;  5COY A;  2EY1 A;  1PRT B;  4XT1 B;  3MXN A;  2EJG C;  2M00 A;  3PMF A;  3MXP A;  1SYC A;  2BCO A;  3CRL C;  2EYO A;  3RLF A;  1HHV A;  2ICI A;  3H3V C;  2F0Q A;  4PQX A;  1JWU D;  5C4H A;  3IFD A;  5EKI A;  4F8M A;  5EPL A;  3S1R B;  1WTO A;  5ELB A;  4B08 A;  2KJX A;  3TSS A;  2B2W A;  1B4O A;  2OEO A;  3QIA A;  1JR0 D;  3DWQ A;  5JVH 3;  1JOQ A;  3NHH A;  1NUC A;  4OO1 I;  1OO9 B;  2J7Z A;  3CRK C;  3R93 A;  1RKN A;  1ZXT A;  1BOS A;  2VXW A;  4HTH A;  1DOK A;  4ZAI A;  1E2V A;  3GTL B;  5EBC A;  2O5I C;  5D3I B;  2B2U A;  4RHS A;  3UI2 A;  2B2T C;  4XQN A;  1FD7 D;  3KLS X;  5IGF A;  4RHR A;  2H4O A;  1L0X B;  1C4Q A;  1XXG A;  4UDU C;  3PUW A;  5KRU A;  3A55 A;  4HCE A;  3SK8 A;  4A3F B;  3SK4 A;  4EQP A;  1PRT C;  2FMM A;  1STB A;  1E0B A;  1IYU A;  4G7Z C;  1RCV D;  2PMZ B;  1F2L A;  2Q8I B;  1IHZ A;  3NTI A;  1M4V A;  1DOL A;  4RGM A;  1HFN A;  4IFD G;  3MWY W;  4F88 A;  3K0Y A;  4OIK A;  4DNT B;  5IGC A;  1E2Z A;  1JB3 A;  2MP1 A;  3EJI A;  1SE3 A;  2EJF C;  2NYZ D;  4X3T A;  1PZJ D;  1U4P A;  2JEA I;  2DNE A;  4IZ8 A;  3K58 A;  4LK1 C;  4AYB B;  4XT3 B;  1R4P B;  2PW5 A;  2DNC A;  3R2T A;  3C2P A;  2AQ3 B;  4BWG B;  3VA7 A;  4H0L C;  1T5X D;  3GO5 A;  1HUN A;  2ZXP A;  3K5M A;  1NSN S;  1LTA D;  4TKO B;  1VCI A;  1AW7 A;  2YYZ A;  1VF7 A;  4ZLT F;  1F2Z A;  1YNN D;  4J6H A;  1JCK B;  1KDA A;  2F0F A;  2R3Z A;  4YIJ A;  1XWE A;  2RVL A;  3BDO A;  4I65 A;  4KV6 A;  3Q6S A;  5BN5 A;  2OT2 A;  1Z47 A;  1XTC D;  4MN3 A;  4K8I A;  1OXU A;  3P1H A;  5ELE A;  4A3J B;  2EZV A;  2QF7 A;  1SNO A;  2RDH A;  3VYS A;  2WP8 J;  3SVM A;  3S1Q B;  1GUW A;  3RD4 A;  5E4W C;  3BVZ A;  2KEE A;  3R3O A;  1BCP D;  1HPC A;  5IGG A;  2EY2 A;  2L1B A;  4IFD J;  1S5F D;  2A74 C;  3AB9 A;  5E3F A;  4KK7 A;  1SBB B;  4IFD H;  4ZUJ A;  2KCN A;  5M9O A;  4BS9 A;  2TMP A;  3C1F A;  2A6H D;  1DD2 A;  5D65 A;  4IN3 A;  4QIW B;  1BQQ T;  2B39 A;  1AFP A;  3HKZ B;  1CA5 A;  2RDF A;  1PZK D;  4C2M B;  2F0E A;  4CKC A;  1UEA B;  3ND9 A;  2K05 A;  5I2X A;  3A56 A;  1EY4 A;  4N9T A;  1GUO A;  5C0X H;  2QIL A;  2VB2 X;  2NB0 A;  1CHP D;  4KD3 A;  2G9H D;  1STN A;  4IFD I;  1YNJ D;  4C3I G;  3N52 A;  1Y8P B;  3TP6 A;  3J80 L;  5CV8 A;  3HZX A;  1SJE D;  1TT2 A;  2RDG A;  1LAB A;  3I91 A;  1HFG A;  1LTG D;  1EY7 A;  5EJW A;  4ZKB B;  3MAQ A;  3NTK A;  1HXY D;  2LMC B;  1SYD A;  2O4X A;  1SYF A;  3D4W A;  2F0G A;  4NW2 A;  4FXG C;  2EOT A;  4JBW A;  1C48 A;  1TS5 A;  5DNF A;  5EBD A;  3MC0 B;  3GQB A;  1WTQ A;  3DM1 A;  3LWE A;  2JE6 I;  3C46 A;  1BNZ A;  1PFN A;  3J81 E;  1SDF A;  2H1E A;  2WIN B;  1HUM A;  4P2C B;  4GZY C;  2KEC A;  3SK5 A;  2F3W A;  2XN9 C;  4JK1 C;  1JWM D;  4BBS B;  3L9A X;  3AU7 A;  3QG1 A;  2CW0 C;  1K83 B;  4C3J G;  3S2D B;  2I07 B;  1QNU A;  4RGN A;  2Y0S B;  1BUV T;  4PMW A;  1EY8 A;  3GD7 A;  3IFT A;  3D4R A;  1H9S A;  2KHS A;  3A8K E;  2PZU A;  1KAB A;  2CW0 D;  1V8Q A;  4FF1 A;  2ZT9 C;  3URY A;  3S1M B;  1T5E A;  1B3A A;  3NWT A;  1Z7T A;  1TWA B;  2EYF A;  5NUC A;  4U68 A;  1KLG D;  1D5Z C;  3PO3 B;  1GUT A;  4J1M A;  2PZT A;  2EY6 A;  4NMZ A;  3GTQ B;  4FF4 A;  1MSH A;  2B2Y A;  4ME5 A;  4OHJ A;  1JOR A;  4A3D B;  4S3S A;  2N55 A;  1HQM C;  1EYD A;  5DM7 3;  2NTS A;  3RUZ A;  4R8I A;  1K8O A;  3OW7 A;  2AWO A;  3A7L A;  3VR4 A;  1ENF A;  5DEH A;  4OO1 G;  3IKJ A;  1PTO C;  1PDQ A;  1B2T A;  1A3V A;  1CZG A;  2A69 C;  3HOY B;  4QCL A;  2XRS D;  3GTO B;  5IOC A;  3NUC A;  3K6O A;  4N9P A;  4XQJ A;  5J22 A;  1PRT F;  3I3C A;  4CHT B;  1B50 A;  2BDN A;  1V1P A;  3KBG A;  1SJH D;  1LV9 A;  3D31 A;  1GHK A;  1PTO D;  2BE5 C;  4XXE A;  1KNA A;  1WCM B;  2PNR C;  2X69 A;  1CHQ D;  1DM0 B;  1RTN A;  2JA8 B;  4RCO A;  5EPJ A;  3SR1 A;  2RSN A;  3BVM A;  2MUY A;  4F7X A;  3MFG A;  5C3W A;  2RQX A;  2Z1C A;  3BVG A;  1CA6 A;  4IUV A;  2C5C A;  2B2W C;  3K5O A;  1EQT A;  3K59 A;  2Z4I A;  3T53 B;  3TZD A;  5CGK A;  4HMI A;  1UAP A;  1LTI D;  4HED A;  3SEB A;  3GV3 A;  2K33 A;  2DY7 A;  2K03 A;  3D3R A;  2L5T A;  4K6D A;  1X3Q A;  4NP5 A;  2MPM A;  3T16 A;  1EOT A;  1G91 A;  4RKL A;  1VF5 C;  5EQ0 A;  2HCI A;  5C4Z A;  4DK1 A;  2K5W A;  1VMC A;  4L6T B;  1HRJ A;  3S2H B;  5CBA E;  2K6A A;  1QOH A;  4L63 B;  3NP8 A;  2FFK B;  2V4D A;  2X6G A;  1TQO A;  1CFM A;  5FLX E;  4OO1 H;  5FO9 B;  2LY7 A;  5G3L D;  1IKL A;  4FNF A;  1HQR D;  4K6L A;  3HS0 C;  3GTG B;  1NR2 A;  2F0S A;  4KJN A;  5FK9 C;  3TP7 A;  1QJO A;  1I50 B;  2NVQ B;  1F9Q A;  1I4Q A;  3SDZ A;  3M4O B;  2B63 B;  5C4X B;  1SYG A;  2NVX B;  1H9R A;  2JA5 B;  3S17 B;  2EVB A;  4TSS A;  1HA6 A;  3V2T A;  2NVY B;  3H91 A;  3DEO A;  2JA7 B;  2Z8L A;  2M2L A;  2JA6 B;  1SFO B;  3K57 A;  5D3D A;  1DCZ A;  1FNV A;  5IGB A;  5T1G A;  5C6A A;  3S16 B;  1TS4 A;  2MJ8 A;  1Q8I A;  3FDT A;  3R2I A;  3X3M A;  2A6E D;  3QWN A;  5K36 G;  1EZ6 A;  1BCP B;  2F0I A;  1JOO A;  3DUZ A;  3K5N A;  4EVO A;  3BYT B;  2O5J C;  5JOB A;  4HSP A;  2PW7 A;  4ZK9 B;  3AMU A;  1LLR D;  4ODG A;  4CKE A;  1JOK A;  1EEI D;  3NQI A;  1EU4 A;  1Y8N B;  5LL6 X;  2R7Z B;  1STH A;  1GUG A;  1Z6H A;  2PYK A;  2EDG A;  3T51 B;  3DXJ C;  1Y1V B;  1L0Y B;  1SAP A;  2ID0 A;  2L12 A;  2R61 A;  2QDB A;  5KYL A;  3DMU A;  3I4L A;  1F77 A;  5JVG 3;  4I7Z C;  4Z9C B;  5J39 A;  4CJ2 C;  1KTK A;  5CYU A;  5IGD A;  4BA1 I;  1BF4 A;  4DXG A;  1SMY D;  3TZU A;  3ZYY X;  4LAA A;  3WDN A;  2XWJ B;  1Q1E A;  4CBV A;  2E2D C;  3SHL A;  5K5P A;  3E0J A;  1YNN C;  3PV0 A;  2F0J A;  1JE4 A;  4ABN A;  1OXT A;  1IW7 D;  2HDM A;  1Y69 U;  2TSS A;  4XDX A;  4ZQ3 A;  1CQF A;  3N6R A;  4TQU S;  2L4N A;  3EFX D;  1PZI D;  4XIG S;  1SYB A;  2G9D A;  4DAV A;  4XTC S;  2K5Q A;  1SYE A;  4G7O C;  4BBR B;  4E6I A;  1TII D;  1ENC A;  5A35 A;  2WAC A;  1W6K A;  1BCP C;  4O1N A;  1LAC A;  3J7A F;  2BDO A;  5K36 H;  1NCV A;  3L7Z C;  5M5X B;  1RHP A;  3U9S A;  3T13 A;  2MHV A;  1GHJ A;  5KIX A;  2K01 A;  3GTK B;  1F9S A;  4FYD A;  1SNC A;  3SK6 A;  4IUT A;  3LWU A;  1BBX C;  3LX0 A;  2R93 B;  2XVS A;  1CK1 A;  2PPB C;  1LT4 D;  1X32 A;  2A6H C;  3BDL A;  2K5D A;  2QEJ C;  4UAI A;  2RBM A;  1G2T A;  4RGT A;  3T56 B;  1V1O A;  1Q12 A;  3HG9 A;  3QB3 A;  1FYC A;  2IT1 A;  5C5L A;  3O13 A;  4ZUI A;  2IL8 A;  5JJZ A;  2PZW A;  1EY5 A;  1IKM A;  1DON A;  1G8Z D;  1YNJ C;  2NN6 G;  1GXD C;  5ELD A;  1PTO F;  2B8G A;  5AFW A;  4FVM A;  3GP7 A;  4Y7N B;  4C3I B;  5JAV A;  4U67 3;  3ERO A;  2O2L D;  1V1P B;  1J9O A;  2JYO A;  1AZP A;  4BY1 B;  1D5X C;  5CV5 A;  1PFB A;  1FR3 A;  1AN8 A;  2EE1 A;  1SE2 A;  1ZYR D;  5FO8 B;  1NR4 A;  1CQV A;  1II3 A;  3RMH A;  4DN4 M;  3D4D A;  5TSS A;  1NAP A;  2C9O A;  5I6Y A;  5C3E B;  2CQA A;  3PO2 B;  1WVL A;  1KDB A;  4RH6 A;  5C5M A;  4PMB A;  4QMG A;  1E2W A;  2D62 A;  2GA4 B;  2EYM A;  2DY8 A;  3BDC A;  2B2Y C;  3I8Z A;  3QOL A;  1LT3 D;  3PUX A;  3HOW B;  1U4R A;  5G3L F;  2IX1 A;  4WFN 3;  1B1Z A;  1OXS C;  2HDL A;  3KLS A;  1PTO B;  2HUG A;  4KKT A;  3J81 L;  5JEA G;  3J7A V;  3MTS A;  4B9W A;  5D14 A;  1LTS D;  2WII B;  5EGT A;  4RCN A;  3HOX B;  4ZRZ A;  3CKI B;  4G7H C;  4C3J B;  2KVM A;  4RKB A;  3DWP A;  1O78 A;  5EKK A;  4QUC A;  1KAA A;  2E2I B;  3PUZ A;  3KK7 A;  3Q23 A;  4TRD A;  2CHB D;  2D9U A;  4KHZ A;  3A7A B;  2AUJ D;  3FMC A;  3VR5 A;  1S5C D;  2ZXR A;  5C44 B;  5CMD A;  3OWF A;  1ILP A;  2XNA C;  1KDC A;  1F2Y A;  4L8J A;  5I2Y A;  1A2U A;  4XYQ A;  1ET6 A;  4KKS A;  3BYY B;  4KN4 C;  5IOD A;  4HSV A;  3WOF A;  4C3H G;  1JIC A;  1EEF D;  4J8Q A;  1A6X A;  2NN6 I;  2B2V A;  1BR9 A;  1O80 A;  1MSG A;  1WTP A;  4EQN A;  1R4Q B;  2HCC A;  2PCF B;  5CV9 A;  3CQZ B;  1R9T B;  4A3G B;  1EU3 A;  5KGU A;  3NE5 B;  3EA6 A;  3NXW A;  2LS0 1;  2OXP A;  1G29 1;  4CJ1 B;  1IYV A;  2KQ3 A;  5FKA C;  3VYT A;  4ZKC B;  3C3L A;  2L55 A;  5LHY 1;  3EQL C;  2FJ2 A;  1PYW D;  5JEA J;  4DXF A;  1I6H B;  3W2D A;  3LNN A;  5I4D A;  1X3P A;  1DXM A;  3OPO A;  2RA4 A;  3M7N A;  2KA7 A;  1LT6 D;  2F3V A;  2N88 A;  4ULL A;  2QKI C;  5M3F B;  1STY A;  1PTO H;  1BO0 A;  1LO5 D;  5FO7 B;  4K2K A;  2QCP X;  3TN2 A;  2IWH A;  2F0T A;  3SXH A;  1TY2 A;  3NSW A;  5CV6 A;  2SOB A;  1U9R A;  2EY5 A;  2VNU D;  1EY0 A;  3I73 A;  3S14 B;  3HEJ A;  4QUF A;  4K14 A;  1ONL A;  1EIG A;  3HRZ C;  2KUM A;  1SEB D;  1EYA A;  1D2B A;  4PNY A;  2Q8R E;  1U4L A;  3VYR A;  1LT5 D;  1EQV A;  1QWY A;  3QOJ A;  4G4K A;  4LJZ C;  2XSC A;  5T1I A;  4KKU A;  4DA2 A;  3PIO 3;  5A2Q E;  1Y8O B;  2L9H A;  2L0C A;  3FVQ A;  5KYI A;  1SND A;  1I6V C;  5KND A;  5CC4 A;  2X6L A;  1GUS A;  4FF2 A;  2BA0 A;  2YU9 B;  4K5W A;  1JWS D;  2E76 C;  4ZYS A;  1ILQ A;  1G6Z A;  2WKC A;  5IT9 E;  4KD4 A;  2B2U C;  1I4R A;  3MVV A;  3OMC A;  3HOU B;  4KN7 C;  2Z4H A;  4XQQ A;  1BCP F;  2JEB I;  1TU2 B;  2NVT B;  3OWE B;  5I9P A;  1D6E C;  5FLX L;  3PUY A;  1FGB D;  2VUM B;  5IIF A;  3KLR A;  1PXU A;  1A15 A;  1O7Z A;  4K5X A;  3OIQ A;  3I4N B;  2F0M A;  1WTX A;  1MGS A;  3PIP 3;  4LMQ D;  1XX8 A;  3C1E A;  1TWC B;  3G6J B;  5EKL A;  3X3N A;  1QE6 A;  3ND8 A;  5CV7 A;  3CU7 A;  4H44 C;  2EJM A;  2K1B A;  3MZ5 A;  2A68 D;  3SE0 A;  5C4J B;  4M1U B;  2FIN B;  1LTT D;  4A3B B;  3TP5 A;  4X3U A;  1SXT A;  3VA5 A;  2A6E C;  1TS3 A;  2F0U A;  2R6G A;  1UUP A;  2LKV A;  3D6W A;  3NPP A;  2CVR A;  3GTM B;  1D1I A;  4DNR B;  3PUV A;  4FP5 D;  3D6C A;  4V19 0;  1PFM A;  4X3K A;  5E1F A;  3F2U A;  2NWG A;  5ELC A;  2A73 B;  3IL8 A;  1A2T A;  1SNQ A;  2Q8T A;  2E2H B;  3D8G A;  4EGV A;  4C1N K;  4CGY B;  1EWH A;  1GUN A;  1M8A A;  1CT1 D;  2IW3 A;  3BG3 A;  1A3U A;  2F0D A;  2BA1 A;  2HQE A;  1TWF B;  2D2C C;  2WKD A;  3H94 A;  3OIP A;  4C1N I;  5KEE A;  1SMY C;  5EPK A;  2F03 A;  4KY7 A;  2SNM A;  3BZD B;  1XYI A;  3NBH A;  4KJO A;  4A93 B;  5E4X A;  2F0P A;  3S15 B;  4HAE A;  1IW7 C;  1F9P A;  1OXX K;  2F4I A;  1STA A;  4IUR A;  5JPN C;  3P7J A;  5CR3 A;  5KNC A;  1BDO A;  1ML0 D;  4K2L A;  4DU9 A;  5DM6 3;  4HMJ A;  1U4M A;  1PMR A;  3NK9 A;  2WAQ B;  3A8J E;  3U9O A;  1Q3L A;  4NDX A;  3MFY A;  4M8A A;  2I46 A;  2BOS A;  1PRT D;  5ISR A;  1EYC A;  1RJT A;  1PLF A;  3ONA B;  1EL0 A;  4WRD A;  1TR5 A;  4IUQ A;  3VR6 A;  1CTM A;  2PQE A;  3KBX A;  2WB1 B;  1QB5 D;  2F0H A;  1B53 A;  3DWA A;  4H13 C;  1SE4 A;  1IL8 A;  3FPU B;  3P20 A;  4F87 A;  2PO4 A;  5C0X G;  5C3X A;  1EZ8 A;  2SEB D;  1RDP D;  1ESR A;  2EXZ A;  4RA8 A;  2ICE C;  2KOL A;  4A3I B;  2F0V A;  4KY6 A;  1H9S B;  3I70 A;  3MXU A;  1EFI D;  3Q22 A;  1FNW A;  4B9X A;  2B2T A;  1QNK A;  3TBI B;  1Q90 A;  5I9O A;  2AQ2 B;  1SSO A;  4X3S A;  1TWG B;  2IX3 A;  1ESF A;  2A5H A;  2K04 A;  3OOC A;  1WTR A;  3M3Y B;  1HTP A;  1C8C A;  1S5B D;  4OL7 A;  1FNU A;  2ZXO A;  1ENA A;  4HR7 B;  2B8F A;  1SNP A;  1H9J A;  1B44 D;  1EWC A;  2R92 B;  5JPM C;  4ID6 A;  2WV6 D;  4MHE A;  2RSO A;  1TKW B;  5DAU A;  4FXK C;  3H0G B;  3I4M B;  4V0B A;  1O7L A;  2F0L A;  3Q24 A;  1WD0 A;  2XIW A;  1W6J A;  3DEP A;  4KMU C;  1LTR D;  2D5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...