4L63B

Apo form of ab5 holotoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ECXA
total genus 24
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l63B00
4RGMA 3OWEB 3GP7A 1MD2D 1SEBD 4O1NA 1PRTC 5ELEA 3TSSA 1T5XD 2Z8LA 1SBBB 3EFXD 1KTKA 3R8BA 1V1OA 1TS3A 5ELBA 1JWUD 2NTTA 1AW7A 1KLUD 3MFGA 1SJED 2XRQD 1FGBD 4K6LA 1V1PA 4BWGB 1BXTA 3W2DA 1EWCA 4L6TB 3BVMA 1B1ZA 1PRTF 1JWSD 1S5BD 1BCPB 1FNUA 1CHQD 1XTCD 1RD9D 1XXGA 1BCPD 4C56C 1UNSA 5FKAC 1HXYD 1PTOC 2ICIA 1PTOB 1PTOH 1M4VA 1EFID 1V1PB 5ELCA 2CHBD 2XN9C 4RCOA 4RHRA 4RHSA 4RFBA 1ENFA 3BVGA 3MC0B 1JQYD 4DXFA 3R2TA 1PTOF 1STEA 3V05A 5FK9C 1CHPD 1SXTA 1LTTD 1EU4A 1ET9A 1FD7D 3URYA 3DWPA 1PRTD 3KLSX 3EA6A 3R2IA 1TS4A 3DWAA 5D3DA 3BYYB 1HQRD 1I4XA 2G9HD 1PRTB 1LT3D 4TSSA 2IJ0A 1LT5D 3BVZA 1RCVD 5D3IB 1SJHD 1I4RA 1QILA 1I4HA 1SE3A 1TY0A 1UUPA 5ELFA 1JCKB 1RF2D 2TSSA 3SEBA 1CQVA 1LLRD 1TS5A 1BCPC 1LTGD 2AQ2B 1PTOD 5I4DA 1S5DD 1LTID 1LO5D 1G8ZD 3BYTB 1LTSD 2QEJC 5ELDA 5TSSA 1B44D 1F77A 2SEBD 4RGTA 1ET6A 1D5ZC 1L0YB 1FNWA 2XRSD 4DXGA 2NTSA 1JR0D 1EU3A 1D5XC 2R61A 3BZDB 2QILA 1CT1D 1ESFA 2IPKD 3O13A 4UDUC 1GOZA 1PYWD 1EEFD 2AQ3B 4Z9CB 1PZJD 1HA5A 2RDHA 1PZID 1LTAD 4L63B 1DJRD 2O2LD 1BCPF 1FNVA 1JWMD 1LT4D 1I4GA 1I4QA 1TY2A 1TS2A 1AN8A 4OHJA 1SE4A 1S5ED 2XNAC 1S5FD 1KLGD 4RGOS 1HTLD 1I4PA 1LTRD 1CK1A 1S5CD 4RGNA 3DWQA 1LT6D 2RDGA 1D6EC 4ZYSA 1D5MC 1RDPD 1LTBD 1SE2A 2WV6D 2AQ1B 1EEID 1DYQA 4RH6A 1PZKD 2J4XA 3CHBD 1L0XB
chains in the Genus database with same CATH superfamily
4A93H 1A62A 2BE5D 4DR3Q 1YHQA 3I90A 2B29A 3NE5B 4MNOA 1EQQA 2O5JC 1W2BA 5GAGC 1KLUD 1NCVA 1F9SA 2L4NA 2E2HH 4K0KL 3UDFA 2K03A 3HOXG 1PYBA 3GV6A 1BCPD 2BA1A 3PIPA 2KA7A 4UAIA 2N55A 2NVQH 4JYAL 2KECA 2CHBD 3C3LA 1SRUA 4JI5Q 2E5LL 1ENFA 1VQDA 4H02A 2VQEQ 4JI8L 4A76A 2PO4A 3FMCA 1Y1VG 4BS9A 4A3GG 1FL0A 3AU7A 4J15A 2VQFL 3MAQA 4DGZA 1WJJA 1EQRA 2R6GA 4A3KH 2BA0A 4V190 1HQMC 1Q90A 4L5TA 2BDOA 1K9MC 2JK8A 4BBRG 3CF5A 1CA5A 1IL2A 1VQPA 2LFNA 2JQOA 2YTXA 5IGGA 4F7XA 1SYCA 1BCPC 2QEXA 1WTOA 1K83B 5E1FA 4LF7Q 3T1HQ 1TWHB 4A3KB 4U673 4ZCKA 4HSPA 1HNZL 1YJ9A 4N9PA 1ET6A 1WTVA 3FKIG 1Q81C 4K5VA 5KYIA 1GXDC 2F0SA 1SNPA 2ZJQA 2K5WA 1S40A 3HKZE 1PZID 4QUFA 3UE1A 3K7UC 1MHWC 4NXML 2WAQE 3J81c 1LV9A 4HJ9A 2WACA 1KLGD 3T53B 2E2JB 1CM9A 2B2VC 1SNQA 3TZDA 3GTOH 1IW7C 1A15A 1SE2A 1JJCB 3GTQB 4LF5Q 3OWEB 3RNUA 4MHEA 5KIXA 4K8IA 3S2DB 4TQUS 2F0NA 1IYJB 1G91A 3NBHB 1S72A 3I4NG 4LFCQ 5KEEA 1VQ6A 4A3GH 3MXUA 3A8KE 4IJHA 3S16B 1GJXA 3K5OA 5M3MH 3SGIA 4WFN3 4HIMA 2I5LX 5JPMC 4GKJQ 5C0XI 1XXGA 3AQQA 4C56C 4OELB 4DV4Q 4XTCS 4B3SL 3H3VC 1V1PB 2JA5B 2NVYH 1K28A 1A0IA 3A5ZB 4OIKA 3BVGA 4KN4C 3E6ZX 1NJIC 3GTMH 1JQYD 1VQAA 3KK7A 3X3MA 1B2TA 2WB1B 3FKIH 2J0TD 4B08A 5FOBB 3BDOA 1QG7A 3E5SA 1HFNA 3KLSX 2L5TA 1YITA 2A68D 3R2IA 3KOJA 3W1BA 3Q8DA 3ICEA 4BA2I 1HQRD 5CYUA 1PA6A 1IBMQ 2FXQA 4HCEA 5CV9A 4DV0L 1NNXA 5C5LA 2I5MX 3CU7A 4OX9Q 5CV5A 1IBML 2B2YC 4KMUC 3NPPA 3G48A 1I6VC 1HZAA 4DAYB 2C35B 4OO1I 1SNCA 1Z6HA 2CQOA 2H4OA 4FF4A 2MUYA 3G4SA 2NWGA 4RGTA 1L0YB 2PQAA 3A54A 2JA8G 5C4XH 3GTGB 3BZDB 2EYPA 3ZYYX 3QJYA 5C3WA 4KKTA 2OQKA 4I7AA 1HCZA 1HZBA 4ME5A 3RZOB 5C44B 3ITPA 3K57A 5EPJA 1EIHA 2A68C 1CZWA 3HS0C 2VZAA 1XX8A 2EZVA 4KK7A 5DAUA 1EY4A 1JE5A 2K14A 1GVPA 2XTIA 5IODA 4UPAA 5JVH3 4GN5A 4C1NI 4QGUA 3AEVA 2FMCA 1I3QH 3EBEA 2CVRA 2RDGA 3CCVA 3J7AF 3J81i 3NEMA 4ME3A 4WJ3M 5DLQE 3HOUH 1QJOA 1K83H 2QDBA 4RGMA 2OWOA 1AFPA 5NUCA 4BA1I 1K73C 5FLXE 3M3YB 1STHA 2JSOA 4DUZL 2XSCA 4LK1C 1XNQQ 2LMCB 2QA4A 3R8BA 3W1GA 1X6OA 4ABNA 4KTAA 4ULLA 4A3JH 4A3CG 4KHPL 4K6LA 2CW0D 1EWCA 4GLAC 1PH9A 1FNUA 1CHQD 3SE0A 4H0LC 2AWOA 5KGUA 1TWGH 3DM3A 5KNBA 1PH6A 4CJ1B 1CTMA 1M4VA 5M5WB 1TWAH 2DN8A 2XN9C 1DXMA 3KF6B 2B8FA 1ASYA 4A3FB 3VYRA 4RA8A 1SFOH 1VQHA 1KC8C 3KLRA 2JEBI 3K6OA 1SXTA 2EYJA 4BY7G 1L1OA 3ER0A 5IY0A 3H91A 1DONA 2JEAI 4TVAB 1K8OA 3F8TA 2G9HD 3CQZB 4MIUA 5H1SE 3MZ5A 3K5MA 4X66Q 5J3BA 1N9WA 1IBLQ 1J9OA 4YWLA 3I7FA 4EVOA 2D5DA 4GNXC 2K5DA 2TMPA 3DEOA 2DJGC 3GTPH 4DR5L 4JBJA 1B44D 1SYFA 1TIID 3L0OA 3HOZB 4JI6L 1EOTA 4DXGA 1GUGA 2F4IA 1VQFA 2V1CC 3A0JA 4DF7A 3ZJYC 4RWSC 3K7AB 1V9PA 5AJ3Q 1CFMA 2O5IC 1EYDA 4XIGS 4BY1B 1N36L 1VQJA 1GM5A 4A3CH 2PPBC 1WCMB 2N49A 4A3FG 3QB3A 2PQEA 4QIWB 3J80i 3SK8A 4K6DA 1TS2A 1S5ED 4CDDC 4KHZA 2ALYB 4JI4Q 2HQEA 4KD3A 5IGBA 3PMFA 1C0AA 1OO9B 3M4OB 4UHVA 1VQMA 5JJIA 1YI2A 1BKBA 1JJ2A 3GP7A 2ASBA 4JBMA 4JOIC 3CC2A 2JP1A 3KDFB 2FMMA 4B3SQ 4XXEA 2FJ2A 3TP8A 3PF4A 3KF8B 5BR8L 2F0MA 5EAYA 2ZXRA 2KHJA 1E1TA 1WOCA 2IX3A 2OEOA 2KENA 3VYUA 5IP7G 4DR4L 1PTOC 2ICIA 4JPBW 2N78A 5ELCA 3HOYH 4RHRA 5KRUA 4DUYL 4DV2Q 1STGA 5KYLA 2EYLA 3OIPA 3HOXH 2UU9Q 2LY7A 1KNAA 1JMCA 3K5LA 3U4VA 4BBSG 1FD7D 4HIDA 1F9QA 4DV0Q 2DNEA 5GADC 2IWHA 4LF5L 5J1ZA 3ERSX 3HOXB 3HGBA 1JOOA 4R4QA 5C4JH 3BDCA 2E8GA 1LABA 3PUVA 2F0EA 1LT5D 1WTPA 1ENAA 1RCVD 2O4XA 1VQEA 5A2QE 1Q12A 2EYHA 4A3KG 1T5EA 2WKDA 1I94Q 2NVXB 2EJFC 2L55A 5IOCA 1PTOD 1LTID 1OXSC 4YWKA 4EQPA 4RKBA 1HUNA 4A93G 5TSSA 2RSNA 1XNRL 3TP7A 2Y0SE 4LF7L 3L3OC 2HT1A 3JAMi 2F03A 1P16A 1MJEA 4J8QA 2NN6H 1XTDA 4K14A 1SE8A 3RLNA 1AH9A 2WIIB 4P72A 2F0KA 1N34L 3JAME 3SK4A 2YYZA 1EY7A 2B63H 4A3DB 4M1UB 4NP5A 1FJGL 3EQLC 2XNAC 4GN4B 4HJ7A 2WAQB 4F87A 1HTLD 5C3XA 5HGTA 2HCIA 2KUMA 2K6AA 5I2XA 3T1YQ 3T56B 1QB5D 4K2LA 4QUCA 3H3VI 2VW9A 1H95A 1Z47A 4GKKL 3I4NB 4K2KA 1T5XD 1KXLA 5GQOA 1K0SA 2H5XA 4HIOA 4PZ7A 1N36Q 2D2CC 1B4OA 1FGBD 4N8X1 4BY1H 2FINB 4BBRH 1IKLA 4DV4L 3I4NH 1TVXA 4KHVA 5CV4A 3S15B 3ULLA 2JA7H 3RLOA 1KNEA 2PW5A 1A2TA 1MKHA 1MSHA 5C5MA 4A3GB 1UE7A 2RCNA 4PQXA 1A6XA 3SHLA 5M3FB 5JJLA 4QF4A 1G6PA 2R93B 2H1EA 1LTTD 4C2MB 1II3A 1X3PA 3PSIA 3G6EA 1F9PA 3EN2A 3GTKB 4R8NA 5IGCA 4X3TA 1IBLL 2AHOB 2B3GA 2D0OA 2IJ0A 2KJXA 4NW2A 3TN2A 2MO0A 1QCBD 4C2MH 4DR1L 1RF2D 3HEJA 1TS5A 1LTGD 2A69D 2L15A 4A3JB 3S1MB 3TQYA 5EBCA 2K33A 1SR3A 3D6CA 1G51A 1LTSD 4JYAQ 1ZEQX 3VYTA 1X3QA 2WFWA 2XRSD 4CDCC 2K52A 1B9MA 1GKHA 3FDTA 4PZ8A 4UP8A 2R61A 3U9OA 5A35A 4JV5Q 2QILA 2LSSA 1JICA 4YHHQ 1I6HB 4DR7Q 3S1MH 3KYHC 2RF4A 3JAMc 3OTOL 3OIQA 4IN3A 3TEHB 2A6ED 5C3EH 5IIFA 3PIOA 1LTAD 3SVMA 3DHQA 1UAPA 1JWMD 2EVBA 1EQTA 2KCMA 1U4MA 2F0IA 5C3EB 1F2LA 2F0LA 2WV6D 5LMNW 1WFQA 1DZ1A 2A69C 2J4XA 3CHBD 4U68A 3OHXC 3MXNA 2ZXOA 4DNTB 2J7ZA 4H44C 3HG9A 1BQQT 1J6QA 4JI0Q 4EQOA 2Q2UA 4DA2A 5IWAL 1PRTC 1BF4A 5DEHA 1X32A 2Z8LA 1D1KA 3S2HH 4DV5Q 4DAYA 2K5HA 4G4KA 3KLSA 1XMOL 3PO3H 2JYOA 4JW0A 1AZQA 1B70B 4C3IB 4DR6L 4GOPB 3M7NA 3K58A 1H9KA 1TT2A 3W2DA 4IPCA 4DR6Q 4J1MA 3AFQA 2A6EC 4NB3A 1A63A 3TZUA 4R8IA 2I07B 2F0OA 2LXKA 3I55A 4PG3A 4OGQC 4NKLA 5IYBG 2VUMG 4NMZA 3NENA 3WWVA 3SK5A 1KABA 1QUQB 2GA4B 2F0QA 3H3VH 3C46A 4I65A 4IUUA 4KY5A 1TWCH 4R4OA 4NPSA 4IO9A 1DOLA 3R2TA 1GHJA 2PQAB 1PV4A 3BZCA 1DOKA 3J7A5 3LNNA 2JA8H 1C48A 3H0GB 1EU4A 1H9RA 2DGYA 2A6HC 1HHVA 4PV1C 5EKIA 1CKMA 2LS01 1PRTD 1E0BA 5E7NA 2HDLA 4B3TL 4JVZA 3QOLA 2NVQB 1PRTB 1VS0A 4GS3A 1B53A 4IPDA 2F3IA 1UE5A 1QZGA 5JJZA 3Q23A 1JCKB 4A3IH 5IT9L 3PO2H 1AE2A 2DY8A 1GD7A 3HOUG 3M4YA 1IYVA 1STAA 1L1OC 3BYTB 3G6JB 4B3ML 2QEJC 2R92G 4DV1Q 4CJ0B 1RKNA 1VQNA 4O2DA 2UU9L 1U4PA 1D5XC 3PCOB 1TQOA 1YEZA 1EOVA 3O13A 2R93H 5JVG3 5E3FA 1NR4A 2OT2A 5FLXL 2PZUA 2AQ3B 3V2TA 1EY8A 1PFNA 1QZHA 1AEXA 4MTNA 1QNUA 1DJRD 3AB9A 3L7ZC 4X62Q 5BN5A 2PMZB 4DUZQ 1O7IA 2F0UA 4JI4L 1BUVT 1R4PB 2EOTA 3DEPA 2VUMH 3C1FA 1F9RA 1I3QB 4B3RL 1D6EC 1VQOA 3CW2C 1KRTA 1GUTA 2F0JA 3FHWA 3BS1A 3WOEA 3H09A 1N33Q 1SEBD 4BY7H 1JE4A 3OW2A 2PI2E 2VUMB 3IKJA 3UI2A 3EFXD 4ID6A 1KTKA 5FLXc 2MFIA 2ZJPA 1TWFH 1V43A 3HRZC 3W3AA 1HH2P 3HOWG 4A3LG 2VNUD 1HZ9A 1EY6A 2EE1A 3VDYA 3GTLH 1ZYRC 1TXYA 3GTPB 4A4IA 3EJIA 4DR4Q 2E76C 4IUTA 1STBA 2IHFA 1SYEA 2K5QA 4DR3L 4KKUA 3MTSA 1GUSA 1PDQA 1WTXA 3KUPA 1XNQL 3Q24A 3J80c 2HIVA 2N88A 4KI0A 3JC66 3VR5A 4JI3L 3H15A 3QOJA 4DV7Q 1E24A 3H0GH 2JE6I 3D8GA 2VL6A 4CGYB 2F4VL 1WYDA 2YU9H 1KDBA 4DV6Q 4A3MG 5D14A 3MXGA 1A3UA 3CAMA 3IFTA 4LF6Q 1Q82C 5FJ8H 5L37A 3N52A 1KDAA 3FRPB 4HMJA 3KJOA 1L0WA 2Y0SG 3LX0A 5ELDA 3U4ZA 4YHHL 1NBWA 1WTQA 2BH2A 2F0WA 1JR0D 2UUCL 2FHTA 2K5VA 3HKSA 1RL2A 2B2UA 2Z6KA 4IUVA 2UXDQ 5E4XA 1N34Q 1B7YB 2E2HB 3PF5A 1T9HA 4Y52H 4G7ZC 3T4AC 1LTLA 4IFDI 1BCPF 1G291 1H9SA 2K50A 5IP9H 2ES2A 2I0QA 1QVCA 4GOPC 3HOYG 1S3OA 4K5XA 1YJWA 1RTNA 2K05A 1SNMA 2KHSA 5C44G 1W6KA 3VA7A 1IYUA 1Z7TA 1YBYA 1MGSA 1SAPA 2PZTA 2A8VA 4BBSH 2F0FA 4A3DH 1SBBB 1EY5A 2D9UA 3NP8A 4R4TA 1XPUA 2NBFA 5J39A 2E5LQ 4L5SA 5I9OA 2HDMA 3A8IE 4KJNA 4LUOA 4LUVA 2WB1E 3TS0A 2RHSB 3IRBA 4CKBA 4QB4A 1B1ZA 1PRTF 1QOHA 2I5HA 1A3VA 4A3MH 1U5KA 4FF1A 4LF4L 1KAAA 1X54A 2KCNA 1ENCA 5CMDA 4JI2L 1HXYD 2EXZA 4Q0FA 1SMXA 3U50C 1TWHH 1A3TA 2OQ0A 4ALPA 2M00A 4BY1G 3N6RA 1R9TH 5JAVA 4RHSA 1H9MA 1PH5A 1JOQA 4XYOA 2Q2IA 1RTOA 3J81j 1RIPA 1VQ4A 1VQ7A 3V05A 2JA7G 5LMUL 1ET9A 4LUZA 4ILWA 2BH8A 2NN6G 3CCUA 3HOZH 1UE6A 4P71A 3S1QH 2L9HA 4BY7B 4YCUA 4ZQ3A 3GO5A 3BYYB 5BN3A 3K8AA 2B63G 1EIFA 2OXPA 4FXGC 1ONLA 4LFBQ 4JI0L 2JJQA 4LFBL 1SE3A 3U58A 3S1QB 1WCMH 4FVMA 1JB3A 3CMEA 1CZGA 4QL5A 3FPUB 4R9WA 3OW7A 2SOBA 4JI6Q 3HOVH 4DUYQ 5C44H 2P5ZX 2OTJA 1VQ8A 4HEDA 3H6MA 2UUAQ 2JA9A 4OO1H 2RSOA 3K0YA 3CPWA 1CT1D 4JI7L 2AUKA 2C9OA 5CV6A 2K1BA 4HJ5A 1CUKA 2R92B 1EIGA 1EFWA 1BDOA 5JEAJ 4LF8Q 1N32Q 1HJPA 4Y7NH 3K0XA 4LFCL 1RHPA 5C4XG 1VMCA 5IGEA 4OWXB 4LFAL 1PH7A 1W6JA 3GTOB 2IY5B 1LT4D 2JA6B 5IT9E 4A93B 1EL0A 1WTRA 2SNSA 4LW1A 1IKMA 4RGOS 1LT6D 2A1AA 1VMPA 1ICFB 1DD2A 1F2ZA 4DK6C 2SDFA 3J81L 2NB0A 1WTWA 3CP0A 1OXVA 1HPCA 1JOKA 1XWEA 3GD7A 4OEMB 4GZYC 5CV8A 1Q1EA 3D4RA 5ELBA 5LHY1 1HRJA 4JOIA 1TKWB 5C0XH 2RBMA 1SJED 4POGA 3BU2A 3K80C 4IQZA 4IPGA 3BJUA 2EYMA 1EZ6A 2X6GA 1S5BD 1D8LA 4NXMQ 5LL6X 1XTCD 1RD9D 5JOBA 1VQGA 5FKAC 2DY7A 5M3MB 1FVIA 5I9PA 1BOSA 3FVQA 5M5YH 3J7YW 4HN7A 3PIO3 3B6YA 2X6LA 3HZXA 3S2HB 4CKCA 1XMQL 2XGTA 1EY0A 5LMNL 4HSVA 4RMFA 1C7YA 4C3IH 5IYBH 1CHPD 5I6YA 5IT9c 4B3RQ 1IBKL 2F0VA 2CH4W 4RCNA 1SDFA 3M7GA 3GTMB 1IBKQ 4R4IA 1WD1A 2F4VQ 1Q8IA 1EIYB 1LYLA 1KDCA 4X3UA 3S1RH 3SK6A 3E0JA 4WORA 4DV3Q 3A74A 3HFZB 4CDEC 1LT3D 3CRKC 3STBC 2NZHA 2F1MA 3OOCA 1VQLA 5ELFA 4YY3L 2EIFA 2NYZD 2TSSA 4IUNA 4DKAC 1LUZA 3DUZA 2XIWA 4R1JA 5I4DA 1UE1A 2L1BA 2RCFA 1NY4A 4ZKBB 3S14H 2NVTB 1PH1A 1MBYA 5KNDA 2ZJRA 3QG1A 1FGUA 2NTSA 2Z6BA 1Z9FA 3KFUA 5ISRA 4IJLA 1I6HH 3FKIB 1HTPA 4DV1L 5C0XG 3K59A 5D65A 4HJ8A 2A74C 4Z9CB 3S17H 1HA5A 1RJTA 2Q2HA 2ZT9C 5FO8B 2RQXA 2O2LD 1HUMA 2F3VA 1I4GA 4QMGA 4K0KQ 1B9NA 2Q8RE 3T1YL 3X3NA 3S1NH 3S9WA 3STBD 2ATWA 4AYBB 1U0LA 1WVLA 2VB2X 4BBRB 4A3FH 3DWQA 4YCVA 2CCZA 3IAYA 1D5MC 2AQ1B 1EEID 4XYQA 1HNWL 4IFDJ 4XQJA 1QNKA 1X3FA 2B2VA 4NXNQ 1GUWA 2B2TA 1WTHA 1VF5C 5M3FH 4OONA 3PUYA 2MP1A 1UWVA 2BE5C 4A3EH 2NVYB 1BXTA 4OWTB 1JWSD 3Q0AA 4AQYQ 4L8JA 2ID0A 1G2TA 4X3KA 3K5NA 1HFGA 2UUCQ 3MVVA 4A3LH 3BG3A 1FYCA 1UNSA 2UXCL 3I56A 4A3IG 1ICWA 4N8FA 2MJ8A 2JA6H 4AQYL 3CC7A 5EQ0A 3TDQA 4C1NK 4QQBX 1V8QA 2JN4A 1IW7D 3VR6A 3RN2A 3DM1A 1PTOF 1EYAA 1AE3A 1ASZA 3U9SA 3SR1A 2KQ3A 2F0HA 1X9NA 1BBWA 3EA6A 2N3SA 2D62A 4CHTB 5K36G 2HQLA 1VQCA 4DV5L 1I4XA 4HIKA 2RKSA 1YNNC 4I7ZC 5EGTA 2E2JH 1OXUA 1OXXK 2B2WC 3TP6A 4PMBA 2K04A 3I72A 3PQIA 4L5RC 2GN5A 3J7ZC 4LF4Q 3WDNA 1N32L 5EBDA 5M5WH 1NSNS 3OTOQ 2KEEA 3MEHA 3VYSA 1CSPA 5IYDG 3J7AV 1NE3A 3UDGA 2WP8J 3D4DA 1PH3A 2Z9HA 5CGKA 2R7ZH 1ESFA 5M3FG 1PYWD 3MXPA 4PZ6A 2UUBQ 2CW0C 5T1GA 4M8AA 4FXDA 3P1HA 2RDHA 3K7AH 2AUJD 3D0FA 5M9OA 4GOPA 1Y69U 1SYBA 1YNXA 1YNND 4R4CA 3GTGH 5C4XB 1S5FD 1CK1A 1SSOA 4X66L 3GTQH 5BR8Q 4APVA 1CQFA 1XMOQ 4A3BG 1NUCA 3CCRA 2Z4HA 1IL8A 4X3SA 5F2DA 5JEAH 3R93A 3VR4A 1SNDA 1R4QB 1KD1C 2FFKB 4JI1L 1PHJA 1B50A 5CC4A 1TR5A 1Q7YC 4HCSA 2XRQD 5C6AA 3H0GG 3NHHA 4BWGB 1OTCA 1JC7A 4A3DG 1BCPB 1E2ZA 4N9TA 3S15H 4YWMA 4LAAA 1WD0A 3NSWA 5FJ8G 4DR1Q 4LNQA 1HR0W 3R3OA 1Y1VH 3PUWA 3RUZA 1L2FA 1H9SB 2K7VA 2L0CA 3TMEA 5IYDH 3PO2B 3LWUA 1TWGB 5CORA 2M9VA 1STEA 3NTIA 3NXWA 4DXFA 4CBVA 2MQHA 2L12A 5GAEC 1E2VA 1XPRA 4FP5D 3G71A 3DWAA 2CH4A 2B39A 5D3DA 1ML0D 4HTHA 4MN3A 3PIP3 3TS2A 2OF1A 2F0DA 4FYDA 1DOMA 3C1EA 4ZUIA 1K0RA 5IYCH 2CFMA 3ULPA 1MSGA 3HOUB 4HJAA 1HA6A 1SYDA 1GHKA 3TRZA 3CQZH 4C3JG 4A75A 4A3BH 2JA5H 1JT8A 1P8LA 1B3AA 4CDFC 1VQ9A 1RODA 3ONAB 1K3RA 1FJGQ 2IX1A 1KRSA 2IW3A 3LWEA 1BR9A 4ZAIA 4JI7Q 2RDFA 3D3RA 5JEAG 1Q3LA 4DAVA 4DAMA 3MEFA 3HOVG 2UUAL 4OL7A 2BOSA 5CBEE 4PMWA 1R9TB 2F0PA 4POFA 5KNCA 2VY3A 4FDBA 1EWIA 2Q8IB 4GKKQ 4L5QA 2RVLA 2XWJB 1Q86C 4UY8C 4DV6L 3KLWA 2GVBA 4DV3L 2WINB 4FXKC 2CKZB 2K28A 5FO9B 2VB3X 1PZKD 1L0XB 2B2YA 5DM73 1NR2A 1YHAA 1PLFA 4FNFA 5M3MG 3MFYA 3S1NB 2K4KA 1I50B 4KD4A 4K8JA 4X64Q 1JB7A 2XWBB 2OTLA 2E2DC 4MTKA 3GTKH 1V1OA 1TS3A 3CMAA 1V1QA 2DJFC 4JBKA 2NTTA 3MFGA 1A2UA 5C4ZA 1PFMA 1PH2A 4A3EB 3G7LA 2QKIC 3ERQA 1TWAB 4BXXG 4LF9Q 1WCMG 1E7ZA 1SN8A 3H94A 5IYCG 4IFDH 2NUCA 3F2UA 3CCMA 3CKIB 1WI5A 3I70A 4OX9L 4HAEA 1AZPA 1IXRA 2EJGC 4RFBA 4QJFA 3MC0B 3M9BA 1TWFB 3KDFA 1QWYA 1E1OA 1Y8PB 2ICEC 2RHQB 1X65A 4G7OC 4TKOB 2HUGA 1X3EA 1B3QA 1Y8OB 2X69A 2ZM6Q 4OIJA 1HNWQ 4C3IG 3A5UA 1G6ZA 4TSSA 4NXNL 3S2DH 1LM0A 2KBNA 3BVZA 4BBSB 1QVGA 2MPMA 1F2YA 1UUPA 2ZTCA 4DR2Q 4DR7L 2EYOA 3DXJC 4JV5L 4YIJA 2EY2A 3E9IA 3I4MG 2WAQG 2RA4A 2LKVA 3GTLB 4DPGA 3WOFA 1F77A 2SEBD 3T1HL 3HKZG 1SFOB 3I2ZA 2HD3A 4F8MA 2LXJA 1CKOA 1XPOA 3D4WA 5IWAQ 2R92H 2N8NA 4DR5Q 3CXCA 1VCIA 3CCLA 2A73B 5M5XB 5JPNC 4WJ4A 2R93G 4JI3Q 1TY2A 3I91A 2EPBA 3J81E 4IFDG 1I4PA 3DLLA 4H7BA 1AP0A 1EZ8A 1DGSA 2VQEL 2ZM6L 2K01A 1YVCA 1OXTA 2MGSA 2ZTEA 4QY7A 3NBHA 3F2BA 3HOWB 4OXPA 4JI5L 4LWCA 1U4LA 3NWSA 3GTJH 4O1NA 3M3YH 5ELEA 1GUOA 2PYKA 1TWCB 2IHEA 5I6WA 5CR3A 3I3CA 3OWFA 1PH4A 1V1PA 2UUBL 1HNXQ 2NVTH 2UXDL 1EY9A 4JCVE 4JBWA 1GUNA 3P7JA 4RG1A 1LACA 3CRLC 3PGZA 4IUQA 1PTOB 1HNZQ 2F0TA 2A6HD 3UDXA 2L11A 4IZ8A 2EY5A 2MNAA 2EDGA 2JA6G 4YY3Q 1VQ5A 3VR3A 2D0PA 1O7ZA 2PCFB 1HR0Q 2EXDA 4CJ2C 1A8VA 1TS4A 4ZRZA 1PMRA 5BN4A 4A3IB 3M85A 5EKKA 1STYA 4JC0A 4DAPA 1QILA 4JI8Q 2CQAA 2K5NA 3A7LA 5K36H 1O7YA 3SEBA 1PH8A 2K32A 2XVSA 4ZKCB 3P20A 2BDNA 4G7HC 3QO2A 3AMUA 1S5DD 3A56A 4CKEA 3ULJA 3NUCA 4KY7A 5I2YA 2ZTDA 3M4QA 1NTGA 1Y1WG 5IGDA 4WJWA 1FNWA 2NVXH 4X62L 1H9JA 1ESRA 2B63B 2KEDA 4UDUC 3QR8A 4GLXA 2I46A 3KF8A 2KHIA 3UE0A 1B8AA 3KBGA 4B9WA 5IGFA 1F2MA 1KAWA 2SNMA 3J80L 1CSQA 4XT1B 1BBUA 1FNVA 2JA7B 1I4QA 2PZWA 1AN8A 2QDLA 2B8GA 1MIUA 1N33L 4IOAA 3RZDB 1BBXC 2EYFA 4RGNA 2V4DA 2CWAA 4KY6A 3W5OA 5C4HA 3T16A 2F0GA 1RDPD 3S1RB 3V96A 3M4OH 3HP3A 5IP9G 1HZCA 3NTKA 3VA5A 4DV2L 1MD2D 1SROA 3CCJA 2Z6KC 1Y8NB 3HKZB 1PYSB 5LMUQ 3TSSA 1D2BA 5EKLA 1CA6A 1BNZA 2EY1A 1E3PA 1K8GA 3S14B 2F3WA 2EY6A 2IT1A 1VQKA 3HOVB 4AH6A 1Y1WB 3QWNA 4IUPA 4L6TB 5JJKA 2QGQA 5HGQA 4HMIA 2G9DA 2KVMA 2R3ZA 4K5WA 4P2CB 2EQSA 2JA8B 1J8IA 1STNA 4P74A 4H13C 4KHPQ 2R7FA 2GVAA 4X65Q 3KBXA 4KV6A 1Y1WH 1I94L 4ZLTF 3FP9A 4B3TQ 4DU9A 3TBIB 4X6AH 5FK9C 4GKJL 3KJPA 1QUQA 4KLKA 2R7ZG 1C4QA 4ZUJA 3URYA 2YU9B 3DWPA 2NZOA 1Q8KA 4EGVA 1CKNB 2G5DA 4GNXA 2Z4IA 4X64L 2VQFQ 2PMZE 4DR2L 3MA2B 3NTHA 1EYCA 3GV3A 4EX5A 5D3IB 1E2WA 3HOZG 1SJHD 1I4RA 1TY0A 1I4HA 1MJCA 1IZ6A 3OMGA 1M1KC 1C8CA 2E2IH 2AWNA 1Q1BA 3S17B 5K5PA 1DM0B 2UXCQ 1CQVA 4FF3A 4DNRB 1NMGA 4LF9L 5J22A 2B2WA 1G8ZD 5A2QL 1D5ZC 2E2IB 2PW7A 3JAML 2HCCA 1EU3A 3RLFA 1W3SA 1UEAB 1VF7A 4C3JH 3T51B 1KQSA 2AKWB 2K75A 2F52A 3NQIA 3CCSA 3I4OA 2YTVA 2Z1CA 1YIJA 4OO1G 3F2DA 5AJ3L 3EVQA 4NDXA 4KN7C 3P75A 3I4MB 4L63B 1YZ6A 5C0XJ 2KOLA 4UP7A 3S16H 3D6WA 3QIAA 4LF6L 5CV7A 3CPFA 1KHIA 3L2PA 2CWPA 1S5CD 4ODGA 1LTBD 5C4JB 1YJNA 3E3XA 3K81C 4Q5VA 1IHZA 5ELOA 4FF2A 2VXWA 3RZDH 1I5FA 3PUZA 3T13A 1QE6A 4KKSA 1NMFA 5EJWA 4O0AA 2HHHQ 2M2LA 5AFWA 3CC4A 1DCZA 4XT3B 5G3LD 4AYBE 4GN3B 2MO1A 2YTYA 1JWUD 5M5YB 1AW7A 1EQVA 2PI2A 1VDZA 1D7QA 1O80A 1GO3E 3BVMA 4UP9A 2Q2TA 4JK1C 5GAHC 2E74C 2ZXPA 1KL9A 1M90C 3OMCA 2YV5A 1PTOH 1EFID 3I8ZA 5IE8A 1XNRQ 1EUJA 1YHBA 4QCLA 1PFSA 1PXUA 2JA5G 3D31A 4BXXH 3NK9A 3MXNB 4ZK9B 2EJMA 4DK0A 3EROA 1HR0L 1CKNA 4GNXB 1X55A 4XDXA 2Z0SA 4AYBG 2ENBA 3IL8A 4JI1Q 3NBIA 3CCEA 4V0BA 5GROA 3PO3B 1D1IA 4WRDA 4IOCA 3FPPA 2R7ZB 4LMQD 1K8MA 4RKLA 2A19A 3RZOH 2PNRC 4Y7NB 3CD6A 4LFAQ 4DV7L 1ILPA 1CI3M 5LMNQ 2AQ2B 1VQBA 5FO7B 4DNIA 1U9RA 1SMYD 4JG2A 1Q46A 4C3HH 4LF8L 1HNXL 3VR2A 3LGJA 3CCQA 2Q8TA 5HY6A 5C3EG 3MHBA 1PFBA 2IX0A 1L1OB 3I4MH 1GOZA 1K8AC 1PVOA 3L9AX 4XQNA 1JJGA 4LJZC 1M8AA 4S3SA 3HOYB 3OYYA 4G57A 2A5HA 4C3HB 3ND9A 3Q22A 1U4RA 3Q6SA 4IPHA 3GTJB 1MI2A 1NAPA 3KF6A 3PV0A 4C3JB 4YCWA 3A7AB 1SLJA 4XQQA 1J5EQ 4HR7B 1YNJC 4O42A 5EPKA 1BO0A 4OHJA 1SE4A 2WKCA 3F1ZA 1LTRD 2DNCA 2E75C 1FR3A 4IURA 1E22A 4ZYSA 5ELNA 1EWHA 3AYHB 2UXBL 1DYQA 3OSOA 1XYIA 3PO3G 1SMYC 3E9HA 4A3JG 3AFPA 1X3GA 3NWTA 2Y0SB 5M5XH 1XJVA 4EQNA 4JI2Q 3PUXA 3TP5A 4F88A 3J80E 1XMQQ 4DFAA 2DUDA 3RR5A 4E6IA 5HURA 4X65L 5COYA 2BCOA 2QCPX 4AIMA 4MZ9A 2AMCB 3EIVA 3M4PA 3GQBA 1YNJD 3IFDA 2WB1G 4FO2A 1SNOA 4GLVB 3A8JE 4A3EG 2MHVA 1O78A 1ZYRD 4RCOA 3NQTA 4C3HG 5FLMG 4J6HA 4A3MB 2QF7A 4DK3C 3UDIA 2B2TC 4PMCA 3S24A 4EQ5A 1QVFA 5LL6S 1VQIA 2HHHL 2JXMB 4B3MQ 4RAUC 3FEWX 3E0EA 4KJOA 4P75A 3NELA 5CBAE 1KIXA 3I73A 5EPLA 5G3LF 5DM63 2UXBQ 1BVSA 3PO2G 3GDEA 1S4ZA 2NZ1D 2IL8A 1Y14B 5E4WC 3I4LA 2KCTA 1N8RC 2QW7A 1UEBA 2NN6I 5IP7H 2OCEA 1C9OA 3MWYW 1ZKOA 1LLRD 4IALA 3OPOA 1X56A 1LO5D 5DNFA 1ZXTA 3A55A 1K3BC 2KCCA 3C2PA 1TU2B 3RMHA 4OWWB 4B9XA 2C5CA 2VS1A 4DK1A 2IPKD 1JORA 4TRDA 4QIWE 1EEFD 3SDZA 3DMUA 1O7LA 3ND8A 3BDLA 1PZJD 2B2UC 1SYGA 1Y1VB 1G2SA 1I50H 3SXHA 3RN5A 1ILQA 3F2CA 4PNYA 4A3BB 5T1IA 4P73A 4DN4M 1EYGA 2PNHA 3TREA 3RD4A 1J5EL 2R7DA 5FLMH 3BZKA 4RH6A 3HOWH 2HIXA
chains in the Genus database with same CATH topology
2BE5D 3I90A 3NE5B 2O5JC 1KLUD 1NCVA 1F9SA 2L4NA 2K03A 3GV6A 1BCPD 2BA1A 2KA7A 4UAIA 2N55A 2KECA 2CHBD 3C3LA 1ENFA 2PO4A 3FMCA 4BS9A 3AU7A 3MAQA 4DGZA 2R6GA 2BA0A 4V190 1HQMC 1Q90A 2BDOA 1CA5A 2LFNA 5IGGA 4F7XA 1SYCA 1BCPC 1WTOA 1K83B 5E1FA 1TWHB 4A3KB 4U673 4HSPA 4N9PA 1ET6A 1WTVA 4K5VA 5KYIA 1GXDC 2F0SA 1SNPA 2K5WA 1PZID 4QUFA 1LV9A 2WACA 1KLGD 3T53B 2E2JB 1CM9A 2B2VC 1SNQA 3TZDA 1IW7C 1A15A 1SE2A 3GTQB 3OWEB 4MHEA 5KIXA 4K8IA 3S2DB 4TQUS 2F0NA 1G91A 5KEEA 3MXUA 3A8KE 3S16B 1GJXA 3K5OA 4WFN3 5JPMC 5C0XI 1XXGA 4C56C 4XTCS 3H3VC 1V1PB 2JA5B 4OIKA 3BVGA 4KN4C 3E6ZX 1JQYD 3KK7A 3X3MA 1B2TA 2WB1B 2J0TD 4B08A 5FOBB 3BDOA 1QG7A 3E5SA 1HFNA 3KLSX 2L5TA 2A68D 3R2IA 4BA2I 1HQRD 5CYUA 4HCEA 5CV9A 5C5LA 3CU7A 5CV5A 2B2YC 4KMUC 3NPPA 1I6VC 4OO1I 1SNCA 1Z6HA 2H4OA 4FF4A 2MUYA 2NWGA 4RGTA 1L0YB 3A54A 3GTGB 3BZDB 2EYPA 3ZYYX 3QJYA 5C3WA 4KKTA 1HCZA 3RZOB 4ME5A 5C44B 3ITPA 3K57A 5EPJA 1EIHA 2A68C 1CZWA 3HS0C 2EZVA 1XX8A 4KK7A 5DAUA 1EY4A 5IODA 5JVH3 4C1NI 2FMCA 2CVRA 2RDGA 3J7AF 1QJOA 2QDBA 4RGMA 1AFPA 5NUCA 4BA1I 5FLXE 3M3YB 1STHA 2JSOA 2XSCA 4LK1C 2LMCB 3R8BA 4ABNA 4KTAA 4ULLA 4K6LA 2CW0D 1EWCA 1FNUA 1CHQD 3SE0A 4H0LC 2AWOA 5KGUA 5KNBA 4CJ1B 1CTMA 1M4VA 5M5WB 2DN8A 2XN9C 1DXMA 2B8FA 4A3FB 3VYRA 4RA8A 3KLRA 2JEBI 3K6OA 1SXTA 2EYJA 3H91A 1DONA 2JEAI 1K8OA 2G9HD 3CQZB 4MIUA 3MZ5A 3K5MA 1J9OA 4EVOA 2D5DA 2K5DA 2TMPA 3DEOA 1B44D 1SYFA 1TIID 3HOZB 4DXGA 1EOTA 1GUGA 2F4IA 4DF7A 4RWSC 3K7AB 1CFMA 2O5IC 1EYDA 4XIGS 4BY1B 2PPBC 1WCMB 3QB3A 2PQEA 4QIWB 3SK8A 4K6DA 1TS2A 1S5ED 4KHZA 2HQEA 4KD3A 5IGBA 3PMFA 1OO9B 3M4OB 3GP7A 2JP1A 2FMMA 4XXEA 2FJ2A 3TP8A 2F0MA 2ZXRA 2IX3A 2OEOA 3VYUA 1PTOC 2ICIA 5ELCA 4RHRA 5KRUA 1STGA 5KYLA 2EYLA 3OIPA 2LY7A 1KNAA 3K5LA 1FD7D 1F9QA 2DNEA 2IWHA 5J1ZA 3HOXB 3HGBA 1JOOA 3BDCA 1LABA 3PUVA 2F0EA 1LT5D 1WTPA 1ENAA 1RCVD 2O4XA 5A2QE 1Q12A 2EYHA 1T5EA 2WKDA 2NVXB 2EJFC 2L55A 5IOCA 1PTOD 1LTID 1OXSC 4EQPA 4RKBA 1HUNA 5TSSA 2RSNA 3TP7A 3L3OC 2F03A 4J8QA 2NN6H 4K14A 2WIIB 2F0KA 3JAME 3SK4A 2YYZA 1EY7A 4A3DB 4M1UB 4NP5A 3EQLC 2XNAC 2WAQB 4F87A 1HTLD 5C3XA 5HGTA 2HCIA 2KUMA 2K6AA 5I2XA 3T56B 1QB5D 4K2LA 4QUCA 1Z47A 3I4NB 4K2KA 1T5XD 2D2CC 1B4OA 1FGBD 2FINB 1IKLA 1TVXA 4KHVA 5CV4A 3S15B 1KNEA 2PW5A 1A2TA 1MSHA 5C5MA 4A3GB 4PQXA 1A6XA 3SHLA 5M3FB 4QF4A 2R93B 2H1EA 1LTTD 4C2MB 1II3A 1X3PA 1F9PA 3GTKB 4R8NA 5IGCA 4X3TA 2IJ0A 2KJXA 4NW2A 3TN2A 1QCBD 1RF2D 3HEJA 1TS5A 1LTGD 2A69D 4A3JB 3S1MB 5EBCA 2K33A 3D6CA 1LTSD 1ZEQX 3VYTA 1X3QA 2XRSD 1B9MA 3FDTA 3U9OA 2R61A 5A35A 2QILA 1JICA 1I6HB 3OIQA 4IN3A 2A6ED 5IIFA 1LTAD 3SVMA 3DHQA 1UAPA 1JWMD 2EVBA 1EQTA 1U4MA 2F0IA 5C3EB 1F2LA 2F0LA 2WV6D 1DZ1A 2A69C 2J4XA 3CHBD 4U68A 3OHXC 3MXNA 2ZXOA 4DNTB 2J7ZA 4H44C 3HG9A 1BQQT 4EQOA 4DA2A 1PRTC 1BF4A 5DEHA 1X32A 2Z8LA 1D1KA 4DAYA 4G4KA 3KLSA 2JYOA 1AZQA 4C3IB 3M7NA 3K58A 1H9KA 1TT2A 3W2DA 4J1MA 2A6EC 4R8IA 3TZUA 2I07B 2F0OA 4OGQC 4NKLA 4NMZA 3SK5A 1KABA 2GA4B 2F0QA 3C46A 4I65A 4IUUA 4KY5A 1DOLA 3R2TA 1GHJA 1DOKA 3LNNA 1C48A 3H0GB 1EU4A 1H9RA 2A6HC 1HHVA 4PV1C 5EKIA 2LS01 1PRTD 1E0BA 2HDLA 3QOLA 2NVQB 1PRTB 1B53A 5JJZA 3Q23A 1JCKB 5IT9L 2DY8A 1IYVA 3M4YA 1STAA 3BYTB 3G6JB 2QEJC 4CJ0B 1RKNA 1U4PA 1D5XC 1TQOA 3O13A 5JVG3 5E3FA 1NR4A 2OT2A 5FLXL 2PZUA 2AQ3B 3V2TA 1EY8A 1PFNA 1AEXA 1QNUA 1DJRD 3AB9A 3L7ZC 5BN5A 2PMZB 2F0UA 1BUVT 1R4PB 2EOTA 3DEPA 3C1FA 1F9RA 1I3QB 1D6EC 1GUTA 2F0JA 3BS1A 3WOEA 3H09A 1SEBD 1JE4A 2VUMB 3IKJA 3UI2A 3EFXD 4ID6A 1KTKA 1V43A 3HRZC 3W3AA 2VNUD 1EY6A 2EE1A 1ZYRC 3GTPB 3EJIA 2E76C 4IUTA 1STBA 1SYEA 2K5QA 4KKUA 3MTSA 1GUSA 1PDQA 1WTXA 3KUPA 3Q24A 2N88A 4KI0A 3VR5A 3QOJA 2JE6I 3D8GA 4CGYB 1KDBA 5D14A 3MXGA 1A3UA 3IFTA 3N52A 1KDAA 3FRPB 4HMJA 3LX0A 5ELDA 1WTQA 2F0WA 1JR0D 2FHTA 2B2UA 4IUVA 5E4XA 2E2HB 4G7ZC 3T4AC 4IFDI 1BCPF 1G291 1H9SA 4K5XA 1RTNA 2K05A 1SNMA 2KHSA 1W6KA 3VA7A 1IYUA 1Z7TA 1MGSA 1SAPA 2PZTA 2F0FA 1SBBB 1EY5A 2D9UA 3NP8A 2NBFA 5J39A 5I9OA 2HDMA 3A8IE 4KJNA 4CKBA 4QB4A 1B1ZA 1PRTF 1QOHA 1A3VA 4FF1A 1KAAA 5CMDA 2KCNA 1ENCA 1HXYD 2EXZA 4Q0FA 1A3TA 2M00A 3N6RA 5JAVA 4RHSA 1H9MA 1JOQA 4XYOA 1RTOA 3V05A 1ET9A 4ILWA 2NN6G 4BY7B 2L9HA 4ZQ3A 3GO5A 3BYYB 5BN3A 2OXPA 4FXGC 1ONLA 1SE3A 3S1QB 4FVMA 1JB3A 1CZGA 3FPUB 4R9WA 3OW7A 2SOBA 4HEDA 3H6MA 4OO1H 2RSOA 3K0YA 1CT1D 2AUKA 2C9OA 5CV6A 2K1BA 2R92B 1EIGA 5JEAJ 1BDOA 1RHPA 1VMCA 5IGEA 3GTOB 1W6JA 1LT4D 2JA6B 5IT9E 4A93B 1EL0A 1WTRA 2SNSA 1IKMA 4RGOS 1LT6D 1VMPA 1DD2A 1F2ZA 2SDFA 3J81L 2NB0A 1WTWA 1OXVA 1HPCA 1JOKA 1XWEA 3GD7A 4GZYC 5CV8A 1Q1EA 3D4RA 5ELBA 5LHY1 1HRJA 1TKWB 5C0XH 2RBMA 1SJED 4IQZA 2EYMA 1EZ6A 2X6GA 1S5BD 5LL6X 1XTCD 1RD9D 5JOBA 5FKAC 2DY7A 5M3MB 5I9PA 1BOSA 3FVQA 3J7YW 4HN7A 3PIO3 2X6LA 3HZXA 3S2HB 4CKCA 1EY0A 4HSVA 1CHPD 5I6YA 2F0VA 4RCNA 1SDFA 3M7GA 3GTMB 1WD1A 1Q8IA 1KDCA 4X3UA 3SK6A 3E0JA 4WORA 1LT3D 3CRKC 2F1MA 3OOCA 5ELFA 2NYZD 2TSSA 4IUNA 3DUZA 2XIWA 5I4DA 2L1BA 4ZKBB 2NVTB 1MBYA 5KNDA 3QG1A 2NTSA 5ISRA 3FKIB 1HTPA 5C0XG 3K59A 5D65A 2A74C 4Z9CB 1HA5A 1RJTA 2ZT9C 5FO8B 2RQXA 2O2LD 1HUMA 2F3VA 1I4GA 4QMGA 1B9NA 2Q8RE 3X3NA 3S9WA 4AYBB 1WVLA 2VB2X 4BBRB 3DWQA 3IAYA 1D5MC 2AQ1B 1EEID 4XYQA 4IFDJ 4XQJA 1QNKA 2B2VA 1GUWA 2B2TA 1VF5C 3PUYA 2MP1A 2BE5C 2NVYB 1BXTA 1JWSD 3Q0AA 4L8JA 2ID0A 1G2TA 4X3KA 3K5NA 1HFGA 3MVVA 3BG3A 1FYCA 1UNSA 1ICWA 2MJ8A 5EQ0A 3TDQA 4C1NK 1V8QA 1IW7D 3VR6A 3DM1A 1PTOF 1EYAA 3U9SA 3SR1A 2KQ3A 2F0HA 3EA6A 2D62A 4CHTB 5K36G 1I4XA 2RKSA 1YNNC 4I7ZC 5EGTA 1OXUA 1OXXK 2B2WC 3TP6A 4PMBA 2K04A 3I72A 3WDNA 5EBDA 1NSNS 2KEEA 3MEHA 3VYSA 3J7AV 2WP8J 3D4DA 5CGKA 1ESFA 1PYWD 3MXPA 2CW0C 5T1GA 4M8AA 4FXDA 3P1HA 2RDHA 2AUJD 5M9OA 1Y69U 1SYBA 1YNND 5C4XB 1S5FD 1CK1A 1SSOA 1CQFA 1NUCA 2Z4HA 1IL8A 4X3SA 5F2DA 5JEAH 3R93A 3VR4A 1SNDA 1R4QB 2FFKB 1B50A 5CC4A 1TR5A 4HCSA 2XRQD 5C6AA 3NHHA 4BWGB 1JC7A 1BCPB 1E2ZA 4N9TA 4LAAA 1WD0A 3NSWA 3R3OA 3PUWA 3RUZA 1H9SB 2K7VA 2L0CA 3TMEA 3PO2B 3LWUA 1TWGB 4DXFA 5CORA 2M9VA 1STEA 3NTIA 3NXWA 4CBVA 2L12A 1E2VA 4FP5D 3DWAA 5D3DA 2B39A 1ML0D 4HTHA 4MN3A 3PIP3 2OF1A 2F0DA 4FYDA 1DOMA 3C1EA 4ZUIA 1MSGA 3HOUB 1HA6A 1SYDA 1GHKA 4C3JG 1B3AA 1RODA 3ONAB 2IX1A 2IW3A 3LWEA 4ZAIA 1BR9A 2RDFA 3D3RA 5JEAG 1Q3LA 4DAVA 4OL7A 2BOSA 5CBEE 4PMWA 1R9TB 2F0PA 5KNCA 2Q8IB 2RVLA 2XWJB 2WINB 4FXKC 2K28A 5FO9B 2VB3X 1PZKD 1L0XB 2B2YA 5DM73 1NR2A 1PLFA 4FNFA 3S1NB 3MFYA 1I50B 4KD4A 4K8JA 2XWBB 2E2DC 1V1OA 1TS3A 2NTTA 3MFGA 1A2UA 5C4ZA 1PFMA 4A3EB 3G7LA 2QKIC 3ERQA 1TWAB 3H94A 4IFDH 2NUCA 3F2UA 3CKIB 3I70A 4HAEA 1AZPA 4RFBA 2EJGC 3MC0B 1TWFB 1QWYA 1Y8PB 2ICEC 4G7OC 4TKOB 2HUGA 1Y8OB 2X69A 4OIJA 4C3IG 1G6ZA 4TSSA 3BVZA 4BBSB 2MPMA 1F2YA 1UUPA 2EYOA 3DXJC 4YIJA 2EY2A 2RA4A 2LKVA 3GTLB 3WOFA 1F77A 2SEBD 1SFOB 4F8MA 3D4WA 1VCIA 2A73B 5M5XB 5JPNC 1TY2A 3I91A 2EPBA 3J81E 4IFDG 1I4PA 4H7BA 1AP0A 1EZ8A 2K01A 1OXTA 2MGSA 3HOWB 3NBHA 1U4LA 3NWSA 4O1NA 5ELEA 1GUOA 2PYKA 1TWCB 5I6WA 5CR3A 3I3CA 3OWFA 1V1PA 1EY9A 4JBWA 1GUNA 3P7JA 1LACA 3CRLC 4IUQA 1PTOB 2F0TA 2A6HD 2L11A 4IZ8A 2EY5A 2EDGA 3VR3A 1O7ZA 2PCFB 4CJ2C 1TS4A 4ZRZA 1PMRA 5BN4A 4A3IB 3M85A 5EKKA 1STYA 4DAPA 1QILA 2CQAA 3A7LA 5K36H 1O7YA 3SEBA 2K32A 2XVSA 4ZKCB 3P20A 2BDNA 4G7HC 3QO2A 3AMUA 1S5DD 3A56A 4CKEA 3NUCA 4KY7A 5I2YA 5IGDA 4WJWA 1FNWA 1H9JA 1ESRA 2B63B 2KEDA 4UDUC 2I46A 3KF8A 5IGFA 3KBGA 4B9WA 1F2MA 2SNMA 3J80L 4XT1B 1FNVA 2JA7B 1I4QA 2PZWA 1AN8A 2B8GA 3RZDB 1BBXC 2EYFA 4RGNA 2V4DA 4KY6A 5C4HA 3T16A 2F0GA 1RDPD 3S1RB 3V96A 3HP3A 3NTKA 3VA5A 1MD2D 1Y8NB 3HKZB 1D2BA 3TSSA 5EKLA 1CA6A 1BNZA 2EY1A 3S14B 2F3WA 2EY6A 2IT1A 3HOVB 1Y1WB 3QWNA 4IUPA 4L6TB 4HMIA 2G9DA 2KVMA 2R3ZA 4K5WA 4P2CB 2JA8B 1J8IA 1STNA 4H13C 3KBXA 4KV6A 4ZLTF 4DU9A 3TBIB 5FK9C 1C4QA 4ZUJA 3URYA 2YU9B 3DWPA 4EGVA 2Z4IA 3MA2B 1EYCA 3NTHA 3GV3A 5D3IB 1E2WA 1SJHD 1I4RA 1TY0A 1I4HA 3OMGA 1C8CA 2AWNA 1Q1BA 3S17B 5K5PA 1DM0B 1CQVA 4FF3A 4DNRB 5J22A 2B2WA 1G8ZD 5A2QL 1D5ZC 2E2IB 2PW7A 3JAML 2HCCA 1EU3A 3RLFA 1UEAB 1VF7A 3T51B 3NQIA 2Z1CA 4OO1G 3EVQA 4NDXA 4KN7C 3P75A 3I4MB 4L63B 5C0XJ 2KOLA 3D6WA 3QIAA 5CV7A 1S5CD 4ODGA 1LTBD 5C4JB 4Q5VA 1IHZA 4FF2A 2VXWA 3PUZA 3T13A 1QE6A 4KKSA 5EJWA 2M2LA 5AFWA 1DCZA 4XT3B 5G3LD 1JWUD 5M5YB 1AW7A 1EQVA 1VDZA 1O80A 3BVMA 4JK1C 2E74C 2ZXPA 3OMCA 1PTOH 1EFID 3I8ZA 4QCLA 1PXUA 3D31A 3NK9A 4ZK9B 2EJMA 4DK0A 3EROA 4XDXA 2ENBA 3IL8A 3NBIA 4V0BA 3PO3B 1D1IA 4WRDA 3FPPA 2R7ZB 4LMQD 1K8MA 4RKLA 2PNRC 4Y7NB 1ILPA 1CI3M 2AQ2B 5FO7B 1U9RA 1SMYD 3VR2A 2Q8TA 3MHBA 1PFBA 2IX0A 1GOZA 3L9AX 4XQNA 4LJZC 1M8AA 4S3SA 3HOYB 4G57A 4C3HB 2A5HA 3ND9A 3Q22A 1U4RA 3Q6SA 3GTJB 1MI2A 1NAPA 3PV0A 4C3JB 3A7AB 4XQQA 4HR7B 1YNJC 4O42A 5EPKA 1BO0A 4OHJA 1SE4A 2WKCA 1LTRD 2DNCA 2E75C 1FR3A 4IURA 4ZYSA 1EWHA 1DYQA 3OSOA 1XYIA 1SMYC 3NWTA 2Y0SB 4EQNA 3PUXA 3TP5A 4F88A 3J80E 4DFAA 4E6IA 5HURA 5COYA 2BCOA 2QCPX 3GQBA 1YNJD 3IFDA 4FO2A 1SNOA 3A8JE 2MHVA 1O78A 1ZYRD 4RCOA 3NQTA 4C3HG 4J6HA 4A3MB 2QF7A 2B2TC 4PMCA 5LL6S 2JXMB 4RAUC 3FEWX 4KJOA 5CBAE 3I73A 5EPLA 5G3LF 5DM63 1S4ZA 2NZ1D 2IL8A 5E4WC 3I4LA 2NN6I 3MWYW 1ZKOA 1LLRD 4IALA 3OPOA 1LO5D 5DNFA 1ZXTA 3A55A 2KCCA 3C2PA 1TU2B 3RMHA 4B9XA 2C5CA 4DK1A 2IPKD 1JORA 4TRDA 1EEFD 3SDZA 3DMUA 1O7LA 3ND8A 3BDLA 1PZJD 2B2UC 1SYGA 1Y1VB 1G2SA 3SXHA 1ILQA 4PNYA 4A3BB 5T1IA 4DN4M 3RD4A 4RH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RGM A;  3OWE B;  3GP7 A;  1MD2 D;  1SEB D;  4O1N A;  1PRT C;  5ELE A;  3TSS A;  1T5X D;  2Z8L A;  1SBB B;  3EFX D;  1KTK A;  3R8B A;  1V1O A;  1TS3 A;  5ELB A;  1JWU D;  2NTT A;  1AW7 A;  1KLU D;  3MFG A;  1SJE D;  2XRQ D;  1FGB D;  4K6L A;  1V1P A;  4BWG B;  1BXT A;  3W2D A;  1EWC A;  4L6T B;  3BVM A;  1B1Z A;  1PRT F;  1JWS D;  1S5B D;  1BCP B;  1FNU A;  1CHQ D;  1XTC D;  1RD9 D;  1XXG A;  1BCP D;  4C56 C;  1UNS A;  5FKA C;  1HXY D;  1PTO C;  2ICI A;  1PTO B;  1PTO H;  1M4V A;  1EFI D;  1V1P B;  5ELC A;  2CHB D;  2XN9 C;  4RCO A;  4RHR A;  4RHS A;  4RFB A;  1ENF A;  3BVG A;  3MC0 B;  1JQY D;  4DXF A;  3R2T A;  1PTO F;  1STE A;  3V05 A;  5FK9 C;  1CHP D;  1SXT A;  1LTT D;  1EU4 A;  1ET9 A;  1FD7 D;  3URY A;  3DWP A;  1PRT D;  3KLS X;  3EA6 A;  3R2I A;  1TS4 A;  3DWA A;  5D3D A;  3BYY B;  1HQR D;  1I4X A;  2G9H D;  1PRT B;  1LT3 D;  4TSS A;  2IJ0 A;  1LT5 D;  3BVZ A;  1RCV D;  5D3I B;  1SJH D;  1I4R A;  1QIL A;  1I4H A;  1SE3 A;  1TY0 A;  1UUP A;  5ELF A;  1JCK B;  1RF2 D;  2TSS A;  3SEB A;  1CQV A;  1LLR D;  1TS5 A;  1BCP C;  1LTG D;  2AQ2 B;  1PTO D;  5I4D A;  1S5D D;  1LTI D;  1LO5 D;  1G8Z D;  3BYT B;  1LTS D;  2QEJ C;  5ELD A;  5TSS A;  1B44 D;  1F77 A;  2SEB D;  4RGT A;  1ET6 A;  1D5Z C;  1L0Y B;  1FNW A;  2XRS D;  4DXG A;  2NTS A;  1JR0 D;  1EU3 A;  1D5X C;  2R61 A;  3BZD B;  2QIL A;  1CT1 D;  1ESF A;  2IPK D;  3O13 A;  4UDU C;  1GOZ A;  1PYW D;  1EEF D;  2AQ3 B;  4Z9C B;  1PZJ D;  1HA5 A;  2RDH A;  1PZI D;  1LTA D;  4L63 B;  1DJR D;  2O2L D;  1BCP F;  1FNV A;  1JWM D;  1LT4 D;  1I4G A;  1I4Q A;  1TY2 A;  1TS2 A;  1AN8 A;  4OHJ A;  1SE4 A;  1S5E D;  2XNA C;  1S5F D;  1KLG D;  4RGO S;  1HTL D;  1I4P A;  1LTR D;  1CK1 A;  1S5C D;  4RGN A;  3DWQ A;  1LT6 D;  2RDG A;  1D6E C;  4ZYS A;  1D5M C;  1RDP D;  1LTB D;  1SE2 A;  2WV6 D;  2AQ1 B;  1EEI D;  1DYQ A;  4RH6 A;  1PZK D;  2J4X A;  3CHB D;  1L0X B; 
#chains in the Genus database with same CATH topology
 4A93 H;  1A62 A;  2BE5 D;  4DR3 Q;  1YHQ A;  3I90 A;  2B29 A;  3NE5 B;  4MNO A;  1EQQ A;  2O5J C;  1W2B A;  5GAG C;  1KLU D;  1NCV A;  1F9S A;  2L4N A;  2E2H H;  4K0K L;  3UDF A;  2K03 A;  3HOX G;  1PYB A;  3GV6 A;  1BCP D;  2BA1 A;  3PIP A;  2KA7 A;  4UAI A;  2N55 A;  2NVQ H;  4JYA L;  2KEC A;  2CHB D;  3C3L A;  1SRU A;  4JI5 Q;  2E5L L;  1ENF A;  1VQD A;  4H02 A;  2VQE Q;  4JI8 L;  4A76 A;  2PO4 A;  3FMC A;  1Y1V G;  4BS9 A;  4A3G G;  1FL0 A;  3AU7 A;  4J15 A;  2VQF L;  3MAQ A;  4DGZ A;  1WJJ A;  1EQR A;  2R6G A;  4A3K H;  2BA0 A;  4V19 0;  1HQM C;  1Q90 A;  4L5T A;  2BDO A;  1K9M C;  2JK8 A;  4BBR G;  3CF5 A;  1CA5 A;  1IL2 A;  1VQP A;  2LFN A;  2JQO A;  2YTX A;  5IGG A;  4F7X A;  1SYC A;  1BCP C;  2QEX A;  1WTO A;  1K83 B;  5E1F A;  4LF7 Q;  3T1H Q;  1TWH B;  4A3K B;  4U67 3;  4ZCK A;  4HSP A;  1HNZ L;  1YJ9 A;  4N9P A;  1ET6 A;  1WTV A;  3FKI G;  1Q81 C;  4K5V A;  5KYI A;  1GXD C;  2F0S A;  1SNP A;  2ZJQ A;  2K5W A;  1S40 A;  3HKZ E;  1PZI D;  4QUF A;  3UE1 A;  3K7U C;  1MHW C;  4NXM L;  2WAQ E;  3J81 c;  1LV9 A;  4HJ9 A;  2WAC A;  1KLG D;  3T53 B;  2E2J B;  1CM9 A;  2B2V C;  1SNQ A;  3TZD A;  3GTO H;  1IW7 C;  1A15 A;  1SE2 A;  1JJC B;  3GTQ B;  4LF5 Q;  3OWE B;  3RNU A;  4MHE A;  5KIX A;  4K8I A;  3S2D B;  4TQU S;  2F0N A;  1IYJ B;  1G91 A;  3NBH B;  1S72 A;  3I4N G;  4LFC Q;  5KEE A;  1VQ6 A;  4A3G H;  3MXU A;  3A8K E;  4IJH A;  3S16 B;  1GJX A;  3K5O A;  5M3M H;  3SGI A;  4WFN 3;  4HIM A;  2I5L X;  5JPM C;  4GKJ Q;  5C0X I;  1XXG A;  3AQQ A;  4C56 C;  4OEL B;  4DV4 Q;  4XTC S;  4B3S L;  3H3V C;  1V1P B;  2JA5 B;  2NVY H;  1K28 A;  1A0I A;  3A5Z B;  4OIK A;  3BVG A;  4KN4 C;  3E6Z X;  1NJI C;  3GTM H;  1JQY D;  1VQA A;  3KK7 A;  3X3M A;  1B2T A;  2WB1 B;  3FKI H;  2J0T D;  4B08 A;  5FOB B;  3BDO A;  1QG7 A;  3E5S A;  1HFN A;  3KLS X;  2L5T A;  1YIT A;  2A68 D;  3R2I A;  3KOJ A;  3W1B A;  3Q8D A;  3ICE A;  4BA2 I;  1HQR D;  5CYU A;  1PA6 A;  1IBM Q;  2FXQ A;  4HCE A;  5CV9 A;  4DV0 L;  1NNX A;  5C5L A;  2I5M X;  3CU7 A;  4OX9 Q;  5CV5 A;  1IBM L;  2B2Y C;  4KMU C;  3NPP A;  3G48 A;  1I6V C;  1HZA A;  4DAY B;  2C35 B;  4OO1 I;  1SNC A;  1Z6H A;  2CQO A;  2H4O A;  4FF4 A;  2MUY A;  3G4S A;  2NWG A;  4RGT A;  1L0Y B;  2PQA A;  3A54 A;  2JA8 G;  5C4X H;  3GTG B;  3BZD B;  2EYP A;  3ZYY X;  3QJY A;  5C3W A;  4KKT A;  2OQK A;  4I7A A;  1HCZ A;  1HZB A;  4ME5 A;  3RZO B;  5C44 B;  3ITP A;  3K57 A;  5EPJ A;  1EIH A;  2A68 C;  1CZW A;  3HS0 C;  2VZA A;  1XX8 A;  2EZV A;  4KK7 A;  5DAU A;  1EY4 A;  1JE5 A;  2K14 A;  1GVP A;  2XTI A;  5IOD A;  4UPA A;  5JVH 3;  4GN5 A;  4C1N I;  4QGU A;  3AEV A;  2FMC A;  1I3Q H;  3EBE A;  2CVR A;  2RDG A;  3CCV A;  3J7A F;  3J81 i;  3NEM A;  4ME3 A;  4WJ3 M;  5DLQ E;  3HOU H;  1QJO A;  1K83 H;  2QDB A;  4RGM A;  2OWO A;  1AFP A;  5NUC A;  4BA1 I;  1K73 C;  5FLX E;  3M3Y B;  1STH A;  2JSO A;  4DUZ L;  2XSC A;  4LK1 C;  1XNQ Q;  2LMC B;  2QA4 A;  3R8B A;  3W1G A;  1X6O A;  4ABN A;  4KTA A;  4ULL A;  4A3J H;  4A3C G;  4KHP L;  4K6L A;  2CW0 D;  1EWC A;  4GLA C;  1PH9 A;  1FNU A;  1CHQ D;  3SE0 A;  4H0L C;  2AWO A;  5KGU A;  1TWG H;  3DM3 A;  5KNB A;  1PH6 A;  4CJ1 B;  1CTM A;  1M4V A;  5M5W B;  1TWA H;  2DN8 A;  2XN9 C;  1DXM A;  3KF6 B;  2B8F A;  1ASY A;  4A3F B;  3VYR A;  4RA8 A;  1SFO H;  1VQH A;  1KC8 C;  3KLR A;  2JEB I;  3K6O A;  1SXT A;  2EYJ A;  4BY7 G;  1L1O A;  3ER0 A;  5IY0 A;  3H91 A;  1DON A;  2JEA I;  4TVA B;  1K8O A;  3F8T A;  2G9H D;  3CQZ B;  4MIU A;  5H1S E;  3MZ5 A;  3K5M A;  4X66 Q;  5J3B A;  1N9W A;  1IBL Q;  1J9O A;  4YWL A;  3I7F A;  4EVO A;  2D5D A;  4GNX C;  2K5D A;  2TMP A;  3DEO A;  2DJG C;  3GTP H;  4DR5 L;  4JBJ A;  1B44 D;  1SYF A;  1TII D;  3L0O A;  3HOZ B;  4JI6 L;  1EOT A;  4DXG A;  1GUG A;  2F4I A;  1VQF A;  2V1C C;  3A0J A;  4DF7 A;  3ZJY C;  4RWS C;  3K7A B;  1V9P A;  5AJ3 Q;  1CFM A;  2O5I C;  1EYD A;  4XIG S;  4BY1 B;  1N36 L;  1VQJ A;  1GM5 A;  4A3C H;  2PPB C;  1WCM B;  2N49 A;  4A3F G;  3QB3 A;  2PQE A;  4QIW B;  3J80 i;  3SK8 A;  4K6D A;  1TS2 A;  1S5E D;  4CDD C;  4KHZ A;  2ALY B;  4JI4 Q;  2HQE A;  4KD3 A;  5IGB A;  3PMF A;  1C0A A;  1OO9 B;  3M4O B;  4UHV A;  1VQM A;  5JJI A;  1YI2 A;  1BKB A;  1JJ2 A;  3GP7 A;  2ASB A;  4JBM A;  4JOI C;  3CC2 A;  2JP1 A;  3KDF B;  2FMM A;  4B3S Q;  4XXE A;  2FJ2 A;  3TP8 A;  3PF4 A;  3KF8 B;  5BR8 L;  2F0M A;  5EAY A;  2ZXR A;  2KHJ A;  1E1T A;  1WOC A;  2IX3 A;  2OEO A;  2KEN A;  3VYU A;  5IP7 G;  4DR4 L;  1PTO C;  2ICI A;  4JPB W;  2N78 A;  5ELC A;  3HOY H;  4RHR A;  5KRU A;  4DUY L;  4DV2 Q;  1STG A;  5KYL A;  2EYL A;  3OIP A;  3HOX H;  2UU9 Q;  2LY7 A;  1KNA A;  1JMC A;  3K5L A;  3U4V A;  4BBS G;  1FD7 D;  4HID A;  1F9Q A;  4DV0 Q;  2DNE A;  5GAD C;  2IWH A;  4LF5 L;  5J1Z A;  3ERS X;  3HOX B;  3HGB A;  1JOO A;  4R4Q A;  5C4J H;  3BDC A;  2E8G A;  1LAB A;  3PUV A;  2F0E A;  1LT5 D;  1WTP A;  1ENA A;  1RCV D;  2O4X A;  1VQE A;  5A2Q E;  1Q12 A;  2EYH A;  4A3K G;  1T5E A;  2WKD A;  1I94 Q;  2NVX B;  2EJF C;  2L55 A;  5IOC A;  1PTO D;  1LTI D;  1OXS C;  4YWK A;  4EQP A;  4RKB A;  1HUN A;  4A93 G;  5TSS A;  2RSN A;  1XNR L;  3TP7 A;  2Y0S E;  4LF7 L;  3L3O C;  2HT1 A;  3JAM i;  2F03 A;  1P16 A;  1MJE A;  4J8Q A;  2NN6 H;  1XTD A;  4K14 A;  1SE8 A;  3RLN A;  1AH9 A;  2WII B;  4P72 A;  2F0K A;  1N34 L;  3JAM E;  3SK4 A;  2YYZ A;  1EY7 A;  2B63 H;  4A3D B;  4M1U B;  4NP5 A;  1FJG L;  3EQL C;  2XNA C;  4GN4 B;  4HJ7 A;  2WAQ B;  4F87 A;  1HTL D;  5C3X A;  5HGT A;  2HCI A;  2KUM A;  2K6A A;  5I2X A;  3T1Y Q;  3T56 B;  1QB5 D;  4K2L A;  4QUC A;  3H3V I;  2VW9 A;  1H95 A;  1Z47 A;  4GKK L;  3I4N B;  4K2K A;  1T5X D;  1KXL A;  5GQO A;  1K0S A;  2H5X A;  4HIO A;  4PZ7 A;  1N36 Q;  2D2C C;  1B4O A;  1FGB D;  4N8X 1;  4BY1 H;  2FIN B;  4BBR H;  1IKL A;  4DV4 L;  3I4N H;  1TVX A;  4KHV A;  5CV4 A;  3S15 B;  3ULL A;  2JA7 H;  3RLO A;  1KNE A;  2PW5 A;  1A2T A;  1MKH A;  1MSH A;  5C5M A;  4A3G B;  1UE7 A;  2RCN A;  4PQX A;  1A6X A;  3SHL A;  5M3F B;  5JJL A;  4QF4 A;  1G6P A;  2R93 B;  2H1E A;  1LTT D;  4C2M B;  1II3 A;  1X3P A;  3PSI A;  3G6E A;  1F9P A;  3EN2 A;  3GTK B;  4R8N A;  5IGC A;  4X3T A;  1IBL L;  2AHO B;  2B3G A;  2D0O A;  2IJ0 A;  2KJX A;  4NW2 A;  3TN2 A;  2MO0 A;  1QCB D;  4C2M H;  4DR1 L;  1RF2 D;  3HEJ A;  1TS5 A;  1LTG D;  2A69 D;  2L15 A;  4A3J B;  3S1M B;  3TQY A;  5EBC A;  2K33 A;  1SR3 A;  3D6C A;  1G51 A;  1LTS D;  4JYA Q;  1ZEQ X;  3VYT A;  1X3Q A;  2WFW A;  2XRS D;  4CDC C;  2K52 A;  1B9M A;  1GKH A;  3FDT A;  4PZ8 A;  4UP8 A;  2R61 A;  3U9O A;  5A35 A;  4JV5 Q;  2QIL A;  2LSS A;  1JIC A;  4YHH Q;  1I6H B;  4DR7 Q;  3S1M H;  3KYH C;  2RF4 A;  3JAM c;  3OTO L;  3OIQ A;  4IN3 A;  3TEH B;  2A6E D;  5C3E H;  5IIF A;  3PIO A;  1LTA D;  3SVM A;  3DHQ A;  1UAP A;  1JWM D;  2EVB A;  1EQT A;  2KCM A;  1U4M A;  2F0I A;  5C3E B;  1F2L A;  2F0L A;  2WV6 D;  5LMN W;  1WFQ A;  1DZ1 A;  2A69 C;  2J4X A;  3CHB D;  4U68 A;  3OHX C;  3MXN A;  2ZXO A;  4DNT B;  2J7Z A;  4H44 C;  3HG9 A;  1BQQ T;  1J6Q A;  4JI0 Q;  4EQO A;  2Q2U A;  4DA2 A;  5IWA L;  1PRT C;  1BF4 A;  5DEH A;  1X32 A;  2Z8L A;  1D1K A;  3S2H H;  4DV5 Q;  4DAY A;  2K5H A;  4G4K A;  3KLS A;  1XMO L;  3PO3 H;  2JYO A;  4JW0 A;  1AZQ A;  1B70 B;  4C3I B;  4DR6 L;  4GOP B;  3M7N A;  3K58 A;  1H9K A;  1TT2 A;  3W2D A;  4IPC A;  4DR6 Q;  4J1M A;  3AFQ A;  2A6E C;  4NB3 A;  1A63 A;  3TZU A;  4R8I A;  2I07 B;  2F0O A;  2LXK A;  3I55 A;  4PG3 A;  4OGQ C;  4NKL A;  5IYB G;  2VUM G;  4NMZ A;  3NEN A;  3WWV A;  3SK5 A;  1KAB A;  1QUQ B;  2GA4 B;  2F0Q A;  3H3V H;  3C46 A;  4I65 A;  4IUU A;  4KY5 A;  1TWC H;  4R4O A;  4NPS A;  4IO9 A;  1DOL A;  3R2T A;  1GHJ A;  2PQA B;  1PV4 A;  3BZC A;  1DOK A;  3J7A 5;  3LNN A;  2JA8 H;  1C48 A;  3H0G B;  1EU4 A;  1H9R A;  2DGY A;  2A6H C;  1HHV A;  4PV1 C;  5EKI A;  1CKM A;  2LS0 1;  1PRT D;  1E0B A;  5E7N A;  2HDL A;  4B3T L;  4JVZ A;  3QOL A;  2NVQ B;  1PRT B;  1VS0 A;  4GS3 A;  1B53 A;  4IPD A;  2F3I A;  1UE5 A;  1QZG A;  5JJZ A;  3Q23 A;  1JCK B;  4A3I H;  5IT9 L;  3PO2 H;  1AE2 A;  2DY8 A;  1GD7 A;  3HOU G;  3M4Y A;  1IYV A;  1STA A;  1L1O C;  3BYT B;  3G6J B;  4B3M L;  2QEJ C;  2R92 G;  4DV1 Q;  4CJ0 B;  1RKN A;  1VQN A;  4O2D A;  2UU9 L;  1U4P A;  1D5X C;  3PCO B;  1TQO A;  1YEZ A;  1EOV A;  3O13 A;  2R93 H;  5JVG 3;  5E3F A;  1NR4 A;  2OT2 A;  5FLX L;  2PZU A;  2AQ3 B;  3V2T A;  1EY8 A;  1PFN A;  1QZH A;  1AEX A;  4MTN A;  1QNU A;  1DJR D;  3AB9 A;  3L7Z C;  4X62 Q;  5BN5 A;  2PMZ B;  4DUZ Q;  1O7I A;  2F0U A;  4JI4 L;  1BUV T;  1R4P B;  2EOT A;  3DEP A;  2VUM H;  3C1F A;  1F9R A;  1I3Q B;  4B3R L;  1D6E C;  1VQO A;  3CW2 C;  1KRT A;  1GUT A;  2F0J A;  3FHW A;  3BS1 A;  3WOE A;  3H09 A;  1N33 Q;  1SEB D;  4BY7 H;  1JE4 A;  3OW2 A;  2PI2 E;  2VUM B;  3IKJ A;  3UI2 A;  3EFX D;  4ID6 A;  1KTK A;  5FLX c;  2MFI A;  2ZJP A;  1TWF H;  1V43 A;  3HRZ C;  3W3A A;  1HH2 P;  3HOW G;  4A3L G;  2VNU D;  1HZ9 A;  1EY6 A;  2EE1 A;  3VDY A;  3GTL H;  1ZYR C;  1TXY A;  3GTP B;  4A4I A;  3EJI A;  4DR4 Q;  2E76 C;  4IUT A;  1STB A;  2IHF A;  1SYE A;  2K5Q A;  4DR3 L;  4KKU A;  3MTS A;  1GUS A;  1PDQ A;  1WTX A;  3KUP A;  1XNQ L;  3Q24 A;  3J80 c;  2HIV A;  2N88 A;  4KI0 A;  3JC6 6;  3VR5 A;  4JI3 L;  3H15 A;  3QOJ A;  4DV7 Q;  1E24 A;  3H0G H;  2JE6 I;  3D8G A;  2VL6 A;  4CGY B;  2F4V L;  1WYD A;  2YU9 H;  1KDB A;  4DV6 Q;  4A3M G;  5D14 A;  3MXG A;  1A3U A;  3CAM A;  3IFT A;  4LF6 Q;  1Q82 C;  5FJ8 H;  5L37 A;  3N52 A;  1KDA A;  3FRP B;  4HMJ A;  3KJO A;  1L0W A;  2Y0S G;  3LX0 A;  5ELD A;  3U4Z A;  4YHH L;  1NBW A;  1WTQ A;  2BH2 A;  2F0W A;  1JR0 D;  2UUC L;  2FHT A;  2K5V A;  3HKS A;  1RL2 A;  2B2U A;  2Z6K A;  4IUV A;  2UXD Q;  5E4X A;  1N34 Q;  1B7Y B;  2E2H B;  3PF5 A;  1T9H A;  4Y52 H;  4G7Z C;  3T4A C;  1LTL A;  4IFD I;  1BCP F;  1G29 1;  1H9S A;  2K50 A;  5IP9 H;  2ES2 A;  2I0Q A;  1QVC A;  4GOP C;  3HOY G;  1S3O A;  4K5X A;  1YJW A;  1RTN A;  2K05 A;  1SNM A;  2KHS A;  5C44 G;  1W6K A;  3VA7 A;  1IYU A;  1Z7T A;  1YBY A;  1MGS A;  1SAP A;  2PZT A;  2A8V A;  4BBS H;  2F0F A;  4A3D H;  1SBB B;  1EY5 A;  2D9U A;  3NP8 A;  4R4T A;  1XPU A;  2NBF A;  5J39 A;  2E5L Q;  4L5S A;  5I9O A;  2HDM A;  3A8I E;  4KJN A;  4LUO A;  4LUV A;  2WB1 E;  3TS0 A;  2RHS B;  3IRB A;  4CKB A;  4QB4 A;  1B1Z A;  1PRT F;  1QOH A;  2I5H A;  1A3V A;  4A3M H;  1U5K A;  4FF1 A;  4LF4 L;  1KAA A;  1X54 A;  2KCN A;  1ENC A;  5CMD A;  4JI2 L;  1HXY D;  2EXZ A;  4Q0F A;  1SMX A;  3U50 C;  1TWH H;  1A3T A;  2OQ0 A;  4ALP A;  2M00 A;  4BY1 G;  3N6R A;  1R9T H;  5JAV A;  4RHS A;  1H9M A;  1PH5 A;  1JOQ A;  4XYO A;  2Q2I A;  1RTO A;  3J81 j;  1RIP A;  1VQ4 A;  1VQ7 A;  3V05 A;  2JA7 G;  5LMU L;  1ET9 A;  4LUZ A;  4ILW A;  2BH8 A;  2NN6 G;  3CCU A;  3HOZ H;  1UE6 A;  4P71 A;  3S1Q H;  2L9H A;  4BY7 B;  4YCU A;  4ZQ3 A;  3GO5 A;  3BYY B;  5BN3 A;  3K8A A;  2B63 G;  1EIF A;  2OXP A;  4FXG C;  1ONL A;  4LFB Q;  4JI0 L;  2JJQ A;  4LFB L;  1SE3 A;  3U58 A;  3S1Q B;  1WCM H;  4FVM A;  1JB3 A;  3CME A;  1CZG A;  4QL5 A;  3FPU B;  4R9W A;  3OW7 A;  2SOB A;  4JI6 Q;  3HOV H;  4DUY Q;  5C44 H;  2P5Z X;  2OTJ A;  1VQ8 A;  4HED A;  3H6M A;  2UUA Q;  2JA9 A;  4OO1 H;  2RSO A;  3K0Y A;  3CPW A;  1CT1 D;  4JI7 L;  2AUK A;  2C9O A;  5CV6 A;  2K1B A;  4HJ5 A;  1CUK A;  2R92 B;  1EIG A;  1EFW A;  1BDO A;  5JEA J;  4LF8 Q;  1N32 Q;  1HJP A;  4Y7N H;  3K0X A;  4LFC L;  1RHP A;  5C4X G;  1VMC A;  5IGE A;  4OWX B;  4LFA L;  1PH7 A;  1W6J A;  3GTO B;  2IY5 B;  1LT4 D;  2JA6 B;  5IT9 E;  4A93 B;  1EL0 A;  1WTR A;  2SNS A;  4LW1 A;  1IKM A;  4RGO S;  1LT6 D;  2A1A A;  1VMP A;  1ICF B;  1DD2 A;  1F2Z A;  4DK6 C;  2SDF A;  3J81 L;  2NB0 A;  1WTW A;  3CP0 A;  1OXV A;  1HPC A;  1JOK A;  1XWE A;  3GD7 A;  4OEM B;  4GZY C;  5CV8 A;  1Q1E A;  3D4R A;  5ELB A;  5LHY 1;  1HRJ A;  4JOI A;  1TKW B;  5C0X H;  2RBM A;  1SJE D;  4POG A;  3BU2 A;  3K80 C;  4IQZ A;  4IPG A;  3BJU A;  2EYM A;  1EZ6 A;  2X6G A;  1S5B D;  1D8L A;  4NXM Q;  5LL6 X;  1XTC D;  1RD9 D;  5JOB A;  1VQG A;  5FKA C;  2DY7 A;  5M3M B;  1FVI A;  5I9P A;  1BOS A;  3FVQ A;  5M5Y H;  3J7Y W;  4HN7 A;  3PIO 3;  3B6Y A;  2X6L A;  3HZX A;  3S2H B;  4CKC A;  1XMQ L;  2XGT A;  1EY0 A;  5LMN L;  4HSV A;  4RMF A;  1C7Y A;  4C3I H;  5IYB H;  1CHP D;  5I6Y A;  5IT9 c;  4B3R Q;  1IBK L;  2F0V A;  2CH4 W;  4RCN A;  1SDF A;  3M7G A;  3GTM B;  1IBK Q;  4R4I A;  1WD1 A;  2F4V Q;  1Q8I A;  1EIY B;  1LYL A;  1KDC A;  4X3U A;  3S1R H;  3SK6 A;  3E0J A;  4WOR A;  4DV3 Q;  3A74 A;  3HFZ B;  4CDE C;  1LT3 D;  3CRK C;  3STB C;  2NZH A;  2F1M A;  3OOC A;  1VQL A;  5ELF A;  4YY3 L;  2EIF A;  2NYZ D;  2TSS A;  4IUN A;  4DKA C;  1LUZ A;  3DUZ A;  2XIW A;  4R1J A;  5I4D A;  1UE1 A;  2L1B A;  2RCF A;  1NY4 A;  4ZKB B;  3S14 H;  2NVT B;  1PH1 A;  1MBY A;  5KND A;  2ZJR A;  3QG1 A;  1FGU A;  2NTS A;  2Z6B A;  1Z9F A;  3KFU A;  5ISR A;  4IJL A;  1I6H H;  3FKI B;  1HTP A;  4DV1 L;  5C0X G;  3K59 A;  5D65 A;  4HJ8 A;  2A74 C;  4Z9C B;  3S17 H;  1HA5 A;  1RJT A;  2Q2H A;  2ZT9 C;  5FO8 B;  2RQX A;  2O2L D;  1HUM A;  2F3V A;  1I4G A;  4QMG A;  4K0K Q;  1B9N A;  2Q8R E;  3T1Y L;  3X3N A;  3S1N H;  3S9W A;  3STB D;  2ATW A;  4AYB B;  1U0L A;  1WVL A;  2VB2 X;  4BBR B;  4A3F H;  3DWQ A;  4YCV A;  2CCZ A;  3IAY A;  1D5M C;  2AQ1 B;  1EEI D;  4XYQ A;  1HNW L;  4IFD J;  4XQJ A;  1QNK A;  1X3F A;  2B2V A;  4NXN Q;  1GUW A;  2B2T A;  1WTH A;  1VF5 C;  5M3F H;  4OON A;  3PUY A;  2MP1 A;  1UWV A;  2BE5 C;  4A3E H;  2NVY B;  1BXT A;  4OWT B;  1JWS D;  3Q0A A;  4AQY Q;  4L8J A;  2ID0 A;  1G2T A;  4X3K A;  3K5N A;  1HFG A;  2UUC Q;  3MVV A;  4A3L H;  3BG3 A;  1FYC A;  1UNS A;  2UXC L;  3I56 A;  4A3I G;  1ICW A;  4N8F A;  2MJ8 A;  2JA6 H;  4AQY L;  3CC7 A;  5EQ0 A;  3TDQ A;  4C1N K;  4QQB X;  1V8Q A;  2JN4 A;  1IW7 D;  3VR6 A;  3RN2 A;  3DM1 A;  1PTO F;  1EYA A;  1AE3 A;  1ASZ A;  3U9S A;  3SR1 A;  2KQ3 A;  2F0H A;  1X9N A;  1BBW A;  3EA6 A;  2N3S A;  2D62 A;  4CHT B;  5K36 G;  2HQL A;  1VQC A;  4DV5 L;  1I4X A;  4HIK A;  2RKS A;  1YNN C;  4I7Z C;  5EGT A;  2E2J H;  1OXU A;  1OXX K;  2B2W C;  3TP6 A;  4PMB A;  2K04 A;  3I72 A;  3PQI A;  4L5R C;  2GN5 A;  3J7Z C;  4LF4 Q;  3WDN A;  1N32 L;  5EBD A;  5M5W H;  1NSN S;  3OTO Q;  2KEE A;  3MEH A;  3VYS A;  1CSP A;  5IYD G;  3J7A V;  1NE3 A;  3UDG A;  2WP8 J;  3D4D A;  1PH3 A;  2Z9H A;  5CGK A;  2R7Z H;  1ESF A;  5M3F G;  1PYW D;  3MXP A;  4PZ6 A;  2UUB Q;  2CW0 C;  5T1G A;  4M8A A;  4FXD A;  3P1H A;  2RDH A;  3K7A H;  2AUJ D;  3D0F A;  5M9O A;  4GOP A;  1Y69 U;  1SYB A;  1YNX A;  1YNN D;  4R4C A;  3GTG H;  5C4X B;  1S5F D;  1CK1 A;  1SSO A;  4X66 L;  3GTQ H;  5BR8 Q;  4APV A;  1CQF A;  1XMO Q;  4A3B G;  1NUC A;  3CCR A;  2Z4H A;  1IL8 A;  4X3S A;  5F2D A;  5JEA H;  3R93 A;  3VR4 A;  1SND A;  1R4Q B;  1KD1 C;  2FFK B;  4JI1 L;  1PHJ A;  1B50 A;  5CC4 A;  1TR5 A;  1Q7Y C;  4HCS A;  2XRQ D;  5C6A A;  3H0G G;  3NHH A;  4BWG B;  1OTC A;  1JC7 A;  4A3D G;  1BCP B;  1E2Z A;  4N9T A;  3S15 H;  4YWM A;  4LAA A;  1WD0 A;  3NSW A;  5FJ8 G;  4DR1 Q;  4LNQ A;  1HR0 W;  3R3O A;  1Y1V H;  3PUW A;  3RUZ A;  1L2F A;  1H9S B;  2K7V A;  2L0C A;  3TME A;  5IYD H;  3PO2 B;  3LWU A;  1TWG B;  5COR A;  2M9V A;  1STE A;  3NTI A;  3NXW A;  4DXF A;  4CBV A;  2MQH A;  2L12 A;  5GAE C;  1E2V A;  1XPR A;  4FP5 D;  3G71 A;  3DWA A;  2CH4 A;  2B39 A;  5D3D A;  1ML0 D;  4HTH A;  4MN3 A;  3PIP 3;  3TS2 A;  2OF1 A;  2F0D A;  4FYD A;  1DOM A;  3C1E A;  4ZUI A;  1K0R A;  5IYC H;  2CFM A;  3ULP A;  1MSG A;  3HOU B;  4HJA A;  1HA6 A;  1SYD A;  1GHK A;  3TRZ A;  3CQZ H;  4C3J G;  4A75 A;  4A3B H;  2JA5 H;  1JT8 A;  1P8L A;  1B3A A;  4CDF C;  1VQ9 A;  1ROD A;  3ONA B;  1K3R A;  1FJG Q;  2IX1 A;  1KRS A;  2IW3 A;  3LWE A;  1BR9 A;  4ZAI A;  4JI7 Q;  2RDF A;  3D3R A;  5JEA G;  1Q3L A;  4DAV A;  4DAM A;  3MEF A;  3HOV G;  2UUA L;  4OL7 A;  2BOS A;  5CBE E;  4PMW A;  1R9T B;  2F0P A;  4POF A;  5KNC A;  2VY3 A;  4FDB A;  1EWI A;  2Q8I B;  4GKK Q;  4L5Q A;  2RVL A;  2XWJ B;  1Q86 C;  4UY8 C;  4DV6 L;  3KLW A;  2GVB A;  4DV3 L;  2WIN B;  4FXK C;  2CKZ B;  2K28 A;  5FO9 B;  2VB3 X;  1PZK D;  1L0X B;  2B2Y A;  5DM7 3;  1NR2 A;  1YHA A;  1PLF A;  4FNF A;  5M3M G;  3MFY A;  3S1N B;  2K4K A;  1I50 B;  4KD4 A;  4K8J A;  4X64 Q;  1JB7 A;  2XWB B;  2OTL A;  2E2D C;  4MTK A;  3GTK H;  1V1O A;  1TS3 A;  3CMA A;  1V1Q A;  2DJF C;  4JBK A;  2NTT A;  3MFG A;  1A2U A;  5C4Z A;  1PFM A;  1PH2 A;  4A3E B;  3G7L A;  2QKI C;  3ERQ A;  1TWA B;  4BXX G;  4LF9 Q;  1WCM G;  1E7Z A;  1SN8 A;  3H94 A;  5IYC G;  4IFD H;  2NUC A;  3F2U A;  3CCM A;  3CKI B;  1WI5 A;  3I70 A;  4OX9 L;  4HAE A;  1AZP A;  1IXR A;  2EJG C;  4RFB A;  4QJF A;  3MC0 B;  3M9B A;  1TWF B;  3KDF A;  1QWY A;  1E1O A;  1Y8P B;  2ICE C;  2RHQ B;  1X65 A;  4G7O C;  4TKO B;  2HUG A;  1X3E A;  1B3Q A;  1Y8O B;  2X69 A;  2ZM6 Q;  4OIJ A;  1HNW Q;  4C3I G;  3A5U A;  1G6Z A;  4TSS A;  4NXN L;  3S2D H;  1LM0 A;  2KBN A;  3BVZ A;  4BBS B;  1QVG A;  2MPM A;  1F2Y A;  1UUP A;  2ZTC A;  4DR2 Q;  4DR7 L;  2EYO A;  3DXJ C;  4JV5 L;  4YIJ A;  2EY2 A;  3E9I A;  3I4M G;  2WAQ G;  2RA4 A;  2LKV A;  3GTL B;  4DPG A;  3WOF A;  1F77 A;  2SEB D;  3T1H L;  3HKZ G;  1SFO B;  3I2Z A;  2HD3 A;  4F8M A;  2LXJ A;  1CKO A;  1XPO A;  3D4W A;  5IWA Q;  2R92 H;  2N8N A;  4DR5 Q;  3CXC A;  1VCI A;  3CCL A;  2A73 B;  5M5X B;  5JPN C;  4WJ4 A;  2R93 G;  4JI3 Q;  1TY2 A;  3I91 A;  2EPB A;  3J81 E;  4IFD G;  1I4P A;  3DLL A;  4H7B A;  1AP0 A;  1EZ8 A;  1DGS A;  2VQE L;  2ZM6 L;  2K01 A;  1YVC A;  1OXT A;  2MGS A;  2ZTE A;  4QY7 A;  3NBH A;  3F2B A;  3HOW B;  4OXP A;  4JI5 L;  4LWC A;  1U4L A;  3NWS A;  3GTJ H;  4O1N A;  3M3Y H;  5ELE A;  1GUO A;  2PYK A;  1TWC B;  2IHE A;  5I6W A;  5CR3 A;  3I3C A;  3OWF A;  1PH4 A;  1V1P A;  2UUB L;  1HNX Q;  2NVT H;  2UXD L;  1EY9 A;  4JCV E;  4JBW A;  1GUN A;  3P7J A;  4RG1 A;  1LAC A;  3CRL C;  3PGZ A;  4IUQ A;  1PTO B;  1HNZ Q;  2F0T A;  2A6H D;  3UDX A;  2L11 A;  4IZ8 A;  2EY5 A;  2MNA A;  2EDG A;  2JA6 G;  4YY3 Q;  1VQ5 A;  3VR3 A;  2D0P A;  1O7Z A;  2PCF B;  1HR0 Q;  2EXD A;  4CJ2 C;  1A8V A;  1TS4 A;  4ZRZ A;  1PMR A;  5BN4 A;  4A3I B;  3M85 A;  5EKK A;  1STY A;  4JC0 A;  4DAP A;  1QIL A;  4JI8 Q;  2CQA A;  2K5N A;  3A7L A;  5K36 H;  1O7Y A;  3SEB A;  1PH8 A;  2K32 A;  2XVS A;  4ZKC B;  3P20 A;  2BDN A;  4G7H C;  3QO2 A;  3AMU A;  1S5D D;  3A56 A;  4CKE A;  3ULJ A;  3NUC A;  4KY7 A;  5I2Y A;  2ZTD A;  3M4Q A;  1NTG A;  1Y1W G;  5IGD A;  4WJW A;  1FNW A;  2NVX H;  4X62 L;  1H9J A;  1ESR A;  2B63 B;  2KED A;  4UDU C;  3QR8 A;  4GLX A;  2I46 A;  3KF8 A;  2KHI A;  3UE0 A;  1B8A A;  3KBG A;  4B9W A;  5IGF A;  1F2M A;  1KAW A;  2SNM A;  3J80 L;  1CSQ A;  4XT1 B;  1BBU A;  1FNV A;  2JA7 B;  1I4Q A;  2PZW A;  1AN8 A;  2QDL A;  2B8G A;  1MIU A;  1N33 L;  4IOA A;  3RZD B;  1BBX C;  2EYF A;  4RGN A;  2V4D A;  2CWA A;  4KY6 A;  3W5O A;  5C4H A;  3T16 A;  2F0G A;  1RDP D;  3S1R B;  3V96 A;  3M4O H;  3HP3 A;  5IP9 G;  1HZC A;  3NTK A;  3VA5 A;  4DV2 L;  1MD2 D;  1SRO A;  3CCJ A;  2Z6K C;  1Y8N B;  3HKZ B;  1PYS B;  5LMU Q;  3TSS A;  1D2B A;  5EKL A;  1CA6 A;  1BNZ A;  2EY1 A;  1E3P A;  1K8G A;  3S14 B;  2F3W A;  2EY6 A;  2IT1 A;  1VQK A;  3HOV B;  4AH6 A;  1Y1W B;  3QWN A;  4IUP A;  4L6T B;  5JJK A;  2QGQ A;  5HGQ A;  4HMI A;  2G9D A;  2KVM A;  2R3Z A;  4K5W A;  4P2C B;  2EQS A;  2JA8 B;  1J8I A;  1STN A;  4P74 A;  4H13 C;  4KHP Q;  2R7F A;  2GVA A;  4X65 Q;  3KBX A;  4KV6 A;  1Y1W H;  1I94 L;  4ZLT F;  3FP9 A;  4B3T Q;  4DU9 A;  3TBI B;  4X6A H;  5FK9 C;  4GKJ L;  3KJP A;  1QUQ A;  4KLK A;  2R7Z G;  1C4Q A;  4ZUJ A;  3URY A;  2YU9 B;  3DWP A;  2NZO A;  1Q8K A;  4EGV A;  1CKN B;  2G5D A;  4GNX A;  2Z4I A;  4X64 L;  2VQF Q;  2PMZ E;  4DR2 L;  3MA2 B;  3NTH A;  1EYC A;  3GV3 A;  4EX5 A;  5D3I B;  1E2W A;  3HOZ G;  1SJH D;  1I4R A;  1TY0 A;  1I4H A;  1MJC A;  1IZ6 A;  3OMG A;  1M1K C;  1C8C A;  2E2I H;  2AWN A;  1Q1B A;  3S17 B;  5K5P A;  1DM0 B;  2UXC Q;  1CQV A;  4FF3 A;  4DNR B;  1NMG A;  4LF9 L;  5J22 A;  2B2W A;  1G8Z D;  5A2Q L;  1D5Z C;  2E2I B;  2PW7 A;  3JAM L;  2HCC A;  1EU3 A;  3RLF A;  1W3S A;  1UEA B;  1VF7 A;  4C3J H;  3T51 B;  1KQS A;  2AKW B;  2K75 A;  2F52 A;  3NQI A;  3CCS A;  3I4O A;  2YTV A;  2Z1C A;  1YIJ A;  4OO1 G;  3F2D A;  5AJ3 L;  3EVQ A;  4NDX A;  4KN7 C;  3P75 A;  3I4M B;  4L63 B;  1YZ6 A;  5C0X J;  2KOL A;  4UP7 A;  3S16 H;  3D6W A;  3QIA A;  4LF6 L;  5CV7 A;  3CPF A;  1KHI A;  3L2P A;  2CWP A;  1S5C D;  4ODG A;  1LTB D;  5C4J B;  1YJN A;  3E3X A;  3K81 C;  4Q5V A;  1IHZ A;  5ELO A;  4FF2 A;  2VXW A;  3RZD H;  1I5F A;  3PUZ A;  3T13 A;  1QE6 A;  4KKS A;  1NMF A;  5EJW A;  4O0A A;  2HHH Q;  2M2L A;  5AFW A;  3CC4 A;  1DCZ A;  4XT3 B;  5G3L D;  4AYB E;  4GN3 B;  2MO1 A;  2YTY A;  1JWU D;  5M5Y B;  1AW7 A;  1EQV A;  2PI2 A;  1VDZ A;  1D7Q A;  1O80 A;  1GO3 E;  3BVM A;  4UP9 A;  2Q2T A;  4JK1 C;  5GAH C;  2E74 C;  2ZXP A;  1KL9 A;  1M90 C;  3OMC A;  2YV5 A;  1PTO H;  1EFI D;  3I8Z A;  5IE8 A;  1XNR Q;  1EUJ A;  1YHB A;  4QCL A;  1PFS A;  1PXU A;  2JA5 G;  3D31 A;  4BXX H;  3NK9 A;  3MXN B;  4ZK9 B;  2EJM A;  4DK0 A;  3ERO A;  1HR0 L;  1CKN A;  4GNX B;  1X55 A;  4XDX A;  2Z0S A;  4AYB G;  2ENB A;  3IL8 A;  4JI1 Q;  3NBI A;  3CCE A;  4V0B A;  5GRO A;  3PO3 B;  1D1I A;  4WRD A;  4IOC A;  3FPP A;  2R7Z B;  4LMQ D;  1K8M A;  4RKL A;  2A19 A;  3RZO H;  2PNR C;  4Y7N B;  3CD6 A;  4LFA Q;  4DV7 L;  1ILP A;  1CI3 M;  5LMN Q;  2AQ2 B;  1VQB A;  5FO7 B;  4DNI A;  1U9R A;  1SMY D;  4JG2 A;  1Q46 A;  4C3H H;  4LF8 L;  1HNX L;  3VR2 A;  3LGJ A;  3CCQ A;  2Q8T A;  5HY6 A;  5C3E G;  3MHB A;  1PFB A;  2IX0 A;  1L1O B;  3I4M H;  1GOZ A;  1K8A C;  1PVO A;  3L9A X;  4XQN A;  1JJG A;  4LJZ C;  1M8A A;  4S3S A;  3HOY B;  3OYY A;  4G57 A;  2A5H A;  4C3H B;  3ND9 A;  3Q22 A;  1U4R A;  3Q6S A;  4IPH A;  3GTJ B;  1MI2 A;  1NAP A;  3KF6 A;  3PV0 A;  4C3J B;  4YCW A;  3A7A B;  1SLJ A;  4XQQ A;  1J5E Q;  4HR7 B;  1YNJ C;  4O42 A;  5EPK A;  1BO0 A;  4OHJ A;  1SE4 A;  2WKC A;  3F1Z A;  1LTR D;  2DNC A;  2E75 C;  1FR3 A;  4IUR A;  1E22 A;  4ZYS A;  5ELN A;  1EWH A;  3AYH B;  2UXB L;  1DYQ A;  3OSO A;  1XYI A;  3PO3 G;  1SMY C;  3E9H A;  4A3J G;  3AFP A;  1X3G A;  3NWT A;  2Y0S B;  5M5X H;  1XJV A;  4EQN A;  4JI2 Q;  3PUX A;  3TP5 A;  4F88 A;  3J80 E;  1XMQ Q;  4DFA A;  2DUD A;  3RR5 A;  4E6I A;  5HUR A;  4X65 L;  5COY A;  2BCO A;  2QCP X;  4AIM A;  4MZ9 A;  2AMC B;  3EIV A;  3M4P A;  3GQB A;  1YNJ D;  3IFD A;  2WB1 G;  4FO2 A;  1SNO A;  4GLV B;  3A8J E;  4A3E G;  2MHV A;  1O78 A;  1ZYR D;  4RCO A;  3NQT A;  4C3H G;  5FLM G;  4J6H A;  4A3M B;  2QF7 A;  4DK3 C;  3UDI A;  2B2T C;  4PMC A;  3S24 A;  4EQ5 A;  1QVF A;  5LL6 S;  1VQI A;  2HHH L;  2JXM B;  4B3M Q;  4RAU C;  3FEW X;  3E0E A;  4KJO A;  4P75 A;  3NEL A;  5CBA E;  1KIX A;  3I73 A;  5EPL A;  5G3L F;  5DM6 3;  2UXB Q;  1BVS A;  3PO2 G;  3GDE A;  1S4Z A;  2NZ1 D;  2IL8 A;  1Y14 B;  5E4W C;  3I4L A;  2KCT A;  1N8R C;  2QW7 A;  1UEB A;  2NN6 I;  5IP7 H;  2OCE A;  1C9O A;  3MWY W;  1ZKO A;  1LLR D;  4IAL A;  3OPO A;  1X56 A;  1LO5 D;  5DNF A;  1ZXT A;  3A55 A;  1K3B C;  2KCC A;  3C2P A;  1TU2 B;  3RMH A;  4OWW B;  4B9X A;  2C5C A;  2VS1 A;  4DK1 A;  2IPK D;  1JOR A;  4TRD A;  4QIW E;  1EEF D;  3SDZ A;  3DMU A;  1O7L A;  3ND8 A;  3BDL A;  1PZJ D;  2B2U C;  1SYG A;  1Y1V B;  1G2S A;  1I50 H;  3SXH A;  3RN5 A;  1ILQ A;  3F2C A;  4PNY A;  4A3B B;  5T1I A;  4P73 A;  4DN4 M;  1EYG A;  2PNH A;  3TRE A;  3RD4 A;  1J5E L;  2R7D A;  5FLM H;  3BZK A;  4RH6 A;  3HOW H;  2HIX A; 
#chains in the Genus database with same CATH homology
 2BE5 D;  3I90 A;  3NE5 B;  2O5J C;  1KLU D;  1NCV A;  1F9S A;  2L4N A;  2K03 A;  3GV6 A;  1BCP D;  2BA1 A;  2KA7 A;  4UAI A;  2N55 A;  2KEC A;  2CHB D;  3C3L A;  1ENF A;  2PO4 A;  3FMC A;  4BS9 A;  3AU7 A;  3MAQ A;  4DGZ A;  2R6G A;  2BA0 A;  4V19 0;  1HQM C;  1Q90 A;  2BDO A;  1CA5 A;  2LFN A;  5IGG A;  4F7X A;  1SYC A;  1BCP C;  1WTO A;  1K83 B;  5E1F A;  1TWH B;  4A3K B;  4U67 3;  4HSP A;  4N9P A;  1ET6 A;  1WTV A;  4K5V A;  5KYI A;  1GXD C;  2F0S A;  1SNP A;  2K5W A;  1PZI D;  4QUF A;  1LV9 A;  2WAC A;  1KLG D;  3T53 B;  2E2J B;  1CM9 A;  2B2V C;  1SNQ A;  3TZD A;  1IW7 C;  1A15 A;  1SE2 A;  3GTQ B;  3OWE B;  4MHE A;  5KIX A;  4K8I A;  3S2D B;  4TQU S;  2F0N A;  1G91 A;  5KEE A;  3MXU A;  3A8K E;  3S16 B;  1GJX A;  3K5O A;  4WFN 3;  5JPM C;  5C0X I;  1XXG A;  4C56 C;  4XTC S;  3H3V C;  1V1P B;  2JA5 B;  4OIK A;  3BVG A;  4KN4 C;  3E6Z X;  1JQY D;  3KK7 A;  3X3M A;  1B2T A;  2WB1 B;  2J0T D;  4B08 A;  5FOB B;  3BDO A;  1QG7 A;  3E5S A;  1HFN A;  3KLS X;  2L5T A;  2A68 D;  3R2I A;  4BA2 I;  1HQR D;  5CYU A;  4HCE A;  5CV9 A;  5C5L A;  3CU7 A;  5CV5 A;  2B2Y C;  4KMU C;  3NPP A;  1I6V C;  4OO1 I;  1SNC A;  1Z6H A;  2H4O A;  4FF4 A;  2MUY A;  2NWG A;  4RGT A;  1L0Y B;  3A54 A;  3GTG B;  3BZD B;  2EYP A;  3ZYY X;  3QJY A;  5C3W A;  4KKT A;  1HCZ A;  3RZO B;  4ME5 A;  5C44 B;  3ITP A;  3K57 A;  5EPJ A;  1EIH A;  2A68 C;  1CZW A;  3HS0 C;  2EZV A;  1XX8 A;  4KK7 A;  5DAU A;  1EY4 A;  5IOD A;  5JVH 3;  4C1N I;  2FMC A;  2CVR A;  2RDG A;  3J7A F;  1QJO A;  2QDB A;  4RGM A;  1AFP A;  5NUC A;  4BA1 I;  5FLX E;  3M3Y B;  1STH A;  2JSO A;  2XSC A;  4LK1 C;  2LMC B;  3R8B A;  4ABN A;  4KTA A;  4ULL A;  4K6L A;  2CW0 D;  1EWC A;  1FNU A;  1CHQ D;  3SE0 A;  4H0L C;  2AWO A;  5KGU A;  5KNB A;  4CJ1 B;  1CTM A;  1M4V A;  5M5W B;  2DN8 A;  2XN9 C;  1DXM A;  2B8F A;  4A3F B;  3VYR A;  4RA8 A;  3KLR A;  2JEB I;  3K6O A;  1SXT A;  2EYJ A;  3H91 A;  1DON A;  2JEA I;  1K8O A;  2G9H D;  3CQZ B;  4MIU A;  3MZ5 A;  3K5M A;  1J9O A;  4EVO A;  2D5D A;  2K5D A;  2TMP A;  3DEO A;  1B44 D;  1SYF A;  1TII D;  3HOZ B;  4DXG A;  1EOT A;  1GUG A;  2F4I A;  4DF7 A;  4RWS C;  3K7A B;  1CFM A;  2O5I C;  1EYD A;  4XIG S;  4BY1 B;  2PPB C;  1WCM B;  3QB3 A;  2PQE A;  4QIW B;  3SK8 A;  4K6D A;  1TS2 A;  1S5E D;  4KHZ A;  2HQE A;  4KD3 A;  5IGB A;  3PMF A;  1OO9 B;  3M4O B;  3GP7 A;  2JP1 A;  2FMM A;  4XXE A;  2FJ2 A;  3TP8 A;  2F0M A;  2ZXR A;  2IX3 A;  2OEO A;  3VYU A;  1PTO C;  2ICI A;  5ELC A;  4RHR A;  5KRU A;  1STG A;  5KYL A;  2EYL A;  3OIP A;  2LY7 A;  1KNA A;  3K5L A;  1FD7 D;  1F9Q A;  2DNE A;  2IWH A;  5J1Z A;  3HOX B;  3HGB A;  1JOO A;  3BDC A;  1LAB A;  3PUV A;  2F0E A;  1LT5 D;  1WTP A;  1ENA A;  1RCV D;  2O4X A;  5A2Q E;  1Q12 A;  2EYH A;  1T5E A;  2WKD A;  2NVX B;  2EJF C;  2L55 A;  5IOC A;  1PTO D;  1LTI D;  1OXS C;  4EQP A;  4RKB A;  1HUN A;  5TSS A;  2RSN A;  3TP7 A;  3L3O C;  2F03 A;  4J8Q A;  2NN6 H;  4K14 A;  2WII B;  2F0K A;  3JAM E;  3SK4 A;  2YYZ A;  1EY7 A;  4A3D B;  4M1U B;  4NP5 A;  3EQL C;  2XNA C;  2WAQ B;  4F87 A;  1HTL D;  5C3X A;  5HGT A;  2HCI A;  2KUM A;  2K6A A;  5I2X A;  3T56 B;  1QB5 D;  4K2L A;  4QUC A;  1Z47 A;  3I4N B;  4K2K A;  1T5X D;  2D2C C;  1B4O A;  1FGB D;  2FIN B;  1IKL A;  1TVX A;  4KHV A;  5CV4 A;  3S15 B;  1KNE A;  2PW5 A;  1A2T A;  1MSH A;  5C5M A;  4A3G B;  4PQX A;  1A6X A;  3SHL A;  5M3F B;  4QF4 A;  2R93 B;  2H1E A;  1LTT D;  4C2M B;  1II3 A;  1X3P A;  1F9P A;  3GTK B;  4R8N A;  5IGC A;  4X3T A;  2IJ0 A;  2KJX A;  4NW2 A;  3TN2 A;  1QCB D;  1RF2 D;  3HEJ A;  1TS5 A;  1LTG D;  2A69 D;  4A3J B;  3S1M B;  5EBC A;  2K33 A;  3D6C A;  1LTS D;  1ZEQ X;  3VYT A;  1X3Q A;  2XRS D;  1B9M A;  3FDT A;  3U9O A;  2R61 A;  5A35 A;  2QIL A;  1JIC A;  1I6H B;  3OIQ A;  4IN3 A;  2A6E D;  5IIF A;  1LTA D;  3SVM A;  3DHQ A;  1UAP A;  1JWM D;  2EVB A;  1EQT A;  1U4M A;  2F0I A;  5C3E B;  1F2L A;  2F0L A;  2WV6 D;  1DZ1 A;  2A69 C;  2J4X A;  3CHB D;  4U68 A;  3OHX C;  3MXN A;  2ZXO A;  4DNT B;  2J7Z A;  4H44 C;  3HG9 A;  1BQQ T;  4EQO A;  4DA2 A;  1PRT C;  1BF4 A;  5DEH A;  1X32 A;  2Z8L A;  1D1K A;  4DAY A;  4G4K A;  3KLS A;  2JYO A;  1AZQ A;  4C3I B;  3M7N A;  3K58 A;  1H9K A;  1TT2 A;  3W2D A;  4J1M A;  2A6E C;  4R8I A;  3TZU A;  2I07 B;  2F0O A;  4OGQ C;  4NKL A;  4NMZ A;  3SK5 A;  1KAB A;  2GA4 B;  2F0Q A;  3C46 A;  4I65 A;  4IUU A;  4KY5 A;  1DOL A;  3R2T A;  1GHJ A;  1DOK A;  3LNN A;  1C48 A;  3H0G B;  1EU4 A;  1H9R A;  2A6H C;  1HHV A;  4PV1 C;  5EKI A;  2LS0 1;  1PRT D;  1E0B A;  2HDL A;  3QOL A;  2NVQ B;  1PRT B;  1B53 A;  5JJZ A;  3Q23 A;  1JCK B;  5IT9 L;  2DY8 A;  1IYV A;  3M4Y A;  1STA A;  3BYT B;  3G6J B;  2QEJ C;  4CJ0 B;  1RKN A;  1U4P A;  1D5X C;  1TQO A;  3O13 A;  5JVG 3;  5E3F A;  1NR4 A;  2OT2 A;  5FLX L;  2PZU A;  2AQ3 B;  3V2T A;  1EY8 A;  1PFN A;  1AEX A;  1QNU A;  1DJR D;  3AB9 A;  3L7Z C;  5BN5 A;  2PMZ B;  2F0U A;  1BUV T;  1R4P B;  2EOT A;  3DEP A;  3C1F A;  1F9R A;  1I3Q B;  1D6E C;  1GUT A;  2F0J A;  3BS1 A;  3WOE A;  3H09 A;  1SEB D;  1JE4 A;  2VUM B;  3IKJ A;  3UI2 A;  3EFX D;  4ID6 A;  1KTK A;  1V43 A;  3HRZ C;  3W3A A;  2VNU D;  1EY6 A;  2EE1 A;  1ZYR C;  3GTP B;  3EJI A;  2E76 C;  4IUT A;  1STB A;  1SYE A;  2K5Q A;  4KKU A;  3MTS A;  1GUS A;  1PDQ A;  1WTX A;  3KUP A;  3Q24 A;  2N88 A;  4KI0 A;  3VR5 A;  3QOJ A;  2JE6 I;  3D8G A;  4CGY B;  1KDB A;  5D14 A;  3MXG A;  1A3U A;  3IFT A;  3N52 A;  1KDA A;  3FRP B;  4HMJ A;  3LX0 A;  5ELD A;  1WTQ A;  2F0W A;  1JR0 D;  2FHT A;  2B2U A;  4IUV A;  5E4X A;  2E2H B;  4G7Z C;  3T4A C;  4IFD I;  1BCP F;  1G29 1;  1H9S A;  4K5X A;  1RTN A;  2K05 A;  1SNM A;  2KHS A;  1W6K A;  3VA7 A;  1IYU A;  1Z7T A;  1MGS A;  1SAP A;  2PZT A;  2F0F A;  1SBB B;  1EY5 A;  2D9U A;  3NP8 A;  2NBF A;  5J39 A;  5I9O A;  2HDM A;  3A8I E;  4KJN A;  4CKB A;  4QB4 A;  1B1Z A;  1PRT F;  1QOH A;  1A3V A;  4FF1 A;  1KAA A;  5CMD A;  2KCN A;  1ENC A;  1HXY D;  2EXZ A;  4Q0F A;  1A3T A;  2M00 A;  3N6R A;  5JAV A;  4RHS A;  1H9M A;  1JOQ A;  4XYO A;  1RTO A;  3V05 A;  1ET9 A;  4ILW A;  2NN6 G;  4BY7 B;  2L9H A;  4ZQ3 A;  3GO5 A;  3BYY B;  5BN3 A;  2OXP A;  4FXG C;  1ONL A;  1SE3 A;  3S1Q B;  4FVM A;  1JB3 A;  1CZG A;  3FPU B;  4R9W A;  3OW7 A;  2SOB A;  4HED A;  3H6M A;  4OO1 H;  2RSO A;  3K0Y A;  1CT1 D;  2AUK A;  2C9O A;  5CV6 A;  2K1B A;  2R92 B;  1EIG A;  5JEA J;  1BDO A;  1RHP A;  1VMC A;  5IGE A;  3GTO B;  1W6J A;  1LT4 D;  2JA6 B;  5IT9 E;  4A93 B;  1EL0 A;  1WTR A;  2SNS A;  1IKM A;  4RGO S;  1LT6 D;  1VMP A;  1DD2 A;  1F2Z A;  2SDF A;  3J81 L;  2NB0 A;  1WTW A;  1OXV A;  1HPC A;  1JOK A;  1XWE A;  3GD7 A;  4GZY C;  5CV8 A;  1Q1E A;  3D4R A;  5ELB A;  5LHY 1;  1HRJ A;  1TKW B;  5C0X H;  2RBM A;  1SJE D;  4IQZ A;  2EYM A;  1EZ6 A;  2X6G A;  1S5B D;  5LL6 X;  1XTC D;  1RD9 D;  5JOB A;  5FKA C;  2DY7 A;  5M3M B;  5I9P A;  1BOS A;  3FVQ A;  3J7Y W;  4HN7 A;  3PIO 3;  2X6L A;  3HZX A;  3S2H B;  4CKC A;  1EY0 A;  4HSV A;  1CHP D;  5I6Y A;  2F0V A;  4RCN A;  1SDF A;  3M7G A;  3GTM B;  1WD1 A;  1Q8I A;  1KDC A;  4X3U A;  3SK6 A;  3E0J A;  4WOR A;  1LT3 D;  3CRK C;  2F1M A;  3OOC A;  5ELF A;  2NYZ D;  2TSS A;  4IUN A;  3DUZ A;  2XIW A;  5I4D A;  2L1B A;  4ZKB B;  2NVT B;  1MBY A;  5KND A;  3QG1 A;  2NTS A;  5ISR A;  3FKI B;  1HTP A;  5C0X G;  3K59 A;  5D65 A;  2A74 C;  4Z9C B;  1HA5 A;  1RJT A;  2ZT9 C;  5FO8 B;  2RQX A;  2O2L D;  1HUM A;  2F3V A;  1I4G A;  4QMG A;  1B9N A;  2Q8R E;  3X3N A;  3S9W A;  4AYB B;  1WVL A;  2VB2 X;  4BBR B;  3DWQ A;  3IAY A;  1D5M C;  2AQ1 B;  1EEI D;  4XYQ A;  4IFD J;  4XQJ A;  1QNK A;  2B2V A;  1GUW A;  2B2T A;  1VF5 C;  3PUY A;  2MP1 A;  2BE5 C;  2NVY B;  1BXT A;  1JWS D;  3Q0A A;  4L8J A;  2ID0 A;  1G2T A;  4X3K A;  3K5N A;  1HFG A;  3MVV A;  3BG3 A;  1FYC A;  1UNS A;  1ICW A;  2MJ8 A;  5EQ0 A;  3TDQ A;  4C1N K;  1V8Q A;  1IW7 D;  3VR6 A;  3DM1 A;  1PTO F;  1EYA A;  3U9S A;  3SR1 A;  2KQ3 A;  2F0H A;  3EA6 A;  2D62 A;  4CHT B;  5K36 G;  1I4X A;  2RKS A;  1YNN C;  4I7Z C;  5EGT A;  1OXU A;  1OXX K;  2B2W C;  3TP6 A;  4PMB A;  2K04 A;  3I72 A;  3WDN A;  5EBD A;  1NSN S;  2KEE A;  3MEH A;  3VYS A;  3J7A V;  2WP8 J;  3D4D A;  5CGK A;  1ESF A;  1PYW D;  3MXP A;  2CW0 C;  5T1G A;  4M8A A;  4FXD A;  3P1H A;  2RDH A;  2AUJ D;  5M9O A;  1Y69 U;  1SYB A;  1YNN D;  5C4X B;  1S5F D;  1CK1 A;  1SSO A;  1CQF A;  1NUC A;  2Z4H A;  1IL8 A;  4X3S A;  5F2D A;  5JEA H;  3R93 A;  3VR4 A;  1SND A;  1R4Q B;  2FFK B;  1B50 A;  5CC4 A;  1TR5 A;  4HCS A;  2XRQ D;  5C6A A;  3NHH A;  4BWG B;  1JC7 A;  1BCP B;  1E2Z A;  4N9T A;  4LAA A;  1WD0 A;  3NSW A;  3R3O A;  3PUW A;  3RUZ A;  1H9S B;  2K7V A;  2L0C A;  3TME A;  3PO2 B;  3LWU A;  1TWG B;  4DXF A;  5COR A;  2M9V A;  1STE A;  3NTI A;  3NXW A;  4CBV A;  2L12 A;  1E2V A;  4FP5 D;  3DWA A;  5D3D A;  2B39 A;  1ML0 D;  4HTH A;  4MN3 A;  3PIP 3;  2OF1 A;  2F0D A;  4FYD A;  1DOM A;  3C1E A;  4ZUI A;  1MSG A;  3HOU B;  1HA6 A;  1SYD A;  1GHK A;  4C3J G;  1B3A A;  1ROD A;  3ONA B;  2IX1 A;  2IW3 A;  3LWE A;  4ZAI A;  1BR9 A;  2RDF A;  3D3R A;  5JEA G;  1Q3L A;  4DAV A;  4OL7 A;  2BOS A;  5CBE E;  4PMW A;  1R9T B;  2F0P A;  5KNC A;  2Q8I B;  2RVL A;  2XWJ B;  2WIN B;  4FXK C;  2K28 A;  5FO9 B;  2VB3 X;  1PZK D;  1L0X B;  2B2Y A;  5DM7 3;  1NR2 A;  1PLF A;  4FNF A;  3S1N B;  3MFY A;  1I50 B;  4KD4 A;  4K8J A;  2XWB B;  2E2D C;  1V1O A;  1TS3 A;  2NTT A;  3MFG A;  1A2U A;  5C4Z A;  1PFM A;  4A3E B;  3G7L A;  2QKI C;  3ERQ A;  1TWA B;  3H94 A;  4IFD H;  2NUC A;  3F2U A;  3CKI B;  3I70 A;  4HAE A;  1AZP A;  4RFB A;  2EJG C;  3MC0 B;  1TWF B;  1QWY A;  1Y8P B;  2ICE C;  4G7O C;  4TKO B;  2HUG A;  1Y8O B;  2X69 A;  4OIJ A;  4C3I G;  1G6Z A;  4TSS A;  3BVZ A;  4BBS B;  2MPM A;  1F2Y A;  1UUP A;  2EYO A;  3DXJ C;  4YIJ A;  2EY2 A;  2RA4 A;  2LKV A;  3GTL B;  3WOF A;  1F77 A;  2SEB D;  1SFO B;  4F8M A;  3D4W A;  1VCI A;  2A73 B;  5M5X B;  5JPN C;  1TY2 A;  3I91 A;  2EPB A;  3J81 E;  4IFD G;  1I4P A;  4H7B A;  1AP0 A;  1EZ8 A;  2K01 A;  1OXT A;  2MGS A;  3HOW B;  3NBH A;  1U4L A;  3NWS A;  4O1N A;  5ELE A;  1GUO A;  2PYK A;  1TWC B;  5I6W A;  5CR3 A;  3I3C A;  3OWF A;  1V1P A;  1EY9 A;  4JBW A;  1GUN A;  3P7J A;  1LAC A;  3CRL C;  4IUQ A;  1PTO B;  2F0T A;  2A6H D;  2L11 A;  4IZ8 A;  2EY5 A;  2EDG A;  3VR3 A;  1O7Z A;  2PCF B;  4CJ2 C;  1TS4 A;  4ZRZ A;  1PMR A;  5BN4 A;  4A3I B;  3M85 A;  5EKK A;  1STY A;  4DAP A;  1QIL A;  2CQA A;  3A7L A;  5K36 H;  1O7Y A;  3SEB A;  2K32 A;  2XVS A;  4ZKC B;  3P20 A;  2BDN A;  4G7H C;  3QO2 A;  3AMU A;  1S5D D;  3A56 A;  4CKE A;  3NUC A;  4KY7 A;  5I2Y A;  5IGD A;  4WJW A;  1FNW A;  1H9J A;  1ESR A;  2B63 B;  2KED A;  4UDU C;  2I46 A;  3KF8 A;  5IGF A;  3KBG A;  4B9W A;  1F2M A;  2SNM A;  3J80 L;  4XT1 B;  1FNV A;  2JA7 B;  1I4Q A;  2PZW A;  1AN8 A;  2B8G A;  3RZD B;  1BBX C;  2EYF A;  4RGN A;  2V4D A;  4KY6 A;  5C4H A;  3T16 A;  2F0G A;  1RDP D;  3S1R B;  3V96 A;  3HP3 A;  3NTK A;  3VA5 A;  1MD2 D;  1Y8N B;  3HKZ B;  1D2B A;  3TSS A;  5EKL A;  1CA6 A;  1BNZ A;  2EY1 A;  3S14 B;  2F3W A;  2EY6 A;  2IT1 A;  3HOV B;  1Y1W B;  3QWN A;  4IUP A;  4L6T B;  4HMI A;  2G9D A;  2KVM A;  2R3Z A;  4K5W A;  4P2C B;  2JA8 B;  1J8I A;  1STN A;  4H13 C;  3KBX A;  4KV6 A;  4ZLT F;  4DU9 A;  3TBI B;  5FK9 C;  1C4Q A;  4ZUJ A;  3URY A;  2YU9 B;  3DWP A;  4EGV A;  2Z4I A;  3MA2 B;  1EYC A;  3NTH A;  3GV3 A;  5D3I B;  1E2W A;  1SJH D;  1I4R A;  1TY0 A;  1I4H A;  3OMG A;  1C8C A;  2AWN A;  1Q1B A;  3S17 B;  5K5P A;  1DM0 B;  1CQV A;  4FF3 A;  4DNR B;  5J22 A;  2B2W A;  1G8Z D;  5A2Q L;  1D5Z C;  2E2I B;  2PW7 A;  3JAM L;  2HCC A;  1EU3 A;  3RLF A;  1UEA B;  1VF7 A;  3T51 B;  3NQI A;  2Z1C A;  4OO1 G;  3EVQ A;  4NDX A;  4KN7 C;  3P75 A;  3I4M B;  4L63 B;  5C0X J;  2KOL A;  3D6W A;  3QIA A;  5CV7 A;  1S5C D;  4ODG A;  1LTB D;  5C4J B;  4Q5V A;  1IHZ A;  4FF2 A;  2VXW A;  3PUZ A;  3T13 A;  1QE6 A;  4KKS A;  5EJW A;  2M2L A;  5AFW A;  1DCZ A;  4XT3 B;  5G3L D;  1JWU D;  5M5Y B;  1AW7 A;  1EQV A;  1VDZ A;  1O80 A;  3BVM A;  4JK1 C;  2E74 C;  2ZXP A;  3OMC A;  1PTO H;  1EFI D;  3I8Z A;  4QCL A;  1PXU A;  3D31 A;  3NK9 A;  4ZK9 B;  2EJM A;  4DK0 A;  3ERO A;  4XDX A;  2ENB A;  3IL8 A;  3NBI A;  4V0B A;  3PO3 B;  1D1I A;  4WRD A;  3FPP A;  2R7Z B;  4LMQ D;  1K8M A;  4RKL A;  2PNR C;  4Y7N B;  1ILP A;  1CI3 M;  2AQ2 B;  5FO7 B;  1U9R A;  1SMY D;  3VR2 A;  2Q8T A;  3MHB A;  1PFB A;  2IX0 A;  1GOZ A;  3L9A X;  4XQN A;  4LJZ C;  1M8A A;  4S3S A;  3HOY B;  4G57 A;  4C3H B;  2A5H A;  3ND9 A;  3Q22 A;  1U4R A;  3Q6S A;  3GTJ B;  1MI2 A;  1NAP A;  3PV0 A;  4C3J B;  3A7A B;  4XQQ A;  4HR7 B;  1YNJ C;  4O42 A;  5EPK A;  1BO0 A;  4OHJ A;  1SE4 A;  2WKC A;  1LTR D;  2DNC A;  2E75 C;  1FR3 A;  4IUR A;  4ZYS A;  1EWH A;  1DYQ A;  3OSO A;  1XYI A;  1SMY C;  3NWT A;  2Y0S B;  4EQN A;  3PUX A;  3TP5 A;  4F88 A;  3J80 E;  4DFA A;  4E6I A;  5HUR A;  5COY A;  2BCO A;  2QCP X;  3GQB A;  1YNJ D;  3IFD A;  4FO2 A;  1SNO A;  3A8J E;  2MHV A;  1O78 A;  1ZYR D;  4RCO A;  3NQT A;  4C3H G;  4J6H A;  4A3M B;  2QF7 A;  2B2T C;  4PMC A;  5LL6 S;  2JXM B;  4RAU C;  3FEW X;  4KJO A;  5CBA E;  3I73 A;  5EPL A;  5G3L F;  5DM6 3;  1S4Z A;  2NZ1 D;  2IL8 A;  5E4W C;  3I4L A;  2NN6 I;  3MWY W;  1ZKO A;  1LLR D;  4IAL A;  3OPO A;  1LO5 D;  5DNF A;  1ZXT A;  3A55 A;  2KCC A;  3C2P A;  1TU2 B;  3RMH A;  4B9X A;  2C5C A;  4DK1 A;  2IPK D;  1JOR A;  4TRD A;  1EEF D;  3SDZ A;  3DMU A;  1O7L A;  3ND8 A;  3BDL A;  1PZJ D;  2B2U C;  1SYG A;  1Y1V B;  1G2S A;  3SXH A;  1ILQ A;  4PNY A;  4A3B B;  5T1I A;  4DN4 M;  3RD4 A;  4RH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...