4L63B

Apo form of ab5 holotoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECXA
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 24
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l63B00
1PZID 1LTSD 1UUPA 1JR0D 1RD9D 1PTOC 1V1OA 4BWGB 3OWEB 4UDUC 2NTSA 1PZJD 1LT5D 3BYTB 1TS4A 1FNVA 1EWCA 1LT6D 1I4GA 1LTRD 2AQ3B 1QILA 1I4QA 1JWUD 5FKAC 1ESFA 2AQ1B 2QILA 1JQYD 2R61A 1D5XC 1JCKB 3BZDB 3R2IA 1DYQA 1PTOH 4TSSA 4RCOA 3W2DA 2WV6D 1FGBD 3DWAA 1M4VA 1CHPD 1V1PB 2IJ0A 4RGOS 4Z9CB 1ENFA 1JWSD 2XRSD 2NTTA 1FD7D 1B1ZA 1UNSA 1I4PA 3BVGA 1BCPB 1CHQD 1BCPF 1LT3D 1HTLD 3KLSX 2XNAC 1FNWA 1TY2A 5D3IB 2O2LD 1LTBD 5ELCA 1HA5A 1SE4A 1SXTA 1BCPD 3CHBD 4ZYSA 3MC0B 1G8ZD 1D5ZC 1PYWD 3BVZA 1BXTA 5TSSA 3O13A 1EU4A 1JWMD 4RFBA 1GOZA 4RGNA 1V1PA 1CQVA 1T5XD 1LO5D 1PRTB 1TY0A 1B44D 4DXFA 1PRTF 1S5BD 2CHBD 1AW7A 2ICIA 1S5CD 2RDGA 4L6TB 3R2TA 4O1NA 1KLUD 1PRTD 1RF2D 1KTKA 1LT4D 4RGTA 1MD2D 3BVMA 5ELDA 2SEBD 1PTOB 5I4DA 1SBBB 4L63B 1PTOF 1EU3A 1I4RA 1TS2A 1I4HA 1RDPD 1I4XA 3MFGA 1PTOD 3TSSA 2IPKD 1XXGA 3SEBA 3GP7A 5D3DA 1FNUA 1BCPC 2AQ2B 1SJHD 1STEA 1KLGD 5FK9C 1L0XB 3BYYB 2Z8LA 1LTID 3R8BA 5ELEA 1LTTD 2J4XA 1TS3A 1EEFD 4RGMA 2QEJC 1S5FD 1LTGD 4RHSA 1EEID 1LTAD 4C56C 1L0YB 2G9HD 4RHRA 1RCVD 4RH6A 1TS5A 1HXYD 1S5ED 1AN8A 1ET9A 1EFID 1ET6A 1CT1D 4DXGA 1DJRD 1S5DD 1SE3A 3V05A 5ELFA 1PZKD 1D6EC 4K6LA 1PRTC 2XRQD 1D5MC 3DWPA 2TSSA 3EA6A 2XN9C 3URYA 3DWQA 1SJED 5ELBA 2RDHA 1F77A 1LLRD 1CK1A 1SE2A 1XTCD 1HQRD 4OHJA 1SEBD 3EFXD
chains in the Genus database with same CATH superfamily
4JW0A 2EPBA 1CKNB 4K5VA 1Q90A 5EQ0A 1R4QB 3KJPA 3E0EA 4UP8A 5C3WA 5CC4A 4R4TA 2DNCA 4KHPL 1Q1BA 4FP5D 1UE5A 2XTIA 1HR0Q 2BCOA 2F0KA 3I7FA 2L11A 3S16B 1IYVA 1MJCA 1HUMA 2EJFC 2BDOA 2M9VA 3TMEA 5M5YH 4YHHL 1F2LA 1KIXA 3G6EA 4BY7H 2O4XA 2B63B 1XNQQ 1JWSD 5KGUA 4A93H 2NTTA 4DKAC 3J81E 2L0CA 1VQ8A 3BJUA 1ZEQX 1CZWA 4DAYA 2NVQH 2SNMA 2F52A 1OXTA 1FNWA 3QB3A 1MBYA 1SR3A 1ZKOA 2IL8A 5LMNQ 3EJIA 4DUYL 2EY2A 5F2DA 5KNDA 4LUZA 3CCMA 1Y1VG 1TKWB 3T53B 4C2MB 1TR5A 5C5LA 1W6JA 3S14B 4BBRB 1PRTF 1NBWA 1Q46A 1H9MA 3J81i 4YY3Q 2GA4B 4JI2Q 2RDGA 3KUPA 3A5ZB 4HTHA 2EIFA 2B2VA 2GN5A 1HFNA 4XT1B 3ITPA 4K0KL 2HT1A 1VQ4A 3A7LA 3VR3A 4X64Q 4NP5A 1AZQA 3S1MB 3P1HA 3I72A 2PNHA 3NXWA 2IPKD 2V1CC 3NWSA 3SXHA 2CH4A 3A55A 3SEBA 2HHHL 4NMZA 3BZKA 3T1HQ 2AQ2B 4DR7Q 3R8BA 5C4XG 2PMZB 3RZDH 1DXMA 2H1EA 3Q8DA 3QO2A 5ELEA 4DR4Q 2F4VL 2HIVA 1GHKA 2A6HD 1BKBA 3V96A 1I94Q 3G71A 3GTQB 3HOVB 1XMQQ 1BQQT 4BY1G 4A3KB 1YJNA 1R9TH 4KY5A 5FLXL 2LY7A 1QZGA 3KF8B 4JI6Q 1SJED 2YTXA 4Y7NH 3PIPA 3W3AA 3D4RA 4NB3A 3CXCA 3K8AA 2EYMA 1UE6A 3A74A 1PLFA 5J22A 4A3LH 3I56A 3MXUA 1N32Q 1EIGA 1NUCA 1K8AC 1CZGA 4GKJL 1LTRD 1IL2A 3E5SA 5FKAC 5L37A 3K7AH 2UUBL 2Y0SE 1OXVA 2KCCA 1KXLA 1X9NA 1JT8A 1OXUA 4MIUA 3ZYYX 2MFIA 1EQVA 1CUKA 4X62Q 4LF4L 1LV9A 1A62A 1V1PB 4NXMQ 1C8CA 4IUQA 2AUKA 2A1AA 5FJ8G 4QGUA 2A74C 3WWVA 2E2JH 1E0BA 3KK7A 3KOJA 4HEDA 5BN5A 1BF4A 4WJ4A 1CKOA 4IPCA 1JWMD 3E9IA 2Y0SB 3HOXH 3K5OA 1T5XD 3PO3H 1L2FA 2HCIA 2K33A 1B8AA 3UE1A 4OX9L 2JSOA 1WTWA 4A3EB 3EN2A 1TWHB 2D9UA 4RGTA 3M7NA 1S72A 2CWAA 3GO5A 1H9JA 4POGA 1AH9A 3S2HB 2I0QA 4KMUC 5JJIA 4ZKBB 5T1GA 1RDPD 1CA5A 2SDFA 1BBWA 1A6XA 1QUQA 1W6KA 1TT2A 1LACA 4JC0A 5FOBB 1L0XB 1HNXQ 3CCVA 2R7ZB 2VUMH 3GTGH 1EOTA 4OO1I 3HOVG 1SROA 2O5JC 4IJHA 3TQYA 1EEID 2KA7A 3EROA 5FO9B 3J7AV 1RCVD 5KNBA 1LYLA 4DAVA 3UE0A 1DJRD 3KLRA 5E4WC 5M5YB 3I4MH 1SNDA 3FEWX 3FPPA 1YHQA 4C3JH 3NP8A 1CKMA 4QUCA 4U68A 3GD7A 5ELBA 4P74A 4A93B 4O1NA 5HGTA 4QF4A 5G3LF 3J81j 4HJ8A 4JVZA 4ZRZA 3AMUA 1KRTA 3E3XA 3DM1A 1LT6D 2EYPA 4NXNL 2A73B 2IX1A 1JJGA 3OTOQ 2EVBA 1PA6A 3VA7A 1H9SA 4X3SA 2A6ED 1HNZL 1Q7YC 3Q6SA 4K8IA 3CPFA 5JPMC 3DWAA 4HMIA 4R8IA 2NVXB 4P2CB 2KEEA 3NSWA 4CKBA 4DGZA 4HAEA 3J7YW 4OONA 1H9KA 1G2SA 4FF2A 1CHQD 2CVRA 3H15A 2B2UA 2B29A 2CW0C 5DNFA 2KENA 1YNNC 1SXTA 2N49A 3F2BA 1NTGA 2Y0SG 3K5NA 4Q5VA 3NPPA 4FXGC 1NSNS 4RFBA 1WTPA 4ZUIA 4PG3A 5GADC 5KYLA 1FL0A 5CV6A 4J15A 4G4KA 4HIKA 4HJ5A 4IPHA 4A3EG 1SYCA 4IALA 4C1NK 1ZXTA 1TU2B 4X66Q 1B53A 2RVLA 4UAIA 4L5QA 4OL7A 3D3RA 4PV1C 4GOPB 4FVMA 1A2TA 1EZ6A 2UU9Q 4C3HG 3JC66 3AYHB 2Z6BA 5IYDG 3MFGA 1PTOD 2AWNA 3HOYG 4ABNA 5D3DA 4L5RC 4K8JA 2R7ZG 4LF6L 5FK9C 2DGYA 2F0SA 1VQGA 1F2YA 1D2BA 4ZQ3A 1KDBA 1LTAD 4C56C 5EPLA 2E76C 5CR3A 3D4WA 1D1IA 3EBEA 4M8AA 3NUCA 1VQ5A 5KRUA 2VQEL 3MFYA 2PNRC 2LMCB 3CD6A 2QCPX 1X6OA 1YNJC 2MHVA 2VY3A 2UUAL 3PF4A 4DV4Q 4JV5Q 3BDOA 3DWQA 1B70B 1IBML 2C35B 3U50C 5IT9E 1B9MA 1A3TA 1WOCA 4TRDA 4A3FB 4DN4M 5EKIA 1Y1VH 3K0YA 2AKWB 3HKSA 1OXXK 3A8JE 1KNAA 4AIMA 4AQYL 3FPUB 4I7AA 4QJFA 3PIOA 2ATWA 2KUMA 3HOXB 2Z6KA 3PO2B 1BVSA 1NY4A 1KRSA 3CRLC 5BN3A 2ID0A 1IBKQ 3STBD 3M3YH 3KFUA 3Q24A 3W5OA 1PFNA 1FJGQ 3HS0C 1CI3M 2IHFA 2PZWA 2B2WA 1HNWL 5EKKA 1LT3D 3H0GG 1GHJA 5JJKA 3K6OA 5C4XH 2IY5B 1YIJA 4MHEA 2N3SA 1SE8A 1PVOA 1HHVA 1VF7A 3I4NB 3BVZA 1QJOA 5TSSA 5HGQA 2QA4A 3CU7A 3GTGB 1EYDA 3AB9A 1EY9A 3PIP3 4DR3L 4BY1H 5D14A 3BU2A 2B39A 4GLAC 1B44D 4OIJA 2CHBD 3RLFA 1TWAH 2J0TD 2WAQG 2JA8B 4CJ2C 4LFCQ 4H02A 1RF2D 2J7ZA 4A4IA 2NVYH 4A3BG 2JP1A 5IIFA 3RUZA 4OELB 1I4RA 1E1OA 2B2TC 2LFNA 2EYOA 4KHPQ 2CQAA 3IAYA 2CQOA 3S16H 1CFMA 1BCPC 2R7FA 2L12A 2QF7A 1GUOA 3JAML 2WB1G 2KCMA 3TZUA 1K9MC 5IP7G 4LF9L 4PZ7A 4YHHQ 1J6QA 2V4DA 3DXJC 2DNEA 3TRZA 1AE3A 3Q23A 4O0AA 4JYAL 2KJXA 1K8OA 1S5DD 2BDNA 1TIID 4DAMA 3CC2A 1NNXA 5CMDA 1VMPA 5NUCA 2TSSA 3HFZB 3HOUB 3EA6A 1STAA 1V8QA 4UHVA 4MTKA 5ELOA 2RDHA 5FJ8H 1CK1A 5C6AA 4DUYQ 4A3FG 1EY0A 3C1FA 1VQJA 4J6HA 3SR1A 2WIIB 1C0AA 1JR0D 1N34L 3EIVA 4R9WA 4C2MH 3CC7A 4XTCS 2YU9B 3PO2G 3J7ZC 1PV4A 4XQQA 3T51B 5A35A 4KKSA 4K0KQ 4TSSA 1TVXA 2KHSA 2CWPA 4XDXA 4FF3A 4HN7A 1EY8A 5IYBG 2HDMA 1D7QA 3NBHB 3QJYA 2ZJQA 5IP9G 1BCPB 3PMFA 1Y14B 2B2YC 3VR5A 5FLXE 1EWIA 1IHZA 1JOKA 2I5HA 1HA5A 1SE4A 3I4NG 2R7DA 3D0FA 3GTQH 1SDFA 5EPJA 1D5ZC 1ILPA 2PCFB 4M1UB 4Q0FA 1XPOA 1GOZA 2RA4A 2NZHA 1B7YB 1C7YA 4YIJA 1DCZA 3M7GA 3PUXA 3UDGA 4DXFA 2JA8G 1QUQB 4JCVE 4I65A 2JEBI 2ES2A 2Q2TA 1OO9B 3CMEA 3BS1A 3D6CA 4LF7Q 1EOVA 2X6LA 4IFDG 1ONLA 3D4DA 1EIHA 2SEBD 4RA8A 2LXJA 4BBSG 3PCOB 4NPSA 5EPKA 3I70A 4P72A 4DAPA 4OWXB 1I5FA 1ZYRC 5IWAQ 4GKJQ 1XXGA 4F88A 2K1BA 1V1QA 1Y1VB 5I6WA 1J5EL 2UUBQ 1GD7A 3GTJH 2LKVA 1IW7C 4A76A 4B3ML 3H6MA 3KDFB 4K5WA 3RLOA 2KQ3A 2TMPA 4DV6L 2JYOA 4QMGA 2RQXA 3SVMA 4KN4C 3ULPA 4DK0A 2EY5A 3NEMA 4LF4Q 3C1EA 3EQLC 4IURA 1P8LA 3CCSA 3SE0A 1SE3A 2HD3A 5ELFA 1X65A 4UY8C 2VNUD 4LF8L 1VQLA 4X65L 3HOUG 2N8NA 3G48A 3VYSA 2AUJD 3M3YB 4JI4Q 4CHTB 3WOFA 3PUWA 1V43A 3KF6B 5JJZA 5GAHC 1K73C 4RKLA 4N8X1 5C4XB 1PZJD 3PGZA 1LT5D 3MEFA 5EGTA 4B3TL 3QIAA 1XMOQ 4CDDC 1I4GA 1F9RA 1MKHA 1VQKA 4C3IB 1MI2A 3CP0A 1PHJA 3VR6A 4ZLTF 1XYIA 1WTXA 5LL6X 4OX9Q 4A3EH 1GO3E 4H44C 5J39A 3LWUA 4DUZL 1O7YA 4LFBL 1Z47A 4C3HH 5CV5A 3TZDA 1HPCA 5IYDH 2F0OA 1UNSA 2NVYB 3HOYH 2YTVA 2WKCA 3BVGA 4FXKC 5A2QE 2ZJPA 2R7ZH 4KHZA 1DONA 5GROA 2Z6KC 1LTBD 1DZ1A 1C4QA 2K03A 2L5TA 3OIQA 3U9SA 4I7ZC 4AH6A 4RGNA 4JOIC 1X55A 4DV7L 2PQAB 4EGVA 1VMCA 3NBIA 3MAQA 4R4OA 4MTNA 4K2LA 1JJ2A 1SMYD 4UP7A 1HH2P 1GUTA 1KC8C 1KLUD 5I2YA 3K7UC 1MD2D 3PIO3 4DV1L 1JB7A 4LNQA 2QKIC 3L2PA 1SN8A 4HSPA 2WACA 3D6WA 1AEXA 1ENCA 2CCZA 1I4HA 1JC7A 2PZTA 3TSSA 5IOCA 3H3VI 4XIGS 4NXNQ 2QEXA 5CBAE 2PMZE 2R3ZA 5AJ3L 2K5WA 3CCUA 1STEA 4ZYSA 4UP9A 5IGFA 2WINB 1HNZQ 4RGMA 1S5FD 2N78A 1L1OA 4DNIA 1Q3LA 1AE2A 1CA6A 1PH3A 2RKSA 2NVXH 1EFID 1YVCA 2KECA 1AFPA 1GUNA 2K32A 4KY7A 4Y52H 5CGKA 4PQXA 1K83H 4DR6L 3H0GH 2CH4W 1U4PA 1K8MA 4K2KA 4PMCA 2MPMA 1LLRD 3SK4A 2F3VA 4ME3A 3EFXD 2NN6G 1LTSD 1UUPA 2HUGA 2Q8RE 4S3SA 2HIXA 4DA2A 1EQTA 4KV6A 3A0JA 1A63A 1QNUA 4KI0A 4C3IG 5I6YA 3BYTB 2LXKA 5KNCA 3SDZA 5JEAG 4OXPA 1O7IA 1BBUA 2UXDL 1JWUD 3KLSA 2XIWA 2R92G 2KHJA 4JBMA 2QDBA 2K5HA 4K5XA 4A3JB 1DD2A 1H9RA 3RMHA 2MO0A 1VQBA 2ZTCA 2OEOA 4RCOA 3FKIG 4JI0L 3I3CA 3I4LA 1I50H 4EQ5A 1KQSA 4A3BH 1V9PA 2K6AA 3HG9A 2GVAA 2KCNA 4GLXA 4CKEA 5I2XA 4LF6Q 1BCPF 4N8FA 4G7HC 3J80E 4DV3L 4B3SL 1JE5A 3H09A 3ND9A 1EYAA 2FFKB 4K6DA 3GTLB 5IP7H 2MNAA 1PYWD 4HJ7A 2UXBL 4OWWB 2EYLA 3GTJB 1MHWC 3SK8A 2VQEQ 4A3DG 2UUAQ 1Q1EA 3OHXC 1B2TA 2K04A 2A69C 4ZCKA 3J80i 1J9OA 1PRTD 1IBMQ 4J1MA 1LT4D 3A8KE 4A3FH 2AHOB 3QOLA 3HP3A 4G7OC 4FDBA 4JI5L 2JA6B 4IPDA 3UDFA 3VYTA 4IUNA 4HR7B 3PO2H 2IX3A 4JBKA 1SRUA 4ME5A 2E5LL 1BR9A 2JK8A 4R1JA 3TREA 1SFOH 4HIDA 4IOAA 4FXDA 4JI3L 1LTGD 5T1IA 1UEAB 2ZT9C 3GTKB 1F9SA 4GN3B 1ET9A 2DJGC 2K5VA 5IYBH 1C9OA 2UUCL 1D5MC 1B9NA 5IP9H 1VQCA 4RKBA 1O7LA 3N6RA 4C3HB 2EY1A 4IUTA 4LF5L 1SE2A 4OHJA 3I4NH 2EJGC 3HOYB 5C4HA 3VYUA 1VQ7A 1ML0D 3S1NH 3PUZA 4YCUA 1E3PA 5M5XH 3GV6A 4BWGB 1QVFA 1I6HH 3MZ5A 3M4YA 4DR3Q 1VDZA 2K50A 5EKLA 2MQHA 1E1TA 3GQBA 5IGCA 2PI2A 2JA8H 4A3JG 1ESFA 2PZUA 1JCKB 1JMCA 2WP8J 1CM9A 5FLXc 4IFDH 2EY6A 1Y8NB 4R4CA 4PZ8A 5GAEC 4BBSH 5CV7A 4R4IA 1G91A 2C5CA 1PH5A 2BE5C 3T1YL 1ENFA 4GOPC 1FD7D 3FP9A 3NTKA 4H13C 1XTDA 2F4IA 1HTLD 5EBDA 1DOKA 1A8VA 1BO0A 1X54A 2Q2IA 1EIFA 1G8ZD 1WJJA 3MC0B 4LF9Q 1NCVA 2EYFA 1UE1A 5CV9A 1BBXC 5M9OA 4X3UA 2A8VA 3PUVA 4RMFA 2FXQA 2XWJB 2IT1A 3NK9A 4JYAQ 1EYGA 1BDOA 3NTIA 4QQBX 4GN4B 4H0LC 3HOUH 1K0SA 1U4LA 2WAQE 5DLQE 2F0FA 3CCEA 2CFMA 4OWTB 2XWBB 1F2MA 2KCTA 1PMRA 3BVMA 1K83B 4CBVA 1EY4A 2F0PA 1N34Q 1SBBB 2EYJA 3BZCA 3H0GB 4L63B 2JA6G 3C3LA 5M3FB 4LFAL 5J3BA 4JI2L 2YU9H 1X3PA 3S2DB 1STBA 3TS2A 1PH1A 4LMQD 3RZOB 1OXSC 4DR5L 2NVTB 2WB1E 4ILWA 3F8TA 4X64L 1TS3A 1WCMG 1QE6A 3AFPA 4A3IH 2F3WA 2QEJC 3MXNB 3PQIA 4POFA 2G9DA 1QVCA 3MHBA 1IZ6A 3LGJA 1TS5A 2WAQB 4GKKL 4DXGA 5IGGA 3N52A 2F0JA 3V05A 3K0XA 2F0HA 1I50B 4GNXA 2F3IA 4H7BA 4A3BB 2BA0A 3URYA 4A3MB 1CKNA 2ZXPA 4GN5A 1PH7A 2K5DA 4KJOA 2K01A 4UDUC 2WB1B 2OXPA 4JBJA 5G3LD 1Q8IA 2B2VC 4KLKA 1B50A 4A75A 1SYGA 5E7NA 3SK5A 2ZXOA 1TWGH 4KD4A 4AYBE 2L1BA 5IGDA 1EY6A 1E2WA 2A6HC 2AQ1B 1DM0B 3I91A 1GVPA 5IGBA 1GUWA 1N32L 1YJ9A 2A68D 2C9OA 3MA2B 2K4KA 3VDYA 1VQIA 1EL0A 3QR8A 4CJ1B 1ASYA 1II3A 1Y69U 1UEBA 2RSNA 3KLWA 2JE6I 2DY7A 1EY5A 4CGYB 1YHBA 1J5EQ 4IN3A 2O2LD 4CKCA 2ZM6Q 4AYBB 4DAYB 1BXTA 3J81c 1XWEA 2OQKA 4QIWE 3CMAA 4TQUS 2F0VA 1Y1WG 1SFOB 1VS0A 1CQVA 1CSPA 1NMGA 5DM63 1XPUA 4X3TA 5CORA 1QG7A 1RIPA 1K3RA 4LF8Q 3TEHB 4X65Q 3NELA 2BOSA 3IFDA 1X3GA 1RJTA 4XT3B 2MJ8A 1WTOA 5IY0A 1YNXA 1NAPA 1YEZA 4O2DA 1PFBA 4JBWA 3TP6A 4RG1A 2NN6H 5I4DA 5M3FG 2H4OA 1PH4A 4MN3A 1NMFA 1VCIA 2VXWA 4OO1G 4XYOA 4DPGA 4B3TQ 2IX0A 1E2ZA 4C3IH 2UXCL 3S1NB 1IXRA 1L0WA 5M5XB 5JEAH 1I6HB 4QIWB 1UAPA 4QB4A 1KLGD 3FHWA 5KIXA 2R92H 5C5MA 2PPBC 1MIUA 3LNNA 4LUOA 3FKIH 4DV0L 4RH6A 4LFBQ 1KHIA 2EJMA 3CPWA 4R8NA 3I2ZA 4ODGA 1ET6A 1X3FA 2MUYA 3KF8A 4XXEA 3EVQA 3P75A 2EDGA 4DNRB 4A3MG 4BBSB 3CCQA 2RHQB 3S17H 3VA5A 3P7JA 4R4QA 1PH9A 3T13A 3U4ZA 3K5MA 1IYJB 3OW7A 3DMUA 3IFTA 1N33L 1MJEA 4BXXG 4A3GG 5E3FA 1RD9D 3PUYA 1IKMA 4DV7Q 1HA6A 5C4JH 3C2PA 3C46A 1U4RA 4A3DH 5C3EH 3AU7A 3J80c 4IFDJ 4F7XA 4FO2A 4FF4A 3OOCA 1S40A 4ZKCB 3B6YA 1CHPD 3NQIA 2NBFA 2L15A 2DUDA 1D8LA 5AJ3Q 5K5PA 5M5WB 1O80A 1Q81C 2EOTA 1X56A 5D3IB 5ELCA 4AYBG 4J8QA 1RODA 2N88A 3G4SA 2P5ZX 3AEVA 2KOLA 1NJIC 3F2DA 4IUVA 4QCLA 4A3IB 1YI2A 2Q8TA 5DM73 4ZK9B 1G2TA 1RTNA 2O5IC 2A6EC 5I9PA 1K3BC 4DR6Q 3AQQA 3M4PA 3S24A 3Q0AA 2HHHQ 2VS1A 4YWMA 2ASBA 2F4VQ 1WTVA 4RCNA 1EU3A 3CCJA 1WTRA 1XJVA 2HQLA 1I4XA 1QB5D 3HOWB 4ZUJA 1Z9FA 1FNUA 1SJHD 4A3JH 1Z6HA 3BYYB 4XQJA 3GTPH 3G7LA 5LMUL 1TWGB 1L0YB 1PFMA 4JI0Q 4JI8L 2VL6A 1TWCH 2B2UC 1AN8A 2AMCB 2FINB 2DJFC 2NYZD 1N9WA 5ELNA 4WJWA 5EJWA 1VQDA 1D6EC 4DV2L 1S4ZA 1EFWA 3K5LA 2LSSA 1TWFH 2FMMA 5C0XG 4DV3Q 4B3SQ 4QL5A 4HCEA 3CAMA 3GTLH 2XRSD 3ND8A 1GXDC 2UXBQ 1PH2A 1PTOC 4HIOA 1A2UA 1XNRL 1Y8OB 3GTOH 4IOCA 1HZCA 2F0WA 4HCSA 4KD3A 2WFWA 4GNXC 4JI7L 2MGSA 2R93G 3OMCA 3OPOA 2NZ1D 4GLVB 1X32A 2RSOA 1WD1A 4RAUC 5K36G 3CW2C 4JI5Q 2JA6H 1H9SB 1IBLL 1B3QA 3OWFA 4RGOS 4DR2L 3RNUA 3TP5A 4A3CG 1UWVA 5JVH3 3UDIA 1RHPA 2E5LQ 1EUJA 1ICWA 1JOOA 2AWOA 1A3UA 1C48A 1WCMH 3GTKH 4C1NI 4F87A 4ALPA 4A3IG 2R92B 2WKDA 2LS01 3OYYA 3HOZB 3L7ZC 4DU9A 2VZAA 1U5KA 4TVAB 2Z9HA 3FKIB 1SYDA 1AP0A 3ULLA 4ID6A 2RDFA 4E6IA 4L6TB 4LAAA 4YCVA 1F2ZA 3STBC 2BH2A 3DM3A 1JB3A 1PTOB 3S17B 5CBEE 3E9HA 5KYIA 3I4OA 1PH6A 3HOWG 4CJ0B 1CTMA 4LFCL 1G51A 1M8AA 3TBIB 5JEAJ 4GNXB 2K14A 5C4JB 2VQFL 1EEFD 4A3DB 5C3EB 2B2WC 2F0MA 3V2TA 4IJLA 1RTOA 3X3MA 5C44G 1KDAA 2F0IA 2VB2X 3E0JA 3VR2A 3T1YQ 2OQ0A 2K05A 4HJAA 1VQ6A 2XRQD 1N36L 1NR4A 3QWNA 2OTLA 2SNSA 5AFWA 1FVIA 1W3SA 1PZID 4F8MA 4UPAA 3M85A 3CCRA 1QWYA 2CW0D 3CQZB 1K28A 1YNND 3A56A 3H3VC 2KVMA 1Y1WH 2D2CC 1TS4A 1LM0A 4KY6A 3S15B 4WFN3 1PH8A 5IT9c 1F9PA 5C3XA 4L8JA 1D5XC 1PYSB 5JOBA 2JA7B 3BZDB 2OCEA 3ZJYC 2ICEC 3CC4A 3PSIA 5GQOA 3H91A 1T5EA 3W2DA 3GDEA 5M3FH 1HUNA 4LFAQ 3S2DH 3CRKC 1X3QA 4OO1H 2YYZA 1B4OA 1GM5A 5JPNC 1MSGA 1B1ZA 1I4PA 3IRBA 3RZOH 2NVTH 1E24A 3MTSA 1SNPA 3GV3A 4DR5Q 4HSVA 2SOBA 2A5HA 5FLMG 3VYRA 3HOZG 1Y8PB 4NDXA 1A0IA 4GKKQ 3GTPB 1VQMA 1B3AA 1STHA 1TWCB 4B9XA 3D31A 4A3MH 4X6AH 4IZ8A 1PDQA 1YNJD 2VW9A 4NW2A 2JA5G 1KDCA 3CKIB 2NB0A 2PO4A 2OWOA 5KEEA 1TWFB 3HKZE 4BXXH 2D5DA 4A3GH 2X69A 4JI1L 5M3MB 1TS2A 3U58A 1ASZA 4N9TA 4MNOA 4LF7L 3F2CA 2EXZA 3TP7A 5BR8L 4U673 3M9BA 3GTOB 5C3EG 1HQMC 1GJXA 5C4ZA 3PV0A 3DHQA 1J8IA 5I9OA 5IWAL 4DR1L 4LK1C 2CKZB 3NQTA 4G7ZC 4PNYA 3S1RH 4IUPA 5DEHA 1PZKD 2JN4A 3WOEA 3HKZB 2D0PA 1HZAA 2Z0SA 2FHTA 4CDEC 1SNCA 2D0OA 4AQYQ 1GKHA 1F77A 2B63G 3KYHC 3E6ZX 1QNKA 5LL6S 3SK6A 5JVG3 1EQRA 3OSOA 2RCFA 1WCMB 1FNVA 4JI4L 2B8GA 3IKJA 2Z4IA 4B3RL 1KNEA 2F0TA 3M4OH 2JA7G 1EYCA 3MVVA 2QILA 1T9HA 2PW7A 2I46A 3L0OA 4G57A 3SGIA 2B2TA 4DV5L 1HNWQ 3HZXA 1O78A 1DYQA 5IYCH 2G5DA 4BBRG 5CV8A 2WV6D 3NBHA 5FO8B 1XMOL 2M2LA 2K75A 4JG2A 4DK1A 1N8RC 2Z1CA 3L9AX 1WD0A 1MSHA 2IJ0A 4Z9CB 1SAPA 4DNTB 3NE5B 2UXCQ 1E2VA 1TXYA 1OTCA 4HJ9A 1JICA 5E1FA 4BA2I 2F1MA 3R93A 1BCPD 1Q8KA 5GAGC 2OF1A 4DV0Q 3FMCA 3BG3A 3JAME 1PFSA 3KBGA 1U4MA 2F0DA 1WI5A 1W2BA 2QGQA 3NWTA 3OMGA 1TY0A 4KKUA 2ZXRA 3T56B 4KJNA 1HR0L 2I5LX 1S5BD 1NR2A 4DF7A 1KABA 3A5UA 3R2TA 5C0XH 3BDLA 2Q2UA 3X3NA 4EQPA 1ENAA 4A3KG 2RBMA 3KJOA 1SNQA 3P20A 3H94A 2XGTA 1N33Q 5J1ZA 2EYHA 5A2QL 5M3MG 1PTOF 3JAMi 4XQNA 4BY7B 2RCNA 1XNQL 2F0LA 3IL8A 3MXGA 4DK6C 1HJPA 3SHLA 3KDFA 3QG1A 2NUCA 1LABA 3K57A 1Y1WB 5ISRA 4K14A 3RD4A 4EVOA 2NVQB 1YZ6A 2J4XA 2R93H 5LMNL 2E75C 1IYUA 1WTHA 5K36H 5CV4A 1HZBA 4RHRA 3FVQA 3CF5A 2B2YA 2BA1A 1QZHA 4PZ6A 1SMYC 3J81L 3HKZG 1AZPA 1PYBA 1VQAA 1XPRA 5IE8A 4A3CH 5M5WH 3KF6A 4YY3L 1YHAA 2RHSB 5FO7B 3WDNA 1JOQA 3T16A 3D8GA 3J7A5 2OTJA 1SNOA 3OIPA 3FRPB 2IWHA 5D65A 2L4NA 4MZ9A 3LWEA 2B3GA 2KEDA 3S9WA 2R6GA 4L5SA 1EWCA 1A3VA 2AQ3B 1EQQA 1QILA 1SYBA 4DR7L 2NWGA 3T1HL 3A8IE 1STYA 4DK3C 1VQPA 4DR4L 3RZDB 4APVA 4EQOA 1I94L 4B08A 2X6GA 1SSOA 1KAAA 1XMQL 1FGBD 2XVSA 4RWSC 2D62A 3HOWH 1L1OC 1WFQA 1R9TB 2MP1A 4LJZC 4A3GB 3ER0A 1ZYRD 4OEMB 4JI6L 5E4XA 3CCLA 3S1QH 2PQAA 4Y7NB 5LMUQ 1HR0W 4KK7A 3I90A 4EX5A 1IW7D 2FMCA 2XSCA 1EZ8A 4N9PA 4JI8Q 2K5QA 1K0RA 2Q8IB 2B8FA 5C44H 3NHHA 4DV2Q 3DEOA 2ICIA 3K7AB 4JK1C 3KBXA 3S1RB 1VQFA 1SNMA 3U4VA 1BNZA 1KAWA 1HFGA 4KN7C 5ELDA 3U9OA 4B3MQ 1MGSA 4BA1I 4X62L 3M4QA 1Q82C 4WORA 4BY7G 3J80L 1XNRQ 4DV6Q 5LMNW 1G6ZA 4NXML 1I3QH 2IW3A 4A93G 4KKTA 3RR5A 1YJWA 4BS9A 4IFDI 2QW7A 2K7VA 3GP7A 4QUFA 2RF4A 4JI7Q 2Z8LA 1LTID 4B9WA 1F9QA 4IO9A 5C0XI 1STGA 2K5NA 3M4OB 3MWYW 2E2JB 1DOLA 2G9HD 4OGQC 4OIKA 1HXYD 1S5ED 1IBLQ 1EIYB 4LUVA 2ALYB 4DR2Q 1L1OB 3PO3B 1KL9A 2FJ2A 1PRTC 4K6LA 4NKLA 2ZJRA 2E2HH 1D1KA 2E2IH 3QOJA 2XN9C 4XYQA 4JOIA 1ILQA 1JORA 1WYDA 1X3EA 1HQRD 1SEBD 5FLMH 1V1OA 3OWEB 4KHVA 3HOZH 2NTSA 3BDCA 5H1SE 1EWHA 3A54A 2HDLA 3G6JB 4P71A 4DUZQ 1XX8A 2JJQA 1VQOA 3OW2A 3GTMH 3K58A 1S3OA 4WRDA 1HNXL 3W1GA 1FR3A 3PF5A 3HGBA 3R2IA 2VUMB 4P75A 2JA5H 1PTOH 1GUGA 1A15A 1EY7A 2ZTDA 4FNFA 2IHEA 1YBYA 1U0LA 2F0UA 3AFQA 2Q2HA 1JE4A 4GS3A 4PMWA 3T4AC 5BN4A 2A19A 3W1BA 3TP8A 4HMJA 3NENA 3DEPA 3NTHA 4FYDA 3R3OA 2PQEA 3HEJA 3K59A 3ONAB 3I4MB 4KTAA 3KLSX 1E7ZA 4LW1A 5JJLA 2XNAC 4C3JB 1GUSA 1VQEA 2VQFQ 3RN2A 3CHBD 3ULJA 1WTQA 4A3LG 3O13A 1EU4A 4FF1A 2QDLA 3VR4A 3MEHA 1YITA 3TS0A 1P16A 1V1PA 2E2DC 2R93B 1TQOA 4DV1Q 1SYFA 3I55A 1PRTB 1LUZA 1ICFB 4LWCA 2NZOA 3OTOL 1N36Q 5C0XJ 5CYUA 3I73A 1HRJA 1KTKA 2EZVA 2B63H 2KBNA 1BUVT 3CQZH 4DFAA 4QY7A 1U9RA 4TKOB 3ICEA 3S15H 3RLNA 1RL2A 2F0EA 3TN2A 1E22A 2EQSA 2PYKA 2JA7H 1LTTD 1QCBD 3FDTA 4X3KA 1H95A 4JPBW 5COYA 1DOMA 2JA9A 3S14H 4BBRH 2N55A 1G291 3HOXG 3ERSX 1CSQA 2JEAI 1JJCB 5IYCG 1CT1D 4PMBA 3PO3G 1LTLA 2K28A 3K81C 2PI2E 3F2UA 4EQNA 2L9HA 1O7ZA 2L55A 5DAUA 2F03A 1RKNA 1IL8A 4IUUA 4X66L 2UXDQ 3S1MH 2HQEA 4ZAIA 3DUZA 4V190 1M90C 2KHIA 4IQZA 2UU9L 3I8ZA 1HTPA 3S1QB 4ULLA 2Z4HA 4L5TA 3ERQA 1I4QA 2NN6I 5IGEA 3HOVH 4YWKA 5C44B 2VUMG 1NE3A 1JQYD 2R61A 2ENBA 2YTYA 2GVBA 3UI2A 4A3KH 3H3VH 5EBCA 2A69D 5JAVA 3J7AF 4O42A 5M3MH 1HCZA 4JI1Q 1M4VA 1FGUA 3I4MG 1Q86C 1IKLA 3JAMc 2M00A 2F0GA 1VF5C 4C3JG 1Q12A 5BR8Q 4DV4L 4CDFC 4JV5L 1R4PB 1I3QB 1TY2A 3A7AB 3L3OC 5IODA 1VQNA 4P73A 3K80C 1SLJA 1PXUA 2PW5A 4CDCC 4DR1Q 2OT2A 1I6VC 1BOSA 3RN5A 1M1KC 1LO5D 2H5XA 1Z7TA 5HY6A 3UDXA 1AW7A 1S5CD 2A68C 2DN8A 2JXMB 2ZM6L 2JQOA 1KD1C 5IT9L 1DGSA 4YWLA 2E2HB 1CQFA 3LX0A 2E2IB 4YCWA 1QVGA 1HZ9A 1IBKL 2BH8A 2YV5A 1FYCA 1STNA 5LHY1 2MO1A 4JI3Q 4HIMA 1FJGL 1QOHA 1SMXA 2F0NA 3F1ZA 5EAYA 4B3RQ 3MXNA 1SYEA 4IPGA 2I5MX 2ZTEA 1VQHA 2UUCQ 1ESRA 4DV5Q 2K52A 1UE7A 4GOPA 4RHSA 3GTMB 3DLLA 4LF5Q 1VQ9A 2F0QA 3MXPA 3TDQA 2E74C 2EXDA 4V0BA 2JA5B 2DY8A 1WVLA 4BY1B 5HURA 4WJ3M 3Q22A 2I07B 1TWHH 2VB3X 3DWPA 2BE5D 1K8GA 1TWAB 3S2HH 1G6PA 1XTCD 2E8GA 2EE1A 4GZYC 2HCCA 3HRZC
chains in the Genus database with same CATH topology
2EPBA 4K5VA 1Q90A 5EQ0A 1R4QB 5CC4A 5C3WA 2DNCA 1Q1BA 4FP5D 2BCOA 2F0KA 2L11A 3S16B 1IYVA 1HUMA 2EJFC 2BDOA 2M9VA 3TMEA 1F2LA 2O4XA 2B63B 1JWSD 5KGUA 2NTTA 3J81E 2L0CA 1ZEQX 1CZWA 4DAYA 2SNMA 1OXTA 1FNWA 3QB3A 1MBYA 1ZKOA 2IL8A 3EJIA 2EY2A 5F2DA 5KNDA 1TKWB 3T53B 4C2MB 1TR5A 5C5LA 1W6JA 3S14B 4BBRB 1PRTF 1H9MA 2GA4B 2RDGA 3KUPA 4HTHA 2B2VA 1HFNA 4XT1B 3ITPA 3A7LA 3VR3A 4NP5A 1AZQA 3S1MB 3P1HA 3I72A 3NXWA 2IPKD 3NWSA 3SXHA 3A55A 3SEBA 4NMZA 2AQ2B 3R8BA 2PMZB 1DXMA 2H1EA 3QO2A 5ELEA 1GHKA 2A6HD 3V96A 3GTQB 3HOVB 1BQQT 4A3KB 4KY5A 5FLXL 2LY7A 1SJED 3W3AA 3D4RA 2EYMA 1PLFA 5J22A 3MXUA 1EIGA 1NUCA 1CZGA 1LTRD 3E5SA 5FKAC 1OXVA 2KCCA 1OXUA 4MIUA 3ZYYX 1EQVA 1LV9A 1V1PB 1C8CA 4IUQA 2AUKA 2A74C 1E0BA 3KK7A 4HEDA 5BN5A 1BF4A 1JWMD 2Y0SB 3K5OA 1T5XD 2K33A 2HCIA 2JSOA 1WTWA 4A3EB 1TWHB 2D9UA 4RGTA 3M7NA 3GO5A 1H9JA 3S2HB 4KMUC 4ZKBB 5T1GA 1RDPD 1CA5A 2SDFA 1A6XA 1W6KA 1TT2A 1LACA 5FOBB 1L0XB 2R7ZB 1EOTA 4OO1I 2O5JC 5FO9B 3J7AV 1EEID 2KA7A 3EROA 1RCVD 5KNBA 4DAVA 1DJRD 3KLRA 5E4WC 5M5YB 1SNDA 3FEWX 3FPPA 3NP8A 4QUCA 4U68A 3GD7A 5ELBA 4A93B 4O1NA 5HGTA 4QF4A 5G3LF 4ZRZA 3AMUA 3DM1A 1LT6D 2EYPA 2A73B 2IX1A 2EVBA 3VA7A 1H9SA 4X3SA 2A6ED 3Q6SA 4K8IA 5JPMC 3DWAA 4HMIA 4R8IA 2NVXB 4P2CB 2KEEA 3NSWA 4CKBA 4DGZA 4HAEA 3J7YW 1H9KA 1G2SA 4FF2A 1CHQD 2CVRA 2B2UA 5DNFA 2CW0C 1YNNC 1SXTA 3K5NA 4Q5VA 3NPPA 4FXGC 1NSNS 4RFBA 1WTPA 4ZUIA 5KYLA 5CV6A 4G4KA 1SYCA 4IALA 4C1NK 1ZXTA 1TU2B 1B53A 2RVLA 4UAIA 4OL7A 3D3RA 4PV1C 4FVMA 1A2TA 1EZ6A 4C3HG 3MFGA 1PTOD 2AWNA 4ABNA 5D3DA 4K8JA 5FK9C 2F0SA 1F2YA 1D2BA 4ZQ3A 1KDBA 1LTAD 4C56C 5EPLA 2E76C 5CR3A 3D4WA 1D1IA 4M8AA 3NUCA 5KRUA 3MFYA 2PNRC 2LMCB 2QCPX 1YNJC 2MHVA 3BDOA 3DWQA 5IT9E 1B9MA 1A3TA 4TRDA 4A3FB 4DN4M 5EKIA 3K0YA 1OXXK 3A8JE 1KNAA 3FPUB 2KUMA 3HOXB 3PO2B 3CRLC 5BN3A 2ID0A 3Q24A 1PFNA 3HS0C 1CI3M 2PZWA 2B2WA 5EKKA 1LT3D 1GHJA 3K6OA 4MHEA 1HHVA 1VF7A 3I4NB 3BVZA 1QJOA 5TSSA 3CU7A 3GTGB 1EYDA 3AB9A 1EY9A 3PIP3 5D14A 2B39A 1B44D 4OIJA 2CHBD 3RLFA 2J0TD 2JA8B 4CJ2C 1RF2D 2J7ZA 2JP1A 5IIFA 3RUZA 1I4RA 2B2TC 2LFNA 2EYOA 2CQAA 3IAYA 1CFMA 1BCPC 2QF7A 2L12A 1GUOA 3JAML 3TZUA 2V4DA 3DXJC 2DNEA 3Q23A 2KJXA 1K8OA 1S5DD 2BDNA 1TIID 5CMDA 1VMPA 5NUCA 2TSSA 3HOUB 3EA6A 1STAA 1V8QA 2RDHA 1CK1A 5C6AA 1EY0A 3C1FA 4J6HA 3SR1A 2WIIB 1JR0D 4R9WA 4XTCS 2YU9B 4XQQA 3T51B 5A35A 4KKSA 4TSSA 1TVXA 2KHSA 4XDXA 4FF3A 4HN7A 1EY8A 2HDMA 3QJYA 1BCPB 3PMFA 2B2YC 3VR5A 5FLXE 1IHZA 1JOKA 1HA5A 1SE4A 1SDFA 5EPJA 1D5ZC 1ILPA 2PCFB 4M1UB 4Q0FA 1GOZA 2RA4A 4YIJA 1DCZA 3M7GA 3PUXA 4DXFA 4I65A 2JEBI 1OO9B 3BS1A 3D6CA 2X6LA 4IFDG 1ONLA 3D4DA 1EIHA 2SEBD 4RA8A 5EPKA 3I70A 4DAPA 1ZYRC 1XXGA 4F88A 2K1BA 1Y1VB 5I6WA 2LKVA 1IW7C 3H6MA 4K5WA 2KQ3A 2TMPA 2JYOA 4QMGA 2RQXA 3SVMA 4KN4C 4DK0A 2EY5A 3C1EA 3EQLC 4IURA 3SE0A 1SE3A 5ELFA 2VNUD 3VYSA 2AUJD 3M3YB 4CHTB 3WOFA 3PUWA 1V43A 5JJZA 4RKLA 5C4XB 1PZJD 1LT5D 5EGTA 3QIAA 1I4GA 1F9RA 4C3IB 1MI2A 3VR6A 4ZLTF 1XYIA 1WTXA 5LL6X 4H44C 5J39A 3LWUA 1O7YA 1Z47A 5CV5A 3TZDA 1HPCA 2F0OA 1UNSA 2NVYB 3BVGA 2WKCA 4FXKC 5A2QE 4KHZA 1DONA 1DZ1A 1LTBD 1C4QA 2K03A 2L5TA 3OIQA 3U9SA 4I7ZC 4RGNA 4EGVA 1VMCA 3NBIA 3MAQA 4K2LA 1SMYD 1GUTA 1KLUD 5I2YA 1MD2D 3PIO3 2QKIC 4HSPA 2WACA 3D6WA 1AEXA 1ENCA 1I4HA 1JC7A 2PZTA 3TSSA 5IOCA 4XIGS 5CBAE 2R3ZA 2K5WA 1STEA 4ZYSA 5IGFA 2WINB 4RGMA 1S5FD 1Q3LA 1CA6A 2RKSA 1EFID 2KECA 1AFPA 1GUNA 2K32A 4KY7A 5CGKA 4PQXA 1U4PA 1K8MA 4K2KA 4PMCA 2MPMA 1LLRD 3SK4A 2F3VA 3EFXD 2NN6G 1LTSD 1UUPA 2HUGA 2Q8RE 4S3SA 4DA2A 1EQTA 4KV6A 1QNUA 4KI0A 4C3IG 5I6YA 3BYTB 5KNCA 3SDZA 5JEAG 1JWUD 3KLSA 2XIWA 2QDBA 4K5XA 1DD2A 4A3JB 1H9RA 3RMHA 2OEOA 4RCOA 3I3CA 3I4LA 2K6AA 3HG9A 2KCNA 4CKEA 5I2XA 1BCPF 4G7HC 3J80E 3H09A 3ND9A 1EYAA 2FFKB 4K6DA 3GTLB 1PYWD 2EYLA 3GTJB 3SK8A 1Q1EA 3OHXC 1B2TA 2K04A 2A69C 1J9OA 1PRTD 4J1MA 1LT4D 3A8KE 3QOLA 3HP3A 4G7OC 2JA6B 3VYTA 4IUNA 4HR7B 2IX3A 4ME5A 1BR9A 4FXDA 1LTGD 5T1IA 1UEAB 2ZT9C 3GTKB 1F9SA 1ET9A 1D5MC 1B9NA 4RKBA 1O7LA 3N6RA 4C3HB 2EY1A 4IUTA 1SE2A 4OHJA 2EJGC 3HOYB 5C4HA 3VYUA 1ML0D 3PUZA 3GV6A 4BWGB 3MZ5A 3M4YA 1VDZA 5EKLA 3GQBA 5IGCA 1ESFA 2PZUA 1JCKB 2WP8J 1CM9A 4IFDH 2EY6A 1Y8NB 5CV7A 1G91A 2C5CA 2BE5C 1ENFA 1FD7D 3NTKA 4H13C 2F4IA 1HTLD 5EBDA 1DOKA 1BO0A 3MC0B 1G8ZD 1NCVA 2EYFA 5CV9A 1BBXC 5M9OA 4X3UA 3PUVA 2XWJB 2IT1A 3NK9A 1BDOA 3NTIA 4H0LC 1U4LA 2F0FA 2XWBB 1F2MA 1PMRA 3BVMA 1K83B 4CBVA 1EY4A 2F0PA 1SBBB 2EYJA 3H0GB 4L63B 3C3LA 5M3FB 1X3PA 3S2DB 1STBA 4LMQD 3RZOB 1OXSC 2NVTB 4ILWA 1TS3A 1QE6A 2F3WA 2QEJC 2G9DA 3MHBA 1TS5A 2WAQB 4DXGA 5IGGA 3N52A 2F0JA 3V05A 2F0HA 1I50B 4H7BA 4A3BB 2BA0A 3URYA 4A3MB 2ZXPA 2K5DA 4KJOA 2K01A 4UDUC 2WB1B 2OXPA 5G3LD 1Q8IA 2B2VC 1B50A 1SYGA 3SK5A 2ZXOA 4KD4A 2L1BA 5IGDA 1EY6A 1E2WA 2A6HC 2AQ1B 1DM0B 3I91A 5IGBA 1GUWA 2A68D 2C9OA 3MA2B 1EL0A 4CJ1B 1II3A 1Y69U 2RSNA 2JE6I 2DY7A 1EY5A 4CGYB 4IN3A 2O2LD 4CKCA 4AYBB 1BXTA 1XWEA 4TQUS 2F0VA 1SFOB 1CQVA 5DM63 4X3TA 5CORA 1QG7A 2BOSA 3IFDA 1RJTA 4XT3B 2MJ8A 1WTOA 1NAPA 1PFBA 4JBWA 3TP6A 2NN6H 5I4DA 2H4OA 4MN3A 1VCIA 2VXWA 4OO1G 4XYOA 2IX0A 1E2ZA 3S1NB 5M5XB 5JEAH 1I6HB 4QIWB 1UAPA 4QB4A 1KLGD 5KIXA 5C5MA 2PPBC 3LNNA 4RH6A 2EJMA 4R8NA 4ODGA 1ET6A 2MUYA 3KF8A 4XXEA 3EVQA 3P75A 2EDGA 4DNRB 4BBSB 3VA5A 3P7JA 3T13A 3K5MA 3OW7A 3DMUA 3IFTA 5E3FA 1RD9D 3PUYA 1IKMA 1HA6A 3C2PA 3C46A 1U4RA 3AU7A 4IFDJ 4F7XA 4FO2A 4FF4A 3OOCA 4ZKCB 1CHPD 3NQIA 2NBFA 5K5PA 5M5WB 1O80A 2EOTA 5D3IB 5ELCA 4J8QA 1RODA 2N88A 2KOLA 4IUVA 4QCLA 4A3IB 2Q8TA 5DM73 4ZK9B 1G2TA 1RTNA 2O5IC 2A6EC 5I9PA 3Q0AA 1WTVA 4RCNA 1EU3A 1WTRA 1I4XA 1QB5D 3HOWB 4ZUJA 1FNUA 1SJHD 1Z6HA 3BYYB 4XQJA 3G7LA 1TWGB 1L0YB 1PFMA 2B2UC 1AN8A 2FINB 2NYZD 4WJWA 5EJWA 1D6EC 1S4ZA 3K5LA 2FMMA 5C0XG 4HCEA 2XRSD 3ND8A 1GXDC 1PTOC 1A2UA 1Y8OB 2F0WA 4HCSA 4KD3A 2MGSA 3OMCA 3OPOA 2NZ1D 1X32A 2RSOA 1WD1A 4RAUC 5K36G 1H9SB 3OWFA 4RGOS 3TP5A 5JVH3 1RHPA 1ICWA 1JOOA 2AWOA 1A3UA 1C48A 4C1NI 4F87A 2R92B 2WKDA 2LS01 3HOZB 3L7ZC 4DU9A 3FKIB 1SYDA 1AP0A 4ID6A 2RDFA 4E6IA 4L6TB 4LAAA 1F2ZA 1JB3A 1PTOB 3S17B 5CBEE 5KYIA 4CJ0B 1CTMA 1M8AA 3TBIB 5JEAJ 5C4JB 1EEFD 4A3DB 5C3EB 2B2WC 2F0MA 3V2TA 1RTOA 3X3MA 1KDAA 2F0IA 2VB2X 3E0JA 3VR2A 2K05A 2XRQD 1NR4A 3QWNA 2SNSA 5AFWA 1PZID 4F8MA 3M85A 1QWYA 2CW0D 3CQZB 3H3VC 1YNND 3A56A 2KVMA 2D2CC 1TS4A 4KY6A 3S15B 4WFN3 1F9PA 5C3XA 4L8JA 1D5XC 5JOBA 2JA7B 3BZDB 2ICEC 3H91A 1T5EA 3W2DA 1HUNA 3CRKC 1X3QA 4OO1H 2YYZA 1B4OA 5JPNC 1MSGA 1B1ZA 1I4PA 3MTSA 1SNPA 3GV3A 4HSVA 2SOBA 2A5HA 3VYRA 1Y8PB 4NDXA 3GTPB 1B3AA 1STHA 1TWCB 4B9XA 3D31A 4IZ8A 1PDQA 1YNJD 4NW2A 1KDCA 3CKIB 2NB0A 2PO4A 5KEEA 1TWFB 2D5DA 2X69A 5M3MB 1TS2A 4N9TA 2EXZA 3TP7A 4U673 3GTOB 1HQMC 1GJXA 5C4ZA 3PV0A 3DHQA 1J8IA 5I9OA 4LK1C 3NQTA 4G7ZC 4PNYA 4IUPA 5DEHA 1PZKD 3WOEA 3HKZB 2FHTA 1SNCA 1F77A 3E6ZX 1QNKA 5LL6S 3SK6A 5JVG3 3OSOA 1WCMB 1FNVA 2B8GA 3IKJA 2Z4IA 1KNEA 2F0TA 1EYCA 3MVVA 2QILA 2PW7A 2I46A 4G57A 2B2TA 3HZXA 1O78A 1DYQA 5CV8A 2WV6D 3NBHA 5FO8B 2M2LA 4DK1A 2Z1CA 3L9AX 1WD0A 1MSHA 2IJ0A 4Z9CB 1SAPA 4DNTB 3NE5B 1E2VA 1JICA 5E1FA 4BA2I 2F1MA 3R93A 1BCPD 2OF1A 3FMCA 3BG3A 3JAME 3KBGA 1U4MA 2F0DA 3NWTA 3OMGA 1TY0A 4KKUA 2ZXRA 3T56B 4KJNA 1S5BD 1NR2A 4DF7A 1KABA 3R2TA 5C0XH 3BDLA 3X3NA 4EQPA 1ENAA 2RBMA 1SNQA 3P20A 3H94A 5J1ZA 2EYHA 5A2QL 1PTOF 4XQNA 4BY7B 2F0LA 3IL8A 3MXGA 3SHLA 3QG1A 2NUCA 1LABA 3K57A 1Y1WB 5ISRA 4K14A 3RD4A 4EVOA 2NVQB 2J4XA 2E75C 1IYUA 5K36H 5CV4A 4RHRA 3FVQA 2B2YA 2BA1A 1SMYC 3J81L 1AZPA 5FO7B 3WDNA 1JOQA 3T16A 3D8GA 1SNOA 3OIPA 3FRPB 2IWHA 5D65A 2L4NA 3LWEA 2KEDA 3S9WA 2R6GA 1EWCA 1A3VA 2AQ3B 1QILA 1SYBA 2NWGA 3A8IE 1STYA 3RZDB 4EQOA 4B08A 2X6GA 1SSOA 1KAAA 1FGBD 2XVSA 4RWSC 2D62A 1R9TB 2MP1A 4LJZC 4A3GB 1ZYRD 5E4XA 4Y7NB 4KK7A 3I90A 1IW7D 2FMCA 2XSCA 1EZ8A 4N9PA 2K5QA 2Q8IB 2B8FA 3NHHA 3DEOA 2ICIA 3K7AB 4JK1C 3KBXA 3S1RB 1SNMA 1BNZA 1HFGA 4KN7C 5ELDA 3U9OA 1MGSA 4BA1I 4WORA 3J80L 1G6ZA 2IW3A 4KKTA 4BS9A 4IFDI 2K7VA 3GP7A 4QUFA 2Z8LA 1LTID 4B9WA 1F9QA 5C0XI 1STGA 3M4OB 3MWYW 2E2JB 1DOLA 2G9HD 4OGQC 4OIKA 1HXYD 1S5ED 3PO3B 2FJ2A 1PRTC 4K6LA 4NKLA 1D1KA 3QOJA 2XN9C 4XYQA 1ILQA 1JORA 1HQRD 1SEBD 1V1OA 3OWEB 4KHVA 2NTSA 3BDCA 1EWHA 3A54A 2HDLA 3G6JB 1XX8A 3K58A 4WRDA 1FR3A 3HGBA 3R2IA 2VUMB 1PTOH 1GUGA 1A15A 1EY7A 4FNFA 3T4AC 2F0UA 4PMWA 1JE4A 5BN4A 3TP8A 4HMJA 3DEPA 3NTHA 4FYDA 3R3OA 2PQEA 3HEJA 3K59A 3ONAB 3I4MB 4KTAA 3KLSX 2XNAC 4C3JB 1GUSA 3CHBD 1WTQA 3O13A 1EU4A 4FF1A 3VR4A 3MEHA 1V1PA 2E2DC 2R93B 1TQOA 1SYFA 1PRTB 5C0XJ 5CYUA 3I73A 1HRJA 1KTKA 2EZVA 1BUVT 4DFAA 1U9RA 4TKOB 2F0EA 3TN2A 2PYKA 1LTTD 1QCBD 3FDTA 4X3KA 5COYA 1DOMA 2N55A 1G291 2JEAI 1CT1D 4PMBA 2K28A 3F2UA 4EQNA 2L9HA 1O7ZA 2L55A 5DAUA 2F03A 1RKNA 1IL8A 4IUUA 2HQEA 4ZAIA 3DUZA 4V190 4IQZA 3I8ZA 1HTPA 3S1QB 4ULLA 2Z4HA 3ERQA 1I4QA 2NN6I 5IGEA 5C44B 1JQYD 2R61A 2ENBA 3UI2A 5EBCA 2A69D 5JAVA 3J7AF 4O42A 1HCZA 1M4VA 1IKLA 2M00A 2F0GA 1VF5C 4C3JG 1Q12A 1R4PB 1I3QB 1TY2A 3A7AB 3L3OC 5IODA 1PXUA 2PW5A 2OT2A 1I6VC 1BOSA 1LO5D 1Z7TA 1AW7A 1S5CD 2A68C 2DN8A 2JXMB 5IT9L 2E2HB 1CQFA 3LX0A 2E2IB 1FYCA 1STNA 5LHY1 1QOHA 2F0NA 3MXNA 1SYEA 1ESRA 4RHSA 3GTMB 2F0QA 3MXPA 3TDQA 2E74C 4V0BA 2JA5B 2DY8A 1WVLA 4BY1B 5HURA 3Q22A 2I07B 2VB3X 3DWPA 2BE5D 1TWAB 1XTCD 2EE1A 4GZYC 2HCCA 3HRZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZI D;  1LTS D;  1UUP A;  1JR0 D;  1RD9 D;  1PTO C;  1V1O A;  4BWG B;  3OWE B;  4UDU C;  2NTS A;  1PZJ D;  1LT5 D;  3BYT B;  1TS4 A;  1FNV A;  1EWC A;  1LT6 D;  1I4G A;  1LTR D;  2AQ3 B;  1QIL A;  1I4Q A;  1JWU D;  5FKA C;  1ESF A;  2AQ1 B;  2QIL A;  1JQY D;  2R61 A;  1D5X C;  1JCK B;  3BZD B;  3R2I A;  1DYQ A;  1PTO H;  4TSS A;  4RCO A;  3W2D A;  2WV6 D;  1FGB D;  3DWA A;  1M4V A;  1CHP D;  1V1P B;  2IJ0 A;  4RGO S;  4Z9C B;  1ENF A;  1JWS D;  2XRS D;  2NTT A;  1FD7 D;  1B1Z A;  1UNS A;  1I4P A;  3BVG A;  1BCP B;  1CHQ D;  1BCP F;  1LT3 D;  1HTL D;  3KLS X;  2XNA C;  1FNW A;  1TY2 A;  5D3I B;  2O2L D;  1LTB D;  5ELC A;  1HA5 A;  1SE4 A;  1SXT A;  1BCP D;  3CHB D;  4ZYS A;  3MC0 B;  1G8Z D;  1D5Z C;  1PYW D;  3BVZ A;  1BXT A;  5TSS A;  3O13 A;  1EU4 A;  1JWM D;  4RFB A;  1GOZ A;  4RGN A;  1V1P A;  1CQV A;  1T5X D;  1LO5 D;  1PRT B;  1TY0 A;  1B44 D;  4DXF A;  1PRT F;  1S5B D;  2CHB D;  1AW7 A;  2ICI A;  1S5C D;  2RDG A;  4L6T B;  3R2T A;  4O1N A;  1KLU D;  1PRT D;  1RF2 D;  1KTK A;  1LT4 D;  4RGT A;  1MD2 D;  3BVM A;  5ELD A;  2SEB D;  1PTO B;  5I4D A;  1SBB B;  4L63 B;  1PTO F;  1EU3 A;  1I4R A;  1TS2 A;  1I4H A;  1RDP D;  1I4X A;  3MFG A;  1PTO D;  3TSS A;  2IPK D;  1XXG A;  3SEB A;  3GP7 A;  5D3D A;  1FNU A;  1BCP C;  2AQ2 B;  1SJH D;  1STE A;  1KLG D;  5FK9 C;  1L0X B;  3BYY B;  2Z8L A;  1LTI D;  3R8B A;  5ELE A;  1LTT D;  2J4X A;  1TS3 A;  1EEF D;  4RGM A;  2QEJ C;  1S5F D;  1LTG D;  4RHS A;  1EEI D;  1LTA D;  4C56 C;  1L0Y B;  2G9H D;  4RHR A;  1RCV D;  4RH6 A;  1TS5 A;  1HXY D;  1S5E D;  1AN8 A;  1ET9 A;  1EFI D;  1ET6 A;  1CT1 D;  4DXG A;  1DJR D;  1S5D D;  1SE3 A;  3V05 A;  5ELF A;  1PZK D;  1D6E C;  4K6L A;  1PRT C;  2XRQ D;  1D5M C;  3DWP A;  2TSS A;  3EA6 A;  2XN9 C;  3URY A;  3DWQ A;  1SJE D;  5ELB A;  2RDH A;  1F77 A;  1LLR D;  1CK1 A;  1SE2 A;  1XTC D;  1HQR D;  4OHJ A;  1SEB D;  3EFX D; 
#chains in the Genus database with same CATH topology
 4JW0 A;  2EPB A;  1CKN B;  4K5V A;  1Q90 A;  5EQ0 A;  1R4Q B;  3KJP A;  3E0E A;  4UP8 A;  5C3W A;  5CC4 A;  4R4T A;  2DNC A;  4KHP L;  1Q1B A;  4FP5 D;  1UE5 A;  2XTI A;  1HR0 Q;  2BCO A;  2F0K A;  3I7F A;  2L11 A;  3S16 B;  1IYV A;  1MJC A;  1HUM A;  2EJF C;  2BDO A;  2M9V A;  3TME A;  5M5Y H;  4YHH L;  1F2L A;  1KIX A;  3G6E A;  4BY7 H;  2O4X A;  2B63 B;  1XNQ Q;  1JWS D;  5KGU A;  4A93 H;  2NTT A;  4DKA C;  3J81 E;  2L0C A;  1VQ8 A;  3BJU A;  1ZEQ X;  1CZW A;  4DAY A;  2NVQ H;  2SNM A;  2F52 A;  1OXT A;  1FNW A;  3QB3 A;  1MBY A;  1SR3 A;  1ZKO A;  2IL8 A;  5LMN Q;  3EJI A;  4DUY L;  2EY2 A;  5F2D A;  5KND A;  4LUZ A;  3CCM A;  1Y1V G;  1TKW B;  3T53 B;  4C2M B;  1TR5 A;  5C5L A;  1W6J A;  3S14 B;  4BBR B;  1PRT F;  1NBW A;  1Q46 A;  1H9M A;  3J81 i;  4YY3 Q;  2GA4 B;  4JI2 Q;  2RDG A;  3KUP A;  3A5Z B;  4HTH A;  2EIF A;  2B2V A;  2GN5 A;  1HFN A;  4XT1 B;  3ITP A;  4K0K L;  2HT1 A;  1VQ4 A;  3A7L A;  3VR3 A;  4X64 Q;  4NP5 A;  1AZQ A;  3S1M B;  3P1H A;  3I72 A;  2PNH A;  3NXW A;  2IPK D;  2V1C C;  3NWS A;  3SXH A;  2CH4 A;  3A55 A;  3SEB A;  2HHH L;  4NMZ A;  3BZK A;  3T1H Q;  2AQ2 B;  4DR7 Q;  3R8B A;  5C4X G;  2PMZ B;  3RZD H;  1DXM A;  2H1E A;  3Q8D A;  3QO2 A;  5ELE A;  4DR4 Q;  2F4V L;  2HIV A;  1GHK A;  2A6H D;  1BKB A;  3V96 A;  1I94 Q;  3G71 A;  3GTQ B;  3HOV B;  1XMQ Q;  1BQQ T;  4BY1 G;  4A3K B;  1YJN A;  1R9T H;  4KY5 A;  5FLX L;  2LY7 A;  1QZG A;  3KF8 B;  4JI6 Q;  1SJE D;  2YTX A;  4Y7N H;  3PIP A;  3W3A A;  3D4R A;  4NB3 A;  3CXC A;  3K8A A;  2EYM A;  1UE6 A;  3A74 A;  1PLF A;  5J22 A;  4A3L H;  3I56 A;  3MXU A;  1N32 Q;  1EIG A;  1NUC A;  1K8A C;  1CZG A;  4GKJ L;  1LTR D;  1IL2 A;  3E5S A;  5FKA C;  5L37 A;  3K7A H;  2UUB L;  2Y0S E;  1OXV A;  2KCC A;  1KXL A;  1X9N A;  1JT8 A;  1OXU A;  4MIU A;  3ZYY X;  2MFI A;  1EQV A;  1CUK A;  4X62 Q;  4LF4 L;  1LV9 A;  1A62 A;  1V1P B;  4NXM Q;  1C8C A;  4IUQ A;  2AUK A;  2A1A A;  5FJ8 G;  4QGU A;  2A74 C;  3WWV A;  2E2J H;  1E0B A;  3KK7 A;  3KOJ A;  4HED A;  5BN5 A;  1BF4 A;  4WJ4 A;  1CKO A;  4IPC A;  1JWM D;  3E9I A;  2Y0S B;  3HOX H;  3K5O A;  1T5X D;  3PO3 H;  1L2F A;  2HCI A;  2K33 A;  1B8A A;  3UE1 A;  4OX9 L;  2JSO A;  1WTW A;  4A3E B;  3EN2 A;  1TWH B;  2D9U A;  4RGT A;  3M7N A;  1S72 A;  2CWA A;  3GO5 A;  1H9J A;  4POG A;  1AH9 A;  3S2H B;  2I0Q A;  4KMU C;  5JJI A;  4ZKB B;  5T1G A;  1RDP D;  1CA5 A;  2SDF A;  1BBW A;  1A6X A;  1QUQ A;  1W6K A;  1TT2 A;  1LAC A;  4JC0 A;  5FOB B;  1L0X B;  1HNX Q;  3CCV A;  2R7Z B;  2VUM H;  3GTG H;  1EOT A;  4OO1 I;  3HOV G;  1SRO A;  2O5J C;  4IJH A;  3TQY A;  1EEI D;  2KA7 A;  3ERO A;  5FO9 B;  3J7A V;  1RCV D;  5KNB A;  1LYL A;  4DAV A;  3UE0 A;  1DJR D;  3KLR A;  5E4W C;  5M5Y B;  3I4M H;  1SND A;  3FEW X;  3FPP A;  1YHQ A;  4C3J H;  3NP8 A;  1CKM A;  4QUC A;  4U68 A;  3GD7 A;  5ELB A;  4P74 A;  4A93 B;  4O1N A;  5HGT A;  4QF4 A;  5G3L F;  3J81 j;  4HJ8 A;  4JVZ A;  4ZRZ A;  3AMU A;  1KRT A;  3E3X A;  3DM1 A;  1LT6 D;  2EYP A;  4NXN L;  2A73 B;  2IX1 A;  1JJG A;  3OTO Q;  2EVB A;  1PA6 A;  3VA7 A;  1H9S A;  4X3S A;  2A6E D;  1HNZ L;  1Q7Y C;  3Q6S A;  4K8I A;  3CPF A;  5JPM C;  3DWA A;  4HMI A;  4R8I A;  2NVX B;  4P2C B;  2KEE A;  3NSW A;  4CKB A;  4DGZ A;  4HAE A;  3J7Y W;  4OON A;  1H9K A;  1G2S A;  4FF2 A;  1CHQ D;  2CVR A;  3H15 A;  2B2U A;  2B29 A;  2CW0 C;  5DNF A;  2KEN A;  1YNN C;  1SXT A;  2N49 A;  3F2B A;  1NTG A;  2Y0S G;  3K5N A;  4Q5V A;  3NPP A;  4FXG C;  1NSN S;  4RFB A;  1WTP A;  4ZUI A;  4PG3 A;  5GAD C;  5KYL A;  1FL0 A;  5CV6 A;  4J15 A;  4G4K A;  4HIK A;  4HJ5 A;  4IPH A;  4A3E G;  1SYC A;  4IAL A;  4C1N K;  1ZXT A;  1TU2 B;  4X66 Q;  1B53 A;  2RVL A;  4UAI A;  4L5Q A;  4OL7 A;  3D3R A;  4PV1 C;  4GOP B;  4FVM A;  1A2T A;  1EZ6 A;  2UU9 Q;  4C3H G;  3JC6 6;  3AYH B;  2Z6B A;  5IYD G;  3MFG A;  1PTO D;  2AWN A;  3HOY G;  4ABN A;  5D3D A;  4L5R C;  4K8J A;  2R7Z G;  4LF6 L;  5FK9 C;  2DGY A;  2F0S A;  1VQG A;  1F2Y A;  1D2B A;  4ZQ3 A;  1KDB A;  1LTA D;  4C56 C;  5EPL A;  2E76 C;  5CR3 A;  3D4W A;  1D1I A;  3EBE A;  4M8A A;  3NUC A;  1VQ5 A;  5KRU A;  2VQE L;  3MFY A;  2PNR C;  2LMC B;  3CD6 A;  2QCP X;  1X6O A;  1YNJ C;  2MHV A;  2VY3 A;  2UUA L;  3PF4 A;  4DV4 Q;  4JV5 Q;  3BDO A;  3DWQ A;  1B70 B;  1IBM L;  2C35 B;  3U50 C;  5IT9 E;  1B9M A;  1A3T A;  1WOC A;  4TRD A;  4A3F B;  4DN4 M;  5EKI A;  1Y1V H;  3K0Y A;  2AKW B;  3HKS A;  1OXX K;  3A8J E;  1KNA A;  4AIM A;  4AQY L;  3FPU B;  4I7A A;  4QJF A;  3PIO A;  2ATW A;  2KUM A;  3HOX B;  2Z6K A;  3PO2 B;  1BVS A;  1NY4 A;  1KRS A;  3CRL C;  5BN3 A;  2ID0 A;  1IBK Q;  3STB D;  3M3Y H;  3KFU A;  3Q24 A;  3W5O A;  1PFN A;  1FJG Q;  3HS0 C;  1CI3 M;  2IHF A;  2PZW A;  2B2W A;  1HNW L;  5EKK A;  1LT3 D;  3H0G G;  1GHJ A;  5JJK A;  3K6O A;  5C4X H;  2IY5 B;  1YIJ A;  4MHE A;  2N3S A;  1SE8 A;  1PVO A;  1HHV A;  1VF7 A;  3I4N B;  3BVZ A;  1QJO A;  5TSS A;  5HGQ A;  2QA4 A;  3CU7 A;  3GTG B;  1EYD A;  3AB9 A;  1EY9 A;  3PIP 3;  4DR3 L;  4BY1 H;  5D14 A;  3BU2 A;  2B39 A;  4GLA C;  1B44 D;  4OIJ A;  2CHB D;  3RLF A;  1TWA H;  2J0T D;  2WAQ G;  2JA8 B;  4CJ2 C;  4LFC Q;  4H02 A;  1RF2 D;  2J7Z A;  4A4I A;  2NVY H;  4A3B G;  2JP1 A;  5IIF A;  3RUZ A;  4OEL B;  1I4R A;  1E1O A;  2B2T C;  2LFN A;  2EYO A;  4KHP Q;  2CQA A;  3IAY A;  2CQO A;  3S16 H;  1CFM A;  1BCP C;  2R7F A;  2L12 A;  2QF7 A;  1GUO A;  3JAM L;  2WB1 G;  2KCM A;  3TZU A;  1K9M C;  5IP7 G;  4LF9 L;  4PZ7 A;  4YHH Q;  1J6Q A;  2V4D A;  3DXJ C;  2DNE A;  3TRZ A;  1AE3 A;  3Q23 A;  4O0A A;  4JYA L;  2KJX A;  1K8O A;  1S5D D;  2BDN A;  1TII D;  4DAM A;  3CC2 A;  1NNX A;  5CMD A;  1VMP A;  5NUC A;  2TSS A;  3HFZ B;  3HOU B;  3EA6 A;  1STA A;  1V8Q A;  4UHV A;  4MTK A;  5ELO A;  2RDH A;  5FJ8 H;  1CK1 A;  5C6A A;  4DUY Q;  4A3F G;  1EY0 A;  3C1F A;  1VQJ A;  4J6H A;  3SR1 A;  2WII B;  1C0A A;  1JR0 D;  1N34 L;  3EIV A;  4R9W A;  4C2M H;  3CC7 A;  4XTC S;  2YU9 B;  3PO2 G;  3J7Z C;  1PV4 A;  4XQQ A;  3T51 B;  5A35 A;  4KKS A;  4K0K Q;  4TSS A;  1TVX A;  2KHS A;  2CWP A;  4XDX A;  4FF3 A;  4HN7 A;  1EY8 A;  5IYB G;  2HDM A;  1D7Q A;  3NBH B;  3QJY A;  2ZJQ A;  5IP9 G;  1BCP B;  3PMF A;  1Y14 B;  2B2Y C;  3VR5 A;  5FLX E;  1EWI A;  1IHZ A;  1JOK A;  2I5H A;  1HA5 A;  1SE4 A;  3I4N G;  2R7D A;  3D0F A;  3GTQ H;  1SDF A;  5EPJ A;  1D5Z C;  1ILP A;  2PCF B;  4M1U B;  4Q0F A;  1XPO A;  1GOZ A;  2RA4 A;  2NZH A;  1B7Y B;  1C7Y A;  4YIJ A;  1DCZ A;  3M7G A;  3PUX A;  3UDG A;  4DXF A;  2JA8 G;  1QUQ B;  4JCV E;  4I65 A;  2JEB I;  2ES2 A;  2Q2T A;  1OO9 B;  3CME A;  3BS1 A;  3D6C A;  4LF7 Q;  1EOV A;  2X6L A;  4IFD G;  1ONL A;  3D4D A;  1EIH A;  2SEB D;  4RA8 A;  2LXJ A;  4BBS G;  3PCO B;  4NPS A;  5EPK A;  3I70 A;  4P72 A;  4DAP A;  4OWX B;  1I5F A;  1ZYR C;  5IWA Q;  4GKJ Q;  1XXG A;  4F88 A;  2K1B A;  1V1Q A;  1Y1V B;  5I6W A;  1J5E L;  2UUB Q;  1GD7 A;  3GTJ H;  2LKV A;  1IW7 C;  4A76 A;  4B3M L;  3H6M A;  3KDF B;  4K5W A;  3RLO A;  2KQ3 A;  2TMP A;  4DV6 L;  2JYO A;  4QMG A;  2RQX A;  3SVM A;  4KN4 C;  3ULP A;  4DK0 A;  2EY5 A;  3NEM A;  4LF4 Q;  3C1E A;  3EQL C;  4IUR A;  1P8L A;  3CCS A;  3SE0 A;  1SE3 A;  2HD3 A;  5ELF A;  1X65 A;  4UY8 C;  2VNU D;  4LF8 L;  1VQL A;  4X65 L;  3HOU G;  2N8N A;  3G48 A;  3VYS A;  2AUJ D;  3M3Y B;  4JI4 Q;  4CHT B;  3WOF A;  3PUW A;  1V43 A;  3KF6 B;  5JJZ A;  5GAH C;  1K73 C;  4RKL A;  4N8X 1;  5C4X B;  1PZJ D;  3PGZ A;  1LT5 D;  3MEF A;  5EGT A;  4B3T L;  3QIA A;  1XMO Q;  4CDD C;  1I4G A;  1F9R A;  1MKH A;  1VQK A;  4C3I B;  1MI2 A;  3CP0 A;  1PHJ A;  3VR6 A;  4ZLT F;  1XYI A;  1WTX A;  5LL6 X;  4OX9 Q;  4A3E H;  1GO3 E;  4H44 C;  5J39 A;  3LWU A;  4DUZ L;  1O7Y A;  4LFB L;  1Z47 A;  4C3H H;  5CV5 A;  3TZD A;  1HPC A;  5IYD H;  2F0O A;  1UNS A;  2NVY B;  3HOY H;  2YTV A;  2WKC A;  3BVG A;  4FXK C;  5A2Q E;  2ZJP A;  2R7Z H;  4KHZ A;  1DON A;  5GRO A;  2Z6K C;  1LTB D;  1DZ1 A;  1C4Q A;  2K03 A;  2L5T A;  3OIQ A;  3U9S A;  4I7Z C;  4AH6 A;  4RGN A;  4JOI C;  1X55 A;  4DV7 L;  2PQA B;  4EGV A;  1VMC A;  3NBI A;  3MAQ A;  4R4O A;  4MTN A;  4K2L A;  1JJ2 A;  1SMY D;  4UP7 A;  1HH2 P;  1GUT A;  1KC8 C;  1KLU D;  5I2Y A;  3K7U C;  1MD2 D;  3PIO 3;  4DV1 L;  1JB7 A;  4LNQ A;  2QKI C;  3L2P A;  1SN8 A;  4HSP A;  2WAC A;  3D6W A;  1AEX A;  1ENC A;  2CCZ A;  1I4H A;  1JC7 A;  2PZT A;  3TSS A;  5IOC A;  3H3V I;  4XIG S;  4NXN Q;  2QEX A;  5CBA E;  2PMZ E;  2R3Z A;  5AJ3 L;  2K5W A;  3CCU A;  1STE A;  4ZYS A;  4UP9 A;  5IGF A;  2WIN B;  1HNZ Q;  4RGM A;  1S5F D;  2N78 A;  1L1O A;  4DNI A;  1Q3L A;  1AE2 A;  1CA6 A;  1PH3 A;  2RKS A;  2NVX H;  1EFI D;  1YVC A;  2KEC A;  1AFP A;  1GUN A;  2K32 A;  4KY7 A;  4Y52 H;  5CGK A;  4PQX A;  1K83 H;  4DR6 L;  3H0G H;  2CH4 W;  1U4P A;  1K8M A;  4K2K A;  4PMC A;  2MPM A;  1LLR D;  3SK4 A;  2F3V A;  4ME3 A;  3EFX D;  2NN6 G;  1LTS D;  1UUP A;  2HUG A;  2Q8R E;  4S3S A;  2HIX A;  4DA2 A;  1EQT A;  4KV6 A;  3A0J A;  1A63 A;  1QNU A;  4KI0 A;  4C3I G;  5I6Y A;  3BYT B;  2LXK A;  5KNC A;  3SDZ A;  5JEA G;  4OXP A;  1O7I A;  1BBU A;  2UXD L;  1JWU D;  3KLS A;  2XIW A;  2R92 G;  2KHJ A;  4JBM A;  2QDB A;  2K5H A;  4K5X A;  4A3J B;  1DD2 A;  1H9R A;  3RMH A;  2MO0 A;  1VQB A;  2ZTC A;  2OEO A;  4RCO A;  3FKI G;  4JI0 L;  3I3C A;  3I4L A;  1I50 H;  4EQ5 A;  1KQS A;  4A3B H;  1V9P A;  2K6A A;  3HG9 A;  2GVA A;  2KCN A;  4GLX A;  4CKE A;  5I2X A;  4LF6 Q;  1BCP F;  4N8F A;  4G7H C;  3J80 E;  4DV3 L;  4B3S L;  1JE5 A;  3H09 A;  3ND9 A;  1EYA A;  2FFK B;  4K6D A;  3GTL B;  5IP7 H;  2MNA A;  1PYW D;  4HJ7 A;  2UXB L;  4OWW B;  2EYL A;  3GTJ B;  1MHW C;  3SK8 A;  2VQE Q;  4A3D G;  2UUA Q;  1Q1E A;  3OHX C;  1B2T A;  2K04 A;  2A69 C;  4ZCK A;  3J80 i;  1J9O A;  1PRT D;  1IBM Q;  4J1M A;  1LT4 D;  3A8K E;  4A3F H;  2AHO B;  3QOL A;  3HP3 A;  4G7O C;  4FDB A;  4JI5 L;  2JA6 B;  4IPD A;  3UDF A;  3VYT A;  4IUN A;  4HR7 B;  3PO2 H;  2IX3 A;  4JBK A;  1SRU A;  4ME5 A;  2E5L L;  1BR9 A;  2JK8 A;  4R1J A;  3TRE A;  1SFO H;  4HID A;  4IOA A;  4FXD A;  4JI3 L;  1LTG D;  5T1I A;  1UEA B;  2ZT9 C;  3GTK B;  1F9S A;  4GN3 B;  1ET9 A;  2DJG C;  2K5V A;  5IYB H;  1C9O A;  2UUC L;  1D5M C;  1B9N A;  5IP9 H;  1VQC A;  4RKB A;  1O7L A;  3N6R A;  4C3H B;  2EY1 A;  4IUT A;  4LF5 L;  1SE2 A;  4OHJ A;  3I4N H;  2EJG C;  3HOY B;  5C4H A;  3VYU A;  1VQ7 A;  1ML0 D;  3S1N H;  3PUZ A;  4YCU A;  1E3P A;  5M5X H;  3GV6 A;  4BWG B;  1QVF A;  1I6H H;  3MZ5 A;  3M4Y A;  4DR3 Q;  1VDZ A;  2K50 A;  5EKL A;  2MQH A;  1E1T A;  3GQB A;  5IGC A;  2PI2 A;  2JA8 H;  4A3J G;  1ESF A;  2PZU A;  1JCK B;  1JMC A;  2WP8 J;  1CM9 A;  5FLX c;  4IFD H;  2EY6 A;  1Y8N B;  4R4C A;  4PZ8 A;  5GAE C;  4BBS H;  5CV7 A;  4R4I A;  1G91 A;  2C5C A;  1PH5 A;  2BE5 C;  3T1Y L;  1ENF A;  4GOP C;  1FD7 D;  3FP9 A;  3NTK A;  4H13 C;  1XTD A;  2F4I A;  1HTL D;  5EBD A;  1DOK A;  1A8V A;  1BO0 A;  1X54 A;  2Q2I A;  1EIF A;  1G8Z D;  1WJJ A;  3MC0 B;  4LF9 Q;  1NCV A;  2EYF A;  1UE1 A;  5CV9 A;  1BBX C;  5M9O A;  4X3U A;  2A8V A;  3PUV A;  4RMF A;  2FXQ A;  2XWJ B;  2IT1 A;  3NK9 A;  4JYA Q;  1EYG A;  1BDO A;  3NTI A;  4QQB X;  4GN4 B;  4H0L C;  3HOU H;  1K0S A;  1U4L A;  2WAQ E;  5DLQ E;  2F0F A;  3CCE A;  2CFM A;  4OWT B;  2XWB B;  1F2M A;  2KCT A;  1PMR A;  3BVM A;  1K83 B;  4CBV A;  1EY4 A;  2F0P A;  1N34 Q;  1SBB B;  2EYJ A;  3BZC A;  3H0G B;  4L63 B;  2JA6 G;  3C3L A;  5M3F B;  4LFA L;  5J3B A;  4JI2 L;  2YU9 H;  1X3P A;  3S2D B;  1STB A;  3TS2 A;  1PH1 A;  4LMQ D;  3RZO B;  1OXS C;  4DR5 L;  2NVT B;  2WB1 E;  4ILW A;  3F8T A;  4X64 L;  1TS3 A;  1WCM G;  1QE6 A;  3AFP A;  4A3I H;  2F3W A;  2QEJ C;  3MXN B;  3PQI A;  4POF A;  2G9D A;  1QVC A;  3MHB A;  1IZ6 A;  3LGJ A;  1TS5 A;  2WAQ B;  4GKK L;  4DXG A;  5IGG A;  3N52 A;  2F0J A;  3V05 A;  3K0X A;  2F0H A;  1I50 B;  4GNX A;  2F3I A;  4H7B A;  4A3B B;  2BA0 A;  3URY A;  4A3M B;  1CKN A;  2ZXP A;  4GN5 A;  1PH7 A;  2K5D A;  4KJO A;  2K01 A;  4UDU C;  2WB1 B;  2OXP A;  4JBJ A;  5G3L D;  1Q8I A;  2B2V C;  4KLK A;  1B50 A;  4A75 A;  1SYG A;  5E7N A;  3SK5 A;  2ZXO A;  1TWG H;  4KD4 A;  4AYB E;  2L1B A;  5IGD A;  1EY6 A;  1E2W A;  2A6H C;  2AQ1 B;  1DM0 B;  3I91 A;  1GVP A;  5IGB A;  1GUW A;  1N32 L;  1YJ9 A;  2A68 D;  2C9O A;  3MA2 B;  2K4K A;  3VDY A;  1VQI A;  1EL0 A;  3QR8 A;  4CJ1 B;  1ASY A;  1II3 A;  1Y69 U;  1UEB A;  2RSN A;  3KLW A;  2JE6 I;  2DY7 A;  1EY5 A;  4CGY B;  1YHB A;  1J5E Q;  4IN3 A;  2O2L D;  4CKC A;  2ZM6 Q;  4AYB B;  4DAY B;  1BXT A;  3J81 c;  1XWE A;  2OQK A;  4QIW E;  3CMA A;  4TQU S;  2F0V A;  1Y1W G;  1SFO B;  1VS0 A;  1CQV A;  1CSP A;  1NMG A;  5DM6 3;  1XPU A;  4X3T A;  5COR A;  1QG7 A;  1RIP A;  1K3R A;  4LF8 Q;  3TEH B;  4X65 Q;  3NEL A;  2BOS A;  3IFD A;  1X3G A;  1RJT A;  4XT3 B;  2MJ8 A;  1WTO A;  5IY0 A;  1YNX A;  1NAP A;  1YEZ A;  4O2D A;  1PFB A;  4JBW A;  3TP6 A;  4RG1 A;  2NN6 H;  5I4D A;  5M3F G;  2H4O A;  1PH4 A;  4MN3 A;  1NMF A;  1VCI A;  2VXW A;  4OO1 G;  4XYO A;  4DPG A;  4B3T Q;  2IX0 A;  1E2Z A;  4C3I H;  2UXC L;  3S1N B;  1IXR A;  1L0W A;  5M5X B;  5JEA H;  1I6H B;  4QIW B;  1UAP A;  4QB4 A;  1KLG D;  3FHW A;  5KIX A;  2R92 H;  5C5M A;  2PPB C;  1MIU A;  3LNN A;  4LUO A;  3FKI H;  4DV0 L;  4RH6 A;  4LFB Q;  1KHI A;  2EJM A;  3CPW A;  4R8N A;  3I2Z A;  4ODG A;  1ET6 A;  1X3F A;  2MUY A;  3KF8 A;  4XXE A;  3EVQ A;  3P75 A;  2EDG A;  4DNR B;  4A3M G;  4BBS B;  3CCQ A;  2RHQ B;  3S17 H;  3VA5 A;  3P7J A;  4R4Q A;  1PH9 A;  3T13 A;  3U4Z A;  3K5M A;  1IYJ B;  3OW7 A;  3DMU A;  3IFT A;  1N33 L;  1MJE A;  4BXX G;  4A3G G;  5E3F A;  1RD9 D;  3PUY A;  1IKM A;  4DV7 Q;  1HA6 A;  5C4J H;  3C2P A;  3C46 A;  1U4R A;  4A3D H;  5C3E H;  3AU7 A;  3J80 c;  4IFD J;  4F7X A;  4FO2 A;  4FF4 A;  3OOC A;  1S40 A;  4ZKC B;  3B6Y A;  1CHP D;  3NQI A;  2NBF A;  2L15 A;  2DUD A;  1D8L A;  5AJ3 Q;  5K5P A;  5M5W B;  1O80 A;  1Q81 C;  2EOT A;  1X56 A;  5D3I B;  5ELC A;  4AYB G;  4J8Q A;  1ROD A;  2N88 A;  3G4S A;  2P5Z X;  3AEV A;  2KOL A;  1NJI C;  3F2D A;  4IUV A;  4QCL A;  4A3I B;  1YI2 A;  2Q8T A;  5DM7 3;  4ZK9 B;  1G2T A;  1RTN A;  2O5I C;  2A6E C;  5I9P A;  1K3B C;  4DR6 Q;  3AQQ A;  3M4P A;  3S24 A;  3Q0A A;  2HHH Q;  2VS1 A;  4YWM A;  2ASB A;  2F4V Q;  1WTV A;  4RCN A;  1EU3 A;  3CCJ A;  1WTR A;  1XJV A;  2HQL A;  1I4X A;  1QB5 D;  3HOW B;  4ZUJ A;  1Z9F A;  1FNU A;  1SJH D;  4A3J H;  1Z6H A;  3BYY B;  4XQJ A;  3GTP H;  3G7L A;  5LMU L;  1TWG B;  1L0Y B;  1PFM A;  4JI0 Q;  4JI8 L;  2VL6 A;  1TWC H;  2B2U C;  1AN8 A;  2AMC B;  2FIN B;  2DJF C;  2NYZ D;  1N9W A;  5ELN A;  4WJW A;  5EJW A;  1VQD A;  1D6E C;  4DV2 L;  1S4Z A;  1EFW A;  3K5L A;  2LSS A;  1TWF H;  2FMM A;  5C0X G;  4DV3 Q;  4B3S Q;  4QL5 A;  4HCE A;  3CAM A;  3GTL H;  2XRS D;  3ND8 A;  1GXD C;  2UXB Q;  1PH2 A;  1PTO C;  4HIO A;  1A2U A;  1XNR L;  1Y8O B;  3GTO H;  4IOC A;  1HZC A;  2F0W A;  4HCS A;  4KD3 A;  2WFW A;  4GNX C;  4JI7 L;  2MGS A;  2R93 G;  3OMC A;  3OPO A;  2NZ1 D;  4GLV B;  1X32 A;  2RSO A;  1WD1 A;  4RAU C;  5K36 G;  3CW2 C;  4JI5 Q;  2JA6 H;  1H9S B;  1IBL L;  1B3Q A;  3OWF A;  4RGO S;  4DR2 L;  3RNU A;  3TP5 A;  4A3C G;  1UWV A;  5JVH 3;  3UDI A;  1RHP A;  2E5L Q;  1EUJ A;  1ICW A;  1JOO A;  2AWO A;  1A3U A;  1C48 A;  1WCM H;  3GTK H;  4C1N I;  4F87 A;  4ALP A;  4A3I G;  2R92 B;  2WKD A;  2LS0 1;  3OYY A;  3HOZ B;  3L7Z C;  4DU9 A;  2VZA A;  1U5K A;  4TVA B;  2Z9H A;  3FKI B;  1SYD A;  1AP0 A;  3ULL A;  4ID6 A;  2RDF A;  4E6I A;  4L6T B;  4LAA A;  4YCV A;  1F2Z A;  3STB C;  2BH2 A;  3DM3 A;  1JB3 A;  1PTO B;  3S17 B;  5CBE E;  3E9H A;  5KYI A;  3I4O A;  1PH6 A;  3HOW G;  4CJ0 B;  1CTM A;  4LFC L;  1G51 A;  1M8A A;  3TBI B;  5JEA J;  4GNX B;  2K14 A;  5C4J B;  2VQF L;  1EEF D;  4A3D B;  5C3E B;  2B2W C;  2F0M A;  3V2T A;  4IJL A;  1RTO A;  3X3M A;  5C44 G;  1KDA A;  2F0I A;  2VB2 X;  3E0J A;  3VR2 A;  3T1Y Q;  2OQ0 A;  2K05 A;  4HJA A;  1VQ6 A;  2XRQ D;  1N36 L;  1NR4 A;  3QWN A;  2OTL A;  2SNS A;  5AFW A;  1FVI A;  1W3S A;  1PZI D;  4F8M A;  4UPA A;  3M85 A;  3CCR A;  1QWY A;  2CW0 D;  3CQZ B;  1K28 A;  1YNN D;  3A56 A;  3H3V C;  2KVM A;  1Y1W H;  2D2C C;  1TS4 A;  1LM0 A;  4KY6 A;  3S15 B;  4WFN 3;  1PH8 A;  5IT9 c;  1F9P A;  5C3X A;  4L8J A;  1D5X C;  1PYS B;  5JOB A;  2JA7 B;  3BZD B;  2OCE A;  3ZJY C;  2ICE C;  3CC4 A;  3PSI A;  5GQO A;  3H91 A;  1T5E A;  3W2D A;  3GDE A;  5M3F H;  1HUN A;  4LFA Q;  3S2D H;  3CRK C;  1X3Q A;  4OO1 H;  2YYZ A;  1B4O A;  1GM5 A;  5JPN C;  1MSG A;  1B1Z A;  1I4P A;  3IRB A;  3RZO H;  2NVT H;  1E24 A;  3MTS A;  1SNP A;  3GV3 A;  4DR5 Q;  4HSV A;  2SOB A;  2A5H A;  5FLM G;  3VYR A;  3HOZ G;  1Y8P B;  4NDX A;  1A0I A;  4GKK Q;  3GTP B;  1VQM A;  1B3A A;  1STH A;  1TWC B;  4B9X A;  3D31 A;  4A3M H;  4X6A H;  4IZ8 A;  1PDQ A;  1YNJ D;  2VW9 A;  4NW2 A;  2JA5 G;  1KDC A;  3CKI B;  2NB0 A;  2PO4 A;  2OWO A;  5KEE A;  1TWF B;  3HKZ E;  4BXX H;  2D5D A;  4A3G H;  2X69 A;  4JI1 L;  5M3M B;  1TS2 A;  3U58 A;  1ASZ A;  4N9T A;  4MNO A;  4LF7 L;  3F2C A;  2EXZ A;  3TP7 A;  5BR8 L;  4U67 3;  3M9B A;  3GTO B;  5C3E G;  1HQM C;  1GJX A;  5C4Z A;  3PV0 A;  3DHQ A;  1J8I A;  5I9O A;  5IWA L;  4DR1 L;  4LK1 C;  2CKZ B;  3NQT A;  4G7Z C;  4PNY A;  3S1R H;  4IUP A;  5DEH A;  1PZK D;  2JN4 A;  3WOE A;  3HKZ B;  2D0P A;  1HZA A;  2Z0S A;  2FHT A;  4CDE C;  1SNC A;  2D0O A;  4AQY Q;  1GKH A;  1F77 A;  2B63 G;  3KYH C;  3E6Z X;  1QNK A;  5LL6 S;  3SK6 A;  5JVG 3;  1EQR A;  3OSO A;  2RCF A;  1WCM B;  1FNV A;  4JI4 L;  2B8G A;  3IKJ A;  2Z4I A;  4B3R L;  1KNE A;  2F0T A;  3M4O H;  2JA7 G;  1EYC A;  3MVV A;  2QIL A;  1T9H A;  2PW7 A;  2I46 A;  3L0O A;  4G57 A;  3SGI A;  2B2T A;  4DV5 L;  1HNW Q;  3HZX A;  1O78 A;  1DYQ A;  5IYC H;  2G5D A;  4BBR G;  5CV8 A;  2WV6 D;  3NBH A;  5FO8 B;  1XMO L;  2M2L A;  2K75 A;  4JG2 A;  4DK1 A;  1N8R C;  2Z1C A;  3L9A X;  1WD0 A;  1MSH A;  2IJ0 A;  4Z9C B;  1SAP A;  4DNT B;  3NE5 B;  2UXC Q;  1E2V A;  1TXY A;  1OTC A;  4HJ9 A;  1JIC A;  5E1F A;  4BA2 I;  2F1M A;  3R93 A;  1BCP D;  1Q8K A;  5GAG C;  2OF1 A;  4DV0 Q;  3FMC A;  3BG3 A;  3JAM E;  1PFS A;  3KBG A;  1U4M A;  2F0D A;  1WI5 A;  1W2B A;  2QGQ A;  3NWT A;  3OMG A;  1TY0 A;  4KKU A;  2ZXR A;  3T56 B;  4KJN A;  1HR0 L;  2I5L X;  1S5B D;  1NR2 A;  4DF7 A;  1KAB A;  3A5U A;  3R2T A;  5C0X H;  3BDL A;  2Q2U A;  3X3N A;  4EQP A;  1ENA A;  4A3K G;  2RBM A;  3KJO A;  1SNQ A;  3P20 A;  3H94 A;  2XGT A;  1N33 Q;  5J1Z A;  2EYH A;  5A2Q L;  5M3M G;  1PTO F;  3JAM i;  4XQN A;  4BY7 B;  2RCN A;  1XNQ L;  2F0L A;  3IL8 A;  3MXG A;  4DK6 C;  1HJP A;  3SHL A;  3KDF A;  3QG1 A;  2NUC A;  1LAB A;  3K57 A;  1Y1W B;  5ISR A;  4K14 A;  3RD4 A;  4EVO A;  2NVQ B;  1YZ6 A;  2J4X A;  2R93 H;  5LMN L;  2E75 C;  1IYU A;  1WTH A;  5K36 H;  5CV4 A;  1HZB A;  4RHR A;  3FVQ A;  3CF5 A;  2B2Y A;  2BA1 A;  1QZH A;  4PZ6 A;  1SMY C;  3J81 L;  3HKZ G;  1AZP A;  1PYB A;  1VQA A;  1XPR A;  5IE8 A;  4A3C H;  5M5W H;  3KF6 A;  4YY3 L;  1YHA A;  2RHS B;  5FO7 B;  3WDN A;  1JOQ A;  3T16 A;  3D8G A;  3J7A 5;  2OTJ A;  1SNO A;  3OIP A;  3FRP B;  2IWH A;  5D65 A;  2L4N A;  4MZ9 A;  3LWE A;  2B3G A;  2KED A;  3S9W A;  2R6G A;  4L5S A;  1EWC A;  1A3V A;  2AQ3 B;  1EQQ A;  1QIL A;  1SYB A;  4DR7 L;  2NWG A;  3T1H L;  3A8I E;  1STY A;  4DK3 C;  1VQP A;  4DR4 L;  3RZD B;  4APV A;  4EQO A;  1I94 L;  4B08 A;  2X6G A;  1SSO A;  1KAA A;  1XMQ L;  1FGB D;  2XVS A;  4RWS C;  2D62 A;  3HOW H;  1L1O C;  1WFQ A;  1R9T B;  2MP1 A;  4LJZ C;  4A3G B;  3ER0 A;  1ZYR D;  4OEM B;  4JI6 L;  5E4X A;  3CCL A;  3S1Q H;  2PQA A;  4Y7N B;  5LMU Q;  1HR0 W;  4KK7 A;  3I90 A;  4EX5 A;  1IW7 D;  2FMC A;  2XSC A;  1EZ8 A;  4N9P A;  4JI8 Q;  2K5Q A;  1K0R A;  2Q8I B;  2B8F A;  5C44 H;  3NHH A;  4DV2 Q;  3DEO A;  2ICI A;  3K7A B;  4JK1 C;  3KBX A;  3S1R B;  1VQF A;  1SNM A;  3U4V A;  1BNZ A;  1KAW A;  1HFG A;  4KN7 C;  5ELD A;  3U9O A;  4B3M Q;  1MGS A;  4BA1 I;  4X62 L;  3M4Q A;  1Q82 C;  4WOR A;  4BY7 G;  3J80 L;  1XNR Q;  4DV6 Q;  5LMN W;  1G6Z A;  4NXM L;  1I3Q H;  2IW3 A;  4A93 G;  4KKT A;  3RR5 A;  1YJW A;  4BS9 A;  4IFD I;  2QW7 A;  2K7V A;  3GP7 A;  4QUF A;  2RF4 A;  4JI7 Q;  2Z8L A;  1LTI D;  4B9W A;  1F9Q A;  4IO9 A;  5C0X I;  1STG A;  2K5N A;  3M4O B;  3MWY W;  2E2J B;  1DOL A;  2G9H D;  4OGQ C;  4OIK A;  1HXY D;  1S5E D;  1IBL Q;  1EIY B;  4LUV A;  2ALY B;  4DR2 Q;  1L1O B;  3PO3 B;  1KL9 A;  2FJ2 A;  1PRT C;  4K6L A;  4NKL A;  2ZJR A;  2E2H H;  1D1K A;  2E2I H;  3QOJ A;  2XN9 C;  4XYQ A;  4JOI A;  1ILQ A;  1JOR A;  1WYD A;  1X3E A;  1HQR D;  1SEB D;  5FLM H;  1V1O A;  3OWE B;  4KHV A;  3HOZ H;  2NTS A;  3BDC A;  5H1S E;  1EWH A;  3A54 A;  2HDL A;  3G6J B;  4P71 A;  4DUZ Q;  1XX8 A;  2JJQ A;  1VQO A;  3OW2 A;  3GTM H;  3K58 A;  1S3O A;  4WRD A;  1HNX L;  3W1G A;  1FR3 A;  3PF5 A;  3HGB A;  3R2I A;  2VUM B;  4P75 A;  2JA5 H;  1PTO H;  1GUG A;  1A15 A;  1EY7 A;  2ZTD A;  4FNF A;  2IHE A;  1YBY A;  1U0L A;  2F0U A;  3AFQ A;  2Q2H A;  1JE4 A;  4GS3 A;  4PMW A;  3T4A C;  5BN4 A;  2A19 A;  3W1B A;  3TP8 A;  4HMJ A;  3NEN A;  3DEP A;  3NTH A;  4FYD A;  3R3O A;  2PQE A;  3HEJ A;  3K59 A;  3ONA B;  3I4M B;  4KTA A;  3KLS X;  1E7Z A;  4LW1 A;  5JJL A;  2XNA C;  4C3J B;  1GUS A;  1VQE A;  2VQF Q;  3RN2 A;  3CHB D;  3ULJ A;  1WTQ A;  4A3L G;  3O13 A;  1EU4 A;  4FF1 A;  2QDL A;  3VR4 A;  3MEH A;  1YIT A;  3TS0 A;  1P16 A;  1V1P A;  2E2D C;  2R93 B;  1TQO A;  4DV1 Q;  1SYF A;  3I55 A;  1PRT B;  1LUZ A;  1ICF B;  4LWC A;  2NZO A;  3OTO L;  1N36 Q;  5C0X J;  5CYU A;  3I73 A;  1HRJ A;  1KTK A;  2EZV A;  2B63 H;  2KBN A;  1BUV T;  3CQZ H;  4DFA A;  4QY7 A;  1U9R A;  4TKO B;  3ICE A;  3S15 H;  3RLN A;  1RL2 A;  2F0E A;  3TN2 A;  1E22 A;  2EQS A;  2PYK A;  2JA7 H;  1LTT D;  1QCB D;  3FDT A;  4X3K A;  1H95 A;  4JPB W;  5COY A;  1DOM A;  2JA9 A;  3S14 H;  4BBR H;  2N55 A;  1G29 1;  3HOX G;  3ERS X;  1CSQ A;  2JEA I;  1JJC B;  5IYC G;  1CT1 D;  4PMB A;  3PO3 G;  1LTL A;  2K28 A;  3K81 C;  2PI2 E;  3F2U A;  4EQN A;  2L9H A;  1O7Z A;  2L55 A;  5DAU A;  2F03 A;  1RKN A;  1IL8 A;  4IUU A;  4X66 L;  2UXD Q;  3S1M H;  2HQE A;  4ZAI A;  3DUZ A;  4V19 0;  1M90 C;  2KHI A;  4IQZ A;  2UU9 L;  3I8Z A;  1HTP A;  3S1Q B;  4ULL A;  2Z4H A;  4L5T A;  3ERQ A;  1I4Q A;  2NN6 I;  5IGE A;  3HOV H;  4YWK A;  5C44 B;  2VUM G;  1NE3 A;  1JQY D;  2R61 A;  2ENB A;  2YTY A;  2GVB A;  3UI2 A;  4A3K H;  3H3V H;  5EBC A;  2A69 D;  5JAV A;  3J7A F;  4O42 A;  5M3M H;  1HCZ A;  4JI1 Q;  1M4V A;  1FGU A;  3I4M G;  1Q86 C;  1IKL A;  3JAM c;  2M00 A;  2F0G A;  1VF5 C;  4C3J G;  1Q12 A;  5BR8 Q;  4DV4 L;  4CDF C;  4JV5 L;  1R4P B;  1I3Q B;  1TY2 A;  3A7A B;  3L3O C;  5IOD A;  1VQN A;  4P73 A;  3K80 C;  1SLJ A;  1PXU A;  2PW5 A;  4CDC C;  4DR1 Q;  2OT2 A;  1I6V C;  1BOS A;  3RN5 A;  1M1K C;  1LO5 D;  2H5X A;  1Z7T A;  5HY6 A;  3UDX A;  1AW7 A;  1S5C D;  2A68 C;  2DN8 A;  2JXM B;  2ZM6 L;  2JQO A;  1KD1 C;  5IT9 L;  1DGS A;  4YWL A;  2E2H B;  1CQF A;  3LX0 A;  2E2I B;  4YCW A;  1QVG A;  1HZ9 A;  1IBK L;  2BH8 A;  2YV5 A;  1FYC A;  1STN A;  5LHY 1;  2MO1 A;  4JI3 Q;  4HIM A;  1FJG L;  1QOH A;  1SMX A;  2F0N A;  3F1Z A;  5EAY A;  4B3R Q;  3MXN A;  1SYE A;  4IPG A;  2I5M X;  2ZTE A;  1VQH A;  2UUC Q;  1ESR A;  4DV5 Q;  2K52 A;  1UE7 A;  4GOP A;  4RHS A;  3GTM B;  3DLL A;  4LF5 Q;  1VQ9 A;  2F0Q A;  3MXP A;  3TDQ A;  2E74 C;  2EXD A;  4V0B A;  2JA5 B;  2DY8 A;  1WVL A;  4BY1 B;  5HUR A;  4WJ3 M;  3Q22 A;  2I07 B;  1TWH H;  2VB3 X;  3DWP A;  2BE5 D;  1K8G A;  1TWA B;  3S2H H;  1G6P A;  1XTC D;  2E8G A;  2EE1 A;  4GZY C;  2HCC A;  3HRZ C; 
#chains in the Genus database with same CATH homology
 2EPB A;  4K5V A;  1Q90 A;  5EQ0 A;  1R4Q B;  5CC4 A;  5C3W A;  2DNC A;  1Q1B A;  4FP5 D;  2BCO A;  2F0K A;  2L11 A;  3S16 B;  1IYV A;  1HUM A;  2EJF C;  2BDO A;  2M9V A;  3TME A;  1F2L A;  2O4X A;  2B63 B;  1JWS D;  5KGU A;  2NTT A;  3J81 E;  2L0C A;  1ZEQ X;  1CZW A;  4DAY A;  2SNM A;  1OXT A;  1FNW A;  3QB3 A;  1MBY A;  1ZKO A;  2IL8 A;  3EJI A;  2EY2 A;  5F2D A;  5KND A;  1TKW B;  3T53 B;  4C2M B;  1TR5 A;  5C5L A;  1W6J A;  3S14 B;  4BBR B;  1PRT F;  1H9M A;  2GA4 B;  2RDG A;  3KUP A;  4HTH A;  2B2V A;  1HFN A;  4XT1 B;  3ITP A;  3A7L A;  3VR3 A;  4NP5 A;  1AZQ A;  3S1M B;  3P1H A;  3I72 A;  3NXW A;  2IPK D;  3NWS A;  3SXH A;  3A55 A;  3SEB A;  4NMZ A;  2AQ2 B;  3R8B A;  2PMZ B;  1DXM A;  2H1E A;  3QO2 A;  5ELE A;  1GHK A;  2A6H D;  3V96 A;  3GTQ B;  3HOV B;  1BQQ T;  4A3K B;  4KY5 A;  5FLX L;  2LY7 A;  1SJE D;  3W3A A;  3D4R A;  2EYM A;  1PLF A;  5J22 A;  3MXU A;  1EIG A;  1NUC A;  1CZG A;  1LTR D;  3E5S A;  5FKA C;  1OXV A;  2KCC A;  1OXU A;  4MIU A;  3ZYY X;  1EQV A;  1LV9 A;  1V1P B;  1C8C A;  4IUQ A;  2AUK A;  2A74 C;  1E0B A;  3KK7 A;  4HED A;  5BN5 A;  1BF4 A;  1JWM D;  2Y0S B;  3K5O A;  1T5X D;  2K33 A;  2HCI A;  2JSO A;  1WTW A;  4A3E B;  1TWH B;  2D9U A;  4RGT A;  3M7N A;  3GO5 A;  1H9J A;  3S2H B;  4KMU C;  4ZKB B;  5T1G A;  1RDP D;  1CA5 A;  2SDF A;  1A6X A;  1W6K A;  1TT2 A;  1LAC A;  5FOB B;  1L0X B;  2R7Z B;  1EOT A;  4OO1 I;  2O5J C;  5FO9 B;  3J7A V;  1EEI D;  2KA7 A;  3ERO A;  1RCV D;  5KNB A;  4DAV A;  1DJR D;  3KLR A;  5E4W C;  5M5Y B;  1SND A;  3FEW X;  3FPP A;  3NP8 A;  4QUC A;  4U68 A;  3GD7 A;  5ELB A;  4A93 B;  4O1N A;  5HGT A;  4QF4 A;  5G3L F;  4ZRZ A;  3AMU A;  3DM1 A;  1LT6 D;  2EYP A;  2A73 B;  2IX1 A;  2EVB A;  3VA7 A;  1H9S A;  4X3S A;  2A6E D;  3Q6S A;  4K8I A;  5JPM C;  3DWA A;  4HMI A;  4R8I A;  2NVX B;  4P2C B;  2KEE A;  3NSW A;  4CKB A;  4DGZ A;  4HAE A;  3J7Y W;  1H9K A;  1G2S A;  4FF2 A;  1CHQ D;  2CVR A;  2B2U A;  5DNF A;  2CW0 C;  1YNN C;  1SXT A;  3K5N A;  4Q5V A;  3NPP A;  4FXG C;  1NSN S;  4RFB A;  1WTP A;  4ZUI A;  5KYL A;  5CV6 A;  4G4K A;  1SYC A;  4IAL A;  4C1N K;  1ZXT A;  1TU2 B;  1B53 A;  2RVL A;  4UAI A;  4OL7 A;  3D3R A;  4PV1 C;  4FVM A;  1A2T A;  1EZ6 A;  4C3H G;  3MFG A;  1PTO D;  2AWN A;  4ABN A;  5D3D A;  4K8J A;  5FK9 C;  2F0S A;  1F2Y A;  1D2B A;  4ZQ3 A;  1KDB A;  1LTA D;  4C56 C;  5EPL A;  2E76 C;  5CR3 A;  3D4W A;  1D1I A;  4M8A A;  3NUC A;  5KRU A;  3MFY A;  2PNR C;  2LMC B;  2QCP X;  1YNJ C;  2MHV A;  3BDO A;  3DWQ A;  5IT9 E;  1B9M A;  1A3T A;  4TRD A;  4A3F B;  4DN4 M;  5EKI A;  3K0Y A;  1OXX K;  3A8J E;  1KNA A;  3FPU B;  2KUM A;  3HOX B;  3PO2 B;  3CRL C;  5BN3 A;  2ID0 A;  3Q24 A;  1PFN A;  3HS0 C;  1CI3 M;  2PZW A;  2B2W A;  5EKK A;  1LT3 D;  1GHJ A;  3K6O A;  4MHE A;  1HHV A;  1VF7 A;  3I4N B;  3BVZ A;  1QJO A;  5TSS A;  3CU7 A;  3GTG B;  1EYD A;  3AB9 A;  1EY9 A;  3PIP 3;  5D14 A;  2B39 A;  1B44 D;  4OIJ A;  2CHB D;  3RLF A;  2J0T D;  2JA8 B;  4CJ2 C;  1RF2 D;  2J7Z A;  2JP1 A;  5IIF A;  3RUZ A;  1I4R A;  2B2T C;  2LFN A;  2EYO A;  2CQA A;  3IAY A;  1CFM A;  1BCP C;  2QF7 A;  2L12 A;  1GUO A;  3JAM L;  3TZU A;  2V4D A;  3DXJ C;  2DNE A;  3Q23 A;  2KJX A;  1K8O A;  1S5D D;  2BDN A;  1TII D;  5CMD A;  1VMP A;  5NUC A;  2TSS A;  3HOU B;  3EA6 A;  1STA A;  1V8Q A;  2RDH A;  1CK1 A;  5C6A A;  1EY0 A;  3C1F A;  4J6H A;  3SR1 A;  2WII B;  1JR0 D;  4R9W A;  4XTC S;  2YU9 B;  4XQQ A;  3T51 B;  5A35 A;  4KKS A;  4TSS A;  1TVX A;  2KHS A;  4XDX A;  4FF3 A;  4HN7 A;  1EY8 A;  2HDM A;  3QJY A;  1BCP B;  3PMF A;  2B2Y C;  3VR5 A;  5FLX E;  1IHZ A;  1JOK A;  1HA5 A;  1SE4 A;  1SDF A;  5EPJ A;  1D5Z C;  1ILP A;  2PCF B;  4M1U B;  4Q0F A;  1GOZ A;  2RA4 A;  4YIJ A;  1DCZ A;  3M7G A;  3PUX A;  4DXF A;  4I65 A;  2JEB I;  1OO9 B;  3BS1 A;  3D6C A;  2X6L A;  4IFD G;  1ONL A;  3D4D A;  1EIH A;  2SEB D;  4RA8 A;  5EPK A;  3I70 A;  4DAP A;  1ZYR C;  1XXG A;  4F88 A;  2K1B A;  1Y1V B;  5I6W A;  2LKV A;  1IW7 C;  3H6M A;  4K5W A;  2KQ3 A;  2TMP A;  2JYO A;  4QMG A;  2RQX A;  3SVM A;  4KN4 C;  4DK0 A;  2EY5 A;  3C1E A;  3EQL C;  4IUR A;  3SE0 A;  1SE3 A;  5ELF A;  2VNU D;  3VYS A;  2AUJ D;  3M3Y B;  4CHT B;  3WOF A;  3PUW A;  1V43 A;  5JJZ A;  4RKL A;  5C4X B;  1PZJ D;  1LT5 D;  5EGT A;  3QIA A;  1I4G A;  1F9R A;  4C3I B;  1MI2 A;  3VR6 A;  4ZLT F;  1XYI A;  1WTX A;  5LL6 X;  4H44 C;  5J39 A;  3LWU A;  1O7Y A;  1Z47 A;  5CV5 A;  3TZD A;  1HPC A;  2F0O A;  1UNS A;  2NVY B;  3BVG A;  2WKC A;  4FXK C;  5A2Q E;  4KHZ A;  1DON A;  1DZ1 A;  1LTB D;  1C4Q A;  2K03 A;  2L5T A;  3OIQ A;  3U9S A;  4I7Z C;  4RGN A;  4EGV A;  1VMC A;  3NBI A;  3MAQ A;  4K2L A;  1SMY D;  1GUT A;  1KLU D;  5I2Y A;  1MD2 D;  3PIO 3;  2QKI C;  4HSP A;  2WAC A;  3D6W A;  1AEX A;  1ENC A;  1I4H A;  1JC7 A;  2PZT A;  3TSS A;  5IOC A;  4XIG S;  5CBA E;  2R3Z A;  2K5W A;  1STE A;  4ZYS A;  5IGF A;  2WIN B;  4RGM A;  1S5F D;  1Q3L A;  1CA6 A;  2RKS A;  1EFI D;  2KEC A;  1AFP A;  1GUN A;  2K32 A;  4KY7 A;  5CGK A;  4PQX A;  1U4P A;  1K8M A;  4K2K A;  4PMC A;  2MPM A;  1LLR D;  3SK4 A;  2F3V A;  3EFX D;  2NN6 G;  1LTS D;  1UUP A;  2HUG A;  2Q8R E;  4S3S A;  4DA2 A;  1EQT A;  4KV6 A;  1QNU A;  4KI0 A;  4C3I G;  5I6Y A;  3BYT B;  5KNC A;  3SDZ A;  5JEA G;  1JWU D;  3KLS A;  2XIW A;  2QDB A;  4K5X A;  1DD2 A;  4A3J B;  1H9R A;  3RMH A;  2OEO A;  4RCO A;  3I3C A;  3I4L A;  2K6A A;  3HG9 A;  2KCN A;  4CKE A;  5I2X A;  1BCP F;  4G7H C;  3J80 E;  3H09 A;  3ND9 A;  1EYA A;  2FFK B;  4K6D A;  3GTL B;  1PYW D;  2EYL A;  3GTJ B;  3SK8 A;  1Q1E A;  3OHX C;  1B2T A;  2K04 A;  2A69 C;  1J9O A;  1PRT D;  4J1M A;  1LT4 D;  3A8K E;  3QOL A;  3HP3 A;  4G7O C;  2JA6 B;  3VYT A;  4IUN A;  4HR7 B;  2IX3 A;  4ME5 A;  1BR9 A;  4FXD A;  1LTG D;  5T1I A;  1UEA B;  2ZT9 C;  3GTK B;  1F9S A;  1ET9 A;  1D5M C;  1B9N A;  4RKB A;  1O7L A;  3N6R A;  4C3H B;  2EY1 A;  4IUT A;  1SE2 A;  4OHJ A;  2EJG C;  3HOY B;  5C4H A;  3VYU A;  1ML0 D;  3PUZ A;  3GV6 A;  4BWG B;  3MZ5 A;  3M4Y A;  1VDZ A;  5EKL A;  3GQB A;  5IGC A;  1ESF A;  2PZU A;  1JCK B;  2WP8 J;  1CM9 A;  4IFD H;  2EY6 A;  1Y8N B;  5CV7 A;  1G91 A;  2C5C A;  2BE5 C;  1ENF A;  1FD7 D;  3NTK A;  4H13 C;  2F4I A;  1HTL D;  5EBD A;  1DOK A;  1BO0 A;  3MC0 B;  1G8Z D;  1NCV A;  2EYF A;  5CV9 A;  1BBX C;  5M9O A;  4X3U A;  3PUV A;  2XWJ B;  2IT1 A;  3NK9 A;  1BDO A;  3NTI A;  4H0L C;  1U4L A;  2F0F A;  2XWB B;  1F2M A;  1PMR A;  3BVM A;  1K83 B;  4CBV A;  1EY4 A;  2F0P A;  1SBB B;  2EYJ A;  3H0G B;  4L63 B;  3C3L A;  5M3F B;  1X3P A;  3S2D B;  1STB A;  4LMQ D;  3RZO B;  1OXS C;  2NVT B;  4ILW A;  1TS3 A;  1QE6 A;  2F3W A;  2QEJ C;  2G9D A;  3MHB A;  1TS5 A;  2WAQ B;  4DXG A;  5IGG A;  3N52 A;  2F0J A;  3V05 A;  2F0H A;  1I50 B;  4H7B A;  4A3B B;  2BA0 A;  3URY A;  4A3M B;  2ZXP A;  2K5D A;  4KJO A;  2K01 A;  4UDU C;  2WB1 B;  2OXP A;  5G3L D;  1Q8I A;  2B2V C;  1B50 A;  1SYG A;  3SK5 A;  2ZXO A;  4KD4 A;  2L1B A;  5IGD A;  1EY6 A;  1E2W A;  2A6H C;  2AQ1 B;  1DM0 B;  3I91 A;  5IGB A;  1GUW A;  2A68 D;  2C9O A;  3MA2 B;  1EL0 A;  4CJ1 B;  1II3 A;  1Y69 U;  2RSN A;  2JE6 I;  2DY7 A;  1EY5 A;  4CGY B;  4IN3 A;  2O2L D;  4CKC A;  4AYB B;  1BXT A;  1XWE A;  4TQU S;  2F0V A;  1SFO B;  1CQV A;  5DM6 3;  4X3T A;  5COR A;  1QG7 A;  2BOS A;  3IFD A;  1RJT A;  4XT3 B;  2MJ8 A;  1WTO A;  1NAP A;  1PFB A;  4JBW A;  3TP6 A;  2NN6 H;  5I4D A;  2H4O A;  4MN3 A;  1VCI A;  2VXW A;  4OO1 G;  4XYO A;  2IX0 A;  1E2Z A;  3S1N B;  5M5X B;  5JEA H;  1I6H B;  4QIW B;  1UAP A;  4QB4 A;  1KLG D;  5KIX A;  5C5M A;  2PPB C;  3LNN A;  4RH6 A;  2EJM A;  4R8N A;  4ODG A;  1ET6 A;  2MUY A;  3KF8 A;  4XXE A;  3EVQ A;  3P75 A;  2EDG A;  4DNR B;  4BBS B;  3VA5 A;  3P7J A;  3T13 A;  3K5M A;  3OW7 A;  3DMU A;  3IFT A;  5E3F A;  1RD9 D;  3PUY A;  1IKM A;  1HA6 A;  3C2P A;  3C46 A;  1U4R A;  3AU7 A;  4IFD J;  4F7X A;  4FO2 A;  4FF4 A;  3OOC A;  4ZKC B;  1CHP D;  3NQI A;  2NBF A;  5K5P A;  5M5W B;  1O80 A;  2EOT A;  5D3I B;  5ELC A;  4J8Q A;  1ROD A;  2N88 A;  2KOL A;  4IUV A;  4QCL A;  4A3I B;  2Q8T A;  5DM7 3;  4ZK9 B;  1G2T A;  1RTN A;  2O5I C;  2A6E C;  5I9P A;  3Q0A A;  1WTV A;  4RCN A;  1EU3 A;  1WTR A;  1I4X A;  1QB5 D;  3HOW B;  4ZUJ A;  1FNU A;  1SJH D;  1Z6H A;  3BYY B;  4XQJ A;  3G7L A;  1TWG B;  1L0Y B;  1PFM A;  2B2U C;  1AN8 A;  2FIN B;  2NYZ D;  4WJW A;  5EJW A;  1D6E C;  1S4Z A;  3K5L A;  2FMM A;  5C0X G;  4HCE A;  2XRS D;  3ND8 A;  1GXD C;  1PTO C;  1A2U A;  1Y8O B;  2F0W A;  4HCS A;  4KD3 A;  2MGS A;  3OMC A;  3OPO A;  2NZ1 D;  1X32 A;  2RSO A;  1WD1 A;  4RAU C;  5K36 G;  1H9S B;  3OWF A;  4RGO S;  3TP5 A;  5JVH 3;  1RHP A;  1ICW A;  1JOO A;  2AWO A;  1A3U A;  1C48 A;  4C1N I;  4F87 A;  2R92 B;  2WKD A;  2LS0 1;  3HOZ B;  3L7Z C;  4DU9 A;  3FKI B;  1SYD A;  1AP0 A;  4ID6 A;  2RDF A;  4E6I A;  4L6T B;  4LAA A;  1F2Z A;  1JB3 A;  1PTO B;  3S17 B;  5CBE E;  5KYI A;  4CJ0 B;  1CTM A;  1M8A A;  3TBI B;  5JEA J;  5C4J B;  1EEF D;  4A3D B;  5C3E B;  2B2W C;  2F0M A;  3V2T A;  1RTO A;  3X3M A;  1KDA A;  2F0I A;  2VB2 X;  3E0J A;  3VR2 A;  2K05 A;  2XRQ D;  1NR4 A;  3QWN A;  2SNS A;  5AFW A;  1PZI D;  4F8M A;  3M85 A;  1QWY A;  2CW0 D;  3CQZ B;  3H3V C;  1YNN D;  3A56 A;  2KVM A;  2D2C C;  1TS4 A;  4KY6 A;  3S15 B;  4WFN 3;  1F9P A;  5C3X A;  4L8J A;  1D5X C;  5JOB A;  2JA7 B;  3BZD B;  2ICE C;  3H91 A;  1T5E A;  3W2D A;  1HUN A;  3CRK C;  1X3Q A;  4OO1 H;  2YYZ A;  1B4O A;  5JPN C;  1MSG A;  1B1Z A;  1I4P A;  3MTS A;  1SNP A;  3GV3 A;  4HSV A;  2SOB A;  2A5H A;  3VYR A;  1Y8P B;  4NDX A;  3GTP B;  1B3A A;  1STH A;  1TWC B;  4B9X A;  3D31 A;  4IZ8 A;  1PDQ A;  1YNJ D;  4NW2 A;  1KDC A;  3CKI B;  2NB0 A;  2PO4 A;  5KEE A;  1TWF B;  2D5D A;  2X69 A;  5M3M B;  1TS2 A;  4N9T A;  2EXZ A;  3TP7 A;  4U67 3;  3GTO B;  1HQM C;  1GJX A;  5C4Z A;  3PV0 A;  3DHQ A;  1J8I A;  5I9O A;  4LK1 C;  3NQT A;  4G7Z C;  4PNY A;  4IUP A;  5DEH A;  1PZK D;  3WOE A;  3HKZ B;  2FHT A;  1SNC A;  1F77 A;  3E6Z X;  1QNK A;  5LL6 S;  3SK6 A;  5JVG 3;  3OSO A;  1WCM B;  1FNV A;  2B8G A;  3IKJ A;  2Z4I A;  1KNE A;  2F0T A;  1EYC A;  3MVV A;  2QIL A;  2PW7 A;  2I46 A;  4G57 A;  2B2T A;  3HZX A;  1O78 A;  1DYQ A;  5CV8 A;  2WV6 D;  3NBH A;  5FO8 B;  2M2L A;  4DK1 A;  2Z1C A;  3L9A X;  1WD0 A;  1MSH A;  2IJ0 A;  4Z9C B;  1SAP A;  4DNT B;  3NE5 B;  1E2V A;  1JIC A;  5E1F A;  4BA2 I;  2F1M A;  3R93 A;  1BCP D;  2OF1 A;  3FMC A;  3BG3 A;  3JAM E;  3KBG A;  1U4M A;  2F0D A;  3NWT A;  3OMG A;  1TY0 A;  4KKU A;  2ZXR A;  3T56 B;  4KJN A;  1S5B D;  1NR2 A;  4DF7 A;  1KAB A;  3R2T A;  5C0X H;  3BDL A;  3X3N A;  4EQP A;  1ENA A;  2RBM A;  1SNQ A;  3P20 A;  3H94 A;  5J1Z A;  2EYH A;  5A2Q L;  1PTO F;  4XQN A;  4BY7 B;  2F0L A;  3IL8 A;  3MXG A;  3SHL A;  3QG1 A;  2NUC A;  1LAB A;  3K57 A;  1Y1W B;  5ISR A;  4K14 A;  3RD4 A;  4EVO A;  2NVQ B;  2J4X A;  2E75 C;  1IYU A;  5K36 H;  5CV4 A;  4RHR A;  3FVQ A;  2B2Y A;  2BA1 A;  1SMY C;  3J81 L;  1AZP A;  5FO7 B;  3WDN A;  1JOQ A;  3T16 A;  3D8G A;  1SNO A;  3OIP A;  3FRP B;  2IWH A;  5D65 A;  2L4N A;  3LWE A;  2KED A;  3S9W A;  2R6G A;  1EWC A;  1A3V A;  2AQ3 B;  1QIL A;  1SYB A;  2NWG A;  3A8I E;  1STY A;  3RZD B;  4EQO A;  4B08 A;  2X6G A;  1SSO A;  1KAA A;  1FGB D;  2XVS A;  4RWS C;  2D62 A;  1R9T B;  2MP1 A;  4LJZ C;  4A3G B;  1ZYR D;  5E4X A;  4Y7N B;  4KK7 A;  3I90 A;  1IW7 D;  2FMC A;  2XSC A;  1EZ8 A;  4N9P A;  2K5Q A;  2Q8I B;  2B8F A;  3NHH A;  3DEO A;  2ICI A;  3K7A B;  4JK1 C;  3KBX A;  3S1R B;  1SNM A;  1BNZ A;  1HFG A;  4KN7 C;  5ELD A;  3U9O A;  1MGS A;  4BA1 I;  4WOR A;  3J80 L;  1G6Z A;  2IW3 A;  4KKT A;  4BS9 A;  4IFD I;  2K7V A;  3GP7 A;  4QUF A;  2Z8L A;  1LTI D;  4B9W A;  1F9Q A;  5C0X I;  1STG A;  3M4O B;  3MWY W;  2E2J B;  1DOL A;  2G9H D;  4OGQ C;  4OIK A;  1HXY D;  1S5E D;  3PO3 B;  2FJ2 A;  1PRT C;  4K6L A;  4NKL A;  1D1K A;  3QOJ A;  2XN9 C;  4XYQ A;  1ILQ A;  1JOR A;  1HQR D;  1SEB D;  1V1O A;  3OWE B;  4KHV A;  2NTS A;  3BDC A;  1EWH A;  3A54 A;  2HDL A;  3G6J B;  1XX8 A;  3K58 A;  4WRD A;  1FR3 A;  3HGB A;  3R2I A;  2VUM B;  1PTO H;  1GUG A;  1A15 A;  1EY7 A;  4FNF A;  3T4A C;  2F0U A;  4PMW A;  1JE4 A;  5BN4 A;  3TP8 A;  4HMJ A;  3DEP A;  3NTH A;  4FYD A;  3R3O A;  2PQE A;  3HEJ A;  3K59 A;  3ONA B;  3I4M B;  4KTA A;  3KLS X;  2XNA C;  4C3J B;  1GUS A;  3CHB D;  1WTQ A;  3O13 A;  1EU4 A;  4FF1 A;  3VR4 A;  3MEH A;  1V1P A;  2E2D C;  2R93 B;  1TQO A;  1SYF A;  1PRT B;  5C0X J;  5CYU A;  3I73 A;  1HRJ A;  1KTK A;  2EZV A;  1BUV T;  4DFA A;  1U9R A;  4TKO B;  2F0E A;  3TN2 A;  2PYK A;  1LTT D;  1QCB D;  3FDT A;  4X3K A;  5COY A;  1DOM A;  2N55 A;  1G29 1;  2JEA I;  1CT1 D;  4PMB A;  2K28 A;  3F2U A;  4EQN A;  2L9H A;  1O7Z A;  2L55 A;  5DAU A;  2F03 A;  1RKN A;  1IL8 A;  4IUU A;  2HQE A;  4ZAI A;  3DUZ A;  4V19 0;  4IQZ A;  3I8Z A;  1HTP A;  3S1Q B;  4ULL A;  2Z4H A;  3ERQ A;  1I4Q A;  2NN6 I;  5IGE A;  5C44 B;  1JQY D;  2R61 A;  2ENB A;  3UI2 A;  5EBC A;  2A69 D;  5JAV A;  3J7A F;  4O42 A;  1HCZ A;  1M4V A;  1IKL A;  2M00 A;  2F0G A;  1VF5 C;  4C3J G;  1Q12 A;  1R4P B;  1I3Q B;  1TY2 A;  3A7A B;  3L3O C;  5IOD A;  1PXU A;  2PW5 A;  2OT2 A;  1I6V C;  1BOS A;  1LO5 D;  1Z7T A;  1AW7 A;  1S5C D;  2A68 C;  2DN8 A;  2JXM B;  5IT9 L;  2E2H B;  1CQF A;  3LX0 A;  2E2I B;  1FYC A;  1STN A;  5LHY 1;  1QOH A;  2F0N A;  3MXN A;  1SYE A;  1ESR A;  4RHS A;  3GTM B;  2F0Q A;  3MXP A;  3TDQ A;  2E74 C;  4V0B A;  2JA5 B;  2DY8 A;  1WVL A;  4BY1 B;  5HUR A;  3Q22 A;  2I07 B;  2VB3 X;  3DWP A;  2BE5 D;  1TWA B;  1XTC D;  2EE1 A;  4GZY C;  2HCC A;  3HRZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...