4L63B

Apo form of ab5 holotoxin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
MTPQNITDLCNEYQNTMIYSLNKEIATYTESLAGKREMVIISFSNGATFQVEVPGSQHLESQKRPLERMKDTLRAAYFTGIKISKLCAWTNKSPNSIAAIELSNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ECXA
total genus 24
structure length 105
sequence length 105
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4l63B00
3MC0B 1FD7D 1SBBB 3MFGA 4ZYSA 1L0XB 1D5ZC 3DWAA 1LT5D 1LTID 1TS5A 1D5MC 3BYTB 2Z8LA 3KLSX 1EWCA 1LTBD 1XTCD 1LTAD 1V1PB 1KLUD 4RH6A 1RCVD 1S5CD 3V05A 4BWGB 1FNWA 3OWEB 1CT1D 1I4GA 2ICIA 1KLGD 5TSSA 4L6TB 1SE4A 1SEBD 1EEID 1BCPC 5FK9C 1V1PA 1LLRD 1AN8A 1LTSD 2RDGA 2J4XA 1TS2A 3EFXD 1V1OA 4RGMA 1L0YB 1HA5A 1B1ZA 5ELBA 3R8BA 1I4HA 1I4RA 3BZDB 2RDHA 1JWSD 4RCOA 3O13A 1CHQD 1PRTB 3BVMA 5I4DA 2IPKD 1S5ED 1CQVA 1PTOD 1SJED 1JR0D 1TY2A 2WV6D 3URYA 3W2DA 4DXGA 1T5XD 1DJRD 1RD9D 5ELCA 2NTSA 1PZID 1TS3A 1PZKD 2NTTA 4Z9CB 1GOZA 1UNSA 2QILA 4O1NA 4RGTA 1LTRD 1HQRD 3R2TA 1PTOC 1BCPF 2CHBD 1QILA 2R61A 5D3DA 1BCPB 1PRTC 4RFBA 4C56C 1D6EC 4K6LA 1LTTD 4DXFA 1B44D 1SJHD 1PTOF 1ESFA 1FGBD 2XRQD 1SE2A 5FKAC 4OHJA 4RHRA 1G8ZD 5D3IB 1S5BD 3BYYB 2AQ2B 3GP7A 3SEBA 1ENFA 4RHSA 2O2LD 1TS4A 2XNAC 1RDPD 2G9HD 1I4PA 2XRSD 4RGOS 1EU4A 1SE3A 1JWUD 1D5XC 1BCPD 1PTOH 1EEFD 1KTKA 3CHBD 1PTOB 1MD2D 1XXGA 2TSSA 1ET9A 3BVZA 1JQYD 1PRTD 1CK1A 1AW7A 4L63B 1UUPA 3TSSA 1LO5D 1ET6A 1FNVA 1PYWD 1BXTA 3DWQA 3DWPA 2SEBD 1LT3D 1JWMD 2IJ0A 3BVGA 1EFID 1CHPD 1HXYD 1EU3A 1M4VA 1STEA 4TSSA 2AQ3B 1FNUA 1S5FD 1SXTA 1LTGD 1JCKB 1LT4D 2XN9C 1I4XA 4UDUC 1I4QA 1F77A 1HTLD 3R2IA 1PRTF 1S5DD 3EA6A 4RGNA 5ELFA 1DYQA 1PZJD 5ELEA 1LT6D 1RF2D 1TY0A 2AQ1B 2QEJC 5ELDA
chains in the Genus database with same CATH superfamily
2Z4HA 3S1MB 1KRTA 4JG2A 1L0XB 2B29A 1AP0A 1JORA 2K1BA 4DFAA 1VQ7A 2ID0A 4B3RL 3K7UC 3S24A 3QB3A 2NVQB 3I3CA 1S5CD 1H9MA 5IT9c 1DCZA 2K14A 1X55A 2HCCA 4R4CA 3VR2A 1F9SA 4QQBX 3C1FA 3GTJH 5FK9C 1B4OA 3UDGA 1VQDA 1VQFA 4YWKA 4LFCQ 2EY1A 2K4KA 4A3LG 1GHKA 3OOCA 3HOVG 4A3DG 1I4HA 1IHZA 1WTWA 3G7LA 3KDFA 1S72A 3J7AF 3T1HQ 1V8QA 2PZUA 3HOYB 1PTOD 2ZXPA 3I4NH 3NTHA 1RD9D 2JA7B 4G4KA 3A55A 1TS3A 2L11A 3C3LA 2F0WA 2WB1B 1FL0A 4OX9L 2ZXRA 1VQ8A 2KBNA 1SYDA 2EJGC 4HIOA 1DZ1A 1KXLA 2A19A 3RR5A 2C35B 5FLXE 1WTHA 1CA5A 1FYCA 1GD7A 5FKAC 4CDCC 2JA5G 3HOWG 2ENBA 2AQ2B 4DNIA 4ZKCB 2A69D 2PMZB 5I2YA 2RKSA 5IIFA 2NN6H 3FMCA 1RDPD 1II3A 3D4WA 2F0GA 2G9HD 1SE3A 3I7FA 3T4AC 3GTKB 4F87A 2RVLA 2I0QA 3I4OA 4JOIA 4GZYC 1VMCA 4PZ6A 2DJFC 1PRTD 4WFN3 4QCLA 3HOXH 5IODA 1TR5A 1ET6A 4QY7A 3CPFA 4OO1I 4IURA 1HJPA 2ZM6L 4AIMA 4BY1H 1AZQA 1XNRQ 1E2WA 2DNCA 2Z9HA 4IN3A 1ICWA 3K0XA 3HZXA 1YI2A 1HR0L 2Z4IA 3TMEA 5JOBA 1XMOQ 5CV5A 5H1SE 4QGUA 4YWMA 2KHIA 3R2IA 1KAAA 3PSIA 1Z7TA 4JI3L 4UP9A 2B2UA 3G71A 4ZUIA 1ML0D 3TZUA 2M2LA 2PNRC 2Q2TA 3TN2A 1Q1EA 2C5CA 3I4LA 1NJIC 1Q3LA 4F8MA 4A3KB 1X3FA 1XTCD 4B3TL 1RIPA 4JI7L 4RH6A 1Y69U 3SXHA 3RLOA 5IGDA 1WCMB 3S2DH 1XMOL 5E4XA 5I9OA 4KTAA 5F2DA 1YJWA 4IPGA 3J81i 1SYEA 2RDGA 3NTKA 2I46A 4IPHA 4A3CG 2F03A 1ILQA 4K2KA 1B1ZA 1SMXA 2IX3A 3QOLA 5M5YH 3MWYW 4IJLA 4DUZL 1NAPA 4QUFA 4IJHA 4KD4A 4DF7A 2UUBQ 1B2TA 5IP7G 3K59A 2SOBA 1K8AC 2BE5C 3T53B 1MBYA 4CHTB 4X65Q 1AEXA 4Z9CB 3LNNA 2UU9L 1A3UA 5LMNL 5C0XJ 4DAYA 1C8CA 3J7AV 1VMPA 3DUZA 4EX5A 4A4IA 4A3EH 5C44G 2D2CC 3HKSA 3HOXB 5C3EB 4PMCA 1IW7D 3T16A 2F52A 3OMCA 1Y1VG 2JA8H 4ALPA 3FDTA 4R8NA 2SDFA 2UXDQ 5C4XH 4IFDG 2EY6A 1B70B 2EZVA 1U0LA 5GAHC 2E2IH 4KLKA 4C1NI 3A8JE 1EYDA 3K5LA 4JI6L 4NXNQ 1HRJA 1JWUD 1VQ6A 3SDZA 1D1KA 4HSPA 1Z47A 4YCWA 1SMYC 4F88A 2PW7A 5J39A 1JQYD 5JJLA 1OXVA 5IP9G 4LF7Q 1A2UA 1AW7A 4X64Q 1A3VA 5DM73 2R7ZH 2D0OA 2EJMA 1A2TA 3J80i 1F2ZA 4QIWB 3KBXA 3TZDA 1CHPD 1STEA 4NMZA 3UDFA 1FVIA 4A3MH 1QUQB 3QOJA 2B63B 3N6RA 1YEZA 1EY7A 2OWOA 1S5DD 2B8GA 4X66L 4KHVA 1X3EA 2JJQA 3RZOB 3N52A 2I5LX 1QB5D 1TQOA 3CMEA 2UUAQ 2BH2A 2VL6A 3MHBA 1ICFB 2R93H 1TWHB 5LMUQ 2K5WA 4GOPB 2KA7A 2PW5A 1CKMA 2KQ3A 3QIAA 4OL7A 2QA4A 1HNZL 3GTOB 1H95A 2K75A 3ERSX 3AU7A 5C5MA 1K83B 1ZYRD 2HT1A 3NE5B 4XYQA 5M3FH 3PIP3 1U9RA 2CQOA 3D6WA 2EY2A 1E0BA 2NZ1D 5FLXL 5LMNW 5EPLA 1RHPA 3QWNA 1HA5A 3ULPA 3EBEA 2BE5D 3PUWA 3CW2C 3R8BA 3ERQA 2PZTA 1DXMA 1EZ6A 1HCZA 4A3GH 2F0SA 3CC4A 1IBKQ 2B3GA 2KJXA 2YTXA 3RN5A 3VYTA 3GDEA 2MP1A 4DK6C 2ZTDA 2I07B 5C4XB 1T5XD 2A6EC 4G7ZC 2J7ZA 1G2TA 3M4OH 3CQZB 5D65A 3MEFA 4OIJA 3SK5A 2ALYB 2RF4A 5IYCH 4GNXA 3HG9A 1Q8KA 1HQRD 4C3IB 2R61A 2JA5B 1D6EC 3KF6A 1CM9A 2N8NA 4ZQ3A 2R92B 1VQPA 4GLXA 3QO2A 1EQQA 1G2SA 2NVXH 4R4OA 1E2ZA 3PO2H 1I4PA 3A8KE 2KHJA 4KN7C 1BCPD 3MXNB 1EEFD 4C3HH 1BF4A 1IBMQ 2VZAA 3HKZG 1DGSA 1T9HA 2RQXA 2EDGA 4LF7L 5C6AA 4HIDA 1HXYD 4NKLA 3OTOQ 2QDBA 1LTGD 3TREA 4A3FH 1PFSA 3BDCA 5EKLA 2KEDA 1B3AA 1I50B 4A3JH 3VA5A 3MZ5A 1CZWA 3U4ZA 1AH9A 5EPJA 4DUYQ 3L3OC 3CP0A 3T56B 1UAPA 5DLQE 4XQQA 2KCMA 1B3QA 3KJPA 3MC0B 1X54A 1K9MC 3T1YQ 1VQMA 3MXGA 4B3TQ 4ZYSA 3OW7A 4JI4L 3ICEA 4C3IG 1FR3A 1CKNA 4O0AA 2MGSA 5JPNC 1M8AA 1VS0A 5TSSA 2YU9H 4A3BB 5EAYA 5M3MG 5KRUA 1F9RA 1WTPA 2MHVA 1Y1WB 3I73A 2GA4B 3IAYA 4DUZQ 4BY7H 2VW9A 3ND8A 3KUPA 4FF1A 2B63G 1K8GA 4UHVA 4HIMA 1ESRA 3A5UA 3S1QB 2IPKD 2OQ0A 1CQVA 1W2BA 5FLMG 3HS0C 1IBKL 3K5OA 3GO5A 5JVG3 1OTCA 5KIXA 4R1JA 5IT9L 1SRUA 4LF5Q 2WACA 2PO4A 4A3IB 3I4MG 2B2YA 3OHXC 1PRTC 2VS1A 4DV0Q 2VB3X 1GJXA 4KKSA 1BR9A 5ELOA 1XMQL 1K3BC 4A3BG 3S14B 3E5SA 3RNUA 1KD1C 2HHHQ 5BN4A 3HOYG 4J15A 4A75A 5C0XG 3WOEA 1NMFA 3M3YB 1TU2B 1ENFA 3GTQB 3OIQA 4FYDA 4JBMA 2XNAC 1NNXA 2OF1A 2FMMA 2X6LA 2KHSA 5E3FA 2CH4W 3D6CA 4POFA 1I94Q 4HN7A 1VCIA 3JAME 3BVZA 3CCSA 1K73C 3U9SA 1KNAA 3PF4A 3F2DA 2F0EA 2EXZA 2FMCA 4HMJA 2R6GA 2ICEC 1QVFA 4K8JA 3B6YA 4KI0A 3PIOA 2L55A 1PFNA 5JJKA 3ULLA 2D62A 1WD0A 2BOSA 1KAWA 2KCTA 1C48A 1Q81C 3I90A 5A2QL 1NR4A 3Q22A 4IPCA 1EYCA 2SNSA 2LSSA 1RKNA 4UDUC 4CKCA 2AUKA 1GKHA 1STYA 4JI3Q 5K36G 1K8OA 1XPOA 2Q8TA 2EE1A 5JJZA 3UE1A 4J1MA 2XWJB 1Y8NB 5C3EG 3S2DB 3AYHB 1O7YA 4KY6A 4DN4M 1Y8PB 1PYSB 2L15A 1V1PB 3I55A 2H5XA 2IHFA 3A0JA 2R7ZB 2RDFA 1CTMA 5EBCA 4HR7B 4ZKBB 4RA8A 5EJWA 4A76A 4O42A 2PZWA 2J4XA 5I6WA 3TP8A 4FF4A 3DHQA 3NELA 2JA7H 4N8X1 2JSOA 4JI8L 4DR5L 4DR4L 1WJJA 5DEHA 4V0BA 4A3FB 1JWSD 1JE4A 1PRTB 3JAMi 4YWLA 3EVQA 1NY4A 4GKKL 3URYA 4DXGA 2FFKB 3S17B 4OWWB 5C3EH 3J80E 1VF7A 3KLSA 3M7NA 4P71A 1G51A 3K6OA 4O1NA 2BDNA 2F0NA 2PQAA 2CHBD 4CKEA 4POGA 1C4QA 2P5ZX 4MHEA 5K36H 1IBLL 2NZOA 3CCUA 1STBA 3GTMB 3VA7A 4DAYB 1VQAA 2XRQD 4K8IA 4NXML 4JYAQ 4IUPA 4LUOA 1FGUA 1JJCB 3W1GA 1HNWL 4R4IA 1R4PB 5LL6S 2K50A 2K04A 4DR7Q 2A73B 1KDBA 1OXUA 3PUZA 2XWBB 1EU4A 3NEMA 3M4OB 4CJ0B 4DR7L 1PTOH 1IZ6A 4A3JB 2E5LQ 1TWCB 2PQEA 2HDLA 2PYKA 4Q0FA 3KBGA 4FVMA 4LMQD 1ENCA 1AE3A 4A3EB 1KDCA 1UUPA 1SYBA 3CQZH 1YBYA 3D3RA 4FP5D 2YV5A 1JJ2A 2SEBD 1EY0A 4JC0A 1UE7A 3CCLA 2K5NA 4KY5A 3H3VI 2R3ZA 3HOYH 1HR0W 4JVZA 3Q6SA 3E0JA 5KEEA 4JPBW 3C2PA 1KL9A 4A3BH 4IUQA 3V2TA 4AQYL 3HOVB 4IFDJ 2E75C 4C2MH 4L5RC 2V4DA 1TKWB 2L0CA 3TRZA 2CWPA 3NSWA 1QUQA 5FO8B 2UUAL 2HQEA 3HOWB 1R4QB 3PCOB 3QR8A 2IWHA 3DLLA 1I6VC 5JAVA 1FD7D 1H9JA 1SBBB 3KK7A 1HNXL 4C3HB 4YY3Q 2Q2IA 2DUDA 1CZGA 4PMWA 1JB7A 1IKMA 3BJUA 5CMDA 1XX8A 1LTAD 2B2VC 4S3SA 3H6MA 5IT9E 2B63H 1I4GA 3W3AA 1EY5A 4BY7G 2WAQG 5J1ZA 1C0AA 4GOPA 1Y8OB 1PH3A 1EFWA 5CYUA 2KCNA 2F0OA 1TS2A 4YHHQ 4R4QA 4UY8C 3BZDB 1TWAH 3A7AB 1Q90A 4L5QA 3STBD 2N49A 5LMUL 3HOZG 4LW1A 4XQNA 3GTOH 4G7OC 1SNQA 2RSOA 3M4YA 4DV7Q 1J9OA 1PH4A 3JAML 1UNSA 1U4LA 3KYHC 3MXPA 4RGTA 1SNCA 1QILA 3F1ZA 4HJAA 1X32A 4K6LA 1UE6A 2A6HD 1DONA 3GTGH 1F2YA 1PTOF 1ESFA 1QZGA 1QVCA 1SE2A 3A5ZB 3M4PA 3T13A 1SNPA 3WOFA 4KN4C 3PO3B 3KF6B 1PDQA 4OX9Q 2F1MA 4BA2I 2O2LD 1JT8A 3LX0A 2OTJA 4OO1H 4R9WA 5IGGA 4ZLTF 2XRSD 4PNYA 1EY4A 2N88A 4JCVE 1XYIA 3H0GB 4JI6Q 4C3HG 1J6QA 4FXKC 5CV6A 3GV6A 3SGIA 2B2VA 3DWQA 3MXNA 5C4JH 5A2QE 4FDBA 2ZJQA 1PVOA 4XDXA 1XWEA 3F2BA 1SNOA 1I3QB 4JI4Q 3G48A 3I2ZA 2EXDA 1OO9B 1VQ9A 4DA2A 3MA2B 2F0PA 1WCMG 1K3RA 4HSVA 1I4QA 4LFBL 4H0LC 3FEWX 1RTNA 1T5EA 5IYCG 2QEJC 3TS2A 4NDXA 5ELDA 4JV5L 1H9SA 2ZXOA 4JI1L 1BO0A 3GTPH 1YHQA 1HH2P 3T51B 2ES2A 4GN3B 2Z8LA 1LYLA 4LUZA 3D4RA 3OWEB 2GN5A 2KOLA 5L37A 2F0VA 1CKNB 1J5EL 5C3WA 2Q2HA 4JI8Q 4DR5Q 4X3UA 4DR6Q 2MJ8A 1HNWQ 3EFXD 2ZTEA 2F4VQ 5M3FG 3IFDA 1ENAA 1X6OA 3D4DA 3CAMA 2F0JA 1I4RA 3JC66 3KLRA 2F4VL 2E2JB 3O13A 3X3NA 1L1OC 4QMGA 1WTOA 5IYDH 4FXDA 2E5LL 2EPBA 3J80L 2UUCL 4FF3A 4X65L 1TY2A 1QNKA 2Q2UA 4X3TA 4APVA 5E7NA 1LUZA 2A6HC 1IXRA 1S3OA 2K32A 2K33A 1D2BA 1A62A 1LTRD 2CVRA 2WAQE 3S2HB 1HFNA 1CQFA 2H4OA 3MVVA 1S40A 1BCPB 2AUJD 1SSOA 4GLAC 2HHHL 5M9OA 2F0HA 4HJ8A 5IGEA 2UUCQ 1RTOA 3K5MA 5C0XI 2LS01 3BYYB 3PGZA 4DR3L 3J80c 1VQCA 2CKZB 1ZXTA 2LY7A 4DV4Q 2R7ZG 4XYOA 5CR3A 4GKJQ 5IP9H 1PMRA 2YTYA 2IX0A 4J8QA 5IYDG 3AB9A 2VQFQ 4IFDI 1U5KA 2ATWA 3BDOA 4H02A 3CCMA 5ELNA 1LO5D 4P2CB 1TWGB 4JK1C 5CBEE 4XQJA 4Q5VA 4FF2A 4K5VA 5C4XG 3DM3A 1DOLA 4LJZC 3U58A 2HCIA 2ASBA 5J22A 1Y1VH 2CFMA 5C3XA 1STAA 2UXCQ 2A1AA 4LFAL 3J7YW 3HEJA 3PQIA 4CBVA 5JEAJ 3VDYA 2DY8A 4KK7A 2Y0SB 4Y52H 4B3ML 4TVAB 1PXUA 2YU9B 2EQSA 1VDZA 3CCQA 1YJ9A 4JI5Q 1HUMA 1UEAB 4K0KL 4DV1L 1PH7A 1EWCA 1Z6HA 3Q8DA 2B2UC 5FO7B 2WIIB 3V05A 2IY5B 1FNWA 1WCMH 3TQYA 4LFAQ 3RLFA 2ICIA 3K5NA 4DNTB 4H7BA 3H09A 1BCPC 4A3CH 1W6KA 3KLWA 3CCVA 1V1PA 4R8IA 4NP5A 1O7LA 5AFWA 1KRSA 3X3MA 4YCUA 1HZAA 1ONLA 5ELBA 4M1UB 2WFWA 1F2LA 1N33L 2LXKA 2X69A 1E1TA 2EYPA 2ZM6Q 1VQBA 1IBML 1BQQT 4N9TA 3NHHA 3NUCA 3NENA 4OO1G 3GTMH 1PZID 1SYGA 1STGA 4CKBA 1X3QA 4X6AH 1GOZA 3NK9A 3NWTA 3KFUA 1WVLA 4EQPA 3S9WA 3BS1A 3PUVA 1BCPF 1SROA 2OEOA 1H9RA 4HAEA 5JJIA 2FINB 4B08A 4WRDA 4OHJA 2PQAB 2GVAA 4MTKA 4GOPC 2K03A 2EJFC 1P16A 2F0QA 4EGVA 4NPSA 4PG3A 4RHSA 3J81E 1Y1VB 1HA6A 4LF9Q 1HR0Q 3S17H 1ZYRC 3E9IA 4AH6A 5C44B 3HOXG 5GADC 2HUGA 4BY1B 1L0WA 5AJ3L 1GM5A 4XTCS 3HOZH 1AFPA 3NQTA 1EWHA 2F0TA 3PF5A 4UPAA 5CV9A 4DU9A 2ZJRA 1SFOH 2NN6G 4WJ3M 3E0EA 4F7XA 1YVCA 3H3VC 1FJGQ 1M4VA 2F3IA 4KV6A 2NVTH 3NXWA 4X62Q 1KC8C 1PH6A 2UU9Q 1HUNA 4B3SQ 4X62L 4HJ5A 1VF5C 1TWCH 4ILWA 1YITA 5BN5A 3FRPB 5G3LD 5KNCA 4LF6L 2B2TC 1NR2A 1SNDA 3FHWA 4OXPA 2K05A 4CDFC 3EROA 2NYZD 3I4NG 3WWVA 1LTID 1TIID 1D5MC 3I56A 1LTBD 1V1QA 3S1RB 4BWGB 1EUJA 5I9PA 1NUCA 4OONA 3HOVH 1YHBA 4LF6Q 4LNQA 3HOUB 5IGFA 4OWXB 1K8MA 3WDNA 1C9OA 4JI2Q 4NB3A 1JC7A 4U68A 1PFBA 4YY3L 1EQRA 4A3GB 2RHQB 3S1NH 1SJED 1MSHA 2K7VA 2N3SA 1Q82C 1EIGA 1QVGA 1E7ZA 2JA6G 1O7ZA 2XVSA 2I5HA 3S15B 4DPGA 2RBMA 1ASYA 2MFIA 4ME5A 3DXJC 3H3VH 1PTOC 2HIVA 1RL2A 5D3DA 3HGBA 1K83H 3IFTA 1F9PA 5EKIA 4L5TA 3C46A 5IYBH 2L5TA 3VR4A 1WYDA 2NWGA 2CWAA 1B50A 2WKDA 2FJ2A 3CCEA 3H91A 2NVTB 1VQGA 2XTIA 3TBIB 1SE8A 1O80A 4JBWA 4DV0L 2C9OA 3BU2A 3CXCA 3S1QH 1QZHA 1IYJB 1IKLA 3EN2A 4TKOB 3GTLH 3RN2A 2LXJA 3V96A 2WB1G 4HIKA 1EWIA 4X3KA 1BXTA 3BZCA 2JA7G 4C2MB 3NWSA 1W3SA 2KUMA 5J3BA 3J81j 4EQOA 5T1IA 4PQXA 3DEOA 4UAIA 1STHA 4IUNA 1N33Q 4KJNA 4ZK9B 4B9XA 1V43A 4RCNA 4N9PA 2EYOA 1SYCA 4B9WA 1ILPA 1RJTA 3I72A 1D5ZC 2N78A 4IALA 4IPDA 3QG1A 2E76C 3VR6A 2L1BA 1ZKOA 4QL5A 1H9SB 3TP6A 3M9BA 3UI2A 2WP8J 1GUWA 1A8VA 1MKHA 2KEEA 4BBRB 4DK0A 2JP1A 1I5FA 2PNHA 2UXBQ 1LTSD 1TT2A 2ZTCA 1LM0A 1Y14B 1MHWC 1QE6A 1MSGA 1VQJA 4MNOA 2A6ED 2Y0SE 3CKIB 3A56A 2RDHA 1DOMA 1UE5A 3CF5A 1WTRA 1KABA 5ISRA 2AMCB 2BH8A 2NVYB 3PMFA 4KY7A 5IWAL 3J7A5 2OT2A 5D14A 2F3VA 1CSQA 1E3PA 1YJNA 2DGYA 5C0XH 3GTLB 5DNFA 4C56C 3G4SA 4IO9A 1VQ5A 1CI3M 4NXMQ 2EYFA 1E2VA 1BBUA 1X3GA 3C1EA 4JYAL 3HKZB 3MFYA 1G291 4DXFA 1VQKA 2FXQA 4DR3Q 2G9DA 2CW0C 3I4MH 3M3YH 5M5XB 3DM1A 3GP7A 5GQOA 1GXDC 2F0FA 2K28A 1TS4A 5C4JB 2WB1E 4XXEA 5CV8A 4A3KG 5FLMH 1ZEQX 2EVBA 2LFNA 4U673 2JA8B 2Q8RE 4DAVA 1XXGA 1WI5A 4AYBG 2DJGC 3GQBA 2L4NA 5K5PA 4X66Q 1I50H 1IYVA 4HEDA 3E3XA 1B8AA 3EQLC 1UWVA 5M3MH 3S14H 4KHZA 4DV4L 2EYLA 1I4XA 1AZPA 1TWHH 3RMHA 1HHVA 5FLXc 1YHAA 5CV7A 2RSNA 1SNMA 4C3IH 4H44C 3H15A 2PCFB 3I70A 2JA6B 1SDFA 3KF8A 1MIUA 1EIFA 3CCJA 3Q24A 1VQLA 3NQIA 4IUVA 1N34Q 1A63A 1YNXA 3P1HA 4A3JG 5HGQA 1A6XA 1N34L 2OCEA 3PO3H 4A3FG 2LMCB 4IOAA 1LTLA 2D0PA 1CT1D 1QOHA 1EYGA 1MGSA 3OW2A 1SE4A 3OWFA 5CGKA 3S15H 1BNZA 1GUOA 1LLRD 1AN8A 4C3JG 2K5QA 1PA6A 4LF8Q 5GAEC 4RG1A 1MJEA 3PUYA 1F9QA 4YIJA 1N9WA 1KQSA 1YNND 5EKKA 1XJVA 4HTHA 5M5WH 3SR1A 4L8JA 1BKBA 1JR0D 3I4NB 1I3QH 1E22A 1PV4A 3PO2G 1EL0A 4CJ2C 1WTQA 3L0OA 2JK8A 1WTXA 2NB0A 2CW0D 5FJ8H 1DM0B 2FHTA 2IX1A 2JEAI 4KKTA 2E2DC 1Q12A 3RLNA 3M85A 3ZJYC 2XGTA 4PV1C 4DGZA 3RZOH 1YZ6A 4ZRZA 1FGBD 4RKLA 2Y0SG 1MI2A 1B9MA 3HOZB 2UXDL 3NBHA 4IZ8A 4P72A 4GS3A 5EGTA 3VYSA 5LHY1 5JEAG 2H1EA 4JI7Q 3RUZA 1PLFA 5HURA 5LMNQ 2R92H 1VQOA 2TSSA 4DK1A 3KOJA 4A3GG 4H13C 1B53A 1TWFH 2F0LA 5IOCA 4CGYB 1C7YA 1N36Q 1FJGL 1LT3D 3HRZC 2B2WA 1D8LA 1Z9FA 4DV2L 2RCFA 3ONAB 4JV5Q 3OIPA 5A35A 1S5FD 5I2XA 3FP9A 1SLJA 4FNFA 2JXMB 2O5JC 2DNEA 4V190 5COYA 4A3IG 2NUCA 2WKCA 4K14A 2DN8A 2MO1A 2R93G 4WJ4A 3DMUA 2JN4A 3ZYYX 5LL6X 2E2HB 4GKJL 3IL8A 3K57A 3MFGA 1ASZA 4DR6L 4LUVA 3DWAA 4B3MQ 3HOUH 1VQHA 4JBJA 3KLSX 4DUYL 2BA1A 3S16B 4CJ1B 2RCNA 3AFQA 1P8LA 2QGQA 2B39A 4MZ9A 4A3MG 4DR1L 1AE2A 3PO2B 1X3PA 2NN6I 1YNNC 1BUVT 5EPKA 5M3MB 3EIVA 4GN4B 4RAUC 4P74A 4HMIA 5G3LF 5CC4A 1PH5A 2IW3A 1R9TH 4RCOA 1N32L 4XT3B 1TWGH 5I6YA 4ME3A 5I4DA 2UXBL 3GTKH 4C3JB 4LF4L 3RZDH 3S1RH 2D9UA 2WV6D 4XIGS 5ELCA 4JI5L 4TRDA 4GKKQ 4IFDH 1M1KC 1Q86C 4MN3A 3GTQH 3R2TA 3Q23A 3I8ZA 2JA8G 4RFBA 1RODA 1M90C 2K6AA 5C44H 1JOKA 4A3EG 1EQVA 4JI0Q 3D8GA 4LF5L 1SN8A 1GUGA 1VQNA 1EIYB 1TWAB 4BBSB 5IP7H 1D5XC 3HKZE 3CHBD 2R93B 3AQQA 1QJOA 5M5WB 1DD2A 1GUNA 1MD2D 2OXPA 2HD3A 2O4XA 1O7IA 3H0GH 4CDEC 4JBKA 3A54A 4DNRB 3TSSA 4WJWA 2EYHA 1F2MA 3DWPA 2KCCA 2RHSB 2L12A 4HJ9A 3PIPA 1L2FA 1TVXA 5IGCA 1EFID 4JI0L 3VR3A 1HTPA 1HFGA 1LABA 5C5LA 3GTGB 2XN9C 3FVQA 3FKIG 1PH8A 4PMBA 4N8FA 3K7AH 4K0KQ 1PRTF 2E74C 2YYZA 2ZJPA 5EBDA 1X9NA 3M4QA 1DYQA 1PZJD 1L1OB 1LT6D 1RF2D 4ZAIA 2AQ1B 2PPBC 1G6ZA 4BBRH 1IL8A 3BYTB 1XPUA 2AKWB 2LKVA 3J81L 4O2DA 3CPWA 3RZDB 4ID6A 3I91A 4LFBQ 2QW7A 1Q8IA 3DEPA 1DOKA 2YTVA 4QF4A 2EYMA 5HY6A 1YIJA 2A8VA 1PH9A 1U4MA 4XT1B 4BY1G 2F0IA 4RGMA 4B3SL 3T1HL 2E2JH 4K5WA 1SYFA 2WINB 1UEBA 1TXYA 4LWCA 4DV3L 2G5DA 4BBRG 2CQAA 1GUTA 3L2PA 3QJYA 4WORA 2VXWA 2KENA 2XIWA 5CBAE 1Q46A 1BOSA 1YNJD 1J8IA 4GNXC 2HIXA 1XNQL 3I4MB 1SR3A 3CC2A 1HPCA 3FPUB 4IQZA 3HOWH 4CDDC 2JA5H 4DK3C 1A15A 2K01A 3FKIH 3PV0A 1E1OA 1CKOA 1GVPA 4RHRA 1G8ZD 2HDMA 5D3IB 4QUCA 3TEHB 1S5BD 3E6ZX 3BZKA 4DV3Q 2NVXB 2BA0A 3W5OA 2Z6KA 2SNMA 3NBIA 5IY0A 4EQNA 3H0GG 1NMGA 4DV5Q 1V9PA 5KYIA 3R3OA 3D0FA 3MXUA 5JVH3 4A3DH 4KHPL 4JI1Q 3D31A 4A3LH 1NBWA 2MQHA 1VQIA 4K5XA 1JWMD 1VQ4A 2CCZA 4BS9A 5AJ3Q 3S1NB 4TSSA 4RKBA 4A93B 2AQ3B 1LV9A 1JCKB 1K0SA 2F0UA 1EOTA 2AHOB 1HNZQ 1EYAA 1OXTA 2O5IC 5DM63 2E8GA 5FOBB 1TY0A 1BBXC 2B8FA 1EY9A 4KKUA 1KHIA 3F8TA 2QEXA 2MNAA 4DV1Q 1GHJA 3TS0A 2VQEQ 1XMQQ 3CMAA 4ZUJA 1PHJA 5CV4A 1Q1BA 1TWFB 3SK4A 1KLUD 3KF8B 2AWOA 1RCVD 2JYOA 2L9HA 3UE0A 1U4PA 1NTGA 5C4HA 4OELB 3OMGA 1Y1WH 4I7ZC 1X56A 1KIXA 3KDFB 4FO2A 1J5EQ 1SMYD 4OGQC 2EIFA 4JW0A 1L0YB 3A8IE 3P7JA 1I94L 4DV7L 2E2HH 2QCPX 3HFZB 3KJOA 2NZHA 2UUBL 5BN3A 3OYYA 1GO3E 4AYBB 2VUMH 4Y7NH 4BXXH 3BDLA 4ODGA 3HOUG 1QCBD 3S16H 3CU7A 1DJRD 1CSPA 3SVMA 2NTSA 1EQTA 4YHHL 2NTTA 1EY6A 3L9AX 3STBC 4I7AA 2AWNA 5M5XH 4UP8A 4K6DA 4A3IH 3UDIA 2M00A 1EIHA 4G7HC 4LF8L 1MJCA 3LWEA 4BBSG 1B9NA 1B44D 1SJHD 3F2UA 3MEHA 2I5MX 4G57A 1N8RC 3EJIA 2Z6KC 1R9TB 2KECA 2K5VA 2TMPA 1QWYA 2UXCL 1JOOA 4RGOS 1D1IA 3NBHB 3S1MH 1I6HB 1CFMA 2JQOA 2IT1A 2R92G 1ET9A 4OWTB 1Q7YC 1BVSA 4X3SA 4HJ7A 5JEAH 1FNVA 1PYWD 4M8AA 1KDAA 2A68D 4L5SA 3IKJA 1B7YB 2K52A 3K8AA 2VNUD 2BCOA 2OQKA 1PFMA 1BDOA 2MUYA 2A69C 2NVYH 3NTIA 4JOIC 1X65A 5C4ZA 1CA6A 1FNUA 2F0MA 4A93G 2F4IA 3T1YL 4EVOA 3SHLA 3L7ZC 3CC7A 3EA6A 1WOCA 4RGNA 2K5HA 5FJ8G 4BA1I 1HQMC 3M7GA 5ELEA 1NSNS 3GD7A 3R93A 3OTOL 2N55A 4IOCA 3CRLC 3MAQA 4LF9L 5KGUA 1LT5D 3CD6A 4DKAC 1KNEA 1PYBA 5IGBA 4NXNL 2PI2E 4DR2Q 3AEVA 2JA9A 3A74A 4DR1Q 4HCSA 2KVMA 4LAAA 4L6TB 4KD3A 3LGJA 1EEID 3K0YA 4RMFA 4C3JH 1SAPA 3U50C 3TP7A 3U4VA 2DY7A 2X6GA 2CH4A 2HQLA 1QG7A 4PZ8A 4NW2A 1D7QA 3PO3G 4E6IA 4DAMA 2F3WA 2NVQH 4IUUA 2M9VA 2NBFA 4DV6L 1XNQQ 4C1NK 4QB4A 2VY3A 5HGTA 1PZKD 4DV2Q 3ULJA 1NCVA 4QIWE 4AQYQ 4P73A 1G6PA 2A5HA 5BR8Q 3F2CA 3CCRA 4A3DB 1LTTD 4IUTA 1JMCA 3ER0A 4K2LA 2B2WC 1JE5A 2Q8IB 3GTPB 2RA4A 4LFCL 2VQFL 1K28A 1JJGA 2EYJA 4RWSC 2B2TA 4DAPA 2XSCA 4TQUS 3S2HH 3MTSA 4I65A 5E1FA 2J0TD 4LK1C 4GLVB 2A74C 4KMUC 4AYBE 4DV5L 2VUMB 4KJOA 1KTKA 1PTOB 1CUKA 2VQEL 3W1BA 5KNBA 4B3RQ 2WAQB 4A3KH 1CK1A 3NPPA 3A7LA 5BR8L 3U9OA 2Z0SA 4JI2L 2BDOA 3AFPA 3K7AB 4X64L 3BVGA 5GAGC 3GTJB 3SK8A 5FO9B 1EU3A 3H94A 3FKIB 2OTLA 1NE3A 2JE6I 4HCEA 1SXTA 1HZBA 1LT4D 1STNA 4UP7A 5NUCA 5M5YB 4DV6Q 1HTLD 3J7ZC 3PUXA 1E24A 5ELFA 1PH2A 4MIUA 3GV3A 1GUSA 1WD1A 1EY8A 1S4ZA 2EY5A 3OPOA 2PI2A 1I6HH 4FXGC 1JOQA 3FPPA 1IYUA 1OXXK 2Z1CA 1L1OA 1TS5A 2D5DA 3RD4A 3OSOA 3PIO3 3ITPA 3AMUA 1G91A 1K0RA 4A93H 5KNDA 1KLGD 5KYLA 3E9HA 1XPRA 1YNJC 5JPMC 1SEBD 3ND9A 1IL2A 3SE0A 1QNUA 2VB2X 1V1OA 2R7DA 1EOVA 4YCVA 2QDLA 5CORA 2E2IB 1W6JA 1CHQD 5M3FB 1JICA 3BVMA 4J6HA 1A0IA 1WFQA 1S5ED 3VYRA 1N32Q 4GNXB 3LWUA 2IHEA 3W2DA 5EQ0A 1WTVA 3SK6A 2Z6BA 3TDQA 2QILA 2R7FA 1HZCA 2GVBA 4MTNA 2F0KA 4OIKA 1PH1A 3JAMc 3TP5A 3NP8A 3P20A 5IE8A 4QJFA 4BBSH 1XTDA 1EZ8A 5GROA 3VR5A 1O78A 5DAUA 5IWAQ 2JEBI 1H9KA 3SEBA 2MO0A 1JB3A 4A3MB 3K81C 3K80C 1IBLQ 1N36L 1A3TA 2IL8A 1SFOB 2A68C 2K5DA 4Y7NB 1IW7C 4OEMB 4R4TA 4LF4Q 2PMZE 3G6EA 3HP3A 3G6JB 5T1GA 2B2YC 4BXXG 2VUMG 3P75A 1VQEA 3UDXA 4KHPQ 4ABNA 1XNRL 4PZ7A 4L63B 4P75A 1UE1A 3K58A 2QF7A 2EOTA 2IJ0A 3Q0AA 3J81c 5E4WC 1Y1WG 1HNXQ 4ULLA 4EQ5A 5IYBG 4ZCKA 4DR4Q 1BBWA 2QKIC 3BG3A 3VYUA 3IRBA 1F77A 2V1CC 4DR2L 2F0DA 1U4RA 1OXSC 1LACA 4GN5A 2MPMA 2JA6H 3CRKC 1HZ9A 2ZT9C 4BY7B
chains in the Genus database with same CATH topology
2Z4HA 3S1MB 1L0XB 1AP0A 1JORA 2K1BA 4DFAA 2ID0A 3QB3A 2NVQB 3I3CA 1S5CD 1H9MA 1DCZA 2HCCA 3VR2A 1F9SA 3C1FA 5FK9C 1B4OA 2EY1A 1GHKA 3OOCA 1I4HA 1IHZA 1WTWA 3G7LA 3J7AF 1V8QA 2PZUA 3HOYB 1PTOD 2ZXPA 3NTHA 1RD9D 2JA7B 4G4KA 3A55A 1TS3A 2L11A 3C3LA 2F0WA 2WB1B 2ZXRA 1SYDA 2EJGC 1DZ1A 5FLXE 1CA5A 1FYCA 5FKAC 2ENBA 2AQ2B 4ZKCB 2A69D 2PMZB 5I2YA 2RKSA 5IIFA 2NN6H 3FMCA 1RDPD 1II3A 3D4WA 2F0GA 2G9HD 1SE3A 3T4AC 3GTKB 4F87A 2RVLA 4GZYC 1VMCA 1PRTD 4WFN3 4QCLA 5IODA 1TR5A 1ET6A 4OO1I 4IURA 1AZQA 1E2WA 2DNCA 4IN3A 1ICWA 3HZXA 2Z4IA 3TMEA 5JOBA 5CV5A 3R2IA 1KAAA 1Z7TA 2B2UA 4ZUIA 1ML0D 3TZUA 2M2LA 2PNRC 3TN2A 1Q1EA 2C5CA 3I4LA 1Q3LA 4F8MA 4A3KB 1XTCD 4RH6A 1Y69U 3SXHA 5IGDA 1WCMB 5E4XA 5I9OA 4KTAA 5F2DA 1SYEA 2RDGA 3NTKA 2I46A 2F03A 1ILQA 4K2KA 1B1ZA 2IX3A 3QOLA 3MWYW 1NAPA 4QUFA 4KD4A 4DF7A 1B2TA 3K59A 2SOBA 2BE5C 3T53B 1MBYA 4CHTB 1AEXA 4Z9CB 3LNNA 1A3UA 5C0XJ 4DAYA 1C8CA 3J7AV 1VMPA 3DUZA 3HOXB 2D2CC 5C3EB 4PMCA 1IW7D 3T16A 3OMCA 3FDTA 4R8NA 2SDFA 4IFDG 2EY6A 2EZVA 4C1NI 3A8JE 1EYDA 3K5LA 1HRJA 1JWUD 3SDZA 1D1KA 4HSPA 1Z47A 1SMYC 4F88A 2PW7A 5J39A 1JQYD 1OXVA 1A2UA 1AW7A 1A3VA 5DM73 2EJMA 1A2TA 1F2ZA 4QIWB 3KBXA 3TZDA 1CHPD 1STEA 4NMZA 3QOJA 2B63B 3N6RA 1EY7A 1S5DD 2B8GA 4KHVA 3RZOB 3N52A 1QB5D 1TQOA 3MHBA 1TWHB 2K5WA 2KA7A 2PW5A 4OL7A 2KQ3A 3QIAA 3GTOB 3AU7A 5C5MA 1K83B 1ZYRD 3NE5B 4XYQA 3PIP3 1U9RA 3D6WA 2EY2A 1E0BA 2NZ1D 5FLXL 5EPLA 1RHPA 3QWNA 1HA5A 2BE5D 3PUWA 3R8BA 3ERQA 2PZTA 1DXMA 1EZ6A 1HCZA 2F0SA 2KJXA 3VYTA 2MP1A 2I07B 5C4XB 1T5XD 2A6EC 4G7ZC 2J7ZA 1G2TA 3CQZB 5D65A 4OIJA 3SK5A 3HG9A 1HQRD 4C3IB 2R61A 2JA5B 1D6EC 1CM9A 4ZQ3A 2R92B 3QO2A 1G2SA 1E2ZA 1I4PA 3A8KE 4KN7C 1BCPD 1EEFD 1BF4A 2RQXA 2EDGA 5C6AA 1HXYD 4NKLA 2QDBA 1LTGD 3BDCA 5EKLA 2KEDA 1B3AA 1I50B 3VA5A 3MZ5A 1CZWA 5EPJA 3L3OC 3T56B 1UAPA 4XQQA 3MC0B 3MXGA 4ZYSA 3OW7A 4C3IG 1FR3A 2MGSA 5JPNC 1M8AA 5TSSA 4A3BB 5KRUA 1F9RA 1WTPA 2MHVA 1Y1WB 3I73A 2GA4B 3IAYA 3ND8A 3KUPA 4FF1A 1ESRA 3S1QB 2IPKD 1CQVA 3HS0C 3K5OA 3GO5A 5JVG3 5KIXA 5IT9L 2WACA 2PO4A 4A3IB 2B2YA 3OHXC 1PRTC 2VB3X 1GJXA 4KKSA 1BR9A 3S14B 3E5SA 5BN4A 5C0XG 3WOEA 3M3YB 1TU2B 1ENFA 3GTQB 3OIQA 4FYDA 2XNAC 2X6LA 2OF1A 2FMMA 2KHSA 5E3FA 3D6CA 4HN7A 1VCIA 3JAME 3BVZA 3U9SA 1KNAA 2F0EA 2EXZA 2FMCA 4HMJA 2R6GA 2ICEC 4K8JA 4KI0A 2L55A 1PFNA 2D62A 1WD0A 2BOSA 1C48A 3I90A 5A2QL 1NR4A 3Q22A 1EYCA 2SNSA 1RKNA 4UDUC 4CKCA 2AUKA 1K8OA 1STYA 5K36G 2Q8TA 2EE1A 5JJZA 4J1MA 2XWJB 1Y8NB 3S2DB 1O7YA 4KY6A 4DN4M 1Y8PB 1V1PB 2R7ZB 2RDFA 1CTMA 5EBCA 4HR7B 4ZKBB 4RA8A 5EJWA 4O42A 2PZWA 2J4XA 5I6WA 3TP8A 4FF4A 3DHQA 2JSOA 5DEHA 4V0BA 4A3FB 1JWSD 1JE4A 1PRTB 3EVQA 3URYA 4DXGA 2FFKB 3S17B 3J80E 1VF7A 3KLSA 3M7NA 3K6OA 4O1NA 2BDNA 2F0NA 2CHBD 4CKEA 1C4QA 4MHEA 5K36H 1STBA 3GTMB 3VA7A 2XRQD 4K8IA 4IUPA 1R4PB 5LL6S 2K04A 2A73B 1KDBA 1OXUA 3PUZA 2XWBB 1EU4A 3M4OB 4CJ0B 1PTOH 4A3JB 1TWCB 2PQEA 2HDLA 2PYKA 4Q0FA 3KBGA 4FVMA 4LMQD 1ENCA 4A3EB 1KDCA 1UUPA 1SYBA 3D3RA 4FP5D 2SEBD 1EY0A 4KY5A 2R3ZA 3Q6SA 3E0JA 5KEEA 3C2PA 4IUQA 3HOVB 3V2TA 4IFDJ 2E75C 2V4DA 1TKWB 2L0CA 3NSWA 5FO8B 2HQEA 3HOWB 1R4QB 2IWHA 1I6VC 5JAVA 1FD7D 1H9JA 1SBBB 3KK7A 4C3HB 1CZGA 4PMWA 1IKMA 5CMDA 1XX8A 1LTAD 2B2VC 4S3SA 3H6MA 5IT9E 1I4GA 3W3AA 1EY5A 5J1ZA 1Y8OB 5CYUA 2KCNA 2F0OA 1TS2A 3BZDB 3A7AB 1Q90A 4XQNA 4G7OC 1SNQA 2RSOA 3M4YA 1J9OA 3JAML 1UNSA 1U4LA 3MXPA 4RGTA 1SNCA 1QILA 1X32A 4K6LA 2A6HD 1DONA 1F2YA 1PTOF 1ESFA 1SE2A 3T13A 1SNPA 3WOFA 4KN4C 3PO3B 1PDQA 2F1MA 4BA2I 2O2LD 3LX0A 4OO1H 4R9WA 5IGGA 4ZLTF 2XRSD 4PNYA 1EY4A 2N88A 1XYIA 3H0GB 4C3HG 4FXKC 5CV6A 3GV6A 2B2VA 3DWQA 3MXNA 5A2QE 4XDXA 1XWEA 1SNOA 1I3QB 1OO9B 4DA2A 3MA2B 2F0PA 4HSVA 1I4QA 4H0LC 3FEWX 1RTNA 1T5EA 2QEJC 4NDXA 5ELDA 1H9SA 2ZXOA 1BO0A 3T51B 2Z8LA 3D4RA 3OWEB 2KOLA 2F0VA 5C3WA 4X3UA 2MJ8A 3EFXD 3IFDA 1ENAA 3D4DA 2F0JA 1I4RA 2E2JB 3KLRA 3O13A 3X3NA 4QMGA 1WTOA 4FXDA 2EPBA 3J80L 4FF3A 1TY2A 1QNKA 4X3TA 2A6HC 2K32A 2K33A 1D2BA 1LTRD 2CVRA 3S2HB 1HFNA 1CQFA 2H4OA 3MVVA 1BCPB 2AUJD 1SSOA 5M9OA 2F0HA 5IGEA 1RTOA 3K5MA 5C0XI 2LS01 3BYYB 1ZXTA 2LY7A 4XYOA 5CR3A 1PMRA 2IX0A 4J8QA 3AB9A 4IFDI 3BDOA 1LO5D 4P2CB 1TWGB 4JK1C 5CBEE 4XQJA 4Q5VA 4FF2A 4K5VA 1DOLA 4LJZC 2HCIA 5J22A 5C3XA 1STAA 3J7YW 3HEJA 4CBVA 5JEAJ 2DY8A 4KK7A 2Y0SB 1PXUA 2YU9B 1VDZA 1HUMA 1UEAB 1EWCA 1Z6HA 5FO7B 2B2UC 2WIIB 3V05A 1FNWA 3RLFA 2ICIA 3K5NA 4DNTB 4H7BA 3H09A 1BCPC 1W6KA 1V1PA 4R8IA 4NP5A 1O7LA 5AFWA 3X3MA 1ONLA 5ELBA 4M1UB 1F2LA 2X69A 2EYPA 1BQQT 4N9TA 3NHHA 3NUCA 4OO1G 1PZID 1SYGA 1STGA 4CKBA 1X3QA 1GOZA 3NK9A 3NWTA 1WVLA 4EQPA 3S9WA 3BS1A 3PUVA 1BCPF 2OEOA 1H9RA 4HAEA 2FINB 4B08A 4WRDA 4OHJA 2K03A 2EJFC 4EGVA 2F0QA 4RHSA 3J81E 1Y1VB 1HA6A 1ZYRC 5C44B 2HUGA 4BY1B 4XTCS 1AFPA 3NQTA 1EWHA 2F0TA 5CV9A 4DU9A 2NN6G 4F7XA 3H3VC 1M4VA 4KV6A 3NXWA 1HUNA 1VF5C 4ILWA 5BN5A 3FRPB 5G3LD 5KNCA 2B2TC 1NR2A 1SNDA 2K05A 3EROA 2NYZD 1LTID 1TIID 1D5MC 1LTBD 3S1RB 4BWGB 5I9PA 1NUCA 3HOUB 5IGFA 1K8MA 3WDNA 1JC7A 4U68A 1PFBA 4A3GB 1SJED 1MSHA 2K7VA 1EIGA 1O7ZA 2XVSA 3S15B 2RBMA 4ME5A 3DXJC 1PTOC 5D3DA 3HGBA 3IFTA 1F9PA 5EKIA 3C46A 2L5TA 3VR4A 2NWGA 1B50A 2WKDA 2FJ2A 3H91A 2NVTB 3TBIB 1O80A 4JBWA 2C9OA 1IKLA 4TKOB 3V96A 4X3KA 1BXTA 4C2MB 3NWSA 2KUMA 4EQOA 5T1IA 4PQXA 3DEOA 4UAIA 1STHA 4IUNA 4KJNA 4ZK9B 4B9XA 1V43A 4RCNA 4N9PA 2EYOA 1SYCA 4B9WA 1ILPA 1RJTA 3I72A 1D5ZC 4IALA 3QG1A 2E76C 3VR6A 2L1BA 1ZKOA 1H9SB 3TP6A 3UI2A 2WP8J 1GUWA 2KEEA 4DK0A 4BBRB 2JP1A 1LTSD 1TT2A 1QE6A 1MSGA 2A6ED 3CKIB 3A56A 2RDHA 1DOMA 1WTRA 1KABA 5ISRA 2NVYB 3PMFA 4KY7A 2OT2A 5D14A 2F3VA 5C0XH 3GTLB 5DNFA 4C56C 1CI3M 2EYFA 1E2VA 3C1EA 3HKZB 1G291 3MFYA 4DXFA 2G9DA 2CW0C 5M5XB 3DM1A 3GP7A 1GXDC 2F0FA 2K28A 1TS4A 5C4JB 4XXEA 5CV8A 1ZEQX 2EVBA 2LFNA 4U673 2JA8B 2Q8RE 4DAVA 1XXGA 3GQBA 2L4NA 5K5PA 1IYVA 4HEDA 3EQLC 4KHZA 2EYLA 1I4XA 1AZPA 3RMHA 1HHVA 5CV7A 2RSNA 1SNMA 4H44C 2PCFB 3I70A 2JA6B 1SDFA 3KF8A 3Q24A 3NQIA 4IUVA 3P1HA 1A6XA 2LMCB 1CT1D 1QOHA 1MGSA 1SE4A 3OWFA 5CGKA 1BNZA 1GUOA 1LLRD 1AN8A 4C3JG 2K5QA 3PUYA 1F9QA 4YIJA 1YNND 5EKKA 4HTHA 3SR1A 4L8JA 1JR0D 3I4NB 1EL0A 4CJ2C 1WTQA 1WTXA 2NB0A 2CW0D 1DM0B 2FHTA 2IX1A 2JEAI 4KKTA 2E2DC 1Q12A 3M85A 4PV1C 4DGZA 4ZRZA 1FGBD 4RKLA 1MI2A 1B9MA 3HOZB 3NBHA 4IZ8A 5EGTA 3VYSA 5LHY1 5JEAG 2H1EA 3RUZA 1PLFA 5HURA 2TSSA 4DK1A 4H13C 1B53A 2F0LA 5IOCA 4CGYB 1LT3D 3HRZC 2B2WA 3ONAB 3OIPA 5A35A 1S5FD 5I2XA 4FNFA 2JXMB 2O5JC 2DNEA 4V190 5COYA 2NUCA 2WKCA 4K14A 2DN8A 3DMUA 3ZYYX 5LL6X 2E2HB 3IL8A 3K57A 3MFGA 3DWAA 3KLSX 2BA1A 3S16B 4CJ1B 2B39A 3PO2B 1X3PA 2NN6I 1YNNC 1BUVT 5EPKA 5M3MB 4RAUC 4HMIA 5G3LF 5CC4A 2IW3A 4RCOA 4XT3B 5I6YA 5I4DA 4C3JB 2D9UA 2WV6D 4XIGS 5ELCA 4TRDA 4IFDH 4MN3A 3R2TA 3Q23A 3I8ZA 4RFBA 1RODA 2K6AA 1JOKA 1EQVA 3D8GA 1GUGA 1TWAB 4BBSB 1D5XC 3CHBD 2R93B 5M5WB 1QJOA 1DD2A 1GUNA 1MD2D 2OXPA 2O4XA 3A54A 4DNRB 3TSSA 4WJWA 2EYHA 1F2MA 3DWPA 2KCCA 2L12A 1TVXA 5IGCA 1EFID 3VR3A 1HTPA 1HFGA 1LABA 5C5LA 3GTGB 2XN9C 3FVQA 4PMBA 1PRTF 2E74C 2YYZA 5EBDA 1DYQA 1PZJD 1LT6D 1RF2D 4ZAIA 2AQ1B 2PPBC 1G6ZA 1IL8A 3BYTB 2LKVA 3J81L 3RZDB 4ID6A 3I91A 1Q8IA 3DEPA 1DOKA 4QF4A 2EYMA 1U4MA 4XT1B 2F0IA 4RGMA 4K5WA 1SYFA 2WINB 2CQAA 1GUTA 3QJYA 4WORA 2VXWA 2XIWA 5CBAE 1BOSA 1YNJD 1J8IA 3I4MB 1HPCA 3FPUB 4IQZA 1A15A 2K01A 3PV0A 4RHRA 1G8ZD 2HDMA 5D3IB 4QUCA 1S5BD 3E6ZX 2NVXB 2BA0A 3NBIA 2SNMA 4EQNA 5KYIA 3R3OA 3MXUA 5JVH3 3D31A 4K5XA 1JWMD 4BS9A 3S1NB 4TSSA 4RKBA 4A93B 2AQ3B 1LV9A 1JCKB 2F0UA 1EOTA 1EYAA 1OXTA 2O5IC 5DM63 5FOBB 1TY0A 1BBXC 2B8FA 1EY9A 4KKUA 1GHJA 4ZUJA 5CV4A 1Q1BA 1TWFB 3SK4A 1KLUD 2AWOA 1RCVD 2JYOA 2L9HA 1U4PA 5C4HA 3OMGA 4I7ZC 4FO2A 1SMYD 4OGQC 1L0YB 3A8IE 3P7JA 2QCPX 5BN3A 4AYBB 3BDLA 4ODGA 1QCBD 3CU7A 1DJRD 3SVMA 2NTSA 1EQTA 2NTTA 1EY6A 3L9AX 2AWNA 4K6DA 2M00A 1EIHA 4G7HC 3LWEA 1B9NA 1B44D 1SJHD 3F2UA 3MEHA 4G57A 3EJIA 1R9TB 2KECA 2TMPA 1QWYA 1JOOA 4RGOS 1D1IA 1I6HB 1CFMA 2IT1A 1ET9A 4X3SA 5JEAH 1FNVA 1PYWD 4M8AA 1KDAA 2A68D 3IKJA 2VNUD 2BCOA 1PFMA 1BDOA 2MUYA 2A69C 3NTIA 5C4ZA 1CA6A 1FNUA 2F0MA 2F4IA 4EVOA 3SHLA 3L7ZC 3EA6A 4RGNA 4BA1I 1HQMC 3M7GA 5ELEA 1NSNS 3GD7A 3R93A 2N55A 3CRLC 3MAQA 5KGUA 1LT5D 1KNEA 5IGBA 4HCSA 2KVMA 4LAAA 4L6TB 4KD3A 1EEID 3K0YA 1SAPA 3TP7A 2DY7A 2X6GA 1QG7A 4NW2A 4E6IA 2F3WA 4IUUA 2M9VA 2NBFA 4C1NK 4QB4A 5HGTA 1PZKD 1NCVA 2A5HA 4A3DB 1LTTD 4IUTA 4K2LA 2B2WC 2Q8IB 3GTPB 2RA4A 2EYJA 4RWSC 2B2TA 4DAPA 2XSCA 4TQUS 3MTSA 4I65A 5E1FA 2J0TD 4LK1C 2A74C 4KMUC 2VUMB 4KJOA 1KTKA 1PTOB 5KNBA 2WAQB 1CK1A 3NPPA 3A7LA 3U9OA 2BDOA 3K7AB 3BVGA 3GTJB 3SK8A 5FO9B 1EU3A 3H94A 3FKIB 2JE6I 4HCEA 1SXTA 1LT4D 1STNA 5NUCA 5M5YB 1HTLD 3PUXA 5ELFA 4MIUA 3GV3A 1GUSA 1WD1A 1S4ZA 1EY8A 2EY5A 3OPOA 4FXGC 1JOQA 3FPPA 1IYUA 1OXXK 2Z1CA 1TS5A 2D5DA 3RD4A 3OSOA 3PIO3 3ITPA 3AMUA 1G91A 5KNDA 1KLGD 5KYLA 1YNJC 5JPMC 1SEBD 3ND9A 3SE0A 1QNUA 2VB2X 1V1OA 5CORA 2E2IB 1W6JA 1CHQD 5M3FB 1JICA 3BVMA 4J6HA 1S5ED 3VYRA 3LWUA 3W2DA 5EQ0A 1WTVA 3SK6A 3TDQA 2QILA 4OIKA 2F0KA 3TP5A 3NP8A 3P20A 1EZ8A 3VR5A 1O78A 5DAUA 2JEBI 1H9KA 3SEBA 1JB3A 4A3MB 1A3TA 2IL8A 1SFOB 2A68C 2K5DA 4Y7NB 1IW7C 3HP3A 3G6JB 5T1GA 2B2YC 3P75A 4ABNA 4L63B 3K58A 2QF7A 2EOTA 2IJ0A 3Q0AA 5E4WC 4ULLA 2QKIC 3BG3A 3VYUA 1F77A 2F0DA 1U4RA 1OXSC 1LACA 2MPMA 3CRKC 2ZT9C 4BY7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC0 B;  1FD7 D;  1SBB B;  3MFG A;  4ZYS A;  1L0X B;  1D5Z C;  3DWA A;  1LT5 D;  1LTI D;  1TS5 A;  1D5M C;  3BYT B;  2Z8L A;  3KLS X;  1EWC A;  1LTB D;  1XTC D;  1LTA D;  1V1P B;  1KLU D;  4RH6 A;  1RCV D;  1S5C D;  3V05 A;  4BWG B;  1FNW A;  3OWE B;  1CT1 D;  1I4G A;  2ICI A;  1KLG D;  5TSS A;  4L6T B;  1SE4 A;  1SEB D;  1EEI D;  1BCP C;  5FK9 C;  1V1P A;  1LLR D;  1AN8 A;  1LTS D;  2RDG A;  2J4X A;  1TS2 A;  3EFX D;  1V1O A;  4RGM A;  1L0Y B;  1HA5 A;  1B1Z A;  5ELB A;  3R8B A;  1I4H A;  1I4R A;  3BZD B;  2RDH A;  1JWS D;  4RCO A;  3O13 A;  1CHQ D;  1PRT B;  3BVM A;  5I4D A;  2IPK D;  1S5E D;  1CQV A;  1PTO D;  1SJE D;  1JR0 D;  1TY2 A;  2WV6 D;  3URY A;  3W2D A;  4DXG A;  1T5X D;  1DJR D;  1RD9 D;  5ELC A;  2NTS A;  1PZI D;  1TS3 A;  1PZK D;  2NTT A;  4Z9C B;  1GOZ A;  1UNS A;  2QIL A;  4O1N A;  4RGT A;  1LTR D;  1HQR D;  3R2T A;  1PTO C;  1BCP F;  2CHB D;  1QIL A;  2R61 A;  5D3D A;  1BCP B;  1PRT C;  4RFB A;  4C56 C;  1D6E C;  4K6L A;  1LTT D;  4DXF A;  1B44 D;  1SJH D;  1PTO F;  1ESF A;  1FGB D;  2XRQ D;  1SE2 A;  5FKA C;  4OHJ A;  4RHR A;  1G8Z D;  5D3I B;  1S5B D;  3BYY B;  2AQ2 B;  3GP7 A;  3SEB A;  1ENF A;  4RHS A;  2O2L D;  1TS4 A;  2XNA C;  1RDP D;  2G9H D;  1I4P A;  2XRS D;  4RGO S;  1EU4 A;  1SE3 A;  1JWU D;  1D5X C;  1BCP D;  1PTO H;  1EEF D;  1KTK A;  3CHB D;  1PTO B;  1MD2 D;  1XXG A;  2TSS A;  1ET9 A;  3BVZ A;  1JQY D;  1PRT D;  1CK1 A;  1AW7 A;  4L63 B;  1UUP A;  3TSS A;  1LO5 D;  1ET6 A;  1FNV A;  1PYW D;  1BXT A;  3DWQ A;  3DWP A;  2SEB D;  1LT3 D;  1JWM D;  2IJ0 A;  3BVG A;  1EFI D;  1CHP D;  1HXY D;  1EU3 A;  1M4V A;  1STE A;  4TSS A;  2AQ3 B;  1FNU A;  1S5F D;  1SXT A;  1LTG D;  1JCK B;  1LT4 D;  2XN9 C;  1I4X A;  4UDU C;  1I4Q A;  1F77 A;  1HTL D;  3R2I A;  1PRT F;  1S5D D;  3EA6 A;  4RGN A;  5ELF A;  1DYQ A;  1PZJ D;  5ELE A;  1LT6 D;  1RF2 D;  1TY0 A;  2AQ1 B;  2QEJ C;  5ELD A; 
#chains in the Genus database with same CATH topology
 2Z4H A;  3S1M B;  1KRT A;  4JG2 A;  1L0X B;  2B29 A;  1AP0 A;  1JOR A;  2K1B A;  4DFA A;  1VQ7 A;  2ID0 A;  4B3R L;  3K7U C;  3S24 A;  3QB3 A;  2NVQ B;  3I3C A;  1S5C D;  1H9M A;  5IT9 c;  1DCZ A;  2K14 A;  1X55 A;  2HCC A;  4R4C A;  3VR2 A;  1F9S A;  4QQB X;  3C1F A;  3GTJ H;  5FK9 C;  1B4O A;  3UDG A;  1VQD A;  1VQF A;  4YWK A;  4LFC Q;  2EY1 A;  2K4K A;  4A3L G;  1GHK A;  3OOC A;  3HOV G;  4A3D G;  1I4H A;  1IHZ A;  1WTW A;  3G7L A;  3KDF A;  1S72 A;  3J7A F;  3T1H Q;  1V8Q A;  2PZU A;  3HOY B;  1PTO D;  2ZXP A;  3I4N H;  3NTH A;  1RD9 D;  2JA7 B;  4G4K A;  3A55 A;  1TS3 A;  2L11 A;  3C3L A;  2F0W A;  2WB1 B;  1FL0 A;  4OX9 L;  2ZXR A;  1VQ8 A;  2KBN A;  1SYD A;  2EJG C;  4HIO A;  1DZ1 A;  1KXL A;  2A19 A;  3RR5 A;  2C35 B;  5FLX E;  1WTH A;  1CA5 A;  1FYC A;  1GD7 A;  5FKA C;  4CDC C;  2JA5 G;  3HOW G;  2ENB A;  2AQ2 B;  4DNI A;  4ZKC B;  2A69 D;  2PMZ B;  5I2Y A;  2RKS A;  5IIF A;  2NN6 H;  3FMC A;  1RDP D;  1II3 A;  3D4W A;  2F0G A;  2G9H D;  1SE3 A;  3I7F A;  3T4A C;  3GTK B;  4F87 A;  2RVL A;  2I0Q A;  3I4O A;  4JOI A;  4GZY C;  1VMC A;  4PZ6 A;  2DJF C;  1PRT D;  4WFN 3;  4QCL A;  3HOX H;  5IOD A;  1TR5 A;  1ET6 A;  4QY7 A;  3CPF A;  4OO1 I;  4IUR A;  1HJP A;  2ZM6 L;  4AIM A;  4BY1 H;  1AZQ A;  1XNR Q;  1E2W A;  2DNC A;  2Z9H A;  4IN3 A;  1ICW A;  3K0X A;  3HZX A;  1YI2 A;  1HR0 L;  2Z4I A;  3TME A;  5JOB A;  1XMO Q;  5CV5 A;  5H1S E;  4QGU A;  4YWM A;  2KHI A;  3R2I A;  1KAA A;  3PSI A;  1Z7T A;  4JI3 L;  4UP9 A;  2B2U A;  3G71 A;  4ZUI A;  1ML0 D;  3TZU A;  2M2L A;  2PNR C;  2Q2T A;  3TN2 A;  1Q1E A;  2C5C A;  3I4L A;  1NJI C;  1Q3L A;  4F8M A;  4A3K B;  1X3F A;  1XTC D;  4B3T L;  1RIP A;  4JI7 L;  4RH6 A;  1Y69 U;  3SXH A;  3RLO A;  5IGD A;  1WCM B;  3S2D H;  1XMO L;  5E4X A;  5I9O A;  4KTA A;  5F2D A;  1YJW A;  4IPG A;  3J81 i;  1SYE A;  2RDG A;  3NTK A;  2I46 A;  4IPH A;  4A3C G;  2F03 A;  1ILQ A;  4K2K A;  1B1Z A;  1SMX A;  2IX3 A;  3QOL A;  5M5Y H;  3MWY W;  4IJL A;  4DUZ L;  1NAP A;  4QUF A;  4IJH A;  4KD4 A;  4DF7 A;  2UUB Q;  1B2T A;  5IP7 G;  3K59 A;  2SOB A;  1K8A C;  2BE5 C;  3T53 B;  1MBY A;  4CHT B;  4X65 Q;  1AEX A;  4Z9C B;  3LNN A;  2UU9 L;  1A3U A;  5LMN L;  5C0X J;  4DAY A;  1C8C A;  3J7A V;  1VMP A;  3DUZ A;  4EX5 A;  4A4I A;  4A3E H;  5C44 G;  2D2C C;  3HKS A;  3HOX B;  5C3E B;  4PMC A;  1IW7 D;  3T16 A;  2F52 A;  3OMC A;  1Y1V G;  2JA8 H;  4ALP A;  3FDT A;  4R8N A;  2SDF A;  2UXD Q;  5C4X H;  4IFD G;  2EY6 A;  1B70 B;  2EZV A;  1U0L A;  5GAH C;  2E2I H;  4KLK A;  4C1N I;  3A8J E;  1EYD A;  3K5L A;  4JI6 L;  4NXN Q;  1HRJ A;  1JWU D;  1VQ6 A;  3SDZ A;  1D1K A;  4HSP A;  1Z47 A;  4YCW A;  1SMY C;  4F88 A;  2PW7 A;  5J39 A;  1JQY D;  5JJL A;  1OXV A;  5IP9 G;  4LF7 Q;  1A2U A;  1AW7 A;  4X64 Q;  1A3V A;  5DM7 3;  2R7Z H;  2D0O A;  2EJM A;  1A2T A;  3J80 i;  1F2Z A;  4QIW B;  3KBX A;  3TZD A;  1CHP D;  1STE A;  4NMZ A;  3UDF A;  1FVI A;  4A3M H;  1QUQ B;  3QOJ A;  2B63 B;  3N6R A;  1YEZ A;  1EY7 A;  2OWO A;  1S5D D;  2B8G A;  4X66 L;  4KHV A;  1X3E A;  2JJQ A;  3RZO B;  3N52 A;  2I5L X;  1QB5 D;  1TQO A;  3CME A;  2UUA Q;  2BH2 A;  2VL6 A;  3MHB A;  1ICF B;  2R93 H;  1TWH B;  5LMU Q;  2K5W A;  4GOP B;  2KA7 A;  2PW5 A;  1CKM A;  2KQ3 A;  3QIA A;  4OL7 A;  2QA4 A;  1HNZ L;  3GTO B;  1H95 A;  2K75 A;  3ERS X;  3AU7 A;  5C5M A;  1K83 B;  1ZYR D;  2HT1 A;  3NE5 B;  4XYQ A;  5M3F H;  3PIP 3;  1U9R A;  2CQO A;  3D6W A;  2EY2 A;  1E0B A;  2NZ1 D;  5FLX L;  5LMN W;  5EPL A;  1RHP A;  3QWN A;  1HA5 A;  3ULP A;  3EBE A;  2BE5 D;  3PUW A;  3CW2 C;  3R8B A;  3ERQ A;  2PZT A;  1DXM A;  1EZ6 A;  1HCZ A;  4A3G H;  2F0S A;  3CC4 A;  1IBK Q;  2B3G A;  2KJX A;  2YTX A;  3RN5 A;  3VYT A;  3GDE A;  2MP1 A;  4DK6 C;  2ZTD A;  2I07 B;  5C4X B;  1T5X D;  2A6E C;  4G7Z C;  2J7Z A;  1G2T A;  3M4O H;  3CQZ B;  5D65 A;  3MEF A;  4OIJ A;  3SK5 A;  2ALY B;  2RF4 A;  5IYC H;  4GNX A;  3HG9 A;  1Q8K A;  1HQR D;  4C3I B;  2R61 A;  2JA5 B;  1D6E C;  3KF6 A;  1CM9 A;  2N8N A;  4ZQ3 A;  2R92 B;  1VQP A;  4GLX A;  3QO2 A;  1EQQ A;  1G2S A;  2NVX H;  4R4O A;  1E2Z A;  3PO2 H;  1I4P A;  3A8K E;  2KHJ A;  4KN7 C;  1BCP D;  3MXN B;  1EEF D;  4C3H H;  1BF4 A;  1IBM Q;  2VZA A;  3HKZ G;  1DGS A;  1T9H A;  2RQX A;  2EDG A;  4LF7 L;  5C6A A;  4HID A;  1HXY D;  4NKL A;  3OTO Q;  2QDB A;  1LTG D;  3TRE A;  4A3F H;  1PFS A;  3BDC A;  5EKL A;  2KED A;  1B3A A;  1I50 B;  4A3J H;  3VA5 A;  3MZ5 A;  1CZW A;  3U4Z A;  1AH9 A;  5EPJ A;  4DUY Q;  3L3O C;  3CP0 A;  3T56 B;  1UAP A;  5DLQ E;  4XQQ A;  2KCM A;  1B3Q A;  3KJP A;  3MC0 B;  1X54 A;  1K9M C;  3T1Y Q;  1VQM A;  3MXG A;  4B3T Q;  4ZYS A;  3OW7 A;  4JI4 L;  3ICE A;  4C3I G;  1FR3 A;  1CKN A;  4O0A A;  2MGS A;  5JPN C;  1M8A A;  1VS0 A;  5TSS A;  2YU9 H;  4A3B B;  5EAY A;  5M3M G;  5KRU A;  1F9R A;  1WTP A;  2MHV A;  1Y1W B;  3I73 A;  2GA4 B;  3IAY A;  4DUZ Q;  4BY7 H;  2VW9 A;  3ND8 A;  3KUP A;  4FF1 A;  2B63 G;  1K8G A;  4UHV A;  4HIM A;  1ESR A;  3A5U A;  3S1Q B;  2IPK D;  2OQ0 A;  1CQV A;  1W2B A;  5FLM G;  3HS0 C;  1IBK L;  3K5O A;  3GO5 A;  5JVG 3;  1OTC A;  5KIX A;  4R1J A;  5IT9 L;  1SRU A;  4LF5 Q;  2WAC A;  2PO4 A;  4A3I B;  3I4M G;  2B2Y A;  3OHX C;  1PRT C;  2VS1 A;  4DV0 Q;  2VB3 X;  1GJX A;  4KKS A;  1BR9 A;  5ELO A;  1XMQ L;  1K3B C;  4A3B G;  3S14 B;  3E5S A;  3RNU A;  1KD1 C;  2HHH Q;  5BN4 A;  3HOY G;  4J15 A;  4A75 A;  5C0X G;  3WOE A;  1NMF A;  3M3Y B;  1TU2 B;  1ENF A;  3GTQ B;  3OIQ A;  4FYD A;  4JBM A;  2XNA C;  1NNX A;  2OF1 A;  2FMM A;  2X6L A;  2KHS A;  5E3F A;  2CH4 W;  3D6C A;  4POF A;  1I94 Q;  4HN7 A;  1VCI A;  3JAM E;  3BVZ A;  3CCS A;  1K73 C;  3U9S A;  1KNA A;  3PF4 A;  3F2D A;  2F0E A;  2EXZ A;  2FMC A;  4HMJ A;  2R6G A;  2ICE C;  1QVF A;  4K8J A;  3B6Y A;  4KI0 A;  3PIO A;  2L55 A;  1PFN A;  5JJK A;  3ULL A;  2D62 A;  1WD0 A;  2BOS A;  1KAW A;  2KCT A;  1C48 A;  1Q81 C;  3I90 A;  5A2Q L;  1NR4 A;  3Q22 A;  4IPC A;  1EYC A;  2SNS A;  2LSS A;  1RKN A;  4UDU C;  4CKC A;  2AUK A;  1GKH A;  1STY A;  4JI3 Q;  5K36 G;  1K8O A;  1XPO A;  2Q8T A;  2EE1 A;  5JJZ A;  3UE1 A;  4J1M A;  2XWJ B;  1Y8N B;  5C3E G;  3S2D B;  3AYH B;  1O7Y A;  4KY6 A;  4DN4 M;  1Y8P B;  1PYS B;  2L15 A;  1V1P B;  3I55 A;  2H5X A;  2IHF A;  3A0J A;  2R7Z B;  2RDF A;  1CTM A;  5EBC A;  4HR7 B;  4ZKB B;  4RA8 A;  5EJW A;  4A76 A;  4O42 A;  2PZW A;  2J4X A;  5I6W A;  3TP8 A;  4FF4 A;  3DHQ A;  3NEL A;  2JA7 H;  4N8X 1;  2JSO A;  4JI8 L;  4DR5 L;  4DR4 L;  1WJJ A;  5DEH A;  4V0B A;  4A3F B;  1JWS D;  1JE4 A;  1PRT B;  3JAM i;  4YWL A;  3EVQ A;  1NY4 A;  4GKK L;  3URY A;  4DXG A;  2FFK B;  3S17 B;  4OWW B;  5C3E H;  3J80 E;  1VF7 A;  3KLS A;  3M7N A;  4P71 A;  1G51 A;  3K6O A;  4O1N A;  2BDN A;  2F0N A;  2PQA A;  2CHB D;  4CKE A;  4POG A;  1C4Q A;  2P5Z X;  4MHE A;  5K36 H;  1IBL L;  2NZO A;  3CCU A;  1STB A;  3GTM B;  3VA7 A;  4DAY B;  1VQA A;  2XRQ D;  4K8I A;  4NXM L;  4JYA Q;  4IUP A;  4LUO A;  1FGU A;  1JJC B;  3W1G A;  1HNW L;  4R4I A;  1R4P B;  5LL6 S;  2K50 A;  2K04 A;  4DR7 Q;  2A73 B;  1KDB A;  1OXU A;  3PUZ A;  2XWB B;  1EU4 A;  3NEM A;  3M4O B;  4CJ0 B;  4DR7 L;  1PTO H;  1IZ6 A;  4A3J B;  2E5L Q;  1TWC B;  2PQE A;  2HDL A;  2PYK A;  4Q0F A;  3KBG A;  4FVM A;  4LMQ D;  1ENC A;  1AE3 A;  4A3E B;  1KDC A;  1UUP A;  1SYB A;  3CQZ H;  1YBY A;  3D3R A;  4FP5 D;  2YV5 A;  1JJ2 A;  2SEB D;  1EY0 A;  4JC0 A;  1UE7 A;  3CCL A;  2K5N A;  4KY5 A;  3H3V I;  2R3Z A;  3HOY H;  1HR0 W;  4JVZ A;  3Q6S A;  3E0J A;  5KEE A;  4JPB W;  3C2P A;  1KL9 A;  4A3B H;  4IUQ A;  3V2T A;  4AQY L;  3HOV B;  4IFD J;  2E75 C;  4C2M H;  4L5R C;  2V4D A;  1TKW B;  2L0C A;  3TRZ A;  2CWP A;  3NSW A;  1QUQ A;  5FO8 B;  2UUA L;  2HQE A;  3HOW B;  1R4Q B;  3PCO B;  3QR8 A;  2IWH A;  3DLL A;  1I6V C;  5JAV A;  1FD7 D;  1H9J A;  1SBB B;  3KK7 A;  1HNX L;  4C3H B;  4YY3 Q;  2Q2I A;  2DUD A;  1CZG A;  4PMW A;  1JB7 A;  1IKM A;  3BJU A;  5CMD A;  1XX8 A;  1LTA D;  2B2V C;  4S3S A;  3H6M A;  5IT9 E;  2B63 H;  1I4G A;  3W3A A;  1EY5 A;  4BY7 G;  2WAQ G;  5J1Z A;  1C0A A;  4GOP A;  1Y8O B;  1PH3 A;  1EFW A;  5CYU A;  2KCN A;  2F0O A;  1TS2 A;  4YHH Q;  4R4Q A;  4UY8 C;  3BZD B;  1TWA H;  3A7A B;  1Q90 A;  4L5Q A;  3STB D;  2N49 A;  5LMU L;  3HOZ G;  4LW1 A;  4XQN A;  3GTO H;  4G7O C;  1SNQ A;  2RSO A;  3M4Y A;  4DV7 Q;  1J9O A;  1PH4 A;  3JAM L;  1UNS A;  1U4L A;  3KYH C;  3MXP A;  4RGT A;  1SNC A;  1QIL A;  3F1Z A;  4HJA A;  1X32 A;  4K6L A;  1UE6 A;  2A6H D;  1DON A;  3GTG H;  1F2Y A;  1PTO F;  1ESF A;  1QZG A;  1QVC A;  1SE2 A;  3A5Z B;  3M4P A;  3T13 A;  1SNP A;  3WOF A;  4KN4 C;  3PO3 B;  3KF6 B;  1PDQ A;  4OX9 Q;  2F1M A;  4BA2 I;  2O2L D;  1JT8 A;  3LX0 A;  2OTJ A;  4OO1 H;  4R9W A;  5IGG A;  4ZLT F;  2XRS D;  4PNY A;  1EY4 A;  2N88 A;  4JCV E;  1XYI A;  3H0G B;  4JI6 Q;  4C3H G;  1J6Q A;  4FXK C;  5CV6 A;  3GV6 A;  3SGI A;  2B2V A;  3DWQ A;  3MXN A;  5C4J H;  5A2Q E;  4FDB A;  2ZJQ A;  1PVO A;  4XDX A;  1XWE A;  3F2B A;  1SNO A;  1I3Q B;  4JI4 Q;  3G48 A;  3I2Z A;  2EXD A;  1OO9 B;  1VQ9 A;  4DA2 A;  3MA2 B;  2F0P A;  1WCM G;  1K3R A;  4HSV A;  1I4Q A;  4LFB L;  4H0L C;  3FEW X;  1RTN A;  1T5E A;  5IYC G;  2QEJ C;  3TS2 A;  4NDX A;  5ELD A;  4JV5 L;  1H9S A;  2ZXO A;  4JI1 L;  1BO0 A;  3GTP H;  1YHQ A;  1HH2 P;  3T51 B;  2ES2 A;  4GN3 B;  2Z8L A;  1LYL A;  4LUZ A;  3D4R A;  3OWE B;  2GN5 A;  2KOL A;  5L37 A;  2F0V A;  1CKN B;  1J5E L;  5C3W A;  2Q2H A;  4JI8 Q;  4DR5 Q;  4X3U A;  4DR6 Q;  2MJ8 A;  1HNW Q;  3EFX D;  2ZTE A;  2F4V Q;  5M3F G;  3IFD A;  1ENA A;  1X6O A;  3D4D A;  3CAM A;  2F0J A;  1I4R A;  3JC6 6;  3KLR A;  2F4V L;  2E2J B;  3O13 A;  3X3N A;  1L1O C;  4QMG A;  1WTO A;  5IYD H;  4FXD A;  2E5L L;  2EPB A;  3J80 L;  2UUC L;  4FF3 A;  4X65 L;  1TY2 A;  1QNK A;  2Q2U A;  4X3T A;  4APV A;  5E7N A;  1LUZ A;  2A6H C;  1IXR A;  1S3O A;  2K32 A;  2K33 A;  1D2B A;  1A62 A;  1LTR D;  2CVR A;  2WAQ E;  3S2H B;  1HFN A;  1CQF A;  2H4O A;  3MVV A;  1S40 A;  1BCP B;  2AUJ D;  1SSO A;  4GLA C;  2HHH L;  5M9O A;  2F0H A;  4HJ8 A;  5IGE A;  2UUC Q;  1RTO A;  3K5M A;  5C0X I;  2LS0 1;  3BYY B;  3PGZ A;  4DR3 L;  3J80 c;  1VQC A;  2CKZ B;  1ZXT A;  2LY7 A;  4DV4 Q;  2R7Z G;  4XYO A;  5CR3 A;  4GKJ Q;  5IP9 H;  1PMR A;  2YTY A;  2IX0 A;  4J8Q A;  5IYD G;  3AB9 A;  2VQF Q;  4IFD I;  1U5K A;  2ATW A;  3BDO A;  4H02 A;  3CCM A;  5ELN A;  1LO5 D;  4P2C B;  1TWG B;  4JK1 C;  5CBE E;  4XQJ A;  4Q5V A;  4FF2 A;  4K5V A;  5C4X G;  3DM3 A;  1DOL A;  4LJZ C;  3U58 A;  2HCI A;  2ASB A;  5J22 A;  1Y1V H;  2CFM A;  5C3X A;  1STA A;  2UXC Q;  2A1A A;  4LFA L;  3J7Y W;  3HEJ A;  3PQI A;  4CBV A;  5JEA J;  3VDY A;  2DY8 A;  4KK7 A;  2Y0S B;  4Y52 H;  4B3M L;  4TVA B;  1PXU A;  2YU9 B;  2EQS A;  1VDZ A;  3CCQ A;  1YJ9 A;  4JI5 Q;  1HUM A;  1UEA B;  4K0K L;  4DV1 L;  1PH7 A;  1EWC A;  1Z6H A;  3Q8D A;  2B2U C;  5FO7 B;  2WII B;  3V05 A;  2IY5 B;  1FNW A;  1WCM H;  3TQY A;  4LFA Q;  3RLF A;  2ICI A;  3K5N A;  4DNT B;  4H7B A;  3H09 A;  1BCP C;  4A3C H;  1W6K A;  3KLW A;  3CCV A;  1V1P A;  4R8I A;  4NP5 A;  1O7L A;  5AFW A;  1KRS A;  3X3M A;  4YCU A;  1HZA A;  1ONL A;  5ELB A;  4M1U B;  2WFW A;  1F2L A;  1N33 L;  2LXK A;  2X69 A;  1E1T A;  2EYP A;  2ZM6 Q;  1VQB A;  1IBM L;  1BQQ T;  4N9T A;  3NHH A;  3NUC A;  3NEN A;  4OO1 G;  3GTM H;  1PZI D;  1SYG A;  1STG A;  4CKB A;  1X3Q A;  4X6A H;  1GOZ A;  3NK9 A;  3NWT A;  3KFU A;  1WVL A;  4EQP A;  3S9W A;  3BS1 A;  3PUV A;  1BCP F;  1SRO A;  2OEO A;  1H9R A;  4HAE A;  5JJI A;  2FIN B;  4B08 A;  4WRD A;  4OHJ A;  2PQA B;  2GVA A;  4MTK A;  4GOP C;  2K03 A;  2EJF C;  1P16 A;  2F0Q A;  4EGV A;  4NPS A;  4PG3 A;  4RHS A;  3J81 E;  1Y1V B;  1HA6 A;  4LF9 Q;  1HR0 Q;  3S17 H;  1ZYR C;  3E9I A;  4AH6 A;  5C44 B;  3HOX G;  5GAD C;  2HUG A;  4BY1 B;  1L0W A;  5AJ3 L;  1GM5 A;  4XTC S;  3HOZ H;  1AFP A;  3NQT A;  1EWH A;  2F0T A;  3PF5 A;  4UPA A;  5CV9 A;  4DU9 A;  2ZJR A;  1SFO H;  2NN6 G;  4WJ3 M;  3E0E A;  4F7X A;  1YVC A;  3H3V C;  1FJG Q;  1M4V A;  2F3I A;  4KV6 A;  2NVT H;  3NXW A;  4X62 Q;  1KC8 C;  1PH6 A;  2UU9 Q;  1HUN A;  4B3S Q;  4X62 L;  4HJ5 A;  1VF5 C;  1TWC H;  4ILW A;  1YIT A;  5BN5 A;  3FRP B;  5G3L D;  5KNC A;  4LF6 L;  2B2T C;  1NR2 A;  1SND A;  3FHW A;  4OXP A;  2K05 A;  4CDF C;  3ERO A;  2NYZ D;  3I4N G;  3WWV A;  1LTI D;  1TII D;  1D5M C;  3I56 A;  1LTB D;  1V1Q A;  3S1R B;  4BWG B;  1EUJ A;  5I9P A;  1NUC A;  4OON A;  3HOV H;  1YHB A;  4LF6 Q;  4LNQ A;  3HOU B;  5IGF A;  4OWX B;  1K8M A;  3WDN A;  1C9O A;  4JI2 Q;  4NB3 A;  1JC7 A;  4U68 A;  1PFB A;  4YY3 L;  1EQR A;  4A3G B;  2RHQ B;  3S1N H;  1SJE D;  1MSH A;  2K7V A;  2N3S A;  1Q82 C;  1EIG A;  1QVG A;  1E7Z A;  2JA6 G;  1O7Z A;  2XVS A;  2I5H A;  3S15 B;  4DPG A;  2RBM A;  1ASY A;  2MFI A;  4ME5 A;  3DXJ C;  3H3V H;  1PTO C;  2HIV A;  1RL2 A;  5D3D A;  3HGB A;  1K83 H;  3IFT A;  1F9P A;  5EKI A;  4L5T A;  3C46 A;  5IYB H;  2L5T A;  3VR4 A;  1WYD A;  2NWG A;  2CWA A;  1B50 A;  2WKD A;  2FJ2 A;  3CCE A;  3H91 A;  2NVT B;  1VQG A;  2XTI A;  3TBI B;  1SE8 A;  1O80 A;  4JBW A;  4DV0 L;  2C9O A;  3BU2 A;  3CXC A;  3S1Q H;  1QZH A;  1IYJ B;  1IKL A;  3EN2 A;  4TKO B;  3GTL H;  3RN2 A;  2LXJ A;  3V96 A;  2WB1 G;  4HIK A;  1EWI A;  4X3K A;  1BXT A;  3BZC A;  2JA7 G;  4C2M B;  3NWS A;  1W3S A;  2KUM A;  5J3B A;  3J81 j;  4EQO A;  5T1I A;  4PQX A;  3DEO A;  4UAI A;  1STH A;  4IUN A;  1N33 Q;  4KJN A;  4ZK9 B;  4B9X A;  1V43 A;  4RCN A;  4N9P A;  2EYO A;  1SYC A;  4B9W A;  1ILP A;  1RJT A;  3I72 A;  1D5Z C;  2N78 A;  4IAL A;  4IPD A;  3QG1 A;  2E76 C;  3VR6 A;  2L1B A;  1ZKO A;  4QL5 A;  1H9S B;  3TP6 A;  3M9B A;  3UI2 A;  2WP8 J;  1GUW A;  1A8V A;  1MKH A;  2KEE A;  4BBR B;  4DK0 A;  2JP1 A;  1I5F A;  2PNH A;  2UXB Q;  1LTS D;  1TT2 A;  2ZTC A;  1LM0 A;  1Y14 B;  1MHW C;  1QE6 A;  1MSG A;  1VQJ A;  4MNO A;  2A6E D;  2Y0S E;  3CKI B;  3A56 A;  2RDH A;  1DOM A;  1UE5 A;  3CF5 A;  1WTR A;  1KAB A;  5ISR A;  2AMC B;  2BH8 A;  2NVY B;  3PMF A;  4KY7 A;  5IWA L;  3J7A 5;  2OT2 A;  5D14 A;  2F3V A;  1CSQ A;  1E3P A;  1YJN A;  2DGY A;  5C0X H;  3GTL B;  5DNF A;  4C56 C;  3G4S A;  4IO9 A;  1VQ5 A;  1CI3 M;  4NXM Q;  2EYF A;  1E2V A;  1BBU A;  1X3G A;  3C1E A;  4JYA L;  3HKZ B;  3MFY A;  1G29 1;  4DXF A;  1VQK A;  2FXQ A;  4DR3 Q;  2G9D A;  2CW0 C;  3I4M H;  3M3Y H;  5M5X B;  3DM1 A;  3GP7 A;  5GQO A;  1GXD C;  2F0F A;  2K28 A;  1TS4 A;  5C4J B;  2WB1 E;  4XXE A;  5CV8 A;  4A3K G;  5FLM H;  1ZEQ X;  2EVB A;  2LFN A;  4U67 3;  2JA8 B;  2Q8R E;  4DAV A;  1XXG A;  1WI5 A;  4AYB G;  2DJG C;  3GQB A;  2L4N A;  5K5P A;  4X66 Q;  1I50 H;  1IYV A;  4HED A;  3E3X A;  1B8A A;  3EQL C;  1UWV A;  5M3M H;  3S14 H;  4KHZ A;  4DV4 L;  2EYL A;  1I4X A;  1AZP A;  1TWH H;  3RMH A;  1HHV A;  5FLX c;  1YHA A;  5CV7 A;  2RSN A;  1SNM A;  4C3I H;  4H44 C;  3H15 A;  2PCF B;  3I70 A;  2JA6 B;  1SDF A;  3KF8 A;  1MIU A;  1EIF A;  3CCJ A;  3Q24 A;  1VQL A;  3NQI A;  4IUV A;  1N34 Q;  1A63 A;  1YNX A;  3P1H A;  4A3J G;  5HGQ A;  1A6X A;  1N34 L;  2OCE A;  3PO3 H;  4A3F G;  2LMC B;  4IOA A;  1LTL A;  2D0P A;  1CT1 D;  1QOH A;  1EYG A;  1MGS A;  3OW2 A;  1SE4 A;  3OWF A;  5CGK A;  3S15 H;  1BNZ A;  1GUO A;  1LLR D;  1AN8 A;  4C3J G;  2K5Q A;  1PA6 A;  4LF8 Q;  5GAE C;  4RG1 A;  1MJE A;  3PUY A;  1F9Q A;  4YIJ A;  1N9W A;  1KQS A;  1YNN D;  5EKK A;  1XJV A;  4HTH A;  5M5W H;  3SR1 A;  4L8J A;  1BKB A;  1JR0 D;  3I4N B;  1I3Q H;  1E22 A;  1PV4 A;  3PO2 G;  1EL0 A;  4CJ2 C;  1WTQ A;  3L0O A;  2JK8 A;  1WTX A;  2NB0 A;  2CW0 D;  5FJ8 H;  1DM0 B;  2FHT A;  2IX1 A;  2JEA I;  4KKT A;  2E2D C;  1Q12 A;  3RLN A;  3M85 A;  3ZJY C;  2XGT A;  4PV1 C;  4DGZ A;  3RZO H;  1YZ6 A;  4ZRZ A;  1FGB D;  4RKL A;  2Y0S G;  1MI2 A;  1B9M A;  3HOZ B;  2UXD L;  3NBH A;  4IZ8 A;  4P72 A;  4GS3 A;  5EGT A;  3VYS A;  5LHY 1;  5JEA G;  2H1E A;  4JI7 Q;  3RUZ A;  1PLF A;  5HUR A;  5LMN Q;  2R92 H;  1VQO A;  2TSS A;  4DK1 A;  3KOJ A;  4A3G G;  4H13 C;  1B53 A;  1TWF H;  2F0L A;  5IOC A;  4CGY B;  1C7Y A;  1N36 Q;  1FJG L;  1LT3 D;  3HRZ C;  2B2W A;  1D8L A;  1Z9F A;  4DV2 L;  2RCF A;  3ONA B;  4JV5 Q;  3OIP A;  5A35 A;  1S5F D;  5I2X A;  3FP9 A;  1SLJ A;  4FNF A;  2JXM B;  2O5J C;  2DNE A;  4V19 0;  5COY A;  4A3I G;  2NUC A;  2WKC A;  4K14 A;  2DN8 A;  2MO1 A;  2R93 G;  4WJ4 A;  3DMU A;  2JN4 A;  3ZYY X;  5LL6 X;  2E2H B;  4GKJ L;  3IL8 A;  3K57 A;  3MFG A;  1ASZ A;  4DR6 L;  4LUV A;  3DWA A;  4B3M Q;  3HOU H;  1VQH A;  4JBJ A;  3KLS X;  4DUY L;  2BA1 A;  3S16 B;  4CJ1 B;  2RCN A;  3AFQ A;  1P8L A;  2QGQ A;  2B39 A;  4MZ9 A;  4A3M G;  4DR1 L;  1AE2 A;  3PO2 B;  1X3P A;  2NN6 I;  1YNN C;  1BUV T;  5EPK A;  5M3M B;  3EIV A;  4GN4 B;  4RAU C;  4P74 A;  4HMI A;  5G3L F;  5CC4 A;  1PH5 A;  2IW3 A;  1R9T H;  4RCO A;  1N32 L;  4XT3 B;  1TWG H;  5I6Y A;  4ME3 A;  5I4D A;  2UXB L;  3GTK H;  4C3J B;  4LF4 L;  3RZD H;  3S1R H;  2D9U A;  2WV6 D;  4XIG S;  5ELC A;  4JI5 L;  4TRD A;  4GKK Q;  4IFD H;  1M1K C;  1Q86 C;  4MN3 A;  3GTQ H;  3R2T A;  3Q23 A;  3I8Z A;  2JA8 G;  4RFB A;  1ROD A;  1M90 C;  2K6A A;  5C44 H;  1JOK A;  4A3E G;  1EQV A;  4JI0 Q;  3D8G A;  4LF5 L;  1SN8 A;  1GUG A;  1VQN A;  1EIY B;  1TWA B;  4BBS B;  5IP7 H;  1D5X C;  3HKZ E;  3CHB D;  2R93 B;  3AQQ A;  1QJO A;  5M5W B;  1DD2 A;  1GUN A;  1MD2 D;  2OXP A;  2HD3 A;  2O4X A;  1O7I A;  3H0G H;  4CDE C;  4JBK A;  3A54 A;  4DNR B;  3TSS A;  4WJW A;  2EYH A;  1F2M A;  3DWP A;  2KCC A;  2RHS B;  2L12 A;  4HJ9 A;  3PIP A;  1L2F A;  1TVX A;  5IGC A;  1EFI D;  4JI0 L;  3VR3 A;  1HTP A;  1HFG A;  1LAB A;  5C5L A;  3GTG B;  2XN9 C;  3FVQ A;  3FKI G;  1PH8 A;  4PMB A;  4N8F A;  3K7A H;  4K0K Q;  1PRT F;  2E74 C;  2YYZ A;  2ZJP A;  5EBD A;  1X9N A;  3M4Q A;  1DYQ A;  1PZJ D;  1L1O B;  1LT6 D;  1RF2 D;  4ZAI A;  2AQ1 B;  2PPB C;  1G6Z A;  4BBR H;  1IL8 A;  3BYT B;  1XPU A;  2AKW B;  2LKV A;  3J81 L;  4O2D A;  3CPW A;  3RZD B;  4ID6 A;  3I91 A;  4LFB Q;  2QW7 A;  1Q8I A;  3DEP A;  1DOK A;  2YTV A;  4QF4 A;  2EYM A;  5HY6 A;  1YIJ A;  2A8V A;  1PH9 A;  1U4M A;  4XT1 B;  4BY1 G;  2F0I A;  4RGM A;  4B3S L;  3T1H L;  2E2J H;  4K5W A;  1SYF A;  2WIN B;  1UEB A;  1TXY A;  4LWC A;  4DV3 L;  2G5D A;  4BBR G;  2CQA A;  1GUT A;  3L2P A;  3QJY A;  4WOR A;  2VXW A;  2KEN A;  2XIW A;  5CBA E;  1Q46 A;  1BOS A;  1YNJ D;  1J8I A;  4GNX C;  2HIX A;  1XNQ L;  3I4M B;  1SR3 A;  3CC2 A;  1HPC A;  3FPU B;  4IQZ A;  3HOW H;  4CDD C;  2JA5 H;  4DK3 C;  1A15 A;  2K01 A;  3FKI H;  3PV0 A;  1E1O A;  1CKO A;  1GVP A;  4RHR A;  1G8Z D;  2HDM A;  5D3I B;  4QUC A;  3TEH B;  1S5B D;  3E6Z X;  3BZK A;  4DV3 Q;  2NVX B;  2BA0 A;  3W5O A;  2Z6K A;  2SNM A;  3NBI A;  5IY0 A;  4EQN A;  3H0G G;  1NMG A;  4DV5 Q;  1V9P A;  5KYI A;  3R3O A;  3D0F A;  3MXU A;  5JVH 3;  4A3D H;  4KHP L;  4JI1 Q;  3D31 A;  4A3L H;  1NBW A;  2MQH A;  1VQI A;  4K5X A;  1JWM D;  1VQ4 A;  2CCZ A;  4BS9 A;  5AJ3 Q;  3S1N B;  4TSS A;  4RKB A;  4A93 B;  2AQ3 B;  1LV9 A;  1JCK B;  1K0S A;  2F0U A;  1EOT A;  2AHO B;  1HNZ Q;  1EYA A;  1OXT A;  2O5I C;  5DM6 3;  2E8G A;  5FOB B;  1TY0 A;  1BBX C;  2B8F A;  1EY9 A;  4KKU A;  1KHI A;  3F8T A;  2QEX A;  2MNA A;  4DV1 Q;  1GHJ A;  3TS0 A;  2VQE Q;  1XMQ Q;  3CMA A;  4ZUJ A;  1PHJ A;  5CV4 A;  1Q1B A;  1TWF B;  3SK4 A;  1KLU D;  3KF8 B;  2AWO A;  1RCV D;  2JYO A;  2L9H A;  3UE0 A;  1U4P A;  1NTG A;  5C4H A;  4OEL B;  3OMG A;  1Y1W H;  4I7Z C;  1X56 A;  1KIX A;  3KDF B;  4FO2 A;  1J5E Q;  1SMY D;  4OGQ C;  2EIF A;  4JW0 A;  1L0Y B;  3A8I E;  3P7J A;  1I94 L;  4DV7 L;  2E2H H;  2QCP X;  3HFZ B;  3KJO A;  2NZH A;  2UUB L;  5BN3 A;  3OYY A;  1GO3 E;  4AYB B;  2VUM H;  4Y7N H;  4BXX H;  3BDL A;  4ODG A;  3HOU G;  1QCB D;  3S16 H;  3CU7 A;  1DJR D;  1CSP A;  3SVM A;  2NTS A;  1EQT A;  4YHH L;  2NTT A;  1EY6 A;  3L9A X;  3STB C;  4I7A A;  2AWN A;  5M5X H;  4UP8 A;  4K6D A;  4A3I H;  3UDI A;  2M00 A;  1EIH A;  4G7H C;  4LF8 L;  1MJC A;  3LWE A;  4BBS G;  1B9N A;  1B44 D;  1SJH D;  3F2U A;  3MEH A;  2I5M X;  4G57 A;  1N8R C;  3EJI A;  2Z6K C;  1R9T B;  2KEC A;  2K5V A;  2TMP A;  1QWY A;  2UXC L;  1JOO A;  4RGO S;  1D1I A;  3NBH B;  3S1M H;  1I6H B;  1CFM A;  2JQO A;  2IT1 A;  2R92 G;  1ET9 A;  4OWT B;  1Q7Y C;  1BVS A;  4X3S A;  4HJ7 A;  5JEA H;  1FNV A;  1PYW D;  4M8A A;  1KDA A;  2A68 D;  4L5S A;  3IKJ A;  1B7Y B;  2K52 A;  3K8A A;  2VNU D;  2BCO A;  2OQK A;  1PFM A;  1BDO A;  2MUY A;  2A69 C;  2NVY H;  3NTI A;  4JOI C;  1X65 A;  5C4Z A;  1CA6 A;  1FNU A;  2F0M A;  4A93 G;  2F4I A;  3T1Y L;  4EVO A;  3SHL A;  3L7Z C;  3CC7 A;  3EA6 A;  1WOC A;  4RGN A;  2K5H A;  5FJ8 G;  4BA1 I;  1HQM C;  3M7G A;  5ELE A;  1NSN S;  3GD7 A;  3R93 A;  3OTO L;  2N55 A;  4IOC A;  3CRL C;  3MAQ A;  4LF9 L;  5KGU A;  1LT5 D;  3CD6 A;  4DKA C;  1KNE A;  1PYB A;  5IGB A;  4NXN L;  2PI2 E;  4DR2 Q;  3AEV A;  2JA9 A;  3A74 A;  4DR1 Q;  4HCS A;  2KVM A;  4LAA A;  4L6T B;  4KD3 A;  3LGJ A;  1EEI D;  3K0Y A;  4RMF A;  4C3J H;  1SAP A;  3U50 C;  3TP7 A;  3U4V A;  2DY7 A;  2X6G A;  2CH4 A;  2HQL A;  1QG7 A;  4PZ8 A;  4NW2 A;  1D7Q A;  3PO3 G;  4E6I A;  4DAM A;  2F3W A;  2NVQ H;  4IUU A;  2M9V A;  2NBF A;  4DV6 L;  1XNQ Q;  4C1N K;  4QB4 A;  2VY3 A;  5HGT A;  1PZK D;  4DV2 Q;  3ULJ A;  1NCV A;  4QIW E;  4AQY Q;  4P73 A;  1G6P A;  2A5H A;  5BR8 Q;  3F2C A;  3CCR A;  4A3D B;  1LTT D;  4IUT A;  1JMC A;  3ER0 A;  4K2L A;  2B2W C;  1JE5 A;  2Q8I B;  3GTP B;  2RA4 A;  4LFC L;  2VQF L;  1K28 A;  1JJG A;  2EYJ A;  4RWS C;  2B2T A;  4DAP A;  2XSC A;  4TQU S;  3S2H H;  3MTS A;  4I65 A;  5E1F A;  2J0T D;  4LK1 C;  4GLV B;  2A74 C;  4KMU C;  4AYB E;  4DV5 L;  2VUM B;  4KJO A;  1KTK A;  1PTO B;  1CUK A;  2VQE L;  3W1B A;  5KNB A;  4B3R Q;  2WAQ B;  4A3K H;  1CK1 A;  3NPP A;  3A7L A;  5BR8 L;  3U9O A;  2Z0S A;  4JI2 L;  2BDO A;  3AFP A;  3K7A B;  4X64 L;  3BVG A;  5GAG C;  3GTJ B;  3SK8 A;  5FO9 B;  1EU3 A;  3H94 A;  3FKI B;  2OTL A;  1NE3 A;  2JE6 I;  4HCE A;  1SXT A;  1HZB A;  1LT4 D;  1STN A;  4UP7 A;  5NUC A;  5M5Y B;  4DV6 Q;  1HTL D;  3J7Z C;  3PUX A;  1E24 A;  5ELF A;  1PH2 A;  4MIU A;  3GV3 A;  1GUS A;  1WD1 A;  1EY8 A;  1S4Z A;  2EY5 A;  3OPO A;  2PI2 A;  1I6H H;  4FXG C;  1JOQ A;  3FPP A;  1IYU A;  1OXX K;  2Z1C A;  1L1O A;  1TS5 A;  2D5D A;  3RD4 A;  3OSO A;  3PIO 3;  3ITP A;  3AMU A;  1G91 A;  1K0R A;  4A93 H;  5KND A;  1KLG D;  5KYL A;  3E9H A;  1XPR A;  1YNJ C;  5JPM C;  1SEB D;  3ND9 A;  1IL2 A;  3SE0 A;  1QNU A;  2VB2 X;  1V1O A;  2R7D A;  1EOV A;  4YCV A;  2QDL A;  5COR A;  2E2I B;  1W6J A;  1CHQ D;  5M3F B;  1JIC A;  3BVM A;  4J6H A;  1A0I A;  1WFQ A;  1S5E D;  3VYR A;  1N32 Q;  4GNX B;  3LWU A;  2IHE A;  3W2D A;  5EQ0 A;  1WTV A;  3SK6 A;  2Z6B A;  3TDQ A;  2QIL A;  2R7F A;  1HZC A;  2GVB A;  4MTN A;  2F0K A;  4OIK A;  1PH1 A;  3JAM c;  3TP5 A;  3NP8 A;  3P20 A;  5IE8 A;  4QJF A;  4BBS H;  1XTD A;  1EZ8 A;  5GRO A;  3VR5 A;  1O78 A;  5DAU A;  5IWA Q;  2JEB I;  1H9K A;  3SEB A;  2MO0 A;  1JB3 A;  4A3M B;  3K81 C;  3K80 C;  1IBL Q;  1N36 L;  1A3T A;  2IL8 A;  1SFO B;  2A68 C;  2K5D A;  4Y7N B;  1IW7 C;  4OEM B;  4R4T A;  4LF4 Q;  2PMZ E;  3G6E A;  3HP3 A;  3G6J B;  5T1G A;  2B2Y C;  4BXX G;  2VUM G;  3P75 A;  1VQE A;  3UDX A;  4KHP Q;  4ABN A;  1XNR L;  4PZ7 A;  4L63 B;  4P75 A;  1UE1 A;  3K58 A;  2QF7 A;  2EOT A;  2IJ0 A;  3Q0A A;  3J81 c;  5E4W C;  1Y1W G;  1HNX Q;  4ULL A;  4EQ5 A;  5IYB G;  4ZCK A;  4DR4 Q;  1BBW A;  2QKI C;  3BG3 A;  3VYU A;  3IRB A;  1F77 A;  2V1C C;  4DR2 L;  2F0D A;  1U4R A;  1OXS C;  1LAC A;  4GN5 A;  2MPM A;  2JA6 H;  3CRK C;  1HZ9 A;  2ZT9 C;  4BY7 B; 
#chains in the Genus database with same CATH homology
 2Z4H A;  3S1M B;  1L0X B;  1AP0 A;  1JOR A;  2K1B A;  4DFA A;  2ID0 A;  3QB3 A;  2NVQ B;  3I3C A;  1S5C D;  1H9M A;  1DCZ A;  2HCC A;  3VR2 A;  1F9S A;  3C1F A;  5FK9 C;  1B4O A;  2EY1 A;  1GHK A;  3OOC A;  1I4H A;  1IHZ A;  1WTW A;  3G7L A;  3J7A F;  1V8Q A;  2PZU A;  3HOY B;  1PTO D;  2ZXP A;  3NTH A;  1RD9 D;  2JA7 B;  4G4K A;  3A55 A;  1TS3 A;  2L11 A;  3C3L A;  2F0W A;  2WB1 B;  2ZXR A;  1SYD A;  2EJG C;  1DZ1 A;  5FLX E;  1CA5 A;  1FYC A;  5FKA C;  2ENB A;  2AQ2 B;  4ZKC B;  2A69 D;  2PMZ B;  5I2Y A;  2RKS A;  5IIF A;  2NN6 H;  3FMC A;  1RDP D;  1II3 A;  3D4W A;  2F0G A;  2G9H D;  1SE3 A;  3T4A C;  3GTK B;  4F87 A;  2RVL A;  4GZY C;  1VMC A;  1PRT D;  4WFN 3;  4QCL A;  5IOD A;  1TR5 A;  1ET6 A;  4OO1 I;  4IUR A;  1AZQ A;  1E2W A;  2DNC A;  4IN3 A;  1ICW A;  3HZX A;  2Z4I A;  3TME A;  5JOB A;  5CV5 A;  3R2I A;  1KAA A;  1Z7T A;  2B2U A;  4ZUI A;  1ML0 D;  3TZU A;  2M2L A;  2PNR C;  3TN2 A;  1Q1E A;  2C5C A;  3I4L A;  1Q3L A;  4F8M A;  4A3K B;  1XTC D;  4RH6 A;  1Y69 U;  3SXH A;  5IGD A;  1WCM B;  5E4X A;  5I9O A;  4KTA A;  5F2D A;  1SYE A;  2RDG A;  3NTK A;  2I46 A;  2F03 A;  1ILQ A;  4K2K A;  1B1Z A;  2IX3 A;  3QOL A;  3MWY W;  1NAP A;  4QUF A;  4KD4 A;  4DF7 A;  1B2T A;  3K59 A;  2SOB A;  2BE5 C;  3T53 B;  1MBY A;  4CHT B;  1AEX A;  4Z9C B;  3LNN A;  1A3U A;  5C0X J;  4DAY A;  1C8C A;  3J7A V;  1VMP A;  3DUZ A;  3HOX B;  2D2C C;  5C3E B;  4PMC A;  1IW7 D;  3T16 A;  3OMC A;  3FDT A;  4R8N A;  2SDF A;  4IFD G;  2EY6 A;  2EZV A;  4C1N I;  3A8J E;  1EYD A;  3K5L A;  1HRJ A;  1JWU D;  3SDZ A;  1D1K A;  4HSP A;  1Z47 A;  1SMY C;  4F88 A;  2PW7 A;  5J39 A;  1JQY D;  1OXV A;  1A2U A;  1AW7 A;  1A3V A;  5DM7 3;  2EJM A;  1A2T A;  1F2Z A;  4QIW B;  3KBX A;  3TZD A;  1CHP D;  1STE A;  4NMZ A;  3QOJ A;  2B63 B;  3N6R A;  1EY7 A;  1S5D D;  2B8G A;  4KHV A;  3RZO B;  3N52 A;  1QB5 D;  1TQO A;  3MHB A;  1TWH B;  2K5W A;  2KA7 A;  2PW5 A;  4OL7 A;  2KQ3 A;  3QIA A;  3GTO B;  3AU7 A;  5C5M A;  1K83 B;  1ZYR D;  3NE5 B;  4XYQ A;  3PIP 3;  1U9R A;  3D6W A;  2EY2 A;  1E0B A;  2NZ1 D;  5FLX L;  5EPL A;  1RHP A;  3QWN A;  1HA5 A;  2BE5 D;  3PUW A;  3R8B A;  3ERQ A;  2PZT A;  1DXM A;  1EZ6 A;  1HCZ A;  2F0S A;  2KJX A;  3VYT A;  2MP1 A;  2I07 B;  5C4X B;  1T5X D;  2A6E C;  4G7Z C;  2J7Z A;  1G2T A;  3CQZ B;  5D65 A;  4OIJ A;  3SK5 A;  3HG9 A;  1HQR D;  4C3I B;  2R61 A;  2JA5 B;  1D6E C;  1CM9 A;  4ZQ3 A;  2R92 B;  3QO2 A;  1G2S A;  1E2Z A;  1I4P A;  3A8K E;  4KN7 C;  1BCP D;  1EEF D;  1BF4 A;  2RQX A;  2EDG A;  5C6A A;  1HXY D;  4NKL A;  2QDB A;  1LTG D;  3BDC A;  5EKL A;  2KED A;  1B3A A;  1I50 B;  3VA5 A;  3MZ5 A;  1CZW A;  5EPJ A;  3L3O C;  3T56 B;  1UAP A;  4XQQ A;  3MC0 B;  3MXG A;  4ZYS A;  3OW7 A;  4C3I G;  1FR3 A;  2MGS A;  5JPN C;  1M8A A;  5TSS A;  4A3B B;  5KRU A;  1F9R A;  1WTP A;  2MHV A;  1Y1W B;  3I73 A;  2GA4 B;  3IAY A;  3ND8 A;  3KUP A;  4FF1 A;  1ESR A;  3S1Q B;  2IPK D;  1CQV A;  3HS0 C;  3K5O A;  3GO5 A;  5JVG 3;  5KIX A;  5IT9 L;  2WAC A;  2PO4 A;  4A3I B;  2B2Y A;  3OHX C;  1PRT C;  2VB3 X;  1GJX A;  4KKS A;  1BR9 A;  3S14 B;  3E5S A;  5BN4 A;  5C0X G;  3WOE A;  3M3Y B;  1TU2 B;  1ENF A;  3GTQ B;  3OIQ A;  4FYD A;  2XNA C;  2X6L A;  2OF1 A;  2FMM A;  2KHS A;  5E3F A;  3D6C A;  4HN7 A;  1VCI A;  3JAM E;  3BVZ A;  3U9S A;  1KNA A;  2F0E A;  2EXZ A;  2FMC A;  4HMJ A;  2R6G A;  2ICE C;  4K8J A;  4KI0 A;  2L55 A;  1PFN A;  2D62 A;  1WD0 A;  2BOS A;  1C48 A;  3I90 A;  5A2Q L;  1NR4 A;  3Q22 A;  1EYC A;  2SNS A;  1RKN A;  4UDU C;  4CKC A;  2AUK A;  1K8O A;  1STY A;  5K36 G;  2Q8T A;  2EE1 A;  5JJZ A;  4J1M A;  2XWJ B;  1Y8N B;  3S2D B;  1O7Y A;  4KY6 A;  4DN4 M;  1Y8P B;  1V1P B;  2R7Z B;  2RDF A;  1CTM A;  5EBC A;  4HR7 B;  4ZKB B;  4RA8 A;  5EJW A;  4O42 A;  2PZW A;  2J4X A;  5I6W A;  3TP8 A;  4FF4 A;  3DHQ A;  2JSO A;  5DEH A;  4V0B A;  4A3F B;  1JWS D;  1JE4 A;  1PRT B;  3EVQ A;  3URY A;  4DXG A;  2FFK B;  3S17 B;  3J80 E;  1VF7 A;  3KLS A;  3M7N A;  3K6O A;  4O1N A;  2BDN A;  2F0N A;  2CHB D;  4CKE A;  1C4Q A;  4MHE A;  5K36 H;  1STB A;  3GTM B;  3VA7 A;  2XRQ D;  4K8I A;  4IUP A;  1R4P B;  5LL6 S;  2K04 A;  2A73 B;  1KDB A;  1OXU A;  3PUZ A;  2XWB B;  1EU4 A;  3M4O B;  4CJ0 B;  1PTO H;  4A3J B;  1TWC B;  2PQE A;  2HDL A;  2PYK A;  4Q0F A;  3KBG A;  4FVM A;  4LMQ D;  1ENC A;  4A3E B;  1KDC A;  1UUP A;  1SYB A;  3D3R A;  4FP5 D;  2SEB D;  1EY0 A;  4KY5 A;  2R3Z A;  3Q6S A;  3E0J A;  5KEE A;  3C2P A;  4IUQ A;  3HOV B;  3V2T A;  4IFD J;  2E75 C;  2V4D A;  1TKW B;  2L0C A;  3NSW A;  5FO8 B;  2HQE A;  3HOW B;  1R4Q B;  2IWH A;  1I6V C;  5JAV A;  1FD7 D;  1H9J A;  1SBB B;  3KK7 A;  4C3H B;  1CZG A;  4PMW A;  1IKM A;  5CMD A;  1XX8 A;  1LTA D;  2B2V C;  4S3S A;  3H6M A;  5IT9 E;  1I4G A;  3W3A A;  1EY5 A;  5J1Z A;  1Y8O B;  5CYU A;  2KCN A;  2F0O A;  1TS2 A;  3BZD B;  3A7A B;  1Q90 A;  4XQN A;  4G7O C;  1SNQ A;  2RSO A;  3M4Y A;  1J9O A;  3JAM L;  1UNS A;  1U4L A;  3MXP A;  4RGT A;  1SNC A;  1QIL A;  1X32 A;  4K6L A;  2A6H D;  1DON A;  1F2Y A;  1PTO F;  1ESF A;  1SE2 A;  3T13 A;  1SNP A;  3WOF A;  4KN4 C;  3PO3 B;  1PDQ A;  2F1M A;  4BA2 I;  2O2L D;  3LX0 A;  4OO1 H;  4R9W A;  5IGG A;  4ZLT F;  2XRS D;  4PNY A;  1EY4 A;  2N88 A;  1XYI A;  3H0G B;  4C3H G;  4FXK C;  5CV6 A;  3GV6 A;  2B2V A;  3DWQ A;  3MXN A;  5A2Q E;  4XDX A;  1XWE A;  1SNO A;  1I3Q B;  1OO9 B;  4DA2 A;  3MA2 B;  2F0P A;  4HSV A;  1I4Q A;  4H0L C;  3FEW X;  1RTN A;  1T5E A;  2QEJ C;  4NDX A;  5ELD A;  1H9S A;  2ZXO A;  1BO0 A;  3T51 B;  2Z8L A;  3D4R A;  3OWE B;  2KOL A;  2F0V A;  5C3W A;  4X3U A;  2MJ8 A;  3EFX D;  3IFD A;  1ENA A;  3D4D A;  2F0J A;  1I4R A;  2E2J B;  3KLR A;  3O13 A;  3X3N A;  4QMG A;  1WTO A;  4FXD A;  2EPB A;  3J80 L;  4FF3 A;  1TY2 A;  1QNK A;  4X3T A;  2A6H C;  2K32 A;  2K33 A;  1D2B A;  1LTR D;  2CVR A;  3S2H B;  1HFN A;  1CQF A;  2H4O A;  3MVV A;  1BCP B;  2AUJ D;  1SSO A;  5M9O A;  2F0H A;  5IGE A;  1RTO A;  3K5M A;  5C0X I;  2LS0 1;  3BYY B;  1ZXT A;  2LY7 A;  4XYO A;  5CR3 A;  1PMR A;  2IX0 A;  4J8Q A;  3AB9 A;  4IFD I;  3BDO A;  1LO5 D;  4P2C B;  1TWG B;  4JK1 C;  5CBE E;  4XQJ A;  4Q5V A;  4FF2 A;  4K5V A;  1DOL A;  4LJZ C;  2HCI A;  5J22 A;  5C3X A;  1STA A;  3J7Y W;  3HEJ A;  4CBV A;  5JEA J;  2DY8 A;  4KK7 A;  2Y0S B;  1PXU A;  2YU9 B;  1VDZ A;  1HUM A;  1UEA B;  1EWC A;  1Z6H A;  5FO7 B;  2B2U C;  2WII B;  3V05 A;  1FNW A;  3RLF A;  2ICI A;  3K5N A;  4DNT B;  4H7B A;  3H09 A;  1BCP C;  1W6K A;  1V1P A;  4R8I A;  4NP5 A;  1O7L A;  5AFW A;  3X3M A;  1ONL A;  5ELB A;  4M1U B;  1F2L A;  2X69 A;  2EYP A;  1BQQ T;  4N9T A;  3NHH A;  3NUC A;  4OO1 G;  1PZI D;  1SYG A;  1STG A;  4CKB A;  1X3Q A;  1GOZ A;  3NK9 A;  3NWT A;  1WVL A;  4EQP A;  3S9W A;  3BS1 A;  3PUV A;  1BCP F;  2OEO A;  1H9R A;  4HAE A;  2FIN B;  4B08 A;  4WRD A;  4OHJ A;  2K03 A;  2EJF C;  4EGV A;  2F0Q A;  4RHS A;  3J81 E;  1Y1V B;  1HA6 A;  1ZYR C;  5C44 B;  2HUG A;  4BY1 B;  4XTC S;  1AFP A;  3NQT A;  1EWH A;  2F0T A;  5CV9 A;  4DU9 A;  2NN6 G;  4F7X A;  3H3V C;  1M4V A;  4KV6 A;  3NXW A;  1HUN A;  1VF5 C;  4ILW A;  5BN5 A;  3FRP B;  5G3L D;  5KNC A;  2B2T C;  1NR2 A;  1SND A;  2K05 A;  3ERO A;  2NYZ D;  1LTI D;  1TII D;  1D5M C;  1LTB D;  3S1R B;  4BWG B;  5I9P A;  1NUC A;  3HOU B;  5IGF A;  1K8M A;  3WDN A;  1JC7 A;  4U68 A;  1PFB A;  4A3G B;  1SJE D;  1MSH A;  2K7V A;  1EIG A;  1O7Z A;  2XVS A;  3S15 B;  2RBM A;  4ME5 A;  3DXJ C;  1PTO C;  5D3D A;  3HGB A;  3IFT A;  1F9P A;  5EKI A;  3C46 A;  2L5T A;  3VR4 A;  2NWG A;  1B50 A;  2WKD A;  2FJ2 A;  3H91 A;  2NVT B;  3TBI B;  1O80 A;  4JBW A;  2C9O A;  1IKL A;  4TKO B;  3V96 A;  4X3K A;  1BXT A;  4C2M B;  3NWS A;  2KUM A;  4EQO A;  5T1I A;  4PQX A;  3DEO A;  4UAI A;  1STH A;  4IUN A;  4KJN A;  4ZK9 B;  4B9X A;  1V43 A;  4RCN A;  4N9P A;  2EYO A;  1SYC A;  4B9W A;  1ILP A;  1RJT A;  3I72 A;  1D5Z C;  4IAL A;  3QG1 A;  2E76 C;  3VR6 A;  2L1B A;  1ZKO A;  1H9S B;  3TP6 A;  3UI2 A;  2WP8 J;  1GUW A;  2KEE A;  4DK0 A;  4BBR B;  2JP1 A;  1LTS D;  1TT2 A;  1QE6 A;  1MSG A;  2A6E D;  3CKI B;  3A56 A;  2RDH A;  1DOM A;  1WTR A;  1KAB A;  5ISR A;  2NVY B;  3PMF A;  4KY7 A;  2OT2 A;  5D14 A;  2F3V A;  5C0X H;  3GTL B;  5DNF A;  4C56 C;  1CI3 M;  2EYF A;  1E2V A;  3C1E A;  3HKZ B;  1G29 1;  3MFY A;  4DXF A;  2G9D A;  2CW0 C;  5M5X B;  3DM1 A;  3GP7 A;  1GXD C;  2F0F A;  2K28 A;  1TS4 A;  5C4J B;  4XXE A;  5CV8 A;  1ZEQ X;  2EVB A;  2LFN A;  4U67 3;  2JA8 B;  2Q8R E;  4DAV A;  1XXG A;  3GQB A;  2L4N A;  5K5P A;  1IYV A;  4HED A;  3EQL C;  4KHZ A;  2EYL A;  1I4X A;  1AZP A;  3RMH A;  1HHV A;  5CV7 A;  2RSN A;  1SNM A;  4H44 C;  2PCF B;  3I70 A;  2JA6 B;  1SDF A;  3KF8 A;  3Q24 A;  3NQI A;  4IUV A;  3P1H A;  1A6X A;  2LMC B;  1CT1 D;  1QOH A;  1MGS A;  1SE4 A;  3OWF A;  5CGK A;  1BNZ A;  1GUO A;  1LLR D;  1AN8 A;  4C3J G;  2K5Q A;  3PUY A;  1F9Q A;  4YIJ A;  1YNN D;  5EKK A;  4HTH A;  3SR1 A;  4L8J A;  1JR0 D;  3I4N B;  1EL0 A;  4CJ2 C;  1WTQ A;  1WTX A;  2NB0 A;  2CW0 D;  1DM0 B;  2FHT A;  2IX1 A;  2JEA I;  4KKT A;  2E2D C;  1Q12 A;  3M85 A;  4PV1 C;  4DGZ A;  4ZRZ A;  1FGB D;  4RKL A;  1MI2 A;  1B9M A;  3HOZ B;  3NBH A;  4IZ8 A;  5EGT A;  3VYS A;  5LHY 1;  5JEA G;  2H1E A;  3RUZ A;  1PLF A;  5HUR A;  2TSS A;  4DK1 A;  4H13 C;  1B53 A;  2F0L A;  5IOC A;  4CGY B;  1LT3 D;  3HRZ C;  2B2W A;  3ONA B;  3OIP A;  5A35 A;  1S5F D;  5I2X A;  4FNF A;  2JXM B;  2O5J C;  2DNE A;  4V19 0;  5COY A;  2NUC A;  2WKC A;  4K14 A;  2DN8 A;  3DMU A;  3ZYY X;  5LL6 X;  2E2H B;  3IL8 A;  3K57 A;  3MFG A;  3DWA A;  3KLS X;  2BA1 A;  3S16 B;  4CJ1 B;  2B39 A;  3PO2 B;  1X3P A;  2NN6 I;  1YNN C;  1BUV T;  5EPK A;  5M3M B;  4RAU C;  4HMI A;  5G3L F;  5CC4 A;  2IW3 A;  4RCO A;  4XT3 B;  5I6Y A;  5I4D A;  4C3J B;  2D9U A;  2WV6 D;  4XIG S;  5ELC A;  4TRD A;  4IFD H;  4MN3 A;  3R2T A;  3Q23 A;  3I8Z A;  4RFB A;  1ROD A;  2K6A A;  1JOK A;  1EQV A;  3D8G A;  1GUG A;  1TWA B;  4BBS B;  1D5X C;  3CHB D;  2R93 B;  5M5W B;  1QJO A;  1DD2 A;  1GUN A;  1MD2 D;  2OXP A;  2O4X A;  3A54 A;  4DNR B;  3TSS A;  4WJW A;  2EYH A;  1F2M A;  3DWP A;  2KCC A;  2L12 A;  1TVX A;  5IGC A;  1EFI D;  3VR3 A;  1HTP A;  1HFG A;  1LAB A;  5C5L A;  3GTG B;  2XN9 C;  3FVQ A;  4PMB A;  1PRT F;  2E74 C;  2YYZ A;  5EBD A;  1DYQ A;  1PZJ D;  1LT6 D;  1RF2 D;  4ZAI A;  2AQ1 B;  2PPB C;  1G6Z A;  1IL8 A;  3BYT B;  2LKV A;  3J81 L;  3RZD B;  4ID6 A;  3I91 A;  1Q8I A;  3DEP A;  1DOK A;  4QF4 A;  2EYM A;  1U4M A;  4XT1 B;  2F0I A;  4RGM A;  4K5W A;  1SYF A;  2WIN B;  2CQA A;  1GUT A;  3QJY A;  4WOR A;  2VXW A;  2XIW A;  5CBA E;  1BOS A;  1YNJ D;  1J8I A;  3I4M B;  1HPC A;  3FPU B;  4IQZ A;  1A15 A;  2K01 A;  3PV0 A;  4RHR A;  1G8Z D;  2HDM A;  5D3I B;  4QUC A;  1S5B D;  3E6Z X;  2NVX B;  2BA0 A;  3NBI A;  2SNM A;  4EQN A;  5KYI A;  3R3O A;  3MXU A;  5JVH 3;  3D31 A;  4K5X A;  1JWM D;  4BS9 A;  3S1N B;  4TSS A;  4RKB A;  4A93 B;  2AQ3 B;  1LV9 A;  1JCK B;  2F0U A;  1EOT A;  1EYA A;  1OXT A;  2O5I C;  5DM6 3;  5FOB B;  1TY0 A;  1BBX C;  2B8F A;  1EY9 A;  4KKU A;  1GHJ A;  4ZUJ A;  5CV4 A;  1Q1B A;  1TWF B;  3SK4 A;  1KLU D;  2AWO A;  1RCV D;  2JYO A;  2L9H A;  1U4P A;  5C4H A;  3OMG A;  4I7Z C;  4FO2 A;  1SMY D;  4OGQ C;  1L0Y B;  3A8I E;  3P7J A;  2QCP X;  5BN3 A;  4AYB B;  3BDL A;  4ODG A;  1QCB D;  3CU7 A;  1DJR D;  3SVM A;  2NTS A;  1EQT A;  2NTT A;  1EY6 A;  3L9A X;  2AWN A;  4K6D A;  2M00 A;  1EIH A;  4G7H C;  3LWE A;  1B9N A;  1B44 D;  1SJH D;  3F2U A;  3MEH A;  4G57 A;  3EJI A;  1R9T B;  2KEC A;  2TMP A;  1QWY A;  1JOO A;  4RGO S;  1D1I A;  1I6H B;  1CFM A;  2IT1 A;  1ET9 A;  4X3S A;  5JEA H;  1FNV A;  1PYW D;  4M8A A;  1KDA A;  2A68 D;  3IKJ A;  2VNU D;  2BCO A;  1PFM A;  1BDO A;  2MUY A;  2A69 C;  3NTI A;  5C4Z A;  1CA6 A;  1FNU A;  2F0M A;  2F4I A;  4EVO A;  3SHL A;  3L7Z C;  3EA6 A;  4RGN A;  4BA1 I;  1HQM C;  3M7G A;  5ELE A;  1NSN S;  3GD7 A;  3R93 A;  2N55 A;  3CRL C;  3MAQ A;  5KGU A;  1LT5 D;  1KNE A;  5IGB A;  4HCS A;  2KVM A;  4LAA A;  4L6T B;  4KD3 A;  1EEI D;  3K0Y A;  1SAP A;  3TP7 A;  2DY7 A;  2X6G A;  1QG7 A;  4NW2 A;  4E6I A;  2F3W A;  4IUU A;  2M9V A;  2NBF A;  4C1N K;  4QB4 A;  5HGT A;  1PZK D;  1NCV A;  2A5H A;  4A3D B;  1LTT D;  4IUT A;  4K2L A;  2B2W C;  2Q8I B;  3GTP B;  2RA4 A;  2EYJ A;  4RWS C;  2B2T A;  4DAP A;  2XSC A;  4TQU S;  3MTS A;  4I65 A;  5E1F A;  2J0T D;  4LK1 C;  2A74 C;  4KMU C;  2VUM B;  4KJO A;  1KTK A;  1PTO B;  5KNB A;  2WAQ B;  1CK1 A;  3NPP A;  3A7L A;  3U9O A;  2BDO A;  3K7A B;  3BVG A;  3GTJ B;  3SK8 A;  5FO9 B;  1EU3 A;  3H94 A;  3FKI B;  2JE6 I;  4HCE A;  1SXT A;  1LT4 D;  1STN A;  5NUC A;  5M5Y B;  1HTL D;  3PUX A;  5ELF A;  4MIU A;  3GV3 A;  1GUS A;  1WD1 A;  1S4Z A;  1EY8 A;  2EY5 A;  3OPO A;  4FXG C;  1JOQ A;  3FPP A;  1IYU A;  1OXX K;  2Z1C A;  1TS5 A;  2D5D A;  3RD4 A;  3OSO A;  3PIO 3;  3ITP A;  3AMU A;  1G91 A;  5KND A;  1KLG D;  5KYL A;  1YNJ C;  5JPM C;  1SEB D;  3ND9 A;  3SE0 A;  1QNU A;  2VB2 X;  1V1O A;  5COR A;  2E2I B;  1W6J A;  1CHQ D;  5M3F B;  1JIC A;  3BVM A;  4J6H A;  1S5E D;  3VYR A;  3LWU A;  3W2D A;  5EQ0 A;  1WTV A;  3SK6 A;  3TDQ A;  2QIL A;  4OIK A;  2F0K A;  3TP5 A;  3NP8 A;  3P20 A;  1EZ8 A;  3VR5 A;  1O78 A;  5DAU A;  2JEB I;  1H9K A;  3SEB A;  1JB3 A;  4A3M B;  1A3T A;  2IL8 A;  1SFO B;  2A68 C;  2K5D A;  4Y7N B;  1IW7 C;  3HP3 A;  3G6J B;  5T1G A;  2B2Y C;  3P75 A;  4ABN A;  4L63 B;  3K58 A;  2QF7 A;  2EOT A;  2IJ0 A;  3Q0A A;  5E4W C;  4ULL A;  2QKI C;  3BG3 A;  3VYU A;  1F77 A;  2F0D A;  1U4R A;  1OXS C;  1LAC A;  2MPM A;  3CRK C;  2ZT9 C;  4BY7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...