4X64L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64L00
3J80c 3M4PA 1EIYB 4R4OA 4QY7A 1Y1VG 2UUBQ 4QJFA 4H02A 4NPSA 1U5KA 3I4MH 4C2MH 1U0LA 1Q7YC 4IJHA 4OO1G 4KHPQ 1S40A 1JJGA 2YTXA 3KFUA 5IYCG 3GTGH 4A3JH 2HIXA 3STBC 4A4IA 1M1KC 4DR7Q 1KAWA 2IY5B 2PI2E 4DK3C 2R92H 1HJPA 2ASBA 1N32Q 4A3MH 1ASZA 3HKZG 1ASYA 4UP8A 4FDBA 4DUYL 1IZ6A 1E1OA 2PNHA 4GLVB 1Q46A 3HOVH 3KYHC 1RIPA 3T1HQ 5DLQE 1VQ5A 2HHHL 1A63A 1H95A 1N9WA 2E8GA 2RCNA 3J81c 3GTJH 3T1YL 3UDFA 3GTQH 4NXML 1CSQA 1T9HA 1TWAH 3PF5A 2KBNA 4DNIA 1Z9FA 3PUXA 1J5EQ 1IBKL 3M85A 1I6HH 1X3EA 4MTNA 1HNWL 4A3FH 4A3DG 5IP9G 3H0GG 4DR6Q 2NZOA 4BBSH 4BXXG 2AHOB 1Q12A 4C3JH 2HT1A 4C3HH 3OTOQ 3RLFA 1VQ4A 2JA7H 4A3CH 1FJGL 2QEXA 2CWPA 2WFWA 2Q2UA 2D0OA 4PZ6A 1QZGA 2ZTEA 4DUZQ 4LFBL 4JI8L 4X62L 3CD6A 3KLWA 2VQFL 2UUCQ 4JI3Q 4DV7Q 3L0OA 3GO5A 5JJKA 5M3FH 3I4NH 3STBD 2F4VQ 3S2DH 4JI4L 5IP7G 1VQ8A 4JCVE 1X3FA 5C3EH 3CCJA 1NE3A 3PUZA 4GKKQ 4X6AH 4R1JA 1RL2A 1UE7A 3TRZA 1E3PA 4P75A 1O7IA 5J3BA 4JOIC 4LFCQ 2MFIA 3UE0A 4A3LH 1SROA 1Y1VH 1N36Q 3A74A 2VW9A 1JJ2A 2B63G 3CC2A 2VY3A 1NBWA 4DV6L 4LUOA 1G51A 1NMGA 3E0EA 2VQEL 1UEBA 3CCLA 5LMNL 4A3EH 4X64Q 1PVOA 2E5LL 1Z47A 3HOUH 2NN6G 2BA1A 3FP9A 2UU9Q 1FVIA 4LF5L 4L5TA 4HJ5A 3I4MG 1OXUA 5C0XI 2JA6H 4ALPA 5C4XG 1VQPA 1HZBA 2UXBQ 3M7NA 1N33L 1HNZQ 4AQYL 3MEFA 1G6PA 4R4QA 1X9NA 2AKWB 3KOJA 4HJ7A 1FL0A 1VCIA 3AQQA 1GD7A 2NZHA 5IYBH 2VNUD 4A3MG 3J7A5 3TS2A 4DV1Q 1IBML 1HZAA 1QUQA 3AFPA 5IP9H 4HJ8A 3H0GH 4OX9L 3GTOH 4R4IA 3CCQA 2LXJA 3HOVG 1I50H 2UXCL 2K52A 2LXKA 3F2DA 3M4OH 5C0XJ 2Z0SA 4A3LG 4OO1I 2B3GA 3NEMA 4DUYQ 4B3RL 2E2IH 1OXSC 2ID0A 2HHHQ 4JG2A 1PH1A 4A3FG 1W3SA 5GAGC 4NXMQ 5IY0A 2JEBI 1IYJB 2CQOA 3JC66 3HOXH 3RN5A 1IBKQ 1QUQB 4X66L 4DAYB 1VQ7A 4JI6L 4LF8L 2R7ZH 4BBSG 4A93G 1HNWQ 2JA7G 1YHBA 3H3VI 4A3CG 3PIOA 4JI1L 1X6OA 1BVSA 1WFQA 5IE8A 2GVBA 1PH2A 1TWCH 3G48A 2JK8A 1E1TA 2WB1G 1XPOA 2ZJQA 3CQZH 1QVFA 1HR0Q 1UWVA 5AJ3L 1FJGQ 5GAEC 4JYAQ 4O2DA 1PH9A 4DK6C 2JJQA 3CPWA 4LFBQ 4LFAL 5M3FG 4OONA 4LUVA 4OWWB 1G291 1L0WA 4DR3L 3I4NG 2XGTA 3ULLA 3A5UA 4JI8Q 1YJ9A 1PH8A 4X62Q 5C3EG 3J81i 2VQFQ 4IOAA 2K4KA 4KLKA 1L2FA 1HNXL 4IFDG 1E22A 1VQFA 3CXCA 3A5ZB 1GM5A 4JI4Q 3PIPA 4NB3A 4YWMA 4AYBG 2OTJA 4X65L 3ER0A 3I55A 2YU9H 4GLXA 1Q1BA 2CKZB 5C4XH 3D31A 4AH6A 1E24A 4YCVA 1I94L 1AE3A 4NXNL 3ICEA 4A3EG 2ZJRA 3BU2A 4DV6Q 1X3GA 3W5OA 4IOCA 2CWAA 5ELOA 2HQLA 4GN3B 3S1MH 2YV5A 3PGZA 3CCSA 1XNRL 2A8VA 3HOUG 2JA5G 1PH5A 2YTVA 2VQEQ 2NVQH 5LMNQ 4APVA 1A62A 1HR0W 4DV4L 3PO2H 1JE5A 1YHQA 3DM3A 2JA6G 2E5LQ 4JOIA 3D0FA 1BBWA 1WCMH 4UP9A 1KHIA 4YY3L 1J6QA 4YHHQ 1Y14B 2RHQB 2Q2TA 4LF5Q 3KF6A 5LMUL 2JA9A 2KCTA 1SE8A 3MXNB 4PZ8A 5IYBG 1JB7A 1N33Q 4LF6L 4AQYQ 3CC4A 4LF4L 3GTLH 3K81C 2Y0SE 1QZHA 1K0RA 1VQ6A 3S15H 4A93H 4RMFA 2Z6KC 5M3MG 4A3KH 1OTCA 1L1OC 4DR2L 1YJWA 4A76A 4OX9Q 4RG1A 4B3SL 3CAMA 1S3OA 5JEAG 2QGQA 5ELNA 4GLAC 5M5WH 1CKNA 3WWVA 1MJEA 2UXCQ 2L15A 3KF6B 2OWOA 1CKOA 5GADC 1KXLA 1LYLA 4DV3L 5EAYA 4GOPC 1PH6A 4B3RQ 2GN5A 4GN5A 3NENA 3HOXG 2UXDL 2K14A 1VQAA 3FKIG 3B6YA 4TVAB 4OWXB 4K0KL 2D0PA 3W1GA 3U58A 1BBUA 2YTYA 1XPUA 3HOYH 4GNXC 1XTDA 4DR1L 4LF8Q 4P71A 2EQSA 1OXTA 4JI0L 4UY8C 3DLLA 4LF7L 4POGA 1CKNB 1UE1A 2F52A 3F1ZA 4A75A 4IPDA 2GVAA 1KRTA 4JI1Q 1N8RC 4LF9L 4AIMA 2BH2A 4QGUA 2XTIA 3CMEA 1EYGA 3KDFA 1Q8KA 4JI7Q 3W1BA 3UDXA 3FHWA 5AJ3Q 4DR5L 4O0AA 3HKZE 4UPAA 3CCRA 1KIXA 2BA0A 1YEZA 2IHEA 4LFAQ 1CSPA 1VQLA 3I56A 4PZ7A 3BZCA 3K80C 4DR3Q 1KD1C 3CC7A 1VQDA 4UP7A 4Y7NH 3CF5A 2JA5H 1EUJA 3S1NH 2JEAI 4GS3A 1Q81C 2K50A 3KJOA 1JJCB 2ZTCA 5M5YH 1K8GA 3I2ZA 1VQEA 1HNXQ 4QQBX 1D7QA 3F8TA 3HOZG 2A1AA 2JE6I 3KDFB 5GROA 1Y1WH 3PCOB 2EXDA 4R4CA 5C4JH 1B70B 4X65Q 4C3IH 4DV0L 3RZOH 4DR7L 3AEVA 1XMQL 3PUYA 1N32L 5BR8L 1I94Q 1SFOH 3JAMc 1EWIA 3SGIA 3PO2G 5M3MH 2IX1A 2ALYB 1GKHA 2BH8A 2WAQG 4TQUS 1WCMG 1XNRQ 4BBRG 1V1QA 3G4SA 2VUMG 1AH9A 3S1RH 4DR4L 2VS1A 4MNOA 3TREA 4DV4Q 2IX0A 1SLJA 4HIOA 4R4TA 2UUAL 3T1YQ 1VQGA 1I5FA 5LMUQ 4JI2L 3FKIH 3PO3G 2I0QA 4A3KG 5M5XH 1HZCA 3GTKH 3I7FA 5FJ8G 2MNAA 3G6EA 1LUZA 4LF4Q 4DAMA 1YITA 4B3TL 5JJIA 4QL5A 1SRUA 4LWCA 2CCZA 4WJ4A 3OW2A 3G71A 4JBKA 3J81j 4DR2Q 1QVGA 4B3SQ 3AFQA 3S1QH 3S16H 2R7FA 3IRBA 4BY1G 5GAHC 2JA8G 1W2BA 4P72A 1K3RA 1EFWA 4DV3Q 3S14H 2K5NA 2N8NA 3HOYG 2UXDQ 3HOWH 5IWAL 4JC0A 3RLOA 4K0KQ 1EQRA 2Z6KA 1BKBA 1Q1EA 3U4ZA 1L1OA 3RNUA 3F2CA 1KL9A 1EQQA 2R7ZG 4JBMA 2JQOA 2ES2A 2KHIA 1YJNA 2FXQA 3PSIA 1X65A 2NVYH 4DR1Q 4JI0Q 2N78A 1WOCA 4DKAC 4LF7Q 1IL2A 1X56A 3AYHB 4DV2L 3HOZH 1VQ9A 4GOPA 4A3BH 2NVTH 5C0XG 4IPCA 2VZAA 2KHJA 3NBHB 5HGQA 3E9IA 3EBEA 1YI2A 1PA6A 4X64L 3CW2C 1GO3E 3ZJYC 3CCMA 4DR5Q 1QVCA 1VQCA 1L1OB 3F2BA 4GNXA 3PUWA 1V43A 5E7NA 5C44G 4ME3A 3LGJA 3RR5A 3GD7A 3VDYA 2UU9L 5IYDH 5FLXc 2PMZE 4JV5L 1N34L 2UXBL 4A3IH 1Y1WG 3Q8DA 4BBRH 5H1SE 5FLMH 1HNZL 2VUMH 1LM0A 1VQOA 1UE5A 1D8LA 4DPGA 3L2PA 4GOPB 1NJIC 2AMCB 1IBLL 3ULPA 1YIJA 3M4QA 4DV1L 3TEHB 1XMOL 4L5QA 4DV0Q 4OXPA 2NN6I 1K83H 4LUZA 4XIGS 4GNXB 1KQSA 1VQNA 3PO3H 1XMQQ 1UE6A 2WB1E 5BR8Q 4JI5L 5FJ8H 1IBMQ 1XPRA 4YCWA 2R93H 2MO1A 1VQJA 2V1CC 2RHSB 2E2HH 4JBJA 4YCUA 3L7ZC 1CUKA 3PF4A 3M9BA 3U4VA 1OXVA 2ZTDA 1B8AA 4DR4Q 3HKSA 4HJ9A 4BY1H 2JA8H 1YZ6A 1K73C 3EIVA 3CCVA 1KC8C 4A3GH 4P74A 5LMNW 2UUAQ 4B3ML 2IT1A 2PI2A 3J7ZC 3CCEA 1E7ZA 3PUVA 4JI2Q 4AYBE 4X66Q 3CCUA 4JI6Q 2ATWA 2R7DA 3H15A 1K8AC 4BA1I 1HR0L 2NVXH 1TWGH 2MO0A 3ULJA 4B3TQ 4LNQA 5K36G 3JAMi 1XNQL 1A8VA 1P8LA 3I4OA 4JYAL 3TS0A 3NELA 3K0XA 4GKJL 4XTCS 3U50C 1YBYA 1X54A 1WI5A 3TQYA 1PV4A 4DV5L 1IXRA 2ZM6L 4BY7H 1M90C 2OTLA 3HOWG 1KRSA 2D62A 4YWLA 2HIVA 1YHAA 1YVCA 1SMXA 5GQOA 4HIDA 4L5RC 1PYBA 1V9PA 1YNXA 2CFMA 2DUDA 3KJPA 2UUBL 4BA2I 5C44H 4IJLA 1C7YA 5IWAQ 5IT9c 1TXYA 2Q2IA 1LTLA 3S17H 2B29A 2H5XA 2IHFA 4KHPL 4A3BG 1GVPA 2A19A 2OQKA 3E9HA 1EOVA 4HIMA 4JBWA 1TWHH 3S2HH 2N3SA 2C35B 4YWKA 3CMAA 4DV2Q 4IFDI 1Q86C 4PG3A 1Q82C 1XJVA 4NXNQ 1HZ9A 5IYCH 1EIFA 2LSSA 1C9OA 1PH3A 1K9MC 2OQ0A 5IYDG 3T1HL 2KCMA 4IO9A 4A3IG 5HY6A 3GTPH 4MZ9A 5FLMG 1VQMA 2N49A 4YHHL 1WYDA 2DGYA 3K8AA 1J5EL 1VS0A 4POFA 2E2JH 3RLNA 4OWTB 3H3VH 3OYYA 4JV5Q 1N34Q 1HH2P 3A0JA 4GN4B 1MIUA 4YY3Q 4KI0A 4A3JG 4DR6L 1MJCA 1VQHA 4IFDJ 4Y52H 2R92G 1B7YB 1IBLQ 1JT8A 1NMFA 2F3IA 3GDEA 4L5SA 3ERSX 3OTOL 3UDGA 2YYZA 1CKMA 3BZKA 4LF6Q 4A3DH 2Q2HA 3GTMH 2R93G 1XMOQ 2I5MX 1MKHA 1R9TH 4BXXH 1C0AA 2WP8J 2ZJPA 4DUZL 2RF4A 4HJAA 3HFZB 4JI5Q 3KF8B 1PFSA 4IPGA 1SR3A 1NY4A 3K7UC 4EX5A 2UUCL 4JI3L 4QIWE 3EN2A 4P73A 4DV7L 2AWOA 1VQIA 3J80i 2R6GA 3UE1A 4A3GG 5JJLA 2F4VL 4WJ3M 1PHJA 3PV0A 3K7AH 3CPFA 3M3YH 4B3MQ 4IPHA 2VL6A 3UDIA 4GKKL 1VQKA 1JMCA 2K5VA 1FGUA 2K75A 2I5HA 1I3QH 4LFCL 1S72A 2KENA 1AE2A 1PH4A 2PQAA 1TWFH 4PMWA 5IP7H 1N36L 2Y0SG 3RZDH 1X55A 1PYSB 3CP0A 2MQHA 2QA4A 3RN2A 1NTGA 4JI7L 4KHZA 4LF9Q 1XNQQ 4BY7G 1DGSA 2B63H 3BJUA 1A0IA 1P16A 4GKJQ 1SN8A 2I5LX 2K5HA 1VQBA 4EQ5A 2WAQE 2OCEA 4J15A 1WJJA 4HIKA 4DV5Q 2EIFA 2AWNA 3S24A 5JEAJ 2ZM6Q 1OXXK 2PQAB 4LW1A 1PH7A
chains in the Genus database with same CATH superfamily
3S14B 1YNND 2DJGC 4NPSA 2K33A 4FF1A 1U5KA 4C2MH 2HDMA 4OO1G 3A54A 4KHPQ 1S40A 2YTXA 1KDBA 4A4IA 2F03A 2HCCA 1CT1D 2CW0D 3K59A 2PI2E 2F0VA 2R92H 1HJPA 3HOZB 1N32Q 4RGOS 1ET6A 5E1FA 4A3BB 4FDBA 4DUYL 4K5VA 1IZ6A 1Q46A 3KYHC 2KEEA 1VQ5A 4FXDA 1N9WA 3J81c 3GTQH 4HN7A 2VB2X 3UDFA 4NXML 2BCOA 4DNIA 2A69C 3PUXA 3Q24A 4ZQ3A 4TSSA 1NCVA 1HNWL 1YNJD 1WD0A 4MTKA 4BBSH 5A2QL 2AHOB 4C3JH 1VQ4A 2WFWA 2KUMA 1M8AA 4LFBL 4DUZQ 1SE2A 4DAPA 5EKIA 4X62L 1STHA 2R93B 3A7AB 2QILA 4JI3Q 5JAVA 4DV7Q 3L0OA 2E2HB 3SXHA 3I4NH 2O4XA 2F4VQ 1GUOA 4JCVE 1K3BC 3PUZA 1F9PA 1BF4A 4GKKQ 2JA8B 1I4RA 1UE7A 1H9SB 4IFDH 1X3PA 1O7IA 5IT9L 1HRJA 2MFIA 1F9SA 1S4ZA 3NTKA 4RH6A 3Q22A 2L5TA 4BWGB 2VY3A 2P5ZX 2F0LA 1G51A 4G4KA 1GUTA 4RGTA 2NVXB 3NQIA 1Y8PB 4A3EH 2AQ3B 2RKSA 2WKCA 3OHXC 2EJMA 2RCFA 3U9SA 1Z47A 1B50A 4CKEA 4LF5L 4ZRZA 1OXUA 4ALPA 5C4XG 1VQPA 2UXBQ 1DOLA 4FO2A 3KOJA 1KTKA 1FL0A 5CV4A 2VNUD 3TS2A 4DV1Q 4ZYSA 4HR7B 1HZAA 3GTOH 1ZYRC 4R4IA 3HOVG 1AW7A 3MXUA 1A2UA 5KYIA 4KY6A 1BCPD 1CI3M 1A15A 3EVQA 5GAGC 5IY0A 1A3TA 1MI2A 5IGFA 4X66L 1STAA 1NNXA 2F0MA 4C3HG 2KVMA 3H3VI 1MSHA 1X6OA 4L63B 1XYIA 3G48A 3SVMA 1QVFA 4I7ZC 3J80E 3CQZH 3GTKB 1DCZA 1EL0A 5GAEC 2NBFA 2QDLA 2TMPA 3GV3A 4JYAQ 2B2YA 4IN3A 4OWWB 1G291 1WTVA 3ULLA 4J8QA 5BN5A 4JI8Q 3J81i 3SK6A 1SJED 2K4KA 4KN4C 2K5QA 5C5LA 1GM5A 3PIPA 1S5BD 4YWMA 2EOTA 4JVZA 1I3QB 1TWFB 1AE3A 1JE4A 2NYZD 3BU2A 5D3DA 4IOCA 2A8VA 3HOUG 2A6HC 4DV4L 3A7LA 4YHHQ 2Q2TA 3KF6A 2F0QA 2JA9A 3J81L 4ZUIA 3MXNB 4LF6L 4AQYQ 1HPCA 2F0OA 4A3KH 1EEFD 1LTID 1WTRA 1BR9A 5CV8A 4OX9Q 4RG1A 5LL6X 1Z6HA 2QGQA 1CKNA 3K0YA 5CGKA 3T53B 5GADC 1KXLA 1WTWA 1HTPA 3HOXG 3HOVB 4OWXB 4IUNA 1HXYD 5I6YA 5JVG3 1BBUA 2NTSA 2YTYA 4X3SA 2O5JC 1TWAB 4DR1L 4LF8Q 4GZYC 1I6HB 1OXTA 2PMZB 2NUCA 4TKOB 3DLLA 3DUZA 5KNBA 1ONLA 2F52A 2HUGA 2R61A 4LF9L 2RA4A 2XTIA 3KDFA 3OIPA 5KRUA 4C3HB 5AJ3Q 3UDXA 3FHWA 3CRLC 4UPAA 3CCRA 1U4PA 4LFAQ 1B9NA 1SNDA 4RCNA 5EBCA 1KLGD 1VQDA 3BZDB 2JA5H 2K50A 3KJOA 2JE6I 4CGYB 4R4CA 2MUYA 4X65Q 5KIXA 3MZ5A 3AEVA 1XMQL 1Y1VB 4L6TB 1B3AA 2A73B 5JVH3 3SGIA 3PO2G 3ERQA 1WTQA 1B9MA 2ALYB 1WCMG 4UAIA 4BBRG 3G4SA 1G2SA 1EY6A 1CFMA 5JEAH 3MFYA 3DWPA 3HOUB 1I5FA 4F8MA 4LAAA 4JI2L 3FKIH 1RKNA 3K57A 2I0QA 4K5WA 2MNAA 1YITA 4QL5A 1U4RA 2CCZA 4JBKA 4A3DB 1QVGA 1LTBD 3H0GB 3L9AX 2VXWA 1XTCD 4P2CB 3MA2B 5D65A 3S14H 3HOYG 2UXDQ 1V1PA 1XX8A 1PRTC 1Q1EA 2KECA 1L1OA 3U4ZA 3RNUA 2EYFA 4IURA 1EQQA 4JBMA 4X3UA 4QCLA 2K32A 3HOXB 1L0YB 1Y8NB 4JI0Q 1ENAA 1L0XB 1IL2A 3MTSA 3HOZH 2B2TA 4A3BH 1C4QA 1PA6A 3E9IA 2PW5A 4X64L 3CW2C 1JCKB 2ZXRA 1PFBA 5IGBA 1VQCA 4GNXA 3PUWA 2Z4IA 5C44G 4Q5VA 1GXDC 5FLMH 5H1SE 1EY0A 1NJIC 4FF2A 1C8CA 3ULPA 1LT4D 3D6WA 4CDFC 2IL8A 4DV0Q 2NN6I 1LT3D 1HTLD 1UE6A 1IBMQ 2R93H 2MO1A 1VQJA 2E2HH 4JBJA 3TSSA 1SNPA 4C56C 1CUKA 1SDFA 3U4VA 1B8AA 3HEJA 3PO2B 2B2YC 2JA8H 1WCMB 4P74A 4B3ML 2PI2A 1KABA 1T5EA 3R8BA 4AYBE 2R7DA 3TDQA 4FF3A 5J39A 1BUVT 2NVXH 2MO0A 3ULJA 3I73A 1XNQL 4A93B 1X54A 4XQJA 3KBXA 4DV5L 1IXRA 3HOWG 3HG9A 2EYMA 5M5WB 1UEAB 3BVMA 4YWLA 1YHAA 1YVCA 1SMXA 1B1ZA 2CFMA 2UUBL 2J0TD 4BA2I 4KJNA 1TXYA 1LT5D 2E75C 1GVPA 3HOYB 2K03A 3T51B 1Y69U 2MGSA 3NUCA 4OO1H 3CMAA 2B2UC 4AYBB 1XJVA 3MXGA 1C9OA 2M9VA 3GP7A 1D6EC 3SK8A 4JW0A 4N9TA 1JWMD 2XVSA 3LX0A 3M7GA 1VS0A 3K6OA 5ISRA 4KI0A 1AFPA 4A3JG 4DR6L 4EVOA 2KHSA 4IUQA 4Y52H 5M5YB 1B4OA 1B7YB 1IBLQ 1JT8A 1SYBA 1QCBD 4NMZA 1PRTB 3BZKA 4KV6A 2KQ3A 1MKHA 2WV6D 3AMUA 4UDUC 4JI5Q 4IPGA 1SR3A 3K7UC 4MIUA 2A6EC 2UUCL 1SNCA 3I8ZA 3EN2A 1I4GA 5JJLA 4WJ3M 4DN4M 1CTMA 1D1IA 3S1RB 4OHJA 3Q6SA 1VQKA 1PRTF 3EROA 3IFTA 3OMCA 1I3QH 4LFCL 2KENA 1TWFH 2BOSA 2F0JA 2Y0SG 3VR4A 3R2IA 1PYSB 1D5ZC 1TU2B 4Z9CB 2XSCA 1FNWA 4RGMA 2QA4A 3RN2A 4CDCC 4BY7G 1DGSA 4ZLTF 5EPJA 1O7YA 1A0IA 1P16A 4GKJQ 5IGEA 1SN8A 2I5LX 2R3ZA 1HCZA 4IQZA 1DONA 1BOSA 3RUZA 2WAQE 4NKLA 1GHKA 3NTIA 1KNAA 1JJ2A 1RD9D 1EIYB 1ZXTA 1IKLA 4HMJA 3MHBA 3HOWB 1CA6A 4DA2A 1PZID 4IJHA 1KDCA 3H09A 2L0CA 3NSWA 3STBC 1M1KC 4CJ0B 3DM1A 4DR7Q 4ZKCB 4DK3C 3DMUA 1ASZA 1EY5A 5A2QE 3DHQA 1E1OA 2PNHA 3HOVH 3IAYA 3LWEA 1JICA 1PXUA 5DLQE 5BN4A 1CSQA 1J5EQ 1TWAH 2XWBB 1IBKL 1Z9FA 1I6HH 4EQPA 1ICFB 2NZOA 1F9RA 3VR5A 1Q12A 4C3HH 3OTOQ 1FJGL 5IT9E 2A68D 2ZTEA 2K1BA 3C2PA 2B2TC 3KLWA 2HDLA 2VQFL 4PMCA 1LTRD 1BDOA 2Z4HA 4RKBA 4CKCA 1BXTA 2RQXA 5J3BA 4JOIC 2OF1A 1Y1VH 5C6AA 1CQFA 3CC2A 1NBWA 1EIHA 2A69D 3SE0A 1LTSD 2Y0SB 3E0EA 4CDEC 2B2WA 5C4ZA 1STGA 3HOUH 1FVIA 3PIO3 4RA8A 4HJ5A 1RHPA 1PFMA 2SEBD 2K5DA 3QOLA 3OWEB 3M7NA 1N33L 3PQIA 1HNZQ 4R4QA 1X9NA 4WORA 1WTPA 3S17B 2SDFA 5CR3A 4HJ7A 2RSNA 3J7A5 1UNSA 3S9WA 3AFPA 4DAYA 5IP9H 3D4DA 3H0GH 3CCQA 2LXJA 2UXCL 2K52A 3H91A 2LXKA 5IGDA 1ENFA 4OO1I 2B3GA 3NEMA 4RWSC 4DUYQ 4B3RL 1OXSC 1OO9B 4JG2A 4A3FG 5FK9C 2VB3X 3GTPB 2H4OA 4NXMQ 3AB9A 2CQOA 3HOXH 4M1UB 2E2JB 1QUQB 1I4QA 1LABA 1HNWQ 1E2ZA 1YHBA 3PIOA 4JI1L 5KNCA 2Z6BA 2ZJQA 4KK7A 1HR0Q 3GTMB 2OT2A 1PH9A 4LFBQ 1AEXA 3G6JB 2V4DA 1L0WA 4X62Q 1ENCA 5C3EG 4K6LA 1DXMA 1ZYRD 3QOJA 1E22A 3A5ZB 3E0JA 2C5CA 3ER0A 3I55A 1SJHD 5HGTA 3ICEA 3J81E 3ITPA 4RHSA 1X3GA 5ELOA 2HQLA 1JOKA 2YV5A 1XNRL 1K8MA 3BDCA 3PO2H 2HD3A 1WCMH 4UP9A 1SNOA 1KHIA 1HQMC 2RHQB 4LF5Q 5LMUL 1H9MA 2KCTA 4OIJA 4PZ8A 5IYBG 1SYFA 3A8JE 4LF4L 1VQ6A 4A93H 3NPPA 5M3MG 1XXGA 3D3RA 2QW7A 3QJYA 1HHVA 4A76A 3J7AV 4B3SL 1S3OA 5ELNA 5M5WH 1SNMA 1MJEA 3QB3A 2L15A 4HAEA 2MJ8A 1PH6A 4QUFA 2BDNA 2K14A 4O42A 1VQAA 4TVAB 4CJ2C 3TZUA 3GTJB 3HOYH 4ID6A 3BVGA 5I9PA 2A6HD 2WKDA 4LF7L 4A3FB 1UE1A 3F1ZA 5IGCA 1N8RC 2GVAA 4DNTB 2BH2A 1ZEQX 4DFAA 1CQVA 4RHRA 1SSOA 4JI7Q 4CKBA 2PW7A 4DR5L 3T4AC 4O0AA 4K6DA 1KIXA 2BA0A 2EJFC 3CRKC 4PZ7A 3K80C 1KD1C 3CC7A 3CF5A 1K28A 2F0EA 1FGBD 1Q81C 2L9HA 1JJCB 1VDZA 2ZTCA 3EFXD 5E3FA 3T13A 5M5YH 1NR2A 4U673 3F8TA 1XWEA 4Q0FA 3S2DB 3R93A 1IL8A 3PCOB 5C3EB 1B70B 1HFNA 1N32L 1EZ6A 4KN7C 2KCCA 2ZXOA 2IX1A 1GKHA 2EYJA 5LHY1 1PDQA 3PIP3 2VUMG 2PQEA 3S1RH 2LKVA 4MNOA 5C4HA 4DV4Q 3GQBA 2IX0A 4X3KA 5E4WC 3T1YQ 2NTTA 2EY6A 1TR5A 3P75A 1ILPA 3PO3G 3I7FA 4B3TL 5JJIA 2RVLA 4WJ4A 4KD3A 2Q8IB 1DJRD 1QG7A 3TP7A 4BY1G 1GHJA 1I50B 2F3WA 5EQ0A 1K3RA 1K8OA 2E2IB 1G91A 3HOWH 1SMYD 1EQRA 2Z6KA 1KL9A 2R7ZG 1DZ1A 2JQOA 4DR1Q 3CKIB 1DOMA 1EY7A 4NDXA 1X56A 3AYHB 4DV2L 2L4NA 4GOPA 2VZAA 3NBHB 1YI2A 5HGQA 1TWCB 4JPBW 2RSOA 3J7YW 3FDTA 2F0UA 1LTAD 1RJTA 1W6KA 5CBAE 4ME3A 3LGJA 3VYSA 2DNEA 5FLXc 2PMZE 4JV5L 2UXBL 1Y1WG 1LM0A 1UE5A 1D8LA 4DPGA 3L2PA 4C3IG 4EQNA 2AMCB 2F0FA 1U9RA 1F2YA 4FVMA 2K04A 3A56A 4DV1L 3W2DA 1EYDA 4RAUC 2K05A 3L3OC 5EPLA 5C4XB 1XMQQ 2B2VC 5FJ8H 1PRTD 4YCWA 1STYA 2CH4A 2FFKB 1A3VA 3S1MB 3S16B 3K5NA 2NZ1D 3M9BA 1OXVA 2SOBA 2ZTDA 3BG3A 5CV7A 2K7VA 1YZ6A 4DXGA 5LMNW 1RCVD 3J7ZC 2SNSA 4XDXA 1FNVA 4JI2Q 3CCUA 4JI6Q 1K8AC 4PMBA 4I7AA 1TT2A 5K36G 5ELFA 5CV5A 3P1HA 4JYAL 3I4OA 4CHTB 3NELA 4ZUJA 1YBYA 3TQYA 5C0XH 2ZM6L 4BY7H 1M90C 2HIVA 4O1NA 3TP6A 4HIDA 1RTNA 1V9PA 3BDOA 1YNXA 3KJPA 1PFNA 4IJLA 1C7YA 1GUWA 3S17H 3OW7A 2H5XA 2IHFA 4DXFA 2OQKA 3E9HA 1EOVA 4IUPA 3D4RA 3KLRA 4EQOA 2N3SA 2C35B 2R7ZB 4IFDI 1FNUA 4ME5A 4PG3A 4NXNQ 2LSSA 2F0NA 2OQ0A 2PO4A 3T1HL 2JSOA 2PCFB 4IO9A 4A3IG 5HY6A 3GTPH 4KJOA 4MZ9A 1VQMA 4YHHL 5CV9A 2E2JH 5IODA 3OYYA 3SDZA 3KK7A 2BE5C 5EPKA 1HH2P 1MIUA 4YY3Q 4Y7NB 1AN8A 3S1NB 1DOKA 4V0BA 2QKIC 2R92G 5IOCA 2JYOA 1Y1WB 1CKMA 1RDPD 1D1KA 2Q2HA 3GTMH 2ICIA 2I5MX 4C3IB 2WP8J 2ZJPA 2AQ1B 3KF8B 3KLSA 1FD7D 4EX5A 5I2XA 2KA7A 1LLRD 2F0IA 3J80i 1JOOA 4RGNA 1PHJA 3PV0A 4IUUA 1DD2A 3UDIA 4X3TA 1JMCA 5IIFA 2RDFA 1PH4A 4B3MQ 4DK0A 1AE2A 2PQAA 4N9PA 1N36L 1VF7A 2EE1A 1TS5A 3DEOA 1I4PA 4QB4A 1EQVA 3TN2A 2X69A 1NTGA 2Q8RE 1VF5C 1XNQQ 1U4MA 3BDLA 4EQ5A 1R4QB 4J15A 4DV5Q 2AWNA 3S24A 5JEAJ 3SHLA 3S1QB 4LW1A 2FMMA 5EJWA 1PH7A 1ILQA 1JR0D 2UUBQ 4H02A 5FLXL 2PYKA 2LMCB 1I4XA 2CHBD 4K8IA 2NB0A 1M4VA 3NE5B 2TSSA 1JJGA 1CHQD 3FMCA 3NWSA 5IYCG 2HIXA 1PTOC 4I65A 4V190 1KAWA 1LTGD 2J7ZA 4XYOA 1O78A 3HKZG 1F2MA 2NVTB 1II3A 1WTHA 3BYTB 3I90A 1RIPA 2HHHL 1EY8A 1H95A 1BBXC 1HA6A 5ELDA 3GTJH 1T9HA 3PF5A 1I4HA 3M85A 1X3EA 4R8IA 4MTNA 5ELBA 1F77A 4A3IB 4A3FH 4BBRB 3VYRA 4DR6Q 1SE3A 4BXXG 1V1OA 1ET9A 1HQRD 2HT1A 3WOEA 3RLFA 3MWYW 4K2KA 1H9SA 2QEXA 2Q2UA 5EBDA 5I2YA 2D0OA 4PZ6A 2WINB 3FVQA 2OXPA 4IUVA 1SXTA 1SYCA 2UUCQ 1DYQA 5DAUA 3GO5A 5JJKA 2C9OA 3STBD 3S2DH 4JI4L 4U68A 5C3EH 1NE3A 3R2TA 4X6AH 1RL2A 4K14A 1E3PA 4LFCQ 5K5PA 3UE0A 5AFWA 1SROA 1SAPA 3D8GA 4ABNA 4DV6L 4LUOA 4WRDA 1Q3LA 5J22A 1QJOA 1TWGB 2VQEL 3CCLA 5LMNL 3UI2A 5JJZA 1PVOA 2E5LL 4FP5D 1TKWB 2NN6G 3M4YA 2UU9Q 3I4MG 5C0XI 5DEHA 1QOHA 3SK5A 1QILA 5C44B 1G6PA 3SEBA 1V8QA 2K5WA 3AQQA 2NZHA 3X3MA 5IYBH 5D14A 4A3MG 1IBML 4HJ8A 3HRZC 3S2HB 2EZVA 1I50H 3H6MA 5CC4A 2Z0SA 1SYGA 4A3LG 2E2IH 5HURA 3MC0B 2L55A 3HP3A 3I3CA 3HKZB 4HMIA 3I72A 2KOLA 2JEBI 1IYJB 3JC66 3RN5A 1IBKQ 1C48A 4WFN3 1KAAA 3OMGA 2JA7G 4A3CG 1GJXA 1JB3A 5JPNC 1CZGA 2CVRA 2RDHA 2D5DA 3IKJA 5IE8A 2GVBA 4IUTA 1TWCH 2WB1G 3FPPA 4TRDA 1UWVA 1FJGQ 5CORA 3BYYB 1QE6A 2JJQA 3CPWA 3N6RA 5M3FG 3T16A 1PTOB 4LUVA 4DR3L 3A5UA 1YJ9A 2VQFQ 1SNQA 4IOAA 1L2FA 1HNXL 2CH4W 4KKTA 1VQFA 5CV6A 2F0SA 1SE4A 4GLXA 2CKZB 5C4XH 1H9KA 1I94L 2O2LD 1PTOF 2KJXA 3MXNA 1TQOA 2CWAA 4GN3B 4EGVA 3S1MH 3S16H 3CCSA 2JA5G 1PH5A 2YTVA 2F0GA 4APVA 1A62A 1HR0W 3ND9A 1VMPA 2JA6G 3DM3A 3NHHA 1MD2D 1BBWA 3SK4A 1Q8IA 3E3XA 4QUCA 2JP1A 2XIWA 2J4XA 3QG1A 1SE8A 2DJFC 1ML0D 1N33Q 1CK1A 3KBGA 1X32A 3CC4A 1IW7C 2Y0SE 3K81C 1K0RA 3I4MB 3SR1A 4H13C 4RMFA 3U9OA 1L1OC 1OTCA 3P20A 4DR2L 3GTGB 4A3JB 5JEAG 3WWVA 2UXCQ 4ILWA 3KF6B 4L8JA 4KMUC 1CKOA 1JC7A 1KNEA 4A3MB 1LYLA 1Q90A 1STEA 5EAYA 4DV3L 4B3RQ 2GN5A 4GN5A 3FKIG 4K0KL 1B53A 3U58A 1WD1A 1WTXA 1XPUA 5KGUA 1B3QA 4GNXC 1XTDA 4UY8C 2QDBA 4POGA 4MHEA 1CKNB 2R7ZH 4JI1Q 3DXJC 2AQ2B 5KYLA 3WDNA 4RKLA 4QGUA 2GA4B 3DWAA 1E2WA 1SEBD 4F88A 2JA7B 5EGTA 3W1BA 1YEZA 2IHEA 1VQLA 4ZKBB 4IALA 2WB1B 3I56A 3R3OA 5G3LF 4Y7NH 1EUJA 3S1NH 2JEAI 1SBBB 4BY7B 3QR8A 4GS3A 1PMRA 2JN4A 5JPMC 1K8GA 4QQBX 3I2ZA 3HOZG 3KDFB 1Y1WH 1EEID 2EXDA 4N8FA 4C3IH 4DR7L 1G8ZD 3PUYA 5BR8L 3JAMc 2HQEA 1EWIA 2F3VA 1QNKA 2BH8A 1XNRQ 1V1QA 2L11A 5NUCA 4XQQA 4DR4L 4G7OC 1SLJA 5T1GA 4HIOA 3KLSX 4R4TA 5LL6S 2UUAL 1VQGA 5LMUQ 2JA6B 4ZCKA 2QF7A 2EYLA 1HZCA 4LF4Q 3QO2A 4HSVA 1AP0A 1SRUA 4OIKA 4RFBA 1BO0A 2RBMA 5I4DA 1DM0B 3OW2A 2F0TA 3FRPB 4E6IA 5K36H 4B3SQ 3AFQA 3NXWA 2FJ2A 3S1QH 2R7FA 3IRBA 5GAHC 2EJGC 2JA8G 2PNRC 1W2BA 3M4OB 2L1BA 5IWAL 3RLOA 1BKBA 2F0DA 4KY5A 2ES2A 1YJNA 2FXQA 3PSIA 4YIJA 4DKAC 4LF7Q 1S5DD 3WOFA 1VQ9A 2NVTH 4IPCA 1B44D 1V1PB 3ZJYC 3CCMA 4DR5Q 1UUPA 1QVCA 1L1OB 3F2BA 1RF2D 1VMCA 5E7NA 3VDYA 3RR5A 3BS1A 1N34L 4A3IH 2A68C 3Q8DA 4BBRH 1HNZL 4QIWB 5KEEA 5CYUA 5FO8B 5FO7B 3VYUA 4C1NI 4KTAA 1YIJA 3M4QA 1TS2A 3MAQA 1XMOL 4L5QA 2AUKA 4OXPA 5F2DA 2YU9B 2PZUA 1H9JA 4GNXB 1VQNA 1O7LA 3LWUA 1XPRA 2V1CC 2RHSB 5M9OA 4XT3B 2G5DA 2K6AA 1HUMA 4YCUA 3L7ZC 1JOQA 2NVQB 4J6HA 1SYEA 2IT1A 4J1MA 1E7ZA 3PUVA 2BDOA 2QCPX 3K58A 4X66Q 3VR2A 2B8GA 5C5MA 1A3UA 1HR0L 2Z8LA 5L37A 1TWGH 4B3TQ 4XT1B 4LNQA 4F87A 3GTLB 1E0BA 3NQTA 1A8VA 3JAMi 4G7HC 3S15B 3TS0A 3V2TA 3K0XA 2Q8TA 3U50C 1WI5A 3ONAB 1PV4A 4FYDA 2OTLA 1EYCA 1W6JA 3HGBA 5GQOA 1PYBA 1STNA 2DUDA 3J7AF 5C44H 5CBEE 2A5HA 2Q2IA 1LTLA 2B29A 4KHPL 2A19A 3MEHA 2DN8A 4HIMA 3S2HH 4YWKA 4DV2Q 5E4XA 1R4PB 1Q82C 5IYCH 1EIFA 2RDGA 1CZWA 1MSGA 1K9MC 5DM63 5IYDG 3JAML 3VR6A 2KCMA 1AZPA 2DGYA 1G6ZA 3K8AA 5FKAC 4POFA 3RLNA 2LS01 4OWTB 4F7XA 1QNUA 4ULLA 4JV5Q 4IFDJ 1NMFA 3GDEA 4L5SA 4LF6Q 5C4JB 4G57A 4BXXH 3RZOB 1C0AA 1YNNC 4DUZL 2DY7A 1PTOH 4HJAA 5TSSA 1D5XC 1SFOB 1PZJD 4JI3L 2F1MA 4DV7L 2AWOA 2DNCA 5M3MB 1VQIA 2LFNA 3UE1A 4A3GG 3EJIA 2F4VL 1S5ED 2CW0C 3DWQA 1LV9A 2B2WC 4IPHA 5COYA 4GKKL 1JORA 1K0SA 2K5VA 1FGUA 1AZQA 1BNZA 2I5HA 4PMWA 1X55A 1D5MC 3CP0A 4N8X1 2MHVA 5M5XB 5FLXE 4JI7L 4LF9Q 2BE5D 3P7JA 1YNJC 2EXZA 3BJUA 2EY1A 2OCEA 4HIKA 2ZM6Q 3H3VC 1EWCA 3OPOA 4LJZC 3J80c 3M4PA 3VR3A 4R4OA 4QY7A 1Y1VG 4NP5A 4QJFA 1PZKD 2NN6H 3I4MH 4OGQC 4C1NK 1U0LA 2EYPA 1Q7YC 3TMEA 3NTHA 5J1ZA 3KFUA 2NVYB 3K5LA 3GTGH 4A3JH 4K2LA 4FXGC 2D2CC 2IY5B 1GUNA 1LT6D 4BS9A 2ASBA 4A3MH 1ASYA 2N88A 2WIIB 4UP8A 3D4WA 4GLVB 4PQXA 3T1HQ 1A63A 2FINB 4UHVA 2MPMA 2E8GA 2RCNA 3T1YL 4A3LH 3Q0AA 2EDGA 2FMCA 2D9UA 2KBNA 5ELCA 4A3DG 1J8IA 2B2UA 5IP9G 1MHWC 3H0GG 2VUMB 4DF7A 2JA7H 1EQTA 2XRSD 2CQAA 4A3CH 1EY4A 2X6GA 2CWPA 1K83B 1QZGA 1NSNS 3PO3B 4PNYA 2IPKD 3IFDA 2ICEC 1QB5D 4JI8L 3CD6A 1EZ8A 3V96A 2L12A 5M3FH 1EU4A 5DNFA 1PTOD 1EOTA 5IP7G 1VQ8A 4HTHA 1X3FA 4HCSA 3CCJA 4R1JA 4BY1B 3TRZA 4A3GB 3E5SA 4P75A 4CDDC 3URYA 1N36Q 3A74A 1TS3A 1BCPC 2VW9A 2B63G 1HA5A 1NMGA 3EQLC 4XQNA 1UEBA 4X64Q 2I07B 2F0KA 2PZWA 3OSOA 1TS4A 2BA1A 3FP9A 2Z1CA 2IJ0A 3I70A 4L5TA 1IKMA 2DY8A 3TBIB 4B9WA 5FOBB 2JA6H 4G7ZC 1HZBA 3C1FA 4AQYL 4R9WA 2O5IC 3MEFA 2AKWB 2XRQD 2ENBA 1VCIA 3NWTA 1GD7A 2AUJD 1SMYC 1QUQA 3I4LA 1NR4A 3OIQA 3N52A 5EKLA 4OX9L 2M2LA 2HCIA 1TWHB 3F2UA 1I6VC 1Y8OB 3G7LA 3X3NA 5C0XJ 3F2DA 5C3WA 3M4OH 1EWHA 1PYWD 2ID0A 2HHHQ 2E74C 2EY5A 5KNDA 1PH1A 2EVBA 1W3SA 1GUGA 3V05A 1CHPD 2KCNA 2XWJB 1VQ7A 4BBSG 4LF8L 4JI6L 4A93G 4DAYB 2NWGA 4K5XA 4C3JG 4CBVA 1BQQT 3ND8A 3NK9A 2F4IA 1BVSA 1WFQA 5G3LD 1PH2A 1XPOA 3CU7A 2JK8A 1E1TA 1KDAA 3Q23A 4KD4A 5AJ3L 1JQYD 1LO5D 5C3XA 1A6XA 2EPBA 3CHBD 1R9TB 4O2DA 5DM73 4DK6C 4LFAL 4OONA 3I4NG 1E2VA 4QMGA 2XGTA 2IW3A 1PH8A 4H7BA 1ESRA 4KLKA 4IFDG 2WACA 4HCEA 3CXCA 4JI4Q 3J80L 3K7AB 4NB3A 4AYBG 4B9XA 3M3YB 2ZT9C 2OTJA 4X65L 2MP1A 5FO9B 2YU9H 2A6ED 5EKKA 1Q1BA 3KUPA 3D31A 4AH6A 4FF4A 1E24A 4YCVA 3RZDB 4NXNL 1S5FD 4A3EG 2ZJRA 4DV6Q 5D3IB 3W5OA 4H44C 3PGZA 4M8AA 2VQEQ 2NVQH 5LMNQ 2B63B 1LACA 1G2TA 1JE5A 1YHQA 3C3LA 3AU7A 2E5LQ 3NBIA 4JOIA 3D0FA 4YY3L 4XYQA 1J6QA 1RODA 1Y14B 1EY9A 3IL8A 1Z7TA 5JOBA 1JB7A 3GTLH 1QZHA 4C2MB 3S15H 2Z6KC 3K5OA 2IX3A 2QEJC 3OOCA 4WJWA 1YJWA 3CAMA 1MGSA 1S5CD 1STBA 4GLAC 1BCPB 2R92B 1TIID 2OWOA 1H9RA 5CMDA 4S3SA 4GOPC 1O80A 2UXDL 3NENA 1UAPA 3BVZA 3B6YA 2X6LA 2D0PA 3W1GA 3TZDA 3GTQB 4P71A 2EQSA 4OEMB 2B39A 4QF4A 4JI0L 1FYCA 4ODGA 4A75A 4IPDA 1BCPF 1KRTA 2F0HA 4AIMA 4BBSB 3CMEA 1EYGA 4C3JB 1Q8KA 3HKZE 3HZXA 1CSPA 4NW2A 3K5MA 3A8IE 1IW7D 3BZCA 4DR3Q 1TVXA 4HEDA 4UP7A 2LY7A 4JK1C 1EYAA 5A35A 1GUSA 1HNXQ 1D7QA 1VQEA 3I4NB 1GOZA 2A1AA 1NUCA 4KKUA 5GROA 4LK1C 5C4JH 2K01A 4DV0L 3RZOH 4CJ1B 3ZYYX 1I94Q 3LNNA 1SFOH 5M3MH 2WAQG 4TQUS 3MFGA 3EA6A 1AH9A 1F9QA 4A3EB 2VS1A 3TREA 3VA7A 2E76C 1EIGA 2XNAC 1B2TA 2PPBC 1FR3A 3D6CA 1PLFA 2PZTA 4FXKC 4A3KG 5M5XH 3GTKH 3PMFA 5FJ8G 1CM9A 1ZKOA 2XN9C 1LUZA 3G6EA 1X3QA 4DAMA 5I6WA 2EYHA 1D2BA 4LWCA 3G71A 2H1EA 3J81j 4DR2Q 4HSPA 3QIAA 3GTOB 2Z9HA 4KKSA 4P72A 3NBHA 1EFWA 4DV3Q 2K5NA 2N8NA 2M00A 1TY0A 4JC0A 4K0KQ 2G9DA 3F2CA 2KHIA 1IYUA 1X65A 2NVYH 4K8JA 2N78A 1WOCA 3DEPA 1ICWA 3C1EA 4DNRB 5C0XG 1SYDA 1JWSD 2KHJA 3EBEA 3O13A 4ZK9B 3CQZB 1GO3E 1JWUD 3MXPA 1V43A 2UU9L 3GD7A 1RTOA 5IYDH 3A55A 2JXMB 4DU9A 3VA5A 3H94A 2EYOA 4DGZA 2VUMH 1VQOA 4GOPB 1WTOA 1IBLL 1F2ZA 3I91A 3FEWX 3NP8A 5T1IA 3TEHB 4IZ8A 1K83H 4LUZA 4XIGS 5BN3A 1KQSA 3PO3H 1KLUD 1T5XD 2WB1E 5BR8Q 3C46A 4JI5L 1O7ZA 3E6ZX 5IGGA 2N55A 4KY7A 3PF4A 4DAVA 4DR4Q 2A74C 3HKSA 1EU3A 3TP8A 4HJ9A 4BY1H 1K73C 1KC8C 3EIVA 2WAQB 4RCOA 5ELEA 3CCVA 4A3GH 2UUAQ 1F2LA 3CCEA 2F0PA 4OL7A 4ZAIA 2ATWA 4FNFA 3H15A 4BA1I 2KEDA 4LMQD 1P8LA 2E2DC 4A3KB 4XTCS 4GKJL 1NAPA 1IYVA 1MBYA 1KRSA 2D62A 1WVLA 4L5RC 1IHZA 1TY2A 5IWAQ 3JAME 5IT9c 5M3FB 2EY2A 4A3BG 5I9OA 4JBWA 4KHVA 1LTTD 1A2TA 1TWHH 1QWYA 3GV6A 1Q86C 3W3AA 4MN3A 1HZ9A 1PH3A 1HFGA 2K28A 5FLMG 2N49A 1WYDA 4PV1C 1J5EL 1U4LA 2I46A 3HS0C 3KF8A 3MVVA 4XXEA 3H3VH 4DK1A 4OELB 1N34Q 3A0JA 4GN4B 2JA5B 2IWHA 1MJCA 1VQHA 3T56B 2B8FA 1J9OA 2F3IA 3ERSX 3OTOL 3UDGA 2YYZA 4A3DH 3QWNA 3OWFA 2R93G 1XMOQ 1R9TH 2RF4A 3TP5A 3HFZB 1PFSA 1NY4A 2ZXPA 2OEOA 4QIWE 4P73A 2F0WA 1CA5A 2R6GA 3K7AH 3FPUB 3CPFA 2FHTA 3M3YH 2VL6A 4B08A 2K75A 3A8KE 1S72A 2B2VA 5IP7H 3RZDH 3FKIB 1ESFA 4R8NA 1HUNA 2MQHA 3RD4A 4KHZA 3RMHA 2B63H 2K5HA 2SNMA 1VQBA 1WJJA 2G9HD 2EIFA 4H0LC 1OXXK 2PQAB 3VYTA 1EFID
chains in the Genus database with same CATH topology
3J80c 3M4PA 1EIYB 4R4OA 4QY7A 1Y1VG 2UUBQ 4QJFA 4H02A 4NPSA 1U5KA 3I4MH 4C2MH 1U0LA 1Q7YC 4IJHA 4OO1G 4KHPQ 1S40A 1JJGA 2YTXA 3KFUA 5IYCG 3GTGH 4A3JH 2HIXA 3STBC 4A4IA 1M1KC 4DR7Q 1KAWA 2IY5B 2PI2E 4DK3C 2R92H 1HJPA 2ASBA 1N32Q 4A3MH 1ASZA 3HKZG 1ASYA 4UP8A 4FDBA 4DUYL 1IZ6A 1E1OA 2PNHA 4GLVB 1Q46A 3HOVH 3KYHC 1RIPA 3T1HQ 5DLQE 1VQ5A 2HHHL 1A63A 1H95A 1N9WA 2E8GA 2RCNA 3J81c 3GTJH 3T1YL 3UDFA 3GTQH 4NXML 1CSQA 1T9HA 1TWAH 3PF5A 2KBNA 4DNIA 1Z9FA 3PUXA 1J5EQ 1IBKL 3M85A 1I6HH 1X3EA 4MTNA 1HNWL 4A3FH 4A3DG 5IP9G 3H0GG 4DR6Q 2NZOA 4BBSH 4BXXG 2AHOB 1Q12A 4C3JH 2HT1A 4C3HH 3OTOQ 3RLFA 1VQ4A 2JA7H 4A3CH 1FJGL 2QEXA 2CWPA 2WFWA 2Q2UA 2D0OA 4PZ6A 1QZGA 2ZTEA 4DUZQ 4LFBL 4JI8L 4X62L 3CD6A 3KLWA 2VQFL 2UUCQ 4JI3Q 4DV7Q 3L0OA 3GO5A 5JJKA 5M3FH 3I4NH 3STBD 2F4VQ 3S2DH 4JI4L 5IP7G 1VQ8A 4JCVE 1X3FA 5C3EH 3CCJA 1NE3A 3PUZA 4GKKQ 4X6AH 4R1JA 1RL2A 1UE7A 3TRZA 1E3PA 4P75A 1O7IA 5J3BA 4JOIC 4LFCQ 2MFIA 3UE0A 4A3LH 1SROA 1Y1VH 1N36Q 3A74A 2VW9A 1JJ2A 2B63G 3CC2A 2VY3A 1NBWA 4DV6L 4LUOA 1G51A 1NMGA 3E0EA 2VQEL 1UEBA 3CCLA 5LMNL 4A3EH 4X64Q 1PVOA 2E5LL 1Z47A 3HOUH 2NN6G 2BA1A 3FP9A 2UU9Q 1FVIA 4LF5L 4L5TA 4HJ5A 3I4MG 1OXUA 5C0XI 2JA6H 4ALPA 5C4XG 1VQPA 1HZBA 2UXBQ 3M7NA 1N33L 1HNZQ 4AQYL 3MEFA 1G6PA 4R4QA 1X9NA 2AKWB 3KOJA 4HJ7A 1FL0A 1VCIA 3AQQA 1GD7A 2NZHA 5IYBH 2VNUD 4A3MG 3J7A5 3TS2A 4DV1Q 1IBML 1HZAA 1QUQA 3AFPA 5IP9H 4HJ8A 3H0GH 4OX9L 3GTOH 4R4IA 3CCQA 2LXJA 3HOVG 1I50H 2UXCL 2K52A 2LXKA 3F2DA 3M4OH 5C0XJ 2Z0SA 4A3LG 4OO1I 2B3GA 3NEMA 4DUYQ 4B3RL 2E2IH 1OXSC 2ID0A 2HHHQ 4JG2A 1PH1A 4A3FG 1W3SA 5GAGC 4NXMQ 5IY0A 2JEBI 1IYJB 2CQOA 3JC66 3HOXH 3RN5A 1IBKQ 1QUQB 4X66L 4DAYB 1VQ7A 4JI6L 4LF8L 2R7ZH 4BBSG 4A93G 1HNWQ 2JA7G 1YHBA 3H3VI 4A3CG 3PIOA 4JI1L 1X6OA 1BVSA 1WFQA 5IE8A 2GVBA 1PH2A 1TWCH 3G48A 2JK8A 1E1TA 2WB1G 1XPOA 2ZJQA 3CQZH 1QVFA 1HR0Q 1UWVA 5AJ3L 1FJGQ 5GAEC 4JYAQ 4O2DA 1PH9A 4DK6C 2JJQA 3CPWA 4LFBQ 4LFAL 5M3FG 4OONA 4LUVA 4OWWB 1G291 1L0WA 4DR3L 3I4NG 2XGTA 3ULLA 3A5UA 4JI8Q 1YJ9A 1PH8A 4X62Q 5C3EG 3J81i 2VQFQ 4IOAA 2K4KA 4KLKA 1L2FA 1HNXL 4IFDG 1E22A 1VQFA 3CXCA 3A5ZB 1GM5A 4JI4Q 3PIPA 4NB3A 4YWMA 4AYBG 2OTJA 4X65L 3ER0A 3I55A 2YU9H 4GLXA 1Q1BA 2CKZB 5C4XH 3D31A 4AH6A 1E24A 4YCVA 1I94L 1AE3A 4NXNL 3ICEA 4A3EG 2ZJRA 3BU2A 4DV6Q 1X3GA 3W5OA 4IOCA 2CWAA 5ELOA 2HQLA 4GN3B 3S1MH 2YV5A 3PGZA 3CCSA 1XNRL 2A8VA 3HOUG 2JA5G 1PH5A 2YTVA 2VQEQ 2NVQH 5LMNQ 4APVA 1A62A 1HR0W 4DV4L 3PO2H 1JE5A 1YHQA 3DM3A 2JA6G 2E5LQ 4JOIA 3D0FA 1BBWA 1WCMH 4UP9A 1KHIA 4YY3L 1J6QA 4YHHQ 1Y14B 2RHQB 2Q2TA 4LF5Q 3KF6A 5LMUL 2JA9A 2KCTA 1SE8A 3MXNB 4PZ8A 5IYBG 1JB7A 1N33Q 4LF6L 4AQYQ 3CC4A 4LF4L 3GTLH 3K81C 2Y0SE 1QZHA 1K0RA 1VQ6A 3S15H 4A93H 4RMFA 2Z6KC 5M3MG 4A3KH 1OTCA 1L1OC 4DR2L 1YJWA 4A76A 4OX9Q 4RG1A 4B3SL 3CAMA 1S3OA 5JEAG 2QGQA 5ELNA 4GLAC 5M5WH 1CKNA 3WWVA 1MJEA 2UXCQ 2L15A 3KF6B 2OWOA 1CKOA 5GADC 1KXLA 1LYLA 4DV3L 5EAYA 4GOPC 1PH6A 4B3RQ 2GN5A 4GN5A 3NENA 3HOXG 2UXDL 2K14A 1VQAA 3FKIG 3B6YA 4TVAB 4OWXB 4K0KL 2D0PA 3W1GA 3U58A 1BBUA 2YTYA 1XPUA 3HOYH 4GNXC 1XTDA 4DR1L 4LF8Q 4P71A 2EQSA 1OXTA 4JI0L 4UY8C 3DLLA 4LF7L 4POGA 1CKNB 1UE1A 2F52A 3F1ZA 4A75A 4IPDA 2GVAA 1KRTA 4JI1Q 1N8RC 4LF9L 4AIMA 2BH2A 4QGUA 2XTIA 3CMEA 1EYGA 3KDFA 1Q8KA 4JI7Q 3W1BA 3UDXA 3FHWA 5AJ3Q 4DR5L 4O0AA 3HKZE 4UPAA 3CCRA 1KIXA 2BA0A 1YEZA 2IHEA 4LFAQ 1CSPA 1VQLA 3I56A 4PZ7A 3BZCA 3K80C 4DR3Q 1KD1C 3CC7A 1VQDA 4UP7A 4Y7NH 3CF5A 2JA5H 1EUJA 3S1NH 2JEAI 4GS3A 1Q81C 2K50A 3KJOA 1JJCB 2ZTCA 5M5YH 1K8GA 3I2ZA 1VQEA 1HNXQ 4QQBX 1D7QA 3F8TA 3HOZG 2A1AA 2JE6I 3KDFB 5GROA 1Y1WH 3PCOB 2EXDA 4R4CA 5C4JH 1B70B 4X65Q 4C3IH 4DV0L 3RZOH 4DR7L 3AEVA 1XMQL 3PUYA 1N32L 5BR8L 1I94Q 1SFOH 3JAMc 1EWIA 3SGIA 3PO2G 5M3MH 2IX1A 2ALYB 1GKHA 2BH8A 2WAQG 4TQUS 1WCMG 1XNRQ 4BBRG 1V1QA 3G4SA 2VUMG 1AH9A 3S1RH 4DR4L 2VS1A 4MNOA 3TREA 4DV4Q 2IX0A 1SLJA 4HIOA 4R4TA 2UUAL 3T1YQ 1VQGA 1I5FA 5LMUQ 4JI2L 3FKIH 3PO3G 2I0QA 4A3KG 5M5XH 1HZCA 3GTKH 3I7FA 5FJ8G 2MNAA 3G6EA 1LUZA 4LF4Q 4DAMA 1YITA 4B3TL 5JJIA 4QL5A 1SRUA 4LWCA 2CCZA 4WJ4A 3OW2A 3G71A 4JBKA 3J81j 4DR2Q 1QVGA 4B3SQ 3AFQA 3S1QH 3S16H 2R7FA 3IRBA 4BY1G 5GAHC 2JA8G 1W2BA 4P72A 1K3RA 1EFWA 4DV3Q 3S14H 2K5NA 2N8NA 3HOYG 2UXDQ 3HOWH 5IWAL 4JC0A 3RLOA 4K0KQ 1EQRA 2Z6KA 1BKBA 1Q1EA 3U4ZA 1L1OA 3RNUA 3F2CA 1KL9A 1EQQA 2R7ZG 4JBMA 2JQOA 2ES2A 2KHIA 1YJNA 2FXQA 3PSIA 1X65A 2NVYH 4DR1Q 4JI0Q 2N78A 1WOCA 4DKAC 4LF7Q 1IL2A 1X56A 3AYHB 4DV2L 3HOZH 1VQ9A 4GOPA 4A3BH 2NVTH 5C0XG 4IPCA 2VZAA 2KHJA 3NBHB 5HGQA 3E9IA 3EBEA 1YI2A 1PA6A 4X64L 3CW2C 1GO3E 3ZJYC 3CCMA 4DR5Q 1QVCA 1VQCA 1L1OB 3F2BA 4GNXA 3PUWA 1V43A 5E7NA 5C44G 4ME3A 3LGJA 3RR5A 3GD7A 3VDYA 2UU9L 5IYDH 5FLXc 2PMZE 4JV5L 1N34L 2UXBL 4A3IH 1Y1WG 3Q8DA 4BBRH 5H1SE 5FLMH 1HNZL 2VUMH 1LM0A 1VQOA 1UE5A 1D8LA 4DPGA 3L2PA 4GOPB 1NJIC 2AMCB 1IBLL 3ULPA 1YIJA 3M4QA 4DV1L 3TEHB 1XMOL 4L5QA 4DV0Q 4OXPA 2NN6I 1K83H 4LUZA 4XIGS 4GNXB 1KQSA 1VQNA 3PO3H 1XMQQ 1UE6A 2WB1E 5BR8Q 4JI5L 5FJ8H 1IBMQ 1XPRA 4YCWA 2R93H 2MO1A 1VQJA 2V1CC 2RHSB 2E2HH 4JBJA 4YCUA 3L7ZC 1CUKA 3PF4A 3M9BA 3U4VA 1OXVA 2ZTDA 1B8AA 4DR4Q 3HKSA 4HJ9A 4BY1H 2JA8H 1YZ6A 1K73C 3EIVA 3CCVA 1KC8C 4A3GH 4P74A 5LMNW 2UUAQ 4B3ML 2IT1A 2PI2A 3J7ZC 3CCEA 1E7ZA 3PUVA 4JI2Q 4AYBE 4X66Q 3CCUA 4JI6Q 2ATWA 2R7DA 3H15A 1K8AC 4BA1I 1HR0L 2NVXH 1TWGH 2MO0A 3ULJA 4B3TQ 4LNQA 5K36G 3JAMi 1XNQL 1A8VA 1P8LA 3I4OA 4JYAL 3TS0A 3NELA 3K0XA 4GKJL 4XTCS 3U50C 1YBYA 1X54A 1WI5A 3TQYA 1PV4A 4DV5L 1IXRA 2ZM6L 4BY7H 1M90C 2OTLA 3HOWG 1KRSA 2D62A 4YWLA 2HIVA 1YHAA 1YVCA 1SMXA 5GQOA 4HIDA 4L5RC 1PYBA 1V9PA 1YNXA 2CFMA 2DUDA 3KJPA 2UUBL 4BA2I 5C44H 4IJLA 1C7YA 5IWAQ 5IT9c 1TXYA 2Q2IA 1LTLA 3S17H 2B29A 2H5XA 2IHFA 4KHPL 4A3BG 1GVPA 2A19A 2OQKA 3E9HA 1EOVA 4HIMA 4JBWA 1TWHH 3S2HH 2N3SA 2C35B 4YWKA 3CMAA 4DV2Q 4IFDI 1Q86C 4PG3A 1Q82C 1XJVA 4NXNQ 1HZ9A 5IYCH 1EIFA 2LSSA 1C9OA 1PH3A 1K9MC 2OQ0A 5IYDG 3T1HL 2KCMA 4IO9A 4A3IG 5HY6A 3GTPH 4MZ9A 5FLMG 1VQMA 2N49A 4YHHL 1WYDA 2DGYA 3K8AA 1J5EL 1VS0A 4POFA 2E2JH 3RLNA 4OWTB 3H3VH 3OYYA 4JV5Q 1N34Q 1HH2P 3A0JA 4GN4B 1MIUA 4YY3Q 4KI0A 4A3JG 4DR6L 1MJCA 1VQHA 4IFDJ 4Y52H 2R92G 1B7YB 1IBLQ 1JT8A 1NMFA 2F3IA 3GDEA 4L5SA 3ERSX 3OTOL 3UDGA 2YYZA 1CKMA 3BZKA 4LF6Q 4A3DH 2Q2HA 3GTMH 2R93G 1XMOQ 2I5MX 1MKHA 1R9TH 4BXXH 1C0AA 2WP8J 2ZJPA 4DUZL 2RF4A 4HJAA 3HFZB 4JI5Q 3KF8B 1PFSA 4IPGA 1SR3A 1NY4A 3K7UC 4EX5A 2UUCL 4JI3L 4QIWE 3EN2A 4P73A 4DV7L 2AWOA 1VQIA 3J80i 2R6GA 3UE1A 4A3GG 5JJLA 2F4VL 4WJ3M 1PHJA 3PV0A 3K7AH 3CPFA 3M3YH 4B3MQ 4IPHA 2VL6A 3UDIA 4GKKL 1VQKA 1JMCA 2K5VA 1FGUA 2K75A 2I5HA 1I3QH 4LFCL 1S72A 2KENA 1AE2A 1PH4A 2PQAA 1TWFH 4PMWA 5IP7H 1N36L 2Y0SG 3RZDH 1X55A 1PYSB 3CP0A 2MQHA 2QA4A 3RN2A 1NTGA 4JI7L 4KHZA 4LF9Q 1XNQQ 4BY7G 1DGSA 2B63H 3BJUA 1A0IA 1P16A 4GKJQ 1SN8A 2I5LX 2K5HA 1VQBA 4EQ5A 2WAQE 2OCEA 4J15A 1WJJA 4HIKA 4DV5Q 2EIFA 2AWNA 3S24A 5JEAJ 2ZM6Q 1OXXK 2PQAB 4LW1A 1PH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 c;  3M4P A;  1EIY B;  4R4O A;  4QY7 A;  1Y1V G;  2UUB Q;  4QJF A;  4H02 A;  4NPS A;  1U5K A;  3I4M H;  4C2M H;  1U0L A;  1Q7Y C;  4IJH A;  4OO1 G;  4KHP Q;  1S40 A;  1JJG A;  2YTX A;  3KFU A;  5IYC G;  3GTG H;  4A3J H;  2HIX A;  3STB C;  4A4I A;  1M1K C;  4DR7 Q;  1KAW A;  2IY5 B;  2PI2 E;  4DK3 C;  2R92 H;  1HJP A;  2ASB A;  1N32 Q;  4A3M H;  1ASZ A;  3HKZ G;  1ASY A;  4UP8 A;  4FDB A;  4DUY L;  1IZ6 A;  1E1O A;  2PNH A;  4GLV B;  1Q46 A;  3HOV H;  3KYH C;  1RIP A;  3T1H Q;  5DLQ E;  1VQ5 A;  2HHH L;  1A63 A;  1H95 A;  1N9W A;  2E8G A;  2RCN A;  3J81 c;  3GTJ H;  3T1Y L;  3UDF A;  3GTQ H;  4NXM L;  1CSQ A;  1T9H A;  1TWA H;  3PF5 A;  2KBN A;  4DNI A;  1Z9F A;  3PUX A;  1J5E Q;  1IBK L;  3M85 A;  1I6H H;  1X3E A;  4MTN A;  1HNW L;  4A3F H;  4A3D G;  5IP9 G;  3H0G G;  4DR6 Q;  2NZO A;  4BBS H;  4BXX G;  2AHO B;  1Q12 A;  4C3J H;  2HT1 A;  4C3H H;  3OTO Q;  3RLF A;  1VQ4 A;  2JA7 H;  4A3C H;  1FJG L;  2QEX A;  2CWP A;  2WFW A;  2Q2U A;  2D0O A;  4PZ6 A;  1QZG A;  2ZTE A;  4DUZ Q;  4LFB L;  4JI8 L;  4X62 L;  3CD6 A;  3KLW A;  2VQF L;  2UUC Q;  4JI3 Q;  4DV7 Q;  3L0O A;  3GO5 A;  5JJK A;  5M3F H;  3I4N H;  3STB D;  2F4V Q;  3S2D H;  4JI4 L;  5IP7 G;  1VQ8 A;  4JCV E;  1X3F A;  5C3E H;  3CCJ A;  1NE3 A;  3PUZ A;  4GKK Q;  4X6A H;  4R1J A;  1RL2 A;  1UE7 A;  3TRZ A;  1E3P A;  4P75 A;  1O7I A;  5J3B A;  4JOI C;  4LFC Q;  2MFI A;  3UE0 A;  4A3L H;  1SRO A;  1Y1V H;  1N36 Q;  3A74 A;  2VW9 A;  1JJ2 A;  2B63 G;  3CC2 A;  2VY3 A;  1NBW A;  4DV6 L;  4LUO A;  1G51 A;  1NMG A;  3E0E A;  2VQE L;  1UEB A;  3CCL A;  5LMN L;  4A3E H;  4X64 Q;  1PVO A;  2E5L L;  1Z47 A;  3HOU H;  2NN6 G;  2BA1 A;  3FP9 A;  2UU9 Q;  1FVI A;  4LF5 L;  4L5T A;  4HJ5 A;  3I4M G;  1OXU A;  5C0X I;  2JA6 H;  4ALP A;  5C4X G;  1VQP A;  1HZB A;  2UXB Q;  3M7N A;  1N33 L;  1HNZ Q;  4AQY L;  3MEF A;  1G6P A;  4R4Q A;  1X9N A;  2AKW B;  3KOJ A;  4HJ7 A;  1FL0 A;  1VCI A;  3AQQ A;  1GD7 A;  2NZH A;  5IYB H;  2VNU D;  4A3M G;  3J7A 5;  3TS2 A;  4DV1 Q;  1IBM L;  1HZA A;  1QUQ A;  3AFP A;  5IP9 H;  4HJ8 A;  3H0G H;  4OX9 L;  3GTO H;  4R4I A;  3CCQ A;  2LXJ A;  3HOV G;  1I50 H;  2UXC L;  2K52 A;  2LXK A;  3F2D A;  3M4O H;  5C0X J;  2Z0S A;  4A3L G;  4OO1 I;  2B3G A;  3NEM A;  4DUY Q;  4B3R L;  2E2I H;  1OXS C;  2ID0 A;  2HHH Q;  4JG2 A;  1PH1 A;  4A3F G;  1W3S A;  5GAG C;  4NXM Q;  5IY0 A;  2JEB I;  1IYJ B;  2CQO A;  3JC6 6;  3HOX H;  3RN5 A;  1IBK Q;  1QUQ B;  4X66 L;  4DAY B;  1VQ7 A;  4JI6 L;  4LF8 L;  2R7Z H;  4BBS G;  4A93 G;  1HNW Q;  2JA7 G;  1YHB A;  3H3V I;  4A3C G;  3PIO A;  4JI1 L;  1X6O A;  1BVS A;  1WFQ A;  5IE8 A;  2GVB A;  1PH2 A;  1TWC H;  3G48 A;  2JK8 A;  1E1T A;  2WB1 G;  1XPO A;  2ZJQ A;  3CQZ H;  1QVF A;  1HR0 Q;  1UWV A;  5AJ3 L;  1FJG Q;  5GAE C;  4JYA Q;  4O2D A;  1PH9 A;  4DK6 C;  2JJQ A;  3CPW A;  4LFB Q;  4LFA L;  5M3F G;  4OON A;  4LUV A;  4OWW B;  1G29 1;  1L0W A;  4DR3 L;  3I4N G;  2XGT A;  3ULL A;  3A5U A;  4JI8 Q;  1YJ9 A;  1PH8 A;  4X62 Q;  5C3E G;  3J81 i;  2VQF Q;  4IOA A;  2K4K A;  4KLK A;  1L2F A;  1HNX L;  4IFD G;  1E22 A;  1VQF A;  3CXC A;  3A5Z B;  1GM5 A;  4JI4 Q;  3PIP A;  4NB3 A;  4YWM A;  4AYB G;  2OTJ A;  4X65 L;  3ER0 A;  3I55 A;  2YU9 H;  4GLX A;  1Q1B A;  2CKZ B;  5C4X H;  3D31 A;  4AH6 A;  1E24 A;  4YCV A;  1I94 L;  1AE3 A;  4NXN L;  3ICE A;  4A3E G;  2ZJR A;  3BU2 A;  4DV6 Q;  1X3G A;  3W5O A;  4IOC A;  2CWA A;  5ELO A;  2HQL A;  4GN3 B;  3S1M H;  2YV5 A;  3PGZ A;  3CCS A;  1XNR L;  2A8V A;  3HOU G;  2JA5 G;  1PH5 A;  2YTV A;  2VQE Q;  2NVQ H;  5LMN Q;  4APV A;  1A62 A;  1HR0 W;  4DV4 L;  3PO2 H;  1JE5 A;  1YHQ A;  3DM3 A;  2JA6 G;  2E5L Q;  4JOI A;  3D0F A;  1BBW A;  1WCM H;  4UP9 A;  1KHI A;  4YY3 L;  1J6Q A;  4YHH Q;  1Y14 B;  2RHQ B;  2Q2T A;  4LF5 Q;  3KF6 A;  5LMU L;  2JA9 A;  2KCT A;  1SE8 A;  3MXN B;  4PZ8 A;  5IYB G;  1JB7 A;  1N33 Q;  4LF6 L;  4AQY Q;  3CC4 A;  4LF4 L;  3GTL H;  3K81 C;  2Y0S E;  1QZH A;  1K0R A;  1VQ6 A;  3S15 H;  4A93 H;  4RMF A;  2Z6K C;  5M3M G;  4A3K H;  1OTC A;  1L1O C;  4DR2 L;  1YJW A;  4A76 A;  4OX9 Q;  4RG1 A;  4B3S L;  3CAM A;  1S3O A;  5JEA G;  2QGQ A;  5ELN A;  4GLA C;  5M5W H;  1CKN A;  3WWV A;  1MJE A;  2UXC Q;  2L15 A;  3KF6 B;  2OWO A;  1CKO A;  5GAD C;  1KXL A;  1LYL A;  4DV3 L;  5EAY A;  4GOP C;  1PH6 A;  4B3R Q;  2GN5 A;  4GN5 A;  3NEN A;  3HOX G;  2UXD L;  2K14 A;  1VQA A;  3FKI G;  3B6Y A;  4TVA B;  4OWX B;  4K0K L;  2D0P A;  3W1G A;  3U58 A;  1BBU A;  2YTY A;  1XPU A;  3HOY H;  4GNX C;  1XTD A;  4DR1 L;  4LF8 Q;  4P71 A;  2EQS A;  1OXT A;  4JI0 L;  4UY8 C;  3DLL A;  4LF7 L;  4POG A;  1CKN B;  1UE1 A;  2F52 A;  3F1Z A;  4A75 A;  4IPD A;  2GVA A;  1KRT A;  4JI1 Q;  1N8R C;  4LF9 L;  4AIM A;  2BH2 A;  4QGU A;  2XTI A;  3CME A;  1EYG A;  3KDF A;  1Q8K A;  4JI7 Q;  3W1B A;  3UDX A;  3FHW A;  5AJ3 Q;  4DR5 L;  4O0A A;  3HKZ E;  4UPA A;  3CCR A;  1KIX A;  2BA0 A;  1YEZ A;  2IHE A;  4LFA Q;  1CSP A;  1VQL A;  3I56 A;  4PZ7 A;  3BZC A;  3K80 C;  4DR3 Q;  1KD1 C;  3CC7 A;  1VQD A;  4UP7 A;  4Y7N H;  3CF5 A;  2JA5 H;  1EUJ A;  3S1N H;  2JEA I;  4GS3 A;  1Q81 C;  2K50 A;  3KJO A;  1JJC B;  2ZTC A;  5M5Y H;  1K8G A;  3I2Z A;  1VQE A;  1HNX Q;  4QQB X;  1D7Q A;  3F8T A;  3HOZ G;  2A1A A;  2JE6 I;  3KDF B;  5GRO A;  1Y1W H;  3PCO B;  2EXD A;  4R4C A;  5C4J H;  1B70 B;  4X65 Q;  4C3I H;  4DV0 L;  3RZO H;  4DR7 L;  3AEV A;  1XMQ L;  3PUY A;  1N32 L;  5BR8 L;  1I94 Q;  1SFO H;  3JAM c;  1EWI A;  3SGI A;  3PO2 G;  5M3M H;  2IX1 A;  2ALY B;  1GKH A;  2BH8 A;  2WAQ G;  4TQU S;  1WCM G;  1XNR Q;  4BBR G;  1V1Q A;  3G4S A;  2VUM G;  1AH9 A;  3S1R H;  4DR4 L;  2VS1 A;  4MNO A;  3TRE A;  4DV4 Q;  2IX0 A;  1SLJ A;  4HIO A;  4R4T A;  2UUA L;  3T1Y Q;  1VQG A;  1I5F A;  5LMU Q;  4JI2 L;  3FKI H;  3PO3 G;  2I0Q A;  4A3K G;  5M5X H;  1HZC A;  3GTK H;  3I7F A;  5FJ8 G;  2MNA A;  3G6E A;  1LUZ A;  4LF4 Q;  4DAM A;  1YIT A;  4B3T L;  5JJI A;  4QL5 A;  1SRU A;  4LWC A;  2CCZ A;  4WJ4 A;  3OW2 A;  3G71 A;  4JBK A;  3J81 j;  4DR2 Q;  1QVG A;  4B3S Q;  3AFQ A;  3S1Q H;  3S16 H;  2R7F A;  3IRB A;  4BY1 G;  5GAH C;  2JA8 G;  1W2B A;  4P72 A;  1K3R A;  1EFW A;  4DV3 Q;  3S14 H;  2K5N A;  2N8N A;  3HOY G;  2UXD Q;  3HOW H;  5IWA L;  4JC0 A;  3RLO A;  4K0K Q;  1EQR A;  2Z6K A;  1BKB A;  1Q1E A;  3U4Z A;  1L1O A;  3RNU A;  3F2C A;  1KL9 A;  1EQQ A;  2R7Z G;  4JBM A;  2JQO A;  2ES2 A;  2KHI A;  1YJN A;  2FXQ A;  3PSI A;  1X65 A;  2NVY H;  4DR1 Q;  4JI0 Q;  2N78 A;  1WOC A;  4DKA C;  4LF7 Q;  1IL2 A;  1X56 A;  3AYH B;  4DV2 L;  3HOZ H;  1VQ9 A;  4GOP A;  4A3B H;  2NVT H;  5C0X G;  4IPC A;  2VZA A;  2KHJ A;  3NBH B;  5HGQ A;  3E9I A;  3EBE A;  1YI2 A;  1PA6 A;  4X64 L;  3CW2 C;  1GO3 E;  3ZJY C;  3CCM A;  4DR5 Q;  1QVC A;  1VQC A;  1L1O B;  3F2B A;  4GNX A;  3PUW A;  1V43 A;  5E7N A;  5C44 G;  4ME3 A;  3LGJ A;  3RR5 A;  3GD7 A;  3VDY A;  2UU9 L;  5IYD H;  5FLX c;  2PMZ E;  4JV5 L;  1N34 L;  2UXB L;  4A3I H;  1Y1W G;  3Q8D A;  4BBR H;  5H1S E;  5FLM H;  1HNZ L;  2VUM H;  1LM0 A;  1VQO A;  1UE5 A;  1D8L A;  4DPG A;  3L2P A;  4GOP B;  1NJI C;  2AMC B;  1IBL L;  3ULP A;  1YIJ A;  3M4Q A;  4DV1 L;  3TEH B;  1XMO L;  4L5Q A;  4DV0 Q;  4OXP A;  2NN6 I;  1K83 H;  4LUZ A;  4XIG S;  4GNX B;  1KQS A;  1VQN A;  3PO3 H;  1XMQ Q;  1UE6 A;  2WB1 E;  5BR8 Q;  4JI5 L;  5FJ8 H;  1IBM Q;  1XPR A;  4YCW A;  2R93 H;  2MO1 A;  1VQJ A;  2V1C C;  2RHS B;  2E2H H;  4JBJ A;  4YCU A;  3L7Z C;  1CUK A;  3PF4 A;  3M9B A;  3U4V A;  1OXV A;  2ZTD A;  1B8A A;  4DR4 Q;  3HKS A;  4HJ9 A;  4BY1 H;  2JA8 H;  1YZ6 A;  1K73 C;  3EIV A;  3CCV A;  1KC8 C;  4A3G H;  4P74 A;  5LMN W;  2UUA Q;  4B3M L;  2IT1 A;  2PI2 A;  3J7Z C;  3CCE A;  1E7Z A;  3PUV A;  4JI2 Q;  4AYB E;  4X66 Q;  3CCU A;  4JI6 Q;  2ATW A;  2R7D A;  3H15 A;  1K8A C;  4BA1 I;  1HR0 L;  2NVX H;  1TWG H;  2MO0 A;  3ULJ A;  4B3T Q;  4LNQ A;  5K36 G;  3JAM i;  1XNQ L;  1A8V A;  1P8L A;  3I4O A;  4JYA L;  3TS0 A;  3NEL A;  3K0X A;  4GKJ L;  4XTC S;  3U50 C;  1YBY A;  1X54 A;  1WI5 A;  3TQY A;  1PV4 A;  4DV5 L;  1IXR A;  2ZM6 L;  4BY7 H;  1M90 C;  2OTL A;  3HOW G;  1KRS A;  2D62 A;  4YWL A;  2HIV A;  1YHA A;  1YVC A;  1SMX A;  5GQO A;  4HID A;  4L5R C;  1PYB A;  1V9P A;  1YNX A;  2CFM A;  2DUD A;  3KJP A;  2UUB L;  4BA2 I;  5C44 H;  4IJL A;  1C7Y A;  5IWA Q;  5IT9 c;  1TXY A;  2Q2I A;  1LTL A;  3S17 H;  2B29 A;  2H5X A;  2IHF A;  4KHP L;  4A3B G;  1GVP A;  2A19 A;  2OQK A;  3E9H A;  1EOV A;  4HIM A;  4JBW A;  1TWH H;  3S2H H;  2N3S A;  2C35 B;  4YWK A;  3CMA A;  4DV2 Q;  4IFD I;  1Q86 C;  4PG3 A;  1Q82 C;  1XJV A;  4NXN Q;  1HZ9 A;  5IYC H;  1EIF A;  2LSS A;  1C9O A;  1PH3 A;  1K9M C;  2OQ0 A;  5IYD G;  3T1H L;  2KCM A;  4IO9 A;  4A3I G;  5HY6 A;  3GTP H;  4MZ9 A;  5FLM G;  1VQM A;  2N49 A;  4YHH L;  1WYD A;  2DGY A;  3K8A A;  1J5E L;  1VS0 A;  4POF A;  2E2J H;  3RLN A;  4OWT B;  3H3V H;  3OYY A;  4JV5 Q;  1N34 Q;  1HH2 P;  3A0J A;  4GN4 B;  1MIU A;  4YY3 Q;  4KI0 A;  4A3J G;  4DR6 L;  1MJC A;  1VQH A;  4IFD J;  4Y52 H;  2R92 G;  1B7Y B;  1IBL Q;  1JT8 A;  1NMF A;  2F3I A;  3GDE A;  4L5S A;  3ERS X;  3OTO L;  3UDG A;  2YYZ A;  1CKM A;  3BZK A;  4LF6 Q;  4A3D H;  2Q2H A;  3GTM H;  2R93 G;  1XMO Q;  2I5M X;  1MKH A;  1R9T H;  4BXX H;  1C0A A;  2WP8 J;  2ZJP A;  4DUZ L;  2RF4 A;  4HJA A;  3HFZ B;  4JI5 Q;  3KF8 B;  1PFS A;  4IPG A;  1SR3 A;  1NY4 A;  3K7U C;  4EX5 A;  2UUC L;  4JI3 L;  4QIW E;  3EN2 A;  4P73 A;  4DV7 L;  2AWO A;  1VQI A;  3J80 i;  2R6G A;  3UE1 A;  4A3G G;  5JJL A;  2F4V L;  4WJ3 M;  1PHJ A;  3PV0 A;  3K7A H;  3CPF A;  3M3Y H;  4B3M Q;  4IPH A;  2VL6 A;  3UDI A;  4GKK L;  1VQK A;  1JMC A;  2K5V A;  1FGU A;  2K75 A;  2I5H A;  1I3Q H;  4LFC L;  1S72 A;  2KEN A;  1AE2 A;  1PH4 A;  2PQA A;  1TWF H;  4PMW A;  5IP7 H;  1N36 L;  2Y0S G;  3RZD H;  1X55 A;  1PYS B;  3CP0 A;  2MQH A;  2QA4 A;  3RN2 A;  1NTG A;  4JI7 L;  4KHZ A;  4LF9 Q;  1XNQ Q;  4BY7 G;  1DGS A;  2B63 H;  3BJU A;  1A0I A;  1P16 A;  4GKJ Q;  1SN8 A;  2I5L X;  2K5H A;  1VQB A;  4EQ5 A;  2WAQ E;  2OCE A;  4J15 A;  1WJJ A;  4HIK A;  4DV5 Q;  2EIF A;  2AWN A;  3S24 A;  5JEA J;  2ZM6 Q;  1OXX K;  2PQA B;  4LW1 A;  1PH7 A; 
#chains in the Genus database with same CATH topology
 3S14 B;  1YNN D;  2DJG C;  4NPS A;  2K33 A;  4FF1 A;  1U5K A;  4C2M H;  2HDM A;  4OO1 G;  3A54 A;  4KHP Q;  1S40 A;  2YTX A;  1KDB A;  4A4I A;  2F03 A;  2HCC A;  1CT1 D;  2CW0 D;  3K59 A;  2PI2 E;  2F0V A;  2R92 H;  1HJP A;  3HOZ B;  1N32 Q;  4RGO S;  1ET6 A;  5E1F A;  4A3B B;  4FDB A;  4DUY L;  4K5V A;  1IZ6 A;  1Q46 A;  3KYH C;  2KEE A;  1VQ5 A;  4FXD A;  1N9W A;  3J81 c;  3GTQ H;  4HN7 A;  2VB2 X;  3UDF A;  4NXM L;  2BCO A;  4DNI A;  2A69 C;  3PUX A;  3Q24 A;  4ZQ3 A;  4TSS A;  1NCV A;  1HNW L;  1YNJ D;  1WD0 A;  4MTK A;  4BBS H;  5A2Q L;  2AHO B;  4C3J H;  1VQ4 A;  2WFW A;  2KUM A;  1M8A A;  4LFB L;  4DUZ Q;  1SE2 A;  4DAP A;  5EKI A;  4X62 L;  1STH A;  2R93 B;  3A7A B;  2QIL A;  4JI3 Q;  5JAV A;  4DV7 Q;  3L0O A;  2E2H B;  3SXH A;  3I4N H;  2O4X A;  2F4V Q;  1GUO A;  4JCV E;  1K3B C;  3PUZ A;  1F9P A;  1BF4 A;  4GKK Q;  2JA8 B;  1I4R A;  1UE7 A;  1H9S B;  4IFD H;  1X3P A;  1O7I A;  5IT9 L;  1HRJ A;  2MFI A;  1F9S A;  1S4Z A;  3NTK A;  4RH6 A;  3Q22 A;  2L5T A;  4BWG B;  2VY3 A;  2P5Z X;  2F0L A;  1G51 A;  4G4K A;  1GUT A;  4RGT A;  2NVX B;  3NQI A;  1Y8P B;  4A3E H;  2AQ3 B;  2RKS A;  2WKC A;  3OHX C;  2EJM A;  2RCF A;  3U9S A;  1Z47 A;  1B50 A;  4CKE A;  4LF5 L;  4ZRZ A;  1OXU A;  4ALP A;  5C4X G;  1VQP A;  2UXB Q;  1DOL A;  4FO2 A;  3KOJ A;  1KTK A;  1FL0 A;  5CV4 A;  2VNU D;  3TS2 A;  4DV1 Q;  4ZYS A;  4HR7 B;  1HZA A;  3GTO H;  1ZYR C;  4R4I A;  3HOV G;  1AW7 A;  3MXU A;  1A2U A;  5KYI A;  4KY6 A;  1BCP D;  1CI3 M;  1A15 A;  3EVQ A;  5GAG C;  5IY0 A;  1A3T A;  1MI2 A;  5IGF A;  4X66 L;  1STA A;  1NNX A;  2F0M A;  4C3H G;  2KVM A;  3H3V I;  1MSH A;  1X6O A;  4L63 B;  1XYI A;  3G48 A;  3SVM A;  1QVF A;  4I7Z C;  3J80 E;  3CQZ H;  3GTK B;  1DCZ A;  1EL0 A;  5GAE C;  2NBF A;  2QDL A;  2TMP A;  3GV3 A;  4JYA Q;  2B2Y A;  4IN3 A;  4OWW B;  1G29 1;  1WTV A;  3ULL A;  4J8Q A;  5BN5 A;  4JI8 Q;  3J81 i;  3SK6 A;  1SJE D;  2K4K A;  4KN4 C;  2K5Q A;  5C5L A;  1GM5 A;  3PIP A;  1S5B D;  4YWM A;  2EOT A;  4JVZ A;  1I3Q B;  1TWF B;  1AE3 A;  1JE4 A;  2NYZ D;  3BU2 A;  5D3D A;  4IOC A;  2A8V A;  3HOU G;  2A6H C;  4DV4 L;  3A7L A;  4YHH Q;  2Q2T A;  3KF6 A;  2F0Q A;  2JA9 A;  3J81 L;  4ZUI A;  3MXN B;  4LF6 L;  4AQY Q;  1HPC A;  2F0O A;  4A3K H;  1EEF D;  1LTI D;  1WTR A;  1BR9 A;  5CV8 A;  4OX9 Q;  4RG1 A;  5LL6 X;  1Z6H A;  2QGQ A;  1CKN A;  3K0Y A;  5CGK A;  3T53 B;  5GAD C;  1KXL A;  1WTW A;  1HTP A;  3HOX G;  3HOV B;  4OWX B;  4IUN A;  1HXY D;  5I6Y A;  5JVG 3;  1BBU A;  2NTS A;  2YTY A;  4X3S A;  2O5J C;  1TWA B;  4DR1 L;  4LF8 Q;  4GZY C;  1I6H B;  1OXT A;  2PMZ B;  2NUC A;  4TKO B;  3DLL A;  3DUZ A;  5KNB A;  1ONL A;  2F52 A;  2HUG A;  2R61 A;  4LF9 L;  2RA4 A;  2XTI A;  3KDF A;  3OIP A;  5KRU A;  4C3H B;  5AJ3 Q;  3UDX A;  3FHW A;  3CRL C;  4UPA A;  3CCR A;  1U4P A;  4LFA Q;  1B9N A;  1SND A;  4RCN A;  5EBC A;  1KLG D;  1VQD A;  3BZD B;  2JA5 H;  2K50 A;  3KJO A;  2JE6 I;  4CGY B;  4R4C A;  2MUY A;  4X65 Q;  5KIX A;  3MZ5 A;  3AEV A;  1XMQ L;  1Y1V B;  4L6T B;  1B3A A;  2A73 B;  5JVH 3;  3SGI A;  3PO2 G;  3ERQ A;  1WTQ A;  1B9M A;  2ALY B;  1WCM G;  4UAI A;  4BBR G;  3G4S A;  1G2S A;  1EY6 A;  1CFM A;  5JEA H;  3MFY A;  3DWP A;  3HOU B;  1I5F A;  4F8M A;  4LAA A;  4JI2 L;  3FKI H;  1RKN A;  3K57 A;  2I0Q A;  4K5W A;  2MNA A;  1YIT A;  4QL5 A;  1U4R A;  2CCZ A;  4JBK A;  4A3D B;  1QVG A;  1LTB D;  3H0G B;  3L9A X;  2VXW A;  1XTC D;  4P2C B;  3MA2 B;  5D65 A;  3S14 H;  3HOY G;  2UXD Q;  1V1P A;  1XX8 A;  1PRT C;  1Q1E A;  2KEC A;  1L1O A;  3U4Z A;  3RNU A;  2EYF A;  4IUR A;  1EQQ A;  4JBM A;  4X3U A;  4QCL A;  2K32 A;  3HOX B;  1L0Y B;  1Y8N B;  4JI0 Q;  1ENA A;  1L0X B;  1IL2 A;  3MTS A;  3HOZ H;  2B2T A;  4A3B H;  1C4Q A;  1PA6 A;  3E9I A;  2PW5 A;  4X64 L;  3CW2 C;  1JCK B;  2ZXR A;  1PFB A;  5IGB A;  1VQC A;  4GNX A;  3PUW A;  2Z4I A;  5C44 G;  4Q5V A;  1GXD C;  5FLM H;  5H1S E;  1EY0 A;  1NJI C;  4FF2 A;  1C8C A;  3ULP A;  1LT4 D;  3D6W A;  4CDF C;  2IL8 A;  4DV0 Q;  2NN6 I;  1LT3 D;  1HTL D;  1UE6 A;  1IBM Q;  2R93 H;  2MO1 A;  1VQJ A;  2E2H H;  4JBJ A;  3TSS A;  1SNP A;  4C56 C;  1CUK A;  1SDF A;  3U4V A;  1B8A A;  3HEJ A;  3PO2 B;  2B2Y C;  2JA8 H;  1WCM B;  4P74 A;  4B3M L;  2PI2 A;  1KAB A;  1T5E A;  3R8B A;  4AYB E;  2R7D A;  3TDQ A;  4FF3 A;  5J39 A;  1BUV T;  2NVX H;  2MO0 A;  3ULJ A;  3I73 A;  1XNQ L;  4A93 B;  1X54 A;  4XQJ A;  3KBX A;  4DV5 L;  1IXR A;  3HOW G;  3HG9 A;  2EYM A;  5M5W B;  1UEA B;  3BVM A;  4YWL A;  1YHA A;  1YVC A;  1SMX A;  1B1Z A;  2CFM A;  2UUB L;  2J0T D;  4BA2 I;  4KJN A;  1TXY A;  1LT5 D;  2E75 C;  1GVP A;  3HOY B;  2K03 A;  3T51 B;  1Y69 U;  2MGS A;  3NUC A;  4OO1 H;  3CMA A;  2B2U C;  4AYB B;  1XJV A;  3MXG A;  1C9O A;  2M9V A;  3GP7 A;  1D6E C;  3SK8 A;  4JW0 A;  4N9T A;  1JWM D;  2XVS A;  3LX0 A;  3M7G A;  1VS0 A;  3K6O A;  5ISR A;  4KI0 A;  1AFP A;  4A3J G;  4DR6 L;  4EVO A;  2KHS A;  4IUQ A;  4Y52 H;  5M5Y B;  1B4O A;  1B7Y B;  1IBL Q;  1JT8 A;  1SYB A;  1QCB D;  4NMZ A;  1PRT B;  3BZK A;  4KV6 A;  2KQ3 A;  1MKH A;  2WV6 D;  3AMU A;  4UDU C;  4JI5 Q;  4IPG A;  1SR3 A;  3K7U C;  4MIU A;  2A6E C;  2UUC L;  1SNC A;  3I8Z A;  3EN2 A;  1I4G A;  5JJL A;  4WJ3 M;  4DN4 M;  1CTM A;  1D1I A;  3S1R B;  4OHJ A;  3Q6S A;  1VQK A;  1PRT F;  3ERO A;  3IFT A;  3OMC A;  1I3Q H;  4LFC L;  2KEN A;  1TWF H;  2BOS A;  2F0J A;  2Y0S G;  3VR4 A;  3R2I A;  1PYS B;  1D5Z C;  1TU2 B;  4Z9C B;  2XSC A;  1FNW A;  4RGM A;  2QA4 A;  3RN2 A;  4CDC C;  4BY7 G;  1DGS A;  4ZLT F;  5EPJ A;  1O7Y A;  1A0I A;  1P16 A;  4GKJ Q;  5IGE A;  1SN8 A;  2I5L X;  2R3Z A;  1HCZ A;  4IQZ A;  1DON A;  1BOS A;  3RUZ A;  2WAQ E;  4NKL A;  1GHK A;  3NTI A;  1KNA A;  1JJ2 A;  1RD9 D;  1EIY B;  1ZXT A;  1IKL A;  4HMJ A;  3MHB A;  3HOW B;  1CA6 A;  4DA2 A;  1PZI D;  4IJH A;  1KDC A;  3H09 A;  2L0C A;  3NSW A;  3STB C;  1M1K C;  4CJ0 B;  3DM1 A;  4DR7 Q;  4ZKC B;  4DK3 C;  3DMU A;  1ASZ A;  1EY5 A;  5A2Q E;  3DHQ A;  1E1O A;  2PNH A;  3HOV H;  3IAY A;  3LWE A;  1JIC A;  1PXU A;  5DLQ E;  5BN4 A;  1CSQ A;  1J5E Q;  1TWA H;  2XWB B;  1IBK L;  1Z9F A;  1I6H H;  4EQP A;  1ICF B;  2NZO A;  1F9R A;  3VR5 A;  1Q12 A;  4C3H H;  3OTO Q;  1FJG L;  5IT9 E;  2A68 D;  2ZTE A;  2K1B A;  3C2P A;  2B2T C;  3KLW A;  2HDL A;  2VQF L;  4PMC A;  1LTR D;  1BDO A;  2Z4H A;  4RKB A;  4CKC A;  1BXT A;  2RQX A;  5J3B A;  4JOI C;  2OF1 A;  1Y1V H;  5C6A A;  1CQF A;  3CC2 A;  1NBW A;  1EIH A;  2A69 D;  3SE0 A;  1LTS D;  2Y0S B;  3E0E A;  4CDE C;  2B2W A;  5C4Z A;  1STG A;  3HOU H;  1FVI A;  3PIO 3;  4RA8 A;  4HJ5 A;  1RHP A;  1PFM A;  2SEB D;  2K5D A;  3QOL A;  3OWE B;  3M7N A;  1N33 L;  3PQI A;  1HNZ Q;  4R4Q A;  1X9N A;  4WOR A;  1WTP A;  3S17 B;  2SDF A;  5CR3 A;  4HJ7 A;  2RSN A;  3J7A 5;  1UNS A;  3S9W A;  3AFP A;  4DAY A;  5IP9 H;  3D4D A;  3H0G H;  3CCQ A;  2LXJ A;  2UXC L;  2K52 A;  3H91 A;  2LXK A;  5IGD A;  1ENF A;  4OO1 I;  2B3G A;  3NEM A;  4RWS C;  4DUY Q;  4B3R L;  1OXS C;  1OO9 B;  4JG2 A;  4A3F G;  5FK9 C;  2VB3 X;  3GTP B;  2H4O A;  4NXM Q;  3AB9 A;  2CQO A;  3HOX H;  4M1U B;  2E2J B;  1QUQ B;  1I4Q A;  1LAB A;  1HNW Q;  1E2Z A;  1YHB A;  3PIO A;  4JI1 L;  5KNC A;  2Z6B A;  2ZJQ A;  4KK7 A;  1HR0 Q;  3GTM B;  2OT2 A;  1PH9 A;  4LFB Q;  1AEX A;  3G6J B;  2V4D A;  1L0W A;  4X62 Q;  1ENC A;  5C3E G;  4K6L A;  1DXM A;  1ZYR D;  3QOJ A;  1E22 A;  3A5Z B;  3E0J A;  2C5C A;  3ER0 A;  3I55 A;  1SJH D;  5HGT A;  3ICE A;  3J81 E;  3ITP A;  4RHS A;  1X3G A;  5ELO A;  2HQL A;  1JOK A;  2YV5 A;  1XNR L;  1K8M A;  3BDC A;  3PO2 H;  2HD3 A;  1WCM H;  4UP9 A;  1SNO A;  1KHI A;  1HQM C;  2RHQ B;  4LF5 Q;  5LMU L;  1H9M A;  2KCT A;  4OIJ A;  4PZ8 A;  5IYB G;  1SYF A;  3A8J E;  4LF4 L;  1VQ6 A;  4A93 H;  3NPP A;  5M3M G;  1XXG A;  3D3R A;  2QW7 A;  3QJY A;  1HHV A;  4A76 A;  3J7A V;  4B3S L;  1S3O A;  5ELN A;  5M5W H;  1SNM A;  1MJE A;  3QB3 A;  2L15 A;  4HAE A;  2MJ8 A;  1PH6 A;  4QUF A;  2BDN A;  2K14 A;  4O42 A;  1VQA A;  4TVA B;  4CJ2 C;  3TZU A;  3GTJ B;  3HOY H;  4ID6 A;  3BVG A;  5I9P A;  2A6H D;  2WKD A;  4LF7 L;  4A3F B;  1UE1 A;  3F1Z A;  5IGC A;  1N8R C;  2GVA A;  4DNT B;  2BH2 A;  1ZEQ X;  4DFA A;  1CQV A;  4RHR A;  1SSO A;  4JI7 Q;  4CKB A;  2PW7 A;  4DR5 L;  3T4A C;  4O0A A;  4K6D A;  1KIX A;  2BA0 A;  2EJF C;  3CRK C;  4PZ7 A;  3K80 C;  1KD1 C;  3CC7 A;  3CF5 A;  1K28 A;  2F0E A;  1FGB D;  1Q81 C;  2L9H A;  1JJC B;  1VDZ A;  2ZTC A;  3EFX D;  5E3F A;  3T13 A;  5M5Y H;  1NR2 A;  4U67 3;  3F8T A;  1XWE A;  4Q0F A;  3S2D B;  3R93 A;  1IL8 A;  3PCO B;  5C3E B;  1B70 B;  1HFN A;  1N32 L;  1EZ6 A;  4KN7 C;  2KCC A;  2ZXO A;  2IX1 A;  1GKH A;  2EYJ A;  5LHY 1;  1PDQ A;  3PIP 3;  2VUM G;  2PQE A;  3S1R H;  2LKV A;  4MNO A;  5C4H A;  4DV4 Q;  3GQB A;  2IX0 A;  4X3K A;  5E4W C;  3T1Y Q;  2NTT A;  2EY6 A;  1TR5 A;  3P75 A;  1ILP A;  3PO3 G;  3I7F A;  4B3T L;  5JJI A;  2RVL A;  4WJ4 A;  4KD3 A;  2Q8I B;  1DJR D;  1QG7 A;  3TP7 A;  4BY1 G;  1GHJ A;  1I50 B;  2F3W A;  5EQ0 A;  1K3R A;  1K8O A;  2E2I B;  1G91 A;  3HOW H;  1SMY D;  1EQR A;  2Z6K A;  1KL9 A;  2R7Z G;  1DZ1 A;  2JQO A;  4DR1 Q;  3CKI B;  1DOM A;  1EY7 A;  4NDX A;  1X56 A;  3AYH B;  4DV2 L;  2L4N A;  4GOP A;  2VZA A;  3NBH B;  1YI2 A;  5HGQ A;  1TWC B;  4JPB W;  2RSO A;  3J7Y W;  3FDT A;  2F0U A;  1LTA D;  1RJT A;  1W6K A;  5CBA E;  4ME3 A;  3LGJ A;  3VYS A;  2DNE A;  5FLX c;  2PMZ E;  4JV5 L;  2UXB L;  1Y1W G;  1LM0 A;  1UE5 A;  1D8L A;  4DPG A;  3L2P A;  4C3I G;  4EQN A;  2AMC B;  2F0F A;  1U9R A;  1F2Y A;  4FVM A;  2K04 A;  3A56 A;  4DV1 L;  3W2D A;  1EYD A;  4RAU C;  2K05 A;  3L3O C;  5EPL A;  5C4X B;  1XMQ Q;  2B2V C;  5FJ8 H;  1PRT D;  4YCW A;  1STY A;  2CH4 A;  2FFK B;  1A3V A;  3S1M B;  3S16 B;  3K5N A;  2NZ1 D;  3M9B A;  1OXV A;  2SOB A;  2ZTD A;  3BG3 A;  5CV7 A;  2K7V A;  1YZ6 A;  4DXG A;  5LMN W;  1RCV D;  3J7Z C;  2SNS A;  4XDX A;  1FNV A;  4JI2 Q;  3CCU A;  4JI6 Q;  1K8A C;  4PMB A;  4I7A A;  1TT2 A;  5K36 G;  5ELF A;  5CV5 A;  3P1H A;  4JYA L;  3I4O A;  4CHT B;  3NEL A;  4ZUJ A;  1YBY A;  3TQY A;  5C0X H;  2ZM6 L;  4BY7 H;  1M90 C;  2HIV A;  4O1N A;  3TP6 A;  4HID A;  1RTN A;  1V9P A;  3BDO A;  1YNX A;  3KJP A;  1PFN A;  4IJL A;  1C7Y A;  1GUW A;  3S17 H;  3OW7 A;  2H5X A;  2IHF A;  4DXF A;  2OQK A;  3E9H A;  1EOV A;  4IUP A;  3D4R A;  3KLR A;  4EQO A;  2N3S A;  2C35 B;  2R7Z B;  4IFD I;  1FNU A;  4ME5 A;  4PG3 A;  4NXN Q;  2LSS A;  2F0N A;  2OQ0 A;  2PO4 A;  3T1H L;  2JSO A;  2PCF B;  4IO9 A;  4A3I G;  5HY6 A;  3GTP H;  4KJO A;  4MZ9 A;  1VQM A;  4YHH L;  5CV9 A;  2E2J H;  5IOD A;  3OYY A;  3SDZ A;  3KK7 A;  2BE5 C;  5EPK A;  1HH2 P;  1MIU A;  4YY3 Q;  4Y7N B;  1AN8 A;  3S1N B;  1DOK A;  4V0B A;  2QKI C;  2R92 G;  5IOC A;  2JYO A;  1Y1W B;  1CKM A;  1RDP D;  1D1K A;  2Q2H A;  3GTM H;  2ICI A;  2I5M X;  4C3I B;  2WP8 J;  2ZJP A;  2AQ1 B;  3KF8 B;  3KLS A;  1FD7 D;  4EX5 A;  5I2X A;  2KA7 A;  1LLR D;  2F0I A;  3J80 i;  1JOO A;  4RGN A;  1PHJ A;  3PV0 A;  4IUU A;  1DD2 A;  3UDI A;  4X3T A;  1JMC A;  5IIF A;  2RDF A;  1PH4 A;  4B3M Q;  4DK0 A;  1AE2 A;  2PQA A;  4N9P A;  1N36 L;  1VF7 A;  2EE1 A;  1TS5 A;  3DEO A;  1I4P A;  4QB4 A;  1EQV A;  3TN2 A;  2X69 A;  1NTG A;  2Q8R E;  1VF5 C;  1XNQ Q;  1U4M A;  3BDL A;  4EQ5 A;  1R4Q B;  4J15 A;  4DV5 Q;  2AWN A;  3S24 A;  5JEA J;  3SHL A;  3S1Q B;  4LW1 A;  2FMM A;  5EJW A;  1PH7 A;  1ILQ A;  1JR0 D;  2UUB Q;  4H02 A;  5FLX L;  2PYK A;  2LMC B;  1I4X A;  2CHB D;  4K8I A;  2NB0 A;  1M4V A;  3NE5 B;  2TSS A;  1JJG A;  1CHQ D;  3FMC A;  3NWS A;  5IYC G;  2HIX A;  1PTO C;  4I65 A;  4V19 0;  1KAW A;  1LTG D;  2J7Z A;  4XYO A;  1O78 A;  3HKZ G;  1F2M A;  2NVT B;  1II3 A;  1WTH A;  3BYT B;  3I90 A;  1RIP A;  2HHH L;  1EY8 A;  1H95 A;  1BBX C;  1HA6 A;  5ELD A;  3GTJ H;  1T9H A;  3PF5 A;  1I4H A;  3M85 A;  1X3E A;  4R8I A;  4MTN A;  5ELB A;  1F77 A;  4A3I B;  4A3F H;  4BBR B;  3VYR A;  4DR6 Q;  1SE3 A;  4BXX G;  1V1O A;  1ET9 A;  1HQR D;  2HT1 A;  3WOE A;  3RLF A;  3MWY W;  4K2K A;  1H9S A;  2QEX A;  2Q2U A;  5EBD A;  5I2Y A;  2D0O A;  4PZ6 A;  2WIN B;  3FVQ A;  2OXP A;  4IUV A;  1SXT A;  1SYC A;  2UUC Q;  1DYQ A;  5DAU A;  3GO5 A;  5JJK A;  2C9O A;  3STB D;  3S2D H;  4JI4 L;  4U68 A;  5C3E H;  1NE3 A;  3R2T A;  4X6A H;  1RL2 A;  4K14 A;  1E3P A;  4LFC Q;  5K5P A;  3UE0 A;  5AFW A;  1SRO A;  1SAP A;  3D8G A;  4ABN A;  4DV6 L;  4LUO A;  4WRD A;  1Q3L A;  5J22 A;  1QJO A;  1TWG B;  2VQE L;  3CCL A;  5LMN L;  3UI2 A;  5JJZ A;  1PVO A;  2E5L L;  4FP5 D;  1TKW B;  2NN6 G;  3M4Y A;  2UU9 Q;  3I4M G;  5C0X I;  5DEH A;  1QOH A;  3SK5 A;  1QIL A;  5C44 B;  1G6P A;  3SEB A;  1V8Q A;  2K5W A;  3AQQ A;  2NZH A;  3X3M A;  5IYB H;  5D14 A;  4A3M G;  1IBM L;  4HJ8 A;  3HRZ C;  3S2H B;  2EZV A;  1I50 H;  3H6M A;  5CC4 A;  2Z0S A;  1SYG A;  4A3L G;  2E2I H;  5HUR A;  3MC0 B;  2L55 A;  3HP3 A;  3I3C A;  3HKZ B;  4HMI A;  3I72 A;  2KOL A;  2JEB I;  1IYJ B;  3JC6 6;  3RN5 A;  1IBK Q;  1C48 A;  4WFN 3;  1KAA A;  3OMG A;  2JA7 G;  4A3C G;  1GJX A;  1JB3 A;  5JPN C;  1CZG A;  2CVR A;  2RDH A;  2D5D A;  3IKJ A;  5IE8 A;  2GVB A;  4IUT A;  1TWC H;  2WB1 G;  3FPP A;  4TRD A;  1UWV A;  1FJG Q;  5COR A;  3BYY B;  1QE6 A;  2JJQ A;  3CPW A;  3N6R A;  5M3F G;  3T16 A;  1PTO B;  4LUV A;  4DR3 L;  3A5U A;  1YJ9 A;  2VQF Q;  1SNQ A;  4IOA A;  1L2F A;  1HNX L;  2CH4 W;  4KKT A;  1VQF A;  5CV6 A;  2F0S A;  1SE4 A;  4GLX A;  2CKZ B;  5C4X H;  1H9K A;  1I94 L;  2O2L D;  1PTO F;  2KJX A;  3MXN A;  1TQO A;  2CWA A;  4GN3 B;  4EGV A;  3S1M H;  3S16 H;  3CCS A;  2JA5 G;  1PH5 A;  2YTV A;  2F0G A;  4APV A;  1A62 A;  1HR0 W;  3ND9 A;  1VMP A;  2JA6 G;  3DM3 A;  3NHH A;  1MD2 D;  1BBW A;  3SK4 A;  1Q8I A;  3E3X A;  4QUC A;  2JP1 A;  2XIW A;  2J4X A;  3QG1 A;  1SE8 A;  2DJF C;  1ML0 D;  1N33 Q;  1CK1 A;  3KBG A;  1X32 A;  3CC4 A;  1IW7 C;  2Y0S E;  3K81 C;  1K0R A;  3I4M B;  3SR1 A;  4H13 C;  4RMF A;  3U9O A;  1L1O C;  1OTC A;  3P20 A;  4DR2 L;  3GTG B;  4A3J B;  5JEA G;  3WWV A;  2UXC Q;  4ILW A;  3KF6 B;  4L8J A;  4KMU C;  1CKO A;  1JC7 A;  1KNE A;  4A3M B;  1LYL A;  1Q90 A;  1STE A;  5EAY A;  4DV3 L;  4B3R Q;  2GN5 A;  4GN5 A;  3FKI G;  4K0K L;  1B53 A;  3U58 A;  1WD1 A;  1WTX A;  1XPU A;  5KGU A;  1B3Q A;  4GNX C;  1XTD A;  4UY8 C;  2QDB A;  4POG A;  4MHE A;  1CKN B;  2R7Z H;  4JI1 Q;  3DXJ C;  2AQ2 B;  5KYL A;  3WDN A;  4RKL A;  4QGU A;  2GA4 B;  3DWA A;  1E2W A;  1SEB D;  4F88 A;  2JA7 B;  5EGT A;  3W1B A;  1YEZ A;  2IHE A;  1VQL A;  4ZKB B;  4IAL A;  2WB1 B;  3I56 A;  3R3O A;  5G3L F;  4Y7N H;  1EUJ A;  3S1N H;  2JEA I;  1SBB B;  4BY7 B;  3QR8 A;  4GS3 A;  1PMR A;  2JN4 A;  5JPM C;  1K8G A;  4QQB X;  3I2Z A;  3HOZ G;  3KDF B;  1Y1W H;  1EEI D;  2EXD A;  4N8F A;  4C3I H;  4DR7 L;  1G8Z D;  3PUY A;  5BR8 L;  3JAM c;  2HQE A;  1EWI A;  2F3V A;  1QNK A;  2BH8 A;  1XNR Q;  1V1Q A;  2L11 A;  5NUC A;  4XQQ A;  4DR4 L;  4G7O C;  1SLJ A;  5T1G A;  4HIO A;  3KLS X;  4R4T A;  5LL6 S;  2UUA L;  1VQG A;  5LMU Q;  2JA6 B;  4ZCK A;  2QF7 A;  2EYL A;  1HZC A;  4LF4 Q;  3QO2 A;  4HSV A;  1AP0 A;  1SRU A;  4OIK A;  4RFB A;  1BO0 A;  2RBM A;  5I4D A;  1DM0 B;  3OW2 A;  2F0T A;  3FRP B;  4E6I A;  5K36 H;  4B3S Q;  3AFQ A;  3NXW A;  2FJ2 A;  3S1Q H;  2R7F A;  3IRB A;  5GAH C;  2EJG C;  2JA8 G;  2PNR C;  1W2B A;  3M4O B;  2L1B A;  5IWA L;  3RLO A;  1BKB A;  2F0D A;  4KY5 A;  2ES2 A;  1YJN A;  2FXQ A;  3PSI A;  4YIJ A;  4DKA C;  4LF7 Q;  1S5D D;  3WOF A;  1VQ9 A;  2NVT H;  4IPC A;  1B44 D;  1V1P B;  3ZJY C;  3CCM A;  4DR5 Q;  1UUP A;  1QVC A;  1L1O B;  3F2B A;  1RF2 D;  1VMC A;  5E7N A;  3VDY A;  3RR5 A;  3BS1 A;  1N34 L;  4A3I H;  2A68 C;  3Q8D A;  4BBR H;  1HNZ L;  4QIW B;  5KEE A;  5CYU A;  5FO8 B;  5FO7 B;  3VYU A;  4C1N I;  4KTA A;  1YIJ A;  3M4Q A;  1TS2 A;  3MAQ A;  1XMO L;  4L5Q A;  2AUK A;  4OXP A;  5F2D A;  2YU9 B;  2PZU A;  1H9J A;  4GNX B;  1VQN A;  1O7L A;  3LWU A;  1XPR A;  2V1C C;  2RHS B;  5M9O A;  4XT3 B;  2G5D A;  2K6A A;  1HUM A;  4YCU A;  3L7Z C;  1JOQ A;  2NVQ B;  4J6H A;  1SYE A;  2IT1 A;  4J1M A;  1E7Z A;  3PUV A;  2BDO A;  2QCP X;  3K58 A;  4X66 Q;  3VR2 A;  2B8G A;  5C5M A;  1A3U A;  1HR0 L;  2Z8L A;  5L37 A;  1TWG H;  4B3T Q;  4XT1 B;  4LNQ A;  4F87 A;  3GTL B;  1E0B A;  3NQT A;  1A8V A;  3JAM i;  4G7H C;  3S15 B;  3TS0 A;  3V2T A;  3K0X A;  2Q8T A;  3U50 C;  1WI5 A;  3ONA B;  1PV4 A;  4FYD A;  2OTL A;  1EYC A;  1W6J A;  3HGB A;  5GQO A;  1PYB A;  1STN A;  2DUD A;  3J7A F;  5C44 H;  5CBE E;  2A5H A;  2Q2I A;  1LTL A;  2B29 A;  4KHP L;  2A19 A;  3MEH A;  2DN8 A;  4HIM A;  3S2H H;  4YWK A;  4DV2 Q;  5E4X A;  1R4P B;  1Q82 C;  5IYC H;  1EIF A;  2RDG A;  1CZW A;  1MSG A;  1K9M C;  5DM6 3;  5IYD G;  3JAM L;  3VR6 A;  2KCM A;  1AZP A;  2DGY A;  1G6Z A;  3K8A A;  5FKA C;  4POF A;  3RLN A;  2LS0 1;  4OWT B;  4F7X A;  1QNU A;  4ULL A;  4JV5 Q;  4IFD J;  1NMF A;  3GDE A;  4L5S A;  4LF6 Q;  5C4J B;  4G57 A;  4BXX H;  3RZO B;  1C0A A;  1YNN C;  4DUZ L;  2DY7 A;  1PTO H;  4HJA A;  5TSS A;  1D5X C;  1SFO B;  1PZJ D;  4JI3 L;  2F1M A;  4DV7 L;  2AWO A;  2DNC A;  5M3M B;  1VQI A;  2LFN A;  3UE1 A;  4A3G G;  3EJI A;  2F4V L;  1S5E D;  2CW0 C;  3DWQ A;  1LV9 A;  2B2W C;  4IPH A;  5COY A;  4GKK L;  1JOR A;  1K0S A;  2K5V A;  1FGU A;  1AZQ A;  1BNZ A;  2I5H A;  4PMW A;  1X55 A;  1D5M C;  3CP0 A;  4N8X 1;  2MHV A;  5M5X B;  5FLX E;  4JI7 L;  4LF9 Q;  2BE5 D;  3P7J A;  1YNJ C;  2EXZ A;  3BJU A;  2EY1 A;  2OCE A;  4HIK A;  2ZM6 Q;  3H3V C;  1EWC A;  3OPO A;  4LJZ C;  3J80 c;  3M4P A;  3VR3 A;  4R4O A;  4QY7 A;  1Y1V G;  4NP5 A;  4QJF A;  1PZK D;  2NN6 H;  3I4M H;  4OGQ C;  4C1N K;  1U0L A;  2EYP A;  1Q7Y C;  3TME A;  3NTH A;  5J1Z A;  3KFU A;  2NVY B;  3K5L A;  3GTG H;  4A3J H;  4K2L A;  4FXG C;  2D2C C;  2IY5 B;  1GUN A;  1LT6 D;  4BS9 A;  2ASB A;  4A3M H;  1ASY A;  2N88 A;  2WII B;  4UP8 A;  3D4W A;  4GLV B;  4PQX A;  3T1H Q;  1A63 A;  2FIN B;  4UHV A;  2MPM A;  2E8G A;  2RCN A;  3T1Y L;  4A3L H;  3Q0A A;  2EDG A;  2FMC A;  2D9U A;  2KBN A;  5ELC A;  4A3D G;  1J8I A;  2B2U A;  5IP9 G;  1MHW C;  3H0G G;  2VUM B;  4DF7 A;  2JA7 H;  1EQT A;  2XRS D;  2CQA A;  4A3C H;  1EY4 A;  2X6G A;  2CWP A;  1K83 B;  1QZG A;  1NSN S;  3PO3 B;  4PNY A;  2IPK D;  3IFD A;  2ICE C;  1QB5 D;  4JI8 L;  3CD6 A;  1EZ8 A;  3V96 A;  2L12 A;  5M3F H;  1EU4 A;  5DNF A;  1PTO D;  1EOT A;  5IP7 G;  1VQ8 A;  4HTH A;  1X3F A;  4HCS A;  3CCJ A;  4R1J A;  4BY1 B;  3TRZ A;  4A3G B;  3E5S A;  4P75 A;  4CDD C;  3URY A;  1N36 Q;  3A74 A;  1TS3 A;  1BCP C;  2VW9 A;  2B63 G;  1HA5 A;  1NMG A;  3EQL C;  4XQN A;  1UEB A;  4X64 Q;  2I07 B;  2F0K A;  2PZW A;  3OSO A;  1TS4 A;  2BA1 A;  3FP9 A;  2Z1C A;  2IJ0 A;  3I70 A;  4L5T A;  1IKM A;  2DY8 A;  3TBI B;  4B9W A;  5FOB B;  2JA6 H;  4G7Z C;  1HZB A;  3C1F A;  4AQY L;  4R9W A;  2O5I C;  3MEF A;  2AKW B;  2XRQ D;  2ENB A;  1VCI A;  3NWT A;  1GD7 A;  2AUJ D;  1SMY C;  1QUQ A;  3I4L A;  1NR4 A;  3OIQ A;  3N52 A;  5EKL A;  4OX9 L;  2M2L A;  2HCI A;  1TWH B;  3F2U A;  1I6V C;  1Y8O B;  3G7L A;  3X3N A;  5C0X J;  3F2D A;  5C3W A;  3M4O H;  1EWH A;  1PYW D;  2ID0 A;  2HHH Q;  2E74 C;  2EY5 A;  5KND A;  1PH1 A;  2EVB A;  1W3S A;  1GUG A;  3V05 A;  1CHP D;  2KCN A;  2XWJ B;  1VQ7 A;  4BBS G;  4LF8 L;  4JI6 L;  4A93 G;  4DAY B;  2NWG A;  4K5X A;  4C3J G;  4CBV A;  1BQQ T;  3ND8 A;  3NK9 A;  2F4I A;  1BVS A;  1WFQ A;  5G3L D;  1PH2 A;  1XPO A;  3CU7 A;  2JK8 A;  1E1T A;  1KDA A;  3Q23 A;  4KD4 A;  5AJ3 L;  1JQY D;  1LO5 D;  5C3X A;  1A6X A;  2EPB A;  3CHB D;  1R9T B;  4O2D A;  5DM7 3;  4DK6 C;  4LFA L;  4OON A;  3I4N G;  1E2V A;  4QMG A;  2XGT A;  2IW3 A;  1PH8 A;  4H7B A;  1ESR A;  4KLK A;  4IFD G;  2WAC A;  4HCE A;  3CXC A;  4JI4 Q;  3J80 L;  3K7A B;  4NB3 A;  4AYB G;  4B9X A;  3M3Y B;  2ZT9 C;  2OTJ A;  4X65 L;  2MP1 A;  5FO9 B;  2YU9 H;  2A6E D;  5EKK A;  1Q1B A;  3KUP A;  3D31 A;  4AH6 A;  4FF4 A;  1E24 A;  4YCV A;  3RZD B;  4NXN L;  1S5F D;  4A3E G;  2ZJR A;  4DV6 Q;  5D3I B;  3W5O A;  4H44 C;  3PGZ A;  4M8A A;  2VQE Q;  2NVQ H;  5LMN Q;  2B63 B;  1LAC A;  1G2T A;  1JE5 A;  1YHQ A;  3C3L A;  3AU7 A;  2E5L Q;  3NBI A;  4JOI A;  3D0F A;  4YY3 L;  4XYQ A;  1J6Q A;  1ROD A;  1Y14 B;  1EY9 A;  3IL8 A;  1Z7T A;  5JOB A;  1JB7 A;  3GTL H;  1QZH A;  4C2M B;  3S15 H;  2Z6K C;  3K5O A;  2IX3 A;  2QEJ C;  3OOC A;  4WJW A;  1YJW A;  3CAM A;  1MGS A;  1S5C D;  1STB A;  4GLA C;  1BCP B;  2R92 B;  1TII D;  2OWO A;  1H9R A;  5CMD A;  4S3S A;  4GOP C;  1O80 A;  2UXD L;  3NEN A;  1UAP A;  3BVZ A;  3B6Y A;  2X6L A;  2D0P A;  3W1G A;  3TZD A;  3GTQ B;  4P71 A;  2EQS A;  4OEM B;  2B39 A;  4QF4 A;  4JI0 L;  1FYC A;  4ODG A;  4A75 A;  4IPD A;  1BCP F;  1KRT A;  2F0H A;  4AIM A;  4BBS B;  3CME A;  1EYG A;  4C3J B;  1Q8K A;  3HKZ E;  3HZX A;  1CSP A;  4NW2 A;  3K5M A;  3A8I E;  1IW7 D;  3BZC A;  4DR3 Q;  1TVX A;  4HED A;  4UP7 A;  2LY7 A;  4JK1 C;  1EYA A;  5A35 A;  1GUS A;  1HNX Q;  1D7Q A;  1VQE A;  3I4N B;  1GOZ A;  2A1A A;  1NUC A;  4KKU A;  5GRO A;  4LK1 C;  5C4J H;  2K01 A;  4DV0 L;  3RZO H;  4CJ1 B;  3ZYY X;  1I94 Q;  3LNN A;  1SFO H;  5M3M H;  2WAQ G;  4TQU S;  3MFG A;  3EA6 A;  1AH9 A;  1F9Q A;  4A3E B;  2VS1 A;  3TRE A;  3VA7 A;  2E76 C;  1EIG A;  2XNA C;  1B2T A;  2PPB C;  1FR3 A;  3D6C A;  1PLF A;  2PZT A;  4FXK C;  4A3K G;  5M5X H;  3GTK H;  3PMF A;  5FJ8 G;  1CM9 A;  1ZKO A;  2XN9 C;  1LUZ A;  3G6E A;  1X3Q A;  4DAM A;  5I6W A;  2EYH A;  1D2B A;  4LWC A;  3G71 A;  2H1E A;  3J81 j;  4DR2 Q;  4HSP A;  3QIA A;  3GTO B;  2Z9H A;  4KKS A;  4P72 A;  3NBH A;  1EFW A;  4DV3 Q;  2K5N A;  2N8N A;  2M00 A;  1TY0 A;  4JC0 A;  4K0K Q;  2G9D A;  3F2C A;  2KHI A;  1IYU A;  1X65 A;  2NVY H;  4K8J A;  2N78 A;  1WOC A;  3DEP A;  1ICW A;  3C1E A;  4DNR B;  5C0X G;  1SYD A;  1JWS D;  2KHJ A;  3EBE A;  3O13 A;  4ZK9 B;  3CQZ B;  1GO3 E;  1JWU D;  3MXP A;  1V43 A;  2UU9 L;  3GD7 A;  1RTO A;  5IYD H;  3A55 A;  2JXM B;  4DU9 A;  3VA5 A;  3H94 A;  2EYO A;  4DGZ A;  2VUM H;  1VQO A;  4GOP B;  1WTO A;  1IBL L;  1F2Z A;  3I91 A;  3FEW X;  3NP8 A;  5T1I A;  3TEH B;  4IZ8 A;  1K83 H;  4LUZ A;  4XIG S;  5BN3 A;  1KQS A;  3PO3 H;  1KLU D;  1T5X D;  2WB1 E;  5BR8 Q;  3C46 A;  4JI5 L;  1O7Z A;  3E6Z X;  5IGG A;  2N55 A;  4KY7 A;  3PF4 A;  4DAV A;  4DR4 Q;  2A74 C;  3HKS A;  1EU3 A;  3TP8 A;  4HJ9 A;  4BY1 H;  1K73 C;  1KC8 C;  3EIV A;  2WAQ B;  4RCO A;  5ELE A;  3CCV A;  4A3G H;  2UUA Q;  1F2L A;  3CCE A;  2F0P A;  4OL7 A;  4ZAI A;  2ATW A;  4FNF A;  3H15 A;  4BA1 I;  2KED A;  4LMQ D;  1P8L A;  2E2D C;  4A3K B;  4XTC S;  4GKJ L;  1NAP A;  1IYV A;  1MBY A;  1KRS A;  2D62 A;  1WVL A;  4L5R C;  1IHZ A;  1TY2 A;  5IWA Q;  3JAM E;  5IT9 c;  5M3F B;  2EY2 A;  4A3B G;  5I9O A;  4JBW A;  4KHV A;  1LTT D;  1A2T A;  1TWH H;  1QWY A;  3GV6 A;  1Q86 C;  3W3A A;  4MN3 A;  1HZ9 A;  1PH3 A;  1HFG A;  2K28 A;  5FLM G;  2N49 A;  1WYD A;  4PV1 C;  1J5E L;  1U4L A;  2I46 A;  3HS0 C;  3KF8 A;  3MVV A;  4XXE A;  3H3V H;  4DK1 A;  4OEL B;  1N34 Q;  3A0J A;  4GN4 B;  2JA5 B;  2IWH A;  1MJC A;  1VQH A;  3T56 B;  2B8F A;  1J9O A;  2F3I A;  3ERS X;  3OTO L;  3UDG A;  2YYZ A;  4A3D H;  3QWN A;  3OWF A;  2R93 G;  1XMO Q;  1R9T H;  2RF4 A;  3TP5 A;  3HFZ B;  1PFS A;  1NY4 A;  2ZXP A;  2OEO A;  4QIW E;  4P73 A;  2F0W A;  1CA5 A;  2R6G A;  3K7A H;  3FPU B;  3CPF A;  2FHT A;  3M3Y H;  2VL6 A;  4B08 A;  2K75 A;  3A8K E;  1S72 A;  2B2V A;  5IP7 H;  3RZD H;  3FKI B;  1ESF A;  4R8N A;  1HUN A;  2MQH A;  3RD4 A;  4KHZ A;  3RMH A;  2B63 H;  2K5H A;  2SNM A;  1VQB A;  1WJJ A;  2G9H D;  2EIF A;  4H0L C;  1OXX K;  2PQA B;  3VYT A;  1EFI D; 
#chains in the Genus database with same CATH homology
 3J80 c;  3M4P A;  1EIY B;  4R4O A;  4QY7 A;  1Y1V G;  2UUB Q;  4QJF A;  4H02 A;  4NPS A;  1U5K A;  3I4M H;  4C2M H;  1U0L A;  1Q7Y C;  4IJH A;  4OO1 G;  4KHP Q;  1S40 A;  1JJG A;  2YTX A;  3KFU A;  5IYC G;  3GTG H;  4A3J H;  2HIX A;  3STB C;  4A4I A;  1M1K C;  4DR7 Q;  1KAW A;  2IY5 B;  2PI2 E;  4DK3 C;  2R92 H;  1HJP A;  2ASB A;  1N32 Q;  4A3M H;  1ASZ A;  3HKZ G;  1ASY A;  4UP8 A;  4FDB A;  4DUY L;  1IZ6 A;  1E1O A;  2PNH A;  4GLV B;  1Q46 A;  3HOV H;  3KYH C;  1RIP A;  3T1H Q;  5DLQ E;  1VQ5 A;  2HHH L;  1A63 A;  1H95 A;  1N9W A;  2E8G A;  2RCN A;  3J81 c;  3GTJ H;  3T1Y L;  3UDF A;  3GTQ H;  4NXM L;  1CSQ A;  1T9H A;  1TWA H;  3PF5 A;  2KBN A;  4DNI A;  1Z9F A;  3PUX A;  1J5E Q;  1IBK L;  3M85 A;  1I6H H;  1X3E A;  4MTN A;  1HNW L;  4A3F H;  4A3D G;  5IP9 G;  3H0G G;  4DR6 Q;  2NZO A;  4BBS H;  4BXX G;  2AHO B;  1Q12 A;  4C3J H;  2HT1 A;  4C3H H;  3OTO Q;  3RLF A;  1VQ4 A;  2JA7 H;  4A3C H;  1FJG L;  2QEX A;  2CWP A;  2WFW A;  2Q2U A;  2D0O A;  4PZ6 A;  1QZG A;  2ZTE A;  4DUZ Q;  4LFB L;  4JI8 L;  4X62 L;  3CD6 A;  3KLW A;  2VQF L;  2UUC Q;  4JI3 Q;  4DV7 Q;  3L0O A;  3GO5 A;  5JJK A;  5M3F H;  3I4N H;  3STB D;  2F4V Q;  3S2D H;  4JI4 L;  5IP7 G;  1VQ8 A;  4JCV E;  1X3F A;  5C3E H;  3CCJ A;  1NE3 A;  3PUZ A;  4GKK Q;  4X6A H;  4R1J A;  1RL2 A;  1UE7 A;  3TRZ A;  1E3P A;  4P75 A;  1O7I A;  5J3B A;  4JOI C;  4LFC Q;  2MFI A;  3UE0 A;  4A3L H;  1SRO A;  1Y1V H;  1N36 Q;  3A74 A;  2VW9 A;  1JJ2 A;  2B63 G;  3CC2 A;  2VY3 A;  1NBW A;  4DV6 L;  4LUO A;  1G51 A;  1NMG A;  3E0E A;  2VQE L;  1UEB A;  3CCL A;  5LMN L;  4A3E H;  4X64 Q;  1PVO A;  2E5L L;  1Z47 A;  3HOU H;  2NN6 G;  2BA1 A;  3FP9 A;  2UU9 Q;  1FVI A;  4LF5 L;  4L5T A;  4HJ5 A;  3I4M G;  1OXU A;  5C0X I;  2JA6 H;  4ALP A;  5C4X G;  1VQP A;  1HZB A;  2UXB Q;  3M7N A;  1N33 L;  1HNZ Q;  4AQY L;  3MEF A;  1G6P A;  4R4Q A;  1X9N A;  2AKW B;  3KOJ A;  4HJ7 A;  1FL0 A;  1VCI A;  3AQQ A;  1GD7 A;  2NZH A;  5IYB H;  2VNU D;  4A3M G;  3J7A 5;  3TS2 A;  4DV1 Q;  1IBM L;  1HZA A;  1QUQ A;  3AFP A;  5IP9 H;  4HJ8 A;  3H0G H;  4OX9 L;  3GTO H;  4R4I A;  3CCQ A;  2LXJ A;  3HOV G;  1I50 H;  2UXC L;  2K52 A;  2LXK A;  3F2D A;  3M4O H;  5C0X J;  2Z0S A;  4A3L G;  4OO1 I;  2B3G A;  3NEM A;  4DUY Q;  4B3R L;  2E2I H;  1OXS C;  2ID0 A;  2HHH Q;  4JG2 A;  1PH1 A;  4A3F G;  1W3S A;  5GAG C;  4NXM Q;  5IY0 A;  2JEB I;  1IYJ B;  2CQO A;  3JC6 6;  3HOX H;  3RN5 A;  1IBK Q;  1QUQ B;  4X66 L;  4DAY B;  1VQ7 A;  4JI6 L;  4LF8 L;  2R7Z H;  4BBS G;  4A93 G;  1HNW Q;  2JA7 G;  1YHB A;  3H3V I;  4A3C G;  3PIO A;  4JI1 L;  1X6O A;  1BVS A;  1WFQ A;  5IE8 A;  2GVB A;  1PH2 A;  1TWC H;  3G48 A;  2JK8 A;  1E1T A;  2WB1 G;  1XPO A;  2ZJQ A;  3CQZ H;  1QVF A;  1HR0 Q;  1UWV A;  5AJ3 L;  1FJG Q;  5GAE C;  4JYA Q;  4O2D A;  1PH9 A;  4DK6 C;  2JJQ A;  3CPW A;  4LFB Q;  4LFA L;  5M3F G;  4OON A;  4LUV A;  4OWW B;  1G29 1;  1L0W A;  4DR3 L;  3I4N G;  2XGT A;  3ULL A;  3A5U A;  4JI8 Q;  1YJ9 A;  1PH8 A;  4X62 Q;  5C3E G;  3J81 i;  2VQF Q;  4IOA A;  2K4K A;  4KLK A;  1L2F A;  1HNX L;  4IFD G;  1E22 A;  1VQF A;  3CXC A;  3A5Z B;  1GM5 A;  4JI4 Q;  3PIP A;  4NB3 A;  4YWM A;  4AYB G;  2OTJ A;  4X65 L;  3ER0 A;  3I55 A;  2YU9 H;  4GLX A;  1Q1B A;  2CKZ B;  5C4X H;  3D31 A;  4AH6 A;  1E24 A;  4YCV A;  1I94 L;  1AE3 A;  4NXN L;  3ICE A;  4A3E G;  2ZJR A;  3BU2 A;  4DV6 Q;  1X3G A;  3W5O A;  4IOC A;  2CWA A;  5ELO A;  2HQL A;  4GN3 B;  3S1M H;  2YV5 A;  3PGZ A;  3CCS A;  1XNR L;  2A8V A;  3HOU G;  2JA5 G;  1PH5 A;  2YTV A;  2VQE Q;  2NVQ H;  5LMN Q;  4APV A;  1A62 A;  1HR0 W;  4DV4 L;  3PO2 H;  1JE5 A;  1YHQ A;  3DM3 A;  2JA6 G;  2E5L Q;  4JOI A;  3D0F A;  1BBW A;  1WCM H;  4UP9 A;  1KHI A;  4YY3 L;  1J6Q A;  4YHH Q;  1Y14 B;  2RHQ B;  2Q2T A;  4LF5 Q;  3KF6 A;  5LMU L;  2JA9 A;  2KCT A;  1SE8 A;  3MXN B;  4PZ8 A;  5IYB G;  1JB7 A;  1N33 Q;  4LF6 L;  4AQY Q;  3CC4 A;  4LF4 L;  3GTL H;  3K81 C;  2Y0S E;  1QZH A;  1K0R A;  1VQ6 A;  3S15 H;  4A93 H;  4RMF A;  2Z6K C;  5M3M G;  4A3K H;  1OTC A;  1L1O C;  4DR2 L;  1YJW A;  4A76 A;  4OX9 Q;  4RG1 A;  4B3S L;  3CAM A;  1S3O A;  5JEA G;  2QGQ A;  5ELN A;  4GLA C;  5M5W H;  1CKN A;  3WWV A;  1MJE A;  2UXC Q;  2L15 A;  3KF6 B;  2OWO A;  1CKO A;  5GAD C;  1KXL A;  1LYL A;  4DV3 L;  5EAY A;  4GOP C;  1PH6 A;  4B3R Q;  2GN5 A;  4GN5 A;  3NEN A;  3HOX G;  2UXD L;  2K14 A;  1VQA A;  3FKI G;  3B6Y A;  4TVA B;  4OWX B;  4K0K L;  2D0P A;  3W1G A;  3U58 A;  1BBU A;  2YTY A;  1XPU A;  3HOY H;  4GNX C;  1XTD A;  4DR1 L;  4LF8 Q;  4P71 A;  2EQS A;  1OXT A;  4JI0 L;  4UY8 C;  3DLL A;  4LF7 L;  4POG A;  1CKN B;  1UE1 A;  2F52 A;  3F1Z A;  4A75 A;  4IPD A;  2GVA A;  1KRT A;  4JI1 Q;  1N8R C;  4LF9 L;  4AIM A;  2BH2 A;  4QGU A;  2XTI A;  3CME A;  1EYG A;  3KDF A;  1Q8K A;  4JI7 Q;  3W1B A;  3UDX A;  3FHW A;  5AJ3 Q;  4DR5 L;  4O0A A;  3HKZ E;  4UPA A;  3CCR A;  1KIX A;  2BA0 A;  1YEZ A;  2IHE A;  4LFA Q;  1CSP A;  1VQL A;  3I56 A;  4PZ7 A;  3BZC A;  3K80 C;  4DR3 Q;  1KD1 C;  3CC7 A;  1VQD A;  4UP7 A;  4Y7N H;  3CF5 A;  2JA5 H;  1EUJ A;  3S1N H;  2JEA I;  4GS3 A;  1Q81 C;  2K50 A;  3KJO A;  1JJC B;  2ZTC A;  5M5Y H;  1K8G A;  3I2Z A;  1VQE A;  1HNX Q;  4QQB X;  1D7Q A;  3F8T A;  3HOZ G;  2A1A A;  2JE6 I;  3KDF B;  5GRO A;  1Y1W H;  3PCO B;  2EXD A;  4R4C A;  5C4J H;  1B70 B;  4X65 Q;  4C3I H;  4DV0 L;  3RZO H;  4DR7 L;  3AEV A;  1XMQ L;  3PUY A;  1N32 L;  5BR8 L;  1I94 Q;  1SFO H;  3JAM c;  1EWI A;  3SGI A;  3PO2 G;  5M3M H;  2IX1 A;  2ALY B;  1GKH A;  2BH8 A;  2WAQ G;  4TQU S;  1WCM G;  1XNR Q;  4BBR G;  1V1Q A;  3G4S A;  2VUM G;  1AH9 A;  3S1R H;  4DR4 L;  2VS1 A;  4MNO A;  3TRE A;  4DV4 Q;  2IX0 A;  1SLJ A;  4HIO A;  4R4T A;  2UUA L;  3T1Y Q;  1VQG A;  1I5F A;  5LMU Q;  4JI2 L;  3FKI H;  3PO3 G;  2I0Q A;  4A3K G;  5M5X H;  1HZC A;  3GTK H;  3I7F A;  5FJ8 G;  2MNA A;  3G6E A;  1LUZ A;  4LF4 Q;  4DAM A;  1YIT A;  4B3T L;  5JJI A;  4QL5 A;  1SRU A;  4LWC A;  2CCZ A;  4WJ4 A;  3OW2 A;  3G71 A;  4JBK A;  3J81 j;  4DR2 Q;  1QVG A;  4B3S Q;  3AFQ A;  3S1Q H;  3S16 H;  2R7F A;  3IRB A;  4BY1 G;  5GAH C;  2JA8 G;  1W2B A;  4P72 A;  1K3R A;  1EFW A;  4DV3 Q;  3S14 H;  2K5N A;  2N8N A;  3HOY G;  2UXD Q;  3HOW H;  5IWA L;  4JC0 A;  3RLO A;  4K0K Q;  1EQR A;  2Z6K A;  1BKB A;  1Q1E A;  3U4Z A;  1L1O A;  3RNU A;  3F2C A;  1KL9 A;  1EQQ A;  2R7Z G;  4JBM A;  2JQO A;  2ES2 A;  2KHI A;  1YJN A;  2FXQ A;  3PSI A;  1X65 A;  2NVY H;  4DR1 Q;  4JI0 Q;  2N78 A;  1WOC A;  4DKA C;  4LF7 Q;  1IL2 A;  1X56 A;  3AYH B;  4DV2 L;  3HOZ H;  1VQ9 A;  4GOP A;  4A3B H;  2NVT H;  5C0X G;  4IPC A;  2VZA A;  2KHJ A;  3NBH B;  5HGQ A;  3E9I A;  3EBE A;  1YI2 A;  1PA6 A;  4X64 L;  3CW2 C;  1GO3 E;  3ZJY C;  3CCM A;  4DR5 Q;  1QVC A;  1VQC A;  1L1O B;  3F2B A;  4GNX A;  3PUW A;  1V43 A;  5E7N A;  5C44 G;  4ME3 A;  3LGJ A;  3RR5 A;  3GD7 A;  3VDY A;  2UU9 L;  5IYD H;  5FLX c;  2PMZ E;  4JV5 L;  1N34 L;  2UXB L;  4A3I H;  1Y1W G;  3Q8D A;  4BBR H;  5H1S E;  5FLM H;  1HNZ L;  2VUM H;  1LM0 A;  1VQO A;  1UE5 A;  1D8L A;  4DPG A;  3L2P A;  4GOP B;  1NJI C;  2AMC B;  1IBL L;  3ULP A;  1YIJ A;  3M4Q A;  4DV1 L;  3TEH B;  1XMO L;  4L5Q A;  4DV0 Q;  4OXP A;  2NN6 I;  1K83 H;  4LUZ A;  4XIG S;  4GNX B;  1KQS A;  1VQN A;  3PO3 H;  1XMQ Q;  1UE6 A;  2WB1 E;  5BR8 Q;  4JI5 L;  5FJ8 H;  1IBM Q;  1XPR A;  4YCW A;  2R93 H;  2MO1 A;  1VQJ A;  2V1C C;  2RHS B;  2E2H H;  4JBJ A;  4YCU A;  3L7Z C;  1CUK A;  3PF4 A;  3M9B A;  3U4V A;  1OXV A;  2ZTD A;  1B8A A;  4DR4 Q;  3HKS A;  4HJ9 A;  4BY1 H;  2JA8 H;  1YZ6 A;  1K73 C;  3EIV A;  3CCV A;  1KC8 C;  4A3G H;  4P74 A;  5LMN W;  2UUA Q;  4B3M L;  2IT1 A;  2PI2 A;  3J7Z C;  3CCE A;  1E7Z A;  3PUV A;  4JI2 Q;  4AYB E;  4X66 Q;  3CCU A;  4JI6 Q;  2ATW A;  2R7D A;  3H15 A;  1K8A C;  4BA1 I;  1HR0 L;  2NVX H;  1TWG H;  2MO0 A;  3ULJ A;  4B3T Q;  4LNQ A;  5K36 G;  3JAM i;  1XNQ L;  1A8V A;  1P8L A;  3I4O A;  4JYA L;  3TS0 A;  3NEL A;  3K0X A;  4GKJ L;  4XTC S;  3U50 C;  1YBY A;  1X54 A;  1WI5 A;  3TQY A;  1PV4 A;  4DV5 L;  1IXR A;  2ZM6 L;  4BY7 H;  1M90 C;  2OTL A;  3HOW G;  1KRS A;  2D62 A;  4YWL A;  2HIV A;  1YHA A;  1YVC A;  1SMX A;  5GQO A;  4HID A;  4L5R C;  1PYB A;  1V9P A;  1YNX A;  2CFM A;  2DUD A;  3KJP A;  2UUB L;  4BA2 I;  5C44 H;  4IJL A;  1C7Y A;  5IWA Q;  5IT9 c;  1TXY A;  2Q2I A;  1LTL A;  3S17 H;  2B29 A;  2H5X A;  2IHF A;  4KHP L;  4A3B G;  1GVP A;  2A19 A;  2OQK A;  3E9H A;  1EOV A;  4HIM A;  4JBW A;  1TWH H;  3S2H H;  2N3S A;  2C35 B;  4YWK A;  3CMA A;  4DV2 Q;  4IFD I;  1Q86 C;  4PG3 A;  1Q82 C;  1XJV A;  4NXN Q;  1HZ9 A;  5IYC H;  1EIF A;  2LSS A;  1C9O A;  1PH3 A;  1K9M C;  2OQ0 A;  5IYD G;  3T1H L;  2KCM A;  4IO9 A;  4A3I G;  5HY6 A;  3GTP H;  4MZ9 A;  5FLM G;  1VQM A;  2N49 A;  4YHH L;  1WYD A;  2DGY A;  3K8A A;  1J5E L;  1VS0 A;  4POF A;  2E2J H;  3RLN A;  4OWT B;  3H3V H;  3OYY A;  4JV5 Q;  1N34 Q;  1HH2 P;  3A0J A;  4GN4 B;  1MIU A;  4YY3 Q;  4KI0 A;  4A3J G;  4DR6 L;  1MJC A;  1VQH A;  4IFD J;  4Y52 H;  2R92 G;  1B7Y B;  1IBL Q;  1JT8 A;  1NMF A;  2F3I A;  3GDE A;  4L5S A;  3ERS X;  3OTO L;  3UDG A;  2YYZ A;  1CKM A;  3BZK A;  4LF6 Q;  4A3D H;  2Q2H A;  3GTM H;  2R93 G;  1XMO Q;  2I5M X;  1MKH A;  1R9T H;  4BXX H;  1C0A A;  2WP8 J;  2ZJP A;  4DUZ L;  2RF4 A;  4HJA A;  3HFZ B;  4JI5 Q;  3KF8 B;  1PFS A;  4IPG A;  1SR3 A;  1NY4 A;  3K7U C;  4EX5 A;  2UUC L;  4JI3 L;  4QIW E;  3EN2 A;  4P73 A;  4DV7 L;  2AWO A;  1VQI A;  3J80 i;  2R6G A;  3UE1 A;  4A3G G;  5JJL A;  2F4V L;  4WJ3 M;  1PHJ A;  3PV0 A;  3K7A H;  3CPF A;  3M3Y H;  4B3M Q;  4IPH A;  2VL6 A;  3UDI A;  4GKK L;  1VQK A;  1JMC A;  2K5V A;  1FGU A;  2K75 A;  2I5H A;  1I3Q H;  4LFC L;  1S72 A;  2KEN A;  1AE2 A;  1PH4 A;  2PQA A;  1TWF H;  4PMW A;  5IP7 H;  1N36 L;  2Y0S G;  3RZD H;  1X55 A;  1PYS B;  3CP0 A;  2MQH A;  2QA4 A;  3RN2 A;  1NTG A;  4JI7 L;  4KHZ A;  4LF9 Q;  1XNQ Q;  4BY7 G;  1DGS A;  2B63 H;  3BJU A;  1A0I A;  1P16 A;  4GKJ Q;  1SN8 A;  2I5L X;  2K5H A;  1VQB A;  4EQ5 A;  2WAQ E;  2OCE A;  4J15 A;  1WJJ A;  4HIK A;  4DV5 Q;  2EIF A;  2AWN A;  3S24 A;  5JEA J;  2ZM6 Q;  1OXX K;  2PQA B;  4LW1 A;  1PH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...