4X64L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64L00
4YHHQ 3E0EA 5JEAG 4DR6L 4YWKA 4X64Q 1IBLQ 1XMOL 3TS2A 1M1KC 1YEZA 3G71A 2JA8H 1HR0Q 2OCEA 3B6YA 1EQQA 4R4OA 3RLOA 4OWWB 4DUYL 3M7NA 1JJ2A 4R1JA 4WJ3M 1A63A 1MJEA 2Q2IA 2LXKA 3K0XA 1KQSA 1IZ6A 3I7FA 4P75A 2BH8A 3HKZE 5LMNL 1KAWA 3GD7A 4RMFA 1PH1A 1OXTA 3BJUA 1X56A 5IYCG 3PO3H 5IY0A 2UXBQ 3U50C 2JA9A 2B3GA 3GTJH 2CQOA 3T1YQ 3LGJA 4DAYB 4JI1L 3PF5A 2K75A 1UE5A 2KHJA 4DK3C 1IXRA 2V1CC 3UDFA 4X66Q 3F2BA 3CCEA 3S2DH 4BA2I 2ES2A 4L5QA 4C3JH 1YHAA 5AJ3L 3CCMA 2LXJA 4A93G 4IPDA 4MTNA 4A3LH 2VQEL 2E2JH 3MXNB 1TXYA 1PH5A 1IBKQ 1YHBA 3CP0A 1GD7A 4AYBG 5M5WH 3PUXA 3I56A 4JI4L 1K8GA 4X65L 2IX0A 5M3FG 2VUMG 3A0JA 3PO2G 1HZAA 3A74A 1VQEA 1VQFA 2RHSB 4R4IA 4QL5A 4AH6A 4QGUA 4DR5Q 2VS1A 1VQOA 1PH8A 2WB1E 1HZCA 4GOPC 2F52A 3CMAA 1I6HH 4HIDA 1VQPA 4JI5Q 2UUAL 3HFZB 1L1OB 3S24A 3PIOA 4NXMQ 2NVQH 4H02A 4A3FG 1I5FA 3DM3A 1PVOA 2PI2A 3KF8B 4DV5L 4DAMA 2JA7G 4X62L 3FKIG 5GQOA 4BBRH 1OXVA 1QVCA 4A3JG 4IJHA 4DR7Q 2AWNA 4A3BH 1EIFA 4XTCS 3I4NH 3PV0A 4IJLA 1PYSB 1WFQA 2NZHA 2Z0SA 1FGUA 2VY3A 4YHHL 4DV1Q 3K80C 3CCSA 2UUBQ 4JBKA 3CCVA 1AH9A 2JE6I 4LFBQ 2PNHA 4X64L 1IBLL 2QGQA 2IHFA 2RCNA 2Z6KC 5IP9G 1HR0L 1OTCA 2HHHQ 3HOUG 1NBWA 1Q1EA 2YTVA 3Q8DA 1KRTA 1KL9A 3S16H 4JI0Q 4DV4Q 2JA5G 3HOYG 1GVPA 4JOIA 4LF4Q 1Y14B 3G4SA 2VUMH 3F1ZA 1QVGA 5M3FH 3HOVG 2WAQG 1SMXA 3U4ZA 2JQOA 3CD6A 1SE8A 3HOWG 3OYYA 2UXBL 3AYHB 3T1YL 1N33Q 3F2CA 4LUZA 1YITA 2H5XA 1SLJA 1M90C 4BY1H 2K50A 2YV5A 4LUOA 4OWTB 4X66L 1E22A 1Y1VH 1QUQB 3RR5A 1X3FA 4A76A 1YJWA 3CPWA 2MFIA 1I3QH 2OQKA 1VQAA 2Q2TA 2OWOA 2JA8G 4A3GG 1TWGH 2ZJPA 4A3CH 3JC66 4B3RQ 5C0XG 3E9IA 5C4JH 3EN2A 1S72A 1V1QA 5JJLA 1LM0A 4HJ5A 4A3JH 1IBKL 3S1RH 5IYDH 4PG3A 4DV7Q 3I2ZA 4NXNL 4B3TQ 1O7IA 2YTYA 1DGSA 4O0AA 3OTOQ 3J81i 3PCOB 5HGQA 4DR5L 1N8RC 1GM5A 4IFDI 1E3PA 3KDFA 1EQRA 2B63H 4B3SQ 2JEAI 4JI5L 3HOUH 2JA7H 3PO3G 5C4XG 2CCZA 2R7DA 5M3MH 4NXML 4QY7A 2YU9H 3KF6B 1CKNA 2E5LQ 4BXXH 3GTLH 1N32Q 3NENA 1H95A 2N78A 4DV2Q 4DK6C 3PIPA 3NBHB 3IRBA 2JK8A 3CCUA 4LNQA 2GVBA 2B29A 1CSQA 4LFCQ 1UEBA 4LF6Q 4DR7L 3T1HL 1XPRA 1JE5A 4YCVA 3DLLA 4KHZA 1YI2A 1L1OC 1R9TH 4DV1L 4HIKA 3FHWA 3CW2C 2UUBL 1VQHA 1Q82C 1YIJA 5FLMH 1X9NA 3ICEA 3H3VH 5LMNW 4IOAA 3NELA 3TREA 2ZJQA 4JBJA 1WOCA 3RN2A 4A3GH 5IP7H 1RIPA 2ZTDA 3TQYA 1G6PA 3WWVA 1C0AA 5FJ8H 4DV4L 4DV0Q 4LF4L 4MNOA 3BZKA 2K5VA 3GTKH 4PZ6A 1KC8C 3CMEA 1SFOH 1S3OA 2VQFQ 3U4VA 1SRUA 3UDGA 3KFUA 4WJ4A 2XTIA 4KHPQ 4BBRG 1IBML 4LW1A 4DR2Q 1K9MC 1Q1BA 2WAQE 4A3BG 4ALPA 4LFAQ 4GOPA 2Q2UA 1YHQA 3I4NG 5C4XH 5IYDG 1QZHA 4IO9A 4DPGA 3RLFA 3ULLA 1YVCA 4A4IA 2JEBI 1Q46A 3BU2A 1XMQQ 1PH2A 3HKSA 3GO5A 3CCQA 2NVTH 4B3RL 4DR1Q 1E24A 2IT1A 2D0OA 4TQUS 1KD1C 1SN8A 5DLQE 4A3IH 5JEAJ 3NEMA 5FLXc 3CCLA 4JBWA 4QQBX 4DV7L 4IPCA 4P72A 4IPHA 5BR8Q 2K4KA 1NY4A 4B3TL 1PH9A 1YJ9A 1K83H 3OTOL 1HNZQ 3L0OA 2A19A 1K8AC 1OXSC 3AQQA 4B3SL 4L5SA 2NVYH 2Z6KA 2D62A 1VQGA 2EIFA 4P71A 5IT9c 2ATWA 5EAYA 3RNUA 3S17H 3PSIA 4HJ7A 1I94L 2Y0SE 1I50H 3AFQA 1EYGA 4C3IH 5GAHC 2E5LL 1N32L 4C2MH 3K8AA 4BY1G 1E7ZA 4Y7NH 1CUKA 4DUZQ 4DV2L 1Y1VG 4A3KH 1NJIC 1E1TA 4GLAC 4LUVA 1HR0W 1JMCA 3J81c 2NVXH 1MIUA 4A3CG 3PUWA 1TWAH 1A8VA 4LFCL 4FDBA 5ELNA 4LF6L 1S40A 1JJGA 4KI0A 1HZ9A 5E7NA 1J6QA 1W3SA 4EX5A 3PGZA 4GNXB 3RZOH 5IWAQ 3F2DA 1GO3E 3KOJA 3W1BA 1NE3A 2PQAB 1X3GA 4UP8A 3S1QH 5C3EH 2VW9A 3CC7A 1VQ4A 2UXCQ 1B8AA 3M4PA 1WYDA 1BVSA 3H0GH 3M3YH 2YTXA 4OX9Q 3I4OA 4JI8Q 2B63G 4HJAA 4JCVE 2DGYA 4BY7G 4NPSA 2JA6G 4X6AH 3STBC 5M3MG 4DV0L 4APVA 1JT8A 1V43A 4GLVB 4BXXG 2WFWA 2CFMA 5GAGC 3CF5A 3RLNA 1J5EQ 2VQFL 4IOCA 1K3RA 2A8VA 3JAMi 1PA6A 2KCMA 4KHPL 4IFDJ 1G291 3J7ZC 2ZJRA 4DR2L 4LFAL 1RL2A 2HT1A 1VQDA 1EFWA 4HJ9A 3D31A 3KJPA 5LMUQ 1QZGA 3S14H 2R7FA 4GS3A 2R92H 5JJIA 5FLMG 1VQIA 1X54A 4HJ8A 1XMQL 4JI3Q 4JI7Q 4JI6Q 2VNUD 4DR1L 1XTDA 3F8TA 3CQZH 4JV5Q 5IP7G 3GTPH 3J7A5 2PMZE 1PFSA 2C35B 5M5YH 2RHQB 5FJ8G 1VQMA 2RF4A 1HJPA 1PH6A 3J80i 1UWVA 3GTMH 5BR8L 4UP7A 2ZTEA 3FP9A 3K7AH 4DUYQ 1L1OA 3UE0A 3TS0A 2E8GA 2K5HA 1HNZL 2NZOA 3EBEA 2ASBA 1HH2P 1NMGA 2R7ZG 3AEVA 2F4VQ 2CWAA 2UUCQ 2Y0SG 4P73A 4BY7H 4A3DH 1UE1A 2R93H 2JA6H 2ZM6Q 1VQCA 2FXQA 1ASZA 4DUZL 1TWCH 3AFPA 4JI0L 3M9BA 1V9PA 4ME3A 1N33L 4Y52H 5IE8A 2N49A 2EQSA 2HIVA 1VQ5A 4L5RC 3PUYA 1FVIA 4DR3Q 1C7YA 3HOZG 1U5KA 1Q81C 4LF8Q 2F3IA 5IWAL 4A3IG 2HIXA 1X55A 3GTQH 4GKJQ 4UY8C 3GDEA 5K36G 1Z9FA 1IL2A 3K7UC 3S1NH 2UXCL 2VL6A 1YBYA 3K81C 4BBSH 1LUZA 4LFBL 1VQLA 1BBUA 4YWMA 5IYBH 3H15A 4OX9L 1Z47A 4JI8L 2HHHL 5HY6A 4A3MH 4KLKA 4GKKQ 4K0KQ 3J81j 4GNXC 3CPFA 1VQ7A 1EOVA 2MQHA 2QEXA 1CKOA 4LF7Q 4A3KG 4A3EH 3UE1A 3GTGH 5ELOA 3A5UA 3S1MH 1SR3A 5GADC 4J15A 3PF4A 3HOXH 2IX1A 1P16A 1Q8KA 1QUQA 2N3SA 4XIGS 4C3HH 3STBD 1XPOA 2AWOA 4OO1I 2OQ0A 2UXDQ 2K5NA 1L2FA 2R7ZH 5LMUL 1Q7YC 5C0XI 5C3EG 4YWLA 4B3MQ 4LF9Q 4JI7L 4JI3L 2L15A 2UU9Q 4JI6L 1W2BA 2E2HH 1N34Q 3I4MH 1UE7A 3E9HA 3H0GG 3JAMc 4JV5L 4DNIA 2QA4A 1G51A 4LF5Q 4GN4B 1FJGQ 1XNQQ 1VQKA 3HOZH 2NN6I 3I55A 1A0IA 2AKWB 1PV4A 4R4TA 2WP8J 1PH4A 2I5LX 3KYHC 1KHIA 4AQYQ 3TEHB 3CXCA 3PUZA 3CCRA 3KF6A 3BZCA 1WCMG 2MO1A 1CSPA 3G48A 3RN5A 1N36Q 4MZ9A 3M4QA 3ZJYC 1EIYB 2IY5B 2F4VL 4POFA 1N9WA 3ULJA 2MNAA 1XJVA 3U58A 2UUCL 1EUJA 4AIMA 4OO1G 1X65A 2A1AA 3J80c 2ZM6L 1MJCA 4IPGA 2K14A 1YNXA 2HQLA 3L7ZC 4R4QA 3RZDH 1Y1WH 1BBWA 4O2DA 2R92G 1HNXQ 1KXLA 4DKAC 1PYBA 4JI2Q 5GROA 1PHJA 2I0QA 4JYAQ 5C44H 4DR3L 3M4OH 5JJKA 4LF8L 4DR4Q 1NTGA 1VQ6A 2I5HA 2YYZA 4A3LG 4GKJL 4DV6Q 3CCJA 2K52A 2OTLA 1U0LA 5J3BA 1YZ6A 1Q86C 4YY3Q 2BH2A 1VS0A 4PZ8A 4NXNQ 4UPAA 2OTJA 1XNRQ 3TRZA 2BA1A 3ULPA 2BA0A 1HZBA 1B70B 3W5OA 4DV3Q 4POGA 4GKKL 4K0KL 1T9HA 5M5XH 1YJNA 2GVAA 4R4CA 4A3DG 2KHIA 4LF7L 4IFDG 1TWHH 3CC4A 3SGIA 3S2HH 1LYLA 3VDYA 4YCWA 1AE2A 1WCMH 3KJOA 3OW2A 2KBNA 3KDFB 4JC0A 1B7YB 2GN5A 3G6EA 5H1SE 1VQ8A 2AMCB 2PI2E 3ER0A 2E2IH 2UXDL 4PMWA 1OXXK 2D0PA 3CAMA 4EQ5A 5IYCH 1CKNB 1L0WA 1WI5A 4B3ML 4LF9L 1KIXA 3T1HQ 4BBSG 1P8LA 1HNWQ 2UU9L 1N34L 2R93G 2CWPA 2Q2HA 5IYBG 4DR6Q 1Q12A 1FJGL 1IYJB 1XMOQ 3W1GA 1XNQL 4A3MG 4BA1I 1LTLA 4A93H 4L5TA 3ERSX 4AQYL 1KRSA 1D7QA 2KCTA 1JJCB 4A3EG 1PH3A 4NB3A 2CKZB 3UDIA 1N36L 3KLWA 3UDXA 1MKHA 3HKZG 3PO2H 3HOXG 1ASYA 1K0RA 2JJQA 4QJFA 4PZ7A 1IBMQ 5LMNQ 1JB7A 3EIVA 2KENA 4LF5L 4A75A 4GNXA 3MEFA 2IHEA 1HNXL 2PQAA 4JI1Q 4A3FH 3GTOH 4JI2L 2ZTCA 1VQNA 1UE6A 1X6OA 1SROA 3L2PA 4OXPA 5GAEC 1QVFA 3I4MG 4JYAL 1D8LA 1VQBA 4DR4L 2EXDA 4HIMA 1GKHA 1A62A 1AE3A 3FKIH 4LWCA 2MO0A 2LSSA 2XGTA 5AJ3Q 4DV6L 4GOPB 1XPUA 4JOIC 4YY3L 1BKBA 1C9OA 2VQEQ 4QIWE 1XNRL 1OXUA 2NN6G 2DUDA 4AYBE 4JI4Q 5C0XJ 1E1OA 4X65Q 2WB1G 4JG2A 1NMFA 2AHOB 4UP9A 2I5MX 5IP9H 3D0FA 4DV3L 1EWIA 1VCIA 3S15H 4JBMA 3M85A 4HIOA 1FL0A 1CKMA 1I94Q 4YCUA 1X3EA 1Y1WG 1K73C 1WJJA 2JA5H 2UUAQ 3HOYH 1VQJA 3A5ZB 1VQ9A 4OONA 1J5EL 3PUVA 5C44G 2ID0A 1TWFH 4GN5A 4P74A 2N8NA 4GN3B 4DV5Q 3HOVH 3H3VI 4X62Q 4RG1A 2VZAA 4TVAB 4GLXA 3HOWH 2R6GA 4OWXB 1PH7A 3CC2A 2ALYB 1HNWL
chains in the Genus database with same CATH superfamily
2IPKD 2EXZA 4OO1H 5JEAG 1IBLQ 1BCPC 2JA8H 1E2VA 3B6YA 1L0YB 5E1FA 1QILA 4OWWB 3M7NA 3NK9A 4OHJA 1EYDA 3K5MA 1HPCA 3OWEB 1D1KA 3I7FA 3VR4A 2BH8A 3GD7A 5M5XB 1DD2A 5IYCG 5IY0A 5JPMC 2JA9A 1PRTC 2CQOA 1F9QA 3TP5A 4DAYB 5FK9C 2KHJA 2V1CC 4X66Q 1EZ6A 1DOMA 4N8X1 5AJ3L 3CCMA 1BF4A 4CDDC 1PH5A 3P20A 4AYBG 3FDTA 5M5WH 2XNAC 2EY6A 3A74A 1VQFA 3LWEA 3H09A 2SEBD 3MVVA 3PIO3 3S16B 3ITPA 5JOBA 2HDLA 1L1OB 3PIOA 2IJ0A 3OW7A 1GUTA 2C9OA 1PVOA 2A6HC 5TSSA 4DAMA 1ILQA 4X62L 2N55A 1AFPA 3EVQA 1QVCA 1V1PB 1PFBA 1EIFA 3QO2A 4XTCS 1QNKA 2Z0SA 4A3FB 4ZKBB 2UUBQ 1Z6HA 3K80C 3CCSA 2PNHA 4LJZC 1IBLL 2F0MA 2KJXA 2F0KA 2RCNA 2F0OA 2Z6KC 3BDOA 5IP9G 1NBWA 3TSSA 3KBXA 2YTVA 1C4QA 3S16H 1HTLD 5FKAC 1H9SA 4MN3A 3F1ZA 2FMCA 3AU7A 3OIQA 1SE8A 4FXDA 3OYYA 3HP3A 1YITA 4OELB 4OO1G 2K50A 2YV5A 4X66L 1Y1VH 4EQPA 1EQTA 1X3FA 4RH6A 1TWFB 4X3TA 3CPWA 4A3GG 2JA8G 1VQAA 2WAQB 4MHEA 2ZJPA 3M7GA 3JC66 2DNEA 3TP6A 5L37A 3VR2A 2L0CA 2LS01 1O7IA 2YTYA 1DGSA 3OTOQ 5IGGA 5EBCA 2NTTA 4GZYC 3A8JE 3WOFA 4B3SQ 3I8ZA 3DXJC 3V96A 1KABA 1B44D 3KF6B 2EPBA 1N32Q 3NENA 1H95A 1LT4D 2JK8A 2GVBA 2B29A 3H6MA 4LFCQ 4LF6Q 3E6ZX 1R9TH 2SDFA 1LTTD 3FHWA 2UUBL 1Q82C 2NVTB 1X9NA 1CHQD 2F0PA 1EFID 1ML0D 4C3JB 5IP7H 1G6PA 3WWVA 5FJ8H 1A3UA 1GUNA 1KC8C 3FPUB 2H4OA 3J81L 1SRUA 5JAVA 1IBML 4DR2Q 1Q1BA 2WAQE 5C4ZA 2CVRA 4Y7NB 1QZHA 3ULLA 1BDOA 4A4IA 1XMQQ 3EQLC 2NVTH 2IT1A 3OIPA 4QUFA 4WJWA 5D14A 2F0WA 1KDAA 4TQUS 3SE0A 3NEMA 4JBWA 4XT3B 3J7AV 4FXGC 2K4KA 3OTOL 3M3YB 2A19A 2F0TA 1K8AC 1OXSC 4B3SL 4L5SA 2D62A 1WTXA 5IT9c 5IT9E 3RNUA 1RF2D 1I94L 1EYGA 5HGTA 4IQZA 4ILWA 1N32L 1WTOA 1ZXTA 1TY0A 4R8NA 4Y7NH 1N33Q 1Y1VG 1E1TA 4LUVA 2QW7A 5CBAE 2RDFA 1MIUA 2NVXH 4PNYA 4LFCL 1TS5A 4RGMA 4LF6L 1JWSD 1JJGA 4KI0A 1J6QA 1W3SA 3F2DA 1GO3E 3T4AC 4KD4A 1X32A 4UP8A 3CC7A 1RDPD 3CQZB 1WYDA 3M3YH 2CH4A 5IOCA 4HJAA 1AZPA 4APVA 1FNUA 1O78A 2CFMA 2F0FA 4LMQD 5GAGC 4E6IA 3CF5A 3RLNA 4K8JA 1J5EQ 1CA6A 1LO5D 2A8VA 1RHPA 2B63B 2KCMA 5ISRA 4DR2L 2JA6B 4UAIA 1EFWA 4CKBA 4HJ9A 2YU9B 1QZGA 3GTLB 2R7FA 1ENCA 1XMQL 4JI6Q 2VNUD 3CQZH 2SNMA 5IP7G 3J7A5 1ONLA 2K5DA 3NPPA 2C35B 3SK6A 5FJ8G 1VQMA 2OTLA 3J80i 1DOLA 1UWVA 4UP7A 5D65A 1QJOA 3UE0A 2E8GA 2K5HA 4A3MB 3EBEA 3AEVA 1LT6D 2DN8A 5LL6S 1UE1A 5I9PA 2JA6H 1SNMA 1ASZA 4IFDH 2O5IC 3AFPA 3HKZB 1N33L 2HIVA 1Y8NB 4B9WA 1NAPA 3PUYA 4DR3Q 1U5KA 1EYAA 1X55A 1EIHA 1Z9FA 2AQ1B 1YBYA 1LUZA 4LFBL 1VQLA 4YWMA 5IYBH 2EDGA 5CYUA 2IX3A 4A3MH 1EQVA 4K2LA 4GNXC 4TRDA 1VQ7A 2MQHA 1NR4A 1SMYC 4JPBW 4A3EH 3UE1A 3GTGH 2F0VA 3CU7A 5C4HA 1Q8KA 1QUQA 3STBD 4OO1I 2L5TA 3CHBD 2K5NA 3HEJA 5J22A 1ICFB 2DY8A 1EU4A 3WDNA 3I70A 4B3MQ 4LF9Q 1CM9A 4ZCKA 4JI6L 3M4OB 1W2BA 3E9HA 3JAMc 3JAME 1G51A 4XYOA 4GN4B 3I55A 1AP0A 4R4TA 2WP8J 4TSSA 2I5LX 1PTOD 2KVMA 1CSPA 1N36Q 1I6VC 5I4DA 3NBHA 1EYCA 2QEJC 2WV6D 4AIMA 4J1MA 5JJLA 3L7ZC 3X3NA 1WCMB 5HURA 2E2IB 3V2TA 3NUCA 1PHJA 2RKSA 2WACA 4HR7B 3MFGA 4DR3L 2CHBD 3M4OH 2EY2A 1V1OA 1VQ6A 1EY7A 1U0LA 2VXWA 2BH2A 4P2CB 3I3CA 2OTJA 1JC7A 1M8AA 2AUJD 2BA0A 4FF3A 5EKIA 3W5OA 4FF2A 1HQRD 1VF7A 4HTHA 2EOTA 1EL0A 4IFDG 1DONA 5CR3A 4CGYB 3SGIA 3PO2B 3S9WA 3C1EA 1LYLA 2EE1A 3DWPA 1WCMH 3KJOA 2KBNA 4JC0A 3G6EA 1VQ8A 2PI2E 3Q0AA 2E2IH 3CAMA 3VR6A 5E3FA 1L0WA 4RAUC 4B3ML 4LF9L 2Q8TA 1EEID 5IYBG 2JA7B 2AQ2B 1IYJB 1XMOQ 4A3MG 1GJXA 4BA1I 1IYUA 1CTMA 2EYFA 4BBSB 2DNCA 4A3EG 1BCPD 2Z1CA 2CKZB 1N36L 3UDXA 3HKZG 5KEEA 3PO2H 1JB7A 2JA5B 4A75A 2B2TC 3MEFA 4WFN3 2IHEA 1STGA 3LX0A 4KKSA 2ZTCA 1VQNA 3HOVB 3BG3A 1D8LA 4HIMA 2JA7H 2MGSA 4K14A 3SEBA 2VQEQ 3GV6A 1B2TA 1I4QA 4QIWE 2A68C 2E2HB 4HAEA 4X65Q 2AHOB 2I5MX 1EWIA 1VCIA 1K73C 5EKLA 3I4LA 3M4YA 2JA5H 2UUAQ 5JPNC 1F2ZA 3SR1A 1VQ9A 2WB1B 3KBGA 2B2YA 3IFDA 3AMUA 3HOVH 1D5XC 4RG1A 3NXWA 4OWXB 3S2DB 1QCBD 3E0EA 1GUSA 2EYJA 4YWKA 3N52A 1XMOL 5A2QL 5CBEE 2L4NA 1SNOA 2OCEA 1EQQA 3RLOA 4DUYL 1JJ2A 5F2DA 2EY5A 1A63A 2MP1A 2LXKA 1KQSA 1O7YA 5ELDA 1OXTA 2UXBQ 3U50C 2B3GA 3SK8A 3VR3A 1BQQT 1LTBD 2NWGA 4L63B 5DNFA 3J80E 1WTWA 4IUNA 2L12A 1UE5A 5FO8B 4QUCA 3UDFA 2MHVA 3S2DH 1HFGA 1SE2A 4IPDA 5CORA 2VQEL 2X6LA 3MXNB 3CRKC 3W2DA 4QF4A 1YHBA 1GD7A 2XRQD 2E75C 4X65L 5M3FG 4X3KA 3PO2G 3A0JA 1HZAA 1KLGD 2L55A 2VS1A 2WB1E 4RFBA 4GOPC 4HIDA 1VQPA 1C48A 1WD1A 3ND9A 2UUAL 5BN5A 4H02A 1I5FA 2P5ZX 2SNSA 2JA7G 1OXVA 1I4PA 4DR7Q 4UHVA 1HQMC 4JW0A 3PV0A 4PV1C 2OT2A 4DV1Q 4JBKA 3CCVA 2JE6I 4WORA 2IHFA 3HOUG 1SNDA 4XQNA 3Q8DA 1KRTA 2JA5G 2XN9C 1GVPA 4EQOA 5CGKA 1EY5A 4MTKA 3EJIA 2J4XA 2EYLA 2K5WA 2BE5D 2RCFA 3S15B 2A6EC 3HOVG 1SNQA 1ZYRC 3U4ZA 3V05A 1RODA 1TQOA 3MXPA 2UXBL 2KHSA 3D6WA 4KN4C 2H5XA 4DNTB 1M90C 1ESRA 3DEPA 2Q2TA 2OWOA 1TKWB 4A3CH 3QG1A 1TWGH 5C4JH 3PMFA 1S72A 5M9OA 1TVXA 2XRSD 3QJYA 4PG3A 4DV7Q 1O7ZA 4NXNL 1H9JA 4DXGA 5CMDA 4A3GB 4O0AA 1N8RC 4IFDI 5HGQA 1GM5A 5FO7B 1EQRA 2D5DA 1A2UA 2Q8IB 2JEAI 4B08A 1DZ1A 4Q5VA 1ZKOA 1AN8A 4DXFA 3PIP3 3K6OA 4QY7A 2E5LQ 2K28A 3PIPA 3IRBA 2O5JC 4DR7L 1FR3A 4N9TA 4YCVA 5AFWA 3SK5A 4KHZA 1JOKA 1L1OC 1STAA 5FLXL 1HRJA 2NTSA 4DV1L 4DN4M 4HIKA 1F2LA 5DAUA 3Q23A 3MXGA 3H3VH 1LABA 3NTHA 1K8OA 4NMZA 1S5DD 1GUGA 1U4PA 2WINB 4JBJA 1WOCA 3Q22A 4A3IB 4CDFC 3RN2A 4A3GH 1RIPA 4IUQA 4FVMA 5M5WB 2HDMA 4MNOA 5D3IB 3MA2B 2K03A 2H1EA 3CMEA 3R2TA 1SFOH 1HHVA 1PTOB 2VQFQ 3UDGA 3HS0C 1CQVA 4KHPQ 2QDLA 3DM1A 1K9MC 4C3IB 1CK1A 5CV8A 4LFAQ 1YHQA 2X69A 2XVSA 5I2XA 3RLFA 1YVCA 1TWAB 2JEBI 1Q46A 2FHTA 2ICIA 2PYKA 2F0UA 1NSNS 3GO5A 4DR1Q 1E24A 1JQYD 1SNPA 4A3IH 5C3WA 5JEAJ 5E4WC 4QQBX 1LTGD 4DV7L 1SYBA 4IPCA 4IPHA 5EPKA 5CV4A 3FEWX 3H0GB 1K83H 2PMZB 2EVBA 1EY6A 3AQQA 3U9SA 2NZ1D 1PTOH 2NVYH 2Z6KA 1VQGA 2EIFA 4ID6A 1SE3A 4CDEC 3MZ5A 1F2MA 2E5LL 3R2IA 2ICEC 3LWUA 4C3IH 5GAHC 3K8AA 4X6AH 1E7ZA 1CUKA 4ULLA 1WTVA 3AB9A 3L9AX 4Z9CB 4A3CG 1TWAH 4FDBA 5ELNA 1B9NA 4EX5A 3SVMA 1SXTA 3KOJA 2CW0C 2F0JA 3W1BA 1NE3A 4U68A 1X3GA 2UXCQ 1Y1VB 5COYA 1B8AA 1ESFA 1VMCA 1KNEA 2A74C 5I6YA 3H0GH 4OX9Q 3GTMB 3I4OA 4JCVE 1ENAA 1V43A 2WFWA 5IODA 2K01A 3K5NA 2SOBA 5EPJA 3R3OA 2VQFL 1K3RA 2J7ZA 1BCPB 3JAMi 2KUMA 4KHPL 4CKCA 1BBXC 1R4QB 1SSOA 4ZKCB 4K5VA 4LFAL 1CHPD 4OIKA 1EIGA 1NR2A 4DAPA 5JJIA 1VQIA 4HJ8A 2K05A 4DR1L 2EJFC 1WD0A 3N6RA 3ZYYX 5EJWA 4JV5Q 3BZDB 1I4HA 2PMZE 5M5YH 2D2CC 3GTMH 1R9TB 1HJPA 1HXYD 5K5PA 2ZTEA 3FP9A 3TS0A 1QE6A 4KKTA 2NZOA 2ASBA 1NMGA 5BN3A 2R7ZG 3KF8A 5KNBA 1STYA 2RBMA 2K04A 2UUCQ 4A3DH 2ZM6Q 1VQCA 2FXQA 3K58A 1V9PA 2N49A 3OHXC 4O1NA 2G9DA 3I73A 1C7YA 3HOZG 1Q81C 3EA6A 1STHA 4Q0FA 4A3IG 4GKJQ 3GDEA 1IL2A 2UXCL 5T1IA 1EZ8A 2AUKA 1BBUA 3C3LA 2Z4IA 4BS9A 4OX9L 3KUPA 1PXUA 4GKKQ 1TIID 3J80L 2QEXA 4C3IG 1IW7C 3NHHA 1YNJD 2QCPX 5ELOA 4HSPA 1Y8OB 2OEOA 1NUCA 3I91A 5GADC 2IX1A 2Q8RE 3SXHA 2F0SA 4XIGS 4C56C 5IGCA 1XPOA 2OQ0A 1JE4A 2ZXOA 5JVG3 1H9KA 4YWLA 5C44B 1FGBD 2NVXB 3LNNA 1JICA 1N34Q 2RQXA 1UE7A 3H0GG 4JV5L 2QA4A 1XNQQ 1VQKA 2NN6I 2AKWB 1HUNA 4KV6A 1KHIA 4KY5A 4AQYQ 3PUZA 3M4QA 3ZJYC 4DAVA 2NB0A 1N9WA 1XJVA 3U58A 4F7XA 1EUJA 4HCEA 2UUCL 2ZM6L 4IPGA 4XT1B 2HQLA 1Y1WH 1BBWA 4RGOS 1H9SB 3TP8A 1KXLA 2QDBA 4DA2A 2BCOA 3T13A 4DFAA 5C44H 4JYAQ 2N88A 5JJKA 4DR4Q 1NTGA 1LACA 2I5HA 2YYZA 4GKJL 3D8GA 3CCJA 4NW2A 4YY3Q 4CJ0B 1UAPA 1KAAA 3SHLA 3TRZA 1T5EA 4DV3Q 4POGA 4GKKL 5EPLA 1D5MC 3OMGA 4A3DG 4R4CA 1UEAB 4FF1A 4MIUA 1AE2A 1YNND 2WIIB 2A69D 1J9OA 3T1HQ 1G8ZD 2B2WC 4RGTA 1N34L 2R93G 1XNQL 2NYZD 2EYPA 2PZUA 1LTLA 4A93H 4L5TA 1JWMD 4AQYL 2XWBB 1KRSA 3VYSA 3HG9A 3UDIA 4X3UA 1ASYA 4ZLTF 4QJFA 4NKLA 1X3PA 4HMIA 3A8IE 3E5SA 4GNXA 1TS4A 4A3EB 3GTGB 3C46A 2PQAA 3NSWA 4JVZA 3GTOH 3NQTA 4JYAL 3L2PA 4DR4L 1GKHA 3MC0B 3FKIH 1XPUA 2LSSA 3VA7A 4JOIC 4YY3L 1BKBA 2F0LA 3FPPA 4J6HA 1C9OA 3T56B 1JWUD 2FJ2A 2DUDA 4JI4Q 5C0XJ 2O4XA 3QWNA 4UP9A 1NMFA 4DV3L 3K5OA 4K8IA 2K1BA 4JBMA 3U9OA 3Q6SA 1QOHA 4YCUA 4K6DA 1Y1WG 3HOYH 1EY9A 2B2VC 1J5EL 3DWQA 3PUVA 5C44G 1KDCA 3D6CA 4P74A 2N8NA 2PNRC 3H3VI 5D3DA 1XYIA 3GTJB 3HOWH 1C8CA 1RCVD 1DXMA 3T1HL 3T16A 3BS1A 4YHHQ 4IUTA 4C1NI 1QG7A 2B8FA 4PQXA 2FFKB 4V0BA 1M1KC 1XWEA 2E2JB 3UI2A 5CV6A 4WJ3M 1MJEA 3TMEA 2Q2IA 2NBFA 1IZ6A 3HKZE 3TZDA 1KAWA 4RMFA 1TS3A 5IGFA 3BJUA 1ENFA 1JR0D 3GTJH 2RVLA 4RHRA 3T1YQ 1F9PA 3LGJA 2K75A 1ZYRD 3QR8A 5JJZA 3CCEA 4BA2I 4BBRB 2ES2A 5A35A 4L5QA 1YHAA 3O13A 2LXJA 4A93G 4IZ8A 2ENBA 4NDXA 2E2JH 4ZYSA 3PUXA 4JI4L 2VUMG 1K8GA 4DF7A 4J8QA 1BNZA 2RHSB 4AH6A 4DR5Q 3HZXA 1SEBD 4DK0A 1VQOA 1PH8A 4G7HC 4IALA 1HZCA 4U673 1HA5A 4JI5Q 1B50A 4RKLA 5KYLA 3HFZB 3S24A 2K5QA 4NXMQ 3URYA 2BDOA 2JXMB 1GOZA 4TKOB 5M3FB 3DM3A 5KNDA 1WTHA 1DJRD 3NWSA 1U4LA 2PCFB 1B4OA 3FKIG 5GQOA 4CDCC 4BBRH 4A3JG 4IJHA 2AWNA 4A3BH 1K3BC 1G91A 3I4NH 4IJLA 4YHHL 1FGUA 2B2TA 3OWFA 5C6AA 3BDLA 2MJ8A 2QGQA 1OTCA 2HHHQ 2DY7A 1Q1EA 1TT2A 3MXUA 1I4GA 3S1RB 3ERQA 4ZQ3A 2KOLA 1J8IA 1LTID 3HOYG 2F0HA 4LF4Q 1Y14B 1O80A 3BVMA 5M3FH 1QVGA 3HOUB 4H44C 2JQOA 3CD6A 4V190 3HOWG 3AYHB 1JCKB 3T1YL 3TDQA 3F2CA 4LUZA 3A55A 1SLJA 4OWTB 4LUOA 1E22A 1QUQB 1YJWA 2MFIA 1I3QH 4HEDA 1PRTD 1V1QA 1V8QA 4HJ5A 3S1RH 3I2ZA 1H9RA 1WVLA 4B3TQ 4DR5L 1PZID 1E3PA 3KDFA 2DJGC 4JI5L 3HOUH 1JOQA 2I07B 5C4XG 1Y8PB 1F77A 1NCVA 4R9WA 4NXML 1CKNA 4BXXH 4ME5A 2VB2X 1RTNA 4DV2Q 2EYMA 5IGBA 3NBHB 1GXDC 5KYIA 1CSQA 3TN2A 3K57A 2E74C 1JE5A 5DM73 1YI2A 3CW2C 2L11A 1VQHA 2A6HD 3CRLC 3ICEA 4OGQC 5LMNW 4IOAA 3TREA 2KEDA 3P75A 5IT9L 1C0AA 4K6LA 4LF4L 3H94A 2HD3A 3QOJA 2K5VA 3BZKA 4PZ6A 4ZRZA 5KIXA 5KNCA 1MI2A 2G9HD 1S3OA 2L1BA 1CZWA 2ZT9C 3U4VA 1LTSD 3KFUA 2B2UC 4WJ4A 2XTIA 3S17B 4BBRG 1G2TA 1I50B 4A3BG 4ALPA 4GOPA 3I4NG 3D4WA 4IO9A 2ZXPA 4KKUA 3MWYW 4JK1C 1PH2A 1E2WA 3BU2A 3CCQA 1PFMA 5DLQE 1STNA 1NY4A 4B3TL 1PH9A 1HNZQ 3KLSA 2LY7A 3BVZA 3EROA 3L0OA 4ODGA 4RKBA 2NUCA 4G4KA 4P71A 4CJ1B 5EAYA 2FINB 2HCCA 3PSIA 4HJ7A 3S17H 1LT5D 1I50H 3H3VC 3A7LA 1AW7A 4C2MH 4DUZQ 4DV2L 1E2ZA 5ELFA 1HR0W 5KGUA 4G7ZC 3J81c 3J81E 1SYCA 3PUWA 1A8VA 1S40A 4RA8A 5E7NA 1EEFD 1KLUD 3S14B 2R92B 1TS2A 5C3EH 1VQ4A 1GUOA 1PMRA 1RKNA 3M4PA 1TWGB 5C4JB 2YTXA 4RCNA 4BWGB 2DGYA 4BY7G 1S5CD 4NPSA 2QKIC 3QOLA 4R8IA 3STBC 4GLVB 1BUVT 4BXXG 1UNSA 1IL8A 4DAYA 1ET9A 4IOCA 3L3OC 1PA6A 4FXKC 1G291 2JYOA 1EWHA 2HT1A 3D31A 4ZUJA 3KJPA 5LMUQ 1SBBB 3S14H 4GS3A 2R92H 3PQIA 4JI3Q 1PTOC 1XTDA 4KD3A 3F8TA 3GTQB 2MUYA 2KCCA 3MAQA 1PFSA 4A3LH 1PH6A 2RHQB 1L1OA 1CA5A 4UDUC 1HNZL 1B3QA 1S5FD 2MPMA 1JB3A 1V1PA 4DUZL 1TWCH 1SFOB 1G2SA 3HOXB 4KHVA 4Y52H 4C3HB 5IE8A 2A5HA 2EQSA 4K5WA 1VQ5A 4L5RC 4HN7A 5CV9A 3JAML 2R7ZB 3T51B 4F88A 3GTQH 1ET6A 2HIXA 1EWCA 4I7AA 3J7YW 2X6GA 2EZVA 3K7UC 3A54A 2VL6A 3K81C 2HUGA 1XXGA 3R93A 3H15A 1Z47A 3HOZB 3DEOA 5HY6A 1LLRD 1U9RA 4K0KQ 3CPFA 2KECA 3DHQA 1EOVA 2Z6BA 3BYTB 4FNFA 4IUPA 1QNUA 2F3WA 5C3XA 1K83B 1LTRD 1Q3LA 3A5UA 1SR3A 3PF4A 3HOXH 4C3HH 2NVYB 2EJGC 3RZDB 2R7ZH 1S5BD 5LMUL 1K8MA 2XIWA 5C3EG 2HCIA 3FVQA 4JI3L 5G3LD 4DNIA 1FJGQ 1EY0A 3MEHA 3HOZH 1GUWA 1PV4A 1HFNA 1PH4A 3KYHC 1JOOA 2KCNA 1GHKA 3TEHB 1FD7D 4H13C 3KF6A 3BZCA 5JVH3 2PW5A 3G48A 3RN5A 3MFYA 1EIYB 3GV3A 3ND8A 4POFA 2MNAA 3ULJA 1TWHB 1X65A 2A1AA 1MJCA 3HRZC 1YNXA 3RZDH 3E3XA 1OO9B 4CJ2C 2R92G 1MHWC 1PYBA 4JI2Q 5GROA 1Q8IA 4A3LG 1A15A 4EGVA 4DNRB 5J3BA 1YZ6A 2D9UA 1Q86C 1F9SA 3NE5B 2KA7A 1D1IA 4UPAA 4RCOA 1XNRQ 2BA1A 3QB3A 2B39A 4KY6A 1I4XA 4KTAA 5ELBA 4K0KL 5M5YB 4XQJA 5M5XH 1K0SA 2XWJB 2XSCA 2AQ3B 1TWHH 3CC4A 1SJED 5C5MA 4XXEA 4YCWA 1B7YB 2GN5A 2QILA 4PMWA 4A3DB 1SMYD 1FNWA 4EQ5A 3WOEA 3OOCA 1HNWQ 1P8LA 4ZUIA 3DWAA 4H0LC 2CWPA 2Q2HA 4DR6Q 3RZOB 2PZWA 1CZGA 1FJGL 4HMJA 1EY4A 4ABNA 3C1FA 3ERSX 2E2DC 3P1HA 2J0TD 2KCTA 1JJCB 1PRTB 4NB3A 2QF7A 2R93B 1JORA 3HOXG 1K0RA 2JJQA 2EJMA 4C3HG 4RWSC 4PZ7A 1IBMQ 5LMNQ 2A73B 3EIVA 3R8BA 1FYCA 2KQ3A 3FMCA 1A3TA 4JI1Q 4A3FH 2VB3X 4JI2L 3K5LA 1X6OA 1QVFA 1SROA 4OXPA 5GAEC 2JP1A 2Z9HA 4S3SA 1A62A 3RZOH 3TBIB 2MO0A 1ICWA 2EYOA 2K7VA 4NP5A 1XNRL 4CKEA 3MHBA 1E1OA 3NWTA 4DGZA 4JG2A 2R93H 2F3VA 3D0FA 3D3RA 3M85A 4HIOA 5IIFA 3A56A 1I94Q 1QB5D 1MSHA 1VQJA 5J1ZA 4OONA 2K32A 1TWFH 4GN5A 4DV5Q 4GN3B 3PO3B 2VZAA 4GLXA 1Y1WB 1PH7A 3CC2A 2ALYB 1HNWL 2RSOA 2IW3A 4X3SA 4DR6L 4RGNA 4X64Q 5FOBB 3TS2A 1Q90A 1YEZA 3G71A 1LTAD 1HR0Q 2F0DA 1U4RA 2BE5C 3MTSA 5C0XH 5EBDA 1SJHD 2Z8LA 3A7AB 4R4OA 1XTCD 5EKKA 4XYQA 1IYVA 4R1JA 2PPBC 1MBYA 1EU3A 3X3MA 3K0XA 4P75A 1I6HB 5LMNL 1PH1A 2NVQB 1X56A 3PO3H 1MGSA 1RTOA 3D4DA 4JI1L 3PF5A 2E76C 1A6XA 4DK3C 1IXRA 3F2BA 5KRUA 1A2TA 4K5XA 4O42A 4C3JH 4I65A 4MTNA 3FRPB 1TXYA 1B53A 1IBKQ 1PLFA 3CP0A 3I56A 2IX0A 3GQBA 2B2WA 4KMUC 1VQEA 3TZUA 4R4IA 4QL5A 4QGUA 2PO4A 5A2QE 4A93B 2F52A 3BVGA 5LL6X 3CMAA 1I6HH 2A68D 1HA6A 2NVQH 5EGTA 3TP7A 4IURA 2VUMB 4A3FG 2V4DA 2DJFC 2F0QA 2CQAA 2PI2A 3KF8B 3NTIA 1A3VA 4DV5L 3F2UA 2I46A 1M4VA 4BY1B 1PYSB 1WFQA 2NZHA 5IYDH 2VY3A 2OF1A 3GTOB 1AH9A 1KTKA 4LFBQ 4X64L 1HR0L 1F9RA 3HGBA 3FKIB 2M9VA 3I72A 4A3JB 5I9OA 3SDZA 4KJOA 1KL9A 1MSGA 4DV4Q 4JOIA 3D4RA 1SDFA 3VYTA 3G4SA 1B1ZA 2VUMH 3G7LA 3NBIA 2WAQG 1BOSA 1SMXA 3KLRA 5M3MB 1BR9A 2Z4HA 3HOYB 3G6JB 4H7BA 2F0IA 3Q24A 1O7LA 1II3A 4BY1H 4A76A 2B2VA 3RR5A 1NNXA 1T5XD 2OQKA 1L0XB 1PTOF 4B3RQ 1UUPA 5C0XG 3E9IA 3HOWB 3EN2A 4LK1C 4IUVA 1LM0A 4A3JH 1RD9D 4L8JA 1IBKL 2LKVA 1U4MA 2B8GA 3J81i 3PCOB 2B63H 3PO3G 3GTKB 1W6KA 2WKCA 2R7DA 4ZAIA 5M3MH 2CCZA 1HTPA 2YU9H 3BYYB 3GTLH 4L6TB 2N78A 4DK6C 4LNQA 1TY2A 3CCUA 5T1GA 1VF5C 4C3JG 1UEBA 2Y0SB 1D6EC 4LAAA 1XPRA 3DLLA 5C4XB 4QMGA 5IGEA 4C1NK 1YIJA 5FLMH 4KN7C 2LFNA 5ELCA 3NELA 1KNAA 2ZJQA 1CT1D 3OPOA 1SAPA 1R4PB 2ZTDA 3TQYA 3IAYA 4DV4L 4DV0Q 1PDQA 3GTKH 4OIJA 4HCSA 2CH4W 5FO9B 3KK7A 1ILPA 2F0NA 5CC4A 4LW1A 1F2YA 2PZTA 3RMHA 4A3KB 2Q2UA 5C4XH 2EY1A 5IYDG 1W6JA 4DPGA 1PYWD 2JN4A 1CFMA 2A6ED 4WRDA 1STBA 5LHY1 2R61A 3HKSA 4B3RL 1BCPF 2D0OA 1KD1C 2LMCB 4A3BB 1SN8A 3I4NB 3S1QB 5FLXc 3CCLA 5FLXE 1IKMA 3NQIA 4P72A 4DU9A 5BR8Q 4KK7A 5K36H 1B3AA 1CQFA 1AEXA 1S4ZA 4M8AA 1YJ9A 4OL7A 4N9PA 4DK1A 2ATWA 3I90A 2Y0SE 3AFQA 4CBVA 4F87A 1PRTF 3IFTA 4BY1G 4A3KH 4JI0Q 4PMBA 1NJIC 4GLAC 1SNCA 1CI3M 1JMCA 2RDGA 4EVOA 5I6WA 1HZ9A 3PGZA 4GNXB 5IWAQ 4G57A 2PQAB 3S1QH 2VW9A 3ONAB 1BXTA 3OSOA 1SYDA 1I4RA 1I3QB 3NTKA 3GTPB 1STEA 1BVSA 1YNJC 4JI8Q 2B63G 4QIWB 5DEHA 3VYUA 2F03A 2JA6G 3K7AB 4N8FA 5EQ0A 5M3MG 4DV0L 3H91A 2RSNA 1JT8A 2G5DA 2HQEA 3VA5A 1LV9A 4KY7A 4BY7B 4IFDJ 1ZEQX 3J7ZC 2ZJRA 1RL2A 5NUCA 1VQDA 2OXPA 1G6ZA 3MXNA 2RDHA 5FLMG 5DM63 1X54A 4JI7Q 2KEEA 2F1MA 2PQEA 1S5ED 1RJTA 3GTPH 2RF4A 2GA4B 5CV7A 5IGDA 3S1NB 3E0JA 2F0EA 5BR8L 4DUYQ 3K7AH 1DYQA 1K28A 4FF4A 3VYRA 3QIAA 1SYFA 1HH2P 2IWHA 2F4VQ 4ZK9B 2CWAA 1DM0B 4F8MA 2Y0SG 4P73A 4BY7H 1TR5A 3S1MB 4JI0L 3M9BA 4ME3A 1SYGA 1VMPA 1FVIA 1GHJA 1DOKA 2F0GA 4I7ZC 4HSVA 4LF8Q 2F3IA 5IWAL 1H9MA 2B2UA 1MD2D 4UY8C 3W3AA 2PW7A 4PMCA 3C2PA 5K36G 3S1NH 1WTRA 2JSOA 4BBSH 3I4MB 1SYEA 4JI8L 2HHHL 2CW0D 4KLKA 3J81j 1YNNC 3P7JA 1CKOA 2K6AA 4LF7Q 4A3KG 2K33A 1WTPA 2A69C 3S1MH 4J15A 3CKIB 4XDXA 3J7AF 1P16A 2N3SA 3K59A 3GP7A 3RD4A 2AWOA 4OEMB 2UXDQ 1L2FA 1Q7YC 4C2MB 5C0XI 4JI7L 2L15A 2UU9Q 2E2HH 3I4MH 1D5ZC 1E0BA 2M00A 5ELEA 1A0IA 1XX8A 2L9HA 5C3EB 2C5CA 3CXCA 4M1UB 1FNVA 3CCRA 1WCMG 2B2YC 2MO1A 2NN6H 3OMCA 4MZ9A 4IN3A 2IY5B 2F4VL 4IUUA 2M2LA 4LF5Q 3J80c 3S2HB 4KJNA 2K14A 1LT3D 4R4QA 4FP5D 4O2DA 1HNXQ 4DKAC 2BOSA 2I0QA 4G7OC 4LF8L 1EOTA 4RHSA 4DV6Q 2K52A 4YIJA 1VS0A 4PZ8A 4NXNQ 2IL8A 5E4XA 3ULPA 5JEAH 1AZQA 3DMUA 2RA4A 1HZBA 1B70B 3RUZA 1T9HA 1PZJD 1YJNA 1IKLA 1PZKD 2GVAA 2KHIA 1IHZA 4AYBB 4LF7L 4QB4A 1HCZA 1QWYA 3S2HH 1EY8A 3VDYA 1B9MA 3OW2A 1X3QA 3KDFB 5H1SE 1Z7TA 2AMCB 3ER0A 4FYDA 2UXDL 1OXXK 1IW7D 2WKDA 5I2YA 2D0PA 5IYCH 1CKNB 2TSSA 1TU2B 1TWCB 1WI5A 1KIXA 4BBSG 5C5LA 2UU9L 3KLSX 4FO2A 1Q12A 1DCZA 4EQNA 3W1GA 3EFXD 4B9XA 1BO0A 4K2KA 3IKJA 1D7QA 1PH3A 3K0YA 3KLWA 1MKHA 1KDBA 1PFNA 1HUMA 2KENA 4LF5L 2R3ZA 5CV5A 5G3LF 4CHTB 1WTQA 1SE4A 1HNXL 4QCLA 3IL8A 1VDZA 1UE6A 3A8KE 3I4MG 1VQBA 3NP8A 2EXDA 4LWCA 1AE3A 2BDNA 4DV6L 2XGTA 5AJ3Q 4GOPB 3DUZA 2FMMA 1OXUA 2NN6G 4AYBE 2JA8B 3BDCA 2WB1G 3SK4A 5IP9H 3S15H 2O2LD 2F4IA 1FL0A 1CKMA 3VR5A 5J39A 1X3EA 1WJJA 3A5ZB 2ID0A 5BN4A 3T53B 1Y69U 4X62Q 2TMPA 4TVAB 2ZXRA 2R6GA 2EYHA 4XQQA 1D2BA
chains in the Genus database with same CATH topology
4YHHQ 3E0EA 5JEAG 4DR6L 4YWKA 4X64Q 1IBLQ 1XMOL 3TS2A 1M1KC 1YEZA 3G71A 2JA8H 1HR0Q 2OCEA 3B6YA 1EQQA 4R4OA 3RLOA 4OWWB 4DUYL 3M7NA 1JJ2A 4R1JA 4WJ3M 1A63A 1MJEA 2Q2IA 2LXKA 3K0XA 1KQSA 1IZ6A 3I7FA 4P75A 2BH8A 3HKZE 5LMNL 1KAWA 3GD7A 4RMFA 1PH1A 1OXTA 3BJUA 1X56A 5IYCG 3PO3H 5IY0A 2UXBQ 3U50C 2JA9A 2B3GA 3GTJH 2CQOA 3T1YQ 3LGJA 4DAYB 4JI1L 3PF5A 2K75A 1UE5A 2KHJA 4DK3C 1IXRA 2V1CC 3UDFA 4X66Q 3F2BA 3CCEA 3S2DH 4BA2I 2ES2A 4L5QA 4C3JH 1YHAA 5AJ3L 3CCMA 2LXJA 4A93G 4IPDA 4MTNA 4A3LH 2VQEL 2E2JH 3MXNB 1TXYA 1PH5A 1IBKQ 1YHBA 3CP0A 1GD7A 4AYBG 5M5WH 3PUXA 3I56A 4JI4L 1K8GA 4X65L 2IX0A 5M3FG 2VUMG 3A0JA 3PO2G 1HZAA 3A74A 1VQEA 1VQFA 2RHSB 4R4IA 4QL5A 4AH6A 4QGUA 4DR5Q 2VS1A 1VQOA 1PH8A 2WB1E 1HZCA 4GOPC 2F52A 3CMAA 1I6HH 4HIDA 1VQPA 4JI5Q 2UUAL 3HFZB 1L1OB 3S24A 3PIOA 4NXMQ 2NVQH 4H02A 4A3FG 1I5FA 3DM3A 1PVOA 2PI2A 3KF8B 4DV5L 4DAMA 2JA7G 4X62L 3FKIG 5GQOA 4BBRH 1OXVA 1QVCA 4A3JG 4IJHA 4DR7Q 2AWNA 4A3BH 1EIFA 4XTCS 3I4NH 3PV0A 4IJLA 1PYSB 1WFQA 2NZHA 2Z0SA 1FGUA 2VY3A 4YHHL 4DV1Q 3K80C 3CCSA 2UUBQ 4JBKA 3CCVA 1AH9A 2JE6I 4LFBQ 2PNHA 4X64L 1IBLL 2QGQA 2IHFA 2RCNA 2Z6KC 5IP9G 1HR0L 1OTCA 2HHHQ 3HOUG 1NBWA 1Q1EA 2YTVA 3Q8DA 1KRTA 1KL9A 3S16H 4JI0Q 4DV4Q 2JA5G 3HOYG 1GVPA 4JOIA 4LF4Q 1Y14B 3G4SA 2VUMH 3F1ZA 1QVGA 5M3FH 3HOVG 2WAQG 1SMXA 3U4ZA 2JQOA 3CD6A 1SE8A 3HOWG 3OYYA 2UXBL 3AYHB 3T1YL 1N33Q 3F2CA 4LUZA 1YITA 2H5XA 1SLJA 1M90C 4BY1H 2K50A 2YV5A 4LUOA 4OWTB 4X66L 1E22A 1Y1VH 1QUQB 3RR5A 1X3FA 4A76A 1YJWA 3CPWA 2MFIA 1I3QH 2OQKA 1VQAA 2Q2TA 2OWOA 2JA8G 4A3GG 1TWGH 2ZJPA 4A3CH 3JC66 4B3RQ 5C0XG 3E9IA 5C4JH 3EN2A 1S72A 1V1QA 5JJLA 1LM0A 4HJ5A 4A3JH 1IBKL 3S1RH 5IYDH 4PG3A 4DV7Q 3I2ZA 4NXNL 4B3TQ 1O7IA 2YTYA 1DGSA 4O0AA 3OTOQ 3J81i 3PCOB 5HGQA 4DR5L 1N8RC 1GM5A 4IFDI 1E3PA 3KDFA 1EQRA 2B63H 4B3SQ 2JEAI 4JI5L 3HOUH 2JA7H 3PO3G 5C4XG 2CCZA 2R7DA 5M3MH 4NXML 4QY7A 2YU9H 3KF6B 1CKNA 2E5LQ 4BXXH 3GTLH 1N32Q 3NENA 1H95A 2N78A 4DV2Q 4DK6C 3PIPA 3NBHB 3IRBA 2JK8A 3CCUA 4LNQA 2GVBA 2B29A 1CSQA 4LFCQ 1UEBA 4LF6Q 4DR7L 3T1HL 1XPRA 1JE5A 4YCVA 3DLLA 4KHZA 1YI2A 1L1OC 1R9TH 4DV1L 4HIKA 3FHWA 3CW2C 2UUBL 1VQHA 1Q82C 1YIJA 5FLMH 1X9NA 3ICEA 3H3VH 5LMNW 4IOAA 3NELA 3TREA 2ZJQA 4JBJA 1WOCA 3RN2A 4A3GH 5IP7H 1RIPA 2ZTDA 3TQYA 1G6PA 3WWVA 1C0AA 5FJ8H 4DV4L 4DV0Q 4LF4L 4MNOA 3BZKA 2K5VA 3GTKH 4PZ6A 1KC8C 3CMEA 1SFOH 1S3OA 2VQFQ 3U4VA 1SRUA 3UDGA 3KFUA 4WJ4A 2XTIA 4KHPQ 4BBRG 1IBML 4LW1A 4DR2Q 1K9MC 1Q1BA 2WAQE 4A3BG 4ALPA 4LFAQ 4GOPA 2Q2UA 1YHQA 3I4NG 5C4XH 5IYDG 1QZHA 4IO9A 4DPGA 3RLFA 3ULLA 1YVCA 4A4IA 2JEBI 1Q46A 3BU2A 1XMQQ 1PH2A 3HKSA 3GO5A 3CCQA 2NVTH 4B3RL 4DR1Q 1E24A 2IT1A 2D0OA 4TQUS 1KD1C 1SN8A 5DLQE 4A3IH 5JEAJ 3NEMA 5FLXc 3CCLA 4JBWA 4QQBX 4DV7L 4IPCA 4P72A 4IPHA 5BR8Q 2K4KA 1NY4A 4B3TL 1PH9A 1YJ9A 1K83H 3OTOL 1HNZQ 3L0OA 2A19A 1K8AC 1OXSC 3AQQA 4B3SL 4L5SA 2NVYH 2Z6KA 2D62A 1VQGA 2EIFA 4P71A 5IT9c 2ATWA 5EAYA 3RNUA 3S17H 3PSIA 4HJ7A 1I94L 2Y0SE 1I50H 3AFQA 1EYGA 4C3IH 5GAHC 2E5LL 1N32L 4C2MH 3K8AA 4BY1G 1E7ZA 4Y7NH 1CUKA 4DUZQ 4DV2L 1Y1VG 4A3KH 1NJIC 1E1TA 4GLAC 4LUVA 1HR0W 1JMCA 3J81c 2NVXH 1MIUA 4A3CG 3PUWA 1TWAH 1A8VA 4LFCL 4FDBA 5ELNA 4LF6L 1S40A 1JJGA 4KI0A 1HZ9A 5E7NA 1J6QA 1W3SA 4EX5A 3PGZA 4GNXB 3RZOH 5IWAQ 3F2DA 1GO3E 3KOJA 3W1BA 1NE3A 2PQAB 1X3GA 4UP8A 3S1QH 5C3EH 2VW9A 3CC7A 1VQ4A 2UXCQ 1B8AA 3M4PA 1WYDA 1BVSA 3H0GH 3M3YH 2YTXA 4OX9Q 3I4OA 4JI8Q 2B63G 4HJAA 4JCVE 2DGYA 4BY7G 4NPSA 2JA6G 4X6AH 3STBC 5M3MG 4DV0L 4APVA 1JT8A 1V43A 4GLVB 4BXXG 2WFWA 2CFMA 5GAGC 3CF5A 3RLNA 1J5EQ 2VQFL 4IOCA 1K3RA 2A8VA 3JAMi 1PA6A 2KCMA 4KHPL 4IFDJ 1G291 3J7ZC 2ZJRA 4DR2L 4LFAL 1RL2A 2HT1A 1VQDA 1EFWA 4HJ9A 3D31A 3KJPA 5LMUQ 1QZGA 3S14H 2R7FA 4GS3A 2R92H 5JJIA 5FLMG 1VQIA 1X54A 4HJ8A 1XMQL 4JI3Q 4JI7Q 4JI6Q 2VNUD 4DR1L 1XTDA 3F8TA 3CQZH 4JV5Q 5IP7G 3GTPH 3J7A5 2PMZE 1PFSA 2C35B 5M5YH 2RHQB 5FJ8G 1VQMA 2RF4A 1HJPA 1PH6A 3J80i 1UWVA 3GTMH 5BR8L 4UP7A 2ZTEA 3FP9A 3K7AH 4DUYQ 1L1OA 3UE0A 3TS0A 2E8GA 2K5HA 1HNZL 2NZOA 3EBEA 2ASBA 1HH2P 1NMGA 2R7ZG 3AEVA 2F4VQ 2CWAA 2UUCQ 2Y0SG 4P73A 4BY7H 4A3DH 1UE1A 2R93H 2JA6H 2ZM6Q 1VQCA 2FXQA 1ASZA 4DUZL 1TWCH 3AFPA 4JI0L 3M9BA 1V9PA 4ME3A 1N33L 4Y52H 5IE8A 2N49A 2EQSA 2HIVA 1VQ5A 4L5RC 3PUYA 1FVIA 4DR3Q 1C7YA 3HOZG 1U5KA 1Q81C 4LF8Q 2F3IA 5IWAL 4A3IG 2HIXA 1X55A 3GTQH 4GKJQ 4UY8C 3GDEA 5K36G 1Z9FA 1IL2A 3K7UC 3S1NH 2UXCL 2VL6A 1YBYA 3K81C 4BBSH 1LUZA 4LFBL 1VQLA 1BBUA 4YWMA 5IYBH 3H15A 4OX9L 1Z47A 4JI8L 2HHHL 5HY6A 4A3MH 4KLKA 4GKKQ 4K0KQ 3J81j 4GNXC 3CPFA 1VQ7A 1EOVA 2MQHA 2QEXA 1CKOA 4LF7Q 4A3KG 4A3EH 3UE1A 3GTGH 5ELOA 3A5UA 3S1MH 1SR3A 5GADC 4J15A 3PF4A 3HOXH 2IX1A 1P16A 1Q8KA 1QUQA 2N3SA 4XIGS 4C3HH 3STBD 1XPOA 2AWOA 4OO1I 2OQ0A 2UXDQ 2K5NA 1L2FA 2R7ZH 5LMUL 1Q7YC 5C0XI 5C3EG 4YWLA 4B3MQ 4LF9Q 4JI7L 4JI3L 2L15A 2UU9Q 4JI6L 1W2BA 2E2HH 1N34Q 3I4MH 1UE7A 3E9HA 3H0GG 3JAMc 4JV5L 4DNIA 2QA4A 1G51A 4LF5Q 4GN4B 1FJGQ 1XNQQ 1VQKA 3HOZH 2NN6I 3I55A 1A0IA 2AKWB 1PV4A 4R4TA 2WP8J 1PH4A 2I5LX 3KYHC 1KHIA 4AQYQ 3TEHB 3CXCA 3PUZA 3CCRA 3KF6A 3BZCA 1WCMG 2MO1A 1CSPA 3G48A 3RN5A 1N36Q 4MZ9A 3M4QA 3ZJYC 1EIYB 2IY5B 2F4VL 4POFA 1N9WA 3ULJA 2MNAA 1XJVA 3U58A 2UUCL 1EUJA 4AIMA 4OO1G 1X65A 2A1AA 3J80c 2ZM6L 1MJCA 4IPGA 2K14A 1YNXA 2HQLA 3L7ZC 4R4QA 3RZDH 1Y1WH 1BBWA 4O2DA 2R92G 1HNXQ 1KXLA 4DKAC 1PYBA 4JI2Q 5GROA 1PHJA 2I0QA 4JYAQ 5C44H 4DR3L 3M4OH 5JJKA 4LF8L 4DR4Q 1NTGA 1VQ6A 2I5HA 2YYZA 4A3LG 4GKJL 4DV6Q 3CCJA 2K52A 2OTLA 1U0LA 5J3BA 1YZ6A 1Q86C 4YY3Q 2BH2A 1VS0A 4PZ8A 4NXNQ 4UPAA 2OTJA 1XNRQ 3TRZA 2BA1A 3ULPA 2BA0A 1HZBA 1B70B 3W5OA 4DV3Q 4POGA 4GKKL 4K0KL 1T9HA 5M5XH 1YJNA 2GVAA 4R4CA 4A3DG 2KHIA 4LF7L 4IFDG 1TWHH 3CC4A 3SGIA 3S2HH 1LYLA 3VDYA 4YCWA 1AE2A 1WCMH 3KJOA 3OW2A 2KBNA 3KDFB 4JC0A 1B7YB 2GN5A 3G6EA 5H1SE 1VQ8A 2AMCB 2PI2E 3ER0A 2E2IH 2UXDL 4PMWA 1OXXK 2D0PA 3CAMA 4EQ5A 5IYCH 1CKNB 1L0WA 1WI5A 4B3ML 4LF9L 1KIXA 3T1HQ 4BBSG 1P8LA 1HNWQ 2UU9L 1N34L 2R93G 2CWPA 2Q2HA 5IYBG 4DR6Q 1Q12A 1FJGL 1IYJB 1XMOQ 3W1GA 1XNQL 4A3MG 4BA1I 1LTLA 4A93H 4L5TA 3ERSX 4AQYL 1KRSA 1D7QA 2KCTA 1JJCB 4A3EG 1PH3A 4NB3A 2CKZB 3UDIA 1N36L 3KLWA 3UDXA 1MKHA 3HKZG 3PO2H 3HOXG 1ASYA 1K0RA 2JJQA 4QJFA 4PZ7A 1IBMQ 5LMNQ 1JB7A 3EIVA 2KENA 4LF5L 4A75A 4GNXA 3MEFA 2IHEA 1HNXL 2PQAA 4JI1Q 4A3FH 3GTOH 4JI2L 2ZTCA 1VQNA 1UE6A 1X6OA 1SROA 3L2PA 4OXPA 5GAEC 1QVFA 3I4MG 4JYAL 1D8LA 1VQBA 4DR4L 2EXDA 4HIMA 1GKHA 1A62A 1AE3A 3FKIH 4LWCA 2MO0A 2LSSA 2XGTA 5AJ3Q 4DV6L 4GOPB 1XPUA 4JOIC 4YY3L 1BKBA 1C9OA 2VQEQ 4QIWE 1XNRL 1OXUA 2NN6G 2DUDA 4AYBE 4JI4Q 5C0XJ 1E1OA 4X65Q 2WB1G 4JG2A 1NMFA 2AHOB 4UP9A 2I5MX 5IP9H 3D0FA 4DV3L 1EWIA 1VCIA 3S15H 4JBMA 3M85A 4HIOA 1FL0A 1CKMA 1I94Q 4YCUA 1X3EA 1Y1WG 1K73C 1WJJA 2JA5H 2UUAQ 3HOYH 1VQJA 3A5ZB 1VQ9A 4OONA 1J5EL 3PUVA 5C44G 2ID0A 1TWFH 4GN5A 4P74A 2N8NA 4GN3B 4DV5Q 3HOVH 3H3VI 4X62Q 4RG1A 2VZAA 4TVAB 4GLXA 3HOWH 2R6GA 4OWXB 1PH7A 3CC2A 2ALYB 1HNWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH Q;  3E0E A;  5JEA G;  4DR6 L;  4YWK A;  4X64 Q;  1IBL Q;  1XMO L;  3TS2 A;  1M1K C;  1YEZ A;  3G71 A;  2JA8 H;  1HR0 Q;  2OCE A;  3B6Y A;  1EQQ A;  4R4O A;  3RLO A;  4OWW B;  4DUY L;  3M7N A;  1JJ2 A;  4R1J A;  4WJ3 M;  1A63 A;  1MJE A;  2Q2I A;  2LXK A;  3K0X A;  1KQS A;  1IZ6 A;  3I7F A;  4P75 A;  2BH8 A;  3HKZ E;  5LMN L;  1KAW A;  3GD7 A;  4RMF A;  1PH1 A;  1OXT A;  3BJU A;  1X56 A;  5IYC G;  3PO3 H;  5IY0 A;  2UXB Q;  3U50 C;  2JA9 A;  2B3G A;  3GTJ H;  2CQO A;  3T1Y Q;  3LGJ A;  4DAY B;  4JI1 L;  3PF5 A;  2K75 A;  1UE5 A;  2KHJ A;  4DK3 C;  1IXR A;  2V1C C;  3UDF A;  4X66 Q;  3F2B A;  3CCE A;  3S2D H;  4BA2 I;  2ES2 A;  4L5Q A;  4C3J H;  1YHA A;  5AJ3 L;  3CCM A;  2LXJ A;  4A93 G;  4IPD A;  4MTN A;  4A3L H;  2VQE L;  2E2J H;  3MXN B;  1TXY A;  1PH5 A;  1IBK Q;  1YHB A;  3CP0 A;  1GD7 A;  4AYB G;  5M5W H;  3PUX A;  3I56 A;  4JI4 L;  1K8G A;  4X65 L;  2IX0 A;  5M3F G;  2VUM G;  3A0J A;  3PO2 G;  1HZA A;  3A74 A;  1VQE A;  1VQF A;  2RHS B;  4R4I A;  4QL5 A;  4AH6 A;  4QGU A;  4DR5 Q;  2VS1 A;  1VQO A;  1PH8 A;  2WB1 E;  1HZC A;  4GOP C;  2F52 A;  3CMA A;  1I6H H;  4HID A;  1VQP A;  4JI5 Q;  2UUA L;  3HFZ B;  1L1O B;  3S24 A;  3PIO A;  4NXM Q;  2NVQ H;  4H02 A;  4A3F G;  1I5F A;  3DM3 A;  1PVO A;  2PI2 A;  3KF8 B;  4DV5 L;  4DAM A;  2JA7 G;  4X62 L;  3FKI G;  5GQO A;  4BBR H;  1OXV A;  1QVC A;  4A3J G;  4IJH A;  4DR7 Q;  2AWN A;  4A3B H;  1EIF A;  4XTC S;  3I4N H;  3PV0 A;  4IJL A;  1PYS B;  1WFQ A;  2NZH A;  2Z0S A;  1FGU A;  2VY3 A;  4YHH L;  4DV1 Q;  3K80 C;  3CCS A;  2UUB Q;  4JBK A;  3CCV A;  1AH9 A;  2JE6 I;  4LFB Q;  2PNH A;  4X64 L;  1IBL L;  2QGQ A;  2IHF A;  2RCN A;  2Z6K C;  5IP9 G;  1HR0 L;  1OTC A;  2HHH Q;  3HOU G;  1NBW A;  1Q1E A;  2YTV A;  3Q8D A;  1KRT A;  1KL9 A;  3S16 H;  4JI0 Q;  4DV4 Q;  2JA5 G;  3HOY G;  1GVP A;  4JOI A;  4LF4 Q;  1Y14 B;  3G4S A;  2VUM H;  3F1Z A;  1QVG A;  5M3F H;  3HOV G;  2WAQ G;  1SMX A;  3U4Z A;  2JQO A;  3CD6 A;  1SE8 A;  3HOW G;  3OYY A;  2UXB L;  3AYH B;  3T1Y L;  1N33 Q;  3F2C A;  4LUZ A;  1YIT A;  2H5X A;  1SLJ A;  1M90 C;  4BY1 H;  2K50 A;  2YV5 A;  4LUO A;  4OWT B;  4X66 L;  1E22 A;  1Y1V H;  1QUQ B;  3RR5 A;  1X3F A;  4A76 A;  1YJW A;  3CPW A;  2MFI A;  1I3Q H;  2OQK A;  1VQA A;  2Q2T A;  2OWO A;  2JA8 G;  4A3G G;  1TWG H;  2ZJP A;  4A3C H;  3JC6 6;  4B3R Q;  5C0X G;  3E9I A;  5C4J H;  3EN2 A;  1S72 A;  1V1Q A;  5JJL A;  1LM0 A;  4HJ5 A;  4A3J H;  1IBK L;  3S1R H;  5IYD H;  4PG3 A;  4DV7 Q;  3I2Z A;  4NXN L;  4B3T Q;  1O7I A;  2YTY A;  1DGS A;  4O0A A;  3OTO Q;  3J81 i;  3PCO B;  5HGQ A;  4DR5 L;  1N8R C;  1GM5 A;  4IFD I;  1E3P A;  3KDF A;  1EQR A;  2B63 H;  4B3S Q;  2JEA I;  4JI5 L;  3HOU H;  2JA7 H;  3PO3 G;  5C4X G;  2CCZ A;  2R7D A;  5M3M H;  4NXM L;  4QY7 A;  2YU9 H;  3KF6 B;  1CKN A;  2E5L Q;  4BXX H;  3GTL H;  1N32 Q;  3NEN A;  1H95 A;  2N78 A;  4DV2 Q;  4DK6 C;  3PIP A;  3NBH B;  3IRB A;  2JK8 A;  3CCU A;  4LNQ A;  2GVB A;  2B29 A;  1CSQ A;  4LFC Q;  1UEB A;  4LF6 Q;  4DR7 L;  3T1H L;  1XPR A;  1JE5 A;  4YCV A;  3DLL A;  4KHZ A;  1YI2 A;  1L1O C;  1R9T H;  4DV1 L;  4HIK A;  3FHW A;  3CW2 C;  2UUB L;  1VQH A;  1Q82 C;  1YIJ A;  5FLM H;  1X9N A;  3ICE A;  3H3V H;  5LMN W;  4IOA A;  3NEL A;  3TRE A;  2ZJQ A;  4JBJ A;  1WOC A;  3RN2 A;  4A3G H;  5IP7 H;  1RIP A;  2ZTD A;  3TQY A;  1G6P A;  3WWV A;  1C0A A;  5FJ8 H;  4DV4 L;  4DV0 Q;  4LF4 L;  4MNO A;  3BZK A;  2K5V A;  3GTK H;  4PZ6 A;  1KC8 C;  3CME A;  1SFO H;  1S3O A;  2VQF Q;  3U4V A;  1SRU A;  3UDG A;  3KFU A;  4WJ4 A;  2XTI A;  4KHP Q;  4BBR G;  1IBM L;  4LW1 A;  4DR2 Q;  1K9M C;  1Q1B A;  2WAQ E;  4A3B G;  4ALP A;  4LFA Q;  4GOP A;  2Q2U A;  1YHQ A;  3I4N G;  5C4X H;  5IYD G;  1QZH A;  4IO9 A;  4DPG A;  3RLF A;  3ULL A;  1YVC A;  4A4I A;  2JEB I;  1Q46 A;  3BU2 A;  1XMQ Q;  1PH2 A;  3HKS A;  3GO5 A;  3CCQ A;  2NVT H;  4B3R L;  4DR1 Q;  1E24 A;  2IT1 A;  2D0O A;  4TQU S;  1KD1 C;  1SN8 A;  5DLQ E;  4A3I H;  5JEA J;  3NEM A;  5FLX c;  3CCL A;  4JBW A;  4QQB X;  4DV7 L;  4IPC A;  4P72 A;  4IPH A;  5BR8 Q;  2K4K A;  1NY4 A;  4B3T L;  1PH9 A;  1YJ9 A;  1K83 H;  3OTO L;  1HNZ Q;  3L0O A;  2A19 A;  1K8A C;  1OXS C;  3AQQ A;  4B3S L;  4L5S A;  2NVY H;  2Z6K A;  2D62 A;  1VQG A;  2EIF A;  4P71 A;  5IT9 c;  2ATW A;  5EAY A;  3RNU A;  3S17 H;  3PSI A;  4HJ7 A;  1I94 L;  2Y0S E;  1I50 H;  3AFQ A;  1EYG A;  4C3I H;  5GAH C;  2E5L L;  1N32 L;  4C2M H;  3K8A A;  4BY1 G;  1E7Z A;  4Y7N H;  1CUK A;  4DUZ Q;  4DV2 L;  1Y1V G;  4A3K H;  1NJI C;  1E1T A;  4GLA C;  4LUV A;  1HR0 W;  1JMC A;  3J81 c;  2NVX H;  1MIU A;  4A3C G;  3PUW A;  1TWA H;  1A8V A;  4LFC L;  4FDB A;  5ELN A;  4LF6 L;  1S40 A;  1JJG A;  4KI0 A;  1HZ9 A;  5E7N A;  1J6Q A;  1W3S A;  4EX5 A;  3PGZ A;  4GNX B;  3RZO H;  5IWA Q;  3F2D A;  1GO3 E;  3KOJ A;  3W1B A;  1NE3 A;  2PQA B;  1X3G A;  4UP8 A;  3S1Q H;  5C3E H;  2VW9 A;  3CC7 A;  1VQ4 A;  2UXC Q;  1B8A A;  3M4P A;  1WYD A;  1BVS A;  3H0G H;  3M3Y H;  2YTX A;  4OX9 Q;  3I4O A;  4JI8 Q;  2B63 G;  4HJA A;  4JCV E;  2DGY A;  4BY7 G;  4NPS A;  2JA6 G;  4X6A H;  3STB C;  5M3M G;  4DV0 L;  4APV A;  1JT8 A;  1V43 A;  4GLV B;  4BXX G;  2WFW A;  2CFM A;  5GAG C;  3CF5 A;  3RLN A;  1J5E Q;  2VQF L;  4IOC A;  1K3R A;  2A8V A;  3JAM i;  1PA6 A;  2KCM A;  4KHP L;  4IFD J;  1G29 1;  3J7Z C;  2ZJR A;  4DR2 L;  4LFA L;  1RL2 A;  2HT1 A;  1VQD A;  1EFW A;  4HJ9 A;  3D31 A;  3KJP A;  5LMU Q;  1QZG A;  3S14 H;  2R7F A;  4GS3 A;  2R92 H;  5JJI A;  5FLM G;  1VQI A;  1X54 A;  4HJ8 A;  1XMQ L;  4JI3 Q;  4JI7 Q;  4JI6 Q;  2VNU D;  4DR1 L;  1XTD A;  3F8T A;  3CQZ H;  4JV5 Q;  5IP7 G;  3GTP H;  3J7A 5;  2PMZ E;  1PFS A;  2C35 B;  5M5Y H;  2RHQ B;  5FJ8 G;  1VQM A;  2RF4 A;  1HJP A;  1PH6 A;  3J80 i;  1UWV A;  3GTM H;  5BR8 L;  4UP7 A;  2ZTE A;  3FP9 A;  3K7A H;  4DUY Q;  1L1O A;  3UE0 A;  3TS0 A;  2E8G A;  2K5H A;  1HNZ L;  2NZO A;  3EBE A;  2ASB A;  1HH2 P;  1NMG A;  2R7Z G;  3AEV A;  2F4V Q;  2CWA A;  2UUC Q;  2Y0S G;  4P73 A;  4BY7 H;  4A3D H;  1UE1 A;  2R93 H;  2JA6 H;  2ZM6 Q;  1VQC A;  2FXQ A;  1ASZ A;  4DUZ L;  1TWC H;  3AFP A;  4JI0 L;  3M9B A;  1V9P A;  4ME3 A;  1N33 L;  4Y52 H;  5IE8 A;  2N49 A;  2EQS A;  2HIV A;  1VQ5 A;  4L5R C;  3PUY A;  1FVI A;  4DR3 Q;  1C7Y A;  3HOZ G;  1U5K A;  1Q81 C;  4LF8 Q;  2F3I A;  5IWA L;  4A3I G;  2HIX A;  1X55 A;  3GTQ H;  4GKJ Q;  4UY8 C;  3GDE A;  5K36 G;  1Z9F A;  1IL2 A;  3K7U C;  3S1N H;  2UXC L;  2VL6 A;  1YBY A;  3K81 C;  4BBS H;  1LUZ A;  4LFB L;  1VQL A;  1BBU A;  4YWM A;  5IYB H;  3H15 A;  4OX9 L;  1Z47 A;  4JI8 L;  2HHH L;  5HY6 A;  4A3M H;  4KLK A;  4GKK Q;  4K0K Q;  3J81 j;  4GNX C;  3CPF A;  1VQ7 A;  1EOV A;  2MQH A;  2QEX A;  1CKO A;  4LF7 Q;  4A3K G;  4A3E H;  3UE1 A;  3GTG H;  5ELO A;  3A5U A;  3S1M H;  1SR3 A;  5GAD C;  4J15 A;  3PF4 A;  3HOX H;  2IX1 A;  1P16 A;  1Q8K A;  1QUQ A;  2N3S A;  4XIG S;  4C3H H;  3STB D;  1XPO A;  2AWO A;  4OO1 I;  2OQ0 A;  2UXD Q;  2K5N A;  1L2F A;  2R7Z H;  5LMU L;  1Q7Y C;  5C0X I;  5C3E G;  4YWL A;  4B3M Q;  4LF9 Q;  4JI7 L;  4JI3 L;  2L15 A;  2UU9 Q;  4JI6 L;  1W2B A;  2E2H H;  1N34 Q;  3I4M H;  1UE7 A;  3E9H A;  3H0G G;  3JAM c;  4JV5 L;  4DNI A;  2QA4 A;  1G51 A;  4LF5 Q;  4GN4 B;  1FJG Q;  1XNQ Q;  1VQK A;  3HOZ H;  2NN6 I;  3I55 A;  1A0I A;  2AKW B;  1PV4 A;  4R4T A;  2WP8 J;  1PH4 A;  2I5L X;  3KYH C;  1KHI A;  4AQY Q;  3TEH B;  3CXC A;  3PUZ A;  3CCR A;  3KF6 A;  3BZC A;  1WCM G;  2MO1 A;  1CSP A;  3G48 A;  3RN5 A;  1N36 Q;  4MZ9 A;  3M4Q A;  3ZJY C;  1EIY B;  2IY5 B;  2F4V L;  4POF A;  1N9W A;  3ULJ A;  2MNA A;  1XJV A;  3U58 A;  2UUC L;  1EUJ A;  4AIM A;  4OO1 G;  1X65 A;  2A1A A;  3J80 c;  2ZM6 L;  1MJC A;  4IPG A;  2K14 A;  1YNX A;  2HQL A;  3L7Z C;  4R4Q A;  3RZD H;  1Y1W H;  1BBW A;  4O2D A;  2R92 G;  1HNX Q;  1KXL A;  4DKA C;  1PYB A;  4JI2 Q;  5GRO A;  1PHJ A;  2I0Q A;  4JYA Q;  5C44 H;  4DR3 L;  3M4O H;  5JJK A;  4LF8 L;  4DR4 Q;  1NTG A;  1VQ6 A;  2I5H A;  2YYZ A;  4A3L G;  4GKJ L;  4DV6 Q;  3CCJ A;  2K52 A;  2OTL A;  1U0L A;  5J3B A;  1YZ6 A;  1Q86 C;  4YY3 Q;  2BH2 A;  1VS0 A;  4PZ8 A;  4NXN Q;  4UPA A;  2OTJ A;  1XNR Q;  3TRZ A;  2BA1 A;  3ULP A;  2BA0 A;  1HZB A;  1B70 B;  3W5O A;  4DV3 Q;  4POG A;  4GKK L;  4K0K L;  1T9H A;  5M5X H;  1YJN A;  2GVA A;  4R4C A;  4A3D G;  2KHI A;  4LF7 L;  4IFD G;  1TWH H;  3CC4 A;  3SGI A;  3S2H H;  1LYL A;  3VDY A;  4YCW A;  1AE2 A;  1WCM H;  3KJO A;  3OW2 A;  2KBN A;  3KDF B;  4JC0 A;  1B7Y B;  2GN5 A;  3G6E A;  5H1S E;  1VQ8 A;  2AMC B;  2PI2 E;  3ER0 A;  2E2I H;  2UXD L;  4PMW A;  1OXX K;  2D0P A;  3CAM A;  4EQ5 A;  5IYC H;  1CKN B;  1L0W A;  1WI5 A;  4B3M L;  4LF9 L;  1KIX A;  3T1H Q;  4BBS G;  1P8L A;  1HNW Q;  2UU9 L;  1N34 L;  2R93 G;  2CWP A;  2Q2H A;  5IYB G;  4DR6 Q;  1Q12 A;  1FJG L;  1IYJ B;  1XMO Q;  3W1G A;  1XNQ L;  4A3M G;  4BA1 I;  1LTL A;  4A93 H;  4L5T A;  3ERS X;  4AQY L;  1KRS A;  1D7Q A;  2KCT A;  1JJC B;  4A3E G;  1PH3 A;  4NB3 A;  2CKZ B;  3UDI A;  1N36 L;  3KLW A;  3UDX A;  1MKH A;  3HKZ G;  3PO2 H;  3HOX G;  1ASY A;  1K0R A;  2JJQ A;  4QJF A;  4PZ7 A;  1IBM Q;  5LMN Q;  1JB7 A;  3EIV A;  2KEN A;  4LF5 L;  4A75 A;  4GNX A;  3MEF A;  2IHE A;  1HNX L;  2PQA A;  4JI1 Q;  4A3F H;  3GTO H;  4JI2 L;  2ZTC A;  1VQN A;  1UE6 A;  1X6O A;  1SRO A;  3L2P A;  4OXP A;  5GAE C;  1QVF A;  3I4M G;  4JYA L;  1D8L A;  1VQB A;  4DR4 L;  2EXD A;  4HIM A;  1GKH A;  1A62 A;  1AE3 A;  3FKI H;  4LWC A;  2MO0 A;  2LSS A;  2XGT A;  5AJ3 Q;  4DV6 L;  4GOP B;  1XPU A;  4JOI C;  4YY3 L;  1BKB A;  1C9O A;  2VQE Q;  4QIW E;  1XNR L;  1OXU A;  2NN6 G;  2DUD A;  4AYB E;  4JI4 Q;  5C0X J;  1E1O A;  4X65 Q;  2WB1 G;  4JG2 A;  1NMF A;  2AHO B;  4UP9 A;  2I5M X;  5IP9 H;  3D0F A;  4DV3 L;  1EWI A;  1VCI A;  3S15 H;  4JBM A;  3M85 A;  4HIO A;  1FL0 A;  1CKM A;  1I94 Q;  4YCU A;  1X3E A;  1Y1W G;  1K73 C;  1WJJ A;  2JA5 H;  2UUA Q;  3HOY H;  1VQJ A;  3A5Z B;  1VQ9 A;  4OON A;  1J5E L;  3PUV A;  5C44 G;  2ID0 A;  1TWF H;  4GN5 A;  4P74 A;  2N8N A;  4GN3 B;  4DV5 Q;  3HOV H;  3H3V I;  4X62 Q;  4RG1 A;  2VZA A;  4TVA B;  4GLX A;  3HOW H;  2R6G A;  4OWX B;  1PH7 A;  3CC2 A;  2ALY B;  1HNW L; 
#chains in the Genus database with same CATH topology
 2IPK D;  2EXZ A;  4OO1 H;  5JEA G;  1IBL Q;  1BCP C;  2JA8 H;  1E2V A;  3B6Y A;  1L0Y B;  5E1F A;  1QIL A;  4OWW B;  3M7N A;  3NK9 A;  4OHJ A;  1EYD A;  3K5M A;  1HPC A;  3OWE B;  1D1K A;  3I7F A;  3VR4 A;  2BH8 A;  3GD7 A;  5M5X B;  1DD2 A;  5IYC G;  5IY0 A;  5JPM C;  2JA9 A;  1PRT C;  2CQO A;  1F9Q A;  3TP5 A;  4DAY B;  5FK9 C;  2KHJ A;  2V1C C;  4X66 Q;  1EZ6 A;  1DOM A;  4N8X 1;  5AJ3 L;  3CCM A;  1BF4 A;  4CDD C;  1PH5 A;  3P20 A;  4AYB G;  3FDT A;  5M5W H;  2XNA C;  2EY6 A;  3A74 A;  1VQF A;  3LWE A;  3H09 A;  2SEB D;  3MVV A;  3PIO 3;  3S16 B;  3ITP A;  5JOB A;  2HDL A;  1L1O B;  3PIO A;  2IJ0 A;  3OW7 A;  1GUT A;  2C9O A;  1PVO A;  2A6H C;  5TSS A;  4DAM A;  1ILQ A;  4X62 L;  2N55 A;  1AFP A;  3EVQ A;  1QVC A;  1V1P B;  1PFB A;  1EIF A;  3QO2 A;  4XTC S;  1QNK A;  2Z0S A;  4A3F B;  4ZKB B;  2UUB Q;  1Z6H A;  3K80 C;  3CCS A;  2PNH A;  4LJZ C;  1IBL L;  2F0M A;  2KJX A;  2F0K A;  2RCN A;  2F0O A;  2Z6K C;  3BDO A;  5IP9 G;  1NBW A;  3TSS A;  3KBX A;  2YTV A;  1C4Q A;  3S16 H;  1HTL D;  5FKA C;  1H9S A;  4MN3 A;  3F1Z A;  2FMC A;  3AU7 A;  3OIQ A;  1SE8 A;  4FXD A;  3OYY A;  3HP3 A;  1YIT A;  4OEL B;  4OO1 G;  2K50 A;  2YV5 A;  4X66 L;  1Y1V H;  4EQP A;  1EQT A;  1X3F A;  4RH6 A;  1TWF B;  4X3T A;  3CPW A;  4A3G G;  2JA8 G;  1VQA A;  2WAQ B;  4MHE A;  2ZJP A;  3M7G A;  3JC6 6;  2DNE A;  3TP6 A;  5L37 A;  3VR2 A;  2L0C A;  2LS0 1;  1O7I A;  2YTY A;  1DGS A;  3OTO Q;  5IGG A;  5EBC A;  2NTT A;  4GZY C;  3A8J E;  3WOF A;  4B3S Q;  3I8Z A;  3DXJ C;  3V96 A;  1KAB A;  1B44 D;  3KF6 B;  2EPB A;  1N32 Q;  3NEN A;  1H95 A;  1LT4 D;  2JK8 A;  2GVB A;  2B29 A;  3H6M A;  4LFC Q;  4LF6 Q;  3E6Z X;  1R9T H;  2SDF A;  1LTT D;  3FHW A;  2UUB L;  1Q82 C;  2NVT B;  1X9N A;  1CHQ D;  2F0P A;  1EFI D;  1ML0 D;  4C3J B;  5IP7 H;  1G6P A;  3WWV A;  5FJ8 H;  1A3U A;  1GUN A;  1KC8 C;  3FPU B;  2H4O A;  3J81 L;  1SRU A;  5JAV A;  1IBM L;  4DR2 Q;  1Q1B A;  2WAQ E;  5C4Z A;  2CVR A;  4Y7N B;  1QZH A;  3ULL A;  1BDO A;  4A4I A;  1XMQ Q;  3EQL C;  2NVT H;  2IT1 A;  3OIP A;  4QUF A;  4WJW A;  5D14 A;  2F0W A;  1KDA A;  4TQU S;  3SE0 A;  3NEM A;  4JBW A;  4XT3 B;  3J7A V;  4FXG C;  2K4K A;  3OTO L;  3M3Y B;  2A19 A;  2F0T A;  1K8A C;  1OXS C;  4B3S L;  4L5S A;  2D62 A;  1WTX A;  5IT9 c;  5IT9 E;  3RNU A;  1RF2 D;  1I94 L;  1EYG A;  5HGT A;  4IQZ A;  4ILW A;  1N32 L;  1WTO A;  1ZXT A;  1TY0 A;  4R8N A;  4Y7N H;  1N33 Q;  1Y1V G;  1E1T A;  4LUV A;  2QW7 A;  5CBA E;  2RDF A;  1MIU A;  2NVX H;  4PNY A;  4LFC L;  1TS5 A;  4RGM A;  4LF6 L;  1JWS D;  1JJG A;  4KI0 A;  1J6Q A;  1W3S A;  3F2D A;  1GO3 E;  3T4A C;  4KD4 A;  1X32 A;  4UP8 A;  3CC7 A;  1RDP D;  3CQZ B;  1WYD A;  3M3Y H;  2CH4 A;  5IOC A;  4HJA A;  1AZP A;  4APV A;  1FNU A;  1O78 A;  2CFM A;  2F0F A;  4LMQ D;  5GAG C;  4E6I A;  3CF5 A;  3RLN A;  4K8J A;  1J5E Q;  1CA6 A;  1LO5 D;  2A8V A;  1RHP A;  2B63 B;  2KCM A;  5ISR A;  4DR2 L;  2JA6 B;  4UAI A;  1EFW A;  4CKB A;  4HJ9 A;  2YU9 B;  1QZG A;  3GTL B;  2R7F A;  1ENC A;  1XMQ L;  4JI6 Q;  2VNU D;  3CQZ H;  2SNM A;  5IP7 G;  3J7A 5;  1ONL A;  2K5D A;  3NPP A;  2C35 B;  3SK6 A;  5FJ8 G;  1VQM A;  2OTL A;  3J80 i;  1DOL A;  1UWV A;  4UP7 A;  5D65 A;  1QJO A;  3UE0 A;  2E8G A;  2K5H A;  4A3M B;  3EBE A;  3AEV A;  1LT6 D;  2DN8 A;  5LL6 S;  1UE1 A;  5I9P A;  2JA6 H;  1SNM A;  1ASZ A;  4IFD H;  2O5I C;  3AFP A;  3HKZ B;  1N33 L;  2HIV A;  1Y8N B;  4B9W A;  1NAP A;  3PUY A;  4DR3 Q;  1U5K A;  1EYA A;  1X55 A;  1EIH A;  1Z9F A;  2AQ1 B;  1YBY A;  1LUZ A;  4LFB L;  1VQL A;  4YWM A;  5IYB H;  2EDG A;  5CYU A;  2IX3 A;  4A3M H;  1EQV A;  4K2L A;  4GNX C;  4TRD A;  1VQ7 A;  2MQH A;  1NR4 A;  1SMY C;  4JPB W;  4A3E H;  3UE1 A;  3GTG H;  2F0V A;  3CU7 A;  5C4H A;  1Q8K A;  1QUQ A;  3STB D;  4OO1 I;  2L5T A;  3CHB D;  2K5N A;  3HEJ A;  5J22 A;  1ICF B;  2DY8 A;  1EU4 A;  3WDN A;  3I70 A;  4B3M Q;  4LF9 Q;  1CM9 A;  4ZCK A;  4JI6 L;  3M4O B;  1W2B A;  3E9H A;  3JAM c;  3JAM E;  1G51 A;  4XYO A;  4GN4 B;  3I55 A;  1AP0 A;  4R4T A;  2WP8 J;  4TSS A;  2I5L X;  1PTO D;  2KVM A;  1CSP A;  1N36 Q;  1I6V C;  5I4D A;  3NBH A;  1EYC A;  2QEJ C;  2WV6 D;  4AIM A;  4J1M A;  5JJL A;  3L7Z C;  3X3N A;  1WCM B;  5HUR A;  2E2I B;  3V2T A;  3NUC A;  1PHJ A;  2RKS A;  2WAC A;  4HR7 B;  3MFG A;  4DR3 L;  2CHB D;  3M4O H;  2EY2 A;  1V1O A;  1VQ6 A;  1EY7 A;  1U0L A;  2VXW A;  2BH2 A;  4P2C B;  3I3C A;  2OTJ A;  1JC7 A;  1M8A A;  2AUJ D;  2BA0 A;  4FF3 A;  5EKI A;  3W5O A;  4FF2 A;  1HQR D;  1VF7 A;  4HTH A;  2EOT A;  1EL0 A;  4IFD G;  1DON A;  5CR3 A;  4CGY B;  3SGI A;  3PO2 B;  3S9W A;  3C1E A;  1LYL A;  2EE1 A;  3DWP A;  1WCM H;  3KJO A;  2KBN A;  4JC0 A;  3G6E A;  1VQ8 A;  2PI2 E;  3Q0A A;  2E2I H;  3CAM A;  3VR6 A;  5E3F A;  1L0W A;  4RAU C;  4B3M L;  4LF9 L;  2Q8T A;  1EEI D;  5IYB G;  2JA7 B;  2AQ2 B;  1IYJ B;  1XMO Q;  4A3M G;  1GJX A;  4BA1 I;  1IYU A;  1CTM A;  2EYF A;  4BBS B;  2DNC A;  4A3E G;  1BCP D;  2Z1C A;  2CKZ B;  1N36 L;  3UDX A;  3HKZ G;  5KEE A;  3PO2 H;  1JB7 A;  2JA5 B;  4A75 A;  2B2T C;  3MEF A;  4WFN 3;  2IHE A;  1STG A;  3LX0 A;  4KKS A;  2ZTC A;  1VQN A;  3HOV B;  3BG3 A;  1D8L A;  4HIM A;  2JA7 H;  2MGS A;  4K14 A;  3SEB A;  2VQE Q;  3GV6 A;  1B2T A;  1I4Q A;  4QIW E;  2A68 C;  2E2H B;  4HAE A;  4X65 Q;  2AHO B;  2I5M X;  1EWI A;  1VCI A;  1K73 C;  5EKL A;  3I4L A;  3M4Y A;  2JA5 H;  2UUA Q;  5JPN C;  1F2Z A;  3SR1 A;  1VQ9 A;  2WB1 B;  3KBG A;  2B2Y A;  3IFD A;  3AMU A;  3HOV H;  1D5X C;  4RG1 A;  3NXW A;  4OWX B;  3S2D B;  1QCB D;  3E0E A;  1GUS A;  2EYJ A;  4YWK A;  3N52 A;  1XMO L;  5A2Q L;  5CBE E;  2L4N A;  1SNO A;  2OCE A;  1EQQ A;  3RLO A;  4DUY L;  1JJ2 A;  5F2D A;  2EY5 A;  1A63 A;  2MP1 A;  2LXK A;  1KQS A;  1O7Y A;  5ELD A;  1OXT A;  2UXB Q;  3U50 C;  2B3G A;  3SK8 A;  3VR3 A;  1BQQ T;  1LTB D;  2NWG A;  4L63 B;  5DNF A;  3J80 E;  1WTW A;  4IUN A;  2L12 A;  1UE5 A;  5FO8 B;  4QUC A;  3UDF A;  2MHV A;  3S2D H;  1HFG A;  1SE2 A;  4IPD A;  5COR A;  2VQE L;  2X6L A;  3MXN B;  3CRK C;  3W2D A;  4QF4 A;  1YHB A;  1GD7 A;  2XRQ D;  2E75 C;  4X65 L;  5M3F G;  4X3K A;  3PO2 G;  3A0J A;  1HZA A;  1KLG D;  2L55 A;  2VS1 A;  2WB1 E;  4RFB A;  4GOP C;  4HID A;  1VQP A;  1C48 A;  1WD1 A;  3ND9 A;  2UUA L;  5BN5 A;  4H02 A;  1I5F A;  2P5Z X;  2SNS A;  2JA7 G;  1OXV A;  1I4P A;  4DR7 Q;  4UHV A;  1HQM C;  4JW0 A;  3PV0 A;  4PV1 C;  2OT2 A;  4DV1 Q;  4JBK A;  3CCV A;  2JE6 I;  4WOR A;  2IHF A;  3HOU G;  1SND A;  4XQN A;  3Q8D A;  1KRT A;  2JA5 G;  2XN9 C;  1GVP A;  4EQO A;  5CGK A;  1EY5 A;  4MTK A;  3EJI A;  2J4X A;  2EYL A;  2K5W A;  2BE5 D;  2RCF A;  3S15 B;  2A6E C;  3HOV G;  1SNQ A;  1ZYR C;  3U4Z A;  3V05 A;  1ROD A;  1TQO A;  3MXP A;  2UXB L;  2KHS A;  3D6W A;  4KN4 C;  2H5X A;  4DNT B;  1M90 C;  1ESR A;  3DEP A;  2Q2T A;  2OWO A;  1TKW B;  4A3C H;  3QG1 A;  1TWG H;  5C4J H;  3PMF A;  1S72 A;  5M9O A;  1TVX A;  2XRS D;  3QJY A;  4PG3 A;  4DV7 Q;  1O7Z A;  4NXN L;  1H9J A;  4DXG A;  5CMD A;  4A3G B;  4O0A A;  1N8R C;  4IFD I;  5HGQ A;  1GM5 A;  5FO7 B;  1EQR A;  2D5D A;  1A2U A;  2Q8I B;  2JEA I;  4B08 A;  1DZ1 A;  4Q5V A;  1ZKO A;  1AN8 A;  4DXF A;  3PIP 3;  3K6O A;  4QY7 A;  2E5L Q;  2K28 A;  3PIP A;  3IRB A;  2O5J C;  4DR7 L;  1FR3 A;  4N9T A;  4YCV A;  5AFW A;  3SK5 A;  4KHZ A;  1JOK A;  1L1O C;  1STA A;  5FLX L;  1HRJ A;  2NTS A;  4DV1 L;  4DN4 M;  4HIK A;  1F2L A;  5DAU A;  3Q23 A;  3MXG A;  3H3V H;  1LAB A;  3NTH A;  1K8O A;  4NMZ A;  1S5D D;  1GUG A;  1U4P A;  2WIN B;  4JBJ A;  1WOC A;  3Q22 A;  4A3I B;  4CDF C;  3RN2 A;  4A3G H;  1RIP A;  4IUQ A;  4FVM A;  5M5W B;  2HDM A;  4MNO A;  5D3I B;  3MA2 B;  2K03 A;  2H1E A;  3CME A;  3R2T A;  1SFO H;  1HHV A;  1PTO B;  2VQF Q;  3UDG A;  3HS0 C;  1CQV A;  4KHP Q;  2QDL A;  3DM1 A;  1K9M C;  4C3I B;  1CK1 A;  5CV8 A;  4LFA Q;  1YHQ A;  2X69 A;  2XVS A;  5I2X A;  3RLF A;  1YVC A;  1TWA B;  2JEB I;  1Q46 A;  2FHT A;  2ICI A;  2PYK A;  2F0U A;  1NSN S;  3GO5 A;  4DR1 Q;  1E24 A;  1JQY D;  1SNP A;  4A3I H;  5C3W A;  5JEA J;  5E4W C;  4QQB X;  1LTG D;  4DV7 L;  1SYB A;  4IPC A;  4IPH A;  5EPK A;  5CV4 A;  3FEW X;  3H0G B;  1K83 H;  2PMZ B;  2EVB A;  1EY6 A;  3AQQ A;  3U9S A;  2NZ1 D;  1PTO H;  2NVY H;  2Z6K A;  1VQG A;  2EIF A;  4ID6 A;  1SE3 A;  4CDE C;  3MZ5 A;  1F2M A;  2E5L L;  3R2I A;  2ICE C;  3LWU A;  4C3I H;  5GAH C;  3K8A A;  4X6A H;  1E7Z A;  1CUK A;  4ULL A;  1WTV A;  3AB9 A;  3L9A X;  4Z9C B;  4A3C G;  1TWA H;  4FDB A;  5ELN A;  1B9N A;  4EX5 A;  3SVM A;  1SXT A;  3KOJ A;  2CW0 C;  2F0J A;  3W1B A;  1NE3 A;  4U68 A;  1X3G A;  2UXC Q;  1Y1V B;  5COY A;  1B8A A;  1ESF A;  1VMC A;  1KNE A;  2A74 C;  5I6Y A;  3H0G H;  4OX9 Q;  3GTM B;  3I4O A;  4JCV E;  1ENA A;  1V43 A;  2WFW A;  5IOD A;  2K01 A;  3K5N A;  2SOB A;  5EPJ A;  3R3O A;  2VQF L;  1K3R A;  2J7Z A;  1BCP B;  3JAM i;  2KUM A;  4KHP L;  4CKC A;  1BBX C;  1R4Q B;  1SSO A;  4ZKC B;  4K5V A;  4LFA L;  1CHP D;  4OIK A;  1EIG A;  1NR2 A;  4DAP A;  5JJI A;  1VQI A;  4HJ8 A;  2K05 A;  4DR1 L;  2EJF C;  1WD0 A;  3N6R A;  3ZYY X;  5EJW A;  4JV5 Q;  3BZD B;  1I4H A;  2PMZ E;  5M5Y H;  2D2C C;  3GTM H;  1R9T B;  1HJP A;  1HXY D;  5K5P A;  2ZTE A;  3FP9 A;  3TS0 A;  1QE6 A;  4KKT A;  2NZO A;  2ASB A;  1NMG A;  5BN3 A;  2R7Z G;  3KF8 A;  5KNB A;  1STY A;  2RBM A;  2K04 A;  2UUC Q;  4A3D H;  2ZM6 Q;  1VQC A;  2FXQ A;  3K58 A;  1V9P A;  2N49 A;  3OHX C;  4O1N A;  2G9D A;  3I73 A;  1C7Y A;  3HOZ G;  1Q81 C;  3EA6 A;  1STH A;  4Q0F A;  4A3I G;  4GKJ Q;  3GDE A;  1IL2 A;  2UXC L;  5T1I A;  1EZ8 A;  2AUK A;  1BBU A;  3C3L A;  2Z4I A;  4BS9 A;  4OX9 L;  3KUP A;  1PXU A;  4GKK Q;  1TII D;  3J80 L;  2QEX A;  4C3I G;  1IW7 C;  3NHH A;  1YNJ D;  2QCP X;  5ELO A;  4HSP A;  1Y8O B;  2OEO A;  1NUC A;  3I91 A;  5GAD C;  2IX1 A;  2Q8R E;  3SXH A;  2F0S A;  4XIG S;  4C56 C;  5IGC A;  1XPO A;  2OQ0 A;  1JE4 A;  2ZXO A;  5JVG 3;  1H9K A;  4YWL A;  5C44 B;  1FGB D;  2NVX B;  3LNN A;  1JIC A;  1N34 Q;  2RQX A;  1UE7 A;  3H0G G;  4JV5 L;  2QA4 A;  1XNQ Q;  1VQK A;  2NN6 I;  2AKW B;  1HUN A;  4KV6 A;  1KHI A;  4KY5 A;  4AQY Q;  3PUZ A;  3M4Q A;  3ZJY C;  4DAV A;  2NB0 A;  1N9W A;  1XJV A;  3U58 A;  4F7X A;  1EUJ A;  4HCE A;  2UUC L;  2ZM6 L;  4IPG A;  4XT1 B;  2HQL A;  1Y1W H;  1BBW A;  4RGO S;  1H9S B;  3TP8 A;  1KXL A;  2QDB A;  4DA2 A;  2BCO A;  3T13 A;  4DFA A;  5C44 H;  4JYA Q;  2N88 A;  5JJK A;  4DR4 Q;  1NTG A;  1LAC A;  2I5H A;  2YYZ A;  4GKJ L;  3D8G A;  3CCJ A;  4NW2 A;  4YY3 Q;  4CJ0 B;  1UAP A;  1KAA A;  3SHL A;  3TRZ A;  1T5E A;  4DV3 Q;  4POG A;  4GKK L;  5EPL A;  1D5M C;  3OMG A;  4A3D G;  4R4C A;  1UEA B;  4FF1 A;  4MIU A;  1AE2 A;  1YNN D;  2WII B;  2A69 D;  1J9O A;  3T1H Q;  1G8Z D;  2B2W C;  4RGT A;  1N34 L;  2R93 G;  1XNQ L;  2NYZ D;  2EYP A;  2PZU A;  1LTL A;  4A93 H;  4L5T A;  1JWM D;  4AQY L;  2XWB B;  1KRS A;  3VYS A;  3HG9 A;  3UDI A;  4X3U A;  1ASY A;  4ZLT F;  4QJF A;  4NKL A;  1X3P A;  4HMI A;  3A8I E;  3E5S A;  4GNX A;  1TS4 A;  4A3E B;  3GTG B;  3C46 A;  2PQA A;  3NSW A;  4JVZ A;  3GTO H;  3NQT A;  4JYA L;  3L2P A;  4DR4 L;  1GKH A;  3MC0 B;  3FKI H;  1XPU A;  2LSS A;  3VA7 A;  4JOI C;  4YY3 L;  1BKB A;  2F0L A;  3FPP A;  4J6H A;  1C9O A;  3T56 B;  1JWU D;  2FJ2 A;  2DUD A;  4JI4 Q;  5C0X J;  2O4X A;  3QWN A;  4UP9 A;  1NMF A;  4DV3 L;  3K5O A;  4K8I A;  2K1B A;  4JBM A;  3U9O A;  3Q6S A;  1QOH A;  4YCU A;  4K6D A;  1Y1W G;  3HOY H;  1EY9 A;  2B2V C;  1J5E L;  3DWQ A;  3PUV A;  5C44 G;  1KDC A;  3D6C A;  4P74 A;  2N8N A;  2PNR C;  3H3V I;  5D3D A;  1XYI A;  3GTJ B;  3HOW H;  1C8C A;  1RCV D;  1DXM A;  3T1H L;  3T16 A;  3BS1 A;  4YHH Q;  4IUT A;  4C1N I;  1QG7 A;  2B8F A;  4PQX A;  2FFK B;  4V0B A;  1M1K C;  1XWE A;  2E2J B;  3UI2 A;  5CV6 A;  4WJ3 M;  1MJE A;  3TME A;  2Q2I A;  2NBF A;  1IZ6 A;  3HKZ E;  3TZD A;  1KAW A;  4RMF A;  1TS3 A;  5IGF A;  3BJU A;  1ENF A;  1JR0 D;  3GTJ H;  2RVL A;  4RHR A;  3T1Y Q;  1F9P A;  3LGJ A;  2K75 A;  1ZYR D;  3QR8 A;  5JJZ A;  3CCE A;  4BA2 I;  4BBR B;  2ES2 A;  5A35 A;  4L5Q A;  1YHA A;  3O13 A;  2LXJ A;  4A93 G;  4IZ8 A;  2ENB A;  4NDX A;  2E2J H;  4ZYS A;  3PUX A;  4JI4 L;  2VUM G;  1K8G A;  4DF7 A;  4J8Q A;  1BNZ A;  2RHS B;  4AH6 A;  4DR5 Q;  3HZX A;  1SEB D;  4DK0 A;  1VQO A;  1PH8 A;  4G7H C;  4IAL A;  1HZC A;  4U67 3;  1HA5 A;  4JI5 Q;  1B50 A;  4RKL A;  5KYL A;  3HFZ B;  3S24 A;  2K5Q A;  4NXM Q;  3URY A;  2BDO A;  2JXM B;  1GOZ A;  4TKO B;  5M3F B;  3DM3 A;  5KND A;  1WTH A;  1DJR D;  3NWS A;  1U4L A;  2PCF B;  1B4O A;  3FKI G;  5GQO A;  4CDC C;  4BBR H;  4A3J G;  4IJH A;  2AWN A;  4A3B H;  1K3B C;  1G91 A;  3I4N H;  4IJL A;  4YHH L;  1FGU A;  2B2T A;  3OWF A;  5C6A A;  3BDL A;  2MJ8 A;  2QGQ A;  1OTC A;  2HHH Q;  2DY7 A;  1Q1E A;  1TT2 A;  3MXU A;  1I4G A;  3S1R B;  3ERQ A;  4ZQ3 A;  2KOL A;  1J8I A;  1LTI D;  3HOY G;  2F0H A;  4LF4 Q;  1Y14 B;  1O80 A;  3BVM A;  5M3F H;  1QVG A;  3HOU B;  4H44 C;  2JQO A;  3CD6 A;  4V19 0;  3HOW G;  3AYH B;  1JCK B;  3T1Y L;  3TDQ A;  3F2C A;  4LUZ A;  3A55 A;  1SLJ A;  4OWT B;  4LUO A;  1E22 A;  1QUQ B;  1YJW A;  2MFI A;  1I3Q H;  4HED A;  1PRT D;  1V1Q A;  1V8Q A;  4HJ5 A;  3S1R H;  3I2Z A;  1H9R A;  1WVL A;  4B3T Q;  4DR5 L;  1PZI D;  1E3P A;  3KDF A;  2DJG C;  4JI5 L;  3HOU H;  1JOQ A;  2I07 B;  5C4X G;  1Y8P B;  1F77 A;  1NCV A;  4R9W A;  4NXM L;  1CKN A;  4BXX H;  4ME5 A;  2VB2 X;  1RTN A;  4DV2 Q;  2EYM A;  5IGB A;  3NBH B;  1GXD C;  5KYI A;  1CSQ A;  3TN2 A;  3K57 A;  2E74 C;  1JE5 A;  5DM7 3;  1YI2 A;  3CW2 C;  2L11 A;  1VQH A;  2A6H D;  3CRL C;  3ICE A;  4OGQ C;  5LMN W;  4IOA A;  3TRE A;  2KED A;  3P75 A;  5IT9 L;  1C0A A;  4K6L A;  4LF4 L;  3H94 A;  2HD3 A;  3QOJ A;  2K5V A;  3BZK A;  4PZ6 A;  4ZRZ A;  5KIX A;  5KNC A;  1MI2 A;  2G9H D;  1S3O A;  2L1B A;  1CZW A;  2ZT9 C;  3U4V A;  1LTS D;  3KFU A;  2B2U C;  4WJ4 A;  2XTI A;  3S17 B;  4BBR G;  1G2T A;  1I50 B;  4A3B G;  4ALP A;  4GOP A;  3I4N G;  3D4W A;  4IO9 A;  2ZXP A;  4KKU A;  3MWY W;  4JK1 C;  1PH2 A;  1E2W A;  3BU2 A;  3CCQ A;  1PFM A;  5DLQ E;  1STN A;  1NY4 A;  4B3T L;  1PH9 A;  1HNZ Q;  3KLS A;  2LY7 A;  3BVZ A;  3ERO A;  3L0O A;  4ODG A;  4RKB A;  2NUC A;  4G4K A;  4P71 A;  4CJ1 B;  5EAY A;  2FIN B;  2HCC A;  3PSI A;  4HJ7 A;  3S17 H;  1LT5 D;  1I50 H;  3H3V C;  3A7L A;  1AW7 A;  4C2M H;  4DUZ Q;  4DV2 L;  1E2Z A;  5ELF A;  1HR0 W;  5KGU A;  4G7Z C;  3J81 c;  3J81 E;  1SYC A;  3PUW A;  1A8V A;  1S40 A;  4RA8 A;  5E7N A;  1EEF D;  1KLU D;  3S14 B;  2R92 B;  1TS2 A;  5C3E H;  1VQ4 A;  1GUO A;  1PMR A;  1RKN A;  3M4P A;  1TWG B;  5C4J B;  2YTX A;  4RCN A;  4BWG B;  2DGY A;  4BY7 G;  1S5C D;  4NPS A;  2QKI C;  3QOL A;  4R8I A;  3STB C;  4GLV B;  1BUV T;  4BXX G;  1UNS A;  1IL8 A;  4DAY A;  1ET9 A;  4IOC A;  3L3O C;  1PA6 A;  4FXK C;  1G29 1;  2JYO A;  1EWH A;  2HT1 A;  3D31 A;  4ZUJ A;  3KJP A;  5LMU Q;  1SBB B;  3S14 H;  4GS3 A;  2R92 H;  3PQI A;  4JI3 Q;  1PTO C;  1XTD A;  4KD3 A;  3F8T A;  3GTQ B;  2MUY A;  2KCC A;  3MAQ A;  1PFS A;  4A3L H;  1PH6 A;  2RHQ B;  1L1O A;  1CA5 A;  4UDU C;  1HNZ L;  1B3Q A;  1S5F D;  2MPM A;  1JB3 A;  1V1P A;  4DUZ L;  1TWC H;  1SFO B;  1G2S A;  3HOX B;  4KHV A;  4Y52 H;  4C3H B;  5IE8 A;  2A5H A;  2EQS A;  4K5W A;  1VQ5 A;  4L5R C;  4HN7 A;  5CV9 A;  3JAM L;  2R7Z B;  3T51 B;  4F88 A;  3GTQ H;  1ET6 A;  2HIX A;  1EWC A;  4I7A A;  3J7Y W;  2X6G A;  2EZV A;  3K7U C;  3A54 A;  2VL6 A;  3K81 C;  2HUG A;  1XXG A;  3R93 A;  3H15 A;  1Z47 A;  3HOZ B;  3DEO A;  5HY6 A;  1LLR D;  1U9R A;  4K0K Q;  3CPF A;  2KEC A;  3DHQ A;  1EOV A;  2Z6B A;  3BYT B;  4FNF A;  4IUP A;  1QNU A;  2F3W A;  5C3X A;  1K83 B;  1LTR D;  1Q3L A;  3A5U A;  1SR3 A;  3PF4 A;  3HOX H;  4C3H H;  2NVY B;  2EJG C;  3RZD B;  2R7Z H;  1S5B D;  5LMU L;  1K8M A;  2XIW A;  5C3E G;  2HCI A;  3FVQ A;  4JI3 L;  5G3L D;  4DNI A;  1FJG Q;  1EY0 A;  3MEH A;  3HOZ H;  1GUW A;  1PV4 A;  1HFN A;  1PH4 A;  3KYH C;  1JOO A;  2KCN A;  1GHK A;  3TEH B;  1FD7 D;  4H13 C;  3KF6 A;  3BZC A;  5JVH 3;  2PW5 A;  3G48 A;  3RN5 A;  3MFY A;  1EIY B;  3GV3 A;  3ND8 A;  4POF A;  2MNA A;  3ULJ A;  1TWH B;  1X65 A;  2A1A A;  1MJC A;  3HRZ C;  1YNX A;  3RZD H;  3E3X A;  1OO9 B;  4CJ2 C;  2R92 G;  1MHW C;  1PYB A;  4JI2 Q;  5GRO A;  1Q8I A;  4A3L G;  1A15 A;  4EGV A;  4DNR B;  5J3B A;  1YZ6 A;  2D9U A;  1Q86 C;  1F9S A;  3NE5 B;  2KA7 A;  1D1I A;  4UPA A;  4RCO A;  1XNR Q;  2BA1 A;  3QB3 A;  2B39 A;  4KY6 A;  1I4X A;  4KTA A;  5ELB A;  4K0K L;  5M5Y B;  4XQJ A;  5M5X H;  1K0S A;  2XWJ B;  2XSC A;  2AQ3 B;  1TWH H;  3CC4 A;  1SJE D;  5C5M A;  4XXE A;  4YCW A;  1B7Y B;  2GN5 A;  2QIL A;  4PMW A;  4A3D B;  1SMY D;  1FNW A;  4EQ5 A;  3WOE A;  3OOC A;  1HNW Q;  1P8L A;  4ZUI A;  3DWA A;  4H0L C;  2CWP A;  2Q2H A;  4DR6 Q;  3RZO B;  2PZW A;  1CZG A;  1FJG L;  4HMJ A;  1EY4 A;  4ABN A;  3C1F A;  3ERS X;  2E2D C;  3P1H A;  2J0T D;  2KCT A;  1JJC B;  1PRT B;  4NB3 A;  2QF7 A;  2R93 B;  1JOR A;  3HOX G;  1K0R A;  2JJQ A;  2EJM A;  4C3H G;  4RWS C;  4PZ7 A;  1IBM Q;  5LMN Q;  2A73 B;  3EIV A;  3R8B A;  1FYC A;  2KQ3 A;  3FMC A;  1A3T A;  4JI1 Q;  4A3F H;  2VB3 X;  4JI2 L;  3K5L A;  1X6O A;  1QVF A;  1SRO A;  4OXP A;  5GAE C;  2JP1 A;  2Z9H A;  4S3S A;  1A62 A;  3RZO H;  3TBI B;  2MO0 A;  1ICW A;  2EYO A;  2K7V A;  4NP5 A;  1XNR L;  4CKE A;  3MHB A;  1E1O A;  3NWT A;  4DGZ A;  4JG2 A;  2R93 H;  2F3V A;  3D0F A;  3D3R A;  3M85 A;  4HIO A;  5IIF A;  3A56 A;  1I94 Q;  1QB5 D;  1MSH A;  1VQJ A;  5J1Z A;  4OON A;  2K32 A;  1TWF H;  4GN5 A;  4DV5 Q;  4GN3 B;  3PO3 B;  2VZA A;  4GLX A;  1Y1W B;  1PH7 A;  3CC2 A;  2ALY B;  1HNW L;  2RSO A;  2IW3 A;  4X3S A;  4DR6 L;  4RGN A;  4X64 Q;  5FOB B;  3TS2 A;  1Q90 A;  1YEZ A;  3G71 A;  1LTA D;  1HR0 Q;  2F0D A;  1U4R A;  2BE5 C;  3MTS A;  5C0X H;  5EBD A;  1SJH D;  2Z8L A;  3A7A B;  4R4O A;  1XTC D;  5EKK A;  4XYQ A;  1IYV A;  4R1J A;  2PPB C;  1MBY A;  1EU3 A;  3X3M A;  3K0X A;  4P75 A;  1I6H B;  5LMN L;  1PH1 A;  2NVQ B;  1X56 A;  3PO3 H;  1MGS A;  1RTO A;  3D4D A;  4JI1 L;  3PF5 A;  2E76 C;  1A6X A;  4DK3 C;  1IXR A;  3F2B A;  5KRU A;  1A2T A;  4K5X A;  4O42 A;  4C3J H;  4I65 A;  4MTN A;  3FRP B;  1TXY A;  1B53 A;  1IBK Q;  1PLF A;  3CP0 A;  3I56 A;  2IX0 A;  3GQB A;  2B2W A;  4KMU C;  1VQE A;  3TZU A;  4R4I A;  4QL5 A;  4QGU A;  2PO4 A;  5A2Q E;  4A93 B;  2F52 A;  3BVG A;  5LL6 X;  3CMA A;  1I6H H;  2A68 D;  1HA6 A;  2NVQ H;  5EGT A;  3TP7 A;  4IUR A;  2VUM B;  4A3F G;  2V4D A;  2DJF C;  2F0Q A;  2CQA A;  2PI2 A;  3KF8 B;  3NTI A;  1A3V A;  4DV5 L;  3F2U A;  2I46 A;  1M4V A;  4BY1 B;  1PYS B;  1WFQ A;  2NZH A;  5IYD H;  2VY3 A;  2OF1 A;  3GTO B;  1AH9 A;  1KTK A;  4LFB Q;  4X64 L;  1HR0 L;  1F9R A;  3HGB A;  3FKI B;  2M9V A;  3I72 A;  4A3J B;  5I9O A;  3SDZ A;  4KJO A;  1KL9 A;  1MSG A;  4DV4 Q;  4JOI A;  3D4R A;  1SDF A;  3VYT A;  3G4S A;  1B1Z A;  2VUM H;  3G7L A;  3NBI A;  2WAQ G;  1BOS A;  1SMX A;  3KLR A;  5M3M B;  1BR9 A;  2Z4H A;  3HOY B;  3G6J B;  4H7B A;  2F0I A;  3Q24 A;  1O7L A;  1II3 A;  4BY1 H;  4A76 A;  2B2V A;  3RR5 A;  1NNX A;  1T5X D;  2OQK A;  1L0X B;  1PTO F;  4B3R Q;  1UUP A;  5C0X G;  3E9I A;  3HOW B;  3EN2 A;  4LK1 C;  4IUV A;  1LM0 A;  4A3J H;  1RD9 D;  4L8J A;  1IBK L;  2LKV A;  1U4M A;  2B8G A;  3J81 i;  3PCO B;  2B63 H;  3PO3 G;  3GTK B;  1W6K A;  2WKC A;  2R7D A;  4ZAI A;  5M3M H;  2CCZ A;  1HTP A;  2YU9 H;  3BYY B;  3GTL H;  4L6T B;  2N78 A;  4DK6 C;  4LNQ A;  1TY2 A;  3CCU A;  5T1G A;  1VF5 C;  4C3J G;  1UEB A;  2Y0S B;  1D6E C;  4LAA A;  1XPR A;  3DLL A;  5C4X B;  4QMG A;  5IGE A;  4C1N K;  1YIJ A;  5FLM H;  4KN7 C;  2LFN A;  5ELC A;  3NEL A;  1KNA A;  2ZJQ A;  1CT1 D;  3OPO A;  1SAP A;  1R4P B;  2ZTD A;  3TQY A;  3IAY A;  4DV4 L;  4DV0 Q;  1PDQ A;  3GTK H;  4OIJ A;  4HCS A;  2CH4 W;  5FO9 B;  3KK7 A;  1ILP A;  2F0N A;  5CC4 A;  4LW1 A;  1F2Y A;  2PZT A;  3RMH A;  4A3K B;  2Q2U A;  5C4X H;  2EY1 A;  5IYD G;  1W6J A;  4DPG A;  1PYW D;  2JN4 A;  1CFM A;  2A6E D;  4WRD A;  1STB A;  5LHY 1;  2R61 A;  3HKS A;  4B3R L;  1BCP F;  2D0O A;  1KD1 C;  2LMC B;  4A3B B;  1SN8 A;  3I4N B;  3S1Q B;  5FLX c;  3CCL A;  5FLX E;  1IKM A;  3NQI A;  4P72 A;  4DU9 A;  5BR8 Q;  4KK7 A;  5K36 H;  1B3A A;  1CQF A;  1AEX A;  1S4Z A;  4M8A A;  1YJ9 A;  4OL7 A;  4N9P A;  4DK1 A;  2ATW A;  3I90 A;  2Y0S E;  3AFQ A;  4CBV A;  4F87 A;  1PRT F;  3IFT A;  4BY1 G;  4A3K H;  4JI0 Q;  4PMB A;  1NJI C;  4GLA C;  1SNC A;  1CI3 M;  1JMC A;  2RDG A;  4EVO A;  5I6W A;  1HZ9 A;  3PGZ A;  4GNX B;  5IWA Q;  4G57 A;  2PQA B;  3S1Q H;  2VW9 A;  3ONA B;  1BXT A;  3OSO A;  1SYD A;  1I4R A;  1I3Q B;  3NTK A;  3GTP B;  1STE A;  1BVS A;  1YNJ C;  4JI8 Q;  2B63 G;  4QIW B;  5DEH A;  3VYU A;  2F03 A;  2JA6 G;  3K7A B;  4N8F A;  5EQ0 A;  5M3M G;  4DV0 L;  3H91 A;  2RSN A;  1JT8 A;  2G5D A;  2HQE A;  3VA5 A;  1LV9 A;  4KY7 A;  4BY7 B;  4IFD J;  1ZEQ X;  3J7Z C;  2ZJR A;  1RL2 A;  5NUC A;  1VQD A;  2OXP A;  1G6Z A;  3MXN A;  2RDH A;  5FLM G;  5DM6 3;  1X54 A;  4JI7 Q;  2KEE A;  2F1M A;  2PQE A;  1S5E D;  1RJT A;  3GTP H;  2RF4 A;  2GA4 B;  5CV7 A;  5IGD A;  3S1N B;  3E0J A;  2F0E A;  5BR8 L;  4DUY Q;  3K7A H;  1DYQ A;  1K28 A;  4FF4 A;  3VYR A;  3QIA A;  1SYF A;  1HH2 P;  2IWH A;  2F4V Q;  4ZK9 B;  2CWA A;  1DM0 B;  4F8M A;  2Y0S G;  4P73 A;  4BY7 H;  1TR5 A;  3S1M B;  4JI0 L;  3M9B A;  4ME3 A;  1SYG A;  1VMP A;  1FVI A;  1GHJ A;  1DOK A;  2F0G A;  4I7Z C;  4HSV A;  4LF8 Q;  2F3I A;  5IWA L;  1H9M A;  2B2U A;  1MD2 D;  4UY8 C;  3W3A A;  2PW7 A;  4PMC A;  3C2P A;  5K36 G;  3S1N H;  1WTR A;  2JSO A;  4BBS H;  3I4M B;  1SYE A;  4JI8 L;  2HHH L;  2CW0 D;  4KLK A;  3J81 j;  1YNN C;  3P7J A;  1CKO A;  2K6A A;  4LF7 Q;  4A3K G;  2K33 A;  1WTP A;  2A69 C;  3S1M H;  4J15 A;  3CKI B;  4XDX A;  3J7A F;  1P16 A;  2N3S A;  3K59 A;  3GP7 A;  3RD4 A;  2AWO A;  4OEM B;  2UXD Q;  1L2F A;  1Q7Y C;  4C2M B;  5C0X I;  4JI7 L;  2L15 A;  2UU9 Q;  2E2H H;  3I4M H;  1D5Z C;  1E0B A;  2M00 A;  5ELE A;  1A0I A;  1XX8 A;  2L9H A;  5C3E B;  2C5C A;  3CXC A;  4M1U B;  1FNV A;  3CCR A;  1WCM G;  2B2Y C;  2MO1 A;  2NN6 H;  3OMC A;  4MZ9 A;  4IN3 A;  2IY5 B;  2F4V L;  4IUU A;  2M2L A;  4LF5 Q;  3J80 c;  3S2H B;  4KJN A;  2K14 A;  1LT3 D;  4R4Q A;  4FP5 D;  4O2D A;  1HNX Q;  4DKA C;  2BOS A;  2I0Q A;  4G7O C;  4LF8 L;  1EOT A;  4RHS A;  4DV6 Q;  2K52 A;  4YIJ A;  1VS0 A;  4PZ8 A;  4NXN Q;  2IL8 A;  5E4X A;  3ULP A;  5JEA H;  1AZQ A;  3DMU A;  2RA4 A;  1HZB A;  1B70 B;  3RUZ A;  1T9H A;  1PZJ D;  1YJN A;  1IKL A;  1PZK D;  2GVA A;  2KHI A;  1IHZ A;  4AYB B;  4LF7 L;  4QB4 A;  1HCZ A;  1QWY A;  3S2H H;  1EY8 A;  3VDY A;  1B9M A;  3OW2 A;  1X3Q A;  3KDF B;  5H1S E;  1Z7T A;  2AMC B;  3ER0 A;  4FYD A;  2UXD L;  1OXX K;  1IW7 D;  2WKD A;  5I2Y A;  2D0P A;  5IYC H;  1CKN B;  2TSS A;  1TU2 B;  1TWC B;  1WI5 A;  1KIX A;  4BBS G;  5C5L A;  2UU9 L;  3KLS X;  4FO2 A;  1Q12 A;  1DCZ A;  4EQN A;  3W1G A;  3EFX D;  4B9X A;  1BO0 A;  4K2K A;  3IKJ A;  1D7Q A;  1PH3 A;  3K0Y A;  3KLW A;  1MKH A;  1KDB A;  1PFN A;  1HUM A;  2KEN A;  4LF5 L;  2R3Z A;  5CV5 A;  5G3L F;  4CHT B;  1WTQ A;  1SE4 A;  1HNX L;  4QCL A;  3IL8 A;  1VDZ A;  1UE6 A;  3A8K E;  3I4M G;  1VQB A;  3NP8 A;  2EXD A;  4LWC A;  1AE3 A;  2BDN A;  4DV6 L;  2XGT A;  5AJ3 Q;  4GOP B;  3DUZ A;  2FMM A;  1OXU A;  2NN6 G;  4AYB E;  2JA8 B;  3BDC A;  2WB1 G;  3SK4 A;  5IP9 H;  3S15 H;  2O2L D;  2F4I A;  1FL0 A;  1CKM A;  3VR5 A;  5J39 A;  1X3E A;  1WJJ A;  3A5Z B;  2ID0 A;  5BN4 A;  3T53 B;  1Y69 U;  4X62 Q;  2TMP A;  4TVA B;  2ZXR A;  2R6G A;  2EYH A;  4XQQ A;  1D2B A; 
#chains in the Genus database with same CATH homology
 4YHH Q;  3E0E A;  5JEA G;  4DR6 L;  4YWK A;  4X64 Q;  1IBL Q;  1XMO L;  3TS2 A;  1M1K C;  1YEZ A;  3G71 A;  2JA8 H;  1HR0 Q;  2OCE A;  3B6Y A;  1EQQ A;  4R4O A;  3RLO A;  4OWW B;  4DUY L;  3M7N A;  1JJ2 A;  4R1J A;  4WJ3 M;  1A63 A;  1MJE A;  2Q2I A;  2LXK A;  3K0X A;  1KQS A;  1IZ6 A;  3I7F A;  4P75 A;  2BH8 A;  3HKZ E;  5LMN L;  1KAW A;  3GD7 A;  4RMF A;  1PH1 A;  1OXT A;  3BJU A;  1X56 A;  5IYC G;  3PO3 H;  5IY0 A;  2UXB Q;  3U50 C;  2JA9 A;  2B3G A;  3GTJ H;  2CQO A;  3T1Y Q;  3LGJ A;  4DAY B;  4JI1 L;  3PF5 A;  2K75 A;  1UE5 A;  2KHJ A;  4DK3 C;  1IXR A;  2V1C C;  3UDF A;  4X66 Q;  3F2B A;  3CCE A;  3S2D H;  4BA2 I;  2ES2 A;  4L5Q A;  4C3J H;  1YHA A;  5AJ3 L;  3CCM A;  2LXJ A;  4A93 G;  4IPD A;  4MTN A;  4A3L H;  2VQE L;  2E2J H;  3MXN B;  1TXY A;  1PH5 A;  1IBK Q;  1YHB A;  3CP0 A;  1GD7 A;  4AYB G;  5M5W H;  3PUX A;  3I56 A;  4JI4 L;  1K8G A;  4X65 L;  2IX0 A;  5M3F G;  2VUM G;  3A0J A;  3PO2 G;  1HZA A;  3A74 A;  1VQE A;  1VQF A;  2RHS B;  4R4I A;  4QL5 A;  4AH6 A;  4QGU A;  4DR5 Q;  2VS1 A;  1VQO A;  1PH8 A;  2WB1 E;  1HZC A;  4GOP C;  2F52 A;  3CMA A;  1I6H H;  4HID A;  1VQP A;  4JI5 Q;  2UUA L;  3HFZ B;  1L1O B;  3S24 A;  3PIO A;  4NXM Q;  2NVQ H;  4H02 A;  4A3F G;  1I5F A;  3DM3 A;  1PVO A;  2PI2 A;  3KF8 B;  4DV5 L;  4DAM A;  2JA7 G;  4X62 L;  3FKI G;  5GQO A;  4BBR H;  1OXV A;  1QVC A;  4A3J G;  4IJH A;  4DR7 Q;  2AWN A;  4A3B H;  1EIF A;  4XTC S;  3I4N H;  3PV0 A;  4IJL A;  1PYS B;  1WFQ A;  2NZH A;  2Z0S A;  1FGU A;  2VY3 A;  4YHH L;  4DV1 Q;  3K80 C;  3CCS A;  2UUB Q;  4JBK A;  3CCV A;  1AH9 A;  2JE6 I;  4LFB Q;  2PNH A;  4X64 L;  1IBL L;  2QGQ A;  2IHF A;  2RCN A;  2Z6K C;  5IP9 G;  1HR0 L;  1OTC A;  2HHH Q;  3HOU G;  1NBW A;  1Q1E A;  2YTV A;  3Q8D A;  1KRT A;  1KL9 A;  3S16 H;  4JI0 Q;  4DV4 Q;  2JA5 G;  3HOY G;  1GVP A;  4JOI A;  4LF4 Q;  1Y14 B;  3G4S A;  2VUM H;  3F1Z A;  1QVG A;  5M3F H;  3HOV G;  2WAQ G;  1SMX A;  3U4Z A;  2JQO A;  3CD6 A;  1SE8 A;  3HOW G;  3OYY A;  2UXB L;  3AYH B;  3T1Y L;  1N33 Q;  3F2C A;  4LUZ A;  1YIT A;  2H5X A;  1SLJ A;  1M90 C;  4BY1 H;  2K50 A;  2YV5 A;  4LUO A;  4OWT B;  4X66 L;  1E22 A;  1Y1V H;  1QUQ B;  3RR5 A;  1X3F A;  4A76 A;  1YJW A;  3CPW A;  2MFI A;  1I3Q H;  2OQK A;  1VQA A;  2Q2T A;  2OWO A;  2JA8 G;  4A3G G;  1TWG H;  2ZJP A;  4A3C H;  3JC6 6;  4B3R Q;  5C0X G;  3E9I A;  5C4J H;  3EN2 A;  1S72 A;  1V1Q A;  5JJL A;  1LM0 A;  4HJ5 A;  4A3J H;  1IBK L;  3S1R H;  5IYD H;  4PG3 A;  4DV7 Q;  3I2Z A;  4NXN L;  4B3T Q;  1O7I A;  2YTY A;  1DGS A;  4O0A A;  3OTO Q;  3J81 i;  3PCO B;  5HGQ A;  4DR5 L;  1N8R C;  1GM5 A;  4IFD I;  1E3P A;  3KDF A;  1EQR A;  2B63 H;  4B3S Q;  2JEA I;  4JI5 L;  3HOU H;  2JA7 H;  3PO3 G;  5C4X G;  2CCZ A;  2R7D A;  5M3M H;  4NXM L;  4QY7 A;  2YU9 H;  3KF6 B;  1CKN A;  2E5L Q;  4BXX H;  3GTL H;  1N32 Q;  3NEN A;  1H95 A;  2N78 A;  4DV2 Q;  4DK6 C;  3PIP A;  3NBH B;  3IRB A;  2JK8 A;  3CCU A;  4LNQ A;  2GVB A;  2B29 A;  1CSQ A;  4LFC Q;  1UEB A;  4LF6 Q;  4DR7 L;  3T1H L;  1XPR A;  1JE5 A;  4YCV A;  3DLL A;  4KHZ A;  1YI2 A;  1L1O C;  1R9T H;  4DV1 L;  4HIK A;  3FHW A;  3CW2 C;  2UUB L;  1VQH A;  1Q82 C;  1YIJ A;  5FLM H;  1X9N A;  3ICE A;  3H3V H;  5LMN W;  4IOA A;  3NEL A;  3TRE A;  2ZJQ A;  4JBJ A;  1WOC A;  3RN2 A;  4A3G H;  5IP7 H;  1RIP A;  2ZTD A;  3TQY A;  1G6P A;  3WWV A;  1C0A A;  5FJ8 H;  4DV4 L;  4DV0 Q;  4LF4 L;  4MNO A;  3BZK A;  2K5V A;  3GTK H;  4PZ6 A;  1KC8 C;  3CME A;  1SFO H;  1S3O A;  2VQF Q;  3U4V A;  1SRU A;  3UDG A;  3KFU A;  4WJ4 A;  2XTI A;  4KHP Q;  4BBR G;  1IBM L;  4LW1 A;  4DR2 Q;  1K9M C;  1Q1B A;  2WAQ E;  4A3B G;  4ALP A;  4LFA Q;  4GOP A;  2Q2U A;  1YHQ A;  3I4N G;  5C4X H;  5IYD G;  1QZH A;  4IO9 A;  4DPG A;  3RLF A;  3ULL A;  1YVC A;  4A4I A;  2JEB I;  1Q46 A;  3BU2 A;  1XMQ Q;  1PH2 A;  3HKS A;  3GO5 A;  3CCQ A;  2NVT H;  4B3R L;  4DR1 Q;  1E24 A;  2IT1 A;  2D0O A;  4TQU S;  1KD1 C;  1SN8 A;  5DLQ E;  4A3I H;  5JEA J;  3NEM A;  5FLX c;  3CCL A;  4JBW A;  4QQB X;  4DV7 L;  4IPC A;  4P72 A;  4IPH A;  5BR8 Q;  2K4K A;  1NY4 A;  4B3T L;  1PH9 A;  1YJ9 A;  1K83 H;  3OTO L;  1HNZ Q;  3L0O A;  2A19 A;  1K8A C;  1OXS C;  3AQQ A;  4B3S L;  4L5S A;  2NVY H;  2Z6K A;  2D62 A;  1VQG A;  2EIF A;  4P71 A;  5IT9 c;  2ATW A;  5EAY A;  3RNU A;  3S17 H;  3PSI A;  4HJ7 A;  1I94 L;  2Y0S E;  1I50 H;  3AFQ A;  1EYG A;  4C3I H;  5GAH C;  2E5L L;  1N32 L;  4C2M H;  3K8A A;  4BY1 G;  1E7Z A;  4Y7N H;  1CUK A;  4DUZ Q;  4DV2 L;  1Y1V G;  4A3K H;  1NJI C;  1E1T A;  4GLA C;  4LUV A;  1HR0 W;  1JMC A;  3J81 c;  2NVX H;  1MIU A;  4A3C G;  3PUW A;  1TWA H;  1A8V A;  4LFC L;  4FDB A;  5ELN A;  4LF6 L;  1S40 A;  1JJG A;  4KI0 A;  1HZ9 A;  5E7N A;  1J6Q A;  1W3S A;  4EX5 A;  3PGZ A;  4GNX B;  3RZO H;  5IWA Q;  3F2D A;  1GO3 E;  3KOJ A;  3W1B A;  1NE3 A;  2PQA B;  1X3G A;  4UP8 A;  3S1Q H;  5C3E H;  2VW9 A;  3CC7 A;  1VQ4 A;  2UXC Q;  1B8A A;  3M4P A;  1WYD A;  1BVS A;  3H0G H;  3M3Y H;  2YTX A;  4OX9 Q;  3I4O A;  4JI8 Q;  2B63 G;  4HJA A;  4JCV E;  2DGY A;  4BY7 G;  4NPS A;  2JA6 G;  4X6A H;  3STB C;  5M3M G;  4DV0 L;  4APV A;  1JT8 A;  1V43 A;  4GLV B;  4BXX G;  2WFW A;  2CFM A;  5GAG C;  3CF5 A;  3RLN A;  1J5E Q;  2VQF L;  4IOC A;  1K3R A;  2A8V A;  3JAM i;  1PA6 A;  2KCM A;  4KHP L;  4IFD J;  1G29 1;  3J7Z C;  2ZJR A;  4DR2 L;  4LFA L;  1RL2 A;  2HT1 A;  1VQD A;  1EFW A;  4HJ9 A;  3D31 A;  3KJP A;  5LMU Q;  1QZG A;  3S14 H;  2R7F A;  4GS3 A;  2R92 H;  5JJI A;  5FLM G;  1VQI A;  1X54 A;  4HJ8 A;  1XMQ L;  4JI3 Q;  4JI7 Q;  4JI6 Q;  2VNU D;  4DR1 L;  1XTD A;  3F8T A;  3CQZ H;  4JV5 Q;  5IP7 G;  3GTP H;  3J7A 5;  2PMZ E;  1PFS A;  2C35 B;  5M5Y H;  2RHQ B;  5FJ8 G;  1VQM A;  2RF4 A;  1HJP A;  1PH6 A;  3J80 i;  1UWV A;  3GTM H;  5BR8 L;  4UP7 A;  2ZTE A;  3FP9 A;  3K7A H;  4DUY Q;  1L1O A;  3UE0 A;  3TS0 A;  2E8G A;  2K5H A;  1HNZ L;  2NZO A;  3EBE A;  2ASB A;  1HH2 P;  1NMG A;  2R7Z G;  3AEV A;  2F4V Q;  2CWA A;  2UUC Q;  2Y0S G;  4P73 A;  4BY7 H;  4A3D H;  1UE1 A;  2R93 H;  2JA6 H;  2ZM6 Q;  1VQC A;  2FXQ A;  1ASZ A;  4DUZ L;  1TWC H;  3AFP A;  4JI0 L;  3M9B A;  1V9P A;  4ME3 A;  1N33 L;  4Y52 H;  5IE8 A;  2N49 A;  2EQS A;  2HIV A;  1VQ5 A;  4L5R C;  3PUY A;  1FVI A;  4DR3 Q;  1C7Y A;  3HOZ G;  1U5K A;  1Q81 C;  4LF8 Q;  2F3I A;  5IWA L;  4A3I G;  2HIX A;  1X55 A;  3GTQ H;  4GKJ Q;  4UY8 C;  3GDE A;  5K36 G;  1Z9F A;  1IL2 A;  3K7U C;  3S1N H;  2UXC L;  2VL6 A;  1YBY A;  3K81 C;  4BBS H;  1LUZ A;  4LFB L;  1VQL A;  1BBU A;  4YWM A;  5IYB H;  3H15 A;  4OX9 L;  1Z47 A;  4JI8 L;  2HHH L;  5HY6 A;  4A3M H;  4KLK A;  4GKK Q;  4K0K Q;  3J81 j;  4GNX C;  3CPF A;  1VQ7 A;  1EOV A;  2MQH A;  2QEX A;  1CKO A;  4LF7 Q;  4A3K G;  4A3E H;  3UE1 A;  3GTG H;  5ELO A;  3A5U A;  3S1M H;  1SR3 A;  5GAD C;  4J15 A;  3PF4 A;  3HOX H;  2IX1 A;  1P16 A;  1Q8K A;  1QUQ A;  2N3S A;  4XIG S;  4C3H H;  3STB D;  1XPO A;  2AWO A;  4OO1 I;  2OQ0 A;  2UXD Q;  2K5N A;  1L2F A;  2R7Z H;  5LMU L;  1Q7Y C;  5C0X I;  5C3E G;  4YWL A;  4B3M Q;  4LF9 Q;  4JI7 L;  4JI3 L;  2L15 A;  2UU9 Q;  4JI6 L;  1W2B A;  2E2H H;  1N34 Q;  3I4M H;  1UE7 A;  3E9H A;  3H0G G;  3JAM c;  4JV5 L;  4DNI A;  2QA4 A;  1G51 A;  4LF5 Q;  4GN4 B;  1FJG Q;  1XNQ Q;  1VQK A;  3HOZ H;  2NN6 I;  3I55 A;  1A0I A;  2AKW B;  1PV4 A;  4R4T A;  2WP8 J;  1PH4 A;  2I5L X;  3KYH C;  1KHI A;  4AQY Q;  3TEH B;  3CXC A;  3PUZ A;  3CCR A;  3KF6 A;  3BZC A;  1WCM G;  2MO1 A;  1CSP A;  3G48 A;  3RN5 A;  1N36 Q;  4MZ9 A;  3M4Q A;  3ZJY C;  1EIY B;  2IY5 B;  2F4V L;  4POF A;  1N9W A;  3ULJ A;  2MNA A;  1XJV A;  3U58 A;  2UUC L;  1EUJ A;  4AIM A;  4OO1 G;  1X65 A;  2A1A A;  3J80 c;  2ZM6 L;  1MJC A;  4IPG A;  2K14 A;  1YNX A;  2HQL A;  3L7Z C;  4R4Q A;  3RZD H;  1Y1W H;  1BBW A;  4O2D A;  2R92 G;  1HNX Q;  1KXL A;  4DKA C;  1PYB A;  4JI2 Q;  5GRO A;  1PHJ A;  2I0Q A;  4JYA Q;  5C44 H;  4DR3 L;  3M4O H;  5JJK A;  4LF8 L;  4DR4 Q;  1NTG A;  1VQ6 A;  2I5H A;  2YYZ A;  4A3L G;  4GKJ L;  4DV6 Q;  3CCJ A;  2K52 A;  2OTL A;  1U0L A;  5J3B A;  1YZ6 A;  1Q86 C;  4YY3 Q;  2BH2 A;  1VS0 A;  4PZ8 A;  4NXN Q;  4UPA A;  2OTJ A;  1XNR Q;  3TRZ A;  2BA1 A;  3ULP A;  2BA0 A;  1HZB A;  1B70 B;  3W5O A;  4DV3 Q;  4POG A;  4GKK L;  4K0K L;  1T9H A;  5M5X H;  1YJN A;  2GVA A;  4R4C A;  4A3D G;  2KHI A;  4LF7 L;  4IFD G;  1TWH H;  3CC4 A;  3SGI A;  3S2H H;  1LYL A;  3VDY A;  4YCW A;  1AE2 A;  1WCM H;  3KJO A;  3OW2 A;  2KBN A;  3KDF B;  4JC0 A;  1B7Y B;  2GN5 A;  3G6E A;  5H1S E;  1VQ8 A;  2AMC B;  2PI2 E;  3ER0 A;  2E2I H;  2UXD L;  4PMW A;  1OXX K;  2D0P A;  3CAM A;  4EQ5 A;  5IYC H;  1CKN B;  1L0W A;  1WI5 A;  4B3M L;  4LF9 L;  1KIX A;  3T1H Q;  4BBS G;  1P8L A;  1HNW Q;  2UU9 L;  1N34 L;  2R93 G;  2CWP A;  2Q2H A;  5IYB G;  4DR6 Q;  1Q12 A;  1FJG L;  1IYJ B;  1XMO Q;  3W1G A;  1XNQ L;  4A3M G;  4BA1 I;  1LTL A;  4A93 H;  4L5T A;  3ERS X;  4AQY L;  1KRS A;  1D7Q A;  2KCT A;  1JJC B;  4A3E G;  1PH3 A;  4NB3 A;  2CKZ B;  3UDI A;  1N36 L;  3KLW A;  3UDX A;  1MKH A;  3HKZ G;  3PO2 H;  3HOX G;  1ASY A;  1K0R A;  2JJQ A;  4QJF A;  4PZ7 A;  1IBM Q;  5LMN Q;  1JB7 A;  3EIV A;  2KEN A;  4LF5 L;  4A75 A;  4GNX A;  3MEF A;  2IHE A;  1HNX L;  2PQA A;  4JI1 Q;  4A3F H;  3GTO H;  4JI2 L;  2ZTC A;  1VQN A;  1UE6 A;  1X6O A;  1SRO A;  3L2P A;  4OXP A;  5GAE C;  1QVF A;  3I4M G;  4JYA L;  1D8L A;  1VQB A;  4DR4 L;  2EXD A;  4HIM A;  1GKH A;  1A62 A;  1AE3 A;  3FKI H;  4LWC A;  2MO0 A;  2LSS A;  2XGT A;  5AJ3 Q;  4DV6 L;  4GOP B;  1XPU A;  4JOI C;  4YY3 L;  1BKB A;  1C9O A;  2VQE Q;  4QIW E;  1XNR L;  1OXU A;  2NN6 G;  2DUD A;  4AYB E;  4JI4 Q;  5C0X J;  1E1O A;  4X65 Q;  2WB1 G;  4JG2 A;  1NMF A;  2AHO B;  4UP9 A;  2I5M X;  5IP9 H;  3D0F A;  4DV3 L;  1EWI A;  1VCI A;  3S15 H;  4JBM A;  3M85 A;  4HIO A;  1FL0 A;  1CKM A;  1I94 Q;  4YCU A;  1X3E A;  1Y1W G;  1K73 C;  1WJJ A;  2JA5 H;  2UUA Q;  3HOY H;  1VQJ A;  3A5Z B;  1VQ9 A;  4OON A;  1J5E L;  3PUV A;  5C44 G;  2ID0 A;  1TWF H;  4GN5 A;  4P74 A;  2N8N A;  4GN3 B;  4DV5 Q;  3HOV H;  3H3V I;  4X62 Q;  4RG1 A;  2VZA A;  4TVA B;  4GLX A;  3HOW H;  2R6G A;  4OWX B;  1PH7 A;  3CC2 A;  2ALY B;  1HNW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...