1WD0A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
b'MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd0A00
2B2WA 4QUFA 2VXWA 3G7LA 4XT3B 4O42A 2CVRA 2B2YA 1U4MA 2RSNA 2K03A 2L4NA 4IUUA 2IL8A 1KNEA 1MI2A 2HCIA 1SAPA 1WVLA 3I90A 1WTVA 4CJ1B 3I3CA 3LWEA 5EQ0A 1EQTA 4CJ0B 1WTRA 5D65A 1J8IA 1DZ1A 1HFGA 1RTOA 2Q8RE 2H1EA 4NW2A 5CBAE 1B50A 2FINB 2XIWA 2HUGA 2BDNA 3TZDA 5EPLA 1PDQA 2MGSA 5D14A 5COYA 1ICWA 2JYOA 2FHTA 1XYIA 2RA4A 1WTPA 4U68A 1GUWA 2JP1A 3ONAB 4R9WA 4X3KA 4ZLTF 1E0BA 1F9PA 2L9HA 2FFKB 2MPMA 1AZPA 3I8ZA 3I91A 4HCSA 2K28A 2KEEA 3DM1A 1MGSA 1F2LA 3N52A 2DY8A 5DNFA 4RWSC 4X3TA 4IUTA 4XT1B 4RAUC 1HFNA 1RHPA 4IUPA 1ILPA 1C8CA 5EKIA 2B2VC 2HDMA 1DOLA 5EPKA 4XDXA 1B2TA 4IURA 2L12A 1NCVA 3FPUB 2B2TA 2Q8TA 2J7ZA 2M2LA 4HEDA 5T1GA 1BF4A 1SSOA 1WD1A 1B3AA 4X3UA 2K04A 4ZKCB 1WTWA 3Q6SA 1X3PA 2KOLA 2HCCA 1B4OA 1EOTA 1F9QA 2X6LA 1NR4A 1F9RA 2KECA 3GV3A 5E4XA 4UAIA 4IUVA 2NWGA 1CA6A 1JICA 1BO0A 1IKMA 3MWYW 5CMDA 1AZQA 1WTQA 1X3QA 2X69A 4OIKA 4HAEA 5CORA 3H91A 1MSHA 1G2SA 2HDLA 1O7ZA 1RODA 2K1BA 1G2TA 1EIGA 1DOMA 1RTNA 1IKLA 4MN3A 4ZKBB 3UI2A 1IL8A 2FMMA 1PFBA 1PFNA 3R93A 3IFDA 1SDFA 1M8AA 2EE1A 2K05A 1U4PA 1A15A 1ML0D 1RJTA 2R3ZA 4MHEA 3TN2A 1O80A 1CM9A 4X3SA 1G6ZA 3GV6A 1HRJA 1XX8A 2MJ8A 3D6WA 4HSVA 5E4WC 1PLFA 2EPBA 1QNKA 1ESRA 1NR2A 1EIHA 1J9OA 1KNAA 1ZXTA 1F9SA 2B2VA 2RVLA 1EL0A 1HUNA 5T1IA 1B53A 1PFMA 3KBXA 2RSOA 2NYZD 4CJ2C 1DOKA 2B2UC 1U4LA 2KEDA 3QO2A 1QE6A 2D9UA 2DY7A 2FJ2A 2K01A 3DEPA 1U4RA 2N55A 1G91A 1VMCA 3F2UA 2KVMA 3KUPA 2NZ1D 3HP3A 1DONA 1TVXA 3P7JA 2L1BA 3DEOA 2KUMA 1BBXC 1WTXA 4DN4M 4IUQA 1HA6A 2B2UA 2MP1A 3MTSA 1AP0A 1HUMA 1WD0A 3IL8A 2L11A 1HHVA 3FDTA 1Q3LA 2N88A 5CBEE 4QUCA 1QG7A 1VMPA 2B2TC 5JJZA 2X6GA 2B2WC 1BNZA 1ILQA 4OIJA 5EJWA 1JE4A 2B2YC 5EPJA 5AFWA 1CA5A 1WTOA 4ZAIA 4R8IA 1X32A 2EOTA 3SVMA 1LV9A 1O7YA 1S4ZA 4LMQD 4RA8A 2SDFA 1NAPA 1MSGA 4ZK9B
chains in the Genus database with same CATH superfamily
5M3MG 2CVRA 2Z6BA 3CCLA 2N8NA 4V190 1IYJB 2HIVA 1HNZL 1Q1EA 4FF1A 2ZTEA 4JK1C 5C0XJ 5CBAE 2KBNA 1B50A 2D0OA 3NUCA 1VQ7A 5CGKA 4F87A 3S2HH 2Z1CA 2EY5A 3BDLA 2R92H 2JP1A 4QY7A 3A7AB 4HMIA 3S1MH 1RCVD 4LJZC 2R92G 5HY6A 2BA1A 5IT9E 1D6EC 2CW0D 3NEMA 4B3TQ 2CQAA 4RKLA 4HJ8A 1TWFB 2B2VC 1UEAB 4DR3Q 1AE3A 3FPUB 4K8IA 2C5CA 2KJXA 4FXDA 1N33L 4X3UA 1EZ8A 1K8GA 1ESFA 4X66L 3BG3A 1B4OA 1II3A 1F9RA 5FO7B 1CA6A 1I6HB 4UAIA 1L1OB 1FYCA 1S5FD 2EZVA 1A3VA 2X69A 1D1KA 4KHZA 2OXPA 1G2TA 3PF5A 2F0PA 3KDFA 5JPMC 1EEFD 5C4ZA 5IGEA 3K80C 3R93A 2OQKA 3W1BA 2NTTA 3VDYA 2JA9A 4WJWA 1K73C 1LM0A 1KRTA 1YJWA 1SE3A 1FGBD 3K59A 3VA5A 3OHXC 1JMCA 5IP7H 4JI2L 1GUNA 1NE3A 2E75C 1QVFA 1AFPA 1UUPA 2F0MA 1J9OA 5IP7G 1F9SA 2RVLA 2PNHA 3W2DA 4ME5A 2HD3A 2F0UA 2B2UC 3SK4A 4A3CH 4J15A 1LTTD 3EN2A 4CDDC 1WFQA 4A3CG 4LF8Q 3BYTB 1WTXA 4B08A 4IOAA 1HA6A 4B3ML 2A68D 5FJ8G 5CBEE 3MVVA 1FD7D 2J0TD 5BN4A 1ZKOA 5DLQE 5F2DA 1JJCB 2YU9B 5AFWA 2F1MA 1E1OA 3R2TA 1LV9A 1O7YA 1EU3A 1V9PA 1A3UA 4ME3A 4P71A 4KHVA 1HZCA 1I4HA 1NAPA 1SROA 4OGQC 4ULLA 3V96A 4XQJA 3G7LA 3I55A 1HZAA 1YVCA 1EQQA 4IUUA 1VQDA 3HKZB 1MI2A 3T1YL 2F3IA 2VQFQ 3U58A 3K8AA 4DAYA 3M3YH 5EQ0A 3FP9A 5FO9B 1TS5A 2ALYB 2JEBI 4LUZA 4ZUJA 4KHPQ 2WACA 1QVGA 4UDUC 1EWHA 3KBGA 3D31A 1AEXA 3NP8A 1HR0L 5IY0A 5COYA 4H0LC 4LF4Q 4DUYL 5FO8B 4RCOA 2E2IH 1STYA 2FXQA 4LK1C 4O1NA 4NXNL 4JYAL 1LT3D 2L9HA 1F9PA 1AZPA 2QEJC 4KD3A 4JBKA 4IUTA 3RMHA 3D8GA 1D5MC 5EPKA 2HDMA 5J1ZA 4ZQ3A 3UE1A 4DGZA 4JPBW 2Q8TA 4AQYL 1D2BA 1X56A 1Z7TA 4DV6Q 3S1NH 3G71A 1FNVA 2BA0A 1V1QA 4CJ0B 4KMUC 1JE5A 1NR4A 2WB1G 4K6DA 3HOXH 5ELDA 2XRQD 2KHIA 4JI7L 2CWPA 3HOXG 5J3BA 2HHHQ 1RODA 2VQEL 4DR5L 1XPRA 1IKLA 3UDGA 1HA5A 3F2DA 2ZTCA 1O80A 1B9MA 1PZJD 1EOVA 4X3SA 1LT5D 4DNIA 1JC7A 4A3EB 4A3JH 1NR2A 2DNCA 2QGQA 1ZXTA 4A3JG 1B53A 5I2YA 1PRTF 2K52A 2CH4W 1SFOH 3R8BA 3MEFA 4GOPB 1L2FA 3GTOH 1VQJA 1LUZA 3I4MG 2XTIA 3IL8A 2Y0SG 1LABA 2ZXRA 1TWHH 3S16B 3L7ZC 3B6YA 1QZHA 1OXXK 2YTXA 1WYDA 5ELEA 3G4SA 2WAQG 1LO5D 1MD2D 4LMQD 3J7A5 4C3HB 2ZTDA 2GA4B 5A2QL 1LT4D 4GKKL 2WINB 1YNXA 2JJQA 1Y8OB 2HQEA 3CD6A 2AWNA 1NJIC 1XTDA 1SXTA 2QW7A 3NENA 3PO3H 2BH2A 3RZOB 3DWAA 3NELA 1QOHA 3A0JA 5C44H 4F88A 1B70B 4C1NK 5G3LD 3PO3G 1L1OA 5CYUA 5C44G 2HUGA 2CW0C 1F77A 1N36Q 3VR4A 2GVBA 4OL7A 4QL5A 2IW3A 3GTQH 2E2DC 1VQ5A 1BCPD 1A2UA 5CV6A 3F8TA 4Y7NH 2L55A 2KEEA 3DM1A 1KD1C 4CBVA 1UWVA 4XXEA 4I7AA 2XN9C 1TIID 3ULJA 1PH1A 1YIJA 2CFMA 4BXXH 4A3IH 4K5VA 4O2DA 2XWJB 4BXXG 2BOSA 3A8JE 4A3IG 4JI5L 3CW2C 1CKOA 5E4XA 2UUBQ 4JBWA 3QIAA 3DM3A 5CV9A 2JA7H 4JYAQ 2ZXPA 3Q8DA 3GTPB 1RD9D 4FF3A 3CF5A 4A75A 2JA7G 3CAMA 2K1BA 3M4OB 4ZKBB 2EYHA 4YIJA 1IW7C 1PFBA 2VUMB 3A74A 1VQBA 1TS4A 5FKAC 1TXYA 4AQYQ 3A55A 3JAML 2LXJA 5K5PA 5E1FA 1Z6HA 3KJPA 4HMJA 1HNXL 3ND9A 3CC2A 1SYEA 2F0IA 2B63B 2A74C 2OT2A 3U50C 1VS0A 4TQUS 5EAYA 1KAAA 1U4RA 3KYHC 3PIP3 3HP3A 4UP7A 2NB0A 4IOCA 3A54A 1J6QA 3RD4A 3K58A 3RN5A 3RR5A 4DV0Q 3PSIA 3BDOA 3PIO3 4HJ9A 1Q3LA 5CV4A 1PVOA 3HG9A 2PNRC 1VMPA 1A3TA 2EXZA 1NBWA 1DXMA 1CA5A 1WTOA 2RF4A 3A5ZB 1G8ZD 2SDFA 1GUTA 4LF9Q 2SNMA 2PQAA 2OQ0A 4HJAA 2EYOA 3PO2B 4OO1H 2L4NA 4FO2A 3IAYA 1DD2A 4OO1G 1EQRA 5ISRA 4K5XA 4GLXA 2EDGA 1TS3A 3MXPA 4R4IA 4X62L 5C4XB 4X64L 1BVSA 1K0RA 1STNA 5D14A 1DYQA 3CRLC 1ICFB 1N9WA 4NKLA 2V4DA 1GKHA 4ZLTF 4GKKQ 4AYBB 1F2LA 2Z6KC 3ULPA 4PQXA 1XNQL 5EKKA 4BBRH 1K3RA 1IYVA 3KJOA 3K7AH 1JQYD 1EWIA 4BBRG 4YCVA 2L12A 1NCVA 1KLUD 1SJHD 4PMCA 3AEVA 1K8MA 2XGTA 2Z4IA 4L5TA 3BS1A 3J81L 2B8FA 1JJ2A 3S15H 4BWGB 1XMOL 2L15A 2KCMA 5KNDA 5CMDA 4GOPA 1J5EQ 2E5LL 1WTQA 1HTLD 4C2MH 2HDLA 1LTLA 3TDQA 2KCTA 4DR2Q 3S14B 1U4PA 4DR1Q 4GN3B 3U9OA 2JA6B 2PI2A 3F2BA 3DLLA 2E76C 5IYDH 5M3MB 3M7NA 5KYLA 5IYDG 2F0DA 4GLVB 1PFMA 2OEOA 3BJUA 1WCMH 1VQ6A 3VR3A 1E24A 2EJFC 2KEDA 1QE6A 4IQZA 1WCMG 2TMPA 1YZ6A 1M4VA 2CHBD 2H4OA 1KIXA 3HOYH 4GN4B 2ES2A 2X6GA 1Y1WH 1HCZA 3S2HB 2R92B 5TSSA 2LFNA 4IJLA 2B3GA 4PZ6A 5E7NA 3C2PA 1Y1WG 2AHOB 3S1MB 4K5WA 3PUVA 3Q22A 4UHVA 3ERSX 1CSPA 1LTID 1KQSA 2R7ZG 4P74A 1M8AA 1DGSA 2B2WA 1WOCA 4QUFA 1TR5A 2K5HA 1ENAA 4ODGA 4QCLA 3VYSA 1EYGA 4LF7L 1BCPC 3I7FA 2A73B 2WV6D 2Q8RE 2D62A 1FNUA 2IY5B 4DR7Q 4DV7L 3S1QH 5FK9C 4DV1L 1D8LA 4UPAA 1PH4A 4G7ZC 3ONAB 5ELCA 4WJ4A 3ER0A 2A6HD 1UE1A 4RGMA 1XWEA 4OONA 5C3WA 4FF2A 1I4XA 2G9DA 3DHQA 5FLXE 2K04A 1PTOD 4X64Q 1YHQA 2Q2UA 1I3QH 2RCFA 3H94A 1GOZA 4KLKA 4MNOA 3R2IA 3DWPA 4ABNA 2RBMA 5KEEA 1NMGA 4CKEA 3TP8A 1EY4A 1W2BA 3HOVH 2E2HH 1IZ6A 3HOVG 2IHFA 5IODA 4QQBX 4YWMA 3CCJA 1LYLA 1N32Q 3GTMH 1BXTA 2O2LD 1XMOQ 1JWSD 1SEBD 4A3MH 3CP0A 2WIIB 2VS1A 4YCUA 1EUJA 5LMUQ 4A3MG 3C46A 1E3PA 2A5HA 2OWOA 3SK6A 1GM5A 4R4OA 4HR7B 3HOWH 3A56A 3KUPA 1LTSD 3PUWA 2L1BA 4CGYB 1TWAH 3URYA 1FJGL 3RN2A 1PH8A 2F4VQ 1I50H 2E2IB 4KD4A 4GNXC 1IBML 2KCNA 2PW5A 3TREA 1ONLA 3M9BA 1QB5D 2EOTA 4CDCC 4RG1A 4N8FA 4ZK9B 2UUAL 3KFUA 1VQLA 3MHBA 1QZGA 4JI3Q 3KLWA 4N9PA 4O42A 1PYWD 5CR3A 2UUCL 3H09A 3ITPA 2D5DA 3S1NB 1FR3A 4IPHA 2WB1B 3DXJC 2F52A 1JT8A 4QIWB 1Q8KA 3TQYA 4A93H 3UDFA 1MHWC 3FPPA 3HOXB 1V8QA 1I94L 4A93G 3CQZH 4Z9CB 2YTYA 2MGSA 1HNWL 2F0FA 3LX0A 4DNTB 2K32A 3CPWA 1YNND 2L0CA 3J7ZC 2M00A 3S24A 2K28A 1VQCA 1F2ZA 1EIFA 1YJ9A 5JJLA 5DNFA 1E2ZA 2Q8IB 2CKZB 2VL6A 5EBCA 4IURA 3CCEA 3BZKA 4ILWA 1ZYRD 2QILA 4A3JB 1UNSA 5T1GA 4G7HC 1SSOA 5JEAJ 1RKNA 4DV7Q 3GTKH 1CQFA 1F9QA 3SE0A 2RDHA 1E22A 5IGGA 1SFOB 4OELB 3T53B 1KDAA 3NHHA 1AZQA 3I4MB 3OMGA 1IBLL 3HOUH 4MTNA 3TBIB 3GTOB 2SOBA 4HJ7A 1X3FA 3RNUA 2Y0SB 3HOUG 3HKZE 3TS0A 2JEAI 3UI2A 1X3GA 1TWHB 4LFCL 1SNQA 2K5VA 4P75A 3SR1A 5KYIA 2Z9HA 4IN3A 3H6MA 2WAQB 4LFAL 4LFBL 4H13C 3I2ZA 3KLRA 3OW2A 1S5BD 2F0HA 2EPBA 1V1OA 1ESRA 1BQQT 4MTKA 1KRSA 2NZHA 5GAGC 3W1GA 3ICEA 2OCEA 3C3LA 5BN5A 1SBBB 3VYRA 1ASYA 3QO2A 4DA2A 1FNWA 2K01A 4TRDA 2VB3X 1NY4A 3PO3B 3MC0B 1RDPD 1TKWB 3L0OA 5C44B 4JI1L 2B2UA 5LL6S 3BDCA 4JI0L 3FKIH 3RLOA 1VQEA 1B7YB 1SJED 2RKSA 5LMNW 4FYDA 3FKIG 2A1AA 3A5UA 3TP5A 3TRZA 2UXDL 4IPCA 1OXSC 2F0TA 2B2YC 3OW7A 3QOJA 1VQ8A 4ZAIA 4Y7NB 4DUZL 1VQNA 4XQNA 2NVTB 4DV3L 3EFXD 4JBMA 3NTIA 1N34L 4GKJL 4FNFA 4A3IB 4RHRA 1JWUD 2UU9L 3CRKC 4XYOA 1KHIA 2A6HC 2VZAA 1HFGA 2Z8LA 2JA7B 3PQIA 4IJHA 2O4XA 1S40A 4KY7A 1VF5C 4IPDA 1YJNA 1WTPA 4K0KQ 5M5WB 1ZEQX 4HCSA 1MGSA 3SEBA 5JVG3 2JXMB 1T5EA 2PQEA 3CMEA 4LF6Q 5JPNC 2IX3A 1BBWA 2RHSB 3J7YW 2ZT9C 4L5RC 4B3RQ 5LL6X 1HNWQ 2PI2E 5DAUA 3GD7A 1O7LA 4EQNA 1BO0A 3H3VH 4TKOB 4OIKA 4ZCKA 3IKJA 2NVYH 3STBD 1AN8A 4YWLA 3D6CA 4MN3A 3DMUA 3PF4A 2BE5D 4OEMB 1HNZQ 3I70A 3UDIA 2CCZA 4EQ5A 2K05A 1EY7A 4HIDA 4MHEA 4PMBA 1LTAD 1UE5A 3QJYA 1QVCA 2F03A 1S5CD 2EJMA 1EL0A 3HEJA 2I5HA 2NYZD 1DOKA 3RLNA 3H3VC 1RIPA 5CV5A 2R93H 1HH2P 1K83H 1X6OA 2ICEC 1PH9A 1DONA 4YY3L 2R93G 5D3IB 1A8VA 4LFCQ 5C0XH 2ICIA 1XTCD 5J39A 1STHA 3NBHA 5C0XG 5M3FH 1C9OA 3FDTA 4RGNA 1N33Q 4R8NA 4X66Q 5M3FG 3KF6A 3SXHA 4Q0FA 1ILQA 1SN8A 4ID6A 3GO5A 2N49A 1JE4A 1XMQL 5DM63 1K8AC 4HIMA 1GVPA 3MXGA 2EYMA 4RA8A 2CWAA 4JI4L 4NB3A 4BBRB 3HRZC 4IFDJ 1HZBA 1UE7A 3K7AB 5KNBA 2LKVA 3MXNB 4YWKA 1AE2A 1V1PB 2F0GA 4DK0A 5M5XH 4JI1Q 4DFAA 3CKIB 5DEHA 5HGTA 2EY6A 2Q2HA 1X65A 1SAPA 1C7YA 2NVQH 1U9RA 3A8KE 2F0VA 3S15B 3UDXA 4JI2Q 4FXKC 1QWYA 4OHJA 1R4PB 4MZ9A 1JCKB 4C2MB 1LT6D 3CCUA 1ZYRC 3BU2A 3I91A 4IZ8A 1I4RA 1EY6A 4GS3A 2CQOA 4N9TA 4K2LA 4XT1B 4RAUC 1RHPA 3H15A 1KABA 1K8OA 4DKAC 4B3MQ 1SYDA 1PMRA 3PIPA 1BKBA 1STEA 3P1HA 2K5DA 4WRDA 5IYBH 2KOLA 1PRTD 1WCMB 2EVBA 3PIOA 2NWGA 3P75A 2WFWA 3VYUA 5IYBG 1Q81C 3T51B 4J8QA 3D3RA 4QMGA 3MFGA 5HGQA 3IRBA 4HAEA 1PV4A 1BCPB 5BN3A 2I0QA 3NWTA 1SYGA 2BH8A 1S3OA 2AQ1B 2ZM6L 3T1YQ 2ASBA 1H9KA 1X55A 3GTLH 1EY8A 1K0SA 4RH6A 4HSPA 1Y1WB 3S2DB 1XPUA 4JOIC 5HURA 3GV6A 3D6WA 4HSVA 2R7ZB 1SLJA 2DJFC 2F0LA 2LS01 1HR0Q 3LGJA 1H9MA 3KLSA 4DUYQ 5T1IA 2RDGA 4NXNQ 4CKCA 2OF1A 2MO0A 2O5JC 1Y8NB 2FJ2A 1E1TA 1G91A 1LTRD 1U0LA 4NP5A 4EX5A 4DV2L 4DR4L 4HTHA 4IUQA 1P8LA 2MP1A 2NVXB 1WD0A 2MQHA 2N88A 2YYZA 3S1QB 2ATWA 3BVMA 3AFPA 2KENA 5EJWA 5C6AA 2NN6H 5IGDA 1L0XB 1T5XD 3S17H 4QJFA 1X32A 2NN6G 4JI7Q 4JV5L 2A68C 2VQEQ 4DR5Q 4XT3B 2I5MX 3S1RH 3ND8A 4OO1I 2G9HD 3CC4A 3MZ5A 2HIXA 1SRUA 2Z0SA 1J8IA 1EFWA 3Q23A 1RTOA 4PMWA 2F0WA 1PH5A 5C5MA 2LSSA 1VQAA 4A3KH 1ASZA 2QCPX 4A3FH 4JI4Q 1ICWA 4A3KG 2Q2TA 1EYDA 4JI8L 3HOVB 1CHQD 4U68A 2E2HB 1IXRA 4A3FG 4QF4A 2PPBC 1UEBA 3EVQA 1VQIA 4A3GH 1PA6A 2NUCA 3QG1A 1D5ZC 1G291 3X3MA 5I6WA 5EKIA 4GNXB 1Y69U 4ZRZA 3GTMB 3AU7A 1VQOA 4A3GG 3MEHA 3V2TA 2B2TA 2CH4A 2J7ZA 4DK1A 3CC7A 3M4QA 4NPSA 5M5YH 4A3MB 1VCIA 1C48A 4R4TA 2ZXOA 4IFDH 3QB3A 1SMXA 2PYKA 3GV3A 5EBDA 3AFQA 4IFDG 3MWYW 3RZDH 1G51A 5CORA 1GXDC 3J80i 1CZWA 2VW9A 3SGIA 3OPOA 1M90C 1TWAB 3KK7A 1DOMA 3J80E 3T13A 1JJGA 1I50B 2BDOA 4I65A 1YNJD 4LAAA 2MFIA 3GP7A 3MXNA 3K5MA 1EY9A 4DAPA 3L3OC 1EEID 2D9UA 1EYCA 1TWCH 2KVMA 2R7FA 1QUQB 2NZ1D 4A93B 4DN4M 1KDBA 3OMCA 3CQZB 1Q90A 4JI5Q 2JQOA 2H5XA 5KNCA 4NXML 2ZJQA 3FHWA 1IBKL 4R9WA 1MSGA 3JAMc 4WJ3M 3M4PA 3MFYA 3J80c 2UXCL 1BBUA 4DV2Q 4C3HH 4DV5L 2SNSA 3A7LA 2A6ED 1N8RC 3OTOL 1FGUA 1M1KC 4N8X1 3NQTA 1VQ9A 3GTKB 1IYUA 4HIOA 2K5QA 2FINB 4G57A 2XIWA 2BDNA 3HOYG 1PYSB 1HNXQ 3HOUB 3PV0A 1YBYA 4JV5Q 2IPKD 1A62A 5FLXL 5AJ3L 4RGOS 1CSQA 4C3JH 2R61A 3CPFA 1HPCA 4C3JG 1PRTC 3T1HL 1G6PA 4RWSC 1SR3A 2AKWB 4KN7C 4LNQA 4BBSH 4XDXA 4L5QA 1B2TA 3H0GH 2PMZE 4KJOA 2M2LA 4BBSG 2A19A 2EY2A 3H0GG 4PV1C 1C0AA 4A3BH 2F0SA 1V43A 4UY8C 4RMFA 4A3BG 1A0IA 4DAVA 1X3QA 3T16A 2LMCB 1JOOA 2TSSA 3GTPH 3SDZA 3EROA 2IX1A 4L5SA 1IL8A 3FKIB 2FMMA 4RCNA 2IT1A 3PMFA 1LTGD 3CCSA 3TN2A 1EZ6A 3GTJH 3BZDB 1YI2A 1HRJA 2MJ8A 4X62Q 2K5NA 1RF2D 2ENBA 3AB9A 4DF7A 2SEBD 2BCOA 2YTVA 1VDZA 2G5DA 2K4KA 4JCVE 4EQOA 2KHSA 1XNQQ 1PZID 3F2UA 4K8JA 4KV6A 1KDCA 3RLFA 4C1NI 4R1JA 4B3TL 3GDEA 4C3IH 2PCFB 4DR3L 1CK1A 4C3IG 5K36H 4C56C 2Q2IA 4F8MA 1U5KA 3L2PA 4K14A 1NMFA 5K36G 4ZYSA 1C4QA 2I07B 2E5LQ 3TS2A 5EGTA 3SVMA 1GO3E 2Y0SE 2VXWA 2JN4A 1K28A 1SNDA 2F0KA 1SMYD 2K03A 1Q7YC 5GADC 1GD7A 4KJNA 3M3YB 2IJ0A 3HOWG 1WVLA 1XJVA 1WTVA 2WAQE 4CJ1B 2MHVA 4NMZA 1GHJA 5D65A 2PZUA 3K7UC 5CV7A 4MIUA 3HOZH 2UXBL 2H1EA 1DCZA 3HOZG 1X3EA 5EPLA 3NPPA 2NVYB 5C4XH 4QGUA 1ENCA 1GUWA 1MBYA 1DJRD 1D1IA 2EQSA 4J1MA 3UE0A 1XNRL 2DY8A 1S5ED 3QOLA 3TMEA 1WJJA 4LW1A 4LF8L 4HJ5A 2A69D 4ALPA 5I6YA 3HS0C 3NQIA 3HGBA 5BR8L 3IFTA 5AJ3Q 1CTMA 3R3OA 2R93B 1E2WA 1K83B 1RL2A 3TP7A 5CC4A 3J81j 2I5LX 3WWVA 1QUQA 1STGA 3WOFA 4JVZA 3EA6A 4P72A 3T1HQ 5IIFA 3EJIA 1ENFA 2NTSA 1PZKD 1TWGH 1YNJC 1VF7A 5KIXA 5M3FB 1TT2A 4G4KA 4L6TB 4G7OC 4WORA 3E0EA 4LF7Q 2VQFL 1CFMA 3V05A 2EY1A 5IGCA 1QNKA 4KHPL 3EIVA 4DV1Q 1NNXA 1Y1VH 5I2XA 3CXCA 2B2VA 1HUNA 4LF4L 1A6XA 1Y1VG 5M5XB 5C3EH 1SYFA 4L63B 2KQ3A 5C3EG 1GUGA 2NVQB 5GROA 2NBFA 1CKNB 2IX0A 3C1FA 4PZ7A 1TY0A 2EIFA 4HN7A 4M1UB 1JOKA 3SHLA 4DV6L 5JJZA 4BY7H 2V1CC 4NDXA 4XTCS 2A6EC 4DU9A 1NUCA 4BY7G 3CCQA 3E6ZX 4O0AA 3GQBA 4DK6C 2HQLA 2NZOA 1CI3M 4V0BA 3OSOA 5GAEC 2AWOA 4DV4L 1F2MA 2HHHL 2B2YA 2E2JH 4UP9A 4POFA 3D4WA 1O7IA 4LUVA 3I3CA 1B8AA 5IOCA 2DN8A 4YHHL 3GTQB 2XSCA 2AQ3B 3OIPA 3G48A 1FL0A 4A4IA 4A3DH 3CMAA 1E7ZA 1PTOH 3PUZA 1E0BA 3GTLB 4A3DG 3I8ZA 3TSSA 3I73A 3X3NA 1S72A 5FLMH 2WP8J 4HCEA 2DJGC 4BY1H 2C35B 4L8JA 5FLMG 1FJGQ 2P5ZX 4EVOA 4BY1G 2UXBQ 3I4NH 1Q1BA 3PUYA 1R9TH 1GJXA 3BVZA 3NSWA 4XYQA 1WD1A 3AYHB 3I4NG 1IBMQ 2ZJRA 3VR2A 2X6LA 4JC0A 1IW7D 4K6LA 2KECA 5IGBA 2RHQB 4JG2A 1VQKA 3ERQA 3H91A 2UUAQ 3H3VI 2MUYA 5IT9c 1XNRQ 2IWHA 1Q86C 1PTOC 5C5LA 2UUCQ 1EIGA 1RTNA 2ID0A 1KAWA 5FJ8H 1B1ZA 5C4HA 1SDFA 2EE1A 3NXWA 1AH9A 1RJTA 2R3ZA 2R6GA 1CM9A 4OWXB 2MO1A 1OXTA 1VQ4A 3T56B 3S17B 1I94Q 4F7XA 5BR8Q 3W5OA 1D5XC 1N36L 1KNAA 2EYLA 4GZYC 2F0OA 4I7ZC 4BS9A 4FXGC 2RSOA 1HQMC 1H95A 2DGYA 3S1RB 2E74C 5EKLA 2DY7A 1LLRD 1VQFA 3E9IA 2GN5A 2F4IA 3C1EA 3ULLA 3CCMA 5A35A 5C0XI 2KHJA 1Z47A 3HZXA 3MTSA 5JAVA 4A3KB 3CCVA 3OOCA 2JA5H 4A3FB 1SMYC 3K81C 1YHAA 3GTGH 2JA5G 5C4JH 3TEHB 2UUBL 4R8IA 1IBLQ 3AQQA 4KY6A 2L5TA 5FOBB 4B3SL 4A3GB 4RKBA 1KLGD 1X54A 2AMCB 1U4MA 2PQAB 5L37A 5CV8A 4H02A 2IL8A 1KNEA 3MXUA 5I4DA 1F2YA 5JEAH 2KA7A 5M5YB 4JW0A 5JEAG 4LFAQ 2F0NA 4LFBQ 5KRUA 2F0QA 3QR8A 1EQTA 3TP6A 1NSNS 2EYJA 1BDOA 3RZDB 1FVIA 4GLAC 4LWCA 3KF8B 1SYCA 3HFZB 1PDQA 5IWAL 2K33A 3NBIA 4Y52H 2O5IC 2FHTA 1XYIA 2A69C 4ZUIA 3PUXA 1QNUA 4DV4Q 2EYPA 2K6AA 4KY5A 2QDBA 2JA8H 3VYTA 4DAMA 4XIGS 1Q82C 4X3TA 3PGZA 2LY7A 2JA8G 1STAA 1C8CA 3OIQA 1OXVA 4IALA 1DOLA 4AIMA 4JI0Q 2J4XA 1YNNC 4DV0L 4HEDA 4YHHQ 1BF4A 1B9NA 1KXLA 1B3AA 4FVMA 4ZKCB 1SYBA 2UXDQ 3Q6SA 2F0EA 2A8VA 1E2VA 4DUZQ 1CHPD 4OWWB 2PZTA 5G3LF 5ELOA 1BUVT 5IYCH 1TWCB 1Y14B 2AQ2B 4OXPA 4LF9L 1CKNA 4GN5A 4DV3Q 4HIKA 2B8GA 2E8GA 5IYCG 3I4MH 1KTKA 3DUZA 4KI0A 3U9SA 1N34Q 4GKJQ 3OWEB 4E6IA 3EQLC 2UU9Q 1BCPF 4FDBA 3OWFA 4IUNA 3P20A 1G6ZA 1HJPA 1TWFH 1KL9A 3NK9A 5M9OA 4AH6A 1EIHA 1PRTB 4IPGA 1A63A 2JSOA 4JOIA 4CJ2C 4KK7A 1I6HH 2GVAA 1WI5A 3I4OA 1VMCA 1I4GA 1PH7A 4OX9L 4JBJA 1TQOA 3HOYB 3F1ZA 1TU2B 4CDFC 1HHVA 1HUMA 2L11A 2I46A 3LWUA 1QG7A 5JVH3 1YITA 2K75A 5GQOA 1BNZA 5IP9H 5JJKA 5EPJA 4C3JB 4TSSA 5IP9G 5NUCA 3K5OA 2NN6I 4RGTA 5IGFA 4KN4C 3DWQA 4K2KA 4A76A 1J5EL 1Z9FA 1JR0D 3G6EA 2NVTH 1MIUA 4AYBE 4BBSB 1PFSA 3H0GB 1L1OC 1STBA 4S3SA 3S9WA 3K6OA 1HTPA 4DR2L 4M8AA 1CUKA 2F3WA 1WTHA 4DR1L 4A3BB 1XXGA 2N78A 2OTJA 1DZ1A 1B3QA 1UAPA 3ZJYC 5A2QE 2DNEA 3LNNA 3RUZA 4B3SQ 1JORA 2QDLA 2RA4A 3KLSX 3VA7A 2YU9H 2FFKB 4DK3C 2K50A 1EY5A 3N52A 5M5WH 4YY3Q 4H7BA 4U673 1HFNA 2R7DA 1ILPA 3MAQA 3GTJB 3FVQA 1VQGA 5J22A 2K14A 1GUSA 1I3QB 3J80L 3NE5B 3HKZG 5H1SE 1D7QA 2B39A 5IWAQ 4UP8A 1XMQQ 1I5FA 4CHTB 2WKDA 2MNAA 4IUVA 4IFDI 1JICA 2AUKA 3M85A 3U4VA 1H9SB 2PZWA 4DR6L 2YV5A 4C3IB 4IO9A 2F0JA 1QCBD 1PFNA 4APVA 3IFDA 3F2CA 1ML0D 3J7AV 3AMUA 4LUOA 2KCCA 2Z6KA 5E4WC 3STBC 4DR7L 3CHBD 2BE5C 3E5SA 1Q12A 1HR0W 1AW7A 3FMCA 3KBXA 3JAMi 1YEZA 3HOWB 3T4AC 1ET6A 3E0JA 2HT1A 2QEXA 3JAME 1SE2A 3PCOB 1I6VC 4KKTA 4P2CB 1CQVA 3HOZB 4J6HA 1TY2A 1GHKA 4PG3A 1PXUA 3KF8A 4FF4A 2B29A 2N3SA 3ZYYX 1BOSA 1H9RA 1PH3A 3I4LA 4PZ8A 2EYFA 1S4ZA 4A3EH 3KOJA 2B2TC 2XWBB 3EBEA 1V1PA 3D4RA 4DXFA 4A3EG 2EJGC 1I4PA 2RSNA 2ZM6Q 4OX9Q 1JB3A 5LHY1 1I4QA 4YCWA 3I90A 4X65L 2K7VA 1EY0A 1L0WA 3QWNA 1BR9A 1W6JA 3NTKA 1N32L 1OXUA 4NW2A 1VQPA 2PW7A 3N6RA 3S16H 3CCRA 2JYOA 2F3VA 1OO9B 1TWGB 5ELNA 3A8IE 5LMUL 4X3KA 1PYBA 3BVGA 3FEWX 4DNRB 5KGUA 1IL2A 3HKSA 2FMCA 1X9NA 2D2CC 3SK5A 4DR4Q 1SNCA 3U4ZA 4C3HG 2DUDA 3NTHA 1K9MC 4GOPC 5C3XA 1Y1VB 4A3LH 4LF5L 1WTWA 2F4VL 3RZOH 1JOQA 4P73A 1X3PA 2HCCA 1EOTA 4A3LG 5C3EB 4XQQA 1K3BC 1VQMA 2VNUD 1IKMA 1QILA 1EWCA 1A2TA 1EYAA 1HXYD 3VR6A 1HZ9A 1MKHA 4POGA 1L0YB 1MSHA 1G2SA 3J81i 1O7ZA 2PO4A 3FRPB 1PHJA 4JI3L 2EXDA 5IE8A 3D4DA 3J81E 5ELFA 1W6KA 3K5NA 5JJIA 4BY7B 4QB4A 3Q24A 5LMNL 1PLFA 3SK8A 1IHZA 4JI6L 3S2DH 4CKBA 5E3FA 2AUJD 2RDFA 2R7ZH 1EFID 4JI8Q 1H9JA 1UE6A 3K0XA 3BYYB 1PTOF 2E2JB 3JC66 4DR6Q 1JB7A 1PH2A 5JOBA 1EIYB 1SNMA 4KKSA 1TVXA 3P7JA 3DEOA 1BBXC 2KUMA 3M4OH 2WB1E 3KDFB 4QIWE 1SNOA 2VUMH 4QUCA 2NVXH 5DM73 2B2WC 1TS2A 4A3DB 2C9OA 2VUMG 1PTOB 3M7GA 1SE8A 4WFN3 4RHSA 4KTAA 4EQPA 4EGVA 3I72A 1JWMD 5ELBA 1S5DD 1PH6A 3WOEA 5I9PA 3O13A 4BY1B 1XPOA 1CZGA 2B63H 1R4QB 3J81c 3TZUA 1R9TB 3I4NB 2B63G 2HCIA 1GUOA 1P16A 3LWEA 1WTRA 2QF7A 4KKUA 1ET9A 3MA2B 3TZDA 3W3AA 4CDEC 3K5LA 1H9SA 3D0FA 1Y8PB 3Q0AA 2D0PA 4PNYA 4B9WA 2MPMA 4TVAB 1DM0B 4GNXA 2M9VA 1HQRD 4R4CA 3M4YA 2ZJPA 4IUPA 4X65Q 2XNAC 1VQHA 3PO2H 2XRSD 1LACA 1B44D 4RFBA 1W3SA 4Q5VA 3L9AX 3PO2G 1SNPA 2RQXA 1OTCA 5GAHC 4X6AH 1LTBD 4DAYB 2QA4A 3BZCA 4NXMQ 3WDNA 2QKIC 1Q46A 3J7AF 3VR5A 5I9OA 1CKMA 1IBKQ 4BA2I 3G6JB 4BA1I 2UXCQ 5C4XG 4DV5Q 3K0YA 2XVSA 3OTOQ 2IHEA 2JE6I 3CU7A 2WKCA 4R4QA 2OTLA 2JA5B 5FLXc 2Z4HA 2PMZB 1A15A 3GTGB 4AYBG 4LF5Q 5C4JB 3NWSA 1XX8A 1SE4A 1MJEA 2VB2X 3E9HA 4OWTB 1YHBA 2VY3A 3E3XA 1EQVA 5D3DA 1U4LA 4K0KL 1MJCA 2JK8A 3DEPA 2N55A 4B9XA 3OYYA 1NTGA 1CT1D 1O78A 4LF6L 3I56A 1AP0A 5LMNQ 4DPGA 5IT9L 4JI6Q 1T9HA 3S14H 2RCNA 3NBHB 1Q8IA 1QJOA 4B3RL 4OIJA 2JA6H 3K57A 3KF6B 1KC8C 4FP5D 2JA8B 2JA6G 5M3MH 4DXGA 4H44C 2LXKA 2K5WA 1EU4A
chains in the Genus database with same CATH topology
2CVRA 4V190 1Q1EA 4FF1A 4JK1C 5C0XJ 5CBAE 1B50A 3NUCA 5CGKA 4F87A 2Z1CA 2EY5A 3BDLA 2JP1A 3A7AB 4HMIA 1RCVD 4LJZC 2BA1A 5IT9E 1D6EC 2CW0D 2CQAA 4RKLA 1TWFB 2B2VC 1UEAB 3FPUB 4K8IA 4FXDA 2C5CA 2KJXA 4X3UA 1EZ8A 1ESFA 3BG3A 1B4OA 1II3A 1F9RA 5FO7B 1CA6A 1I6HB 4UAIA 1S5FD 1FYCA 2EZVA 1A3VA 2X69A 1D1KA 4KHZA 2OXPA 1G2TA 2F0PA 5JPMC 1EEFD 5C4ZA 5IGEA 3R93A 2NTTA 4WJWA 1SE3A 1FGBD 3K59A 3VA5A 3OHXC 1GUNA 2E75C 1AFPA 1UUPA 2F0MA 1J9OA 1F9SA 2RVLA 3W2DA 4ME5A 2F0UA 2B2UC 3SK4A 1LTTD 3BYTB 1WTXA 4B08A 1HA6A 2A68D 5CBEE 3MVVA 1FD7D 2J0TD 5BN4A 1ZKOA 5F2DA 2YU9B 5AFWA 2F1MA 3R2TA 1LV9A 1O7YA 1EU3A 1A3UA 4KHVA 4OGQC 1I4HA 1NAPA 4ULLA 3V96A 4XQJA 3G7LA 4IUUA 3HKZB 1MI2A 4DAYA 5EQ0A 5FO9B 1TS5A 2JEBI 4ZUJA 2WACA 4UDUC 1EWHA 3KBGA 3D31A 1AEXA 3NP8A 5COYA 4H0LC 5FO8B 4RCOA 1STYA 4LK1C 4O1NA 1LT3D 2L9HA 1F9PA 1AZPA 2QEJC 4KD3A 4IUTA 3RMHA 3D8GA 1D5MC 5EPKA 2HDMA 5J1ZA 4ZQ3A 4DGZA 2Q8TA 1D2BA 1Z7TA 1FNVA 2BA0A 4CJ0B 4KMUC 1NR4A 4K6DA 5ELDA 2XRQD 1RODA 1IKLA 1HA5A 1O80A 1B9MA 1PZJD 4X3SA 1LT5D 1JC7A 4A3EB 1NR2A 2DNCA 1ZXTA 1B53A 5I2YA 1PRTF 3R8BA 3IL8A 1LABA 2ZXRA 3S16B 3L7ZC 1OXXK 5ELEA 1LO5D 1MD2D 4LMQD 4C3HB 2GA4B 5A2QL 1LT4D 2WINB 1Y8OB 2HQEA 2AWNA 1SXTA 3RZOB 3DWAA 1QOHA 4F88A 4C1NK 5G3LD 5CYUA 2HUGA 2CW0C 1F77A 3VR4A 4OL7A 2IW3A 2E2DC 1BCPD 1A2UA 5CV6A 2L55A 2KEEA 3DM1A 4CBVA 4XXEA 2XN9C 1TIID 4K5VA 2XWJB 2BOSA 3A8JE 5E4XA 4JBWA 3QIAA 5CV9A 2ZXPA 3GTPB 1RD9D 4FF3A 2K1BA 3M4OB 4ZKBB 2EYHA 4YIJA 1IW7C 1PFBA 2VUMB 1TS4A 5FKAC 3A55A 3JAML 5K5PA 5E1FA 1Z6HA 4HMJA 3ND9A 1SYEA 2F0IA 2B63B 2A74C 2OT2A 4TQUS 1KAAA 1U4RA 3PIP3 3HP3A 2NB0A 3A54A 3RD4A 3K58A 3BDOA 3PIO3 1Q3LA 5CV4A 3HG9A 2PNRC 1VMPA 1A3TA 2EXZA 1DXMA 1CA5A 1WTOA 1G8ZD 2SDFA 1GUTA 2SNMA 2EYOA 3PO2B 4OO1H 2L4NA 4FO2A 3IAYA 1DD2A 4OO1G 5ISRA 4K5XA 2EDGA 1TS3A 3MXPA 5C4XB 1STNA 5D14A 1DYQA 3CRLC 4NKLA 2V4DA 4ZLTF 4AYBB 1F2LA 4PQXA 5EKKA 1IYVA 1JQYD 2L12A 1NCVA 1KLUD 1SJHD 4PMCA 1K8MA 2Z4IA 3BS1A 3J81L 2B8FA 4BWGB 5KNDA 5CMDA 1WTQA 1HTLD 2HDLA 3TDQA 3S14B 1U4PA 3U9OA 2JA6B 2E76C 5M3MB 3M7NA 5KYLA 2F0DA 1PFMA 2OEOA 3VR3A 2EJFC 2KEDA 1QE6A 4IQZA 2TMPA 1M4VA 2CHBD 2H4OA 2X6GA 3S2HB 1HCZA 2R92B 5TSSA 2LFNA 3C2PA 3S1MB 4K5WA 3PUVA 3Q22A 1LTID 1M8AA 2B2WA 4QUFA 1TR5A 1ENAA 4ODGA 4QCLA 3VYSA 1BCPC 2A73B 2WV6D 2Q8RE 2D62A 1FNUA 5FK9C 4G7ZC 3ONAB 5ELCA 2A6HD 4RGMA 1XWEA 5C3WA 4FF2A 1I4XA 2G9DA 3DHQA 5FLXE 2K04A 1PTOD 3H94A 1GOZA 3R2IA 3DWPA 4ABNA 2RBMA 5KEEA 4CKEA 3TP8A 1EY4A 5IODA 1BXTA 2O2LD 1JWSD 1SEBD 2WIIB 3C46A 2A5HA 3SK6A 4HR7B 3A56A 3KUPA 1LTSD 3PUWA 2L1BA 4CGYB 3URYA 2E2IB 4KD4A 2KCNA 2PW5A 1ONLA 1QB5D 2EOTA 4ZK9B 3MHBA 4N9PA 4O42A 1PYWD 5CR3A 3H09A 3ITPA 2D5DA 3S1NB 1FR3A 2WB1B 3DXJC 4QIWB 3FPPA 3HOXB 1V8QA 4Z9CB 2MGSA 2F0FA 3LX0A 4DNTB 2K32A 1YNND 2L0CA 2M00A 2K28A 1F2ZA 5DNFA 1E2ZA 2Q8IB 5EBCA 4IURA 4ILWA 1ZYRD 2QILA 4A3JB 1UNSA 5T1GA 4G7HC 1SSOA 5JEAJ 1RKNA 1CQFA 1F9QA 3SE0A 2RDHA 5IGGA 1SFOB 3T53B 1KDAA 3NHHA 1AZQA 3I4MB 3OMGA 3TBIB 3GTOB 2SOBA 2Y0SB 2JEAI 3UI2A 1TWHB 1SNQA 3SR1A 5KYIA 4IN3A 3H6MA 2WAQB 4H13C 3KLRA 1S5BD 2F0HA 2EPBA 1V1OA 1ESRA 1BQQT 3C3LA 5BN5A 1SBBB 3VYRA 3QO2A 4DA2A 1FNWA 2K01A 4TRDA 2VB3X 3PO3B 3MC0B 1RDPD 1TKWB 5C44B 2B2UA 5LL6S 3BDCA 1SJED 2RKSA 4FYDA 3TP5A 1OXSC 2F0TA 2B2YC 3OW7A 3QOJA 4ZAIA 4Y7NB 4XQNA 2NVTB 3EFXD 3NTIA 4FNFA 4A3IB 4RHRA 1JWUD 3CRKC 4XYOA 2A6HC 1HFGA 2Z8LA 2JA7B 2O4XA 4KY7A 1VF5C 1WTPA 5M5WB 1ZEQX 4HCSA 1MGSA 3SEBA 5JVG3 2JXMB 1T5EA 2PQEA 5JPNC 2IX3A 3J7YW 2ZT9C 5LL6X 5DAUA 3GD7A 1O7LA 4EQNA 1BO0A 4TKOB 4OIKA 3IKJA 1AN8A 3D6CA 4MN3A 3DMUA 2BE5D 3I70A 2K05A 1EY7A 4MHEA 4PMBA 1LTAD 3QJYA 2F03A 1S5CD 2EJMA 1EL0A 3HEJA 2NYZD 1DOKA 3H3VC 5CV5A 2ICEC 1DONA 5D3IB 5C0XH 2ICIA 1XTCD 5J39A 1STHA 3NBHA 5C0XG 3FDTA 4RGNA 4R8NA 3SXHA 4Q0FA 1ILQA 4ID6A 3GO5A 1JE4A 5DM63 3MXGA 2EYMA 4RA8A 4BBRB 3HRZC 4IFDJ 3K7AB 5KNBA 2LKVA 1V1PB 2F0GA 4DK0A 4DFAA 3CKIB 5DEHA 5HGTA 2EY6A 1SAPA 1U9RA 3A8KE 2F0VA 3S15B 4FXKC 1QWYA 4OHJA 1R4PB 1JCKB 4C2MB 1LT6D 1ZYRC 3I91A 4IZ8A 1I4RA 1EY6A 4N9TA 4K2LA 4XT1B 4RAUC 1RHPA 1KABA 1K8OA 1SYDA 1PMRA 1STEA 3P1HA 2K5DA 4WRDA 2KOLA 1PRTD 1WCMB 2EVBA 2NWGA 3P75A 3VYUA 3T51B 4J8QA 3D3RA 4QMGA 3MFGA 4HAEA 1BCPB 5BN3A 3NWTA 1SYGA 2AQ1B 1H9KA 1EY8A 4RH6A 4HSPA 1Y1WB 3S2DB 5HURA 3GV6A 3D6WA 4HSVA 2R7ZB 2F0LA 2LS01 1H9MA 3KLSA 5T1IA 2RDGA 4CKCA 2OF1A 2O5JC 1Y8NB 2FJ2A 1G91A 1LTRD 4NP5A 4HTHA 4IUQA 2MP1A 2NVXB 1WD0A 2N88A 2YYZA 3S1QB 3BVMA 5EJWA 5C6AA 2NN6H 5IGDA 1L0XB 1T5XD 1X32A 2NN6G 2A68C 4XT3B 3ND8A 4OO1I 2G9HD 3MZ5A 1J8IA 3Q23A 1RTOA 4PMWA 2F0WA 5C5MA 2QCPX 1ICWA 1EYDA 3HOVB 1CHQD 4U68A 2E2HB 4QF4A 2PPBC 3EVQA 2NUCA 3QG1A 1D5ZC 1G291 3X3MA 5I6WA 5EKIA 1Y69U 4ZRZA 3GTMB 3AU7A 3MEHA 3V2TA 2B2TA 2J7ZA 4DK1A 4A3MB 1VCIA 1C48A 2ZXOA 4IFDH 3QB3A 2PYKA 3GV3A 5EBDA 4IFDG 3MWYW 5CORA 1GXDC 1CZWA 3OPOA 1TWAB 3KK7A 1DOMA 3J80E 3T13A 1I50B 2BDOA 4I65A 1YNJD 4LAAA 3GP7A 3MXNA 3K5MA 1EY9A 4DAPA 3L3OC 1EEID 2D9UA 1EYCA 2KVMA 2NZ1D 4A93B 4DN4M 1KDBA 3OMCA 3CQZB 1Q90A 5KNCA 4R9WA 1MSGA 3MFYA 2SNSA 3A7LA 2A6ED 3NQTA 3GTKB 1IYUA 2K5QA 2FINB 4G57A 2XIWA 2BDNA 3HOUB 3PV0A 2IPKD 5FLXL 4RGOS 2R61A 1HPCA 4C3JG 1PRTC 4RWSC 4KN7C 4XDXA 1B2TA 4KJOA 2M2LA 2EY2A 4PV1C 2F0SA 1V43A 4DAVA 1X3QA 3T16A 2LMCB 1JOOA 2TSSA 3SDZA 3EROA 2IX1A 1IL8A 3FKIB 2FMMA 4RCNA 2IT1A 3PMFA 1LTGD 3TN2A 1EZ6A 3BZDB 1HRJA 2MJ8A 1RF2D 2ENBA 3AB9A 4DF7A 2SEBD 2BCOA 1VDZA 4EQOA 2KHSA 1PZID 3F2UA 4K8JA 4KV6A 1KDCA 3RLFA 4C1NI 2PCFB 1CK1A 4C3IG 5K36H 4C56C 4F8MA 4K14A 5K36G 4ZYSA 1C4QA 2I07B 5EGTA 3SVMA 2VXWA 1SNDA 2F0KA 1SMYD 2K03A 4KJNA 3M3YB 2IJ0A 1WVLA 1WTVA 4CJ1B 2MHVA 4NMZA 1GHJA 5D65A 2PZUA 5CV7A 4MIUA 2H1EA 1DCZA 5EPLA 3NPPA 2NVYB 1ENCA 1GUWA 1MBYA 1DJRD 1D1IA 4J1MA 2DY8A 1S5ED 3QOLA 3TMEA 2A69D 5I6YA 3HS0C 3NQIA 3HGBA 3IFTA 1CTMA 3R3OA 2R93B 1E2WA 1K83B 3TP7A 5CC4A 1STGA 3WOFA 3EA6A 5IIFA 3EJIA 1ENFA 2NTSA 1PZKD 1YNJC 1VF7A 5KIXA 5M3FB 1TT2A 4G4KA 4L6TB 4G7OC 4WORA 1CFMA 3V05A 2EY1A 5IGCA 1QNKA 5I2XA 2B2VA 1HUNA 1A6XA 5M5XB 1SYFA 4L63B 2KQ3A 1GUGA 2NVQB 2NBFA 2IX0A 3C1FA 1TY0A 4HN7A 4M1UB 1JOKA 3SHLA 5JJZA 4NDXA 4XTCS 2A6EC 4DU9A 1NUCA 3E6ZX 3GQBA 1CI3M 4V0BA 3OSOA 2AWOA 1F2MA 2B2YA 3D4WA 3I3CA 5IOCA 2DN8A 3GTQB 2XSCA 2AQ3B 3OIPA 1PTOH 3PUZA 1E0BA 3GTLB 3I8ZA 3TSSA 3I73A 3X3NA 2WP8J 4HCEA 4L8JA 4EVOA 1Q1BA 3PUYA 1GJXA 3BVZA 3NSWA 4XYQA 1WD1A 3VR2A 2X6LA 4K6LA 1IW7D 2KECA 5IGBA 3ERQA 3H91A 2MUYA 2IWHA 1PTOC 5C5LA 1EIGA 1RTNA 2ID0A 1B1ZA 5C4HA 1SDFA 2EE1A 3NXWA 1RJTA 2R3ZA 2R6GA 1CM9A 1OXTA 3T56B 3S17B 4F7XA 1D5XC 1KNAA 2EYLA 4GZYC 2F0OA 4I7ZC 4BS9A 4FXGC 2RSOA 1HQMC 3S1RB 2E74C 5EKLA 2DY7A 1LLRD 2F4IA 3C1EA 5A35A 5C0XI 3MTSA 1Z47A 3HZXA 5JAVA 4A3KB 3OOCA 4A3FB 1SMYC 4R8IA 4KY6A 2L5TA 5FOBB 4A3GB 4RKBA 1KLGD 1U4MA 5CV8A 2IL8A 1KNEA 3MXUA 5I4DA 1F2YA 5JEAH 2KA7A 5M5YB 5JEAG 2F0NA 5KRUA 2F0QA 1EQTA 3TP6A 1NSNS 2EYJA 1BDOA 3RZDB 1SYCA 1PDQA 2K33A 3NBIA 2O5IC 2FHTA 1XYIA 2A69C 4ZUIA 3PUXA 1QNUA 2EYPA 2K6AA 4KY5A 2QDBA 3VYTA 4XIGS 4X3TA 2LY7A 1STAA 1C8CA 3OIQA 1OXVA 4IALA 1DOLA 2J4XA 1YNNC 4HEDA 1BF4A 1B9NA 1B3AA 4FVMA 4ZKCB 1SYBA 3Q6SA 2F0EA 1E2VA 1CHPD 2PZTA 5G3LF 1BUVT 1TWCB 2AQ2B 2B8GA 1KTKA 3DUZA 4KI0A 3U9SA 3OWEB 4E6IA 3EQLC 1BCPF 3OWFA 4IUNA 3P20A 1G6ZA 3NK9A 5M9OA 1EIHA 1PRTB 2JSOA 4CJ2C 4KK7A 1VMCA 1I4GA 1TQOA 3HOYB 1TU2B 1HHVA 1HUMA 2L11A 2I46A 3LWUA 1QG7A 5JVH3 1BNZA 5EPJA 4C3JB 4TSSA 5NUCA 3K5OA 2NN6I 4RGTA 5IGFA 4KN4C 3DWQA 4K2KA 1JR0D 4BBSB 3H0GB 1STBA 4S3SA 3S9WA 3K6OA 1HTPA 4M8AA 2F3WA 4A3BB 1XXGA 1DZ1A 1UAPA 5A2QE 2DNEA 3LNNA 3RUZA 1JORA 2RA4A 3KLSX 3VA7A 2FFKB 1EY5A 3N52A 4H7BA 4U673 1HFNA 1ILPA 3MAQA 3GTJB 3FVQA 5J22A 1GUSA 1I3QB 3J80L 3NE5B 2B39A 4CHTB 2WKDA 4IUVA 4IFDI 1JICA 3M85A 1H9SB 2PZWA 4C3IB 2F0JA 1QCBD 1PFNA 3IFDA 1ML0D 3J7AV 3AMUA 2KCCA 5E4WC 3CHBD 2BE5C 3E5SA 1Q12A 1AW7A 3FMCA 3KBXA 3HOWB 3T4AC 1ET6A 3E0JA 3JAME 1SE2A 4P2CB 1I6VC 4KKTA 1CQVA 3HOZB 4J6HA 1TY2A 1GHKA 1PXUA 3KF8A 4FF4A 3ZYYX 1BOSA 1H9RA 3I4LA 2EYFA 1S4ZA 2B2TC 2XWBB 1V1PA 3D4RA 4DXFA 2EJGC 1I4PA 2RSNA 1JB3A 5LHY1 1I4QA 3I90A 2K7VA 1EY0A 3QWNA 1BR9A 1W6JA 3NTKA 1OXUA 4NW2A 2PW7A 3N6RA 2JYOA 2F3VA 1OO9B 1TWGB 3A8IE 4X3KA 4DNRB 3BVGA 3FEWX 5KGUA 2FMCA 2D2CC 3SK5A 1SNCA 4C3HG 3NTHA 5C3XA 1Y1VB 1WTWA 1JOQA 1X3PA 2HCCA 1EOTA 5C3EB 4XQQA 2VNUD 1IKMA 1QILA 1EWCA 1A2TA 1EYAA 1HXYD 3VR6A 1L0YB 1MSHA 1G2SA 1O7ZA 2PO4A 3FRPB 3D4DA 3J81E 5ELFA 1W6KA 3K5NA 4BY7B 4QB4A 3Q24A 1PLFA 3SK8A 1IHZA 4CKBA 5E3FA 2AUJD 2RDFA 1EFID 1H9JA 3BYYB 1PTOF 2E2JB 5JOBA 1SNMA 4KKSA 1TVXA 3P7JA 3DEOA 1BBXC 2KUMA 1SNOA 4QUCA 5DM73 2B2WC 1TS2A 4A3DB 2C9OA 1PTOB 3M7GA 4WFN3 4RHSA 4KTAA 4EQPA 4EGVA 3I72A 1JWMD 5ELBA 1S5DD 3WOEA 5I9PA 3O13A 4BY1B 1CZGA 1R4QB 3TZUA 1R9TB 3I4NB 2HCIA 1GUOA 3LWEA 1WTRA 2QF7A 4KKUA 1ET9A 3MA2B 3TZDA 3W3AA 3K5LA 1H9SA 1Y8PB 3Q0AA 4PNYA 4B9WA 2MPMA 1DM0B 2M9VA 1HQRD 3M4YA 4IUPA 2XNAC 2XRSD 1LACA 1B44D 4RFBA 4Q5VA 3L9AX 1SNPA 2RQXA 1LTBD 3WDNA 2QKIC 3J7AF 3VR5A 5I9OA 4BA2I 3G6JB 4BA1I 3K0YA 2XVSA 2JE6I 3CU7A 2WKCA 2JA5B 2Z4HA 2PMZB 1A15A 3GTGB 5C4JB 3NWSA 1XX8A 1SE4A 2VB2X 1EQVA 5D3DA 1U4LA 3DEPA 2N55A 4B9XA 1CT1D 1O78A 1AP0A 5IT9L 1Q8IA 1QJOA 4OIJA 3K57A 4FP5D 2JA8B 4DXGA 4H44C 2AUKA 2K5WA 1EU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W A;  4QUF A;  2VXW A;  3G7L A;  4XT3 B;  4O42 A;  2CVR A;  2B2Y A;  1U4M A;  2RSN A;  2K03 A;  2L4N A;  4IUU A;  2IL8 A;  1KNE A;  1MI2 A;  2HCI A;  1SAP A;  1WVL A;  3I90 A;  1WTV A;  4CJ1 B;  3I3C A;  3LWE A;  5EQ0 A;  1EQT A;  4CJ0 B;  1WTR A;  5D65 A;  1J8I A;  1DZ1 A;  1HFG A;  1RTO A;  2Q8R E;  2H1E A;  4NW2 A;  5CBA E;  1B50 A;  2FIN B;  2XIW A;  2HUG A;  2BDN A;  3TZD A;  5EPL A;  1PDQ A;  2MGS A;  5D14 A;  5COY A;  1ICW A;  2JYO A;  2FHT A;  1XYI A;  2RA4 A;  1WTP A;  4U68 A;  1GUW A;  2JP1 A;  3ONA B;  4R9W A;  4X3K A;  4ZLT F;  1E0B A;  1F9P A;  2L9H A;  2FFK B;  2MPM A;  1AZP A;  3I8Z A;  3I91 A;  4HCS A;  2K28 A;  2KEE A;  3DM1 A;  1MGS A;  1F2L A;  3N52 A;  2DY8 A;  5DNF A;  4RWS C;  4X3T A;  4IUT A;  4XT1 B;  4RAU C;  1HFN A;  1RHP A;  4IUP A;  1ILP A;  1C8C A;  5EKI A;  2B2V C;  2HDM A;  1DOL A;  5EPK A;  4XDX A;  1B2T A;  4IUR A;  2L12 A;  1NCV A;  3FPU B;  2B2T A;  2Q8T A;  2J7Z A;  2M2L A;  4HED A;  5T1G A;  1BF4 A;  1SSO A;  1WD1 A;  1B3A A;  4X3U A;  2K04 A;  4ZKC B;  1WTW A;  3Q6S A;  1X3P A;  2KOL A;  2HCC A;  1B4O A;  1EOT A;  1F9Q A;  2X6L A;  1NR4 A;  1F9R A;  2KEC A;  3GV3 A;  5E4X A;  4UAI A;  4IUV A;  2NWG A;  1CA6 A;  1JIC A;  1BO0 A;  1IKM A;  3MWY W;  5CMD A;  1AZQ A;  1WTQ A;  1X3Q A;  2X69 A;  4OIK A;  4HAE A;  5COR A;  3H91 A;  1MSH A;  1G2S A;  2HDL A;  1O7Z A;  1ROD A;  2K1B A;  1G2T A;  1EIG A;  1DOM A;  1RTN A;  1IKL A;  4MN3 A;  4ZKB B;  3UI2 A;  1IL8 A;  2FMM A;  1PFB A;  1PFN A;  3R93 A;  3IFD A;  1SDF A;  1M8A A;  2EE1 A;  2K05 A;  1U4P A;  1A15 A;  1ML0 D;  1RJT A;  2R3Z A;  4MHE A;  3TN2 A;  1O80 A;  1CM9 A;  4X3S A;  1G6Z A;  3GV6 A;  1HRJ A;  1XX8 A;  2MJ8 A;  3D6W A;  4HSV A;  5E4W C;  1PLF A;  2EPB A;  1QNK A;  1ESR A;  1NR2 A;  1EIH A;  1J9O A;  1KNA A;  1ZXT A;  1F9S A;  2B2V A;  2RVL A;  1EL0 A;  1HUN A;  5T1I A;  1B53 A;  1PFM A;  3KBX A;  2RSO A;  2NYZ D;  4CJ2 C;  1DOK A;  2B2U C;  1U4L A;  2KED A;  3QO2 A;  1QE6 A;  2D9U A;  2DY7 A;  2FJ2 A;  2K01 A;  3DEP A;  1U4R A;  2N55 A;  1G91 A;  1VMC A;  3F2U A;  2KVM A;  3KUP A;  2NZ1 D;  3HP3 A;  1DON A;  1TVX A;  3P7J A;  2L1B A;  3DEO A;  2KUM A;  1BBX C;  1WTX A;  4DN4 M;  4IUQ A;  1HA6 A;  2B2U A;  2MP1 A;  3MTS A;  1AP0 A;  1HUM A;  1WD0 A;  3IL8 A;  2L11 A;  1HHV A;  3FDT A;  1Q3L A;  2N88 A;  5CBE E;  4QUC A;  1QG7 A;  1VMP A;  2B2T C;  5JJZ A;  2X6G A;  2B2W C;  1BNZ A;  1ILQ A;  4OIJ A;  5EJW A;  1JE4 A;  2B2Y C;  5EPJ A;  5AFW A;  1CA5 A;  1WTO A;  4ZAI A;  4R8I A;  1X32 A;  2EOT A;  3SVM A;  1LV9 A;  1O7Y A;  1S4Z A;  4LMQ D;  4RA8 A;  2SDF A;  1NAP A;  1MSG A;  4ZK9 B; 
#chains in the Genus database with same CATH topology
 5M3M G;  2CVR A;  2Z6B A;  3CCL A;  2N8N A;  4V19 0;  1IYJ B;  2HIV A;  1HNZ L;  1Q1E A;  4FF1 A;  2ZTE A;  4JK1 C;  5C0X J;  5CBA E;  2KBN A;  1B50 A;  2D0O A;  3NUC A;  1VQ7 A;  5CGK A;  4F87 A;  3S2H H;  2Z1C A;  2EY5 A;  3BDL A;  2R92 H;  2JP1 A;  4QY7 A;  3A7A B;  4HMI A;  3S1M H;  1RCV D;  4LJZ C;  2R92 G;  5HY6 A;  2BA1 A;  5IT9 E;  1D6E C;  2CW0 D;  3NEM A;  4B3T Q;  2CQA A;  4RKL A;  4HJ8 A;  1TWF B;  2B2V C;  1UEA B;  4DR3 Q;  1AE3 A;  3FPU B;  4K8I A;  2C5C A;  2KJX A;  4FXD A;  1N33 L;  4X3U A;  1EZ8 A;  1K8G A;  1ESF A;  4X66 L;  3BG3 A;  1B4O A;  1II3 A;  1F9R A;  5FO7 B;  1CA6 A;  1I6H B;  4UAI A;  1L1O B;  1FYC A;  1S5F D;  2EZV A;  1A3V A;  2X69 A;  1D1K A;  4KHZ A;  2OXP A;  1G2T A;  3PF5 A;  2F0P A;  3KDF A;  5JPM C;  1EEF D;  5C4Z A;  5IGE A;  3K80 C;  3R93 A;  2OQK A;  3W1B A;  2NTT A;  3VDY A;  2JA9 A;  4WJW A;  1K73 C;  1LM0 A;  1KRT A;  1YJW A;  1SE3 A;  1FGB D;  3K59 A;  3VA5 A;  3OHX C;  1JMC A;  5IP7 H;  4JI2 L;  1GUN A;  1NE3 A;  2E75 C;  1QVF A;  1AFP A;  1UUP A;  2F0M A;  1J9O A;  5IP7 G;  1F9S A;  2RVL A;  2PNH A;  3W2D A;  4ME5 A;  2HD3 A;  2F0U A;  2B2U C;  3SK4 A;  4A3C H;  4J15 A;  1LTT D;  3EN2 A;  4CDD C;  1WFQ A;  4A3C G;  4LF8 Q;  3BYT B;  1WTX A;  4B08 A;  4IOA A;  1HA6 A;  4B3M L;  2A68 D;  5FJ8 G;  5CBE E;  3MVV A;  1FD7 D;  2J0T D;  5BN4 A;  1ZKO A;  5DLQ E;  5F2D A;  1JJC B;  2YU9 B;  5AFW A;  2F1M A;  1E1O A;  3R2T A;  1LV9 A;  1O7Y A;  1EU3 A;  1V9P A;  1A3U A;  4ME3 A;  4P71 A;  4KHV A;  1HZC A;  1I4H A;  1NAP A;  1SRO A;  4OGQ C;  4ULL A;  3V96 A;  4XQJ A;  3G7L A;  3I55 A;  1HZA A;  1YVC A;  1EQQ A;  4IUU A;  1VQD A;  3HKZ B;  1MI2 A;  3T1Y L;  2F3I A;  2VQF Q;  3U58 A;  3K8A A;  4DAY A;  3M3Y H;  5EQ0 A;  3FP9 A;  5FO9 B;  1TS5 A;  2ALY B;  2JEB I;  4LUZ A;  4ZUJ A;  4KHP Q;  2WAC A;  1QVG A;  4UDU C;  1EWH A;  3KBG A;  3D31 A;  1AEX A;  3NP8 A;  1HR0 L;  5IY0 A;  5COY A;  4H0L C;  4LF4 Q;  4DUY L;  5FO8 B;  4RCO A;  2E2I H;  1STY A;  2FXQ A;  4LK1 C;  4O1N A;  4NXN L;  4JYA L;  1LT3 D;  2L9H A;  1F9P A;  1AZP A;  2QEJ C;  4KD3 A;  4JBK A;  4IUT A;  3RMH A;  3D8G A;  1D5M C;  5EPK A;  2HDM A;  5J1Z A;  4ZQ3 A;  3UE1 A;  4DGZ A;  4JPB W;  2Q8T A;  4AQY L;  1D2B A;  1X56 A;  1Z7T A;  4DV6 Q;  3S1N H;  3G71 A;  1FNV A;  2BA0 A;  1V1Q A;  4CJ0 B;  4KMU C;  1JE5 A;  1NR4 A;  2WB1 G;  4K6D A;  3HOX H;  5ELD A;  2XRQ D;  2KHI A;  4JI7 L;  2CWP A;  3HOX G;  5J3B A;  2HHH Q;  1ROD A;  2VQE L;  4DR5 L;  1XPR A;  1IKL A;  3UDG A;  1HA5 A;  3F2D A;  2ZTC A;  1O80 A;  1B9M A;  1PZJ D;  1EOV A;  4X3S A;  1LT5 D;  4DNI A;  1JC7 A;  4A3E B;  4A3J H;  1NR2 A;  2DNC A;  2QGQ A;  1ZXT A;  4A3J G;  1B53 A;  5I2Y A;  1PRT F;  2K52 A;  2CH4 W;  1SFO H;  3R8B A;  3MEF A;  4GOP B;  1L2F A;  3GTO H;  1VQJ A;  1LUZ A;  3I4M G;  2XTI A;  3IL8 A;  2Y0S G;  1LAB A;  2ZXR A;  1TWH H;  3S16 B;  3L7Z C;  3B6Y A;  1QZH A;  1OXX K;  2YTX A;  1WYD A;  5ELE A;  3G4S A;  2WAQ G;  1LO5 D;  1MD2 D;  4LMQ D;  3J7A 5;  4C3H B;  2ZTD A;  2GA4 B;  5A2Q L;  1LT4 D;  4GKK L;  2WIN B;  1YNX A;  2JJQ A;  1Y8O B;  2HQE A;  3CD6 A;  2AWN A;  1NJI C;  1XTD A;  1SXT A;  2QW7 A;  3NEN A;  3PO3 H;  2BH2 A;  3RZO B;  3DWA A;  3NEL A;  1QOH A;  3A0J A;  5C44 H;  4F88 A;  1B70 B;  4C1N K;  5G3L D;  3PO3 G;  1L1O A;  5CYU A;  5C44 G;  2HUG A;  2CW0 C;  1F77 A;  1N36 Q;  3VR4 A;  2GVB A;  4OL7 A;  4QL5 A;  2IW3 A;  3GTQ H;  2E2D C;  1VQ5 A;  1BCP D;  1A2U A;  5CV6 A;  3F8T A;  4Y7N H;  2L55 A;  2KEE A;  3DM1 A;  1KD1 C;  4CBV A;  1UWV A;  4XXE A;  4I7A A;  2XN9 C;  1TII D;  3ULJ A;  1PH1 A;  1YIJ A;  2CFM A;  4BXX H;  4A3I H;  4K5V A;  4O2D A;  2XWJ B;  4BXX G;  2BOS A;  3A8J E;  4A3I G;  4JI5 L;  3CW2 C;  1CKO A;  5E4X A;  2UUB Q;  4JBW A;  3QIA A;  3DM3 A;  5CV9 A;  2JA7 H;  4JYA Q;  2ZXP A;  3Q8D A;  3GTP B;  1RD9 D;  4FF3 A;  3CF5 A;  4A75 A;  2JA7 G;  3CAM A;  2K1B A;  3M4O B;  4ZKB B;  2EYH A;  4YIJ A;  1IW7 C;  1PFB A;  2VUM B;  3A74 A;  1VQB A;  1TS4 A;  5FKA C;  1TXY A;  4AQY Q;  3A55 A;  3JAM L;  2LXJ A;  5K5P A;  5E1F A;  1Z6H A;  3KJP A;  4HMJ A;  1HNX L;  3ND9 A;  3CC2 A;  1SYE A;  2F0I A;  2B63 B;  2A74 C;  2OT2 A;  3U50 C;  1VS0 A;  4TQU S;  5EAY A;  1KAA A;  1U4R A;  3KYH C;  3PIP 3;  3HP3 A;  4UP7 A;  2NB0 A;  4IOC A;  3A54 A;  1J6Q A;  3RD4 A;  3K58 A;  3RN5 A;  3RR5 A;  4DV0 Q;  3PSI A;  3BDO A;  3PIO 3;  4HJ9 A;  1Q3L A;  5CV4 A;  1PVO A;  3HG9 A;  2PNR C;  1VMP A;  1A3T A;  2EXZ A;  1NBW A;  1DXM A;  1CA5 A;  1WTO A;  2RF4 A;  3A5Z B;  1G8Z D;  2SDF A;  1GUT A;  4LF9 Q;  2SNM A;  2PQA A;  2OQ0 A;  4HJA A;  2EYO A;  3PO2 B;  4OO1 H;  2L4N A;  4FO2 A;  3IAY A;  1DD2 A;  4OO1 G;  1EQR A;  5ISR A;  4K5X A;  4GLX A;  2EDG A;  1TS3 A;  3MXP A;  4R4I A;  4X62 L;  5C4X B;  4X64 L;  1BVS A;  1K0R A;  1STN A;  5D14 A;  1DYQ A;  3CRL C;  1ICF B;  1N9W A;  4NKL A;  2V4D A;  1GKH A;  4ZLT F;  4GKK Q;  4AYB B;  1F2L A;  2Z6K C;  3ULP A;  4PQX A;  1XNQ L;  5EKK A;  4BBR H;  1K3R A;  1IYV A;  3KJO A;  3K7A H;  1JQY D;  1EWI A;  4BBR G;  4YCV A;  2L12 A;  1NCV A;  1KLU D;  1SJH D;  4PMC A;  3AEV A;  1K8M A;  2XGT A;  2Z4I A;  4L5T A;  3BS1 A;  3J81 L;  2B8F A;  1JJ2 A;  3S15 H;  4BWG B;  1XMO L;  2L15 A;  2KCM A;  5KND A;  5CMD A;  4GOP A;  1J5E Q;  2E5L L;  1WTQ A;  1HTL D;  4C2M H;  2HDL A;  1LTL A;  3TDQ A;  2KCT A;  4DR2 Q;  3S14 B;  1U4P A;  4DR1 Q;  4GN3 B;  3U9O A;  2JA6 B;  2PI2 A;  3F2B A;  3DLL A;  2E76 C;  5IYD H;  5M3M B;  3M7N A;  5KYL A;  5IYD G;  2F0D A;  4GLV B;  1PFM A;  2OEO A;  3BJU A;  1WCM H;  1VQ6 A;  3VR3 A;  1E24 A;  2EJF C;  2KED A;  1QE6 A;  4IQZ A;  1WCM G;  2TMP A;  1YZ6 A;  1M4V A;  2CHB D;  2H4O A;  1KIX A;  3HOY H;  4GN4 B;  2ES2 A;  2X6G A;  1Y1W H;  1HCZ A;  3S2H B;  2R92 B;  5TSS A;  2LFN A;  4IJL A;  2B3G A;  4PZ6 A;  5E7N A;  3C2P A;  1Y1W G;  2AHO B;  3S1M B;  4K5W A;  3PUV A;  3Q22 A;  4UHV A;  3ERS X;  1CSP A;  1LTI D;  1KQS A;  2R7Z G;  4P74 A;  1M8A A;  1DGS A;  2B2W A;  1WOC A;  4QUF A;  1TR5 A;  2K5H A;  1ENA A;  4ODG A;  4QCL A;  3VYS A;  1EYG A;  4LF7 L;  1BCP C;  3I7F A;  2A73 B;  2WV6 D;  2Q8R E;  2D62 A;  1FNU A;  2IY5 B;  4DR7 Q;  4DV7 L;  3S1Q H;  5FK9 C;  4DV1 L;  1D8L A;  4UPA A;  1PH4 A;  4G7Z C;  3ONA B;  5ELC A;  4WJ4 A;  3ER0 A;  2A6H D;  1UE1 A;  4RGM A;  1XWE A;  4OON A;  5C3W A;  4FF2 A;  1I4X A;  2G9D A;  3DHQ A;  5FLX E;  2K04 A;  1PTO D;  4X64 Q;  1YHQ A;  2Q2U A;  1I3Q H;  2RCF A;  3H94 A;  1GOZ A;  4KLK A;  4MNO A;  3R2I A;  3DWP A;  4ABN A;  2RBM A;  5KEE A;  1NMG A;  4CKE A;  3TP8 A;  1EY4 A;  1W2B A;  3HOV H;  2E2H H;  1IZ6 A;  3HOV G;  2IHF A;  5IOD A;  4QQB X;  4YWM A;  3CCJ A;  1LYL A;  1N32 Q;  3GTM H;  1BXT A;  2O2L D;  1XMO Q;  1JWS D;  1SEB D;  4A3M H;  3CP0 A;  2WII B;  2VS1 A;  4YCU A;  1EUJ A;  5LMU Q;  4A3M G;  3C46 A;  1E3P A;  2A5H A;  2OWO A;  3SK6 A;  1GM5 A;  4R4O A;  4HR7 B;  3HOW H;  3A56 A;  3KUP A;  1LTS D;  3PUW A;  2L1B A;  4CGY B;  1TWA H;  3URY A;  1FJG L;  3RN2 A;  1PH8 A;  2F4V Q;  1I50 H;  2E2I B;  4KD4 A;  4GNX C;  1IBM L;  2KCN A;  2PW5 A;  3TRE A;  1ONL A;  3M9B A;  1QB5 D;  2EOT A;  4CDC C;  4RG1 A;  4N8F A;  4ZK9 B;  2UUA L;  3KFU A;  1VQL A;  3MHB A;  1QZG A;  4JI3 Q;  3KLW A;  4N9P A;  4O42 A;  1PYW D;  5CR3 A;  2UUC L;  3H09 A;  3ITP A;  2D5D A;  3S1N B;  1FR3 A;  4IPH A;  2WB1 B;  3DXJ C;  2F52 A;  1JT8 A;  4QIW B;  1Q8K A;  3TQY A;  4A93 H;  3UDF A;  1MHW C;  3FPP A;  3HOX B;  1V8Q A;  1I94 L;  4A93 G;  3CQZ H;  4Z9C B;  2YTY A;  2MGS A;  1HNW L;  2F0F A;  3LX0 A;  4DNT B;  2K32 A;  3CPW A;  1YNN D;  2L0C A;  3J7Z C;  2M00 A;  3S24 A;  2K28 A;  1VQC A;  1F2Z A;  1EIF A;  1YJ9 A;  5JJL A;  5DNF A;  1E2Z A;  2Q8I B;  2CKZ B;  2VL6 A;  5EBC A;  4IUR A;  3CCE A;  3BZK A;  4ILW A;  1ZYR D;  2QIL A;  4A3J B;  1UNS A;  5T1G A;  4G7H C;  1SSO A;  5JEA J;  1RKN A;  4DV7 Q;  3GTK H;  1CQF A;  1F9Q A;  3SE0 A;  2RDH A;  1E22 A;  5IGG A;  1SFO B;  4OEL B;  3T53 B;  1KDA A;  3NHH A;  1AZQ A;  3I4M B;  3OMG A;  1IBL L;  3HOU H;  4MTN A;  3TBI B;  3GTO B;  2SOB A;  4HJ7 A;  1X3F A;  3RNU A;  2Y0S B;  3HOU G;  3HKZ E;  3TS0 A;  2JEA I;  3UI2 A;  1X3G A;  1TWH B;  4LFC L;  1SNQ A;  2K5V A;  4P75 A;  3SR1 A;  5KYI A;  2Z9H A;  4IN3 A;  3H6M A;  2WAQ B;  4LFA L;  4LFB L;  4H13 C;  3I2Z A;  3KLR A;  3OW2 A;  1S5B D;  2F0H A;  2EPB A;  1V1O A;  1ESR A;  1BQQ T;  4MTK A;  1KRS A;  2NZH A;  5GAG C;  3W1G A;  3ICE A;  2OCE A;  3C3L A;  5BN5 A;  1SBB B;  3VYR A;  1ASY A;  3QO2 A;  4DA2 A;  1FNW A;  2K01 A;  4TRD A;  2VB3 X;  1NY4 A;  3PO3 B;  3MC0 B;  1RDP D;  1TKW B;  3L0O A;  5C44 B;  4JI1 L;  2B2U A;  5LL6 S;  3BDC A;  4JI0 L;  3FKI H;  3RLO A;  1VQE A;  1B7Y B;  1SJE D;  2RKS A;  5LMN W;  4FYD A;  3FKI G;  2A1A A;  3A5U A;  3TP5 A;  3TRZ A;  2UXD L;  4IPC A;  1OXS C;  2F0T A;  2B2Y C;  3OW7 A;  3QOJ A;  1VQ8 A;  4ZAI A;  4Y7N B;  4DUZ L;  1VQN A;  4XQN A;  2NVT B;  4DV3 L;  3EFX D;  4JBM A;  3NTI A;  1N34 L;  4GKJ L;  4FNF A;  4A3I B;  4RHR A;  1JWU D;  2UU9 L;  3CRK C;  4XYO A;  1KHI A;  2A6H C;  2VZA A;  1HFG A;  2Z8L A;  2JA7 B;  3PQI A;  4IJH A;  2O4X A;  1S40 A;  4KY7 A;  1VF5 C;  4IPD A;  1YJN A;  1WTP A;  4K0K Q;  5M5W B;  1ZEQ X;  4HCS A;  1MGS A;  3SEB A;  5JVG 3;  2JXM B;  1T5E A;  2PQE A;  3CME A;  4LF6 Q;  5JPN C;  2IX3 A;  1BBW A;  2RHS B;  3J7Y W;  2ZT9 C;  4L5R C;  4B3R Q;  5LL6 X;  1HNW Q;  2PI2 E;  5DAU A;  3GD7 A;  1O7L A;  4EQN A;  1BO0 A;  3H3V H;  4TKO B;  4OIK A;  4ZCK A;  3IKJ A;  2NVY H;  3STB D;  1AN8 A;  4YWL A;  3D6C A;  4MN3 A;  3DMU A;  3PF4 A;  2BE5 D;  4OEM B;  1HNZ Q;  3I70 A;  3UDI A;  2CCZ A;  4EQ5 A;  2K05 A;  1EY7 A;  4HID A;  4MHE A;  4PMB A;  1LTA D;  1UE5 A;  3QJY A;  1QVC A;  2F03 A;  1S5C D;  2EJM A;  1EL0 A;  3HEJ A;  2I5H A;  2NYZ D;  1DOK A;  3RLN A;  3H3V C;  1RIP A;  5CV5 A;  2R93 H;  1HH2 P;  1K83 H;  1X6O A;  2ICE C;  1PH9 A;  1DON A;  4YY3 L;  2R93 G;  5D3I B;  1A8V A;  4LFC Q;  5C0X H;  2ICI A;  1XTC D;  5J39 A;  1STH A;  3NBH A;  5C0X G;  5M3F H;  1C9O A;  3FDT A;  4RGN A;  1N33 Q;  4R8N A;  4X66 Q;  5M3F G;  3KF6 A;  3SXH A;  4Q0F A;  1ILQ A;  1SN8 A;  4ID6 A;  3GO5 A;  2N49 A;  1JE4 A;  1XMQ L;  5DM6 3;  1K8A C;  4HIM A;  1GVP A;  3MXG A;  2EYM A;  4RA8 A;  2CWA A;  4JI4 L;  4NB3 A;  4BBR B;  3HRZ C;  4IFD J;  1HZB A;  1UE7 A;  3K7A B;  5KNB A;  2LKV A;  3MXN B;  4YWK A;  1AE2 A;  1V1P B;  2F0G A;  4DK0 A;  5M5X H;  4JI1 Q;  4DFA A;  3CKI B;  5DEH A;  5HGT A;  2EY6 A;  2Q2H A;  1X65 A;  1SAP A;  1C7Y A;  2NVQ H;  1U9R A;  3A8K E;  2F0V A;  3S15 B;  3UDX A;  4JI2 Q;  4FXK C;  1QWY A;  4OHJ A;  1R4P B;  4MZ9 A;  1JCK B;  4C2M B;  1LT6 D;  3CCU A;  1ZYR C;  3BU2 A;  3I91 A;  4IZ8 A;  1I4R A;  1EY6 A;  4GS3 A;  2CQO A;  4N9T A;  4K2L A;  4XT1 B;  4RAU C;  1RHP A;  3H15 A;  1KAB A;  1K8O A;  4DKA C;  4B3M Q;  1SYD A;  1PMR A;  3PIP A;  1BKB A;  1STE A;  3P1H A;  2K5D A;  4WRD A;  5IYB H;  2KOL A;  1PRT D;  1WCM B;  2EVB A;  3PIO A;  2NWG A;  3P75 A;  2WFW A;  3VYU A;  5IYB G;  1Q81 C;  3T51 B;  4J8Q A;  3D3R A;  4QMG A;  3MFG A;  5HGQ A;  3IRB A;  4HAE A;  1PV4 A;  1BCP B;  5BN3 A;  2I0Q A;  3NWT A;  1SYG A;  2BH8 A;  1S3O A;  2AQ1 B;  2ZM6 L;  3T1Y Q;  2ASB A;  1H9K A;  1X55 A;  3GTL H;  1EY8 A;  1K0S A;  4RH6 A;  4HSP A;  1Y1W B;  3S2D B;  1XPU A;  4JOI C;  5HUR A;  3GV6 A;  3D6W A;  4HSV A;  2R7Z B;  1SLJ A;  2DJF C;  2F0L A;  2LS0 1;  1HR0 Q;  3LGJ A;  1H9M A;  3KLS A;  4DUY Q;  5T1I A;  2RDG A;  4NXN Q;  4CKC A;  2OF1 A;  2MO0 A;  2O5J C;  1Y8N B;  2FJ2 A;  1E1T A;  1G91 A;  1LTR D;  1U0L A;  4NP5 A;  4EX5 A;  4DV2 L;  4DR4 L;  4HTH A;  4IUQ A;  1P8L A;  2MP1 A;  2NVX B;  1WD0 A;  2MQH A;  2N88 A;  2YYZ A;  3S1Q B;  2ATW A;  3BVM A;  3AFP A;  2KEN A;  5EJW A;  5C6A A;  2NN6 H;  5IGD A;  1L0X B;  1T5X D;  3S17 H;  4QJF A;  1X32 A;  2NN6 G;  4JI7 Q;  4JV5 L;  2A68 C;  2VQE Q;  4DR5 Q;  4XT3 B;  2I5M X;  3S1R H;  3ND8 A;  4OO1 I;  2G9H D;  3CC4 A;  3MZ5 A;  2HIX A;  1SRU A;  2Z0S A;  1J8I A;  1EFW A;  3Q23 A;  1RTO A;  4PMW A;  2F0W A;  1PH5 A;  5C5M A;  2LSS A;  1VQA A;  4A3K H;  1ASZ A;  2QCP X;  4A3F H;  4JI4 Q;  1ICW A;  4A3K G;  2Q2T A;  1EYD A;  4JI8 L;  3HOV B;  1CHQ D;  4U68 A;  2E2H B;  1IXR A;  4A3F G;  4QF4 A;  2PPB C;  1UEB A;  3EVQ A;  1VQI A;  4A3G H;  1PA6 A;  2NUC A;  3QG1 A;  1D5Z C;  1G29 1;  3X3M A;  5I6W A;  5EKI A;  4GNX B;  1Y69 U;  4ZRZ A;  3GTM B;  3AU7 A;  1VQO A;  4A3G G;  3MEH A;  3V2T A;  2B2T A;  2CH4 A;  2J7Z A;  4DK1 A;  3CC7 A;  3M4Q A;  4NPS A;  5M5Y H;  4A3M B;  1VCI A;  1C48 A;  4R4T A;  2ZXO A;  4IFD H;  3QB3 A;  1SMX A;  2PYK A;  3GV3 A;  5EBD A;  3AFQ A;  4IFD G;  3MWY W;  3RZD H;  1G51 A;  5COR A;  1GXD C;  3J80 i;  1CZW A;  2VW9 A;  3SGI A;  3OPO A;  1M90 C;  1TWA B;  3KK7 A;  1DOM A;  3J80 E;  3T13 A;  1JJG A;  1I50 B;  2BDO A;  4I65 A;  1YNJ D;  4LAA A;  2MFI A;  3GP7 A;  3MXN A;  3K5M A;  1EY9 A;  4DAP A;  3L3O C;  1EEI D;  2D9U A;  1EYC A;  1TWC H;  2KVM A;  2R7F A;  1QUQ B;  2NZ1 D;  4A93 B;  4DN4 M;  1KDB A;  3OMC A;  3CQZ B;  1Q90 A;  4JI5 Q;  2JQO A;  2H5X A;  5KNC A;  4NXM L;  2ZJQ A;  3FHW A;  1IBK L;  4R9W A;  1MSG A;  3JAM c;  4WJ3 M;  3M4P A;  3MFY A;  3J80 c;  2UXC L;  1BBU A;  4DV2 Q;  4C3H H;  4DV5 L;  2SNS A;  3A7L A;  2A6E D;  1N8R C;  3OTO L;  1FGU A;  1M1K C;  4N8X 1;  3NQT A;  1VQ9 A;  3GTK B;  1IYU A;  4HIO A;  2K5Q A;  2FIN B;  4G57 A;  2XIW A;  2BDN A;  3HOY G;  1PYS B;  1HNX Q;  3HOU B;  3PV0 A;  1YBY A;  4JV5 Q;  2IPK D;  1A62 A;  5FLX L;  5AJ3 L;  4RGO S;  1CSQ A;  4C3J H;  2R61 A;  3CPF A;  1HPC A;  4C3J G;  1PRT C;  3T1H L;  1G6P A;  4RWS C;  1SR3 A;  2AKW B;  4KN7 C;  4LNQ A;  4BBS H;  4XDX A;  4L5Q A;  1B2T A;  3H0G H;  2PMZ E;  4KJO A;  2M2L A;  4BBS G;  2A19 A;  2EY2 A;  3H0G G;  4PV1 C;  1C0A A;  4A3B H;  2F0S A;  1V43 A;  4UY8 C;  4RMF A;  4A3B G;  1A0I A;  4DAV A;  1X3Q A;  3T16 A;  2LMC B;  1JOO A;  2TSS A;  3GTP H;  3SDZ A;  3ERO A;  2IX1 A;  4L5S A;  1IL8 A;  3FKI B;  2FMM A;  4RCN A;  2IT1 A;  3PMF A;  1LTG D;  3CCS A;  3TN2 A;  1EZ6 A;  3GTJ H;  3BZD B;  1YI2 A;  1HRJ A;  2MJ8 A;  4X62 Q;  2K5N A;  1RF2 D;  2ENB A;  3AB9 A;  4DF7 A;  2SEB D;  2BCO A;  2YTV A;  1VDZ A;  2G5D A;  2K4K A;  4JCV E;  4EQO A;  2KHS A;  1XNQ Q;  1PZI D;  3F2U A;  4K8J A;  4KV6 A;  1KDC A;  3RLF A;  4C1N I;  4R1J A;  4B3T L;  3GDE A;  4C3I H;  2PCF B;  4DR3 L;  1CK1 A;  4C3I G;  5K36 H;  4C56 C;  2Q2I A;  4F8M A;  1U5K A;  3L2P A;  4K14 A;  1NMF A;  5K36 G;  4ZYS A;  1C4Q A;  2I07 B;  2E5L Q;  3TS2 A;  5EGT A;  3SVM A;  1GO3 E;  2Y0S E;  2VXW A;  2JN4 A;  1K28 A;  1SND A;  2F0K A;  1SMY D;  2K03 A;  1Q7Y C;  5GAD C;  1GD7 A;  4KJN A;  3M3Y B;  2IJ0 A;  3HOW G;  1WVL A;  1XJV A;  1WTV A;  2WAQ E;  4CJ1 B;  2MHV A;  4NMZ A;  1GHJ A;  5D65 A;  2PZU A;  3K7U C;  5CV7 A;  4MIU A;  3HOZ H;  2UXB L;  2H1E A;  1DCZ A;  3HOZ G;  1X3E A;  5EPL A;  3NPP A;  2NVY B;  5C4X H;  4QGU A;  1ENC A;  1GUW A;  1MBY A;  1DJR D;  1D1I A;  2EQS A;  4J1M A;  3UE0 A;  1XNR L;  2DY8 A;  1S5E D;  3QOL A;  3TME A;  1WJJ A;  4LW1 A;  4LF8 L;  4HJ5 A;  2A69 D;  4ALP A;  5I6Y A;  3HS0 C;  3NQI A;  3HGB A;  5BR8 L;  3IFT A;  5AJ3 Q;  1CTM A;  3R3O A;  2R93 B;  1E2W A;  1K83 B;  1RL2 A;  3TP7 A;  5CC4 A;  3J81 j;  2I5L X;  3WWV A;  1QUQ A;  1STG A;  3WOF A;  4JVZ A;  3EA6 A;  4P72 A;  3T1H Q;  5IIF A;  3EJI A;  1ENF A;  2NTS A;  1PZK D;  1TWG H;  1YNJ C;  1VF7 A;  5KIX A;  5M3F B;  1TT2 A;  4G4K A;  4L6T B;  4G7O C;  4WOR A;  3E0E A;  4LF7 Q;  2VQF L;  1CFM A;  3V05 A;  2EY1 A;  5IGC A;  1QNK A;  4KHP L;  3EIV A;  4DV1 Q;  1NNX A;  1Y1V H;  5I2X A;  3CXC A;  2B2V A;  1HUN A;  4LF4 L;  1A6X A;  1Y1V G;  5M5X B;  5C3E H;  1SYF A;  4L63 B;  2KQ3 A;  5C3E G;  1GUG A;  2NVQ B;  5GRO A;  2NBF A;  1CKN B;  2IX0 A;  3C1F A;  4PZ7 A;  1TY0 A;  2EIF A;  4HN7 A;  4M1U B;  1JOK A;  3SHL A;  4DV6 L;  5JJZ A;  4BY7 H;  2V1C C;  4NDX A;  4XTC S;  2A6E C;  4DU9 A;  1NUC A;  4BY7 G;  3CCQ A;  3E6Z X;  4O0A A;  3GQB A;  4DK6 C;  2HQL A;  2NZO A;  1CI3 M;  4V0B A;  3OSO A;  5GAE C;  2AWO A;  4DV4 L;  1F2M A;  2HHH L;  2B2Y A;  2E2J H;  4UP9 A;  4POF A;  3D4W A;  1O7I A;  4LUV A;  3I3C A;  1B8A A;  5IOC A;  2DN8 A;  4YHH L;  3GTQ B;  2XSC A;  2AQ3 B;  3OIP A;  3G48 A;  1FL0 A;  4A4I A;  4A3D H;  3CMA A;  1E7Z A;  1PTO H;  3PUZ A;  1E0B A;  3GTL B;  4A3D G;  3I8Z A;  3TSS A;  3I73 A;  3X3N A;  1S72 A;  5FLM H;  2WP8 J;  4HCE A;  2DJG C;  4BY1 H;  2C35 B;  4L8J A;  5FLM G;  1FJG Q;  2P5Z X;  4EVO A;  4BY1 G;  2UXB Q;  3I4N H;  1Q1B A;  3PUY A;  1R9T H;  1GJX A;  3BVZ A;  3NSW A;  4XYQ A;  1WD1 A;  3AYH B;  3I4N G;  1IBM Q;  2ZJR A;  3VR2 A;  2X6L A;  4JC0 A;  1IW7 D;  4K6L A;  2KEC A;  5IGB A;  2RHQ B;  4JG2 A;  1VQK A;  3ERQ A;  3H91 A;  2UUA Q;  3H3V I;  2MUY A;  5IT9 c;  1XNR Q;  2IWH A;  1Q86 C;  1PTO C;  5C5L A;  2UUC Q;  1EIG A;  1RTN A;  2ID0 A;  1KAW A;  5FJ8 H;  1B1Z A;  5C4H A;  1SDF A;  2EE1 A;  3NXW A;  1AH9 A;  1RJT A;  2R3Z A;  2R6G A;  1CM9 A;  4OWX B;  2MO1 A;  1OXT A;  1VQ4 A;  3T56 B;  3S17 B;  1I94 Q;  4F7X A;  5BR8 Q;  3W5O A;  1D5X C;  1N36 L;  1KNA A;  2EYL A;  4GZY C;  2F0O A;  4I7Z C;  4BS9 A;  4FXG C;  2RSO A;  1HQM C;  1H95 A;  2DGY A;  3S1R B;  2E74 C;  5EKL A;  2DY7 A;  1LLR D;  1VQF A;  3E9I A;  2GN5 A;  2F4I A;  3C1E A;  3ULL A;  3CCM A;  5A35 A;  5C0X I;  2KHJ A;  1Z47 A;  3HZX A;  3MTS A;  5JAV A;  4A3K B;  3CCV A;  3OOC A;  2JA5 H;  4A3F B;  1SMY C;  3K81 C;  1YHA A;  3GTG H;  2JA5 G;  5C4J H;  3TEH B;  2UUB L;  4R8I A;  1IBL Q;  3AQQ A;  4KY6 A;  2L5T A;  5FOB B;  4B3S L;  4A3G B;  4RKB A;  1KLG D;  1X54 A;  2AMC B;  1U4M A;  2PQA B;  5L37 A;  5CV8 A;  4H02 A;  2IL8 A;  1KNE A;  3MXU A;  5I4D A;  1F2Y A;  5JEA H;  2KA7 A;  5M5Y B;  4JW0 A;  5JEA G;  4LFA Q;  2F0N A;  4LFB Q;  5KRU A;  2F0Q A;  3QR8 A;  1EQT A;  3TP6 A;  1NSN S;  2EYJ A;  1BDO A;  3RZD B;  1FVI A;  4GLA C;  4LWC A;  3KF8 B;  1SYC A;  3HFZ B;  1PDQ A;  5IWA L;  2K33 A;  3NBI A;  4Y52 H;  2O5I C;  2FHT A;  1XYI A;  2A69 C;  4ZUI A;  3PUX A;  1QNU A;  4DV4 Q;  2EYP A;  2K6A A;  4KY5 A;  2QDB A;  2JA8 H;  3VYT A;  4DAM A;  4XIG S;  1Q82 C;  4X3T A;  3PGZ A;  2LY7 A;  2JA8 G;  1STA A;  1C8C A;  3OIQ A;  1OXV A;  4IAL A;  1DOL A;  4AIM A;  4JI0 Q;  2J4X A;  1YNN C;  4DV0 L;  4HED A;  4YHH Q;  1BF4 A;  1B9N A;  1KXL A;  1B3A A;  4FVM A;  4ZKC B;  1SYB A;  2UXD Q;  3Q6S A;  2F0E A;  2A8V A;  1E2V A;  4DUZ Q;  1CHP D;  4OWW B;  2PZT A;  5G3L F;  5ELO A;  1BUV T;  5IYC H;  1TWC B;  1Y14 B;  2AQ2 B;  4OXP A;  4LF9 L;  1CKN A;  4GN5 A;  4DV3 Q;  4HIK A;  2B8G A;  2E8G A;  5IYC G;  3I4M H;  1KTK A;  3DUZ A;  4KI0 A;  3U9S A;  1N34 Q;  4GKJ Q;  3OWE B;  4E6I A;  3EQL C;  2UU9 Q;  1BCP F;  4FDB A;  3OWF A;  4IUN A;  3P20 A;  1G6Z A;  1HJP A;  1TWF H;  1KL9 A;  3NK9 A;  5M9O A;  4AH6 A;  1EIH A;  1PRT B;  4IPG A;  1A63 A;  2JSO A;  4JOI A;  4CJ2 C;  4KK7 A;  1I6H H;  2GVA A;  1WI5 A;  3I4O A;  1VMC A;  1I4G A;  1PH7 A;  4OX9 L;  4JBJ A;  1TQO A;  3HOY B;  3F1Z A;  1TU2 B;  4CDF C;  1HHV A;  1HUM A;  2L11 A;  2I46 A;  3LWU A;  1QG7 A;  5JVH 3;  1YIT A;  2K75 A;  5GQO A;  1BNZ A;  5IP9 H;  5JJK A;  5EPJ A;  4C3J B;  4TSS A;  5IP9 G;  5NUC A;  3K5O A;  2NN6 I;  4RGT A;  5IGF A;  4KN4 C;  3DWQ A;  4K2K A;  4A76 A;  1J5E L;  1Z9F A;  1JR0 D;  3G6E A;  2NVT H;  1MIU A;  4AYB E;  4BBS B;  1PFS A;  3H0G B;  1L1O C;  1STB A;  4S3S A;  3S9W A;  3K6O A;  1HTP A;  4DR2 L;  4M8A A;  1CUK A;  2F3W A;  1WTH A;  4DR1 L;  4A3B B;  1XXG A;  2N78 A;  2OTJ A;  1DZ1 A;  1B3Q A;  1UAP A;  3ZJY C;  5A2Q E;  2DNE A;  3LNN A;  3RUZ A;  4B3S Q;  1JOR A;  2QDL A;  2RA4 A;  3KLS X;  3VA7 A;  2YU9 H;  2FFK B;  4DK3 C;  2K50 A;  1EY5 A;  3N52 A;  5M5W H;  4YY3 Q;  4H7B A;  4U67 3;  1HFN A;  2R7D A;  1ILP A;  3MAQ A;  3GTJ B;  3FVQ A;  1VQG A;  5J22 A;  2K14 A;  1GUS A;  1I3Q B;  3J80 L;  3NE5 B;  3HKZ G;  5H1S E;  1D7Q A;  2B39 A;  5IWA Q;  4UP8 A;  1XMQ Q;  1I5F A;  4CHT B;  2WKD A;  2MNA A;  4IUV A;  4IFD I;  1JIC A;  2AUK A;  3M85 A;  3U4V A;  1H9S B;  2PZW A;  4DR6 L;  2YV5 A;  4C3I B;  4IO9 A;  2F0J A;  1QCB D;  1PFN A;  4APV A;  3IFD A;  3F2C A;  1ML0 D;  3J7A V;  3AMU A;  4LUO A;  2KCC A;  2Z6K A;  5E4W C;  3STB C;  4DR7 L;  3CHB D;  2BE5 C;  3E5S A;  1Q12 A;  1HR0 W;  1AW7 A;  3FMC A;  3KBX A;  3JAM i;  1YEZ A;  3HOW B;  3T4A C;  1ET6 A;  3E0J A;  2HT1 A;  2QEX A;  3JAM E;  1SE2 A;  3PCO B;  1I6V C;  4KKT A;  4P2C B;  1CQV A;  3HOZ B;  4J6H A;  1TY2 A;  1GHK A;  4PG3 A;  1PXU A;  3KF8 A;  4FF4 A;  2B29 A;  2N3S A;  3ZYY X;  1BOS A;  1H9R A;  1PH3 A;  3I4L A;  4PZ8 A;  2EYF A;  1S4Z A;  4A3E H;  3KOJ A;  2B2T C;  2XWB B;  3EBE A;  1V1P A;  3D4R A;  4DXF A;  4A3E G;  2EJG C;  1I4P A;  2RSN A;  2ZM6 Q;  4OX9 Q;  1JB3 A;  5LHY 1;  1I4Q A;  4YCW A;  3I90 A;  4X65 L;  2K7V A;  1EY0 A;  1L0W A;  3QWN A;  1BR9 A;  1W6J A;  3NTK A;  1N32 L;  1OXU A;  4NW2 A;  1VQP A;  2PW7 A;  3N6R A;  3S16 H;  3CCR A;  2JYO A;  2F3V A;  1OO9 B;  1TWG B;  5ELN A;  3A8I E;  5LMU L;  4X3K A;  1PYB A;  3BVG A;  3FEW X;  4DNR B;  5KGU A;  1IL2 A;  3HKS A;  2FMC A;  1X9N A;  2D2C C;  3SK5 A;  4DR4 Q;  1SNC A;  3U4Z A;  4C3H G;  2DUD A;  3NTH A;  1K9M C;  4GOP C;  5C3X A;  1Y1V B;  4A3L H;  4LF5 L;  1WTW A;  2F4V L;  3RZO H;  1JOQ A;  4P73 A;  1X3P A;  2HCC A;  1EOT A;  4A3L G;  5C3E B;  4XQQ A;  1K3B C;  1VQM A;  2VNU D;  1IKM A;  1QIL A;  1EWC A;  1A2T A;  1EYA A;  1HXY D;  3VR6 A;  1HZ9 A;  1MKH A;  4POG A;  1L0Y B;  1MSH A;  1G2S A;  3J81 i;  1O7Z A;  2PO4 A;  3FRP B;  1PHJ A;  4JI3 L;  2EXD A;  5IE8 A;  3D4D A;  3J81 E;  5ELF A;  1W6K A;  3K5N A;  5JJI A;  4BY7 B;  4QB4 A;  3Q24 A;  5LMN L;  1PLF A;  3SK8 A;  1IHZ A;  4JI6 L;  3S2D H;  4CKB A;  5E3F A;  2AUJ D;  2RDF A;  2R7Z H;  1EFI D;  4JI8 Q;  1H9J A;  1UE6 A;  3K0X A;  3BYY B;  1PTO F;  2E2J B;  3JC6 6;  4DR6 Q;  1JB7 A;  1PH2 A;  5JOB A;  1EIY B;  1SNM A;  4KKS A;  1TVX A;  3P7J A;  3DEO A;  1BBX C;  2KUM A;  3M4O H;  2WB1 E;  3KDF B;  4QIW E;  1SNO A;  2VUM H;  4QUC A;  2NVX H;  5DM7 3;  2B2W C;  1TS2 A;  4A3D B;  2C9O A;  2VUM G;  1PTO B;  3M7G A;  1SE8 A;  4WFN 3;  4RHS A;  4KTA A;  4EQP A;  4EGV A;  3I72 A;  1JWM D;  5ELB A;  1S5D D;  1PH6 A;  3WOE A;  5I9P A;  3O13 A;  4BY1 B;  1XPO A;  1CZG A;  2B63 H;  1R4Q B;  3J81 c;  3TZU A;  1R9T B;  3I4N B;  2B63 G;  2HCI A;  1GUO A;  1P16 A;  3LWE A;  1WTR A;  2QF7 A;  4KKU A;  1ET9 A;  3MA2 B;  3TZD A;  3W3A A;  4CDE C;  3K5L A;  1H9S A;  3D0F A;  1Y8P B;  3Q0A A;  2D0P A;  4PNY A;  4B9W A;  2MPM A;  4TVA B;  1DM0 B;  4GNX A;  2M9V A;  1HQR D;  4R4C A;  3M4Y A;  2ZJP A;  4IUP A;  4X65 Q;  2XNA C;  1VQH A;  3PO2 H;  2XRS D;  1LAC A;  1B44 D;  4RFB A;  1W3S A;  4Q5V A;  3L9A X;  3PO2 G;  1SNP A;  2RQX A;  1OTC A;  5GAH C;  4X6A H;  1LTB D;  4DAY B;  2QA4 A;  3BZC A;  4NXM Q;  3WDN A;  2QKI C;  1Q46 A;  3J7A F;  3VR5 A;  5I9O A;  1CKM A;  1IBK Q;  4BA2 I;  3G6J B;  4BA1 I;  2UXC Q;  5C4X G;  4DV5 Q;  3K0Y A;  2XVS A;  3OTO Q;  2IHE A;  2JE6 I;  3CU7 A;  2WKC A;  4R4Q A;  2OTL A;  2JA5 B;  5FLX c;  2Z4H A;  2PMZ B;  1A15 A;  3GTG B;  4AYB G;  4LF5 Q;  5C4J B;  3NWS A;  1XX8 A;  1SE4 A;  1MJE A;  2VB2 X;  3E9H A;  4OWT B;  1YHB A;  2VY3 A;  3E3X A;  1EQV A;  5D3D A;  1U4L A;  4K0K L;  1MJC A;  2JK8 A;  3DEP A;  2N55 A;  4B9X A;  3OYY A;  1NTG A;  1CT1 D;  1O78 A;  4LF6 L;  3I56 A;  1AP0 A;  5LMN Q;  4DPG A;  5IT9 L;  4JI6 Q;  1T9H A;  3S14 H;  2RCN A;  3NBH B;  1Q8I A;  1QJO A;  4B3R L;  4OIJ A;  2JA6 H;  3K57 A;  3KF6 B;  1KC8 C;  4FP5 D;  2JA8 B;  2JA6 G;  5M3M H;  4DXG A;  4H44 C;  2LXK A;  2K5W A;  1EU4 A; 
#chains in the Genus database with same CATH homology
 2CVR A;  4V19 0;  1Q1E A;  4FF1 A;  4JK1 C;  5C0X J;  5CBA E;  1B50 A;  3NUC A;  5CGK A;  4F87 A;  2Z1C A;  2EY5 A;  3BDL A;  2JP1 A;  3A7A B;  4HMI A;  1RCV D;  4LJZ C;  2BA1 A;  5IT9 E;  1D6E C;  2CW0 D;  2CQA A;  4RKL A;  1TWF B;  2B2V C;  1UEA B;  3FPU B;  4K8I A;  4FXD A;  2C5C A;  2KJX A;  4X3U A;  1EZ8 A;  1ESF A;  3BG3 A;  1B4O A;  1II3 A;  1F9R A;  5FO7 B;  1CA6 A;  1I6H B;  4UAI A;  1S5F D;  1FYC A;  2EZV A;  1A3V A;  2X69 A;  1D1K A;  4KHZ A;  2OXP A;  1G2T A;  2F0P A;  5JPM C;  1EEF D;  5C4Z A;  5IGE A;  3R93 A;  2NTT A;  4WJW A;  1SE3 A;  1FGB D;  3K59 A;  3VA5 A;  3OHX C;  1GUN A;  2E75 C;  1AFP A;  1UUP A;  2F0M A;  1J9O A;  1F9S A;  2RVL A;  3W2D A;  4ME5 A;  2F0U A;  2B2U C;  3SK4 A;  1LTT D;  3BYT B;  1WTX A;  4B08 A;  1HA6 A;  2A68 D;  5CBE E;  3MVV A;  1FD7 D;  2J0T D;  5BN4 A;  1ZKO A;  5F2D A;  2YU9 B;  5AFW A;  2F1M A;  3R2T A;  1LV9 A;  1O7Y A;  1EU3 A;  1A3U A;  4KHV A;  4OGQ C;  1I4H A;  1NAP A;  4ULL A;  3V96 A;  4XQJ A;  3G7L A;  4IUU A;  3HKZ B;  1MI2 A;  4DAY A;  5EQ0 A;  5FO9 B;  1TS5 A;  2JEB I;  4ZUJ A;  2WAC A;  4UDU C;  1EWH A;  3KBG A;  3D31 A;  1AEX A;  3NP8 A;  5COY A;  4H0L C;  5FO8 B;  4RCO A;  1STY A;  4LK1 C;  4O1N A;  1LT3 D;  2L9H A;  1F9P A;  1AZP A;  2QEJ C;  4KD3 A;  4IUT A;  3RMH A;  3D8G A;  1D5M C;  5EPK A;  2HDM A;  5J1Z A;  4ZQ3 A;  4DGZ A;  2Q8T A;  1D2B A;  1Z7T A;  1FNV A;  2BA0 A;  4CJ0 B;  4KMU C;  1NR4 A;  4K6D A;  5ELD A;  2XRQ D;  1ROD A;  1IKL A;  1HA5 A;  1O80 A;  1B9M A;  1PZJ D;  4X3S A;  1LT5 D;  1JC7 A;  4A3E B;  1NR2 A;  2DNC A;  1ZXT A;  1B53 A;  5I2Y A;  1PRT F;  3R8B A;  3IL8 A;  1LAB A;  2ZXR A;  3S16 B;  3L7Z C;  1OXX K;  5ELE A;  1LO5 D;  1MD2 D;  4LMQ D;  4C3H B;  2GA4 B;  5A2Q L;  1LT4 D;  2WIN B;  1Y8O B;  2HQE A;  2AWN A;  1SXT A;  3RZO B;  3DWA A;  1QOH A;  4F88 A;  4C1N K;  5G3L D;  5CYU A;  2HUG A;  2CW0 C;  1F77 A;  3VR4 A;  4OL7 A;  2IW3 A;  2E2D C;  1BCP D;  1A2U A;  5CV6 A;  2L55 A;  2KEE A;  3DM1 A;  4CBV A;  4XXE A;  2XN9 C;  1TII D;  4K5V A;  2XWJ B;  2BOS A;  3A8J E;  5E4X A;  4JBW A;  3QIA A;  5CV9 A;  2ZXP A;  3GTP B;  1RD9 D;  4FF3 A;  2K1B A;  3M4O B;  4ZKB B;  2EYH A;  4YIJ A;  1IW7 C;  1PFB A;  2VUM B;  1TS4 A;  5FKA C;  3A55 A;  3JAM L;  5K5P A;  5E1F A;  1Z6H A;  4HMJ A;  3ND9 A;  1SYE A;  2F0I A;  2B63 B;  2A74 C;  2OT2 A;  4TQU S;  1KAA A;  1U4R A;  3PIP 3;  3HP3 A;  2NB0 A;  3A54 A;  3RD4 A;  3K58 A;  3BDO A;  3PIO 3;  1Q3L A;  5CV4 A;  3HG9 A;  2PNR C;  1VMP A;  1A3T A;  2EXZ A;  1DXM A;  1CA5 A;  1WTO A;  1G8Z D;  2SDF A;  1GUT A;  2SNM A;  2EYO A;  3PO2 B;  4OO1 H;  2L4N A;  4FO2 A;  3IAY A;  1DD2 A;  4OO1 G;  5ISR A;  4K5X A;  2EDG A;  1TS3 A;  3MXP A;  5C4X B;  1STN A;  5D14 A;  1DYQ A;  3CRL C;  4NKL A;  2V4D A;  4ZLT F;  4AYB B;  1F2L A;  4PQX A;  5EKK A;  1IYV A;  1JQY D;  2L12 A;  1NCV A;  1KLU D;  1SJH D;  4PMC A;  1K8M A;  2Z4I A;  3BS1 A;  3J81 L;  2B8F A;  4BWG B;  5KND A;  5CMD A;  1WTQ A;  1HTL D;  2HDL A;  3TDQ A;  3S14 B;  1U4P A;  3U9O A;  2JA6 B;  2E76 C;  5M3M B;  3M7N A;  5KYL A;  2F0D A;  1PFM A;  2OEO A;  3VR3 A;  2EJF C;  2KED A;  1QE6 A;  4IQZ A;  2TMP A;  1M4V A;  2CHB D;  2H4O A;  2X6G A;  3S2H B;  1HCZ A;  2R92 B;  5TSS A;  2LFN A;  3C2P A;  3S1M B;  4K5W A;  3PUV A;  3Q22 A;  1LTI D;  1M8A A;  2B2W A;  4QUF A;  1TR5 A;  1ENA A;  4ODG A;  4QCL A;  3VYS A;  1BCP C;  2A73 B;  2WV6 D;  2Q8R E;  2D62 A;  1FNU A;  5FK9 C;  4G7Z C;  3ONA B;  5ELC A;  2A6H D;  4RGM A;  1XWE A;  5C3W A;  4FF2 A;  1I4X A;  2G9D A;  3DHQ A;  5FLX E;  2K04 A;  1PTO D;  3H94 A;  1GOZ A;  3R2I A;  3DWP A;  4ABN A;  2RBM A;  5KEE A;  4CKE A;  3TP8 A;  1EY4 A;  5IOD A;  1BXT A;  2O2L D;  1JWS D;  1SEB D;  2WII B;  3C46 A;  2A5H A;  3SK6 A;  4HR7 B;  3A56 A;  3KUP A;  1LTS D;  3PUW A;  2L1B A;  4CGY B;  3URY A;  2E2I B;  4KD4 A;  2KCN A;  2PW5 A;  1ONL A;  1QB5 D;  2EOT A;  4ZK9 B;  3MHB A;  4N9P A;  4O42 A;  1PYW D;  5CR3 A;  3H09 A;  3ITP A;  2D5D A;  3S1N B;  1FR3 A;  2WB1 B;  3DXJ C;  4QIW B;  3FPP A;  3HOX B;  1V8Q A;  4Z9C B;  2MGS A;  2F0F A;  3LX0 A;  4DNT B;  2K32 A;  1YNN D;  2L0C A;  2M00 A;  2K28 A;  1F2Z A;  5DNF A;  1E2Z A;  2Q8I B;  5EBC A;  4IUR A;  4ILW A;  1ZYR D;  2QIL A;  4A3J B;  1UNS A;  5T1G A;  4G7H C;  1SSO A;  5JEA J;  1RKN A;  1CQF A;  1F9Q A;  3SE0 A;  2RDH A;  5IGG A;  1SFO B;  3T53 B;  1KDA A;  3NHH A;  1AZQ A;  3I4M B;  3OMG A;  3TBI B;  3GTO B;  2SOB A;  2Y0S B;  2JEA I;  3UI2 A;  1TWH B;  1SNQ A;  3SR1 A;  5KYI A;  4IN3 A;  3H6M A;  2WAQ B;  4H13 C;  3KLR A;  1S5B D;  2F0H A;  2EPB A;  1V1O A;  1ESR A;  1BQQ T;  3C3L A;  5BN5 A;  1SBB B;  3VYR A;  3QO2 A;  4DA2 A;  1FNW A;  2K01 A;  4TRD A;  2VB3 X;  3PO3 B;  3MC0 B;  1RDP D;  1TKW B;  5C44 B;  2B2U A;  5LL6 S;  3BDC A;  1SJE D;  2RKS A;  4FYD A;  3TP5 A;  1OXS C;  2F0T A;  2B2Y C;  3OW7 A;  3QOJ A;  4ZAI A;  4Y7N B;  4XQN A;  2NVT B;  3EFX D;  3NTI A;  4FNF A;  4A3I B;  4RHR A;  1JWU D;  3CRK C;  4XYO A;  2A6H C;  1HFG A;  2Z8L A;  2JA7 B;  2O4X A;  4KY7 A;  1VF5 C;  1WTP A;  5M5W B;  1ZEQ X;  4HCS A;  1MGS A;  3SEB A;  5JVG 3;  2JXM B;  1T5E A;  2PQE A;  5JPN C;  2IX3 A;  3J7Y W;  2ZT9 C;  5LL6 X;  5DAU A;  3GD7 A;  1O7L A;  4EQN A;  1BO0 A;  4TKO B;  4OIK A;  3IKJ A;  1AN8 A;  3D6C A;  4MN3 A;  3DMU A;  2BE5 D;  3I70 A;  2K05 A;  1EY7 A;  4MHE A;  4PMB A;  1LTA D;  3QJY A;  2F03 A;  1S5C D;  2EJM A;  1EL0 A;  3HEJ A;  2NYZ D;  1DOK A;  3H3V C;  5CV5 A;  2ICE C;  1DON A;  5D3I B;  5C0X H;  2ICI A;  1XTC D;  5J39 A;  1STH A;  3NBH A;  5C0X G;  3FDT A;  4RGN A;  4R8N A;  3SXH A;  4Q0F A;  1ILQ A;  4ID6 A;  3GO5 A;  1JE4 A;  5DM6 3;  3MXG A;  2EYM A;  4RA8 A;  4BBR B;  3HRZ C;  4IFD J;  3K7A B;  5KNB A;  2LKV A;  1V1P B;  2F0G A;  4DK0 A;  4DFA A;  3CKI B;  5DEH A;  5HGT A;  2EY6 A;  1SAP A;  1U9R A;  3A8K E;  2F0V A;  3S15 B;  4FXK C;  1QWY A;  4OHJ A;  1R4P B;  1JCK B;  4C2M B;  1LT6 D;  1ZYR C;  3I91 A;  4IZ8 A;  1I4R A;  1EY6 A;  4N9T A;  4K2L A;  4XT1 B;  4RAU C;  1RHP A;  1KAB A;  1K8O A;  1SYD A;  1PMR A;  1STE A;  3P1H A;  2K5D A;  4WRD A;  2KOL A;  1PRT D;  1WCM B;  2EVB A;  2NWG A;  3P75 A;  3VYU A;  3T51 B;  4J8Q A;  3D3R A;  4QMG A;  3MFG A;  4HAE A;  1BCP B;  5BN3 A;  3NWT A;  1SYG A;  2AQ1 B;  1H9K A;  1EY8 A;  4RH6 A;  4HSP A;  1Y1W B;  3S2D B;  5HUR A;  3GV6 A;  3D6W A;  4HSV A;  2R7Z B;  2F0L A;  2LS0 1;  1H9M A;  3KLS A;  5T1I A;  2RDG A;  4CKC A;  2OF1 A;  2O5J C;  1Y8N B;  2FJ2 A;  1G91 A;  1LTR D;  4NP5 A;  4HTH A;  4IUQ A;  2MP1 A;  2NVX B;  1WD0 A;  2N88 A;  2YYZ A;  3S1Q B;  3BVM A;  5EJW A;  5C6A A;  2NN6 H;  5IGD A;  1L0X B;  1T5X D;  1X32 A;  2NN6 G;  2A68 C;  4XT3 B;  3ND8 A;  4OO1 I;  2G9H D;  3MZ5 A;  1J8I A;  3Q23 A;  1RTO A;  4PMW A;  2F0W A;  5C5M A;  2QCP X;  1ICW A;  1EYD A;  3HOV B;  1CHQ D;  4U68 A;  2E2H B;  4QF4 A;  2PPB C;  3EVQ A;  2NUC A;  3QG1 A;  1D5Z C;  1G29 1;  3X3M A;  5I6W A;  5EKI A;  1Y69 U;  4ZRZ A;  3GTM B;  3AU7 A;  3MEH A;  3V2T A;  2B2T A;  2J7Z A;  4DK1 A;  4A3M B;  1VCI A;  1C48 A;  2ZXO A;  4IFD H;  3QB3 A;  2PYK A;  3GV3 A;  5EBD A;  4IFD G;  3MWY W;  5COR A;  1GXD C;  1CZW A;  3OPO A;  1TWA B;  3KK7 A;  1DOM A;  3J80 E;  3T13 A;  1I50 B;  2BDO A;  4I65 A;  1YNJ D;  4LAA A;  3GP7 A;  3MXN A;  3K5M A;  1EY9 A;  4DAP A;  3L3O C;  1EEI D;  2D9U A;  1EYC A;  2KVM A;  2NZ1 D;  4A93 B;  4DN4 M;  1KDB A;  3OMC A;  3CQZ B;  1Q90 A;  5KNC A;  4R9W A;  1MSG A;  3MFY A;  2SNS A;  3A7L A;  2A6E D;  3NQT A;  3GTK B;  1IYU A;  2K5Q A;  2FIN B;  4G57 A;  2XIW A;  2BDN A;  3HOU B;  3PV0 A;  2IPK D;  5FLX L;  4RGO S;  2R61 A;  1HPC A;  4C3J G;  1PRT C;  4RWS C;  4KN7 C;  4XDX A;  1B2T A;  4KJO A;  2M2L A;  2EY2 A;  4PV1 C;  2F0S A;  1V43 A;  4DAV A;  1X3Q A;  3T16 A;  2LMC B;  1JOO A;  2TSS A;  3SDZ A;  3ERO A;  2IX1 A;  1IL8 A;  3FKI B;  2FMM A;  4RCN A;  2IT1 A;  3PMF A;  1LTG D;  3TN2 A;  1EZ6 A;  3BZD B;  1HRJ A;  2MJ8 A;  1RF2 D;  2ENB A;  3AB9 A;  4DF7 A;  2SEB D;  2BCO A;  1VDZ A;  4EQO A;  2KHS A;  1PZI D;  3F2U A;  4K8J A;  4KV6 A;  1KDC A;  3RLF A;  4C1N I;  2PCF B;  1CK1 A;  4C3I G;  5K36 H;  4C56 C;  4F8M A;  4K14 A;  5K36 G;  4ZYS A;  1C4Q A;  2I07 B;  5EGT A;  3SVM A;  2VXW A;  1SND A;  2F0K A;  1SMY D;  2K03 A;  4KJN A;  3M3Y B;  2IJ0 A;  1WVL A;  1WTV A;  4CJ1 B;  2MHV A;  4NMZ A;  1GHJ A;  5D65 A;  2PZU A;  5CV7 A;  4MIU A;  2H1E A;  1DCZ A;  5EPL A;  3NPP A;  2NVY B;  1ENC A;  1GUW A;  1MBY A;  1DJR D;  1D1I A;  4J1M A;  2DY8 A;  1S5E D;  3QOL A;  3TME A;  2A69 D;  5I6Y A;  3HS0 C;  3NQI A;  3HGB A;  3IFT A;  1CTM A;  3R3O A;  2R93 B;  1E2W A;  1K83 B;  3TP7 A;  5CC4 A;  1STG A;  3WOF A;  3EA6 A;  5IIF A;  3EJI A;  1ENF A;  2NTS A;  1PZK D;  1YNJ C;  1VF7 A;  5KIX A;  5M3F B;  1TT2 A;  4G4K A;  4L6T B;  4G7O C;  4WOR A;  1CFM A;  3V05 A;  2EY1 A;  5IGC A;  1QNK A;  5I2X A;  2B2V A;  1HUN A;  1A6X A;  5M5X B;  1SYF A;  4L63 B;  2KQ3 A;  1GUG A;  2NVQ B;  2NBF A;  2IX0 A;  3C1F A;  1TY0 A;  4HN7 A;  4M1U B;  1JOK A;  3SHL A;  5JJZ A;  4NDX A;  4XTC S;  2A6E C;  4DU9 A;  1NUC A;  3E6Z X;  3GQB A;  1CI3 M;  4V0B A;  3OSO A;  2AWO A;  1F2M A;  2B2Y A;  3D4W A;  3I3C A;  5IOC A;  2DN8 A;  3GTQ B;  2XSC A;  2AQ3 B;  3OIP A;  1PTO H;  3PUZ A;  1E0B A;  3GTL B;  3I8Z A;  3TSS A;  3I73 A;  3X3N A;  2WP8 J;  4HCE A;  4L8J A;  4EVO A;  1Q1B A;  3PUY A;  1GJX A;  3BVZ A;  3NSW A;  4XYQ A;  1WD1 A;  3VR2 A;  2X6L A;  4K6L A;  1IW7 D;  2KEC A;  5IGB A;  3ERQ A;  3H91 A;  2MUY A;  2IWH A;  1PTO C;  5C5L A;  1EIG A;  1RTN A;  2ID0 A;  1B1Z A;  5C4H A;  1SDF A;  2EE1 A;  3NXW A;  1RJT A;  2R3Z A;  2R6G A;  1CM9 A;  1OXT A;  3T56 B;  3S17 B;  4F7X A;  1D5X C;  1KNA A;  2EYL A;  4GZY C;  2F0O A;  4I7Z C;  4BS9 A;  4FXG C;  2RSO A;  1HQM C;  3S1R B;  2E74 C;  5EKL A;  2DY7 A;  1LLR D;  2F4I A;  3C1E A;  5A35 A;  5C0X I;  3MTS A;  1Z47 A;  3HZX A;  5JAV A;  4A3K B;  3OOC A;  4A3F B;  1SMY C;  4R8I A;  4KY6 A;  2L5T A;  5FOB B;  4A3G B;  4RKB A;  1KLG D;  1U4M A;  5CV8 A;  2IL8 A;  1KNE A;  3MXU A;  5I4D A;  1F2Y A;  5JEA H;  2KA7 A;  5M5Y B;  5JEA G;  2F0N A;  5KRU A;  2F0Q A;  1EQT A;  3TP6 A;  1NSN S;  2EYJ A;  1BDO A;  3RZD B;  1SYC A;  1PDQ A;  2K33 A;  3NBI A;  2O5I C;  2FHT A;  1XYI A;  2A69 C;  4ZUI A;  3PUX A;  1QNU A;  2EYP A;  2K6A A;  4KY5 A;  2QDB A;  3VYT A;  4XIG S;  4X3T A;  2LY7 A;  1STA A;  1C8C A;  3OIQ A;  1OXV A;  4IAL A;  1DOL A;  2J4X A;  1YNN C;  4HED A;  1BF4 A;  1B9N A;  1B3A A;  4FVM A;  4ZKC B;  1SYB A;  3Q6S A;  2F0E A;  1E2V A;  1CHP D;  2PZT A;  5G3L F;  1BUV T;  1TWC B;  2AQ2 B;  2B8G A;  1KTK A;  3DUZ A;  4KI0 A;  3U9S A;  3OWE B;  4E6I A;  3EQL C;  1BCP F;  3OWF A;  4IUN A;  3P20 A;  1G6Z A;  3NK9 A;  5M9O A;  1EIH A;  1PRT B;  2JSO A;  4CJ2 C;  4KK7 A;  1VMC A;  1I4G A;  1TQO A;  3HOY B;  1TU2 B;  1HHV A;  1HUM A;  2L11 A;  2I46 A;  3LWU A;  1QG7 A;  5JVH 3;  1BNZ A;  5EPJ A;  4C3J B;  4TSS A;  5NUC A;  3K5O A;  2NN6 I;  4RGT A;  5IGF A;  4KN4 C;  3DWQ A;  4K2K A;  1JR0 D;  4BBS B;  3H0G B;  1STB A;  4S3S A;  3S9W A;  3K6O A;  1HTP A;  4M8A A;  2F3W A;  4A3B B;  1XXG A;  1DZ1 A;  1UAP A;  5A2Q E;  2DNE A;  3LNN A;  3RUZ A;  1JOR A;  2RA4 A;  3KLS X;  3VA7 A;  2FFK B;  1EY5 A;  3N52 A;  4H7B A;  4U67 3;  1HFN A;  1ILP A;  3MAQ A;  3GTJ B;  3FVQ A;  5J22 A;  1GUS A;  1I3Q B;  3J80 L;  3NE5 B;  2B39 A;  4CHT B;  2WKD A;  4IUV A;  4IFD I;  1JIC A;  3M85 A;  1H9S B;  2PZW A;  4C3I B;  2F0J A;  1QCB D;  1PFN A;  3IFD A;  1ML0 D;  3J7A V;  3AMU A;  2KCC A;  5E4W C;  3CHB D;  2BE5 C;  3E5S A;  1Q12 A;  1AW7 A;  3FMC A;  3KBX A;  3HOW B;  3T4A C;  1ET6 A;  3E0J A;  3JAM E;  1SE2 A;  4P2C B;  1I6V C;  4KKT A;  1CQV A;  3HOZ B;  4J6H A;  1TY2 A;  1GHK A;  1PXU A;  3KF8 A;  4FF4 A;  3ZYY X;  1BOS A;  1H9R A;  3I4L A;  2EYF A;  1S4Z A;  2B2T C;  2XWB B;  1V1P A;  3D4R A;  4DXF A;  2EJG C;  1I4P A;  2RSN A;  1JB3 A;  5LHY 1;  1I4Q A;  3I90 A;  2K7V A;  1EY0 A;  3QWN A;  1BR9 A;  1W6J A;  3NTK A;  1OXU A;  4NW2 A;  2PW7 A;  3N6R A;  2JYO A;  2F3V A;  1OO9 B;  1TWG B;  3A8I E;  4X3K A;  4DNR B;  3BVG A;  3FEW X;  5KGU A;  2FMC A;  2D2C C;  3SK5 A;  1SNC A;  4C3H G;  3NTH A;  5C3X A;  1Y1V B;  1WTW A;  1JOQ A;  1X3P A;  2HCC A;  1EOT A;  5C3E B;  4XQQ A;  2VNU D;  1IKM A;  1QIL A;  1EWC A;  1A2T A;  1EYA A;  1HXY D;  3VR6 A;  1L0Y B;  1MSH A;  1G2S A;  1O7Z A;  2PO4 A;  3FRP B;  3D4D A;  3J81 E;  5ELF A;  1W6K A;  3K5N A;  4BY7 B;  4QB4 A;  3Q24 A;  1PLF A;  3SK8 A;  1IHZ A;  4CKB A;  5E3F A;  2AUJ D;  2RDF A;  1EFI D;  1H9J A;  3BYY B;  1PTO F;  2E2J B;  5JOB A;  1SNM A;  4KKS A;  1TVX A;  3P7J A;  3DEO A;  1BBX C;  2KUM A;  1SNO A;  4QUC A;  5DM7 3;  2B2W C;  1TS2 A;  4A3D B;  2C9O A;  1PTO B;  3M7G A;  4WFN 3;  4RHS A;  4KTA A;  4EQP A;  4EGV A;  3I72 A;  1JWM D;  5ELB A;  1S5D D;  3WOE A;  5I9P A;  3O13 A;  4BY1 B;  1CZG A;  1R4Q B;  3TZU A;  1R9T B;  3I4N B;  2HCI A;  1GUO A;  3LWE A;  1WTR A;  2QF7 A;  4KKU A;  1ET9 A;  3MA2 B;  3TZD A;  3W3A A;  3K5L A;  1H9S A;  1Y8P B;  3Q0A A;  4PNY A;  4B9W A;  2MPM A;  1DM0 B;  2M9V A;  1HQR D;  3M4Y A;  4IUP A;  2XNA C;  2XRS D;  1LAC A;  1B44 D;  4RFB A;  4Q5V A;  3L9A X;  1SNP A;  2RQX A;  1LTB D;  3WDN A;  2QKI C;  3J7A F;  3VR5 A;  5I9O A;  4BA2 I;  3G6J B;  4BA1 I;  3K0Y A;  2XVS A;  2JE6 I;  3CU7 A;  2WKC A;  2JA5 B;  2Z4H A;  2PMZ B;  1A15 A;  3GTG B;  5C4J B;  3NWS A;  1XX8 A;  1SE4 A;  2VB2 X;  1EQV A;  5D3D A;  1U4L A;  3DEP A;  2N55 A;  4B9X A;  1CT1 D;  1O78 A;  1AP0 A;  5IT9 L;  1Q8I A;  1QJO A;  4OIJ A;  3K57 A;  4FP5 D;  2JA8 B;  4DXG A;  4H44 C;  2AUK A;  2K5W A;  1EU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...