1WD0A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd0A00
1S4ZA 2CVRA 5COYA 5CMDA 2HCIA 1RHPA 3DM1A 4XDXA 4DN4M 1G2SA 1BO0A 1U4LA 2JP1A 4ZLTF 5D65A 1WD0A 1B53A 1SDFA 2HDLA 2X6LA 1C8CA 4R9WA 4CJ0B 4IUVA 2MJ8A 5EKIA 1PFMA 1EIGA 1PLFA 2R3ZA 4RWSC 1MSGA 2NZ1D 3MTSA 1IKLA 3GV6A 3DEPA 1RTNA 2KUMA 4NW2A 5EQ0A 3SVMA 1ICWA 4HSVA 3MWYW 2IL8A 1Q3LA 2EOTA 4IUQA 1IL8A 1DOLA 2K03A 1DOMA 4X3TA 4XT3B 1QG7A 2RVLA 2Q8RE 4R8IA 2N88A 3N52A 4X3UA 1MI2A 2B2WC 3P7JA 5EPLA 1BF4A 3I90A 2XIWA 3IFDA 1LV9A 1WD1A 1G91A 1O7ZA 2RA4A 1MSHA 4OIKA 3KUPA 1M8AA 2B2YC 1IKMA 4UAIA 1AZQA 3QO2A 5CBAE 4LMQD 1WTVA 2RSOA 1HFNA 1O7YA 3IL8A 4CJ1B 5JJZA 1QNKA 2MP1A 2M2LA 1NR4A 3DEOA 1RODA 5T1IA 1HFGA 1BNZA 1JE4A 1X32A 2NWGA 2L4NA 2BDNA 1TVXA 1VMPA 2KEDA 1WVLA 1J9OA 3D6WA 1RTOA 2JYOA 2MPMA 4HEDA 1F2LA 1WTQA 1B2TA 1PDQA 1X3QA 2L9HA 2EPBA 1ILQA 4IURA 1JICA 1DONA 1HUNA 2DY7A 2K01A 2K28A 4QUCA 1AP0A 2HUGA 1F9SA 2Q8TA 2B2VC 3ONAB 1GUWA 4HCSA 1E0BA 2HDMA 1QE6A 2EE1A 2K1BA 2NYZD 2L12A 5EJWA 1DZ1A 4IUPA 2D9UA 2KOLA 2KEEA 1F9RA 4HAEA 2B2TA 1CM9A 1AZPA 4ZAIA 1U4PA 2B2UC 1PFBA 1SAPA 2B2WA 1F9PA 1KNEA 2HCCA 2N55A 5EPJA 4QUFA 1ESRA 1HRJA 2RSNA 2K05A 1XX8A 2B2YA 2KECA 3FPUB 1CA6A 1ILPA 1WTWA 5T1GA 3LWEA 5CORA 1WTRA 1HUMA 1ZXTA 3UI2A 2J7ZA 3R93A 4XT1B 1EQTA 2FFKB 1U4RA 2SDFA 4ZK9B 1G2TA 2VXWA 1WTOA 1SSOA 1NAPA 1ML0D 2FJ2A 2MGSA 2L11A 1EIHA 1PFNA 5D14A 2DY8A 4IUTA 1VMCA 3I8ZA 1U4MA 5EPKA 1CA5A 4MN3A 1B50A 3F2UA 4MHEA 4ZKBB 3H91A 3G7LA 4U68A 2B2VA 1B4OA 1A15A 2FHTA 2FINB 3Q6SA 3HP3A 3FDTA 4RA8A 1NCVA 1NR2A 4IUUA 1KNAA 5DNFA 5CBEE 1B3AA 4O42A 1RJTA 1WTPA 4RAUC 5AFWA 2H1EA 4OIJA 4X3KA 1BBXC 2B2UA 1WTXA 1J8IA 1MGSA 1F9QA 3I3CA 1O80A 4CJ2C 1EOTA 3I91A 4X3SA 1G6ZA 5E4XA 1HHVA 2B2TC 2KVMA 2L1BA 2K04A 2FMMA 3TN2A 4ZKCB 3KBXA 1DOKA 1X3PA 1EL0A 3GV3A 5E4WC 1HA6A 2X6GA 2X69A 1XYIA 3TZDA
chains in the Genus database with same CATH superfamily
5GQOA 2I5HA 1NSNS 1E7ZA 4ABNA 5M3MH 2R93G 1MIUA 1HA5A 2JP1A 4BY7G 4J8QA 4JI1Q 1KAAA 1UE1A 1VQJA 4JI4L 2VQEL 1XTCD 3PUXA 1SR3A 2NVQH 3M7NA 4BXXG 1KDAA 3J81i 4YWLA 1WCMG 4NW2A 3HKSA 1DM0B 1NJIC 5FO7B 1DOLA 1BVSA 1I3QB 4IPGA 2EY1A 1XPUA 5FOBB 4DR7L 3NTIA 5EPLA 1EFWA 3NXWA 1TR5A 3L7ZC 1FYCA 4V0BA 4R8NA 4CJ1B 3CRLC 1B7YB 3E0JA 2MP1A 4EX5A 4RGOS 3CCEA 1PYBA 2YTXA 3OPOA 3OIPA 3HKZE 4J15A 1KHIA 1PH4A 1X56A 1IHZA 4OO1I 3WDNA 3X3MA 1XNRL 5IYDG 1VQ8A 2F1MA 4OWTB 1NTGA 1EU4A 3RLOA 1STNA 2Q8TA 2VQEQ 4DV5L 1PHJA 4JI4Q 3E5SA 4OX9L 5JVG3 2NVXB 2NYZD 1ZYRC 1DZ1A 2H4OA 2VUMG 4R4CA 4QL5A 2AQ1B 1BXTA 2RF4A 5EPJA 3TREA 1IBKL 4GKJL 1AFPA 1JJ2A 2F0OA 3FMCA 2LY7A 3KBGA 4DR7Q 1TWHB 1HCZA 1PZID 1QVFA 3HOXB 2A74C 2PI2E 1IBLQ 5IP9H 4A3FG 2VY3A 1LTBD 3JAMi 5C3WA 1PH3A 4BA2I 1XNRQ 5DLQE 4C3IG 4IPCA 5C4XG 4DV5Q 1SNDA 4CDFC 2SNMA 1RJTA 4DGZA 4F88A 4RAUC 4P2CB 4A75A 4V190 2XWJB 3L0OA 2R93H 5E3FA 3I4NG 2OWOA 5FJ8H 1B44D 2LS01 1BBWA 3S14H 2K5NA 1IBKQ 4GKJQ 5IWAL 2JA8B 1EEFD 1R9TH 3QIAA 3OWEB 3TZDA 2JK8A 5LL6X 5FLXL 4KKUA 3K7AB 3F2BA 1GUGA 4K5WA 4Y7NH 4GNXA 1VQKA 4DV4Q 3TDQA 3D4DA 3PO2H 1KAWA 3U9OA 1Y14B 4K8IA 3LNNA 3CHBD 1SYEA 4DK0A 3H6MA 3W3AA 4FXGC 3PO3H 4J1MA 5LMNL 4BBRH 2F0KA 4X3UA 5I9PA 1EFID 1K28A 2ZTCA 1FGUA 3V05A 2CH4A 1VQ5A 1O7ZA 3PSIA 5JJZA 2NZHA 5A2QE 2WB1E 4A93G 4DNIA 3UDFA 5IWAQ 2WFWA 5KNBA 4IJHA 4C3HG 1VQDA 1YBYA 5IGEA 1SRUA 2B63H 2O4XA 4P71A 4KY7A 3HOUH 4HMJA 5EBDA 1JICA 1DONA 2K01A 2KCCA 2OXPA 1AP0A 3K59A 1JC7A 2A1AA 4KY5A 4QQBX 3F1ZA 4HCSA 3RR5A 5E1FA 1S5DD 2R7ZH 2R92B 1Z9FA 1EQQA 2B2TA 3M4YA 2RKSA 3U4ZA 4QF4A 5LMNQ 3J80c 1VCIA 2KECA 2CCZA 4NXML 1JWUD 1BCPF 3MHBA 1H9SA 3LWEA 2F0FA 1D7QA 1CKNA 3UI2A 4N8X1 1KRSA 3S2HH 4BBSH 2JA9A 1K9MC 3S16B 4DAYA 3VA7A 2VXWA 3T4AC 3N6RA 1Q46A 4CKBA 1SSOA 2L11A 4TQUS 1EIHA 1CA5A 3M3YH 1B50A 4ZKBB 1Q8KA 5M5WB 4PMWA 3T51B 1B4OA 4EGVA 2K75A 2JSOA 4NXNL 2CQOA 2N8NA 1SNQA 4WFN3 5JEAJ 4XYOA 2B2UA 3J7ZC 4DR4L 5CV8A 2E74C 2QILA 3VA5A 4A3KG 3NP8A 5GAHC 1EQRA 1GO3E 4DFAA 1HTPA 5E4WC 4NXMQ 2C5CA 3DM1A 2N78A 2A6EC 1YNND 4RCOA 4PQXA 1YJNA 1EIGA 3MEFA 4A3JH 1HNXL 1STGA 3H94A 1J6QA 3BZDB 4JI0L 4WJ4A 4JI7L 4KD3A 3DWQA 1IL8A 2UXBL 1CHQD 2ZJQA 5C44H 5CR3A 1RCVD 3MXNB 3PIPA 3PUVA 3OHXC 1Y1WB 3C3LA 4NXNQ 1S5ED 4R4TA 3I4MG 3CCMA 3OW2A 1XWEA 3E0EA 4HJ9A 3KDFB 4KN7C 2PNRC 5M3MB 1LT4D 1BDOA 3IL8A 2L55A 4IPDA 4PZ6A 3OMGA 3CPWA 3DMUA 3UE1A 1ONLA 1HFGA 2F4IA 4CKEA 1SYGA 2NVQB 4XQNA 2YV5A 4ZUJA 4A3GB 3G48A 3A74A 5G3LF 2F3IA 1PV4A 1FVIA 5HGTA 3NTHA 4KI0A 3K5LA 5EKKA 3OIQA 4JBJA 1LT3D 3T56B 1ICFB 2RDFA 4OXPA 2AQ3B 1SJHD 1SNCA 4P75A 5GAGC 1JB7A 4JI0Q 1JQYD 1EUJA 2KA7A 2IX3A 2UXBQ 2B2UC 3KJPA 1KL9A 5IP7H 1XMQQ 2B2YA 1XPRA 2RDGA 1PA6A 2IT1A 5F2DA 2F0VA 3FPPA 4HIDA 4LF9Q 3K0YA 2HD3A 2A6HC 2AWOA 3T16A 3TS2A 1U0LA 1A8VA 2I5MX 2K4KA 1NMGA 2GN5A 1NAPA 2MGSA 1TS2A 2E8GA 1DXMA 5CGKA 2G5DA 3Q23A 3RZDH 3J7A5 3J80i 3EFXD 3MAQA 2RDHA 3H15A 2I0QA 2Z6KA 3PGZA 1B3AA 5K36G 3NQIA 3ER0A 5BN4A 2D0PA 2KCMA 1JE5A 3K81C 1S40A 3OYYA 1G6ZA 1HNZL 3CCRA 3NQTA 5ELBA 1SNMA 1OTCA 4EQ5A 1CT1D 5CV5A 5A2QL 2GA4B 1FNWA 4UPAA 1F2YA 5J3BA 2BCOA 1C8CA 4R9WA 3H0GH 4IUVA 4Q5VA 2A19A 4CDEC 2JA6G 2A5HA 4DR3L 1LTSD 2KUMA 3M4PA 3SVMA 3MWYW 2IL8A 1JT8A 2PCFB 3RLFA 2EOTA 1WI5A 4FF2A 2R93B 1E2WA 3FVQA 4X62Q 1HPCA 1R9TB 2NTSA 3IFDA 3UDXA 4RFBA 4R4OA 2B2YC 1SYCA 5ISRA 2PZTA 3HGBA 3GTKH 3PIOA 1YNJD 1HNZQ 5KYIA 3J7AF 2M2LA 3PUYA 2EYPA 4Y7NB 2KHJA 4LFCL 2HQLA 2JEBI 3JC66 3SK5A 1DJRD 5C3EG 3PO2B 1DCZA 4C1NI 1Q8IA 1WTQA 2OQ0A 1G51A 3KFUA 1JR0D 4EQPA 1LT5D 1I4GA 4QY7A 1PRTF 3J7AV 2DY7A 3PO3B 1D5MC 3ONAB 3AEVA 2UUAL 2EYMA 3BZCA 4A3LG 1K8OA 3VDYA 2WP8J 5FLXc 1A62A 4MTNA 2KEEA 1Z47A 2Z6KC 1I94L 4YHHL 3IAYA 1SMYD 1OXXK 1O78A 4E6IA 2HCCA 2NN6H 4A3EH 1V1PB 2ZTDA 1PMRA 3HRZC 3VR2A 1EY9A 1VQOA 2J7ZA 2B63B 1PRTB 4KLKA 1GOZA 4JI5L 3J7YW 1YHQA 1C0AA 3HOUB 4P74A 1R4QB 5D3DA 4L6TB 1UE5A 4LFCQ 3I8ZA 2OCEA 2R7ZB 4DUZQ 2D2CC 2QKIC 3Q6SA 1L0WA 3DWPA 1SE2A 3AFQA 3P75A 1TQOA 1LT6D 2UUAQ 4ULLA 4OIJA 1BQQT 1IL2A 2K5QA 4N9PA 1AEXA 1YITA 3ERQA 3I91A 4YHHQ 4I65A 1I94Q 3S2HB 4BBSB 3CC2A 3T1HL 2JA8H 1MJEA 1KDBA 2K6AA 4BY1G 4K0KL 3K7AH 1QOHA 3I7FA 5KRUA 5COYA 3M3YB 1SDFA 1XTDA 4JI5Q 2E5LL 4POFA 1M1KC 2R3ZA 4OEMB 2R6GA 1ICWA 4L8JA 3SR1A 1SROA 4KKTA 1TKWB 1CUKA 4RMFA 2RCFA 2JA5G 2N88A 1YNXA 2F0NA 4ME5A 1WD1A 2A8VA 4MZ9A 2Q8IB 4KJOA 3GTOH 4HSPA 4A3BH 5J22A 3L3OC 3OTOL 2KCTA 2EYOA 3CCVA 3T1HQ 1G8ZD 4TVAB 4DXFA 1JE4A 1P16A 1TWFH 1CK1A 3BYTB 2XGTA 2DJGC 2SOBA 1QVCA 3TBIB 3EIVA 1QILA 4RHSA 2K28A 2I46A 5C44B 1PFSA 3BYYB 2E5LQ 4JI2Q 3K6OA 3CQZH 1X9NA 2K1BA 2SEBD 4C3HB 1YJ9A 5LMNW 3HKZG 4LF5Q 3ICEA 1Y8NB 1EY8A 3ULPA 2RSNA 3SK8A 1UNSA 5HGQA 1PH1A 4KHPL 2A68C 5CV6A 2G9HD 3CXCA 3QWNA 1KC8C 5EBCA 2EYFA 4B3SL 4IO9A 3OTOQ 1BUVT 2SDFA 5IGFA 1B9MA 5GADC 2E2HH 1KQSA 2OT2A 5M5XH 2F52A 3H91A 4U68A 2PZUA 2QDBA 3DWAA 1XMOQ 1NR2A 3ZJYC 1ASZA 2QF7A 5EAYA 5CC4A 1VQBA 3SDZA 2MO0A 3G6EA 4U673 4NP5A 3S15H 3ND9A 3G71A 2KVMA 2IHEA 4CBVA 1JCKB 2YU9B 1VS0A 2OEOA 3TP8A 3ND8A 1Q12A 4DAMA 4KHPQ 3TP5A 4DK1A 4I7AA 4A3KB 3RZDB 3QOJA 4B3SQ 5ELNA 1IKLA 3DEPA 1IYUA 2PI2A 3FKIH 1RIPA 2IHFA 4X3TA 1N36L 4IUNA 4JYAL 1TY2A 2LKVA 1Y1WH 2UXDL 2QA4A 4M1UB 4JG2A 5IY0A 1G91A 1JOQA 4C3JG 1JJGA 1SYBA 1A3TA 4G7ZC 4LNQA 4IFDG 1BBUA 4X6AH 4LMQD 3SEBA 2O2LD 1QNKA 2WINB 3BVMA 5IGCA 1K8MA 1LTRD 1RODA 4IPHA 3F2DA 2C9OA 2DNEA 3H0GB 3T13A 4OGQC 3HOZH 2E2IH 4A3GH 2MHVA 2MPMA 2F03A 2Z9HA 1T5EA 3CU7A 1SMXA 1X3QA 2MQHA 2K5HA 1NE3A 4N9TA 2E2JH 1T5XD 4DV2L 4LFBL 2PQAB 1D5ZC 2WB1G 3CCJA 1E3PA 1VQ6A 1JOKA 4A3CG 4RG1A 2IY5B 5EGTA 1N36Q 1N33L 1YIJA 3RZOH 4R1JA 3LX0A 1D1KA 2JA7H 3GTKB 4FNFA 1Y69U 2EVBA 4LFAL 3SE0A 1PZKD 5T1GA 1D8LA 1VDZA 4RGMA 3TP6A 3NBIA 2VW9A 3A5UA 4B9WA 4MN3A 4MHEA 5C0XH 2EYHA 1K8AC 2DJFC 1A15A 2FHTA 3AMUA 1E1TA 4GKKL 3DLLA 5DNFA 4LFBQ 1LO5D 4A3EB 1WTXA 4WJ3M 3BDLA 3NE5B 1HNWL 1F9QA 1A6XA 4IN3A 1EY6A 3K57A 5IYCH 1I6HB 4GOPB 1OXTA 4GN5A 4L5TA 1AW7A 3B6YA 4A3DH 4K2LA 1S4ZA 1CFMA 5BN3A 3R2TA 4JPBW 1G2SA 3S1NH 2F0PA 3M7GA 4DV6L 2MJ8A 4RWSC 1V43A 2GVAA 2OTLA 3IRBA 4JBWA 4JI8L 4OX9Q 4K6LA 5DAUA 3T1YL 2RQXA 3UE0A 2EJMA 4BY7H 4NB3A 5ELDA 3KF6B 4GKKQ 1XJVA 1V1PA 1SEBD 4BXXH 2VQFL 1TWCH 3BJUA 3MXUA 1WCMH 1MSHA 2IWHA 4MIUA 1QZGA 1HNWQ 1IKMA 3KF8B 1HFNA 1G291 5IODA 3GO5A 5I2XA 3DEOA 1LTGD 1X32A 2PW7A 1EOVA 1Y1VG 3QR8A 1CQFA 4RCNA 1KD1C 1FNVA 1TVXA 2AKWB 3BU2A 1AE2A 4UP8A 2Z6BA 4YWKA 2CKZB 2PMZE 4DV6Q 2NN6I 1EYCA 2MUYA 4H02A 4AH6A 2HDMA 4X66L 1QUQB 4YCUA 5C6AA 4JI8Q 4ZYSA 2D9UA 3T1YQ 1T9HA 1IW7C 4C2MH 4B3RL 4DPGA 4ZAIA 1GM5A 3HOWG 3GTOB 4A3BB 5M3FG 2B2WA 2F0GA 5IYDH 1XPOA 3W1BA 1TU2B 3HOVG 4UP7A 2VQFQ 1TWFB 1EZ6A 1QZHA 3G4SA 2VUMH 2EY6A 3KLRA 1UUPA 5I4DA 4DV0L 3C2PA 3CKIB 5ELFA 2Q2IA 3V2TA 2E75C 3CQZB 4ODGA 3I2ZA 1SNPA 4OELB 3KLWA 3A5ZB 4XIGS 4XXEA 3WOFA 1JB3A 2ZXRA 5JJKA 2XVSA 1UE6A 5I6WA 1GD7A 4A3FH 2QEJC 4PG3A 4X66Q 1D6EC 1CZGA 1A2TA 1MHWC 2WACA 4B3RQ 4C3IH 4ZKCB 3SGIA 1DOKA 1PRTC 3MVVA 5C4XH 2X6GA 5IYBG 4LUOA 5CV4A 2F0TA 2E2HB 4DN4M 2R61A 2NUCA 5M5XB 2NB0A 4DV0Q 3I4NH 1A0IA 2X6LA 2YYZA 2CH4W 4JC0A 2XNAC 2Z4IA 1STAA 3RN2A 3GV6A 1IYVA 4G7OC 3ERSX 1SYDA 1EU3A 4GLXA 1VQGA 4XT3B 2TSSA 3J81j 4FXDA 1QJOA 3HOYG 3S15B 1K3BC 1IXRA 4A3IG 2K7VA 2M9VA 2Z8LA 1K8GA 2B2WC 4DNRB 5LMUL 1LV9A 2EDGA 2RA4A 2K14A 3TZUA 1F2ZA 3QO2A 1STBA 1GHKA 4LWCA 2B29A 2KENA 3SK4A 1WYDA 2L4NA 1PVOA 3BZKA 3PF4A 2HIXA 5JVH3 1VQNA 4OO1G 4LF7L 3GTPH 3FKIB 3ITPA 1PYWD 2G9DA 1M4VA 4HCEA 4EQOA 5IE8A 4A93H 4A3MG 2EZVA 2ZXPA 2AUKA 2D62A 4C3HH 2YTYA 4KHZA 3DUZA 3CW2C 2BH2A 3M4QA 1I6VC 4HJAA 4DR4Q 3CCUA 3M85A 1HZAA 4DR6L 1XX8A 1Z6HA 1PH7A 1CA6A 5J1ZA 5LMUQ 3HOZB 2E2IB 3S17B 4AYBE 5H1SE 4NDXA 2LMCB 1EY4A 4XQQA 2E2JB 3BVGA 1HNXQ 1PH9A 2DY8A 1VMCA 3U58A 1DGSA 4ZRZA 4LF7Q 4PV1C 5FLMG 3K80C 4JI7Q 2A69D 2KHSA 1SE3A 2JE6I 2D0OA 1J5EL 3RZOB 2JA7B 5IIFA 1ET9A 1V8QA 1GJXA 3I4LA 4FF3A 1I4XA 1J8IA 3MC0B 1MGSA 3VYSA 4I7ZC 1O80A 5FK9C 2VB2X 1MBYA 1RDPD 3RMHA 3TN2A 2Y0SB 3WWVA 2YU9H 4P73A 2ES2A 4TRDA 1XYIA 2F0DA 2ATWA 3E9IA 4QIWB 1FGBD 3P1HA 1U4LA 4A3KH 3H3VH 5D65A 1B53A 3VYRA 2NZ1D 3MTSA 1E2VA 1O7IA 2XSCA 4QJFA 4KTAA 3NWTA 2WAQB 1SN8A 4H44C 2JN4A 2BA0A 3D6CA 1J5EQ 3Q8DA 2ICEC 3S1QH 1S5CD 2HQEA 1MI2A 3W1GA 3P7JA 3HOXG 4KHVA 4A3DB 3CCLA 3GTLH 4OIKA 4EVOA 3NENA 4RGTA 1U5KA 3TP7A 5CBAE 1WTVA 4JK1C 4DR1L 1SFOH 3VYUA 3S1NB 1KXLA 1GUNA 3TSSA 2NWGA 3Q22A 5IT9E 3I4MH 1VMPA 2VS1A 4AIMA 1CHPD 4C3JB 3GTQH 4B3TL 4G7HC 1PDQA 3RD4A 4HN7A 5C0XJ 2UXCL 1EWHA 1K83H 4QUCA 4BY7B 1ENAA 1AE3A 3H09A 1RD9D 1EWIA 3OW7A 1TWCB 3G6JB 3W2DA 1CM9A 1WCMB 2ZJRA 4GOPA 2Q2HA 5JJIA 1PFBA 1SAPA 2F0UA 2B39A 3BDOA 1JJCB 1GVPA 1HQRD 2K05A 4LF4L 4KN4C 2QDLA 4ZCKA 1WTWA 1FNUA 1HUMA 1TT2A 3MXPA 4IOAA 1PZJD 5JPNC 2F0EA 3R93A 4JBKA 4JV5L 5C0XI 4JBMA 4DR1Q 1X3GA 4ID6A 3KOJA 5ELEA 2B8FA 1Z7TA 3PQIA 4DU9A 4ZQ3A 5KEEA 4A4IA 1AH9A 4IUTA 2NVTH 4CDCC 4DR3Q 2VL6A 4JOIC 1SNOA 2E76C 2F0SA 2K50A 3OOCA 4DV7L 4HIKA 1DD2A 4B3TQ 3EA6A 4C2MB 2F0LA 4Y52H 3KF6A 4BS9A 2HHHL 2CWPA 3E3XA 3VR6A 1KNAA 3GTMH 3I3CA 4PZ7A 1I6HH 2VUMB 1JOOA 1X3PA 1U9RA 2ICIA 4LUVA 3CMEA 4LF4Q 4X65L 1X55A 1HA6A 5K36H 4HJ5A 4IFDI 2K5WA 1IBML 4IJLA 4JV5Q 1HQMC 1LTAD 1NMFA 2HDLA 2HT1A 4LF6L 5EKIA 2V1CC 4APVA 2XRQD 1MSGA 2JXMB 4GLVB 2R92G 1QUQA 2WKCA 4A3FB 2XWBB 1GUSA 3D0FA 1Q3LA 3GTGH 2EJGC 2JQOA 3FP9A 4HJ7A 1K0SA 1VQEA 4GNXB 1PTOB 3FEWX 3UDGA 3N52A 3A8KE 1V1QA 2HHHQ 4OWWB 4C3IB 4GOPC 2JA6H 1Q82C 4DNTB 1JORA 5C4XB 1NY4A 3VR5A 4LAAA 3I4NB 2KHIA 4YY3L 1I4RA 4ILWA 4FP5D 2NVYH 3W5OA 2KEDA 2UUCL 3O13A 1TS5A 1TXYA 3ZYYX 3HFZB 1IBMQ 1Q86C 1ILQA 2DUDA 4LF6Q 1F9SA 4KKSA 2M00A 4RKBA 5EJWA 2IW3A 4YCVA 2EXDA 4RKLA 4C56C 5C3EH 2UUBL 2F0JA 3DHQA 3QOLA 2V4DA 4S3SA 1STHA 1S3OA 4A3LH 2BDOA 1L2FA 3A7LA 4K0KQ 1WOCA 2F4VL 4ME3A 1STEA 1V1OA 3GTPB 2FFKB 3NHHA 3S1MH 2Q2TA 5K5PA 1N34L 5D14A 5C5MA 1H9SB 4A93B 3HOVB 1SE8A 1E24A 1CKNB 1W2BA 1OXSC 3MFYA 2UUCQ 3G7LA 4DAYB 3CRKC 3C1EA 2K33A 1GUTA 1FL0A 5DM73 3CCQA 1PTOD 1FD7D 2NBFA 4RHRA 3D4WA 5M3MG 2WKDA 4TSSA 2UUBQ 1HZCA 1PH5A 2EQSA 3MEHA 5KGUA 2FMMA 3CPFA 4H7BA 1YNNC 1P8LA 4DK3C 5BN5A 5KIXA 3D8GA 1BF4A 1B70B 3A7AB 4K6DA 3TS0A 4ZLTF 1Q1BA 2PPBC 1EY0A 2CW0D 5IT9L 3MXNA 3D4RA 1B8AA 4DKAC 1N34Q 1C48A 1OXUA 1HZBA 4BY1H 1H95A 2J4XA 2A6ED 2K03A 3KDFA 4DA2A 2TMPA 1MJCA 1QG7A 1GHJA 2Q8RE 4UHVA 3X3NA 1CQVA 5TSSA 2Z4HA 3AFPA 1IYJB 3EQLC 1F2MA 1LACA 1VQAA 5C4HA 3NTKA 1VF7A 1WFQA 1AZQA 1E22A 2XTIA 2JA5H 1I50H 4FO2A 4HR7B 5T1IA 1R4PB 1S5FD 4A3IB 4MTKA 2JYOA 3PV0A 1B2TA 3Q0AA 4YCWA 2OQKA 3DXJC 1GXDC 1LABA 2HUGA 1WTHA 5I6YA 1LTID 2RCNA 4FDBA 3S1QB 2KOLA 2A73B 3LWUA 4FVMA 5E7NA 3GTLB 4O0AA 3RUZA 1L1OB 3OMCA 1U4PA 4K5VA 2WIIB 1F9PA 1NBWA 3MFGA 2UU9L 2KCNA 1HRJA 1SFOB 5NUCA 3NBHB 2OF1A 1A63A 4GN3B 4YIJA 1HXYD 1KLUD 2ENBA 1PH6A 3I4MB 3S17H 4DAVA 3GTQB 1H9MA 1VQCA 4K2KA 1U4RA 4A76A 1A3UA 3J81E 1K83B 2B3GA 5IGDA 1ML0D 1UWVA 2XRSD 4B3ML 4ALPA 2A6HD 3A0JA 1VQMA 5FJ8G 2L0CA 1EQVA 3I72A 3EJIA 2IX1A 2EY5A 3HP3A 3LGJA 4JYAQ 1QWYA 4JI3L 4HMIA 4CKCA 5CBEE 2UXDQ 3K7UC 4UDUC 2CQAA 3L9AX 3CCSA 5FKAC 3H3VI 2I5LX 1HHVA 1RKNA 1NNXA 2UU9Q 2ZT9C 3PO2G 3BVZA 5BR8L 1VQ4A 2NVTB 1I4HA 1JWMD 1RHPA 4YWMA 3GTJH 3PO3G 1BO0A 1IBLL 3L2PA 4BBRG 1ZEQX 2PYKA 2ZXOA 1D1IA 1ET6A 1F77A 4L5QA 4DV2Q 2EYLA 4B3MQ 4HSVA 3MZ5A 4IUQA 1DOMA 3GTMB 1YEZA 4XQJA 3I70A 1HJPA 1N33Q 1YNJC 1G6PA 3NPPA 4JI3Q 2GVBA 4LFAQ 3MA2B 2B63G 1KIXA 1EYAA 5GAEC 4UAIA 4H13C 3HOUG 3QG1A 2PW5A 1UAPA 1BKBA 2SNSA 4PZ8A 5KNCA 3JAME 3TMEA 2Y0SE 2R7ZG 5BR8Q 1H9JA 4C3JH 3SHLA 2ZM6L 4IFDH 5EKLA 1C4QA 2HIVA 3T53B 2PNHA 1SMYC 4QIWE 3EVQA 3GTGB 1YHAA 1EYDA 4DV4L 1W3SA 4DF7A 4Z9CB 1EEID 1QE6A 2JA6B 4BBSG 1MKHA 2DN8A 1AZPA 2N55A 4LK1C 5C5LA 2WAQE 1M90C 2F0WA 2NVYB 3CC7A 1B9NA 1XXGA 5IOCA 1I5FA 3GDEA 4A3CH 4CGYB 1TWGH 1KLGD 4UP9A 1EQTA 1MD2D 4KK7A 3PUZA 1TY0A 2Q2UA 1DYQA 2BE5D 1SBBB 1S5BD 1PFNA 3TEHB 1CZWA 1HZ9A 5I2YA 3NELA 4P72A 3PIP3 2ZM6Q 5C3EB 4KD4A 4WJWA 5I9OA 2QEXA 4L5RC 4GN4B 1NCVA 1BOSA 3KYHC 4AYBG 3RN5A 2I07B 1HR0L 5CV9A 1K0RA 4DR5L 1FR3A 2ALYB 3I56A 5M9OA 3K5MA 3HG9A 4CJ2C 3R3OA 3STBD 2JJQA 2QCPX 4PMBA 3F2CA 4A3JG 3S1MB 3GV3A 2X69A 1KABA 2CVRA 3I55A 1CI3M 3TRZA 5C44G 3DM3A 1CSPA 4CJ0B 4FF4A 2R7DA 1PFMA 1PLFA 1RL2A 2Z0SA 5EQ0A 1C7YA 4DV3L 1UEBA 4TKOB 3MXGA 2DGYA 3NEMA 1PTOH 2B8GA 2PO4A 2PZWA 3VR3A 4QB4A 1HR0Q 4DR5Q 4N8FA 2AHOB 1SYFA 3PMFA 2MO1A 3S24A 1VQLA 1SJED 1N8RC 2RSOA 3S1RH 3EBEA 2RHQB 1PYSB 3F8TA 2NTTA 2MNAA 2BDNA 1FJGL 4M8AA 2F0MA 3D6WA 3CC4A 3J81L 4BY1B 1EIFA 2NZOA 2F3WA 1F2LA 3FRPB 3QJYA 2L9HA 5KNDA 4IOCA 4K5XA 4G57A 5IP7G 1S72A 1K73C 1EWCA 1ZKOA 4PNYA 3OSOA 4GNXC 1PTOC 1Y1VH 4F87A 3PF5A 4DV3Q 5CYUA 3K0XA 2LXJA 3A8JE 5IT9c 1Y8PB 1EIYB 3SXHA 1BCPB 3BDCA 1I50B 2JA5B 2E2DC 4R4QA 3A56A 5C4JB 1ZXTA 3AYHB 4H0LC 5JJLA 4RGNA 1TIID 2CW0C 3HOWH 4C1NK 1OXVA 4JCVE 5M3FH 1TS4A 4BWGB 4OHJA 3ULLA 3URYA 4L63B 4FF1A 2A68D 3HOVH 3R2IA 1L0YB 1FJGQ 3KLSA 1KDCA 3U50C 3M4OH 2FINB 2F0QA 3FDTA 4IQZA 4RA8A 2FXQA 1C9OA 1ENFA 4O42A 5HY6A 3UDIA 2LFNA 2KQ3A 2F3VA 2LXKA 3PIO3 2JEAI 1EZ8A 3K8AA 1YHBA 3BS1A 1N9WA 3H0GG 5M5YH 2B2TC 3HKZB 1XMQL 4HTHA 3HZXA 3KBXA 2EJFC 1TS3A 4LF9L 4DV1L 4J6HA 1KRTA 1BR9A 4XDXA 1YZ6A 4K14A 3JAML 5ELOA 1W6JA 4NPSA 1VF5C 3R8BA 2VZAA 1Q1EA 3E6ZX 5IYBH 2XN9C 1L1OA 3BG3A 2CWAA 1TWAH 4IALA 3A8IE 2O5IC 1UE7A 3NBHA 4HIOA 1XNQL 1D2BA 1YI2A 5C3XA 5DM63 4DR6Q 3I90A 3FHWA 2J0TD 5FO9B 1BCPD 2VB3X 3KUPA 1I4PA 3V96A 3GTJB 3AQQA 3HOYH 3S2DH 3U9SA 1WJJA 4A3IH 2PQAA 4JOIA 1SXTA 2N49A 1ENCA 3AU7A 4DV1Q 1RF2D 2CFMA 1RTOA 3J80E 4HEDA 2FMCA 4OONA 4G4KA 4O2DA 3U4VA 2AWNA 2NN6G 5J39A 1HH2P 4X64L 3TQYA 4A3EG 1GUWA 1A3VA 1X3FA 3K5NA 2EE1A 4XTCS 1F9RA 1AN8A 4OO1H 5JPMC 4POGA 1QNUA 4B9XA 4R4IA 4QUFA 4X62L 1X65A 2EXZA 1XNQQ 4A3MH 3H3VC 2ID0A 1ILPA 4AQYL 1WTRA 4PMCA 3C46A 2ASBA 5IGBA 3CD6A 1A2UA 1EY5A 2FJ2A 5LHY1 3A55A 2L15A 1U4MA 4GS3A 1NUCA 2PMZB 1YJWA 1PXUA 3F2UA 4JI6L 1ESFA 4HIMA 1KTKA 3WOEA 1LLRD 4LJZC 2JA8G 4X64Q 1L1OC 1GKHA 1ZYRD 5GROA 4CHTB 1QVGA 4X3KA 2EY2A 1BBXC 1JWSD 1LM0A 2WB1B 2O5JC 1X3EA 5DEHA 1I3QH 5FLMH 1X54A 3EN2A 1TWGB 2L1BA 3S14B 4LF8L 3M9BA 4DR2L 5AFWA 1PH8A 1VQHA 1HTLD 1V9PA 4AQYQ 4L5SA 2HCIA 5G3LD 4IFDJ 2K5VA 1WD0A 1CKMA 4NMZA 3E9HA 2UXCQ 4JVZA 2L5TA 1RTNA 3GP7A 3P20A 4A3BG 4DUZL 4JI6Q 3KF8A 1LTTD 3CF5A 1VQPA 2DNCA 4BBRB 2NVXH 2QW7A 1PTOF 2WV6D 2K52A 3EROA 1O7LA 1M8AA 2EIFA 4WORA 1O7YA 2PQEA 4EQNA 2VNUD 1Y8OB 2F0HA 1NR4A 1QB5D 1BNZA 4O1NA 4IZ8A 4LF8Q 1TWHH 2BE5C 4DR2Q 1B3QA 5JEAG 3HOXH 4QCLA 1CSQA 1J9OA 4OWXB 1WVLA 3NUCA 3CAMA 4DV7Q 2EPBA 3NWSA 4QGUA 1HUNA 1EY7A 3CP0A 1L0XB 5KYLA 1Q90A 1E0BA 3PCOB 1GUOA 4Q0FA 3IKJA 4IUPA 3D3RA 4HAEA 1VQ7A 3AB9A 3STBC 2LSSA 4UY8C 3S1RB 1ESRA 5IGGA 2BA1A 2EYJA 5C4ZA 5D3IB 4X65Q 1IW7D 4F7XA 2BOSA 1UEAB 1X6OA 1STYA 4QMGA 4LUZA 5A35A 4ZK9B 3KLSX 2IJ0A 1WTOA 3KJOA 4LW1A 5EPKA 4DUYL 2KBNA 1Y1VB 3NK9A 2B2VA 4K8JA 4KV6A 4NKLA 4JI2L 3CMAA 1II3A 4IUUA 2H1EA 3NSWA 4LF5L 3J81c 5HURA 1D5XC 5FO8B 1CTMA 1QCBD 2BH8A 2K04A 3HOWB 4YY3Q 4DAPA 1EL0A 5M3FB 1VQFA 4AYBB 2ZTEA 5AJ3L 3FKIG 4ZUIA 5CMDA 2YTVA 2Z1CA 3M4OB 1Q7YC 1Y1WG 1JMCA 1PRTD 3J80L 2AUJD 4A3JB 3SK6A 5ELCA 2ZJPA 1PH2A 1OO9B 1N32L 4GLAC 2IX0A 2N3SA 1H9KA 4DUYQ 1SLJA 4KY6A 2RVLA 1XMOL 1HR0W 4R8IA 3PUWA 5M5YB 1W6KA 3HOZG 5JOBA 2R92H 4A3GG 5JEAH 4BA1I 2XIWA 5L37A 3GQBA 3Q24A 1E2ZA 4MNOA 5FLXE 2F4VQ 3GD7A 2KJXA 1LTLA 5LL6S 2RHSB 4OL7A 5AJ3Q 5JAVA 3S16H 3VYTA 1E1OA 2QGQA 4IURA 2C35B 3IFTA 2JA7G 3OWFA 2CHBD 2B2VC 1TWAB 4HJ8A 1LUZA 2L12A 2MFIA 3VR4A 5M5WH 1N32Q 2AQ2B 4FYDA 4DXGA 3K58A 3JAMc 2Y0SG 3HS0C 1KNEA 2AMCB 1VQ9A 3K5OA 3HOYB 3FPUB 3S2DB 4B08A 2OTJA 4GZYC 5C4JH 1VQIA 2K32A 4WRDA 5CORA 2F0IA 5C0XG 1K3RA 4XT1B 4KMUC 2H5XA 4JI1L 2A69C 1G2TA 1H9RA 4CDDC 1IZ6A 2P5ZX 2R7FA 3S9WA 1EYGA 1B1ZA 1I4QA 1SE4A 3I4OA 4XYQA 2WAQG 1CKOA 5IYCG 4JW0A 3D31A 1ASYA 3QB3A 4RH6A 5IP9G 4A3DG 4FXKC 3KK7A 1WTPA 1Q81C 4A3MB 2K5DA 1BCPC 3RNUA 3ULJA 1EOTA 2RBMA 3RLNA 4X3SA 5CV7A 5E4XA 1YVCA 3I73A 4F8MA 4DK6C 3HEJA 3A54A 1LYLA 2D5DA 2IPKD 4KJNA 3C1FA
chains in the Genus database with same CATH topology
1NSNS 4ABNA 1HA5A 2JP1A 4J8QA 1KAAA 1XTCD 3PUXA 3M7NA 1KDAA 4NW2A 1DM0B 5FO7B 1DOLA 1I3QB 2EY1A 5FOBB 3NTIA 5EPLA 3NXWA 1TR5A 3L7ZC 1FYCA 4V0BA 4R8NA 4CJ1B 3CRLC 3E0JA 2MP1A 4RGOS 3OPOA 3OIPA 1IHZA 4OO1I 3WDNA 3X3MA 2F1MA 1EU4A 1STNA 2Q8TA 3E5SA 2NVXB 5JVG3 2NYZD 1ZYRC 1DZ1A 2H4OA 2AQ1B 1BXTA 5EPJA 1AFPA 2F0OA 3FMCA 2LY7A 3KBGA 1TWHB 1HCZA 1PZID 3HOXB 2A74C 1LTBD 5C3WA 4BA2I 4C3IG 1SNDA 2SNMA 1RJTA 4DGZA 4F88A 4RAUC 4P2CB 4V190 2XWJB 5E3FA 1B44D 2LS01 2JA8B 1EEFD 3QIAA 3OWEB 3TZDA 5LL6X 5FLXL 4KKUA 3K7AB 1GUGA 4K5WA 3TDQA 3D4DA 3U9OA 4K8IA 3LNNA 3CHBD 1SYEA 4DK0A 3H6MA 3W3AA 4FXGC 4J1MA 2F0KA 4X3UA 5I9PA 1EFID 3V05A 1O7ZA 5JJZA 5A2QE 5KNBA 4C3HG 5IGEA 2O4XA 4KY7A 4HMJA 5EBDA 1JICA 1DONA 2K01A 2KCCA 2OXPA 1AP0A 3K59A 1JC7A 4KY5A 4HCSA 5E1FA 1S5DD 2R92B 2B2TA 3M4YA 2RKSA 4QF4A 1VCIA 2KECA 1JWUD 1BCPF 3MHBA 1H9SA 3LWEA 2F0FA 3UI2A 3S16B 4DAYA 3VA7A 2VXWA 3T4AC 3N6RA 4CKBA 1SSOA 2L11A 4TQUS 1EIHA 1CA5A 1B50A 4ZKBB 5M5WB 4PMWA 3T51B 1B4OA 4EGVA 2JSOA 1SNQA 4WFN3 5JEAJ 4XYOA 2B2UA 5CV8A 2E74C 2QILA 3VA5A 3NP8A 4DFAA 1HTPA 5E4WC 2C5CA 3DM1A 2A6EC 1YNND 4RCOA 4PQXA 1EIGA 1STGA 3H94A 3BZDB 4KD3A 3DWQA 1IL8A 1CHQD 5CR3A 1RCVD 3PUVA 3OHXC 1Y1WB 3C3LA 1S5ED 1XWEA 4KN7C 2PNRC 5M3MB 1LT4D 1BDOA 3IL8A 2L55A 3OMGA 3DMUA 1ONLA 1HFGA 2F4IA 4CKEA 1SYGA 2NVQB 4XQNA 4ZUJA 4A3GB 5G3LF 5HGTA 3NTHA 4KI0A 3K5LA 5EKKA 3OIQA 1LT3D 3T56B 2RDFA 2AQ3B 1SJHD 1SNCA 1JQYD 2KA7A 2IX3A 2B2UC 2B2YA 2RDGA 2IT1A 5F2DA 2F0VA 3FPPA 3K0YA 2A6HC 2AWOA 3T16A 1NAPA 2MGSA 1TS2A 1DXMA 5CGKA 3Q23A 3EFXD 3MAQA 2RDHA 1B3AA 5K36G 3NQIA 5BN4A 1G6ZA 3NQTA 5ELBA 1SNMA 1CT1D 5CV5A 5A2QL 2GA4B 1FNWA 1F2YA 2BCOA 1C8CA 4R9WA 4IUVA 4Q5VA 2A5HA 1LTSD 2KUMA 3SVMA 3MWYW 2IL8A 2PCFB 3RLFA 2EOTA 2R93B 4FF2A 1E2WA 3FVQA 1HPCA 1R9TB 2NTSA 3IFDA 4RFBA 2B2YC 1SYCA 5ISRA 2PZTA 3HGBA 1YNJD 5KYIA 3J7AF 2M2LA 3PUYA 2EYPA 4Y7NB 2JEBI 3SK5A 1DJRD 3PO2B 1DCZA 4C1NI 1Q8IA 1WTQA 4EQPA 1JR0D 1LT5D 1I4GA 1PRTF 3J7AV 2DY7A 3PO3B 1D5MC 3ONAB 2EYMA 1K8OA 2WP8J 2KEEA 1Z47A 3IAYA 1SMYD 1OXXK 1O78A 4E6IA 2HCCA 2NN6H 1V1PB 1PMRA 3HRZC 3VR2A 1EY9A 2J7ZA 2B63B 1PRTB 1GOZA 3J7YW 3HOUB 1R4QB 5D3DA 4L6TB 3I8ZA 2R7ZB 2D2CC 2QKIC 3Q6SA 3DWPA 1SE2A 3P75A 1TQOA 1LT6D 4ULLA 4OIJA 1BQQT 2K5QA 4N9PA 1AEXA 3ERQA 3I91A 4I65A 3S2HB 4BBSB 1KDBA 2K6AA 1QOHA 5KRUA 5COYA 3M3YB 1SDFA 2R3ZA 2R6GA 1ICWA 4L8JA 3SR1A 4KKTA 1TKWB 2N88A 2F0NA 4ME5A 1WD1A 2Q8IB 4KJOA 4HSPA 5J22A 3L3OC 2EYOA 1G8ZD 4DXFA 1JE4A 1CK1A 3BYTB 2SOBA 3TBIB 1QILA 4RHSA 2K28A 2I46A 5C44B 3BYYB 3K6OA 2K1BA 2SEBD 4C3HB 1Y8NB 1EY8A 2RSNA 3SK8A 1UNSA 2A68C 5CV6A 2G9HD 3QWNA 5EBCA 2EYFA 1BUVT 2SDFA 5IGFA 1B9MA 2OT2A 3H91A 4U68A 2PZUA 2QDBA 3DWAA 1NR2A 2QF7A 5CC4A 3SDZA 4U673 4NP5A 3ND9A 2KVMA 4CBVA 1JCKB 2YU9B 2OEOA 3TP8A 3ND8A 1Q12A 3TP5A 4DK1A 4A3KB 3RZDB 3QOJA 1IKLA 3DEPA 1IYUA 4X3TA 4IUNA 1TY2A 2LKVA 4M1UB 1G91A 1JOQA 4C3JG 1SYBA 1A3TA 4G7ZC 4IFDG 4LMQD 3SEBA 2O2LD 1QNKA 2WINB 3BVMA 5IGCA 1K8MA 1LTRD 1RODA 2C9OA 2DNEA 3H0GB 3T13A 4OGQC 2MHVA 2MPMA 2F03A 1T5EA 3CU7A 1X3QA 4N9TA 1T5XD 1D5ZC 1JOKA 5EGTA 3LX0A 1D1KA 3GTKB 4FNFA 1Y69U 2EVBA 3SE0A 1PZKD 5T1GA 1VDZA 4RGMA 3TP6A 3NBIA 4B9WA 4MN3A 4MHEA 5C0XH 2EYHA 1A15A 2FHTA 3AMUA 5DNFA 1LO5D 4A3EB 1WTXA 3BDLA 3NE5B 1F9QA 1A6XA 4IN3A 1EY6A 3K57A 1I6HB 1OXTA 1AW7A 4K2LA 1S4ZA 1CFMA 5BN3A 3R2TA 1G2SA 2F0PA 3M7GA 2MJ8A 4RWSC 1V43A 4JBWA 4K6LA 5DAUA 2RQXA 2EJMA 5ELDA 1V1PA 1SEBD 3MXUA 1MSHA 2IWHA 4MIUA 1IKMA 1HFNA 1G291 5IODA 3GO5A 5I2XA 3DEOA 1LTGD 1X32A 2PW7A 4RCNA 1CQFA 1FNVA 1TVXA 2NN6I 1EYCA 2MUYA 2HDMA 5C6AA 4ZYSA 2D9UA 1IW7C 4ZAIA 3GTOB 4A3BB 2B2WA 2F0GA 1TU2B 1TWFB 1EZ6A 2EY6A 3KLRA 1UUPA 5I4DA 3C2PA 3CKIB 5ELFA 3V2TA 2E75C 3CQZB 4ODGA 1SNPA 4XIGS 4XXEA 3WOFA 1JB3A 2ZXRA 2XVSA 5I6WA 2QEJC 1D6EC 1CZGA 1A2TA 2WACA 4ZKCB 1DOKA 1PRTC 3MVVA 2X6GA 5CV4A 2F0TA 2E2HB 4DN4M 2R61A 2NUCA 5M5XB 2NB0A 2X6LA 2YYZA 2XNAC 2Z4IA 1STAA 1IYVA 3GV6A 4G7OC 1SYDA 1EU3A 4XT3B 2TSSA 4FXDA 1QJOA 3S15B 2K7VA 2M9VA 2Z8LA 2B2WC 4DNRB 1LV9A 2EDGA 2RA4A 3TZUA 1F2ZA 3QO2A 1STBA 1GHKA 3SK4A 2L4NA 4OO1G 5JVH3 3ITPA 1PYWD 2G9DA 3FKIB 1M4VA 4HCEA 4EQOA 2EZVA 2ZXPA 2AUKA 2D62A 4KHZA 3DUZA 1I6VC 3M85A 1XX8A 1Z6HA 1CA6A 5J1ZA 3HOZB 2E2IB 3S17B 4NDXA 2LMCB 1EY4A 4XQQA 2E2JB 3BVGA 2DY8A 1VMCA 4ZRZA 4PV1C 2A69D 2KHSA 1SE3A 2JE6I 3RZOB 2JA7B 5IIFA 1ET9A 1V8QA 1GJXA 3I4LA 4FF3A 1I4XA 1J8IA 3MC0B 1MGSA 3VYSA 4I7ZC 1O80A 5FK9C 2VB2X 1MBYA 1RDPD 3RMHA 3TN2A 2Y0SB 4TRDA 1XYIA 2F0DA 4QIWB 1FGBD 3P1HA 1U4LA 5D65A 1B53A 3VYRA 2NZ1D 3MTSA 1E2VA 2XSCA 4KTAA 3NWTA 2WAQB 4H44C 2BA0A 3D6CA 2ICEC 1S5CD 2HQEA 1MI2A 3P7JA 4A3DB 4KHVA 4OIKA 4EVOA 4RGTA 3TP7A 5CBAE 1WTVA 4JK1C 3VYUA 3S1NB 1GUNA 3TSSA 2NWGA 3Q22A 5IT9E 1VMPA 4C3JB 1CHPD 4G7HC 1PDQA 3RD4A 4HN7A 5C0XJ 1EWHA 4QUCA 4BY7B 1ENAA 3H09A 1RD9D 3OW7A 1TWCB 3G6JB 3W2DA 1CM9A 1WCMB 1PFBA 1SAPA 2F0UA 2B39A 3BDOA 1HQRD 2K05A 4KN4C 1WTWA 1FNUA 1HUMA 1TT2A 3MXPA 1PZJD 5JPNC 2F0EA 3R93A 5C0XI 4ID6A 5ELEA 2B8FA 1Z7TA 4DU9A 4ZQ3A 5KEEA 4IUTA 1SNOA 2E76C 2F0SA 3OOCA 1DD2A 3EA6A 4C2MB 2F0LA 4BS9A 3VR6A 1KNAA 3I3CA 2VUMB 1JOOA 1X3PA 1U9RA 2ICIA 1HA6A 5K36H 4IFDI 2K5WA 1HQMC 1LTAD 2HDLA 5EKIA 2XRQD 1MSGA 2JXMB 2WKCA 4A3FB 2XWBB 1GUSA 1Q3LA 2EJGC 1PTOB 3FEWX 3N52A 3A8KE 4C3IB 4DNTB 1JORA 5C4XB 3VR5A 4LAAA 3I4NB 1I4RA 4ILWA 4FP5D 2KEDA 3O13A 1TS5A 3ZYYX 1ILQA 1F9SA 4KKSA 2M00A 4RKBA 5EJWA 2IW3A 4RKLA 4C56C 2F0JA 3DHQA 3QOLA 2V4DA 4S3SA 1STHA 2BDOA 3A7LA 1STEA 1V1OA 3GTPB 2FFKB 3NHHA 5K5PA 5D14A 5C5MA 1H9SB 4A93B 3HOVB 1OXSC 3MFYA 3G7LA 3CRKC 3C1EA 2K33A 1GUTA 5DM73 1PTOD 1FD7D 2NBFA 4RHRA 3D4WA 2WKDA 4TSSA 3MEHA 5KGUA 2FMMA 4H7BA 1YNNC 5BN5A 5KIXA 3D8GA 1BF4A 3A7AB 4K6DA 4ZLTF 1Q1BA 2PPBC 1EY0A 2CW0D 5IT9L 3MXNA 3D4RA 1C48A 1OXUA 2J4XA 2A6ED 2K03A 4DA2A 2TMPA 1QG7A 1GHJA 2Q8RE 3X3NA 1CQVA 5TSSA 2Z4HA 3EQLC 1F2MA 1LACA 5C4HA 3NTKA 1VF7A 1AZQA 4FO2A 4HR7B 5T1IA 1R4PB 1S5FD 4A3IB 2JYOA 3PV0A 1B2TA 3Q0AA 3DXJC 1GXDC 1LABA 2HUGA 5I6YA 1LTID 3S1QB 2KOLA 2A73B 3LWUA 4FVMA 3GTLB 3RUZA 3OMCA 1U4PA 4K5VA 2WIIB 1F9PA 3MFGA 2KCNA 1HRJA 1SFOB 5NUCA 2OF1A 4YIJA 1HXYD 1KLUD 2ENBA 3I4MB 4DAVA 3GTQB 1H9MA 4K2KA 1U4RA 1A3UA 3J81E 1K83B 5IGDA 1ML0D 2XRSD 2A6HD 2L0CA 1EQVA 3I72A 3EJIA 2IX1A 2EY5A 3HP3A 1QWYA 4HMIA 4CKCA 5CBEE 4UDUC 2CQAA 3L9AX 5FKAC 1HHVA 1RKNA 2ZT9C 3BVZA 2NVTB 1I4HA 1JWMD 1RHPA 1BO0A 1ZEQX 2PYKA 2ZXOA 1D1IA 1ET6A 1F77A 2EYLA 4HSVA 3MZ5A 4IUQA 1DOMA 3GTMB 4XQJA 3I70A 1YNJC 3NPPA 3MA2B 1EYAA 4UAIA 4H13C 3QG1A 2PW5A 1UAPA 2SNSA 5KNCA 3JAME 3TMEA 1H9JA 3SHLA 4IFDH 5EKLA 1C4QA 3T53B 3GTGB 1SMYC 3EVQA 1EYDA 4DF7A 4Z9CB 1EEID 1QE6A 2JA6B 2DN8A 1AZPA 2N55A 4LK1C 5C5LA 2F0WA 2NVYB 1B9NA 1XXGA 5IOCA 4CGYB 1KLGD 1EQTA 1MD2D 4KK7A 3PUZA 1TY0A 1DYQA 2BE5D 1SBBB 1S5BD 1PFNA 1CZWA 5I2YA 3PIP3 5C3EB 4WJWA 4KD4A 5I9OA 1NCVA 1BOSA 2I07B 5CV9A 1FR3A 5M9OA 3K5MA 3HG9A 4CJ2C 3R3OA 2QCPX 4PMBA 3S1MB 3GV3A 2X69A 1KABA 2CVRA 1CI3M 4FF4A 4CJ0B 1PFMA 1PLFA 5EQ0A 4TKOB 3MXGA 1PTOH 2B8GA 2PO4A 2PZWA 3VR3A 4QB4A 1SYFA 3PMFA 1SJED 2RSOA 2NTTA 2BDNA 4M8AA 2F0MA 3D6WA 3J81L 4BY1B 2F3WA 1F2LA 3FRPB 3QJYA 2L9HA 5KNDA 4K5XA 4G57A 1EWCA 1ZKOA 4PNYA 3OSOA 1PTOC 4F87A 5CYUA 3A8JE 1Y8PB 3SXHA 1BCPB 3BDCA 1I50B 2JA5B 2E2DC 3A56A 5C4JB 1ZXTA 4H0LC 4RGNA 1TIID 2CW0C 4C1NK 1OXVA 1TS4A 4BWGB 4OHJA 3URYA 4FF1A 4L63B 2A68D 3R2IA 1L0YB 3KLSA 1KDCA 2FINB 2F0QA 3FDTA 4IQZA 4RA8A 1ENFA 4O42A 2LFNA 2KQ3A 2F3VA 3PIO3 2JEAI 1EZ8A 3BS1A 2B2TC 3HKZB 4HTHA 3HZXA 3KBXA 2EJFC 1TS3A 4J6HA 1BR9A 4XDXA 4K14A 3JAML 1W6JA 1VF5C 3R8BA 1Q1EA 3E6ZX 2XN9C 3BG3A 4IALA 3A8IE 2O5IC 3NBHA 1D2BA 5C3XA 5DM63 3I90A 2J0TD 5FO9B 1BCPD 2VB3X 3KUPA 1I4PA 3V96A 3GTJB 3U9SA 1SXTA 3AU7A 1ENCA 1RF2D 1RTOA 3J80E 4HEDA 2FMCA 4G4KA 2AWNA 2NN6G 5J39A 1GUWA 1A3VA 3K5NA 2EE1A 4XTCS 1F9RA 1AN8A 4OO1H 5JPMC 1QNUA 4B9XA 4QUFA 2EXZA 3H3VC 2ID0A 1ILPA 1WTRA 4PMCA 3C46A 5IGBA 1A2UA 1EY5A 2FJ2A 5LHY1 3A55A 1U4MA 1NUCA 2PMZB 1PXUA 3F2UA 1ESFA 1KTKA 3WOEA 1LLRD 4LJZC 1ZYRD 4CHTB 4X3KA 2EY2A 1BBXC 1JWSD 2WB1B 2O5JC 5DEHA 1TWGB 2L1BA 3S14B 5AFWA 1HTLD 2HCIA 5G3LD 4IFDJ 1WD0A 4NMZA 2L5TA 1RTNA 3GP7A 3P20A 3KF8A 1LTTD 2DNCA 4BBRB 1PTOF 2WV6D 3EROA 1O7LA 1M8AA 4WORA 1O7YA 2PQEA 4EQNA 2VNUD 1Y8OB 2F0HA 1NR4A 1QB5D 1BNZA 4O1NA 4IZ8A 2BE5C 5JEAG 4QCLA 1WVLA 1J9OA 3NUCA 2EPBA 3NWSA 1HUNA 1EY7A 1L0XB 5KYLA 1Q90A 1E0BA 1GUOA 4Q0FA 3IKJA 4IUPA 3D3RA 4HAEA 3AB9A 3S1RB 1ESRA 5IGGA 2BA1A 5C4ZA 2EYJA 5D3IB 1IW7D 4F7XA 2BOSA 1UEAB 1STYA 4QMGA 5A35A 4ZK9B 3KLSX 2IJ0A 1WTOA 5EPKA 1Y1VB 3NK9A 2B2VA 4K8JA 4KV6A 4NKLA 1II3A 4IUUA 2H1EA 3NSWA 5HURA 1D5XC 5FO8B 1CTMA 1QCBD 2K04A 3HOWB 4DAPA 1EL0A 5M3FB 4AYBB 4ZUIA 5CMDA 2Z1CA 3M4OB 1PRTD 3J80L 2AUJD 4A3JB 3SK6A 5ELCA 1OO9B 2IX0A 1H9KA 4KY6A 2RVLA 4R8IA 3PUWA 5M5YB 1W6KA 5JOBA 5JEAH 4BA1I 2XIWA 3GQBA 3Q24A 1E2ZA 5FLXE 3GD7A 2KJXA 5LL6S 4OL7A 5JAVA 3VYTA 4IURA 3IFTA 3OWFA 2CHBD 2B2VC 1TWAB 2L12A 3VR4A 2AQ2B 4FYDA 4DXGA 3K58A 3HS0C 1KNEA 3K5OA 3HOYB 3FPUB 3S2DB 4B08A 4GZYC 4WRDA 2K32A 5CORA 2F0IA 5C0XG 4XT1B 4KMUC 2A69C 1G2TA 1H9RA 3S9WA 1B1ZA 1I4QA 1SE4A 4XYQA 3D31A 3QB3A 4RH6A 4FXKC 3KK7A 1WTPA 4A3MB 2K5DA 1BCPC 1EOTA 2RBMA 4X3SA 5CV7A 5E4XA 3I73A 4F8MA 3HEJA 3A54A 2D5DA 2IPKD 4KJNA 3C1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Z A;  2CVR A;  5COY A;  5CMD A;  2HCI A;  1RHP A;  3DM1 A;  4XDX A;  4DN4 M;  1G2S A;  1BO0 A;  1U4L A;  2JP1 A;  4ZLT F;  5D65 A;  1WD0 A;  1B53 A;  1SDF A;  2HDL A;  2X6L A;  1C8C A;  4R9W A;  4CJ0 B;  4IUV A;  2MJ8 A;  5EKI A;  1PFM A;  1EIG A;  1PLF A;  2R3Z A;  4RWS C;  1MSG A;  2NZ1 D;  3MTS A;  1IKL A;  3GV6 A;  3DEP A;  1RTN A;  2KUM A;  4NW2 A;  5EQ0 A;  3SVM A;  1ICW A;  4HSV A;  3MWY W;  2IL8 A;  1Q3L A;  2EOT A;  4IUQ A;  1IL8 A;  1DOL A;  2K03 A;  1DOM A;  4X3T A;  4XT3 B;  1QG7 A;  2RVL A;  2Q8R E;  4R8I A;  2N88 A;  3N52 A;  4X3U A;  1MI2 A;  2B2W C;  3P7J A;  5EPL A;  1BF4 A;  3I90 A;  2XIW A;  3IFD A;  1LV9 A;  1WD1 A;  1G91 A;  1O7Z A;  2RA4 A;  1MSH A;  4OIK A;  3KUP A;  1M8A A;  2B2Y C;  1IKM A;  4UAI A;  1AZQ A;  3QO2 A;  5CBA E;  4LMQ D;  1WTV A;  2RSO A;  1HFN A;  1O7Y A;  3IL8 A;  4CJ1 B;  5JJZ A;  1QNK A;  2MP1 A;  2M2L A;  1NR4 A;  3DEO A;  1ROD A;  5T1I A;  1HFG A;  1BNZ A;  1JE4 A;  1X32 A;  2NWG A;  2L4N A;  2BDN A;  1TVX A;  1VMP A;  2KED A;  1WVL A;  1J9O A;  3D6W A;  1RTO A;  2JYO A;  2MPM A;  4HED A;  1F2L A;  1WTQ A;  1B2T A;  1PDQ A;  1X3Q A;  2L9H A;  2EPB A;  1ILQ A;  4IUR A;  1JIC A;  1DON A;  1HUN A;  2DY7 A;  2K01 A;  2K28 A;  4QUC A;  1AP0 A;  2HUG A;  1F9S A;  2Q8T A;  2B2V C;  3ONA B;  1GUW A;  4HCS A;  1E0B A;  2HDM A;  1QE6 A;  2EE1 A;  2K1B A;  2NYZ D;  2L12 A;  5EJW A;  1DZ1 A;  4IUP A;  2D9U A;  2KOL A;  2KEE A;  1F9R A;  4HAE A;  2B2T A;  1CM9 A;  1AZP A;  4ZAI A;  1U4P A;  2B2U C;  1PFB A;  1SAP A;  2B2W A;  1F9P A;  1KNE A;  2HCC A;  2N55 A;  5EPJ A;  4QUF A;  1ESR A;  1HRJ A;  2RSN A;  2K05 A;  1XX8 A;  2B2Y A;  2KEC A;  3FPU B;  1CA6 A;  1ILP A;  1WTW A;  5T1G A;  3LWE A;  5COR A;  1WTR A;  1HUM A;  1ZXT A;  3UI2 A;  2J7Z A;  3R93 A;  4XT1 B;  1EQT A;  2FFK B;  1U4R A;  2SDF A;  4ZK9 B;  1G2T A;  2VXW A;  1WTO A;  1SSO A;  1NAP A;  1ML0 D;  2FJ2 A;  2MGS A;  2L11 A;  1EIH A;  1PFN A;  5D14 A;  2DY8 A;  4IUT A;  1VMC A;  3I8Z A;  1U4M A;  5EPK A;  1CA5 A;  4MN3 A;  1B50 A;  3F2U A;  4MHE A;  4ZKB B;  3H91 A;  3G7L A;  4U68 A;  2B2V A;  1B4O A;  1A15 A;  2FHT A;  2FIN B;  3Q6S A;  3HP3 A;  3FDT A;  4RA8 A;  1NCV A;  1NR2 A;  4IUU A;  1KNA A;  5DNF A;  5CBE E;  1B3A A;  4O42 A;  1RJT A;  1WTP A;  4RAU C;  5AFW A;  2H1E A;  4OIJ A;  4X3K A;  1BBX C;  2B2U A;  1WTX A;  1J8I A;  1MGS A;  1F9Q A;  3I3C A;  1O80 A;  4CJ2 C;  1EOT A;  3I91 A;  4X3S A;  1G6Z A;  5E4X A;  1HHV A;  2B2T C;  2KVM A;  2L1B A;  2K04 A;  2FMM A;  3TN2 A;  4ZKC B;  3KBX A;  1DOK A;  1X3P A;  1EL0 A;  3GV3 A;  5E4W C;  1HA6 A;  2X6G A;  2X69 A;  1XYI A;  3TZD A; 
#chains in the Genus database with same CATH topology
 5GQO A;  2I5H A;  1NSN S;  1E7Z A;  4ABN A;  5M3M H;  2R93 G;  1MIU A;  1HA5 A;  2JP1 A;  4BY7 G;  4J8Q A;  4JI1 Q;  1KAA A;  1UE1 A;  1VQJ A;  4JI4 L;  2VQE L;  1XTC D;  3PUX A;  1SR3 A;  2NVQ H;  3M7N A;  4BXX G;  1KDA A;  3J81 i;  4YWL A;  1WCM G;  4NW2 A;  3HKS A;  1DM0 B;  1NJI C;  5FO7 B;  1DOL A;  1BVS A;  1I3Q B;  4IPG A;  2EY1 A;  1XPU A;  5FOB B;  4DR7 L;  3NTI A;  5EPL A;  1EFW A;  3NXW A;  1TR5 A;  3L7Z C;  1FYC A;  4V0B A;  4R8N A;  4CJ1 B;  3CRL C;  1B7Y B;  3E0J A;  2MP1 A;  4EX5 A;  4RGO S;  3CCE A;  1PYB A;  2YTX A;  3OPO A;  3OIP A;  3HKZ E;  4J15 A;  1KHI A;  1PH4 A;  1X56 A;  1IHZ A;  4OO1 I;  3WDN A;  3X3M A;  1XNR L;  5IYD G;  1VQ8 A;  2F1M A;  4OWT B;  1NTG A;  1EU4 A;  3RLO A;  1STN A;  2Q8T A;  2VQE Q;  4DV5 L;  1PHJ A;  4JI4 Q;  3E5S A;  4OX9 L;  5JVG 3;  2NVX B;  2NYZ D;  1ZYR C;  1DZ1 A;  2H4O A;  2VUM G;  4R4C A;  4QL5 A;  2AQ1 B;  1BXT A;  2RF4 A;  5EPJ A;  3TRE A;  1IBK L;  4GKJ L;  1AFP A;  1JJ2 A;  2F0O A;  3FMC A;  2LY7 A;  3KBG A;  4DR7 Q;  1TWH B;  1HCZ A;  1PZI D;  1QVF A;  3HOX B;  2A74 C;  2PI2 E;  1IBL Q;  5IP9 H;  4A3F G;  2VY3 A;  1LTB D;  3JAM i;  5C3W A;  1PH3 A;  4BA2 I;  1XNR Q;  5DLQ E;  4C3I G;  4IPC A;  5C4X G;  4DV5 Q;  1SND A;  4CDF C;  2SNM A;  1RJT A;  4DGZ A;  4F88 A;  4RAU C;  4P2C B;  4A75 A;  4V19 0;  2XWJ B;  3L0O A;  2R93 H;  5E3F A;  3I4N G;  2OWO A;  5FJ8 H;  1B44 D;  2LS0 1;  1BBW A;  3S14 H;  2K5N A;  1IBK Q;  4GKJ Q;  5IWA L;  2JA8 B;  1EEF D;  1R9T H;  3QIA A;  3OWE B;  3TZD A;  2JK8 A;  5LL6 X;  5FLX L;  4KKU A;  3K7A B;  3F2B A;  1GUG A;  4K5W A;  4Y7N H;  4GNX A;  1VQK A;  4DV4 Q;  3TDQ A;  3D4D A;  3PO2 H;  1KAW A;  3U9O A;  1Y14 B;  4K8I A;  3LNN A;  3CHB D;  1SYE A;  4DK0 A;  3H6M A;  3W3A A;  4FXG C;  3PO3 H;  4J1M A;  5LMN L;  4BBR H;  2F0K A;  4X3U A;  5I9P A;  1EFI D;  1K28 A;  2ZTC A;  1FGU A;  3V05 A;  2CH4 A;  1VQ5 A;  1O7Z A;  3PSI A;  5JJZ A;  2NZH A;  5A2Q E;  2WB1 E;  4A93 G;  4DNI A;  3UDF A;  5IWA Q;  2WFW A;  5KNB A;  4IJH A;  4C3H G;  1VQD A;  1YBY A;  5IGE A;  1SRU A;  2B63 H;  2O4X A;  4P71 A;  4KY7 A;  3HOU H;  4HMJ A;  5EBD A;  1JIC A;  1DON A;  2K01 A;  2KCC A;  2OXP A;  1AP0 A;  3K59 A;  1JC7 A;  2A1A A;  4KY5 A;  4QQB X;  3F1Z A;  4HCS A;  3RR5 A;  5E1F A;  1S5D D;  2R7Z H;  2R92 B;  1Z9F A;  1EQQ A;  2B2T A;  3M4Y A;  2RKS A;  3U4Z A;  4QF4 A;  5LMN Q;  3J80 c;  1VCI A;  2KEC A;  2CCZ A;  4NXM L;  1JWU D;  1BCP F;  3MHB A;  1H9S A;  3LWE A;  2F0F A;  1D7Q A;  1CKN A;  3UI2 A;  4N8X 1;  1KRS A;  3S2H H;  4BBS H;  2JA9 A;  1K9M C;  3S16 B;  4DAY A;  3VA7 A;  2VXW A;  3T4A C;  3N6R A;  1Q46 A;  4CKB A;  1SSO A;  2L11 A;  4TQU S;  1EIH A;  1CA5 A;  3M3Y H;  1B50 A;  4ZKB B;  1Q8K A;  5M5W B;  4PMW A;  3T51 B;  1B4O A;  4EGV A;  2K75 A;  2JSO A;  4NXN L;  2CQO A;  2N8N A;  1SNQ A;  4WFN 3;  5JEA J;  4XYO A;  2B2U A;  3J7Z C;  4DR4 L;  5CV8 A;  2E74 C;  2QIL A;  3VA5 A;  4A3K G;  3NP8 A;  5GAH C;  1EQR A;  1GO3 E;  4DFA A;  1HTP A;  5E4W C;  4NXM Q;  2C5C A;  3DM1 A;  2N78 A;  2A6E C;  1YNN D;  4RCO A;  4PQX A;  1YJN A;  1EIG A;  3MEF A;  4A3J H;  1HNX L;  1STG A;  3H94 A;  1J6Q A;  3BZD B;  4JI0 L;  4WJ4 A;  4JI7 L;  4KD3 A;  3DWQ A;  1IL8 A;  2UXB L;  1CHQ D;  2ZJQ A;  5C44 H;  5CR3 A;  1RCV D;  3MXN B;  3PIP A;  3PUV A;  3OHX C;  1Y1W B;  3C3L A;  4NXN Q;  1S5E D;  4R4T A;  3I4M G;  3CCM A;  3OW2 A;  1XWE A;  3E0E A;  4HJ9 A;  3KDF B;  4KN7 C;  2PNR C;  5M3M B;  1LT4 D;  1BDO A;  3IL8 A;  2L55 A;  4IPD A;  4PZ6 A;  3OMG A;  3CPW A;  3DMU A;  3UE1 A;  1ONL A;  1HFG A;  2F4I A;  4CKE A;  1SYG A;  2NVQ B;  4XQN A;  2YV5 A;  4ZUJ A;  4A3G B;  3G48 A;  3A74 A;  5G3L F;  2F3I A;  1PV4 A;  1FVI A;  5HGT A;  3NTH A;  4KI0 A;  3K5L A;  5EKK A;  3OIQ A;  4JBJ A;  1LT3 D;  3T56 B;  1ICF B;  2RDF A;  4OXP A;  2AQ3 B;  1SJH D;  1SNC A;  4P75 A;  5GAG C;  1JB7 A;  4JI0 Q;  1JQY D;  1EUJ A;  2KA7 A;  2IX3 A;  2UXB Q;  2B2U C;  3KJP A;  1KL9 A;  5IP7 H;  1XMQ Q;  2B2Y A;  1XPR A;  2RDG A;  1PA6 A;  2IT1 A;  5F2D A;  2F0V A;  3FPP A;  4HID A;  4LF9 Q;  3K0Y A;  2HD3 A;  2A6H C;  2AWO A;  3T16 A;  3TS2 A;  1U0L A;  1A8V A;  2I5M X;  2K4K A;  1NMG A;  2GN5 A;  1NAP A;  2MGS A;  1TS2 A;  2E8G A;  1DXM A;  5CGK A;  2G5D A;  3Q23 A;  3RZD H;  3J7A 5;  3J80 i;  3EFX D;  3MAQ A;  2RDH A;  3H15 A;  2I0Q A;  2Z6K A;  3PGZ A;  1B3A A;  5K36 G;  3NQI A;  3ER0 A;  5BN4 A;  2D0P A;  2KCM A;  1JE5 A;  3K81 C;  1S40 A;  3OYY A;  1G6Z A;  1HNZ L;  3CCR A;  3NQT A;  5ELB A;  1SNM A;  1OTC A;  4EQ5 A;  1CT1 D;  5CV5 A;  5A2Q L;  2GA4 B;  1FNW A;  4UPA A;  1F2Y A;  5J3B A;  2BCO A;  1C8C A;  4R9W A;  3H0G H;  4IUV A;  4Q5V A;  2A19 A;  4CDE C;  2JA6 G;  2A5H A;  4DR3 L;  1LTS D;  2KUM A;  3M4P A;  3SVM A;  3MWY W;  2IL8 A;  1JT8 A;  2PCF B;  3RLF A;  2EOT A;  1WI5 A;  4FF2 A;  2R93 B;  1E2W A;  3FVQ A;  4X62 Q;  1HPC A;  1R9T B;  2NTS A;  3IFD A;  3UDX A;  4RFB A;  4R4O A;  2B2Y C;  1SYC A;  5ISR A;  2PZT A;  3HGB A;  3GTK H;  3PIO A;  1YNJ D;  1HNZ Q;  5KYI A;  3J7A F;  2M2L A;  3PUY A;  2EYP A;  4Y7N B;  2KHJ A;  4LFC L;  2HQL A;  2JEB I;  3JC6 6;  3SK5 A;  1DJR D;  5C3E G;  3PO2 B;  1DCZ A;  4C1N I;  1Q8I A;  1WTQ A;  2OQ0 A;  1G51 A;  3KFU A;  1JR0 D;  4EQP A;  1LT5 D;  1I4G A;  4QY7 A;  1PRT F;  3J7A V;  2DY7 A;  3PO3 B;  1D5M C;  3ONA B;  3AEV A;  2UUA L;  2EYM A;  3BZC A;  4A3L G;  1K8O A;  3VDY A;  2WP8 J;  5FLX c;  1A62 A;  4MTN A;  2KEE A;  1Z47 A;  2Z6K C;  1I94 L;  4YHH L;  3IAY A;  1SMY D;  1OXX K;  1O78 A;  4E6I A;  2HCC A;  2NN6 H;  4A3E H;  1V1P B;  2ZTD A;  1PMR A;  3HRZ C;  3VR2 A;  1EY9 A;  1VQO A;  2J7Z A;  2B63 B;  1PRT B;  4KLK A;  1GOZ A;  4JI5 L;  3J7Y W;  1YHQ A;  1C0A A;  3HOU B;  4P74 A;  1R4Q B;  5D3D A;  4L6T B;  1UE5 A;  4LFC Q;  3I8Z A;  2OCE A;  2R7Z B;  4DUZ Q;  2D2C C;  2QKI C;  3Q6S A;  1L0W A;  3DWP A;  1SE2 A;  3AFQ A;  3P75 A;  1TQO A;  1LT6 D;  2UUA Q;  4ULL A;  4OIJ A;  1BQQ T;  1IL2 A;  2K5Q A;  4N9P A;  1AEX A;  1YIT A;  3ERQ A;  3I91 A;  4YHH Q;  4I65 A;  1I94 Q;  3S2H B;  4BBS B;  3CC2 A;  3T1H L;  2JA8 H;  1MJE A;  1KDB A;  2K6A A;  4BY1 G;  4K0K L;  3K7A H;  1QOH A;  3I7F A;  5KRU A;  5COY A;  3M3Y B;  1SDF A;  1XTD A;  4JI5 Q;  2E5L L;  4POF A;  1M1K C;  2R3Z A;  4OEM B;  2R6G A;  1ICW A;  4L8J A;  3SR1 A;  1SRO A;  4KKT A;  1TKW B;  1CUK A;  4RMF A;  2RCF A;  2JA5 G;  2N88 A;  1YNX A;  2F0N A;  4ME5 A;  1WD1 A;  2A8V A;  4MZ9 A;  2Q8I B;  4KJO A;  3GTO H;  4HSP A;  4A3B H;  5J22 A;  3L3O C;  3OTO L;  2KCT A;  2EYO A;  3CCV A;  3T1H Q;  1G8Z D;  4TVA B;  4DXF A;  1JE4 A;  1P16 A;  1TWF H;  1CK1 A;  3BYT B;  2XGT A;  2DJG C;  2SOB A;  1QVC A;  3TBI B;  3EIV A;  1QIL A;  4RHS A;  2K28 A;  2I46 A;  5C44 B;  1PFS A;  3BYY B;  2E5L Q;  4JI2 Q;  3K6O A;  3CQZ H;  1X9N A;  2K1B A;  2SEB D;  4C3H B;  1YJ9 A;  5LMN W;  3HKZ G;  4LF5 Q;  3ICE A;  1Y8N B;  1EY8 A;  3ULP A;  2RSN A;  3SK8 A;  1UNS A;  5HGQ A;  1PH1 A;  4KHP L;  2A68 C;  5CV6 A;  2G9H D;  3CXC A;  3QWN A;  1KC8 C;  5EBC A;  2EYF A;  4B3S L;  4IO9 A;  3OTO Q;  1BUV T;  2SDF A;  5IGF A;  1B9M A;  5GAD C;  2E2H H;  1KQS A;  2OT2 A;  5M5X H;  2F52 A;  3H91 A;  4U68 A;  2PZU A;  2QDB A;  3DWA A;  1XMO Q;  1NR2 A;  3ZJY C;  1ASZ A;  2QF7 A;  5EAY A;  5CC4 A;  1VQB A;  3SDZ A;  2MO0 A;  3G6E A;  4U67 3;  4NP5 A;  3S15 H;  3ND9 A;  3G71 A;  2KVM A;  2IHE A;  4CBV A;  1JCK B;  2YU9 B;  1VS0 A;  2OEO A;  3TP8 A;  3ND8 A;  1Q12 A;  4DAM A;  4KHP Q;  3TP5 A;  4DK1 A;  4I7A A;  4A3K B;  3RZD B;  3QOJ A;  4B3S Q;  5ELN A;  1IKL A;  3DEP A;  1IYU A;  2PI2 A;  3FKI H;  1RIP A;  2IHF A;  4X3T A;  1N36 L;  4IUN A;  4JYA L;  1TY2 A;  2LKV A;  1Y1W H;  2UXD L;  2QA4 A;  4M1U B;  4JG2 A;  5IY0 A;  1G91 A;  1JOQ A;  4C3J G;  1JJG A;  1SYB A;  1A3T A;  4G7Z C;  4LNQ A;  4IFD G;  1BBU A;  4X6A H;  4LMQ D;  3SEB A;  2O2L D;  1QNK A;  2WIN B;  3BVM A;  5IGC A;  1K8M A;  1LTR D;  1ROD A;  4IPH A;  3F2D A;  2C9O A;  2DNE A;  3H0G B;  3T13 A;  4OGQ C;  3HOZ H;  2E2I H;  4A3G H;  2MHV A;  2MPM A;  2F03 A;  2Z9H A;  1T5E A;  3CU7 A;  1SMX A;  1X3Q A;  2MQH A;  2K5H A;  1NE3 A;  4N9T A;  2E2J H;  1T5X D;  4DV2 L;  4LFB L;  2PQA B;  1D5Z C;  2WB1 G;  3CCJ A;  1E3P A;  1VQ6 A;  1JOK A;  4A3C G;  4RG1 A;  2IY5 B;  5EGT A;  1N36 Q;  1N33 L;  1YIJ A;  3RZO H;  4R1J A;  3LX0 A;  1D1K A;  2JA7 H;  3GTK B;  4FNF A;  1Y69 U;  2EVB A;  4LFA L;  3SE0 A;  1PZK D;  5T1G A;  1D8L A;  1VDZ A;  4RGM A;  3TP6 A;  3NBI A;  2VW9 A;  3A5U A;  4B9W A;  4MN3 A;  4MHE A;  5C0X H;  2EYH A;  1K8A C;  2DJF C;  1A15 A;  2FHT A;  3AMU A;  1E1T A;  4GKK L;  3DLL A;  5DNF A;  4LFB Q;  1LO5 D;  4A3E B;  1WTX A;  4WJ3 M;  3BDL A;  3NE5 B;  1HNW L;  1F9Q A;  1A6X A;  4IN3 A;  1EY6 A;  3K57 A;  5IYC H;  1I6H B;  4GOP B;  1OXT A;  4GN5 A;  4L5T A;  1AW7 A;  3B6Y A;  4A3D H;  4K2L A;  1S4Z A;  1CFM A;  5BN3 A;  3R2T A;  4JPB W;  1G2S A;  3S1N H;  2F0P A;  3M7G A;  4DV6 L;  2MJ8 A;  4RWS C;  1V43 A;  2GVA A;  2OTL A;  3IRB A;  4JBW A;  4JI8 L;  4OX9 Q;  4K6L A;  5DAU A;  3T1Y L;  2RQX A;  3UE0 A;  2EJM A;  4BY7 H;  4NB3 A;  5ELD A;  3KF6 B;  4GKK Q;  1XJV A;  1V1P A;  1SEB D;  4BXX H;  2VQF L;  1TWC H;  3BJU A;  3MXU A;  1WCM H;  1MSH A;  2IWH A;  4MIU A;  1QZG A;  1HNW Q;  1IKM A;  3KF8 B;  1HFN A;  1G29 1;  5IOD A;  3GO5 A;  5I2X A;  3DEO A;  1LTG D;  1X32 A;  2PW7 A;  1EOV A;  1Y1V G;  3QR8 A;  1CQF A;  4RCN A;  1KD1 C;  1FNV A;  1TVX A;  2AKW B;  3BU2 A;  1AE2 A;  4UP8 A;  2Z6B A;  4YWK A;  2CKZ B;  2PMZ E;  4DV6 Q;  2NN6 I;  1EYC A;  2MUY A;  4H02 A;  4AH6 A;  2HDM A;  4X66 L;  1QUQ B;  4YCU A;  5C6A A;  4JI8 Q;  4ZYS A;  2D9U A;  3T1Y Q;  1T9H A;  1IW7 C;  4C2M H;  4B3R L;  4DPG A;  4ZAI A;  1GM5 A;  3HOW G;  3GTO B;  4A3B B;  5M3F G;  2B2W A;  2F0G A;  5IYD H;  1XPO A;  3W1B A;  1TU2 B;  3HOV G;  4UP7 A;  2VQF Q;  1TWF B;  1EZ6 A;  1QZH A;  3G4S A;  2VUM H;  2EY6 A;  3KLR A;  1UUP A;  5I4D A;  4DV0 L;  3C2P A;  3CKI B;  5ELF A;  2Q2I A;  3V2T A;  2E75 C;  3CQZ B;  4ODG A;  3I2Z A;  1SNP A;  4OEL B;  3KLW A;  3A5Z B;  4XIG S;  4XXE A;  3WOF A;  1JB3 A;  2ZXR A;  5JJK A;  2XVS A;  1UE6 A;  5I6W A;  1GD7 A;  4A3F H;  2QEJ C;  4PG3 A;  4X66 Q;  1D6E C;  1CZG A;  1A2T A;  1MHW C;  2WAC A;  4B3R Q;  4C3I H;  4ZKC B;  3SGI A;  1DOK A;  1PRT C;  3MVV A;  5C4X H;  2X6G A;  5IYB G;  4LUO A;  5CV4 A;  2F0T A;  2E2H B;  4DN4 M;  2R61 A;  2NUC A;  5M5X B;  2NB0 A;  4DV0 Q;  3I4N H;  1A0I A;  2X6L A;  2YYZ A;  2CH4 W;  4JC0 A;  2XNA C;  2Z4I A;  1STA A;  3RN2 A;  3GV6 A;  1IYV A;  4G7O C;  3ERS X;  1SYD A;  1EU3 A;  4GLX A;  1VQG A;  4XT3 B;  2TSS A;  3J81 j;  4FXD A;  1QJO A;  3HOY G;  3S15 B;  1K3B C;  1IXR A;  4A3I G;  2K7V A;  2M9V A;  2Z8L A;  1K8G A;  2B2W C;  4DNR B;  5LMU L;  1LV9 A;  2EDG A;  2RA4 A;  2K14 A;  3TZU A;  1F2Z A;  3QO2 A;  1STB A;  1GHK A;  4LWC A;  2B29 A;  2KEN A;  3SK4 A;  1WYD A;  2L4N A;  1PVO A;  3BZK A;  3PF4 A;  2HIX A;  5JVH 3;  1VQN A;  4OO1 G;  4LF7 L;  3GTP H;  3FKI B;  3ITP A;  1PYW D;  2G9D A;  1M4V A;  4HCE A;  4EQO A;  5IE8 A;  4A93 H;  4A3M G;  2EZV A;  2ZXP A;  2AUK A;  2D62 A;  4C3H H;  2YTY A;  4KHZ A;  3DUZ A;  3CW2 C;  2BH2 A;  3M4Q A;  1I6V C;  4HJA A;  4DR4 Q;  3CCU A;  3M85 A;  1HZA A;  4DR6 L;  1XX8 A;  1Z6H A;  1PH7 A;  1CA6 A;  5J1Z A;  5LMU Q;  3HOZ B;  2E2I B;  3S17 B;  4AYB E;  5H1S E;  4NDX A;  2LMC B;  1EY4 A;  4XQQ A;  2E2J B;  3BVG A;  1HNX Q;  1PH9 A;  2DY8 A;  1VMC A;  3U58 A;  1DGS A;  4ZRZ A;  4LF7 Q;  4PV1 C;  5FLM G;  3K80 C;  4JI7 Q;  2A69 D;  2KHS A;  1SE3 A;  2JE6 I;  2D0O A;  1J5E L;  3RZO B;  2JA7 B;  5IIF A;  1ET9 A;  1V8Q A;  1GJX A;  3I4L A;  4FF3 A;  1I4X A;  1J8I A;  3MC0 B;  1MGS A;  3VYS A;  4I7Z C;  1O80 A;  5FK9 C;  2VB2 X;  1MBY A;  1RDP D;  3RMH A;  3TN2 A;  2Y0S B;  3WWV A;  2YU9 H;  4P73 A;  2ES2 A;  4TRD A;  1XYI A;  2F0D A;  2ATW A;  3E9I A;  4QIW B;  1FGB D;  3P1H A;  1U4L A;  4A3K H;  3H3V H;  5D65 A;  1B53 A;  3VYR A;  2NZ1 D;  3MTS A;  1E2V A;  1O7I A;  2XSC A;  4QJF A;  4KTA A;  3NWT A;  2WAQ B;  1SN8 A;  4H44 C;  2JN4 A;  2BA0 A;  3D6C A;  1J5E Q;  3Q8D A;  2ICE C;  3S1Q H;  1S5C D;  2HQE A;  1MI2 A;  3W1G A;  3P7J A;  3HOX G;  4KHV A;  4A3D B;  3CCL A;  3GTL H;  4OIK A;  4EVO A;  3NEN A;  4RGT A;  1U5K A;  3TP7 A;  5CBA E;  1WTV A;  4JK1 C;  4DR1 L;  1SFO H;  3VYU A;  3S1N B;  1KXL A;  1GUN A;  3TSS A;  2NWG A;  3Q22 A;  5IT9 E;  3I4M H;  1VMP A;  2VS1 A;  4AIM A;  1CHP D;  4C3J B;  3GTQ H;  4B3T L;  4G7H C;  1PDQ A;  3RD4 A;  4HN7 A;  5C0X J;  2UXC L;  1EWH A;  1K83 H;  4QUC A;  4BY7 B;  1ENA A;  1AE3 A;  3H09 A;  1RD9 D;  1EWI A;  3OW7 A;  1TWC B;  3G6J B;  3W2D A;  1CM9 A;  1WCM B;  2ZJR A;  4GOP A;  2Q2H A;  5JJI A;  1PFB A;  1SAP A;  2F0U A;  2B39 A;  3BDO A;  1JJC B;  1GVP A;  1HQR D;  2K05 A;  4LF4 L;  4KN4 C;  2QDL A;  4ZCK A;  1WTW A;  1FNU A;  1HUM A;  1TT2 A;  3MXP A;  4IOA A;  1PZJ D;  5JPN C;  2F0E A;  3R93 A;  4JBK A;  4JV5 L;  5C0X I;  4JBM A;  4DR1 Q;  1X3G A;  4ID6 A;  3KOJ A;  5ELE A;  2B8F A;  1Z7T A;  3PQI A;  4DU9 A;  4ZQ3 A;  5KEE A;  4A4I A;  1AH9 A;  4IUT A;  2NVT H;  4CDC C;  4DR3 Q;  2VL6 A;  4JOI C;  1SNO A;  2E76 C;  2F0S A;  2K50 A;  3OOC A;  4DV7 L;  4HIK A;  1DD2 A;  4B3T Q;  3EA6 A;  4C2M B;  2F0L A;  4Y52 H;  3KF6 A;  4BS9 A;  2HHH L;  2CWP A;  3E3X A;  3VR6 A;  1KNA A;  3GTM H;  3I3C A;  4PZ7 A;  1I6H H;  2VUM B;  1JOO A;  1X3P A;  1U9R A;  2ICI A;  4LUV A;  3CME A;  4LF4 Q;  4X65 L;  1X55 A;  1HA6 A;  5K36 H;  4HJ5 A;  4IFD I;  2K5W A;  1IBM L;  4IJL A;  4JV5 Q;  1HQM C;  1LTA D;  1NMF A;  2HDL A;  2HT1 A;  4LF6 L;  5EKI A;  2V1C C;  4APV A;  2XRQ D;  1MSG A;  2JXM B;  4GLV B;  2R92 G;  1QUQ A;  2WKC A;  4A3F B;  2XWB B;  1GUS A;  3D0F A;  1Q3L A;  3GTG H;  2EJG C;  2JQO A;  3FP9 A;  4HJ7 A;  1K0S A;  1VQE A;  4GNX B;  1PTO B;  3FEW X;  3UDG A;  3N52 A;  3A8K E;  1V1Q A;  2HHH Q;  4OWW B;  4C3I B;  4GOP C;  2JA6 H;  1Q82 C;  4DNT B;  1JOR A;  5C4X B;  1NY4 A;  3VR5 A;  4LAA A;  3I4N B;  2KHI A;  4YY3 L;  1I4R A;  4ILW A;  4FP5 D;  2NVY H;  3W5O A;  2KED A;  2UUC L;  3O13 A;  1TS5 A;  1TXY A;  3ZYY X;  3HFZ B;  1IBM Q;  1Q86 C;  1ILQ A;  2DUD A;  4LF6 Q;  1F9S A;  4KKS A;  2M00 A;  4RKB A;  5EJW A;  2IW3 A;  4YCV A;  2EXD A;  4RKL A;  4C56 C;  5C3E H;  2UUB L;  2F0J A;  3DHQ A;  3QOL A;  2V4D A;  4S3S A;  1STH A;  1S3O A;  4A3L H;  2BDO A;  1L2F A;  3A7L A;  4K0K Q;  1WOC A;  2F4V L;  4ME3 A;  1STE A;  1V1O A;  3GTP B;  2FFK B;  3NHH A;  3S1M H;  2Q2T A;  5K5P A;  1N34 L;  5D14 A;  5C5M A;  1H9S B;  4A93 B;  3HOV B;  1SE8 A;  1E24 A;  1CKN B;  1W2B A;  1OXS C;  3MFY A;  2UUC Q;  3G7L A;  4DAY B;  3CRK C;  3C1E A;  2K33 A;  1GUT A;  1FL0 A;  5DM7 3;  3CCQ A;  1PTO D;  1FD7 D;  2NBF A;  4RHR A;  3D4W A;  5M3M G;  2WKD A;  4TSS A;  2UUB Q;  1HZC A;  1PH5 A;  2EQS A;  3MEH A;  5KGU A;  2FMM A;  3CPF A;  4H7B A;  1YNN C;  1P8L A;  4DK3 C;  5BN5 A;  5KIX A;  3D8G A;  1BF4 A;  1B70 B;  3A7A B;  4K6D A;  3TS0 A;  4ZLT F;  1Q1B A;  2PPB C;  1EY0 A;  2CW0 D;  5IT9 L;  3MXN A;  3D4R A;  1B8A A;  4DKA C;  1N34 Q;  1C48 A;  1OXU A;  1HZB A;  4BY1 H;  1H95 A;  2J4X A;  2A6E D;  2K03 A;  3KDF A;  4DA2 A;  2TMP A;  1MJC A;  1QG7 A;  1GHJ A;  2Q8R E;  4UHV A;  3X3N A;  1CQV A;  5TSS A;  2Z4H A;  3AFP A;  1IYJ B;  3EQL C;  1F2M A;  1LAC A;  1VQA A;  5C4H A;  3NTK A;  1VF7 A;  1WFQ A;  1AZQ A;  1E22 A;  2XTI A;  2JA5 H;  1I50 H;  4FO2 A;  4HR7 B;  5T1I A;  1R4P B;  1S5F D;  4A3I B;  4MTK A;  2JYO A;  3PV0 A;  1B2T A;  3Q0A A;  4YCW A;  2OQK A;  3DXJ C;  1GXD C;  1LAB A;  2HUG A;  1WTH A;  5I6Y A;  1LTI D;  2RCN A;  4FDB A;  3S1Q B;  2KOL A;  2A73 B;  3LWU A;  4FVM A;  5E7N A;  3GTL B;  4O0A A;  3RUZ A;  1L1O B;  3OMC A;  1U4P A;  4K5V A;  2WII B;  1F9P A;  1NBW A;  3MFG A;  2UU9 L;  2KCN A;  1HRJ A;  1SFO B;  5NUC A;  3NBH B;  2OF1 A;  1A63 A;  4GN3 B;  4YIJ A;  1HXY D;  1KLU D;  2ENB A;  1PH6 A;  3I4M B;  3S17 H;  4DAV A;  3GTQ B;  1H9M A;  1VQC A;  4K2K A;  1U4R A;  4A76 A;  1A3U A;  3J81 E;  1K83 B;  2B3G A;  5IGD A;  1ML0 D;  1UWV A;  2XRS D;  4B3M L;  4ALP A;  2A6H D;  3A0J A;  1VQM A;  5FJ8 G;  2L0C A;  1EQV A;  3I72 A;  3EJI A;  2IX1 A;  2EY5 A;  3HP3 A;  3LGJ A;  4JYA Q;  1QWY A;  4JI3 L;  4HMI A;  4CKC A;  5CBE E;  2UXD Q;  3K7U C;  4UDU C;  2CQA A;  3L9A X;  3CCS A;  5FKA C;  3H3V I;  2I5L X;  1HHV A;  1RKN A;  1NNX A;  2UU9 Q;  2ZT9 C;  3PO2 G;  3BVZ A;  5BR8 L;  1VQ4 A;  2NVT B;  1I4H A;  1JWM D;  1RHP A;  4YWM A;  3GTJ H;  3PO3 G;  1BO0 A;  1IBL L;  3L2P A;  4BBR G;  1ZEQ X;  2PYK A;  2ZXO A;  1D1I A;  1ET6 A;  1F77 A;  4L5Q A;  4DV2 Q;  2EYL A;  4B3M Q;  4HSV A;  3MZ5 A;  4IUQ A;  1DOM A;  3GTM B;  1YEZ A;  4XQJ A;  3I70 A;  1HJP A;  1N33 Q;  1YNJ C;  1G6P A;  3NPP A;  4JI3 Q;  2GVB A;  4LFA Q;  3MA2 B;  2B63 G;  1KIX A;  1EYA A;  5GAE C;  4UAI A;  4H13 C;  3HOU G;  3QG1 A;  2PW5 A;  1UAP A;  1BKB A;  2SNS A;  4PZ8 A;  5KNC A;  3JAM E;  3TME A;  2Y0S E;  2R7Z G;  5BR8 Q;  1H9J A;  4C3J H;  3SHL A;  2ZM6 L;  4IFD H;  5EKL A;  1C4Q A;  2HIV A;  3T53 B;  2PNH A;  1SMY C;  4QIW E;  3EVQ A;  3GTG B;  1YHA A;  1EYD A;  4DV4 L;  1W3S A;  4DF7 A;  4Z9C B;  1EEI D;  1QE6 A;  2JA6 B;  4BBS G;  1MKH A;  2DN8 A;  1AZP A;  2N55 A;  4LK1 C;  5C5L A;  2WAQ E;  1M90 C;  2F0W A;  2NVY B;  3CC7 A;  1B9N A;  1XXG A;  5IOC A;  1I5F A;  3GDE A;  4A3C H;  4CGY B;  1TWG H;  1KLG D;  4UP9 A;  1EQT A;  1MD2 D;  4KK7 A;  3PUZ A;  1TY0 A;  2Q2U A;  1DYQ A;  2BE5 D;  1SBB B;  1S5B D;  1PFN A;  3TEH B;  1CZW A;  1HZ9 A;  5I2Y A;  3NEL A;  4P72 A;  3PIP 3;  2ZM6 Q;  5C3E B;  4KD4 A;  4WJW A;  5I9O A;  2QEX A;  4L5R C;  4GN4 B;  1NCV A;  1BOS A;  3KYH C;  4AYB G;  3RN5 A;  2I07 B;  1HR0 L;  5CV9 A;  1K0R A;  4DR5 L;  1FR3 A;  2ALY B;  3I56 A;  5M9O A;  3K5M A;  3HG9 A;  4CJ2 C;  3R3O A;  3STB D;  2JJQ A;  2QCP X;  4PMB A;  3F2C A;  4A3J G;  3S1M B;  3GV3 A;  2X69 A;  1KAB A;  2CVR A;  3I55 A;  1CI3 M;  3TRZ A;  5C44 G;  3DM3 A;  1CSP A;  4CJ0 B;  4FF4 A;  2R7D A;  1PFM A;  1PLF A;  1RL2 A;  2Z0S A;  5EQ0 A;  1C7Y A;  4DV3 L;  1UEB A;  4TKO B;  3MXG A;  2DGY A;  3NEM A;  1PTO H;  2B8G A;  2PO4 A;  2PZW A;  3VR3 A;  4QB4 A;  1HR0 Q;  4DR5 Q;  4N8F A;  2AHO B;  1SYF A;  3PMF A;  2MO1 A;  3S24 A;  1VQL A;  1SJE D;  1N8R C;  2RSO A;  3S1R H;  3EBE A;  2RHQ B;  1PYS B;  3F8T A;  2NTT A;  2MNA A;  2BDN A;  1FJG L;  4M8A A;  2F0M A;  3D6W A;  3CC4 A;  3J81 L;  4BY1 B;  1EIF A;  2NZO A;  2F3W A;  1F2L A;  3FRP B;  3QJY A;  2L9H A;  5KND A;  4IOC A;  4K5X A;  4G57 A;  5IP7 G;  1S72 A;  1K73 C;  1EWC A;  1ZKO A;  4PNY A;  3OSO A;  4GNX C;  1PTO C;  1Y1V H;  4F87 A;  3PF5 A;  4DV3 Q;  5CYU A;  3K0X A;  2LXJ A;  3A8J E;  5IT9 c;  1Y8P B;  1EIY B;  3SXH A;  1BCP B;  3BDC A;  1I50 B;  2JA5 B;  2E2D C;  4R4Q A;  3A56 A;  5C4J B;  1ZXT A;  3AYH B;  4H0L C;  5JJL A;  4RGN A;  1TII D;  2CW0 C;  3HOW H;  4C1N K;  1OXV A;  4JCV E;  5M3F H;  1TS4 A;  4BWG B;  4OHJ A;  3ULL A;  3URY A;  4L63 B;  4FF1 A;  2A68 D;  3HOV H;  3R2I A;  1L0Y B;  1FJG Q;  3KLS A;  1KDC A;  3U50 C;  3M4O H;  2FIN B;  2F0Q A;  3FDT A;  4IQZ A;  4RA8 A;  2FXQ A;  1C9O A;  1ENF A;  4O42 A;  5HY6 A;  3UDI A;  2LFN A;  2KQ3 A;  2F3V A;  2LXK A;  3PIO 3;  2JEA I;  1EZ8 A;  3K8A A;  1YHB A;  3BS1 A;  1N9W A;  3H0G G;  5M5Y H;  2B2T C;  3HKZ B;  1XMQ L;  4HTH A;  3HZX A;  3KBX A;  2EJF C;  1TS3 A;  4LF9 L;  4DV1 L;  4J6H A;  1KRT A;  1BR9 A;  4XDX A;  1YZ6 A;  4K14 A;  3JAM L;  5ELO A;  1W6J A;  4NPS A;  1VF5 C;  3R8B A;  2VZA A;  1Q1E A;  3E6Z X;  5IYB H;  2XN9 C;  1L1O A;  3BG3 A;  2CWA A;  1TWA H;  4IAL A;  3A8I E;  2O5I C;  1UE7 A;  3NBH A;  4HIO A;  1XNQ L;  1D2B A;  1YI2 A;  5C3X A;  5DM6 3;  4DR6 Q;  3I90 A;  3FHW A;  2J0T D;  5FO9 B;  1BCP D;  2VB3 X;  3KUP A;  1I4P A;  3V96 A;  3GTJ B;  3AQQ A;  3HOY H;  3S2D H;  3U9S A;  1WJJ A;  4A3I H;  2PQA A;  4JOI A;  1SXT A;  2N49 A;  1ENC A;  3AU7 A;  4DV1 Q;  1RF2 D;  2CFM A;  1RTO A;  3J80 E;  4HED A;  2FMC A;  4OON A;  4G4K A;  4O2D A;  3U4V A;  2AWN A;  2NN6 G;  5J39 A;  1HH2 P;  4X64 L;  3TQY A;  4A3E G;  1GUW A;  1A3V A;  1X3F A;  3K5N A;  2EE1 A;  4XTC S;  1F9R A;  1AN8 A;  4OO1 H;  5JPM C;  4POG A;  1QNU A;  4B9X A;  4R4I A;  4QUF A;  4X62 L;  1X65 A;  2EXZ A;  1XNQ Q;  4A3M H;  3H3V C;  2ID0 A;  1ILP A;  4AQY L;  1WTR A;  4PMC A;  3C46 A;  2ASB A;  5IGB A;  3CD6 A;  1A2U A;  1EY5 A;  2FJ2 A;  5LHY 1;  3A55 A;  2L15 A;  1U4M A;  4GS3 A;  1NUC A;  2PMZ B;  1YJW A;  1PXU A;  3F2U A;  4JI6 L;  1ESF A;  4HIM A;  1KTK A;  3WOE A;  1LLR D;  4LJZ C;  2JA8 G;  4X64 Q;  1L1O C;  1GKH A;  1ZYR D;  5GRO A;  4CHT B;  1QVG A;  4X3K A;  2EY2 A;  1BBX C;  1JWS D;  1LM0 A;  2WB1 B;  2O5J C;  1X3E A;  5DEH A;  1I3Q H;  5FLM H;  1X54 A;  3EN2 A;  1TWG B;  2L1B A;  3S14 B;  4LF8 L;  3M9B A;  4DR2 L;  5AFW A;  1PH8 A;  1VQH A;  1HTL D;  1V9P A;  4AQY Q;  4L5S A;  2HCI A;  5G3L D;  4IFD J;  2K5V A;  1WD0 A;  1CKM A;  4NMZ A;  3E9H A;  2UXC Q;  4JVZ A;  2L5T A;  1RTN A;  3GP7 A;  3P20 A;  4A3B G;  4DUZ L;  4JI6 Q;  3KF8 A;  1LTT D;  3CF5 A;  1VQP A;  2DNC A;  4BBR B;  2NVX H;  2QW7 A;  1PTO F;  2WV6 D;  2K52 A;  3ERO A;  1O7L A;  1M8A A;  2EIF A;  4WOR A;  1O7Y A;  2PQE A;  4EQN A;  2VNU D;  1Y8O B;  2F0H A;  1NR4 A;  1QB5 D;  1BNZ A;  4O1N A;  4IZ8 A;  4LF8 Q;  1TWH H;  2BE5 C;  4DR2 Q;  1B3Q A;  5JEA G;  3HOX H;  4QCL A;  1CSQ A;  1J9O A;  4OWX B;  1WVL A;  3NUC A;  3CAM A;  4DV7 Q;  2EPB A;  3NWS A;  4QGU A;  1HUN A;  1EY7 A;  3CP0 A;  1L0X B;  5KYL A;  1Q90 A;  1E0B A;  3PCO B;  1GUO A;  4Q0F A;  3IKJ A;  4IUP A;  3D3R A;  4HAE A;  1VQ7 A;  3AB9 A;  3STB C;  2LSS A;  4UY8 C;  3S1R B;  1ESR A;  5IGG A;  2BA1 A;  2EYJ A;  5C4Z A;  5D3I B;  4X65 Q;  1IW7 D;  4F7X A;  2BOS A;  1UEA B;  1X6O A;  1STY A;  4QMG A;  4LUZ A;  5A35 A;  4ZK9 B;  3KLS X;  2IJ0 A;  1WTO A;  3KJO A;  4LW1 A;  5EPK A;  4DUY L;  2KBN A;  1Y1V B;  3NK9 A;  2B2V A;  4K8J A;  4KV6 A;  4NKL A;  4JI2 L;  3CMA A;  1II3 A;  4IUU A;  2H1E A;  3NSW A;  4LF5 L;  3J81 c;  5HUR A;  1D5X C;  5FO8 B;  1CTM A;  1QCB D;  2BH8 A;  2K04 A;  3HOW B;  4YY3 Q;  4DAP A;  1EL0 A;  5M3F B;  1VQF A;  4AYB B;  2ZTE A;  5AJ3 L;  3FKI G;  4ZUI A;  5CMD A;  2YTV A;  2Z1C A;  3M4O B;  1Q7Y C;  1Y1W G;  1JMC A;  1PRT D;  3J80 L;  2AUJ D;  4A3J B;  3SK6 A;  5ELC A;  2ZJP A;  1PH2 A;  1OO9 B;  1N32 L;  4GLA C;  2IX0 A;  2N3S A;  1H9K A;  4DUY Q;  1SLJ A;  4KY6 A;  2RVL A;  1XMO L;  1HR0 W;  4R8I A;  3PUW A;  5M5Y B;  1W6K A;  3HOZ G;  5JOB A;  2R92 H;  4A3G G;  5JEA H;  4BA1 I;  2XIW A;  5L37 A;  3GQB A;  3Q24 A;  1E2Z A;  4MNO A;  5FLX E;  2F4V Q;  3GD7 A;  2KJX A;  1LTL A;  5LL6 S;  2RHS B;  4OL7 A;  5AJ3 Q;  5JAV A;  3S16 H;  3VYT A;  1E1O A;  2QGQ A;  4IUR A;  2C35 B;  3IFT A;  2JA7 G;  3OWF A;  2CHB D;  2B2V C;  1TWA B;  4HJ8 A;  1LUZ A;  2L12 A;  2MFI A;  3VR4 A;  5M5W H;  1N32 Q;  2AQ2 B;  4FYD A;  4DXG A;  3K58 A;  3JAM c;  2Y0S G;  3HS0 C;  1KNE A;  2AMC B;  1VQ9 A;  3K5O A;  3HOY B;  3FPU B;  3S2D B;  4B08 A;  2OTJ A;  4GZY C;  5C4J H;  1VQI A;  2K32 A;  4WRD A;  5COR A;  2F0I A;  5C0X G;  1K3R A;  4XT1 B;  4KMU C;  2H5X A;  4JI1 L;  2A69 C;  1G2T A;  1H9R A;  4CDD C;  1IZ6 A;  2P5Z X;  2R7F A;  3S9W A;  1EYG A;  1B1Z A;  1I4Q A;  1SE4 A;  3I4O A;  4XYQ A;  2WAQ G;  1CKO A;  5IYC G;  4JW0 A;  3D31 A;  1ASY A;  3QB3 A;  4RH6 A;  5IP9 G;  4A3D G;  4FXK C;  3KK7 A;  1WTP A;  1Q81 C;  4A3M B;  2K5D A;  1BCP C;  3RNU A;  3ULJ A;  1EOT A;  2RBM A;  3RLN A;  4X3S A;  5CV7 A;  5E4X A;  1YVC A;  3I73 A;  4F8M A;  4DK6 C;  3HEJ A;  3A54 A;  1LYL A;  2D5D A;  2IPK D;  4KJN A;  3C1F A; 
#chains in the Genus database with same CATH homology
 1NSN S;  4ABN A;  1HA5 A;  2JP1 A;  4J8Q A;  1KAA A;  1XTC D;  3PUX A;  3M7N A;  1KDA A;  4NW2 A;  1DM0 B;  5FO7 B;  1DOL A;  1I3Q B;  2EY1 A;  5FOB B;  3NTI A;  5EPL A;  3NXW A;  1TR5 A;  3L7Z C;  1FYC A;  4V0B A;  4R8N A;  4CJ1 B;  3CRL C;  3E0J A;  2MP1 A;  4RGO S;  3OPO A;  3OIP A;  1IHZ A;  4OO1 I;  3WDN A;  3X3M A;  2F1M A;  1EU4 A;  1STN A;  2Q8T A;  3E5S A;  2NVX B;  5JVG 3;  2NYZ D;  1ZYR C;  1DZ1 A;  2H4O A;  2AQ1 B;  1BXT A;  5EPJ A;  1AFP A;  2F0O A;  3FMC A;  2LY7 A;  3KBG A;  1TWH B;  1HCZ A;  1PZI D;  3HOX B;  2A74 C;  1LTB D;  5C3W A;  4BA2 I;  4C3I G;  1SND A;  2SNM A;  1RJT A;  4DGZ A;  4F88 A;  4RAU C;  4P2C B;  4V19 0;  2XWJ B;  5E3F A;  1B44 D;  2LS0 1;  2JA8 B;  1EEF D;  3QIA A;  3OWE B;  3TZD A;  5LL6 X;  5FLX L;  4KKU A;  3K7A B;  1GUG A;  4K5W A;  3TDQ A;  3D4D A;  3U9O A;  4K8I A;  3LNN A;  3CHB D;  1SYE A;  4DK0 A;  3H6M A;  3W3A A;  4FXG C;  4J1M A;  2F0K A;  4X3U A;  5I9P A;  1EFI D;  3V05 A;  1O7Z A;  5JJZ A;  5A2Q E;  5KNB A;  4C3H G;  5IGE A;  2O4X A;  4KY7 A;  4HMJ A;  5EBD A;  1JIC A;  1DON A;  2K01 A;  2KCC A;  2OXP A;  1AP0 A;  3K59 A;  1JC7 A;  4KY5 A;  4HCS A;  5E1F A;  1S5D D;  2R92 B;  2B2T A;  3M4Y A;  2RKS A;  4QF4 A;  1VCI A;  2KEC A;  1JWU D;  1BCP F;  3MHB A;  1H9S A;  3LWE A;  2F0F A;  3UI2 A;  3S16 B;  4DAY A;  3VA7 A;  2VXW A;  3T4A C;  3N6R A;  4CKB A;  1SSO A;  2L11 A;  4TQU S;  1EIH A;  1CA5 A;  1B50 A;  4ZKB B;  5M5W B;  4PMW A;  3T51 B;  1B4O A;  4EGV A;  2JSO A;  1SNQ A;  4WFN 3;  5JEA J;  4XYO A;  2B2U A;  5CV8 A;  2E74 C;  2QIL A;  3VA5 A;  3NP8 A;  4DFA A;  1HTP A;  5E4W C;  2C5C A;  3DM1 A;  2A6E C;  1YNN D;  4RCO A;  4PQX A;  1EIG A;  1STG A;  3H94 A;  3BZD B;  4KD3 A;  3DWQ A;  1IL8 A;  1CHQ D;  5CR3 A;  1RCV D;  3PUV A;  3OHX C;  1Y1W B;  3C3L A;  1S5E D;  1XWE A;  4KN7 C;  2PNR C;  5M3M B;  1LT4 D;  1BDO A;  3IL8 A;  2L55 A;  3OMG A;  3DMU A;  1ONL A;  1HFG A;  2F4I A;  4CKE A;  1SYG A;  2NVQ B;  4XQN A;  4ZUJ A;  4A3G B;  5G3L F;  5HGT A;  3NTH A;  4KI0 A;  3K5L A;  5EKK A;  3OIQ A;  1LT3 D;  3T56 B;  2RDF A;  2AQ3 B;  1SJH D;  1SNC A;  1JQY D;  2KA7 A;  2IX3 A;  2B2U C;  2B2Y A;  2RDG A;  2IT1 A;  5F2D A;  2F0V A;  3FPP A;  3K0Y A;  2A6H C;  2AWO A;  3T16 A;  1NAP A;  2MGS A;  1TS2 A;  1DXM A;  5CGK A;  3Q23 A;  3EFX D;  3MAQ A;  2RDH A;  1B3A A;  5K36 G;  3NQI A;  5BN4 A;  1G6Z A;  3NQT A;  5ELB A;  1SNM A;  1CT1 D;  5CV5 A;  5A2Q L;  2GA4 B;  1FNW A;  1F2Y A;  2BCO A;  1C8C A;  4R9W A;  4IUV A;  4Q5V A;  2A5H A;  1LTS D;  2KUM A;  3SVM A;  3MWY W;  2IL8 A;  2PCF B;  3RLF A;  2EOT A;  2R93 B;  4FF2 A;  1E2W A;  3FVQ A;  1HPC A;  1R9T B;  2NTS A;  3IFD A;  4RFB A;  2B2Y C;  1SYC A;  5ISR A;  2PZT A;  3HGB A;  1YNJ D;  5KYI A;  3J7A F;  2M2L A;  3PUY A;  2EYP A;  4Y7N B;  2JEB I;  3SK5 A;  1DJR D;  3PO2 B;  1DCZ A;  4C1N I;  1Q8I A;  1WTQ A;  4EQP A;  1JR0 D;  1LT5 D;  1I4G A;  1PRT F;  3J7A V;  2DY7 A;  3PO3 B;  1D5M C;  3ONA B;  2EYM A;  1K8O A;  2WP8 J;  2KEE A;  1Z47 A;  3IAY A;  1SMY D;  1OXX K;  1O78 A;  4E6I A;  2HCC A;  2NN6 H;  1V1P B;  1PMR A;  3HRZ C;  3VR2 A;  1EY9 A;  2J7Z A;  2B63 B;  1PRT B;  1GOZ A;  3J7Y W;  3HOU B;  1R4Q B;  5D3D A;  4L6T B;  3I8Z A;  2R7Z B;  2D2C C;  2QKI C;  3Q6S A;  3DWP A;  1SE2 A;  3P75 A;  1TQO A;  1LT6 D;  4ULL A;  4OIJ A;  1BQQ T;  2K5Q A;  4N9P A;  1AEX A;  3ERQ A;  3I91 A;  4I65 A;  3S2H B;  4BBS B;  1KDB A;  2K6A A;  1QOH A;  5KRU A;  5COY A;  3M3Y B;  1SDF A;  2R3Z A;  2R6G A;  1ICW A;  4L8J A;  3SR1 A;  4KKT A;  1TKW B;  2N88 A;  2F0N A;  4ME5 A;  1WD1 A;  2Q8I B;  4KJO A;  4HSP A;  5J22 A;  3L3O C;  2EYO A;  1G8Z D;  4DXF A;  1JE4 A;  1CK1 A;  3BYT B;  2SOB A;  3TBI B;  1QIL A;  4RHS A;  2K28 A;  2I46 A;  5C44 B;  3BYY B;  3K6O A;  2K1B A;  2SEB D;  4C3H B;  1Y8N B;  1EY8 A;  2RSN A;  3SK8 A;  1UNS A;  2A68 C;  5CV6 A;  2G9H D;  3QWN A;  5EBC A;  2EYF A;  1BUV T;  2SDF A;  5IGF A;  1B9M A;  2OT2 A;  3H91 A;  4U68 A;  2PZU A;  2QDB A;  3DWA A;  1NR2 A;  2QF7 A;  5CC4 A;  3SDZ A;  4U67 3;  4NP5 A;  3ND9 A;  2KVM A;  4CBV A;  1JCK B;  2YU9 B;  2OEO A;  3TP8 A;  3ND8 A;  1Q12 A;  3TP5 A;  4DK1 A;  4A3K B;  3RZD B;  3QOJ A;  1IKL A;  3DEP A;  1IYU A;  4X3T A;  4IUN A;  1TY2 A;  2LKV A;  4M1U B;  1G91 A;  1JOQ A;  4C3J G;  1SYB A;  1A3T A;  4G7Z C;  4IFD G;  4LMQ D;  3SEB A;  2O2L D;  1QNK A;  2WIN B;  3BVM A;  5IGC A;  1K8M A;  1LTR D;  1ROD A;  2C9O A;  2DNE A;  3H0G B;  3T13 A;  4OGQ C;  2MHV A;  2MPM A;  2F03 A;  1T5E A;  3CU7 A;  1X3Q A;  4N9T A;  1T5X D;  1D5Z C;  1JOK A;  5EGT A;  3LX0 A;  1D1K A;  3GTK B;  4FNF A;  1Y69 U;  2EVB A;  3SE0 A;  1PZK D;  5T1G A;  1VDZ A;  4RGM A;  3TP6 A;  3NBI A;  4B9W A;  4MN3 A;  4MHE A;  5C0X H;  2EYH A;  1A15 A;  2FHT A;  3AMU A;  5DNF A;  1LO5 D;  4A3E B;  1WTX A;  3BDL A;  3NE5 B;  1F9Q A;  1A6X A;  4IN3 A;  1EY6 A;  3K57 A;  1I6H B;  1OXT A;  1AW7 A;  4K2L A;  1S4Z A;  1CFM A;  5BN3 A;  3R2T A;  1G2S A;  2F0P A;  3M7G A;  2MJ8 A;  4RWS C;  1V43 A;  4JBW A;  4K6L A;  5DAU A;  2RQX A;  2EJM A;  5ELD A;  1V1P A;  1SEB D;  3MXU A;  1MSH A;  2IWH A;  4MIU A;  1IKM A;  1HFN A;  1G29 1;  5IOD A;  3GO5 A;  5I2X A;  3DEO A;  1LTG D;  1X32 A;  2PW7 A;  4RCN A;  1CQF A;  1FNV A;  1TVX A;  2NN6 I;  1EYC A;  2MUY A;  2HDM A;  5C6A A;  4ZYS A;  2D9U A;  1IW7 C;  4ZAI A;  3GTO B;  4A3B B;  2B2W A;  2F0G A;  1TU2 B;  1TWF B;  1EZ6 A;  2EY6 A;  3KLR A;  1UUP A;  5I4D A;  3C2P A;  3CKI B;  5ELF A;  3V2T A;  2E75 C;  3CQZ B;  4ODG A;  1SNP A;  4XIG S;  4XXE A;  3WOF A;  1JB3 A;  2ZXR A;  2XVS A;  5I6W A;  2QEJ C;  1D6E C;  1CZG A;  1A2T A;  2WAC A;  4ZKC B;  1DOK A;  1PRT C;  3MVV A;  2X6G A;  5CV4 A;  2F0T A;  2E2H B;  4DN4 M;  2R61 A;  2NUC A;  5M5X B;  2NB0 A;  2X6L A;  2YYZ A;  2XNA C;  2Z4I A;  1STA A;  1IYV A;  3GV6 A;  4G7O C;  1SYD A;  1EU3 A;  4XT3 B;  2TSS A;  4FXD A;  1QJO A;  3S15 B;  2K7V A;  2M9V A;  2Z8L A;  2B2W C;  4DNR B;  1LV9 A;  2EDG A;  2RA4 A;  3TZU A;  1F2Z A;  3QO2 A;  1STB A;  1GHK A;  3SK4 A;  2L4N A;  4OO1 G;  5JVH 3;  3ITP A;  1PYW D;  2G9D A;  3FKI B;  1M4V A;  4HCE A;  4EQO A;  2EZV A;  2ZXP A;  2AUK A;  2D62 A;  4KHZ A;  3DUZ A;  1I6V C;  3M85 A;  1XX8 A;  1Z6H A;  1CA6 A;  5J1Z A;  3HOZ B;  2E2I B;  3S17 B;  4NDX A;  2LMC B;  1EY4 A;  4XQQ A;  2E2J B;  3BVG A;  2DY8 A;  1VMC A;  4ZRZ A;  4PV1 C;  2A69 D;  2KHS A;  1SE3 A;  2JE6 I;  3RZO B;  2JA7 B;  5IIF A;  1ET9 A;  1V8Q A;  1GJX A;  3I4L A;  4FF3 A;  1I4X A;  1J8I A;  3MC0 B;  1MGS A;  3VYS A;  4I7Z C;  1O80 A;  5FK9 C;  2VB2 X;  1MBY A;  1RDP D;  3RMH A;  3TN2 A;  2Y0S B;  4TRD A;  1XYI A;  2F0D A;  4QIW B;  1FGB D;  3P1H A;  1U4L A;  5D65 A;  1B53 A;  3VYR A;  2NZ1 D;  3MTS A;  1E2V A;  2XSC A;  4KTA A;  3NWT A;  2WAQ B;  4H44 C;  2BA0 A;  3D6C A;  2ICE C;  1S5C D;  2HQE A;  1MI2 A;  3P7J A;  4A3D B;  4KHV A;  4OIK A;  4EVO A;  4RGT A;  3TP7 A;  5CBA E;  1WTV A;  4JK1 C;  3VYU A;  3S1N B;  1GUN A;  3TSS A;  2NWG A;  3Q22 A;  5IT9 E;  1VMP A;  4C3J B;  1CHP D;  4G7H C;  1PDQ A;  3RD4 A;  4HN7 A;  5C0X J;  1EWH A;  4QUC A;  4BY7 B;  1ENA A;  3H09 A;  1RD9 D;  3OW7 A;  1TWC B;  3G6J B;  3W2D A;  1CM9 A;  1WCM B;  1PFB A;  1SAP A;  2F0U A;  2B39 A;  3BDO A;  1HQR D;  2K05 A;  4KN4 C;  1WTW A;  1FNU A;  1HUM A;  1TT2 A;  3MXP A;  1PZJ D;  5JPN C;  2F0E A;  3R93 A;  5C0X I;  4ID6 A;  5ELE A;  2B8F A;  1Z7T A;  4DU9 A;  4ZQ3 A;  5KEE A;  4IUT A;  1SNO A;  2E76 C;  2F0S A;  3OOC A;  1DD2 A;  3EA6 A;  4C2M B;  2F0L A;  4BS9 A;  3VR6 A;  1KNA A;  3I3C A;  2VUM B;  1JOO A;  1X3P A;  1U9R A;  2ICI A;  1HA6 A;  5K36 H;  4IFD I;  2K5W A;  1HQM C;  1LTA D;  2HDL A;  5EKI A;  2XRQ D;  1MSG A;  2JXM B;  2WKC A;  4A3F B;  2XWB B;  1GUS A;  1Q3L A;  2EJG C;  1PTO B;  3FEW X;  3N52 A;  3A8K E;  4C3I B;  4DNT B;  1JOR A;  5C4X B;  3VR5 A;  4LAA A;  3I4N B;  1I4R A;  4ILW A;  4FP5 D;  2KED A;  3O13 A;  1TS5 A;  3ZYY X;  1ILQ A;  1F9S A;  4KKS A;  2M00 A;  4RKB A;  5EJW A;  2IW3 A;  4RKL A;  4C56 C;  2F0J A;  3DHQ A;  3QOL A;  2V4D A;  4S3S A;  1STH A;  2BDO A;  3A7L A;  1STE A;  1V1O A;  3GTP B;  2FFK B;  3NHH A;  5K5P A;  5D14 A;  5C5M A;  1H9S B;  4A93 B;  3HOV B;  1OXS C;  3MFY A;  3G7L A;  3CRK C;  3C1E A;  2K33 A;  1GUT A;  5DM7 3;  1PTO D;  1FD7 D;  2NBF A;  4RHR A;  3D4W A;  2WKD A;  4TSS A;  3MEH A;  5KGU A;  2FMM A;  4H7B A;  1YNN C;  5BN5 A;  5KIX A;  3D8G A;  1BF4 A;  3A7A B;  4K6D A;  4ZLT F;  1Q1B A;  2PPB C;  1EY0 A;  2CW0 D;  5IT9 L;  3MXN A;  3D4R A;  1C48 A;  1OXU A;  2J4X A;  2A6E D;  2K03 A;  4DA2 A;  2TMP A;  1QG7 A;  1GHJ A;  2Q8R E;  3X3N A;  1CQV A;  5TSS A;  2Z4H A;  3EQL C;  1F2M A;  1LAC A;  5C4H A;  3NTK A;  1VF7 A;  1AZQ A;  4FO2 A;  4HR7 B;  5T1I A;  1R4P B;  1S5F D;  4A3I B;  2JYO A;  3PV0 A;  1B2T A;  3Q0A A;  3DXJ C;  1GXD C;  1LAB A;  2HUG A;  5I6Y A;  1LTI D;  3S1Q B;  2KOL A;  2A73 B;  3LWU A;  4FVM A;  3GTL B;  3RUZ A;  3OMC A;  1U4P A;  4K5V A;  2WII B;  1F9P A;  3MFG A;  2KCN A;  1HRJ A;  1SFO B;  5NUC A;  2OF1 A;  4YIJ A;  1HXY D;  1KLU D;  2ENB A;  3I4M B;  4DAV A;  3GTQ B;  1H9M A;  4K2K A;  1U4R A;  1A3U A;  3J81 E;  1K83 B;  5IGD A;  1ML0 D;  2XRS D;  2A6H D;  2L0C A;  1EQV A;  3I72 A;  3EJI A;  2IX1 A;  2EY5 A;  3HP3 A;  1QWY A;  4HMI A;  4CKC A;  5CBE E;  4UDU C;  2CQA A;  3L9A X;  5FKA C;  1HHV A;  1RKN A;  2ZT9 C;  3BVZ A;  2NVT B;  1I4H A;  1JWM D;  1RHP A;  1BO0 A;  1ZEQ X;  2PYK A;  2ZXO A;  1D1I A;  1ET6 A;  1F77 A;  2EYL A;  4HSV A;  3MZ5 A;  4IUQ A;  1DOM A;  3GTM B;  4XQJ A;  3I70 A;  1YNJ C;  3NPP A;  3MA2 B;  1EYA A;  4UAI A;  4H13 C;  3QG1 A;  2PW5 A;  1UAP A;  2SNS A;  5KNC A;  3JAM E;  3TME A;  1H9J A;  3SHL A;  4IFD H;  5EKL A;  1C4Q A;  3T53 B;  3GTG B;  1SMY C;  3EVQ A;  1EYD A;  4DF7 A;  4Z9C B;  1EEI D;  1QE6 A;  2JA6 B;  2DN8 A;  1AZP A;  2N55 A;  4LK1 C;  5C5L A;  2F0W A;  2NVY B;  1B9N A;  1XXG A;  5IOC A;  4CGY B;  1KLG D;  1EQT A;  1MD2 D;  4KK7 A;  3PUZ A;  1TY0 A;  1DYQ A;  2BE5 D;  1SBB B;  1S5B D;  1PFN A;  1CZW A;  5I2Y A;  3PIP 3;  5C3E B;  4WJW A;  4KD4 A;  5I9O A;  1NCV A;  1BOS A;  2I07 B;  5CV9 A;  1FR3 A;  5M9O A;  3K5M A;  3HG9 A;  4CJ2 C;  3R3O A;  2QCP X;  4PMB A;  3S1M B;  3GV3 A;  2X69 A;  1KAB A;  2CVR A;  1CI3 M;  4FF4 A;  4CJ0 B;  1PFM A;  1PLF A;  5EQ0 A;  4TKO B;  3MXG A;  1PTO H;  2B8G A;  2PO4 A;  2PZW A;  3VR3 A;  4QB4 A;  1SYF A;  3PMF A;  1SJE D;  2RSO A;  2NTT A;  2BDN A;  4M8A A;  2F0M A;  3D6W A;  3J81 L;  4BY1 B;  2F3W A;  1F2L A;  3FRP B;  3QJY A;  2L9H A;  5KND A;  4K5X A;  4G57 A;  1EWC A;  1ZKO A;  4PNY A;  3OSO A;  1PTO C;  4F87 A;  5CYU A;  3A8J E;  1Y8P B;  3SXH A;  1BCP B;  3BDC A;  1I50 B;  2JA5 B;  2E2D C;  3A56 A;  5C4J B;  1ZXT A;  4H0L C;  4RGN A;  1TII D;  2CW0 C;  4C1N K;  1OXV A;  1TS4 A;  4BWG B;  4OHJ A;  3URY A;  4FF1 A;  4L63 B;  2A68 D;  3R2I A;  1L0Y B;  3KLS A;  1KDC A;  2FIN B;  2F0Q A;  3FDT A;  4IQZ A;  4RA8 A;  1ENF A;  4O42 A;  2LFN A;  2KQ3 A;  2F3V A;  3PIO 3;  2JEA I;  1EZ8 A;  3BS1 A;  2B2T C;  3HKZ B;  4HTH A;  3HZX A;  3KBX A;  2EJF C;  1TS3 A;  4J6H A;  1BR9 A;  4XDX A;  4K14 A;  3JAM L;  1W6J A;  1VF5 C;  3R8B A;  1Q1E A;  3E6Z X;  2XN9 C;  3BG3 A;  4IAL A;  3A8I E;  2O5I C;  3NBH A;  1D2B A;  5C3X A;  5DM6 3;  3I90 A;  2J0T D;  5FO9 B;  1BCP D;  2VB3 X;  3KUP A;  1I4P A;  3V96 A;  3GTJ B;  3U9S A;  1SXT A;  3AU7 A;  1ENC A;  1RF2 D;  1RTO A;  3J80 E;  4HED A;  2FMC A;  4G4K A;  2AWN A;  2NN6 G;  5J39 A;  1GUW A;  1A3V A;  3K5N A;  2EE1 A;  4XTC S;  1F9R A;  1AN8 A;  4OO1 H;  5JPM C;  1QNU A;  4B9X A;  4QUF A;  2EXZ A;  3H3V C;  2ID0 A;  1ILP A;  1WTR A;  4PMC A;  3C46 A;  5IGB A;  1A2U A;  1EY5 A;  2FJ2 A;  5LHY 1;  3A55 A;  1U4M A;  1NUC A;  2PMZ B;  1PXU A;  3F2U A;  1ESF A;  1KTK A;  3WOE A;  1LLR D;  4LJZ C;  1ZYR D;  4CHT B;  4X3K A;  2EY2 A;  1BBX C;  1JWS D;  2WB1 B;  2O5J C;  5DEH A;  1TWG B;  2L1B A;  3S14 B;  5AFW A;  1HTL D;  2HCI A;  5G3L D;  4IFD J;  1WD0 A;  4NMZ A;  2L5T A;  1RTN A;  3GP7 A;  3P20 A;  3KF8 A;  1LTT D;  2DNC A;  4BBR B;  1PTO F;  2WV6 D;  3ERO A;  1O7L A;  1M8A A;  4WOR A;  1O7Y A;  2PQE A;  4EQN A;  2VNU D;  1Y8O B;  2F0H A;  1NR4 A;  1QB5 D;  1BNZ A;  4O1N A;  4IZ8 A;  2BE5 C;  5JEA G;  4QCL A;  1WVL A;  1J9O A;  3NUC A;  2EPB A;  3NWS A;  1HUN A;  1EY7 A;  1L0X B;  5KYL A;  1Q90 A;  1E0B A;  1GUO A;  4Q0F A;  3IKJ A;  4IUP A;  3D3R A;  4HAE A;  3AB9 A;  3S1R B;  1ESR A;  5IGG A;  2BA1 A;  5C4Z A;  2EYJ A;  5D3I B;  1IW7 D;  4F7X A;  2BOS A;  1UEA B;  1STY A;  4QMG A;  5A35 A;  4ZK9 B;  3KLS X;  2IJ0 A;  1WTO A;  5EPK A;  1Y1V B;  3NK9 A;  2B2V A;  4K8J A;  4KV6 A;  4NKL A;  1II3 A;  4IUU A;  2H1E A;  3NSW A;  5HUR A;  1D5X C;  5FO8 B;  1CTM A;  1QCB D;  2K04 A;  3HOW B;  4DAP A;  1EL0 A;  5M3F B;  4AYB B;  4ZUI A;  5CMD A;  2Z1C A;  3M4O B;  1PRT D;  3J80 L;  2AUJ D;  4A3J B;  3SK6 A;  5ELC A;  1OO9 B;  2IX0 A;  1H9K A;  4KY6 A;  2RVL A;  4R8I A;  3PUW A;  5M5Y B;  1W6K A;  5JOB A;  5JEA H;  4BA1 I;  2XIW A;  3GQB A;  3Q24 A;  1E2Z A;  5FLX E;  3GD7 A;  2KJX A;  5LL6 S;  4OL7 A;  5JAV A;  3VYT A;  4IUR A;  3IFT A;  3OWF A;  2CHB D;  2B2V C;  1TWA B;  2L12 A;  3VR4 A;  2AQ2 B;  4FYD A;  4DXG A;  3K58 A;  3HS0 C;  1KNE A;  3K5O A;  3HOY B;  3FPU B;  3S2D B;  4B08 A;  4GZY C;  4WRD A;  2K32 A;  5COR A;  2F0I A;  5C0X G;  4XT1 B;  4KMU C;  2A69 C;  1G2T A;  1H9R A;  3S9W A;  1B1Z A;  1I4Q A;  1SE4 A;  4XYQ A;  3D31 A;  3QB3 A;  4RH6 A;  4FXK C;  3KK7 A;  1WTP A;  4A3M B;  2K5D A;  1BCP C;  1EOT A;  2RBM A;  4X3S A;  5CV7 A;  5E4X A;  3I73 A;  4F8M A;  3HEJ A;  3A54 A;  2D5D A;  2IPK D;  4KJN A;  3C1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...