1WD0A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd0A00
2L1BA 4ZAIA 1XX8A 4HAEA 1NAPA 1SAPA 2KECA 3GV3A 3FDTA 1CA5A 1QE6A 3IFDA 3G7LA 4XDXA 4X3SA 1WD0A 1X3PA 1MSGA 2FFKB 1PDQA 5EPKA 1AP0A 1G91A 2K28A 4IUTA 1HFGA 2B2VC 3KBXA 5EKIA 1BO0A 4IURA 4UAIA 4XT3B 2B2WA 4RAUC 5CBEE 1RTOA 2XIWA 3HP3A 1EIGA 1JICA 2B2WC 3MTSA 1WTPA 4HCSA 2RVLA 1WTRA 1AZQA 2NYZD 1KNEA 1WTWA 2KEDA 1Q3LA 4QUFA 4NW2A 3TN2A 1HUNA 1SDFA 5EQ0A 2CVRA 4CJ2C 2KOLA 2JYOA 5E4XA 5EPJA 1O7YA 1G2TA 1DOLA 1PFBA 1ESRA 2K05A 2FMMA 3R93A 3GV6A 1VMPA 4QUCA 5T1GA 2B2TC 3QO2A 1A15A 1U4LA 2N88A 4RA8A 5CBAE 2HDMA 1HHVA 3N52A 1J8IA 4X3TA 1XYIA 2RSOA 1MGSA 4XT1B 3DEOA 1WD1A 1IL8A 2B2YA 2Q8TA 1EQTA 2R3ZA 1B50A 1QG7A 1DOKA 1RTNA 2X69A 4RWSC 3TZDA 4ZLTF 5CMDA 1RODA 1TVXA 2H1EA 2L4NA 3Q6SA 5DNFA 1PLFA 2EPBA 1ML0D 1HA6A 4CJ0B 1BBXC 1JE4A 1F9PA 2KUMA 1WTVA 1HRJA 4X3KA 5D14A 1C8CA 5E4WC 1U4RA 3IL8A 4X3UA 1DONA 2FINB 2X6GA 2MJ8A 3I90A 1EL0A 1HUMA 2EOTA 1J9OA 2B2UA 4R8IA 1G2SA 5JJZA 1IKLA 3H91A 1SSOA 4OIJA 5AFWA 1VMCA 3SVMA 4R9WA 5EJWA 4HEDA 1KNAA 2L9HA 3MWYW 1WTOA 4IUPA 1NCVA 2HCIA 1M8AA 4ZKBB 1U4MA 2MP1A 2L11A 1ILQA 2L12A 2HUGA 1EIHA 1HFNA 1X32A 1WVLA 1B2TA 4CJ1B 1B53A 2BDNA 3KUPA 2NWGA 1BF4A 4IUUA 1MSHA 2HCCA 5CORA 1CM9A 3D6WA 1NR4A 1O7ZA 2FJ2A 1GUWA 2JP1A 4U68A 4IUQA 4MHEA 1AZPA 2NZ1D 2SDFA 1MI2A 2K04A 3LWEA 1X3QA 1IKMA 2KVMA 1O80A 1F2LA 1QNKA 2B2UC 1NR2A 2K1BA 4DN4M 1B4OA 3P7JA 2RA4A 4O42A 2J7ZA 4OIKA 4ZKCB 1ILPA 1PFNA 3ONAB 3I8ZA 2K03A 3UI2A 1G6ZA 1DOMA 1PFMA 5T1IA 3I91A 2DY7A 1F9QA 3I3CA 1CA6A 1U4PA 2IL8A 1ZXTA 1EOTA 2N55A 2HDLA 2K01A 1E0BA 2RSNA 1F9SA 5EPLA 1RHPA 4IUVA 2KEEA 1S4ZA 4MN3A 2FHTA 3F2UA 1ICWA 1WTQA 1RJTA 2M2LA 1WTXA 2B2YC 3DEPA 4LMQD 1LV9A 2D9UA 3DM1A 3FPUB 4HSVA 1DZ1A 2EE1A 1BNZA 2VXWA 2MGSA 5D65A 1B3AA 2B2VA 5COYA 1F9RA 2X6LA 2MPMA 2B2TA 4ZK9B 2DY8A 2Q8RE
chains in the Genus database with same CATH superfamily
1YJ9A 2EYMA 3GV3A 2YTXA 3TS2A 1F2ZA 1UE7A 4H0LC 2D62A 3MVVA 1PDQA 3I72A 3NENA 4IUTA 1X54A 3DLLA 4A76A 2ES2A 2KCTA 3TP6A 5CV8A 2CWPA 4XT3B 3D4DA 1HQRD 4G7ZC 3JAME 3PO3G 1PYWD 2EDGA 5JJLA 2PQEA 1IXRA 4DR1Q 4A3MH 3TN2A 1PA6A 2F0KA 1YHBA 1S5CD 5KNCA 2VQFQ 2A6HC 1A63A 5ELEA 2WP8J 1LT5D 2VS1A 3ULLA 2YU9B 2UUAL 3MAQA 4RCOA 1EUJA 5EAYA 2R7ZG 1MGSA 4Y52H 3HOUB 4J15A 1TVXA 3QIAA 1EQVA 1BBXC 3ZJYC 1VQDA 2AWOA 1I4RA 2JA8B 4X3KA 3DM3A 1U4RA 3GDEA 3IL8A 2FINB 2X6GA 2Q2HA 1YBYA 2QCPX 5IYCG 1ENCA 3H91A 2UXDL 4OIJA 3VA5A 2E2IH 5DM73 4Q5VA 1WFQA 2VUMH 3TDQA 5CV5A 1Q81C 3H0GG 5IP9G 5K36H 1WVLA 4QQBX 2K5WA 2BDNA 4K14A 4DR2Q 2D5DA 2F4VQ 3HOWG 1BCPD 3I73A 2A68C 2FJ2A 2PMZB 4A3MB 4FF3A 1F2LA 1NR2A 1UEAB 3MEHA 4Y7NH 2G5DA 4KHPL 2ZJRA 4N9PA 3UI2A 2KA7A 2VUMB 3I7FA 2F0FA 1R4PB 2BH2A 4TQUS 4WORA 2KEEA 1I4HA 3KLWA 2E2HB 1BXTA 1ENFA 4PZ6A 3HS0C 5D3IB 4C56C 1BQQT 4A3DB 2Z9HA 2HQEA 4C3IH 2F0QA 1YZ6A 3UDFA 4QL5A 1E2ZA 2X6LA 2B2TA 1AW7A 2Q8RE 1NAPA 3T51B 4DV6L 4B3TL 2DGYA 2ID0A 2GA4B 3G4SA 1N33L 3DWPA 3C1FA 1VQKA 4ALPA 1AE2A 1K83B 1K3RA 4JOIC 1ZYRD 3H3VH 2AMCB 3S1NB 3E5SA 4FP5D 4C3IB 3RLOA 3CMAA 5EPJA 4C1NK 4IPCA 3HGBA 3NEMA 3K5MA 4BY7H 1H9JA 4Q0FA 1JWSD 1U4LA 4HIOA 5C0XI 1YJWA 1LTID 3TP8A 3SK4A 4BY1B 4RGOS 4CKBA 2X69A 4HR7B 1UNSA 2Z0SA 3A5UA 3IAYA 3FPPA 1N9WA 2L4NA 2JA6G 2EJMA 5EKLA 3BU2A 3GO5A 3SE0A 3J7AF 3M3YH 2CW0C 4A3GB 4DNRB 1X3FA 2EOTA 3NQIA 1G2SA 1GVPA 1Z7TA 4JBMA 1JQYD 1I94L 1WTOA 3J7AV 1KLGD 1FNUA 4ZKBB 3E0JA 3ND9A 1LLRD 4R4OA 4GLXA 2Z1CA 3KUPA 1GOZA 3CF5A 1Y8NB 2ZXPA 1XMOQ 4AYBE 2QDLA 4R4IA 3HOZG 1ZEQX 2EYHA 3KJOA 3F8TA 5FO9B 5FLXc 2SNSA 1W3SA 2C9OA 5IYBG 1IKMA 1A8VA 2KVMA 3TBIB 2E5LL 2K5HA 3FP9A 2E5LQ 4IUNA 2K5NA 1Q46A 4L6TB 3S1QB 4ZQ3A 1DOMA 1XMQQ 1DCZA 4P75A 1U4PA 2HD3A 1ZXTA 2VY3A 3NXWA 4DV1Q 2Z6KC 4IUVA 5G3LD 2J4XA 2DJFC 2RQXA 3S14B 1Q7YC 3GTGB 5FLXE 4LF8Q 3W5OA 4JV5L 2EXDA 2XNAC 1BBUA 1SJHD 5KGUA 1HNZL 3TEHB 2MHVA 4V0BA 3K5OA 2JA8H 4EQNA 5KEEA 1MBYA 4G57A 1Y1WH 1DXMA 2WAQG 1Z6HA 2RDFA 1CZWA 5IP9H 2WV6D 4XDXA 5M5XH 1KABA 4UP9A 2K28A 1XTDA 5ELBA 5CBEE 1IL2A 4Y7NB 1JICA 4K0KQ 4DUZL 4LFCL 2L5TA 1HQMC 4MTKA 1JORA 4DUZQ 2EJGC 2DUDA 1TWFH 4QF4A 4YWKA 1CKMA 2Q2TA 1QUQB 2RCNA 3HZXA 5IYBH 3BJUA 4JI7L 4J1MA 4OGQC 1XYIA 1I5FA 3SXHA 1WD1A 1Y1VH 2B2YA 5J22A 4LUOA 4RWSC 3D31A 4KY7A 2EIFA 4G4KA 5DNFA 1KD1C 2I0QA 5M5YB 4KI0A 5GQOA 3J7ZC 3PUXA 4BBSB 2NTTA 1KHIA 5E3FA 3PO3H 3I90A 1EL0A 1JMCA 2F0UA 1CQVA 3SVMA 3BS1A 4YY3L 2O4XA 1IBLL 1FGUA 3K7AB 4HEDA 1D5MC 4DR1L 3RZDH 1MD2D 2B63G 4BWGB 1VQPA 3SK6A 1VQLA 3AYHB 1S72A 3HG9A 1AEXA 1JOOA 4IUUA 1EIYB 2NN6H 2XTIA 5D3DA 1KAAA 3BZCA 4DR4L 4A3EH 2QEXA 3G6EA 4FYDA 1IYJB 5IWAQ 5FLXL 1Z9FA 2B2UC 4A3DH 1ILPA 3PCOB 4ZKCB 3GTMB 2F0MA 1NUCA 3E3XA 3I4LA 5C4XH 5IGCA 1F2YA 1F9QA 2JQOA 1B9NA 4L5TA 3T1YL 2PO4A 4GN3B 3R2IA 1Q1BA 2F0PA 2QGQA 4HJ9A 2IJ0A 2D9UA 1V8QA 2XSCA 1TWGH 3KF6A 4OX9Q 2FMCA 3L7ZC 1VQ6A 5COYA 3I56A 1SYGA 2MPMA 3MXPA 5C4JH 3I4NG 3CP0A 3PUWA 4DV4L 4C3JH 4HJAA 2L0CA 4DR7L 3IFDA 3ULPA 4F7XA 1ET6A 4IO9A 2OF1A 1CFMA 2JSOA 2EQSA 1QOHA 4IZ8A 1GHKA 2BE5D 1QNUA 4LF6Q 3TMEA 2L15A 4JBJA 4LF6L 4IFDI 4PQXA 1J5EL 2Z4IA 1GKHA 4ULLA 4JI6L 4NXNL 2BE5C 2DJGC 1I94Q 1BKBA 3X3NA 5LMUL 1SMYD 3OTOQ 4GKKL 3UDXA 4KJNA 4CDCC 2KOLA 2JE6I 1HCZA 1FVIA 2PZTA 5IOCA 5E4XA 2AKWB 2ASBA 3URYA 4LW1A 5IIFA 3S14H 5ELDA 5DEHA 4RA8A 3FKIG 2H5XA 4RFBA 3HOWH 4C3JG 3BDCA 2JN4A 1S5ED 2JA5H 2RDHA 3PSIA 4DR3Q 1EEFD 3S1MH 1VQBA 2EPBA 3A56A 4DU9A 5IY0A 2V4DA 1D1KA 3ER0A 4H7BA 2CH4W 4DV0L 3W3AA 2SOBA 1GJXA 3W2DA 3FRPB 3VR2A 4C2MB 4A3FB 5C3WA 1EYGA 2QW7A 4JW0A 3S17H 4FO2A 1MKHA 4X64L 4OX9L 2WAQE 4DV5Q 3MFYA 2H4OA 2L11A 2WB1E 1HNWQ 3QR8A 2R61A 2EYJA 3Q0AA 2QEJC 2JJQA 3R2TA 1H9SB 5A2QL 1SE8A 4R8NA 1MSHA 1SNQA 4K6LA 1BBWA 4GNXB 3HOUG 3D6WA 4A3DG 2XN9C 3L3OC 1S3OA 1HXYD 4U68A 2SDFA 1MI2A 3U4VA 4PMBA 2KJXA 4NDXA 1PTOB 1VQOA 1YNJC 4FF1A 1PH4A 2LXJA 4KKUA 3GTLH 3J80i 2K03A 3PO2H 2IHFA 1STBA 3KDFA 2IL8A 2N55A 1GUSA 4UPAA 1I4XA 3PIOA 1WCMH 2I5MX 1ONLA 4B3ML 2M2LA 4A3IH 3DM1A 2JA7H 2ZT9C 1LTGD 1DZ1A 1GM5A 4PMCA 1CUKA 1SROA 5I9OA 2BDOA 2L1BA 1P8LA 4KKSA 1V43A 1SNCA 3GTKH 5LHY1 5KRUA 4GZYC 4IPGA 4CGYB 4JI1Q 4NW2A 2B3GA 2Y0SE 4HIDA 5EQ0A 1N34Q 3A7AB 3HKZG 3S1NH 1ENAA 4YIJA 3FVQA 4IFDJ 3R93A 4TKOB 1RD9D 4EQ5A 1Q86C 1OXTA 4ME5A 1HHVA 4X3TA 1PRTF 3TREA 3KLSX 1A0IA 1STGA 5HGQA 5DLQE 4HTHA 2CW0D 1AH9A 4KHVA 2H1EA 2UUAQ 1CI3M 3GTMH 3EVQA 2D2CC 2LMCB 1BVSA 1VQJA 2EJFC 1F9PA 1Y1WG 1TIID 2A6EC 4GS3A 4A3KG 1NJIC 2MJ8A 2VUMG 2B2UA 5FK9C 3E9IA 1PXUA 3JAML 4R1JA 2OTLA 1E1OA 4EGVA 3S9WA 3T1HQ 5C3XA 5K36G 1K28A 3HFZB 4L5RC 3TZUA 3KFUA 3ND8A 4GLAC 3I4MH 3OWFA 3AU7A 3GTJB 1HFNA 4K2LA 1UE6A 4CJ1B 1A3VA 4LF5L 5C4JB 2OCEA 4WJWA 2TSSA 1LTRD 2MO1A 2HCCA 1UWVA 5M3MG 4JI7Q 2TMPA 1Q90A 1TWCH 2F0GA 2SNMA 1ZYRC 3CRLC 2NZ1D 4ZRZA 3NTHA 1Q82C 3KLSA 4JBWA 3DWQA 3D3RA 1LTTD 2RA4A 1LUZA 1YITA 3HKZE 4DNIA 1QZHA 5DM63 1A62A 4QIWE 3GTOH 3WOFA 3J80L 3LWUA 4N8FA 1KLUD 4JPBW 1VQFA 3H09A 3KDFB 2XRSD 5BN3A 3CXCA 2VW9A 2EYPA 5LL6X 1RJTA 2B2YC 5E7NA 3OHXC 4B9XA 2B29A 3VR5A 4K6DA 3VYTA 3M7NA 3A7LA 1C48A 2VXWA 3CW2C 3VYSA 5LMNW 1W6JA 4TRDA 1E3PA 3I55A 5M3MB 1W2BA 2WAQB 2Z6BA 2UXCQ 3MEFA 5GROA 2E74C 1SYCA 1GD7A 2B2VC 2NB0A 1BO0A 4IURA 4AYBB 4M8AA 5IWAL 4A3CH 3QJYA 2XIWA 3K7UC 4OELB 2RCFA 1CTMA 2NYZD 3WOEA 1N33Q 2KEDA 4QUFA 2CVRA 3J81L 1M90C 3MXGA 2JYOA 1MIUA 2UUCQ 1VMPA 5T1GA 4UY8C 1D8LA 2ZJQA 2I07B 2N8NA 1A15A 1Y1VG 4L8JA 3HOYB 3HOXG 1EYAA 3ITPA 2KENA 1VF7A 3QG1A 5CV6A 3FHWA 4BY1G 5FOBB 3E9HA 1TS5A 3L2PA 3EA6A 1RODA 1QUQA 4UDUC 1RKNA 1STYA 3K6OA 4GOPC 4EQPA 3W1GA 2IW3A 5D14A 2LS01 1TS3A 4CBVA 1DONA 4PZ8A 5H1SE 3PMFA 4ZUIA 1X6OA 4R8IA 1QVGA 2I5HA 2E2DC 5EKKA 1B44D 2ZM6Q 4XQJA 5M3FH 5C5MA 2A68D 3N6RA 3JAMi 3TS0A 1YHQA 1SFOH 4LF4L 4IJHA 4P72A 5C3EH 1HA5A 1PH5A 4HJ7A 3PGZA 3BYYB 5FKAC 5IGFA 1EWHA 1IHZA 1SMYC 4DF7A 4GOPA 3OSOA 3J81c 1Y8PB 2NVTH 2HIXA 4B3SQ 3KLRA 3M4QA 1TWCB 4NXML 4A93G 1UE5A 1GXDC 4DK1A 1O80A 5A2QE 4GNXA 4X65L 1TY0A 2JA7B 1FL0A 3KF8B 1B7YB 1HTLD 2DY7A 3T56B 3F2DA 1XJVA 1CA6A 4I7AA 2UXBL 4JI2Q 1RHPA 4RMFA 3F2UA 3F2BA 3OMGA 3DEPA 3I70A 3ERSX 2R7FA 2N3SA 2YYZA 2B2VA 4P73A 1E24A 4ZAIA 1O7IA 5F2DA 1SYFA 2AQ3B 1HNXQ 1KDBA 1H95A 1VQ4A 1GHJA 1QE6A 1VQ7A 1C0AA 3GTKB 3H94A 2B8FA 3KF8A 5EKIA 4ZCKA 1CHQD 4RAUC 2I46A 1EIGA 2PQAB 3MTSA 2F0SA 1KNEA 1GUGA 3A8KE 3O13A 1PZID 4A3FG 3K59A 4OEMB 1DOLA 3I2ZA 1ESRA 2FMMA 2K7VA 2B2TC 4LFBL 4I7ZC 1HPCA 4OL7A 3T16A 4C1NI 1DJRD 4XT1B 4BY7G 1B50A 5I4DA 4C3JB 2EY6A 1QJOA 1PTOH 1STEA 3CHBD 4P74A 4ILWA 2O2LD 2IPKD 1ML0D 4K5VA 3STBC 5C0XJ 4FXGC 2A8VA 3RLNA 4DAPA 2Z4HA 1E1TA 4FNFA 4GKKQ 1N36Q 3KYHC 1EYCA 4JI2L 1IKLA 1KRTA 1LM0A 5AFWA 2ZTEA 1SE2A 2DNCA 4IUPA 4C3HH 2NN6I 3HOXB 5HURA 1SFOB 3K58A 2HUGA 2WACA 3CQZH 3EQLC 3S16H 4C3HB 3GTQH 2ICEC 3I4MG 1VQAA 3M4YA 1BF4A 1D1IA 4A3BB 4KY6A 1TS4A 4IPDA 4JI5Q 3K0XA 1VF5C 5GAHC 2QA4A 2NVQH 1VDZA 1JOQA 2ENBA 1X3GA 5M5YH 2LXKA 1CT1D 1AN8A 1E2WA 3I8ZA 4OWTB 2F0NA 4DV5L 2BA1A 1STHA 1LACA 3V2TA 3K5NA 5BN4A 4DFAA 4KMUC 4JI4Q 4U673 1TWAB 2AUJD 3T1HL 2MFIA 1GUTA 4H02A 3PUYA 1YVCA 5GAGC 4LJZC 5I6WA 1S5BD 2DY8A 5M3FG 3LNNA 2L55A 3AFQA 3W1BA 3OIPA 4IPHA 1K83H 4JI0L 1WD0A 1EYDA 2F03A 1HJPA 3P20A 2XVSA 1STNA 1CKNB 3MA2B 1N36L 4UAIA 3HP3A 3HOXH 3T1YQ 4MNOA 3GTLB 4BBRB 4X6AH 1Y1WB 1TWFB 1VQIA 4QMGA 1Q3LA 1ICFB 1G51A 1QILA 3J80E 5FO8B 2F3WA 2EZVA 3HOZH 5JAVA 1O7YA 1G2TA 5AJ3Q 2K05A 3CCVA 3U50C 4QGUA 1KXLA 5AJ3L 3UDGA 4DXFA 1D5XC 4B3RQ 5BN5A 4RCNA 4DUYQ 4DR4Q 3DEOA 4NPSA 3NPPA 1TXYA 4ZLTF 2E76C 5HGTA 2ZXOA 3GP7A 1K0RA 2IX1A 1VCIA 4MTNA 1HUMA 1SE4A 2VQFL 3J81i 1L0YB 1YI2A 4QCLA 5C44G 3LX0A 2K52A 1ET9A 1NCVA 1NNXA 2WKCA 2JEBI 1ILQA 4JCVE 2A74C 4N8X1 4LF5Q 1ASYA 5GAEC 4B08A 1SLJA 1BUVT 5EBCA 1UE1A 1HNWL 5C5LA 1PRTC 1AZPA 3LWEA 1YEZA 4DV7L 1B4OA 2J7ZA 3S2DH 3RNUA 3EFXD 1VQNA 2F0EA 2F4IA 1SJED 3UE0A 1I3QH 2EY1A 2VQEQ 4LF9L 3S2DB 3DXJC 4EX5A 5EPLA 4HIMA 1SRUA 3T4AC 2OXPA 1KDAA 1TQOA 4MN3A 2FHTA 4DV4Q 4DR7Q 4BS9A 1Q1EA 1WTXA 1M1KC 1BCPF 4A3BG 1PH6A 3T53B 2BCOA 3Q22A 2HHHQ 3HOVG 4JI3L 1XPRA 4J8QA 2R7ZB 1CHPD 5JOBA 3FDTA 4JBKA 3PIO3 2R92B 3G7LA 4BA1I 1PVOA 1X55A 2AWNA 2R93H 1V1PB 3OYYA 1AP0A 4YHHL 1G91A 2MNAA 1PH7A 1G6PA 2B2WA 1RTOA 1QCBD 4LUVA 1XNRQ 4DXGA 1XNRL 4JI1L 1XNQL 4QB4A 5IYCH 3RLFA 1JB3A 1SDFA 4PNYA 4KHZA 4XYQA 4BXXG 1H9SA 2NVXB 3OIQA 4ABNA 3GV6A 4QUCA 2UUBL 4DR3L 3B6YA 1IZ6A 5C0XG 1DD2A 5ELCA 3G48A 4KD4A 2PQAA 3OW2A 1IL8A 3PO2B 1PRTD 2KHSA 1QG7A 3ZYYX 1EZ8A 1I50H 4P2CB 4B9WA 3F1ZA 4XTCS 4RHSA 1TY2A 1E22A 4WJ3M 4FXKC 2VZAA 1KC8C 1C8CA 2WINB 4DR6Q 3GTGH 2GVBA 1G8ZD 4OWWB 2JA7G 4DR6L 1O78A 1MJCA 1JWMD 1SSOA 5JJIA 4PMWA 3K5LA 2XGTA 2F4VL 3CMEA 3WDNA 1SR3A 5IE8A 2RBMA 4IFDG 1HTPA 1JC7A 1RCVD 3D0FA 2PNHA 3FEWX 2JEAI 4A3EG 2F1MA 4A3FH 5DAUA 1FD7D 1ASZA 1BOSA 2G9DA 3QOJA 2HT1A 3PO3B 2K04A 2M9VA 4A3MG 4YCWA 4DR2L 4O42A 1XMOL 3P1HA 1ESFA 3MXNA 2B39A 2E75C 1H9RA 3P75A 2A73B 1SE3A 4CDEC 3HEJA 4YWMA 1EWIA 1QVCA 3TRZA 1ICWA 2MO0A 4BA2I 4A3LG 1I4QA 4H44C 3S1RB 2K5VA 1B3AA 4A3EB 4DUYL 3C1EA 4ZK9B 2KQ3A 3VA7A 3L0OA 4K5WA 1L2FA 2QDBA 2NTSA 4K5XA 3X3MA 5IP7G 5CV7A 2F0HA 2M00A 5LMNL 3TQYA 4JG2A 4BY7B 3KBGA 2YTVA 1EY4A 3AMUA 1P16A 3UE1A 1PH9A 3CPFA 3A0JA 1CZGA 2PNRC 4CJ2C 1YNXA 4R4TA 1PFBA 2K33A 2KCNA 1SYDA 5CBAE 1Q8KA 4XQQA 4IOCA 1JWUD 5IT9E 1I6VC 3H3VC 1I4PA 2AHOB 2E2JB 3A54A 3RZOB 3SR1A 4A93H 2XWBB 4C2MH 1L1OB 4RGMA 1L0WA 2EYLA 3Q8DA 4YCVA 1HA6A 4CJ0B 1JR0D 4F8MA 4A3GH 1EY9A 2F0TA 4DV2Q 1KRSA 1VQ9A 4OO1G 3E0EA 3D8GA 2EY2A 2PCFB 2JK8A 3DWAA 5FO7B 2K32A 5IGEA 4CHTB 1U4MA 3EROA 5JVH3 5M5XB 4A75A 1EIHA 3S24A 1X32A 3DHQA 3GTOB 4XXEA 2R7ZH 2NWGA 4V190 2CKZB 4IOAA 3CC4A 1B8AA 1EFID 2KBNA 1J6QA 3K0YA 3FKIB 4YCUA 3RN5A 5C44B 4WJ4A 3SK8A 1X3QA 1M4VA 3CC7A 3VR4A 1MHWC 1A2TA 4ID6A 3GTJH 5J39A 1C4QA 1QZGA 2GN5A 1XNQQ 1I3QB 5CC4A 1WCMG 3S1QH 4JV5Q 2YU9H 3CD6A 5I6YA 1PYBA 4KV6A 2K5DA 1S4ZA 1A3UA 2QF7A 2KHIA 3JAMc 3KK7A 3NSWA 4BBRG 3UDIA 5JEAG 4LAAA 4R4CA 4JOIA 3J7A5 3NBHB 4KLKA 3S1MB 1PV4A 1N32L 1E7ZA 4BBSH 1Q12A 1V1OA 3Q23A 1TR5A 1I50B 1QB5D 3HKZB 1X3PA 2AUKA 4GN4B 2O5IC 1WI5A 2A5HA 3PUZA 1CKOA 5M3FB 5A35A 2CQOA 2B63H 3S17B 2UXBQ 1KAWA 3RUZA 3G6JB 1C9OA 4NXNQ 3PF4A 1WTPA 1IW7C 3PQIA 4FF2A 1T5EA 1HH2P 3CCRA 2LFNA 1Y69U 4OO1I 5CGKA 5C4ZA 3U4ZA 3OWEB 2PMZE 4CDDC 4X62L 3N52A 5IYDH 3GTPH 2JA5G 2RSOA 3MHBA 2C5CA 1EU4A 1CKNA 1EQTA 3K7AH 3NQTA 5TSSA 3RZDB 3TZDA 2ZTDA 4Z9CB 1IBML 4LNQA 2OQ0A 1S5FD 3Q6SA 2VL6A 5LL6S 4X65Q 4A3KH 1CSQA 3TSSA 1YJNA 4O2DA 1JE4A 3ICEA 1KDCA 5KIXA 3QWNA 3OTOL 5E4WC 4X3UA 3HOVB 3H6MA 3EN2A 3ULJA 5JJZA 1KTKA 4HMJA 1VMCA 4DR5Q 2Q8IB 5KYIA 4KN7C 4GKJQ 1XPOA 4EVOA 1M8AA 4DV1L 3GTPB 4NXMQ 3SEBA 4DNTB 1JE5A 1DM0B 1F2MA 1FNWA 4LF7L 1RIPA 2OEOA 3BDLA 5JJKA 4LF7Q 1PYSB 5NUCA 1K0SA 1HZ9A 3M3YB 2JP1A 4MHEA 5IP7H 1F77A 2Y0SB 1XWEA 2G9HD 3P7JA 1SN8A 3CCUA 4HIKA 1B3QA 2A69D 4BY1H 4LUZA 4DAYA 1TS2A 5C6AA 2O5JC 5C4XG 3BVZA 3M7GA 2OTJA 1BDOA 1ZKOA 2F0OA 1R9TB 3K81C 1LV9A 3GQBA 1SYEA 1VQ5A 4AIMA 5J3BA 2KCMA 4RGTA 4DN4M 1L1OC 2ATWA 2R7DA 4C3HG 3GTQB 4HN7A 2K6AA 2NVYB 2NUCA 1OXXK 5LMUQ 4HJ8A 4K8IA 1YIJA 5CYUA 1HFGA 3A74A 1EQRA 1EOVA 5CV9A 3VDYA 4KKTA 4HCSA 1CSPA 4JI4L 2BH8A 1WTRA 3S2HB 2VB2X 3M4PA 3SGIA 1SNMA 2PZUA 3A8IE 1G291 2PW7A 2HHHL 1VQCA 1VQHA 1X56A 1WTHA 3A5ZB 3M9BA 2A19A 1BCPC 4JI5L 4DV0Q 2ZTCA 2F0DA 2EVBA 1X65A 4X66Q 4YY3Q 3E6ZX 4IFDH 2CWAA 1PHJA 2KUMA 3IRBA 2XWJB 1OTCA 2A69C 2QKIC 1NSNS 2LY7A 4GN5A 3KF6B 2V1CC 1JB7A 4XYOA 1IYUA 2QILA 1NTGA 5M5WH 2RKSA 5ISRA 2JA5B 5IT9c 1LABA 5FJ8G 1SNPA 2PZWA 2Z6KA 1NE3A 1GO3E 3NELA 2MP1A 3V96A 2EY5A 4AH6A 2L12A 2JA6B 4A4IA 4AYBG 1N32Q 1D5ZC 2R93B 1DGSA 1T9HA 1B53A 4KK7A 1O7LA 4F87A 1E2VA 1UAPA 3BZDB 4RH6A 1KL9A 4X66L 3J7YW 1O7ZA 3TP7A 3S2HH 1EFWA 1TU2B 4AQYQ 1YNJD 1OXUA 3NBHA 1LT3D 3MXUA 1D6EC 4DGZA 1X9NA 1PFNA 4UHVA 5EGTA 5IGGA 1Y1VB 3HOYG 1UEBA 3A8JE 4FVMA 4A3JG 2VQEL 1I4GA 3K8AA 3NTIA 4DV2L 1MJEA 4TVAB 1EOTA 1Z47A 2HDLA 2K01A 1SBBB 3JC66 3NBIA 1K8OA 3H0GB 1LTBD 1OO9B 4G7HC 2WB1B 1TWHB 4DPGA 3PIP3 2NVTB 1X3EA 4IALA 1EWCA 2FXQA 2K5QA 1SEBD 3RZOH 2D0OA 1SAPA 1CQFA 4JVZA 4JYAL 4JI6Q 3U58A 1KQSA 1FNVA 2R92G 1PZJD 4OWXB 4X3SA 1PZKD 4DAVA 1HZCA 5EPKA 4E6IA 1EQQA 3AFPA 1N34L 4RKBA 3KBXA 1K9MC 1H9KA 3C2PA 2VB3X 4DK0A 1IW7D 1YNND 1D7QA 1SMXA 2CQAA 1BCPB 1WYDA 3D4WA 3NP8A 1NMFA 1L0XB 1WTWA 2ZXRA 3EIVA 3FMCA 2EXZA 1HZBA 4O1NA 2I5LX 2UUCL 4HJ5A 4QJFA 4A3IG 2UUBQ 4A3LH 4KTAA 2EYFA 5E1FA 1GUOA 4FF4A 3U9SA 1L1OA 2IY5B 2N88A 1B70B 3HKSA 4R4QA 1HR0Q 1HR0L 3MC0B 4KJOA 2Z8LA 2Q8TA 3CCEA 4YHHQ 4I65A 2ZJPA 5C4XB 1VQMA 1K8MA 4L5SA 1T5XD 1LT4D 3NWSA 3HOZB 1EY6A 1PLFA 4YWLA 1OXVA 1H9MA 1C7YA 4A3CG 1S5DD 4WRDA 3DMUA 1Y8OB 4ZUJA 2K75A 1TWHH 4NMZA 4A3JB 2OWOA 1D2BA 5I9PA 2L9HA 3ERQA 1EY5A 1PTOC 2GVAA 5GADC 3S15H 2NVYH 4ODGA 4X64Q 2K4KA 2YV5A 1A2UA 3VYUA 5FLMG 4HMIA 2JA9A 1VS0A 4JI8Q 1QVFA 4KHPQ 1CM9A 4WFN3 3WWVA 3PIPA 4XIGS 4IUQA 5JPNC 4RGNA 4A93B 1PTOD 3VR3A 1SNOA 1K8AC 4A3GG 1WJJA 5JEAJ 4DAMA 4OONA 4QY7A 3STBD 4G7OC 1E0BA 2R92H 4A3JH 3BYTB 2BOSA 4C3IG 1LTAD 1FYCA 4KY5A 1PRTB 4DV6Q 4B3TQ 4H13C 4GKJL 3CCJA 3KJPA 4K8JA 4HSVA 1RF2D 2F0LA 1JJ2A 2LSSA 1IBKQ 4LFAL 3D4RA 2IX3A 2LKVA 4UP8A 2KECA 2UU9Q 1CA5A 1CK1A 4KN4C 3NUCA 3H3VI 1EZ6A 3I4MB 4FXDA 3CQZB 1PFSA 4PV1C 2R6GA 4NB3A 1AFPA 3HOYH 1VQGA 3S15B 5C3EG 3NTKA 3J81j 3C46A 1I6HB 3I4NH 1GUNA 4NKLA 1FGBD 1YNNC 1HUNA 2MUYA 1JJGA 2F0WA 1HZAA 3I4OA 5KNDA 4LFBQ 3PV0A 3QO2A 4X62Q 2UU9L 3EJIA 4JI8L 1WOCA 3M4OH 5L37A 1J8IA 4P71A 5BR8Q 3IKJA 2PYKA 5BR8L 4PG3A 1PH2A 3CC2A 3NK9A 5ELFA 1II3A 4HCEA 4ZYSA 4LF4Q 2WIIB 4O0AA 4A3IB 3CAMA 1TWGB 1XXGA 4CDFC 3RR5A 2NN6G 2CCZA 5IT9L 4FDBA 1TKWB 1A3TA 3CCLA 2WB1G 4L63B 1U9RA 3M4OB 2F0VA 5CR3A 2JA6H 1EY7A 1PH8A 4B3SL 4CKCA 1V9PA 2A6ED 2E2IB 1R4QB 3RD4A 3VR6A 1B2TA 1IBKL 4M1UB 2DN8A 2SEBD 4JYAQ 1V1QA 1K73C 2PI2A 3KOJA 2ICIA 2CH4A 2KCCA 5CORA 4L5QA 1NR4A 1W6KA 3CU7A 3I4NB 3CKIB 5IGBA 3HOUH 3AB9A 5ELOA 5ELNA 2RHQB 3BG3A 3ONAB 4DR5L 3BZKA 1NY4A 4NP5A 1B9MA 1PFMA 2OT2A 1XMQL 4DV3L 4DAYB 3CCSA 1EY8A 5IODA 3R3OA 3J81E 4JC0A 2ALYB 1HNXL 2RF4A 1N8RC 2D0PA 3S1RH 4RKLA 2UXCL 2EE1A 1YHAA 5D65A 1Q8IA 3SDZA 3CRKC 5LMNQ 1IYVA 3BVMA 2IHEA 1HNZQ 4HAEA 5G3LF 3L9AX 2EYOA 3QOLA 2F52A 1MSGA 5C4HA 3M85A 4LWCA 3QB3A 3MXNB 2Q2UA 2F3IA 2Y0SG 4OO1H 2RVLA 1U0LA 4K0KL 5M5WB 4CKEA 4DK3C 3OMCA 1KIXA 2PW5A 4TSSA 4MZ9A 3FKIH 5JPMC 1J5EQ 2ZM6L 4QIWB 3DUZA 1RDPD 5I2XA 1BR9A 3H15A 3BVGA 3VYRA 1RL2A 1STAA 4OXPA 1LO5D 2KHJA 5M9OA 2F0JA 5K5PA 1DOKA 1PMRA 4GLVB 5CMDA 4POGA 1LTSD 2R93G 5FJ8H 1S40A 2NZHA 2F3VA 4APVA 5KNBA 1R9TH 3NHHA 4GNXC 4DV3Q 3OW7A 4A3BH 3H0GH 3T13A 2E8GA 4R9WA 4UP7A 4F88A 4K2KA 2JXMB 2IWHA 2P5ZX 3C3LA 5I2YA 3PF5A 3V05A 5FLMH 2J0TD 2BA0A 3D6CA 3PUVA 1FR3A 2YTYA 3OPOA 3GD7A 1Y14B 2AQ1B 2VNUD 4JK1C 2NVXH 5CV4A 2F0IA 5C44H 4AQYL 3TP5A 5KYLA 3CPWA 1NMGA 2CFMA 1EIFA 1LT6D 1TWAH 1QNKA 5J1ZA 1LTLA 2IT1A 3HRZC 4OHJA 3RMHA 3HOWB 2DNEA 4RHRA 2A6HD 1V1PA 4BBSG 1G6ZA 5T1IA 3I91A 3I3CA 2Q2IA 1K3BC 1XTCD 2RSNA 2N49A 1F9SA 1OXSC 4EQOA 5JEAH 2UXDQ 1WTQA 2NVQB 4XQNA 5JVG3 2N78A 1PH1A 3MFGA 4RG1A 4LF8L 2MGSA 2K14A 1F9RA 4BBRH 4GOPB 1I6HH 1XX8A 1U5KA 4DA2A 1IBMQ 3SK5A 3G71A 3K57A 1WCMB 4MIUA 2FFKB 2B63B 3S16B 1SYBA 1FJGL 3F2CA 1JT8A 1DYQA 5M3MH 2K50A 2PPBC 2B2WC 1AZQA 2AQ2B 1LYLA 4B3RL 2HQLA 2PI2E 2NZOA 3BDOA 5C0XH 4A3KB 2B8GA 1EU3A 2RDGA 1IBLQ 3CCMA 2CHBD 4DK6C 2HDMA 5EBDA 1JOKA 5C3EB 3K80C 4LK1C 4LFAQ 2R3ZA 1RTNA 3CCQA 4KD3A 4BXXH 1VQ8A 4J6HA 1UUPA 4PZ7A 3NE5B 3AEVA 3J80c 1WTVA 2HIVA 1HRJA 3EBEA 3MZ5A 1J9OA 1VQEA 1K8GA 4IN3A 2C35B 2WKDA 5EJWA 2E2HH 1KNAA 3MWYW 1B1ZA 2OQKA 2JA8G 4ME3A 2WFWA 3A55A 4DKAC 2HCIA 2A1AA 2NBFA 4N9TA 4B3MQ 1EEID 4DV7Q 3HOVH 2IX0A 2RHSB 3SHLA 4POFA 1A6XA 3OOCA 1GUWA 4HSPA 1SNDA 1QWYA 1FJGQ 4LF9Q 1AE3A 4S3SA 2K1BA 5IYDG 4OIKA 4JI0Q 5IGDA 1JCKB 2XRQD 4IQZA 3NWTA 5HY6A 4LFCQ 2E2JH 3IFTA 3R8BA 1JJCB 1TT2A 4JI3Q 3LGJA 1SXTA 3U9OA 1XPUA 4IJLA 1HR0W 4LMQD 3AQQA 3FPUB 1PTOF 1PH3A 1EY0A 3Q24A 1BNZA 3RN2A 2MQHA 3PO2G 1NBWA
chains in the Genus database with same CATH topology
2EYMA 3GV3A 1F2ZA 4H0LC 2D62A 3MVVA 1PDQA 3I72A 4IUTA 3TP6A 5CV8A 4XT3B 3D4DA 1HQRD 4G7ZC 3JAME 1PYWD 2EDGA 2PQEA 3TN2A 2F0KA 1S5CD 5KNCA 2A6HC 5ELEA 2WP8J 1LT5D 2YU9B 3MAQA 4RCOA 1MGSA 3HOUB 1TVXA 3QIAA 1EQVA 1BBXC 2AWOA 1I4RA 2JA8B 4X3KA 1U4RA 3IL8A 2FINB 2X6GA 2QCPX 1ENCA 3H91A 4OIJA 3VA5A 5DM73 4Q5VA 3TDQA 5CV5A 5K36H 1WVLA 2K5WA 2BDNA 4K14A 2D5DA 1BCPD 3I73A 2A68C 2FJ2A 2PMZB 4A3MB 4FF3A 1F2LA 1NR2A 1UEAB 3MEHA 4N9PA 3UI2A 2KA7A 2VUMB 2F0FA 1R4PB 4TQUS 4WORA 2KEEA 1I4HA 2E2HB 1BXTA 1ENFA 5D3IB 3HS0C 4C56C 1BQQT 4A3DB 2HQEA 2F0QA 1E2ZA 2X6LA 2B2TA 1AW7A 2Q8RE 1NAPA 3T51B 2ID0A 2GA4B 3DWPA 3C1FA 1K83B 1ZYRD 3S1NB 3E5SA 4FP5D 4C3IB 5EPJA 4C1NK 3HGBA 3K5MA 1H9JA 4Q0FA 1JWSD 1U4LA 5C0XI 1LTID 3TP8A 3SK4A 4BY1B 4RGOS 4CKBA 2X69A 4HR7B 1UNSA 3IAYA 3FPPA 2L4NA 2EJMA 5EKLA 3GO5A 3SE0A 3J7AF 2CW0C 4A3GB 4DNRB 2EOTA 3NQIA 1G2SA 1Z7TA 1JQYD 1WTOA 3J7AV 1KLGD 1FNUA 4ZKBB 3E0JA 3ND9A 1LLRD 2Z1CA 3KUPA 1GOZA 1Y8NB 2ZXPA 1ZEQX 2EYHA 5FO9B 2SNSA 2C9OA 1IKMA 2KVMA 3TBIB 4IUNA 4L6TB 3S1QB 4ZQ3A 1DOMA 1DCZA 1U4PA 1ZXTA 3NXWA 4IUVA 5G3LD 2J4XA 2RQXA 3S14B 3GTGB 5FLXE 2XNAC 1SJHD 5KGUA 2MHVA 4V0BA 3K5OA 4EQNA 5KEEA 1MBYA 4G57A 1DXMA 1Z6HA 2RDFA 1CZWA 2WV6D 4XDXA 1KABA 2K28A 5ELBA 5CBEE 4Y7NB 1JICA 2L5TA 1HQMC 1JORA 2EJGC 4QF4A 3HZXA 4J1MA 4OGQC 1XYIA 3SXHA 1WD1A 2B2YA 5J22A 4RWSC 3D31A 4KY7A 4G4KA 5DNFA 5M5YB 4KI0A 3PUXA 4BBSB 2NTTA 5E3FA 3I90A 1EL0A 2F0UA 1CQVA 3SVMA 3BS1A 2O4XA 3K7AB 4HEDA 1D5MC 1MD2D 4BWGB 3SK6A 3HG9A 1AEXA 1JOOA 4IUUA 2NN6H 5D3DA 1KAAA 4FYDA 5FLXL 2B2UC 1ILPA 4ZKCB 3GTMB 2F0MA 1NUCA 3I4LA 5IGCA 1F2YA 1F9QA 1B9NA 2PO4A 3R2IA 1Q1BA 2F0PA 2IJ0A 2D9UA 1V8QA 2XSCA 2FMCA 3L7ZC 5COYA 1SYGA 2MPMA 3MXPA 3PUWA 2L0CA 3IFDA 4F7XA 1ET6A 2OF1A 1CFMA 2JSOA 1QOHA 4IZ8A 1GHKA 2BE5D 1QNUA 3TMEA 4IFDI 4PQXA 2Z4IA 4ULLA 2BE5C 3X3NA 1SMYD 4KJNA 2KOLA 2JE6I 1HCZA 2PZTA 5IOCA 5E4XA 3URYA 5IIFA 5ELDA 5DEHA 4RA8A 4RFBA 4C3JG 3BDCA 1S5ED 2RDHA 1EEFD 2EPBA 3A56A 4DU9A 2V4DA 1D1KA 4H7BA 3W3AA 2SOBA 1GJXA 3W2DA 3FRPB 3VR2A 4C2MB 4A3FB 5C3WA 4FO2A 3MFYA 2H4OA 2L11A 2R61A 2EYJA 3Q0AA 2QEJC 3R2TA 1H9SB 5A2QL 4R8NA 1MSHA 1SNQA 4K6LA 3D6WA 2XN9C 3L3OC 1HXYD 4U68A 2SDFA 1MI2A 4PMBA 2KJXA 4NDXA 1PTOB 1YNJC 4FF1A 4KKUA 2K03A 1STBA 2IL8A 2N55A 1GUSA 1I4XA 1ONLA 2M2LA 3DM1A 2ZT9C 1LTGD 1DZ1A 4PMCA 5I9OA 2BDOA 2L1BA 4KKSA 1V43A 1SNCA 5LHY1 5KRUA 4GZYC 4CGYB 4NW2A 5EQ0A 3A7AB 1ENAA 4YIJA 3FVQA 4IFDJ 3R93A 4TKOB 1RD9D 1OXTA 4ME5A 1HHVA 4X3TA 1PRTF 3KLSX 1STGA 4HTHA 2CW0D 4KHVA 2H1EA 1CI3M 3EVQA 2D2CC 2LMCB 2EJFC 1F9PA 1TIID 2A6EC 2MJ8A 2B2UA 5FK9C 1PXUA 3JAML 4EGVA 3S9WA 5K36G 5C3XA 3TZUA 3ND8A 3OWFA 3AU7A 3GTJB 1HFNA 4K2LA 4CJ1B 1A3VA 5C4JB 4WJWA 2TSSA 1LTRD 2HCCA 2TMPA 1Q90A 2F0GA 2SNMA 1ZYRC 3CRLC 2NZ1D 4ZRZA 3NTHA 3KLSA 4JBWA 3DWQA 3D3RA 1LTTD 2RA4A 5DM63 3WOFA 3J80L 3LWUA 1KLUD 3H09A 2XRSD 5BN3A 2EYPA 5LL6X 1RJTA 2B2YC 3OHXC 4B9XA 3VR5A 4K6DA 3VYTA 3M7NA 3A7LA 1C48A 2VXWA 3VYSA 1W6JA 4TRDA 5M3MB 2WAQB 2E74C 1SYCA 2B2VC 4AYBB 2NB0A 1BO0A 4IURA 4M8AA 3QJYA 2XIWA 1CTMA 2NYZD 3WOEA 2KEDA 4QUFA 2CVRA 3J81L 3MXGA 2JYOA 1VMPA 5T1GA 2I07B 1A15A 4L8JA 3HOYB 1EYAA 3ITPA 1VF7A 3QG1A 5CV6A 5FOBB 1TS5A 3EA6A 1RODA 4UDUC 1RKNA 1STYA 3K6OA 4EQPA 2IW3A 5D14A 2LS01 1TS3A 4CBVA 1DONA 3PMFA 4ZUIA 4R8IA 2E2DC 5EKKA 1B44D 4XQJA 5C5MA 2A68D 3N6RA 1HA5A 3BYYB 5FKAC 5IGFA 1EWHA 1IHZA 1SMYC 4DF7A 3OSOA 1Y8PB 3KLRA 1TWCB 1GXDC 4DK1A 1O80A 5A2QE 2JA7B 1TY0A 1HTLD 2DY7A 3T56B 1CA6A 1RHPA 3F2UA 3OMGA 3DEPA 3I70A 2YYZA 2B2VA 4ZAIA 5F2DA 1SYFA 2AQ3B 1KDBA 1GHJA 1QE6A 3GTKB 3H94A 2B8FA 3KF8A 5EKIA 1CHQD 4RAUC 2I46A 1EIGA 3MTSA 2F0SA 1KNEA 1GUGA 3A8KE 3O13A 1PZID 3K59A 1DOLA 1ESRA 2FMMA 2K7VA 2B2TC 4I7ZC 1HPCA 4OL7A 3T16A 4C1NI 1DJRD 4XT1B 1B50A 5I4DA 4C3JB 2EY6A 1QJOA 1PTOH 1STEA 3CHBD 4ILWA 2O2LD 2IPKD 1ML0D 4K5VA 5C0XJ 4FXGC 4DAPA 2Z4HA 4FNFA 1EYCA 1IKLA 5AFWA 1SE2A 2DNCA 4IUPA 2NN6I 3HOXB 5HURA 1SFOB 3K58A 2HUGA 2WACA 3EQLC 4C3HB 2ICEC 1BF4A 3M4YA 1D1IA 4A3BB 4KY6A 1TS4A 1VF5C 1VDZA 1JOQA 2ENBA 1CT1D 1AN8A 1E2WA 3I8ZA 2F0NA 2BA1A 1STHA 1LACA 3V2TA 3K5NA 5BN4A 4DFAA 4KMUC 4U673 1TWAB 2AUJD 1GUTA 3PUYA 4LJZC 5I6WA 1S5BD 2DY8A 3LNNA 2L55A 3OIPA 1WD0A 1EYDA 2F03A 3P20A 2XVSA 1STNA 3MA2B 4UAIA 3HP3A 3GTLB 4BBRB 1Y1WB 1TWFB 4QMGA 1Q3LA 1QILA 3J80E 5FO8B 2F3WA 2EZVA 5JAVA 1O7YA 1G2TA 2K05A 4DXFA 1D5XC 5BN5A 4RCNA 3DEOA 3NPPA 4ZLTF 2E76C 5HGTA 2ZXOA 3GP7A 2IX1A 1VCIA 1HUMA 1SE4A 1L0YB 4QCLA 3LX0A 1ET9A 1NCVA 2WKCA 2JEBI 1ILQA 2A74C 4B08A 1BUVT 5EBCA 5C5LA 1PRTC 1AZPA 3LWEA 1B4OA 2J7ZA 3EFXD 2F0EA 2F4IA 1SJED 2EY1A 3S2DB 3DXJC 5EPLA 3T4AC 2OXPA 1KDAA 1TQOA 4MN3A 2FHTA 4BS9A 1Q1EA 1WTXA 1BCPF 3T53B 2BCOA 3Q22A 4J8QA 2R7ZB 1CHPD 5JOBA 3FDTA 3PIO3 2R92B 3G7LA 4BA1I 2AWNA 1V1PB 1AP0A 1G91A 2B2WA 1RTOA 1QCBD 4DXGA 4QB4A 3RLFA 1JB3A 1SDFA 4PNYA 4KHZA 4XYQA 1H9SA 2NVXB 3OIQA 4ABNA 3GV6A 4QUCA 1DD2A 5C0XG 5ELCA 4KD4A 1IL8A 3PO2B 1PRTD 2KHSA 1QG7A 3ZYYX 1EZ8A 4P2CB 4B9WA 4XTCS 4RHSA 1TY2A 4FXKC 1C8CA 2WINB 1G8ZD 1O78A 1JWMD 1SSOA 4PMWA 3K5LA 3WDNA 2RBMA 4IFDG 1HTPA 1JC7A 1RCVD 3FEWX 2JEAI 2F1MA 5DAUA 1FD7D 1BOSA 2G9DA 3QOJA 3PO3B 2K04A 2M9VA 4O42A 3P1HA 1ESFA 3MXNA 2B39A 2E75C 1H9RA 3P75A 2A73B 1SE3A 3HEJA 1ICWA 4BA2I 1I4QA 4H44C 3S1RB 1B3AA 4A3EB 3C1EA 4ZK9B 2KQ3A 3VA7A 4K5WA 2QDBA 2NTSA 4K5XA 3X3MA 5CV7A 2F0HA 2M00A 4BY7B 3KBGA 1EY4A 3AMUA 1CZGA 2PNRC 4CJ2C 1PFBA 2K33A 2KCNA 1SYDA 5CBAE 4XQQA 1JWUD 5IT9E 1I6VC 3H3VC 1I4PA 2E2JB 3A54A 3RZOB 3SR1A 2XWBB 4RGMA 2EYLA 1HA6A 4CJ0B 1JR0D 4F8MA 1EY9A 2F0TA 4OO1G 3D8GA 2EY2A 2PCFB 3DWAA 5FO7B 2K32A 5IGEA 4CHTB 1U4MA 3EROA 5JVH3 5M5XB 1EIHA 1X32A 3DHQA 3GTOB 4XXEA 2NWGA 4V190 1EFID 3FKIB 3K0YA 5C44B 3SK8A 1X3QA 1M4VA 3VR4A 1A2TA 4ID6A 5J39A 1C4QA 1I3QB 5CC4A 5I6YA 4KV6A 2K5DA 1S4ZA 1A3UA 2QF7A 3KK7A 3NSWA 5JEAG 4LAAA 3S1MB 1Q12A 1V1OA 3Q23A 1TR5A 1I50B 1QB5D 3HKZB 1X3PA 2AUKA 2O5IC 2A5HA 3PUZA 5M3FB 5A35A 3S17B 3RUZA 3G6JB 1WTPA 1IW7C 4FF2A 1T5EA 2LFNA 1Y69U 4OO1I 5CGKA 5C4ZA 3OWEB 3N52A 2RSOA 3MHBA 2C5CA 1EU4A 1EQTA 3RZDB 3NQTA 5TSSA 3TZDA 4Z9CB 1S5FD 3Q6SA 5LL6S 3TSSA 1JE4A 1KDCA 5KIXA 3QWNA 5E4WC 4X3UA 3HOVB 3H6MA 5JJZA 1KTKA 4HMJA 1VMCA 2Q8IB 5KYIA 4KN7C 4EVOA 1M8AA 3GTPB 3SEBA 4DNTB 1DM0B 1F2MA 1FNWA 2OEOA 3BDLA 5NUCA 3M3YB 2JP1A 4MHEA 1F77A 2Y0SB 1XWEA 2G9HD 3P7JA 2A69D 4DAYA 1TS2A 5C6AA 2O5JC 3BVZA 3M7GA 1BDOA 1ZKOA 2F0OA 1R9TB 1LV9A 3GQBA 1SYEA 4RGTA 4DN4M 4C3HG 3GTQB 4HN7A 2K6AA 2NVYB 2NUCA 1OXXK 4K8IA 5CYUA 1HFGA 5CV9A 4KKTA 4HCSA 1WTRA 3S2HB 2VB2X 1SNMA 2PZUA 3A8IE 1G291 2PW7A 1BCPC 2F0DA 2EVBA 3E6ZX 4IFDH 2KUMA 2XWJB 2A69C 2QKIC 1NSNS 2LY7A 4XYOA 1IYUA 2QILA 2RKSA 5ISRA 2JA5B 1LABA 1SNPA 2PZWA 2MP1A 3V96A 2EY5A 2JA6B 2L12A 1D5ZC 2R93B 1B53A 4KK7A 1O7LA 4F87A 1E2VA 1UAPA 3BZDB 4RH6A 3J7YW 1O7ZA 3TP7A 1TU2B 1YNJD 1OXUA 3NBHA 1LT3D 3MXUA 1D6EC 4DGZA 1PFNA 5EGTA 5IGGA 1Y1VB 3A8JE 4FVMA 1I4GA 3NTIA 1EOTA 1Z47A 2HDLA 2K01A 1SBBB 3NBIA 1K8OA 3H0GB 1LTBD 1OO9B 4G7HC 2WB1B 1TWHB 3PIP3 2NVTB 4IALA 1EWCA 2K5QA 1SEBD 1SAPA 1CQFA 1FNVA 1PZJD 4X3SA 1PZKD 4DAVA 5EPKA 4E6IA 4RKBA 3KBXA 1H9KA 3C2PA 2VB3X 4DK0A 1IW7D 1YNND 2CQAA 1BCPB 3D4WA 3NP8A 1L0XB 1WTWA 2ZXRA 3FMCA 2EXZA 4O1NA 4KTAA 2EYFA 5E1FA 1GUOA 4FF4A 3U9SA 2N88A 3MC0B 4KJOA 2Z8LA 2Q8TA 4I65A 5C4XB 1K8MA 1T5XD 1LT4D 3NWSA 3HOZB 1EY6A 1PLFA 1OXVA 1H9MA 1S5DD 4WRDA 3DMUA 1Y8OB 4ZUJA 4NMZA 4A3JB 1D2BA 5I9PA 2L9HA 3ERQA 1EY5A 1PTOC 4ODGA 1A2UA 3VYUA 4HMIA 1CM9A 4WFN3 4XIGS 4IUQA 5JPNC 4RGNA 4A93B 1PTOD 3VR3A 1SNOA 5JEAJ 4G7OC 1E0BA 3BYTB 2BOSA 4C3IG 1LTAD 1FYCA 4KY5A 1PRTB 4H13C 4K8JA 4HSVA 1RF2D 2F0LA 3D4RA 2IX3A 2LKVA 2KECA 1CA5A 1CK1A 4KN4C 3NUCA 1EZ6A 3I4MB 4FXDA 3CQZB 4PV1C 2R6GA 1AFPA 3S15B 3NTKA 3C46A 1I6HB 1GUNA 4NKLA 1FGBD 1YNNC 1HUNA 2MUYA 2F0WA 5KNDA 3PV0A 3QO2A 3EJIA 1J8IA 3IKJA 2PYKA 3NK9A 5ELFA 1II3A 4HCEA 4ZYSA 2WIIB 4A3IB 1TWGB 1XXGA 2NN6G 5IT9L 1TKWB 1A3TA 4L63B 1U9RA 3M4OB 2F0VA 5CR3A 1EY7A 4CKCA 2A6ED 2E2IB 1R4QB 3RD4A 3VR6A 1B2TA 4M1UB 2DN8A 2SEBD 2ICIA 2KCCA 5CORA 1NR4A 1W6KA 3CU7A 3I4NB 3CKIB 5IGBA 3AB9A 3BG3A 3ONAB 4NP5A 1B9MA 1PFMA 2OT2A 1EY8A 5IODA 3R3OA 3J81E 4RKLA 2EE1A 5D65A 1Q8IA 3SDZA 3CRKC 1IYVA 3BVMA 4HAEA 5G3LF 3L9AX 2EYOA 3QOLA 1MSGA 5C4HA 3M85A 3QB3A 4OO1H 2RVLA 5M5WB 4CKEA 3OMCA 2PW5A 4TSSA 5JPMC 4QIWB 3DUZA 1RDPD 5I2XA 1BR9A 3BVGA 3VYRA 1STAA 1LO5D 5M9OA 2F0JA 5K5PA 1DOKA 1PMRA 5CMDA 1LTSD 2F3VA 5KNBA 3NHHA 3OW7A 3T13A 4R9WA 4F88A 4K2KA 2JXMB 2IWHA 3C3LA 5I2YA 3V05A 2J0TD 2BA0A 3D6CA 3PUVA 1FR3A 3GD7A 3OPOA 2AQ1B 2VNUD 4JK1C 5CV4A 2F0IA 3TP5A 5KYLA 1LT6D 1QNKA 5J1ZA 2IT1A 3HRZC 4OHJA 3RMHA 3HOWB 2DNEA 4RHRA 2A6HD 1V1PA 1G6ZA 5T1IA 3I91A 3I3CA 1XTCD 2RSNA 1F9SA 1OXSC 4EQOA 5JEAH 1WTQA 2NVQB 4XQNA 5JVG3 3MFGA 2MGSA 1F9RA 1XX8A 4DA2A 3SK5A 3K57A 1WCMB 4MIUA 2FFKB 2B63B 3S16B 1SYBA 1DYQA 2PPBC 2B2WC 1AZQA 2AQ2B 3BDOA 5C0XH 4A3KB 2B8GA 1EU3A 2RDGA 2CHBD 2HDMA 5EBDA 1JOKA 5C3EB 4LK1C 2R3ZA 1RTNA 4KD3A 4J6HA 1UUPA 3NE5B 1WTVA 1HRJA 3MZ5A 1J9OA 4IN3A 5EJWA 2WKDA 1KNAA 3MWYW 1B1ZA 3A55A 2HCIA 2NBFA 4N9TA 1EEID 2IX0A 3SHLA 1A6XA 3OOCA 1GUWA 4HSPA 1SNDA 1QWYA 4S3SA 2K1BA 4OIKA 5IGDA 1JCKB 2XRQD 4IQZA 3NWTA 3IFTA 3R8BA 1TT2A 1SXTA 3U9OA 4LMQD 3FPUB 1PTOF 1EY0A 3Q24A 1BNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  4ZAI A;  1XX8 A;  4HAE A;  1NAP A;  1SAP A;  2KEC A;  3GV3 A;  3FDT A;  1CA5 A;  1QE6 A;  3IFD A;  3G7L A;  4XDX A;  4X3S A;  1WD0 A;  1X3P A;  1MSG A;  2FFK B;  1PDQ A;  5EPK A;  1AP0 A;  1G91 A;  2K28 A;  4IUT A;  1HFG A;  2B2V C;  3KBX A;  5EKI A;  1BO0 A;  4IUR A;  4UAI A;  4XT3 B;  2B2W A;  4RAU C;  5CBE E;  1RTO A;  2XIW A;  3HP3 A;  1EIG A;  1JIC A;  2B2W C;  3MTS A;  1WTP A;  4HCS A;  2RVL A;  1WTR A;  1AZQ A;  2NYZ D;  1KNE A;  1WTW A;  2KED A;  1Q3L A;  4QUF A;  4NW2 A;  3TN2 A;  1HUN A;  1SDF A;  5EQ0 A;  2CVR A;  4CJ2 C;  2KOL A;  2JYO A;  5E4X A;  5EPJ A;  1O7Y A;  1G2T A;  1DOL A;  1PFB A;  1ESR A;  2K05 A;  2FMM A;  3R93 A;  3GV6 A;  1VMP A;  4QUC A;  5T1G A;  2B2T C;  3QO2 A;  1A15 A;  1U4L A;  2N88 A;  4RA8 A;  5CBA E;  2HDM A;  1HHV A;  3N52 A;  1J8I A;  4X3T A;  1XYI A;  2RSO A;  1MGS A;  4XT1 B;  3DEO A;  1WD1 A;  1IL8 A;  2B2Y A;  2Q8T A;  1EQT A;  2R3Z A;  1B50 A;  1QG7 A;  1DOK A;  1RTN A;  2X69 A;  4RWS C;  3TZD A;  4ZLT F;  5CMD A;  1ROD A;  1TVX A;  2H1E A;  2L4N A;  3Q6S A;  5DNF A;  1PLF A;  2EPB A;  1ML0 D;  1HA6 A;  4CJ0 B;  1BBX C;  1JE4 A;  1F9P A;  2KUM A;  1WTV A;  1HRJ A;  4X3K A;  5D14 A;  1C8C A;  5E4W C;  1U4R A;  3IL8 A;  4X3U A;  1DON A;  2FIN B;  2X6G A;  2MJ8 A;  3I90 A;  1EL0 A;  1HUM A;  2EOT A;  1J9O A;  2B2U A;  4R8I A;  1G2S A;  5JJZ A;  1IKL A;  3H91 A;  1SSO A;  4OIJ A;  5AFW A;  1VMC A;  3SVM A;  4R9W A;  5EJW A;  4HED A;  1KNA A;  2L9H A;  3MWY W;  1WTO A;  4IUP A;  1NCV A;  2HCI A;  1M8A A;  4ZKB B;  1U4M A;  2MP1 A;  2L11 A;  1ILQ A;  2L12 A;  2HUG A;  1EIH A;  1HFN A;  1X32 A;  1WVL A;  1B2T A;  4CJ1 B;  1B53 A;  2BDN A;  3KUP A;  2NWG A;  1BF4 A;  4IUU A;  1MSH A;  2HCC A;  5COR A;  1CM9 A;  3D6W A;  1NR4 A;  1O7Z A;  2FJ2 A;  1GUW A;  2JP1 A;  4U68 A;  4IUQ A;  4MHE A;  1AZP A;  2NZ1 D;  2SDF A;  1MI2 A;  2K04 A;  3LWE A;  1X3Q A;  1IKM A;  2KVM A;  1O80 A;  1F2L A;  1QNK A;  2B2U C;  1NR2 A;  2K1B A;  4DN4 M;  1B4O A;  3P7J A;  2RA4 A;  4O42 A;  2J7Z A;  4OIK A;  4ZKC B;  1ILP A;  1PFN A;  3ONA B;  3I8Z A;  2K03 A;  3UI2 A;  1G6Z A;  1DOM A;  1PFM A;  5T1I A;  3I91 A;  2DY7 A;  1F9Q A;  3I3C A;  1CA6 A;  1U4P A;  2IL8 A;  1ZXT A;  1EOT A;  2N55 A;  2HDL A;  2K01 A;  1E0B A;  2RSN A;  1F9S A;  5EPL A;  1RHP A;  4IUV A;  2KEE A;  1S4Z A;  4MN3 A;  2FHT A;  3F2U A;  1ICW A;  1WTQ A;  1RJT A;  2M2L A;  1WTX A;  2B2Y C;  3DEP A;  4LMQ D;  1LV9 A;  2D9U A;  3DM1 A;  3FPU B;  4HSV A;  1DZ1 A;  2EE1 A;  1BNZ A;  2VXW A;  2MGS A;  5D65 A;  1B3A A;  2B2V A;  5COY A;  1F9R A;  2X6L A;  2MPM A;  2B2T A;  4ZK9 B;  2DY8 A;  2Q8R E; 
#chains in the Genus database with same CATH topology
 1YJ9 A;  2EYM A;  3GV3 A;  2YTX A;  3TS2 A;  1F2Z A;  1UE7 A;  4H0L C;  2D62 A;  3MVV A;  1PDQ A;  3I72 A;  3NEN A;  4IUT A;  1X54 A;  3DLL A;  4A76 A;  2ES2 A;  2KCT A;  3TP6 A;  5CV8 A;  2CWP A;  4XT3 B;  3D4D A;  1HQR D;  4G7Z C;  3JAM E;  3PO3 G;  1PYW D;  2EDG A;  5JJL A;  2PQE A;  1IXR A;  4DR1 Q;  4A3M H;  3TN2 A;  1PA6 A;  2F0K A;  1YHB A;  1S5C D;  5KNC A;  2VQF Q;  2A6H C;  1A63 A;  5ELE A;  2WP8 J;  1LT5 D;  2VS1 A;  3ULL A;  2YU9 B;  2UUA L;  3MAQ A;  4RCO A;  1EUJ A;  5EAY A;  2R7Z G;  1MGS A;  4Y52 H;  3HOU B;  4J15 A;  1TVX A;  3QIA A;  1EQV A;  1BBX C;  3ZJY C;  1VQD A;  2AWO A;  1I4R A;  2JA8 B;  4X3K A;  3DM3 A;  1U4R A;  3GDE A;  3IL8 A;  2FIN B;  2X6G A;  2Q2H A;  1YBY A;  2QCP X;  5IYC G;  1ENC A;  3H91 A;  2UXD L;  4OIJ A;  3VA5 A;  2E2I H;  5DM7 3;  4Q5V A;  1WFQ A;  2VUM H;  3TDQ A;  5CV5 A;  1Q81 C;  3H0G G;  5IP9 G;  5K36 H;  1WVL A;  4QQB X;  2K5W A;  2BDN A;  4K14 A;  4DR2 Q;  2D5D A;  2F4V Q;  3HOW G;  1BCP D;  3I73 A;  2A68 C;  2FJ2 A;  2PMZ B;  4A3M B;  4FF3 A;  1F2L A;  1NR2 A;  1UEA B;  3MEH A;  4Y7N H;  2G5D A;  4KHP L;  2ZJR A;  4N9P A;  3UI2 A;  2KA7 A;  2VUM B;  3I7F A;  2F0F A;  1R4P B;  2BH2 A;  4TQU S;  4WOR A;  2KEE A;  1I4H A;  3KLW A;  2E2H B;  1BXT A;  1ENF A;  4PZ6 A;  3HS0 C;  5D3I B;  4C56 C;  1BQQ T;  4A3D B;  2Z9H A;  2HQE A;  4C3I H;  2F0Q A;  1YZ6 A;  3UDF A;  4QL5 A;  1E2Z A;  2X6L A;  2B2T A;  1AW7 A;  2Q8R E;  1NAP A;  3T51 B;  4DV6 L;  4B3T L;  2DGY A;  2ID0 A;  2GA4 B;  3G4S A;  1N33 L;  3DWP A;  3C1F A;  1VQK A;  4ALP A;  1AE2 A;  1K83 B;  1K3R A;  4JOI C;  1ZYR D;  3H3V H;  2AMC B;  3S1N B;  3E5S A;  4FP5 D;  4C3I B;  3RLO A;  3CMA A;  5EPJ A;  4C1N K;  4IPC A;  3HGB A;  3NEM A;  3K5M A;  4BY7 H;  1H9J A;  4Q0F A;  1JWS D;  1U4L A;  4HIO A;  5C0X I;  1YJW A;  1LTI D;  3TP8 A;  3SK4 A;  4BY1 B;  4RGO S;  4CKB A;  2X69 A;  4HR7 B;  1UNS A;  2Z0S A;  3A5U A;  3IAY A;  3FPP A;  1N9W A;  2L4N A;  2JA6 G;  2EJM A;  5EKL A;  3BU2 A;  3GO5 A;  3SE0 A;  3J7A F;  3M3Y H;  2CW0 C;  4A3G B;  4DNR B;  1X3F A;  2EOT A;  3NQI A;  1G2S A;  1GVP A;  1Z7T A;  4JBM A;  1JQY D;  1I94 L;  1WTO A;  3J7A V;  1KLG D;  1FNU A;  4ZKB B;  3E0J A;  3ND9 A;  1LLR D;  4R4O A;  4GLX A;  2Z1C A;  3KUP A;  1GOZ A;  3CF5 A;  1Y8N B;  2ZXP A;  1XMO Q;  4AYB E;  2QDL A;  4R4I A;  3HOZ G;  1ZEQ X;  2EYH A;  3KJO A;  3F8T A;  5FO9 B;  5FLX c;  2SNS A;  1W3S A;  2C9O A;  5IYB G;  1IKM A;  1A8V A;  2KVM A;  3TBI B;  2E5L L;  2K5H A;  3FP9 A;  2E5L Q;  4IUN A;  2K5N A;  1Q46 A;  4L6T B;  3S1Q B;  4ZQ3 A;  1DOM A;  1XMQ Q;  1DCZ A;  4P75 A;  1U4P A;  2HD3 A;  1ZXT A;  2VY3 A;  3NXW A;  4DV1 Q;  2Z6K C;  4IUV A;  5G3L D;  2J4X A;  2DJF C;  2RQX A;  3S14 B;  1Q7Y C;  3GTG B;  5FLX E;  4LF8 Q;  3W5O A;  4JV5 L;  2EXD A;  2XNA C;  1BBU A;  1SJH D;  5KGU A;  1HNZ L;  3TEH B;  2MHV A;  4V0B A;  3K5O A;  2JA8 H;  4EQN A;  5KEE A;  1MBY A;  4G57 A;  1Y1W H;  1DXM A;  2WAQ G;  1Z6H A;  2RDF A;  1CZW A;  5IP9 H;  2WV6 D;  4XDX A;  5M5X H;  1KAB A;  4UP9 A;  2K28 A;  1XTD A;  5ELB A;  5CBE E;  1IL2 A;  4Y7N B;  1JIC A;  4K0K Q;  4DUZ L;  4LFC L;  2L5T A;  1HQM C;  4MTK A;  1JOR A;  4DUZ Q;  2EJG C;  2DUD A;  1TWF H;  4QF4 A;  4YWK A;  1CKM A;  2Q2T A;  1QUQ B;  2RCN A;  3HZX A;  5IYB H;  3BJU A;  4JI7 L;  4J1M A;  4OGQ C;  1XYI A;  1I5F A;  3SXH A;  1WD1 A;  1Y1V H;  2B2Y A;  5J22 A;  4LUO A;  4RWS C;  3D31 A;  4KY7 A;  2EIF A;  4G4K A;  5DNF A;  1KD1 C;  2I0Q A;  5M5Y B;  4KI0 A;  5GQO A;  3J7Z C;  3PUX A;  4BBS B;  2NTT A;  1KHI A;  5E3F A;  3PO3 H;  3I90 A;  1EL0 A;  1JMC A;  2F0U A;  1CQV A;  3SVM A;  3BS1 A;  4YY3 L;  2O4X A;  1IBL L;  1FGU A;  3K7A B;  4HED A;  1D5M C;  4DR1 L;  3RZD H;  1MD2 D;  2B63 G;  4BWG B;  1VQP A;  3SK6 A;  1VQL A;  3AYH B;  1S72 A;  3HG9 A;  1AEX A;  1JOO A;  4IUU A;  1EIY B;  2NN6 H;  2XTI A;  5D3D A;  1KAA A;  3BZC A;  4DR4 L;  4A3E H;  2QEX A;  3G6E A;  4FYD A;  1IYJ B;  5IWA Q;  5FLX L;  1Z9F A;  2B2U C;  4A3D H;  1ILP A;  3PCO B;  4ZKC B;  3GTM B;  2F0M A;  1NUC A;  3E3X A;  3I4L A;  5C4X H;  5IGC A;  1F2Y A;  1F9Q A;  2JQO A;  1B9N A;  4L5T A;  3T1Y L;  2PO4 A;  4GN3 B;  3R2I A;  1Q1B A;  2F0P A;  2QGQ A;  4HJ9 A;  2IJ0 A;  2D9U A;  1V8Q A;  2XSC A;  1TWG H;  3KF6 A;  4OX9 Q;  2FMC A;  3L7Z C;  1VQ6 A;  5COY A;  3I56 A;  1SYG A;  2MPM A;  3MXP A;  5C4J H;  3I4N G;  3CP0 A;  3PUW A;  4DV4 L;  4C3J H;  4HJA A;  2L0C A;  4DR7 L;  3IFD A;  3ULP A;  4F7X A;  1ET6 A;  4IO9 A;  2OF1 A;  1CFM A;  2JSO A;  2EQS A;  1QOH A;  4IZ8 A;  1GHK A;  2BE5 D;  1QNU A;  4LF6 Q;  3TME A;  2L15 A;  4JBJ A;  4LF6 L;  4IFD I;  4PQX A;  1J5E L;  2Z4I A;  1GKH A;  4ULL A;  4JI6 L;  4NXN L;  2BE5 C;  2DJG C;  1I94 Q;  1BKB A;  3X3N A;  5LMU L;  1SMY D;  3OTO Q;  4GKK L;  3UDX A;  4KJN A;  4CDC C;  2KOL A;  2JE6 I;  1HCZ A;  1FVI A;  2PZT A;  5IOC A;  5E4X A;  2AKW B;  2ASB A;  3URY A;  4LW1 A;  5IIF A;  3S14 H;  5ELD A;  5DEH A;  4RA8 A;  3FKI G;  2H5X A;  4RFB A;  3HOW H;  4C3J G;  3BDC A;  2JN4 A;  1S5E D;  2JA5 H;  2RDH A;  3PSI A;  4DR3 Q;  1EEF D;  3S1M H;  1VQB A;  2EPB A;  3A56 A;  4DU9 A;  5IY0 A;  2V4D A;  1D1K A;  3ER0 A;  4H7B A;  2CH4 W;  4DV0 L;  3W3A A;  2SOB A;  1GJX A;  3W2D A;  3FRP B;  3VR2 A;  4C2M B;  4A3F B;  5C3W A;  1EYG A;  2QW7 A;  4JW0 A;  3S17 H;  4FO2 A;  1MKH A;  4X64 L;  4OX9 L;  2WAQ E;  4DV5 Q;  3MFY A;  2H4O A;  2L11 A;  2WB1 E;  1HNW Q;  3QR8 A;  2R61 A;  2EYJ A;  3Q0A A;  2QEJ C;  2JJQ A;  3R2T A;  1H9S B;  5A2Q L;  1SE8 A;  4R8N A;  1MSH A;  1SNQ A;  4K6L A;  1BBW A;  4GNX B;  3HOU G;  3D6W A;  4A3D G;  2XN9 C;  3L3O C;  1S3O A;  1HXY D;  4U68 A;  2SDF A;  1MI2 A;  3U4V A;  4PMB A;  2KJX A;  4NDX A;  1PTO B;  1VQO A;  1YNJ C;  4FF1 A;  1PH4 A;  2LXJ A;  4KKU A;  3GTL H;  3J80 i;  2K03 A;  3PO2 H;  2IHF A;  1STB A;  3KDF A;  2IL8 A;  2N55 A;  1GUS A;  4UPA A;  1I4X A;  3PIO A;  1WCM H;  2I5M X;  1ONL A;  4B3M L;  2M2L A;  4A3I H;  3DM1 A;  2JA7 H;  2ZT9 C;  1LTG D;  1DZ1 A;  1GM5 A;  4PMC A;  1CUK A;  1SRO A;  5I9O A;  2BDO A;  2L1B A;  1P8L A;  4KKS A;  1V43 A;  1SNC A;  3GTK H;  5LHY 1;  5KRU A;  4GZY C;  4IPG A;  4CGY B;  4JI1 Q;  4NW2 A;  2B3G A;  2Y0S E;  4HID A;  5EQ0 A;  1N34 Q;  3A7A B;  3HKZ G;  3S1N H;  1ENA A;  4YIJ A;  3FVQ A;  4IFD J;  3R93 A;  4TKO B;  1RD9 D;  4EQ5 A;  1Q86 C;  1OXT A;  4ME5 A;  1HHV A;  4X3T A;  1PRT F;  3TRE A;  3KLS X;  1A0I A;  1STG A;  5HGQ A;  5DLQ E;  4HTH A;  2CW0 D;  1AH9 A;  4KHV A;  2H1E A;  2UUA Q;  1CI3 M;  3GTM H;  3EVQ A;  2D2C C;  2LMC B;  1BVS A;  1VQJ A;  2EJF C;  1F9P A;  1Y1W G;  1TII D;  2A6E C;  4GS3 A;  4A3K G;  1NJI C;  2MJ8 A;  2VUM G;  2B2U A;  5FK9 C;  3E9I A;  1PXU A;  3JAM L;  4R1J A;  2OTL A;  1E1O A;  4EGV A;  3S9W A;  3T1H Q;  5C3X A;  5K36 G;  1K28 A;  3HFZ B;  4L5R C;  3TZU A;  3KFU A;  3ND8 A;  4GLA C;  3I4M H;  3OWF A;  3AU7 A;  3GTJ B;  1HFN A;  4K2L A;  1UE6 A;  4CJ1 B;  1A3V A;  4LF5 L;  5C4J B;  2OCE A;  4WJW A;  2TSS A;  1LTR D;  2MO1 A;  2HCC A;  1UWV A;  5M3M G;  4JI7 Q;  2TMP A;  1Q90 A;  1TWC H;  2F0G A;  2SNM A;  1ZYR C;  3CRL C;  2NZ1 D;  4ZRZ A;  3NTH A;  1Q82 C;  3KLS A;  4JBW A;  3DWQ A;  3D3R A;  1LTT D;  2RA4 A;  1LUZ A;  1YIT A;  3HKZ E;  4DNI A;  1QZH A;  5DM6 3;  1A62 A;  4QIW E;  3GTO H;  3WOF A;  3J80 L;  3LWU A;  4N8F A;  1KLU D;  4JPB W;  1VQF A;  3H09 A;  3KDF B;  2XRS D;  5BN3 A;  3CXC A;  2VW9 A;  2EYP A;  5LL6 X;  1RJT A;  2B2Y C;  5E7N A;  3OHX C;  4B9X A;  2B29 A;  3VR5 A;  4K6D A;  3VYT A;  3M7N A;  3A7L A;  1C48 A;  2VXW A;  3CW2 C;  3VYS A;  5LMN W;  1W6J A;  4TRD A;  1E3P A;  3I55 A;  5M3M B;  1W2B A;  2WAQ B;  2Z6B A;  2UXC Q;  3MEF A;  5GRO A;  2E74 C;  1SYC A;  1GD7 A;  2B2V C;  2NB0 A;  1BO0 A;  4IUR A;  4AYB B;  4M8A A;  5IWA L;  4A3C H;  3QJY A;  2XIW A;  3K7U C;  4OEL B;  2RCF A;  1CTM A;  2NYZ D;  3WOE A;  1N33 Q;  2KED A;  4QUF A;  2CVR A;  3J81 L;  1M90 C;  3MXG A;  2JYO A;  1MIU A;  2UUC Q;  1VMP A;  5T1G A;  4UY8 C;  1D8L A;  2ZJQ A;  2I07 B;  2N8N A;  1A15 A;  1Y1V G;  4L8J A;  3HOY B;  3HOX G;  1EYA A;  3ITP A;  2KEN A;  1VF7 A;  3QG1 A;  5CV6 A;  3FHW A;  4BY1 G;  5FOB B;  3E9H A;  1TS5 A;  3L2P A;  3EA6 A;  1ROD A;  1QUQ A;  4UDU C;  1RKN A;  1STY A;  3K6O A;  4GOP C;  4EQP A;  3W1G A;  2IW3 A;  5D14 A;  2LS0 1;  1TS3 A;  4CBV A;  1DON A;  4PZ8 A;  5H1S E;  3PMF A;  4ZUI A;  1X6O A;  4R8I A;  1QVG A;  2I5H A;  2E2D C;  5EKK A;  1B44 D;  2ZM6 Q;  4XQJ A;  5M3F H;  5C5M A;  2A68 D;  3N6R A;  3JAM i;  3TS0 A;  1YHQ A;  1SFO H;  4LF4 L;  4IJH A;  4P72 A;  5C3E H;  1HA5 A;  1PH5 A;  4HJ7 A;  3PGZ A;  3BYY B;  5FKA C;  5IGF A;  1EWH A;  1IHZ A;  1SMY C;  4DF7 A;  4GOP A;  3OSO A;  3J81 c;  1Y8P B;  2NVT H;  2HIX A;  4B3S Q;  3KLR A;  3M4Q A;  1TWC B;  4NXM L;  4A93 G;  1UE5 A;  1GXD C;  4DK1 A;  1O80 A;  5A2Q E;  4GNX A;  4X65 L;  1TY0 A;  2JA7 B;  1FL0 A;  3KF8 B;  1B7Y B;  1HTL D;  2DY7 A;  3T56 B;  3F2D A;  1XJV A;  1CA6 A;  4I7A A;  2UXB L;  4JI2 Q;  1RHP A;  4RMF A;  3F2U A;  3F2B A;  3OMG A;  3DEP A;  3I70 A;  3ERS X;  2R7F A;  2N3S A;  2YYZ A;  2B2V A;  4P73 A;  1E24 A;  4ZAI A;  1O7I A;  5F2D A;  1SYF A;  2AQ3 B;  1HNX Q;  1KDB A;  1H95 A;  1VQ4 A;  1GHJ A;  1QE6 A;  1VQ7 A;  1C0A A;  3GTK B;  3H94 A;  2B8F A;  3KF8 A;  5EKI A;  4ZCK A;  1CHQ D;  4RAU C;  2I46 A;  1EIG A;  2PQA B;  3MTS A;  2F0S A;  1KNE A;  1GUG A;  3A8K E;  3O13 A;  1PZI D;  4A3F G;  3K59 A;  4OEM B;  1DOL A;  3I2Z A;  1ESR A;  2FMM A;  2K7V A;  2B2T C;  4LFB L;  4I7Z C;  1HPC A;  4OL7 A;  3T16 A;  4C1N I;  1DJR D;  4XT1 B;  4BY7 G;  1B50 A;  5I4D A;  4C3J B;  2EY6 A;  1QJO A;  1PTO H;  1STE A;  3CHB D;  4P74 A;  4ILW A;  2O2L D;  2IPK D;  1ML0 D;  4K5V A;  3STB C;  5C0X J;  4FXG C;  2A8V A;  3RLN A;  4DAP A;  2Z4H A;  1E1T A;  4FNF A;  4GKK Q;  1N36 Q;  3KYH C;  1EYC A;  4JI2 L;  1IKL A;  1KRT A;  1LM0 A;  5AFW A;  2ZTE A;  1SE2 A;  2DNC A;  4IUP A;  4C3H H;  2NN6 I;  3HOX B;  5HUR A;  1SFO B;  3K58 A;  2HUG A;  2WAC A;  3CQZ H;  3EQL C;  3S16 H;  4C3H B;  3GTQ H;  2ICE C;  3I4M G;  1VQA A;  3M4Y A;  1BF4 A;  1D1I A;  4A3B B;  4KY6 A;  1TS4 A;  4IPD A;  4JI5 Q;  3K0X A;  1VF5 C;  5GAH C;  2QA4 A;  2NVQ H;  1VDZ A;  1JOQ A;  2ENB A;  1X3G A;  5M5Y H;  2LXK A;  1CT1 D;  1AN8 A;  1E2W A;  3I8Z A;  4OWT B;  2F0N A;  4DV5 L;  2BA1 A;  1STH A;  1LAC A;  3V2T A;  3K5N A;  5BN4 A;  4DFA A;  4KMU C;  4JI4 Q;  4U67 3;  1TWA B;  2AUJ D;  3T1H L;  2MFI A;  1GUT A;  4H02 A;  3PUY A;  1YVC A;  5GAG C;  4LJZ C;  5I6W A;  1S5B D;  2DY8 A;  5M3F G;  3LNN A;  2L55 A;  3AFQ A;  3W1B A;  3OIP A;  4IPH A;  1K83 H;  4JI0 L;  1WD0 A;  1EYD A;  2F03 A;  1HJP A;  3P20 A;  2XVS A;  1STN A;  1CKN B;  3MA2 B;  1N36 L;  4UAI A;  3HP3 A;  3HOX H;  3T1Y Q;  4MNO A;  3GTL B;  4BBR B;  4X6A H;  1Y1W B;  1TWF B;  1VQI A;  4QMG A;  1Q3L A;  1ICF B;  1G51 A;  1QIL A;  3J80 E;  5FO8 B;  2F3W A;  2EZV A;  3HOZ H;  5JAV A;  1O7Y A;  1G2T A;  5AJ3 Q;  2K05 A;  3CCV A;  3U50 C;  4QGU A;  1KXL A;  5AJ3 L;  3UDG A;  4DXF A;  1D5X C;  4B3R Q;  5BN5 A;  4RCN A;  4DUY Q;  4DR4 Q;  3DEO A;  4NPS A;  3NPP A;  1TXY A;  4ZLT F;  2E76 C;  5HGT A;  2ZXO A;  3GP7 A;  1K0R A;  2IX1 A;  1VCI A;  4MTN A;  1HUM A;  1SE4 A;  2VQF L;  3J81 i;  1L0Y B;  1YI2 A;  4QCL A;  5C44 G;  3LX0 A;  2K52 A;  1ET9 A;  1NCV A;  1NNX A;  2WKC A;  2JEB I;  1ILQ A;  4JCV E;  2A74 C;  4N8X 1;  4LF5 Q;  1ASY A;  5GAE C;  4B08 A;  1SLJ A;  1BUV T;  5EBC A;  1UE1 A;  1HNW L;  5C5L A;  1PRT C;  1AZP A;  3LWE A;  1YEZ A;  4DV7 L;  1B4O A;  2J7Z A;  3S2D H;  3RNU A;  3EFX D;  1VQN A;  2F0E A;  2F4I A;  1SJE D;  3UE0 A;  1I3Q H;  2EY1 A;  2VQE Q;  4LF9 L;  3S2D B;  3DXJ C;  4EX5 A;  5EPL A;  4HIM A;  1SRU A;  3T4A C;  2OXP A;  1KDA A;  1TQO A;  4MN3 A;  2FHT A;  4DV4 Q;  4DR7 Q;  4BS9 A;  1Q1E A;  1WTX A;  1M1K C;  1BCP F;  4A3B G;  1PH6 A;  3T53 B;  2BCO A;  3Q22 A;  2HHH Q;  3HOV G;  4JI3 L;  1XPR A;  4J8Q A;  2R7Z B;  1CHP D;  5JOB A;  3FDT A;  4JBK A;  3PIO 3;  2R92 B;  3G7L A;  4BA1 I;  1PVO A;  1X55 A;  2AWN A;  2R93 H;  1V1P B;  3OYY A;  1AP0 A;  4YHH L;  1G91 A;  2MNA A;  1PH7 A;  1G6P A;  2B2W A;  1RTO A;  1QCB D;  4LUV A;  1XNR Q;  4DXG A;  1XNR L;  4JI1 L;  1XNQ L;  4QB4 A;  5IYC H;  3RLF A;  1JB3 A;  1SDF A;  4PNY A;  4KHZ A;  4XYQ A;  4BXX G;  1H9S A;  2NVX B;  3OIQ A;  4ABN A;  3GV6 A;  4QUC A;  2UUB L;  4DR3 L;  3B6Y A;  1IZ6 A;  5C0X G;  1DD2 A;  5ELC A;  3G48 A;  4KD4 A;  2PQA A;  3OW2 A;  1IL8 A;  3PO2 B;  1PRT D;  2KHS A;  1QG7 A;  3ZYY X;  1EZ8 A;  1I50 H;  4P2C B;  4B9W A;  3F1Z A;  4XTC S;  4RHS A;  1TY2 A;  1E22 A;  4WJ3 M;  4FXK C;  2VZA A;  1KC8 C;  1C8C A;  2WIN B;  4DR6 Q;  3GTG H;  2GVB A;  1G8Z D;  4OWW B;  2JA7 G;  4DR6 L;  1O78 A;  1MJC A;  1JWM D;  1SSO A;  5JJI A;  4PMW A;  3K5L A;  2XGT A;  2F4V L;  3CME A;  3WDN A;  1SR3 A;  5IE8 A;  2RBM A;  4IFD G;  1HTP A;  1JC7 A;  1RCV D;  3D0F A;  2PNH A;  3FEW X;  2JEA I;  4A3E G;  2F1M A;  4A3F H;  5DAU A;  1FD7 D;  1ASZ A;  1BOS A;  2G9D A;  3QOJ A;  2HT1 A;  3PO3 B;  2K04 A;  2M9V A;  4A3M G;  4YCW A;  4DR2 L;  4O42 A;  1XMO L;  3P1H A;  1ESF A;  3MXN A;  2B39 A;  2E75 C;  1H9R A;  3P75 A;  2A73 B;  1SE3 A;  4CDE C;  3HEJ A;  4YWM A;  1EWI A;  1QVC A;  3TRZ A;  1ICW A;  2MO0 A;  4BA2 I;  4A3L G;  1I4Q A;  4H44 C;  3S1R B;  2K5V A;  1B3A A;  4A3E B;  4DUY L;  3C1E A;  4ZK9 B;  2KQ3 A;  3VA7 A;  3L0O A;  4K5W A;  1L2F A;  2QDB A;  2NTS A;  4K5X A;  3X3M A;  5IP7 G;  5CV7 A;  2F0H A;  2M00 A;  5LMN L;  3TQY A;  4JG2 A;  4BY7 B;  3KBG A;  2YTV A;  1EY4 A;  3AMU A;  1P16 A;  3UE1 A;  1PH9 A;  3CPF A;  3A0J A;  1CZG A;  2PNR C;  4CJ2 C;  1YNX A;  4R4T A;  1PFB A;  2K33 A;  2KCN A;  1SYD A;  5CBA E;  1Q8K A;  4XQQ A;  4IOC A;  1JWU D;  5IT9 E;  1I6V C;  3H3V C;  1I4P A;  2AHO B;  2E2J B;  3A54 A;  3RZO B;  3SR1 A;  4A93 H;  2XWB B;  4C2M H;  1L1O B;  4RGM A;  1L0W A;  2EYL A;  3Q8D A;  4YCV A;  1HA6 A;  4CJ0 B;  1JR0 D;  4F8M A;  4A3G H;  1EY9 A;  2F0T A;  4DV2 Q;  1KRS A;  1VQ9 A;  4OO1 G;  3E0E A;  3D8G A;  2EY2 A;  2PCF B;  2JK8 A;  3DWA A;  5FO7 B;  2K32 A;  5IGE A;  4CHT B;  1U4M A;  3ERO A;  5JVH 3;  5M5X B;  4A75 A;  1EIH A;  3S24 A;  1X32 A;  3DHQ A;  3GTO B;  4XXE A;  2R7Z H;  2NWG A;  4V19 0;  2CKZ B;  4IOA A;  3CC4 A;  1B8A A;  1EFI D;  2KBN A;  1J6Q A;  3K0Y A;  3FKI B;  4YCU A;  3RN5 A;  5C44 B;  4WJ4 A;  3SK8 A;  1X3Q A;  1M4V A;  3CC7 A;  3VR4 A;  1MHW C;  1A2T A;  4ID6 A;  3GTJ H;  5J39 A;  1C4Q A;  1QZG A;  2GN5 A;  1XNQ Q;  1I3Q B;  5CC4 A;  1WCM G;  3S1Q H;  4JV5 Q;  2YU9 H;  3CD6 A;  5I6Y A;  1PYB A;  4KV6 A;  2K5D A;  1S4Z A;  1A3U A;  2QF7 A;  2KHI A;  3JAM c;  3KK7 A;  3NSW A;  4BBR G;  3UDI A;  5JEA G;  4LAA A;  4R4C A;  4JOI A;  3J7A 5;  3NBH B;  4KLK A;  3S1M B;  1PV4 A;  1N32 L;  1E7Z A;  4BBS H;  1Q12 A;  1V1O A;  3Q23 A;  1TR5 A;  1I50 B;  1QB5 D;  3HKZ B;  1X3P A;  2AUK A;  4GN4 B;  2O5I C;  1WI5 A;  2A5H A;  3PUZ A;  1CKO A;  5M3F B;  5A35 A;  2CQO A;  2B63 H;  3S17 B;  2UXB Q;  1KAW A;  3RUZ A;  3G6J B;  1C9O A;  4NXN Q;  3PF4 A;  1WTP A;  1IW7 C;  3PQI A;  4FF2 A;  1T5E A;  1HH2 P;  3CCR A;  2LFN A;  1Y69 U;  4OO1 I;  5CGK A;  5C4Z A;  3U4Z A;  3OWE B;  2PMZ E;  4CDD C;  4X62 L;  3N52 A;  5IYD H;  3GTP H;  2JA5 G;  2RSO A;  3MHB A;  2C5C A;  1EU4 A;  1CKN A;  1EQT A;  3K7A H;  3NQT A;  5TSS A;  3RZD B;  3TZD A;  2ZTD A;  4Z9C B;  1IBM L;  4LNQ A;  2OQ0 A;  1S5F D;  3Q6S A;  2VL6 A;  5LL6 S;  4X65 Q;  4A3K H;  1CSQ A;  3TSS A;  1YJN A;  4O2D A;  1JE4 A;  3ICE A;  1KDC A;  5KIX A;  3QWN A;  3OTO L;  5E4W C;  4X3U A;  3HOV B;  3H6M A;  3EN2 A;  3ULJ A;  5JJZ A;  1KTK A;  4HMJ A;  1VMC A;  4DR5 Q;  2Q8I B;  5KYI A;  4KN7 C;  4GKJ Q;  1XPO A;  4EVO A;  1M8A A;  4DV1 L;  3GTP B;  4NXM Q;  3SEB A;  4DNT B;  1JE5 A;  1DM0 B;  1F2M A;  1FNW A;  4LF7 L;  1RIP A;  2OEO A;  3BDL A;  5JJK A;  4LF7 Q;  1PYS B;  5NUC A;  1K0S A;  1HZ9 A;  3M3Y B;  2JP1 A;  4MHE A;  5IP7 H;  1F77 A;  2Y0S B;  1XWE A;  2G9H D;  3P7J A;  1SN8 A;  3CCU A;  4HIK A;  1B3Q A;  2A69 D;  4BY1 H;  4LUZ A;  4DAY A;  1TS2 A;  5C6A A;  2O5J C;  5C4X G;  3BVZ A;  3M7G A;  2OTJ A;  1BDO A;  1ZKO A;  2F0O A;  1R9T B;  3K81 C;  1LV9 A;  3GQB A;  1SYE A;  1VQ5 A;  4AIM A;  5J3B A;  2KCM A;  4RGT A;  4DN4 M;  1L1O C;  2ATW A;  2R7D A;  4C3H G;  3GTQ B;  4HN7 A;  2K6A A;  2NVY B;  2NUC A;  1OXX K;  5LMU Q;  4HJ8 A;  4K8I A;  1YIJ A;  5CYU A;  1HFG A;  3A74 A;  1EQR A;  1EOV A;  5CV9 A;  3VDY A;  4KKT A;  4HCS A;  1CSP A;  4JI4 L;  2BH8 A;  1WTR A;  3S2H B;  2VB2 X;  3M4P A;  3SGI A;  1SNM A;  2PZU A;  3A8I E;  1G29 1;  2PW7 A;  2HHH L;  1VQC A;  1VQH A;  1X56 A;  1WTH A;  3A5Z B;  3M9B A;  2A19 A;  1BCP C;  4JI5 L;  4DV0 Q;  2ZTC A;  2F0D A;  2EVB A;  1X65 A;  4X66 Q;  4YY3 Q;  3E6Z X;  4IFD H;  2CWA A;  1PHJ A;  2KUM A;  3IRB A;  2XWJ B;  1OTC A;  2A69 C;  2QKI C;  1NSN S;  2LY7 A;  4GN5 A;  3KF6 B;  2V1C C;  1JB7 A;  4XYO A;  1IYU A;  2QIL A;  1NTG A;  5M5W H;  2RKS A;  5ISR A;  2JA5 B;  5IT9 c;  1LAB A;  5FJ8 G;  1SNP A;  2PZW A;  2Z6K A;  1NE3 A;  1GO3 E;  3NEL A;  2MP1 A;  3V96 A;  2EY5 A;  4AH6 A;  2L12 A;  2JA6 B;  4A4I A;  4AYB G;  1N32 Q;  1D5Z C;  2R93 B;  1DGS A;  1T9H A;  1B53 A;  4KK7 A;  1O7L A;  4F87 A;  1E2V A;  1UAP A;  3BZD B;  4RH6 A;  1KL9 A;  4X66 L;  3J7Y W;  1O7Z A;  3TP7 A;  3S2H H;  1EFW A;  1TU2 B;  4AQY Q;  1YNJ D;  1OXU A;  3NBH A;  1LT3 D;  3MXU A;  1D6E C;  4DGZ A;  1X9N A;  1PFN A;  4UHV A;  5EGT A;  5IGG A;  1Y1V B;  3HOY G;  1UEB A;  3A8J E;  4FVM A;  4A3J G;  2VQE L;  1I4G A;  3K8A A;  3NTI A;  4DV2 L;  1MJE A;  4TVA B;  1EOT A;  1Z47 A;  2HDL A;  2K01 A;  1SBB B;  3JC6 6;  3NBI A;  1K8O A;  3H0G B;  1LTB D;  1OO9 B;  4G7H C;  2WB1 B;  1TWH B;  4DPG A;  3PIP 3;  2NVT B;  1X3E A;  4IAL A;  1EWC A;  2FXQ A;  2K5Q A;  1SEB D;  3RZO H;  2D0O A;  1SAP A;  1CQF A;  4JVZ A;  4JYA L;  4JI6 Q;  3U58 A;  1KQS A;  1FNV A;  2R92 G;  1PZJ D;  4OWX B;  4X3S A;  1PZK D;  4DAV A;  1HZC A;  5EPK A;  4E6I A;  1EQQ A;  3AFP A;  1N34 L;  4RKB A;  3KBX A;  1K9M C;  1H9K A;  3C2P A;  2VB3 X;  4DK0 A;  1IW7 D;  1YNN D;  1D7Q A;  1SMX A;  2CQA A;  1BCP B;  1WYD A;  3D4W A;  3NP8 A;  1NMF A;  1L0X B;  1WTW A;  2ZXR A;  3EIV A;  3FMC A;  2EXZ A;  1HZB A;  4O1N A;  2I5L X;  2UUC L;  4HJ5 A;  4QJF A;  4A3I G;  2UUB Q;  4A3L H;  4KTA A;  2EYF A;  5E1F A;  1GUO A;  4FF4 A;  3U9S A;  1L1O A;  2IY5 B;  2N88 A;  1B70 B;  3HKS A;  4R4Q A;  1HR0 Q;  1HR0 L;  3MC0 B;  4KJO A;  2Z8L A;  2Q8T A;  3CCE A;  4YHH Q;  4I65 A;  2ZJP A;  5C4X B;  1VQM A;  1K8M A;  4L5S A;  1T5X D;  1LT4 D;  3NWS A;  3HOZ B;  1EY6 A;  1PLF A;  4YWL A;  1OXV A;  1H9M A;  1C7Y A;  4A3C G;  1S5D D;  4WRD A;  3DMU A;  1Y8O B;  4ZUJ A;  2K75 A;  1TWH H;  4NMZ A;  4A3J B;  2OWO A;  1D2B A;  5I9P A;  2L9H A;  3ERQ A;  1EY5 A;  1PTO C;  2GVA A;  5GAD C;  3S15 H;  2NVY H;  4ODG A;  4X64 Q;  2K4K A;  2YV5 A;  1A2U A;  3VYU A;  5FLM G;  4HMI A;  2JA9 A;  1VS0 A;  4JI8 Q;  1QVF A;  4KHP Q;  1CM9 A;  4WFN 3;  3WWV A;  3PIP A;  4XIG S;  4IUQ A;  5JPN C;  4RGN A;  4A93 B;  1PTO D;  3VR3 A;  1SNO A;  1K8A C;  4A3G G;  1WJJ A;  5JEA J;  4DAM A;  4OON A;  4QY7 A;  3STB D;  4G7O C;  1E0B A;  2R92 H;  4A3J H;  3BYT B;  2BOS A;  4C3I G;  1LTA D;  1FYC A;  4KY5 A;  1PRT B;  4DV6 Q;  4B3T Q;  4H13 C;  4GKJ L;  3CCJ A;  3KJP A;  4K8J A;  4HSV A;  1RF2 D;  2F0L A;  1JJ2 A;  2LSS A;  1IBK Q;  4LFA L;  3D4R A;  2IX3 A;  2LKV A;  4UP8 A;  2KEC A;  2UU9 Q;  1CA5 A;  1CK1 A;  4KN4 C;  3NUC A;  3H3V I;  1EZ6 A;  3I4M B;  4FXD A;  3CQZ B;  1PFS A;  4PV1 C;  2R6G A;  4NB3 A;  1AFP A;  3HOY H;  1VQG A;  3S15 B;  5C3E G;  3NTK A;  3J81 j;  3C46 A;  1I6H B;  3I4N H;  1GUN A;  4NKL A;  1FGB D;  1YNN C;  1HUN A;  2MUY A;  1JJG A;  2F0W A;  1HZA A;  3I4O A;  5KND A;  4LFB Q;  3PV0 A;  3QO2 A;  4X62 Q;  2UU9 L;  3EJI A;  4JI8 L;  1WOC A;  3M4O H;  5L37 A;  1J8I A;  4P71 A;  5BR8 Q;  3IKJ A;  2PYK A;  5BR8 L;  4PG3 A;  1PH2 A;  3CC2 A;  3NK9 A;  5ELF A;  1II3 A;  4HCE A;  4ZYS A;  4LF4 Q;  2WII B;  4O0A A;  4A3I B;  3CAM A;  1TWG B;  1XXG A;  4CDF C;  3RR5 A;  2NN6 G;  2CCZ A;  5IT9 L;  4FDB A;  1TKW B;  1A3T A;  3CCL A;  2WB1 G;  4L63 B;  1U9R A;  3M4O B;  2F0V A;  5CR3 A;  2JA6 H;  1EY7 A;  1PH8 A;  4B3S L;  4CKC A;  1V9P A;  2A6E D;  2E2I B;  1R4Q B;  3RD4 A;  3VR6 A;  1B2T A;  1IBK L;  4M1U B;  2DN8 A;  2SEB D;  4JYA Q;  1V1Q A;  1K73 C;  2PI2 A;  3KOJ A;  2ICI A;  2CH4 A;  2KCC A;  5COR A;  4L5Q A;  1NR4 A;  1W6K A;  3CU7 A;  3I4N B;  3CKI B;  5IGB A;  3HOU H;  3AB9 A;  5ELO A;  5ELN A;  2RHQ B;  3BG3 A;  3ONA B;  4DR5 L;  3BZK A;  1NY4 A;  4NP5 A;  1B9M A;  1PFM A;  2OT2 A;  1XMQ L;  4DV3 L;  4DAY B;  3CCS A;  1EY8 A;  5IOD A;  3R3O A;  3J81 E;  4JC0 A;  2ALY B;  1HNX L;  2RF4 A;  1N8R C;  2D0P A;  3S1R H;  4RKL A;  2UXC L;  2EE1 A;  1YHA A;  5D65 A;  1Q8I A;  3SDZ A;  3CRK C;  5LMN Q;  1IYV A;  3BVM A;  2IHE A;  1HNZ Q;  4HAE A;  5G3L F;  3L9A X;  2EYO A;  3QOL A;  2F52 A;  1MSG A;  5C4H A;  3M85 A;  4LWC A;  3QB3 A;  3MXN B;  2Q2U A;  2F3I A;  2Y0S G;  4OO1 H;  2RVL A;  1U0L A;  4K0K L;  5M5W B;  4CKE A;  4DK3 C;  3OMC A;  1KIX A;  2PW5 A;  4TSS A;  4MZ9 A;  3FKI H;  5JPM C;  1J5E Q;  2ZM6 L;  4QIW B;  3DUZ A;  1RDP D;  5I2X A;  1BR9 A;  3H15 A;  3BVG A;  3VYR A;  1RL2 A;  1STA A;  4OXP A;  1LO5 D;  2KHJ A;  5M9O A;  2F0J A;  5K5P A;  1DOK A;  1PMR A;  4GLV B;  5CMD A;  4POG A;  1LTS D;  2R93 G;  5FJ8 H;  1S40 A;  2NZH A;  2F3V A;  4APV A;  5KNB A;  1R9T H;  3NHH A;  4GNX C;  4DV3 Q;  3OW7 A;  4A3B H;  3H0G H;  3T13 A;  2E8G A;  4R9W A;  4UP7 A;  4F88 A;  4K2K A;  2JXM B;  2IWH A;  2P5Z X;  3C3L A;  5I2Y A;  3PF5 A;  3V05 A;  5FLM H;  2J0T D;  2BA0 A;  3D6C A;  3PUV A;  1FR3 A;  2YTY A;  3OPO A;  3GD7 A;  1Y14 B;  2AQ1 B;  2VNU D;  4JK1 C;  2NVX H;  5CV4 A;  2F0I A;  5C44 H;  4AQY L;  3TP5 A;  5KYL A;  3CPW A;  1NMG A;  2CFM A;  1EIF A;  1LT6 D;  1TWA H;  1QNK A;  5J1Z A;  1LTL A;  2IT1 A;  3HRZ C;  4OHJ A;  3RMH A;  3HOW B;  2DNE A;  4RHR A;  2A6H D;  1V1P A;  4BBS G;  1G6Z A;  5T1I A;  3I91 A;  3I3C A;  2Q2I A;  1K3B C;  1XTC D;  2RSN A;  2N49 A;  1F9S A;  1OXS C;  4EQO A;  5JEA H;  2UXD Q;  1WTQ A;  2NVQ B;  4XQN A;  5JVG 3;  2N78 A;  1PH1 A;  3MFG A;  4RG1 A;  4LF8 L;  2MGS A;  2K14 A;  1F9R A;  4BBR H;  4GOP B;  1I6H H;  1XX8 A;  1U5K A;  4DA2 A;  1IBM Q;  3SK5 A;  3G71 A;  3K57 A;  1WCM B;  4MIU A;  2FFK B;  2B63 B;  3S16 B;  1SYB A;  1FJG L;  3F2C A;  1JT8 A;  1DYQ A;  5M3M H;  2K50 A;  2PPB C;  2B2W C;  1AZQ A;  2AQ2 B;  1LYL A;  4B3R L;  2HQL A;  2PI2 E;  2NZO A;  3BDO A;  5C0X H;  4A3K B;  2B8G A;  1EU3 A;  2RDG A;  1IBL Q;  3CCM A;  2CHB D;  4DK6 C;  2HDM A;  5EBD A;  1JOK A;  5C3E B;  3K80 C;  4LK1 C;  4LFA Q;  2R3Z A;  1RTN A;  3CCQ A;  4KD3 A;  4BXX H;  1VQ8 A;  4J6H A;  1UUP A;  4PZ7 A;  3NE5 B;  3AEV A;  3J80 c;  1WTV A;  2HIV A;  1HRJ A;  3EBE A;  3MZ5 A;  1J9O A;  1VQE A;  1K8G A;  4IN3 A;  2C35 B;  2WKD A;  5EJW A;  2E2H H;  1KNA A;  3MWY W;  1B1Z A;  2OQK A;  2JA8 G;  4ME3 A;  2WFW A;  3A55 A;  4DKA C;  2HCI A;  2A1A A;  2NBF A;  4N9T A;  4B3M Q;  1EEI D;  4DV7 Q;  3HOV H;  2IX0 A;  2RHS B;  3SHL A;  4POF A;  1A6X A;  3OOC A;  1GUW A;  4HSP A;  1SND A;  1QWY A;  1FJG Q;  4LF9 Q;  1AE3 A;  4S3S A;  2K1B A;  5IYD G;  4OIK A;  4JI0 Q;  5IGD A;  1JCK B;  2XRQ D;  4IQZ A;  3NWT A;  5HY6 A;  4LFC Q;  2E2J H;  3IFT A;  3R8B A;  1JJC B;  1TT2 A;  4JI3 Q;  3LGJ A;  1SXT A;  3U9O A;  1XPU A;  4IJL A;  1HR0 W;  4LMQ D;  3AQQ A;  3FPU B;  1PTO F;  1PH3 A;  1EY0 A;  3Q24 A;  1BNZ A;  3RN2 A;  2MQH A;  3PO2 G;  1NBW A; 
#chains in the Genus database with same CATH homology
 2EYM A;  3GV3 A;  1F2Z A;  4H0L C;  2D62 A;  3MVV A;  1PDQ A;  3I72 A;  4IUT A;  3TP6 A;  5CV8 A;  4XT3 B;  3D4D A;  1HQR D;  4G7Z C;  3JAM E;  1PYW D;  2EDG A;  2PQE A;  3TN2 A;  2F0K A;  1S5C D;  5KNC A;  2A6H C;  5ELE A;  2WP8 J;  1LT5 D;  2YU9 B;  3MAQ A;  4RCO A;  1MGS A;  3HOU B;  1TVX A;  3QIA A;  1EQV A;  1BBX C;  2AWO A;  1I4R A;  2JA8 B;  4X3K A;  1U4R A;  3IL8 A;  2FIN B;  2X6G A;  2QCP X;  1ENC A;  3H91 A;  4OIJ A;  3VA5 A;  5DM7 3;  4Q5V A;  3TDQ A;  5CV5 A;  5K36 H;  1WVL A;  2K5W A;  2BDN A;  4K14 A;  2D5D A;  1BCP D;  3I73 A;  2A68 C;  2FJ2 A;  2PMZ B;  4A3M B;  4FF3 A;  1F2L A;  1NR2 A;  1UEA B;  3MEH A;  4N9P A;  3UI2 A;  2KA7 A;  2VUM B;  2F0F A;  1R4P B;  4TQU S;  4WOR A;  2KEE A;  1I4H A;  2E2H B;  1BXT A;  1ENF A;  5D3I B;  3HS0 C;  4C56 C;  1BQQ T;  4A3D B;  2HQE A;  2F0Q A;  1E2Z A;  2X6L A;  2B2T A;  1AW7 A;  2Q8R E;  1NAP A;  3T51 B;  2ID0 A;  2GA4 B;  3DWP A;  3C1F A;  1K83 B;  1ZYR D;  3S1N B;  3E5S A;  4FP5 D;  4C3I B;  5EPJ A;  4C1N K;  3HGB A;  3K5M A;  1H9J A;  4Q0F A;  1JWS D;  1U4L A;  5C0X I;  1LTI D;  3TP8 A;  3SK4 A;  4BY1 B;  4RGO S;  4CKB A;  2X69 A;  4HR7 B;  1UNS A;  3IAY A;  3FPP A;  2L4N A;  2EJM A;  5EKL A;  3GO5 A;  3SE0 A;  3J7A F;  2CW0 C;  4A3G B;  4DNR B;  2EOT A;  3NQI A;  1G2S A;  1Z7T A;  1JQY D;  1WTO A;  3J7A V;  1KLG D;  1FNU A;  4ZKB B;  3E0J A;  3ND9 A;  1LLR D;  2Z1C A;  3KUP A;  1GOZ A;  1Y8N B;  2ZXP A;  1ZEQ X;  2EYH A;  5FO9 B;  2SNS A;  2C9O A;  1IKM A;  2KVM A;  3TBI B;  4IUN A;  4L6T B;  3S1Q B;  4ZQ3 A;  1DOM A;  1DCZ A;  1U4P A;  1ZXT A;  3NXW A;  4IUV A;  5G3L D;  2J4X A;  2RQX A;  3S14 B;  3GTG B;  5FLX E;  2XNA C;  1SJH D;  5KGU A;  2MHV A;  4V0B A;  3K5O A;  4EQN A;  5KEE A;  1MBY A;  4G57 A;  1DXM A;  1Z6H A;  2RDF A;  1CZW A;  2WV6 D;  4XDX A;  1KAB A;  2K28 A;  5ELB A;  5CBE E;  4Y7N B;  1JIC A;  2L5T A;  1HQM C;  1JOR A;  2EJG C;  4QF4 A;  3HZX A;  4J1M A;  4OGQ C;  1XYI A;  3SXH A;  1WD1 A;  2B2Y A;  5J22 A;  4RWS C;  3D31 A;  4KY7 A;  4G4K A;  5DNF A;  5M5Y B;  4KI0 A;  3PUX A;  4BBS B;  2NTT A;  5E3F A;  3I90 A;  1EL0 A;  2F0U A;  1CQV A;  3SVM A;  3BS1 A;  2O4X A;  3K7A B;  4HED A;  1D5M C;  1MD2 D;  4BWG B;  3SK6 A;  3HG9 A;  1AEX A;  1JOO A;  4IUU A;  2NN6 H;  5D3D A;  1KAA A;  4FYD A;  5FLX L;  2B2U C;  1ILP A;  4ZKC B;  3GTM B;  2F0M A;  1NUC A;  3I4L A;  5IGC A;  1F2Y A;  1F9Q A;  1B9N A;  2PO4 A;  3R2I A;  1Q1B A;  2F0P A;  2IJ0 A;  2D9U A;  1V8Q A;  2XSC A;  2FMC A;  3L7Z C;  5COY A;  1SYG A;  2MPM A;  3MXP A;  3PUW A;  2L0C A;  3IFD A;  4F7X A;  1ET6 A;  2OF1 A;  1CFM A;  2JSO A;  1QOH A;  4IZ8 A;  1GHK A;  2BE5 D;  1QNU A;  3TME A;  4IFD I;  4PQX A;  2Z4I A;  4ULL A;  2BE5 C;  3X3N A;  1SMY D;  4KJN A;  2KOL A;  2JE6 I;  1HCZ A;  2PZT A;  5IOC A;  5E4X A;  3URY A;  5IIF A;  5ELD A;  5DEH A;  4RA8 A;  4RFB A;  4C3J G;  3BDC A;  1S5E D;  2RDH A;  1EEF D;  2EPB A;  3A56 A;  4DU9 A;  2V4D A;  1D1K A;  4H7B A;  3W3A A;  2SOB A;  1GJX A;  3W2D A;  3FRP B;  3VR2 A;  4C2M B;  4A3F B;  5C3W A;  4FO2 A;  3MFY A;  2H4O A;  2L11 A;  2R61 A;  2EYJ A;  3Q0A A;  2QEJ C;  3R2T A;  1H9S B;  5A2Q L;  4R8N A;  1MSH A;  1SNQ A;  4K6L A;  3D6W A;  2XN9 C;  3L3O C;  1HXY D;  4U68 A;  2SDF A;  1MI2 A;  4PMB A;  2KJX A;  4NDX A;  1PTO B;  1YNJ C;  4FF1 A;  4KKU A;  2K03 A;  1STB A;  2IL8 A;  2N55 A;  1GUS A;  1I4X A;  1ONL A;  2M2L A;  3DM1 A;  2ZT9 C;  1LTG D;  1DZ1 A;  4PMC A;  5I9O A;  2BDO A;  2L1B A;  4KKS A;  1V43 A;  1SNC A;  5LHY 1;  5KRU A;  4GZY C;  4CGY B;  4NW2 A;  5EQ0 A;  3A7A B;  1ENA A;  4YIJ A;  3FVQ A;  4IFD J;  3R93 A;  4TKO B;  1RD9 D;  1OXT A;  4ME5 A;  1HHV A;  4X3T A;  1PRT F;  3KLS X;  1STG A;  4HTH A;  2CW0 D;  4KHV A;  2H1E A;  1CI3 M;  3EVQ A;  2D2C C;  2LMC B;  2EJF C;  1F9P A;  1TII D;  2A6E C;  2MJ8 A;  2B2U A;  5FK9 C;  1PXU A;  3JAM L;  4EGV A;  3S9W A;  5K36 G;  5C3X A;  3TZU A;  3ND8 A;  3OWF A;  3AU7 A;  3GTJ B;  1HFN A;  4K2L A;  4CJ1 B;  1A3V A;  5C4J B;  4WJW A;  2TSS A;  1LTR D;  2HCC A;  2TMP A;  1Q90 A;  2F0G A;  2SNM A;  1ZYR C;  3CRL C;  2NZ1 D;  4ZRZ A;  3NTH A;  3KLS A;  4JBW A;  3DWQ A;  3D3R A;  1LTT D;  2RA4 A;  5DM6 3;  3WOF A;  3J80 L;  3LWU A;  1KLU D;  3H09 A;  2XRS D;  5BN3 A;  2EYP A;  5LL6 X;  1RJT A;  2B2Y C;  3OHX C;  4B9X A;  3VR5 A;  4K6D A;  3VYT A;  3M7N A;  3A7L A;  1C48 A;  2VXW A;  3VYS A;  1W6J A;  4TRD A;  5M3M B;  2WAQ B;  2E74 C;  1SYC A;  2B2V C;  4AYB B;  2NB0 A;  1BO0 A;  4IUR A;  4M8A A;  3QJY A;  2XIW A;  1CTM A;  2NYZ D;  3WOE A;  2KED A;  4QUF A;  2CVR A;  3J81 L;  3MXG A;  2JYO A;  1VMP A;  5T1G A;  2I07 B;  1A15 A;  4L8J A;  3HOY B;  1EYA A;  3ITP A;  1VF7 A;  3QG1 A;  5CV6 A;  5FOB B;  1TS5 A;  3EA6 A;  1ROD A;  4UDU C;  1RKN A;  1STY A;  3K6O A;  4EQP A;  2IW3 A;  5D14 A;  2LS0 1;  1TS3 A;  4CBV A;  1DON A;  3PMF A;  4ZUI A;  4R8I A;  2E2D C;  5EKK A;  1B44 D;  4XQJ A;  5C5M A;  2A68 D;  3N6R A;  1HA5 A;  3BYY B;  5FKA C;  5IGF A;  1EWH A;  1IHZ A;  1SMY C;  4DF7 A;  3OSO A;  1Y8P B;  3KLR A;  1TWC B;  1GXD C;  4DK1 A;  1O80 A;  5A2Q E;  2JA7 B;  1TY0 A;  1HTL D;  2DY7 A;  3T56 B;  1CA6 A;  1RHP A;  3F2U A;  3OMG A;  3DEP A;  3I70 A;  2YYZ A;  2B2V A;  4ZAI A;  5F2D A;  1SYF A;  2AQ3 B;  1KDB A;  1GHJ A;  1QE6 A;  3GTK B;  3H94 A;  2B8F A;  3KF8 A;  5EKI A;  1CHQ D;  4RAU C;  2I46 A;  1EIG A;  3MTS A;  2F0S A;  1KNE A;  1GUG A;  3A8K E;  3O13 A;  1PZI D;  3K59 A;  1DOL A;  1ESR A;  2FMM A;  2K7V A;  2B2T C;  4I7Z C;  1HPC A;  4OL7 A;  3T16 A;  4C1N I;  1DJR D;  4XT1 B;  1B50 A;  5I4D A;  4C3J B;  2EY6 A;  1QJO A;  1PTO H;  1STE A;  3CHB D;  4ILW A;  2O2L D;  2IPK D;  1ML0 D;  4K5V A;  5C0X J;  4FXG C;  4DAP A;  2Z4H A;  4FNF A;  1EYC A;  1IKL A;  5AFW A;  1SE2 A;  2DNC A;  4IUP A;  2NN6 I;  3HOX B;  5HUR A;  1SFO B;  3K58 A;  2HUG A;  2WAC A;  3EQL C;  4C3H B;  2ICE C;  1BF4 A;  3M4Y A;  1D1I A;  4A3B B;  4KY6 A;  1TS4 A;  1VF5 C;  1VDZ A;  1JOQ A;  2ENB A;  1CT1 D;  1AN8 A;  1E2W A;  3I8Z A;  2F0N A;  2BA1 A;  1STH A;  1LAC A;  3V2T A;  3K5N A;  5BN4 A;  4DFA A;  4KMU C;  4U67 3;  1TWA B;  2AUJ D;  1GUT A;  3PUY A;  4LJZ C;  5I6W A;  1S5B D;  2DY8 A;  3LNN A;  2L55 A;  3OIP A;  1WD0 A;  1EYD A;  2F03 A;  3P20 A;  2XVS A;  1STN A;  3MA2 B;  4UAI A;  3HP3 A;  3GTL B;  4BBR B;  1Y1W B;  1TWF B;  4QMG A;  1Q3L A;  1QIL A;  3J80 E;  5FO8 B;  2F3W A;  2EZV A;  5JAV A;  1O7Y A;  1G2T A;  2K05 A;  4DXF A;  1D5X C;  5BN5 A;  4RCN A;  3DEO A;  3NPP A;  4ZLT F;  2E76 C;  5HGT A;  2ZXO A;  3GP7 A;  2IX1 A;  1VCI A;  1HUM A;  1SE4 A;  1L0Y B;  4QCL A;  3LX0 A;  1ET9 A;  1NCV A;  2WKC A;  2JEB I;  1ILQ A;  2A74 C;  4B08 A;  1BUV T;  5EBC A;  5C5L A;  1PRT C;  1AZP A;  3LWE A;  1B4O A;  2J7Z A;  3EFX D;  2F0E A;  2F4I A;  1SJE D;  2EY1 A;  3S2D B;  3DXJ C;  5EPL A;  3T4A C;  2OXP A;  1KDA A;  1TQO A;  4MN3 A;  2FHT A;  4BS9 A;  1Q1E A;  1WTX A;  1BCP F;  3T53 B;  2BCO A;  3Q22 A;  4J8Q A;  2R7Z B;  1CHP D;  5JOB A;  3FDT A;  3PIO 3;  2R92 B;  3G7L A;  4BA1 I;  2AWN A;  1V1P B;  1AP0 A;  1G91 A;  2B2W A;  1RTO A;  1QCB D;  4DXG A;  4QB4 A;  3RLF A;  1JB3 A;  1SDF A;  4PNY A;  4KHZ A;  4XYQ A;  1H9S A;  2NVX B;  3OIQ A;  4ABN A;  3GV6 A;  4QUC A;  1DD2 A;  5C0X G;  5ELC A;  4KD4 A;  1IL8 A;  3PO2 B;  1PRT D;  2KHS A;  1QG7 A;  3ZYY X;  1EZ8 A;  4P2C B;  4B9W A;  4XTC S;  4RHS A;  1TY2 A;  4FXK C;  1C8C A;  2WIN B;  1G8Z D;  1O78 A;  1JWM D;  1SSO A;  4PMW A;  3K5L A;  3WDN A;  2RBM A;  4IFD G;  1HTP A;  1JC7 A;  1RCV D;  3FEW X;  2JEA I;  2F1M A;  5DAU A;  1FD7 D;  1BOS A;  2G9D A;  3QOJ A;  3PO3 B;  2K04 A;  2M9V A;  4O42 A;  3P1H A;  1ESF A;  3MXN A;  2B39 A;  2E75 C;  1H9R A;  3P75 A;  2A73 B;  1SE3 A;  3HEJ A;  1ICW A;  4BA2 I;  1I4Q A;  4H44 C;  3S1R B;  1B3A A;  4A3E B;  3C1E A;  4ZK9 B;  2KQ3 A;  3VA7 A;  4K5W A;  2QDB A;  2NTS A;  4K5X A;  3X3M A;  5CV7 A;  2F0H A;  2M00 A;  4BY7 B;  3KBG A;  1EY4 A;  3AMU A;  1CZG A;  2PNR C;  4CJ2 C;  1PFB A;  2K33 A;  2KCN A;  1SYD A;  5CBA E;  4XQQ A;  1JWU D;  5IT9 E;  1I6V C;  3H3V C;  1I4P A;  2E2J B;  3A54 A;  3RZO B;  3SR1 A;  2XWB B;  4RGM A;  2EYL A;  1HA6 A;  4CJ0 B;  1JR0 D;  4F8M A;  1EY9 A;  2F0T A;  4OO1 G;  3D8G A;  2EY2 A;  2PCF B;  3DWA A;  5FO7 B;  2K32 A;  5IGE A;  4CHT B;  1U4M A;  3ERO A;  5JVH 3;  5M5X B;  1EIH A;  1X32 A;  3DHQ A;  3GTO B;  4XXE A;  2NWG A;  4V19 0;  1EFI D;  3FKI B;  3K0Y A;  5C44 B;  3SK8 A;  1X3Q A;  1M4V A;  3VR4 A;  1A2T A;  4ID6 A;  5J39 A;  1C4Q A;  1I3Q B;  5CC4 A;  5I6Y A;  4KV6 A;  2K5D A;  1S4Z A;  1A3U A;  2QF7 A;  3KK7 A;  3NSW A;  5JEA G;  4LAA A;  3S1M B;  1Q12 A;  1V1O A;  3Q23 A;  1TR5 A;  1I50 B;  1QB5 D;  3HKZ B;  1X3P A;  2AUK A;  2O5I C;  2A5H A;  3PUZ A;  5M3F B;  5A35 A;  3S17 B;  3RUZ A;  3G6J B;  1WTP A;  1IW7 C;  4FF2 A;  1T5E A;  2LFN A;  1Y69 U;  4OO1 I;  5CGK A;  5C4Z A;  3OWE B;  3N52 A;  2RSO A;  3MHB A;  2C5C A;  1EU4 A;  1EQT A;  3RZD B;  3NQT A;  5TSS A;  3TZD A;  4Z9C B;  1S5F D;  3Q6S A;  5LL6 S;  3TSS A;  1JE4 A;  1KDC A;  5KIX A;  3QWN A;  5E4W C;  4X3U A;  3HOV B;  3H6M A;  5JJZ A;  1KTK A;  4HMJ A;  1VMC A;  2Q8I B;  5KYI A;  4KN7 C;  4EVO A;  1M8A A;  3GTP B;  3SEB A;  4DNT B;  1DM0 B;  1F2M A;  1FNW A;  2OEO A;  3BDL A;  5NUC A;  3M3Y B;  2JP1 A;  4MHE A;  1F77 A;  2Y0S B;  1XWE A;  2G9H D;  3P7J A;  2A69 D;  4DAY A;  1TS2 A;  5C6A A;  2O5J C;  3BVZ A;  3M7G A;  1BDO A;  1ZKO A;  2F0O A;  1R9T B;  1LV9 A;  3GQB A;  1SYE A;  4RGT A;  4DN4 M;  4C3H G;  3GTQ B;  4HN7 A;  2K6A A;  2NVY B;  2NUC A;  1OXX K;  4K8I A;  5CYU A;  1HFG A;  5CV9 A;  4KKT A;  4HCS A;  1WTR A;  3S2H B;  2VB2 X;  1SNM A;  2PZU A;  3A8I E;  1G29 1;  2PW7 A;  1BCP C;  2F0D A;  2EVB A;  3E6Z X;  4IFD H;  2KUM A;  2XWJ B;  2A69 C;  2QKI C;  1NSN S;  2LY7 A;  4XYO A;  1IYU A;  2QIL A;  2RKS A;  5ISR A;  2JA5 B;  1LAB A;  1SNP A;  2PZW A;  2MP1 A;  3V96 A;  2EY5 A;  2JA6 B;  2L12 A;  1D5Z C;  2R93 B;  1B53 A;  4KK7 A;  1O7L A;  4F87 A;  1E2V A;  1UAP A;  3BZD B;  4RH6 A;  3J7Y W;  1O7Z A;  3TP7 A;  1TU2 B;  1YNJ D;  1OXU A;  3NBH A;  1LT3 D;  3MXU A;  1D6E C;  4DGZ A;  1PFN A;  5EGT A;  5IGG A;  1Y1V B;  3A8J E;  4FVM A;  1I4G A;  3NTI A;  1EOT A;  1Z47 A;  2HDL A;  2K01 A;  1SBB B;  3NBI A;  1K8O A;  3H0G B;  1LTB D;  1OO9 B;  4G7H C;  2WB1 B;  1TWH B;  3PIP 3;  2NVT B;  4IAL A;  1EWC A;  2K5Q A;  1SEB D;  1SAP A;  1CQF A;  1FNV A;  1PZJ D;  4X3S A;  1PZK D;  4DAV A;  5EPK A;  4E6I A;  4RKB A;  3KBX A;  1H9K A;  3C2P A;  2VB3 X;  4DK0 A;  1IW7 D;  1YNN D;  2CQA A;  1BCP B;  3D4W A;  3NP8 A;  1L0X B;  1WTW A;  2ZXR A;  3FMC A;  2EXZ A;  4O1N A;  4KTA A;  2EYF A;  5E1F A;  1GUO A;  4FF4 A;  3U9S A;  2N88 A;  3MC0 B;  4KJO A;  2Z8L A;  2Q8T A;  4I65 A;  5C4X B;  1K8M A;  1T5X D;  1LT4 D;  3NWS A;  3HOZ B;  1EY6 A;  1PLF A;  1OXV A;  1H9M A;  1S5D D;  4WRD A;  3DMU A;  1Y8O B;  4ZUJ A;  4NMZ A;  4A3J B;  1D2B A;  5I9P A;  2L9H A;  3ERQ A;  1EY5 A;  1PTO C;  4ODG A;  1A2U A;  3VYU A;  4HMI A;  1CM9 A;  4WFN 3;  4XIG S;  4IUQ A;  5JPN C;  4RGN A;  4A93 B;  1PTO D;  3VR3 A;  1SNO A;  5JEA J;  4G7O C;  1E0B A;  3BYT B;  2BOS A;  4C3I G;  1LTA D;  1FYC A;  4KY5 A;  1PRT B;  4H13 C;  4K8J A;  4HSV A;  1RF2 D;  2F0L A;  3D4R A;  2IX3 A;  2LKV A;  2KEC A;  1CA5 A;  1CK1 A;  4KN4 C;  3NUC A;  1EZ6 A;  3I4M B;  4FXD A;  3CQZ B;  4PV1 C;  2R6G A;  1AFP A;  3S15 B;  3NTK A;  3C46 A;  1I6H B;  1GUN A;  4NKL A;  1FGB D;  1YNN C;  1HUN A;  2MUY A;  2F0W A;  5KND A;  3PV0 A;  3QO2 A;  3EJI A;  1J8I A;  3IKJ A;  2PYK A;  3NK9 A;  5ELF A;  1II3 A;  4HCE A;  4ZYS A;  2WII B;  4A3I B;  1TWG B;  1XXG A;  2NN6 G;  5IT9 L;  1TKW B;  1A3T A;  4L63 B;  1U9R A;  3M4O B;  2F0V A;  5CR3 A;  1EY7 A;  4CKC A;  2A6E D;  2E2I B;  1R4Q B;  3RD4 A;  3VR6 A;  1B2T A;  4M1U B;  2DN8 A;  2SEB D;  2ICI A;  2KCC A;  5COR A;  1NR4 A;  1W6K A;  3CU7 A;  3I4N B;  3CKI B;  5IGB A;  3AB9 A;  3BG3 A;  3ONA B;  4NP5 A;  1B9M A;  1PFM A;  2OT2 A;  1EY8 A;  5IOD A;  3R3O A;  3J81 E;  4RKL A;  2EE1 A;  5D65 A;  1Q8I A;  3SDZ A;  3CRK C;  1IYV A;  3BVM A;  4HAE A;  5G3L F;  3L9A X;  2EYO A;  3QOL A;  1MSG A;  5C4H A;  3M85 A;  3QB3 A;  4OO1 H;  2RVL A;  5M5W B;  4CKE A;  3OMC A;  2PW5 A;  4TSS A;  5JPM C;  4QIW B;  3DUZ A;  1RDP D;  5I2X A;  1BR9 A;  3BVG A;  3VYR A;  1STA A;  1LO5 D;  5M9O A;  2F0J A;  5K5P A;  1DOK A;  1PMR A;  5CMD A;  1LTS D;  2F3V A;  5KNB A;  3NHH A;  3OW7 A;  3T13 A;  4R9W A;  4F88 A;  4K2K A;  2JXM B;  2IWH A;  3C3L A;  5I2Y A;  3V05 A;  2J0T D;  2BA0 A;  3D6C A;  3PUV A;  1FR3 A;  3GD7 A;  3OPO A;  2AQ1 B;  2VNU D;  4JK1 C;  5CV4 A;  2F0I A;  3TP5 A;  5KYL A;  1LT6 D;  1QNK A;  5J1Z A;  2IT1 A;  3HRZ C;  4OHJ A;  3RMH A;  3HOW B;  2DNE A;  4RHR A;  2A6H D;  1V1P A;  1G6Z A;  5T1I A;  3I91 A;  3I3C A;  1XTC D;  2RSN A;  1F9S A;  1OXS C;  4EQO A;  5JEA H;  1WTQ A;  2NVQ B;  4XQN A;  5JVG 3;  3MFG A;  2MGS A;  1F9R A;  1XX8 A;  4DA2 A;  3SK5 A;  3K57 A;  1WCM B;  4MIU A;  2FFK B;  2B63 B;  3S16 B;  1SYB A;  1DYQ A;  2PPB C;  2B2W C;  1AZQ A;  2AQ2 B;  3BDO A;  5C0X H;  4A3K B;  2B8G A;  1EU3 A;  2RDG A;  2CHB D;  2HDM A;  5EBD A;  1JOK A;  5C3E B;  4LK1 C;  2R3Z A;  1RTN A;  4KD3 A;  4J6H A;  1UUP A;  3NE5 B;  1WTV A;  1HRJ A;  3MZ5 A;  1J9O A;  4IN3 A;  5EJW A;  2WKD A;  1KNA A;  3MWY W;  1B1Z A;  3A55 A;  2HCI A;  2NBF A;  4N9T A;  1EEI D;  2IX0 A;  3SHL A;  1A6X A;  3OOC A;  1GUW A;  4HSP A;  1SND A;  1QWY A;  4S3S A;  2K1B A;  4OIK A;  5IGD A;  1JCK B;  2XRQ D;  4IQZ A;  3NWT A;  3IFT A;  3R8B A;  1TT2 A;  1SXT A;  3U9O A;  4LMQ D;  3FPU B;  1PTO F;  1EY0 A;  3Q24 A;  1BNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...