1WD0A

Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*TP*AP*TP*AP*TP*AP*GP*G)-3'
publication title Structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Structural protein/dna
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wd0A00
1AZQA 1B2TA 2B2UA 4X3SA 1NAPA 1JICA 1NR4A 2HDMA 2JYOA 2MGSA 2K05A 3LWEA 2K28A 2N88A 2VXWA 1CM9A 1ML0D 2NWGA 2Q8RE 4RWSC 1AP0A 3D6WA 2RA4A 1B50A 4OIJA 3I8ZA 4QUCA 1JE4A 2K1BA 2NZ1D 4CJ2C 1WTQA 1G6ZA 1TVXA 1SAPA 1HFGA 1C8CA 2KVMA 1CA5A 2KEDA 2KUMA 2M2LA 3IL8A 1WTPA 1NCVA 1PFBA 2RVLA 1XYIA 4IUUA 4CJ1B 1U4LA 2XIWA 2B2WC 1RODA 3ONAB 5E4XA 1WTWA 1CA6A 1DOMA 1F9QA 1DOKA 2B2VC 2FHTA 1G91A 2HDLA 1B3AA 1PDQA 1HA6A 2EE1A 4R8IA 4DN4M 3HP3A 1O7ZA 5EPLA 3SVMA 1HFNA 2KEEA 5EQ0A 4OIKA 5T1GA 4X3KA 2B2TA 2K04A 2L1BA 4XT1B 1XX8A 2Q8TA 5COYA 2B2YC 1MSGA 1HRJA 2BDNA 4IUPA 5CORA 3N52A 1IKMA 2L4NA 4RAUC 1MI2A 2J7ZA 1ILPA 1ESRA 1ICWA 1NR2A 3GV6A 2L12A 1RTOA 1O80A 2X6GA 3FPUB 2X69A 1J9OA 4QUFA 1WVLA 1EL0A 1WTXA 4XDXA 1WTRA 1HUMA 4CJ0B 1HHVA 4NW2A 4ZKBB 1QG7A 1X32A 1EQTA 2IL8A 2HUGA 1WTVA 2HCCA 3I90A 3FDTA 1U4PA 1B4OA 2RSNA 1F9SA 2K01A 3KUPA 1M8AA 4IUTA 1HUNA 4IUVA 5D65A 1BF4A 1MGSA 3GV3A 1EOTA 1RHPA 1F9RA 1RJTA 4HEDA 1O7YA 2L11A 5EPJA 1ILQA 1BBXC 5E4WC 1DZ1A 1EIGA 1DOLA 5AFWA 3H91A 3TN2A 1KNAA 3DEOA 2L9HA 3IFDA 1S4ZA 1QNKA 3DEPA 4XT3B 4U68A 5CBAE 1KNEA 3G7LA 2K03A 4ZAIA 3R93A 1MSHA 1E0BA 1LV9A 2N55A 2NYZD 3UI2A 1X3PA 2FFKB 1F2LA 4ZLTF 4X3UA 1RTNA 2B2WA 5EJWA 2DY7A 4HAEA 2B2VA 4HCSA 2MJ8A 1QE6A 2KOLA 4X3TA 2FMMA 3MWYW 1U4MA 2EPBA 2MPMA 3I3CA 3Q6SA 4MN3A 1BO0A 4MHEA 4RA8A 2B2TC 5T1IA 5DNFA 1WTOA 3P7JA 2B2UC 3QO2A 4LMQD 1A15A 5JJZA 2EOTA 2B2YA 5CMDA 4IUQA 2SDFA 5EKIA 1ZXTA 1J8IA 1BNZA 1SSOA 1PFNA 3MTSA 3F2UA 1X3QA 1PLFA 2CVRA 4O42A 5CBEE 2JP1A 1PFMA 2D9UA 2DY8A 2MP1A 5D14A 2X6LA 1VMCA 1AZPA 1WD0A 2KECA 1G2SA 1SDFA 4R9WA 4HSVA 4ZK9B 1WD1A 5EPKA 3DM1A 1IKLA 1Q3LA 3I91A 1B53A 2FINB 1IL8A 1U4RA 1F9PA 3KBXA 2R3ZA 2RSOA 2HCIA 1EIHA 4UAIA 4IURA 4ZKCB 2H1EA 3TZDA 1DONA 2FJ2A 1GUWA 1VMPA 1G2TA
chains in the Genus database with same CATH superfamily
2XN9C 5GAHC 3HOWB 1GUNA 3CCQA 3L3OC 2RHSB 3X3MA 1W2BA 3K7AB 2R7ZG 1D5XC 2OTJA 3HOXG 1HNXQ 1EU4A 3HOVB 2KCNA 2A69C 5CV4A 4DAYB 4QIWE 2KVMA 1RD9D 4YWMA 4JV5Q 3OMGA 3RLOA 2MNAA 3TEHB 2FHTA 1CKNB 3JAML 4IFDJ 2F0NA 2MHVA 2PQEA 1LTGD 5IIFA 1WI5A 1IL2A 1B3AA 1HA6A 4ABNA 3PIOA 1QWYA 1EWCA 4R4OA 5T1GA 4KI0A 4CKCA 3V05A 4Q5VA 1IKMA 2L4NA 4OWXB 1TWHH 2J7ZA 5FJ8H 2R7FA 3E5SA 5DEHA 1FNUA 1BCPC 2ZJQA 2F0EA 1UWVA 3NTHA 4F88A 1YEZA 4DNRB 2EY1A 3GO5A 1VQ4A 4MZ9A 1SE8A 1JOQA 2K01A 3AYHB 2A74C 3RR5A 1N9WA 5D65A 3PIO3 4JCVE 1VQGA 3PV0A 1II3A 2YU9H 1TQOA 3NBHB 3GTLB 1BBXC 3OMCA 5E4WC 1JB7A 4A93G 4J8QA 1H9KA 4GKJL 2DUDA 1Q46A 3QR8A 1QNKA 5CV6A 4DR5L 4A3JB 4DR3Q 3E9HA 1A62A 2F4VL 1H9JA 3KF6B 1X3PA 3DWQA 4PZ6A 5GADC 3J7AF 1JJGA 1K3BC 1UEAB 3ULJA 2BA1A 3Q24A 1ET6A 1PA6A 5C0XJ 2ZM6L 1XPUA 4JI2L 4V0BA 3ICEA 3AU7A 3OTOL 3GTMH 1A15A 2EOTA 1EWIA 2SDFA 2HIXA 4XQJA 1PFNA 4KTAA 1PTOD 4K0KL 2HD3A 1KC8C 4MTNA 4JI7L 1EZ6A 5IGBA 1N34L 5BR8Q 4LF4L 4S3SA 1TY0A 1VF5C 1I50B 1QZHA 4L5RC 4IJHA 1SYFA 1X6OA 3K58A 4C3IB 5KNCA 1XMQQ 1RL2A 4NKLA 4YWLA 3NUCA 4KLKA 1SE3A 5FJ8G 4A75A 2KHSA 1VQHA 1TIID 3I8ZA 3KLSA 2EY6A 3A74A 1VQ7A 1MHWC 3CMEA 1QB5D 1SAPA 2WB1E 1WTQA 2IX1A 2N49A 1HH2P 3IL8A 4DR2Q 4FP5D 1LABA 5CR3A 2B3GA 2K5HA 2SOBA 2O5JC 3SGIA 2AKWB 3CP0A 1XPRA 1JR0D 2PNRC 2DGYA 1I50H 2NTSA 2HHHQ 3SVMA 2F0DA 3VR6A 4DV7L 2K04A 3WDNA 3K5OA 1K8AC 1YBYA 3GTJB 5G3LF 2KBNA 4DV5Q 3C1FA 5JOBA 3FMCA 4DAMA 4APVA 1EEFD 2EYJA 2UU9Q 3TS2A 2JE6I 3A8JE 3GTQB 3EQLC 2A5HA 2Z0SA 1ONLA 1FVIA 3KF8A 5LMNQ 3M3YB 4JBKA 3I4OA 1RJTA 3EFXD 1O7YA 1O78A 1D5MC 5C3EB 1OXXK 4A3JG 3M4YA 3MXPA 3J7ZC 5JAVA 2KCMA 2F3IA 4XQQA 2DNCA 3ER0A 2DJGC 3ERSX 4GZYC 1HNZL 4JI4Q 4DXFA 2N8NA 4JI0Q 2YTYA 5DLQE 1CSPA 3J80L 3TP8A 1EQVA 1Y8PB 1Q12A 2AHOB 2R93B 1X3GA 3BDCA 4DF7A 1WTOA 3NTKA 1JMCA 1KDCA 3K81C 4JBWA 2RQXA 4B3MQ 1EY6A 1JOKA 2PW7A 4OXPA 4A3IB 4X6AH 1X54A 4EVOA 1C4QA 1N36L 1BKBA 2CKZB 5JJLA 2UXCQ 2TMPA 2KECA 2VQEQ 4B3TL 3IFTA 2HT1A 4RH6A 3A7AB 4DNTB 5HGTA 3C46A 2GN5A 1BQQT 2Z6KC 1F9PA 3PUXA 4X62Q 2B39A 1X3EA 3TBIB 1PTOB 3F1ZA 1R4PB 1DONA 5IT9L 4OELB 4DUZQ 2MO1A 3K0YA 1YHAA 3AFQA 1H9SB 1NR4A 1YNNC 2K28A 2JEBI 2N88A 4HJ5A 2RA4A 3VA7A 1JE4A 3GD7A 4A3GB 4GKKQ 2A6HC 3UDIA 1Y1WH 1GUSA 4OO1I 1XYIA 1D1IA 1EUJA 5EAYA 5ELOA 5I6WA 3I73A 2KCTA 2B63H 1PRTB 4NP5A 3IRBA 2B2VC 2NVTH 4N9TA 5C5LA 4HMIA 4K8JA 1YJ9A 2EE1A 2K5WA 5M9OA 2E74C 2RHQB 4XT1B 4GOPB 1D8LA 3HKZE 4BWGB 5BN4A 4KHZA 1ICWA 3BG3A 1NTGA 4L5QA 1VQEA 1WVLA 5JEAJ 4LF7Q 3A7LA 4CJ0B 2CCZA 3QOLA 2E2HB 4NW2A 1QZGA 4GLVB 1I4XA 1DCZA 2IL8A 1IYUA 4K5VA 2C35B 1F9SA 3CMAA 4IUVA 2NVXB 3MEHA 2XTIA 5IGCA 4IO9A 1FJGQ 1SE2A 2K14A 5KIXA 2L11A 4JI1Q 4IFDI 4H7BA 4PMWA 3IFDA 3K7UC 4LWCA 2F0VA 3NPPA 3CAMA 2B8FA 5FKAC 5JVH3 1MSHA 1E0BA 1JWSD 4JBJA 5IWAQ 4FF1A 2NYZD 2PQAB 2OF1A 5IGEA 1C7YA 2E2JH 1V8QA 2R93G 5E3FA 3H6MA 1VQKA 1LTAD 1IZ6A 1RF2D 4PV1C 2XRQD 5IP9G 1N32L 2EY2A 3A54A 2AQ3B 5CMDA 1QVFA 3MXNA 3BZDB 1UNSA 3EA6A 1HPCA 1Y1WG 2JP1A 5D14A 1KDBA 3HFZB 1SR3A 3H0GB 5IGGA 3J80i 4X65L 3T1HL 1WD1A 1PXUA 1IBLQ 1Q3LA 3MFYA 2UU9L 1STAA 4LF5Q 2VUMB 2FINB 3TP5A 1B3QA 3P20A 5C4XB 5LMNL 3KK7A 1EQRA 3M4OB 4JVZA 2GA4B 2F0JA 4JK1C 2F0OA 1A2TA 2NTTA 2LKVA 1XJVA 2ZJRA 3G4SA 4KHPQ 2WB1B 2AWNA 1CM9A 2WP8J 4QL5A 3KJPA 1LTLA 3GTOH 1PH1A 5IP7H 1Z9FA 5C0XI 4B3SL 1G6ZA 5JPNC 1T5EA 2BH2A 5LL6X 4LF8Q 1PFBA 2RVLA 4P74A 1N8RC 1OTCA 1CK1A 3J81j 4DK3C 3GP7A 4RKLA 1GUGA 2VUMH 2K52A 4DV4Q 2HDLA 4K2LA 3NELA 1OO9B 4AH6A 3GTGH 3T1YL 1O7IA 1OXTA 2K33A 1HR0Q 2V1CC 2JA7B 1VQJA 4HJ8A 1SXTA 4RKBA 3KF8B 2UXCL 4QF4A 3W5OA 4AQYQ 5FLXL 1RTOA 1EIYB 5C5MA 4IUNA 1VQNA 3LNNA 2F3WA 2KHJA 2F3VA 3I4NB 3S17B 2G9DA 2ATWA 4HN7A 4UY8C 3SHLA 2BCOA 3UDGA 3GTKB 4Y7NB 1M8AA 1EYDA 4TVAB 4J1MA 2MUYA 1RHPA 4LK1C 1BVSA 4A4IA 4DAYA 4RGOS 1B7YB 2Z1CA 3NQIA 2ZTEA 1BBWA 4HR7B 3M7GA 1K83H 1TS5A 1XMOQ 2MFIA 1CKNA 3DWPA 2IT1A 1TS4A 3QJYA 2N55A 3D4DA 2F0UA 2ICIA 1I6HH 5DAUA 3FRPB 1NJIC 3DMUA 4DR1Q 5DNFA 4DR4Q 4NXML 3GTKH 4Y7NH 2OQKA 5IP7G 5C4HA 3MXGA 3G6JB 2SEBD 1J8IA 2CVRA 1PLFA 2PO4A 3QG1A 5JVG3 1YITA 1TY2A 4LF6L 4LF7L 1KLGD 3NK9A 1E1OA 2QCPX 3S2DB 2VUMG 4A3DB 2RDFA 5L37A 1J5EQ 2KCCA 2O2LD 2OQ0A 3HG9A 2L5TA 3AMUA 3NWSA 1VQCA 3NBHA 1Y69U 2D0OA 2V4DA 2BH8A 1IBMQ 1HNWQ 4FNFA 1ICFB 1TVXA 3NP8A 1E22A 4I7AA 3TMEA 2EJGC 1LTRD 3S15B 3PIPA 1HQMC 1DXMA 2PMZB 3ONAB 2E76C 2K5QA 2RF4A 4WRDA 3S1MH 1UEBA 2OTLA 1KIXA 1Z6HA 5LMNW 3C3LA 3B6YA 2AQ2B 2HQEA 1S3OA 1XPOA 2JEAI 3W1BA 3WOFA 2B2TA 2ZJPA 3KLWA 2R92B 1FD7D 1YJNA 2ZXOA 2I5MX 1CUKA 2IX3A 4HJAA 4LF9Q 1Q7YC 4R4TA 3LWUA 3RZDH 2R7ZB 4POFA 3HOXB 2BDOA 1W6JA 1SMXA 2P5ZX 5I4DA 1EY7A 1GKHA 2NVYB 4ZKBB 4O2DA 3K57A 2A8VA 5D3IB 4AIMA 1BCPB 5BN5A 3CC4A 1XNQL 2Z4IA 3PUVA 4KHPL 5CV5A 1WCMH 3C2PA 5LL6S 4K2KA 4UP9A 3CRKC 4OWTB 2R92H 1DOLA 1PYSB 1PH5A 3CCUA 2IX0A 1OXSC 1PH9A 3DEPA 1M4VA 4EQPA 4LFCQ 2AMCB 4HAEA 3U50C 4DU9A 2RDGA 3W3AA 1JOOA 5ELBA 5A35A 4A3KH 4G4KA 2F4IA 4LFAL 3R3OA 1TWFB 2QDBA 1CHQD 1LACA 5EKIA 4G7ZC 2YTXA 2VZAA 1PFMA 2D9UA 3TS0A 4A93B 3J7AV 4IALA 3ZYYX 1STNA 1Z47A 4PG3A 1L2FA 3HKSA 3OSOA 3VA5A 4DR6Q 1TWCH 2RSOA 1SE4A 3D31A 4IURA 3J81L 3EJIA 1C48A 1VMPA 4BS9A 3T4AC 3D3RA 4X3SA 4H13C 1STYA 4MNOA 4ODGA 2A6HD 3MFGA 2ICEC 3NHHA 1U4LA 4ZRZA 4YHHQ 2ZTDA 4I7ZC 4FXKC 1SNOA 1C0AA 2LFNA 1YHQA 5IYDH 1WCMG 5M3FH 3T51B 1O7ZA 4P2CB 5C44H 4A76A 1QNUA 3UDFA 2R92G 4KN4C 2MQHA 1AW7A 1TWHB 3BDOA 1NMGA 1RIPA 3VYTA 1YI2A 2X6GA 1KAAA 2F0WA 1EL0A 2LXJA 4B08A 3PO2H 2EYFA 2YV5A 2Z6BA 4A3KG 3PSIA 3J7YW 3I90A 1H9SA 3FDTA 5C4JB 2RSNA 3KUPA 5GAEC 3OW7A 2BOSA 2YU9B 2F0PA 1EOTA 3E9IA 5EBCA 2KHIA 4IZ8A 2KENA 1ENFA 3K59A 2RDHA 5IOCA 2XGTA 3A55A 2L55A 2FMCA 3NQTA 2M00A 1B8AA 1PH2A 1SYBA 2NN6H 3QWNA 3D4RA 4POGA 3K0XA 4FXDA 1Y8NB 3UI2A 1SBBB 1XNRQ 3VYSA 2F0SA 1S5ED 5M5YH 5KNBA 4GOPA 3DHQA 4JYAL 1J6QA 1SMYD 5ELNA 1GJXA 1S72A 2Q2UA 4LFBL 4DR7L 2RKSA 3GTMB 1K9MC 5C4JH 3PF4A 3RZOB 2B2YA 4IUQA 4NXNL 3DM3A 4RCNA 5FO9B 3JAME 2IWHA 1H9RA 1E2VA 4JI3L 1KDAA 2F0FA 5IYDG 5M3FG 5C44G 1W3SA 5JPMC 2HCIA 2G5DA 2EY5A 4OGQC 4LNQA 4NPSA 1BOSA 1N33L 2CFMA 1KRSA 1YZ6A 1HR0W 4LUOA 1G2TA 4DV3Q 2JYOA 1DGSA 3ND9A 3R2IA 2UUBQ 4K14A 4K6LA 4DUYQ 4PMCA 3RZOH 4XYQA 3PO2G 2PQAA 1R9TH 4GNXB 3J81i 1X65A 2KUMA 2M2LA 5I9PA 3I2ZA 2UXDL 5JJIA 4X66Q 5G3LD 1HZ9A 3PMFA 1DOKA 2XWJB 3Q22A 4OX9L 3STBD 3KYHC 4R8IA 1JCKB 4YIJA 4QY7A 1KRTA 1HRJA 1KABA 1TKWB 3BS1A 1MI2A 3PGZA 4KD3A 1ESRA 5K5PA 2NN6G 1B9MA 3FPUB 3KLSX 5J39A 4PNYA 3NBIA 1Q81C 1BXTA 3R8BA 2IHFA 3CCRA 2SNMA 1LLRD 3MXUA 2EXZA 1PYBA 1Q90A 4DXGA 3RUZA 3CF5A 3A8IE 1D7QA 2RCFA 2VS1A 1IYJB 1K3RA 2QA4A 5EBDA 1FGUA 1VQ9A 4JI6Q 3R2TA 4A3LH 1QUQA 2F0HA 1CT1D 2QEJC 2EQSA 5M5XH 1F2LA 1GOZA 4HCSA 1PZKD 3AFPA 1BBUA 1I4GA 4OEMB 1PTOF 5CGKA 1E24A 3Q8DA 3QO2A 1UE5A 4G57A 4FO2A 1HNXL 5A2QL 1H9MA 1VDZA 1U0LA 5HURA 4B3RQ 4A3CH 1SNQA 4JV5L 3E0JA 2EXDA 4L5TA 4C3JH 2DJFC 2IJ0A 2NBFA 2Y0SG 1EY5A 2D2CC 3HOUH 2O5IC 1EIHA 2B8GA 4QCLA 4R1JA 1PRTF 2PCFB 4DV0Q 4DNIA 1PYWD 5ELFA 4C3HH 3DWAA 1G8ZD 4EX5A 4N8X1 2WV6D 4QB4A 3CRLC 3S2HH 2JA8H 1Y1WB 5H1SE 3KFUA 1VF7A 2B63B 3I7FA 1HTPA 2YTVA 4HSPA 2NVTB 2G9HD 1DOMA 1F9QA 3P1HA 2D5DA 3PO3H 2CQOA 1NE3A 3GTPH 4JG2A 1Q8IA 4ALPA 4ZYSA 3CCMA 3IKJA 1GUOA 4NDXA 3EBEA 2F0IA 4A3LG 4KY6A 3CPFA 4GNXC 5HY6A 5C3WA 1PMRA 1KQSA 5C6AA 1C9OA 2EVBA 4DR3L 1EZ8A 1HCZA 3DXJC 5FOBB 1WTRA 4BA1I 2L15A 2PYKA 1KAWA 3F2DA 4A3EH 3K80C 2EZVA 4OONA 2TSSA 5IE8A 3HRZC 1S5BD 2PMZE 1PZID 1FGBD 3GV3A 3U58A 4A3CG 1HTLD 2OEOA 4UHVA 4JBMA 1SYCA 3ZJYC 4C3JG 3U4ZA 1AFPA 4BY7H 5CC4A 4IFDH 3UDXA 5BR8L 4U68A 3S16H 3E6ZX 3HOUG 4QQBX 4A3MH 1SRUA 4GS3A 2CH4A 1LV9A 1IW7D 5IT9E 4FF3A 2E2JB 4DA2A 4C3HG 3FEWX 2D0PA 4DK0A 2DY7A 1XMQL 3U9OA 1LT6D 4DGZA 1TS3A 4MIUA 1XTCD 2B2UC 3AQQA 2JA8G 3D6CA 3RLNA 1BNZA 3PUWA 1X3QA 4CKEA 2CHBD 2DY8A 3J7A5 1AZPA 4DR2L 2F0GA 4HIDA 3S1RB 1SDFA 1SNCA 3DUZA 1IKLA 3PO3G 3MZ5A 2E2IH 1R4QB 1L1OC 2R3ZA 2HHHL 2A1AA 1IBKQ 1KHIA 2FJ2A 1GUWA 3BZCA 2H4OA 2LSSA 3RN5A 4JOIC 1SMYC 4X64Q 3NE5B 1I94Q 4BA2I 1LT5D 4CBVA 3GTOB 1TT2A 3HGBA 1K8OA 4DV5L 4QUCA 3M7NA 5FO7B 3TREA 5C0XH 1RCVD 5IODA 4XQNA 4QGUA 4A3EG 2E5LQ 2B63G 3I4MH 3EVQA 5C3XA 2LY7A 3S1RH 1SYEA 3L9AX 1EFWA 2B2WC 2WKCA 2ENBA 3GTGB 3QB3A 1ASYA 1PDQA 2EYMA 3BVMA 3CU7A 1MJEA 4OIKA 3FKIB 3S14H 4BY7G 2BDNA 3CCEA 2JA9A 4RAUC 3MVVA 3JAMc 2QILA 2L12A 5FK9C 4A3MG 2KA7A 5FLMH 1SFOH 4QUFA 4KK7A 3TP6A 1WTXA 4QMGA 2A68D 2UUAQ 2VQFQ 2Q2IA 4JI4L 1VQ8A 3S1QH 4JI0L 1E7ZA 1QUQB 2VL6A 2A6ED 5CV7A 2KJXA 3SEBA 1MKHA 3OPOA 5LMUQ 4ZCKA 3WOEA 1FNVA 2MO0A 1VQ5A 2E8GA 3STBC 3H3VI 4B3ML 2IY5B 2XNAC 3AB9A 3FKIH 1K83B 2YYZA 4FDBA 2JA5H 2VQEL 1PZJD 3A0JA 2K03A 4X62L 4KD4A 1I6HB 2MJ8A 4X3TA 4DUZL 2EPBA 4MN3A 3MEFA 2PW5A 3RNUA 3P7JA 3K5MA 3H94A 3X3NA 4KV6A 5C0XG 3MTSA 3F2UA 3I4MG 1G51A 4GKKL 3GQBA 1YIJA 4BXXH 1WD0A 3BVGA 3OOCA 4MTKA 2Q2TA 1SNDA 4HMJA 2JQOA 1XTDA 1LYLA 5IGDA 4PZ7A 1JJ2A 1PH3A 2I0QA 1LTSD 4F87A 3PF5A 1HZAA 3U9SA 4DN4M 4C1NK 3CKIB 5FLXE 1I4RA 1NAPA 3BYTB 3VR2A 2JA6H 5FLMG 1L0XB 3PQIA 2D62A 3TSSA 1E3PA 4DK6C 4DV1Q 1HFGA 5M5WH 4YY3Q 3HEJA 2WINB 4LUVA 2C9OA 1VQLA 2L0CA 4UP8A 3S1MB 1T5XD 1ZEQX 2I5LX 4RCOA 4G7HC 2EJFC 4TSSA 3CC2A 4DV2Q 1BCPF 2VB2X 3FKIG 3NEMA 2Y0SE 1FJGL 3T13A 1XXGA 5KNDA 1VQIA 4WJWA 4R4IA 4JI1L 2JA5G 2AWOA 1D1KA 2UXBQ 5IY0A 3K5NA 3H09A 3RZDB 1EYGA 2WKDA 5DM63 2OXPA 3GV6A 2I5HA 3CC7A 3E0EA 5IWAL 1JQYD 1JE5A 2CW0D 1SLJA 3KLRA 1X32A 2Z6KA 5I6YA 1JWMD 1L0YB 5KEEA 1U4PA 2A19A 5FO8B 1K0RA 4X64L 1WCMB 1EFID 1SNMA 4RFBA 3RN2A 1WOCA 2UUCQ 1EYAA 4P75A 4BXXG 5EPJA 4GNXA 2E5LL 1K8MA 1GM5A 2IPKD 2N78A 1IBLL 1QILA 4LF5L 4UP7A 3G6EA 2QKIC 4EGVA 2NZOA 4ZLTF 2B2VA 4OWWB 1HZCA 3FPPA 4A3KB 2FMMA 2JA6G 2JXMB 4MHEA 4RA8A 4BBRH 5JEAH 4WJ4A 1X56A 1E2ZA 1ZXTA 4CHTB 1UE7A 3NENA 2WIIB 1X9NA 2KQ3A 3ERQA 2X6LA 3J80c 4LF8L 1Y1VB 4GKJQ 1TWGH 2LXKA 4FXGC 4U673 1NNXA 1TWCB 4DR5Q 5TSSA 4EQ5A 4B9WA 1U4RA 4DV4L 2F4VQ 3BVZA 4UDUC 1PH7A 1T9HA 2H1EA 3TZDA 1IW7C 4ZKCB 2NVQH 1VQMA 1HR0L 3CD6A 2JJQA 4BBSH 2ZM6Q 2L1BA 4JI2Q 1A63A 2B2UA 4Y52H 1VQAA 3HOZB 3OTOQ 4AQYL 2Q8RE 1UE1A 1AP0A 3D6WA 1GHKA 5IT9c 3TZUA 4IOCA 2EDGA 1VQDA 1QVGA 1V9PA 4JI7Q 1Y1VH 1N34Q 4LF4Q 3MHBA 2RBMA 2PPBC 2F0KA 3OWEB 5M3FB 3F2BA 3HZXA 5C44B 1GHJA 3S9WA 1AH9A 1MIUA 2F52A 3M4PA 1B1ZA 1EQQA 5CYUA 1LTTD 3I72A 4F8MA 4H02A 1XMOL 3HOZH 5J22A 4WORA 4KN7C 4DKAC 1SYGA 3A56A 5LHY1 3CQZB 3PO2B 4R4QA 1CKOA 3M4QA 1FYCA 4G7OC 2HUGA 3QIAA 4CDCC 4BBRG 5JEAG 4DR1L 4DR4L 1Q8KA 1S5CD 1FNWA 4HEDA 4DV7Q 3EROA 5IYBH 4M1UB 4GLAC 1TWAB 3VR5A 4OL7A 3H91A 1LT4D 2XWBB 3A8KE 2L9HA 2ALYB 2F03A 3ULPA 1AE2A 2VW9A 1BUVT 2ZT9C 3J81E 2J4XA 1J5EL 2Q8IB 1KXLA 4DK1A 3CQZH 5M5YB 3V96A 4BBSG 2A68C 3URYA 4IOAA 5E7NA 4K5XA 5T1IA 2A6EC 2UXBL 3NTIA 1IBML 4JI5Q 1HNWL 1I4QA 5EKLA 5ELEA 2QW7A 1SSOA 2EIFA 3D8GA 4H0LC 1SJED 3S1NH 1Y1VG 3T53B 1TWAH 4R9WA 1EY4A 3NSWA 2I07B 1G291 1JT8A 4NMZA 3ULLA 5AJ3Q 3KBXA 4TQUS 3EIVA 4KMUC 3PUYA 3RD4A 1YHBA 1HNZQ 4NB3A 2UUCL 1TR5A 3C1EA 1PH8A 2K50A 2NZHA 2AUJD 1AZQA 3HOZG 1JICA 1GO3E 4LF9L 4KJNA 2Z4HA 2QGQA 2RCNA 3HOWH 4N9PA 4RWSC 1B9NA 3K7AH 1R9TB 4CJ2C 1ZYRD 3CHBD 4OHJA 3HOVH 3MA2B 1N36Q 5HGQA 1NCVA 1S5FD 1Z7TA 1WYDA 2F0TA 4B3TQ 1NSNS 1A6XA 2Q2HA 2Y0SB 2EYHA 3HOYB 3AEVA 1A3VA 1S5DD 1GVPA 5IYBG 2WAQG 4A3FB 1EEID 4ZUJA 3CPWA 1MSGA 4FYDA 4HTHA 3S24A 1TU2B 4EQOA 2XSCA 2EYOA 1NR2A 2NN6I 2N3SA 3JC66 3LX0A 4PZ8A 3F2CA 3I4LA 5JJKA 4XDXA 2CWAA 4LFCL 1EOVA 1D2BA 1U9RA 3OHXC 1EQTA 2PZTA 4N8FA 2CQAA 1GD7A 5FLXc 3HOYH 3SK4A 5IGFA 3F8TA 4YCVA 1PFSA 1SN8A 4A3FH 3GDEA 4RG1A 3SXHA 3GTLH 4LJZC 4A3BB 1KNAA 3UE0A 1MBYA 4JC0A 3M9BA 4DR6L 1V1PB 5M5XB 3CCVA 4A3JH 4K6DA 2FFKB 3OIQA 4DV6Q 1RTNA 4AYBG 5EJWA 2CW0C 4RGNA 1PHJA 2VB3X 3Q6SA 1H95A 3HOWG 2BE5D 1PRTD 3HOVG 1HXYD 1K28A 3V2TA 1LTID 4YWKA 5CBEE 2ASBA 3LGJA 4C3JB 4ID6A 4LW1A 3A5UA 4A3BH 4YHHL 5EPKA 3DM1A 4K8IA 3HOUB 1I3QB 1SYDA 2R7DA 1ENCA 1G6PA 2K5DA 4UAIA 4C3HB 1E2WA 3G48A 4C3IH 2IW3A 1DM0B 1K73C 1L1OB 4BY1B 4JW0A 5EKKA 4P73A 1DYQA 2VXWA 3S2HB 1N32Q 1ML0D 1B50A 4DAVA 1V1QA 4OIJA 2JA8B 1NY4A 3JAMi 4FVMA 1SROA 1C8CA 3OYYA 3TP7A 4C1NI 4P72A 3BDLA 4X65Q 3T1HQ 1RODA 1WTWA 3HOYG 3TRZA 1XWEA 1CA6A 1VQBA 3PO3B 4K5WA 1I3QH 3GTPB 2A73B 2WACA 4JI5L 3OW2A 3CCLA 1HFNA 4A3FG 3EN2A 5KGUA 1XX8A 3KDFB 4JPBW 3UE1A 1LO5D 4IUPA 4BY1H 4RMFA 4R8NA 2QF7A 4L63B 1EU3A 2HQLA 3FP9A 1HA5A 1PV4A 1KLUD 4FF4A 1Q1EA 2F0MA 1J9OA 4KY7A 3VYUA 3GTJH 4B3SQ 3I55A 5AJ3L 5I2XA 2JN4A 4ZQ3A 4A3EB 1XNRL 2E2DC 2OT2A 4OO1H 4O0AA 2LMCB 1EIFA 3E3XA 2HCCA 4KHVA 5A2QE 1HUNA 1UUPA 3GTQH 2HIVA 3CCSA 4J15A 3T1YQ 4IPCA 2GVBA 3M3YH 1ILQA 4BY7B 4A3BG 5AFWA 4ME5A 3W2DA 1KTKA 3TN2A 2PZUA 5C3EH 3S16B 3KJOA 3FHWA 4A3MB 4QJFA 4XT3B 5CBAE 1VQOA 4ZAIA 4L6TB 3DLLA 3J80E 4C3IG 1RKNA 2M9VA 1QE6A 5KRUA 2JK8A 3MWYW 4KY5A 2MPMA 2GVAA 4CDDC 4DV3L 1BO0A 2B2TC 5KYIA 2UUBL 1VQ6A 2LS01 2R93H 1SNPA 1OXVA 4QIWB 5JJZA 3L0OA 4DUYL 1A8VA 5IP9H 1ESFA 4O42A 4CGYB 3BJUA 4A3IH 1I4HA 3VR3A 4X66L 4FF2A 5F2DA 2E2IB 1I5FA 4ULLA 3I56A 1CSQA 1B53A 1Y8OB 2I46A 3ITPA 2XVSA 4L8JA 2NUCA 2SNSA 2JSOA 1BDOA 1SJHD 4IN3A 1PTOH 2OWOA 4BY1G 2QEXA 3QOJA 1GUTA 3VYRA 3LWEA 4NXMQ 2NWGA 2K5NA 1KD1C 3J81c 3CXCA 5D3DA 4LF6Q 3I4MB 1EWHA 4ILWA 2KEDA 1U5KA 4OO1G 4DV6L 4A3GH 4L5SA 4ZUIA 1A0IA 5BN3A 3L2PA 3IAYA 2ZTCA 3HP3A 3S14B 4IPDA 1K0SA 3M85A 1A2UA 3RMHA 5COYA 4H44C 5CORA 5C3EG 2O4XA 3N52A 1AE3A 1YNJD 4JI6L 1SFOB 1LT3D 2NB0A 1Y14B 2X69A 3BU2A 1NBWA 1TXYA 1QOHA 2R61A 1HJPA 3D4WA 1DJRD 1O7LA 3S1QB 1CI3M 1IHZA 1ZYRC 5M3MB 2WFWA 1QG7A 1WJJA 5I2YA 2K5VA 2E2HH 1WTVA 5ISRA 1DD2A 5E1FA 4E6IA 3PCOB 1WTHA 4JI8Q 4HCEA 2Z9HA 2EYLA 2NVXH 4PMBA 4A3IG 3H3VH 5CV8A 4IFDG 4B3RL 1GXDC 2JA5B 1JB3A 4HJ9A 2WAQE 5EGTA 1EY0A 4XXEA 4DPGA 3NXWA 1S4ZA 3N6RA 1D6EC 4PQXA 1E1TA 1KNEA 1M1KC 5I9OA 2ZXPA 4DV0L 5M3MH 3SK6A 4KJOA 5IYCH 2F1MA 2DNEA 2EYPA 1XNQQ 3K6OA 3PUZA 1CZGA 2F0QA 1L0WA 1STHA 2A69D 2PNHA 3K5LA 4YCUA 1VQPA 1HHVA 1NMFA 1VS0A 4J6HA 3TDQA 2K75A 4ME3A 4A3GG 2K32A 1CHPD 2J0TD 2CH4W 1MJCA 3SE0A 1PTOC 3H0GH 2K6AA 1IL8A 1Q86C 3MAQA 5C4XH 4GN4B 3VR4A 1YJWA 1QCBD 1A3TA 4IQZA 2CWPA 3M4OH 5C4ZA 2JA6B 4XYOA 4XTCS 4TRDA 4AYBE 1Q82C 4CDEC 2HDMA 4RHSA 4LFAQ 1CQVA 1EY9A 1I6VC 1BCPD 5GQOA 5M5WB 2BE5C 1IYVA 1PRTC 1S40A 1I4PA 2OCEA 1K8GA 4CJ1B 1UAPA 4GOPC 4EQNA 2KEEA 4HIOA 1HQRD 1FR3A 1YVCA 3Q0AA 2Q8TA 1WFQA 2B2YC 1B70B 3SDZA 2JA7H 3L7ZC 1ILPA 3NWTA 1O80A 4UPAA 4WFN3 1BR9A 4HJ7A 2PI2E 3RLFA 3WWVA 1HUMA 5M3MG 1KL9A 4RGTA 1FL0A 3SK5A 5IYCG 1B44D 2BA0A 4O1NA 3I4NH 3H3VC 3S17H 1JJCB 4DFAA 4IUTA 1JC7A 3OIPA 1HZBA 2PI2A 1CKMA 2B29A 1MGSA 3CCJA 1ZKOA 1F9RA 2ES2A 4KKUA 1V1OA 1DZ1A 4F7XA 3DEOA 3H0GG 2AUKA 3K8AA 3R93A 1CFMA 1ENAA 1STBA 2ID0A 5C4XG 3SR1A 4IJLA 1EY8A 1P16A 1IBKL 4X3UA 3T56B 2IHEA 4LUZA 2ZXRA 1U4MA 1W6KA 2Z8LA 3BYYB 4R4CA 4BBRB 2PZWA 1V43A 1I94L 1TS2A 2WB1G 3FVQA 2VY3A 1YNXA 2FXQA 3HS0C 3A5ZB 4KKTA 1P8LA 3KF6A 2MP1A 1TWGB 1VMCA 1ET9A 1X3FA 2DN8A 5K36H 4ZK9B 2XRSD 3D0FA 2AQ1B 3S2DH 5ELCA 4V190 1ASZA 1OXUA 4A3DH 1MD2D 1PVOA 2NVQB 4JI8L 3ND8A 4XIGS 4BBSB 3HKZB 4GLXA 1JORA 2E75C 4JYAQ 2JA7G 4LFBQ 4DR7Q 1B2TA 2MGSA 2K05A 2F0LA 4DAPA 1F77A 1QVCA 4HIKA 2C5CA 2K1BA 2NZ1D 1V1PA 1M90C 4NXNQ 1VQFA 5J3BA 1CA5A 2UUAL 3I4NG 2VQFL 1F2ZA 1D5ZC 2K4KA 1WTPA 1CQFA 4IUUA 3PIP3 2XIWA 4IPHA 4JI3Q 5E4XA 4CKBA 3S15H 1RDPD 1X55A 5LMUL 4C56C 1VCIA 1G91A 4TKOB 1F2YA 4Z9CB 5EPLA 1N33Q 5EQ0A 4X3KA 5J1ZA 3T16A 1IXRA 3OWFA 3BZKA 3G71A 1QJOA 1A3UA 3MXNB 2R7ZH 4K0KQ 3HOXH 1UE6A 4GN5A 1STEA 4RHRA 1SEBD 2NVYH 2UXDQ 5DM73 1L1OA 5NUCA 2K7VA 1B4OA 3MC0B 4I65A 3SK8A 4OX9Q 4C2MB 4CDFC 1LUZA 1BF4A 3CW2C 2EJMA 2WAQB 4JOIA 1JWUD 4IPGA 3U4VA 4B9XA 5K36G 1EIGA 4P71A 4KKSA 1CZWA 4Q0FA 4GN3B 3P75A 5GAGC 4M8AA 3KOJA 1YNJC 3G7LA 1PH6A 4A3DG 1AN8A 1LTBD 2QDLA 3Q23A 2B2WA 1PH4A 3O13A 2KOLA 3KDFA 1CTMA 3I3CA 1NUCA 1YNND 3H15A 5ELDA 4HIMA 4LMQD 4C2MH 5GROA 2R6GA 4RGMA 4LAAA 3S1NB 4DV1L 1TWFH 1Q1BA 4YY3L 4YCWA 5CV9A 4A93H 3TQYA 1G2SA 4HSVA 3I91A 1EYCA 2H5XA 2VNUD 1F2MA 4DV2L 3HKZG 3VDYA 4AYBB 5KYLA 4WJ3M 3W1GA 3KBGA 3I70A 1LM0A 1AEXA 1STGA
chains in the Genus database with same CATH topology
2XN9C 3HOWB 1GUNA 3L3OC 3X3MA 3K7AB 1D5XC 1EU4A 3HOVB 2KCNA 2A69C 5CV4A 2KVMA 1RD9D 3OMGA 2FHTA 3JAML 4IFDJ 2F0NA 2MHVA 2PQEA 1LTGD 5IIFA 1B3AA 1HA6A 4ABNA 1QWYA 1EWCA 5T1GA 4KI0A 4CKCA 3V05A 4Q5VA 1IKMA 2L4NA 2J7ZA 3E5SA 5DEHA 1FNUA 1BCPC 2F0EA 3NTHA 4F88A 4DNRB 2EY1A 3GO5A 1JOQA 2K01A 2A74C 5D65A 3PIO3 3PV0A 1II3A 1TQOA 3GTLB 1BBXC 3OMCA 5E4WC 4J8QA 1H9KA 1QNKA 5CV6A 4A3JB 1H9JA 1X3PA 3DWQA 3J7AF 1UEAB 2BA1A 3Q24A 1ET6A 5C0XJ 4V0BA 3AU7A 1A15A 2EOTA 2SDFA 4XQJA 1PFNA 4KTAA 1PTOD 1EZ6A 5IGBA 4S3SA 1TY0A 1VF5C 1I50B 1SYFA 3K58A 4C3IB 5KNCA 4NKLA 3NUCA 1SE3A 2KHSA 1TIID 3I8ZA 3KLSA 2EY6A 1WTQA 1QB5D 1SAPA 2IX1A 3IL8A 4FP5D 1LABA 5CR3A 2SOBA 2O5JC 1JR0D 2PNRC 2NTSA 3SVMA 2F0DA 3VR6A 2K04A 3WDNA 3K5OA 3GTJB 5G3LF 3C1FA 5JOBA 3FMCA 1EEFD 2EYJA 2JE6I 3A8JE 3GTQB 3EQLC 2A5HA 1ONLA 3KF8A 3M3YB 1RJTA 3EFXD 1O7YA 1O78A 1D5MC 5C3EB 1OXXK 3M4YA 3MXPA 5JAVA 4XQQA 2DNCA 4GZYC 4DXFA 3J80L 3TP8A 1EQVA 1Y8PB 1Q12A 2R93B 3BDCA 4DF7A 1WTOA 3NTKA 1KDCA 4JBWA 2RQXA 1EY6A 1JOKA 2PW7A 4A3IB 4EVOA 1C4QA 2TMPA 2KECA 3IFTA 4RH6A 3A7AB 4DNTB 5HGTA 3C46A 1BQQT 1F9PA 3PUXA 2B39A 3TBIB 1PTOB 1R4PB 1DONA 5IT9L 3K0YA 1H9SB 1NR4A 1YNNC 2K28A 2JEBI 2N88A 2RA4A 3VA7A 1JE4A 3GD7A 4A3GB 2A6HC 1GUSA 4OO1I 1XYIA 1D1IA 5I6WA 3I73A 1PRTB 4NP5A 2B2VC 4N9TA 5C5LA 4HMIA 4K8JA 2EE1A 2K5WA 5M9OA 2E74C 4XT1B 4BWGB 5BN4A 4KHZA 1ICWA 3BG3A 1WVLA 5JEAJ 3A7LA 4CJ0B 3QOLA 2E2HB 4NW2A 1I4XA 1DCZA 2IL8A 1IYUA 4K5VA 1F9SA 4IUVA 2NVXB 3MEHA 5IGCA 1SE2A 5KIXA 2L11A 4IFDI 4H7BA 4PMWA 3IFDA 2F0VA 3NPPA 2B8FA 5JVH3 5FKAC 1MSHA 1E0BA 1JWSD 4FF1A 2NYZD 2OF1A 5IGEA 1V8QA 5E3FA 3H6MA 1LTAD 1RF2D 4PV1C 2XRQD 2EY2A 3A54A 2AQ3B 5CMDA 3MXNA 3BZDB 1UNSA 3EA6A 1HPCA 2JP1A 5D14A 1KDBA 3H0GB 5IGGA 1WD1A 1PXUA 1Q3LA 3MFYA 1STAA 2VUMB 2FINB 3TP5A 3P20A 5C4XB 3KK7A 3M4OB 2GA4B 2F0JA 4JK1C 2F0OA 1A2TA 2NTTA 2LKVA 2WB1B 2AWNA 1CM9A 2WP8J 1G6ZA 5C0XI 5JPNC 1T5EA 5LL6X 1PFBA 2RVLA 1CK1A 3GP7A 4RKLA 1GUGA 2HDLA 4K2LA 1OO9B 1OXTA 2K33A 2JA7B 1SXTA 4RKBA 4QF4A 5FLXL 1RTOA 5C5MA 4IUNA 3LNNA 2F3WA 2F3VA 3I4NB 3S17B 2G9DA 4HN7A 3SHLA 2BCOA 3GTKB 4Y7NB 1M8AA 1EYDA 4J1MA 2MUYA 1RHPA 4LK1C 4DAYA 4RGOS 2Z1CA 3NQIA 4HR7B 3M7GA 1TS5A 3DWPA 2IT1A 1TS4A 3QJYA 2N55A 3D4DA 2F0UA 2ICIA 5DAUA 3FRPB 3DMUA 5DNFA 5C4HA 3MXGA 3G6JB 2SEBD 1J8IA 2CVRA 1PLFA 2PO4A 3QG1A 5JVG3 1TY2A 1KLGD 3NK9A 2QCPX 3S2DB 4A3DB 2RDFA 2KCCA 2O2LD 3HG9A 2L5TA 3AMUA 3NWSA 3NBHA 1Y69U 2V4DA 4FNFA 1TVXA 3NP8A 3TMEA 2EJGC 1LTRD 3S15B 1HQMC 1DXMA 2PMZB 3ONAB 2E76C 2K5QA 4WRDA 1Z6HA 3C3LA 2AQ2B 2HQEA 2JEAI 3WOFA 2B2TA 2R92B 1FD7D 2ZXOA 2IX3A 3LWUA 2R7ZB 3HOXB 2BDOA 1W6JA 5I4DA 1EY7A 2NVYB 4ZKBB 3K57A 5D3IB 1BCPB 5BN5A 2Z4IA 3PUVA 5CV5A 3C2PA 5LL6S 4K2KA 3CRKC 1DOLA 2IX0A 1OXSC 3DEPA 1M4VA 4EQPA 4HAEA 4DU9A 2RDGA 3W3AA 1JOOA 5ELBA 5A35A 4G4KA 2F4IA 3R3OA 1TWFB 2QDBA 1CHQD 1LACA 5EKIA 4G7ZC 1PFMA 2D9UA 4A93B 3J7AV 4IALA 3ZYYX 1STNA 1Z47A 3OSOA 3VA5A 2RSOA 1SE4A 3D31A 4IURA 3J81L 3EJIA 1C48A 1VMPA 4BS9A 3T4AC 3D3RA 4X3SA 4H13C 1STYA 4ODGA 2A6HD 3MFGA 2ICEC 3NHHA 1U4LA 4ZRZA 4I7ZC 4FXKC 1SNOA 2LFNA 3T51B 1O7ZA 4P2CB 1QNUA 4KN4C 1AW7A 1TWHB 3BDOA 3VYTA 2X6GA 1KAAA 2F0WA 1EL0A 4B08A 2EYFA 3J7YW 3I90A 1H9SA 3FDTA 5C4JB 2RSNA 3KUPA 3OW7A 2BOSA 2YU9B 2F0PA 1EOTA 5EBCA 4IZ8A 1ENFA 3K59A 2RDHA 5IOCA 3A55A 2L55A 2FMCA 3NQTA 2M00A 1SYBA 2NN6H 3QWNA 3D4RA 4FXDA 1Y8NB 3UI2A 1SBBB 3VYSA 2F0SA 1S5ED 5KNBA 3DHQA 1SMYD 1GJXA 2RKSA 3GTMB 3RZOB 2B2YA 4IUQA 4RCNA 5FO9B 3JAME 2IWHA 1H9RA 1E2VA 1KDAA 2F0FA 5JPMC 2HCIA 2EY5A 4OGQC 1BOSA 1G2TA 2JYOA 3R2IA 3ND9A 4K14A 4K6LA 4PMCA 4XYQA 5I9PA 2KUMA 2M2LA 5G3LD 3PMFA 1DOKA 2XWJB 3Q22A 4R8IA 1JCKB 4YIJA 1HRJA 1KABA 1TKWB 3BS1A 1MI2A 4KD3A 1ESRA 5K5PA 2NN6G 1B9MA 3FPUB 3KLSX 5J39A 4PNYA 3NBIA 1BXTA 3R8BA 2SNMA 1LLRD 3MXUA 2EXZA 1Q90A 4DXGA 3RUZA 3A8IE 5EBDA 3R2TA 2F0HA 1CT1D 2QEJC 1F2LA 1GOZA 4HCSA 1PZKD 1I4GA 1PTOF 5CGKA 3QO2A 4G57A 4FO2A 5A2QL 1H9MA 1VDZA 5HURA 1SNQA 3E0JA 2IJ0A 2NBFA 1EY5A 2D2CC 2O5IC 1EIHA 2B8GA 4QCLA 1PRTF 2PCFB 1PYWD 5ELFA 3DWAA 1G8ZD 2WV6D 4QB4A 3CRLC 1Y1WB 1VF7A 2B63B 1HTPA 4HSPA 2NVTB 2G9HD 1DOMA 1F9QA 3P1HA 2D5DA 1Q8IA 4ZYSA 3IKJA 1GUOA 4NDXA 2F0IA 4KY6A 5C3WA 1PMRA 5C6AA 2EVBA 1EZ8A 1HCZA 3DXJC 5FOBB 1WTRA 4BA1I 2PYKA 2EZVA 2TSSA 3HRZC 1S5BD 1PZID 1FGBD 3GV3A 1HTLD 2OEOA 1SYCA 4C3JG 1AFPA 4IFDH 5CC4A 4U68A 3E6ZX 1LV9A 1IW7D 5IT9E 4FF3A 2E2JB 4DA2A 4C3HG 3FEWX 4DK0A 2DY7A 3U9OA 1LT6D 4DGZA 1TS3A 4MIUA 1XTCD 2B2UC 3D6CA 1BNZA 3PUWA 1X3QA 4CKEA 2CHBD 2DY8A 1AZPA 2F0GA 3S1RB 1SDFA 1SNCA 3DUZA 1IKLA 3MZ5A 1R4QB 2R3ZA 2FJ2A 1GUWA 2H4OA 1SMYC 3NE5B 4BA2I 1LT5D 4CBVA 3GTOB 1TT2A 3HGBA 1K8OA 3M7NA 4QUCA 5FO7B 5C0XH 1RCVD 5IODA 4XQNA 3EVQA 5C3XA 2LY7A 1SYEA 3L9AX 2B2WC 2WKCA 2ENBA 3GTGB 3QB3A 1PDQA 2EYMA 3BVMA 3CU7A 4OIKA 3FKIB 2BDNA 4RAUC 3MVVA 2QILA 2L12A 5FK9C 2KA7A 4QUFA 4KK7A 3TP6A 1WTXA 4QMGA 2A68D 5CV7A 3SEBA 2A6ED 2KJXA 3OPOA 3WOEA 1FNVA 2XNAC 3AB9A 1K83B 2YYZA 1PZJD 2K03A 4KD4A 1I6HB 2MJ8A 4X3TA 2EPBA 4MN3A 2PW5A 3P7JA 3K5MA 3H94A 3X3NA 4KV6A 5C0XG 3MTSA 3F2UA 3GQBA 1WD0A 3BVGA 3OOCA 1SNDA 4HMJA 5IGDA 1LTSD 4F87A 3U9SA 4DN4M 4C1NK 3CKIB 5FLXE 1I4RA 1NAPA 3BYTB 3VR2A 1L0XB 2D62A 3TSSA 1HFGA 3HEJA 2WINB 2C9OA 2L0CA 3S1MB 1T5XD 1ZEQX 4RCOA 4G7HC 2EJFC 4TSSA 1BCPF 2VB2X 3T13A 1XXGA 5KNDA 4WJWA 2AWOA 1D1KA 3K5NA 3H09A 3RZDB 2WKDA 5DM63 2OXPA 3GV6A 1JQYD 2CW0D 3KLRA 1X32A 5I6YA 1JWMD 1L0YB 5KEEA 1U4PA 5FO8B 1WCMB 1EFID 1SNMA 4RFBA 1EYAA 5EPJA 1K8MA 2IPKD 1QILA 2QKIC 4EGVA 4ZLTF 2B2VA 3FPPA 4A3KB 2FMMA 2JXMB 4MHEA 4RA8A 5JEAH 1E2ZA 1ZXTA 4CHTB 2WIIB 2KQ3A 3ERQA 2X6LA 1Y1VB 4FXGC 4U673 1TWCB 5TSSA 4B9WA 1U4RA 3BVZA 4UDUC 4ZKCB 2H1EA 3TZDA 1IW7C 2L1BA 2B2UA 3HOZB 2Q8RE 1AP0A 3D6WA 1GHKA 3TZUA 2EDGA 3MHBA 2RBMA 2PPBC 2F0KA 3OWEB 5M3FB 3HZXA 5C44B 1GHJA 3S9WA 1B1ZA 5CYUA 1LTTD 3I72A 4F8MA 5J22A 4WORA 4KN7C 1SYGA 3A56A 5LHY1 3CQZB 3PO2B 1FYCA 4G7OC 2HUGA 3QIAA 5JEAG 1S5CD 1FNWA 4HEDA 3EROA 4M1UB 1TWAB 3VR5A 4OL7A 3H91A 1LT4D 2XWBB 3A8KE 2L9HA 2F03A 1BUVT 2ZT9C 3J81E 2J4XA 2Q8IB 4DK1A 5M5YB 3V96A 2A68C 3URYA 4K5XA 5T1IA 2A6EC 3NTIA 1I4QA 5EKLA 5ELEA 1SSOA 3D8GA 4H0LC 1SJED 3T53B 4R9WA 1EY4A 3NSWA 2I07B 1G291 4NMZA 3KBXA 4TQUS 4KMUC 3PUYA 3RD4A 1TR5A 3C1EA 2AUJD 1AZQA 1JICA 4KJNA 2Z4HA 4N9PA 4RWSC 1B9NA 1R9TB 4CJ2C 1ZYRD 3CHBD 4OHJA 3MA2B 1NCVA 1S5FD 1Z7TA 2F0TA 1NSNS 1A6XA 3HOYB 2Y0SB 2EYHA 1A3VA 1S5DD 4A3FB 1EEID 4ZUJA 1MSGA 4FYDA 4HTHA 1TU2B 4EQOA 2XSCA 2EYOA 1NR2A 2NN6I 3LX0A 3I4LA 4XDXA 1D2BA 1U9RA 3OHXC 1EQTA 2PZTA 2CQAA 3SK4A 5IGFA 3SXHA 4LJZC 4A3BB 1KNAA 1MBYA 1V1PB 5M5XB 4K6DA 2FFKB 3OIQA 1RTNA 5EJWA 2CW0C 4RGNA 2VB3X 3Q6SA 2BE5D 1PRTD 1HXYD 3V2TA 5CBEE 1LTID 4C3JB 4ID6A 5EPKA 3DM1A 4K8IA 3HOUB 1I3QB 1SYDA 1ENCA 2K5DA 4UAIA 4C3HB 1E2WA 2IW3A 1DM0B 4BY1B 5EKKA 1DYQA 2VXWA 3S2HB 1ML0D 1B50A 4DAVA 4OIJA 2JA8B 4FVMA 1C8CA 3TP7A 4C1NI 3BDLA 1WTWA 1RODA 1XWEA 1CA6A 3PO3B 4K5WA 3GTPB 2A73B 2WACA 1HFNA 5KGUA 1XX8A 1LO5D 4IUPA 4R8NA 2QF7A 4L63B 1EU3A 1HA5A 1KLUD 4FF4A 1Q1EA 2F0MA 1J9OA 4KY7A 3VYUA 5I2XA 4ZQ3A 4A3EB 2E2DC 2OT2A 4OO1H 2LMCB 2HCCA 4KHVA 5A2QE 1HUNA 1UUPA 1ILQA 4BY7B 5AFWA 4ME5A 3W2DA 1KTKA 3TN2A 2PZUA 3S16B 4A3MB 4XT3B 5CBAE 4ZAIA 4L6TB 3J80E 4C3IG 1RKNA 2M9VA 1QE6A 5KRUA 3MWYW 4KY5A 2MPMA 1BO0A 2B2TC 5KYIA 2LS01 1SNPA 1OXVA 4QIWB 5JJZA 1ESFA 4O42A 4CGYB 1I4HA 3VR3A 4FF2A 5F2DA 2E2IB 4ULLA 1B53A 1Y8OB 2I46A 3ITPA 2XVSA 4L8JA 2NUCA 2SNSA 2JSOA 1BDOA 1SJHD 4IN3A 1PTOH 3QOJA 1GUTA 3VYRA 3LWEA 2NWGA 5D3DA 3I4MB 1EWHA 4ILWA 2KEDA 4OO1G 4ZUIA 5BN3A 3IAYA 3HP3A 3S14B 3M85A 1A2UA 3RMHA 5COYA 4H44C 5CORA 2O4XA 3N52A 1YNJD 1SFOB 1LT3D 2NB0A 2X69A 1QOHA 2R61A 3D4WA 1DJRD 1O7LA 3S1QB 1CI3M 1IHZA 1ZYRC 5M3MB 1QG7A 5I2YA 1WTVA 5ISRA 1DD2A 5E1FA 4E6IA 4HCEA 2EYLA 4PMBA 5CV8A 4IFDG 1GXDC 2JA5B 1JB3A 5EGTA 1EY0A 4XXEA 3NXWA 1S4ZA 3N6RA 1D6EC 4PQXA 1KNEA 5I9OA 2ZXPA 3SK6A 4KJOA 2F1MA 2DNEA 2EYPA 3K6OA 3PUZA 1CZGA 2F0QA 1STHA 2A69D 3K5LA 1HHVA 3TDQA 4J6HA 2K32A 1CHPD 2J0TD 3SE0A 1PTOC 2K6AA 1IL8A 3MAQA 3VR4A 1QCBD 1A3TA 4IQZA 5C4ZA 2JA6B 4XYOA 4XTCS 4TRDA 2HDMA 4RHSA 1CQVA 1EY9A 1I6VC 1BCPD 5M5WB 2BE5C 1IYVA 1PRTC 1I4PA 4CJ1B 1UAPA 4EQNA 2KEEA 1HQRD 1FR3A 3Q0AA 2Q8TA 2B2YC 3SDZA 3L7ZC 1ILPA 3NWTA 1O80A 4WFN3 1BR9A 3RLFA 1HUMA 4RGTA 3SK5A 1B44D 2BA0A 4O1NA 3H3VC 4DFAA 4IUTA 1JC7A 3OIPA 1MGSA 1ZKOA 1F9RA 4KKUA 1V1OA 1DZ1A 4F7XA 3DEOA 2AUKA 3R93A 1CFMA 1ENAA 1STBA 2ID0A 3SR1A 1EY8A 4X3UA 3T56B 2ZXRA 1U4MA 1W6KA 2Z8LA 3BYYB 4BBRB 2PZWA 1V43A 1TS2A 3FVQA 3HS0C 4KKTA 2MP1A 1TWGB 1VMCA 1ET9A 2DN8A 5K36H 4ZK9B 2XRSD 2AQ1B 5ELCA 4V190 1OXUA 2NVQB 1MD2D 3ND8A 4XIGS 4BBSB 3HKZB 1JORA 2E75C 1B2TA 2MGSA 2K05A 2F0LA 4DAPA 1F77A 2C5CA 2K1BA 2NZ1D 1V1PA 1CA5A 1WTPA 1F2ZA 1D5ZC 1CQFA 4IUUA 3PIP3 2XIWA 5E4XA 4CKBA 1RDPD 4C56C 1VCIA 1G91A 4TKOB 1F2YA 4Z9CB 5EPLA 5EQ0A 4X3KA 5J1ZA 3T16A 3OWFA 1QJOA 1A3UA 1STEA 4RHRA 1SEBD 5DM73 5NUCA 2K7VA 1B4OA 3MC0B 4I65A 3SK8A 4C2MB 1BF4A 2EJMA 2WAQB 1JWUD 4B9XA 5K36G 1EIGA 4KKSA 1CZWA 4Q0FA 3P75A 4M8AA 1YNJC 3G7LA 1AN8A 1LTBD 3Q23A 2B2WA 3O13A 2KOLA 1CTMA 3I3CA 1NUCA 1YNND 5ELDA 4LMQD 2R6GA 4RGMA 4LAAA 3S1NB 1Q1BA 5CV9A 1G2SA 4HSVA 3I91A 1EYCA 2VNUD 1F2MA 4AYBB 5KYLA 3KBGA 3I70A 1AEXA 1STGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZQ A;  1B2T A;  2B2U A;  4X3S A;  1NAP A;  1JIC A;  1NR4 A;  2HDM A;  2JYO A;  2MGS A;  2K05 A;  3LWE A;  2K28 A;  2N88 A;  2VXW A;  1CM9 A;  1ML0 D;  2NWG A;  2Q8R E;  4RWS C;  1AP0 A;  3D6W A;  2RA4 A;  1B50 A;  4OIJ A;  3I8Z A;  4QUC A;  1JE4 A;  2K1B A;  2NZ1 D;  4CJ2 C;  1WTQ A;  1G6Z A;  1TVX A;  1SAP A;  1HFG A;  1C8C A;  2KVM A;  1CA5 A;  2KED A;  2KUM A;  2M2L A;  3IL8 A;  1WTP A;  1NCV A;  1PFB A;  2RVL A;  1XYI A;  4IUU A;  4CJ1 B;  1U4L A;  2XIW A;  2B2W C;  1ROD A;  3ONA B;  5E4X A;  1WTW A;  1CA6 A;  1DOM A;  1F9Q A;  1DOK A;  2B2V C;  2FHT A;  1G91 A;  2HDL A;  1B3A A;  1PDQ A;  1HA6 A;  2EE1 A;  4R8I A;  4DN4 M;  3HP3 A;  1O7Z A;  5EPL A;  3SVM A;  1HFN A;  2KEE A;  5EQ0 A;  4OIK A;  5T1G A;  4X3K A;  2B2T A;  2K04 A;  2L1B A;  4XT1 B;  1XX8 A;  2Q8T A;  5COY A;  2B2Y C;  1MSG A;  1HRJ A;  2BDN A;  4IUP A;  5COR A;  3N52 A;  1IKM A;  2L4N A;  4RAU C;  1MI2 A;  2J7Z A;  1ILP A;  1ESR A;  1ICW A;  1NR2 A;  3GV6 A;  2L12 A;  1RTO A;  1O80 A;  2X6G A;  3FPU B;  2X69 A;  1J9O A;  4QUF A;  1WVL A;  1EL0 A;  1WTX A;  4XDX A;  1WTR A;  1HUM A;  4CJ0 B;  1HHV A;  4NW2 A;  4ZKB B;  1QG7 A;  1X32 A;  1EQT A;  2IL8 A;  2HUG A;  1WTV A;  2HCC A;  3I90 A;  3FDT A;  1U4P A;  1B4O A;  2RSN A;  1F9S A;  2K01 A;  3KUP A;  1M8A A;  4IUT A;  1HUN A;  4IUV A;  5D65 A;  1BF4 A;  1MGS A;  3GV3 A;  1EOT A;  1RHP A;  1F9R A;  1RJT A;  4HED A;  1O7Y A;  2L11 A;  5EPJ A;  1ILQ A;  1BBX C;  5E4W C;  1DZ1 A;  1EIG A;  1DOL A;  5AFW A;  3H91 A;  3TN2 A;  1KNA A;  3DEO A;  2L9H A;  3IFD A;  1S4Z A;  1QNK A;  3DEP A;  4XT3 B;  4U68 A;  5CBA E;  1KNE A;  3G7L A;  2K03 A;  4ZAI A;  3R93 A;  1MSH A;  1E0B A;  1LV9 A;  2N55 A;  2NYZ D;  3UI2 A;  1X3P A;  2FFK B;  1F2L A;  4ZLT F;  4X3U A;  1RTN A;  2B2W A;  5EJW A;  2DY7 A;  4HAE A;  2B2V A;  4HCS A;  2MJ8 A;  1QE6 A;  2KOL A;  4X3T A;  2FMM A;  3MWY W;  1U4M A;  2EPB A;  2MPM A;  3I3C A;  3Q6S A;  4MN3 A;  1BO0 A;  4MHE A;  4RA8 A;  2B2T C;  5T1I A;  5DNF A;  1WTO A;  3P7J A;  2B2U C;  3QO2 A;  4LMQ D;  1A15 A;  5JJZ A;  2EOT A;  2B2Y A;  5CMD A;  4IUQ A;  2SDF A;  5EKI A;  1ZXT A;  1J8I A;  1BNZ A;  1SSO A;  1PFN A;  3MTS A;  3F2U A;  1X3Q A;  1PLF A;  2CVR A;  4O42 A;  5CBE E;  2JP1 A;  1PFM A;  2D9U A;  2DY8 A;  2MP1 A;  5D14 A;  2X6L A;  1VMC A;  1AZP A;  1WD0 A;  2KEC A;  1G2S A;  1SDF A;  4R9W A;  4HSV A;  4ZK9 B;  1WD1 A;  5EPK A;  3DM1 A;  1IKL A;  1Q3L A;  3I91 A;  1B53 A;  2FIN B;  1IL8 A;  1U4R A;  1F9P A;  3KBX A;  2R3Z A;  2RSO A;  2HCI A;  1EIH A;  4UAI A;  4IUR A;  4ZKC B;  2H1E A;  3TZD A;  1DON A;  2FJ2 A;  1GUW A;  1VMP A;  1G2T A; 
#chains in the Genus database with same CATH topology
 2XN9 C;  5GAH C;  3HOW B;  1GUN A;  3CCQ A;  3L3O C;  2RHS B;  3X3M A;  1W2B A;  3K7A B;  2R7Z G;  1D5X C;  2OTJ A;  3HOX G;  1HNX Q;  1EU4 A;  3HOV B;  2KCN A;  2A69 C;  5CV4 A;  4DAY B;  4QIW E;  2KVM A;  1RD9 D;  4YWM A;  4JV5 Q;  3OMG A;  3RLO A;  2MNA A;  3TEH B;  2FHT A;  1CKN B;  3JAM L;  4IFD J;  2F0N A;  2MHV A;  2PQE A;  1LTG D;  5IIF A;  1WI5 A;  1IL2 A;  1B3A A;  1HA6 A;  4ABN A;  3PIO A;  1QWY A;  1EWC A;  4R4O A;  5T1G A;  4KI0 A;  4CKC A;  3V05 A;  4Q5V A;  1IKM A;  2L4N A;  4OWX B;  1TWH H;  2J7Z A;  5FJ8 H;  2R7F A;  3E5S A;  5DEH A;  1FNU A;  1BCP C;  2ZJQ A;  2F0E A;  1UWV A;  3NTH A;  4F88 A;  1YEZ A;  4DNR B;  2EY1 A;  3GO5 A;  1VQ4 A;  4MZ9 A;  1SE8 A;  1JOQ A;  2K01 A;  3AYH B;  2A74 C;  3RR5 A;  1N9W A;  5D65 A;  3PIO 3;  4JCV E;  1VQG A;  3PV0 A;  1II3 A;  2YU9 H;  1TQO A;  3NBH B;  3GTL B;  1BBX C;  3OMC A;  5E4W C;  1JB7 A;  4A93 G;  4J8Q A;  1H9K A;  4GKJ L;  2DUD A;  1Q46 A;  3QR8 A;  1QNK A;  5CV6 A;  4DR5 L;  4A3J B;  4DR3 Q;  3E9H A;  1A62 A;  2F4V L;  1H9J A;  3KF6 B;  1X3P A;  3DWQ A;  4PZ6 A;  5GAD C;  3J7A F;  1JJG A;  1K3B C;  1UEA B;  3ULJ A;  2BA1 A;  3Q24 A;  1ET6 A;  1PA6 A;  5C0X J;  2ZM6 L;  1XPU A;  4JI2 L;  4V0B A;  3ICE A;  3AU7 A;  3OTO L;  3GTM H;  1A15 A;  2EOT A;  1EWI A;  2SDF A;  2HIX A;  4XQJ A;  1PFN A;  4KTA A;  1PTO D;  4K0K L;  2HD3 A;  1KC8 C;  4MTN A;  4JI7 L;  1EZ6 A;  5IGB A;  1N34 L;  5BR8 Q;  4LF4 L;  4S3S A;  1TY0 A;  1VF5 C;  1I50 B;  1QZH A;  4L5R C;  4IJH A;  1SYF A;  1X6O A;  3K58 A;  4C3I B;  5KNC A;  1XMQ Q;  1RL2 A;  4NKL A;  4YWL A;  3NUC A;  4KLK A;  1SE3 A;  5FJ8 G;  4A75 A;  2KHS A;  1VQH A;  1TII D;  3I8Z A;  3KLS A;  2EY6 A;  3A74 A;  1VQ7 A;  1MHW C;  3CME A;  1QB5 D;  1SAP A;  2WB1 E;  1WTQ A;  2IX1 A;  2N49 A;  1HH2 P;  3IL8 A;  4DR2 Q;  4FP5 D;  1LAB A;  5CR3 A;  2B3G A;  2K5H A;  2SOB A;  2O5J C;  3SGI A;  2AKW B;  3CP0 A;  1XPR A;  1JR0 D;  2PNR C;  2DGY A;  1I50 H;  2NTS A;  2HHH Q;  3SVM A;  2F0D A;  3VR6 A;  4DV7 L;  2K04 A;  3WDN A;  3K5O A;  1K8A C;  1YBY A;  3GTJ B;  5G3L F;  2KBN A;  4DV5 Q;  3C1F A;  5JOB A;  3FMC A;  4DAM A;  4APV A;  1EEF D;  2EYJ A;  2UU9 Q;  3TS2 A;  2JE6 I;  3A8J E;  3GTQ B;  3EQL C;  2A5H A;  2Z0S A;  1ONL A;  1FVI A;  3KF8 A;  5LMN Q;  3M3Y B;  4JBK A;  3I4O A;  1RJT A;  3EFX D;  1O7Y A;  1O78 A;  1D5M C;  5C3E B;  1OXX K;  4A3J G;  3M4Y A;  3MXP A;  3J7Z C;  5JAV A;  2KCM A;  2F3I A;  4XQQ A;  2DNC A;  3ER0 A;  2DJG C;  3ERS X;  4GZY C;  1HNZ L;  4JI4 Q;  4DXF A;  2N8N A;  4JI0 Q;  2YTY A;  5DLQ E;  1CSP A;  3J80 L;  3TP8 A;  1EQV A;  1Y8P B;  1Q12 A;  2AHO B;  2R93 B;  1X3G A;  3BDC A;  4DF7 A;  1WTO A;  3NTK A;  1JMC A;  1KDC A;  3K81 C;  4JBW A;  2RQX A;  4B3M Q;  1EY6 A;  1JOK A;  2PW7 A;  4OXP A;  4A3I B;  4X6A H;  1X54 A;  4EVO A;  1C4Q A;  1N36 L;  1BKB A;  2CKZ B;  5JJL A;  2UXC Q;  2TMP A;  2KEC A;  2VQE Q;  4B3T L;  3IFT A;  2HT1 A;  4RH6 A;  3A7A B;  4DNT B;  5HGT A;  3C46 A;  2GN5 A;  1BQQ T;  2Z6K C;  1F9P A;  3PUX A;  4X62 Q;  2B39 A;  1X3E A;  3TBI B;  1PTO B;  3F1Z A;  1R4P B;  1DON A;  5IT9 L;  4OEL B;  4DUZ Q;  2MO1 A;  3K0Y A;  1YHA A;  3AFQ A;  1H9S B;  1NR4 A;  1YNN C;  2K28 A;  2JEB I;  2N88 A;  4HJ5 A;  2RA4 A;  3VA7 A;  1JE4 A;  3GD7 A;  4A3G B;  4GKK Q;  2A6H C;  3UDI A;  1Y1W H;  1GUS A;  4OO1 I;  1XYI A;  1D1I A;  1EUJ A;  5EAY A;  5ELO A;  5I6W A;  3I73 A;  2KCT A;  2B63 H;  1PRT B;  4NP5 A;  3IRB A;  2B2V C;  2NVT H;  4N9T A;  5C5L A;  4HMI A;  4K8J A;  1YJ9 A;  2EE1 A;  2K5W A;  5M9O A;  2E74 C;  2RHQ B;  4XT1 B;  4GOP B;  1D8L A;  3HKZ E;  4BWG B;  5BN4 A;  4KHZ A;  1ICW A;  3BG3 A;  1NTG A;  4L5Q A;  1VQE A;  1WVL A;  5JEA J;  4LF7 Q;  3A7L A;  4CJ0 B;  2CCZ A;  3QOL A;  2E2H B;  4NW2 A;  1QZG A;  4GLV B;  1I4X A;  1DCZ A;  2IL8 A;  1IYU A;  4K5V A;  2C35 B;  1F9S A;  3CMA A;  4IUV A;  2NVX B;  3MEH A;  2XTI A;  5IGC A;  4IO9 A;  1FJG Q;  1SE2 A;  2K14 A;  5KIX A;  2L11 A;  4JI1 Q;  4IFD I;  4H7B A;  4PMW A;  3IFD A;  3K7U C;  4LWC A;  2F0V A;  3NPP A;  3CAM A;  2B8F A;  5FKA C;  5JVH 3;  1MSH A;  1E0B A;  1JWS D;  4JBJ A;  5IWA Q;  4FF1 A;  2NYZ D;  2PQA B;  2OF1 A;  5IGE A;  1C7Y A;  2E2J H;  1V8Q A;  2R93 G;  5E3F A;  3H6M A;  1VQK A;  1LTA D;  1IZ6 A;  1RF2 D;  4PV1 C;  2XRQ D;  5IP9 G;  1N32 L;  2EY2 A;  3A54 A;  2AQ3 B;  5CMD A;  1QVF A;  3MXN A;  3BZD B;  1UNS A;  3EA6 A;  1HPC A;  1Y1W G;  2JP1 A;  5D14 A;  1KDB A;  3HFZ B;  1SR3 A;  3H0G B;  5IGG A;  3J80 i;  4X65 L;  3T1H L;  1WD1 A;  1PXU A;  1IBL Q;  1Q3L A;  3MFY A;  2UU9 L;  1STA A;  4LF5 Q;  2VUM B;  2FIN B;  3TP5 A;  1B3Q A;  3P20 A;  5C4X B;  5LMN L;  3KK7 A;  1EQR A;  3M4O B;  4JVZ A;  2GA4 B;  2F0J A;  4JK1 C;  2F0O A;  1A2T A;  2NTT A;  2LKV A;  1XJV A;  2ZJR A;  3G4S A;  4KHP Q;  2WB1 B;  2AWN A;  1CM9 A;  2WP8 J;  4QL5 A;  3KJP A;  1LTL A;  3GTO H;  1PH1 A;  5IP7 H;  1Z9F A;  5C0X I;  4B3S L;  1G6Z A;  5JPN C;  1T5E A;  2BH2 A;  5LL6 X;  4LF8 Q;  1PFB A;  2RVL A;  4P74 A;  1N8R C;  1OTC A;  1CK1 A;  3J81 j;  4DK3 C;  3GP7 A;  4RKL A;  1GUG A;  2VUM H;  2K52 A;  4DV4 Q;  2HDL A;  4K2L A;  3NEL A;  1OO9 B;  4AH6 A;  3GTG H;  3T1Y L;  1O7I A;  1OXT A;  2K33 A;  1HR0 Q;  2V1C C;  2JA7 B;  1VQJ A;  4HJ8 A;  1SXT A;  4RKB A;  3KF8 B;  2UXC L;  4QF4 A;  3W5O A;  4AQY Q;  5FLX L;  1RTO A;  1EIY B;  5C5M A;  4IUN A;  1VQN A;  3LNN A;  2F3W A;  2KHJ A;  2F3V A;  3I4N B;  3S17 B;  2G9D A;  2ATW A;  4HN7 A;  4UY8 C;  3SHL A;  2BCO A;  3UDG A;  3GTK B;  4Y7N B;  1M8A A;  1EYD A;  4TVA B;  4J1M A;  2MUY A;  1RHP A;  4LK1 C;  1BVS A;  4A4I A;  4DAY A;  4RGO S;  1B7Y B;  2Z1C A;  3NQI A;  2ZTE A;  1BBW A;  4HR7 B;  3M7G A;  1K83 H;  1TS5 A;  1XMO Q;  2MFI A;  1CKN A;  3DWP A;  2IT1 A;  1TS4 A;  3QJY A;  2N55 A;  3D4D A;  2F0U A;  2ICI A;  1I6H H;  5DAU A;  3FRP B;  1NJI C;  3DMU A;  4DR1 Q;  5DNF A;  4DR4 Q;  4NXM L;  3GTK H;  4Y7N H;  2OQK A;  5IP7 G;  5C4H A;  3MXG A;  3G6J B;  2SEB D;  1J8I A;  2CVR A;  1PLF A;  2PO4 A;  3QG1 A;  5JVG 3;  1YIT A;  1TY2 A;  4LF6 L;  4LF7 L;  1KLG D;  3NK9 A;  1E1O A;  2QCP X;  3S2D B;  2VUM G;  4A3D B;  2RDF A;  5L37 A;  1J5E Q;  2KCC A;  2O2L D;  2OQ0 A;  3HG9 A;  2L5T A;  3AMU A;  3NWS A;  1VQC A;  3NBH A;  1Y69 U;  2D0O A;  2V4D A;  2BH8 A;  1IBM Q;  1HNW Q;  4FNF A;  1ICF B;  1TVX A;  3NP8 A;  1E22 A;  4I7A A;  3TME A;  2EJG C;  1LTR D;  3S15 B;  3PIP A;  1HQM C;  1DXM A;  2PMZ B;  3ONA B;  2E76 C;  2K5Q A;  2RF4 A;  4WRD A;  3S1M H;  1UEB A;  2OTL A;  1KIX A;  1Z6H A;  5LMN W;  3C3L A;  3B6Y A;  2AQ2 B;  2HQE A;  1S3O A;  1XPO A;  2JEA I;  3W1B A;  3WOF A;  2B2T A;  2ZJP A;  3KLW A;  2R92 B;  1FD7 D;  1YJN A;  2ZXO A;  2I5M X;  1CUK A;  2IX3 A;  4HJA A;  4LF9 Q;  1Q7Y C;  4R4T A;  3LWU A;  3RZD H;  2R7Z B;  4POF A;  3HOX B;  2BDO A;  1W6J A;  1SMX A;  2P5Z X;  5I4D A;  1EY7 A;  1GKH A;  2NVY B;  4ZKB B;  4O2D A;  3K57 A;  2A8V A;  5D3I B;  4AIM A;  1BCP B;  5BN5 A;  3CC4 A;  1XNQ L;  2Z4I A;  3PUV A;  4KHP L;  5CV5 A;  1WCM H;  3C2P A;  5LL6 S;  4K2K A;  4UP9 A;  3CRK C;  4OWT B;  2R92 H;  1DOL A;  1PYS B;  1PH5 A;  3CCU A;  2IX0 A;  1OXS C;  1PH9 A;  3DEP A;  1M4V A;  4EQP A;  4LFC Q;  2AMC B;  4HAE A;  3U50 C;  4DU9 A;  2RDG A;  3W3A A;  1JOO A;  5ELB A;  5A35 A;  4A3K H;  4G4K A;  2F4I A;  4LFA L;  3R3O A;  1TWF B;  2QDB A;  1CHQ D;  1LAC A;  5EKI A;  4G7Z C;  2YTX A;  2VZA A;  1PFM A;  2D9U A;  3TS0 A;  4A93 B;  3J7A V;  4IAL A;  3ZYY X;  1STN A;  1Z47 A;  4PG3 A;  1L2F A;  3HKS A;  3OSO A;  3VA5 A;  4DR6 Q;  1TWC H;  2RSO A;  1SE4 A;  3D31 A;  4IUR A;  3J81 L;  3EJI A;  1C48 A;  1VMP A;  4BS9 A;  3T4A C;  3D3R A;  4X3S A;  4H13 C;  1STY A;  4MNO A;  4ODG A;  2A6H D;  3MFG A;  2ICE C;  3NHH A;  1U4L A;  4ZRZ A;  4YHH Q;  2ZTD A;  4I7Z C;  4FXK C;  1SNO A;  1C0A A;  2LFN A;  1YHQ A;  5IYD H;  1WCM G;  5M3F H;  3T51 B;  1O7Z A;  4P2C B;  5C44 H;  4A76 A;  1QNU A;  3UDF A;  2R92 G;  4KN4 C;  2MQH A;  1AW7 A;  1TWH B;  3BDO A;  1NMG A;  1RIP A;  3VYT A;  1YI2 A;  2X6G A;  1KAA A;  2F0W A;  1EL0 A;  2LXJ A;  4B08 A;  3PO2 H;  2EYF A;  2YV5 A;  2Z6B A;  4A3K G;  3PSI A;  3J7Y W;  3I90 A;  1H9S A;  3FDT A;  5C4J B;  2RSN A;  3KUP A;  5GAE C;  3OW7 A;  2BOS A;  2YU9 B;  2F0P A;  1EOT A;  3E9I A;  5EBC A;  2KHI A;  4IZ8 A;  2KEN A;  1ENF A;  3K59 A;  2RDH A;  5IOC A;  2XGT A;  3A55 A;  2L55 A;  2FMC A;  3NQT A;  2M00 A;  1B8A A;  1PH2 A;  1SYB A;  2NN6 H;  3QWN A;  3D4R A;  4POG A;  3K0X A;  4FXD A;  1Y8N B;  3UI2 A;  1SBB B;  1XNR Q;  3VYS A;  2F0S A;  1S5E D;  5M5Y H;  5KNB A;  4GOP A;  3DHQ A;  4JYA L;  1J6Q A;  1SMY D;  5ELN A;  1GJX A;  1S72 A;  2Q2U A;  4LFB L;  4DR7 L;  2RKS A;  3GTM B;  1K9M C;  5C4J H;  3PF4 A;  3RZO B;  2B2Y A;  4IUQ A;  4NXN L;  3DM3 A;  4RCN A;  5FO9 B;  3JAM E;  2IWH A;  1H9R A;  1E2V A;  4JI3 L;  1KDA A;  2F0F A;  5IYD G;  5M3F G;  5C44 G;  1W3S A;  5JPM C;  2HCI A;  2G5D A;  2EY5 A;  4OGQ C;  4LNQ A;  4NPS A;  1BOS A;  1N33 L;  2CFM A;  1KRS A;  1YZ6 A;  1HR0 W;  4LUO A;  1G2T A;  4DV3 Q;  2JYO A;  1DGS A;  3ND9 A;  3R2I A;  2UUB Q;  4K14 A;  4K6L A;  4DUY Q;  4PMC A;  3RZO H;  4XYQ A;  3PO2 G;  2PQA A;  1R9T H;  4GNX B;  3J81 i;  1X65 A;  2KUM A;  2M2L A;  5I9P A;  3I2Z A;  2UXD L;  5JJI A;  4X66 Q;  5G3L D;  1HZ9 A;  3PMF A;  1DOK A;  2XWJ B;  3Q22 A;  4OX9 L;  3STB D;  3KYH C;  4R8I A;  1JCK B;  4YIJ A;  4QY7 A;  1KRT A;  1HRJ A;  1KAB A;  1TKW B;  3BS1 A;  1MI2 A;  3PGZ A;  4KD3 A;  1ESR A;  5K5P A;  2NN6 G;  1B9M A;  3FPU B;  3KLS X;  5J39 A;  4PNY A;  3NBI A;  1Q81 C;  1BXT A;  3R8B A;  2IHF A;  3CCR A;  2SNM A;  1LLR D;  3MXU A;  2EXZ A;  1PYB A;  1Q90 A;  4DXG A;  3RUZ A;  3CF5 A;  3A8I E;  1D7Q A;  2RCF A;  2VS1 A;  1IYJ B;  1K3R A;  2QA4 A;  5EBD A;  1FGU A;  1VQ9 A;  4JI6 Q;  3R2T A;  4A3L H;  1QUQ A;  2F0H A;  1CT1 D;  2QEJ C;  2EQS A;  5M5X H;  1F2L A;  1GOZ A;  4HCS A;  1PZK D;  3AFP A;  1BBU A;  1I4G A;  4OEM B;  1PTO F;  5CGK A;  1E24 A;  3Q8D A;  3QO2 A;  1UE5 A;  4G57 A;  4FO2 A;  1HNX L;  5A2Q L;  1H9M A;  1VDZ A;  1U0L A;  5HUR A;  4B3R Q;  4A3C H;  1SNQ A;  4JV5 L;  3E0J A;  2EXD A;  4L5T A;  4C3J H;  2DJF C;  2IJ0 A;  2NBF A;  2Y0S G;  1EY5 A;  2D2C C;  3HOU H;  2O5I C;  1EIH A;  2B8G A;  4QCL A;  4R1J A;  1PRT F;  2PCF B;  4DV0 Q;  4DNI A;  1PYW D;  5ELF A;  4C3H H;  3DWA A;  1G8Z D;  4EX5 A;  4N8X 1;  2WV6 D;  4QB4 A;  3CRL C;  3S2H H;  2JA8 H;  1Y1W B;  5H1S E;  3KFU A;  1VF7 A;  2B63 B;  3I7F A;  1HTP A;  2YTV A;  4HSP A;  2NVT B;  2G9H D;  1DOM A;  1F9Q A;  3P1H A;  2D5D A;  3PO3 H;  2CQO A;  1NE3 A;  3GTP H;  4JG2 A;  1Q8I A;  4ALP A;  4ZYS A;  3CCM A;  3IKJ A;  1GUO A;  4NDX A;  3EBE A;  2F0I A;  4A3L G;  4KY6 A;  3CPF A;  4GNX C;  5HY6 A;  5C3W A;  1PMR A;  1KQS A;  5C6A A;  1C9O A;  2EVB A;  4DR3 L;  1EZ8 A;  1HCZ A;  3DXJ C;  5FOB B;  1WTR A;  4BA1 I;  2L15 A;  2PYK A;  1KAW A;  3F2D A;  4A3E H;  3K80 C;  2EZV A;  4OON A;  2TSS A;  5IE8 A;  3HRZ C;  1S5B D;  2PMZ E;  1PZI D;  1FGB D;  3GV3 A;  3U58 A;  4A3C G;  1HTL D;  2OEO A;  4UHV A;  4JBM A;  1SYC A;  3ZJY C;  4C3J G;  3U4Z A;  1AFP A;  4BY7 H;  5CC4 A;  4IFD H;  3UDX A;  5BR8 L;  4U68 A;  3S16 H;  3E6Z X;  3HOU G;  4QQB X;  4A3M H;  1SRU A;  4GS3 A;  2CH4 A;  1LV9 A;  1IW7 D;  5IT9 E;  4FF3 A;  2E2J B;  4DA2 A;  4C3H G;  3FEW X;  2D0P A;  4DK0 A;  2DY7 A;  1XMQ L;  3U9O A;  1LT6 D;  4DGZ A;  1TS3 A;  4MIU A;  1XTC D;  2B2U C;  3AQQ A;  2JA8 G;  3D6C A;  3RLN A;  1BNZ A;  3PUW A;  1X3Q A;  4CKE A;  2CHB D;  2DY8 A;  3J7A 5;  1AZP A;  4DR2 L;  2F0G A;  4HID A;  3S1R B;  1SDF A;  1SNC A;  3DUZ A;  1IKL A;  3PO3 G;  3MZ5 A;  2E2I H;  1R4Q B;  1L1O C;  2R3Z A;  2HHH L;  2A1A A;  1IBK Q;  1KHI A;  2FJ2 A;  1GUW A;  3BZC A;  2H4O A;  2LSS A;  3RN5 A;  4JOI C;  1SMY C;  4X64 Q;  3NE5 B;  1I94 Q;  4BA2 I;  1LT5 D;  4CBV A;  3GTO B;  1TT2 A;  3HGB A;  1K8O A;  4DV5 L;  4QUC A;  3M7N A;  5FO7 B;  3TRE A;  5C0X H;  1RCV D;  5IOD A;  4XQN A;  4QGU A;  4A3E G;  2E5L Q;  2B63 G;  3I4M H;  3EVQ A;  5C3X A;  2LY7 A;  3S1R H;  1SYE A;  3L9A X;  1EFW A;  2B2W C;  2WKC A;  2ENB A;  3GTG B;  3QB3 A;  1ASY A;  1PDQ A;  2EYM A;  3BVM A;  3CU7 A;  1MJE A;  4OIK A;  3FKI B;  3S14 H;  4BY7 G;  2BDN A;  3CCE A;  2JA9 A;  4RAU C;  3MVV A;  3JAM c;  2QIL A;  2L12 A;  5FK9 C;  4A3M G;  2KA7 A;  5FLM H;  1SFO H;  4QUF A;  4KK7 A;  3TP6 A;  1WTX A;  4QMG A;  2A68 D;  2UUA Q;  2VQF Q;  2Q2I A;  4JI4 L;  1VQ8 A;  3S1Q H;  4JI0 L;  1E7Z A;  1QUQ B;  2VL6 A;  2A6E D;  5CV7 A;  2KJX A;  3SEB A;  1MKH A;  3OPO A;  5LMU Q;  4ZCK A;  3WOE A;  1FNV A;  2MO0 A;  1VQ5 A;  2E8G A;  3STB C;  3H3V I;  4B3M L;  2IY5 B;  2XNA C;  3AB9 A;  3FKI H;  1K83 B;  2YYZ A;  4FDB A;  2JA5 H;  2VQE L;  1PZJ D;  3A0J A;  2K03 A;  4X62 L;  4KD4 A;  1I6H B;  2MJ8 A;  4X3T A;  4DUZ L;  2EPB A;  4MN3 A;  3MEF A;  2PW5 A;  3RNU A;  3P7J A;  3K5M A;  3H94 A;  3X3N A;  4KV6 A;  5C0X G;  3MTS A;  3F2U A;  3I4M G;  1G51 A;  4GKK L;  3GQB A;  1YIJ A;  4BXX H;  1WD0 A;  3BVG A;  3OOC A;  4MTK A;  2Q2T A;  1SND A;  4HMJ A;  2JQO A;  1XTD A;  1LYL A;  5IGD A;  4PZ7 A;  1JJ2 A;  1PH3 A;  2I0Q A;  1LTS D;  4F87 A;  3PF5 A;  1HZA A;  3U9S A;  4DN4 M;  4C1N K;  3CKI B;  5FLX E;  1I4R A;  1NAP A;  3BYT B;  3VR2 A;  2JA6 H;  5FLM G;  1L0X B;  3PQI A;  2D62 A;  3TSS A;  1E3P A;  4DK6 C;  4DV1 Q;  1HFG A;  5M5W H;  4YY3 Q;  3HEJ A;  2WIN B;  4LUV A;  2C9O A;  1VQL A;  2L0C A;  4UP8 A;  3S1M B;  1T5X D;  1ZEQ X;  2I5L X;  4RCO A;  4G7H C;  2EJF C;  4TSS A;  3CC2 A;  4DV2 Q;  1BCP F;  2VB2 X;  3FKI G;  3NEM A;  2Y0S E;  1FJG L;  3T13 A;  1XXG A;  5KND A;  1VQI A;  4WJW A;  4R4I A;  4JI1 L;  2JA5 G;  2AWO A;  1D1K A;  2UXB Q;  5IY0 A;  3K5N A;  3H09 A;  3RZD B;  1EYG A;  2WKD A;  5DM6 3;  2OXP A;  3GV6 A;  2I5H A;  3CC7 A;  3E0E A;  5IWA L;  1JQY D;  1JE5 A;  2CW0 D;  1SLJ A;  3KLR A;  1X32 A;  2Z6K A;  5I6Y A;  1JWM D;  1L0Y B;  5KEE A;  1U4P A;  2A19 A;  5FO8 B;  1K0R A;  4X64 L;  1WCM B;  1EFI D;  1SNM A;  4RFB A;  3RN2 A;  1WOC A;  2UUC Q;  1EYA A;  4P75 A;  4BXX G;  5EPJ A;  4GNX A;  2E5L L;  1K8M A;  1GM5 A;  2IPK D;  2N78 A;  1IBL L;  1QIL A;  4LF5 L;  4UP7 A;  3G6E A;  2QKI C;  4EGV A;  2NZO A;  4ZLT F;  2B2V A;  4OWW B;  1HZC A;  3FPP A;  4A3K B;  2FMM A;  2JA6 G;  2JXM B;  4MHE A;  4RA8 A;  4BBR H;  5JEA H;  4WJ4 A;  1X56 A;  1E2Z A;  1ZXT A;  4CHT B;  1UE7 A;  3NEN A;  2WII B;  1X9N A;  2KQ3 A;  3ERQ A;  2X6L A;  3J80 c;  4LF8 L;  1Y1V B;  4GKJ Q;  1TWG H;  2LXK A;  4FXG C;  4U67 3;  1NNX A;  1TWC B;  4DR5 Q;  5TSS A;  4EQ5 A;  4B9W A;  1U4R A;  4DV4 L;  2F4V Q;  3BVZ A;  4UDU C;  1PH7 A;  1T9H A;  2H1E A;  3TZD A;  1IW7 C;  4ZKC B;  2NVQ H;  1VQM A;  1HR0 L;  3CD6 A;  2JJQ A;  4BBS H;  2ZM6 Q;  2L1B A;  4JI2 Q;  1A63 A;  2B2U A;  4Y52 H;  1VQA A;  3HOZ B;  3OTO Q;  4AQY L;  2Q8R E;  1UE1 A;  1AP0 A;  3D6W A;  1GHK A;  5IT9 c;  3TZU A;  4IOC A;  2EDG A;  1VQD A;  1QVG A;  1V9P A;  4JI7 Q;  1Y1V H;  1N34 Q;  4LF4 Q;  3MHB A;  2RBM A;  2PPB C;  2F0K A;  3OWE B;  5M3F B;  3F2B A;  3HZX A;  5C44 B;  1GHJ A;  3S9W A;  1AH9 A;  1MIU A;  2F52 A;  3M4P A;  1B1Z A;  1EQQ A;  5CYU A;  1LTT D;  3I72 A;  4F8M A;  4H02 A;  1XMO L;  3HOZ H;  5J22 A;  4WOR A;  4KN7 C;  4DKA C;  1SYG A;  3A56 A;  5LHY 1;  3CQZ B;  3PO2 B;  4R4Q A;  1CKO A;  3M4Q A;  1FYC A;  4G7O C;  2HUG A;  3QIA A;  4CDC C;  4BBR G;  5JEA G;  4DR1 L;  4DR4 L;  1Q8K A;  1S5C D;  1FNW A;  4HED A;  4DV7 Q;  3ERO A;  5IYB H;  4M1U B;  4GLA C;  1TWA B;  3VR5 A;  4OL7 A;  3H91 A;  1LT4 D;  2XWB B;  3A8K E;  2L9H A;  2ALY B;  2F03 A;  3ULP A;  1AE2 A;  2VW9 A;  1BUV T;  2ZT9 C;  3J81 E;  2J4X A;  1J5E L;  2Q8I B;  1KXL A;  4DK1 A;  3CQZ H;  5M5Y B;  3V96 A;  4BBS G;  2A68 C;  3URY A;  4IOA A;  5E7N A;  4K5X A;  5T1I A;  2A6E C;  2UXB L;  3NTI A;  1IBM L;  4JI5 Q;  1HNW L;  1I4Q A;  5EKL A;  5ELE A;  2QW7 A;  1SSO A;  2EIF A;  3D8G A;  4H0L C;  1SJE D;  3S1N H;  1Y1V G;  3T53 B;  1TWA H;  4R9W A;  1EY4 A;  3NSW A;  2I07 B;  1G29 1;  1JT8 A;  4NMZ A;  3ULL A;  5AJ3 Q;  3KBX A;  4TQU S;  3EIV A;  4KMU C;  3PUY A;  3RD4 A;  1YHB A;  1HNZ Q;  4NB3 A;  2UUC L;  1TR5 A;  3C1E A;  1PH8 A;  2K50 A;  2NZH A;  2AUJ D;  1AZQ A;  3HOZ G;  1JIC A;  1GO3 E;  4LF9 L;  4KJN A;  2Z4H A;  2QGQ A;  2RCN A;  3HOW H;  4N9P A;  4RWS C;  1B9N A;  3K7A H;  1R9T B;  4CJ2 C;  1ZYR D;  3CHB D;  4OHJ A;  3HOV H;  3MA2 B;  1N36 Q;  5HGQ A;  1NCV A;  1S5F D;  1Z7T A;  1WYD A;  2F0T A;  4B3T Q;  1NSN S;  1A6X A;  2Q2H A;  2Y0S B;  2EYH A;  3HOY B;  3AEV A;  1A3V A;  1S5D D;  1GVP A;  5IYB G;  2WAQ G;  4A3F B;  1EEI D;  4ZUJ A;  3CPW A;  1MSG A;  4FYD A;  4HTH A;  3S24 A;  1TU2 B;  4EQO A;  2XSC A;  2EYO A;  1NR2 A;  2NN6 I;  2N3S A;  3JC6 6;  3LX0 A;  4PZ8 A;  3F2C A;  3I4L A;  5JJK A;  4XDX A;  2CWA A;  4LFC L;  1EOV A;  1D2B A;  1U9R A;  3OHX C;  1EQT A;  2PZT A;  4N8F A;  2CQA A;  1GD7 A;  5FLX c;  3HOY H;  3SK4 A;  5IGF A;  3F8T A;  4YCV A;  1PFS A;  1SN8 A;  4A3F H;  3GDE A;  4RG1 A;  3SXH A;  3GTL H;  4LJZ C;  4A3B B;  1KNA A;  3UE0 A;  1MBY A;  4JC0 A;  3M9B A;  4DR6 L;  1V1P B;  5M5X B;  3CCV A;  4A3J H;  4K6D A;  2FFK B;  3OIQ A;  4DV6 Q;  1RTN A;  4AYB G;  5EJW A;  2CW0 C;  4RGN A;  1PHJ A;  2VB3 X;  3Q6S A;  1H95 A;  3HOW G;  2BE5 D;  1PRT D;  3HOV G;  1HXY D;  1K28 A;  3V2T A;  1LTI D;  4YWK A;  5CBE E;  2ASB A;  3LGJ A;  4C3J B;  4ID6 A;  4LW1 A;  3A5U A;  4A3B H;  4YHH L;  5EPK A;  3DM1 A;  4K8I A;  3HOU B;  1I3Q B;  1SYD A;  2R7D A;  1ENC A;  1G6P A;  2K5D A;  4UAI A;  4C3H B;  1E2W A;  3G48 A;  4C3I H;  2IW3 A;  1DM0 B;  1K73 C;  1L1O B;  4BY1 B;  4JW0 A;  5EKK A;  4P73 A;  1DYQ A;  2VXW A;  3S2H B;  1N32 Q;  1ML0 D;  1B50 A;  4DAV A;  1V1Q A;  4OIJ A;  2JA8 B;  1NY4 A;  3JAM i;  4FVM A;  1SRO A;  1C8C A;  3OYY A;  3TP7 A;  4C1N I;  4P72 A;  3BDL A;  4X65 Q;  3T1H Q;  1ROD A;  1WTW A;  3HOY G;  3TRZ A;  1XWE A;  1CA6 A;  1VQB A;  3PO3 B;  4K5W A;  1I3Q H;  3GTP B;  2A73 B;  2WAC A;  4JI5 L;  3OW2 A;  3CCL A;  1HFN A;  4A3F G;  3EN2 A;  5KGU A;  1XX8 A;  3KDF B;  4JPB W;  3UE1 A;  1LO5 D;  4IUP A;  4BY1 H;  4RMF A;  4R8N A;  2QF7 A;  4L63 B;  1EU3 A;  2HQL A;  3FP9 A;  1HA5 A;  1PV4 A;  1KLU D;  4FF4 A;  1Q1E A;  2F0M A;  1J9O A;  4KY7 A;  3VYU A;  3GTJ H;  4B3S Q;  3I55 A;  5AJ3 L;  5I2X A;  2JN4 A;  4ZQ3 A;  4A3E B;  1XNR L;  2E2D C;  2OT2 A;  4OO1 H;  4O0A A;  2LMC B;  1EIF A;  3E3X A;  2HCC A;  4KHV A;  5A2Q E;  1HUN A;  1UUP A;  3GTQ H;  2HIV A;  3CCS A;  4J15 A;  3T1Y Q;  4IPC A;  2GVB A;  3M3Y H;  1ILQ A;  4BY7 B;  4A3B G;  5AFW A;  4ME5 A;  3W2D A;  1KTK A;  3TN2 A;  2PZU A;  5C3E H;  3S16 B;  3KJO A;  3FHW A;  4A3M B;  4QJF A;  4XT3 B;  5CBA E;  1VQO A;  4ZAI A;  4L6T B;  3DLL A;  3J80 E;  4C3I G;  1RKN A;  2M9V A;  1QE6 A;  5KRU A;  2JK8 A;  3MWY W;  4KY5 A;  2MPM A;  2GVA A;  4CDD C;  4DV3 L;  1BO0 A;  2B2T C;  5KYI A;  2UUB L;  1VQ6 A;  2LS0 1;  2R93 H;  1SNP A;  1OXV A;  4QIW B;  5JJZ A;  3L0O A;  4DUY L;  1A8V A;  5IP9 H;  1ESF A;  4O42 A;  4CGY B;  3BJU A;  4A3I H;  1I4H A;  3VR3 A;  4X66 L;  4FF2 A;  5F2D A;  2E2I B;  1I5F A;  4ULL A;  3I56 A;  1CSQ A;  1B53 A;  1Y8O B;  2I46 A;  3ITP A;  2XVS A;  4L8J A;  2NUC A;  2SNS A;  2JSO A;  1BDO A;  1SJH D;  4IN3 A;  1PTO H;  2OWO A;  4BY1 G;  2QEX A;  3QOJ A;  1GUT A;  3VYR A;  3LWE A;  4NXM Q;  2NWG A;  2K5N A;  1KD1 C;  3J81 c;  3CXC A;  5D3D A;  4LF6 Q;  3I4M B;  1EWH A;  4ILW A;  2KED A;  1U5K A;  4OO1 G;  4DV6 L;  4A3G H;  4L5S A;  4ZUI A;  1A0I A;  5BN3 A;  3L2P A;  3IAY A;  2ZTC A;  3HP3 A;  3S14 B;  4IPD A;  1K0S A;  3M85 A;  1A2U A;  3RMH A;  5COY A;  4H44 C;  5COR A;  5C3E G;  2O4X A;  3N52 A;  1AE3 A;  1YNJ D;  4JI6 L;  1SFO B;  1LT3 D;  2NB0 A;  1Y14 B;  2X69 A;  3BU2 A;  1NBW A;  1TXY A;  1QOH A;  2R61 A;  1HJP A;  3D4W A;  1DJR D;  1O7L A;  3S1Q B;  1CI3 M;  1IHZ A;  1ZYR C;  5M3M B;  2WFW A;  1QG7 A;  1WJJ A;  5I2Y A;  2K5V A;  2E2H H;  1WTV A;  5ISR A;  1DD2 A;  5E1F A;  4E6I A;  3PCO B;  1WTH A;  4JI8 Q;  4HCE A;  2Z9H A;  2EYL A;  2NVX H;  4PMB A;  4A3I G;  3H3V H;  5CV8 A;  4IFD G;  4B3R L;  1GXD C;  2JA5 B;  1JB3 A;  4HJ9 A;  2WAQ E;  5EGT A;  1EY0 A;  4XXE A;  4DPG A;  3NXW A;  1S4Z A;  3N6R A;  1D6E C;  4PQX A;  1E1T A;  1KNE A;  1M1K C;  5I9O A;  2ZXP A;  4DV0 L;  5M3M H;  3SK6 A;  4KJO A;  5IYC H;  2F1M A;  2DNE A;  2EYP A;  1XNQ Q;  3K6O A;  3PUZ A;  1CZG A;  2F0Q A;  1L0W A;  1STH A;  2A69 D;  2PNH A;  3K5L A;  4YCU A;  1VQP A;  1HHV A;  1NMF A;  1VS0 A;  4J6H A;  3TDQ A;  2K75 A;  4ME3 A;  4A3G G;  2K32 A;  1CHP D;  2J0T D;  2CH4 W;  1MJC A;  3SE0 A;  1PTO C;  3H0G H;  2K6A A;  1IL8 A;  1Q86 C;  3MAQ A;  5C4X H;  4GN4 B;  3VR4 A;  1YJW A;  1QCB D;  1A3T A;  4IQZ A;  2CWP A;  3M4O H;  5C4Z A;  2JA6 B;  4XYO A;  4XTC S;  4TRD A;  4AYB E;  1Q82 C;  4CDE C;  2HDM A;  4RHS A;  4LFA Q;  1CQV A;  1EY9 A;  1I6V C;  1BCP D;  5GQO A;  5M5W B;  2BE5 C;  1IYV A;  1PRT C;  1S40 A;  1I4P A;  2OCE A;  1K8G A;  4CJ1 B;  1UAP A;  4GOP C;  4EQN A;  2KEE A;  4HIO A;  1HQR D;  1FR3 A;  1YVC A;  3Q0A A;  2Q8T A;  1WFQ A;  2B2Y C;  1B70 B;  3SDZ A;  2JA7 H;  3L7Z C;  1ILP A;  3NWT A;  1O80 A;  4UPA A;  4WFN 3;  1BR9 A;  4HJ7 A;  2PI2 E;  3RLF A;  3WWV A;  1HUM A;  5M3M G;  1KL9 A;  4RGT A;  1FL0 A;  3SK5 A;  5IYC G;  1B44 D;  2BA0 A;  4O1N A;  3I4N H;  3H3V C;  3S17 H;  1JJC B;  4DFA A;  4IUT A;  1JC7 A;  3OIP A;  1HZB A;  2PI2 A;  1CKM A;  2B29 A;  1MGS A;  3CCJ A;  1ZKO A;  1F9R A;  2ES2 A;  4KKU A;  1V1O A;  1DZ1 A;  4F7X A;  3DEO A;  3H0G G;  2AUK A;  3K8A A;  3R93 A;  1CFM A;  1ENA A;  1STB A;  2ID0 A;  5C4X G;  3SR1 A;  4IJL A;  1EY8 A;  1P16 A;  1IBK L;  4X3U A;  3T56 B;  2IHE A;  4LUZ A;  2ZXR A;  1U4M A;  1W6K A;  2Z8L A;  3BYY B;  4R4C A;  4BBR B;  2PZW A;  1V43 A;  1I94 L;  1TS2 A;  2WB1 G;  3FVQ A;  2VY3 A;  1YNX A;  2FXQ A;  3HS0 C;  3A5Z B;  4KKT A;  1P8L A;  3KF6 A;  2MP1 A;  1TWG B;  1VMC A;  1ET9 A;  1X3F A;  2DN8 A;  5K36 H;  4ZK9 B;  2XRS D;  3D0F A;  2AQ1 B;  3S2D H;  5ELC A;  4V19 0;  1ASZ A;  1OXU A;  4A3D H;  1MD2 D;  1PVO A;  2NVQ B;  4JI8 L;  3ND8 A;  4XIG S;  4BBS B;  3HKZ B;  4GLX A;  1JOR A;  2E75 C;  4JYA Q;  2JA7 G;  4LFB Q;  4DR7 Q;  1B2T A;  2MGS A;  2K05 A;  2F0L A;  4DAP A;  1F77 A;  1QVC A;  4HIK A;  2C5C A;  2K1B A;  2NZ1 D;  1V1P A;  1M90 C;  4NXN Q;  1VQF A;  5J3B A;  1CA5 A;  2UUA L;  3I4N G;  2VQF L;  1F2Z A;  1D5Z C;  2K4K A;  1WTP A;  1CQF A;  4IUU A;  3PIP 3;  2XIW A;  4IPH A;  4JI3 Q;  5E4X A;  4CKB A;  3S15 H;  1RDP D;  1X55 A;  5LMU L;  4C56 C;  1VCI A;  1G91 A;  4TKO B;  1F2Y A;  4Z9C B;  5EPL A;  1N33 Q;  5EQ0 A;  4X3K A;  5J1Z A;  3T16 A;  1IXR A;  3OWF A;  3BZK A;  3G71 A;  1QJO A;  1A3U A;  3MXN B;  2R7Z H;  4K0K Q;  3HOX H;  1UE6 A;  4GN5 A;  1STE A;  4RHR A;  1SEB D;  2NVY H;  2UXD Q;  5DM7 3;  1L1O A;  5NUC A;  2K7V A;  1B4O A;  3MC0 B;  4I65 A;  3SK8 A;  4OX9 Q;  4C2M B;  4CDF C;  1LUZ A;  1BF4 A;  3CW2 C;  2EJM A;  2WAQ B;  4JOI A;  1JWU D;  4IPG A;  3U4V A;  4B9X A;  5K36 G;  1EIG A;  4P71 A;  4KKS A;  1CZW A;  4Q0F A;  4GN3 B;  3P75 A;  5GAG C;  4M8A A;  3KOJ A;  1YNJ C;  3G7L A;  1PH6 A;  4A3D G;  1AN8 A;  1LTB D;  2QDL A;  3Q23 A;  2B2W A;  1PH4 A;  3O13 A;  2KOL A;  3KDF A;  1CTM A;  3I3C A;  1NUC A;  1YNN D;  3H15 A;  5ELD A;  4HIM A;  4LMQ D;  4C2M H;  5GRO A;  2R6G A;  4RGM A;  4LAA A;  3S1N B;  4DV1 L;  1TWF H;  1Q1B A;  4YY3 L;  4YCW A;  5CV9 A;  4A93 H;  3TQY A;  1G2S A;  4HSV A;  3I91 A;  1EYC A;  2H5X A;  2VNU D;  1F2M A;  4DV2 L;  3HKZ G;  3VDY A;  4AYB B;  5KYL A;  4WJ3 M;  3W1G A;  3KBG A;  3I70 A;  1LM0 A;  1AEX A;  1STG A; 
#chains in the Genus database with same CATH homology
 2XN9 C;  3HOW B;  1GUN A;  3L3O C;  3X3M A;  3K7A B;  1D5X C;  1EU4 A;  3HOV B;  2KCN A;  2A69 C;  5CV4 A;  2KVM A;  1RD9 D;  3OMG A;  2FHT A;  3JAM L;  4IFD J;  2F0N A;  2MHV A;  2PQE A;  1LTG D;  5IIF A;  1B3A A;  1HA6 A;  4ABN A;  1QWY A;  1EWC A;  5T1G A;  4KI0 A;  4CKC A;  3V05 A;  4Q5V A;  1IKM A;  2L4N A;  2J7Z A;  3E5S A;  5DEH A;  1FNU A;  1BCP C;  2F0E A;  3NTH A;  4F88 A;  4DNR B;  2EY1 A;  3GO5 A;  1JOQ A;  2K01 A;  2A74 C;  5D65 A;  3PIO 3;  3PV0 A;  1II3 A;  1TQO A;  3GTL B;  1BBX C;  3OMC A;  5E4W C;  4J8Q A;  1H9K A;  1QNK A;  5CV6 A;  4A3J B;  1H9J A;  1X3P A;  3DWQ A;  3J7A F;  1UEA B;  2BA1 A;  3Q24 A;  1ET6 A;  5C0X J;  4V0B A;  3AU7 A;  1A15 A;  2EOT A;  2SDF A;  4XQJ A;  1PFN A;  4KTA A;  1PTO D;  1EZ6 A;  5IGB A;  4S3S A;  1TY0 A;  1VF5 C;  1I50 B;  1SYF A;  3K58 A;  4C3I B;  5KNC A;  4NKL A;  3NUC A;  1SE3 A;  2KHS A;  1TII D;  3I8Z A;  3KLS A;  2EY6 A;  1WTQ A;  1QB5 D;  1SAP A;  2IX1 A;  3IL8 A;  4FP5 D;  1LAB A;  5CR3 A;  2SOB A;  2O5J C;  1JR0 D;  2PNR C;  2NTS A;  3SVM A;  2F0D A;  3VR6 A;  2K04 A;  3WDN A;  3K5O A;  3GTJ B;  5G3L F;  3C1F A;  5JOB A;  3FMC A;  1EEF D;  2EYJ A;  2JE6 I;  3A8J E;  3GTQ B;  3EQL C;  2A5H A;  1ONL A;  3KF8 A;  3M3Y B;  1RJT A;  3EFX D;  1O7Y A;  1O78 A;  1D5M C;  5C3E B;  1OXX K;  3M4Y A;  3MXP A;  5JAV A;  4XQQ A;  2DNC A;  4GZY C;  4DXF A;  3J80 L;  3TP8 A;  1EQV A;  1Y8P B;  1Q12 A;  2R93 B;  3BDC A;  4DF7 A;  1WTO A;  3NTK A;  1KDC A;  4JBW A;  2RQX A;  1EY6 A;  1JOK A;  2PW7 A;  4A3I B;  4EVO A;  1C4Q A;  2TMP A;  2KEC A;  3IFT A;  4RH6 A;  3A7A B;  4DNT B;  5HGT A;  3C46 A;  1BQQ T;  1F9P A;  3PUX A;  2B39 A;  3TBI B;  1PTO B;  1R4P B;  1DON A;  5IT9 L;  3K0Y A;  1H9S B;  1NR4 A;  1YNN C;  2K28 A;  2JEB I;  2N88 A;  2RA4 A;  3VA7 A;  1JE4 A;  3GD7 A;  4A3G B;  2A6H C;  1GUS A;  4OO1 I;  1XYI A;  1D1I A;  5I6W A;  3I73 A;  1PRT B;  4NP5 A;  2B2V C;  4N9T A;  5C5L A;  4HMI A;  4K8J A;  2EE1 A;  2K5W A;  5M9O A;  2E74 C;  4XT1 B;  4BWG B;  5BN4 A;  4KHZ A;  1ICW A;  3BG3 A;  1WVL A;  5JEA J;  3A7L A;  4CJ0 B;  3QOL A;  2E2H B;  4NW2 A;  1I4X A;  1DCZ A;  2IL8 A;  1IYU A;  4K5V A;  1F9S A;  4IUV A;  2NVX B;  3MEH A;  5IGC A;  1SE2 A;  5KIX A;  2L11 A;  4IFD I;  4H7B A;  4PMW A;  3IFD A;  2F0V A;  3NPP A;  2B8F A;  5JVH 3;  5FKA C;  1MSH A;  1E0B A;  1JWS D;  4FF1 A;  2NYZ D;  2OF1 A;  5IGE A;  1V8Q A;  5E3F A;  3H6M A;  1LTA D;  1RF2 D;  4PV1 C;  2XRQ D;  2EY2 A;  3A54 A;  2AQ3 B;  5CMD A;  3MXN A;  3BZD B;  1UNS A;  3EA6 A;  1HPC A;  2JP1 A;  5D14 A;  1KDB A;  3H0G B;  5IGG A;  1WD1 A;  1PXU A;  1Q3L A;  3MFY A;  1STA A;  2VUM B;  2FIN B;  3TP5 A;  3P20 A;  5C4X B;  3KK7 A;  3M4O B;  2GA4 B;  2F0J A;  4JK1 C;  2F0O A;  1A2T A;  2NTT A;  2LKV A;  2WB1 B;  2AWN A;  1CM9 A;  2WP8 J;  1G6Z A;  5C0X I;  5JPN C;  1T5E A;  5LL6 X;  1PFB A;  2RVL A;  1CK1 A;  3GP7 A;  4RKL A;  1GUG A;  2HDL A;  4K2L A;  1OO9 B;  1OXT A;  2K33 A;  2JA7 B;  1SXT A;  4RKB A;  4QF4 A;  5FLX L;  1RTO A;  5C5M A;  4IUN A;  3LNN A;  2F3W A;  2F3V A;  3I4N B;  3S17 B;  2G9D A;  4HN7 A;  3SHL A;  2BCO A;  3GTK B;  4Y7N B;  1M8A A;  1EYD A;  4J1M A;  2MUY A;  1RHP A;  4LK1 C;  4DAY A;  4RGO S;  2Z1C A;  3NQI A;  4HR7 B;  3M7G A;  1TS5 A;  3DWP A;  2IT1 A;  1TS4 A;  3QJY A;  2N55 A;  3D4D A;  2F0U A;  2ICI A;  5DAU A;  3FRP B;  3DMU A;  5DNF A;  5C4H A;  3MXG A;  3G6J B;  2SEB D;  1J8I A;  2CVR A;  1PLF A;  2PO4 A;  3QG1 A;  5JVG 3;  1TY2 A;  1KLG D;  3NK9 A;  2QCP X;  3S2D B;  4A3D B;  2RDF A;  2KCC A;  2O2L D;  3HG9 A;  2L5T A;  3AMU A;  3NWS A;  3NBH A;  1Y69 U;  2V4D A;  4FNF A;  1TVX A;  3NP8 A;  3TME A;  2EJG C;  1LTR D;  3S15 B;  1HQM C;  1DXM A;  2PMZ B;  3ONA B;  2E76 C;  2K5Q A;  4WRD A;  1Z6H A;  3C3L A;  2AQ2 B;  2HQE A;  2JEA I;  3WOF A;  2B2T A;  2R92 B;  1FD7 D;  2ZXO A;  2IX3 A;  3LWU A;  2R7Z B;  3HOX B;  2BDO A;  1W6J A;  5I4D A;  1EY7 A;  2NVY B;  4ZKB B;  3K57 A;  5D3I B;  1BCP B;  5BN5 A;  2Z4I A;  3PUV A;  5CV5 A;  3C2P A;  5LL6 S;  4K2K A;  3CRK C;  1DOL A;  2IX0 A;  1OXS C;  3DEP A;  1M4V A;  4EQP A;  4HAE A;  4DU9 A;  2RDG A;  3W3A A;  1JOO A;  5ELB A;  5A35 A;  4G4K A;  2F4I A;  3R3O A;  1TWF B;  2QDB A;  1CHQ D;  1LAC A;  5EKI A;  4G7Z C;  1PFM A;  2D9U A;  4A93 B;  3J7A V;  4IAL A;  3ZYY X;  1STN A;  1Z47 A;  3OSO A;  3VA5 A;  2RSO A;  1SE4 A;  3D31 A;  4IUR A;  3J81 L;  3EJI A;  1C48 A;  1VMP A;  4BS9 A;  3T4A C;  3D3R A;  4X3S A;  4H13 C;  1STY A;  4ODG A;  2A6H D;  3MFG A;  2ICE C;  3NHH A;  1U4L A;  4ZRZ A;  4I7Z C;  4FXK C;  1SNO A;  2LFN A;  3T51 B;  1O7Z A;  4P2C B;  1QNU A;  4KN4 C;  1AW7 A;  1TWH B;  3BDO A;  3VYT A;  2X6G A;  1KAA A;  2F0W A;  1EL0 A;  4B08 A;  2EYF A;  3J7Y W;  3I90 A;  1H9S A;  3FDT A;  5C4J B;  2RSN A;  3KUP A;  3OW7 A;  2BOS A;  2YU9 B;  2F0P A;  1EOT A;  5EBC A;  4IZ8 A;  1ENF A;  3K59 A;  2RDH A;  5IOC A;  3A55 A;  2L55 A;  2FMC A;  3NQT A;  2M00 A;  1SYB A;  2NN6 H;  3QWN A;  3D4R A;  4FXD A;  1Y8N B;  3UI2 A;  1SBB B;  3VYS A;  2F0S A;  1S5E D;  5KNB A;  3DHQ A;  1SMY D;  1GJX A;  2RKS A;  3GTM B;  3RZO B;  2B2Y A;  4IUQ A;  4RCN A;  5FO9 B;  3JAM E;  2IWH A;  1H9R A;  1E2V A;  1KDA A;  2F0F A;  5JPM C;  2HCI A;  2EY5 A;  4OGQ C;  1BOS A;  1G2T A;  2JYO A;  3R2I A;  3ND9 A;  4K14 A;  4K6L A;  4PMC A;  4XYQ A;  5I9P A;  2KUM A;  2M2L A;  5G3L D;  3PMF A;  1DOK A;  2XWJ B;  3Q22 A;  4R8I A;  1JCK B;  4YIJ A;  1HRJ A;  1KAB A;  1TKW B;  3BS1 A;  1MI2 A;  4KD3 A;  1ESR A;  5K5P A;  2NN6 G;  1B9M A;  3FPU B;  3KLS X;  5J39 A;  4PNY A;  3NBI A;  1BXT A;  3R8B A;  2SNM A;  1LLR D;  3MXU A;  2EXZ A;  1Q90 A;  4DXG A;  3RUZ A;  3A8I E;  5EBD A;  3R2T A;  2F0H A;  1CT1 D;  2QEJ C;  1F2L A;  1GOZ A;  4HCS A;  1PZK D;  1I4G A;  1PTO F;  5CGK A;  3QO2 A;  4G57 A;  4FO2 A;  5A2Q L;  1H9M A;  1VDZ A;  5HUR A;  1SNQ A;  3E0J A;  2IJ0 A;  2NBF A;  1EY5 A;  2D2C C;  2O5I C;  1EIH A;  2B8G A;  4QCL A;  1PRT F;  2PCF B;  1PYW D;  5ELF A;  3DWA A;  1G8Z D;  2WV6 D;  4QB4 A;  3CRL C;  1Y1W B;  1VF7 A;  2B63 B;  1HTP A;  4HSP A;  2NVT B;  2G9H D;  1DOM A;  1F9Q A;  3P1H A;  2D5D A;  1Q8I A;  4ZYS A;  3IKJ A;  1GUO A;  4NDX A;  2F0I A;  4KY6 A;  5C3W A;  1PMR A;  5C6A A;  2EVB A;  1EZ8 A;  1HCZ A;  3DXJ C;  5FOB B;  1WTR A;  4BA1 I;  2PYK A;  2EZV A;  2TSS A;  3HRZ C;  1S5B D;  1PZI D;  1FGB D;  3GV3 A;  1HTL D;  2OEO A;  1SYC A;  4C3J G;  1AFP A;  4IFD H;  5CC4 A;  4U68 A;  3E6Z X;  1LV9 A;  1IW7 D;  5IT9 E;  4FF3 A;  2E2J B;  4DA2 A;  4C3H G;  3FEW X;  4DK0 A;  2DY7 A;  3U9O A;  1LT6 D;  4DGZ A;  1TS3 A;  4MIU A;  1XTC D;  2B2U C;  3D6C A;  1BNZ A;  3PUW A;  1X3Q A;  4CKE A;  2CHB D;  2DY8 A;  1AZP A;  2F0G A;  3S1R B;  1SDF A;  1SNC A;  3DUZ A;  1IKL A;  3MZ5 A;  1R4Q B;  2R3Z A;  2FJ2 A;  1GUW A;  2H4O A;  1SMY C;  3NE5 B;  4BA2 I;  1LT5 D;  4CBV A;  3GTO B;  1TT2 A;  3HGB A;  1K8O A;  3M7N A;  4QUC A;  5FO7 B;  5C0X H;  1RCV D;  5IOD A;  4XQN A;  3EVQ A;  5C3X A;  2LY7 A;  1SYE A;  3L9A X;  2B2W C;  2WKC A;  2ENB A;  3GTG B;  3QB3 A;  1PDQ A;  2EYM A;  3BVM A;  3CU7 A;  4OIK A;  3FKI B;  2BDN A;  4RAU C;  3MVV A;  2QIL A;  2L12 A;  5FK9 C;  2KA7 A;  4QUF A;  4KK7 A;  3TP6 A;  1WTX A;  4QMG A;  2A68 D;  5CV7 A;  3SEB A;  2A6E D;  2KJX A;  3OPO A;  3WOE A;  1FNV A;  2XNA C;  3AB9 A;  1K83 B;  2YYZ A;  1PZJ D;  2K03 A;  4KD4 A;  1I6H B;  2MJ8 A;  4X3T A;  2EPB A;  4MN3 A;  2PW5 A;  3P7J A;  3K5M A;  3H94 A;  3X3N A;  4KV6 A;  5C0X G;  3MTS A;  3F2U A;  3GQB A;  1WD0 A;  3BVG A;  3OOC A;  1SND A;  4HMJ A;  5IGD A;  1LTS D;  4F87 A;  3U9S A;  4DN4 M;  4C1N K;  3CKI B;  5FLX E;  1I4R A;  1NAP A;  3BYT B;  3VR2 A;  1L0X B;  2D62 A;  3TSS A;  1HFG A;  3HEJ A;  2WIN B;  2C9O A;  2L0C A;  3S1M B;  1T5X D;  1ZEQ X;  4RCO A;  4G7H C;  2EJF C;  4TSS A;  1BCP F;  2VB2 X;  3T13 A;  1XXG A;  5KND A;  4WJW A;  2AWO A;  1D1K A;  3K5N A;  3H09 A;  3RZD B;  2WKD A;  5DM6 3;  2OXP A;  3GV6 A;  1JQY D;  2CW0 D;  3KLR A;  1X32 A;  5I6Y A;  1JWM D;  1L0Y B;  5KEE A;  1U4P A;  5FO8 B;  1WCM B;  1EFI D;  1SNM A;  4RFB A;  1EYA A;  5EPJ A;  1K8M A;  2IPK D;  1QIL A;  2QKI C;  4EGV A;  4ZLT F;  2B2V A;  3FPP A;  4A3K B;  2FMM A;  2JXM B;  4MHE A;  4RA8 A;  5JEA H;  1E2Z A;  1ZXT A;  4CHT B;  2WII B;  2KQ3 A;  3ERQ A;  2X6L A;  1Y1V B;  4FXG C;  4U67 3;  1TWC B;  5TSS A;  4B9W A;  1U4R A;  3BVZ A;  4UDU C;  4ZKC B;  2H1E A;  3TZD A;  1IW7 C;  2L1B A;  2B2U A;  3HOZ B;  2Q8R E;  1AP0 A;  3D6W A;  1GHK A;  3TZU A;  2EDG A;  3MHB A;  2RBM A;  2PPB C;  2F0K A;  3OWE B;  5M3F B;  3HZX A;  5C44 B;  1GHJ A;  3S9W A;  1B1Z A;  5CYU A;  1LTT D;  3I72 A;  4F8M A;  5J22 A;  4WOR A;  4KN7 C;  1SYG A;  3A56 A;  5LHY 1;  3CQZ B;  3PO2 B;  1FYC A;  4G7O C;  2HUG A;  3QIA A;  5JEA G;  1S5C D;  1FNW A;  4HED A;  3ERO A;  4M1U B;  1TWA B;  3VR5 A;  4OL7 A;  3H91 A;  1LT4 D;  2XWB B;  3A8K E;  2L9H A;  2F03 A;  1BUV T;  2ZT9 C;  3J81 E;  2J4X A;  2Q8I B;  4DK1 A;  5M5Y B;  3V96 A;  2A68 C;  3URY A;  4K5X A;  5T1I A;  2A6E C;  3NTI A;  1I4Q A;  5EKL A;  5ELE A;  1SSO A;  3D8G A;  4H0L C;  1SJE D;  3T53 B;  4R9W A;  1EY4 A;  3NSW A;  2I07 B;  1G29 1;  4NMZ A;  3KBX A;  4TQU S;  4KMU C;  3PUY A;  3RD4 A;  1TR5 A;  3C1E A;  2AUJ D;  1AZQ A;  1JIC A;  4KJN A;  2Z4H A;  4N9P A;  4RWS C;  1B9N A;  1R9T B;  4CJ2 C;  1ZYR D;  3CHB D;  4OHJ A;  3MA2 B;  1NCV A;  1S5F D;  1Z7T A;  2F0T A;  1NSN S;  1A6X A;  3HOY B;  2Y0S B;  2EYH A;  1A3V A;  1S5D D;  4A3F B;  1EEI D;  4ZUJ A;  1MSG A;  4FYD A;  4HTH A;  1TU2 B;  4EQO A;  2XSC A;  2EYO A;  1NR2 A;  2NN6 I;  3LX0 A;  3I4L A;  4XDX A;  1D2B A;  1U9R A;  3OHX C;  1EQT A;  2PZT A;  2CQA A;  3SK4 A;  5IGF A;  3SXH A;  4LJZ C;  4A3B B;  1KNA A;  1MBY A;  1V1P B;  5M5X B;  4K6D A;  2FFK B;  3OIQ A;  1RTN A;  5EJW A;  2CW0 C;  4RGN A;  2VB3 X;  3Q6S A;  2BE5 D;  1PRT D;  1HXY D;  3V2T A;  5CBE E;  1LTI D;  4C3J B;  4ID6 A;  5EPK A;  3DM1 A;  4K8I A;  3HOU B;  1I3Q B;  1SYD A;  1ENC A;  2K5D A;  4UAI A;  4C3H B;  1E2W A;  2IW3 A;  1DM0 B;  4BY1 B;  5EKK A;  1DYQ A;  2VXW A;  3S2H B;  1ML0 D;  1B50 A;  4DAV A;  4OIJ A;  2JA8 B;  4FVM A;  1C8C A;  3TP7 A;  4C1N I;  3BDL A;  1WTW A;  1ROD A;  1XWE A;  1CA6 A;  3PO3 B;  4K5W A;  3GTP B;  2A73 B;  2WAC A;  1HFN A;  5KGU A;  1XX8 A;  1LO5 D;  4IUP A;  4R8N A;  2QF7 A;  4L63 B;  1EU3 A;  1HA5 A;  1KLU D;  4FF4 A;  1Q1E A;  2F0M A;  1J9O A;  4KY7 A;  3VYU A;  5I2X A;  4ZQ3 A;  4A3E B;  2E2D C;  2OT2 A;  4OO1 H;  2LMC B;  2HCC A;  4KHV A;  5A2Q E;  1HUN A;  1UUP A;  1ILQ A;  4BY7 B;  5AFW A;  4ME5 A;  3W2D A;  1KTK A;  3TN2 A;  2PZU A;  3S16 B;  4A3M B;  4XT3 B;  5CBA E;  4ZAI A;  4L6T B;  3J80 E;  4C3I G;  1RKN A;  2M9V A;  1QE6 A;  5KRU A;  3MWY W;  4KY5 A;  2MPM A;  1BO0 A;  2B2T C;  5KYI A;  2LS0 1;  1SNP A;  1OXV A;  4QIW B;  5JJZ A;  1ESF A;  4O42 A;  4CGY B;  1I4H A;  3VR3 A;  4FF2 A;  5F2D A;  2E2I B;  4ULL A;  1B53 A;  1Y8O B;  2I46 A;  3ITP A;  2XVS A;  4L8J A;  2NUC A;  2SNS A;  2JSO A;  1BDO A;  1SJH D;  4IN3 A;  1PTO H;  3QOJ A;  1GUT A;  3VYR A;  3LWE A;  2NWG A;  5D3D A;  3I4M B;  1EWH A;  4ILW A;  2KED A;  4OO1 G;  4ZUI A;  5BN3 A;  3IAY A;  3HP3 A;  3S14 B;  3M85 A;  1A2U A;  3RMH A;  5COY A;  4H44 C;  5COR A;  2O4X A;  3N52 A;  1YNJ D;  1SFO B;  1LT3 D;  2NB0 A;  2X69 A;  1QOH A;  2R61 A;  3D4W A;  1DJR D;  1O7L A;  3S1Q B;  1CI3 M;  1IHZ A;  1ZYR C;  5M3M B;  1QG7 A;  5I2Y A;  1WTV A;  5ISR A;  1DD2 A;  5E1F A;  4E6I A;  4HCE A;  2EYL A;  4PMB A;  5CV8 A;  4IFD G;  1GXD C;  2JA5 B;  1JB3 A;  5EGT A;  1EY0 A;  4XXE A;  3NXW A;  1S4Z A;  3N6R A;  1D6E C;  4PQX A;  1KNE A;  5I9O A;  2ZXP A;  3SK6 A;  4KJO A;  2F1M A;  2DNE A;  2EYP A;  3K6O A;  3PUZ A;  1CZG A;  2F0Q A;  1STH A;  2A69 D;  3K5L A;  1HHV A;  3TDQ A;  4J6H A;  2K32 A;  1CHP D;  2J0T D;  3SE0 A;  1PTO C;  2K6A A;  1IL8 A;  3MAQ A;  3VR4 A;  1QCB D;  1A3T A;  4IQZ A;  5C4Z A;  2JA6 B;  4XYO A;  4XTC S;  4TRD A;  2HDM A;  4RHS A;  1CQV A;  1EY9 A;  1I6V C;  1BCP D;  5M5W B;  2BE5 C;  1IYV A;  1PRT C;  1I4P A;  4CJ1 B;  1UAP A;  4EQN A;  2KEE A;  1HQR D;  1FR3 A;  3Q0A A;  2Q8T A;  2B2Y C;  3SDZ A;  3L7Z C;  1ILP A;  3NWT A;  1O80 A;  4WFN 3;  1BR9 A;  3RLF A;  1HUM A;  4RGT A;  3SK5 A;  1B44 D;  2BA0 A;  4O1N A;  3H3V C;  4DFA A;  4IUT A;  1JC7 A;  3OIP A;  1MGS A;  1ZKO A;  1F9R A;  4KKU A;  1V1O A;  1DZ1 A;  4F7X A;  3DEO A;  2AUK A;  3R93 A;  1CFM A;  1ENA A;  1STB A;  2ID0 A;  3SR1 A;  1EY8 A;  4X3U A;  3T56 B;  2ZXR A;  1U4M A;  1W6K A;  2Z8L A;  3BYY B;  4BBR B;  2PZW A;  1V43 A;  1TS2 A;  3FVQ A;  3HS0 C;  4KKT A;  2MP1 A;  1TWG B;  1VMC A;  1ET9 A;  2DN8 A;  5K36 H;  4ZK9 B;  2XRS D;  2AQ1 B;  5ELC A;  4V19 0;  1OXU A;  2NVQ B;  1MD2 D;  3ND8 A;  4XIG S;  4BBS B;  3HKZ B;  1JOR A;  2E75 C;  1B2T A;  2MGS A;  2K05 A;  2F0L A;  4DAP A;  1F77 A;  2C5C A;  2K1B A;  2NZ1 D;  1V1P A;  1CA5 A;  1WTP A;  1F2Z A;  1D5Z C;  1CQF A;  4IUU A;  3PIP 3;  2XIW A;  5E4X A;  4CKB A;  1RDP D;  4C56 C;  1VCI A;  1G91 A;  4TKO B;  1F2Y A;  4Z9C B;  5EPL A;  5EQ0 A;  4X3K A;  5J1Z A;  3T16 A;  3OWF A;  1QJO A;  1A3U A;  1STE A;  4RHR A;  1SEB D;  5DM7 3;  5NUC A;  2K7V A;  1B4O A;  3MC0 B;  4I65 A;  3SK8 A;  4C2M B;  1BF4 A;  2EJM A;  2WAQ B;  1JWU D;  4B9X A;  5K36 G;  1EIG A;  4KKS A;  1CZW A;  4Q0F A;  3P75 A;  4M8A A;  1YNJ C;  3G7L A;  1AN8 A;  1LTB D;  3Q23 A;  2B2W A;  3O13 A;  2KOL A;  1CTM A;  3I3C A;  1NUC A;  1YNN D;  5ELD A;  4LMQ D;  2R6G A;  4RGM A;  4LAA A;  3S1N B;  1Q1B A;  5CV9 A;  1G2S A;  4HSV A;  3I91 A;  1EYC A;  2VNU D;  1F2M A;  4AYB B;  5KYL A;  3KBG A;  3I70 A;  1AEX A;  1STG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...