4PMCA

Crystal structure of staphylcoccal nuclease variant delta+phs i72k v74k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS I72K V74K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pmcA00
3DHQA 5CR3A 2EY2A 2SOBA 3S9WA 2F0EA 2F0LA 2OXPA 2F0WA 5IGDA 3HZXA 1JOOA 5JOBA 3SK5A 5IGBA 2F0OA 3NXWA 5KEEA 2SNMA 4DFAA 3DMUA 1EZ6A 1KDAA 4ZUIA 3D6CA 5C3XA 4PNYA 5J1ZA 4KD4A 1STBA 4PMBA 4MIUA 1F2ZA 5IGCA 2F0FA 3NQTA 1EY5A 3NHHA 5I9OA 3SK4A 3TP7A 4K5VA 1A2TA 4N9TA 5IGFA 5EKLA 3QOJA 2ENBA 3ITPA 4KY5A 5K5PA 1ENAA 4S3SA 4TRDA 5EKKA 4F8MA 2LKVA 1SYGA 1EZ8A 5KGUA 4R8NA 4ZUJA 3MEHA 3P75A 4HMJA 2HQEA 5M9OA 2F0PA 2F0QA 3MZ5A 2EYOA 5E1FA 5C6AA 4WRDA 3QB3A 2O4XA 4K8JA 1TQOA 5KRUA 5CV6A 4HMIA 2EY5A 4K2LA 1EYDA 2PQEA 1KABA 1TR5A 5C4HA 1SYBA 4NP5A 3C1FA 5CV4A 2WACA 1STAA 4QB4A 2OF1A 2EYHA 4KY7A 3E5SA 5E3FA 1EYAA 2F0MA 2EXZA 4K6DA 5C3WA 4NDXA 3P1HA 4G57A 4KJOA 4KTAA 4DF7A 3TP6A 2RBMA 3OWFA 2F0GA 3TP8A 1EY8A 3LX0A 1SYDA 2F0HA 1EQVA 5IGEA 5IGGA 5IOCA 3TMEA 2RDFA 2M00A 2F0UA 5IODA 1A3TA 4RKBA 3NK9A 3OMCA 4QMGA 4EQNA 4ZQ3A 2PZWA 1NUCA 1EY6A 1A2UA 1AEXA 4LAAA 1EYCA 2F0KA 4K5WA 5I6YA 5I9PA 4K2KA 2EYMA 5C5LA 1JOQA 1EY0A 3MVVA 5IIFA 4K14A 1SNQA 4NMZA 4DU9A 1EY7A 1F2MA 4NKLA 4F7XA 5DEHA 5J22A 4PMCA 5C5MA 1SNPA 2KQ3A 4K8IA 1STYA 1SNCA 2PZUA 4N9PA 1A3UA 2EYPA 2NUCA 5C4ZA 5CC4A 5JAVA 2QDBA 4I65A 3BDCA 3OSOA 4KV6A 1STGA 4B9WA 2F0DA 2EY1A 3D4DA 4B9XA 4OL7A 1SYCA 4WORA 5CV7A 3HEJA 1IHZA 5KIXA 1SYFA 3R3OA 1EY9A 4KY6A 1SNDA 5ISRA 1EY4A 4RKLA 1U9RA 3EVQA 5KYLA 2OEOA 4KHVA 3VA5A 2F0TA 2EYLA 1RKNA 3NP8A 5J39A 3ERQA 5I6WA 2F0VA 4K5XA 4EQPA 4J6HA 3SR1A 1SYEA 1ENCA 5HURA 3U9OA 1SNOA 3MXPA 3D4WA 5CV8A 4IZ8A 3SXHA 2F0IA 1STHA 3PMFA 4YIJA 4J1MA 2RKSA 3SHLA 3MHBA 4KJNA 2SNSA 4EVOA 2PYKA 5CV9A 1NSNS 2EYFA 3C1EA 3SK8A 3QOLA 5KYIA 3H6MA 5NUCA 4QF4A 1F2YA 1KDBA 3EROA 5HGTA 2F0JA 2EYJA 4ME5A 2PW5A 4IALA 5CV5A 4ODGA 4DGZA 4ID6A 2KHSA 3OMGA 5F2DA 4KD3A 5DAUA 3V2TA 3TP5A 4EQOA 4IUNA 2F0NA 3D8GA 3SK6A 3T16A 3RUZA 3NUCA 2F3VA 4HTHA 1TT2A 2F3WA 1JORA 5EGTA 2F0SA 1II3A 4H7BA 1JOKA 1SNMA 4E6IA 1STNA 3EJIA 3BDLA 3T13A 1KDCA 2PW7A 2PZTA 1A3VA 5CGKA 2EY6A 1KAAA
chains in the Genus database with same CATH superfamily
4CJ0B 5C3EH 1PH2A 1TWGH 2KA7A 5H1SE 3SK5A 5KEEA 3M4YA 1B8AA 2DNCA 1KDAA 2C9OA 3SVMA 1X54A 4DV1L 4JI6L 1S5FD 1NNXA 4OELB 5E4WC 1EY5A 1XJVA 4Y7NH 2WIIB 3OTOL 2QA4A 3ITPA 4S3SA 3GTJH 1K0SA 3W2DA 3GDEA 2RQXA 3S1QH 2F0PA 4BY7H 4XIGS 3A54A 4UAIA 4HMIA 2K01A 2KOLA 2ID0A 4DK6C 2C35B 3C1FA 4HCSA 4GZYC 4A3CH 4R4TA 1FL0A 4O42A 4A3KB 4PMWA 1G2SA 5EPJA 1N34L 1YITA 5IGGA 5IT9L 4UHVA 1R4QB 2ZTCA 1GD7A 2EJGC 2JA5G 1BUVT 4A3JG 1YHBA 5D14A 1EYCA 3FVQA 4B3SL 5IIFA 1TWHB 1PH6A 1EY7A 3HOWH 2K5QA 2I5LX 2NVQB 2NYZD 1SNPA 3S16B 2X6GA 1EL0A 2B2TA 5JJKA 1VS0A 3HKZB 1I94L 2TSSA 1STGA 1SYCA 1J6QA 5IWAL 2CHBD 4HJ8A 3K5MA 3ER0A 4HEDA 1U9RA 4ABNA 2AQ1B 2E2HH 4JI3Q 1RKNA 1K73C 1VQ5A 1R9TH 2F0VA 4IURA 3TRZA 1ENCA 3HGBA 4DN4M 3S15H 4X66Q 3SXHA 1TWAB 3PMFA 5IE8A 2K03A 3NSWA 3MXNA 3J80i 2PYKA 1VQJA 3EFXD 4B3TQ 2JA7G 3S1MH 2N78A 2LMCB 2KHSA 4BBSH 3C46A 1SXTA 1FJGL 1TT2A 1JORA 4G4KA 3L3OC 1IBMQ 1ESFA 3HOZB 1VF7A 2Z1CA 2XRQD 3J7AF 1KAAA 1RL2A 1X6OA 2AHOB 4EQ5A 5BR8L 1VQAA 4ZCKA 2B2UC 3I90A 2DJGC 3NXWA 2UUCQ 3I4OA 2K6AA 1WTQA 2B39A 4A3EG 1AZPA 4HJ9A 1LO5D 4QCLA 1I3QH 2WINB 3R93A 4B3RL 2PPBC 2HDMA 1WCMH 2ZT9C 3GTGB 4DV4L 1RD9D 1O80A 4XTCS 2WP8J 5IGFA 1D2BA 3RZDB 4KY5A 1V8QA 1S5BD 2QKIC 4ZUJA 4HMJA 2HQEA 4IOAA 2VB2X 3K0YA 2X69A 2VUMB 2FINB 3W1BA 3FKIG 3H0GH 2LY7A 1WTWA 1UE5A 1VQOA 4ZKBB 2V4DA 3NBHB 1SYBA 4JG2A 3CCQA 3Q0AA 2EQSA 1GUSA 5GADC 3TP6A 1V1OA 3PGZA 4R4QA 3T1HL 2K5WA 2K5VA 2B63B 2K04A 2KBNA 4YCUA 1EQVA 2SDFA 4LF8Q 2M00A 1HRJA 4LF7L 3M9BA 4LAAA 1VQEA 5ELDA 5EKIA 5FO9B 3G4SA 1SNQA 1EU4A 3K8AA 4JI4L 3X3NA 3LWEA 4JI7Q 1LT4D 3CF5A 1U4RA 3U4VA 2BDOA 2UXCQ 3H91A 4A3GH 3S2DH 2EY1A 5C0XJ 5ISRA 3HOYH 5M5WH 2L5TA 1WI5A 4KMUC 4DV0L 1CQVA 3NWTA 2OT2A 3CQZB 3AFPA 2L0CA 4HIDA 3ULJA 3A55A 1H9SA 4JK1C 1SR3A 1F2YA 3I4MG 4B3MQ 4JV5Q 3D3RA 2EE1A 3CC4A 1YJWA 1E2WA 2HUGA 1HFGA 2O2LD 3PSIA 3TQYA 3S1RH 1JJ2A 4A93G 3OIPA 4OWXB 1IYUA 4E6IA 5M3MB 1HZ9A 3BDLA 1SAPA 1PLFA 3WOFA 3W5OA 3HFZB 3PIOA 5FLXE 4ULLA 2A6HC 2D5DA 3SDZA 4A3FB 2JA8G 2VQEQ 3ULLA 2K05A 3HOVH 1JOOA 2UUBL 4IUTA 2A1AA 2FMCA 2E5LL 2SNMA 1KTKA 3M4QA 2CVRA 1STBA 5A2QE 1YNND 2Z6KC 2O5JC 2FHTA 4UPAA 3QWNA 5M3FG 1XXGA 3I7FA 2QCPX 2ENBA 4HR7B 4A4IA 3GQBA 2QW7A 3IFDA 4RFBA 1DXMA 2ZXOA 4DXGA 2XN9C 3MEHA 2Y0SB 4C3IH 2NVXH 4F88A 1EQTA 2QDLA 1QVCA 1TQOA 2UUAQ 2EZVA 2J4XA 4EX5A 2B2VA 4BY1H 2NVTH 2NB0A 4GOPB 1XWEA 3N52A 5E3FA 3E5SA 3PUVA 4G57A 2R93B 5FLXc 3PUWA 1HHVA 1LTRD 3CHBD 3IKJA 3BZDB 1PFMA 1I4QA 1MJCA 3I4NB 1JWMD 4QMGA 4WJ4A 4C2MB 1WTXA 4PV1C 1Z9FA 5DM73 4KK7A 4DAYB 1PMRA 1A62A 5FJ8H 5C5MA 1X32A 2H1EA 3LWUA 3PIP3 2A6ED 4DUYL 1C0AA 2PNRC 5CMDA 1EOVA 4A75A 2NUCA 2G9HD 2AWOA 2QDBA 5FOBB 1J5EQ 3D4DA 4IPCA 4B9XA 2MHVA 2CQOA 4JI0L 1IHZA 1SYFA 4KY6A 4H13C 1XMOL 3D0FA 2OEOA 4XQJA 2E74C 3EA6A 4A3DB 5C44H 1X9NA 1DYQA 1EEFD 1I6VC 2P5ZX 4YCWA 2ZXRA 2EJFC 1K9MC 4A3BH 3UDIA 5CV9A 4R8IA 3SK8A 2LS01 1EOTA 5HGTA 3I3CA 1VQBA 2QEXA 4FF3A 3H94A 3VYSA 1YEZA 3KF8A 3V2TA 1LM0A 1DONA 1PXUA 4MTKA 4GNXC 3FPUB 2KJXA 5HY6A 4YWLA 3T13A 3D31A 5CGKA 2LFNA 3GTLH 1A63A 4TQUS 1NJIC 3GTMH 1IYVA 1QE6A 1L1OA 1VQ6A 3I70A 3CAMA 1CFMA 2Q8RE 3OW2A 4H02A 4JI5L 1CZWA 1Y1WH 5C3XA 1D5XC 3S14H 1PH9A 1X65A 1E24A 1HZBA 3CCSA 4DAPA 2NZOA 3OHXC 3A8KE 4JI6Q 4C1NI 1C4QA 4MTNA 1QZHA 1O7YA 2UXBL 2HIXA 2EYOA 2K5DA 4IJLA 1GO3E 2YTYA 2E2DC 2RDHA 4HIMA 1WTVA 1PTOB 3ICEA 2KHJA 3U9SA 1I6HB 3H09A 1VQMA 4KY7A 4RG1A 3T51B 5IYCH 5C3EB 2L4NA 4NDXA 3P1HA 3I4LA 4CKBA 3CKIB 3GTKH 4XYOA 4YWKA 4NXNL 3DWAA 1PH7A 1N8RC 4FDBA 4C3JG 2E2JH 1UAPA 1AEXA 1HNXQ 3A8JE 3UE1A 4HJ7A 4Y7NB 1VQPA 4F7XA 5DEHA 3GP7A 1NR4A 2B2WC 4GS3A 4B3SQ 1FNUA 3GTJB 4NB3A 1STYA 2EYPA 3S1QB 1UE1A 3CCRA 4BY7B 2Q2HA 1S5ED 2GVAA 2F0DA 3Q23A 3UI2A 2D0OA 4O2DA 5ELBA 4LF8L 3HEJA 1NY4A 1U4PA 1UEAB 2PI2E 1I94Q 1Q90A 3ND9A 4MZ9A 4KHZA 1YNNC 3DM3A 4UDUC 5COYA 3V05A 5IWAQ 2MNAA 3J81i 2K75A 1BCPF 1STHA 1V9PA 1BVSA 1B70B 3J7A5 1F9QA 4KJNA 2UXCL 2JN4A 4QF4A 2CH4W 2R7ZG 3AU7A 2EXDA 1IYJB 3HOWB 3SK6A 2MO0A 4LWCA 3ULPA 3EQLC 1EIYB 5IY0A 3H3VH 4DV3L 1UE7A 2EY6A 1NBWA 4QQBX 2NTSA 2I46A 3AYHB 3PO3G 3A56A 5IGDA 4B3ML 2RDGA 2E2HB 1W3SA 3L0OA 3G7LA 1R9TB 2R92H 1LTBD 4UP9A 3S15B 5GAEC 1EIHA 1NAPA 1VCIA 3OW7A 4FYDA 2WAQB 3NHHA 2A5HA 3DWPA 1SROA 4LF4L 1QILA 1Q7YC 4B3RQ 4BA1I 3BYYB 5KGUA 2JA6H 3S1MB 4DV4Q 2JP1A 5FK9C 5FO7B 1KIXA 3P75A 1O7ZA 4LF5L 4BBSB 1Y1VG 2IX3A 4GLAC 1TWCH 3HKZE 3MXNB 1BDOA 1HCZA 1EYDA 1TR5A 1HNZL 4JOIC 4L5RC 1KXLA 1CA6A 2EYHA 3V96A 1E7ZA 2A74C 5JEAH 4LFCL 2IHFA 1JJGA 4LF9L 4BXXG 4CHTB 1LT5D 3A74A 3PUZA 1HA6A 5IT9E 5JPMC 1JJCB 1BCPB 3STBD 3T1HQ 3OMCA 1Z47A 3I72A 1I3QB 1YBYA 2UUAL 5C4XG 2KCMA 1IL8A 5C5LA 5IP7H 1JOQA 1WCMB 2AWNA 4LF7Q 2JEBI 1HJPA 1ESRA 1VMPA 1TWFH 4K8IA 2KECA 4JI4Q 4DNIA 1PHJA 2YV5A 4JBMA 3G48A 3H0GB 5CV7A 5K36H 3R3OA 4RKLA 1GUWA 1DCZA 1QWYA 1TVXA 3NP8A 4ME3A 5J39A 2DJFC 1OO9B 4J6HA 1SE4A 4PZ6A 1BOSA 5D3DA 2EOTA 4Z9CB 4DV0Q 1BR9A 3PO2H 1MSGA 1ET6A 1PFSA 1CZGA 3CCMA 2ZJQA 3TDQA 5KYIA 1XMQL 1YHQA 1TKWB 1J5EL 3U50C 4A76A 1LLRD 5I2XA 4DR1L 2DY8A 1ML0D 3JAMc 3CMEA 4AIMA 2BH2A 1PV4A 2JJQA 1QUQA 3AEVA 1CKNA 1JOKA 3EN2A 5ELFA 1STNA 1FYCA 1VQKA 1A3VA 2BH8A 3VA7A 4A3GB 4OIKA 1ASZA 1MSHA 4BA2I 3S2DB 1CM9A 1VQHA 3FDTA 3J7ZC 3K81C 3NEMA 3G6EA 5IYDH 3HOYB 4C1NK 5C0XG 5M5WB 4OX9Q 1ET9A 1EZ6A 5M5YH 1A6XA 4C3HH 2UUBQ 1HZCA 2BA0A 2F0FA 4NXMQ 2E5LQ 3NQTA 1X3FA 1KQSA 1NMFA 4ZLTF 4FNFA 3VR6A 3PIPA 3HS0C 2N3SA 3DEOA 1AN8A 3QOJA 4H44C 2O5IC 1ENAA 2C5CA 1CK1A 1YNJC 2K1BA 2L11A 2RSOA 2EIFA 2LXJA 3S1RB 4KI0A 2PNHA 4K8JA 5E7NA 3CCUA 3MWYW 1JCKB 5KRUA 3AQQA 2V1CC 4K2LA 1H9SB 2IW3A 3W1GA 3TEHB 2F3IA 1GOZA 5C3WA 2D9UA 4CJ1B 2Q2UA 2DGYA 4V0BA 3HOVB 5DLQE 3CC7A 1FVIA 3S24A 4A3MG 1QNUA 1EY8A 4R4IA 4CDFC 5JJIA 2PMZE 5IODA 2L9HA 3GTPH 1MIUA 1NUCA 2F03A 2JXMB 2EYMA 1DD2A 4LUZA 4NMZA 4DU9A 4A3IG 3FPPA 4L6TB 5IYBG 3I73A 1FNVA 3M4OH 1A3UA 3TS0A 4C3IB 1PFBA 3LNNA 3M3YH 3OSOA 4B9WA 3M85A 2NVXB 3CC2A 4DUYQ 5C0XI 1ILPA 2B2VC 3F2DA 2A6HD 3S1NH 4U68A 1LYLA 2OTLA 4BY1B 4XYQA 1HNXL 2NVTB 1WFQA 4JI0Q 4YWMA 1XMOQ 1MBYA 4ILWA 3U9OA 4BBRH 4IFDJ 2ES2A 5ELOA 3F8TA 4A3LG 4Y52H 4PZ7A 3D4RA 1T9HA 1K83H 1SDFA 2RVLA 2VZAA 3H6MA 1WTOA 4HJ5A 1Y8PB 4RGMA 2XTIA 5FLMG 4ID6A 4AQYL 1X3QA 4TKOB 3E0JA 4IUNA 1G6ZA 2Y0SE 1JICA 2F3VA 2BDNA 2JA9A 5GAHC 1UWVA 3K7AH 1NMGA 3BU2A 1BF4A 1AE3A 1RCVD 2F0LA 2E8GA 3MAQA 2F0OA 3STBC 2IJ0A 1U4LA 4TVAB 2J0TD 2MFIA 5ELEA 2F1MA 1B50A 1Q12A 1EWCA 2WKCA 1F77A 5C44B 4JI5Q 4LNQA 1EQRA 2K7VA 1OXXK 3B6YA 3J81L 4A3BB 2A68D 4LFBL 1VQCA 4IOCA 5EBCA 1V43A 3HOUG 1PRTB 4DV7L 3RN2A 4JBKA 1B3QA 1PH5A 3HOXG 4LF6Q 2UXBQ 1VQ4A 3GV6A 4POFA 1KABA 2OQKA 2JA5H 4A3JH 2WACA 3RD4A 1IZ6A 3AB9A 2OF1A 4C56C 3GTLB 1EYAA 3BG3A 3FEWX 3KF8B 3D6WA 2EPBA 3GTMB 3WWVA 1LTSD 3P20A 3E9IA 3K5LA 1Y1WB 3S14B 1A0IA 4RKBA 4EQNA 3OWEB 5LHY1 4PZ8A 4NXNQ 1L1OB 4MNOA 3J7YW 4FXGC 4NKLA 4DNRB 1SE3A 1B9MA 2B2YA 1RIPA 5GQOA 1VQIA 1SNCA 2UU9Q 5JAVA 4P73A 4WORA 1F9PA 3ZJYC 1D7QA 5C4JB 2K52A 5BN4A 1N36L 3EVQA 5E4XA 2K50A 2JA7H 1EFWA 2XVSA 1G8ZD 1TXYA 2WB1G 3SR1A 3PUYA 4J1MA 3GTKB 1GKHA 5T1IA 2OTJA 3OPOA 1PTOD 4EVOA 1TS5A 3FHWA 4FF4A 2JE6I 1KDBA 3EROA 1LTGD 4UP8A 5FKAC 3O13A 2E2JB 4DGZA 2CQAA 1B7YB 1I4HA 2MPMA 3RUZA 1RF2D 1FGBD 2F4IA 4I7AA 4DKAC 4H7BA 5BN3A 4DUZQ 1SNMA 4A3EH 3RNUA 2G5DA 2OQ0A 3SEBA 2L1BA 5LL6S 2VL6A 2ZTDA 4YCVA 2YU9H 4RAUC 4DV3Q 1QZGA 3U4ZA 1DM0B 2R61A 4AYBB 2CW0D 1E1TA 3DMUA 2HD3A 4PNYA 5CYUA 4FF1A 5BN5A 3TN2A 1LTID 2IPKD 3FKIH 4JC0A 2I5HA 3K59A 4A3KG 1DJRD 1C48A 3H15A 4LF4Q 1CKMA 4P71A 3CMAA 1DOKA 1K3BC 2F0QA 4IPGA 1YHAA 3NE5B 4CDCC 4OX9L 2N8NA 3RN5A 5T1GA 5CV6A 4LF5Q 2ZM6L 4NXML 2PQAB 5DNFA 4APVA 3GTOB 3VR5A 4KJOA 3HKZG 5EPLA 3QG1A 1HNZQ 1TIID 3Q24A 1WD0A 4GOPC 4LFCQ 4K0KQ 1O7IA 2R92B 4LF9Q 3R2IA 2SEBD 4K2KA 2Z6BA 4K14A 5LL6X 1U5KA 2B8GA 4Q0FA 5J3BA 3T1YQ 3M4PA 4PMCA 4JI1Q 4DR6L 2JA6B 4K6LA 3F2BA 4PQXA 1I4GA 5D3IB 1WYDA 4KV6A 1BKBA 1TWCB 1W6KA 3NELA 1SNDA 4XQQA 4X3UA 1PYBA 3I4MH 2EYLA 2X6LA 2LXKA 2OCEA 1G51A 3HOZG 2RCFA 3K80C 1E0BA 2F0IA 4QL5A 1MKHA 2RKSA 4A93H 1I4XA 2A68C 1K28A 1VDZA 2ZXPA 3GTQH 2K4KA 2NN6G 2ZJRA 2E2IH 1PZKD 4FVMA 2H5XA 1AFPA 4P2CB 2A69C 2JA8H 3NTKA 1XMQQ 1PTOF 4I7ZC 1M4VA 1WD1A 4OEMB 3TP5A 2NTTA 1EIGA 1B3AA 1EYGA 2N49A 3VR4A 1Q1EA 1IW7D 4XDXA 2F3WA 4R9WA 1BCPD 1LTTD 1II3A 1TWFB 4DR1Q 4DK3C 1C8CA 1XX8A 3F1ZA 1KDCA 1SEBD 3FMCA 3SE0A 1PH1A 4DK1A 1DGSA 5M3FH 2VUMG 4QIWE 3NBIA 4DV2L 2TMPA 2VW9A 2KEDA 3VR3A 4X3SA 1YJNA 4ZRZA 4X62L 2JQOA 5LMUQ 3PO2B 3Q6SA 1E2VA 4X3TA 1N33L 1A2TA 3NTIA 2B63G 1BO0A 1XNQL 2B8FA 1HZAA 3MFGA 4MHEA 5GAGC 1QJOA 2GN5A 3A5ZB 4FXKC 2BA1A 2K5HA 3S17H 5EAYA 1GXDC 4RH6A 4NP5A 1HPCA 1YIJA 4QB4A 1B2TA 5GROA 1CKOA 4HN7A 3NTHA 4J15A 1PTOC 1QUQB 4HCEA 2B2UA 1CKNB 4KN7C 2AUJD 5M5YB 3GO5A 4C3HB 2ASBA 2OWOA 3I91A 4LF6L 3J80L 1S5CD 2E76C 2L55A 3DXJC 4IPDA 3BYTB 3IFTA 1GVPA 2N55A 3PCOB 4RCNA 3VYRA 1RTOA 5HGQA 4ZK9B 1HQMC 1MGSA 1Q46A 1UE6A 1C7YA 1TWGB 3E0EA 1E2ZA 1X3PA 2CW0C 1IL2A 1AW7A 3KBXA 1ICWA 3OYYA 4OIJA 4DXFA 5CORA 4EQPA 3RZOH 5M3MG 1E3PA 2A19A 3SGIA 3D4WA 1Y8NB 4O0AA 4A3FG 3MHBA 3PV0A 3JAMi 2UU9L 1L2FA 3QOLA 1DOLA 3GTPB 1WJJA 4DV5L 3FP9A 1YNJD 2WB1E 2M9VA 4CKEA 3KLSX 4AQYQ 1LACA 3L7ZC 2AQ3B 4JW0A 3BVMA 2PZTA 1PA6A 3M4OB 3DHQA 2EY2A 2Y0SG 3S9WA 4CDDC 2F0EA 4NW2A 3S1NB 3VYUA 2IL8A 1PZJD 4ZUIA 3PQIA 1XPUA 4BBRB 5IGCA 4OO1G 1ZEQX 4UY8C 4DR5L 4K5VA 4DUZL 4IFDG 2VB3X 2R93G 1K83B 4N8FA 3KLWA 4DR2Q 1OXSC 2B2TC 1XNRL 4TRDA 3I4NG 1SYGA 1NE3A 1SJHD 4LFBQ 3G71A 1NR2A 2F52A 4IUPA 1HXYD 4DV7Q 4C3JH 2B3GA 3RLFA 3RR5A 5KNDA 3K7AB 2HHHL 4OGQC 2RBMA 2A8VA 1WOCA 1AP0A 5IGEA 3LX0A 3DM1A 2Z4IA 1CHQD 1TY2A 2F0UA 1HUNA 1VQGA 1AH9A 2K32A 2LSSA 1EY6A 2PZWA 4HSPA 4QUCA 5I9PA 3A7LA 4A3DG 2Z6KA 4HIKA 2VS1A 1BBXC 1IW7C 3I8ZA 1BCPC 5J22A 1ZKOA 1RODA 2L15A 4XT1B 4LFAL 1IXRA 4K0KL 1JC7A 4HIOA 2N88A 1CTMA 2PCFB 3ONAB 2ICEC 4P74A 1J9OA 2JK8A 2BE5C 4A3JB 2JA5B 4QJFA 5EBDA 1SN8A 2R7ZH 1PRTD 2BCOA 2CCZA 4MN3A 1N36Q 4IO9A 4CDEC 4OWTB 2Z0SA 3T1YL 4JI1L 3I55A 1KD1C 1E22A 3DLLA 1JB7A 1SE2A 2PW5A 5EJWA 4GN4B 2MQHA 3PO3H 2XWBB 4RHSA 4DPGA 4HTHA 4JCVE 4FF2A 2VNUD 5IP9G 4ZAIA 1KLUD 1KHIA 3MC0B 1OXTA 2SOBA 4JI8Q 3QJYA 4ZYSA 3EBEA 4L8JA 1KRSA 2JA7B 3UDGA 1KC8C 5IT9c 1VMCA 1HUMA 4L5TA 1Y1VH 1PFNA 1HH2P 5C3EG 4NPSA 4G7HC 4UP7A 3J81E 1WTHA 4DR3Q 5K5PA 3KYHC 2VQFL 1W6JA 3E9HA 1WVLA 5LMNL 5C6AA 4Q5VA 4JI2Q 1SFOH 4BXXH 1S5DD 4WRDA 2O4XA 3E6ZX 4DR4L 1J8IA 4GNXA 2EY5A 1LV9A 4A3EB 5LMUL 5C4XH 2EXZA 2ZM6Q 2YU9B 3GV3A 1D1IA 3I56A 4BY7G 4M1UB 3K0XA 3I2ZA 3MA2B 3TP8A 1D1KA 1D5MC 1H9RA 3Q22A 1Z7TA 1GM5A 4EGVA 1EWHA 3AFQA 1S4ZA 4A3CG 4G7OC 5I6YA 4IJHA 3UDXA 3FKIB 1N32L 4HSVA 1M8AA 1SBBB 3MXUA 1SMYD 3X3MA 1F2MA 5I4DA 1I50H 3K5NA 4DR6Q 4QGUA 1PDQA 1NTGA 4GKJQ 2PO4A 2NVYH 3HOWG 1EY4A 1CA5A 1B4OA 1TY0A 4AYBE 1PH4A 1TS3A 2MJ8A 1SNOA 5CV8A 1MHWC 2K5NA 4RA8A 5AJ3Q 1R4PB 2XRSD 1CT1D 1YVCA 2XNAC 1B9NA 3ERSX 1PRTF 4L5QA 5AFWA 3L9AX 1D6EC 2EYJA 4IALA 4IUUA 4ODGA 1ZYRD 4GLVB 1PYSB 2Q8TA 1HQRD 1Q82C 3PUXA 1BNZA 1U0LA 3C3LA 3D8GA 3T16A 1V1PA 2D2CC 2WAQG 3NUCA 5C0XH 3DEPA 5FO8B 2B2WA 3MXPA 2AKWB 2FJ2A 1EIFA 2R7DA 2WKDA 1PYWD 4BBSG 4CGYB 1K0RA 2B29A 3IAYA 3I4MB 1I5FA 5M5XH 3MTSA 2HCIA 1UUPA 4MIUA 4DV2Q 5JEAJ 2ALYB 3KDFA 4A93B 3SK4A 4N9TA 3GTQB 3PF4A 3HRZC 2E2IB 3BZCA 2DY7A 3ND8A 4X62Q 5EKKA 1NCVA 2KCNA 1IBLL 1N33Q 3KOJA 4QY7A 4HJAA 2NZHA 2JA8B 3JAML 3MZ5A 4LMQD 3CCEA 1XNQQ 4A3MH 1HNWL 1WCMG 3URYA 3BJUA 1XYIA 2XWJB 1PRTC 4IUVA 4KKUA 3VYTA 1F9SA 1STAA 1H9JA 1RTNA 1FR3A 4F87A 4FP5D 4A3IH 5M3FB 1CSQA 4DR2L 2ICIA 2KHIA 4LUVA 5IYBH 1GJXA 2HQLA 3E3XA 3H0GG 5IOCA 4X65L 1KAWA 4JYAL 3NENA 2K28A 1XPOA 3T4AC 3AMUA 2XSCA 1RJTA 2A69D 2R7FA 2D0PA 4JPBW 3CCVA 1B1ZA 1C9OA 4YY3L 4OWWB 1PVOA 2PZUA 4N9PA 3G6JB 1SE8A 1L1OC 4A3LH 1QB5D 3MXGA 3S17B 3N6RA 2MGSA 2YTXA 1QCBD 2Q2TA 1S3OA 1IKLA 4KHVA 4WFN3 1Y8OB 1JB3A 2YYZA 5I6WA 5FLMH 2QILA 4GN3B 4K5XA 1G2TA 1SYEA 4JOIA 4A3GG 3SHLA 1LTAD 4LW1A 1P16A 3C1EA 3HOYG 5G3LD 3BDOA 5CV5A 5TSSA 4X64L 2D62A 1TU2B 4GKKL 4DV5Q 1HTPA 4X6AH 2KUMA 1CQFA 2FXQA 1CHPD 1K8GA 1VQDA 1X3GA 3S2HH 2AMCB 1JMCA 1OXUA 4IQZA 3HZXA 3Q8DA 4ALPA 4DFAA 1I4PA 1IBKQ 3HOUH 1LT6D 3M7NA 3RZOB 2CFMA 4PMBA 2R3ZA 1MI2A 3CRKC 1FD7D 5I9OA 2WV6D 1SMYC 2EJMA 3HOXH 3NQIA 3HOVG 1KLGD 1JQYD 3IL8A 3KF6A 2QF7A 3HKSA 4DR5Q 3LGJA 4JI8L 4JBWA 4XXEA 1XNRQ 3KFUA 4BWGB 4GN5A 1VQFA 2FMMA 5CV4A 4RGNA 1KL9A 2F4VQ 1H9KA 2CKZB 1L0YB 4IN3A 5DM63 1SLJA 4C3IG 3K7UC 3KJOA 1HTLD 4DR3L 2KEEA 3OWFA 3H3VC 2IHEA 1OXVA 2HHHQ 2I5MX 1X56A 4BY1G 4JI2L 1ZYRC 1QG7A 4ZQ3A 1A2UA 5A35A 4DV6L 2PI2A 3J80E 1CUKA 1Q86C 5JJLA 2PMZB 1I4RA 1X3EA 4KHPQ 4TSSA 2G9DA 2J7ZA 3VDYA 5C4ZA 1JWUD 3CU7A 4AH6A 1HR0L 1QVFA 1SMXA 4IUQA 1EU3A 5KIXA 3A5UA 2M2LA 1EY9A 4LFAQ 3U58A 3VA5A 5FJ8G 4C3JB 1YNXA 3J81j 1KNEA 2RF4A 2NWGA 4DNTB 4DR7L 1QOHA 2ZTEA 4R4CA 1S72A 2MO1A 5NUCA 1EEID 4R4OA 4KKSA 1BBUA 1K8OA 4GKJL 4RMFA 2KVMA 5DAUA 3J80c 5C44G 5G3LF 5CBEE 1XPRA 1GUNA 3K6OA 1KNAA 4A3BG 1LABA 3GD7A 3C2PA 4DA2A 3UE0A 5AJ3L 1G91A 2VY3A 1PH3A 4LUOA 5CR3A 4A3KH 1AZQA 1O7LA 2WAQE 2R7ZB 5KNBA 2DNEA 5EQ0A 2K14A 1F2ZA 2EVBA 1HA5A 3RLOA 3UDFA 3WDNA 4POGA 5JJZA 2RSNA 4RHRA 2XGTA 3TP7A 1TWHH 4YHHQ 2RA4A 1ILQA 5LMNW 3KUPA 4XT3B 2NVQH 3TZUA 1Y1WG 3S16H 3KK7A 1SSOA 3K57A 2HIVA 3PO3B 1ICFB 3NWSA 5ELCA 4DAVA 1GHKA 3QB3A 2VQFQ 1G6PA 5LMNQ 5C4HA 2A73B 2WFWA 4J8QA 4DR4Q 1BQQT 2BE5D 4XQNA 5JPNC 2K33A 4KTAA 2RHQB 1Q81C 1TWAH 2EDGA 2UXDQ 3NPPA 3TMEA 4CKCA 2I0QA 4BS9A 4R1JA 1K3RA 1U4MA 4LJZC 4OXPA 1Y1VB 5IYCG 1TS4A 3ZYYX 1EY0A 3MVVA 3IRBA 1ENFA 2L12A 4P72A 1N9WA 3VR2A 3WOEA 4GLXA 4IPHA 1PH8A 1Q1BA 3CD6A 1VF5C 2JSOA 1YI2A 3M7GA 1WTRA 1N32Q 3HOZH 1SFOB 1SJED 4JI3L 2AUKA 3TS2A 2DN8A 3F2UA 1MJEA 2NN6I 2NN6H 3FRPB 1VQ7A 3CRLC 1ONLA 1YZ6A 4KN4C 5KYLA 1M90C 4X66L 5JVG3 2XIWA 1W2BA 2CH4A 5C4XB 5HURA 1H95A 1F9RA 4B3TL 3GTGH 1S40A 2EYFA 4GNXB 3RZDH 4AYBG 3NBHA 2R6GA 2FFKB 1IBML 1JWSD 2CWPA 4EQOA 2VUMH 2F0NA 4DV1Q 2BOSA 3BVZA 5KNCA 3CPFA 5EGTA 3JC66 1D5ZC 1I50B 3T56B 4X3KA 3OTOQ 2UUCL 5FLXL 2E75C 3CW2C 5L37A 5C4JH 2Q8IB 2OXPA 2JEAI 1Z6HA 3OOCA 1GUGA 5JOBA 2NVYB 2B63H 1T5EA 2MP1A 5JVH3 1JE4A 2KENA 1T5XD 3D6CA 4KD4A 1O78A 4V190 2HDLA 5A2QL 2HCCA 1LT3D 1EWIA 1IKMA 3DUZA 1QVGA 1AE2A 1K8AC 4RGTA 1LTLA 4JBJA 4KKTA 4CBVA 2IX0A 3QR8A 1A8VA 1N34Q 2LKVA 1VQ9A 4ZKCB 2R92G 2QGQA 1VQLA 1XTCD 3M3YB 3DWQA 1IBLQ 1IBKL 2VXWA 2AQ2B 1A15A 3K5OA 1ASYA 3BVGA 1Y69U 1XTDA 1HNWQ 2JA6G 5I2YA 4K6DA 2F0MA 3CQZH 4QUFA 2NBFA 4DF7A 1V1PB 3HG9A 2F0HA 1EUJA 1BBWA 2RDFA 3QO2A 2IX1A 5M5XB 1A3TA 1H9MA 3CPWA 1X55A 3BZKA 1CSPA 2F0KA 4X65Q 4JYAQ 2KCTA 3CXCA 4JI7L 5JEAG 2CWAA 2F4VL 2PQAA 2I07B 2Z8LA 1KRTA 4KLKA 5M3MH 1Q8KA 4I65A 2NZ1D 3KDFB 3RLNA 4RGOS 4A3FH 4OL7A 4A3MB 4YY3Q 5IP7G 2ZJPA 3L2PA 3H3VI 4L5SA 1CI3M 1VQ8A 1FJGQ 3ERQA 4CJ2C 5EPKA 2IT1A 2MUYA 3GTOH 4A3IB 4IZ8A 1JE5A 4KHPL 4HAEA 2SNSA 1L0XB 2GA4B 4JV5L 1MD2D 5K36G 5BR8Q 1B53A 4B08A 1TS2A 2JYOA 1YJ9A 4GOPA 4ME5A 4H0LC 5F2DA 1Y14B 4KD3A 2DUDA 2IY5B 4X64Q 3PO2G 3CCJA 2A6EC 1LUZA 1VQNA 2F0SA 3KLRA 4WJWA 4GKKQ 3HP3A 3J7AV 1HFNA 2VQEL 2YTVA 4O1NA 4OO1H 4OO1I 1SRUA 2HT1A 3TSSA 3MFYA 4IFDI 4IFDH 2R93H 2KCCA 4DAYA 3MEFA 2F0WA 3KJPA 5IGBA 2Z9HA 3K58A 3I4NH 1STEA 4RCOA 1GHJA 1DZ1A 5J1ZA 2ATWA 1WTPA 4QIWB 2Q2IA 4C2MH 1QNKA 4JVZA 2RHSB 1P8LA 4U673 2B2YC 1RDPD 5EKLA 1K8MA 5IYDG 2Z4HA 4F8MA 1EZ8A 1EQQA 1B44D 4R8NA 3JAME 4C3HG 5M9OA 3A0JA 5E1FA 4PG3A 1RHPA 4LK1C 5ELNA 1L0WA 2GVBA 1GUTA 3TREA 3T53B 1FNWA 2PQEA 3BS1A 5D65A 4YHHL 4A3DH 3S2HB 3TZDA 3KBGA 1ZXTA 2H4OA 1E1OA 1Q8IA 2RCNA 4N8X1 1PZID 2F0GA 4DAMA 3PIO3 1BXTA 1SYDA 1D8LA 3HOUB 3NK9A 3F2CA 3P7JA 1EFID 4K5WA 3HOXB 1G291 1FGUA 4DV6Q 2KQ3A 1HR0W 4FXDA 1F2LA 1M1KC 3EIVA 3W3AA 2UXDL 5CC4A 3OIQA 3R8BA 3BDCA 1UNSA 4FO2A 3CCLA 3R2TA 1JT8A 1HR0Q 3KF6B 2F0TA 2IWHA 4G7ZC 1OTCA 4OONA 4L63B 4YIJA 1Q3LA 4DR7Q 3TBIB 1NSNS 1UEBA 3CP0A 4OHJA 3J81c 5CBAE 4RWSC 3PF5A 2F0JA 4DK0A 5IP9H 4M8AA 4P75A 3KLSA 3OMGA 2QEJC 3A7AB 4BBRG 3QIAA 3RMHA 1DOMA 1V1QA 1GUOA 1JR0D 1PTOH 2WB1B 4WJ3M 3EJIA 2PW7A 1I6HH 3A8IE
chains in the Genus database with same CATH topology
4CJ0B 2KA7A 3SK5A 5KEEA 3M4YA 2DNCA 1KDAA 2C9OA 3SVMA 1S5FD 5E4WC 1EY5A 2WIIB 3ITPA 4S3SA 3W2DA 2RQXA 2F0PA 4XIGS 3A54A 4UAIA 4HMIA 2K01A 2KOLA 2ID0A 3C1FA 4HCSA 4GZYC 4O42A 4A3KB 4PMWA 1G2SA 5EPJA 5IGGA 5IT9L 1R4QB 2EJGC 1BUVT 5D14A 1EYCA 3FVQA 5IIFA 1TWHB 1EY7A 2K5QA 2NVQB 2NYZD 1SNPA 3S16B 2X6GA 1EL0A 2B2TA 3HKZB 2TSSA 1STGA 1SYCA 2CHBD 3K5MA 4HEDA 1U9RA 4ABNA 2AQ1B 1RKNA 2F0VA 4IURA 1ENCA 3HGBA 4DN4M 3SXHA 1TWAB 3PMFA 2K03A 3NSWA 3MXNA 2PYKA 3EFXD 2LMCB 2KHSA 3C46A 1SXTA 1TT2A 1JORA 4G4KA 3L3OC 1ESFA 3HOZB 1VF7A 2Z1CA 2XRQD 3J7AF 1KAAA 2B2UC 3I90A 3NXWA 2K6AA 1WTQA 2B39A 1AZPA 1LO5D 4QCLA 2WINB 3R93A 2PPBC 2HDMA 3GTGB 2ZT9C 1RD9D 1O80A 4XTCS 2WP8J 5IGFA 1D2BA 3RZDB 4KY5A 1V8QA 1S5BD 2QKIC 4ZUJA 4HMJA 2HQEA 2VB2X 3K0YA 2X69A 2VUMB 2FINB 1WTWA 2LY7A 4ZKBB 2V4DA 1SYBA 3Q0AA 1GUSA 3TP6A 1V1OA 2K5WA 2B63B 2K04A 1EQVA 2SDFA 2M00A 1HRJA 4LAAA 5ELDA 5EKIA 5FO9B 1SNQA 1EU4A 3X3NA 3LWEA 1LT4D 1U4RA 2BDOA 3H91A 2EY1A 5C0XJ 5ISRA 2L5TA 4KMUC 1CQVA 3NWTA 2OT2A 3CQZB 2L0CA 3A55A 1H9SA 4JK1C 1F2YA 3D3RA 2EE1A 1E2WA 2HUGA 1HFGA 2O2LD 3OIPA 1IYUA 4E6IA 5M3MB 3BDLA 1SAPA 1PLFA 3WOFA 5FLXE 4ULLA 2A6HC 2D5DA 3SDZA 4A3FB 2K05A 1JOOA 4IUTA 2FMCA 1KTKA 2SNMA 2CVRA 1STBA 5A2QE 1YNND 2O5JC 2FHTA 3QWNA 1XXGA 2QCPX 2ENBA 4HR7B 3GQBA 3IFDA 4RFBA 1DXMA 2ZXOA 4DXGA 2XN9C 3MEHA 2Y0SB 4F88A 1EQTA 1TQOA 2EZVA 2J4XA 2B2VA 2NB0A 1XWEA 3N52A 5E3FA 3E5SA 3PUVA 4G57A 2R93B 3PUWA 1HHVA 1LTRD 3CHBD 3BZDB 3IKJA 1PFMA 1I4QA 3I4NB 1JWMD 4QMGA 4C2MB 1WTXA 4PV1C 5DM73 4KK7A 1PMRA 5C5MA 1X32A 2H1EA 3LWUA 3PIP3 2A6ED 2PNRC 5CMDA 2NUCA 2G9HD 2AWOA 2QDBA 5FOBB 3D4DA 4B9XA 2MHVA 1IHZA 1SYFA 4KY6A 4H13C 2OEOA 4XQJA 2E74C 3EA6A 4A3DB 1DYQA 1EEFD 1I6VC 2ZXRA 2EJFC 5CV9A 4R8IA 3SK8A 2LS01 1EOTA 5HGTA 3I3CA 4FF3A 3H94A 3VYSA 3KF8A 3V2TA 1DONA 1PXUA 3FPUB 2KJXA 3T13A 3D31A 5CGKA 2LFNA 4TQUS 1IYVA 1QE6A 3I70A 1CFMA 2Q8RE 1CZWA 5C3XA 1D5XC 4DAPA 3OHXC 3A8KE 4C1NI 1C4QA 1O7YA 2EYOA 2K5DA 2E2DC 2RDHA 1WTVA 1PTOB 3U9SA 1I6HB 3H09A 4KY7A 3T51B 5C3EB 2L4NA 4NDXA 3P1HA 3I4LA 4CKBA 3CKIB 4XYOA 3DWAA 4C3JG 1UAPA 1AEXA 3A8JE 4Y7NB 4F7XA 5DEHA 3GP7A 1NR4A 2B2WC 3GTJB 1FNUA 1STYA 2EYPA 3S1QB 4BY7B 1S5ED 2F0DA 3Q23A 3UI2A 5ELBA 3HEJA 1U4PA 1UEAB 1Q90A 3ND9A 4UDUC 4KHZA 1YNNC 5COYA 3V05A 1BCPF 1STHA 1F9QA 4KJNA 4QF4A 3AU7A 3HOWB 3SK6A 3EQLC 2EY6A 2NTSA 2I46A 3A56A 5IGDA 2RDGA 2E2HB 3G7LA 1R9TB 1LTBD 3S15B 1EIHA 1NAPA 1VCIA 3OW7A 4FYDA 2WAQB 3NHHA 2A5HA 3DWPA 1QILA 4BA1I 3BYYB 5KGUA 3S1MB 2JP1A 5FK9C 5FO7B 3P75A 1O7ZA 4BBSB 2IX3A 1BDOA 1HCZA 1EYDA 1TR5A 1CA6A 2EYHA 3V96A 2A74C 5JEAH 4CHTB 1LT5D 3PUZA 1HA6A 5IT9E 5JPMC 1BCPB 3OMCA 1Z47A 3I72A 1I3QB 1IL8A 5C5LA 1JOQA 1WCMB 2AWNA 2JEBI 1ESRA 1VMPA 4K8IA 2KECA 5CV7A 3H0GB 5K36H 3R3OA 4RKLA 1GUWA 1DCZA 1QWYA 1TVXA 3NP8A 5J39A 1OO9B 4J6HA 1SE4A 1BOSA 5D3DA 2EOTA 4Z9CB 1BR9A 1MSGA 1ET6A 1CZGA 3TDQA 5KYIA 1TKWB 1LLRD 5I2XA 2DY8A 1ML0D 1JOKA 5ELFA 1STNA 1FYCA 1A3VA 3VA7A 4A3GB 4OIKA 3S2DB 1MSHA 4BA2I 1CM9A 3FDTA 3HOYB 4C1NK 5C0XG 5M5WB 1ET9A 1EZ6A 1A6XA 2BA0A 2F0FA 3NQTA 4ZLTF 4FNFA 3VR6A 3HS0C 3DEOA 1AN8A 3QOJA 4H44C 2O5IC 1ENAA 2C5CA 1CK1A 1YNJC 2K1BA 2L11A 2RSOA 3S1RB 4KI0A 4K8JA 3MWYW 1JCKB 5KRUA 4K2LA 1H9SB 2IW3A 1GOZA 5C3WA 2D9UA 4CJ1B 4V0BA 3HOVB 1QNUA 1EY8A 5IODA 2L9HA 1NUCA 2F03A 2JXMB 2EYMA 1DD2A 4NMZA 4DU9A 3FPPA 4L6TB 3I73A 1FNVA 1A3UA 4C3IB 1PFBA 3LNNA 3OSOA 4B9WA 3M85A 2NVXB 5C0XI 1ILPA 2B2VC 2A6HD 4U68A 4BY1B 4XYQA 2NVTB 1MBYA 4ILWA 3U9OA 4IFDJ 3D4RA 1SDFA 2RVLA 1WTOA 3H6MA 1Y8PB 4RGMA 4ID6A 1X3QA 4TKOB 3E0JA 4IUNA 1G6ZA 1JICA 2F3VA 2BDNA 1BF4A 1RCVD 2F0LA 3MAQA 2F0OA 2IJ0A 1U4LA 2J0TD 5ELEA 2F1MA 1B50A 1Q12A 1EWCA 2WKCA 1F77A 5C44B 2K7VA 1OXXK 3J81L 4A3BB 2A68D 5EBCA 1V43A 1PRTB 3GV6A 1KABA 2WACA 3RD4A 3AB9A 2OF1A 4C56C 3GTLB 1EYAA 3BG3A 3FEWX 3D6WA 2EPBA 3GTMB 1LTSD 3P20A 3K5LA 1Y1WB 3S14B 4RKBA 4EQNA 3OWEB 5LHY1 3J7YW 4FXGC 4NKLA 4DNRB 1SE3A 1B9MA 2B2YA 1SNCA 5JAVA 4WORA 1F9PA 5C4JB 5BN4A 3EVQA 5E4XA 2XVSA 1G8ZD 3SR1A 3PUYA 4J1MA 3GTKB 5T1IA 3OPOA 4EVOA 1PTOD 1TS5A 4FF4A 2JE6I 1KDBA 5FKAC 1LTGD 3EROA 3O13A 2E2JB 4DGZA 2CQAA 1I4HA 2MPMA 3RUZA 1RF2D 1FGBD 2F4IA 4H7BA 5BN3A 1SNMA 3SEBA 2L1BA 5LL6S 4RAUC 1DM0B 2R61A 4AYBB 2CW0D 3DMUA 4PNYA 5CYUA 4FF1A 5BN5A 3TN2A 1LTID 2IPKD 3K59A 1DJRD 1C48A 1DOKA 2F0QA 3NE5B 5T1GA 5CV6A 5DNFA 3GTOB 3VR5A 4KJOA 5EPLA 3QG1A 1TIID 3Q24A 1WD0A 2R92B 3R2IA 2SEBD 4K2KA 4K14A 5LL6X 2B8GA 4Q0FA 4PMCA 2JA6B 4K6LA 4PQXA 1I4GA 5D3IB 4KV6A 1TWCB 1W6KA 1SNDA 4XQQA 4X3UA 2EYLA 2X6LA 1E0BA 2F0IA 2RKSA 1I4XA 2A68C 2ZXPA 1VDZA 2NN6G 1PZKD 4FVMA 1AFPA 4P2CB 2A69C 3NTKA 1PTOF 4I7ZC 1M4VA 1WD1A 3TP5A 2NTTA 1EIGA 1B3AA 3VR4A 4XDXA 1Q1EA 1IW7D 2F3WA 4R9WA 1BCPD 1LTTD 1II3A 1TWFB 1C8CA 1XX8A 1KDCA 1SEBD 3FMCA 3SE0A 4DK1A 3NBIA 2TMPA 2KEDA 3VR3A 4X3SA 4ZRZA 3PO2B 3Q6SA 1E2VA 4X3TA 1A2TA 3NTIA 1BO0A 2B8FA 3MFGA 4MHEA 1QJOA 4FXKC 2BA1A 1GXDC 4RH6A 4NP5A 1HPCA 4QB4A 1B2TA 4HN7A 3NTHA 1PTOC 4HCEA 2B2UA 4KN7C 2AUJD 5M5YB 3GO5A 4C3HB 3I91A 3J80L 1S5CD 2E76C 2L55A 3DXJC 3BYTB 3IFTA 2N55A 4RCNA 3VYRA 1RTOA 4ZK9B 1HQMC 1MGSA 1TWGB 1E2ZA 1X3PA 2CW0C 1AW7A 3KBXA 1ICWA 4OIJA 4DXFA 5CORA 4EQPA 3D4WA 1Y8NB 3MHBA 3PV0A 3QOLA 1DOLA 3GTPB 1YNJD 2M9VA 4CKEA 3KLSX 1LACA 3L7ZC 2AQ3B 3BVMA 2PZTA 3M4OB 3DHQA 2EY2A 3S9WA 2F0EA 4NW2A 3S1NB 3VYUA 2IL8A 1PZJD 4ZUIA 4BBRB 5IGCA 4OO1G 1ZEQX 4K5VA 4IFDG 2VB3X 1K83B 1OXSC 2B2TC 4TRDA 1SYGA 1SJHD 1NR2A 4IUPA 1HXYD 3RLFA 5KNDA 3K7AB 4OGQC 2RBMA 1AP0A 5IGEA 3LX0A 3DM1A 2Z4IA 1CHQD 1TY2A 2F0UA 1HUNA 2K32A 2PZWA 1EY6A 4HSPA 4QUCA 5I9PA 3A7LA 1BBXC 1IW7C 3I8ZA 1BCPC 5J22A 1ZKOA 1RODA 4XT1B 1JC7A 2N88A 1CTMA 2PCFB 3ONAB 2ICEC 1J9OA 4A3JB 2BE5C 2JA5B 5EBDA 1PRTD 2BCOA 4MN3A 1SE2A 2PW5A 5EJWA 2XWBB 4RHSA 4HTHA 4FF2A 2VNUD 4ZAIA 1KLUD 3MC0B 1OXTA 2SOBA 3QJYA 4ZYSA 4L8JA 2JA7B 1VMCA 1HUMA 1PFNA 4G7HC 3J81E 5K5PA 1W6JA 1WVLA 5C6AA 4Q5VA 1S5DD 4WRDA 2O4XA 3E6ZX 1J8IA 2EY5A 1LV9A 4A3EB 2EXZA 2YU9B 3GV3A 1D1IA 4M1UB 3MA2B 3TP8A 1D1KA 1D5MC 1H9RA 3Q22A 1Z7TA 4EGVA 1EWHA 1S4ZA 4G7OC 5I6YA 3FKIB 4HSVA 1M8AA 1SBBB 3MXUA 1SMYD 3X3MA 1F2MA 5I4DA 3K5NA 1PDQA 2PO4A 1EY4A 1CA5A 1B4OA 1TY0A 1TS3A 2MJ8A 1SNOA 5CV8A 4RA8A 1R4PB 2XRSD 1CT1D 2XNAC 1B9NA 1PRTF 5AFWA 3L9AX 1D6EC 2EYJA 4IALA 4IUUA 4ODGA 1ZYRD 2Q8TA 1HQRD 3PUXA 1BNZA 3C3LA 3D8GA 3T16A 1V1PA 2D2CC 3NUCA 5C0XH 3DEPA 5FO8B 2B2WA 3MXPA 2FJ2A 2WKDA 1PYWD 4CGYB 3IAYA 3I4MB 3MTSA 2HCIA 1UUPA 4MIUA 5JEAJ 4A93B 3SK4A 4N9TA 3GTQB 3HRZC 2E2IB 2DY7A 3ND8A 5EKKA 1NCVA 2KCNA 2JA8B 3JAML 3MZ5A 4LMQD 3URYA 1XYIA 2XWJB 1PRTC 4IUVA 4KKUA 3VYTA 1F9SA 1STAA 1H9JA 1RTNA 1FR3A 4F87A 4FP5D 5M3FB 2ICIA 1GJXA 5IOCA 2K28A 3T4AC 3AMUA 2XSCA 1RJTA 2A69D 1B1ZA 2PZUA 4N9PA 3G6JB 1QB5D 3MXGA 3S17B 3N6RA 2MGSA 1QCBD 1IKLA 4KHVA 4WFN3 1Y8OB 1JB3A 2YYZA 5I6WA 2QILA 4K5XA 1G2TA 1SYEA 3SHLA 1LTAD 3C1EA 5G3LD 3BDOA 5CV5A 5TSSA 2D62A 1TU2B 1HTPA 2KUMA 1CQFA 1CHPD 1OXUA 4IQZA 3HZXA 4DFAA 1I4PA 1LT6D 3M7NA 3RZOB 4PMBA 2R3ZA 1MI2A 3CRKC 1FD7D 5I9OA 2WV6D 1SMYC 2EJMA 3NQIA 1KLGD 1JQYD 3IL8A 2QF7A 4JBWA 4XXEA 4BWGB 2FMMA 5CV4A 4RGNA 1H9KA 4IN3A 1L0YB 5DM63 4C3IG 1HTLD 2KEEA 3OWFA 3H3VC 1OXVA 1ZYRC 1QG7A 4ZQ3A 1A2UA 5A35A 3J80E 2PMZB 1I4RA 4TSSA 2G9DA 2J7ZA 5C4ZA 1JWUD 3CU7A 4IUQA 1EU3A 5KIXA 2M2LA 1EY9A 3VA5A 4C3JB 1KNEA 2NWGA 4DNTB 1QOHA 5NUCA 1EEID 4KKSA 1K8OA 2KVMA 5DAUA 5G3LF 5CBEE 1GUNA 3K6OA 1KNAA 1LABA 3GD7A 3C2PA 4DA2A 1G91A 5CR3A 1AZQA 1O7LA 2R7ZB 5KNBA 2DNEA 5EQ0A 1F2ZA 2EVBA 1HA5A 3WDNA 5JJZA 2RSNA 4RHRA 3TP7A 2RA4A 1ILQA 3KUPA 4XT3B 3TZUA 3KK7A 1SSOA 3K57A 3PO3B 4DAVA 3NWSA 5ELCA 1GHKA 3QB3A 5C4HA 2A73B 4J8QA 1BQQT 2BE5D 4XQNA 5JPNC 2K33A 4KTAA 2EDGA 3NPPA 3TMEA 4CKCA 4BS9A 1U4MA 4LJZC 1Y1VB 1TS4A 3ZYYX 1EY0A 3MVVA 1ENFA 2L12A 3VR2A 3WOEA 1Q1BA 1VF5C 2JSOA 3M7GA 1WTRA 1SFOB 1SJED 2AUKA 2DN8A 3F2UA 2NN6I 2NN6H 3FRPB 3CRLC 1ONLA 4KN4C 5KYLA 5JVG3 2XIWA 5C4XB 5HURA 1F9RA 2EYFA 3NBHA 2R6GA 2FFKB 1JWSD 4EQOA 2F0NA 2BOSA 3BVZA 5KNCA 5EGTA 1D5ZC 1I50B 3T56B 4X3KA 5FLXL 2E75C 2Q8IB 2OXPA 2JEAI 1Z6HA 3OOCA 1GUGA 5JOBA 2NVYB 1T5EA 2MP1A 5JVH3 1JE4A 1T5XD 3D6CA 4KD4A 1O78A 4V190 2HDLA 5A2QL 2HCCA 1LT3D 1IKMA 3DUZA 4RGTA 4KKTA 4CBVA 2IX0A 2LKVA 4ZKCB 1XTCD 3M3YB 3DWQA 2VXWA 2AQ2B 1A15A 3K5OA 3BVGA 1Y69U 5I2YA 4K6DA 2F0MA 4QUFA 2NBFA 4DF7A 1V1PB 3HG9A 2F0HA 2RDFA 3QO2A 2IX1A 5M5XB 1A3TA 1H9MA 2F0KA 5JEAG 2I07B 2Z8LA 4I65A 2NZ1D 4RGOS 4OL7A 4A3MB 1CI3M 3ERQA 4CJ2C 5EPKA 2IT1A 2MUYA 4A3IB 4IZ8A 4HAEA 2SNSA 1L0XB 2GA4B 5K36G 1MD2D 1B53A 4B08A 1TS2A 2JYOA 4ME5A 4H0LC 5F2DA 4KD3A 2A6EC 2F0SA 3KLRA 4WJWA 3HP3A 3J7AV 1HFNA 4O1NA 4OO1H 4OO1I 3TSSA 3MFYA 4IFDI 4IFDH 2KCCA 4DAYA 2F0WA 5IGBA 3K58A 1STEA 4RCOA 1GHJA 1DZ1A 5J1ZA 1WTPA 4QIWB 1QNKA 4U673 2B2YC 1RDPD 5EKLA 1K8MA 2Z4HA 4F8MA 1EZ8A 1B44D 4R8NA 3JAME 4C3HG 5M9OA 5E1FA 1RHPA 4LK1C 1GUTA 3T53B 1FNWA 2PQEA 3BS1A 5D65A 3S2HB 3TZDA 3KBGA 1ZXTA 2H4OA 1Q8IA 1PZID 2F0GA 3PIO3 1BXTA 1SYDA 3HOUB 3NK9A 3P7JA 1EFID 4K5WA 3HOXB 1G291 2KQ3A 4FXDA 1F2LA 3W3AA 5CC4A 3OIQA 3R8BA 3BDCA 1UNSA 4FO2A 3R2TA 2F0TA 2IWHA 4G7ZC 4L63B 4YIJA 1Q3LA 3TBIB 1NSNS 4OHJA 5CBAE 4RWSC 2F0JA 4DK0A 4M8AA 3KLSA 3OMGA 2QEJC 3A7AB 3QIAA 3RMHA 1DOMA 1GUOA 1JR0D 1PTOH 2WB1B 3EJIA 2PW7A 3A8IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHQ A;  5CR3 A;  2EY2 A;  2SOB A;  3S9W A;  2F0E A;  2F0L A;  2OXP A;  2F0W A;  5IGD A;  3HZX A;  1JOO A;  5JOB A;  3SK5 A;  5IGB A;  2F0O A;  3NXW A;  5KEE A;  2SNM A;  4DFA A;  3DMU A;  1EZ6 A;  1KDA A;  4ZUI A;  3D6C A;  5C3X A;  4PNY A;  5J1Z A;  4KD4 A;  1STB A;  4PMB A;  4MIU A;  1F2Z A;  5IGC A;  2F0F A;  3NQT A;  1EY5 A;  3NHH A;  5I9O A;  3SK4 A;  3TP7 A;  4K5V A;  1A2T A;  4N9T A;  5IGF A;  5EKL A;  3QOJ A;  2ENB A;  3ITP A;  4KY5 A;  5K5P A;  1ENA A;  4S3S A;  4TRD A;  5EKK A;  4F8M A;  2LKV A;  1SYG A;  1EZ8 A;  5KGU A;  4R8N A;  4ZUJ A;  3MEH A;  3P75 A;  4HMJ A;  2HQE A;  5M9O A;  2F0P A;  2F0Q A;  3MZ5 A;  2EYO A;  5E1F A;  5C6A A;  4WRD A;  3QB3 A;  2O4X A;  4K8J A;  1TQO A;  5KRU A;  5CV6 A;  4HMI A;  2EY5 A;  4K2L A;  1EYD A;  2PQE A;  1KAB A;  1TR5 A;  5C4H A;  1SYB A;  4NP5 A;  3C1F A;  5CV4 A;  2WAC A;  1STA A;  4QB4 A;  2OF1 A;  2EYH A;  4KY7 A;  3E5S A;  5E3F A;  1EYA A;  2F0M A;  2EXZ A;  4K6D A;  5C3W A;  4NDX A;  3P1H A;  4G57 A;  4KJO A;  4KTA A;  4DF7 A;  3TP6 A;  2RBM A;  3OWF A;  2F0G A;  3TP8 A;  1EY8 A;  3LX0 A;  1SYD A;  2F0H A;  1EQV A;  5IGE A;  5IGG A;  5IOC A;  3TME A;  2RDF A;  2M00 A;  2F0U A;  5IOD A;  1A3T A;  4RKB A;  3NK9 A;  3OMC A;  4QMG A;  4EQN A;  4ZQ3 A;  2PZW A;  1NUC A;  1EY6 A;  1A2U A;  1AEX A;  4LAA A;  1EYC A;  2F0K A;  4K5W A;  5I6Y A;  5I9P A;  4K2K A;  2EYM A;  5C5L A;  1JOQ A;  1EY0 A;  3MVV A;  5IIF A;  4K14 A;  1SNQ A;  4NMZ A;  4DU9 A;  1EY7 A;  1F2M A;  4NKL A;  4F7X A;  5DEH A;  5J22 A;  4PMC A;  5C5M A;  1SNP A;  2KQ3 A;  4K8I A;  1STY A;  1SNC A;  2PZU A;  4N9P A;  1A3U A;  2EYP A;  2NUC A;  5C4Z A;  5CC4 A;  5JAV A;  2QDB A;  4I65 A;  3BDC A;  3OSO A;  4KV6 A;  1STG A;  4B9W A;  2F0D A;  2EY1 A;  3D4D A;  4B9X A;  4OL7 A;  1SYC A;  4WOR A;  5CV7 A;  3HEJ A;  1IHZ A;  5KIX A;  1SYF A;  3R3O A;  1EY9 A;  4KY6 A;  1SND A;  5ISR A;  1EY4 A;  4RKL A;  1U9R A;  3EVQ A;  5KYL A;  2OEO A;  4KHV A;  3VA5 A;  2F0T A;  2EYL A;  1RKN A;  3NP8 A;  5J39 A;  3ERQ A;  5I6W A;  2F0V A;  4K5X A;  4EQP A;  4J6H A;  3SR1 A;  1SYE A;  1ENC A;  5HUR A;  3U9O A;  1SNO A;  3MXP A;  3D4W A;  5CV8 A;  4IZ8 A;  3SXH A;  2F0I A;  1STH A;  3PMF A;  4YIJ A;  4J1M A;  2RKS A;  3SHL A;  3MHB A;  4KJN A;  2SNS A;  4EVO A;  2PYK A;  5CV9 A;  1NSN S;  2EYF A;  3C1E A;  3SK8 A;  3QOL A;  5KYI A;  3H6M A;  5NUC A;  4QF4 A;  1F2Y A;  1KDB A;  3ERO A;  5HGT A;  2F0J A;  2EYJ A;  4ME5 A;  2PW5 A;  4IAL A;  5CV5 A;  4ODG A;  4DGZ A;  4ID6 A;  2KHS A;  3OMG A;  5F2D A;  4KD3 A;  5DAU A;  3V2T A;  3TP5 A;  4EQO A;  4IUN A;  2F0N A;  3D8G A;  3SK6 A;  3T16 A;  3RUZ A;  3NUC A;  2F3V A;  4HTH A;  1TT2 A;  2F3W A;  1JOR A;  5EGT A;  2F0S A;  1II3 A;  4H7B A;  1JOK A;  1SNM A;  4E6I A;  1STN A;  3EJI A;  3BDL A;  3T13 A;  1KDC A;  2PW7 A;  2PZT A;  1A3V A;  5CGK A;  2EY6 A;  1KAA A; 
#chains in the Genus database with same CATH topology
 4CJ0 B;  5C3E H;  1PH2 A;  1TWG H;  2KA7 A;  5H1S E;  3SK5 A;  5KEE A;  3M4Y A;  1B8A A;  2DNC A;  1KDA A;  2C9O A;  3SVM A;  1X54 A;  4DV1 L;  4JI6 L;  1S5F D;  1NNX A;  4OEL B;  5E4W C;  1EY5 A;  1XJV A;  4Y7N H;  2WII B;  3OTO L;  2QA4 A;  3ITP A;  4S3S A;  3GTJ H;  1K0S A;  3W2D A;  3GDE A;  2RQX A;  3S1Q H;  2F0P A;  4BY7 H;  4XIG S;  3A54 A;  4UAI A;  4HMI A;  2K01 A;  2KOL A;  2ID0 A;  4DK6 C;  2C35 B;  3C1F A;  4HCS A;  4GZY C;  4A3C H;  4R4T A;  1FL0 A;  4O42 A;  4A3K B;  4PMW A;  1G2S A;  5EPJ A;  1N34 L;  1YIT A;  5IGG A;  5IT9 L;  4UHV A;  1R4Q B;  2ZTC A;  1GD7 A;  2EJG C;  2JA5 G;  1BUV T;  4A3J G;  1YHB A;  5D14 A;  1EYC A;  3FVQ A;  4B3S L;  5IIF A;  1TWH B;  1PH6 A;  1EY7 A;  3HOW H;  2K5Q A;  2I5L X;  2NVQ B;  2NYZ D;  1SNP A;  3S16 B;  2X6G A;  1EL0 A;  2B2T A;  5JJK A;  1VS0 A;  3HKZ B;  1I94 L;  2TSS A;  1STG A;  1SYC A;  1J6Q A;  5IWA L;  2CHB D;  4HJ8 A;  3K5M A;  3ER0 A;  4HED A;  1U9R A;  4ABN A;  2AQ1 B;  2E2H H;  4JI3 Q;  1RKN A;  1K73 C;  1VQ5 A;  1R9T H;  2F0V A;  4IUR A;  3TRZ A;  1ENC A;  3HGB A;  4DN4 M;  3S15 H;  4X66 Q;  3SXH A;  1TWA B;  3PMF A;  5IE8 A;  2K03 A;  3NSW A;  3MXN A;  3J80 i;  2PYK A;  1VQJ A;  3EFX D;  4B3T Q;  2JA7 G;  3S1M H;  2N78 A;  2LMC B;  2KHS A;  4BBS H;  3C46 A;  1SXT A;  1FJG L;  1TT2 A;  1JOR A;  4G4K A;  3L3O C;  1IBM Q;  1ESF A;  3HOZ B;  1VF7 A;  2Z1C A;  2XRQ D;  3J7A F;  1KAA A;  1RL2 A;  1X6O A;  2AHO B;  4EQ5 A;  5BR8 L;  1VQA A;  4ZCK A;  2B2U C;  3I90 A;  2DJG C;  3NXW A;  2UUC Q;  3I4O A;  2K6A A;  1WTQ A;  2B39 A;  4A3E G;  1AZP A;  4HJ9 A;  1LO5 D;  4QCL A;  1I3Q H;  2WIN B;  3R93 A;  4B3R L;  2PPB C;  2HDM A;  1WCM H;  2ZT9 C;  3GTG B;  4DV4 L;  1RD9 D;  1O80 A;  4XTC S;  2WP8 J;  5IGF A;  1D2B A;  3RZD B;  4KY5 A;  1V8Q A;  1S5B D;  2QKI C;  4ZUJ A;  4HMJ A;  2HQE A;  4IOA A;  2VB2 X;  3K0Y A;  2X69 A;  2VUM B;  2FIN B;  3W1B A;  3FKI G;  3H0G H;  2LY7 A;  1WTW A;  1UE5 A;  1VQO A;  4ZKB B;  2V4D A;  3NBH B;  1SYB A;  4JG2 A;  3CCQ A;  3Q0A A;  2EQS A;  1GUS A;  5GAD C;  3TP6 A;  1V1O A;  3PGZ A;  4R4Q A;  3T1H L;  2K5W A;  2K5V A;  2B63 B;  2K04 A;  2KBN A;  4YCU A;  1EQV A;  2SDF A;  4LF8 Q;  2M00 A;  1HRJ A;  4LF7 L;  3M9B A;  4LAA A;  1VQE A;  5ELD A;  5EKI A;  5FO9 B;  3G4S A;  1SNQ A;  1EU4 A;  3K8A A;  4JI4 L;  3X3N A;  3LWE A;  4JI7 Q;  1LT4 D;  3CF5 A;  1U4R A;  3U4V A;  2BDO A;  2UXC Q;  3H91 A;  4A3G H;  3S2D H;  2EY1 A;  5C0X J;  5ISR A;  3HOY H;  5M5W H;  2L5T A;  1WI5 A;  4KMU C;  4DV0 L;  1CQV A;  3NWT A;  2OT2 A;  3CQZ B;  3AFP A;  2L0C A;  4HID A;  3ULJ A;  3A55 A;  1H9S A;  4JK1 C;  1SR3 A;  1F2Y A;  3I4M G;  4B3M Q;  4JV5 Q;  3D3R A;  2EE1 A;  3CC4 A;  1YJW A;  1E2W A;  2HUG A;  1HFG A;  2O2L D;  3PSI A;  3TQY A;  3S1R H;  1JJ2 A;  4A93 G;  3OIP A;  4OWX B;  1IYU A;  4E6I A;  5M3M B;  1HZ9 A;  3BDL A;  1SAP A;  1PLF A;  3WOF A;  3W5O A;  3HFZ B;  3PIO A;  5FLX E;  4ULL A;  2A6H C;  2D5D A;  3SDZ A;  4A3F B;  2JA8 G;  2VQE Q;  3ULL A;  2K05 A;  3HOV H;  1JOO A;  2UUB L;  4IUT A;  2A1A A;  2FMC A;  2E5L L;  2SNM A;  1KTK A;  3M4Q A;  2CVR A;  1STB A;  5A2Q E;  1YNN D;  2Z6K C;  2O5J C;  2FHT A;  4UPA A;  3QWN A;  5M3F G;  1XXG A;  3I7F A;  2QCP X;  2ENB A;  4HR7 B;  4A4I A;  3GQB A;  2QW7 A;  3IFD A;  4RFB A;  1DXM A;  2ZXO A;  4DXG A;  2XN9 C;  3MEH A;  2Y0S B;  4C3I H;  2NVX H;  4F88 A;  1EQT A;  2QDL A;  1QVC A;  1TQO A;  2UUA Q;  2EZV A;  2J4X A;  4EX5 A;  2B2V A;  4BY1 H;  2NVT H;  2NB0 A;  4GOP B;  1XWE A;  3N52 A;  5E3F A;  3E5S A;  3PUV A;  4G57 A;  2R93 B;  5FLX c;  3PUW A;  1HHV A;  1LTR D;  3CHB D;  3IKJ A;  3BZD B;  1PFM A;  1I4Q A;  1MJC A;  3I4N B;  1JWM D;  4QMG A;  4WJ4 A;  4C2M B;  1WTX A;  4PV1 C;  1Z9F A;  5DM7 3;  4KK7 A;  4DAY B;  1PMR A;  1A62 A;  5FJ8 H;  5C5M A;  1X32 A;  2H1E A;  3LWU A;  3PIP 3;  2A6E D;  4DUY L;  1C0A A;  2PNR C;  5CMD A;  1EOV A;  4A75 A;  2NUC A;  2G9H D;  2AWO A;  2QDB A;  5FOB B;  1J5E Q;  3D4D A;  4IPC A;  4B9X A;  2MHV A;  2CQO A;  4JI0 L;  1IHZ A;  1SYF A;  4KY6 A;  4H13 C;  1XMO L;  3D0F A;  2OEO A;  4XQJ A;  2E74 C;  3EA6 A;  4A3D B;  5C44 H;  1X9N A;  1DYQ A;  1EEF D;  1I6V C;  2P5Z X;  4YCW A;  2ZXR A;  2EJF C;  1K9M C;  4A3B H;  3UDI A;  5CV9 A;  4R8I A;  3SK8 A;  2LS0 1;  1EOT A;  5HGT A;  3I3C A;  1VQB A;  2QEX A;  4FF3 A;  3H94 A;  3VYS A;  1YEZ A;  3KF8 A;  3V2T A;  1LM0 A;  1DON A;  1PXU A;  4MTK A;  4GNX C;  3FPU B;  2KJX A;  5HY6 A;  4YWL A;  3T13 A;  3D31 A;  5CGK A;  2LFN A;  3GTL H;  1A63 A;  4TQU S;  1NJI C;  3GTM H;  1IYV A;  1QE6 A;  1L1O A;  1VQ6 A;  3I70 A;  3CAM A;  1CFM A;  2Q8R E;  3OW2 A;  4H02 A;  4JI5 L;  1CZW A;  1Y1W H;  5C3X A;  1D5X C;  3S14 H;  1PH9 A;  1X65 A;  1E24 A;  1HZB A;  3CCS A;  4DAP A;  2NZO A;  3OHX C;  3A8K E;  4JI6 Q;  4C1N I;  1C4Q A;  4MTN A;  1QZH A;  1O7Y A;  2UXB L;  2HIX A;  2EYO A;  2K5D A;  4IJL A;  1GO3 E;  2YTY A;  2E2D C;  2RDH A;  4HIM A;  1WTV A;  1PTO B;  3ICE A;  2KHJ A;  3U9S A;  1I6H B;  3H09 A;  1VQM A;  4KY7 A;  4RG1 A;  3T51 B;  5IYC H;  5C3E B;  2L4N A;  4NDX A;  3P1H A;  3I4L A;  4CKB A;  3CKI B;  3GTK H;  4XYO A;  4YWK A;  4NXN L;  3DWA A;  1PH7 A;  1N8R C;  4FDB A;  4C3J G;  2E2J H;  1UAP A;  1AEX A;  1HNX Q;  3A8J E;  3UE1 A;  4HJ7 A;  4Y7N B;  1VQP A;  4F7X A;  5DEH A;  3GP7 A;  1NR4 A;  2B2W C;  4GS3 A;  4B3S Q;  1FNU A;  3GTJ B;  4NB3 A;  1STY A;  2EYP A;  3S1Q B;  1UE1 A;  3CCR A;  4BY7 B;  2Q2H A;  1S5E D;  2GVA A;  2F0D A;  3Q23 A;  3UI2 A;  2D0O A;  4O2D A;  5ELB A;  4LF8 L;  3HEJ A;  1NY4 A;  1U4P A;  1UEA B;  2PI2 E;  1I94 Q;  1Q90 A;  3ND9 A;  4MZ9 A;  4KHZ A;  1YNN C;  3DM3 A;  4UDU C;  5COY A;  3V05 A;  5IWA Q;  2MNA A;  3J81 i;  2K75 A;  1BCP F;  1STH A;  1V9P A;  1BVS A;  1B70 B;  3J7A 5;  1F9Q A;  4KJN A;  2UXC L;  2JN4 A;  4QF4 A;  2CH4 W;  2R7Z G;  3AU7 A;  2EXD A;  1IYJ B;  3HOW B;  3SK6 A;  2MO0 A;  4LWC A;  3ULP A;  3EQL C;  1EIY B;  5IY0 A;  3H3V H;  4DV3 L;  1UE7 A;  2EY6 A;  1NBW A;  4QQB X;  2NTS A;  2I46 A;  3AYH B;  3PO3 G;  3A56 A;  5IGD A;  4B3M L;  2RDG A;  2E2H B;  1W3S A;  3L0O A;  3G7L A;  1R9T B;  2R92 H;  1LTB D;  4UP9 A;  3S15 B;  5GAE C;  1EIH A;  1NAP A;  1VCI A;  3OW7 A;  4FYD A;  2WAQ B;  3NHH A;  2A5H A;  3DWP A;  1SRO A;  4LF4 L;  1QIL A;  1Q7Y C;  4B3R Q;  4BA1 I;  3BYY B;  5KGU A;  2JA6 H;  3S1M B;  4DV4 Q;  2JP1 A;  5FK9 C;  5FO7 B;  1KIX A;  3P75 A;  1O7Z A;  4LF5 L;  4BBS B;  1Y1V G;  2IX3 A;  4GLA C;  1TWC H;  3HKZ E;  3MXN B;  1BDO A;  1HCZ A;  1EYD A;  1TR5 A;  1HNZ L;  4JOI C;  4L5R C;  1KXL A;  1CA6 A;  2EYH A;  3V96 A;  1E7Z A;  2A74 C;  5JEA H;  4LFC L;  2IHF A;  1JJG A;  4LF9 L;  4BXX G;  4CHT B;  1LT5 D;  3A74 A;  3PUZ A;  1HA6 A;  5IT9 E;  5JPM C;  1JJC B;  1BCP B;  3STB D;  3T1H Q;  3OMC A;  1Z47 A;  3I72 A;  1I3Q B;  1YBY A;  2UUA L;  5C4X G;  2KCM A;  1IL8 A;  5C5L A;  5IP7 H;  1JOQ A;  1WCM B;  2AWN A;  4LF7 Q;  2JEB I;  1HJP A;  1ESR A;  1VMP A;  1TWF H;  4K8I A;  2KEC A;  4JI4 Q;  4DNI A;  1PHJ A;  2YV5 A;  4JBM A;  3G48 A;  3H0G B;  5CV7 A;  5K36 H;  3R3O A;  4RKL A;  1GUW A;  1DCZ A;  1QWY A;  1TVX A;  3NP8 A;  4ME3 A;  5J39 A;  2DJF C;  1OO9 B;  4J6H A;  1SE4 A;  4PZ6 A;  1BOS A;  5D3D A;  2EOT A;  4Z9C B;  4DV0 Q;  1BR9 A;  3PO2 H;  1MSG A;  1ET6 A;  1PFS A;  1CZG A;  3CCM A;  2ZJQ A;  3TDQ A;  5KYI A;  1XMQ L;  1YHQ A;  1TKW B;  1J5E L;  3U50 C;  4A76 A;  1LLR D;  5I2X A;  4DR1 L;  2DY8 A;  1ML0 D;  3JAM c;  3CME A;  4AIM A;  2BH2 A;  1PV4 A;  2JJQ A;  1QUQ A;  3AEV A;  1CKN A;  1JOK A;  3EN2 A;  5ELF A;  1STN A;  1FYC A;  1VQK A;  1A3V A;  2BH8 A;  3VA7 A;  4A3G B;  4OIK A;  1ASZ A;  1MSH A;  4BA2 I;  3S2D B;  1CM9 A;  1VQH A;  3FDT A;  3J7Z C;  3K81 C;  3NEM A;  3G6E A;  5IYD H;  3HOY B;  4C1N K;  5C0X G;  5M5W B;  4OX9 Q;  1ET9 A;  1EZ6 A;  5M5Y H;  1A6X A;  4C3H H;  2UUB Q;  1HZC A;  2BA0 A;  2F0F A;  4NXM Q;  2E5L Q;  3NQT A;  1X3F A;  1KQS A;  1NMF A;  4ZLT F;  4FNF A;  3VR6 A;  3PIP A;  3HS0 C;  2N3S A;  3DEO A;  1AN8 A;  3QOJ A;  4H44 C;  2O5I C;  1ENA A;  2C5C A;  1CK1 A;  1YNJ C;  2K1B A;  2L11 A;  2RSO A;  2EIF A;  2LXJ A;  3S1R B;  4KI0 A;  2PNH A;  4K8J A;  5E7N A;  3CCU A;  3MWY W;  1JCK B;  5KRU A;  3AQQ A;  2V1C C;  4K2L A;  1H9S B;  2IW3 A;  3W1G A;  3TEH B;  2F3I A;  1GOZ A;  5C3W A;  2D9U A;  4CJ1 B;  2Q2U A;  2DGY A;  4V0B A;  3HOV B;  5DLQ E;  3CC7 A;  1FVI A;  3S24 A;  4A3M G;  1QNU A;  1EY8 A;  4R4I A;  4CDF C;  5JJI A;  2PMZ E;  5IOD A;  2L9H A;  3GTP H;  1MIU A;  1NUC A;  2F03 A;  2JXM B;  2EYM A;  1DD2 A;  4LUZ A;  4NMZ A;  4DU9 A;  4A3I G;  3FPP A;  4L6T B;  5IYB G;  3I73 A;  1FNV A;  3M4O H;  1A3U A;  3TS0 A;  4C3I B;  1PFB A;  3LNN A;  3M3Y H;  3OSO A;  4B9W A;  3M85 A;  2NVX B;  3CC2 A;  4DUY Q;  5C0X I;  1ILP A;  2B2V C;  3F2D A;  2A6H D;  3S1N H;  4U68 A;  1LYL A;  2OTL A;  4BY1 B;  4XYQ A;  1HNX L;  2NVT B;  1WFQ A;  4JI0 Q;  4YWM A;  1XMO Q;  1MBY A;  4ILW A;  3U9O A;  4BBR H;  4IFD J;  2ES2 A;  5ELO A;  3F8T A;  4A3L G;  4Y52 H;  4PZ7 A;  3D4R A;  1T9H A;  1K83 H;  1SDF A;  2RVL A;  2VZA A;  3H6M A;  1WTO A;  4HJ5 A;  1Y8P B;  4RGM A;  2XTI A;  5FLM G;  4ID6 A;  4AQY L;  1X3Q A;  4TKO B;  3E0J A;  4IUN A;  1G6Z A;  2Y0S E;  1JIC A;  2F3V A;  2BDN A;  2JA9 A;  5GAH C;  1UWV A;  3K7A H;  1NMG A;  3BU2 A;  1BF4 A;  1AE3 A;  1RCV D;  2F0L A;  2E8G A;  3MAQ A;  2F0O A;  3STB C;  2IJ0 A;  1U4L A;  4TVA B;  2J0T D;  2MFI A;  5ELE A;  2F1M A;  1B50 A;  1Q12 A;  1EWC A;  2WKC A;  1F77 A;  5C44 B;  4JI5 Q;  4LNQ A;  1EQR A;  2K7V A;  1OXX K;  3B6Y A;  3J81 L;  4A3B B;  2A68 D;  4LFB L;  1VQC A;  4IOC A;  5EBC A;  1V43 A;  3HOU G;  1PRT B;  4DV7 L;  3RN2 A;  4JBK A;  1B3Q A;  1PH5 A;  3HOX G;  4LF6 Q;  2UXB Q;  1VQ4 A;  3GV6 A;  4POF A;  1KAB A;  2OQK A;  2JA5 H;  4A3J H;  2WAC A;  3RD4 A;  1IZ6 A;  3AB9 A;  2OF1 A;  4C56 C;  3GTL B;  1EYA A;  3BG3 A;  3FEW X;  3KF8 B;  3D6W A;  2EPB A;  3GTM B;  3WWV A;  1LTS D;  3P20 A;  3E9I A;  3K5L A;  1Y1W B;  3S14 B;  1A0I A;  4RKB A;  4EQN A;  3OWE B;  5LHY 1;  4PZ8 A;  4NXN Q;  1L1O B;  4MNO A;  3J7Y W;  4FXG C;  4NKL A;  4DNR B;  1SE3 A;  1B9M A;  2B2Y A;  1RIP A;  5GQO A;  1VQI A;  1SNC A;  2UU9 Q;  5JAV A;  4P73 A;  4WOR A;  1F9P A;  3ZJY C;  1D7Q A;  5C4J B;  2K52 A;  5BN4 A;  1N36 L;  3EVQ A;  5E4X A;  2K50 A;  2JA7 H;  1EFW A;  2XVS A;  1G8Z D;  1TXY A;  2WB1 G;  3SR1 A;  3PUY A;  4J1M A;  3GTK B;  1GKH A;  5T1I A;  2OTJ A;  3OPO A;  1PTO D;  4EVO A;  1TS5 A;  3FHW A;  4FF4 A;  2JE6 I;  1KDB A;  3ERO A;  1LTG D;  4UP8 A;  5FKA C;  3O13 A;  2E2J B;  4DGZ A;  2CQA A;  1B7Y B;  1I4H A;  2MPM A;  3RUZ A;  1RF2 D;  1FGB D;  2F4I A;  4I7A A;  4DKA C;  4H7B A;  5BN3 A;  4DUZ Q;  1SNM A;  4A3E H;  3RNU A;  2G5D A;  2OQ0 A;  3SEB A;  2L1B A;  5LL6 S;  2VL6 A;  2ZTD A;  4YCV A;  2YU9 H;  4RAU C;  4DV3 Q;  1QZG A;  3U4Z A;  1DM0 B;  2R61 A;  4AYB B;  2CW0 D;  1E1T A;  3DMU A;  2HD3 A;  4PNY A;  5CYU A;  4FF1 A;  5BN5 A;  3TN2 A;  1LTI D;  2IPK D;  3FKI H;  4JC0 A;  2I5H A;  3K59 A;  4A3K G;  1DJR D;  1C48 A;  3H15 A;  4LF4 Q;  1CKM A;  4P71 A;  3CMA A;  1DOK A;  1K3B C;  2F0Q A;  4IPG A;  1YHA A;  3NE5 B;  4CDC C;  4OX9 L;  2N8N A;  3RN5 A;  5T1G A;  5CV6 A;  4LF5 Q;  2ZM6 L;  4NXM L;  2PQA B;  5DNF A;  4APV A;  3GTO B;  3VR5 A;  4KJO A;  3HKZ G;  5EPL A;  3QG1 A;  1HNZ Q;  1TII D;  3Q24 A;  1WD0 A;  4GOP C;  4LFC Q;  4K0K Q;  1O7I A;  2R92 B;  4LF9 Q;  3R2I A;  2SEB D;  4K2K A;  2Z6B A;  4K14 A;  5LL6 X;  1U5K A;  2B8G A;  4Q0F A;  5J3B A;  3T1Y Q;  3M4P A;  4PMC A;  4JI1 Q;  4DR6 L;  2JA6 B;  4K6L A;  3F2B A;  4PQX A;  1I4G A;  5D3I B;  1WYD A;  4KV6 A;  1BKB A;  1TWC B;  1W6K A;  3NEL A;  1SND A;  4XQQ A;  4X3U A;  1PYB A;  3I4M H;  2EYL A;  2X6L A;  2LXK A;  2OCE A;  1G51 A;  3HOZ G;  2RCF A;  3K80 C;  1E0B A;  2F0I A;  4QL5 A;  1MKH A;  2RKS A;  4A93 H;  1I4X A;  2A68 C;  1K28 A;  1VDZ A;  2ZXP A;  3GTQ H;  2K4K A;  2NN6 G;  2ZJR A;  2E2I H;  1PZK D;  4FVM A;  2H5X A;  1AFP A;  4P2C B;  2A69 C;  2JA8 H;  3NTK A;  1XMQ Q;  1PTO F;  4I7Z C;  1M4V A;  1WD1 A;  4OEM B;  3TP5 A;  2NTT A;  1EIG A;  1B3A A;  1EYG A;  2N49 A;  3VR4 A;  1Q1E A;  1IW7 D;  4XDX A;  2F3W A;  4R9W A;  1BCP D;  1LTT D;  1II3 A;  1TWF B;  4DR1 Q;  4DK3 C;  1C8C A;  1XX8 A;  3F1Z A;  1KDC A;  1SEB D;  3FMC A;  3SE0 A;  1PH1 A;  4DK1 A;  1DGS A;  5M3F H;  2VUM G;  4QIW E;  3NBI A;  4DV2 L;  2TMP A;  2VW9 A;  2KED A;  3VR3 A;  4X3S A;  1YJN A;  4ZRZ A;  4X62 L;  2JQO A;  5LMU Q;  3PO2 B;  3Q6S A;  1E2V A;  4X3T A;  1N33 L;  1A2T A;  3NTI A;  2B63 G;  1BO0 A;  1XNQ L;  2B8F A;  1HZA A;  3MFG A;  4MHE A;  5GAG C;  1QJO A;  2GN5 A;  3A5Z B;  4FXK C;  2BA1 A;  2K5H A;  3S17 H;  5EAY A;  1GXD C;  4RH6 A;  4NP5 A;  1HPC A;  1YIJ A;  4QB4 A;  1B2T A;  5GRO A;  1CKO A;  4HN7 A;  3NTH A;  4J15 A;  1PTO C;  1QUQ B;  4HCE A;  2B2U A;  1CKN B;  4KN7 C;  2AUJ D;  5M5Y B;  3GO5 A;  4C3H B;  2ASB A;  2OWO A;  3I91 A;  4LF6 L;  3J80 L;  1S5C D;  2E76 C;  2L55 A;  3DXJ C;  4IPD A;  3BYT B;  3IFT A;  1GVP A;  2N55 A;  3PCO B;  4RCN A;  3VYR A;  1RTO A;  5HGQ A;  4ZK9 B;  1HQM C;  1MGS A;  1Q46 A;  1UE6 A;  1C7Y A;  1TWG B;  3E0E A;  1E2Z A;  1X3P A;  2CW0 C;  1IL2 A;  1AW7 A;  3KBX A;  1ICW A;  3OYY A;  4OIJ A;  4DXF A;  5COR A;  4EQP A;  3RZO H;  5M3M G;  1E3P A;  2A19 A;  3SGI A;  3D4W A;  1Y8N B;  4O0A A;  4A3F G;  3MHB A;  3PV0 A;  3JAM i;  2UU9 L;  1L2F A;  3QOL A;  1DOL A;  3GTP B;  1WJJ A;  4DV5 L;  3FP9 A;  1YNJ D;  2WB1 E;  2M9V A;  4CKE A;  3KLS X;  4AQY Q;  1LAC A;  3L7Z C;  2AQ3 B;  4JW0 A;  3BVM A;  2PZT A;  1PA6 A;  3M4O B;  3DHQ A;  2EY2 A;  2Y0S G;  3S9W A;  4CDD C;  2F0E A;  4NW2 A;  3S1N B;  3VYU A;  2IL8 A;  1PZJ D;  4ZUI A;  3PQI A;  1XPU A;  4BBR B;  5IGC A;  4OO1 G;  1ZEQ X;  4UY8 C;  4DR5 L;  4K5V A;  4DUZ L;  4IFD G;  2VB3 X;  2R93 G;  1K83 B;  4N8F A;  3KLW A;  4DR2 Q;  1OXS C;  2B2T C;  1XNR L;  4TRD A;  3I4N G;  1SYG A;  1NE3 A;  1SJH D;  4LFB Q;  3G71 A;  1NR2 A;  2F52 A;  4IUP A;  1HXY D;  4DV7 Q;  4C3J H;  2B3G A;  3RLF A;  3RR5 A;  5KND A;  3K7A B;  2HHH L;  4OGQ C;  2RBM A;  2A8V A;  1WOC A;  1AP0 A;  5IGE A;  3LX0 A;  3DM1 A;  2Z4I A;  1CHQ D;  1TY2 A;  2F0U A;  1HUN A;  1VQG A;  1AH9 A;  2K32 A;  2LSS A;  1EY6 A;  2PZW A;  4HSP A;  4QUC A;  5I9P A;  3A7L A;  4A3D G;  2Z6K A;  4HIK A;  2VS1 A;  1BBX C;  1IW7 C;  3I8Z A;  1BCP C;  5J22 A;  1ZKO A;  1ROD A;  2L15 A;  4XT1 B;  4LFA L;  1IXR A;  4K0K L;  1JC7 A;  4HIO A;  2N88 A;  1CTM A;  2PCF B;  3ONA B;  2ICE C;  4P74 A;  1J9O A;  2JK8 A;  2BE5 C;  4A3J B;  2JA5 B;  4QJF A;  5EBD A;  1SN8 A;  2R7Z H;  1PRT D;  2BCO A;  2CCZ A;  4MN3 A;  1N36 Q;  4IO9 A;  4CDE C;  4OWT B;  2Z0S A;  3T1Y L;  4JI1 L;  3I55 A;  1KD1 C;  1E22 A;  3DLL A;  1JB7 A;  1SE2 A;  2PW5 A;  5EJW A;  4GN4 B;  2MQH A;  3PO3 H;  2XWB B;  4RHS A;  4DPG A;  4HTH A;  4JCV E;  4FF2 A;  2VNU D;  5IP9 G;  4ZAI A;  1KLU D;  1KHI A;  3MC0 B;  1OXT A;  2SOB A;  4JI8 Q;  3QJY A;  4ZYS A;  3EBE A;  4L8J A;  1KRS A;  2JA7 B;  3UDG A;  1KC8 C;  5IT9 c;  1VMC A;  1HUM A;  4L5T A;  1Y1V H;  1PFN A;  1HH2 P;  5C3E G;  4NPS A;  4G7H C;  4UP7 A;  3J81 E;  1WTH A;  4DR3 Q;  5K5P A;  3KYH C;  2VQF L;  1W6J A;  3E9H A;  1WVL A;  5LMN L;  5C6A A;  4Q5V A;  4JI2 Q;  1SFO H;  4BXX H;  1S5D D;  4WRD A;  2O4X A;  3E6Z X;  4DR4 L;  1J8I A;  4GNX A;  2EY5 A;  1LV9 A;  4A3E B;  5LMU L;  5C4X H;  2EXZ A;  2ZM6 Q;  2YU9 B;  3GV3 A;  1D1I A;  3I56 A;  4BY7 G;  4M1U B;  3K0X A;  3I2Z A;  3MA2 B;  3TP8 A;  1D1K A;  1D5M C;  1H9R A;  3Q22 A;  1Z7T A;  1GM5 A;  4EGV A;  1EWH A;  3AFQ A;  1S4Z A;  4A3C G;  4G7O C;  5I6Y A;  4IJH A;  3UDX A;  3FKI B;  1N32 L;  4HSV A;  1M8A A;  1SBB B;  3MXU A;  1SMY D;  3X3M A;  1F2M A;  5I4D A;  1I50 H;  3K5N A;  4DR6 Q;  4QGU A;  1PDQ A;  1NTG A;  4GKJ Q;  2PO4 A;  2NVY H;  3HOW G;  1EY4 A;  1CA5 A;  1B4O A;  1TY0 A;  4AYB E;  1PH4 A;  1TS3 A;  2MJ8 A;  1SNO A;  5CV8 A;  1MHW C;  2K5N A;  4RA8 A;  5AJ3 Q;  1R4P B;  2XRS D;  1CT1 D;  1YVC A;  2XNA C;  1B9N A;  3ERS X;  1PRT F;  4L5Q A;  5AFW A;  3L9A X;  1D6E C;  2EYJ A;  4IAL A;  4IUU A;  4ODG A;  1ZYR D;  4GLV B;  1PYS B;  2Q8T A;  1HQR D;  1Q82 C;  3PUX A;  1BNZ A;  1U0L A;  3C3L A;  3D8G A;  3T16 A;  1V1P A;  2D2C C;  2WAQ G;  3NUC A;  5C0X H;  3DEP A;  5FO8 B;  2B2W A;  3MXP A;  2AKW B;  2FJ2 A;  1EIF A;  2R7D A;  2WKD A;  1PYW D;  4BBS G;  4CGY B;  1K0R A;  2B29 A;  3IAY A;  3I4M B;  1I5F A;  5M5X H;  3MTS A;  2HCI A;  1UUP A;  4MIU A;  4DV2 Q;  5JEA J;  2ALY B;  3KDF A;  4A93 B;  3SK4 A;  4N9T A;  3GTQ B;  3PF4 A;  3HRZ C;  2E2I B;  3BZC A;  2DY7 A;  3ND8 A;  4X62 Q;  5EKK A;  1NCV A;  2KCN A;  1IBL L;  1N33 Q;  3KOJ A;  4QY7 A;  4HJA A;  2NZH A;  2JA8 B;  3JAM L;  3MZ5 A;  4LMQ D;  3CCE A;  1XNQ Q;  4A3M H;  1HNW L;  1WCM G;  3URY A;  3BJU A;  1XYI A;  2XWJ B;  1PRT C;  4IUV A;  4KKU A;  3VYT A;  1F9S A;  1STA A;  1H9J A;  1RTN A;  1FR3 A;  4F87 A;  4FP5 D;  4A3I H;  5M3F B;  1CSQ A;  4DR2 L;  2ICI A;  2KHI A;  4LUV A;  5IYB H;  1GJX A;  2HQL A;  3E3X A;  3H0G G;  5IOC A;  4X65 L;  1KAW A;  4JYA L;  3NEN A;  2K28 A;  1XPO A;  3T4A C;  3AMU A;  2XSC A;  1RJT A;  2A69 D;  2R7F A;  2D0P A;  4JPB W;  3CCV A;  1B1Z A;  1C9O A;  4YY3 L;  4OWW B;  1PVO A;  2PZU A;  4N9P A;  3G6J B;  1SE8 A;  1L1O C;  4A3L H;  1QB5 D;  3MXG A;  3S17 B;  3N6R A;  2MGS A;  2YTX A;  1QCB D;  2Q2T A;  1S3O A;  1IKL A;  4KHV A;  4WFN 3;  1Y8O B;  1JB3 A;  2YYZ A;  5I6W A;  5FLM H;  2QIL A;  4GN3 B;  4K5X A;  1G2T A;  1SYE A;  4JOI A;  4A3G G;  3SHL A;  1LTA D;  4LW1 A;  1P16 A;  3C1E A;  3HOY G;  5G3L D;  3BDO A;  5CV5 A;  5TSS A;  4X64 L;  2D62 A;  1TU2 B;  4GKK L;  4DV5 Q;  1HTP A;  4X6A H;  2KUM A;  1CQF A;  2FXQ A;  1CHP D;  1K8G A;  1VQD A;  1X3G A;  3S2H H;  2AMC B;  1JMC A;  1OXU A;  4IQZ A;  3HZX A;  3Q8D A;  4ALP A;  4DFA A;  1I4P A;  1IBK Q;  3HOU H;  1LT6 D;  3M7N A;  3RZO B;  2CFM A;  4PMB A;  2R3Z A;  1MI2 A;  3CRK C;  1FD7 D;  5I9O A;  2WV6 D;  1SMY C;  2EJM A;  3HOX H;  3NQI A;  3HOV G;  1KLG D;  1JQY D;  3IL8 A;  3KF6 A;  2QF7 A;  3HKS A;  4DR5 Q;  3LGJ A;  4JI8 L;  4JBW A;  4XXE A;  1XNR Q;  3KFU A;  4BWG B;  4GN5 A;  1VQF A;  2FMM A;  5CV4 A;  4RGN A;  1KL9 A;  2F4V Q;  1H9K A;  2CKZ B;  1L0Y B;  4IN3 A;  5DM6 3;  1SLJ A;  4C3I G;  3K7U C;  3KJO A;  1HTL D;  4DR3 L;  2KEE A;  3OWF A;  3H3V C;  2IHE A;  1OXV A;  2HHH Q;  2I5M X;  1X56 A;  4BY1 G;  4JI2 L;  1ZYR C;  1QG7 A;  4ZQ3 A;  1A2U A;  5A35 A;  4DV6 L;  2PI2 A;  3J80 E;  1CUK A;  1Q86 C;  5JJL A;  2PMZ B;  1I4R A;  1X3E A;  4KHP Q;  4TSS A;  2G9D A;  2J7Z A;  3VDY A;  5C4Z A;  1JWU D;  3CU7 A;  4AH6 A;  1HR0 L;  1QVF A;  1SMX A;  4IUQ A;  1EU3 A;  5KIX A;  3A5U A;  2M2L A;  1EY9 A;  4LFA Q;  3U58 A;  3VA5 A;  5FJ8 G;  4C3J B;  1YNX A;  3J81 j;  1KNE A;  2RF4 A;  2NWG A;  4DNT B;  4DR7 L;  1QOH A;  2ZTE A;  4R4C A;  1S72 A;  2MO1 A;  5NUC A;  1EEI D;  4R4O A;  4KKS A;  1BBU A;  1K8O A;  4GKJ L;  4RMF A;  2KVM A;  5DAU A;  3J80 c;  5C44 G;  5G3L F;  5CBE E;  1XPR A;  1GUN A;  3K6O A;  1KNA A;  4A3B G;  1LAB A;  3GD7 A;  3C2P A;  4DA2 A;  3UE0 A;  5AJ3 L;  1G91 A;  2VY3 A;  1PH3 A;  4LUO A;  5CR3 A;  4A3K H;  1AZQ A;  1O7L A;  2WAQ E;  2R7Z B;  5KNB A;  2DNE A;  5EQ0 A;  2K14 A;  1F2Z A;  2EVB A;  1HA5 A;  3RLO A;  3UDF A;  3WDN A;  4POG A;  5JJZ A;  2RSN A;  4RHR A;  2XGT A;  3TP7 A;  1TWH H;  4YHH Q;  2RA4 A;  1ILQ A;  5LMN W;  3KUP A;  4XT3 B;  2NVQ H;  3TZU A;  1Y1W G;  3S16 H;  3KK7 A;  1SSO A;  3K57 A;  2HIV A;  3PO3 B;  1ICF B;  3NWS A;  5ELC A;  4DAV A;  1GHK A;  3QB3 A;  2VQF Q;  1G6P A;  5LMN Q;  5C4H A;  2A73 B;  2WFW A;  4J8Q A;  4DR4 Q;  1BQQ T;  2BE5 D;  4XQN A;  5JPN C;  2K33 A;  4KTA A;  2RHQ B;  1Q81 C;  1TWA H;  2EDG A;  2UXD Q;  3NPP A;  3TME A;  4CKC A;  2I0Q A;  4BS9 A;  4R1J A;  1K3R A;  1U4M A;  4LJZ C;  4OXP A;  1Y1V B;  5IYC G;  1TS4 A;  3ZYY X;  1EY0 A;  3MVV A;  3IRB A;  1ENF A;  2L12 A;  4P72 A;  1N9W A;  3VR2 A;  3WOE A;  4GLX A;  4IPH A;  1PH8 A;  1Q1B A;  3CD6 A;  1VF5 C;  2JSO A;  1YI2 A;  3M7G A;  1WTR A;  1N32 Q;  3HOZ H;  1SFO B;  1SJE D;  4JI3 L;  2AUK A;  3TS2 A;  2DN8 A;  3F2U A;  1MJE A;  2NN6 I;  2NN6 H;  3FRP B;  1VQ7 A;  3CRL C;  1ONL A;  1YZ6 A;  4KN4 C;  5KYL A;  1M90 C;  4X66 L;  5JVG 3;  2XIW A;  1W2B A;  2CH4 A;  5C4X B;  5HUR A;  1H95 A;  1F9R A;  4B3T L;  3GTG H;  1S40 A;  2EYF A;  4GNX B;  3RZD H;  4AYB G;  3NBH A;  2R6G A;  2FFK B;  1IBM L;  1JWS D;  2CWP A;  4EQO A;  2VUM H;  2F0N A;  4DV1 Q;  2BOS A;  3BVZ A;  5KNC A;  3CPF A;  5EGT A;  3JC6 6;  1D5Z C;  1I50 B;  3T56 B;  4X3K A;  3OTO Q;  2UUC L;  5FLX L;  2E75 C;  3CW2 C;  5L37 A;  5C4J H;  2Q8I B;  2OXP A;  2JEA I;  1Z6H A;  3OOC A;  1GUG A;  5JOB A;  2NVY B;  2B63 H;  1T5E A;  2MP1 A;  5JVH 3;  1JE4 A;  2KEN A;  1T5X D;  3D6C A;  4KD4 A;  1O78 A;  4V19 0;  2HDL A;  5A2Q L;  2HCC A;  1LT3 D;  1EWI A;  1IKM A;  3DUZ A;  1QVG A;  1AE2 A;  1K8A C;  4RGT A;  1LTL A;  4JBJ A;  4KKT A;  4CBV A;  2IX0 A;  3QR8 A;  1A8V A;  1N34 Q;  2LKV A;  1VQ9 A;  4ZKC B;  2R92 G;  2QGQ A;  1VQL A;  1XTC D;  3M3Y B;  3DWQ A;  1IBL Q;  1IBK L;  2VXW A;  2AQ2 B;  1A15 A;  3K5O A;  1ASY A;  3BVG A;  1Y69 U;  1XTD A;  1HNW Q;  2JA6 G;  5I2Y A;  4K6D A;  2F0M A;  3CQZ H;  4QUF A;  2NBF A;  4DF7 A;  1V1P B;  3HG9 A;  2F0H A;  1EUJ A;  1BBW A;  2RDF A;  3QO2 A;  2IX1 A;  5M5X B;  1A3T A;  1H9M A;  3CPW A;  1X55 A;  3BZK A;  1CSP A;  2F0K A;  4X65 Q;  4JYA Q;  2KCT A;  3CXC A;  4JI7 L;  5JEA G;  2CWA A;  2F4V L;  2PQA A;  2I07 B;  2Z8L A;  1KRT A;  4KLK A;  5M3M H;  1Q8K A;  4I65 A;  2NZ1 D;  3KDF B;  3RLN A;  4RGO S;  4A3F H;  4OL7 A;  4A3M B;  4YY3 Q;  5IP7 G;  2ZJP A;  3L2P A;  3H3V I;  4L5S A;  1CI3 M;  1VQ8 A;  1FJG Q;  3ERQ A;  4CJ2 C;  5EPK A;  2IT1 A;  2MUY A;  3GTO H;  4A3I B;  4IZ8 A;  1JE5 A;  4KHP L;  4HAE A;  2SNS A;  1L0X B;  2GA4 B;  4JV5 L;  1MD2 D;  5K36 G;  5BR8 Q;  1B53 A;  4B08 A;  1TS2 A;  2JYO A;  1YJ9 A;  4GOP A;  4ME5 A;  4H0L C;  5F2D A;  1Y14 B;  4KD3 A;  2DUD A;  2IY5 B;  4X64 Q;  3PO2 G;  3CCJ A;  2A6E C;  1LUZ A;  1VQN A;  2F0S A;  3KLR A;  4WJW A;  4GKK Q;  3HP3 A;  3J7A V;  1HFN A;  2VQE L;  2YTV A;  4O1N A;  4OO1 H;  4OO1 I;  1SRU A;  2HT1 A;  3TSS A;  3MFY A;  4IFD I;  4IFD H;  2R93 H;  2KCC A;  4DAY A;  3MEF A;  2F0W A;  3KJP A;  5IGB A;  2Z9H A;  3K58 A;  3I4N H;  1STE A;  4RCO A;  1GHJ A;  1DZ1 A;  5J1Z A;  2ATW A;  1WTP A;  4QIW B;  2Q2I A;  4C2M H;  1QNK A;  4JVZ A;  2RHS B;  1P8L A;  4U67 3;  2B2Y C;  1RDP D;  5EKL A;  1K8M A;  5IYD G;  2Z4H A;  4F8M A;  1EZ8 A;  1EQQ A;  1B44 D;  4R8N A;  3JAM E;  4C3H G;  5M9O A;  3A0J A;  5E1F A;  4PG3 A;  1RHP A;  4LK1 C;  5ELN A;  1L0W A;  2GVB A;  1GUT A;  3TRE A;  3T53 B;  1FNW A;  2PQE A;  3BS1 A;  5D65 A;  4YHH L;  4A3D H;  3S2H B;  3TZD A;  3KBG A;  1ZXT A;  2H4O A;  1E1O A;  1Q8I A;  2RCN A;  4N8X 1;  1PZI D;  2F0G A;  4DAM A;  3PIO 3;  1BXT A;  1SYD A;  1D8L A;  3HOU B;  3NK9 A;  3F2C A;  3P7J A;  1EFI D;  4K5W A;  3HOX B;  1G29 1;  1FGU A;  4DV6 Q;  2KQ3 A;  1HR0 W;  4FXD A;  1F2L A;  1M1K C;  3EIV A;  3W3A A;  2UXD L;  5CC4 A;  3OIQ A;  3R8B A;  3BDC A;  1UNS A;  4FO2 A;  3CCL A;  3R2T A;  1JT8 A;  1HR0 Q;  3KF6 B;  2F0T A;  2IWH A;  4G7Z C;  1OTC A;  4OON A;  4L63 B;  4YIJ A;  1Q3L A;  4DR7 Q;  3TBI B;  1NSN S;  1UEB A;  3CP0 A;  4OHJ A;  3J81 c;  5CBA E;  4RWS C;  3PF5 A;  2F0J A;  4DK0 A;  5IP9 H;  4M8A A;  4P75 A;  3KLS A;  3OMG A;  2QEJ C;  3A7A B;  4BBR G;  3QIA A;  3RMH A;  1DOM A;  1V1Q A;  1GUO A;  1JR0 D;  1PTO H;  2WB1 B;  4WJ3 M;  3EJI A;  2PW7 A;  1I6H H;  3A8I E; 
#chains in the Genus database with same CATH homology
 4CJ0 B;  2KA7 A;  3SK5 A;  5KEE A;  3M4Y A;  2DNC A;  1KDA A;  2C9O A;  3SVM A;  1S5F D;  5E4W C;  1EY5 A;  2WII B;  3ITP A;  4S3S A;  3W2D A;  2RQX A;  2F0P A;  4XIG S;  3A54 A;  4UAI A;  4HMI A;  2K01 A;  2KOL A;  2ID0 A;  3C1F A;  4HCS A;  4GZY C;  4O42 A;  4A3K B;  4PMW A;  1G2S A;  5EPJ A;  5IGG A;  5IT9 L;  1R4Q B;  2EJG C;  1BUV T;  5D14 A;  1EYC A;  3FVQ A;  5IIF A;  1TWH B;  1EY7 A;  2K5Q A;  2NVQ B;  2NYZ D;  1SNP A;  3S16 B;  2X6G A;  1EL0 A;  2B2T A;  3HKZ B;  2TSS A;  1STG A;  1SYC A;  2CHB D;  3K5M A;  4HED A;  1U9R A;  4ABN A;  2AQ1 B;  1RKN A;  2F0V A;  4IUR A;  1ENC A;  3HGB A;  4DN4 M;  3SXH A;  1TWA B;  3PMF A;  2K03 A;  3NSW A;  3MXN A;  2PYK A;  3EFX D;  2LMC B;  2KHS A;  3C46 A;  1SXT A;  1TT2 A;  1JOR A;  4G4K A;  3L3O C;  1ESF A;  3HOZ B;  1VF7 A;  2Z1C A;  2XRQ D;  3J7A F;  1KAA A;  2B2U C;  3I90 A;  3NXW A;  2K6A A;  1WTQ A;  2B39 A;  1AZP A;  1LO5 D;  4QCL A;  2WIN B;  3R93 A;  2PPB C;  2HDM A;  3GTG B;  2ZT9 C;  1RD9 D;  1O80 A;  4XTC S;  2WP8 J;  5IGF A;  1D2B A;  3RZD B;  4KY5 A;  1V8Q A;  1S5B D;  2QKI C;  4ZUJ A;  4HMJ A;  2HQE A;  2VB2 X;  3K0Y A;  2X69 A;  2VUM B;  2FIN B;  1WTW A;  2LY7 A;  4ZKB B;  2V4D A;  1SYB A;  3Q0A A;  1GUS A;  3TP6 A;  1V1O A;  2K5W A;  2B63 B;  2K04 A;  1EQV A;  2SDF A;  2M00 A;  1HRJ A;  4LAA A;  5ELD A;  5EKI A;  5FO9 B;  1SNQ A;  1EU4 A;  3X3N A;  3LWE A;  1LT4 D;  1U4R A;  2BDO A;  3H91 A;  2EY1 A;  5C0X J;  5ISR A;  2L5T A;  4KMU C;  1CQV A;  3NWT A;  2OT2 A;  3CQZ B;  2L0C A;  3A55 A;  1H9S A;  4JK1 C;  1F2Y A;  3D3R A;  2EE1 A;  1E2W A;  2HUG A;  1HFG A;  2O2L D;  3OIP A;  1IYU A;  4E6I A;  5M3M B;  3BDL A;  1SAP A;  1PLF A;  3WOF A;  5FLX E;  4ULL A;  2A6H C;  2D5D A;  3SDZ A;  4A3F B;  2K05 A;  1JOO A;  4IUT A;  2FMC A;  1KTK A;  2SNM A;  2CVR A;  1STB A;  5A2Q E;  1YNN D;  2O5J C;  2FHT A;  3QWN A;  1XXG A;  2QCP X;  2ENB A;  4HR7 B;  3GQB A;  3IFD A;  4RFB A;  1DXM A;  2ZXO A;  4DXG A;  2XN9 C;  3MEH A;  2Y0S B;  4F88 A;  1EQT A;  1TQO A;  2EZV A;  2J4X A;  2B2V A;  2NB0 A;  1XWE A;  3N52 A;  5E3F A;  3E5S A;  3PUV A;  4G57 A;  2R93 B;  3PUW A;  1HHV A;  1LTR D;  3CHB D;  3BZD B;  3IKJ A;  1PFM A;  1I4Q A;  3I4N B;  1JWM D;  4QMG A;  4C2M B;  1WTX A;  4PV1 C;  5DM7 3;  4KK7 A;  1PMR A;  5C5M A;  1X32 A;  2H1E A;  3LWU A;  3PIP 3;  2A6E D;  2PNR C;  5CMD A;  2NUC A;  2G9H D;  2AWO A;  2QDB A;  5FOB B;  3D4D A;  4B9X A;  2MHV A;  1IHZ A;  1SYF A;  4KY6 A;  4H13 C;  2OEO A;  4XQJ A;  2E74 C;  3EA6 A;  4A3D B;  1DYQ A;  1EEF D;  1I6V C;  2ZXR A;  2EJF C;  5CV9 A;  4R8I A;  3SK8 A;  2LS0 1;  1EOT A;  5HGT A;  3I3C A;  4FF3 A;  3H94 A;  3VYS A;  3KF8 A;  3V2T A;  1DON A;  1PXU A;  3FPU B;  2KJX A;  3T13 A;  3D31 A;  5CGK A;  2LFN A;  4TQU S;  1IYV A;  1QE6 A;  3I70 A;  1CFM A;  2Q8R E;  1CZW A;  5C3X A;  1D5X C;  4DAP A;  3OHX C;  3A8K E;  4C1N I;  1C4Q A;  1O7Y A;  2EYO A;  2K5D A;  2E2D C;  2RDH A;  1WTV A;  1PTO B;  3U9S A;  1I6H B;  3H09 A;  4KY7 A;  3T51 B;  5C3E B;  2L4N A;  4NDX A;  3P1H A;  3I4L A;  4CKB A;  3CKI B;  4XYO A;  3DWA A;  4C3J G;  1UAP A;  1AEX A;  3A8J E;  4Y7N B;  4F7X A;  5DEH A;  3GP7 A;  1NR4 A;  2B2W C;  3GTJ B;  1FNU A;  1STY A;  2EYP A;  3S1Q B;  4BY7 B;  1S5E D;  2F0D A;  3Q23 A;  3UI2 A;  5ELB A;  3HEJ A;  1U4P A;  1UEA B;  1Q90 A;  3ND9 A;  4UDU C;  4KHZ A;  1YNN C;  5COY A;  3V05 A;  1BCP F;  1STH A;  1F9Q A;  4KJN A;  4QF4 A;  3AU7 A;  3HOW B;  3SK6 A;  3EQL C;  2EY6 A;  2NTS A;  2I46 A;  3A56 A;  5IGD A;  2RDG A;  2E2H B;  3G7L A;  1R9T B;  1LTB D;  3S15 B;  1EIH A;  1NAP A;  1VCI A;  3OW7 A;  4FYD A;  2WAQ B;  3NHH A;  2A5H A;  3DWP A;  1QIL A;  4BA1 I;  3BYY B;  5KGU A;  3S1M B;  2JP1 A;  5FK9 C;  5FO7 B;  3P75 A;  1O7Z A;  4BBS B;  2IX3 A;  1BDO A;  1HCZ A;  1EYD A;  1TR5 A;  1CA6 A;  2EYH A;  3V96 A;  2A74 C;  5JEA H;  4CHT B;  1LT5 D;  3PUZ A;  1HA6 A;  5IT9 E;  5JPM C;  1BCP B;  3OMC A;  1Z47 A;  3I72 A;  1I3Q B;  1IL8 A;  5C5L A;  1JOQ A;  1WCM B;  2AWN A;  2JEB I;  1ESR A;  1VMP A;  4K8I A;  2KEC A;  5CV7 A;  3H0G B;  5K36 H;  3R3O A;  4RKL A;  1GUW A;  1DCZ A;  1QWY A;  1TVX A;  3NP8 A;  5J39 A;  1OO9 B;  4J6H A;  1SE4 A;  1BOS A;  5D3D A;  2EOT A;  4Z9C B;  1BR9 A;  1MSG A;  1ET6 A;  1CZG A;  3TDQ A;  5KYI A;  1TKW B;  1LLR D;  5I2X A;  2DY8 A;  1ML0 D;  1JOK A;  5ELF A;  1STN A;  1FYC A;  1A3V A;  3VA7 A;  4A3G B;  4OIK A;  3S2D B;  1MSH A;  4BA2 I;  1CM9 A;  3FDT A;  3HOY B;  4C1N K;  5C0X G;  5M5W B;  1ET9 A;  1EZ6 A;  1A6X A;  2BA0 A;  2F0F A;  3NQT A;  4ZLT F;  4FNF A;  3VR6 A;  3HS0 C;  3DEO A;  1AN8 A;  3QOJ A;  4H44 C;  2O5I C;  1ENA A;  2C5C A;  1CK1 A;  1YNJ C;  2K1B A;  2L11 A;  2RSO A;  3S1R B;  4KI0 A;  4K8J A;  3MWY W;  1JCK B;  5KRU A;  4K2L A;  1H9S B;  2IW3 A;  1GOZ A;  5C3W A;  2D9U A;  4CJ1 B;  4V0B A;  3HOV B;  1QNU A;  1EY8 A;  5IOD A;  2L9H A;  1NUC A;  2F03 A;  2JXM B;  2EYM A;  1DD2 A;  4NMZ A;  4DU9 A;  3FPP A;  4L6T B;  3I73 A;  1FNV A;  1A3U A;  4C3I B;  1PFB A;  3LNN A;  3OSO A;  4B9W A;  3M85 A;  2NVX B;  5C0X I;  1ILP A;  2B2V C;  2A6H D;  4U68 A;  4BY1 B;  4XYQ A;  2NVT B;  1MBY A;  4ILW A;  3U9O A;  4IFD J;  3D4R A;  1SDF A;  2RVL A;  1WTO A;  3H6M A;  1Y8P B;  4RGM A;  4ID6 A;  1X3Q A;  4TKO B;  3E0J A;  4IUN A;  1G6Z A;  1JIC A;  2F3V A;  2BDN A;  1BF4 A;  1RCV D;  2F0L A;  3MAQ A;  2F0O A;  2IJ0 A;  1U4L A;  2J0T D;  5ELE A;  2F1M A;  1B50 A;  1Q12 A;  1EWC A;  2WKC A;  1F77 A;  5C44 B;  2K7V A;  1OXX K;  3J81 L;  4A3B B;  2A68 D;  5EBC A;  1V43 A;  1PRT B;  3GV6 A;  1KAB A;  2WAC A;  3RD4 A;  3AB9 A;  2OF1 A;  4C56 C;  3GTL B;  1EYA A;  3BG3 A;  3FEW X;  3D6W A;  2EPB A;  3GTM B;  1LTS D;  3P20 A;  3K5L A;  1Y1W B;  3S14 B;  4RKB A;  4EQN A;  3OWE B;  5LHY 1;  3J7Y W;  4FXG C;  4NKL A;  4DNR B;  1SE3 A;  1B9M A;  2B2Y A;  1SNC A;  5JAV A;  4WOR A;  1F9P A;  5C4J B;  5BN4 A;  3EVQ A;  5E4X A;  2XVS A;  1G8Z D;  3SR1 A;  3PUY A;  4J1M A;  3GTK B;  5T1I A;  3OPO A;  4EVO A;  1PTO D;  1TS5 A;  4FF4 A;  2JE6 I;  1KDB A;  5FKA C;  1LTG D;  3ERO A;  3O13 A;  2E2J B;  4DGZ A;  2CQA A;  1I4H A;  2MPM A;  3RUZ A;  1RF2 D;  1FGB D;  2F4I A;  4H7B A;  5BN3 A;  1SNM A;  3SEB A;  2L1B A;  5LL6 S;  4RAU C;  1DM0 B;  2R61 A;  4AYB B;  2CW0 D;  3DMU A;  4PNY A;  5CYU A;  4FF1 A;  5BN5 A;  3TN2 A;  1LTI D;  2IPK D;  3K59 A;  1DJR D;  1C48 A;  1DOK A;  2F0Q A;  3NE5 B;  5T1G A;  5CV6 A;  5DNF A;  3GTO B;  3VR5 A;  4KJO A;  5EPL A;  3QG1 A;  1TII D;  3Q24 A;  1WD0 A;  2R92 B;  3R2I A;  2SEB D;  4K2K A;  4K14 A;  5LL6 X;  2B8G A;  4Q0F A;  4PMC A;  2JA6 B;  4K6L A;  4PQX A;  1I4G A;  5D3I B;  4KV6 A;  1TWC B;  1W6K A;  1SND A;  4XQQ A;  4X3U A;  2EYL A;  2X6L A;  1E0B A;  2F0I A;  2RKS A;  1I4X A;  2A68 C;  2ZXP A;  1VDZ A;  2NN6 G;  1PZK D;  4FVM A;  1AFP A;  4P2C B;  2A69 C;  3NTK A;  1PTO F;  4I7Z C;  1M4V A;  1WD1 A;  3TP5 A;  2NTT A;  1EIG A;  1B3A A;  3VR4 A;  4XDX A;  1Q1E A;  1IW7 D;  2F3W A;  4R9W A;  1BCP D;  1LTT D;  1II3 A;  1TWF B;  1C8C A;  1XX8 A;  1KDC A;  1SEB D;  3FMC A;  3SE0 A;  4DK1 A;  3NBI A;  2TMP A;  2KED A;  3VR3 A;  4X3S A;  4ZRZ A;  3PO2 B;  3Q6S A;  1E2V A;  4X3T A;  1A2T A;  3NTI A;  1BO0 A;  2B8F A;  3MFG A;  4MHE A;  1QJO A;  4FXK C;  2BA1 A;  1GXD C;  4RH6 A;  4NP5 A;  1HPC A;  4QB4 A;  1B2T A;  4HN7 A;  3NTH A;  1PTO C;  4HCE A;  2B2U A;  4KN7 C;  2AUJ D;  5M5Y B;  3GO5 A;  4C3H B;  3I91 A;  3J80 L;  1S5C D;  2E76 C;  2L55 A;  3DXJ C;  3BYT B;  3IFT A;  2N55 A;  4RCN A;  3VYR A;  1RTO A;  4ZK9 B;  1HQM C;  1MGS A;  1TWG B;  1E2Z A;  1X3P A;  2CW0 C;  1AW7 A;  3KBX A;  1ICW A;  4OIJ A;  4DXF A;  5COR A;  4EQP A;  3D4W A;  1Y8N B;  3MHB A;  3PV0 A;  3QOL A;  1DOL A;  3GTP B;  1YNJ D;  2M9V A;  4CKE A;  3KLS X;  1LAC A;  3L7Z C;  2AQ3 B;  3BVM A;  2PZT A;  3M4O B;  3DHQ A;  2EY2 A;  3S9W A;  2F0E A;  4NW2 A;  3S1N B;  3VYU A;  2IL8 A;  1PZJ D;  4ZUI A;  4BBR B;  5IGC A;  4OO1 G;  1ZEQ X;  4K5V A;  4IFD G;  2VB3 X;  1K83 B;  1OXS C;  2B2T C;  4TRD A;  1SYG A;  1SJH D;  1NR2 A;  4IUP A;  1HXY D;  3RLF A;  5KND A;  3K7A B;  4OGQ C;  2RBM A;  1AP0 A;  5IGE A;  3LX0 A;  3DM1 A;  2Z4I A;  1CHQ D;  1TY2 A;  2F0U A;  1HUN A;  2K32 A;  2PZW A;  1EY6 A;  4HSP A;  4QUC A;  5I9P A;  3A7L A;  1BBX C;  1IW7 C;  3I8Z A;  1BCP C;  5J22 A;  1ZKO A;  1ROD A;  4XT1 B;  1JC7 A;  2N88 A;  1CTM A;  2PCF B;  3ONA B;  2ICE C;  1J9O A;  4A3J B;  2BE5 C;  2JA5 B;  5EBD A;  1PRT D;  2BCO A;  4MN3 A;  1SE2 A;  2PW5 A;  5EJW A;  2XWB B;  4RHS A;  4HTH A;  4FF2 A;  2VNU D;  4ZAI A;  1KLU D;  3MC0 B;  1OXT A;  2SOB A;  3QJY A;  4ZYS A;  4L8J A;  2JA7 B;  1VMC A;  1HUM A;  1PFN A;  4G7H C;  3J81 E;  5K5P A;  1W6J A;  1WVL A;  5C6A A;  4Q5V A;  1S5D D;  4WRD A;  2O4X A;  3E6Z X;  1J8I A;  2EY5 A;  1LV9 A;  4A3E B;  2EXZ A;  2YU9 B;  3GV3 A;  1D1I A;  4M1U B;  3MA2 B;  3TP8 A;  1D1K A;  1D5M C;  1H9R A;  3Q22 A;  1Z7T A;  4EGV A;  1EWH A;  1S4Z A;  4G7O C;  5I6Y A;  3FKI B;  4HSV A;  1M8A A;  1SBB B;  3MXU A;  1SMY D;  3X3M A;  1F2M A;  5I4D A;  3K5N A;  1PDQ A;  2PO4 A;  1EY4 A;  1CA5 A;  1B4O A;  1TY0 A;  1TS3 A;  2MJ8 A;  1SNO A;  5CV8 A;  4RA8 A;  1R4P B;  2XRS D;  1CT1 D;  2XNA C;  1B9N A;  1PRT F;  5AFW A;  3L9A X;  1D6E C;  2EYJ A;  4IAL A;  4IUU A;  4ODG A;  1ZYR D;  2Q8T A;  1HQR D;  3PUX A;  1BNZ A;  3C3L A;  3D8G A;  3T16 A;  1V1P A;  2D2C C;  3NUC A;  5C0X H;  3DEP A;  5FO8 B;  2B2W A;  3MXP A;  2FJ2 A;  2WKD A;  1PYW D;  4CGY B;  3IAY A;  3I4M B;  3MTS A;  2HCI A;  1UUP A;  4MIU A;  5JEA J;  4A93 B;  3SK4 A;  4N9T A;  3GTQ B;  3HRZ C;  2E2I B;  2DY7 A;  3ND8 A;  5EKK A;  1NCV A;  2KCN A;  2JA8 B;  3JAM L;  3MZ5 A;  4LMQ D;  3URY A;  1XYI A;  2XWJ B;  1PRT C;  4IUV A;  4KKU A;  3VYT A;  1F9S A;  1STA A;  1H9J A;  1RTN A;  1FR3 A;  4F87 A;  4FP5 D;  5M3F B;  2ICI A;  1GJX A;  5IOC A;  2K28 A;  3T4A C;  3AMU A;  2XSC A;  1RJT A;  2A69 D;  1B1Z A;  2PZU A;  4N9P A;  3G6J B;  1QB5 D;  3MXG A;  3S17 B;  3N6R A;  2MGS A;  1QCB D;  1IKL A;  4KHV A;  4WFN 3;  1Y8O B;  1JB3 A;  2YYZ A;  5I6W A;  2QIL A;  4K5X A;  1G2T A;  1SYE A;  3SHL A;  1LTA D;  3C1E A;  5G3L D;  3BDO A;  5CV5 A;  5TSS A;  2D62 A;  1TU2 B;  1HTP A;  2KUM A;  1CQF A;  1CHP D;  1OXU A;  4IQZ A;  3HZX A;  4DFA A;  1I4P A;  1LT6 D;  3M7N A;  3RZO B;  4PMB A;  2R3Z A;  1MI2 A;  3CRK C;  1FD7 D;  5I9O A;  2WV6 D;  1SMY C;  2EJM A;  3NQI A;  1KLG D;  1JQY D;  3IL8 A;  2QF7 A;  4JBW A;  4XXE A;  4BWG B;  2FMM A;  5CV4 A;  4RGN A;  1H9K A;  4IN3 A;  1L0Y B;  5DM6 3;  4C3I G;  1HTL D;  2KEE A;  3OWF A;  3H3V C;  1OXV A;  1ZYR C;  1QG7 A;  4ZQ3 A;  1A2U A;  5A35 A;  3J80 E;  2PMZ B;  1I4R A;  4TSS A;  2G9D A;  2J7Z A;  5C4Z A;  1JWU D;  3CU7 A;  4IUQ A;  1EU3 A;  5KIX A;  2M2L A;  1EY9 A;  3VA5 A;  4C3J B;  1KNE A;  2NWG A;  4DNT B;  1QOH A;  5NUC A;  1EEI D;  4KKS A;  1K8O A;  2KVM A;  5DAU A;  5G3L F;  5CBE E;  1GUN A;  3K6O A;  1KNA A;  1LAB A;  3GD7 A;  3C2P A;  4DA2 A;  1G91 A;  5CR3 A;  1AZQ A;  1O7L A;  2R7Z B;  5KNB A;  2DNE A;  5EQ0 A;  1F2Z A;  2EVB A;  1HA5 A;  3WDN A;  5JJZ A;  2RSN A;  4RHR A;  3TP7 A;  2RA4 A;  1ILQ A;  3KUP A;  4XT3 B;  3TZU A;  3KK7 A;  1SSO A;  3K57 A;  3PO3 B;  4DAV A;  3NWS A;  5ELC A;  1GHK A;  3QB3 A;  5C4H A;  2A73 B;  4J8Q A;  1BQQ T;  2BE5 D;  4XQN A;  5JPN C;  2K33 A;  4KTA A;  2EDG A;  3NPP A;  3TME A;  4CKC A;  4BS9 A;  1U4M A;  4LJZ C;  1Y1V B;  1TS4 A;  3ZYY X;  1EY0 A;  3MVV A;  1ENF A;  2L12 A;  3VR2 A;  3WOE A;  1Q1B A;  1VF5 C;  2JSO A;  3M7G A;  1WTR A;  1SFO B;  1SJE D;  2AUK A;  2DN8 A;  3F2U A;  2NN6 I;  2NN6 H;  3FRP B;  3CRL C;  1ONL A;  4KN4 C;  5KYL A;  5JVG 3;  2XIW A;  5C4X B;  5HUR A;  1F9R A;  2EYF A;  3NBH A;  2R6G A;  2FFK B;  1JWS D;  4EQO A;  2F0N A;  2BOS A;  3BVZ A;  5KNC A;  5EGT A;  1D5Z C;  1I50 B;  3T56 B;  4X3K A;  5FLX L;  2E75 C;  2Q8I B;  2OXP A;  2JEA I;  1Z6H A;  3OOC A;  1GUG A;  5JOB A;  2NVY B;  1T5E A;  2MP1 A;  5JVH 3;  1JE4 A;  1T5X D;  3D6C A;  4KD4 A;  1O78 A;  4V19 0;  2HDL A;  5A2Q L;  2HCC A;  1LT3 D;  1IKM A;  3DUZ A;  4RGT A;  4KKT A;  4CBV A;  2IX0 A;  2LKV A;  4ZKC B;  1XTC D;  3M3Y B;  3DWQ A;  2VXW A;  2AQ2 B;  1A15 A;  3K5O A;  3BVG A;  1Y69 U;  5I2Y A;  4K6D A;  2F0M A;  4QUF A;  2NBF A;  4DF7 A;  1V1P B;  3HG9 A;  2F0H A;  2RDF A;  3QO2 A;  2IX1 A;  5M5X B;  1A3T A;  1H9M A;  2F0K A;  5JEA G;  2I07 B;  2Z8L A;  4I65 A;  2NZ1 D;  4RGO S;  4OL7 A;  4A3M B;  1CI3 M;  3ERQ A;  4CJ2 C;  5EPK A;  2IT1 A;  2MUY A;  4A3I B;  4IZ8 A;  4HAE A;  2SNS A;  1L0X B;  2GA4 B;  5K36 G;  1MD2 D;  1B53 A;  4B08 A;  1TS2 A;  2JYO A;  4ME5 A;  4H0L C;  5F2D A;  4KD3 A;  2A6E C;  2F0S A;  3KLR A;  4WJW A;  3HP3 A;  3J7A V;  1HFN A;  4O1N A;  4OO1 H;  4OO1 I;  3TSS A;  3MFY A;  4IFD I;  4IFD H;  2KCC A;  4DAY A;  2F0W A;  5IGB A;  3K58 A;  1STE A;  4RCO A;  1GHJ A;  1DZ1 A;  5J1Z A;  1WTP A;  4QIW B;  1QNK A;  4U67 3;  2B2Y C;  1RDP D;  5EKL A;  1K8M A;  2Z4H A;  4F8M A;  1EZ8 A;  1B44 D;  4R8N A;  3JAM E;  4C3H G;  5M9O A;  5E1F A;  1RHP A;  4LK1 C;  1GUT A;  3T53 B;  1FNW A;  2PQE A;  3BS1 A;  5D65 A;  3S2H B;  3TZD A;  3KBG A;  1ZXT A;  2H4O A;  1Q8I A;  1PZI D;  2F0G A;  3PIO 3;  1BXT A;  1SYD A;  3HOU B;  3NK9 A;  3P7J A;  1EFI D;  4K5W A;  3HOX B;  1G29 1;  2KQ3 A;  4FXD A;  1F2L A;  3W3A A;  5CC4 A;  3OIQ A;  3R8B A;  3BDC A;  1UNS A;  4FO2 A;  3R2T A;  2F0T A;  2IWH A;  4G7Z C;  4L63 B;  4YIJ A;  1Q3L A;  3TBI B;  1NSN S;  4OHJ A;  5CBA E;  4RWS C;  2F0J A;  4DK0 A;  4M8A A;  3KLS A;  3OMG A;  2QEJ C;  3A7A B;  3QIA A;  3RMH A;  1DOM A;  1GUO A;  1JR0 D;  1PTO H;  2WB1 B;  3EJI A;  2PW7 A;  3A8I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...