4PMCA

Crystal structure of staphylcoccal nuclease variant delta+phs i72k v74k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS I72K V74K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pmcA00
1JOOA 4K6DA 4K8JA 3OSOA 1EZ6A 1STBA 2OEOA 2PZTA 4TRDA 2SNMA 1TT2A 4EQNA 5CV5A 3T16A 1EZ8A 2EY5A 1A2UA 2EXZA 2O4XA 4IALA 4KY6A 1NUCA 4EQOA 1ENAA 2RBMA 1NSNS 2SOBA 3SR1A 1EYDA 2EY2A 2F0QA 2EYHA 5KEEA 2F0KA 1A3TA 3D4WA 1KDAA 4MIUA 1SYCA 4ZUJA 3NP8A 1EQVA 3MHBA 5C4ZA 2F0VA 1STYA 3NK9A 3SK4A 1STHA 2EYPA 2F0JA 5F2DA 5KRUA 2F0NA 4N9PA 2SNSA 4KTAA 3E5SA 4B9XA 5K5PA 4PMBA 2EYOA 4DU9A 2F0OA 2HQEA 2LKVA 1A3UA 3TP5A 4QF4A 5JAVA 1F2YA 5DEHA 1A2TA 4NKLA 5C5LA 1SNQA 2M00A 5J22A 1SNDA 4YIJA 5IODA 1F2ZA 2F0MA 5IGCA 4G57A 4ZUIA 2F0HA 3NUCA 5CV6A 4K5VA 3DHQA 4IZ8A 4J6HA 1U9RA 5J1ZA 5ISRA 5CV8A 1F2MA 1EY5A 1SYBA 4I65A 5C3XA 4ID6A 3D8GA 5C6AA 2F0GA 1KABA 2EY6A 2F0TA 1EY8A 3HEJA 2F3WA 5I6WA 3QB3A 4E6IA 1SYDA 4NMZA 5NUCA 5C4HA 1RKNA 4K5XA 3SHLA 4R8NA 2KHSA 4DFAA 5HURA 2WACA 4DGZA 1TR5A 3C1EA 5C5MA 5HGTA 1EY9A 3D4DA 5CGKA 1SNCA 1KDCA 4B9WA 1KDBA 3ERQA 5IGGA 2F0PA 5IOCA 1JORA 2PZUA 5I9PA 5IGDA 4K2LA 5EKLA 5IGFA 4K8IA 5JOBA 4PMCA 1A3VA 2EYLA 5IGEA 4NDXA 5CV9A 2NUCA 3SK8A 1STAA 5KGUA 5CR3A 3DMUA 1JOKA 4F8MA 4KHVA 3H6MA 2KQ3A 3BDLA 3OMCA 5CV4A 3EROA 5E3FA 2F0SA 3R3OA 2F0WA 1EY7A 2EYFA 1SYEA 4NP5A 4DF7A 2RDFA 4IUNA 4KJOA 4K14A 4PNYA 4S3SA 1ENCA 3HZXA 1KAAA 1EY0A 4QMGA 4KY5A 3LX0A 4RKBA 5EGTA 3P75A 4OL7A 4ME5A 4K5WA 3SK5A 4F7XA 1II3A 2PW5A 3C1FA 2F0EA 1STNA 4N9TA 5IGBA 3MEHA 3SXHA 5CV7A 3U9OA 5I9OA 2PZWA 3MXPA 2F0DA 1EYAA 2EY1A 5I6YA 3S9WA 4KY7A 1EY6A 4LAAA 1SNOA 1SNPA 3EVQA 1SYFA 2OF1A 4KV6A 2QDBA 5IIFA 3TP6A 3MZ5A 4KD4A 4ODGA 3OWFA 4WRDA 3V2TA 2OXPA 2F0LA 3EJIA 3QOLA 2F0UA 5J39A 4HMJA 3NHHA 3PMFA 5KYIA 4J1MA 5KYLA 5E1FA 2ENBA 2F0FA 4WORA 3NXWA 3T13A 4KD3A 1EYCA 3P1HA 1EY4A 3TP7A 4EVOA 3QOJA 5C3WA 4KJNA 3NQTA 1SYGA 2RKSA 1TQOA 3MVVA 1AEXA 3BDCA 2F0IA 2PYKA 4K2KA 3OMGA 2F3VA 3SK6A 5KIXA 2PW7A 3ITPA 4HTHA 3D6CA 3RUZA 5M9OA 2EYMA 1JOQA 1IHZA 1STGA 4RKLA 5EKKA 2EYJA 4H7BA 3VA5A 4QB4A 5DAUA 3TMEA 4EQPA 5CC4A 1SNMA 3TP8A 4ZQ3A 2PQEA 4HMIA
chains in the Genus database with same CATH superfamily
4K6DA 1YJWA 4F88A 3QR8A 5EPKA 4JOIC 1KRSA 1EZ8A 3GTMB 1NMFA 4NXNL 4ZKCB 1AZQA 4IJLA 1WTRA 2D5DA 1HQRD 4Y7NB 4LK1C 5TSSA 3EFXD 3NTKA 4A3EB 2QW7A 2NTSA 1K8MA 3KLWA 4C3IG 2JA7G 5M5WB 4DV0Q 1OXSC 4IO9A 4IFDJ 1F2YA 1VQJA 4X3TA 1BXTA 2Z0SA 4LF7L 1X32A 4RGNA 1DJRD 1JWUD 3KDFB 5GROA 1W3SA 5CV6A 5FLXE 3DHQA 2R93B 4C2MH 4QQBX 1SYBA 3CRKC 3A5ZB 2OWOA 1N34L 2ICIA 4DR2Q 1SSOA 4PZ6A 5I6WA 4GLVB 5D3DA 2WAQE 3NENA 3DLLA 2CH4A 2WACA 3X3NA 4DNIA 1K3RA 4RAUC 4KLKA 4C3HH 5CGKA 3UE0A 4JI3Q 1CT1D 4JW0A 4JBWA 3PO2H 4B08A 3TN2A 4GKKQ 3BVZA 1OXXK 3I72A 1AE3A 1PLFA 3K7AB 4B3SL 5KNBA 2B8FA 2A6HD 2LY7A 3F2UA 3I8ZA 1VMCA 1ENCA 1NTGA 3HZXA 2K05A 2R3ZA 4KY5A 2A5HA 3I3CA 4ABNA 3S17B 3SK5A 1GHKA 2FINB 4CGYB 5C4XG 4JBJA 1JJGA 3S2HH 4C56C 3S1NB 3SE0A 1TS4A 3MXNB 1OO9B 1RHPA 1DGSA 1RTOA 1CSQA 1S5CD 4TSSA 3OTOQ 1O7LA 3KF6A 1AE2A 1K8OA 4KD3A 5FO7B 1MJEA 1PYWD 3PO3H 2F0IA 2NVXB 4ZYSA 5CC4A 5DAUA 1TWFB 2A6HC 3I4OA 1Z9FA 1PTOD 3QO2A 3HOXB 4BY7B 1SFOH 1S5FD 1DXMA 5A2QL 1WTPA 5IP9G 1SLJA 3H3VH 1Q90A 2NVYB 3HOZG 1UWVA 4KY6A 3VA7A 1R9TB 1EYDA 2F0QA 3SVMA 2HCCA 2Y0SB 1JCKB 1X65A 1LT6D 4JI1Q 1Y8OB 4WJ4A 2XTIA 3PUYA 4N9PA 2K5NA 1CK1A 3CRLC 2JA9A 2KBNA 1BF4A 3Q22A 4IUVA 1D5ZC 4GLXA 2V1CC 4IN3A 1CQVA 3VYUA 5HGQA 3HOVH 4CJ0B 1PYBA 2WB1G 5C5LA 1SNQA 2M00A 5BN5A 4YIJA 1XNRQ 4WFN3 1N32Q 4JCVE 4EQ5A 2ZXPA 1E2WA 1OXUA 4LNQA 2N8NA 1SE4A 4J15A 3G6EA 3E0JA 3PUVA 1U9RA 5ISRA 5C3EG 4A3DB 5C3XA 2KECA 3H91A 4XYOA 3M3YH 1L1OC 1PTOC 4A93H 1IBLQ 2NVQB 2MGSA 1RKNA 4JI7Q 3C3LA 4X64L 1EY9A 1ILQA 2B2VA 4B9WA 4DV7Q 2DJGC 1E22A 2B2UA 1TKWB 3X3MA 4RHSA 2PZUA 2BH2A 1X3QA 4K2LA 3G7LA 1ICWA 1K8GA 4DUZQ 2EDGA 3SK8A 5C44G 3RZDH 1VS0A 5IYBH 1XPUA 4H13C 4RWSC 3T1HL 1O80A 3Q23A 2FHTA 2RDFA 1XNQL 5EGTA 5IYDG 4JI6L 4V0BA 1IYVA 3NBHB 1HPCA 1EQQA 3IL8A 2MP1A 4C3IB 2F03A 1KHIA 2UXCQ 1EYAA 1NE3A 4LFAQ 1A6XA 1SNOA 3EVQA 5G3LD 5D14A 5IIFA 1EUJA 1S40A 3TP6A 4ODGA 1Q7YC 1JQYD 3PUXA 1MKHA 1Q1BA 3GTKB 2EJFC 1EOTA 5E1FA 1WVLA 3NPPA 1M1KC 1K83H 3HOYH 1JOQA 3D6CA 4P73A 1M8AA 3I73A 3D31A 3ERSX 4JYAQ 4HMIA 2HHHQ 4A3FG 1FYCA 3I91A 4POGA 3FP9A 4FO2A 2K14A 1E3PA 1FJGL 5DNFA 4X66L 3E9HA 3MWYW 1Q1EA 4OELB 1CUKA 4L5TA 2MHVA 1SE2A 4ZUJA 2MO0A 4IUPA 4C3HG 4R4OA 2OTJA 4EGVA 2KHIA 2RCNA 4KTAA 4FF1A 2RVLA 2LKVA 3PO2G 2TMPA 3WDNA 4CJ2C 2YU9B 4NKLA 3A56A 2B63H 4HCSA 1HXYD 3HGBA 2FMCA 3LWEA 1AP0A 5EAYA 1ASYA 1DM0B 1DOMA 4A3JH 3STBD 1HTLD 5J1ZA 4DV5Q 5CV8A 4JI8L 3OHXC 1PRTC 3J81i 3PF4A 2K01A 2NN6I 1SYDA 3VR2A 4K5XA 5FKAC 2NVTH 2IW3A 5ELOA 3CCVA 4QCLA 3CCMA 1KNEA 3CP0A 4XQJA 2F0PA 2K32A 1YIJA 4B3ML 2DNEA 4BA2I 1VQ7A 2B2WA 3DXJC 1CKNB 4M8AA 1XJVA 4PMCA 2EYLA 4BY1H 1HNXQ 3R2TA 3KLSX 4H44C 4F8MA 5BR8L 3J7AF 5CV4A 3HOZB 4LFCQ 1K8AC 3PO3G 1MSHA 3GTQB 2E2IB 1YITA 1ZYRC 4R4QA 1NR2A 1MHWC 3A8IE 1KAAA 1PZJD 1BDOA 2K5WA 2SDFA 1KRTA 2PNRC 4DKAC 3STBC 5A35A 4XYQA 2VQFQ 4IPDA 1STNA 2KCCA 2JE6I 3M85A 1Y1WG 1QNUA 1F9PA 2PZWA 4YWKA 2B29A 1H9JA 4LAAA 2EE1A 2L5TA 2WB1B 3BYTB 2LXKA 4A3IH 1D1IA 2IL8A 3FDTA 3OWFA 1S5DD 2CKZB 2CWPA 5H1SE 3IAYA 5C3EB 3HOVG 5D3IB 2VW9A 3DWAA 5C3WA 2ZTDA 1EU3A 1BBWA 3SK6A 2FXQA 5LMNL 1TU2B 2EYMA 4IUUA 2ICEC 3G4SA 3R8BA 3HOWG 3ND8A 4TRDA 2HIVA 4EQNA 3J80E 4JI4L 2I0QA 4NXML 4MTNA 4A93G 2SOBA 4XDXA 1I4QA 3WWVA 2WKCA 4HIMA 2B39A 3FKIH 5AJ3Q 3ULPA 2EYHA 4HJ7A 4G7ZC 4KHPL 2Z9HA 2ASBA 1IL8A 1YHAA 1IBKL 1XMQL 4JVZA 2JK8A 4I7ZC 1I3QB 2JYOA 2R7ZG 4FF4A 5LL6S 5CBAE 1L2FA 1SMYC 2D62A 4L63B 3TP5A 1C8CA 3S1MB 2HT1A 1GVPA 5ELDA 4DAYA 1F2ZA 3EN2A 2E5LQ 2PPBC 4K5VA 4FF2A 4G7OC 2C5CA 4ID6A 3VYSA 2E74C 4CKBA 3ICEA 1ZKOA 1KQSA 2FMMA 5M3FB 3J7YW 4HCEA 1H9SB 4JPBW 1TR5A 2WKDA 1ET9A 5LMUL 3I4MG 4QJFA 2G9DA 1EIYB 5IGGA 1YNJC 2XWJB 3K0YA 4GLAC 2PQAA 2XRQD 2PMZB 2KUMA 4KKSA 5IP7H 5FO9B 2XNAC 1B2TA 3EA6A 1PH2A 3GP7A 4NDXA 1HZ9A 4C2MB 2HDLA 4P72A 4A3FB 2XVSA 1GKHA 1FVIA 4DNTB 2F0SA 3UDXA 3HOYG 1PV4A 1HR0W 2ZM6Q 2UUBQ 1JC7A 3SEBA 3C1FA 4N9TA 4A3GG 4LW1A 4LWCA 3GTJH 4GN5A 1FGBD 1SR3A 3OW7A 3VR3A 3PO2B 1QE6A 3U58A 4DR1L 3TSSA 3SGIA 1V1QA 2OXPA 3EIVA 5LL6X 1T9HA 4LFBQ 3CCEA 4C3JG 2XWBB 1VDZA 1AZPA 4FVMA 3IRBA 2I5HA 2TSSA 2UXDQ 4DPGA 1UE5A 1Q12A 2B63G 1NAPA 3LNNA 1IYJB 3S2HB 1IHZA 1G2SA 1T5XD 1NNXA 4FF3A 3TMEA 1STEA 2AWOA 4A3JG 4CKEA 3J81c 3OSOA 2OEOA 2Y0SE 1TT2A 1VF7A 3AYHB 1LACA 3ND9A 3CQZH 4LUZA 4XQNA 4R4TA 4A3MG 3NELA 1K73C 4DV3L 3A0JA 4GKKL 2F0KA 3EBEA 1BCPD 4YHHL 1O7YA 2F0VA 5EKIA 1F77A 5F2DA 3PO3B 2Z8LA 3AQQA 4MHEA 3BZKA 4A3BH 1SFOB 4WJ3M 1S5ED 1PH5A 1Y1WB 1PH6A 1LLRD 5IT9c 2ZXOA 1EEID 1L0YB 1TWAH 5JJIA 2HIXA 1AH9A 2F0TA 1EY8A 1KC8C 2CCZA 1PH8A 5KNCA 4JI5Q 2QDLA 5C4HA 2NN6H 2I5MX 3Q24A 2EVBA 5C5MA 3HOVB 1CM9A 2A68C 4N8X1 1T5EA 5LMNW 5JVG3 1ILPA 4XIGS 2VQEQ 2A6ED 2AHOB 3HOWB 4AYBG 1JMCA 4KMUC 1HCZA 4MN3A 3G48A 3M7NA 1C4QA 1G51A 3CMEA 2CQAA 2F0WA 2PI2E 4A93B 2FFKB 1BNZA 2A73B 3V05A 3PCOB 4RKBA 2NTTA 1PH7A 3Q0AA 2RA4A 2E2JB 4BBSH 1II3A 1MBYA 2Q8IB 3RZOH 2EY1A 3G6JB 1X6OA 2R7ZB 1XMOL 3FKIG 1HNWQ 5EPJA 1HA6A 3RZDB 1N32L 1F9RA 2QILA 2F0LA 4HJ8A 1HH2P 2V4DA 1DOKA 1U4MA 1V43A 1LTSD 3NE5B 5C4JH 1H9RA 1U0LA 3NBHA 1FGUA 2BDOA 5I9OA 2A6EC 1N36L 1WYDA 3L9AX 5IT9E 4B3RQ 3ITPA 1IBLL 2UXBL 1EWIA 1STGA 5IWAL 3BS1A 2EJMA 3K6OA 4K8JA 3I4MB 1SXTA 4RCOA 1MJCA 2AQ1B 2DY7A 3AB9A 4DV4L 3H94A 1VQOA 1I50B 1I6HB 4ALPA 3UDFA 1NUCA 4UDUC 3KUPA 4DUZL 2A74C 1E7ZA 2WINB 4UP9A 2JP1A 3L2PA 4MTKA 4P74A 4G7HC 4OWTB 3MXGA 1STYA 3NK9A 1STHA 2EYPA 3AU7A 4XT1B 3H15A 2LXJA 5IP7G 1OXTA 4RGMA 5FO8B 4DV1Q 4A3GB 2F0MA 5FLMH 4FDBA 4LFAL 3BZDB 4JI2Q 1IKMA 3CC7A 1N8RC 1ICFB 4QUCA 1XYIA 4CJ1B 1PFBA 1V9PA 4C3JB 1HNZQ 1I94Q 4FXGC 2B2YA 4DGZA 5HGTA 2D0OA 5IOCA 1JORA 2P5ZX 5M3MH 4JYAL 5JOBA 3C2PA 3WOEA 1GUNA 1JWSD 1HUNA 1STAA 1TWGH 1G2TA 3S16B 4KHVA 4BS9A 2KQ3A 5E3FA 1IL2A 4DR6Q 3GTOH 3KBGA 4LF6Q 2MJ8A 4R4IA 2IHEA 2A19A 1QNKA 2JN4A 4IUNA 4A3MB 2A1AA 2NVTB 1LABA 1TVXA 2IT1A 2RSNA 2WB1E 3QWNA 1YHQA 3ZJYC 1N33L 5CV7A 2CQOA 2Z4IA 2YV5A 1LTAD 4H02A 4GKJL 1VQNA 2F0UA 2UUCQ 1EIFA 2KA7A 4EX5A 4BXXG 1Q81C 1L0XB 1PFSA 3WOFA 3KOJA 1GJXA 4KJNA 1K0SA 1TS2A 1AEXA 4K0KQ 3RLFA 3QG1A 1TIID 5HY6A 1U4RA 2VZAA 4U68A 2BA1A 2HCIA 4ME3A 4IFDH 1WTXA 2HUGA 3T16A 4QIWB 4EQOA 1X56A 1RCVD 4R4CA 3NTIA 4OONA 2K33A 2NN6G 3DEPA 1HNXL 2ID0A 4JOIA 1PH4A 1EQVA 3MHBA 4LFCL 2LFNA 3T1YQ 2E2HH 2KOLA 2ZT9C 4GN4B 3E5SA 1HZBA 1UE7A 4UP7A 2F0OA 2OCEA 1UE6A 2M2LA 4DK0A 4A76A 5DEHA 4LF4Q 1MIUA 1YNND 4DUYL 2G5DA 4P71A 3S2DH 5A2QE 1VQHA 2K5HA 4ILWA 2R61A 5LHY1 3FKIB 2GVAA 4CDCC 5C6AA 1WTHA 4AQYL 3OW2A 4BBSG 2YTVA 4PZ8A 5EPLA 3K5NA 2QKIC 1JICA 2JSOA 1O78A 4NMZA 3W1BA 2R92H 4RGTA 1A15A 3ER0A 2VNUD 2PMZE 4L5QA 3K5LA 2G9HD 1X9NA 1PA6A 1QVGA 3HG9A 3ERQA 4B3TQ 4DV6L 4O1NA 2JA8H 1CQFA 1HRJA 1CHPD 2DUDA 5EKLA 3S1RB 5KGUA 3QJYA 2EZVA 4LF8Q 3BDLA 5GADC 1G291 1OTCA 1HUMA 4DF7A 4IPHA 5AJ3L 4DR5Q 1H9SA 4TKOB 4JV5Q 1VQ8A 3F2CA 2WAQG 3MAQA 1RODA 2CW0D 4F87A 1JB7A 2I07B 2VUMH 1V8QA 1XTCD 1EY6A 4PMWA 4BBRH 1D8LA 2BE5D 2Z4HA 4KD4A 3GV3A 5M5XB 3NHHA 5M5YH 1J5EQ 4WORA 2EQSA 3P1HA 2L4NA 4K2KA 2F4IA 3BDCA 3M4YA 4GOPB 4X62Q 1SDFA 5FLMG 1PTOF 3F2DA 2PQEA 2JA7B 1XTDA 2VS1A 5ELFA 1NMGA 3GDEA 2K6AA 1HTPA 4NB3A 1A2UA 1NBWA 3K0XA 2R7FA 4DV2L 3SR1A 1PZID 1SYCA 3N52A 3A8JE 2CH4W 3FMCA 3TRZA 2BE5C 3W1GA 1IBML 1KLUD 3E6ZX 5M3MG 1WCMH 1P16A 3GO5A 3T53B 3GTLB 3M4OH 1A2TA 1LT5D 1SNDA 4NXNQ 3TZUA 5IGCA 1QUQA 2Q2UA 1FL0A 3MEFA 2F0HA 2K4KA 4ZUIA 2IHFA 4KN4C 1F9QA 1SE8A 2JA5H 3GV6A 1Y14B 1BCPB 1R4PB 4AIMA 3HKZG 1G6PA 2F3WA 5JEAJ 3QB3A 1V1PA 3HFZB 1ENFA 4WJWA 1EWCA 4R8NA 4YWMA 4DFAA 4JI0L 1G8ZD 1L1OA 5IY0A 2UXDL 1D5XC 1W6JA 1UNSA 3H0GH 2A69D 3FHWA 4IUQA 1LUZA 3ULJA 1ET6A 1VQLA 1HFNA 5C4XB 3VR5A 3K81C 3KK7A 1N34Q 2NUCA 3GTMH 2XSCA 4ULLA 4LF5Q 4DK1A 4L5SA 1QJOA 4HR7B 2KCNA 4C1NI 4A3EH 4K14A 4PNYA 1LTGD 4I7AA 1EY0A 2A8VA 1EWHA 1VQ9A 4OL7A 4A4IA 4DR3L 3D4RA 4IFDG 1VCIA 2X6GA 5CBEE 2OQKA 3AEVA 1KXLA 2O5JC 3HOUH 4R8IA 2H4OA 1I4HA 1H9MA 1E2ZA 3F8TA 2EOTA 4XT3B 2R93H 4OX9L 3NWSA 1A62A 1WI5A 3BDOA 3AFQA 2KJXA 3NXWA 5C0XJ 4DXFA 5D65A 1LO5D 2RKSA 2OTLA 4JI5L 5KIXA 3VR4A 4HIKA 4CBVA 1PRTF 3KJPA 4EQPA 1TXYA 4IPCA 3RZOB 3PIP3 1PDQA 1TWCB 2QEJC 3K80C 1U4PA 2EY5A 3NQIA 3OPOA 1Q8IA 1B9NA 2VQEL 1VQ5A 1LM0A 1S3OA 1Y1VH 3M4PA 5GAGC 2CFMA 5JJLA 3RN2A 4XXEA 4QUFA 3RD4A 2ZJPA 3UI2A 3S1QB 4NPSA 2JA8G 2HQEA 2AKWB 2B3GA 2AQ3B 2KCMA 3BVMA 3S1NH 2JXMB 2X69A 3GD7A 4PQXA 2K1BA 3TBIB 1QVFA 2Z6KC 4L6TB 2Z1CA 4IZ8A 2UUAL 4TQUS 4CDEC 3HRZC 1Q82C 5C44B 2K04A 3KF6B 4E6IA 3RN5A 2DGYA 4X65L 2BA0A 4GZYC 2KHSA 2NVXH 4OIJA 2VUMG 5I2YA 2E75C 1GUGA 3F1ZA 5GAEC 4X6AH 1TWFH 4B3RL 3K59A 3M9BA 3HOXH 5I9PA 1EL0A 3J80L 2QGQA 4K8IA 5IYBG 4X3SA 2D9UA 2NVYH 3CC2A 1WFQA 5CR3A 3DMUA 4YY3L 2BH8A 2E8GA 2VXWA 2EYFA 5FJ8H 4X64Q 1C48A 4NW2A 1VQEA 2K5VA 3M4QA 3P75A 3E3XA 1X3EA 2LSSA 3KJOA 5IGBA 1H95A 3MXPA 3S9WA 1HQMC 5M3MB 1DOLA 4IOAA 1ONLA 2I5LX 3KDFA 3NTHA 2RQXA 3CKIB 3LWUA 3CMAA 3T1HQ 4CHTB 2EIFA 4Y52H 1GUWA 4A3DH 4JI2L 4J1MA 5KYLA 4JI6Q 2KHJA 2E2DC 1WCMG 3MTSA 1M4VA 2PCFB 3HKZB 4HIDA 1Y69U 3OMGA 3K7UC 1HJPA 2K28A 1DD2A 1I94L 4C3HB 3RMHA 1QZGA 4H7BA 2QA4A 4QIWE 4DV0L 2GVBA 5K36H 4UHVA 1H9KA 1TWHH 4DR7Q 2N3SA 1Y8PB 4IALA 2N55A 1ENAA 2Z6KA 1NSNS 2IJ0A 3PUWA 1WTQA 1C0AA 1AW7A 1KDAA 1PH3A 2F0JA 3KLRA 4DR2L 3B6YA 3H0GG 2SNSA 3EQLC 3CCSA 2PO4A 3KYHC 5JAVA 1LT4D 3N6RA 3UE1A 2Z6BA 4IFDI 3MXNA 1FJGQ 3L7ZC 3U4VA 1VMPA 4X66Q 4JI3L 1HR0Q 2C35B 4FNFA 3L0OA 1F2MA 3GTKH 1SROA 4HJ5A 4GOPC 4Q0FA 3HEJA 5ELCA 3DWPA 1K3BC 2ZJRA 2K75A 2L1BA 2UU9Q 4PV1C 1YHBA 1E0BA 1BBUA 3HOUG 3D4DA 1IW7D 3CAMA 2WV6D 4R9WA 2R93G 1E1OA 1PYSB 4BY1G 5DM63 2B2TC 3J7ZC 2QEXA 4HIOA 5CV9A 3CF5A 1NCVA 1MD2D 1SJED 4P2CB 3EROA 5JPNC 1XXGA 5EBCA 3A7LA 3OIPA 5I2XA 1WTWA 2F52A 3OTOL 5CORA 4F7XA 1XWEA 3IKJA 3JAML 3R93A 2FJ2A 4B3MQ 1GUTA 2YU9H 1CSPA 4CKCA 4DA2A 4A3IG 1X3FA 2JA8B 1BCPC 4QL5A 1SNPA 1PFMA 5BR8Q 1Y1VG 1UE1A 1RD9D 4LUVA 1EQRA 3ULLA 4R1JA 1IW7C 4XTCS 3M3YB 1ASZA 2RCFA 4GS3A 3J81E 3NQTA 3HS0C 1YEZA 4JI1L 2ZTEA 3K8AA 3DUZA 3VA5A 3SDZA 2VUMB 1BVSA 3FVQA 4OWXB 1B70B 3PIO3 2L0CA 1XNRL 3NBIA 1PVOA 1TS5A 5M5YB 3DWQA 2EY2A 3V96A 4APVA 5E4XA 1B3QA 3KLSA 4LF8L 1LTLA 5LMNQ 3J7AV 2RHQB 1LV9A 5IYCH 1GD7A 3A8KE 4DR5L 2PI2A 3HOXG 1RF2D 1P8LA 1B7YB 1VQCA 4JV5L 5DM73 4JI7L 2XIWA 3KF8B 1L0WA 2CHBD 4JI4Q 2H1EA 4DV7L 4NXMQ 2KEDA 3F2BA 3A55A 1ESRA 4KHPQ 2B2TA 3S15H 1HZCA 2DN8A 2F0GA 1XMQQ 5C3EH 1DYQA 3Q6SA 1K83B 2NYZD 1X3PA 3HOYB 1HZAA 1WCMB 1C7YA 3AFPA 1KIXA 3M4OB 4X62L 1KDBA 3UDGA 3KFUA 2F4VQ 5FK9C 2UXCL 2MPMA 3CXCA 5ELBA 2I46A 1JOKA 3OMCA 4LJZC 3RLNA 4LUOA 1SYEA 2RHSB 4OWWB 4S3SA 3VDYA 4G4KA 5K36G 1I3QH 3MFGA 2PW5A 2D0PA 2F0EA 1QZHA 5IYDH 3MEHA 4HSPA 1XPOA 3S1MH 3GTPH 2B63B 4YCVA 2IX1A 1AN8A 2CVRA 4DAYB 2QDBA 2HHHL 4A3JB 2JQOA 2F1MA 1GHJA 1CKOA 4X3UA 5J39A 1A8VA 2K5DA 3CW2C 1X54A 3T13A 1VQPA 1JT8A 1EY4A 2B8GA 1SBBB 5M3FH 2L15A 3MVVA 2IY5B 2F3VA 1EYGA 4DAPA 3U4ZA 5M9OA 2KVMA 4RKLA 1KD1C 5EKKA 2Q8RE 1I4GA 3TZDA 4MNOA 1AFPA 4DR1Q 3OIQA 3HOUB 4ZKBB 2PQAB 4GNXB 2GA4B 2NB0A 1CKNA 5L37A 2AQ2B 2PZTA 5IE8A 2SNMA 5FLXL 5KEEA 4BY1B 4HAEA 1VQBA 4HEDA 2MFIA 3MFYA 4DXGA 4A3FH 3GTGH 1R4QB 3P7JA 2JEBI 4LF5L 2NZHA 1Y8NB 1FNVA 4MIUA 3CPWA 3I4NH 4DV5L 3DM1A 5E7NA 4B9XA 4A3BG 4UPAA 4DU9A 4M1UB 1EU4A 1I4XA 1CI3M 1I6VC 3U9SA 4DR4Q 3BYYB 5E4WC 3CCRA 2J0TD 3W3AA 4G57A 4A3IB 4DV3Q 4YCWA 1I5FA 4YHHQ 4I65A 1BR9A 1Y1VB 1SJHD 4A3LH 3A74A 1CZGA 4AYBB 4FYDA 4OIKA 4JBMA 2B2VC 3NSWA 1QILA 2B2UC 2NWGA 2H5XA 4C1NK 4RHRA 1IXRA 3J80i 2VQFL 1U4LA 3BJUA 1J6QA 4KK7A 1G91A 3LGJA 5IGFA 1D5MC 4ZAIA 3JC66 2NZ1D 3I90A 2IPKD 1YBYA 2BCOA 2VB3X 1LTRD 1VQGA 1EEFD 4GN3B 1EY7A 1GOZA 1K0RA 1PXUA 5DLQE 5C0XI 3I55A 1I4RA 4ME5A 2XN9C 2EPBA 1PTOH 3OOCA 1QCBD 3DM3A 1OXVA 2AUJD 2NBFA 3E9IA 3H09A 4RFBA 3OYYA 4LF9Q 4AH6A 1Y1WH 3O13A 3S14H 4RMFA 1MSGA 4CDDC 4POFA 5T1IA 1HFGA 3HKZE 1SAPA 2QCPX 5KYIA 2YTYA 5IYCG 4Q5VA 3TP7A 3RNUA 1B44D 1YNNC 4FP5D 1SYGA 1S72A 5GQOA 1FD7D 4QY7A 1YVCA 2L9HA 1JE4A 2ZXRA 1XMOQ 3H3VC 3CPFA 2HQLA 1WJJA 3D0FA 1O7ZA 3CCQA 3I56A 2EXDA 2HDMA 1GUOA 3HOWH 5JPMC 2O4XA 2E5LL 2JA6H 4IOCA 1PMRA 1N36Q 1A3TA 3D4WA 4UP8A 5C4ZA 2UXBQ 3SK4A 1IYUA 3FPPA 5IWAQ 2F0NA 2E2JH 1KNAA 1EFWA 2EYOA 3T51B 2BOSA 4UAIA 3GTJB 4DV4Q 3CU7A 1TWHB 2MNAA 2R7ZH 3TEHB 1DCZA 3QIAA 1UAPA 1SN8A 4ZRZA 3NUCA 4H0LC 1B4OA 4ZLTF 1EY5A 2VB2X 1D6EC 2CW0C 2N88A 1KLGD 3W5OA 1A63A 3A5UA 1QVCA 5J3BA 5NUCA 3SHLA 4HJ9A 5JJKA 4X3KA 1GXDC 2ZM6L 2UUBL 4OXPA 2B2WC 3VYRA 4A3KH 3I4MH 5IGDA 1HA5A 1BQQT 2DY8A 2K7VA 2O2LD 3C46A 1A3VA 1I6HH 1LTTD 1I50H 1MGSA 1K9MC 4DR7L 3CQZB 3S24A 5M3FG 5ELNA 2HD3A 3R3OA 3I7FA 2XGTA 1I4PA 2KCTA 1TY2A 4A3CH 4KJOA 2PNHA 2AWNA 4RH6A 4LFBL 3TQYA 1JJCB 3JAMi 4OO1H 1KAWA 2YTXA 3MA2B 2J7ZA 1PRTD 1SMXA 3IFTA 4LF7Q 4A3BB 4KN7C 5FOBB 2J4XA 4KY7A 2EJGC 4A3GH 1SYFA 4KV6A 2RSOA 4HN7A 4FXKC 3MZ5A 1PH1A 3I4NG 4L5RC 1QG7A 1VQIA 2RDHA 1CTMA 1TWAB 3BU2A 1JR0D 3EJIA 4HMJA 3PMFA 4PZ7A 1HR0L 2Q2TA 2XRSD 2ENBA 2F0FA 4Y7NH 1QB5D 1DZ1A 2N78A 3QOJA 4C3JH 1PZKD 4U673 1N33Q 2PYKA 1YI2A 2PW7A 3PUZA 3RLOA 2UU9L 5M5WH 3CHBD 4QB4A 1Q3LA 5AFWA 4ZQ3A 1ZYRD 2DNCA 3DEOA 1DONA 4GKJQ 2KENA 1EZ6A 3KBXA 5G3LF 1G6ZA 4A3LG 2LMCB 4JG2A 4B3SQ 3PGZA 3S16H 3FRPB 3NEMA 1UEAB 1Q8KA 4RGOS 1E2VA 3L3OC 2Q8TA 1JJ2A 2A69C 1Q46A 4A3MH 3J80c 5KRUA 5JJZA 4DN4M 1XX8A 4BBSB 5JEAH 5K5PA 4PMBA 4DK3C 5J22A 3PF5A 4BWGB 2ZJQA 2ALYB 3PSIA 4J6HA 1WTVA 2R6GA 1UUPA 1RDPD 2OQ0A 1YJ9A 1VQMA 3K7AH 3D8GA 3PIPA 2EY6A 2R92G 3K57A 5C4JB 3BVGA 1B8AA 1MI2A 5EBDA 1X3GA 2AUKA 4GNXC 2AMCB 3S17H 5I4DA 3TS2A 5EQ0A 3T4AC 4DUYQ 1ZEQX 3KF8A 5CMDA 4XQQA 1QOHA 2WAQB 1W2BA 1D2BA 1EOVA 1YZ6A 2RDGA 1IKLA 4OGQC 1FNUA 4AQYQ 1KL9A 1VQDA 3Q8DA 3S15B 3NWTA 1SMYD 1HNWL 3CC4A 4KI0A 1Z47A 3HKSA 1XPRA 3I4LA 1WD1A 2K5QA 2M9VA 3UDIA 4K5WA 2ZTCA 1LTID 5C0XH 4DV6Q 4JC0A 4BBRG 1FNWA 1EIGA 1B50A 4BY7H 2JA6G 1CA5A 2O5IC 1JWMD 4LMQD 2F3IA 3ZYYX 2NZOA 4WRDA 3QOLA 1R9TH 2SEBD 1YNJD 1F9SA 1PFNA 1QWYA 4IURA 1TS3A 1CA6A 2KEEA 3TS0A 2N49A 3PQIA 1J8IA 3RUZA 4HTHA 3AMUA 2EYJA 1VF5C 1D7QA 3GTPB 3TP8A 4Z9CB 1JOOA 1J9OA 2GN5A 3S1RH 3RR5A 4DV1L 2F4VL 1Z6HA 2EXZA 1X55A 1TWGB 4JK1C 3CCJA 2RBMA 3T56B 4KKTA 1WTOA 1O7IA 5GAHC 1XNQQ 3GTOB 1LYLA 4ZK9B 4KHZA 1BKBA 4A3KG 2NVQH 1EIHA 3CCLA 1BUVT 5KNDA 1E24A 1D1KA 4DAMA 1HNZL 4OEMB 4QF4A 4HJAA 4GNXA 2E76C 2JA5G 3PV0A 4DV2Q 4RA8A 3D6WA 3J7A5 4AYBE 4QGUA 3GTGB 3JAMc 4A3CG 1V1OA 5M5XH 4O0AA 1S5BD 1SEBD 4OO1G 1KABA 3I4NB 4K6LA 4MZ9A 4DNRB 1IBMQ 4DR6L 3TREA 3URYA 5HURA 4LF6L 3C1EA 1JE5A 3I70A 1JB3A 3BG3A 4C3IH 2JA7H 2OT2A 4FXDA 3OWEB 2BDNA 5IGEA 1YJNA 3GQBA 1E1TA 2K03A 3H6MA 4OHJA 4A3EG 4CDFC 2IX0A 4JI0Q 4NP5A 2UUCL 3CCUA 2E2HB 3D3RA 4QMGA 3LX0A 3FPUB 1BOSA 2X6LA 2WP8J 3K5MA 5CYUA 3SXHA 3GTLH 4K0KL 1RJTA 4HSVA 1RL2A 5BN3A 2MO1A 1M90C 2OF1A 4DR4L 3S2DB 1QUQB 1B53A 4JI8Q 2A68D 1HHVA 4RG1A 2JEAI 1RIPA 2MQHA 2Q2IA 2VL6A 1B3AA 5JEAG 2L12A 1EYCA 4EVOA 1VQ4A 4BXXH 1V1PB 2R7DA 4BA1I 2R92B 1CFMA 4DR3Q 1TQOA 2IX3A 5JVH3 4UY8C 3MC0B 3JAME 1L1OB 1PTOB 3T1YL 2LS01 5T1GA 2DJFC 1U5KA 3H3VI 1CHQD 1STBA 4OX9Q 5C4XH 3S14B 1K28A 1RTNA 4LF4L 1SE3A 4N8FA 5CV5A 1YNXA 1NJIC 4L8JA 3TDQA 1C9OA 3E0EA 1B9MA 1BO0A 2VY3A 2CWAA 4TVAB 3NP8A 3G71A 3CD6A 1GUSA 1UEBA 3VYTA 1VQ6A 2K52A 1F2LA 1A3UA 3W2DA 4PG3A 3I2ZA 4IUTA 4KKUA 2ES2A 5ELEA 5IODA 4BBRB 4P75A 3M7GA 2WFWA 4B3TL 1EFID 4LF9L 1LTBD 2Q2HA 1NY4A 3R2IA 1LT3D 2JA6B 1VQFA 4J8QA 2IWHA 5IP9H 3HOZH 2B2YC 1BCPF 1N9WA 4YWLA 5C0XG 3J81j 1PH9A 1GO3E 3J81L 2E2IH 3GTQH 3PIOA 3VR6A 5COYA 1BBXC 4GOPA 3P20A 2L11A 1FR3A 4BY7G 1GM5A 1SNCA 1KDCA 2K50A 4IPGA 2JJQA 1PHJA 1TWCH 3HP3A 2UUAQ 2MUYA 1W6KA 2Y0SG 1ML0D 5EJWA 5FJ8G 1WOCA 1A0IA 1IBKQ 4IJHA 4X65Q 1WD0A 3IFDA 1ZXTA 1TY0A 2YYZA 1J5EL 5FLXc 3MXUA 5IT9L 4A75A 4O42A 2QF7A 2L55A 3ONAB 3S1QH 1S4ZA 1IZ6A 1NR4A 4A3KB 4ZCKA 3U9OA 1SRUA 2F0DA 5I6YA 4DK6C 2WIIB 3K58A 4A3DG 3K5OA 4YY3Q 4V190 1CKMA 3FEWX 4O2DA 3V2TA 1Q86C 3A54A 2JA5B 1Z7TA 4IQZA 1CZWA 1EQTA 2ATWA 3A7AB 5C44H 1VQKA 1ESFA 2C9OA 2D2CC 4OO1I 1KTKA 4DAVA 4JBKA 1B1ZA 2RF4A 5LMUQ 1PRTB 5BN4A 4RCNA 3U50C 1VQAA 4YCUA 1SNMA 3H0GB 3BZCA
chains in the Genus database with same CATH topology
4K6DA 4F88A 5EPKA 3GTMB 1EZ8A 4ZKCB 1AZQA 1WTRA 2D5DA 1HQRD 4Y7NB 4LK1C 5TSSA 3EFXD 3NTKA 4A3EB 2NTSA 1K8MA 4C3IG 5M5WB 1OXSC 4IFDJ 1F2YA 4X3TA 1BXTA 1X32A 4RGNA 1DJRD 1JWUD 5FLXE 5CV6A 3DHQA 2R93B 1SYBA 3CRKC 2ICIA 1SSOA 5I6WA 5D3DA 2WACA 3X3NA 4RAUC 5CGKA 1CT1D 4JBWA 4B08A 3TN2A 3BVZA 1OXXK 3I72A 1PLFA 3K7AB 5KNBA 2B8FA 2A6HD 2LY7A 3F2UA 3I8ZA 1VMCA 1ENCA 3HZXA 2K05A 2R3ZA 4KY5A 2A5HA 3I3CA 4ABNA 3S17B 3SK5A 1GHKA 2FINB 4CGYB 4C56C 3S1NB 3SE0A 1TS4A 1OO9B 1RHPA 1RTOA 1S5CD 4TSSA 1O7LA 1K8OA 4KD3A 5FO7B 1PYWD 2F0IA 2NVXB 4ZYSA 5CC4A 5DAUA 1TWFB 2A6HC 1PTOD 3QO2A 3HOXB 4BY7B 1S5FD 1DXMA 5A2QL 1WTPA 1Q90A 2NVYB 4KY6A 3VA7A 1R9TB 1EYDA 2F0QA 3SVMA 2HCCA 2Y0SB 1JCKB 1LT6D 1Y8OB 3PUYA 4N9PA 3CRLC 1CK1A 1BF4A 3Q22A 4IUVA 1D5ZC 4IN3A 1CQVA 3VYUA 4CJ0B 5C5LA 1SNQA 2M00A 5BN5A 4YIJA 4WFN3 2ZXPA 1E2WA 1OXUA 1SE4A 3E0JA 3PUVA 1U9RA 5ISRA 4A3DB 5C3XA 2KECA 3H91A 4XYOA 1PTOC 2NVQB 2MGSA 1RKNA 3C3LA 1EY9A 1ILQA 2B2VA 4B9WA 2B2UA 1TKWB 3X3MA 4RHSA 2PZUA 1X3QA 4K2LA 3G7LA 1ICWA 2EDGA 3SK8A 4H13C 4RWSC 1O80A 3Q23A 2FHTA 2RDFA 5EGTA 4V0BA 1IYVA 1HPCA 3IL8A 2MP1A 4C3IB 2F03A 1EYAA 1A6XA 1SNOA 3EVQA 5G3LD 5D14A 5IIFA 3TP6A 4ODGA 1JQYD 3PUXA 1Q1BA 3GTKB 2EJFC 1EOTA 5E1FA 1WVLA 3NPPA 1JOQA 3D6CA 1M8AA 3I73A 3D31A 4HMIA 1FYCA 3I91A 4FO2A 5DNFA 3MWYW 1Q1EA 2MHVA 1SE2A 4ZUJA 4IUPA 4C3HG 4EGVA 4KTAA 4FF1A 2RVLA 2LKVA 2TMPA 3WDNA 4CJ2C 2YU9B 4NKLA 3A56A 4HCSA 1HXYD 3HGBA 2FMCA 3LWEA 1AP0A 1DM0B 1DOMA 1HTLD 5J1ZA 5CV8A 3OHXC 1PRTC 2K01A 2NN6I 1SYDA 3VR2A 4K5XA 5FKAC 2IW3A 4QCLA 1KNEA 4XQJA 2F0PA 2K32A 2DNEA 4BA2I 2B2WA 3DXJC 4M8AA 4PMCA 2EYLA 3R2TA 3KLSX 4H44C 4F8MA 3J7AF 5CV4A 3HOZB 1MSHA 3GTQB 2E2IB 1ZYRC 1NR2A 3A8IE 1KAAA 1PZJD 1BDOA 2K5WA 2SDFA 2PNRC 5A35A 4XYQA 1STNA 2KCCA 2JE6I 3M85A 1QNUA 1F9PA 2PZWA 1H9JA 4LAAA 2EE1A 2L5TA 2WB1B 3BYTB 1D1IA 2IL8A 3FDTA 3OWFA 1S5DD 3IAYA 5C3EB 5D3IB 3DWAA 5C3WA 1EU3A 3SK6A 1TU2B 2EYMA 4IUUA 2ICEC 3R8BA 3ND8A 4TRDA 4EQNA 3J80E 2SOBA 4XDXA 1I4QA 2WKCA 2B39A 2EYHA 4G7ZC 1IL8A 4I7ZC 1I3QB 2JYOA 4FF4A 5LL6S 5CBAE 1SMYC 2D62A 4L63B 3TP5A 1C8CA 3S1MB 5ELDA 4DAYA 1F2ZA 2PPBC 4K5VA 4FF2A 4G7OC 3VYSA 2C5CA 4ID6A 2E74C 4CKBA 1ZKOA 2FMMA 5M3FB 3J7YW 4HCEA 1H9SB 1TR5A 2WKDA 1ET9A 2G9DA 5IGGA 1YNJC 2XWJB 3K0YA 2XRQD 2PMZB 2KUMA 4KKSA 5FO9B 2XNAC 1B2TA 3EA6A 3GP7A 4NDXA 4C2MB 2HDLA 4A3FB 2XVSA 4DNTB 2F0SA 1JC7A 3SEBA 3C1FA 4N9TA 1FGBD 3OW7A 3PO2B 3VR3A 1QE6A 3TSSA 2OXPA 5LL6X 4C3JG 2XWBB 1VDZA 1AZPA 4FVMA 2TSSA 1Q12A 1NAPA 3LNNA 3S2HB 1IHZA 1G2SA 1T5XD 4FF3A 3TMEA 1STEA 2AWOA 4CKEA 3OSOA 2OEOA 1TT2A 1VF7A 1LACA 3ND9A 4XQNA 2F0KA 1BCPD 1O7YA 2F0VA 5EKIA 1F77A 5F2DA 3PO3B 2Z8LA 4MHEA 1SFOB 1S5ED 1Y1WB 1LLRD 2ZXOA 1EEID 1L0YB 2F0TA 1EY8A 5KNCA 5C4HA 2NN6H 3Q24A 2EVBA 5C5MA 3HOVB 1CM9A 2A68C 1T5EA 5JVG3 1ILPA 4XIGS 2A6ED 3HOWB 4KMUC 1HCZA 4MN3A 3M7NA 1C4QA 2CQAA 2F0WA 4A93B 2FFKB 1BNZA 2A73B 3V05A 4RKBA 2NTTA 3Q0AA 2RA4A 2E2JB 1II3A 1MBYA 2Q8IB 2EY1A 3G6JB 2R7ZB 5EPJA 1HA6A 3RZDB 1F9RA 2QILA 2F0LA 2V4DA 1DOKA 1U4MA 1V43A 1LTSD 3NE5B 1H9RA 3NBHA 5I9OA 2BDOA 2A6EC 3L9AX 5IT9E 3ITPA 1STGA 3BS1A 2EJMA 3K6OA 4K8JA 3I4MB 1SXTA 4RCOA 2AQ1B 2DY7A 3AB9A 1I6HB 3H94A 1I50B 1NUCA 4UDUC 3KUPA 2A74C 2WINB 2JP1A 4G7HC 3MXGA 1STYA 3NK9A 1STHA 2EYPA 3AU7A 4XT1B 1OXTA 4RGMA 5FO8B 4A3GB 2F0MA 3BZDB 1IKMA 4QUCA 1XYIA 4CJ1B 1PFBA 4C3JB 4FXGC 2B2YA 4DGZA 5HGTA 5IOCA 1JORA 5JOBA 3C2PA 3WOEA 1GUNA 1JWSD 1HUNA 1STAA 1G2TA 3S16B 4KHVA 4BS9A 2KQ3A 5E3FA 3KBGA 2MJ8A 4IUNA 1QNKA 4A3MB 2NVTB 1LABA 1TVXA 2IT1A 2RSNA 3QWNA 5CV7A 2Z4IA 1LTAD 2F0UA 2KA7A 1L0XB 3WOFA 1GJXA 4KJNA 1TS2A 1AEXA 3RLFA 3QG1A 1TIID 1U4RA 4U68A 2BA1A 2HCIA 4IFDH 1WTXA 2HUGA 3T16A 4QIWB 4EQOA 1RCVD 3NTIA 2K33A 2NN6G 3DEPA 2ID0A 1EQVA 3MHBA 2LFNA 2KOLA 2ZT9C 3E5SA 2F0OA 2M2LA 4DK0A 5DEHA 1YNND 5A2QE 4ILWA 2R61A 5LHY1 3FKIB 5C6AA 5EPLA 3K5NA 2QKIC 1JICA 2JSOA 1O78A 4NMZA 4RGTA 1A15A 2VNUD 3K5LA 2G9HD 3HG9A 3ERQA 4O1NA 1CQFA 1HRJA 1CHPD 5EKLA 3S1RB 5KGUA 3QJYA 2EZVA 3BDLA 1G291 1HUMA 4DF7A 1H9SA 4TKOB 3MAQA 1RODA 2CW0D 4F87A 2I07B 1V8QA 1XTCD 1EY6A 4PMWA 2BE5D 2Z4HA 4KD4A 3GV3A 5M5XB 3NHHA 4WORA 3P1HA 2L4NA 4K2KA 2F4IA 3BDCA 3M4YA 1SDFA 1PTOF 2PQEA 2JA7B 5ELFA 2K6AA 1HTPA 1A2UA 3SR1A 1PZID 1SYCA 3N52A 3A8JE 3FMCA 2BE5C 1KLUD 3E6ZX 3GO5A 3T53B 3GTLB 1A2TA 1LT5D 1SNDA 3TZUA 5IGCA 4ZUIA 2F0HA 4KN4C 1F9QA 3GV6A 1BCPB 1R4PB 2F3WA 5JEAJ 3QB3A 1V1PA 1ENFA 4WJWA 1EWCA 4R8NA 4DFAA 1G8ZD 1D5XC 1W6JA 1UNSA 2A69D 4IUQA 1HFNA 1ET6A 5C4XB 3VR5A 3KK7A 2NUCA 2XSCA 4ULLA 4DK1A 1QJOA 4HR7B 2KCNA 4C1NI 4K14A 4PNYA 1LTGD 1EY0A 1EWHA 4OL7A 3D4RA 4IFDG 1VCIA 2X6GA 5CBEE 2O5JC 4R8IA 2H4OA 1I4HA 1H9MA 1E2ZA 2EOTA 4XT3B 3NWSA 3BDOA 2KJXA 3NXWA 5C0XJ 4DXFA 5D65A 1LO5D 2RKSA 5KIXA 3VR4A 4CBVA 1PRTF 4EQPA 3RZOB 3PIP3 1PDQA 1TWCB 2QEJC 1U4PA 2EY5A 3NQIA 3OPOA 1Q8IA 1B9NA 4XXEA 4QUFA 3RD4A 3UI2A 3S1QB 2HQEA 2AQ3B 3BVMA 2JXMB 2X69A 3GD7A 4PQXA 2K1BA 3TBIB 4L6TB 2Z1CA 4IZ8A 4TQUS 3HRZC 5C44B 2K04A 4E6IA 2BA0A 4GZYC 2KHSA 4OIJA 5I2YA 2E75C 1GUGA 3K59A 5I9PA 1EL0A 3J80L 4K8IA 4X3SA 2D9UA 5CR3A 3DMUA 2VXWA 2EYFA 1C48A 4NW2A 3P75A 5IGBA 3MXPA 3S9WA 1HQMC 5M3MB 1DOLA 1ONLA 3NTHA 2RQXA 3CKIB 3LWUA 1GUWA 4CHTB 4J1MA 5KYLA 2E2DC 3MTSA 1M4VA 2PCFB 3HKZB 1Y69U 3OMGA 2K28A 1DD2A 4C3HB 3RMHA 4H7BA 5K36H 1H9KA 1Y8PB 4IALA 2N55A 1ENAA 1NSNS 2IJ0A 3PUWA 1WTQA 1AW7A 1KDAA 2F0JA 3KLRA 2SNSA 3EQLC 2PO4A 5JAVA 1LT4D 3N6RA 4IFDI 3MXNA 3L7ZC 1VMPA 4FNFA 1F2MA 4Q0FA 3HEJA 5ELCA 3DWPA 2L1BA 4PV1C 1E0BA 3D4DA 1IW7D 2WV6D 4R9WA 5DM63 2B2TC 5CV9A 1NCVA 1MD2D 1SJED 4P2CB 3EROA 5JPNC 1XXGA 5EBCA 3A7LA 3OIPA 5I2XA 1WTWA 5CORA 4F7XA 1XWEA 3IKJA 3JAML 3R93A 2FJ2A 1GUTA 4CKCA 4DA2A 2JA8B 1BCPC 1SNPA 1PFMA 1RD9D 1IW7C 4XTCS 3M3YB 3J81E 3NQTA 3HS0C 3DUZA 3VA5A 3SDZA 2VUMB 3FVQA 3PIO3 2L0CA 3NBIA 1TS5A 5M5YB 3DWQA 2EY2A 3V96A 5E4XA 3KLSA 3J7AV 1LV9A 3A8KE 1RF2D 5DM73 2XIWA 2CHBD 2H1EA 2KEDA 3A55A 1ESRA 2B2TA 2DN8A 2F0GA 1DYQA 3Q6SA 1K83B 2NYZD 1X3PA 3HOYB 1WCMB 3M4OB 1KDBA 5FK9C 2MPMA 5ELBA 2I46A 1JOKA 3OMCA 4LJZC 1SYEA 4S3SA 4G4KA 5K36G 3MFGA 2PW5A 2F0EA 3MEHA 4HSPA 2B63B 2IX1A 1AN8A 2CVRA 2QDBA 4A3JB 2F1MA 1GHJA 4X3UA 5J39A 2K5DA 3T13A 1EY4A 2B8GA 1SBBB 3MVVA 2F3VA 4DAPA 5M9OA 2KVMA 4RKLA 5EKKA 2Q8RE 1I4GA 3TZDA 1AFPA 3OIQA 3HOUB 4ZKBB 2GA4B 2NB0A 2AQ2B 2PZTA 2SNMA 5FLXL 5KEEA 4BY1B 4HAEA 4HEDA 4DXGA 3MFYA 1R4QB 3P7JA 2JEBI 1Y8NB 1FNVA 4MIUA 3DM1A 4B9XA 4DU9A 4M1UB 1EU4A 1I4XA 1CI3M 1I6VC 3U9SA 3BYYB 5E4WC 2J0TD 3W3AA 4G57A 4A3IB 4I65A 1BR9A 1Y1VB 1SJHD 1CZGA 4AYBB 4FYDA 4OIKA 2B2VC 3NSWA 1QILA 2B2UC 2NWGA 4C1NK 4RHRA 1U4LA 4KK7A 1G91A 5IGFA 1D5MC 4ZAIA 2NZ1D 3I90A 2IPKD 2BCOA 2VB3X 1LTRD 1EEFD 1EY7A 1GOZA 1PXUA 5C0XI 1I4RA 4ME5A 2XN9C 2EPBA 1PTOH 3OOCA 1QCBD 1OXVA 2AUJD 2NBFA 3H09A 4RFBA 3O13A 1MSGA 5T1IA 1HFGA 1SAPA 2QCPX 5KYIA 4Q5VA 3TP7A 1B44D 1YNNC 4FP5D 1SYGA 1FD7D 2L9HA 1JE4A 2ZXRA 3H3VC 1O7ZA 2HDMA 1GUOA 5JPMC 2O4XA 1PMRA 1A3TA 3D4WA 5C4ZA 3SK4A 1IYUA 3FPPA 2F0NA 1KNAA 2EYOA 3T51B 2BOSA 4UAIA 3GTJB 3CU7A 1TWHB 1DCZA 3QIAA 1UAPA 4ZRZA 3NUCA 4H0LC 1B4OA 4ZLTF 1EY5A 2VB2X 1D6EC 2CW0C 2N88A 1KLGD 5NUCA 3SHLA 4X3KA 1GXDC 2B2WC 3VYRA 5IGDA 1HA5A 1BQQT 2DY8A 2K7VA 2O2LD 3C46A 1A3VA 1LTTD 1MGSA 3CQZB 3R3OA 1I4PA 1TY2A 4KJOA 2AWNA 4RH6A 4OO1H 3MA2B 2J7ZA 1PRTD 3IFTA 4A3BB 4KN7C 5FOBB 2J4XA 4KY7A 2EJGC 1SYFA 4KV6A 2RSOA 4HN7A 4FXKC 3MZ5A 1QG7A 2RDHA 1CTMA 1TWAB 3EJIA 1JR0D 4HMJA 3PMFA 2XRSD 2ENBA 2F0FA 1QB5D 1DZ1A 3QOJA 1PZKD 4U673 2PYKA 2PW7A 3PUZA 3CHBD 4QB4A 1Q3LA 5AFWA 4ZQ3A 1ZYRD 2DNCA 3DEOA 1DONA 1EZ6A 3KBXA 5G3LF 1G6ZA 2LMCB 3FRPB 1UEAB 4RGOS 1E2VA 3L3OC 2Q8TA 2A69C 5KRUA 5JJZA 4DN4M 1XX8A 4BBSB 5JEAH 5K5PA 4PMBA 5J22A 4BWGB 4J6HA 1WTVA 2R6GA 1UUPA 1RDPD 3D8GA 2EY6A 3K57A 5C4JB 3BVGA 1MI2A 5EBDA 2AUKA 5I4DA 5EQ0A 3T4AC 1ZEQX 3KF8A 5CMDA 4XQQA 1QOHA 2WAQB 1D2BA 2RDGA 1IKLA 4OGQC 1FNUA 3S15B 3NWTA 1SMYD 4KI0A 1Z47A 3I4LA 1WD1A 2K5QA 2M9VA 4K5WA 1LTID 5C0XH 1FNWA 1EIGA 1B50A 1CA5A 2O5IC 1JWMD 4LMQD 3ZYYX 4WRDA 3QOLA 2SEBD 1YNJD 1F9SA 1PFNA 1QWYA 4IURA 1TS3A 1CA6A 2KEEA 1J8IA 3RUZA 4HTHA 3AMUA 2EYJA 1VF5C 3GTPB 3TP8A 4Z9CB 1JOOA 1J9OA 1Z6HA 2EXZA 1TWGB 4JK1C 2RBMA 3T56B 4KKTA 1WTOA 3GTOB 4ZK9B 4KHZA 1EIHA 1BUVT 5KNDA 1D1KA 4QF4A 2E76C 3PV0A 4RA8A 3D6WA 3GTGB 1V1OA 1S5BD 1SEBD 4OO1G 1KABA 3I4NB 4K6LA 4DNRB 3URYA 5HURA 3C1EA 3I70A 1JB3A 3BG3A 2OT2A 4FXDA 3OWEB 2BDNA 5IGEA 3GQBA 2K03A 3H6MA 4OHJA 2IX0A 4NP5A 2E2HB 3D3RA 4QMGA 3LX0A 3FPUB 1BOSA 2X6LA 2WP8J 3K5MA 5CYUA 3SXHA 1RJTA 4HSVA 5BN3A 2OF1A 3S2DB 1B53A 2A68D 1HHVA 2JEAI 1B3AA 5JEAG 2L12A 1EYCA 4EVOA 1V1PB 4BA1I 2R92B 1CFMA 1TQOA 2IX3A 5JVH3 3MC0B 3JAME 1PTOB 2LS01 5T1GA 1CHQD 1STBA 3S14B 1RTNA 1SE3A 5CV5A 4L8JA 3TDQA 1B9MA 1BO0A 3NP8A 1GUSA 3VYTA 1F2LA 1A3UA 3W2DA 4IUTA 4KKUA 5ELEA 5IODA 4BBRB 3M7GA 1EFID 1LTBD 2JA6B 3R2IA 1LT3D 4J8QA 2IWHA 2B2YC 1BCPF 5C0XG 3J81L 3VR6A 5COYA 1BBXC 3P20A 2L11A 1FR3A 1SNCA 1KDCA 3HP3A 2MUYA 1W6KA 1ML0D 5EJWA 1WD0A 3IFDA 1ZXTA 1TY0A 2YYZA 3MXUA 5IT9L 4O42A 2QF7A 2L55A 3ONAB 1S4ZA 1NR4A 4A3KB 3U9OA 2F0DA 5I6YA 2WIIB 3K58A 3K5OA 4V190 3FEWX 3V2TA 3A54A 2JA5B 1Z7TA 4IQZA 1CZWA 1EQTA 3A7AB 1ESFA 2C9OA 2D2CC 4OO1I 1KTKA 4DAVA 1B1ZA 1PRTB 5BN4A 4RCNA 1SNMA 3H0GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOO A;  4K6D A;  4K8J A;  3OSO A;  1EZ6 A;  1STB A;  2OEO A;  2PZT A;  4TRD A;  2SNM A;  1TT2 A;  4EQN A;  5CV5 A;  3T16 A;  1EZ8 A;  2EY5 A;  1A2U A;  2EXZ A;  2O4X A;  4IAL A;  4KY6 A;  1NUC A;  4EQO A;  1ENA A;  2RBM A;  1NSN S;  2SOB A;  3SR1 A;  1EYD A;  2EY2 A;  2F0Q A;  2EYH A;  5KEE A;  2F0K A;  1A3T A;  3D4W A;  1KDA A;  4MIU A;  1SYC A;  4ZUJ A;  3NP8 A;  1EQV A;  3MHB A;  5C4Z A;  2F0V A;  1STY A;  3NK9 A;  3SK4 A;  1STH A;  2EYP A;  2F0J A;  5F2D A;  5KRU A;  2F0N A;  4N9P A;  2SNS A;  4KTA A;  3E5S A;  4B9X A;  5K5P A;  4PMB A;  2EYO A;  4DU9 A;  2F0O A;  2HQE A;  2LKV A;  1A3U A;  3TP5 A;  4QF4 A;  5JAV A;  1F2Y A;  5DEH A;  1A2T A;  4NKL A;  5C5L A;  1SNQ A;  2M00 A;  5J22 A;  1SND A;  4YIJ A;  5IOD A;  1F2Z A;  2F0M A;  5IGC A;  4G57 A;  4ZUI A;  2F0H A;  3NUC A;  5CV6 A;  4K5V A;  3DHQ A;  4IZ8 A;  4J6H A;  1U9R A;  5J1Z A;  5ISR A;  5CV8 A;  1F2M A;  1EY5 A;  1SYB A;  4I65 A;  5C3X A;  4ID6 A;  3D8G A;  5C6A A;  2F0G A;  1KAB A;  2EY6 A;  2F0T A;  1EY8 A;  3HEJ A;  2F3W A;  5I6W A;  3QB3 A;  4E6I A;  1SYD A;  4NMZ A;  5NUC A;  5C4H A;  1RKN A;  4K5X A;  3SHL A;  4R8N A;  2KHS A;  4DFA A;  5HUR A;  2WAC A;  4DGZ A;  1TR5 A;  3C1E A;  5C5M A;  5HGT A;  1EY9 A;  3D4D A;  5CGK A;  1SNC A;  1KDC A;  4B9W A;  1KDB A;  3ERQ A;  5IGG A;  2F0P A;  5IOC A;  1JOR A;  2PZU A;  5I9P A;  5IGD A;  4K2L A;  5EKL A;  5IGF A;  4K8I A;  5JOB A;  4PMC A;  1A3V A;  2EYL A;  5IGE A;  4NDX A;  5CV9 A;  2NUC A;  3SK8 A;  1STA A;  5KGU A;  5CR3 A;  3DMU A;  1JOK A;  4F8M A;  4KHV A;  3H6M A;  2KQ3 A;  3BDL A;  3OMC A;  5CV4 A;  3ERO A;  5E3F A;  2F0S A;  3R3O A;  2F0W A;  1EY7 A;  2EYF A;  1SYE A;  4NP5 A;  4DF7 A;  2RDF A;  4IUN A;  4KJO A;  4K14 A;  4PNY A;  4S3S A;  1ENC A;  3HZX A;  1KAA A;  1EY0 A;  4QMG A;  4KY5 A;  3LX0 A;  4RKB A;  5EGT A;  3P75 A;  4OL7 A;  4ME5 A;  4K5W A;  3SK5 A;  4F7X A;  1II3 A;  2PW5 A;  3C1F A;  2F0E A;  1STN A;  4N9T A;  5IGB A;  3MEH A;  3SXH A;  5CV7 A;  3U9O A;  5I9O A;  2PZW A;  3MXP A;  2F0D A;  1EYA A;  2EY1 A;  5I6Y A;  3S9W A;  4KY7 A;  1EY6 A;  4LAA A;  1SNO A;  1SNP A;  3EVQ A;  1SYF A;  2OF1 A;  4KV6 A;  2QDB A;  5IIF A;  3TP6 A;  3MZ5 A;  4KD4 A;  4ODG A;  3OWF A;  4WRD A;  3V2T A;  2OXP A;  2F0L A;  3EJI A;  3QOL A;  2F0U A;  5J39 A;  4HMJ A;  3NHH A;  3PMF A;  5KYI A;  4J1M A;  5KYL A;  5E1F A;  2ENB A;  2F0F A;  4WOR A;  3NXW A;  3T13 A;  4KD3 A;  1EYC A;  3P1H A;  1EY4 A;  3TP7 A;  4EVO A;  3QOJ A;  5C3W A;  4KJN A;  3NQT A;  1SYG A;  2RKS A;  1TQO A;  3MVV A;  1AEX A;  3BDC A;  2F0I A;  2PYK A;  4K2K A;  3OMG A;  2F3V A;  3SK6 A;  5KIX A;  2PW7 A;  3ITP A;  4HTH A;  3D6C A;  3RUZ A;  5M9O A;  2EYM A;  1JOQ A;  1IHZ A;  1STG A;  4RKL A;  5EKK A;  2EYJ A;  4H7B A;  3VA5 A;  4QB4 A;  5DAU A;  3TME A;  4EQP A;  5CC4 A;  1SNM A;  3TP8 A;  4ZQ3 A;  2PQE A;  4HMI A; 
#chains in the Genus database with same CATH topology
 4K6D A;  1YJW A;  4F88 A;  3QR8 A;  5EPK A;  4JOI C;  1KRS A;  1EZ8 A;  3GTM B;  1NMF A;  4NXN L;  4ZKC B;  1AZQ A;  4IJL A;  1WTR A;  2D5D A;  1HQR D;  4Y7N B;  4LK1 C;  5TSS A;  3EFX D;  3NTK A;  4A3E B;  2QW7 A;  2NTS A;  1K8M A;  3KLW A;  4C3I G;  2JA7 G;  5M5W B;  4DV0 Q;  1OXS C;  4IO9 A;  4IFD J;  1F2Y A;  1VQJ A;  4X3T A;  1BXT A;  2Z0S A;  4LF7 L;  1X32 A;  4RGN A;  1DJR D;  1JWU D;  3KDF B;  5GRO A;  1W3S A;  5CV6 A;  5FLX E;  3DHQ A;  2R93 B;  4C2M H;  4QQB X;  1SYB A;  3CRK C;  3A5Z B;  2OWO A;  1N34 L;  2ICI A;  4DR2 Q;  1SSO A;  4PZ6 A;  5I6W A;  4GLV B;  5D3D A;  2WAQ E;  3NEN A;  3DLL A;  2CH4 A;  2WAC A;  3X3N A;  4DNI A;  1K3R A;  4RAU C;  4KLK A;  4C3H H;  5CGK A;  3UE0 A;  4JI3 Q;  1CT1 D;  4JW0 A;  4JBW A;  3PO2 H;  4B08 A;  3TN2 A;  4GKK Q;  3BVZ A;  1OXX K;  3I72 A;  1AE3 A;  1PLF A;  3K7A B;  4B3S L;  5KNB A;  2B8F A;  2A6H D;  2LY7 A;  3F2U A;  3I8Z A;  1VMC A;  1ENC A;  1NTG A;  3HZX A;  2K05 A;  2R3Z A;  4KY5 A;  2A5H A;  3I3C A;  4ABN A;  3S17 B;  3SK5 A;  1GHK A;  2FIN B;  4CGY B;  5C4X G;  4JBJ A;  1JJG A;  3S2H H;  4C56 C;  3S1N B;  3SE0 A;  1TS4 A;  3MXN B;  1OO9 B;  1RHP A;  1DGS A;  1RTO A;  1CSQ A;  1S5C D;  4TSS A;  3OTO Q;  1O7L A;  3KF6 A;  1AE2 A;  1K8O A;  4KD3 A;  5FO7 B;  1MJE A;  1PYW D;  3PO3 H;  2F0I A;  2NVX B;  4ZYS A;  5CC4 A;  5DAU A;  1TWF B;  2A6H C;  3I4O A;  1Z9F A;  1PTO D;  3QO2 A;  3HOX B;  4BY7 B;  1SFO H;  1S5F D;  1DXM A;  5A2Q L;  1WTP A;  5IP9 G;  1SLJ A;  3H3V H;  1Q90 A;  2NVY B;  3HOZ G;  1UWV A;  4KY6 A;  3VA7 A;  1R9T B;  1EYD A;  2F0Q A;  3SVM A;  2HCC A;  2Y0S B;  1JCK B;  1X65 A;  1LT6 D;  4JI1 Q;  1Y8O B;  4WJ4 A;  2XTI A;  3PUY A;  4N9P A;  2K5N A;  1CK1 A;  3CRL C;  2JA9 A;  2KBN A;  1BF4 A;  3Q22 A;  4IUV A;  1D5Z C;  4GLX A;  2V1C C;  4IN3 A;  1CQV A;  3VYU A;  5HGQ A;  3HOV H;  4CJ0 B;  1PYB A;  2WB1 G;  5C5L A;  1SNQ A;  2M00 A;  5BN5 A;  4YIJ A;  1XNR Q;  4WFN 3;  1N32 Q;  4JCV E;  4EQ5 A;  2ZXP A;  1E2W A;  1OXU A;  4LNQ A;  2N8N A;  1SE4 A;  4J15 A;  3G6E A;  3E0J A;  3PUV A;  1U9R A;  5ISR A;  5C3E G;  4A3D B;  5C3X A;  2KEC A;  3H91 A;  4XYO A;  3M3Y H;  1L1O C;  1PTO C;  4A93 H;  1IBL Q;  2NVQ B;  2MGS A;  1RKN A;  4JI7 Q;  3C3L A;  4X64 L;  1EY9 A;  1ILQ A;  2B2V A;  4B9W A;  4DV7 Q;  2DJG C;  1E22 A;  2B2U A;  1TKW B;  3X3M A;  4RHS A;  2PZU A;  2BH2 A;  1X3Q A;  4K2L A;  3G7L A;  1ICW A;  1K8G A;  4DUZ Q;  2EDG A;  3SK8 A;  5C44 G;  3RZD H;  1VS0 A;  5IYB H;  1XPU A;  4H13 C;  4RWS C;  3T1H L;  1O80 A;  3Q23 A;  2FHT A;  2RDF A;  1XNQ L;  5EGT A;  5IYD G;  4JI6 L;  4V0B A;  1IYV A;  3NBH B;  1HPC A;  1EQQ A;  3IL8 A;  2MP1 A;  4C3I B;  2F03 A;  1KHI A;  2UXC Q;  1EYA A;  1NE3 A;  4LFA Q;  1A6X A;  1SNO A;  3EVQ A;  5G3L D;  5D14 A;  5IIF A;  1EUJ A;  1S40 A;  3TP6 A;  4ODG A;  1Q7Y C;  1JQY D;  3PUX A;  1MKH A;  1Q1B A;  3GTK B;  2EJF C;  1EOT A;  5E1F A;  1WVL A;  3NPP A;  1M1K C;  1K83 H;  3HOY H;  1JOQ A;  3D6C A;  4P73 A;  1M8A A;  3I73 A;  3D31 A;  3ERS X;  4JYA Q;  4HMI A;  2HHH Q;  4A3F G;  1FYC A;  3I91 A;  4POG A;  3FP9 A;  4FO2 A;  2K14 A;  1E3P A;  1FJG L;  5DNF A;  4X66 L;  3E9H A;  3MWY W;  1Q1E A;  4OEL B;  1CUK A;  4L5T A;  2MHV A;  1SE2 A;  4ZUJ A;  2MO0 A;  4IUP A;  4C3H G;  4R4O A;  2OTJ A;  4EGV A;  2KHI A;  2RCN A;  4KTA A;  4FF1 A;  2RVL A;  2LKV A;  3PO2 G;  2TMP A;  3WDN A;  4CJ2 C;  2YU9 B;  4NKL A;  3A56 A;  2B63 H;  4HCS A;  1HXY D;  3HGB A;  2FMC A;  3LWE A;  1AP0 A;  5EAY A;  1ASY A;  1DM0 B;  1DOM A;  4A3J H;  3STB D;  1HTL D;  5J1Z A;  4DV5 Q;  5CV8 A;  4JI8 L;  3OHX C;  1PRT C;  3J81 i;  3PF4 A;  2K01 A;  2NN6 I;  1SYD A;  3VR2 A;  4K5X A;  5FKA C;  2NVT H;  2IW3 A;  5ELO A;  3CCV A;  4QCL A;  3CCM A;  1KNE A;  3CP0 A;  4XQJ A;  2F0P A;  2K32 A;  1YIJ A;  4B3M L;  2DNE A;  4BA2 I;  1VQ7 A;  2B2W A;  3DXJ C;  1CKN B;  4M8A A;  1XJV A;  4PMC A;  2EYL A;  4BY1 H;  1HNX Q;  3R2T A;  3KLS X;  4H44 C;  4F8M A;  5BR8 L;  3J7A F;  5CV4 A;  3HOZ B;  4LFC Q;  1K8A C;  3PO3 G;  1MSH A;  3GTQ B;  2E2I B;  1YIT A;  1ZYR C;  4R4Q A;  1NR2 A;  1MHW C;  3A8I E;  1KAA A;  1PZJ D;  1BDO A;  2K5W A;  2SDF A;  1KRT A;  2PNR C;  4DKA C;  3STB C;  5A35 A;  4XYQ A;  2VQF Q;  4IPD A;  1STN A;  2KCC A;  2JE6 I;  3M85 A;  1Y1W G;  1QNU A;  1F9P A;  2PZW A;  4YWK A;  2B29 A;  1H9J A;  4LAA A;  2EE1 A;  2L5T A;  2WB1 B;  3BYT B;  2LXK A;  4A3I H;  1D1I A;  2IL8 A;  3FDT A;  3OWF A;  1S5D D;  2CKZ B;  2CWP A;  5H1S E;  3IAY A;  5C3E B;  3HOV G;  5D3I B;  2VW9 A;  3DWA A;  5C3W A;  2ZTD A;  1EU3 A;  1BBW A;  3SK6 A;  2FXQ A;  5LMN L;  1TU2 B;  2EYM A;  4IUU A;  2ICE C;  3G4S A;  3R8B A;  3HOW G;  3ND8 A;  4TRD A;  2HIV A;  4EQN A;  3J80 E;  4JI4 L;  2I0Q A;  4NXM L;  4MTN A;  4A93 G;  2SOB A;  4XDX A;  1I4Q A;  3WWV A;  2WKC A;  4HIM A;  2B39 A;  3FKI H;  5AJ3 Q;  3ULP A;  2EYH A;  4HJ7 A;  4G7Z C;  4KHP L;  2Z9H A;  2ASB A;  1IL8 A;  1YHA A;  1IBK L;  1XMQ L;  4JVZ A;  2JK8 A;  4I7Z C;  1I3Q B;  2JYO A;  2R7Z G;  4FF4 A;  5LL6 S;  5CBA E;  1L2F A;  1SMY C;  2D62 A;  4L63 B;  3TP5 A;  1C8C A;  3S1M B;  2HT1 A;  1GVP A;  5ELD A;  4DAY A;  1F2Z A;  3EN2 A;  2E5L Q;  2PPB C;  4K5V A;  4FF2 A;  4G7O C;  2C5C A;  4ID6 A;  3VYS A;  2E74 C;  4CKB A;  3ICE A;  1ZKO A;  1KQS A;  2FMM A;  5M3F B;  3J7Y W;  4HCE A;  1H9S B;  4JPB W;  1TR5 A;  2WKD A;  1ET9 A;  5LMU L;  3I4M G;  4QJF A;  2G9D A;  1EIY B;  5IGG A;  1YNJ C;  2XWJ B;  3K0Y A;  4GLA C;  2PQA A;  2XRQ D;  2PMZ B;  2KUM A;  4KKS A;  5IP7 H;  5FO9 B;  2XNA C;  1B2T A;  3EA6 A;  1PH2 A;  3GP7 A;  4NDX A;  1HZ9 A;  4C2M B;  2HDL A;  4P72 A;  4A3F B;  2XVS A;  1GKH A;  1FVI A;  4DNT B;  2F0S A;  3UDX A;  3HOY G;  1PV4 A;  1HR0 W;  2ZM6 Q;  2UUB Q;  1JC7 A;  3SEB A;  3C1F A;  4N9T A;  4A3G G;  4LW1 A;  4LWC A;  3GTJ H;  4GN5 A;  1FGB D;  1SR3 A;  3OW7 A;  3VR3 A;  3PO2 B;  1QE6 A;  3U58 A;  4DR1 L;  3TSS A;  3SGI A;  1V1Q A;  2OXP A;  3EIV A;  5LL6 X;  1T9H A;  4LFB Q;  3CCE A;  4C3J G;  2XWB B;  1VDZ A;  1AZP A;  4FVM A;  3IRB A;  2I5H A;  2TSS A;  2UXD Q;  4DPG A;  1UE5 A;  1Q12 A;  2B63 G;  1NAP A;  3LNN A;  1IYJ B;  3S2H B;  1IHZ A;  1G2S A;  1T5X D;  1NNX A;  4FF3 A;  3TME A;  1STE A;  2AWO A;  4A3J G;  4CKE A;  3J81 c;  3OSO A;  2OEO A;  2Y0S E;  1TT2 A;  1VF7 A;  3AYH B;  1LAC A;  3ND9 A;  3CQZ H;  4LUZ A;  4XQN A;  4R4T A;  4A3M G;  3NEL A;  1K73 C;  4DV3 L;  3A0J A;  4GKK L;  2F0K A;  3EBE A;  1BCP D;  4YHH L;  1O7Y A;  2F0V A;  5EKI A;  1F77 A;  5F2D A;  3PO3 B;  2Z8L A;  3AQQ A;  4MHE A;  3BZK A;  4A3B H;  1SFO B;  4WJ3 M;  1S5E D;  1PH5 A;  1Y1W B;  1PH6 A;  1LLR D;  5IT9 c;  2ZXO A;  1EEI D;  1L0Y B;  1TWA H;  5JJI A;  2HIX A;  1AH9 A;  2F0T A;  1EY8 A;  1KC8 C;  2CCZ A;  1PH8 A;  5KNC A;  4JI5 Q;  2QDL A;  5C4H A;  2NN6 H;  2I5M X;  3Q24 A;  2EVB A;  5C5M A;  3HOV B;  1CM9 A;  2A68 C;  4N8X 1;  1T5E A;  5LMN W;  5JVG 3;  1ILP A;  4XIG S;  2VQE Q;  2A6E D;  2AHO B;  3HOW B;  4AYB G;  1JMC A;  4KMU C;  1HCZ A;  4MN3 A;  3G48 A;  3M7N A;  1C4Q A;  1G51 A;  3CME A;  2CQA A;  2F0W A;  2PI2 E;  4A93 B;  2FFK B;  1BNZ A;  2A73 B;  3V05 A;  3PCO B;  4RKB A;  2NTT A;  1PH7 A;  3Q0A A;  2RA4 A;  2E2J B;  4BBS H;  1II3 A;  1MBY A;  2Q8I B;  3RZO H;  2EY1 A;  3G6J B;  1X6O A;  2R7Z B;  1XMO L;  3FKI G;  1HNW Q;  5EPJ A;  1HA6 A;  3RZD B;  1N32 L;  1F9R A;  2QIL A;  2F0L A;  4HJ8 A;  1HH2 P;  2V4D A;  1DOK A;  1U4M A;  1V43 A;  1LTS D;  3NE5 B;  5C4J H;  1H9R A;  1U0L A;  3NBH A;  1FGU A;  2BDO A;  5I9O A;  2A6E C;  1N36 L;  1WYD A;  3L9A X;  5IT9 E;  4B3R Q;  3ITP A;  1IBL L;  2UXB L;  1EWI A;  1STG A;  5IWA L;  3BS1 A;  2EJM A;  3K6O A;  4K8J A;  3I4M B;  1SXT A;  4RCO A;  1MJC A;  2AQ1 B;  2DY7 A;  3AB9 A;  4DV4 L;  3H94 A;  1VQO A;  1I50 B;  1I6H B;  4ALP A;  3UDF A;  1NUC A;  4UDU C;  3KUP A;  4DUZ L;  2A74 C;  1E7Z A;  2WIN B;  4UP9 A;  2JP1 A;  3L2P A;  4MTK A;  4P74 A;  4G7H C;  4OWT B;  3MXG A;  1STY A;  3NK9 A;  1STH A;  2EYP A;  3AU7 A;  4XT1 B;  3H15 A;  2LXJ A;  5IP7 G;  1OXT A;  4RGM A;  5FO8 B;  4DV1 Q;  4A3G B;  2F0M A;  5FLM H;  4FDB A;  4LFA L;  3BZD B;  4JI2 Q;  1IKM A;  3CC7 A;  1N8R C;  1ICF B;  4QUC A;  1XYI A;  4CJ1 B;  1PFB A;  1V9P A;  4C3J B;  1HNZ Q;  1I94 Q;  4FXG C;  2B2Y A;  4DGZ A;  5HGT A;  2D0O A;  5IOC A;  1JOR A;  2P5Z X;  5M3M H;  4JYA L;  5JOB A;  3C2P A;  3WOE A;  1GUN A;  1JWS D;  1HUN A;  1STA A;  1TWG H;  1G2T A;  3S16 B;  4KHV A;  4BS9 A;  2KQ3 A;  5E3F A;  1IL2 A;  4DR6 Q;  3GTO H;  3KBG A;  4LF6 Q;  2MJ8 A;  4R4I A;  2IHE A;  2A19 A;  1QNK A;  2JN4 A;  4IUN A;  4A3M B;  2A1A A;  2NVT B;  1LAB A;  1TVX A;  2IT1 A;  2RSN A;  2WB1 E;  3QWN A;  1YHQ A;  3ZJY C;  1N33 L;  5CV7 A;  2CQO A;  2Z4I A;  2YV5 A;  1LTA D;  4H02 A;  4GKJ L;  1VQN A;  2F0U A;  2UUC Q;  1EIF A;  2KA7 A;  4EX5 A;  4BXX G;  1Q81 C;  1L0X B;  1PFS A;  3WOF A;  3KOJ A;  1GJX A;  4KJN A;  1K0S A;  1TS2 A;  1AEX A;  4K0K Q;  3RLF A;  3QG1 A;  1TII D;  5HY6 A;  1U4R A;  2VZA A;  4U68 A;  2BA1 A;  2HCI A;  4ME3 A;  4IFD H;  1WTX A;  2HUG A;  3T16 A;  4QIW B;  4EQO A;  1X56 A;  1RCV D;  4R4C A;  3NTI A;  4OON A;  2K33 A;  2NN6 G;  3DEP A;  1HNX L;  2ID0 A;  4JOI A;  1PH4 A;  1EQV A;  3MHB A;  4LFC L;  2LFN A;  3T1Y Q;  2E2H H;  2KOL A;  2ZT9 C;  4GN4 B;  3E5S A;  1HZB A;  1UE7 A;  4UP7 A;  2F0O A;  2OCE A;  1UE6 A;  2M2L A;  4DK0 A;  4A76 A;  5DEH A;  4LF4 Q;  1MIU A;  1YNN D;  4DUY L;  2G5D A;  4P71 A;  3S2D H;  5A2Q E;  1VQH A;  2K5H A;  4ILW A;  2R61 A;  5LHY 1;  3FKI B;  2GVA A;  4CDC C;  5C6A A;  1WTH A;  4AQY L;  3OW2 A;  4BBS G;  2YTV A;  4PZ8 A;  5EPL A;  3K5N A;  2QKI C;  1JIC A;  2JSO A;  1O78 A;  4NMZ A;  3W1B A;  2R92 H;  4RGT A;  1A15 A;  3ER0 A;  2VNU D;  2PMZ E;  4L5Q A;  3K5L A;  2G9H D;  1X9N A;  1PA6 A;  1QVG A;  3HG9 A;  3ERQ A;  4B3T Q;  4DV6 L;  4O1N A;  2JA8 H;  1CQF A;  1HRJ A;  1CHP D;  2DUD A;  5EKL A;  3S1R B;  5KGU A;  3QJY A;  2EZV A;  4LF8 Q;  3BDL A;  5GAD C;  1G29 1;  1OTC A;  1HUM A;  4DF7 A;  4IPH A;  5AJ3 L;  4DR5 Q;  1H9S A;  4TKO B;  4JV5 Q;  1VQ8 A;  3F2C A;  2WAQ G;  3MAQ A;  1ROD A;  2CW0 D;  4F87 A;  1JB7 A;  2I07 B;  2VUM H;  1V8Q A;  1XTC D;  1EY6 A;  4PMW A;  4BBR H;  1D8L A;  2BE5 D;  2Z4H A;  4KD4 A;  3GV3 A;  5M5X B;  3NHH A;  5M5Y H;  1J5E Q;  4WOR A;  2EQS A;  3P1H A;  2L4N A;  4K2K A;  2F4I A;  3BDC A;  3M4Y A;  4GOP B;  4X62 Q;  1SDF A;  5FLM G;  1PTO F;  3F2D A;  2PQE A;  2JA7 B;  1XTD A;  2VS1 A;  5ELF A;  1NMG A;  3GDE A;  2K6A A;  1HTP A;  4NB3 A;  1A2U A;  1NBW A;  3K0X A;  2R7F A;  4DV2 L;  3SR1 A;  1PZI D;  1SYC A;  3N52 A;  3A8J E;  2CH4 W;  3FMC A;  3TRZ A;  2BE5 C;  3W1G A;  1IBM L;  1KLU D;  3E6Z X;  5M3M G;  1WCM H;  1P16 A;  3GO5 A;  3T53 B;  3GTL B;  3M4O H;  1A2T A;  1LT5 D;  1SND A;  4NXN Q;  3TZU A;  5IGC A;  1QUQ A;  2Q2U A;  1FL0 A;  3MEF A;  2F0H A;  2K4K A;  4ZUI A;  2IHF A;  4KN4 C;  1F9Q A;  1SE8 A;  2JA5 H;  3GV6 A;  1Y14 B;  1BCP B;  1R4P B;  4AIM A;  3HKZ G;  1G6P A;  2F3W A;  5JEA J;  3QB3 A;  1V1P A;  3HFZ B;  1ENF A;  4WJW A;  1EWC A;  4R8N A;  4YWM A;  4DFA A;  4JI0 L;  1G8Z D;  1L1O A;  5IY0 A;  2UXD L;  1D5X C;  1W6J A;  1UNS A;  3H0G H;  2A69 D;  3FHW A;  4IUQ A;  1LUZ A;  3ULJ A;  1ET6 A;  1VQL A;  1HFN A;  5C4X B;  3VR5 A;  3K81 C;  3KK7 A;  1N34 Q;  2NUC A;  3GTM H;  2XSC A;  4ULL A;  4LF5 Q;  4DK1 A;  4L5S A;  1QJO A;  4HR7 B;  2KCN A;  4C1N I;  4A3E H;  4K14 A;  4PNY A;  1LTG D;  4I7A A;  1EY0 A;  2A8V A;  1EWH A;  1VQ9 A;  4OL7 A;  4A4I A;  4DR3 L;  3D4R A;  4IFD G;  1VCI A;  2X6G A;  5CBE E;  2OQK A;  3AEV A;  1KXL A;  2O5J C;  3HOU H;  4R8I A;  2H4O A;  1I4H A;  1H9M A;  1E2Z A;  3F8T A;  2EOT A;  4XT3 B;  2R93 H;  4OX9 L;  3NWS A;  1A62 A;  1WI5 A;  3BDO A;  3AFQ A;  2KJX A;  3NXW A;  5C0X J;  4DXF A;  5D65 A;  1LO5 D;  2RKS A;  2OTL A;  4JI5 L;  5KIX A;  3VR4 A;  4HIK A;  4CBV A;  1PRT F;  3KJP A;  4EQP A;  1TXY A;  4IPC A;  3RZO B;  3PIP 3;  1PDQ A;  1TWC B;  2QEJ C;  3K80 C;  1U4P A;  2EY5 A;  3NQI A;  3OPO A;  1Q8I A;  1B9N A;  2VQE L;  1VQ5 A;  1LM0 A;  1S3O A;  1Y1V H;  3M4P A;  5GAG C;  2CFM A;  5JJL A;  3RN2 A;  4XXE A;  4QUF A;  3RD4 A;  2ZJP A;  3UI2 A;  3S1Q B;  4NPS A;  2JA8 G;  2HQE A;  2AKW B;  2B3G A;  2AQ3 B;  2KCM A;  3BVM A;  3S1N H;  2JXM B;  2X69 A;  3GD7 A;  4PQX A;  2K1B A;  3TBI B;  1QVF A;  2Z6K C;  4L6T B;  2Z1C A;  4IZ8 A;  2UUA L;  4TQU S;  4CDE C;  3HRZ C;  1Q82 C;  5C44 B;  2K04 A;  3KF6 B;  4E6I A;  3RN5 A;  2DGY A;  4X65 L;  2BA0 A;  4GZY C;  2KHS A;  2NVX H;  4OIJ A;  2VUM G;  5I2Y A;  2E75 C;  1GUG A;  3F1Z A;  5GAE C;  4X6A H;  1TWF H;  4B3R L;  3K59 A;  3M9B A;  3HOX H;  5I9P A;  1EL0 A;  3J80 L;  2QGQ A;  4K8I A;  5IYB G;  4X3S A;  2D9U A;  2NVY H;  3CC2 A;  1WFQ A;  5CR3 A;  3DMU A;  4YY3 L;  2BH8 A;  2E8G A;  2VXW A;  2EYF A;  5FJ8 H;  4X64 Q;  1C48 A;  4NW2 A;  1VQE A;  2K5V A;  3M4Q A;  3P75 A;  3E3X A;  1X3E A;  2LSS A;  3KJO A;  5IGB A;  1H95 A;  3MXP A;  3S9W A;  1HQM C;  5M3M B;  1DOL A;  4IOA A;  1ONL A;  2I5L X;  3KDF A;  3NTH A;  2RQX A;  3CKI B;  3LWU A;  3CMA A;  3T1H Q;  4CHT B;  2EIF A;  4Y52 H;  1GUW A;  4A3D H;  4JI2 L;  4J1M A;  5KYL A;  4JI6 Q;  2KHJ A;  2E2D C;  1WCM G;  3MTS A;  1M4V A;  2PCF B;  3HKZ B;  4HID A;  1Y69 U;  3OMG A;  3K7U C;  1HJP A;  2K28 A;  1DD2 A;  1I94 L;  4C3H B;  3RMH A;  1QZG A;  4H7B A;  2QA4 A;  4QIW E;  4DV0 L;  2GVB A;  5K36 H;  4UHV A;  1H9K A;  1TWH H;  4DR7 Q;  2N3S A;  1Y8P B;  4IAL A;  2N55 A;  1ENA A;  2Z6K A;  1NSN S;  2IJ0 A;  3PUW A;  1WTQ A;  1C0A A;  1AW7 A;  1KDA A;  1PH3 A;  2F0J A;  3KLR A;  4DR2 L;  3B6Y A;  3H0G G;  2SNS A;  3EQL C;  3CCS A;  2PO4 A;  3KYH C;  5JAV A;  1LT4 D;  3N6R A;  3UE1 A;  2Z6B A;  4IFD I;  3MXN A;  1FJG Q;  3L7Z C;  3U4V A;  1VMP A;  4X66 Q;  4JI3 L;  1HR0 Q;  2C35 B;  4FNF A;  3L0O A;  1F2M A;  3GTK H;  1SRO A;  4HJ5 A;  4GOP C;  4Q0F A;  3HEJ A;  5ELC A;  3DWP A;  1K3B C;  2ZJR A;  2K75 A;  2L1B A;  2UU9 Q;  4PV1 C;  1YHB A;  1E0B A;  1BBU A;  3HOU G;  3D4D A;  1IW7 D;  3CAM A;  2WV6 D;  4R9W A;  2R93 G;  1E1O A;  1PYS B;  4BY1 G;  5DM6 3;  2B2T C;  3J7Z C;  2QEX A;  4HIO A;  5CV9 A;  3CF5 A;  1NCV A;  1MD2 D;  1SJE D;  4P2C B;  3ERO A;  5JPN C;  1XXG A;  5EBC A;  3A7L A;  3OIP A;  5I2X A;  1WTW A;  2F52 A;  3OTO L;  5COR A;  4F7X A;  1XWE A;  3IKJ A;  3JAM L;  3R93 A;  2FJ2 A;  4B3M Q;  1GUT A;  2YU9 H;  1CSP A;  4CKC A;  4DA2 A;  4A3I G;  1X3F A;  2JA8 B;  1BCP C;  4QL5 A;  1SNP A;  1PFM A;  5BR8 Q;  1Y1V G;  1UE1 A;  1RD9 D;  4LUV A;  1EQR A;  3ULL A;  4R1J A;  1IW7 C;  4XTC S;  3M3Y B;  1ASZ A;  2RCF A;  4GS3 A;  3J81 E;  3NQT A;  3HS0 C;  1YEZ A;  4JI1 L;  2ZTE A;  3K8A A;  3DUZ A;  3VA5 A;  3SDZ A;  2VUM B;  1BVS A;  3FVQ A;  4OWX B;  1B70 B;  3PIO 3;  2L0C A;  1XNR L;  3NBI A;  1PVO A;  1TS5 A;  5M5Y B;  3DWQ A;  2EY2 A;  3V96 A;  4APV A;  5E4X A;  1B3Q A;  3KLS A;  4LF8 L;  1LTL A;  5LMN Q;  3J7A V;  2RHQ B;  1LV9 A;  5IYC H;  1GD7 A;  3A8K E;  4DR5 L;  2PI2 A;  3HOX G;  1RF2 D;  1P8L A;  1B7Y B;  1VQC A;  4JV5 L;  5DM7 3;  4JI7 L;  2XIW A;  3KF8 B;  1L0W A;  2CHB D;  4JI4 Q;  2H1E A;  4DV7 L;  4NXM Q;  2KED A;  3F2B A;  3A55 A;  1ESR A;  4KHP Q;  2B2T A;  3S15 H;  1HZC A;  2DN8 A;  2F0G A;  1XMQ Q;  5C3E H;  1DYQ A;  3Q6S A;  1K83 B;  2NYZ D;  1X3P A;  3HOY B;  1HZA A;  1WCM B;  1C7Y A;  3AFP A;  1KIX A;  3M4O B;  4X62 L;  1KDB A;  3UDG A;  3KFU A;  2F4V Q;  5FK9 C;  2UXC L;  2MPM A;  3CXC A;  5ELB A;  2I46 A;  1JOK A;  3OMC A;  4LJZ C;  3RLN A;  4LUO A;  1SYE A;  2RHS B;  4OWW B;  4S3S A;  3VDY A;  4G4K A;  5K36 G;  1I3Q H;  3MFG A;  2PW5 A;  2D0P A;  2F0E A;  1QZH A;  5IYD H;  3MEH A;  4HSP A;  1XPO A;  3S1M H;  3GTP H;  2B63 B;  4YCV A;  2IX1 A;  1AN8 A;  2CVR A;  4DAY B;  2QDB A;  2HHH L;  4A3J B;  2JQO A;  2F1M A;  1GHJ A;  1CKO A;  4X3U A;  5J39 A;  1A8V A;  2K5D A;  3CW2 C;  1X54 A;  3T13 A;  1VQP A;  1JT8 A;  1EY4 A;  2B8G A;  1SBB B;  5M3F H;  2L15 A;  3MVV A;  2IY5 B;  2F3V A;  1EYG A;  4DAP A;  3U4Z A;  5M9O A;  2KVM A;  4RKL A;  1KD1 C;  5EKK A;  2Q8R E;  1I4G A;  3TZD A;  4MNO A;  1AFP A;  4DR1 Q;  3OIQ A;  3HOU B;  4ZKB B;  2PQA B;  4GNX B;  2GA4 B;  2NB0 A;  1CKN A;  5L37 A;  2AQ2 B;  2PZT A;  5IE8 A;  2SNM A;  5FLX L;  5KEE A;  4BY1 B;  4HAE A;  1VQB A;  4HED A;  2MFI A;  3MFY A;  4DXG A;  4A3F H;  3GTG H;  1R4Q B;  3P7J A;  2JEB I;  4LF5 L;  2NZH A;  1Y8N B;  1FNV A;  4MIU A;  3CPW A;  3I4N H;  4DV5 L;  3DM1 A;  5E7N A;  4B9X A;  4A3B G;  4UPA A;  4DU9 A;  4M1U B;  1EU4 A;  1I4X A;  1CI3 M;  1I6V C;  3U9S A;  4DR4 Q;  3BYY B;  5E4W C;  3CCR A;  2J0T D;  3W3A A;  4G57 A;  4A3I B;  4DV3 Q;  4YCW A;  1I5F A;  4YHH Q;  4I65 A;  1BR9 A;  1Y1V B;  1SJH D;  4A3L H;  3A74 A;  1CZG A;  4AYB B;  4FYD A;  4OIK A;  4JBM A;  2B2V C;  3NSW A;  1QIL A;  2B2U C;  2NWG A;  2H5X A;  4C1N K;  4RHR A;  1IXR A;  3J80 i;  2VQF L;  1U4L A;  3BJU A;  1J6Q A;  4KK7 A;  1G91 A;  3LGJ A;  5IGF A;  1D5M C;  4ZAI A;  3JC6 6;  2NZ1 D;  3I90 A;  2IPK D;  1YBY A;  2BCO A;  2VB3 X;  1LTR D;  1VQG A;  1EEF D;  4GN3 B;  1EY7 A;  1GOZ A;  1K0R A;  1PXU A;  5DLQ E;  5C0X I;  3I55 A;  1I4R A;  4ME5 A;  2XN9 C;  2EPB A;  1PTO H;  3OOC A;  1QCB D;  3DM3 A;  1OXV A;  2AUJ D;  2NBF A;  3E9I A;  3H09 A;  4RFB A;  3OYY A;  4LF9 Q;  4AH6 A;  1Y1W H;  3O13 A;  3S14 H;  4RMF A;  1MSG A;  4CDD C;  4POF A;  5T1I A;  1HFG A;  3HKZ E;  1SAP A;  2QCP X;  5KYI A;  2YTY A;  5IYC G;  4Q5V A;  3TP7 A;  3RNU A;  1B44 D;  1YNN C;  4FP5 D;  1SYG A;  1S72 A;  5GQO A;  1FD7 D;  4QY7 A;  1YVC A;  2L9H A;  1JE4 A;  2ZXR A;  1XMO Q;  3H3V C;  3CPF A;  2HQL A;  1WJJ A;  3D0F A;  1O7Z A;  3CCQ A;  3I56 A;  2EXD A;  2HDM A;  1GUO A;  3HOW H;  5JPM C;  2O4X A;  2E5L L;  2JA6 H;  4IOC A;  1PMR A;  1N36 Q;  1A3T A;  3D4W A;  4UP8 A;  5C4Z A;  2UXB Q;  3SK4 A;  1IYU A;  3FPP A;  5IWA Q;  2F0N A;  2E2J H;  1KNA A;  1EFW A;  2EYO A;  3T51 B;  2BOS A;  4UAI A;  3GTJ B;  4DV4 Q;  3CU7 A;  1TWH B;  2MNA A;  2R7Z H;  3TEH B;  1DCZ A;  3QIA A;  1UAP A;  1SN8 A;  4ZRZ A;  3NUC A;  4H0L C;  1B4O A;  4ZLT F;  1EY5 A;  2VB2 X;  1D6E C;  2CW0 C;  2N88 A;  1KLG D;  3W5O A;  1A63 A;  3A5U A;  1QVC A;  5J3B A;  5NUC A;  3SHL A;  4HJ9 A;  5JJK A;  4X3K A;  1GXD C;  2ZM6 L;  2UUB L;  4OXP A;  2B2W C;  3VYR A;  4A3K H;  3I4M H;  5IGD A;  1HA5 A;  1BQQ T;  2DY8 A;  2K7V A;  2O2L D;  3C46 A;  1A3V A;  1I6H H;  1LTT D;  1I50 H;  1MGS A;  1K9M C;  4DR7 L;  3CQZ B;  3S24 A;  5M3F G;  5ELN A;  2HD3 A;  3R3O A;  3I7F A;  2XGT A;  1I4P A;  2KCT A;  1TY2 A;  4A3C H;  4KJO A;  2PNH A;  2AWN A;  4RH6 A;  4LFB L;  3TQY A;  1JJC B;  3JAM i;  4OO1 H;  1KAW A;  2YTX A;  3MA2 B;  2J7Z A;  1PRT D;  1SMX A;  3IFT A;  4LF7 Q;  4A3B B;  4KN7 C;  5FOB B;  2J4X A;  4KY7 A;  2EJG C;  4A3G H;  1SYF A;  4KV6 A;  2RSO A;  4HN7 A;  4FXK C;  3MZ5 A;  1PH1 A;  3I4N G;  4L5R C;  1QG7 A;  1VQI A;  2RDH A;  1CTM A;  1TWA B;  3BU2 A;  1JR0 D;  3EJI A;  4HMJ A;  3PMF A;  4PZ7 A;  1HR0 L;  2Q2T A;  2XRS D;  2ENB A;  2F0F A;  4Y7N H;  1QB5 D;  1DZ1 A;  2N78 A;  3QOJ A;  4C3J H;  1PZK D;  4U67 3;  1N33 Q;  2PYK A;  1YI2 A;  2PW7 A;  3PUZ A;  3RLO A;  2UU9 L;  5M5W H;  3CHB D;  4QB4 A;  1Q3L A;  5AFW A;  4ZQ3 A;  1ZYR D;  2DNC A;  3DEO A;  1DON A;  4GKJ Q;  2KEN A;  1EZ6 A;  3KBX A;  5G3L F;  1G6Z A;  4A3L G;  2LMC B;  4JG2 A;  4B3S Q;  3PGZ A;  3S16 H;  3FRP B;  3NEM A;  1UEA B;  1Q8K A;  4RGO S;  1E2V A;  3L3O C;  2Q8T A;  1JJ2 A;  2A69 C;  1Q46 A;  4A3M H;  3J80 c;  5KRU A;  5JJZ A;  4DN4 M;  1XX8 A;  4BBS B;  5JEA H;  5K5P A;  4PMB A;  4DK3 C;  5J22 A;  3PF5 A;  4BWG B;  2ZJQ A;  2ALY B;  3PSI A;  4J6H A;  1WTV A;  2R6G A;  1UUP A;  1RDP D;  2OQ0 A;  1YJ9 A;  1VQM A;  3K7A H;  3D8G A;  3PIP A;  2EY6 A;  2R92 G;  3K57 A;  5C4J B;  3BVG A;  1B8A A;  1MI2 A;  5EBD A;  1X3G A;  2AUK A;  4GNX C;  2AMC B;  3S17 H;  5I4D A;  3TS2 A;  5EQ0 A;  3T4A C;  4DUY Q;  1ZEQ X;  3KF8 A;  5CMD A;  4XQQ A;  1QOH A;  2WAQ B;  1W2B A;  1D2B A;  1EOV A;  1YZ6 A;  2RDG A;  1IKL A;  4OGQ C;  1FNU A;  4AQY Q;  1KL9 A;  1VQD A;  3Q8D A;  3S15 B;  3NWT A;  1SMY D;  1HNW L;  3CC4 A;  4KI0 A;  1Z47 A;  3HKS A;  1XPR A;  3I4L A;  1WD1 A;  2K5Q A;  2M9V A;  3UDI A;  4K5W A;  2ZTC A;  1LTI D;  5C0X H;  4DV6 Q;  4JC0 A;  4BBR G;  1FNW A;  1EIG A;  1B50 A;  4BY7 H;  2JA6 G;  1CA5 A;  2O5I C;  1JWM D;  4LMQ D;  2F3I A;  3ZYY X;  2NZO A;  4WRD A;  3QOL A;  1R9T H;  2SEB D;  1YNJ D;  1F9S A;  1PFN A;  1QWY A;  4IUR A;  1TS3 A;  1CA6 A;  2KEE A;  3TS0 A;  2N49 A;  3PQI A;  1J8I A;  3RUZ A;  4HTH A;  3AMU A;  2EYJ A;  1VF5 C;  1D7Q A;  3GTP B;  3TP8 A;  4Z9C B;  1JOO A;  1J9O A;  2GN5 A;  3S1R H;  3RR5 A;  4DV1 L;  2F4V L;  1Z6H A;  2EXZ A;  1X55 A;  1TWG B;  4JK1 C;  3CCJ A;  2RBM A;  3T56 B;  4KKT A;  1WTO A;  1O7I A;  5GAH C;  1XNQ Q;  3GTO B;  1LYL A;  4ZK9 B;  4KHZ A;  1BKB A;  4A3K G;  2NVQ H;  1EIH A;  3CCL A;  1BUV T;  5KND A;  1E24 A;  1D1K A;  4DAM A;  1HNZ L;  4OEM B;  4QF4 A;  4HJA A;  4GNX A;  2E76 C;  2JA5 G;  3PV0 A;  4DV2 Q;  4RA8 A;  3D6W A;  3J7A 5;  4AYB E;  4QGU A;  3GTG B;  3JAM c;  4A3C G;  1V1O A;  5M5X H;  4O0A A;  1S5B D;  1SEB D;  4OO1 G;  1KAB A;  3I4N B;  4K6L A;  4MZ9 A;  4DNR B;  1IBM Q;  4DR6 L;  3TRE A;  3URY A;  5HUR A;  4LF6 L;  3C1E A;  1JE5 A;  3I70 A;  1JB3 A;  3BG3 A;  4C3I H;  2JA7 H;  2OT2 A;  4FXD A;  3OWE B;  2BDN A;  5IGE A;  1YJN A;  3GQB A;  1E1T A;  2K03 A;  3H6M A;  4OHJ A;  4A3E G;  4CDF C;  2IX0 A;  4JI0 Q;  4NP5 A;  2UUC L;  3CCU A;  2E2H B;  3D3R A;  4QMG A;  3LX0 A;  3FPU B;  1BOS A;  2X6L A;  2WP8 J;  3K5M A;  5CYU A;  3SXH A;  3GTL H;  4K0K L;  1RJT A;  4HSV A;  1RL2 A;  5BN3 A;  2MO1 A;  1M90 C;  2OF1 A;  4DR4 L;  3S2D B;  1QUQ B;  1B53 A;  4JI8 Q;  2A68 D;  1HHV A;  4RG1 A;  2JEA I;  1RIP A;  2MQH A;  2Q2I A;  2VL6 A;  1B3A A;  5JEA G;  2L12 A;  1EYC A;  4EVO A;  1VQ4 A;  4BXX H;  1V1P B;  2R7D A;  4BA1 I;  2R92 B;  1CFM A;  4DR3 Q;  1TQO A;  2IX3 A;  5JVH 3;  4UY8 C;  3MC0 B;  3JAM E;  1L1O B;  1PTO B;  3T1Y L;  2LS0 1;  5T1G A;  2DJF C;  1U5K A;  3H3V I;  1CHQ D;  1STB A;  4OX9 Q;  5C4X H;  3S14 B;  1K28 A;  1RTN A;  4LF4 L;  1SE3 A;  4N8F A;  5CV5 A;  1YNX A;  1NJI C;  4L8J A;  3TDQ A;  1C9O A;  3E0E A;  1B9M A;  1BO0 A;  2VY3 A;  2CWA A;  4TVA B;  3NP8 A;  3G71 A;  3CD6 A;  1GUS A;  1UEB A;  3VYT A;  1VQ6 A;  2K52 A;  1F2L A;  1A3U A;  3W2D A;  4PG3 A;  3I2Z A;  4IUT A;  4KKU A;  2ES2 A;  5ELE A;  5IOD A;  4BBR B;  4P75 A;  3M7G A;  2WFW A;  4B3T L;  1EFI D;  4LF9 L;  1LTB D;  2Q2H A;  1NY4 A;  3R2I A;  1LT3 D;  2JA6 B;  1VQF A;  4J8Q A;  2IWH A;  5IP9 H;  3HOZ H;  2B2Y C;  1BCP F;  1N9W A;  4YWL A;  5C0X G;  3J81 j;  1PH9 A;  1GO3 E;  3J81 L;  2E2I H;  3GTQ H;  3PIO A;  3VR6 A;  5COY A;  1BBX C;  4GOP A;  3P20 A;  2L11 A;  1FR3 A;  4BY7 G;  1GM5 A;  1SNC A;  1KDC A;  2K50 A;  4IPG A;  2JJQ A;  1PHJ A;  1TWC H;  3HP3 A;  2UUA Q;  2MUY A;  1W6K A;  2Y0S G;  1ML0 D;  5EJW A;  5FJ8 G;  1WOC A;  1A0I A;  1IBK Q;  4IJH A;  4X65 Q;  1WD0 A;  3IFD A;  1ZXT A;  1TY0 A;  2YYZ A;  1J5E L;  5FLX c;  3MXU A;  5IT9 L;  4A75 A;  4O42 A;  2QF7 A;  2L55 A;  3ONA B;  3S1Q H;  1S4Z A;  1IZ6 A;  1NR4 A;  4A3K B;  4ZCK A;  3U9O A;  1SRU A;  2F0D A;  5I6Y A;  4DK6 C;  2WII B;  3K58 A;  4A3D G;  3K5O A;  4YY3 Q;  4V19 0;  1CKM A;  3FEW X;  4O2D A;  3V2T A;  1Q86 C;  3A54 A;  2JA5 B;  1Z7T A;  4IQZ A;  1CZW A;  1EQT A;  2ATW A;  3A7A B;  5C44 H;  1VQK A;  1ESF A;  2C9O A;  2D2C C;  4OO1 I;  1KTK A;  4DAV A;  4JBK A;  1B1Z A;  2RF4 A;  5LMU Q;  1PRT B;  5BN4 A;  4RCN A;  3U50 C;  1VQA A;  4YCU A;  1SNM A;  3H0G B;  3BZC A; 
#chains in the Genus database with same CATH homology
 4K6D A;  4F88 A;  5EPK A;  3GTM B;  1EZ8 A;  4ZKC B;  1AZQ A;  1WTR A;  2D5D A;  1HQR D;  4Y7N B;  4LK1 C;  5TSS A;  3EFX D;  3NTK A;  4A3E B;  2NTS A;  1K8M A;  4C3I G;  5M5W B;  1OXS C;  4IFD J;  1F2Y A;  4X3T A;  1BXT A;  1X32 A;  4RGN A;  1DJR D;  1JWU D;  5FLX E;  5CV6 A;  3DHQ A;  2R93 B;  1SYB A;  3CRK C;  2ICI A;  1SSO A;  5I6W A;  5D3D A;  2WAC A;  3X3N A;  4RAU C;  5CGK A;  1CT1 D;  4JBW A;  4B08 A;  3TN2 A;  3BVZ A;  1OXX K;  3I72 A;  1PLF A;  3K7A B;  5KNB A;  2B8F A;  2A6H D;  2LY7 A;  3F2U A;  3I8Z A;  1VMC A;  1ENC A;  3HZX A;  2K05 A;  2R3Z A;  4KY5 A;  2A5H A;  3I3C A;  4ABN A;  3S17 B;  3SK5 A;  1GHK A;  2FIN B;  4CGY B;  4C56 C;  3S1N B;  3SE0 A;  1TS4 A;  1OO9 B;  1RHP A;  1RTO A;  1S5C D;  4TSS A;  1O7L A;  1K8O A;  4KD3 A;  5FO7 B;  1PYW D;  2F0I A;  2NVX B;  4ZYS A;  5CC4 A;  5DAU A;  1TWF B;  2A6H C;  1PTO D;  3QO2 A;  3HOX B;  4BY7 B;  1S5F D;  1DXM A;  5A2Q L;  1WTP A;  1Q90 A;  2NVY B;  4KY6 A;  3VA7 A;  1R9T B;  1EYD A;  2F0Q A;  3SVM A;  2HCC A;  2Y0S B;  1JCK B;  1LT6 D;  1Y8O B;  3PUY A;  4N9P A;  3CRL C;  1CK1 A;  1BF4 A;  3Q22 A;  4IUV A;  1D5Z C;  4IN3 A;  1CQV A;  3VYU A;  4CJ0 B;  5C5L A;  1SNQ A;  2M00 A;  5BN5 A;  4YIJ A;  4WFN 3;  2ZXP A;  1E2W A;  1OXU A;  1SE4 A;  3E0J A;  3PUV A;  1U9R A;  5ISR A;  4A3D B;  5C3X A;  2KEC A;  3H91 A;  4XYO A;  1PTO C;  2NVQ B;  2MGS A;  1RKN A;  3C3L A;  1EY9 A;  1ILQ A;  2B2V A;  4B9W A;  2B2U A;  1TKW B;  3X3M A;  4RHS A;  2PZU A;  1X3Q A;  4K2L A;  3G7L A;  1ICW A;  2EDG A;  3SK8 A;  4H13 C;  4RWS C;  1O80 A;  3Q23 A;  2FHT A;  2RDF A;  5EGT A;  4V0B A;  1IYV A;  1HPC A;  3IL8 A;  2MP1 A;  4C3I B;  2F03 A;  1EYA A;  1A6X A;  1SNO A;  3EVQ A;  5G3L D;  5D14 A;  5IIF A;  3TP6 A;  4ODG A;  1JQY D;  3PUX A;  1Q1B A;  3GTK B;  2EJF C;  1EOT A;  5E1F A;  1WVL A;  3NPP A;  1JOQ A;  3D6C A;  1M8A A;  3I73 A;  3D31 A;  4HMI A;  1FYC A;  3I91 A;  4FO2 A;  5DNF A;  3MWY W;  1Q1E A;  2MHV A;  1SE2 A;  4ZUJ A;  4IUP A;  4C3H G;  4EGV A;  4KTA A;  4FF1 A;  2RVL A;  2LKV A;  2TMP A;  3WDN A;  4CJ2 C;  2YU9 B;  4NKL A;  3A56 A;  4HCS A;  1HXY D;  3HGB A;  2FMC A;  3LWE A;  1AP0 A;  1DM0 B;  1DOM A;  1HTL D;  5J1Z A;  5CV8 A;  3OHX C;  1PRT C;  2K01 A;  2NN6 I;  1SYD A;  3VR2 A;  4K5X A;  5FKA C;  2IW3 A;  4QCL A;  1KNE A;  4XQJ A;  2F0P A;  2K32 A;  2DNE A;  4BA2 I;  2B2W A;  3DXJ C;  4M8A A;  4PMC A;  2EYL A;  3R2T A;  3KLS X;  4H44 C;  4F8M A;  3J7A F;  5CV4 A;  3HOZ B;  1MSH A;  3GTQ B;  2E2I B;  1ZYR C;  1NR2 A;  3A8I E;  1KAA A;  1PZJ D;  1BDO A;  2K5W A;  2SDF A;  2PNR C;  5A35 A;  4XYQ A;  1STN A;  2KCC A;  2JE6 I;  3M85 A;  1QNU A;  1F9P A;  2PZW A;  1H9J A;  4LAA A;  2EE1 A;  2L5T A;  2WB1 B;  3BYT B;  1D1I A;  2IL8 A;  3FDT A;  3OWF A;  1S5D D;  3IAY A;  5C3E B;  5D3I B;  3DWA A;  5C3W A;  1EU3 A;  3SK6 A;  1TU2 B;  2EYM A;  4IUU A;  2ICE C;  3R8B A;  3ND8 A;  4TRD A;  4EQN A;  3J80 E;  2SOB A;  4XDX A;  1I4Q A;  2WKC A;  2B39 A;  2EYH A;  4G7Z C;  1IL8 A;  4I7Z C;  1I3Q B;  2JYO A;  4FF4 A;  5LL6 S;  5CBA E;  1SMY C;  2D62 A;  4L63 B;  3TP5 A;  1C8C A;  3S1M B;  5ELD A;  4DAY A;  1F2Z A;  2PPB C;  4K5V A;  4FF2 A;  4G7O C;  3VYS A;  2C5C A;  4ID6 A;  2E74 C;  4CKB A;  1ZKO A;  2FMM A;  5M3F B;  3J7Y W;  4HCE A;  1H9S B;  1TR5 A;  2WKD A;  1ET9 A;  2G9D A;  5IGG A;  1YNJ C;  2XWJ B;  3K0Y A;  2XRQ D;  2PMZ B;  2KUM A;  4KKS A;  5FO9 B;  2XNA C;  1B2T A;  3EA6 A;  3GP7 A;  4NDX A;  4C2M B;  2HDL A;  4A3F B;  2XVS A;  4DNT B;  2F0S A;  1JC7 A;  3SEB A;  3C1F A;  4N9T A;  1FGB D;  3OW7 A;  3PO2 B;  3VR3 A;  1QE6 A;  3TSS A;  2OXP A;  5LL6 X;  4C3J G;  2XWB B;  1VDZ A;  1AZP A;  4FVM A;  2TSS A;  1Q12 A;  1NAP A;  3LNN A;  3S2H B;  1IHZ A;  1G2S A;  1T5X D;  4FF3 A;  3TME A;  1STE A;  2AWO A;  4CKE A;  3OSO A;  2OEO A;  1TT2 A;  1VF7 A;  1LAC A;  3ND9 A;  4XQN A;  2F0K A;  1BCP D;  1O7Y A;  2F0V A;  5EKI A;  1F77 A;  5F2D A;  3PO3 B;  2Z8L A;  4MHE A;  1SFO B;  1S5E D;  1Y1W B;  1LLR D;  2ZXO A;  1EEI D;  1L0Y B;  2F0T A;  1EY8 A;  5KNC A;  5C4H A;  2NN6 H;  3Q24 A;  2EVB A;  5C5M A;  3HOV B;  1CM9 A;  2A68 C;  1T5E A;  5JVG 3;  1ILP A;  4XIG S;  2A6E D;  3HOW B;  4KMU C;  1HCZ A;  4MN3 A;  3M7N A;  1C4Q A;  2CQA A;  2F0W A;  4A93 B;  2FFK B;  1BNZ A;  2A73 B;  3V05 A;  4RKB A;  2NTT A;  3Q0A A;  2RA4 A;  2E2J B;  1II3 A;  1MBY A;  2Q8I B;  2EY1 A;  3G6J B;  2R7Z B;  5EPJ A;  1HA6 A;  3RZD B;  1F9R A;  2QIL A;  2F0L A;  2V4D A;  1DOK A;  1U4M A;  1V43 A;  1LTS D;  3NE5 B;  1H9R A;  3NBH A;  5I9O A;  2BDO A;  2A6E C;  3L9A X;  5IT9 E;  3ITP A;  1STG A;  3BS1 A;  2EJM A;  3K6O A;  4K8J A;  3I4M B;  1SXT A;  4RCO A;  2AQ1 B;  2DY7 A;  3AB9 A;  1I6H B;  3H94 A;  1I50 B;  1NUC A;  4UDU C;  3KUP A;  2A74 C;  2WIN B;  2JP1 A;  4G7H C;  3MXG A;  1STY A;  3NK9 A;  1STH A;  2EYP A;  3AU7 A;  4XT1 B;  1OXT A;  4RGM A;  5FO8 B;  4A3G B;  2F0M A;  3BZD B;  1IKM A;  4QUC A;  1XYI A;  4CJ1 B;  1PFB A;  4C3J B;  4FXG C;  2B2Y A;  4DGZ A;  5HGT A;  5IOC A;  1JOR A;  5JOB A;  3C2P A;  3WOE A;  1GUN A;  1JWS D;  1HUN A;  1STA A;  1G2T A;  3S16 B;  4KHV A;  4BS9 A;  2KQ3 A;  5E3F A;  3KBG A;  2MJ8 A;  4IUN A;  1QNK A;  4A3M B;  2NVT B;  1LAB A;  1TVX A;  2IT1 A;  2RSN A;  3QWN A;  5CV7 A;  2Z4I A;  1LTA D;  2F0U A;  2KA7 A;  1L0X B;  3WOF A;  1GJX A;  4KJN A;  1TS2 A;  1AEX A;  3RLF A;  3QG1 A;  1TII D;  1U4R A;  4U68 A;  2BA1 A;  2HCI A;  4IFD H;  1WTX A;  2HUG A;  3T16 A;  4QIW B;  4EQO A;  1RCV D;  3NTI A;  2K33 A;  2NN6 G;  3DEP A;  2ID0 A;  1EQV A;  3MHB A;  2LFN A;  2KOL A;  2ZT9 C;  3E5S A;  2F0O A;  2M2L A;  4DK0 A;  5DEH A;  1YNN D;  5A2Q E;  4ILW A;  2R61 A;  5LHY 1;  3FKI B;  5C6A A;  5EPL A;  3K5N A;  2QKI C;  1JIC A;  2JSO A;  1O78 A;  4NMZ A;  4RGT A;  1A15 A;  2VNU D;  3K5L A;  2G9H D;  3HG9 A;  3ERQ A;  4O1N A;  1CQF A;  1HRJ A;  1CHP D;  5EKL A;  3S1R B;  5KGU A;  3QJY A;  2EZV A;  3BDL A;  1G29 1;  1HUM A;  4DF7 A;  1H9S A;  4TKO B;  3MAQ A;  1ROD A;  2CW0 D;  4F87 A;  2I07 B;  1V8Q A;  1XTC D;  1EY6 A;  4PMW A;  2BE5 D;  2Z4H A;  4KD4 A;  3GV3 A;  5M5X B;  3NHH A;  4WOR A;  3P1H A;  2L4N A;  4K2K A;  2F4I A;  3BDC A;  3M4Y A;  1SDF A;  1PTO F;  2PQE A;  2JA7 B;  5ELF A;  2K6A A;  1HTP A;  1A2U A;  3SR1 A;  1PZI D;  1SYC A;  3N52 A;  3A8J E;  3FMC A;  2BE5 C;  1KLU D;  3E6Z X;  3GO5 A;  3T53 B;  3GTL B;  1A2T A;  1LT5 D;  1SND A;  3TZU A;  5IGC A;  4ZUI A;  2F0H A;  4KN4 C;  1F9Q A;  3GV6 A;  1BCP B;  1R4P B;  2F3W A;  5JEA J;  3QB3 A;  1V1P A;  1ENF A;  4WJW A;  1EWC A;  4R8N A;  4DFA A;  1G8Z D;  1D5X C;  1W6J A;  1UNS A;  2A69 D;  4IUQ A;  1HFN A;  1ET6 A;  5C4X B;  3VR5 A;  3KK7 A;  2NUC A;  2XSC A;  4ULL A;  4DK1 A;  1QJO A;  4HR7 B;  2KCN A;  4C1N I;  4K14 A;  4PNY A;  1LTG D;  1EY0 A;  1EWH A;  4OL7 A;  3D4R A;  4IFD G;  1VCI A;  2X6G A;  5CBE E;  2O5J C;  4R8I A;  2H4O A;  1I4H A;  1H9M A;  1E2Z A;  2EOT A;  4XT3 B;  3NWS A;  3BDO A;  2KJX A;  3NXW A;  5C0X J;  4DXF A;  5D65 A;  1LO5 D;  2RKS A;  5KIX A;  3VR4 A;  4CBV A;  1PRT F;  4EQP A;  3RZO B;  3PIP 3;  1PDQ A;  1TWC B;  2QEJ C;  1U4P A;  2EY5 A;  3NQI A;  3OPO A;  1Q8I A;  1B9N A;  4XXE A;  4QUF A;  3RD4 A;  3UI2 A;  3S1Q B;  2HQE A;  2AQ3 B;  3BVM A;  2JXM B;  2X69 A;  3GD7 A;  4PQX A;  2K1B A;  3TBI B;  4L6T B;  2Z1C A;  4IZ8 A;  4TQU S;  3HRZ C;  5C44 B;  2K04 A;  4E6I A;  2BA0 A;  4GZY C;  2KHS A;  4OIJ A;  5I2Y A;  2E75 C;  1GUG A;  3K59 A;  5I9P A;  1EL0 A;  3J80 L;  4K8I A;  4X3S A;  2D9U A;  5CR3 A;  3DMU A;  2VXW A;  2EYF A;  1C48 A;  4NW2 A;  3P75 A;  5IGB A;  3MXP A;  3S9W A;  1HQM C;  5M3M B;  1DOL A;  1ONL A;  3NTH A;  2RQX A;  3CKI B;  3LWU A;  1GUW A;  4CHT B;  4J1M A;  5KYL A;  2E2D C;  3MTS A;  1M4V A;  2PCF B;  3HKZ B;  1Y69 U;  3OMG A;  2K28 A;  1DD2 A;  4C3H B;  3RMH A;  4H7B A;  5K36 H;  1H9K A;  1Y8P B;  4IAL A;  2N55 A;  1ENA A;  1NSN S;  2IJ0 A;  3PUW A;  1WTQ A;  1AW7 A;  1KDA A;  2F0J A;  3KLR A;  2SNS A;  3EQL C;  2PO4 A;  5JAV A;  1LT4 D;  3N6R A;  4IFD I;  3MXN A;  3L7Z C;  1VMP A;  4FNF A;  1F2M A;  4Q0F A;  3HEJ A;  5ELC A;  3DWP A;  2L1B A;  4PV1 C;  1E0B A;  3D4D A;  1IW7 D;  2WV6 D;  4R9W A;  5DM6 3;  2B2T C;  5CV9 A;  1NCV A;  1MD2 D;  1SJE D;  4P2C B;  3ERO A;  5JPN C;  1XXG A;  5EBC A;  3A7L A;  3OIP A;  5I2X A;  1WTW A;  5COR A;  4F7X A;  1XWE A;  3IKJ A;  3JAM L;  3R93 A;  2FJ2 A;  1GUT A;  4CKC A;  4DA2 A;  2JA8 B;  1BCP C;  1SNP A;  1PFM A;  1RD9 D;  1IW7 C;  4XTC S;  3M3Y B;  3J81 E;  3NQT A;  3HS0 C;  3DUZ A;  3VA5 A;  3SDZ A;  2VUM B;  3FVQ A;  3PIO 3;  2L0C A;  3NBI A;  1TS5 A;  5M5Y B;  3DWQ A;  2EY2 A;  3V96 A;  5E4X A;  3KLS A;  3J7A V;  1LV9 A;  3A8K E;  1RF2 D;  5DM7 3;  2XIW A;  2CHB D;  2H1E A;  2KED A;  3A55 A;  1ESR A;  2B2T A;  2DN8 A;  2F0G A;  1DYQ A;  3Q6S A;  1K83 B;  2NYZ D;  1X3P A;  3HOY B;  1WCM B;  3M4O B;  1KDB A;  5FK9 C;  2MPM A;  5ELB A;  2I46 A;  1JOK A;  3OMC A;  4LJZ C;  1SYE A;  4S3S A;  4G4K A;  5K36 G;  3MFG A;  2PW5 A;  2F0E A;  3MEH A;  4HSP A;  2B63 B;  2IX1 A;  1AN8 A;  2CVR A;  2QDB A;  4A3J B;  2F1M A;  1GHJ A;  4X3U A;  5J39 A;  2K5D A;  3T13 A;  1EY4 A;  2B8G A;  1SBB B;  3MVV A;  2F3V A;  4DAP A;  5M9O A;  2KVM A;  4RKL A;  5EKK A;  2Q8R E;  1I4G A;  3TZD A;  1AFP A;  3OIQ A;  3HOU B;  4ZKB B;  2GA4 B;  2NB0 A;  2AQ2 B;  2PZT A;  2SNM A;  5FLX L;  5KEE A;  4BY1 B;  4HAE A;  4HED A;  4DXG A;  3MFY A;  1R4Q B;  3P7J A;  2JEB I;  1Y8N B;  1FNV A;  4MIU A;  3DM1 A;  4B9X A;  4DU9 A;  4M1U B;  1EU4 A;  1I4X A;  1CI3 M;  1I6V C;  3U9S A;  3BYY B;  5E4W C;  2J0T D;  3W3A A;  4G57 A;  4A3I B;  4I65 A;  1BR9 A;  1Y1V B;  1SJH D;  1CZG A;  4AYB B;  4FYD A;  4OIK A;  2B2V C;  3NSW A;  1QIL A;  2B2U C;  2NWG A;  4C1N K;  4RHR A;  1U4L A;  4KK7 A;  1G91 A;  5IGF A;  1D5M C;  4ZAI A;  2NZ1 D;  3I90 A;  2IPK D;  2BCO A;  2VB3 X;  1LTR D;  1EEF D;  1EY7 A;  1GOZ A;  1PXU A;  5C0X I;  1I4R A;  4ME5 A;  2XN9 C;  2EPB A;  1PTO H;  3OOC A;  1QCB D;  1OXV A;  2AUJ D;  2NBF A;  3H09 A;  4RFB A;  3O13 A;  1MSG A;  5T1I A;  1HFG A;  1SAP A;  2QCP X;  5KYI A;  4Q5V A;  3TP7 A;  1B44 D;  1YNN C;  4FP5 D;  1SYG A;  1FD7 D;  2L9H A;  1JE4 A;  2ZXR A;  3H3V C;  1O7Z A;  2HDM A;  1GUO A;  5JPM C;  2O4X A;  1PMR A;  1A3T A;  3D4W A;  5C4Z A;  3SK4 A;  1IYU A;  3FPP A;  2F0N A;  1KNA A;  2EYO A;  3T51 B;  2BOS A;  4UAI A;  3GTJ B;  3CU7 A;  1TWH B;  1DCZ A;  3QIA A;  1UAP A;  4ZRZ A;  3NUC A;  4H0L C;  1B4O A;  4ZLT F;  1EY5 A;  2VB2 X;  1D6E C;  2CW0 C;  2N88 A;  1KLG D;  5NUC A;  3SHL A;  4X3K A;  1GXD C;  2B2W C;  3VYR A;  5IGD A;  1HA5 A;  1BQQ T;  2DY8 A;  2K7V A;  2O2L D;  3C46 A;  1A3V A;  1LTT D;  1MGS A;  3CQZ B;  3R3O A;  1I4P A;  1TY2 A;  4KJO A;  2AWN A;  4RH6 A;  4OO1 H;  3MA2 B;  2J7Z A;  1PRT D;  3IFT A;  4A3B B;  4KN7 C;  5FOB B;  2J4X A;  4KY7 A;  2EJG C;  1SYF A;  4KV6 A;  2RSO A;  4HN7 A;  4FXK C;  3MZ5 A;  1QG7 A;  2RDH A;  1CTM A;  1TWA B;  3EJI A;  1JR0 D;  4HMJ A;  3PMF A;  2XRS D;  2ENB A;  2F0F A;  1QB5 D;  1DZ1 A;  3QOJ A;  1PZK D;  4U67 3;  2PYK A;  2PW7 A;  3PUZ A;  3CHB D;  4QB4 A;  1Q3L A;  5AFW A;  4ZQ3 A;  1ZYR D;  2DNC A;  3DEO A;  1DON A;  1EZ6 A;  3KBX A;  5G3L F;  1G6Z A;  2LMC B;  3FRP B;  1UEA B;  4RGO S;  1E2V A;  3L3O C;  2Q8T A;  2A69 C;  5KRU A;  5JJZ A;  4DN4 M;  1XX8 A;  4BBS B;  5JEA H;  5K5P A;  4PMB A;  5J22 A;  4BWG B;  4J6H A;  1WTV A;  2R6G A;  1UUP A;  1RDP D;  3D8G A;  2EY6 A;  3K57 A;  5C4J B;  3BVG A;  1MI2 A;  5EBD A;  2AUK A;  5I4D A;  5EQ0 A;  3T4A C;  1ZEQ X;  3KF8 A;  5CMD A;  4XQQ A;  1QOH A;  2WAQ B;  1D2B A;  2RDG A;  1IKL A;  4OGQ C;  1FNU A;  3S15 B;  3NWT A;  1SMY D;  4KI0 A;  1Z47 A;  3I4L A;  1WD1 A;  2K5Q A;  2M9V A;  4K5W A;  1LTI D;  5C0X H;  1FNW A;  1EIG A;  1B50 A;  1CA5 A;  2O5I C;  1JWM D;  4LMQ D;  3ZYY X;  4WRD A;  3QOL A;  2SEB D;  1YNJ D;  1F9S A;  1PFN A;  1QWY A;  4IUR A;  1TS3 A;  1CA6 A;  2KEE A;  1J8I A;  3RUZ A;  4HTH A;  3AMU A;  2EYJ A;  1VF5 C;  3GTP B;  3TP8 A;  4Z9C B;  1JOO A;  1J9O A;  1Z6H A;  2EXZ A;  1TWG B;  4JK1 C;  2RBM A;  3T56 B;  4KKT A;  1WTO A;  3GTO B;  4ZK9 B;  4KHZ A;  1EIH A;  1BUV T;  5KND A;  1D1K A;  4QF4 A;  2E76 C;  3PV0 A;  4RA8 A;  3D6W A;  3GTG B;  1V1O A;  1S5B D;  1SEB D;  4OO1 G;  1KAB A;  3I4N B;  4K6L A;  4DNR B;  3URY A;  5HUR A;  3C1E A;  3I70 A;  1JB3 A;  3BG3 A;  2OT2 A;  4FXD A;  3OWE B;  2BDN A;  5IGE A;  3GQB A;  2K03 A;  3H6M A;  4OHJ A;  2IX0 A;  4NP5 A;  2E2H B;  3D3R A;  4QMG A;  3LX0 A;  3FPU B;  1BOS A;  2X6L A;  2WP8 J;  3K5M A;  5CYU A;  3SXH A;  1RJT A;  4HSV A;  5BN3 A;  2OF1 A;  3S2D B;  1B53 A;  2A68 D;  1HHV A;  2JEA I;  1B3A A;  5JEA G;  2L12 A;  1EYC A;  4EVO A;  1V1P B;  4BA1 I;  2R92 B;  1CFM A;  1TQO A;  2IX3 A;  5JVH 3;  3MC0 B;  3JAM E;  1PTO B;  2LS0 1;  5T1G A;  1CHQ D;  1STB A;  3S14 B;  1RTN A;  1SE3 A;  5CV5 A;  4L8J A;  3TDQ A;  1B9M A;  1BO0 A;  3NP8 A;  1GUS A;  3VYT A;  1F2L A;  1A3U A;  3W2D A;  4IUT A;  4KKU A;  5ELE A;  5IOD A;  4BBR B;  3M7G A;  1EFI D;  1LTB D;  2JA6 B;  3R2I A;  1LT3 D;  4J8Q A;  2IWH A;  2B2Y C;  1BCP F;  5C0X G;  3J81 L;  3VR6 A;  5COY A;  1BBX C;  3P20 A;  2L11 A;  1FR3 A;  1SNC A;  1KDC A;  3HP3 A;  2MUY A;  1W6K A;  1ML0 D;  5EJW A;  1WD0 A;  3IFD A;  1ZXT A;  1TY0 A;  2YYZ A;  3MXU A;  5IT9 L;  4O42 A;  2QF7 A;  2L55 A;  3ONA B;  1S4Z A;  1NR4 A;  4A3K B;  3U9O A;  2F0D A;  5I6Y A;  2WII B;  3K58 A;  3K5O A;  4V19 0;  3FEW X;  3V2T A;  3A54 A;  2JA5 B;  1Z7T A;  4IQZ A;  1CZW A;  1EQT A;  3A7A B;  1ESF A;  2C9O A;  2D2C C;  4OO1 I;  1KTK A;  4DAV A;  1B1Z A;  1PRT B;  5BN4 A;  4RCN A;  1SNM A;  3H0G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...