4PMCA

Crystal structure of staphylcoccal nuclease variant delta+phs i72k v74k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS I72K V74K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pmcA00
4HTHA 4K5WA 2PW7A 1KDCA 2KHSA 4K14A 2F0MA 2SNSA 1SNDA 3OMGA 3PMFA 2EYFA 3EJIA 5HURA 4WRDA 1JORA 3TP8A 2PYKA 3D4WA 4EQPA 2EYPA 1EZ8A 4ID6A 4KD3A 2EY2A 5I6WA 5KGUA 3MVVA 5IGBA 5HGTA 1SNQA 5KEEA 5JAVA 4PNYA 2RDFA 3SK6A 3SXHA 2F0NA 3TP5A 4K2LA 2F0IA 2F0SA 3MEHA 1A2TA 3TP6A 4HMIA 5CR3A 2M00A 4ZUIA 2LKVA 4TRDA 2F0QA 4NMZA 2RKSA 5NUCA 4EQNA 5IGDA 4N9TA 1TT2A 4DF7A 1TQOA 5CV4A 3SHLA 2EY1A 1JOOA 1SYEA 2PZTA 2HQEA 1JOKA 5C3WA 1F2YA 5KRUA 1EY4A 4K6DA 4K5XA 1STNA 2EYJA 1SNMA 4R8NA 2EY6A 2PW5A 4NKLA 3P1HA 2SOBA 1EY9A 5CV6A 3MZ5A 4KY7A 3T13A 3VA5A 1EY5A 2NUCA 5IOCA 5EGTA 4IALA 5ISRA 1F2ZA 1RKNA 4B9WA 3NP8A 5I6YA 5E1FA 4QB4A 2EXZA 1SNOA 2F0FA 3TMEA 1STHA 2F0HA 5CV5A 4S3SA 1A3TA 1TR5A 3DHQA 4RKLA 2OXPA 3E5SA 5C6AA 1A3VA 4LAAA 4KJNA 5IGEA 4HMJA 2F0EA 3H6MA 4B9XA 4KTAA 2KQ3A 4F8MA 1EY8A 3P75A 1EY6A 3DMUA 5C4HA 4QF4A 5CV9A 4MIUA 3OSOA 5J1ZA 1SYBA 2EYHA 2F0OA 3NQTA 5IIFA 1EY7A 1SNCA 4E6IA 5IGGA 1EY0A 1SYGA 3SK4A 2WACA 1SYDA 4IZ8A 2PZUA 5KYIA 1II3A 3EROA 3QOJA 4QMGA 5IGFA 4OL7A 4ODGA 2PQEA 2EYOA 4PMBA 3C1EA 2F0UA 2F0LA 4KY5A 2F3VA 1KABA 2EYMA 3HEJA 4NDXA 4KHVA 4ZUJA 3BDCA 3QOLA 3SR1A 1EZ6A 5C3XA 5I9PA 3OMCA 3C1FA 3MXPA 1STYA 1AEXA 1EYAA 3NUCA 4H7BA 2SNMA 3EVQA 2F0KA 5DAUA 5EKKA 4KJOA 1NUCA 1EQVA 1KDAA 3D8GA 3NHHA 1STAA 3ERQA 3RUZA 3ITPA 4DU9A 3SK8A 1KAAA 2EY5A 2F0GA 5JOBA 5CGKA 4EQOA 5K5PA 3HZXA 2F0TA 1ENAA 1SNPA 1STGA 2F3WA 4KD4A 2F0PA 2F0DA 4N9PA 1KDBA 5EKLA 2F0WA 2ENBA 5I9OA 3V2TA 5M9OA 3BDLA 4ZQ3A 4ME5A 1F2MA 3D4DA 5CV8A 5IGCA 4KV6A 5IODA 1SYCA 5CV7A 5F2DA 5C5LA 4IUNA 4DGZA 2F0VA 1ENCA 4K8IA 1NSNS 4YIJA 5CC4A 5J39A 1JOQA 4F7XA 4K5VA 2QDBA 3NK9A 2RBMA 3T16A 5C4ZA 1EYDA 2OF1A 3D6CA 4RKBA 1A3UA 1U9RA 1EYCA 2PZWA 3NXWA 4I65A 2F0JA 1STBA 3R3OA 3TP7A 3U9OA 5KYLA 4WORA 3LX0A 3S9WA 4NP5A 2O4XA 4KY6A 5J22A 1IHZA 5KIXA 4K2KA 4J1MA 4EVOA 2EYLA 5DEHA 4J6HA 5E3FA 1SYFA 2OEOA 4G57A 3MHBA 5C5MA 3SK5A 4PMCA 3QB3A 4DFAA 1A2UA 3OWFA 4K8JA
chains in the Genus database with same CATH superfamily
5CR3A 4NXNL 2SNSA 4EQ5A 1YNND 3T56B 2OCEA 1EZ8A 1KLGD 3OIPA 3CHBD 1UE5A 2J4XA 1I94Q 3SXHA 4PMWA 2DY7A 1B9MA 4UAIA 1SE4A 2B2YC 2HCCA 5GADC 3DEOA 3J81c 3PUXA 1HTPA 3ULJA 1VQPA 3KLRA 1SNMA 1KLUD 1T5EA 4KY7A 1RL2A 1X6OA 1EY5A 3J80i 1IBKQ 1D5ZC 1L0WA 2CW0D 3CCRA 3GTLH 5M3MG 3HOWH 2AQ2B 1Q8IA 5DNFA 4JOIC 5IT9L 1STHA 1DGSA 2BH8A 4IO9A 1D8LA 1XMOQ 4LK1C 5D3DA 4KJNA 4A76A 1DOLA 5KNDA 1S5ED 5C4HA 4L5SA 5GAHC 4QUFA 1KTKA 2AQ1B 2QEXA 2QILA 2WACA 5KYIA 2B8GA 4DUZL 5C0XH 2Q2IA 4LF7L 2KCTA 2WB1G 3RLNA 1K28A 5LHY1 3MXPA 5EKKA 1PH6A 2F0KA 3G6JB 4DAYB 4AH6A 1Q8KA 1VQNA 1E2ZA 1MIUA 4A3CG 4JI8L 3KYHC 1F2MA 1PRTC 2B63B 4O1NA 4U68A 4A3JG 4F7XA 1TWCH 3PF5A 3X3MA 2SEBD 4BY1B 4LFCL 3F1ZA 2PO4A 4RHSA 3TP7A 3M7NA 3CPWA 3K57A 1CZGA 4OXPA 2JA5H 3HOZH 5IWAL 3CRLC 3KF8A 2N55A 1M4VA 3WDNA 1R4PB 4HTHA 1NBWA 4DUYL 3PMFA 1SNDA 3WWVA 1U0LA 4ZAIA 4CJ1B 2RHQB 3KF6B 2JP1A 4BBSH 1FL0A 1B8AA 4X3SA 2J0TD 3H0GB 3GTMB 3I73A 4JI7Q 2E74C 1L1OB 4JI1L 4B3ML 5JPMC 5FLMH 4JI4L 4ZUIA 4TRDA 2RCNA 2M2LA 1HNXQ 1NMGA 3D0FA 5IT9c 3S1MH 1WVLA 4JI3Q 1D6EC 1PMRA 2R7ZB 3K5LA 2B2UC 2YU9H 1Y1WH 4NXNQ 3UDIA 4JCVE 4KHZA 4A3FB 1F2LA 3L3OC 1GOZA 1O7ZA 3BG3A 3K81C 2KCNA 3CCVA 3UDGA 2Z9HA 4XQQA 1LT4D 1F9RA 4RGMA 1JE4A 1C8CA 1XX8A 2A69D 2PPBC 4G7ZC 1TKWB 1I4XA 1TY0A 4L6TB 1LTTD 4A3IB 2E2HH 1TR5A 1VQLA 2MQHA 3H6MA 4B9XA 4B3TQ 5LMUL 1GUWA 2NZ1D 2MUYA 4DV7L 3ZJYC 3PIP3 1S5DD 4A3DB 3MXGA 1ASYA 2UUCL 3FP9A 3SK4A 1SYDA 2ICEC 4HCSA 2PZUA 1Q81C 4QMGA 1XNRL 1I4HA 2EYMA 3F2BA 1HCZA 4JI2Q 4IURA 3C1FA 4JG2A 5DAUA 1QOHA 3EVQA 5KYLA 5JJLA 1BQQT 2DJGC 5IYBH 4DU9A 2EY5A 2F0GA 2Q2HA 5LL6X 1HQMC 1L2FA 3HKZB 3HOVB 4EX5A 3S1RH 2NWGA 3FEWX 4DV2Q 4XYOA 4JYAL 3VR3A 1I50H 1H9MA 3E0JA 5F2DA 1XNQQ 2R7FA 3AYHB 2E2IH 3HOUG 2UU9L 5FKAC 2XRQD 2I07B 4X64L 3HOYG 1QE6A 1E22A 4DR2Q 4PZ6A 5D3IB 4RH6A 1SYFA 2X6GA 4G57A 4C2MH 1A2UA 4DR4L 4K5WA 4A3MH 1EEFD 1V1PB 3HKSA 1QZHA 3DUZA 4YWKA 3PF4A 2Y0SE 5JAVA 2UXBQ 4O42A 1QB5D 2B2VA 1AZQA 3GTPB 4LFCQ 1N33L 3I4OA 1PRTD 3J7A5 5I4DA 1PH8A 3P7JA 2PNRC 2NVXH 1WTRA 1QWYA 4DNIA 5KNCA 2F0QA 2RKSA 4ZKCB 5CV4A 4AYBE 1LT6D 2SDFA 2L5TA 3I56A 1EU3A 1F9SA 3KBGA 1DZ1A 3I4MH 3TRZA 1STNA 2L4NA 2EXDA 4L63B 1D5XC 3AQQA 3KJOA 2VY3A 1TY2A 1Y8OB 1ET9A 4HR7B 4XTCS 3F8TA 2JA8B 2EPBA 3TZUA 1TU2B 3J81j 3E9IA 1MJEA 2B2YA 3VR4A 4JI1Q 2VQFL 1Z7TA 1TWFH 3DHQA 4A3BH 3S16H 1C0AA 1ZYRD 5K36H 4H02A 1B44D 5IYCG 1Y1VH 2PQAB 5LL6S 2DGYA 3U9SA 2UUBL 4P2CB 2FXQA 3H09A 1Z9FA 2K50A 3QO2A 3BVGA 5C4XB 2Z6KA 1A6XA 1Q3LA 4KLKA 4DK3C 2BE5C 2CVRA 4KY5A 3K8AA 1KABA 3U50C 4JOIA 4WFN3 1B3AA 3DWPA 1EZ6A 2IX0A 5CMDA 3BVZA 1NY4A 2SNMA 4U673 1EQVA 3RLOA 1O78A 4JI6L 3SK8A 2X69A 4BA1I 3NBIA 3RZDB 5EKLA 5M9OA 1NE3A 4N9PA 2EE1A 2HDMA 1B9NA 3JC66 4TQUS 3V2TA 3TSSA 1PTOC 2X6LA 4OX9L 3D4RA 5C0XI 3CQZH 2VUMH 1CKOA 1X54A 3S1NB 5JEAH 1AFPA 5AJ3Q 4C3HH 1WTHA 2K75A 5LMNL 4UP8A 3MXNB 4K8IA 5ELCA 2VB2X 3G7LA 1WI5A 4V0BA 4FXKC 5E4XA 5A35A 1EFID 5A2QL 4X66Q 2WAQB 4JI5Q 3J80E 4UDUC 1LYLA 4KY6A 4A93G 2TMPA 5KIXA 2WP8J 4YY3L 2JA7G 2OQ0A 3NTKA 3RN5A 1K8MA 2Q2UA 2VQEL 1FJGQ 2RDGA 3T4AC 3K5NA 3HP3A 4K8JA 1PH2A 1VQ8A 3OMGA 4DAMA 1JWMD 3CCLA 3U4ZA 2EY2A 1PV4A 1E2VA 3UE0A 2LXJA 5KEEA 4WJWA 1SBBB 2WAQE 2F0NA 3TP5A 1IL8A 1WTOA 4BXXG 4WJ3M 3A8KE 3K5MA 5JVH3 2UXCL 4NMZA 4EQNA 2DNEA 4R4CA 4OO1H 1JOKA 2G5DA 3PCOB 1F2YA 5M3MB 4HIKA 2K33A 1CHQD 4LNQA 3MZ5A 1V1OA 1IXRA 4IJLA 2XNAC 3L0OA 2JA6G 2R6GA 3GTKH 1BBUA 2IX1A 1FD7D 2EJFC 1EIHA 4X65Q 2I5LX 4A3LH 3FKIH 3NEMA 1N33Q 2VL6A 4S3SA 2RSNA 1A3TA 5HY6A 2IWHA 2ZT9C 3CU7A 5EBCA 4KMUC 2WB1B 4QIWB 3ERSX 1EY8A 4QF4A 4MIUA 3NQTA 2XRSD 5EPLA 2JA9A 1SNCA 3I4NG 1H9JA 1A8VA 2Q8RE 4CGYB 1XMQL 1H9SB 2F0LA 2F3VA 4RFBA 4P72A 3R8BA 5EJWA 2CWAA 3FRPB 1UUPA 3OW2A 4MTKA 4C3IH 3F2DA 1Z6HA 1L0XB 2VQFQ 4CKEA 4HIOA 4A3JB 5CGKA 1HA5A 5K5PA 2F0TA 1ENAA 2F3WA 4QIWE 4IJHA 1L1OC 3S15B 1YJNA 2UUBQ 5TSSA 2KA7A 2VW9A 3T1HL 5IP7G 1NTGA 3T53B 1Y8PB 3PO2H 4RKBA 4ABNA 4WORA 3GV6A 1D1IA 1R9TH 2M9VA 1WTQA 2B2TC 2KEDA 2OEOA 5JVG3 2HHHL 5ELDA 2BE5D 3K0XA 2A6EC 1ML0D 3CW2C 1U4MA 1EYGA 4NB3A 1W6JA 4YHHQ 1EWIA 2NVYB 3G48A 3TP8A 3G4SA 3S14B 2WKCA 2YTYA 2K01A 3PUWA 1EIGA 5LMNQ 1B7YB 3M4OH 3TN2A 3K6OA 1U4LA 4FF2A 2KEEA 1QVFA 5IT9E 1LTID 1G91A 3C3LA 1RD9D 3CMAA 1E1OA 1X3GA 4LF4L 3Q22A 4Y52H 1FGBD 2Y0SG 1KRSA 4OGQC 3L2PA 3WOFA 1K8GA 1PTOH 3FPUB 5GQOA 1PFBA 2MHVA 3S24A 3RNUA 2OTLA 5ELOA 1SMYC 1UE6A 3T13A 2F4VQ 1N34Q 1IBKL 1E0BA 2XN9C 4IALA 2DY8A 1A15A 2AQ3B 3FHWA 4AYBG 2XGTA 1VDZA 1SAPA 3VDYA 1XMOL 1B50A 3M3YB 4DV0Q 1Z47A 1ET6A 1TWAB 1GUGA 1B4OA 2FFKB 2A68D 4DPGA 4AIMA 1CFMA 1VQDA 2MFIA 5IYDG 3AFPA 4JVZA 4NP5A 3I72A 5IGEA 2QF7A 1J5EQ 3HOZG 1PH1A 3HOUB 2CCZA 4GNXB 3NSWA 4DGZA 1CKNA 2ENBA 3HOYB 1DCZA 5J39A 1NSNS 3T51B 3T16A 2V4DA 4R1JA 2ES2A 4FF4A 5M3FG 4I65A 1CA6A 1WOCA 2GA4B 1SROA 3GD7A 1S72A 1PH5A 2R61A 1HR0L 2B63H 2FJ2A 2V1CC 5GROA 2J7ZA 5C3EG 4H44C 4BWGB 3CCEA 3BVMA 3SK5A 1U5KA 4DR6Q 1NR2A 4GOPC 4BY1H 5M5XB 3OTOQ 2PW7A 2ZJRA 2L9HA 4JBWA 2EIFA 3W1GA 3PO3G 3SK6A 1TWHB 3A5ZB 4JI7L 4BBRG 3KLSX 4H0LC 3OYYA 4MZ9A 1KQSA 3DWQA 4HMIA 1XTDA 2DNCA 2LKVA 3KLSA 5IE8A 1CT1D 4Q5VA 4GKKL 4A3GG 3H0GH 1VS0A 4MNOA 3GTMH 1V43A 1EY4A 1G8ZD 1PH9A 2Z8LA 2N88A 5CV6A 1C48A 2OTJA 5IOCA 2A6ED 2R7ZH 2GVAA 2B8FA 4YCUA 2CKZB 1GUNA 3I90A 4IUQA 2QCPX 4OO1I 4A3FH 3AFQA 1Y14B 1VF7A 1S3OA 1PYWD 4LF4Q 2FMMA 4RGOS 4B3TL 1S5BD 2CH4W 2B39A 3JAMi 4QY7A 4JBJA 1F77A 1IW7C 1YNXA 4A3IH 1YIJA 1HUMA 4DR7Q 5IGFA 3MTSA 4C3JG 3C1EA 3NBHB 1JB3A 1Y69U 2Z6KC 2CQOA 4JI2L 1EYAA 3K7AB 1MGSA 4A3DH 1TWGB 1SMYD 5IGBA 2WKDA 3NHHA 4IFDI 1AE3A 2GN5A 2BOSA 5JPNC 1STGA 4OIJA 2WIIB 1HUNA 3M9BA 4DV2L 1HQRD 4ME5A 1BOSA 4A93B 2VZAA 4CKCA 2JA7B 1YBYA 1XNQL 1I6HB 3GTGB 1VQAA 1LTGD 3HOVH 2L0CA 4M8AA 3STBC 1U9RA 2RA4A 4DK6C 1CHPD 2A74C 3KF6A 3E6ZX 2F0JA 1AE2A 5DLQE 1YJWA 1HZ9A 1WCMG 1MI2A 4DR2L 3MXUA 1TS3A 2UXDQ 1NAPA 2B3GA 2MGSA 4J1MA 1I4PA 1L1OA 1PVOA 1WYDA 1G6ZA 5NUCA 1E24A 2QEJC 1VF5C 4XIGS 3PUVA 1X56A 2E5LQ 1S40A 4JW0A 3OW7A 1VQ4A 2UXBL 1N32Q 1E1TA 4IUTA 3F2CA 3MEHA 3HFZB 2FHTA 1HR0Q 3J7YW 2B2TA 1P16A 4HSVA 3BYTB 3BZCA 3GQBA 4N9TA 2JA6B 1J9OA 2AKWB 3PIOA 1BCPC 5C3WA 5KRUA 2I46A 3PV0A 1BDOA 4K5XA 3GTPH 2EYJA 1EUJA 1W6KA 2R93G 2R92G 3VA5A 3GTJB 3SDZA 4HIDA 4IPHA 5EGTA 5HGQA 3UE1A 5ISRA 4DA2A 4FO2A 3MWYW 1VMPA 3RLFA 3I4NB 1VQIA 5FJ8H 3R2TA 1BNZA 2OXPA 3CP0A 2NBFA 3VR6A 2JEAI 1QJOA 1VQJA 1EWCA 4QGUA 4GKKQ 3PUYA 4KTAA 1CM9A 5CORA 2K04A 1K3BC 2CHBD 1XJVA 2RQXA 3I70A 2K5NA 4XDXA 4Y7NB 2K1BA 3QWNA 3A74A 5A2QE 1KXLA 4DV6Q 3FPPA 2NZHA 4TKOB 4OWWB 2A19A 1HZBA 1Y8NB 2KHIA 2AUKA 1AEXA 4DNTB 1I5FA 3RZOB 1G2SA 3F2UA 2LY7A 5C4XH 2MO0A 1X3EA 3IKJA 1JCKB 1TS2A 3PUZA 4KD4A 3GTQB 2EJGC 1BO0A 3NWTA 1W2BA 4IUPA 5EAYA 5C4JB 5CV8A 4ME3A 1RJTA 2B2WC 2NTTA 4JK1C 5IP9G 5AJ3L 4LF8L 3ND8A 1SEBD 3NK9A 2RBMA 3RZDH 1V1PA 2OQKA 4X66L 4XYQA 5CBEE 4JI5L 3U9OA 1PRTF 1PH3A 3KF8B 3S1NH 3LWEA 1ICWA 1PA6A 1XYIA 4HAEA 2EYLA 2E8GA 5KNBA 5C44G 1FJGL 4K0KQ 5C5MA 2F0IA 4R4IA 2KECA 4FXGC 4BA2I 1YHBA 3S17B 3A7LA 2HUGA 2XSCA 1MBYA 3D4WA 4ID6A 1QUQB 3CF5A 2WV6D 2Y0SB 1HHVA 4R4TA 1K83B 2D5DA 4IOCA 3LGJA 2A6HC 2M00A 1XPUA 1YNJC 2ZTCA 1BF4A 4GOPA 5IGDA 1SE3A 3TEHB 3STBD 1TQOA 4A3EG 3KDFB 1SYEA 4AYBB 2WFWA 2JSOA 3PSIA 3HG9A 3C46A 5M3MH 4X65L 4QB4A 3TMEA 4PZ7A 5FO7B 3E5SA 2C5CA 4HMJA 3K58A 3U4VA 3E0EA 4OHJA 1OO9B 4FF3A 2JYOA 3Q6SA 4G4KA 1BR9A 4E6IA 2XIWA 3MC0B 3HOZB 2E76C 4GN4B 4FVMA 1M8AA 5BN4A 1BCPD 1E2WA 1FVIA 3MXNA 5E4WC 1JICA 1EQRA 1JQYD 3NUCA 1I6VC 4BY7G 4CDCC 4X6AH 4EQOA 2N8NA 4C56C 4LF5Q 4A3CH 4IQZA 5M3FB 5LMNW 3BJUA 3ONAB 1I4GA 3D4DA 5I2XA 4IPDA 1SYCA 5C3EB 1E7ZA 4YIJA 4A3JH 1X3FA 2K5VA 3CCSA 4L5RC 2YU9B 1OXVA 2HCIA 2QDLA 1VMCA 3S15H 4MTNA 2OT2A 1IHZA 3NENA 1PFNA 3HRZC 4FDBA 4J6HA 1WFQA 4RCOA 2K5WA 3PO3B 4X3UA 4FYDA 4BBRB 2ZTEA 1CA5A 4YHHL 1KDCA 2EQSA 4QCLA 1LTRD 4I7AA 4LMQD 1KNEA 2KUMA 2N49A 5CYUA 1O7YA 3JAME 4LF8Q 2BCOA 4A3GB 1Q82C 1AZPA 3Q0AA 3M4PA 4DAPA 2NVYH 3H94A 3S14H 1XWEA 3M4QA 5FO8B 2JJQA 4G7HC 4QJFA 2VB3X 1TS5A 2IL8A 2G9DA 3AEVA 2OWOA 3CRKC 2F4VL 3J7AV 1N34L 2CWPA 3NQIA 4A3KG 4KKUA 1LT3D 2QW7A 2YTVA 4DR5Q 1I50B 1CQVA 5BR8Q 1LACA 2KVMA 1H9SA 1GD7A 1JE5A 3EBEA 4DV0L 1A3VA 1JJGA 4C3JB 2KQ3A 4QL5A 1EY6A 2L12A 3K0YA 2WINB 5J1ZA 1C7YA 5EPKA 5IGGA 1P8LA 1S5FD 3M3YH 1HNZQ 1KIXA 1C4QA 3A7AB 3QOJA 2EYOA 2EOTA 4NDXA 3MFGA 1YHQA 1DXMA 1GUSA 1TWAH 1IYVA 1IBLQ 1SE8A 1STYA 4H7BA 5C3XA 4DV1Q 1J5EL 3SEBA 5IY0A 2IT1A 1KAAA 1AW7A 3H3VH 2MP1A 4GN3B 5C0XJ 4HIMA 1ESRA 3BDLA 3AU7A 2MNAA 3G6EA 2E2DC 4IFDH 1OXUA 2NN6I 1WCMB 2K32A 4IUVA 3ULPA 3CCQA 3A5UA 3HOUH 5ELEA 1EFWA 1JR0D 3HOXG 2PZWA 3BZKA 4HSPA 3NXWA 1PTOF 2Z6BA 2Q2TA 3HOYH 1YHAA 2E2JB 4M1UB 3E9HA 1PRTB 3RD4A 5DEHA 3MFYA 4PQXA 4B08A 4DR6L 1B70B 3QB3A 1N36Q 3O13A 1EQTA 2LXKA 3OTOL 3V96A 4ULLA 2B2WA 1JORA 3I55A 4DR1L 3EJIA 5HURA 4KD3A 2RHSB 4CBVA 1QG7A 1B1ZA 1VQ5A 2K05A 1K0RA 2PI2A 2HDLA 4CDEC 3ZYYX 1CUKA 4K2LA 2R7DA 3W1BA 3TP6A 3CCUA 2R93B 2R92B 3CPFA 1NR4A 1TWHH 5FK9C 4X3KA 4FNFA 1ZEQX 2IY5B 2EY6A 1ILPA 2F4IA 1HPCA 4RWSC 1N9WA 1HFNA 1EY9A 1IKMA 4DV3Q 2KCMA 3HS0C 4AQYL 4GLXA 1DYQA 1TIID 3CMEA 3OPOA 1PTOD 3HOWG 1SN8A 5G3LF 5CV5A 4IPGA 4XT1B 2A8VA 2AUJD 2XVSA 4RHRA 4ZYSA 1X9NA 4A4IA 3R2IA 4RAUC 2O5IC 5IYCH 3RN2A 5EQ0A 1VQ7A 1CSPA 1EQQA 1HNWQ 3DMUA 3EA6A 1SRUA 3OSOA 2C35B 3K5OA 1SYBA 4HJ8A 4KN4C 4JPBW 2JN4A 1FNUA 4GNXA 1Q86C 2L1BA 4DR7L 5C0XG 4WJ4A 3JAML 4H13C 1KL9A 3QOLA 2YYZA 5BN3A 3OMCA 3VYRA 2PCFB 5DM73 1DM0B 1STAA 2BDOA 5COYA 2B29A 3ITPA 5M5WB 3R93A 1BKBA 3HZXA 3I7FA 1SMXA 2NVTB 1QCBD 2H4OA 3A0JA 1IBMQ 3HGBA 5FO9B 1KNAA 3K7AH 2DN8A 5D65A 3KJPA 2UUAQ 1TWGH 4LUVA 4OELB 4Q0FA 3ER0A 3ND9A 5C44B 1IKLA 1WTWA 5E7NA 2JXMB 2Z1CA 3D6CA 4CDFC 1HR0W 1EYCA 4TSSA 4DNRB 3LX0A 1CK1A 5AFWA 5G3LD 4A93H 2UXDL 3PQIA 4LF9L 4K2KA 2JA7H 4I7ZC 1ONLA 2JA5G 1Q1BA 2Q8IB 3J7AF 4B3RQ 1I6HH 3GTGH 4PMCA 5EBDA 3T1YL 4K14A 2K52A 1JB7A 1TXYA 1OXSC 2EYPA 2E5LL 2I5MX 2RF4A 4KK7A 5I2YA 5I6WA 4BBSG 2BDNA 4CJ0B 1SNQA 4RMFA 3IFTA 5M5YB 2ZJPA 1LT5D 4A3EB 1N32L 1H95A 1B3QA 1F9QA 1NCVA 3VA7A 4BXXH 2F0SA 2DUDA 5FLMG 5T1IA 3TREA 1HH2P 3DXJC 1MSHA 4HJ9A 1GHKA 3GTOB 1HJPA 1MJCA 3SHLA 4G7OC 1JOOA 4RCNA 1Y1WG 1HTLD 1RCVD 4J8QA 4QQBX 4B3SQ 4DR1Q 2PW5A 3I3CA 5EPJA 3P1HA 4HJ7A 3BDOA 3RR5A 1RODA 1S4ZA 3P20A 2JA6H 1UEAB 4JBMA 2ALYB 1EWHA 5E1FA 4OWTB 2EXZA 2KBNA 4R4QA 2RSOA 1EIFA 3JAMc 4KHPQ 3GTJH 4RKLA 2PNHA 3GO5A 3TDQA 4P71A 1PZID 3P75A 1KAWA 5CV9A 1AN8A 2HIXA 1WTVA 3DWAA 1ICFB 4IOAA 4R9WA 1WD0A 4BY7B 5T1GA 3QR8A 4UHVA 4DV6L 1ZXTA 1A62A 4PMBA 4XXEA 3BZDB 2N3SA 5I9PA 4AQYQ 3BU2A 1GJXA 4XQJA 4DAVA 2RDHA 4Y7NH 1HZCA 4MN3A 1I4RA 5IYBG 3D31A 2K5DA 4JI0Q 3CC4A 4KKTA 2F0DA 1GM5A 1KDBA 2FINB 2A69C 1HA6A 4DAYA 2O2LD 1GHJA 3CC7A 3RZOH 5IP7H 5C5LA 4NXMQ 4P73A 4K5VA 1N8RC 1SR3A 5C4ZA 1EYDA 1G51A 3GTQH 3E3XA 3H3VI 2K6AA 5C4JH 1ENFA 1PTOB 3DLLA 3S9WA 1QZGA 5J22A 4LF6Q 1YZ6A 1VQ6A 2K5HA 5JEAJ 1SFOB 3KOJA 3UDXA 2QA4A 4K0KL 3S2DB 3ULLA 3NTIA 1SE2A 4HJ5A 2KHSA 1D7QA 1UE1A 5ELBA 4A3MG 1BXTA 2PYKA 1JMCA 5JJKA 2P5ZX 4DN4M 1Q7YC 5HGTA 3S2HB 2JEBI 1JJ2A 1ASZA 1CKMA 2MO1A 3TQYA 1RIPA 1A2TA 1GXDC 3S17H 1EOVA 4CHTB 4DR3Q 1CI3M 1STEA 3M85A 4LF9Q 2NVQB 4A3KB 2C9OA 3Q23A 2JK8A 3T1YQ 1QVCA 1SXTA 3I4MG 1K83H 2Z4HA 4FXDA 1PZKD 3J81i 4NKLA 2SOBA 3PIO3 3MA2B 5D14A 4GKJQ 4PV1C 3S1QB 4N8FA 3B6YA 3OOCA 2F0FA 2AMCB 4A3BG 2K14A 4LAAA 5K36G 5GAEC 1Y1VG 1H9KA 1K73C 2HD3A 2VXWA 1EY7A 1VQGA 4UPAA 4K6LA 4GLAC 4DV4Q 1JT8A 3EROA 4OL7A 1I3QB 1VQFA 1WTPA 1XPOA 5IYDH 3NE5B 1VQBA 4KHVA 3SR1A 3BDCA 4LJZC 1DD2A 1Q12A 4IFDJ 4LFBQ 4GLVB 1Q46A 2HQLA 2HIVA 2ID0A 3ERQA 1BBWA 1LM0A 4LFAQ 1MHWC 4LF5L 3HOXB 3DM3A 4C1NK 5FLXL 1SJHD 3FDTA 5I9OA 4ZK9B 2JA8H 1DONA 3H15A 4KKSA 3AB9A 2VUMG 5IODA 1VQCA 5JEAG 4C3HG 4JV5L 3EIVA 1ZYRC 1AP0A 4DV5Q 2NYZD 2QDBA 2YTXA 2EZVA 2L15A 5CBAE 5M3FH 2NN6H 1QUQA 1F9PA 5C3EH 1T5XD 5E3FA 1MD2D 3MHBA 4IPCA 1T9HA 3NPPA 2F0MA 2NB0A 1D1KA 3OHXC 1WD1A 4WRDA 4L5QA 1W3SA 5FOBB 4EQPA 3CKIB 3KDFA 3QG1A 2CQAA 1VQMA 3PO3H 4PNYA 2RDFA 3TS0A 4BBRH 1IZ6A 3TZDA 3W5OA 1YI2A 1IW7D 4A3GH 2ASBA 1TT2A 2NTSA 2HQEA 3GTLB 2F3IA 4OO1G 3HOWB 1V1QA 2YV5A 2ATWA 1X65A 2IJ0A 1M90C 2XWBB 1LTSD 2Q8TA 2A73B 1UWVA 1ILQA 2NUCA 1TS4A 1BCPF 2O5JC 2JE6I 3NP8A 4DR5L 1D5MC 3W2DA 3CAMA 4A3LG 3FKIG 5BR8L 2F0HA 1NNXA 4GS3A 3VR5A 3PIPA 3H3VC 5L37A 3I4LA 1TVXA 2GVBA 4F8MA 4R4OA 3GV3A 4IFDG 1UE7A 5FLXc 4C1NI 1KHIA 2ZM6L 3VYUA 4J15A 1VQOA 1HNZL 4IZ8A 2PQAA 3L9AX 4F88A 2F03A 2F1MA 4RA8A 2ZXOA 1CZWA 4C3JH 4ODGA 4DUZQ 2PQEA 2QGQA 4GNXC 4LF7Q 2F0UA 2A1AA 3HEJA 1NMFA 3BS1A 1IBLL 1O80A 4HN7A 2Z4IA 4DV1L 3D8GA 4ZKBB 4C3IG 5JOBA 3HKZE 2ZXPA 1TWCB 3OWEB 1XTCD 1SNPA 3DM1A 2F0WA 4JI8Q 1NJIC 2XWJB 1JOQA 2JA5B 4LW1A 3X3NA 3PO2G 4ALPA 1XXGA 1PYBA 3R3OA 4ZRZA 1WCMH 4BBSB 2AWNA 1FYCA 1PXUA 5IWAQ 4FF1A 1N36L 3KFUA 1PFMA 1OTCA 3PGZA 4DUYQ 2E2JH 2Z0SA 1WTXA 1PYSB 4JV5Q 2LS01 3S1MB 2G9HD 4EGVA 4UP7A 1JWSD 2A5HA 4GOPB 2EJMA 4PZ8A 2MPMA 4ZLTF 1Y1WB 1O7IA 4B3MQ 4JI4Q 4LUZA 1G2TA 1EL0A 2L55A 4IUUA 2PZTA 4K6DA 3M4YA 1RTOA 1U4PA 4GZYC 2R93H 1X32A 1E3PA 2R92H 4DV3L 2E2HB 1CQFA 1UNSA 2R3ZA 2IHFA 5JJIA 2K28A 4ZCKA 1RKNA 4RG1A 2K5QA 1JC7A 1RF2D 4P75A 4MHEA 5ELFA 3BYYB 1DOMA 1SLJA 3FVQA 5JJZA 3LWUA 3VYTA 3IAYA 1VQEA 2F0EA 1OXXK 1LV9A 4HCEA 1HNWL 5LMUQ 1SJED 2KOLA 4DV7Q 1G6PA 4BS9A 1VCIA 2KHJA 1D2BA 2HT1A 2BA0A 1J8IA 2UUCQ 4DXFA 5ELNA 2KJXA 1GKHA 1XNRQ 3S1RB 1PH4A 4PG3A 2ZJQA 4L8JA 1LTAD 3DEPA 4LWCA 1IYUA 3KUPA 1V9PA 4QUCA 4NW2A 4O0AA 3A54A 4KI0A 2FMCA 2E2IB 3URYA 4N8X1 3Q8DA 4CDDC 3V05A 1IBML 4ZQ3A 4JYAQ 4A75A 5IP9H 4L5TA 2UUAL 3A8IE 4KV6A 2A6HD 3AMUA 2H5XA 1YNJD 4DK0A 5M5WH 2ICIA 1OXTA 2ZM6Q 3EN2A 2BH2A 4KN7C 4C2MB 3J81E 1R4QB 4LUOA 2UU9Q 2NVTH 3WOEA 4DKAC 1GUOA 1STBA 3TBIB 1S5CD 4P74A 4X64Q 3CD6A 4X62L 4A3MB 2B63G 1K8OA 1K8AC 2A68C 4Z9CB 5C44H 4B3RL 2AHOB 1K0SA 1PFSA 1K9MC 4YWLA 3OWFA 4RGTA 4YCVA 4BY1G 3G71A 4DR4Q 4NPSA 3VR2A 5BN5A 1DOKA 2EYFA 3FMCA 3GP7A 2NVXB 3W3AA 4XT3B 2D9UA 2E75C 4GN5A 3MVVA 1QNUA 1HXYD 3IRBA 2I0QA 2CH4A 1K3RA 3ICEA 4RGNA 1BBXC 3I4MB 1PLFA 2K7VA 3CXCA 1PDQA 2IHEA 5DM63 5M5YH 1FNVA 2B2UA 3NTHA 4A3EH 3H0GG 4DF7A 4POGA 1EU4A 1JWUD 1KD1C 4B3SL 2RVLA 3OIQA 2ZXRA 3MEFA 1FGUA 1TWFB 4FP5D 4UY8C 4OONA 3SGIA 4A3BB 3S16B 2IPKD 3GTOH 1ESFA 1Y1VB 2R7ZG 2KCCA 4B9WA 1A0IA 1BCPB 1O7LA 5M5XH 3M7GA 1Q1EA 2L11A 2MJ8A 1XPRA 2JQOA 3NELA 4KHPL 4A3FG 1G291 3I8ZA 5C6AA 3C2PA 2WB1E 1FNWA 1UAPA 4R8IA 3CCJA 2QKIC 3I91A 1LABA 2F0OA 2EYHA 1LTLA 4A3IG 1EY0A 1SYGA 2K4KA 1U4RA 3IFDA 1C9OA 2TSSA 2VNUD 2D62A 3D3RA 3Q24A 3A8JE 4HJAA 5KGUA 1LTBD 4ZUJA 1GVPA 3VYSA 3TS2A 4CKBA 1X55A 3KLWA 3CQZB 1YNNC 2VUMB 1YVCA 4C3HB 4A3DG 4KJOA 2D0PA 1KDAA 3RUZA 4BY7H 2KENA 4V190 4JI6Q 1MKHA 4JI0L 3SE0A 3UI2A 2XTIA 1YITA 1H9RA 4OWXB 4OX9Q 2D2CC 2ZTDA 3UDFA 4NXML 4IUNA 1ENCA 5CC4A 3A56A 2NZOA 2IX3A 1I94L 1PHJA 1HFGA 1L0YB 3HKZG 3HOVG 1UEBA 4YWMA 2AWOA 1M1KC 3CCMA 3QIAA 4LF6L 4CJ2C 1FR3A 1PH7A 4YY3Q 1WJJA 2VQEQ 1EOTA 3K80C 2IW3A 1RDPD 2CW0C 4DFAA 1VQHA 3LNNA 1EEID 1SFOH 4OIKA 2LFNA 3QJYA 1I4QA 1CTMA 4DK1A 3S2DH 3CC2A 5EKIA 1YEZA 1LO5D 4YCWA 1BVSA 1SDFA 1HZAA 4UP9A 1AH9A 1ZKOA 4DR3L 4X62Q 1RTNA 3J80L 3K7UC 1GO3E 2CFMA 2UXCQ 1B53A 1V8QA 2RCFA 3S2HH 2EY1A 3GTKB 2PI2E 1Q90A 4JC0A 5H1SE 3GDEA 4F87A 3N52A 1DJRD 3FKIB 4R8NA 1IL2A 3KK7A 3IL8A 2NVQH 4A3KH 1RHPA 4GKJL 4HEDA 1QNKA 1PZJD 1F2ZA 1EIYB 5I6YA 1SNOA 3J81L 2BA1A 5FJ8G 3I2ZA 3K59A 1A63A 5FLXE 1HRJA 1QILA 2EVBA 1BUVT 4ILWA 4POFA 3SVMA 2VS1A 4O2DA 3RMHA 2JA8G 1JJCB 2PMZB 3S1QH 3N6RA 2LMCB 5IIFA 5J3BA 4APVA 3KBXA 2D0OA 4C3IB 4DV4L 3D6WA 4X3TA 1II3A 1XMQQ 4JBKA 1J6QA 2NN6G 1KC8C 2DJFC 4XQNA 4LFBL 2LSSA 4TVAB 2F52A 1NUCA 5C4XG 3NBHA 1LLRD 1QVGA 4IN3A 4LFAL 3PO2B 1IYJB 1I3QH 1SSOA 2F0PA 1YJ9A 2PMZE 2H1EA 1GUTA 2K03A 3H91A 5IGCA 1CSQA 3U58A 2I5HA 2N78A 3T1HQ 5CV7A 3I4NH 1R9TB 1VQ9A 2F0VA 4DV5L 4DXGA 5GAGC 1X3PA 3EQLC 1MSGA 3L7ZC 3A55A 3HOXH 1B2TA 2OF1A 4OEMB 1A3UA 1VQKA 2B2VC 1KRTA 2O4XA 1CKNB 4EVOA 3EFXD 1HNXL 3J7ZC 3M4OB 3NWSA 4JI3L 2EDGA 2HHHQ 3MAQA 1LUZA 3J80c 1X3QA 2WAQG
chains in the Genus database with same CATH topology
5CR3A 2SNSA 1YNND 3T56B 1EZ8A 1KLGD 3OIPA 3CHBD 2J4XA 3SXHA 4PMWA 2DY7A 1B9MA 4UAIA 1SE4A 2B2YC 2HCCA 3DEOA 3PUXA 1HTPA 3KLRA 1SNMA 1KLUD 1T5EA 4KY7A 1EY5A 1D5ZC 2CW0D 2AQ2B 1Q8IA 5DNFA 5IT9L 1STHA 4LK1C 5D3DA 4KJNA 1DOLA 5KNDA 1S5ED 5C4HA 4QUFA 1KTKA 2AQ1B 2QILA 2WACA 5KYIA 2B8GA 5C0XH 5LHY1 3MXPA 5EKKA 2F0KA 3G6JB 1E2ZA 1F2MA 1PRTC 2B63B 4O1NA 4U68A 4F7XA 3X3MA 2SEBD 4BY1B 2PO4A 4RHSA 3TP7A 3M7NA 3K57A 1CZGA 3CRLC 3KF8A 2N55A 1M4VA 3WDNA 1R4PB 4HTHA 3PMFA 1SNDA 4ZAIA 4CJ1B 2JP1A 4X3SA 2J0TD 3H0GB 3GTMB 3I73A 2E74C 5JPMC 4ZUIA 4TRDA 2M2LA 1WVLA 1D6EC 1PMRA 2R7ZB 3K5LA 2B2UC 4KHZA 4A3FB 1F2LA 3BG3A 1GOZA 1O7ZA 3L3OC 2KCNA 4XQQA 1LT4D 1F9RA 4RGMA 1JE4A 1C8CA 1XX8A 2A69D 2PPBC 4G7ZC 1TKWB 1I4XA 1TY0A 4L6TB 1LTTD 4A3IB 1TR5A 3H6MA 4B9XA 1GUWA 2NZ1D 2MUYA 3PIP3 1S5DD 4A3DB 3MXGA 3SK4A 1SYDA 2ICEC 4HCSA 2PZUA 4QMGA 1I4HA 2EYMA 1HCZA 4IURA 3C1FA 5DAUA 1QOHA 3EVQA 5KYLA 1BQQT 4DU9A 2EY5A 2F0GA 5LL6X 1HQMC 3HKZB 3HOVB 2NWGA 3FEWX 4XYOA 3VR3A 1H9MA 3E0JA 5F2DA 5FKAC 2XRQD 2I07B 1QE6A 5D3IB 4RH6A 1SYFA 2X6GA 4G57A 1A2UA 4K5WA 1EEFD 1V1PB 3DUZA 5JAVA 4O42A 1QB5D 2B2VA 1AZQA 3GTPB 1PRTD 5I4DA 3P7JA 2PNRC 1WTRA 1QWYA 5KNCA 2F0QA 2RKSA 4ZKCB 5CV4A 1LT6D 2SDFA 2L5TA 1EU3A 1F9SA 3KBGA 1DZ1A 1STNA 2L4NA 4L63B 1D5XC 1TY2A 1Y8OB 1ET9A 4HR7B 4XTCS 2JA8B 2EPBA 3TZUA 1TU2B 2B2YA 3VR4A 1Z7TA 3DHQA 1ZYRD 5K36H 1B44D 5LL6S 3U9SA 4P2CB 3H09A 3QO2A 3BVGA 5C4XB 1A6XA 1Q3LA 2BE5C 2CVRA 4KY5A 4WFN3 1KABA 1B3AA 3DWPA 1EZ6A 2IX0A 5CMDA 3BVZA 2SNMA 4U673 1EQVA 1O78A 3SK8A 2X69A 4BA1I 3NBIA 3RZDB 5EKLA 5M9OA 4N9PA 2EE1A 2HDMA 1B9NA 4TQUS 3V2TA 3TSSA 1PTOC 2X6LA 3D4RA 5C0XI 1AFPA 3S1NB 5JEAH 4K8IA 5ELCA 2VB2X 3G7LA 4V0BA 4FXKC 5E4XA 5A35A 1EFID 5A2QL 2WAQB 3J80E 4UDUC 4KY6A 2TMPA 5KIXA 2WP8J 3NTKA 1K8MA 2RDGA 3T4AC 3K5NA 3HP3A 4K8JA 3OMGA 1JWMD 2EY2A 1E2VA 5KEEA 4WJWA 1SBBB 2F0NA 3TP5A 1IL8A 1WTOA 3A8KE 3K5MA 5JVH3 4NMZA 4EQNA 2DNEA 4OO1H 1JOKA 5M3MB 1F2YA 2K33A 1CHQD 3MZ5A 1V1OA 2XNAC 2R6GA 2IX1A 1FD7D 2EJFC 1EIHA 4S3SA 2RSNA 1A3TA 2IWHA 2ZT9C 3CU7A 5EBCA 4KMUC 2WB1B 4QIWB 1EY8A 4QF4A 4MIUA 3NQTA 2XRSD 5EPLA 1SNCA 1H9JA 2Q8RE 4CGYB 1H9SB 2F0LA 2F3VA 4RFBA 3R8BA 5EJWA 3FRPB 1UUPA 1Z6HA 1L0XB 4CKEA 4A3JB 5CGKA 1HA5A 5K5PA 2F0TA 1ENAA 2F3WA 3S15B 5TSSA 2KA7A 3T53B 1Y8PB 4RKBA 4ABNA 4WORA 3GV6A 1D1IA 2M9VA 1WTQA 2B2TC 2KEDA 2OEOA 5JVG3 5ELDA 2BE5D 2A6EC 1ML0D 1U4MA 1W6JA 2NVYB 3TP8A 3S14B 2WKCA 2K01A 3PUWA 1EIGA 3TN2A 3K6OA 1U4LA 4FF2A 2KEEA 5IT9E 1LTID 1G91A 3C3LA 1RD9D 3Q22A 1FGBD 4OGQC 3WOFA 1PTOH 3FPUB 1PFBA 2MHVA 1SMYC 3T13A 1E0BA 2XN9C 4IALA 2DY8A 1A15A 2AQ3B 1VDZA 1SAPA 1B50A 3M3YB 1Z47A 1ET6A 1TWAB 1GUGA 1B4OA 2FFKB 2A68D 1CFMA 4NP5A 3I72A 5IGEA 2QF7A 3HOUB 3NSWA 4DGZA 2ENBA 3HOYB 1DCZA 5J39A 1NSNS 3T51B 3T16A 2V4DA 4FF4A 4I65A 1CA6A 2GA4B 3GD7A 2R61A 2FJ2A 2J7ZA 4H44C 4BWGB 3BVMA 3SK5A 1NR2A 5M5XB 2PW7A 2L9HA 4JBWA 3SK6A 1TWHB 3KLSX 4H0LC 3DWQA 4HMIA 2DNCA 2LKVA 3KLSA 1CT1D 4Q5VA 1V43A 1EY4A 1G8ZD 2N88A 2Z8LA 5CV6A 1C48A 5IOCA 2A6ED 2B8FA 1GUNA 3I90A 4IUQA 2QCPX 4OO1I 1VF7A 1PYWD 2FMMA 4RGOS 1S5BD 2B39A 1F77A 1IW7C 1HUMA 5IGFA 3MTSA 4C3JG 3C1EA 1JB3A 1Y69U 1EYAA 3K7AB 1MGSA 1TWGB 1SMYD 5IGBA 2WKDA 3NHHA 4IFDI 2BOSA 5JPNC 1STGA 4OIJA 2WIIB 1HUNA 1HQRD 4ME5A 1BOSA 4A93B 4CKCA 2JA7B 1I6HB 3GTGB 1LTGD 2L0CA 4M8AA 1U9RA 2RA4A 1CHPD 2A74C 3E6ZX 2F0JA 1MI2A 3MXUA 1TS3A 1NAPA 2MGSA 4J1MA 1I4PA 1G6ZA 5NUCA 2QEJC 1VF5C 4XIGS 3PUVA 3OW7A 4IUTA 3MEHA 2FHTA 3J7YW 2B2TA 4HSVA 3BYTB 3GQBA 4N9TA 2JA6B 1J9OA 1BCPC 5C3WA 5KRUA 2I46A 3PV0A 1BDOA 4K5XA 2EYJA 1W6KA 3VA5A 3GTJB 3SDZA 5EGTA 5ISRA 4DA2A 4FO2A 3MWYW 1VMPA 3RLFA 3I4NB 3R2TA 1BNZA 2OXPA 2NBFA 3VR6A 2JEAI 1QJOA 1EWCA 3PUYA 4KTAA 1CM9A 5CORA 2K04A 2CHBD 2RQXA 3I70A 4XDXA 4Y7NB 2K1BA 3QWNA 5A2QE 3FPPA 4TKOB 1Y8NB 2AUKA 1AEXA 4DNTB 3RZOB 1G2SA 3F2UA 2LY7A 3IKJA 1JCKB 1TS2A 3PUZA 4KD4A 3GTQB 2EJGC 1BO0A 3NWTA 4IUPA 5C4JB 5CV8A 1RJTA 2B2WC 2NTTA 4JK1C 3ND8A 1SEBD 3NK9A 2RBMA 1V1PA 4XYQA 5CBEE 3U9OA 1PRTF 3LWEA 1ICWA 1XYIA 4HAEA 2EYLA 5KNBA 5C5MA 2F0IA 2KECA 4FXGC 4BA2I 3S17B 3A7LA 2HUGA 2XSCA 1MBYA 3D4WA 4ID6A 2WV6D 2Y0SB 1HHVA 1K83B 2D5DA 2A6HC 2M00A 1YNJC 1BF4A 5IGDA 1SE3A 1TQOA 1SYEA 4AYBB 2JSOA 3HG9A 3C46A 4QB4A 3TMEA 5FO7B 3E5SA 2C5CA 4HMJA 3K58A 4OHJA 1OO9B 4FF3A 2JYOA 3Q6SA 4G4KA 1BR9A 4E6IA 2XIWA 3MC0B 3HOZB 2E76C 4FVMA 1M8AA 5BN4A 1BCPD 1E2WA 3MXNA 5E4WC 1JICA 1JQYD 3NUCA 1I6VC 4EQOA 4C56C 4IQZA 5M3FB 3ONAB 1I4GA 3D4DA 5I2XA 1SYCA 5C3EB 4YIJA 2YU9B 1OXVA 2HCIA 1VMCA 2OT2A 1IHZA 1PFNA 3HRZC 4J6HA 4RCOA 2K5WA 3PO3B 4X3UA 4FYDA 4BBRB 1CA5A 1KDCA 4QCLA 1LTRD 4LMQD 1KNEA 2KUMA 5CYUA 1O7YA 3JAME 2BCOA 4A3GB 1AZPA 3Q0AA 4DAPA 3H94A 1XWEA 5FO8B 4G7HC 2VB3X 1TS5A 2IL8A 2G9DA 3CRKC 3J7AV 3NQIA 4KKUA 1LT3D 1I50B 1CQVA 1LACA 2KVMA 1H9SA 1A3VA 4C3JB 2KQ3A 1EY6A 2L12A 3K0YA 2WINB 5J1ZA 5EPKA 5IGGA 1S5FD 1C4QA 3A7AB 3QOJA 2EYOA 2EOTA 4NDXA 3MFGA 1IYVA 1DXMA 1GUSA 1STYA 4H7BA 5C3XA 3SEBA 2IT1A 1KAAA 1AW7A 2MP1A 5C0XJ 1ESRA 3BDLA 3AU7A 4IFDH 2E2DC 1OXUA 2NN6I 1WCMB 2K32A 4IUVA 5ELEA 1JR0D 2PZWA 4HSPA 3NXWA 1PTOF 2E2JB 4M1UB 1PRTB 3RD4A 5DEHA 3MFYA 4PQXA 4B08A 3QB3A 3O13A 1EQTA 3V96A 4ULLA 2B2WA 1JORA 3EJIA 5HURA 4KD3A 4CBVA 1QG7A 1B1ZA 2K05A 2HDLA 3ZYYX 4K2LA 3TP6A 2R93B 2R92B 1NR4A 5FK9C 4X3KA 4FNFA 1ZEQX 2EY6A 1ILPA 2F4IA 1HPCA 4RWSC 1HFNA 1EY9A 1IKMA 3HS0C 1DYQA 1TIID 3OPOA 1PTOD 5G3LF 5CV5A 4XT1B 2AUJD 2XVSA 4RHRA 4ZYSA 3R2IA 4RAUC 2O5IC 5EQ0A 3DMUA 3EA6A 3OSOA 3K5OA 1SYBA 4KN4C 1FNUA 2L1BA 5C0XG 3JAML 4H13C 3QOLA 5BN3A 2YYZA 3OMCA 3VYRA 2PCFB 5DM73 1DM0B 1STAA 2BDOA 5COYA 3ITPA 5M5WB 3R93A 3HZXA 2NVTB 1QCBD 2H4OA 3HGBA 5FO9B 1KNAA 2DN8A 5D65A 4Q0FA 3ND9A 5C44B 1IKLA 1WTWA 2JXMB 2Z1CA 3D6CA 1EYCA 4TSSA 4DNRB 3LX0A 1CK1A 5AFWA 5G3LD 4K2KA 4I7ZC 1ONLA 3J7AF 1Q1BA 2Q8IB 4PMCA 5EBDA 4K14A 1OXSC 2EYPA 4KK7A 5I2YA 5I6WA 2BDNA 4CJ0B 1SNQA 5M5YB 3IFTA 1LT5D 4A3EB 1F9QA 1NCVA 3VA7A 2F0SA 5T1IA 3DXJC 1MSHA 1GHKA 3GTOB 3SHLA 4G7OC 1JOOA 4RCNA 1HTLD 1RCVD 4J8QA 2PW5A 3I3CA 5EPJA 3P1HA 3BDOA 1RODA 1S4ZA 3P20A 1UEAB 1EWHA 5E1FA 2EXZA 2RSOA 4RKLA 3GO5A 3TDQA 1PZID 3P75A 5CV9A 1AN8A 1WTVA 3DWAA 4R9WA 1WD0A 4BY7B 5T1GA 1ZXTA 4PMBA 4XXEA 3BZDB 5I9PA 1GJXA 4XQJA 4DAVA 2RDHA 4MN3A 1I4RA 3D31A 2K5DA 4KKTA 2F0DA 1KDBA 2FINB 2A69C 1HA6A 4DAYA 2O2LD 1GHJA 5C5LA 4K5VA 5C4ZA 1EYDA 2K6AA 1ENFA 1PTOB 3S9WA 5J22A 5JEAJ 1SFOB 3S2DB 3NTIA 1SE2A 2KHSA 5ELBA 1BXTA 2PYKA 4DN4M 5HGTA 3S2HB 2JEBI 1A2TA 1GXDC 4CHTB 1CI3M 1STEA 3M85A 2NVQB 4A3KB 2C9OA 3Q23A 1SXTA 2Z4HA 4FXDA 1PZKD 4NKLA 2SOBA 3PIO3 3MA2B 5D14A 4PV1C 3S1QB 3OOCA 2F0FA 4LAAA 5K36G 1H9KA 2VXWA 1EY7A 4K6LA 3EROA 4OL7A 1I3QB 1WTPA 3NE5B 4KHVA 3SR1A 3BDCA 4LJZC 1DD2A 1Q12A 4IFDJ 2ID0A 3ERQA 3HOXB 4C1NK 5FLXL 1SJHD 3FDTA 5I9OA 4ZK9B 1DONA 4KKSA 3AB9A 5IODA 5JEAG 4C3HG 1ZYRC 1AP0A 2NYZD 2QDBA 2EZVA 5CBAE 2NN6H 1F9PA 1T5XD 5E3FA 1MD2D 3MHBA 3NPPA 2F0MA 2NB0A 1D1KA 3OHXC 1WD1A 4WRDA 5FOBB 4EQPA 3CKIB 3QG1A 2CQAA 4PNYA 2RDFA 3TZDA 1IW7D 1TT2A 2NTSA 2HQEA 3GTLB 4OO1G 3HOWB 2IJ0A 2XWBB 1LTSD 2Q8TA 2A73B 1ILQA 2NUCA 1TS4A 1BCPF 2O5JC 2JE6I 3NP8A 1D5MC 3W2DA 2F0HA 3VR5A 3H3VC 3I4LA 1TVXA 4F8MA 3GV3A 4IFDG 4C1NI 3VYUA 4IZ8A 3L9AX 4F88A 2F03A 2F1MA 4RA8A 2ZXOA 1CZWA 4ODGA 2PQEA 2F0UA 3HEJA 3BS1A 1O80A 4HN7A 2Z4IA 3D8GA 4ZKBB 4C3IG 5JOBA 3OWEB 2ZXPA 1TWCB 1XTCD 1SNPA 3DM1A 2F0WA 2XWJB 1JOQA 2JA5B 3X3NA 1XXGA 3R3OA 4ZRZA 4BBSB 2AWNA 1FYCA 1PXUA 4FF1A 1PFMA 1WTXA 2LS01 3S1MB 2G9HD 4EGVA 1JWSD 2A5HA 2EJMA 2MPMA 4ZLTF 1Y1WB 1G2TA 1EL0A 2L55A 4IUUA 2PZTA 4K6DA 3M4YA 1RTOA 1U4PA 4GZYC 1X32A 2E2HB 1CQFA 1UNSA 2R3ZA 2K28A 1RKNA 2K5QA 1JC7A 1RF2D 4MHEA 5ELFA 3BYYB 1DOMA 3FVQA 5JJZA 3LWUA 3VYTA 3IAYA 2F0EA 1OXXK 1LV9A 4HCEA 1SJED 2KOLA 4BS9A 1VCIA 1D2BA 2BA0A 1J8IA 4DXFA 2KJXA 3S1RB 4L8JA 1LTAD 3DEPA 1IYUA 3KUPA 4QUCA 4NW2A 3A54A 4KI0A 2FMCA 2E2IB 3URYA 3V05A 4ZQ3A 3A8IE 4KV6A 2A6HD 3AMUA 4DK0A 1YNJD 2ICIA 1OXTA 4KN7C 4C2MB 3J81E 1R4QB 3WOEA 1GUOA 1STBA 3TBIB 1S5CD 4A3MB 1K8OA 2A68C 4Z9CB 3OWFA 4RGTA 3VR2A 5BN5A 1DOKA 2EYFA 3FMCA 3GP7A 2NVXB 3W3AA 4XT3B 2D9UA 2E75C 3MVVA 1QNUA 1HXYD 4RGNA 1BBXC 3I4MB 1PLFA 2K7VA 1PDQA 5DM63 1FNVA 2B2UA 3NTHA 4DF7A 1EU4A 1JWUD 2RVLA 3OIQA 2ZXRA 1TWFB 4FP5D 4A3BB 3S16B 2IPKD 1ESFA 1Y1VB 2KCCA 4B9WA 1BCPB 1O7LA 3M7GA 1Q1EA 2L11A 2MJ8A 1G291 3I8ZA 5C6AA 3C2PA 1FNWA 1UAPA 4R8IA 2QKIC 3I91A 1LABA 2F0OA 2EYHA 1EY0A 1SYGA 1U4RA 3IFDA 2TSSA 2VNUD 2D62A 3D3RA 3Q24A 3A8JE 5KGUA 1LTBD 4ZUJA 3VYSA 4CKBA 3CQZB 2VUMB 1YNNC 4C3HB 4KJOA 3RUZA 1KDAA 4V190 3SE0A 3UI2A 1H9RA 2D2CC 4IUNA 1ENCA 5CC4A 3A56A 2IX3A 1HFGA 1L0YB 2AWOA 3QIAA 4CJ2C 1FR3A 1EOTA 2IW3A 1RDPD 2CW0C 4DFAA 3LNNA 1EEID 4OIKA 2LFNA 3QJYA 1I4QA 1CTMA 4DK1A 5EKIA 1LO5D 1SDFA 1ZKOA 1RTNA 3J80L 1B53A 1V8QA 2EY1A 3GTKB 1Q90A 4F87A 3N52A 1DJRD 3FKIB 4R8NA 3KK7A 3IL8A 1RHPA 4HEDA 1QNKA 1PZJD 1F2ZA 5I6YA 1SNOA 3J81L 2BA1A 3K59A 5FLXE 1HRJA 1QILA 2EVBA 1BUVT 4ILWA 3SVMA 3RMHA 2PMZB 3N6RA 2LMCB 5IIFA 3KBXA 4C3IB 3D6WA 4X3TA 1II3A 2NN6G 4XQNA 1NUCA 3NBHA 1LLRD 4IN3A 3PO2B 1SSOA 2F0PA 2H1EA 1GUTA 2K03A 3H91A 5IGCA 5CV7A 1R9TB 2F0VA 4DXGA 1X3PA 3EQLC 1MSGA 3L7ZC 3A55A 1B2TA 2OF1A 1A3UA 2B2VC 2O4XA 4EVOA 3EFXD 3M4OB 3NWSA 2EDGA 3MAQA 1X3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTH A;  4K5W A;  2PW7 A;  1KDC A;  2KHS A;  4K14 A;  2F0M A;  2SNS A;  1SND A;  3OMG A;  3PMF A;  2EYF A;  3EJI A;  5HUR A;  4WRD A;  1JOR A;  3TP8 A;  2PYK A;  3D4W A;  4EQP A;  2EYP A;  1EZ8 A;  4ID6 A;  4KD3 A;  2EY2 A;  5I6W A;  5KGU A;  3MVV A;  5IGB A;  5HGT A;  1SNQ A;  5KEE A;  5JAV A;  4PNY A;  2RDF A;  3SK6 A;  3SXH A;  2F0N A;  3TP5 A;  4K2L A;  2F0I A;  2F0S A;  3MEH A;  1A2T A;  3TP6 A;  4HMI A;  5CR3 A;  2M00 A;  4ZUI A;  2LKV A;  4TRD A;  2F0Q A;  4NMZ A;  2RKS A;  5NUC A;  4EQN A;  5IGD A;  4N9T A;  1TT2 A;  4DF7 A;  1TQO A;  5CV4 A;  3SHL A;  2EY1 A;  1JOO A;  1SYE A;  2PZT A;  2HQE A;  1JOK A;  5C3W A;  1F2Y A;  5KRU A;  1EY4 A;  4K6D A;  4K5X A;  1STN A;  2EYJ A;  1SNM A;  4R8N A;  2EY6 A;  2PW5 A;  4NKL A;  3P1H A;  2SOB A;  1EY9 A;  5CV6 A;  3MZ5 A;  4KY7 A;  3T13 A;  3VA5 A;  1EY5 A;  2NUC A;  5IOC A;  5EGT A;  4IAL A;  5ISR A;  1F2Z A;  1RKN A;  4B9W A;  3NP8 A;  5I6Y A;  5E1F A;  4QB4 A;  2EXZ A;  1SNO A;  2F0F A;  3TME A;  1STH A;  2F0H A;  5CV5 A;  4S3S A;  1A3T A;  1TR5 A;  3DHQ A;  4RKL A;  2OXP A;  3E5S A;  5C6A A;  1A3V A;  4LAA A;  4KJN A;  5IGE A;  4HMJ A;  2F0E A;  3H6M A;  4B9X A;  4KTA A;  2KQ3 A;  4F8M A;  1EY8 A;  3P75 A;  1EY6 A;  3DMU A;  5C4H A;  4QF4 A;  5CV9 A;  4MIU A;  3OSO A;  5J1Z A;  1SYB A;  2EYH A;  2F0O A;  3NQT A;  5IIF A;  1EY7 A;  1SNC A;  4E6I A;  5IGG A;  1EY0 A;  1SYG A;  3SK4 A;  2WAC A;  1SYD A;  4IZ8 A;  2PZU A;  5KYI A;  1II3 A;  3ERO A;  3QOJ A;  4QMG A;  5IGF A;  4OL7 A;  4ODG A;  2PQE A;  2EYO A;  4PMB A;  3C1E A;  2F0U A;  2F0L A;  4KY5 A;  2F3V A;  1KAB A;  2EYM A;  3HEJ A;  4NDX A;  4KHV A;  4ZUJ A;  3BDC A;  3QOL A;  3SR1 A;  1EZ6 A;  5C3X A;  5I9P A;  3OMC A;  3C1F A;  3MXP A;  1STY A;  1AEX A;  1EYA A;  3NUC A;  4H7B A;  2SNM A;  3EVQ A;  2F0K A;  5DAU A;  5EKK A;  4KJO A;  1NUC A;  1EQV A;  1KDA A;  3D8G A;  3NHH A;  1STA A;  3ERQ A;  3RUZ A;  3ITP A;  4DU9 A;  3SK8 A;  1KAA A;  2EY5 A;  2F0G A;  5JOB A;  5CGK A;  4EQO A;  5K5P A;  3HZX A;  2F0T A;  1ENA A;  1SNP A;  1STG A;  2F3W A;  4KD4 A;  2F0P A;  2F0D A;  4N9P A;  1KDB A;  5EKL A;  2F0W A;  2ENB A;  5I9O A;  3V2T A;  5M9O A;  3BDL A;  4ZQ3 A;  4ME5 A;  1F2M A;  3D4D A;  5CV8 A;  5IGC A;  4KV6 A;  5IOD A;  1SYC A;  5CV7 A;  5F2D A;  5C5L A;  4IUN A;  4DGZ A;  2F0V A;  1ENC A;  4K8I A;  1NSN S;  4YIJ A;  5CC4 A;  5J39 A;  1JOQ A;  4F7X A;  4K5V A;  2QDB A;  3NK9 A;  2RBM A;  3T16 A;  5C4Z A;  1EYD A;  2OF1 A;  3D6C A;  4RKB A;  1A3U A;  1U9R A;  1EYC A;  2PZW A;  3NXW A;  4I65 A;  2F0J A;  1STB A;  3R3O A;  3TP7 A;  3U9O A;  5KYL A;  4WOR A;  3LX0 A;  3S9W A;  4NP5 A;  2O4X A;  4KY6 A;  5J22 A;  1IHZ A;  5KIX A;  4K2K A;  4J1M A;  4EVO A;  2EYL A;  5DEH A;  4J6H A;  5E3F A;  1SYF A;  2OEO A;  4G57 A;  3MHB A;  5C5M A;  3SK5 A;  4PMC A;  3QB3 A;  4DFA A;  1A2U A;  3OWF A;  4K8J A; 
#chains in the Genus database with same CATH topology
 5CR3 A;  4NXN L;  2SNS A;  4EQ5 A;  1YNN D;  3T56 B;  2OCE A;  1EZ8 A;  1KLG D;  3OIP A;  3CHB D;  1UE5 A;  2J4X A;  1I94 Q;  3SXH A;  4PMW A;  2DY7 A;  1B9M A;  4UAI A;  1SE4 A;  2B2Y C;  2HCC A;  5GAD C;  3DEO A;  3J81 c;  3PUX A;  1HTP A;  3ULJ A;  1VQP A;  3KLR A;  1SNM A;  1KLU D;  1T5E A;  4KY7 A;  1RL2 A;  1X6O A;  1EY5 A;  3J80 i;  1IBK Q;  1D5Z C;  1L0W A;  2CW0 D;  3CCR A;  3GTL H;  5M3M G;  3HOW H;  2AQ2 B;  1Q8I A;  5DNF A;  4JOI C;  5IT9 L;  1STH A;  1DGS A;  2BH8 A;  4IO9 A;  1D8L A;  1XMO Q;  4LK1 C;  5D3D A;  4KJN A;  4A76 A;  1DOL A;  5KND A;  1S5E D;  5C4H A;  4L5S A;  5GAH C;  4QUF A;  1KTK A;  2AQ1 B;  2QEX A;  2QIL A;  2WAC A;  5KYI A;  2B8G A;  4DUZ L;  5C0X H;  2Q2I A;  4LF7 L;  2KCT A;  2WB1 G;  3RLN A;  1K28 A;  5LHY 1;  3MXP A;  5EKK A;  1PH6 A;  2F0K A;  3G6J B;  4DAY B;  4AH6 A;  1Q8K A;  1VQN A;  1E2Z A;  1MIU A;  4A3C G;  4JI8 L;  3KYH C;  1F2M A;  1PRT C;  2B63 B;  4O1N A;  4U68 A;  4A3J G;  4F7X A;  1TWC H;  3PF5 A;  3X3M A;  2SEB D;  4BY1 B;  4LFC L;  3F1Z A;  2PO4 A;  4RHS A;  3TP7 A;  3M7N A;  3CPW A;  3K57 A;  1CZG A;  4OXP A;  2JA5 H;  3HOZ H;  5IWA L;  3CRL C;  3KF8 A;  2N55 A;  1M4V A;  3WDN A;  1R4P B;  4HTH A;  1NBW A;  4DUY L;  3PMF A;  1SND A;  3WWV A;  1U0L A;  4ZAI A;  4CJ1 B;  2RHQ B;  3KF6 B;  2JP1 A;  4BBS H;  1FL0 A;  1B8A A;  4X3S A;  2J0T D;  3H0G B;  3GTM B;  3I73 A;  4JI7 Q;  2E74 C;  1L1O B;  4JI1 L;  4B3M L;  5JPM C;  5FLM H;  4JI4 L;  4ZUI A;  4TRD A;  2RCN A;  2M2L A;  1HNX Q;  1NMG A;  3D0F A;  5IT9 c;  3S1M H;  1WVL A;  4JI3 Q;  1D6E C;  1PMR A;  2R7Z B;  3K5L A;  2B2U C;  2YU9 H;  1Y1W H;  4NXN Q;  3UDI A;  4JCV E;  4KHZ A;  4A3F B;  1F2L A;  3L3O C;  1GOZ A;  1O7Z A;  3BG3 A;  3K81 C;  2KCN A;  3CCV A;  3UDG A;  2Z9H A;  4XQQ A;  1LT4 D;  1F9R A;  4RGM A;  1JE4 A;  1C8C A;  1XX8 A;  2A69 D;  2PPB C;  4G7Z C;  1TKW B;  1I4X A;  1TY0 A;  4L6T B;  1LTT D;  4A3I B;  2E2H H;  1TR5 A;  1VQL A;  2MQH A;  3H6M A;  4B9X A;  4B3T Q;  5LMU L;  1GUW A;  2NZ1 D;  2MUY A;  4DV7 L;  3ZJY C;  3PIP 3;  1S5D D;  4A3D B;  3MXG A;  1ASY A;  2UUC L;  3FP9 A;  3SK4 A;  1SYD A;  2ICE C;  4HCS A;  2PZU A;  1Q81 C;  4QMG A;  1XNR L;  1I4H A;  2EYM A;  3F2B A;  1HCZ A;  4JI2 Q;  4IUR A;  3C1F A;  4JG2 A;  5DAU A;  1QOH A;  3EVQ A;  5KYL A;  5JJL A;  1BQQ T;  2DJG C;  5IYB H;  4DU9 A;  2EY5 A;  2F0G A;  2Q2H A;  5LL6 X;  1HQM C;  1L2F A;  3HKZ B;  3HOV B;  4EX5 A;  3S1R H;  2NWG A;  3FEW X;  4DV2 Q;  4XYO A;  4JYA L;  3VR3 A;  1I50 H;  1H9M A;  3E0J A;  5F2D A;  1XNQ Q;  2R7F A;  3AYH B;  2E2I H;  3HOU G;  2UU9 L;  5FKA C;  2XRQ D;  2I07 B;  4X64 L;  3HOY G;  1QE6 A;  1E22 A;  4DR2 Q;  4PZ6 A;  5D3I B;  4RH6 A;  1SYF A;  2X6G A;  4G57 A;  4C2M H;  1A2U A;  4DR4 L;  4K5W A;  4A3M H;  1EEF D;  1V1P B;  3HKS A;  1QZH A;  3DUZ A;  4YWK A;  3PF4 A;  2Y0S E;  5JAV A;  2UXB Q;  4O42 A;  1QB5 D;  2B2V A;  1AZQ A;  3GTP B;  4LFC Q;  1N33 L;  3I4O A;  1PRT D;  3J7A 5;  5I4D A;  1PH8 A;  3P7J A;  2PNR C;  2NVX H;  1WTR A;  1QWY A;  4DNI A;  5KNC A;  2F0Q A;  2RKS A;  4ZKC B;  5CV4 A;  4AYB E;  1LT6 D;  2SDF A;  2L5T A;  3I56 A;  1EU3 A;  1F9S A;  3KBG A;  1DZ1 A;  3I4M H;  3TRZ A;  1STN A;  2L4N A;  2EXD A;  4L63 B;  1D5X C;  3AQQ A;  3KJO A;  2VY3 A;  1TY2 A;  1Y8O B;  1ET9 A;  4HR7 B;  4XTC S;  3F8T A;  2JA8 B;  2EPB A;  3TZU A;  1TU2 B;  3J81 j;  3E9I A;  1MJE A;  2B2Y A;  3VR4 A;  4JI1 Q;  2VQF L;  1Z7T A;  1TWF H;  3DHQ A;  4A3B H;  3S16 H;  1C0A A;  1ZYR D;  5K36 H;  4H02 A;  1B44 D;  5IYC G;  1Y1V H;  2PQA B;  5LL6 S;  2DGY A;  3U9S A;  2UUB L;  4P2C B;  2FXQ A;  3H09 A;  1Z9F A;  2K50 A;  3QO2 A;  3BVG A;  5C4X B;  2Z6K A;  1A6X A;  1Q3L A;  4KLK A;  4DK3 C;  2BE5 C;  2CVR A;  4KY5 A;  3K8A A;  1KAB A;  3U50 C;  4JOI A;  4WFN 3;  1B3A A;  3DWP A;  1EZ6 A;  2IX0 A;  5CMD A;  3BVZ A;  1NY4 A;  2SNM A;  4U67 3;  1EQV A;  3RLO A;  1O78 A;  4JI6 L;  3SK8 A;  2X69 A;  4BA1 I;  3NBI A;  3RZD B;  5EKL A;  5M9O A;  1NE3 A;  4N9P A;  2EE1 A;  2HDM A;  1B9N A;  3JC6 6;  4TQU S;  3V2T A;  3TSS A;  1PTO C;  2X6L A;  4OX9 L;  3D4R A;  5C0X I;  3CQZ H;  2VUM H;  1CKO A;  1X54 A;  3S1N B;  5JEA H;  1AFP A;  5AJ3 Q;  4C3H H;  1WTH A;  2K75 A;  5LMN L;  4UP8 A;  3MXN B;  4K8I A;  5ELC A;  2VB2 X;  3G7L A;  1WI5 A;  4V0B A;  4FXK C;  5E4X A;  5A35 A;  1EFI D;  5A2Q L;  4X66 Q;  2WAQ B;  4JI5 Q;  3J80 E;  4UDU C;  1LYL A;  4KY6 A;  4A93 G;  2TMP A;  5KIX A;  2WP8 J;  4YY3 L;  2JA7 G;  2OQ0 A;  3NTK A;  3RN5 A;  1K8M A;  2Q2U A;  2VQE L;  1FJG Q;  2RDG A;  3T4A C;  3K5N A;  3HP3 A;  4K8J A;  1PH2 A;  1VQ8 A;  3OMG A;  4DAM A;  1JWM D;  3CCL A;  3U4Z A;  2EY2 A;  1PV4 A;  1E2V A;  3UE0 A;  2LXJ A;  5KEE A;  4WJW A;  1SBB B;  2WAQ E;  2F0N A;  3TP5 A;  1IL8 A;  1WTO A;  4BXX G;  4WJ3 M;  3A8K E;  3K5M A;  5JVH 3;  2UXC L;  4NMZ A;  4EQN A;  2DNE A;  4R4C A;  4OO1 H;  1JOK A;  2G5D A;  3PCO B;  1F2Y A;  5M3M B;  4HIK A;  2K33 A;  1CHQ D;  4LNQ A;  3MZ5 A;  1V1O A;  1IXR A;  4IJL A;  2XNA C;  3L0O A;  2JA6 G;  2R6G A;  3GTK H;  1BBU A;  2IX1 A;  1FD7 D;  2EJF C;  1EIH A;  4X65 Q;  2I5L X;  4A3L H;  3FKI H;  3NEM A;  1N33 Q;  2VL6 A;  4S3S A;  2RSN A;  1A3T A;  5HY6 A;  2IWH A;  2ZT9 C;  3CU7 A;  5EBC A;  4KMU C;  2WB1 B;  4QIW B;  3ERS X;  1EY8 A;  4QF4 A;  4MIU A;  3NQT A;  2XRS D;  5EPL A;  2JA9 A;  1SNC A;  3I4N G;  1H9J A;  1A8V A;  2Q8R E;  4CGY B;  1XMQ L;  1H9S B;  2F0L A;  2F3V A;  4RFB A;  4P72 A;  3R8B A;  5EJW A;  2CWA A;  3FRP B;  1UUP A;  3OW2 A;  4MTK A;  4C3I H;  3F2D A;  1Z6H A;  1L0X B;  2VQF Q;  4CKE A;  4HIO A;  4A3J B;  5CGK A;  1HA5 A;  5K5P A;  2F0T A;  1ENA A;  2F3W A;  4QIW E;  4IJH A;  1L1O C;  3S15 B;  1YJN A;  2UUB Q;  5TSS A;  2KA7 A;  2VW9 A;  3T1H L;  5IP7 G;  1NTG A;  3T53 B;  1Y8P B;  3PO2 H;  4RKB A;  4ABN A;  4WOR A;  3GV6 A;  1D1I A;  1R9T H;  2M9V A;  1WTQ A;  2B2T C;  2KED A;  2OEO A;  5JVG 3;  2HHH L;  5ELD A;  2BE5 D;  3K0X A;  2A6E C;  1ML0 D;  3CW2 C;  1U4M A;  1EYG A;  4NB3 A;  1W6J A;  4YHH Q;  1EWI A;  2NVY B;  3G48 A;  3TP8 A;  3G4S A;  3S14 B;  2WKC A;  2YTY A;  2K01 A;  3PUW A;  1EIG A;  5LMN Q;  1B7Y B;  3M4O H;  3TN2 A;  3K6O A;  1U4L A;  4FF2 A;  2KEE A;  1QVF A;  5IT9 E;  1LTI D;  1G91 A;  3C3L A;  1RD9 D;  3CMA A;  1E1O A;  1X3G A;  4LF4 L;  3Q22 A;  4Y52 H;  1FGB D;  2Y0S G;  1KRS A;  4OGQ C;  3L2P A;  3WOF A;  1K8G A;  1PTO H;  3FPU B;  5GQO A;  1PFB A;  2MHV A;  3S24 A;  3RNU A;  2OTL A;  5ELO A;  1SMY C;  1UE6 A;  3T13 A;  2F4V Q;  1N34 Q;  1IBK L;  1E0B A;  2XN9 C;  4IAL A;  2DY8 A;  1A15 A;  2AQ3 B;  3FHW A;  4AYB G;  2XGT A;  1VDZ A;  1SAP A;  3VDY A;  1XMO L;  1B50 A;  3M3Y B;  4DV0 Q;  1Z47 A;  1ET6 A;  1TWA B;  1GUG A;  1B4O A;  2FFK B;  2A68 D;  4DPG A;  4AIM A;  1CFM A;  1VQD A;  2MFI A;  5IYD G;  3AFP A;  4JVZ A;  4NP5 A;  3I72 A;  5IGE A;  2QF7 A;  1J5E Q;  3HOZ G;  1PH1 A;  3HOU B;  2CCZ A;  4GNX B;  3NSW A;  4DGZ A;  1CKN A;  2ENB A;  3HOY B;  1DCZ A;  5J39 A;  1NSN S;  3T51 B;  3T16 A;  2V4D A;  4R1J A;  2ES2 A;  4FF4 A;  5M3F G;  4I65 A;  1CA6 A;  1WOC A;  2GA4 B;  1SRO A;  3GD7 A;  1S72 A;  1PH5 A;  2R61 A;  1HR0 L;  2B63 H;  2FJ2 A;  2V1C C;  5GRO A;  2J7Z A;  5C3E G;  4H44 C;  4BWG B;  3CCE A;  3BVM A;  3SK5 A;  1U5K A;  4DR6 Q;  1NR2 A;  4GOP C;  4BY1 H;  5M5X B;  3OTO Q;  2PW7 A;  2ZJR A;  2L9H A;  4JBW A;  2EIF A;  3W1G A;  3PO3 G;  3SK6 A;  1TWH B;  3A5Z B;  4JI7 L;  4BBR G;  3KLS X;  4H0L C;  3OYY A;  4MZ9 A;  1KQS A;  3DWQ A;  4HMI A;  1XTD A;  2DNC A;  2LKV A;  3KLS A;  5IE8 A;  1CT1 D;  4Q5V A;  4GKK L;  4A3G G;  3H0G H;  1VS0 A;  4MNO A;  3GTM H;  1V43 A;  1EY4 A;  1G8Z D;  1PH9 A;  2Z8L A;  2N88 A;  5CV6 A;  1C48 A;  2OTJ A;  5IOC A;  2A6E D;  2R7Z H;  2GVA A;  2B8F A;  4YCU A;  2CKZ B;  1GUN A;  3I90 A;  4IUQ A;  2QCP X;  4OO1 I;  4A3F H;  3AFQ A;  1Y14 B;  1VF7 A;  1S3O A;  1PYW D;  4LF4 Q;  2FMM A;  4RGO S;  4B3T L;  1S5B D;  2CH4 W;  2B39 A;  3JAM i;  4QY7 A;  4JBJ A;  1F77 A;  1IW7 C;  1YNX A;  4A3I H;  1YIJ A;  1HUM A;  4DR7 Q;  5IGF A;  3MTS A;  4C3J G;  3C1E A;  3NBH B;  1JB3 A;  1Y69 U;  2Z6K C;  2CQO A;  4JI2 L;  1EYA A;  3K7A B;  1MGS A;  4A3D H;  1TWG B;  1SMY D;  5IGB A;  2WKD A;  3NHH A;  4IFD I;  1AE3 A;  2GN5 A;  2BOS A;  5JPN C;  1STG A;  4OIJ A;  2WII B;  1HUN A;  3M9B A;  4DV2 L;  1HQR D;  4ME5 A;  1BOS A;  4A93 B;  2VZA A;  4CKC A;  2JA7 B;  1YBY A;  1XNQ L;  1I6H B;  3GTG B;  1VQA A;  1LTG D;  3HOV H;  2L0C A;  4M8A A;  3STB C;  1U9R A;  2RA4 A;  4DK6 C;  1CHP D;  2A74 C;  3KF6 A;  3E6Z X;  2F0J A;  1AE2 A;  5DLQ E;  1YJW A;  1HZ9 A;  1WCM G;  1MI2 A;  4DR2 L;  3MXU A;  1TS3 A;  2UXD Q;  1NAP A;  2B3G A;  2MGS A;  4J1M A;  1I4P A;  1L1O A;  1PVO A;  1WYD A;  1G6Z A;  5NUC A;  1E24 A;  2QEJ C;  1VF5 C;  4XIG S;  3PUV A;  1X56 A;  2E5L Q;  1S40 A;  4JW0 A;  3OW7 A;  1VQ4 A;  2UXB L;  1N32 Q;  1E1T A;  4IUT A;  3F2C A;  3MEH A;  3HFZ B;  2FHT A;  1HR0 Q;  3J7Y W;  2B2T A;  1P16 A;  4HSV A;  3BYT B;  3BZC A;  3GQB A;  4N9T A;  2JA6 B;  1J9O A;  2AKW B;  3PIO A;  1BCP C;  5C3W A;  5KRU A;  2I46 A;  3PV0 A;  1BDO A;  4K5X A;  3GTP H;  2EYJ A;  1EUJ A;  1W6K A;  2R93 G;  2R92 G;  3VA5 A;  3GTJ B;  3SDZ A;  4HID A;  4IPH A;  5EGT A;  5HGQ A;  3UE1 A;  5ISR A;  4DA2 A;  4FO2 A;  3MWY W;  1VMP A;  3RLF A;  3I4N B;  1VQI A;  5FJ8 H;  3R2T A;  1BNZ A;  2OXP A;  3CP0 A;  2NBF A;  3VR6 A;  2JEA I;  1QJO A;  1VQJ A;  1EWC A;  4QGU A;  4GKK Q;  3PUY A;  4KTA A;  1CM9 A;  5COR A;  2K04 A;  1K3B C;  2CHB D;  1XJV A;  2RQX A;  3I70 A;  2K5N A;  4XDX A;  4Y7N B;  2K1B A;  3QWN A;  3A74 A;  5A2Q E;  1KXL A;  4DV6 Q;  3FPP A;  2NZH A;  4TKO B;  4OWW B;  2A19 A;  1HZB A;  1Y8N B;  2KHI A;  2AUK A;  1AEX A;  4DNT B;  1I5F A;  3RZO B;  1G2S A;  3F2U A;  2LY7 A;  5C4X H;  2MO0 A;  1X3E A;  3IKJ A;  1JCK B;  1TS2 A;  3PUZ A;  4KD4 A;  3GTQ B;  2EJG C;  1BO0 A;  3NWT A;  1W2B A;  4IUP A;  5EAY A;  5C4J B;  5CV8 A;  4ME3 A;  1RJT A;  2B2W C;  2NTT A;  4JK1 C;  5IP9 G;  5AJ3 L;  4LF8 L;  3ND8 A;  1SEB D;  3NK9 A;  2RBM A;  3RZD H;  1V1P A;  2OQK A;  4X66 L;  4XYQ A;  5CBE E;  4JI5 L;  3U9O A;  1PRT F;  1PH3 A;  3KF8 B;  3S1N H;  3LWE A;  1ICW A;  1PA6 A;  1XYI A;  4HAE A;  2EYL A;  2E8G A;  5KNB A;  5C44 G;  1FJG L;  4K0K Q;  5C5M A;  2F0I A;  4R4I A;  2KEC A;  4FXG C;  4BA2 I;  1YHB A;  3S17 B;  3A7L A;  2HUG A;  2XSC A;  1MBY A;  3D4W A;  4ID6 A;  1QUQ B;  3CF5 A;  2WV6 D;  2Y0S B;  1HHV A;  4R4T A;  1K83 B;  2D5D A;  4IOC A;  3LGJ A;  2A6H C;  2M00 A;  1XPU A;  1YNJ C;  2ZTC A;  1BF4 A;  4GOP A;  5IGD A;  1SE3 A;  3TEH B;  3STB D;  1TQO A;  4A3E G;  3KDF B;  1SYE A;  4AYB B;  2WFW A;  2JSO A;  3PSI A;  3HG9 A;  3C46 A;  5M3M H;  4X65 L;  4QB4 A;  3TME A;  4PZ7 A;  5FO7 B;  3E5S A;  2C5C A;  4HMJ A;  3K58 A;  3U4V A;  3E0E A;  4OHJ A;  1OO9 B;  4FF3 A;  2JYO A;  3Q6S A;  4G4K A;  1BR9 A;  4E6I A;  2XIW A;  3MC0 B;  3HOZ B;  2E76 C;  4GN4 B;  4FVM A;  1M8A A;  5BN4 A;  1BCP D;  1E2W A;  1FVI A;  3MXN A;  5E4W C;  1JIC A;  1EQR A;  1JQY D;  3NUC A;  1I6V C;  4BY7 G;  4CDC C;  4X6A H;  4EQO A;  2N8N A;  4C56 C;  4LF5 Q;  4A3C H;  4IQZ A;  5M3F B;  5LMN W;  3BJU A;  3ONA B;  1I4G A;  3D4D A;  5I2X A;  4IPD A;  1SYC A;  5C3E B;  1E7Z A;  4YIJ A;  4A3J H;  1X3F A;  2K5V A;  3CCS A;  4L5R C;  2YU9 B;  1OXV A;  2HCI A;  2QDL A;  1VMC A;  3S15 H;  4MTN A;  2OT2 A;  1IHZ A;  3NEN A;  1PFN A;  3HRZ C;  4FDB A;  4J6H A;  1WFQ A;  4RCO A;  2K5W A;  3PO3 B;  4X3U A;  4FYD A;  4BBR B;  2ZTE A;  1CA5 A;  4YHH L;  1KDC A;  2EQS A;  4QCL A;  1LTR D;  4I7A A;  4LMQ D;  1KNE A;  2KUM A;  2N49 A;  5CYU A;  1O7Y A;  3JAM E;  4LF8 Q;  2BCO A;  4A3G B;  1Q82 C;  1AZP A;  3Q0A A;  3M4P A;  4DAP A;  2NVY H;  3H94 A;  3S14 H;  1XWE A;  3M4Q A;  5FO8 B;  2JJQ A;  4G7H C;  4QJF A;  2VB3 X;  1TS5 A;  2IL8 A;  2G9D A;  3AEV A;  2OWO A;  3CRK C;  2F4V L;  3J7A V;  1N34 L;  2CWP A;  3NQI A;  4A3K G;  4KKU A;  1LT3 D;  2QW7 A;  2YTV A;  4DR5 Q;  1I50 B;  1CQV A;  5BR8 Q;  1LAC A;  2KVM A;  1H9S A;  1GD7 A;  1JE5 A;  3EBE A;  4DV0 L;  1A3V A;  1JJG A;  4C3J B;  2KQ3 A;  4QL5 A;  1EY6 A;  2L12 A;  3K0Y A;  2WIN B;  5J1Z A;  1C7Y A;  5EPK A;  5IGG A;  1P8L A;  1S5F D;  3M3Y H;  1HNZ Q;  1KIX A;  1C4Q A;  3A7A B;  3QOJ A;  2EYO A;  2EOT A;  4NDX A;  3MFG A;  1YHQ A;  1DXM A;  1GUS A;  1TWA H;  1IYV A;  1IBL Q;  1SE8 A;  1STY A;  4H7B A;  5C3X A;  4DV1 Q;  1J5E L;  3SEB A;  5IY0 A;  2IT1 A;  1KAA A;  1AW7 A;  3H3V H;  2MP1 A;  4GN3 B;  5C0X J;  4HIM A;  1ESR A;  3BDL A;  3AU7 A;  2MNA A;  3G6E A;  2E2D C;  4IFD H;  1OXU A;  2NN6 I;  1WCM B;  2K32 A;  4IUV A;  3ULP A;  3CCQ A;  3A5U A;  3HOU H;  5ELE A;  1EFW A;  1JR0 D;  3HOX G;  2PZW A;  3BZK A;  4HSP A;  3NXW A;  1PTO F;  2Z6B A;  2Q2T A;  3HOY H;  1YHA A;  2E2J B;  4M1U B;  3E9H A;  1PRT B;  3RD4 A;  5DEH A;  3MFY A;  4PQX A;  4B08 A;  4DR6 L;  1B70 B;  3QB3 A;  1N36 Q;  3O13 A;  1EQT A;  2LXK A;  3OTO L;  3V96 A;  4ULL A;  2B2W A;  1JOR A;  3I55 A;  4DR1 L;  3EJI A;  5HUR A;  4KD3 A;  2RHS B;  4CBV A;  1QG7 A;  1B1Z A;  1VQ5 A;  2K05 A;  1K0R A;  2PI2 A;  2HDL A;  4CDE C;  3ZYY X;  1CUK A;  4K2L A;  2R7D A;  3W1B A;  3TP6 A;  3CCU A;  2R93 B;  2R92 B;  3CPF A;  1NR4 A;  1TWH H;  5FK9 C;  4X3K A;  4FNF A;  1ZEQ X;  2IY5 B;  2EY6 A;  1ILP A;  2F4I A;  1HPC A;  4RWS C;  1N9W A;  1HFN A;  1EY9 A;  1IKM A;  4DV3 Q;  2KCM A;  3HS0 C;  4AQY L;  4GLX A;  1DYQ A;  1TII D;  3CME A;  3OPO A;  1PTO D;  3HOW G;  1SN8 A;  5G3L F;  5CV5 A;  4IPG A;  4XT1 B;  2A8V A;  2AUJ D;  2XVS A;  4RHR A;  4ZYS A;  1X9N A;  4A4I A;  3R2I A;  4RAU C;  2O5I C;  5IYC H;  3RN2 A;  5EQ0 A;  1VQ7 A;  1CSP A;  1EQQ A;  1HNW Q;  3DMU A;  3EA6 A;  1SRU A;  3OSO A;  2C35 B;  3K5O A;  1SYB A;  4HJ8 A;  4KN4 C;  4JPB W;  2JN4 A;  1FNU A;  4GNX A;  1Q86 C;  2L1B A;  4DR7 L;  5C0X G;  4WJ4 A;  3JAM L;  4H13 C;  1KL9 A;  3QOL A;  2YYZ A;  5BN3 A;  3OMC A;  3VYR A;  2PCF B;  5DM7 3;  1DM0 B;  1STA A;  2BDO A;  5COY A;  2B29 A;  3ITP A;  5M5W B;  3R93 A;  1BKB A;  3HZX A;  3I7F A;  1SMX A;  2NVT B;  1QCB D;  2H4O A;  3A0J A;  1IBM Q;  3HGB A;  5FO9 B;  1KNA A;  3K7A H;  2DN8 A;  5D65 A;  3KJP A;  2UUA Q;  1TWG H;  4LUV A;  4OEL B;  4Q0F A;  3ER0 A;  3ND9 A;  5C44 B;  1IKL A;  1WTW A;  5E7N A;  2JXM B;  2Z1C A;  3D6C A;  4CDF C;  1HR0 W;  1EYC A;  4TSS A;  4DNR B;  3LX0 A;  1CK1 A;  5AFW A;  5G3L D;  4A93 H;  2UXD L;  3PQI A;  4LF9 L;  4K2K A;  2JA7 H;  4I7Z C;  1ONL A;  2JA5 G;  1Q1B A;  2Q8I B;  3J7A F;  4B3R Q;  1I6H H;  3GTG H;  4PMC A;  5EBD A;  3T1Y L;  4K14 A;  2K52 A;  1JB7 A;  1TXY A;  1OXS C;  2EYP A;  2E5L L;  2I5M X;  2RF4 A;  4KK7 A;  5I2Y A;  5I6W A;  4BBS G;  2BDN A;  4CJ0 B;  1SNQ A;  4RMF A;  3IFT A;  5M5Y B;  2ZJP A;  1LT5 D;  4A3E B;  1N32 L;  1H95 A;  1B3Q A;  1F9Q A;  1NCV A;  3VA7 A;  4BXX H;  2F0S A;  2DUD A;  5FLM G;  5T1I A;  3TRE A;  1HH2 P;  3DXJ C;  1MSH A;  4HJ9 A;  1GHK A;  3GTO B;  1HJP A;  1MJC A;  3SHL A;  4G7O C;  1JOO A;  4RCN A;  1Y1W G;  1HTL D;  1RCV D;  4J8Q A;  4QQB X;  4B3S Q;  4DR1 Q;  2PW5 A;  3I3C A;  5EPJ A;  3P1H A;  4HJ7 A;  3BDO A;  3RR5 A;  1ROD A;  1S4Z A;  3P20 A;  2JA6 H;  1UEA B;  4JBM A;  2ALY B;  1EWH A;  5E1F A;  4OWT B;  2EXZ A;  2KBN A;  4R4Q A;  2RSO A;  1EIF A;  3JAM c;  4KHP Q;  3GTJ H;  4RKL A;  2PNH A;  3GO5 A;  3TDQ A;  4P71 A;  1PZI D;  3P75 A;  1KAW A;  5CV9 A;  1AN8 A;  2HIX A;  1WTV A;  3DWA A;  1ICF B;  4IOA A;  4R9W A;  1WD0 A;  4BY7 B;  5T1G A;  3QR8 A;  4UHV A;  4DV6 L;  1ZXT A;  1A62 A;  4PMB A;  4XXE A;  3BZD B;  2N3S A;  5I9P A;  4AQY Q;  3BU2 A;  1GJX A;  4XQJ A;  4DAV A;  2RDH A;  4Y7N H;  1HZC A;  4MN3 A;  1I4R A;  5IYB G;  3D31 A;  2K5D A;  4JI0 Q;  3CC4 A;  4KKT A;  2F0D A;  1GM5 A;  1KDB A;  2FIN B;  2A69 C;  1HA6 A;  4DAY A;  2O2L D;  1GHJ A;  3CC7 A;  3RZO H;  5IP7 H;  5C5L A;  4NXM Q;  4P73 A;  4K5V A;  1N8R C;  1SR3 A;  5C4Z A;  1EYD A;  1G51 A;  3GTQ H;  3E3X A;  3H3V I;  2K6A A;  5C4J H;  1ENF A;  1PTO B;  3DLL A;  3S9W A;  1QZG A;  5J22 A;  4LF6 Q;  1YZ6 A;  1VQ6 A;  2K5H A;  5JEA J;  1SFO B;  3KOJ A;  3UDX A;  2QA4 A;  4K0K L;  3S2D B;  3ULL A;  3NTI A;  1SE2 A;  4HJ5 A;  2KHS A;  1D7Q A;  1UE1 A;  5ELB A;  4A3M G;  1BXT A;  2PYK A;  1JMC A;  5JJK A;  2P5Z X;  4DN4 M;  1Q7Y C;  5HGT A;  3S2H B;  2JEB I;  1JJ2 A;  1ASZ A;  1CKM A;  2MO1 A;  3TQY A;  1RIP A;  1A2T A;  1GXD C;  3S17 H;  1EOV A;  4CHT B;  4DR3 Q;  1CI3 M;  1STE A;  3M85 A;  4LF9 Q;  2NVQ B;  4A3K B;  2C9O A;  3Q23 A;  2JK8 A;  3T1Y Q;  1QVC A;  1SXT A;  3I4M G;  1K83 H;  2Z4H A;  4FXD A;  1PZK D;  3J81 i;  4NKL A;  2SOB A;  3PIO 3;  3MA2 B;  5D14 A;  4GKJ Q;  4PV1 C;  3S1Q B;  4N8F A;  3B6Y A;  3OOC A;  2F0F A;  2AMC B;  4A3B G;  2K14 A;  4LAA A;  5K36 G;  5GAE C;  1Y1V G;  1H9K A;  1K73 C;  2HD3 A;  2VXW A;  1EY7 A;  1VQG A;  4UPA A;  4K6L A;  4GLA C;  4DV4 Q;  1JT8 A;  3ERO A;  4OL7 A;  1I3Q B;  1VQF A;  1WTP A;  1XPO A;  5IYD H;  3NE5 B;  1VQB A;  4KHV A;  3SR1 A;  3BDC A;  4LJZ C;  1DD2 A;  1Q12 A;  4IFD J;  4LFB Q;  4GLV B;  1Q46 A;  2HQL A;  2HIV A;  2ID0 A;  3ERQ A;  1BBW A;  1LM0 A;  4LFA Q;  1MHW C;  4LF5 L;  3HOX B;  3DM3 A;  4C1N K;  5FLX L;  1SJH D;  3FDT A;  5I9O A;  4ZK9 B;  2JA8 H;  1DON A;  3H15 A;  4KKS A;  3AB9 A;  2VUM G;  5IOD A;  1VQC A;  5JEA G;  4C3H G;  4JV5 L;  3EIV A;  1ZYR C;  1AP0 A;  4DV5 Q;  2NYZ D;  2QDB A;  2YTX A;  2EZV A;  2L15 A;  5CBA E;  5M3F H;  2NN6 H;  1QUQ A;  1F9P A;  5C3E H;  1T5X D;  5E3F A;  1MD2 D;  3MHB A;  4IPC A;  1T9H A;  3NPP A;  2F0M A;  2NB0 A;  1D1K A;  3OHX C;  1WD1 A;  4WRD A;  4L5Q A;  1W3S A;  5FOB B;  4EQP A;  3CKI B;  3KDF A;  3QG1 A;  2CQA A;  1VQM A;  3PO3 H;  4PNY A;  2RDF A;  3TS0 A;  4BBR H;  1IZ6 A;  3TZD A;  3W5O A;  1YI2 A;  1IW7 D;  4A3G H;  2ASB A;  1TT2 A;  2NTS A;  2HQE A;  3GTL B;  2F3I A;  4OO1 G;  3HOW B;  1V1Q A;  2YV5 A;  2ATW A;  1X65 A;  2IJ0 A;  1M90 C;  2XWB B;  1LTS D;  2Q8T A;  2A73 B;  1UWV A;  1ILQ A;  2NUC A;  1TS4 A;  1BCP F;  2O5J C;  2JE6 I;  3NP8 A;  4DR5 L;  1D5M C;  3W2D A;  3CAM A;  4A3L G;  3FKI G;  5BR8 L;  2F0H A;  1NNX A;  4GS3 A;  3VR5 A;  3PIP A;  3H3V C;  5L37 A;  3I4L A;  1TVX A;  2GVB A;  4F8M A;  4R4O A;  3GV3 A;  4IFD G;  1UE7 A;  5FLX c;  4C1N I;  1KHI A;  2ZM6 L;  3VYU A;  4J15 A;  1VQO A;  1HNZ L;  4IZ8 A;  2PQA A;  3L9A X;  4F88 A;  2F03 A;  2F1M A;  4RA8 A;  2ZXO A;  1CZW A;  4C3J H;  4ODG A;  4DUZ Q;  2PQE A;  2QGQ A;  4GNX C;  4LF7 Q;  2F0U A;  2A1A A;  3HEJ A;  1NMF A;  3BS1 A;  1IBL L;  1O80 A;  4HN7 A;  2Z4I A;  4DV1 L;  3D8G A;  4ZKB B;  4C3I G;  5JOB A;  3HKZ E;  2ZXP A;  1TWC B;  3OWE B;  1XTC D;  1SNP A;  3DM1 A;  2F0W A;  4JI8 Q;  1NJI C;  2XWJ B;  1JOQ A;  2JA5 B;  4LW1 A;  3X3N A;  3PO2 G;  4ALP A;  1XXG A;  1PYB A;  3R3O A;  4ZRZ A;  1WCM H;  4BBS B;  2AWN A;  1FYC A;  1PXU A;  5IWA Q;  4FF1 A;  1N36 L;  3KFU A;  1PFM A;  1OTC A;  3PGZ A;  4DUY Q;  2E2J H;  2Z0S A;  1WTX A;  1PYS B;  4JV5 Q;  2LS0 1;  3S1M B;  2G9H D;  4EGV A;  4UP7 A;  1JWS D;  2A5H A;  4GOP B;  2EJM A;  4PZ8 A;  2MPM A;  4ZLT F;  1Y1W B;  1O7I A;  4B3M Q;  4JI4 Q;  4LUZ A;  1G2T A;  1EL0 A;  2L55 A;  4IUU A;  2PZT A;  4K6D A;  3M4Y A;  1RTO A;  1U4P A;  4GZY C;  2R93 H;  1X32 A;  1E3P A;  2R92 H;  4DV3 L;  2E2H B;  1CQF A;  1UNS A;  2R3Z A;  2IHF A;  5JJI A;  2K28 A;  4ZCK A;  1RKN A;  4RG1 A;  2K5Q A;  1JC7 A;  1RF2 D;  4P75 A;  4MHE A;  5ELF A;  3BYY B;  1DOM A;  1SLJ A;  3FVQ A;  5JJZ A;  3LWU A;  3VYT A;  3IAY A;  1VQE A;  2F0E A;  1OXX K;  1LV9 A;  4HCE A;  1HNW L;  5LMU Q;  1SJE D;  2KOL A;  4DV7 Q;  1G6P A;  4BS9 A;  1VCI A;  2KHJ A;  1D2B A;  2HT1 A;  2BA0 A;  1J8I A;  2UUC Q;  4DXF A;  5ELN A;  2KJX A;  1GKH A;  1XNR Q;  3S1R B;  1PH4 A;  4PG3 A;  2ZJQ A;  4L8J A;  1LTA D;  3DEP A;  4LWC A;  1IYU A;  3KUP A;  1V9P A;  4QUC A;  4NW2 A;  4O0A A;  3A54 A;  4KI0 A;  2FMC A;  2E2I B;  3URY A;  4N8X 1;  3Q8D A;  4CDD C;  3V05 A;  1IBM L;  4ZQ3 A;  4JYA Q;  4A75 A;  5IP9 H;  4L5T A;  2UUA L;  3A8I E;  4KV6 A;  2A6H D;  3AMU A;  2H5X A;  1YNJ D;  4DK0 A;  5M5W H;  2ICI A;  1OXT A;  2ZM6 Q;  3EN2 A;  2BH2 A;  4KN7 C;  4C2M B;  3J81 E;  1R4Q B;  4LUO A;  2UU9 Q;  2NVT H;  3WOE A;  4DKA C;  1GUO A;  1STB A;  3TBI B;  1S5C D;  4P74 A;  4X64 Q;  3CD6 A;  4X62 L;  4A3M B;  2B63 G;  1K8O A;  1K8A C;  2A68 C;  4Z9C B;  5C44 H;  4B3R L;  2AHO B;  1K0S A;  1PFS A;  1K9M C;  4YWL A;  3OWF A;  4RGT A;  4YCV A;  4BY1 G;  3G71 A;  4DR4 Q;  4NPS A;  3VR2 A;  5BN5 A;  1DOK A;  2EYF A;  3FMC A;  3GP7 A;  2NVX B;  3W3A A;  4XT3 B;  2D9U A;  2E75 C;  4GN5 A;  3MVV A;  1QNU A;  1HXY D;  3IRB A;  2I0Q A;  2CH4 A;  1K3R A;  3ICE A;  4RGN A;  1BBX C;  3I4M B;  1PLF A;  2K7V A;  3CXC A;  1PDQ A;  2IHE A;  5DM6 3;  5M5Y H;  1FNV A;  2B2U A;  3NTH A;  4A3E H;  3H0G G;  4DF7 A;  4POG A;  1EU4 A;  1JWU D;  1KD1 C;  4B3S L;  2RVL A;  3OIQ A;  2ZXR A;  3MEF A;  1FGU A;  1TWF B;  4FP5 D;  4UY8 C;  4OON A;  3SGI A;  4A3B B;  3S16 B;  2IPK D;  3GTO H;  1ESF A;  1Y1V B;  2R7Z G;  2KCC A;  4B9W A;  1A0I A;  1BCP B;  1O7L A;  5M5X H;  3M7G A;  1Q1E A;  2L11 A;  2MJ8 A;  1XPR A;  2JQO A;  3NEL A;  4KHP L;  4A3F G;  1G29 1;  3I8Z A;  5C6A A;  3C2P A;  2WB1 E;  1FNW A;  1UAP A;  4R8I A;  3CCJ A;  2QKI C;  3I91 A;  1LAB A;  2F0O A;  2EYH A;  1LTL A;  4A3I G;  1EY0 A;  1SYG A;  2K4K A;  1U4R A;  3IFD A;  1C9O A;  2TSS A;  2VNU D;  2D62 A;  3D3R A;  3Q24 A;  3A8J E;  4HJA A;  5KGU A;  1LTB D;  4ZUJ A;  1GVP A;  3VYS A;  3TS2 A;  4CKB A;  1X55 A;  3KLW A;  3CQZ B;  1YNN C;  2VUM B;  1YVC A;  4C3H B;  4A3D G;  4KJO A;  2D0P A;  1KDA A;  3RUZ A;  4BY7 H;  2KEN A;  4V19 0;  4JI6 Q;  1MKH A;  4JI0 L;  3SE0 A;  3UI2 A;  2XTI A;  1YIT A;  1H9R A;  4OWX B;  4OX9 Q;  2D2C C;  2ZTD A;  3UDF A;  4NXM L;  4IUN A;  1ENC A;  5CC4 A;  3A56 A;  2NZO A;  2IX3 A;  1I94 L;  1PHJ A;  1HFG A;  1L0Y B;  3HKZ G;  3HOV G;  1UEB A;  4YWM A;  2AWO A;  1M1K C;  3CCM A;  3QIA A;  4LF6 L;  4CJ2 C;  1FR3 A;  1PH7 A;  4YY3 Q;  1WJJ A;  2VQE Q;  1EOT A;  3K80 C;  2IW3 A;  1RDP D;  2CW0 C;  4DFA A;  1VQH A;  3LNN A;  1EEI D;  1SFO H;  4OIK A;  2LFN A;  3QJY A;  1I4Q A;  1CTM A;  4DK1 A;  3S2D H;  3CC2 A;  5EKI A;  1YEZ A;  1LO5 D;  4YCW A;  1BVS A;  1SDF A;  1HZA A;  4UP9 A;  1AH9 A;  1ZKO A;  4DR3 L;  4X62 Q;  1RTN A;  3J80 L;  3K7U C;  1GO3 E;  2CFM A;  2UXC Q;  1B53 A;  1V8Q A;  2RCF A;  3S2H H;  2EY1 A;  3GTK B;  2PI2 E;  1Q90 A;  4JC0 A;  5H1S E;  3GDE A;  4F87 A;  3N52 A;  1DJR D;  3FKI B;  4R8N A;  1IL2 A;  3KK7 A;  3IL8 A;  2NVQ H;  4A3K H;  1RHP A;  4GKJ L;  4HED A;  1QNK A;  1PZJ D;  1F2Z A;  1EIY B;  5I6Y A;  1SNO A;  3J81 L;  2BA1 A;  5FJ8 G;  3I2Z A;  3K59 A;  1A63 A;  5FLX E;  1HRJ A;  1QIL A;  2EVB A;  1BUV T;  4ILW A;  4POF A;  3SVM A;  2VS1 A;  4O2D A;  3RMH A;  2JA8 G;  1JJC B;  2PMZ B;  3S1Q H;  3N6R A;  2LMC B;  5IIF A;  5J3B A;  4APV A;  3KBX A;  2D0O A;  4C3I B;  4DV4 L;  3D6W A;  4X3T A;  1II3 A;  1XMQ Q;  4JBK A;  1J6Q A;  2NN6 G;  1KC8 C;  2DJF C;  4XQN A;  4LFB L;  2LSS A;  4TVA B;  2F52 A;  1NUC A;  5C4X G;  3NBH A;  1LLR D;  1QVG A;  4IN3 A;  4LFA L;  3PO2 B;  1IYJ B;  1I3Q H;  1SSO A;  2F0P A;  1YJ9 A;  2PMZ E;  2H1E A;  1GUT A;  2K03 A;  3H91 A;  5IGC A;  1CSQ A;  3U58 A;  2I5H A;  2N78 A;  3T1H Q;  5CV7 A;  3I4N H;  1R9T B;  1VQ9 A;  2F0V A;  4DV5 L;  4DXG A;  5GAG C;  1X3P A;  3EQL C;  1MSG A;  3L7Z C;  3A55 A;  3HOX H;  1B2T A;  2OF1 A;  4OEM B;  1A3U A;  1VQK A;  2B2V C;  1KRT A;  2O4X A;  1CKN B;  4EVO A;  3EFX D;  1HNX L;  3J7Z C;  3M4O B;  3NWS A;  4JI3 L;  2EDG A;  2HHH Q;  3MAQ A;  1LUZ A;  3J80 c;  1X3Q A;  2WAQ G; 
#chains in the Genus database with same CATH homology
 5CR3 A;  2SNS A;  1YNN D;  3T56 B;  1EZ8 A;  1KLG D;  3OIP A;  3CHB D;  2J4X A;  3SXH A;  4PMW A;  2DY7 A;  1B9M A;  4UAI A;  1SE4 A;  2B2Y C;  2HCC A;  3DEO A;  3PUX A;  1HTP A;  3KLR A;  1SNM A;  1KLU D;  1T5E A;  4KY7 A;  1EY5 A;  1D5Z C;  2CW0 D;  2AQ2 B;  1Q8I A;  5DNF A;  5IT9 L;  1STH A;  4LK1 C;  5D3D A;  4KJN A;  1DOL A;  5KND A;  1S5E D;  5C4H A;  4QUF A;  1KTK A;  2AQ1 B;  2QIL A;  2WAC A;  5KYI A;  2B8G A;  5C0X H;  5LHY 1;  3MXP A;  5EKK A;  2F0K A;  3G6J B;  1E2Z A;  1F2M A;  1PRT C;  2B63 B;  4O1N A;  4U68 A;  4F7X A;  3X3M A;  2SEB D;  4BY1 B;  2PO4 A;  4RHS A;  3TP7 A;  3M7N A;  3K57 A;  1CZG A;  3CRL C;  3KF8 A;  2N55 A;  1M4V A;  3WDN A;  1R4P B;  4HTH A;  3PMF A;  1SND A;  4ZAI A;  4CJ1 B;  2JP1 A;  4X3S A;  2J0T D;  3H0G B;  3GTM B;  3I73 A;  2E74 C;  5JPM C;  4ZUI A;  4TRD A;  2M2L A;  1WVL A;  1D6E C;  1PMR A;  2R7Z B;  3K5L A;  2B2U C;  4KHZ A;  4A3F B;  1F2L A;  3BG3 A;  1GOZ A;  1O7Z A;  3L3O C;  2KCN A;  4XQQ A;  1LT4 D;  1F9R A;  4RGM A;  1JE4 A;  1C8C A;  1XX8 A;  2A69 D;  2PPB C;  4G7Z C;  1TKW B;  1I4X A;  1TY0 A;  4L6T B;  1LTT D;  4A3I B;  1TR5 A;  3H6M A;  4B9X A;  1GUW A;  2NZ1 D;  2MUY A;  3PIP 3;  1S5D D;  4A3D B;  3MXG A;  3SK4 A;  1SYD A;  2ICE C;  4HCS A;  2PZU A;  4QMG A;  1I4H A;  2EYM A;  1HCZ A;  4IUR A;  3C1F A;  5DAU A;  1QOH A;  3EVQ A;  5KYL A;  1BQQ T;  4DU9 A;  2EY5 A;  2F0G A;  5LL6 X;  1HQM C;  3HKZ B;  3HOV B;  2NWG A;  3FEW X;  4XYO A;  3VR3 A;  1H9M A;  3E0J A;  5F2D A;  5FKA C;  2XRQ D;  2I07 B;  1QE6 A;  5D3I B;  4RH6 A;  1SYF A;  2X6G A;  4G57 A;  1A2U A;  4K5W A;  1EEF D;  1V1P B;  3DUZ A;  5JAV A;  4O42 A;  1QB5 D;  2B2V A;  1AZQ A;  3GTP B;  1PRT D;  5I4D A;  3P7J A;  2PNR C;  1WTR A;  1QWY A;  5KNC A;  2F0Q A;  2RKS A;  4ZKC B;  5CV4 A;  1LT6 D;  2SDF A;  2L5T A;  1EU3 A;  1F9S A;  3KBG A;  1DZ1 A;  1STN A;  2L4N A;  4L63 B;  1D5X C;  1TY2 A;  1Y8O B;  1ET9 A;  4HR7 B;  4XTC S;  2JA8 B;  2EPB A;  3TZU A;  1TU2 B;  2B2Y A;  3VR4 A;  1Z7T A;  3DHQ A;  1ZYR D;  5K36 H;  1B44 D;  5LL6 S;  3U9S A;  4P2C B;  3H09 A;  3QO2 A;  3BVG A;  5C4X B;  1A6X A;  1Q3L A;  2BE5 C;  2CVR A;  4KY5 A;  4WFN 3;  1KAB A;  1B3A A;  3DWP A;  1EZ6 A;  2IX0 A;  5CMD A;  3BVZ A;  2SNM A;  4U67 3;  1EQV A;  1O78 A;  3SK8 A;  2X69 A;  4BA1 I;  3NBI A;  3RZD B;  5EKL A;  5M9O A;  4N9P A;  2EE1 A;  2HDM A;  1B9N A;  4TQU S;  3V2T A;  3TSS A;  1PTO C;  2X6L A;  3D4R A;  5C0X I;  1AFP A;  3S1N B;  5JEA H;  4K8I A;  5ELC A;  2VB2 X;  3G7L A;  4V0B A;  4FXK C;  5E4X A;  5A35 A;  1EFI D;  5A2Q L;  2WAQ B;  3J80 E;  4UDU C;  4KY6 A;  2TMP A;  5KIX A;  2WP8 J;  3NTK A;  1K8M A;  2RDG A;  3T4A C;  3K5N A;  3HP3 A;  4K8J A;  3OMG A;  1JWM D;  2EY2 A;  1E2V A;  5KEE A;  4WJW A;  1SBB B;  2F0N A;  3TP5 A;  1IL8 A;  1WTO A;  3A8K E;  3K5M A;  5JVH 3;  4NMZ A;  4EQN A;  2DNE A;  4OO1 H;  1JOK A;  5M3M B;  1F2Y A;  2K33 A;  1CHQ D;  3MZ5 A;  1V1O A;  2XNA C;  2R6G A;  2IX1 A;  1FD7 D;  2EJF C;  1EIH A;  4S3S A;  2RSN A;  1A3T A;  2IWH A;  2ZT9 C;  3CU7 A;  5EBC A;  4KMU C;  2WB1 B;  4QIW B;  1EY8 A;  4QF4 A;  4MIU A;  3NQT A;  2XRS D;  5EPL A;  1SNC A;  1H9J A;  2Q8R E;  4CGY B;  1H9S B;  2F0L A;  2F3V A;  4RFB A;  3R8B A;  5EJW A;  3FRP B;  1UUP A;  1Z6H A;  1L0X B;  4CKE A;  4A3J B;  5CGK A;  1HA5 A;  5K5P A;  2F0T A;  1ENA A;  2F3W A;  3S15 B;  5TSS A;  2KA7 A;  3T53 B;  1Y8P B;  4RKB A;  4ABN A;  4WOR A;  3GV6 A;  1D1I A;  2M9V A;  1WTQ A;  2B2T C;  2KED A;  2OEO A;  5JVG 3;  5ELD A;  2BE5 D;  2A6E C;  1ML0 D;  1U4M A;  1W6J A;  2NVY B;  3TP8 A;  3S14 B;  2WKC A;  2K01 A;  3PUW A;  1EIG A;  3TN2 A;  3K6O A;  1U4L A;  4FF2 A;  2KEE A;  5IT9 E;  1LTI D;  1G91 A;  3C3L A;  1RD9 D;  3Q22 A;  1FGB D;  4OGQ C;  3WOF A;  1PTO H;  3FPU B;  1PFB A;  2MHV A;  1SMY C;  3T13 A;  1E0B A;  2XN9 C;  4IAL A;  2DY8 A;  1A15 A;  2AQ3 B;  1VDZ A;  1SAP A;  1B50 A;  3M3Y B;  1Z47 A;  1ET6 A;  1TWA B;  1GUG A;  1B4O A;  2FFK B;  2A68 D;  1CFM A;  4NP5 A;  3I72 A;  5IGE A;  2QF7 A;  3HOU B;  3NSW A;  4DGZ A;  2ENB A;  3HOY B;  1DCZ A;  5J39 A;  1NSN S;  3T51 B;  3T16 A;  2V4D A;  4FF4 A;  4I65 A;  1CA6 A;  2GA4 B;  3GD7 A;  2R61 A;  2FJ2 A;  2J7Z A;  4H44 C;  4BWG B;  3BVM A;  3SK5 A;  1NR2 A;  5M5X B;  2PW7 A;  2L9H A;  4JBW A;  3SK6 A;  1TWH B;  3KLS X;  4H0L C;  3DWQ A;  4HMI A;  2DNC A;  2LKV A;  3KLS A;  1CT1 D;  4Q5V A;  1V43 A;  1EY4 A;  1G8Z D;  2N88 A;  2Z8L A;  5CV6 A;  1C48 A;  5IOC A;  2A6E D;  2B8F A;  1GUN A;  3I90 A;  4IUQ A;  2QCP X;  4OO1 I;  1VF7 A;  1PYW D;  2FMM A;  4RGO S;  1S5B D;  2B39 A;  1F77 A;  1IW7 C;  1HUM A;  5IGF A;  3MTS A;  4C3J G;  3C1E A;  1JB3 A;  1Y69 U;  1EYA A;  3K7A B;  1MGS A;  1TWG B;  1SMY D;  5IGB A;  2WKD A;  3NHH A;  4IFD I;  2BOS A;  5JPN C;  1STG A;  4OIJ A;  2WII B;  1HUN A;  1HQR D;  4ME5 A;  1BOS A;  4A93 B;  4CKC A;  2JA7 B;  1I6H B;  3GTG B;  1LTG D;  2L0C A;  4M8A A;  1U9R A;  2RA4 A;  1CHP D;  2A74 C;  3E6Z X;  2F0J A;  1MI2 A;  3MXU A;  1TS3 A;  1NAP A;  2MGS A;  4J1M A;  1I4P A;  1G6Z A;  5NUC A;  2QEJ C;  1VF5 C;  4XIG S;  3PUV A;  3OW7 A;  4IUT A;  3MEH A;  2FHT A;  3J7Y W;  2B2T A;  4HSV A;  3BYT B;  3GQB A;  4N9T A;  2JA6 B;  1J9O A;  1BCP C;  5C3W A;  5KRU A;  2I46 A;  3PV0 A;  1BDO A;  4K5X A;  2EYJ A;  1W6K A;  3VA5 A;  3GTJ B;  3SDZ A;  5EGT A;  5ISR A;  4DA2 A;  4FO2 A;  3MWY W;  1VMP A;  3RLF A;  3I4N B;  3R2T A;  1BNZ A;  2OXP A;  2NBF A;  3VR6 A;  2JEA I;  1QJO A;  1EWC A;  3PUY A;  4KTA A;  1CM9 A;  5COR A;  2K04 A;  2CHB D;  2RQX A;  3I70 A;  4XDX A;  4Y7N B;  2K1B A;  3QWN A;  5A2Q E;  3FPP A;  4TKO B;  1Y8N B;  2AUK A;  1AEX A;  4DNT B;  3RZO B;  1G2S A;  3F2U A;  2LY7 A;  3IKJ A;  1JCK B;  1TS2 A;  3PUZ A;  4KD4 A;  3GTQ B;  2EJG C;  1BO0 A;  3NWT A;  4IUP A;  5C4J B;  5CV8 A;  1RJT A;  2B2W C;  2NTT A;  4JK1 C;  3ND8 A;  1SEB D;  3NK9 A;  2RBM A;  1V1P A;  4XYQ A;  5CBE E;  3U9O A;  1PRT F;  3LWE A;  1ICW A;  1XYI A;  4HAE A;  2EYL A;  5KNB A;  5C5M A;  2F0I A;  2KEC A;  4FXG C;  4BA2 I;  3S17 B;  3A7L A;  2HUG A;  2XSC A;  1MBY A;  3D4W A;  4ID6 A;  2WV6 D;  2Y0S B;  1HHV A;  1K83 B;  2D5D A;  2A6H C;  2M00 A;  1YNJ C;  1BF4 A;  5IGD A;  1SE3 A;  1TQO A;  1SYE A;  4AYB B;  2JSO A;  3HG9 A;  3C46 A;  4QB4 A;  3TME A;  5FO7 B;  3E5S A;  2C5C A;  4HMJ A;  3K58 A;  4OHJ A;  1OO9 B;  4FF3 A;  2JYO A;  3Q6S A;  4G4K A;  1BR9 A;  4E6I A;  2XIW A;  3MC0 B;  3HOZ B;  2E76 C;  4FVM A;  1M8A A;  5BN4 A;  1BCP D;  1E2W A;  3MXN A;  5E4W C;  1JIC A;  1JQY D;  3NUC A;  1I6V C;  4EQO A;  4C56 C;  4IQZ A;  5M3F B;  3ONA B;  1I4G A;  3D4D A;  5I2X A;  1SYC A;  5C3E B;  4YIJ A;  2YU9 B;  1OXV A;  2HCI A;  1VMC A;  2OT2 A;  1IHZ A;  1PFN A;  3HRZ C;  4J6H A;  4RCO A;  2K5W A;  3PO3 B;  4X3U A;  4FYD A;  4BBR B;  1CA5 A;  1KDC A;  4QCL A;  1LTR D;  4LMQ D;  1KNE A;  2KUM A;  5CYU A;  1O7Y A;  3JAM E;  2BCO A;  4A3G B;  1AZP A;  3Q0A A;  4DAP A;  3H94 A;  1XWE A;  5FO8 B;  4G7H C;  2VB3 X;  1TS5 A;  2IL8 A;  2G9D A;  3CRK C;  3J7A V;  3NQI A;  4KKU A;  1LT3 D;  1I50 B;  1CQV A;  1LAC A;  2KVM A;  1H9S A;  1A3V A;  4C3J B;  2KQ3 A;  1EY6 A;  2L12 A;  3K0Y A;  2WIN B;  5J1Z A;  5EPK A;  5IGG A;  1S5F D;  1C4Q A;  3A7A B;  3QOJ A;  2EYO A;  2EOT A;  4NDX A;  3MFG A;  1IYV A;  1DXM A;  1GUS A;  1STY A;  4H7B A;  5C3X A;  3SEB A;  2IT1 A;  1KAA A;  1AW7 A;  2MP1 A;  5C0X J;  1ESR A;  3BDL A;  3AU7 A;  4IFD H;  2E2D C;  1OXU A;  2NN6 I;  1WCM B;  2K32 A;  4IUV A;  5ELE A;  1JR0 D;  2PZW A;  4HSP A;  3NXW A;  1PTO F;  2E2J B;  4M1U B;  1PRT B;  3RD4 A;  5DEH A;  3MFY A;  4PQX A;  4B08 A;  3QB3 A;  3O13 A;  1EQT A;  3V96 A;  4ULL A;  2B2W A;  1JOR A;  3EJI A;  5HUR A;  4KD3 A;  4CBV A;  1QG7 A;  1B1Z A;  2K05 A;  2HDL A;  3ZYY X;  4K2L A;  3TP6 A;  2R93 B;  2R92 B;  1NR4 A;  5FK9 C;  4X3K A;  4FNF A;  1ZEQ X;  2EY6 A;  1ILP A;  2F4I A;  1HPC A;  4RWS C;  1HFN A;  1EY9 A;  1IKM A;  3HS0 C;  1DYQ A;  1TII D;  3OPO A;  1PTO D;  5G3L F;  5CV5 A;  4XT1 B;  2AUJ D;  2XVS A;  4RHR A;  4ZYS A;  3R2I A;  4RAU C;  2O5I C;  5EQ0 A;  3DMU A;  3EA6 A;  3OSO A;  3K5O A;  1SYB A;  4KN4 C;  1FNU A;  2L1B A;  5C0X G;  3JAM L;  4H13 C;  3QOL A;  5BN3 A;  2YYZ A;  3OMC A;  3VYR A;  2PCF B;  5DM7 3;  1DM0 B;  1STA A;  2BDO A;  5COY A;  3ITP A;  5M5W B;  3R93 A;  3HZX A;  2NVT B;  1QCB D;  2H4O A;  3HGB A;  5FO9 B;  1KNA A;  2DN8 A;  5D65 A;  4Q0F A;  3ND9 A;  5C44 B;  1IKL A;  1WTW A;  2JXM B;  2Z1C A;  3D6C A;  1EYC A;  4TSS A;  4DNR B;  3LX0 A;  1CK1 A;  5AFW A;  5G3L D;  4K2K A;  4I7Z C;  1ONL A;  3J7A F;  1Q1B A;  2Q8I B;  4PMC A;  5EBD A;  4K14 A;  1OXS C;  2EYP A;  4KK7 A;  5I2Y A;  5I6W A;  2BDN A;  4CJ0 B;  1SNQ A;  5M5Y B;  3IFT A;  1LT5 D;  4A3E B;  1F9Q A;  1NCV A;  3VA7 A;  2F0S A;  5T1I A;  3DXJ C;  1MSH A;  1GHK A;  3GTO B;  3SHL A;  4G7O C;  1JOO A;  4RCN A;  1HTL D;  1RCV D;  4J8Q A;  2PW5 A;  3I3C A;  5EPJ A;  3P1H A;  3BDO A;  1ROD A;  1S4Z A;  3P20 A;  1UEA B;  1EWH A;  5E1F A;  2EXZ A;  2RSO A;  4RKL A;  3GO5 A;  3TDQ A;  1PZI D;  3P75 A;  5CV9 A;  1AN8 A;  1WTV A;  3DWA A;  4R9W A;  1WD0 A;  4BY7 B;  5T1G A;  1ZXT A;  4PMB A;  4XXE A;  3BZD B;  5I9P A;  1GJX A;  4XQJ A;  4DAV A;  2RDH A;  4MN3 A;  1I4R A;  3D31 A;  2K5D A;  4KKT A;  2F0D A;  1KDB A;  2FIN B;  2A69 C;  1HA6 A;  4DAY A;  2O2L D;  1GHJ A;  5C5L A;  4K5V A;  5C4Z A;  1EYD A;  2K6A A;  1ENF A;  1PTO B;  3S9W A;  5J22 A;  5JEA J;  1SFO B;  3S2D B;  3NTI A;  1SE2 A;  2KHS A;  5ELB A;  1BXT A;  2PYK A;  4DN4 M;  5HGT A;  3S2H B;  2JEB I;  1A2T A;  1GXD C;  4CHT B;  1CI3 M;  1STE A;  3M85 A;  2NVQ B;  4A3K B;  2C9O A;  3Q23 A;  1SXT A;  2Z4H A;  4FXD A;  1PZK D;  4NKL A;  2SOB A;  3PIO 3;  3MA2 B;  5D14 A;  4PV1 C;  3S1Q B;  3OOC A;  2F0F A;  4LAA A;  5K36 G;  1H9K A;  2VXW A;  1EY7 A;  4K6L A;  3ERO A;  4OL7 A;  1I3Q B;  1WTP A;  3NE5 B;  4KHV A;  3SR1 A;  3BDC A;  4LJZ C;  1DD2 A;  1Q12 A;  4IFD J;  2ID0 A;  3ERQ A;  3HOX B;  4C1N K;  5FLX L;  1SJH D;  3FDT A;  5I9O A;  4ZK9 B;  1DON A;  4KKS A;  3AB9 A;  5IOD A;  5JEA G;  4C3H G;  1ZYR C;  1AP0 A;  2NYZ D;  2QDB A;  2EZV A;  5CBA E;  2NN6 H;  1F9P A;  1T5X D;  5E3F A;  1MD2 D;  3MHB A;  3NPP A;  2F0M A;  2NB0 A;  1D1K A;  3OHX C;  1WD1 A;  4WRD A;  5FOB B;  4EQP A;  3CKI B;  3QG1 A;  2CQA A;  4PNY A;  2RDF A;  3TZD A;  1IW7 D;  1TT2 A;  2NTS A;  2HQE A;  3GTL B;  4OO1 G;  3HOW B;  2IJ0 A;  2XWB B;  1LTS D;  2Q8T A;  2A73 B;  1ILQ A;  2NUC A;  1TS4 A;  1BCP F;  2O5J C;  2JE6 I;  3NP8 A;  1D5M C;  3W2D A;  2F0H A;  3VR5 A;  3H3V C;  3I4L A;  1TVX A;  4F8M A;  3GV3 A;  4IFD G;  4C1N I;  3VYU A;  4IZ8 A;  3L9A X;  4F88 A;  2F03 A;  2F1M A;  4RA8 A;  2ZXO A;  1CZW A;  4ODG A;  2PQE A;  2F0U A;  3HEJ A;  3BS1 A;  1O80 A;  4HN7 A;  2Z4I A;  3D8G A;  4ZKB B;  4C3I G;  5JOB A;  3OWE B;  2ZXP A;  1TWC B;  1XTC D;  1SNP A;  3DM1 A;  2F0W A;  2XWJ B;  1JOQ A;  2JA5 B;  3X3N A;  1XXG A;  3R3O A;  4ZRZ A;  4BBS B;  2AWN A;  1FYC A;  1PXU A;  4FF1 A;  1PFM A;  1WTX A;  2LS0 1;  3S1M B;  2G9H D;  4EGV A;  1JWS D;  2A5H A;  2EJM A;  2MPM A;  4ZLT F;  1Y1W B;  1G2T A;  1EL0 A;  2L55 A;  4IUU A;  2PZT A;  4K6D A;  3M4Y A;  1RTO A;  1U4P A;  4GZY C;  1X32 A;  2E2H B;  1CQF A;  1UNS A;  2R3Z A;  2K28 A;  1RKN A;  2K5Q A;  1JC7 A;  1RF2 D;  4MHE A;  5ELF A;  3BYY B;  1DOM A;  3FVQ A;  5JJZ A;  3LWU A;  3VYT A;  3IAY A;  2F0E A;  1OXX K;  1LV9 A;  4HCE A;  1SJE D;  2KOL A;  4BS9 A;  1VCI A;  1D2B A;  2BA0 A;  1J8I A;  4DXF A;  2KJX A;  3S1R B;  4L8J A;  1LTA D;  3DEP A;  1IYU A;  3KUP A;  4QUC A;  4NW2 A;  3A54 A;  4KI0 A;  2FMC A;  2E2I B;  3URY A;  3V05 A;  4ZQ3 A;  3A8I E;  4KV6 A;  2A6H D;  3AMU A;  4DK0 A;  1YNJ D;  2ICI A;  1OXT A;  4KN7 C;  4C2M B;  3J81 E;  1R4Q B;  3WOE A;  1GUO A;  1STB A;  3TBI B;  1S5C D;  4A3M B;  1K8O A;  2A68 C;  4Z9C B;  3OWF A;  4RGT A;  3VR2 A;  5BN5 A;  1DOK A;  2EYF A;  3FMC A;  3GP7 A;  2NVX B;  3W3A A;  4XT3 B;  2D9U A;  2E75 C;  3MVV A;  1QNU A;  1HXY D;  4RGN A;  1BBX C;  3I4M B;  1PLF A;  2K7V A;  1PDQ A;  5DM6 3;  1FNV A;  2B2U A;  3NTH A;  4DF7 A;  1EU4 A;  1JWU D;  2RVL A;  3OIQ A;  2ZXR A;  1TWF B;  4FP5 D;  4A3B B;  3S16 B;  2IPK D;  1ESF A;  1Y1V B;  2KCC A;  4B9W A;  1BCP B;  1O7L A;  3M7G A;  1Q1E A;  2L11 A;  2MJ8 A;  1G29 1;  3I8Z A;  5C6A A;  3C2P A;  1FNW A;  1UAP A;  4R8I A;  2QKI C;  3I91 A;  1LAB A;  2F0O A;  2EYH A;  1EY0 A;  1SYG A;  1U4R A;  3IFD A;  2TSS A;  2VNU D;  2D62 A;  3D3R A;  3Q24 A;  3A8J E;  5KGU A;  1LTB D;  4ZUJ A;  3VYS A;  4CKB A;  3CQZ B;  2VUM B;  1YNN C;  4C3H B;  4KJO A;  3RUZ A;  1KDA A;  4V19 0;  3SE0 A;  3UI2 A;  1H9R A;  2D2C C;  4IUN A;  1ENC A;  5CC4 A;  3A56 A;  2IX3 A;  1HFG A;  1L0Y B;  2AWO A;  3QIA A;  4CJ2 C;  1FR3 A;  1EOT A;  2IW3 A;  1RDP D;  2CW0 C;  4DFA A;  3LNN A;  1EEI D;  4OIK A;  2LFN A;  3QJY A;  1I4Q A;  1CTM A;  4DK1 A;  5EKI A;  1LO5 D;  1SDF A;  1ZKO A;  1RTN A;  3J80 L;  1B53 A;  1V8Q A;  2EY1 A;  3GTK B;  1Q90 A;  4F87 A;  3N52 A;  1DJR D;  3FKI B;  4R8N A;  3KK7 A;  3IL8 A;  1RHP A;  4HED A;  1QNK A;  1PZJ D;  1F2Z A;  5I6Y A;  1SNO A;  3J81 L;  2BA1 A;  3K59 A;  5FLX E;  1HRJ A;  1QIL A;  2EVB A;  1BUV T;  4ILW A;  3SVM A;  3RMH A;  2PMZ B;  3N6R A;  2LMC B;  5IIF A;  3KBX A;  4C3I B;  3D6W A;  4X3T A;  1II3 A;  2NN6 G;  4XQN A;  1NUC A;  3NBH A;  1LLR D;  4IN3 A;  3PO2 B;  1SSO A;  2F0P A;  2H1E A;  1GUT A;  2K03 A;  3H91 A;  5IGC A;  5CV7 A;  1R9T B;  2F0V A;  4DXG A;  1X3P A;  3EQL C;  1MSG A;  3L7Z C;  3A55 A;  1B2T A;  2OF1 A;  1A3U A;  2B2V C;  2O4X A;  4EVO A;  3EFX D;  3M4O B;  3NWS A;  2EDG A;  3MAQ A;  1X3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...