1X65A

Solution structure of the third cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
89
structure length
89
Chain Sequence
GSSGSSGREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords UNR protein
total genus 3
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x65A01
4P75A 2JA7H 1PH4A 3BZCA 5IYDG 1XNRQ 4DV7Q 4DR2Q 2ALYB 4IOAA 1VQMA 4IPDA 1Q82C 1FVIA 1TWCH 3HFZB 5FLMG 4DV5Q 4LF5Q 2R7ZG 1N33Q 2Y0SG 2PQAA 3S1QH 3PO2G 4GKJQ 1VCIA 2OQ0A 1HJPA 1X3EA 1VQKA 3K81C 2XGTA 3F2CA 4HJAA 4DR5L 3KJPA 1NTGA 1P8LA 3I4OA 4IJHA 4POGA 1TWAH 1YBYA 1VQGA 4X66Q 3G6EA 4IFDG 3GTLH 4K0KQ 4A3JG 2ATWA 1G6PA 4A3KH 1UE5A 2Q2IA 2R92G 3EN2A 2ES2A 3DLLA 4UY8C 1NE3A 2VQEQ 4JI1L 3H3VH 5M3MG 1M1KC 4DUZQ 1YHAA 3RR5A 3FHWA 1HNZL 3S14H 2E5LL 1S3OA 3L7ZC 1E3PA 4GKKL 1EOVA 1SE8A 3G4SA 3CMEA 1GO3E 2K75A 5LMNW 1VQ7A 4WJ4A 1A0IA 4OONA 2UXCQ 3GDEA 1YHQA 3M85A 4YHHL 1HR0L 1YIJA 4DR1Q 1RL2A 4LF6L 2A1AA 1PH2A 2GVAA 2BA0A 3E0EA 1E24A 4IJLA 1UE1A 1EQRA 4JC0A 4YWKA 4DNIA 4YCUA 4MTNA 4R4QA 5C44G 3CCMA 1B8AA 1YJNA 3CCJA 1NMGA 3ICEA 2UXBL 1C9OA 2JE6I 3CMAA 3AEVA 5C44H 3VDYA 2UXDQ 2WAQE 5IE8A 2ZM6Q 3CCQA 1N36L 1HNWL 3NBHB 2K4KA 4KI0A 4AH6A 4AYBG 1C0AA 2UUAQ 4DR6L 1NBWA 4JI2L 1KQSA 3S2DH 1CUKA 3KF6B 4AQYQ 5HY6A 2BH2A 2JQOA 4JI1Q 4C2MH 1IXRA 2VZAA 2RHQB 4DV3L 4YWLA 3H0GH 4X62Q 2JEAI 4QIWE 3ULLA 2EQSA 4YHHQ 1V1QA 3K7AH 1IBLQ 2UUCQ 5ELNA 4HIKA 2AKWB 2B3GA 4P72A 1L1OB 3FKIH 3CCSA 4JBMA 4DV1L 4IOCA 3JC66 2JA5H 3UDGA 1I94L 5GROA 5EAYA 3BJUA 2CCZA 3KDFA 1L2FA 1VQJA 1VQCA 2NN6G 1Y1WG 1X9NA 1PH5A 3AFPA 5HGQA 2R92H 1Q8KA 4A93H 4DR1L 4QY7A 3CCLA 4DR7Q 4DV7L 4A3IG 2I5LX 3CC2A 4BXXH 1N9WA 1Q12A 5JJIA 2FXQA 3MXNB 4L5RC 3KLWA 3GO5A 1JT8A 1WI5A 3CF5A 3RZDH 4B3TQ 3J7ZC 1S72A 3HKZG 4JOIA 4LF5L 1A62A 2UUBL 1P16A 2WB1E 4LF9Q 1EYGA 2F3IA 3CXCA 1CSPA 4LWCA 1VQBA 3RZOH 1N33L 1VS0A 2YTVA 4PZ8A 1TWFH 4R4IA 4DV1Q 1Y1VH 3BZKA 1O7IA 3W1GA 3B6YA 2OTLA 2K14A 2OTJA 2GN5A 3WWVA 1G51A 1B70B 4JI8L 4A3FH 1NJIC 1VQ8A 3UDXA 5BR8Q 1YEZA 2ZJRA 2JA6H 3PCOB 4DV2L 1LYLA 5M5XH 3HOVG 3PO3G 4YCVA 1VQOA 1VQLA 1J5EQ 1I94Q 2I0QA 4KHPQ 1L1OA 3J81j 3M4QA 2HT1A 3U58A 1Y14B 3S1RH 3I7FA 3PUZA 1OXTA 1LM0A 4XIGS 4LUVA 4DK3C 4X65Q 3RLFA 1XMOQ 1UE6A 2UUBQ 4LF8L 5GADC 1KHIA 1IBMQ 1K83H 1XPUA 2D62A 2AHOB 2UXCL 2VY3A 1ASZA 3STBD 1IBKL 4AIMA 1SMXA 4ALPA 5C4XH 1PV4A 1HH2P 4Y7NH 3CPWA 1YNXA 2CQOA 4JI0L 2UU9L 4A3KG 4JI3Q 4DR3Q 1W2BA 3GTQH 4L5SA 2RCNA 2IX1A 4HIMA 2KBNA 3W5OA 3ZJYC 3PSIA 1PYSB 1SN8A 1X3GA 4LFBL 1NMFA 3HKZE 4K0KL 1XNQQ 1G291 3PO2H 3UE1A 4LF7L 3HOZG 1QVCA 1SRUA 2I5HA 2IHFA 3D0FA 4BY1G 4DV3Q 1GM5A 2E2JH 4DR5Q 5GAHC 4DUYL 4JI7L 3KYHC 5C4JH 3L0OA 1KRTA 5IYDH 4LUOA 1GKHA 3HOVH 1N8RC 3PO3H 4BY7H 3A0JA 4JCVE 4RMFA 4R4CA 4GNXC 1IBML 2YV5A 4UP7A 1EWIA 1C7YA 1HNZQ 1XMOL 4JI5Q 5LMUL 2QA4A 3T1YQ 2LXJA 3KF6A 1K8AC 1HNXL 2VQEL 1KC8C 1VQ9A 1MJEA 3S2HH 3ULPA 2HIVA 1I3QH 1HZBA 2RHSB 2WFWA 4GOPC 1E1OA 5C0XG 3AYHB 4IPGA 2Z6KC 3S1MH 3I4MH 4QGUA 3OTOL 4A4IA 2ZTCA 1XNQL 4NB3A 2F4VL 3J80i 2HHHL 4LF6Q 1SLJA 3J81c 5GAEC 1Q86C 3CCRA 1XPOA 2WB1G 1JE5A 1WCMG 4GN5A 5LMNQ 3HOUH 3TS2A 2ID0A 3DM3A 4DV5L 4OO1G 2PQAB 3FKIG 3TQYA 4JI6L 4DAMA 4GLXA 4DV2Q 3S1NH 4YWMA 5J3BA 3NEMA 4DV6Q 1OTCA 2HHHQ 1MIUA 2BH8A 2JA8H 2CFMA 2NVXH 4DUYQ 3U4VA 2ZJQA 5BR8L 1E1TA 3NENA 5IP9G 3HOWH 1PH3A 4A3CH 1KAWA 4IPCA 1YI2A 1SFOH 2MO0A 1K3RA 2KHIA 1IL2A 4P74A 4ME3A 4OWXB 3PGZA 3CC4A 4OX9Q 4AQYL 4GS3A 1KRSA 1TXYA 1B7YB 4DV6L 2K5NA 1I5FA 1IZ6A 3F1ZA 3CCVA 1PH6A 3S17H 3M4PA 2ZTEA 2R7ZH 4B3SL 1U0LA 3CW2C 1QZHA 1S40A 4WJ3M 5FJ8H 1YVCA 1Q7YC 1IBLL 2UUCL 4DR7L 1MKHA 1X54A 1OXXK 3M7NA 1Z47A 5IWAQ 4TQUS 3UE0A 3KDFB 3F2BA 2F4VQ 4BBRH 2LXKA 2PI2A 2OCEA 4A3FG 1HR0Q 1DGSA 1TWHH 2HQLA 2R6GA 3I56A 4HIOA 2ASBA 4BY7G 5IP7H 4DR4Q 4JV5Q 4AYBE 4YY3L 4A3GH 3PUXA 1Z9FA 4GOPA 4JG2A 4L5TA 2YU9H 1A8VA 4JBJA 1VQ5A 4UP8A 4J15A 2IX0A 3CPFA 1CSQA 1R9TH 5DLQE 2QGQA 2PMZE 4LW1A 2LSSA 2UXDL 4DUZL 4HJ9A 3K7UC 1WOCA 3SGIA 4JI7Q 4YY3Q 5C3EH 4APVA 4R4TA 5IYBH 1V43A 4DV4L 1KIXA 4A3LH 1AE2A 1QUQB 2UXBQ 4BXXG 1KXLA 3D31A 1YHBA 4DAYB 1OXVA 1E22A 2VQFL 4DPGA 1VQNA 4LFAL 1WCMH 3W1BA 5M3MH 4A3LG 2N8NA 1A63A 3K8AA 1JJGA 2R7DA 4IFDI 1PVOA 3K80C 4HJ5A 4LF4L 1N32Q 4LUZA 1HNXQ 2N3SA 3I4MG 3NELA 2AWNA 4GLAC 5LMUQ 4GLVB 1YJ9A 4KHPL 3HKSA 3TREA 1Q1BA 1WJJA 2MQHA 3T1HQ 3KFUA 4PZ7A 4JI4L 1BKBA 4A3EH 3S15H 2WAQG 3M4OH 4DR4L 3AQQA 4OWWB 4JV5L 4O2DA 5AJ3L 1E7ZA 1FJGQ 2IY5B 1VQDA 2NZHA 2B63H 4A3BG 1PH1A 3I4NG 2IT1A 1FGUA 1OXUA 5IP7G 3HOYH 4X6AH 2A8VA 3CQZH 3S16H 4EQ5A 4JI4Q 3Q8DA 5JEAJ 1QVGA 4A3BH 4C3IH 3CC7A 4RG1A 4JI0Q 4GKJL 4O0AA 4KHZA 4GNXA 1VQPA 1M90C 3RNUA 4LF4Q 1N32L 4A3EG 2PNHA 1CKNA 2R7FA 3E9IA 3UDIA 4MNOA 3RLNA 4LFAQ 1HR0W 2PI2E 3PIOA 4LF7Q 4A3CG 3CP0A 1H95A 2VW9A 4A3IH 5IP9H 2VQFQ 3GTKH 2Z6KA 3ER0A 2CKZB 1BBWA 3A74A 3M9BA 3J7A5 1SROA 1V9PA 4B3MQ 4NXNL 4POFA 1I50H 2K5HA 5IYCG 3T1HL 1U5KA 4IO9A 4DV0L 1XPRA 4JYAQ 1T9HA 1WFQA 4DK6C 3AFQA 3I55A 5IYCH 2DUDA 2Q2HA 5IT9c 3H3VI 1J6QA 1Q81C 4YCWA 2Y0SE 2ZM6L 1Y1WH 1HNWQ 4LFCL 2Z0SA 3EIVA 2MFIA 2NVYH 2OWOA 4B3ML 3PUYA 1L0WA 1QZGA 1EIFA 1UE7A 4BBSH 1BBUA 5IY0A 4A76A 1I6HH 1EUJA 3JAMc 1N34L 5FLMH 5C3EG 3HOUG 4BA1I 2VL6A 4FDBA 4DKAC 1HZ9A 4A3GG 4R1JA 2N49A 4DR6Q 5GQOA 3H0GG 1K73C 2B29A 4B3RL 3STBC 2N78A 5LMNL 4BA2I 2MO1A 1JB7A 2RF4A 4PMWA 1QVFA 2R93H 1KD1C 3U4ZA 2JA9A 3I2ZA 4X64L 4DR3L 5M5WH 2I5MX 4DV0Q 1X56A 3FP9A 4NXNQ 4A3DG 1LUZA 4BY1H 4A3MH 4JBWA 4GN3B 3IRBA 4H02A 3HOZH 4X66L 3GTPH 2K50A 3HOYG 1SR3A 1HZCA 1KL9A 2YTYA 4TVAB 4GN4B 2JK8A 3G71A 3M3YH 4GOPB 3F8TA 3KOJA 4B3SQ 5FJ8G 1GVPA 1AE3A 3GTGH 4XTCS 1D8LA 5JJKA 1RIPA 1TWGH 5E7NA 3K0XA 4B3TL 5H1SE 2JEBI 4OX9L 4QL5A 2JA8G 4JBKA 2AWOA 4B3RQ 2UU9Q 1FJGL 2OQKA 3LGJA 1J5EL 4IPHA 1OXSC 1VQIA 3HOXH 2KHJA 2DGYA 1VQAA 4R4OA 5AJ3Q 4A3JH 1N34Q 2JA5G 3HOWG 4BBSG 3KF8B 2YTXA 3RN5A 3U50C 1MJCA 4JI2Q 4LFBQ 4X65L 1UWVA 2AMCB 3OW2A 5C4XG 2GVBA 4C3HH 3UDFA 2QEXA 4GNXB 2Q2UA 2EIFA 1D7QA 5M5YH 4C3JH 4QQBX 2UUAL 5ELOA 4UP9A 4NPSA 2D0OA 4P73A 1YJWA 1CKMA 1X55A 1N36Q 5C0XI 1JMCA 4KLKA 4X62L 1UEBA 3OTOQ 1IYJB 1JJ2A 2L15A 3CD6A 2KCMA 4A3MG 5GAGC 4A3DH 4LF8Q 2E2HH 4DV4Q 2C35B 5K36G 4A75A 3PV0A 1XMQQ 1ASYA 3RN2A 3L2PA 1JJCB 2JA7G 3I4NH 4JYAL 4JOIC 4HIDA 1X6OA 1WYDA 4L5QA 1K8GA 4BBRG 2H5XA 4EX5A 1EIYB 3JAMi 4NXMQ 2VUMG 3TRZA 1PHJA 2XTIA 2E5LQ 2Q2TA 1CKNB 1Y1VG 4JI3L 4HJ8A 2E2IH 2CWPA 3MEFA 4MZ9A 1EQQA 1VQ4A 1CKOA 1QUQA 1LTLA 2B63G 3PUWA 5IWAL 4HJ7A 2NN6I 1PH7A 3ERSX 1IBKQ 1W3SA 4P71A 3E9HA 2ZJPA 2K52A 3PF5A 3PF4A 1Q1EA 3F2DA 2YYZA 3T1YL 1VQ6A 4UPAA 4LF9L 3S24A 3GTMH 1GD7A 3CAMA 3ULJA 2A19A 1L1OC 1FL0A 1EFWA 4QJFA 4X64Q 4DR2L 2CWAA 3J80c 5JJLA 3PUVA 1VQHA 2BA1A 3J81i 5C0XJ 1X65A 5JEAG 2D0PA 5M3FH 4PG3A 4A93G 1PA6A 3CCEA 3RLOA 3EBEA 3GD7A 3BU2A 1VQFA 2NZOA 1XJVA 1PYBA 2WP8J 5M3FG 4OO1I 1K9MC 1XNRL 1XMQL 2MNAA 1AH9A 1YZ6A 3PIPA 1Q46A 2JJQA 4OWTB 2KENA 5IYBG 3A5ZB 4JI8Q 3HOXG 1PH9A 2K5VA 3GTOH 4JI6Q 2EXDA 4NXML 2E8GA 3OYYA 3CCUA 2HIXA 2IHEA 2F52A 2V1CC 5FLXc 1YITA 4OXPA 2VUMH 1HZAA 4JI5L 1PFSA 2VNUD 1K0RA 4LNQA 1PH8A 2KCTA 1XTDA 3KJOA 2NVQH 4GKKQ 4IFDJ 1X3FA 4Y52H 3TEHB 1NY4A 3H15A 2VS1A 3G48A 2NVTH 3GTJH 1VQEA 3A5UA 1BVSA 4PZ6A 3TS0A 2JA6G 2R93G 4LFCQ 2ZTDA
chains in the Genus database with same CATH superfamily
4HSPA 2L5TA 1O7YA 5IYDG 4DV7Q 2HDMA 1X3PA 2B2WA 4IOAA 3J7AF 5JVH3 3BG3A 4XQQA 1IYUA 3O13A 1CM9A 1FVIA 3HFZB 1PZJD 5FLMG 4DV5Q 1N33Q 2PQAA 4DA2A 3PO2G 1HJPA 3S2DB 4K8IA 4HJAA 4FF1A 2EY6A 4IFDG 4MN3A 5IOCA 2MP1A 4A3KH 3EN2A 4UY8C 2VQEQ 1DCZA 1DZ1A 1A6XA 1YHAA 2A6EC 1RCVD 5FO7B 3DUZA 1HNZL 3MXPA 4DN4M 1KDAA 5IT9E 2RQXA 3P1HA 3CMEA 1GO3E 1F9QA 5LMNW 1QCBD 4WJ4A 2UXCQ 1YHQA 4YHHL 4DR1Q 1RL2A 3CHBD 1PH2A 3KLSA 1LTRD 3E0EA 4ODGA 5C44G 1ICFB 2UXBL 4L6TB 3CMAA 1RTOA 5C44H 2WAQE 5AFWA 5IE8A 1QNUA 5IIFA 4I7ZC 1C0AA 2UUAQ 4JI2L 1VMPA 2B2WC 1TVXA 2Z9HA 1CUKA 4CGYB 4FVMA 2KVMA 1ENAA 3HRZC 3PO3B 4ZUIA 1ET9A 2RHQB 2VZAA 1TWFB 1IW7C 4A3JB 1IBLQ 5ELNA 3KBXA 3E5SA 2EJFC 3NP8A 4HSVA 3Q0AA 1I94L 1SXTA 1VQJA 1VQCA 1X9NA 1PH5A 2K03A 1Q8KA 4A93H 4DV7L 4BXXH 2I5LX 1PFBA 2L1BA 2F0VA 4JOIA 2A5HA 2FFKB 2WB1E 3TP6A 1PFMA 4LF9Q 1G6ZA 4L8JA 1SNMA 4KTAA 3GQBA 3CXCA 1VQBA 1BCPF 1VS0A 2EYMA 2ZXRA 3EJIA 2B2UC 4R4IA 2OTJA 1QNKA 1G51A 1MI2A 5JPNC 4LAAA 4BS9A 3PCOB 2H1EA 3HOVG 1BCPD 2A69C 1VQLA 3LWUA 2XWBB 3TZDA 1I94Q 2RDGA 3J81j 3U58A 1Y14B 1SNCA 5C4JB 3S1RH 4LUVA 3RLFA 2KECA 2CHBD 5CR3A 1XPUA 3C2PA 2UXCL 3STBD 5IGBA 1IBKL 1PV4A 2PO4A 4JI0L 1YNXA 5IGDA 4JI3Q 4DR3Q 3GTQH 2IX1A 3D8GA 1SNDA 3ZJYC 1SYDA 2R92B 1B1ZA 1PYSB 1B3QA 1SN8A 5NUCA 1XNQQ 5G3LF 1G291 3UE1A 3HOZG 1QVCA 3D0FA 2I5HA 1K8MA 4MTKA 3A56A 3A8JE 4XDXA 5T1IA 3KYHC 3A8IE 1KRTA 1FR3A 4LUOA 3P20A 3HOVH 5IYDH 3A0JA 2EE1A 5IGGA 4R4CA 4GNXC 4UP7A 5I2YA 3FVQA 3I72A 2WACA 4JI5Q 5LMUL 2QA4A 2LXJA 2VQEL 1KC8C 1VQ9A 2HIVA 1PRTB 1K83B 1I3QH 1HZBA 1CK1A 1S5ED 4A4IA 2L11A 1QB5D 2F4VL 4LF6Q 1QOHA 3J81c 3CRKC 1TWAB 3CCRA 2SDFA 4GN5A 1JE5A 1WCMG 5LMNQ 3HOUH 3R93A 4DV5L 3LX0A 5KIXA 1BBXC 4JI6L 4YWMA 5E4WC 1O7ZA 2JSOA 5CMDA 4EQNA 1MIUA 2DNEA 1CT1D 3U4VA 5BR8L 3HOWH 1PH3A 1KAWA 2EYLA 2MO0A 1K3RA 2KHIA 1SFOH 5LL6S 4OWXB 4MHEA 4N8X1 2K5NA 1I5FA 1PTOC 1KDCA 3KBGA 1BO0A 1Q7YC 1LACA 1OXXK 4TQUS 2F4VQ 3KDFB 5CORA 2LXKA 2C5CA 4A3KB 2OCEA 2HQLA 4HIOA 4DR4Q 4KY7A 1ML0D 2QCPX 1AN8A 1FNWA 4L5TA 5JPMC 1A8VA 4J15A 2IX0A 3TP5A 4DUZL 2RSNA 1WOCA 3A7LA 1LV9A 4YY3Q 2OEOA 1BOSA 1A2TA 1D1KA 1EZ6A 1DD2A 1OXVA 2VQFL 1VQNA 4LFAL 5M3MH 2N8NA 3K8AA 3T53B 3DWQA 3HZXA 4IFDI 1PVOA 5JAVA 1K0SA 4HJ5A 4FXKC 2K6AA 4GLVB 4R9WA 5IGEA 1HQMC 4U673 3S15H 3SXHA 3M4OH 1SYGA 2K33A 1F2ZA 4DR4L 2B8GA 2CH4A 4KY6A 1VQDA 3K58A 2LFNA 3I4NG 2Z4HA 4K5VA 1LO5D 5IP7G 4ID6A 1SYFA 1XX8A 4EGVA 4X6AH 4CKEA 1QVGA 3RZDB 4C3IH 4MIUA 2JXMB 4RG1A 3I4MB 4GKJL 4K2LA 4GNXA 1YNJD 1ESFA 2VB3X 3BVZA 1VQPA 1O80A 4XXEA 4H44C 1IKLA 3PIOA 4LF7Q 4A3CG 2WKDA 2Z1CA 4ME5A 3M9BA 3A74A 3J7A5 1V9PA 1HCZA 3VR5A 4HCEA 4A3MB 1I50H 1PLFA 2K5HA 5JEAH 2LY7A 4JYAQ 4DV0L 2IL8A 1HA5A 1T9HA 4KN7C 4OIJA 1F77A 3NTHA 2K28A 2EVBA 4YCWA 2Y0SE 4LFCL 2L9HA 2B63B 3OHXC 3C1EA 3EIVA 1B9MA 4B3ML 4FXDA 3PUYA 4A76A 2NYZD 3JAMc 1I6HH 3R2TA 1TQOA 5I9PA 2VL6A 3TSSA 1HZ9A 1EYDA 3GP7A 3NBHA 2MGSA 1PTOB 3H0GG 5DM73 1K73C 1ZEQX 1E2WA 4B3RL 2XIWA 3STBC 3SK5A 4BA2I 2RF4A 2ICIA 5M5YB 1B9NA 4BWGB 2Z4IA 2IX3A 5M5WH 1D5XC 3OWFA 1R9TB 5ELCA 2J4XA 3IRBA 2RDFA 3MWYW 1SR3A 4GN4B 2JK8A 3M3YH 4GOPB 5EPKA 3GTGH 4K5XA 2MJ8A 5FO9B 4RA8A 2JA8G 2OQKA 5KEEA 2LMCB 1J5EL 3HOXH 3VR2A 4CBVA 4A3JH 4R4OA 1N34Q 1PRTC 3C46A 4IFDH 5ELBA 3U50C 4LFBQ 4X65L 3A55A 3OW2A 2NTSA 4G7ZC 2B2TC 2GVBA 2Q2UA 2K04A 1EY0A 2KA7A 4C3JH 4QQBX 5ELOA 4UP9A 2KOLA 4NPSA 4P73A 1CKMA 1N36Q 4Z9CB 5M3FB 5C0XI 1STYA 1GUNA 3OTOQ 3LWEA 1IYJB 4UAIA 1EY9A 1SMYD 3EVQA 2JA5B 5GAGC 5KYIA 2E2HH 4WFN3 1JC7A 2I07B 3PV0A 3OOCA 4XQJA 4IUUA 4OL7A 1O7LA 4JOIC 5A2QE 3NTIA 1H9SA 4G4KA 4BBRG 3IAYA 1Y1VG 3VA5A 1Y8OB 2JA6B 2E2IH 4RAUC 3TBIB 2CWPA 4MZ9A 1WD0A 2AQ1B 4FXGC 3SK6A 4E6IA 2V4DA 3PUWA 4HJ7A 2ZJPA 1EU3A 3JAME 4IURA 3T1YL 1VQ6A 2LKVA 2B39A 4LF9L 5IGFA 1GD7A 3CAMA 2A19A 4V190 1LTBD 3SDZA 2RBMA 3CCEA 1Y69U 1ILPA 2B2YC 3BU2A 1AFPA 3H09A 3HOYB 5J39A 1AH9A 5IYBG 3A5ZB 1HXYD 4JI6Q 2WINB 3MA2B 3D4DA 3CCUA 1IL8A 5FLXc 4ZK9B 4OXPA 3VYSA 4A93B 1D2BA 1PFSA 2F1MA 2KCTA 2MHVA 2NZ1D 1X3FA 4JVZA 4B9XA 3IL8A 3TS0A 2K05A 4IUPA 1EWCA 1K3BC 1PH4A 3FEWX 1XNRQ 5FK9C 2ALYB 1GUTA 1I3QB 4DU9A 2PW5A 2ZT9C 3OWEB 4GKJQ 1AEXA 2F0GA 3K81C 4DR5L 4IUNA 1NTGA 1B53A 3NE5B 4POGA 1TWAH 2SNSA 1VQGA 4K0KQ 3GTLH 1ET6A 2RCFA 3QB3A 4A3JG 1KLGD 3H0GB 1G6PA 2Q2IA 1M8AA 2ES2A 4HR7B 3DLLA 1NE3A 4JI1L 3R2IA 5M3MG 5A2QL 4DUZQ 1M1KC 1G91A 2B2TA 3RR5A 5ELDA 2E5LL 1S3OA 1RHPA 4GKKL 5FLXE 4DF7A 3G4SA 1VQ7A 2JP1A 5A35A 3DM1A 4KV6A 1YIJA 4LF6L 1SAPA 3ND9A 1GUSA 4YWKA 1E24A 4IJLA 3V05A 1YJNA 3CCJA 1C9OA 1TY0A 2F3VA 3NBIA 4AYBG 3QOLA 3I3CA 4IN3A 1BNZA 5LHY1 1KQSA 1E0BA 3S2DH 5C3EB 4ZKCB 1WTXA 5HY6A 2JA7B 5EKKA 1CFMA 1I4QA 5ISRA 3SR1A 4H13C 1STAA 2EQSA 1B3AA 4YHHQ 3HOZB 3K7AH 1IHZA 4HIKA 2B3GA 4P72A 4JBMA 4DV1L 2PZTA 3QIAA 4IOCA 4A3BB 2K5WA 3UDGA 1G8ZD 2A73B 1A3VA 3KDFA 2RA4A 1FYCA 3AFPA 5J22A 4OEMB 4PV1C 1PRTF 1G2TA 4QY7A 4DR7Q 3CC2A 1MD2D 1Q12A 2PYKA 3MXNB 4KD3A 4LMQD 4OGQC 4Q0FA 4HEDA 1DM0B 3RZDH 4B3TQ 1JB3A 3MC0B 2N55A 5M9OA 5C44B 1P16A 2B8FA 3EQLC 4RWSC 1EYGA 2F3IA 3SEBA 2FINB 1TWFH 1Y1VH 2QDBA 2K01A 3QO2A 3CKIB 2GN5A 4A3FH 1B70B 3UDXA 1YEZA 3MFYA 3QJYA 4DV2L 4KHPQ 2F0EA 3M4QA 1PZKD 1RJTA 2HT1A 2O5IC 3I7FA 1LM0A 2BOSA 4DK3C 1UE6A 1RTNA 2NUCA 1K83H 3J7YW 4PMBA 2D62A 3VYTA 4J6HA 4BY1B 1B2TA 4LK1C 4AIMA 1BQQT 1SMXA 5C4XH 2EJGC 4KD4A 4Y7NH 3OPOA 2CQOA 4A3KG 5I9OA 1W2BA 3GV3A 2IW3A 1A2UA 2KBNA 1STBA 5ELEA 1TR5A 4QMGA 1NCVA 3PSIA 1X3GA 4LFBL 2A68D 2F0KA 5M3MB 3IFTA 3K0YA 4LF7L 3X3NA 1GM5A 1SRUA 3MZ5A 2E2JH 4RKBA 4HN7A 1SBBB 1PZID 2JA8B 4DR5Q 4DUYL 2K5QA 2WB1B 3L0OA 3GTOB 1N8RC 4JCVE 4RMFA 3SVMA 2B2VA 2YV5A 4A3GB 5FO8B 1YNNC 4RFBA 1HNXL 2Z8LA 1MJEA 3S2HH 2A74C 5LL6X 5CBEE 5C0XG 3D3RA 2Z6KC 4HMJA 4DK0A 3T13A 4NB3A 3J80i 4KHVA 1XPOA 1SSOA 2CVRA 3I4NB 1T5XD 3DHQA 3MEHA 3TQYA 4FYDA 4KJOA 3NEMA 1SE2A 2AUJD 2TSSA 4H7BA 4DV6Q 4HMIA 2HHHQ 2NVXH 4DUYQ 1W6KA 1YI2A 4IPCA 4BY7B 1IL2A 3H94A 4ME3A 4GS3A 3A8KE 3QR8A 1KRSA 1Y1WB 2DJFC 1PH6A 1EFID 1D5MC 1U0LA 3G7LA 5FJ8H 2F0QA 1LTSD 2E2JB 4DR7L 1MKHA 1DYQA 3UE0A 5IWAQ 1HPCA 5CYUA 4BBRH 3MHBA 1PTOD 4A3FG 1HR0Q 3SHLA 3HOUB 4QIWB 5IP7H 4JV5Q 4AYBE 2G9HD 4A3GH 4OIKA 3PUXA 1Z9FA 4DGZA 1UNSA 2X6GA 2AUKA 2YU9H 4JBJA 2ENBA 1PTOF 2VB2X 1R9TH 5DLQE 2IPKD 4LW1A 2EDGA 3K5LA 4JK1C 2ICEC 3X3MA 4B08A 1F2LA 2UXBQ 3HG9A 2O2LD 5D65A 3GTGB 3HKZB 2IJ0A 1WCMH 3NXWA 1O78A 1GUOA 2MUYA 2R7DA 1HNXQ 2N3SA 4O42A 3I4MG 3S17B 2AWNA 2M9VA 1H9MA 4F8MA 3IKJA 3TREA 1TS2A 1Q1BA 1WJJA 1Z6HA 5C4HA 5KYLA 4PZ7A 3T1HQ 4JI4L 3AQQA 2HD3A 3T4AC 3TZUA 2B63H 5CV8A 1PH1A 1JOOA 3CQZH 3S16H 4JI4Q 4JI0Q 4KHZA 4K5WA 3KLSX 3RLNA 1HUNA 3ND8A 5IT9L 3E0JA 4R8NA 3CP0A 1PDQA 1H95A 5IP9H 4HCSA 3ER0A 4ZKBB 2CKZB 3AU7A 3SK4A 3VA7A 4POFA 4RCNA 3K59A 3AFQA 3I55A 2A69D 2DUDA 2Q2HA 5IT9c 1J6QA 1Q81C 3U9SA 3S15B 4C56C 1EUJA 3I91A 5M5XB 1WTRA 5FLMH 3D6CA 3HOUG 4FDBA 4CDDC 5FKAC 1CA5A 5GQOA 2PCFB 1ONLA 2B29A 3WOEA 3H91A 4J8QA 5LMNL 3LNNA 1KD1C 4IUVA 3U4ZA 4DR3L 4X64L 4DV0Q 2I5MX 1XTCD 2FHTA 1DOKA 4DAPA 1NNXA 4GN3B 4H02A 4TRDA 3HOZH 4X66L 4KKUA 4ZCKA 5JJZA 3KOJA 3KUPA 3RUZA 1L0YB 3S1MB 1X32A 1AE3A 2E76C 5JJKA 1D8LA 2L4NA 1EIHA 4KY5A 1TWGH 5E7NA 3K0XA 3L9AX 4C2MB 2QKIC 5H1SE 4OX9L 2AWOA 2UU9Q 1FJGL 4IPHA 1OXSC 1VQIA 5D3DA 3V96A 3I90A 4F88A 4FF4A 3EFXD 3RN5A 1EYAA 1PTOH 3K5MA 4JI2Q 2NB0A 5T1GA 5C4XG 3BS1A 3VR3A 1BR9A 1SFOB 1U4LA 1D7QA 4RGOS 1K28A 1V1PB 1EY8A 2D0OA 1YJWA 4K2KA 1PRTD 2NVYB 1Y1VB 5E1FA 2D2CC 1HFGA 4RGMA 2KEDA 3BYYB 1JJ2A 5KRUA 3CD6A 2KCMA 4A3MG 4A3DH 1ESRA 4A75A 3L3OC 1XMQQ 2LS01 1SNPA 4FF2A 3L2PA 1JJCB 3I4NH 4JYAL 1JCKB 3PIO3 4HIDA 2G5DA 1K8GA 2H5XA 4EX5A 2VUMG 3TRZA 4NXMQ 2XTIA 1CKNB 1VQ4A 1QUQA 4ABNA 1T5EA 3T56B 4WRDA 4DAYA 1W3SA 2SEBD 4P71A 2XNAC 3PF5A 4C3HG 2B2YA 4LJZC 5I2XA 3ULJA 2F0JA 2F03A 5JJLA 5C0XJ 1X65A 5TSSA 4DXGA 5JEAG 1PA6A 3RLOA 2F0FA 1XJVA 3GD7A 1A3TA 1PYBA 1XNRL 1XMQL 5FOBB 2WV6D 2XRQD 2R93B 1KABA 1RODA 2JJQA 4OWTB 2KENA 1PH9A 3HOXG 3J81E 2K5VA 4N9TA 2EXDA 5EJWA 1BCPB 4NXML 2HIXA 2IHEA 2V1CC 3DEOA 1HZAA 4RGNA 1PH8A 4GKKQ 2NVQH 3KJOA 2Y0SB 3S1NB 3H15A 2VS1A 5KNDA 4PZ6A 2JA6G 1HRJA 4LFCQ 4IO9A 3GTMB 4P75A 3BZCA 4ZQ3A 3WDNA 4DR2Q 1H9JA 2F0TA 4A3IB 3AMUA 3U9OA 1Q82C 1TWCH 4LF5Q 2Y0SG 2CH4W 1VDZA 3S1QH 2OQ0A 2XGTA 3KJPA 3R8BA 3I4OA 1ILQA 1YBYA 4L63B 4X66Q 3G6EA 5L37A 3DXJC 1UE5A 2R92G 1X3QA 5CV7A 1ICWA 2KEEA 3L7ZC 4AYBB 2BDOA 1M4VA 4K6LA 3DWPA 1A0IA 4OONA 4FP5D 5C4XB 1KNEA 4ZRZA 2O5JC 3BZDB 2BA0A 4JC0A 1UE1A 1EQRA 3CCMA 4DNIA 1V1OA 4R4QA 1NMGA 3NK9A 2UXDQ 4NMZA 4G57A 1PMRA 2TMPA 3NBHB 2K4KA 5CGKA 4DR6L 2N88A 4KKSA 4EQPA 4AQYQ 1XXGA 2JQOA 1CZWA 1Q90A 4K14A 4DV3L 3H0GH 4CHTB 1EOTA 4X62Q 3ULLA 1TWCB 4KK7A 1F9PA 2AKWB 2XN9C 3EA6A 3FKIH 1SJED 2RSOA 4EQOA 5GROA 2CCZA 4JW0A 1L2FA 1PYWD 2F0OA 2R92H 1Z7TA 4NP5A 1C4QA 3CCLA 3I70A 1N9WA 2K5DA 3VYRA 3IFDA 1VMCA 2F0DA 3CF5A 5IGCA 3J7ZC 1S72A 1WTHA 2WIIB 4NW2A 2UUBL 3HEJA 1HFNA 3NSWA 4LWCA 4CDFC 3RZOH 1N33L 4G7OC 1ZYRD 2YTVA 4DV1Q 3W1GA 1O7IA 1B44D 3W2DA 3MVVA 3WWVA 2HDLA 4JI8L 2ZJRA 2JA6H 3QOJA 2F0NA 1UUPA 4YCVA 1VQOA 1J5EQ 3KF8A 2I0QA 5CC4A 1L1OA 1LTAD 3PIP3 3PUZA 1OXTA 3FDTA 4X65Q 1F2MA 4QUCA 5KNCA 4LF8L 5ELFA 4GZYC 2EXZA 4C3IB 4FO2A 2YU9B 1HTLD 5EQ0A 3CPWA 2UU9L 4KKTA 3H3VC 1STNA 3W5OA 2EYHA 1NMFA 3HKZE 1SYCA 3PO2H 2B2VC 2IHFA 2KHSA 3TP8A 1LTID 4QB4A 5I6YA 1B50A 2M2LA 2B2UA 2X69A 1GKHA 3D4WA 4BY7H 1VF7A 1EIGA 3K5OA 3TDQA 1EWIA 1XMOL 1JR0D 3T1YQ 3GV6A 3KF6A 2VXWA 1A3UA 4V0BA 2PZWA 1E1OA 3CQZB 4WJWA 3S1MH 4QGUA 1NR2A 2ZTCA 1EEID 1L0XB 1SLJA 2F0UA 4CDEC 2WB1G 3MAQA 2ID0A 1LABA 4OO1G 2PQAB 3FKIG 3S1NH 4DV2Q 1HTPA 1OTCA 2NVTB 2JA8H 1F9SA 2PQEA 2ZJQA 5IP9G 1JWSD 4A3EB 4A3CH 4P74A 1JQYD 3CC4A 3PGZA 1HUMA 4AQYL 3URYA 1B7YB 1I6VC 1IZ6A 3F1ZA 3S17H 2R7ZH 2ZTEA 1QWYA 4B3SL 3CW2C 3S14B 4WJ3M 1S40A 1YVCA 1IBLL 1WTWA 1X54A 3F2BA 1EY5A 2PI2A 1TWHH 4O1NA 3I56A 4BY7G 2WKCA 4CKCA 1HA6A 4YY3L 1U4RA 3GTKB 2HQEA 4JG2A 3KLRA 5DEHA 1VQ5A 4UP8A 2I46A 3CPFA 2QGQA 2LSSA 3P75A 1D1IA 5I4DA 5EPLA 1SJHD 2XWJB 3K7UC 4DK1A 4HJ9A 4JI7Q 5C3EH 4APVA 4R4TA 4A3LH 1V43A 3A54A 2FMMA 1QUQB 2XRSD 3D31A 1YHBA 4DNTB 1QILA 4B9WA 5HGTA 3RZOB 3W1BA 1BUVT 5KGUA 2PZUA 1HHVA 3K80C 1N32Q 1WTOA 4LUZA 2NVQB 4YIJA 1R4QB 2D9UA 4GLAC 1LT4D 4RGTA 4KHPL 2GA4B 2EJMA 3HKSA 4JPBW 4C1NK 5EKIA 2MQHA 3KFUA 4OELB 2IWHA 1BKBA 4A3EH 2WAQG 1YNJC 4OWWB 4BBSB 5AJ3L 2P5ZX 2NZHA 4A3BG 3EROA 1JOQA 1FGUA 2H4OA 3HOYH 2A8VA 3Q8DA 5JEAJ 2KQ3A 3JAML 1STEA 4IALA 1R4PB 4X3TA 2Q8TA 1KTKA 1M90C 1LT3D 4FNFA 4LF4Q 2E2DC 2PNHA 1CKNA 2R7FA 5C4ZA 4PQXA 3E3XA 1DONA 3UDIA 4LFAQ 3T51B 3MXGA 1SYBA 5CV9A 1TS5A 4A3IH 5C3WA 1RKNA 2PPBC 3GTKH 4RHSA 1BBWA 2RKSA 1VF5C 1A15A 2AQ3B 2E74C 3CRLC 1QJOA 4B3MQ 2HCIA 1JORA 1U5KA 1WFQA 4IZ8A 3H3VI 1Y1WH 1II3A 3R3OA 2OWOA 1QZGA 1UE7A 3NPPA 5IY0A 3NUCA 1E2ZA 2L0CA 4DKAC 4R1JA 4DR6Q 4CJ0B 2L12A 3S16B 4U68A 3Q6SA 2MO1A 1JB7A 4C3HB 2R93H 1IW7D 3NQIA 5BN5A 2JA9A 1CI3M 4OHJA 3W3AA 1BF4A 1X56A 3FP9A 2FMCA 5CBAE 3I4LA 4A3DG 3Q24A 1DJRD 4TSSA 4DFAA 3GTPH 4XQNA 4P2CB 1HZCA 4WORA 4KN4C 3F8TA 4B3SQ 3M7GA 1GVPA 1MBYA 5FJ8G 2DN8A 3ZYYX 4QL5A 4JBKA 2NN6H 3MTSA 3LGJA 5JOBA 3S2HB 2KHJA 1ENFA 2OT2A 4BBSG 3KF8B 2YTXA 1NSNS 1MJCA 1ZXTA 1JE4A 1TS3A 1UWVA 2AMCB 4RKLA 2QEXA 2EIFA 4I7AA 3P7JA 2UUAL 3C3LA 1ZKOA 2PMZB 1TWHB 1X55A 2EY2A 1JMCA 1UEBA 2K7VA 1BCPC 2L15A 3PMFA 4K8JA 4ZLTF 1SDFA 4LF8Q 4DV4Q 1GUGA 1TY2A 3NWSA 5K36G 3MXNA 1U9RA 1ASYA 1D5ZC 3RN2A 1MSGA 4Y7NB 2JA7G 2WAQB 1GXDC 5C6AA 2F0WA 1EIYB 3J80E 2E5LQ 4JI3L 4HJ8A 1J8IA 2EYFA 1LTLA 2B63G 3AB9A 3BYTB 3E9HA 2K52A 5CV6A 1Q1EA 3F2DA 2YYZA 4ZYSA 3S24A 3GTMH 1U4MA 1EL0A 1L1OC 2HUGA 4QJFA 3BVMA 3PUVA 3J81i 4A93G 4PG3A 2NZOA 3OMGA 4OO1I 1K9MC 4F7XA 4A3DB 3PIPA 1Q46A 1TKWB 5E4XA 1UEAB 3OYYA 1H9SB 3VR6A 1LTTD 1CHQD 1I4XA 1K0RA 5CV4A 3PO2B 1XTDA 4IQZA 5C3XA 1LT6D 1NY4A 3G48A 1KAAA 1VQEA 3TN2A 4UHVA 1NUCA 3RD4A 3A5UA 3GTJH 2F0HA 4N8FA 2EY1A 3KK7A 2JA7H 3MFGA 3SK8A 4XT3B 1VQMA 4IPDA 3M4YA 3CU7A 2F0SA 5COYA 1CTMA 1Q3LA 3I8ZA 1SE3A 2R7ZG 3N52A 1VCIA 2A6ED 1X3EA 5IODA 1VQKA 3F2CA 1EQTA 3D4RA 1P8LA 3TP7A 4IJHA 1NR4A 4OO1H 1TU2B 1GHJA 1S4ZA 2ATWA 4KMUC 1JICA 5KNBA 3H3VH 1C8CA 5M5WB 4XYOA 3FHWA 4G7HC 2R7ZB 3S14H 4Q5VA 4IUQA 1E3PA 1EOVA 1SE8A 3DMUA 1Q8IA 2O4XA 5D3IB 1UAPA 2K75A 2PNRC 2KUMA 2DJGC 1HQRD 1U4PA 3GDEA 2X6LA 1E2VA 3M85A 1RF2D 1SEBD 1HR0L 2G9DA 4R8IA 2A1AA 2FJ2A 2QDLA 1I4PA 2GVAA 1C48A 3AEVA 4ZAIA 1KLUD 4MTNA 4YCUA 3ICEA 1B8AA 4K6DA 2JE6I 2NVXB 2DNCA 3VDYA 2F0IA 2ZM6Q 3CCQA 3BDCA 2R61A 1N36L 1HNWL 4AH6A 4KI0A 4KJNA 4N9PA 1NBWA 3NQTA 4PNYA 4I65A 4RH6A 3KF6B 1LT5D 1CA6A 1GJXA 1TWGB 4M8AA 5HURA 2BH2A 4JI1Q 3HOVB 4C2MH 1IXRA 3H6MA 4YWLA 2JEAI 4QIWE 2Q8RE 1V1QA 1STHA 2UUCQ 3FMCA 1L1OB 3CCSA 3JC66 2JA5H 3HS0C 5EBDA 1JWMD 5EAYA 3BJUA 2M00A 2R3ZA 4ZUJA 1Y1WG 2NN6G 1EU4A 5HGQA 2F3WA 1AZQA 4DR1L 1XYIA 4A3IG 5EBCA 5EKLA 1I4RA 2BCOA 5JJIA 2FXQA 2XVSA 4L5RC 3KLWA 3GO5A 1JT8A 3TMEA 1WI5A 3HKZG 4LF5L 1A62A 2EY5A 2QW7A 3BDOA 5C0XH 1AP0A 3HOWB 1CSPA 1WCMB 4RHRA 4PZ8A 5C5LA 2OTLA 3BZKA 4HTHA 3B6YA 4X3SA 2K14A 1CZGA 2BDNA 1NJIC 1VQ8A 3J80L 5BR8Q 1STGA 1CQFA 1EQVA 1LYLA 3ITPA 5M5XH 3PO3G 1AW7A 3QG1A 1ZYRC 4NDXA 4ULLA 4XIGS 2MPMA 1XMOQ 2SNMA 2UUBQ 5GADC 1KHIA 3K6OA 1IBMQ 3OW7A 2AHOB 3D6WA 2K1BA 2VY3A 2PW7A 1W6JA 1ASZA 4ALPA 5DNFA 1HH2P 5J1ZA 4F87A 3FRPB 1MGSA 4L5SA 2RCNA 2EOTA 4HIMA 1FGBD 2F0PA 4K0KL 2KCCA 1H9RA 4BY1G 4DV3Q 1RD9D 2F0MA 5FLXL 5GAHC 1EZ8A 4JI7L 5C4JH 3S1RB 2NBFA 2CW0D 5D14A 3PO3H 4CJ1B 1IBML 1C7YA 4HAEA 1HNZQ 2L55A 2JYOA 1K8AC 3HOXB 1EEFD 3ULPA 1V1PA 5K36H 1WVLA 1JOKA 2RHSB 3HP3A 1EYCA 1DOLA 1V8QA 2WFWA 4GOPC 3AYHB 1MHWC 4IPGA 3I4MH 3OTOL 3VYUA 1TIID 1XNQL 3UI2A 2K32A 5JVG3 2HHHL 1Q86C 2BE5D 5GAEC 3TS2A 3DM3A 1SE4A 4DAMA 4GLXA 5J3BA 3BVGA 2BH8A 2CFMA 2HCCA 3WOFA 1E1TA 3NENA 1IYVA 4M1UB 1S5DD 2A6HC 4OX9Q 1H9KA 1OO9B 1TXYA 1DOMA 4DV6L 3CCVA 5E3FA 1LLRD 3M4PA 1SNQA 4C3IG 1QZHA 2CQAA 1I6HB 3OMCA 2UUCL 2QF7A 4FF3A 1Z47A 3M7NA 5CV5A 2ASBA 4IFDJ 1DGSA 2R6GA 3FPUB 3MXUA 1FNVA 3OSOA 4GOPA 4DXFA 4QCLA 1F2YA 1CSQA 3ERQA 2PMZE 1EY7A 4IUTA 2UXDL 1BDOA 3GTPB 3FKIB 1JWUD 3SGIA 1KIXA 4DV4L 5IYBH 1LTGD 1FNUA 1AE2A 5BN4A 4BXXG 1KXLA 4DAYB 2XSCA 1E22A 4DPGA 4A3LG 1A63A 1IKMA 1XWEA 1JJGA 1J9OA 4LF4L 1DXMA 3NELA 3PQIA 3F2UA 5LMUQ 1SNOA 1YJ9A 1G2SA 1Y8NB 3NHHA 4NKLA 1WD1A 5EGTA 4JV5L 4O2DA 1E7ZA 1FJGQ 2IY5B 4XT1B 2IT1A 2NWGA 2JN4A 1OXUA 4DAVA 4QF4A 3DEPA 4EQ5A 2KCNA 4A3BH 4QUFA 3CC7A 2QEJC 4O0AA 2ZXOA 4J1MA 5F2DA 3RNUA 1N32L 1F9RA 4A3EG 3C1FA 3E9IA 1KNAA 3Q22A 2EPBA 4MNOA 1WTPA 1HR0W 2PI2E 2DY7A 2VW9A 2J0TD 2VQFQ 2Z6KA 1WTQA 5C5MA 1SROA 4NXNL 3M3YB 4TKOB 2E2IB 5IYCG 3T1HL 1XPRA 2EYOA 4DK6C 1GUWA 5IYCH 2F4IA 2ZM6L 1HNWQ 2NTTA 1TS4A 2Z0SA 2MFIA 2NVYH 1L0WA 1EIFA 4BBSH 1BBUA 3N6RA 1N34L 1KDBA 1EY4A 1QG7A 5C3EG 5G3LD 4BA1I 1S5BD 1EWHA 4A3GG 3T16A 2N49A 1CQVA 1TT2A 3G6JB 3FPPA 3V2TA 3SE0A 4C3JB 1EY6A 2N78A 1PFNA 2J7ZA 4PMWA 1QVFA 3E6ZX 3I2ZA 2EYJA 3VR4A 1GHKA 3Q23A 4CJ2C 4NXNQ 1LUZA 4BY1H 4A3MH 4JBWA 1I4HA 3K7AB 2K50A 3HOYG 3A7AB 1KL9A 2YTYA 4TVAB 3J81L 3G71A 1Y8PB 2EZVA 4XTCS 4C1NI 1RIPA 4B3TL 2JEBI 3NTKA 3OIPA 2CW0C 4B3RQ 1RDPD 5BN3A 2ZXPA 2DGYA 1VQAA 5AJ3Q 2JA5G 3HOWG 1ENCA 3QWNA 1WTVA 2OXPA 1SMYC 4C3HH 3UDFA 4GNXB 1D6EC 1K8OA 2F0LA 5M5YH 4PMCA 4BBRB 2Q8IB 2E75C 2BE5C 2VUMB 4KLKA 4X62L 4RCOA 1PXUA 3K57A 4A3FB 1S5FD 2D5DA 3J7AV 1NAPA 4H0LC 4S3SA 4X3KA 5DAUA 5K5PA 3ONAB 2C9OA 2C35B 3RMHA 1GOZA 1QE6A 4CDCC 5EPJA 1X6OA 1WYDA 4EVOA 4L5QA 4XYQA 3GTQB 3JAMi 2A6HD 1PHJA 3OIQA 2Q2TA 1I50B 3DWAA 3S1QB 2OF1A 3MEFA 1EQQA 1CKOA 1FD7D 5IWAL 2NN6I 1PH7A 3NWTA 3ERSX 1IBKQ 2QILA 2RVLA 3BDLA 3GTJB 3PF4A 2DY8A 4UPAA 3HGBA 2A68C 3I73A 4ILWA 1CHPD 1FL0A 4X3UA 2Z6BA 1EFWA 4C3JG 4X64Q 2CWAA 3J80c 4DR2L 1VQHA 1I4GA 1MSHA 2BA1A 2D0PA 2RDHA 5M3FH 3EBEA 1VQFA 2E2HB 2WP8J 5M3FG 1AZPA 3K5NA 2MNAA 5I6WA 4CKBA 1YZ6A 4JI8Q 3M4OB 3GTOH 1YNND 3GTLB 2E8GA 2F52A 1SYEA 4DNRB 5DM63 1YITA 2VUMH 4UDUC 4JI5L 2VNUD 2KJXA 2EYPA 4LNQA 2AQ2B 4Y52H 1BXTA 2SOBA 1B4OA 3TEHB 3S9WA 2NVTH 2R93G 1BVSA 1S5CD 2ZTDA
chains in the Genus database with same CATH topology
4P75A 2JA7H 1PH4A 3BZCA 5IYDG 1XNRQ 4DV7Q 4DR2Q 2ALYB 4IOAA 1VQMA 4IPDA 1Q82C 1FVIA 1TWCH 3HFZB 5FLMG 4DV5Q 4LF5Q 2R7ZG 1N33Q 2Y0SG 2PQAA 3S1QH 3PO2G 4GKJQ 1VCIA 2OQ0A 1HJPA 1X3EA 1VQKA 3K81C 2XGTA 3F2CA 4HJAA 4DR5L 3KJPA 1NTGA 1P8LA 3I4OA 4IJHA 4POGA 1TWAH 1YBYA 1VQGA 4X66Q 3G6EA 4IFDG 3GTLH 4K0KQ 4A3JG 2ATWA 1G6PA 4A3KH 1UE5A 2Q2IA 2R92G 3EN2A 2ES2A 3DLLA 4UY8C 1NE3A 2VQEQ 4JI1L 3H3VH 5M3MG 1M1KC 4DUZQ 1YHAA 3RR5A 3FHWA 1HNZL 3S14H 2E5LL 1S3OA 3L7ZC 1E3PA 4GKKL 1EOVA 1SE8A 3G4SA 3CMEA 1GO3E 2K75A 5LMNW 1VQ7A 4WJ4A 1A0IA 4OONA 2UXCQ 3GDEA 1YHQA 3M85A 4YHHL 1HR0L 1YIJA 4DR1Q 1RL2A 4LF6L 2A1AA 1PH2A 2GVAA 2BA0A 3E0EA 1E24A 4IJLA 1UE1A 1EQRA 4JC0A 4YWKA 4DNIA 4YCUA 4MTNA 4R4QA 5C44G 3CCMA 1B8AA 1YJNA 3CCJA 1NMGA 3ICEA 2UXBL 1C9OA 2JE6I 3CMAA 3AEVA 5C44H 3VDYA 2UXDQ 2WAQE 5IE8A 2ZM6Q 3CCQA 1N36L 1HNWL 3NBHB 2K4KA 4KI0A 4AH6A 4AYBG 1C0AA 2UUAQ 4DR6L 1NBWA 4JI2L 1KQSA 3S2DH 1CUKA 3KF6B 4AQYQ 5HY6A 2BH2A 2JQOA 4JI1Q 4C2MH 1IXRA 2VZAA 2RHQB 4DV3L 4YWLA 3H0GH 4X62Q 2JEAI 4QIWE 3ULLA 2EQSA 4YHHQ 1V1QA 3K7AH 1IBLQ 2UUCQ 5ELNA 4HIKA 2AKWB 2B3GA 4P72A 1L1OB 3FKIH 3CCSA 4JBMA 4DV1L 4IOCA 3JC66 2JA5H 3UDGA 1I94L 5GROA 5EAYA 3BJUA 2CCZA 3KDFA 1L2FA 1VQJA 1VQCA 2NN6G 1Y1WG 1X9NA 1PH5A 3AFPA 5HGQA 2R92H 1Q8KA 4A93H 4DR1L 4QY7A 3CCLA 4DR7Q 4DV7L 4A3IG 2I5LX 3CC2A 4BXXH 1N9WA 1Q12A 5JJIA 2FXQA 3MXNB 4L5RC 3KLWA 3GO5A 1JT8A 1WI5A 3CF5A 3RZDH 4B3TQ 3J7ZC 1S72A 3HKZG 4JOIA 4LF5L 1A62A 2UUBL 1P16A 2WB1E 4LF9Q 1EYGA 2F3IA 3CXCA 1CSPA 4LWCA 1VQBA 3RZOH 1N33L 1VS0A 2YTVA 4PZ8A 1TWFH 4R4IA 4DV1Q 1Y1VH 3BZKA 1O7IA 3W1GA 3B6YA 2OTLA 2K14A 2OTJA 2GN5A 3WWVA 1G51A 1B70B 4JI8L 4A3FH 1NJIC 1VQ8A 3UDXA 5BR8Q 1YEZA 2ZJRA 2JA6H 3PCOB 4DV2L 1LYLA 5M5XH 3HOVG 3PO3G 4YCVA 1VQOA 1VQLA 1J5EQ 1I94Q 2I0QA 4KHPQ 1L1OA 3J81j 3M4QA 2HT1A 3U58A 1Y14B 3S1RH 3I7FA 3PUZA 1OXTA 1LM0A 4XIGS 4LUVA 4DK3C 4X65Q 3RLFA 1XMOQ 1UE6A 2UUBQ 4LF8L 5GADC 1KHIA 1IBMQ 1K83H 1XPUA 2D62A 2AHOB 2UXCL 2VY3A 1ASZA 3STBD 1IBKL 4AIMA 1SMXA 4ALPA 5C4XH 1PV4A 1HH2P 4Y7NH 3CPWA 1YNXA 2CQOA 4JI0L 2UU9L 4A3KG 4JI3Q 4DR3Q 1W2BA 3GTQH 4L5SA 2RCNA 2IX1A 4HIMA 2KBNA 3W5OA 3ZJYC 3PSIA 1PYSB 1SN8A 1X3GA 4LFBL 1NMFA 3HKZE 4K0KL 1XNQQ 1G291 3PO2H 3UE1A 4LF7L 3HOZG 1QVCA 1SRUA 2I5HA 2IHFA 3D0FA 4BY1G 4DV3Q 1GM5A 2E2JH 4DR5Q 5GAHC 4DUYL 4JI7L 3KYHC 5C4JH 3L0OA 1KRTA 5IYDH 4LUOA 1GKHA 3HOVH 1N8RC 3PO3H 4BY7H 3A0JA 4JCVE 4RMFA 4R4CA 4GNXC 1IBML 2YV5A 4UP7A 1EWIA 1C7YA 1HNZQ 1XMOL 4JI5Q 5LMUL 2QA4A 3T1YQ 2LXJA 3KF6A 1K8AC 1HNXL 2VQEL 1KC8C 1VQ9A 1MJEA 3S2HH 3ULPA 2HIVA 1I3QH 1HZBA 2RHSB 2WFWA 4GOPC 1E1OA 5C0XG 3AYHB 4IPGA 2Z6KC 3S1MH 3I4MH 4QGUA 3OTOL 4A4IA 2ZTCA 1XNQL 4NB3A 2F4VL 3J80i 2HHHL 4LF6Q 1SLJA 3J81c 5GAEC 1Q86C 3CCRA 1XPOA 2WB1G 1JE5A 1WCMG 4GN5A 5LMNQ 3HOUH 3TS2A 2ID0A 3DM3A 4DV5L 4OO1G 2PQAB 3FKIG 3TQYA 4JI6L 4DAMA 4GLXA 4DV2Q 3S1NH 4YWMA 5J3BA 3NEMA 4DV6Q 1OTCA 2HHHQ 1MIUA 2BH8A 2JA8H 2CFMA 2NVXH 4DUYQ 3U4VA 2ZJQA 5BR8L 1E1TA 3NENA 5IP9G 3HOWH 1PH3A 4A3CH 1KAWA 4IPCA 1YI2A 1SFOH 2MO0A 1K3RA 2KHIA 1IL2A 4P74A 4ME3A 4OWXB 3PGZA 3CC4A 4OX9Q 4AQYL 4GS3A 1KRSA 1TXYA 1B7YB 4DV6L 2K5NA 1I5FA 1IZ6A 3F1ZA 3CCVA 1PH6A 3S17H 3M4PA 2ZTEA 2R7ZH 4B3SL 1U0LA 3CW2C 1QZHA 1S40A 4WJ3M 5FJ8H 1YVCA 1Q7YC 1IBLL 2UUCL 4DR7L 1MKHA 1X54A 1OXXK 3M7NA 1Z47A 5IWAQ 4TQUS 3UE0A 3KDFB 3F2BA 2F4VQ 4BBRH 2LXKA 2PI2A 2OCEA 4A3FG 1HR0Q 1DGSA 1TWHH 2HQLA 2R6GA 3I56A 4HIOA 2ASBA 4BY7G 5IP7H 4DR4Q 4JV5Q 4AYBE 4YY3L 4A3GH 3PUXA 1Z9FA 4GOPA 4JG2A 4L5TA 2YU9H 1A8VA 4JBJA 1VQ5A 4UP8A 4J15A 2IX0A 3CPFA 1CSQA 1R9TH 5DLQE 2QGQA 2PMZE 4LW1A 2LSSA 2UXDL 4DUZL 4HJ9A 3K7UC 1WOCA 3SGIA 4JI7Q 4YY3Q 5C3EH 4APVA 4R4TA 5IYBH 1V43A 4DV4L 1KIXA 4A3LH 1AE2A 1QUQB 2UXBQ 4BXXG 1KXLA 3D31A 1YHBA 4DAYB 1OXVA 1E22A 2VQFL 4DPGA 1VQNA 4LFAL 1WCMH 3W1BA 5M3MH 4A3LG 2N8NA 1A63A 3K8AA 1JJGA 2R7DA 4IFDI 1PVOA 3K80C 4HJ5A 4LF4L 1N32Q 4LUZA 1HNXQ 2N3SA 3I4MG 3NELA 2AWNA 4GLAC 5LMUQ 4GLVB 1YJ9A 4KHPL 3HKSA 3TREA 1Q1BA 1WJJA 2MQHA 3T1HQ 3KFUA 4PZ7A 4JI4L 1BKBA 4A3EH 3S15H 2WAQG 3M4OH 4DR4L 3AQQA 4OWWB 4JV5L 4O2DA 5AJ3L 1E7ZA 1FJGQ 2IY5B 1VQDA 2NZHA 2B63H 4A3BG 1PH1A 3I4NG 2IT1A 1FGUA 1OXUA 5IP7G 3HOYH 4X6AH 2A8VA 3CQZH 3S16H 4EQ5A 4JI4Q 3Q8DA 5JEAJ 1QVGA 4A3BH 4C3IH 3CC7A 4RG1A 4JI0Q 4GKJL 4O0AA 4KHZA 4GNXA 1VQPA 1M90C 3RNUA 4LF4Q 1N32L 4A3EG 2PNHA 1CKNA 2R7FA 3E9IA 3UDIA 4MNOA 3RLNA 4LFAQ 1HR0W 2PI2E 3PIOA 4LF7Q 4A3CG 3CP0A 1H95A 2VW9A 4A3IH 5IP9H 2VQFQ 3GTKH 2Z6KA 3ER0A 2CKZB 1BBWA 3A74A 3M9BA 3J7A5 1SROA 1V9PA 4B3MQ 4NXNL 4POFA 1I50H 2K5HA 5IYCG 3T1HL 1U5KA 4IO9A 4DV0L 1XPRA 4JYAQ 1T9HA 1WFQA 4DK6C 3AFQA 3I55A 5IYCH 2DUDA 2Q2HA 5IT9c 3H3VI 1J6QA 1Q81C 4YCWA 2Y0SE 2ZM6L 1Y1WH 1HNWQ 4LFCL 2Z0SA 3EIVA 2MFIA 2NVYH 2OWOA 4B3ML 3PUYA 1L0WA 1QZGA 1EIFA 1UE7A 4BBSH 1BBUA 5IY0A 4A76A 1I6HH 1EUJA 3JAMc 1N34L 5FLMH 5C3EG 3HOUG 4BA1I 2VL6A 4FDBA 4DKAC 1HZ9A 4A3GG 4R1JA 2N49A 4DR6Q 5GQOA 3H0GG 1K73C 2B29A 4B3RL 3STBC 2N78A 5LMNL 4BA2I 2MO1A 1JB7A 2RF4A 4PMWA 1QVFA 2R93H 1KD1C 3U4ZA 2JA9A 3I2ZA 4X64L 4DR3L 5M5WH 2I5MX 4DV0Q 1X56A 3FP9A 4NXNQ 4A3DG 1LUZA 4BY1H 4A3MH 4JBWA 4GN3B 3IRBA 4H02A 3HOZH 4X66L 3GTPH 2K50A 3HOYG 1SR3A 1HZCA 1KL9A 2YTYA 4TVAB 4GN4B 2JK8A 3G71A 3M3YH 4GOPB 3F8TA 3KOJA 4B3SQ 5FJ8G 1GVPA 1AE3A 3GTGH 4XTCS 1D8LA 5JJKA 1RIPA 1TWGH 5E7NA 3K0XA 4B3TL 5H1SE 2JEBI 4OX9L 4QL5A 2JA8G 4JBKA 2AWOA 4B3RQ 2UU9Q 1FJGL 2OQKA 3LGJA 1J5EL 4IPHA 1OXSC 1VQIA 3HOXH 2KHJA 2DGYA 1VQAA 4R4OA 5AJ3Q 4A3JH 1N34Q 2JA5G 3HOWG 4BBSG 3KF8B 2YTXA 3RN5A 3U50C 1MJCA 4JI2Q 4LFBQ 4X65L 1UWVA 2AMCB 3OW2A 5C4XG 2GVBA 4C3HH 3UDFA 2QEXA 4GNXB 2Q2UA 2EIFA 1D7QA 5M5YH 4C3JH 4QQBX 2UUAL 5ELOA 4UP9A 4NPSA 2D0OA 4P73A 1YJWA 1CKMA 1X55A 1N36Q 5C0XI 1JMCA 4KLKA 4X62L 1UEBA 3OTOQ 1IYJB 1JJ2A 2L15A 3CD6A 2KCMA 4A3MG 5GAGC 4A3DH 4LF8Q 2E2HH 4DV4Q 2C35B 5K36G 4A75A 3PV0A 1XMQQ 1ASYA 3RN2A 3L2PA 1JJCB 2JA7G 3I4NH 4JYAL 4JOIC 4HIDA 1X6OA 1WYDA 4L5QA 1K8GA 4BBRG 2H5XA 4EX5A 1EIYB 3JAMi 4NXMQ 2VUMG 3TRZA 1PHJA 2XTIA 2E5LQ 2Q2TA 1CKNB 1Y1VG 4JI3L 4HJ8A 2E2IH 2CWPA 3MEFA 4MZ9A 1EQQA 1VQ4A 1CKOA 1QUQA 1LTLA 2B63G 3PUWA 5IWAL 4HJ7A 2NN6I 1PH7A 3ERSX 1IBKQ 1W3SA 4P71A 3E9HA 2ZJPA 2K52A 3PF5A 3PF4A 1Q1EA 3F2DA 2YYZA 3T1YL 1VQ6A 4UPAA 4LF9L 3S24A 3GTMH 1GD7A 3CAMA 3ULJA 2A19A 1L1OC 1FL0A 1EFWA 4QJFA 4X64Q 4DR2L 2CWAA 3J80c 5JJLA 3PUVA 1VQHA 2BA1A 3J81i 5C0XJ 1X65A 5JEAG 2D0PA 5M3FH 4PG3A 4A93G 1PA6A 3CCEA 3RLOA 3EBEA 3GD7A 3BU2A 1VQFA 2NZOA 1XJVA 1PYBA 2WP8J 5M3FG 4OO1I 1K9MC 1XNRL 1XMQL 2MNAA 1AH9A 1YZ6A 3PIPA 1Q46A 2JJQA 4OWTB 2KENA 5IYBG 3A5ZB 4JI8Q 3HOXG 1PH9A 2K5VA 3GTOH 4JI6Q 2EXDA 4NXML 2E8GA 3OYYA 3CCUA 2HIXA 2IHEA 2F52A 2V1CC 5FLXc 1YITA 4OXPA 2VUMH 1HZAA 4JI5L 1PFSA 2VNUD 1K0RA 4LNQA 1PH8A 2KCTA 1XTDA 3KJOA 2NVQH 4GKKQ 4IFDJ 1X3FA 4Y52H 3TEHB 1NY4A 3H15A 2VS1A 3G48A 2NVTH 3GTJH 1VQEA 3A5UA 1BVSA 4PZ6A 3TS0A 2JA6G 2R93G 4LFCQ 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 A;  2JA7 H;  1PH4 A;  3BZC A;  5IYD G;  1XNR Q;  4DV7 Q;  4DR2 Q;  2ALY B;  4IOA A;  1VQM A;  4IPD A;  1Q82 C;  1FVI A;  1TWC H;  3HFZ B;  5FLM G;  4DV5 Q;  4LF5 Q;  2R7Z G;  1N33 Q;  2Y0S G;  2PQA A;  3S1Q H;  3PO2 G;  4GKJ Q;  1VCI A;  2OQ0 A;  1HJP A;  1X3E A;  1VQK A;  3K81 C;  2XGT A;  3F2C A;  4HJA A;  4DR5 L;  3KJP A;  1NTG A;  1P8L A;  3I4O A;  4IJH A;  4POG A;  1TWA H;  1YBY A;  1VQG A;  4X66 Q;  3G6E A;  4IFD G;  3GTL H;  4K0K Q;  4A3J G;  2ATW A;  1G6P A;  4A3K H;  1UE5 A;  2Q2I A;  2R92 G;  3EN2 A;  2ES2 A;  3DLL A;  4UY8 C;  1NE3 A;  2VQE Q;  4JI1 L;  3H3V H;  5M3M G;  1M1K C;  4DUZ Q;  1YHA A;  3RR5 A;  3FHW A;  1HNZ L;  3S14 H;  2E5L L;  1S3O A;  3L7Z C;  1E3P A;  4GKK L;  1EOV A;  1SE8 A;  3G4S A;  3CME A;  1GO3 E;  2K75 A;  5LMN W;  1VQ7 A;  4WJ4 A;  1A0I A;  4OON A;  2UXC Q;  3GDE A;  1YHQ A;  3M85 A;  4YHH L;  1HR0 L;  1YIJ A;  4DR1 Q;  1RL2 A;  4LF6 L;  2A1A A;  1PH2 A;  2GVA A;  2BA0 A;  3E0E A;  1E24 A;  4IJL A;  1UE1 A;  1EQR A;  4JC0 A;  4YWK A;  4DNI A;  4YCU A;  4MTN A;  4R4Q A;  5C44 G;  3CCM A;  1B8A A;  1YJN A;  3CCJ A;  1NMG A;  3ICE A;  2UXB L;  1C9O A;  2JE6 I;  3CMA A;  3AEV A;  5C44 H;  3VDY A;  2UXD Q;  2WAQ E;  5IE8 A;  2ZM6 Q;  3CCQ A;  1N36 L;  1HNW L;  3NBH B;  2K4K A;  4KI0 A;  4AH6 A;  4AYB G;  1C0A A;  2UUA Q;  4DR6 L;  1NBW A;  4JI2 L;  1KQS A;  3S2D H;  1CUK A;  3KF6 B;  4AQY Q;  5HY6 A;  2BH2 A;  2JQO A;  4JI1 Q;  4C2M H;  1IXR A;  2VZA A;  2RHQ B;  4DV3 L;  4YWL A;  3H0G H;  4X62 Q;  2JEA I;  4QIW E;  3ULL A;  2EQS A;  4YHH Q;  1V1Q A;  3K7A H;  1IBL Q;  2UUC Q;  5ELN A;  4HIK A;  2AKW B;  2B3G A;  4P72 A;  1L1O B;  3FKI H;  3CCS A;  4JBM A;  4DV1 L;  4IOC A;  3JC6 6;  2JA5 H;  3UDG A;  1I94 L;  5GRO A;  5EAY A;  3BJU A;  2CCZ A;  3KDF A;  1L2F A;  1VQJ A;  1VQC A;  2NN6 G;  1Y1W G;  1X9N A;  1PH5 A;  3AFP A;  5HGQ A;  2R92 H;  1Q8K A;  4A93 H;  4DR1 L;  4QY7 A;  3CCL A;  4DR7 Q;  4DV7 L;  4A3I G;  2I5L X;  3CC2 A;  4BXX H;  1N9W A;  1Q12 A;  5JJI A;  2FXQ A;  3MXN B;  4L5R C;  3KLW A;  3GO5 A;  1JT8 A;  1WI5 A;  3CF5 A;  3RZD H;  4B3T Q;  3J7Z C;  1S72 A;  3HKZ G;  4JOI A;  4LF5 L;  1A62 A;  2UUB L;  1P16 A;  2WB1 E;  4LF9 Q;  1EYG A;  2F3I A;  3CXC A;  1CSP A;  4LWC A;  1VQB A;  3RZO H;  1N33 L;  1VS0 A;  2YTV A;  4PZ8 A;  1TWF H;  4R4I A;  4DV1 Q;  1Y1V H;  3BZK A;  1O7I A;  3W1G A;  3B6Y A;  2OTL A;  2K14 A;  2OTJ A;  2GN5 A;  3WWV A;  1G51 A;  1B70 B;  4JI8 L;  4A3F H;  1NJI C;  1VQ8 A;  3UDX A;  5BR8 Q;  1YEZ A;  2ZJR A;  2JA6 H;  3PCO B;  4DV2 L;  1LYL A;  5M5X H;  3HOV G;  3PO3 G;  4YCV A;  1VQO A;  1VQL A;  1J5E Q;  1I94 Q;  2I0Q A;  4KHP Q;  1L1O A;  3J81 j;  3M4Q A;  2HT1 A;  3U58 A;  1Y14 B;  3S1R H;  3I7F A;  3PUZ A;  1OXT A;  1LM0 A;  4XIG S;  4LUV A;  4DK3 C;  4X65 Q;  3RLF A;  1XMO Q;  1UE6 A;  2UUB Q;  4LF8 L;  5GAD C;  1KHI A;  1IBM Q;  1K83 H;  1XPU A;  2D62 A;  2AHO B;  2UXC L;  2VY3 A;  1ASZ A;  3STB D;  1IBK L;  4AIM A;  1SMX A;  4ALP A;  5C4X H;  1PV4 A;  1HH2 P;  4Y7N H;  3CPW A;  1YNX A;  2CQO A;  4JI0 L;  2UU9 L;  4A3K G;  4JI3 Q;  4DR3 Q;  1W2B A;  3GTQ H;  4L5S A;  2RCN A;  2IX1 A;  4HIM A;  2KBN A;  3W5O A;  3ZJY C;  3PSI A;  1PYS B;  1SN8 A;  1X3G A;  4LFB L;  1NMF A;  3HKZ E;  4K0K L;  1XNQ Q;  1G29 1;  3PO2 H;  3UE1 A;  4LF7 L;  3HOZ G;  1QVC A;  1SRU A;  2I5H A;  2IHF A;  3D0F A;  4BY1 G;  4DV3 Q;  1GM5 A;  2E2J H;  4DR5 Q;  5GAH C;  4DUY L;  4JI7 L;  3KYH C;  5C4J H;  3L0O A;  1KRT A;  5IYD H;  4LUO A;  1GKH A;  3HOV H;  1N8R C;  3PO3 H;  4BY7 H;  3A0J A;  4JCV E;  4RMF A;  4R4C A;  4GNX C;  1IBM L;  2YV5 A;  4UP7 A;  1EWI A;  1C7Y A;  1HNZ Q;  1XMO L;  4JI5 Q;  5LMU L;  2QA4 A;  3T1Y Q;  2LXJ A;  3KF6 A;  1K8A C;  1HNX L;  2VQE L;  1KC8 C;  1VQ9 A;  1MJE A;  3S2H H;  3ULP A;  2HIV A;  1I3Q H;  1HZB A;  2RHS B;  2WFW A;  4GOP C;  1E1O A;  5C0X G;  3AYH B;  4IPG A;  2Z6K C;  3S1M H;  3I4M H;  4QGU A;  3OTO L;  4A4I A;  2ZTC A;  1XNQ L;  4NB3 A;  2F4V L;  3J80 i;  2HHH L;  4LF6 Q;  1SLJ A;  3J81 c;  5GAE C;  1Q86 C;  3CCR A;  1XPO A;  2WB1 G;  1JE5 A;  1WCM G;  4GN5 A;  5LMN Q;  3HOU H;  3TS2 A;  2ID0 A;  3DM3 A;  4DV5 L;  4OO1 G;  2PQA B;  3FKI G;  3TQY A;  4JI6 L;  4DAM A;  4GLX A;  4DV2 Q;  3S1N H;  4YWM A;  5J3B A;  3NEM A;  4DV6 Q;  1OTC A;  2HHH Q;  1MIU A;  2BH8 A;  2JA8 H;  2CFM A;  2NVX H;  4DUY Q;  3U4V A;  2ZJQ A;  5BR8 L;  1E1T A;  3NEN A;  5IP9 G;  3HOW H;  1PH3 A;  4A3C H;  1KAW A;  4IPC A;  1YI2 A;  1SFO H;  2MO0 A;  1K3R A;  2KHI A;  1IL2 A;  4P74 A;  4ME3 A;  4OWX B;  3PGZ A;  3CC4 A;  4OX9 Q;  4AQY L;  4GS3 A;  1KRS A;  1TXY A;  1B7Y B;  4DV6 L;  2K5N A;  1I5F A;  1IZ6 A;  3F1Z A;  3CCV A;  1PH6 A;  3S17 H;  3M4P A;  2ZTE A;  2R7Z H;  4B3S L;  1U0L A;  3CW2 C;  1QZH A;  1S40 A;  4WJ3 M;  5FJ8 H;  1YVC A;  1Q7Y C;  1IBL L;  2UUC L;  4DR7 L;  1MKH A;  1X54 A;  1OXX K;  3M7N A;  1Z47 A;  5IWA Q;  4TQU S;  3UE0 A;  3KDF B;  3F2B A;  2F4V Q;  4BBR H;  2LXK A;  2PI2 A;  2OCE A;  4A3F G;  1HR0 Q;  1DGS A;  1TWH H;  2HQL A;  2R6G A;  3I56 A;  4HIO A;  2ASB A;  4BY7 G;  5IP7 H;  4DR4 Q;  4JV5 Q;  4AYB E;  4YY3 L;  4A3G H;  3PUX A;  1Z9F A;  4GOP A;  4JG2 A;  4L5T A;  2YU9 H;  1A8V A;  4JBJ A;  1VQ5 A;  4UP8 A;  4J15 A;  2IX0 A;  3CPF A;  1CSQ A;  1R9T H;  5DLQ E;  2QGQ A;  2PMZ E;  4LW1 A;  2LSS A;  2UXD L;  4DUZ L;  4HJ9 A;  3K7U C;  1WOC A;  3SGI A;  4JI7 Q;  4YY3 Q;  5C3E H;  4APV A;  4R4T A;  5IYB H;  1V43 A;  4DV4 L;  1KIX A;  4A3L H;  1AE2 A;  1QUQ B;  2UXB Q;  4BXX G;  1KXL A;  3D31 A;  1YHB A;  4DAY B;  1OXV A;  1E22 A;  2VQF L;  4DPG A;  1VQN A;  4LFA L;  1WCM H;  3W1B A;  5M3M H;  4A3L G;  2N8N A;  1A63 A;  3K8A A;  1JJG A;  2R7D A;  4IFD I;  1PVO A;  3K80 C;  4HJ5 A;  4LF4 L;  1N32 Q;  4LUZ A;  1HNX Q;  2N3S A;  3I4M G;  3NEL A;  2AWN A;  4GLA C;  5LMU Q;  4GLV B;  1YJ9 A;  4KHP L;  3HKS A;  3TRE A;  1Q1B A;  1WJJ A;  2MQH A;  3T1H Q;  3KFU A;  4PZ7 A;  4JI4 L;  1BKB A;  4A3E H;  3S15 H;  2WAQ G;  3M4O H;  4DR4 L;  3AQQ A;  4OWW B;  4JV5 L;  4O2D A;  5AJ3 L;  1E7Z A;  1FJG Q;  2IY5 B;  1VQD A;  2NZH A;  2B63 H;  4A3B G;  1PH1 A;  3I4N G;  2IT1 A;  1FGU A;  1OXU A;  5IP7 G;  3HOY H;  4X6A H;  2A8V A;  3CQZ H;  3S16 H;  4EQ5 A;  4JI4 Q;  3Q8D A;  5JEA J;  1QVG A;  4A3B H;  4C3I H;  3CC7 A;  4RG1 A;  4JI0 Q;  4GKJ L;  4O0A A;  4KHZ A;  4GNX A;  1VQP A;  1M90 C;  3RNU A;  4LF4 Q;  1N32 L;  4A3E G;  2PNH A;  1CKN A;  2R7F A;  3E9I A;  3UDI A;  4MNO A;  3RLN A;  4LFA Q;  1HR0 W;  2PI2 E;  3PIO A;  4LF7 Q;  4A3C G;  3CP0 A;  1H95 A;  2VW9 A;  4A3I H;  5IP9 H;  2VQF Q;  3GTK H;  2Z6K A;  3ER0 A;  2CKZ B;  1BBW A;  3A74 A;  3M9B A;  3J7A 5;  1SRO A;  1V9P A;  4B3M Q;  4NXN L;  4POF A;  1I50 H;  2K5H A;  5IYC G;  3T1H L;  1U5K A;  4IO9 A;  4DV0 L;  1XPR A;  4JYA Q;  1T9H A;  1WFQ A;  4DK6 C;  3AFQ A;  3I55 A;  5IYC H;  2DUD A;  2Q2H A;  5IT9 c;  3H3V I;  1J6Q A;  1Q81 C;  4YCW A;  2Y0S E;  2ZM6 L;  1Y1W H;  1HNW Q;  4LFC L;  2Z0S A;  3EIV A;  2MFI A;  2NVY H;  2OWO A;  4B3M L;  3PUY A;  1L0W A;  1QZG A;  1EIF A;  1UE7 A;  4BBS H;  1BBU A;  5IY0 A;  4A76 A;  1I6H H;  1EUJ A;  3JAM c;  1N34 L;  5FLM H;  5C3E G;  3HOU G;  4BA1 I;  2VL6 A;  4FDB A;  4DKA C;  1HZ9 A;  4A3G G;  4R1J A;  2N49 A;  4DR6 Q;  5GQO A;  3H0G G;  1K73 C;  2B29 A;  4B3R L;  3STB C;  2N78 A;  5LMN L;  4BA2 I;  2MO1 A;  1JB7 A;  2RF4 A;  4PMW A;  1QVF A;  2R93 H;  1KD1 C;  3U4Z A;  2JA9 A;  3I2Z A;  4X64 L;  4DR3 L;  5M5W H;  2I5M X;  4DV0 Q;  1X56 A;  3FP9 A;  4NXN Q;  4A3D G;  1LUZ A;  4BY1 H;  4A3M H;  4JBW A;  4GN3 B;  3IRB A;  4H02 A;  3HOZ H;  4X66 L;  3GTP H;  2K50 A;  3HOY G;  1SR3 A;  1HZC A;  1KL9 A;  2YTY A;  4TVA B;  4GN4 B;  2JK8 A;  3G71 A;  3M3Y H;  4GOP B;  3F8T A;  3KOJ A;  4B3S Q;  5FJ8 G;  1GVP A;  1AE3 A;  3GTG H;  4XTC S;  1D8L A;  5JJK A;  1RIP A;  1TWG H;  5E7N A;  3K0X A;  4B3T L;  5H1S E;  2JEB I;  4OX9 L;  4QL5 A;  2JA8 G;  4JBK A;  2AWO A;  4B3R Q;  2UU9 Q;  1FJG L;  2OQK A;  3LGJ A;  1J5E L;  4IPH A;  1OXS C;  1VQI A;  3HOX H;  2KHJ A;  2DGY A;  1VQA A;  4R4O A;  5AJ3 Q;  4A3J H;  1N34 Q;  2JA5 G;  3HOW G;  4BBS G;  3KF8 B;  2YTX A;  3RN5 A;  3U50 C;  1MJC A;  4JI2 Q;  4LFB Q;  4X65 L;  1UWV A;  2AMC B;  3OW2 A;  5C4X G;  2GVB A;  4C3H H;  3UDF A;  2QEX A;  4GNX B;  2Q2U A;  2EIF A;  1D7Q A;  5M5Y H;  4C3J H;  4QQB X;  2UUA L;  5ELO A;  4UP9 A;  4NPS A;  2D0O A;  4P73 A;  1YJW A;  1CKM A;  1X55 A;  1N36 Q;  5C0X I;  1JMC A;  4KLK A;  4X62 L;  1UEB A;  3OTO Q;  1IYJ B;  1JJ2 A;  2L15 A;  3CD6 A;  2KCM A;  4A3M G;  5GAG C;  4A3D H;  4LF8 Q;  2E2H H;  4DV4 Q;  2C35 B;  5K36 G;  4A75 A;  3PV0 A;  1XMQ Q;  1ASY A;  3RN2 A;  3L2P A;  1JJC B;  2JA7 G;  3I4N H;  4JYA L;  4JOI C;  4HID A;  1X6O A;  1WYD A;  4L5Q A;  1K8G A;  4BBR G;  2H5X A;  4EX5 A;  1EIY B;  3JAM i;  4NXM Q;  2VUM G;  3TRZ A;  1PHJ A;  2XTI A;  2E5L Q;  2Q2T A;  1CKN B;  1Y1V G;  4JI3 L;  4HJ8 A;  2E2I H;  2CWP A;  3MEF A;  4MZ9 A;  1EQQ A;  1VQ4 A;  1CKO A;  1QUQ A;  1LTL A;  2B63 G;  3PUW A;  5IWA L;  4HJ7 A;  2NN6 I;  1PH7 A;  3ERS X;  1IBK Q;  1W3S A;  4P71 A;  3E9H A;  2ZJP A;  2K52 A;  3PF5 A;  3PF4 A;  1Q1E A;  3F2D A;  2YYZ A;  3T1Y L;  1VQ6 A;  4UPA A;  4LF9 L;  3S24 A;  3GTM H;  1GD7 A;  3CAM A;  3ULJ A;  2A19 A;  1L1O C;  1FL0 A;  1EFW A;  4QJF A;  4X64 Q;  4DR2 L;  2CWA A;  3J80 c;  5JJL A;  3PUV A;  1VQH A;  2BA1 A;  3J81 i;  5C0X J;  1X65 A;  5JEA G;  2D0P A;  5M3F H;  4PG3 A;  4A93 G;  1PA6 A;  3CCE A;  3RLO A;  3EBE A;  3GD7 A;  3BU2 A;  1VQF A;  2NZO A;  1XJV A;  1PYB A;  2WP8 J;  5M3F G;  4OO1 I;  1K9M C;  1XNR L;  1XMQ L;  2MNA A;  1AH9 A;  1YZ6 A;  3PIP A;  1Q46 A;  2JJQ A;  4OWT B;  2KEN A;  5IYB G;  3A5Z B;  4JI8 Q;  3HOX G;  1PH9 A;  2K5V A;  3GTO H;  4JI6 Q;  2EXD A;  4NXM L;  2E8G A;  3OYY A;  3CCU A;  2HIX A;  2IHE A;  2F52 A;  2V1C C;  5FLX c;  1YIT A;  4OXP A;  2VUM H;  1HZA A;  4JI5 L;  1PFS A;  2VNU D;  1K0R A;  4LNQ A;  1PH8 A;  2KCT A;  1XTD A;  3KJO A;  2NVQ H;  4GKK Q;  4IFD J;  1X3F A;  4Y52 H;  3TEH B;  1NY4 A;  3H15 A;  2VS1 A;  3G48 A;  2NVT H;  3GTJ H;  1VQE A;  3A5U A;  1BVS A;  4PZ6 A;  3TS0 A;  2JA6 G;  2R93 G;  4LFC Q;  2ZTD A; 
#chains in the Genus database with same CATH topology
 4HSP A;  2L5T A;  1O7Y A;  5IYD G;  4DV7 Q;  2HDM A;  1X3P A;  2B2W A;  4IOA A;  3J7A F;  5JVH 3;  3BG3 A;  4XQQ A;  1IYU A;  3O13 A;  1CM9 A;  1FVI A;  3HFZ B;  1PZJ D;  5FLM G;  4DV5 Q;  1N33 Q;  2PQA A;  4DA2 A;  3PO2 G;  1HJP A;  3S2D B;  4K8I A;  4HJA A;  4FF1 A;  2EY6 A;  4IFD G;  4MN3 A;  5IOC A;  2MP1 A;  4A3K H;  3EN2 A;  4UY8 C;  2VQE Q;  1DCZ A;  1DZ1 A;  1A6X A;  1YHA A;  2A6E C;  1RCV D;  5FO7 B;  3DUZ A;  1HNZ L;  3MXP A;  4DN4 M;  1KDA A;  5IT9 E;  2RQX A;  3P1H A;  3CME A;  1GO3 E;  1F9Q A;  5LMN W;  1QCB D;  4WJ4 A;  2UXC Q;  1YHQ A;  4YHH L;  4DR1 Q;  1RL2 A;  3CHB D;  1PH2 A;  3KLS A;  1LTR D;  3E0E A;  4ODG A;  5C44 G;  1ICF B;  2UXB L;  4L6T B;  3CMA A;  1RTO A;  5C44 H;  2WAQ E;  5AFW A;  5IE8 A;  1QNU A;  5IIF A;  4I7Z C;  1C0A A;  2UUA Q;  4JI2 L;  1VMP A;  2B2W C;  1TVX A;  2Z9H A;  1CUK A;  4CGY B;  4FVM A;  2KVM A;  1ENA A;  3HRZ C;  3PO3 B;  4ZUI A;  1ET9 A;  2RHQ B;  2VZA A;  1TWF B;  1IW7 C;  4A3J B;  1IBL Q;  5ELN A;  3KBX A;  3E5S A;  2EJF C;  3NP8 A;  4HSV A;  3Q0A A;  1I94 L;  1SXT A;  1VQJ A;  1VQC A;  1X9N A;  1PH5 A;  2K03 A;  1Q8K A;  4A93 H;  4DV7 L;  4BXX H;  2I5L X;  1PFB A;  2L1B A;  2F0V A;  4JOI A;  2A5H A;  2FFK B;  2WB1 E;  3TP6 A;  1PFM A;  4LF9 Q;  1G6Z A;  4L8J A;  1SNM A;  4KTA A;  3GQB A;  3CXC A;  1VQB A;  1BCP F;  1VS0 A;  2EYM A;  2ZXR A;  3EJI A;  2B2U C;  4R4I A;  2OTJ A;  1QNK A;  1G51 A;  1MI2 A;  5JPN C;  4LAA A;  4BS9 A;  3PCO B;  2H1E A;  3HOV G;  1BCP D;  2A69 C;  1VQL A;  3LWU A;  2XWB B;  3TZD A;  1I94 Q;  2RDG A;  3J81 j;  3U58 A;  1Y14 B;  1SNC A;  5C4J B;  3S1R H;  4LUV A;  3RLF A;  2KEC A;  2CHB D;  5CR3 A;  1XPU A;  3C2P A;  2UXC L;  3STB D;  5IGB A;  1IBK L;  1PV4 A;  2PO4 A;  4JI0 L;  1YNX A;  5IGD A;  4JI3 Q;  4DR3 Q;  3GTQ H;  2IX1 A;  3D8G A;  1SND A;  3ZJY C;  1SYD A;  2R92 B;  1B1Z A;  1PYS B;  1B3Q A;  1SN8 A;  5NUC A;  1XNQ Q;  5G3L F;  1G29 1;  3UE1 A;  3HOZ G;  1QVC A;  3D0F A;  2I5H A;  1K8M A;  4MTK A;  3A56 A;  3A8J E;  4XDX A;  5T1I A;  3KYH C;  3A8I E;  1KRT A;  1FR3 A;  4LUO A;  3P20 A;  3HOV H;  5IYD H;  3A0J A;  2EE1 A;  5IGG A;  4R4C A;  4GNX C;  4UP7 A;  5I2Y A;  3FVQ A;  3I72 A;  2WAC A;  4JI5 Q;  5LMU L;  2QA4 A;  2LXJ A;  2VQE L;  1KC8 C;  1VQ9 A;  2HIV A;  1PRT B;  1K83 B;  1I3Q H;  1HZB A;  1CK1 A;  1S5E D;  4A4I A;  2L11 A;  1QB5 D;  2F4V L;  4LF6 Q;  1QOH A;  3J81 c;  3CRK C;  1TWA B;  3CCR A;  2SDF A;  4GN5 A;  1JE5 A;  1WCM G;  5LMN Q;  3HOU H;  3R93 A;  4DV5 L;  3LX0 A;  5KIX A;  1BBX C;  4JI6 L;  4YWM A;  5E4W C;  1O7Z A;  2JSO A;  5CMD A;  4EQN A;  1MIU A;  2DNE A;  1CT1 D;  3U4V A;  5BR8 L;  3HOW H;  1PH3 A;  1KAW A;  2EYL A;  2MO0 A;  1K3R A;  2KHI A;  1SFO H;  5LL6 S;  4OWX B;  4MHE A;  4N8X 1;  2K5N A;  1I5F A;  1PTO C;  1KDC A;  3KBG A;  1BO0 A;  1Q7Y C;  1LAC A;  1OXX K;  4TQU S;  2F4V Q;  3KDF B;  5COR A;  2LXK A;  2C5C A;  4A3K B;  2OCE A;  2HQL A;  4HIO A;  4DR4 Q;  4KY7 A;  1ML0 D;  2QCP X;  1AN8 A;  1FNW A;  4L5T A;  5JPM C;  1A8V A;  4J15 A;  2IX0 A;  3TP5 A;  4DUZ L;  2RSN A;  1WOC A;  3A7L A;  1LV9 A;  4YY3 Q;  2OEO A;  1BOS A;  1A2T A;  1D1K A;  1EZ6 A;  1DD2 A;  1OXV A;  2VQF L;  1VQN A;  4LFA L;  5M3M H;  2N8N A;  3K8A A;  3T53 B;  3DWQ A;  3HZX A;  4IFD I;  1PVO A;  5JAV A;  1K0S A;  4HJ5 A;  4FXK C;  2K6A A;  4GLV B;  4R9W A;  5IGE A;  1HQM C;  4U67 3;  3S15 H;  3SXH A;  3M4O H;  1SYG A;  2K33 A;  1F2Z A;  4DR4 L;  2B8G A;  2CH4 A;  4KY6 A;  1VQD A;  3K58 A;  2LFN A;  3I4N G;  2Z4H A;  4K5V A;  1LO5 D;  5IP7 G;  4ID6 A;  1SYF A;  1XX8 A;  4EGV A;  4X6A H;  4CKE A;  1QVG A;  3RZD B;  4C3I H;  4MIU A;  2JXM B;  4RG1 A;  3I4M B;  4GKJ L;  4K2L A;  4GNX A;  1YNJ D;  1ESF A;  2VB3 X;  3BVZ A;  1VQP A;  1O80 A;  4XXE A;  4H44 C;  1IKL A;  3PIO A;  4LF7 Q;  4A3C G;  2WKD A;  2Z1C A;  4ME5 A;  3M9B A;  3A74 A;  3J7A 5;  1V9P A;  1HCZ A;  3VR5 A;  4HCE A;  4A3M B;  1I50 H;  1PLF A;  2K5H A;  5JEA H;  2LY7 A;  4JYA Q;  4DV0 L;  2IL8 A;  1HA5 A;  1T9H A;  4KN7 C;  4OIJ A;  1F77 A;  3NTH A;  2K28 A;  2EVB A;  4YCW A;  2Y0S E;  4LFC L;  2L9H A;  2B63 B;  3OHX C;  3C1E A;  3EIV A;  1B9M A;  4B3M L;  4FXD A;  3PUY A;  4A76 A;  2NYZ D;  3JAM c;  1I6H H;  3R2T A;  1TQO A;  5I9P A;  2VL6 A;  3TSS A;  1HZ9 A;  1EYD A;  3GP7 A;  3NBH A;  2MGS A;  1PTO B;  3H0G G;  5DM7 3;  1K73 C;  1ZEQ X;  1E2W A;  4B3R L;  2XIW A;  3STB C;  3SK5 A;  4BA2 I;  2RF4 A;  2ICI A;  5M5Y B;  1B9N A;  4BWG B;  2Z4I A;  2IX3 A;  5M5W H;  1D5X C;  3OWF A;  1R9T B;  5ELC A;  2J4X A;  3IRB A;  2RDF A;  3MWY W;  1SR3 A;  4GN4 B;  2JK8 A;  3M3Y H;  4GOP B;  5EPK A;  3GTG H;  4K5X A;  2MJ8 A;  5FO9 B;  4RA8 A;  2JA8 G;  2OQK A;  5KEE A;  2LMC B;  1J5E L;  3HOX H;  3VR2 A;  4CBV A;  4A3J H;  4R4O A;  1N34 Q;  1PRT C;  3C46 A;  4IFD H;  5ELB A;  3U50 C;  4LFB Q;  4X65 L;  3A55 A;  3OW2 A;  2NTS A;  4G7Z C;  2B2T C;  2GVB A;  2Q2U A;  2K04 A;  1EY0 A;  2KA7 A;  4C3J H;  4QQB X;  5ELO A;  4UP9 A;  2KOL A;  4NPS A;  4P73 A;  1CKM A;  1N36 Q;  4Z9C B;  5M3F B;  5C0X I;  1STY A;  1GUN A;  3OTO Q;  3LWE A;  1IYJ B;  4UAI A;  1EY9 A;  1SMY D;  3EVQ A;  2JA5 B;  5GAG C;  5KYI A;  2E2H H;  4WFN 3;  1JC7 A;  2I07 B;  3PV0 A;  3OOC A;  4XQJ A;  4IUU A;  4OL7 A;  1O7L A;  4JOI C;  5A2Q E;  3NTI A;  1H9S A;  4G4K A;  4BBR G;  3IAY A;  1Y1V G;  3VA5 A;  1Y8O B;  2JA6 B;  2E2I H;  4RAU C;  3TBI B;  2CWP A;  4MZ9 A;  1WD0 A;  2AQ1 B;  4FXG C;  3SK6 A;  4E6I A;  2V4D A;  3PUW A;  4HJ7 A;  2ZJP A;  1EU3 A;  3JAM E;  4IUR A;  3T1Y L;  1VQ6 A;  2LKV A;  2B39 A;  4LF9 L;  5IGF A;  1GD7 A;  3CAM A;  2A19 A;  4V19 0;  1LTB D;  3SDZ A;  2RBM A;  3CCE A;  1Y69 U;  1ILP A;  2B2Y C;  3BU2 A;  1AFP A;  3H09 A;  3HOY B;  5J39 A;  1AH9 A;  5IYB G;  3A5Z B;  1HXY D;  4JI6 Q;  2WIN B;  3MA2 B;  3D4D A;  3CCU A;  1IL8 A;  5FLX c;  4ZK9 B;  4OXP A;  3VYS A;  4A93 B;  1D2B A;  1PFS A;  2F1M A;  2KCT A;  2MHV A;  2NZ1 D;  1X3F A;  4JVZ A;  4B9X A;  3IL8 A;  3TS0 A;  2K05 A;  4IUP A;  1EWC A;  1K3B C;  1PH4 A;  3FEW X;  1XNR Q;  5FK9 C;  2ALY B;  1GUT A;  1I3Q B;  4DU9 A;  2PW5 A;  2ZT9 C;  3OWE B;  4GKJ Q;  1AEX A;  2F0G A;  3K81 C;  4DR5 L;  4IUN A;  1NTG A;  1B53 A;  3NE5 B;  4POG A;  1TWA H;  2SNS A;  1VQG A;  4K0K Q;  3GTL H;  1ET6 A;  2RCF A;  3QB3 A;  4A3J G;  1KLG D;  3H0G B;  1G6P A;  2Q2I A;  1M8A A;  2ES2 A;  4HR7 B;  3DLL A;  1NE3 A;  4JI1 L;  3R2I A;  5M3M G;  5A2Q L;  4DUZ Q;  1M1K C;  1G91 A;  2B2T A;  3RR5 A;  5ELD A;  2E5L L;  1S3O A;  1RHP A;  4GKK L;  5FLX E;  4DF7 A;  3G4S A;  1VQ7 A;  2JP1 A;  5A35 A;  3DM1 A;  4KV6 A;  1YIJ A;  4LF6 L;  1SAP A;  3ND9 A;  1GUS A;  4YWK A;  1E24 A;  4IJL A;  3V05 A;  1YJN A;  3CCJ A;  1C9O A;  1TY0 A;  2F3V A;  3NBI A;  4AYB G;  3QOL A;  3I3C A;  4IN3 A;  1BNZ A;  5LHY 1;  1KQS A;  1E0B A;  3S2D H;  5C3E B;  4ZKC B;  1WTX A;  5HY6 A;  2JA7 B;  5EKK A;  1CFM A;  1I4Q A;  5ISR A;  3SR1 A;  4H13 C;  1STA A;  2EQS A;  1B3A A;  4YHH Q;  3HOZ B;  3K7A H;  1IHZ A;  4HIK A;  2B3G A;  4P72 A;  4JBM A;  4DV1 L;  2PZT A;  3QIA A;  4IOC A;  4A3B B;  2K5W A;  3UDG A;  1G8Z D;  2A73 B;  1A3V A;  3KDF A;  2RA4 A;  1FYC A;  3AFP A;  5J22 A;  4OEM B;  4PV1 C;  1PRT F;  1G2T A;  4QY7 A;  4DR7 Q;  3CC2 A;  1MD2 D;  1Q12 A;  2PYK A;  3MXN B;  4KD3 A;  4LMQ D;  4OGQ C;  4Q0F A;  4HED A;  1DM0 B;  3RZD H;  4B3T Q;  1JB3 A;  3MC0 B;  2N55 A;  5M9O A;  5C44 B;  1P16 A;  2B8F A;  3EQL C;  4RWS C;  1EYG A;  2F3I A;  3SEB A;  2FIN B;  1TWF H;  1Y1V H;  2QDB A;  2K01 A;  3QO2 A;  3CKI B;  2GN5 A;  4A3F H;  1B70 B;  3UDX A;  1YEZ A;  3MFY A;  3QJY A;  4DV2 L;  4KHP Q;  2F0E A;  3M4Q A;  1PZK D;  1RJT A;  2HT1 A;  2O5I C;  3I7F A;  1LM0 A;  2BOS A;  4DK3 C;  1UE6 A;  1RTN A;  2NUC A;  1K83 H;  3J7Y W;  4PMB A;  2D62 A;  3VYT A;  4J6H A;  4BY1 B;  1B2T A;  4LK1 C;  4AIM A;  1BQQ T;  1SMX A;  5C4X H;  2EJG C;  4KD4 A;  4Y7N H;  3OPO A;  2CQO A;  4A3K G;  5I9O A;  1W2B A;  3GV3 A;  2IW3 A;  1A2U A;  2KBN A;  1STB A;  5ELE A;  1TR5 A;  4QMG A;  1NCV A;  3PSI A;  1X3G A;  4LFB L;  2A68 D;  2F0K A;  5M3M B;  3IFT A;  3K0Y A;  4LF7 L;  3X3N A;  1GM5 A;  1SRU A;  3MZ5 A;  2E2J H;  4RKB A;  4HN7 A;  1SBB B;  1PZI D;  2JA8 B;  4DR5 Q;  4DUY L;  2K5Q A;  2WB1 B;  3L0O A;  3GTO B;  1N8R C;  4JCV E;  4RMF A;  3SVM A;  2B2V A;  2YV5 A;  4A3G B;  5FO8 B;  1YNN C;  4RFB A;  1HNX L;  2Z8L A;  1MJE A;  3S2H H;  2A74 C;  5LL6 X;  5CBE E;  5C0X G;  3D3R A;  2Z6K C;  4HMJ A;  4DK0 A;  3T13 A;  4NB3 A;  3J80 i;  4KHV A;  1XPO A;  1SSO A;  2CVR A;  3I4N B;  1T5X D;  3DHQ A;  3MEH A;  3TQY A;  4FYD A;  4KJO A;  3NEM A;  1SE2 A;  2AUJ D;  2TSS A;  4H7B A;  4DV6 Q;  4HMI A;  2HHH Q;  2NVX H;  4DUY Q;  1W6K A;  1YI2 A;  4IPC A;  4BY7 B;  1IL2 A;  3H94 A;  4ME3 A;  4GS3 A;  3A8K E;  3QR8 A;  1KRS A;  1Y1W B;  2DJF C;  1PH6 A;  1EFI D;  1D5M C;  1U0L A;  3G7L A;  5FJ8 H;  2F0Q A;  1LTS D;  2E2J B;  4DR7 L;  1MKH A;  1DYQ A;  3UE0 A;  5IWA Q;  1HPC A;  5CYU A;  4BBR H;  3MHB A;  1PTO D;  4A3F G;  1HR0 Q;  3SHL A;  3HOU B;  4QIW B;  5IP7 H;  4JV5 Q;  4AYB E;  2G9H D;  4A3G H;  4OIK A;  3PUX A;  1Z9F A;  4DGZ A;  1UNS A;  2X6G A;  2AUK A;  2YU9 H;  4JBJ A;  2ENB A;  1PTO F;  2VB2 X;  1R9T H;  5DLQ E;  2IPK D;  4LW1 A;  2EDG A;  3K5L A;  4JK1 C;  2ICE C;  3X3M A;  4B08 A;  1F2L A;  2UXB Q;  3HG9 A;  2O2L D;  5D65 A;  3GTG B;  3HKZ B;  2IJ0 A;  1WCM H;  3NXW A;  1O78 A;  1GUO A;  2MUY A;  2R7D A;  1HNX Q;  2N3S A;  4O42 A;  3I4M G;  3S17 B;  2AWN A;  2M9V A;  1H9M A;  4F8M A;  3IKJ A;  3TRE A;  1TS2 A;  1Q1B A;  1WJJ A;  1Z6H A;  5C4H A;  5KYL A;  4PZ7 A;  3T1H Q;  4JI4 L;  3AQQ A;  2HD3 A;  3T4A C;  3TZU A;  2B63 H;  5CV8 A;  1PH1 A;  1JOO A;  3CQZ H;  3S16 H;  4JI4 Q;  4JI0 Q;  4KHZ A;  4K5W A;  3KLS X;  3RLN A;  1HUN A;  3ND8 A;  5IT9 L;  3E0J A;  4R8N A;  3CP0 A;  1PDQ A;  1H95 A;  5IP9 H;  4HCS A;  3ER0 A;  4ZKB B;  2CKZ B;  3AU7 A;  3SK4 A;  3VA7 A;  4POF A;  4RCN A;  3K59 A;  3AFQ A;  3I55 A;  2A69 D;  2DUD A;  2Q2H A;  5IT9 c;  1J6Q A;  1Q81 C;  3U9S A;  3S15 B;  4C56 C;  1EUJ A;  3I91 A;  5M5X B;  1WTR A;  5FLM H;  3D6C A;  3HOU G;  4FDB A;  4CDD C;  5FKA C;  1CA5 A;  5GQO A;  2PCF B;  1ONL A;  2B29 A;  3WOE A;  3H91 A;  4J8Q A;  5LMN L;  3LNN A;  1KD1 C;  4IUV A;  3U4Z A;  4DR3 L;  4X64 L;  4DV0 Q;  2I5M X;  1XTC D;  2FHT A;  1DOK A;  4DAP A;  1NNX A;  4GN3 B;  4H02 A;  4TRD A;  3HOZ H;  4X66 L;  4KKU A;  4ZCK A;  5JJZ A;  3KOJ A;  3KUP A;  3RUZ A;  1L0Y B;  3S1M B;  1X32 A;  1AE3 A;  2E76 C;  5JJK A;  1D8L A;  2L4N A;  1EIH A;  4KY5 A;  1TWG H;  5E7N A;  3K0X A;  3L9A X;  4C2M B;  2QKI C;  5H1S E;  4OX9 L;  2AWO A;  2UU9 Q;  1FJG L;  4IPH A;  1OXS C;  1VQI A;  5D3D A;  3V96 A;  3I90 A;  4F88 A;  4FF4 A;  3EFX D;  3RN5 A;  1EYA A;  1PTO H;  3K5M A;  4JI2 Q;  2NB0 A;  5T1G A;  5C4X G;  3BS1 A;  3VR3 A;  1BR9 A;  1SFO B;  1U4L A;  1D7Q A;  4RGO S;  1K28 A;  1V1P B;  1EY8 A;  2D0O A;  1YJW A;  4K2K A;  1PRT D;  2NVY B;  1Y1V B;  5E1F A;  2D2C C;  1HFG A;  4RGM A;  2KED A;  3BYY B;  1JJ2 A;  5KRU A;  3CD6 A;  2KCM A;  4A3M G;  4A3D H;  1ESR A;  4A75 A;  3L3O C;  1XMQ Q;  2LS0 1;  1SNP A;  4FF2 A;  3L2P A;  1JJC B;  3I4N H;  4JYA L;  1JCK B;  3PIO 3;  4HID A;  2G5D A;  1K8G A;  2H5X A;  4EX5 A;  2VUM G;  3TRZ A;  4NXM Q;  2XTI A;  1CKN B;  1VQ4 A;  1QUQ A;  4ABN A;  1T5E A;  3T56 B;  4WRD A;  4DAY A;  1W3S A;  2SEB D;  4P71 A;  2XNA C;  3PF5 A;  4C3H G;  2B2Y A;  4LJZ C;  5I2X A;  3ULJ A;  2F0J A;  2F03 A;  5JJL A;  5C0X J;  1X65 A;  5TSS A;  4DXG A;  5JEA G;  1PA6 A;  3RLO A;  2F0F A;  1XJV A;  3GD7 A;  1A3T A;  1PYB A;  1XNR L;  1XMQ L;  5FOB B;  2WV6 D;  2XRQ D;  2R93 B;  1KAB A;  1ROD A;  2JJQ A;  4OWT B;  2KEN A;  1PH9 A;  3HOX G;  3J81 E;  2K5V A;  4N9T A;  2EXD A;  5EJW A;  1BCP B;  4NXM L;  2HIX A;  2IHE A;  2V1C C;  3DEO A;  1HZA A;  4RGN A;  1PH8 A;  4GKK Q;  2NVQ H;  3KJO A;  2Y0S B;  3S1N B;  3H15 A;  2VS1 A;  5KND A;  4PZ6 A;  2JA6 G;  1HRJ A;  4LFC Q;  4IO9 A;  3GTM B;  4P75 A;  3BZC A;  4ZQ3 A;  3WDN A;  4DR2 Q;  1H9J A;  2F0T A;  4A3I B;  3AMU A;  3U9O A;  1Q82 C;  1TWC H;  4LF5 Q;  2Y0S G;  2CH4 W;  1VDZ A;  3S1Q H;  2OQ0 A;  2XGT A;  3KJP A;  3R8B A;  3I4O A;  1ILQ A;  1YBY A;  4L63 B;  4X66 Q;  3G6E A;  5L37 A;  3DXJ C;  1UE5 A;  2R92 G;  1X3Q A;  5CV7 A;  1ICW A;  2KEE A;  3L7Z C;  4AYB B;  2BDO A;  1M4V A;  4K6L A;  3DWP A;  1A0I A;  4OON A;  4FP5 D;  5C4X B;  1KNE A;  4ZRZ A;  2O5J C;  3BZD B;  2BA0 A;  4JC0 A;  1UE1 A;  1EQR A;  3CCM A;  4DNI A;  1V1O A;  4R4Q A;  1NMG A;  3NK9 A;  2UXD Q;  4NMZ A;  4G57 A;  1PMR A;  2TMP A;  3NBH B;  2K4K A;  5CGK A;  4DR6 L;  2N88 A;  4KKS A;  4EQP A;  4AQY Q;  1XXG A;  2JQO A;  1CZW A;  1Q90 A;  4K14 A;  4DV3 L;  3H0G H;  4CHT B;  1EOT A;  4X62 Q;  3ULL A;  1TWC B;  4KK7 A;  1F9P A;  2AKW B;  2XN9 C;  3EA6 A;  3FKI H;  1SJE D;  2RSO A;  4EQO A;  5GRO A;  2CCZ A;  4JW0 A;  1L2F A;  1PYW D;  2F0O A;  2R92 H;  1Z7T A;  4NP5 A;  1C4Q A;  3CCL A;  3I70 A;  1N9W A;  2K5D A;  3VYR A;  3IFD A;  1VMC A;  2F0D A;  3CF5 A;  5IGC A;  3J7Z C;  1S72 A;  1WTH A;  2WII B;  4NW2 A;  2UUB L;  3HEJ A;  1HFN A;  3NSW A;  4LWC A;  4CDF C;  3RZO H;  1N33 L;  4G7O C;  1ZYR D;  2YTV A;  4DV1 Q;  3W1G A;  1O7I A;  1B44 D;  3W2D A;  3MVV A;  3WWV A;  2HDL A;  4JI8 L;  2ZJR A;  2JA6 H;  3QOJ A;  2F0N A;  1UUP A;  4YCV A;  1VQO A;  1J5E Q;  3KF8 A;  2I0Q A;  5CC4 A;  1L1O A;  1LTA D;  3PIP 3;  3PUZ A;  1OXT A;  3FDT A;  4X65 Q;  1F2M A;  4QUC A;  5KNC A;  4LF8 L;  5ELF A;  4GZY C;  2EXZ A;  4C3I B;  4FO2 A;  2YU9 B;  1HTL D;  5EQ0 A;  3CPW A;  2UU9 L;  4KKT A;  3H3V C;  1STN A;  3W5O A;  2EYH A;  1NMF A;  3HKZ E;  1SYC A;  3PO2 H;  2B2V C;  2IHF A;  2KHS A;  3TP8 A;  1LTI D;  4QB4 A;  5I6Y A;  1B50 A;  2M2L A;  2B2U A;  2X69 A;  1GKH A;  3D4W A;  4BY7 H;  1VF7 A;  1EIG A;  3K5O A;  3TDQ A;  1EWI A;  1XMO L;  1JR0 D;  3T1Y Q;  3GV6 A;  3KF6 A;  2VXW A;  1A3U A;  4V0B A;  2PZW A;  1E1O A;  3CQZ B;  4WJW A;  3S1M H;  4QGU A;  1NR2 A;  2ZTC A;  1EEI D;  1L0X B;  1SLJ A;  2F0U A;  4CDE C;  2WB1 G;  3MAQ A;  2ID0 A;  1LAB A;  4OO1 G;  2PQA B;  3FKI G;  3S1N H;  4DV2 Q;  1HTP A;  1OTC A;  2NVT B;  2JA8 H;  1F9S A;  2PQE A;  2ZJQ A;  5IP9 G;  1JWS D;  4A3E B;  4A3C H;  4P74 A;  1JQY D;  3CC4 A;  3PGZ A;  1HUM A;  4AQY L;  3URY A;  1B7Y B;  1I6V C;  1IZ6 A;  3F1Z A;  3S17 H;  2R7Z H;  2ZTE A;  1QWY A;  4B3S L;  3CW2 C;  3S14 B;  4WJ3 M;  1S40 A;  1YVC A;  1IBL L;  1WTW A;  1X54 A;  3F2B A;  1EY5 A;  2PI2 A;  1TWH H;  4O1N A;  3I56 A;  4BY7 G;  2WKC A;  4CKC A;  1HA6 A;  4YY3 L;  1U4R A;  3GTK B;  2HQE A;  4JG2 A;  3KLR A;  5DEH A;  1VQ5 A;  4UP8 A;  2I46 A;  3CPF A;  2QGQ A;  2LSS A;  3P75 A;  1D1I A;  5I4D A;  5EPL A;  1SJH D;  2XWJ B;  3K7U C;  4DK1 A;  4HJ9 A;  4JI7 Q;  5C3E H;  4APV A;  4R4T A;  4A3L H;  1V43 A;  3A54 A;  2FMM A;  1QUQ B;  2XRS D;  3D31 A;  1YHB A;  4DNT B;  1QIL A;  4B9W A;  5HGT A;  3RZO B;  3W1B A;  1BUV T;  5KGU A;  2PZU A;  1HHV A;  3K80 C;  1N32 Q;  1WTO A;  4LUZ A;  2NVQ B;  4YIJ A;  1R4Q B;  2D9U A;  4GLA C;  1LT4 D;  4RGT A;  4KHP L;  2GA4 B;  2EJM A;  3HKS A;  4JPB W;  4C1N K;  5EKI A;  2MQH A;  3KFU A;  4OEL B;  2IWH A;  1BKB A;  4A3E H;  2WAQ G;  1YNJ C;  4OWW B;  4BBS B;  5AJ3 L;  2P5Z X;  2NZH A;  4A3B G;  3ERO A;  1JOQ A;  1FGU A;  2H4O A;  3HOY H;  2A8V A;  3Q8D A;  5JEA J;  2KQ3 A;  3JAM L;  1STE A;  4IAL A;  1R4P B;  4X3T A;  2Q8T A;  1KTK A;  1M90 C;  1LT3 D;  4FNF A;  4LF4 Q;  2E2D C;  2PNH A;  1CKN A;  2R7F A;  5C4Z A;  4PQX A;  3E3X A;  1DON A;  3UDI A;  4LFA Q;  3T51 B;  3MXG A;  1SYB A;  5CV9 A;  1TS5 A;  4A3I H;  5C3W A;  1RKN A;  2PPB C;  3GTK H;  4RHS A;  1BBW A;  2RKS A;  1VF5 C;  1A15 A;  2AQ3 B;  2E74 C;  3CRL C;  1QJO A;  4B3M Q;  2HCI A;  1JOR A;  1U5K A;  1WFQ A;  4IZ8 A;  3H3V I;  1Y1W H;  1II3 A;  3R3O A;  2OWO A;  1QZG A;  1UE7 A;  3NPP A;  5IY0 A;  3NUC A;  1E2Z A;  2L0C A;  4DKA C;  4R1J A;  4DR6 Q;  4CJ0 B;  2L12 A;  3S16 B;  4U68 A;  3Q6S A;  2MO1 A;  1JB7 A;  4C3H B;  2R93 H;  1IW7 D;  3NQI A;  5BN5 A;  2JA9 A;  1CI3 M;  4OHJ A;  3W3A A;  1BF4 A;  1X56 A;  3FP9 A;  2FMC A;  5CBA E;  3I4L A;  4A3D G;  3Q24 A;  1DJR D;  4TSS A;  4DFA A;  3GTP H;  4XQN A;  4P2C B;  1HZC A;  4WOR A;  4KN4 C;  3F8T A;  4B3S Q;  3M7G A;  1GVP A;  1MBY A;  5FJ8 G;  2DN8 A;  3ZYY X;  4QL5 A;  4JBK A;  2NN6 H;  3MTS A;  3LGJ A;  5JOB A;  3S2H B;  2KHJ A;  1ENF A;  2OT2 A;  4BBS G;  3KF8 B;  2YTX A;  1NSN S;  1MJC A;  1ZXT A;  1JE4 A;  1TS3 A;  1UWV A;  2AMC B;  4RKL A;  2QEX A;  2EIF A;  4I7A A;  3P7J A;  2UUA L;  3C3L A;  1ZKO A;  2PMZ B;  1TWH B;  1X55 A;  2EY2 A;  1JMC A;  1UEB A;  2K7V A;  1BCP C;  2L15 A;  3PMF A;  4K8J A;  4ZLT F;  1SDF A;  4LF8 Q;  4DV4 Q;  1GUG A;  1TY2 A;  3NWS A;  5K36 G;  3MXN A;  1U9R A;  1ASY A;  1D5Z C;  3RN2 A;  1MSG A;  4Y7N B;  2JA7 G;  2WAQ B;  1GXD C;  5C6A A;  2F0W A;  1EIY B;  3J80 E;  2E5L Q;  4JI3 L;  4HJ8 A;  1J8I A;  2EYF A;  1LTL A;  2B63 G;  3AB9 A;  3BYT B;  3E9H A;  2K52 A;  5CV6 A;  1Q1E A;  3F2D A;  2YYZ A;  4ZYS A;  3S24 A;  3GTM H;  1U4M A;  1EL0 A;  1L1O C;  2HUG A;  4QJF A;  3BVM A;  3PUV A;  3J81 i;  4A93 G;  4PG3 A;  2NZO A;  3OMG A;  4OO1 I;  1K9M C;  4F7X A;  4A3D B;  3PIP A;  1Q46 A;  1TKW B;  5E4X A;  1UEA B;  3OYY A;  1H9S B;  3VR6 A;  1LTT D;  1CHQ D;  1I4X A;  1K0R A;  5CV4 A;  3PO2 B;  1XTD A;  4IQZ A;  5C3X A;  1LT6 D;  1NY4 A;  3G48 A;  1KAA A;  1VQE A;  3TN2 A;  4UHV A;  1NUC A;  3RD4 A;  3A5U A;  3GTJ H;  2F0H A;  4N8F A;  2EY1 A;  3KK7 A;  2JA7 H;  3MFG A;  3SK8 A;  4XT3 B;  1VQM A;  4IPD A;  3M4Y A;  3CU7 A;  2F0S A;  5COY A;  1CTM A;  1Q3L A;  3I8Z A;  1SE3 A;  2R7Z G;  3N52 A;  1VCI A;  2A6E D;  1X3E A;  5IOD A;  1VQK A;  3F2C A;  1EQT A;  3D4R A;  1P8L A;  3TP7 A;  4IJH A;  1NR4 A;  4OO1 H;  1TU2 B;  1GHJ A;  1S4Z A;  2ATW A;  4KMU C;  1JIC A;  5KNB A;  3H3V H;  1C8C A;  5M5W B;  4XYO A;  3FHW A;  4G7H C;  2R7Z B;  3S14 H;  4Q5V A;  4IUQ A;  1E3P A;  1EOV A;  1SE8 A;  3DMU A;  1Q8I A;  2O4X A;  5D3I B;  1UAP A;  2K75 A;  2PNR C;  2KUM A;  2DJG C;  1HQR D;  1U4P A;  3GDE A;  2X6L A;  1E2V A;  3M85 A;  1RF2 D;  1SEB D;  1HR0 L;  2G9D A;  4R8I A;  2A1A A;  2FJ2 A;  2QDL A;  1I4P A;  2GVA A;  1C48 A;  3AEV A;  4ZAI A;  1KLU D;  4MTN A;  4YCU A;  3ICE A;  1B8A A;  4K6D A;  2JE6 I;  2NVX B;  2DNC A;  3VDY A;  2F0I A;  2ZM6 Q;  3CCQ A;  3BDC A;  2R61 A;  1N36 L;  1HNW L;  4AH6 A;  4KI0 A;  4KJN A;  4N9P A;  1NBW A;  3NQT A;  4PNY A;  4I65 A;  4RH6 A;  3KF6 B;  1LT5 D;  1CA6 A;  1GJX A;  1TWG B;  4M8A A;  5HUR A;  2BH2 A;  4JI1 Q;  3HOV B;  4C2M H;  1IXR A;  3H6M A;  4YWL A;  2JEA I;  4QIW E;  2Q8R E;  1V1Q A;  1STH A;  2UUC Q;  3FMC A;  1L1O B;  3CCS A;  3JC6 6;  2JA5 H;  3HS0 C;  5EBD A;  1JWM D;  5EAY A;  3BJU A;  2M00 A;  2R3Z A;  4ZUJ A;  1Y1W G;  2NN6 G;  1EU4 A;  5HGQ A;  2F3W A;  1AZQ A;  4DR1 L;  1XYI A;  4A3I G;  5EBC A;  5EKL A;  1I4R A;  2BCO A;  5JJI A;  2FXQ A;  2XVS A;  4L5R C;  3KLW A;  3GO5 A;  1JT8 A;  3TME A;  1WI5 A;  3HKZ G;  4LF5 L;  1A62 A;  2EY5 A;  2QW7 A;  3BDO A;  5C0X H;  1AP0 A;  3HOW B;  1CSP A;  1WCM B;  4RHR A;  4PZ8 A;  5C5L A;  2OTL A;  3BZK A;  4HTH A;  3B6Y A;  4X3S A;  2K14 A;  1CZG A;  2BDN A;  1NJI C;  1VQ8 A;  3J80 L;  5BR8 Q;  1STG A;  1CQF A;  1EQV A;  1LYL A;  3ITP A;  5M5X H;  3PO3 G;  1AW7 A;  3QG1 A;  1ZYR C;  4NDX A;  4ULL A;  4XIG S;  2MPM A;  1XMO Q;  2SNM A;  2UUB Q;  5GAD C;  1KHI A;  3K6O A;  1IBM Q;  3OW7 A;  2AHO B;  3D6W A;  2K1B A;  2VY3 A;  2PW7 A;  1W6J A;  1ASZ A;  4ALP A;  5DNF A;  1HH2 P;  5J1Z A;  4F87 A;  3FRP B;  1MGS A;  4L5S A;  2RCN A;  2EOT A;  4HIM A;  1FGB D;  2F0P A;  4K0K L;  2KCC A;  1H9R A;  4BY1 G;  4DV3 Q;  1RD9 D;  2F0M A;  5FLX L;  5GAH C;  1EZ8 A;  4JI7 L;  5C4J H;  3S1R B;  2NBF A;  2CW0 D;  5D14 A;  3PO3 H;  4CJ1 B;  1IBM L;  1C7Y A;  4HAE A;  1HNZ Q;  2L55 A;  2JYO A;  1K8A C;  3HOX B;  1EEF D;  3ULP A;  1V1P A;  5K36 H;  1WVL A;  1JOK A;  2RHS B;  3HP3 A;  1EYC A;  1DOL A;  1V8Q A;  2WFW A;  4GOP C;  3AYH B;  1MHW C;  4IPG A;  3I4M H;  3OTO L;  3VYU A;  1TII D;  1XNQ L;  3UI2 A;  2K32 A;  5JVG 3;  2HHH L;  1Q86 C;  2BE5 D;  5GAE C;  3TS2 A;  3DM3 A;  1SE4 A;  4DAM A;  4GLX A;  5J3B A;  3BVG A;  2BH8 A;  2CFM A;  2HCC A;  3WOF A;  1E1T A;  3NEN A;  1IYV A;  4M1U B;  1S5D D;  2A6H C;  4OX9 Q;  1H9K A;  1OO9 B;  1TXY A;  1DOM A;  4DV6 L;  3CCV A;  5E3F A;  1LLR D;  3M4P A;  1SNQ A;  4C3I G;  1QZH A;  2CQA A;  1I6H B;  3OMC A;  2UUC L;  2QF7 A;  4FF3 A;  1Z47 A;  3M7N A;  5CV5 A;  2ASB A;  4IFD J;  1DGS A;  2R6G A;  3FPU B;  3MXU A;  1FNV A;  3OSO A;  4GOP A;  4DXF A;  4QCL A;  1F2Y A;  1CSQ A;  3ERQ A;  2PMZ E;  1EY7 A;  4IUT A;  2UXD L;  1BDO A;  3GTP B;  3FKI B;  1JWU D;  3SGI A;  1KIX A;  4DV4 L;  5IYB H;  1LTG D;  1FNU A;  1AE2 A;  5BN4 A;  4BXX G;  1KXL A;  4DAY B;  2XSC A;  1E22 A;  4DPG A;  4A3L G;  1A63 A;  1IKM A;  1XWE A;  1JJG A;  1J9O A;  4LF4 L;  1DXM A;  3NEL A;  3PQI A;  3F2U A;  5LMU Q;  1SNO A;  1YJ9 A;  1G2S A;  1Y8N B;  3NHH A;  4NKL A;  1WD1 A;  5EGT A;  4JV5 L;  4O2D A;  1E7Z A;  1FJG Q;  2IY5 B;  4XT1 B;  2IT1 A;  2NWG A;  2JN4 A;  1OXU A;  4DAV A;  4QF4 A;  3DEP A;  4EQ5 A;  2KCN A;  4A3B H;  4QUF A;  3CC7 A;  2QEJ C;  4O0A A;  2ZXO A;  4J1M A;  5F2D A;  3RNU A;  1N32 L;  1F9R A;  4A3E G;  3C1F A;  3E9I A;  1KNA A;  3Q22 A;  2EPB A;  4MNO A;  1WTP A;  1HR0 W;  2PI2 E;  2DY7 A;  2VW9 A;  2J0T D;  2VQF Q;  2Z6K A;  1WTQ A;  5C5M A;  1SRO A;  4NXN L;  3M3Y B;  4TKO B;  2E2I B;  5IYC G;  3T1H L;  1XPR A;  2EYO A;  4DK6 C;  1GUW A;  5IYC H;  2F4I A;  2ZM6 L;  1HNW Q;  2NTT A;  1TS4 A;  2Z0S A;  2MFI A;  2NVY H;  1L0W A;  1EIF A;  4BBS H;  1BBU A;  3N6R A;  1N34 L;  1KDB A;  1EY4 A;  1QG7 A;  5C3E G;  5G3L D;  4BA1 I;  1S5B D;  1EWH A;  4A3G G;  3T16 A;  2N49 A;  1CQV A;  1TT2 A;  3G6J B;  3FPP A;  3V2T A;  3SE0 A;  4C3J B;  1EY6 A;  2N78 A;  1PFN A;  2J7Z A;  4PMW A;  1QVF A;  3E6Z X;  3I2Z A;  2EYJ A;  3VR4 A;  1GHK A;  3Q23 A;  4CJ2 C;  4NXN Q;  1LUZ A;  4BY1 H;  4A3M H;  4JBW A;  1I4H A;  3K7A B;  2K50 A;  3HOY G;  3A7A B;  1KL9 A;  2YTY A;  4TVA B;  3J81 L;  3G71 A;  1Y8P B;  2EZV A;  4XTC S;  4C1N I;  1RIP A;  4B3T L;  2JEB I;  3NTK A;  3OIP A;  2CW0 C;  4B3R Q;  1RDP D;  5BN3 A;  2ZXP A;  2DGY A;  1VQA A;  5AJ3 Q;  2JA5 G;  3HOW G;  1ENC A;  3QWN A;  1WTV A;  2OXP A;  1SMY C;  4C3H H;  3UDF A;  4GNX B;  1D6E C;  1K8O A;  2F0L A;  5M5Y H;  4PMC A;  4BBR B;  2Q8I B;  2E75 C;  2BE5 C;  2VUM B;  4KLK A;  4X62 L;  4RCO A;  1PXU A;  3K57 A;  4A3F B;  1S5F D;  2D5D A;  3J7A V;  1NAP A;  4H0L C;  4S3S A;  4X3K A;  5DAU A;  5K5P A;  3ONA B;  2C9O A;  2C35 B;  3RMH A;  1GOZ A;  1QE6 A;  4CDC C;  5EPJ A;  1X6O A;  1WYD A;  4EVO A;  4L5Q A;  4XYQ A;  3GTQ B;  3JAM i;  2A6H D;  1PHJ A;  3OIQ A;  2Q2T A;  1I50 B;  3DWA A;  3S1Q B;  2OF1 A;  3MEF A;  1EQQ A;  1CKO A;  1FD7 D;  5IWA L;  2NN6 I;  1PH7 A;  3NWT A;  3ERS X;  1IBK Q;  2QIL A;  2RVL A;  3BDL A;  3GTJ B;  3PF4 A;  2DY8 A;  4UPA A;  3HGB A;  2A68 C;  3I73 A;  4ILW A;  1CHP D;  1FL0 A;  4X3U A;  2Z6B A;  1EFW A;  4C3J G;  4X64 Q;  2CWA A;  3J80 c;  4DR2 L;  1VQH A;  1I4G A;  1MSH A;  2BA1 A;  2D0P A;  2RDH A;  5M3F H;  3EBE A;  1VQF A;  2E2H B;  2WP8 J;  5M3F G;  1AZP A;  3K5N A;  2MNA A;  5I6W A;  4CKB A;  1YZ6 A;  4JI8 Q;  3M4O B;  3GTO H;  1YNN D;  3GTL B;  2E8G A;  2F52 A;  1SYE A;  4DNR B;  5DM6 3;  1YIT A;  2VUM H;  4UDU C;  4JI5 L;  2VNU D;  2KJX A;  2EYP A;  4LNQ A;  2AQ2 B;  4Y52 H;  1BXT A;  2SOB A;  1B4O A;  3TEH B;  3S9W A;  2NVT H;  2R93 G;  1BVS A;  1S5C D;  2ZTD A; 
#chains in the Genus database with same CATH homology
 4P75 A;  2JA7 H;  1PH4 A;  3BZC A;  5IYD G;  1XNR Q;  4DV7 Q;  4DR2 Q;  2ALY B;  4IOA A;  1VQM A;  4IPD A;  1Q82 C;  1FVI A;  1TWC H;  3HFZ B;  5FLM G;  4DV5 Q;  4LF5 Q;  2R7Z G;  1N33 Q;  2Y0S G;  2PQA A;  3S1Q H;  3PO2 G;  4GKJ Q;  1VCI A;  2OQ0 A;  1HJP A;  1X3E A;  1VQK A;  3K81 C;  2XGT A;  3F2C A;  4HJA A;  4DR5 L;  3KJP A;  1NTG A;  1P8L A;  3I4O A;  4IJH A;  4POG A;  1TWA H;  1YBY A;  1VQG A;  4X66 Q;  3G6E A;  4IFD G;  3GTL H;  4K0K Q;  4A3J G;  2ATW A;  1G6P A;  4A3K H;  1UE5 A;  2Q2I A;  2R92 G;  3EN2 A;  2ES2 A;  3DLL A;  4UY8 C;  1NE3 A;  2VQE Q;  4JI1 L;  3H3V H;  5M3M G;  1M1K C;  4DUZ Q;  1YHA A;  3RR5 A;  3FHW A;  1HNZ L;  3S14 H;  2E5L L;  1S3O A;  3L7Z C;  1E3P A;  4GKK L;  1EOV A;  1SE8 A;  3G4S A;  3CME A;  1GO3 E;  2K75 A;  5LMN W;  1VQ7 A;  4WJ4 A;  1A0I A;  4OON A;  2UXC Q;  3GDE A;  1YHQ A;  3M85 A;  4YHH L;  1HR0 L;  1YIJ A;  4DR1 Q;  1RL2 A;  4LF6 L;  2A1A A;  1PH2 A;  2GVA A;  2BA0 A;  3E0E A;  1E24 A;  4IJL A;  1UE1 A;  1EQR A;  4JC0 A;  4YWK A;  4DNI A;  4YCU A;  4MTN A;  4R4Q A;  5C44 G;  3CCM A;  1B8A A;  1YJN A;  3CCJ A;  1NMG A;  3ICE A;  2UXB L;  1C9O A;  2JE6 I;  3CMA A;  3AEV A;  5C44 H;  3VDY A;  2UXD Q;  2WAQ E;  5IE8 A;  2ZM6 Q;  3CCQ A;  1N36 L;  1HNW L;  3NBH B;  2K4K A;  4KI0 A;  4AH6 A;  4AYB G;  1C0A A;  2UUA Q;  4DR6 L;  1NBW A;  4JI2 L;  1KQS A;  3S2D H;  1CUK A;  3KF6 B;  4AQY Q;  5HY6 A;  2BH2 A;  2JQO A;  4JI1 Q;  4C2M H;  1IXR A;  2VZA A;  2RHQ B;  4DV3 L;  4YWL A;  3H0G H;  4X62 Q;  2JEA I;  4QIW E;  3ULL A;  2EQS A;  4YHH Q;  1V1Q A;  3K7A H;  1IBL Q;  2UUC Q;  5ELN A;  4HIK A;  2AKW B;  2B3G A;  4P72 A;  1L1O B;  3FKI H;  3CCS A;  4JBM A;  4DV1 L;  4IOC A;  3JC6 6;  2JA5 H;  3UDG A;  1I94 L;  5GRO A;  5EAY A;  3BJU A;  2CCZ A;  3KDF A;  1L2F A;  1VQJ A;  1VQC A;  2NN6 G;  1Y1W G;  1X9N A;  1PH5 A;  3AFP A;  5HGQ A;  2R92 H;  1Q8K A;  4A93 H;  4DR1 L;  4QY7 A;  3CCL A;  4DR7 Q;  4DV7 L;  4A3I G;  2I5L X;  3CC2 A;  4BXX H;  1N9W A;  1Q12 A;  5JJI A;  2FXQ A;  3MXN B;  4L5R C;  3KLW A;  3GO5 A;  1JT8 A;  1WI5 A;  3CF5 A;  3RZD H;  4B3T Q;  3J7Z C;  1S72 A;  3HKZ G;  4JOI A;  4LF5 L;  1A62 A;  2UUB L;  1P16 A;  2WB1 E;  4LF9 Q;  1EYG A;  2F3I A;  3CXC A;  1CSP A;  4LWC A;  1VQB A;  3RZO H;  1N33 L;  1VS0 A;  2YTV A;  4PZ8 A;  1TWF H;  4R4I A;  4DV1 Q;  1Y1V H;  3BZK A;  1O7I A;  3W1G A;  3B6Y A;  2OTL A;  2K14 A;  2OTJ A;  2GN5 A;  3WWV A;  1G51 A;  1B70 B;  4JI8 L;  4A3F H;  1NJI C;  1VQ8 A;  3UDX A;  5BR8 Q;  1YEZ A;  2ZJR A;  2JA6 H;  3PCO B;  4DV2 L;  1LYL A;  5M5X H;  3HOV G;  3PO3 G;  4YCV A;  1VQO A;  1VQL A;  1J5E Q;  1I94 Q;  2I0Q A;  4KHP Q;  1L1O A;  3J81 j;  3M4Q A;  2HT1 A;  3U58 A;  1Y14 B;  3S1R H;  3I7F A;  3PUZ A;  1OXT A;  1LM0 A;  4XIG S;  4LUV A;  4DK3 C;  4X65 Q;  3RLF A;  1XMO Q;  1UE6 A;  2UUB Q;  4LF8 L;  5GAD C;  1KHI A;  1IBM Q;  1K83 H;  1XPU A;  2D62 A;  2AHO B;  2UXC L;  2VY3 A;  1ASZ A;  3STB D;  1IBK L;  4AIM A;  1SMX A;  4ALP A;  5C4X H;  1PV4 A;  1HH2 P;  4Y7N H;  3CPW A;  1YNX A;  2CQO A;  4JI0 L;  2UU9 L;  4A3K G;  4JI3 Q;  4DR3 Q;  1W2B A;  3GTQ H;  4L5S A;  2RCN A;  2IX1 A;  4HIM A;  2KBN A;  3W5O A;  3ZJY C;  3PSI A;  1PYS B;  1SN8 A;  1X3G A;  4LFB L;  1NMF A;  3HKZ E;  4K0K L;  1XNQ Q;  1G29 1;  3PO2 H;  3UE1 A;  4LF7 L;  3HOZ G;  1QVC A;  1SRU A;  2I5H A;  2IHF A;  3D0F A;  4BY1 G;  4DV3 Q;  1GM5 A;  2E2J H;  4DR5 Q;  5GAH C;  4DUY L;  4JI7 L;  3KYH C;  5C4J H;  3L0O A;  1KRT A;  5IYD H;  4LUO A;  1GKH A;  3HOV H;  1N8R C;  3PO3 H;  4BY7 H;  3A0J A;  4JCV E;  4RMF A;  4R4C A;  4GNX C;  1IBM L;  2YV5 A;  4UP7 A;  1EWI A;  1C7Y A;  1HNZ Q;  1XMO L;  4JI5 Q;  5LMU L;  2QA4 A;  3T1Y Q;  2LXJ A;  3KF6 A;  1K8A C;  1HNX L;  2VQE L;  1KC8 C;  1VQ9 A;  1MJE A;  3S2H H;  3ULP A;  2HIV A;  1I3Q H;  1HZB A;  2RHS B;  2WFW A;  4GOP C;  1E1O A;  5C0X G;  3AYH B;  4IPG A;  2Z6K C;  3S1M H;  3I4M H;  4QGU A;  3OTO L;  4A4I A;  2ZTC A;  1XNQ L;  4NB3 A;  2F4V L;  3J80 i;  2HHH L;  4LF6 Q;  1SLJ A;  3J81 c;  5GAE C;  1Q86 C;  3CCR A;  1XPO A;  2WB1 G;  1JE5 A;  1WCM G;  4GN5 A;  5LMN Q;  3HOU H;  3TS2 A;  2ID0 A;  3DM3 A;  4DV5 L;  4OO1 G;  2PQA B;  3FKI G;  3TQY A;  4JI6 L;  4DAM A;  4GLX A;  4DV2 Q;  3S1N H;  4YWM A;  5J3B A;  3NEM A;  4DV6 Q;  1OTC A;  2HHH Q;  1MIU A;  2BH8 A;  2JA8 H;  2CFM A;  2NVX H;  4DUY Q;  3U4V A;  2ZJQ A;  5BR8 L;  1E1T A;  3NEN A;  5IP9 G;  3HOW H;  1PH3 A;  4A3C H;  1KAW A;  4IPC A;  1YI2 A;  1SFO H;  2MO0 A;  1K3R A;  2KHI A;  1IL2 A;  4P74 A;  4ME3 A;  4OWX B;  3PGZ A;  3CC4 A;  4OX9 Q;  4AQY L;  4GS3 A;  1KRS A;  1TXY A;  1B7Y B;  4DV6 L;  2K5N A;  1I5F A;  1IZ6 A;  3F1Z A;  3CCV A;  1PH6 A;  3S17 H;  3M4P A;  2ZTE A;  2R7Z H;  4B3S L;  1U0L A;  3CW2 C;  1QZH A;  1S40 A;  4WJ3 M;  5FJ8 H;  1YVC A;  1Q7Y C;  1IBL L;  2UUC L;  4DR7 L;  1MKH A;  1X54 A;  1OXX K;  3M7N A;  1Z47 A;  5IWA Q;  4TQU S;  3UE0 A;  3KDF B;  3F2B A;  2F4V Q;  4BBR H;  2LXK A;  2PI2 A;  2OCE A;  4A3F G;  1HR0 Q;  1DGS A;  1TWH H;  2HQL A;  2R6G A;  3I56 A;  4HIO A;  2ASB A;  4BY7 G;  5IP7 H;  4DR4 Q;  4JV5 Q;  4AYB E;  4YY3 L;  4A3G H;  3PUX A;  1Z9F A;  4GOP A;  4JG2 A;  4L5T A;  2YU9 H;  1A8V A;  4JBJ A;  1VQ5 A;  4UP8 A;  4J15 A;  2IX0 A;  3CPF A;  1CSQ A;  1R9T H;  5DLQ E;  2QGQ A;  2PMZ E;  4LW1 A;  2LSS A;  2UXD L;  4DUZ L;  4HJ9 A;  3K7U C;  1WOC A;  3SGI A;  4JI7 Q;  4YY3 Q;  5C3E H;  4APV A;  4R4T A;  5IYB H;  1V43 A;  4DV4 L;  1KIX A;  4A3L H;  1AE2 A;  1QUQ B;  2UXB Q;  4BXX G;  1KXL A;  3D31 A;  1YHB A;  4DAY B;  1OXV A;  1E22 A;  2VQF L;  4DPG A;  1VQN A;  4LFA L;  1WCM H;  3W1B A;  5M3M H;  4A3L G;  2N8N A;  1A63 A;  3K8A A;  1JJG A;  2R7D A;  4IFD I;  1PVO A;  3K80 C;  4HJ5 A;  4LF4 L;  1N32 Q;  4LUZ A;  1HNX Q;  2N3S A;  3I4M G;  3NEL A;  2AWN A;  4GLA C;  5LMU Q;  4GLV B;  1YJ9 A;  4KHP L;  3HKS A;  3TRE A;  1Q1B A;  1WJJ A;  2MQH A;  3T1H Q;  3KFU A;  4PZ7 A;  4JI4 L;  1BKB A;  4A3E H;  3S15 H;  2WAQ G;  3M4O H;  4DR4 L;  3AQQ A;  4OWW B;  4JV5 L;  4O2D A;  5AJ3 L;  1E7Z A;  1FJG Q;  2IY5 B;  1VQD A;  2NZH A;  2B63 H;  4A3B G;  1PH1 A;  3I4N G;  2IT1 A;  1FGU A;  1OXU A;  5IP7 G;  3HOY H;  4X6A H;  2A8V A;  3CQZ H;  3S16 H;  4EQ5 A;  4JI4 Q;  3Q8D A;  5JEA J;  1QVG A;  4A3B H;  4C3I H;  3CC7 A;  4RG1 A;  4JI0 Q;  4GKJ L;  4O0A A;  4KHZ A;  4GNX A;  1VQP A;  1M90 C;  3RNU A;  4LF4 Q;  1N32 L;  4A3E G;  2PNH A;  1CKN A;  2R7F A;  3E9I A;  3UDI A;  4MNO A;  3RLN A;  4LFA Q;  1HR0 W;  2PI2 E;  3PIO A;  4LF7 Q;  4A3C G;  3CP0 A;  1H95 A;  2VW9 A;  4A3I H;  5IP9 H;  2VQF Q;  3GTK H;  2Z6K A;  3ER0 A;  2CKZ B;  1BBW A;  3A74 A;  3M9B A;  3J7A 5;  1SRO A;  1V9P A;  4B3M Q;  4NXN L;  4POF A;  1I50 H;  2K5H A;  5IYC G;  3T1H L;  1U5K A;  4IO9 A;  4DV0 L;  1XPR A;  4JYA Q;  1T9H A;  1WFQ A;  4DK6 C;  3AFQ A;  3I55 A;  5IYC H;  2DUD A;  2Q2H A;  5IT9 c;  3H3V I;  1J6Q A;  1Q81 C;  4YCW A;  2Y0S E;  2ZM6 L;  1Y1W H;  1HNW Q;  4LFC L;  2Z0S A;  3EIV A;  2MFI A;  2NVY H;  2OWO A;  4B3M L;  3PUY A;  1L0W A;  1QZG A;  1EIF A;  1UE7 A;  4BBS H;  1BBU A;  5IY0 A;  4A76 A;  1I6H H;  1EUJ A;  3JAM c;  1N34 L;  5FLM H;  5C3E G;  3HOU G;  4BA1 I;  2VL6 A;  4FDB A;  4DKA C;  1HZ9 A;  4A3G G;  4R1J A;  2N49 A;  4DR6 Q;  5GQO A;  3H0G G;  1K73 C;  2B29 A;  4B3R L;  3STB C;  2N78 A;  5LMN L;  4BA2 I;  2MO1 A;  1JB7 A;  2RF4 A;  4PMW A;  1QVF A;  2R93 H;  1KD1 C;  3U4Z A;  2JA9 A;  3I2Z A;  4X64 L;  4DR3 L;  5M5W H;  2I5M X;  4DV0 Q;  1X56 A;  3FP9 A;  4NXN Q;  4A3D G;  1LUZ A;  4BY1 H;  4A3M H;  4JBW A;  4GN3 B;  3IRB A;  4H02 A;  3HOZ H;  4X66 L;  3GTP H;  2K50 A;  3HOY G;  1SR3 A;  1HZC A;  1KL9 A;  2YTY A;  4TVA B;  4GN4 B;  2JK8 A;  3G71 A;  3M3Y H;  4GOP B;  3F8T A;  3KOJ A;  4B3S Q;  5FJ8 G;  1GVP A;  1AE3 A;  3GTG H;  4XTC S;  1D8L A;  5JJK A;  1RIP A;  1TWG H;  5E7N A;  3K0X A;  4B3T L;  5H1S E;  2JEB I;  4OX9 L;  4QL5 A;  2JA8 G;  4JBK A;  2AWO A;  4B3R Q;  2UU9 Q;  1FJG L;  2OQK A;  3LGJ A;  1J5E L;  4IPH A;  1OXS C;  1VQI A;  3HOX H;  2KHJ A;  2DGY A;  1VQA A;  4R4O A;  5AJ3 Q;  4A3J H;  1N34 Q;  2JA5 G;  3HOW G;  4BBS G;  3KF8 B;  2YTX A;  3RN5 A;  3U50 C;  1MJC A;  4JI2 Q;  4LFB Q;  4X65 L;  1UWV A;  2AMC B;  3OW2 A;  5C4X G;  2GVB A;  4C3H H;  3UDF A;  2QEX A;  4GNX B;  2Q2U A;  2EIF A;  1D7Q A;  5M5Y H;  4C3J H;  4QQB X;  2UUA L;  5ELO A;  4UP9 A;  4NPS A;  2D0O A;  4P73 A;  1YJW A;  1CKM A;  1X55 A;  1N36 Q;  5C0X I;  1JMC A;  4KLK A;  4X62 L;  1UEB A;  3OTO Q;  1IYJ B;  1JJ2 A;  2L15 A;  3CD6 A;  2KCM A;  4A3M G;  5GAG C;  4A3D H;  4LF8 Q;  2E2H H;  4DV4 Q;  2C35 B;  5K36 G;  4A75 A;  3PV0 A;  1XMQ Q;  1ASY A;  3RN2 A;  3L2P A;  1JJC B;  2JA7 G;  3I4N H;  4JYA L;  4JOI C;  4HID A;  1X6O A;  1WYD A;  4L5Q A;  1K8G A;  4BBR G;  2H5X A;  4EX5 A;  1EIY B;  3JAM i;  4NXM Q;  2VUM G;  3TRZ A;  1PHJ A;  2XTI A;  2E5L Q;  2Q2T A;  1CKN B;  1Y1V G;  4JI3 L;  4HJ8 A;  2E2I H;  2CWP A;  3MEF A;  4MZ9 A;  1EQQ A;  1VQ4 A;  1CKO A;  1QUQ A;  1LTL A;  2B63 G;  3PUW A;  5IWA L;  4HJ7 A;  2NN6 I;  1PH7 A;  3ERS X;  1IBK Q;  1W3S A;  4P71 A;  3E9H A;  2ZJP A;  2K52 A;  3PF5 A;  3PF4 A;  1Q1E A;  3F2D A;  2YYZ A;  3T1Y L;  1VQ6 A;  4UPA A;  4LF9 L;  3S24 A;  3GTM H;  1GD7 A;  3CAM A;  3ULJ A;  2A19 A;  1L1O C;  1FL0 A;  1EFW A;  4QJF A;  4X64 Q;  4DR2 L;  2CWA A;  3J80 c;  5JJL A;  3PUV A;  1VQH A;  2BA1 A;  3J81 i;  5C0X J;  1X65 A;  5JEA G;  2D0P A;  5M3F H;  4PG3 A;  4A93 G;  1PA6 A;  3CCE A;  3RLO A;  3EBE A;  3GD7 A;  3BU2 A;  1VQF A;  2NZO A;  1XJV A;  1PYB A;  2WP8 J;  5M3F G;  4OO1 I;  1K9M C;  1XNR L;  1XMQ L;  2MNA A;  1AH9 A;  1YZ6 A;  3PIP A;  1Q46 A;  2JJQ A;  4OWT B;  2KEN A;  5IYB G;  3A5Z B;  4JI8 Q;  3HOX G;  1PH9 A;  2K5V A;  3GTO H;  4JI6 Q;  2EXD A;  4NXM L;  2E8G A;  3OYY A;  3CCU A;  2HIX A;  2IHE A;  2F52 A;  2V1C C;  5FLX c;  1YIT A;  4OXP A;  2VUM H;  1HZA A;  4JI5 L;  1PFS A;  2VNU D;  1K0R A;  4LNQ A;  1PH8 A;  2KCT A;  1XTD A;  3KJO A;  2NVQ H;  4GKK Q;  4IFD J;  1X3F A;  4Y52 H;  3TEH B;  1NY4 A;  3H15 A;  2VS1 A;  3G48 A;  2NVT H;  3GTJ H;  1VQE A;  3A5U A;  1BVS A;  4PZ6 A;  3TS0 A;  2JA6 G;  2R93 G;  4LFC Q;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...