1X65A

Solution structure of the third cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
89
structure length
89
Chain Sequence
GSSGSSGREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords UNR protein
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x65A01
4DAMA 4GKJQ 2N3SA 3F8TA 2VQEL 2BA1A 4C3JH 3ER0A 4A93G 1NMGA 2B3GA 3J81i 4OONA 4DK6C 1HR0Q 3S1MH 2HIVA 4JBMA 4BBRH 1VQ4A 2Q2HA 5LMNL 3PO3G 3JC66 3TS2A 2KHJA 4JI8Q 5J3BA 3E0EA 2JA6H 1BBWA 3J7ZC 4RMFA 5LMUL 4QY7A 3FP9A 2VNUD 4GN4B 1VQEA 5GAHC 3UE0A 1VQ5A 1ASYA 1EIYB 1XPUA 2R92G 3S24A 2PI2A 1PH6A 5M3FG 4A3MH 4YWKA 4PZ7A 1JJ2A 2ZTEA 4DV5Q 3M4PA 4R4IA 3CXCA 1PH8A 4B3TQ 4LF4L 2JA8H 4EX5A 3PF5A 1CSQA 3M7NA 4JV5L 4LFBL 1VQMA 5C3EG 1PH7A 2F4VQ 3CQZH 3RLFA 4Y7NH 4LF8Q 4DAYB 4A3FG 3PUVA 4DV4Q 4P72A 1XNQQ 1N9WA 4DR4Q 4C3IH 4C2MH 3FHWA 2NVQH 2WFWA 4Y52H 2UUBQ 4A93H 4BA1I 1EUJA 3T1YL 1VQKA 4K0KL 2WB1G 4GOPB 5IYDG 1S72A 1G291 3G71A 4KHPQ 4X64Q 1K73C 3UDFA 5E7NA 4RG1A 3PO3H 2YTVA 1Q7YC 3GO5A 2E2HH 3HOUH 3CPFA 1CSPA 4UY8C 1EIFA 2K5VA 4LUZA 4YHHL 4QGUA 3CC7A 2JA7G 4JI3Q 1NY4A 1KRSA 2JE6I 4A3IH 4JI2Q 4DV0Q 1YITA 4JI4L 5M3MH 1JB7A 3EIVA 2VY3A 4GS3A 3DLLA 4ALPA 2BA0A 2IT1A 4DR1Q 4JYAL 4HJ7A 1HNZL 5GROA 1L1OB 1TWCH 1I5FA 1Z9FA 3BZCA 1UEBA 4NXML 3A5ZB 1PYSB 2N49A 3AQQA 4LWCA 1VQ9A 4B3SL 4LFAL 2B63G 2UXCL 1PHJA 2HT1A 1N32L 2ZJRA 1VCIA 1P16A 1Z47A 4C3HH 4YY3L 1G51A 5C3EH 5EAYA 4GNXB 4BY1H 4DV1L 4A3FH 1V43A 2AWOA 2K4KA 1S40A 1KIXA 1C9OA 5GQOA 1K83H 1VQDA 3A0JA 5BR8L 1S3OA 5FLMG 4DR2L 3CMEA 1AH9A 2WB1E 1SMXA 3NENA 1MJEA 4LF5L 3PO2G 2DUDA 4A3DG 1VQLA 4WJ4A 1OXVA 5IYDH 4X62Q 3T1HL 1X3FA 4GKKQ 1V9PA 4LF6Q 1XMOQ 4A3LH 3PCOB 1Q86C 4L5QA 3GTKH 4FDBA 1MJCA 1C0AA 2JA7H 3W1GA 4L5RC 1OXXK 1YJWA 4NXNL 3KDFA 4GOPA 1A0IA 2LSSA 2ALYB 2VQEQ 2K52A 2YYZA 2CFMA 3S14H 1CKNB 1EWIA 2Q2IA 2JEBI 4NB3A 5M5XH 4PG3A 3HOVG 2NVTH 4OO1G 1VQNA 1EQRA 4OXPA 2ATWA 2VUMG 1SR3A 3CCJA 4A3JG 2EQSA 4JBJA 4X66Q 4DR5Q 5HGQA 4A3GH 4KHZA 2R93G 1B7YB 1XTDA 3E9HA 4R1JA 4ME3A 1Q81C 2R7FA 4BXXG 4LF9Q 4JI7L 1L1OA 1IZ6A 1SE8A 2VQFL 1A62A 1K8GA 2R6GA 1W2BA 4IOCA 4JCVE 5ELNA 3S2HH 4A3BG 4JOIC 3OTOL 2Y0SG 1HNXQ 3AFQA 2D62A 3U4VA 3AFPA 3H3VH 4JI6L 3I4MG 5FLMH 4X6AH 1IXRA 1YIJA 2L15A 1CUKA 4YWLA 4IO9A 4GNXA 3PO2H 1YNXA 4HIMA 1QUQA 3CF5A 5JJKA 4LF4Q 3TS0A 1EQQA 4LFBQ 1VQPA 4YWMA 5FLXc 1WJJA 2HHHL 4DUZL 3J7A5 1L2FA 1TWAH 2JA8G 3OW2A 1Q1EA 4PMWA 3J80c 3UDGA 3RN5A 1FJGL 4JI1Q 2RHSB 1BVSA 1HJPA 4HIOA 3T1YQ 1QZGA 2E2IH 1W3SA 3HOVH 4K0KQ 3NBHB 2NN6G 3J80i 3FKIH 4AQYL 2VUMH 4DR7Q 4IJLA 1YHBA 4HJ9A 4A3JH 1N34L 2PMZE 1BBUA 4YCUA 5C44H 1QVFA 1IL2A 3U4ZA 1Y1VG 1JJCB 1CKNA 2JA9A 2R93H 1I3QH 3PV0A 1Q12A 2MNAA 1IBMQ 3PUYA 4BXXH 1VQGA 1GD7A 1G6PA 5HY6A 4DKAC 2Y0SE 4HJ5A 1D7QA 1PH3A 2HQLA 3CCMA 2CWPA 4A3BH 2DGYA 2N8NA 3HOUG 3K8AA 1MIUA 4JI4Q 2JK8A 2A19A 3KLWA 2IX0A 2KBNA 5JEAG 3I4MH 1N36L 1QZHA 1HNZQ 4JYAQ 3VDYA 4A3IG 2C35B 2D0OA 3CMAA 1XNRL 3RR5A 3U58A 3M3YH 2MO1A 1K9MC 4YCWA 2QA4A 4DV2L 5M3MG 4B3SQ 1I6HH 3BZKA 4LFAQ 1YHQA 1I94Q 3A5UA 1OXUA 4APVA 3BJUA 1VQFA 1Y14B 2KENA 4YY3Q 5C0XI 3K7UC 1A8VA 3NEMA 1IYJB 1E1OA 2MO0A 4R4OA 3SGIA 1M90C 4DV1Q 3F1ZA 1C7YA 5GADC 4LF7L 3HOZG 3MEFA 4IFDJ 2K5HA 1K0RA 1PH4A 4DV6Q 5BR8Q 1Q8KA 3S1QH 4BY1G 4DR2Q 1J5EL 4LF5Q 3BU2A 1SFOH 5JJIA 4OWTB 1JT8A 1IBKQ 2EXDA 4DV3L 4OWXB 2Z6KC 3T1HQ 1IBLL 1Y1VH 3PIOA 2I5HA 1YJNA 4OX9L 1E3PA 4B3MQ 2KCMA 3KDFB 1VQAA 3HOYG 4DR3L 3KJOA 1GKHA 1E7ZA 3I4OA 2ES2A 2HIXA 4A3LG 1JJGA 1NMFA 4GN3B 1SROA 2YV5A 2K14A 4HIDA 1SN8A 1YVCA 1XMQQ 1QVGA 2PQAB 3W5OA 2ASBA 2IX1A 3KJPA 4LFCQ 3I2ZA 3G6EA 4GLXA 4B3RQ 1OXTA 1OXSC 3CC2A 3K81C 1X54A 2OQ0A 4A4IA 3RNUA 5M5WH 5IWAQ 2IY5B 2AWNA 2GVAA 2YTYA 4IJHA 3HOZH 1LTLA 4DR6L 1P8LA 4AYBG 4A3GG 4GKJL 1QVCA 4BA2I 1HNWQ 1LM0A 1PH1A 1QUQB 1L0WA 5M5YH 1PA6A 1YHAA 4DPGA 2E8GA 5H1SE 3ICEA 4IFDI 1WCMG 3TQYA 2UXBQ 4WJ3M 1GM5A 2VW9A 2HHHQ 4GLAC 2ZM6L 3HOYH 1UE5A 4P73A 1N8RC 2UU9Q 1FJGQ 4O0AA 2MQHA 2WAQG 2AMCB 1KC8C 1HR0W 3B6YA 1NJIC 3HKZG 2Q2TA 3D31A 2I5MX 4AQYQ 4DV5L 4B3TL 5JJLA 1NBWA 1D8LA 5DLQE 2IHEA 2R7DA 3GTQH 1TWHH 2PQAA 3CW2C 3FKIG 4H02A 4XTCS 5FJ8G 2K5NA 2JEAI 1HH2P 3H0GG 1PVOA 4LF8L 4A76A 5C44G 2A8VA 2ZTDA 4DV4L 4R4QA 3CAMA 4PZ8A 5LMNQ 3IRBA 2F52A 2IHFA 4JI0L 4P74A 4QL5A 2ID0A 3S17H 2K50A 5LMUQ 1N36Q 3I56A 1RL2A 2QGQA 3CP0A 3CD6A 2AHOB 3KF6A 5C0XJ 1NE3A 3S1RH 4KHPL 1WCMH 2CKZB 4X64L 3GD7A 1A63A 4UP8A 2KHIA 2WP8J 3KYHC 4GN5A 2UXDL 2F3IA 1X3GA 3I7FA 2RF4A 2XGTA 1EOVA 1VQ8A 4POFA 3E9IA 1Q46A 1E1TA 2UXCQ 4JI3L 4JV5Q 4JI2L 4TVAB 4DV0L 1E24A 1YI2A 4GLVB 3KF8B 1X9NA 2BH2A 3HOXG 4X65L 3NELA 1HZBA 2K75A 4KI0A 1T9HA 1N33L 1KL9A 1VQHA 3STBC 4DUYL 1WOCA 4HJAA 5IYCG 1SLJA 2PNHA 1FL0A 2PI2E 3A74A 4O2DA 3I4NH 3RN2A 3M9BA 4OX9Q 1KXLA 5FJ8H 3M4QA 3H0GH 5ELOA 3ULJA 3CCRA 1SRUA 1YJ9A 1VQJA 3HOWG 4POGA 3I55A 2E5LL 4YHHQ 1JE5A 4LUOA 1FGUA 1K3RA 2E2JH 2MFIA 2RHQB 4DV7L 1CKOA 2VZAA 3CCQA 1H95A 1VQIA 4X62L 3ULLA 1N32Q 2VL6A 2H5XA 1XMOL 4IOAA 4EQ5A 1B70B 2A1AA 4NXMQ 2NZOA 1E22A 2GN5A 3ERSX 4GOPC 3RZDH 1Q82C 4JI5L 2N78A 1YZ6A 2LXJA 3HOXH 4LNQA 3RZOH 4IPCA 1Y1WH 1M1KC 2UUCL 4LUVA 1PV4A 1HZ9A 3F2CA 5IP9G 3S15H 1VQ6A 1B8AA 5IYCH 4MTNA 4X66L 3RLOA 4DR5L 4R4CA 5C4JH 3H3VI 4LF9L 1KHIA 1PFSA 4XIGS 2ZM6Q 5AJ3L 4A3EG 1L1OC 3G48A 1UWVA 3W1BA 3GTGH 1GO3E 2JQOA 1YEZA 1HNXL 1HZCA 3HOWH 2LXKA 1LUZA 1X65A 3HKSA 4NXNQ 1MKHA 4AH6A 2D0PA 4GNXC 1X56A 5LMNW 1VQOA 4HIKA 4OWWB 3TREA 3PIPA 2XTIA 1JMCA 2OTLA 1VQBA 2NVXH 4BY7H 3PUWA 4AIMA 1AE3A 2ZTCA 2CWAA 3TEHB 4OO1I 4IPGA 1TWGH 2JJQA 2FXQA 4UPAA 4JBWA 4JI1L 4JI0Q 4JI7Q 2OQKA 2UUAL 4J15A 2VQFQ 4L5TA 2BH8A 5JEAJ 3KFUA 3KF6B 4JOIA 3GTLH 4DR7L 3K0XA 3OTOQ 4UP7A 4HJ8A 4NPSA 5IP9H 2OWOA 3M4OH 1PH5A 1NTGA 4JI6Q 2V1CC 4JC0A 2NZHA 3CCUA 1HR0L 2UXDQ 3CCSA 1IBML 1OTCA 3UDXA 1FVIA 1X6OA 5IE8A 4A3EH 1U0LA 2QEXA 3CPWA 3UE1A 2JA5G 1LYLA 3HFZB 1WYDA 3DM3A 4JI8L 1XPRA 1PH2A 4DUZQ 1GVPA 4X65Q 4LW1A 2R92H 5C4XG 3OYYA 3J81j 2Q2UA 5M3FH 4P71A 3PSIA 5IYBG 1EYGA 3CC4A 1N33Q 3GDEA 4DUYQ 5C0XG 5GAEC 1ASZA 1VQCA 1V1QA 1I94L 4MNOA 4QJFA 4BY7G 3L0OA 1TWFH 3LGJA 3Q8DA 3ULPA 1UE7A 3JAMc 3F2BA 1O7IA 2VS1A 3U50C 3AEVA 3GTOH 1N34Q 5IP7G 2NN6I 5K36G 4KLKA 4IPDA 3I4NG 4BBSG 4IPHA 4DV6L 3MXNB 3JAMi 2F4VL 1PYBA 1CKMA 3PUZA 2E5LQ 3GTMH 1XPOA 3KOJA 4AYBE 4A3KG 2Z0SA 1KQSA 4DR4L 3PUXA 1XNQL 3PF4A 4DV7Q 1IBKL 4L5SA 2EIFA 3TRZA 4QQBX 3H15A 4JG2A 1WFQA 2I5LX 2UUBL 2CCZA 4B3ML 1I50H 3GTPH 1XNRQ 4DV2Q 2OTJA 2JA5H 4YCVA 4JI5Q 1HZAA 1VQ7A 2YU9H 1U5KA 2R7ZG 4A3CG 1XMQL 1XJVA 1DGSA 3M85A 3RLNA 1K8AC 1BKBA 3K80C 1KRTA 5C4XH 2UUCQ 4LF7Q 4LFCL 3S1NH 4PZ6A 3AYHB 3WWVA 2WAQE 5IYBH 4B3RL 3PGZA 3HKZE 3K7AH 1AE2A 1TXYA 4JBKA 2B63H 1UE1A 1Y1WG 1PH9A 4DR1L 2B29A 4DK3C 3STBD 4A75A 2KCTA 5GAGC 1J5EQ 3L2PA 2NVYH 3S16H 5IWAL 3F2DA 3ZJYC 2Z6KA 5AJ3Q 1UE6A 2ZJPA 4BBRG 4DV3Q 4TQUS 1KAWA 4DNIA 5IP7H 3L7ZC 1Q1BA 1IBLQ 2RCNA 4BBSH 2CQOA 3EBEA 2JA6G 1HNWL 4A3KH 4DR3Q 4UP9A 4IFDG 1EFWA 3CCVA 3GTJH 4A3DH 1R9TH 2OCEA 1YBYA 1KD1C 4MZ9A 4QIWE 1X3EA 2AKWB 3D0FA 2UXBL 1WI5A 3EN2A 4A3MG 2ZJQA 3UDIA 1X55A 3CCLA 3S2DH 3G4SA 2GVBA 4GKKL 4LF6L 2UU9L 2I0QA 2R7ZH 3CCEA 4A3CH 5IT9c 1J6QA 5IY0A 2UUAQ 4R4TA 4P75A 1VS0A 3J81c 2YTXA 4DR6Q 1RIPA
chains in the Genus database with same CATH superfamily
2N3SA 1S5BD 1CT1D 2VQEL 2BA1A 2Q8TA 4C3JH 3T4AC 2I46A 2B3GA 4OGQC 4DK6C 1HR0Q 2JA8B 3OIQA 4O42A 3PO3G 1CA5A 4JI8Q 2K32A 3E0EA 1SJED 1SE4A 1EY5A 2F0QA 2VNUD 4GN4B 2A69C 1Y1VB 2R92G 2EJFC 1JJ2A 3VR4A 1JWMD 2QF7A 3HOUB 3NK9A 4ULLA 1XYIA 4A3FG 3PUVA 1BF4A 4N8X1 2H1EA 4C2MH 4G4KA 1EUJA 3T1YL 1PTOD 2WB1G 4L6TB 4GOPB 1S72A 3G71A 4C3HB 2RDHA 3UDFA 3PO3H 2YTVA 1Q7YC 3CPFA 4UY8C 3DUZA 2K5VA 2MP1A 4YHHL 1PZJD 1NY4A 1KRSA 4JI2Q 4KTAA 1YITA 4JI4L 3ND9A 4ALPA 4HJ7A 2HCIA 4NXML 4B3SL 4LWCA 2M2LA 5EAYA 3FDTA 4A3FH 4MIUA 3S14B 4R8NA 1K83H 1ZEQX 5BR8L 3GTQB 2NVTB 1S3OA 1CTMA 1SMXA 3DEOA 1MJEA 3PO2G 2Q8IB 1OXVA 4UAIA 2EY2A 1X3FA 1V9PA 4LF6Q 2F0KA 4XDXA 3W1GA 3NWSA 1OXXK 3LX0A 1M4VA 1A0IA 4HSPA 3MXPA 1EOTA 1WCMB 2CFMA 1EWIA 2Q2IA 1JQYD 1U4RA 1K8OA 1BUVT 2EQSA 4JBJA 3SK6A 3WDNA 4A3GH 1B7YB 1XTDA 2AQ1B 3E9HA 3HKZB 1L1OA 1SE8A 2VQFL 1EL0A 2WACA 3R93A 1MI2A 2KQ3A 1QG7A 2XNAC 4JI6L 2SNSA 1B44D 4YWLA 3H0GB 3PMFA 1YNXA 3PO2H 3CF5A 1MSHA 2D5DA 4NMZA 5C44B 4LF4Q 1SYBA 1SJHD 5FLXc 4FF2A 5F2DA 1HHVA 2JA8G 2EYJA 1TS3A 4L63B 1L0YB 2HUGA 3AMUA 2RHSB 2JYOA 1PYWD 3NBHB 5EBDA 3V96A 1GUGA 3M4YA 3RZDB 5CGKA 5D14A 3U4ZA 1Y1VG 1JJCB 3HOXB 2K1BA 3PV0A 1Q12A 1IBMQ 4HMJA 1VQGA 5LL6S 1I4GA 4DGZA 1IW7C 2Y0SE 4CJ2C 4DKAC 1PH3A 3CCMA 3HOUG 1VMPA 2KBNA 1F2ZA 3DHQA 2A69D 1K9MC 3SK8A 4DV2L 4LFAQ 1YHQA 3GV3A 1TT2A 2N88A 1X32A 2KENA 3BJUA 4IURA 1E2ZA 3GV6A 1A8VA 4KD4A 4YY3Q 4DV1Q 4LF7L 4IFDJ 2K5HA 5DM73 4H7BA 1H9JA 4C3HG 4DV6Q 1ZYRD 3A56A 3K5LA 1UEAB 2OF1A 1LT5D 2NTTA 3VYTA 5FO8B 2F3WA 4N8FA 4OWXB 2Z6KC 3T1HQ 1Q90A 4IUVA 5EKKA 1Y1VH 2E2DC 2I5HA 3PIOA 1E3PA 3MFYA 4B3MQ 3KDFB 3M4OB 1O78A 2HIXA 3HEJA 1SSOA 1NMFA 4C1NK 1XMQQ 2K14A 5EKIA 1QVGA 1J9OA 1C4QA 5C3WA 2IWHA 5BN3A 4CDEC 1EZ6A 1OXSC 3CC2A 4A4IA 1X54A 2IY5B 3VA7A 2AWNA 3VYUA 3K58A 2AQ3B 1P8LA 3I72A 1JC7A 5I6YA 1QVCA 1V1PB 3H3VC 4BA2I 1CFMA 3LWEA 4PV1C 1PA6A 4DPGA 4Q5VA 5H1SE 1WCMG 3SHLA 1TWHB 2UXBQ 1GM5A 2L4NA 3MC0B 4CHTB 1Y8PB 1STNA 5DNFA 1IHZA 1FJGQ 1ILPA 2AMCB 2PZUA 3HKZG 1I50B 3D31A 1NJIC 2Q2TA 2BCOA 2DY7A 4AQYQ 5JJLA 1NBWA 1UNSA 2YU9B 4CBVA 2G5DA 3GTQH 1SYFA 4H02A 2DY8A 3S1NB 1PVOA 3H0GG 1JCKB 1EQVA 5JPNC 5C44G 3NTKA 1HXYD 4JK1C 2PCFB 4R4QA 5LMNQ 3IRBA 4JI0L 5HGTA 3H91A 4P74A 4KHVA 3E3XA 1N36Q 1WTWA 1DD2A 2NB0A 3QIAA 1WCMH 2CKZB 2RSNA 3J7YW 4A3KB 3T13A 1X3GA 1EOVA 4POFA 1E1TA 4I65A 2PZWA 4JI2L 2F0DA 1O7YA 1X9NA 1U9RA 1DYQA 3HOXG 4X65L 3NELA 4KI0A 1N33L 3NSWA 1VQHA 4HJAA 1MHWC 2PNHA 4LK1C 5BN4A 3RN2A 3M9BA 3M4QA 3H0GH 2HQEA 1SRUA 1VQJA 3QO2A 4POGA 3S1MB 1IW7D 3NBIA 1K3RA 5KEEA 2R61A 4HTHA 4DV7L 4EVOA 2VL6A 1CK1A 3NQTA 5D3IB 4IOAA 1B70B 1IYVA 1E22A 5ELFA 4K5VA 3RZDH 4V190 3O13A 3HOXH 2Z1CA 4LNQA 1Y1WH 3EQLC 1LV9A 5C6AA 1B8AA 2B2YC 5ELEA 3RLOA 4R4CA 3BVGA 4FF4A 2ZM6Q 4ILWA 3W1BA 2NVQB 4R8IA 1RODA 3EJIA 4KJNA 4NXNQ 4AH6A 1Y69U 2D0PA 5JOBA 5LMNW 4DNRB 2DNCA 4XQQA 2E2HB 4OWWB 1DCZA 1SMYC 2A68D 4IN3A 1LLRD 3PIPA 2NBFA 2OTLA 4TKOB 4AIMA 2CWAA 1LO5D 5JVH3 2JJQA 4JBWA 3VYSA 4L5TA 1CQFA 3BDOA 5JEAJ 2PNRC 3K5OA 3M4OH 2OWOA 1TWFB 4N9TA 4JC0A 1E2VA 4BY1B 2EOTA 2E76C 5KIXA 3CCSA 3UDXA 1IBML 5IE8A 3CPWA 2QEXA 3UE1A 1GVPA 2F3VA 1TS2A 3J81j 3PSIA 1EYGA 4DUYQ 1KLGD 2J7ZA 2K5WA 5GAEC 4K6LA 1ASZA 3R8BA 4KY6A 4HEDA 2PZTA 4ABNA 3QOJA 1MD2D 2JA7B 3ULPA 3F2BA 1O7IA 2IW3A 4KK7A 1N34Q 4MTKA 4IPHA 4DV6L 2E5LQ 4A3KG 2Z0SA 2F4IA 4DR4L 5EPJA 4QQBX 3TBIB 2Z9HA 1CZGA 1HTLD 4B9XA 1WTHA 2IX3A 4OIJA 2CCZA 2EJGC 4B3ML 1I50H 1QNUA 1W6JA 1FNVA 1STEA 2CW0C 2YU9H 1U5KA 1XMQL 1ENFA 3OSOA 3G6JB 1B4OA 1ML0D 5EJWA 2UUCQ 2F0GA 4K5WA 3S1NH 2F1MA 5LL6X 4RGMA 3HKZE 4XYOA 1PFMA 4JBKA 5FLXE 4DK3C 1TWAB 3R3OA 2KCCA 3ZJYC 2Z6KA 4TQUS 5T1IA 1I4QA 1MBYA 2FHTA 3EBEA 3HOVB 2VUMB 4A3KH 5A2QL 4IFDG 1S5CD 2EJMA 3I90A 4ZUJA 4C3JB 3T56B 2TMPA 1YBYA 5KNBA 2Z4HA 3MXNA 1JB3A 2AKWB 2UXBL 5COYA 5JJZA 2BDOA 4OIKA 1B2TA 2Y0SB 4GKKL 2M9VA 1BO0A 3CCEA 1TU2B 4P75A 2OT2A 1DOLA 4DAMA 4ME5A 4GKJQ 3F8TA 4OL7A 4TRDA 1S5ED 2X6GA 1UUPA 4RWSC 3S1MH 1STGA 1WD1A 2KECA 5LMNL 3OWEB 3S1QB 2KHJA 2EYOA 1SFOB 3J7ZC 4HMIA 4IFDH 1VQEA 2CQAA 1VQ5A 3MZ5A 1XPUA 2ZXRA 2LY7A 1PH6A 3T53B 2K04A 2Z8LA 4YWKA 1F9PA 1PH8A 1TY2A 1SMYD 5IGFA 3M7NA 4EX5A 3PF5A 1CSQA 4LFBL 1GUOA 1FD7D 4BS9A 5CC4A 1LTGD 1I4RA 1GUWA 1XNQQ 4CJ1B 2O2LD 3DM1A 3FHWA 2NVQH 2WFWA 2MGSA 3A8KE 3NBHA 3MXGA 1PRTB 1G8ZD 1NAPA 4X64Q 4KY5A 4C1NI 2F0TA 1SYCA 2E2HH 1YNJC 5M5YB 3RUZA 2JA7G 4LUZA 4KN4C 3CC7A 4K14A 2KUMA 4P2CB 1LTSD 1K83B 1CA6A 4KKTA 5ELCA 1JB7A 2VY3A 1CM9A 2IT1A 3AU7A 5GROA 3NE5B 4NDXA 3HOYB 3KBGA 3BZCA 3J7AF 1QB5D 3A8IE 3A5ZB 3AQQA 2K5DA 1CQVA 1PHJA 2ZJRA 2KEEA 1VCIA 1Z47A 1T5EA 4GNXB 4BY1H 1X3PA 2K4KA 1C9OA 5GQOA 3S9WA 3CMEA 1AH9A 2DUDA 3M7GA 4DAYA 1RTNA 1XMOQ 4A3LH 1Q86C 3S17B 3EVQA 4FDBA 5LHY1 1MJCA 1YNNC 2JA7H 1JICA 2CW0D 4NXNL 3KDFA 5CORA 2ALYB 2XRQD 1IYUA 4N9PA 4Q0FA 1SNQA 3A54A 4I7ZC 1CKNB 4NB3A 4EGVA 5M5XH 2K5QA 4PG3A 3HOVG 1VQNA 1EQRA 4JPBW 4OXPA 2ATWA 1SR3A 2VUMG 4C3JG 2B2YA 5HGQA 4KHZA 4KD3A 1BCPB 4BXXG 1IZ6A 1W2BA 2Z6BA 4IOCA 5ELNA 2KOLA 3VYRA 2Y0SG 3AFQA 5E3FA 1H9SA 3HZXA 5CV4A 1EZ8A 4X6AH 1SE3A 4K8IA 3D6CA 1S5FD 4FYDA 1G91A 3QG1A 1II3A 1WJJA 2HHHL 3J7A5 1L2FA 1TWAH 1ILQA 1BR9A 2SEBD 2N55A 2RDFA 1GHKA 4HIOA 1QZGA 3P1HA 3HOVH 4K0KQ 1ONLA 1PFBA 2NN6G 2VUMH 3J81E 1YHBA 4HJ9A 5FO7B 4HCSA 1N34L 4YCUA 1F2LA 5IT9L 4BXXH 4CGYB 5CV7A 4WFN3 3S15B 1D7QA 4ZQ3A 2HQLA 3IFDA 2DGYA 2P5ZX 3R2TA 1MIUA 2WINB 3KLWA 5JEAG 4JYAQ 1HNZQ 3VDYA 4LAAA 2D0OA 4RAUC 5E4XA 2O5JC 3BZKA 3HOWB 2PQEA 3TSSA 1PRTC 3A5UA 1Y14B 1VQFA 4R4OA 4DU9A 1E1OA 2D9UA 2MO0A 4ZAIA 4IZ8A 5J39A 1PH4A 1Q8KA 4NKLA 3S1QH 1FNWA 4DR2Q 2NVXB 1ZYRC 4LF5Q 1SFOH 2NN6H 4CJ0B 2A74C 4HAEA 1TWGB 1YJNA 4OX9L 5IODA 2KCMA 2MHVA 3HOYG 1ESFA 1E7ZA 1YNJD 3I4OA 2ES2A 4GN3B 1SROA 4DXGA 5JEAH 3W5OA 2ICIA 4IUNA 4DF7A 3KJPA 1KNEA 4GLXA 5C5MA 1TVXA 1I4PA 2EVBA 3RNUA 2YTYA 2K33A 1D5ZC 2CVRA 4A3GG 4GKJL 1LM0A 1QUQB 2SDFA 5M5YH 3GTOB 1YHAA 4IFDI 1RCVD 1JE4A 4H0LC 1B9NA 1SE2A 4X3SA 1HFNA 3HOYH 1BCPC 1STHA 4F8MA 3IFTA 5FK9C 1YNND 2UU9Q 1HR0W 4CKBA 3B6YA 2AUKA 5C4ZA 4M8AA 2NYZD 4YIJA 3HS0C 5E4WC 2PQAA 3NTIA 1STAA 3DWAA 3EROA 2DN8A 4TSSA 2IHFA 4RA8A 2KCNA 3S17H 5LMUQ 1RL2A 2QGQA 3CP0A 1AEXA 1NE3A 4X64L 1A63A 3GD7A 1DOMA 4RKLA 4QCLA 2UXDL 1LTTD 2XGTA 1LABA 1AZQA 3E9IA 3GTJB 1R9TB 4JV5Q 3P20A 2HDLA 4TVAB 4CDFC 1E24A 1HRJA 3NHHA 3KF8B 4GLVB 2BH2A 2K75A 2FMMA 2K05A 1T9HA 2HD3A 1KL9A 4J8QA 2PI2E 3BVMA 3TMEA 3I4NH 1G2TA 5ELOA 3ULJA 3J80L 4XYQA 3OW7A 3HOWG 1RD9D 1Y1WB 4MN3A 1FGUA 2PO4A 2MFIA 1TS4A 2RHQB 4BBRB 4ZLTF 3ND8A 3W2DA 1CZWA 5I4DA 3V05A 3CCQA 1VQIA 2JP1A 2JA6B 2H5XA 3AB9A 1XMOL 1HTPA 2A1AA 2NZOA 1PRTD 1XWEA 3FVQA 5T1GA 4GOPC 1Q82C 4JI5L 1EU4A 1EQTA 2LXJA 1TIID 2LS01 4A3MB 1NSNS 1O7ZA 1NNXA 3F2CA 5IP9G 3S15H 1VQ6A 2V4DA 4IQZA 4Y7NB 1KHIA 1O80A 4XIGS 2EYFA 4C3IB 1GO3E 2JQOA 1WVLA 3HOWH 2LXKA 1GUNA 1RDPD 4RFBA 1JWSD 1VQOA 1HUMA 2XTIA 3HGBA 2NVXH 2A68C 1A6XA 1H9KA 3PUWA 1AE3A 1ET9A 3KLSX 2OXPA 3TEHB 1TWGH 5M3MB 3F2UA 2FXQA 1GUTA 4LMQD 1WTVA 1TWCB 2NWGA 2OQKA 2UUAL 3KFUA 3KF6B 1NR2A 4X3KA 3FEWX 1K3BC 1R4QB 1A3TA 4JW0A 3OTOQ 3A55A 5IP9H 1EFID 2F0HA 1NTGA 1QWYA 4B08A 3CCUA 1HR0L 2E75C 1OTCA 3SE0A 3ITPA 2K28A 3FPUB 3TP5A 1LYLA 1NR4A 1WYDA 4LJZC 4U673 4JI8L 4FF3A 1QJOA 1BCPD 2QCPX 3P75A 5M3FH 5IYBG 2DJGC 4ZRZA 1QVFA 3GDEA 5C0XG 3TP7A 5I9PA 1EWCA 4G7HC 1V1QA 3GTKB 2B2VC 3L0OA 3LGJA 2VS1A 3AEVA 3GTOH 5BN5A 2NN6I 1X3QA 2H4OA 1CKMA 3PUZA 1XPOA 5CBAE 1H95A 3PUXA 4PNYA 2EIFA 3H15A 1WTQA 1U4MA 1XNRQ 1BBXC 1NUCA 3S2HB 2OTJA 4YCVA 1VQ7A 1DGSA 3RLNA 1BKBA 5IYBH 3PGZA 5C0XH 1AE2A 2B63H 1Y1WG 4K6DA 2B2UC 4A75A 4ZYSA 3S16H 1J5EQ 5GAGC 4KKSA 2F0SA 5AJ3Q 1UE6A 2ZJPA 4BBRG 4DV3Q 4DNIA 1KAWA 1RKNA 1IBLQ 2E2IB 3VR3A 3HG9A 2JA6G 5KGUA 4DFAA 1PZID 1CHPD 3GTJH 3DMUA 1B3QA 4A3DH 5G3LF 1R9TH 1U4PA 1RF2D 3Q24A 3D0FA 2A6EC 4FXDA 4A3MG 2XIWA 2ZJQA 3VR2A 3CCLA 3G4SA 2GVBA 4LF6L 2UU9L 1J6QA 1NCVA 4QUCA 3J81c 4DR6Q 3FMCA 1HJPA 4C3IG 3ER0A 3CKIB 1MSGA 3J81i 3I4LA 2HIVA 4BBRH 1VQ4A 4OELB 3SR1A 4KJOA 2L55A 3Q22A 2JA6H 1BBWA 5ELDA 4K2LA 2RDGA 4RMFA 2F0WA 5IOCA 5LMUL 4QY7A 3FP9A 1Y8OB 3UE0A 5GAHC 2QW7A 4GZYC 1Z6HA 1HPCA 3FPPA 4A3MH 4PZ7A 2ZTEA 4DV5Q 4B3TQ 4R4IA 5EPLA 3KUPA 4XXEA 4LF4L 4K8JA 4JV5L 1EY6A 1WTOA 1VQMA 1PH7A 1VF7A 1KAAA 5ELBA 4XQJA 2F4VQ 3RLFA 4Y7NH 1MGSA 2FJ2A 4C3IH 2UUBQ 4KY7A 3HOZB 1G291 4KHPQ 1K73C 5E7NA 3MEHA 3CRLC 1PTOF 4FP5D 1EIFA 1PFNA 5EPKA 4A3IH 4O1NA 4DV0Q 4H13C 5I6WA 4KN7C 1SYEA 5M3MH 3KLSA 4GS3A 3DLLA 2BA0A 2B2WC 3ONAB 4DR1Q 1L1OB 1S5DD 1TWCH 1UEBA 1PYSB 2KVMA 4EQOA 4LFAL 3MTSA 2HT1A 5JPMC 1EU3A 4YY3L 3D4DA 4DV1L 1WTPA 2X69A 1Y8NB 3JAME 2AWOA 1S40A 4OHJA 5M5XB 1VQDA 2FINB 2L12A 3A0JA 2L5TA 2WV6D 3A8JE 3NENA 3ZYYX 3SXHA 5CYUA 4WJ4A 3D6WA 3T1HL 5CV8A 4L5QA 3GTKH 1DONA 2A5HA 4GOPA 2LSSA 2WKCA 5EQ0A 1RJTA 2VQEQ 4M1UB 5JVG3 4OO1G 5C3XA 1DXMA 5EBCA 2EYPA 4K5XA 2MUYA 4X66Q 4DR5Q 2WAQB 4R1JA 2R7FA 4LF9Q 4DXFA 5L37A 1K8GA 2R6GA 3TZDA 4JCVE 3H6MA 3S2HH 3OTOL 1FGBD 2D62A 2EZVA 4FF1A 1RHPA 4RHSA 2L15A 1GUSA 4HIMA 1QUQA 5JJKA 2K01A 2A6ED 3TS0A 3D4RA 5I9OA 2LMCB 4YWMA 1K28A 2J0TD 2OEOA 2E2JB 4QIWB 3OW2A 2HDMA 1Q1EA 3RN5A 5CV5A 3Q0AA 1FJGL 4JI1Q 2E2IH 3T1YQ 5EGTA 4OO1H 3ERQA 3FKIH 4AQYL 4DR7Q 1KABA 4IJLA 1AW7A 1PZKD 2QKIC 3TDQA 1HCZA 1IL2A 1ENAA 1G6ZA 2JA9A 3RZOB 2MNAA 3PUYA 3PIO3 3H09A 4FO2A 2TSSA 1M8AA 1TR5A 5FOBB 4JI4Q 2JK8A 5C4JB 2IX0A 1N36L 1QZHA 2C35B 3CMAA 1XNRL 3RR5A 4G57A 3U58A 2MO1A 3M3YH 2WIIB 4YCWA 4B3SQ 2B2VA 2F0EA 5C0XI 3K7UC 3NEMA 5CR3A 3SGIA 2F0FA 1M90C 3F1ZA 3HOZG 1K0RA 5BR8Q 3KF8A 4BY1G 3U9SA 1J5EL 5JJIA 4OWTB 4DV3L 3EFXD 1LTRD 1IBLL 2PYKA 1VQAA 3W3AA 3KJOA 4QMGA 1D6EC 1ZKOA 3WOFA 4A3LG 1JJGA 4HIDA 1SN8A 1D1IA 2ASBA 3I2ZA 1Z7TA 4A3EB 1Q3LA 1ZXTA 1OXTA 3K81C 2OQ0A 2R92B 1U4LA 1SYGA 5FKAC 1B1ZA 5DM63 3HOZH 1LTLA 4DR6L 2JXMB 3DWPA 2F0MA 2E8GA 3Q6SA 3ICEA 2B8GA 1GXDC 3QWNA 4WJ3M 2R3ZA 3H94A 4GLAC 2ZM6L 2EY5A 2KHSA 1A2TA 4P73A 4K2KA 2MQHA 2WAQG 3X3MA 2ZXPA 3GTPB 2I5MX 4V0BA 5KNDA 2X6LA 4DV5L 4B3TL 2JA5B 4ZKBB 1D8LA 4QUFA 1DOKA 4EQPA 2R7DA 5C4XB 4IUPA 3D3RA 4XTCS 5FJ8G 3QJYA 3DEPA 4A76A 1W6KA 2ZTDA 3CAMA 4PZ8A 2FFKB 3IAYA 2F52A 3IL8A 4QL5A 4HCEA 3LNNA 1F9QA 2NVYB 2K50A 3K0YA 1PTOH 3KF6A 4DN4M 5KNCA 5C0XJ 4DK0A 4KHPL 3I4NB 4BBSB 1V1PA 4UP8A 3KYHC 4GN5A 3NTHA 2F3IA 3I7FA 2RF4A 1VQ8A 2UXCQ 2B2TC 4RCOA 1Q46A 2DJFC 5IGBA 4DV0L 5C4HA 2D2CC 3K5MA 2F03A 3NQIA 2EY1A 3STBC 4DUYL 5IYCG 1SLJA 3J80E 5DAUA 1ICWA 3A74A 4O2DA 5FLXL 1KXLA 3HP3A 5FJ8H 3CCRA 1A3VA 5CMDA 4J1MA 2J4XA 1FYCA 2PMZB 2E5LL 1Q8IA 2E2JH 3OOCA 3E5SA 2VZAA 3NWTA 1JWUD 3ULLA 2B2WA 1N32Q 1HQRD 1PMRA 3RMHA 1EY0A 1C8CA 4EQ5A 2EY6A 3PIP3 3ERSX 3BVZA 3CRKC 4ODGA 1EYDA 2N78A 3C1EA 3RZOH 2UUCL 2F0LA 1M1KC 1PV4A 1S4ZA 4FXGC 5IYCH 4MTNA 4X66L 4DR5L 4UDUC 3CQZB 5C4JH 4LF9L 4A3EG 3BZDB 3G48A 3K57A 2VXWA 1VF5C 1YEZA 4A93B 1HZCA 2RA4A 3SK4A 5J22A 1QOHA 3WOEA 3HKSA 1MKHA 1ESRA 4GNXC 4PMCA 1X56A 2A6HC 5K5PA 3EA6A 3TREA 1LTBD 1JOQA 4NW2A 4OO1I 4UPAA 4JI1L 2SOBA 4JI0Q 4U68A 2F0IA 4X3UA 3C2PA 4JI7Q 1F77A 4F7XA 5M3FB 4J15A 3K5NA 2NZ1D 3OPOA 4DR7L 4HJ8A 4NPSA 1PH5A 5C3EB 3NP8A 2NZHA 1F9RA 3BDCA 2CHBD 1RTOA 5FO9B 2ENBA 1X6OA 4A3EH 2B8FA 4UHVA 4XT1B 2JA5G 1STYA 2BOSA 2K6AA 3HFZB 1XPRA 1PH2A 5IGGA 4DUZQ 4X65Q 4LW1A 2R92H 5C4XG 1KNAA 2IJ0A 3MVVA 3OMGA 1ENCA 3NUCA 4XT3B 1N33Q 2ICEC 4XQNA 4MNOA 1UE7A 3JAMc 3IKJA 3U50C 3E6ZX 4BWGB 4KLKA 3I4NG 4BBSG 3MXNB 2KEDA 3JAMi 1IKMA 3I3CA 1TS5A 1SNCA 3PF4A 1XNQL 2B63B 1SNMA 4DV7Q 3TZUA 1HUNA 3S16B 2I5LX 4DAPA 3GTPH 5AFWA 2C5CA 2JA5H 3V2TA 2L0CA 4A3CG 1XJVA 2QDBA 3SDZA 1KRTA 1ET6A 5C4XH 4A3DB 3MXUA 3BS1A 4PZ6A 3AYHB 4L8JA 2WAQE 3STBD 1PLFA 2KCTA 3L2PA 2NVYH 1IKLA 2IL8A 1TKWB 1JOKA 2K03A 3L7ZC 1FNUA 3MWYW 2RCNA 4BBSH 2CQOA 1XX8A 4DR3Q 1T5XD 4UP9A 1EFWA 4A3JB 2RQXA 3N6RA 3NPPA 2R93B 2RKSA 1I3QB 1KD1C 4MZ9A 4QIWE 2KA7A 1WI5A 1JR0D 3EN2A 5C5LA 2RVLA 3G7LA 3MFGA 3S2DH 3K6OA 4A3BB 1JORA 3OIPA 2F0JA 4JVZA 3I4MB 4A3CH 5IT9c 5IY0A 1VS0A 1EIHA 1I6HB 2LFNA 2K52A 1KLUD 1D5MC 4A93G 1NMGA 5CBEE 4OONA 2RBMA 1VMCA 4E6IA 1C48A 3J81L 4JBMA 1B50A 2Q2HA 3JC66 3TS2A 5KRUA 1V8QA 5J3BA 2L9HA 5JAVA 2PW7A 3R2IA 1ASYA 1EIYB 3S24A 2PI2A 5M3FG 2A6HD 1SAPA 2UXCL 3M4PA 3CXCA 2JA8H 2BDNA 5C3EG 1TY0A 3L9AX 3CQZH 3OWFA 4CKCA 4A3IB 4LF8Q 4DAYB 3J7AV 4DV4Q 4P72A 4DR4Q 1N9WA 1HQMC 4S3SA 4Y52H 1XXGA 4A93H 4BA1I 5M5WB 2RCFA 1VQKA 4K0KL 5IYDG 4KV6A 5D65A 1QNKA 4RG1A 3GO5A 3HOUH 1SXTA 1CSPA 2B2TA 1SNPA 4H44C 3NXWA 1AZPA 4QGUA 4JI3Q 2DNEA 4HN7A 2JE6I 4RKBA 3BDLA 4QB4A 2EDGA 3EIVA 1N32L 4JYAL 3MAQA 4IUTA 1HNZL 3PQIA 3N52A 3LWUA 1I5FA 1Z9FA 2EPBA 2N49A 1VQ9A 2B63G 3D4WA 1H9SB 4ZKCB 4C3HH 1P16A 4RGTA 5C3EH 1G51A 2EYMA 4PMBA 1V43A 4MHEA 1KIXA 5FLMG 4DR2L 2WB1E 2K7VA 4LF5L 4A3DG 3OHXC 2FMCA 2PPBC 1VQLA 4AYBB 3GP7A 1E2WA 5IYDH 5KYIA 4X62Q 4FNFA 4GKKQ 1LT4D 3PCOB 1F2MA 3U9OA 1C0AA 4L5RC 1YJWA 4FXKC 1KDCA 1CHQD 2AUJD 3S1RB 2A73B 2YYZA 4ZK9B 4Z9CB 3S14H 2JEBI 5KYLA 2XWJB 2NVTH 2C9OA 3TP8A 3URYA 3CCJA 4A3JG 3K59A 4IUQA 3MHBA 3TN2A 5IGCA 2R93G 1Q81C 4ME3A 4JI7L 3A7AB 4J6HA 1A62A 5A2QE 4A3BG 1STBA 4JOIC 5E1FA 1HNXQ 3HRZC 3U4VA 3AFPA 3H3VH 3I4MG 5FLMH 3FKIB 1IXRA 1YIJA 4IO9A 1CUKA 3I70A 4GNXA 2G9HD 5EKLA 1EY9A 1EQQA 4LFBQ 2E74C 1VQPA 4DA2A 2NUCA 4DUZL 2ZT9C 2XVSA 4HSVA 3TP6A 2F0PA 4PMWA 3J80c 3UDGA 1SYDA 1BVSA 3A7LA 3M3YB 1W3SA 3J80i 2CH4W 4A3JH 2PMZE 1BBUA 5C44H 2CH4A 2GA4B 2R93H 1CKNA 1I3QH 1GD7A 2O4XA 5HY6A 1G6PA 2L11A 4HJ5A 2CWPA 4A3BH 2N8NA 1O7LA 3K8AA 2A19A 3D8GA 5D3DA 3I4MH 4A3IG 1VDZA 2F0VA 5HURA 1D5XC 1TQOA 3GTGB 5IGEA 2QA4A 1I6HH 5M3MG 2EYHA 1HFGA 1G2SA 1I94Q 1OXUA 4APVA 1IYJB 3GQBA 1EEFD 2VB3X 1I4HA 1C7YA 5GADC 3MEFA 1GOZA 5IGDA 3SVMA 1SNDA 1DJRD 3SEBA 2EYLA 3BU2A 1JT8A 1IBKQ 2EXDA 5DEHA 1E0BA 4X3TA 3QOLA 1I4XA 3GTLB 4DR3L 1GKHA 2AQ2B 3FRPB 4NP5A 2YV5A 1B9MA 1YVCA 5IIFA 5I2XA 1A2UA 2PQAB 2JN4A 3T51B 4F87A 2IX1A 4LFCQ 1A3UA 3G6EA 4B3RQ 4OEMB 2Q8RE 5M5WH 4PQXA 5IWAQ 2GVAA 2Z4IA 3VA5A 4IJHA 1WD0A 1PDQA 4I7AA 4AYBG 2HCCA 3BYTB 1HNWQ 1PH1A 3P7JA 1L0WA 1FR3A 1D2BA 2B39A 4CKEA 3KLRA 4F88A 4RGOS 3TQYA 3E0JA 3GTMB 3X3NA 1EYCA 2HHHQ 2VW9A 4DAVA 1SBBB 1HA5A 1UE5A 1N8RC 1A15A 3RD4A 4O0AA 4KMUC 1KC8C 1PTOB 1KTKA 1PXUA 2M00A 1SDFA 5DLQE 2IHEA 1TWHH 3FKIG 3CW2C 1LTID 2K5NA 2JEAI 1HH2P 4LF8L 2A8VA 3K7AB 4DV4L 1LT3D 1DZ1A 1EYAA 4BY7B 3CU7A 3T16A 2ID0A 3I8ZA 4G7OC 3I56A 4ZUIA 3I73A 3CD6A 2QEJC 2AHOB 1IL8A 2MPMA 4CDDC 3S1RH 2KHIA 2WP8J 2VB2X 1BNZA 1EIGA 1ICFB 2KJXA 3SK5A 4JI3L 4RGNA 4CDCC 4IUUA 2QILA 1YI2A 2LKVA 1CI3M 2L1BA 1HZBA 1H9RA 1GHJA 4ID6A 1WOCA 2EE1A 4DNTB 1FL0A 2R7ZB 4RH6A 1LACA 4OX9Q 5IT9E 3S2DB 1D1KA 1UAPA 1BDOA 1QE6A 1YJ9A 3MA2B 3I55A 4ZCKA 4YHHQ 4B9WA 1JE5A 4LUOA 2WKDA 1KDAA 1CKOA 4X62L 1BXTA 1GJXA 1J8IA 5ISRA 2IPKD 1WTXA 2XWBB 4NXMQ 2GN5A 2F0OA 3C1FA 1K8MA 2BE5C 1YZ6A 4IPCA 5M9OA 4LUVA 1PRTF 1OO9B 1L0XB 1F2YA 1HZ9A 1EY4A 1EY8A 1B53A 1V1OA 1DM0B 3H3VI 1PFSA 5AJ3L 1L1OC 1UWVA 4C2MB 3GTGH 3BYYB 1HNXL 3VR5A 4C56C 1LUZA 1X65A 4RHRA 5CV9A 1I6VC 1F9SA 3PO3B 4HIKA 1JMCA 1VQBA 2ZTCA 3QB3A 2B2UA 4IPGA 2XRSD 4HR7B 2VQFQ 2BH8A 1R4PB 4JOIA 3GTLH 3K0XA 1PTOC 4UP7A 4WRDA 1AFPA 1SNOA 3L3OC 4JI6Q 2V1CC 2UXDQ 4A3FB 1FVIA 3C46A 1U0LA 1QCBD 2G9DA 2JSOA 1HA6A 3DM3A 4EQNA 3C3LA 2XN9C 1EEID 1SEBD 2WB1B 3OYYA 2Q2UA 3QR8A 4P71A 3CC4A 1BQQT 1VQCA 1H9MA 1BCPF 1I94L 2F0NA 3UI2A 4QJFA 4BY7G 1BOSA 1TWFH 3Q8DA 4R9WA 1EWHA 4DK1A 3DWQA 5CV6A 5NUCA 5IP7G 2NTSA 5K36G 2I07B 4IPDA 2EXZA 2PW5A 2F4VL 2SNMA 3VR6A 1PYBA 3GTMH 1WTRA 3KOJA 4AYBE 1KQSA 1EY7A 2XSCA 3JAML 4L5SA 1IBKL 2ZXOA 3TRZA 4A3GB 4JG2A 1WFQA 2UUBL 4KKUA 1LT6D 1KDBA 4DV2Q 4FVMA 1AP0A 1B3AA 4JI5Q 1HZAA 2R7ZG 3I91A 5TSSA 3M85A 1K8AC 3PO2B 3K80C 4LF7Q 4RCNA 4LFCL 3WWVA 3CHBD 3DXJC 2QDLA 5J1ZA 5A35A 4G7ZC 4B3RL 1QILA 3K7AH 1TXYA 1XTCD 2MJ8A 1UE1A 2RSOA 4IALA 1PH9A 4DR1L 2B29A 3KK7A 4BY7H 1LTAD 5IWAL 3F2DA 5IP7H 5K36H 5G3LD 1Q1BA 4WJWA 2F0UA 1HNWL 2O5IC 3CCVA 4QF4A 2OCEA 1X3EA 3Q23A 4WORA 3UDIA 1X55A 3OMCA 2I0QA 3BG3A 2R7ZH 1K0SA 1JOOA 2UUAQ 5I2YA 4R4TA 3KBXA 1AN8A 2YTXA 2BE5D 1RIPA
chains in the Genus database with same CATH topology
4DAMA 4GKJQ 2N3SA 3F8TA 2VQEL 2BA1A 4C3JH 3ER0A 4A93G 1NMGA 2B3GA 3J81i 4OONA 4DK6C 1HR0Q 3S1MH 2HIVA 4JBMA 4BBRH 1VQ4A 2Q2HA 5LMNL 3PO3G 3JC66 3TS2A 2KHJA 4JI8Q 5J3BA 3E0EA 2JA6H 1BBWA 3J7ZC 4RMFA 5LMUL 4QY7A 3FP9A 2VNUD 4GN4B 1VQEA 5GAHC 3UE0A 1VQ5A 1ASYA 1EIYB 1XPUA 2R92G 3S24A 2PI2A 1PH6A 5M3FG 4A3MH 4YWKA 4PZ7A 1JJ2A 2ZTEA 4DV5Q 3M4PA 4R4IA 3CXCA 1PH8A 4B3TQ 4LF4L 2JA8H 4EX5A 3PF5A 1CSQA 3M7NA 4JV5L 4LFBL 1VQMA 5C3EG 1PH7A 2F4VQ 3CQZH 3RLFA 4Y7NH 4LF8Q 4DAYB 4A3FG 3PUVA 4DV4Q 4P72A 1XNQQ 1N9WA 4DR4Q 4C3IH 4C2MH 3FHWA 2NVQH 2WFWA 4Y52H 2UUBQ 4A93H 4BA1I 1EUJA 3T1YL 1VQKA 4K0KL 2WB1G 4GOPB 5IYDG 1S72A 1G291 3G71A 4KHPQ 4X64Q 1K73C 3UDFA 5E7NA 4RG1A 3PO3H 2YTVA 1Q7YC 3GO5A 2E2HH 3HOUH 3CPFA 1CSPA 4UY8C 1EIFA 2K5VA 4LUZA 4YHHL 4QGUA 3CC7A 2JA7G 4JI3Q 1NY4A 1KRSA 2JE6I 4A3IH 4JI2Q 4DV0Q 1YITA 4JI4L 5M3MH 1JB7A 3EIVA 2VY3A 4GS3A 3DLLA 4ALPA 2BA0A 2IT1A 4DR1Q 4JYAL 4HJ7A 1HNZL 5GROA 1L1OB 1TWCH 1I5FA 1Z9FA 3BZCA 1UEBA 4NXML 3A5ZB 1PYSB 2N49A 3AQQA 4LWCA 1VQ9A 4B3SL 4LFAL 2B63G 2UXCL 1PHJA 2HT1A 1N32L 2ZJRA 1VCIA 1P16A 1Z47A 4C3HH 4YY3L 1G51A 5C3EH 5EAYA 4GNXB 4BY1H 4DV1L 4A3FH 1V43A 2AWOA 2K4KA 1S40A 1KIXA 1C9OA 5GQOA 1K83H 1VQDA 3A0JA 5BR8L 1S3OA 5FLMG 4DR2L 3CMEA 1AH9A 2WB1E 1SMXA 3NENA 1MJEA 4LF5L 3PO2G 2DUDA 4A3DG 1VQLA 4WJ4A 1OXVA 5IYDH 4X62Q 3T1HL 1X3FA 4GKKQ 1V9PA 4LF6Q 1XMOQ 4A3LH 3PCOB 1Q86C 4L5QA 3GTKH 4FDBA 1MJCA 1C0AA 2JA7H 3W1GA 4L5RC 1OXXK 1YJWA 4NXNL 3KDFA 4GOPA 1A0IA 2LSSA 2ALYB 2VQEQ 2K52A 2YYZA 2CFMA 3S14H 1CKNB 1EWIA 2Q2IA 2JEBI 4NB3A 5M5XH 4PG3A 3HOVG 2NVTH 4OO1G 1VQNA 1EQRA 4OXPA 2ATWA 2VUMG 1SR3A 3CCJA 4A3JG 2EQSA 4JBJA 4X66Q 4DR5Q 5HGQA 4A3GH 4KHZA 2R93G 1B7YB 1XTDA 3E9HA 4R1JA 4ME3A 1Q81C 2R7FA 4BXXG 4LF9Q 4JI7L 1L1OA 1IZ6A 1SE8A 2VQFL 1A62A 1K8GA 2R6GA 1W2BA 4IOCA 4JCVE 5ELNA 3S2HH 4A3BG 4JOIC 3OTOL 2Y0SG 1HNXQ 3AFQA 2D62A 3U4VA 3AFPA 3H3VH 4JI6L 3I4MG 5FLMH 4X6AH 1IXRA 1YIJA 2L15A 1CUKA 4YWLA 4IO9A 4GNXA 3PO2H 1YNXA 4HIMA 1QUQA 3CF5A 5JJKA 4LF4Q 3TS0A 1EQQA 4LFBQ 1VQPA 4YWMA 5FLXc 1WJJA 2HHHL 4DUZL 3J7A5 1L2FA 1TWAH 2JA8G 3OW2A 1Q1EA 4PMWA 3J80c 3UDGA 3RN5A 1FJGL 4JI1Q 2RHSB 1BVSA 1HJPA 4HIOA 3T1YQ 1QZGA 2E2IH 1W3SA 3HOVH 4K0KQ 3NBHB 2NN6G 3J80i 3FKIH 4AQYL 2VUMH 4DR7Q 4IJLA 1YHBA 4HJ9A 4A3JH 1N34L 2PMZE 1BBUA 4YCUA 5C44H 1QVFA 1IL2A 3U4ZA 1Y1VG 1JJCB 1CKNA 2JA9A 2R93H 1I3QH 3PV0A 1Q12A 2MNAA 1IBMQ 3PUYA 4BXXH 1VQGA 1GD7A 1G6PA 5HY6A 4DKAC 2Y0SE 4HJ5A 1D7QA 1PH3A 2HQLA 3CCMA 2CWPA 4A3BH 2DGYA 2N8NA 3HOUG 3K8AA 1MIUA 4JI4Q 2JK8A 2A19A 3KLWA 2IX0A 2KBNA 5JEAG 3I4MH 1N36L 1QZHA 1HNZQ 4JYAQ 3VDYA 4A3IG 2C35B 2D0OA 3CMAA 1XNRL 3RR5A 3U58A 3M3YH 2MO1A 1K9MC 4YCWA 2QA4A 4DV2L 5M3MG 4B3SQ 1I6HH 3BZKA 4LFAQ 1YHQA 1I94Q 3A5UA 1OXUA 4APVA 3BJUA 1VQFA 1Y14B 2KENA 4YY3Q 5C0XI 3K7UC 1A8VA 3NEMA 1IYJB 1E1OA 2MO0A 4R4OA 3SGIA 1M90C 4DV1Q 3F1ZA 1C7YA 5GADC 4LF7L 3HOZG 3MEFA 4IFDJ 2K5HA 1K0RA 1PH4A 4DV6Q 5BR8Q 1Q8KA 3S1QH 4BY1G 4DR2Q 1J5EL 4LF5Q 3BU2A 1SFOH 5JJIA 4OWTB 1JT8A 1IBKQ 2EXDA 4DV3L 4OWXB 2Z6KC 3T1HQ 1IBLL 1Y1VH 3PIOA 2I5HA 1YJNA 4OX9L 1E3PA 4B3MQ 2KCMA 3KDFB 1VQAA 3HOYG 4DR3L 3KJOA 1GKHA 1E7ZA 3I4OA 2ES2A 2HIXA 4A3LG 1JJGA 1NMFA 4GN3B 1SROA 2YV5A 2K14A 4HIDA 1SN8A 1YVCA 1XMQQ 1QVGA 2PQAB 3W5OA 2ASBA 2IX1A 3KJPA 4LFCQ 3I2ZA 3G6EA 4GLXA 4B3RQ 1OXTA 1OXSC 3CC2A 3K81C 1X54A 2OQ0A 4A4IA 3RNUA 5M5WH 5IWAQ 2IY5B 2AWNA 2GVAA 2YTYA 4IJHA 3HOZH 1LTLA 4DR6L 1P8LA 4AYBG 4A3GG 4GKJL 1QVCA 4BA2I 1HNWQ 1LM0A 1PH1A 1QUQB 1L0WA 5M5YH 1PA6A 1YHAA 4DPGA 2E8GA 5H1SE 3ICEA 4IFDI 1WCMG 3TQYA 2UXBQ 4WJ3M 1GM5A 2VW9A 2HHHQ 4GLAC 2ZM6L 3HOYH 1UE5A 4P73A 1N8RC 2UU9Q 1FJGQ 4O0AA 2MQHA 2WAQG 2AMCB 1KC8C 1HR0W 3B6YA 1NJIC 3HKZG 2Q2TA 3D31A 2I5MX 4AQYQ 4DV5L 4B3TL 5JJLA 1NBWA 1D8LA 5DLQE 2IHEA 2R7DA 3GTQH 1TWHH 2PQAA 3CW2C 3FKIG 4H02A 4XTCS 5FJ8G 2K5NA 2JEAI 1HH2P 3H0GG 1PVOA 4LF8L 4A76A 5C44G 2A8VA 2ZTDA 4DV4L 4R4QA 3CAMA 4PZ8A 5LMNQ 3IRBA 2F52A 2IHFA 4JI0L 4P74A 4QL5A 2ID0A 3S17H 2K50A 5LMUQ 1N36Q 3I56A 1RL2A 2QGQA 3CP0A 3CD6A 2AHOB 3KF6A 5C0XJ 1NE3A 3S1RH 4KHPL 1WCMH 2CKZB 4X64L 3GD7A 1A63A 4UP8A 2KHIA 2WP8J 3KYHC 4GN5A 2UXDL 2F3IA 1X3GA 3I7FA 2RF4A 2XGTA 1EOVA 1VQ8A 4POFA 3E9IA 1Q46A 1E1TA 2UXCQ 4JI3L 4JV5Q 4JI2L 4TVAB 4DV0L 1E24A 1YI2A 4GLVB 3KF8B 1X9NA 2BH2A 3HOXG 4X65L 3NELA 1HZBA 2K75A 4KI0A 1T9HA 1N33L 1KL9A 1VQHA 3STBC 4DUYL 1WOCA 4HJAA 5IYCG 1SLJA 2PNHA 1FL0A 2PI2E 3A74A 4O2DA 3I4NH 3RN2A 3M9BA 4OX9Q 1KXLA 5FJ8H 3M4QA 3H0GH 5ELOA 3ULJA 3CCRA 1SRUA 1YJ9A 1VQJA 3HOWG 4POGA 3I55A 2E5LL 4YHHQ 1JE5A 4LUOA 1FGUA 1K3RA 2E2JH 2MFIA 2RHQB 4DV7L 1CKOA 2VZAA 3CCQA 1H95A 1VQIA 4X62L 3ULLA 1N32Q 2VL6A 2H5XA 1XMOL 4IOAA 4EQ5A 1B70B 2A1AA 4NXMQ 2NZOA 1E22A 2GN5A 3ERSX 4GOPC 3RZDH 1Q82C 4JI5L 2N78A 1YZ6A 2LXJA 3HOXH 4LNQA 3RZOH 4IPCA 1Y1WH 1M1KC 2UUCL 4LUVA 1PV4A 1HZ9A 3F2CA 5IP9G 3S15H 1VQ6A 1B8AA 5IYCH 4MTNA 4X66L 3RLOA 4DR5L 4R4CA 5C4JH 3H3VI 4LF9L 1KHIA 1PFSA 4XIGS 2ZM6Q 5AJ3L 4A3EG 1L1OC 3G48A 1UWVA 3W1BA 3GTGH 1GO3E 2JQOA 1YEZA 1HNXL 1HZCA 3HOWH 2LXKA 1LUZA 1X65A 3HKSA 4NXNQ 1MKHA 4AH6A 2D0PA 4GNXC 1X56A 5LMNW 1VQOA 4HIKA 4OWWB 3TREA 3PIPA 2XTIA 1JMCA 2OTLA 1VQBA 2NVXH 4BY7H 3PUWA 4AIMA 1AE3A 2ZTCA 2CWAA 3TEHB 4OO1I 4IPGA 1TWGH 2JJQA 2FXQA 4UPAA 4JBWA 4JI1L 4JI0Q 4JI7Q 2OQKA 2UUAL 4J15A 2VQFQ 4L5TA 2BH8A 5JEAJ 3KFUA 3KF6B 4JOIA 3GTLH 4DR7L 3K0XA 3OTOQ 4UP7A 4HJ8A 4NPSA 5IP9H 2OWOA 3M4OH 1PH5A 1NTGA 4JI6Q 2V1CC 4JC0A 2NZHA 3CCUA 1HR0L 2UXDQ 3CCSA 1IBML 1OTCA 3UDXA 1FVIA 1X6OA 5IE8A 4A3EH 1U0LA 2QEXA 3CPWA 3UE1A 2JA5G 1LYLA 3HFZB 1WYDA 3DM3A 4JI8L 1XPRA 1PH2A 4DUZQ 1GVPA 4X65Q 4LW1A 2R92H 5C4XG 3OYYA 3J81j 2Q2UA 5M3FH 4P71A 3PSIA 5IYBG 1EYGA 3CC4A 1N33Q 3GDEA 4DUYQ 5C0XG 5GAEC 1ASZA 1VQCA 1V1QA 1I94L 4MNOA 4QJFA 4BY7G 3L0OA 1TWFH 3LGJA 3Q8DA 3ULPA 1UE7A 3JAMc 3F2BA 1O7IA 2VS1A 3U50C 3AEVA 3GTOH 1N34Q 5IP7G 2NN6I 5K36G 4KLKA 4IPDA 3I4NG 4BBSG 4IPHA 4DV6L 3MXNB 3JAMi 2F4VL 1PYBA 1CKMA 3PUZA 2E5LQ 3GTMH 1XPOA 3KOJA 4AYBE 4A3KG 2Z0SA 1KQSA 4DR4L 3PUXA 1XNQL 3PF4A 4DV7Q 1IBKL 4L5SA 2EIFA 3TRZA 4QQBX 3H15A 4JG2A 1WFQA 2I5LX 2UUBL 2CCZA 4B3ML 1I50H 3GTPH 1XNRQ 4DV2Q 2OTJA 2JA5H 4YCVA 4JI5Q 1HZAA 1VQ7A 2YU9H 1U5KA 2R7ZG 4A3CG 1XMQL 1XJVA 1DGSA 3M85A 3RLNA 1K8AC 1BKBA 3K80C 1KRTA 5C4XH 2UUCQ 4LF7Q 4LFCL 3S1NH 4PZ6A 3AYHB 3WWVA 2WAQE 5IYBH 4B3RL 3PGZA 3HKZE 3K7AH 1AE2A 1TXYA 4JBKA 2B63H 1UE1A 1Y1WG 1PH9A 4DR1L 2B29A 4DK3C 3STBD 4A75A 2KCTA 5GAGC 1J5EQ 3L2PA 2NVYH 3S16H 5IWAL 3F2DA 3ZJYC 2Z6KA 5AJ3Q 1UE6A 2ZJPA 4BBRG 4DV3Q 4TQUS 1KAWA 4DNIA 5IP7H 3L7ZC 1Q1BA 1IBLQ 2RCNA 4BBSH 2CQOA 3EBEA 2JA6G 1HNWL 4A3KH 4DR3Q 4UP9A 4IFDG 1EFWA 3CCVA 3GTJH 4A3DH 1R9TH 2OCEA 1YBYA 1KD1C 4MZ9A 4QIWE 1X3EA 2AKWB 3D0FA 2UXBL 1WI5A 3EN2A 4A3MG 2ZJQA 3UDIA 1X55A 3CCLA 3S2DH 3G4SA 2GVBA 4GKKL 4LF6L 2UU9L 2I0QA 2R7ZH 3CCEA 4A3CH 5IT9c 1J6QA 5IY0A 2UUAQ 4R4TA 4P75A 1VS0A 3J81c 2YTXA 4DR6Q 1RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAM A;  4GKJ Q;  2N3S A;  3F8T A;  2VQE L;  2BA1 A;  4C3J H;  3ER0 A;  4A93 G;  1NMG A;  2B3G A;  3J81 i;  4OON A;  4DK6 C;  1HR0 Q;  3S1M H;  2HIV A;  4JBM A;  4BBR H;  1VQ4 A;  2Q2H A;  5LMN L;  3PO3 G;  3JC6 6;  3TS2 A;  2KHJ A;  4JI8 Q;  5J3B A;  3E0E A;  2JA6 H;  1BBW A;  3J7Z C;  4RMF A;  5LMU L;  4QY7 A;  3FP9 A;  2VNU D;  4GN4 B;  1VQE A;  5GAH C;  3UE0 A;  1VQ5 A;  1ASY A;  1EIY B;  1XPU A;  2R92 G;  3S24 A;  2PI2 A;  1PH6 A;  5M3F G;  4A3M H;  4YWK A;  4PZ7 A;  1JJ2 A;  2ZTE A;  4DV5 Q;  3M4P A;  4R4I A;  3CXC A;  1PH8 A;  4B3T Q;  4LF4 L;  2JA8 H;  4EX5 A;  3PF5 A;  1CSQ A;  3M7N A;  4JV5 L;  4LFB L;  1VQM A;  5C3E G;  1PH7 A;  2F4V Q;  3CQZ H;  3RLF A;  4Y7N H;  4LF8 Q;  4DAY B;  4A3F G;  3PUV A;  4DV4 Q;  4P72 A;  1XNQ Q;  1N9W A;  4DR4 Q;  4C3I H;  4C2M H;  3FHW A;  2NVQ H;  2WFW A;  4Y52 H;  2UUB Q;  4A93 H;  4BA1 I;  1EUJ A;  3T1Y L;  1VQK A;  4K0K L;  2WB1 G;  4GOP B;  5IYD G;  1S72 A;  1G29 1;  3G71 A;  4KHP Q;  4X64 Q;  1K73 C;  3UDF A;  5E7N A;  4RG1 A;  3PO3 H;  2YTV A;  1Q7Y C;  3GO5 A;  2E2H H;  3HOU H;  3CPF A;  1CSP A;  4UY8 C;  1EIF A;  2K5V A;  4LUZ A;  4YHH L;  4QGU A;  3CC7 A;  2JA7 G;  4JI3 Q;  1NY4 A;  1KRS A;  2JE6 I;  4A3I H;  4JI2 Q;  4DV0 Q;  1YIT A;  4JI4 L;  5M3M H;  1JB7 A;  3EIV A;  2VY3 A;  4GS3 A;  3DLL A;  4ALP A;  2BA0 A;  2IT1 A;  4DR1 Q;  4JYA L;  4HJ7 A;  1HNZ L;  5GRO A;  1L1O B;  1TWC H;  1I5F A;  1Z9F A;  3BZC A;  1UEB A;  4NXM L;  3A5Z B;  1PYS B;  2N49 A;  3AQQ A;  4LWC A;  1VQ9 A;  4B3S L;  4LFA L;  2B63 G;  2UXC L;  1PHJ A;  2HT1 A;  1N32 L;  2ZJR A;  1VCI A;  1P16 A;  1Z47 A;  4C3H H;  4YY3 L;  1G51 A;  5C3E H;  5EAY A;  4GNX B;  4BY1 H;  4DV1 L;  4A3F H;  1V43 A;  2AWO A;  2K4K A;  1S40 A;  1KIX A;  1C9O A;  5GQO A;  1K83 H;  1VQD A;  3A0J A;  5BR8 L;  1S3O A;  5FLM G;  4DR2 L;  3CME A;  1AH9 A;  2WB1 E;  1SMX A;  3NEN A;  1MJE A;  4LF5 L;  3PO2 G;  2DUD A;  4A3D G;  1VQL A;  4WJ4 A;  1OXV A;  5IYD H;  4X62 Q;  3T1H L;  1X3F A;  4GKK Q;  1V9P A;  4LF6 Q;  1XMO Q;  4A3L H;  3PCO B;  1Q86 C;  4L5Q A;  3GTK H;  4FDB A;  1MJC A;  1C0A A;  2JA7 H;  3W1G A;  4L5R C;  1OXX K;  1YJW A;  4NXN L;  3KDF A;  4GOP A;  1A0I A;  2LSS A;  2ALY B;  2VQE Q;  2K52 A;  2YYZ A;  2CFM A;  3S14 H;  1CKN B;  1EWI A;  2Q2I A;  2JEB I;  4NB3 A;  5M5X H;  4PG3 A;  3HOV G;  2NVT H;  4OO1 G;  1VQN A;  1EQR A;  4OXP A;  2ATW A;  2VUM G;  1SR3 A;  3CCJ A;  4A3J G;  2EQS A;  4JBJ A;  4X66 Q;  4DR5 Q;  5HGQ A;  4A3G H;  4KHZ A;  2R93 G;  1B7Y B;  1XTD A;  3E9H A;  4R1J A;  4ME3 A;  1Q81 C;  2R7F A;  4BXX G;  4LF9 Q;  4JI7 L;  1L1O A;  1IZ6 A;  1SE8 A;  2VQF L;  1A62 A;  1K8G A;  2R6G A;  1W2B A;  4IOC A;  4JCV E;  5ELN A;  3S2H H;  4A3B G;  4JOI C;  3OTO L;  2Y0S G;  1HNX Q;  3AFQ A;  2D62 A;  3U4V A;  3AFP A;  3H3V H;  4JI6 L;  3I4M G;  5FLM H;  4X6A H;  1IXR A;  1YIJ A;  2L15 A;  1CUK A;  4YWL A;  4IO9 A;  4GNX A;  3PO2 H;  1YNX A;  4HIM A;  1QUQ A;  3CF5 A;  5JJK A;  4LF4 Q;  3TS0 A;  1EQQ A;  4LFB Q;  1VQP A;  4YWM A;  5FLX c;  1WJJ A;  2HHH L;  4DUZ L;  3J7A 5;  1L2F A;  1TWA H;  2JA8 G;  3OW2 A;  1Q1E A;  4PMW A;  3J80 c;  3UDG A;  3RN5 A;  1FJG L;  4JI1 Q;  2RHS B;  1BVS A;  1HJP A;  4HIO A;  3T1Y Q;  1QZG A;  2E2I H;  1W3S A;  3HOV H;  4K0K Q;  3NBH B;  2NN6 G;  3J80 i;  3FKI H;  4AQY L;  2VUM H;  4DR7 Q;  4IJL A;  1YHB A;  4HJ9 A;  4A3J H;  1N34 L;  2PMZ E;  1BBU A;  4YCU A;  5C44 H;  1QVF A;  1IL2 A;  3U4Z A;  1Y1V G;  1JJC B;  1CKN A;  2JA9 A;  2R93 H;  1I3Q H;  3PV0 A;  1Q12 A;  2MNA A;  1IBM Q;  3PUY A;  4BXX H;  1VQG A;  1GD7 A;  1G6P A;  5HY6 A;  4DKA C;  2Y0S E;  4HJ5 A;  1D7Q A;  1PH3 A;  2HQL A;  3CCM A;  2CWP A;  4A3B H;  2DGY A;  2N8N A;  3HOU G;  3K8A A;  1MIU A;  4JI4 Q;  2JK8 A;  2A19 A;  3KLW A;  2IX0 A;  2KBN A;  5JEA G;  3I4M H;  1N36 L;  1QZH A;  1HNZ Q;  4JYA Q;  3VDY A;  4A3I G;  2C35 B;  2D0O A;  3CMA A;  1XNR L;  3RR5 A;  3U58 A;  3M3Y H;  2MO1 A;  1K9M C;  4YCW A;  2QA4 A;  4DV2 L;  5M3M G;  4B3S Q;  1I6H H;  3BZK A;  4LFA Q;  1YHQ A;  1I94 Q;  3A5U A;  1OXU A;  4APV A;  3BJU A;  1VQF A;  1Y14 B;  2KEN A;  4YY3 Q;  5C0X I;  3K7U C;  1A8V A;  3NEM A;  1IYJ B;  1E1O A;  2MO0 A;  4R4O A;  3SGI A;  1M90 C;  4DV1 Q;  3F1Z A;  1C7Y A;  5GAD C;  4LF7 L;  3HOZ G;  3MEF A;  4IFD J;  2K5H A;  1K0R A;  1PH4 A;  4DV6 Q;  5BR8 Q;  1Q8K A;  3S1Q H;  4BY1 G;  4DR2 Q;  1J5E L;  4LF5 Q;  3BU2 A;  1SFO H;  5JJI A;  4OWT B;  1JT8 A;  1IBK Q;  2EXD A;  4DV3 L;  4OWX B;  2Z6K C;  3T1H Q;  1IBL L;  1Y1V H;  3PIO A;  2I5H A;  1YJN A;  4OX9 L;  1E3P A;  4B3M Q;  2KCM A;  3KDF B;  1VQA A;  3HOY G;  4DR3 L;  3KJO A;  1GKH A;  1E7Z A;  3I4O A;  2ES2 A;  2HIX A;  4A3L G;  1JJG A;  1NMF A;  4GN3 B;  1SRO A;  2YV5 A;  2K14 A;  4HID A;  1SN8 A;  1YVC A;  1XMQ Q;  1QVG A;  2PQA B;  3W5O A;  2ASB A;  2IX1 A;  3KJP A;  4LFC Q;  3I2Z A;  3G6E A;  4GLX A;  4B3R Q;  1OXT A;  1OXS C;  3CC2 A;  3K81 C;  1X54 A;  2OQ0 A;  4A4I A;  3RNU A;  5M5W H;  5IWA Q;  2IY5 B;  2AWN A;  2GVA A;  2YTY A;  4IJH A;  3HOZ H;  1LTL A;  4DR6 L;  1P8L A;  4AYB G;  4A3G G;  4GKJ L;  1QVC A;  4BA2 I;  1HNW Q;  1LM0 A;  1PH1 A;  1QUQ B;  1L0W A;  5M5Y H;  1PA6 A;  1YHA A;  4DPG A;  2E8G A;  5H1S E;  3ICE A;  4IFD I;  1WCM G;  3TQY A;  2UXB Q;  4WJ3 M;  1GM5 A;  2VW9 A;  2HHH Q;  4GLA C;  2ZM6 L;  3HOY H;  1UE5 A;  4P73 A;  1N8R C;  2UU9 Q;  1FJG Q;  4O0A A;  2MQH A;  2WAQ G;  2AMC B;  1KC8 C;  1HR0 W;  3B6Y A;  1NJI C;  3HKZ G;  2Q2T A;  3D31 A;  2I5M X;  4AQY Q;  4DV5 L;  4B3T L;  5JJL A;  1NBW A;  1D8L A;  5DLQ E;  2IHE A;  2R7D A;  3GTQ H;  1TWH H;  2PQA A;  3CW2 C;  3FKI G;  4H02 A;  4XTC S;  5FJ8 G;  2K5N A;  2JEA I;  1HH2 P;  3H0G G;  1PVO A;  4LF8 L;  4A76 A;  5C44 G;  2A8V A;  2ZTD A;  4DV4 L;  4R4Q A;  3CAM A;  4PZ8 A;  5LMN Q;  3IRB A;  2F52 A;  2IHF A;  4JI0 L;  4P74 A;  4QL5 A;  2ID0 A;  3S17 H;  2K50 A;  5LMU Q;  1N36 Q;  3I56 A;  1RL2 A;  2QGQ A;  3CP0 A;  3CD6 A;  2AHO B;  3KF6 A;  5C0X J;  1NE3 A;  3S1R H;  4KHP L;  1WCM H;  2CKZ B;  4X64 L;  3GD7 A;  1A63 A;  4UP8 A;  2KHI A;  2WP8 J;  3KYH C;  4GN5 A;  2UXD L;  2F3I A;  1X3G A;  3I7F A;  2RF4 A;  2XGT A;  1EOV A;  1VQ8 A;  4POF A;  3E9I A;  1Q46 A;  1E1T A;  2UXC Q;  4JI3 L;  4JV5 Q;  4JI2 L;  4TVA B;  4DV0 L;  1E24 A;  1YI2 A;  4GLV B;  3KF8 B;  1X9N A;  2BH2 A;  3HOX G;  4X65 L;  3NEL A;  1HZB A;  2K75 A;  4KI0 A;  1T9H A;  1N33 L;  1KL9 A;  1VQH A;  3STB C;  4DUY L;  1WOC A;  4HJA A;  5IYC G;  1SLJ A;  2PNH A;  1FL0 A;  2PI2 E;  3A74 A;  4O2D A;  3I4N H;  3RN2 A;  3M9B A;  4OX9 Q;  1KXL A;  5FJ8 H;  3M4Q A;  3H0G H;  5ELO A;  3ULJ A;  3CCR A;  1SRU A;  1YJ9 A;  1VQJ A;  3HOW G;  4POG A;  3I55 A;  2E5L L;  4YHH Q;  1JE5 A;  4LUO A;  1FGU A;  1K3R A;  2E2J H;  2MFI A;  2RHQ B;  4DV7 L;  1CKO A;  2VZA A;  3CCQ A;  1H95 A;  1VQI A;  4X62 L;  3ULL A;  1N32 Q;  2VL6 A;  2H5X A;  1XMO L;  4IOA A;  4EQ5 A;  1B70 B;  2A1A A;  4NXM Q;  2NZO A;  1E22 A;  2GN5 A;  3ERS X;  4GOP C;  3RZD H;  1Q82 C;  4JI5 L;  2N78 A;  1YZ6 A;  2LXJ A;  3HOX H;  4LNQ A;  3RZO H;  4IPC A;  1Y1W H;  1M1K C;  2UUC L;  4LUV A;  1PV4 A;  1HZ9 A;  3F2C A;  5IP9 G;  3S15 H;  1VQ6 A;  1B8A A;  5IYC H;  4MTN A;  4X66 L;  3RLO A;  4DR5 L;  4R4C A;  5C4J H;  3H3V I;  4LF9 L;  1KHI A;  1PFS A;  4XIG S;  2ZM6 Q;  5AJ3 L;  4A3E G;  1L1O C;  3G48 A;  1UWV A;  3W1B A;  3GTG H;  1GO3 E;  2JQO A;  1YEZ A;  1HNX L;  1HZC A;  3HOW H;  2LXK A;  1LUZ A;  1X65 A;  3HKS A;  4NXN Q;  1MKH A;  4AH6 A;  2D0P A;  4GNX C;  1X56 A;  5LMN W;  1VQO A;  4HIK A;  4OWW B;  3TRE A;  3PIP A;  2XTI A;  1JMC A;  2OTL A;  1VQB A;  2NVX H;  4BY7 H;  3PUW A;  4AIM A;  1AE3 A;  2ZTC A;  2CWA A;  3TEH B;  4OO1 I;  4IPG A;  1TWG H;  2JJQ A;  2FXQ A;  4UPA A;  4JBW A;  4JI1 L;  4JI0 Q;  4JI7 Q;  2OQK A;  2UUA L;  4J15 A;  2VQF Q;  4L5T A;  2BH8 A;  5JEA J;  3KFU A;  3KF6 B;  4JOI A;  3GTL H;  4DR7 L;  3K0X A;  3OTO Q;  4UP7 A;  4HJ8 A;  4NPS A;  5IP9 H;  2OWO A;  3M4O H;  1PH5 A;  1NTG A;  4JI6 Q;  2V1C C;  4JC0 A;  2NZH A;  3CCU A;  1HR0 L;  2UXD Q;  3CCS A;  1IBM L;  1OTC A;  3UDX A;  1FVI A;  1X6O A;  5IE8 A;  4A3E H;  1U0L A;  2QEX A;  3CPW A;  3UE1 A;  2JA5 G;  1LYL A;  3HFZ B;  1WYD A;  3DM3 A;  4JI8 L;  1XPR A;  1PH2 A;  4DUZ Q;  1GVP A;  4X65 Q;  4LW1 A;  2R92 H;  5C4X G;  3OYY A;  3J81 j;  2Q2U A;  5M3F H;  4P71 A;  3PSI A;  5IYB G;  1EYG A;  3CC4 A;  1N33 Q;  3GDE A;  4DUY Q;  5C0X G;  5GAE C;  1ASZ A;  1VQC A;  1V1Q A;  1I94 L;  4MNO A;  4QJF A;  4BY7 G;  3L0O A;  1TWF H;  3LGJ A;  3Q8D A;  3ULP A;  1UE7 A;  3JAM c;  3F2B A;  1O7I A;  2VS1 A;  3U50 C;  3AEV A;  3GTO H;  1N34 Q;  5IP7 G;  2NN6 I;  5K36 G;  4KLK A;  4IPD A;  3I4N G;  4BBS G;  4IPH A;  4DV6 L;  3MXN B;  3JAM i;  2F4V L;  1PYB A;  1CKM A;  3PUZ A;  2E5L Q;  3GTM H;  1XPO A;  3KOJ A;  4AYB E;  4A3K G;  2Z0S A;  1KQS A;  4DR4 L;  3PUX A;  1XNQ L;  3PF4 A;  4DV7 Q;  1IBK L;  4L5S A;  2EIF A;  3TRZ A;  4QQB X;  3H15 A;  4JG2 A;  1WFQ A;  2I5L X;  2UUB L;  2CCZ A;  4B3M L;  1I50 H;  3GTP H;  1XNR Q;  4DV2 Q;  2OTJ A;  2JA5 H;  4YCV A;  4JI5 Q;  1HZA A;  1VQ7 A;  2YU9 H;  1U5K A;  2R7Z G;  4A3C G;  1XMQ L;  1XJV A;  1DGS A;  3M85 A;  3RLN A;  1K8A C;  1BKB A;  3K80 C;  1KRT A;  5C4X H;  2UUC Q;  4LF7 Q;  4LFC L;  3S1N H;  4PZ6 A;  3AYH B;  3WWV A;  2WAQ E;  5IYB H;  4B3R L;  3PGZ A;  3HKZ E;  3K7A H;  1AE2 A;  1TXY A;  4JBK A;  2B63 H;  1UE1 A;  1Y1W G;  1PH9 A;  4DR1 L;  2B29 A;  4DK3 C;  3STB D;  4A75 A;  2KCT A;  5GAG C;  1J5E Q;  3L2P A;  2NVY H;  3S16 H;  5IWA L;  3F2D A;  3ZJY C;  2Z6K A;  5AJ3 Q;  1UE6 A;  2ZJP A;  4BBR G;  4DV3 Q;  4TQU S;  1KAW A;  4DNI A;  5IP7 H;  3L7Z C;  1Q1B A;  1IBL Q;  2RCN A;  4BBS H;  2CQO A;  3EBE A;  2JA6 G;  1HNW L;  4A3K H;  4DR3 Q;  4UP9 A;  4IFD G;  1EFW A;  3CCV A;  3GTJ H;  4A3D H;  1R9T H;  2OCE A;  1YBY A;  1KD1 C;  4MZ9 A;  4QIW E;  1X3E A;  2AKW B;  3D0F A;  2UXB L;  1WI5 A;  3EN2 A;  4A3M G;  2ZJQ A;  3UDI A;  1X55 A;  3CCL A;  3S2D H;  3G4S A;  2GVB A;  4GKK L;  4LF6 L;  2UU9 L;  2I0Q A;  2R7Z H;  3CCE A;  4A3C H;  5IT9 c;  1J6Q A;  5IY0 A;  2UUA Q;  4R4T A;  4P75 A;  1VS0 A;  3J81 c;  2YTX A;  4DR6 Q;  1RIP A; 
#chains in the Genus database with same CATH topology
 2N3S A;  1S5B D;  1CT1 D;  2VQE L;  2BA1 A;  2Q8T A;  4C3J H;  3T4A C;  2I46 A;  2B3G A;  4OGQ C;  4DK6 C;  1HR0 Q;  2JA8 B;  3OIQ A;  4O42 A;  3PO3 G;  1CA5 A;  4JI8 Q;  2K32 A;  3E0E A;  1SJE D;  1SE4 A;  1EY5 A;  2F0Q A;  2VNU D;  4GN4 B;  2A69 C;  1Y1V B;  2R92 G;  2EJF C;  1JJ2 A;  3VR4 A;  1JWM D;  2QF7 A;  3HOU B;  3NK9 A;  4ULL A;  1XYI A;  4A3F G;  3PUV A;  1BF4 A;  4N8X 1;  2H1E A;  4C2M H;  4G4K A;  1EUJ A;  3T1Y L;  1PTO D;  2WB1 G;  4L6T B;  4GOP B;  1S72 A;  3G71 A;  4C3H B;  2RDH A;  3UDF A;  3PO3 H;  2YTV A;  1Q7Y C;  3CPF A;  4UY8 C;  3DUZ A;  2K5V A;  2MP1 A;  4YHH L;  1PZJ D;  1NY4 A;  1KRS A;  4JI2 Q;  4KTA A;  1YIT A;  4JI4 L;  3ND9 A;  4ALP A;  4HJ7 A;  2HCI A;  4NXM L;  4B3S L;  4LWC A;  2M2L A;  5EAY A;  3FDT A;  4A3F H;  4MIU A;  3S14 B;  4R8N A;  1K83 H;  1ZEQ X;  5BR8 L;  3GTQ B;  2NVT B;  1S3O A;  1CTM A;  1SMX A;  3DEO A;  1MJE A;  3PO2 G;  2Q8I B;  1OXV A;  4UAI A;  2EY2 A;  1X3F A;  1V9P A;  4LF6 Q;  2F0K A;  4XDX A;  3W1G A;  3NWS A;  1OXX K;  3LX0 A;  1M4V A;  1A0I A;  4HSP A;  3MXP A;  1EOT A;  1WCM B;  2CFM A;  1EWI A;  2Q2I A;  1JQY D;  1U4R A;  1K8O A;  1BUV T;  2EQS A;  4JBJ A;  3SK6 A;  3WDN A;  4A3G H;  1B7Y B;  1XTD A;  2AQ1 B;  3E9H A;  3HKZ B;  1L1O A;  1SE8 A;  2VQF L;  1EL0 A;  2WAC A;  3R93 A;  1MI2 A;  2KQ3 A;  1QG7 A;  2XNA C;  4JI6 L;  2SNS A;  1B44 D;  4YWL A;  3H0G B;  3PMF A;  1YNX A;  3PO2 H;  3CF5 A;  1MSH A;  2D5D A;  4NMZ A;  5C44 B;  4LF4 Q;  1SYB A;  1SJH D;  5FLX c;  4FF2 A;  5F2D A;  1HHV A;  2JA8 G;  2EYJ A;  1TS3 A;  4L63 B;  1L0Y B;  2HUG A;  3AMU A;  2RHS B;  2JYO A;  1PYW D;  3NBH B;  5EBD A;  3V96 A;  1GUG A;  3M4Y A;  3RZD B;  5CGK A;  5D14 A;  3U4Z A;  1Y1V G;  1JJC B;  3HOX B;  2K1B A;  3PV0 A;  1Q12 A;  1IBM Q;  4HMJ A;  1VQG A;  5LL6 S;  1I4G A;  4DGZ A;  1IW7 C;  2Y0S E;  4CJ2 C;  4DKA C;  1PH3 A;  3CCM A;  3HOU G;  1VMP A;  2KBN A;  1F2Z A;  3DHQ A;  2A69 D;  1K9M C;  3SK8 A;  4DV2 L;  4LFA Q;  1YHQ A;  3GV3 A;  1TT2 A;  2N88 A;  1X32 A;  2KEN A;  3BJU A;  4IUR A;  1E2Z A;  3GV6 A;  1A8V A;  4KD4 A;  4YY3 Q;  4DV1 Q;  4LF7 L;  4IFD J;  2K5H A;  5DM7 3;  4H7B A;  1H9J A;  4C3H G;  4DV6 Q;  1ZYR D;  3A56 A;  3K5L A;  1UEA B;  2OF1 A;  1LT5 D;  2NTT A;  3VYT A;  5FO8 B;  2F3W A;  4N8F A;  4OWX B;  2Z6K C;  3T1H Q;  1Q90 A;  4IUV A;  5EKK A;  1Y1V H;  2E2D C;  2I5H A;  3PIO A;  1E3P A;  3MFY A;  4B3M Q;  3KDF B;  3M4O B;  1O78 A;  2HIX A;  3HEJ A;  1SSO A;  1NMF A;  4C1N K;  1XMQ Q;  2K14 A;  5EKI A;  1QVG A;  1J9O A;  1C4Q A;  5C3W A;  2IWH A;  5BN3 A;  4CDE C;  1EZ6 A;  1OXS C;  3CC2 A;  4A4I A;  1X54 A;  2IY5 B;  3VA7 A;  2AWN A;  3VYU A;  3K58 A;  2AQ3 B;  1P8L A;  3I72 A;  1JC7 A;  5I6Y A;  1QVC A;  1V1P B;  3H3V C;  4BA2 I;  1CFM A;  3LWE A;  4PV1 C;  1PA6 A;  4DPG A;  4Q5V A;  5H1S E;  1WCM G;  3SHL A;  1TWH B;  2UXB Q;  1GM5 A;  2L4N A;  3MC0 B;  4CHT B;  1Y8P B;  1STN A;  5DNF A;  1IHZ A;  1FJG Q;  1ILP A;  2AMC B;  2PZU A;  3HKZ G;  1I50 B;  3D31 A;  1NJI C;  2Q2T A;  2BCO A;  2DY7 A;  4AQY Q;  5JJL A;  1NBW A;  1UNS A;  2YU9 B;  4CBV A;  2G5D A;  3GTQ H;  1SYF A;  4H02 A;  2DY8 A;  3S1N B;  1PVO A;  3H0G G;  1JCK B;  1EQV A;  5JPN C;  5C44 G;  3NTK A;  1HXY D;  4JK1 C;  2PCF B;  4R4Q A;  5LMN Q;  3IRB A;  4JI0 L;  5HGT A;  3H91 A;  4P74 A;  4KHV A;  3E3X A;  1N36 Q;  1WTW A;  1DD2 A;  2NB0 A;  3QIA A;  1WCM H;  2CKZ B;  2RSN A;  3J7Y W;  4A3K B;  3T13 A;  1X3G A;  1EOV A;  4POF A;  1E1T A;  4I65 A;  2PZW A;  4JI2 L;  2F0D A;  1O7Y A;  1X9N A;  1U9R A;  1DYQ A;  3HOX G;  4X65 L;  3NEL A;  4KI0 A;  1N33 L;  3NSW A;  1VQH A;  4HJA A;  1MHW C;  2PNH A;  4LK1 C;  5BN4 A;  3RN2 A;  3M9B A;  3M4Q A;  3H0G H;  2HQE A;  1SRU A;  1VQJ A;  3QO2 A;  4POG A;  3S1M B;  1IW7 D;  3NBI A;  1K3R A;  5KEE A;  2R61 A;  4HTH A;  4DV7 L;  4EVO A;  2VL6 A;  1CK1 A;  3NQT A;  5D3I B;  4IOA A;  1B70 B;  1IYV A;  1E22 A;  5ELF A;  4K5V A;  3RZD H;  4V19 0;  3O13 A;  3HOX H;  2Z1C A;  4LNQ A;  1Y1W H;  3EQL C;  1LV9 A;  5C6A A;  1B8A A;  2B2Y C;  5ELE A;  3RLO A;  4R4C A;  3BVG A;  4FF4 A;  2ZM6 Q;  4ILW A;  3W1B A;  2NVQ B;  4R8I A;  1ROD A;  3EJI A;  4KJN A;  4NXN Q;  4AH6 A;  1Y69 U;  2D0P A;  5JOB A;  5LMN W;  4DNR B;  2DNC A;  4XQQ A;  2E2H B;  4OWW B;  1DCZ A;  1SMY C;  2A68 D;  4IN3 A;  1LLR D;  3PIP A;  2NBF A;  2OTL A;  4TKO B;  4AIM A;  2CWA A;  1LO5 D;  5JVH 3;  2JJQ A;  4JBW A;  3VYS A;  4L5T A;  1CQF A;  3BDO A;  5JEA J;  2PNR C;  3K5O A;  3M4O H;  2OWO A;  1TWF B;  4N9T A;  4JC0 A;  1E2V A;  4BY1 B;  2EOT A;  2E76 C;  5KIX A;  3CCS A;  3UDX A;  1IBM L;  5IE8 A;  3CPW A;  2QEX A;  3UE1 A;  1GVP A;  2F3V A;  1TS2 A;  3J81 j;  3PSI A;  1EYG A;  4DUY Q;  1KLG D;  2J7Z A;  2K5W A;  5GAE C;  4K6L A;  1ASZ A;  3R8B A;  4KY6 A;  4HED A;  2PZT A;  4ABN A;  3QOJ A;  1MD2 D;  2JA7 B;  3ULP A;  3F2B A;  1O7I A;  2IW3 A;  4KK7 A;  1N34 Q;  4MTK A;  4IPH A;  4DV6 L;  2E5L Q;  4A3K G;  2Z0S A;  2F4I A;  4DR4 L;  5EPJ A;  4QQB X;  3TBI B;  2Z9H A;  1CZG A;  1HTL D;  4B9X A;  1WTH A;  2IX3 A;  4OIJ A;  2CCZ A;  2EJG C;  4B3M L;  1I50 H;  1QNU A;  1W6J A;  1FNV A;  1STE A;  2CW0 C;  2YU9 H;  1U5K A;  1XMQ L;  1ENF A;  3OSO A;  3G6J B;  1B4O A;  1ML0 D;  5EJW A;  2UUC Q;  2F0G A;  4K5W A;  3S1N H;  2F1M A;  5LL6 X;  4RGM A;  3HKZ E;  4XYO A;  1PFM A;  4JBK A;  5FLX E;  4DK3 C;  1TWA B;  3R3O A;  2KCC A;  3ZJY C;  2Z6K A;  4TQU S;  5T1I A;  1I4Q A;  1MBY A;  2FHT A;  3EBE A;  3HOV B;  2VUM B;  4A3K H;  5A2Q L;  4IFD G;  1S5C D;  2EJM A;  3I90 A;  4ZUJ A;  4C3J B;  3T56 B;  2TMP A;  1YBY A;  5KNB A;  2Z4H A;  3MXN A;  1JB3 A;  2AKW B;  2UXB L;  5COY A;  5JJZ A;  2BDO A;  4OIK A;  1B2T A;  2Y0S B;  4GKK L;  2M9V A;  1BO0 A;  3CCE A;  1TU2 B;  4P75 A;  2OT2 A;  1DOL A;  4DAM A;  4ME5 A;  4GKJ Q;  3F8T A;  4OL7 A;  4TRD A;  1S5E D;  2X6G A;  1UUP A;  4RWS C;  3S1M H;  1STG A;  1WD1 A;  2KEC A;  5LMN L;  3OWE B;  3S1Q B;  2KHJ A;  2EYO A;  1SFO B;  3J7Z C;  4HMI A;  4IFD H;  1VQE A;  2CQA A;  1VQ5 A;  3MZ5 A;  1XPU A;  2ZXR A;  2LY7 A;  1PH6 A;  3T53 B;  2K04 A;  2Z8L A;  4YWK A;  1F9P A;  1PH8 A;  1TY2 A;  1SMY D;  5IGF A;  3M7N A;  4EX5 A;  3PF5 A;  1CSQ A;  4LFB L;  1GUO A;  1FD7 D;  4BS9 A;  5CC4 A;  1LTG D;  1I4R A;  1GUW A;  1XNQ Q;  4CJ1 B;  2O2L D;  3DM1 A;  3FHW A;  2NVQ H;  2WFW A;  2MGS A;  3A8K E;  3NBH A;  3MXG A;  1PRT B;  1G8Z D;  1NAP A;  4X64 Q;  4KY5 A;  4C1N I;  2F0T A;  1SYC A;  2E2H H;  1YNJ C;  5M5Y B;  3RUZ A;  2JA7 G;  4LUZ A;  4KN4 C;  3CC7 A;  4K14 A;  2KUM A;  4P2C B;  1LTS D;  1K83 B;  1CA6 A;  4KKT A;  5ELC A;  1JB7 A;  2VY3 A;  1CM9 A;  2IT1 A;  3AU7 A;  5GRO A;  3NE5 B;  4NDX A;  3HOY B;  3KBG A;  3BZC A;  3J7A F;  1QB5 D;  3A8I E;  3A5Z B;  3AQQ A;  2K5D A;  1CQV A;  1PHJ A;  2ZJR A;  2KEE A;  1VCI A;  1Z47 A;  1T5E A;  4GNX B;  4BY1 H;  1X3P A;  2K4K A;  1C9O A;  5GQO A;  3S9W A;  3CME A;  1AH9 A;  2DUD A;  3M7G A;  4DAY A;  1RTN A;  1XMO Q;  4A3L H;  1Q86 C;  3S17 B;  3EVQ A;  4FDB A;  5LHY 1;  1MJC A;  1YNN C;  2JA7 H;  1JIC A;  2CW0 D;  4NXN L;  3KDF A;  5COR A;  2ALY B;  2XRQ D;  1IYU A;  4N9P A;  4Q0F A;  1SNQ A;  3A54 A;  4I7Z C;  1CKN B;  4NB3 A;  4EGV A;  5M5X H;  2K5Q A;  4PG3 A;  3HOV G;  1VQN A;  1EQR A;  4JPB W;  4OXP A;  2ATW A;  1SR3 A;  2VUM G;  4C3J G;  2B2Y A;  5HGQ A;  4KHZ A;  4KD3 A;  1BCP B;  4BXX G;  1IZ6 A;  1W2B A;  2Z6B A;  4IOC A;  5ELN A;  2KOL A;  3VYR A;  2Y0S G;  3AFQ A;  5E3F A;  1H9S A;  3HZX A;  5CV4 A;  1EZ8 A;  4X6A H;  1SE3 A;  4K8I A;  3D6C A;  1S5F D;  4FYD A;  1G91 A;  3QG1 A;  1II3 A;  1WJJ A;  2HHH L;  3J7A 5;  1L2F A;  1TWA H;  1ILQ A;  1BR9 A;  2SEB D;  2N55 A;  2RDF A;  1GHK A;  4HIO A;  1QZG A;  3P1H A;  3HOV H;  4K0K Q;  1ONL A;  1PFB A;  2NN6 G;  2VUM H;  3J81 E;  1YHB A;  4HJ9 A;  5FO7 B;  4HCS A;  1N34 L;  4YCU A;  1F2L A;  5IT9 L;  4BXX H;  4CGY B;  5CV7 A;  4WFN 3;  3S15 B;  1D7Q A;  4ZQ3 A;  2HQL A;  3IFD A;  2DGY A;  2P5Z X;  3R2T A;  1MIU A;  2WIN B;  3KLW A;  5JEA G;  4JYA Q;  1HNZ Q;  3VDY A;  4LAA A;  2D0O A;  4RAU C;  5E4X A;  2O5J C;  3BZK A;  3HOW B;  2PQE A;  3TSS A;  1PRT C;  3A5U A;  1Y14 B;  1VQF A;  4R4O A;  4DU9 A;  1E1O A;  2D9U A;  2MO0 A;  4ZAI A;  4IZ8 A;  5J39 A;  1PH4 A;  1Q8K A;  4NKL A;  3S1Q H;  1FNW A;  4DR2 Q;  2NVX B;  1ZYR C;  4LF5 Q;  1SFO H;  2NN6 H;  4CJ0 B;  2A74 C;  4HAE A;  1TWG B;  1YJN A;  4OX9 L;  5IOD A;  2KCM A;  2MHV A;  3HOY G;  1ESF A;  1E7Z A;  1YNJ D;  3I4O A;  2ES2 A;  4GN3 B;  1SRO A;  4DXG A;  5JEA H;  3W5O A;  2ICI A;  4IUN A;  4DF7 A;  3KJP A;  1KNE A;  4GLX A;  5C5M A;  1TVX A;  1I4P A;  2EVB A;  3RNU A;  2YTY A;  2K33 A;  1D5Z C;  2CVR A;  4A3G G;  4GKJ L;  1LM0 A;  1QUQ B;  2SDF A;  5M5Y H;  3GTO B;  1YHA A;  4IFD I;  1RCV D;  1JE4 A;  4H0L C;  1B9N A;  1SE2 A;  4X3S A;  1HFN A;  3HOY H;  1BCP C;  1STH A;  4F8M A;  3IFT A;  5FK9 C;  1YNN D;  2UU9 Q;  1HR0 W;  4CKB A;  3B6Y A;  2AUK A;  5C4Z A;  4M8A A;  2NYZ D;  4YIJ A;  3HS0 C;  5E4W C;  2PQA A;  3NTI A;  1STA A;  3DWA A;  3ERO A;  2DN8 A;  4TSS A;  2IHF A;  4RA8 A;  2KCN A;  3S17 H;  5LMU Q;  1RL2 A;  2QGQ A;  3CP0 A;  1AEX A;  1NE3 A;  4X64 L;  1A63 A;  3GD7 A;  1DOM A;  4RKL A;  4QCL A;  2UXD L;  1LTT D;  2XGT A;  1LAB A;  1AZQ A;  3E9I A;  3GTJ B;  1R9T B;  4JV5 Q;  3P20 A;  2HDL A;  4TVA B;  4CDF C;  1E24 A;  1HRJ A;  3NHH A;  3KF8 B;  4GLV B;  2BH2 A;  2K75 A;  2FMM A;  2K05 A;  1T9H A;  2HD3 A;  1KL9 A;  4J8Q A;  2PI2 E;  3BVM A;  3TME A;  3I4N H;  1G2T A;  5ELO A;  3ULJ A;  3J80 L;  4XYQ A;  3OW7 A;  3HOW G;  1RD9 D;  1Y1W B;  4MN3 A;  1FGU A;  2PO4 A;  2MFI A;  1TS4 A;  2RHQ B;  4BBR B;  4ZLT F;  3ND8 A;  3W2D A;  1CZW A;  5I4D A;  3V05 A;  3CCQ A;  1VQI A;  2JP1 A;  2JA6 B;  2H5X A;  3AB9 A;  1XMO L;  1HTP A;  2A1A A;  2NZO A;  1PRT D;  1XWE A;  3FVQ A;  5T1G A;  4GOP C;  1Q82 C;  4JI5 L;  1EU4 A;  1EQT A;  2LXJ A;  1TII D;  2LS0 1;  4A3M B;  1NSN S;  1O7Z A;  1NNX A;  3F2C A;  5IP9 G;  3S15 H;  1VQ6 A;  2V4D A;  4IQZ A;  4Y7N B;  1KHI A;  1O80 A;  4XIG S;  2EYF A;  4C3I B;  1GO3 E;  2JQO A;  1WVL A;  3HOW H;  2LXK A;  1GUN A;  1RDP D;  4RFB A;  1JWS D;  1VQO A;  1HUM A;  2XTI A;  3HGB A;  2NVX H;  2A68 C;  1A6X A;  1H9K A;  3PUW A;  1AE3 A;  1ET9 A;  3KLS X;  2OXP A;  3TEH B;  1TWG H;  5M3M B;  3F2U A;  2FXQ A;  1GUT A;  4LMQ D;  1WTV A;  1TWC B;  2NWG A;  2OQK A;  2UUA L;  3KFU A;  3KF6 B;  1NR2 A;  4X3K A;  3FEW X;  1K3B C;  1R4Q B;  1A3T A;  4JW0 A;  3OTO Q;  3A55 A;  5IP9 H;  1EFI D;  2F0H A;  1NTG A;  1QWY A;  4B08 A;  3CCU A;  1HR0 L;  2E75 C;  1OTC A;  3SE0 A;  3ITP A;  2K28 A;  3FPU B;  3TP5 A;  1LYL A;  1NR4 A;  1WYD A;  4LJZ C;  4U67 3;  4JI8 L;  4FF3 A;  1QJO A;  1BCP D;  2QCP X;  3P75 A;  5M3F H;  5IYB G;  2DJG C;  4ZRZ A;  1QVF A;  3GDE A;  5C0X G;  3TP7 A;  5I9P A;  1EWC A;  4G7H C;  1V1Q A;  3GTK B;  2B2V C;  3L0O A;  3LGJ A;  2VS1 A;  3AEV A;  3GTO H;  5BN5 A;  2NN6 I;  1X3Q A;  2H4O A;  1CKM A;  3PUZ A;  1XPO A;  5CBA E;  1H95 A;  3PUX A;  4PNY A;  2EIF A;  3H15 A;  1WTQ A;  1U4M A;  1XNR Q;  1BBX C;  1NUC A;  3S2H B;  2OTJ A;  4YCV A;  1VQ7 A;  1DGS A;  3RLN A;  1BKB A;  5IYB H;  3PGZ A;  5C0X H;  1AE2 A;  2B63 H;  1Y1W G;  4K6D A;  2B2U C;  4A75 A;  4ZYS A;  3S16 H;  1J5E Q;  5GAG C;  4KKS A;  2F0S A;  5AJ3 Q;  1UE6 A;  2ZJP A;  4BBR G;  4DV3 Q;  4DNI A;  1KAW A;  1RKN A;  1IBL Q;  2E2I B;  3VR3 A;  3HG9 A;  2JA6 G;  5KGU A;  4DFA A;  1PZI D;  1CHP D;  3GTJ H;  3DMU A;  1B3Q A;  4A3D H;  5G3L F;  1R9T H;  1U4P A;  1RF2 D;  3Q24 A;  3D0F A;  2A6E C;  4FXD A;  4A3M G;  2XIW A;  2ZJQ A;  3VR2 A;  3CCL A;  3G4S A;  2GVB A;  4LF6 L;  2UU9 L;  1J6Q A;  1NCV A;  4QUC A;  3J81 c;  4DR6 Q;  3FMC A;  1HJP A;  4C3I G;  3ER0 A;  3CKI B;  1MSG A;  3J81 i;  3I4L A;  2HIV A;  4BBR H;  1VQ4 A;  4OEL B;  3SR1 A;  4KJO A;  2L55 A;  3Q22 A;  2JA6 H;  1BBW A;  5ELD A;  4K2L A;  2RDG A;  4RMF A;  2F0W A;  5IOC A;  5LMU L;  4QY7 A;  3FP9 A;  1Y8O B;  3UE0 A;  5GAH C;  2QW7 A;  4GZY C;  1Z6H A;  1HPC A;  3FPP A;  4A3M H;  4PZ7 A;  2ZTE A;  4DV5 Q;  4B3T Q;  4R4I A;  5EPL A;  3KUP A;  4XXE A;  4LF4 L;  4K8J A;  4JV5 L;  1EY6 A;  1WTO A;  1VQM A;  1PH7 A;  1VF7 A;  1KAA A;  5ELB A;  4XQJ A;  2F4V Q;  3RLF A;  4Y7N H;  1MGS A;  2FJ2 A;  4C3I H;  2UUB Q;  4KY7 A;  3HOZ B;  1G29 1;  4KHP Q;  1K73 C;  5E7N A;  3MEH A;  3CRL C;  1PTO F;  4FP5 D;  1EIF A;  1PFN A;  5EPK A;  4A3I H;  4O1N A;  4DV0 Q;  4H13 C;  5I6W A;  4KN7 C;  1SYE A;  5M3M H;  3KLS A;  4GS3 A;  3DLL A;  2BA0 A;  2B2W C;  3ONA B;  4DR1 Q;  1L1O B;  1S5D D;  1TWC H;  1UEB A;  1PYS B;  2KVM A;  4EQO A;  4LFA L;  3MTS A;  2HT1 A;  5JPM C;  1EU3 A;  4YY3 L;  3D4D A;  4DV1 L;  1WTP A;  2X69 A;  1Y8N B;  3JAM E;  2AWO A;  1S40 A;  4OHJ A;  5M5X B;  1VQD A;  2FIN B;  2L12 A;  3A0J A;  2L5T A;  2WV6 D;  3A8J E;  3NEN A;  3ZYY X;  3SXH A;  5CYU A;  4WJ4 A;  3D6W A;  3T1H L;  5CV8 A;  4L5Q A;  3GTK H;  1DON A;  2A5H A;  4GOP A;  2LSS A;  2WKC A;  5EQ0 A;  1RJT A;  2VQE Q;  4M1U B;  5JVG 3;  4OO1 G;  5C3X A;  1DXM A;  5EBC A;  2EYP A;  4K5X A;  2MUY A;  4X66 Q;  4DR5 Q;  2WAQ B;  4R1J A;  2R7F A;  4LF9 Q;  4DXF A;  5L37 A;  1K8G A;  2R6G A;  3TZD A;  4JCV E;  3H6M A;  3S2H H;  3OTO L;  1FGB D;  2D62 A;  2EZV A;  4FF1 A;  1RHP A;  4RHS A;  2L15 A;  1GUS A;  4HIM A;  1QUQ A;  5JJK A;  2K01 A;  2A6E D;  3TS0 A;  3D4R A;  5I9O A;  2LMC B;  4YWM A;  1K28 A;  2J0T D;  2OEO A;  2E2J B;  4QIW B;  3OW2 A;  2HDM A;  1Q1E A;  3RN5 A;  5CV5 A;  3Q0A A;  1FJG L;  4JI1 Q;  2E2I H;  3T1Y Q;  5EGT A;  4OO1 H;  3ERQ A;  3FKI H;  4AQY L;  4DR7 Q;  1KAB A;  4IJL A;  1AW7 A;  1PZK D;  2QKI C;  3TDQ A;  1HCZ A;  1IL2 A;  1ENA A;  1G6Z A;  2JA9 A;  3RZO B;  2MNA A;  3PUY A;  3PIO 3;  3H09 A;  4FO2 A;  2TSS A;  1M8A A;  1TR5 A;  5FOB B;  4JI4 Q;  2JK8 A;  5C4J B;  2IX0 A;  1N36 L;  1QZH A;  2C35 B;  3CMA A;  1XNR L;  3RR5 A;  4G57 A;  3U58 A;  2MO1 A;  3M3Y H;  2WII B;  4YCW A;  4B3S Q;  2B2V A;  2F0E A;  5C0X I;  3K7U C;  3NEM A;  5CR3 A;  3SGI A;  2F0F A;  1M90 C;  3F1Z A;  3HOZ G;  1K0R A;  5BR8 Q;  3KF8 A;  4BY1 G;  3U9S A;  1J5E L;  5JJI A;  4OWT B;  4DV3 L;  3EFX D;  1LTR D;  1IBL L;  2PYK A;  1VQA A;  3W3A A;  3KJO A;  4QMG A;  1D6E C;  1ZKO A;  3WOF A;  4A3L G;  1JJG A;  4HID A;  1SN8 A;  1D1I A;  2ASB A;  3I2Z A;  1Z7T A;  4A3E B;  1Q3L A;  1ZXT A;  1OXT A;  3K81 C;  2OQ0 A;  2R92 B;  1U4L A;  1SYG A;  5FKA C;  1B1Z A;  5DM6 3;  3HOZ H;  1LTL A;  4DR6 L;  2JXM B;  3DWP A;  2F0M A;  2E8G A;  3Q6S A;  3ICE A;  2B8G A;  1GXD C;  3QWN A;  4WJ3 M;  2R3Z A;  3H94 A;  4GLA C;  2ZM6 L;  2EY5 A;  2KHS A;  1A2T A;  4P73 A;  4K2K A;  2MQH A;  2WAQ G;  3X3M A;  2ZXP A;  3GTP B;  2I5M X;  4V0B A;  5KND A;  2X6L A;  4DV5 L;  4B3T L;  2JA5 B;  4ZKB B;  1D8L A;  4QUF A;  1DOK A;  4EQP A;  2R7D A;  5C4X B;  4IUP A;  3D3R A;  4XTC S;  5FJ8 G;  3QJY A;  3DEP A;  4A76 A;  1W6K A;  2ZTD A;  3CAM A;  4PZ8 A;  2FFK B;  3IAY A;  2F52 A;  3IL8 A;  4QL5 A;  4HCE A;  3LNN A;  1F9Q A;  2NVY B;  2K50 A;  3K0Y A;  1PTO H;  3KF6 A;  4DN4 M;  5KNC A;  5C0X J;  4DK0 A;  4KHP L;  3I4N B;  4BBS B;  1V1P A;  4UP8 A;  3KYH C;  4GN5 A;  3NTH A;  2F3I A;  3I7F A;  2RF4 A;  1VQ8 A;  2UXC Q;  2B2T C;  4RCO A;  1Q46 A;  2DJF C;  5IGB A;  4DV0 L;  5C4H A;  2D2C C;  3K5M A;  2F03 A;  3NQI A;  2EY1 A;  3STB C;  4DUY L;  5IYC G;  1SLJ A;  3J80 E;  5DAU A;  1ICW A;  3A74 A;  4O2D A;  5FLX L;  1KXL A;  3HP3 A;  5FJ8 H;  3CCR A;  1A3V A;  5CMD A;  4J1M A;  2J4X A;  1FYC A;  2PMZ B;  2E5L L;  1Q8I A;  2E2J H;  3OOC A;  3E5S A;  2VZA A;  3NWT A;  1JWU D;  3ULL A;  2B2W A;  1N32 Q;  1HQR D;  1PMR A;  3RMH A;  1EY0 A;  1C8C A;  4EQ5 A;  2EY6 A;  3PIP 3;  3ERS X;  3BVZ A;  3CRK C;  4ODG A;  1EYD A;  2N78 A;  3C1E A;  3RZO H;  2UUC L;  2F0L A;  1M1K C;  1PV4 A;  1S4Z A;  4FXG C;  5IYC H;  4MTN A;  4X66 L;  4DR5 L;  4UDU C;  3CQZ B;  5C4J H;  4LF9 L;  4A3E G;  3BZD B;  3G48 A;  3K57 A;  2VXW A;  1VF5 C;  1YEZ A;  4A93 B;  1HZC A;  2RA4 A;  3SK4 A;  5J22 A;  1QOH A;  3WOE A;  3HKS A;  1MKH A;  1ESR A;  4GNX C;  4PMC A;  1X56 A;  2A6H C;  5K5P A;  3EA6 A;  3TRE A;  1LTB D;  1JOQ A;  4NW2 A;  4OO1 I;  4UPA A;  4JI1 L;  2SOB A;  4JI0 Q;  4U68 A;  2F0I A;  4X3U A;  3C2P A;  4JI7 Q;  1F77 A;  4F7X A;  5M3F B;  4J15 A;  3K5N A;  2NZ1 D;  3OPO A;  4DR7 L;  4HJ8 A;  4NPS A;  1PH5 A;  5C3E B;  3NP8 A;  2NZH A;  1F9R A;  3BDC A;  2CHB D;  1RTO A;  5FO9 B;  2ENB A;  1X6O A;  4A3E H;  2B8F A;  4UHV A;  4XT1 B;  2JA5 G;  1STY A;  2BOS A;  2K6A A;  3HFZ B;  1XPR A;  1PH2 A;  5IGG A;  4DUZ Q;  4X65 Q;  4LW1 A;  2R92 H;  5C4X G;  1KNA A;  2IJ0 A;  3MVV A;  3OMG A;  1ENC A;  3NUC A;  4XT3 B;  1N33 Q;  2ICE C;  4XQN A;  4MNO A;  1UE7 A;  3JAM c;  3IKJ A;  3U50 C;  3E6Z X;  4BWG B;  4KLK A;  3I4N G;  4BBS G;  3MXN B;  2KED A;  3JAM i;  1IKM A;  3I3C A;  1TS5 A;  1SNC A;  3PF4 A;  1XNQ L;  2B63 B;  1SNM A;  4DV7 Q;  3TZU A;  1HUN A;  3S16 B;  2I5L X;  4DAP A;  3GTP H;  5AFW A;  2C5C A;  2JA5 H;  3V2T A;  2L0C A;  4A3C G;  1XJV A;  2QDB A;  3SDZ A;  1KRT A;  1ET6 A;  5C4X H;  4A3D B;  3MXU A;  3BS1 A;  4PZ6 A;  3AYH B;  4L8J A;  2WAQ E;  3STB D;  1PLF A;  2KCT A;  3L2P A;  2NVY H;  1IKL A;  2IL8 A;  1TKW B;  1JOK A;  2K03 A;  3L7Z C;  1FNU A;  3MWY W;  2RCN A;  4BBS H;  2CQO A;  1XX8 A;  4DR3 Q;  1T5X D;  4UP9 A;  1EFW A;  4A3J B;  2RQX A;  3N6R A;  3NPP A;  2R93 B;  2RKS A;  1I3Q B;  1KD1 C;  4MZ9 A;  4QIW E;  2KA7 A;  1WI5 A;  1JR0 D;  3EN2 A;  5C5L A;  2RVL A;  3G7L A;  3MFG A;  3S2D H;  3K6O A;  4A3B B;  1JOR A;  3OIP A;  2F0J A;  4JVZ A;  3I4M B;  4A3C H;  5IT9 c;  5IY0 A;  1VS0 A;  1EIH A;  1I6H B;  2LFN A;  2K52 A;  1KLU D;  1D5M C;  4A93 G;  1NMG A;  5CBE E;  4OON A;  2RBM A;  1VMC A;  4E6I A;  1C48 A;  3J81 L;  4JBM A;  1B50 A;  2Q2H A;  3JC6 6;  3TS2 A;  5KRU A;  1V8Q A;  5J3B A;  2L9H A;  5JAV A;  2PW7 A;  3R2I A;  1ASY A;  1EIY B;  3S24 A;  2PI2 A;  5M3F G;  2A6H D;  1SAP A;  2UXC L;  3M4P A;  3CXC A;  2JA8 H;  2BDN A;  5C3E G;  1TY0 A;  3L9A X;  3CQZ H;  3OWF A;  4CKC A;  4A3I B;  4LF8 Q;  4DAY B;  3J7A V;  4DV4 Q;  4P72 A;  4DR4 Q;  1N9W A;  1HQM C;  4S3S A;  4Y52 H;  1XXG A;  4A93 H;  4BA1 I;  5M5W B;  2RCF A;  1VQK A;  4K0K L;  5IYD G;  4KV6 A;  5D65 A;  1QNK A;  4RG1 A;  3GO5 A;  3HOU H;  1SXT A;  1CSP A;  2B2T A;  1SNP A;  4H44 C;  3NXW A;  1AZP A;  4QGU A;  4JI3 Q;  2DNE A;  4HN7 A;  2JE6 I;  4RKB A;  3BDL A;  4QB4 A;  2EDG A;  3EIV A;  1N32 L;  4JYA L;  3MAQ A;  4IUT A;  1HNZ L;  3PQI A;  3N52 A;  3LWU A;  1I5F A;  1Z9F A;  2EPB A;  2N49 A;  1VQ9 A;  2B63 G;  3D4W A;  1H9S B;  4ZKC B;  4C3H H;  1P16 A;  4RGT A;  5C3E H;  1G51 A;  2EYM A;  4PMB A;  1V43 A;  4MHE A;  1KIX A;  5FLM G;  4DR2 L;  2WB1 E;  2K7V A;  4LF5 L;  4A3D G;  3OHX C;  2FMC A;  2PPB C;  1VQL A;  4AYB B;  3GP7 A;  1E2W A;  5IYD H;  5KYI A;  4X62 Q;  4FNF A;  4GKK Q;  1LT4 D;  3PCO B;  1F2M A;  3U9O A;  1C0A A;  4L5R C;  1YJW A;  4FXK C;  1KDC A;  1CHQ D;  2AUJ D;  3S1R B;  2A73 B;  2YYZ A;  4ZK9 B;  4Z9C B;  3S14 H;  2JEB I;  5KYL A;  2XWJ B;  2NVT H;  2C9O A;  3TP8 A;  3URY A;  3CCJ A;  4A3J G;  3K59 A;  4IUQ A;  3MHB A;  3TN2 A;  5IGC A;  2R93 G;  1Q81 C;  4ME3 A;  4JI7 L;  3A7A B;  4J6H A;  1A62 A;  5A2Q E;  4A3B G;  1STB A;  4JOI C;  5E1F A;  1HNX Q;  3HRZ C;  3U4V A;  3AFP A;  3H3V H;  3I4M G;  5FLM H;  3FKI B;  1IXR A;  1YIJ A;  4IO9 A;  1CUK A;  3I70 A;  4GNX A;  2G9H D;  5EKL A;  1EY9 A;  1EQQ A;  4LFB Q;  2E74 C;  1VQP A;  4DA2 A;  2NUC A;  4DUZ L;  2ZT9 C;  2XVS A;  4HSV A;  3TP6 A;  2F0P A;  4PMW A;  3J80 c;  3UDG A;  1SYD A;  1BVS A;  3A7L A;  3M3Y B;  1W3S A;  3J80 i;  2CH4 W;  4A3J H;  2PMZ E;  1BBU A;  5C44 H;  2CH4 A;  2GA4 B;  2R93 H;  1CKN A;  1I3Q H;  1GD7 A;  2O4X A;  5HY6 A;  1G6P A;  2L11 A;  4HJ5 A;  2CWP A;  4A3B H;  2N8N A;  1O7L A;  3K8A A;  2A19 A;  3D8G A;  5D3D A;  3I4M H;  4A3I G;  1VDZ A;  2F0V A;  5HUR A;  1D5X C;  1TQO A;  3GTG B;  5IGE A;  2QA4 A;  1I6H H;  5M3M G;  2EYH A;  1HFG A;  1G2S A;  1I94 Q;  1OXU A;  4APV A;  1IYJ B;  3GQB A;  1EEF D;  2VB3 X;  1I4H A;  1C7Y A;  5GAD C;  3MEF A;  1GOZ A;  5IGD A;  3SVM A;  1SND A;  1DJR D;  3SEB A;  2EYL A;  3BU2 A;  1JT8 A;  1IBK Q;  2EXD A;  5DEH A;  1E0B A;  4X3T A;  3QOL A;  1I4X A;  3GTL B;  4DR3 L;  1GKH A;  2AQ2 B;  3FRP B;  4NP5 A;  2YV5 A;  1B9M A;  1YVC A;  5IIF A;  5I2X A;  1A2U A;  2PQA B;  2JN4 A;  3T51 B;  4F87 A;  2IX1 A;  4LFC Q;  1A3U A;  3G6E A;  4B3R Q;  4OEM B;  2Q8R E;  5M5W H;  4PQX A;  5IWA Q;  2GVA A;  2Z4I A;  3VA5 A;  4IJH A;  1WD0 A;  1PDQ A;  4I7A A;  4AYB G;  2HCC A;  3BYT B;  1HNW Q;  1PH1 A;  3P7J A;  1L0W A;  1FR3 A;  1D2B A;  2B39 A;  4CKE A;  3KLR A;  4F88 A;  4RGO S;  3TQY A;  3E0J A;  3GTM B;  3X3N A;  1EYC A;  2HHH Q;  2VW9 A;  4DAV A;  1SBB B;  1HA5 A;  1UE5 A;  1N8R C;  1A15 A;  3RD4 A;  4O0A A;  4KMU C;  1KC8 C;  1PTO B;  1KTK A;  1PXU A;  2M00 A;  1SDF A;  5DLQ E;  2IHE A;  1TWH H;  3FKI G;  3CW2 C;  1LTI D;  2K5N A;  2JEA I;  1HH2 P;  4LF8 L;  2A8V A;  3K7A B;  4DV4 L;  1LT3 D;  1DZ1 A;  1EYA A;  4BY7 B;  3CU7 A;  3T16 A;  2ID0 A;  3I8Z A;  4G7O C;  3I56 A;  4ZUI A;  3I73 A;  3CD6 A;  2QEJ C;  2AHO B;  1IL8 A;  2MPM A;  4CDD C;  3S1R H;  2KHI A;  2WP8 J;  2VB2 X;  1BNZ A;  1EIG A;  1ICF B;  2KJX A;  3SK5 A;  4JI3 L;  4RGN A;  4CDC C;  4IUU A;  2QIL A;  1YI2 A;  2LKV A;  1CI3 M;  2L1B A;  1HZB A;  1H9R A;  1GHJ A;  4ID6 A;  1WOC A;  2EE1 A;  4DNT B;  1FL0 A;  2R7Z B;  4RH6 A;  1LAC A;  4OX9 Q;  5IT9 E;  3S2D B;  1D1K A;  1UAP A;  1BDO A;  1QE6 A;  1YJ9 A;  3MA2 B;  3I55 A;  4ZCK A;  4YHH Q;  4B9W A;  1JE5 A;  4LUO A;  2WKD A;  1KDA A;  1CKO A;  4X62 L;  1BXT A;  1GJX A;  1J8I A;  5ISR A;  2IPK D;  1WTX A;  2XWB B;  4NXM Q;  2GN5 A;  2F0O A;  3C1F A;  1K8M A;  2BE5 C;  1YZ6 A;  4IPC A;  5M9O A;  4LUV A;  1PRT F;  1OO9 B;  1L0X B;  1F2Y A;  1HZ9 A;  1EY4 A;  1EY8 A;  1B53 A;  1V1O A;  1DM0 B;  3H3V I;  1PFS A;  5AJ3 L;  1L1O C;  1UWV A;  4C2M B;  3GTG H;  3BYY B;  1HNX L;  3VR5 A;  4C56 C;  1LUZ A;  1X65 A;  4RHR A;  5CV9 A;  1I6V C;  1F9S A;  3PO3 B;  4HIK A;  1JMC A;  1VQB A;  2ZTC A;  3QB3 A;  2B2U A;  4IPG A;  2XRS D;  4HR7 B;  2VQF Q;  2BH8 A;  1R4P B;  4JOI A;  3GTL H;  3K0X A;  1PTO C;  4UP7 A;  4WRD A;  1AFP A;  1SNO A;  3L3O C;  4JI6 Q;  2V1C C;  2UXD Q;  4A3F B;  1FVI A;  3C46 A;  1U0L A;  1QCB D;  2G9D A;  2JSO A;  1HA6 A;  3DM3 A;  4EQN A;  3C3L A;  2XN9 C;  1EEI D;  1SEB D;  2WB1 B;  3OYY A;  2Q2U A;  3QR8 A;  4P71 A;  3CC4 A;  1BQQ T;  1VQC A;  1H9M A;  1BCP F;  1I94 L;  2F0N A;  3UI2 A;  4QJF A;  4BY7 G;  1BOS A;  1TWF H;  3Q8D A;  4R9W A;  1EWH A;  4DK1 A;  3DWQ A;  5CV6 A;  5NUC A;  5IP7 G;  2NTS A;  5K36 G;  2I07 B;  4IPD A;  2EXZ A;  2PW5 A;  2F4V L;  2SNM A;  3VR6 A;  1PYB A;  3GTM H;  1WTR A;  3KOJ A;  4AYB E;  1KQS A;  1EY7 A;  2XSC A;  3JAM L;  4L5S A;  1IBK L;  2ZXO A;  3TRZ A;  4A3G B;  4JG2 A;  1WFQ A;  2UUB L;  4KKU A;  1LT6 D;  1KDB A;  4DV2 Q;  4FVM A;  1AP0 A;  1B3A A;  4JI5 Q;  1HZA A;  2R7Z G;  3I91 A;  5TSS A;  3M85 A;  1K8A C;  3PO2 B;  3K80 C;  4LF7 Q;  4RCN A;  4LFC L;  3WWV A;  3CHB D;  3DXJ C;  2QDL A;  5J1Z A;  5A35 A;  4G7Z C;  4B3R L;  1QIL A;  3K7A H;  1TXY A;  1XTC D;  2MJ8 A;  1UE1 A;  2RSO A;  4IAL A;  1PH9 A;  4DR1 L;  2B29 A;  3KK7 A;  4BY7 H;  1LTA D;  5IWA L;  3F2D A;  5IP7 H;  5K36 H;  5G3L D;  1Q1B A;  4WJW A;  2F0U A;  1HNW L;  2O5I C;  3CCV A;  4QF4 A;  2OCE A;  1X3E A;  3Q23 A;  4WOR A;  3UDI A;  1X55 A;  3OMC A;  2I0Q A;  3BG3 A;  2R7Z H;  1K0S A;  1JOO A;  2UUA Q;  5I2Y A;  4R4T A;  3KBX A;  1AN8 A;  2YTX A;  2BE5 D;  1RIP A; 
#chains in the Genus database with same CATH homology
 4DAM A;  4GKJ Q;  2N3S A;  3F8T A;  2VQE L;  2BA1 A;  4C3J H;  3ER0 A;  4A93 G;  1NMG A;  2B3G A;  3J81 i;  4OON A;  4DK6 C;  1HR0 Q;  3S1M H;  2HIV A;  4JBM A;  4BBR H;  1VQ4 A;  2Q2H A;  5LMN L;  3PO3 G;  3JC6 6;  3TS2 A;  2KHJ A;  4JI8 Q;  5J3B A;  3E0E A;  2JA6 H;  1BBW A;  3J7Z C;  4RMF A;  5LMU L;  4QY7 A;  3FP9 A;  2VNU D;  4GN4 B;  1VQE A;  5GAH C;  3UE0 A;  1VQ5 A;  1ASY A;  1EIY B;  1XPU A;  2R92 G;  3S24 A;  2PI2 A;  1PH6 A;  5M3F G;  4A3M H;  4YWK A;  4PZ7 A;  1JJ2 A;  2ZTE A;  4DV5 Q;  3M4P A;  4R4I A;  3CXC A;  1PH8 A;  4B3T Q;  4LF4 L;  2JA8 H;  4EX5 A;  3PF5 A;  1CSQ A;  3M7N A;  4JV5 L;  4LFB L;  1VQM A;  5C3E G;  1PH7 A;  2F4V Q;  3CQZ H;  3RLF A;  4Y7N H;  4LF8 Q;  4DAY B;  4A3F G;  3PUV A;  4DV4 Q;  4P72 A;  1XNQ Q;  1N9W A;  4DR4 Q;  4C3I H;  4C2M H;  3FHW A;  2NVQ H;  2WFW A;  4Y52 H;  2UUB Q;  4A93 H;  4BA1 I;  1EUJ A;  3T1Y L;  1VQK A;  4K0K L;  2WB1 G;  4GOP B;  5IYD G;  1S72 A;  1G29 1;  3G71 A;  4KHP Q;  4X64 Q;  1K73 C;  3UDF A;  5E7N A;  4RG1 A;  3PO3 H;  2YTV A;  1Q7Y C;  3GO5 A;  2E2H H;  3HOU H;  3CPF A;  1CSP A;  4UY8 C;  1EIF A;  2K5V A;  4LUZ A;  4YHH L;  4QGU A;  3CC7 A;  2JA7 G;  4JI3 Q;  1NY4 A;  1KRS A;  2JE6 I;  4A3I H;  4JI2 Q;  4DV0 Q;  1YIT A;  4JI4 L;  5M3M H;  1JB7 A;  3EIV A;  2VY3 A;  4GS3 A;  3DLL A;  4ALP A;  2BA0 A;  2IT1 A;  4DR1 Q;  4JYA L;  4HJ7 A;  1HNZ L;  5GRO A;  1L1O B;  1TWC H;  1I5F A;  1Z9F A;  3BZC A;  1UEB A;  4NXM L;  3A5Z B;  1PYS B;  2N49 A;  3AQQ A;  4LWC A;  1VQ9 A;  4B3S L;  4LFA L;  2B63 G;  2UXC L;  1PHJ A;  2HT1 A;  1N32 L;  2ZJR A;  1VCI A;  1P16 A;  1Z47 A;  4C3H H;  4YY3 L;  1G51 A;  5C3E H;  5EAY A;  4GNX B;  4BY1 H;  4DV1 L;  4A3F H;  1V43 A;  2AWO A;  2K4K A;  1S40 A;  1KIX A;  1C9O A;  5GQO A;  1K83 H;  1VQD A;  3A0J A;  5BR8 L;  1S3O A;  5FLM G;  4DR2 L;  3CME A;  1AH9 A;  2WB1 E;  1SMX A;  3NEN A;  1MJE A;  4LF5 L;  3PO2 G;  2DUD A;  4A3D G;  1VQL A;  4WJ4 A;  1OXV A;  5IYD H;  4X62 Q;  3T1H L;  1X3F A;  4GKK Q;  1V9P A;  4LF6 Q;  1XMO Q;  4A3L H;  3PCO B;  1Q86 C;  4L5Q A;  3GTK H;  4FDB A;  1MJC A;  1C0A A;  2JA7 H;  3W1G A;  4L5R C;  1OXX K;  1YJW A;  4NXN L;  3KDF A;  4GOP A;  1A0I A;  2LSS A;  2ALY B;  2VQE Q;  2K52 A;  2YYZ A;  2CFM A;  3S14 H;  1CKN B;  1EWI A;  2Q2I A;  2JEB I;  4NB3 A;  5M5X H;  4PG3 A;  3HOV G;  2NVT H;  4OO1 G;  1VQN A;  1EQR A;  4OXP A;  2ATW A;  2VUM G;  1SR3 A;  3CCJ A;  4A3J G;  2EQS A;  4JBJ A;  4X66 Q;  4DR5 Q;  5HGQ A;  4A3G H;  4KHZ A;  2R93 G;  1B7Y B;  1XTD A;  3E9H A;  4R1J A;  4ME3 A;  1Q81 C;  2R7F A;  4BXX G;  4LF9 Q;  4JI7 L;  1L1O A;  1IZ6 A;  1SE8 A;  2VQF L;  1A62 A;  1K8G A;  2R6G A;  1W2B A;  4IOC A;  4JCV E;  5ELN A;  3S2H H;  4A3B G;  4JOI C;  3OTO L;  2Y0S G;  1HNX Q;  3AFQ A;  2D62 A;  3U4V A;  3AFP A;  3H3V H;  4JI6 L;  3I4M G;  5FLM H;  4X6A H;  1IXR A;  1YIJ A;  2L15 A;  1CUK A;  4YWL A;  4IO9 A;  4GNX A;  3PO2 H;  1YNX A;  4HIM A;  1QUQ A;  3CF5 A;  5JJK A;  4LF4 Q;  3TS0 A;  1EQQ A;  4LFB Q;  1VQP A;  4YWM A;  5FLX c;  1WJJ A;  2HHH L;  4DUZ L;  3J7A 5;  1L2F A;  1TWA H;  2JA8 G;  3OW2 A;  1Q1E A;  4PMW A;  3J80 c;  3UDG A;  3RN5 A;  1FJG L;  4JI1 Q;  2RHS B;  1BVS A;  1HJP A;  4HIO A;  3T1Y Q;  1QZG A;  2E2I H;  1W3S A;  3HOV H;  4K0K Q;  3NBH B;  2NN6 G;  3J80 i;  3FKI H;  4AQY L;  2VUM H;  4DR7 Q;  4IJL A;  1YHB A;  4HJ9 A;  4A3J H;  1N34 L;  2PMZ E;  1BBU A;  4YCU A;  5C44 H;  1QVF A;  1IL2 A;  3U4Z A;  1Y1V G;  1JJC B;  1CKN A;  2JA9 A;  2R93 H;  1I3Q H;  3PV0 A;  1Q12 A;  2MNA A;  1IBM Q;  3PUY A;  4BXX H;  1VQG A;  1GD7 A;  1G6P A;  5HY6 A;  4DKA C;  2Y0S E;  4HJ5 A;  1D7Q A;  1PH3 A;  2HQL A;  3CCM A;  2CWP A;  4A3B H;  2DGY A;  2N8N A;  3HOU G;  3K8A A;  1MIU A;  4JI4 Q;  2JK8 A;  2A19 A;  3KLW A;  2IX0 A;  2KBN A;  5JEA G;  3I4M H;  1N36 L;  1QZH A;  1HNZ Q;  4JYA Q;  3VDY A;  4A3I G;  2C35 B;  2D0O A;  3CMA A;  1XNR L;  3RR5 A;  3U58 A;  3M3Y H;  2MO1 A;  1K9M C;  4YCW A;  2QA4 A;  4DV2 L;  5M3M G;  4B3S Q;  1I6H H;  3BZK A;  4LFA Q;  1YHQ A;  1I94 Q;  3A5U A;  1OXU A;  4APV A;  3BJU A;  1VQF A;  1Y14 B;  2KEN A;  4YY3 Q;  5C0X I;  3K7U C;  1A8V A;  3NEM A;  1IYJ B;  1E1O A;  2MO0 A;  4R4O A;  3SGI A;  1M90 C;  4DV1 Q;  3F1Z A;  1C7Y A;  5GAD C;  4LF7 L;  3HOZ G;  3MEF A;  4IFD J;  2K5H A;  1K0R A;  1PH4 A;  4DV6 Q;  5BR8 Q;  1Q8K A;  3S1Q H;  4BY1 G;  4DR2 Q;  1J5E L;  4LF5 Q;  3BU2 A;  1SFO H;  5JJI A;  4OWT B;  1JT8 A;  1IBK Q;  2EXD A;  4DV3 L;  4OWX B;  2Z6K C;  3T1H Q;  1IBL L;  1Y1V H;  3PIO A;  2I5H A;  1YJN A;  4OX9 L;  1E3P A;  4B3M Q;  2KCM A;  3KDF B;  1VQA A;  3HOY G;  4DR3 L;  3KJO A;  1GKH A;  1E7Z A;  3I4O A;  2ES2 A;  2HIX A;  4A3L G;  1JJG A;  1NMF A;  4GN3 B;  1SRO A;  2YV5 A;  2K14 A;  4HID A;  1SN8 A;  1YVC A;  1XMQ Q;  1QVG A;  2PQA B;  3W5O A;  2ASB A;  2IX1 A;  3KJP A;  4LFC Q;  3I2Z A;  3G6E A;  4GLX A;  4B3R Q;  1OXT A;  1OXS C;  3CC2 A;  3K81 C;  1X54 A;  2OQ0 A;  4A4I A;  3RNU A;  5M5W H;  5IWA Q;  2IY5 B;  2AWN A;  2GVA A;  2YTY A;  4IJH A;  3HOZ H;  1LTL A;  4DR6 L;  1P8L A;  4AYB G;  4A3G G;  4GKJ L;  1QVC A;  4BA2 I;  1HNW Q;  1LM0 A;  1PH1 A;  1QUQ B;  1L0W A;  5M5Y H;  1PA6 A;  1YHA A;  4DPG A;  2E8G A;  5H1S E;  3ICE A;  4IFD I;  1WCM G;  3TQY A;  2UXB Q;  4WJ3 M;  1GM5 A;  2VW9 A;  2HHH Q;  4GLA C;  2ZM6 L;  3HOY H;  1UE5 A;  4P73 A;  1N8R C;  2UU9 Q;  1FJG Q;  4O0A A;  2MQH A;  2WAQ G;  2AMC B;  1KC8 C;  1HR0 W;  3B6Y A;  1NJI C;  3HKZ G;  2Q2T A;  3D31 A;  2I5M X;  4AQY Q;  4DV5 L;  4B3T L;  5JJL A;  1NBW A;  1D8L A;  5DLQ E;  2IHE A;  2R7D A;  3GTQ H;  1TWH H;  2PQA A;  3CW2 C;  3FKI G;  4H02 A;  4XTC S;  5FJ8 G;  2K5N A;  2JEA I;  1HH2 P;  3H0G G;  1PVO A;  4LF8 L;  4A76 A;  5C44 G;  2A8V A;  2ZTD A;  4DV4 L;  4R4Q A;  3CAM A;  4PZ8 A;  5LMN Q;  3IRB A;  2F52 A;  2IHF A;  4JI0 L;  4P74 A;  4QL5 A;  2ID0 A;  3S17 H;  2K50 A;  5LMU Q;  1N36 Q;  3I56 A;  1RL2 A;  2QGQ A;  3CP0 A;  3CD6 A;  2AHO B;  3KF6 A;  5C0X J;  1NE3 A;  3S1R H;  4KHP L;  1WCM H;  2CKZ B;  4X64 L;  3GD7 A;  1A63 A;  4UP8 A;  2KHI A;  2WP8 J;  3KYH C;  4GN5 A;  2UXD L;  2F3I A;  1X3G A;  3I7F A;  2RF4 A;  2XGT A;  1EOV A;  1VQ8 A;  4POF A;  3E9I A;  1Q46 A;  1E1T A;  2UXC Q;  4JI3 L;  4JV5 Q;  4JI2 L;  4TVA B;  4DV0 L;  1E24 A;  1YI2 A;  4GLV B;  3KF8 B;  1X9N A;  2BH2 A;  3HOX G;  4X65 L;  3NEL A;  1HZB A;  2K75 A;  4KI0 A;  1T9H A;  1N33 L;  1KL9 A;  1VQH A;  3STB C;  4DUY L;  1WOC A;  4HJA A;  5IYC G;  1SLJ A;  2PNH A;  1FL0 A;  2PI2 E;  3A74 A;  4O2D A;  3I4N H;  3RN2 A;  3M9B A;  4OX9 Q;  1KXL A;  5FJ8 H;  3M4Q A;  3H0G H;  5ELO A;  3ULJ A;  3CCR A;  1SRU A;  1YJ9 A;  1VQJ A;  3HOW G;  4POG A;  3I55 A;  2E5L L;  4YHH Q;  1JE5 A;  4LUO A;  1FGU A;  1K3R A;  2E2J H;  2MFI A;  2RHQ B;  4DV7 L;  1CKO A;  2VZA A;  3CCQ A;  1H95 A;  1VQI A;  4X62 L;  3ULL A;  1N32 Q;  2VL6 A;  2H5X A;  1XMO L;  4IOA A;  4EQ5 A;  1B70 B;  2A1A A;  4NXM Q;  2NZO A;  1E22 A;  2GN5 A;  3ERS X;  4GOP C;  3RZD H;  1Q82 C;  4JI5 L;  2N78 A;  1YZ6 A;  2LXJ A;  3HOX H;  4LNQ A;  3RZO H;  4IPC A;  1Y1W H;  1M1K C;  2UUC L;  4LUV A;  1PV4 A;  1HZ9 A;  3F2C A;  5IP9 G;  3S15 H;  1VQ6 A;  1B8A A;  5IYC H;  4MTN A;  4X66 L;  3RLO A;  4DR5 L;  4R4C A;  5C4J H;  3H3V I;  4LF9 L;  1KHI A;  1PFS A;  4XIG S;  2ZM6 Q;  5AJ3 L;  4A3E G;  1L1O C;  3G48 A;  1UWV A;  3W1B A;  3GTG H;  1GO3 E;  2JQO A;  1YEZ A;  1HNX L;  1HZC A;  3HOW H;  2LXK A;  1LUZ A;  1X65 A;  3HKS A;  4NXN Q;  1MKH A;  4AH6 A;  2D0P A;  4GNX C;  1X56 A;  5LMN W;  1VQO A;  4HIK A;  4OWW B;  3TRE A;  3PIP A;  2XTI A;  1JMC A;  2OTL A;  1VQB A;  2NVX H;  4BY7 H;  3PUW A;  4AIM A;  1AE3 A;  2ZTC A;  2CWA A;  3TEH B;  4OO1 I;  4IPG A;  1TWG H;  2JJQ A;  2FXQ A;  4UPA A;  4JBW A;  4JI1 L;  4JI0 Q;  4JI7 Q;  2OQK A;  2UUA L;  4J15 A;  2VQF Q;  4L5T A;  2BH8 A;  5JEA J;  3KFU A;  3KF6 B;  4JOI A;  3GTL H;  4DR7 L;  3K0X A;  3OTO Q;  4UP7 A;  4HJ8 A;  4NPS A;  5IP9 H;  2OWO A;  3M4O H;  1PH5 A;  1NTG A;  4JI6 Q;  2V1C C;  4JC0 A;  2NZH A;  3CCU A;  1HR0 L;  2UXD Q;  3CCS A;  1IBM L;  1OTC A;  3UDX A;  1FVI A;  1X6O A;  5IE8 A;  4A3E H;  1U0L A;  2QEX A;  3CPW A;  3UE1 A;  2JA5 G;  1LYL A;  3HFZ B;  1WYD A;  3DM3 A;  4JI8 L;  1XPR A;  1PH2 A;  4DUZ Q;  1GVP A;  4X65 Q;  4LW1 A;  2R92 H;  5C4X G;  3OYY A;  3J81 j;  2Q2U A;  5M3F H;  4P71 A;  3PSI A;  5IYB G;  1EYG A;  3CC4 A;  1N33 Q;  3GDE A;  4DUY Q;  5C0X G;  5GAE C;  1ASZ A;  1VQC A;  1V1Q A;  1I94 L;  4MNO A;  4QJF A;  4BY7 G;  3L0O A;  1TWF H;  3LGJ A;  3Q8D A;  3ULP A;  1UE7 A;  3JAM c;  3F2B A;  1O7I A;  2VS1 A;  3U50 C;  3AEV A;  3GTO H;  1N34 Q;  5IP7 G;  2NN6 I;  5K36 G;  4KLK A;  4IPD A;  3I4N G;  4BBS G;  4IPH A;  4DV6 L;  3MXN B;  3JAM i;  2F4V L;  1PYB A;  1CKM A;  3PUZ A;  2E5L Q;  3GTM H;  1XPO A;  3KOJ A;  4AYB E;  4A3K G;  2Z0S A;  1KQS A;  4DR4 L;  3PUX A;  1XNQ L;  3PF4 A;  4DV7 Q;  1IBK L;  4L5S A;  2EIF A;  3TRZ A;  4QQB X;  3H15 A;  4JG2 A;  1WFQ A;  2I5L X;  2UUB L;  2CCZ A;  4B3M L;  1I50 H;  3GTP H;  1XNR Q;  4DV2 Q;  2OTJ A;  2JA5 H;  4YCV A;  4JI5 Q;  1HZA A;  1VQ7 A;  2YU9 H;  1U5K A;  2R7Z G;  4A3C G;  1XMQ L;  1XJV A;  1DGS A;  3M85 A;  3RLN A;  1K8A C;  1BKB A;  3K80 C;  1KRT A;  5C4X H;  2UUC Q;  4LF7 Q;  4LFC L;  3S1N H;  4PZ6 A;  3AYH B;  3WWV A;  2WAQ E;  5IYB H;  4B3R L;  3PGZ A;  3HKZ E;  3K7A H;  1AE2 A;  1TXY A;  4JBK A;  2B63 H;  1UE1 A;  1Y1W G;  1PH9 A;  4DR1 L;  2B29 A;  4DK3 C;  3STB D;  4A75 A;  2KCT A;  5GAG C;  1J5E Q;  3L2P A;  2NVY H;  3S16 H;  5IWA L;  3F2D A;  3ZJY C;  2Z6K A;  5AJ3 Q;  1UE6 A;  2ZJP A;  4BBR G;  4DV3 Q;  4TQU S;  1KAW A;  4DNI A;  5IP7 H;  3L7Z C;  1Q1B A;  1IBL Q;  2RCN A;  4BBS H;  2CQO A;  3EBE A;  2JA6 G;  1HNW L;  4A3K H;  4DR3 Q;  4UP9 A;  4IFD G;  1EFW A;  3CCV A;  3GTJ H;  4A3D H;  1R9T H;  2OCE A;  1YBY A;  1KD1 C;  4MZ9 A;  4QIW E;  1X3E A;  2AKW B;  3D0F A;  2UXB L;  1WI5 A;  3EN2 A;  4A3M G;  2ZJQ A;  3UDI A;  1X55 A;  3CCL A;  3S2D H;  3G4S A;  2GVB A;  4GKK L;  4LF6 L;  2UU9 L;  2I0Q A;  2R7Z H;  3CCE A;  4A3C H;  5IT9 c;  1J6Q A;  5IY0 A;  2UUA Q;  4R4T A;  4P75 A;  1VS0 A;  3J81 c;  2YTX A;  4DR6 Q;  1RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...