1X65A

Solution structure of the third cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNR protein
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 3
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x65A01
1Y1WG 2EIFA 4JI3L 2R7ZH 1S3OA 4JI0Q 1N34L 4DR6L 2N78A 3CCEA 1X56A 1MJCA 2DGYA 4APVA 5HGQA 4YHHQ 1Q46A 1EWIA 4QL5A 4DR4Q 3H0GG 4X66L 4JI1Q 4HIKA 1I94L 1SFOH 2HQLA 4NB3A 3F2BA 3H15A 3UDXA 3G6EA 2R92H 3S1MH 3PUXA 1XMQQ 1WYDA 4DV1Q 3I4MH 4LF8Q 5LMNL 1BVSA 4Y7NH 3CCQA 2JA6H 4X62L 4KI0A 1EQRA 1K83H 2E2HH 5C44G 4DR5Q 2AWNA 4LW1A 1G6PA 1QVCA 2VUMG 1YHAA 2LXJA 3HKZG 2Q2IA 3PUZA 2UXDL 3CCRA 1UE1A 4A3BG 4O0AA 4DR6Q 3CCVA 1V1QA 4DV5Q 1EUJA 5C3EG 4ALPA 1GM5A 2K5VA 4DR7L 4EX5A 4JV5Q 4JI7Q 2GVBA 2V1CC 3CF5A 1I94Q 1IYJB 1GD7A 4OX9L 4AH6A 1YJ9A 4A3LH 2MQHA 1PVOA 1KAWA 2Q2HA 3NELA 4O2DA 1N9WA 5IYCG 2UXCQ 4LFAQ 3EIVA 1XPOA 4GKKL 3UE0A 3J7A5 1NMGA 4X65Q 2HIXA 1IBLL 2UUCL 3S1QH 3CXCA 1A8VA 4UPAA 4GOPA 4DUZQ 1CKOA 1L2FA 2RF4A 1Y14B 5IP9H 4LUOA 3CMEA 4DUYL 4X6AH 1BBUA 1VQMA 1YVCA 1SROA 5ELOA 2B63H 2LXKA 4GNXB 2UXDQ 2GVAA 2PI2A 4QGUA 3KFUA 4P75A 4P74A 1PH1A 2R6GA 2YTXA 1XPUA 1Q81C 3HOZH 1NTGA 3E9IA 3W1BA 4A3FG 4DK6C 5IT9c 4TQUS 2R7ZG 3VDYA 4LF7Q 2Y0SG 5GQOA 2D62A 3TREA 4HIOA 3E9HA 3PF4A 3AFQA 1LYLA 5GADC 1QVFA 1LM0A 1SRUA 5JJLA 1HH2P 2RHQB 1K0RA 3GD7A 3J80c 4GNXA 3RN5A 2AKWB 2UUAL 1KD1C 3E0EA 1VQLA 2JA8H 3S1RH 1YI2A 3J81j 4LF6L 2R92G 1Q1EA 4A93H 2IX1A 4BBSH 2ES2A 4IJLA 1QZHA 1Q86C 3CC2A 3CC4A 4JI2L 4GOPC 1XPRA 3I4MG 4LWCA 4DUYQ 1YIJA 3RN2A 2PMZE 2JA6G 2CWPA 1VQ9A 4GLVB 3TEHB 2JA9A 4JYAQ 1PYBA 4GKJQ 1XNRQ 2MFIA 3RLNA 2A8VA 4MTNA 1J5EL 3JAMc 1L0WA 2QA4A 2WB1G 4HIDA 4RG1A 4HJ8A 4A75A 4L5SA 2K4KA 4IFDI 1S40A 5C4XH 1M1KC 1KRSA 1Y1VH 4DV3Q 1LUZA 4AYBE 5FJ8H 3RR5A 3U50C 2JEAI 2UUBL 4BXXH 5M5YH 2MNAA 1XMOQ 2NVQH 4IOAA 2H5XA 2IHEA 1O7IA 2GN5A 1YNXA 4A3LG 4IPGA 5K36G 2ZM6L 1B8AA 3K8AA 3OW2A 3HOVH 1VQ6A 2Z0SA 1NBWA 2LSSA 1VCIA 1VQ4A 3HOUH 1N32L 4NPSA 1N8RC 1PH4A 4JI0L 4JI4Q 1HJPA 2IHFA 4DV2Q 3I7FA 4YY3Q 4HJAA 4YHHL 3KJPA 4DR2Q 2B63G 2MO0A 4DR4L 1X3EA 4JI1L 3F1ZA 1HZAA 3K81C 3HOYH 2Q2TA 3HOZG 1UWVA 2BA1A 2FXQA 3CAMA 4YCWA 1X9NA 1H95A 1Q1BA 1N33Q 3TRZA 1WJJA 2DUDA 2L15A 3CCJA 3I4NH 4DV1L 4LF8L 1KIXA 2OQ0A 1GKHA 3S15H 2A19A 3J81i 4LF9Q 5IP7H 3GTKH 1PH5A 2JA8G 4DR5L 1C7YA 1W3SA 5J3BA 1WI5A 4POFA 3CCLA 2F52A 4OWTB 5JJKA 3DM3A 4A93G 4IFDG 4GN4B 1J6QA 4BBSG 1N32Q 1AE3A 3PF5A 2N49A 2R7FA 1HR0W 5M3MH 4DV6Q 1MIUA 5IYDH 3KF8B 4DV5L 2WP8J 3KYHC 4GN5A 1KHIA 3CMAA 1KC8C 1P8LA 1EIYB 4JCVE 3L2PA 3AEVA 4JV5L 1Q8KA 4JI7L 4GS3A 4IPHA 4ME3A 2EXDA 3M7NA 5ELNA 3TS2A 1OXUA 2K5HA 3GTGH 2JQOA 4J15A 2UXCL 3EN2A 4IO9A 4GLXA 4LFAL 1IBKQ 1PA6A 3WWVA 5C4XG 1XTDA 1Y1VG 5IE8A 4HIMA 2EQSA 4X65L 3S1NH 5BR8Q 2HIVA 5FJ8G 2B29A 1BKBA 1X55A 5FLMH 4BXXG 3PUVA 4DUZL 4MNOA 2K52A 2KHJA 4A4IA 2KBNA 2ASBA 4BY7H 3CPWA 1RL2A 2ZJRA 1Q7YC 3PIOA 3HOVG 1TWCH 1M90C 3HOUG 2OWOA 4A3JH 4X64Q 3OTOQ 2WAQG 5JJIA 3PO2H 3MXNB 4LF7L 1D8LA 3A0JA 4HJ9A 4K0KQ 4PG3A 2RHSB 1P16A 1KQSA 1JMCA 3KDFB 3STBD 3ICEA 2Q2UA 1E22A 2XTIA 1SN8A 2AMCB 4IPDA 5DLQE 4DR3Q 1T9HA 2E2IH 4B3TQ 3GTLH 3HOYG 1VQNA 4IFDJ 1WFQA 1VQ8A 4A3DH 3BU2A 1L1OB 3KLWA 4B3MQ 3FHWA 4LUZA 3I4NG 4WJ4A 2B3GA 3PO3H 3ULLA 1GVPA 4A3GH 2I5LX 2I5MX 2HHHQ 3CPFA 1E1TA 4R4TA 1Z47A 1X65A 2F3IA 3UDFA 5IP7G 3I55A 5LMUQ 4JYAL 4P72A 4DAYB 4GKJL 4L5TA 4YWKA 2C35B 1XNRL 1VQKA 3U4ZA 2R7DA 3M85A 4DV0Q 4FDBA 3GTOH 1KXLA 1L1OA 3PGZA 4XTCS 1UEBA 2CKZB 4JI5Q 4BA2I 4C3JH 1YITA 1VQBA 2QEXA 5M3MG 5HY6A 1XJVA 5IYDG 4AYBG 1V43A 3Q8DA 1YJWA 4DV3L 1NJIC 2E2JH 1YHBA 4C2MH 3M4OH 1XMOL 3MEFA 4LFBQ 2K14A 4L5RC 4PMWA 1IBMQ 1I5FA 3HKSA 3A5UA 3GDEA 1VQOA 1CKNB 2KCMA 3PIPA 1N36Q 3S2DH 4POGA 1X54A 1NE3A 2PNHA 2K75A 5EAYA 1PH3A 1EYGA 3RNUA 4B3SQ 4JOIA 5FLMG 2QGQA 2F4VQ 3J7ZC 1IXRA 1FGUA 4JI4L 2VL6A 3U58A 4A3KH 4DV2L 4A3IH 4JBWA 4PZ8A 1VQEA 4YY3L 3U4VA 4OO1I 4DV4Q 5GAHC 2ALYB 1IL2A 4DR2L 1EFWA 4BY7G 1PFSA 1VQIA 1CKNA 1HNZQ 1AH9A 2UXBQ 2VS1A 4BY1H 3H3VI 2VNUD 1HR0Q 1YBYA 1E7ZA 4JBJA 4A3JG 1Q82C 1VQGA 1VQHA 3CW2C 4LUVA 4QIWE 1TWHH 1PH8A 1N33L 2A1AA 3PO2G 2JA7H 3GTMH 3S24A 1UE6A 5IYBH 4MZ9A 2VW9A 2JK8A 4TVAB 4GNXC 1VQPA 4QY7A 2KENA 4L5QA 2I5HA 4IOCA 4UP7A 4LF9L 2KCTA 2YYZA 4PZ7A 4JBKA 4A3DG 3PUYA 2CCZA 2NVYH 2JA5H 3CP0A 1DGSA 1IZ6A 4DR1Q 3ERSX 2NVTH 4B3RQ 2R93H 1VQFA 2BH8A 2NN6I 2VQEQ 3M4QA 4JOIC 4OWWB 3PO3G 5IP9G 4A3GG 3D0FA 1VS0A 2IT1A 4DV6L 1E3PA 4YWLA 5LMNW 4LFCQ 3UDGA 1XNQQ 4JI6L 4XIGS 3RZOH 4LNQA 3ZJYC 1FL0A 4LF5Q 4HJ5A 1I6HH 1ASZA 1K9MC 3HFZB 5H1SE 1OTCA 1SR3A 4A3CH 1RIPA 2K50A 3CCSA 3T1HQ 1IBKL 2CWAA 2MO1A 4PZ6A 1E1OA 5FLXc 4A3MH 2KHIA 1JJ2A 4A3BH 5BR8L 1HNXQ 5M5WH 4UP8A 4OO1G 2JJQA 4LF4Q 4DKAC 1PH2A 1VQ5A 4C3IH 5IWAQ 1VQDA 1PH9A 3GTQH 3NENA 4DV7Q 4R4CA 1OXTA 3G71A 4BA1I 1FVIA 1SLJA 3BZKA 3AQQA 1FJGQ 5GROA 4X64L 3OTOL 1AE2A 3BJUA 3W1GA 2WB1E 4A3IG 3FKIH 4A3KG 4K0KL 1PV4A 4JI6Q 5E7NA 2PQAB 3A5ZB 5AJ3Q 3T1YQ 4DPGA 4QJFA 4GN3B 2YTYA 2ZJQA 4DR3L 3NBHB 1TXYA 2D0PA 2RCNA 4BY1G 4B3TL 3K7AH 3GTPH 1LTLA 1VQJA 3F2CA 5C0XI 1I3QH 4IJHA 4B3ML 2NN6G 1QZGA 1A62A 2Z6KA 2IX0A 5IYBG 4A3FH 3M9BA 1E24A 1HZBA 4UP9A 2HHHL 2CQOA 2PQAA 1G291 1KL9A 4JC0A 5LMUL 4BBRH 3J81c 1W2BA 2E5LQ 1Q12A 5GAGC 4DV0L 1R9TH 2JA5G 2OTLA 2R93G 3GO5A 2JEBI 4OWXB 3ER0A 4JI5L 4DNIA 1CSPA 3CC7A 3UDIA 3DLLA 2UU9Q 1VQ7A 3AYHB 1K3RA 1WCMH 4QQBX 4JI8Q 4GLAC 1G51A 4YCVA 4LFBL 1IBML 2N8NA 1TWGH 3G48A 1X6OA 3IRBA 5JEAG 1ASYA 4KHZA 1A63A 4A3CG 1YEZA 4AQYQ 3S16H 1N36L 2Z6KC 2VY3A 1PH7A 3SGIA 4B3SL 3CD6A 4RMFA 4A3MG 4JI3Q 3S14H 1TWFH 2NZOA 2NZHA 4P73A 3RLOA 1N34Q 1YJNA 1HZCA 2F4VL 3S17H 4KHPL 3KDFA 1PH6A 1B7YB 1JE5A 2D0OA 3PSIA 4GOPB 1EIFA 1NY4A 4JG2A 3J80i 5C4JH 4X66Q 4DV4L 3JC66 3KF6B 2IY5B 1VQCA 1HNZL 2UXBL 1K8AC 3OYYA 1CSQA 5C0XG 2OTJA 4NXML 1HR0L 2HT1A 1VQAA 2VQFL 1UE7A 2BA0A 5LMNQ 3FKIG 4R1JA 3HOWH 3TS0A 2K5NA 1A0IA 4X62Q 3RZDH 1YHQA 3ULPA 1OXSC 2BH2A 3KF6A 1QUQB 1QVGA 3H3VH 3JAMi 4YWMA 5M3FH 1KRTA 2ATWA 3HOXH 3M3YH 4DR1L 4B3RL 3UE1A 4NXNL 3HKZE 2VQEL 4KHPQ 1UE5A 1D7QA 1U5KA 2ID0A 2ZTCA 4DR7Q 1HZ9A 3GTJH 1K73C 1EOVA 4LFCL 5M5XH 1XNQL 4BBRG 4A3EH 3F2DA 2WAQE 1L1OC 3L0OA 3STBC 1QUQA 5JEAJ 2OQKA 4OX9Q 3F8TA 1BBWA 2NVXH 3CQZH 1NMFA 4NXMQ 1JJCB 1WOCA 4LF5L 2VQFQ 2YV5A 4GKKQ 1C9OA 1HNWL 3PCOB 3T1HL 1IBLQ 2UUCQ 1SMXA 1Y1WH 1SE8A 1WCMG 1HNXL 3G4SA 3W5OA 4AIMA 1V9PA 3BZCA 2E8GA 4LF4L 1OXVA 1X3GA 3K7UC 3K80C 4P71A 1GO3E 3H0GH 5IWAL 3AFPA 5C0XJ 1OXXK 4NXNQ 4DV7L 4DK3C 1Z9FA 4R4IA 3I56A 3ULJA 1U0LA 2ZTEA 4R4QA 1FJGL 3FP9A 1EQQA 2VZAA 2ZTDA 1B70B 4IPCA 1MJEA 4HJ7A 2Y0SE 3LGJA 4OXPA 2XGTA 4R4OA 5AJ3L 3T1YL 3I2ZA 4C3HH 5C44H 5GAEC 2UUAQ 1HNWQ 4LF6Q 5IY0A 3I4OA 2VUMH 1JJGA 2ZJPA 1CUKA 2N3SA 3CCMA 4JI2Q 3M4PA 3K0XA 4OONA 3KJOA 2YU9H 1I50H 2PI2E 3HOWG 3EBEA 5C3EH 3PUWA 2YTVA 4EQ5A 1YZ6A 1C0AA 1K8GA 1PYSB 2E5LL 3CCUA 5M3FG 4H02A 3PV0A 3D31A 1JT8A 3RLFA 1J5EQ 3HOXG 2I0QA 5IYCH 3B6YA 1MKHA 2WFWA 2AHOB 4DAMA 1X3FA 1PHJA 3L7ZC 4A76A 2UU9L 2CFMA 1XMQL 1JB7A 2UUBQ 4A3EG 2OCEA 3S2HH 4KLKA 4JI8L 3A74A 1S72A 3NEMA 3TQYA 2ZM6Q 4YCUA 1CKMA 4JBMA 2JE6I 3KOJA 4Y52H 4UY8C 4WJ3M 4AQYL 1TWAH 2JA7G 2AWOA
chains in the Genus database with same CATH superfamily
1Y1WG 4FF2A 4KK7A 2R7ZH 3DHQA 4JI0Q 4NP5A 1N34L 2N78A 3CKIB 5ELEA 5ISRA 2A5HA 4DR4Q 2HDMA 3NE5B 3UDXA 2OEOA 5ELBA 4OHJA 4TKOB 4DNTB 2F0UA 1WYDA 5CV6A 3S15B 5C5MA 4X62L 1S5ED 3MWYW 2E2HH 4MTKA 3HG9A 2VUMG 1G2SA 2LXJA 4FF1A 2UXDL 3EA6A 2R7ZB 1G8ZD 1GM5A 2K5VA 3OMGA 2CH4W 4JI7Q 4HMJA 1GD7A 4H13C 1YJ9A 4A3LH 1GUWA 1PVOA 4GKKL 3UE0A 2EYOA 2MHVA 2M2LA 2HIXA 2UUCL 3S1QH 3CXCA 2E2HB 1YNJD 1L2FA 2RF4A 3OIQA 4OELB 3WOEA 1VQMA 2B63H 2LXKA 4P75A 4P74A 1PH1A 1PTOC 3HOZH 4A3JB 1XXGA 5IT9c 4TQUS 4TSSA 5COYA 2LMCB 3Q24A 4HIOA 1H9SA 5GADC 1LM0A 5FLXL 1U4RA 4GNXA 3RN5A 2JA8H 3E0EA 1YI2A 4LF6L 3J81j 2R92G 1Q1EA 2BDOA 4BBSH 4IJLA 1QZHA 4RHSA 4DUYQ 1V1PB 4FXKC 2B63B 1VF7A 4GKJQ 1PRTC 3Q22A 4MTNA 2WB1G 4A75A 4DU9A 2E2JB 2K7VA 3Q23A 4RGMA 3U50C 5EKIA 5M5YH 2NVQH 4YIJA 2H5XA 1LLRD 2B2UC 2IHEA 4R8NA 1YNXA 3MA2B 5LHY1 4IPGA 4BBSB 5K36G 2ZM6L 3NP8A 1NR4A 3K8AA 1VQ6A 2Z0SA 2Q8TA 1JWUD 1A15A 1VCIA 1TY0A 2LSSA 1EY9A 3KLSX 1VQ4A 1G6ZA 1LTSD 4N9TA 1N8RC 3QJYA 1ET6A 1D6EC 4JI0L 1HJPA 1LABA 2L12A 4Z9CB 2K03A 1STHA 4DR4L 2CHBD 1HZAA 1H9MA 1MI2A 1CQFA 1UWVA 2FXQA 1WTQA 2F0PA 3I4NH 1U9RA 2OQ0A 4OL7A 2A73B 4CJ0B 2A19A 1EY8A 3J81i 4LF9Q 2NBFA 1SE4A 2H4OA 4A93G 4IFDG 2N49A 1MIUA 5IYDH 5A2QE 4GN5A 3CMAA 1BCPD 1P8LA 5IOCA 3L3OC 4JI7L 2EXDA 2PMZB 2L0CA 3TS2A 3EN2A 4GLXA 5C4XG 1PA6A 1Y1VG 4HIMA 5KEEA 1F77A 5BR8Q 3MHBA 3TP5A 5FJ8G 1BKBA 2F3WA 1Q8IA 3PUVA 2K52A 2XIWA 1LTAD 1Q7YC 1E2WA 3PIOA 3HOVG 4X3UA 3FPPA 2OWOA 1TIID 3OTOQ 2WACA 3PO2H 4K0KQ 3QG1A 1U4PA 2RHSB 3KDFB 2VB3X 2Q2UA 2AMCB 5DLQE 1SJED 3HOYG 3GTPB 4MHEA 3BU2A 3WDNA 3PIP3 1SNQA 4RAUC 4WJ4A 3PO3H 4KD3A 3MXNA 2IWHA 4EQPA 3CPFA 2SEBD 4GKJL 3V96A 4DAYB 4YWKA 1KLUD 2R7DA 3M85A 2TMPA 2D9UA 4BA2I 2DY8A 1B53A 5M3MG 5C3WA 1GXDC 3TDQA 1V43A 1STAA 1NJIC 1YHBA 1IKLA 4OO1H 1KDBA 3MEFA 1B3QA 5KNBA 4L5RC 1IBMQ 1I5FA 2MPMA 1R4QB 5C3XA 5T1GA 1VQOA 1N36Q 3S14B 5EGTA 3RNUA 4JOIA 2F0VA 3VYSA 4A3KH 4JBWA 2FJ2A 3GQBA 3U4VA 2ALYB 2DNCA 3KBXA 3C1EA 4K2LA 3FEWX 1E2VA 2VNUD 2A68D 1VQGA 4LUVA 5E1FA 1TWHH 3HOWB 3S24A 3FPUB 4TVAB 1VQPA 4QY7A 2QW7A 2I5HA 4IOCA 4LF9L 1XWEA 4CDFC 3HOXB 3CP0A 3E5SA 3ERSX 2NN6I 4XT3B 2VQEQ 1IW7C 4JOIC 4A3KB 4OWWB 2EJGC 5IP9G 2IT1A 2HQEA 5EBCA 3K5LA 4BS9A 1W6JA 2F0GA 1Q90A 4XIGS 5D65A 5JEAH 1I6HH 4A3CH 1Y1WB 2F0SA 3T1HQ 2IPKD 4PZ6A 2NB0A 4A3MH 5BR8L 1HNXQ 1I6VC 5M5WH 5I2XA 2GA4B 3N6RA 4LF4Q 3BDCA 3VYRA 4DKAC 5IT9E 1VQ5A 1LTTD 4C3IH 2QEJC 1PXUA 1O7YA 3Q0AA 1AZQA 3TP7A 1RTOA 5C0XH 4X3KA 3OTOL 3A54A 5BN3A 1AE2A 3BJUA 5D3IB 4A3IG 1UNSA 4K0KL 5E7NA 2F0OA 3A5ZB 4DPGA 4QJFA 1YNNC 1TS5A 2YTYA 3NBHB 2VUMB 2RCNA 4BY1G 3UI2A 3K7AH 4U68A 1LTLA 1JE4A 1QJOA 1QZGA 5M5WB 2Z6KA 1LV9A 1B1ZA 2IX0A 5DM73 5IYBG 5I2YA 1HZBA 2PQAA 4JC0A 4QMGA 1LTID 2EVBA 3J81c 4QIWB 1W2BA 1Q12A 1R9TH 4QCLA 3U9SA 2R93G 3GO5A 4DN4M 4F7XA 2QF7A 3WOFA 2CQAA 2EJFC 1AEXA 2A6HC 3AYHB 1I4HA 1I4QA 3K7AB 3D4RA 3DUZA 1IBML 1ASYA 3G48A 3K5OA 3IRBA 1TWAB 1A63A 3S16H 4M1UB 1N36L 2Z6KC 3X3NA 2EPBA 4IUNA 1TWFH 3HP3A 3JAML 1YJNA 3KDFA 1JOOA 2EE1A 1JOKA 1X32A 5C4JH 2R92B 2F0NA 1B9NA 1D5MC 2X6GA 1DOLA 1PDQA 1VQAA 2VQFL 4CKBA 3FKIG 1K83B 1A0IA 1WTOA 1B44D 3R3OA 5DAUA 3H3VH 4RGTA 2X69A 2WB1B 2ATWA 3MTSA 4NXNL 2VQEL 5CC4A 4DR7Q 1HZ9A 3GTJH 5DM63 1L0XB 3VYTA 5M5XH 2X6LA 4A3EH 3F2DA 4IUVA 3L0OA 5JEAJ 1QUQA 4OX9Q 1FD7D 3F8TA 4NXMQ 3CQZH 1JJCB 1HNWL 3E6ZX 5J39A 3T1HL 1SMXA 3ND9A 1MSHA 2B2WA 1HNXL 3W5OA 4AIMA 1V9PA 2RSOA 4LF4L 3K7UC 3K80C 5C0XJ 5CORA 1B9MA 2QILA 4CKEA 4R4IA 3I56A 2EY5A 3MC0B 4WORA 5M5XB 4ZKCB 4A3EB 4OIKA 1RJTA 4CJ2C 1EQQA 1AW7A 5KRUA 3LGJA 4R4OA 2XGTA 4RGOS 4C3HH 1BQQT 5GAEC 3EVQA 2UUAQ 3DEOA 1SBBB 1HQMC 4JI2Q 4H44C 2PI2E 2B2WC 4JK1C 3EBEA 5C3EH 4EGVA 4G7ZC 3HZXA 4ZUIA 1JB3A 5M3FG 2I0QA 1RD9D 4XDXA 4ILWA 5EQ0A 5C4XB 1Y1VB 3L7ZC 4KY6A 5I6YA 3TZDA 4K5WA 1XMQL 4C3HB 1PTOH 2PYKA 5EPJA 1HCZA 1XTCD 3I91A 3S2HH 3A74A 3KLRA 3HKZB 3P20A 4IZ8A 3ERQA 3TQYA 3HOVB 3A8IE 2JE6I 2RSNA 4WJ3M 2JA7G 1PYWD 2EIFA 1A3TA 1CHPD 2K1BA 3CCEA 5CBEE 1MJCA 2JYOA 4JW0A 4APVA 5HGQA 4YHHQ 4DAVA 3HOYB 3H0GG 4ZQ3A 4NB3A 3FVQA 1SNMA 2ICIA 3F2BA 1K8OA 3G6EA 1PTOB 1GHJA 1EL0A 1BVSA 1WTVA 3R2TA 2WKDA 4GZYC 1IYVA 2PW5A 2AWNA 2F0WA 2G9HD 1FGBD 2KEDA 2Q2IA 3PUZA 5DNFA 2SDFA 5M3MB 4C1NK 3K59A 3CCVA 1V1QA 4DV5Q 4O1NA 1CI3M 4DR7L 2L5TA 2GVBA 2V1CC 3CF5A 1ONLA 1QOHA 1IYJB 2RDFA 4OX9L 1PRTB 2MQHA 4CJ1B 2BCOA 3J7A5 4X65Q 2G9DA 2XN9C 1K8MA 4X6AH 2B2YC 5IP9H 1Y14B 1CZWA 1H9SB 5EPKA 1JWSD 5ELOA 4GNXB 2UXDQ 4H0LC 4QGUA 2E76C 2QDBA 2FINB 2R6GA 2KECA 1EU4A 1HHVA 2F0IA 3K6OA 3IKJA 1EYDA 4HCSA 4V190 4V0BA 3VDYA 4PNYA 2Y0SG 5GQOA 3BDOA 2E2IB 1LYLA 1SRUA 3GD7A 2UUAL 1VQLA 1SE2A 3MFGA 1T5EA 4JI2L 3CC4A 3I4MG 4LWCA 3RN2A 2PMZE 3HRZC 1S5BD 3EQLC 3J81E 2JA6G 2CWPA 2B2TC 1VQ9A 3EJIA 2DNEA 2KUMA 2AUJD 3RLNA 3D8GA 2Z6BA 2A8VA 1GUOA 1CT1D 1L0WA 2QA4A 4IFDI 2K4KA 5BN4A 1S40A 1LTGD 3CRKC 4RCOA 2BDNA 3R8BA 5DEHA 4DV3Q 4C2MB 1SYGA 1EEID 2NZ1D 3W3AA 2WINB 3VR5A 1EIGA 1B8AA 4IUTA 1VMPA 3OW2A 3J7AF 1NBWA 1RTNA 1MD2D 4IN3A 4A3IB 1ESRA 1TKWB 3I7FA 4YY3Q 3OSOA 4HJAA 4YHHL 4DR2Q 2MO0A 1X3EA 4BY1B 2F0HA 1X9NA 1H95A 1II3A 3TRZA 3EROA 1GHKA 3CCJA 2L15A 1OO9B 2H1EA 3S15H 2B2VA 5IP7H 1PH5A 1C7YA 2NVYB 2R93B 4KN4C 2Q8RE 3DM3A 4GN4B 1AE3A 3IL8A 2R7FA 4G4KA 1HR0W 1I4XA 4DV5L 1D1IA 1F2MA 2MGSA 5NUCA 1KHIA 1KC8C 1DYQA 4JCVE 3J80E 1Q8KA 1KABA 2DN8A 2A69C 2DJGC 2PZUA 3I90A 3M7NA 1B4OA 1ENAA 3LNNA 5ELNA 2PQEA 1OXUA 1MBYA 3GTGH 4LAAA 3D3RA 3WWVA 4X65L 3KF8A 2CH4A 5FLMH 1LACA 2B29A 4BXXG 1HRJA 4MNOA 2KHJA 1QNUA 2ASBA 4EQNA 3CPWA 2RBMA 1EU3A 4U673 2P5ZX 4AYBB 4KKUA 1QNKA 5C4HA 3HOUG 1QE6A 3T13A 4A3JH 2PO4A 2WAQG 3FKIB 4FVMA 4K14A 3MXNB 3A0JA 4HJ9A 2HD3A 3GTGB 1E22A 2XTIA 4CDEC 4DR3Q 4B3TQ 1T9HA 3GTLH 1VQ8A 2Z1CA 3SK6A 4LUZA 4LMQD 1ZEQX 2AUKA 4IUUA 3ULLA 4UDUC 3MXGA 2I5MX 3E0JA 2HHHQ 4R4TA 2F3IA 3NQIA 4L5TA 2C35B 2F0MA 3GTOH 1KXLA 1RCVD 2HCCA 3NXWA 1UEBA 2Z4HA 4JI5Q 1VQBA 2B8GA 2QEXA 4PMCA 5HY6A 1XJVA 3I8ZA 4ULLA 4DV3L 2E2JH 1EWCA 3D4DA 3GTLB 1TWGB 5IGFA 3A5UA 2FFKB 3TSSA 1X54A 1PH3A 4FNFA 4XYOA 5CV8A 2F4VQ 3J7ZC 1IXRA 1FGUA 2VL6A 3QR8A 4PZ8A 1VQEA 4YY3L 3GTOB 3BVMA 1C4QA 4BY7G 4DR2L 1EFWA 4CDCC 1PFSA 1CKNA 1AH9A 3T16A 2VS1A 1S4ZA 3BVGA 1PH8A 2NN6H 3NTKA 4QIWE 2JA7H 5JVG3 3GTMH 1YNJC 4MZ9A 4GNXC 3RZDB 2D5DA 2KCTA 2KVMA 4PZ7A 5M3FB 2K32A 4A3DG 4IURA 3H91A 4F87A 2JA5H 1IZ6A 5KNDA 3PMFA 3M4QA 4A3GG 3D0FA 2K6AA 5LMNW 2M9VA 4JI6L 2RDGA 2J4XA 3ZJYC 1FL0A 1EY5A 5E4WC 3QB3A 1W6KA 4LF5Q 1VMCA 4C3JG 2JA7B 1BR9A 3GTMB 3CCSA 2CWAA 1ZYRD 1JJ2A 2KHIA 1O78A 4UP8A 2JA5B 2AQ3B 2L55A 3H0GB 1PH9A 4N8X1 4HAEA 3NENA 1Y69U 4R4CA 2B8FA 1I4RA 1OXTA 4BA1I 3G71A 5IGDA 4Q0FA 1V8QA 3W1GA 2WB1E 1AN8A 1PV4A 1G2TA 4CKCA 2PQAB 5AJ3Q 1NCVA 4DR3L 5EKKA 1LT6D 1TXYA 4B3TL 3GTPH 1G91A 4K5XA 1SYCA 1GJXA 3NQTA 1F2ZA 3M9BA 1LO5D 2HHHL 4ZYSA 2CQOA 4FXGC 1G291 1U4MA 5C6AA 1EY7A 4O42A 1UEAB 4WFN3 2Z9HA 2F0FA 1VDZA 2HUGA 4JI5L 1PMRA 4ZRZA 3DLLA 5CV5A 1VQ7A 1WCMH 4GLAC 4N9PA 5LL6X 2N8NA 3S9WA 1EFID 1GUSA 1YEZA 2KOLA 4AQYQ 4XQNA 2PW7A 2VY3A 5D14A 1CM9A 3SGIA 3S14H 4JI3Q 2NZOA 2F4VL 4KHPL 1HZCA 1RF2D 1PH6A 2F0DA 1PZKD 5JAVA 1CA6A 3J80i 2JP1A 4X66Q 1SSOA 4E6IA 2IY5B 1VQCA 3S1MB 3OYYA 5FLXE 2HT1A 3I4MB 1WCMB 3HEJA 4KY5A 4RGNA 1BDOA 3HOWH 3TS0A 1KDAA 1ZXTA 5IODA 3KF6A 1QUQB 1QVGA 4DAPA 2I07B 1TS3A 1KRTA 3HOXH 3OOCA 1FYCA 3M3YH 2O5JC 2E2DC 1U4LA 3HKZE 5EKLA 4TRDA 3R2IA 4ZAIA 1UE5A 1U5KA 2ID0A 2ZTCA 1Y8OB 2DY7A 4F8MA 2KA7A 4BBRG 4KKTA 4B08A 4P2CB 1WOCA 4LF5L 5FKAC 3C1FA 2VQFQ 1NNXA 1IBLQ 1Y1WH 2O4XA 3G4SA 2TSSA 4KV6A 4DXFA 5FOBB 3BZCA 3ND8A 1OXVA 2BE5D 4P71A 3M3YB 1GO3E 1OXXK 4NXNQ 3K58A 3R93A 2F0KA 3ULJA 1U0LA 4C56C 4R4QA 3FP9A 4J1MA 2VZAA 2ZTDA 3OPOA 1MJEA 3MXUA 1JWMD 4OXPA 5AJ3L 3SK5A 1F9QA 1HNWQ 3OWFA 4NMZA 5CGKA 2VUMH 1CUKA 2N3SA 4IQZA 5HURA 4ME5A 3VR6A 4KMUC 2EXZA 2IW3A 1FNVA 1PYSB 1D5ZC 4H02A 1JT8A 3RLFA 1MKHA 2WFWA 4EVOA 1PHJA 3V2TA 4EQOA 4PMBA 1TT2A 2A68C 4A76A 2CFMA 4BWGB 3M4YA 1L0YB 2F3VA 2UUBQ 2SOBA 2ZXPA 3NEMA 2G5DA 4M8AA 1EY0A 4JBMA 3HOUB 4UY8C 4AQYL 1TWAH 4QUCA 2AWOA 2WAQB 3IFDA 4JI3L 1S3OA 4DR6L 1BXTA 2AQ1B 1Q46A 1Y8PB 3KK7A 4X66L 3GP7A 4JI1Q 3BDLA 1I94L 1SFOH 3QOJA 5I4DA 3H15A 2F0JA 2R92H 3PUXA 2I46A 1XMQQ 1CA5A 2K04A 4DV1Q 4LF8Q 4Y7NH 3S2DB 3GTKB 1K83H 5C44G 1CZGA 1DJRD 4LW1A 1QVCA 1YHAA 3HGBA 3CCRA 4A3BG 2EZVA 4O0AA 3AMUA 1VF5C 1SXTA 4DXGA 2RVLA 4EX5A 4OIJA 1SFOB 2VB2X 3HS0C 4XT1B 1ENCA 1I4GA 4AH6A 5IYCG 2Q2HA 1KNAA 1T5XD 4O2DA 5K36H 3EIVA 1XPOA 3VA7A 4Y7NB 5A35A 3NTHA 1M8AA 1IBLL 1A8VA 1HTPA 3D6CA 4DUZQ 2L11A 1WVLA 1X3QA 2ZT9C 2GVAA 1TWCB 3KFUA 1XPUA 1Q81C 3E9IA 3W1BA 4A3FG 3I4LA 2R7ZG 4LF7Q 2D62A 3FRPB 1JICA 1H9KA 3E9HA 3PF4A 4K5VA 1EY4A 1QVFA 5JJLA 1D2BA 1HH2P 2RHQB 1K0RA 3I73A 3J80c 4A3DB 1C8CA 3S1RH 1ILQA 4K6LA 1SNPA 4A93H 4IFDH 2F0TA 2IX1A 2ES2A 1EQTA 2V4DA 3CC2A 4A3GB 3DM1A 1YIJA 1WTWA 2F4IA 1A2TA 1AP0A 4GLVB 4JYAQ 2SNMA 1XNRQ 2MFIA 5CR3A 4RCNA 5KYLA 1Z6HA 4C3JB 1DONA 1SNDA 2LKVA 3Q6SA 1M1KC 5C4XH 1KRSA 1Y1VH 2EYJA 4RFBA 4AYBE 5FJ8H 4DK0A 2UUBL 1RODA 2MNAA 1XMOQ 4IOAA 3S1RB 1D5XC 1PFBA 2QCPX 4X3TA 4A3LG 4A93B 1EOTA 3HOVH 1PTOF 3J81L 1ILPA 1N32L 2K33A 3CHBD 1PH4A 4JI4Q 2IHFA 1RHPA 2B63G 4B9XA 1DOMA 4JI1L 3F1ZA 5EJWA 3HOYH 3HOZG 3CAMA 4YCWA 5L37A 1Q1BA 1N33Q 3DXJC 2DUDA 2B39A 3TMEA 4DV1L 4LF8L 1KIXA 2EYLA 1GKHA 1KTKA 3LWUA 1I4PA 2JA8G 3SVMA 1PRTF 1WI5A 4DGZA 3IAYA 4OWTB 3K57A 3PIO3 2MP1A 1J6QA 4BBSG 1TY2A 4WJWA 4FP5D 5M3MH 4DV6Q 3KF8B 2K5WA 3KYHC 4CHTB 4FXDA 3AEVA 3L2PA 4IUQA 4IPHA 4ME3A 3TZUA 3P1HA 1SEBD 2JQOA 4J15A 4DNRB 3QO2A 1BF4A 1LT3D 3S1NH 1X55A 4DUZL 1Z7TA 4A4IA 2KBNA 5IIFA 3KBGA 1SMYD 1TVXA 2SNSA 5JJIA 2D2CC 1A3VA 2M00A 4LF7L 1EIHA 4NW2A 3BYYB 4KTAA 1JMCA 3T53B 1KQSA 4HR7B 3STBD 4NDXA 1SN8A 2E2IH 4IPDA 3VR2A 4IFDJ 1I3QB 1VQNA 1WFQA 3S1NB 4B3MQ 2PZWA 4KY7A 5E3FA 4DFAA 3I4NG 3AU7A 1GVPA 1UAPA 2I5LX 4I7ZC 1MSGA 1TQOA 1E1TA 3MXPA 5CV7A 5LMUQ 4JYAL 1XNRL 3U4ZA 4DV0Q 1L1OA 3PGZA 3A7LA 1H9RA 5IYDG 3FMCA 3Q8DA 1YJWA 2KHSA 3NHHA 4C2MH 1XMOL 3KUPA 3E3XA 2O2LD 4PMWA 3GDEA 1CKNB 2KCMA 3PIPA 1SNOA 1EYGA 1Y8NB 2K75A 5FO8B 1GUGA 3D4WA 4JI4L 4I65A 3U58A 4A3IH 2KCCA 2A6ED 4F88A 1VQIA 4BY1H 2FHTA 3H3VI 1HR0Q 1YBYA 4DF7A 1IHZA 3IFTA 3NTIA 4JBJA 5ELDA 3CW2C 5E4XA 1Q82C 1RKNA 3SK4A 1N33L 3PO2G 2A1AA 2CW0D 1UE6A 5IYBH 5TSSA 2JK8A 3RUZA 2KENA 4L5QA 4UP7A 1STEA 4JBKA 3NWSA 3DEPA 2CCZA 2NVYH 2NVTH 1DGSA 1HTLD 2EYFA 4B3RQ 2R93H 4KJNA 1VQFA 2BH8A 3PO3G 1VS0A 1SYEA 4DV6L 2L4NA 4LFCQ 5I9OA 1SJHD 1XNQQ 5FK9C 1BOSA 2F0QA 3MAQA 4HJ5A 1ASZA 3HFZB 5H1SE 1WTHA 1RIPA 2K50A 2RQXA 4UAIA 1JQYD 2MO1A 1E1OA 5FLXc 4A3BH 1DD2A 1SYBA 2F03A 3VYUA 4OO1G 2JJQA 3H6MA 2NVTB 1Q3LA 3GTQH 5IWAQ 4DV7Q 3BZKA 3MZ5A 1QB5D 3AQQA 4A3KG 3FKIH 4JI6Q 3H3VC 5C44B 1BCPB 4GN3B 1BO0A 2ZJQA 5BN5A 5JJZA 2ENBA 1VQJA 4JPBW 3F2CA 4B3ML 4A3BB 1I50B 3F2UA 1E0BA 1A62A 1NSNS 4A3FH 2B2VC 2EY1A 4UP9A 3GTQB 1KL9A 5CV9A 5CMDA 5LMUL 1RDPD 1ICFB 4DV0L 1PTOD 3QWNA 5A2QL 3A55A 4OWXB 3ER0A 4DNIA 1PZJD 3QIAA 4CBVA 4G7OC 2UU9Q 3T4AC 5JPNC 1K3RA 2XNAC 4JI8Q 4QQBX 1G51A 4YCVA 5ELFA 1TWGH 5JEAG 5D3DA 4KHZA 4A3CG 3X3MA 4A3FB 1DZ1A 1PH7A 3CD6A 4A3MG 1TR5A 3S17H 3K0YA 1O7LA 1JE5A 2D0OA 3PSIA 5JOBA 1EIFA 4GOPB 1PRTD 4JG2A 4C3IG 3KF6B 3NPPA 1EQVA 2E74C 5C0XG 1CSQA 3TN2A 1HR0L 1NAPA 2J0TD 2BA0A 5LMNQ 2K5NA 4MN3A 3H09A 3BYTB 3NBIA 3RZDH 1YHQA 1ET9A 1OXSC 3JAMi 4YWMA 1JORA 5M3FH 4B3RL 3S17B 3UE1A 2HDLA 4KHPQ 1R4PB 1O7ZA 1EOVA 4LFCL 1E2ZA 1XNQL 2WAQE 1HXYD 3SK8A 1BBWA 2B2UA 5T1IA 1IKMA 1C9OA 3S1QB 2QKIC 3K5NA 3U9OA 1SE8A 1B3AA 1EYAA 2IJ0A 4DA2A 5J22A 3H0GH 3HOZB 5IWAL 3AFPA 4S3SA 4DV7L 4DK3C 1Z9FA 2VXWA 4HSPA 4R8IA 4HMIA 1KLGD 2ZTEA 3SR1A 3NUCA 3OHXC 2EY2A 5EBDA 1B70B 4IPCA 4HJ7A 2JA8B 3I2ZA 3I72A 4RH6A 3QOLA 3M7GA 2A74C 3I4OA 2ZJPA 2J7ZA 4KHVA 1LTRD 3M4PA 5FO7B 3KJOA 4B9WA 2YU9H 1WTRA 3P75A 1CQVA 3PUWA 1KDCA 2YTVA 2ZXOA 1YZ6A 1IL8A 3FDTA 2HCIA 3CCUA 3PV0A 1ESFA 1J5EQ 3B6YA 4DAMA 1X3FA 4PV1C 3SE0A 1ENFA 4RHRA 2UU9L 1S5FD 4L6TB 5M5YB 1JB7A 2NVQB 2AQ2B 5AFWA 4A3EG 2OCEA 4JI8L 1S72A 1J8IA 1M4VA 1ICWA 4YCUA 1CKMA 2YU9B 3KOJA 1TU2B 4Y52H 3TP8A 3J7YW 2AHOB 3UDGA 1HFNA 5IT9L 5CV4A 4L63B 2BOSA 1X56A 1MGSA 2DGYA 4QUFA 1EWIA 4IALA 2NTSA 3N52A 4K2KA 4QL5A 5G3LF 4HIKA 2HQLA 4KD4A 1BUVT 1JR0D 1K0SA 3TP6A 4XXEA 1EEFD 3I4NB 3S1MH 1ZYRC 3I4MH 5LMNL 3CCQA 2JA6H 4KJOA 4KI0A 1EQRA 3RD4A 4C3HG 4DR5Q 1STNA 1G6PA 2K5DA 4CGYB 3HKZG 1QCBD 2RA4A 2Z8LA 5F2DA 3DWQA 1UE1A 2Y0SB 4I7AA 4DR6Q 3T51B 1BCPC 1V1OA 1EUJA 3BZDB 1O80A 3MVVA 5C3EG 4ALPA 1BBXC 3BVZA 4JV5Q 1I94Q 4HEDA 3RMHA 5M9OA 1QWYA 3GV3A 1KAWA 1ZKOA 3NELA 3OMCA 1N9WA 2UXCQ 2JSOA 4LFAQ 3NK9A 1NMGA 5C5LA 2JA6B 3SEBA 1KAAA 4UPAA 4GOPA 1CKOA 4DUYL 3CMEA 3H94A 4LUOA 4XQQA 1BBUA 3O13A 4ZLTF 1YVCA 1SROA 5K5PA 1HFGA 2PI2A 2XRSD 2R3ZA 4C1NI 2YTXA 2JXMB 1NTGA 3I3CA 3ONAB 5IGEA 1IYUA 1IW7D 1STBA 4DK6C 3PO2B 1CFMA 5IGCA 4LJZC 1K28A 3V05A 3NSWA 3TREA 3AFQA 2AKWB 1KD1C 1DOKA 3TBIB 1UUPA 3PO3B 4FYDA 1PLFA 1Q86C 4KN7C 4GOPC 1XPRA 2PNRC 2Z4IA 3OW7A 3TEHB 2JA9A 1SDFA 1PYBA 4HCEA 4IUPA 3BS1A 1J5EL 3JAMc 4HIDA 4RG1A 4HJ8A 4L5SA 1V1PA 1LUZA 3RR5A 2JEAI 4BXXH 1O7IA 1YNND 2GN5A 3ZYYX 2NYZD 1NR2A 1STGA 3HOUH 4NPSA 4UHVA 4HTHA 1SYFA 2EYPA 1XX8A 4DV2Q 1F9RA 3LX0A 5LL6S 3KJPA 3K81C 2Q2TA 4G57A 2BA1A 4ZKBB 5CBAE 1EWHA 1TWHB 1WD1A 5C4ZA 1WJJA 2OF1A 2A6HD 2XRQD 2L9HA 3C2PA 2IX3A 2OT2A 3W2DA 3S2DH 3GTKH 2QDLA 4KKSA 4DR5L 1W3SA 2BE5C 3OIPA 5J3BA 3P7JA 4POFA 5IGGA 3CCLA 2F52A 3AB9A 4ODGA 5JJKA 1N32Q 4ABNA 3PF5A 2N55A 1GUTA 3L9AX 2WP8J 1EIYB 1SAPA 4JV5L 1SYDA 1X3PA 4GS3A 4XYQA 3ITPA 1A6XA 4X3SA 1HA6A 4H7BA 1I6HB 2K5HA 2UXCL 4IO9A 3LWEA 4LFAL 1IBKQ 1XTDA 5IE8A 4A3MB 2EQSA 3A8JE 1LT5D 2HIVA 2O5IC 1CHQD 4C3IB 2RKSA 1QG7A 3URYA 2ZXRA 4BY7H 1RL2A 2ICEC 5EPLA 2ZJRA 3C46A 4G7HC 4CDDC 1PFNA 1TWCH 1M90C 4X64Q 1D8LA 3CRLC 3D6WA 3C3LA 4PG3A 3GV6A 1P16A 3ICEA 2KEEA 4A3DH 2IL8A 1L1OB 3KLWA 3I70A 4WRDA 2RDHA 3FHWA 5JPMC 2B3GA 4A3GH 2KJXA 1AFPA 1DXMA 4BY7B 2R61A 1Z47A 1X65A 3UDFA 5IP7G 3I55A 3BG3A 4P72A 1WTXA 1HUNA 1R9TB 1VQKA 4FDBA 3T56B 1HA5A 2EYHA 4XTCS 2CKZB 4C3JH 1YITA 2L1BA 4AYBG 1A2UA 4RWSC 3G7LA 5G3LD 4ID6A 3M4OH 1S5CD 4DAYA 4LFBQ 2K14A 3HKSA 2FMCA 3EFXD 3S16B 1ML0D 2JN4A 2NUCA 1H9JA 4POGA 3SDZA 1NE3A 1TWFB 2PNHA 5EAYA 5KIXA 4B3SQ 4FO2A 5FLMG 2QGQA 1LTBD 1WTPA 1HPCA 1GOZA 4DV2L 2PCFB 5C4JB 4LK1C 4OO1I 4DV4Q 5GAHC 1IL2A 4K6DA 1D1KA 1HNZQ 3MEHA 2UXBQ 1E7ZA 4A3JG 1WD0A 1VQHA 3M4OB 2K05A 2VW9A 2PZTA 2LS01 2YYZA 3PUYA 4N8FA 4DR1Q 2MUYA 1STYA 4RA8A 3K5MA 4HSVA 4FF3A 2KCNA 3GTJB 1E3PA 1EYCA 4YWLA 1PFMA 1GUNA 3KLSA 4OGQC 2EJMA 1B2TA 1F2YA 2MJ8A 3CQZB 3RZOH 4LNQA 1XYIA 1K9MC 1OTCA 1SR3A 1IBKL 5KGUA 2LFNA 2C5CA 1DCZA 1SE3A 4ZUJA 2EY6A 2K28A 1PH2A 1VQDA 5FO9B 2F0LA 1F9PA 1FVIA 1SLJA 2XVSA 4FF4A 5J1ZA 1FJGQ 5GROA 4X64L 1LT4D 3RZOB 1JCKB 3T1YQ 5KNCA 3OWEB 3A7AB 2D0PA 5C0XI 1I3QH 4IJHA 2NN6G 5C3EB 2C9OA 1E24A 2Q8IB 2WKCA 3MFYA 3JAME 4BBRH 1CTMA 2E5LQ 2LY7A 3NBHA 1AZPA 5GAGC 2JA5G 5JVH3 4R9WA 2OTLA 2DJFC 3SXHA 2JEBI 1EZ6A 1CSPA 3J80L 3CC7A 3UDIA 1EZ8A 2RCFA 1SNCA 2E75C 3S2HB 1TS4A 4HN7A 3DWPA 4ZCKA 4LFBL 2B2YA 4K8JA 4DK1A 1F2LA 1X6OA 2KQ3A 1FNUA 3A8KE 1TS2A 3A56A 1QILA 4B3SL 4RMFA 2NZHA 4P73A 1N34Q 3RLOA 4BBRB 3DWAA 1B7YB 1NY4A 1J9OA 2NTTA 4DV4L 2PPBC 3JC66 1B50A 1NUCA 1HNZL 4RKLA 2UXBL 1K8AC 2OTJA 4XQJA 4NXML 1MHWC 1UE7A 4J6HA 3SHLA 4R1JA 4X62Q 2EYMA 2WIIB 3ULPA 1JOQA 2BH2A 2B2TA 4K8IA 1SMYC 5I6WA 4DR1L 1D7QA 3VR4A 5KYIA 1K73C 4QB4A 4RKBA 1L1OC 3STBC 2OQKA 2F0EA 2NVXH 1NMFA 4GKKQ 2YV5A 1FR3A 1K3BC 3PCOB 2UUCQ 1A3UA 2N88A 2EOTA 2WV6D 2NWGA 1WCMG 3J7AV 1HUMA 1BCPF 2E8GA 1X3GA 2K5QA 2XWBB 1C48A 1KNEA 2CVRA 5ELCA 3VA5A 1F9SA 1FNWA 4PQXA 3VR3A 4JVZA 3DMUA 1FJGL 3G6JB 5IGBA 2K01A 1EY6A 3CU7A 2Y0SE 2NVXB 3T1YL 2A69D 4J8QA 5C44H 4OEMB 4LF6Q 5IY0A 1HQRD 1JJGA 3PQIA 4QF4A 3CCMA 3K0XA 4OONA 1CK1A 1I50H 4NKLA 3HOWG 2XWJB 5CYUA 2A6EC 2EDGA 3NWTA 4EQ5A 1C0AA 1K8GA 2E5LL 2XSCA 3D31A 2F1MA 4L8JA 3HOXG 5IYCH 4MIUA 1S5DD 2FMMA 2CW0C 2OXPA 1PZID 5I9PA 4KLKA 1BNZA 1JC7A 4ZK9B 2ZM6Q 5HGTA 1DM0B 4Q5VA
chains in the Genus database with same CATH topology
1Y1WG 2EIFA 4JI3L 2R7ZH 1S3OA 4JI0Q 1N34L 4DR6L 2N78A 3CCEA 1X56A 1MJCA 2DGYA 4APVA 5HGQA 4YHHQ 1Q46A 1EWIA 4QL5A 4DR4Q 3H0GG 4X66L 4JI1Q 4HIKA 1I94L 1SFOH 2HQLA 4NB3A 3F2BA 3H15A 3UDXA 3G6EA 2R92H 3S1MH 3PUXA 1XMQQ 1WYDA 4DV1Q 3I4MH 4LF8Q 5LMNL 1BVSA 4Y7NH 3CCQA 2JA6H 4X62L 4KI0A 1EQRA 1K83H 2E2HH 5C44G 4DR5Q 2AWNA 4LW1A 1G6PA 1QVCA 2VUMG 1YHAA 2LXJA 3HKZG 2Q2IA 3PUZA 2UXDL 3CCRA 1UE1A 4A3BG 4O0AA 4DR6Q 3CCVA 1V1QA 4DV5Q 1EUJA 5C3EG 4ALPA 1GM5A 2K5VA 4DR7L 4EX5A 4JV5Q 4JI7Q 2GVBA 2V1CC 3CF5A 1I94Q 1IYJB 1GD7A 4OX9L 4AH6A 1YJ9A 4A3LH 2MQHA 1PVOA 1KAWA 2Q2HA 3NELA 4O2DA 1N9WA 5IYCG 2UXCQ 4LFAQ 3EIVA 1XPOA 4GKKL 3UE0A 3J7A5 1NMGA 4X65Q 2HIXA 1IBLL 2UUCL 3S1QH 3CXCA 1A8VA 4UPAA 4GOPA 4DUZQ 1CKOA 1L2FA 2RF4A 1Y14B 5IP9H 4LUOA 3CMEA 4DUYL 4X6AH 1BBUA 1VQMA 1YVCA 1SROA 5ELOA 2B63H 2LXKA 4GNXB 2UXDQ 2GVAA 2PI2A 4QGUA 3KFUA 4P75A 4P74A 1PH1A 2R6GA 2YTXA 1XPUA 1Q81C 3HOZH 1NTGA 3E9IA 3W1BA 4A3FG 4DK6C 5IT9c 4TQUS 2R7ZG 3VDYA 4LF7Q 2Y0SG 5GQOA 2D62A 3TREA 4HIOA 3E9HA 3PF4A 3AFQA 1LYLA 5GADC 1QVFA 1LM0A 1SRUA 5JJLA 1HH2P 2RHQB 1K0RA 3GD7A 3J80c 4GNXA 3RN5A 2AKWB 2UUAL 1KD1C 3E0EA 1VQLA 2JA8H 3S1RH 1YI2A 3J81j 4LF6L 2R92G 1Q1EA 4A93H 2IX1A 4BBSH 2ES2A 4IJLA 1QZHA 1Q86C 3CC2A 3CC4A 4JI2L 4GOPC 1XPRA 3I4MG 4LWCA 4DUYQ 1YIJA 3RN2A 2PMZE 2JA6G 2CWPA 1VQ9A 4GLVB 3TEHB 2JA9A 4JYAQ 1PYBA 4GKJQ 1XNRQ 2MFIA 3RLNA 2A8VA 4MTNA 1J5EL 3JAMc 1L0WA 2QA4A 2WB1G 4HIDA 4RG1A 4HJ8A 4A75A 4L5SA 2K4KA 4IFDI 1S40A 5C4XH 1M1KC 1KRSA 1Y1VH 4DV3Q 1LUZA 4AYBE 5FJ8H 3RR5A 3U50C 2JEAI 2UUBL 4BXXH 5M5YH 2MNAA 1XMOQ 2NVQH 4IOAA 2H5XA 2IHEA 1O7IA 2GN5A 1YNXA 4A3LG 4IPGA 5K36G 2ZM6L 1B8AA 3K8AA 3OW2A 3HOVH 1VQ6A 2Z0SA 1NBWA 2LSSA 1VCIA 1VQ4A 3HOUH 1N32L 4NPSA 1N8RC 1PH4A 4JI0L 4JI4Q 1HJPA 2IHFA 4DV2Q 3I7FA 4YY3Q 4HJAA 4YHHL 3KJPA 4DR2Q 2B63G 2MO0A 4DR4L 1X3EA 4JI1L 3F1ZA 1HZAA 3K81C 3HOYH 2Q2TA 3HOZG 1UWVA 2BA1A 2FXQA 3CAMA 4YCWA 1X9NA 1H95A 1Q1BA 1N33Q 3TRZA 1WJJA 2DUDA 2L15A 3CCJA 3I4NH 4DV1L 4LF8L 1KIXA 2OQ0A 1GKHA 3S15H 2A19A 3J81i 4LF9Q 5IP7H 3GTKH 1PH5A 2JA8G 4DR5L 1C7YA 1W3SA 5J3BA 1WI5A 4POFA 3CCLA 2F52A 4OWTB 5JJKA 3DM3A 4A93G 4IFDG 4GN4B 1J6QA 4BBSG 1N32Q 1AE3A 3PF5A 2N49A 2R7FA 1HR0W 5M3MH 4DV6Q 1MIUA 5IYDH 3KF8B 4DV5L 2WP8J 3KYHC 4GN5A 1KHIA 3CMAA 1KC8C 1P8LA 1EIYB 4JCVE 3L2PA 3AEVA 4JV5L 1Q8KA 4JI7L 4GS3A 4IPHA 4ME3A 2EXDA 3M7NA 5ELNA 3TS2A 1OXUA 2K5HA 3GTGH 2JQOA 4J15A 2UXCL 3EN2A 4IO9A 4GLXA 4LFAL 1IBKQ 1PA6A 3WWVA 5C4XG 1XTDA 1Y1VG 5IE8A 4HIMA 2EQSA 4X65L 3S1NH 5BR8Q 2HIVA 5FJ8G 2B29A 1BKBA 1X55A 5FLMH 4BXXG 3PUVA 4DUZL 4MNOA 2K52A 2KHJA 4A4IA 2KBNA 2ASBA 4BY7H 3CPWA 1RL2A 2ZJRA 1Q7YC 3PIOA 3HOVG 1TWCH 1M90C 3HOUG 2OWOA 4A3JH 4X64Q 3OTOQ 2WAQG 5JJIA 3PO2H 3MXNB 4LF7L 1D8LA 3A0JA 4HJ9A 4K0KQ 4PG3A 2RHSB 1P16A 1KQSA 1JMCA 3KDFB 3STBD 3ICEA 2Q2UA 1E22A 2XTIA 1SN8A 2AMCB 4IPDA 5DLQE 4DR3Q 1T9HA 2E2IH 4B3TQ 3GTLH 3HOYG 1VQNA 4IFDJ 1WFQA 1VQ8A 4A3DH 3BU2A 1L1OB 3KLWA 4B3MQ 3FHWA 4LUZA 3I4NG 4WJ4A 2B3GA 3PO3H 3ULLA 1GVPA 4A3GH 2I5LX 2I5MX 2HHHQ 3CPFA 1E1TA 4R4TA 1Z47A 1X65A 2F3IA 3UDFA 5IP7G 3I55A 5LMUQ 4JYAL 4P72A 4DAYB 4GKJL 4L5TA 4YWKA 2C35B 1XNRL 1VQKA 3U4ZA 2R7DA 3M85A 4DV0Q 4FDBA 3GTOH 1KXLA 1L1OA 3PGZA 4XTCS 1UEBA 2CKZB 4JI5Q 4BA2I 4C3JH 1YITA 1VQBA 2QEXA 5M3MG 5HY6A 1XJVA 5IYDG 4AYBG 1V43A 3Q8DA 1YJWA 4DV3L 1NJIC 2E2JH 1YHBA 4C2MH 3M4OH 1XMOL 3MEFA 4LFBQ 2K14A 4L5RC 4PMWA 1IBMQ 1I5FA 3HKSA 3A5UA 3GDEA 1VQOA 1CKNB 2KCMA 3PIPA 1N36Q 3S2DH 4POGA 1X54A 1NE3A 2PNHA 2K75A 5EAYA 1PH3A 1EYGA 3RNUA 4B3SQ 4JOIA 5FLMG 2QGQA 2F4VQ 3J7ZC 1IXRA 1FGUA 4JI4L 2VL6A 3U58A 4A3KH 4DV2L 4A3IH 4JBWA 4PZ8A 1VQEA 4YY3L 3U4VA 4OO1I 4DV4Q 5GAHC 2ALYB 1IL2A 4DR2L 1EFWA 4BY7G 1PFSA 1VQIA 1CKNA 1HNZQ 1AH9A 2UXBQ 2VS1A 4BY1H 3H3VI 2VNUD 1HR0Q 1YBYA 1E7ZA 4JBJA 4A3JG 1Q82C 1VQGA 1VQHA 3CW2C 4LUVA 4QIWE 1TWHH 1PH8A 1N33L 2A1AA 3PO2G 2JA7H 3GTMH 3S24A 1UE6A 5IYBH 4MZ9A 2VW9A 2JK8A 4TVAB 4GNXC 1VQPA 4QY7A 2KENA 4L5QA 2I5HA 4IOCA 4UP7A 4LF9L 2KCTA 2YYZA 4PZ7A 4JBKA 4A3DG 3PUYA 2CCZA 2NVYH 2JA5H 3CP0A 1DGSA 1IZ6A 4DR1Q 3ERSX 2NVTH 4B3RQ 2R93H 1VQFA 2BH8A 2NN6I 2VQEQ 3M4QA 4JOIC 4OWWB 3PO3G 5IP9G 4A3GG 3D0FA 1VS0A 2IT1A 4DV6L 1E3PA 4YWLA 5LMNW 4LFCQ 3UDGA 1XNQQ 4JI6L 4XIGS 3RZOH 4LNQA 3ZJYC 1FL0A 4LF5Q 4HJ5A 1I6HH 1ASZA 1K9MC 3HFZB 5H1SE 1OTCA 1SR3A 4A3CH 1RIPA 2K50A 3CCSA 3T1HQ 1IBKL 2CWAA 2MO1A 4PZ6A 1E1OA 5FLXc 4A3MH 2KHIA 1JJ2A 4A3BH 5BR8L 1HNXQ 5M5WH 4UP8A 4OO1G 2JJQA 4LF4Q 4DKAC 1PH2A 1VQ5A 4C3IH 5IWAQ 1VQDA 1PH9A 3GTQH 3NENA 4DV7Q 4R4CA 1OXTA 3G71A 4BA1I 1FVIA 1SLJA 3BZKA 3AQQA 1FJGQ 5GROA 4X64L 3OTOL 1AE2A 3BJUA 3W1GA 2WB1E 4A3IG 3FKIH 4A3KG 4K0KL 1PV4A 4JI6Q 5E7NA 2PQAB 3A5ZB 5AJ3Q 3T1YQ 4DPGA 4QJFA 4GN3B 2YTYA 2ZJQA 4DR3L 3NBHB 1TXYA 2D0PA 2RCNA 4BY1G 4B3TL 3K7AH 3GTPH 1LTLA 1VQJA 3F2CA 5C0XI 1I3QH 4IJHA 4B3ML 2NN6G 1QZGA 1A62A 2Z6KA 2IX0A 5IYBG 4A3FH 3M9BA 1E24A 1HZBA 4UP9A 2HHHL 2CQOA 2PQAA 1G291 1KL9A 4JC0A 5LMUL 4BBRH 3J81c 1W2BA 2E5LQ 1Q12A 5GAGC 4DV0L 1R9TH 2JA5G 2OTLA 2R93G 3GO5A 2JEBI 4OWXB 3ER0A 4JI5L 4DNIA 1CSPA 3CC7A 3UDIA 3DLLA 2UU9Q 1VQ7A 3AYHB 1K3RA 1WCMH 4QQBX 4JI8Q 4GLAC 1G51A 4YCVA 4LFBL 1IBML 2N8NA 1TWGH 3G48A 1X6OA 3IRBA 5JEAG 1ASYA 4KHZA 1A63A 4A3CG 1YEZA 4AQYQ 3S16H 1N36L 2Z6KC 2VY3A 1PH7A 3SGIA 4B3SL 3CD6A 4RMFA 4A3MG 4JI3Q 3S14H 1TWFH 2NZOA 2NZHA 4P73A 3RLOA 1N34Q 1YJNA 1HZCA 2F4VL 3S17H 4KHPL 3KDFA 1PH6A 1B7YB 1JE5A 2D0OA 3PSIA 4GOPB 1EIFA 1NY4A 4JG2A 3J80i 5C4JH 4X66Q 4DV4L 3JC66 3KF6B 2IY5B 1VQCA 1HNZL 2UXBL 1K8AC 3OYYA 1CSQA 5C0XG 2OTJA 4NXML 1HR0L 2HT1A 1VQAA 2VQFL 1UE7A 2BA0A 5LMNQ 3FKIG 4R1JA 3HOWH 3TS0A 2K5NA 1A0IA 4X62Q 3RZDH 1YHQA 3ULPA 1OXSC 2BH2A 3KF6A 1QUQB 1QVGA 3H3VH 3JAMi 4YWMA 5M3FH 1KRTA 2ATWA 3HOXH 3M3YH 4DR1L 4B3RL 3UE1A 4NXNL 3HKZE 2VQEL 4KHPQ 1UE5A 1D7QA 1U5KA 2ID0A 2ZTCA 4DR7Q 1HZ9A 3GTJH 1K73C 1EOVA 4LFCL 5M5XH 1XNQL 4BBRG 4A3EH 3F2DA 2WAQE 1L1OC 3L0OA 3STBC 1QUQA 5JEAJ 2OQKA 4OX9Q 3F8TA 1BBWA 2NVXH 3CQZH 1NMFA 4NXMQ 1JJCB 1WOCA 4LF5L 2VQFQ 2YV5A 4GKKQ 1C9OA 1HNWL 3PCOB 3T1HL 1IBLQ 2UUCQ 1SMXA 1Y1WH 1SE8A 1WCMG 1HNXL 3G4SA 3W5OA 4AIMA 1V9PA 3BZCA 2E8GA 4LF4L 1OXVA 1X3GA 3K7UC 3K80C 4P71A 1GO3E 3H0GH 5IWAL 3AFPA 5C0XJ 1OXXK 4NXNQ 4DV7L 4DK3C 1Z9FA 4R4IA 3I56A 3ULJA 1U0LA 2ZTEA 4R4QA 1FJGL 3FP9A 1EQQA 2VZAA 2ZTDA 1B70B 4IPCA 1MJEA 4HJ7A 2Y0SE 3LGJA 4OXPA 2XGTA 4R4OA 5AJ3L 3T1YL 3I2ZA 4C3HH 5C44H 5GAEC 2UUAQ 1HNWQ 4LF6Q 5IY0A 3I4OA 2VUMH 1JJGA 2ZJPA 1CUKA 2N3SA 3CCMA 4JI2Q 3M4PA 3K0XA 4OONA 3KJOA 2YU9H 1I50H 2PI2E 3HOWG 3EBEA 5C3EH 3PUWA 2YTVA 4EQ5A 1YZ6A 1C0AA 1K8GA 1PYSB 2E5LL 3CCUA 5M3FG 4H02A 3PV0A 3D31A 1JT8A 3RLFA 1J5EQ 3HOXG 2I0QA 5IYCH 3B6YA 1MKHA 2WFWA 2AHOB 4DAMA 1X3FA 1PHJA 3L7ZC 4A76A 2UU9L 2CFMA 1XMQL 1JB7A 2UUBQ 4A3EG 2OCEA 3S2HH 4KLKA 4JI8L 3A74A 1S72A 3NEMA 3TQYA 2ZM6Q 4YCUA 1CKMA 4JBMA 2JE6I 3KOJA 4Y52H 4UY8C 4WJ3M 4AQYL 1TWAH 2JA7G 2AWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W G;  2EIF A;  4JI3 L;  2R7Z H;  1S3O A;  4JI0 Q;  1N34 L;  4DR6 L;  2N78 A;  3CCE A;  1X56 A;  1MJC A;  2DGY A;  4APV A;  5HGQ A;  4YHH Q;  1Q46 A;  1EWI A;  4QL5 A;  4DR4 Q;  3H0G G;  4X66 L;  4JI1 Q;  4HIK A;  1I94 L;  1SFO H;  2HQL A;  4NB3 A;  3F2B A;  3H15 A;  3UDX A;  3G6E A;  2R92 H;  3S1M H;  3PUX A;  1XMQ Q;  1WYD A;  4DV1 Q;  3I4M H;  4LF8 Q;  5LMN L;  1BVS A;  4Y7N H;  3CCQ A;  2JA6 H;  4X62 L;  4KI0 A;  1EQR A;  1K83 H;  2E2H H;  5C44 G;  4DR5 Q;  2AWN A;  4LW1 A;  1G6P A;  1QVC A;  2VUM G;  1YHA A;  2LXJ A;  3HKZ G;  2Q2I A;  3PUZ A;  2UXD L;  3CCR A;  1UE1 A;  4A3B G;  4O0A A;  4DR6 Q;  3CCV A;  1V1Q A;  4DV5 Q;  1EUJ A;  5C3E G;  4ALP A;  1GM5 A;  2K5V A;  4DR7 L;  4EX5 A;  4JV5 Q;  4JI7 Q;  2GVB A;  2V1C C;  3CF5 A;  1I94 Q;  1IYJ B;  1GD7 A;  4OX9 L;  4AH6 A;  1YJ9 A;  4A3L H;  2MQH A;  1PVO A;  1KAW A;  2Q2H A;  3NEL A;  4O2D A;  1N9W A;  5IYC G;  2UXC Q;  4LFA Q;  3EIV A;  1XPO A;  4GKK L;  3UE0 A;  3J7A 5;  1NMG A;  4X65 Q;  2HIX A;  1IBL L;  2UUC L;  3S1Q H;  3CXC A;  1A8V A;  4UPA A;  4GOP A;  4DUZ Q;  1CKO A;  1L2F A;  2RF4 A;  1Y14 B;  5IP9 H;  4LUO A;  3CME A;  4DUY L;  4X6A H;  1BBU A;  1VQM A;  1YVC A;  1SRO A;  5ELO A;  2B63 H;  2LXK A;  4GNX B;  2UXD Q;  2GVA A;  2PI2 A;  4QGU A;  3KFU A;  4P75 A;  4P74 A;  1PH1 A;  2R6G A;  2YTX A;  1XPU A;  1Q81 C;  3HOZ H;  1NTG A;  3E9I A;  3W1B A;  4A3F G;  4DK6 C;  5IT9 c;  4TQU S;  2R7Z G;  3VDY A;  4LF7 Q;  2Y0S G;  5GQO A;  2D62 A;  3TRE A;  4HIO A;  3E9H A;  3PF4 A;  3AFQ A;  1LYL A;  5GAD C;  1QVF A;  1LM0 A;  1SRU A;  5JJL A;  1HH2 P;  2RHQ B;  1K0R A;  3GD7 A;  3J80 c;  4GNX A;  3RN5 A;  2AKW B;  2UUA L;  1KD1 C;  3E0E A;  1VQL A;  2JA8 H;  3S1R H;  1YI2 A;  3J81 j;  4LF6 L;  2R92 G;  1Q1E A;  4A93 H;  2IX1 A;  4BBS H;  2ES2 A;  4IJL A;  1QZH A;  1Q86 C;  3CC2 A;  3CC4 A;  4JI2 L;  4GOP C;  1XPR A;  3I4M G;  4LWC A;  4DUY Q;  1YIJ A;  3RN2 A;  2PMZ E;  2JA6 G;  2CWP A;  1VQ9 A;  4GLV B;  3TEH B;  2JA9 A;  4JYA Q;  1PYB A;  4GKJ Q;  1XNR Q;  2MFI A;  3RLN A;  2A8V A;  4MTN A;  1J5E L;  3JAM c;  1L0W A;  2QA4 A;  2WB1 G;  4HID A;  4RG1 A;  4HJ8 A;  4A75 A;  4L5S A;  2K4K A;  4IFD I;  1S40 A;  5C4X H;  1M1K C;  1KRS A;  1Y1V H;  4DV3 Q;  1LUZ A;  4AYB E;  5FJ8 H;  3RR5 A;  3U50 C;  2JEA I;  2UUB L;  4BXX H;  5M5Y H;  2MNA A;  1XMO Q;  2NVQ H;  4IOA A;  2H5X A;  2IHE A;  1O7I A;  2GN5 A;  1YNX A;  4A3L G;  4IPG A;  5K36 G;  2ZM6 L;  1B8A A;  3K8A A;  3OW2 A;  3HOV H;  1VQ6 A;  2Z0S A;  1NBW A;  2LSS A;  1VCI A;  1VQ4 A;  3HOU H;  1N32 L;  4NPS A;  1N8R C;  1PH4 A;  4JI0 L;  4JI4 Q;  1HJP A;  2IHF A;  4DV2 Q;  3I7F A;  4YY3 Q;  4HJA A;  4YHH L;  3KJP A;  4DR2 Q;  2B63 G;  2MO0 A;  4DR4 L;  1X3E A;  4JI1 L;  3F1Z A;  1HZA A;  3K81 C;  3HOY H;  2Q2T A;  3HOZ G;  1UWV A;  2BA1 A;  2FXQ A;  3CAM A;  4YCW A;  1X9N A;  1H95 A;  1Q1B A;  1N33 Q;  3TRZ A;  1WJJ A;  2DUD A;  2L15 A;  3CCJ A;  3I4N H;  4DV1 L;  4LF8 L;  1KIX A;  2OQ0 A;  1GKH A;  3S15 H;  2A19 A;  3J81 i;  4LF9 Q;  5IP7 H;  3GTK H;  1PH5 A;  2JA8 G;  4DR5 L;  1C7Y A;  1W3S A;  5J3B A;  1WI5 A;  4POF A;  3CCL A;  2F52 A;  4OWT B;  5JJK A;  3DM3 A;  4A93 G;  4IFD G;  4GN4 B;  1J6Q A;  4BBS G;  1N32 Q;  1AE3 A;  3PF5 A;  2N49 A;  2R7F A;  1HR0 W;  5M3M H;  4DV6 Q;  1MIU A;  5IYD H;  3KF8 B;  4DV5 L;  2WP8 J;  3KYH C;  4GN5 A;  1KHI A;  3CMA A;  1KC8 C;  1P8L A;  1EIY B;  4JCV E;  3L2P A;  3AEV A;  4JV5 L;  1Q8K A;  4JI7 L;  4GS3 A;  4IPH A;  4ME3 A;  2EXD A;  3M7N A;  5ELN A;  3TS2 A;  1OXU A;  2K5H A;  3GTG H;  2JQO A;  4J15 A;  2UXC L;  3EN2 A;  4IO9 A;  4GLX A;  4LFA L;  1IBK Q;  1PA6 A;  3WWV A;  5C4X G;  1XTD A;  1Y1V G;  5IE8 A;  4HIM A;  2EQS A;  4X65 L;  3S1N H;  5BR8 Q;  2HIV A;  5FJ8 G;  2B29 A;  1BKB A;  1X55 A;  5FLM H;  4BXX G;  3PUV A;  4DUZ L;  4MNO A;  2K52 A;  2KHJ A;  4A4I A;  2KBN A;  2ASB A;  4BY7 H;  3CPW A;  1RL2 A;  2ZJR A;  1Q7Y C;  3PIO A;  3HOV G;  1TWC H;  1M90 C;  3HOU G;  2OWO A;  4A3J H;  4X64 Q;  3OTO Q;  2WAQ G;  5JJI A;  3PO2 H;  3MXN B;  4LF7 L;  1D8L A;  3A0J A;  4HJ9 A;  4K0K Q;  4PG3 A;  2RHS B;  1P16 A;  1KQS A;  1JMC A;  3KDF B;  3STB D;  3ICE A;  2Q2U A;  1E22 A;  2XTI A;  1SN8 A;  2AMC B;  4IPD A;  5DLQ E;  4DR3 Q;  1T9H A;  2E2I H;  4B3T Q;  3GTL H;  3HOY G;  1VQN A;  4IFD J;  1WFQ A;  1VQ8 A;  4A3D H;  3BU2 A;  1L1O B;  3KLW A;  4B3M Q;  3FHW A;  4LUZ A;  3I4N G;  4WJ4 A;  2B3G A;  3PO3 H;  3ULL A;  1GVP A;  4A3G H;  2I5L X;  2I5M X;  2HHH Q;  3CPF A;  1E1T A;  4R4T A;  1Z47 A;  1X65 A;  2F3I A;  3UDF A;  5IP7 G;  3I55 A;  5LMU Q;  4JYA L;  4P72 A;  4DAY B;  4GKJ L;  4L5T A;  4YWK A;  2C35 B;  1XNR L;  1VQK A;  3U4Z A;  2R7D A;  3M85 A;  4DV0 Q;  4FDB A;  3GTO H;  1KXL A;  1L1O A;  3PGZ A;  4XTC S;  1UEB A;  2CKZ B;  4JI5 Q;  4BA2 I;  4C3J H;  1YIT A;  1VQB A;  2QEX A;  5M3M G;  5HY6 A;  1XJV A;  5IYD G;  4AYB G;  1V43 A;  3Q8D A;  1YJW A;  4DV3 L;  1NJI C;  2E2J H;  1YHB A;  4C2M H;  3M4O H;  1XMO L;  3MEF A;  4LFB Q;  2K14 A;  4L5R C;  4PMW A;  1IBM Q;  1I5F A;  3HKS A;  3A5U A;  3GDE A;  1VQO A;  1CKN B;  2KCM A;  3PIP A;  1N36 Q;  3S2D H;  4POG A;  1X54 A;  1NE3 A;  2PNH A;  2K75 A;  5EAY A;  1PH3 A;  1EYG A;  3RNU A;  4B3S Q;  4JOI A;  5FLM G;  2QGQ A;  2F4V Q;  3J7Z C;  1IXR A;  1FGU A;  4JI4 L;  2VL6 A;  3U58 A;  4A3K H;  4DV2 L;  4A3I H;  4JBW A;  4PZ8 A;  1VQE A;  4YY3 L;  3U4V A;  4OO1 I;  4DV4 Q;  5GAH C;  2ALY B;  1IL2 A;  4DR2 L;  1EFW A;  4BY7 G;  1PFS A;  1VQI A;  1CKN A;  1HNZ Q;  1AH9 A;  2UXB Q;  2VS1 A;  4BY1 H;  3H3V I;  2VNU D;  1HR0 Q;  1YBY A;  1E7Z A;  4JBJ A;  4A3J G;  1Q82 C;  1VQG A;  1VQH A;  3CW2 C;  4LUV A;  4QIW E;  1TWH H;  1PH8 A;  1N33 L;  2A1A A;  3PO2 G;  2JA7 H;  3GTM H;  3S24 A;  1UE6 A;  5IYB H;  4MZ9 A;  2VW9 A;  2JK8 A;  4TVA B;  4GNX C;  1VQP A;  4QY7 A;  2KEN A;  4L5Q A;  2I5H A;  4IOC A;  4UP7 A;  4LF9 L;  2KCT A;  2YYZ A;  4PZ7 A;  4JBK A;  4A3D G;  3PUY A;  2CCZ A;  2NVY H;  2JA5 H;  3CP0 A;  1DGS A;  1IZ6 A;  4DR1 Q;  3ERS X;  2NVT H;  4B3R Q;  2R93 H;  1VQF A;  2BH8 A;  2NN6 I;  2VQE Q;  3M4Q A;  4JOI C;  4OWW B;  3PO3 G;  5IP9 G;  4A3G G;  3D0F A;  1VS0 A;  2IT1 A;  4DV6 L;  1E3P A;  4YWL A;  5LMN W;  4LFC Q;  3UDG A;  1XNQ Q;  4JI6 L;  4XIG S;  3RZO H;  4LNQ A;  3ZJY C;  1FL0 A;  4LF5 Q;  4HJ5 A;  1I6H H;  1ASZ A;  1K9M C;  3HFZ B;  5H1S E;  1OTC A;  1SR3 A;  4A3C H;  1RIP A;  2K50 A;  3CCS A;  3T1H Q;  1IBK L;  2CWA A;  2MO1 A;  4PZ6 A;  1E1O A;  5FLX c;  4A3M H;  2KHI A;  1JJ2 A;  4A3B H;  5BR8 L;  1HNX Q;  5M5W H;  4UP8 A;  4OO1 G;  2JJQ A;  4LF4 Q;  4DKA C;  1PH2 A;  1VQ5 A;  4C3I H;  5IWA Q;  1VQD A;  1PH9 A;  3GTQ H;  3NEN A;  4DV7 Q;  4R4C A;  1OXT A;  3G71 A;  4BA1 I;  1FVI A;  1SLJ A;  3BZK A;  3AQQ A;  1FJG Q;  5GRO A;  4X64 L;  3OTO L;  1AE2 A;  3BJU A;  3W1G A;  2WB1 E;  4A3I G;  3FKI H;  4A3K G;  4K0K L;  1PV4 A;  4JI6 Q;  5E7N A;  2PQA B;  3A5Z B;  5AJ3 Q;  3T1Y Q;  4DPG A;  4QJF A;  4GN3 B;  2YTY A;  2ZJQ A;  4DR3 L;  3NBH B;  1TXY A;  2D0P A;  2RCN A;  4BY1 G;  4B3T L;  3K7A H;  3GTP H;  1LTL A;  1VQJ A;  3F2C A;  5C0X I;  1I3Q H;  4IJH A;  4B3M L;  2NN6 G;  1QZG A;  1A62 A;  2Z6K A;  2IX0 A;  5IYB G;  4A3F H;  3M9B A;  1E24 A;  1HZB A;  4UP9 A;  2HHH L;  2CQO A;  2PQA A;  1G29 1;  1KL9 A;  4JC0 A;  5LMU L;  4BBR H;  3J81 c;  1W2B A;  2E5L Q;  1Q12 A;  5GAG C;  4DV0 L;  1R9T H;  2JA5 G;  2OTL A;  2R93 G;  3GO5 A;  2JEB I;  4OWX B;  3ER0 A;  4JI5 L;  4DNI A;  1CSP A;  3CC7 A;  3UDI A;  3DLL A;  2UU9 Q;  1VQ7 A;  3AYH B;  1K3R A;  1WCM H;  4QQB X;  4JI8 Q;  4GLA C;  1G51 A;  4YCV A;  4LFB L;  1IBM L;  2N8N A;  1TWG H;  3G48 A;  1X6O A;  3IRB A;  5JEA G;  1ASY A;  4KHZ A;  1A63 A;  4A3C G;  1YEZ A;  4AQY Q;  3S16 H;  1N36 L;  2Z6K C;  2VY3 A;  1PH7 A;  3SGI A;  4B3S L;  3CD6 A;  4RMF A;  4A3M G;  4JI3 Q;  3S14 H;  1TWF H;  2NZO A;  2NZH A;  4P73 A;  3RLO A;  1N34 Q;  1YJN A;  1HZC A;  2F4V L;  3S17 H;  4KHP L;  3KDF A;  1PH6 A;  1B7Y B;  1JE5 A;  2D0O A;  3PSI A;  4GOP B;  1EIF A;  1NY4 A;  4JG2 A;  3J80 i;  5C4J H;  4X66 Q;  4DV4 L;  3JC6 6;  3KF6 B;  2IY5 B;  1VQC A;  1HNZ L;  2UXB L;  1K8A C;  3OYY A;  1CSQ A;  5C0X G;  2OTJ A;  4NXM L;  1HR0 L;  2HT1 A;  1VQA A;  2VQF L;  1UE7 A;  2BA0 A;  5LMN Q;  3FKI G;  4R1J A;  3HOW H;  3TS0 A;  2K5N A;  1A0I A;  4X62 Q;  3RZD H;  1YHQ A;  3ULP A;  1OXS C;  2BH2 A;  3KF6 A;  1QUQ B;  1QVG A;  3H3V H;  3JAM i;  4YWM A;  5M3F H;  1KRT A;  2ATW A;  3HOX H;  3M3Y H;  4DR1 L;  4B3R L;  3UE1 A;  4NXN L;  3HKZ E;  2VQE L;  4KHP Q;  1UE5 A;  1D7Q A;  1U5K A;  2ID0 A;  2ZTC A;  4DR7 Q;  1HZ9 A;  3GTJ H;  1K73 C;  1EOV A;  4LFC L;  5M5X H;  1XNQ L;  4BBR G;  4A3E H;  3F2D A;  2WAQ E;  1L1O C;  3L0O A;  3STB C;  1QUQ A;  5JEA J;  2OQK A;  4OX9 Q;  3F8T A;  1BBW A;  2NVX H;  3CQZ H;  1NMF A;  4NXM Q;  1JJC B;  1WOC A;  4LF5 L;  2VQF Q;  2YV5 A;  4GKK Q;  1C9O A;  1HNW L;  3PCO B;  3T1H L;  1IBL Q;  2UUC Q;  1SMX A;  1Y1W H;  1SE8 A;  1WCM G;  1HNX L;  3G4S A;  3W5O A;  4AIM A;  1V9P A;  3BZC A;  2E8G A;  4LF4 L;  1OXV A;  1X3G A;  3K7U C;  3K80 C;  4P71 A;  1GO3 E;  3H0G H;  5IWA L;  3AFP A;  5C0X J;  1OXX K;  4NXN Q;  4DV7 L;  4DK3 C;  1Z9F A;  4R4I A;  3I56 A;  3ULJ A;  1U0L A;  2ZTE A;  4R4Q A;  1FJG L;  3FP9 A;  1EQQ A;  2VZA A;  2ZTD A;  1B70 B;  4IPC A;  1MJE A;  4HJ7 A;  2Y0S E;  3LGJ A;  4OXP A;  2XGT A;  4R4O A;  5AJ3 L;  3T1Y L;  3I2Z A;  4C3H H;  5C44 H;  5GAE C;  2UUA Q;  1HNW Q;  4LF6 Q;  5IY0 A;  3I4O A;  2VUM H;  1JJG A;  2ZJP A;  1CUK A;  2N3S A;  3CCM A;  4JI2 Q;  3M4P A;  3K0X A;  4OON A;  3KJO A;  2YU9 H;  1I50 H;  2PI2 E;  3HOW G;  3EBE A;  5C3E H;  3PUW A;  2YTV A;  4EQ5 A;  1YZ6 A;  1C0A A;  1K8G A;  1PYS B;  2E5L L;  3CCU A;  5M3F G;  4H02 A;  3PV0 A;  3D31 A;  1JT8 A;  3RLF A;  1J5E Q;  3HOX G;  2I0Q A;  5IYC H;  3B6Y A;  1MKH A;  2WFW A;  2AHO B;  4DAM A;  1X3F A;  1PHJ A;  3L7Z C;  4A76 A;  2UU9 L;  2CFM A;  1XMQ L;  1JB7 A;  2UUB Q;  4A3E G;  2OCE A;  3S2H H;  4KLK A;  4JI8 L;  3A74 A;  1S72 A;  3NEM A;  3TQY A;  2ZM6 Q;  4YCU A;  1CKM A;  4JBM A;  2JE6 I;  3KOJ A;  4Y52 H;  4UY8 C;  4WJ3 M;  4AQY L;  1TWA H;  2JA7 G;  2AWO A; 
#chains in the Genus database with same CATH topology
 1Y1W G;  4FF2 A;  4KK7 A;  2R7Z H;  3DHQ A;  4JI0 Q;  4NP5 A;  1N34 L;  2N78 A;  3CKI B;  5ELE A;  5ISR A;  2A5H A;  4DR4 Q;  2HDM A;  3NE5 B;  3UDX A;  2OEO A;  5ELB A;  4OHJ A;  4TKO B;  4DNT B;  2F0U A;  1WYD A;  5CV6 A;  3S15 B;  5C5M A;  4X62 L;  1S5E D;  3MWY W;  2E2H H;  4MTK A;  3HG9 A;  2VUM G;  1G2S A;  2LXJ A;  4FF1 A;  2UXD L;  3EA6 A;  2R7Z B;  1G8Z D;  1GM5 A;  2K5V A;  3OMG A;  2CH4 W;  4JI7 Q;  4HMJ A;  1GD7 A;  4H13 C;  1YJ9 A;  4A3L H;  1GUW A;  1PVO A;  4GKK L;  3UE0 A;  2EYO A;  2MHV A;  2M2L A;  2HIX A;  2UUC L;  3S1Q H;  3CXC A;  2E2H B;  1YNJ D;  1L2F A;  2RF4 A;  3OIQ A;  4OEL B;  3WOE A;  1VQM A;  2B63 H;  2LXK A;  4P75 A;  4P74 A;  1PH1 A;  1PTO C;  3HOZ H;  4A3J B;  1XXG A;  5IT9 c;  4TQU S;  4TSS A;  5COY A;  2LMC B;  3Q24 A;  4HIO A;  1H9S A;  5GAD C;  1LM0 A;  5FLX L;  1U4R A;  4GNX A;  3RN5 A;  2JA8 H;  3E0E A;  1YI2 A;  4LF6 L;  3J81 j;  2R92 G;  1Q1E A;  2BDO A;  4BBS H;  4IJL A;  1QZH A;  4RHS A;  4DUY Q;  1V1P B;  4FXK C;  2B63 B;  1VF7 A;  4GKJ Q;  1PRT C;  3Q22 A;  4MTN A;  2WB1 G;  4A75 A;  4DU9 A;  2E2J B;  2K7V A;  3Q23 A;  4RGM A;  3U50 C;  5EKI A;  5M5Y H;  2NVQ H;  4YIJ A;  2H5X A;  1LLR D;  2B2U C;  2IHE A;  4R8N A;  1YNX A;  3MA2 B;  5LHY 1;  4IPG A;  4BBS B;  5K36 G;  2ZM6 L;  3NP8 A;  1NR4 A;  3K8A A;  1VQ6 A;  2Z0S A;  2Q8T A;  1JWU D;  1A15 A;  1VCI A;  1TY0 A;  2LSS A;  1EY9 A;  3KLS X;  1VQ4 A;  1G6Z A;  1LTS D;  4N9T A;  1N8R C;  3QJY A;  1ET6 A;  1D6E C;  4JI0 L;  1HJP A;  1LAB A;  2L12 A;  4Z9C B;  2K03 A;  1STH A;  4DR4 L;  2CHB D;  1HZA A;  1H9M A;  1MI2 A;  1CQF A;  1UWV A;  2FXQ A;  1WTQ A;  2F0P A;  3I4N H;  1U9R A;  2OQ0 A;  4OL7 A;  2A73 B;  4CJ0 B;  2A19 A;  1EY8 A;  3J81 i;  4LF9 Q;  2NBF A;  1SE4 A;  2H4O A;  4A93 G;  4IFD G;  2N49 A;  1MIU A;  5IYD H;  5A2Q E;  4GN5 A;  3CMA A;  1BCP D;  1P8L A;  5IOC A;  3L3O C;  4JI7 L;  2EXD A;  2PMZ B;  2L0C A;  3TS2 A;  3EN2 A;  4GLX A;  5C4X G;  1PA6 A;  1Y1V G;  4HIM A;  5KEE A;  1F77 A;  5BR8 Q;  3MHB A;  3TP5 A;  5FJ8 G;  1BKB A;  2F3W A;  1Q8I A;  3PUV A;  2K52 A;  2XIW A;  1LTA D;  1Q7Y C;  1E2W A;  3PIO A;  3HOV G;  4X3U A;  3FPP A;  2OWO A;  1TII D;  3OTO Q;  2WAC A;  3PO2 H;  4K0K Q;  3QG1 A;  1U4P A;  2RHS B;  3KDF B;  2VB3 X;  2Q2U A;  2AMC B;  5DLQ E;  1SJE D;  3HOY G;  3GTP B;  4MHE A;  3BU2 A;  3WDN A;  3PIP 3;  1SNQ A;  4RAU C;  4WJ4 A;  3PO3 H;  4KD3 A;  3MXN A;  2IWH A;  4EQP A;  3CPF A;  2SEB D;  4GKJ L;  3V96 A;  4DAY B;  4YWK A;  1KLU D;  2R7D A;  3M85 A;  2TMP A;  2D9U A;  4BA2 I;  2DY8 A;  1B53 A;  5M3M G;  5C3W A;  1GXD C;  3TDQ A;  1V43 A;  1STA A;  1NJI C;  1YHB A;  1IKL A;  4OO1 H;  1KDB A;  3MEF A;  1B3Q A;  5KNB A;  4L5R C;  1IBM Q;  1I5F A;  2MPM A;  1R4Q B;  5C3X A;  5T1G A;  1VQO A;  1N36 Q;  3S14 B;  5EGT A;  3RNU A;  4JOI A;  2F0V A;  3VYS A;  4A3K H;  4JBW A;  2FJ2 A;  3GQB A;  3U4V A;  2ALY B;  2DNC A;  3KBX A;  3C1E A;  4K2L A;  3FEW X;  1E2V A;  2VNU D;  2A68 D;  1VQG A;  4LUV A;  5E1F A;  1TWH H;  3HOW B;  3S24 A;  3FPU B;  4TVA B;  1VQP A;  4QY7 A;  2QW7 A;  2I5H A;  4IOC A;  4LF9 L;  1XWE A;  4CDF C;  3HOX B;  3CP0 A;  3E5S A;  3ERS X;  2NN6 I;  4XT3 B;  2VQE Q;  1IW7 C;  4JOI C;  4A3K B;  4OWW B;  2EJG C;  5IP9 G;  2IT1 A;  2HQE A;  5EBC A;  3K5L A;  4BS9 A;  1W6J A;  2F0G A;  1Q90 A;  4XIG S;  5D65 A;  5JEA H;  1I6H H;  4A3C H;  1Y1W B;  2F0S A;  3T1H Q;  2IPK D;  4PZ6 A;  2NB0 A;  4A3M H;  5BR8 L;  1HNX Q;  1I6V C;  5M5W H;  5I2X A;  2GA4 B;  3N6R A;  4LF4 Q;  3BDC A;  3VYR A;  4DKA C;  5IT9 E;  1VQ5 A;  1LTT D;  4C3I H;  2QEJ C;  1PXU A;  1O7Y A;  3Q0A A;  1AZQ A;  3TP7 A;  1RTO A;  5C0X H;  4X3K A;  3OTO L;  3A54 A;  5BN3 A;  1AE2 A;  3BJU A;  5D3I B;  4A3I G;  1UNS A;  4K0K L;  5E7N A;  2F0O A;  3A5Z B;  4DPG A;  4QJF A;  1YNN C;  1TS5 A;  2YTY A;  3NBH B;  2VUM B;  2RCN A;  4BY1 G;  3UI2 A;  3K7A H;  4U68 A;  1LTL A;  1JE4 A;  1QJO A;  1QZG A;  5M5W B;  2Z6K A;  1LV9 A;  1B1Z A;  2IX0 A;  5DM7 3;  5IYB G;  5I2Y A;  1HZB A;  2PQA A;  4JC0 A;  4QMG A;  1LTI D;  2EVB A;  3J81 c;  4QIW B;  1W2B A;  1Q12 A;  1R9T H;  4QCL A;  3U9S A;  2R93 G;  3GO5 A;  4DN4 M;  4F7X A;  2QF7 A;  3WOF A;  2CQA A;  2EJF C;  1AEX A;  2A6H C;  3AYH B;  1I4H A;  1I4Q A;  3K7A B;  3D4R A;  3DUZ A;  1IBM L;  1ASY A;  3G48 A;  3K5O A;  3IRB A;  1TWA B;  1A63 A;  3S16 H;  4M1U B;  1N36 L;  2Z6K C;  3X3N A;  2EPB A;  4IUN A;  1TWF H;  3HP3 A;  3JAM L;  1YJN A;  3KDF A;  1JOO A;  2EE1 A;  1JOK A;  1X32 A;  5C4J H;  2R92 B;  2F0N A;  1B9N A;  1D5M C;  2X6G A;  1DOL A;  1PDQ A;  1VQA A;  2VQF L;  4CKB A;  3FKI G;  1K83 B;  1A0I A;  1WTO A;  1B44 D;  3R3O A;  5DAU A;  3H3V H;  4RGT A;  2X69 A;  2WB1 B;  2ATW A;  3MTS A;  4NXN L;  2VQE L;  5CC4 A;  4DR7 Q;  1HZ9 A;  3GTJ H;  5DM6 3;  1L0X B;  3VYT A;  5M5X H;  2X6L A;  4A3E H;  3F2D A;  4IUV A;  3L0O A;  5JEA J;  1QUQ A;  4OX9 Q;  1FD7 D;  3F8T A;  4NXM Q;  3CQZ H;  1JJC B;  1HNW L;  3E6Z X;  5J39 A;  3T1H L;  1SMX A;  3ND9 A;  1MSH A;  2B2W A;  1HNX L;  3W5O A;  4AIM A;  1V9P A;  2RSO A;  4LF4 L;  3K7U C;  3K80 C;  5C0X J;  5COR A;  1B9M A;  2QIL A;  4CKE A;  4R4I A;  3I56 A;  2EY5 A;  3MC0 B;  4WOR A;  5M5X B;  4ZKC B;  4A3E B;  4OIK A;  1RJT A;  4CJ2 C;  1EQQ A;  1AW7 A;  5KRU A;  3LGJ A;  4R4O A;  2XGT A;  4RGO S;  4C3H H;  1BQQ T;  5GAE C;  3EVQ A;  2UUA Q;  3DEO A;  1SBB B;  1HQM C;  4JI2 Q;  4H44 C;  2PI2 E;  2B2W C;  4JK1 C;  3EBE A;  5C3E H;  4EGV A;  4G7Z C;  3HZX A;  4ZUI A;  1JB3 A;  5M3F G;  2I0Q A;  1RD9 D;  4XDX A;  4ILW A;  5EQ0 A;  5C4X B;  1Y1V B;  3L7Z C;  4KY6 A;  5I6Y A;  3TZD A;  4K5W A;  1XMQ L;  4C3H B;  1PTO H;  2PYK A;  5EPJ A;  1HCZ A;  1XTC D;  3I91 A;  3S2H H;  3A74 A;  3KLR A;  3HKZ B;  3P20 A;  4IZ8 A;  3ERQ A;  3TQY A;  3HOV B;  3A8I E;  2JE6 I;  2RSN A;  4WJ3 M;  2JA7 G;  1PYW D;  2EIF A;  1A3T A;  1CHP D;  2K1B A;  3CCE A;  5CBE E;  1MJC A;  2JYO A;  4JW0 A;  4APV A;  5HGQ A;  4YHH Q;  4DAV A;  3HOY B;  3H0G G;  4ZQ3 A;  4NB3 A;  3FVQ A;  1SNM A;  2ICI A;  3F2B A;  1K8O A;  3G6E A;  1PTO B;  1GHJ A;  1EL0 A;  1BVS A;  1WTV A;  3R2T A;  2WKD A;  4GZY C;  1IYV A;  2PW5 A;  2AWN A;  2F0W A;  2G9H D;  1FGB D;  2KED A;  2Q2I A;  3PUZ A;  5DNF A;  2SDF A;  5M3M B;  4C1N K;  3K59 A;  3CCV A;  1V1Q A;  4DV5 Q;  4O1N A;  1CI3 M;  4DR7 L;  2L5T A;  2GVB A;  2V1C C;  3CF5 A;  1ONL A;  1QOH A;  1IYJ B;  2RDF A;  4OX9 L;  1PRT B;  2MQH A;  4CJ1 B;  2BCO A;  3J7A 5;  4X65 Q;  2G9D A;  2XN9 C;  1K8M A;  4X6A H;  2B2Y C;  5IP9 H;  1Y14 B;  1CZW A;  1H9S B;  5EPK A;  1JWS D;  5ELO A;  4GNX B;  2UXD Q;  4H0L C;  4QGU A;  2E76 C;  2QDB A;  2FIN B;  2R6G A;  2KEC A;  1EU4 A;  1HHV A;  2F0I A;  3K6O A;  3IKJ A;  1EYD A;  4HCS A;  4V19 0;  4V0B A;  3VDY A;  4PNY A;  2Y0S G;  5GQO A;  3BDO A;  2E2I B;  1LYL A;  1SRU A;  3GD7 A;  2UUA L;  1VQL A;  1SE2 A;  3MFG A;  1T5E A;  4JI2 L;  3CC4 A;  3I4M G;  4LWC A;  3RN2 A;  2PMZ E;  3HRZ C;  1S5B D;  3EQL C;  3J81 E;  2JA6 G;  2CWP A;  2B2T C;  1VQ9 A;  3EJI A;  2DNE A;  2KUM A;  2AUJ D;  3RLN A;  3D8G A;  2Z6B A;  2A8V A;  1GUO A;  1CT1 D;  1L0W A;  2QA4 A;  4IFD I;  2K4K A;  5BN4 A;  1S40 A;  1LTG D;  3CRK C;  4RCO A;  2BDN A;  3R8B A;  5DEH A;  4DV3 Q;  4C2M B;  1SYG A;  1EEI D;  2NZ1 D;  3W3A A;  2WIN B;  3VR5 A;  1EIG A;  1B8A A;  4IUT A;  1VMP A;  3OW2 A;  3J7A F;  1NBW A;  1RTN A;  1MD2 D;  4IN3 A;  4A3I B;  1ESR A;  1TKW B;  3I7F A;  4YY3 Q;  3OSO A;  4HJA A;  4YHH L;  4DR2 Q;  2MO0 A;  1X3E A;  4BY1 B;  2F0H A;  1X9N A;  1H95 A;  1II3 A;  3TRZ A;  3ERO A;  1GHK A;  3CCJ A;  2L15 A;  1OO9 B;  2H1E A;  3S15 H;  2B2V A;  5IP7 H;  1PH5 A;  1C7Y A;  2NVY B;  2R93 B;  4KN4 C;  2Q8R E;  3DM3 A;  4GN4 B;  1AE3 A;  3IL8 A;  2R7F A;  4G4K A;  1HR0 W;  1I4X A;  4DV5 L;  1D1I A;  1F2M A;  2MGS A;  5NUC A;  1KHI A;  1KC8 C;  1DYQ A;  4JCV E;  3J80 E;  1Q8K A;  1KAB A;  2DN8 A;  2A69 C;  2DJG C;  2PZU A;  3I90 A;  3M7N A;  1B4O A;  1ENA A;  3LNN A;  5ELN A;  2PQE A;  1OXU A;  1MBY A;  3GTG H;  4LAA A;  3D3R A;  3WWV A;  4X65 L;  3KF8 A;  2CH4 A;  5FLM H;  1LAC A;  2B29 A;  4BXX G;  1HRJ A;  4MNO A;  2KHJ A;  1QNU A;  2ASB A;  4EQN A;  3CPW A;  2RBM A;  1EU3 A;  4U67 3;  2P5Z X;  4AYB B;  4KKU A;  1QNK A;  5C4H A;  3HOU G;  1QE6 A;  3T13 A;  4A3J H;  2PO4 A;  2WAQ G;  3FKI B;  4FVM A;  4K14 A;  3MXN B;  3A0J A;  4HJ9 A;  2HD3 A;  3GTG B;  1E22 A;  2XTI A;  4CDE C;  4DR3 Q;  4B3T Q;  1T9H A;  3GTL H;  1VQ8 A;  2Z1C A;  3SK6 A;  4LUZ A;  4LMQ D;  1ZEQ X;  2AUK A;  4IUU A;  3ULL A;  4UDU C;  3MXG A;  2I5M X;  3E0J A;  2HHH Q;  4R4T A;  2F3I A;  3NQI A;  4L5T A;  2C35 B;  2F0M A;  3GTO H;  1KXL A;  1RCV D;  2HCC A;  3NXW A;  1UEB A;  2Z4H A;  4JI5 Q;  1VQB A;  2B8G A;  2QEX A;  4PMC A;  5HY6 A;  1XJV A;  3I8Z A;  4ULL A;  4DV3 L;  2E2J H;  1EWC A;  3D4D A;  3GTL B;  1TWG B;  5IGF A;  3A5U A;  2FFK B;  3TSS A;  1X54 A;  1PH3 A;  4FNF A;  4XYO A;  5CV8 A;  2F4V Q;  3J7Z C;  1IXR A;  1FGU A;  2VL6 A;  3QR8 A;  4PZ8 A;  1VQE A;  4YY3 L;  3GTO B;  3BVM A;  1C4Q A;  4BY7 G;  4DR2 L;  1EFW A;  4CDC C;  1PFS A;  1CKN A;  1AH9 A;  3T16 A;  2VS1 A;  1S4Z A;  3BVG A;  1PH8 A;  2NN6 H;  3NTK A;  4QIW E;  2JA7 H;  5JVG 3;  3GTM H;  1YNJ C;  4MZ9 A;  4GNX C;  3RZD B;  2D5D A;  2KCT A;  2KVM A;  4PZ7 A;  5M3F B;  2K32 A;  4A3D G;  4IUR A;  3H91 A;  4F87 A;  2JA5 H;  1IZ6 A;  5KND A;  3PMF A;  3M4Q A;  4A3G G;  3D0F A;  2K6A A;  5LMN W;  2M9V A;  4JI6 L;  2RDG A;  2J4X A;  3ZJY C;  1FL0 A;  1EY5 A;  5E4W C;  3QB3 A;  1W6K A;  4LF5 Q;  1VMC A;  4C3J G;  2JA7 B;  1BR9 A;  3GTM B;  3CCS A;  2CWA A;  1ZYR D;  1JJ2 A;  2KHI A;  1O78 A;  4UP8 A;  2JA5 B;  2AQ3 B;  2L55 A;  3H0G B;  1PH9 A;  4N8X 1;  4HAE A;  3NEN A;  1Y69 U;  4R4C A;  2B8F A;  1I4R A;  1OXT A;  4BA1 I;  3G71 A;  5IGD A;  4Q0F A;  1V8Q A;  3W1G A;  2WB1 E;  1AN8 A;  1PV4 A;  1G2T A;  4CKC A;  2PQA B;  5AJ3 Q;  1NCV A;  4DR3 L;  5EKK A;  1LT6 D;  1TXY A;  4B3T L;  3GTP H;  1G91 A;  4K5X A;  1SYC A;  1GJX A;  3NQT A;  1F2Z A;  3M9B A;  1LO5 D;  2HHH L;  4ZYS A;  2CQO A;  4FXG C;  1G29 1;  1U4M A;  5C6A A;  1EY7 A;  4O42 A;  1UEA B;  4WFN 3;  2Z9H A;  2F0F A;  1VDZ A;  2HUG A;  4JI5 L;  1PMR A;  4ZRZ A;  3DLL A;  5CV5 A;  1VQ7 A;  1WCM H;  4GLA C;  4N9P A;  5LL6 X;  2N8N A;  3S9W A;  1EFI D;  1GUS A;  1YEZ A;  2KOL A;  4AQY Q;  4XQN A;  2PW7 A;  2VY3 A;  5D14 A;  1CM9 A;  3SGI A;  3S14 H;  4JI3 Q;  2NZO A;  2F4V L;  4KHP L;  1HZC A;  1RF2 D;  1PH6 A;  2F0D A;  1PZK D;  5JAV A;  1CA6 A;  3J80 i;  2JP1 A;  4X66 Q;  1SSO A;  4E6I A;  2IY5 B;  1VQC A;  3S1M B;  3OYY A;  5FLX E;  2HT1 A;  3I4M B;  1WCM B;  3HEJ A;  4KY5 A;  4RGN A;  1BDO A;  3HOW H;  3TS0 A;  1KDA A;  1ZXT A;  5IOD A;  3KF6 A;  1QUQ B;  1QVG A;  4DAP A;  2I07 B;  1TS3 A;  1KRT A;  3HOX H;  3OOC A;  1FYC A;  3M3Y H;  2O5J C;  2E2D C;  1U4L A;  3HKZ E;  5EKL A;  4TRD A;  3R2I A;  4ZAI A;  1UE5 A;  1U5K A;  2ID0 A;  2ZTC A;  1Y8O B;  2DY7 A;  4F8M A;  2KA7 A;  4BBR G;  4KKT A;  4B08 A;  4P2C B;  1WOC A;  4LF5 L;  5FKA C;  3C1F A;  2VQF Q;  1NNX A;  1IBL Q;  1Y1W H;  2O4X A;  3G4S A;  2TSS A;  4KV6 A;  4DXF A;  5FOB B;  3BZC A;  3ND8 A;  1OXV A;  2BE5 D;  4P71 A;  3M3Y B;  1GO3 E;  1OXX K;  4NXN Q;  3K58 A;  3R93 A;  2F0K A;  3ULJ A;  1U0L A;  4C56 C;  4R4Q A;  3FP9 A;  4J1M A;  2VZA A;  2ZTD A;  3OPO A;  1MJE A;  3MXU A;  1JWM D;  4OXP A;  5AJ3 L;  3SK5 A;  1F9Q A;  1HNW Q;  3OWF A;  4NMZ A;  5CGK A;  2VUM H;  1CUK A;  2N3S A;  4IQZ A;  5HUR A;  4ME5 A;  3VR6 A;  4KMU C;  2EXZ A;  2IW3 A;  1FNV A;  1PYS B;  1D5Z C;  4H02 A;  1JT8 A;  3RLF A;  1MKH A;  2WFW A;  4EVO A;  1PHJ A;  3V2T A;  4EQO A;  4PMB A;  1TT2 A;  2A68 C;  4A76 A;  2CFM A;  4BWG B;  3M4Y A;  1L0Y B;  2F3V A;  2UUB Q;  2SOB A;  2ZXP A;  3NEM A;  2G5D A;  4M8A A;  1EY0 A;  4JBM A;  3HOU B;  4UY8 C;  4AQY L;  1TWA H;  4QUC A;  2AWO A;  2WAQ B;  3IFD A;  4JI3 L;  1S3O A;  4DR6 L;  1BXT A;  2AQ1 B;  1Q46 A;  1Y8P B;  3KK7 A;  4X66 L;  3GP7 A;  4JI1 Q;  3BDL A;  1I94 L;  1SFO H;  3QOJ A;  5I4D A;  3H15 A;  2F0J A;  2R92 H;  3PUX A;  2I46 A;  1XMQ Q;  1CA5 A;  2K04 A;  4DV1 Q;  4LF8 Q;  4Y7N H;  3S2D B;  3GTK B;  1K83 H;  5C44 G;  1CZG A;  1DJR D;  4LW1 A;  1QVC A;  1YHA A;  3HGB A;  3CCR A;  4A3B G;  2EZV A;  4O0A A;  3AMU A;  1VF5 C;  1SXT A;  4DXG A;  2RVL A;  4EX5 A;  4OIJ A;  1SFO B;  2VB2 X;  3HS0 C;  4XT1 B;  1ENC A;  1I4G A;  4AH6 A;  5IYC G;  2Q2H A;  1KNA A;  1T5X D;  4O2D A;  5K36 H;  3EIV A;  1XPO A;  3VA7 A;  4Y7N B;  5A35 A;  3NTH A;  1M8A A;  1IBL L;  1A8V A;  1HTP A;  3D6C A;  4DUZ Q;  2L11 A;  1WVL A;  1X3Q A;  2ZT9 C;  2GVA A;  1TWC B;  3KFU A;  1XPU A;  1Q81 C;  3E9I A;  3W1B A;  4A3F G;  3I4L A;  2R7Z G;  4LF7 Q;  2D62 A;  3FRP B;  1JIC A;  1H9K A;  3E9H A;  3PF4 A;  4K5V A;  1EY4 A;  1QVF A;  5JJL A;  1D2B A;  1HH2 P;  2RHQ B;  1K0R A;  3I73 A;  3J80 c;  4A3D B;  1C8C A;  3S1R H;  1ILQ A;  4K6L A;  1SNP A;  4A93 H;  4IFD H;  2F0T A;  2IX1 A;  2ES2 A;  1EQT A;  2V4D A;  3CC2 A;  4A3G B;  3DM1 A;  1YIJ A;  1WTW A;  2F4I A;  1A2T A;  1AP0 A;  4GLV B;  4JYA Q;  2SNM A;  1XNR Q;  2MFI A;  5CR3 A;  4RCN A;  5KYL A;  1Z6H A;  4C3J B;  1DON A;  1SND A;  2LKV A;  3Q6S A;  1M1K C;  5C4X H;  1KRS A;  1Y1V H;  2EYJ A;  4RFB A;  4AYB E;  5FJ8 H;  4DK0 A;  2UUB L;  1ROD A;  2MNA A;  1XMO Q;  4IOA A;  3S1R B;  1D5X C;  1PFB A;  2QCP X;  4X3T A;  4A3L G;  4A93 B;  1EOT A;  3HOV H;  1PTO F;  3J81 L;  1ILP A;  1N32 L;  2K33 A;  3CHB D;  1PH4 A;  4JI4 Q;  2IHF A;  1RHP A;  2B63 G;  4B9X A;  1DOM A;  4JI1 L;  3F1Z A;  5EJW A;  3HOY H;  3HOZ G;  3CAM A;  4YCW A;  5L37 A;  1Q1B A;  1N33 Q;  3DXJ C;  2DUD A;  2B39 A;  3TME A;  4DV1 L;  4LF8 L;  1KIX A;  2EYL A;  1GKH A;  1KTK A;  3LWU A;  1I4P A;  2JA8 G;  3SVM A;  1PRT F;  1WI5 A;  4DGZ A;  3IAY A;  4OWT B;  3K57 A;  3PIO 3;  2MP1 A;  1J6Q A;  4BBS G;  1TY2 A;  4WJW A;  4FP5 D;  5M3M H;  4DV6 Q;  3KF8 B;  2K5W A;  3KYH C;  4CHT B;  4FXD A;  3AEV A;  3L2P A;  4IUQ A;  4IPH A;  4ME3 A;  3TZU A;  3P1H A;  1SEB D;  2JQO A;  4J15 A;  4DNR B;  3QO2 A;  1BF4 A;  1LT3 D;  3S1N H;  1X55 A;  4DUZ L;  1Z7T A;  4A4I A;  2KBN A;  5IIF A;  3KBG A;  1SMY D;  1TVX A;  2SNS A;  5JJI A;  2D2C C;  1A3V A;  2M00 A;  4LF7 L;  1EIH A;  4NW2 A;  3BYY B;  4KTA A;  1JMC A;  3T53 B;  1KQS A;  4HR7 B;  3STB D;  4NDX A;  1SN8 A;  2E2I H;  4IPD A;  3VR2 A;  4IFD J;  1I3Q B;  1VQN A;  1WFQ A;  3S1N B;  4B3M Q;  2PZW A;  4KY7 A;  5E3F A;  4DFA A;  3I4N G;  3AU7 A;  1GVP A;  1UAP A;  2I5L X;  4I7Z C;  1MSG A;  1TQO A;  1E1T A;  3MXP A;  5CV7 A;  5LMU Q;  4JYA L;  1XNR L;  3U4Z A;  4DV0 Q;  1L1O A;  3PGZ A;  3A7L A;  1H9R A;  5IYD G;  3FMC A;  3Q8D A;  1YJW A;  2KHS A;  3NHH A;  4C2M H;  1XMO L;  3KUP A;  3E3X A;  2O2L D;  4PMW A;  3GDE A;  1CKN B;  2KCM A;  3PIP A;  1SNO A;  1EYG A;  1Y8N B;  2K75 A;  5FO8 B;  1GUG A;  3D4W A;  4JI4 L;  4I65 A;  3U58 A;  4A3I H;  2KCC A;  2A6E D;  4F88 A;  1VQI A;  4BY1 H;  2FHT A;  3H3V I;  1HR0 Q;  1YBY A;  4DF7 A;  1IHZ A;  3IFT A;  3NTI A;  4JBJ A;  5ELD A;  3CW2 C;  5E4X A;  1Q82 C;  1RKN A;  3SK4 A;  1N33 L;  3PO2 G;  2A1A A;  2CW0 D;  1UE6 A;  5IYB H;  5TSS A;  2JK8 A;  3RUZ A;  2KEN A;  4L5Q A;  4UP7 A;  1STE A;  4JBK A;  3NWS A;  3DEP A;  2CCZ A;  2NVY H;  2NVT H;  1DGS A;  1HTL D;  2EYF A;  4B3R Q;  2R93 H;  4KJN A;  1VQF A;  2BH8 A;  3PO3 G;  1VS0 A;  1SYE A;  4DV6 L;  2L4N A;  4LFC Q;  5I9O A;  1SJH D;  1XNQ Q;  5FK9 C;  1BOS A;  2F0Q A;  3MAQ A;  4HJ5 A;  1ASZ A;  3HFZ B;  5H1S E;  1WTH A;  1RIP A;  2K50 A;  2RQX A;  4UAI A;  1JQY D;  2MO1 A;  1E1O A;  5FLX c;  4A3B H;  1DD2 A;  1SYB A;  2F03 A;  3VYU A;  4OO1 G;  2JJQ A;  3H6M A;  2NVT B;  1Q3L A;  3GTQ H;  5IWA Q;  4DV7 Q;  3BZK A;  3MZ5 A;  1QB5 D;  3AQQ A;  4A3K G;  3FKI H;  4JI6 Q;  3H3V C;  5C44 B;  1BCP B;  4GN3 B;  1BO0 A;  2ZJQ A;  5BN5 A;  5JJZ A;  2ENB A;  1VQJ A;  4JPB W;  3F2C A;  4B3M L;  4A3B B;  1I50 B;  3F2U A;  1E0B A;  1A62 A;  1NSN S;  4A3F H;  2B2V C;  2EY1 A;  4UP9 A;  3GTQ B;  1KL9 A;  5CV9 A;  5CMD A;  5LMU L;  1RDP D;  1ICF B;  4DV0 L;  1PTO D;  3QWN A;  5A2Q L;  3A55 A;  4OWX B;  3ER0 A;  4DNI A;  1PZJ D;  3QIA A;  4CBV A;  4G7O C;  2UU9 Q;  3T4A C;  5JPN C;  1K3R A;  2XNA C;  4JI8 Q;  4QQB X;  1G51 A;  4YCV A;  5ELF A;  1TWG H;  5JEA G;  5D3D A;  4KHZ A;  4A3C G;  3X3M A;  4A3F B;  1DZ1 A;  1PH7 A;  3CD6 A;  4A3M G;  1TR5 A;  3S17 H;  3K0Y A;  1O7L A;  1JE5 A;  2D0O A;  3PSI A;  5JOB A;  1EIF A;  4GOP B;  1PRT D;  4JG2 A;  4C3I G;  3KF6 B;  3NPP A;  1EQV A;  2E74 C;  5C0X G;  1CSQ A;  3TN2 A;  1HR0 L;  1NAP A;  2J0T D;  2BA0 A;  5LMN Q;  2K5N A;  4MN3 A;  3H09 A;  3BYT B;  3NBI A;  3RZD H;  1YHQ A;  1ET9 A;  1OXS C;  3JAM i;  4YWM A;  1JOR A;  5M3F H;  4B3R L;  3S17 B;  3UE1 A;  2HDL A;  4KHP Q;  1R4P B;  1O7Z A;  1EOV A;  4LFC L;  1E2Z A;  1XNQ L;  2WAQ E;  1HXY D;  3SK8 A;  1BBW A;  2B2U A;  5T1I A;  1IKM A;  1C9O A;  3S1Q B;  2QKI C;  3K5N A;  3U9O A;  1SE8 A;  1B3A A;  1EYA A;  2IJ0 A;  4DA2 A;  5J22 A;  3H0G H;  3HOZ B;  5IWA L;  3AFP A;  4S3S A;  4DV7 L;  4DK3 C;  1Z9F A;  2VXW A;  4HSP A;  4R8I A;  4HMI A;  1KLG D;  2ZTE A;  3SR1 A;  3NUC A;  3OHX C;  2EY2 A;  5EBD A;  1B70 B;  4IPC A;  4HJ7 A;  2JA8 B;  3I2Z A;  3I72 A;  4RH6 A;  3QOL A;  3M7G A;  2A74 C;  3I4O A;  2ZJP A;  2J7Z A;  4KHV A;  1LTR D;  3M4P A;  5FO7 B;  3KJO A;  4B9W A;  2YU9 H;  1WTR A;  3P75 A;  1CQV A;  3PUW A;  1KDC A;  2YTV A;  2ZXO A;  1YZ6 A;  1IL8 A;  3FDT A;  2HCI A;  3CCU A;  3PV0 A;  1ESF A;  1J5E Q;  3B6Y A;  4DAM A;  1X3F A;  4PV1 C;  3SE0 A;  1ENF A;  4RHR A;  2UU9 L;  1S5F D;  4L6T B;  5M5Y B;  1JB7 A;  2NVQ B;  2AQ2 B;  5AFW A;  4A3E G;  2OCE A;  4JI8 L;  1S72 A;  1J8I A;  1M4V A;  1ICW A;  4YCU A;  1CKM A;  2YU9 B;  3KOJ A;  1TU2 B;  4Y52 H;  3TP8 A;  3J7Y W;  2AHO B;  3UDG A;  1HFN A;  5IT9 L;  5CV4 A;  4L63 B;  2BOS A;  1X56 A;  1MGS A;  2DGY A;  4QUF A;  1EWI A;  4IAL A;  2NTS A;  3N52 A;  4K2K A;  4QL5 A;  5G3L F;  4HIK A;  2HQL A;  4KD4 A;  1BUV T;  1JR0 D;  1K0S A;  3TP6 A;  4XXE A;  1EEF D;  3I4N B;  3S1M H;  1ZYR C;  3I4M H;  5LMN L;  3CCQ A;  2JA6 H;  4KJO A;  4KI0 A;  1EQR A;  3RD4 A;  4C3H G;  4DR5 Q;  1STN A;  1G6P A;  2K5D A;  4CGY B;  3HKZ G;  1QCB D;  2RA4 A;  2Z8L A;  5F2D A;  3DWQ A;  1UE1 A;  2Y0S B;  4I7A A;  4DR6 Q;  3T51 B;  1BCP C;  1V1O A;  1EUJ A;  3BZD B;  1O80 A;  3MVV A;  5C3E G;  4ALP A;  1BBX C;  3BVZ A;  4JV5 Q;  1I94 Q;  4HED A;  3RMH A;  5M9O A;  1QWY A;  3GV3 A;  1KAW A;  1ZKO A;  3NEL A;  3OMC A;  1N9W A;  2UXC Q;  2JSO A;  4LFA Q;  3NK9 A;  1NMG A;  5C5L A;  2JA6 B;  3SEB A;  1KAA A;  4UPA A;  4GOP A;  1CKO A;  4DUY L;  3CME A;  3H94 A;  4LUO A;  4XQQ A;  1BBU A;  3O13 A;  4ZLT F;  1YVC A;  1SRO A;  5K5P A;  1HFG A;  2PI2 A;  2XRS D;  2R3Z A;  4C1N I;  2YTX A;  2JXM B;  1NTG A;  3I3C A;  3ONA B;  5IGE A;  1IYU A;  1IW7 D;  1STB A;  4DK6 C;  3PO2 B;  1CFM A;  5IGC A;  4LJZ C;  1K28 A;  3V05 A;  3NSW A;  3TRE A;  3AFQ A;  2AKW B;  1KD1 C;  1DOK A;  3TBI B;  1UUP A;  3PO3 B;  4FYD A;  1PLF A;  1Q86 C;  4KN7 C;  4GOP C;  1XPR A;  2PNR C;  2Z4I A;  3OW7 A;  3TEH B;  2JA9 A;  1SDF A;  1PYB A;  4HCE A;  4IUP A;  3BS1 A;  1J5E L;  3JAM c;  4HID A;  4RG1 A;  4HJ8 A;  4L5S A;  1V1P A;  1LUZ A;  3RR5 A;  2JEA I;  4BXX H;  1O7I A;  1YNN D;  2GN5 A;  3ZYY X;  2NYZ D;  1NR2 A;  1STG A;  3HOU H;  4NPS A;  4UHV A;  4HTH A;  1SYF A;  2EYP A;  1XX8 A;  4DV2 Q;  1F9R A;  3LX0 A;  5LL6 S;  3KJP A;  3K81 C;  2Q2T A;  4G57 A;  2BA1 A;  4ZKB B;  5CBA E;  1EWH A;  1TWH B;  1WD1 A;  5C4Z A;  1WJJ A;  2OF1 A;  2A6H D;  2XRQ D;  2L9H A;  3C2P A;  2IX3 A;  2OT2 A;  3W2D A;  3S2D H;  3GTK H;  2QDL A;  4KKS A;  4DR5 L;  1W3S A;  2BE5 C;  3OIP A;  5J3B A;  3P7J A;  4POF A;  5IGG A;  3CCL A;  2F52 A;  3AB9 A;  4ODG A;  5JJK A;  1N32 Q;  4ABN A;  3PF5 A;  2N55 A;  1GUT A;  3L9A X;  2WP8 J;  1EIY B;  1SAP A;  4JV5 L;  1SYD A;  1X3P A;  4GS3 A;  4XYQ A;  3ITP A;  1A6X A;  4X3S A;  1HA6 A;  4H7B A;  1I6H B;  2K5H A;  2UXC L;  4IO9 A;  3LWE A;  4LFA L;  1IBK Q;  1XTD A;  5IE8 A;  4A3M B;  2EQS A;  3A8J E;  1LT5 D;  2HIV A;  2O5I C;  1CHQ D;  4C3I B;  2RKS A;  1QG7 A;  3URY A;  2ZXR A;  4BY7 H;  1RL2 A;  2ICE C;  5EPL A;  2ZJR A;  3C46 A;  4G7H C;  4CDD C;  1PFN A;  1TWC H;  1M90 C;  4X64 Q;  1D8L A;  3CRL C;  3D6W A;  3C3L A;  4PG3 A;  3GV6 A;  1P16 A;  3ICE A;  2KEE A;  4A3D H;  2IL8 A;  1L1O B;  3KLW A;  3I70 A;  4WRD A;  2RDH A;  3FHW A;  5JPM C;  2B3G A;  4A3G H;  2KJX A;  1AFP A;  1DXM A;  4BY7 B;  2R61 A;  1Z47 A;  1X65 A;  3UDF A;  5IP7 G;  3I55 A;  3BG3 A;  4P72 A;  1WTX A;  1HUN A;  1R9T B;  1VQK A;  4FDB A;  3T56 B;  1HA5 A;  2EYH A;  4XTC S;  2CKZ B;  4C3J H;  1YIT A;  2L1B A;  4AYB G;  1A2U A;  4RWS C;  3G7L A;  5G3L D;  4ID6 A;  3M4O H;  1S5C D;  4DAY A;  4LFB Q;  2K14 A;  3HKS A;  2FMC A;  3EFX D;  3S16 B;  1ML0 D;  2JN4 A;  2NUC A;  1H9J A;  4POG A;  3SDZ A;  1NE3 A;  1TWF B;  2PNH A;  5EAY A;  5KIX A;  4B3S Q;  4FO2 A;  5FLM G;  2QGQ A;  1LTB D;  1WTP A;  1HPC A;  1GOZ A;  4DV2 L;  2PCF B;  5C4J B;  4LK1 C;  4OO1 I;  4DV4 Q;  5GAH C;  1IL2 A;  4K6D A;  1D1K A;  1HNZ Q;  3MEH A;  2UXB Q;  1E7Z A;  4A3J G;  1WD0 A;  1VQH A;  3M4O B;  2K05 A;  2VW9 A;  2PZT A;  2LS0 1;  2YYZ A;  3PUY A;  4N8F A;  4DR1 Q;  2MUY A;  1STY A;  4RA8 A;  3K5M A;  4HSV A;  4FF3 A;  2KCN A;  3GTJ B;  1E3P A;  1EYC A;  4YWL A;  1PFM A;  1GUN A;  3KLS A;  4OGQ C;  2EJM A;  1B2T A;  1F2Y A;  2MJ8 A;  3CQZ B;  3RZO H;  4LNQ A;  1XYI A;  1K9M C;  1OTC A;  1SR3 A;  1IBK L;  5KGU A;  2LFN A;  2C5C A;  1DCZ A;  1SE3 A;  4ZUJ A;  2EY6 A;  2K28 A;  1PH2 A;  1VQD A;  5FO9 B;  2F0L A;  1F9P A;  1FVI A;  1SLJ A;  2XVS A;  4FF4 A;  5J1Z A;  1FJG Q;  5GRO A;  4X64 L;  1LT4 D;  3RZO B;  1JCK B;  3T1Y Q;  5KNC A;  3OWE B;  3A7A B;  2D0P A;  5C0X I;  1I3Q H;  4IJH A;  2NN6 G;  5C3E B;  2C9O A;  1E24 A;  2Q8I B;  2WKC A;  3MFY A;  3JAM E;  4BBR H;  1CTM A;  2E5L Q;  2LY7 A;  3NBH A;  1AZP A;  5GAG C;  2JA5 G;  5JVH 3;  4R9W A;  2OTL A;  2DJF C;  3SXH A;  2JEB I;  1EZ6 A;  1CSP A;  3J80 L;  3CC7 A;  3UDI A;  1EZ8 A;  2RCF A;  1SNC A;  2E75 C;  3S2H B;  1TS4 A;  4HN7 A;  3DWP A;  4ZCK A;  4LFB L;  2B2Y A;  4K8J A;  4DK1 A;  1F2L A;  1X6O A;  2KQ3 A;  1FNU A;  3A8K E;  1TS2 A;  3A56 A;  1QIL A;  4B3S L;  4RMF A;  2NZH A;  4P73 A;  1N34 Q;  3RLO A;  4BBR B;  3DWA A;  1B7Y B;  1NY4 A;  1J9O A;  2NTT A;  4DV4 L;  2PPB C;  3JC6 6;  1B50 A;  1NUC A;  1HNZ L;  4RKL A;  2UXB L;  1K8A C;  2OTJ A;  4XQJ A;  4NXM L;  1MHW C;  1UE7 A;  4J6H A;  3SHL A;  4R1J A;  4X62 Q;  2EYM A;  2WII B;  3ULP A;  1JOQ A;  2BH2 A;  2B2T A;  4K8I A;  1SMY C;  5I6W A;  4DR1 L;  1D7Q A;  3VR4 A;  5KYI A;  1K73 C;  4QB4 A;  4RKB A;  1L1O C;  3STB C;  2OQK A;  2F0E A;  2NVX H;  1NMF A;  4GKK Q;  2YV5 A;  1FR3 A;  1K3B C;  3PCO B;  2UUC Q;  1A3U A;  2N88 A;  2EOT A;  2WV6 D;  2NWG A;  1WCM G;  3J7A V;  1HUM A;  1BCP F;  2E8G A;  1X3G A;  2K5Q A;  2XWB B;  1C48 A;  1KNE A;  2CVR A;  5ELC A;  3VA5 A;  1F9S A;  1FNW A;  4PQX A;  3VR3 A;  4JVZ A;  3DMU A;  1FJG L;  3G6J B;  5IGB A;  2K01 A;  1EY6 A;  3CU7 A;  2Y0S E;  2NVX B;  3T1Y L;  2A69 D;  4J8Q A;  5C44 H;  4OEM B;  4LF6 Q;  5IY0 A;  1HQR D;  1JJG A;  3PQI A;  4QF4 A;  3CCM A;  3K0X A;  4OON A;  1CK1 A;  1I50 H;  4NKL A;  3HOW G;  2XWJ B;  5CYU A;  2A6E C;  2EDG A;  3NWT A;  4EQ5 A;  1C0A A;  1K8G A;  2E5L L;  2XSC A;  3D31 A;  2F1M A;  4L8J A;  3HOX G;  5IYC H;  4MIU A;  1S5D D;  2FMM A;  2CW0 C;  2OXP A;  1PZI D;  5I9P A;  4KLK A;  1BNZ A;  1JC7 A;  4ZK9 B;  2ZM6 Q;  5HGT A;  1DM0 B;  4Q5V A; 
#chains in the Genus database with same CATH homology
 1Y1W G;  2EIF A;  4JI3 L;  2R7Z H;  1S3O A;  4JI0 Q;  1N34 L;  4DR6 L;  2N78 A;  3CCE A;  1X56 A;  1MJC A;  2DGY A;  4APV A;  5HGQ A;  4YHH Q;  1Q46 A;  1EWI A;  4QL5 A;  4DR4 Q;  3H0G G;  4X66 L;  4JI1 Q;  4HIK A;  1I94 L;  1SFO H;  2HQL A;  4NB3 A;  3F2B A;  3H15 A;  3UDX A;  3G6E A;  2R92 H;  3S1M H;  3PUX A;  1XMQ Q;  1WYD A;  4DV1 Q;  3I4M H;  4LF8 Q;  5LMN L;  1BVS A;  4Y7N H;  3CCQ A;  2JA6 H;  4X62 L;  4KI0 A;  1EQR A;  1K83 H;  2E2H H;  5C44 G;  4DR5 Q;  2AWN A;  4LW1 A;  1G6P A;  1QVC A;  2VUM G;  1YHA A;  2LXJ A;  3HKZ G;  2Q2I A;  3PUZ A;  2UXD L;  3CCR A;  1UE1 A;  4A3B G;  4O0A A;  4DR6 Q;  3CCV A;  1V1Q A;  4DV5 Q;  1EUJ A;  5C3E G;  4ALP A;  1GM5 A;  2K5V A;  4DR7 L;  4EX5 A;  4JV5 Q;  4JI7 Q;  2GVB A;  2V1C C;  3CF5 A;  1I94 Q;  1IYJ B;  1GD7 A;  4OX9 L;  4AH6 A;  1YJ9 A;  4A3L H;  2MQH A;  1PVO A;  1KAW A;  2Q2H A;  3NEL A;  4O2D A;  1N9W A;  5IYC G;  2UXC Q;  4LFA Q;  3EIV A;  1XPO A;  4GKK L;  3UE0 A;  3J7A 5;  1NMG A;  4X65 Q;  2HIX A;  1IBL L;  2UUC L;  3S1Q H;  3CXC A;  1A8V A;  4UPA A;  4GOP A;  4DUZ Q;  1CKO A;  1L2F A;  2RF4 A;  1Y14 B;  5IP9 H;  4LUO A;  3CME A;  4DUY L;  4X6A H;  1BBU A;  1VQM A;  1YVC A;  1SRO A;  5ELO A;  2B63 H;  2LXK A;  4GNX B;  2UXD Q;  2GVA A;  2PI2 A;  4QGU A;  3KFU A;  4P75 A;  4P74 A;  1PH1 A;  2R6G A;  2YTX A;  1XPU A;  1Q81 C;  3HOZ H;  1NTG A;  3E9I A;  3W1B A;  4A3F G;  4DK6 C;  5IT9 c;  4TQU S;  2R7Z G;  3VDY A;  4LF7 Q;  2Y0S G;  5GQO A;  2D62 A;  3TRE A;  4HIO A;  3E9H A;  3PF4 A;  3AFQ A;  1LYL A;  5GAD C;  1QVF A;  1LM0 A;  1SRU A;  5JJL A;  1HH2 P;  2RHQ B;  1K0R A;  3GD7 A;  3J80 c;  4GNX A;  3RN5 A;  2AKW B;  2UUA L;  1KD1 C;  3E0E A;  1VQL A;  2JA8 H;  3S1R H;  1YI2 A;  3J81 j;  4LF6 L;  2R92 G;  1Q1E A;  4A93 H;  2IX1 A;  4BBS H;  2ES2 A;  4IJL A;  1QZH A;  1Q86 C;  3CC2 A;  3CC4 A;  4JI2 L;  4GOP C;  1XPR A;  3I4M G;  4LWC A;  4DUY Q;  1YIJ A;  3RN2 A;  2PMZ E;  2JA6 G;  2CWP A;  1VQ9 A;  4GLV B;  3TEH B;  2JA9 A;  4JYA Q;  1PYB A;  4GKJ Q;  1XNR Q;  2MFI A;  3RLN A;  2A8V A;  4MTN A;  1J5E L;  3JAM c;  1L0W A;  2QA4 A;  2WB1 G;  4HID A;  4RG1 A;  4HJ8 A;  4A75 A;  4L5S A;  2K4K A;  4IFD I;  1S40 A;  5C4X H;  1M1K C;  1KRS A;  1Y1V H;  4DV3 Q;  1LUZ A;  4AYB E;  5FJ8 H;  3RR5 A;  3U50 C;  2JEA I;  2UUB L;  4BXX H;  5M5Y H;  2MNA A;  1XMO Q;  2NVQ H;  4IOA A;  2H5X A;  2IHE A;  1O7I A;  2GN5 A;  1YNX A;  4A3L G;  4IPG A;  5K36 G;  2ZM6 L;  1B8A A;  3K8A A;  3OW2 A;  3HOV H;  1VQ6 A;  2Z0S A;  1NBW A;  2LSS A;  1VCI A;  1VQ4 A;  3HOU H;  1N32 L;  4NPS A;  1N8R C;  1PH4 A;  4JI0 L;  4JI4 Q;  1HJP A;  2IHF A;  4DV2 Q;  3I7F A;  4YY3 Q;  4HJA A;  4YHH L;  3KJP A;  4DR2 Q;  2B63 G;  2MO0 A;  4DR4 L;  1X3E A;  4JI1 L;  3F1Z A;  1HZA A;  3K81 C;  3HOY H;  2Q2T A;  3HOZ G;  1UWV A;  2BA1 A;  2FXQ A;  3CAM A;  4YCW A;  1X9N A;  1H95 A;  1Q1B A;  1N33 Q;  3TRZ A;  1WJJ A;  2DUD A;  2L15 A;  3CCJ A;  3I4N H;  4DV1 L;  4LF8 L;  1KIX A;  2OQ0 A;  1GKH A;  3S15 H;  2A19 A;  3J81 i;  4LF9 Q;  5IP7 H;  3GTK H;  1PH5 A;  2JA8 G;  4DR5 L;  1C7Y A;  1W3S A;  5J3B A;  1WI5 A;  4POF A;  3CCL A;  2F52 A;  4OWT B;  5JJK A;  3DM3 A;  4A93 G;  4IFD G;  4GN4 B;  1J6Q A;  4BBS G;  1N32 Q;  1AE3 A;  3PF5 A;  2N49 A;  2R7F A;  1HR0 W;  5M3M H;  4DV6 Q;  1MIU A;  5IYD H;  3KF8 B;  4DV5 L;  2WP8 J;  3KYH C;  4GN5 A;  1KHI A;  3CMA A;  1KC8 C;  1P8L A;  1EIY B;  4JCV E;  3L2P A;  3AEV A;  4JV5 L;  1Q8K A;  4JI7 L;  4GS3 A;  4IPH A;  4ME3 A;  2EXD A;  3M7N A;  5ELN A;  3TS2 A;  1OXU A;  2K5H A;  3GTG H;  2JQO A;  4J15 A;  2UXC L;  3EN2 A;  4IO9 A;  4GLX A;  4LFA L;  1IBK Q;  1PA6 A;  3WWV A;  5C4X G;  1XTD A;  1Y1V G;  5IE8 A;  4HIM A;  2EQS A;  4X65 L;  3S1N H;  5BR8 Q;  2HIV A;  5FJ8 G;  2B29 A;  1BKB A;  1X55 A;  5FLM H;  4BXX G;  3PUV A;  4DUZ L;  4MNO A;  2K52 A;  2KHJ A;  4A4I A;  2KBN A;  2ASB A;  4BY7 H;  3CPW A;  1RL2 A;  2ZJR A;  1Q7Y C;  3PIO A;  3HOV G;  1TWC H;  1M90 C;  3HOU G;  2OWO A;  4A3J H;  4X64 Q;  3OTO Q;  2WAQ G;  5JJI A;  3PO2 H;  3MXN B;  4LF7 L;  1D8L A;  3A0J A;  4HJ9 A;  4K0K Q;  4PG3 A;  2RHS B;  1P16 A;  1KQS A;  1JMC A;  3KDF B;  3STB D;  3ICE A;  2Q2U A;  1E22 A;  2XTI A;  1SN8 A;  2AMC B;  4IPD A;  5DLQ E;  4DR3 Q;  1T9H A;  2E2I H;  4B3T Q;  3GTL H;  3HOY G;  1VQN A;  4IFD J;  1WFQ A;  1VQ8 A;  4A3D H;  3BU2 A;  1L1O B;  3KLW A;  4B3M Q;  3FHW A;  4LUZ A;  3I4N G;  4WJ4 A;  2B3G A;  3PO3 H;  3ULL A;  1GVP A;  4A3G H;  2I5L X;  2I5M X;  2HHH Q;  3CPF A;  1E1T A;  4R4T A;  1Z47 A;  1X65 A;  2F3I A;  3UDF A;  5IP7 G;  3I55 A;  5LMU Q;  4JYA L;  4P72 A;  4DAY B;  4GKJ L;  4L5T A;  4YWK A;  2C35 B;  1XNR L;  1VQK A;  3U4Z A;  2R7D A;  3M85 A;  4DV0 Q;  4FDB A;  3GTO H;  1KXL A;  1L1O A;  3PGZ A;  4XTC S;  1UEB A;  2CKZ B;  4JI5 Q;  4BA2 I;  4C3J H;  1YIT A;  1VQB A;  2QEX A;  5M3M G;  5HY6 A;  1XJV A;  5IYD G;  4AYB G;  1V43 A;  3Q8D A;  1YJW A;  4DV3 L;  1NJI C;  2E2J H;  1YHB A;  4C2M H;  3M4O H;  1XMO L;  3MEF A;  4LFB Q;  2K14 A;  4L5R C;  4PMW A;  1IBM Q;  1I5F A;  3HKS A;  3A5U A;  3GDE A;  1VQO A;  1CKN B;  2KCM A;  3PIP A;  1N36 Q;  3S2D H;  4POG A;  1X54 A;  1NE3 A;  2PNH A;  2K75 A;  5EAY A;  1PH3 A;  1EYG A;  3RNU A;  4B3S Q;  4JOI A;  5FLM G;  2QGQ A;  2F4V Q;  3J7Z C;  1IXR A;  1FGU A;  4JI4 L;  2VL6 A;  3U58 A;  4A3K H;  4DV2 L;  4A3I H;  4JBW A;  4PZ8 A;  1VQE A;  4YY3 L;  3U4V A;  4OO1 I;  4DV4 Q;  5GAH C;  2ALY B;  1IL2 A;  4DR2 L;  1EFW A;  4BY7 G;  1PFS A;  1VQI A;  1CKN A;  1HNZ Q;  1AH9 A;  2UXB Q;  2VS1 A;  4BY1 H;  3H3V I;  2VNU D;  1HR0 Q;  1YBY A;  1E7Z A;  4JBJ A;  4A3J G;  1Q82 C;  1VQG A;  1VQH A;  3CW2 C;  4LUV A;  4QIW E;  1TWH H;  1PH8 A;  1N33 L;  2A1A A;  3PO2 G;  2JA7 H;  3GTM H;  3S24 A;  1UE6 A;  5IYB H;  4MZ9 A;  2VW9 A;  2JK8 A;  4TVA B;  4GNX C;  1VQP A;  4QY7 A;  2KEN A;  4L5Q A;  2I5H A;  4IOC A;  4UP7 A;  4LF9 L;  2KCT A;  2YYZ A;  4PZ7 A;  4JBK A;  4A3D G;  3PUY A;  2CCZ A;  2NVY H;  2JA5 H;  3CP0 A;  1DGS A;  1IZ6 A;  4DR1 Q;  3ERS X;  2NVT H;  4B3R Q;  2R93 H;  1VQF A;  2BH8 A;  2NN6 I;  2VQE Q;  3M4Q A;  4JOI C;  4OWW B;  3PO3 G;  5IP9 G;  4A3G G;  3D0F A;  1VS0 A;  2IT1 A;  4DV6 L;  1E3P A;  4YWL A;  5LMN W;  4LFC Q;  3UDG A;  1XNQ Q;  4JI6 L;  4XIG S;  3RZO H;  4LNQ A;  3ZJY C;  1FL0 A;  4LF5 Q;  4HJ5 A;  1I6H H;  1ASZ A;  1K9M C;  3HFZ B;  5H1S E;  1OTC A;  1SR3 A;  4A3C H;  1RIP A;  2K50 A;  3CCS A;  3T1H Q;  1IBK L;  2CWA A;  2MO1 A;  4PZ6 A;  1E1O A;  5FLX c;  4A3M H;  2KHI A;  1JJ2 A;  4A3B H;  5BR8 L;  1HNX Q;  5M5W H;  4UP8 A;  4OO1 G;  2JJQ A;  4LF4 Q;  4DKA C;  1PH2 A;  1VQ5 A;  4C3I H;  5IWA Q;  1VQD A;  1PH9 A;  3GTQ H;  3NEN A;  4DV7 Q;  4R4C A;  1OXT A;  3G71 A;  4BA1 I;  1FVI A;  1SLJ A;  3BZK A;  3AQQ A;  1FJG Q;  5GRO A;  4X64 L;  3OTO L;  1AE2 A;  3BJU A;  3W1G A;  2WB1 E;  4A3I G;  3FKI H;  4A3K G;  4K0K L;  1PV4 A;  4JI6 Q;  5E7N A;  2PQA B;  3A5Z B;  5AJ3 Q;  3T1Y Q;  4DPG A;  4QJF A;  4GN3 B;  2YTY A;  2ZJQ A;  4DR3 L;  3NBH B;  1TXY A;  2D0P A;  2RCN A;  4BY1 G;  4B3T L;  3K7A H;  3GTP H;  1LTL A;  1VQJ A;  3F2C A;  5C0X I;  1I3Q H;  4IJH A;  4B3M L;  2NN6 G;  1QZG A;  1A62 A;  2Z6K A;  2IX0 A;  5IYB G;  4A3F H;  3M9B A;  1E24 A;  1HZB A;  4UP9 A;  2HHH L;  2CQO A;  2PQA A;  1G29 1;  1KL9 A;  4JC0 A;  5LMU L;  4BBR H;  3J81 c;  1W2B A;  2E5L Q;  1Q12 A;  5GAG C;  4DV0 L;  1R9T H;  2JA5 G;  2OTL A;  2R93 G;  3GO5 A;  2JEB I;  4OWX B;  3ER0 A;  4JI5 L;  4DNI A;  1CSP A;  3CC7 A;  3UDI A;  3DLL A;  2UU9 Q;  1VQ7 A;  3AYH B;  1K3R A;  1WCM H;  4QQB X;  4JI8 Q;  4GLA C;  1G51 A;  4YCV A;  4LFB L;  1IBM L;  2N8N A;  1TWG H;  3G48 A;  1X6O A;  3IRB A;  5JEA G;  1ASY A;  4KHZ A;  1A63 A;  4A3C G;  1YEZ A;  4AQY Q;  3S16 H;  1N36 L;  2Z6K C;  2VY3 A;  1PH7 A;  3SGI A;  4B3S L;  3CD6 A;  4RMF A;  4A3M G;  4JI3 Q;  3S14 H;  1TWF H;  2NZO A;  2NZH A;  4P73 A;  3RLO A;  1N34 Q;  1YJN A;  1HZC A;  2F4V L;  3S17 H;  4KHP L;  3KDF A;  1PH6 A;  1B7Y B;  1JE5 A;  2D0O A;  3PSI A;  4GOP B;  1EIF A;  1NY4 A;  4JG2 A;  3J80 i;  5C4J H;  4X66 Q;  4DV4 L;  3JC6 6;  3KF6 B;  2IY5 B;  1VQC A;  1HNZ L;  2UXB L;  1K8A C;  3OYY A;  1CSQ A;  5C0X G;  2OTJ A;  4NXM L;  1HR0 L;  2HT1 A;  1VQA A;  2VQF L;  1UE7 A;  2BA0 A;  5LMN Q;  3FKI G;  4R1J A;  3HOW H;  3TS0 A;  2K5N A;  1A0I A;  4X62 Q;  3RZD H;  1YHQ A;  3ULP A;  1OXS C;  2BH2 A;  3KF6 A;  1QUQ B;  1QVG A;  3H3V H;  3JAM i;  4YWM A;  5M3F H;  1KRT A;  2ATW A;  3HOX H;  3M3Y H;  4DR1 L;  4B3R L;  3UE1 A;  4NXN L;  3HKZ E;  2VQE L;  4KHP Q;  1UE5 A;  1D7Q A;  1U5K A;  2ID0 A;  2ZTC A;  4DR7 Q;  1HZ9 A;  3GTJ H;  1K73 C;  1EOV A;  4LFC L;  5M5X H;  1XNQ L;  4BBR G;  4A3E H;  3F2D A;  2WAQ E;  1L1O C;  3L0O A;  3STB C;  1QUQ A;  5JEA J;  2OQK A;  4OX9 Q;  3F8T A;  1BBW A;  2NVX H;  3CQZ H;  1NMF A;  4NXM Q;  1JJC B;  1WOC A;  4LF5 L;  2VQF Q;  2YV5 A;  4GKK Q;  1C9O A;  1HNW L;  3PCO B;  3T1H L;  1IBL Q;  2UUC Q;  1SMX A;  1Y1W H;  1SE8 A;  1WCM G;  1HNX L;  3G4S A;  3W5O A;  4AIM A;  1V9P A;  3BZC A;  2E8G A;  4LF4 L;  1OXV A;  1X3G A;  3K7U C;  3K80 C;  4P71 A;  1GO3 E;  3H0G H;  5IWA L;  3AFP A;  5C0X J;  1OXX K;  4NXN Q;  4DV7 L;  4DK3 C;  1Z9F A;  4R4I A;  3I56 A;  3ULJ A;  1U0L A;  2ZTE A;  4R4Q A;  1FJG L;  3FP9 A;  1EQQ A;  2VZA A;  2ZTD A;  1B70 B;  4IPC A;  1MJE A;  4HJ7 A;  2Y0S E;  3LGJ A;  4OXP A;  2XGT A;  4R4O A;  5AJ3 L;  3T1Y L;  3I2Z A;  4C3H H;  5C44 H;  5GAE C;  2UUA Q;  1HNW Q;  4LF6 Q;  5IY0 A;  3I4O A;  2VUM H;  1JJG A;  2ZJP A;  1CUK A;  2N3S A;  3CCM A;  4JI2 Q;  3M4P A;  3K0X A;  4OON A;  3KJO A;  2YU9 H;  1I50 H;  2PI2 E;  3HOW G;  3EBE A;  5C3E H;  3PUW A;  2YTV A;  4EQ5 A;  1YZ6 A;  1C0A A;  1K8G A;  1PYS B;  2E5L L;  3CCU A;  5M3F G;  4H02 A;  3PV0 A;  3D31 A;  1JT8 A;  3RLF A;  1J5E Q;  3HOX G;  2I0Q A;  5IYC H;  3B6Y A;  1MKH A;  2WFW A;  2AHO B;  4DAM A;  1X3F A;  1PHJ A;  3L7Z C;  4A76 A;  2UU9 L;  2CFM A;  1XMQ L;  1JB7 A;  2UUB Q;  4A3E G;  2OCE A;  3S2H H;  4KLK A;  4JI8 L;  3A74 A;  1S72 A;  3NEM A;  3TQY A;  2ZM6 Q;  4YCU A;  1CKM A;  4JBM A;  2JE6 I;  3KOJ A;  4Y52 H;  4UY8 C;  4WJ3 M;  4AQY L;  1TWA H;  2JA7 G;  2AWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...