1X65A

Solution structure of the third cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
89
structure length
89
Chain Sequence
GSSGSSGREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNR protein
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 3
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x65A01
4DR5L 3G71A 2ZJPA 1VQCA 4L5RC 4A93G 3UDXA 3EN2A 1J5EL 2AMCB 4GKKL 4HJ8A 4DUZQ 4JI3L 1FJGQ 1YJ9A 5IYBG 3KF6B 1YHQA 3I55A 2UU9Q 4JI0L 2VUMG 4DV5L 1LTLA 4KHPL 4A76A 1CSQA 3E9HA 2VY3A 3AYHB 4IFDI 1NTGA 4R4CA 3S17H 3PUYA 4HIKA 4P75A 1EWIA 1Y1WG 4NXNQ 1TWFH 3ULLA 3A74A 1ASZA 3G6EA 3K0XA 3CCRA 3S14H 1SROA 1V43A 1T9HA 2N3SA 4YWLA 3J81j 1OTCA 1XNRQ 2E5LL 4DV7Q 4P74A 4C3JH 3CCVA 2QA4A 4B3MQ 2UXBL 3G48A 4GNXC 3A5UA 3GTQH 1L0WA 1VQ7A 4HIOA 5IP9H 1CKNB 4DK3C 2KCMA 2A8VA 5C44G 1KHIA 1JT8A 1B70B 4K0KQ 2NN6G 3CCEA 2ZM6Q 1I50H 1NE3A 2XTIA 5GQOA 3DLLA 4GLXA 4LF5L 4A3DH 4JBMA 1HNWQ 4JI6L 2R7DA 3TS2A 3HOZG 4LF8Q 5BR8Q 2NVQH 4GN4B 2JQOA 4A3KG 4A75A 1XMOQ 2GVAA 3MEFA 1XPUA 3GTJH 4DR3L 2IHEA 4NB3A 1VQKA 4KI0A 4A3MG 4C3IH 3KLWA 4JI4L 4YHHL 5EAYA 4YY3L 2ASBA 3I4NH 1QUQB 4JI5Q 4A93H 4DV4L 1UE5A 5GAGC 4YCUA 3ERSX 1WJJA 5IYBH 1WFQA 3HOWG 1KD1C 1HZ9A 3W5OA 4YCWA 4JYAL 1Q1EA 1TWCH 3HFZB 2WB1G 4L5TA 4GOPB 2WAQG 2YYZA 1EFWA 1V9PA 4DR2L 4P73A 1O7IA 2Z0SA 4JBWA 5LMNW 4A3EG 2D0PA 3ULJA 5JJIA 3W1GA 1Y1WH 4L5SA 5HGQA 4X64L 2E2JH 3G4SA 4LF7Q 1EQQA 5GADC 1VQ5A 1XNQQ 1IYJB 3M4QA 4JI1Q 1SLJA 1UWVA 4R1JA 4JI2Q 4OX9Q 4IPHA 4YWKA 3LGJA 4JI7L 3HOVG 5IYDG 1C9OA 4PZ6A 4R4TA 1MKHA 3CCSA 3BU2A 2V1CC 5C44H 2R92G 3T1YL 1E1TA 1I94L 2WB1E 2Y0SG 3K8AA 2UUAQ 1JMCA 5C0XI 1IZ6A 3J80c 2F4VQ 1Q1BA 2GVBA 1OXVA 4DUZL 3UDGA 4GLAC 2Q2UA 1FJGL 2NVTH 3CW2C 2DGYA 3I4MG 3F1ZA 4LFAQ 2E8GA 4RMFA 1M1KC 4QY7A 4LF9Q 1OXUA 2OTJA 1Q8KA 2UXDQ 1LUZA 5J3BA 4GNXB 4JOIC 3U4ZA 2WP8J 3A5ZB 2VL6A 2Z6KC 4NXNL 1WI5A 3T1HL 1OXXK 3NBHB 4B3SL 1S72A 4POFA 1EYGA 5IP7H 1BVSA 1M90C 2ZTDA 1SFOH 2CCZA 1K73C 2ES2A 4IOAA 1TWHH 1VQBA 3HOXG 1QVFA 4B3ML 1VQAA 2K75A 2I5HA 3RNUA 1EOVA 4DNIA 4R4IA 3U58A 1UEBA 4R4OA 4NXMQ 1YJWA 3CC7A 1VQNA 4A3EH 1RL2A 2PMZE 1K0RA 1YHBA 3K7AH 1SRUA 3KF6A 4AYBG 1CSPA 4IPDA 1VQDA 4AYBE 2ZM6L 3RN2A 1KQSA 3GTLH 1UE1A 2EIFA 1UE7A 3M3YH 1VQHA 2JA9A 4LF8L 2NVXH 5FLMH 3RZOH 3H15A 4DV1L 4A3FG 5IP9G 1PYSB 3I56A 4B3RL 4P71A 3E9IA 3HOVH 5C4XH 4H02A 1K3RA 3CMEA 1PA6A 1KAWA 3Q8DA 4ALPA 1JJ2A 1IBMQ 4UP7A 1QZGA 2RCNA 1NMGA 4LUZA 2ZJQA 4JG2A 4A3DG 4IJLA 1H95A 1PHJA 4LNQA 2BA0A 5HY6A 1MJEA 1X6OA 1X54A 1VS0A 5IWAQ 4A3JG 4IFDG 3STBC 2C35B 3JAMi 2KBNA 1NJIC 1N34Q 3I2ZA 4NPSA 1G6PA 1IBLQ 1E22A 2LXJA 5IYCG 1HNZQ 4X66Q 3J81i 4DUYQ 1D8LA 2OCEA 3I4NG 1KC8C 2ZTEA 3S15H 4IPGA 4BXXG 3F2DA 4DV3Q 5JJLA 2E2IH 1E3PA 2OWOA 4BA1I 2WFWA 2F3IA 4JI1L 4FDBA 3TREA 4A4IA 3EBEA 3HOXH 3K7UC 4JI2L 2B63H 3TS0A 4LFBQ 1CKMA 3RR5A 3UE1A 1N36Q 3M9BA 3I4OA 3HOUG 3UDFA 3B6YA 1QUQA 4A3BH 3KF8B 4AQYQ 4AH6A 3GTGH 3RLFA 4DR6L 4EX5A 2PQAB 3CCLA 2VNUD 2JJQA 1V1QA 1VQGA 4HJ9A 1BBUA 1NY4A 3TQYA 3KJPA 3GDEA 3RZDH 3U4VA 2UUAL 3GTKH 2R93H 2BH8A 2F4VL 3H3VI 1N33Q 2ZJRA 5DLQE 4P72A 2N49A 3S24A 2VQEQ 4GOPA 3OTOL 1Y1VH 4A3FH 4ME3A 1VQ9A 2A19A 3HKSA 4LF9L 1VQLA 2UXDL 4QJFA 2VQFL 2DUDA 5IY0A 3A0JA 4J15A 1W3SA 2JA5G 2LSSA 1Q82C 4PZ7A 3CQZH 3PO2H 5C3EH 2JEAI 1HNXQ 2ATWA 4A3JH 4DKAC 1N32Q 2BA1A 3M4PA 4X62Q 3HOYH 3FKIH 4IPCA 1R9TH 1XJVA 5IYCH 1Q12A 4GLVB 4Y7NH 3J7ZC 2AKWB 1IBKQ 2HIVA 3S1RH 5AJ3Q 4NXML 3H3VH 2A1AA 5M3FH 3F2BA 4BXXH 4IOCA 4GS3A 5IP7G 3GTOH 4BY7H 3KFUA 1FGUA 4OWWB 4KLKA 3CD6A 1Y14B 3AFQA 4JBJA 4GNXA 2OTLA 5C0XG 2R6GA 4C3HH 3L2PA 4HIDA 4B3TQ 5GROA 3BJUA 1Q86C 1L2FA 1E24A 1TWGH 4C2MH 1YITA 1IBML 1VQOA 1PH7A 2HHHL 2UUCL 3HOUH 1JJGA 1KXLA 4XTCS 2JA8G 2K5HA 4R4QA 2CFMA 1FL0A 4OWTB 1SMXA 3KDFB 1MIUA 1NBWA 1YZ6A 1WOCA 3KOJA 4X65Q 1VQ8A 5FLMG 1P8LA 2YU9H 5IWAL 3AFPA 4DV6L 3S1NH 1VCIA 1EIYB 4LF4Q 5C4XG 4TQUS 3UE0A 1G51A 3MXNB 1HR0L 3PGZA 1N34L 1VQ4A 4BBRH 1IBLL 3OYYA 1PFSA 1QZHA 3ZJYC 2RHQB 4QQBX 1KIXA 1J6QA 3NELA 2EQSA 4DR5Q 1A8VA 2ID0A 1BKBA 2JA5H 3KJOA 2IT1A 1RIPA 2UU9L 4GKKQ 2NZHA 1VQMA 4JI3Q 1IXRA 4UP8A 1SN8A 4L5QA 3CCJA 1K83H 4DV5Q 3PV0A 4KHPQ 1I6HH 1HZAA 2I5LX 2N78A 4LFBL 4QIWE 1HJPA 2K14A 1N36L 1PH3A 5LMNQ 4A3GG 2GN5A 2KHIA 1AE3A 1XNRL 5M5YH 4DV7L 1G291 3PSIA 1X3EA 1U5KA 1YEZA 5M3MG 2E5LQ 4OONA 2B63G 2VQEL 3PO2G 4BA2I 4JV5Q 2UXBQ 2L15A 4A3BG 1KL9A 4HJ7A 4IJHA 2R7FA 2Q2TA 2QGQA 2ALYB 1KRSA 4K0KL 2CKZB 3M85A 4DR1Q 2JA8H 2R93G 1QVCA 4DPGA 3EIVA 4XIGS 1PH8A 1HNWL 2IY5B 1L1OB 3JAMc 2VW9A 2YTYA 3M4OH 3KYHC 5BR8L 5GAHC 1Y1VG 2KENA 1XPOA 3NEMA 1XMOL 1Q7YC 2F52A 2VZAA 2PI2E 2ZTCA 3PUWA 1HR0W 4DAMA 3D0FA 2KCTA 3WWVA 1GO3E 1MJCA 3W1BA 2MFIA 2JE6I 2PQAA 3STBD 1VQFA 1W2BA 2Q2HA 4JOIA 4JI5L 4JI4Q 4GN5A 5ELNA 5JEAG 4YY3Q 1U0LA 2KHJA 2Z6KA 5C3EG 4YHHQ 3F2CA 1DGSA 4DV4Q 3K80C 4LWCA 5FLXc 1YIJA 3HOYG 4DK6C 4DR4Q 4QGUA 3FKIG 3PIPA 1PH5A 2I5MX 3VDYA 1P16A 1XMQQ 3PO3G 5LMUQ 2EXDA 4JYAQ 4O2DA 5ELOA 4POGA 2K50A 4B3TL 4A3IG 3RLNA 5M3FG 1K9MC 4DR2Q 1YJNA 4BY7G 4A3GH 4WJ4A 4LF7L 3CCQA 1PVOA 4X64Q 1K8AC 4PMWA 2B3GA 3CC2A 5FJ8H 1NMFA 1XNQL 5M5WH 2K5VA 4OX9L 2AWOA 5M3MH 1EUJA 4IFDJ 2JA6H 2AWNA 4TVAB 3CC4A 1A63A 3S16H 1OXTA 2UUBQ 4APVA 4JI7Q 1XPRA 2YV5A 3H0GH 4LW1A 1PH6A 3DM3A 2R7ZG 4JI8Q 4WJ3M 3CCMA 3T1YQ 1I94Q 4DV2Q 2Q2IA 5K36G 1A0IA 1YI2A 4LFAL 1JJCB 4BBRG 4YCVA 5JJKA 1WYDA 2HQLA 1TWAH 3GTMH 3UDIA 2K52A 2MO1A 3JC66 2JA7H 4GKJQ 4BY1H 4OO1I 2QEXA 4RG1A 3KDFA 5LMNL 4A3LG 1S3OA 2PI2A 1Z47A 3T1HQ 4LUOA 1YVCA 3K81C 4OXPA 1X55A 4B3SQ 2VS1A 1X9NA 1EIFA 1K8GA 3S1QH 1X3GA 5IT9c 3FP9A 4LF6Q 3PO3H 4BBSH 1B7YB 1HZBA 4DV0Q 4LFCQ 4JV5L 3BZCA 4UP9A 3S2DH 3AQQA 2K4KA 1L1OC 1VQJA 2HIXA 1B8AA 2N8NA 1GKHA 4MNOA 3PIOA 4A3IH 2UXCQ 3D31A 3RN5A 3GO5A 2HT1A 1GVPA 4DR1L 2I0QA 1SE8A 3F8TA 4A3CH 3AEVA 2D62A 2FXQA 4GN3B 1PH1A 2BH2A 1VQEA 3NENA 3SGIA 2OQKA 3CXCA 5M5XH 3CCUA 4EQ5A 4DV1Q 4HJ5A 4B3RQ 1TXYA 1LYLA 1E1OA 4AIMA 3J7A5 2JK8A 1I5FA 1X65A 3S2HH 1BBWA 4QL5A 2R7ZH 4DR7Q 5IE8A 1KRTA 1OXSC 2IX0A 1YBYA 2OQ0A 4KHZA 2VUMH 3I7FA 5C4JH 1WCMG 4DR4L 2NN6I 1HNZL 2CWAA 4X66L 1CKOA 1N9WA 1XMQL 5LMUL 4DUYL 3E0EA 1C7YA 2IX1A 3PF4A 5C0XJ 1PV4A 3ICEA 1J5EQ 1L1OA 2IHFA 2LXKA 4DV3L 1S40A 4A3LH 1JE5A 4MZ9A 4JI0Q 1UE6A 3PUZA 1VQPA 2NZOA 3FHWA 1N8RC 3TRZA 2CWPA 2UUBL 1E7ZA 4AQYL 2MO0A 4JI8L 2H5XA 1PH2A 1YHAA 4DR6Q 5FJ8G 3PUVA 2XGTA 3RLOA 1Q81C 2CQOA 4YWMA 4DV2L 1N33L 1HZCA 2WAQE 2JA6G 3GTPH 3HKZG 3HOZH 1VQ6A 3OTOQ 2K5NA 1VQIA 3H0GG 1AE2A 4MTNA 4PG3A 4A3KH 4LUVA 4HJAA 1XTDA 2VQFQ 4GKJL 4O0AA 4Y52H 4UPAA 1C0AA 4A3MH 4LF5Q 2MQHA 5E7NA 1PH4A 4JI6Q 1HNXL 3L7ZC 1ASYA 3J81c 2YTVA 2MNAA 3U50C 4DAYB 4PZ8A 1A62A 1JB7A 1N32L 2RF4A 4X62L 3M7NA 3J80i 1WCMH 3OW2A 3HOWH 1HH2P 4LF6L 4DR3Q 2B29A 2JA7G 3CP0A 4BY1G 2Y0SE 1CUKA 1IBKL 4LFCL 4DV0L 1D7QA 3ER0A 4JCVE 5AJ3L 2PNHA 3HKZE 3CF5A 3CPWA 3PUXA 4X6AH 2UXCL 2AHOB 1PH9A 3ULPA 1PYBA 2NVYH 2D0OA 3IRBA 3PF5A 3PCOB 1Z9FA 4JC0A 1X56A 3CPFA 1QVGA 1Q46A 1GM5A 3CAMA 3S1MH 2JEBI 3CMAA 2RHSB 1X3FA 5IYDH 1YNXA 1SR3A 2UUCQ 1GD7A 1LM0A 4UY8C 4OWXB 5H1SE 3GD7A 2HHHQ 4DR7L 4BBSG 4A3CG 2R92H 2E2HH 4X65L 5JEAJ 4JBKA 5GAEC 4OO1G 3BZKA 2YTXA 4LF4L 4GOPC 4DV6Q 4IO9A 3L0OA 1HR0Q 1IL2A 1EQRA 3I4MH 1FVIA 3TEHB 4HIMA 1AH9A 1CKNA 1I3QH
chains in the Genus database with same CATH superfamily
2F3VA 3G71A 1X3QA 4DUZQ 1YJ9A 3KF6B 2Z1CA 1LTLA 1NR2A 3E9HA 1HQRD 3BYTB 1EU4A 1NTGA 4P75A 1EWIA 1ASZA 5G3LD 1V43A 1O7LA 1SJED 4P74A 4C3JH 3CCVA 3G48A 5D65A 2SDFA 1SE2A 2DNCA 3CKIB 2KCMA 1JT8A 3CCEA 2ZM6Q 4LF5L 1B2TA 1WTWA 3VR5A 1PLFA 4RKBA 3TSSA 1ONLA 2JQOA 4A75A 1XMOQ 3MEFA 2NVXB 4QIWB 3GTJH 3D3RA 4PV1C 4NB3A 4KI0A 3H3VC 1W6KA 2RDHA 4KD3A 4YHHL 4YY3L 2ASBA 3I4NH 1UE5A 4YCUA 3ERSX 3LX0A 4M1UB 3U9OA 4B08A 2C5CA 1VMCA 4L5TA 2GA4B 1O7IA 5LMNW 3ULJA 5JJIA 3DEPA 1O7YA 1J9OA 1EQQA 2OEOA 4XQQA 5GADC 1WTOA 1H9RA 1IYJB 3KK7A 3T51B 1UWVA 4JI2Q 1G2TA 3M7GA 4IPHA 2AQ2B 1K3BC 4YWKA 5IYDG 2XRSD 4R4TA 5M3MB 1U4PA 3S16B 1EU3A 2Y0SG 5I4DA 1IZ6A 4I7AA 3UDGA 3GTKB 2R93B 1JOQA 2DGYA 3I4MG 4LFAQ 2E8GA 1Y1VB 2ZT9C 4LF9Q 2OTJA 1Q8KA 1LUZA 4IUTA 1JORA 2AQ1B 1FNWA 1QE6A 1LTBD 1R4QB 1EIGA 2J0TD 1WI5A 4NXNL 5EGTA 1M90C 1B50A 1TKWB 3BG3A 2ES2A 1VQBA 1EOVA 3FKIB 1WTVA 4DNIA 4R4IA 3U58A 4H44C 1VQNA 1K0RA 1YHBA 3K7AH 3TDQA 3KF6A 2XIWA 3TP8A 5EBDA 4A3IB 1AZQA 3GTLH 2DN8A 4HCEA 4X3SA 2Q8IB 3RZOH 2AQ3B 5IP9G 3E9IA 5J39A 5M5XB 1PA6A 1KAWA 3Q8DA 1JE4A 4C3HB 5I6YA 4ALPA 2RCNA 4LUZA 3D4WA 1ZEQX 3DHQA 5C5LA 5DM63 2BA0A 5HY6A 1PTOD 5KYLA 2R7ZB 1X6OA 5IODA 4IFDG 3JAMi 3I2ZA 4NPSA 3J80E 1G6PA 1UAPA 4CJ1B 1EIHA 3J81i 1D8LA 4ILWA 3S15H 1GUOA 4IPGA 3F2DA 4DV3Q 1EY9A 2E2IH 2EOTA 1RD9D 3TREA 4JI1L 1YNJC 2B63H 2F0NA 3TS0A 1IHZA 5EPLA 4H13C 4A3BH 1QJOA 4EX5A 1V1QA 2NZ1D 1ICFB 2QKIC 4HJ9A 4G57A 4P72A 2SNMA 3EFXD 3OTOL 2A19A 5IGEA 1VQLA 4WJWA 5IY0A 2FMCA 2K32A 2A68C 2JEAI 1HNXQ 2ATWA 3GV3A 1WD0A 4DKAC 3TP6A 3M4PA 4X62Q 2EY1A 1BCPF 1WCMB 1SSOA 2AKWB 3IAYA 5ELEA 2K5QA 4NXML 3MZ5A 2A1AA 1I4QA 3HG9A 5EKKA 2CW0C 4GS3A 1NUCA 3GTOH 1FGUA 4KLKA 4XT1B 1NAPA 2OTLA 2EVBA 4WRDA 1L2FA 1E24A 2UUCL 1IBML 1QG7A 4RHSA 3S1MB 4XTCS 4R4QA 1FL0A 2NBFA 1SMXA 3KDFB 1MIUA 1YZ6A 1EZ6A 5IWAL 3AFPA 4DV6L 2G9DA 4LF4Q 4FO2A 1G51A 1EYAA 1IBLL 2HD3A 3OYYA 3V2TA 2DJFC 1KIXA 3I4MB 2ID0A 3HRZC 4KK7A 2NZHA 3CCJA 1I6HH 3PV0A 1F9SA 3ERQA 3N6RA 2N78A 4LFBL 1HJPA 1TWAB 2NUCA 1N36L 4DU9A 5LMNQ 2HCCA 2KHIA 4DAVA 1BQQT 4DV7L 3S14B 4BA2I 4JV5Q 5D3DA 5NUCA 1JR0D 3QR8A 2Q2TA 1QCBD 2HUGA 1WTXA 3M85A 4LJZC 4BBSB 1II3A 2KENA 1XPOA 1CHQD 2BDOA 2F52A 2VZAA 2DY8A 3PUWA 2NVQB 1I4GA 2KOLA 2MFIA 2JE6I 3MEHA 2Q2HA 4YHHQ 4YY3Q 5C3EG 1JWSD 3DEOA 4LWCA 1YIJA 4A93B 4QGUA 1BO0A 2I5MX 2KCNA 3VDYA 1XMQQ 2VUMB 1EQVA 2EXDA 4OIKA 3K57A 5CBEE 5M3FG 4IZ8A 3TP7A 1YNJD 5G3LF 4LF7L 2B3GA 1NMFA 1Y1WB 2L5TA 2E2JB 5FKAC 1EUJA 2JA6H 4APVA 1ZYRD 1KDCA 4JI8Q 4DK1A 5K36G 1ET6A 3BDOA 5CV6A 1EY7A 4ULLA 4FVMA 2A68D 4BBRG 3GTPB 3J7AV 1CT1D 2HQLA 1GUSA 3UDIA 2JA7H 3K5MA 1AP0A 2KEDA 1F2ZA 3N52A 4Q0FA 2QEXA 3KDFA 4A3MB 2PZWA 2HQEA 5FO8B 3S1QH 4RGTA 5IT9c 2EY2A 3LWEA 1B7YB 1RHPA 3ND9A 3S2DH 2K4KA 3RN5A 1EYDA 1GVPA 5CR3A 1BDOA 3F8TA 4A3EB 3A54A 1SE3A 4RAUC 4A3CH 2BH2A 1A2TA 1VQEA 3NENA 3CXCA 3NTIA 4H0LC 4EQ5A 4HJ5A 2P5ZX 1LYLA 1E1OA 4G7ZC 1X65A 4QL5A 1ET9A 4MTKA 2L4NA 5K36H 1S5CD 3A7LA 1KRTA 4ZKBB 2A6EC 2NN6I 1HNZL 4F87A 1C7YA 1JWUD 3OOCA 5C0XJ 1PV4A 1I3QB 1PFMA 2HDMA 1K8MA 2X6GA 4MZ9A 4JI0Q 4DF7A 2M9VA 3C46A 3H6MA 1G6ZA 2UUBL 1E7ZA 4CDEC 2J4XA 2AUJD 1FNUA 3MFGA 3EJIA 4LAAA 3PQIA 3PUVA 1TWFB 1Q81C 5IGCA 3UI2A 1SYEA 3RZDB 4IUQA 3HOZH 5HGTA 3OTOQ 3IFDA 4MTNA 1I6VC 4PG3A 4A3KH 4PNYA 4HJAA 2DNEA 2X6LA 4GKJL 1PTOF 2MQHA 1I50B 4A3DB 3QG1A 4KMUC 3U50C 1JB7A 2RF4A 3J80i 3D6WA 4FF1A 3CRLC 3HOWH 5EBCA 4LF6L 4A3JB 1EY6A 4BY1G 1IBKL 4LFCL 3ER0A 3CF5A 1I4PA 3HEJA 1SYGA 4C3IB 4ZKCB 2UXCL 1PH9A 3S1RB 3M4YA 1PYBA 3IRBA 3PF5A 1CA5A 1Z9FA 1JOOA 1ESRA 2L0CA 2JEBI 4TRDA 1X3FA 1D5MC 2IW3A 3NQIA 3SDZA 1GD7A 2UUCQ 3SHLA 2QILA 1TWGB 3HOUB 4X65L 5KNDA 4JBKA 3R8BA 3BZKA 4GOPC 1GXDC 4DV6Q 2PO4A 3WOEA 1IL2A 1SNOA 2EY5A 1FVIA 1H9SB 2FMMA 1AH9A 5T1GA 4AYBE 1HQMC 4U673 4EGVA 4ZLTF 1B3QA 5CV5A 1PZID 1CHPD 2PYKA 4L5RC 3UDXA 3EN2A 1J5EL 3OHXC 2AMCB 2F0KA 4HJ8A 4GKKL 3D8GA 2F1MA 5FOBB 1EY5A 2JA5B 4TSSA 4DV5L 4KHPL 3Q24A 4DXGA 4NP5A 4R4CA 2FINB 3K0XA 5IGBA 3SVMA 4YWLA 3AU7A 4N9PA 4DV7Q 4EQOA 2VB3X 2QA4A 4B3MQ 2UXBL 1EY4A 1STGA 2LS01 1L0WA 1VQ7A 4HIOA 3GTQH 1CKNB 4DK3C 2A6HC 2QW7A 2AUKA 2PQEA 1B70B 1ENCA 1NE3A 1L0YB 3F2UA 4GZYC 5ELCA 4LF8Q 1B9MA 4GN4B 3M4OB 2F0WA 4RH6A 1SE4A 4LMQD 5DNFA 3AMUA 5I6WA 5C4XB 1VQKA 2A6ED 4QF4A 1HZ9A 4JYAL 3HFZB 1TWCH 1NSNS 4GOPB 1T5XD 5IGGA 4DR2L 4JBWA 1W6JA 4DNRB 2D0PA 3W1GA 4X64L 3G4SA 4LF7Q 2EJMA 4K14A 3AB9A 4FXGC 5CYUA 2EYPA 1C9OA 3BU2A 1DJRD 1LTTD 2V1CC 2R92G 3T56B 3K8AA 2F4VQ 2GVBA 1S4ZA 1FJGL 4GLAC 3CW2C 3F1ZA 4KKSA 4RMFA 4RHRA 4QY7A 1OXUA 1B3AA 1EWHA 5TSSA 5J3BA 1DOMA 2JN4A 4JOIC 4S3SA 3U4ZA 1KNEA 2XNAC 3T1HL 2K28A 1MD2D 2F0MA 3J7AF 4K6DA 4B3SL 3PO2B 1B53A 4POFA 1EYGA 1SFOH 2CCZA 4IOAA 1H9SA 3HOXG 4ABNA 4CDFC 3EROA 1VQAA 2K75A 2I5HA 3HOYB 2K5WA 1R9TB 4Y7NB 3PO3B 1PXUA 2EJGC 1RL2A 2Z8LA 4AYBG 1CSPA 3BYYB 1VQDA 3RN2A 4C3JG 1KQSA 4BY7B 1UE7A 2JA9A 3KBXA 3HS0C 2NVXH 2B2UA 5FLMH 4X3KA 3H15A 4A3FG 3I56A 1MSHA 3LWUA 1TS4A 3KLRA 4Z9CB 2B2VC 1JJ2A 1H95A 1X3PA 4JG2A 2B39A 5E4XA 1H9JA 1PHJA 1MJEA 4PMCA 2EYMA 2EJFC 2KBNA 1N34Q 2I46A 1E22A 5IYCG 1HNZQ 1NNXA 1HXYD 1KNAA 1PTOH 1PRTB 4FXDA 3I4NG 1KC8C 2ZTEA 1CM9A 5JJLA 1U4LA 4JPBW 1QOHA 3ITPA 5F2DA 2OWOA 4EVOA 4P2CB 2QDBA 3FRPB 2WINB 4A4IA 3EBEA 3HOXH 5CORA 1CKMA 5ISRA 3I4OA 3B6YA 1IYVA 4AH6A 1IKLA 1YNNC 3TQYA 2UUAL 3GDEA 2CH4W 1V1OA 3GTKH 2R93H 3H3VI 2K7VA 2A6HD 5DLQE 2WIIB 2N49A 2VQEQ 4GOPA 1S5BD 1Y1VH 4A3FH 4EQNA 4ME3A 1AZPA 1VQ9A 1WTHA 2UXDL 2VQFL 2DUDA 3E6ZX 2IX3A 2LSSA 1Q82C 1MGSA 3CQZH 5JEAH 1LTAD 1BNZA 4E6IA 5C6AA 3FKIH 1XJVA 5IYCH 1Q12A 4BS9A 1KDAA 3SK5A 1IBKQ 4RWSC 3H3VH 3EQLC 4A3LG 4XDXA 1CQVA 4IOCA 4KV6A 3EA6A 1TS2A 3KFUA 4OWWB 1Y14B 2KECA 3AFQA 4QMGA 4B3TQ 4HIDA 3MTSA 4C3HH 5I9PA 3C1FA 1VQOA 1PH7A 2JA8G 5KYIA 4G7OC 3RMHA 4X65Q 1RKNA 1EEFD 5M5WB 3S1NH 1F9PA 1EIYB 2PZUA 1A2UA 3PGZA 3I8ZA 1PFSA 1AEXA 2RHQB 1DM0B 3NELA 4XT3B 2EQSA 3H0GB 1A8VA 3I4LA 1BKBA 1H9MA 2IT1A 4GKKQ 4UP8A 3BVGA 4L5QA 1K83H 4HEDA 2SOBA 4DV5Q 4KHPQ 2F0PA 1HZAA 3FEWX 1V1PA 4DK0A 3MAQA 5AFWA 1PH3A 4N9TA 5CC4A 4A3GG 2MHVA 2O5IC 2Z9HA 1XNRL 3Q0AA 1G291 1X3EA 1U5KA 2NYZD 2B63G 1S5ED 2UXBQ 2L15A 4A3BG 5D14A 2QGQA 5K5PA 4DR1Q 2JA8H 2IY5B 1E2VA 1QVCA 2RSOA 4XIGS 1PZKD 1PMRA 1L1OB 3JAMc 2YTYA 1FNVA 1CZGA 5BR8L 3KLSX 3H91A 1LT3D 3I73A 1Q7YC 1SXTA 4HMJA 4DAMA 2RCFA 4PQXA 1GO3E 3GTJB 1W2BA 4JOIA 3F2CA 5FLXc 1JQYD 4DK6C 4DR4Q 1HPCA 3NXWA 2RBMA 4RFBA 1P16A 2WV6D 5C4JB 4JYAQ 1D1KA 4O2DA 2K50A 3NE5B 2B2YC 1WTQA 4DR2Q 3X3NA 4A3GH 4FXKC 4X64Q 4PMWA 1XNQL 4OX9L 1YNND 2K1BA 2F3WA 4IFDJ 2AWNA 1TY2A 3A8IE 3CC4A 1A63A 2YV5A 4UAIA 3TBIB 3K58A 2B2VA 2TSSA 4WJ3M 2Z4IA 4OHJA 4DV2Q 2Q2IA 1YI2A 3E0JA 3OW7A 1WYDA 5EPJA 3NP8A 1TWAH 3GTMH 2IJ0A 2MO1A 3JC66 4UDUC 5FO9B 1SNDA 2C9OA 5EQ0A 1SNCA 2PI2A 4KHVA 3T1HQ 1YVCA 3R2IA 3K81C 4WORA 1X55A 4B3SQ 1STHA 3IFTA 1K8GA 2H4OA 1X3GA 3DUZA 2DJGC 2HT1A 4IUPA 1JWMD 2I0QA 1SE8A 3VA5A 3R93A 5BN3A 4GN3B 3K7AB 5FO7B 3QJYA 5IIFA 1VF5C 1LT5D 3CCUA 1JB3A 1LACA 4AIMA 1GHJA 3QO2A 3J7A5 3RZOB 2JK8A 1I5FA 3S2HH 1BBWA 3MC0B 4DR7Q 1U4RA 2HDLA 1SAPA 4QUFA 1PDQA 3I70A 1OXSC 1YBYA 2V4DA 2Y0SB 2VUMH 1UNSA 2CWAA 5BN4A 5LMUL 4KJOA 2F0OA 3VR2A 2ICEC 1TU2B 4L6TB 1L1OA 2F03A 3S15B 4HCSA 2SNSA 3FHWA 2E2IB 1TR5A 4OL7A 2CWPA 2MO0A 3Q23A 1G91A 2QCPX 5L37A 4K8IA 4A3BB 1JC7A 2K5DA 4CJ2C 2M2LA 2XGTA 1Y8OB 2CQOA 1N33L 2WAQE 1S5DD 2JA6G 3GTPH 3HKZG 2XWBB 1Y8NB 1AE2A 2B8FA 1RODA 1STAA 2VQFQ 4WFN3 4Y52H 1HA5A 4RA8A 4C1NK 4A3MH 4LF5Q 1O80A 1ASYA 3T53B 2YTVA 4DAYB 1A62A 5DM73 4J6HA 1C48A 1A3TA 2JA7G 2B29A 3CP0A 4DV0L 4JCVE 1ICWA 4X6AH 3PUXA 1GHKA 2DY7A 1BF4A 3ULPA 2NVYH 2D0OA 3A56A 2KHSA 1JCKB 4V0BA 3OSOA 1QVGA 1Q46A 1GM5A 5C4ZA 3CAMA 3CMAA 4UY8C 1LM0A 4OWXB 1B4OA 2EYOA 4A3CG 2E2HH 2WACA 4FF2A 3GQBA 1FR3A 5J1ZA 3L0OA 1TQOA 3FMCA 5EKLA 2Q8TA 1EQRA 4HIMA 1A3VA 1CA6A 2A5HA 1I3QH 4DR5L 2LMCB 1SMYC 2ZJPA 1Y69U 1VQCA 5I2YA 2RQXA 1ZXTA 3DMUA 2O4XA 4JI3L 2NB0A 2NVTB 4A76A 1MBYA 3AYHB 4XYOA 3S17H 2B2YA 2QDLA 4NXNQ 5A2QL 1TWFH 3ULLA 3G6EA 1XNRQ 3MA2B 2E5LL 3Q6SA 2CW0D 4GNXC 1TWHB 3A5UA 2A8VA 5C44G 1KHIA 4XYQA 3V96A 2NN6G 3QIAA 1I50H 4A3DH 2XN9C 4JBMA 4JI6L 2R7DA 3TS2A 3HOZG 5BR8Q 5KIXA 3M3YB 4A3KG 1KLUD 1O78A 4DR3L 2IHEA 4XXEA 4C3IH 3KLWA 4JI4L 3BDCA 3P75A 4DV4L 5GAGC 1WJJA 4ID6A 1WFQA 2XWJB 3HOWG 3MVVA 4FNFA 3VYUA 2WB1G 4ZUJA 2WAQG 4J8QA 2F0HA 2YYZA 1EFWA 1V9PA 1I4RA 2Z0SA 1XTCD 3VYTA 3CHBD 4L5SA 5HGQA 1Z7TA 4DAYA 3IKJA 3NTHA 1XNQQ 4JI1Q 1SLJA 4R1JA 4OX9Q 1O7ZA 3LGJA 3HOVG 2PW5A 2EY6A 4PZ6A 1RTNA 5C44H 5ELBA 3T1YL 1AW7A 1F77A 1TVXA 1I94L 2NN6H 1AN8A 1JMCA 5C0XI 3J80c 1Q1BA 2Q2UA 2B2UC 4DUZL 1LTRD 4V190 1CTMA 1BCPC 1M1KC 2B2WA 5LL6S 4GNXB 3C3LA 2IWHA 2WP8J 2VL6A 2XVSA 3SK6A 1DCZA 3NBHB 4YIJA 4CGYB 5C3EB 5IP7H 2ZTDA 4K2KA 1K73C 1PYWD 1DXMA 2SEBD 3RNUA 4X3TA 3Q22A 4NXMQ 3CC7A 4CKEA 2PMZE 5E3FA 3RUZA 2B8GA 3S2DB 1SRUA 2L12A 5M3FB 2ZM6L 2EYFA 2EIFA 4FF3A 4B3RL 5DAUA 1PYSB 1SYBA 3HOVH 3NK9A 5C4XH 3OWFA 2LY7A 1STEA 1OO9B 4H02A 2OF1A 1IBMQ 4UP7A 1QZGA 1NMGA 2ZJQA 4IJLA 4LNQA 1IW7C 3L3OC 1X54A 5IWAQ 3STBC 1BUVT 2C35B 2YU9B 1NJIC 5IT9L 1IBLQ 1STYA 4BBRB 4N8FA 1F2YA 1K28A 4BXXG 4FF4A 5FK9C 2XRQD 2WFWA 3BZDB 4FDBA 4UHVA 4JI2L 4ZCKA 2FJ2A 1BCPB 4DNTB 4LFBQ 3R2TA 3OPOA 5EJWA 3M9BA 1N36Q 1CI3M 3KF8B 3GTGH 3RLFA 2RDFA 2PQAB 1Y8PB 2KA7A 1VQGA 1NY4A 3KJPA 3CU7A 2IL8A 2BH8A 1N33Q 2ZJRA 5M5YB 3S24A 1HUNA 1TIID 4DN4M 3HKSA 4LF9L 1CZWA 4QJFA 1RJTA 3A0JA 3VR3A 3PO2H 3SXHA 2F0EA 2G5DA 2BA1A 1BR9A 3HOYH 3URYA 4IURA 4IPCA 1R9TH 4Y7NH 3KBGA 4KJNA 4BXXH 4BY7H 3CD6A 4JBJA 4GNXA 3L2PA 2K33A 5BN5A 1HUMA 4C2MH 2JXMB 1YITA 2HHHL 1JJGA 3NBHA 2K5HA 1EZ8A 3KOJA 1NBWA 1LLRD 1WOCA 1VQ8A 3CRKC 5FLMG 1PRTC 2EYLA 4HMIA 3MXNB 1RTOA 4RCOA 2FHTA 4N8X1 1QZHA 1SNQA 3ZJYC 2FFKB 4F7XA 3DM1A 4DR5Q 4HR7B 1QNKA 4RGNA 3KJOA 2UU9L 1RIPA 5CMDA 3IL8A 1CK1A 3K6OA 4JI3Q 4Q5VA 3NHHA 3V05A 1LV9A 4RKLA 3NTKA 5C3XA 4BY1B 1AE3A 3E3XA 1HTLD 2NTSA 1F2MA 5M3MG 1YEZA 3ZYYX 2E5LQ 4OONA 2OT2A 1M8AA 1KL9A 3K5NA 4HJ7A 1DYQA 4IJHA 3MXPA 2ALYB 1KRSA 4PMBA 4K0KL 3FDTA 2R93G 3EIVA 1HNWL 1QWYA 4IN3A 2BE5C 4XQNA 1Y1VG 3RD4A 5A35A 5A2QE 4ODGA 1IW7D 2ZTCA 2KJXA 1FYCA 3K5OA 2KCTA 3KF8A 2G9HD 1MJCA 1B44D 1V1PB 3W1BA 2PQAA 4CJ0B 3STBD 1VQFA 2EZVA 2A69C 4JI5L 4JI4Q 4GN5A 5ELNA 5JEAG 2CH4A 1DGSA 4DV4Q 3K80C 4RGOS 4JW0A 1G2SA 3FKIG 2F0JA 3PIPA 1PH5A 4KKUA 3BVZA 4C56C 4QB4A 5ELOA 2LKVA 5EKIA 3VYRA 3RLNA 4A3IG 4MN3A 1K9MC 2ZXPA 4I65A 3CCQA 2PPBC 1PVOA 3CC2A 1ESFA 5FJ8H 2JYOA 5M5WH 4CBVA 3SR1A 5M3MH 4C3HG 4TVAB 2MUYA 3S16H 2UUBQ 2O2LD 5JJZA 1PTOC 3H0GH 3DM3A 2R7ZG 4ZYSA 3CCMA 3T1YQ 1ENAA 3C2PA 1I94Q 2NTTA 1WTRA 2B2TA 3OWEB 1A0IA 2KUMA 1AFPA 3TZUA 3R3OA 1JJCB 4YCVA 4R8IA 1SEBD 2F0FA 4OO1I 4GKJQ 4C1NI 3I3CA 1WTPA 5LMNL 1HCZA 2E2DC 3OMGA 1S3OA 1X32A 2EXZA 2MPMA 3OMCA 5C4HA 4HSVA 4LUOA 3MXNA 1X9NA 1SDFA 5JPNC 4LF6Q 3TP5A 1HZBA 1D5XC 5COYA 4LFCQ 1SFOB 3WOFA 4JV5L 1L1OC 1B8AA 1F9RA 1VQJA 2HIXA 4MNOA 2N8NA 4O1NA 5D3IB 3PIOA 4A3IH 2UXCQ 3D31A 3GO5A 3S9WA 3SK4A 3AEVA 2D62A 2FXQA 1PH1A 3SGIA 2OQKA 1GUGA 5M5XH 4OO1H 3G6JB 2F4IA 4XQJA 2N88A 1A3UA 4B3RQ 1TXYA 2L9HA 2RSNA 5C5MA 1PRTD 3I90A 4G4KA 2R7ZH 1E2WA 2HCIA 2QF7A 2R92B 4K5WA 1A6XA 2OQ0A 2WKDA 2QEJC 4KHZA 5C4JH 1WCMG 4CKBA 3KLSA 4X66L 1CKOA 1XMQL 5CV7A 4DUYL 3E0EA 5I9OA 3W3AA 2L11A 2PMZB 3ICEA 3MXUA 1J5EQ 1PTOB 2EE1A 2LXKA 1S40A 4A3LH 4ZK9B 2PZTA 2I07B 1VQPA 1HFGA 2NZOA 1HTPA 2CQAA 5LHY1 3TRZA 1RCVD 2E76C 2BDNA 3HOXB 3C1EA 3NWSA 4AQYL 3T4AC 5IT9E 2X69A 2ZXOA 4JI8L 1YHAA 1LTSD 1SYCA 3PIP3 2F0DA 4B9WA 4AYBB 3VR4A 1VQ6A 4C3JB 1MSGA 1VQIA 2K5NA 3K5LA 2BE5D 4LUVA 4DFAA 3D4DA 1L0XB 2Q8RE 4A3FB 2J7ZA 4CDCC 1KTKA 4UPAA 5E7NA 2WKCA 3J81c 4NDXA 1N32L 4PZ8A 2A69D 1WVLA 3CQZB 1WCMH 4IUVA 3G7LA 3ONAB 1CUKA 5AJ3L 2PNHA 3HKZE 4OEMB 3CPWA 4HN7A 2AHOB 3I4NB 3PCOB 3MHBA 1ILQA 4JC0A 1X56A 3CPFA 4FYDA 1BBXC 2K6AA 3S1MH 5E1FA 2RHSB 5IYDH 1YNXA 1Q90A 5H1SE 2HHHQ 3GD7A 4BBSG 5ELDA 4F88A 4M8AA 3LNNA 2RVLA 4H7BA 5GAEC 1B9NA 2YTXA 1IYUA 4ZAIA 3HGBA 3I4MH 3S1NB 3TEHB 3PIO3 4A93G 2F0TA 4L63B 1TT2A 1FD7D 1FJGQ 2VUMG 5IYBG 4JI0L 1YHQA 3I55A 2UU9Q 1IL8A 2L55A 1CSQA 3SK8A 4JK1C 3MWYW 1K83B 2VY3A 4IFDI 1RF2D 1C4QA 3PUYA 4HIKA 1HRJA 4KN4C 1Y1WG 1S5FD 3A74A 3CCRA 1U9RA 3S14H 1SROA 2N3SA 1T9HA 1OTCA 3J81j 1ZYRC 1CQFA 1LO5D 5IP9H 4KKTA 4K0KQ 3D6CA 4BBSH 2XTIA 5GQOA 3DLLA 4GLXA 2D9UA 1HNWQ 3QWNA 1PFBA 3GV6A 2JA8B 3GTLB 2NVQH 4IFDH 2GVAA 1XPUA 4NKLA 1LT6D 1VDZA 1EFID 1SNMA 5KNCA 4A3MG 1UUPA 2F0LA 4K5VA 5EAYA 4A93H 1QUQB 4NMZA 4JI5Q 1GUWA 2XSCA 1RDPD 4G7HC 3DWAA 2TMPA 5IYBH 2B2WC 1KD1C 3QB3A 3TMEA 2RKSA 3W5OA 1KAAA 4YCWA 1Q1EA 1SYFA 1SJHD 4K2LA 4P73A 4A3EG 4IUUA 1J8IA 1Y1WH 2E2JH 1T5EA 4HAEA 3HP3A 3JAML 1VQ5A 4A3GB 3M4QA 1WD1A 3J81L 1GUNA 4MHEA 3J7YW 4JI7L 2B63B 1MKHA 3CCSA 1M4VA 3NUCA 3E5SA 1LTID 1MHWC 1E1TA 2RDGA 2K04A 2WB1E 5IOCA 2UUAQ 5FLXL 1OXVA 1F9QA 2NVTH 3NWTA 1H9KA 1ILPA 1STNA 1KABA 2UXDQ 1LTGD 2PNRC 3NPPA 3A5ZB 3GTMB 2Z6KC 4KD4A 1OXXK 1S72A 1G8ZD 5CV4A 1BVSA 5LL6X 1TWHH 1QVFA 2BCOA 4B3ML 4KY6A 1VMPA 2F0VA 5KNBA 1UEBA 3DWQA 4R4OA 1YJWA 2R61A 4A3EH 2KQ3A 5E4WC 2F0IA 4IPDA 5DEHA 4ZQ3A 5JOBA 1VF7A 1UE1A 1SBBB 4QUCA 3SEBA 3GTOB 1VQHA 3M3YH 4LF8L 4DV1L 3O13A 4P71A 3CMEA 1K3RA 2D2CC 4A3DG 3TN2A 3S2HB 4JVZA 1VS0A 4A3JG 2LXJA 4X66Q 4C3IG 4DUYQ 4ME5A 2K03A 4K8JA 2OCEA 1EEID 4RGMA 1D2BA 4DAPA 1JOKA 1E3PA 1IKMA 3A8KE 4BA1I 2F3IA 3A7AB 3K7UC 1PFNA 1I6HB 1I4XA 3RR5A 3UE1A 4CDDC 1D6EC 3HOUG 3UDFA 1LABA 1QUQA 4AQYQ 2VNUD 4DR6L 3CCLA 1D5ZC 2JJQA 4KY7A 1BBUA 3RZDH 3U4VA 5C3WA 2F4VL 1DZ1A 1HA6A 2EYJA 3EVQA 1PRTF 3OIPA 4J1MA 4J15A 1DOLA 1W3SA 3A8JE 2JA5G 1A15A 4PZ7A 3NSWA 5C3EH 4A3JH 1N32Q 1Q8IA 1HFNA 4FP5D 1EWCA 1JICA 2E74C 4GLVB 3J7ZC 2HIVA 3S1RH 5AJ3Q 2Z4HA 1QNUA 2ZXRA 3P20A 3F2BA 5M3FH 1DD2A 5KEEA 1DOKA 4NW2A 5IP7G 3QOJA 5KGUA 2NVYB 3PMFA 3BVMA 5C0XG 2R6GA 3NBIA 5GROA 3BJUA 1Q86C 3HOUH 1TWGH 5CV8A 1KDBA 4HTHA 1E0BA 2K05A 1KXLA 3W2DA 2CFMA 4OWTB 5KRUA 3BDLA 1EY8A 1P8LA 1TS5A 2YU9H 2PCFB 2E2HB 1VCIA 2JSOA 5C4XG 4TQUS 3UE0A 1HR0L 1NCVA 2E75C 1N34L 1VQ4A 4BBRH 2JA6B 4DA2A 1EOTA 3HKZB 1K0SA 4QQBX 1R4PB 1J6QA 2K01A 2JA5H 4KY5A 1VQMA 1IXRA 1SN8A 5CV9A 3MFYA 4U68A 5ELFA 2I5LX 5HURA 4QIWE 2K14A 1EL0A 2JA7B 2L1BA 3VYSA 2MJ8A 1TS3A 2GN5A 1QB5D 3S17B 3NQTA 5M5YH 3PSIA 1EYCA 2VQEL 2KCCA 3S1QB 1Z6HA 3FVQA 5C0XH 2R7FA 2CHBD 2CKZB 4DPGA 4ZUIA 1PH8A 3DXJC 2F0QA 2VW9A 3M4OH 3KYHC 5GAHC 1XMOL 3NEMA 1BOSA 2PI2E 1HR0W 3D0FA 3WWVA 2Z6BA 4R8NA 1Q3LA 2B2TC 4K5XA 3K59A 4CKCA 3PO2G 1U0LA 2KHJA 1ML0D 2Z6KA 1SMYD 3HOYG 2A73B 3PO3G 1XXGA 3ND8A 5LMUQ 2IPKD 2F0UA 3MXGA 4POGA 4B3TL 2EYHA 2ENBA 5JAVA 1MI2A 1YJNA 4BY7G 4WJ4A 1K8AC 3P7JA 2K5VA 3P1HA 2AWOA 4I7ZC 1ZKOA 4O42A 1OXTA 4JI7Q 1E2ZA 1XPRA 4LW1A 1STBA 1PH6A 2A74C 4HSPA 1I4HA 3H09A 2VXWA 2VB2X 4CHTB 5C44B 2CVRA 1UEAB 5I2XA 5T1IA 4TKOB 3I91A 1QILA 4LFAL 2RA4A 3HOZB 3JAME 5JJKA 1DONA 1K8OA 2M00A 1LT4D 4F8MA 4A3KB 2K52A 3J81E 3I72A 4BY1H 1NR4A 4X3UA 1EQTA 4IALA 4RG1A 1D1IA 2F0GA 2EDGA 1XWEA 1Z47A 4OXPA 1EY0A 1CFMA 2VS1A 3H94A 1EIFA 3FP9A 3PO3H 5J22A 4R9WA 5FLXE 3HOWB 4DV0Q 1SNPA 3BZCA 4UP9A 4KTAA 3AQQA 4K6LA 1GKHA 2WB1B 2WAQB 1GUTA 1B1ZA 4DR1L 2H1EA 3J80L 2MP1A 3FPUB 1GJXA 4MIUA 5JPMC 3K0YA 2F0SA 4DV1Q 3HOVB 3T13A 4RCNA 2MGSA 5IE8A 3FPPA 2IX0A 5EPKA 3OIQA 3X3MA 3I7FA 4DR4L 2N55A 1N9WA 1BCPD 2IX1A 1FGBD 3PF4A 4IQZA 2IHFA 4DV3L 5M9OA 1JE5A 3KUPA 4DGZA 1UE6A 3PUZA 4OELB 1U4MA 2O5JC 1SYDA 1BXTA 3A55A 1F2LA 3HZXA 1N8RC 4QCLA 3D4RA 2R3ZA 1KLGD 3WDNA 4BWGB 2H5XA 1PH2A 4DR6Q 5FJ8G 2OXPA 3RLOA 3GTGB 4DV2L 4YWMA 1HZCA 1XX8A 3VA7A 3T16A 1C8CA 3H0GG 3L9AX 3SE0A 3GTQB 1XTDA 2PW7A 4O0AA 3DWPA 1HHVA 3VR6A 1C0AA 4OGQC 4ZRZA 4OIJA 1PH4A 1ENFA 3QOLA 4JI6Q 1HNXL 3L7ZC 4L8JA 2MNAA 1GOZA 4X62L 3M7NA 3OW2A 2NWGA 1HH2P 4DXFA 4DR3Q 2D5DA 1TY0A 2Y0SE 4EQPA 1D7QA 2KEEA 2BOSA 2LFNA 1PZJD 5IGFA 1TWCB 2JP1A 1SR3A 3GP7A 3BS1A 4DR7L 2R92H 4C2MB 4LK1C 2ICIA 1V8QA 2EPBA 4IUNA 5JEAJ 3TZDA 4B9XA 4OO1G 5CGKA 5CBAE 5JVH3 4LF4L 4IO9A 2KVMA 4KN7C 1HR0Q 1XYIA 1CKNA 5JVG3 5IGDA 3U9SA
chains in the Genus database with same CATH topology
4DR5L 3G71A 2ZJPA 1VQCA 4L5RC 4A93G 3UDXA 3EN2A 1J5EL 2AMCB 4GKKL 4HJ8A 4DUZQ 4JI3L 1FJGQ 1YJ9A 5IYBG 3KF6B 1YHQA 3I55A 2UU9Q 4JI0L 2VUMG 4DV5L 1LTLA 4KHPL 4A76A 1CSQA 3E9HA 2VY3A 3AYHB 4IFDI 1NTGA 4R4CA 3S17H 3PUYA 4HIKA 4P75A 1EWIA 1Y1WG 4NXNQ 1TWFH 3ULLA 3A74A 1ASZA 3G6EA 3K0XA 3CCRA 3S14H 1SROA 1V43A 1T9HA 2N3SA 4YWLA 3J81j 1OTCA 1XNRQ 2E5LL 4DV7Q 4P74A 4C3JH 3CCVA 2QA4A 4B3MQ 2UXBL 3G48A 4GNXC 3A5UA 3GTQH 1L0WA 1VQ7A 4HIOA 5IP9H 1CKNB 4DK3C 2KCMA 2A8VA 5C44G 1KHIA 1JT8A 1B70B 4K0KQ 2NN6G 3CCEA 2ZM6Q 1I50H 1NE3A 2XTIA 5GQOA 3DLLA 4GLXA 4LF5L 4A3DH 4JBMA 1HNWQ 4JI6L 2R7DA 3TS2A 3HOZG 4LF8Q 5BR8Q 2NVQH 4GN4B 2JQOA 4A3KG 4A75A 1XMOQ 2GVAA 3MEFA 1XPUA 3GTJH 4DR3L 2IHEA 4NB3A 1VQKA 4KI0A 4A3MG 4C3IH 3KLWA 4JI4L 4YHHL 5EAYA 4YY3L 2ASBA 3I4NH 1QUQB 4JI5Q 4A93H 4DV4L 1UE5A 5GAGC 4YCUA 3ERSX 1WJJA 5IYBH 1WFQA 3HOWG 1KD1C 1HZ9A 3W5OA 4YCWA 4JYAL 1Q1EA 1TWCH 3HFZB 2WB1G 4L5TA 4GOPB 2WAQG 2YYZA 1EFWA 1V9PA 4DR2L 4P73A 1O7IA 2Z0SA 4JBWA 5LMNW 4A3EG 2D0PA 3ULJA 5JJIA 3W1GA 1Y1WH 4L5SA 5HGQA 4X64L 2E2JH 3G4SA 4LF7Q 1EQQA 5GADC 1VQ5A 1XNQQ 1IYJB 3M4QA 4JI1Q 1SLJA 1UWVA 4R1JA 4JI2Q 4OX9Q 4IPHA 4YWKA 3LGJA 4JI7L 3HOVG 5IYDG 1C9OA 4PZ6A 4R4TA 1MKHA 3CCSA 3BU2A 2V1CC 5C44H 2R92G 3T1YL 1E1TA 1I94L 2WB1E 2Y0SG 3K8AA 2UUAQ 1JMCA 5C0XI 1IZ6A 3J80c 2F4VQ 1Q1BA 2GVBA 1OXVA 4DUZL 3UDGA 4GLAC 2Q2UA 1FJGL 2NVTH 3CW2C 2DGYA 3I4MG 3F1ZA 4LFAQ 2E8GA 4RMFA 1M1KC 4QY7A 4LF9Q 1OXUA 2OTJA 1Q8KA 2UXDQ 1LUZA 5J3BA 4GNXB 4JOIC 3U4ZA 2WP8J 3A5ZB 2VL6A 2Z6KC 4NXNL 1WI5A 3T1HL 1OXXK 3NBHB 4B3SL 1S72A 4POFA 1EYGA 5IP7H 1BVSA 1M90C 2ZTDA 1SFOH 2CCZA 1K73C 2ES2A 4IOAA 1TWHH 1VQBA 3HOXG 1QVFA 4B3ML 1VQAA 2K75A 2I5HA 3RNUA 1EOVA 4DNIA 4R4IA 3U58A 1UEBA 4R4OA 4NXMQ 1YJWA 3CC7A 1VQNA 4A3EH 1RL2A 2PMZE 1K0RA 1YHBA 3K7AH 1SRUA 3KF6A 4AYBG 1CSPA 4IPDA 1VQDA 4AYBE 2ZM6L 3RN2A 1KQSA 3GTLH 1UE1A 2EIFA 1UE7A 3M3YH 1VQHA 2JA9A 4LF8L 2NVXH 5FLMH 3RZOH 3H15A 4DV1L 4A3FG 5IP9G 1PYSB 3I56A 4B3RL 4P71A 3E9IA 3HOVH 5C4XH 4H02A 1K3RA 3CMEA 1PA6A 1KAWA 3Q8DA 4ALPA 1JJ2A 1IBMQ 4UP7A 1QZGA 2RCNA 1NMGA 4LUZA 2ZJQA 4JG2A 4A3DG 4IJLA 1H95A 1PHJA 4LNQA 2BA0A 5HY6A 1MJEA 1X6OA 1X54A 1VS0A 5IWAQ 4A3JG 4IFDG 3STBC 2C35B 3JAMi 2KBNA 1NJIC 1N34Q 3I2ZA 4NPSA 1G6PA 1IBLQ 1E22A 2LXJA 5IYCG 1HNZQ 4X66Q 3J81i 4DUYQ 1D8LA 2OCEA 3I4NG 1KC8C 2ZTEA 3S15H 4IPGA 4BXXG 3F2DA 4DV3Q 5JJLA 2E2IH 1E3PA 2OWOA 4BA1I 2WFWA 2F3IA 4JI1L 4FDBA 3TREA 4A4IA 3EBEA 3HOXH 3K7UC 4JI2L 2B63H 3TS0A 4LFBQ 1CKMA 3RR5A 3UE1A 1N36Q 3M9BA 3I4OA 3HOUG 3UDFA 3B6YA 1QUQA 4A3BH 3KF8B 4AQYQ 4AH6A 3GTGH 3RLFA 4DR6L 4EX5A 2PQAB 3CCLA 2VNUD 2JJQA 1V1QA 1VQGA 4HJ9A 1BBUA 1NY4A 3TQYA 3KJPA 3GDEA 3RZDH 3U4VA 2UUAL 3GTKH 2R93H 2BH8A 2F4VL 3H3VI 1N33Q 2ZJRA 5DLQE 4P72A 2N49A 3S24A 2VQEQ 4GOPA 3OTOL 1Y1VH 4A3FH 4ME3A 1VQ9A 2A19A 3HKSA 4LF9L 1VQLA 2UXDL 4QJFA 2VQFL 2DUDA 5IY0A 3A0JA 4J15A 1W3SA 2JA5G 2LSSA 1Q82C 4PZ7A 3CQZH 3PO2H 5C3EH 2JEAI 1HNXQ 2ATWA 4A3JH 4DKAC 1N32Q 2BA1A 3M4PA 4X62Q 3HOYH 3FKIH 4IPCA 1R9TH 1XJVA 5IYCH 1Q12A 4GLVB 4Y7NH 3J7ZC 2AKWB 1IBKQ 2HIVA 3S1RH 5AJ3Q 4NXML 3H3VH 2A1AA 5M3FH 3F2BA 4BXXH 4IOCA 4GS3A 5IP7G 3GTOH 4BY7H 3KFUA 1FGUA 4OWWB 4KLKA 3CD6A 1Y14B 3AFQA 4JBJA 4GNXA 2OTLA 5C0XG 2R6GA 4C3HH 3L2PA 4HIDA 4B3TQ 5GROA 3BJUA 1Q86C 1L2FA 1E24A 1TWGH 4C2MH 1YITA 1IBML 1VQOA 1PH7A 2HHHL 2UUCL 3HOUH 1JJGA 1KXLA 4XTCS 2JA8G 2K5HA 4R4QA 2CFMA 1FL0A 4OWTB 1SMXA 3KDFB 1MIUA 1NBWA 1YZ6A 1WOCA 3KOJA 4X65Q 1VQ8A 5FLMG 1P8LA 2YU9H 5IWAL 3AFPA 4DV6L 3S1NH 1VCIA 1EIYB 4LF4Q 5C4XG 4TQUS 3UE0A 1G51A 3MXNB 1HR0L 3PGZA 1N34L 1VQ4A 4BBRH 1IBLL 3OYYA 1PFSA 1QZHA 3ZJYC 2RHQB 4QQBX 1KIXA 1J6QA 3NELA 2EQSA 4DR5Q 1A8VA 2ID0A 1BKBA 2JA5H 3KJOA 2IT1A 1RIPA 2UU9L 4GKKQ 2NZHA 1VQMA 4JI3Q 1IXRA 4UP8A 1SN8A 4L5QA 3CCJA 1K83H 4DV5Q 3PV0A 4KHPQ 1I6HH 1HZAA 2I5LX 2N78A 4LFBL 4QIWE 1HJPA 2K14A 1N36L 1PH3A 5LMNQ 4A3GG 2GN5A 2KHIA 1AE3A 1XNRL 5M5YH 4DV7L 1G291 3PSIA 1X3EA 1U5KA 1YEZA 5M3MG 2E5LQ 4OONA 2B63G 2VQEL 3PO2G 4BA2I 4JV5Q 2UXBQ 2L15A 4A3BG 1KL9A 4HJ7A 4IJHA 2R7FA 2Q2TA 2QGQA 2ALYB 1KRSA 4K0KL 2CKZB 3M85A 4DR1Q 2JA8H 2R93G 1QVCA 4DPGA 3EIVA 4XIGS 1PH8A 1HNWL 2IY5B 1L1OB 3JAMc 2VW9A 2YTYA 3M4OH 3KYHC 5BR8L 5GAHC 1Y1VG 2KENA 1XPOA 3NEMA 1XMOL 1Q7YC 2F52A 2VZAA 2PI2E 2ZTCA 3PUWA 1HR0W 4DAMA 3D0FA 2KCTA 3WWVA 1GO3E 1MJCA 3W1BA 2MFIA 2JE6I 2PQAA 3STBD 1VQFA 1W2BA 2Q2HA 4JOIA 4JI5L 4JI4Q 4GN5A 5ELNA 5JEAG 4YY3Q 1U0LA 2KHJA 2Z6KA 5C3EG 4YHHQ 3F2CA 1DGSA 4DV4Q 3K80C 4LWCA 5FLXc 1YIJA 3HOYG 4DK6C 4DR4Q 4QGUA 3FKIG 3PIPA 1PH5A 2I5MX 3VDYA 1P16A 1XMQQ 3PO3G 5LMUQ 2EXDA 4JYAQ 4O2DA 5ELOA 4POGA 2K50A 4B3TL 4A3IG 3RLNA 5M3FG 1K9MC 4DR2Q 1YJNA 4BY7G 4A3GH 4WJ4A 4LF7L 3CCQA 1PVOA 4X64Q 1K8AC 4PMWA 2B3GA 3CC2A 5FJ8H 1NMFA 1XNQL 5M5WH 2K5VA 4OX9L 2AWOA 5M3MH 1EUJA 4IFDJ 2JA6H 2AWNA 4TVAB 3CC4A 1A63A 3S16H 1OXTA 2UUBQ 4APVA 4JI7Q 1XPRA 2YV5A 3H0GH 4LW1A 1PH6A 3DM3A 2R7ZG 4JI8Q 4WJ3M 3CCMA 3T1YQ 1I94Q 4DV2Q 2Q2IA 5K36G 1A0IA 1YI2A 4LFAL 1JJCB 4BBRG 4YCVA 5JJKA 1WYDA 2HQLA 1TWAH 3GTMH 3UDIA 2K52A 2MO1A 3JC66 2JA7H 4GKJQ 4BY1H 4OO1I 2QEXA 4RG1A 3KDFA 5LMNL 4A3LG 1S3OA 2PI2A 1Z47A 3T1HQ 4LUOA 1YVCA 3K81C 4OXPA 1X55A 4B3SQ 2VS1A 1X9NA 1EIFA 1K8GA 3S1QH 1X3GA 5IT9c 3FP9A 4LF6Q 3PO3H 4BBSH 1B7YB 1HZBA 4DV0Q 4LFCQ 4JV5L 3BZCA 4UP9A 3S2DH 3AQQA 2K4KA 1L1OC 1VQJA 2HIXA 1B8AA 2N8NA 1GKHA 4MNOA 3PIOA 4A3IH 2UXCQ 3D31A 3RN5A 3GO5A 2HT1A 1GVPA 4DR1L 2I0QA 1SE8A 3F8TA 4A3CH 3AEVA 2D62A 2FXQA 4GN3B 1PH1A 2BH2A 1VQEA 3NENA 3SGIA 2OQKA 3CXCA 5M5XH 3CCUA 4EQ5A 4DV1Q 4HJ5A 4B3RQ 1TXYA 1LYLA 1E1OA 4AIMA 3J7A5 2JK8A 1I5FA 1X65A 3S2HH 1BBWA 4QL5A 2R7ZH 4DR7Q 5IE8A 1KRTA 1OXSC 2IX0A 1YBYA 2OQ0A 4KHZA 2VUMH 3I7FA 5C4JH 1WCMG 4DR4L 2NN6I 1HNZL 2CWAA 4X66L 1CKOA 1N9WA 1XMQL 5LMUL 4DUYL 3E0EA 1C7YA 2IX1A 3PF4A 5C0XJ 1PV4A 3ICEA 1J5EQ 1L1OA 2IHFA 2LXKA 4DV3L 1S40A 4A3LH 1JE5A 4MZ9A 4JI0Q 1UE6A 3PUZA 1VQPA 2NZOA 3FHWA 1N8RC 3TRZA 2CWPA 2UUBL 1E7ZA 4AQYL 2MO0A 4JI8L 2H5XA 1PH2A 1YHAA 4DR6Q 5FJ8G 3PUVA 2XGTA 3RLOA 1Q81C 2CQOA 4YWMA 4DV2L 1N33L 1HZCA 2WAQE 2JA6G 3GTPH 3HKZG 3HOZH 1VQ6A 3OTOQ 2K5NA 1VQIA 3H0GG 1AE2A 4MTNA 4PG3A 4A3KH 4LUVA 4HJAA 1XTDA 2VQFQ 4GKJL 4O0AA 4Y52H 4UPAA 1C0AA 4A3MH 4LF5Q 2MQHA 5E7NA 1PH4A 4JI6Q 1HNXL 3L7ZC 1ASYA 3J81c 2YTVA 2MNAA 3U50C 4DAYB 4PZ8A 1A62A 1JB7A 1N32L 2RF4A 4X62L 3M7NA 3J80i 1WCMH 3OW2A 3HOWH 1HH2P 4LF6L 4DR3Q 2B29A 2JA7G 3CP0A 4BY1G 2Y0SE 1CUKA 1IBKL 4LFCL 4DV0L 1D7QA 3ER0A 4JCVE 5AJ3L 2PNHA 3HKZE 3CF5A 3CPWA 3PUXA 4X6AH 2UXCL 2AHOB 1PH9A 3ULPA 1PYBA 2NVYH 2D0OA 3IRBA 3PF5A 3PCOB 1Z9FA 4JC0A 1X56A 3CPFA 1QVGA 1Q46A 1GM5A 3CAMA 3S1MH 2JEBI 3CMAA 2RHSB 1X3FA 5IYDH 1YNXA 1SR3A 2UUCQ 1GD7A 1LM0A 4UY8C 4OWXB 5H1SE 3GD7A 2HHHQ 4DR7L 4BBSG 4A3CG 2R92H 2E2HH 4X65L 5JEAJ 4JBKA 5GAEC 4OO1G 3BZKA 2YTXA 4LF4L 4GOPC 4DV6Q 4IO9A 3L0OA 1HR0Q 1IL2A 1EQRA 3I4MH 1FVIA 3TEHB 4HIMA 1AH9A 1CKNA 1I3QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 L;  3G71 A;  2ZJP A;  1VQC A;  4L5R C;  4A93 G;  3UDX A;  3EN2 A;  1J5E L;  2AMC B;  4GKK L;  4HJ8 A;  4DUZ Q;  4JI3 L;  1FJG Q;  1YJ9 A;  5IYB G;  3KF6 B;  1YHQ A;  3I55 A;  2UU9 Q;  4JI0 L;  2VUM G;  4DV5 L;  1LTL A;  4KHP L;  4A76 A;  1CSQ A;  3E9H A;  2VY3 A;  3AYH B;  4IFD I;  1NTG A;  4R4C A;  3S17 H;  3PUY A;  4HIK A;  4P75 A;  1EWI A;  1Y1W G;  4NXN Q;  1TWF H;  3ULL A;  3A74 A;  1ASZ A;  3G6E A;  3K0X A;  3CCR A;  3S14 H;  1SRO A;  1V43 A;  1T9H A;  2N3S A;  4YWL A;  3J81 j;  1OTC A;  1XNR Q;  2E5L L;  4DV7 Q;  4P74 A;  4C3J H;  3CCV A;  2QA4 A;  4B3M Q;  2UXB L;  3G48 A;  4GNX C;  3A5U A;  3GTQ H;  1L0W A;  1VQ7 A;  4HIO A;  5IP9 H;  1CKN B;  4DK3 C;  2KCM A;  2A8V A;  5C44 G;  1KHI A;  1JT8 A;  1B70 B;  4K0K Q;  2NN6 G;  3CCE A;  2ZM6 Q;  1I50 H;  1NE3 A;  2XTI A;  5GQO A;  3DLL A;  4GLX A;  4LF5 L;  4A3D H;  4JBM A;  1HNW Q;  4JI6 L;  2R7D A;  3TS2 A;  3HOZ G;  4LF8 Q;  5BR8 Q;  2NVQ H;  4GN4 B;  2JQO A;  4A3K G;  4A75 A;  1XMO Q;  2GVA A;  3MEF A;  1XPU A;  3GTJ H;  4DR3 L;  2IHE A;  4NB3 A;  1VQK A;  4KI0 A;  4A3M G;  4C3I H;  3KLW A;  4JI4 L;  4YHH L;  5EAY A;  4YY3 L;  2ASB A;  3I4N H;  1QUQ B;  4JI5 Q;  4A93 H;  4DV4 L;  1UE5 A;  5GAG C;  4YCU A;  3ERS X;  1WJJ A;  5IYB H;  1WFQ A;  3HOW G;  1KD1 C;  1HZ9 A;  3W5O A;  4YCW A;  4JYA L;  1Q1E A;  1TWC H;  3HFZ B;  2WB1 G;  4L5T A;  4GOP B;  2WAQ G;  2YYZ A;  1EFW A;  1V9P A;  4DR2 L;  4P73 A;  1O7I A;  2Z0S A;  4JBW A;  5LMN W;  4A3E G;  2D0P A;  3ULJ A;  5JJI A;  3W1G A;  1Y1W H;  4L5S A;  5HGQ A;  4X64 L;  2E2J H;  3G4S A;  4LF7 Q;  1EQQ A;  5GAD C;  1VQ5 A;  1XNQ Q;  1IYJ B;  3M4Q A;  4JI1 Q;  1SLJ A;  1UWV A;  4R1J A;  4JI2 Q;  4OX9 Q;  4IPH A;  4YWK A;  3LGJ A;  4JI7 L;  3HOV G;  5IYD G;  1C9O A;  4PZ6 A;  4R4T A;  1MKH A;  3CCS A;  3BU2 A;  2V1C C;  5C44 H;  2R92 G;  3T1Y L;  1E1T A;  1I94 L;  2WB1 E;  2Y0S G;  3K8A A;  2UUA Q;  1JMC A;  5C0X I;  1IZ6 A;  3J80 c;  2F4V Q;  1Q1B A;  2GVB A;  1OXV A;  4DUZ L;  3UDG A;  4GLA C;  2Q2U A;  1FJG L;  2NVT H;  3CW2 C;  2DGY A;  3I4M G;  3F1Z A;  4LFA Q;  2E8G A;  4RMF A;  1M1K C;  4QY7 A;  4LF9 Q;  1OXU A;  2OTJ A;  1Q8K A;  2UXD Q;  1LUZ A;  5J3B A;  4GNX B;  4JOI C;  3U4Z A;  2WP8 J;  3A5Z B;  2VL6 A;  2Z6K C;  4NXN L;  1WI5 A;  3T1H L;  1OXX K;  3NBH B;  4B3S L;  1S72 A;  4POF A;  1EYG A;  5IP7 H;  1BVS A;  1M90 C;  2ZTD A;  1SFO H;  2CCZ A;  1K73 C;  2ES2 A;  4IOA A;  1TWH H;  1VQB A;  3HOX G;  1QVF A;  4B3M L;  1VQA A;  2K75 A;  2I5H A;  3RNU A;  1EOV A;  4DNI A;  4R4I A;  3U58 A;  1UEB A;  4R4O A;  4NXM Q;  1YJW A;  3CC7 A;  1VQN A;  4A3E H;  1RL2 A;  2PMZ E;  1K0R A;  1YHB A;  3K7A H;  1SRU A;  3KF6 A;  4AYB G;  1CSP A;  4IPD A;  1VQD A;  4AYB E;  2ZM6 L;  3RN2 A;  1KQS A;  3GTL H;  1UE1 A;  2EIF A;  1UE7 A;  3M3Y H;  1VQH A;  2JA9 A;  4LF8 L;  2NVX H;  5FLM H;  3RZO H;  3H15 A;  4DV1 L;  4A3F G;  5IP9 G;  1PYS B;  3I56 A;  4B3R L;  4P71 A;  3E9I A;  3HOV H;  5C4X H;  4H02 A;  1K3R A;  3CME A;  1PA6 A;  1KAW A;  3Q8D A;  4ALP A;  1JJ2 A;  1IBM Q;  4UP7 A;  1QZG A;  2RCN A;  1NMG A;  4LUZ A;  2ZJQ A;  4JG2 A;  4A3D G;  4IJL A;  1H95 A;  1PHJ A;  4LNQ A;  2BA0 A;  5HY6 A;  1MJE A;  1X6O A;  1X54 A;  1VS0 A;  5IWA Q;  4A3J G;  4IFD G;  3STB C;  2C35 B;  3JAM i;  2KBN A;  1NJI C;  1N34 Q;  3I2Z A;  4NPS A;  1G6P A;  1IBL Q;  1E22 A;  2LXJ A;  5IYC G;  1HNZ Q;  4X66 Q;  3J81 i;  4DUY Q;  1D8L A;  2OCE A;  3I4N G;  1KC8 C;  2ZTE A;  3S15 H;  4IPG A;  4BXX G;  3F2D A;  4DV3 Q;  5JJL A;  2E2I H;  1E3P A;  2OWO A;  4BA1 I;  2WFW A;  2F3I A;  4JI1 L;  4FDB A;  3TRE A;  4A4I A;  3EBE A;  3HOX H;  3K7U C;  4JI2 L;  2B63 H;  3TS0 A;  4LFB Q;  1CKM A;  3RR5 A;  3UE1 A;  1N36 Q;  3M9B A;  3I4O A;  3HOU G;  3UDF A;  3B6Y A;  1QUQ A;  4A3B H;  3KF8 B;  4AQY Q;  4AH6 A;  3GTG H;  3RLF A;  4DR6 L;  4EX5 A;  2PQA B;  3CCL A;  2VNU D;  2JJQ A;  1V1Q A;  1VQG A;  4HJ9 A;  1BBU A;  1NY4 A;  3TQY A;  3KJP A;  3GDE A;  3RZD H;  3U4V A;  2UUA L;  3GTK H;  2R93 H;  2BH8 A;  2F4V L;  3H3V I;  1N33 Q;  2ZJR A;  5DLQ E;  4P72 A;  2N49 A;  3S24 A;  2VQE Q;  4GOP A;  3OTO L;  1Y1V H;  4A3F H;  4ME3 A;  1VQ9 A;  2A19 A;  3HKS A;  4LF9 L;  1VQL A;  2UXD L;  4QJF A;  2VQF L;  2DUD A;  5IY0 A;  3A0J A;  4J15 A;  1W3S A;  2JA5 G;  2LSS A;  1Q82 C;  4PZ7 A;  3CQZ H;  3PO2 H;  5C3E H;  2JEA I;  1HNX Q;  2ATW A;  4A3J H;  4DKA C;  1N32 Q;  2BA1 A;  3M4P A;  4X62 Q;  3HOY H;  3FKI H;  4IPC A;  1R9T H;  1XJV A;  5IYC H;  1Q12 A;  4GLV B;  4Y7N H;  3J7Z C;  2AKW B;  1IBK Q;  2HIV A;  3S1R H;  5AJ3 Q;  4NXM L;  3H3V H;  2A1A A;  5M3F H;  3F2B A;  4BXX H;  4IOC A;  4GS3 A;  5IP7 G;  3GTO H;  4BY7 H;  3KFU A;  1FGU A;  4OWW B;  4KLK A;  3CD6 A;  1Y14 B;  3AFQ A;  4JBJ A;  4GNX A;  2OTL A;  5C0X G;  2R6G A;  4C3H H;  3L2P A;  4HID A;  4B3T Q;  5GRO A;  3BJU A;  1Q86 C;  1L2F A;  1E24 A;  1TWG H;  4C2M H;  1YIT A;  1IBM L;  1VQO A;  1PH7 A;  2HHH L;  2UUC L;  3HOU H;  1JJG A;  1KXL A;  4XTC S;  2JA8 G;  2K5H A;  4R4Q A;  2CFM A;  1FL0 A;  4OWT B;  1SMX A;  3KDF B;  1MIU A;  1NBW A;  1YZ6 A;  1WOC A;  3KOJ A;  4X65 Q;  1VQ8 A;  5FLM G;  1P8L A;  2YU9 H;  5IWA L;  3AFP A;  4DV6 L;  3S1N H;  1VCI A;  1EIY B;  4LF4 Q;  5C4X G;  4TQU S;  3UE0 A;  1G51 A;  3MXN B;  1HR0 L;  3PGZ A;  1N34 L;  1VQ4 A;  4BBR H;  1IBL L;  3OYY A;  1PFS A;  1QZH A;  3ZJY C;  2RHQ B;  4QQB X;  1KIX A;  1J6Q A;  3NEL A;  2EQS A;  4DR5 Q;  1A8V A;  2ID0 A;  1BKB A;  2JA5 H;  3KJO A;  2IT1 A;  1RIP A;  2UU9 L;  4GKK Q;  2NZH A;  1VQM A;  4JI3 Q;  1IXR A;  4UP8 A;  1SN8 A;  4L5Q A;  3CCJ A;  1K83 H;  4DV5 Q;  3PV0 A;  4KHP Q;  1I6H H;  1HZA A;  2I5L X;  2N78 A;  4LFB L;  4QIW E;  1HJP A;  2K14 A;  1N36 L;  1PH3 A;  5LMN Q;  4A3G G;  2GN5 A;  2KHI A;  1AE3 A;  1XNR L;  5M5Y H;  4DV7 L;  1G29 1;  3PSI A;  1X3E A;  1U5K A;  1YEZ A;  5M3M G;  2E5L Q;  4OON A;  2B63 G;  2VQE L;  3PO2 G;  4BA2 I;  4JV5 Q;  2UXB Q;  2L15 A;  4A3B G;  1KL9 A;  4HJ7 A;  4IJH A;  2R7F A;  2Q2T A;  2QGQ A;  2ALY B;  1KRS A;  4K0K L;  2CKZ B;  3M85 A;  4DR1 Q;  2JA8 H;  2R93 G;  1QVC A;  4DPG A;  3EIV A;  4XIG S;  1PH8 A;  1HNW L;  2IY5 B;  1L1O B;  3JAM c;  2VW9 A;  2YTY A;  3M4O H;  3KYH C;  5BR8 L;  5GAH C;  1Y1V G;  2KEN A;  1XPO A;  3NEM A;  1XMO L;  1Q7Y C;  2F52 A;  2VZA A;  2PI2 E;  2ZTC A;  3PUW A;  1HR0 W;  4DAM A;  3D0F A;  2KCT A;  3WWV A;  1GO3 E;  1MJC A;  3W1B A;  2MFI A;  2JE6 I;  2PQA A;  3STB D;  1VQF A;  1W2B A;  2Q2H A;  4JOI A;  4JI5 L;  4JI4 Q;  4GN5 A;  5ELN A;  5JEA G;  4YY3 Q;  1U0L A;  2KHJ A;  2Z6K A;  5C3E G;  4YHH Q;  3F2C A;  1DGS A;  4DV4 Q;  3K80 C;  4LWC A;  5FLX c;  1YIJ A;  3HOY G;  4DK6 C;  4DR4 Q;  4QGU A;  3FKI G;  3PIP A;  1PH5 A;  2I5M X;  3VDY A;  1P16 A;  1XMQ Q;  3PO3 G;  5LMU Q;  2EXD A;  4JYA Q;  4O2D A;  5ELO A;  4POG A;  2K50 A;  4B3T L;  4A3I G;  3RLN A;  5M3F G;  1K9M C;  4DR2 Q;  1YJN A;  4BY7 G;  4A3G H;  4WJ4 A;  4LF7 L;  3CCQ A;  1PVO A;  4X64 Q;  1K8A C;  4PMW A;  2B3G A;  3CC2 A;  5FJ8 H;  1NMF A;  1XNQ L;  5M5W H;  2K5V A;  4OX9 L;  2AWO A;  5M3M H;  1EUJ A;  4IFD J;  2JA6 H;  2AWN A;  4TVA B;  3CC4 A;  1A63 A;  3S16 H;  1OXT A;  2UUB Q;  4APV A;  4JI7 Q;  1XPR A;  2YV5 A;  3H0G H;  4LW1 A;  1PH6 A;  3DM3 A;  2R7Z G;  4JI8 Q;  4WJ3 M;  3CCM A;  3T1Y Q;  1I94 Q;  4DV2 Q;  2Q2I A;  5K36 G;  1A0I A;  1YI2 A;  4LFA L;  1JJC B;  4BBR G;  4YCV A;  5JJK A;  1WYD A;  2HQL A;  1TWA H;  3GTM H;  3UDI A;  2K52 A;  2MO1 A;  3JC6 6;  2JA7 H;  4GKJ Q;  4BY1 H;  4OO1 I;  2QEX A;  4RG1 A;  3KDF A;  5LMN L;  4A3L G;  1S3O A;  2PI2 A;  1Z47 A;  3T1H Q;  4LUO A;  1YVC A;  3K81 C;  4OXP A;  1X55 A;  4B3S Q;  2VS1 A;  1X9N A;  1EIF A;  1K8G A;  3S1Q H;  1X3G A;  5IT9 c;  3FP9 A;  4LF6 Q;  3PO3 H;  4BBS H;  1B7Y B;  1HZB A;  4DV0 Q;  4LFC Q;  4JV5 L;  3BZC A;  4UP9 A;  3S2D H;  3AQQ A;  2K4K A;  1L1O C;  1VQJ A;  2HIX A;  1B8A A;  2N8N A;  1GKH A;  4MNO A;  3PIO A;  4A3I H;  2UXC Q;  3D31 A;  3RN5 A;  3GO5 A;  2HT1 A;  1GVP A;  4DR1 L;  2I0Q A;  1SE8 A;  3F8T A;  4A3C H;  3AEV A;  2D62 A;  2FXQ A;  4GN3 B;  1PH1 A;  2BH2 A;  1VQE A;  3NEN A;  3SGI A;  2OQK A;  3CXC A;  5M5X H;  3CCU A;  4EQ5 A;  4DV1 Q;  4HJ5 A;  4B3R Q;  1TXY A;  1LYL A;  1E1O A;  4AIM A;  3J7A 5;  2JK8 A;  1I5F A;  1X65 A;  3S2H H;  1BBW A;  4QL5 A;  2R7Z H;  4DR7 Q;  5IE8 A;  1KRT A;  1OXS C;  2IX0 A;  1YBY A;  2OQ0 A;  4KHZ A;  2VUM H;  3I7F A;  5C4J H;  1WCM G;  4DR4 L;  2NN6 I;  1HNZ L;  2CWA A;  4X66 L;  1CKO A;  1N9W A;  1XMQ L;  5LMU L;  4DUY L;  3E0E A;  1C7Y A;  2IX1 A;  3PF4 A;  5C0X J;  1PV4 A;  3ICE A;  1J5E Q;  1L1O A;  2IHF A;  2LXK A;  4DV3 L;  1S40 A;  4A3L H;  1JE5 A;  4MZ9 A;  4JI0 Q;  1UE6 A;  3PUZ A;  1VQP A;  2NZO A;  3FHW A;  1N8R C;  3TRZ A;  2CWP A;  2UUB L;  1E7Z A;  4AQY L;  2MO0 A;  4JI8 L;  2H5X A;  1PH2 A;  1YHA A;  4DR6 Q;  5FJ8 G;  3PUV A;  2XGT A;  3RLO A;  1Q81 C;  2CQO A;  4YWM A;  4DV2 L;  1N33 L;  1HZC A;  2WAQ E;  2JA6 G;  3GTP H;  3HKZ G;  3HOZ H;  1VQ6 A;  3OTO Q;  2K5N A;  1VQI A;  3H0G G;  1AE2 A;  4MTN A;  4PG3 A;  4A3K H;  4LUV A;  4HJA A;  1XTD A;  2VQF Q;  4GKJ L;  4O0A A;  4Y52 H;  4UPA A;  1C0A A;  4A3M H;  4LF5 Q;  2MQH A;  5E7N A;  1PH4 A;  4JI6 Q;  1HNX L;  3L7Z C;  1ASY A;  3J81 c;  2YTV A;  2MNA A;  3U50 C;  4DAY B;  4PZ8 A;  1A62 A;  1JB7 A;  1N32 L;  2RF4 A;  4X62 L;  3M7N A;  3J80 i;  1WCM H;  3OW2 A;  3HOW H;  1HH2 P;  4LF6 L;  4DR3 Q;  2B29 A;  2JA7 G;  3CP0 A;  4BY1 G;  2Y0S E;  1CUK A;  1IBK L;  4LFC L;  4DV0 L;  1D7Q A;  3ER0 A;  4JCV E;  5AJ3 L;  2PNH A;  3HKZ E;  3CF5 A;  3CPW A;  3PUX A;  4X6A H;  2UXC L;  2AHO B;  1PH9 A;  3ULP A;  1PYB A;  2NVY H;  2D0O A;  3IRB A;  3PF5 A;  3PCO B;  1Z9F A;  4JC0 A;  1X56 A;  3CPF A;  1QVG A;  1Q46 A;  1GM5 A;  3CAM A;  3S1M H;  2JEB I;  3CMA A;  2RHS B;  1X3F A;  5IYD H;  1YNX A;  1SR3 A;  2UUC Q;  1GD7 A;  1LM0 A;  4UY8 C;  4OWX B;  5H1S E;  3GD7 A;  2HHH Q;  4DR7 L;  4BBS G;  4A3C G;  2R92 H;  2E2H H;  4X65 L;  5JEA J;  4JBK A;  5GAE C;  4OO1 G;  3BZK A;  2YTX A;  4LF4 L;  4GOP C;  4DV6 Q;  4IO9 A;  3L0O A;  1HR0 Q;  1IL2 A;  1EQR A;  3I4M H;  1FVI A;  3TEH B;  4HIM A;  1AH9 A;  1CKN A;  1I3Q H; 
#chains in the Genus database with same CATH topology
 2F3V A;  3G71 A;  1X3Q A;  4DUZ Q;  1YJ9 A;  3KF6 B;  2Z1C A;  1LTL A;  1NR2 A;  3E9H A;  1HQR D;  3BYT B;  1EU4 A;  1NTG A;  4P75 A;  1EWI A;  1ASZ A;  5G3L D;  1V43 A;  1O7L A;  1SJE D;  4P74 A;  4C3J H;  3CCV A;  3G48 A;  5D65 A;  2SDF A;  1SE2 A;  2DNC A;  3CKI B;  2KCM A;  1JT8 A;  3CCE A;  2ZM6 Q;  4LF5 L;  1B2T A;  1WTW A;  3VR5 A;  1PLF A;  4RKB A;  3TSS A;  1ONL A;  2JQO A;  4A75 A;  1XMO Q;  3MEF A;  2NVX B;  4QIW B;  3GTJ H;  3D3R A;  4PV1 C;  4NB3 A;  4KI0 A;  3H3V C;  1W6K A;  2RDH A;  4KD3 A;  4YHH L;  4YY3 L;  2ASB A;  3I4N H;  1UE5 A;  4YCU A;  3ERS X;  3LX0 A;  4M1U B;  3U9O A;  4B08 A;  2C5C A;  1VMC A;  4L5T A;  2GA4 B;  1O7I A;  5LMN W;  3ULJ A;  5JJI A;  3DEP A;  1O7Y A;  1J9O A;  1EQQ A;  2OEO A;  4XQQ A;  5GAD C;  1WTO A;  1H9R A;  1IYJ B;  3KK7 A;  3T51 B;  1UWV A;  4JI2 Q;  1G2T A;  3M7G A;  4IPH A;  2AQ2 B;  1K3B C;  4YWK A;  5IYD G;  2XRS D;  4R4T A;  5M3M B;  1U4P A;  3S16 B;  1EU3 A;  2Y0S G;  5I4D A;  1IZ6 A;  4I7A A;  3UDG A;  3GTK B;  2R93 B;  1JOQ A;  2DGY A;  3I4M G;  4LFA Q;  2E8G A;  1Y1V B;  2ZT9 C;  4LF9 Q;  2OTJ A;  1Q8K A;  1LUZ A;  4IUT A;  1JOR A;  2AQ1 B;  1FNW A;  1QE6 A;  1LTB D;  1R4Q B;  1EIG A;  2J0T D;  1WI5 A;  4NXN L;  5EGT A;  1M90 C;  1B50 A;  1TKW B;  3BG3 A;  2ES2 A;  1VQB A;  1EOV A;  3FKI B;  1WTV A;  4DNI A;  4R4I A;  3U58 A;  4H44 C;  1VQN A;  1K0R A;  1YHB A;  3K7A H;  3TDQ A;  3KF6 A;  2XIW A;  3TP8 A;  5EBD A;  4A3I B;  1AZQ A;  3GTL H;  2DN8 A;  4HCE A;  4X3S A;  2Q8I B;  3RZO H;  2AQ3 B;  5IP9 G;  3E9I A;  5J39 A;  5M5X B;  1PA6 A;  1KAW A;  3Q8D A;  1JE4 A;  4C3H B;  5I6Y A;  4ALP A;  2RCN A;  4LUZ A;  3D4W A;  1ZEQ X;  3DHQ A;  5C5L A;  5DM6 3;  2BA0 A;  5HY6 A;  1PTO D;  5KYL A;  2R7Z B;  1X6O A;  5IOD A;  4IFD G;  3JAM i;  3I2Z A;  4NPS A;  3J80 E;  1G6P A;  1UAP A;  4CJ1 B;  1EIH A;  3J81 i;  1D8L A;  4ILW A;  3S15 H;  1GUO A;  4IPG A;  3F2D A;  4DV3 Q;  1EY9 A;  2E2I H;  2EOT A;  1RD9 D;  3TRE A;  4JI1 L;  1YNJ C;  2B63 H;  2F0N A;  3TS0 A;  1IHZ A;  5EPL A;  4H13 C;  4A3B H;  1QJO A;  4EX5 A;  1V1Q A;  2NZ1 D;  1ICF B;  2QKI C;  4HJ9 A;  4G57 A;  4P72 A;  2SNM A;  3EFX D;  3OTO L;  2A19 A;  5IGE A;  1VQL A;  4WJW A;  5IY0 A;  2FMC A;  2K32 A;  2A68 C;  2JEA I;  1HNX Q;  2ATW A;  3GV3 A;  1WD0 A;  4DKA C;  3TP6 A;  3M4P A;  4X62 Q;  2EY1 A;  1BCP F;  1WCM B;  1SSO A;  2AKW B;  3IAY A;  5ELE A;  2K5Q A;  4NXM L;  3MZ5 A;  2A1A A;  1I4Q A;  3HG9 A;  5EKK A;  2CW0 C;  4GS3 A;  1NUC A;  3GTO H;  1FGU A;  4KLK A;  4XT1 B;  1NAP A;  2OTL A;  2EVB A;  4WRD A;  1L2F A;  1E24 A;  2UUC L;  1IBM L;  1QG7 A;  4RHS A;  3S1M B;  4XTC S;  4R4Q A;  1FL0 A;  2NBF A;  1SMX A;  3KDF B;  1MIU A;  1YZ6 A;  1EZ6 A;  5IWA L;  3AFP A;  4DV6 L;  2G9D A;  4LF4 Q;  4FO2 A;  1G51 A;  1EYA A;  1IBL L;  2HD3 A;  3OYY A;  3V2T A;  2DJF C;  1KIX A;  3I4M B;  2ID0 A;  3HRZ C;  4KK7 A;  2NZH A;  3CCJ A;  1I6H H;  3PV0 A;  1F9S A;  3ERQ A;  3N6R A;  2N78 A;  4LFB L;  1HJP A;  1TWA B;  2NUC A;  1N36 L;  4DU9 A;  5LMN Q;  2HCC A;  2KHI A;  4DAV A;  1BQQ T;  4DV7 L;  3S14 B;  4BA2 I;  4JV5 Q;  5D3D A;  5NUC A;  1JR0 D;  3QR8 A;  2Q2T A;  1QCB D;  2HUG A;  1WTX A;  3M85 A;  4LJZ C;  4BBS B;  1II3 A;  2KEN A;  1XPO A;  1CHQ D;  2BDO A;  2F52 A;  2VZA A;  2DY8 A;  3PUW A;  2NVQ B;  1I4G A;  2KOL A;  2MFI A;  2JE6 I;  3MEH A;  2Q2H A;  4YHH Q;  4YY3 Q;  5C3E G;  1JWS D;  3DEO A;  4LWC A;  1YIJ A;  4A93 B;  4QGU A;  1BO0 A;  2I5M X;  2KCN A;  3VDY A;  1XMQ Q;  2VUM B;  1EQV A;  2EXD A;  4OIK A;  3K57 A;  5CBE E;  5M3F G;  4IZ8 A;  3TP7 A;  1YNJ D;  5G3L F;  4LF7 L;  2B3G A;  1NMF A;  1Y1W B;  2L5T A;  2E2J B;  5FKA C;  1EUJ A;  2JA6 H;  4APV A;  1ZYR D;  1KDC A;  4JI8 Q;  4DK1 A;  5K36 G;  1ET6 A;  3BDO A;  5CV6 A;  1EY7 A;  4ULL A;  4FVM A;  2A68 D;  4BBR G;  3GTP B;  3J7A V;  1CT1 D;  2HQL A;  1GUS A;  3UDI A;  2JA7 H;  3K5M A;  1AP0 A;  2KED A;  1F2Z A;  3N52 A;  4Q0F A;  2QEX A;  3KDF A;  4A3M B;  2PZW A;  2HQE A;  5FO8 B;  3S1Q H;  4RGT A;  5IT9 c;  2EY2 A;  3LWE A;  1B7Y B;  1RHP A;  3ND9 A;  3S2D H;  2K4K A;  3RN5 A;  1EYD A;  1GVP A;  5CR3 A;  1BDO A;  3F8T A;  4A3E B;  3A54 A;  1SE3 A;  4RAU C;  4A3C H;  2BH2 A;  1A2T A;  1VQE A;  3NEN A;  3CXC A;  3NTI A;  4H0L C;  4EQ5 A;  4HJ5 A;  2P5Z X;  1LYL A;  1E1O A;  4G7Z C;  1X65 A;  4QL5 A;  1ET9 A;  4MTK A;  2L4N A;  5K36 H;  1S5C D;  3A7L A;  1KRT A;  4ZKB B;  2A6E C;  2NN6 I;  1HNZ L;  4F87 A;  1C7Y A;  1JWU D;  3OOC A;  5C0X J;  1PV4 A;  1I3Q B;  1PFM A;  2HDM A;  1K8M A;  2X6G A;  4MZ9 A;  4JI0 Q;  4DF7 A;  2M9V A;  3C46 A;  3H6M A;  1G6Z A;  2UUB L;  1E7Z A;  4CDE C;  2J4X A;  2AUJ D;  1FNU A;  3MFG A;  3EJI A;  4LAA A;  3PQI A;  3PUV A;  1TWF B;  1Q81 C;  5IGC A;  3UI2 A;  1SYE A;  3RZD B;  4IUQ A;  3HOZ H;  5HGT A;  3OTO Q;  3IFD A;  4MTN A;  1I6V C;  4PG3 A;  4A3K H;  4PNY A;  4HJA A;  2DNE A;  2X6L A;  4GKJ L;  1PTO F;  2MQH A;  1I50 B;  4A3D B;  3QG1 A;  4KMU C;  3U50 C;  1JB7 A;  2RF4 A;  3J80 i;  3D6W A;  4FF1 A;  3CRL C;  3HOW H;  5EBC A;  4LF6 L;  4A3J B;  1EY6 A;  4BY1 G;  1IBK L;  4LFC L;  3ER0 A;  3CF5 A;  1I4P A;  3HEJ A;  1SYG A;  4C3I B;  4ZKC B;  2UXC L;  1PH9 A;  3S1R B;  3M4Y A;  1PYB A;  3IRB A;  3PF5 A;  1CA5 A;  1Z9F A;  1JOO A;  1ESR A;  2L0C A;  2JEB I;  4TRD A;  1X3F A;  1D5M C;  2IW3 A;  3NQI A;  3SDZ A;  1GD7 A;  2UUC Q;  3SHL A;  2QIL A;  1TWG B;  3HOU B;  4X65 L;  5KND A;  4JBK A;  3R8B A;  3BZK A;  4GOP C;  1GXD C;  4DV6 Q;  2PO4 A;  3WOE A;  1IL2 A;  1SNO A;  2EY5 A;  1FVI A;  1H9S B;  2FMM A;  1AH9 A;  5T1G A;  4AYB E;  1HQM C;  4U67 3;  4EGV A;  4ZLT F;  1B3Q A;  5CV5 A;  1PZI D;  1CHP D;  2PYK A;  4L5R C;  3UDX A;  3EN2 A;  1J5E L;  3OHX C;  2AMC B;  2F0K A;  4HJ8 A;  4GKK L;  3D8G A;  2F1M A;  5FOB B;  1EY5 A;  2JA5 B;  4TSS A;  4DV5 L;  4KHP L;  3Q24 A;  4DXG A;  4NP5 A;  4R4C A;  2FIN B;  3K0X A;  5IGB A;  3SVM A;  4YWL A;  3AU7 A;  4N9P A;  4DV7 Q;  4EQO A;  2VB3 X;  2QA4 A;  4B3M Q;  2UXB L;  1EY4 A;  1STG A;  2LS0 1;  1L0W A;  1VQ7 A;  4HIO A;  3GTQ H;  1CKN B;  4DK3 C;  2A6H C;  2QW7 A;  2AUK A;  2PQE A;  1B70 B;  1ENC A;  1NE3 A;  1L0Y B;  3F2U A;  4GZY C;  5ELC A;  4LF8 Q;  1B9M A;  4GN4 B;  3M4O B;  2F0W A;  4RH6 A;  1SE4 A;  4LMQ D;  5DNF A;  3AMU A;  5I6W A;  5C4X B;  1VQK A;  2A6E D;  4QF4 A;  1HZ9 A;  4JYA L;  3HFZ B;  1TWC H;  1NSN S;  4GOP B;  1T5X D;  5IGG A;  4DR2 L;  4JBW A;  1W6J A;  4DNR B;  2D0P A;  3W1G A;  4X64 L;  3G4S A;  4LF7 Q;  2EJM A;  4K14 A;  3AB9 A;  4FXG C;  5CYU A;  2EYP A;  1C9O A;  3BU2 A;  1DJR D;  1LTT D;  2V1C C;  2R92 G;  3T56 B;  3K8A A;  2F4V Q;  2GVB A;  1S4Z A;  1FJG L;  4GLA C;  3CW2 C;  3F1Z A;  4KKS A;  4RMF A;  4RHR A;  4QY7 A;  1OXU A;  1B3A A;  1EWH A;  5TSS A;  5J3B A;  1DOM A;  2JN4 A;  4JOI C;  4S3S A;  3U4Z A;  1KNE A;  2XNA C;  3T1H L;  2K28 A;  1MD2 D;  2F0M A;  3J7A F;  4K6D A;  4B3S L;  3PO2 B;  1B53 A;  4POF A;  1EYG A;  1SFO H;  2CCZ A;  4IOA A;  1H9S A;  3HOX G;  4ABN A;  4CDF C;  3ERO A;  1VQA A;  2K75 A;  2I5H A;  3HOY B;  2K5W A;  1R9T B;  4Y7N B;  3PO3 B;  1PXU A;  2EJG C;  1RL2 A;  2Z8L A;  4AYB G;  1CSP A;  3BYY B;  1VQD A;  3RN2 A;  4C3J G;  1KQS A;  4BY7 B;  1UE7 A;  2JA9 A;  3KBX A;  3HS0 C;  2NVX H;  2B2U A;  5FLM H;  4X3K A;  3H15 A;  4A3F G;  3I56 A;  1MSH A;  3LWU A;  1TS4 A;  3KLR A;  4Z9C B;  2B2V C;  1JJ2 A;  1H95 A;  1X3P A;  4JG2 A;  2B39 A;  5E4X A;  1H9J A;  1PHJ A;  1MJE A;  4PMC A;  2EYM A;  2EJF C;  2KBN A;  1N34 Q;  2I46 A;  1E22 A;  5IYC G;  1HNZ Q;  1NNX A;  1HXY D;  1KNA A;  1PTO H;  1PRT B;  4FXD A;  3I4N G;  1KC8 C;  2ZTE A;  1CM9 A;  5JJL A;  1U4L A;  4JPB W;  1QOH A;  3ITP A;  5F2D A;  2OWO A;  4EVO A;  4P2C B;  2QDB A;  3FRP B;  2WIN B;  4A4I A;  3EBE A;  3HOX H;  5COR A;  1CKM A;  5ISR A;  3I4O A;  3B6Y A;  1IYV A;  4AH6 A;  1IKL A;  1YNN C;  3TQY A;  2UUA L;  3GDE A;  2CH4 W;  1V1O A;  3GTK H;  2R93 H;  3H3V I;  2K7V A;  2A6H D;  5DLQ E;  2WII B;  2N49 A;  2VQE Q;  4GOP A;  1S5B D;  1Y1V H;  4A3F H;  4EQN A;  4ME3 A;  1AZP A;  1VQ9 A;  1WTH A;  2UXD L;  2VQF L;  2DUD A;  3E6Z X;  2IX3 A;  2LSS A;  1Q82 C;  1MGS A;  3CQZ H;  5JEA H;  1LTA D;  1BNZ A;  4E6I A;  5C6A A;  3FKI H;  1XJV A;  5IYC H;  1Q12 A;  4BS9 A;  1KDA A;  3SK5 A;  1IBK Q;  4RWS C;  3H3V H;  3EQL C;  4A3L G;  4XDX A;  1CQV A;  4IOC A;  4KV6 A;  3EA6 A;  1TS2 A;  3KFU A;  4OWW B;  1Y14 B;  2KEC A;  3AFQ A;  4QMG A;  4B3T Q;  4HID A;  3MTS A;  4C3H H;  5I9P A;  3C1F A;  1VQO A;  1PH7 A;  2JA8 G;  5KYI A;  4G7O C;  3RMH A;  4X65 Q;  1RKN A;  1EEF D;  5M5W B;  3S1N H;  1F9P A;  1EIY B;  2PZU A;  1A2U A;  3PGZ A;  3I8Z A;  1PFS A;  1AEX A;  2RHQ B;  1DM0 B;  3NEL A;  4XT3 B;  2EQS A;  3H0G B;  1A8V A;  3I4L A;  1BKB A;  1H9M A;  2IT1 A;  4GKK Q;  4UP8 A;  3BVG A;  4L5Q A;  1K83 H;  4HED A;  2SOB A;  4DV5 Q;  4KHP Q;  2F0P A;  1HZA A;  3FEW X;  1V1P A;  4DK0 A;  3MAQ A;  5AFW A;  1PH3 A;  4N9T A;  5CC4 A;  4A3G G;  2MHV A;  2O5I C;  2Z9H A;  1XNR L;  3Q0A A;  1G29 1;  1X3E A;  1U5K A;  2NYZ D;  2B63 G;  1S5E D;  2UXB Q;  2L15 A;  4A3B G;  5D14 A;  2QGQ A;  5K5P A;  4DR1 Q;  2JA8 H;  2IY5 B;  1E2V A;  1QVC A;  2RSO A;  4XIG S;  1PZK D;  1PMR A;  1L1O B;  3JAM c;  2YTY A;  1FNV A;  1CZG A;  5BR8 L;  3KLS X;  3H91 A;  1LT3 D;  3I73 A;  1Q7Y C;  1SXT A;  4HMJ A;  4DAM A;  2RCF A;  4PQX A;  1GO3 E;  3GTJ B;  1W2B A;  4JOI A;  3F2C A;  5FLX c;  1JQY D;  4DK6 C;  4DR4 Q;  1HPC A;  3NXW A;  2RBM A;  4RFB A;  1P16 A;  2WV6 D;  5C4J B;  4JYA Q;  1D1K A;  4O2D A;  2K50 A;  3NE5 B;  2B2Y C;  1WTQ A;  4DR2 Q;  3X3N A;  4A3G H;  4FXK C;  4X64 Q;  4PMW A;  1XNQ L;  4OX9 L;  1YNN D;  2K1B A;  2F3W A;  4IFD J;  2AWN A;  1TY2 A;  3A8I E;  3CC4 A;  1A63 A;  2YV5 A;  4UAI A;  3TBI B;  3K58 A;  2B2V A;  2TSS A;  4WJ3 M;  2Z4I A;  4OHJ A;  4DV2 Q;  2Q2I A;  1YI2 A;  3E0J A;  3OW7 A;  1WYD A;  5EPJ A;  3NP8 A;  1TWA H;  3GTM H;  2IJ0 A;  2MO1 A;  3JC6 6;  4UDU C;  5FO9 B;  1SND A;  2C9O A;  5EQ0 A;  1SNC A;  2PI2 A;  4KHV A;  3T1H Q;  1YVC A;  3R2I A;  3K81 C;  4WOR A;  1X55 A;  4B3S Q;  1STH A;  3IFT A;  1K8G A;  2H4O A;  1X3G A;  3DUZ A;  2DJG C;  2HT1 A;  4IUP A;  1JWM D;  2I0Q A;  1SE8 A;  3VA5 A;  3R93 A;  5BN3 A;  4GN3 B;  3K7A B;  5FO7 B;  3QJY A;  5IIF A;  1VF5 C;  1LT5 D;  3CCU A;  1JB3 A;  1LAC A;  4AIM A;  1GHJ A;  3QO2 A;  3J7A 5;  3RZO B;  2JK8 A;  1I5F A;  3S2H H;  1BBW A;  3MC0 B;  4DR7 Q;  1U4R A;  2HDL A;  1SAP A;  4QUF A;  1PDQ A;  3I70 A;  1OXS C;  1YBY A;  2V4D A;  2Y0S B;  2VUM H;  1UNS A;  2CWA A;  5BN4 A;  5LMU L;  4KJO A;  2F0O A;  3VR2 A;  2ICE C;  1TU2 B;  4L6T B;  1L1O A;  2F03 A;  3S15 B;  4HCS A;  2SNS A;  3FHW A;  2E2I B;  1TR5 A;  4OL7 A;  2CWP A;  2MO0 A;  3Q23 A;  1G91 A;  2QCP X;  5L37 A;  4K8I A;  4A3B B;  1JC7 A;  2K5D A;  4CJ2 C;  2M2L A;  2XGT A;  1Y8O B;  2CQO A;  1N33 L;  2WAQ E;  1S5D D;  2JA6 G;  3GTP H;  3HKZ G;  2XWB B;  1Y8N B;  1AE2 A;  2B8F A;  1ROD A;  1STA A;  2VQF Q;  4WFN 3;  4Y52 H;  1HA5 A;  4RA8 A;  4C1N K;  4A3M H;  4LF5 Q;  1O80 A;  1ASY A;  3T53 B;  2YTV A;  4DAY B;  1A62 A;  5DM7 3;  4J6H A;  1C48 A;  1A3T A;  2JA7 G;  2B29 A;  3CP0 A;  4DV0 L;  4JCV E;  1ICW A;  4X6A H;  3PUX A;  1GHK A;  2DY7 A;  1BF4 A;  3ULP A;  2NVY H;  2D0O A;  3A56 A;  2KHS A;  1JCK B;  4V0B A;  3OSO A;  1QVG A;  1Q46 A;  1GM5 A;  5C4Z A;  3CAM A;  3CMA A;  4UY8 C;  1LM0 A;  4OWX B;  1B4O A;  2EYO A;  4A3C G;  2E2H H;  2WAC A;  4FF2 A;  3GQB A;  1FR3 A;  5J1Z A;  3L0O A;  1TQO A;  3FMC A;  5EKL A;  2Q8T A;  1EQR A;  4HIM A;  1A3V A;  1CA6 A;  2A5H A;  1I3Q H;  4DR5 L;  2LMC B;  1SMY C;  2ZJP A;  1Y69 U;  1VQC A;  5I2Y A;  2RQX A;  1ZXT A;  3DMU A;  2O4X A;  4JI3 L;  2NB0 A;  2NVT B;  4A76 A;  1MBY A;  3AYH B;  4XYO A;  3S17 H;  2B2Y A;  2QDL A;  4NXN Q;  5A2Q L;  1TWF H;  3ULL A;  3G6E A;  1XNR Q;  3MA2 B;  2E5L L;  3Q6S A;  2CW0 D;  4GNX C;  1TWH B;  3A5U A;  2A8V A;  5C44 G;  1KHI A;  4XYQ A;  3V96 A;  2NN6 G;  3QIA A;  1I50 H;  4A3D H;  2XN9 C;  4JBM A;  4JI6 L;  2R7D A;  3TS2 A;  3HOZ G;  5BR8 Q;  5KIX A;  3M3Y B;  4A3K G;  1KLU D;  1O78 A;  4DR3 L;  2IHE A;  4XXE A;  4C3I H;  3KLW A;  4JI4 L;  3BDC A;  3P75 A;  4DV4 L;  5GAG C;  1WJJ A;  4ID6 A;  1WFQ A;  2XWJ B;  3HOW G;  3MVV A;  4FNF A;  3VYU A;  2WB1 G;  4ZUJ A;  2WAQ G;  4J8Q A;  2F0H A;  2YYZ A;  1EFW A;  1V9P A;  1I4R A;  2Z0S A;  1XTC D;  3VYT A;  3CHB D;  4L5S A;  5HGQ A;  1Z7T A;  4DAY A;  3IKJ A;  3NTH A;  1XNQ Q;  4JI1 Q;  1SLJ A;  4R1J A;  4OX9 Q;  1O7Z A;  3LGJ A;  3HOV G;  2PW5 A;  2EY6 A;  4PZ6 A;  1RTN A;  5C44 H;  5ELB A;  3T1Y L;  1AW7 A;  1F77 A;  1TVX A;  1I94 L;  2NN6 H;  1AN8 A;  1JMC A;  5C0X I;  3J80 c;  1Q1B A;  2Q2U A;  2B2U C;  4DUZ L;  1LTR D;  4V19 0;  1CTM A;  1BCP C;  1M1K C;  2B2W A;  5LL6 S;  4GNX B;  3C3L A;  2IWH A;  2WP8 J;  2VL6 A;  2XVS A;  3SK6 A;  1DCZ A;  3NBH B;  4YIJ A;  4CGY B;  5C3E B;  5IP7 H;  2ZTD A;  4K2K A;  1K73 C;  1PYW D;  1DXM A;  2SEB D;  3RNU A;  4X3T A;  3Q22 A;  4NXM Q;  3CC7 A;  4CKE A;  2PMZ E;  5E3F A;  3RUZ A;  2B8G A;  3S2D B;  1SRU A;  2L12 A;  5M3F B;  2ZM6 L;  2EYF A;  2EIF A;  4FF3 A;  4B3R L;  5DAU A;  1PYS B;  1SYB A;  3HOV H;  3NK9 A;  5C4X H;  3OWF A;  2LY7 A;  1STE A;  1OO9 B;  4H02 A;  2OF1 A;  1IBM Q;  4UP7 A;  1QZG A;  1NMG A;  2ZJQ A;  4IJL A;  4LNQ A;  1IW7 C;  3L3O C;  1X54 A;  5IWA Q;  3STB C;  1BUV T;  2C35 B;  2YU9 B;  1NJI C;  5IT9 L;  1IBL Q;  1STY A;  4BBR B;  4N8F A;  1F2Y A;  1K28 A;  4BXX G;  4FF4 A;  5FK9 C;  2XRQ D;  2WFW A;  3BZD B;  4FDB A;  4UHV A;  4JI2 L;  4ZCK A;  2FJ2 A;  1BCP B;  4DNT B;  4LFB Q;  3R2T A;  3OPO A;  5EJW A;  3M9B A;  1N36 Q;  1CI3 M;  3KF8 B;  3GTG H;  3RLF A;  2RDF A;  2PQA B;  1Y8P B;  2KA7 A;  1VQG A;  1NY4 A;  3KJP A;  3CU7 A;  2IL8 A;  2BH8 A;  1N33 Q;  2ZJR A;  5M5Y B;  3S24 A;  1HUN A;  1TII D;  4DN4 M;  3HKS A;  4LF9 L;  1CZW A;  4QJF A;  1RJT A;  3A0J A;  3VR3 A;  3PO2 H;  3SXH A;  2F0E A;  2G5D A;  2BA1 A;  1BR9 A;  3HOY H;  3URY A;  4IUR A;  4IPC A;  1R9T H;  4Y7N H;  3KBG A;  4KJN A;  4BXX H;  4BY7 H;  3CD6 A;  4JBJ A;  4GNX A;  3L2P A;  2K33 A;  5BN5 A;  1HUM A;  4C2M H;  2JXM B;  1YIT A;  2HHH L;  1JJG A;  3NBH A;  2K5H A;  1EZ8 A;  3KOJ A;  1NBW A;  1LLR D;  1WOC A;  1VQ8 A;  3CRK C;  5FLM G;  1PRT C;  2EYL A;  4HMI A;  3MXN B;  1RTO A;  4RCO A;  2FHT A;  4N8X 1;  1QZH A;  1SNQ A;  3ZJY C;  2FFK B;  4F7X A;  3DM1 A;  4DR5 Q;  4HR7 B;  1QNK A;  4RGN A;  3KJO A;  2UU9 L;  1RIP A;  5CMD A;  3IL8 A;  1CK1 A;  3K6O A;  4JI3 Q;  4Q5V A;  3NHH A;  3V05 A;  1LV9 A;  4RKL A;  3NTK A;  5C3X A;  4BY1 B;  1AE3 A;  3E3X A;  1HTL D;  2NTS A;  1F2M A;  5M3M G;  1YEZ A;  3ZYY X;  2E5L Q;  4OON A;  2OT2 A;  1M8A A;  1KL9 A;  3K5N A;  4HJ7 A;  1DYQ A;  4IJH A;  3MXP A;  2ALY B;  1KRS A;  4PMB A;  4K0K L;  3FDT A;  2R93 G;  3EIV A;  1HNW L;  1QWY A;  4IN3 A;  2BE5 C;  4XQN A;  1Y1V G;  3RD4 A;  5A35 A;  5A2Q E;  4ODG A;  1IW7 D;  2ZTC A;  2KJX A;  1FYC A;  3K5O A;  2KCT A;  3KF8 A;  2G9H D;  1MJC A;  1B44 D;  1V1P B;  3W1B A;  2PQA A;  4CJ0 B;  3STB D;  1VQF A;  2EZV A;  2A69 C;  4JI5 L;  4JI4 Q;  4GN5 A;  5ELN A;  5JEA G;  2CH4 A;  1DGS A;  4DV4 Q;  3K80 C;  4RGO S;  4JW0 A;  1G2S A;  3FKI G;  2F0J A;  3PIP A;  1PH5 A;  4KKU A;  3BVZ A;  4C56 C;  4QB4 A;  5ELO A;  2LKV A;  5EKI A;  3VYR A;  3RLN A;  4A3I G;  4MN3 A;  1K9M C;  2ZXP A;  4I65 A;  3CCQ A;  2PPB C;  1PVO A;  3CC2 A;  1ESF A;  5FJ8 H;  2JYO A;  5M5W H;  4CBV A;  3SR1 A;  5M3M H;  4C3H G;  4TVA B;  2MUY A;  3S16 H;  2UUB Q;  2O2L D;  5JJZ A;  1PTO C;  3H0G H;  3DM3 A;  2R7Z G;  4ZYS A;  3CCM A;  3T1Y Q;  1ENA A;  3C2P A;  1I94 Q;  2NTT A;  1WTR A;  2B2T A;  3OWE B;  1A0I A;  2KUM A;  1AFP A;  3TZU A;  3R3O A;  1JJC B;  4YCV A;  4R8I A;  1SEB D;  2F0F A;  4OO1 I;  4GKJ Q;  4C1N I;  3I3C A;  1WTP A;  5LMN L;  1HCZ A;  2E2D C;  3OMG A;  1S3O A;  1X32 A;  2EXZ A;  2MPM A;  3OMC A;  5C4H A;  4HSV A;  4LUO A;  3MXN A;  1X9N A;  1SDF A;  5JPN C;  4LF6 Q;  3TP5 A;  1HZB A;  1D5X C;  5COY A;  4LFC Q;  1SFO B;  3WOF A;  4JV5 L;  1L1O C;  1B8A A;  1F9R A;  1VQJ A;  2HIX A;  4MNO A;  2N8N A;  4O1N A;  5D3I B;  3PIO A;  4A3I H;  2UXC Q;  3D31 A;  3GO5 A;  3S9W A;  3SK4 A;  3AEV A;  2D62 A;  2FXQ A;  1PH1 A;  3SGI A;  2OQK A;  1GUG A;  5M5X H;  4OO1 H;  3G6J B;  2F4I A;  4XQJ A;  2N88 A;  1A3U A;  4B3R Q;  1TXY A;  2L9H A;  2RSN A;  5C5M A;  1PRT D;  3I90 A;  4G4K A;  2R7Z H;  1E2W A;  2HCI A;  2QF7 A;  2R92 B;  4K5W A;  1A6X A;  2OQ0 A;  2WKD A;  2QEJ C;  4KHZ A;  5C4J H;  1WCM G;  4CKB A;  3KLS A;  4X66 L;  1CKO A;  1XMQ L;  5CV7 A;  4DUY L;  3E0E A;  5I9O A;  3W3A A;  2L11 A;  2PMZ B;  3ICE A;  3MXU A;  1J5E Q;  1PTO B;  2EE1 A;  2LXK A;  1S40 A;  4A3L H;  4ZK9 B;  2PZT A;  2I07 B;  1VQP A;  1HFG A;  2NZO A;  1HTP A;  2CQA A;  5LHY 1;  3TRZ A;  1RCV D;  2E76 C;  2BDN A;  3HOX B;  3C1E A;  3NWS A;  4AQY L;  3T4A C;  5IT9 E;  2X69 A;  2ZXO A;  4JI8 L;  1YHA A;  1LTS D;  1SYC A;  3PIP 3;  2F0D A;  4B9W A;  4AYB B;  3VR4 A;  1VQ6 A;  4C3J B;  1MSG A;  1VQI A;  2K5N A;  3K5L A;  2BE5 D;  4LUV A;  4DFA A;  3D4D A;  1L0X B;  2Q8R E;  4A3F B;  2J7Z A;  4CDC C;  1KTK A;  4UPA A;  5E7N A;  2WKC A;  3J81 c;  4NDX A;  1N32 L;  4PZ8 A;  2A69 D;  1WVL A;  3CQZ B;  1WCM H;  4IUV A;  3G7L A;  3ONA B;  1CUK A;  5AJ3 L;  2PNH A;  3HKZ E;  4OEM B;  3CPW A;  4HN7 A;  2AHO B;  3I4N B;  3PCO B;  3MHB A;  1ILQ A;  4JC0 A;  1X56 A;  3CPF A;  4FYD A;  1BBX C;  2K6A A;  3S1M H;  5E1F A;  2RHS B;  5IYD H;  1YNX A;  1Q90 A;  5H1S E;  2HHH Q;  3GD7 A;  4BBS G;  5ELD A;  4F88 A;  4M8A A;  3LNN A;  2RVL A;  4H7B A;  5GAE C;  1B9N A;  2YTX A;  1IYU A;  4ZAI A;  3HGB A;  3I4M H;  3S1N B;  3TEH B;  3PIO 3;  4A93 G;  2F0T A;  4L63 B;  1TT2 A;  1FD7 D;  1FJG Q;  2VUM G;  5IYB G;  4JI0 L;  1YHQ A;  3I55 A;  2UU9 Q;  1IL8 A;  2L55 A;  1CSQ A;  3SK8 A;  4JK1 C;  3MWY W;  1K83 B;  2VY3 A;  4IFD I;  1RF2 D;  1C4Q A;  3PUY A;  4HIK A;  1HRJ A;  4KN4 C;  1Y1W G;  1S5F D;  3A74 A;  3CCR A;  1U9R A;  3S14 H;  1SRO A;  2N3S A;  1T9H A;  1OTC A;  3J81 j;  1ZYR C;  1CQF A;  1LO5 D;  5IP9 H;  4KKT A;  4K0K Q;  3D6C A;  4BBS H;  2XTI A;  5GQO A;  3DLL A;  4GLX A;  2D9U A;  1HNW Q;  3QWN A;  1PFB A;  3GV6 A;  2JA8 B;  3GTL B;  2NVQ H;  4IFD H;  2GVA A;  1XPU A;  4NKL A;  1LT6 D;  1VDZ A;  1EFI D;  1SNM A;  5KNC A;  4A3M G;  1UUP A;  2F0L A;  4K5V A;  5EAY A;  4A93 H;  1QUQ B;  4NMZ A;  4JI5 Q;  1GUW A;  2XSC A;  1RDP D;  4G7H C;  3DWA A;  2TMP A;  5IYB H;  2B2W C;  1KD1 C;  3QB3 A;  3TME A;  2RKS A;  3W5O A;  1KAA A;  4YCW A;  1Q1E A;  1SYF A;  1SJH D;  4K2L A;  4P73 A;  4A3E G;  4IUU A;  1J8I A;  1Y1W H;  2E2J H;  1T5E A;  4HAE A;  3HP3 A;  3JAM L;  1VQ5 A;  4A3G B;  3M4Q A;  1WD1 A;  3J81 L;  1GUN A;  4MHE A;  3J7Y W;  4JI7 L;  2B63 B;  1MKH A;  3CCS A;  1M4V A;  3NUC A;  3E5S A;  1LTI D;  1MHW C;  1E1T A;  2RDG A;  2K04 A;  2WB1 E;  5IOC A;  2UUA Q;  5FLX L;  1OXV A;  1F9Q A;  2NVT H;  3NWT A;  1H9K A;  1ILP A;  1STN A;  1KAB A;  2UXD Q;  1LTG D;  2PNR C;  3NPP A;  3A5Z B;  3GTM B;  2Z6K C;  4KD4 A;  1OXX K;  1S72 A;  1G8Z D;  5CV4 A;  1BVS A;  5LL6 X;  1TWH H;  1QVF A;  2BCO A;  4B3M L;  4KY6 A;  1VMP A;  2F0V A;  5KNB A;  1UEB A;  3DWQ A;  4R4O A;  1YJW A;  2R61 A;  4A3E H;  2KQ3 A;  5E4W C;  2F0I A;  4IPD A;  5DEH A;  4ZQ3 A;  5JOB A;  1VF7 A;  1UE1 A;  1SBB B;  4QUC A;  3SEB A;  3GTO B;  1VQH A;  3M3Y H;  4LF8 L;  4DV1 L;  3O13 A;  4P71 A;  3CME A;  1K3R A;  2D2C C;  4A3D G;  3TN2 A;  3S2H B;  4JVZ A;  1VS0 A;  4A3J G;  2LXJ A;  4X66 Q;  4C3I G;  4DUY Q;  4ME5 A;  2K03 A;  4K8J A;  2OCE A;  1EEI D;  4RGM A;  1D2B A;  4DAP A;  1JOK A;  1E3P A;  1IKM A;  3A8K E;  4BA1 I;  2F3I A;  3A7A B;  3K7U C;  1PFN A;  1I6H B;  1I4X A;  3RR5 A;  3UE1 A;  4CDD C;  1D6E C;  3HOU G;  3UDF A;  1LAB A;  1QUQ A;  4AQY Q;  2VNU D;  4DR6 L;  3CCL A;  1D5Z C;  2JJQ A;  4KY7 A;  1BBU A;  3RZD H;  3U4V A;  5C3W A;  2F4V L;  1DZ1 A;  1HA6 A;  2EYJ A;  3EVQ A;  1PRT F;  3OIP A;  4J1M A;  4J15 A;  1DOL A;  1W3S A;  3A8J E;  2JA5 G;  1A15 A;  4PZ7 A;  3NSW A;  5C3E H;  4A3J H;  1N32 Q;  1Q8I A;  1HFN A;  4FP5 D;  1EWC A;  1JIC A;  2E74 C;  4GLV B;  3J7Z C;  2HIV A;  3S1R H;  5AJ3 Q;  2Z4H A;  1QNU A;  2ZXR A;  3P20 A;  3F2B A;  5M3F H;  1DD2 A;  5KEE A;  1DOK A;  4NW2 A;  5IP7 G;  3QOJ A;  5KGU A;  2NVY B;  3PMF A;  3BVM A;  5C0X G;  2R6G A;  3NBI A;  5GRO A;  3BJU A;  1Q86 C;  3HOU H;  1TWG H;  5CV8 A;  1KDB A;  4HTH A;  1E0B A;  2K05 A;  1KXL A;  3W2D A;  2CFM A;  4OWT B;  5KRU A;  3BDL A;  1EY8 A;  1P8L A;  1TS5 A;  2YU9 H;  2PCF B;  2E2H B;  1VCI A;  2JSO A;  5C4X G;  4TQU S;  3UE0 A;  1HR0 L;  1NCV A;  2E75 C;  1N34 L;  1VQ4 A;  4BBR H;  2JA6 B;  4DA2 A;  1EOT A;  3HKZ B;  1K0S A;  4QQB X;  1R4P B;  1J6Q A;  2K01 A;  2JA5 H;  4KY5 A;  1VQM A;  1IXR A;  1SN8 A;  5CV9 A;  3MFY A;  4U68 A;  5ELF A;  2I5L X;  5HUR A;  4QIW E;  2K14 A;  1EL0 A;  2JA7 B;  2L1B A;  3VYS A;  2MJ8 A;  1TS3 A;  2GN5 A;  1QB5 D;  3S17 B;  3NQT A;  5M5Y H;  3PSI A;  1EYC A;  2VQE L;  2KCC A;  3S1Q B;  1Z6H A;  3FVQ A;  5C0X H;  2R7F A;  2CHB D;  2CKZ B;  4DPG A;  4ZUI A;  1PH8 A;  3DXJ C;  2F0Q A;  2VW9 A;  3M4O H;  3KYH C;  5GAH C;  1XMO L;  3NEM A;  1BOS A;  2PI2 E;  1HR0 W;  3D0F A;  3WWV A;  2Z6B A;  4R8N A;  1Q3L A;  2B2T C;  4K5X A;  3K59 A;  4CKC A;  3PO2 G;  1U0L A;  2KHJ A;  1ML0 D;  2Z6K A;  1SMY D;  3HOY G;  2A73 B;  3PO3 G;  1XXG A;  3ND8 A;  5LMU Q;  2IPK D;  2F0U A;  3MXG A;  4POG A;  4B3T L;  2EYH A;  2ENB A;  5JAV A;  1MI2 A;  1YJN A;  4BY7 G;  4WJ4 A;  1K8A C;  3P7J A;  2K5V A;  3P1H A;  2AWO A;  4I7Z C;  1ZKO A;  4O42 A;  1OXT A;  4JI7 Q;  1E2Z A;  1XPR A;  4LW1 A;  1STB A;  1PH6 A;  2A74 C;  4HSP A;  1I4H A;  3H09 A;  2VXW A;  2VB2 X;  4CHT B;  5C44 B;  2CVR A;  1UEA B;  5I2X A;  5T1I A;  4TKO B;  3I91 A;  1QIL A;  4LFA L;  2RA4 A;  3HOZ B;  3JAM E;  5JJK A;  1DON A;  1K8O A;  2M00 A;  1LT4 D;  4F8M A;  4A3K B;  2K52 A;  3J81 E;  3I72 A;  4BY1 H;  1NR4 A;  4X3U A;  1EQT A;  4IAL A;  4RG1 A;  1D1I A;  2F0G A;  2EDG A;  1XWE A;  1Z47 A;  4OXP A;  1EY0 A;  1CFM A;  2VS1 A;  3H94 A;  1EIF A;  3FP9 A;  3PO3 H;  5J22 A;  4R9W A;  5FLX E;  3HOW B;  4DV0 Q;  1SNP A;  3BZC A;  4UP9 A;  4KTA A;  3AQQ A;  4K6L A;  1GKH A;  2WB1 B;  2WAQ B;  1GUT A;  1B1Z A;  4DR1 L;  2H1E A;  3J80 L;  2MP1 A;  3FPU B;  1GJX A;  4MIU A;  5JPM C;  3K0Y A;  2F0S A;  4DV1 Q;  3HOV B;  3T13 A;  4RCN A;  2MGS A;  5IE8 A;  3FPP A;  2IX0 A;  5EPK A;  3OIQ A;  3X3M A;  3I7F A;  4DR4 L;  2N55 A;  1N9W A;  1BCP D;  2IX1 A;  1FGB D;  3PF4 A;  4IQZ A;  2IHF A;  4DV3 L;  5M9O A;  1JE5 A;  3KUP A;  4DGZ A;  1UE6 A;  3PUZ A;  4OEL B;  1U4M A;  2O5J C;  1SYD A;  1BXT A;  3A55 A;  1F2L A;  3HZX A;  1N8R C;  4QCL A;  3D4R A;  2R3Z A;  1KLG D;  3WDN A;  4BWG B;  2H5X A;  1PH2 A;  4DR6 Q;  5FJ8 G;  2OXP A;  3RLO A;  3GTG B;  4DV2 L;  4YWM A;  1HZC A;  1XX8 A;  3VA7 A;  3T16 A;  1C8C A;  3H0G G;  3L9A X;  3SE0 A;  3GTQ B;  1XTD A;  2PW7 A;  4O0A A;  3DWP A;  1HHV A;  3VR6 A;  1C0A A;  4OGQ C;  4ZRZ A;  4OIJ A;  1PH4 A;  1ENF A;  3QOL A;  4JI6 Q;  1HNX L;  3L7Z C;  4L8J A;  2MNA A;  1GOZ A;  4X62 L;  3M7N A;  3OW2 A;  2NWG A;  1HH2 P;  4DXF A;  4DR3 Q;  2D5D A;  1TY0 A;  2Y0S E;  4EQP A;  1D7Q A;  2KEE A;  2BOS A;  2LFN A;  1PZJ D;  5IGF A;  1TWC B;  2JP1 A;  1SR3 A;  3GP7 A;  3BS1 A;  4DR7 L;  2R92 H;  4C2M B;  4LK1 C;  2ICI A;  1V8Q A;  2EPB A;  4IUN A;  5JEA J;  3TZD A;  4B9X A;  4OO1 G;  5CGK A;  5CBA E;  5JVH 3;  4LF4 L;  4IO9 A;  2KVM A;  4KN7 C;  1HR0 Q;  1XYI A;  1CKN A;  5JVG 3;  5IGD A;  3U9S A; 
#chains in the Genus database with same CATH homology
 4DR5 L;  3G71 A;  2ZJP A;  1VQC A;  4L5R C;  4A93 G;  3UDX A;  3EN2 A;  1J5E L;  2AMC B;  4GKK L;  4HJ8 A;  4DUZ Q;  4JI3 L;  1FJG Q;  1YJ9 A;  5IYB G;  3KF6 B;  1YHQ A;  3I55 A;  2UU9 Q;  4JI0 L;  2VUM G;  4DV5 L;  1LTL A;  4KHP L;  4A76 A;  1CSQ A;  3E9H A;  2VY3 A;  3AYH B;  4IFD I;  1NTG A;  4R4C A;  3S17 H;  3PUY A;  4HIK A;  4P75 A;  1EWI A;  1Y1W G;  4NXN Q;  1TWF H;  3ULL A;  3A74 A;  1ASZ A;  3G6E A;  3K0X A;  3CCR A;  3S14 H;  1SRO A;  1V43 A;  1T9H A;  2N3S A;  4YWL A;  3J81 j;  1OTC A;  1XNR Q;  2E5L L;  4DV7 Q;  4P74 A;  4C3J H;  3CCV A;  2QA4 A;  4B3M Q;  2UXB L;  3G48 A;  4GNX C;  3A5U A;  3GTQ H;  1L0W A;  1VQ7 A;  4HIO A;  5IP9 H;  1CKN B;  4DK3 C;  2KCM A;  2A8V A;  5C44 G;  1KHI A;  1JT8 A;  1B70 B;  4K0K Q;  2NN6 G;  3CCE A;  2ZM6 Q;  1I50 H;  1NE3 A;  2XTI A;  5GQO A;  3DLL A;  4GLX A;  4LF5 L;  4A3D H;  4JBM A;  1HNW Q;  4JI6 L;  2R7D A;  3TS2 A;  3HOZ G;  4LF8 Q;  5BR8 Q;  2NVQ H;  4GN4 B;  2JQO A;  4A3K G;  4A75 A;  1XMO Q;  2GVA A;  3MEF A;  1XPU A;  3GTJ H;  4DR3 L;  2IHE A;  4NB3 A;  1VQK A;  4KI0 A;  4A3M G;  4C3I H;  3KLW A;  4JI4 L;  4YHH L;  5EAY A;  4YY3 L;  2ASB A;  3I4N H;  1QUQ B;  4JI5 Q;  4A93 H;  4DV4 L;  1UE5 A;  5GAG C;  4YCU A;  3ERS X;  1WJJ A;  5IYB H;  1WFQ A;  3HOW G;  1KD1 C;  1HZ9 A;  3W5O A;  4YCW A;  4JYA L;  1Q1E A;  1TWC H;  3HFZ B;  2WB1 G;  4L5T A;  4GOP B;  2WAQ G;  2YYZ A;  1EFW A;  1V9P A;  4DR2 L;  4P73 A;  1O7I A;  2Z0S A;  4JBW A;  5LMN W;  4A3E G;  2D0P A;  3ULJ A;  5JJI A;  3W1G A;  1Y1W H;  4L5S A;  5HGQ A;  4X64 L;  2E2J H;  3G4S A;  4LF7 Q;  1EQQ A;  5GAD C;  1VQ5 A;  1XNQ Q;  1IYJ B;  3M4Q A;  4JI1 Q;  1SLJ A;  1UWV A;  4R1J A;  4JI2 Q;  4OX9 Q;  4IPH A;  4YWK A;  3LGJ A;  4JI7 L;  3HOV G;  5IYD G;  1C9O A;  4PZ6 A;  4R4T A;  1MKH A;  3CCS A;  3BU2 A;  2V1C C;  5C44 H;  2R92 G;  3T1Y L;  1E1T A;  1I94 L;  2WB1 E;  2Y0S G;  3K8A A;  2UUA Q;  1JMC A;  5C0X I;  1IZ6 A;  3J80 c;  2F4V Q;  1Q1B A;  2GVB A;  1OXV A;  4DUZ L;  3UDG A;  4GLA C;  2Q2U A;  1FJG L;  2NVT H;  3CW2 C;  2DGY A;  3I4M G;  3F1Z A;  4LFA Q;  2E8G A;  4RMF A;  1M1K C;  4QY7 A;  4LF9 Q;  1OXU A;  2OTJ A;  1Q8K A;  2UXD Q;  1LUZ A;  5J3B A;  4GNX B;  4JOI C;  3U4Z A;  2WP8 J;  3A5Z B;  2VL6 A;  2Z6K C;  4NXN L;  1WI5 A;  3T1H L;  1OXX K;  3NBH B;  4B3S L;  1S72 A;  4POF A;  1EYG A;  5IP7 H;  1BVS A;  1M90 C;  2ZTD A;  1SFO H;  2CCZ A;  1K73 C;  2ES2 A;  4IOA A;  1TWH H;  1VQB A;  3HOX G;  1QVF A;  4B3M L;  1VQA A;  2K75 A;  2I5H A;  3RNU A;  1EOV A;  4DNI A;  4R4I A;  3U58 A;  1UEB A;  4R4O A;  4NXM Q;  1YJW A;  3CC7 A;  1VQN A;  4A3E H;  1RL2 A;  2PMZ E;  1K0R A;  1YHB A;  3K7A H;  1SRU A;  3KF6 A;  4AYB G;  1CSP A;  4IPD A;  1VQD A;  4AYB E;  2ZM6 L;  3RN2 A;  1KQS A;  3GTL H;  1UE1 A;  2EIF A;  1UE7 A;  3M3Y H;  1VQH A;  2JA9 A;  4LF8 L;  2NVX H;  5FLM H;  3RZO H;  3H15 A;  4DV1 L;  4A3F G;  5IP9 G;  1PYS B;  3I56 A;  4B3R L;  4P71 A;  3E9I A;  3HOV H;  5C4X H;  4H02 A;  1K3R A;  3CME A;  1PA6 A;  1KAW A;  3Q8D A;  4ALP A;  1JJ2 A;  1IBM Q;  4UP7 A;  1QZG A;  2RCN A;  1NMG A;  4LUZ A;  2ZJQ A;  4JG2 A;  4A3D G;  4IJL A;  1H95 A;  1PHJ A;  4LNQ A;  2BA0 A;  5HY6 A;  1MJE A;  1X6O A;  1X54 A;  1VS0 A;  5IWA Q;  4A3J G;  4IFD G;  3STB C;  2C35 B;  3JAM i;  2KBN A;  1NJI C;  1N34 Q;  3I2Z A;  4NPS A;  1G6P A;  1IBL Q;  1E22 A;  2LXJ A;  5IYC G;  1HNZ Q;  4X66 Q;  3J81 i;  4DUY Q;  1D8L A;  2OCE A;  3I4N G;  1KC8 C;  2ZTE A;  3S15 H;  4IPG A;  4BXX G;  3F2D A;  4DV3 Q;  5JJL A;  2E2I H;  1E3P A;  2OWO A;  4BA1 I;  2WFW A;  2F3I A;  4JI1 L;  4FDB A;  3TRE A;  4A4I A;  3EBE A;  3HOX H;  3K7U C;  4JI2 L;  2B63 H;  3TS0 A;  4LFB Q;  1CKM A;  3RR5 A;  3UE1 A;  1N36 Q;  3M9B A;  3I4O A;  3HOU G;  3UDF A;  3B6Y A;  1QUQ A;  4A3B H;  3KF8 B;  4AQY Q;  4AH6 A;  3GTG H;  3RLF A;  4DR6 L;  4EX5 A;  2PQA B;  3CCL A;  2VNU D;  2JJQ A;  1V1Q A;  1VQG A;  4HJ9 A;  1BBU A;  1NY4 A;  3TQY A;  3KJP A;  3GDE A;  3RZD H;  3U4V A;  2UUA L;  3GTK H;  2R93 H;  2BH8 A;  2F4V L;  3H3V I;  1N33 Q;  2ZJR A;  5DLQ E;  4P72 A;  2N49 A;  3S24 A;  2VQE Q;  4GOP A;  3OTO L;  1Y1V H;  4A3F H;  4ME3 A;  1VQ9 A;  2A19 A;  3HKS A;  4LF9 L;  1VQL A;  2UXD L;  4QJF A;  2VQF L;  2DUD A;  5IY0 A;  3A0J A;  4J15 A;  1W3S A;  2JA5 G;  2LSS A;  1Q82 C;  4PZ7 A;  3CQZ H;  3PO2 H;  5C3E H;  2JEA I;  1HNX Q;  2ATW A;  4A3J H;  4DKA C;  1N32 Q;  2BA1 A;  3M4P A;  4X62 Q;  3HOY H;  3FKI H;  4IPC A;  1R9T H;  1XJV A;  5IYC H;  1Q12 A;  4GLV B;  4Y7N H;  3J7Z C;  2AKW B;  1IBK Q;  2HIV A;  3S1R H;  5AJ3 Q;  4NXM L;  3H3V H;  2A1A A;  5M3F H;  3F2B A;  4BXX H;  4IOC A;  4GS3 A;  5IP7 G;  3GTO H;  4BY7 H;  3KFU A;  1FGU A;  4OWW B;  4KLK A;  3CD6 A;  1Y14 B;  3AFQ A;  4JBJ A;  4GNX A;  2OTL A;  5C0X G;  2R6G A;  4C3H H;  3L2P A;  4HID A;  4B3T Q;  5GRO A;  3BJU A;  1Q86 C;  1L2F A;  1E24 A;  1TWG H;  4C2M H;  1YIT A;  1IBM L;  1VQO A;  1PH7 A;  2HHH L;  2UUC L;  3HOU H;  1JJG A;  1KXL A;  4XTC S;  2JA8 G;  2K5H A;  4R4Q A;  2CFM A;  1FL0 A;  4OWT B;  1SMX A;  3KDF B;  1MIU A;  1NBW A;  1YZ6 A;  1WOC A;  3KOJ A;  4X65 Q;  1VQ8 A;  5FLM G;  1P8L A;  2YU9 H;  5IWA L;  3AFP A;  4DV6 L;  3S1N H;  1VCI A;  1EIY B;  4LF4 Q;  5C4X G;  4TQU S;  3UE0 A;  1G51 A;  3MXN B;  1HR0 L;  3PGZ A;  1N34 L;  1VQ4 A;  4BBR H;  1IBL L;  3OYY A;  1PFS A;  1QZH A;  3ZJY C;  2RHQ B;  4QQB X;  1KIX A;  1J6Q A;  3NEL A;  2EQS A;  4DR5 Q;  1A8V A;  2ID0 A;  1BKB A;  2JA5 H;  3KJO A;  2IT1 A;  1RIP A;  2UU9 L;  4GKK Q;  2NZH A;  1VQM A;  4JI3 Q;  1IXR A;  4UP8 A;  1SN8 A;  4L5Q A;  3CCJ A;  1K83 H;  4DV5 Q;  3PV0 A;  4KHP Q;  1I6H H;  1HZA A;  2I5L X;  2N78 A;  4LFB L;  4QIW E;  1HJP A;  2K14 A;  1N36 L;  1PH3 A;  5LMN Q;  4A3G G;  2GN5 A;  2KHI A;  1AE3 A;  1XNR L;  5M5Y H;  4DV7 L;  1G29 1;  3PSI A;  1X3E A;  1U5K A;  1YEZ A;  5M3M G;  2E5L Q;  4OON A;  2B63 G;  2VQE L;  3PO2 G;  4BA2 I;  4JV5 Q;  2UXB Q;  2L15 A;  4A3B G;  1KL9 A;  4HJ7 A;  4IJH A;  2R7F A;  2Q2T A;  2QGQ A;  2ALY B;  1KRS A;  4K0K L;  2CKZ B;  3M85 A;  4DR1 Q;  2JA8 H;  2R93 G;  1QVC A;  4DPG A;  3EIV A;  4XIG S;  1PH8 A;  1HNW L;  2IY5 B;  1L1O B;  3JAM c;  2VW9 A;  2YTY A;  3M4O H;  3KYH C;  5BR8 L;  5GAH C;  1Y1V G;  2KEN A;  1XPO A;  3NEM A;  1XMO L;  1Q7Y C;  2F52 A;  2VZA A;  2PI2 E;  2ZTC A;  3PUW A;  1HR0 W;  4DAM A;  3D0F A;  2KCT A;  3WWV A;  1GO3 E;  1MJC A;  3W1B A;  2MFI A;  2JE6 I;  2PQA A;  3STB D;  1VQF A;  1W2B A;  2Q2H A;  4JOI A;  4JI5 L;  4JI4 Q;  4GN5 A;  5ELN A;  5JEA G;  4YY3 Q;  1U0L A;  2KHJ A;  2Z6K A;  5C3E G;  4YHH Q;  3F2C A;  1DGS A;  4DV4 Q;  3K80 C;  4LWC A;  5FLX c;  1YIJ A;  3HOY G;  4DK6 C;  4DR4 Q;  4QGU A;  3FKI G;  3PIP A;  1PH5 A;  2I5M X;  3VDY A;  1P16 A;  1XMQ Q;  3PO3 G;  5LMU Q;  2EXD A;  4JYA Q;  4O2D A;  5ELO A;  4POG A;  2K50 A;  4B3T L;  4A3I G;  3RLN A;  5M3F G;  1K9M C;  4DR2 Q;  1YJN A;  4BY7 G;  4A3G H;  4WJ4 A;  4LF7 L;  3CCQ A;  1PVO A;  4X64 Q;  1K8A C;  4PMW A;  2B3G A;  3CC2 A;  5FJ8 H;  1NMF A;  1XNQ L;  5M5W H;  2K5V A;  4OX9 L;  2AWO A;  5M3M H;  1EUJ A;  4IFD J;  2JA6 H;  2AWN A;  4TVA B;  3CC4 A;  1A63 A;  3S16 H;  1OXT A;  2UUB Q;  4APV A;  4JI7 Q;  1XPR A;  2YV5 A;  3H0G H;  4LW1 A;  1PH6 A;  3DM3 A;  2R7Z G;  4JI8 Q;  4WJ3 M;  3CCM A;  3T1Y Q;  1I94 Q;  4DV2 Q;  2Q2I A;  5K36 G;  1A0I A;  1YI2 A;  4LFA L;  1JJC B;  4BBR G;  4YCV A;  5JJK A;  1WYD A;  2HQL A;  1TWA H;  3GTM H;  3UDI A;  2K52 A;  2MO1 A;  3JC6 6;  2JA7 H;  4GKJ Q;  4BY1 H;  4OO1 I;  2QEX A;  4RG1 A;  3KDF A;  5LMN L;  4A3L G;  1S3O A;  2PI2 A;  1Z47 A;  3T1H Q;  4LUO A;  1YVC A;  3K81 C;  4OXP A;  1X55 A;  4B3S Q;  2VS1 A;  1X9N A;  1EIF A;  1K8G A;  3S1Q H;  1X3G A;  5IT9 c;  3FP9 A;  4LF6 Q;  3PO3 H;  4BBS H;  1B7Y B;  1HZB A;  4DV0 Q;  4LFC Q;  4JV5 L;  3BZC A;  4UP9 A;  3S2D H;  3AQQ A;  2K4K A;  1L1O C;  1VQJ A;  2HIX A;  1B8A A;  2N8N A;  1GKH A;  4MNO A;  3PIO A;  4A3I H;  2UXC Q;  3D31 A;  3RN5 A;  3GO5 A;  2HT1 A;  1GVP A;  4DR1 L;  2I0Q A;  1SE8 A;  3F8T A;  4A3C H;  3AEV A;  2D62 A;  2FXQ A;  4GN3 B;  1PH1 A;  2BH2 A;  1VQE A;  3NEN A;  3SGI A;  2OQK A;  3CXC A;  5M5X H;  3CCU A;  4EQ5 A;  4DV1 Q;  4HJ5 A;  4B3R Q;  1TXY A;  1LYL A;  1E1O A;  4AIM A;  3J7A 5;  2JK8 A;  1I5F A;  1X65 A;  3S2H H;  1BBW A;  4QL5 A;  2R7Z H;  4DR7 Q;  5IE8 A;  1KRT A;  1OXS C;  2IX0 A;  1YBY A;  2OQ0 A;  4KHZ A;  2VUM H;  3I7F A;  5C4J H;  1WCM G;  4DR4 L;  2NN6 I;  1HNZ L;  2CWA A;  4X66 L;  1CKO A;  1N9W A;  1XMQ L;  5LMU L;  4DUY L;  3E0E A;  1C7Y A;  2IX1 A;  3PF4 A;  5C0X J;  1PV4 A;  3ICE A;  1J5E Q;  1L1O A;  2IHF A;  2LXK A;  4DV3 L;  1S40 A;  4A3L H;  1JE5 A;  4MZ9 A;  4JI0 Q;  1UE6 A;  3PUZ A;  1VQP A;  2NZO A;  3FHW A;  1N8R C;  3TRZ A;  2CWP A;  2UUB L;  1E7Z A;  4AQY L;  2MO0 A;  4JI8 L;  2H5X A;  1PH2 A;  1YHA A;  4DR6 Q;  5FJ8 G;  3PUV A;  2XGT A;  3RLO A;  1Q81 C;  2CQO A;  4YWM A;  4DV2 L;  1N33 L;  1HZC A;  2WAQ E;  2JA6 G;  3GTP H;  3HKZ G;  3HOZ H;  1VQ6 A;  3OTO Q;  2K5N A;  1VQI A;  3H0G G;  1AE2 A;  4MTN A;  4PG3 A;  4A3K H;  4LUV A;  4HJA A;  1XTD A;  2VQF Q;  4GKJ L;  4O0A A;  4Y52 H;  4UPA A;  1C0A A;  4A3M H;  4LF5 Q;  2MQH A;  5E7N A;  1PH4 A;  4JI6 Q;  1HNX L;  3L7Z C;  1ASY A;  3J81 c;  2YTV A;  2MNA A;  3U50 C;  4DAY B;  4PZ8 A;  1A62 A;  1JB7 A;  1N32 L;  2RF4 A;  4X62 L;  3M7N A;  3J80 i;  1WCM H;  3OW2 A;  3HOW H;  1HH2 P;  4LF6 L;  4DR3 Q;  2B29 A;  2JA7 G;  3CP0 A;  4BY1 G;  2Y0S E;  1CUK A;  1IBK L;  4LFC L;  4DV0 L;  1D7Q A;  3ER0 A;  4JCV E;  5AJ3 L;  2PNH A;  3HKZ E;  3CF5 A;  3CPW A;  3PUX A;  4X6A H;  2UXC L;  2AHO B;  1PH9 A;  3ULP A;  1PYB A;  2NVY H;  2D0O A;  3IRB A;  3PF5 A;  3PCO B;  1Z9F A;  4JC0 A;  1X56 A;  3CPF A;  1QVG A;  1Q46 A;  1GM5 A;  3CAM A;  3S1M H;  2JEB I;  3CMA A;  2RHS B;  1X3F A;  5IYD H;  1YNX A;  1SR3 A;  2UUC Q;  1GD7 A;  1LM0 A;  4UY8 C;  4OWX B;  5H1S E;  3GD7 A;  2HHH Q;  4DR7 L;  4BBS G;  4A3C G;  2R92 H;  2E2H H;  4X65 L;  5JEA J;  4JBK A;  5GAE C;  4OO1 G;  3BZK A;  2YTX A;  4LF4 L;  4GOP C;  4DV6 Q;  4IO9 A;  3L0O A;  1HR0 Q;  1IL2 A;  1EQR A;  3I4M H;  1FVI A;  3TEH B;  4HIM A;  1AH9 A;  1CKN A;  1I3Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...