3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
molecule keywords BipA
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
4ES3A 2DY1A 4ZCLA 2EFGA 2YWHA 2XEXA 1P9QC 1N0VC 1DARA 2BM0A 1ZM2A 3OQ2A 2BV3A 1N0UA 2J7KA 1ELOA 3B78A 2BM1A 1WDTA 1ZM3A 1VI7A 4ZCIA 2YWFA 1KTVA 2CVEA 1FNMA 4TNOA 2IVYA 1T95A 4ES1A 4MAKA 3ZZUA 2ZITA 4ES2A 2KDOA 4ZCKA 4QR0A 2I0XA 4MYUA 3B82A 2L9NA 5G4DA 3ZZ0A 1U2RA 2WBMA 1ZM4A 3EXCX 2YWEA 1ZPWX 3CB4A 2E1RA 3B8HA 4QR1A 4QR2A 3ZZTA 1ZM9A 4ZCMA 3LH2S 4MYTA 2NPFA 4M1KA 2I8EA 3E3XA 4FN5A 2YWGA 3UI3A
chains in the Genus database with same CATH superfamily
1S4FA 2E5GA 3HKZD 3PMFA 3PO4A 1XK8A 4KPYA 4LFBF 3H40A 3MM8B 2CWKA 1JORA 4GKKJ 2Y0SB 4A3LH 3PIPQ 1R8BA 1O51A 4DEZA 4NLQA 1F77A 1K47A 1Y3JA 4IFYA 2ALYB 2L1BA 3BM7A 5LMNW 1GFWB 4GKJJ 2XI2A 1BR9A 1MN9A 2K5QA 1SV5A 4X65L 3MPYA 3HKSA 1KTVA 2Q3PA 3RZDH 2QYCA 1HNZL 3MEHA 3W61A 3I4NH 3EROA 2ZTDA 2FVSA 4DQIA 3I0RA 2BDNA 3AJDA 5IQQA 1I50H 1BE4A 2NREA 1B9MA 3DUZA 5DDOC 2F0JA 4CYUA 4IUUA 4QIFA 3G82B 2V9KA 3UO0A 2UU9L 1M8AA 3TBIB 2B5JA 1F5CA 2ERRA 2JZ5A 2BE2B 3EDRB 2FHMA 1HWLA 2BCOA 3ND8A 1BQXA 4PAAA 4JI0J 2PA3A 5F2DA 4LF7L 4KKOB 2YKNA 1UCNA 2DHSA 3VCDA 3EQLC 3BBBA 6FDRA 4PWDB 3I4MG 1JB7A 4HDHA 2HBYB 2I38A 1ZA1B 4ECUA 4JI3F 1VQ4S 4ZIWA 3EZ5A 2CQCA 2DR7A 4NA2A 3T5LA 2F9DA 2H5JB 2JLGA 4UAIA 1VQSA 1JLBB 1KRSA 4NZ6A 4RW9A 2ICIA 4ZPTR 5GQOA 3OPKA 3K7AH 5FO9B 3CW2C 2K8GA 1W26A 1WSRA 2VH7A 3KDNA 5CC4A 4LFAJ 1YJNS 3W1BA 3S1QH 3MCNA 3N6RA 1SMXA 3R5DA 3UDGA 5AFWA 1Y1VH 5C4ZA 3I7FA 4UP7A 4OO1G 1S97A 2AP6A 3MXNA 4HCEA 3T5JA 5EKIA 5EPLA 1ZOTA 3IA0A 3URYA 1FDDA 1TY0A 2FGOA 1QAJA 2Z1CA 1DGSA 2XZDB 1VQCA 1CKNA 4QF4A 1LWEA 2ZOGA 2F63A 3GV3A 2EIFA 4L5TA 1EY5A 3H15A 4AYBE 1WTBA 4WF9Q 5DEHA 1EQQA 4U7CA 2XSJB 3G8SA 2KOLA 3KLVA 3CQZB 4BBSB 1MN7A 4H4KC 2QW7A 3QRRA 2IY5B 4OX7A 3EYZA 2DY8A 1F1BB 1WHXA 1L0XB 4CT9A 1S7IA 3K6OA 3S2DH 2PMWA 5CCMA 1FGBD 2R7QA 1NPPA 2DNLA 3R5GA 4K4YA 3OL9A 3R8YA 1WTQA 2EFPA 1Y00A 5I3QA 4RW9B 4TU9A 2Z58B 2DGOA 4LNQA 3WIVA 3N5BA 2DNNA 3JAMi 3LTOA 3JTPA 2XYPB 1CKOA 5LSRA 4ZN1A 4KY5A 2GJFA 3DWQA 4MYTA 3IR6B 4QYZJ 4DV0F 3VR2A 3R1LA 3OWEB 2UXDJ 4W92B 1UVJA 4EMDA 2LEAA 3T19A 1IBLQ 1RACB 3ENWA 2J6UA 3BR9A 1Z1ZA 2R7DA 4NI2B 4A46A 4OZ1A 2FJAB 4QIWD 1HD1A 1YHQA 3L3OC 3GLJA 4OHZA 3C6UB 2O67A 2MPUA 3JS9A 5KT4A 1DM0B 3VGVA 2F0FA 4HH1A 2UU9F 1N32J 3HLUA 3NOCA 1U02A 2HVEA 3D1QA 1XNRF 1J5EJ 4FVMA 3EJIA 3MPWA 2VQEL 4DL5A 4GLAC 3EXYA 1S5CD 1FI4A 2BJ9A 5IWAJ 2FJDB 1UJ4A 1NJWA 1YNND 4R0EA 4IFDJ 2FHKA 3QQCD 4KB7A 1UA0A 1PGZA 3MFHA 2F0TA 3TN2A 2ZKUA 4RR5A 1T7PA 4MFBA 2LQ9A 3QGPA 1N8RT 4DL7A 2GHVC 4NCGB 1CHQD 2PZUA 3NGSA 4NE9C 1FKOB 2RE1A 4A3JH 3ND9A 2DVIA 4K0KF 2K5WA 3WHIA 1K8AC 3MAAA 4LREA 1H9RA 3TZXA 1ASZA 2UXCJ 2ADCA 1KR4A 4ES3A 1JE5A 3NGDA 4A3BH 2JJ4D 3J81U 3TANA 2EFVA 1M0SA 5T7LB 4KD3A 3KG1A 1IWAA 1YI2A 4ZDNA 1KNEA 2LFNA 4C8YA 1PC4A 1FJGQ 2CPIA 1VQNS 2MGZA 3VTIA 5H9EK 4X66J 3WBZA 1RTHA 3BU2A 1FRLA 4JI3L 5JAVA 4DQRA 3RBXA 4YCWA 3PNIA 1SC4B 2CPDA 2FY8A 4P7VA 2R7ZB 2BV3A 1TVRB 4LSLB 4HIDA 1C1CA 3K80C 1G6BA 4WPAA 4U95A 2BRLA 2PMZE 1PVOA 2WW4A 4DUZQ 3M4OB 5F8LA 1SE3A 2IHFA 4LRAA 2U1AA 5ETKA 1T05B 3HVTA 3LP2A 4OHVA 3DI6B 1S1VA 1Z2ZA 2OPQB 2ASBA 1M1HA 3A1YG 3HKZE 1CQMA 2CIMA 4HVZA 1DOLA 1EYGA 5CV6A 3T51B 1OYDA 3AOCA 4DV7J 4NA1A 3JAML 4NCGA 5KFBA 2JRSA 4A3MB 3GO5A 1EX8A 3OLAA 2UUAJ 1FJ7A 5DG7A 2ZJPQ 5C24B 1A63A 2VJUA 8ATCB 1UEVA 1R8AA 1WOPA 2GO9A 2A10A 5GVQA 5H9EJ 1C0TA 4DAVA 2OEKA 1N33L 4B3TF 4ID8A 4PG4A 3DEPA 4DK0A 2R93H 3T4AC 1TKZA 1IKVB 4RX6A 2B9XA 3OR2B 2VB3X 2WKCA 4KRWA 3GYNA 2K52A 1VMBA 3HGBA 1BQNB 3I0RB 3DRPA 4CH1A 4DCJB 1TU0B 3GPAA 1K9MT 2ZH5A 1O6XA 4JI8F 1K0VA 1EY8A 3EGNA 4B3RL 5IP7G 5C25B 4LSLA 2C1EB 3QT6A 4ERDA 2NN6G 3R3TA 4RO0A 1BF4A 5AJ3L 3KYLA 4UY8C 3FCWA 1DTQB 2IPOB 2AUKA 2XCAA 2Z2MA 2FC9A 1KDAA 2LA6A 1I94L 2J7KA 2R3VA 1ZM3A 3D7SB 1YJNA 1NJXA 1PC5A 3DM2B 5EPJA 2C22A 3U27A 1SV5B 3FNNA 3R5BA 1QUQB 4XAKA 3FFIB 1S6PA 4UUXA 3C46A 1D5MC 4NLUA 4A8WA 5A6PA 1N5QA 5COYA 4A3EB 3P1HA 1IBLF 1RHRB 3MXUA 5A2QE 1ZZFA 1HW9A 1TS3A 4DNTB 1RT2A 1HNWQ 3PIOA 2WVFA 2V69A 5M5YH 1Q7YT 3BSOA 2VZAA 4DV1F 5KNDA 2HNZA 2CJ9A 3AH6A 3ER0A 2C2MB 1JLFA 4L63B 4IFDI 3OW2A 1SH3A 1OTCA 4B3RF 2ZXOA 2BH8A 2EPIA 3GTQH 4BLGA 1SE4A 2UXCQ 2B39A 4XDDA 4HH0A 4DL4A 4CH7A 4NLRA 4C8LA 1UWVA 2LEPA 4DV5J 1EIGA 4HTIA 1P9YA 1Y3KA 3IAS9 1NE3A 4KY7A 1HH2P 3OT9A 3SHLA 4TXSA 2X1FA 5JEAG 4H13C 2G1HA 4XYQA 1A2UA 1R8PA 1YEZA 5L39A 1WEYA 1KFSA 1NSQA 2IRUA 4A3BG 3DM2A 3O6QA 4I6AA 3T5HA 4K2JA 4C2MH 3UDLA 4IG0A 3BO3A 1ICWA 1SMYD 2UUCL 1U1QA 2Y8WA 2G0JA 1FNMA 3A56A 1A8VA 5KFVA 3LWEA 2DIVA 1X3FA 3U02A 4ETXA 3BDLA 2E76C 4WKRA 4A3FB 3QOJA 4DU9A 3OIQA 1SJQA 1RT5A 4M63A 3L7UA 2CJBA 2IBOA 2RF2B 3BPDA 3VYUA 4JI7L 4MTPA 1EP4B 4OYOA 3D67A 5M5XB 4RKBA 4DV3Q 1RWOB 1TMMA 4DV4L 1XN9A 5ETTA 5IC4B 5B0GA 3W65A 4BXXG 1PTOB 3QJLA 3TAMA 4XYOA 4ID5B 2XQCA 1KQSA 3RUBL 3O44A 2MKIA 3QSIA 4CLFA 1Z2LA 1CC8A 1B53A 4DR3F 5J2QA 1XERA 2PI2E 2IRYA 4Q2MA 4ZLNA 2PN6A 4CO4A 1VQEA 5H9FJ 3GTGB 1F2MA 1W2IA 4ZLPA 3SDEB 4LRDA 3W2WB 4JI2L 1YIJA 3BGRB 2UUBQ 4LF9F 2UVWA 1E1OA 1HZAA 1VQIA 2COLA 4OZ2A 2K75A 2QL9B 5KYIA 1PYBA 4Q44A 1KTKA 1VQ6A 5CYQA 1WTXA 2MJNA 3DOKB 5ETPA 1S40A 3FSIA 5GAEI 3A8KA 2JEGA 4Y2KA 4P2XA 2VODA 4TYBA 5E1FA 3I4OA 1HKAA 4F0MA 1U48A 4WKYA 2E74C 1XNQJ 4YHHF 2XBPA 3C6UA 3H7HB 4FZVA 1APSA 3F73A 1XPRA 3OL6A 5C42B 2NZ4A 1UFWA 2CQ4A 4OX9J 2XRQD 4DV1L 1RWKB 5ETRA 2CWAA 1P16A 1TFYA 2LCWA 2A8VA 3D6HB 3D6MB 1O7IA 1N5VA 3KTQA 3GTPB 4DSIA 3CUNA 4F04B 1KHWA 1QE1A 4CLUA 2F3IA 2G13A 2HHSA 3UPFA 4J91A 2QLWA 4KD4A 4LF6Q 1Q0NA 4P52A 2R7FA 4C8MA 3GTJH 3CF5Q 3GCWP 2SEBD 1M4VA 5AXMA 4K5SA 1N34Q 3MAAB 2F3WA 3GD7A 4OXPA 1R6YA 4IPDA 4A4IA 4C1NK 4QMGA 1NTGA 3LALA 5L9NA 2FMMA 1F2LA 3SI8A 2JN4A 4FXGC 2F3JA 2HQ3A 1QSLA 5HY6A 5KT2A 4DR3J 4DR4Q 4FF1A 3EA6A 5GADU 4BA1I 2K50A 2BANB 3KJQB 4I4BA 5C6AA 2AGPA 4BS2A 3D5MA 2LXUA 4DV2F 4DR6Q 1REVB 1R89A 3KUGA 3ZNUA 1JJCB 2WVDA 1SJ3P 2F0KA 3PJ9A 1PTOC 3G6JB 1VQFA 4I2QB 4C3MA 2F0OA 3LP2B 1PA6A 1JK9B 1O0PA 3L7ZC 4LUZA 5JJZA 4C0HA 1L3KA 2VW9A 3M2VB 1XJVA 4IR1A 1Q8KA 2F4VF 2GIFA 5T41A 3TAPA 2YNFA 3ERSX 1VQ8S 4U7UD 4JV5Q 3MEEB 4YCUA 2JH3A 2QF7A 5F0UA 3KLRA 5EWEA 4DR1Q 5J2MB 3FVQA 2VBXA 2GV1A 2GHWA 2V67A 4G7OC 2Z0GA 4WK3A 2DRDA 4EX5A 4DUYF 3MOJB 2ZZTA 1LACA 4HL9A 2KXHA 5CCLA 3PEJA 4FN5A 4H0LC 3NMAA 2HAFA 3RN2A 2HLTA 4C8ZA 2UVRA 4X62F 4NYZA 5FLMH 3T1AA 1BQMB 2VC0A 2B2WA 2K05A 3HOUB 2QLBB 2V2QA 2E8GA 1IJFB 1YHAA 1CULB 3KMQA 1PJ7A 4J9LA 2PNRC 2EE1A 4AQYL 4KGZB 1LEOA 3QJJA 4NXMJ 3V05A 3WDNA 3G7LA 1H98A 2K7KA 3EGZA 4ZVTB 4IR9A 3NG8A 2XMVA 1M5KC 1STHA 2PI4A 1HBNB 5E3AA 1SL2A 3L0OA 3DWAA 3M4QA 1LWEB 3TA1A 4CO5A 2YNGB 2E7XA 5J1PA 2XMKA 1AZQA 1PJ5A 2JNJA 3MUTP 3N6MA 1DJ0A 4KPCA 1KDNA 4ZVSB 3T6BA 1U25A 3FEXB 3E0JA 3MECA 2DXEA 3WC2A 1Q4RA 1AB8A 3D0FA 3S15B 2V5HG 4ELVA 1SE8A 5ITHA 1FRXA 3G6XA 3Q23A 5KG3A 1P8LA 4F02A 1HWIA 3RMHA 1BO0A 1JLEA 1UJ6A 3DLLA 4DR1L 2I5JA 1TAQA 3CB4A 5GMEA 2JHEA 1ZTTA 3S1RB 1OXUA 3NKYA 2HQCA 1I50B 1HFGA 2HQEA 4HT7A 1MMDA 3CIZA 3U1NA 1OXVA 4CKCA 2RUSA 5D4LA 1VCIA 2C28A 4ED5A 3NRBA 4IKAA 1VISA 3T5KA 1EY4A 2ZOMA 2VHGA 3PO3G 2UXDQ 1WG1A 3HJFA 2CQ1A 1XMQQ 4I69A 3IRBA 3MMBB 4IRCA 4RNHA 4HIKA 3GTYX 4DV6F 4IUVA 4YY3F 3CJKA 2XHWA 1RYRA 2BRKA 3JSBA 2IJRA 1PXUA 3CJ3A 1NXIA 1IXRA 3RBZA 1XYIA 1IBLL 3LAMA 1HD0A 1QCBD 2WCXA 5CV4A 3JXOA 1OJ4A 3M6XA 5J2PA 4DXLA 1BQQT 4LFAF 3Q8SB 2EJMA 1ZYRD 1ZS6A 2ICEC 4ZKBB 2XY5A 2PGCA 1UTAA 2M7SA 5ETQA 5IFMA 2YWKA 3HX9A 2Q43A 5KNCA 3TRZA 1FA0A 4APVA 3WQPA 4CP5A 4FPRA 3IBFB 4XIGS 4C0BA 3D3BJ 1HQUA 3WIUA 3BQ2A 2R8IA 2PMZB 2ZFHA 2FHJD 3N28A 2DR8A 3CDEA 1NAQA 3SSSA 5A35A 1Q79A 4XDXA 1QDUB 1T9UA 1RAIB 1WACA 1VQMA 2D74B 3BSNA 1AFPA 1I94Q 4OMFG 1VQ7S 3GR0A 1SUQA 3HOYB 3MCOA 2XYGB 1GJXA 1S48A 1ITPA 4C7QA 2Y0BB 1TUWA 1FEEA 4QYRA 1PRTD 1BVSA 4L5QA 1LFWA 2HIVA 2HQIA 2CQAA 3CNQP 2HS3A 2MQPA 2GA4B 2JVOA 4UP9A 2AWZA 5C42A 2RJZA 1Y1VG 1RTJA 1LT5D 3CKIB 2CXEA 2HCIA 2LXKA 4F67A 4C4WA 4Y34A 4ELUA 2C9OA 1U9RA 2JWNA 3EGWB 3THPA 4GNXB 3CJRA 2POKA 3V2UC 1LW0B 3LGNA 2ASYA 1LQ9A 1SMYC 3VA5A 5D8HB 4IOAA 3C19A 2VQFF 2YWWA 4J9SA 4K4UA 4WWSA 4J1MA 3T41A 4YDDB 1O7ZA 3SK4A 2KZZA 2HDLA 1V5VA 3FPUB 5LOQA 4UHVA 3OSNA 4A3GB 1KLMB 3EJMA 4ANCA 1RHKB 4G57A 2UV8G 1RYSA 4DV2J 3S24A 2P9EA 5DQGA 3L4BC 1BBUA 1SROA 2HGMA 3Q2SC 5DETA 4OYWA 3O8WA 1PH9A 3BKFA 3EM1A 3M8QA 1CVJA 5EAYA 5D15A 3CE8A 4KN4C 2JA8H 5IYCH 4Q0BA 1GKHA 4NPSA 3QFHA 2E2HB 2QSFA 2VV5A 1HI0P 1IQZA 1RODA 2DEIA 3I4MH 5FK9C 3UN5A 4C3LA 1QVCA 5CYMA 2R93G 1RA7A 4PMWA 3T9ZA 4XXEA 3PACA 3TOQA 1RT2B 3E5SA 4G1QB 3D1OA 3E2EA 3OUYB 3CU7A 4NLPA 2XMUA 1JJGA 1NBWA 1XMQJ 3FUYA 3OHXC 1SFOH 3EVOA 4ZVEA 1GHKA 4J5OA 1HQEA 2XZTB 4Q45A 1BNZA 2V4JB 1TV6B 4DX6A 4JI0F 1S5FD 4ZITA 2DY1A 3CCUS 3RUZA 1YJ9S 2X7IA 4ETZA 3U50C 2JC1A 4HYKA 4DGZA 4OONA 5JPNC 1K3BC 3JTNA 3MEEA 4K4WA 3NELA 4PWUA 2DNKA 4DPXA 4O1NA 4FNHA 3OXFA 3MR3A 2X6LA 1OSDA 1YNXA 3I2ZA 2NTTA 2PFFB 2Z56B 2PI5A 1CPZA 2K33A 2UXBQ 4E98A 2DGWA 4LF5J 3FP9A 4IUPA 4FF2A 5KFJA 3K59A 4RZRA 1T3OA 4QIWE 2R7ZH 4CLPA 5IS2A 3SV4A 1B8AA 4O3PA 3QBCA 1WI8A 2NVTH 1GOZA 1FX4A 1RKNA 5IM0A 1KTQA 2JA6G 3OHAA 1QNKA 3UDFA 2G9HD 2EQSA 3OXLA 1RAEB 4XT3B 4QGUA 1VQYA 2ACYA 4OELB 1STYA 1CJKB 2LQJA 4N56A 3KBGA 3IFEA 2MZJA 4DV7F 1VRUA 3PIO3 1V9OA 1IKMA 3T16A 1YBYA 4XT1B 2A6ED 2YTVA 2YNGA 3RRKA 5IC6B 1Z4UA 2DNQA 4PYAA 2VL6A 2ZDPA 2HQLA 4RHRA 2VG5B 2AJ0A 4KT0C 1KQGB 3H90A 5IGFA 3M2UB 1MIUA 2KENA 4ID6A 3ADAC 4EEYA 3PKMA 2M8HA 3MCSA 1VQPS 3V6DB 3CCSA 4O3SA 3LWLA 3V6JA 5HO4A 5J2QB 2BA9A 3UNYA 5LSOA 4BC9A 3CJ0A 2JA9A 1SC3B 1VBXA 4BBRH 3HOZB 3DHQA 2R42A 3CCJA 1RTIB 4ES1A 3KHRA 4DNRB 4PXEA 3BN4A 4JI4F 2I9SA 4L74A 5KOXA 2FJWA 1CJVA 5IQ6A 2FFKB 3T1HF 4O23A 4LBPA 2ZNZA 4WTOB 2J4XA 1VJWA 4L5RC 9ATCB 1KC8T 1B3QA 4ID5A 2FLLA 2FJVA 5CH7B 1S6UA 3SCKE 3QT7A 4IFVB 3BGFA 1WNEA 1SKWA 2GQCA 1RHQB 4NXNJ 2D9UA 3PM9A 3U4VA 2R7ZG 4FKYA 4CLSA 5LT5A 3SDEA 3W2WA 1ZZNA 4DF7A 1G4CA 3CIMA 3CO0P 5L37A 3G4SS 1ILQA 4B08A 3A13A 3HOUH 5C0XG 1Y1WH 2I6WA 4DV0L 5D3GA 3OL8A 1VQ9A 3GJTB 4A3CG 2HHHJ 4CDEC 3K8WA 3M8SA 1G1XA 2LQ8A 1WTRA 2AEMA 4YB7A 1VRTA 1VQMS 3QIAA 3CF5A 1SN8A 4GVLA 3L3CA 2B29A 4J9RA 1SJFA 3ITHB 4R8IA 1PBUA 1VR6A 1KEKA 2K03A 2N4CA 5L9XA 3QMQA 4QWBA 4R0JA 4ZLLA 4A3EH 1U4RA 5E3RA 5CABA 4GVBA 2XULA 3HHNB 2JFKA 4M1UB 3NL0A 4HTHA 1M90C 4K0KJ 3GIMA 1B0PA 2K5HA 1DZ5A 1AW7A 1RBLA 2WAQG 2QA4S 4WYWA 1G2SA 4FKXA 1NDLA 1SJRA 2GW8A 3I5CA 1NMEB 1KOOA 1JR0D 1AYEA 2Z9HA 4WFN3 1PO6A 1WSVA 4YHHL 1KWMA 4DA2A 1QE1B 7FDRA 2ZT9C 4JW0A 4LF8L 3H5XA 4DR2F 5JVH3 2VKRA 3DEOA 4K6LA 3R3OA 5C4XH 3SCLE 5F8GA 4ZPAA 2J5AA 1A62A 2KVQE 5KFHA 3AFQA 1UKUA 2MQLA 1FDBA 1GUWA 2R8HA 4B3SJ 1VGYA 1N34L 1QVFA 3TARA 1ULRA 5DM63 2G2YA 4YR2A 3MDFA 3KKFA 3WWVA 1RT1A 1U1KA 1VQOA 1GXUA 2KRBA 4QOTA 1UE1A 3OPOA 1EB0A 1SUQB 3PUWA 1X9MA 4LF1A 3P20A 3CCQS 3TDQA 2W4DA 3LUYA 3E9IA 3W2DA 5LMUL 4OGQC 2G4BA 2VD3A 4USJC 5EKLA 5KFOA 3CDWA 2DR5A 2ZH6A 1HFNA 4MIAA 4L3KA 1J5EQ 3ZZ0A 2HHHF 5IP9H 1TL7B 4AYBD 4U9RA 3PO2H 3TS2A 1HTLD 4DF4A 2Y8YA 3UI2A 4PQAA 3Q8YA 1S5ED 3PW7A 4Q0BB 1P6TA 4RMFA 3AXMA 1I4XA 5IYBG 2A1BA 4YP3A 3BN7A 4IH5A 3DRSB 2R8JA 4C3IG 1CQVA 1ROFA 1QUVA 4LR9A 1W6KA 1STBA 2MP1A 3OUYA 2DY7A 5IYDG 1RZMA 5KTQA 3S1QB 2VG6A 1XMQF 2ROGA 2X3GA 2Z6KC 4JI2Q 4O2DA 3OSOA 2ZM6F 1JQGA 4YHHQ 3PW0A 4QQBA 2N3OA 1PH3A 4HCSA 2BKNA 1E2ZA 3ZXWA 1A3UA 1PH8A 1RA6A 1TELA 1RCXB 3BB5A 1B4OA 2F7VA 5KIXA 1IKXB 1F3FA 1PRTC 1N88A 1Q86C 1KKHA 1CA5A 2B2UA 4EQ5A 1PDQA 2CZVC 2IRXA 4A3FG 5CGKA 1KVKA 2J8SA 1NR2A 1QE6A 5SUHA 2ZBRA 3T1HQ 2H1YA 6AT1B 5DG8A 2EFNA 2NLWA 2ZKTA 3W3SA 4DR7F 3OTOJ 2D0OA 4LUVA 4MK9A 2JA8B 2V4JA 4YOEA 1IJEB 4MIBA 2VIHA 3BG3A 3NP5A 4ER8A 5KFDA 4I2PA 1TWFH 1FNVA 4F25A 3L9AX 3KOJA 1U4PA 1EU3A 2RRNA 3OTEA 2ZJRA 3QAEA 3PZPA 2L0CA 3VYTA 4C3IB 4IJHA 2YWHA 2D3UA 4ZAIA 2FLNA 4J37A 2D69A 2HQDA 1N56A 4KKUA 3I56A 4I0WA 1PYWD 3I31A 1FK9A 3CCSS 2C2ZB 4J8QA 2BYCA 4ZLJA 1KLUD 2KCMA 2V8VA 3S17H 4ZVQB 5DM7Q 3JAMc 3TREA 3MR2A 1JC7A 4A8OA 2QRRA 2EFQA 2OTLA 3Q8QB 3I5BA 1N34F 5DGAA 2RD5C 5D14A 3FZ2A 2KRRA 4C8NA 2XLJA 1FWPA 4NRUA 4ED0A 4Z7CA 2WHOA 1IN0A 2HFZA 2NXJA 1XX8A 2WV6D 3I82A 3QLHA 2GC8A 4LQ9A 4J9QA 1S3OA 5CHCB 5EHHA 3VAGA 1N5TA 4YY3Q 3MR6A 2UUCQ 4PPDA 4NLWA 2DJFC 4B3MJ 3C3LA 3RZOH 2HAIA 1CJVB 5LMUJ 2HUGA 1VRQC 2KT3A 2CQBA 1SR3A 4J9OA 1R0AB 3A74A 4KHVA 4UDUC 1GUNA 1NSNS 3BKTA 3M2RB 1FJEB 1HBUB 4ED4A 1KNAA 4FP5D 1ZM2A 4A8MP 2DCLA 1GH8A 2OD4A 2OEJA 3EVWA 3M32A 3TUZC 5D4NA 4HI2A 2B9EA 2ENBA 1FD7D 5AE1A 4JI6L 1LTGD 1CM9A 1N5SA 2NVXH 1OO9B 3HOXH 1H9JA 3PCOB 3STBD 2HPUA 2E29A 3IS9A 4N9PA 1E6YB 2DISA 3M30A 1PKUA 2Q79A 3OXGA 3MWYW 1LW2A 4A8FA 1XMOL 3FKIH 1ZAXA 4HSPA 2BBEA 3R6LB 1WC0A 4YHHJ 1YI2S 2B63B 4L6V3 1I94J 1PHJA 2Z6BA 3G6YA 3E8OA 1Q12A 4USIA 1NM2A 3I9ZA 1SIWB 2HHXA 5DM73 2XNQA 4RWWA 4M5DA 1FDNA 1NB2A 1UAWA 3GB0A 2VUMH 3MEDA 2ATWA 1BBWA 5BYQA 1NH8A 2XHCA 5LHY1 1RTJB 3EIVA 4K5XA 3UDXA 4KKSA 3S1NB 3AQQA 2ZD1B 4A76A 1F9RA 4QYZK 3LO3A 4JI8Q 2DUDA 2D5DA 1RAOA 3ULHA 1LW0A 2DH9A 2WW8A 4C0OC 3GSDA 4KH1B 3B82A 1WCMB 3HS0C 4LUBA 4U67Q 3CXCR 5GAHC 1QILA 2AJ4A 3HVAA 4QB4A 1X4CA 3RB0A 3CD0A 3GTOH 1L1OC 2B63H 1KLMA 2DGYA 4XTTA 4F4ZA 1F9QA 3IFDA 2ZTEA 1TL1B 3MPVA 3SMZA 1PAEX 1UL3A 2F0WA 3BS1A 2JA6H 2E2IB 4A3JB 3M8QB 3S2HH 2VF3A 5I3UA 2Q8TA 2MLZA 2BUNA 3KJVB 2WB4A 1KOHA 3QGHA 4JI4Q 1DURA 1TL3B 2FIUA 1KHIA 4JI7Q 2UXBF 2BQRA 2VOPA 3DRRB 4X65Q 1EYCA 1JJHA 2NSBA 2RIJA 2V9WA 3AQOA 1R27B 1QSSA 4GRSA 3MPDA 5KYLA 2WSCC 2KYZA 1C48A 1WVLA 1YJVA 4RWXA 4KKOA 1E24A 2QSWA 5A6WA 2QC3A 1I5OB 3RZOB 4PWDA 1RTDB 4LF7J 2N49A 2CPJA 2RDFA 4W98A 5E41A 1KLGD 4ECQA 2E5LJ 3W60A 4JB8B 1R9TH 4XPCA 2Z57B 4RWSC 2K2PA 1TT2A 1LWFA 3ISND 4JPBW 1FFGB 1U1OA 1X56A 2PZTA 1VRUB 2YTYA 1GHJA 3E9HA 2NTSA 2CRLA 4CLTA 1DTQA 4DR2L 2VFSA 3AA9A 1SYEA 2B51A 1NK8A 4Y6IA 3GQBA 3L95X 1H2VZ 2M88A 4WP9A 1CJTB 4S0MA 5DGBA 1W2BR 2FVPA 2YKMA 5AXLA 4C98A 2XSJA 1RBOB 1YWXA 4Q0FA 3CC2S 4UW2A 3S16B 3QG1A 1T3NA 1H7XA 5KT7A 2F0PA 1JWSD 5E0OA 2VPYB 1RWUA 2UXDF 2MZRA 1X5PA 1EIHA 5J1NA 1NJIT 3NSWA 4WE1B 1CJKA 4USTA 1EZZB 4X4PA 4A48A 3R5AA 2W7PA 5CORA 4J9KA 4N7TA 4XQQA 1CUKA 3F41A 1EEFD 1RBAA 4AQYQ 2V6AA 2FPHX 2VG7A 3B8HA 5JJLA 4JYAJ 2VG5A 4B3RQ 2MTLA 4PEOA 2J9EA 4X4UA 4FYWB 2Z2YB 3FKIG 5FD1A 4M8AA 4DUYL 1HHTP 1ZEQX 5DDRC 3PIP3 2EK6A 5FIIA 3ETOA 1VF7A 2OTLS 2AD9A 2IHEA 1EJ7L 3V4IB 1HRJA 1STNA 1F3VA 2Y9HA 4OI6A 3NTIA 3TUPA 1LT4D 1R0BG 1HQUB 3MM6B 2M3DA 2V50A 3DDIA 2PA8D 5G0RA 1CKMA 2Z8QA 1LXNA 1WF2A 1W6JA 2K3IA 5D3GB 2YPYA 2EXDA 1XJWB 1S99A 3VYSA 1R3NA 2E1RA 3CQZH 2V4RA 5KFPA 3NXZA 4PUOA 3H5UA 3EE3A 5K8MA 2ZH3A 4X3KA 4GKKF 1UZDA 2FJXA 1HZCA 1N33Q 4MTNA 1TK5A 2ZUAA 2QX0A 4LFBJ 5FJ8G 1NZAA 3KLWA 5JJKA 2Y3YA 3HFVA 2HNYA 3GTLH 3SR1A 1TS4A 1FKOA 3K8VA 2RF2A 4LIRA 2OLWA 4TLRA 2WOMB 2OFHX 2GVZA 2B9WA 4KH0B 4GNXA 2H4WB 2HHHQ 1RHJB 2DT9A 3JQMA 1TS2A 1SKRA 3GV5B 1ZTWA 3B6YA 3E01A 3IG1B 3NGRA 2NCKL 2A0FB 3KF8A 2H5EA 3DGPB 4GN3B 4L73A 3HHLD 1ENAA 2RKIB 3BDCA 5KFSA 1WHVA 5IZHA 5KEEA 4F8MA 1T9YA 2BJEA 1A6XA 2IJFA 2IYGA 3F56A 3EXCX 4KV6A 2FY1A 3M1VA 2MZ1A 3R97A 4E0DA 2BKOA 3QO2A 4GLXA 3TUIC 2OPQA 1KNZA 4RBTA 4OHYA 1J27A 4MAKA 3R2IA 3D4JA 1YSJA 5C5LA 3NGUA 1ICEB 4EYIB 3D66A 1LT3D 4M5DB 1FRJA 1T9XA 3QIPB 4LBIA 3BYTB 4QW9A 4DV0Q 2B5JB 1S0NA 5KFRA 3CAMA 3PO3H 4KGVB 4ZVPB 3R7BB 1KABA 2DRBA 1PAUB 4DL2A 3GFXA 1LTBD 5LMNF 2D9PA 4ODGA 5ADZA 3VAHA 4DV4F 1Y69U 1WD6A 4Y3CA 1GM5A 1FVIA 2QL7B 4JI4L 2CJXB 3S16H 1X5OA 2FVCA 4MN3A 1JJ4A 1XC9A 2OPPA 2QMWA 4LR8A 3GONA 3M05A 3KUHA 2H48B 2HNDA 3KK3B 2BJ7A 3Q8RB 1R8HA 4ZCMA 4DV5L 4HIOA 2J76E 2KZMA 3W9HA 1IKYB 2PQEA 4DSFA 4V0BA 2CKWA 3CCZA 2RSQA 5ELEA 2P5VA 1XEZA 4JUZA 3J80Y 2VBWA 5A8WA 5F8JA 3O3LA 1SYBA 3Q89A 1HNVB 1RT4A 1P27B 2N55A 2YKOA 1F5BA 1RLDA 1KVJA 2FJ2A 3UD5A 4JV1A 1HNWJ 4YS2A 1VQ8A 2VPXB 1F9PA 3CMAS 3I4HX 4ZPBA 4GN5A 2DBBA 3A8IA 4MKVA 3QO9B 2EW9A 4G1IA 5CD4H 3AD9C 4I7AA 2KECA 2A19A 2HHVA 3HOWG 3GV6A 5C3EG 3UVJA 3TP7A 1S4ZA 1B44D 1PRTB 3LOUA 1U0HB 1RKIA 4DU7A 4M5NA 4BBRG 1N0VC 2VBZA 1Q82C 5M3FH 4B3TL 1P1LA 3K2YA 1UEUA 1X32A 4AE5A 3HD1A 2DH8A 2B63G 1FX2A 5A8KA 3BYYB 3DOMB 2JA7G 3MC0B 4V1Ak 2QN6B 1GUOA 3MZIA 4YR3A 2W9CA 3ZZOA 4KFBA 2GN5A 4JI3Q 1IYVA 1XNRJ 2QE5A 4A47A 4WYLA 3ILOA 1D7QA 3G8QA 4DCOB 2J0XA 4JI5Q 4OYBA 1WG5A 4A3IB 3Q8DA 3EFXD 5FO7B 2FTRA 1WC3A 5JJIA 5IIFA 3CDBA 4HMIA 3C8YA 3AOBA 3OQ2A 1HQRD 2DHHA 3ENQA 2JOQA 4EGVA 3STBC 2W9BA 4JC0A 1WTPA 2QMUB 4JYAF 5TSSA 1V1PB 1S1WB 3AFPA 1FD8A 3J7YI 2YKPA 4DV3J 2UXBL 1D09B 5IT9Y 1V1QA 1LWCB 1P8GA 2CPFA 4ILMA 4OEMB 4LSNA 2KA7A 1U45A 1YBTA 2XO7A 2EYMA 1U0HA 4R8NA 1AZSB 2ZITA 3PRDA 1R6VA 4AYBB 5I42B 2VUGA 2DHGA 2F9JA 4HHJA 3NP8A 1D9AA 2PIIA 2IVFB 2VFVA 5IYBH 4DV1J 5CV5A 4DXFA 3MR7A 4M5KA 3SSRA 1TMJA 1U1LA 1CS4A 1HNZJ 4I7ZC 4F88A 2FHTA 5HLFA 4XQNA 2NVYB 4M5HA 3TYTA 1SJHD 3UDIA 3PTWA 2MHVA 1AP0A 3ZTSA 2F4VL 2HHUA 3EZUA 4GKJF 4R4OA 4AD6A 3M30B 4B3MQ 2F0VA 4R8UB 4NZ0A 2VG7B 5B0CA 3SFUA 4LT6A 4JI0Q 1H2TZ 1R0AA 1Y14B 4DR7J 1H73A 1RAFB 2N7YA 1YNNC 4RCNA 2MQNA 4K7QA 4GKJL 2DH7A 3FMWA 2NR0A 4Y0FA 4UOHA 1S9EA 4KKTA 2GAGC 2C3MA 4B17A 4DLEA 1JB0C 4HJ7A 2XSFA 3P6YC 3CPWR 1RWNB 4TNOA 2WP8J 4O44A 1H3DA 4LSNB 4F0HA 4NCBA 2DNYA 3HHLC 1GT8A 1SQEA 3HULA 3TSSA 1VC0A 4L5SA 3AODA 2RDDA 4I68A 1XMOJ 1S12A 4Y2CA 1DYQA 3NNCA 1VOMA 3QOLA 3SEBA 3OTDA 5M3MB 3VAJA 2M52A 1NPKA 1AA1B 4BBSG 1SYFA 4Z2XA 1RDRA 2AYBA 1EOTA 1VS0A 1BBXC 1KIXA 2ZJPA 2XY6A 3G6EA 5M5XH 4BY1H 1IKLA 3MXHP 2RKIA 3H6MA 2VDIA 1N34J 4WFBQ 2VB6A 5T1GA 2YWGA 5HJXA 2BQ3A 3W64A 1JWMD 3HP6A 1SEBD 3JSMB 2RQMA 3HVWA 4WCEQ 2XO6A 2DNEA 1L3VA 2WOMA 4DR4J 1VK3A 5DNFA 3GR1A 4CO2A 5E3QA 4ICLB 4GZYC 1NDCA 4QZVB 4AL5A 2IC3B 5I3UB 4CLZA 3CC4S 2GVDA 1MNEA 4QU6A 4ZVFA 1WOSA 4DR6J 1KD1C 2Z6KA 3QWUA 4ECWA 4DR4L 3CCRA 3R5CA 4P2SA 2O5IC 2EYPA 4CRJA 4OIKA 2I1RA 1NZ8A 3BQ0A 4K2XA 2E66A 2AT1B 2GGPB 4RW4B 4IDKB 2TSSA 1CQNA 4ZKAA 1SNDA 5AT1B 4Q2LA 4O4GB 2DHXA 3G9CA 1CJUA 4OJHA 5HMXA 1S6QB 2ZWPA 4OX9L 3OYYA 3I96A 3O5TB 1OXTA 1CZWA 4KAIA 1IW7C 1PTOD 4PG6A 1YJ9A 2A2CA 1QUQA 5IV4A 2V8PA 3PF5A 2W4PA 4LFCQ 3MUMP 3KJVA 3DU5A 1MJEA 1OO0B 2GIRA 4NXNQ 2Z2ZA 2BACA 1IBLJ 3J7AN 2BABA 1VQ4A 5ETLA 2BM1A 4DV1Q 3KJOA 5B7WA 4RNMA 4XTCS 4WU3A 3J81L 5EJWA 2EYHA 1QZGA 1HNWF 2IM1A 4JBKA 1IKYA 3CD7A 1H95A 4J6HA 2W2MP 4X64J 1HPZB 1NAPA 3OBIA 4KIAA 2E9RX 3Q0AA 4LQ3A 1E6VB 1RJJA 2IC3A 1M5PC 1OS5A 2IMWP 2CW0D 2K01A 1PH4A 2DGUA 5DRKA 2QA1A 1NB7A 1JMCA 1JKHB 2HFSA 1S1XA 3JTOA 1FRMA 3S9WA 1HR0L 4UQTA 3NHHA 2GFFA 5MAOA 4K2KA 2D41A 1RIPA 2K6AA 3NWSA 4JI1J 3CCLS 1CLFA 2XGTA 1PFMA 1H7WA 2IJNA 3POTA 4DR1J 2YX7A 4OJ3A 3CWJA 2ZH1A 5BR8J 4FYVB 3MA2B 1VQ5S 3CPWA 3MMAA 5G3LD 5U47A 3RLNA 3BDPA 4HJAA 2V34A 3ZJYC 3SE0A 4ZP9A 1TK0A 1NK5A 1QJHA 1UPPA 2QTWA 3PW5A 4DCPB 4XQJA 4DWIA 5CYJA 2XWBB 2EC0A 2XWJB 2RB7A 2GZOA 1K83H 2MQHA 2GX8A 3M4PA 4RA8A 3CCWA 2H5XA 2MQOA 3QATA 3RLOA 3WX4A 4EO8A 1I3QH 2WK4A 1EIYB 1N33F 4C8KA 1OSCA 2AUJD 3TAMB 3MECB 5MLCV 2F0UA 2XY7A 1RF2D 3HOZH 3TJAA 5A8KB 3NXWA 3ZO7A 1HXYD 5IWAF 2K5DA 4OI0A 2BE9B 4PV1C 3K5PA 1X9WA 1VQLS 2CKZB 4JI0L 3H42A 1IW7D 3PO2G 2B8FA 4OX9F 1DCZA 1MI2A 2XTIA 1B50A 1F9SA 3POTB 5C44G 4C3KA 3TQ1A 4I65A 1TQOA 2KKHA 3M4XA 1DOMA 5I42A 3R8BA 1K9MC 2EOTA 4Y2AA 3ZNJ1 3TI0A 1VF5C 2ILZA 2WBRA 4ZP6A 2J7UA 3VR5A 4MYUA 4I7FA 4JOIC 2DK2A 1G6PA 4QR1A 3SSQA 2G2ZA 4POFA 4UTGA 1C8CA 1FVSA 2I5MX 1I6HB 3PIPA 5CR3A 4X3TA 2BW2A 3H0GH 4Z7YA 2J0WA 3HFZB 4DR1F 3R1HA 3SBMA 2XS7A 3P4UB 3HZGA 3ERQA 3HOWB 4DSLA 4H4KA 3CO9A 5KT5A 2EDGA 1VBZA 1WC1A 3PF4A 5M2UA 2JEBI 3QRPA 3VGSA 5ELNA 1RKJA 4KHPQ 4YCVA 1E1TA 4NDXA 4IFVA 3FDSA 3T13A 1ZM4A 4NP5A 3VV2B 1Q81C 4J90A 2XWXA 1WF1A 4NASA 1BKBA 5HQMA 3CCMS 3G6ES 1S49A 4BBRB 5A0YA 2WKDA 2YQ1A 1O80A 4IH6A 3MM5B 2OMLA 1BXNA 3DM3A 1ZM9A 4DR5F 2I8EA 1EFWA 1KAAA 1UZHA 3JB9k 1WC5A 9RUBA 1JNRB 2OJ3A 1K0RA 3THTA 1VC6A 1T9TA 2IFXA 1C2PA 4MH8A 3X3MA 1Y11A 1JLQA 1RISA 3K7UC 1MJCA 1Y10A 4O44B 4K0KL 2DN8A 2RQ4A 3NAIA 4DV0J 4ZCLA 1SL1A 1Q95G 1GX6A 4ZVGA 1ESFA 1R4PB 1HMVB 1SI9A 1ZXTA 2IAJB 4DQQA 1CT1D 3DRYA 1N6QA 5BXIA 1HZBA 1VQOS 1LNQA 2D2CC 3CRLC 1JICA 2PDAA 2JX2A 3KLEB 2CQ0A 5DO2A 1VQJA 1UW9A 1E22A 4A3MH 5EBCA 5G3LF 2GGPA 3I32A 4RW4A 1A3VA 3BS9A 3W63A 1GTHA 5EGTA 4A75A 2K3KA 4LF4J 3DLEB 1EY9A 2M70A 1ZYQA 3W66A 1SBRA 3BEGB 4DUZL 1RD9D 3LH2S 2PEHA 1CJTA 4CKEA 1NCLA 3J80i 4ICLA 4J9UE 4KTAA 1N36L 3PX0A 1JLGB 1AN8A 5F8MA 2VICA 2L9DA 4ZPCA 5GAGU 1X3QA 3J7ZT 1STEA 3PUZA 1L0YB 2GMLA 3US5A 4X64L 1F9HA 4EK2A 2O66A 3G87A 4Q5VA 3A5UA 4CKBA 4YR0A 3PRVA 2UXBJ 4LF5Q 3UE2A 2XTJP 3GV7B 2K7VA 1QJOA 4CLKA 2F5GA 2VDHA 4RGOS 1WTWA 2WAQD 2RCFA 4EWTA 5KFYA 2HLUA 2CJAA 2PD1A 1BDOA 5ELDA 2UUBJ 2HCCA 4E8UA 1GXTA 4JYAL 1MG7A 3BVMA 1QVGA 3PUYA 1J2VA 4X4OA 3UWTA 1U8WA 5E33A 3H4DA 2MHEA 2XS2A 2G1DA 2L11A 4KLKA 5HVHA 4WTYA 1FVQA 1FJGF 1DFDA 2YNHA 4C56C 4BWGB 2YPZA 4DX5A 2B2YA 1REGX 5CV7A 2O5JC 1A6LA 1RB0A 4FYYB 5K14B 2A6MA 5E4WC 1IYUA 1GAOA 4XDCA 2AX1A 4FPIA 1PZID 3H5SA 1U26A 1A2TA 1HA5A 2F0IA 5C4JH 2ACMA 5F3TA 1XNQQ 2DNRA 2BZ2A 2AGOA 2F8HA 3KK2A 2J0TD 4JP8A 2B2YC 3ZZZA 4R9WA 4DK1A 5CYUA 4RHSA 3VAFA 4H54A 1JLGA 4F7VA 1DJRD 1WEXA 2CPXA 3QT5A 2KBNA 2Y0SE 1VCTA 3MXNB 4K5WA 3H98A 2HDMA 3V5RA 3MEGA 3UI3A 2HYIB 3DDKA 4KHPL 2AU0A 2L15A 2DGSA 4CO3A 3J80L 4P2CB 4U7UK 3SCIE 2FB0A 1QAIA 3K81C 2XN9C 5LL6d 1HNIB 3D28A 2NWGA 2IDLA 3DLGA 4R5PB 1Q1KA 2PT0A 1RAAB 2BKPA 3TVZA 1QVGR 3DMJA 4NMZA 4NEYA 3C1EA 4Q43A 4B3TQ 3RLFA 2D0PA 4J7CA 3I4LA 5BYSA 5GMDA 4DFPA 2WAQB 2EJGC 2AZ1A 4FYXB 1G51A 3U58A 1ZA2B 1WI6A 4DG1A 4FP9A 4ALZA 1R31A 2C5CA 1YKWA 4PQXA 4ATNA 1TXYA 1N36J 4C3HB 3BBFA 1JE4A 1UFLA 3CT9A 5K36G 2OF1A 2OQKA 1KC8C 4OV6A 2R92H 4Y2MA 2IT1A 2CWXA 4IUFA 3OVSA 5SZTA 3LX0A 3R9LA 4FO2A 3RTVA 4HHUA 4HEA9 4ZKCB 1LK5A 1FTRA 1DTTA 1NR4A 1FK9B 5CV9A 2MMYA 1RTNA 1VQLA 1TUGB 3PEHA 2LDYA 2DHAA 2IDEA 4K14A 2V8DA 1I4QA 1PSDA 2C3YA 1VQ6S 4DUZF 1MLAA 5D78A 2AQ2B 2E5LQ 1FR3A 3JYTA 1S10A 4DLGA 4RW7B 1X4GA 2J7ZA 1S9EB 1GX5A 2IHR1 4RBUA 2O3DA 4F3OA 4BY7H 2NZHA 2XC9A 2ZEJA 5F9NA 2DPJA 1SNOA 3I91A 2HURA 3H59A 4USVA 1PZKD 4GO7X 2YTCA 2HRTA 3TQYA 4JI6Q 2QKIC 3QJYA 5HROB 1SDFA 4KJOA 1UA1A 1I4PA 2MJ8A 3G8TA 1FJGJ 2YXLA 3GP9A 3KBXA 2BOPA 4X66Q 1LM0A 4QWDA 2MGZB 3KK1A 3KWMA 3N9UC 4JV5F 1TKTA 1BMQB 3DC2A 4C3JH 1PH2A 2DYAA 4ECVA 4NEZA 5CA5A 3HOYG 3ZZRA 1QVFR 1KVIA 3ZYYX 4KBIA 4OHWA 5A76A 2QYGA 1KQSR 2FLOA 1G291 2QLFB 4F4KA 4DL0C 2YH0A 2E2DC 4KC5A 2MSSA 4QCLA 3HDSA 5DJBA 2YKNB 1I4HA 1SLJA 2H4OA 2AEFA 5A8WB 1EYDA 2RU3A 4PCQA 2RBMA 4G4KA 1HNVA 2XZWA 2UXCF 3RB6A 2KG0A 2XMWA 3H25A 3PR4A 5LMNQ 4WU2A 1K8GA 4FXVA 2HWHA 2ZBIA 3PFEA 1IR0A 2UUAQ 3GE9A 3A7AB 4NLDA 3LP0B 2UUAF 3KHGA 1ZH5A 2NVQB 3UCZP 5D65A 1FD2A 4LVOP 1T05A 3RGIA 4NXNF 3M3YB 3OIPA 4QUFA 4OYAA 1HMVA 1TV6A 3HKWA 4ECTA 4A3GG 4PNYA 1M1GA 3OR1A 2E2HH 1T5EA 4NLGA 7AT1B 4ED7A 1LTLA 1JXVA 4OIXA 2OPRB 5GAEU 1TY2A 3BVGA 4YIJA 3GTKB 2N78A 2JJQA 2W9CB 4B9VA 2L41A 4DPWA 1STGA 5HMYA 2F0MA 2YQ0A 5LMUF 1X4BA 3LGJA 1IYJB 3F44A 3AMUA 3BQ1A 4FF4A 2GS8A 2K1BA 4WJ4A 1S59A 1VDHA 5M9OA 1H6KX 2HRYA 4ZS6A 4KO0B 1YVFA 4JI1F 3IFTA 4PG3A 2ROEA 2N7CA 2BE7D 2GO8A 5C0XJ 3OW7A 2A68C 4Y7NB 2WAQE 2V1CC 5HVGA 3I55S 3DCAA 2ADBA 2ATLA 1FRKA 1RP5A 4GLVB 4DR5L 2DITA 3O1LA 2H1EA 2NZ1D 5I6YA 1BY9A 2CQPA 4PZVA 1W7WA 1E0BA 1GMWA 4BHQA 2EG2A 4OYPA 4Q8FA 3GYXB 2CQGA 4IOCQ 3IXQA 3UDEA 2N3SA 5BR8Q 1XMBA 4JBMA 2D3OR 4EQPA 5HJYA 1TR5A 4D3HA 1LLRD 2W7AA 3M2UA 1SCJB 2NB0A 2ASLA 4B3SF 1VBKA 2ROPA 4YB1P 2EY5A 2LVWA 4EYHB 2FYXA 4DPYA 1XTDA 3KLIA 2IIHA 1BCPD 3TO8A 4HSVA 3TW0A 1S57A 2JA6B 1F2GA 1YTYA 1HUMA 3IR5B 4A3LG 1NSAA 1YJTA 1UEKA 2WB1D 4O0AA 1AFJA 4R4QA 4QR0A 1EZ6A 1QZHA 5CZXA 4RGMA 3R93A 2FC8A 4FS2A 2EVZA 4IYQA 4OX8A 1UE7A 2HD3A 3GIJA 1JLAB 3AJ2A 4TU7A 2UUWA 1LTRD 2G9DA 2W8LA 3I56S 3BJYA 4X64F 4TSSA 1IL8A 4LF9L 1SYGA 1KN6A 4DMZA 1X55A 4LJZC 4P10A 1H2UX 5F9LA 2A6OA 3HEJA 4O3RA 1EQTA 3NMRA 3NS7B 4CT8A 1HCZA 3FRYA 3NWRA 4I6WA 4G7HC 1HHQA 3FQLA 1HA1A 4B9UA 4KK7A 2HFVA 3CMEA 5IP9G 3G71A 3NAHA 2F4VQ 4JVZA 5JUMA 5DLGA 4K8RA 5I3PA 5FDLB 2SDFA 2BR0A 4DBQA 4DJBA 5ETMA 3KF6A 4KGKA 1Z6HA 1B0VA 2JA5B 2ZXRA 4NLTA 3A4TA 4RKUC 4ES2A 3Q86A 2J6TA 2A2DA 2YH1A 2JVRA 5EX0A 4K2LA 3BYPA 3VDYA 2MSTA 3C6TA 2KCNA 5JVHQ 4CJ0B 5GAHI 3LP1A 1U49A 2R7SA 3I73A 3J81c 4ZPVR 1PH7A 2GAHC 1ZETA 4F50A 1VQKS 4CDFC 2VQFJ 1NK6A 1NJIC 2PQAA 1GXDC 3AEVA 1KD1T 1C0AA 3W9IA 1LTSD 1ZAWA 2K06A 3Q6SA 3LPYA 3CDAA 3DLBA 4ILWA 3ITPA 3EMTA 3NCPA 4MNOA 1YNJD 2LFVA 4MIUA 1WORA 2UXDL 3EWGA 2CA9A 3ET6A 1OQ6A 4EQNA 4ZMMA 1CK1A 1Y8NB 1K1SA 5T14A 3AQPA 1D1IA 1XR5A 1R4QB 1NBEB 2W24A 1QAYA 2RF4A 3HVTB 4DPOA 5GAHU 4HJ9A 3W3AA 2RVLA 2F40A 1XMOF 2DO0A 1U4BA 5FLXE 5K9FA 1RT1B 2W01A 3KF6B 4HMJA 5C4XB 3H3VI 5IYDH 4F36A 5GADC 2DY9A 4GC6A 1DQAA 4FDBA 4B3SL 2BJ1A 2QMXA 1N5YB 1LK7A 2WSFC 1GO3E 3W5OA 1HHVA 1J5OA 1N48A 2AIRB 2E5HA 1K83B 5C24A 3RN5A 3QGIA 4I56A 5D0GA 5LM7E 2K5NA 1FRIA 1UE6A 2ILYA 2VOOA 3RB4A 4JK1C 3X1LB 1I3QB 1X5SA 2KEDA 1KQKA 2B4UA 1TKZB 5F41A 5K5PA 3CJSA 3NE5B 1YQHA 3NS5A 5H1SE 1HWUA 4DF8A 3ONAB 1VYAA 2E1PA 3F1ZA 3DRSA 1B1ZA 2B8GA 2NUCA 2L4NA 5KAKA 4JBJA 4ME5A 5LXRA 5C25A 2NSCA 2KCCA 1FWLA 3EX7B 1Q7LB 1BD6A 2EFGA 5L1LA 3HRZC 2K7JA 2VUMB 5C2GA 4DS4A 3M8ZA 3AB9A 2LS01 2QG9B 3ICLA 1U4LA 4Q7AA 3KNAA 4NKLA 2DNOA 4LF5F 4MIWA 3D4DA 2DB1A 1YRXA 3N5FA 1HYSB 2BE5D 2Y1LB 4DAYB 2DXDA 2F4VJ 3W5ZA 4JV5J 3IP0A 1CEZA 4IJLA 5E3PA 1OY6A 4BY7B 3MPUB 2CG4A 1MGSA 5KG6A 2HG4A 1YITS 3W8GA 3IAM9 1T5XD 3GFZA 1FDAA 1OWXA 1PYOB 4EU0A 4GMKA 5FLXY 3SDZA 5DZ7A 1SE2A 2ZE2B 1G91A 4JI7J 4I67A 1LYLA 2HBZB 3T1YL 2WRMA 3LPEA 4X2BA 5I2XA 2BDPA 1YNJC 2A68D 4H4OB 3HHDA 2IMOA 4PXCA 1U0LA 1VIOA 2MQ8A 1L5UA 2ZJRQ 3PYGA 4LF9J 1UNSA 2RHQB 1VK8A 8AT1B 3M9MB 2PNHA 4IFDH 2QILA 1AFIA 3RAMA 1RCOB 4RUHA 4N41A 1SKUB 3UW1A 4WJBA 4QBUA 4ED1A 5IGGA 3A54A 3GIIA 4QIVA 2KM8B 2PFDA 4DR5J 3GIRA 4POGA 4CYUB 1HWKA 1HJPA 2OP5A 3I3CA 3FVYA 3IM8A 2HK3A 3VAMA 1XPOA 3DMJB 4DXGA 2UU9Q 3RBEA 2EY1A 2MFIA 1PH6A 1UP1A 4E6IA 1K3RA 1VLOA 1HBOA 2EVBA 5HVFA 3HCXA 4DU8A 5KFZA 5CMDA 3EPGA 1RQ0A 5KFLA 3TP2A 2V94A 4IG0B 3KYHC 4CDDC 4CNZA 2FZKB 4C11A 4C3IH 3CJ5A 2F65A 4X4QA 5I6WA 5KFIA 2PW5A 5E3FA 4F7XA 3SCJE 2B4PA 5M5WB 2H51B 2XGQA 3VQSA 4ELTA 1W3SA 3S1MB 3H2VE 2RT3A 1JOQA 2DGXA 3KOAA 2CYYA 2KXNB 4RU2A 4B3TJ 1TL4A 1TUVA 4NRTA 1NK9A 2YWEA 4JI5F 4GKKQ 1N33J 3B4DA 4DQPA 4X4RA 4KI0A 1ASYA 1BC6A 3DOLB 2B0GA 5IM0B 1XMQL 4BC7A 3JYTB 4OHJA 3KJFB 2Q6BA 5E2QA 5HBMB 1S4EA 2HS0A 1CQFA 4B9SA 1XWLA 5FLXU 2GQQA 2QV6A 2VA3A 4F4YA 3V81B 3M8WA 3MM9B 1RE1B 2JEFA 5CQGA 3OOCA 3FC9A 4P75A 3PW4A 3WOEA 1GMWD 3CCJS 2YY3A 5HROA 1EETA 5CYQB 3TRGA 2GVBA 1N4LA 2VS1A 2OELA 2IM0A 3D0GE 2W2QP 4Y7NH 1GNKA 2JP1A 4HTJA 4A3DH 3G71S 1GQEA 5IOCA 1D3WA 5HP1B 5BN3A 3PJXA 2CNKB 2JA5G 1S72A 2P8IA 4NOHA 4ZN3A 4ZHRA 3W62A 3SV3A 2D3ZA 2O2LD 1WHYA 2D3O1 3DLHA 1VQBA 1U1MA 4RFBA 1I4GA 3AA8A 4B02A 1Q3LA 3GTMB 1MMNA 1JMTA 1U2FA 3EZOA 4NZ7A 3T1YJ 1Q81T 1IVZA 1NUEA 3TP8A 1X4EA 4JI6J 1WTVA 4BDPA 4DV5Q 1SNCA 1F2ZA 1S0MA 2K1RA 4RW8B 5G4DA 1IHZA 5AE2A 3RAQA 2Y0SG 1FJGL 1FTCA 1D8ZA 4DAPA 3FMCA 5K8PA 1S0VA 4B9MA 2DRAA 2OAUA 4BCAA 4F4XA 1SVDA 2AYEA 4DR5Q 2HK2A 4LMQD 3SFGA 1L0WA 5FLMG 3MEFA 2K28A 3NBHA 2FVRA 1JT8A 3NCRA 3KLHB 5HK4A 4YDXA 1XXGA 1NCVA 3N01A 3T53B 1CBKA 1S77D 2IX3A 2KJXA 4MZ9A 3GTJB 1WCMH 2ZXPA 3MMCB 1PBAA 1C0UA 2OO4A 1AE2A 4HAEA 2OWOA 4UOCA 4WBFA 3M7GA 3RZDB 4CLYA 3UD4P 4OI2A 2HHPA 2KHCA 1E3PA 1VQNA 2DNPA 3AB2B 4OI4A 2CPHA 1SC1B 4IH7A 5A2QY 3MHYA 1KONA 1NKEA 2VC1A 3I8ZA 5KFCA 2EWHA 3NQIA 2R7OA 3JAMY 1Z47A 4J9PA 3IWXA 1C4AA 4WXWA 2O1PA 1FCAA 3KJNB 5KFGA 5JVGQ 2P2CB 2MO1A 2YX4A 2QGQA 1Y5IB 3DXJC 2K5VA 2KU7A 3R2TA 1WC4A 4O0IA 1YDLA 4CBVA 4K8JA 3D3CJ 1HLWA 2B43A 3RJMB 5AE3A 3CHBD 4DKAC 4TU8A 3TMEA 5AXKA 3QGGA 2DNGA 1X4DA 4LF4F 2KT2A 1FE4A 4YY3J 1YG0A 4BY1G 3CCVS 1Q7YC 4HLBA 1LOUA 4YFUA 3DI6A 1U1PA 1FRHA 4DSKA 2FINB 3ULJA 1WHWA 3FRZA 3QJPA 1B70B 2Z2LA 4DK6C 3I70A 3K89A 2I0QA 4DAYA 5C0XI 5FKAC 2LP4A 4AIMA 1JOKA 3GWCA 1VFJA 3AD8C 3H94A 3DU6A 2ZH9A 2F0GA 3I0SA 3N0VA 1Q8IA 5CAAA 3FJ2A 3V6KA 3U1MA 5IWAQ 2HRUA 3DNCA 2QA2A 4M5IA 3DLGB 3QO9A 1KFDA 3C15B 4F4AA 4PG8A 3PV8A 2GMJA 3BPSP 3C16A 2PW7A 4N9TA 3SZ2A 4DFJA 2C35B 4L72B 3OJSA 1NJYA 3HK2A 1GUTA 1ET6A 3MD1A 4PR6A 2JYOA 2QCPX 3CCLA 4A3GH 2OEOA 4UQGA 3HKZB 1OMSA 1RWXB 3HOZG 3G48A 3RAXA 1BQNA 1U0SA 3KNGA 2X1BA 2KXFA 1W25A 4P73A 3IRXA 1RT7B 1HIYA 4MK7A 1FNUA 3FEZA 4R25A 3PKYA 2ZUGA 5J1EB 3I6PA 3CJKB 2I5JB 1K0SA 2W2PP 3D1HA 4WZQA 1FYCA 3I4PA 3QZ7A 2F0SA 4UY8T 5G0RB 2IM3A 5EBDA 4OV1A 1AZSA 4LRFA 4Y2IA 2CFXA 3M9BA 4RW6A 2M9KA 5EDWA 1UVIA 1KSPA 1WI5A 3DLKA 4FDFA 4PUOB 4C11B 3MR5A 4MKBA 2MDAA 3HI9A 3M3YH 3OHBA 3S8SA 4LSZB 2HBQB 1Y7PA 3D8GA 3FBFA 2AF6A 2CPYA 2V8HA 2HNZB 4WFXA 2N4DA 3BF4A 4RAUC 5KRUA 1JWWA 4Z9CB 4N8OA 3M9NB 3DRXA 3RD4A 2W2OP 4LF6L 1BCPB 2X3DA 2JA8G 2XYHB 4N8X1 1XNRL 5F8HA 1Y8PB 1EHWA 1CS4B 4X4VA 3MAHA 4ZK7M 1WEZA 4G7ZC 5KT6A 1WG4A 3N4WA 3NWGA 4HHHA 1HNZQ 5HMZA 1RU1A 4CTAB 5JVG3 1WYDA 4PZ6A 4X65J 2YX1A 2QEXA 2MLXA 3ISNC 2VUMG 2WBMA 3J81Y 3MTSA 3J7Z5 2RCNA 1RWPB 4KHPF 2LSSA 5M2RA 5DZ6A 3RRGA 3W5XA 4A3FH 3AY0A 1K73T 2VXWA 4RUAA 4M95A 3BDEA 1QTMA 5J3BA 2BA0A 4X65F 5GAGI 1UEAB 4A3BB 3ITHA 3LWMA 4ZCKA 1DQ8A 4LF7Q 3CJ4A 3MMJA 3GG0A 2XRSD 4Y52H 4DR7Q 2NPFA 5M2PA 1BOSA 2C2OB 2ZJQA 4ZVOB 1PTOH 4DUTA 2LU2A 2JK8A 2K14A 1V5IB 2XEXA 3ILIA 4USHA 1M5VC 1RHPA 1STAA 3MM9A 2F52A 2RHSB 4LWCA 1FESA 4AH6A 4AL7A 4ZOSA 1HL6A 1JB3A 3RR7A 3Q2TC 2ZH2A 3J80c 2AX0A 2B7CB 1DARA 1HBUA 2BM0A 2D7SA 2I2YA 4C3HG 3VQTA 1FXRA 4BBYA 2EXUA 2XLKA 4RUBA 2QA4A 2H5IB 3OW2R 4LF8J 5J2MA 4G1QA 2N3LA 4X3SA 1UVNA 5KOWA 1WD1A 4IZ8A 1S9FA 4A3KG 4NLYA 4NLVA 3L09A 1ICFB 4UP8A 3KK7A 2BVZA 1XR7A 5KG0A 5D3DA 1CHPD 1AROP 1NMGA 5GADI 1IBMJ 4RU9A 5IV3A 1RAJA 3NWTA 2HHTA 3GJQB 3DHWC 1D8YA 3VAIA 4OQJA 2DGTA 4U673 1ET9A 3FMBA 3TAQA 1VHFA 2B4OA 4DFMA 5EPKA 3X3UA 3TWZA 2HVDA 2Y1RI 2N8NA 4LBHA 4ECXA 4CO0A 3TJ9A 2CCZA 2E9ZA 2PYKA 4RL1A 2RH3A 3TX0A 3VGTA 1H9SA 2EEYA 2MEWA 2ZE2A 2G2OA 4PMBA 1PG5B 1VQHA 3VF0B 5KFXA 4NMLA 1B7YB 2BMBA 3TNVA 3CCQA 2VU5A 3UCGA 2Y1IA 1YITA 4KTQA 1WJ9A 2Q2UA 1QAXA 2P9GA 3JAME 3GTQB 4JI1Q 1XIQA 5KFFA 3N52A 2ZOFA 4ED2A 4TY8A 4UOFA 4ZVUB 2A69D 4OWWB 3HHLB 1WCMG 2B2WC 4ZP8A 3QFWA 1K28A 3DLEA 2DCUB 4LVNP 2ALZA 3RB3A 1G7CB 4O3QA 4ZIVA 1MD2D 1B4SA 4H4OA 2XMAA 1F2YA 4B9NA 2F0LA 1A7GE 3PO3B 2BX6A 2RDIA 1IBKQ 5BR8L 2R2TA 4QWAA 2IVYA 4NYOA 1RK8A 4HI1A 2W25A 5HSPA 4ZJLA 1V1PA 5C3WA 4UZBA 4CZCA 1REVA 5CV8A 2VKZG 1DHMA 2NVQH 3K57A 1CZGA 3QWPA 3OLBA 2HFNA 1YVCA 3RBDA 1V43A 4EZ6A 3BVZA 3IC1A 5FO8B 4E2FB 2PMHA 4ZK9B 2EZVA 4LIWA 4A3IG 1X5TA 2RS2A 5GAEC 1L1OB 2H54B 3V6DA 2RMLA 3NLCA 1XPUA 3DKDA 5NUCA 1D6EC 3MI7X 3P5TL 2FLPA 4DV2Q 2J6SA 1AUSL 3QIDA 4JI1L 1YZ6A 2ABYA 3BBCA 3C16B 1OXSC 5IXUA 2I5HA 4ALPA 1DBDA 1SJ4P 2QFIA 4K5VA 4ZUJA 3J81j 1N9WA 1HI1A 3BKUA 4IOAQ 3KG4A 5B0FA 2MGSA 1YJRA 3GIKA 2DJWA 5HAOA 3NBIA 1FFSB 3AJ1A 2QL5B 2LMIA 1NU4A 3AYHB 3WOFA 3ZC4A 1ESRA 2YV5A 4XK8C 1IKWA 1KP6A 5HBMA 3IRXB 2D62A 2OXPA 3NNAA 3PV0A 3KG0A 2NZOA 4QWCA 3HSZA 2OCEA 4FYDA 4PQUA 2UXCL 2W4CA 2R2RA 1NK7A 1RI7A 2BDOA 4KN7C 1TFWA 2XS5A 1CSPA 2V2ZA 3VAKA 1PV4A 3HZXA 1WDTA 3A8KE 1XWEA 3HOXB 1VRTB 3HT0A 4P74A 3PGZA 4TQSA 1YJWS 4DR6L 3D31A 1HBMA 2CNOB 3M7VA 1DOKA 1II3A 1SYDA 4MFBB 5I4MA 2FUG9 3D3RA 4TKTA 1NSKL 1P9QC 4F3MA 3H2LA 2EI5A 3PUVA 1U5KA 5EKKA 4A3KH 1DTTB 5ELCA 1EY6A 1CG2A 3JSMA 4ED3A 1AH9A 3IS9B 1HQMC 4JBCA 2SOBA 2W7OA 4K6DA 3Q22A 1RCVD 3T56B 2F8MA 4ZYSA 3FQKA 1SKSA 4AXIA 2A73B 5D0HA 3S1TA 1GMVA 3ZTQA 1AE3A 1UWBA 2Z8LA 1WKJA 1FERA 4NPOA 4DFKA 2KJWA 3OFGA 3D68A 3HKZG 1EUJA 2NQPA 2Q2TA 2DTJA 1F9EB 2B3TB 4B9WA 4DL3A 2FGCA 3IL8A 1FWKA 4B3MF 5L8RC 2VZ9A 5ELBA 3QNWB 3CD6A 2JSXA 1G8ZD 1DY3A 4R4CA 4TRDA 4OO1I 1EARA 1X0FA 3PDNA 4GOPC 2PI2A 2BJDA 4CM0A 1OQ3A 4AT1B 2KO1A 3H0GB 3L2PA 1NRKA 2YKAA 4CTAA 4NXMF 2MUYA 3CSKA 2FVQA 4ECZA 5D3IB 1O7LA 3LNNA 4NLXA 1MWZA 2YWFA 1UE5A 1HQEB 1X3PA 2LKZA 2F0DA 3TP5A 3TVYA 3I4MB 2ID0A 4JI8J 3N6NA 1TWGH 3PG9A 3S1MH 1D1UA 1X6OA 2EYJA 3MXGA 3CD5A 1LABA 2EK1A 3CCES 2C2NA 3J7A5 2M2BA 5IYCG 3SYZA 3MMCA 4QIEA 4FS1A 1IBKL 3MZ5A 3KLFA 2JEJA 2XIWA 3NS6A 3OFFA 1EY0A 2R92B 4DV7Q 3TEHB 1PH5A 3AD7C 4F87A 4OHXA 4C48A 1RGVA 4JI6F 1X7VA 1QTNB 1UVKA 4ZRZA 3V4MA 1G2TA 3PYDA 2OHDA 3FEYB 3H4BA 1JIHA 1S6OA 3VZIA 3I87A 2HMIB 1IKVA 1M5SA 2IBKA 1NUCA 5KG2A 3QAUA 3TJ8A 3ULPA 1KLNA 1J6QA 3I0SB 1S1XB 5C5MA 2BOAA 2KUMA 2FZCB 2HBRB 4MKYA 1SNQA 4LW1A 2PE8A 3HJVA 4U96A 3K7AB 2HS4A 3KHLA 3Q24A 4ECSA 3Q8PB 4IUQA 2E44A 2X6GA 4O3OA 2GIQA 1IBCB 2ES2A 2RQXA 4CCHA 4EQOA 4F26A 1R7IA 4DV3L 1Y1VB 3TZYA 3V6HA 4PRFA 5A2QL 1UPMB 1X4FA 4HR2A 3DN9A 4CO1A 3HG9A 2HVIA 1TR0A 2HW3A 3NGTA 2QO3A 4ZP7A 4NLOA 4DPTA 2G0CA 4JV5L 2BE5C 2HIYA 2WACA 4C1NI 2PMZD 1G3OA 4K59A 3Q8VA 5IODA 2A18A 2RDGA 1X65A 1W2BA 2CVIA 2M5YA 2VY3A 2R7TA 4GC7A 1GXLA 4ZUIA 4OZLA 1JLFB 4DN0A 1LTAD 2NS1B 1EAYC 3JQJA 4OYIA 1I6VC 2Y0SD 2ZM6Q 2LYVA 2O5DA 1S1TA 1UUPA 3MHBA 3CJQA 3MTKA 2VFTA 3FZBA 2ASJA 4RNFA 2G0IA 2DGVA 1HNXF 4NI2A 1ZPVA 3SEOA 5C7PA 4AUKA 1C4QA 1OY8A 2CHBD 1A9NB 1HQ2A 4HJ5A 2DNHA 3VVUA 3KK2B 3KLGB 2CQ3A 4B3RJ 3P5BP 2O4XA 2WIIB 3S15H 1M90T 2H9ZA 1A3TA 3VR3A 3T1HL 1HNWL 4KHMA 1QSYA 2U2FA 5KFNA 2NUUG 2B7BB 2RDHA 4BY7G 2DXFA 2XCPA 1V3SA 1PFNA 1DD2A 2L3MA 3AFGA 3PJWA 4N8FA 1QY7A 3S1RH 4R5PA 4MMOA 2YYZA 1RT5B 2MKYA 4A93B 1B9NA 3IO1A 2I5LX 4GS3A 3M85A 3MM7B 3BR8A 1EP4A 4OWTB 1C9OA 2B2TC 1D5XC 3MOZA 4O42A 5C44B 1Q86T 2OKQA 3IAYA 2VQEF 4ILRA 2QJ3A 5T7LA 1RTZA 4O0NA 5HI7A 4LF4L 4GO5X 3M6UA 2QGFB 1JCKB 5C4JB 4TN2A 3M4YA 2E2JH 4QL5A 4LFCJ 3NGKA 3AHPA 1VHIA 1GEHA 4DV2L 1UAPA 1R8CA 1NKCA 5F0WA 4MHEA 4JI2J 2YBVA 1VDZA 4D3GA 1KHVA 4ZPDA 4EVOA 2WTFA 1HNZF 5D4OA 4K4ZA 4P72A 1UMJA 4KV8A 1RWMB 1NHUA 3OMGA 3FPPA 4I64A 2CPEA 3KDFA 4KMUC 4ECRA 2OT2A 3J7AV 3KHHA 1C0UB 2KFZA 1O5JA 4ZVHA 4YWKA 3MMBA 4URSA 2QZ8A 1SSOA 3OTOQ 2YNIA 1X3GA 1MBYA 3UDCA 4A93G 2UU9J 1N32F 3OVBA 2R7VA 4HN7A 3M6WA 3M6VA 2I46A 3CEDA 1Y8OB 5H9FK 2E5JA 2F1MA 2E2JB 1NHKL 3EVQA 3ZZPA 2E9TA 3NQTA 4OX9Q 2JQOA 3PY8A 1I6JA 2PQAB 1UVMA 3M8YA 3FHWA 5LMNJ 2C3OA 3TQEA 1VMCA 2V2KA 4IG3A 5JXSA 3TR5A 1V3ZA 2AWOA 2UP1A 2ZNYA 3ZTRA 4TQRA 3CC7A 2JA7H 2RILA 4NL5A 1N54B 3ET6B 3GG1A 3DRRA 1BCPC 1EFID 1HI8A 1T94A 3I90A 2XWYA 2DNMA 3RW7A 2J9CA 4N77A 2KG1A 3J7ZC 3CJ2A 1JJ2A 2E1AA 3VHQA 4JOIA 1PFBA 1ML0D 4UPAA 5D4PA 3IWNC 2A3JA 4BBSH 1DLOA 1D8LA 2CFMA 1U2CA 2OSQA 1T02A 4KSEB 3M2VA 3HD2A 4X62L 4H02A 3X3NA 2IA0A 1XNQL 2NYZD 2E2IH 3BREA 1VLYA 1IKXA 3MUVP 4PG5A 3UFCX 3L7PA 1DAXA 5F8NA 2NXUA 4LRBA 1EQMA 1FJCA 5C3EH 5A8RA 1VI7A 1J5OB 4DR6F 4USKA 3GTMH 2VONA 4UUWA 1AZPA 1WOCA 1ENFA 2B2VC 4CWBA 3GQCA 3P49B 4CGYB 4N76A 3E3XA 3K5LA 2HWIA 4CI0B 1X9SA 4C8OA 4TLQA 1SL0A 4C6AA 2W2NP 2B2TA 1BUXA 1TKXA 4L75A 2HHQA 4WFAQ 2EJFC 5HGQA 1PTOF 4QIWB 1C7YA 3IWLA 3QRQA 1RT7A 4OI1A 1IQTA 1LWFB 1NNXA 1MWQA 2V0NA 3AOAA 1LV9A 1SPBP 2CH4A 3C66A 1F0XA 3RW6A 3IMQJ 2KTQA 4DS5A 4EBDA 1CJUB 1KL9A 3GSIA 3W9JA 4DV4J 3BGLA 3EUNA 3ZZUA 1VQ5A 1A0IA 2QFJA 5C44H 3OV7A 3CULA 5B0DA 4MK8A 4G1PA 5KFEA 1RT4B 1BCPF 3DLKB 1KQFB 4PKDB 1JJ2R 3KLIB 3P45B 3TZDA 2XMTA 5CYMB 4M5LA 4PG7A 4ITSA 2CJYB 3ZTPA 3H09A 5EWFA 3VR4A 1HR0F 3H2UB 2MZSA 3ETMA 1AEXA 2CAJA 4V19J 3HFKA 2BXJA 1HBNA 2CADA 2QEJC 1F60B 3PX4A 1SH0A 3CXCA 4JBWA 4ABNA 5EUHA 2VB2X 2IJ0A 1WFQA 7FD1A 2VL1A 4C2MB 2AHOB 1RWVB 2ZWOA 1S1UA 4ZLTF 2E7WA 1TWCB 4ED6A 1DONA 3BSCA 5KFUA 4A3DG 4GNXC 3G6VA 3V96A 1BWVA 5KFAA 1YRUA 1PIEA 3U1LA 2QA4G 2JEIA 2RAQA 3PSIA 4C9DA 2MQMA 2FHOB 3CMQA 4JV0A 4DR2J 2QDBA 1JXEA 3ICEA 3C14A 3MM6A 2AWNA 2YVSA 4MKAA 3HSDA 2E75C 2Q66A 2ZTCA 1TAUA 1K0TA 1QUPA 1SXLA 3MWBA 2MO0A 1LW2B 3FCVA 2B6AA 4JI2F 4KE5A 4Y65A 1IM6A 4XIUA 4WXOA 2HFOA 4YQWA 3SXHA 3VZHA 3A12A 1HNXQ 2OTJA 2HGLA 3TA0A 1S1TB 1TQLA 3DM1A 1LTID 3J81i 4URGA 1YIJS 4A4JA 4MJKA 4KGXB 3UCUP 4DR3L 4OJ1A 2L9NA 3A3PB 1NSPA 2J0SD 2RVJA 2FJBB 3CGIA 3A8IE 1IBML 1ILPA 4USUA 3DGVA 4H44C 2MPMA 5HQLA 1MMLA 1B3AA 2VQFQ 3JQKA 5J1ZA 4HEDA 4UZCA 1K73C 4PWWA 4LF5L 2JFDA 2V4DA 3K0JA 2WFWA 4LK1C 5M3MG 1O78A 3LQVA 1FNXH 3H3VC 2ZD1A 2KT5A 5GMKa 1B3TA 3DOLA 2MKJA 3PUXA 5D0RA 4CNYA 2UUBL 1TKTB 5IY0A 2C2KB 1BWEA 5EQ0A 5RUBA 1TWHH 3S7RA 4ZJOA 2EY6A 2LXJA 2MZTA 3ONQA 4HJ8A 4OYMA 3W2VB 2DPIA 2OD6A 3V81A 3CTRA 3M8PB 3CCMA 3TA2A 3QYYA 3UR0A 3O13A 1N0UA 3QPIA 3S14H 2CVEA 1S72S 5M5WH 1ENCA 1SNPA 4USWA 1I6HH 4F8RA 4NW2A 1EWCA 4YMEA 3ZTOA 2JA5H 3OFHA 1XR6A 5IT9E 2HHWA 5FLXL 4PMCA 2KEEA 3OSPA 2BANA 2J8AA 3B4MA 1LTTD 2BH2A 1H74A 2OUGA 2Q2IA 2MKCA 3PRBA 1L3TA 4X4NA 1M1KT 1Y4ZB 1HWJA 1UWAA 2GCFA 5B0EA 2B2UC 1I1GA 3O2IA 2E7VA 2NN6H 2NXEA 5DDQC 4DK3C 5D0EA 4QWEA 1JLCB 2GVDB 3MFGA 1PMRA 3MEKA 1NO8A 2LA4A 4WIIA 2BQUA 1CFMA 2F03A 2XLIA 2XNRA 2OPPB 1EQVA 5C2CA 1CA6A 4FXDA 1WELA 3PW2A 1C1CB 2OH2A 2OFGX 3VA7A 1GD7A 1C4CA 4W90B 3K8AA 4ZVRB 3M8PA 3LWUA 4LF7F 1NHVA 5AJ3Q 1IZ6A 5A0YB 2CWPA 1QLNA 2AJQA 4U8VA 2YKMB 4LFCL 2DNCA 4LF2A 2M00A 3LGHA 2KVIA 3BH6B 3UNGC 1CULA 4HIMA 4A3CH 3BO4A 3F2DA 5DQHA 4IOCA 4LAAA 3CCUA 5I9OA 2AQ1B 4IDKA 1PCAA 3KDOA 2ZVIA 1PLFA 2CJKA 3IRWP 1SH2A 2X1GA 3PHEA 5E5NA 3TUJC 3NENA 2UUCJ 2CQIA 2AJ1A 5D77A 4G3IA 1ZPWX 3OFEA 2RU9A 1I94F 1HYSA 1X31C 5M3MH 2BW7A 2VASA 1JKHA 2RNEA 1T03B 2CZ4A 1S1WA 4KJIA 3NY0A 2HVZA 3HHEA 3G2XA 5KG4A 3ENVA 2IVMA 4K4VA 1JQYD 4TYAA 1I3OB 1MKHA 3NTHA 4ZQ3A 3PHTA 3OL7A 3I5AA 5KFTA 2MKSA 1JLBA 1Q8BA 1CKNB 5JPMC 3EN2A 4A3KB 1OY9A 5M3FB 4RG1A 1WKKA 5GROA 1HPZA 5BJRA 1EKSA 4UY85 2A69C 3U7JA 2GJ2A 4HKQA 5A2QU 1U8SA 4Y00A 3MMAB 4P2FA 4OZNA 2DJGC 1S6PB 4NCAA 2R7UA 1J5EL 3CC2A 1U6ZA 5DM6Q 5HLFB 1SIZA 3R7NB 1HR0J 3L7OA 1MROB 1EIFA 1XTCD 1SNMA 1TU2B 3NTKA 1FNWA 1I51B 4L3NA 1LT6D 1Z7TA 3DYAA 4ANDA 3WZ0A 4DQSA 4WP3A 2I0XA 1VC5A 4PQUB 2HGNA 2K04A 3BSAA 2EPBA 4QR2A 4X6AH 2GVZB 5D6GA 3R6GB 5L1JA 2RSNA 4WFNQ 1SYCA 4C2MA 1RTDA 3IGNA 1TWAH 1AXQA 2Q2HA 4K50A 1K8OA 3GU0A 2V63A 1T03A 1IR1A 1Q90A 3R5JB 4NB3A 3PO5A 3HVRA 4CH0S 4YY3L 4DV6L 3RYLA 2R8KA 3BZQA 3C6TB 2EYLA 2ASDA 3MM7A 3EVMA 5F8IA 3T9NA 2NPIA 1KXLA 2HEKA 1G2EA 2UUCF 4QPTA 2VPWB 3QR8A 4RW6B 2B6AB 1YHBA 3M4OH 4DV7L 1PYTA 5AJ3J 1L2FA 2LMCB 2M9VA 1QM9A 4YB6A 1FFWB 5C0XH 1Y1WG 4K4XA 3HOXG 3SQGA 4YB5A 1SAPA 3SVMA 5HP1A 2BEFA 4IUNA 5HURA 1RT6A 3D6CA 4JI4J 3AB4B 3C14B 3T1YQ 1VQDA 1IL2A 3A7LA 1Q46A 3JSYA 2BJ8A 3F2UA 4DG1B 3IKJA 5EX3A 2DNZA 2XM3A 1FKPB 1RDPD 3FKBA 1N32Q 4JI3J 2PSZA 1XNRQ 2K32A 2V2VA 4IG3B 4I7FB 3M7NA 5I4DA 3BGOP 1RTHB 4C3JG 1PRTF 3HOVB 3VWSA 4DUZJ 4JI5J 5JEAJ 3J81E 2DR6A 1ZAVA 2VQFL 2R7XA 1EYAA 2Q6CA 2F0QA 2KH9A 3A8EA 1X3EA 2O01C 5ETOA 3VVTA 2P6TA 1J5EF 3RR8A 2VNUD 3JC66 4X66L 5IGCA 3GYGA 4DL6A 4LRCA 1H0HB 1XQIA 2NUHA 2R93B 4CQ1A 1U6FA 4X3UA 4OL8A 4A3DB 4F2RA 3ISZA 2MKHA 2E1MC 3SQGB 1S7HA 2HNYB 3LAKA 3AU7A 6FD1A 5KT3A 3FCHA 1RT6B 5A8RB 2FMCA 2H4YB 2MY7A 4PPZA 5LL6S 4DNIA 4S3SA 4Y28C 2EYOA 1HR0Q 2R92G 2DIUA 2WVBA 1C0TB 3A8JA 3IN5A 3U9SA 1GK8A 1RABB 4V190 3MCMA 4K8IA 4OZ5A 4QU7A 2VQEJ 2I07B 3MVVA 3E01B 3E6ZX 3IG1A 1B99A 4WFYA 3CC7S 2FDNA 3UN2A 1ACMB 3T1YF 4M8LA 1HUNA 4LF8F 5GAGC 3GTPH 3KUEA 4OFZA 2LY7A 3OD2A 4CLWA 1NH7A 3MFIA 4K5RA 4FNFA 5KFMA 5M5YB 3P8BB 3MF5A 3M1VB 2KM8C 1CSQA 3K58A 4TKOB 3LA0A 4NYPA 2AQ4A 4LF6F 4DAMA 2B4VA 2B8PA 4JV2A 2AKWB 2RRAA 4EBEA 2W9BB 4DV6Q 1TKXB 2CVRA 4OX6A 4UF4A 3SIPB 4F0KA 3CMAA 4FVCA 1DZ1A 4TVAB 3LGMA 1Y9OA 3D2WA 3C15A 4LFBQ 5IT4A 4R4TA 4QJVA 4EO6A 2KVMA 1UFKA 1UETA 3HO1A 3MXPA 4B9TA 4EFAC 4DX7A 2NBFA 4LUOA 4AYBG 2XNAC 5KGUA 3GDEA 2QDLA 1EZ8A 2JXMB 1IM4A 2F4FA 3OR1B 4DSJA 4JI7F 3KLSX 4I2PB 2LEBA 4KHRA 4NMXA 3HT3A 3R2CJ 5C4XG 1M5OC 1FF2A 2CQDA 1QB5D 2A6HC 5B0BA 3A8JE 2CUYA 2DEJA 1SQFA 2H3EB 1GUGA 5CBEE 2C3PA 1D0EA 5L46A 1RWWB 2GJIA 1FGUA 2KDOA 2KYXA 1FL0A 3KUPA 1F2HA 4RNOA 2Q8RE 2HT1A 1H9KA 4AQYF 5M3FG 4M1KA 3BH7B 3P75A 2KQ3A 3P3DA 1SJED 3ZFVA 1FE0A 2FHJA 1RTOA 1NEEA 3RG6A 3NOGA 1WD0A 3BV8A 1S9GA 2OEMA 2QLJB 2GMHA 1T95A 2AYMA 1YX2A 3FEWX 3N6LA 3GILA 4WE1A 1MROA 2E5LL 1NK4A 4A3MG 3NNHA 1X54A 2YQ3A 3UVJB 5T1IA 3ZZYA 2WONB 3DDNA 3S2DB 2NN6I 3W1YC 3IGVA 5C3EB 4HDGA 1N36Q 3HZEA 3M2RA 2BJ3A 1N36F 2UZAA 3AAWB 3UE1A 3TEGA 1HNXL 3G86A 1DQ9A 1HPCA 5HN0A 4OYZA 1Q1BA 3IBCB 1BHNA 4A8KA 1JLEB 1LXJA 5K8NA 4LMZA 4GVBB 2NZCA 4QQBX 2CG8A 4HR7B 2ZHBA 1T8EA 4RH6A 3BGUA 1SXTA 4J9NA 2C2RA 1HARA 2PEBA 4B9XA 3DXSX 1D9FA 2HIXA 3GV8B 3DLLQ 1RXOB 2G9OA 2L48A 3H91A 1UVLA 3MM5A 2FXQA 2SXLA 2WB1G 3CPFA 2F3VA 5AJ3F 2MHNA 2KI2A 4DOZA 2EXZA 3KMSA 3VALA 2Z0SA 1VQGA 3QB3A 4TY9A 5IP7H 4BWMA 2VBYA 3UD3P 1B0TA 1HA6A 1YRTA 3PXGa 3DMUA 3K7RA 2M0GB 2MXYA 3W5YA 1VBYA 4L6TB 5BR8F 4QY7A 2IX1A 2GHPA 3WDOA 1RHUB 1S5ZA 1N52B 2AV5A 4G65A 2D1CA 3J7YU 4LFAQ 2BA1A 1JX4A 5CD4A 1VQ9S 2J9DA 3DOKA 3LANA 1PFSA 4LF6J 2ZM6J 2OPSB 2OI2A 1JLCA 3IBWA 4W4MA 2LXFA 1WJJA 1FXLA 1V8QA 3DGPA<