3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BipA
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
4ZCLA 3UI3A 4ES1A 1ZM3A 2NPFA 1ZPWX 2YWFA 1P9QC 1N0UA 1VI7A 1ZM9A 2I0XA 2J7KA 3CB4A 3LH2S 1WDTA 1ELOA 3B78A 4ES3A 4ES2A 2XEXA 2DY1A 1U2RA 3ZZTA 2EFGA 1T95A 4MAKA 3B82A 4TNOA 2YWHA 1FNMA 1N0VC 2BM1A 2ZITA 3B8HA 4M1KA 3ZZUA 1DARA 4ZCKA 4QR1A 3ZZ0A 4FN5A 1ZM2A 2BM0A 3OQ2A 3EXCX 2BV3A 1ZM4A 2CVEA 2L9NA 4QR2A 4ZCMA 2WBMA 3E3XA 2I8EA 4QR0A 4ZCIA 2YWGA 2YWEA 4MYTA 2KDOA 5G4DA 1KTVA 4MYUA 2E1RA 2IVYA
chains in the Genus database with same CATH superfamily
2HS4A 4NA1A 3PUWA 1NSAA 1TU2B 2OTLS 1N5YB 3IAM9 3R7SB 4LUOA 4DR1J 1J5OB 3IBCB 5CBEE 1WDTA 4FPRA 4KTQA 5ELCA 3CJ3A 1KQFB 4HYKA 1HD1A 2K4KA 4DPWA 4KV8B 1GUWA 1GEHA 4K4WA 1N6QB 3VWSA 1WCMH 3MUMP 2ZM6L 4A8FA 2WKDA 4OZNA 4KH1B 1WC4A 1WTVA 4P10A 4XTTA 4NWBA 2VXWA 3G86A 1K0SA 1J5EL 3NAIA 1VQJA 2RSQA 1N33Q 2BA0A 4LR7A 1S0MA 4DV7J 1RAOA 4F88A 3GIIA 5J2MB 3F2DA 1RHPA 1YJUA 3UCGA 4U7CA 1F0XA 1C1BA 3BGOP 2HWTA 4F50A 5B0FA 1SCJB 3U1LA 2E9TA 4R8UB 3SXLA 5F2DA 2EWHA 4LFBF 1IN0A 1HYSB 5U47A 5BYQA 4YWLA 4R4CA 1Z9FA 2DGYA 2XQCA 4Y00A 4OJGA 2R3VA 2DR7A 3H4DA 5LT5A 3BGRA 4KY6A 3CC7S 2OEJA 2VG7A 3MD3A 2M5YA 1VQ6A 2QEXS 2YNGA 1S6QB 1PFMA 3H0GH 3ND8A 2ZH1A 2EYOA 3S1MB 1RDRA 2ZUAA 3HXMA 2L1BA 1S1VA 4WFNQ 1JJGA 3I32A 2GMLA 2B63B 3MPYA 2G2YA 1PV4A 3RB0A 4DCOB 3M1VA 3SSSA 3PYFA 2NXNA 1AFIA 2BYCA 4G57A 2C2OB 2Q6CA 1NDKA 2DT9A 4N8X1 1T03B 1DARA 4DUZL 3MFIA 4LF9F 1WTPA 2YNFA 2YNIA 1N5QA 1SV5A 4LFAF 5EKIA 3M8PA 1OXVA 4RBTA 2RRNA 5D0GA 3ET6B 4LQ3A 4PXEA 3IFEA 2VG6B 4ZVQB 4ZP6A 4DAYB 3NNCA 1TKZB 1NDPA 1B7YB 4ULLA 4NLVA 4QYRA 2I38A 1PTOB 1AE2A 2XGQA 5JEAH 1HR0F 5J22A 1AZQA 3FQKA 4B3SJ 1RHMB 2HRUA 2LYVA 4CTAA 5CMDA 1KSPA 4MKBA 1IR1A 2BDNA 3T9NA 2HHHJ 5M3MG 1VYAA 3RG6A 3MXUA 1HHQA 1D8YA 1EWIA 4DU9A 4ATNA 4TQRA 3PV8A 2ZVIA 3I4HX 4LSNA 2QLBB 1D5ZC 2QX0A 1QSYA 1KLUD 5SUHA 1D5MC 2Y0SB 2CPHA 2NWGA 1NK8A 2VY3A 4R9WA 4GVLA 1FJGF 5D15A 4IO9A 3TZUA 3I4LA 4NMZA 2WAQB 3PNIA 3HOVB 3NMRA 4QB4A 2DGTA 4I2QA 1LOUA 5I3QA 5L9NA 2KG1A 1HBMB 1NZ8A 1SJ1A 1M4VA 1NY4A 1JLQB 4M5LA 4G1IA 3BV8A 2N4CA 3N6NA 2X1FA 4RW6B 3A5UA 4LF2A 4TU9A 5IFMA 4KJIA 3WWVA 1RCXB 4WYWA 5IT9E 4K6DA 4GO5X 4GKKL 2KHIA 3H42A 4DQQA 4Q0FA 2MKYA 5J1PA 4IQMA 4O0AA 1TWFH 4DV0F 3ZO7A 3T1HL 2N3OA 2F0JA 2XHWA 2L15A 1V9OA 1X4FA 4I7AA 2CG8A 2XY7A 3J80U 4MMOA 4IRDA 5IT0A 4XPEA 3HVTA 1TL1A 2RU9A 4JI7F 2ZUGA 1LO5D 2DHAA 3HG9A 3DFEA 2JSOA 2EE1A 2AYBA 4UZCA 5I4MA 2UVVA 5JVHQ 3A3OB 3N01A 3N6RA 1QJOA 2YWWA 3BJYA 5FD1A 3I0RB 3GJSB 5JJKA 3M32B 3M3YH 1YBTA 2BEFA 4MFBB 4S3SA 2BJEA 3B6BA 2YPZA 2A6ED 1EL0A 3KMSA 2DTJA 3G6YA 3TZZA 1WJ9A 2VQFJ 5IGBA 2RS8A 3GG0A 4X4TA 1A63A 3MDFA 1TK8A 2Z57B 1U1OA 5IT9Y 1JKHA 4A3FH 3KK3B 1GMUA 4KTAA 2FZCB 3N5FA 4R25A 5KNCA 1ZEQX 2CJAA 2YNHA 4C8NA 4DV6F 3UE0A 4PYDA 2N3SA 1APSA 3RBDA 5IODA 3P7JA 3DOKB 2KENA 1ICWA 3L9ZA 3ZFVA 3H8YA 4PUOA 1EOVA 5IT9L 2MGSA 3RU0A 4WTYA 5B0AA 4JBMA 5B0CA 4M1UB 1CZGA 3C6UB 3QRPA 2ZHAA 3BGUA 4K8IA 1U48A 2CUYA 1BCPB 5K5PA 4C11A 2HW3A 3QT5A 4ALPA 4A3IG 5H9FJ 1K8OA 1RT1B 3M9NB 2D3OR 2W4DA 2L9HA 4WIQA 5K8PA 2AJ1A 3GQCA 1U45A 4DKAC 4DS5A 1SB6A 2FHJA 3EX7B 2R7ZB 3TAQA 1EY8A 3FMWA 1FKPB 3BN7A 1K9MC 1N0UA 2LQJA 1CSPA 3KLIA 3RMHA 3DYAA 3VR3A 4WZMA 2PA8D 1Z2ZA 4X64F 1RAAB 2F9JA 3TR5A 1WC5A 5EPKA 2R7OA 2QCPX 1R9TB 5A8WB 1NCVA 2YWEA 3RGIA 1G8ZD 3FHWA 2ABYA 2RHQB 3KG0A 1NBWA 2EG2A 1I94F 1FRLA 2Z2MA 2OSRA 4NYOA 4KD4A 1HW9A 1D9FA 3UPFA 4J91A 3I4NB 3KK1B 3MM7B 1L3SA 3G8QA 3ZNUA 1EHWA 1Q4RA 1YRXA 4A3GH 1VQIA 1NK4A 4HCSA 5CGKA 3DU5A 1VMCA 1D1UA 3M2UA 2JA6H 5ISRA 3NSWA 2HZCA 3HSDA 1XMQF 2EVBA 2QIFA 1T0TV 2Z2ZA 2Q8TA 2MQPA 1EQRA 3S1RB 3KMQA 1D1KA 1X5SA 3LANA 3HOUB 1VQ6S 3P5BP 1RWVB 1HBNB 1P8LA 1S0VA 4ZPTR 1QILA 2JA5G 1TKXB 2JNJA 4FXVA 1S5DD 3OVAA 2DY7A 3A7LA 4ID8A 1UE6A 4KHPL 1AZSB 2NVQH 4UY85 1JJCB 3AJDA 4ZP7A 1UFKA 2VC1A 3T5KA 2AWNA 4LR8A 3OIQA 5HO4A 3ITPA 3HOYH 4N7TA 4F4AA 1FI4A 2PQAB 4QMGA 4L74A 1W7WA 1U6BA 1VQ7A 3QRRA 1XPUA 4WJ3M 2YKNB 2L48A 2IX1A 2XC9A 5CD4H 1U9RA 1YZ6A 5M5WH 2CJYB 3FRZA 2UU9L 3TOQA 1OYEA 3K0YA 2EFNA 1IKWA 3W2VA 3MMAB 2D2CC 1IKYB 5DM6Q 4OYBA 3HHLC 1JE4A 3DDIA 1XTDA 2C2NA 1YJWA 4JI8L 1VC0A 4U95A 1NJXA 1R7IA 1UWVA 1NO8A 3EIVA 1S9GA 2GGPA 4KMUC 2A69D 2E7VA 4UUWA 1SE2A 4B17A 4J9OA 3JAMY 1VRTB 4QOTA 3PO3B 1N32Q 3OJUA 2P9EA 4NEYA 3EPGA 1SKUB 1BR9A 4O4GA 1N9WA 4HJ5A 1ROFA 1ULRA 2SNMA 5H1SV 3OSPA 4ZN1A 2JDJA 1D7QA 4FP9A 1N36Q 3FBEA 3C19A 1W26A 1VHFA 3FDSA 3PIPA 2MQMA 3RZAA 4PMCA 4Q5VA 1NUEA 1PKUA 5DQIA 1IYUA 3MFHA 3KLRA 3J7A5 2X1GA 3QO2A 4UP7A 2XS5A 1IKLA 5AFWA 1JMTA 1P9QC 4LF6J 2NN6H 3EVWA 4O3NA 3O8WA 4ZDNA 3Q8SB 4KI0A 3SCIE 1MJCA 4A3LH 4L5RC 4XAKA 4DWIA 1CFMA 2H3EB 1F5CA 3AH6A 3EDQB 2UXDQ 4F3MA 4K4VA 3ZYYX 4OO1G 2F4VQ 3TNVA 1O7LA 1ACMB 4NYPA 3TJAA 4DR7Q 1LW2A 1S1TB 1IBKQ 2BJ7A 3TVYA 3IAS9 4R8IA 1WTRA 5D3DA 3BQ1A 1RODA 3I4PA 3M30B 4LBHA 5C44G 1S40A 1TVRB 3X1LB 2LCWA 2F0KA 4BC7A 4CO4A 2ROEA 4YHHL 4L72B 1DTQB 4X4QA 4RGOS 2OFGX 4CM0A 1QAXA 2J6SA 2JSXA 1PYBA 4EFAC 4HACA 1EWHA 1QY7A 2KM8C 2XZTB 2KRBA 1XX8A 3B78A 2VDHA 1H2TZ 3CPFA 1PTOF 4DR5Q 2QYGA 2RH3A 4KR0B 1IQTA 2HBYB 2OEMA 3MM9B 3R5JB 1LTAD 4B3MF 3EICA 3TUJC 4PCQA 1VHIA 1X9WA 5BR8J 4JCVE 3TS2A 2DXEA 4FS1A 1V5IB 3N28A 4DR2Q 4PPDA 4CT8A 1H38A 2EK6A 1UUPA 2IJ0A 3KLGA 4QR2A 3V4MA 2CPYA 3QIDA 3KHLA 5C5MA 4IDKA 1KLGD 4X3SA 2BKOA 2E29A 4OMFG 3OTOF 4QY7A 1JLBB 2PC6A 5KGUA 4IKAA 1U1NA 4TVAB 3SV4A 2BA9A 2JP1A 5IT4A 3MMBA 3HVAA 3NS6A 2B39A 1IBMQ 1H9KA 2BOSA 2K3IA 3LPYA 4PWDA 1S57A 3T16A 3CJ2A 2B63H 1AT1B 4X6AH 4LVOP 3CQZB 1X5PA 1RAJA 3BBBA 5D78A 1QTNB 1RYSA 2G4BA 5IIFA 1ITPA 4JI4F 5C0XG 4HJ7A 1C0AA 5E1FA 1F2GA 2JHEA 1G6ZA 3KJVB 2V63A 2Z56B 4NEZA 1UWBA 4B3RJ 1RT2A 3Q8PB 1CJTB 1CKNA 4DPTA 1X4BA 2ZH3A 1LEOA 1S6UA 1PJ5A 2DNMA 2J0WA 1KQKA 2Q2TA 1TZ0A 1OQ6A 2R93G 1HBUA 3F0NA 5IYDH 4AQYL 1PTOH 3SIPB 3QJPA 4Y34A 5E4XA 4B3OA 1HBOA 1IJFB 1H98A 2RD5C 3GTPH 1E6YA 1EQQA 3EXCX 1NSKL 2LDYA 2K7VA 2XMJA 5IYBH 5T14A 2QLWA 3FBBA 4ZVEA 2ZBPA 4UTGA 4WP3A 2A6HD 5K9FA 4ILMA 1P1LA 1JJ2R 3D67A 4K59A 4QU7A 3OJSA 3DNCA 2E75C 4JV0A 3GMGA 2X51A 1Q79A 4CH0S 4LRDA 1X3GA 3SFGA 4YN3B 5KFYA 4G3IA 5KFZA 2RUSA 4RA8A 1RKNA 1C48A 4HN7A 1T9TA 1WC0A 3B6YA 3M8RA 1MU2B 8RUCA 1U49A 4G7OC 4JC0A 1WG1A 3M8QA 1JJ2A 3W2DA 4I69A 2I1RA 3ZTSA 1E24A 1PH6A 3FSYA 2MHNA 2K33A 2F0SA 3CCSA 4AL5A 2W01A 2N78A 4C3MA 5C2GA 1LKZA 3IBFB 3LP1B 4CLWA 2DN8A 5C4XB 2HDLA 1O78A 2E1RA 3MMCA 1S4ZA 5B7WA 2CNLB 5A2QE 4LF7Q 1N34F 4RNFA 4UAIA 3RZDB 2NS1B 3TN2A 1VQ7S 1E1TA 3CCLS 4KN7C 3D4WA 4LRBA 5EUHA 1BCPF 3A8IA 5LJ5Y 4J9VA 2OQKA 4IJLA 3THTA 1WF0A 1CTMA 2IVYA 5I42A 1FNXH 5FDLB 2U2FA 3HVWA 2DJGC 4XIUA 3GJQB 3TAMB 3BYRA 5AJ3F 1YJWS 3DHQA 3LGJA 1VF5C 4L5QA 1DOMA 3PF5A 5CC4A 4ZJLA 3C15B 2EZVA 2Z6KC 1ZYRD 1PC4A 4RH6A 4PNYA 2EK1A 3VVUA 5FO9B 5M3FB 1RJJA 5CV9A 2DY1A 4I2PA 4R5PB 4TNOA 4FZVA 1IKXA 4K5RA 1LABA 3NNHA 2PI4A 4ZCMA 2CPJA 5EN1A 1KEKA 4GVBB 4FNIA 3QZ7A 1JQYD 5AE2A 4DUTA 1JQGA 5A2QY 1PTOD 3KDOA 1HZ9A 5IT9c 1H2UX 2PZUA 1NMGA 1OS5A 2ZTCA 3HHLB 1WD6A 3KBXA 2GVDB 5A8RA 3DXJC 2GQCA 4F4ZA 1FDDA 1EJ7L 3S17B 2EFVA 1S4EA 1BQQT 4DR4Q 2UXDJ 5A2QL 3H3VI 2EY6A 1BMQB 4FYVB 1SNCA 4CIOA 2VQEL 4DR7J 4ZHRA 1IBKJ 5DZ7A 1FFGB 1EETA 2Y0SD 4X4VA 4DV2L 4LF4Q 1RTNA 3MEKA 3AD7C 1HPZA 3PIOQ 2W2NP 3PYDA 3GG1A 1ILQA 4P74A 3D1QA 3ZJYC 2WAQD 4OHYA 2V9KA 2UUCQ 5DZ6A 2W7OA 1SYDA 1GAOA 3FP9A 2AWZA 1T9XA 4K50A 1X5OA 1LNQA 2XY5A 4ZVOB 3BYYB 3ONQA 5CYMA 3MFGA 2QA1A 5DM7Q 4F87A 1SC4B 3M4QA 3MR6A 1II3A 2MQNA 3D4DA 5J1NA 4JI3J 3G87A 1EEID 1PZID 3F2BA 2TSSA 4POGA 1YJ9S 1H9SB 3CJ0A 2J8SA 3IP0A 2KFZA 4M1KA 1RA6A 2GW8A 4DR5J 3TRZA 3UI2A 1XNRL 1U24A 1V1PB 4LF5Q 5E7OB 3OHBA 3VYUA 2IC3B 4TU8A 4TQSA 2FVRA 3F1ZA 4ZKAA 1KQSR 1MSWD 2JA8H 1NR2A 2VC0A 2N3LA 1XNQJ 2KTQA 1K73C 3VDYA 1EP4B 4NRUA 1HL6A 5BN5A 5HQ8A 1Q86C 4DR2J 4DFAA 1I4QA 2XO7A 2CQ2A 5IC4B 3KLWA 1OQ3A 4L5SA 4CLSA 1MMDA 2WHOA 2LQ8A 1DOKA 3GV8B 1KQSA 3E51A 4DUYQ 2UUBL 1PILA 2VDIA 3QNWB 1JLAA 3HKZE 2VHGA 3UE1A 2ES2A 1IBMJ 3TA0A 3HOUH 2FY8A 1IBLF 2R7SA 2F0HA 4WJBA 3BZKA 1HQMC 2HDMA 1JLEA 4WE1A 2NXUA 5DG7A 1IKVB 2KM8B 2OGUA 3JTNA 2FYXA 2OKQA 1WC3A 2QJ3A 2XYHB 3RW6A 4FDFA 5KFDA 4C3KA 1WEYA 3M2RA 5ELOA 1YNND 3GTLH 1N5YA 1VR6A 3TARA 1UVIA 5IP7H 1J5OA 1HNXF 5IV3A 2ADCA 4B9LA 4A3MG 3A12A 3NXZA 1F9QA 4X4RA 4BS9A 2BH2A 4PWWA 5NUCA 3BR8A 3R2CJ 4EZ9A 3G6JB 4BY7G 2HNZA 4QIWB 2FJXA 1CHPD 3ITHB 3MUTP 4YIJA 2BUNA 2EC0A 3R1LA 2FVPA 4GNXA 4YDDB 2FUG9 4KB7A 3DLHA 4KV6A 1KQGB 2M4MA 3IXQA 4A75A 4XXEA 1J5EQ 2GA7A 3D8GA 2ROPA 4JVZA 4YY3L 4A8SA 3AD8C 4KJNA 2JC1A 3MCOA 4R8UA 2MNAA 2EXZA 1NMEB 2SXLA 3WHIA 2IDLA 4OHVA 1I3OB 1S1XB 3PO3H 5E4WC 2L5TA 1R0BG 1UVMA 2ZH7A 3DM2A 1KD1T 5EX0A 1BWVA 1FT8A 2I9SA 5ELEA 3RLFA 4MTPA 3FSXA 4ZUJA 1Y1WH 4X62Q 2CFMA 3CJKB 4RBVA 1EIHA 2XSJA 3QWPA 2Y1IA 3MCMA 1EY6A 3FKIH 3CCSS 5FJ4A 4JI5J 4LF7J 1VJQA 3AEVA 1NHUA 4UOCA 1YI2A 5KFMA 3WIVA 5M2PA 2UVRA 1Y8PB 1L1OC 1EOTA 3AY0A 2V9WA 1F9HA 1N8RC 2QW7A 1O7ZA 3W61A 3NBIA 1I4HA 1QDUB 3L09A 1Y8OB 4JBJA 2JX2A 1GX6A 3I72A 4HEA9 3C2PA 3JSMA 2VPWB 1O80A 2K1RA 4I7FB 4QIFA 4U9RA 1I51B 3O1LA 2LP4A 4CLFA 1S0OA 3EGWB 5IV4A 4CI0B 3BSAA 3CMEA 3R97A 4LFBL 3R1HA 4ME3A 1A3VA 1KL9A 4KO0B 1ICFB 4B02A 3UO0A 5I2XA 1DXMA 1HI1A 1VQSA 1ZPVA 4TXSA 4QUCA 4DNTB 3D28A 1K1QA 3GSIA 3G6EA 1EY5A 3LGMA 4N9PA 4WBFA 5HLFA 4E2FB 2PMHA 5HP1B 4XPCA 1HKAA 2YKMB 4E98A 3R27A 2DNLA 1ZA1B 3DDNA 3MPDA 3UQSA 1TL4A 2Q2HA 1RACB 1EY4A 2FHTA 2HAIA 1TUGB 3ZZ0A 2ZE2A 2UXBF 1BQXA 1R8HA 1E2WA 3JAMi 1TKTB 1WHYA 3N5BA 2R7WA 3PUXA 3BVGA 2Y9HA 2B9EA 2MKJA 2ZJRA 4Y6IA 1KKHA 1JLQA 1RT6A 4RR5A 4LF9L 1KOHA 3S9WA 1XBWA 4LFAL 4ZVHA 4GRSA 1HD0A 1HNWF 4LF4J 4C3IG 1PA6A 4DV5Q 2WP8J 3PJ9A 1JB0C 1G6BA 2D9PA 1NLKL 4ERDA 4JYAQ 3GIKA 1S3OA 4DV4Q 3RRGA 3OFHA 1BD6A 2UUCJ 3PRDA 1S7HA 2M9KA 5CV6A 1Y1VG 1XMOL 4JI2F 2B6AA 5AXMA 1HR0L 4EI2A 3FEWX 2ROGA 2FFKB 3HGBA 2E5LQ 2YTYA 3P45B 3N52A 3PY8A 1H3DA 3B4DA 1M90C 2MY7A 4V19X 4JV5Q 1GMWA 4KY5A 2F0MA 4XYOA 2HGNA 4USUA 4EO6A 1YIJA 1WTQA 2ZEJA 3A8IE 3TP5A 2PI2A 4LF5J 3HOWB 1F9FA 3PUYA 3S1QB 5L1JA 3K7AB 5D0EA 2HYIB 3OUYA 4HAEA 3MTKA 2HBQB 2QGQA 2KHCA 3NS5A 2C2RA 4E6IA 4IH6A 1IWAA 1X4EA 1U4RA 3M4OB 3OVSA 2R7TA 2WINB 1IQZA 2DGOA 2ASBA 3P96A 4X2BA 5LMNW 5L8RC 1TMMA 3DCAA 1BC6A 3KK3A 3UD5A 1F9PA 1U02A 1BOSA 1FKOB 2BRLA 1R8BA 3LH2S 1B99A 2VUGA 3RBZA 4CLTA 3SGIA 1S5BD 2CA9A 4W98A 4CYUB 2LSSA 4XQNA 1FTCA 5KT7A 4DHVA 4DV0L 2HQCA 4P2MA 1SYEA 4TYBA 2L55A 5EJWA 5GADC 2EY1A 2BDOA 3D6FB 1V8QA 2K32A 1NRKA 3C6UA 5D0HA 2XMWA 3MR7A 3DRSA 2XGPA 3H91A 5C24A 2XBPA 2HLTA 3UDXA 4DGZA 3H94A 2GCFA 4C8YA 2G2OA 3H0PA 1RT3A 4KE5A 3S6EA 1J2VA 1GK8A 5GMDA 5J3BA 4CDDC 5K8OA 3VA7A 4QU6A 4HR2A 3PO4A 3CHBD 4X84A 2BE2A 5B0GA 3PGZA 4C3JG 4B3SF 2H5XA 3V81A 2YY3A 3BPDA 2CDRB 5LMUQ 5C4XH 1DTTB 2W9BB 1PGZA 4BXXG 4Y2IA 1Y5IB 2GX8A 3I96A 1FKPA 4PG7A 2KZMA 4K2LA 3RUBL 5IS2A 3DRXA 2QKIC 5AXLA 1XWEA 3RZDH 2F0IA 4C2MB 2E2HB 1C1CB 1RE1B 4HH1A 5D4NA 1UVLA 4DV3Q 1PHJA 2Z2LA 2MHEA 1J5EJ 4DV6L 5C44B 2WBRA 4YQWA 4XDDA 3LX0A 1YEZA 1W2BA 2MY8A 3MAAB 2OSQA 1HNVB 3MGJA 4M63A 1LWFA 1MMLA 1K0RA 1YITA 2DRAA 1HNZQ 2BRKA 3KK1A 3MXPA 4ZIWA 3B54A 1PH8A 2ZFHA 3UVJA 4RGTA 3U50C 4J9SA 1AB8A 2VJVA 4CDCC 5JXSA 4DBQA 2EYHA 3L3OC 1D2BA 3CUNA 1PYTA 4N41A 4RWXA 5M3FH 3I0SA 4X62J 3Q6SA 1YHAA 2YKOA 4IOAA 1D8LA 5GAGI 4X4UA 2HVZA 1BLUA 2ZH9A 2LDIA 4WWSA 4YEAA 4LBIA 5KFFA 5IM0A 1IL2A 4ZJOA 4HR7B 2LU1A 1EKSA 3SQGA 1DGSA 4X4OA 3BO2A 1TKXA 4C0BA 4WF9Q 4KKOA 1V3ZA 1VQCA 2AJQA 2HBRB 2N55A 3OR1B 2XY6A 1BKBA 1U6FA 3W2WA 3OL7A 1QUQA 1OY9A 2CKZB 3S17H 4DR6L 3F41A 2NVXB 4OX6A 1S97A 1JOOA 2HAFA 3NQTA 2M2LA 4NZ0A 4LT6A 4OGQC 4DDFA 4DUZJ 2E5IA 2OD4A 4CLYA 4DL2A 4ZPBA 1SE3A 3AJ2A 1I94L 2PQAA 4BY1G 4K2JA 2MPUA 5KT6A 2HIQA 2KO1A 2EFPA 1UEKA 2AIRB 1RAIB 1G2EA 2YKNA 1U8SA 4OZ0A 4PG8A 1AH9A 3CMES 4GKJF 4UP9A 4C0HA 3VR2A 4MN3A 3MM8A 3MMAA 1QLNA 5J2NB 1K8GA 2M52A 1IKYA 3K8VA 4M5GA 4F04B 5HURA 4DL5A 2HSEB 3W9JA 1PBAA 3NBPB 4UY8C 2IA0A 4ZJQA 4IZ8A 4ES2A 1CJVA 3K5PA 4ILWA 3G6ES 1J6QA 5I3UB 3TZDA 4RW9B 1L1OB 2HHQA 1JOKA 4J6HA 1U4BA 2R93B 3P8BB 3PV0A 1RDPD 1UE1A 4NKLA 4QZVB 3KOAA 2ZJPA 1VRTA 2I46A 2K01A 4A3BG 3MR3A 4C0OC 2BANB 1H7XA 1WOSA 2L12A 4ANCA 1FDBA 1FVSA 2CQBA 4CH7A 3GP9A 5D65A 2KH9A 1QUPA 1HWJA 3NCPA 4DV5J 1B64A 1HQUA 3AD9C 2ZM6F 1IL8A 4KPYA 4JYAJ 4OONA 4GN5A 2MFIA 1V5VA 3PEHA 3QIPB 2J6TA 4ME5A 4NLOA 1NMFA 1OPZA 1PAEX 2E7XA 1HQRD 1SE4A 4J9UE 4MK9A 1N33F 3MM5B 5LSLA 3MR5A 2ERRA 4FDBA 1ML0D 4ELVA 1O0PA 1LTLA 4HEDA 2YWFA 4LF8Q 4OZ1A 3N9UC 2PFDA 4JV5J 3KBGA 5KFPA 1STEA 2NYHA 4GS3A 2E1AA 4RW8A 5D4OA 1NUCA 4PXCA 2Z1CA 3KJPA 1RT7A 2L08A 3ZZZA 3PMFA 2XTIA 3ZTRA 3HHLD 1CKOA 4DL0C 1N56A 2WSFC 2GFFA 4ICLA 1FFWB 1NCLA 1TVRA 3CXCR 4KHMA 1YIJS 3IG1A 1O6XA 2N8NA 4OXPA 1S99A 2QLFB 1IZ6A 4NCBA 3HP3A 4EUVA 1B0VA 2P5ZX 1DTQA 2JEFA 4A3KG 3W3AA 4KSEB 3CXCA 1YHBA 5ETKA 1FK9A 3FCHA 1SQFA 2MJ8A 1FGUA 3OFGA 2C2ZB 3MOJB 2B0GA 2Z4HA 4DPUA 2B7CB 2YTCA 3UD4P 4KKTA 4J7CA 3AFGA 2KJWA 2R2SA 5GAHI 3V6KA 2JWNA 1UETA 1HTLD 3F56A 3GFZA 4M8LA 5M5XB 3GU0A 2Y0SE 3JC66 2DNCA 1HWIA 3IM8A 2VB2X 1RU2A 3K58A 2GO9A 2OI2A 3BGRB 1DLOA 1T3OA 4ZK7M 4K4SA 4YR0A 3M05A 1N52B 2VG7B 1P1TA 2YNGB 5GROA 2FY1A 2F0TA 5LMUJ 1Q16B 4WU3A 2FJVA 2GHPA 1D1IA 4P6QA 2V8DA 3A3NB 4C1NK 3EVQA 1BNZA 1S1VB 5HJYA 2RS2A 2BQRA 3Q86A 4HIOA 4RCOA 4I65A 1HHVA 3FKBA 4KT0C 2NREA 1KTQA 2CG4A 1XR6A 1Q7LB 1VF7A 4RGNA 1A9NB 4O23A 3KJVA 2MKKA 2BMBA 2YNFB 1VBXA 2IY5B 3TQ1A 2YNIB 3HX9A 3S14H 1SV5B 4C8KA 1HNZJ 2J9CA 3M8PB 4R8NA 4ZVGA 1X60A 2ZH8A 1U4LA 2HQ3A 4RNOA 4YCWA 3RRHA 3ILOA 3EGVA 4B3ML 4F0MA 1YITS 1NJYA 4GKKF 3CCTA 3T5HA 2PI2E 2QA4G 3W65A 1QOHA 4WORA 1UWAA 2DH9A 5F8LA 4URQU 4DX5A 5D77A 2H4OA 1FRXA 2AUJD 3T1HF 4OX9Q 4RNMA 4X3TA 5FIIA 4CTAB 1YDLA 3LOUA 4BBYA 2UXCQ 1NHKL 2XCPA 1H72C 3BQ2A 2XWYA 1JT8A 3MECB 2DH7A 2ATCB 1OYDA 4PABA 2D74B 4OEMB 3G82B 1B3AA 3EQLC 1STBA 4PKDB 3NXWA 3IRXA 1CUKA 2ZTEA 2Z0SA 1WD0A 4DR3Q 5KFJA 3BDPA 4KHPJ 3STBC 4JI4L 1MU2A 1I5OB 1HZCA 3PW7A 1E0BA 1EIGA 2IWHA 4I2QB 3GV5B 5F8MA 2HQGA 3PJWA 2IJFA 1Y7PA 4OQJA 2CNOB 5KYLA 2VZ9A 1R4PB 4RCNA 2ZZMA 3LP1A 2JA7B 1OY6A 1X65A 2L11A 5I2YA 1SH0A 4YCVA 4U67Q 1JNZB 3RRKA 4ZPAA 1EEFD 2HHVA 3R2DJ 1AFJA 4JV1A 1VCTA 2ATWA 1JMCA 1STAA 5KFXA 3UDGA 2QMWA 2V6AA 1DM0B 4BBRH 1M1HA 4FYDA 3J80E 1VQOA 1A6LA 2FC9A 1F9RA 4Q8FA 4ELTA 2F3IA 3PW2A 2J0TD 3HHDA 4A3MB 4MTNA 3MEEA 4ECWA 1GUTA 4MKVA 2CZVC 4CKEA 3HVTB 1TL1B 1WHXA 4JI8J 4F25A 4YB5A 2A5HA 3P4UB 3V5RA 1B44D 3GYXB 1ZS6A 2RQMA 1NTGA 5CORA 2EI5A 4DN0A 5C42B 3VGSA 3HOWH 1XR7A 2IL8A 1FHTA 2XYPB 3S1QH 3K7AH 2YTXA 3U02A 4NLRA 2LXIA 1LLRD 1NPRA 4AYBE 2KXHA 5HQLA 2IHFA 4YS2A 4P2CB 3DLGA 2E44A 1UPMB 3OSOA 3J81i 5CH7B 2AGQA 3KYHC 4QF4A 5ETRA 1Q5YA 4AE5A 4DV1Q 5F41A 1JKHB 3A8JA 4RKBA 4XIGS 2K5WA 2XMUA 2B4VA 5B09A 3D6CA 3J80Y 2AQ2B 3THVA 3DEPA 2V4JA 1IVZA 1RUSA 4RBUA 1NK9A 1T9UA 1W25A 4PUOB 4HVZA 1RHQB 1SVDA 3JTPA 1ZBTA 5E41A 2QL9B 2H5EA 5L37A 2PPBC 1NXIA 5G4DA 3MOZA 4MK8A 3TW0A 3W63A 2NYIA 3J80L 2Z30B 8ATCB 4F4YA 3OOCA 4WRDA 2XTJP 5AJ3L 2IRUA 4ER8A 1NBEB 3C14A 4R4OA 2MZ1A 1GNKA 4RPFA 1MWYA 4CT9A 1ZM4A 4NMXA 1TK0A 3MXGA 2QSFA 2HIVA 3JQKA 3H5UA 2HWIA 4ECVA 3AB2B 4CDFC 2XRQD 2GQ2A 4A3DH 2B8QA 2DR9A 1U0LA 4LRFA 4YHHJ 4N56A 1SC1B 4OJ1A 3LWEA 3KLIB 3DYAB 4C2MH 3PJXA 2OHDA 3CD6A 5C44H 5GADI 1UVNA 1M5HA 2H51B 4OHWA 2B2WC 1PH2A 1KOOA 1XNRQ 2DJFC 2MKSA 4X65F 2M70A 3QQCD 4LFCL 2CAJA 4NCAA 5AT1B 2MYFA 2NXJA 4IOCQ 4CDEC 2HMIA 1KHVA 4NXNL 1Y5NB 1FX4A 4YFUA 3L9AX 2GZOA 2HNYA 2UU9F 3M2UB 1UEBA 3S24A 1T94A 3N6MA 3UDVA 3PYEA 2M00A 4LREA 4DL3A 1D9DA 2I6WA 4A3EH 4JI0Q 1Q8LA 1LTRD 2D3ZA 2IVMA 1TWCH 3I4MH 3IGNA 2RSNA 4PG6A 3L95X 4WP9A 2HWHA 1TR5A 1FWPA 1RP5A 4CO5A 3PIP3 2BKPA 1D5XC 2WTFA 2BCOA 1R4QB 2C1EB 4ZP9A 2JOQA 2GHVC 1N32F 1Y1VB 3VAIA 1J8IA 1PDQA 2KYZA 2NVXH 3E0JA 4AT1B 4EWTA 3M6VA 1WTWA 4BBSB 5BN3A 2ZKTA 2KI2A 4NW2A 4ED6A 3NPPA 2RKSA 2A10A 2QLJB 1KRTA 2ZOFA 1N36F 1B3QA 2VF3A 4UDUC 2QDLA 1SJFA 3HSZA 4FXKC 2GVZA 5ETTA 1XC9A 2FLNA 2F0PA 2VASA 3FCVA 4RMFA 2ASDA 3I87A 4C7QA 4OX9J 3RAMA 1NPKA 3W2VB 1IKWB 3QJLA 1V3RA 5AXNA 2HVHA 4NPSA 3VGUA 1OJ4A 3I90A 3GE9A 5DGBA 2V68A 2UXDF 1MROA 2DHHA 5DJBA 4Y2AA 3M8YA 2AEFA 2UZAA 3FK4A 1GXDC 2WW4A 2F4VF 4X66Q 1S9GB 2RVJA 2GGPB 4NASA 4OWWB 1D6EC 3BEGB 4OV6A 4N47A 4B9UA 1R3NA 3F73A 2DCUB 4NX9A 2Z9HA 2OPSB 1S5FD 5M2UA 2LVWA 5GAGU 1VQGA 4KK7A 5ELFA 2VW9A 5LXRA 2N7YA 1WF1A 3L7UA 1ZXTA 3HFVA 3R5BA 1B0TA 4CJ2C 5CV5A 5IWAQ 4O4GB 1HPCA 4OFZA 3G48A 2EFOA 4ZVRB 3EGZA 3RLNA 1WJJA 2XN9C 3CJKA 1GTHA 2BM0A 3J81j 3M4XA 2HHTA 5FLMH 4BLGA 3ENAA 4FF4A 3V2TA 1PZKD 1NSQA 2AD9A 1TS2A 1WWHA 1AUSL 2LMIA 4FP5D 5K36G 2BQUA 1DZ5A 1SYFA 3KLSA 3MZIA 2EJMA 1U0SA 2LQ5A 2LXUA 1Q1EA 2KEDA 4C3JB 4QJVA 4OX8A 3DLLQ 3T1YQ 1GTEA 1T9VA 1LW2B 1HA6A 1JXLA 2AJ2A 3DLKA 4N9TA 1UVJA 3CULA 4J37A 2EDGA 3DM1A 1HNIA 2PFFB 3PQIA 4QJFA 5DDPC 2EC2A 2VKZG 3IFTA 1PH1A 1QVFR 4DSJA 3QBCA 1X4HA 4CGYB 3KKFA 1URNA 4YR2A 2F40A 4GZYC 1UL3A 2QZ8A 3H59A 4WPAA 4ED1A 1UE5A 5DDRC 3HOXG 1M5VC 3K7RA 4DV1J 2HZAA 1VDZA 2V2VA 1PSDA 5TSSA 5JUMA 4K0KL 4X4NA 3CJ8A 2AW0A 2ZZTA 4HACB 1TKTA 2H65B 1R89A 2DGWA 3E6ZX 4PEOA 4Q43A 1ZZNA 4HSVA 2W24A 4HTIA 4H44C 3MWYW 3ULPA 3A5ZB 4KD3A 2GN5A 2D0OA 3CO0P 5C7PA 2WVEA 1Q0NA 3BKFA 4LF9Q 4BWJA 4PG3A 5HMYA 4AQYF 1IM6A 2CNNB 2JEIA 3LTOA 3GB0A 3IS9A 2EPBA 3V96A 1UTAA 3V2UC 3DUZA 2TMPA 2H1EA 5HBMB 1H7WA 3KLGB 1HMVA 2V67A 4TU7A 3SCJE 4IDKB 2XS7A 3QGHA 3OHXC 4A4JA 1KC8T 4GNXC 2IJNA 5ETOA 4A8XA 1Y11A 1NKCA 3VALA 1NJIT 3RBXA 3MMBB 3SK5A 2E1MC 3PRBA 4FYWB 1MN9A 2CNKB 5J1ZA 5IT9U 2WONA 4PWDB 1TWHH 4BY1B 4DSIA 2ID0A 4R4IA 4V1Ak 1J9OA 4NLWA 3DU6A 3UNYA 2ILZA 1G291 4HH0A 5BXIA 2N7CA 5LL6X 1CBKA 2UXBL 1WCMG 4TKOB 1UKUA 4UQGA 1MLAA 2E2DC 1F9EB 2QLXA 2WACA 2IJRA 5EBDA 2NSBA 1VRUA 2F7VA 1XNRJ 3CD6S 1FJGQ 4RW7B 1UWBB 2DGXA 4DSFA 2XWXA 1RT2B 1CKNB 2FMCA 1PZJD 4IG0A 1UEAB 5CZVA 3D54A 3U4ZA 1YSJA 2OLWA 2IM3A 2R2TA 4GO7X 1HBUB 2VNUD 2B2YA 4KGVB 4LF7F 1UJ6A 4NDXA 3SVMA 4B3OB 1HBOB 3ZTPA 2MTLA 2FGCA 3FVQA 1E6YB 2VOOA 4C6AA 5GAHU 3MI7X 5CCLA 2UUBJ 4AL7A 1Y9OA 1EIYB 5ADZA 4HIKA 2AUKA 2HFSA 1FWLA 4AUKA 2XO6A 1LV9A 1GFWB 1VQAA 3QT8A 3A54A 2OQ0A 3A8JE 2HVDA 3W64A 2ZH2A 3H0GG 4OYMA 2E1CA 1Q46A 4DQSA 2J0XA 1EU4A 2MLYA 4PWUA 4JI7Q 3QLHA 3M8QB 2LFVA 1CZWA 4JBCA 2IW3A 3OL8A 1S5CD 4CDIA 4WFBQ 3HRZC 1VQFA 5HQMA 1RJTA 2FHOB 3POTB 1TQLA 4ZCLA 5DG8A 2JA7H 4F4WA 3U1NA 2R7FA 3QSIA 2NPFA 3W9HA 1FRHA 5DO2A 2ZXPA 2LS01 3GD7A 2EY2A 3MMCB 4GC6A 2AQ1B 1IXRA 1NB7A 2KJXA 3LGNA 2AJ4A 4ZPVR 3BDEA 1C1CA 1XIQA 4BS2A 2Z58B 3TEHB 5F3ZA 1O51A 1TP7A 4GN4B 1KAWA 5M9OA 3D0HE 4A3MH 4PQUA 4DR4F 2RDIA 2R7XA 5KIXA 2A68C 4BA1I 5I42B 5KOXA 4YY3J 3OXFA 4DPXA 2VQEF 3BZQA 4OI6A 3K8AA 4DV2F 3K57A 1E2VA 2CW0C 4A3KB 2XRSD 2WZ1A 4A3JG 4CRJA 2B5JA 4ENOA 5C5LA 4C48A 2XEXA 5IWAJ 2FJAB 5HANA 4CZCA 5B0DA 1YRUA 2RDHA 1PLFA 2IRXA 4DF8A 4I2PB 1SQGA 4OJHA 4I4BA 4B3SL 4Q7AA 3CCRS 5DRKA 4DAVA 1LWEA 1YBAA 5E0OA 1QB5D 4ECXA 2HHHQ 4UT4A 1U7LA 4A4IA 1BQNB 4CJ1B 2RJZA 2ZWOA 1KLMA 1V9PA 2AJFE 3TUIC 3GFXA 5A8RB 2L3MA 3J80c 5DG9A 3Q8VA 3BVZA 2PNRC 2ZNYA 4X64Q 2F3VA 1A0IA 1N4LA 3PO2H 3H15A 1UW4A 3HM9A 3D68A 3HF5A 1SMXA 3DLEA 2J7ZA 2RSOA 3MWBA 4ZHRB 5JEAJ 1EETB 2V2KA 4USKA 5EBCA 2J0QD 1P6TA 1LT3D 3JAMU 1WC6A 2O67A 1HPZB 4LFBJ 1ZPWX 4IPDA 3BN4A 2E74C 4Q44A 2PDAA 5KG6A 2Y0BB 4DUYF 4B9WA 2FC8A 2PN6A 2YQ1A 2RA4A 2E2JH 4ZLPA 5H9EK 5J2NA 2N49A 3D3CJ 4L73A 1Q7YC 1RWMB 3TEGA 5KFSA 1WI6A 3NBPA 3TDQA 4HKQA 1XMQQ 4FVCA 1TS3A 2DIVA 5HMXA 5CYMB 4QIWE 1AFPA 4DL4A 3GTKB 1Y8NB 1QVGR 1L3VA 4NYZA 3UDCA 3IBWA 3CDUA 4KLKA 2DHGA 2MSTA 1G4CA 3GTJH 3H7HB 4RWWA 4CO1A 4QPXA 4MZ9A 1MWZA 3IO1A 2KBNA 1ZM2A 1NAQA 2PW5A 2LEBA 4I67A 1CKMA 4IUQA 1Q8BA 3NUCA 4O3SA 1BCPC 3L7OA 1RBOB 1TAUA 1RWUA 4KYZA 4A3FG 2M9VA 5T7LA 2C42A 3J7AN 1SNOA 4F8MA 1NKEA 1WOOA 4E8UA 4LF9J 4YCUA 1BUVT 4LFAJ 3K5NA 1JXVA 3GIJA 4OHJA 4Y0FA 2XNQA 4CWBA 2KL8A 2VQFQ 2LQ9A 2ALYB 3R3OA 4WFXA 2J8AA 3IWLA 3Q8UA 4IRKA 3P1HA 4FF2A 4W90B 3PACA 3CMQA 3DEOA 3GJRB 2OPRA 4GKJL 2QV6A 2CVRA 3W8GA 1EZZB 1JLAB 1HR0J 1Q82C 5KRUA 4NA3A 5E33A 7AT1B 4G6VB 3M8WA 1Q12A 4K4YA 4B9MA 2GA4B 3H09A 3I4OA 2B4UA 4OELB 1HWLA 1RIPA 1B0PA 1JLEB 4NLPA 1BGXT 2FD2A 3CIZA 3T6JA 3EPIA 3AQPA 1RWWB 1Z4UA 4AL6A 4XDCA 3A8KA 5DETA 1SPBP 2XI2A 1KWMA 1SJHD 2YTVA 1VFJA 1K8MA 3CP0A 4LK1C 3CE8A 1RL2A 2Q2IA 3V4IA 1FJGJ 1I3QH 1SFOH 1RAEB 4BBSH 3TS0A 1SL2A 3J7ZC 2DNRA 1FL0A 1KDCA 4NE9C 1VS0A 1FEEA 4MAKA 2HNZB 2VKRA 2L41A 3T5LA 1FJCA 1TWAB 4HMIA 3RNUA 2G2ZA 5E3RA 1X4GA 3AQQA 4GNXB 1QUVA 3S2HB 1IYVA 3PR5B 3KLHA 2CQIA 2V4DA 1ASYA 4DF7A 2ZC4A 4KPCA 1N33L 3PXGa 1S77D 3VR1A 3RN2A 3GYNA 3ELHA 2EBGA 4A3GG 1OXSC 1N5VA 2Q2UA 1J27A 1WTHA 1JJ4A 5D3IB 1M5KC 2FHJD 2JA6G 4M95A 1Y3JA 4DV0J 1L3TA 3IKJA 1GHKA 4D3GA 1JLGA 1H73A 3DWPA 2MLXA 1JOQA 3NLCA 1S6OA 2UUAQ 1WHVA 2AZ3A 3LALA 2RUGA 3DI6B 2RF4A 4JI7J 1QM9A 3HEJA 2IBKA 5C25B 3RB4A 1KDAA 3NGUA 1A2TA 4USMA 3DM2B 4V190 1L5UA 3D6WA 1OXUA 2MKCA 3HHNB 1F2MA 1BDOA 5E7NA 2PT0A 2QE5A 4YB1P 4NXMF 2XSJB 5FO7B 2QGFB 2CWAA 1TKDA 3D6HB 1WNEA 3M6XA 2UV8A 1CA6A 3FEXB 1U09A 4ECSA 1P27B 3HOYG 4Q8EA 4U8YA 2KECA 2ZJQQ 2PEBA 3CW2C 1SNPA 3QB3A 1UA1A 4DV6J 3OW2R 5ETQA 3JSMB 1DURA 3ZC4A 2K1RB 3EYZA 2HRYA 3UFCX 2V2ZA 3CGIA 4ES1A 2DGVA 4LMZA 2F0NA 1K0VA 2KEEA 4JYAF 5JPNC 2B4OA 4DV4F 2A6OA 1QTMA 2OWOA 2Y1LB 3MTJA 3S2DB 3CD5A 4QIEA 3CF5Q 2PSZA 1XMOF 2CQCA 4DS4A 4B3MQ 4JBKA 4FF3A 1C7YA 4P7VA 3S8SA 3SR1A 1XERA 1KIXA 2VA3A 2ICEC 2UUTA 2E5LF 3QR8A 5HLFB 2YYZA 4HHHA 3MUVP 5GQOA 3OMCA 4B3TF 2JEAI 2O1PA 4H4MB 2J4XA 5HI7A 3MECA 1UVKA 1DONA 2BM1A 2ZITA 3OTOQ 1VJWA 3G82A 4LIRA 4IPGA 2NXCA 1HQEA 1VLOA 1ENAA 5DQHA 1RYRA 1CVJA 2ZE2B 7FD1A 3TYTA 1WOPA 2R8IA 4O0NA 4X64J 3KHHA 4QBUA 2ZBIA 1GUGA 3OPOA 4EYIB 3GO5A 1RT6B 1TKWB 3E9IA 1RHJB 3LP0A 2DO0A 1YTYA 2K5DA 2NN6G 5CYUA 2BOPA 1I94J 2BA1A 1K83B 4FXWA 2PZTA 4A3LG 2HFZA 5FLXU 2K7KA 3LWLA 2PZWA 5HGQA 4OYZA 3SFUA 2DR5A 3P5TL 4M5NA 3NY0A 1JK9B 5FJ8G 5C5JA 2LKVA 4Z9CB 5LXYA 2B6AB 2NN6I 3WDNA 2ICIA 4OV1A 3OFEA 4LF6Q 1XMQJ 4QWEA 1N5SA 1Q1KA 3HKZD 4OJ3A 2I07B 5KFWA 3I55A 3VGVA 1BWEA 4YB7A 3NTHA 1S5ZA 5C4HA 2HIXA 4ZN3A 1YJ7A 3P6YC 5HY6A 4ILRA 3A56A 1OWXA 2V8PA 1XYIA 3DGPB 4IFYA 3TUZC 2I5LX 1DAXA 1ESFA 2HHPA 3I5AA 2BX6A 3V6DB 5C42A 2IHR1 4L75A 4KGMA 3MC0B 3OL9A 4C3HH 5KT4A 1KNZA 2CKWA 2KOLA 2FJBB 2LKZA 3R5AA 1A7GE 1F2YA 3VVTA 3BPSP 4XDXA 3CNQP 3OUYB 1HUMA 2XMTA 5H9EJ 2HS0A 1FR3A 1EUJA 3R5GA 3STBD 2R8KA 2IDEA 1EY9A 1CA5A 4HHJA 3Q8QB 3TAPA 2OPPA 3LW5C 4OWTB 2WB1G 4DV3F 1SROA 3U9SA 2E2IB 3BH7B 5D8HB 1WC1A 5IGDA 1N34Q 1XN9A 3RYLA 5JOBA 4GLVB 1C0TA 2BDPA 1RHKB 1PH7A 3I82A 4Q2LA 1H0HB 2NBFA 3DRSB 5C24B 2VUMB 1PMRA 3D5MA 2EBEA 1SMYC 5BR8Q 1YNJC 1KDBA 4J9QA 2JJ4D 1RT3B 2F0VA 4JV2A 1K0TA 2EYMA 2JEBI 2AKWB 2W25A 2FGOA 2B63G 4UP8A 4ECRA 5C4JB 1K8AT 3QWUA 2W2MP 2LFNA 2SDFA 4LAAA 2BE2B 2GIRA 3BSNA 3HOZB 1MSGA 2BOAA 3TX0A 3V81B 4QCLA 3PIOA 3V6JA 3OPKA 4HSPA 2CJQA 3Q8RB 2Q8RE 2C3MA 4PG5A 2DGUA 1M1KT 2MSSA 2R92H 3GWCA 2DEIA 1VQNS 2H1YA 4K4TA 3MFYA 4NB3A 5LMNQ 4DR6F 2R42A 5KFBA 5I4DA 4QWBA 4ID5A 2ZDPA 1A6XA 1CS4A 4U6PA 4M5DA 3DLBA 3LUYA 1C4AA 5IYDG 3KUPA 5KG3A 2I0XA 4AYBB 3EGNA 1LWFB 1HLWA 1GXLA 1YG0A 3QSYB 3OV7A 4NZ7A 3K8WA 4B3RQ 1FDAA 2QMXA 3MD1A 1S72A 3GDEA 2UUAJ 4KKSA 4A3KH 3FGVA 5IYBG 1NK7A 2POKA 3UVJB 1EWCA 1V6HA 3E3XA 1U8WA 3SDEB 1ICEB 5CR3A 3M6UA 3KLEA 1CLFA 3DKDA 4G1QB 2K75A 2CJKA 1HQ2A 1NZAA 2FQQB 1RA7A 2C3OA 3I0SB 2DPIA 2X1AA 4ZLJA 3WZ0A 3NE5B 1UMJA 3B82A 2HD3A 4ZCKA 1MNEA 1RCOB 3E01A 2DNOA 3IFDA 1NNDA 1GXUA 1RADB 2WAQG 5IM0B 1BQMA 3SQGB 3NCRA 5F8GA 4F2RA 2VJUA 1UJ4A 4KKOB 1YZ7A 1V1QA 2VG5A 3EXYA 3ZZRA 1NSNS 5CCMA 2Z2YB 5C3EB 4ED5A 1X9NA 2E76C 2HFOA 3W2WB 4IRCA 1QUQB 2PNHA 2NVYB 3GTOB 2FLOA 5L9XA 2LECA 1RBLA 1JR0D 2HCCA 1GJXA 3ETOA 3HK2A 5CYQA 4A48A 3TWZA 1YJTA 4CO2A 3SK4A 3UCZP 2QMUB 2YPYA 4DFKA 2GJIA 3QT7A 3WQPA 2Q6BA 3S1NH 4X65L 3MF5A 3A8KE 2Y8WA 2OPQA 3GILA 3CCLA 2N4DA 1QZHA 3EDRB 1JX4A 2IMWP 4B3MJ 3V6HA 3EROA 2E5HA 4ZAIA 1WCMB 1PFNA 2F0QA 1AEXA 1EQMA 5J39A 3MM8B 1RTDA 1BBUA 5CQGA 3K80C 2EIFA 3D9BA 5KFNA 4O2DA 4LF8F 2RMLA 1BVSA 1Y00A 4LVNP 3OTOJ 1F9SA 1CJVB 5DAUA 5IYCH 2I5MX 2XCAA 5M5YH 2V5HG 4OZ5A 1E22A 4RAUC 3T1AA 2D3O1 2I2YA 1X3EA 1IBLQ 2EQSA 3DM3A 1M0SA 1ESRA 2NB0A 3VAKA 2OPSA 4EVOA 5FOBB 1N32L 4CH1A 3SMZA 2YWGA 3M4PA 5JVG3 1Y69U 1BXTA 3D6MB 2DBBA 3UI3A 2NUHA 4TYAA 2QF7A 5E3FA 2EKYA 3FC9A 4K5WA 4NLDA 2BJDA 1FRJA 2AMCB 2XZWA 1HQUB 4DXLA 1K28A 3Q8DA 1N36L 2VV5A 3AODA 3C66A 2HK3A 4HMJA 1HNXQ 2WB4A 3J7A1 1E6VB 3KUEA 2HHSA 3DOMB 1L2FA 3CCWA 4IUNA 1ZYQA 4O44A 2IM0A 2W1BA 3TMEA 2ATLA 5I6YA 1D3WA 2RIJA 4IO1A 4U7UK 4X4SA 4NPOA 1Q1BA 1Q81C 4A8KA 3J81U 3IWXA 1HI8A 3LQVA 1UEVA 4DFPA 4RW8B 2UXDL 3W1BA 4PV1C 3CT9A 3PX6A 3I55S 4QQBA 1DRZA 2F4VL 1RT7B 1REVA 1JLFA 4DR7L 4DG1A 1IBKL 4N8NA 3MXNA 2Z6BA 1FNWA 5CV8A 4ICLB 2ZKUA 2V50A 1LYLA 3OFFA 1HR0W 4A3CH 3E2EA 3T4AC 1MHWC 4F0HA 3IG1B 1XEZA 1U1QA 4JUZA 5BJRA 2C35B 1TL5A 5LHY1 4TSSA 4BA2I 2O2LD 4ZVFA 3I73A 3URYA 1YJ9A 3M8ZA 3MAHA 3FVYA 3F44A 1TWAH 1SH2A 2VFTA 2B2VA 4A3JB 4QL5A 3K6OA 2E9RX 5JJZA 4JI3Q 1FK9B 1VBZA 4IQXA 2JA8G 3EVOA 2ZZNA 1SLJA 2MQQA 1C4QA 1N34J 4O3QA 3W9IA 2BACA 2K14A 3QOLA 1R31A 4DR5L 2RE1A 1IBCB 1ASZA 3NBHA 1WSVA 2B3GA 1FXRA 2O01C 3P49B 1CSQA 2JL9A 4LR9A 1XNQQ 3JYTA 1PYSB 1X7VA 4EEYA 3D6TB 2DGQA 4Y65A 3HOUG 3EE3A 5F9LA 5AJ3J 1U4MA 3NELA 1CM9A 5HBMA 4DR2L 1DLOB 4NLTA 3MTSA 2J5AA 3AOAA 1L3KA 2R6GA 2Z6KA 2I8EA 3PR4A 2CQ3A 4E0DA 3UN2A 1KRSA 1OY8A 1NPPA 2UXCF 3DXBA 2V8VA 3S1MH 3VYTA 2Z8QA 1XJWB 3EWGA 4DK6C 1RTZA 4DSKA 2BJ9A 3N6LA 1TWFB 1WOCA 2W8LA 7FDRA 4ECUA 2NTTA 2H9ZA 5IP7G 3W1GA 5LMNJ 4DR3F 2IX3A 4CLLA 3GIMA 4LSZB 1T11A 2M0GB 2H4YB 2UXBQ 3PDNA 4IJHA 4RW7A 3MEDA 3NMAA 4EBDA 1TL3A 2G0JA 4ANDA 2UVWA 2RDGA 4YDXA 5D4LA 4F2SA 1SXLA 3S2DH 1S72S 1HNWQ 1NDLA 3Q22A 2ENBA 1WACA 3ZZTA 3PO5A 1B70B 4DMZA 1LTBD 3OVBA 4ITSA 4RG1A 1OIAA 4DI6A 3W5XA 1FD2A 3LP2A 2R7QA 3CPWR 3PO3G 4KHVA 1YBUA 4K5XA 4JI2Q 3U1MA 3HPOA 3R6LB 4OYWA 3HSGA 2BQ3A 2OF1A 3CJSA 5CV4A 5KFKA 2B2TA 2EJFC 3IRXB 3NL0A 1Y1WG 1FRMA 1NH7A 3ZZYA 2D1CA 1S1WA 2FXQA 4WYLA 1SKRA 2M2BA 3K17A 3FKIG 3HOVH 2DHSA 2VFRA 4PG4A 1Z2LA 3TP6A 2F5GA 2XNRA 3VR4A 4NLQA 4WJ4A 3POTA 3T41A 4QR0A 2NZHA 1FWKA 3PSIA 3K89A 4OI2A 1WORA 2HNDA 1AXQA 4JI5Q 3IL8A 4DK1A 4LF7L 3I56A 1K9MT 2QN6B 5IOCA 1T3NA 2Q3PA 3MEFA 2YKAA 3GJTB 1B7FA 1PC5A 4IFDH 1AROP 2VFUA 2LQBA 1LACA 3P3DA 4LRCA 3KG1A 3H5XA 3MEEB 1OXTA 2NTSA 1DZ1A 3PW0A 3TVKA 4OIJA 4MKAA 1H74A 5HGTA 1IBLJ 4OI0A 1BUXA 5I9OA 3WC0A 3S7RA 1UEUA 1ZZFA 3M2VA 2NQPA 2JVRA 4YWMA 4DZDA 2W9CA 2AQ4A 3HJFA 4A3GB 1HZAA 2P5VA 1PVOA 3PM9A 3DLGB 4IOBA 1TU0B 1UE7A 1EIFA 1HFNA 3J7YI 3SQOP 5E2QA 1HNXJ 4CO0A 2I5HA 2XS2A 1JWUD 2M8HA 1BQNA 1L0XB 3KNAA 2PIIA 3QRQA 2DY8A 3AFPA 3EZ5A 2F1FA 5L38A 2H4WB 2K5QA 1Q95G 1ILPA 2F4FA 4USTA 2CQAA 2V4JB 3M7GA 2HS3A 2A3JA 4XYQA 1S4FA 2HT1A 1F5BA 2UUWA 3QPIA 2CDQA 1TMJA 2JXMB 3PUVA 4POFA 1XQIA 2VPZB 4H54A 4DR4L 3WDOA 2GJ2A 4LFCF 2KVQE 2QFIA 3LA0A 3MZ5A 2B3TB 3N79A 4C8OA 1RTIA 2VUMH 3CJRA 2R3ZA 2ZC3A 4NXNF 1FJ7A 3N0VA 2UV8G 4EQNA 4USWA 4LF4L 4G7ZC 3HOYB 4K8RA 4RFBA 3C14B 2MZQA 2OELA 2A68D 4ZVUB 4M5KA 4DCPB 4GC7A 4J8QA 2EOTA 1LK7A 1RHUB 3E8OA 2B2YC 2CZ9A 3MA2B 5C4JH 2UUCL 1ENFA 3HOZH 4XT1B 4RWSC 2CW0D 3K2YA 4KHRA 4JI0F 2V8GA 2QTWA 4HJ8A 5HVHA 1UPPA 4JI6F 1KONA 2AZ1A 1Q78A 2R7ZH 5A76A 2ASYA 1S7IA 2MHVA 5CYJA 1QJHA 4FNFA 2B2UA 3VYRA 2XM3A 2QA4A 2RU3A 2D7SA 2D5DA 1R9TH 1WHWA 1FD8A 4DNRB 4JG2A 4G65A 2WVCA 5LL6S 4FS2A 5IQ6A 1LM0A 5L1IA 3THPA 5DDOC 4MHEA 3QO9A 1PJ7A 2FIUA 3FPUB 4LWCA 4URSA 3C8YA 2AEJA 1S1UA 3OTEA 5M3MB 4DNIA 1D0EA 2CJ9A 2KCNA 4P52A 3I4NH 1GMWD 1H6KX 2F0OA 2HMIB 3TSSA 1N0VC 2J9EA 4FN5A 3IR6B 3VA5A 2YH0A 4H4KA 2HNYB 5GVQA 3OBIA 1CJUA 1EU3A 1HI0P 1E7ZA 4RUBA 4DUYL 3OXGA 4EX5A 3S1RH 4NI2A 4H7BA 5H9FK 4J15A 1YRTA 3NQIA 4GKJQ 2QFJA 1E3PA 1WI8A 3FSIA 4K5VA 2ZD1A 4F02A 2D41A 4KGXB 3C46A 4IN3A 4X66F 1SYGA 2Z4PA 3CO9A 3PVXA 4OLPA 4DSLA 5C3EH 1ZTWA 1ET6A 4KFBA 5KEEA 3A74A 1TFWA 5C4XG 5KT3A 1YJRA 1HFEL 3I8ZA 1FTRA 4IG3A 2UXBJ 3KK7A 3GTQB 4WFN3 2XYGB 4N76A 1Q8KA 2FINB 4CP5A 4HIDA 2HZVA 3NGSA 4Y28C 1X4CA 4ECQA 2M7SA 2IAJA 1BCPD 2GVZB 1RWPB 4P75A 1HNWJ 4ALZA 2CFXA 2C3PA 2ZM6Q 1GQEA 3BS9A 2FVCA 3W5ZA 1I6JA 2VZAA 4J5OA 3KF8B 1BBXC 3AFQA 1DJ0A 1S59A 3I70A 4N8FA 3M9MB 3QATA 4JI2J 2GAHC 3T1YF 3D7SB 5HSPA 5EX3A 2P9CA 2VL6A 1MROB 4OZLA 4ZRZA 2JLGA 5M3FG 4KY3A 1NB2A 3U58A 4OWXB 1LQ9A 5JMNA 2CHBD 3IN5A 1RTJA 3M7VA 1PYWD 2E7WA 1JLCB 2EYFA 2JJQA 3DI6A 3ILJA 2XZDB 2WB1B 5F8IA 3DRPA 5C25A 3QT6A 2K2PA 2RQ4A 1R6YA 4EBCA 4URGA 1PRTC 5FKAC 4Y52H 3MEGA 4MH8A 2D3UA 4W4MA 3HO1A 5HVFA 2K3KA 1ZH5A 1B9NA 1KVJA 4AYBD 2CWPA 4DAPA 2HKEA 1JNRB 4IALA 4MYUA 2DGSA 4X62L 1R27B 2YV5A 3R9LA 2HFNA 5J2QA 2OO4A 4LJZC 2RCNA 4K0KF 4K14A 3DRRA 3I7FA 1STHA 2F0EA 1HW8A 4L3KA 4L6V3 1NJZA 1HFGA 1ZA2B 2KXNB 1U1KA 3KXDA 4A3IB 4AIMA 3HZEA 3VQTA 2QT7A 2IM1A 1EFWA 3I56S 2MZRA 3GFYA 2CZ4A 3PRVA 3CMAA 1SJED 4L3NA 4DUZQ 4WFYA 2QEJC 2V1CC 2K06A 2L9DA 1A3UA 4ZVPB 3DLKB 1CQVA 1CPZA 1KP6A 1FCAA 1HNIB 3ERQA 4RJVA 2QC3A 3ZNJ1 3CJTA 4JI1F 1DHMA 3TP2A 3PHEA 1KVKA 2WVBA 2XLKA 4DEZA 3GTMB 4ZKBB 2LXJA 4XQJA 4JB8B 1WUUA 4FKXA 1AZPA 3TUPA 1Y14B 1RABB 3GTPB 1G1XA 4H4MA 1QNKA 5JVH3 5M2RA 5KFCA 3ENWA 4NXML 4DK0A 5KFGA 3GV7B 3FRYA 2RDFA 4HCEA 2BE5C 1XTZA 1WELA 3ENVA 1SC6A 4A3JH 1VMBA 4WFZA 4IQZA 2YWHA 3KG4A 2NUCA 1G91A 2BVZA 4RW4A 5CXTA 2DEJA 2A0FB 5D0RA 1KAAA 1CSJA 3KLSX 2EEYA 2F0FA 1S48A 3G71A 2VB6A 3K59A 1U4PA 3V05A 3W8PA 4F67A 3KLVA 4DR1F 1OPIA 4OIKA 2W2OP 1NHVA 2BXJA 1AE3A 5AE3A 2JA5B 3ISNC 4DV5L 3VZIA 1STYA 2HVEA 4JYAL 2B9XA 5IP9H 2AWOA 4DV4L 3IS9B 3SV3A 3GPAA 1T5XD 2R61A 1F3FA 1VI7A 3I9V9 4Q45A 1HMVB 2HK2A 4HDHA 1EB0A 4NMLA 5KFTA 4A8OA 1SL1A 2IPOB 5CHCB 1I4XA 4GKKQ 2XSFA 3DC2A 4DV7F 2E5LL 1RT5A 5MAOA 2XLJA 5A8KB 4B3TL 1CJKA 1BXNA 4YMEA 2WONB 1URRA 3QJJA 3T1HQ 4JV5L 1Q53A 4FKYA 3DGPA 2FZGB 2KN4A 2DNHA 4R1JA 3CQZH 1Q3LA 4ANEA 4K4ZA 3V6DA 3I5CA 1RT4B 4Q0BA 1JB7A 1CULA 2K6AA 3CD0A 3CRLC 2QA4S 1EY0A 3O3LA 1Z47A 4F0KA 2DPJA 3H3VC 4MIAA 3KJOA 1SIWB 1VRUB 2J9DA 1LFWA 1SJ3P 1LTID 1REGX 2B56A 5KFQA 4IG0B 1DD2A 1N54B 4DFMA 1VLYA 1DY3A 3CWJA 3MM6A 5CZXA 1SNDA 2XMAA 2ZHOA 3RTVA 2F1MA 3PUZA 2JN4A 2PEHA 4WJWA 3CCMA 4OZJA 3LWMA 5KYIA 4GKJJ 5E3CA 1WI5A 2AYGA 4O1NA 1CK1A 1AYEA 1S6PA 4ZPDA 1TV6A 3C6TA 2A8VA 2IRYA 2MPMA 4J90A 4CLKA 4U7UD 2CQ1A 1VQ8A 1LTTD 3RAXA 1YVCA 1K47A 4OYPA 3CCEA 3U4VA 2C3YA 3L4BC 4CNZA 3QLHB 3CDEA 5K14A 4CNYA 3U7JA 1VRQC 3TJ8A 2W9AA 4HHUA 1X32A 2DY9A 1HTPA 2F3JA 1IWGA 4NP5A 4C8LA 4G7HC 4DPYA 4A93G 5LMUL 2HHHF 1LW0A 3Q0AA 4C4WA 3NOGA 2JFKA 2RCFA 4IFVA 3BDOA 5GAEC 3VF0B 2ZM6J 3C1EA 3ZZPA 2X3DA 4WXOA 1SE8A 5BN4A 1LUZA 1JCKB 3BYTB 2G9HD 4DV3L 2R7DA 5IC6B 1BO0A 1VS3A 3UR3C 3R5CA 4ZS6A 2BH8A 1N33J 1T02A 4PQUB 3DGVA 4K7QA 1VQMA 2E8GA 3TBIB 3BM7A 1KN6A 1HNZL 4M8AA 4DLGA 4AXIA 3KK2B 3SDEA 4Z2XA 3CIMA 2DUDA 5DM63 2XGTA 4QUFA 2RNEA 5I9PA 3FEZA 2B5JB 4G1QA 2JA8B 4C8ZA 3W3SA 1K73T 1JXEA 1WTFA 1Q86T 5KFEA 2JFDA 2AJ0A 3LO3A 1N48A 1PBUA 3AB4B 3KUGA 2MKIA 2KQ3A 4IOCA 2BJ8A 3MURP 2ZNZA 1WKJA 5C3WA 1U0HA 1SMYD 2G5DA 1YNJD 1LWEB 3H5SA 3FJ2A 5IGCA 2I5JA 3DHWC 2PA3A 2YXLA 4ED2A 1KLMB 2LMCB 2WOMA 4TY8A 2Z8LA 4PZ6A 3X3NA 3BGFA 5EKKA 1MJEA 4C3LA 2QL5B 5EGYA 1RAFB 1HXYD 4WZQA 4KHPQ 1GKHA 1T9YA 4NLXA 1R8PA 3TJ9A 1VQEA 4I68A 2XI3A 1XPRA 2WSCC 3JAME 5HROA 2F0GA 3A55A 1PFBA 2VD3A 1PYOB 1Z7TA 2OT2A 4BBRG 3J7AV 3DLEB 3G7LA 3GTLB 2QA2A 1U1PA 1XPOA 5KG2A 2VQFF 3CMAS 4UQTA 1FEHA 1WD1A 4HL9A 5DLGA 1PRTB 1RAGB 3O6QA 4X65Q 4NZ6A 4V19J 3VAMA 4BCAA 1RXOB 1RSCA 1Q8IA 4X3KA 4GLAC 1RB0A 2F0UA 5IGGA 2OUGA 1PH5A 2H48B 3EJMA 3HFKA 2K05A 2ZDOA 3DOLA 2UU9Q 1FDNA 5LL6d 3W62A 3HOWG 5G0RB 4ZMMA 2C2KB 4P9SA 1EKRA 4JI8Q 2RAQA 2AF6A 5HJXA 3BZDB 2HEKA 3J7YW 4EO8A 4GN3B 1X6OA 5KNDA 4MIBA 2NR0A 4IUTA 5F0UA 3J7YU 3E9HA 3D4JA 3CC4A 3ETMA 4MTKA 4C9DA 1QSSA 5T7LB 3VCDA 3CJ4A 5M3MH 2IA6A 3VR6A 5KG1A 4CJ0B 3CU7A 1RU1A 3QGIA 3TVZA 3G71S 2M3DA 1VK3A 1LTSD 3ICLA 3OLAA 2AX1A 2MZSA 3K5MA 1K3RA 3HKWA 1Y1WB 1E6VA 1NKBA 2LA4A 3DOMA 3S1TA 1FESA 2VB3X 2MO1A 3J7Z5 3JAML 2PYKA 2OPRB 2CVEA 1R6VA 3FKIB 4GKKJ 4KBIA 4H0LC 4FF1A 2MJNA 5HVGA 3IRBA 1GUOA 1TFYA 2XG8A 1N8RT 3T19A 4LF8L 3M6WA 1PFSA 3T1HJ 5EGTA 6FDRA 2HBZB 1FD7D 3RB6A 1TT2A 3BJUA 2UUAF 3MVVA 5COYA 2RILA 4P71A 3RW7A 4DL7A 4PXBA 5FJ8H 2QG9B 3DLLA 3M9OB 4A3DG 5DDQC 2RRBA 3F2CA 3GTQH 2MO0A 3V4IB 1WKLA 1RWNB 4DXGA 3LAMA 2LY7A 3PX0A 3AOBA 1TWGB 3DHXA 1S9EA 1U26A 2GQQA 4OZ3A 4OO1I 3ILLA 4M5JA 5HL7Q 2K5HA 4DZ6A 2GS8A 4KY7A 3QWNA 1SKWA 4YHHQ 1ELOA 3HULA 2GHWA 2V69A 4ZVTB 2XMVA 5KAKA 2K5NA 3KLFA 2R7RA 1M5PC 3OR2A 3KLHB 3AB9A 3KTQA 5E3QA 1QE1A 1V1OA 5FK9C 5DEHA 3HP6A 2PMZB 4JOUA 3CCMS 2O66A 1WTXA 1SJQA 4I56A 2KHJA 2NUUG 3EM1A 1SUQA 1UFWA 3CCZA 4BHQA 2ZH4A 1JLGB 3RD4A 1RTOA 4J9NA 4A3EG 4TY9A 2Y1RI 5EKLA 3I4MG 5MLCV 4PZVA 1SYBA 5C2CA 1XTCD 3F2UA 1VQ8S 3D1HA 3TX8A 1X55A 1I6HB 1VK8A 3WOEA 3CCES 4ZLNA 2EFQA 1KD1C 4NRTA 2E9ZA 3DDKA 3R7BB 3NTKA 2J7WA 4QWDA 1X4DA 3NWSA 4DN4M 2B8GA 4X3UA 2CYYA 4QIGA 2B43A 2DNZA 2G1DA 1TUVA 1NAPA 1FRKA 1M90T 2CPXA 1JWWA 4IUPA 4A8YA 4A3IH 3O5TB 3GTYX 3IR5B 1TIID 2DH8A 2KFYA 3VV2B 3FFIB 5HMWA 1IR2A 1MIUA 4LUBA 5A6WA 5C4ZA 5DLFA 4ABNA 4H4OA 2RBMA 5JPMC 1UZDA 1SEBD 3BH6B 4NCGA 1SC3B 2ASLA 3QGGA 1W6JA 1VQMS 1VCIA 4ZITA 5D3GA 3H98A 2MGZA 2GNKA 3UDLA 3AOCA 5CA5A 4DQIA 4X4PA 1A62A 5C0XI 1CHQD 2H5IB 2J9DE 1SRUA 2L0CA 3KF6A 4AQYQ 3GTMH 4Y2KA 4LF6F 4PRFA 4ZLLA 4TRDA 4OI4A 5HN0A 1GO3E 4OX9L 1MN7A 2DNPA 2DR6A 3CDAA 2P8IA 1VQ4A 1XR5A 2EYLA 2UXCL 4C98A 3FUYA 4QIWD 2AX0A 1VMPA 2K8GA 4IUVA 3C3LA 4IO9Q 2B9WA 3A1YG 1HQEB 4TKTA 2J7KA 3ONAB 1OO0B 1EYDA 4HJ9A 4DX7A 1T7PA 4QW8A 1IUJA 2UP1A 1C0UA 1I1GA 4DR3L 2V2QA 5FLMG 2N88A 4GOPA 3BSOA 2KCMA 4B9VA 2WBMA 1SQEA 1JC7A 3GCXP 2YKPA 2ADBA 2JLEA 1ZOTA 2B2WA 1IKMA 1M8AA 4UUXA 3S15B 3LP0B 1SDFA 5FLXE 4OI3A 5ETPA 3O44A 2JA5H 1Q5VA 5C0XJ 2W4PA 3GCWP 4J9PA 3HMJG 2LEPA 3DMJA 4X65J 5DNFA 2WFWA 4Z37A 3VAGA 2AGPA 2WB1D 2A2DA 2JQOA 1F77A 1S49A 2XIWA 3RB3A 4R4TA 3GQBA 3BKUA 1HJPA 2G9DA 3BBFA 2YWKA 2B2VC 1QVCA 5GAGC 3OSNA 2UU9J 3UD3P 1SH3A 3SZ2A 4H13C 4WXWA 1X3PA 2OD6A 2F9DA 2L4NA 1RTHA 4OHZA 1SIZA 3GV6A 3PIO3 1WG5A 4F36A 3UNGC 3X3UA 3WOFA 5J1EA 4BY7B 4O4RA 5K5MA 3I31A 4IFYB 5KG5A 1YGYA 2NYZD 5BR8F 3R8BA 3PG9A 3PHTA 1QCBD 3UCUP 5D14A 3GONA 3BO4A 4NL5A 2JEGA 4NA2A 5DM73 1N32J 1LWCA 3PW4A 1P8GA 1VQKA 5FLXY 3DMUA 4CCHA 2CH4W 4RX6A 1HA5A 1U47A 1GM5A 4EZ6A 2JA9A 4LJMA 2RKIA 3CC4S 1UAWA 2C9OA 3M4OH 3WBZA 1JB3A 3MHBA 1N36J 2Q8IB 2M88A 1U5KA 2X6GA 2O3DA 4IUFA 4DV1L 3CKIB 2YX4A 5RUBA 5IE8A 4A47A 2OPPB 5LMNF 2CQHA 1BE4A 5FLXL 1TY0A 3M9BA 1PXUA 4KRWA 3LNNA 3HCXA 1VOMA 4DLEA 1P9YA 2KA7A 3UE2A 2XWBB 5EWGA 3UR0A 1C0TB 4O0IA 3IMQJ 1EY7A 4L6TB 4B3RF 1EQ0A 2A6MA 2ASJA 3ERSX 2CCZA 3IRWP 2XNAC 1UW9A 4EGVA 2EY5A 2KVMA 4Y2MA 1RISA 2VQEQ 1V43A 2F4VJ 4JOIA 3RUZA 4DV2Q 1TK5A 3PF4A 4RO0A 3OYYA 2VFVA 2IHEA 3G6VA 2A1AA 3H2VE 3NGKA 4MIWA 3AMUA 1S9FA 2PO4A 5CD4A 3ICEA 1RQ0A 1QE6A 4LSLB 4TQUS 4OO1H 1FF2A 1SJRA 1KDNA 4UY8T 1R0AA 1BF4A 2MJUA 3H90A 2R4FA 1MKHA 2E2HH 3D0IE 4HJAA 3OT9A 1L0WA 2B2TC 1QAJA 1KHWA 2IX0A 1SJ4P 3OW7A 4FXGC 5SZTA 1MW7A 4MIUA 4ID5B 4XQQA 4G4KA 1PRTF 1RZMA 1CS4B 4RU9A 4WKRA 3FZ2A 4M5DB 4EQ5A 4L5TA 3TA1A 3HD2A 2LU2A 3NG8A 2DNYA 3MAQA 1QSLA 1VC6A 2BE9B 2SOBA 2XULA 3A13A 5HAOA 3NWTA 2NVTB 3KLEB 4DL6A 2ZHBA 1ZAVA 3SDZA 3F8TA 4DF4A 1T9HA 4C1NI 4FNHA 1FXDA 2D62A 2HQFA 2PI5A 1HH2P 2EJGC 2F63A 4TLQA 3E01B 2W2QP 4JI0L 4KC5A 5GAEI 2OEKA 2UUBQ 4P2FA 3SXHA 1HCZA 4ZK9B 3ILIA 3ZTOA 2KHSA 5ELNA 1QD1A 4JI6L 5ITHA 4C3IB 4ECZA 2R8JA 1BQMB 1DFDA 3D0GE 1AUDA 3EBEA 1GUNA 3CCUA 3K81C 3T3FA 1VQHA 2VG5B 3QJYA 4ILLA 3FDTA 2JA7G 2ZT9C 3T51B 4DAMA 1OSDA 2C2MB 3LAKA 3RN5A 3SSQA 4CKCA 5GAHC 1ZM9A 3S16B 3PYGA 2KJVA 4WKYA 1BHNA 2RF2A 5CYQB 2YX1A 3MXHP 1X56A 5THWA 2BV3A 1Q90A 5BYRA 5F9NA 4ETZA 3NOCA 4V0BA 1IW7D 3N4WA 2VPXB 2OPQB 2WK4A 4DX6A 4KV8A 1N6QA 5C0XH 3HKSA 1UCNA 4AQYJ 4XK8C 3H6MA 2A19A 3KF8A 1JWSD 1RTDB 1U6ZA 3BVMA 1I4PA 2VBZA 3CJQA 1CC7A 4Y7NB 1KLNA 1NE3A 2D9UA 1LT6D 2VBXA 1W6KA 4QWAA 3HS0C 4YY3Q 3WX8A 4EBEA 5J2MA 2R93H 3JSBA 2CWKA 5KT2A 1VQ4S 4DR7F 4X66L 1IBKF 4LUVA 1Y4ZB 4QIVA 4DU8A 1TXYA 1BY9A 1JLCA 1FE4A 1CQNA 3HJVA 1LXNA 2ACMA 4HT7A 4Y2CA 1HYSA 2CVIA 2WVFA 3CCRA 2IVFB 4RGMA 5IWAL 3GR1A 3PIPQ 3JAMc 1XK8A 3VAHA 4I64A 4OL7A 3GSDA 3S01A 4Z7YA 2ZXOA 1S6QA 3MPWA 3RR7A 2P6TA 1K1SA 3H2UB 1AN8A 3JSRA 2CPEA 2XMMA 4KQZA 2NPIA 3J81E 4GLXA 3PO2G 4JI3F 2RQXA 4O44B 2IMOA 1AW0A 2B2UC 4Y3CA 4RUAA 1G7CB 4PMWA 1Y3KA 4DR5F 4MYTA 3TZYA 4L8JA 2KT3A 2RRAA 4LNQA 3IWNC 3T1YL 4A93B 1T03A 1T8EA 2ZJQA 1XNQF 3Q24A 2HQDA 2ZH6A 3S14B 5KNBA 3D4RA 1HHSA 1REVB 1JLFB 4KAIA 4UPAA 4DG1B 3MXNB 2OJ3A 4DR2F 3G9CA 4UF4A 5JJIA 3ET6A 4LFBQ 3BF4A 2VG6A 4DAYA 1TKZA 3HZGA 1FNOA 3GIRA 4H4KC 3PZPA 1C2PA 1TWGH 5ETLA 2FJWA 3NCQA 4YOEA 3R5DA 1ZKOA 1DYQA 1IBMF 4F7VA 3CF5A 1VQKS 5KFAA 1PRTD 1EYGA 4QYZK 2CQ4A 4NXMQ 1F6TA 1ZM3A 3J81Y 1QVFA 1Y10A 1QZGA 2IPKD 3NP8A 5F8JA 1RK8A 4DXFA 2FHKA 1GD7A 4MKYA 1VBKA 4YUDA 1F5AA 4J9LA 2R2UA 2ZOMA 3BR9A 2BE7D 4NLYA 3NBHB 2X3GA 3J81L 2F8HA 1VQ9A 2DISA 4ETXA 4IURA 5M5XH 4DR4J 3NENA 4O3OA 2A18A 1HBMA 2NLWA 5EDWA 5D4PA 2VQEJ 3JYTB 3BREA 4LFAQ 3VYSA 3H3VH 4RW6A 4QQBX 4DV2J 3T9ZA 3ND9A 3HSJA 1FO1A 2NZ4A 3K5OA 2BJ3A 2DB1A 5LSOA 2JC0A 4P2SA 4USIA 1I6HH 2QYCA 1E1OA 4JI1L 2FJEB 3U9OA 1NK5A 2C22A 1DQ8A 1SSOA 1CI3M 5B0EA 2AGOA 1XMOQ 3RZOB 2EFGA 1AA1B 1HR0Q 4BBRB 2VU5A 5A8KA 1IR0A 2GIQA 4RLEA 4LMQD 4BBSG 3SEOA 2GIFA 2KXFA 4ZVSB 4B3TQ 5ETVA 2MEWA 1LFPA 3AA9A 3ISZA 4B9TA 2VONA 1CQMA 2J0SD 1RT4A 3OTCA 5AXKA 3OTDA 1X54A 3MMJA 2GMHA 5KFIA 2BE5D 3NAHA 2KYXA 3QFHA 1EZ6A 4C8MA 3I0RA 1FJGL 2DD8S 2H54B 3GFHA 2Y1JA 1FKAF 3MEDB 2QL7B 3M32A 4RU2A 3T53B 2EG1A 1HIYA 1TL3B 4RZRA 4DR1L 4MFBA 1RWOB 2OCEA 3QGPA 3TQEA 4P73A 2OFHX 3IR7B 3BB5A 3L3CA 1QAYA 1O8BA 1D8ZA 1F2ZA 4JI5F 2DR8A 4DFJA 4A3BB 4BC9A 5A0YB 4OIXA 3MCSA 3EUNA 3ISND 4PZ8A 3LP2B 4DUYJ 1NNXA 6FD1A 4DV7L 3A4TA 3KDFB 2VH7A 1WF2A 4DV0Q 3G6XA 1MD2D 3DOKA 3CVKA 5KFLA 5KFHA 1WKKA 4BWMA 4ZKCB 4OZ2A 2JLFA 1X5TA 1FJEB 3HKZG 2WIIB 2PGCA 3R93A 4H02A 1X3FA 1TL7B 1S1WB 4K5SA 2FVSA 3CCUS 4PYAA 3U27A 4UZBA 4JI7L 2PMZD 4DX8H 2AV5A 1Z6HA 3S15H 1RWXB 4UHVA 4RNNA 1SKSA 3ULJA 1RT1A 2R8HA 3HLUA 3RLOA 3KFWX 2E66A 2B51A 2C3UA 1FFSB 5GMEA 2HNDB 5K8NA 3MCNA 4U68A 3BZCA 2A2CA 2HLUA 1W2BR 1VQYA 4A3DB 1B50A 2KRRA 3BO3A 1JORA 2WKCA 2J6UA 4YWKA 4ED4A 4P2XA 4DV6Q 5A8WA 1LXJA 5JEAG 4BY7H 2VL1A 5J2PB 4LF4F 3UDIA 3KK2A 4N5SA 5D6GA 3FCWA 4HLBA 2VIHA 2OIHA 4A8WA 1NM2A 2UVUA 3RBEA 3OXLA 3W60A 3DLJA 3MM7A 2O5IC 3M2VB 2UUCF 1GXTA 2F3WA 3I2ZA 4ZPCA 3HT3A 4HIMA 2BR0A 2W9CB 4J9MA 3SEBA 1PH9A 3B8HA 4Q2MA 3W7BA 1T05B 1M5SA 4LQ9A 2IT1A 3NHHA 1WTBA 3SCLE 4O42A 3P75A 5FLXc 3C16B 4RHSA 1R43A 3KJQB 2XSCA 4IPCA 1C9OA 1VISA 5L46A 2HHHL 2O4XA 3NTIA 2CQGA 4A3EB 1X4AA 2F8EX 3M4YA 4ES3A 1I50B 1TWCB 3I4MB 2DKOB 2KVIA 4TN2A 2C2DA 1HBNA 1MG7A 3MR2A 4PPZA 3H25A 1VQLA 1UFLA 2YU9B 2YX7A 2NZ1D 3BU2A 4F4KA 2FPHX 5A6PA 4LF5F 2MQOA 3PEJA 5ELDA 4ZUIA 2F03A 4PMBA 1AZSA 2BABA 2MLZA 1I6VC 4X64L 2K5VA 2K03A 1YI2S 1UA0A 4DR6Q 3H20A 4KGZB 4KH0B 3WC2A 1FVQA 1RTIB 1DBDA 2V4RA 2KKHA 2KUMA 1S10A 3H4BA 3AHPA 3VR5A 1I94Q 1K3BC 2NZOA 2ZOGA 2LA6A 1EYCA 1VQDA 1G3OA 5KG4A 2DO4A 5T41A 4WK3A 3IGVA 1SI9A 1G6PA 1X9MA 2L9WA 1R8AA 4CHTB 5ETMA 1GH8A 5ETNA 5DQGA 3R8YA 1Y0HA 2QRRA 3MPVA 1XMQL 5G0RA 4C3HG 1O5JA 4A8MP 2EVZA 2KFNA 4NXMJ 3HFZB 3FZBA 1FNVA 4LW1A 3EN2A 1RD9D 1YKWA 3NKYA 3NS7B 3R7NB 4ZCIA 3BDCA 3QAUA 4ED7A 3K0JA 4M5IA 3T6BA 1SBBB 1QVGA 1O7IA 1WYDA 1WSRA 3QO9B 4PQAA 4LF1A 2HUGA 1I4RA 1SYCA 1S1UB 2CPZA 4FPIA 2HCIA 2DNEA 3GTGB 1RLCL 1TVXA 3VAFA 1D9AA 4FYYB 3ZZOA 1EQVA 2ACYA 4RUHA 2X69A 2VQFL 2NVTH 3JB9k 1VQ9S 2WB1E 3A0JA 2SNSA 2F0DA 2F0WA 1VGYA 3IAYA 3R6GB 4QYZJ 5EPJA 2EYPA 2GAGC 4DV4J 2DRDA 1CJUB 2GO8A 1GT8A 1XMBA 2EPIA 1DQAA 4C56C 3J80i 1OMSA 4KN4C 4AH6A 3OIPA 1J5EF 3CCQA 1T95A 1PCAA 1XMOJ 4NI2B 5C6AA 4OHXA 1VQ5A 4ZQ3A 4CO3A 2CIMA 3Q2SC 2KT5A 1VQPA 2MUYA 2E5LJ 4C3IH 1ENCA 2ZD1B 4I7ZC 2F4IA 1DOLA 4EGLA 4B3TJ 3AXMA 3LPEA 1F2LA 2N82B 1JICA 2MKHA 1F3VA 4KFBB 2F65A 1XJVA 4CKBA 1Y1VH 3KHRA 2Q79A 5IOLA 3D31A 3TP8A 1S12A 4UOHA 1S1TA 4DK3C 4IG3B 3S16H 2VPYB 2R92G 1ONLA 2HGMA 3VQSA 3TQYA 1FXLA 4R0EA 4X62F 2APOA 2AHOB 4DPGA 3M30A 4I0WA 2FMMA 4ZA1A 5IQQA 1E2ZA 1VQNA 2IAJB 1EYAA 4AD6A 2ZWPA 1RLDA 1RBAA 1LT5D 5EWFA 1VIOA 3E0EA 1TS5A 5GADU 3QAEA 3PKYA 3C1FA 3QOJA 1L3UA 1WFQA 3Q8YA 4FVMA 3G4SA 4J1MA 3FEYB 3TP7A 3JXOA 4K4UA 1YWXA 5KG7A 1X0PA 4APVA 2HHXA 3W66A 3HHEA 2DHXA 4Y7NH 5IZHA 1NEEA 1V3SA 2CWXA 4DUZF 2HPUA 3OD2A 1HARA 3OLBA 2CPDA 1LT4D 3UDEA 2QO3A 3PKMA 4HTJA 4S0MA 1RTJB 1C1BB 2UUAL 2V34A 3MM9A