3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
b'VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BipA
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
1VI7A 1U2RA 3LH2S 4MYUA 2XEXA 4TNOA 4ES3A 4QR2A 2J7KA 3ZZTA 3EXCX 4ES1A 4ES2A 2BM0A 2IVYA 3B82A 4QR0A 2KDOA 2NPFA 3OQ2A 3E3XA 4ZCKA 1N0VC 1T95A 5G4DA 2YWGA 3CB4A 2BM1A 2L9NA 1ZM4A 4ZCIA 2YWEA 1DARA 2I0XA 1P9QC 2YWHA 1ZPWX 2BV3A 1ZM3A 3B78A 3B8HA 3ZZUA 1ELOA 4ZCMA 2EFGA 1FNMA 4MYTA 4QR1A 1KTVA 1ZM9A 2I8EA 1N0UA 1WDTA 4MAKA 3UI3A 4FN5A 2E1RA 4M1KA 3ZZ0A 4ZCLA 2DY1A 2CVEA 1ZM2A 2ZITA 2WBMA 2YWFA
chains in the Genus database with same CATH superfamily
4ZUJA 2UXDQ 1VQMS 4KY3A 1YHBA 1C0TB 4FXVA 4LAAA 2C2MB 3KOAA 3WX8A 2K1RB 2J0SD 3THTA 4CO0A 4ZCMA 1RHQB 2PE8A 1SCJB 1UJ6A 2KCCA 2CWXA 4QYZJ 4LNQA 3M9NB 4YS2A 4JBWA 5T1GA 1OTCA 1O7YA 1G6PA 1KTQA 2XN9C 2K5HA 4M5MA 3PRDA 4DV4J 3HEJA 1B99A 1BQNA 5D77A 2CPXA 4C8OA 4BHQA 4A8WA 1D8ZA 3S9WA 2K5QA 4C0OC 5I3QA 3GP7A 3MWYW 3DCAA 2RDJA 3OWFA 2MHEA 3D0FA 4F87A 2C2ZB 1CKOA 2Y9HA 1WKKA 3MDFA 4QJFA 3IGNA 2R92B 2I1RA 4BY1H 4ELTA 4EWTA 3B4MA 2CPZA 2B2WC 3VZHA 1JQYD 1YVCA 2BA9A 5A76A 4DR3L 3DGPB 4RWSC 4ILRA 1FCAA 1IQZA 3CCEA 2ZJQA 3KLHA 1FYCA 3OVSA 1XYIA 1F5AA 2HRYA 2F0MA 2BACA 3VGTA 3W9IA 3MTSA 5L9NA 1EYDA 3LWLA 4K6LA 2G2OA 4N5SA 3NQIA 3HHLC 4ALZA 3OSPA 1SIWB 3DEPA 3B6BA 4DV7L 1SNDA 4P52A 3BU2A 4I2PA 2CG8A 1SB6A 1IBLL 2A10A 1NM2A 2RUGA 4H54A 3WOFA 3M6UA 1LV9A 4DR4L 1SJQA 4DR1F 1QUPA 1YNND 3TAMA 4DR6Q 4DPXA 3NGSA 3TUPA 1VQ6S 1WOPA 5AE3A 3CJ2A 1XBWA 2GO9A 3BKTA 1BQNB 3GTOB 3H3VI 3PIPQ 2CQAA 3MM8A 4OGQC 1FNVA 3BKFA 3CRLC 1UEAB 1GMUA 3G6XA 1KC8C 2AGOA 2IHR1 4F0KA 3MUMP 4IUTA 4YMEA 2WW8A 2X1GA 1RT4B 4QIEA 1VYAA 3UVJB 1B9MA 5HVGA 1AB8A 2X3DA 1SKRA 2R7SA 5IOLA 2GVBA 2UVRA 2VA3A 1FI4A 1V9OA 2SDFA 1B3AA 5C6AA 2MZTA 1NR2A 3KLHB 3RGIA 3A8IE 2JX2A 3NP5A 1HWJA 2UP1A 1HNXQ 1YRUA 3T9NA 2XY5A 2PN6A 4FVCA 4DV3F 1QWYA 5J2QA 3FDTA 2ZEJA 4KV8B 1UE6A 1S6UA 3G7LA 2DHHA 1NDLA 4I2PB 3CDAA 2ILYA 5K14A 1N4LA 2N3LA 3E9HA 4JI3L 4HCEA 4HSPA 3BSAA 1IKMA 3TAMB 4HN7A 1SN8A 3OTOJ 1H9MA 2FVSA 4AFFA 2EFGA 2JH3A 2EFQA 1HIYA 1D1KA 1WDTA 4IQXA 2YWWA 5FLXL 3MM6B 1RE1B 3UE1A 3MM8B 3KJVA 2JLGA 1PO6A 2HFNA 1V1QA 1YNNC 2HQ3A 4B9VA 2UUCL 3S15B 1WUUA 3P8BB 3NQTA 3VR4A 1FRIA 1Y1WH 1RISA 3GTQH 4LMZA 4WIQA 3HRZC 3PUXA 4J91A 4OL7A 1ZYQA 2AYMA 4KJOA 5IGFA 1BHNA 3U1LA 2G4BA 1VHIA 2UXBF 5KFKA 2A73B 1VC0A 1WTRA 3N5BA 3KLRA 2NSCA 1HQEA 1LYLA 1XMOQ 1FK9A 2GIFA 2GAHC 5TSSA 2MSSA 4IPGA 2JQOA 5JPMC 4F50A 5DQGA 4LVNP 4M5IA 1D1UA 4ZVHA 1EQTA 3NS5A 4Y2CA 2EYHA 5M2RA 3AJ1A 4G65A 4O2DA 1TWAH 1T03A 5K14B 2R2UA 2WTFA 3HDSA 1SBBB 3IFTA 2R93G 2M2BA 1NBEB 2CYYA 3R7BB 3TW0A 4TU7A 2XGPA 1G2SA 5F3TA 4ILMA 3K58A 4J9UE 4HJ7A 4PZ6A 3VZIA 3QLHA 2IT1A 5JJBA 5HO4A 1KDNA 1O7LA 2V4JA 2VF3A 5M5XB 3ILIA 4A8MP 4M8AA 4DZ6A 1VBXA 1NNXA 2Q2IA 1V5VA 5KIXA 2LMCB 2DR8A 4HYKA 4A8YA 4MTPA 4U8VA 1Y3JA 1H3DA 1HQEB 1FK9B 1HQUA 3CNQP 4K4ZA 3K81C 2PQAA 2Q8TA 1CFMA 2B0GA 1QVGR 1JJ2A 2BA0A 3A3NB 3X3MA 1T05A 4F4AA 4ME3A 2IJ0A 1O8BA 4IOCA 4NCGB 1T03B 2OAUA 3BDOA 2IX1A 2YNGA 3NL0A 4ZITA 3GTMB 5K20B 3S16H 4A3CH 2I8EA 2MQNA 3DMJA 4DL3A 2ZH2A 3RB6A 3H3VH 1H74A 1NUCA 3NPPA 2IRXA 2QLJB 3LUYA 4DV2L 2V63A 4MNOA 1OYDA 2LEBA 5IM0A 4MIAA 5C4JB 1N6QB 4MJKA 1Q82C 1F6TA 2OQKA 1U6BA 1OQ3A 3QLHB 2QL9B 3DUZA 3SFGA 4BLGA 2ZHAA 3HG9A 5C42A 1SC3B 2P9CA 3TP2A 3HHDA 3VGSA 2BMBA 2D62A 5E3CA 2ZNYA 1RHMB 4ES2A 1RT1A 2XS7A 1FVSA 3FRZA 3PJXA 3R2TA 1OXXK 2RT3A 1N36J 3GG1A 5C44G 4A3IB 1HQUB 3TP7A 1M0SA 3HOWG 2PQAB 4L76A 2M4MA 1X60A 2ZUAA 3RW7A 4A75A 1F1BB 3GONA 1NKBA 1T05B 4DU8A 4NLDA 3H5YA 2YH1A 2Q2UA 1A8VA 4OX7A 5CBAE 4BY7G 2IM1A 3BBCA 1RWKB 5KAKA 2HBQB 4CO1A 2MQHA 1FA0A 3M2VA 1FWLA 4MAKA 1FGBD 3K5OA 3CF5A 4N77A 1ZPVA 5KFDA 3DMJB 5EX0A 1H6KX 2DHSA 2HHHJ 4X64F 4U673 2AQ1B 2V8PA 1W26A 2Z6KA 3S6EA 2VKRA 4K4VA 2VQEL 3I31A 1YHQS 3NP8A 5IM0B 3KLFB 3NENA 1MJEA 1HWLA 1TV6B 4UF4A 2VNUD 1RAJA 3I56A 2J8SA 4YP3A 3F56A 2XMVA 4LF9J 5C42B 4A8QA 4JI4J 1YJ7A 4FYDA 4HHHA 5DRKA 4DR2L 1YJ9A 1FNUA 2HCCA 1RT1B 3D28A 5IT9Y 4Y52H 3G82B 4KHPQ 1Q46A 1RHJB 2XWJB 4CYUA 2WBRA 3M32B 2DNOA 2QA2A 1C9OA 4DX5A 1I6JA 2NVYB 2MJ8A 3BGLA 3AB4B 4JI5Q 3NWSA 3D4WA 4PXBA 2L3MA 2NXUA 5A8RA 3TP5A 3W2VB 1HPZA 3DRSA 4B3SJ 2EW9A 1U4MA 5HI7A 2E9ZA 5AXMA 5CCLA 1I94J 2NVXB 2CKWA 4K2XA 2K7VA 3MCNA 3M8QB 3PO3H 2C3OA 1LXNA 2VICA 2FINB 2H1YA 4RW4A 2NXEA 4FP5D 3QT5A 1SFOB 3NTIA 3UD3P 4F26A 2NBFA 4C9DA 2PQEA 4ZLTF 1K9MC 2C2NA 1C2PA 3OTOF 1TWCH 4ECYA 2MKJA 4S3SA 4UHVA 5KNDA 3BYRA 2YKMA 4KO0A 3GTJH 1EETA 3S24A 2KYZA 1DFDA 1UMJA 2IFXA 4RNMA 5BR8Q 2WVFA 4OQJA 2BW7A 3WDNA 3S2HH 1FGUA 4KE5A 2DNMA 2NZ4A 4JPBW 2I5JA 2DIVA 1VR6A 4HCSA 2B9WA 3T19A 2EYJA 4XPCA 5GROA 3HHKA 3M8ZA 1R8AA 1TQLA 2PZTA 1JJCB 3W64A 1PFMA 3L3CA 2MKHA 2Y1RI 4JYAF 4AL5A 4XO0A 3H7HB 3DRSB 3OFGA 3CP0A 3M1VB 1R6YA 2AZ3A 4OZ1A 4PXEA 4UP7A 4WF9Q 3I6PA 4N8NA 1HNWL 5U47A 2HS3A 1TKZA 5C4HA 3Q2SC 3UQSA 4C3JB 4KHRA 1BNZA 3WHIA 4JVZA 5LMNF 1HBMA 1CA5A 4RW4B 3RZOB 2M7SA 5E3QA 5IFMA 4CKBA 5DGAA 5F8GA 1ICWA 1WHWA 1Q1EA 1RQ0A 1UAWA 4CJ1B 3JQKA 1ZA1B 4CH1A 3X1LB 4L8JA 2YKMB 4KO0B 2NTSA 5HQMA 7FD1A 3OXLA 3MECA 3EX7B 2ZOMA 1UE1A 3GU0A 2CRLA 2KKHA 2CPFA 1FRMA 5M5WB 2CZ4A 2JN4A 4LFAQ 1YNJC 2ZTEA 2HQFA 2I5JB 5GAEI 1RXOB 4ZIVA 3AMUA 2B2VA 2CZVC 5CC4A 4OX9Q 1BF4A 4PG8A 2A3JA 2C22A 2J8AA 1K83B 3I73A 2LQ9A 1DJRD 2ZT9C 3IG1B 4I68A 2EQSA 1SYCA 1Q3LA 5KFBA 4I67A 4A3FG 3OTDA 4V0BA 2OPQA 3R5DA 2F0DA 2DCLA 4GKKQ 3HOVB 3RB4A 4PXCA 4CO3A 4CH0S 4JI2L 3EICA 1Z2LA 3CW2C 4MT1A 4ZVUB 1RWXB 3PXGa 1TKZB 5BYSA 1HH2P 3Q86A 4ZCIA 3CJSA 1CM9A 1N33Q 1W2BA 2N7CA 1PGZA 1NMEB 1KQSA 5BN4A 4U96A 4DZDA 5E7NA 1QOHA 3HOYG 1JOQA 2L41A 2F0QA 2YKQA 3I0RA 2V6AA 4KHMA 2AUJD 4ZK7M 1EIGA 2R7ZG 2W1BA 4F4ZA 3IBFB 1EZ6A 1XNRQ 1HLWA 1WF1A 2XMUA 4OI6A 2ATWA 4PUOA 5J1PA 1MGSA 3SHLA 2LQBA 5C5LA 3JXOA 3DLJA 1NEEA 2XMAA 1U1NA 5J2MB 1Y8OB 2AV5A 2OMLA 1N36F 4PYDA 1SE3A 3SQGA 4L5TA 2EK1A 4LUOA 3RD4A 1ILPA 4QPTA 2IJNA 2JP1A 3CCTA 2IMOA 3FK4A 2CWAA 1F9HA 2NS1B 3UDCA 3DRPA 2E2HH 3W2WB 2W7AA 4ANDA 2FJ2A 4KPCA 1GVPA 1A9NB 2OHDA 3ZNUA 2POKA 2DD8S 3IFEA 2LU2A 3OIQA 3FBEA 5L39A 2RA4A 3QZ7A 4NX9A 3CC2S 1LTLA 1U6FA 2V68A 4DK0A 4B17A 5LXRA 1SJ3P 5KTQA 4L6TB 1E1OA 2GGPA 4LFBQ 1WD6A 2KXHA 3CO9A 4I1TA 3AA9A 3I0RB 1M5KC 4DL2A 3TA2A 4JI6L 2K75A 2Z2MA 1MG7A 4GKJL 2FIUA 4KGXB 5H1SV 2CNOB 4O4GB 3NAHA 4PUOB 1P27B 1ZA2B 1HNZQ 3HX9A 1E6VB 3SCJE 4JI7J 1QLNA 1PFSA 1Y00A 4KGKA 2P6TA 2BQRA 1MBYA 1GK8A 1LNQA 5DETA 2BEFA 2TMPA 1C4CA 4KN7C 3I4MH 2YQ1A 1R0AA 4RKLA 1ZM3A 2J0WA 3ER0A 1CEZA 3FRYA 4RU9A 3VQSA 1WI6A 1WEXA 4QQBA 3Q8VA 3P7JA 2HGNA 2XZTB 2BBEA 4HEA9 4JV0A 2QTWA 1TTHB 1SUQA 3DRPB 3A7LA 1F0XA 3UNYA 4O0IA 1J5EL 4NMXA 2UUTA 1DARA 2NYIA 4EYHB 1QZHA 3CCUS 4CLZA 3FMCA 3FCWA 3F0NA 4B3SF 5HATA 4B3TQ 3H09A 1SDFA 5F9LA 1FVIA 1KLNA 4JV5J 3N28A 2N8NA 3FEXB 5C5JA 4ZPDA 2MHVA 3I96A 4DUTA 1Q5YA 3VDYA 3MFGA 3T3FA 2JEFA 4HHJA 2GGPB 1PKUA 3PYFA 2M52A 2NSBA 2R92G 5IODA 4C7QA 1NHVA 2YY3A 4XQJA 2IHEA 3CPWR 1K1QA 5LHY1 2RKIA 1WVLA 2WOMB 4FNHA 3OIPA 2OSRA 4DR7F 3KUPA 4EGLA 1RADB 2GA4B 2ZDOA 3HSGA 5G4DA 4ED6A 1KIXA 2XIWA 3OJUA 1GUTA 2K52A 5I4MA 5MAOA 4N8OA 2XO6A 1R0AB 1B4OA 2HNDA 1KAAA 2G13A 2HAIA 4F3OA 1KRPA 2EFNA 2E5LL 1PCAA 1RT5A 1N5YA 1ROFA 3QG1A 2ZM6J 3QIAA 1SUQB 1TS3A 2XGQA 2CJKA 3TZZA 2DNEA 4HDGA 1TWHH 1R89A 3R27A 2FVPA 4IO9A 1S4ZA 3J81c 4PABA 1EZZB 3BV8A 4J9QA 1QNUA 1G4CA 1RABB 2RH3A 4NXNJ 3X3UA 1IKWB 3KK2B 3L95X 4N41A 3TX0A 1AYEA 4C97A 1F2LA 2LXFA 3BH6B 2K50A 2V2QA 4F04B 1JQGA 2RIJA 4GVBA 1LTTD 3DXJC 4ECRA 5M3MB 1C0UA 1ZKOA 2DKOB 1EYGA 3VAIA 1T9XA 3IBCB 1D5ZC 1YJWS 3J80c 3HOXH 1Q8BA 4B3OA 1DM0B 1WKJA 4E6IA 5C4XH 1C8CA 2GCFA 1B70B 3HKWA 4YY3F 4LF8Q 2MY8A 4OYAA 2J9DE 1ONLA 2VOOA 1RT6A 1EKRA 4KR0B 4RPFA 1PYTA 2HNDB 5IV4A 2XNAC 1VQ7S 1RT3A 3FPUB 1D9FA 1PBUA 3MD3A 3A7AB 3WOEA 4DR5L 1RT5B 4OHZA 4CLKA 4HVZA 1F77A 2DR7A 5ETTA 2BOAA 1N5YB 3U4ZA 2BUNA 1Q1BA 3IM8A 3KWMA 2EY1A 2HFVA 1QJHA 2GO8A 4ZCLA 3GIMA 2IRUA 4H02A 4C3KA 4LF4J 1XR6A 1CK1A 4C3LA 2VB6A 1N34F 2DGSA 4LF6J 3D3BJ 4ZLPA 3N5FA 1HR0L 2VJUA 1DY3A 1GT8A 4GVBB 1KHWA 1IWGA 1C0UB 2MHNA 2UUAQ 4A3JB 3FC9A 2UU9Q 1NKEA 3OOCA 1VQDA 2QILA 2SXLA 3W2DA 1D8LA 1SIZA 3WC0A 3HSZA 2ZKTA 2AKWB 4X84A 2AP6A 1TKDA 4C6AA 4U7UK 3OL7A 1RT6B 3HD2A 3V2TA 1TK5A 1D2BA 3GPAA 3HHLA 4QGUA 2ICEC 3NHHA 4IZ8A 4NRTA 2AGPA 2X1AA 5K8PA 1JLQA 1R9TB 3JTOA 2KHJA 2OPPA 5KYLA 3AOCA 4G1QA 1FE4A 4DU9A 3ETMA 2R8KA 2R2SA 1SEBD 1EY9A 4J9RA 3OHXC 3CMAS 4JI1Q 2R9LA 2RDHA 4ANEA 2F0GA 5B0FA 1S0NA 5L1LA 2JOQA 2Z2YB 1V8QA 2KM8B 5CZXA 5FO7B 2RKSA 1EFID 3OTBA 5KFSA 1MN7A 2GNKA 3T1HQ 4EQOA 2HDLA 5LOQA 5FD1A 2JC1A 3BZCA 1XMQL 5IP9G 2E2JB 4RNHA 3ZZYA 1RTIA 3JAMc 1FHTA 2ZH4A 2EJFC 4OHJA 3GJQB 1GD7A 2EI5A 1DQAA 3M8RA 3HS0C 3THVA 3BR9A 3GCWP 3FDSA 4IRCA 2PI2A 5GMKa 3I91A 1BCPF 2MQQA 2F0VA 1BQQT 4AQYQ 2ZE2B 4BWJA 4OHXA 2B7BB 1ASZA 6AT1B 2Z2LA 5GVQA 1E22A 1V43A 3D1OA 1Y11A 1WSRA 1YRXA 2IVYA 1DCZA 4PQUB 5A2QY 1PH8A 2PIIA 3MVVA 4OO1I 1LT6D 1JLQB 1PJ6A 3D68A 5JUMA 1WTHA 2XZDB 2OPPB 1XMOJ 1Z6HA 4MZ9A 1E6YA 4H0LC 4G1QB 3CIMA 5IWAQ 1STBA 3TJ8A 4RAUC 4ZOSA 3PSIA 4ECTA 1GNKA 2O66A 2RRNA 2WB1B 1QDUB 5C3EB 2DISA 1SC1B 3ZZPA 2FLNA 1M90C 2KQ3A 4U95A 3OW2A 2ZTCA 2KXFA 3UCGA 4HI1A 4Q8EA 1BGXT 2VPYB 4R4QA 4UOFA 1VQKS 1STEA 2ZJQQ 3HOZB 1RTIB 3D0HE 2CWPA 4DSLA 4ES1A 3WBZA 4LF7Q 1NCLA 1QILA 1REGX 3CCQA 3IAYA 4Q44A 2L11A 2R7VA 5CV6A 4DKAC 3TQEA 2VKZG 4BBSH 3KLVA 1TR0A 4OZ0A 4A3MH 3R8BA 4C8MA 2CQGA 1CQVA 3MEEB 1OPZA 4DK6C 3F1ZA 3E0JA 1RHRB 4LF1A 1FNWA 2PMZB 1S49A 2HKEA 1NK9A 4KY6A 1E1TA 3AQQA 4A3KH 4CLPA 4HH0A 1KDCA 5H9FJ 4A3IG 2XMWA 4KHVA 1L3UA 3M6XA 3M4QA 2EKYA 3BQ1A 4W90B 5DJBA 2FHJD 4PQAA 3MGJA 2UXCQ 1TUVA 3DLEA 3FPPA 5E3RA 5HGTA 1FNOA 5KEEA 1EY8A 1UWVA 1S99A 4JBKA 1E6YB 2W8LA 1QUQA 2ROEA 3VV2B 3HVTA 1VLYA 4W98A 4DR1L 5DDRC 4IPCA 4RU2A 4MK8A 1PAEX 2IMWP 4YB6A 1UNSA 4DFKA 1IYJB 3NBHB 4RWXA 3J7A1 3NWRA 4NDXA 4R4CA 5GADC 1VMPA 3S1MB 2XY7A 4KMUC 4XTCS 5F3ZA 4UOGA 4DN9A 4LT6A 3CCES 4Z7CA 3MEFA 1P8GA 1NDPA 1EKSA 1VRQC 4OLOA 3A0JA 1STNA 2NUHA 4ZMMA 2RF2B 4DOZA 3EXYA 3GTPH 4I69A 2I5MX 2J7ZA 1LWFB 4X2BA 1GOZA 5A35A 2APOA 1A3UA 3PGZA 4QUCA 2W9AA 1Q4RA 1F9RA 1BKBA 3QJPA 1PDQA 3VWSA 4DFPA 3BREA 4DV3L 1S1TA 1LTID 3DLEB 1WHVA 4NEZA 1BWVA 1B8AA 3LX0A 5HJYA 3AA8A 1QUQB 1HR0W 3QWUA 3HVTB 4WXOA 3GJTB 4NLTA 3DNCA 2RU3A 2ZVSA 2LDYA 1W2IA 4FYYB 2QMXA 4CNZA 3GFZA 3A3PB 1GEHA 3CCLA 2FZCB 2NZ1D 4DHVA 4UW2A 4CDEC 4L74A 1U8WA 5DS7A 5C0XJ 2GJ2A 2F63A 2AYBA 3V6JA 3CC7A 4OYZA 4RGTA 2KYXA 1NMFA 1JLEA 2ZJRA 4L5RC 2LA4A 3KUEA 5FIIA 1UZHA 4DR6F 3I4NH 2UXBL 3D6MB 4DR3J 1IR2A 2KZZA 4I56A 2YX4A 2FJXA 3VYRA 4TKTA 3NNAA 4EGVA 2Z0SA 1I4RA 4HIMA 4OO1H 4D3HA 1R4PB 2F0WA 1S1TB 5C0XI 2W24A 5CV5A 4PWWA 4DV7J 1SE8A 2GQQA 2DHXA 3PJ9A 2G9OA 5THWA 1V3RA 2EJMA 2XB2D 3KDOA 3C46A 5B0DA 2Q43A 1TL1B 4DR4J 1KL9A 2F1FA 2KT2A 3K7AH 2V50A 2B43A 4EYIB 3CQZH 5DDOC 4HACA 3Q8UA 2V8VA 4I2QA 1HNXF 5CABA 5D0HA 1U1LA 4P2MA 1WTOA 1HNIA 1MD2D 3JYTA 2A6MA 3S2DB 4TU9A 1K28A 1JT8A 1CKMA 4Q5VA 4RBUA 4JUZA 3KF6A 2VB3X 3C1EA 1JLEB 2KRBA 3BJYA 2Y1LB 3RW6A 1NRKA 3VAJA 5JEAJ 1L1OC 4LFCQ 4NI2A 4IOCQ 4ZN1A 2L12A 2AX1A 4FPRA 1UETA 5HMZA 1FO1A 3ULJA 3H25A 4LSZB 4GS3A 1RF2D 1NB2A 1U2FA 3SK4A 1CSQA 3ENQA 1HXYD 4K8IA 1URNA 3TR5A 1CUKA 1AA1B 1F5CA 4A8XA 3KJPA 2SNMA 4KH0B 3K0JA 4QR0A 2IHFA 2KB2A 2QG9B 4JI3J 2L08A 2VASA 4HMIA 5EPLA 1RACB 2CPYA 3V6HA 4IR1A 2KENA 1F9FA 4RKBA 2CJXB 3K7RA 1UE5A 4QW8A 2DY7A 3AD9C 4HACB 1XMOF 2AQ2B 4L3KA 1M5SA 5JJZA 1UFLA 4LSNA 1RAAB 4OWXB 2RAQA 1HNIB 4J9VA 2GV1A 1N88A 3JYTB 4A8FA 1HBUB 4DUYJ 2F7VA 1C1CA 1SKSA 1IZ6A 3IP0A 4CLLA 1S6QA 2MO1A 3KF6B 4DV1J 2Y0BB 1D1IA 3FSIA 1QD1A 1P6TA 3U7JA 3CXCR 2DITA 1GUWA 5CR3A 2E29A 4G7HC 5EWGA 3NAIA 4P71A 2VC0A 2ASBA 1J6QA 2KXNB 3L9ZA 1R31A 3UN2A 4ED5A 2KCMA 3FGVA 2CADA 3OSNA 4CBVA 1ZPWX 3GV5B 4RKUC 5I2XA 3CF5Q 4NYOA 3DDKA 4H4OA 5GAHI 3J7ZC 3DI6A 4KI0A 1RK8A 2ADBA 3MEDA 2XYPB 4QY7A 1R43A 1VQ8A 4OX9J 3FZ2A 3DXBA 4NA3A 2EC2A 1KQFB 2X6GA 2R7DA 3V05A 4GN5A 1X32A 3ZZ0A 3NGDA 1NR4A 2ICIA 5E0OA 1DTTB 4LSNB 2H5EA 2Q79A 3MR3A 1VQMA 1Q81C 3PDNA 4D3GA 2M3DA 3HXMA 2OH2A 1AXQA 2WVDA 1RIPA 1GXLA 4FS2A 1C1CB 4BBRB 3FBBA 2HNYA 3FCVA 3KG1A 1IJFB 2W2PP 4YCUA 1B3TA 4P2CB 2BKOA 3NG8A 3GIJA 1VCTA 5L1KA 1SJHD 2W4DA 3LAMA 1N52B 1IQTA 1U1KA 5E33A 2PZUA 1B2TA 1UFKA 4XDDA 2XHWA 4DQQA 2VUMB 5C0XH 5CYMA 1L3VA 3H0GH 4DL0C 3RYLA 3DI6B 4L63B 5IQQA 5ELBA 4URGA 2DGUA 2LLZA 3MEDB 2HRTA 4X3KA 4A3EH 1R8BA 4NMLA 4QIWD 1I4XA 2G5DA 2ZD1A 4OYWA 1B7FA 2RB7A 1Y3KA 2EBGA 3HP6A 3MHBA 3W1YC 2EVZA 2V69A 4UY8C 3SK8A 3AQOA 2HIXA 3T41A 1ZZNA 3MXNA 1RCOB 1YJ9S 4KKTA 4ANCA 4W4MA 4YB1P 2QMWA 4QOTA 3OTOL 2YX7A 3KYLA 5B7WA 3Q24A 3IMQJ 2D9UA 3IWXA 2HIQA 2HNYB 1VC6A 3R3TA 3AFGA 1LEOA 4DPTA 3T5LA 2JA7H 2R8JA 1JIHA 3H2UB 2EPBA 2HIYA 3RZDH 1X5OA 3OMCA 4XIUA 2K8GA 4NLPA 4ETZA 5J1NA 5ELOA 2VQFQ 1OQ6A 1C1BA 5CORA 4X66Q 2F0LA 4JYAL 3TJ9A 3AFPA 4O42A 4NWBA 3S1NH 2N55A 3I0SA 4OHWA 3KK1A 4K5VA 3HOUH 1LW0A 2ZD1B 5JEAH 3KK7A 4KHPF 5J2PB 3N6NA 2MGZB 4C3IH 4IJLA 1D9DA 2PNRC 4DUZQ 2R7OA 2HK3A 1RA6A 5LMNL 5CGKA 2YU9H 3F41A 2ENBA 1S6PA 2G2ZA 2G2YA 3MXNB 2B63G 1KBRA 2VQEJ 1GMWD 5KNCA 3BO3A 1WD0A 1BD6A 5HSPA 4LRBA 1VQGA 5DG8A 3EZ5A 3Q0AA 2QA4A 2V8DA 2K5WA 4OX6A 3LW5C 2IBOA 4AXJA 1TL3A 3GTKH 2B4VA 2BR0A 1SE4A 2DGOA 2KHIA 3GIIA 2Y1JA 4MFBA 2X6LA 3PV0A 3OR2A 3NTHA 2Z57B 1IM4A 5IYBH 4MYTA 3PRVA 5GAEU 2DJGC 2B6AA 3GV3A 1I6VC 3DM3A 4IFYA 2AT1B 2IVMA 1BXNA 1A2UA 3PJWA 3TZUA 1YZ7A 1K73T 1C1BB 2VIHA 4BA2I 3G8QA 3TRGA 3C16B 4TY8A 3ZO7A 3I0SB 3R7NB 1PRTF 5BR8F 3KK1B 3O6QA 1QVFA 2CPHA 4QIFA 3V6KA 1KFSA 4B9XA 1SKUB 1OY9A 2W9CA 3PEJA 3H5UA 4A4JA 5C44H 1VF7A 3U50C 2DNGA 4IJHA 5CYQA 3TS0A 3S1TA 1S6PB 5KFMA 4R1JA 2FVQA 3CJ8A 3TZDA 2RQMA 4PG5A 2F40A 2HEKA 2FC8A 4OWTB 1FDBA 3K0YA 1RWNB 3GZ7A 4HR7B 2AD9A 2IA0A 3PF4A 2Z8QA 4KYZA 4EZ9A 2MLXA 4CDIA 4DV2Q 1TL3B 5LJ5Y 2P9EA 5KGUA 4QU7A 3LO3A 3BN4A 4A3JG 4DUYF 4ED8A 1YIJA 5EKLA 2L9HA 4WWSA 4IFVA 2V94A 4MFBB 3E8OA 3OR2B 3UD4P 3TO8A 3CD6A 3SIPB 4P10A 2B6AB 1LWCB 1KQGB 4B08A 4IFYB 1SXTA 1Y1WB 5KG1A 3D6HB 1XNQQ 3EVQA 2BH2A 3GTQB 1KR4A 1N36L 2IAJB 3RLFA 3EDQB 2F0PA 4DV5Q 1CQFA 4TLQA 3JSMA 4TY8B 1EWHA 1R0CB 5DO2A 5HLFA 4LFAF 4RNNA 3GDEA 3TYTA 1KD1C 2D3UA 2EOTA 4OX9F 1CLFA 3AT1B 1PAUB 2WV6D 5CYQB 3QSYB 5HP1A 5ELNA 1SYDA 3M30A 3D6FB 2K14A 2JEBI 4FF1A 1TWAB 2HHHL 2HVEA 2KJWA 1AZSB 2BCOA 1SNQA 3F2CA 2W2MP 2CG4A 4HJAA 1HCZA 5DLGA 3FQKA 3MMAA 4ZPTR 3VF0B 1IR0A 2WRMA 2XSJA 2F0KA 4BS9A 5DAUA 4IFVB 4LF9L 2J6TA 1RU2A 3HULA 3MUTP 1N33F 3NMRA 2BJDA 2CPJA 5KFUA 1CQNA 5CCMA 1JLCB 4RW9A 2UUAJ 1I5OB 4O3OA 5J2NA 2UU9J 5CAAA 2CQPA 2VFRA 4ZP7A 3QGIA 2OXPA 4CLFA 2OD4A 3JSMB 2MTLA 4X3TA 4IYQA 2WVEA 3IRWP 1K8MA 1G51A 3LF0A 2QRRA 4JI2J 2HGMA 1X55A 5HLFB 2HYIB 2QEXA 2NXJA 5CQGA 2WB1G 3PF5A 2YWGA 2QFJA 5C3EG 1AUDA 4B3SL 4P2XA 4RA8A 4Y0FA 5HP1B 1MI2A 4ILLA 3O5TB 2E1AA 3M30B 1I94L 2WK4A 1RTJA 4TVAB 5E4XA 4USHA 3FUYA 1LKZA 4WORA 3HOZG 2MLZA 3S16B 2EYFA 4YCWA 3KXDA 4F7XA 1W25A 2YTXA 3RUBL 1U09A 1RSCA 2B4UA 3MMAB 4TLRA 3FVQA 1Y10A 3WQPA 2R6GA 4DR7L 1PJ7A 1TKWB 4PG3A 2H65B 3D0IE 4LR8A 3H4DA 4ZPVR 3A1YG 3GMGA 1L2FA 4KGZB 2KDOA 4P73A 4RW9B 4OYOA 4PG7A 5J2NB 4IO9Q 4JP8A 2OEOA 1IW7D 5JVH3 2VHGA 3QFWA 4LFBF 5IC6B 3NUCA 1R3NA 4N47A 1RTNA 2LQ8A 5FLXE 4ZPWR 1BUXA 1NBWA 1JLGA 1JJGA 1LLRD 1HNZF 3Q8DA 3VAHA 2D5DA 4KV6A 2J7WA 2KFYA 4OYMA 1VQAA 4USMA 2K33A 2QL5B 3TDQA 2HLUA 1W6JA 5C3XA 1YGYA 1WEYA 2R7TA 2XYHB 3NCQA 4E0DA 3M8WA 3E5SA 5HQ8A 4IH5A 4I7ZC 3I9V9 1YSJA 3A8JA 5KFHA 2CFXA 3KNAA 2YWEA 2JEAI 1I4GA 1UVLA 4JI6J 1XN9A 2JSXA 3SBMA 4KRWA 3V5RA 4GKJJ 3SV4A 1S1WA 3DOLA 1VFJA 1TZ0A 3CJ5A 2OWOA 4DX6A 3U58A 3H59A 3R93A 4LF7J 3K17A 3QT6A 3OPKA 4X62Q 5M3FH 1TUWA 3DYAA 1D09B 2QW7A 3BZDB 2HHWA 4PCQA 3RRKA 3N6MA 1U4RA 4XT1B 5ELCA 1SSOA 2HD3A 2N78A 2K2PA 4AYBB 1MW7A 3QGHA 1JLGB 3OTEA 2K6AA 4A8KA 1PTOH 1IYUA 2JA5H 3OFEA 1AFIA 4C3HH 2DGYA 1VQIA 1XX8A 3M05A 2Y0SB 1RHPA 2NN6I 1IW7C 2EY5A 2B39A 5CV4A 1V3ZA 3SCLE 2EEYA 3ZYYX 2NVTB 1VMCA 1WTVA 1T02A 1CT1D 4RMFA 2IDLA 4E2FB 1JB3A 3DHXA 2BOPA 2HFSA 1SVDA 2RRAA 2BDNA 3ZFVA 2QSFA 2KEEA 3DLGB 3QYYA 4EX5A 2RILA 5KG3A 1JMCA 4IDKA 4ED3A 5IE8A 2EG2A 3W60A 1X9NA 2MYFA 2XI3A 1KSPA 2I0QA 1M1KC 2O5JC 4DG1A 1D5XC 4C8YA 2GZOA 1HBNA 4P9SA 3NS6A 3PO3B 1AE2A 4A3LH 1MU2B 3FFIA 2ZBCA 2ZBPA 4FF3A 2FTRA 2A74C 3CTRA 2AJ2A 2OEMA 2CA9A 3IN5A 3KHHA 2HG4A 2HQLA 3DOLB 1K44A 5IYDG 5C4ZA 2X1BA 1TWCB 4A93H 2ZKUA 1ENCA 4V19J 5B0BA 3GQCA 4TN2A 2Z56B 1ICEB 3BGRA 1EU4A 1PTOF 3GTJB 1WTXA 3DYAB 3HF5A 5COYA 2ZOGA 1FWKA 2DIUA 1O78A 2ZH5A 5LSRA 1QCBD 2AZ1A 3H40A 3S2HB 1WWHA 5FLXY 2E5LJ 2KCTA 3ZTRA 3GFHA 3T9ZA 1S0VA 1Y1VH 2FD2A 2VBZA 2FJBB 3HKZB 5ETVA 3CB4A 3MTJA 1ZAWA 3TVKA 3VQTA 3AY0A 2VPXB 4DF7A 4RLEA 2UVWA 4BXXG 1SAPA 3P5TL 3E0EA 5C5MA 1VRUA 2KN4A 4NKLA 4Q0BB 4X4UA 2YWFA 3S14H 1G2EA 4IDKB 4QBUA 1K8AT 3R97A 5KG2A 3NELA 3BZKA 5D3GA 5C25A 4DG1B 5F8IA 2DXFA 1HBNB 1ZXTA 1N32J 5D4PA 4RCNA 2ERRA 1FVQA 5EX3A 3FFIB 1Z9FA 2H48B 3A3OB 1TS2A 2FLOA 3D2WA 1S9GA 4ECXA 2OLWA 5GAGI 1BQMA 3BDEA 3T4AC 5H9FK 4X4PA 2FHOB 4ZVSB 3KYHC 1SYBA 2F0EA 2DY8A 4NXMQ 3IRBA 1UVKA 4FNIA 5L9XA 5CV9A 3PACA 3HZXA 1LTGD 1PH5A 4JI7L 1LUZA 1P1LA 4YHHQ 5DDQC 2YKPA 2MQ8A 3MPVA 5B09A 4DSJA 2L1BA 1I50H 3TRZA 2J9DA 1FDNA 4YB7A 3PYEA 4FO2A 4DR5J 1SNPA 2LYVA 2XULA 4RBTA 4KLKA 2UUAF 3M2RB 3RR5A 1XWLA 2UU9F 5I9OA 3EGWB 4HSVA 1XTCD 1OXTA 4HDHA 2RE1A 4XXEA 4HI2A 1B0VA 4J8QA 1A6LA 3D4JA 4RGOS 1VRUB 1NK5A 1ZS6A 3LPYA 4F0HA 2NLWA 3QJYA 1U26A 1T8EA 4MTNA 2MGSA 5D3GB 2F03A 2A1BA 3M7GA 5C25B 4UOHA 3R1LA 1QE6A 4ZLJA 3JTPA 1NSKL 1Y9OA 2CVEA 4UY85 4EK2A 1XC9A 4Y6IA 2W7OA 1S9GB 4OXPA 4JI1F 2C2DA 1BQMB 1UPMB 2BM1A 2XCPA 3CC2A 3TVZA 4HJ9A 2VFTA 2IA6A 4LMQD 3N6LA 3A12A 3IWLA 3T1HF 4ZVEA 3NKYA 3AHPA 4KAIA 1FJGQ 1EIFA 2XLJA 1N8RC 2ROPA 4WU2A 2D3ZA 1B9NA 2WB4A 4LFCJ 1WTQA 2XLIA 3KOJA 2Q2TA 4LF5Q 2QZ8A 5DG7A 3FQLA 2QSWA 1GXDC 1IXRA 2NN6H 2DGWA 5IV3A 1GH8A 5GAHC 3IL8A 4O1NA 4LRCA 1EY7A 1A3TA 1EQMA 3NGTA 1T9YA 2E8GA 3IGVA 4AQYF 1X3GA 2WCXA 3K59A 3H0PA 4ZVQB 1YTYA 4O3NA 3CCQS 1VQ4A 3OHAA 2K03A 4G7ZC 1U7LA 4FYVB 3M9BA 1ENAA 4U8YA 1YVFA 1WTPA 4ZDNA 4IG0B 4JBMA 3POTA 5EN1A 1XMQJ 2E2HB 1DZ1A 1JLAA 4BBRG 2ATCB 3VHQA 5HROA 1UEKA 4CO5A 3K0XA 2XEXA 5IWAF 1S5DD 2V4DA 5CXTA 1Q16B 3KHRA 4RR5A 1AEXA 3N4WA 1YJNA 8AT1B 2A6HD 3C15B 3MCSA 4GO7X 2K4KA 1WC1A 5BXIA 1DHMA 2VUMG 1QZGA 2U1AA 3KJFB 2BX6A 1JWMD 1FKAF 2G9DA 3I4HX 1Q90A 4J15A 5A8WA 1X9MA 2HS4A 4LF7F 1VK8A 4DK3C 5KT4A 4DV0Q 3RR7A 2B2VC 2I9SA 5KG6A 4ME5A 3CCRA 3GFYA 1Q53A 2FQQB 1X8DA 4OZ3A 3U1NA 1NCVA 3TUZC 2KBNA 2DCUB 4P74A 3I4MB 4Q7AA 1QVCA 3L9AX 3QQCD 4JV2A 3D5MA 5I9PA 2ZJRQ 3M4OH 3FJ2A 1AT1B 4OI4A 3Q8RB 1LTSD 5K8OA 1B7YB 5KYIA 2GQ2A 2IDEA 5DQHA 2V0NA 4LR9A 1FNMA 2UXCF 3P49B 2QF7A 2KVMA 1FXRA 1EYCA 3BBFA 1PZKD 4LF4L 2KOLA 1QAIA 4A4IA 4XQNA 4QU6A 5D4LA 5HROB 5KFWA 1U4LA 5D78A 4C3MA 5AFWA 2DNHA 5KFPA 5EWEA 3S1QH 1ZZFA 2HZCA 2BQUA 2MQLA 2MQMA 4R8UA 3VR3A 1T3OA 2DK2A 2RQXA 1FD8A 4OZLA 2C5CA 4DXFA 4PMBA 2ZUGA 1TMMA 5LMUQ 5E5NA 5IP9H 2GHPA 2DR5A 3RLOA 2A1AA 5IP7G 4XYOA 3MM7B 2DJFC 2DY9A 3PX0A 2ZJPA 5A8WB 2BANB 1P8LA 3OLBA 5M5XH 2JFKA 1JJ4A 1U0SA 3CCLS 2A6HC 2R8GA 4ABNA 3OV7A 5JVHQ 5EQ0A 1JXVA 4ZKBB 5J1EB 3FKIH 2W7PA 4X3UA 3OW7A 1RAFB 3K5LA 3ILOA 3CC7S 3CE8A 2WAQB 3Q8PB 1K8OA 2QL7B 1RTDB 5K36H 2RBMA 3ITHA 1HNXL 1LWXA 1JORA 3M8PA 4LRFA 2JVOA 1Z7TA 4PPDA 3TOQA 1NY4A 1KS2A 5I6WA 2WB1E 3GJRB 2H9ZA 3TUIC 4K2LA 5L8RC 3FSYA 3BF4A 1H38A 2FLPA 1VQJA 1TWHB 4K59A 3GTMH 1T9WA 3BVZA 2V2VA 5I4DA 4R8UB 2M5YA 3ILJA 4H44C 3NEKA 1MKHA 3UN3A 2F3WA 4JI0J 2PI2E 2RDIA 4B3MJ 2OUGA 2PMZE 5ETKA 2I38A 3ZTSA 5I42A 2HAFA 1TFYA 1RHKB 3HD1A 1S4FA 3FCHA 4G57A 3J81i 2ZBQA 4MHEA 4B9LA 2CQCA 2F0OA 2VW9A 2A18A 3HOXB 1O5JA 2ZC3A 1HWKA 2VA2A 3W9JA 5C4XB 3J81U 3K57A 1QTMA 2UV8A 1WYDA 3GV6A 5CYJA 3NK9A 2NYHA 2HGLA 2YH0A 1RJTA 2ZH9A 1XMOL 4WYWA 3TQ1A 4ZRZA 3PKMA 3M8PB 2XMKA 4M5JA 2Z30B 2EXDA 1B64A 2J0TD 1CULA 4A3BH 4F4YA 2FJEB 2IX3A 2BW2A 3J80i 1TXYA 5J3BA 2QA4G 1KNEA 2JSOA 2MKYA 3AB9A 1FKPA 3PHEA 4Z9CB 5CMDA 1H9SA 4FF2A 4K2JA 3FBCA 4J1MA 5C3WA 5GADU 3J80U 1EY6A 2NZCA 3G2XA 2H4YB 5ETPA 4ED1A 1CZWA 4LF2A 3A8KA 3TREA 1OXSC 3F2BA 2E44A 4JW0A 3SXHA 3MURP 3NEMA 3RZAA 1IN0A 5I42B 1EQQA 1Y1WG 1Y14B 5KFXA 3BM7A 2KG1A 3QATA 2YWKA 2BJ3A 2DJWA 2QE5A 1HA1A 4P7VA 5HMWA 1WELA 2HS0A 1NPRA 1NE3A 4O23A 4LFCF 5EBDA 1DQ9A 4I64A 4DAYA 2OIHA 4A3DH 1H72C 4CP5A 4OFZA 2H4OA 4ZJLA 1NK6A 1BCPB 1EYAA 4XDXA 4KFBA 3TBIB 2PMWA 3MOZA 3MZ5A 1FRLA 4C0HA 5EAYA 1H9KA 4LBHA 1DD2A 4EU0A 2YTYA 1FKPB 1Z4UA 4AL6A 2MKIA 1WC5A 1HD1A 1VQNA 2A68C 2LXJA 2JL9A 2JEJA 2B4OA 1VQ8S 3QO9A 4ECWA 2V9WA 2AEMA 4B9UA 5KFFA 2NPFA 3ENAA 5EWFA 2AEFA 1PIEA 1VQKA 4I0WA 2DUDA 3DGPA 3BQ0A 5CA5A 3OUYA 3PCOB 3X3NA 4X4VA 3GTLB 1CG2A 1V9PA 4Y7NH 4ES3A 4OI2A 3UWTA 3KG4A 1VGYA 2R3VA 3B4DA 1S57A 3TAQA 1MSWD 3JAMi 1XNQJ 4BA1I 5HGQA 4GOPC 2WB1D 3MXGA 1JJHA 1IVZA 4DAYB 4OMFG 1X54A 4OHYA 4ECUA 3OWEB 3QJLA 3ENWA 4KFBB 4KPYA 4WKYA 3JAMU 3TEHB 3K5MA 4QIWB 3W5YA 3T1AA 1URRA 1T95A 4A3CG 3KHGA 2AHOB 2KM8C 4PQXA 2A8VA 2CQDA 1PSDA 1MWZA 1R8HA 3MI7X 1GMWA 4HIDA 1YX2A 3VR2A 3DMUA 2LMIA 4DX8H 2PMZD 2BJ8A 5NUCA 4OZNA 4ZPAA 3R9LA 1X4AA 3QO9B 2MQOA 3BYTB 1RT4A 3UVJA 1E24A 3ERQA 3GD7A 1LT3D 1OSDA 4BBSB 5KT2A 4A3MB 1JB0C 3KG0A 1V5IB 5CHCB 1Z47A 3C2PA 3OUYB 3T5KA 1U47A 3UCUP 2DH9A 2XO7A 3PMFA 4TXSA 1F3VA 2BM0A 2CIMA 4A3KB 1HJPA 2E1MC 2OD6A 1JMTA 3OQ2A 1ZTTA 1X65A 2L9NA 4YWLA 4KV8A 5HAOA 2QA1A 3CDWA 2ZZNA 4X64J 3KDNA 3RMHA 3QAUA 4X4SA 1QSLA 4DPGA 2ZC4A 4ECZA 2D0PA 2RQCA 3ONAB 4RO0A 1TWGH 2MZSA 5H9EK 2B8PA 2BDPA 5G3LD 4IG3A 3SV3A 1JX4A 3GTYX 3MM6A 4K0KQ 3L4BC 5KFVA 2G0IA 3S17H 1FL0A 1XQIA 3J81L 4Q2MA 4WRDA 2DN8A 3HPOA 1UVMA 1RL2A 3QAEA 5E3FA 4WFN3 1VQLA 2J0QD 3Q8SB 3CGIA 3M7NA 3GYNA 1WTWA 4LJZC 2RHSB 3GTPB 1KC8T 4JI0F 3J7YU 4B3MF 1S5BD 1CJUA 5BR8L 4AYBG 3EGVA 3RBZA 3DRYA 5AXKA 3G48A 3TANA 2R42A 1PVOA 2Y0SG 2HMIA 1WJJA 4ILWA 1T9TA 2QA4S 1NJYA 3J80L 1BBUA 1WG1A 2EJGC 3OHBA 1S1UA 3IAM9 1WF0A 4I6AA 3QWNA 2KFZA 4L75A 5KFZA 3MM5B 1KXLA 2L5TA 1K8GA 1HD0A 2VQFF 4NLWA 2I0XA 2CHBD 4X66F 3NWGA 1JK9B 1IBKQ 4B3RJ 4DA2A 4A76A 1R6VA 1VRTB 4USJC 3GFXA 2HURA 1FXLA 3SK6A 4IG3B 3PO3G 4NYZA 2B2TA 4HJ8A 4DUYL 1X31C 4OI1A 5E3PA 1UFWA 1OIAA 3CIZA 4DUZF 4DV1L 4DV4Q 1MN9A 4USUA 2DH7A 1OXUA 2MB0B 1FFSB 1KVIA 4NMZA 1TVRA 7AT1B 2C35B 4QF4A 3V4IB 4K6DA 1JWSD 4CKCA 4FZVA 1NTGA 1RWPB 4MIUA 1SPBP 2CW0D 2W25A 4TQUS 3Q83A 1PYBA 5DGBA 2PMHA 3C19A 3IM9A 3I4NB 1LFPA 3B6YA 3RNUA 4A48A 5IXUA 2KA7A 4JYAJ 2X3GA 1CJUB 3BSCA 4X62J 3RRHA 1FRHA 3HKZG 1APSA 4DAVA 3F44A 1YWXA 5D6GA 1SJED 3L7UA 2HMIB 2IX0A 4K5SA 4OX9L 3MD1A 4NCGA 5LMNJ 2YPZA 1S1UB 1AE3A 4HEDA 5ELFA 4A8OA 1CHPD 3NSWA 3Q23A 3FZBA 1VIXA 1X4HA 1YIJS 4DQPA 2I5HA 1JJ2R 1IUJA 2KG0A 1LV5A 3N9UC 2OCEA 1OY8A 2A2CA 3I8ZA 3I5BA 3CD6S 3K7AB 4IUVA 2B8GA 2YVSA 1KAWA 4XK8C 2NVQH 3CQZB 2AJ1A 4EMDA 8ATCB 4ZLNA 5F9NA 3CHBD 1N6QA 3H2VE 1N5QA 5HMYA 5KFQA 4CNYA 4P2FA 5JAVA 2FHKA 5EJWA 3TWZA 1L0WA 2F4VQ 4O0AA 3TP8A 1N33L 3M9OB 1TWFH 2L4NA 1XTZA 2YV5A 5M2PA 1I3QH 1TVRB 5T41A 5HQLA 2EFPA 1KNZA 4P75A 1EWIA 3DOKB 3TEGA 4DAMA 1RWMB 1HWUA 5IT9E 4H4MA 3JAML 1JLBA 2UVVA 4M5DA 1JKHA 3OTCA 4DV2F 5F2DA 5IIFA 1SMYD 3QWPA 1ZM2A 2FXQA 4C98A 4M1UB 2O4XA 2CW0C 1KLUD 3H98A 2QDLA 4JC0A 4Q0FA 2IC3B 3VALA 2SOBA 1KVKA 4ETXA 1BDOA 4RNOA 1XNQF 2CNKB 5E41A 4DV5F 2PPBC 2Z6BA 5EHHA 2DNCA 5IT9c 2F3IA 3EBEA 4U7CA 1NSNS 1VQBA 3DWPA 2FMMA 2HK2A 2JA8H 3M6VA 4TKOB 3KLFA 4RW8B 3NCPA 1TV6A 2B9YA 3LP0A 1IWAA 3OTOQ 1STAA 5GQOA 2B63H 4X65J 2YBVA 3GSDA 2VZ9A 2R8IA 5F41A 4YR0A 3VTIA 5EPKA 1IL2A 1Q82T 2F8HA 1D6EC 3DWAA 4CT9A 1U4BA 2QEXS 3G82A 4Y65A 3GILA 1RBOB 4H4MB 1D9AA 1JLBB 5FDLA 2ZXOA 4PG6A 3M32A 4M5DB 4LJMA 4GZYC 1JKHB 5C2GA 3NE5B 1O7IA 4IPDA 1P1TA 2ILZA 4L6V3 4F25A 1WFQA 2JLEA 1HNZL 1TELA 4EFAC 4PPZA 2Z8LA 4YHHJ 1PC4A 1SE2A 1XEZA 3R5JB 3W2VA 2BE9B 1JNZB 3U9SA 2K5NA 4YN3B 5DEHA 3T56B 1EL0A 3WIVA 3H90A 1T9VA 2E7VA 1J5OA 3KNGA 1SMYC 5IGCA 3CJRA 3M8QA 2XLKA 2BOSA 3TUJC 3G4SA 3V96A 2FDNA 2YTVA 3P20A 4CDDC 3Q8QB 3GP9A 3JQJA 1RBLA 3O44A 1TK0A 3LP0B 1NJIC 5JJLA 3G8SA 4R4TA 3KUGA 4FS1A 1EB0A 1PXUA 3I32A 4UZCA 5FJ8H 1PH9A 3FEWX 3IBWA 1PH7A 2AJFE 3E3XA 4FBTA 1S4EA 1WTBA 1BOSA 3C6UA 3M9MB 1NJIT 2MKCA 5EGYA 1J27A 5FDLB 1FX2A 4MIWA 4GNXC 1GX6A 1S7HA 5LM7E 3KF8B 4C2MH 5F8JA 1H9JA 3PR5B 3N52A 3FP9A 4FN5A 4IOBA 1CA6A 3SDZA 1FFGB 1TQOA 3LWEA 1N54B 2F9DA 1C4AA 1MWQA 4FDFA 3LOUA 3H0GB 3B82A 2QLWA 1JOKA 1HHSA 4PG4A 4LF5J 3GV8B 2FPHX 3M1VA 3QRRA 3JSBA 2HBRB 1XJVA 4A3EB 1CZGA 3F2DA 1BQXA 3LGHA 1J5OB 2DGXA 1NMGA 2PI5A 1EIHA 2D74B 3HMJG 1S9FA 2C28A 1U1OA 5I6YA 2D2CC 5I3PA 1WCMH 5HMXA 2IVFB 1YNJD 3H91A 5L37A 2HWIA 3QO2A 4B3RF 4NLSA 4DR7J 4F8MA 4OJHA 2WSFC 1SH0A 4WZQA 4DF8A 3U27A 1MJCA 1KABA 1K9MT 4LRDA 1GFWB 4WE1A 3C6UB 2LU1A 3V6DA 1IKYA 2JA7B 1CJTB 5FJ4A 2WVCA 3UDGA 1PH3A 4HMJA 3IS9A 2VFSA 4CGYB 3RZDB 5KG7A 2IJRA 2OP5A 4WP3A 1TR5A 3IG1A 1U25A 1I4QA 2RHQB 1SV5A 2V2KA 4HLBA 3TN2A 4K5RA 1L0YB 2WAQG 4DNIA 3V2UC 1W6KA 3CWJA 2HBZB 4WBFA 4L5QA 1I6HH 4DV0J 3LP1B 4X62F 4N76A 2ZWPA 3IRXB 2XQCA 3ULPA 4HT7A 3S1NB 4N9TA 1KHIA 1Q79A 2DNZA 1BR9A 3HOUB 3IR6B 3I70A 3QBCA 2F0NA 2AUKA 2GIQA 3CKIB 4J9NA 2OI2A 4C3IB 4XPEA 1TAUA 3HHEA 2XS2A 2YU9B 5GMEA 4YFUA 1MHWC 2X7IA 1VQSA 1S12A 2YXLA 4WTOB 2HHHQ 2CQ2A 5GAGU 2JXMB 2RSQA 1TP7A 5T14A 3AODA 3GIRA 3NWTA 2VU5A 1EY0A 4FDBA 1OO9B 1VS3A 3MR2A 1W2BR 4OZ2A 1X3QA 2HWHA 3W3AA 4IN3A 2OMOA 4YY3J 3R7SB 4ZQ3A 1O80A 1KQSR 4I6WA 2R2RA 4H13C 1AW7A 3GTKB 4G6VB 4BDPA 2HUGA 4WE1B 4WFNQ 2MY7A 3V6DB 2KZMA 3I72A 4LF9Q 5EGTA 4JI4Q 1IKYB 2D7SA 2B4PA 3IS9B 1JE5A 3HOXG 2MJNA 1PH1A 2UUAL 2UU9L 3L7PA 4F2SA 3O3LA 1SV5B 5J2MA 2JHEA 3K7UC 2MFIA 2V34A 1ELOA 3WX4A 2MLYA 4OI3A 2B5JA 4PMWA 4E8UA 2LEAA 4DFAA 3MPDA 5HANA 3W2WA 2MP1A 2DNRA 1HI1A 4ZKCB 1N34J 3MAAA 4ZS6A 3KLWA 2CQ4A 4QJVA 2UZAA 3EYZA 1DOKA 5C44B 3MUVP 2R7WA 2F8MA 2HZVA 3VAKA 4FYXB 1SBRA 3I5AA 1ZM9A 1I94Q 5IGEA 4JI1L 1VQ9A 4JBJA 1P16A 3OPOA 1I1GA 5T1IA 2CDQA 1Y8NB 4DSKA 4LVOP 3EMTA 4P72A 3H6MA 1HMVA 3K6OA 2XTIA 2D9PA 4L73A 5DM7Q 3B78A 4O4GA 3L2PA 1L3KA 1E6VA 4NZ0A 4K5WA 4X65F 3TNVA 3T1YJ 1GO3E 1KDAA 3NTKA 1RT2A 5ADZA 1H7XA 1EAYC 2DNLA 4L72B 2LFNA 4IUUA 1G3OA 4G1IA 1WC4A 2FLLA 2UV8G 1SJRA 5KFGA 1T5XD 4FVMA 4AYBE 4DDFA 2KI2A 4AQYL 3RU0A 4J9OA 1RAIB 3AFQA 2B5JB 4NXMF 1LTRD 2Y0SE 3GCXP 1GXUA 5EPJA 4JI8Q 3PKYA 4YHHF 1JCKB 1VF5C 2C2EA 3MAAB 5K5PA 4OIXA 3PW4A 4OYPA 4GLVB 3SCIE 2XWXA 3PFEA 5IWAL 3EE3A 5E7OB 3AB2B 3A8JE 2AGQA 4U7UD 1M4VA 3SCKE 2EYLA 4ZUIA 4LK1C 3AXMA 1NK4A 4UTGA 4ZVTB 2ACMA 4RWWA 2BA1A 1HMVB 3JSYA 2I6WA 1VC5A 3LP2A 4PWDA 3P45B 3I2ZA 4DL7A 3SMZA 2OTJS 2XMJA 2WOMA 3CPFA 4LF7L 3US5A 1GAOA 1RT2B 1TU0B 1Y69U 3MOJB 3PZPA 1VQ4S 1IBMJ 2HPUA 3UR3C 1EZ8A 4W92B 5BN3A 4RGMA 1WHXA 3HKZE 3CRKC 3IXQA 4Q45A 2OTLA 2EYPA 3GWCA 3C14A 3EA6A 2QIFA 2JE6I 1FJGF 5FK9C 3EVWA 4LR7A 3AJ2A 1NHUA 1DURA 2WONA 2UXCL 1YJNS 1X4FA 4FP9A 1XPOA 2MKSA 5B0AA 3ENVA 3FKBA 3KLGA 4LF5F 1YEZA 4KHZA 4X4RA 3KJQB 1IL8A 1KWMA 3GYGA 4AE5A 2WACA 4ELVA 5GMDA 3HHNB 5IOCA 2ZJPQ 3MAQA 1IKWA 2EVBA 3GO5A 3KK2A 2O2LD 2DEJA 1HHTP 5IZHA 2PEBA 3OMGA 4PKDB 1D8YA 2YTCA 1S72A 2XYGB 4IO1A 1DOLA 4G1PA 2ZNZA 3CCWA 2VDIA 1X5PA 3CCRS 1JB7A 2J9CA 3DM2A 3LP2B 4PWDB 4BBSG 1I3OB 4A3MG 5J39A 1F2HA 1QTNB 2KECA 1YQHA 1SNMA 2NUUG 1UW4A 2BRLA 3CT9A 2HFUA 2LXUA 5IYCH 4A3KG 3WZ0A 1X4DA 3UE2A 1LTBD 2EXZA 2K01A 3T53B 1CS4B 3C14B 1HNVA 1YBTA 2ATLA 4QWEA 2WIIB 1FKOB 2ZWOA 4LIRA 3PUWA 2UXDJ 1UCNA 2AU0A 2YNIA 2WONB 3VYTA 3ISND 3EWGA 2BKPA 1H2VZ 5FLMH 2E1PA 4ENOA 4DV0F 1NJZA 4J5OA 2JEIA 3KLGB 3HKSA 4F3MA 2D3O1 3EPGA 2YNHA 3SZ2A 1B1ZA 4DPOA 5DM63 4M95A 1ULRA 3D54A 2XGTA 1N32L 3R3OA 5C2CA 4NPSA 4IRKA 1B50A 3H3VC 3G87A 2MZ1A 3BS1A 2LS01 1YK9A 3UDVA 3DM2B 3SSSA 3VA5A 1ESRA 2LQ5A 2CXEA 2H1EA 3UR0A 4BCAA 1QG7A 4OX8A 5A6WA 4K4XA 4AYBD 3P96A 3C3LA 3CJTA 4MMOA 3HT3A 3ADAC 1IJEB 7FDRA 5M3FB 4RUHA 3DU5A 2Y0SD 4G3IA 4IPHA 4GOPA 2MPUA 4JI7Q 1MROA 4WJBA 4GN4B 5D0GA 3BEGB 5A2QE 3ZJYC 1HNVB 1SJFA 5LMUF 1Q7LB 1FFWB 3SFUA 4RHRA 3KUHA 1VQOA 2N49A 1D7QA 1HA5A 1SQGA 2YNIB 5JJIA 1PTOB 2JA5B 3HZEA 2HW3A 4C3HB 1AZQA 3UO0A 4USKA 2GJFA 4GLXA 1WNEA 2E2IH 2YNHB 1NH8A 2H51B 1TFWA 1IKVA 3U9OA 2TSSA 4DR6J 1RLDA 3ISNC 3IA0A 2CNLB 3L7ZC 3PO5A 4DV6Q 4FXDA 2YKNB 3U02A 1ENFA 4ID5B 4JV5Q 1WI8A 4PXDA 4K0KJ 1DGSA 2GJIA 3T13A 4UQTA 3P1HA 2PNHA 3UDXA 1FXDA 3I4NG 2RMLA 3KMSA 1UZDA 2ZE2A 2DHGA 3M6WA 4MK9A 3RLNA 3HKZD 4EQ5A 4A93B 3H2LA 2AJ0A 4LFCL 4GOPB 1DZ5A 1F60B 4ED7A 1MROB 3T1YF 2NB0A 4PQUA 4OO1G 1WOCA 2HVZA 4WZMA 1FJEB 2L15A 4HIKA 3HVWA 4JCVE 1HNXJ 1M5PC 3NBPA 1FE0A 2HHSA 1Y1VB 2QFIA 1D5MC 4Z7YA 4YR3A 3MHYA 4IOAA 3FEZA 5KFJA 4CLWA 2FY1A 1PG5B 1F9PA 4J7CA 1E0BA 3CO0P 1DLOA 1WJ9A 3G6VA 2ZVIA 3LWMA 5E4WC 4YR2A 1GKHA 2ZM6Q 3IR5B 3KMQA 1VJWA 1IKVB 4LBIA 1FDDA 1ZEQX 4DLEA 4B9SA 2RSOA 2KVQE 3S14B 5L1IA 1IBKJ 4CHTB 1S5CD 1FRXA 2KVIA 2R2TA 3DHQA 4RH6A 2Q8IB 4KKSA 3OW2R 2IL8A 4NXNQ 4NLOA 2ZBIA 3MEEA 2M8DB 4P6QA 2HNZA 4NLXA 3D6TB 2DGVA 3UNGC 1X4EA 3W61A 2UUWA 5KG5A 2RDFA 3OVAA 2ROGA 2LQJA 1IM6A 4WYLA 3DWQA 2VL1A 2F9JA 1SC4B 1VQPA 4YQWA 1JICA 1QNKA 4OYBA 1NSQA 1RA7A 1YRTA 5IP7H 4TQRA 3B54A 1I50B 2WAQE 1EHWA 4ED4A 3VVTA 1IBMF 2N3OA 1RD9D 4USIA 3NBPB 4NCAA 2FZKB 3L3OC 4GLAC 4OYIA 2K06A 1DONA 1RI7A 3IAS9 1VQNS 2EC0A 2GN5A 1HQMC 3HSJA 4K8JA 3BBBA 1DLOB 3CULA 1RWVB 2IRYA 4OLPA 4MH8A 3NBHA 1STYA 3PVXA 4DQSA 3BGUA 3IO1A 2HHQA 3SSRA 4IFDG 1OPIA 4RBVA 1N5VA 3FBFA 3PRBA 3QZ8A 4A3GH 4HIOA 1RT7A 4R0EA 2H3EB 5AXNA 4Y28C 2CUYA 4ECQA 4Y3CA 1NSPA 1GX5A 4ZP6A 2JJ4D 2Q3PA 3I5CA 3QSIA 1M90T 3EZOA 4LQ3A 4LF4Q 4PMCA 3PIOA 2MXYA 2VC1A 3ZTPA 3CDBA 2IYIA 1O7ZA 4NLUA 3CD0A 1X0PA 1FERA 2WZ1A 2JK8A 4LF6Q 2RF2A 2E5JA 2HNZB 1EEFD 1KLGD 1D0EA 4NRUA 2F4VJ 1KRSA 3K5PA 1PV4A 2C2OB 1LWFA 3M8SA 4K4YA 2JYOA 3FHWA 1PH2A 4K4WA 1XTDA 4RX6A 2JA6H 3BDPA 4WIIA 1KN6A 1J8IA 2PW5A 3M4XA 4DXGA 5IGDA 1FX4A 4PRFA 3H15A 3ZZZA 4MKYA 4R4OA 1XWEA 3EFXD 4WPAA 1KTKA 2OPSA 4EBDA 4F02A 1PMRA 2E7XA 3CVKA 1T5EA 3LALA 2Z4PA 1RZMA 2UXDF 1QJOA 1RYSA 3CCZA 5C7PA 2CJ9A 2AMCB 1GQEA 1JWWA 1RT7B 4IUFA 2QDBA 4CDCC 3AYHB 2ZH7A 1OJ4A 3OFHA 2CFMA 4DN4M 1NK7A 2QV6A 5E2QA 1CTMA 1X5TA 1K47A 4DPYA 2LCWA 1F2ZA 2CQ0A 5CZVA 5B0CA 5B0EA 4JI0L 4B3ML 1CJKA 1UW9A 3MPWA 1ILQA 3O13A 2QYGA 2P2CB 3S1RH 2GMHA 2OELA 5C24A 1UAPA 3V4MA 1FNXH 1G7CB 4HTHA 1DBDA 4CH7A 4DS4A 4C8ZA 5C0XG 1EQVA 1Q8IA 1Q7YC 4GO5X 3H0GG 1RWUA 4CWBA 2XWYA 1R8PA 4ZP9A 3DRXA 1PFNA 2OPSB 4OIKA 2VQFL 3VA7A 4A3EG 1VI7A 1SXLA 2KJXA 4AT1B 1TL1A 4YDXA 1LK5A 1UVNA 3I4OA 4X66L 1TAQA 1Q7YT 2B3GA 3J7AN 4KB7A 2AEJA 3PW5A 1WHYA 1VQLS 4C56C 4YCVA 1FESA 4Q8FA 3M4OB 2JA9A 3E51A 1IR1A 4ZPCA 4H4KA 2Y1IA 4DUZL 1EIYB 2BABA 5J2QB 4CDFC 2DEIA 3EXCX 3E6ZX 2UUBQ 3MF5A 1SNCA 1UEUA 4ZYSA 5HL7Q 2CWKA 3A8KE 5HN0A 1F9SA 4WCEQ 2LFVA 3S1QB 5IT4A 4FXGC 1C0AA 2ZITA 2JA7G 2GA7A 1CJKB 4K0KF 4CJ0B 3CCVA 5E3AA 2M0GB 5C24B 4ZCKA 1F9EB 3KJVB 2I2YA 4F0MA 2WAQD 3HVAA 1SQEA 2PT0A 3LWUA 4KHPJ 3PUZA 5AJ3Q 2WFWA 3W1GA 3D67A 2XMMA 4M5LA 2C42A 5KFLA 3GB0A 1WI5A 2XY6A 4WK3A 4JI5J 4N8X1 3PO2H 3UN5A 3HOUG 3MR5A 2M00A 2V4RA 4EEYA 3FKIB 3NS7B 5JEAG 1LT4D 2X69A 5K5MA 5M5YH 4C3JG 1H2TZ 1TMJA 2CPIA 4QIWE 1X56A 4C3IG 2ASLA 1HFEL 3IKJA 4WP9A 2ALZA 4L5SA 1U1MA 5K8NA 1GTHA 1HBUA 2DTJA 2F1MA 4EQNA 2HFOA 2BYCA 1V3SA 3G6YA 1F9QA 1NKCA 2L9WA 5DM6Q 3RBXA 4R0JA 2LY7A 4TYBA 5D0RA 4Y34A 2F0HA 4K2KA 5EBCA 3KKFA 3OD2A 1KOOA 1IBKF 4M5NA 3BVGA 4YWKA 1X7VA 4I6YA 2FMCA 4GNXA 3CJ3A 1IXKA 3S01A 1RWOB 5KFYA 1NO8A 4PV1C 3NXZA 2MPMA 5IYBG 2NUCA 5BR8J 4ZJOA 4PYAA 5LSLA 4PR6A 2M9VA 1CC8A 1U9RA 5ETOA 4Z2XA 5GAEC 2QEJC 4DV4F 1FRKA 1K0VA 2V4JB 2KHSA 3HOVG 1Y5IB 3BYYB 3PV8A 2MJUA 1U1PA 2HHTA 1TVXA 1QVGA 1XNQL 1T9HA 4JOIC 4DV5L 2CAJA 2BVZA 1E2VA 2NZHA 2VPWB 1A7GE 1I51B 4DS5A 1B3QA 1DTTA 4R4IA 2NQPA 2PFDA 3A56A 1SL2A 1H0HB 2LXKA 4A3BB 3GV7B 4K4TA 4GC7A 3MMCA 3HI9A 3OJSA 4IH7A 1N56A 5GADI 4WFBQ 2YNGB 3PYGA 4KKOA 4Z37A 2Y3YA 4CM2A 1T7PA 6FDRA 2R7FA 1NK0A 3E9IA 1PBAA 1K0TA 4GNXB 3FVYA 1CKNA 1I4HA 1I5FA 4X3SA 2DPIA 4F2RA 4ALPA 3AD7C 3F2UA 1RKIA 2KU7A 2QGFB 2F4VF 4C8KA 2VFVA 2B2YC 1RAOA 4LFAJ 2EG1A 2MKKA 4Y2MA 4DR3Q 4OV1A 3SR1A 1BCPD 4B9WA 2PCFB 1LK7A 2A69D 4J9SA 4ZVRB 2BE7D 2NTTA 3J7ZT 5CD4H 4X64L 4J9LA 4DV7Q 2ZOFA 2AWNA 4P7TA 3L09A 3JC66 1EY4A 2RF4A 5HVFA 4GKKJ 3PO4A 4A3DB 2NCKL 1IBLQ 2AW0A 3G71A 3K89A 4DR4Q 2Z1CA 2NVTH 4WFXA 3GIKA 4C1NK 1JOOA 1WDDA 2GQCA 3AU7A 3EIVA 2LVWA 3MMCB 4Y2AA 1N33J 4YDDB 4KD3A 4HJ5A 4KKOB 3R2IA 1Q81T 3M2VB 1SL1A 4FYWB 5A8KA 2H5JB 1P9YA 3A5UA 2K5VA 4RG1A 1VQYA 2ASYA 2IWHA 1CKNB 3I55A 4ECVA 1U02A 3CMEA 1OY6A 5ITHA 3D0GE 3P4UB 5KT5A 3VVUA 1NZ8A 4K8RA 3VAFA 1XNRJ 2ZZTA 3W63A 4BS2A 2XTJP 4R8NA 2O5IC 2X1FA 4N7TA 5G0RA 2HRUA 3QB3A 2BJ9A 4OL8A 3G4SS 2PFFB 1U0LA 1ITPA 1HWIA 4YIJA 1ZM4A 4Y7NB 3CU7A 3JB9k 4ID6A 5J2PA 2OQ0A 1ESFA 1VQ5A 2MGZA 4OJGA 1CJVA 4CYUB 1UE7A 4U9RA 5B0GA 2V5HG 1BCPC 4QR2A 1EX8A 4NZ7A 4ZIWA 3LTOA 4JI8J 4JI3Q 1HYSA 3H5SA 2A69C 4B3RL 3PX4A 4K14A 3EN2A 5A8RB 2QC3A 3MXHP 1HTLD 1HPZB 3QT7A 3T16A 1PHJA 4UY8T 3HO1A 3M8YA 4RL1A 3S7RA 3D6CA 2R93H 4QCLA 2V67A 3CJQA 5A8KB 4DUYQ 2P6SA 5IGBA 2R7QA 3KLSX 3PNIA 1X4GA 1STHA 4LFBJ 2UUCQ 2K04A 4DV1Q 4URSA 3G8TA 3GQBA 3LA0A 2ADCA 1OSCA 2KHDA 4ICLA 2VB2X 4BY1B 1HNZJ 5G0RB 2CQOA 1RB0A 3C16A 2YX1A 3A13A 2BRKA 4X62L 1EETB 2J7UA 3BSNA 4DAPA 5J22A 2DHAA 1PYWD 4ZKAA 2MZQA 4JG2A 3BH7B 4H7BA 1CJVB 2QX0A 4OYXA 1YDLA 2CH4W 3TAPA 3KHLA 1OS5A 1G291 1QVFR 1YI2A 4JI5F 2QYCA 1HYSB 1F2GA 2GHWA 1HQRD 2N4DA 2E76C 1TWGB 2O67A 4B3TJ 1XPUA 4DBQA 3PG9A 1YJTA 1F2MA 4R5PA 5M3MG 3UI2A 1QAYA 2V8GA 5K9FA 4V1Ak 1TY0A 1P9QC 3H8YA 3RN2A 1HBMB 1YG0A 3S17B 1LWCA 1VQCA 1ZH5A 3CJ4A 3E01A 2VONA 4BWGB 4POFA 2WSEC 2WBMA 4ICLB 1NZAA 3Q89A 5M3FG 3LAKA 2I5LX 4WKRA 1ZOTA 4N56A 2IAJA 1X4CA 3J7YI 2IM2A 3R5BA 1TL7A 3EDRB 4OONA 2RS2A 2ZTDA 3BPSP 1H73A 3I4PA 4M94A 3MECB 4I7AA 2G1DA 5DLQE 5LT5A 3TA1A 3PIO3 1N0UA 1SH2A 2C1EB 3MCMA 2JA5G 4M5KA 3JQMA 4C3HG 2BZ2A 3M4YA 3ISZA 3HOWH 2WW4A 2CH4A 2RVLA 4J90A 1UWAA 2FUG9 2J76E 1A2TA 4KY5A 3TVYA 4C8LA 3CMQA 4HH1A 3RR8A 4UAIA 2W01A 3N0VA 2HWTA 4I4BA 4AIMA 2VFUA 4PZ7A 4BY7H 3WDOA 1AZSA 2OPQB 4M1KA 5KFAA 2ZXPA 4C0BA 1YHAA 5H9EJ 2R3ZA 1RTZA 3M3YH 4X4TA 3PY8A 1MIUA 4R5PB 3EUNA 4A3LG 2FB0A 3DFEA 4X65L 1S1XA 2YPYA 1U49A 1U1QA 2VZAA 2V1CC 3W65A 3BR8A 3AOBA 1EARA 1Q8LA 2ZFHA 5DLFA 1SKWA 4A93G 5DG9A 3E01B 2M70A 3TZXA 3DEOA 1JLCA 2F4IA 1X4BA 2D9OA 4NYPA 1C7YA 3OXFA 2HHHF 1G1XA 2W8KA 4DL5A 3RBEA 1NJXA 3MEKA 1AROP 1GTEA 3HJFA 1TL7B 4NXML 4LF8J 3ET6A 1TUGB 1I4PA 1Y1VG 5BYRA 4YHHL 3OVBA 2MUYA 1NDCA 1VQ9S 4LF9F 4JI4F 2HVDA 4MKBA 4CLTA 3KFUA 3C66A 3W1BA 4K50A 3BDLA 1Y7PA 2G9HD 2K5DA 4YEAA 1LACA 2J4XA 2R7UA 4OELB 1AUSL 1HW8A 3SQGB 1KD1T 1NSAA 3LH2S 4GKKF 2J6UA 1LFWA 3KTQA 1MLAA 2FY8A 5KT3A 5KG0A 1ZETA 1EQ0A 4HAEA 1GMVA 1XIQA 2VQEQ 2ZXRA 1T94A 2B2UC 3SI8A 1EOVA 4F36A 5A0YA 3W3SA 4LRAA 2NVQB 2B9EA 4JOUA 3G86A 2MO0A 1S1XB 4QIVA 1NPKA 3CD5A 4DV6J 1GUGA 4IQZA 4GMKA 1HRJA 3BS9A 4DCJB 1UJ5A 1I94F 1TWFB 1U1RA 4DR2Q 1WF2A 1K0RA 3SQOP 1I3QB 3QOJA 4C8NA 3VYSA 3CEDA 2HQEA 1RWWB 3KFWX 4FPIA 4HTIA 4ED2A 4A46A 5ETQA 4O3QA 2SNSA 1V1OA 1FJGL 2PO4A 1XNRF 3ET6B 2OF1A 2K7JA 2ZH3A 2XC9A 4ERDA 2WINB 3J81E 2CKZB 4LF5L 2MNAA 1VQHA 5HY6A 3BSOA 3A4TA 4ZLLA 4XT3B 1MMNA 3T6BA 2MMYA 2N88A 4I65A 1U2CA 4JI1J 1BWEA 2FJDB 3A8EA 2IM0A 3VGVA 5AT1B 2F0UA 1AN8A 1Q8KA 4KT0C 5LJ3Y 2IY5B 4JI8F 1ZAXA 2KT5A 2B2TC 2HHXA 3T1HJ 5A0YB 3MFIA 4O0NA 4GN3B 5D3IB 2JA8B 3J80E 2OTLS 3NOGA 3D31A 1IBCB 3W8PA 2JVRA 5IT0A 1UL3A 1EJ7L 2B63B 3H4BA 4U67Q 2PYKA 1FD2A 5LMNW 5AE1A 1N0VC 3BO4A 3CPWA 4RW6A 3HFVA 1GHJA 1FTCA 3WIUA 3ZZRA 2XSFA 3UD5A 1MNEA 3GYXB 4AQYJ 2N7YA 4C2MA 3MR7A 1U2RA 3UE0A 5IT9U 2BE2A 5KOWA 5KRUA 1WG4A 2NN6G 4KK7A 3TS2A 2RKIB 2COLA 1S72S 3MEHA 4DV0L 2W2NP 4V19X 1BLUA 5LL6X 3CCJA 1MMDA 1K0SA 4A3FH 4QWCA 2E66A 3DLGA 5IWAJ 2DO0A 3HVRA 1A62A 1YITA 4QZVB 4QPXA 2DYAA 1FD7D 1R0BG 3PM9A 1HNWQ 1REVA 2AIRB 2KT3A 3I7FA 2K1BA 2ZHBA 2IW3A 4M5GA 5D14A 1MU2A 5FLXc 1HUMA 1VDZA 1ET6A 3D6WA 4IALA 2AYGA 3FSXA 3I87A 3R6LB 2VBXA 1S77D 1RHUB 5EDWA 1QY7A 3W8GA 2GIRA 1KNAA 2OO4A 1M5HA 4B3TF 1TL5A 1YJVA 3G9CA 1VBZA 4YY3L 2F0SA 4LSLA 2EBEA 4OI0A 3NMAA 3HOYH 3HP3A 1N9WA 4RW6B 4N9PA 1UVIA 4L3NA 3BZQA 2R7ZH 1NLKL 2XZWA 3AOAA 1QSSA 3TJAA 5LMUL 2ZDPA 4XAKA 3NOCA 1YBUA 3R5AA 4C2MB 4EZ6A 1VQEA 1ZYRD 2KO1A 2B2WA 2VL6A 2E5IA 4B9TA 4Y2KA 3J81Y 3HJVA 2BE2B 2UXCJ 3G6JB 4DLGA 2RRBA 2WKDA 2DXDA 4B3OB 4Q43A 2FVCA 2GVAA 4Q0BA 1IKLA 2V9KA 3GTGH 2E1RA 1LO5D 3C6TA 4CLYA 3T5HA 1N34L 4JI2Q 3JAME 4ZPBA 5MLCV 2YKOA 2GVDA 1RT3B 1REVB 1WC3A 4QYZK 2V2ZA 1U24A 1T3NA 1OMSA 2WSCC 3D66A 5D0EA 2GMLA 2F3VA 1Q95G 3J80Y 3OL6A 1WCMB 1X3EA 2I07B 5E1FA 3ZC4A 2EWHA 1PZID 2DNPA 1M1KT 2V4QA 3QT8A 2RCNA 1U48A 4OZJA 1VQOS 4LSLB 2OJ3A 4IOAQ 4O44A 1ACMB 4DSIA 3ZZUA 1N48A 5HK4A 3CC4A 4ZK9B 2P9GA 3T1YL 2HHUA 1OXVA 4DNTB 1KOHA 1AZPA 2VD3A 2F0JA 2XWBB 2HIVA 1UTAA 4ZHRA 3M2RA 1B53A 4DEZA 4N8FA 3GTLH 4RCOA 1SQFA 5CBEE 5KFIA 2DR6A 3FKIG 3W62A 5KT6A 3RAMA 2XI2A 5JVG3 2RJZA 2NREA 4BWMA 4LF8F 5K36G 1T9UA 1I6HB 3H94A 3OSOA 2CJYB 1PRTD 3C6TB 4TY9A 1ZYRC 1K1SA 1IKXA 3HHLB 5CH7B 2R8HA 2QJ3A 4JI7F 2GVDB 5J1ZA 4KD4A 1SLJA 4KGMA 3A55A 2D41A 2D1CA 3ZZOA 3CDEA 1PILA 3GG0A 3W5OA 4EQPA 5KFOA 4JV1A 2EDGA 3F73A 4IUPA 2MZRA 2A6OA 1SYGA 3RB3A 4NB3A 1HQ2A 2IPKD 3EZUA 1S48A 2UUBJ 2E1CA 2P5VA 4JI6Q 1WC0A 4HT5A 4O44B 3AEVA 4GKJQ 5CV8A 2EFVA 2KFNA 1A15A 1KP6A 5FO9B 4DV6F 2R92H 2FVRA 1VLOA 1XMBA 2RU9A 3TI0A 1GHKA 4MKAA 4JV5F 1IBML 4ZHRB 1V1PA 5ETLA 3MXPA 3QNWB 2ALYB 3C8YA 1J9OA 4NLYA 3PHTA 1X3FA 5AJ3J 5ETRA 3PIOQ 4KC5A 4IFDJ 1CPZA 5IS2A 1BBWA 1JR0D 3UFCX 3JAMY 3PX6A 2VOPA 2CQHA 1IKXB 1HBOA 4IG0A 1G6BA 1J5EQ 4LUBA 2HQCA 1YJRA 1JXLA 3J7AV 4A3BG 3CCMA 4ITSA 1VBKA 2CCZA 1HFNA 2D0OA 2G0CA 3OXGA 4M5HA 1PRTC 1VQPS 3S8SA 4EUVA 3D1HA 3GTOH 3BYPA 4YUDA 5IT9L 2J5AA 3C15A 2C3MA 4J9KA 1ASYA 2W4CA 4NPOA 3J7AF 2ZM6F 1H9RA 2XSCA 2PZWA 4IFDI 2KEDA 4PWUA 4RHSA 5F8LA 2RVJA 4WTYA 2JDJA 4K4UA 1FR3A 4GRSA 1PC5A 4TNOA 3N01A 5JOBA 3VGUA 4J6HA 1BUVT 1U4PA 4NXNF 2IBKA 2J9EA 2CQIA 1V1PB 1HHQA 1YNXA 2CPDA 2VDHA 4X4NA 2VBWA 4DQRA 3LGJA 4DCPB 1MWYA 1N8RT 3D1QA 2A0FB 2D3OR 4WU3A 4B02A 4KN4C 2OTJA 1XERA 1KVJA 4QW9A 2E5LQ 2OEJA 2DNKA 1FTRA 2UXDL 2WP8J 1FWPA 1RP5A 2EYOA 1S1VA 4A3DG 5BJRA 3MMBA 3P6YC 4DF4A 2JEGA 1H7WA 1W3SA 1X3PA 5D3DA 1HBOB 2XNRA 3I4LA 1Q5VA 2ID0A 5B08A 2C3PA 1Y4ZB 4YOEA 3UI3A 2EYMA 3WC2A 2KHCA 1M5VC 3VCDA 4DGZA 4DXLA 4ZVGA 2F0IA 3D3CJ 2QKIC 1YZ6A 2R61A 4IKAA 4JB8B 3VAGA 2BV3A 1N32Q 1SJ1A 2DH8A 2LSSA 3O2IA 2EY2A 1VDHA 1DAXA 2FFKB 2J6SA 2QGQA 3MM7A 3S15H 2HVHA 4J9MA 2GC8A 2BANA 2JJQA 3MA2B 4OJ3A 3CJKA 4BBYA 4F8RA 5L38A 2FJAB 1UJ4A 3SEOA 1B44D 4LF4F 4PZVA 1VK3A 1YBYA 4CIOA 5J1EA 2H5XA 3KBXA 4LF6F 5LL6S 1EFWA 4JOIA 4RUAA 2PI4A 1ML0D 1QAJA 1RTDA 1FT8A 2HQDA 2NYZD 4DR5Q 1SYFA 1VBYA 1S1VB 3UPFA 2E9RX 3MMBB 4EBEA 2JZ5A 1K3BC 1E2WA 4WJWA 5D4NA 2IM3A 5ELDA 2B3TB 1ZAVA 1HUNA 4NP5A 2DBBA 3DLLA 3I82A 1IBLJ 2VG7A 1VS0A 4ZN3A 3K80C 4DR6L 4DFJA 3OYYA 4C4WA 3I3CA 4KTQA 3F8TA 1LM0A 1M8AA 3PW7A 4NL5A 1MSHA 4CI0B 3QIPA 2E7WA 1B0PA 4K0KL 1VCIA 1HR0Q 5AE2A 4QUFA 1CC7A 2OEKA 3URYA 5IQ6A 2LXIA 4BY1G 5L46A 3O8WA 3CJKB 1LT5D 2B2YA 4FKXA 1R8CA 2DNYA 1S76D 3BGFA 3IC1A 2Z9HA 1NAPA 1VIOA 1RYRA 2GX8A 4KSEB 1UEVA 3MC0B 1NH7A 4FXKC 2Q6CA 1H95A 3D3RA 3CCSA 2H5IB 2EE1A 3HSDA 4LIWA 1RAEB 2XS5A 5I3UA 1CVJA 1DRZA 2M8HA 2DRBA 3RTVA 4X4QA 3QIDA 3A8IA 5JMNA 1BVSA 1A6XA 1M1HA 2DGQA 3CCVS 4DL6A 4ZVOB 1HARA 2VG7B 3VR1A 4DU7A 3V81A 4KJIA 1KONA 3E2EA 1IBKL 1XMQQ 2CJBA 5I2YA 2ZHOA 1U6ZA 4IFDH 3QIPB 5C4JH 3D8GA 4NOHA 4I2QB 3G6EA 3BDCA 1CSPA 3EGZA 1HHVA 2RDDA 2LKZA 4E98A 4HHUA 1SL0A 4UZBA 1RKJA 3EPIA 2K05A 4DV4L 1UP1A 5F8NA 3FEYB 2YWHA 2UUCJ 2UUBF 2XCAA 3CJ0A 5BN5A 4CJ2C 3HCXA 5JXSA 1PTOD 2VQFJ 4A3IH 4NI2B 3EVOA 4EO6A 2EXUA 4X66J 3OL9A 3UDIA 3RAXA 1RDRA 1H98A 5I3UB 3QMQA 3TZYA 4O3RA 4IURA 4OWWB 4LQ9A 2HHPA 4K7QA 2HSEB 4TQSA 4UPAA 2DR9A 2A68D 5SZTA 5AJ3F 1EOTA 1QB5D 4DUZJ 4OHVA 4NA1A 3V81B 4P2SA 2H54B 4DX7A 2E2IB 2YNFA 4DSEA 1LQ9A 4ZJQA 4LREA 4B9NA 1KDBA 4KIAA 2CQBA 1Z2ZA 1X9SA 2ZH1A 3W7BA 3CXCA 2QO3A 1JNRB 3RBDA 4BC7A 3JSRA 2B29A 2AJQA 1SMXA 2F4VL 2L55A 3RJMB 1ZTWA 1ZBTA 3EGNA 4CCHA 1S6QB 1KTVA 2LP4A 4F4WA 3TQYA 2QLXA 3MWBA 5K8MA 1N5TA 1RAGB 1EP4A 1BY9A 1Y5NB 3KJOA 3MPYA 2XRQD 2NVYH 2HZAA 3DRRA 1ET9A 1SI9A 1RKNA 1KHVA 2GS8A 1EUJA 5JVGQ 3H5XA 4H4OB 4KTAA 4DR1Q 4QQBX 3BGOP 1PTOC 3PW2A 5A2QU 4F4KA 2HVIA 2FGCA 2VXWA 2NVXH 2G1HA 5JPNC 4O4RA 3ZXWA 4RGNA 3DN9A 1C48A 3EM1A 4U6PA 2YNFB 4OJ1A 3I56S 3DLHA 1AH9A 2DO4A 1SFOH 1HL6A 4R25A 1F3FA 3HK2A 3TZWA 1GM5A 4DMZA 4UT4A 4APVA 1Y0HA 5DNFA 2W2QP 4DSFA 5KFCA 4DV2J 1S59A 1DTQA 2CJQA 1YKWA 4ZVFA 4DPUA 3LANA 2AX0A 2FJVA 4NZ6A