3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
molecule keywords BipA
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
4QR1A 3LH2S 2CVEA 2EFGA 1U2RA 1VI7A 2YWFA 2I8EA 4TNOA 1T95A 4ES2A 3EXCX 2YWEA 1ZM3A 2BV3A 2E1RA 3B78A 3B82A 3ZZUA 4ZCMA 1P9QC 3CB4A 1ELOA 2BM1A 1FNMA 3B8HA 4QR2A 1DARA 2IVYA 3UI3A 2BM0A 1WDTA 5G4DA 1ZPWX 1N0UA 4ES1A 4MYTA 1ZM4A 2NPFA 2WBMA 3ZZTA 1ZM9A 3ZZ0A 4ZCIA 2DY1A 2I0XA 3OQ2A 2ZITA 4M1KA 3E3XA 4FN5A 4MAKA 2YWGA 1ZM2A 4ES3A 4QR0A 2YWHA 4ZCKA 1KTVA 2XEXA 4ZCLA 2L9NA 1N0VC 2KDOA 4MYUA 2J7KA
chains in the Genus database with same CATH superfamily
2QILA 4I6AA 3BVMA 1D2BA 1Q90A 2A3JA 1TKTA 2H4OA 5D0EA 3C16B 2ZH3A 4LWCA 3PRBA 4KD3A 1NZ8A 1R89A 2RDDA 3ZZ0A 2QA4S 1WOPA 1ZA1B 4ELVA 4A3GG 2AZ3A 4GN3B 2QDBA 1K3RA 3M4OB 2XEXA 2CAJA 1TK8A 2AGQA 1C1BA 1VRQC 3HG9A 3KUEA 2MQNA 4X3SA 2YBVA 3PACA 1PGZA 2HFOA 2DRAA 3Q24A 1S59A 2L11A 2ZFHA 4EWTA 1XR5A 5ETKA 5ETRA 4ES1A 5LL6X 4LF5F 1F5AA 4DEZA 3HF5A 4I7ZC 3AH6A 2GA7A 4NA1A 1VRUA 5LXYA 2BOPA 3MTSA 2HVZA 3HVWA 1EETA 1H2UX 1QY7A 2HNYB 3D54A 2HFNA 3CMQA 3UN3A 2ENBA 2VA2A 4ITSA 3IFDA 1GHJA 1DCZA 3DWAA 3KJPA 1VC5A 1D9DA 4JI4Q 5GAEU 2XWYA 4J9QA 1SRUA 2JN4A 3UE1A 1F9PA 3EX7B 2VQFQ 3LP2A 1V9PA 1TQLA 4NX9A 1PV4A 3V5RA 2EY6A 1F9SA 2V4RA 1BOSA 3V6HA 4G7HC 3AJ2A 3CJ5A 4WP9A 2AHOB 4OX9L 1HNWJ 2M4MA 2F3VA 2PYKA 4M5DB 4WFNQ 4ZVSB 3MF5A 4PXBA 2R8JA 4B3MF 1S1XB 3S2HH 1DZ5A 4X62Q 1HNXJ 3J80c 2LA4A 3TRZA 3WOEA 5G0RB 2G1DA 4IO9Q 1N32L 3NNAA 3GWCA 2CQ4A 4HKQA 2K6AA 1UCNA 4BS9A 4WIIA 3U4ZA 1T5XD 3TZXA 4RBUA 2MKYA 1HMVB 5CZXA 2VFSA 3KKFA 3J7A1 2OCEA 3CQZH 2PNHA 1GK8A 3MCMA 1L1OC 2V0NA 2B43A 4KAIA 4KD4A 2QJ3A 2OFHX 2WCXA 3DRYA 2OD6A 4LK1C 4CLUA 3HKSA 3KJVA 2PD1A 4JK1C 3HOVG 3SDEA 1VQ4S 3L9ZA 2E2HB 4AYBE 1JMTA 1AFPA 4DR3F 1UWBA 2RKSA 2QZ8A 1C0TA 2FC9A 1U6FA 4C8ZA 1XMQL 1CA5A 2IDEA 4DCJB 2J5AA 3TX0A 1C1CB 3KHLA 4IH7A 2OPPB 4OYWA 2Y1IA 2BJ1A 2D41A 3HHLC 2XC9A 4K6LA 3J7YW 2XYHB 1NMFA 4R0EA 4K4WA 2HHHJ 2G13A 2MO0A 3DMUA 1F77A 1JWSD 2V8HA 4QIVA 4USTA 4Y28C 4F0KA 2DJFC 4Q2MA 2EKNA 3PNIA 4O1NA 2GQ2A 2HFZA 3M8ZA 1F9RA 3A8IE 2PIIA 5BXIA 4R8IA 2NSBA 3VYRA 4DAPA 4POGA 1D7QA 4NA3A 2DIUA 4R4IA 1X65A 4KB7A 4BBRG 3GTMH 3HFVA 1E1OA 4DR7L 4CBVA 3M9OB 4UPAA 5F41A 5KG6A 1IKVB 2DNNA 3MECB 1REVB 7FD1A 5DZ7A 3TQYA 3ENAA 4JV5F 1KDBA 2RUGA 1OQ6A 4NA2A 4J90A 1ZM9A 1GXLA 3S15B 4RW9A 4YHHL 3J7YI 1S77D 3FFIB 1EEID 3FRYA 3JXOA 3O3LA 3RRHA 1TVRB 3BR9A 3RAMA 4ECVA 1GX6A 2HK3A 3NE5B 5HVGA 3M2UA 3K5MA 4JI7Q 2E1MC 2N78A 1GMWD 1YKWA 3EVWA 3EN2A 1YJRA 2EBEA 2F0TA 3I4NB 4ES3A 2CZ4A 4DQPA 3ELHA 2MKIA 2Y8WA 1EIFA 3HI9A 1WD0A 3HSGA 1LYLA 2RQKA 5C0XG 4DI6A 1VQOA 1RBOB 1WG5A 2G2ZA 4ZVGA 1F0XA 1PH1A 3QATA 5D14A 5HY6A 2HQCA 4QMGA 1UMJA 2Q8RE 5M5XB 3FKIB 1I5OB 2IPKD 1FK9B 4Q7AA 2Z0SA 1K28A 1U0LA 4RWXA 4A93B 2HVIA 2W01A 3H09A 1KRTA 1K0TA 3HGBA 3PO3B 4X65J 1S5ED 1FNWA 3T1YF 3CRKC 1CS4B 1CSPA 1RA6A 3GQCA 4LR7A 2K5DA 5CABA 5J2PB 4CYUA 2RVJA 4ID5B 1UAWA 2C2ZB 4DUZF 5M5WB 4Y0FA 3G4SS 3K80C 1DD2A 2KHIA 2AU0A 5J2PA 4JC0A 1MROB 3NLCA 2X6GA 5IM0A 1EUJA 1MROA 2CQ1A 3SCKE 4KI0A 1N36F 4ZVUB 4K2KA 2IM3A 3D4DA 2U2FA 1LTAD 1VQKA 3MXGA 4DOZA 4ZAIA 3QWUA 1TFYA 2LXJA 4DR5L 1SE2A 2RSQA 4IUPA 2GVZA 2GMHA 3NMRA 5M5YH 1A7GE 2NUUG 1HLWA 4WRDA 3WHIA 4DR3J 2VB2X 3AB9A 4TKTA 1SH2A 3ZTPA 3CCQS 4MAKA 2F0GA 3ULJA 1JE4A 1EL0A 2H9ZA 5LMNJ 4QW8A 2CPHA 2NTSA 2B2WC 4B3TQ 2AYMA 3N28A 1NRKA 3NXWA 5F8IA 4Y65A 2CQ0A 2QMWA 1SQEA 2JA9A 2J8AA 2HD3A 2HRYA 1PAUB 2VBXA 4UY8T 2HQFA 3BDCA 4IUVA 1C4QA 2GZOA 4C3HH 5LJ5Y 4KPYA 1TMJA 1J2VA 1XQIA 3MM8A 4ZN1A 2ZH9A 4QQBX 2IA0A 3ZTSA 2NZ4A 3IAS9 1PJ5A 1DLOA 1RBAA 3QMQA 1E22A 4B3RJ 1TWAB 1ROFA 2K2PA 1HW9A 4JV1A 3LPEA 1EZ8A 2L12A 1FEHA 4ZKBB 4MTNA 2Y9HA 2HLTA 1EAYC 1IBLF 2AYEA 3ULHA 2GQQA 5LSRA 1RTHA 5I9OA 2NN6I 2R7ZH 4KHPJ 4H4OB 3D6TB 3CDUA 1REVA 1U02A 2QGQA 1WF2A 1Q7YT 5ELNA 2GVDB 2GFFA 1YNJC 2GO8A 3OTCA 1X56A 3CCTA 5BR8Q 4JV5J 2KENA 4DCOB 1LWEA 2A6HD 3FPUB 1D0EA 2Z4PA 2CG4A 4A8WA 4PZ6A 3V6DB 1JX4A 2W8KA 4BDPA 1VI7A 4H4MB 1LV5A 1EFWA 2XWBB 1O5JA 1P1LA 1VK8A 2ERRA 1IYUA 2AP6A 2HS4A 2J0WA 4LIWA 4DV0J 2Z2YB 1KOOA 5KNBA 1I3OB 1NJZA 4NPOA 1VJWA 5B0DA 2Q8TA 3S8SA 2B39A 1B3QA 4CJ1B 2G1HA 2C22A 2R2RA 3QJYA 4XPCA 4NPSA 3PQIA 3VQTA 1U8SA 2R6GA 3NQTA 1VBXA 1WTBA 1U49A 3M6UA 2UU9Q 2HW3A 4JI2Q 3FBEA 3BGLA 4LBHA 4DR7F 4ABNA 1G91A 2F8HA 4ZRZA 2EKYA 3KLGA 2A74C 4B9MA 1DTTB 3FDSA 3HMJG 4NEYA 2TMPA 2DR5A 2EI5A 3LWMA 4KJOA 1WTRA 1ENAA 4P2SA 5KNCA 2ZKUA 3CB4A 4NXMQ 1Z6HA 4C3IH 2JA6B 1R0AB 1K44A 1VFJA 1RTZA 4NLUA 2DVIA 2XS7A 4RCNA 3LWEA 1M1KC 3MAAA 1JNZB 2QYGA 5KT5A 3JYTA 2K1RB 4O3RA 3G7LA 2CJKA 1Z9FA 3B82A 5KFRA 4QWAA 2XMWA 1WTFA 5K9FA 2AX1A 1G2SA 3PHEA 3SXLA 4LF1A 1DYQA 3EA6A 1VQEA 4CM0A 3QRPA 3HSZA 2DHXA 4DUTA 3J7Z5 1U8WA 2V6AA 1KD1T 5HO4A 3OMGA 3D0HE 2F3JA 2SNMA 2NZHA 3ZTRA 2V8GA 2K50A 3F0NA 4LF4J 4CKCA 2VIHA 5GAEC 3P5TL 4IFDG 5D6GA 2R93B 1LQ9A 4PG8A 3KJFB 3BGUA 1JWUD 4O2DA 2FB0A 3KMQA 3OXLA 1S9GA 4J8QA 2C3MA 4C2MH 3QIDA 1QDUB 2HIXA 2C2EA 3OUYA 4A3JB 5HL7Q 4NL5A 3SSQA 2Y0SG 4LFAF 1S76D 2YNGA 1WHWA 3TYTA 4JW0A 2ZVIA 2DR8A 4ZHRA 4U7CA 4QIWB 3UDFA 2KT5A 3UDGA 1X6OA 2EW9A 4JI4L 3EICA 2VG7A 1P1TA 5A6PA 4C8KA 3VGUA 2VQFL 3MMAA 1WJJA 4O3QA 2ZOMA 2RT3A 2ZJPQ 1RE1B 4LMQD 4ZVPB 2BX6A 2BZ2A 2OSQA 2WP8J 4A3DB 1NSAA 3BGFA 2HDLA 4K4ZA 3CKIB 1B1ZA 3F56A 1LTLA 5CBAE 4WU3A 2ADCA 3W8PA 4NLOA 1LTID 4NYOA 2COLA 2AJ4A 1WC0A 3RR8A 1TR5A 3G6EA 5T41A 3J81Y 2R7VA 5IYDG 3GMGA 4PQAA 1WC4A 1N32Q 4DPOA 3EPIA 1TL3A 1IKXA 3UD3P 2HURA 2RAQA 2B9YA 3C16A 3ZTOA 4EMDA 3AOAA 4Y52H 2ZZMA 4B9TA 1WSVA 4CT9A 1URRA 1QCBD 2LFNA 3GFYA 2DY8A 2Z4IA 3I6PA 3T1HF 1AE2A 1WVLA 1LWXA 1PTOF 1IBKJ 1JWMD 4CYUB 4IFDJ 3R27A 5KFVA 1YVCA 2YTXA 2HFSA 1S5ZA 4DX6A 3DHXA 5EGTA 3G6ES 3B54A 1HKAA 4UF4A 2CPFA 5GAGC 4B3RF 3PCOB 4EVOA 4TQSA 4KV6A 3HD2A 1B9NA 3ISND 1HZBA 1XMQQ 1FDDA 1X54A 1NNXA 5GMEA 1RHPA 1D8LA 3KLVA 4JYAL 2LQBA 3T1HQ 2HHWA 2I5LX 3OTOJ 3MM6A 3PO3H 1VQJA 2KFZA 4ALZA 1KRPA 1H7XA 4WE1A 2LVWA 5E3QA 3M8PA 3DRSA 3BKUA 3GIKA 2B4UA 1EYAA 1U1LA 3VGTA 5HMWA 4B9SA 3PUXA 2WKDA 5DEHA 3HHLD 2FHKA 1EWHA 4B3SJ 5AJ3J 5M5WH 1JLBB 4YB7A 2DXDA 2H48B 3MXHP 4GRSA 3VAFA 4DR7Q 3I87A 4HJ8A 5ETSA 2KUMA 4JBWA 4KR0B 3PIOQ 4A3KB 4BXXG 1XC9A 1CJKA 2CA9A 1U47A 4WYWA 2Z2MA 4A3EG 3PO2B 4APVA 3F44A 1RT7A 1QM9A 2J9CA 1M5VC 2YPZA 4TY8A 5G3LF 1JLAA 1Q78A 2NTTA 2F65A 4ZLLA 3LANA 1HRJA 2KCTA 4YHHQ 1EEFD 3CULA 1XERA 4DR5F 1DONA 4X4RA 4A3BG 4B9NA 1WEXA 4Y7NH 1ZBTA 5M5YB 1Y1WH 1HBNA 3CCSA 4RPFA 3TEHB 2OGUA 1CZWA 1IQTA 1X9MA 1X0PA 3UVJA 3UPFA 4UZCA 2DBBA 4LF4F 4ZVQB 4X64Q 4LFAQ 4LRFA 4AFFA 1PILA 3SFUA 5JXSA 2E2HH 3G82A 2YNHA 5K8NA 3R5GA 3TOQA 5CGKA 2JA8H 3BQ0A 1HNXF 1UW9A 4WYLA 5HQLA 3OFEA 6FD1A 3CCSS 2XMMA 3ZNJ1 1UKUA 4NWBA 1VC6A 4NYPA 2L15A 3OR2A 3FZBA 1V1QA 4TRDA 3DWPA 2MY7A 4DQSA 5D4OA 4CH0S 3SSRA 2J7KA 1Q0NA 1JOOA 3TWZA 2MJ8A 5F8GA 3S1MH 4LR8A 2QLWA 2KB2A 3KLWA 3MTJA 3VTIA 1Q8LA 4UOFA 4JI3L 2PZUA 1WD6A 4USJC 4MHEA 3JQMA 2VZAA 3M8RA 2B56A 1IHZA 4HJ9A 1CC7A 2GVDA 4DPUA 2XVSA 1YHAA 4N47A 4DK0A 1GEHA 4J6HA 4DAVA 1BGXT 1M90T 3IKJA 2MO1A 2CPDA 3LNNA 3FSYA 4CH7A 3VVTA 4USIA 4DR5Q 2O4XA 4YDXA 4M5DA 1IM4A 3GTPH 1SJFA 2A10A 1SBBB 4I2PA 4U68A 2DNCA 2MKKA 1AP0A 3D66A 4MFBB 3OWEB 3OSPA 1JLBA 2H5JB 3UR0A 1WJ9A 4B3TL 2KRRA 3RR7A 2GC8A 8AT1B 3PKYA 3BO2A 4NXNF 2N55A 4RCOA 3GFZA 1F2GA 2WVCA 1B8AA 4LFCQ 4ED6A 1R8PA 3CSKA 1R27B 5C24B 4WFAQ 1ZPWX 3CJSA 2W25A 4CTAB 4GVLA 1LT5D 4LMZA 1O7LA 2R92G 4C3IB 2Z0GA 4ZCKA 4WE1B 3MURP 2A5HA 2ZH2A 3M4OH 5C3EG 1FD2A 3N5FA 1I5FA 2NVYB 4RL1A 2QC3A 1D8YA 4U9RA 4PEOA 4C3KA 4C98A 1ML0D 3IAYA 3EDQB 2XLJA 3DLGA 3WIVA 2LEBA 1XMOF 1AFJA 1YSJA 1D9FA 4FF2A 2B0GA 2AZ1A 3QWNA 1CUKA 4X66F 1TELA 5G3LD 5C5JA 3U7JA 4DUYL 3TSSA 1NAQA 4XTCS 1PRTF 3DLEA 2YNFB 2IAJB 4RW8A 4F4KA 4ZN3A 2B8GA 2MKJA 4PG4A 2SXLA 3CCJA 4ED5A 3N6LA 3ILIA 4DL2A 3QLHB 2H1EA 2Q2UA 3NGKA 3WIUA 1VQ7A 4N8X1 1FT8A 3RB6A 1S4ZA 3K59A 2FTRA 2OEKA 3OVBA 3MM9A 1EJ7L 2KCCA 1EQTA 2HFVA 1FTRA 1TU0B 2AMCB 4ILLA 1NK8A 4OO1H 2R7TA 3U1MA 2F3IA 2DRDA 2XZDB 2UU9L 8RUCA 3S2HB 4JI2L 4M63A 2R7UA 1BD6A 1VISA 4BY7H 1R4QB 1KTKA 3WZ0A 3J7AV 2R7QA 1RCOB 4WP8A 2HS3A 1QE1B 3M32B 5HGQA 4YHHF 4YFUA 4NXML 1RK8A 5K8OA 2IRYA 1CJVA 2AJ1A 1LFPA 3A55A 2JXMB 4M5LA 4GMKA 1FR3A 3T9ZA 3PGZA 1WOSA 2IYIA 2HWTA 3MUTP 4DR6F 2B6AA 2JA5H 2OPRB 1RT5B 1R8AA 3J80E 1HWKA 4U8VA 2YTCA 3IXQA 3KLSX 2LXFA 4RW9B 3IG1B 2R7ZB 1C4CA 4YB6A 2GJ2A 3LTOA 4DV0L 2KG1A 4B3OA 2LSSA 4RGNA 5BR8F 2KJVA 3OL6A 1RYRA 2XSJB 5K8PA 2D0OA 3PO3G 1GX5A 3I4NG 4FXGC 4HTIA 5DDQC 3V2TA 2OTJS 2AYBA 3PUZA 2FHJA 1Q12A 4ZVHA 1AROP 2IVFB 3CUNA 2AT1B 3NAIA 4QUCA 2LXIA 3L4BC 1NCLA 2D69A 4KO0A 1N33J 2XGPA 3E51A 3J7ZT 1K1SA 1NK7A 3FKBA 3CIZA 4KJIA 2WBMA 1NDCA 1HNVB 1LW0B 5MLCV 3AHPA 4A8SA 1HZCA 3M6WA 3QZ8A 2YTVA 3HOUH 2HGLA 2W9CB 2IJFA 2MEWA 3KLRA 2I8EA 3HOWG 5KG1A 2LEPA 2UVWA 4M94A 1XWLA 4XQJA 2R2UA 3FZ2A 1FD7D 1QD1A 4DUZJ 4OYBA 4O3OA 4IALA 5C3EB 4IURA 2BCOA 1LT6D 1C7YA 1HWLA 5A8RB 4R5PB 5J2NA 4CM2A 3D6FB 4FDBA 2CJBA 1WC1A 5EHHA 4TXSA 3PF4A 2AGOA 1VQ5S 4O0IA 1R6YA 1FRKA 2I46A 5KYIA 5E3FA 4I2QA 1Q8IA 5JJBA 2EZVA 4P73A 3Q8PB 1E6VB 2CW0C 4E2FB 3PO5A 4C48A 2HK2A 4DN0A 1F2LA 1LWEB 5C42A 5IWAF 1FNXH 2JDJA 5L38A 5A8KA 2YKMA 2LECA 1YQHA 4ZQ3A 2FC8A 3DCAA 2IX1A 3UR3C 4HL9A 2FJEB 2B3GA 2YKMB 3KUHA 4KTAA 1AB8A 3HOZG 1UPPA 2VHGA 2R93G 3GTJB 3K57A 4JI5J 4HR2A 3IGNA 3W61A 3ZO7A 5EKLA 1U1NA 2D9UA 1TXYA 2VICA 1IW7D 4DA2A 1VQMA 4WZMA 3A3OB 1KABA 4WWSA 4HHUA 2L9DA 2VG5A 1WTXA 4A48A 1WHYA 2HFUA 2BDOA 1G2TA 3T9NA 4O44B 4JYAQ 3T1HL 3S1NH 4KN7C 1N5QA 2LA6A 3TUJC 1I50H 2BE5C 3H6MA 1HBMA 2ILZA 2O5IC 2HIQA 3KK1A 1PH7A 3PRVA 1V6HA 3KJOA 4PYDA 3KDFB 1N6QA 2RSNA 1BXTA 2WIIB 1H7WA 1S1WA 5H1SE 2QA4A 1RT3A 2PA3A 3FP9A 4YQWA 2IHEA 4GS3A 1BR9A 5D4LA 1HI1A 3F1ZA 2F4VL 4HVZA 3J7AN 2WW8A 1S5CD 3GONA 3QOJA 4LFAJ 1S7HA 1RTHB 1HR0L 4P74A 4QYZJ 3QO9A 2B9WA 2F0HA 4RUBA 1UE7A 5CBEE 1GH8A 4R4QA 4BBSB 1SMYD 3MXUA 2BA9A 4LQ9A 4B3OB 2NZOA 2ZKTA 2VPWB 3RD4A 3UNGC 4IUFA 3MMCB 1H38A 1S49A 4J37A 2L3MA 3IBFB 4X64L 3KG0A 3PYDA 4LFAL 3D68A 3H2UB 4C8MA 2CJ9A 4OJGA 4FDFA 1NHVA 2H3EB 2QEJC 4P52A 4DL3A 4Q0BA 1OY6A 4GNXC 1EY5A 4PWDB 1JJCB 5KT3A 3L3OC 2F0PA 4JI1Q 1NZAA 5HN0A 1HYSA 1NHKL 1U7LA 3ET6B 3DLGB 2DXFA 4B3SQ 1V43A 1SUQA 2Z57B 5ELCA 2OLWA 1RHUB 3AMUA 2IRUA 2CQ3A 3KF6B 5IGBA 2MQ8A 5AE1A 3VF0B 4OYMA 4A8YA 4AQYJ 3NG8A 1U09A 1MNEA 4C3JB 4YHHJ 3GIMA 5C24A 1AT1B 4RKBA 1SMYC 2F4IA 5IY0A 3ZZUA 4JI3Q 5EPKA 2L48A 4YCVA 3ZZOA 5CV4A 2WINB 3QOLA 1WELA 3MOZA 4WJWA 1P27B 4ZLPA 3PX4A 1HTLD 3LX0A 4A3KH 1DHMA 2ZJRQ 2FVCA 4DU8A 4DR6J 3D1QA 2DR9A 2NXNA 4TLRA 2UUBL 5KNDA 2RRBA 4EQNA 4DSKA 4PG7A 2LXKA 3V6JA 3T5JA 4R8UA 2AQ3B 4I69A 1WTVA 4O0AA 2WVFA 2IM1A 3VWSA 1JB0C 3TAPA 4B9VA 4USKA 3JAME 2KG0A 4PXDA 2VJVA 5D78A 4EX5A 3NELA 3BKFA 3DOMB 4CO0A 2DO4A 1RP5A 4OHYA 4QJVA 4OO1G 5L1JA 2D7SA 3ISZA 2VUMG 2FGCA 2LCWA 3H90A 1SKSA 2XN9C 1I6HH 3BQ2A 4CTAA 2DHAA 1N33F 1Y5LB 1VS3A 4RKLA 2H65B 3ENQA 1RDRA 5IGCA 1KAWA 2VL6A 4B9XA 3HCXA 3DM3A 4JI0F 2P8IA 4LFCL 3BJUA 1EHWA 5HP1B 4IN3A 2O1PA 3V4MA 2IJNA 1SKWA 1B0VA 2IFXA 2RD5C 2I0QA 4F3OA 2M00A 1T3NA 1HD0A 1IW7C 1PH4A 5J2MA 2C28A 5GAHC 2MJNA 3G96A 4RW6B 2ACMA 2C2MB 4PXEA 4JP8A 1N36Q 1KQKA 5LOQA 2A6EC 2M9KA 4OYIA 2OPPA 1IYJB 1KP6A 1R0BG 3FFIA 1I4GA 1YHBA 1HWUA 4RG1A 3OV7A 3DI6A 3HKZB 3RGIA 2BW2A 1K1QA 1SNQA 1UEVA 2B5JA 1MMDA 3H5UA 5LMUL 1Q5YA 4DUYQ 3BYPA 2XWJB 4ODGA 1KNAA 1NJYA 4KK7A 4X84A 3LWLA 3J80Y 3KBGA 1VS0A 4LF6L 3A4TA 1HIYA 1HWIA 3BSOA 5J39A 4NRTA 5E4XA 3DRPB 2Y3YA 1VQGA 4ZS6A 1VQPS 2HKEA 2CXEA 2I5JA 2LDIA 1CK1A 4USMA 1VMPA 2B2TC 4KT0C 3W65A 2VUMH 1RHRB 3HLUA 3Q8RB 1RACB 4DXLA 5CD4A 4DNTB 3EXCX 5G0RA 2ZTCA 4M5IA 5C2CA 3NSWA 2ZC3A 3H5SA 3PEHA 1CPZA 4EQPA 5D3IB 3HHNB 4DLGA 1EQMA 2EFVA 2AWNA 3DLHA 3WDOA 2NWGA 3TS0A 5I4MA 3QRRA 1BLUA 1RADB 1YJTA 1U1RA 4L72B 5C3EH 1UWBB 1OTCA 5K36G 5DG8A 1NEEA 2ZWOA 4WKRA 4NYZA 3DRXA 4ECRA 3UE0A 1CM9A 3HT0A 5JEAG 4JYAF 3GJSB 4LQ3A 2R4FA 4IDKB 1H9JA 1X60A 3I5CA 3ONAB 1B53A 1GMWA 4NMLA 2WVEA 5HROB 4ZJOA 3LAKA 3OXFA 1YBTA 2CADA 2LEAA 3NNCA 5D3GB 2YWKA 1EETB 2XNQA 4DHVA 4L3KA 2VDIA 4YWLA 4ERDA 3RTVA 4OXPA 2MQMA 4DV0Q 1LXNA 5J2QA 1Y7PA 1NPRA 4HJ5A 1VQSA 5A2QU 3JAML 2MUYA 1U4LA 4FNHA 4ZYSA 5HLFA 2ZD1A 4OJHA 5A76A 3IS9A 2XY7A 5FJ4A 2E66A 4QU6A 1CG2A 2KT2A 3R5BA 1PO6A 1VRTB 2HG4A 1X4EA 2Z9HA 2P9GA 2WSEC 3NWRA 2ATWA 5NUCA 1ZH5A 1JLQA 1F9EB 2YNIA 2IC3A 4ZIVA 5C25A 3T13A 1VQNA 4USVA 2QL5B 2OELA 3KFUA 1IKLA 3S1NB 4K5WA 4YP3A 3ETMA 2NPFA 1FDAA 2K52A 3MPUB 5IP9H 2BANA 1BQMB 1H72C 2X1FA 4OWTB 4B9LA 4LFBQ 1TL7A 5CYJA 1U1MA 5ETPA 4NCAA 1PJ6A 3PW7A 2GGPB 3D6CA 1RWKB 1XMBA 1HZ9A 2M52A 3PW2A 4KE5A 1FE0A 2DIVA 1IM6A 3TREA 4QYZK 5EN1A 1BNZA 1AUSL 4HJAA 4DNIA 1Y1WB 3UN2A 1YJVA 1PRTD 1VQOS 5FLXE 1C1BB 1N0VC 4DFKA 1RL2A 5I3PA 3H4BA 4JI5L 4AL5A 1U6ZA 3GQBA 2EVZA 2DR7A 2CJQA 1N0UA 4L63B 3ONQA 3VDYA 2ZVSA 4ZA1A 4HAEA 1HZAA 2E9TA 3W2VB 3F41A 3Q8DA 3M7VA 5TSSA 1DAXA 2X1GA 2AWZA 3I4NH 4MK9A 2VOOA 4KY5A 4C3JG 2LQ8A 4WJ4A 2EFPA 3MEEA 4KTQA 3M8SA 4PMCA 2K14A 2YU9H 1M8AA 2Z2ZA 3R2CJ 1TWGB 2Q3PA 3A8KA 1SYFA 3SIPB 5B0EA 2HNDB 4IRDA 4LIRA 5J1EB 2EE1A 4A3EB 2V2ZA 4A3GB 1EP4A 3JAMY 2JOQA 5F0WA 5CMDA 1YJ9S 3ND8A 2MMYA 3FKIH 3CCWA 1SNMA 2JQOA 1C4AA 2F40A 2PW5A 2XG8A 5JJLA 4C3IG 1X32A 1GMUA 1IVZA 2MQHA 1TL7B 3D3BJ 3D1OA 3KDFA 5B0BA 1N6QB 4OZLA 1S5DD 2JEFA 2KI2A 1JXEA 1F5CA 4RHSA 1YWXA 4JVZA 3OUYB 3X3MA 3CHBD 2OQKA 1Y10A 3K5OA 4PYAA 4IKAA 1PZKD 1RAFB 4OI4A 2KBNA 2DH9A 3DDNA 3AJ1A 3FSXA 4PG3A 5EKIA 4NXMJ 4YWKA 4OX7A 5DDRC 2OQ0A 1QJHA 4JV0A 2LU1A 4L3NA 4DV4Q 4BBYA 5D77A 1S72A 2DGQA 1S3OA 4LJMA 3GTPB 2F4VQ 3IBWA 5BJRA 4CZCA 1NMEB 1K73T 3UD4P 1HR0Q 2EXZA 5HVFA 3H0PA 3R6LB 4C8NA 3K7RA 3KK7A 1BMQB 2ZE2A 3CTRA 5IGDA 3R7SB 4AIMA 2BUNA 2MXYA 3AODA 5CV7A 1Q3LA 3ZTQA 1TKXB 5KFFA 2XNAC 3UN5A 3V6DA 2MKSA 1H74A 4CQ1A 1I94F 2MSTA 2JX2A 4MJKA 2ZNZA 1XWEA 4NZ7A 3PO4A 2ASLA 1DTTA 1UVIA 4QJFA 4Q8FA 3R7BB 2DNOA 1J5EQ 5L1LA 5FDLB 2HAFA 3DRPA 2RU9A 4JI1L 4GOPC 5CYMA 3U50C 4FPIA 3GTKB 2BH8A 4B3SL 2X51A 3RZAA 1RTIA 5D0RA 3TP6A 2J7UA 4CP5A 4G6VB 3D0GE 1TL1A 1BY9A 4FP9A 2AQ2B 4NZ6A 4FKYA 2IA6A 4RW4A 3U02A 1BQQT 4K2JA 1Y8PB 4YS2A 3G71A 1BWVA 2CZVC 3EROA 5LMUF 4J9OA 3FVYA 4HIOA 1SJ1A 2YTYA 3BKTA 1B64A 4QIWD 4FXVA 4U96A 1CKMA 3VR5A 2CVIA 1EZZB 4IG0B 2UUBQ 2PMZE 2MZ1A 5CR3A 3HOWB 4X64J 3QIAA 4L74A 2GV1A 2XYPB 5KFOA 4G7OC 3QYYA 4DF4A 3H4DA 4V1Ak 4JOIA 3NGSA 4UY8C 1UJ4A 2N7CA 1D5MC 1EQRA 1PBUA 1V3SA 1BCPC 5BYQA 3G8QA 1DOLA 3MR6A 4N77A 1EU3A 3CCMA 4C4WA 4XDDA 1NUCA 1VQMS 2RBMA 3BDEA 1CFMA 2G2YA 4K5XA 5KFEA 2OPRA 3TS2A 1F9QA 2CQAA 5JJIA 3PYGA 1NR4A 1IXKA 3EM1A 1U2FA 1K83H 1WOOA 1CT1D 2W4CA 1Y1WG 2VOPA 2UXBF 1U1KA 1L3SA 1ZYRC 4K4SA 4KKOA 3L7ZC 2E7WA 2RCNA 3RAQA 4YMEA 2FXQA 2QA4G 3O6QA 4RNFA 3M8PB 2ES2A 1TKWB 2JE6I 4HJ7A 1WC6A 2DGOA 3BEGB 3C6TB 2E29A 2W2NP 2KXNB 4K5SA 4Y6IA 5DRKA 4FPRA 3ZC4A 1GXDC 1N36L 2BOSA 1AW7A 3T41A 1JJGA 1M1HA 2R7XA 1SKRA 3U9OA 3L7OA 3SXHA 3W64A 2ZM6F 3EGNA 2R3VA 3ENVA 4LFCF 3CF5Q 4BHQA 3IFEA 4F3MA 3CCVS 2FVPA 4HDHA 5LMUQ 2XMAA 1XBWA 1IYVA 5KFMA 4N8OA 1V5IB 1Y14B 2WK4A 2ZJRA 2KFYA 1HNXL 3DHWC 2E76C 2W8LA 1IZ6A 2MTLA 4J9RA 1I51B 1SDFA 1YRXA 1M4VA 3E0JA 4LF6Q 3BN4A 3MPYA 1RF2D 2R93H 1EYGA 3PUVA 1YNND 4CKBA 1N54B 2ZXOA 1B3AA 3A5UA 1S1TB 3K89A 4PQXA 4K50A 1Q7YC 3TRGA 2RVLA 1B0PA 2CH4W 2OI2A 5H9EK 3PYFA 2GCFA 3FQLA 2ZBRA 1RT2B 3TZDA 3M4PA 3MEDA 4Z9CB 4I64A 5CV8A 1TUWA 3CJ4A 2IDLA 2MZQA 2DNYA 3MZIA 3CO0P 4WJBA 4RW7A 3A54A 2WV6D 4AL6A 4DV7F 1PYSB 3HHEA 1SC4B 3ULLA 4ZKAA 3MXNB 4A3FH 1MN7A 3JTPA 2KZZA 1HA6A 1RA7A 1XNRJ 1DOMA 3NP5A 1VLOA 2HHQA 1L1OA 1T3OA 1SC6A 2A2DA 1WI5A 1S1WB 4L8JA 1Y8OB 2VKZG 5IP7G 2J7ZA 1C1CA 3S2DB 1MWZA 3HZXA 4LAAA 4DV7Q 2PA8D 1VMCA 1ZAVA 4JI4J 5KGUA 4HMJA 1JJ2R 2SOBA 2V8VA 3B8HA 5T7LA 2F0NA 2I38A 1YVFA 1NHUA 1ICFB 4RBVA 1MJEA 5L9XA 3RBEA 2RQXA 4IH6A 5B08A 2B7BB 5KFGA 4FBTA 1RWNB 2CNKB 1QNUA 2JA8G 4FS1A 3OPOA 3R7NB 2NXUA 3NOCA 2VZ9A 4IOAA 3PY8A 4M5JA 1N56A 2F52A 1GUTA 1PH3A 3QGGA 1QNKA 2LMIA 5CYMB 2JSXA 4FYVB 3MEGA 5FDLA 2EG1A 1YJWA 4CLWA 1IKVA 3VR2A 3I4LA 4Z7YA 2CJAA 3HKWA 4I7FA 4PKDB 3X1LB 4DL6A 2AF6A 4GVBA 1IQZA 1ET6A 3W2DA 4OL8A 4KN4C 2KXFA 4H02A 2F0JA 3V4IA 4Y2MA 5KIXA 2QT7A 4EBCA 2B8FA 1VCIA 4NI2A 4LFBL 2X1AA 2CFMA 2M8HA 2P5ZX 3MWYW 3HULA 4J9LA 4PR6A 5DAUA 3RZDB 3K81C 4I2QB 2BOAA 1XIQA 1ITPA 2XZTB 1KRSA 3K7AH 1UEKA 2N88A 5HGTA 2VA3A 4DV1J 2HDMA 5IOLA 5H9FK 3ICLA 3RYLA 4QF4A 4U673 2A6HC 1V5VA 2KJWA 5L1KA 1M5KC 4AYBD 4OI0A 4JI5Q 2AGPA 4J9MA 4LFBJ 4AQYQ 5A2QE 4LF5L 1LW0A 5MAOA 1OQ3A 1UJ5A 3SV3A 3EPGA 3GTLH 4I7AA 2CG8A 4NLYA 3AOCA 2XI3A 1MHWC 3ISNC 3I56S 1HI8A 4EFAC 1HJPA 2IMWP 1A15A 5A8KB 1EY4A 1KFSA 2HVDA 1HBNB 5CCMA 3KNGA 4W90B 1VQPA 5IT9c 2PI2A 3VR1A 1OXUA 4DR7J 2BVZA 3NWSA 1YIJA 1X4AA 1L3VA 1IR2A 4OX9J 1N88A 1HARA 4EGVA 4YUDA 2JEGA 2XSFA 3OJSA 3OMCA 4OZ3A 4A3MB 1LTBD 1AA1B 3GV3A 1SNOA 3THVA 1WG4A 2FD2A 5GADC 4HH0A 2AJFE 4GNXB 2C9OA 2YWWA 4QYRA 1SYCA 3TAQA 1XNRF 2UXBJ 4PG5A 1FL0A 1Q1BA 1VCTA 3BO4A 3P75A 1TUVA 1SAPA 2FYXA 3TUZC 4USUA 1IBLJ 3EVQA 4O3PA 3CCEA 5KTQA 4QY7A 5JVH3 1KFDA 1QOHA 4EBDA 4CLSA 4LF6F 3LA0A 4DV4L 1W26A 4BBRB 5EWGA 3K8WA 2B4PA 2RKIB 4Z37A 3C15B 5F2DA 4BA1I 3GTGH 2O66A 4Q45A 5LHY1 4MH8A 3GR1A 2JJQA 5KFAA 3R1HA 3H42A 2V4QA 4BCAA 2BE5D 2WZ1A 2K3IA 2VQEL 1VQCA 1AZSA 2HHTA 2KL8A 3BDLA 3MM7B 3Q8UA 5I6YA 3CDWA 1H3DA 5LT5A 4C9DA 3JAMc 2BJEA 1SI9A 1FI4A 3BVGA 1B7FA 4L6V3 1T03A 3UE2A 2M8DB 3IWXA 2AEFA 2PPBC 4RU2A 2KVIA 5HK4A 3AA9A 1HR0F 1SJED 4FN5A 1J5EL 2B2WA 3G9CA 3I96A 3DOLA 1PH2A 2DNEA 3DWQA 5D4NA 3PF5A 3BZKA 5HLFB 3Q89A 3N6RA 1WSRA 1XJVA 1R0CB 2JH3A 4OZ5A 3M2RA 2GO9A 4CO5A 1P6TA 4G4KA 4DR3L 2ZDPA 1Q86C 1V1PA 2KYZA 2BQRA 2Q6CA 1AUDA 4FNIA 3NCPA 2Z30B 4CLKA 3I73A 4ZPWR 2WONA 1CKNA 1HPZB 1RHJB 4C11B 1KHVA 4LF7F 5KT4A 1U5KA 1FCAA 1LACA 1HFEL 3BYYB 2L41A 2ALZA 2WVBA 2B2TA 2I0XA 4JI2F 4OZJA 4B08A 3QB3A 4K0KQ 1SQFA 1VQFA 2R8KA 2Z8LA 2K8GA 1VQ9S 2ZT9C 2EIFA 1IKMA 4M5KA 2O67A 5IQQA 3RZOB 3OHXC 2LDYA 2EJGC 4JI4F 1BVSA 1UPMB 3NPPA 3QFHA 2OD4A 3BJYA 5T1IA 3AU7A 2OPSB 4DCPB 1MSWD 5DLGA 2O5JC 1U24A 1UAPA 4A3MG 3LALA 4P2CB 2YVSA 4DF7A 2HSEB 3CXCA 3TUIC 1VQ8A 1MBYA 4YWMA 4I2PB 1HNWF 2XRQD 2NUCA 4XDXA 3HPOA 3X3UA 2V5HG 2XRSD 3IRXB 4QOTA 1N33Q 1FGUA 2EPIA 1NSQA 3CC7S 4IFVB 1X0FA 3TN2A 1K9MC 2JA7H 5GAHI 2NVQH 4IG3A 3DLLQ 5FO8B 3KYHC 1FRHA 2MGZA 3GTOB 2OTJA 3D31A 3QT8A 2A18A 1I1GA 2WB4A 2PQAA 4DR5J 1SSOA 3MA2B 2QEXA 3IGVA 5KG5A 2GQCA 4XYOA 2WTFA 1WG1A 1X9NA 2NPIA 3PIPQ 1KQSR 1EY0A 3DRRA 4CDCC 4CDFC 3GTQH 4ALPA 1GTHA 1GNKA 1VHFA 5LM7E 2ZUGA 2M88A 2POKA 3AB4B 3SGIA 2DH8A 1N34F 1V9OA 3UO0A 4N41A 1Z47A 1FXRA 3KNAA 4A3CH 4USWA 1HNXQ 5J2MB 1XTZA 1PH8A 4DV4F 2E5JA 4GC7A 4IR9A 2B4VA 3M4QA 4LNQA 2ZH5A 1RLCL 3W5ZA 4L5SA 3GSDA 4HACB 2E1AA 1VQ5A 3HKZG 3KLEA 1GFWB 2CFXA 1JJHA 3A1YG 1QJOA 2ZTEA 1VBKA 3D2WA 2MGZB 1OWXA 2GIQA 4AT1B 4ECXA 1XNRL 1M5HA 2DNGA 2B5JB 4UTGA 3MFIA 3HOVH 4J9UE 1TWFB 5M3FH 1BQNB 1TK0A 2BQUA 2RJZA 2YWGA 1AXQA 5KFLA 3G8TA 4C0BA 1N8RC 2QW7A 2EY1A 2MSSA 3HD1A 2WB1G 1UW4A 3CJ2A 3SEBA 3CC2S 3AD9C 1YI2A 4A3IH 1E1TA 1MLAA 3UNYA 4RGMA 2F0SA 3SVMA 4KKSA 4ZCIA 3QWPA 4PABA 3RBZA 3W3SA 3FHWA 3IN5A 2A8VA 3ENWA 2ZJPA 4X4VA 1YHQA 5D15A 1OYDA 4DR4L 2R3ZA 4OYAA 2EFGA 5L1IA 1WF1A 1V3RA 1ZAWA 5JMNA 2WSFC 4C7QA 2HWHA 3OPKA 4QZVB 1CULB 1UFKA 3PRDA 4DV7L 2ZM6Q 2XM3A 2HBYB 2KFNA 3CC2A 2VU5A 4DX8H 3J81c 3QSYB 4IRCA 4LF8L 4DR2L 3GYGA 1HI0P 2QLBB 1HHTP 4UQTA 1CA6A 2B29A 4YN3B 1NM2A 4LSZB 1GMVA 4DS4A 3DGVA 3VYUA 2QYCA 4YDDB 1ASYA 2LMCB 1NDKA 1Z2LA 3F73A 1IR1A 4LF8J 1NR2A 4OHVA 4OYOA 4ED7A 3PJWA 1KBRA 2HHHF 3KLIB 2HPUA 2O2LD 2XLIA 1SNDA 4RNMA 1BDOA 1GKHA 4DPXA 1X5TA 4ZVFA 4DK1A 1U0HB 1RT4A 3HS0C 2CDRB 3VR3A 3IC1A 4DX7A 1N9WA 3D0IE 3RUZA 3MM7A 5FJ8G 2JVRA 2R7OA 1LO5D 2DPJA 1RWOB 2OMOA 4GO5X 1T9HA 4Y3CA 4FXKC 4DFMA 4R4TA 4HTHA 3VHQA 4FNFA 1K8AT 4XQQA 5H9FJ 2ZTDA 4GKJF 1XR7A 4O4RA 1PAEX 3GYXB 5IODA 5KFJA 3BPDA 4I1TA 3I72A 3KDOA 1NJIT 3VR6A 1SR3A 1JOKA 4AQYL 5M2RA 4LF5Q 4ZHRB 4LRCA 3T3FA 3KLFB 3ET6A 2B63G 3FKIG 3S2DH 4MKBA 4BBSH 2VNUD 3I70A 2VG7B 1U2CA 3HVTA 2XZWA 4OV6A 1YITA 1STBA 4IQMA 3NGTA 3SDZA 4ATNA 2UV8G 2V67A 3OR1A 4MKAA 4DUZQ 4P2FA 1NSNS 2R8IA 4ZPAA 4HSVA 3OLBA 3G48A 2N4CA 2RRAA 5DM63 1W2BA 2KXHA 2B2UA 3S7RA 4WTOB 5KYLA 3TAMA 2Q66A 1ESRA 4WP3A 5LSOA 1DOKA 2VG6B 1OIAA 1UVNA 2C35B 1YJNS 1KVKA 1PIEA 2Z58B 3V81B 3PVXA 1JLCB 1JJ4A 3NTIA 1M1KT 3MMAB 2ZDOA 1YG0A 4ZOSA 3DN9A 2Y0BB 1HA5A 3B6BA 4IFYB 1CQMA 2IVYA 4PPZA 2E2JB 1BHNA 5DGBA 1G8ZD 3D67A 1F3FA 1OXTA 2F63A 5B7WA 5HROA 2G4BA 5CYQB 4JOIC 3DNCA 3KK3A 2L9NA 2CPZA 3NWTA 2N3OA 2KO1A 2B63H 3VVUA 3K7AB 4N9TA 3HHDA 1K0SA 1ZS6A 1G6ZA 2VC1A 4OWWB 1Q81T 3OVSA 4DLEA 4OZ0A 1O51A 4ECWA 1AEXA 4EEYA 1XNQJ 3E5SA 1NXIA 1OSDA 3KDNA 3QG1A 4JV5Q 5BR8J 4OL7A 5L37A 2VQEQ 2W7AA 3BGRB 1N34J 3G6XA 1I6JA 2J0TD 4NI2B 1RAGB 2J6UA 3EIVA 1PHJA 1H95A 2XMTA 2ZWPA 1FDBA 3MAHA 1GM5A 1K83B 1FNVA 1WDTA 1L0WA 4DWIA 5FJ8H 3HK2A 1GJXA 4NCBA 1IXRA 2K7KA 3FJ2A 3MFYA 1E6YA 5SZTA 5AXMA 4OX8A 4U6PA 3U58A 2DN8A 3Q8VA 2FINB 3GSIA 1RI7A 1NBWA 4DV1F 1N5VA 2RB7A 3BBFA 1UUPA 3BG3A 3WQPA 4JUZA 4QWEA 2PMZB 2IRXA 2QA2A 5EKKA 1E6VA 4AE5A 5K8MA 1QAXA 4NLGA 1FERA 4GLXA 4DR3Q 5A8RA 1T9VA 3H5YA 1HTPA 1DLOB 2AUKA 4GKJL 2YYZA 3GD7A 1T8EA 5KFXA 3DU5A 3M1VB 3CAMA 3EMTA 3PFEA 2FZKB 3H8YA 5IFMA 1R9TB 1PVOA 2R42A 2ZHAA 3KUGA 4FP5D 1Q81C 4K0KL 1VOMA 2A73B 1XN9A 2DYAA 2KKHA 2QLFB 3MEFA 1JLGA 4MIUA 5J1PA 1VRUB 4ELUA 3M32A 2YQ0A 1NO8A 2HCIA 5AE2A 3KJQB 3I56A 1RAIB 4Y2AA 2E9ZA 1FXLA 5HBMA 2HHVA 4HI1A 2RDIA 2FJDB 3TJ9A 1CZGA 1MSHA 2OWOA 4JI1J 4QGUA 4IH5A 2UXCQ 4HEDA 4ZP8A 1IJEB 3NNHA 4A3FB 3L09A 1MGSA 3KMSA 3R2DJ 3HZGA 1X4FA 4J91A 1KDAA 4ILWA 4HMIA 2HRUA 1U25A 3QO2A 1WUUA 2FJAB 4MK7A 5AE3A 1S5BD 1O7IA 3OD2A 1F2HA 2C2DA 4G7ZC 2VB3X 1TKTB 1N33L 2QRRA 3OR1B 4PMWA 1ICEB 3PXGa 4DR6Q 1M90C 3PW5A 1PFSA 3C19A 2I6WA 2XCPA 3U1NA 1N52B 2ZHBA 3NENA 2CKZB 4OHWA 4Y00A 5JAVA 5KFYA 1M5SA 3TUPA 3OHBA 2JA6H 4Y2CA 3VGSA 3OTDA 2EY5A 3T1AA 1WC3A 3F2DA 2J8SA 5E41A 1F9HA 1NDPA 3BPSP 1LKZA 5KOWA 4JBMA 3FMCA 4RUAA 3HHKA 4F4XA 4A8MP 2KM8B 1QE1A 3V6KA 1VQNS 4P72A 2F1MA 1F3VA 1S7IA 3UFCX 4J9SA 3W5OA 1WHXA 2J0XA 1X9WA 5A0YB 1TS3A 3OFFA 4I56A 5ETNA 4DV2Q 4F0MA 2RF2B 1S1VA 3BH7B 3H98A 3UDXA 1KHIA 4DV6Q 1DFDA 4CH1A 1CULA 1U0HA 5DM73 1WKJA 3BDOA 5JVHQ 1PBAA 3A3PB 1PTOB 2RNEA 1S6QB 3C6TA 2WB1E 2K5WA 2EC2A 2I07B 1FRLA 3KHGA 5EPJA 4IUTA 3CVKA 1XNRQ 4K2XA 4GN4B 2XGTA 4ZVEA 2JJ4D 4IO9A 3S16B 3R6GB 4ZKCB 1U48A 4KHPL 2LQJA 2R7DA 1NKEA 2H4YB 1KQFB 3FGVA 1DM0B 4OI6A 1NMGA 1MN9A 3P8BB 4IZ8A 1P8LA 1NNDA 1BCPB 3FVQA 1YNJD 2HRTA 3K2YA 2NVQB 3HDSA 2D74B 5J3BA 1UE6A 4IUQA 4S0MA 3OHAA 2DGYA 5AJ3Q 1RHQB 1MI2A 3IM8A 1DJRD 4DR4Q 1X7VA 1HQEA 3KG1A 1IBMJ 3RN2A 4GKKJ 5CC4A 1IJFB 3I4MB 1YJ9A 2YX4A 4H44C 2ZM6L 3CD7A 2GHWA 2ASYA 4ECYA 4LF8Q 1AZQA 4DR2Q 1BF4A 4G65A 1F9FA 1C0TB 1GTEA 4YY3F 2IIHA 3CD0A 4JBCA 3FEXB 2MJUA 4DFPA 2CJXB 4ME3A 4P2XA 1IL2A 1DXMA 1SFOB 1R3NA 3MM5B 3G8SA 2Y8YA 3W7BA 3FCHA 4ANEA 2KCMA 2RU3A 1HQUB 4EO8A 1Y9OA 4NP5A 4F0HA 4A3GH 2P6TA 4NXNJ 1H9SB 1VHIA 1NH8A 3KLHA 4J9KA 2LS01 3IR7B 2EJMA 3TA1A 4MZ9A 4HACA 3SCIE 4DSLA 4NCGB 4WFXA 1A6LA 2J0QD 4ETZA 4BBRH 4WFZA 1GUWA 1T9TA 1KL9A 2YWHA 2MLXA 4G3IA 3QQCD 3GP9A 3QBCA 3HKZD 2VKRA 4IR1A 2RDGA 3KHRA 2HEKA 4HSPA 4ZPCA 1I3QH 3CT9A 2WACA 4URSA 1K8OA 1TV6B 1XPUA 4ZK9B 5ELOA 5FLMH 1S12A 2IMOA 2JC0A 2OPSA 4ANCA 4DV3Q 1Q16B 3MD1A 3HOZB 4UOGA 4NLPA 5F3ZA 2WVDA 1RWMB 1YEZA 1ZTTA 5HMYA 3LP2B 1K3BC 4C8OA 1HBUA 1Q95G 4RZRA 4DGZA 4O23A 1TZ0A 3LOUA 2BW7A 2HHPA 4RKUC 3TVYA 5LXRA 4NDXA 3UCUP 3BO3A 3M8QA 4TYBA 4IQXA 3F2UA 8ATCB 4DUZL 1RODA 3CIMA 1RT1A 2FMCA 2EK6A 2I9SA 1I4RA 1N4LA 4BC9A 1EY9A 3ZJYC 2K7VA 1VLYA 1NKBA 1QUVA 4KO0B 1KLMA 3N5BA 2BYCA 5DLQE 3M2VB 1S0VA 2JA8B 1V1PB 5ETVA 1B0TA 1LEOA 2FDNA 4KKTA 3MUMP 3GTKH 1FRJA 1SYBA 4ECUA 4LSNA 4ED3A 4C3JH 2DTJA 5EPLA 4DXFA 4L5QA 3DEOA 1ASZA 2HMIA 1CQNA 1U6BA 1OO0B 4YCWA 3PJXA 5M3MH 3KFWX 1Q82C 4N9PA 5GROA 1RT5A 2GS8A 3QJLA 1CTMA 1KLUD 3GV5B 1H0HB 2P5VA 4DG1B 1NE3A 1RHKB 5JEAH 1OXSC 1JICA 1QSYA 1TS5A 1CJVB 3TMEA 1R6VA 5IXUA 2E5LJ 4HR7B 2DHGA 3OTBA 3C14A 2C2NA 4K8RA 3HOWH 3MVVA 5GADU 4J9PA 2NZCA 4P9SA 2V4JA 3MHBA 1G1XA 4JV5L 1Y11A 2QF7A 5IV3A 1A9NB 2ADBA 2MFIA 1ENFA 3NS6A 1DURA 2J0SD 4DAMA 4CDDC 1C0UA 2RRNA 4TQUS 5FOBB 3MR7A 2GGPA 4X6AH 1YNXA 1RTOA 1PSDA 2KTQA 4X3TA 1O80A 4R4CA 1YBAA 4N7TA 4M1KA 4P7TA 3ILOA 1JLQB 1CHQD 3SSSA 4RBTA 9ATCB 4GKJJ 1SYDA 3MMCA 3STBD 2FLNA 1ICWA 3MI7X 1IBMF 1RAHB 3ZZRA 2EBGA 3TX8A 2CNOB 4DV5L 3M85A 2NN6H 1AE3A 2VBZA 2KHJA 1L2FA 5AFWA 3H3VH 1WI6A 4KMUC 4A76A 4C1NI 1D5XC 2NVYH 3DM2A 1GQEA 3MMBA 3OBIA 3GG1A 3AQPA 3HM9A 4GKJQ 3IS9B 3ZZPA 1HQRD 4P7VA 1QB5D 1XYIA 2J6SA 2VY3A 2QG9B 4EYIB 5IGFA 4O4GA 1ZPVA 3I8ZA 2XY6A 3NEKA 3OSOA 3VALA 4XAKA 4R9WA 4ZUIA 3UCGA 2DGXA 1ILPA 1VBZA 2KA7A 4A8KA 1SN8A 2W2QP 3JC66 2E75C 3DXSX 4CT8A 5A2QY 5I3UA 1WORA 4WF9Q 1C0AA 2HT1A 4LF8F 3KOAA 1JK9B 2W24A 2NQPA 2QFIA 2XLKA 2NVXB 5KG2A 5JJKA 3GTYX 2YV5A 2VG5B 3GR0A 2UXCL 1S5FD 1UVMA 3CJ8A 4OGQC 1N48A 1WOCA 3BU2A 1VF5C 4H54A 4JB8B 2Z1CA 2AIRB 2ASBA 1LABA 4DPGA 2IT1A 2K1RA 2V69A 2N82B 2DD8S 3RRGA 1VIOA 1WFQA 1HHVA 3EQLC 4DR6L 2E1RA 2JYOA 3SZ2A 2VD3A 2HUGA 3HT3A 3AOBA 2CPYA 4ZDNA 3GFHA 1WKKA 3MR3A 2Z6BA 4ED2A 2ROGA 1SC1B 1YJWS 3J80i 1KHWA 3W1BA 1JXLA 3LP1A 2E7XA 4DV6J 1L3UA 1HBUB 2Q79A 3J7AF 2K28A 5KFCA 1S79A 2OH2A 4CO4A 1SL1A 3NMAA 2VV5A 1OMSA 5FLXU 1EQQA 3URYA 5C4XH 2HZVA 1DGSA 4K4XA 2A1AA 1K9MT 3BVZA 1T94A 3HXMA 1ZETA 2JA7G 3W9HA 4DV2L 4RW6A 4RHRA 1XNQL 2P6SA 1Q1EA 4EI2A 1LWFA 4NMZA 4NKLA 2MLZA 2BRKA 3R9LA 3PM9A 2IL8A 4DV6L 2YY3A 3SK5A 2AQ1B 2RH3A 4R25A 5KEEA 3ILJA 3AAWB 2YKQA 2KZMA 4O3NA 4RJVA 1RTDB 3GIRA 4B9UA 1B4SA 4R0JA 2DEIA 2PO4A 2QX0A 4V190 3I0RB 1GXUA 2KJXA 1WCMG 2F7VA 2VJUA 5F8JA 3FCWA 1PFNA 1DRZA 3UI2A 2E74C 3VYTA 4KHPQ 3M4YA 5H1SV 5KT2A 2XSCA 5LMUJ 1JB3A 2QE5A 5IC4B 2PI2E 1NB7A 2QN6B 1AN8A 3QIPA 2J7WA 3QT7A 1ONLA 4WTYA 2PMZD 2B9EA 1TVXA 4R8UB 1ESFA 4NXMF 2AJ0A 1I3QB 4HI2A 4K4TA 4QIWE 2CZ9A 3W5XA 1NKCA 5AJ3L 3W9JA 2F4VF 4HTJA 1X31C 5SUHA 5ETLA 4ES2A 2CWXA 1FJGF 1D6EC 4PMBA 4DL0C 4XIUA 2BKPA 3MPVA 1S6QA 5KG0A 1KQSA 3TANA 2UUBJ 3Q6SA 1NH7A 1XXGA 5IWAL 5BN4A 4DPWA 2B2UC 3J80U 3GV6A 1UEAB 3L9AX 4X64F 4MYUA 4XT1B 3TZZA 2W7OA 2FVRA 3N6MA 3W62A 2VPXB 3BSNA 1I4PA 1DQ8A 3R2IA 3A56A 2YX1A 5E4WC 4LJZC 3BZQA 3HZEA 4DPTA 4F8RA 4MN3A 2KT3A 3S14B 5DETA 4JI2J 1WF0A 3R93A 1WHVA 4KBIA 3VQSA 5DM6Q 5ISRA 3SQGB 2Q43A 3FRZA 1UL3A 4UOCA 3DLKA 4PQUB 3HSDA 3IL8A 4E98A 4PWDA 4YB5A 1K8AC 5EGYA 2GVZB 3NTHA 3N01A 1GUGA 1X55A 1Z2ZA 1SH3A 2PE8A 1WYDA 3PEJA 3DOKA 3RLFA 1QVGA 3TO8A 3W66A 1KC8T 4Q8EA 4M95A 4E6IA 1LLRD 1RDPD 4F04B 2F5GA 1T02A 3DDKA 3NGRA 3DLEB 1P8GA 2SDFA 2D2CC 3PO2H 2XHCA 2K04A 3B4MA 1U1PA 1SB6A 5G4DA 1TIID 3VAIA 1DJ0A 2A69D 4DSEA 5GADI 3EGVA 3GZ7A 3T1YQ 2D3O1 1FK9A 4ZITA 2L08A 5DQIA 2DT9A 4LSLA 1HL6A 1J5EF 3WC2A 2QDLA 2AYGA 1FNOA 1AZSB 3MECA 4RX6A 4HDGA 1SV5B 4EZ9A 3C3LA 2GAGC 3AXMA 1EZ6A 3G4SA 2R9LA 2Z6KC 1MU2A 4DV3L 1S6PB 3FMWA 1EB0A 4KKUA 3AJDA 4J1MA 1RT3B 3BR8A 4FYXB 4AXJA 5GVQA 1UEUA 1MMNA 1T9UA 4RR5A 2NVTB 1R43A 1TY2A 4K2LA 4X4TA 1HYSB 2QSFA 2G0IA 3TP8A 3OVAA 4BC7A 4GOPA 4F02A 3K58A 3LF0A 1O8BA 1KD1C 1RABB 4O0NA 4KJNA 3BQ1A 2DGTA 1D1UA 1TVRA 2E2IB 1FFSB 3PV0A 4O44A 1JLGB 2DR6A 2HIYA 2YKNB 3CCRS 2VQFF 4DV4J 2BDNA 1N32F 1A0OB 2KOLA 1FA0A 1A3UA 4QPTA 3ND9A 1YI2S 1M5OC 4BY7G 1NK9A 2VUGA 2QTWA 4F4ZA 2B2YC 4CJ0B 3AA8A 5EBCA 3OOCA 2JA5G 1N5TA 4ECSA 3MFGA 4HT7A 4DSJA 2FLLA 3H2LA 3A8JE 1URNA 3A0JA 3BS9A 2EXUA 2FVSA 4CJ2C 3Q2SC 4Z2XA 4YY3J 3JSMB 5CV5A 3HOUG 1RYSA 3KLEB 3HOYB 2C42A 4DNRB 1LTSD 2F8EX 5IT0A 4HCSA 3V05A 1D1KA 3MOJB 3MAAB 4I6WA 1S10A 4BA2I 1SPBP 3DMJA 2JLFA 2KVQE 2R7FA 4NEZA 1IN0A 1GXTA 3HJVA 4HT5A 1V8QA 2MHEA 4OZ2A 4OYXA 3NGDA 4DUYJ 1PCAA 1TS2A 4P71A 2D3UA 3UQSA 2MQOA 1S40A 3SDEB 3VGVA 1WI8A 2LLZA 4CLLA 4CIOA 2UUTA 2APOA 1TWCH 2OPQA 2XTJP 4E8UA 4OIJA 3TDQA 2UXBQ 1G3OA 4WKYA 1ET9A 1UE1A 1W2IA 3LGMA 4JOUA 3CJTA 1R31A 3G82B 1SROA 4G1IA 4ENOA 4XDCA 3L7UA 3K0XA 4DU7A 4CO2A 1QVFA 1VQIA 2R7RA 1X8DA 3TVKA 4OV1A 1LV9A 3Q23A 3EUNA 2ZH6A 2W9CA 3CNQP 5DQGA 1HMVA 4LUVA 1NAPA 1UETA 4DV5Q 5K36H 4KHZA 3DYAA 1VK3A 1OY8A 2EXDA 1L3KA 3H94A 4ELTA 4JI6J 3FBCA 3RJMB 3TP2A 2B8PA 2HLUA 2IBKA 1S72S 1YTYA 4HIKA 1NBEB 3Q8YA 1T11A 3QRQA 3QPIA 2FQQB 4CDEC 3OYYA 3NEMA 3R8YA 5C0XI 3HOXB 4WFYA 3MTKA 4DK3C 3TJ8A 1Q5VA 2VG6A 1WTWA 3H0GB 1SE3A 3PDNA 5E5NA 4KHVA 4HHHA 3I4PA 1RGVA 3J81L 2CPXA 1X5SA 2HQ3A 4ECZA 1X3QA 5F9NA 5M2PA 2CQHA 1HNVA 3NAHA 4UQGA 2FJVA 3NS7B 1VYAA 4NRUA 4QWCA 3PW4A 4OJ3A 1XEZA 4QQBA 1NK6A 4CCHA 1JORA 4O3SA 1BC6A 4UAIA 2DY1A 3C6UA 4BY1B 1N32J 5J1EA 3LP0B 5C0XJ 2IJ0A 4GLAC 1RAAB 2EOTA 2HS0A 4BY7B 2V4JB 1JIHA 2VFVA 4X4QA 3AQQA 2GW8A 3FMBA 3VYSA 4PWUA 2BR0A 2V63A 3SCJE 4ED8A 1ZEQX 3Q86A 2V1CC 2DNPA 2WOMB 2F4FA 3AT1B 1CQVA 4IPHA 2JP1A 3SHLA 3S15H 2DKOB 2IWHA 1UA1A 3I4MH 2QMXA 2K1BA 1IKWA 1GOZA 4HCEA 3KLIA 5HMZA 1T03B 2C2RA 3QLHA 4FYDA 1FRIA 5HI7A 3PW0A 3DEPA 3O2IA 5DM7Q 2NN6G 4RNOA 2AEJA 3EWGA 5ETOA 1J5OB 4TYAA 1G4CA 4JI7F 3HVTB 2VH7A 3W3AA 4RUHA 3DOKB 3PTWA 4B3TF 3QSIA 2XS5A 2HYIB 1RIPA 4QIFA 4BS2A 1U9RA 4OJ1A 4DQRA 2E5LQ 3MAQA 4DV2F 3AFGA 4QCLA 5KG3A 1LTTD 3M2VA 3WOFA 3C1EA 5CQGA 1KLMB 1XNQQ 1N5YB 1E24A 3K17A 3JSBA 4RLEA 1SJRA 1C9OA 1BQMA 3CCMS 3MGJA 4DUYF 1EIGA 2XB2D 5LMNW 1GUNA 1RT1B 1YJ7A 1VDZA 3UW1A 3RN5A 1Y0HA 3BBCA 1OJ4A 2CDQA 1HUMA 4NOHA 2MQQA 2RQCA 1BQXA 4ZK7M 2W9AA 5EX0A 1NJWA 2PFDA 2OJ3A 3QZ7A 5DLFA 4AQYF 1PH6A 3OW7A 3VA5A 4G1QA 4ER8A 4CLFA 4LF7L 5CHCB 1J9OA 3KHHA 3M4XA 4LF9L 3QR8A 2D0PA 1YITS 4ETXA 1BUVT 1TV6A 5CV9A 3QFWA 3I82A 1WWHA 4XO0A 1RLDA 2F0IA 2CH4A 3M3YH 3M8YA 3TQEA 2BQ3A 2ZD1B 4CKEA 4LF6J 1KSPA 2ZBCA 1NDLA 4LF7J 1CJTB 5J2QB 2HNZA 2BH2A 1BBUA 5C4HA 3RB4A 4PG6A 5IOCA 2RHSB 2CQDA 2RMLA 3PKMA 5E33A 2QKIC 1RB0A 3EBEA 2C3UA 5IWAQ 1I6HB 3ZNUA 3Q8SB 1ZA2B 3BS1A 3LGNA 1RTDA 3H3VC 4DL7A 1XX8A 4DSFA 1D1IA 1Q7LB 3MFHA 5IT9Y 2N4DA 1NK5A 4MTKA 3I2ZA 1RZMA 4L5TA 4N56A 4Y2IA 4L73A 1QG7A 3VZIA 4LR9A 3RU0A 2FJ2A 1TAQA 1TWGH 2K5VA 4POFA 4W4MA 1I50B 4DDFA 4DU9A 3AEVA 4A3EH 5DG7A 2BACA 4W92B 4UZBA 3V4IB 1WKLA 1WACA 4TY9A 3O8WA 1TL4A 1RWWB 3OIQA 5M9OA 4I7FB 4QR1A 3K5LA 3GPAA 3CJKB 2MNAA 4KHPF 1PC5A 3K5NA 1HH2P 3DLLA 1HQUA 5D65A 4H4OA 1VQYA 3T1YL 4B3TJ 1STEA 4H7BA 4Q5VA 2B2YA 2HGMA 2R2TA 1B3TA 1E2VA 2Q1LA 1DY3A 4WFN3 1SQGA 1TY0A 3A74A 4C2MA 1CJKB 1F2ZA 1S48A 4A3BH 2XMVA 5DS7A 4W98A 1SEBD 3BGOP 3OXGA 1YZ6A 4PCQA 2YKNA 3EFXD 5JPMC 2J9EA 1MW7A 1TWCB 3QAUA 1JKHB 1H98A 1Q82T 1FVSA 4A3JG 4DV2J 3STBC 2QLXA 3HHLB 2VBYA 3JSYA 3MPWA 1YDLA 3NWGA 2C3OA 2W2OP 3DGPA 4KLKA 4KV8B 3TJAA 1I94J 3BDPA 3WWVA 1P9QC 3U27A 1FEEA 1DQAA 3H0GG 3A8IA 2E5HA 1KXLA 4ID6A 4F3QA 5IGEA 2DXEA 2DB1A 1KNZA 2ZBPA 4IUNA 1XTCD 2JWNA 3KF6A 1MIUA 1FFWB 1SIWB 4DFJA 3RMHA 4A3IG 2ZH4A 3MCNA 2PMHA 1KVJA 1FNMA 3BREA 4ZLTF 2OF1A 1WC5A 4LFCJ 1X5OA 4LT6A 5C4JB 2Y1LB 3LUYA 3MMBB 2J9DA 1T7PA 3NBHA 4UP8A 3P5BP 3A7LA 1B44D 1RT2A 4BY1G 5CXTA 1Y4ZB 5HQMA 2CUYA 2XMJA 2L5TA 1TMMA 4NZ0A 4L5RC 2KCNA 3C46A 2FHOB 2JLGA 1S1UA 3LO3A 1H2TZ 3OL8A 2FY8A 3LGJA 2UU9J 3IMQJ 5KFZA 4F4YA 2WB1B 1XK8A 5EAYA 4OEMB 2Q2TA 3ERSX 1IWAA 3C1FA 3H25A 2WOMA 3RNUA 3H2VE 2ZBQA 1UE5A 2UV8A 3MM6B 3DM1A 1JCKB 2KM8C 5KFTA 3M9NB 2HQEA 4OZ1A 4DR1L 2FVQA 2DNRA 2VC0A 2V9KA 2QL9B 1C0UB 3W63A 2NVTH 1JR0D 1BXNA 5I2YA 1ZAXA 3E8OA 1W6JA 3C6UB 2BABA 3HRZC 1VQ9A 3QT5A 4YR3A 1HFNA 2UXBL 3R5CA 3ZYYX 4HEA9 5IP7H 3CPWR 2OAUA 2CIMA 2SEBD 4F7XA 3OQ2A 4CNZA 3SK8A 1E2WA 2E2IH 1CSJA 2F0UA 2J76E 5CZVA 4H4KA 1TKZB 1Y8NB 3DOLB 1CJUB 3OT9A 4QU7A 1J5OA 4K0KJ 4KY7A 3MZ5A 4K5VA 1SYGA 3E01B 1HBMB 1RTNA 2A68C 2OEOA 2IW3A 3JQKA 1STGA 4KRWA 1I4QA 1H9MA 2CWKA 1W3SA 4OI3A 2PQEA 3BYRA 3CCES 1E7ZA 2P9EA 1S4FA 2MDAA 5L46A 3FQKA 3HP3A 1IKYA 2CVEA 2NREA 5EX3A 2W1BA 4G1PA 2GJFA 4M5MA 4U67Q 1CLFA 3D7SB 2CPEA 1VQKS 4OX6A 2BXJA 2W4DA 2UUAF 3SFGA 4DR4F 5CCLA 3PX6A 2ZJQA 5F0UA 4KC5A 2DH7A 5IE8A 4HIDA 1DTQA 3NBPB 5KG7A 4C3HG 2XYGB 3I0SA 3D3CJ 3FPPA 2VB6A 2FHJD 1U0SA 3E9IA 1KS2A 3H59A 1K0RA 1QVFR 4V19X 4EK2A 4DV3J 3CD6A 4MT1A 5D3GA 3GU0A 1G6BA 1FD8A 1J8IA 5HQ8A 4GKKQ 2F0QA 1KQGB 3PIOA 3HOVB 3M1VA 2CYYA 2G0CA 4GZYC 3MD3A 5KG4A 3K0JA 3QGIA 2G9DA 5CAAA 1GO3E 1CHPD 3P6YC 1B70B 2NUHA 2KHCA 3CCRA 3FDTA 2ROPA 4XPEA 1TL1B 4F2SA 1OO9B 1NLKL 3TEGA 1S6OA 2N3SA 3QAEA 1KOHA 2Z56B 3WBZA 4A8QA 4FBUA 3NK9A 2BA0A 1NTGA 3E2EA 4MIBA 1UVLA 3CMAS 2IBOA 5IT9U 1A2UA 1FWPA 2GHVC 1O78A 1SJ4P 2Z4HA 3Q0AA 2VONA 2CQPA 3G71S 3VZHA 1I4XA 2CJYB 4X65Q 3I4MG 4K8IA 2L9WA 1FX4A 2G9HD 4NLXA 3M3YB 3B6YA 5EDWA 4ZCLA 1D3WA 2Q6BA 4Y2KA 4H13C 3CXCR 2EPBA 4ZVTB 3D8GA 2RA4A 3AD8C 1PZJD 3U1LA 4I4BA 5AXNA 1EQVA 1WTQA 3T6BA 1L5UA 3CMAA 2BMBA 5ELDA 5C42B 3HOXH 3JSRA 2A6ED 3GP7A 2ZE2B 1WD1A 1JNRB 2E7VA 3EXYA 5M5XH 5C4ZA 3KLGB 3M6XA 2E5LL 2ACYA 1SL0A 5LL6S 1EU4A 3W1GA 5J2NB 2MKCA 3JAMU 3EGWB 4JBJA 1Q79A 1LNQA 2O01C 4CLZA 1LT3D 3E3XA 3Q2TC 1Q4RA 4R8NA 1X4BA 1UZHA 2JA6G 1B99A 4NASA 1Q8KA 4C1NK 4K4UA 4RMFA 4JI6F 4PZ8A 1HQMC 3D28A 2PEHA 4U8YA 2IJRA 4F7VA 1CC8A 4OQJA 2ICIA 2EFQA 3S24A 4K0KF 2UXCF 1HR0J 5DDOC 2WFWA 3AYHB 2WW4A 3BH6B 2MHVA 1JLCA 4C6AA 4A3DH 4K5RA 4LF7Q 2E5IA 4GVBB 1FRMA 2FIUA 5D4PA 2LU2A 4CO3A 4XIGS 1UNSA 4LF9Q 4IFYA 3J81E 2VW9A 3KLSA 3ULPA 3SCLE 3D1HA 3GG0A 3M05A 1BKBA 3D0FA 2UUCJ 2VBWA 5BYRA 4HN7A 3A13A 1X3EA 2R61A 4BWMA 3IR6B 3JTNA 5F8HA 3I0SB 1F2MA 2DRBA 4BLGA 5FLXL 4JI6Q 3MUVP 2F1FA 1XR6A 5F8LA 5LMNF 1YGYA 3HVRA 2V50A 4TQRA 2PSZA 3BF4A 4RW7B 5T7LB 3P1HA 4LREA 4IFDI 5A2QL 4A3BB 1NUEA 1SMXA 2FJXA 1T9XA 1XMQJ 2ZXPA 3B4DA 1TK5A 4C8YA 1GUSA 1SJ3P 1MMLA 2CWAA 4JCVE 1JXVA 1OXXK 4ICLB 5A8WA 1QTNB 2PZTA 1PYWD 2YU9B 1FVQA 3T51B 1X9SA 3Q8QB 1L1OB 1TR0A 2CQCA 4Q2LA 2M5YA 1ZM2A 2D62A 3O5TB 1ZYRD 3LW5C 4F4AA 3SQOP 5IV4A 1J27A 4NLVA 4OX9F 1CS4A 2EWHA 2WAQD 1VQAA 1Z4UA 2MLYA 1SV5A 4LUBA 3ITPA 3POTA 3TA0A 1RCXB 5AT1B 4DR4J 4X65F 3T1YJ 2E2JH 5AJ3F 2V2QA 3NL0A 4DXGA 2D9PA 2Q2IA 1VQLA 5BN5A 4DZ6A 4M5HA 4OIXA 3OWFA 3FBFA 3I55A 2CHBD 1U4PA 2AQ4A 5FLMG 2XS2A 2E1PA 2A1BA 2OEJA 5C25B 1EYDA 2YNFA 5M3MB 1AFIA 2BE2A 2HZCA 3M2UB 2O3DA 1OPIA 1VQBA 1XMOJ 3WC0A 3THPA 1NPKA 1YJNA 4JI3F 5M3MG 3PJ9A 2K5QA 2DNMA 1D5ZC 1GAOA 2LYVA 1VGYA 4X4OA 3QIPB 4NLSA 3CCUS 2GMJA 1STHA 2IHFA 4Y7NB 1QSLA 4XT3B 2EYFA 1R8CA 2NXJA 1X3PA 1LFWA 1VQDA 1TAUA 1EOVA 1KVIA 3SQGA 4DV6F 3BSAA 2D5DA 2DJWA 2ID0A 5J1ZA 1FHTA 4DQQA 1UEBA 2Q8IB 1O0PA 2L1BA 4JI1F 1AZPA 1W6KA 1N8RT 4XQNA 5CA5A 2DGVA 1RWPB 3CCUA 2JHEA 2HHHL 5DZ6A 4P10A 2QGFB 3TR5A 1NB2A 4OMFG 2YQ3A 3TP5A 1NJIC 4X4UA 2XGQA 1OPZA 1WEYA 3ZZYA 4N76A 4UP7A 3I7FA 3VA7A 2UUCF 4ZPBA 3ADAC 3EDRB 3NKYA 2RQMA 1A3VA 1O6XA 3H0GH 3L0OA 1JB7A 5RUBA 1J6QA 3T5LA 4F25A 4CGYB 2OUGA 4ED0A 1RKIA 1K8MA 2CW0D 5B0FA 4A3JH 4MNOA 4A3LH 2P2CB 4MKVA 3H5XA 3S6EA 3PUWA 4UHVA 4X66Q 2HQGA 3TNVA 5M3FG 1QAIA 5E0OA 3DKDA 1LM0A 1G291 2GIFA 4NLDA 4DSIA 3M8WA 2NZ1D 4BY1H 1HNIA 2EK1A 4P2MA 3S17H 2VASA 1ZTWA 1HCZA 4MIWA 1QUQA 5K20B 5COYA 1C8CA 4DFAA 2DISA 2RHQB 2Y0SD 5K14B 4DR1Q 1FJGJ 2RDFA 3HEJA 2OIHA 3HOUB 4A8OA 5HMXA 1LK7A 2KN4A 4C3MA 2EC0A 4QW9A 2ASDA 1ZZFA 2NVXH 4TU9A 3CJ3A 5HSPA 2M3DA 4JI8L 4LBPA 1EIYB 1ENCA 4V0BA 3DRRB 1SBRA 5CD4H 4QL5A 2I1RA 4DN9A 4E0DA 1STYA 1KLNA 3I91A 4OLOA 5J22A 3H7HB 1QVCA 2KEDA 1JWWA 5I3UB 2YNHB 3HFKA 4OELB 4DPYA 3GV7B 1EIHA 4LFBF 1Y5NB 4JI3J 2CQOA 5FLXc 2CQIA 1ZOTA 1F60B 1SJQA 2VF3A 4GO7X 1EP4B 3BB5A 3W2WB 2F0OA 5KFQA 4TY8B 3TZYA 1CSQA 1CJTA 5IC6B 5C3WA 2F9JA 4WU2A 2AJQA 3M30B 1KDCA 3PG9A 2XSJA 4A8XA 1SYEA 3GLJA 4TN2A 2W9BB 2GMLA 1SH0A 1LTGD 4G1QB 3E9HA 4WBFA 1HFGA 1RT7B 4X62J 2CNLB 1S4EA 3OTOF 2K01A 1PDQA 3PUYA 2V8DA 1J5EJ 2F0KA 4URGA 2IYGA 1SXTA 4GKKL 4ZCMA 5JJZA 1T9YA 5I3QA 2JFDA 2HNYA 4WIQA 4DV0F 5IYBG 2WONB 3MR5A 1TUGB 2J6TA 3ITHB 2JEAI 3IWNC 3QJPA 2WBRA 3HJFA 3KLFA 2H51B 3GTMB 1YZ7A 1LOUA 4J5OA 1AH9A 3KXDA 4RA8A 4QB4A 3G87A 1B2TA 4RNHA 2QMUB 1N5YA 5E2QA 1FDNA 1A6XA 3BN7A 2RKIA 2HIVA 3J81U 3S1RH 2EVBA 1HNZQ 4AUKA 4X65L 4A93G 5C5LA 3UDIA 2J9DE 4DK6C 2KYXA 1D8ZA 2WHOA 4P75A 2JLEA 2K75A 2ZH8A 5A8WB 4CI0B 4K4YA 2CQBA 1W7WA 2JA5B 4ID8A 2NR0A 4NLQA 2YNIB 2A6OA 3CJRA 3IA0A 3PMFA 3Q22A 1MWYA 1PXUA 2LKVA 2M2BA 4ED4A 4P6QA 5GAEI 1A63A 1YBUA 2AKWB 5E7NA 3N9UC 3CCJS 5A35A 3T1HJ 4IPCA 3NUCA 1YJUA 4QPXA 2UXDJ 3G6VA 4ILRA 2ZXRA 1JOQA 1N34L 5JEAJ 2F03A 1HBOA 1C2PA 2KH9A 4S3SA 2ATLA 4ECQA 1GHKA 3BYTB 1F2YA 1PLFA 4LSNB 1EFID 1P9YA 1KAAA 5B0AA 4IQZA 3CMES 1Y69U 4EQ5A 2QO3A 3NOGA 1VJQA 4UY85 2W4PA 4U95A 3EJIA 1TQOA 3W8GA 3JYTB 2PI5A 1MG7A 3TZWA 2DCUB 2AW0A 4Q43A 4Q44A 1R0AA 4KY6A 2Z2LA 2BV3A 2MZRA 3UWTA 1MWQA 4F4WA 3CDBA 5FKAC 3RZDH 2MPUA 4A3LG 2QLJB 4K59A 2N3LA 5FO7B 1YX2A 4R4OA 1W2BR 1TKDA 4IDKA 2HZAA 2XQCA 1Q1KA 1VRTA 4WCEQ 5I9PA 2QFJA 3HFZB 4DBQA 2LQ5A 1RWVB 3GCXP 1I4HA 4C0HA 4JI6L 4A47A 2JVOA 3K5PA 3AY0A 1V1OA 4I65A 4OI1A 2HHXA 1BWEA 2XY5A 3KTQA 2PZWA 3SBMA 2H5EA 1QVGR 4A75A 5DNFA 3PIPA 2K5HA 1P16A 3I5BA 1A62A 4X4SA 1PYBA 3DYAB 1HNIB 4FYYB 4NLTA 4I0WA 4KGVB 1LK5A 2DHHA 3MC0B 4IOAQ 4AXIA 4X62F 4NLWA 1KC8C 3GCWP 1I6VC 1T05A 3MM5A 1SC3B 5KT7A 4MYTA 4Q0FA 2BJ7A 4IOCA 3FEYB 1FF2A 3J7YU 1H9RA 4C3LA 3Q83A 4YOEA 3H3VI 1G2EA 2IPOB 4R5PA 3LGHA 5HANA 2V8PA 5E3PA 2UUCQ 2KRBA 2IM2A 2NYHA 3DI6B 1Q8BA 3WX4A 3MCOA 3I5AA 4ANDA 1X4GA 5K14A 5KFNA 4ZVOB 3GJRB 1GT8A 3PR5B 3LWUA 4TSSA 2N49A 2RSOA 2HHSA 2RQ4A 3SV4A 1RKJA 1OXVA 2D3OR 2FHMA 2QCPX 1C48A 1RWXB 3CU7A 4B3SF 2I2YA 4H4MA 2N7YA 4V19J 4LUOA 1KONA 3V81A 4RH6A 2ZC4A 1UA0A 1KTVA 4NLRA 1G7CB 2PI4A 3KK2A 1YRUA 4PZVA 1XNQF 3MPDA 4J7CA 1QWYA 4OHZA 3F8TA 1ELOA 4LF4L 2EYMA 5M3FB 2E44A 1KWMA 1F6TA 1JLAB 1S0NA 4CNYA 4PNYA 5AXLA 1PC4A 1RTJA 5C3XA 2XO7A 1QILA 4KYZA 2PFFB 2HQIA 1B9MA 1RAJA 1U2RA 4PRFA 2NXCA 2C2OB 2BE2B 1XTDA 1A2TA 1O7ZA 2QIFA 1S1TA 3EVOA 3IP0A 1VIXA 1PZID 3T4AC 4LRAA 1N5SA 3W9IA 4A3DG 4DJBA 1TKZA 4LRDA 1S0MA 2HHHQ 4B9WA 4IUUA 1M0SA 4URQU 1JLFB 5FIIA 5HP1A 1TP7A 1H2VZ 1S1VB 1YBYA 2NCKL 1XMOQ 3QGHA 4JI8F 5IYCG 1CKNB 1HPZA 4C11A 3TP7A 1GUOA 6AT1B 4ZPTR 2EY2A 4ZPVR 1HHSA 1RCVD 1RXOB 4F88A 4BBSG 3D9BA 1S6PA 2GX8A 4A3CG 3MXNA 1FRXA 2DNZA 3U9SA 1S99A 3DOMA 2M2LA 2RIJA 2JEJA 3RAXA 4X66L 3R3OA 2LQ9A 3HOXG 5H9EJ 4KFBB 4QWDA 3SI8A 1QE6A 4F50A 2PN6A 3HVAA 1EYCA 4I68A 1PH5A 1II3A 1RT6B 1QAYA 2LP4A 2MYFA 3ZFVA 1EY6A 2FMMA 4M5GA 2UXDF 4UP9A 1RTJB 5M2UA 1SLJA 2F0DA 1EARA 4ILMA 4ID5A 4PUOB 1R4PB 1X3FA 4ZP7A 3S9WA 3T5HA 1FE4A 3C66A 1RJTA 4WPAA 4JI0Q 2JSOA 1UJ6A 4NXNL 3DLKB 5F8NA 4JI8Q 1CKOA 2JA7B 4RUCA 1SUQB 1S9EB 3IAM9 4KQZA 1SIZA 1WTOA 3C15A 5GAGU 1PTOC 3S1RB 2VL1A 3SEOA 2PDAA 3FUYA 3MDFA 4KV8A 3PO2G 2TSSA 1Y5IB 2XMUA 2CVRA 1U45A 1FJEB 2ROEA 3DC2A 3N4WA 3I55S 3HHLA 1OS5A 4A3FG 3P96A 4K6DA 2KEEA 3GTJH 3EVMA 1ZKOA 5ETMA 5GMKa 1UVJA 3AB2B 3CPWA 4FF4A 4YR0A 3JAMi 3AFPA 4CLTA 2R92H 2HBZB 4LBIA 5LJ3Y 4QIEA 4PXCA 1EY8A 4B3ML 4MIAA 3QGPA 2KQ3A 4JBKA 5KFWA 1DQ9A 2OMLA 5KFUA 1EX8A 2K03A 2DY7A 4NE9C 2RUSA 2QV6A 2B4OA 2JC1A 4X3KA 4WZQA 4NB3A 4WORA 3NHHA 3S1TA 4M8LA 2UVUA 3ZZTA 1FTCA 1G51A 2B8QA 2C1EB 3P49B 3FNNA 5JVG3 5U47A 3CCZA 2VUMB 5ELBA 2ZH1A 1SNCA 4DV5J 2OO4A 4DV1Q 3NQIA 3SK4A 2F8MA 1FWKA 3I0RA 1LXJA 3EJMA 1PTOH 2BDPA 2IX3A 3O13A 2R2SA 4R1JA 5DJBA 2E8GA 1SKUB 1W25A 1EY7A 4LF5J 2DHSA 1IBKQ 1OY9A 3OFHA 4DF8A 2F0FA 3OR2B 2JNJA 3BBBA 4RFBA 2CQGA 5THWA 4RW4B 3SR1A 3W60A 1UWVA 1Y3JA 4YB1P 1VF7A 2UVVA 1JT8A 2VS1A 1HNZL 4GLVB 5IT4A 3I3CA 1NU4A 4UDUC 4ZIWA 7FDRA 1RTIB 5LSLA 4BWGB 5EBDA 3FC9A 2NSCA 3N52A 3C8YA 1X4HA 2OP5A 1ULRA 1T05B 4I6YA 1FVIA 2NBFA 2ASJA 4QIGA 4IG3B 4KSEB 2L4NA 4GKKF 5GMDA 3KUPA 1IL8A 3ILLA 4O4GB 3R1LA 2E5LF 2KHSA 4LRBA 1E6YB 5JVGQ 5C4XG 4CO1A 2C3YA 2WAQE 5L9NA 2JK8A 4IYQA 3T53B 5L39A 2X3GA 3EZ5A 1WDDA 3MWBA 1N34Q 1X4DA 3WX8A 3O1LA 3PFOA 1SE8A 1SCJB 2OTLA 5HVHA 1MKHA 3GYNA 4G57A 4J9VA 4WXWA 2K33A 3BSCA 5KFHA 1EKRA 2GA4B 3K8AA 2GAHC 2UU9F 1DTQB 3NBPA 3CEDA 1NSKL 1FJGQ 4DR1J 3A7AB 5HJXA 2A6MA 4AYBG 3ER0A 2ZNYA 2F0VA 1SFOH 5IT9L 3A8KE 4EO6A 4KHRA 2X1BA 4DZDA 1A3TA 2OT2A 1VMBA 3I4OA 1E3PA 3G2XA 3FEWX 2R7SA 4L76A 3M7GA 1VQ6A 3M9BA 3D4JA 3R5DA 1L0YB 3E6ZX 1WTPA 2KHDA 3CCLS 1YIJS 2MY8A 1BO0A 2K4KA 3J81i 5IWAJ 1PA6A 5CYQA 3KK3B 1LW2A 2OTLS 4OYPA 4DX5A 2RS2A 4F87A 1X4CA 4KH1B 4ZUJA 5HJYA 4NMXA 1PFMA 5BYSA 2XNRA 1CJUA 1WCMB 4PPDA 1HW8A 2R8HA 2ZZNA 2HNDA 2XO6A 5JOBA 2K32A 1E2ZA 1HR0W 1Q53A 1HBOB 2BA1A 2ZEJA 1VQ4A 4IJLA 3CCLA 3R3TA 2YKPA 2IY5B 5IT9E 1FNUA 1ZM4A 2DCLA 3P4UB 2R7WA 3DM2B 2Y1JA 1TU2B 4RWSC 4IPDA 3CD6S 2BANB 3MM9B 3HOZH 2WSCC 5EWEA 1F5BA 3CP0A 3UCZP 1FWLA 1FKOB 2GVBA 1S1UB 2ZUAA 3PZPA 3RB3A 5KT6A 2FLPA 3GB0A 1EOTA 1FGBD 3KF8A 1JQGA 5IM0B 1FKOA 2JL9A 3P45B 4EGLA 2VQEJ 2E5GA 4KFBA 2HMIB 2JEBI 1TWAH 1R8BA 3CCQA 5C0XH 4FF3A 2VFRA 5IQ6A 3M30A 3I9ZA 4DV5F 3IWLA 4WK1A<