3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
molecule keywords BipA
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
4MYUA 4QR2A 1FNMA 2BV3A 1U2RA 3E3XA 2I0XA 1ZPWX 1DARA 1ZM4A 4TNOA 3CB4A 4QR0A 2KDOA 2L9NA 1KTVA 1ZM2A 2IVYA 2XEXA 4ZCLA 2BM0A 1ZM3A 3B82A 1VI7A 1T95A 1N0VC 1ZM9A 2CVEA 2YWEA 1ELOA 4MAKA 2I8EA 3UI3A 4M1KA 4ES1A 4ES2A 1P9QC 3LH2S 2ZITA 3OQ2A 2NPFA 1N0UA 3ZZUA 3EXCX 3ZZ0A 2YWFA 5G4DA 2BM1A 4ZCKA 1WDTA 2EFGA 4ZCIA 4ZCMA 2E1RA 2YWGA 4MYTA 2WBMA 4QR1A 4ES3A 2DY1A 3ZZTA 3B8HA 2J7KA 2YWHA 4FN5A 3B78A
chains in the Genus database with same CATH superfamily
2VQEQ 1VQNS 3HOYH 2KG1A 2FJBB 4CBVA 2I46A 4JI2F 2AJQA 3RRGA 1TUWA 2RRAA 4OX9J 1UWAA 1IBKJ 2B4UA 3MXPA 1NB2A 5D65A 4F3MA 4IRKA 2F4VL 1S97A 1EY4A 2EC0A 3JB9k 1Z2LA 4UF4A 3FC9A 4EWTA 4PWDB 5C4XH 3CCLA 1GEHA 2IVYA 2W4DA 1QUQB 2RNEA 4CLZA 4BS2A 4YHHQ 2D62A 2NVQH 2GVDA 3DI6A 2MNAA 2KJXA 3SQGA 3RBZA 4LF6L 3V6KA 4ZPAA 2GHVC 4DR3L 2WB1B 2DNMA 3CTRA 5H9EK 1S12A 1TL3A 2VFUA 4J9SA 3MXUA 2EFOA 4L5RC 2VQFF 1V1PB 4IDKA 3IBCB 4ANCA 4BY1G 2C3YA 2W9CB 1QVFA 2CPFA 3F44A 1U0LA 1YX2A 1XBWA 3GTQB 4EYHB 2VG6B 2RQCA 2NXUA 4O4GA 1V5IB 4DAMA 1QOHA 3M8YA 1A6LA 4ATNA 4QPTA 2OWOA 1EKSA 1U1NA 2APOA 4LR9A 3FSIA 3Q22A 2XMMA 4JYAL 2SNSA 1XNRJ 2YTXA 4OX6A 2YTCA 1SJQA 4HJ5A 4KFBA 4OHYA 2PMZD 1W3SA 4A4IA 4ID6A 2K33A 4HVZA 4JV2A 2AJFE 2R7ZB 1IR2A 2KCTA 2WSFC 1TWFB 2Z6KC 5RUBA 3AMUA 3KJQB 4DR2L 2CQBA 1HWKA 2V1CC 2IA6A 1YWXA 2B9WA 2ZH5A 4A46A 2HFOA 4MYTA 2LKVA 2R92B 3OSPA 2D41A 4DG1B 3AQQA 4DFKA 4K4ZA 3M4OB 4CRJA 4O3PA 3A8JE 1RL2A 4OI3A 2B7BB 1KLGD 3CJ3A 4GO7X 4FS1A 2HHHF 3IM8A 4KE5A 4AYBE 2XSJA 4NMZA 3PYDA 3NKYA 3UVJA 3P5TL 2M70A 2E5LL 2DEJA 4IQMA 5M5YH 2J9EA 1I3QH 4R9WA 1ZTWA 2H9ZA 2GV1A 1V1QA 3HOZB 1MSGA 2OTLS 1LW2A 3GJRB 1YNJD 1N33J 3RRKA 2EE1A 4HCEA 4LF8L 3S17H 4B3TJ 1G51A 1WTPA 2NR0A 2HFUA 3KJOA 2WP8J 4CM0A 1VQKA 4C7QA 2QMWA 3S2HB 1YJVA 5C44G 3W8PA 3SV3A 4LR8A 1ZAWA 4W4MA 4U8VA 5A8RA 4A47A 1N5SA 1LWFA 1S57A 3GZ7A 4GOPA 3R7NB 2N78A 1EQQA 4OO1I 1XNQL 4DSJA 2P5ZX 3HOZH 4YWKA 5EKKA 4NXNL 3I4OA 2M2BA 1KRTA 2A10A 3FQLA 3H2VE 4CDCC 1OS5A 1S40A 1NK5A 5D4PA 5C5MA 5IOLA 3IAS9 4PXBA 3QT5A 4K0KL 1BQXA 2GO8A 1VQLS 2RT3A 2G0JA 2XLIA 3FEWX 1UTAA 3EX7B 2ACYA 1FERA 8ATCB 1FKOB 1QUVA 4CIOA 1S5CD 3E01A 1UJ5A 4BBSB 1PFSA 1P9YA 3PZPA 1IM4A 3DLLQ 1MMLA 3G71S 1MU2B 2VKZG 3T6JA 3HOUH 2D69A 5LOQA 1IKMA 2HNZB 3AD9C 3W5OA 1HW9A 1ET9A 2HDMA 4G57A 3M9MB 5DZ7A 4LF6F 3GG1A 4BWMA 3JXOA 1S5ED 2R6GA 4M5DA 2IL8A 3LGMA 3T4AC 3RD4A 4QIFA 3PR4A 2XC9A 4PPZA 3LQVA 1Y1VH 3RMHA 1D5MC 2WVDA 4KHMA 4TU9A 1EHWA 2I0QA 2VDIA 5JJZA 3HMJG 2ALYB 4NPOA 1CZWA 5M3FH 3M3YH 5K14B 2AWZA 2W9BB 2WZ1A 3BBCA 1VQOA 3BB5A 3D6WA 2EG2A 5A2QU 2YWEA 5M5WB 3WZ0A 2XGTA 3UD3P 1DQAA 4QQBA 1OQ3A 3BJYA 3QQCD 2BJ8A 1XMQL 2JLGA 5C25A 2GVZA 4RH6A 3SYZA 2FJWA 1NU4A 4QR2A 2UV8A 1WTVA 1OQ6A 2L5TA 1M1KT 3KFWX 1CSQA 3PO3H 5KFHA 4NDXA 2RDFA 4C8NA 4JI1Q 1E1TA 4FVMA 4B08A 4ALZA 5G3LF 1JLFB 3GIRA 1DCZA 2F1FA 2F0OA 3JQKA 2WB1E 3BH7B 4X84A 3D4JA 3HVTB 3GTOB 3AFQA 1RT5B 2NREA 1U7LA 3U1NA 4C3HH 2D74B 3ITPA 4NA1A 2F4IA 3TQEA 2LU1A 4F4WA 1C8CA 1XN9A 1A2UA 2QCPX 4C11B 1R9TB 5HMXA 2Q6CA 1K0VA 1HNZQ 2D1CA 4LFAQ 2SNMA 5B0EA 4NLWA 4KH1B 3OIPA 3F2UA 4NLUA 2KUMA 1CHPD 2DR8A 4EMDA 5HROA 2KI2A 3ETOA 3BQ1A 3CP0A 3PW7A 3KK3B 3IR6B 1K83H 4HJ7A 1PYBA 3LP1A 4DFJA 4C9DA 3MEDA 4HJ8A 1STNA 5EPLA 3AODA 2XCPA 2BRKA 1RHQB 5E33A 3P49B 3GYNA 4DV2F 4M5JA 5CH7B 2LQ8A 3GTLB 3G6YA 1ZETA 5AE3A 4LF9Q 4J7CA 1PCAA 2I5JB 4HHUA 4GN3B 1XPOA 2OJ3A 3KK7A 2I5JA 2RDJA 1FEEA 1O0PA 4B3ML 4X3SA 2HRTA 5ELOA 4QW8A 4JI1J 3WOFA 3DOMA 1TELA 4ZVQB 3KDNA 2ZH1A 3H3VI 1PHJA 1ZPVA 1KSPA 4LFBQ 2AUKA 3IRWP 1OXTA 1TU0B 2A2CA 4Z2XA 4DNTB 5FDLB 3ZXWA 4L72B 3ULPA 1NDLA 2W9CA 2IRXA 4EFAC 1E1OA 2CPDA 2ZWOA 1STHA 1DY3A 3ZYYX 1TAUA 3AU7A 4MYUA 5LMNL 2R7WA 5DG9A 4X4PA 1Q1KA 3GSIA 2QSFA 4G65A 2XG8A 4DV4L 4RNMA 2V67A 4ZOSA 4A3KB 4JI6Q 4CLYA 4BHQA 1VQNA 3L9ZA 4GN5A 2GAGC 5AJ3J 4KO0B 1N5YB 1RWXB 3NGUA 3KLHA 1NJZA 2G13A 2F0MA 2KVMA 2OUGA 2NZ1D 1U49A 4IFVB 4FYWB 2ZHAA 4C2MH 2MO0A 2DJWA 1S4ZA 2LLZA 3JS9A 5KG3A 2BOAA 5ETNA 2BMBA 5FO7B 4ZVFA 4ICLB 1QJOA 1JWSD 1H9SB 2KVIA 3TS2A 2I38A 1GXDC 1CJTA 1Q46A 3R27A 1VQMS 4ED5A 2B7CB 5AFWA 1EL0A 2LKZA 1TY0A 1VRQC 4HACA 4C8YA 3SK8A 3UDVA 2GJ2A 2F5GA 1SH2A 4HACB 3DXSX 3R97A 3GIMA 3IRBA 1S0MA 4DUZL 3CXCR 3HFZB 3ZZRA 5F3ZA 3AFGA 5DQIA 5A8WA 4DR3F 3IM9A 4DU7A 1OXSC 2XMUA 4NCGB 3EWGA 4NI2B 1MGSA 2J6TA 3EZ5A 4PQUB 2RKIA 4CYUA 5E7OB 3GIKA 3TX8A 1NR4A 1U8WA 4PXEA 1RT7B 3MXNB 2HQDA 4DR4L 2KCNA 3AQOA 1RT7A 4KY3A 1KVJA 2HHPA 4X4QA 4DZ6A 5IXUA 1DLOA 1MHWC 1NHUA 3KK1B 2JA8B 2NBFA 1N32F 4DR2Q 2CWXA 1Q8IA 3A8KE 2HHUA 3SV4A 3UR0A 1XEZA 5LT5A 3EROA 2EFQA 3PUYA 2RSNA 2XTIA 1N33L 3DDNA 2CCZA 1S5ZA 5CD4H 1QAIA 2C2OB 2CZ4A 1LQ9A 2V94A 4LSLB 4MIWA 1EIGA 3W9JA 1P16A 3FZBA 4KO0A 1NPKA 2KQ3A 2YNFA 1VQ7S 4DV0F 1IHZA 3LP1B 1VQSA 3FGVA 1U4BA 3V5RA 2CPYA 1D8YA 5I2XA 2XMJA 1JT8A 5IIFA 4N8OA 4KSEB 2DNPA 1N48A 1S6OA 3I9ZA 1RHJB 4AD6A 2E75C 1IN0A 3Q6SA 3OFHA 3BR9A 3OXFA 4JB8B 1TVRB 1AYEA 1F1BB 2GMLA 4NLGA 2H65B 1WI5A 2V9WA 1J5OA 3QBCA 4QWCA 4PABA 1T9VA 4BCAA 2XCAA 2VPYB 4YN3B 1GO3E 2RF4A 5AT1B 8RUCA 1QUQA 4FXWA 3W62A 1TL5A 4NLRA 4PNYA 3QIAA 1WSRA 4NRTA 1I3OB 3UDCA 1ILPA 2ZZTA 3ISZA 5KFXA 1G6BA 3TUIC 2E66A 2DPIA 4C3JB 2CFXA 4RW9B 4LFCQ 4DL7A 5A2QY 3FEZA 2ABYA 3GD7A 3ULJA 4I2QA 2GVBA 1IBLF 3GTYX 1HXYD 5CC4A 1XNQJ 4OX9Q 5IT9E 1S1WA 1HNZJ 4NA3A 1WD0A 3C6TA 2N4DA 1TXYA 5KG5A 1EP4B 1QNUA 5J2MA 3HSZA 1CA5A 1X5TA 1FDAA 2HHXA 4LSNA 3F8TA 4DV1L 2HVIA 2N4CA 4OI0A 1A15A 3IN5A 3ADAC 3J80i 3X1LB 3VZIA 4UP7A 5F8MA 1GVPA 2IYIA 3HO1A 1GHJA 2MPUA 1M5KC 1FTRA 2WB1G 2B63B 3PGZA 5IM0A 2YU9B 4JI4Q 3D1HA 1GUSA 1S5DD 1KOHA 1RWUA 4USKA 3TA2A 1RT1A 3AB9A 1MBYA 1JLCA 4USJC 1Q82T 2NZ4A 3OYYA 3NE5B 4BY7H 3H2LA 5M5WH 3PIOQ 3MA2B 3SMZA 1IBKL 4A8WA 3F73A 4NLSA 1NH8A 1Y4ZB 4W90B 1OTCA 4UQTA 1UVKA 4F0KA 5GAHI 1WUUA 2J7ZA 4RGNA 2XTJP 3BVGA 2VQFL 1VQOS 1GOZA 3O5TB 1URNA 1CLFA 2FGCA 1JORA 2KDOA 3AOAA 3D66A 2L9HA 2HQFA 2R7QA 2JA8G 1AUDA 2F0FA 4ME3A 1A7GE 1UE5A 3JYTB 1G8ZD 4ETXA 3OSNA 1B3AA 3GTPB 1YJ7A 2EYJA 3WDNA 1SCJB 4LBPA 5D0GA 2IAJA 5CQGA 2RA4A 1IBCB 3LGNA 1HHSA 4K6DA 5JOBA 4DR1Q 3A0JA 4LF8J 5IT9U 3EUNA 3J80U 2R93H 4DV6F 3F2DA 2V8VA 4NPSA 3NCQA 3O6QA 3Q8SB 1CG2A 1X9WA 1DRZA 3KUGA 2HIVA 2LFNA 3HLUA 2D3OR 1RTNA 1ZXTA 4LBIA 2N88A 1B9MA 3G71A 5C3EB 4UP9A 5FK9C 1HNZL 4TNOA 5CBEE 2RF2B 3QAEA 3MXNA 1WTRA 3BPSP 3EXYA 3L7PA 3GYGA 4C3HB 3MF5A 3H40A 5C0XH 3OTOQ 3RRHA 5LJ5Y 3FCHA 2KHCA 2R7ZG 3K80C 1Y3KA 2W2PP 4U7UD 1O6XA 1IUJA 3M7GA 4F3OA 3E3XA 1FD7D 4LF6Q 1B9NA 4OIKA 3MMCA 4B3SL 1F9RA 2IMOA 4FVCA 4DR2J 2NCKL 4J5OA 2M4MA 2V8HA 1K0RA 2EKYA 1RT1B 3HG9A 5C0XJ 3IBFB 4AQYF 3MZIA 3PF4A 2Z4PA 4QYZK 2UUBQ 4K5WA 4N8NA 3I55S 4IKAA 1RHMB 2FZCB 5B0AA 2XY7A 3NXZA 3VAJA 3BGUA 2PGCA 4TKTA 1GUNA 1L0XB 3NEMA 1R8PA 3DEPA 4JI0Q 4ZCIA 3BN4A 1YBTA 5C4HA 4P52A 2ZH9A 2E5GA 4KT0C 5CYJA 5H1SV 1RAJA 2I1RA 1LTRD 1FNMA 4RW7A 3RW6A 1SSOA 1UEVA 4USTA 2CDQA 1WDDA 2CQCA 3M2VB 1KFSA 2D3O1 1PJ5A 2XWJB 2HBRB 2A6MA 2YWFA 2DK2A 2VBZA 3PY8A 5K8PA 2HNDA 3VGVA 1DZ1A 1HW8A 2B2VC 4A75A 1MJEA 2IRUA 4OYAA 4I2QB 3K81C 3D6MB 5EX0A 6AT1B 1I1GA 3B6YA 2PQEA 4FP5D 2UZAA 2YKNA 4NMLA 2ASLA 1A8VA 1NBEB 4R8NA 1D1IA 4Q7AA 2AUJD 1UPMB 1FRJA 3U9SA 3S2DB 4CJ1B 2KL8A 3GV3A 2KXFA 4NLTA 2B8QA 2LDIA 2CQ3A 3FNNA 3AB2B 2WSEC 4EQOA 3T19A 3TEHB 1SR3A 4R8IA 1FK9B 1M1KC 1VRTB 1SJRA 2XLKA 2OPRA 1MN9A 4JI5Q 3DRYA 1KDAA 2DNCA 1IKLA 2DYAA 2HVHA 4PR6A 2ZE2A 4LF9F 4TVAB 4DV7Q 3ZZPA 2G4BA 4LRCA 1G2EA 2F0KA 4IUNA 1RT2A 2J0QD 5CR3A 3I70A 2B3TB 3G6JB 2A0FB 1KLUD 4JI7F 3I4NG 2NLWA 2MYFA 4POGA 5EN1A 3FKIB 2V2KA 2EG1A 4RR5A 4C1NK 1HA6A 1RLCL 1L2FA 2ASBA 3CJKB 2K7KA 4QB4A 4K8JA 4PG3A 1HWLA 1TFWA 1TKZB 2X3GA 4KD4A 4P75A 3MVVA 2POKA 2QZ8A 2HG4A 3OXGA 1UAPA 1U24A 1HFGA 4F36A 2MB0B 2K52A 3QLHA 3MEFA 3J7AV 2UV8G 1PZKD 4I7AA 3GV7B 3HOYB 4IUUA 5JJKA 1EQMA 1ZYQA 5M3MG 2HAIA 4KYZA 4Q2LA 4NXML 1RXOB 3W2DA 1I4GA 5IV4A 3K57A 4Y52H 2RJZA 1VCTA 4OQJA 2HYIB 2F9JA 1HNXJ 3PQIA 1YNJC 5CV4A 1PFBA 4A76A 3S15H 1VQ8S 3I0SA 1DXMA 3MURP 1EY0A 1QSLA 1YLXA 4O0IA 2UXDJ 4B9NA 2NVQB 1LTTD 3CCJS 3L9AX 3AHPA 3CT9A 3M8WA 2P8IA 4EGLA 4IH6A 3PW2A 1PDQA 4KRWA 2EBGA 3DCAA 1QAJA 1HA5A 3ET6B 3PHTA 3CW2C 4Z9CB 2BX6A 2VQEL 1AT1B 3UFCX 2IDLA 2CPHA 4RW8A 3CD7A 2K3IA 4ES3A 3OVBA 4JG2A 2DH8A 2MSSA 1JR0D 1BMQB 3R5JB 2XZDB 5IT9c 3HXMA 3J80c 3QGHA 2R2TA 2RRBA 4ZPCA 2OPQA 3V81A 2M8DB 2MJUA 3E01B 1R6YA 1FD2A 1FA0A 3I4MB 2B9YA 4IOAQ 2QYCA 2PIIA 2CQ2A 3LTOA 1YBYA 3K8AA 1VQFA 2ZDPA 3AQPA 2IPKD 3W2VA 2HVDA 3GILA 2EYPA 4ZLNA 1SL1A 3NNAA 3K7AB 3PTWA 2ZVSA 3HZXA 4LUZA 4M8LA 1JB7A 1VC0A 1VQYA 4GLXA 2NWGA 1SEBD 2MPMA 5I4MA 3H6MA 3LWLA 3M6WA 3A8JA 3PYGA 3RJMB 4QWAA 3RNUA 1PTOD 2RDGA 1X4CA 3HDSA 1V1OA 2V5HG 4OX9L 3C8YA 3PX6A 1VQCA 2R7FA 1NZAA 3FHWA 1UJ4A 1SVDA 1ZM9A 4DQPA 2F8HA 1VF5C 1PAEX 4EYIB 2ZM6J 2VXWA 3N5FA 2B9XA 1OIAA 2TSSA 1RWWB 3FSYA 4KY7A 1GH8A 1VRUB 2DY9A 2MZRA 4NWBA 5IC6B 3DYAB 4CH7A 1G3OA 4DPTA 1X4EA 2RKIB 4A8QA 1NNXA 2XWBB 5J2PB 1LTLA 1U5KA 4OI2A 3UI3A 3UO0A 5KNBA 8AT1B 3BYTB 1XMOQ 3A1YG 5HVHA 2RILA 3S1RB 2JP1A 1NMGA 1F6TA 3HD2A 3HHEA 1N32L 1FCAA 1JOOA 3VR6A 4GN4B 2FLOA 4A3FB 5GVQA 1RADB 4NYPA 4PUOB 5LL6X 4K5XA 2XO7A 1LWEA 1KQSR 1IKWA 3M8ZA 2VPZB 5EX3A 3S8SA 2DY1A 4DI6A 1X3GA 3BREA 3HHLC 1M1GA 4QR0A 2J8AA 2Y3YA 3MC0B 4O42A 1HQUB 3PX4A 2EC2A 1HARA 2R92G 1CC8A 4PG7A 2CFMA 4HR2A 2CQPA 4HSVA 2J0XA 2HHHQ 2IMWP 3S01A 3S1NH 1GTHA 4KN4C 3VAKA 1SXTA 4XPEA 1TWAH 4NRUA 3ENQA 4PWUA 2K5VA 4KGXB 4O3RA 4QCLA 2JEAI 5ETKA 4RBTA 1JC7A 4NXMF 3UDEA 5KT6A 4ZYSA 3L7ZC 3J7AF 4CO2A 4UQGA 3T6BA 1U47A 4IRCA 3OL9A 1H74A 1DJ0A 3KJVA 3DOKA 4RUAA 3L09A 2BOPA 1O51A 3L7UA 4RNFA 2K5DA 4LREA 1PZID 1IBLJ 1WWHA 1P9QC 2MHVA 4HEA9 1SFOH 1SKSA 3CD6A 5HBMA 2VHGA 2K14A 1S6QB 4ED2A 3W1GA 1KHWA 1TVXA 2FVPA 4U68A 2MQMA 3TP2A 3FRZA 4D3HA 4YY3F 3PO2G 4DAYA 1DOMA 3GQBA 5A0YA 3T9NA 1NTGA 1S1UB 1F2ZA 4DV7L 4LIRA 3O1LA 1HR0F 5HY6A 4A3DH 2ZXPA 3PV0A 3DWAA 2UUCQ 1G6ZA 1B1ZA 3PO3B 4MAKA 4GC7A 4DV2Q 2WVFA 3KHLA 2E8GA 1L0WA 5M3MH 2FFKB 1PH6A 1B44D 3MECB 4OIXA 5KFIA 4PG4A 4RU9A 3I5BA 2VB6A 3RAXA 2FVSA 2CPIA 2OEOA 3CMES 3SCIE 2IBKA 1NUCA 2XSCA 3MFYA 5D4OA 5KFZA 3QWUA 4QY7A 2Y1RI 3OTCA 5LXRA 2EY5A 2WKDA 3OV7A 4G1PA 1M5PC 4PMCA 4F2SA 4R8UB 3MUTP 2I07B 2OMLA 2EK6A 5KFNA 2KXNB 1WNEA 2MKCA 4C3HG 2OSQA 2OXPA 4XIGS 4HIOA 5DETA 1NSNS 1GFWB 3HFKA 2ZBQA 4ZVPB 2HVEA 5HMYA 1S4FA 1KONA 5FLMG 1CJKA 3TOQA 1XMQQ 1KDNA 3GTLH 1W26A 2WCXA 1Q7YT 4EZ9A 5IWAL 1ROFA 1KXLA 3CJ2A 4ZP6A 3M8PB 4X4OA 5IQQA 2OT2A 3D1OA 2RS8A 2B63G 1STYA 2K32A 3EGZA 1CJUA 3TNVA 3UD5A 2QLWA 2R7UA 3FVYA 4QIEA 3UN5A 4XQQA 1PTOH 4E2FB 4CT8A 2NXNA 1YHQA 1B64A 5LL6S 3R6GB 3AYHB 3ND8A 1I50H 2NB0A 2F8MA 1VFJA 3RB6A 1X31C 1HTLD 1JLBA 3TS0A 4FNIA 1RWVB 3RN5A 3AB4B 2ZH4A 1N36L 2K03A 2BM0A 1ZM3A 2OPSA 5KT2A 5D15A 4LRFA 1CVJA 1IKXA 4CQ1A 4B3RQ 1PO6A 1Q86C 4CNYA 2BQUA 5B7WA 1F77A 2M9KA 3DDKA 3HP6A 3TX0A 4DFAA 3ULHA 4KLKA 4M95A 3QOLA 4CO3A 4IQXA 3NELA 5L1LA 4RX6A 1Q81C 3DOLB 4APVA 1SQGA 2Q2UA 2FVQA 1VQ6A 3BPDA 3M2UA 1S7HA 5GADC 2MLZA 4IALA 2UXCJ 3P96A 3M2UB 5FLXE 1PILA 3N79A 4OYBA 2NUHA 1L1OC 3CC7S 4ERDA 3TP8A 3UD4P 1UEBA 4NLPA 1PRTF 1X4BA 4ZPWR 3PJ9A 2DXEA 3TAPA 3OUYA 4BWJA 4FPRA 2UXCL 2KKHA 3R3OA 1RKJA 1VQ5A 1TL7A 3I4NH 3WHIA 3C2PA 4PWWA 3CMAA 2VUMB 1XXGA 1YJ9S 1NM2A 2B4OA 1MMDA 1SUQB 1M90T 4DR4F 4M5DB 3GSDA 1H9SA 2V4QA 5D77A 2KRRA 1HKAA 3KLIB 2AZ3A 2NQPA 1MN7A 4MIBA 2R7RA 3D54A 2KB2A 3EJIA 1UFLA 3GTKB 1T9XA 1S1VA 2MGSA 3QWPA 4JV0A 4IJHA 1NJWA 1TIID 2BQRA 2XZWA 3DXJC 2RDDA 1X4FA 4OIJA 1Q82C 4NCBA 2FY1A 1UVIA 1S1TA 2QO3A 2ZJPQ 1CQNA 2GC8A 3NBPA 3UDFA 3BS9A 3DLKB 2NXCA 2X6GA 4ZS6A 2KZMA 4UOCA 2RQKA 1SNCA 3F2CA 4PZ6A 3GFZA 1UZHA 4U67Q 1IVZA 3V05A 4KK7A 4ES2A 1TS4A 3MCMA 1FDBA 4DV4J 2IIHA 4DUYQ 1KTQA 1C1BA 4V0BA 4WIIA 5A0YB 3DHQA 5GAGC 2N82B 3G2XA 1YI2A 4NLOA 4WFN3 2UVWA 5ELCA 3ISND 3H20A 1RT5A 3UQSA 2HBZB 2G0IA 4O3QA 5HL7Q 4DX5A 4JI7J 1WJ9A 5JPMC 3IKJA 1TWGB 4KGVB 1LW0B 3R2IA 5M5XH 3PUXA 4X62J 4Y28C 1TKDA 2GMHA 2FY8A 2DGYA 4BC7A 4A8MP 2PC6A 5CORA 1LLRD 4C8MA 1K73C 4KHRA 1M5OC 3C15B 4NYZA 1RT3B 1KN6A 3IFDA 3V81B 3MR2A 2QF7A 4P72A 1FRXA 5EPKA 4TLQA 2G9OA 1SQEA 2NPIA 5EHHA 4C3MA 2CQ0A 1ICEB 1OXXK 3OOCA 2DY7A 5JEAH 3FJ2A 2FJAB 2JYOA 2XIWA 2HQCA 3ZZZA 1EY5A 3I6PA 1KAWA 3RB4A 4GOPC 1B70B 1MMNA 1KD1T 1Q90A 2NSCA 1FJEB 1BO0A 3NSWA 1QVFR 1TS3A 5HVFA 2LSSA 2A6HD 1VQ9S 4URGA 3UDGA 4BS9A 1N4LA 5E0OA 1FJ7A 2MQLA 4FXDA 3VVTA 5IP9G 1SRUA 1WACA 2MFIA 1FRIA 4AH6A 2B4PA 2NN6G 1U26A 4ENOA 2W2OP 4MK9A 3S16B 1D9FA 3NGSA 1FWKA 2DKOB 3CCLS 2XS7A 3IG1B 1WHYA 2FDNA 4CM2A 2JC0A 5T7LB 3W3SA 2CDRB 2OH2A 5FLMH 3PO5A 3PUWA 1RAIB 1EWIA 4DUZJ 4RHRA 4DV2L 4P2CB 3M8RA 2W7PA 2GCFA 2AYGA 3I7FA 3A8KA 3R5BA 1XQIA 2EY6A 1KNZA 3CDWA 2I6WA 4A3GG 2WB4A 3W64A 4GS3A 3N6LA 3CCTA 2MGZB 2Q2IA 2JFDA 4KPYA 1N56A 3POTA 1OXUA 2BABA 3V6JA 2X1BA 2RBMA 2CG8A 1M4VA 5C2GA 2JEJA 4A3FH 1NRKA 1S1XB 1ICFB 2QG9B 1I6HB 4K4VA 2W01A 4XXEA 4JI8J 2E5HA 4A3CG 2EJFC 2QLXA 2L08A 2N7CA 2E1RA 4FF1A 3TAMA 2UUAL 1R8HA 5EKIA 3NP5A 1HNIA 3I90A 4JI7L 2YTYA 1HNIB 5GAHU 1GTEA 4DV1J 5C44H 2VZ9A 2F4VF 5KOWA 4JYAQ 4DFPA 2Z2LA 3QAUA 2B8FA 2DR9A 4CGYB 3I91A 5KFYA 3K7UC 4IOCQ 4YFUA 4X65J 3SK5A 2NS1B 5DDQC 3DLHA 4X65L 1BY9A 3UPFA 1VQAA 2AQ3B 3E8OA 4DV3F 3SCLE 2AQ2B 2RH3A 3CC7A 2WVBA 1X0PA 4ZCLA 3NCPA 2NVXH 3TVZA 1CJTB 1PTOF 1LK7A 3DMJB 2C3OA 4ALPA 5T1IA 2HGLA 4F7VA 2XYGB 1VIXA 4MTNA 4FPIA 3FFIA 4IN3A 2QL7B 1S59A 3QR8A 2MZ1A 4ULLA 3TYTA 1PH5A 2IA0A 2RVJA 4DHVA 4B3RL 1SNQA 5T7LA 1FKPA 4Z37A 4F0MA 2JXMB 2HFZA 3I31A 3H15A 3LF0A 4FBTA 3M7NA 2VASA 2K8GA 4I7FB 1FVQA 2BJDA 5C4ZA 3WWVA 5CMDA 3SGIA 1Q7LB 4H4OA 4H7BA 1ZTTA 2UUCJ 1T03B 4OYPA 1VHIA 4P2FA 1EB0A 1RGVA 1O7ZA 3ELHA 2R7SA 2BKOA 2V4RA 1CQMA 1Y10A 2VIHA 4ZVEA 5TSSA 3G8TA 2JWNA 5D0EA 1HNWL 2DTJA 2JLEA 3M8QB 2AYBA 2FJEB 3O13A 3M4XA 3I4MG 4AT1B 2G9DA 2QDLA 4KH0B 2GGPB 1CSPA 4QIWB 4J91A 4UZBA 5DGAA 1BDOA 3I56S 1UMJA 5FKAC 1CKOA 2ZM6Q 2HQGA 1L3TA 5CYQB 1IBKF 3EDQB 4XPCA 3T56B 1H9MA 3TW0A 3J81E 1S9GA 4FYYB 4TQSA 1E24A 3SDEA 1MI2A 2R2UA 3RGIA 4JOIC 1FNXH 1BCPC 1FNUA 4NMXA 2FD2A 4H4MA 2JJ4D 2ZTEA 4F2RA 3VGSA 1SC6A 3KKFA 1RCXB 1UUPA 3NTHA 3K0JA 1F9EB 5H1SE 3UCUP 2E5IA 1H2UX 2OQ0A 4OMFG 4QL5A 1JNRB 1VJQA 4RO0A 1JICA 4JBCA 4TQRA 2LEPA 3BQ2A 5IGGA 2P9GA 4WJ3M 3W1BA 2CZ9A 1O8BA 4KHPL 4RW4B 3V96A 2BJ9A 5J2QA 1RTZA 2VQFJ 4ECTA 3ITHA 4K4XA 3GONA 4X3TA 1X5SA 3I3CA 1WTWA 3VR2A 2GNKA 4OZJA 3M4QA 2KFYA 2KG0A 4FO2A 3NS6A 1JKHA 5EPJA 1LNQA 3G86A 2CJYB 3M9NB 2L41A 3J81L 2CG4A 4ECXA 3LGJA 1SLJA 1LKZA 5DM6Q 1TL3B 1PAUB 2E9RX 1RUSA 2YKPA 1Y14B 1ESRA 4HIMA 4B9MA 2L3MA 5JEAG 1C4CA 3MEGA 2B8PA 2W9AA 3U9OA 2CJXB 4GNXC 1ML0D 3HVWA 1DTQB 4CLSA 3SZ2A 3S9WA 1JE4A 1U0HB 3CCEA 2ADCA 3AXKA 3AD8C 3GCWP 1RT6B 5F8GA 1SJFA 5KFMA 1WTOA 1C4AA 4UT4A 2UXCQ 2CRLA 5ETSA 2CNNB 1VQ4A 4DL6A 1Y1VG 3TWZA 3B4MA 4YB7A 4KY6A 3T5HA 2W7OA 4HT5A 3L0OA 5CYQA 2BM1A 2HHHJ 2GS8A 4EEYA 3S15B 1WKJA 1X4GA 4L73A 3HZGA 3JAML 1Q8KA 3MMJA 4CLKA 1N34J 3NGTA 3KHHA 4O2DA 4A3EH 2BW7A 3OTEA 3QJPA 2WFWA 4L3KA 4RNHA 5GQOA 3FEXB 1X4DA 3KTQA 4MMOA 2HNZA 4XDDA 3C6UA 1CC7A 1IL8A 3V4IB 1NK6A 3OL8A 4O23A 4WFBQ 2E1PA 1T05B 2A68C 4C2MB 2VF3A 1DTTB 4DR7Q 2AKWB 1UFWA 1BBUA 3H98A 4A8KA 2CW0C 3QJLA 5IYBH 1CM9A 1WOCA 3RAQA 2V0NA 2VNUD 1F2YA 2ROGA 3QO9B 4PZVA 1X5PA 2IHR1 5DGBA 4A3IB 4AYBG 5I3UA 3FEYB 4DR5J 1VBZA 3MPYA 2MHEA 1A6XA 2DR5A 2VPXB 2BKNA 3G8SA 3UE1A 2UUAF 3AOCA 4HKQA 4ZIWA 4PKDB 1R0AB 5JMNA 4BWGB 4O3SA 2JA8H 1RHKB 2CH4A 5HGTA 1KEKA 4XYOA 4A3DG 4ZLJA 2BJ1A 5ETOA 3NENA 2Y0SG 2HPUA 4ID5A 3OLBA 4N7TA 1VR6A 2QFIA 3Q2SC 3N52A 4F4AA 1G1XA 1V9OA 4DV4Q 1VRTA 3VYRA 3Q89A 5G3LD 1U1OA 3PKYA 4A3BG 1GMVA 4X4RA 4DR1F 4X64J 1SMYC 1ULRA 2Z2MA 1DARA 5A6WA 2JNJA 2IHEA 4DXFA 2ZWPA 4CH0S 1ICWA 3IBWA 4RKBA 2DGTA 3KLVA 2ZHOA 2DNQA 4YOEA 1WELA 4Y0FA 4U95A 5I2YA 2ILZA 3D9BA 5CZVA 3J81j 5BN5A 1X54A 3EZUA 3KF6A 3KLHB 4RZRA 1UCNA 2Q79A 1N5YA 4URQU 3LUYA 3NNCA 1G4CA 2ZEJA 1KBRA 4OONA 3ZTPA 1FWLA 2QTWA 1SE3A 5J22A 2U1AA 4H13C 1TUGB 3EMTA 3IR7B 3VA7A 2B0GA 4X2BA 2DCUB 1LFWA 3KG0A 2VG7B 4P9SA 4JVZA 3Q8VA 5ELBA 3MM9B 2P2CB 3KJFB 2WONA 4H4KA 1I94J 2KOLA 2KCCA 2F0HA 2YNIA 1KDCA 5I3UB 4CHTB 1AE3A 4B9SA 1T94A 5K5MA 4G1QB 3U4VA 3U58A 2YNGB 2Y1IA 3D3CJ 3QMQA 3E0JA 2C2RA 1UKUA 2F0PA 2K1RA 3KDFB 2YKMA 3MR6A 1PVOA 4YEAA 2WOMB 2AW0A 2OTJS 3QZ8A 3KLSX 1M0SA 4RBUA 2QA4S 2HFVA 2CNKB 3AOBA 2FMMA 1D9AA 3MUMP 3LAKA 4UY8C 1FDDA 3D7SB 3GTJH 3THVA 1RT6A 1JB3A 1DGSA 3DEOA 3KK1A 2L15A 4ZP9A 1P8LA 2VA3A 2GIFA 1J2VA 3TQYA 1VYAA 4ECQA 2Q43A 4KHZA 3KHRA 5I42B 4IPDA 2ZJPA 2CPEA 1Q7YC 3CCSS 2QFJA 4H54A 2Y9HA 1AA1B 4YR2A 1NKEA 3CGIA 3KUHA 2AT1B 2FZKB 5ELNA 1DZ5A 2DNNA 4Y7NB 3CCWA 3PW4A 2XSFA 1UW4A 5D3IB 5BJRA 1QJHA 1ZPWX 1C7YA 2FXQA 1F5BA 3VR4A 1N33Q 2LMIA 4E0DA 4EZ6A 3CC2S 2Z1CA 4BBRG 3EM1A 2CQGA 3QT6A 2YPZA 2PCFB 1JIHA 3OBIA 1LWCB 4JI1F 2KEDA 1ZYRD 3J80Y 4ILWA 2CPZA 4F88A 4Q5VA 2XMTA 1FJGQ 3IRXA 3KYHC 4QOTA 3KK2A 3BS1A 2M00A 3RBDA 3ILIA 1DOLA 2C42A 2VB2X 3SK4A 4DUZF 5C4JB 5C44B 1S48A 2KN4A 1LACA 4O1NA 2GN5A 1NDPA 2WK4A 1QUPA 2W4PA 1Q4RA 1Y7PA 3FSXA 1VRUA 3OXLA 2E1MC 2YKOA 5C24A 3Q8UA 3UE2A 2H5EA 3LWUA 1HNWQ 3PYFA 4LR7A 3I0SB 5DQGA 1CSJA 4B3MF 1RTHA 3OTDA 1FXLA 2KBNA 1YK9A 1U25A 3B78A 1WG5A 1TWCB 3QSIA 1SKRA 5KG0A 2O67A 4ZLLA 4WFZA 3PHEA 2H4OA 4JI8F 2RF2A 4O4RA 3VA5A 3VYSA 1PMRA 4PV1C 2PQAB 1ZA1B 1FNVA 3CJ4A 4YB5A 2RUSA 3CD5A 5CXTA 4ZPTR 3RR8A 2EVZA 5JVGQ 4C3JG 4DU8A 3C14A 4OO1H 1LV5A 3FBEA 2M7SA 4CLUA 1TL1B 2B2YC 2KM8B 4HR7B 3J7AN 3FCWA 2VBYA 2PI2A 4GKJQ 4DUYL 3SBMA 5GROA 1Z2ZA 1VQ8A 3JAMU 4J8QA 4YDDB 3PYEA 1PXUA 1Q1BA 1SXLA 2A1AA 1RI7A 2KT5A 2HGNA 3A5ZB 1TWHH 1I5OB 2CKZB 3GFHA 4EK2A 1RAFB 4ICLA 4G6VB 4LF5J 1EOTA 3OTOJ 2N7YA 1U4LA 4GKKJ 2UXBL 2K5WA 3F41A 5GMKa 4N47A 2JA7G 3S1MB 2FTRA 4USMA 5I3QA 1GQEA 3MPDA 3CQZB 2BVZA 2AJ0A 3MEEA 2UUBL 4C4WA 4M5MA 4RMFA 2Y1JA 2NN6H 2AJ2A 4C0OC 3M8SA 3QB3A 4WE1A 4GKKL 3MM8B 1HNXQ 4KY5A 3J81c 5B08A 2WB1D 2CH4W 2PNRC 4L3NA 2DGOA 1SPBP 1II3A 3V6HA 3KJPA 2WRMA 3M9OB 2RQXA 5CA5A 3H3VC 1VISA 2CUYA 3BVZA 2YNGA 3PFEA 4USUA 1QVCA 3DM2A 3NBHB 2HEKA 1FTCA 2HHSA 2IDEA 1HNWJ 1L5UA 2YNHB 2A18A 4KV8A 4MNOA 2BOSA 2H1EA 4L5TA 4K4SA 5EAYA 4DS5A 2Z6BA 4WK3A 1T03A 5LSOA 4XT3B 4HTHA 1I50B 4KV6A 2HFSA 5LSRA 3S2DH 1KC8C 3KLEB 5KEEA 1DTQA 1PC5A 3V2UC 1RISA 2C3MA 4BA2I 1X6OA 2OTJA 3QPIA 3X3NA 1UE1A 1IW7D 3CDUA 3H8YA 1PG5B 3UW1A 1HI8A 1RHUB 2JVRA 2ICEC 2XM3A 1RP5A 1NUEA 2WVCA 4I67A 2AQ4A 1C1CB 3EDRB 3P45B 2ZUGA 1EFWA 3LPEA 2Z30B 4WRDA 5IWAQ 4JK1C 2C1EB 5M2RA 2DNHA 3U1LA 3PIPA 3P4UB 5IM0B 4K0KF 3I56A 3R7BB 5JXSA 1N8RT 1TS2A 1H38A 2G0CA 2K06A 4O3OA 4G4KA 3V4MA 1AE2A 3KXDA 2ENBA 4TLRA 4QU6A 3FUYA 3CCZA 4R4CA 5LJ3Y 1FR3A 1PFNA 5IYBG 1VI7A 2OELA 4OZNA 1FO1A 1J9OA 3QRPA 3PV8A 2IPOB 3MTSA 2B51A 4WP3A 2ZC4A 1HPCA 1JX4A 1EYDA 2BACA 1XNQF 1CEZA 4USHA 2BDNA 3CWJA 1G291 3JAME 2QLBB 3OTBA 4LFAF 2VODA 1UVLA 1JMCA 2JJQA 1PV4A 4DV0J 1VCIA 1HNZF 4CO4A 4NEZA 4DF4A 2LQ5A 4B3TQ 3OHAA 4H0LC 3GPAA 4C3LA 1Q3LA 4I1TA 2GHWA 1O78A 5L9XA 2BE5D 3MFIA 4I56A 4I7ZC 5IWAJ 2V4JA 3CPWA 2E9ZA 3NWRA 4DK3C 4NXMQ 3DU6A 2BE2A 3HSDA 1HLWA 1TK8A 2FJVA 2VKRA 1S1WB 1L0YB 2BE9B 2KJWA 4ID8A 2HWIA 5F8IA 5ETVA 4FKYA 5KFEA 1VBXA 3CJTA 1JOKA 3HOXG 2J9DA 1P27B 1RWPB 2IVMA 4MTKA 1GKHA 4P2XA 3LNNA 4C3IH 2CJQA 3ZO7A 5GADU 3C1EA 1B4SA 2D9PA 3I72A 1SC3B 4LSNB 3S1TA 4PPDA 2ZBCA 3BGFA 1T5XD 2PMWA 2HHVA 3HOUG 3TI0A 2Y0BB 2A5HA 2ZE2B 1HQUA 3T5LA 1DFDA 2M52A 3MTJA 2YQ3A 3HOXH 2WKCA 4TYBA 5M5YB 4N8X1 1C0UB 5D0HA 4A3LG 4PQAA 3P1HA 5IT9L 4OZ2A 1KC8T 4BDPA 4YCWA 2Z4HA 1Z47A 3TZZA 1X3QA 5BR8Q 1EU4A 4OHZA 4DR5L 4A3MG 3DDIA 5C42A 4JI3J 3JTOA 5DEHA 2QYGA 2F0JA 4C3JH 5C42B 3MEHA 3PUZA 3CJSA 5AJ3F 5BN4A 3JSYA 5ETPA 1XJWB 3OFGA 1H2TZ 5LM7E 2YPYA 3B8HA 4RUCA 1NR2A 4NL5A 4C8OA 3NAIA 2ZBRA 1YVFA 1I4RA 2Z6KA 3D28A 5EBDA 3ULLA 2RVLA 3THPA 3OWEB 1O7IA 4KD3A 2B63H 5KFGA 3IXQA 2QEXS 2LVWA 3DOKB 4U9RA 1YNND 2ZZMA 3OD2A 1AB8A 2XNQA 5J2NB 1TL4A 2X69A 1HZCA 3BKFA 3R2DJ 1RODA 5J2NA 3I32A 2QDBA 1QB5D 3JAMc 1K8MA 3RTVA 4L76A 1VK8A 2YKNB 3PG9A 4CDEC 2XWYA 2KH9A 1PLFA 4HI1A 4USVA 3CCES 1HQEB 1KHIA 5KNDA 2EFPA 5CYMB 4BLGA 1S1UA 3J7YI 1IL2A 4K4WA 4M5LA 2F0VA 3OFFA 2EOTA 2MZSA 1S49A 2HURA 5AJ3L 3HKZB 1VIOA 4OHVA 4GKJL 4E98A 1IKYA 4A8XA 1HIYA 1GX5A 1ZKOA 3HEJA 1KLMB 2OP5A 4QR1A 1A3TA 2WVEA 4MN3A 5FJ8H 2CQDA 1K8GA 1AFJA 2B2WA 1F9SA 2HSEB 4C11A 1I4XA 1S9GB 2MQ8A 4A3EG 1X3PA 2C2ZB 2DEIA 2HHQA 4CKCA 5KG1A 2J6UA 3PUVA 1U0SA 3HOYG 1CJVB 2GVAA 1NDKA 3W2WB 1RT4A 4FN5A 4B9XA 2G9HD 5HROB 1UVJA 5AXMA 4DDFA 2C9OA 4EQ5A 5EGTA 5DZ6A 1SFOB 4OHXA 4RNOA 2MMYA 4MKYA 4ES1A 2F0SA 1HWIA 4HDHA 3JAMi 1HZAA 5KFJA 4LRAA 5E3CA 3OR2B 3J7Z5 4U96A 3R2CJ 1NPPA 1K47A 3E51A 3T1HL 1J5OB 4PXDA 3D6HB 3W9HA 1Y1WH 2EDGA 1UL3A 1R8CA 2VV5A 2IJFA 5K14A 2W9BA 1U45A 3HKSA 1ZA2B 1KQFB 3JTNA 4GVLA 4DL0C 1XMOL 5M3MB 4V19J 4ZPDA 3HVRA 1R89A 4A8SA 1DONA 1OYEA 4DCJB 1WTHA 2ERRA 1UFKA 2Z0SA 3ZTSA 2F0DA 3IA0A 1S9EA 2UUAQ 3DRXA 3GR1A 5FJ8G 2HZVA 2DO0A 4DKAC 4LFAL 5DDRC 3UDIA 1IXKA 2R7VA 1EOVA 2B8GA 5JEAJ 4WU2A 4JI6L 2FUG9 1X8DA 1NO8A 1C9OA 2BJEA 3BG3A 2W8LA 2XQCA 4OHJA 1NMEB 4A93B 5DG8A 5F9LA 3DM3A 5I42A 1Y8PB 4RW8B 2O3DA 1L1OB 2DH9A 5HANA 1VQBA 1HR0W 4JI2Q 4OYXA 2AQ1B 2LU2A 4WU3A 1LTID 1U4RA 2LQJA 2MLXA 1OY9A 2DNGA 1E3PA 4JI5F 4DMZA 2YY3A 2WV6D 1XMOF 2HIQA 3SDEB 5IT4A 2W7AA 4ZKAA 1NHVA 1HR0L 2ZXRA 2FVRA 2I5LX 4EO6A 4LNQA 1HNXL 4IR9A 1C2PA 3W2VB 3HT0A 4BY1B 1HNXF 2QN6B 4LRDA 3NOCA 4J37A 4X66L 4WTOB 2NTTA 1U2FA 2WBRA 4ME5A 4IOCA 4F87A 3LP0B 4X66F 1S4EA 1BCPF 1LTGD 2KVQE 1B0PA 1MJCA 2LA6A 3TO8A 2P9CA 1HHQA 4ED7A 4KJOA 1NCVA 1NK9A 1FRLA 3G6ES 5F0WA 4RW4A 3MEEB 4JI4L 3WX4A 2WONB 4C1NI 1A2TA 1B3TA 3VF0B 2J9CA 1IR1A 4B3MJ 3SIPB 4U673 1HNVA 4X6AH 1FE0A 3U50C 2FHJD 2PNHA 3BGRB 2GA4B 3NK9A 4BBRB 4KHPF 4QMGA 3NXWA 3DLKA 2OTLA 1ET6A 3W63A 4F25A 4TU7A 1H2VZ 1GX6A 4RWXA 2AV5A 2ZM6L 5J2PA 2R8GA 3MMAB 3RLFA 3K0XA 1XMQF 4KKSA 5KYIA 3VYTA 4N56A 3M1VB 4P6QA 2DXDA 2ZNYA 4LF8F 4YCVA 1EQTA 4GNXA 4CO5A 1WC5A 1U0HA 4KBIA 1IKYB 4PXCA 4DV6J 1SJ3P 1SKUB 2ASJA 2G2ZA 1EIFA 5CAAA 2F7VA 2P5VA 2DIVA 2HCCA 1YNXA 1DOKA 2RE1A 4KN7C 4IH7A 2A69D 2ZKUA 4A3FG 3OFEA 3TVKA 4YP3A 2CPJA 2L9DA 5BR8L 6FD1A 2PMZB 1NJXA 1NY4A 4IURA 3UDLA 3GP7A 1K3BC 2ZBIA 3ENAA 4WFXA 5M2PA 2B2UA 1WC6A 5DDPC 5C7PA 1X65A 4WP8A 2BUNA 5ETTA 5HJYA 3OTOF 5IGEA 5C4XB 3ICLA 2DNZA 1SNOA 3JQJA 2BEFA 2BRLA 4DPXA 5EJWA 4B3TL 5K5PA 2C5CA 2C2NA 1BQMB 4KKTA 3HRZC 2WAQD 4R25A 1I4PA 4B02A 3K8WA 3WDOA 1IBLQ 4WP9A 4KB7A 2FHJA 3HHNB 3OPOA 1XC9A 1S0VA 2QLFB 1UPPA 2R7OA 3OIQA 4QYZJ 3W8GA 3E0EA 3RZAA 4UY8T 4Q43A 5IYDH 2UUTA 1D8LA 4G7OC 1N88A 3FCVA 2ZKTA 2KM8C 1MWYA 1KP6A 4J9VA 4D3GA 4ZN3A 2VFTA 4ZPBA 1OSCA 3M7VA 1BXTA 4RLEA 2RCFA 1RDRA 2ZJQQ 3M2RA 4UW2A 2Y0SE 1RWNB 3UR3C 3OJSA 1MWZA 4NE9C 2I0XA 2GVZB 3J7YU 1RTIA 2IT1A 4K2LA 3Q83A 5HP1A 3B82A 4DV3L 1YJNA 1RTHB 3CJQA 2JVOA 5KAKA 1XPRA 2KENA 3O44A 1TWFH 1JXLA 4NASA 4Y65A 3DWQA 2GMJA 5KG7A 3S6EA 4G3IA 1DM0B 3NS5A 1IKWB 4OJHA 5FLXL 5KFQA 2M88A 1KQGB 2IWHA 3B6BA 2EVBA 4MIAA 5B0CA 1X55A 4JUZA 3CCMA 4TXSA 5DLFA 3BEGB 3DM1A 1CKMA 1I4HA 2Q2HA 2BCOA 3N6MA 3QFWA 1Q95G 2M9VA 2DGVA 2K7VA 4KGMA 1JWWA 3UI2A 5M3FG 1C0UA 2FHMA 3OUYB 4DAPA 1S6UA 1DAXA 1RIPA 3MR7A 1S9FA 3PO4A 2UXDQ 1TKTB 4IPHA 4Y6IA 4AE5A 4J1MA 5C3EG 2RB7A 2N3SA 1G7CB 3OHBA 3IRXB 1GMWA 1K0TA 5HJXA 4I0WA 3KOJA 3KLGB 1P8GA 2HDLA 4C56C 3PIPQ 1HFEL 1WF1A 3A7AB 2UU9Q 5E3QA 3D4RA 5JVH3 1RLDA 1LTAD 1LWXA 4N9TA 3HOWH 5EUHA 3HFVA 1VMCA 2DHAA 3SCKE 1ZH5A 3WIUA 3FBCA 2B4VA 2AGQA 3S14B 5A8KA 2DCLA 5GMDA 3I0RB 4A3KG 2W24A 3J81U 4LF9L 2OQKA 4WXWA 2IM0A 1HMVA 3NP8A 4B9WA 4QIWE 1JOQA 4JOUA 2F3WA 3HHLA 3PXGa 2LXKA 2O4XA 2OPPB 1LT6D 2IFXA 4RWSC 2KHDA 5BR8F 1VQMA 3Q8QB 4DV0Q 2YWWA 1N9WA 1IZ6A 2AIRB 1DLOB 4N9PA 4O4GB 3R5CA 3GFXA 5IY0A 1VQKS 2GGPA 3BYRA 2HIXA 1EYAA 4RGOS 5T41A 1UZDA 5IYCH 3TJAA 3DOLA 1HPZA 4X3UA 4WBFA 3P7JA 4YCUA 3W61A 2O1PA 4EQNA 3ENWA 2YYZA 1OSDA 1KOOA 2XMWA 1A3VA 2PI4A 4P7TA 5D8HB 3EN2A 2HFNA 1JJ2A 2OGUA 3MMBB 2C3PA 2JEBI 2PZTA 1AH9A 3T3FA 3GQCA 2W1BA 2V34A 1TWCH 3ZZ0A 1RHPA 5J1NA 3K5PA 4U8YA 4EO8A 4OO1G 5J1EA 4QQBX 4LQ3A 4XTCS 2MZTA 2VG5A 1X3EA 5KFKA 1QZHA 1Y1VB 2OHDA 2ZH3A 1YNNC 3H3VH 4KR0B 3C66A 4TRDA 3MAAB 4AXIA 1FFWB 4MK7A 5JJLA 3TZWA 2LECA 3CCMS 4N41A 4C8ZA 3SE0A 3LPYA 2JE6I 2VG7A 5ETMA 4MHEA 4KGKA 1R9TH 1PH1A 2PN6A 2SXLA 3I4PA 1JLAA 5A2QE 1SN8A 2QJ3A 1B3QA 4ZJLA 1HWUA 1STEA 3VR1A 2ZOMA 1BQNB 1Z4UA 2EXDA 2PI2E 5CBAE 1ZM2A 3ITHB 2XNAC 3SDZA 4X4UA 4DUYF 2XNRA 2FC8A 1BCPB 1L3VA 3NG8A 5LSLA 1SBRA 2YNHA 4KV8B 2JA5H 2F0EA 2B5JB 4JI0J 1D8ZA 2K01A 3PO2H 5FD1A 4AL6A 1CPZA 4I4BA 2DGXA 4IG0B 4I7FA 4HH0A 3QT8A 5A6PA 3I8ZA 4QZVB 4HYKA 3PJXA 4J9PA 3DNCA 4ID5B 4DX7A 5DAUA 1FRKA 2HWHA 3KUPA 1NSQA 2OLWA 3M3YB 1ZEQX 5EWEA 1MLAA 4I68A 2JSXA 4WWSA 2CAJA 1WTQA 2A74C 4JI7Q 1LWEB 2OAUA 3FMCA 1IWGA 1X3FA 3CF5A 1JB0C 4RGMA 4FF4A 3M4PA 3KBXA 5A2QL 1VQGA 2HS3A 4RAUC 4K14A 1WOOA 1P1TA 1Y69U 3K59A 4B3SF 3PDNA 4DR4J 5F8HA 3BDCA 3HS0C 1H0HB 1X0FA 3FKBA 4A3JH 1WCMB 3JSMB 1EZ8A 2R7TA 3KYLA 5E4WC 4R8UA 4NW2A 3OT9A 1V9PA 3S1MH 1E6VB 1U4MA 2F3IA 5LMUJ 2JA7B 1NDCA 3HKWA 2AU0A 1EY7A 2E1CA 2RCNA 3H4DA 2KYXA 4DV6L 4C97A 2I5MX 1W2BA 1OO0B 2MUYA 2JSOA 2UXBF 2DNYA 3MEDB 3EIVA 1NLKL 4IO1A 4OX7A 3GTGB 2WHOA 4C2MA 3MD3A 3HOVH 1F5AA 3FKIH 4KGZB 3M8PA 2XGPA 3TUPA 1D5ZC 2O5IC 1CULB 5JAVA 2DJFC 3JYTA 3DGPB 1AFIA 4DV3Q 3Q8YA 4NXMJ 3HJVA 3TDQA 1SJ1A 2ZBPA 1SMXA 4F02A 4IPGA 3QOJA 1TQLA 3BGRA 4ZVRB 3R5AA 3KG4A 1L3SA 5JJIA 1J5EQ 2ZTCA 4F67A 1RACB 3MOJB 1SE4A 3IWXA 5CV8A 3RN2A 1YGYA 5DLQE 4LIWA 4JV5L 3CCRS 5ETLA 3D6TB 3QO2A 3GG0A 4CNZA 1YTYA 1S3OA 2YH0A 4GOPB 2DNKA 1TKXA 1EAYC 4YY3J 1BE4A 2A6HC 2GAHC 3UCGA 4GRSA 1FRMA 4M1UB 4J9QA 4DUTA 2CADA 4DX8H 3MM5B 3BVMA 2Z8LA 3CSKA 5BXIA 1QM9A 4KFBB 1FT8A 1V43A 2NXEA 4DN0A 2QIFA 1SJED 1UWBA 1Y5IB 3CC2A 2BQ3A 3M30A 3QIPA 3I4NB 1EY9A 5ELEA 4DV1Q 3TZXA 2CA9A 2CVEA 4WKRA 5KFOA 1RZMA 2B43A 5KTQA 4A3IH 2BDPA 3GB0A 2ZNZA 2NPFA 4V1Ak 5ITHA 1OWXA 4F3QA 3BO2A 2HQ3A 4DX6A 1EIYB 1VQ6S 4Q0BA 1K9MC 1K0SA 1FDNA 4I6WA 1K8AC 3A54A 3CE8A 1IYVA 1UNSA 1PZJD 3MM9A 4DR7J 4GO5X 4R1JA 4BBYA 4DV5L 4KHPJ 2IVFB 4ELVA 4LRBA 4DV5J 3KJVB 5IV3A 4J90A 4J9LA 2MQNA 4B9LA 5L46A 1BBXC 2OEKA 3H7HB 2QMXA 3QJYA 2HBYB 1HNVB 2Q6BA 2DNLA 2IAJB 2QEXA 1KL9A 2DO4A 4LF5L 1KRSA 3IO1A 5C24B 2F4VQ 1ZAVA 1O7YA 4HJ9A 3GE9A 4O44B 2QRRA 3U27A 5A8KB 3IL8A 2JA6G 4FXVA 4CYUB 4WTYA 1KWMA 2CJAA 3A12A 1CTMA 5C25B 2HKEA 1FNOA 2XY6A 1WC3A 5CZXA 4LF4J 4NI2A 2B6AB 2HK3A 4ECWA 1WEXA 1IBML 3J81Y 1XR6A 3T1HQ 1C48A 1SNPA 2R7ZH 3CEDA 5D3DA 3S17B 5FLXc 3CCJA 4RPFA 4DV1F 3EE3A 1XIQA 2CQ4A 3CCUA 3R5GA 4CWBA 3KHGA 1HQRD 1PKUA 1PYTA 4H44C 2BV3A 2ZD1B 3MTKA 4X65F 4A3GB 3OMGA 2OI2A 4DL2A 3DLEB 2NN6I 1QAXA 2YBVA 1T3OA 3IFEA 2YX1A 3UCZP 2DD8S 4DL4A 3NWSA 4N8FA 2SEBD 1DBDA 2R8IA 4KKOB 2MKYA 4F4XA 3E5SA 1TR5A 1NNDA 3DRRB 1RBAA 4OX8A 3EVOA 1SIZA 2VUMH 3UNYA 1SJHD 2DIUA 1YJNS 1JXEA 3E9HA 5IFMA 2FINB 3EGWB 4DG1A 1LYLA 3DUZA 2VG5B 3V4IA 3CMEA 3BGLA 3QWNA 2E76C 3NAHA 4CLPA 2J0SD 4PEOA 1HTPA 1T9UA 2N3OA 2IJRA 2LA4A 4AFFA 4JOIA 4FP9A 2R2SA 4J9NA 2GQ2A 4Y2CA 9ATCB 3HD1A 3QATA 1PH4A 2VJVA 3ZZOA 2UUCF 1B7YB 5J3BA 4LMQD 1HHVA 1JLEB 3P75A 1PYOB 3R9LA 5L1JA 1HR0Q 1TZ0A 3PEJA 2DRAA 1JLEA 1JK9B 4ZPVR 1QTNB 2E7XA 2Z4IA 4DV0L 3T1HJ 1IJFB 2F0WA 3SQGB 2ICIA 4NZ6A 1R3NA 3GV8B 2JLFA 1BCPD 4K5RA 5DNFA 1VDZA 5DO2A 2HK2A 4Y7NH 2OPSB 3GWCA 5CHCB 4IUVA 4ZLTF 3KLFA 3S1NB 3PCOB 2W2MP 3KLFB 1GJXA 3L4BC 3E9IA 2PQAA 4K8IA 2B2WC 2PT0A 3TAQA 3J80L 2VOPA 1I6HH 4HSPA 1SJ4P 5E5NA 3GTJB 1M90C 5BYSA 4TN2A 3T51B 2WINB 3H42A 2MDAA 3MOZA 1WHWA 4ED6A 2JEIA 3M8QA 1VBYA 4A3CH 1YJRA 4DV4F 1Q86T 2FZGB 4LF7J 2EYMA 5K20B 1UEAB 1D2BA 2GQQA 2ZH6A 3SHLA 1WOSA 5BN3A 1Y5NB 2AJ4A 2N3LA 4OLOA 3KK3A 1PBAA 3UDXA 2IX0A 2F0TA 3QG1A 4URSA 4QJFA 2KU7A 2L12A 2EI5A 1JWUD 4ZVHA 1T05A 4YR3A 4A3BH 2J5AA 1H72C 1VQ4S 2TMPA 4OWXB 1BLUA 2HHTA 3K89A 3NGKA 3EJMA 1NSPA 1PIEA 4JI3Q 1PJ7A 4WORA 1Y1WB 2ROEA 3TEGA 4DR3Q 4BXXH 1B0TA 1PRTB 3ETMA 2K6AA 2YU9H 1KIXA 3HULA 3C19A 4P74A 1F0XA 4ZHRA 4OYIA 4NCAA 4G7ZC 4RG1A 2ASYA 1SBBB 4W92B 4ECYA 4RW6B 4R5PA 3OW2R 2VA2A 2F8EX 1QCBD 2CKWA 2MZJA 3M2RB 1BC6A 4RW6A 1R43A 2GHPA 3PFOA 1YZ6A 3I0RA 5T1GA 2BKPA 2WOMA 4W98A 3OTOL 1IXRA 3HKZG 4ZVGA 4DZDA 3LWMA 2R8KA 2XB2D 2O5JC 5HP1B 1HBMB 3HOVG 1DURA 3KNGA 3LALA 4OJGA 1O7LA 4U7CA 1LWFB 1HBMA 2F9DA 1EY8A 4K4YA 2A68D 4KIAA 5DDOC 3S1QB 3GV6A 5CV5A 2P6TA 2RU3A 4QF4A 2K04A 5LMUQ 1Q8LA 4OLPA 1B53A 2CVIA 3BYPA 3PACA 2U2FA 5KT5A 2C35B 1IBMQ 5IGDA 2MXYA 2YTVA 1L3UA 1HPZB 5J39A 2AEFA 4ED4A 3NMAA 1I6VC 4OYWA 1OMSA 4ECUA 1Z7TA 3LX0A 5GAGU 3OQ2A 3R3TA 1ENCA 3QGIA 4PQXA 2CHBD 2XO6A 3BSNA 1B4OA 3MPVA 2ATWA 3T1YJ 5F2DA 4EQPA 3M05A 1WTFA 4LSLA 5M3FB 4FF3A 4FYDA 3CKIB 3WIVA 3QJJA 1VQJA 4MKBA 4IFVA 2K50A 3RBEA 3MM7B 2F52A 1DJRD 3CAMA 4HHHA 4CT9A 4ZDNA 2UUAJ 4Q44A 3W1YC 4CLFA 1HBUA 1I6JA 2O66A 3KK2B 2F4VJ 2RQ4A 1RA7A 4JI4F 1EZ6A 4B9UA 2L9NA 4H4KC 1N34F 1G2TA 1N0VC 5IYCG 3W3AA 2JK8A 1JXVA 4Q45A 1FVIA 4O0AA 2AYEA 2DGSA 4RCNA 2VUMG 1PJ6A 1KDBA 3BZDB 4HJAA 1U6FA 4LT6A 4A3DB 3EGVA 1U6ZA 3IG1A 3V2TA 4IFDI 2CYYA 1YJWS 3DHWC 4NEYA 4NXNJ 1RK8A 1K8OA 3TP5A 4J6HA 4IG3A 1T7PA 2DHHA 3TZDA 2YXLA 3NBPB 2Y8WA 3IAYA 1JLQA 2IYGA 2XVSA 3C3LA 4Q8EA 1QILA 4K59A 4ZA1A 2VBWA 4F0HA 3TQ1A 1I4QA 1SAPA 1RU1A 4IDKB 4R4IA 5E41A 1HMVB 1D6EC 4DSIA 1PYWD 2J0WA 4N76A 1HWJA 4B3SJ 3PRBA 2QC3A 3PJWA 2DHSA 1NPRA 2Z2YB 3H4BA 3N28A 1Q12A 3QGPA 2MKJA 3ZZTA 5AXLA 1A9NB 5FIIA 4WXOA 1Q16B 1PH8A 1KVKA 1LOUA 4IUPA 4U6PA 3MM6A 4ZP7A 3G6XA 2OSRA 2F65A 1EEID 2B29A 1EX8A 3PW5A 2Z58B 1FKOA 3JAMY 1U1MA 1Q1EA 2ZTDA 1LXJA 1FJGL 4WJ4A 3PX0A 3B4DA 1R4PB 1YBUA 1U8SA 3HCXA 3K8VA 2NVTB 4X64F 4LAAA 1EQ0A 1SYGA 1PC4A 2IX1A 2BJ3A 1TKTA 3ZZUA 2PFDA 1IYJB 3S24A 1NEEA 2B3GA 5NUCA 2EWHA 1LFPA 2QGQA 1BGXT 1UE7A 2ZUAA 4YB1P 2WAQB 4GLAC 1FXDA 2HCIA 3D31A 2HHHL 4QJVA 2NSBA 3N0VA 4ZKCB 2LXUA 1TY2A 1WF2A 2VDHA 2E5LF 4G1QA 5LHY1 4S0MA 2OD6A 5IZHA 1X5OA 4WE1B 4PMBA 1QE1A 5D14A 4HT7A 3S7RA 5DG7A 1JQGA 1GXLA 2VQEF 2ZJRA 4K50A 5FJ4A 5KFBA 2R61A 1LUZA 2I8EA 3DYAA 1CI3M 5IP7G 1R0CB 3KMSA 5THWA 4QBUA 5HATA 3PM9A 3TA0A 3HX9A 2EQSA 2E44A 1YJTA 1WEYA 1F9QA 1N54B 1OO9B 4QWDA 4I64A 3EZOA 3D0FA 3LGHA 3BBFA 1ELOA 1SYCA 1FEHA 2ZITA 1H95A 4ZP8A 2RHQB 1OYDA 5E3RA 3G9CA 2J9DE 2IC3A 1E2WA 1XTCD 2K4KA 2JDJA 1AUSL 1Q81T 3UWTA 2B2YA 2MQHA 2ZH2A 2FHOB 1Y8OB 2VW9A 3AY0A 2B2TA 1IBMJ 2NYZD 2LDYA 3J7YW 3VWSA 1F3VA 5LMUL 4ED0A 1NMFA 2EJGC 3CXCA 2E74C 3S2HH 5DRKA 4E6IA 3DKDA 3MAHA 4X4VA 4RWWA 2LY7A 1PA6A 4H4MB 4DPWA 3ZC4A 4DR7F 4IFDG 4CTAA 1VQLA 3UN3A 4DV5F 4CTAB 1X7VA 1TT2A 3STBD 3CULA 5LMNW 1GAOA 2NYIA 4LW1A 3D6CA 2HW3A 3SK6A 1IR0A 3D8GA 3RG6A 5KRUA 1SUQA 1HBUB 1BOSA 3BV8A 4N77A 1NJYA 2L55A 4PRFA 5IC4B 3CVKA 2DNOA 4I6YA 1RTDB 1HBNA 3K2YA 5KFFA 1M8AA 4PZ7A 1RHRB 2LFVA 2M5YA 4AXJA 3GJQB 1CZGA 3N6RA 2M8HA 1HBOA 4DN9A 1JKHB 1YVCA 2FB0A 3H0PA 2DH7A 2DHGA 1OJ4A 1W2BR 1FHTA 1SKWA 5D6GA 3LOUA 5L8RC 3K7AH 2EYLA 3ZTRA 1DHMA 3H5SA 2RSOA 3VR5A 3CPFA 4DR5F 2EFVA 3STBC 2X1AA 2EYOA 2E2HH 1K1SA 4LQ9A 2E1AA 1HA1A 2HBQB 1FJGJ 5LMNJ 1DD2A 2H48B 3VVUA 3EFXD 1FK9A 2F4FA 1WKLA 2AWOA 4ODGA 1ENFA 2KFNA 1BUXA 3GIIA 3V6DA 1SNDA 2LCWA 2EBEA 3NUCA 3H0GB 3EPGA 2E2HB 4LF7Q 2NVXB 1U1RA 5EWFA 2D3ZA 4IJLA 3DLEA 3RR5A 1XJVA 2K5HA 3H0GH 1XK8A 2FLPA 4LF5F 3OW2A 1L1OA 5EKLA 1RJJA 2QE5A 1TV6B 4NA2A 2FLLA 4DR5Q 2R2RA 4PYDA 2BA9A 2R7DA 1TV6A 2DN8A 3W5YA 4DR1J 3I96A 3C15A 2CW0D 1XTZA 4JV5Q 3PIOA 3HI9A 1R4QB 4JI3L 1KS2A 4IFYA 3MFHA 1XNQQ 1KFDA 1RA6A 1RT4B 3VAFA 3HSGA 5KFDA 2HMIB 3F0NA 3Q8RB 3CIMA 5B0BA 1I3QB 3M32B 3FP9A 2PD1A 4BXXG 4LFBJ 1LV9A 4HN7A 4J9KA 2EJMA 2H5XA 4A3JG 3Q86A 2GIQA 4ZK9B 5T14A 2FQQB 4BY7B 3HK2A 1FGUA 5HLFB 3PO2B 1H9KA 2JRSA 3I4HX 2J7WA 1B2TA 3IWNC 2MKHA 2HHWA 2LXJA 4DWIA 5I6YA 5C3WA 1HI1A 2XEXA 2O5DA 2FC9A 3TA1A 2O2LD 4NLDA 4DR4Q 3CCVS 4HLBA 1SE2A 1FFSB 3EYZA 1MROA 1H6KX 3RAMA 3OL6A 1EFID 2UUBF 4OWTB 3PKMA 5SUHA 2COLA 3I5AA 1QE6A 4AQYQ 1SMYD 3HZEA 1I94F 4GKKF 3DLGA 1KTVA 2C2EA 1HQEA 4M5KA 2I9SA 3T13A 3MMAA 4DQIA 5AJ3Q 4HIKA 2WAQG 1MIUA 2W2NP 3VGUA 2O01C 4OWWB 3EVMA 1CS4B 4ANEA 4A93H 2K05A 4ZJQA 1CQVA 4ZKBB 4F26A 2VU5A 5I6WA 4ANDA 5J2MB 4DK6C 1IKXB 1WHVA 1F9FA 3BDLA 1VQ7A 1JLFA 4LF7F 2QW7A 3FMWA 2RQMA 1VLOA 4GKJJ 2OPRB 5E3PA 2J0TD 1C1CA 2ZD1A 1HNWF 2QSWA 4BBSG 2WIIB 1Y00A 4R0JA 1S1XA 3T1YL 2AEJA 1KLMA 1TL1A 4K2KA 3CDAA 2J7UA 3Q0AA 1S99A 3BDOA 4TY8A 1PBUA 2H1YA 3SFGA 1HQ2A 3BH6B 2L4NA 3M30B 1AZSB 2BE5C 3I82A 2DGWA 5IE8A 3H59A 3SR1A 2JC1A 2YNFB 1HZBA 1MU2A 5D78A 4LWCA 4Y00A 2GJIA 1V5VA 2XWXA 1JQYD 3R8BA 3MHYA 4EX5A 3RU0A 4OI6A 2Q8TA 4I2PA 3T16A 3CQZH 1Z1ZA 2CXEA 4WKYA 3RB3A 3T5KA 5EQ0A 3NCRA 1PH3A 2KXHA 3ILLA 2KT3A 4UOHA 2X3DA 1H73A 1IW7C 2D5DA 3PF5A 5ELFA 1TWHB 4J9RA 4DK1A 1RF2D 2YNIB 4PG5A 3N9UC 4AIMA 3DC2A 2NUUG 2A6EC 1G2SA 3Q24A 4IPCA 4OYZA 1V8QA 4X66Q 2K3KA 3F2BA 2VC1A 2ASDA 4F8RA 4EGVA 2FHKA 4X64Q 1LW2B 3GR0A 4M5NA 4WFNQ 5JJBA 4RGTA 5KOXA 3NBHA 2V4DA 4OHWA 2MY8A 2LXIA 3W5XA 2BE2B 1HQMC 5E1FA 4X4TA 4AL5A 1E22A 4P73A 2V4JB 1I5FA 1AW0A 3AA8A 1I51B 5KFUA 4LFAJ 4K8RA 4ZUJA 3US5A 5KT7A 3K5OA 1UEUA 1M5SA 2PI5A 1TQOA 4JI6J 1U6BA 5SZTA 4WK1A 3DXBA 1RD9D 1LABA 5H9FJ 3Q2TC 3EA6A 3GTKH 3M85A 1GUOA 4K4UA 3WOEA 3POTB 4QWBA 2QA4A 5DM63 2JZ5A 1EWCA 4PUOA 3T1YF 3NTKA 3MEKA 4JI3F 3G4SS 1PRTD 4DU9A 5IWAF 2YWGA 5LL6d 5HMZA 4IUFA 5KFWA 2QA1A 3TAMB 3PRVA 3AA9A 4JV5J 4OYOA 2B39A 3ND9A 1RU2A 2OPQB 2VC0A 2DRBA 3FKIG 1B50A 4DNRB 1RQ0A 1E2VA 2C22A 1UVMA 1P6TA 4LFCF 2VL1A 2E7WA 3WQPA 4RUBA 4DF7A 3ONQA 1JLGB 5J1EB 1LK5A 3MI7X 2XMKA 4IFDJ 3VR3A 3GU0A 1W7WA 1LTBD 1A0OB 4RUHA 1ACMB 2M3DA 4L8JA 3EVWA 5G0RB 3CJ0A 3MAAA 1S6PB 1UP1A 2H3EB 5HK4A 1PH2A 4IRDA 2D9OA 1J6QA 3N4WA 3KG1A 4I69A 3GV5B 1F2MA 5E3FA 3HVAA 4QIWD 1X9NA 1N33F 5B0GA 1CULA 3BSOA 1U1QA 2EXUA 1WFQA 5KG6A 1BQNA 4IOBA 1QY7A 4A3KH 1TAQA 3WBZA 1RYSA 3G82B 4JBWA 1IBLL 3PSIA 3H91A 1FFGB 2DGUA 3A4TA 4LMZA 1FKPB 4AYBD 2NXJA 4RW9A 1Q5VA 1S6QA 1TU2B 4YY3L 2HRUA 4K5SA 5J1ZA 3OL7A 1SYEA 1YZ7A 3TRZA 4X62Q 2BJ7A 2GO9A 4NKLA 2DR7A 5KFCA 1B7FA 3OJUA 4X4NA 3PR5B 1T11A 5C4XG 4USWA 1WC0A 4QW9A 2A19A 5ISRA 3V6DB 2M0GB 3MCOA 2NZHA 1R6VA 5IGFA 4JC0A 3MD1A 1GNKA 5D4NA 2ZT9C 1SV5B 2L11A 4KKUA 4N5SA 4JI2J 4FKXA 1E7ZA 3BO3A 4IZ8A 1FGBD 1B8AA 1FJCA 4OX9F 3CD6S 1K28A 4P10A 2MQQA 5K8OA 4NP5A 4OYMA 2PDAA 1MW7A 4M1KA 2BR0A 4DF8A 1K9MT 4IFYB 3T1YQ 3QIDA 3MMBA 2CWPA 2OO4A 5JVHQ 1U4PA 1YI2S 2OF1A 1GD7A 5KNCA 4ABNA 3N5BA 4P7VA 3G6VA 2AX0A 1ZBTA 3IGVA 3MR5A 3CJ8A 3C6UB 2PEHA 3HHLD 4Q2MA 1SL0A 4K0KJ 5G0RA 5HSPA 2D2CC 2ACMA 3J7ZT 1F9PA 3CNQP 2LQ9A 1WTBA 1Y11A 2NTSA 1Q8BA 2Y1LB 3OHXC 5HVGA 4RU2A 1NK0A 3VAGA 4WZMA 2AWNA 2JH3A 1C0TB 3LP2B 3K17A 1YKWA 2ATCB 4K4TA 1C0TA 3TMEA 2RUGA 3ILJA 4L6V3 2RHSB 5DM7Q 4OL8A 4M63A 1FVSA 2FLNA 4DS4A 4GC6A 2K1BA 3QGGA 1EQVA 3EVQA 1JLQB 3G7LA 1VLYA 4OZ3A 1XNRF 2W4CA 5HO4A 2FJ2A 4CJ2C 5CYMA 5K8MA 3ZTQA 2UP1A 3K5NA 4IG0A 1EYCA 4BBSH 3H5XA 2ES2A 2PMHA 1S72A 1FX4A 4RKLA 2VD3A 1F2GA 1IBMF 1TWAB 4UZCA 2ZOGA 3L3OC 4FS2A 2AX1A 4RNNA 2G2OA 4F04B 3I55A 3HOWG 1D09B 1GMUA 2RKSA 5EBCA 3RZOB 3A3NB 4LFCL 3FRYA 1AROP 4ELUA 2F0NA 1NCLA 1RAGB 2XRSD 5KG4A 4LVOP 3O8WA 2UU9F 2J7KA 3FBBA 2R9LA 1YDLA 3SXLA 2UXBQ 2R93G 5DS7A 2UXDL 1RAAB 1NJIT 2X6LA 4KI0A 3PW0A 4XT1B 1HYSB 1SC1B 4L74A 4YQWA 5AE1A 4GKKQ 4JI8Q 2OFHX 1X4HA 4C8KA 3T1AA 4GVBA 1UETA 4NLXA 3IAM9 4RA8A 1YJWA 3ONAB 1EKRA 2PZWA 2AD9A 2QGFB 4DXGA 2FPHX 4B3TF 2R7XA 2PA8D 1K8AT 5L1IA 4JI5J 4ILMA 2GZOA 2MKSA 2OEJA 4DQSA 2MO1A 1YIJA 4DPGA 2VFVA 2WAQE 1X9MA 3KUEA 3Q23A 1XMQJ 2YWHA 1RTDA 1H7XA 4DSLA 4Y2IA 4OZ5A 2AF6A 2F0GA 3DRSB 1NAPA 2QL9B 3A13A 2ZDOA 1E2ZA 2F3VA 3P8BB 1QSSA 4EVOA 1FJGF 2XY5A 4FBUA 4DCPB 4OZ1A 3DLGB 4NLYA 3K5MA 1KNAA 1PH9A 4DFMA 2LYVA 2RAQA 1H7WA 2XI3A 3QFHA 1GT8A 1YITA 4ZK7M 4HL9A 4DPUA 3GTOH 1EP4A 1ZZNA 2D0PA 3SFUA 4YHHF 2R8HA 3N6NA 4GNXB 3BBBA 2W2QP 4YY3Q 5FLXY 1NKBA 2N49A 3JSBA 2V8GA 2QX0A 1TKXB 1C0AA 1H3DA 3KLEA 3HHLB 3NL0A 4EBEA 1S0OA 5MAOA 2A1BA 1SIWB 1YRXA 2CWKA 4ECVA 2KTQA 2E2JH 1GM5A 1XERA 2IC3B 1PTOC 2A69C 2VH7A 3MPUB 3ZTOA 4O0NA 1NK8A 2VJUA 3MMCB 5BYQA 1NJIC 4BC9A 1MD2D 4TY9A 4J9UE 5FOBB 9RUBA 4MH8A 2AGPA 1W6KA 1BKBA 4LFBF 4TY8B 3BF4A 4HAEA 5F3TA 5ETQA 3D3RA 4IR1A 3KLWA 1IKVB 3DGVA 1WVLA 3CJKA 5AXNA 1FF2A 2XBPA 2JX2A 4XQNA 4RBVA 2UVVA 5FLXU 1TUVA 3HKZD 1ILQA 2B9EA 2NZCA 2AJ1A 3KWMA 2BBEA 1YRUA 1NK4A 3ZJYC 4LBHA 5IODA 1SH3A 4TU8A 2LS01 3W9IA 2WACA 5GMEA 4ITSA 3IMQJ 3VV2B 1EYGA 2UUBJ 2SOBA 2KCMA 4BY1H 2OKQA 3G87A 2R42A 3CDEA 5ELDA 1WTXA 2H4YB 2AGOA 2CQOA 2BYCA 4AL7A 2WTFA 5K36H 1RABB 3MM8A 1G6PA 1E0BA 5F8JA 1IBKQ 1U48A 3A7LA 3ENVA 2RDIA 3O3LA 4EU0A 3DM2B 1WDTA 5E7NA 4LF6J 4ZITA 2H5IB 4JI0L 1SNMA 2EY1A 2FVCA 2HLTA 2F0IA 1CBKA 1R0AA 3ISNC 1N32J 4NLQA 4I65A 4YHHL 4GKJF 2V50A 2YX7A 3VZHA 4BY7G 4ZMMA 3L7OA 1TTHB 4F50A 1CHQD 3LWEA 1V1PA 1YHAA 2NZOA 2VICA 1SC4B 1XNRL 1LM0A 3D2WA 1N36Q 4JYAJ 1R31A 1LT5D 4WFYA 1NXIA 4WF9Q 2EPBA 2G5DA 4CP5A 2OCEA 2N55A 2JA6B 3HT3A 5M9OA 2CIMA 1Q0NA 1MNEA 2KECA 4IUQA 1EU3A 4KTAA 1ASYA 1XR7A 3SI8A 2JA6H 2NUCA 3UNGC 2XMVA 2HWTA 2JN4A 2H4WB 3NWTA 1MKHA 1GUWA 4C0HA 5COYA 4C8LA 2EW9A 1J5EF 2NVTH 3M9BA 1E6VA 1Z9FA 1S5FD 2V8PA 3JSMA 4NX9A 1BXNA 4A4JA 4ZVOB 3VQSA 3T53B 4HCSA 1SH0A 3BU2A 1IJEB 3CD0A 1STGA 2XYHB 2IBOA 1ZAXA 5IGBA 1XMOJ 1TVRA 3RUZA 3CRLC 2L1BA 5HLFA 2MHNA 4DV6Q 2MJ8A 1B0VA 3CRKC 2EPIA 5HAOA 2DITA 2KYZA 1WD1A 3QO9A 1BVSA 3BKUA 2DNEA 2L9WA 4GZYC 1CK1A 4X66J 1XWLA 3G82A 2FYXA 3OSOA 2QEJC 2VONA 2E5LQ 3DN9A 4V19X 2GJFA 4MT1A 2UUCL 5HQLA 1RTIB 4DEZA 2Y0SD 3J7A1 7FDRA 3SCJE 3DRPA 4NXNQ 2VPWB 4H4OB 2ZJQA 2GW8A 2XN9C 3FVQA 2XYPB 3D0HE 4L6TB 3MAQA 3FDTA 5L39A 1FKAF 1ZYRC 3GTQH 4M5HA 4P2MA 3X3MA 4HEDA 3BYYB 2CZVC 2OFGX 4MKVA 1S77D 3T41A 4LF1A 2A2DA 4KJIA 2VY3A 2KRBA 1XWEA 3ET6A 4L5SA 1EETB 2CVRA 1WYDA 1RAOA 1U02A 3TSSA 3OW7A 4CJ0B 1KR4A 3X3UA 3W60A 1KQKA 4TSSA 1RTOA 4YIJA 2VQFQ 3U7JA 3MECA 2D0OA 2XZTB 1WOPA 3RB0A 1LW0A 3N01A 1CKNA 2PPBC 5L9NA 5HN0A 4KKOA 3BSCA 4ECSA 5C0XG 3HGBA 2ATLA 1RCVD 4MFBA 3L2PA 2QKIC 3H5UA 4K0KQ 3EBEA 2JQOA 4DUYJ 2WSCC 1ENAA 4HTIA 4L5QA 3HOZG 3I4LA 3FBFA 1ONLA 4XDCA 4MJKA 3K6OA 5IOCA 3GYXB 5HURA 3MGJA 4DR3J 3TRGA 1N5VA 1PYSB 4HTJA 3SSRA 1HCZA 4ZVUB 3DWPA 2WW4A 1BBWA 4PG6A 1UJ6A 1X60A 2DUDA 3M2VA 1REGX 2JOQA 3L95X 2HQLA 5KFRA 5J2QB 5K36G 1E6YB 3CJRA 3LP2A 2R92H 4FXGC 1VQPS 5EGYA 1E6YA 1VQ5S 2ROPA 4MTPA 2HNDB 1HL6A 4FXKC 2K75A 4NCGA 1GHKA 4GMKA 5C3XA 3HF5A 3OR1B 3CUNA 3A5UA 3LANA 3U02A 1UE6A 3MEGB 2HLUA 3R7SB 1S9EB 2DHXA 4M5IA 2L48A 4Y2MA 2DNRA 1VC5A 3MPWA 1S76D 2RS2A 3FZ2A 2ADBA 1QNKA 3DLLA 4DCOB 2CQHA 3A3OB 2ALZA 3CCQA 5J1PA 3HOWB 4KPCA 4X64L 2JFKA 1ZM4A 3ILOA 1RTJB 1F5CA 2QA2A 2HD3A 2QILA 1FRHA 1VGYA 4LK1C 2BANA 4JI0F 2MKKA 2UXBJ 1DQ9A 1HRJA 2MJNA 3D67A 5EWGA 4R4QA 3DMUA 1ZZFA 3R2TA 1WEZA 2ZHBA 1V6HA 2LXFA 2Z9HA 3GTPH 3S16H 3DRRA 1VS0A 4UAIA 2HIYA 1RE1B 4NZ0A 4B3RJ 4DGZA 2CQIA 2F40A 5DQHA 1RKNA 2IM1A 3GJSB 3BQ0A 2EFGA 3VGTA 1QWYA 4FNFA 4PZ8A 4ILRA 4KHVA 3MWBA 3UVJB 4B3MQ 1DTTA 1QVGA 4A3BB 4CO0A 4FF2A 5KGUA 1QD1A 3KLGA 2ZH8A 3BN7A 3FFIB 4F4KA 4ZUIA 2PEBA 2VFRA 2KHSA 1LT3D 2F03A 2F0LA 3AJDA 5K8NA 2MQPA 1EARA 5D0RA 2E2IH 4LFBL 3R6LB 1Y8NB 1O5JA 1PSDA 2G1HA 1MSWD 4Z7CA 3J81i 4AUKA 5C5LA 1N36J 4JI5L 3CCQS 2JEGA 1SROA 3HHKA 4UUWA 3KNAA 1C4QA 4O44A 1JLBB 4NLVA 1R8AA 5F9NA 1D1KA 1JJCB 4PQUA 2MSTA 4A3JB 3HJFA 3NHHA 3VAIA 1FX2A 3BSAA 3IC1A 4LVNP 5LMNQ 2R4FA 4DUZQ 4UDUC 2UVRA 5I9PA 2BXJA 2PA3A 4K7QA 3C6TB 2UU9J 1AZPA 1HUNA 4UY85 1RAEB 4ER8A 4RHSA 4QIVA 4KQZA 3BZKA 3HVTA 5H9FK 3GIJA 4DR6Q 1JJHA 1FI4A 1CQFA 2VOOA 1F60B 4J9OA 1VQEA 2ZVIA 4DOZA 1JWMD 1SQFA 4A3LH 1AW7A 1SDFA 3RBXA 3A74A 2Z8QA 3HOVB 5BR8J 2N8NA 1ITPA 1LXNA 2MEWA 3K0YA 1FYCA 1J8IA 3NOGA 1Q78A 1UAWA 1YQHA 3NEKA 2XLJA 3J7ZC 1WSVA 1U1KA 3NPPA 3H25A 4YWLA 4UHVA 4DSFA 2HUGA 2M2LA 2E29A 2HMIA 3CC4A 1PGZA 3H90A 2A8VA 3NNHA 1W6JA 3M6XA 1D0EA 3M6UA 5GADI 4DPOA 3AD7C 2KT2A 3OLAA 1NAQA 3TP6A 1VDHA 3VQTA 2Z2ZA 1BQQT 4HMJA 4NZ7A 4IYQA 1KRPA 3BZCA 1VHFA 2V6AA 3RW7A 1OXVA 1Q53A 3M4YA 4DQQA 3DRSA 3BZQA 2MY7A 1Z6HA 2VS1A 1AZQA 1YBAA 2HZCA 3GO5A 4OELB 2UXDF 2JHEA 1VMBA 3OVAA 1RJTA 4FZVA 4ZIVA 2GX8A 4WYWA 3AJ1A 3OWFA 2EEYA 1VS3A 3DOMB 4PAAA 4YHHJ 3T9ZA 2HGMA 3R1LA 1TMMA 1PFMA 3SEBA 2NVYB 4JBMA 4WJBA 2IM2A 3BKTA 3C46A 5AE2A 4L63B 3C16B 5MLCV 1VBKA 2RU9A 1W2IA 1N5TA 3OVSA 2CJ9A 5GAEI 1T02A 4ZN1A 2BA0A 3CF5Q 4AQYJ 4OFZA 3RLOA 4CH1A 1N34Q 5ADZA 1T8EA 1EETA 2WBMA 1NH7A 2G2YA 5A35A 2XGQA 4ED8A 1D3WA 5KFLA 1T9YA 2JA9A 1FXRA 4QWEA 3C14B 3CMQA 1RTJA 2NVYH 4A8OA 1JNZB 1VOMA 2E7VA 2DISA 5IQ6A 2XMAA 4X62L 1WI6A 5EDWA 1CKNB 1M5HA 1K44A 3SXHA 2OEMA 3KJNB 3M6VA<