3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
molecule keywords BipA
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
2BM1A 4ZCMA 2BV3A 1ZM9A 2IVYA 1ELOA 1KTVA 4MYUA 2YWEA 2ZITA 2L9NA 1ZM2A 1ZM3A 1P9QC 2YWFA 4ES2A 1VI7A 3ZZUA 3UI3A 2XEXA 1ZPWX 3ZZTA 2CVEA 4ES3A 4ES1A 3ZZ0A 1WDTA 2DY1A 2NPFA 1U2RA 1T95A 3EXCX 4QR0A 3B78A 3B82A 4TNOA 2YWGA 1ZM4A 2YWHA 1FNMA 2I8EA 4ZCKA 1N0UA 3LH2S 4ZCLA 2BM0A 5G4DA 4QR1A 2WBMA 4MAKA 3OQ2A 4FN5A 4MYTA 3B8HA 2EFGA 1DARA 4QR2A 3E3XA 2E1RA 2KDOA 2J7KA 4M1KA 4ZCIA 3CB4A 1N0VC 2I0XA
chains in the Genus database with same CATH superfamily
1FDAA 4LQ9A 4EU0A 1SJHD 1MWYA 2LXFA 3RBDA 4J7CA 1S59A 1NMGA 2J0XA 4PQAA 3J7YU 4I6YA 4M5GA 1HR0W 4QU7A 4FF4A 3RBZA 2HHXA 4LFBQ 2ZOMA 3CCQA 3UCGA 4O3RA 3AFQA 3PO3G 4NLYA 3SDZA 4TNOA 1RWXB 3KLHA 2R7ZH 2X1AA 1ENCA 1LWEA 4DR7J 1P8GA 2Y1LB 4OJ3A 3RYLA 3CC4S 1OWXA 4CO4A 1MSWD 1EL0A 4DPGA 5FLXU 3MEEA 4C56C 4HJ8A 3KOJA 4C0BA 1N36Q 4P52A 3M8RA 1FD7D 4A3BG 3J7YI 2JEJA 2DGWA 4ELUA 2D3ZA 2DNNA 3C1FA 1EY7A 5C3WA 4CM0A 1SE4A 4C8YA 3LWEA 4JYAL 1TKTA 1SJ3P 2HHUA 1DXMA 3RRKA 2VH7A 4DI6A 3HF5A 1X4GA 4J1MA 4Y3CA 3F0NA 1G6BA 1HZCA 1EKSA 4ZA1A 4KKOA 2KQ3A 4OHZA 3I0SB 1F9EB 4AYBD 3TARA 1EETB 2N55A 1IKLA 1EY0A 4PZVA 4FKXA 4RW4B 2B3GA 1FJGF 2Z4HA 4Y52H 1TWFB 3BYYB 1G1XA 3F56A 3ETOA 3HCXA 2Q2UA 4IO9A 3HG9A 5EHHA 1H9KA 3FPPA 2YKMB 4IFVB 1PZID 4PWDB 1S7IA 5T1IA 2DNPA 2CQOA 2B5JA 3W63A 3CCZA 3TUZC 2CNKB 5C3XA 3KFWX 2VFSA 2WKCA 4YY3J 2IYGA 2NCKL 2ZZMA 5J2NA 1LOUA 2XLJA 1SKRA 4RWWA 3LGJA 3SEOA 4JI3L 4BA2I 1SYFA 2MKCA 2CFXA 4X65J 4ZP8A 2RKSA 4K5VA 2VG5A 3CKIB 3MCOA 4A3IB 3R5AA 2HMIA 3UNYA 1JLQA 1U2CA 2PMHA 4HDGA 3MAAA 4IJHA 2OELA 4DV1L 2D0PA 5AJ3Q 4GNXA 1D9FA 2R7XA 4HCEA 3QRRA 1S1TB 1VQ6S 4XDDA 4B3TF 4HR2A 2J0TD 3T5LA 2VONA 2ZVIA 1FDNA 3D6HB 5KT4A 2F3IA 5C3EH 2CWXA 2MMYA 3SQGA 1ZZNA 1TL3B 3FQKA 3QJYA 4B9TA 2V4DA 3VAFA 4OLPA 2U1AA 1K44A 5CORA 2MQ8A 2MKHA 3BREA 3I4MH 2B4UA 3TJ9A 1H9SB 2DR8A 2MGSA 1SNDA 1HNVB 4DS4A 1FVSA 3IBWA 5HMYA 4B9NA 4WK3A 4JI1F 4ODGA 1D9DA 1HUMA 1NSQA 3BQ1A 5IGEA 1VISA 5HL7Q 5EKIA 2H4OA 1S9FA 2MLYA 3JQJA 4GKJF 2ID0A 1MWQA 1KHVA 4OJGA 4QIGA 5L46A 1GUTA 5KG2A 3RD4A 3IR6B 1KVIA 2RSNA 4XQNA 3CJRA 3PO4A 3A5ZB 1U1QA 4NXNL 2P6TA 5C24A 5I4MA 4NE9C 3V6HA 3FRPB 3GG0A 2V9WA 1BVSA 1IBKQ 5DM6Q 1K8MA 3I5AA 1S0VA 1F2LA 1FTRA 1UVMA 3MOJB 2C3UA 3E0EA 1LWCB 1RWMB 5AXMA 4CT8A 3SXHA 3ZTQA 4CJ1B 4M1KA 3TQ1A 2VPYB 5C4HA 5IYDH 2DGQA 2LQJA 2KJXA 1AE3A 1QAYA 4DR7L 1E22A 3A74A 3UWTA 2QA1A 2LEAA 1N33J 1R3NA 2K6AA 3W1YC 2VG7B 2XRSD 1JQYD 1QNKA 1VQOS 1IKYA 5FLXc 2Z6KA 4DR5J 1UEBA 2DIUA 4DR5Q 4IUVA 2VFRA 1YLXA 1VJWA 1TWFH 1G6PA 4KHRA 1REVB 3I72A 4P71A 5KFTA 1MMDA 2HURA 5J39A 5IV4A 2HS0A 3J80U 4F02A 3POTA 1YJ9A 2KA7A 3AQQA 3HOUB 2A68D 5DJBA 4BS2A 3QFHA 2E2IH 3SK8A 4ZP9A 4WXWA 1UFLA 4C8KA 4G7ZC 3BZDB 3EN2A 2W2PP 3TAPA 3ZZZA 5D0RA 5K14A 4DR2J 2R93H 2J0WA 3HS0C 3CC2A 4QIVA 4OX6A 4DNTB 3ULJA 2HIXA 3LW5C 1CHPD 5JEAH 2RQKA 3H7HB 1UEAB 3H0PA 4YHHF 2LXJA 2DHXA 4O3OA 3E2EA 1LFWA 2ZFHA 2MSSA 4AXIA 1M1KC 1XMQQ 4TRDA 5I3UB 5EGYA 4QMGA 1N6QB 3P6YC 4BBSG 4F36A 1JWMD 3MVVA 4USMA 5E41A 5ELBA 5IGGA 1RYRA 4IZ8A 1S1WB 2ZNYA 3CDAA 2RU9A 5K5MA 2GIQA 2EFVA 4J9UE 1WI5A 4Q0BB 4DNRB 4A3BB 1S9GB 3BS9A 2WV6D 2WAQB 4J9NA 1EQVA 4OONA 4I67A 1B9MA 3STBD 2QO3A 4JI1L 3H4BA 2ALYB 4LVNP 2N3OA 4QIEA 2W9CA 1TWGB 1BXNA 3KK2B 1BNZA 2UXCQ 1X4BA 5F8NA 2XTJP 2NYZD 3MMCB 4LSNB 3R8BA 2W9BA 4H0LC 1JB3A 1Q95G 2XMUA 1BOSA 4W92B 1G8ZD 3IR5B 2V63A 1N0UA 2K04A 1SR3A 4OYIA 5CH7B 3QIDA 2BDNA 1RTDA 4RR5A 2HIVA 3TAMA 2JA6B 2KKHA 3CCVS 3S1RH 3V6DB 1CVJA 2AHOB 4POFA 4AL6A 3FPUB 4ZKBB 3N6MA 1E1OA 3B4DA 4JI4F 2EK1A 3LPYA 1CJKB 2DY1A 2LA6A 2YU9B 4GC7A 1RQ0A 3CULA 3UE1A 4DAPA 5ETSA 1P6TA 2PN6A 5JJKA 3OFEA 4WP9A 2BXJA 3TA1A 4A8KA 2BBEA 3R5DA 2LS01 4X65L 3GTLH 1PYWD 2ZJPQ 3A5UA 3TBIB 1O7IA 4C8NA 3J7AF 3RLOA 1TL7B 2P9CA 3MM7A 2F52A 2F5GA 3ND8A 4C3KA 2XB2D 1WTOA 1UW4A 1PLFA 4JI3F 3QSYB 4M94A 2FMMA 3A3PB 1SQGA 1TVXA 4HH1A 4LF9J 4DU7A 5L8RC 3NCPA 3KDOA 4A3DB 2LMCB 2KHIA 5KFFA 1S1XB 4WZQA 4DV4F 1QJHA 2E2DC 2I0XA 3NEKA 3M7GA 5T14A 5MAOA 4XQQA 3QIAA 2K05A 1GHKA 1I94Q 3HKWA 4AT1B 2CVRA 2CPFA 2FQQB 2J8SA 5F41A 3OL7A 4NLGA 3IBFB 3MM7B 5C5MA 3IMQJ 1BQNB 1S3OA 2VOOA 4O2DA 4WK1A 1HZAA 4USHA 1VQYA 4EO8A 4KLKA 3H3VI 3NTIA 4XTCS 4LSZB 2BX6A 1WF0A 5K8MA 3BR8A 4K5WA 3K57A 4P2MA 2OTJA 4MKAA 3WC0A 2QFJA 3Q8RB 2CHBD 4LF7L 2IA6A 2EDGA 1M90T 3NRBA 3K5PA 2QLXA 4LWCA 2W9BB 1RABB 1LT5D 3E01A 3G4SS 4PV1C 1VK3A 1U4LA 1KTQA 4FXVA 2DR7A 1EKRA 4CTAB 3GMGA 2J6TA 4DX8H 3KMSA 1Q7LB 2TSSA 4CKEA 2F0DA 5GAGC 4D3HA 1U1MA 2BA0A 2JA5G 3GTQB 4FO2A 3S1MB 1CJVB 5KRUA 3MEKA 3I56S 3M4OB 3KDFB 2XM3A 4X3UA 2RVJA 5M5WH 4DV2Q 3JB9k 1V3SA 5BXIA 3N52A 4UF4A 4CLKA 5ADZA 4DR7Q 1RBLA 4FP5D 1CSQA 3E3XA 4WORA 4DUZL 1PFMA 3IR7B 3DGPA 4A3LH 2QW7A 1FVQA 4I7FB 2ROGA 3NWSA 1RLCL 2DNYA 1O5JA 1TR5A 2PQAA 3CJ2A 1EQQA 3CWJA 3CCEA 4IRCA 1NBEB 1RHUB 3CCTA 4L6V3 3T5KA 4NXMF 1HBOA 3T9ZA 4MK8A 4I2PB 1NSNS 4RHSA 2OEJA 4MH8A 3H0GH 4ICLA 2JA8H 1VS0A 3JSYA 3ILOA 4B3MQ 1GMWA 1LW2B 2CJYB 3PX6A 1NPRA 4A8WA 4A3KG 3FEXB 5LJ5Y 2GVZA 2CFMA 3GR0A 3P4UB 4DR2L 2N88A 2JQOA 4PABA 2KT3A 4LFCQ 1FDDA 4O4RA 2W9AA 1L3KA 4ECXA 1UJ5A 1REVA 3BN4A 3AB4B 2FLLA 3S17B 5D15A 1QCBD 1Y69U 3EZ5A 3HP6A 4DR3F 3Q8VA 4DL5A 4DFKA 5CV6A 4RL1A 1VQ5A 5KG7A 2BDPA 2QDLA 2X1BA 3D31A 1WTPA 1QB5D 5HVFA 5IIFA 3AQPA 5THWA 3S16H 1RTJA 4LF8F 1UETA 1IW7D 4DLGA 3PHTA 2QLJB 2WRMA 3OL6A 1WC4A 3GJSB 1PH5A 5E7OB 2KRRA 4LJMA 3GTGB 2KVQE 1M5PC 3A1YG 1J2VA 2KZZA 1VBKA 1TAQA 3MXGA 1LO5D 2RDHA 4LF1A 3L95X 1PFBA 1U2FA 3LPEA 4ZDNA 2ZH7A 2MQLA 1S5ED 2AW0A 2GVBA 2JEIA 2HHTA 3A4TA 4K4TA 1C4QA 1HMVB 1CTMA 4DHVA 2Z2LA 3HM9A 1PZJD 4KHVA 2NZCA 4HIOA 1IKWA 4DR7F 4WFN3 3RG6A 1SH3A 4OYZA 2HBYB 3J7ZC 3WHIA 4CDFC 1B4OA 5EKKA 3N5FA 1TY0A 4B08A 1FXDA 1KNZA 4JI8L 2NUCA 5CYJA 3PKYA 4HMJA 3VAGA 1N5YA 5CYQA 1YNXA 1D09B 3TUPA 1A6XA 1HR0J 5D65A 1U0SA 1SPBP 3IAYA 1TL3A 1U1KA 3FBCA 2E74C 1RZMA 3V6KA 1R8CA 2O5IC 3PHEA 5EPJA 4QIWB 2DGVA 3A8KA 2DHGA 4M8LA 3M8SA 5LSOA 4J8QA 4B9WA 4JI6Q 1B0PA 4J90A 1ZEQX 1HWIA 1RAGB 3FGVA 2DGOA 4GNXB 1I3QH 1PH8A 2VBXA 3H90A 5HY6A 2BH2A 2JC1A 2P6SA 4DX6A 4ZJQA 1UE5A 5A35A 3O6QA 1OQ6A 1SNMA 4J9RA 3D28A 3VF0B 3T16A 4DWIA 4DSFA 4RKUC 1D1UA 1KL9A 2OWOA 2NS1B 2GAGC 2HIYA 1XERA 5JXSA 2AMCB 4LR7A 3PW2A 4J9MA 4EBCA 3D4JA 5FO8B 5G0RA 1QUPA 1KP6A 2YV5A 4DUZJ 2B51A 2I8EA 1TT2A 1VQPA 1N32F 1Q79A 1LW2A 1HBNA 2ADCA 2JA6G 1FRIA 2AJ0A 1B4SA 4MTKA 4DN9A 5D4NA 1DHMA 2W2MP 4Y2MA 1PSDA 2H4WB 1BLUA 2NN6I 2RDDA 5HQMA 3PIOA 1T3OA 4R0EA 4Z9CB 2E1MC 3NBIA 1O8BA 1ZAVA 1F77A 4ZPWR 3M9NB 4V1Ak 1MIUA 1FWLA 2CQPA 2NZHA 4IDKB 4I7FA 4OELB 1UVNA 4X62Q 3H8YA 4K14A 4XYOA 4B3TJ 4F2SA 3GJTB 2H51B 3R2CJ 1HHTP 1RB0A 1WOOA 2PI2E 3MMBB 4X66L 2ZOGA 1IBMQ 2KYZA 1RHRB 4F3OA 5I2XA 4JI2J 5HP1B 3PRDA 3M85A 4R1JA 4DV5F 5C0XG 2MY8A 2CCZA 3FHWA 1V1QA 2CZ9A 2SNSA 1WDTA 3ZZ0A 4HDHA 2O66A 2JZ5A 1AROP 5ETOA 1IYUA 1XTZA 3KXDA 4UQTA 2FLPA 1S0NA 2XC9A 3R7BB 1GM5A 5KEEA 1VQFA 5K9FA 3IKJA 2C9OA 3BDEA 4JV0A 1I5FA 4A93B 1T5EA 3DGVA 3GIJA 3S2HB 4IOCA 3HX9A 1JORA 2F4VF 2RMLA 2KENA 1F2YA 4JI6F 4QPTA 1VQPS 2F9JA 2CQ2A 3S1QH 5KT2A 2DNKA 1KQSA 3PX4A 3BSNA 2FJAB 4AQYF 5GROA 2JFDA 1NO8A 3LAMA 1WTBA 3DMUA 4JBKA 2LSSA 4I69A 2Z4IA 3SCIE 2GVDB 4AFFA 1Y14B 4YHHQ 1EY9A 1MSHA 2IPKD 2ZUGA 3GTOB 4HEA9 1FA0A 1Q82C 4EI2A 1N5QA 1JWWA 1JK9B 4YWLA 1B70B 2VICA 1O7YA 3C15B 2EJMA 1VDHA 2B4PA 3CF5A 2FJVA 1DOKA 1X0PA 2QE5A 2E7WA 2IX0A 5LXRA 3VYRA 4OHVA 3KLFA 4DUYJ 4KN7C 2CG4A 2A69D 4DCPB 3OXGA 3KLRA 5KFVA 1UTAA 5KOXA 1VRTB 1BCPD 4WJBA 1P1LA 2VQFQ 4AD6A 1QILA 4IOAQ 5CC4A 2D7SA 1H6KX 2FGOA 2NUUG 1DLOA 1NNDA 1EEID 2IC3A 2EJGC 4YDDB 5D0EA 4J9PA 2Z2ZA 2ZHAA 4UHVA 2ATLA 3PEJA 1ZH5A 2EI5A 3OHAA 2VFTA 3JC66 4X4RA 3GB0A 2ZZNA 3KLSA 1PJ7A 4KO0B 1LWXA 2AQ3B 2E5HA 1IYJB 2QL5B 1N33L 3LGMA 4JI8Q 1RTHA 1Y1WG 4QWEA 2F0VA 1X4CA 1XWEA 5L37A 1G6ZA 1B2TA 1UVLA 1S9GA 1S7HA 4Q0BA 2BA9A 3K0YA 3W66A 4M5DA 1CZGA 2XCPA 1N48A 4ED5A 2HUGA 3TAQA 3NNHA 2C2NA 1RODA 1ZTWA 4Q43A 1B3QA 5HSPA 5I3UA 3S14B 5SZTA 1QSYA 3K89A 3VVTA 2LCWA 3PJWA 4KTAA 1FE4A 3SSSA 1RAIB 2GQCA 5A76A 2VUGA 3TP7A 2XLKA 1TKDA 2DNMA 3PFOA 2DCLA 2C2MB 2GO9A 4YP3A 1PJ5A 3GU0A 1JXLA 3U1NA 2IMOA 4P72A 4DUYQ 1GFWB 1FE0A 2EY5A 2Z6BA 2ZH8A 4F8MA 2CQDA 4RO0A 1VQHA 4XK8C 4X2BA 2YNGA 1S79A 3GO5A 4PXDA 2NTSA 4CDCC 3DOMA 1KRSA 2E5LF 2HCCA 3TUJC 1GMVA 3BDLA 3C6UB 2BE5D 1IKYB 1DBDA 2VG7A 4OYAA 1GVPA 1JLBA 3CXCA 2CQIA 2J5AA 2K01A 2ZH6A 2VQFF 3RUBL 1L1OB 3QT6A 4I56A 1VCIA 1GEHA 3TYTA 3SFUA 1D5XC 1LWFB 5KYIA 4JI2L 5CCMA 4QQBX 3CVKA 3S8SA 4CRJA 2RSQA 5C7PA 4PG7A 3M2RB 1FCAA 2V8GA 2PO4A 4KHMA 1RAOA 2CJXB 2YX7A 5JEAG 1IBKL 3KJPA 5KG4A 2ZM6Q 2GN5A 3NE5B 4LUVA 4UP9A 2NSCA 3HHDA 4RKLA 2OTJS 2MGZB 3KJFB 5F8HA 4HT7A 2IPOB 5C24B 5E3CA 1RL2A 3DLBA 3P8BB 2YNHB 2YWEA 3I6PA 1NM2A 2QILA 3NOCA 2Y9HA 4OYOA 5EWEA 4UP7A 1QUQB 3TJ8A 1TL4A 5E3AA 1XMOQ 1E6VA 4OJHA 2DHAA 1I94F 1LTLA 1EQRA 1RT7A 3VR2A 4ZLPA 1KXLA 3K8AA 2IHEA 4CT9A 1V6HA 4APVA 3LA0A 1SH2A 1F0XA 1RT3A 1S1UA 3Q8YA 4YMEA 1KHIA 2DJGC 3I8ZA 4WFYA 3IM9A 4RA8A 1FDBA 1GXTA 1L3VA 3AOBA 5AE3A 5KNDA 1YBUA 4O44A 2GNKA 1FJGL 1S4FA 1TK0A 1SKSA 3SQGB 5FD1A 2HQEA 2XS7A 2IYIA 2UZAA 1ZTTA 3PO5A 1ASZA 2A8VA 3D6WA 1VMCA 1N5TA 2AEFA 3G7LA 2XYGB 1O7LA 1U48A 3WIUA 3JAML 3CCSA 3K80C 1AT1B 1XNRF 3R5GA 5I4DA 3DXSX 3F41A 5GADU 3NGTA 2ZH4A 3BH6B 2RF2A 4RGTA 4MN3A 2K28A 2VG5B 1VRUA 1J6QA 1TKZA 1QSLA 3L2PA 1BD6A 3MPUB 2F0IA 2IBOA 1VHFA 4RBTA 1PRTF 4JC0A 4XDXA 5J2NB 4O3PA 3L3CA 5GMDA 4DFJA 2OPQB 3B6BA 1RE1B 2E5LQ 1M1GA 5AXLA 3FSYA 3KK1B 4OIJA 1ONLA 1S6QB 1Q0NA 5AE2A 4DF7A 4LFBL 1V43A 2ZVSA 2B5JB 2ZJQA 1Y1WB 5HJYA 4O0NA 4HHJA 3ELHA 1HNXF 3AFGA 3V05A 1LTRD 2OEKA 4RLEA 1K0TA 4I2QB 1JLAB 1Q90A 1HNWQ 1WHYA 1U1LA 2LEPA 3Q83A 1JQGA 2LP4A 1SJED 3I0SA 3U1LA 2I5JA 3F2DA 3MR5A 5DG9A 3K2YA 3OW7A 4USWA 5FDLA 1ZXTA 3J7YW 2BV3A 2YQ0A 2WW8A 3RBEA 1QTNB 1YJNA 2YKOA 1CM9A 1EY4A 4TVAB 3MM5B 2PPBC 4AL7A 2D9OA 2FC9A 3E0JA 4HJAA 4OL7A 2ZD1B 1FTCA 4DQSA 4LF8J 3FEYB 3JAME 4EBEA 3HOXG 2OH2A 1KR4A 1U47A 2O01C 4RH6A 1HNIB 5F3ZA 2F0UA 3MUTP 5E7NA 1RTNA 2V4RA 2R61A 1I6HB 4IQXA 3HMJG 4RU2A 2B39A 2M88A 1U6FA 3BDCA 2G1DA 2AV5A 3IS9A 5HLFA 3M30B 4CO0A 2G2OA 2GA7A 1EZ6A 2VU5A 5HANA 5DDRC 3FCHA 4RBUA 4FS1A 2VA2A 4YS2A 1IBMJ 2WBRA 3W8GA 1VQ6A 2OEOA 1I94J 2Y3YA 2K50A 2KVIA 2ABYA 1EJ7L 4MKYA 1NJXA 1SUQA 3CB4A 3VYUA 4X3SA 2WHOA 4WRDA 4A3DH 4KKSA 1H95A 2XMAA 1UWVA 3ENWA 5LMUQ 2A2CA 2GIRA 1X31C 3OJUA 4B3RL 1FNOA 1ITPA 4F7VA 5JVHQ 5ELOA 1X3FA 2A10A 4BBSB 4RWSC 5IYCG 4OX9Q 2GC8A 1RTZA 4ZKAA 2RRAA 3NHHA 3LP0A 3P3DA 4N8NA 3R3OA 1S12A 3CJ0A 2RQ4A 3EGZA 5CAAA 1FRMA 5GAEC 2D2CC 3FFIA 2MKJA 5A8KA 2W7AA 5HATA 1T02A 4HKQA 4KRWA 1FGUA 3N6LA 5J2PB 2IJRA 4LF7Q 1RWNB 1W6JA 2CQ3A 2ROEA 4A93H 1EIYB 4OZ1A 1AZPA 4BBRB 2ZBCA 4FF3A 4JV2A 1TMMA 1CKOA 3CP0A 3KLEA 3BSCA 1FJGJ 3BU2A 5FJ4A 1OY8A 2MJNA 3DRSB 1LTSD 2DYAA 3BGRA 4HI2A 4DX5A 1KDNA 1D1KA 3G82B 3MEGB 2UUBJ 2IX1A 4GKJQ 4DUZF 2YPZA 5C44H 4DV5J 4F26A 3BM7A 3QOJA 3F2BA 1RT5B 1N32J 3CCRA 3I32A 4KMUC 4BWJA 5LSRA 1D3WA 1IBLQ 3D54A 4ES3A 4DV2L 3G8SA 1TQOA 2JA5B 1HR0L 1TL5A 4C6AA 5A2QY 3P75A 4ZVRB 4BBRH 1EUJA 5M3FB 1VQ8S 4USUA 4QUCA 3I0RA 1PKUA 2F3VA 2BVZA 1O80A 3GFYA 4RW9B 1VQ5S 1O7ZA 2LFNA 2MP1A 1C0AA 1KRPA 4P75A 2HD3A 2DHHA 2N3LA 2CG8A 4WFXA 2KH9A 2BQ3A 2WB1E 2BJDA 2RAQA 3EROA 2K52A 3S24A 5IGDA 1U1NA 3S2DB 2ZWPA 3KF6B 2DT9A 2EG2A 2ZH1A 4OO1I 3ZJYC 3NCQA 5A2QL 4IG3B 4IUUA 1Q1EA 3DHXA 3IFDA 3M6WA 1IHZA 2HHQA 3TREA 2V8PA 4JCVE 1PTOF 1GX5A 1HZ9A 4KGKA 1G2EA 3W9IA 1FHTA 4KYZA 2E2IB 4ZPCA 2ZH9A 4LF9F 2UXBF 4CWBA 2ROPA 2DNHA 5D6GA 5IP9G 1VGYA 3B6YA 4AH6A 1L0XB 2RDIA 3M4OH 4GO5X 2GCFA 4QBUA 2RQCA 4EUVA 1T03B 2XIWA 3U58A 3V4IA 1GH8A 3QBCA 1DY3A 5C4XG 5F8IA 2XHWA 2ZE2A 3CCUA 3E8OA 1ZOTA 3PYDA 4Y7NB 4QY7A 1IR1A 1NBWA 5J1ZA 1V9OA 4WE1A 2F4VJ 1RF2D 4A47A 4I65A 1T0TV 2YQ1A 1E3PA 3R27A 2HQDA 3T1AA 2OPRB 2LFVA 4ZVGA 1PTOC 1CULA 4ULLA 4ED4A 3A56A 2J0QD 5C42A 3Q22A 1WDDA 5KFWA 1WNEA 3CCMA 1K0VA 2N7CA 3AJ2A 1EAYC 4A3IG 3OTEA 2R7DA 4RW6B 1YZ6A 5E5NA 3X3UA 3CE8A 1T9UA 3KUEA 4GMKA 5KFBA 3OVAA 4NCGB 1BC6A 1WEZA 2XY7A 2LXIA 1SJQA 4CO1A 5KFZA 5JJBA 2MQNA 3TUIC 4CM2A 2XSFA 5C5LA 5M3FG 4RUBA 3DFEA 2F9DA 2L9NA 1S10A 2XEXA 3RZDH 3EGVA 4C98A 2QSFA 3C2PA 2D69A 2KT2A 2PC6A 2UUBF 1Y9OA 5F3TA 1KRTA 1DTTB 4L74A 4K4UA 3MPYA 3LTOA 4PUOA 3KLSX 2CNLB 1SJRA 1AFIA 4DQPA 3DKDA 2UUAF 1JT8A 5BR8J 3DRRA 1TMJA 4LSLB 4CH0S 1LEOA 2KYXA 2UXDJ 4HR7B 5B0GA 3IBCB 3O3LA 4OX8A 4F8RA 4M5NA 3EGNA 5LMNF 1NKCA 3CPWA 3C3LA 3EE3A 2XLIA 2UXBQ 3V81A 2O2LD 4DV5L 3KNAA 2HCIA 1KBRA 1NJWA 2WFWA 4CYUB 1D5ZC 5HROA 1PC4A 3G71S 1W2BA 2NREA 2OP5A 5KFCA 3MMAB 2M7SA 1KQSR 2VB3X 4C0HA 1WSRA 4DV2J 1X3EA 3GV6A 1TWCB 3ICEA 1SJFA 1K73C 4ERDA 1PH2A 4K6LA 2MTLA 3I5CA 3NBPB 3DCAA 1FNUA 5FKAC 4IFDJ 1WEYA 3BG3A 1PH4A 3OHXC 2JA6H 3PIPQ 1UNSA 4HJ7A 2B8QA 1SKUB 2KCTA 4JV5J 2GQQA 1ZM3A 2MZJA 3D2WA 2JA8B 1RGVA 1E6YA 2H1EA 2EVBA 4N5SA 3T51B 4FS2A 4AL5A 1F3FA 3T3FA 3U9OA 2KHDA 2X3GA 3PVXA 3I55A 2WSCC 2KB2A 5DLGA 2NVQB 2Q79A 4NZ6A 3S15H 3U9SA 5KGUA 4RFBA 3T13A 1CS4A 1HUNA 3TEHB 2J9DE 2IJ0A 3TO8A 1A2TA 3DEPA 4HCSA 5HBMA 1HKAA 2AJQA 2VZ9A 3NOGA 2AU0A 2Q6CA 1F2ZA 1K1SA 4ZLJA 4ZP6A 1SFOB 1UE6A 2UV8A 4PMWA 1DQ9A 2JVRA 3AA8A 1NCLA 1S0OA 4YWKA 1NAPA 1PH1A 5H9EK 1XK8A 3NELA 4HN7A 2CH4A 4R8NA 2KXHA 4DG1A 1SBBB 1UWBB 3NK9A 1AYEA 2F0TA 1H98A 2BCOA 3G87A 4M63A 2Z58B 2YTXA 2QJ3A 3DOLB 2GA4B 1QWYA 4FYXB 2XNAC 1V1PA 3QIPA 2YKPA 4DFMA 1WTXA 4OWXB 3HKZB 1V1OA 4K4VA 4GN3B 3NEMA 1M0SA 1RDPD 2XTIA 2KG0A 2XWYA 4F4ZA 3HVRA 2AIRB 2RDFA 4PMCA 1URNA 3QJPA 2XHCA 2Y0SE 1YZ7A 1XNRJ 4WJWA 4ZN3A 1B7YB 4LF4L 2B6AB 3OR2B 4DV3F 4Y7NH 4UUXA 2UXDF 3G9CA 3OPOA 4A3FG 3ICLA 2WKDA 2DRAA 1X4HA 1IKXB 5LMNJ 3U27A 2G1HA 4N8OA 3I55S 1UUPA 4ALZA 1IBLF 2WB1D 5C5JA 4M5JA 1UFWA 1XN9A 3G6VA 4C2MH 1EYCA 2ZTEA 5IGFA 4MAKA 2ICEC 1YHQA 1RT2B 1UEVA 3MDFA 4IPHA 4PQUB 3C46A 3JYTA 4P73A 4TY8B 5B0BA 3OT9A 4C3JG 4ILLA 2V50A 3MTSA 4GKKL 4FBUA 4ED1A 3FRZA 3MECA 3F2UA 1AB8A 3EBEA 4RNFA 1L3TA 2HZCA 2CQAA 4QIFA 1RIPA 4DXFA 2F3WA 2VQFL 3KNGA 4ELTA 3VYSA 4L6TB 1FJ7A 2YWKA 1EY5A 4DF4A 4NZ7A 1AZSA 2YU9H 5HVGA 4JV5F 1RADB 1FERA 1KTKA 3LP2A 3I91A 2XSJA 2Q2HA 2QX0A 4CDDC 4XDCA 3MFGA 1SJ4P 2L9WA 5C0XJ 1SC3B 4OX9J 3I31A 4E8UA 1Q46A 1MMNA 4LF6Q 2X7IA 2HHHQ 3PO3H 2R7SA 2BJ1A 1FNWA 1AP0A 4DV6F 2JC0A 3HHLC 3Q8UA 2JA7H 1M5HA 1CI3M 1Q1KA 4MFBA 2DY8A 4JBWA 2ZZTA 1FKOB 4CLTA 1RHQB 2J76E 2C2EA 2Q43A 2R7RA 1JMTA 3HVTA 1U1OA 2XMWA 3P96A 2KHSA 5A8WB 1PHJA 1QAXA 2CWKA 4HLBA 4XPCA 4RGOS 1DQ8A 2RB7A 4ANEA 1EZZB 3QJJA 3HJFA 2F1MA 1ILPA 4QIWD 2POKA 5KFGA 1IBMF 2M2BA 4G1QB 2PA3A 3HOZH 3EGWB 3NQTA 1DGSA 2XYHB 2A6EC 3TZZA 4A3IH 4H7BA 3PR5B 4RW8A 3AXKA 1KHWA 2HHPA 1SBRA 2ZBIA 3UO0A 3N9UC 4I68A 2IWHA 3EWGA 2NN6H 1EIHA 1U0HA 5DM63 4JI0Q 3QAUA 3RN5A 1CFMA 3D0FA 2UUCJ 4Q5VA 3R5BA 3EVMA 2Q3PA 4JV5Q 2P8IA 4DR3Q 3IL8A 2BRLA 1WTHA 1K8OA 5D3GB 1ZPVA 5FK9C 3H5SA 4H4OB 3KK3B 3HOVH 2JSOA 4O4GA 4DMZA 2A6HC 2L3MA 4UY8C 3W61A 2K5NA 2X1GA 5ETLA 2D9UA 2Y0BB 5CZVA 5H9EJ 5I9OA 2K5WA 4LF7F 4FPRA 1LW0A 1BQMA 2QMXA 3HK2A 3J80E 1Q5YA 5BR8Q 4CLUA 3A55A 1SV5B 2G9DA 4MIWA 2YNFB 3HZXA 5KNCA 4KV8B 3QGHA 1EP4A 4DV0J 1V3ZA 2HVZA 3NAIA 3LGHA 3STBC 1YTYA 3HHLA 4A46A 2QGQA 3UDIA 1YNJC 1NUEA 2D3UA 4L63B 2F0KA 2ZM6J 4JG2A 6FDRA 1I4RA 4DK0A 2WONA 2J9CA 3H91A 3VHQA 2E5IA 5HJXA 1P9QC 3HKZG 1HIYA 1IW7C 1O6XA 2BJ7A 1Q86T 2R4FA 1D6EC 1PAUB 2KECA 1PBUA 1SXLA 1C9OA 5I3QA 3CJKB 1TU0B 3TR5A 5A8RA 1EB0A 2E1CA 4FYVB 4DPYA 5FLMG 4EGLA 1MHWC 1UE1A 4OHJA 2A6ED 4L3KA 2QCPX 3OWEB 4EQPA 4DR4L 3PO2G 2F1FA 2RSOA 4XXEA 2ADBA 1A0OB 3U4ZA 3K7AH 3BVMA 1XMOL 3CD6S 3S9WA 4OYWA 1IBML 1VOMA 1IBCB 3DMJB 4C1NK 2VS1A 2I9SA 4TQUS 1WD0A 1C1BB 4OMFG 4KV8A 2XZDB 4KY5A 1ZYRC 2K14A 1NJYA 1X4DA 1LNQA 3WX8A 5CXTA 2VFUA 3OW2R 4USTA 4Y2AA 2OPPA 2ZEJA 3GTLB 3SDEA 2AQ1B 1F5AA 2VC1A 2JYOA 2DGUA 3OWFA 4OEMB 2JJQA 4DSKA 1RWUA 3TZXA 3AOAA 4IUNA 1JJCB 1KVKA 1WOPA 1JICA 3I7FA 4K0KL 1K47A 3O5TB 4WKYA 2AUJD 1T05A 2B2VA 2C1EB 2B8FA 1VQ7A 4KGXB 4PG5A 3FDTA 2K1RB 5HMZA 2KTQA 5AFWA 2B9YA 1VI7A 2DN8A 3QYYA 2VY3A 2BOAA 1EQ0A 2LQ5A 3I56A 5GMKa 2FC8A 2AWZA 2TMPA 3LALA 5ITHA 3T1YL 5DGAA 1JLCB 3NCRA 3QZ7A 2M0GB 4DR6L 1JOKA 1ZS6A 1SSOA 2RQMA 3C16A 1S6PA 4FPIA 4L3NA 1Y1WH 1QE1A 5IQ6A 1N32L 2NVYH 5FIIA 4EYHB 1HNZQ 3AYHB 4HACA 3PM9A 3G6EA 3CJ5A 3OIPA 3AJDA 4N77A 2H1YA 4IFDH 3EX7B 1HNWL 4F7XA 3KTQA 1EWCA 2A19A 1K73T 1C1CA 2V9KA 3BYRA 3AFPA 1DYQA 3GIMA 3MPWA 4C8LA 2EKYA 3GTMH 3N6RA 2FJ2A 3HVTB 1NHVA 1UVKA 5AXNA 2K75A 3UI3A 4NXMQ 3W2VA 2FJWA 3A7LA 1W6KA 1TUGB 4ID5A 2EC2A 4JI7Q 4LF4F 2B63B 1X60A 2W7OA 1I5OB 1TS3A 1RA6A 2VG6A 1NMFA 1G3OA 4NZ0A 3NS6A 1IKVA 2R93B 4M8AA 4ED8A 3ITPA 2JA5H 7FD1A 4QWBA 4QOTA 1MN7A 2GAHC 2WVBA 2CWPA 5DLFA 2IM1A 5CMDA 2ERRA 3HD1A 2DNGA 2OGUA 4GN5A 3W9JA 4OHYA 1A6LA 5I3PA 3S1TA 3GTKH 3NS7B 5DGBA 4MYUA 2Q8RE 2R93G 5EWGA 3IFEA 1RAFB 3RNUA 4JI0L 3J81Y 3QO2A 3WIVA 3LX0A 1FRHA 3VA5A 1S9EB 2FHJA 5CABA 1HJPA 4WBFA 2FXQA 2RUGA 1GQEA 4B3SJ 1O51A 3M2VB 3JTOA 4BCAA 4CO3A 3X3MA 2ATCB 3DOKA 1R0AB 2R7FA 3SYZA 2MUYA 1Y0HA 4R8IA 3H0GG 2AJFE 2BE9B 1M1HA 2RIJA 4R8UB 1RCOB 1U25A 2HDMA 3PDNA 2P5ZX 1NHUA 4WFAQ 4J9LA 5BR8F 5L39A 1PRTC 2BJ8A 4KJIA 3SK5A 1YHAA 4PG6A 1X0FA 4ETXA 3HJVA 4N8FA 4U96A 5E2QA 1PILA 2DEIA 4WTOB 4E0DA 4R8UA 3ZYYX 4FXKC 3J7AV 2VJVA 4C3HH 3J7ZT 3M9MB 1HBMB 1GMWD 2V4JB 4LMZA 2VL6A 1SYDA 2EPBA 4OHWA 2XMMA 3ERSX 1HNXJ 2DO0A 1T95A 2YQ3A 2M00A 1EOTA 1WC0A 3KLGA 4FZVA 2O67A 5IT9L 2EC0A 1XR5A 4QWDA 4CQ1A 4QW8A 5KFUA 3Q8QB 1VF7A 2MKSA 5EPLA 4G7HC 4EQOA 2RHSB 4G57A 1NTGA 4DK6C 4DV1Q 4DPWA 4MIUA 5G3LF 1IBLL 5C25B 2EEYA 4LBHA 3FMCA 4BXXG 1HR0Q 3PY8A 2R7OA 1SE2A 2HQGA 4X4UA 4JI4Q 2YX1A 2WOMB 1PXUA 4LBPA 2PFDA 3QR8A 2PW7A 5JPMC 4AQYQ 2UXDL 2XN9C 3DM2A 1WWHA 2F7VA 5ELFA 4DR6J 5LHY1 4X4TA 3K17A 1B64A 1H73A 3DU6A 1U26A 2MKYA 3MCMA 4J9SA 4DXLA 3BDPA 3AOCA 4FYWB 4Y34A 5CV4A 3GFZA 1LTTD 3M8PA 4OHXA 4R5PA 1B3AA 3URYA 1DURA 3K7RA 1XNQQ 2E5LJ 4HH0A 2V4QA 3S7RA 2RS2A 1LQ9A 4G3IA 3IRXA 4N9PA 4DUZQ 1VQOA 1Z7TA 4QB4A 3MUMP 3J81L 1HWUA 3I4MB 1HQ2A 3TW0A 3B78A 3VA7A 5DG8A 4RJVA 4DNIA 3T1YQ 1V8QA 5C2GA 4G1PA 1F3VA 1GK8A 1HQEB 2GGPA 1X6OA 3N79A 3ZFVA 3MHBA 3KBXA 4A3CG 3J81i 3I5BA 3ZTPA 4IYQA 4ZN1A 3V81B 4DSLA 3UDFA 2VZAA 1WF1A 3HKSA 3MFIA 1H72C 2Y0SD 4DR2Q 2D0OA 4JK1C 4KGMA 4ECWA 2D62A 4NRTA 1U4PA 1YHBA 2UVWA 3ET6A 1CSPA 5KOWA 4JI0J 3JXOA 1Z6HA 4RNMA 1EX8A 2H65B 1LACA 1TP7A 3DHQA 1YJWS 4TLRA 1RBOB 3QLHA 4JI7L 2FB0A 2G9HD 4TYBA 3UDVA 3BPSP 5IT9c 5KG0A 3R1HA 5ELEA 3GTJB 1J27A 1H7WA 1V5IB 3DMJA 2VJUA 3OXFA 3CC7S 1RHPA 3FKIH 2B4VA 2XNQA 4N47A 1WKLA 2OF1A 1JWUD 1IQZA 1C0TB 5IGCA 3MM6B 1FD2A 3R6LB 4UOGA 1LTID 5IYBG 3MXHP 2B2YC 1RUSA 3MCSA 4EMDA 5D0GA 3BR9A 4C3JH 2I38A 2PSZA 3HO1A 3M6VA 3PSIA 4MYTA 3PUZA 1WHVA 4F2RA 3J7AN 1N0VC 1ML0D 1TUWA 1BO0A 1Q7YC 2R7VA 3J80L 2YWFA 4ZHRB 3J81E 2P2CB 4LFCF 2R2UA 4L5TA 4CLSA 4ZPDA 1WFQA 4DV5Q 2YNFA 1X3QA 2LEBA 1GXDC 3CUNA 2X69A 3KJVB 3NG8A 3D3RA 3CJQA 3THTA 1HPZA 2RRBA 3MM8A 4A3MG 1YRXA 2ATWA 2FZKB 2ENBA 2D5DA 3QRPA 1X9MA 3HOWG 2BANA 2EFPA 4Q8FA 3BGOP 1FEEA 2AYGA 1Y7PA 1MSGA 4O4GB 4JI6L 5IT0A 3KK3A 2R6GA 5A6WA 3HEJA 2D3O1 5LM7E 3ZZTA 3VAIA 4PAAA 2JLFA 4P6QA 2BYCA 1SYEA 1B3TA 2KFNA 1PMRA 5JEAJ 4V19J 4BC7A 5F9NA 5H1SV 1TWAH 2RQXA 4OX9L 3KF6A 2QEJC 1SQFA 1Q3LA 2YPYA 5I42A 3I4NG 2FFKB 1H7XA 3MHYA 1ET6A 1ZM9A 4O3SA 5B08A 2VOPA 1SCJB 1PJ6A 1TFYA 3I70A 1URRA 1KLGD 2JLEA 4XYQA 1YITA 2HHHJ 2BE2A 3ER0A 5J2QB 1VQAA 2MDAA 2FPHX 1D8ZA 1BUVT 1OO0B 4IURA 3SE0A 2G5DA 3Q0AA 1J5EL 1FKPB 2DHSA 2EJFC 1WD1A 2VHGA 3U4VA 2MNAA 3FMBA 4GKJL 4NLRA 5IM0B 3X1LB 2FHJD 3ITHA 1I6VC 3D5MA 3BJYA 1Y10A 2SEBD 3QOLA 4H02A 4F67A 4NLVA 5CGKA 3PMFA 4DCOB 5A2QE 1GTEA 1G4CA 4PQXA 4DXGA 3K5OA 2DNCA 3UE0A 4U68A 3HFKA 4X65F 2VXWA 1G91A 2K5HA 1H2TZ 2EPIA 3JSRA 4OFZA 4C4WA 2PFFB 3VGVA 2DY9A 2R7TA 1DRZA 1AFPA 2CUYA 1OXVA 1JKHB 2XGTA 1STNA 3KHHA 3UR0A 5IP7H 2PZTA 3RUZA 4HHHA 3RTVA 2L12A 1U1PA 1CQNA 3BQ0A 4K4WA 1HARA 3DDNA 3G8TA 3R6GB 4QR2A 1HYSA 2N49A 4KHPL 1QJOA 4DV1J 1ENFA 5K36G 4DV2F 4RUHA 4LF9Q 1W7WA 4OX9F 3MFHA 2GMJA 4DL3A 3AHPA 3ZO7A 3S16B 2OPSA 1SVDA 3RU0A 5EX3A 2B9EA 1M5SA 2KG1A 1O78A 1JLFB 3V6JA 3GV5B 1H0HB 4DV7J 4M5MA 2ZNZA 2C2ZB 3R2DJ 2K3IA 3UDEA 2D3OR 4GVBB 4NOHA 4P74A 2GS8A 3FJ2A 2J6SA 4IOAA 1H74A 5GAHI 4P7VA 3QT8A 2PNRC 2CKZB 2G9OA 2BRKA 1FFGB 1Q8KA 1JXVA 2FLOA 4QJFA 4ANDA 3G96A 1RKIA 4UPAA 1HNIA 4S3SA 1A8VA 1KWMA 3HOVG 4WYLA 4LFAQ 1HQMC 2MHVA 2ZH5A 3PNIA 4DQQA 2Y0SB 4F0KA 3MM5A 2YWWA 1YBAA 4CLYA 3DYAB 5KIXA 4FNIA 1TK8A 3UN2A 1UWBA 1GXUA 2PQEA 2RRNA 1FT8A 4DG1B 4DV4Q 2R8HA 1N4LA 4RMFA 3RZAA 5KG1A 2PIIA 5M3MG 3L9ZA 5C44G 5ETVA 4V0BA 3DHWC 1MU2A 2HS4A 2KU7A 1NAQA 1Y8PB 2XWBB 3WDOA 4JI5Q 2MKIA 3T6BA 2R3VA 2AQ4A 2AKWB 5C4ZA 2FGCA 3UPFA 1XPRA 1OPZA 1SIWB 2WAQD 2ES2A 2VUMB 2WW4A 3PW7A 4AUKA 3A13A 2FY8A 2OLWA 1KQFB 1Z1ZA 1PRTB 4LRFA 2WAQG 3HSGA 4ZVTB 1OXUA 3KK1A 2HVIA 3ILJA 2H5XA 3CQZH 2Z2YB 3DLEA 3DWPA 1XJWB 2X1FA 1OTCA 3DWAA 2Q2IA 5E4WC 5C4XH 4B9UA 2J9DA 4KTQA 3BKTA 1CSJA 3FDSA 1UA1A 2HFOA 3S6EA 2PZUA 2RF2B 4F0HA 2MHNA 2HNDA 2M9VA 3MD1A 2BM1A 4I64A 1BBWA 3HOYG 3CCLS 2XMJA 1QVCA 4C3JB 2F8HA 1RTIB 3PFEA 4L5QA 2DRDA 1XMQJ 2EQSA 3NMAA 4DDFA 1M5KC 3LGNA 4CJ0B 2YH0A 2CQCA 1YIJA 2ZDOA 4F50A 5C6AA 1JE5A 2PI5A 4LVOP 1HNWJ 4XT1B 2W2OP 2N8NA 2RKIB 2DGYA 1ESFA 2R7ZB 2QTWA 2CKWA 3KF8A 2HNYA 4K8IA 1Q53A 3HVAA 2GZOA 1SMYD 3KYLA 3CMES 2N82B 4PPDA 1FEHA 1EWHA 5KFRA 5GQOA 3M05A 4AIMA 4AYBE 2EK6A 4UOCA 4L75A 5DM73 2A2DA 5M5YB 4LF5Q 3UDLA 3P49B 1KDAA 1E6VB 3NAHA 3J81c 3MEDB 3HT3A 2ZBRA 3DM3A 4RG1A 1D7QA 4KGZB 1NR2A 1WKJA 2CQ0A 2WACA 3GIRA 1HA5A 1QZGA 3A8JA 2X6GA 1QY7A 2F40A 4E6IA 5J2QA 1G291 1U8SA 1F9RA 3WWVA 4C48A 4DV6J 5M3MB 2SNMA 2L41A 4PUOB 2UXCF 3CMAS 5KFEA 1X4AA 5F8GA 2IRYA 3OW2A 5AJ3L 3GIKA 2CVIA 4YFUA 4JYAF 2KJWA 5JUMA 3RW7A 2HW3A 4O42A 2I07B 3CCJS 1K3BC 4H44C 2CH4W 3PV0A 1LWFA 5IOCA 1JLEB 3EJIA 2CNOB 3CCQS 4ME3A 4Y2KA 4A3BH 1L1OA 4B3SL 4OL8A 2XMKA 2XNRA 3IO1A 2OSQA 2KCNA 3SEBA 4HTIA 3CCLA 5LMNW 5LT5A 2HT1A 1HHSA 4USKA 1UZHA 4ZLNA 1HWKA 1QUVA 3G6ES 4NI2A 4KHPQ 2D9PA 1HNZF 1VQCA 4BBYA 4LF9L 2R7WA 3QG1A 1WTQA 1J5OB 2UUCF 3VTIA 2EYLA 1SI9A 3M8YA 4DUYF 3A8EA 1S97A 4NXNQ 3RGIA 3RJMB 2KHJA 1JX4A 4H4KC 3HDSA 4U9RA 4ZJLA 4C3MA 4OI6A 4UY8T 5GAEU 4IFDG 4PKDB 8AT1B 4LF4J 4ZHRA 1MD2D 4LRBA 3CCRS 2ASYA 1WC1A 2DTJA 3I4PA 1T03A 2HRTA 4IQZA 1FJGQ 1NPPA 2GHVC 1W26A 5JAVA 5LMNL 2FVQA 4DSEA 4R25A 1RT6A 2L11A 4LAAA 4EBDA 1XTDA 4C8MA 1U4RA 4KJOA 2ALZA 1K8AT 3OLBA 1A3TA 1XBWA 4DR4F 2F65A 2HIQA 3QGPA 1EY6A 4OWWB 3TN2A 2FHOB 1X3GA 1F9QA 4NLSA 2ZC3A 3QO9A 5HK4A 2JEGA 4ZVQB 2Y1JA 2XG8A 1KC8T 2B2UA 2BOPA 3TWZA 1HNXQ 1XQIA 3C14A 2V1CC 4RCNA 3MGJA 1K28A 4RCOA 1KD1C 2DXDA 3CCWA 4B3TQ 3GJQB 2DD8S 1EQTA 4ZUJA 1DARA 2MQOA 4X64Q 4RPFA 3QLHB 1RHJB 3ZTOA 5RUBA 4U7UD 2FTRA 1NJIT 1PGZA 3H59A 2R3ZA 2KN4A 4ECYA 2YKNB 2B8GA 3AD8C 2LU1A 2DNQA 2FIUA 3NNAA 4DSIA 3CD5A 2HKEA 1WCMH 2WB1B 3BVGA 1KNEA 1VQ9A 3UCZP 3T1HL 4MNOA 3OMGA 1RU1A 4NB3A 5KFXA 4ZUIA 4HIMA 2EYPA 3T5JA 3O1LA 3A7AB 4X4QA 2C3PA 2I0QA 4YY3L 4JYAJ 1F60B 2IRXA 1GT8A 2F0GA 4TN2A 1B50A 3KHRA 2HG4A 4KGVB 4A3FH 3CGIA 3U1MA 1HQEA 4HJ5A 3KF8B 2QMWA 3CW2C 1PDQA 5IXUA 4IRKA 4A3KB 1ZKOA 4BXXH 3AQOA 3HT0A 3MXPA 4DAMA 1I50B 2V8HA 3EPIA 1V5VA 3KLVA 3RAXA 3D6TB 1GXLA 5IYDG 1K8AC 4J15A 1STGA 5KFLA 3SHLA 4DV6L 1SXTA 4F4AA 3K5NA 1SMYC 4TKOB 1E2ZA 3IRXB 3PO3B 2IMWP 2BACA 2FJEB 1UAPA 1TKXA 1N8RC 3MI7X 4F3MA 3G4SA 2OKQA 1VQMA 5IP9H 4FF1A 5IYBH 2PMWA 5EUHA 2F4VQ 2WBMA 5AXKA 2EY6A 3OTBA 2MFIA 2E1PA 5CBEE 5C3EB 1QE6A 4PZ7A 1PFNA 1VJQA 3DLEB 4NW2A 4KFBB 5J2MB 2UVVA 3R7SB 1PH7A 2ZHOA 4BBSH 2F8EX 3WBZA 4K2JA 1L3SA 2LECA 4JI8F 1QSSA 1FK9B 4GVBA 3FKIB 4UY85 4ECRA 4ECUA 3MAQA 1MU2B 1FNXH 4DUTA 2EE1A 3C1EA 1CG2A 3IS9B 2PZWA 4NA1A 3MF5A 1JLFA 2R2TA 5A6PA 4LUZA 2RE1A 4B3RF 5HP1A 3DYAA 3NWTA 2I2YA 5KFQA 1GX6A 2OPSB 1B7FA 3KLGB 3MMBA 5FLMH 4B3OA 3LUYA 2ZD1A 5D14A 4OIKA 4A8SA 1D8LA 1GUOA 4JI3Q 4A3GH 2LKZA 2QA2A 4XTTA 2V4JA 1IQTA 4IDKA 2R7QA 2Z57B 1TKXB 2HVDA 4K4ZA 3CC2S 4KAIA 2HHHF 1NJIC 1IJEB 1U45A 1SNQA 4DK1A 1VDZA 1YITS 2BW2A 2I5JB 1N34L 1R7IA 5HGQA 2QN6B 3T53B 3CDWA 5IC4B 4JI5F 1EYAA 2YWHA 2CZVC 4Y2IA 1SC4B 1STYA 1XMOJ 5M2PA 1EYDA 2P5VA 2E2HB 5CV8A 2HLTA 1YWXA 1HBNB 3G6JB 4IN3A 1NRKA 1HA6A 4BBRG 4EYIB 4KBIA 1TV6A 4IOCQ 4Q0FA 4ALPA 3V4MA 4IALA 2KFYA 2JJ4D 2YTYA 1STHA 2V69A 4A3JH 1X55A 1MROB 3GG1A 1DAXA 3GSIA 5ETPA 2MZRA 2XI3A 3GQCA 3RBXA 1VRUB 1VFJA 4G7OC 1IM6A 3UN5A 1VLOA 2A73B 3WOEA 2VQEQ 2ZXOA 2YKNA 3TP2A 4F3QA 3VZHA 3QFWA 1Q86C 1FR3A 1JKHA 2XRQD 2PA8D 3JAMY 4HJ9A 1KN6A 4K5RA 3UR3C 2VUMH 3NSWA 2SOBA 1BUXA 3N01A 2M3DA 3HXMA 1BHNA 4A76A 4WWSA 3VR4A 2JH3A 1LKZA 4BLGA 1SL0A 2QV6A 4B3TL 3QO9B 1X5PA 4LFCJ 2DNLA 4DS5A 4B3ML 4C2MA 1WC6A 3G8QA 1E2VA 2DR5A 4HTJA 3GYGA 3R5CA 4IH5A 3N6NA 1UW9A 4KY6A 4DZDA 1NSKL 1QUQA 5CZXA 1FKPA 4WPAA 3EPGA 1S4ZA 5FLXY 5EDWA 3T1HJ 3PEHA 2R7UA 3SBMA 2K32A 5CV7A 4F04B 3T1HQ 2ZHBA 2AGOA 4NPOA 2Q1LA 1ELOA 4QYZK 2DRBA 3W5OA 1WHWA 1UJ6A 4CO2A 2MGZA 1LK5A 3KJVA 4B3RJ 4LR8A 3M6XA 3BKUA 4LIRA 4DR6F 4OYXA 4B9VA 3HOVB 3VGUA 4IRDA 1QG7A 4JBCA 3TZWA 2MLXA 3G6XA 2H3EB 3EDQB 2RILA 3BO3A 1X9NA 1VBZA 1B8AA 1U6ZA 3GSDA 1N5VA 2JE6I 3OSPA 3IP0A 5I42B 1NDKA 3GCWP 4NWBA 4TU7A 1J5OA 2JN4A 2CWAA 3H20A 4PRFA 5K8NA 2E1RA 4DV6Q 3DXBA 4NRUA 4ZVUB 3NENA 3WC2A 5ELDA 2ZWOA 4XAKA 1X9SA 2WIIB 2RH3A 4DV7L 4NYPA 2Y1IA 1QVGR 2GV1A 1BCPF 2ZBPA 1SAPA 3HOZB 1Q8BA 1WJ9A 4W98A 1NLKL 1JJ2R 4PWUA 1ROFA 3W7BA 3UDGA 1KONA 4A4JA 2UVRA 2VV5A 1C0TA 2Z0GA 3BYTB 4YWMA 5NUCA 3JSMA 4ID6A 1YQHA 4CI0B 4KD3A 3MM8B 3I9ZA 2KXNB 2YBVA 2JOQA 1HA1A 2NYIA 3BGFA 2E9ZA 1MLAA 2GJIA 2VASA 4HIDA 1O0PA 4OV6A 1F9SA 1YJVA 5H9FK 2FHMA 2KFZA 4J9VA 5C0XI 5DQIA 2FHTA 2UXCL 2QIFA 3AH6A 2Z0SA 2AJ4A 2Q6BA 1IXKA 4CLLA 2SXLA 1OSCA 2LQBA 3DI6B 3HOZG 1NZAA 3U02A 3MR3A 2YWGA 2M4MA 3KHGA 1R0BG 5A8RB 3D0IE 1UVJA 1N52B 2G0CA 3BO4A 3MEDA 4JI7F 3T41A 3PTWA 2HAFA 2IVYA 1P8LA 4O3NA 1STBA 4DAYB 3MM6A 5L1IA 4USIA 4H54A 3HKZE 1WELA 4IPDA 1PBAA 3M8WA 4X65Q 3D8GA 2R8KA 2QL9B 3EVQA 4ZITA 3QRQA 3L09A 2JFKA 1WG1A 2L55A 3GPAA 3SV4A 1X7VA 4K5XA 4NLDA 4B3SF 2MXYA 3O2IA 1JJ4A 3H15A 3BS1A 1VQ4S 4EQNA 2RDJA 1VQKS 3OSNA 2W8LA 4LF8Q 2OFHX 4I6WA 3D6CA 1ZM4A 4JPBW 3J80c 5J1NA 3P7JA 2DY7A 1AFJA 8ATCB 3T1HF 1VQ8A 3F73A 4DV7F 1VQNS 2PMZB 2CPYA 2HNZB 4JI4L 2JHEA 1K83B 1KC8C 3NTHA 2V2KA 4HEDA 2L0CA 1RHKB 4WP8A 2IM0A 3D0GE 5M5XH 4KC5A 3PR4A 2L9HA 2O5JC 4NLXA 3R7NB 3CMAA 2ZH3A 3BSOA 3NWGA 2CRLA 7FDRA 1VRTA 4AYBG 4ZVOB 3B4MA 4NLPA 3GV7B 3PF5A 5CD4H 2XYPB 3K0JA 4K7QA 3CCJA 4H13C 1U02A 1KLNA 2I1RA 4DN0A 4KY3A 1U0HB 5D78A 2B2WC 1OS5A 4URQU 4OYBA 3C15A 1Q16B 1H2UX 4LFBF 2EYMA 2PCFB 3TA0A 2K7VA 1L1OC 3UE2A 2GX8A 4RW8B 1RAHB 2R8JA 1SKWA 5KFDA 1A0IA 5L38A 1UL3A 1TUVA 2GVDA 3GTKB 3TZUA 3HOXH 4QJVA 3FCWA 1GOZA 4PG3A 2K3KA 1M4VA 4JUZA 1YJWA 2WSEC 4X66Q 5M2RA 4R5PB 2XGPA 1T94A 5BN4A 4W4MA 3EDRB 1IJFB 2R2SA 5GADI 3FK4A 2B0GA 2B2YA 1RHMB 4URSA 1E0BA 1CJUB 3KWMA 4U8VA 1QDUB 2DEJA 2WVEA 1CJKA 2P9GA 5H9FJ 1NEEA 1NK8A 3CHBD 1F1BB 2NVYB 2LDIA 1AN8A 3MA2B 2QMUB 3UW1A 3PJXA 1M1KT 1VQ4A 4UW2A 1T9TA 1W2BR 4R4QA 4CH7A 2K5DA 3S1QB 4IJLA 3MXUA 2A3JA 1LT4D 3GTMB 2ZUAA 2A74C 4LSNA 2FJBB 4O0IA 2IA0A 3ONAB 4GC6A 4JI7J 1AZSB 2HRYA 1KKHA 1VCTA 1RWOB 3NP5A 9RUBA 2ZBQA 4B17A 3FQLA 4GLVB 5GVQA 2YTCA 3DEOA 1KQKA 3B54A 4EQ5A 2AQ2B 4YCUA 2F0JA 1RJTA 3OUYB 2QG9B 3KBGA 2C3OA 3PYFA 3G2XA 2B2WA 2MLZA 3OSOA 1STAA 5FO9B 2CNNB 1U2RA 1CEZA 3T9NA 2OD6A 3HZGA 4ABNA 3MEFA 4BY1H 2PMZE 4FN5A 2AX0A 3NGSA 5JVGQ 3FUYA 1PG5B 2B43A 4JP8A 2UU9F 2HGLA 1JOQA 2CJKA 4JI0F 1A3UA 5C4XB 4DV1F 3CJTA 4OZNA 2J4XA 1U4BA 1D2BA 4Y6IA 1KAWA 2VG6B 4OQJA 4MHEA 2C5CA 2CZ4A 2OD4A 1VQGA 2UXCJ 4YCWA 1K9MC 4NXNJ 1FGBD 1KFSA 1PV4A 2HQ3A 1NH7A 1S76D 2XCAA 3W2VB 4ILRA 1WJJA 3SR1A 4RU9A 4DAVA 3M2VA 5LMUF 2XVSA 2DH7A 3R1LA 1CJUA 4O3QA 1S72A 3L3OC 1FFSB 5EBCA 3CMQA 4LFBJ 4TLQA 3AB9A 4JBJA 5FO7B 5HURA 2C3MA 3GWCA 1IWGA 1NKEA 1RSCA 2W4CA 5KT7A 1C4CA 1ET9A 2EFOA 1XR7A 4RX6A 4HACB 1XR6A 1EY8A 1WTRA 4ZS6A 2FMCA 1QE1B 2CJAA 3JQMA 2UXBL 1S6PB 4YB1P 3SK4A 2FVPA 3M4XA 1APSA 3MTKA 1U7LA 1XXGA 4QWAA 3UQSA 3ERQA 2CPEA 1VQMS 3HHLD 2ZXPA 3TSSA 1N5YB 1LWCA 1Q12A 2Y1RI 3UFCX 3K7AB 3NMRA 3OBIA 1WOCA 2CADA 3TDQA 1T9XA 4PEOA 4LF8L 4KH1B 3GYXB 3M3YH 4OYMA 1N34F 3M9OB 2FY1A 3HVWA 1VS3A 2GFFA 2BJ9A 1QAIA 5K36H 1QM9A 1VC0A 4DV3J 2C35B 2HBQB 5HN0A 4WIIA 3MAHA 2F0WA 1XMOF 2DNOA 2QA4A 1MJEA 5J1EA 3CIZA 4OYPA 3CCSS 3SDEB 1ICWA 3QWUA 4P2XA 2UUAL 4WCEQ 2HNZA 1PC5A 4ECZA 4NCBA 2PGCA 3TRGA 2Z2MA 3LAKA 4RHRA 1SFOH 1X5SA 4FVMA 2NBFA 1OXSC 1N9WA 1Z2ZA 1NE3A 4YR0A 4A8QA 2XY5A 3CO9A 1SLJA 1C0UA 2NLWA 3CIMA 1IR2A 3L9AX 5ETRA 1CLFA 2VC0A 3B8HA 4PYDA 3MMAA 2JVOA 2V68A 4DR1F 3WQPA 4ZCIA 3DXJC 3I4OA 3IC1A 3N28A 1S1TA 3IAS9 2K1RA 3LQVA 3PW5A 4DAYA 2VBZA 1VK8A 1NPKA 3MZIA 4NA3A 3IRWP 2AWNA 1R27B 4PG8A 2MB0B 3J7A5 2IT1A 2OMLA 3RB0A 4Y00A 1ZA2B 3D9BA 1KFDA 4JI5J 2OUGA 1YJ7A 3CC4A 4CKBA 4IUPA 4A3JG 2HSEB 4MTNA 4ED0A 1YG0A 4HTHA 5ISRA 5CD4A 4N41A 4CJ2C 5HAOA 2WONB 3O13A 5DQHA 2M70A 2CDRB 1YHQS 2GVZB 2DUDA 1HZBA 3HHLB 5IT9Y 4LJZC 2WZ1A 1TWCH 3D4DA 4YN3B 3S01A 2F0OA 4OZ0A 2CPHA 2NTTA 3CEDA 4YR3A 3HKZD 2DO4A 3LWUA 1IBKF 4UOHA 3X3NA 1U24A 3PQIA 1Q78A 2DXEA 2MJUA 4EFAC 2VB6A 3ET6B 5ETNA 3Q24A 1FWKA 3CJKA 2FVSA 3FC9A 4IUFA 4C3HB 5D3GA 4UAIA 4I7ZC 3I4LA 1UPPA 4Y65A 2K7KA 5M3MH 1UWAA 4C7QA 2LQ9A 2OPRA 1NB2A 4DL6A 2CQ1A 4NXML 1C0UB 1VQEA 3MEEB 1BGXT 2FINB 4YY3Q 3NWRA 5IY0A 3R2IA 3ONQA 3NS5A 5BYQA 4DL7A 2A69C 1UKUA 2R42A 3SSRA 2NR0A 1SROA 2NXCA 2UXBJ 2N78A 2MZ1A 2R9LA 1CC8A 1PYOB 3VAHA 4LMQD 5FLXL 4KI0A 1FXRA 3THPA 1HNZJ 2D74B 1TTHB 2GJFA 3CRKC 2DB1A 5J1EB 3FSIA 4LF7J 7AT1B 4ZLTF 1N88A 2XO7A 2ZKTA 1JE4A 2DNRA 5IQQA 1GNKA 1RP5A 3G6YA 3F44A 3V96A 1FKOA 2R8IA 4FXDA 2ZITA 2NVXH 4CZCA 1FYCA 3FKIG 4C2MB 2B8PA 2ZM6F 5TSSA 1BQNA 1EWIA 4A48A 4ZK7M 5GMEA 1CHQD 1RBAA 2F4VL 2J7KA 4FKYA 2NVTH 1QVFA 3TS2A 1VRQC 4GKKF 2UU9L 3OVSA 1Q81C 3QWPA 2WOMA 2VD3A 3AU7A 1DTQA 3IAM9 2I46A 4M1UB 3K8WA 1CQFA 4NYZA 1HLWA 1XMQL 2OCEA 3AMUA 1RISA 3H3VH 4DL0C 4IO1A 3I4MG 4ZP7A 4CLPA 5C25A 4J91A 1WACA 2MPMA 5AE1A 4DR4J 3CJ8A 2Z6KC 3OTDA 3IM8A 4RNNA 4OV1A 1ZA1B 4QUFA 3FRYA 3BEGB 3W3SA 2KM8C 1CA5A 3IWXA 3HI9A 2IHR1 4DF8A 2JXMB 2Q2TA 1Q8LA 1GTHA 4BA1I 4X3TA 1MROA 1I6JA 1KS2A 4DQIA 4LF2A 3MCNA 1A63A 1CC7A 1NNXA 2E76C 1A7GE 5F8LA 1ACMB 3MR2A 1BXTA 5LMUL 3HOWB 3KLEB 3R8YA 4MKVA 2B9WA 4C3IG 5I2YA 1TXYA 3D1OA 3QWNA 2UUAJ 3OLAA 3VAJA 3WX4A 2UUAQ 5DDPC 1TU2B 2X51A 3MMCA 5J2PA 2B6AA 2XZWA 1Z9FA 5BR8L 2W9CB 3R97A 1WI6A 5A8KB 2KO1A 4HI1A 4BC9A 3I87A 4A75A 3MPVA 3CCUS 3DDKA 3DOKB 1R0AA 4HVZA 5GAHU 3OUYA 2HK2A 1SEBD 5LOQA 3CO0P 1YJ9S 4L72B 3PO2B 4MTPA 3HOYH 1S1WA 3A8KE 5E3QA 4B3OB 5CYUA 3QIPB 3RB4A 4A3EB 1A9NB 4KK7A 3DOLA 1FJCA 1TWGH 2EG1A 3HFZB 1Y5NB 3KUGA 4OZ2A 2PEHA 4R4OA 5KNBA 3PRBA 2VUMG 2AUKA 2KDOA 1IZ6A 1H9JA 4Z7CA 1H9MA 1NY4A 4EEYA 3W3AA 2UUCQ 3MZ5A 2EYOA 3R5JB 3QGIA 5KYLA 1IKXA 3KYHC 1ZM2A 1GO3E 1VF5C 3DLHA 3J81U 1PTOH 3EXCX 5K14B 2F0NA 3UI2A 2E2JH 1FK9A 1OXXK 3OR2A 1RLDA 2BJ3A 2PT0A 4OI3A 4G65A 2YH1A 4F4YA 5HLFB 1IKVB 1SJ1A 3SCJE 4ZAIA 4YOEA 2HQIA 2A6MA 1YI2A 2HFUA 1X32A 5SUHA 2EFQA 3HLUA 4ZK9B 4KE5A 1F2MA 4KFBA 5J2MA 4ID5B 4I1TA 4WZMA 3WOFA 1X56A 1IN0A 2RVLA 4JI8J 3H3VC 3CTRA 3M4PA 3PYGA 1RKNA 5L1LA 1ZAXA 2HQFA 5M9OA 4KN4C 4ECVA 4QQBA 3MTJA 1FRLA 2EKNA 4A3KH 5KG3A 1XNQF 2LY7A 2B2UC 1HWLA 3DLLA 5A2QU 3RR5A 4B9SA 2J9EA 1U8WA 3RB3A 1R89A 3C16B 2XO6A 2AJ2A 3WZ0A 1VQ9S 3ILIA 1JXEA 3OIQA 3CCVA 4U673 1C2PA 1BWEA 1FFWB 3ZNUA 1SDFA 3H5UA 3KLWA 4I2QA 3ULPA 5ETTA 1XX8A 1JLCA 2GQ2A 5L9XA 3TVKA 3P5BP 2UP1A 2R2RA 2A18A 2J6UA 1Y11A 5C2CA 4CYUA 4DSJA 1S6QA 4DFPA 3E51A 1SNPA 5CR3A 1VYAA 2LDYA 2OPQA 3OJSA 1QZHA 4CCHA 2W7PA 1TWHB 4NEZA 1HNZL 1LM0A 3LP1A 4OI2A 3EIVA 2HVHA 2KCCA 2M8HA 1R8HA 1KSPA 3FCVA 2C2RA 4NLUA 4IUQA 1NXIA 2IL8A 5D0HA 4KHZA 2G13A 1XNRL 1WTFA 5E3RA 4YHHL 5KFNA 2XWJB 4Q2LA 4QU6A 4N56A 1W3SA 3TS0A 2I5MX 5K5PA 3S14H 2DGSA 3J80Y 4BWMA 4I4BA 4PXBA 2DH8A 4P2CB 3UDXA 3TX0A 4P7TA 2E2JB 2VFVA 5B0AA 3NBPA 5IWAQ 2M5YA 3IG1B 2BE5C 5LMUJ 2DR6A 5F9LA 4M5HA 3C14B 1S0MA 2V2VA 4ME5A 1AUDA 4FDBA 1WVLA 2DH9A 4K2KA 4QGUA 3HSDA 1RT3B 3LOUA 2E66A 5C3EG 3RAMA 4J9OA 3V2TA 3VYTA 2IFXA 2VODA 2F0FA 3PIOQ 5D3IB 1JLQB 3SCKE 2MZTA 2NVQH 2DBBA 2VPWB 4WTYA 1YGYA 4GZYC 1VQLS 2I5HA 2M8DB 4C9DA 2UUWA 1RT6B 2EBGA 3DI6A 4LRCA 4IH7A 2IHFA 5LL6S 4DGZA 5F8MA 3BKFA 4A3MB 2PYKA 5C42B 3NGKA 2EBEA 2ZJQQ 2KBNA 2FLNA 2O5DA 5U47A 3TRZA 1CULB 1VMPA 1P9YA 1CUKA 1BMQB 1N33Q 1P16A 3TA2A 2AGQA 2N3SA 1HPCA 4L73A 1IVZA 1EP4B 2XMVA 1A2UA 3PO2H 1SV5A 1I4PA 3PW0A 1PYBA 1BQMB 3IGNA 4NPSA 2OHDA 3BQ2A 1NB7A 1HQUB 4X84A 3JSMB 3BN7A 3QMQA 1KLMB 2JRSA 1Q7YT 1IXRA 1G7CB 4NI2B 2HYIB 3CCES 4LR9A 2HBRB 4ZOSA 4IR1A 2RCFA 5LJ3Y 3MUVP 2BDOA 3JTPA 3TP8A 3Q8DA 4H4OA 1NK0A 3S15B 3A3NB 3UD3P 3OXLA 3QQCD 3W2DA 4ZVHA 1RK8A 2UUBL 3NLCA 5JJIA 1NU4A 4X4OA 4DCJB 1QTMA 1FESA 5EKLA 1IR0A 3EMTA 1LTBD 3BDOA 1UAWA 4IG3A 2YNGB 3FMWA 4NCAA 2CW0C 1JLEA 4GOPA 3KLIB 2IJFA 3EXYA 4R9WA 1H38A 3K0XA 2RBMA 4DLEA 1RCVD 5FJ8H 4DUYL 2OAUA 3BB5A 4WE1B 1N34J 1KTVA 4ECSA 2RUSA 4NLTA 3S2HH 1LUZA 2C2OB 2K06A 2F0PA 1HFGA 3I0RB 4J5OA 4MZ9A 3V4IB 2XY6A 1WYDA 2DKOB 3AA9A 1UMJA 3KJQB 5EPKA 4HSVA 3K5MA 1Y00A 5HI7A 4ZVFA 1Q81T 1RACB 2FYXA 2AP6A 1I4HA 3OTOJ 4NLWA 4LRDA 4Z7YA 4NLOA 4DV0F 1HL6A 2E29A 2HWTA 3CXCR 2IJNA 4F87A 3PCOB 4X62L 2BE7D 3EICA 1NKBA 3DRSA 2HNYB 2Q8TA 3NUCA 3HRZC 2NB0A 2JEAI 4OX7A 2J8AA 2RKIA 4GOPC 4XIGS 2N4DA 4QR0A 1REGX 1WTWA 1LT3D 4ZCLA 3GIIA 2XSCA 3BH7B 2B2TC 5KFAA 2KOLA 4LREA 4BY7B 4XQJA 4EK2A 3MC0B 2IIHA 1UEUA 3KG1A 1GKHA 1RTIA 5C0XH 3FFIB 5IV3A 1BE4A 4S0MA 1EIFA 1H2VZ 3KUHA 3SGIA 4X4VA 4F88A 5EAYA 1X4FA 2HNDB 1YKWA 2W2QP 2J7UA 4USVA 4HAEA 1KEKA 4BWGB 2ZOFA 4YQWA 3D1QA 2B56A 4HIKA 1Y1VB 3S1NH 2H5IB 1MMLA 3JYTB 1VQSA 2M9KA 5HMXA 5KG5A 4FDFA 5L1KA 1R31A 2K1BA 2FD2A 4WIQA 4DFAA 5DEHA 2PW5A 2YXLA 3BGRB 1TR0A 1WG5A 1TV6B 1XWLA 3KLFB 3P5TL 2RNEA 1NK5A 1F6TA 2A1BA 1ICEB 1KOHA 1S5ZA 4X4SA 1IBKJ 4YB7A 1F9HA 4G6VB 4TSSA 4YB6A 3H42A 1KQGB 5J22A 3KMQA 1P1TA 4LUBA 1ZBTA 4J37A 3PACA 4C3IB 3EVWA 3OFHA 1VQDA 1LV5A 4JI5L 2JDJA 3M8QB 3W62A 4WJ3M 2F0MA 4GKKQ 4MMOA 2KHCA 5BN3A 3VDYA 1RXOB 2OMOA 3MMJA 4I6AA 2AX1A 4G1IA 1U6BA 2JL9A 4LF6L 2HHHL 2CJQA 1L2FA 1V1PB 4ED3A 2Q8IB 3HULA 2L1BA 3FZ2A 1DOMA 4P2SA 4IFYA 4DX7A 3HOWH 1C7YA 4DEZA 4RUCA 2WINB 2MPUA 2K5QA 3NQIA 1FVIA 2NYHA 3D0HE 2EYHA 3KK7A 1V9PA 1NH8A 2J0SD 3VV2B 5F2DA 4CH1A 2V2QA 5ETKA 3BPDA 1JB7A 4QCLA 2QT7A 1D5MC 1T11A 2CDQA 3OTOF 2BEFA 2PMZD 1EEFD 1YVCA 2RU3A 2Z8QA 1A3VA 1SH0A 3D3BJ 2L4NA 5JJZA 3D7SB 1FKAF 3W8PA 2QF7A 1Q4RA 3PIO3 2E44A 1WORA 4BDPA 3PKMA 4RAUC 1NCVA 1RTOA 2F0SA 5DZ7A 2HFZA 4JV5L 4HMIA 1UZDA 1PCAA 3GE9A 5KFMA 4Z37A 4ZIVA 2AEMA 2E8GA 3M32B 4PXEA 4AE5A 5FDLB 3I73A 2OXPA 4KHPJ 4LT6A 4IPGA 2O3DA 2CJBA 3CT9A 5T41A 2LKVA 1VQJA 2XMTA 1NDPA 4XIUA 2QKIC 3P20A 4Y2CA 4K2LA 5CYMB 2YKQA 2ILZA 1RD9D 4LQ3A 3VQTA 3V5RA 1EFWA 2V67A 4QL5A 2OJ3A 2QEXS 4XPEA 1VQ7S 1L3UA 4JYAQ 3RZDB 2F3JA 5ELNA 2QRRA 3I96A 2YNIB 2EZVA 9ATCB 5KG6A 4A4IA 3KFUA 1H3DA 4ZRZA 5HGTA 3C19A 2BR0A 4WFZA 2HDLA 3UD4P 3ITHB 2JA7G 3BVZA 4FYYB 1RT7B 2NZOA 5IM0A 3OR1B 1RT4A 4LF5J 4JV1A 3VGSA 1OYEA 2F4IA 2V2ZA 2MYFA 3ZZPA 4EX5A 1YBTA 2UU9J 2HZVA 2KT5A 4FYDA 3DRRB 5JVH3 5F8JA 2NZ4A 3ND9A 4PCQA 1TIID 5J1PA 4KKTA 3VCDA 5EWFA 2IM2A 3P45B 2VB2X 4MIAA 1I6HH 4X62J 2BE2B 1S5CD 5FJ8G 4DL2A 3L0OA 4OGQC 2XGQA 2BJEA 4B02A 4CKCA 2WSFC 5HO4A 5KT6A 1PH6A 2MSTA 1MKHA 1I94L 2GMHA 4O44B 4HSPA 4LF6F 3D1HA 1RI7A 3E9IA 4UUWA 3PV8A 1LV9A 4UOFA 3Q2SC 3TANA 5ELCA 4CLWA 1ZYQA 1RYSA 1BF4A 1YRUA 1NHKL 2PI4A 1B0TA 3JTNA 1CZWA 3FSXA 3LWLA 2WCXA 2LYVA 1SC1B 2C22A 1T3NA 3D4WA 3BV8A 3BGUA 5DAUA 5IE8A 2JX2A 1JLBB 2K03A 1WSVA 4QYZJ 4PG4A 1BR9A 4ZIWA 1JNZB 3TP6A 1R8BA 1S4EA 4DR4Q 4JOIA 3OQ2A 3VVUA 2BMBA 3LF0A 2BANB 1Y1VH 4RUAA 1HCZA 2YNHA 4CBVA 2LLZA 4UZCA 3NGDA 1TAUA 3DOMB 3TEGA 4WXOA 4IKAA 4A8OA 1DJ0A 4QWCA 5KTQA 3CAMA 3QZ8A 4O0AA 2DPIA 3D67A 2KUMA 3GV8B 3EJMA 4U7UK 3RR7A 2OQ0A 1M8AA 4XT3B 3L7UA 3SVMA 4MIBA 4C0OC 4LNQA 5B7WA 5ETQA 3ENAA 3N5BA 1NSAA 1I3OB 3M2RA 3BZCA 3UD5A 1OPIA 3NXWA 1N5SA 1I1GA 2ASLA 1RWWB 2L48A 2NSBA 2V5HG 4EVOA 1K1QA 4ZVEA 3TZYA 5BN5A 5M3FH 5CQGA 1HQRD 1XNQJ 3CD0A 4IOBA 3UDCA 3O8WA 2HHVA 5IFMA 3I2ZA 3M2UA 4CDEC 4KHPF 1II3A 3BGLA 2IDEA 4EO6A 1XMQF 1FJEB 3W1GA 1N32Q 2HWIA 3H2UB 3MXNB 1DCZA 2FVCA 4A8MP 5HVHA 2AYBA 1ASYA 2MQPA 1HNWF 4KKUA 3GR1A 3HOXB 3IXQA 4Y28C 3QT7A 3ZZUA 4NLQA 4WKRA 1HH2P 2MHEA 2R92G 1X5TA 2B4OA 3HOUG 4CNZA 5EGTA 2NVTB 3BSAA 3ZC4A 4ETZA 3H40A 2Y8WA 4MT1A 4KQZA 1HBOB 1TKWB 5IWAJ 2IY5B 2B2VC 2QYCA 3D4RA 4YIJA 1U9RA 4WP3A 4QF4A 4YB5A 1ZETA 3HHNB 1OO9B 2IC3B 2W2NP 2EFNA 5IT9E 2EFGA 1S77D 3PXGa 1PTOD 2RD5C 1PO6A 2EY2A 1RT5A 4F4WA 2HFNA 3CDBA 3BO2A 2OT2A 3S17H 5BYRA 5B0CA 2R8GA 3IWLA 4NYOA 1HI8A 2Z56B 2V8VA 3ILLA 3MEGA 3W9HA 1X65A 3IN5A 4E2FB 1KABA 4WU3A 3R3TA 1OSDA 4NKLA 3KDFA 4FXWA 3QJLA 2JA8G 1WTVA 1CJVA 1BQQT 1OJ4A 4OLOA 3KJOA 1SE8A 3PIP3 4WYWA 1QVGA 2GO8A 4Q44A 1PRTD 4LIWA 1WUUA 1PA6A 2KM8B 3H4DA 4GS3A 1KDBA 4LBIA 3H25A 1D9AA 5B0EA 2XQCA 1JLGA 1TQLA 3E9HA 1ZPWX 4OO1G 3HD2A 1CJTA 2DGXA 5T7LB 1Q5VA 3KJNB 1TS4A 1PH3A 2EVZA 2ZTDA 5L1JA 2Z9HA 4YDXA 3K81C 2M52A 4OI0A 5KT5A 3C66A 2X3DA 3LP0B 3M8PB 1SMXA 1EIGA 3MD3A 1M90C 3MFYA 1EYGA 2DCUB 4LUOA 1FXLA 4JI1Q 1BQXA 4OI4A 3MR7A 2NQPA 3RR8A 1YNND 1UPMB 4LF5L 4DN4M 1JNRB 3DN9A 5DZ6A 2W01A 2V34A 1SUQB 5JMNA 4DV3L 2AZ3A 3VAKA 3UVJA 3N0VA 3DM2B 3EZOA 1N36J 3W5YA 1LK7A 1JWSD 4X66F 2H5EA 4KPCA 4QW9A 3GD7A 1RA7A 2WTFA 4K0KJ 1IL2A 1F2GA 4PXCA 1F9FA 5KFOA 3AEVA 5M2UA 1EQMA 3M30A 5BYSA 2E5JA 2WVFA 2Z8LA 3OTCA 2LXUA 5E1FA 3RLFA 2CW0D 1T8EA 3PIPA 4ZVPB 1VHIA 1Q8IA 2PD1A 2R92H 1WF2A 4DKAC 4OI1A 2RT3A 1FWPA 1E24A 4UZBA 2D41A 3M6UA 1HTPA 3K6OA 1CKMA 4DBQA 2C28A 2IVMA 5IC6B 3GLJA 2RCNA 2BQRA 3KG4A 2EY1A 3CC7A 5LL6X 1TVRB 2QZ8A 2ACMA 1JJGA 3B82A 2DGTA 4ZLLA 3GZ7A 2Z30B 2BKOA 1HBMA 2DJFC 4B9XA 2BUNA 4R4IA 3DUZA 1VQKA 3Q23A 1DONA 2M2LA 4PZ6A 2G0JA 3CDUA 3GP9A 1FRXA 5IS2A 5M5WB 2H9ZA 5COYA 4JVZA 4AQYL 2UXDQ 1XMBA 4OZJA 1B1ZA 1HW9A 5J3BA 2L15A 5E33A 1DM0B 3Q8SB 4F4XA 3GFHA 3FEZA 1QLNA 1FRJA 1S1VB 1U0LA 4TU9A 2UVUA 3DRXA 3Q8PB 1VC5A 3DNCA 1Q1BA 3HHKA 3T1YJ 3R2TA 3H94A 5HQLA 3ISZA 1C4AA 4YEAA 3PGZA 2COLA 2AGPA 2HVEA 4A3LG 5DS7A 3DRPB 3JAMU 2FVRA 3ZNJ1 1XNQL 2RA4A 2CPZA 1S9EA 1G2SA 5LMNQ 5JVG3 3ISND 2DPJA 1HYSB 4P10A 5KFSA 1TKZB 2CPIA 2IAJA 1WCMG 1TK5A 3KKFA 4OZLA 2F0HA 3OYYA 1G2TA 2JEFA 2HPUA 3D6MB 2NPFA 1XEZA 4NX9A 2DR9A 1SNOA 1HRJA 4ZYSA 1HBUB 3W1BA 4JOUA 4Q7AA 2DNZA 2BQUA 2EXZA 3EA6A 3F2CA 2OTLA 3L4BC 4RBVA 1CKNA 5M5YH 1X54A 3G71A 4IFDI 4TKTA 1S1UB 2CQGA 1MJCA 4DR6Q 2QC3A 3SV3A 1HFNA 3AODA 5D77A 3SZ2A 3PUVA 4WFNQ 3L7ZC 3MWBA 1V3RA 5K8PA 3K58A 3QPIA 4LRAA 3PYEA 1N36F 2LMIA 4DV0Q 2VBYA 3A8IE 2CPJA 1F5CA 2E7VA 4Q45A 3H98A 3J7Z5 5IODA 3MR6A 2A68C 2UUTA 2VA3A 1X3PA 2XULA 2ASJA 1B44D 3T6JA 3OPKA 2MZQA 4G4KA 1ULRA 5K8OA 3AT1B 1J5EF 2EXDA 4C3IH 3A8IA 3AJ1A 2FDNA 4CHTB 1T9HA 5A0YB 2YX4A 2IW3A 2ZJRQ 3FBFA 5MLCV 2Z4PA 1R9TH 2KEEA 3H0GB 4LFAJ 2MZSA 2QSWA 4B3MF 5CYQB 5A0YA 4ZMMA 2KL8A 3KDNA 4JI2F 4TU8A 4N76A 2Z1CA 1K0RA 4ER8A 5GAGI 1NJZA 3TZDA 4URGA 1JCKB 1Y3KA 2HZAA 3K59A 2N7YA 4ECTA 4ILMA 1YNNC 1IKWB 4NDXA 4M5KA 1AH9A 1S5BD 4NMLA 3SMZA 2J7WA 1E1TA 1VQBA 3VWSA 1HMVA 2YVSA 3EFXD 2CA9A 1YNJD 1XPUA 1SL1A 2EW9A 1I3QB 3RLNA 4K4SA 2K33A 3NTKA 3KOAA 3QGGA 1LLRD 1HPZB 1QAJA 3T1YF 4ZPBA 4RGNA 3CD7A 2JEBI 1CQVA 2V0NA 2CYYA 5F0WA 1X8DA 1CKNB 4BY7H 1R8AA 3P1HA 3NKYA 4KR0B 2V94A 3PX0A 3OVBA 4CDIA 4CIOA 5KFYA 2AD9A 1RT1B 4AQYJ 2CAJA 3HFVA 1HHQA 4DR3L 4POGA 3GYNA 1WD6A 4DQRA 1SRUA 4WU2A 2H5JB 4GVLA 2VQEF 4GKKJ 1C48A 5DRKA 3BBBA 2HGMA 2PQAB 2F0EA 2B9XA 5IT9U 1HHVA 3EVOA 2WB1G 4ATNA 4J9KA 2IAJB 2HAIA 3I82A 1N56A 2HLUA 1BCPB 3GFXA 2Y0SG 3QNWB 4K8RA 4M5DB 3MWYW 2JA9A 1LYLA 1R4PB 3EUNA 4GLXA 1WC3A 2QEXA 2G2ZA 2DISA 4NMZA 1AEXA 3CJSA 1K9MT 1FRKA 4FXGC 1RAAB 1NDLA 2L5TA 3KUPA 1RTHB 1CK1A 5FLXE 1I50H 1XTCD 2AZ1A 2UUCL 3GJRB 1S1VA 4KO0A 5JOBA 4ICLB 1PYSB 4LF5F 1UA0A 3OV7A 4ECQA 1Y4ZB 4O1NA 5I6YA 1LW0B 3GTOH 1GMUA 5GAEI 3S1RB 5DETA 4AYBB 1EETA 1T9WA 4FVCA 4C1NI 3T4AC 4A3MH 2CIMA 1TS2A 2P9EA 3JAMi 3I4NH 1G51A 3LNNA 1B99A 2VKZG 6FD1A 2EIFA 1DLOB 4X62F 3RB6A 2K4KA 3TMEA 1YRTA 1TVRA 2YYZA 1RAEB 1TL1B 3KHLA 4DL4A 4X64J 2K8GA 1OY9A 4QR1A 2MO0A 3E6ZX 5ETMA 4IPCA 1JOOA 1K83H 2IX3A 2GGPB 4EGVA 1Y8NB 4JI2Q 2W25A 1QD1A 3I3CA 2ZC4A 1NK9A 2BW7A 3I4HX 1LTAD 2BA1A 4PNYA 1Y5IB 3OFFA 3G86A 1SL2A 2VQEL 2ZM6L 1N33F 3NGUA 5AT1B 4CTAA 5HMWA 2O1PA 5D4LA 2FZCB 4NA2A 3E01B 3DRYA 1S57A 4G1QA 2QLFB 1YJRA 2W24A 2WVDA 1KAAA<