3E3XA

The c-terminal part of bipa protein from vibrio parahaemolyticus rimd 2210633
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
300
structure length
278
Chain Sequence
VDEPTVTMTFQVNTSPFAGEGFVTSRNILERLEKELVHNVALRVEQTDDPDKFRVSGRGELHLSILIENMRREGFELAVSRPEVIIEEDGQLMEPFETVTIDVMEEHQGGIMENIGLRGELDMAPDGKGRVRMDFIMPSRGLIGFQTEFMTLTSGSGLLYHTFDHYGPHGGNIGQRVNGVLIANAAGKALTNALFNLQERGRLFIGHGVEVYEGMVIGIHSRDNDLTVNALKAQVLTPPIVMTLEQALEFIDDDELVEVTPESIRIRKFLTESDRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BipA
publication title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
total genus 68
structure length 278
sequence length 300
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 3e3xA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3e3xA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 3e3xA01
4ZCIA 2L9NA 4ES1A 1WDTA 4MAKA 1ZM2A 3LH2S 1ZM9A 2EFGA 2WBMA 2YWFA 3ZZUA 1KTVA 2BV3A 1N0UA 4ES3A 4QR2A 2KDOA 4QR1A 3E3XA 1ELOA 4QR0A 2CVEA 1FNMA 3EXCX 4FN5A 2J7KA 4TNOA 3ZZ0A 4MYUA 1ZM4A 2I8EA 2BM1A 2DY1A 4ZCKA 1T95A 4ES2A 4MYTA 2YWHA 3CB4A 1N0VC 2I0XA 3UI3A 2E1RA 1ZM3A 4ZCLA 3B78A 1ZPWX 2ZITA 3OQ2A 1DARA 2NPFA 2YWGA 4ZCMA 2YWEA 2BM0A 2IVYA 1VI7A 1U2RA 2XEXA 3ZZTA 3B82A 5G4DA 1P9QC 3B8HA 4M1KA
chains in the Genus database with same CATH superfamily
1IHZA 2MLYA 1EYDA 1M0SA 3BKFA 3UDGA 1PC5A 3M8WA 5HO4A 1RAJA 1HR0L 3VAGA 1N36Q 3SDEB 3JSMB 2NZ1D 3JSYA 2CKWA 5COYA 3K58A 2I5JB 1REGX 3D3CJ 1KRPA 2RUGA 4XPEA 4EYIB 2D7SA 1UA1A 3CC4A 2H5JB 5EUHA 4ED0A 2R2SA 1FRLA 3ULPA 1LXJA 1U25A 3W1BA 2EYJA 2NREA 2NVTH 4CNYA 1LT3D 1FHTA 1SH2A 1U26A 1H2UX 4J15A 1X8DA 3I9ZA 1P9QC 4B3SL 4A4JA 4A46A 2GJIA 2QF7A 2WKCA 4JI2L 4MIAA 4HJ9A 3I72A 4JI0L 1HNVB 2DR9A 3E51A 4W98A 4B3RF 3NP5A 3T5KA 1TFWA 1RT4A 3HVWA 3BR8A 2ZE2B 4WJWA 1NUEA 4K50A 2R7DA 4U9RA 3MUTP 3ZFVA 1DLOA 4YHHQ 1GX5A 3M9BA 5B08A 1LO5D 3CDBA 3PKMA 1JNRB 8AT1B 1MSHA 1JXVA 5FLXc 2CZ4A 4RCNA 4A3KG 2HNYB 2IX0A 4FYVB 1F2ZA 3MM5A 5DS7A 1PILA 5C5LA 3VAFA 3HO1A 3MM7B 5LXRA 1Q82T 3CCJA 3F41A 3DDNA 3NENA 5DQGA 3E9IA 4OZ1A 2QYGA 2CVRA 1Y10A 3I90A 1NB2A 3HP3A 4GN3B 1S77D 4ZPDA 3DI6A 4KHRA 4A3EH 2XMKA 2WONA 4UP7A 1TWCH 3LGMA 4CJ0B 3ZTQA 4EO8A 2CWXA 4HI1A 2DGOA 4USIA 3LX0A 2QV6A 2I0QA 2KXNB 3RBEA 4E0DA 1TWHH 4X4UA 4DMZA 6FD1A 5F8NA 2GNKA 3RUBL 2RE1A 3TUZC 1UWVA 5CV9A 4DKAC 5CCLA 1ILPA 4IO9A 1LTTD 2G9DA 2BV3A 5I2XA 1HA6A 3G71A 1VMPA 3QB3A 3DLHA 1ZS6A 2B63H 4I2QA 4ID5A 4FVMA 4B3RJ 3QG1A 2R93B 1A15A 4CH0S 1C4QA 2GJ2A 1B0VA 4JBCA 1R3NA 4OZ3A 3D66A 2J0SD 3DGPB 4DN4M 3MGJA 1Y1VH 3HFVA 1AE2A 3FQKA 1E24A 3OSOA 4ELVA 1RU1A 3J81c 2YX1A 4J91A 4NLSA 1MN7A 4DSLA 3CD6A 5LT5A 1V1PA 4PG4A 1S57A 3NG8A 1RAAB 3UW1A 5HVHA 2R7VA 4U96A 2LEBA 3AMUA 1CJUB 4CLTA 1CSJA 3HMJG 1SR3A 2KUMA 2JNJA 1BHNA 4BWGB 2IRYA 1NR4A 2RBMA 4OL7A 4ZPAA 1NRKA 3NTHA 2YX7A 3Q8YA 5C4JB 3S1QB 1OXUA 4OX7A 4K0KF 5FO7B 2EVZA 1GUWA 4DSJA 4DXLA 4X65Q 3OFHA 4A8YA 1EKSA 2VS1A 3I4MG 4K4UA 2CQ2A 3N4WA 3W5XA 3MD1A 4IOCA 1G2TA 3QR8A 4DX6A 1QZGA 2VPYB 1SJQA 3PACA 1PZKD 1FNOA 3ENWA 1I51B 2XWXA 3GTKH 2I5LX 1EJ7L 1TIID 4FF3A 1STAA 5J3BA 2KENA 4OXPA 3T4AC 3NMAA 2YWWA 2RAQA 5DG9A 4CO2A 3CCMA 3HVTB 1V8QA 4NCBA 3HX9A 5C42A 3CT9A 1FEHA 2M00A 5JJIA 2NZ4A 3TZDA 1VQPA 1QVFA 3FPUB 2JL9A 2ZH3A 3HF5A 3VAHA 3X1LB 4P2CB 2DR6A 3BGOP 5A8RB 2N4CA 3DRPA 4M5KA 2ASJA 3BQ1A 4BDPA 5FLMH 1O78A 3CCQS 3J81Y 1RTHA 2BDNA 4ICLA 4K8JA 1TWFB 2FVRA 2ZDPA 4DV0Q 1PYWD 1E7ZA 2DNHA 2CQ4A 2JA7B 2W2NP 3JQJA 1KBRA 2YNHA 4URGA 3M4OH 2WAQE 2C2EA 3IKJA 2AHOB 1UVKA 1T8EA 2CWAA 4LFAQ 1ZA2B 1WTOA 2HKEA 2BH8A 1YG0A 3W2VA 5KAKA 1F1BB 2ZBCA 3C3LA 1K83H 3RTVA 3PX6A 4JI5Q 1KHVA 1LNQA 4K0KJ 5EBCA 3C16A 1RA6A 4NLGA 4GO7X 5HN0A 3AHPA 1K8GA 3DLEA 4Y2KA 3KLWA 5EKIA 2QO3A 3OXFA 4Q45A 3MM9B 4FO2A 2NVXH 4YY3F 2GN5A 3QO2A 3RUZA 3DWAA 3EJIA 3ERQA 4A3BB 4XAKA 2MQLA 3S1TA 3W62A 2K28A 5RUBA 1UW4A 4CKBA 1CC8A 1RTZA 2IRXA 2I5HA 1QSLA 5HQLA 1ZM4A 2EXZA 3R5BA 2VG7B 2DD8S 2I0XA 4C3HB 1U4RA 2HZVA 3FBEA 1ZZNA 6AT1B 4CH7A 3OSNA 1QJOA 1H2TZ 2YKOA 4YN3B 1T94A 5LJ3Y 4G7OC 3MM6A 3MR6A 1ZAWA 4RW8B 1VBZA 4ILMA 3UCUP 3MHBA 1KVJA 2ASYA 5KT2A 1V3ZA 2V4QA 3HP6A 4TLRA 4C0BA 3VR2A 1NHVA 5J2MB 4DXFA 2WRMA 2UXCF 2OKQA 3CCLS 1FRHA 5BXIA 2EFQA 5GAGC 1X55A 4DGZA 2VONA 1V3SA 1FERA 2Z1CA 5DLQE 2A0FB 2ZH6A 4U67Q 2V69A 4X3UA 1B8AA 2DITA 3VQTA 1HZCA 3J7A1 2B5JA 5KT5A 3T1YF 4K8RA 5HMWA 1KOOA 3LUYA 2ATWA 2LQBA 1YJNA 4K5WA 4A3DB 4EQOA 5K14B 4O3RA 1HQUA 4DV2L 4DXGA 3AAWB 3LP2A 3QJPA 1YHBA 4PG3A 1G51A 4DUYJ 2JLFA 2V8VA 2YKAA 2DNKA 5KFYA 1KHWA 4C8ZA 2BKPA 3I87A 2XHWA 2X1AA 4L5SA 1LFWA 4QWEA 3R93A 4MHEA 3BVZA 5D6GA 2OT2A 2AW0A 1B53A 1X4AA 2MO0A 4IG0B 3WX4A 4DBQA 4IQZA 3LW5C 3I56S 4HHJA 2ZJRA 2GGPA 2LQ5A 1SBBB 5EQ0A 1YSJA 1IYUA 4OX9L 3ERSX 3BPDA 3Q89A 2HGNA 3TEHB 5CYMA 2OTJS 1VYAA 2YQ0A 1TK5A 1GTHA 4JP8A 1WJJA 3GG0A 4HEA9 2E9RX 4C6AA 5E3CA 3RRGA 3NS5A 2MZTA 3PIOA 1F6TA 4B3TQ 4CLWA 1U1LA 4IFDH 2IC3B 4RWSC 4ODGA 2HHWA 1CKOA 3G8SA 4DSKA 4C3IB 1GNKA 2YH0A 1FJCA 1WCMH 4P73A 2HUGA 2FJWA 2FZCB 1FE4A 2YBVA 1GUNA 1SJED 3J80U 3FPPA 2VNUD 3AQQA 2XGQA 4A3MH 1F2GA 3AXKA 1D8LA 3BYRA 4ZLNA 1H9KA 5GAEI 2AJ4A 3TUPA 3T1YJ 3M2VB 3V4IB 3PCOB 2VBZA 4K0KL 2HQCA 1T9XA 4EYHB 1CQFA 4J37A 1HRJA 3TZWA 5F2DA 1JKHB 5D0GA 1X5TA 2Z6BA 1CKNB 4X66J 4Y52H 4OIKA 3VR4A 3HOYG 7FDRA 2JH3A 1VRUA 4NYZA 2EEYA 3KOJA 2C2OB 1ACMB 1TR5A 2RRBA 4MKVA 5DDPC 1UETA 1MU2A 1R9TH 2QGFB 1FNUA 1WYDA 3J7Z5 1NZAA 1XX8A 1NLKL 2ZH4A 2RDDA 2FZGB 3QBCA 1YGYA 2B2UA 4LUZA 3X3UA 3VV2B 1DQAA 3AH6A 4LF8F 2AUKA 1S5BD 2JA8H 2DRAA 3AYHB 1SMYD 5K9FA 2CJ9A 1OWXA 1HJPA 1KTVA 2DGSA 3BU2A 2NTTA 2ICEC 3OT9A 2IMOA 3MAQA 3S2DB 4Q0BA 2RDHA 3PEJA 3BQ0A 1UEVA 3V05A 3QRPA 3PUWA 3NQTA 4KKSA 3CDAA 5CABA 5IT4A 1YHAA 3CCSA 3MM8B 2P2CB 2CJKA 4LUVA 1NKCA 2D2CC 1UA0A 2L55A 3KFUA 4UW2A 4CQ1A 2ID0A 4F50A 4LFCQ 1YIJS 4U6PA 2Y0SE 2AYGA 4HH0A 5A8KA 4AQYF 1TWGH 3VDYA 5ELBA 1RTJA 2F03A 2RDGA 2N49A 1KAAA 2DH8A 1KONA 4R4IA 3CRLC 3ZTSA 2GQ2A 1GUGA 5ETVA 1FRXA 1WACA 1X4GA 2EFOA 5BN4A 1RHJB 2R3VA 4XDDA 3IAYA 4YCVA 2DGWA 1LM0A 3QLHA 5A6WA 1D1KA 4JI4F 4DUYL 3MEHA 3ZZZA 3GCXP 4IR1A 2ZBQA 1L1OA 1I6HH 2F0SA 1YJ7A 1VQIA 4B3OA 5EHHA 3KLEA 1TQLA 2LDIA 2BQ3A 1EL0A 1AZSB 3UDEA 3PO2H 4CDDC 5LXYA 4ECWA 5KIXA 5JEAH 1TL3A 5CYQA 1VDZA 1XIQA 3M4QA 4HHUA 2DEIA 4P72A 2DNYA 4DUZQ 1BGXT 3PYGA 4ZP6A 4FYYB 3S1MB 2D9UA 3W65A 4DEZA 3A12A 3EA6A 2D0PA 3MEGB 1H95A 3ULHA 3U1LA 1OS5A 2QFJA 2VZ9A 4DL6A 3B54A 4RAUC 4DV6Q 2WAQB 3HI9A 1HUNA 3QO9B 4BY1G 1FX4A 1JLAA 1C0UB 2LQ8A 4WE1A 2NCKL 3CPFA 3ZZRA 5A35A 4J9OA 3H59A 3FFIB 3IRXB 5HSPA 4ED7A 4IALA 2W4CA 2YU9B 2XY7A 2VC0A 1M90T 2VFRA 1S79A 2K05A 4QZVB 3DRSB 4AQYJ 3R27A 1SKWA 4ZHRB 4XQJA 1SDFA 1G2EA 5T7LA 2Z30B 1U45A 2ACYA 2DISA 4CLZA 4Y7NB 4MJKA 5AE1A 4CLFA 1Z7TA 1PRTF 4NXNQ 4A3FG 2HWTA 2J0WA 1WG4A 3GTLB 4ZYSA 4X66L 5LMNF 4WK1A 1RAHB 3FZBA 1JWSD 2C3UA 3UO0A 1LKZA 2LQJA 4JI4J 3ND9A 2YKQA 1VQCA 1LWFB 3M6VA 1VCIA 3I6PA 3QOLA 4EBDA 1BQNB 1N54B 1XXGA 1NR2A 1U0HA 1WDTA 2OLWA 4TU9A 1STGA 4WJ3M 5BJRA 5HAOA 2AQ4A 1GOZA 1FR3A 4JI1Q 1MW7A 3UDVA 4JYAQ 4Y2MA 1IBMF 1XPOA 1FEEA 4FPRA 4BBRG 1PCAA 3PRDA 1GK8A 5M5YB 3ELHA 2RT3A 3TAMA 1RIPA 1QSYA 3GV6A 1WC6A 2C9OA 4DV4F 1I4HA 4OYMA 1MIUA 4MTPA 2E9TA 4YWKA 4TVAB 4C7QA 2JEAI 1GMWA 1E6YB 3NEKA 2MPMA 3CRKC 3NLCA 2FGCA 2V4JA 3GV8B 3SEBA 1SNPA 4YP3A 1JOKA 3UDXA 4UHVA 3OIPA 5IODA 4LF9Q 5HI7A 3W5ZA 4EX5A 1YJVA 4IOAQ 3BZKA 4LJZC 1I94L 4M5HA 3KK2A 3GIRA 4LQ9A 3RW6A 1SROA 5D0HA 4RW6A 4KV6A 3STBD 4CNZA 2OGUA 2IW3A 2XZWA 5IXUA 2LXIA 1BO0A 1U7LA 4DR1F 5LMNJ 3R2DJ 4N77A 2Z2LA 4FKXA 4Y34A 2W4DA 2XY6A 2ZFHA 4G1QB 1YHQS 3UD4P 1AROP 4G6VB 4ZK9B 3H94A 2VG5B 2B4UA 2EDGA 3OTEA 4DF4A 1BCPF 4CHTB 2ZBPA 1DJ0A 2PYKA 3PUVA 2R8IA 1DD2A 2MQNA 2HHXA 5HQ8A 1HA1A 2F0TA 5C0XH 2E2HH 2D3ZA 3POTB 3K57A 2CUYA 1JLBB 4ZRZA 1IBMJ 3U02A 3FKIH 4UOGA 4ZVSB 3TOQA 1FKPB 2J7ZA 4RW4B 4L5RC 3W9IA 4HIMA 4R4OA 4YQWA 4USMA 1HPZA 4DV4J 1PRTC 3DXSX 1HI8A 4NZ7A 2I6WA 1EWCA 3DOKA 4OI0A 3D0FA 4DR7F 1YK9A 3E01B 1AFIA 4R8UA 1JXLA 3PO4A 2HIXA 3OVAA 1L0YB 4L6V3 3P6YC 1VMCA 1JLQA 4LMZA 4I56A 1O7LA 3HOWG 3BGLA 3OBIA 1RI7A 2XMVA 3BVMA 4EU0A 1PFNA 2VG6B 4ANDA 3ITHA 4ANCA 4H13C 2L08A 2VKRA 4FNFA 2CPEA 1RTIA 2V2ZA 5I42B 1IM4A 1NDLA 5CD4A 2QMUB 5EWGA 3RLOA 1DOMA 1SUQB 1XTZA 4UQGA 2OPRB 3Q23A 4QR2A 4JI4L 4C8LA 1I50B 2MKJA 1N34F 4RHRA 2GQQA 5A2QE 3AODA 1IBLL 3W64A 1VQMS 2XS7A 1PH7A 3DU5A 4AT1B 4RU9A 1FXLA 2XSJB 4JI7F 3D0GE 2F0WA 3D6TB 3HSDA 5HANA 3FK4A 1S48A 2HIVA 2JVRA 4DG1A 1OPIA 4IH7A 4LSNB 1EY6A 1YNXA 2QCPX 2XO7A 2P5ZX 3R7NB 4KD4A 3FCWA 4ED8A 1VQLS 4CLLA 2PNHA 3D67A 1S0OA 2J4XA 2F8HA 4A3BG 3MMBB 2NSBA 5KTQA 2R92B 2AIRB 4ZKAA 1VMBA 4X4OA 5KT6A 2HNZA 2YYZA 3BS1A 4Y00A 4PG5A 8RUCA 2Y0SB 1TL1B 4QOTA 3C14A 1NJIC 3GTMB 1TR0A 1BCPC 1JLFB 4P9SA 3AT1B 3OTOQ 2E44A 3GTPB 4KGKA 3I31A 2PEHA 2RF2B 3L7UA 3GD7A 1TXYA 3ONAB 4IQMA 1S7IA 3M4PA 2J9DE 3C6UB 1VJWA 3LALA 2ZKTA 1LWEA 1HBOB 3LA0A 3A3PB 1C2PA 1S6QA 1T9TA 2HHVA 3K7AB 1RAFB 4F3MA 3C15A 1VQEA 5K20B 3TJ9A 3KOAA 4A3KH 3CJQA 4I6WA 1HFEL 1REVB 3AB4B 5A76A 2MNAA 3I0RA 3CD0A 2IM3A 3NBHA 3MCOA 4NLDA 4ZKBB 1NPKA 1N34J 4XQNA 4B3MQ 4A8OA 2E5LJ 1HFNA 2Y0BB 4QCLA 4JI3F 2QA4G 5KFLA 4B9MA 1D9FA 4GNXC 4KV8A 4R5PA 4BS9A 4QWBA 3BDEA 3LPEA 5FLXE 4A3DG 3I4OA 1HWUA 4ZVQB 1IKYB 1AFJA 2IWHA 1S1VA 3CCTA 4HJ8A 4UOHA 1EY8A 4UT4A 1VRQC 3CSKA 2Z9HA 2DNRA 1HMVB 1RT1A 3SYZA 1LTLA 2ZH8A 2KA7A 1Z2ZA 2XNRA 3OPOA 5KFGA 4N5SA 2AJ1A 5D77A 1GUTA 4TKTA 2EC0A 1RWUA 2C3MA 4P2FA 3BPSP 3F1ZA 1T9YA 1UVNA 2D69A 4CIOA 1TL7A 3OWFA 2NXJA 5KFIA 2G2ZA 2ATCB 4P71A 1JWMD 3MAAA 5JJZA 2XYHB 4Z2XA 2XB2D 1IKWB 3IL8A 1I3QB 4RUHA 3KLHB 2DHHA 3HHNB 3NPPA 1TV6A 3JC66 3SCJE 3DYAB 2M2BA 4OYXA 4GZYC 1HZBA 2R7WA 3TYTA 3SDEA 2HQ3A 4ZCIA 1QE1B 3JSMA 2RQKA 3ZTOA 2F0QA 3PYDA 2I5JA 4PG6A 3MAHA 2ZJPQ 1PZID 3QGIA 1RHUB 4DV3Q 4RLEA 3FEYB 4UTGA 2DEJA 1FWLA 3PRBA 3DOLB 4LF2A 3GIIA 4JI3J 4XXEA 1NCVA 2KVQE 1NNXA 3J81E 2RQXA 4PG8A 2MJNA 4WP9A 1Q81C 4N56A 3I4MH 3G8QA 4C8KA 2OPSB 1EYAA 1FJGJ 2B3TB 4YR2A 3KDNA 1Q7YC 1S7HA 2ERRA 4OGQC 2K3IA 5T1GA 1S3OA 2BA9A 1NSAA 5KFQA 3GONA 2E75C 3T56B 1HNVA 1MG7A 3A7LA 2RUSA 4X4NA 3D1QA 3CW2C 1I6JA 3PR4A 3W8PA 1CULB 1U2CA 2ZE2A 3I5CA 4CTAB 1VQ6A 4AFFA 1N4LA 2Q6BA 3VAIA 1YBAA 2M70A 4USHA 3Q0AA 1I4PA 1QAXA 5AXNA 2XC9A 2NVTB 1WTFA 3BN7A 5J1NA 3ISNC 2FYXA 1AEXA 4HVZA 4J90A 5IWAF 3SSRA 5U47A 1GUSA 4LF7F 2JFKA 4K7QA 2HNYA 4K5RA 1K0TA 5CZVA 3AD9C 1X54A 3MM7A 2VL1A 4A47A 1CQVA 3VVUA 1UE5A 3G9CA 2RD5C 4A8KA 4DV7F 4Z7YA 2VA3A 2NS1B 3P5TL 2E5LL 4WTOB 3VYSA 4Q8FA 3PO5A 5EPJA 5KG2A 2ASLA 3K5LA 4V0BA 2DVIA 2C2ZB 2MSSA 5IFMA 3MFHA 4AH6A 5ETSA 3J80i 2CQ1A 4W92B 4I1TA 1WJ9A 1IBKF 4YCUA 5KFOA 3G8TA 4EEYA 3FMWA 1SFOH 1SJ1A 4JOIA 4AYBD 1F0XA 2OEKA 4FP9A 3UDFA 3M6WA 1N8RC 4GKJQ 3SGIA 1V9OA 2WVDA 2WCXA 3H2UB 4CRJA 4B9LA 2R3ZA 2VIHA 4FF1A 2HFOA 2BANB 4DV5F 3PY8A 2DH7A 1XC9A 2I46A 3A8JA 4GVBB 5KFPA 5I4MA 4A3EB 2EYLA 3DC2A 1K44A 3HEJA 1TWCB 4C8NA 3BO4A 3DGPA 2UUBF 2APOA 1UVLA 2KQ3A 2KFNA 3F56A 4IOBA 5IE8A 2W2MP 2XTIA 1XQIA 1TWHB 2HIQA 5JAVA 4O3PA 1PH5A 4S0MA 5IWAJ 1C1BB 1YDLA 4LF7J 4X62Q 1CJUA 4R4QA 1KSPA 4ZVOB 4MH8A 3P20A 2ZTEA 5F0UA 3ETOA 1AFPA 2ASDA 2XHCA 2JJ4D 2NLWA 2RMLA 4A3IG 3H09A 1JK9B 1RHRB 3MTJA 4DV7J 2B63B 4I7FB 1E1TA 3A8IE 2W7PA 3K0YA 3NWRA 3VWSA 1RKJA 1NSPA 3CGIA 4RCOA 4RUAA 2HBRB 1Y1VB 1X9WA 3PNIA 2XLJA 2UUAL 5E2QA 2ALZA 3RN2A 2AX0A 2VZAA 5E7NA 1FRKA 4U68A 1FJGL 1LK5A 3FBFA 4LRCA 4ZVHA 1Y14B 1E3PA 4ZN1A 2G1HA 1VQOS 1U0LA 3HVTA 1WKJA 4NMXA 1XJVA 2P6TA 4M5MA 4ZP9A 1J5EL 3PHTA 2HT1A 5K36G 1UZHA 4RWXA 1BQXA 4RA8A 4JI8J 4LR8A 3CJ8A 1G6PA 4CBVA 1NHKL 5A8RA 2P5VA 2QE5A 3PF5A 4Q2LA 4B3RQ 3G82B 2AJQA 3THTA 4CLUA 1KQSA 3KF6B 3KLRA 4C8MA 3EPIA 1SJ3P 2MKCA 2DNPA 1KKHA 3JSRA 2UUBJ 3NEMA 2AJFE 2HCIA 3O2IA 3K8AA 3Q8PB 3GTKB 4ZP7A 3PO3H 1MHWC 3MEDB 2JQOA 1EHWA 2UV8G 1XN9A 5CBAE 2AEMA 1VDHA 3RU0A 1S12A 2K14A 3NAIA 5HJXA 2BJ7A 2VPXB 4JOUA 1N36F 3CXCA 2R7TA 3CU7A 5KNBA 3CPWR 1QUPA 4DR2Q 3J80Y 1Z2LA 4WRDA 1FWKA 1GO3E 5LMNW 1X56A 4DR3L 2G0IA 1CZGA 2V8PA 4RUCA 3HKWA 4NEZA 2UU9Q 3MM9A 1JT8A 5M2PA 2WOMB 4KAIA 4DF8A 2JZ5A 3J7ZT 1GFWB 1BQQT 3GJQB 4BBYA 2TMPA 5F8HA 1CVJA 3O1LA 2AU0A 3HOYH 2AYEA 4JC0A 3Q8VA 2LXJA 1SXLA 3SSSA 2B2UC 4O3QA 1GXLA 4IOAA 4X64L 3MFIA 2C3YA 2VG7A 3CC7S 3M4OB 3MPYA 4CKEA 4NLWA 3PIPQ 4B9VA 4TRDA 1KNEA 1Y11A 2Q8IB 4DPOA 5JVH3 3GV3A 1KEKA 4FP5D 3QGGA 5LMUL 4PRFA 1EY5A 1K83B 4GO5X 3CCLA 3JQKA 1RBLA 1Q90A 4QIGA 3MR2A 5C2GA 4RW8A 4GN4B 2PEBA 1IL2A 3LGJA 4NRUA 2NVXB 5J2MA 1KN6A 5HGTA 4RW7B 2OIHA 3AFQA 2HURA 1CKMA 1Q1BA 3GP9A 2H3EB 2RKSA 5L1JA 1BY9A 3PF4A 2SOBA 3SMZA 1X5OA 2NXCA 4B9UA 2QFIA 1X4HA 1RF2D 2QA4A 1N36J 1OQ3A 4L5QA 1T7PA 3KF8B 3MEFA 4LF4Q 1Y1WH 2VA2A 1VQ8S 1IJEB 1KRSA 2B2TA 4ZMMA 1JR0D 3H98A 2PCFB 2HFZA 3GCWP 2YVSA 2W9CB 3ZZUA 3D1HA 2N4DA 5K14A 4OL8A 4HI2A 1YVCA 2F0EA 1Y8PB 5DEHA 1L1OC 1KLNA 5IYDH 3I56A 1VISA 4MN3A 4TXSA 2O5JC 3PXGa 5E4XA 2CJYB 1TWAH 3OR2B 2NVYH 3QMQA 4M8AA 2N55A 4LRDA 4Z7CA 1I4QA 3DHWC 1RKIA 3M1VB 3HKZG 3F2CA 1UMJA 3KJOA 4IG0A 2VBYA 2R8KA 2DRDA 3HK2A 2XMUA 2VB6A 1A3VA 4WXWA 3R5JB 1D5ZC 4JI8L 4KY3A 3F0NA 1MNEA 5EBDA 2X7IA 4ITSA 1RAOA 2YX4A 2RS8A 4PXCA 3ILOA 2NTSA 3T6BA 2ABYA 3AU7A 3UNGC 3BBBA 5IC6B 3I55A 2BACA 2UUBL 2X3GA 3I5AA 2R2RA 4J5OA 2DHXA 2IC3A 4WKYA 4CT8A 3HHDA 3KBXA 4DAPA 4F8MA 3JTPA 5J1PA 1X5PA 2R92G 3KUHA 4Y2AA 2HRTA 1IBCB 2FVPA 3PJ9A 3GLJA 4BY1H 4IZ8A 2D1CA 3AD7C 1F9FA 1UE7A 3M2VA 3V4IA 2Y0SG 1GAOA 1K8AC 3JS9A 3R8YA 4OJGA 1BBXC 1FX2A 1RTNA 1UTAA 1RCXB 3OTDA 3OFEA 1JKHA 1CKNA 2C28A 1VBYA 4JB8B 2GFFA 1TU0B 4H44C 1FO1A 5C25B 1RT6B 4LIRA 4PQAA 2DJWA 4A3FH 1FDAA 3EIVA 1BOSA 4YY3Q 3MTKA 1S5DD 1Y3JA 1ITPA 3NUCA 4WBFA 2DCLA 2B4PA 3MR7A 4ZS6A 2J7WA 2QGQA 1PFMA 4PMBA 3NS7B 3E5SA 1SE8A 2JSOA 4QPXA 1WCMB 2IVFB 4UF4A 1UZDA 1U6FA 3CJ3A 4F4AA 4Q44A 3G6ES 3K81C 4A3MB 4Q0FA 3UNYA 2XLKA 4YB7A 4PQUB 2BJ9A 1N32F 3GO5A 1DOLA 5J2NB 2PI5A 1Z47A 1HFGA 3QWPA 4BBRH 1YIJA 1WC1A 5C4XG 2RVLA 4JK1C 5H9FJ 2LU1A 3C1FA 3NWGA 4DV0F 2V2VA 2R8JA 4IPCA 3CF5Q 2EPIA 3D6CA 3MM8A 4WJ4A 2QEXS 2UXCQ 5KG6A 4DNTB 4PQXA 4P2SA 3RGIA 4KD3A 2IHR1 3M9OB 4RR5A 2NUCA 2HZCA 2HVIA 1D6EC 1ZPVA 4LFAF 1K0RA 2XIWA 3IWXA 1DTTB 1N36L 1KTKA 1A2TA 4DFJA 3E6ZX 3R2TA 2JA8B 3M32B 3T1YQ 1UPPA 3MXUA 4X65J 5KFTA 5ETOA 1ZXTA 3SK8A 4F2SA 4XO0A 1WC4A 2CNNB 2N7YA 1U8WA 3PTWA 1QD1A 1NE3A 3SQGB 2BH2A 3K5PA 1YRTA 4MMOA 3UR0A 2HVZA 4GNXB 1O51A 3KHGA 4PAAA 2JA5H 1XEZA 2IL8A 1DCZA 3J81j 3RMHA 1AZSA 1S72S 1W3SA 2RKIB 2KU7A 1WHXA 2N3OA 2M0GB 1TWGB 1VQ9S 4RGMA 2EXDA 4TNOA 5F9NA 3HOXG 1KXLA 1QY7A 2VU5A 2OSQA 5B0CA 3BBCA 3JAML 3TRGA 4CGYB 2JEJA 2QL5B 1BQMB 1JLEB 1U4MA 3QSIA 1HNWQ 2ZJPA 4N47A 2DR8A 2LXFA 4PXEA 2Z8QA 2Z4IA 3OTCA 4DV0J 3M6XA 4BWJA 4YHHL 5GAGI 2OPQB 1PTOH 2Y1RI 3P3DA 1I6HB 1NUCA 3G71S 3QO9A 1M5KC 2XNQA 1TMJA 2HFUA 2GO9A 3MXHP 3IRXA 3FFIA 4L73A 1SRUA 1QSSA 2B51A 1VQBA 3RW7A 3PO2B 1F3VA 1WKLA 1EWIA 3NHHA 1SH0A 2VH7A 4LFAJ 3DRSA 2RDJA 5EKLA 4ZHRA 2G5DA 3T5LA 5M2RA 4X3SA 1B3AA 4JI5J 3HOWH 1FA0A 2G2YA 1XR5A 3CIMA 3TS0A 1W7WA 3LAMA 1EWHA 4DJBA 3QZ7A 3B82A 1YNJC 5CYJA 1J6QA 3LP0B 2VY3A 3O6QA 2H51B 3RNUA 4K6LA 5GAHU 1LWFA 2D0OA 1LW0B 3NCQA 1HD0A 5KFNA 2QL7B 1BQNA 3NOGA 5DO2A 1R0CB 2AEFA 1RKNA 5EPKA 2A2CA 4P75A 2Z2MA 1H9SB 2GVDB 1Z9FA 3U1MA 4RGTA 3D8GA 3TA0A 4OHJA 2IPKD 4Y2IA 4OZNA 2OAUA 1AUSL 5IQQA 5A2QU 2OMOA 2MO1A 1Q8IA 4H54A 4LF8Q 3CKIB 2I5MX 5FO8B 4DR5Q 3SQOP 2F4VQ 2RQ4A 3H5YA 3MCSA 3GPAA 2HGLA 3CCMS 1S5FD 1ESFA 2GO8A 4B3TF 4WXOA 2OHDA 4O0NA 3GSIA 1VQPS 3BYPA 4MK7A 1S1WB 1E6YA 1A0OB 1S6PB 2B2WA 4C48A 1YJTA 1EEFD 1NMGA 4C3JH 3VVTA 2CQBA 1S5ZA 2NXUA 2F3WA 1Q4RA 3TA2A 2MEWA 4OYAA 4KIAA 3NXZA 4X65L 2RSQA 3CUNA 4FNHA 1VQNA 3AD8C 2WW8A 3KK7A 5CXTA 2JC0A 1IKXB 2KCTA 4FBTA 4G1QA 1RT5B 1GTEA 4OONA 3EN2A 2X51A 3GDEA 2C42A 2VG5A 1DBDA 2ZBIA 3L7ZC 2F0PA 1K3BC 1UL3A 3TP5A 2FJVA 3T19A 5FK9C 1SQEA 1S1UB 4ZK7M 3VYRA 3D68A 4IJLA 1LT6D 2W8LA 4HEDA 4F67A 2RVJA 3POTA 4F4YA 3DCAA 1LEOA 1CA6A 3KLFB 1JLBA 3ND8A 2IBOA 2ZUGA 2QILA 1VIXA 1FKPA 1WG5A 3G6VA 2FHOB 1WG1A 4RW4A 1HW8A 2JOQA 2EZVA 1Y1VG 3O3LA 1CC7A 1SNMA 3DRRB 4KGXB 1U4BA 1EB0A 1NJYA 1KDNA 2XEXA 5FLXU 3EDRB 2DB1A 4DDFA 4B3TJ 2EFGA 1QJHA 4DAYB 3FEZA 5DG8A 3N5BA 3I4HX 1FI4A 3O13A 4H4OB 3HVRA 2KHCA 2E2IH 1FF2A 5L46A 3E01A 4MK8A 4FF2A 3ZC4A 3EFXD 1C4CA 3EDQB 3UI3A 4WFAQ 1QWYA 3EVOA 2W01A 4LFCF 4OHVA 2EY2A 4M1KA 1YJUA 1NM2A 2E2HB 3W63A 1N5TA 2VG6A 2HHHF 2MHNA 3DNCA 1K3RA 5DM73 3FKIB 4RBTA 4JI5L 1KOHA 1VQMA 2K52A 2C1EB 1RWKB 5I42A 1T9VA 3GTQH 4LK1C 3UDLA 3UE1A 4AYBB 1SUQA 1YX2A 1I1GA 3C46A 3P1HA 3I4NG 2MQPA 2E9ZA 2CH4A 2OPRA 2HG4A 2EYOA 2KT2A 4XTCS 2P8IA 1N88A 4OYOA 1CZWA 3S8SA 2C35B 3J7YU 2F65A 3R7BB 5G0RB 3S14H 2LKVA 2ZBRA 1TY0A 3LOUA 2PI2E 2XSJA 4GLXA 1XTDA 1YJNS 2CZVC 4M1UB 2BCOA 4ZLTF 1YZ6A 1PFBA 4IO1A 1RYSA 3I0SB 4LSNA 2EY6A 3JAMc 3D1OA 1RT7B 3SFGA 4DUZF 1IBMQ 4EK2A 2HQFA 3MPDA 4LFBQ 1QNUA 2A6ED 2C2DA 2QG9B 5LSRA 1RBAA 4KR0B 3MMBA 5JJBA 4LR7A 4RBUA 1UFWA 2A69D 1WF2A 2IYIA 1U1QA 2YQ3A 1MROB 4DV6F 1TKWB 5BN3A 4EGVA 4C2MH 3NTKA 3CCES 1JJHA 4OZ0A 4OHWA 1TL1A 2D3OR 1EZ8A 2BX6A 3R2CJ 3HJVA 3KG1A 4PXBA 2RDFA 4LFCJ 1YJ9S 1JLFA 2Z2YB 5ELNA 1WC5A 2VPWB 1YRUA 5EAYA 3QJJA 2EYPA 1VK8A 1RD9D 2RF2A 2VV5A 1W2IA 2HHHJ 3C6UA 3PIPA 1ULRA 4NXNF 1HBOA 2WKDA 5C24B 1Q86T 1EY7A 2RRAA 3OW2A 2CJBA 4H4MB 2FD2A 2FJAB 3B4DA 2IHEA 2U1AA 1JQYD 4MKBA 2QA2A 2OEJA 3BKUA 4DR1Q 4X4VA 1WTRA 2A6EC 3VGVA 1V9PA 1REVA 4HR2A 2DY1A 5IT9L 2MP1A 3QYYA 4HTHA 2J8AA 4JI0Q 5JVHQ 1KD1T 2A69C 4DPGA 1FVSA 4OV6A 1X9NA 1Y5LB 2K1BA 1SNCA 4Y28C 4N8NA 4RKUC 3KLIB 2ROPA 3HT0A 3WBZA 1QG7A 2NYHA 4KPCA 1S0MA 4JOIC 2VQEF 1IKYA 2QW7A 4KGVB 3S6EA 4DUZJ 1HMVA 4F8RA 3MOJB 4C8OA 1QTNB 1WVLA 3H5SA 4A3KB 1FE0A 2VUMG 1SYEA 2BDOA 2F3VA 3GSDA 1CBKA 4DV6J 4V1Ak 2AD9A 4C3LA 1UP1A 1P9YA 3GP7A 1PC4A 1R43A 1CM9A 1VF7A 2JLGA 4DR7Q 1OXSC 3BB5A 4U95A 4NPSA 2UVRA 1UW9A 4OWXB 1STBA 1XWEA 4K2KA 4AL6A 1IKWA 2LA4A 4F0HA 3GTOH 1N33Q 1KFSA 3KLHA 3BKTA 1KDBA 3CCSS 1LW2B 1YVFA 3IFEA 3G87A 2ILZA 3ENVA 3V6DB 4NXNJ 2M9VA 3DYAA 3UE0A 3VHQA 3P96A 4A93G 1L3KA 5HMZA 1G7CB 1SYBA 3B78A 1QE1A 1RWWB 3GV5B 4YB1P 1M1KC 3VALA 3NL0A 4HTJA 3UI2A 2A6OA 3ZTRA 2NPIA 3R7SB 4AXJA 2L11A 3S9WA 2VFVA 2PZUA 4CO4A 2O3DA 2XWJB 2LY7A 2BVZA 4A3IH 1SXTA 5KFEA 3DOLA 1N34Q 3U4ZA 1NK4A 2HZAA 3SR1A 3W9JA 3F2DA 2IMWP 2BRLA 2XWBB 4JI7Q 2AEJA 2WB1E 2M5YA 5FD1A 4JI1J 4MIBA 1RTDB 4JYAJ 1Q53A 1HKAA 3M3YH 4C11B 2DY7A 5GQOA 2A19A 4HACB 2HQLA 5AE3A 2OPSA 1TVRB 2CW0D 4GC6A 3LAKA 2GZOA 3BJYA 2F63A 4CCHA 1EOVA 5SZTA 2WHOA 3D6HB 4K5VA 1R6YA 2CCZA 1CULA 1ZM2A 1F9HA 2M4MA 3I4PA 1IR0A 4DV1Q 3CP0A 4CTAA 3HOUG 3PR5B 5LSOA 4LFCL 1KNZA 2Q6CA 5D4LA 1BVSA 1VQAA 1VQJA 2CPZA 2VQFQ 2B2VA 2R42A 2I2YA 2CA9A 3I4MB 2H4WB 1S1TB 3RZOH 4I65A 5FJ8G 3QJLA 1AP0A 1R27B 1K73C 3IM9A 4PUOB 4HJ7A 1QDUB 1FGUA 2BYCA 4LT6A 4HCSA 2AQ3B 2JLEA 2CW0C 5JJLA 3QFHA 4USTA 2HYIB 2IBKA 4IFDI 1PBUA 2XMAA 4PXDA 2E29A 2JYOA 4OO1I 4EI2A 4FXGC 3CF5A 4JI3Q 2E1AA 5HMXA 2RRNA 3ZZPA 1QZHA 2K50A 3AJDA 4IFVB 4YB6A 3TVYA 1JXEA 1U0SA 2QLJB 2KM8B 3F73A 3TZXA 1ILQA 3GB0A 2R2TA 4XT1B 1R4PB 3H42A 4QIEA 1HLWA 1B64A 3AQOA 2QT7A 1K8MA 5IQ6A 1S9EB 3MCNA 1MLAA 3OLBA 2QIFA 2D9OA 5JOBA 1D2BA 3GJTB 2BANA 4IR9A 3V2UC 4DV6L 1VQSA 2CNOB 2VB3X 3CMAS 2DNLA 2NBFA 3M7GA 4GVBA 1AH9A 1P6TA 2GHPA 2V34A 4NLYA 5DETA 3OTOF 4F4WA 4ME3A 2D3O1 2LFNA 3BGUA 5EJWA 1KS2A 2QLFB 4FXKC 2PZTA 2LXKA 1RHPA 2AZ1A 2K1RB 1OYDA 3CMEA 1C1BA 3RB3A 4G4KA 3FEWX 1SFOB 1FFWB 2R7RA 2E1PA 2JEIA 2H9ZA 4P52A 3N6RA 5IT9c 1D9DA 3M4XA 2QYCA 2YNIB 1L3UA 5CD4H 4I7FA 4DHVA 1JORA 4B3MF 3H25A 3IXQA 1TKTB 1M4VA 4L63B 3FBBA 5E0OA 2HS0A 3M8PB 2PPBC 4HIOA 3DRXA 3PQIA 3H2VE 3QT7A 4LJMA 3U9OA 4QWDA 1U09A 4JI1L 4OQJA 4JYAL 1R0BG 3CB4A 3TP8A 3NGKA 1HYSA 1RCOB 2HBYB 1STHA 2ZVIA 5M3MG 4LREA 1U02A 5BR8Q 4HMIA 4N9TA 4WYWA 2UUWA 4R0JA 3WZ0A 2DNZA 3E3XA 2IX3A 5I9PA 3KLSX 1SH3A 2CG8A 3IR6B 4XQQA 1Q82C 1FXRA 3OIQA 3DM2B 3ISZA 3BV8A 3G82A 4U8YA 4CO1A 1ZTTA 3KF6A 4LF9L 3IRWP 1QAYA 1NXIA 2J9DA 3OTOJ 1B3QA 1U1MA 1XNRL 3HD1A 4DV2Q 3MEDA 1RT2B 4K4SA 4K2XA 4IN3A 2SNSA 2UUCQ 4JUZA 5KFMA 5IWAQ 1Q8BA 2CJQA 2FLPA 1GVPA 3MF5A 2LU2A 4C56C 3G7LA 2NQPA 2VOPA 1DXMA 1Y5IB 1JWUD 4KFBB 2Y8WA 1WHWA 1JWWA 1K28A 1HBUB 2V8GA 4B3MJ 1S4EA 4DS5A 1NCLA 1Y9OA 4ZA1A 1ZTWA 4HL9A 4MAKA 2DBBA 5KFWA 1ZA1B 2WOMA 5DNFA 2D3UA 3HCXA 5C4ZA 3GTGH 1QUQB 2KKHA 4LRFA 4I4BA 4IUNA 1E6VB 1E2VA 1SNQA 3PO3B 2N7CA 2KCNA 5T14A 1FTCA 1IBKQ 3SEOA 4WPAA 3OWEB 1N5SA 3D6WA 4A3GG 3C6TB 2XG8A 2DH9A 3OL6A 4JV2A 4K14A 4NASA 2DNMA 2Z56B 4U7UD 1KC8T 3A8KA 5L1KA 5HK4A 5EWEA 4JPBW 3L4BC 4HKQA 2Z0SA 2L48A 4DV5Q 3EE3A 1U48A 4LWCA 5BYSA 4UY85 4LF6L 3PYFA 3W2WB 5IIFA 8ATCB 3WWVA 2PIIA 3W61A 2R7FA 2ZJQA 4RW7A 5I3PA 4PNYA 4UPAA 2EFNA 5C4XH 3HOYB 5HJYA 5KFBA 5ADZA 4LUBA 5KFJA 2ZC3A 2A1BA 1DTQB 1GMUA 2FFKB 2VHGA 2A3JA 1OXXK 1PHJA 1G91A 3L3OC 3R97A 1TAUA 1S59A 3KF8A 2K5DA 4DR4L 3K8WA 4FBUA 2FINB 3MMCA 2RHSB 1DOKA 4DV3J 2WB1B 4LF1A 2GMLA 3M8SA 2DGQA 2IM0A 2L9HA 1UVIA 4HCEA 4CP5A 1WTVA 1SKSA 4I67A 4NCGB 4WJBA 3HOZG 2J9CA 3D5MA 2Q2TA 4U7UK 4C97A 1TU2B 3V6KA 3OR2A 1T11A 2MY7A 5G4DA 5B7WA 5CMDA 4GKJF 2LMCB 3M1VA 2ZH2A 2K06A 5F8IA 4PZ7A 3TN2A 4WIIA 2AV5A 4NXMQ 1Y1WB 4ELUA 2XBPA 4NZ0A 5THWA 5DDRC 1N56A 3HKSA 3SV4A 1Q3LA 5DM7Q 4GKKL 5KG4A 3HOXH 1C4AA 3VA5A 4I68A 4Q2MA 1TL4A 3K8VA 3OTOL 1Y7PA 5KOXA 3D2WA 3Q86A 5C0XI 2C2MB 3IS9B 1CS4B 3CJKB 2ADCA 2CHBD 4C8YA 1XMBA 4QUFA 1FCAA 1VJQA 1TWAB 2BXJA 2NVYB 3QT6A 3QATA 3FRZA 1BDOA 4USVA 2B9EA 2K5VA 4KRWA 3K7RA 1RACB 1IWAA 1RWMB 1QM9A 1HQ2A 5D14A 1BBWA 3EXCX 4DNIA 3T41A 1IKLA 2LKZA 2Q79A 4CDCC 4Q5VA 2OXPA 5F0WA 2YKNB 4LBHA 3I73A 2CIMA 5C25A 4I0WA 3G6EA 1RT6A 3OL8A 3V5RA 3EVWA 1B1ZA 1TP7A 1TKZB 3IC1A 4A3LG 1EQRA 2A8VA 5GMDA 1A2UA 1CHPD 4G7ZC 5L37A 3IFDA 1ZPWX 5D3IB 4F4XA 1FK9B 1HW9A 4NLTA 1SKUB 4BY1B 4GKJJ 1EYCA 4DPWA 3UN3A 4PQUA 3WOFA 3AA8A 3BZCA 4P10A 4QWCA 1U2FA 1DZ1A 5J2NA 4QIVA 9ATCB 2QEXA 3PZPA 1VQ4S 5CV5A 3MD3A 1MGSA 1UPMB 5A2QY 1NK0A 1XNQQ 2DJFC 4NLRA 2H54B 5CA5A 2RU3A 4DK6C 4A3FB 2V9KA 2CPJA 2B2WC 2J9EA 2MMYA 2YWFA 3Q2SC 2AKWB 3GFYA 1NDPA 4M95A 4RKLA 2K03A 4O42A 3KNGA 1RK8A 3AY0A 3DUZA 1T05B 4X62J 2F1MA 1VQ6S 2ICIA 2FDNA 3J81i 1DTTA 1NH7A 5FOBB 3TJ8A 4M5DB 4ED5A 4DR2F 5C4HA 3A8IA 2A6HD 3M32A 3EGWB 1QB5D 3DKDA 3TP2A 2RS2A 4DV3L 2DY8A 5JVGQ 1S72A 2UU9F 4BBRB 1HHQA 4OX8A 3TVKA 1NO8A 3BBFA 4XIGS 4G7HC 1VQ9A 1IKVB 3SQGA 5IS2A 4LQ3A 2GA4B 4GNXA 3OYYA 3K5MA 1HNXF 3A55A 4HMJA 5EWFA 5H9EK 3S2HH 2RB7A 2RKIA 2BKOA 2B9XA 4PPZA 3H5XA 4GLVB 4M5JA 1VOMA 2CQAA 2VF3A 5D4OA 3DM3A 4OJ1A 5GROA 3FMCA 1HIYA 3HKZD 3PSIA 1I94Q 4J9NA 3RYLA 1BQMA 2MQMA 1JLEA 3X3MA 1JMCA 1FDDA 1ASYA 4POGA 1K8OA 2OEMA 5F3TA 4KH0B 4ANEA 4JV5F 4PV1C 2BBEA 4QB4A 3M2UB 1NDCA 2MKIA 3NXWA 2XULA 2B8FA 5KT7A 5FLXY 1MMNA 2JA5B 2ZM6Q 1J9OA 4JVZA 3C19A 4KHPF 2KXFA 3NCPA 3N52A 3S1NH 1CTMA 5KFAA 4LMQD 4K59A 4LF4F 4WFBQ 3PW2A 5K8PA 4DR2J 4DLEA 3LTOA 1JB0C 2V9WA 1PLFA 2KHJA 1VCTA 3KMQA 1BR9A 5I4DA 2U2FA 4WP3A 3GR0A 4PMCA 2Y0SD 2UU9J 3LP0A 2XCAA 1D5MC 4ZCMA 4NI2B 2B8PA 1U1NA 2NN6I 3LGNA 1PTOB 3I4NH 2XQCA 3H3VC 1Q79A 3CCUS 2DHAA 1H2VZ 1HNXJ 1HWKA 3EJMA 1VLYA 3PX0A 2ZC4A 1SE2A 1H9SA 2GVDA 4H4KA 3GIMA 1E0BA 4KO0B 4PPDA 4KGZB 1MJEA 1SJRA 5M5XH 5ETMA 2DNOA 1PH3A 1EIFA 4EBCA 3NNHA 2DN8A 3HOWB 3MZ5A 1N32Q 1F60B 3GV7B 4YWLA 5D0EA 1B9NA 1F5CA 4O44B 4F25A 3KJVB 2QEJC 2LSSA 2KYXA 1S1WA 4PWUA 3MURP 2OEOA 1N6QB 2DY9A 2GIFA 2DCUB 1X3FA 1YI2S 3QGPA 1N9WA 2JK8A 4X62L 3M2RB 2IA0A 3JAME 1IBLQ 5IOLA 4KPYA 3UD5A 4LF4J 4J9MA 1UE6A 3KNAA 5ELEA 4J6HA 3BN4A 1NH8A 2F0JA 2NVQH 1M5VC 5F3ZA 3KYHC 2HAFA 4OHXA 3TW0A 4AIMA 1HD1A 5ELFA 2PZWA 1IKXA 2FMCA 1IM6A 5ETPA 1RT5A 2IA6A 3IBCB 1LXNA 4DR6F 3OD2A 2HWIA 4ZVRB 3PM9A 5AFWA 5J2PB 4RO0A 3BH7B 3T51B 1Q1EA 1S1UA 1LUZA 2KT3A 1EY4A 2MKHA 2A1AA 2I8EA 3NKYA 4C3JB 4ECRA 4PZ8A 1HBNB 4W4MA 3N6LA 2KG1A 1CPZA 4RH6A 5CV4A 4ABNA 3KLFA 2JP1A 1H72C 1M90C 2VASA 4KJIA 4IRCA 3W1YC 1T9UA 4WU3A 1U49A 1TS2A 1JICA 2PT0A 4B3RL 5BYRA 4JI6F 5D3GB 2POKA 4DFAA 1YJWA 4LIWA 4YUDA 3DRRA 5KG3A 4A75A 4GC7A 5GADU 1VQFA 2N3LA 4DAYA 2IFXA 1H7XA 2BOPA 4H4OA 3A54A 4R9WA 1RLCL 1SJFA 3P5BP 4KC5A 5LSLA 1HWLA 1AA1B 3JTOA 3K5NA 2VUMH 5C7PA 4K6DA 2ZZTA 2JJQA 1ZBTA 1PH1A 2GCFA 2H4YB 1W2BR 4R8NA 1CJKB 2WVCA 1O6XA 2W24A 4DCJB 3GILA 3FC9A 2XTJP 4D3HA 4ECZA 3H0PA 1WEYA 2RJZA 4PG7A 2CFXA 4I64A 2KT5A 3FNNA 4HJ5A 4A48A 1T0TV 5J1EB 4JW0A 3TQYA 1I5FA 3JYTB 3MFYA 4ZVGA 3NGSA 2QA4S 4YY3J 1O5JA 2QN6B 5G0RA 4A93H 4IYQA 4JV1A 2CQHA 2NYIA 1RHMB 3TREA 2E2IB 3HG9A 2DYAA 3KLSA 2KBNA 2C2KB 5CAAA 2B8GA 3KLVA 2B39A 2F4IA 2CQOA 3NNAA 2CJXB 2DO0A 3I0SA 3R2IA 2B9WA 1GD7A 1RT7A 1ZH5A 3CCEA 2E2JH 3GFZA 1PSDA 1ET6A 2VD3A 3FVQA 4OYBA 4KHVA 3EZOA 5CQGA 3HULA 3GTQB 4CO0A 1HNWF 3HVAA 1CK1A 1YJ9A 2EPBA 3BYYB 2CJAA 2MDAA 1RGVA 3PO3G 1JJCB 4C1NK 1MROA 2KECA 3S14B 4LRBA 1CEZA 2UXCJ 5KFZA 1WDDA 2KJVA 2B2VC 1R7IA 3BDPA 3M05A 2F0OA 1TVXA 5F8JA 3HOUH 1CA5A 1KIXA 5D4NA 3I55S 4OWTB 1HHTP 2JA9A 2CNKB 1QVGR 5CBEE 3ADAC 1VC6A 3S7RA 5C24A 3T5JA 4H4MA 2SEBD 4GRSA 1TUWA 2QZ8A 2X6LA 5CORA 1G2SA 5FJ8H 2AYBA 1D5XC 2PFFB 1IYVA 3DDIA 2VPZB 1QNKA 1Y5NB 4NYOA 4L5TA 4C2MB 3L09A 1ENCA 4MT1A 4MTKA 2F1FA 3TSSA 1FT8A 2HHTA 4O2DA 4N8OA 5C5JA 3W60A 3HKZE 3GIJA 4MFBB 3AFGA 3BYTB 3UPFA 4DQIA 5K5MA 3J7AF 3KLIA 5K5PA 2DNCA 2WB1G 1D1IA 1FD7D 2B4VA 5KFXA 4LSLB 4NA2A 1UFKA 2V68A 1KQKA 1EY0A 4DR5F 5KYIA 1NJWA 1SIWB 2LVWA 4WZMA 2ZHAA 1HA5A 4KBIA 2F4VF 3QIDA 5KG7A 1HNWJ 3WQPA 4O3OA 3IR5B 4QYZK 4GOPB 1PJ7A 4RGNA 4ZP8A 4I7ZC 3HOVG 3FCHA 3SBMA 4ED2A 2IJ0A 1CJVB 4KSEB 1YBYA 3BDCA 2LEAA 4FDFA 3TDQA 4R8IA 3WOEA 3FVYA 1A0IA 3OUYB 5GAHC 5K8NA 2GA7A 2L5TA 3I96A 1Y1WG 4DAVA 2SDFA 1ASZA 3HT3A 1RP5A 1FKAF 4J9SA 2MQHA 3V2TA 2HHHQ 2HBZB 3EXYA 3HSJA 5DG7A 3V6DA 1ZAXA 2KTQA 5KFCA 1A62A 1J8IA 3IWNC 1VQKS 1OPZA 4O4GB 1BWEA 3HHLD 5IYDG 4FKYA 5TSSA 2V8DA 4YR0A 1SMYC 3CCRA 2KXHA 4YY3L 4URSA 3DLLQ 5ELCA 2QSFA 5ETQA 3HHKA 3I82A 2V5HG 3R8BA 1XBWA 2IRUA 2MLZA 3ZXWA 2FB0A 3FQLA 3ZNJ1 1RTDA 2F3IA 4OI4A 1RABB 4C11A 1APSA 1UFLA 1DONA 3GTOB 2B29A 4HACA 3L3CA 5KT4A 4LF8J 1TVRA 2XVSA 4DR5J 5F9LA 2F4VJ 2BQRA 5M3MH 5AJ3Q 3URYA 1G1XA 1NY4A 5KNCA 2QLXA 1VQ7S 2DPJA 4EVOA 1JMTA 4V190 4OZJA 1H3DA 1ENAA 1SEBD 4NMLA 4MZ9A 2FTRA 2UXCL 4NZ6A 2JC1A 3OW7A 1PDQA 4A3IB 2UXBF 4PYDA 3D6FB 2PQAB 2O67A 4OWWB 1RT3B 3OOCA 4X3KA 1GH8A 2EJMA 4IPGA 2C3PA 4NCAA 3ET6B 3M3YB 1X3GA 2KRBA 1NAQA 1S1TA 3QRRA 4ZKCB 2MTLA 3T1YL 2Z58B 2IAJB 2UUAQ 4WFXA 4PUOA 1BNZA 4Q43A 2PD1A 1SL2A 4KQZA 4IPHA 2E2DC 1D8ZA 2R2UA 3U50C 2KCMA 2BQUA 1BBUA 3SK4A 2RQCA 3TUIC 4ECVA 2UXDQ 1RYRA 3D4JA 3R1LA 1J5EQ 3UWTA 2VUGA 4O3NA 4OI1A 1VQ5S 3EQLC 1YBTA 4BY7G 4QYRA 3LP1B 4IUTA 1BKBA 4L75A 2AUJD 3PUYA 4XYQA 1H9JA 4WORA 1SIZA 2GAGC 1KAWA 3IM8A 3Q6SA 2VL6A 4X3TA 4GS3A 4IFVA 4RFBA 1KVIA 2G9HD 3SSQA 1IL8A 3CMAA 3RZOB 4LFBF 3LWLA 2Z4PA 2E1CA 2B9YA 2VQEQ 1FFSB 1S9EA 1PFSA 4USJC 2ZXRA 1LLRD 3KUPA 2HQIA 2ZOMA 1JLGB 2CH4W 4YFUA 5FDLB 1G3OA 1R8HA 2PE8A 3ZNUA 4ENOA 1PKUA 4UY8T 1K9MT 4EQ5A 4FS1A 4QBUA 4M5NA 3E8OA 4N41A 4A3GH 3A3OB 1HR0F 3IO1A 4U8VA 1Y0HA 2FJDB 1FFGB 2ZITA 4TQRA 2FJXA 3PIP3 2X1BA 3N9UC 2MSTA 4NW2A 4IH5A 2UXBJ 3PKYA 1AW0A 2FLLA 1LT4D 3W5OA 1EUJA 1RDPD 2Q1LA 5DJBA 1Z4UA 2XWYA 2JX2A 4ZVEA 2IJRA 3ZZ0A 1FJ7A 2K1RA 2VDIA 4LR9A 1WTXA 4N7TA 3IAS9 4ERDA 1NHUA 1U5KA 2F8EX 3BGRB 3RBDA 3FRPB 3RLFA 4K4XA 2K32A 3IN5A 1I3OB 2YNIA 3PG9A 4B3SF 1U1PA 2JA5G 2PI2A 4JI2F 5AE2A 4A8MP 4JI0F 1TKTA 4A8WA 3M8PA 2FVQA 2FJ2A 1VBKA 1OJ4A 3LPYA 1VQNS 3PW5A 3D4WA 4ZPVR 5DDQC 5LHY1 3IP0A 2EJGC 1S10A 2MGZB 1ET9A 4LF8L 2QLBB 1Q5YA 4LFBJ 3HOZH 4DR5L 1TMMA 3CULA 2CADA 3K0XA 2F4VL 2J0XA 4USKA 4J9KA 1WEZA 3STBC 2J8SA 1WOPA 1Q5VA 1G8ZD 4OJ3A 1J2VA 2HFSA 2E7WA 2VODA 1RLDA 3DM2A 2F3JA 4EZ6A 4LUOA 2ES2A 4QJFA 4IFDJ 1C1CB 3T6JA 4F4KA 4I69A 2DKOB 3B8HA 1Q0NA 1KQGB 4QIFA 5IT0A 3VF0B 4UZBA 4CYUB 4ELTA 5IGEA 1N33F 4ECSA 2ZEJA 4AQYL 1EAYC 1M1HA 1RT2A 2BA0A 4LNQA 2E5IA 3HSZA 3OQ2A 5IP7G 1QAIA 5FKAC 3KJNB 3RRKA 1NNDA 1QLNA 2MKYA 1TT2A 3IRBA 4DR1J 2C5CA 4KYZA 2VICA 5BN5A 4KFBA 2DPIA 5MAOA 4B3SJ 3A56A 3D6MB 4JI2J 1HBUA 3HKZB 4JI0J 3NWSA 1F9RA 1L3SA 2FHMA 1TZ0A 1KVKA 2RCNA 1NB7A 1AUDA 4CI0B 3TQ1A 4ALPA 1Z6HA 2KL8A 2IJNA 2V6AA 1QUQA 1CUKA 5E3FA 1E6VA 4MKYA 2HQGA 5KT3A 1WD1A 1PH9A 2CPXA 4ED1A 1OQ6A 4RWWA 5E33A 1PXUA 3CCWA 1ICFB 3CAMA 1BD6A 1BMQB 4A3LH 2VC1A 2RU9A 3T3FA 4AXIA 2IX1A 1E22A 1PVOA 3DEPA 3C6TA 4YMEA 3BDOA 3J81L 2Q2IA 2OJ3A 5EKKA 4OIJA 2G1DA 4DV1F 4C3JG 1OY8A 4OHYA 2W7OA 1URRA 3PJXA 2Z4HA 2ROEA 4CJ1B 2R7ZG 2PN6A 4BBSG 3W2WA 2FY1A 4DSFA 2A10A 5C44G 4DR7J 3RRHA 3M8QB 2VFSA 2VQFF 3GTGB 5C3EG 1H73A 2MPUA 4RNHA 4KKOB 4JCVE 1JC7A 1UAWA 3ULLA 3WC0A 1N33J 3GTJH 2O66A 2K5QA 4XTTA 2VJUA 1K1SA 1DTQA 1FNWA 2B7CB 3KKFA 1NK9A 4NLOA 1TQOA 3W3SA 4XIUA 2F0NA 4RNNA 4KHMA 1JOOA 1AN8A 1WF0A 1A6LA 5LMNL 4ZN3A 1RA7A 4NDXA 4FF4A 2K75A 3AQPA 3EMTA 1F2LA 4ETXA 4OMFG 3KG0A 1GMVA 5T41A 3TZYA 3UN5A 2DNGA 5DLGA 3L95X 2WACA 1NAPA 2FVSA 4IRDA 4P74A 4DAMA 4JI7J 2OO4A 4NCGA 3CO9A 1FVIA 5C4XB 3CCZA 4F2RA 5JEAJ 1IBML 4LFBL 1LT5D 3M4YA 4B08A 5KFKA 4WU2A 4L3KA 3OHAA 5D15A 4OYIA 1LK7A 2R7UA 2YWEA 4UDUC 3GFXA 4DV4L 2K5WA 1ZM9A 3I8ZA 2B6AB 2H5XA 2RF4A 4DOZA 4KE5A 1J5OB 1WNEA 4DV1J 3ER0A 1S9FA 3PW7A 2R8HA 3BSNA 3OV7A 1A9NB 1FVQA 2CQGA 3K17A 2XNAC 3DN9A 2C2RA 3CTRA 2VQFJ 3KDFB 3MTSA 2BR0A 1LABA 3IS9A 3BS9A 3J7ZC 4KTAA 3IBFB 1CS4A 3HHEA 3CJKA 5NUCA 2O2LD 1C0TB 3M7VA 1IXKA 1DQ8A 1A6XA 1TKXB 2PDAA 2HBQB 5IGDA 4FNIA 2MB0B 2NZCA 1RXOB 2RA4A 4DR1L 4RPFA 2AWZA 3CPWA 1VHIA 2EKYA 1RU2A 4URQU 3AJ2A 3EGZA 1HNIB 1ML0D 2YKNA 2CWPA 4EWTA 1VGYA 3HOXB 2GW8A 2I9SA 2YKMB 1EEID 4DQQA 1XPRA 4ED6A 4LRAA 5M3FG 4B9XA 1JE5A 2OFHX 1Y3KA 1S1XB 4G3IA 1TKZA 1SJHD 1JJGA 3AOCA 2F0UA 3S15H 4J9UE 4H4KC 5BR8F 2GS8A 5KOWA 1CJTB 1VQ4A 4DL0C 1Q46A 1DQ9A 1FK9A 1HI1A 4DQPA 4JBJA 3DM1A 1V43A 1RAGB 4LVOP 4DN0A 1HQEB 2M88A 5JPNC 1KDAA 2O4XA 2BW7A 1FDBA 5DM63 5L1LA 2DT9A 1FKOB 4LBIA 4EGLA 3K0JA 3UVJB 5T1IA 4DR7L 2B3GA 4EMDA 3TZUA 4RNOA 3ZYYX 3IWLA 2XSCA 2HWHA 4LF5Q 3ZTPA 3BZDB 3N6NA 2BJ8A 4DV2F 4DFKA 1N33L 2YPYA 5HURA 5IM0B 1URNA 2UUCF 3AB9A 2Y8YA 4DSEA 2V94A 1T05A 1M5SA 4I7AA 5IGBA 3V4MA 3D7SB 2M52A 3PYEA 1WD0A 1BE4A 4YDXA 1BF4A 4QW9A 1EETB 2R9LA 4OI3A 4M5DA 4CLYA 3J7A5 2NPFA 3R5DA 4KN4C 3IMQJ 3M8RA 3TAPA 1NBWA 1NDKA 3JAMU 5L9XA 3FP9A 1T5XD 4IPDA 4A8XA 1N34L 4J8QA 3S01A 1ELOA 1QCBD 2VW9A 4H02A 4OX9F 1IJFB 4JI7L 3MI7X 4IUUA 2NN6G 2BE5D 1IKVA 3EGVA 3VR5A 3VTIA 4XT3B 1EFWA 5C0XJ 1VHFA 2PQEA 5BR8J 5J1ZA 5HL7Q 3A1YG 1I6VC 2LQ9A 4TY8B 4QR0A 1YITS 1LTRD 5A0YB 1W26A 4MTNA 5I3UB 3Q8RB 3OTBA 3G4SS 1RHKB 3NRBA 3FBCA 3FJ2A 3PX4A 4BXXG 2PW7A 2HSEB 1Q12A 1SL1A 3KG4A 3TP6A 3TX0A 4DV1L 1LTSD 1R0AB 1GHKA 2GAHC 1HI0P 2AJ0A 3RN5A 2NXEA 1FXDA 3DLLA 2VQFL 3CWJA 2EYMA 3M2UA 3RB4A 4DV2J 5J2QB 5DZ7A 3H4DA 3C66A 2BE5C 1B99A 4ME5A 2E1MC 3AB2B 2UUCJ 3S2HB 2ZTDA 3EX7B 4Q8EA 3T13A 2L15A 3MXPA 4QWAA 1EQVA 1P8GA 2QSWA 2EJFC 3OFGA 1AZPA 4KN7C 1FJEB 3MXNB 3CCUA 3BEGB 1RWPB 4RL1A 2P9CA 1S6UA 4WFNQ 2D9PA 3CMES 4DX8H 2KHSA 1XR6A 1GXUA 2DIUA 4JI3L 3KDOA 1RSCA 5C3WA 4OX9J 3G2XA 4NI2A 2KG0A 1KABA 4RGOS 4CO5A 1F9SA 2ADBA 3VR3A 3J7YW 1PZJD 2R7SA 4L74A 5J22A 5GMEA 1KL9A 2GV1A 3TO8A 1IBKJ 3C8YA 4P2XA 3SZ2A 4KO0A 3I4LA 1U4PA 1R6VA 3S1NB 2XRSD 2OUGA 3MPVA 4KY5A 5ETKA 2W2PP 4NXMF 2CWKA 1X5SA 2K01A 1EQMA 1XMQQ 4QU6A 3AOBA 4DV5J 1NK5A 1YI2A 2MZ1A 5LL6S 4O44A 1AW7A 3HHLB 1MWQA 3QAUA 3N01A 3KJVA 5I9OA 1WTHA 2GMJA 3ENAA 4BA2I 3L9AX 3DXBA 2AWNA 1WOOA 3MWBA 4ZPCA 3I4NB 2RSNA 2RNEA 4RUBA 1N6QA 3H0GG 3I3CA 1AYEA 4RBVA 4DUYF 1IR2A 3CCVS 2KHIA 1V6HA 1WOSA 3G86A 5M9OA 3M2RA 5EX0A 5C3XA 3D28A 2UVWA 1Q78A 2F4FA 2CVEA 3UN2A 1GXDC 3R5AA 3HJFA 5M5XB 2DR5A 5JMNA 1HNZQ 3S16H 2CDQA 5GAEU 1S4FA 2L9NA 3MUVP 3A4TA 3N5FA 5EPLA 4KY7A 2IY5B 3CE8A 1WTQA 3A3NB 1BLUA 4OHZA 1FRMA 4OEMB 2X1FA 4WF9Q 1BXTA 4Y6IA 1KHIA 3EPGA 5J2PA 5BR8L 5E4WC 3GIKA 1P1TA 3W3AA 1HNXQ 3NGRA 2A5HA 1HBNA 1XMOQ 1PJ6A 4HIKA 3VAKA 2VFTA 2GVZB 4DK1A 4NXMJ 1O80A 2NVQB 1B4OA 2OTLA 5D3GA 2KFYA 1MN9A 1XNQF 3QAEA 1RJTA 2ZTCA 2XN9C 1GM5A 1T5EA 2W7AA 1HR0W 4NLPA 4X66F 2HFNA 1WD6A 4M5LA 3MEEB 5DZ6A 4JV5Q 2Z0GA 4HLBA 2KVIA 4FZVA 1RADB 4EBEA 3HOVH 1X7VA 2UUCL 4TSSA 5HGQA 2BJ3A 3T53B 5IWAL 5KEEA 2OH2A 4LF7L 4KHPQ 1CJKA 1YTYA 3H8YA 3UR3C 1EU4A 2DR7A 1AB8A 3GQCA 4DV7L 5AT1B 1P16A 2HD3A 5J1EA 3NMRA 2JVOA 4UP8A 3TANA 4DS4A 4ZUIA 3OPKA 1OY9A 3JYTA 2M3DA 4V19X 4FYWB 1TUGB 4JBMA 3RBZA 2HHUA 4WWSA 3K5OA 3DLGB 4QU7A 3CDUA 3RZDH 1DRZA 4UQTA 3N79A 3WIUA 2IDLA 2VUMB 1FRJA 1DAXA 3D9BA 1IBKL 4BWMA 1VRTB 5HBMB 3UD3P 4X4SA 1UWBB 5JPMC 3OXLA 4KK7A 3LWMA 4OO1H 4PZ6A 1S76D 4YB5A 2G4BA 4A3JH 3RG6A 4HDGA 1PH6A 1I94F 4P7TA 4DV5L 5HY6A 2B4OA 2GIRA 2F8MA 3F8TA 1PYTA 2XM3A 4B9WA 4ZVTB 1XNQJ 2IM2A 4KKTA 1UVMA 2CPHA 1B4SA 5B0BA 1NMEB 3T9ZA 3PVXA 2J6UA 5LL6d 3P49B 2YTXA 2YV5A 4M8LA 5IT9U 4A93B 5C5MA 2CXEA 5EN1A 2E1RA 2AGQA 2ZM6F 2XS2A 2H65B 2XO6A 1I5OB 4DUTA 1JLCB 1PBAA 3H90A 3SCLE 1PA6A 2K7VA 2DHSA 2HQEA 2JA6H 1SE3A 4KT0C 5G3LF 5GVQA 4PWWA 2F0FA 4IUVA 3OHXC 3N0VA 2KZMA 1KRTA 1T3OA 4F36A 1HWIA 5A6PA 4DU9A 2DO4A 3THPA 2E2JB 2WTFA 4F26A 3I32A 1Q1KA 1QVFR 3W66A 1JOQA 5EGYA 4PYAA 2EXUA 3BG3A 3H3VI 2PO4A 4MKAA 1L2FA 1N52B 5ETNA 2B2YA 2CQPA 2AP6A 4FN5A 3A74A 2Z57B 2H5IB 1D8YA 4C2MA 2F0HA 1VK3A 2AF6A 4HSVA 4DR6Q 2AT1B 4K2LA 3PMFA 5K8OA 4HN7A 3RD4A 2KO1A 4MFBA 4TYAA 2DNQA 1X6OA 2NSCA 3HOUB 2KM8C 4BY7H 1ZZFA 2FJBB 2FUG9 4NWBA 1G291 7FD1A 4NXML 4LSLA 3KYLA 3T1HQ 1SV5B 4IKAA 4UOFA 2EK6A 1I94J 4AD6A 3A13A 2FHTA 2HIYA 4JI6Q 5IGGA 3QOJA 3F44A 2GHWA 1SPBP 4GOPA 2YH1A 4MIWA 1WI8A 3TBIB 1CJVA 2R6GA 4DL2A 4X4PA 2Z6KA 3WDNA 1R9TB 2ZM6J 3IG1B 2ALYB 2CFMA 1VQKA 3OUYA 5G3LD 1ICWA 3CMQA 1TK8A 1IBLF 1DJRD 2A6MA 1EIHA 2MJ8A 4R25A 2EFPA 3DWQA 2KN4A 4ZVPB 4HT5A 3TQEA 1EY9A 4ECUA 1BUVT 1B0PA 3Q8UA 3TWZA 3TRZA 4O4GA 1X4DA 3BZQA 4OI2A 2F40A 5E3AA 2IYGA 3NGDA 4DFPA 5I6YA 2FHKA 4EZ9A 2OCEA 3CJ0A 2GQCA 3I91A 1SNOA 3GR1A 3DHXA 4X6AH 2EIFA 3MMJA 2KH9A 2L12A 2GVAA 1VI7A 4BA1I 2F0DA 1JJ2A 4IH6A 1VQ7A 3KBGA 1HZ9A 1OO0B 3H91A 1SSOA 3DLJA 3TARA 1FGBD 1H7WA 2AQ2B 4HJAA 2BOAA 4I6AA 1N32J 2A73B 4C3KA 4USUA 2GIQA 4KKUA 1S0NA 5E7OB 2K4KA 2MZQA 2WK4A 5HVGA 1Q86C 3MOZA 1XNQL 4OZ2A 2WW4A 3MEGA 5B0EA 5ETRA 3TR5A 5LL6X 2QLWA 3FMBA 1IR1A 3UCGA 4J9VA 2N88A 5CGKA 2CDRB 2EYFA 4BCAA 1C0UA 2PQAA 1RT3A 1KD1C 2HDMA 1PO6A 3SXHA 2ROGA 3S17H 3EUNA 5I3QA 1U8SA 4DK0A 1IBLJ 4RW9B 1S6OA 3NGUA 5HROB 1U6ZA 2LP4A 3ET6A 2ZHOA 4QPTA 2XMWA 4CDFC 1GT8A 3MUMP 1B50A 2NXNA 4X2BA 2HK2A 5F8GA 1VQ5A 1TK0A 2IAJA 3EZUA 2K6AA 3LWUA 2BOSA 2ACMA 2XI3A 5HATA 3ITPA 3DRYA 5M3MB 2K5HA 4BLGA 3KJQB 1B2TA 1N48A 1WHYA 3KJFB 5IP7H 1GQEA 1ROFA 3O44A 1O7IA 5KGUA 3KUGA 1W6KA 3F2BA 4RMFA 4F3QA 3SCKE 2MKKA 2XCPA 1KLMB 4KY6A 1NSQA 4IQXA 2QJ3A 5GADC 4O0AA 1NSNS 3LP1A 5DM6Q 2B43A 1D9AA 3A7AB 4NA3A 3AOAA 2Y3YA 2YWHA 3R6GB 1LQ9A 4C1NI 2WB4A 1HZAA 4J9RA 2R7XA 3M9MB 3FSYA 4L3NA 3D54A 3R6LB 4NPOA 1B9MA 1PH8A 1QAJA 4ZVUB 4AL7A 2NUUG 3W8GA 3MPUB 3R1HA 2WB1D 2R93G 1GHJA 1XNRQ 2K8GA 2LXUA 1SN8A 1NK6A 1RWOB 1PYSB 5LM7E 1PRTD 2Z2ZA 1JLGA 2UV8A 5FDLA 3MA2B 7AT1B 2OWOA 1Y8OB 1SC6A 1NEEA 2H1EA 3V81B 3RZAA 3MVVA 2VKZG 3PEHA 3KLGB 1R8CA 2CPFA 2ZM6L 3TAQA 2X6GA 1L3TA 1QTMA 4L6TB 1UWAA 1ZYRD 1RQ0A 3SVMA 3MHYA 2R7ZH 3OVSA 1QOHA 3KTQA 2FHJD 4BBSH 5C44H 3TI0A 5DRKA 2H1YA 2ZDOA 2M8DB 4PCQA 4TY9A 5C3EH 1DFDA 3IGNA 4CKCA 3BGRA 1CFMA 4DU8A 1X4FA 4DL4A 3GE9A 3H2LA 2MYFA 4DA2A 2YQ1A 5HVFA 2VDHA 3ZZTA 3CJ2A 1NU4A 2BJEA 3FGVA 2FLNA 4A3CH 2WBMA 1KR4A 2KEEA 2QA1A 4ED3A 4A3GB 2G9OA 1UAPA 1AT1B 2JDJA 4PWDB 2ZJQQ 1E2ZA 2EK1A 1D7QA 2BRKA 3A5UA 1CI3M 2PNRC 2HLTA 3TUJC 4LF6Q 2X3DA 1P1LA 1Y69U 2MGZA 1IZ6A 1MWZA 4EQPA 3J7AV 1ZYRC 5M5WH 5KFFA 5DLFA 1N32L 3PGZA 1UCNA 4X4QA 3EVQA 1SC3B 4RHSA 3HRZC 2EBGA 3JAMi 1DGSA 4HHHA 1ONLA 4DV0L 2BE9B 2HVEA 1BWVA 5GAHI 2JA7G 4DPUA 1K1QA 1C1CA 4DR4Q 5IYBG 3WDOA 3D0HE 1YJWS 2UXBQ 1BCPD 2D5DA 2H5EA 2DGUA 2E5LF 2CZ9A 2OMLA 1DARA 4R0EA 3QJYA 4CYUA 3LO3A 4LFAL 2DJGC 1IN0A 2A2DA 3MMAB 3ONQA 2F0LA 4TQUS 3HOZB 3UE2A 3CJ4A 1X9MA 3D0IE 1IQZA 3GG1A 3RJMB 2W9AA 1EP4B 2PMZD 5IV3A 2ZXPA 4A8SA 1CHQD 5IYCG 3I5BA 2AMCB 4FYDA 4ZDNA 2L4NA 3EROA 5FJ4A 2EE1A 1WSVA 1LV5A 5B0DA 1B0TA 4IDKB 2HVHA 5CHCB 2MZRA 3AXMA 4MNOA 2FQQB 1FTRA 1X60A 1EIYB 3W5YA 2FPHX 2AYMA 3CJSA 4QIWD 3L0OA 1CG2A 1JNZB 4C3HG 4G65A 4M5IA 2M8HA 4GKKQ 1JJ2R 2MKSA 3S1RH 3IGVA 5IOCA 3PV8A 5M3FH 2B0GA 3HLUA 4F4ZA 5EX3A 3CC2S 2FZKB 3CIZA 9RUBA 4N76A 5IY0A 1AZQA 3KXDA 2WINB 5AJ3F 3M8YA 1T95A 3PFEA 4K2JA 3FKBA 4Y65A 2XLIA 4DPYA 4MIUA 3HGBA 4UOCA 3W1GA 2ZOGA 5IC4B 3CJ5A 2PGCA 2KFZA 3MECB 4QW8A 5E1FA 2L9DA 4E98A 1PTOF 1HR0Q 1AXQA 1SC1B 2WBRA 1EFID 4R4CA 5HP1B 3M8QA 2E5JA 4O3SA 3T16A 1SI9A 1Q8LA 4NMZA 3H7HB 4KKOA 4PZVA 5E5NA 5HLFB 2WVBA 1V1QA 3DMUA 1IUJA 1DURA 4FDBA 3J80L 3RAMA 1C48A 3TVZA 4ES1A 5H1SV 2V50A 2DK2A 2UUAF 2IPOB 2L41A 2Q8TA 2PFDA 3E9HA 1U1OA 3DLBA 4F04B 1FJGF 1ICEB 1FRIA 4CT9A 4KMUC 2UXDF 3C2PA 3P45B 1ESRA 4B3SQ 3QQCD 1J5EF 1WSRA 4JI2Q 4NE9C 2MQQA 2QMXA 4X4RA 2CQDA 4QY7A 2JRSA 1U1KA 4QQBX 3NBPB 4GVLA 1YLXA 2BW2A 1X32A 2GHVC 1KDCA 3K59A 4ES2A 1A3UA 3I9V9 3E2EA 3VYUA 3E0EA 3GQBA 3A8KE 4ZCLA 3JAMY 3VR1A 1VF5C 1KFDA 4CO3A 2YWKA 5E3PA 4OLPA 1UKUA 3DLKB 3GTJB 5JVG3 2V4DA 1SC4B 1KLUD 2NN6H 2DNEA 2G0CA 2DTJA 5A8WB 2F0IA 5F8MA 3P75A 3CDWA 2CG4A 5AJ3J 4DI6A 4J1MA 1HHVA 2HMIB 3M7NA 1T3NA 5L1IA 1RAIB 2AX1A 4B3TL 2B6AA 1PTOD 1J5OA 3I2ZA 3NP8A 4B9SA 1WOCA 1JB3A 3J7YI 1IKMA 4C3IG 1G4CA 1I4XA 4BXXH 1WI5A 1F3FA 2HNDB 2K33A 2O1PA 4DR3F 3ETMA 4BC9A 3TA1A 2F0VA 4RG1A 4OFZA 1OMSA 4OV1A 3KDFA 1WTPA 3NGTA 1ZM3A 1MKHA 4EFAC 3ISND 2GMHA 1TY2A 2XMTA 1C0TA 1B7YB 4CLPA 2IDEA 1SCJB 2KYZA 3HPOA 4G1PA 3DDKA 3N28A 2UUAJ 5KYLA 1T03B 1TKXA 2KCCA 3SFUA 4DX5A 1OXVA 4X64F 1SLJA 2RDIA 2HGMA 2ZNZA 2UXDJ 4I2PB 1KC8C 4OYWA 2OELA 1VQGA 5ETLA 2N3SA 1J5EJ 4DLGA 1HNIA 1L3VA 4CLSA 1S9GB 5LMUF 1O7YA 2YKMA 4ZPBA 5H1SE 3FDTA 4IG3B 3I7FA 4H0LC 2IIHA 5L9NA 2W9BB 1PTOC 4GN5A 1S1XA 2K2PA 1RBOB 2ASBA 4KHZA 1XR7A 2YNFB 3CCRS 4FPIA 1UJ5A 4PABA 1CJTA 4DCPB 2V2KA 2BMBA 4CM0A 2F0GA 2VQEJ 1PAUB 2BJDA 2ZOFA 3SI8A 4WZQA 2ZZNA 5CC4A 2VBWA 3VYTA 1HQEA 3B6YA 2HEKA 3RLNA 2O5DA 2ZWOA 1UE1A 3OL7A 2EG2A 2V8HA 4C98A 2X1GA 2F5GA 1BC6A 3Q24A 2ZWPA 5M2UA 1HXYD 1FKOA 3OR1B 3UVJA 1ZOTA 3D4DA 1PYBA 2UUTA 2V63A 3EICA 2W25A 4DR3J 2HFVA 3EYZA 3S15B 5IM0A 2HHHL 1PG5B 5FIIA 4J9QA 2QKIC 3Q83A 5KFDA 3SK6A 3M6UA 4ZJQA 1V5IB 3H0GH 3CQZH 3ZJYC 1EETA 4Y0FA 4IFYB 4X64J 2W2OP 3WC2A 5DAUA 3NNCA 2L3MA 3BVGA 4CM2A 1YQHA 3QT8A 1FNVA 1XTCD 5B0FA 3MCMA 1WTBA 3EBEA 4RX6A 3H5UA 1U24A 1OYEA 2GJFA 4P7VA 5LMUJ 2LEPA 1YITA 4JI8F 2JHEA 2W1BA 1U1RA 1YBUA 2EI5A 2FJEB 2E66A 4LVNP 2BA1A 3G4SA 5E3QA 2K7KA 4QGUA 4WFYA 3LWEA 2J0QD 1XYIA 2MZSA 4DUZL 4TY8A 1W6JA 5CH7B 1PV4A 3TNVA 3U27A 5AJ3L 1IXRA 3K89A 5A0YA 5I3UA 5EDWA 2XY5A 2PI4A 3WIVA 2Q2UA 4MYTA 1HBMB 2EYHA 1B3TA 2KI2A 2PA8D 2ZH1A 1FD2A 3DMJB 1IYJB 2J5AA 2WAQG 4G1IA 1R0AA 3GYGA 2VBXA 3GYNA 1STNA 3T1AA 1TUVA 4OIXA 1STYA 1VC5A 1NKEA 3W7BA 4RNFA 3J80c 2CNLB 3MR3A 4NLQA 1CQMA 1NJIT 4HDHA 3HM9A 2PMZE 2R7QA 4FXVA 5J2QA 2LLZA 1YRXA 1SB6A 2BM0A 2IVYA 1ZYQA 1D3WA 4ZOSA 4NXNL 1HYSB 2HHPA 2Q2HA 4FYXB 2BDPA 1SNDA 5E41A 1U6BA 1WUUA 2NZHA 5IGFA 4QF4A 3K7UC 4QIWE 3NS6A 4Y3CA 3MXNA 3CCQA 5D4PA 2UXDL 4ULLA 1X4CA 4M5GA 2MJUA 4WTYA 1EOTA 2JN4A 4ILWA 3KHRA 3J7AN 4YOEA 1H9RA 5D3DA 2JE6I 1ENFA 4POFA 4F0MA 2OPPB 2QMWA 2UZAA 1H0HB 2YY3A 2LDYA 4O0IA 5KFHA 2PW5A 1E2WA 4ATNA 4HSPA 3DFEA 3QIPB 3N6MA 4CWBA 4H7BA 1LWCB 1KWMA 2VQEL 2AWOA 4ZAIA 5AXKA 2EG1A 5ETTA 1L5UA 3QPIA 3KK1B 1G6BA 4FXDA 2XSFA 4HH1A 2J6SA 3W9HA 5KNDA 2AGPA 4DPXA 1T02A 4ZIVA 4YIJA 1U9RA 4OZ5A 5CV7A 3CCVA 5E3RA 3KK3B 1MMDA 3CJRA 1XWLA 2WVFA 3HHLA 5D78A 3H6MA 4F02A 3TP7A 1JB7A 3LF0A 4PR6A 3RR7A 1F9PA 3PW4A 4RU2A 1K47A 2ZD1B 1LTID 2D74B 3UFCX 5C6AA 2I1RA 3H40A 1EZZB 1DY3A 1S5CD 1WC0A 1WELA 2YWGA 1QILA 2VFUA 4IUQA 3SIPB 5IT9Y 2WSCC 2CPYA 1NK7A 1X9SA 3KUEA 1SYFA 5KFVA 1YJRA 3M30B 1PH2A 2XRQD 2E76C 3P8BB 1R89A 4USWA 1U4LA 5IP9G 1RZMA 1STEA 2W2QP 1D1UA 4TLQA 2QDLA 1IQTA 1N0VC 3RAQA 2A18A 1MD2D 2DNNA 1NBEB 2B2YC 1O0PA 2CRLA 3R9LA 1YEZA 1V1OA 2KHDA 4OX9Q 3JQMA 4ES3A 2C2NA 3LANA 3VGTA 1QUVA 1UJ6A 4ECQA 2W4PA 5GMKa 3PJWA 4NB3A 2JEBI 4YHHF 1VS0A 1Q81T 2HVDA 1TTHB 2F7VA 1EYGA 3FCVA 2RH3A 4J9LA 1RJJA 1TS3A 3KHHA 1Q7YT 2GVZA 3MXGA 4QJVA 2O5IC 2GX8A 2IJFA 4TYBA 1TAQA 4ALZA 5AXLA 2BJ1A 5KRUA 3S16B 5K8MA 3JXOA 1H74A 4GOPC 2HDLA 1B7FA 2QL9B 3U1NA 4LF5F 2BE2B 3P4UB 4KI0A 2OF1A 3MMCB 5D65A 4UZCA 4C9DA 2Z6KC 4K0KQ 3OXGA 3MEEA 2ZXOA 4KLKA 2FGOA 1HH2P 3BJUA 2B56A 2J7KA 4NYPA 4ECTA 4EQNA 4TKOB 3DOMB 3AEVA 3FHWA 1KTQA 2G0JA 4ECXA 4X4TA 3ZO7A 2YNGB 3UQSA 1F2MA 3RBXA 4W90B 2OTJA 1JQGA 3D3BJ 1WTWA 2YTYA 1I4RA 3TS2A 4NOHA 4QUCA 4HIDA 4ZJLA 2W9CA 5LOQA 3EM1A 4EUVA 1PRTB 1HQMC 1N5YB 3NE5B 4ID8A 5B09A 3DLGA 4K4ZA 2CQ3A 5I2YA 2M9KA 3HOVB 3IR7B 1K0VA 4YHHJ 1VRTA 5HBMA 1SJ4P 1NTGA 2DGXA 1UWBA 4L8JA 1PYOB 3DEOA 1T9HA 1NMFA 1BUXA 1F5BA 2I07B 2ATLA 1N8RT 2XS5A 1NJZA 4NKLA 3BSAA 4ZLLA 2PC6A 4LF5J 1GMWD 2HCCA 3JSBA 4X65F 1RE1B 2X69A 1GEHA 2CVIA 3MPWA 1X3PA 3BGFA 4L72B 1VLOA 1KP6A 3SXLA 3TMEA 3SE0A 3RZDB 1X4BA 2ZT9C 5GAGU 3BO3A 4ECYA 2IVMA 5L8RC 4AYBE 1LTAD 1JLCA 1R4QB 4DCOB 4DUYQ 2H4OA 5JJKA 1XERA 2E74C 3CO0P 4FXWA 1L0XB 2N82B 4X84A 4ED4A 1IWGA 2XGPA 3DWPA 1F9QA 4A3JB 4DFMA 3CC4S 1F9EB 3DU6A 4ZLPA 3M8ZA 3US5A 2B8QA 4OLOA 2FMMA 2R8GA 1S5ED 1MSWD 3WX8A 1S4ZA 2Y1LB 1II3A 4B3ML 2DHGA 2CPDA 2PA3A 3HFKA 2SXLA 3MWYW 2SNMA 2QRRA 4WIQA 4BHQA 1RT4B