4LUOA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luoA00
4A3IG 2I0QA 2VW9A 4X62Q 2EIFA 3I56A 4NPSA 4R4TA 2OCEA 3FP9A 2Z6KC 1YI2A 3S24A 5HGQA 4LF9L 1AE2A 1CKOA 4MZ9A 5BR8Q 4HIKA 1QVCA 2OTJA 2UUAL 4QGUA 2VY3A 3WWVA 1XMOL 1B7YB 3TREA 1OXTA 1I94L 3K8AA 4L5TA 4A3IH 3S17H 1KRSA 3HOZH 2UXCQ 3GTOH 1E24A 2N8NA 3RZDH 1QZGA 4DV5L 1KAWA 4A3KH 1HNZL 2GVAA 1V43A 5GAGC 4DV4L 2I5LX 3H15A 3OW2A 1PH7A 1L1OA 1J5EL 2UUCQ 4LF7L 2KCTA 1KHIA 1W2BA 1X9NA 4A3DH 3S15H 2Z0SA 4GKJQ 3E9IA 2R93G 3I55A 2Y0SG 2CWAA 5IYBH 1EIYB 4JI2L 1UE6A 4BBSH 2CCZA 2BA1A 3FHWA 4P75A 4YWLA 1UE1A 2IHFA 4DV1L 1YITA 4NXML 1VQKA 4IPHA 1G291 2PQAB 1QUQB 1YVCA 1S72A 3FKIG 5IWAL 2YYZA 3KDFB 4LF6Q 4JBKA 1JJCB 3A5UA 4LF8L 2R7ZH 1LUZA 1CSPA 5EAYA 3HKSA 4UP8A 3HOXH 1NBWA 3K0XA 1SROA 3CCMA 1X6OA 5M3FH 3GD7A 2UUAQ 3FKIH 3KLWA 4LF4L 1I94Q 3D31A 4TQUS 4JOIA 3M4OH 1VQCA 2UXBQ 4AYBG 2LSSA 4DV3L 2YU9H 2K50A 1MKHA 3EBEA 3I2ZA 4GKKQ 3BU2A 2IX0A 4A76A 4DV5Q 1GD7A 3J7A5 5HY6A 1KD1C 1HNZQ 2NZHA 3PSIA 5M3MH 4DV4Q 3GTPH 4DUZL 3L7ZC 3RN5A 1J5EQ 1HZBA 1Q7YC 1I6HH 1BBUA 4IPCA 3KFUA 4IFDI 4HJ7A 1CKNB 2E5LL 4LFBL 4X66L 4JI2Q 4DV1Q 3ER0A 4APVA 3RLNA 1IBLL 4A3GG 3OTOL 1M90C 4POFA 2YV5A 1HR0W 2XGTA 2AWNA 1OXSC 5IWAQ 4P74A 1TWHH 3GDEA 1CUKA 4LUZA 1X3EA 4JI1L 2HHHL 4JI4L 1FGUA 1LM0A 1K8AC 4LF8Q 4DR7Q 2MQHA 3GTGH 4JYAL 1VQEA 4A3EG 4A3FH 2K5NA 4QIWE 4B3TL 3GTJH 4YHHL 2JA6H 2DGYA 3S2HH 1TWGH 2NVYH 2R7FA 4Y7NH 3PIPA 4A3GH 3UE0A 1HNWL 1L1OC 1HR0L 3IRBA 4IFDG 3S16H 3DM3A 4EX5A 3PUYA 4DPGA 4C3IH 3M4PA 4P71A 4GS3A 1N34L 2D0PA 5E7NA 5IP9G 3JAMc 3JAMi 3PO3G 4H02A 5C3EH 1GKHA 3A0JA 2H5XA 5C44G 1X3GA 2IT1A 3L0OA 5GAEC 3F2DA 2ZJQA 4UY8C 3HKZE 4JV5Q 3EIVA 1L1OB 1N32Q 3VDYA 2D62A 2B29A 2K4KA 5K36G 1JT8A 4P72A 3H3VI 3U50C 4GN3B 5H1SE 4X66Q 3CCVA 4L5SA 5IP9H 1MJEA 3H0GG 1YZ6A 2B63G 5JJLA 1WYDA 4A75A 3K7AH 2RF4A 1DGSA 4JI8L 1P16A 3ULPA 3HOUH 4DR5L 4JOIC 3I4NG 5IP7H 2CWPA 3S1NH 2HHHQ 3NEMA 4JI1Q 4AQYL 4MTNA 1VQ9A 1EYGA 4B3TQ 2L15A 4UPAA 3H0GH 5JEAJ 4YCWA 4JI6L 1HNWQ 3J80c 3UDIA 1SN8A 3J80i 3G71A 1HR0Q 4L5RC 1B8AA 1WJJA 3I4NH 2KCMA 3RLOA 2Q2IA 2WAQG 4DR3L 4POGA 4QY7A 1N34Q 1A62A 3M7NA 1E3PA 1PYBA 1NMFA 1JE5A 3S14H 3GTMH 2CQOA 1MIUA 1I3QH 2ALYB 4EQ5A 3RNUA 1IZ6A 1Q82C 5FJ8G 1SR3A 4DR4L 2JK8A 1KQSA 3HOWG 3NBHB 2VQFL 1NY4A 4DR2Q 1KXLA 4OX9L 2JEBI 5LMUQ 2UXDL 2F3IA 2F52A 4DK3C 4DAYB 1VQGA 4HJAA 1U5KA 4C3JH 1K0RA 4NB3A 3CMEA 4IPDA 4IOCA 2NVXH 1P8LA 4X65Q 2PMZE 1GVPA 4JI7Q 5FJ8H 3STBD 3HOWH 4A3CG 1U0LA 4DR5Q 3RLFA 2BH2A 4LUVA 4DV6L 3F8TA 5AJ3L 2ZM6Q 2A19A 1SE8A 4BA1I 2JA7G 4J15A 2R92G 4R1JA 1FVIA 3KYHC 2N3SA 1Y1WG 2IHEA 1TWCH 1VQIA 2I5MX 3A5ZB 2Q2UA 5IYDG 3S1RH 2KENA 4UP7A 4A3CH 4LW1A 1YBYA 2JE6I 1AH9A 4HJ5A 4KLKA 4HJ9A 4DR3Q 4LFAL 1XPUA 2C35B 1KIXA 4IOAA 3CF5A 1IL2A 1N36L 1K8GA 2JA7H 4UP9A 3TRZA 2N78A 2E2JH 2D0OA 5FLMG 1OTCA 1Y1WH 5C4JH 2IX1A 2JA8G 4DR4Q 1A63A 3CCLA 2VQFQ 1XNQQ 3F2CA 4OX9Q 1BVSA 2UXDQ 2FXQA 3AEVA 5C0XI 1O7IA 4GNXA 1YJNA 1IBML 1KL9A 2R93H 3BZCA 4BY1G 4X64L 2B3GA 3L2PA 1JJ2A 2E2IH 1VQ8A 1XPOA 3CC7A 1TWFH 2JA8H 4LF9Q 4DK6C 1T9HA 3HKZG 4C3HH 3CCUA 1Q81C 3RR5A 2RHSB 3NELA 2ZTEA 1XMOQ 5AJ3Q 1R9TH 3CXCA 1YHBA 3A74A 1TWAH 4OWTB 5IYCG 3PF4A 3PGZA 3E0EA 1PHJA 2ASBA 3EN2A 2AKWB 3M9BA 1HH2P 1N33L 1OXVA 1VQ7A 1WOCA 4JBJA 4KHPL 3OYYA 4A3MG 4LF7Q 4LWCA 5C0XG 5M5YH 2UUBL 1Q12A 1YEZA 5LMNW 1N36Q 3AFPA 3CP0A 3UE1A 5GADC 3T1HL 1GM5A 4QJFA 3PUWA 5IYCH 1M1KC 4NXMQ 1VQ5A 4OWWB 2LXKA 4XTCS 4HIDA 2WB1E 1HJPA 1EFWA 2VZAA 3GO5A 4JI5L 1J6QA 4QQBX 5M5WH 1K9MC 3PO2G 4DR6L 1IBMQ 3KOJA 2MFIA 1IXRA 5LMNL 3W1GA 1EUJA 1WFQA 2KBNA 3RZOH 1XJVA 4PMWA 1HZ9A 4DV0L 1VQBA 3M85A 3KF6A 1QVFA 5GAHC 4A3JG 1Y1VG 4LF4Q 1UE5A 3HOYG 2AWOA 3PIOA 1ASYA 3CD6A 3G48A 1Q1BA 4DV3Q 4HJ8A 1PVOA 5IT9c 3W1BA 1VQMA 1G6PA 1D8LA 4A3EH 5JJKA 4P73A 3MEFA 4K0KL 1NMGA 4IFDJ 2MNAA 4DUZQ 4DV7L 2QA4A 2UUBQ 1Y1VH 2AMCB 3CCSA 3HOYH 1HZCA 4GNXC 3GTKH 4LF5L 4NXNL 2K5HA 3BJUA 2E5LQ 4PZ8A 3UDGA 3T1HQ 2Y0SE 4LFBQ 2WP8J 4AIMA 1IBLQ 3PO3H 4A4IA 3OTOQ 1S40A 3PUZA 5C44H 2KHJA 3J81j 4YWMA 4JI5Q 1HZAA 1YHQA 2OWOA 4GN5A 1L2FA 1VQLA 4DR6Q 2K75A 1EQQA 2LXJA 4YY3L 4JI4Q 5LMNQ 4RG1A 1N8RC 1V1QA 3ULLA 4GNXB 4JBWA 1SMXA 4JYAQ 2YTYA 3GTQH 1IYJB 4DV0Q 1K83H 4YHHQ 1Z47A 2B63H 1SLJA 4JG2A 3JC66 3I7FA 2I5HA 3UDFA 3GTLH 4BY7G 1JJGA 4BXXG 3KDFA 1CKMA 3ZJYC 4JI0L 3CPWA 3K7UC 4IPGA 1EIFA 4YCUA 4Y52H 3CW2C 2JA9A 4AYBE 1CSQA 3I4MG 2F4VL 1E1TA 2CFMA 3J81c 3J81i 1Q86C 3CC2A 2R6GA 1B70B 4DNIA 3CPFA 4DV7Q 2YTXA 3PUVA 2JEAI 3F1ZA 3U4ZA 4LF5Q 1YJWA 3H3VH 3M3YH 4HIMA 4GLXA 3I4MH 1NE3A 3MXNB 2RCNA 4O0AA 1VQDA 4AH6A 3CQZH 2UXBL 4BBRG 1C9OA 2CKZB 4JI8Q 1QVGA 5M5XH 1MJCA 4A93G 3AYHB 1CKNA 2WFWA 1FJGL 4DKAC 2JJQA 1SRUA 2E2HH 4B3ML 4AQYQ 1NTGA 1Q8KA 3W5OA 1PH2A 4WJ3M 2KHIA 2EXDA 5ELNA 1VQNA 4LFCL 3TS0A 4BBRH 4JI6Q 2EQSA 1XNRL 1WCMG 4GOPA 2ES2A 1PFSA 3KJOA 3KF6B 5DLQE 1SFOH 1XPRA 5IY0A 2K5VA 3ULJA 2E8GA 4GLAC 3BZKA 3NENA 1V9PA 1Y14B 1ASZA 1KRTA 2F4VQ 4BA2I 2R92H 1PH4A 1IBKL 4ALPA 3F2BA 4A3KG 4HIOA 1WCMH 2HQLA 3K81C 2VQEL 3CCRA 5IYDH 1PH5A 4OXPA 1YIJA 1BBWA 2BH8A 4A3DG 1VQ4A 2HIVA 1OXUA 5IYBG 4GKKL 4A3BG 4BBSG 3HOVG 2PI2E 1YJ9A 5FLMH 1XTDA 4GLVB 1PH3A 1L0WA 1EWIA 3SGIA 2DUDA 4IO9A 2A1AA 1X55A 1H95A 1FJGQ 4DV6Q 1BKBA 4B3MQ 4L5QA 2Q2TA 2R7ZG 5GROA 3Q8DA 4A3BH 1W3SA 3HOVH 3HOXG 1PH6A 4BY1H 2YTVA 4LFCQ 3KJPA 1XNRQ 1G51A 1I5FA 2ZTDA 5M3FG 3RN2A 2IY5B 2PNHA 4DUYL 4LNQA 4X6AH 2WAQE 4DAMA 4LFAQ 1VQPA 1VQOA 4PZ7A 1X3FA 4DR7L 2Q2HA 3D0FA 4JC0A 1IBKQ 1OXXK 2NZOA 1VS0A 1X65A 2NVQH 3KF8B 1K73C 2XTIA 4GN4B 1E22A 1LTLA 4C2MH 1D7QA 5M3MG 3CAMA 2VQEQ 1JB7A 2OQKA 1VQFA 4OWXB 4MNOA 4KHZA 4RMFA 5C0XJ 1C0AA 1Q1EA 4A3MH 5J3BA 3TEHB 4OO1I 4DR1L 5ELOA 3S1MH 1N9WA 1E1OA 1AE3A 3B6YA 4YWKA 3HFZB 3STBC 4X64Q 1S3OA 1YNXA 5FLXc 4GOPC 1E7ZA 1VQJA 2QGQA 3ICEA 2VNUD 4JV5L 3I4OA 4R4IA 3PUXA 3U4VA 1N32L 1RL2A 3PO2H 4PG3A 2QEXA 2VS1A 1UEBA 4KI0A 4QL5A 4A3FG 4B3SL 2VUMG 4FDBA 2JA6G 4IJHA 1X56A 1VQAA 1PV4A 3AQQA 2K14A 1N33Q 4DUYQ 4GOPB 3S2DH 4KHPQ 2V1CC 2AHOB 4TVAB 4A3JH 3TS2A 1WI5A 3U58A 4OO1G 3DLLA 4O2DA 1GO3E 2VL6A 3T1YL 3PCOB 2BA0A 2VUMH 5C3EG 2HIXA 1PA6A 3CCEA 1EQRA 3TQYA 2Z6KA 2JQOA 1VQ6A 1I50H 1A8VA 2MO0A 1LYLA 1Q46A 3PV0A 5C4XG 1QZHA 1HNXL 3UDXA 2PI2A 4DV2L 4DR1Q 2MO1A 1RIPA 2K52A 3G6EA 1XMQL 1KC8C 2NN6I 4JI3L 2UU9L 4A3LG 5JJIA 1K3RA 3S1QH 1C7YA 2PQAA 1QUQA 3LGJA 3HOUG 4R4QA 5C4XH 5IE8A 3K80C 3ERSX 5IP7G 3G4SA 4DR2L 3PF5A 5LMUL 1NJIC 1PH8A 2JA5G 2OTLA 4B3RL 1UE7A 2RHQB 3CCQA 2NVTH 4B3SQ 1PH9A 4X62L 2ZJPA 4A3LH 3E9HA 4X65L 4JI7L 5JEAG 3CC4A 4ME3A 4IJLA 4BY7H 4K0KQ 5BR8L 4BXXH 2GVBA 1YHAA 4PZ6A 2JA5H 4JBMA 4YCVA 2ZM6L 4NXNQ 2UXCL 4LUOA 3T1YQ 1JMCA 2NN6G 1A0IA 4WJ4A 4R4CA 2R7DA 4JCVE 2ZTCA 1VQHA 1TXYA 5GQOA 3M4QA 2UUCL 3CCJA 1HNXQ 4DV2Q 1PH1A 4YY3Q 2A8VA 4GKJL 2GN5A 2OQ0A 4XIGS 1XMQQ 1Z9FA 4R4OA 2UU9Q 4JI3Q 2ZJRA 1FL0A 3CMAA 2WB1G 2N49A 2ID0A 1UWVA 1VCIA 2HT1A 4JI0Q 1PYSB 1XNQL 1EOVA 3J7ZC 2ATWA 4A93H 3AFQA 4OONA 4B3RQ 1X54A 3HOZG 4LF6L
chains in the Genus database with same CATH superfamily
1CT1D 4F8MA 1JORA 2VW9A 3I56A 2NB0A 1E2ZA 2RQXA 5HGQA 3HRZC 4MZ9A 5BR8Q 3F2UA 4HIKA 4DK0A 3DHQA 2L12A 3I91A 1XMOL 1B7YB 3TREA 2UXBL 4L5TA 1BCPC 1E24A 3RZDH 4FF2A 4CBVA 1KAWA 1B9MA 1TIID 4IUNA 1HNZL 2GVAA 2JXMB 1XTCD 1F9RA 1V43A 5GAGC 1J5EL 2KCTA 1KHIA 1X9NA 1TY0A 3MVVA 2Z0SA 4FYDA 3I55A 1QOHA 4BBSH 4NXML 2I46A 1UE1A 3WOEA 1VQKA 4IPHA 1GUWA 1YVCA 1S72A 1OO9B 1B1ZA 3FKIG 3TP6A 1MSHA 4LF6Q 1C48A 3AU7A 4NKLA 5EAYA 2EYOA 3V96A 3CCMA 1X6OA 1GUGA 2K1BA 1PTOF 3M3YB 3BDOA 1VMCA 4LF4L 3NTHA 2H4OA 1EYDA 1I94Q 3M4OH 4AYBG 1LTTD 2LSSA 5D3DA 2YU9H 3EBEA 3X3MA 2J7ZA 4DV4Q 1HZBA 1I6HH 1SMYD 4HJ7A 4X66L 1IYVA 3ER0A 1YNJD 3NE5B 2XGTA 2AWNA 1OXSC 5IWAQ 2JA7B 3ERQA 3GDEA 1MI2A 2E2JB 4JI4L 1LM0A 2FHTA 1K8AC 1DXMA 4KJNA 2F0SA 1J9OA 4A3EG 4A3FH 1S5FD 1V1PB 3K57A 3UE0A 1DM0B 1L1OC 1HR0L 3ND9A 1EWHA 2R93B 2L4NA 3DM3A 2RDFA 3PUYA 1Q90A 3M4PA 4C3IH 4EGVA 5C3XA 4C3HB 2H5XA 2OEOA 2ZJQA 4JVZA 1NNXA 1ENFA 1N32Q 5K36G 1JT8A 4CKCA 3U50C 4GN3B 4I65A 3BG3A 3H0GG 1PTOH 1CI3M 4A75A 2RF4A 1DGSA 1U4LA 1P16A 1XWEA 4JI8L 5M5YB 1ESFA 1G2SA 2CWPA 3S1NH 1U4PA 4MTNA 4H13C 2PPBC 5BN4A 1KAAA 1LO5D 3J80i 3Q23A 4L5RC 1B8AA 3EVQA 3FMCA 5C4HA 2A6HC 5C4ZA 1STAA 3VA7A 1N34Q 1JE5A 2ALYB 3RNUA 1IZ6A 1Q82C 3AB9A 2DN8A 2EY5A 2KVMA 2VQFL 1WTHA 4DAYB 1LV9A 1SNCA 2A69D 4XQNA 4RCOA 4IPDA 2JSOA 4TKOB 2NVXH 4X65Q 2PMZE 1GVPA 4JI7Q 3HOYB 1U0LA 4DR5Q 4Q5VA 3DEOA 3F8TA 2ZM6Q 2A19A 1SE8A 3VA5A 2PZUA 4J15A 4BA1I 4R1JA 5C44B 3KYHC 1Y1WG 1I50B 1QWYA 2I5MX 2Q2UA 3S1RH 3BVGA 4LW1A 2JE6I 3A8IE 1AH9A 4DR3Q 4O1NA 3GTQB 1MBYA 1KNEA 1K8GA 2N78A 2D0OA 4I7AA 1G2TA 4DR4Q 4KN7C 3P20A 4OX9Q 2UXDQ 2FXQA 2JN4A 2DY8A 3S9WA 3L2PA 2E2IH 1XPOA 3JAME 2JA8H 1T9HA 3ITPA 3CCUA 2KEEA 3RR5A 3I4MB 3SHLA 2F0DA 5AJ3Q 4HR7B 2F0MA 3A74A 1TWAH 4OWTB 1ENCA 2EOTA 1VQ7A 4JBJA 1CQFA 1RD9D 4L6TB 1LLRD 1Q12A 3MXNA 1XX8A 1ICWA 5GADC 4FXDA 2EYJA 5IYCH 1JCKB 2Z1CA 4S3SA 1EFWA 2VZAA 3GO5A 1JOQA 1J6QA 4QQBX 5M5WH 1SNPA 4ZCKA 3MA2B 5IGEA 4DR6L 2SDFA 3MXPA 4DA2A 1IXRA 5KRUA 1EUJA 4CHTB 1HZ9A 1M4VA 2LY7A 4DV0L 3S17B 5GAHC 5CBAE 2RDGA 3KBXA 1EYAA 4A3KB 5IT9c 1VQMA 1D8LA 1LABA 4RWSC 5JJKA 4FF3A 5KEEA 3MEFA 1NMGA 4A3DB 3S15B 1Y1VH 2VB2X 3CCSA 3CKIB 3A56A 2L9HA 4NXNL 3UDGA 3QG1A 2QDBA 2Z6BA 3PO3H 5EBDA 1S40A 5CYUA 2K6AA 1BF4A 1B9NA 2C9OA 2K75A 4RGTA 3OWFA 3HOXB 1PFMA 2A6ED 1V1QA 4GNXB 5M3FB 1K0SA 1K83H 2Z8LA 1Z47A 2B63H 4JG2A 3I7FA 2I5HA 3GTLH 3KDFA 1WD1A 2K5WA 3MXGA 1EIFA 1I4GA 4YCUA 4ULLA 2JA9A 4RGMA 5J22A 4DK1A 1TVXA 1EQVA 2ZXRA 1WTXA 1Q86C 4J6HA 5EBCA 1SMYC 3FVQA 4NDXA 1B70B 4DNIA 3PUVA 3U4ZA 1A6XA 1YNJC 1VQDA 3CQZH 1HQMC 1TWHB 5D3IB 2CKZB 5IIFA 1SSOA 1KNAA 3OOCA 4DKAC 2JJQA 1A15A 2E2HH 3GTJB 3W5OA 3GV6A 5ELNA 1XNRL 3TS0A 4JI6Q 3DMUA 3KF6B 3V05A 1U4MA 2CH4W 2E8GA 2EJGC 5A2QL 1ASZA 1Y14B 1HCZA 4BA2I 1PH4A 1IBKL 2KEDA 5IT9L 5IGGA 5C4XB 5FLXE 3CCRA 5IYDH 1BBWA 1Z7TA 2BH8A 4ABNA 2HIVA 4BBSG 3HOVG 1F9QA 2F0WA 2PI2E 3HOUB 1XTDA 3SGIA 2DUDA 3D4DA 1HTLD 1EOTA 1FJGQ 4CJ1B 1UEAB 4DV6Q 4B3MQ 2K01A 4N9PA 5GROA 3K5OA 4I7ZC 4A3BH 1E0BA 4BY1H 3BYYB 3KJPA 3QB3A 4LNQA 4X6AH 2WAQE 3MFGA 1I3QB 1T5EA 1OXXK 2SOBA 3CRKC 1K73C 4DAVA 1PMRA 1E22A 5CORA 1D7QA 2I07B 2F0IA 3CAMA 2VQEQ 1EIGA 1JB7A 2OQKA 4OWXB 5C0XJ 1Q1EA 3R8BA 3TEHB 4OO1I 1H9SA 3D4WA 4KY5A 3IL8A 2PNRC 1B50A 3CU7A 3O13A 4X64Q 1V8QA 3HFZB 2O4XA 4GOPC 5EGTA 3QOJA 5KGUA 3NBHA 3D6WA 3BVMA 1C8CA 3NTKA 3HOZB 1LTAD 1AN8A 2JP1A 3I4OA 4LAAA 3PUXA 4CDEC 3PO2H 1DONA 2EJFC 2QEXA 2VS1A 1TWCB 3VYSA 1O7ZA 4CJ0B 4A3FG 5KIXA 4XT1B 2VUMG 1QJOA 2V1CC 4DNTB 1STNA 4OO1G 4C3IG 3DLLA 1GO3E 4HCEA 3T1YL 5JAVA 3PCOB 5DM63 2Z6KA 1HXYD 2JQOA 3P1HA 1A8VA 1Q46A 2QILA 1HNXL 1SNMA 4DV2L 3N6RA 1TWFB 1BQQT 3BVZA 3S1QH 3FKIB 2MGSA 4IUTA 4R4QA 5IE8A 4DR2L 3K80C 4NP5A 3MHBA 3HGBA 1NJIC 2NVTH 1BUVT 4B3SQ 4KKUA 1PH9A 3BS1A 4A3LH 1SEBD 4BY7H 4IJLA 4K0KQ 4AYBB 2JA5H 4JBMA 4YCVA 5EQ0A 2UXCL 3NSWA 2AUKA 4LUOA 5KNCA 1QILA 4M1UB 1I4QA 2R7DA 2RVLA 2E75C 1PFNA 4X3KA 1ZEQX 1RCVD 4YY3Q 2A8VA 4GKJL 2GN5A 1B2TA 2OQ0A 4TRDA 4JI3Q 2ZJRA 1FR3A 2N49A 2ID0A 1VCIA 1D1KA 1PYSB 4JI0Q 1EOVA 1E2VA 3J7ZC 4B3RQ 1X54A 1PVOA 5E3FA 1F2YA 2BE5C 1EEID 4CDCC 4NPSA 1V1PA 2OCEA 3FP9A 1CQVA 1AE2A 2K32A 2XSCA 3M7GA 1B4OA 1STEA 3NWTA 1DOKA 1HA6A 3K8AA 4A3IH 3GTOH 2N8NA 3E0JA 3SVMA 2N55A 4DV5L 2XVSA 1RTNA 3R2IA 2A6EC 1R4QB 1SE2A 5C6AA 1LT5D 3H0GB 3E9IA 1EIYB 1UE6A 2BA1A 4P75A 1DYQA 1TKWB 4IUUA 4TSSA 4YWLA 3H3VC 5C5MA 1G291 3NQIA 2PQAB 1EZ6A 1QUQB 1A3VA 1SBBB 2YYZA 3KDFB 3UI2A 1EY8A 3MEHA 5I2XA 1JJCB 4LF8L 3GTMB 5F2DA 1LUZA 4CJ2C 4G7OC 3T4AC 3W2DA 1JC7A 4RA8A 2UXBQ 1VQCA 3I3CA 3HEJA 2Q8TA 4DV3L 1DJRD 3I2ZA 4WFN3 2Z4HA 4A76A 1GD7A 3J7A5 5HY6A 1HNZQ 3PSIA 3GTPH 1STBA 4DUZL 1J5EQ 1A3TA 2VXWA 3KFUA 1YNND 4DAYA 2KJXA 1SE4A 4IURA 4APVA 3V2TA 1IBLL 1SFOB 2AQ1B 1HR0W 2ZXOA 4KKSA 4JI1L 4DR7Q 1Y1WB 2MQHA 5C4JB 2IX3A 1VQEA 4U673 4B3TL 2K5NA 4ZQ3A 2F1MA 3S2HH 4A3GH 1ZYRD 1TWGH 4Y7NH 3PIPA 2IPKD 1PFBA 3IRBA 4EX5A 5E1FA 5E7NA 5IP9G 2XRSD 3PO3G 5C3EH 3A0JA 4C1NK 5GAEC 4UY8C 4R9WA 1R9TB 4JV5Q 3EIVA 2D62A 1TY2A 4X66Q 1MJEA 2B63G 1SYDA 3K7AH 3ULPA 2SNSA 3I4NG 5IP7H 3NEMA 2NVQB 1TR5A 1VQ9A 1G91A 5ELDA 2L15A 5JEAJ 4YCWA 2IW3A 2PO4A 2M2LA 1SN8A 4NW2A 3G71A 2CH4A 1HR0Q 3RLOA 2WAQG 5KYIA 3RZOB 1DOMA 4POGA 4QY7A 1E3PA 3S14H 3FPPA 4KD4A 3LNNA 1VF5C 5IGCA 4DF7A 1SR3A 4K6DA 2JK8A 5FJ8G 1KQSA 3HOWG 2DY7A 3NBHB 5D65A 3G7LA 2JEBI 5LMUQ 4DK3C 4XYOA 1VQGA 3A55A 2ZXPA 4NB3A 3CMEA 3RUZA 4A3CG 3RLFA 1D1IA 2BH2A 1TQOA 4LUVA 1K8OA 1L0XB 2OXPA 1IW7D 3MAQA 1EWCA 3OPOA 5A35A 2LFNA 1VQIA 1O7YA 5IYDG 2B2TA 2KENA 4UP7A 5ELCA 3I90A 4KLKA 1XPUA 4LFAL 2KUMA 5EKKA 4EVOA 2JA7H 1N36L 1CK1A 4UP9A 3TRZA 2E2JH 2F0TA 4KJOA 2IX1A 4PMBA 5FKAC 1A63A 2VQFQ 1XNQQ 3F2CA 4IQZA 1BVSA 5C0XI 5A2QE 4GNXA 1YJNA 1KL9A 3EROA 1IBML 2R93H 4BY1G 3SEBA 2B3GA 3A8JE 1GUSA 1A2UA 1RKNA 3C1EA 4DK6C 4LF9Q 1IKLA 1JWMD 4C3HH 1E2WA 3NELA 2RSNA 4RHRA 5M5XB 4QCLA 1OXVA 2D9UA 5JJZA 4LF7Q 2IJ0A 4LWCA 5C0XG 5M5YH 1JWUD 1FGBD 3OSOA 1TU2B 1LTID 2FMMA 4ODGA 3T1HL 4QJFA 3EA6A 3SR1A 1VQ5A 3VYRA 2WB1E 2IWHA 4JI5L 3J80E 5C3WA 3PO2G 2KA7A 3VR6A 3KOJA 3WOFA 5I6YA 5LMNL 4PQXA 2KBNA 3FPUB 2EY2A 1XJVA 2ICIA 3QO2A 2J0TD 4PMWA 3FRPB 1WTRA 3AMUA 3M85A 3KF6A 3OMCA 1F77A 3A8KE 1WTQA 1D5ZC 3PIOA 1ASYA 4RKLA 3LX0A 4P73A 3HP3A 3R3OA 4IFDJ 1RHPA 3TN2A 1X3PA 3EQLC 3TP7A 4IFDH 3HOYH 4BBSB 4LF5L 3HOVB 2E5LQ 2M9VA 4LFBQ 1KLUD 4CDDC 1F9PA 4AIMA 4A4IA 3OTOQ 1ET6A 5C44H 3MFYA 5BN3A 1CA5A 3H94A 2N88A 1WTWA 1HZAA 4GN5A 1WVLA 4DR6Q 3T16A 2LXJA 2H1EA 3ULLA 1SJHD 4C2MB 4JYAQ 2YTYA 3GTQH 4DV0Q 4YHHQ 4BY7G 3M4OB 2F0JA 2YU9B 1IKMA 5IGDA 1CSQA 1G6ZA 5EKLA 1EFID 4KV6A 3J81c 1PRTF 1I6HB 1YNNC 3DWPA 3CPFA 2JEAI 4P2CB 1NR2A 2A68D 2K5QA 4FF4A 3H3VH 3OWEB 4HIMA 4GLXA 3I4MH 4O0AA 3U9SA 4JPBW 1AFPA 3NWSA 1MD2D 4BBRG 2CHBD 1G8ZD 2XIWA 2WFWA 1I4PA 5I2YA 4A3FB 4AQYQ 1Q8KA 2VUMB 1EY7A 1ZYRC 1PH2A 3E3XA 2NTSA 2PMZB 1VQNA 4LFCL 1Y8NB 4IUPA 1WCMG 2ES2A 1PFSA 3KJOA 4C3IB 5DLQE 1AZQA 2FFKB 1XPRA 4GLAC 3BZKA 3NENA 1LT4D 1X32A 4LMQD 2R92H 1RODA 1GHJA 3F2BA 4HIOA 1HPCA 2HCCA 1UNSA 4OXPA 1O7LA 4CGYB 1OXUA 5CMDA 3MWYW 4OIKA 1YJ9A 5FLMH 4IZ8A 1Q3LA 4N8FA 1EWIA 1L0WA 4IO9A 1VF7A 2F0QA 3SDZA 3BDLA 4IUQA 1XNRQ 2YTVA 3KLRA 1G51A 1V1OA 1I5FA 1W6JA 2ZTDA 2IY5B 4DUYL 4DAMA 4OHJA 1VQOA 1X3FA 4JC0A 1M8AA 1IBKQ 2G9HD 1VS0A 1X65A 4G7HC 3KF8B 2XTIA 2EPBA 1D5XC 4GN4B 3I72A 1LTLA 3J81L 4A93B 1VDZA 1NAPA 4RMFA 1C0AA 2XWJB 4A3MH 5J3BA 4DR1L 3S1MH 1N9WA 1E1OA 1AE3A 4YWKA 1RTOA 1S3OA 1YNXA 5IGFA 2RCFA 1IW7C 3ICEA 2VNUD 1RJTA 5CV5A 5KNBA 3U4VA 4B08A 1N32L 2F3WA 4PG3A 4UAIA 4JK1C 1UEBA 4QL5A 2F0NA 1O80A 1PV4A 1N33Q 4KHPQ 2WINB 4TVAB 4A3JH 1WI5A 3U58A 1PRTB 4O2DA 4K2LA 2VL6A 5DAUA 2BA0A 5CV6A 5C3EG 1LTSD 1H9KA 4FXGC 2F0GA 3QIAA 3SK6A 2O5IC 4K2KA 3T56B 2RBMA 1GHKA 1I4RA 1JE4A 1KC8C 2D5DA 2UU9L 2DNEA 1D6EC 2PQAA 1QUQA 3LGJA 1EYCA 5C4XH 5IP7G 3TS2A 4PV1C 3G4SA 3PF5A 1PH8A 2OTLA 1EY9A 3CCQA 1NSNS 1X3QA 4X62L 4G7ZC 1QNKA 1PLFA 4X65L 2PZWA 5JEAG 4JI7L 1ET9A 2GVBA 5NUCA 2HUGA 1K28A 2ZM6L 1JMCA 3T1YQ 1A3UA 4R4CA 1JOOA 2ICEC 3RD4A 5LL6S 1EY6A 3M4QA 4QUCA 2UUCL 5AFWA 1HNXQ 4DV2Q 3D3RA 1B44D 4K5XA 4WRDA 2RSOA 4FNFA 5FK9C 4FVMA 2K5DA 2NN6H 2E76C 1CZGA 1Z9FA 2NVYB 3NK9A 1DOLA 1BOSA 3CMAA 2WB1G 1UWVA 2OF1A 5EPKA 4OONA 2WP8J 2B2VA 2EZVA 5JVH3 2EIFA 1JOKA 1YI2A 2Z6KC 2WIIB 3S24A 1CKOA 1IYUA 1K8MA 2UUAL 4QGUA 2VY3A 3A7LA 4K6LA 3HOZH 1OXTA 1I4XA 1PRTD 3URYA 3PO3B 2UXCQ 1KRSA 4HCSA 1QZGA 1WTOA 3HS0C 2I5LX 3H15A 3OW2A 1PH7A 3PMFA 1NR4A 1STYA 1W2BA 1PZID 4GKJQ 1K83B 4RH6A 2B63B 2R93G 2EJMA 3GTLB 2F3VA 4JI2L 4R8IA 4DV1L 3ND8A 3CHBD 2IHFA 3I4NB 4C3HG 1U4RA 3FDTA 3Q22A 3MTSA 3H91A 4OGQC 2QCPX 4UHVA 4JBKA 4IN3A 1S5DD 2R7ZH 3C2PA 4UP8A 1IL8A 1SROA 2A68C 2WAQB 4X3UA 2PW7A 3FKIH 1RDPD 3KLWA 2A69C 4U68A 3D31A 4JOIA 5IGBA 4C3JB 4IUVA 1MKHA 4GKKQ 4DV5Q 3HOWB 3DWAA 1KD1C 3SK8A 1PYWD 2NZHA 4ID6A 4EQNA 5M3MH 2E2HB 1Q7YC 4IFDI 1XYIA 1HRJA 1CHPD 1SE3A 2KCNA 1S5BD 3RLNA 2X69A 5DEHA 1CHQD 4B9XA 2B2UA 1U9RA 1TS3A 2HHHL 4LF8Q 1SYCA 3J7YW 4RAUC 3GTGH 2X6LA 4QIWE 2QDLA 3T51B 2JA6H 2DGYA 1HNWL 4HN7A 2NBFA 1H9JA 2AQ2B 2IL8A 4IFDG 3S16H 2HDMA 3K0YA 4P71A 4GS3A 3JAMc 1SXTA 5C44G 1EEFD 1SNOA 1X3GA 2EYMA 2F4IA 4MIUA 5ELFA 1L1OB 3VDYA 1Y8PB 3H6MA 2B29A 4BY1B 3BYTB 3H3VI 5C5LA 5H1SE 2TMPA 1BR9A 3CCVA 4L5SA 2A5HA 3TDQA 2B2YA 4OELB 5E4XA 2L1BA 4JI1Q 2SEBD 3PIP3 4OIJA 1EYGA 4B3TQ 3H0GH 4JI6L 4LK1C 3MXUA 3MZ5A 2RA4A 1WJJA 1H9MA 2KCMA 3I70A 1NCVA 1PYBA 2VB3X 4HAEA 1NMFA 4FF1A 3GTMH 1GUNA 1MIUA 4EQ5A 1K3BC 4JW0A 1NY4A 5FO7B 4ILWA 2F52A 2B2WA 4A3EB 4HJAA 4C56C 4IOCA 1P8LA 4ZUJA 1CM9A 3STBD 2BCOA 2XNAC 3GTKB 4K5VA 2PYKA 4DV6L 1B3AA 2R92G 1FVIA 2N3SA 4DU9A 2IHEA 2C35B 4IOAA 1IL2A 2F0PA 5FLMG 3JAML 4ZYSA 1Y1WH 5C4JH 2JA8G 4RCNA 2DNCA 2D2CC 4BY7B 4X64L 4XXEA 5IODA 1EY5A 3HKZG 1HUMA 1Q81C 2F0LA 2ZTEA 1XMOQ 4ME5A 1R9TH 4QB4A 1YHBA 3QR8A 3HG9A 5LHY1 5IYCG 3PGZA 3E0EA 1PHJA 2ASBA 3EN2A 3BZDB 4K8IA 4FO2A 4A3MG 2UUBL 4J8QA 1EQTA 1N36Q 1TS4A 2K05A 5LMNW 4BBRB 2NYZD 3PUWA 5EJWA 1M1KC 4NXMQ 4OWWB 2LXKA 1LTRD 3DUZA 1K9MC 1IBMQ 3W1GA 3RZOH 1WCMB 2RDHA 1MGSA 5HGTA 3C46A 4KY7A 1VQBA 2B2TC 2F0OA 1PXUA 1QNUA 4PNYA 1PRTC 4F7XA 4A3JG 4M8AA 4ZLTF 1Y1VG 4LF4Q 5TSSA 3G48A 1Q1BA 4HJ8A 1SNQA 3W1BA 2NUCA 3GQBA 2SNMA 4K0KL 4K14A 1EU4A 4DV7L 2XN9C 2QA4A 1LT3D 1HZCA 4GNXC 1II3A 3QJYA 5LL6X 3BJUA 1A2TA 3T1HQ 2Y0SE 2K7VA 3U9OA 5M9OA 3PUZA 3LWEA 5DNFA 3J81j 2PCFB 1FNWA 4YWMA 4JI5Q 2QW7A 4ZK9B 4HEDA 1STGA 1R4PB 4XYQA 1FD7D 3ZYYX 4YY3L 4JI4Q 4GZYC 5LMNQ 1JICA 4RG1A 1N8RC 4CKBA 1SMXA 4QMGA 2F0KA 1SLJA 3UDFA 3VR3A 4JI0L 1CKMA 3ZJYC 3K7UC 4IPGA 4Y52H 4DGZA 3CW2C 2G9DA 2F4VL 1E1TA 2CFMA 3KF8A 2O5JC 1LTGD 3I8ZA 3GTPB 2QKIC 5HURA 2TSSA 3J81i 1SAPA 2R6GA 2YTXA 2NTTA 1SJED 4LF5Q 1YJWA 3M3YH 2RCNA 1B3QA 4AH6A 3S2DB 2MUYA 4H44C 1C9OA 1ML0D 3LWUA 4Z9CB 4JI8Q 5M5XH 2EVBA 3NTIA 3AYHB 1CKNA 1SRUA 1AEXA 1SNDA 2ZT9C 1BBXC 2EXDA 3VR5A 4KD3A 2EQSA 5IY0A 1NUCA 1V9PA 1KRTA 5C3EB 1PZJD 3KLSX 2FINB 3QOLA 2KHSA 1YIJA 2Z4IA 4YIJA 1IHZA 2QF7A 4A3BG 3K7AB 1ENAA 4FP5D 4RKBA 5CR3A 2B39A 1KTKA 2NZ1D 2K03A 4GLVB 5IT9E 2A1AA 2KOLA 3VYTA 2Q2TA 2R7ZG 2B8GA 1EL0A 3HOVH 4LFCQ 3Q24A 2PNHA 3S14B 4PZ7A 4DR7L 2Q2HA 3D0FA 2F0HA 2QEJC 2AUJD 4C2MH 5M3MG 5ISRA 1EZ8A 4KHZA 4MNOA 3T13A 4LJZC 2LKVA 1UUPA 3NUCA 3B6YA 3STBC 2EYHA 2WB1B 4HSVA 4ZKBB 1D2BA 1E7ZA 1VQJA 1HA5A 2QGQA 4G4KA 1BXTA 4JV5L 1FNVA 4HTHA 1LT6D 2V4DA 3RZDB 3TZDA 2JA6G 1D5MC 2F0UA 1VQAA 3AQQA 2K14A 4DUYQ 4N8X1 4GOPB 2AHOB 3OW7A 3MC0B 1PDQA 3IFDA 2VUMH 2HIXA 3TQYA 3E5SA 1I50H 2MO0A 4OO1H 4X3TA 1QZHA 3UDXA 2PI2A 4DR1Q 3E6ZX 1RIPA 3D4RA 3NQTA 3G6EA 1XMQL 3L3OC 4A3LG 5JJIA 2JYOA 2FJ2A 3ERSX 2JA5G 5LMUL 1BDOA 2Z9HA 1UE7A 2RHQB 3OIQA 5G3LD 2ZJPA 3PQIA 3HZXA 4ME3A 5BR8L 4BXXH 4PZ6A 4KHVA 4NXNQ 5FO8B 1A0IA 3Q0AA 2ZTCA 1LTBD 5J39A 1VQHA 1TXYA 3CCJA 1JWSD 1KDAA 4HSPA 2UU9Q 2P5ZX 1FL0A 3TZUA 1MSGA 4R8NA 3X3NA 4WJ3M 3GV3A 1XNQL 2ATWA 3TMEA 3AFQA 1F9SA 1KABA 5I6WA 4A93H 3GP7A 1TS5A 1Z6HA 1IYJB 4LF6L 2XRQD 3TSSA 4A3IG 2I0QA 4X62Q 4Q0FA 5EKIA 3K5NA 4K8JA 4KMUC 4R4TA 1STHA 3IFTA 4LF9L 2OTJA 1QVCA 1KDCA 5K5PA 1I94L 3WWVA 3S17H 1DCZA 1PTOB 1QE6A 4A3KH 2HCIA 3S1NB 4DV4L 1L1OA 1SDFA 2PQEA 4WJWA 2UUCQ 4LF7L 3H09A 4A3DH 4H0LC 3TP5A 2E2DC 3S15H 1WD0A 2Y0SG 2CWAA 5IYBH 2L55A 1Y69U 5JVG3 2CCZA 3FHWA 1YITA 4QF4A 1CA6A 2LMCB 5IWAL 2KECA 3SK4A 3C1FA 3A5UA 1AZPA 1CSPA 1ONLA 2RKSA 3HKSA 2Q8IB 3HOXH 1NBWA 3K0XA 4XDXA 5M3FH 4DN4M 3GD7A 1HQRD 1QCBD 1ZKOA 2UUAQ 4OEMB 4TQUS 2O2LD 3IKJA 2K50A 2NVXB 3BU2A 2IX0A 1F2LA 5COYA 2G5DA 3NXWA 4DFAA 3A7AB 3L7ZC 4MTKA 3RN5A 2K33A 1G6PA 1BBUA 4IPCA 4V0BA 2B2VC 1BCPF 1CKNB 1CZWA 2E5LL 4LFBL 4JI2Q 4DV1Q 3S1RB 3R2TA 1UAPA 2MJ8A 3OTOL 1M90C 4A3GG 4POFA 2YV5A 2J4XA 4P74A 1TWHH 2R92B 4LUZA 1CUKA 4QUFA 1X3EA 5ELBA 1FGUA 4DXGA 1WTPA 4JYAL 1S5CD 3GTJH 4YHHL 4F88A 2EY6A 1BNZA 2R7FA 2NVYH 4PMCA 4RGOS 1F2ZA 4HMIA 4DPGA 1N34L 2E2IB 1PTOD 2D0PA 3JAMi 2JA8B 2F0VA 4H02A 1GKHA 1L0YB 2BE5D 2IT1A 3L0OA 3F2DA 1DZ1A 3CRLC 3HKZE 2EYPA 2K4KA 1TWAB 2WKDA 4P72A 1FYCA 5IP9H 3W3AA 4BWGB 1YZ6A 5JJLA 3HKZB 1WYDA 5L37A 3HOUH 4DR5L 2CVRA 1B53A 2MHVA 4JOIC 2HHHQ 4AQYL 2X6GA 1GXDC 5CV7A 5I9OA 3KBGA 3VYUA 1J8IA 4UPAA 2F0EA 1HNWQ 3J80c 3UDIA 4A3MB 5M5WB 3S1MB 1JB3A 4E6IA 3I4NH 1AP0A 2Q2IA 4DR3L 1A62A 3I73A 3C3LA 3M7NA 1ZXTA 4KTAA 2CQOA 4L8JA 3EFXD 1I3QH 3KUPA 4CKEA 1TT2A 4DR4L 5DM73 3J7AF 1KXLA 2B2UC 4DR2Q 5T1GA 2Q8RE 4OX9L 2UXDL 2F3IA 4KKTA 1KDBA 1T5XD 2EDGA 1KLGD 1U5KA 4C3JH 1K0RA 2BDOA 3I4LA 2BOSA 2A74C 4A3JB 3K58A 5EPLA 5FJ8H 1Y1VB 3HOWH 1CFMA 2KCCA 4V190 2MP1A 1MHWC 2WV6D 3P7JA 1SYGA 5AJ3L 2KQ3A 2JA7G 3A54A 2K04A 1I4HA 3TP8A 3A5ZB 1TWCH 4A3CH 1XXGA 2CW0D 1YBYA 4HJ5A 4HJ9A 1EU3A 3EJIA 1KIXA 2F03A 3CF5A 1OTCA 5FOBB 2B2YC 1BCPB 4BS9A 4K5WA 3CCLA 1HUNA 4G57A 5CGKA 3AEVA 5JPNC 1O7IA 4CDFC 3BZCA 1JQYD 3DEPA 1JJ2A 1VQ8A 3TBIB 3CC7A 1TWFH 2BDNA 1HHVA 4RFBA 2RHSB 3CXCA 3CQZB 3DXJC 3KLSA 4DAPA 1EY0A 5CV4A 1S4ZA 3PF4A 1S5ED 2AKWB 2XWBB 1AW7A 3M9BA 1HH2P 1N33L 2MPMA 3J80L 1WOCA 4KHPL 3OYYA 2PZTA 2B2WC 3SE0A 1YEZA 3AFPA 3CP0A 3UE1A 1GM5A 1HFNA 2LS01 4HMJA 4XTCS 3K6OA 4HIDA 1HJPA 2DJGC 2DJFC 3K5MA 3DM1A 5KNDA 5C0XH 3OIPA 1F2MA 2M00A 2MFIA 1WFQA 2FMCA 1QVFA 1LACA 2R61A 5J1ZA 4WORA 4NMZA 3HOYG 3ONAB 1O78A 1UE5A 1TS2A 2AWOA 5JPMC 3CD6A 5JOBA 4QIWB 4DV3Q 2E74C 1BO0A 4A3EH 1GJXA 3RMHA 2MNAA 4DUZQ 1GUOA 2UUBQ 2AMCB 4A3BB 3GTKH 2K5HA 4PZ8A 3DWQA 4EQOA 2EYLA 1IBLQ 3M4YA 4XT3B 3L9AX 4DXFA 1BCPD 2KHJA 1YHQA 2OWOA 2R7ZB 1L2FA 1VQLA 3KK7A 1EQQA 5K36H 5D14A 4JBWA 5KYLA 3OMGA 2CQAA 3JC66 1SYFA 1JJGA 1VMPA 4BXXG 3CPWA 3K5LA 2L0CA 2L11A 2EY1A 4AYBE 3I4MG 5E4WC 5M3MB 2K28A 5IOCA 3CC2A 4DV7Q 3PO2B 3F1ZA 4B9WA 1NE3A 3MXNB 1FNUA 2B8FA 2ENBA 1C4QA 3QWNA 3T53B 2WKCA 5I4DA 4UDUC 1QVGA 1MJCA 4A93G 2EYFA 3OHXC 3BDCA 1FJGL 3GTGB 4B3ML 1NTGA 3Q6SA 2JA6B 2KHIA 4BBRH 5CBEE 3S16B 1QG7A 4GOPA 5EPJA 1SFOH 1PTOC 2K5VA 3ULJA 5T1IA 2F4VQ 3S1QB 4MHEA 3P75A 4ALPA 4MN3A 4A3KG 3NPPA 1WCMH 2HQLA 5CV9A 3K81C 2VQEL 1ICFB 1ILQA 4F87A 1PH5A 2NVTB 4A3DG 3SK5A 1VQ4A 5CV8A 4ZRZA 5IYBG 4GKKL 5FO9B 5I9PA 1SYEA 1Q8IA 1PH3A 2GA4B 2JA5B 1X55A 1H95A 3SXHA 4J1MA 1BKBA 1CTMA 4L5QA 1JR0D 1ESRA 3Q8DA 3G6JB 1W3SA 4FXKC 3N52A 2AQ3B 3HOXG 1PH6A 5M3FG 1GUTA 4H7BA 1HTPA 3RN2A 1W6KA 2HDLA 4LFAQ 1VQPA 1QB5D 4X3SA 4L63B 2NZOA 2NVQH 4OL7A 1H9RA 1VQFA 2C5CA 2WACA 5ELOA 3K59A 2A6HD 3NP8A 5BN5A 5FLXc 5G3LF 5CC4A 4ZKCB 3J81E 4A3IB 4R4IA 3GTOB 1RL2A 3R93A 4N9TA 4EQPA 4B3SL 4KI0A 2CW0C 4FDBA 3J7AV 4IJHA 1X56A 3S2DH 4ZUIA 2PW5A 2HD3A 1WTVA 1PA6A 3CCEA 1EQRA 1GOZA 1VQ6A 5C4XG 3PV0A 1EY4A 1LYLA 2Y0SB 3FEWX 1EIHA 2MO1A 2K52A 4O42A 2NN6I 4JI3L 1K3RA 2R3ZA 1PZKD 1C7YA 3IAYA 3HOUG 3PIO3 1I6VC 4DNRB 4KK7A 2F0FA 4B3RL 5ELEA 3VR2A 2EXZA 2HQEA 4XQJA 3E9HA 3D8GA 2L5TA 3CC4A 4XQQA 4IALA 1YHAA 1HFGA 4ZAIA 1ILPA 4KN4C 2NN6G 4WJ4A 4RHSA 2A73B 4JCVE 2EE1A 3NBIA 5JEAH 2OT2A 3D6CA 1RF2D 2NWGA 5GQOA 1PH1A 3NHHA 1H9SB 4A3GB 4C3JG 3S2HB 1TWGB 4XIGS 4Y7NB 1XMQQ 4R4OA 4C1NI 5FLXL 1DD2A 4RGNA 3WDNA 2HT1A 4KY6A 1Y8OB 3HOZG 3VR4A 1SYBA
chains in the Genus database with same CATH topology
4A3IG 2I0QA 2VW9A 4X62Q 2EIFA 3I56A 4NPSA 4R4TA 2OCEA 3FP9A 2Z6KC 1YI2A 3S24A 5HGQA 4LF9L 1AE2A 1CKOA 4MZ9A 5BR8Q 4HIKA 1QVCA 2OTJA 2UUAL 4QGUA 2VY3A 3WWVA 1XMOL 1B7YB 3TREA 1OXTA 1I94L 3K8AA 4L5TA 4A3IH 3S17H 1KRSA 3HOZH 2UXCQ 3GTOH 1E24A 2N8NA 3RZDH 1QZGA 4DV5L 1KAWA 4A3KH 1HNZL 2GVAA 1V43A 5GAGC 4DV4L 2I5LX 3H15A 3OW2A 1PH7A 1L1OA 1J5EL 2UUCQ 4LF7L 2KCTA 1KHIA 1W2BA 1X9NA 4A3DH 3S15H 2Z0SA 4GKJQ 3E9IA 2R93G 3I55A 2Y0SG 2CWAA 5IYBH 1EIYB 4JI2L 1UE6A 4BBSH 2CCZA 2BA1A 3FHWA 4P75A 4YWLA 1UE1A 2IHFA 4DV1L 1YITA 4NXML 1VQKA 4IPHA 1G291 2PQAB 1QUQB 1YVCA 1S72A 3FKIG 5IWAL 2YYZA 3KDFB 4LF6Q 4JBKA 1JJCB 3A5UA 4LF8L 2R7ZH 1LUZA 1CSPA 5EAYA 3HKSA 4UP8A 3HOXH 1NBWA 3K0XA 1SROA 3CCMA 1X6OA 5M3FH 3GD7A 2UUAQ 3FKIH 3KLWA 4LF4L 1I94Q 3D31A 4TQUS 4JOIA 3M4OH 1VQCA 2UXBQ 4AYBG 2LSSA 4DV3L 2YU9H 2K50A 1MKHA 3EBEA 3I2ZA 4GKKQ 3BU2A 2IX0A 4A76A 4DV5Q 1GD7A 3J7A5 5HY6A 1KD1C 1HNZQ 2NZHA 3PSIA 5M3MH 4DV4Q 3GTPH 4DUZL 3L7ZC 3RN5A 1J5EQ 1HZBA 1Q7YC 1I6HH 1BBUA 4IPCA 3KFUA 4IFDI 4HJ7A 1CKNB 2E5LL 4LFBL 4X66L 4JI2Q 4DV1Q 3ER0A 4APVA 3RLNA 1IBLL 4A3GG 3OTOL 1M90C 4POFA 2YV5A 1HR0W 2XGTA 2AWNA 1OXSC 5IWAQ 4P74A 1TWHH 3GDEA 1CUKA 4LUZA 1X3EA 4JI1L 2HHHL 4JI4L 1FGUA 1LM0A 1K8AC 4LF8Q 4DR7Q 2MQHA 3GTGH 4JYAL 1VQEA 4A3EG 4A3FH 2K5NA 4QIWE 4B3TL 3GTJH 4YHHL 2JA6H 2DGYA 3S2HH 1TWGH 2NVYH 2R7FA 4Y7NH 3PIPA 4A3GH 3UE0A 1HNWL 1L1OC 1HR0L 3IRBA 4IFDG 3S16H 3DM3A 4EX5A 3PUYA 4DPGA 4C3IH 3M4PA 4P71A 4GS3A 1N34L 2D0PA 5E7NA 5IP9G 3JAMc 3JAMi 3PO3G 4H02A 5C3EH 1GKHA 3A0JA 2H5XA 5C44G 1X3GA 2IT1A 3L0OA 5GAEC 3F2DA 2ZJQA 4UY8C 3HKZE 4JV5Q 3EIVA 1L1OB 1N32Q 3VDYA 2D62A 2B29A 2K4KA 5K36G 1JT8A 4P72A 3H3VI 3U50C 4GN3B 5H1SE 4X66Q 3CCVA 4L5SA 5IP9H 1MJEA 3H0GG 1YZ6A 2B63G 5JJLA 1WYDA 4A75A 3K7AH 2RF4A 1DGSA 4JI8L 1P16A 3ULPA 3HOUH 4DR5L 4JOIC 3I4NG 5IP7H 2CWPA 3S1NH 2HHHQ 3NEMA 4JI1Q 4AQYL 4MTNA 1VQ9A 1EYGA 4B3TQ 2L15A 4UPAA 3H0GH 5JEAJ 4YCWA 4JI6L 1HNWQ 3J80c 3UDIA 1SN8A 3J80i 3G71A 1HR0Q 4L5RC 1B8AA 1WJJA 3I4NH 2KCMA 3RLOA 2Q2IA 2WAQG 4DR3L 4POGA 4QY7A 1N34Q 1A62A 3M7NA 1E3PA 1PYBA 1NMFA 1JE5A 3S14H 3GTMH 2CQOA 1MIUA 1I3QH 2ALYB 4EQ5A 3RNUA 1IZ6A 1Q82C 5FJ8G 1SR3A 4DR4L 2JK8A 1KQSA 3HOWG 3NBHB 2VQFL 1NY4A 4DR2Q 1KXLA 4OX9L 2JEBI 5LMUQ 2UXDL 2F3IA 2F52A 4DK3C 4DAYB 1VQGA 4HJAA 1U5KA 4C3JH 1K0RA 4NB3A 3CMEA 4IPDA 4IOCA 2NVXH 1P8LA 4X65Q 2PMZE 1GVPA 4JI7Q 5FJ8H 3STBD 3HOWH 4A3CG 1U0LA 4DR5Q 3RLFA 2BH2A 4LUVA 4DV6L 3F8TA 5AJ3L 2ZM6Q 2A19A 1SE8A 4BA1I 2JA7G 4J15A 2R92G 4R1JA 1FVIA 3KYHC 2N3SA 1Y1WG 2IHEA 1TWCH 1VQIA 2I5MX 3A5ZB 2Q2UA 5IYDG 3S1RH 2KENA 4UP7A 4A3CH 4LW1A 1YBYA 2JE6I 1AH9A 4HJ5A 4KLKA 4HJ9A 4DR3Q 4LFAL 1XPUA 2C35B 1KIXA 4IOAA 3CF5A 1IL2A 1N36L 1K8GA 2JA7H 4UP9A 3TRZA 2N78A 2E2JH 2D0OA 5FLMG 1OTCA 1Y1WH 5C4JH 2IX1A 2JA8G 4DR4Q 1A63A 3CCLA 2VQFQ 1XNQQ 3F2CA 4OX9Q 1BVSA 2UXDQ 2FXQA 3AEVA 5C0XI 1O7IA 4GNXA 1YJNA 1IBML 1KL9A 2R93H 3BZCA 4BY1G 4X64L 2B3GA 3L2PA 1JJ2A 2E2IH 1VQ8A 1XPOA 3CC7A 1TWFH 2JA8H 4LF9Q 4DK6C 1T9HA 3HKZG 4C3HH 3CCUA 1Q81C 3RR5A 2RHSB 3NELA 2ZTEA 1XMOQ 5AJ3Q 1R9TH 3CXCA 1YHBA 3A74A 1TWAH 4OWTB 5IYCG 3PF4A 3PGZA 3E0EA 1PHJA 2ASBA 3EN2A 2AKWB 3M9BA 1HH2P 1N33L 1OXVA 1VQ7A 1WOCA 4JBJA 4KHPL 3OYYA 4A3MG 4LF7Q 4LWCA 5C0XG 5M5YH 2UUBL 1Q12A 1YEZA 5LMNW 1N36Q 3AFPA 3CP0A 3UE1A 5GADC 3T1HL 1GM5A 4QJFA 3PUWA 5IYCH 1M1KC 4NXMQ 1VQ5A 4OWWB 2LXKA 4XTCS 4HIDA 2WB1E 1HJPA 1EFWA 2VZAA 3GO5A 4JI5L 1J6QA 4QQBX 5M5WH 1K9MC 3PO2G 4DR6L 1IBMQ 3KOJA 2MFIA 1IXRA 5LMNL 3W1GA 1EUJA 1WFQA 2KBNA 3RZOH 1XJVA 4PMWA 1HZ9A 4DV0L 1VQBA 3M85A 3KF6A 1QVFA 5GAHC 4A3JG 1Y1VG 4LF4Q 1UE5A 3HOYG 2AWOA 3PIOA 1ASYA 3CD6A 3G48A 1Q1BA 4DV3Q 4HJ8A 1PVOA 5IT9c 3W1BA 1VQMA 1G6PA 1D8LA 4A3EH 5JJKA 4P73A 3MEFA 4K0KL 1NMGA 4IFDJ 2MNAA 4DUZQ 4DV7L 2QA4A 2UUBQ 1Y1VH 2AMCB 3CCSA 3HOYH 1HZCA 4GNXC 3GTKH 4LF5L 4NXNL 2K5HA 3BJUA 2E5LQ 4PZ8A 3UDGA 3T1HQ 2Y0SE 4LFBQ 2WP8J 4AIMA 1IBLQ 3PO3H 4A4IA 3OTOQ 1S40A 3PUZA 5C44H 2KHJA 3J81j 4YWMA 4JI5Q 1HZAA 1YHQA 2OWOA 4GN5A 1L2FA 1VQLA 4DR6Q 2K75A 1EQQA 2LXJA 4YY3L 4JI4Q 5LMNQ 4RG1A 1N8RC 1V1QA 3ULLA 4GNXB 4JBWA 1SMXA 4JYAQ 2YTYA 3GTQH 1IYJB 4DV0Q 1K83H 4YHHQ 1Z47A 2B63H 1SLJA 4JG2A 3JC66 3I7FA 2I5HA 3UDFA 3GTLH 4BY7G 1JJGA 4BXXG 3KDFA 1CKMA 3ZJYC 4JI0L 3CPWA 3K7UC 4IPGA 1EIFA 4YCUA 4Y52H 3CW2C 2JA9A 4AYBE 1CSQA 3I4MG 2F4VL 1E1TA 2CFMA 3J81c 3J81i 1Q86C 3CC2A 2R6GA 1B70B 4DNIA 3CPFA 4DV7Q 2YTXA 3PUVA 2JEAI 3F1ZA 3U4ZA 4LF5Q 1YJWA 3H3VH 3M3YH 4HIMA 4GLXA 3I4MH 1NE3A 3MXNB 2RCNA 4O0AA 1VQDA 4AH6A 3CQZH 2UXBL 4BBRG 1C9OA 2CKZB 4JI8Q 1QVGA 5M5XH 1MJCA 4A93G 3AYHB 1CKNA 2WFWA 1FJGL 4DKAC 2JJQA 1SRUA 2E2HH 4B3ML 4AQYQ 1NTGA 1Q8KA 3W5OA 1PH2A 4WJ3M 2KHIA 2EXDA 5ELNA 1VQNA 4LFCL 3TS0A 4BBRH 4JI6Q 2EQSA 1XNRL 1WCMG 4GOPA 2ES2A 1PFSA 3KJOA 3KF6B 5DLQE 1SFOH 1XPRA 5IY0A 2K5VA 3ULJA 2E8GA 4GLAC 3BZKA 3NENA 1V9PA 1Y14B 1ASZA 1KRTA 2F4VQ 4BA2I 2R92H 1PH4A 1IBKL 4ALPA 3F2BA 4A3KG 4HIOA 1WCMH 2HQLA 3K81C 2VQEL 3CCRA 5IYDH 1PH5A 4OXPA 1YIJA 1BBWA 2BH8A 4A3DG 1VQ4A 2HIVA 1OXUA 5IYBG 4GKKL 4A3BG 4BBSG 3HOVG 2PI2E 1YJ9A 5FLMH 1XTDA 4GLVB 1PH3A 1L0WA 1EWIA 3SGIA 2DUDA 4IO9A 2A1AA 1X55A 1H95A 1FJGQ 4DV6Q 1BKBA 4B3MQ 4L5QA 2Q2TA 2R7ZG 5GROA 3Q8DA 4A3BH 1W3SA 3HOVH 3HOXG 1PH6A 4BY1H 2YTVA 4LFCQ 3KJPA 1XNRQ 1G51A 1I5FA 2ZTDA 5M3FG 3RN2A 2IY5B 2PNHA 4DUYL 4LNQA 4X6AH 2WAQE 4DAMA 4LFAQ 1VQPA 1VQOA 4PZ7A 1X3FA 4DR7L 2Q2HA 3D0FA 4JC0A 1IBKQ 1OXXK 2NZOA 1VS0A 1X65A 2NVQH 3KF8B 1K73C 2XTIA 4GN4B 1E22A 1LTLA 4C2MH 1D7QA 5M3MG 3CAMA 2VQEQ 1JB7A 2OQKA 1VQFA 4OWXB 4MNOA 4KHZA 4RMFA 5C0XJ 1C0AA 1Q1EA 4A3MH 5J3BA 3TEHB 4OO1I 4DR1L 5ELOA 3S1MH 1N9WA 1E1OA 1AE3A 3B6YA 4YWKA 3HFZB 3STBC 4X64Q 1S3OA 1YNXA 5FLXc 4GOPC 1E7ZA 1VQJA 2QGQA 3ICEA 2VNUD 4JV5L 3I4OA 4R4IA 3PUXA 3U4VA 1N32L 1RL2A 3PO2H 4PG3A 2QEXA 2VS1A 1UEBA 4KI0A 4QL5A 4A3FG 4B3SL 2VUMG 4FDBA 2JA6G 4IJHA 1X56A 1VQAA 1PV4A 3AQQA 2K14A 1N33Q 4DUYQ 4GOPB 3S2DH 4KHPQ 2V1CC 2AHOB 4TVAB 4A3JH 3TS2A 1WI5A 3U58A 4OO1G 3DLLA 4O2DA 1GO3E 2VL6A 3T1YL 3PCOB 2BA0A 2VUMH 5C3EG 2HIXA 1PA6A 3CCEA 1EQRA 3TQYA 2Z6KA 2JQOA 1VQ6A 1I50H 1A8VA 2MO0A 1LYLA 1Q46A 3PV0A 5C4XG 1QZHA 1HNXL 3UDXA 2PI2A 4DV2L 4DR1Q 2MO1A 1RIPA 2K52A 3G6EA 1XMQL 1KC8C 2NN6I 4JI3L 2UU9L 4A3LG 5JJIA 1K3RA 3S1QH 1C7YA 2PQAA 1QUQA 3LGJA 3HOUG 4R4QA 5C4XH 5IE8A 3K80C 3ERSX 5IP7G 3G4SA 4DR2L 3PF5A 5LMUL 1NJIC 1PH8A 2JA5G 2OTLA 4B3RL 1UE7A 2RHQB 3CCQA 2NVTH 4B3SQ 1PH9A 4X62L 2ZJPA 4A3LH 3E9HA 4X65L 4JI7L 5JEAG 3CC4A 4ME3A 4IJLA 4BY7H 4K0KQ 5BR8L 4BXXH 2GVBA 1YHAA 4PZ6A 2JA5H 4JBMA 4YCVA 2ZM6L 4NXNQ 2UXCL 4LUOA 3T1YQ 1JMCA 2NN6G 1A0IA 4WJ4A 4R4CA 2R7DA 4JCVE 2ZTCA 1VQHA 1TXYA 5GQOA 3M4QA 2UUCL 3CCJA 1HNXQ 4DV2Q 1PH1A 4YY3Q 2A8VA 4GKJL 2GN5A 2OQ0A 4XIGS 1XMQQ 1Z9FA 4R4OA 2UU9Q 4JI3Q 2ZJRA 1FL0A 3CMAA 2WB1G 2N49A 2ID0A 1UWVA 1VCIA 2HT1A 4JI0Q 1PYSB 1XNQL 1EOVA 3J7ZC 2ATWA 4A93H 3AFQA 4OONA 4B3RQ 1X54A 3HOZG 4LF6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I G;  2I0Q A;  2VW9 A;  4X62 Q;  2EIF A;  3I56 A;  4NPS A;  4R4T A;  2OCE A;  3FP9 A;  2Z6K C;  1YI2 A;  3S24 A;  5HGQ A;  4LF9 L;  1AE2 A;  1CKO A;  4MZ9 A;  5BR8 Q;  4HIK A;  1QVC A;  2OTJ A;  2UUA L;  4QGU A;  2VY3 A;  3WWV A;  1XMO L;  1B7Y B;  3TRE A;  1OXT A;  1I94 L;  3K8A A;  4L5T A;  4A3I H;  3S17 H;  1KRS A;  3HOZ H;  2UXC Q;  3GTO H;  1E24 A;  2N8N A;  3RZD H;  1QZG A;  4DV5 L;  1KAW A;  4A3K H;  1HNZ L;  2GVA A;  1V43 A;  5GAG C;  4DV4 L;  2I5L X;  3H15 A;  3OW2 A;  1PH7 A;  1L1O A;  1J5E L;  2UUC Q;  4LF7 L;  2KCT A;  1KHI A;  1W2B A;  1X9N A;  4A3D H;  3S15 H;  2Z0S A;  4GKJ Q;  3E9I A;  2R93 G;  3I55 A;  2Y0S G;  2CWA A;  5IYB H;  1EIY B;  4JI2 L;  1UE6 A;  4BBS H;  2CCZ A;  2BA1 A;  3FHW A;  4P75 A;  4YWL A;  1UE1 A;  2IHF A;  4DV1 L;  1YIT A;  4NXM L;  1VQK A;  4IPH A;  1G29 1;  2PQA B;  1QUQ B;  1YVC A;  1S72 A;  3FKI G;  5IWA L;  2YYZ A;  3KDF B;  4LF6 Q;  4JBK A;  1JJC B;  3A5U A;  4LF8 L;  2R7Z H;  1LUZ A;  1CSP A;  5EAY A;  3HKS A;  4UP8 A;  3HOX H;  1NBW A;  3K0X A;  1SRO A;  3CCM A;  1X6O A;  5M3F H;  3GD7 A;  2UUA Q;  3FKI H;  3KLW A;  4LF4 L;  1I94 Q;  3D31 A;  4TQU S;  4JOI A;  3M4O H;  1VQC A;  2UXB Q;  4AYB G;  2LSS A;  4DV3 L;  2YU9 H;  2K50 A;  1MKH A;  3EBE A;  3I2Z A;  4GKK Q;  3BU2 A;  2IX0 A;  4A76 A;  4DV5 Q;  1GD7 A;  3J7A 5;  5HY6 A;  1KD1 C;  1HNZ Q;  2NZH A;  3PSI A;  5M3M H;  4DV4 Q;  3GTP H;  4DUZ L;  3L7Z C;  3RN5 A;  1J5E Q;  1HZB A;  1Q7Y C;  1I6H H;  1BBU A;  4IPC A;  3KFU A;  4IFD I;  4HJ7 A;  1CKN B;  2E5L L;  4LFB L;  4X66 L;  4JI2 Q;  4DV1 Q;  3ER0 A;  4APV A;  3RLN A;  1IBL L;  4A3G G;  3OTO L;  1M90 C;  4POF A;  2YV5 A;  1HR0 W;  2XGT A;  2AWN A;  1OXS C;  5IWA Q;  4P74 A;  1TWH H;  3GDE A;  1CUK A;  4LUZ A;  1X3E A;  4JI1 L;  2HHH L;  4JI4 L;  1FGU A;  1LM0 A;  1K8A C;  4LF8 Q;  4DR7 Q;  2MQH A;  3GTG H;  4JYA L;  1VQE A;  4A3E G;  4A3F H;  2K5N A;  4QIW E;  4B3T L;  3GTJ H;  4YHH L;  2JA6 H;  2DGY A;  3S2H H;  1TWG H;  2NVY H;  2R7F A;  4Y7N H;  3PIP A;  4A3G H;  3UE0 A;  1HNW L;  1L1O C;  1HR0 L;  3IRB A;  4IFD G;  3S16 H;  3DM3 A;  4EX5 A;  3PUY A;  4DPG A;  4C3I H;  3M4P A;  4P71 A;  4GS3 A;  1N34 L;  2D0P A;  5E7N A;  5IP9 G;  3JAM c;  3JAM i;  3PO3 G;  4H02 A;  5C3E H;  1GKH A;  3A0J A;  2H5X A;  5C44 G;  1X3G A;  2IT1 A;  3L0O A;  5GAE C;  3F2D A;  2ZJQ A;  4UY8 C;  3HKZ E;  4JV5 Q;  3EIV A;  1L1O B;  1N32 Q;  3VDY A;  2D62 A;  2B29 A;  2K4K A;  5K36 G;  1JT8 A;  4P72 A;  3H3V I;  3U50 C;  4GN3 B;  5H1S E;  4X66 Q;  3CCV A;  4L5S A;  5IP9 H;  1MJE A;  3H0G G;  1YZ6 A;  2B63 G;  5JJL A;  1WYD A;  4A75 A;  3K7A H;  2RF4 A;  1DGS A;  4JI8 L;  1P16 A;  3ULP A;  3HOU H;  4DR5 L;  4JOI C;  3I4N G;  5IP7 H;  2CWP A;  3S1N H;  2HHH Q;  3NEM A;  4JI1 Q;  4AQY L;  4MTN A;  1VQ9 A;  1EYG A;  4B3T Q;  2L15 A;  4UPA A;  3H0G H;  5JEA J;  4YCW A;  4JI6 L;  1HNW Q;  3J80 c;  3UDI A;  1SN8 A;  3J80 i;  3G71 A;  1HR0 Q;  4L5R C;  1B8A A;  1WJJ A;  3I4N H;  2KCM A;  3RLO A;  2Q2I A;  2WAQ G;  4DR3 L;  4POG A;  4QY7 A;  1N34 Q;  1A62 A;  3M7N A;  1E3P A;  1PYB A;  1NMF A;  1JE5 A;  3S14 H;  3GTM H;  2CQO A;  1MIU A;  1I3Q H;  2ALY B;  4EQ5 A;  3RNU A;  1IZ6 A;  1Q82 C;  5FJ8 G;  1SR3 A;  4DR4 L;  2JK8 A;  1KQS A;  3HOW G;  3NBH B;  2VQF L;  1NY4 A;  4DR2 Q;  1KXL A;  4OX9 L;  2JEB I;  5LMU Q;  2UXD L;  2F3I A;  2F52 A;  4DK3 C;  4DAY B;  1VQG A;  4HJA A;  1U5K A;  4C3J H;  1K0R A;  4NB3 A;  3CME A;  4IPD A;  4IOC A;  2NVX H;  1P8L A;  4X65 Q;  2PMZ E;  1GVP A;  4JI7 Q;  5FJ8 H;  3STB D;  3HOW H;  4A3C G;  1U0L A;  4DR5 Q;  3RLF A;  2BH2 A;  4LUV A;  4DV6 L;  3F8T A;  5AJ3 L;  2ZM6 Q;  2A19 A;  1SE8 A;  4BA1 I;  2JA7 G;  4J15 A;  2R92 G;  4R1J A;  1FVI A;  3KYH C;  2N3S A;  1Y1W G;  2IHE A;  1TWC H;  1VQI A;  2I5M X;  3A5Z B;  2Q2U A;  5IYD G;  3S1R H;  2KEN A;  4UP7 A;  4A3C H;  4LW1 A;  1YBY A;  2JE6 I;  1AH9 A;  4HJ5 A;  4KLK A;  4HJ9 A;  4DR3 Q;  4LFA L;  1XPU A;  2C35 B;  1KIX A;  4IOA A;  3CF5 A;  1IL2 A;  1N36 L;  1K8G A;  2JA7 H;  4UP9 A;  3TRZ A;  2N78 A;  2E2J H;  2D0O A;  5FLM G;  1OTC A;  1Y1W H;  5C4J H;  2IX1 A;  2JA8 G;  4DR4 Q;  1A63 A;  3CCL A;  2VQF Q;  1XNQ Q;  3F2C A;  4OX9 Q;  1BVS A;  2UXD Q;  2FXQ A;  3AEV A;  5C0X I;  1O7I A;  4GNX A;  1YJN A;  1IBM L;  1KL9 A;  2R93 H;  3BZC A;  4BY1 G;  4X64 L;  2B3G A;  3L2P A;  1JJ2 A;  2E2I H;  1VQ8 A;  1XPO A;  3CC7 A;  1TWF H;  2JA8 H;  4LF9 Q;  4DK6 C;  1T9H A;  3HKZ G;  4C3H H;  3CCU A;  1Q81 C;  3RR5 A;  2RHS B;  3NEL A;  2ZTE A;  1XMO Q;  5AJ3 Q;  1R9T H;  3CXC A;  1YHB A;  3A74 A;  1TWA H;  4OWT B;  5IYC G;  3PF4 A;  3PGZ A;  3E0E A;  1PHJ A;  2ASB A;  3EN2 A;  2AKW B;  3M9B A;  1HH2 P;  1N33 L;  1OXV A;  1VQ7 A;  1WOC A;  4JBJ A;  4KHP L;  3OYY A;  4A3M G;  4LF7 Q;  4LWC A;  5C0X G;  5M5Y H;  2UUB L;  1Q12 A;  1YEZ A;  5LMN W;  1N36 Q;  3AFP A;  3CP0 A;  3UE1 A;  5GAD C;  3T1H L;  1GM5 A;  4QJF A;  3PUW A;  5IYC H;  1M1K C;  4NXM Q;  1VQ5 A;  4OWW B;  2LXK A;  4XTC S;  4HID A;  2WB1 E;  1HJP A;  1EFW A;  2VZA A;  3GO5 A;  4JI5 L;  1J6Q A;  4QQB X;  5M5W H;  1K9M C;  3PO2 G;  4DR6 L;  1IBM Q;  3KOJ A;  2MFI A;  1IXR A;  5LMN L;  3W1G A;  1EUJ A;  1WFQ A;  2KBN A;  3RZO H;  1XJV A;  4PMW A;  1HZ9 A;  4DV0 L;  1VQB A;  3M85 A;  3KF6 A;  1QVF A;  5GAH C;  4A3J G;  1Y1V G;  4LF4 Q;  1UE5 A;  3HOY G;  2AWO A;  3PIO A;  1ASY A;  3CD6 A;  3G48 A;  1Q1B A;  4DV3 Q;  4HJ8 A;  1PVO A;  5IT9 c;  3W1B A;  1VQM A;  1G6P A;  1D8L A;  4A3E H;  5JJK A;  4P73 A;  3MEF A;  4K0K L;  1NMG A;  4IFD J;  2MNA A;  4DUZ Q;  4DV7 L;  2QA4 A;  2UUB Q;  1Y1V H;  2AMC B;  3CCS A;  3HOY H;  1HZC A;  4GNX C;  3GTK H;  4LF5 L;  4NXN L;  2K5H A;  3BJU A;  2E5L Q;  4PZ8 A;  3UDG A;  3T1H Q;  2Y0S E;  4LFB Q;  2WP8 J;  4AIM A;  1IBL Q;  3PO3 H;  4A4I A;  3OTO Q;  1S40 A;  3PUZ A;  5C44 H;  2KHJ A;  3J81 j;  4YWM A;  4JI5 Q;  1HZA A;  1YHQ A;  2OWO A;  4GN5 A;  1L2F A;  1VQL A;  4DR6 Q;  2K75 A;  1EQQ A;  2LXJ A;  4YY3 L;  4JI4 Q;  5LMN Q;  4RG1 A;  1N8R C;  1V1Q A;  3ULL A;  4GNX B;  4JBW A;  1SMX A;  4JYA Q;  2YTY A;  3GTQ H;  1IYJ B;  4DV0 Q;  1K83 H;  4YHH Q;  1Z47 A;  2B63 H;  1SLJ A;  4JG2 A;  3JC6 6;  3I7F A;  2I5H A;  3UDF A;  3GTL H;  4BY7 G;  1JJG A;  4BXX G;  3KDF A;  1CKM A;  3ZJY C;  4JI0 L;  3CPW A;  3K7U C;  4IPG A;  1EIF A;  4YCU A;  4Y52 H;  3CW2 C;  2JA9 A;  4AYB E;  1CSQ A;  3I4M G;  2F4V L;  1E1T A;  2CFM A;  3J81 c;  3J81 i;  1Q86 C;  3CC2 A;  2R6G A;  1B70 B;  4DNI A;  3CPF A;  4DV7 Q;  2YTX A;  3PUV A;  2JEA I;  3F1Z A;  3U4Z A;  4LF5 Q;  1YJW A;  3H3V H;  3M3Y H;  4HIM A;  4GLX A;  3I4M H;  1NE3 A;  3MXN B;  2RCN A;  4O0A A;  1VQD A;  4AH6 A;  3CQZ H;  2UXB L;  4BBR G;  1C9O A;  2CKZ B;  4JI8 Q;  1QVG A;  5M5X H;  1MJC A;  4A93 G;  3AYH B;  1CKN A;  2WFW A;  1FJG L;  4DKA C;  2JJQ A;  1SRU A;  2E2H H;  4B3M L;  4AQY Q;  1NTG A;  1Q8K A;  3W5O A;  1PH2 A;  4WJ3 M;  2KHI A;  2EXD A;  5ELN A;  1VQN A;  4LFC L;  3TS0 A;  4BBR H;  4JI6 Q;  2EQS A;  1XNR L;  1WCM G;  4GOP A;  2ES2 A;  1PFS A;  3KJO A;  3KF6 B;  5DLQ E;  1SFO H;  1XPR A;  5IY0 A;  2K5V A;  3ULJ A;  2E8G A;  4GLA C;  3BZK A;  3NEN A;  1V9P A;  1Y14 B;  1ASZ A;  1KRT A;  2F4V Q;  4BA2 I;  2R92 H;  1PH4 A;  1IBK L;  4ALP A;  3F2B A;  4A3K G;  4HIO A;  1WCM H;  2HQL A;  3K81 C;  2VQE L;  3CCR A;  5IYD H;  1PH5 A;  4OXP A;  1YIJ A;  1BBW A;  2BH8 A;  4A3D G;  1VQ4 A;  2HIV A;  1OXU A;  5IYB G;  4GKK L;  4A3B G;  4BBS G;  3HOV G;  2PI2 E;  1YJ9 A;  5FLM H;  1XTD A;  4GLV B;  1PH3 A;  1L0W A;  1EWI A;  3SGI A;  2DUD A;  4IO9 A;  2A1A A;  1X55 A;  1H95 A;  1FJG Q;  4DV6 Q;  1BKB A;  4B3M Q;  4L5Q A;  2Q2T A;  2R7Z G;  5GRO A;  3Q8D A;  4A3B H;  1W3S A;  3HOV H;  3HOX G;  1PH6 A;  4BY1 H;  2YTV A;  4LFC Q;  3KJP A;  1XNR Q;  1G51 A;  1I5F A;  2ZTD A;  5M3F G;  3RN2 A;  2IY5 B;  2PNH A;  4DUY L;  4LNQ A;  4X6A H;  2WAQ E;  4DAM A;  4LFA Q;  1VQP A;  1VQO A;  4PZ7 A;  1X3F A;  4DR7 L;  2Q2H A;  3D0F A;  4JC0 A;  1IBK Q;  1OXX K;  2NZO A;  1VS0 A;  1X65 A;  2NVQ H;  3KF8 B;  1K73 C;  2XTI A;  4GN4 B;  1E22 A;  1LTL A;  4C2M H;  1D7Q A;  5M3M G;  3CAM A;  2VQE Q;  1JB7 A;  2OQK A;  1VQF A;  4OWX B;  4MNO A;  4KHZ A;  4RMF A;  5C0X J;  1C0A A;  1Q1E A;  4A3M H;  5J3B A;  3TEH B;  4OO1 I;  4DR1 L;  5ELO A;  3S1M H;  1N9W A;  1E1O A;  1AE3 A;  3B6Y A;  4YWK A;  3HFZ B;  3STB C;  4X64 Q;  1S3O A;  1YNX A;  5FLX c;  4GOP C;  1E7Z A;  1VQJ A;  2QGQ A;  3ICE A;  2VNU D;  4JV5 L;  3I4O A;  4R4I A;  3PUX A;  3U4V A;  1N32 L;  1RL2 A;  3PO2 H;  4PG3 A;  2QEX A;  2VS1 A;  1UEB A;  4KI0 A;  4QL5 A;  4A3F G;  4B3S L;  2VUM G;  4FDB A;  2JA6 G;  4IJH A;  1X56 A;  1VQA A;  1PV4 A;  3AQQ A;  2K14 A;  1N33 Q;  4DUY Q;  4GOP B;  3S2D H;  4KHP Q;  2V1C C;  2AHO B;  4TVA B;  4A3J H;  3TS2 A;  1WI5 A;  3U58 A;  4OO1 G;  3DLL A;  4O2D A;  1GO3 E;  2VL6 A;  3T1Y L;  3PCO B;  2BA0 A;  2VUM H;  5C3E G;  2HIX A;  1PA6 A;  3CCE A;  1EQR A;  3TQY A;  2Z6K A;  2JQO A;  1VQ6 A;  1I50 H;  1A8V A;  2MO0 A;  1LYL A;  1Q46 A;  3PV0 A;  5C4X G;  1QZH A;  1HNX L;  3UDX A;  2PI2 A;  4DV2 L;  4DR1 Q;  2MO1 A;  1RIP A;  2K52 A;  3G6E A;  1XMQ L;  1KC8 C;  2NN6 I;  4JI3 L;  2UU9 L;  4A3L G;  5JJI A;  1K3R A;  3S1Q H;  1C7Y A;  2PQA A;  1QUQ A;  3LGJ A;  3HOU G;  4R4Q A;  5C4X H;  5IE8 A;  3K80 C;  3ERS X;  5IP7 G;  3G4S A;  4DR2 L;  3PF5 A;  5LMU L;  1NJI C;  1PH8 A;  2JA5 G;  2OTL A;  4B3R L;  1UE7 A;  2RHQ B;  3CCQ A;  2NVT H;  4B3S Q;  1PH9 A;  4X62 L;  2ZJP A;  4A3L H;  3E9H A;  4X65 L;  4JI7 L;  5JEA G;  3CC4 A;  4ME3 A;  4IJL A;  4BY7 H;  4K0K Q;  5BR8 L;  4BXX H;  2GVB A;  1YHA A;  4PZ6 A;  2JA5 H;  4JBM A;  4YCV A;  2ZM6 L;  4NXN Q;  2UXC L;  4LUO A;  3T1Y Q;  1JMC A;  2NN6 G;  1A0I A;  4WJ4 A;  4R4C A;  2R7D A;  4JCV E;  2ZTC A;  1VQH A;  1TXY A;  5GQO A;  3M4Q A;  2UUC L;  3CCJ A;  1HNX Q;  4DV2 Q;  1PH1 A;  4YY3 Q;  2A8V A;  4GKJ L;  2GN5 A;  2OQ0 A;  4XIG S;  1XMQ Q;  1Z9F A;  4R4O A;  2UU9 Q;  4JI3 Q;  2ZJR A;  1FL0 A;  3CMA A;  2WB1 G;  2N49 A;  2ID0 A;  1UWV A;  1VCI A;  2HT1 A;  4JI0 Q;  1PYS B;  1XNQ L;  1EOV A;  3J7Z C;  2ATW A;  4A93 H;  3AFQ A;  4OON A;  4B3R Q;  1X54 A;  3HOZ G;  4LF6 L; 
#chains in the Genus database with same CATH topology
 1CT1 D;  4F8M A;  1JOR A;  2VW9 A;  3I56 A;  2NB0 A;  1E2Z A;  2RQX A;  5HGQ A;  3HRZ C;  4MZ9 A;  5BR8 Q;  3F2U A;  4HIK A;  4DK0 A;  3DHQ A;  2L12 A;  3I91 A;  1XMO L;  1B7Y B;  3TRE A;  2UXB L;  4L5T A;  1BCP C;  1E24 A;  3RZD H;  4FF2 A;  4CBV A;  1KAW A;  1B9M A;  1TII D;  4IUN A;  1HNZ L;  2GVA A;  2JXM B;  1XTC D;  1F9R A;  1V43 A;  5GAG C;  1J5E L;  2KCT A;  1KHI A;  1X9N A;  1TY0 A;  3MVV A;  2Z0S A;  4FYD A;  3I55 A;  1QOH A;  4BBS H;  4NXM L;  2I46 A;  1UE1 A;  3WOE A;  1VQK A;  4IPH A;  1GUW A;  1YVC A;  1S72 A;  1OO9 B;  1B1Z A;  3FKI G;  3TP6 A;  1MSH A;  4LF6 Q;  1C48 A;  3AU7 A;  4NKL A;  5EAY A;  2EYO A;  3V96 A;  3CCM A;  1X6O A;  1GUG A;  2K1B A;  1PTO F;  3M3Y B;  3BDO A;  1VMC A;  4LF4 L;  3NTH A;  2H4O A;  1EYD A;  1I94 Q;  3M4O H;  4AYB G;  1LTT D;  2LSS A;  5D3D A;  2YU9 H;  3EBE A;  3X3M A;  2J7Z A;  4DV4 Q;  1HZB A;  1I6H H;  1SMY D;  4HJ7 A;  4X66 L;  1IYV A;  3ER0 A;  1YNJ D;  3NE5 B;  2XGT A;  2AWN A;  1OXS C;  5IWA Q;  2JA7 B;  3ERQ A;  3GDE A;  1MI2 A;  2E2J B;  4JI4 L;  1LM0 A;  2FHT A;  1K8A C;  1DXM A;  4KJN A;  2F0S A;  1J9O A;  4A3E G;  4A3F H;  1S5F D;  1V1P B;  3K57 A;  3UE0 A;  1DM0 B;  1L1O C;  1HR0 L;  3ND9 A;  1EWH A;  2R93 B;  2L4N A;  3DM3 A;  2RDF A;  3PUY A;  1Q90 A;  3M4P A;  4C3I H;  4EGV A;  5C3X A;  4C3H B;  2H5X A;  2OEO A;  2ZJQ A;  4JVZ A;  1NNX A;  1ENF A;  1N32 Q;  5K36 G;  1JT8 A;  4CKC A;  3U50 C;  4GN3 B;  4I65 A;  3BG3 A;  3H0G G;  1PTO H;  1CI3 M;  4A75 A;  2RF4 A;  1DGS A;  1U4L A;  1P16 A;  1XWE A;  4JI8 L;  5M5Y B;  1ESF A;  1G2S A;  2CWP A;  3S1N H;  1U4P A;  4MTN A;  4H13 C;  2PPB C;  5BN4 A;  1KAA A;  1LO5 D;  3J80 i;  3Q23 A;  4L5R C;  1B8A A;  3EVQ A;  3FMC A;  5C4H A;  2A6H C;  5C4Z A;  1STA A;  3VA7 A;  1N34 Q;  1JE5 A;  2ALY B;  3RNU A;  1IZ6 A;  1Q82 C;  3AB9 A;  2DN8 A;  2EY5 A;  2KVM A;  2VQF L;  1WTH A;  4DAY B;  1LV9 A;  1SNC A;  2A69 D;  4XQN A;  4RCO A;  4IPD A;  2JSO A;  4TKO B;  2NVX H;  4X65 Q;  2PMZ E;  1GVP A;  4JI7 Q;  3HOY B;  1U0L A;  4DR5 Q;  4Q5V A;  3DEO A;  3F8T A;  2ZM6 Q;  2A19 A;  1SE8 A;  3VA5 A;  2PZU A;  4J15 A;  4BA1 I;  4R1J A;  5C44 B;  3KYH C;  1Y1W G;  1I50 B;  1QWY A;  2I5M X;  2Q2U A;  3S1R H;  3BVG A;  4LW1 A;  2JE6 I;  3A8I E;  1AH9 A;  4DR3 Q;  4O1N A;  3GTQ B;  1MBY A;  1KNE A;  1K8G A;  2N78 A;  2D0O A;  4I7A A;  1G2T A;  4DR4 Q;  4KN7 C;  3P20 A;  4OX9 Q;  2UXD Q;  2FXQ A;  2JN4 A;  2DY8 A;  3S9W A;  3L2P A;  2E2I H;  1XPO A;  3JAM E;  2JA8 H;  1T9H A;  3ITP A;  3CCU A;  2KEE A;  3RR5 A;  3I4M B;  3SHL A;  2F0D A;  5AJ3 Q;  4HR7 B;  2F0M A;  3A74 A;  1TWA H;  4OWT B;  1ENC A;  2EOT A;  1VQ7 A;  4JBJ A;  1CQF A;  1RD9 D;  4L6T B;  1LLR D;  1Q12 A;  3MXN A;  1XX8 A;  1ICW A;  5GAD C;  4FXD A;  2EYJ A;  5IYC H;  1JCK B;  2Z1C A;  4S3S A;  1EFW A;  2VZA A;  3GO5 A;  1JOQ A;  1J6Q A;  4QQB X;  5M5W H;  1SNP A;  4ZCK A;  3MA2 B;  5IGE A;  4DR6 L;  2SDF A;  3MXP A;  4DA2 A;  1IXR A;  5KRU A;  1EUJ A;  4CHT B;  1HZ9 A;  1M4V A;  2LY7 A;  4DV0 L;  3S17 B;  5GAH C;  5CBA E;  2RDG A;  3KBX A;  1EYA A;  4A3K B;  5IT9 c;  1VQM A;  1D8L A;  1LAB A;  4RWS C;  5JJK A;  4FF3 A;  5KEE A;  3MEF A;  1NMG A;  4A3D B;  3S15 B;  1Y1V H;  2VB2 X;  3CCS A;  3CKI B;  3A56 A;  2L9H A;  4NXN L;  3UDG A;  3QG1 A;  2QDB A;  2Z6B A;  3PO3 H;  5EBD A;  1S40 A;  5CYU A;  2K6A A;  1BF4 A;  1B9N A;  2C9O A;  2K75 A;  4RGT A;  3OWF A;  3HOX B;  1PFM A;  2A6E D;  1V1Q A;  4GNX B;  5M3F B;  1K0S A;  1K83 H;  2Z8L A;  1Z47 A;  2B63 H;  4JG2 A;  3I7F A;  2I5H A;  3GTL H;  3KDF A;  1WD1 A;  2K5W A;  3MXG A;  1EIF A;  1I4G A;  4YCU A;  4ULL A;  2JA9 A;  4RGM A;  5J22 A;  4DK1 A;  1TVX A;  1EQV A;  2ZXR A;  1WTX A;  1Q86 C;  4J6H A;  5EBC A;  1SMY C;  3FVQ A;  4NDX A;  1B70 B;  4DNI A;  3PUV A;  3U4Z A;  1A6X A;  1YNJ C;  1VQD A;  3CQZ H;  1HQM C;  1TWH B;  5D3I B;  2CKZ B;  5IIF A;  1SSO A;  1KNA A;  3OOC A;  4DKA C;  2JJQ A;  1A15 A;  2E2H H;  3GTJ B;  3W5O A;  3GV6 A;  5ELN A;  1XNR L;  3TS0 A;  4JI6 Q;  3DMU A;  3KF6 B;  3V05 A;  1U4M A;  2CH4 W;  2E8G A;  2EJG C;  5A2Q L;  1ASZ A;  1Y14 B;  1HCZ A;  4BA2 I;  1PH4 A;  1IBK L;  2KED A;  5IT9 L;  5IGG A;  5C4X B;  5FLX E;  3CCR A;  5IYD H;  1BBW A;  1Z7T A;  2BH8 A;  4ABN A;  2HIV A;  4BBS G;  3HOV G;  1F9Q A;  2F0W A;  2PI2 E;  3HOU B;  1XTD A;  3SGI A;  2DUD A;  3D4D A;  1HTL D;  1EOT A;  1FJG Q;  4CJ1 B;  1UEA B;  4DV6 Q;  4B3M Q;  2K01 A;  4N9P A;  5GRO A;  3K5O A;  4I7Z C;  4A3B H;  1E0B A;  4BY1 H;  3BYY B;  3KJP A;  3QB3 A;  4LNQ A;  4X6A H;  2WAQ E;  3MFG A;  1I3Q B;  1T5E A;  1OXX K;  2SOB A;  3CRK C;  1K73 C;  4DAV A;  1PMR A;  1E22 A;  5COR A;  1D7Q A;  2I07 B;  2F0I A;  3CAM A;  2VQE Q;  1EIG A;  1JB7 A;  2OQK A;  4OWX B;  5C0X J;  1Q1E A;  3R8B A;  3TEH B;  4OO1 I;  1H9S A;  3D4W A;  4KY5 A;  3IL8 A;  2PNR C;  1B50 A;  3CU7 A;  3O13 A;  4X64 Q;  1V8Q A;  3HFZ B;  2O4X A;  4GOP C;  5EGT A;  3QOJ A;  5KGU A;  3NBH A;  3D6W A;  3BVM A;  1C8C A;  3NTK A;  3HOZ B;  1LTA D;  1AN8 A;  2JP1 A;  3I4O A;  4LAA A;  3PUX A;  4CDE C;  3PO2 H;  1DON A;  2EJF C;  2QEX A;  2VS1 A;  1TWC B;  3VYS A;  1O7Z A;  4CJ0 B;  4A3F G;  5KIX A;  4XT1 B;  2VUM G;  1QJO A;  2V1C C;  4DNT B;  1STN A;  4OO1 G;  4C3I G;  3DLL A;  1GO3 E;  4HCE A;  3T1Y L;  5JAV A;  3PCO B;  5DM6 3;  2Z6K A;  1HXY D;  2JQO A;  3P1H A;  1A8V A;  1Q46 A;  2QIL A;  1HNX L;  1SNM A;  4DV2 L;  3N6R A;  1TWF B;  1BQQ T;  3BVZ A;  3S1Q H;  3FKI B;  2MGS A;  4IUT A;  4R4Q A;  5IE8 A;  4DR2 L;  3K80 C;  4NP5 A;  3MHB A;  3HGB A;  1NJI C;  2NVT H;  1BUV T;  4B3S Q;  4KKU A;  1PH9 A;  3BS1 A;  4A3L H;  1SEB D;  4BY7 H;  4IJL A;  4K0K Q;  4AYB B;  2JA5 H;  4JBM A;  4YCV A;  5EQ0 A;  2UXC L;  3NSW A;  2AUK A;  4LUO A;  5KNC A;  1QIL A;  4M1U B;  1I4Q A;  2R7D A;  2RVL A;  2E75 C;  1PFN A;  4X3K A;  1ZEQ X;  1RCV D;  4YY3 Q;  2A8V A;  4GKJ L;  2GN5 A;  1B2T A;  2OQ0 A;  4TRD A;  4JI3 Q;  2ZJR A;  1FR3 A;  2N49 A;  2ID0 A;  1VCI A;  1D1K A;  1PYS B;  4JI0 Q;  1EOV A;  1E2V A;  3J7Z C;  4B3R Q;  1X54 A;  1PVO A;  5E3F A;  1F2Y A;  2BE5 C;  1EEI D;  4CDC C;  4NPS A;  1V1P A;  2OCE A;  3FP9 A;  1CQV A;  1AE2 A;  2K32 A;  2XSC A;  3M7G A;  1B4O A;  1STE A;  3NWT A;  1DOK A;  1HA6 A;  3K8A A;  4A3I H;  3GTO H;  2N8N A;  3E0J A;  3SVM A;  2N55 A;  4DV5 L;  2XVS A;  1RTN A;  3R2I A;  2A6E C;  1R4Q B;  1SE2 A;  5C6A A;  1LT5 D;  3H0G B;  3E9I A;  1EIY B;  1UE6 A;  2BA1 A;  4P75 A;  1DYQ A;  1TKW B;  4IUU A;  4TSS A;  4YWL A;  3H3V C;  5C5M A;  1G29 1;  3NQI A;  2PQA B;  1EZ6 A;  1QUQ B;  1A3V A;  1SBB B;  2YYZ A;  3KDF B;  3UI2 A;  1EY8 A;  3MEH A;  5I2X A;  1JJC B;  4LF8 L;  3GTM B;  5F2D A;  1LUZ A;  4CJ2 C;  4G7O C;  3T4A C;  3W2D A;  1JC7 A;  4RA8 A;  2UXB Q;  1VQC A;  3I3C A;  3HEJ A;  2Q8T A;  4DV3 L;  1DJR D;  3I2Z A;  4WFN 3;  2Z4H A;  4A76 A;  1GD7 A;  3J7A 5;  5HY6 A;  1HNZ Q;  3PSI A;  3GTP H;  1STB A;  4DUZ L;  1J5E Q;  1A3T A;  2VXW A;  3KFU A;  1YNN D;  4DAY A;  2KJX A;  1SE4 A;  4IUR A;  4APV A;  3V2T A;  1IBL L;  1SFO B;  2AQ1 B;  1HR0 W;  2ZXO A;  4KKS A;  4JI1 L;  4DR7 Q;  1Y1W B;  2MQH A;  5C4J B;  2IX3 A;  1VQE A;  4U67 3;  4B3T L;  2K5N A;  4ZQ3 A;  2F1M A;  3S2H H;  4A3G H;  1ZYR D;  1TWG H;  4Y7N H;  3PIP A;  2IPK D;  1PFB A;  3IRB A;  4EX5 A;  5E1F A;  5E7N A;  5IP9 G;  2XRS D;  3PO3 G;  5C3E H;  3A0J A;  4C1N K;  5GAE C;  4UY8 C;  4R9W A;  1R9T B;  4JV5 Q;  3EIV A;  2D62 A;  1TY2 A;  4X66 Q;  1MJE A;  2B63 G;  1SYD A;  3K7A H;  3ULP A;  2SNS A;  3I4N G;  5IP7 H;  3NEM A;  2NVQ B;  1TR5 A;  1VQ9 A;  1G91 A;  5ELD A;  2L15 A;  5JEA J;  4YCW A;  2IW3 A;  2PO4 A;  2M2L A;  1SN8 A;  4NW2 A;  3G71 A;  2CH4 A;  1HR0 Q;  3RLO A;  2WAQ G;  5KYI A;  3RZO B;  1DOM A;  4POG A;  4QY7 A;  1E3P A;  3S14 H;  3FPP A;  4KD4 A;  3LNN A;  1VF5 C;  5IGC A;  4DF7 A;  1SR3 A;  4K6D A;  2JK8 A;  5FJ8 G;  1KQS A;  3HOW G;  2DY7 A;  3NBH B;  5D65 A;  3G7L A;  2JEB I;  5LMU Q;  4DK3 C;  4XYO A;  1VQG A;  3A55 A;  2ZXP A;  4NB3 A;  3CME A;  3RUZ A;  4A3C G;  3RLF A;  1D1I A;  2BH2 A;  1TQO A;  4LUV A;  1K8O A;  1L0X B;  2OXP A;  1IW7 D;  3MAQ A;  1EWC A;  3OPO A;  5A35 A;  2LFN A;  1VQI A;  1O7Y A;  5IYD G;  2B2T A;  2KEN A;  4UP7 A;  5ELC A;  3I90 A;  4KLK A;  1XPU A;  4LFA L;  2KUM A;  5EKK A;  4EVO A;  2JA7 H;  1N36 L;  1CK1 A;  4UP9 A;  3TRZ A;  2E2J H;  2F0T A;  4KJO A;  2IX1 A;  4PMB A;  5FKA C;  1A63 A;  2VQF Q;  1XNQ Q;  3F2C A;  4IQZ A;  1BVS A;  5C0X I;  5A2Q E;  4GNX A;  1YJN A;  1KL9 A;  3ERO A;  1IBM L;  2R93 H;  4BY1 G;  3SEB A;  2B3G A;  3A8J E;  1GUS A;  1A2U A;  1RKN A;  3C1E A;  4DK6 C;  4LF9 Q;  1IKL A;  1JWM D;  4C3H H;  1E2W A;  3NEL A;  2RSN A;  4RHR A;  5M5X B;  4QCL A;  1OXV A;  2D9U A;  5JJZ A;  4LF7 Q;  2IJ0 A;  4LWC A;  5C0X G;  5M5Y H;  1JWU D;  1FGB D;  3OSO A;  1TU2 B;  1LTI D;  2FMM A;  4ODG A;  3T1H L;  4QJF A;  3EA6 A;  3SR1 A;  1VQ5 A;  3VYR A;  2WB1 E;  2IWH A;  4JI5 L;  3J80 E;  5C3W A;  3PO2 G;  2KA7 A;  3VR6 A;  3KOJ A;  3WOF A;  5I6Y A;  5LMN L;  4PQX A;  2KBN A;  3FPU B;  2EY2 A;  1XJV A;  2ICI A;  3QO2 A;  2J0T D;  4PMW A;  3FRP B;  1WTR A;  3AMU A;  3M85 A;  3KF6 A;  3OMC A;  1F77 A;  3A8K E;  1WTQ A;  1D5Z C;  3PIO A;  1ASY A;  4RKL A;  3LX0 A;  4P73 A;  3HP3 A;  3R3O A;  4IFD J;  1RHP A;  3TN2 A;  1X3P A;  3EQL C;  3TP7 A;  4IFD H;  3HOY H;  4BBS B;  4LF5 L;  3HOV B;  2E5L Q;  2M9V A;  4LFB Q;  1KLU D;  4CDD C;  1F9P A;  4AIM A;  4A4I A;  3OTO Q;  1ET6 A;  5C44 H;  3MFY A;  5BN3 A;  1CA5 A;  3H94 A;  2N88 A;  1WTW A;  1HZA A;  4GN5 A;  1WVL A;  4DR6 Q;  3T16 A;  2LXJ A;  2H1E A;  3ULL A;  1SJH D;  4C2M B;  4JYA Q;  2YTY A;  3GTQ H;  4DV0 Q;  4YHH Q;  4BY7 G;  3M4O B;  2F0J A;  2YU9 B;  1IKM A;  5IGD A;  1CSQ A;  1G6Z A;  5EKL A;  1EFI D;  4KV6 A;  3J81 c;  1PRT F;  1I6H B;  1YNN C;  3DWP A;  3CPF A;  2JEA I;  4P2C B;  1NR2 A;  2A68 D;  2K5Q A;  4FF4 A;  3H3V H;  3OWE B;  4HIM A;  4GLX A;  3I4M H;  4O0A A;  3U9S A;  4JPB W;  1AFP A;  3NWS A;  1MD2 D;  4BBR G;  2CHB D;  1G8Z D;  2XIW A;  2WFW A;  1I4P A;  5I2Y A;  4A3F B;  4AQY Q;  1Q8K A;  2VUM B;  1EY7 A;  1ZYR C;  1PH2 A;  3E3X A;  2NTS A;  2PMZ B;  1VQN A;  4LFC L;  1Y8N B;  4IUP A;  1WCM G;  2ES2 A;  1PFS A;  3KJO A;  4C3I B;  5DLQ E;  1AZQ A;  2FFK B;  1XPR A;  4GLA C;  3BZK A;  3NEN A;  1LT4 D;  1X32 A;  4LMQ D;  2R92 H;  1ROD A;  1GHJ A;  3F2B A;  4HIO A;  1HPC A;  2HCC A;  1UNS A;  4OXP A;  1O7L A;  4CGY B;  1OXU A;  5CMD A;  3MWY W;  4OIK A;  1YJ9 A;  5FLM H;  4IZ8 A;  1Q3L A;  4N8F A;  1EWI A;  1L0W A;  4IO9 A;  1VF7 A;  2F0Q A;  3SDZ A;  3BDL A;  4IUQ A;  1XNR Q;  2YTV A;  3KLR A;  1G51 A;  1V1O A;  1I5F A;  1W6J A;  2ZTD A;  2IY5 B;  4DUY L;  4DAM A;  4OHJ A;  1VQO A;  1X3F A;  4JC0 A;  1M8A A;  1IBK Q;  2G9H D;  1VS0 A;  1X65 A;  4G7H C;  3KF8 B;  2XTI A;  2EPB A;  1D5X C;  4GN4 B;  3I72 A;  1LTL A;  3J81 L;  4A93 B;  1VDZ A;  1NAP A;  4RMF A;  1C0A A;  2XWJ B;  4A3M H;  5J3B A;  4DR1 L;  3S1M H;  1N9W A;  1E1O A;  1AE3 A;  4YWK A;  1RTO A;  1S3O A;  1YNX A;  5IGF A;  2RCF A;  1IW7 C;  3ICE A;  2VNU D;  1RJT A;  5CV5 A;  5KNB A;  3U4V A;  4B08 A;  1N32 L;  2F3W A;  4PG3 A;  4UAI A;  4JK1 C;  1UEB A;  4QL5 A;  2F0N A;  1O80 A;  1PV4 A;  1N33 Q;  4KHP Q;  2WIN B;  4TVA B;  4A3J H;  1WI5 A;  3U58 A;  1PRT B;  4O2D A;  4K2L A;  2VL6 A;  5DAU A;  2BA0 A;  5CV6 A;  5C3E G;  1LTS D;  1H9K A;  4FXG C;  2F0G A;  3QIA A;  3SK6 A;  2O5I C;  4K2K A;  3T56 B;  2RBM A;  1GHK A;  1I4R A;  1JE4 A;  1KC8 C;  2D5D A;  2UU9 L;  2DNE A;  1D6E C;  2PQA A;  1QUQ A;  3LGJ A;  1EYC A;  5C4X H;  5IP7 G;  3TS2 A;  4PV1 C;  3G4S A;  3PF5 A;  1PH8 A;  2OTL A;  1EY9 A;  3CCQ A;  1NSN S;  1X3Q A;  4X62 L;  4G7Z C;  1QNK A;  1PLF A;  4X65 L;  2PZW A;  5JEA G;  4JI7 L;  1ET9 A;  2GVB A;  5NUC A;  2HUG A;  1K28 A;  2ZM6 L;  1JMC A;  3T1Y Q;  1A3U A;  4R4C A;  1JOO A;  2ICE C;  3RD4 A;  5LL6 S;  1EY6 A;  3M4Q A;  4QUC A;  2UUC L;  5AFW A;  1HNX Q;  4DV2 Q;  3D3R A;  1B44 D;  4K5X A;  4WRD A;  2RSO A;  4FNF A;  5FK9 C;  4FVM A;  2K5D A;  2NN6 H;  2E76 C;  1CZG A;  1Z9F A;  2NVY B;  3NK9 A;  1DOL A;  1BOS A;  3CMA A;  2WB1 G;  1UWV A;  2OF1 A;  5EPK A;  4OON A;  2WP8 J;  2B2V A;  2EZV A;  5JVH 3;  2EIF A;  1JOK A;  1YI2 A;  2Z6K C;  2WII B;  3S24 A;  1CKO A;  1IYU A;  1K8M A;  2UUA L;  4QGU A;  2VY3 A;  3A7L A;  4K6L A;  3HOZ H;  1OXT A;  1I4X A;  1PRT D;  3URY A;  3PO3 B;  2UXC Q;  1KRS A;  4HCS A;  1QZG A;  1WTO A;  3HS0 C;  2I5L X;  3H15 A;  3OW2 A;  1PH7 A;  3PMF A;  1NR4 A;  1STY A;  1W2B A;  1PZI D;  4GKJ Q;  1K83 B;  4RH6 A;  2B63 B;  2R93 G;  2EJM A;  3GTL B;  2F3V A;  4JI2 L;  4R8I A;  4DV1 L;  3ND8 A;  3CHB D;  2IHF A;  3I4N B;  4C3H G;  1U4R A;  3FDT A;  3Q22 A;  3MTS A;  3H91 A;  4OGQ C;  2QCP X;  4UHV A;  4JBK A;  4IN3 A;  1S5D D;  2R7Z H;  3C2P A;  4UP8 A;  1IL8 A;  1SRO A;  2A68 C;  2WAQ B;  4X3U A;  2PW7 A;  3FKI H;  1RDP D;  3KLW A;  2A69 C;  4U68 A;  3D31 A;  4JOI A;  5IGB A;  4C3J B;  4IUV A;  1MKH A;  4GKK Q;  4DV5 Q;  3HOW B;  3DWA A;  1KD1 C;  3SK8 A;  1PYW D;  2NZH A;  4ID6 A;  4EQN A;  5M3M H;  2E2H B;  1Q7Y C;  4IFD I;  1XYI A;  1HRJ A;  1CHP D;  1SE3 A;  2KCN A;  1S5B D;  3RLN A;  2X69 A;  5DEH A;  1CHQ D;  4B9X A;  2B2U A;  1U9R A;  1TS3 A;  2HHH L;  4LF8 Q;  1SYC A;  3J7Y W;  4RAU C;  3GTG H;  2X6L A;  4QIW E;  2QDL A;  3T51 B;  2JA6 H;  2DGY A;  1HNW L;  4HN7 A;  2NBF A;  1H9J A;  2AQ2 B;  2IL8 A;  4IFD G;  3S16 H;  2HDM A;  3K0Y A;  4P71 A;  4GS3 A;  3JAM c;  1SXT A;  5C44 G;  1EEF D;  1SNO A;  1X3G A;  2EYM A;  2F4I A;  4MIU A;  5ELF A;  1L1O B;  3VDY A;  1Y8P B;  3H6M A;  2B29 A;  4BY1 B;  3BYT B;  3H3V I;  5C5L A;  5H1S E;  2TMP A;  1BR9 A;  3CCV A;  4L5S A;  2A5H A;  3TDQ A;  2B2Y A;  4OEL B;  5E4X A;  2L1B A;  4JI1 Q;  2SEB D;  3PIP 3;  4OIJ A;  1EYG A;  4B3T Q;  3H0G H;  4JI6 L;  4LK1 C;  3MXU A;  3MZ5 A;  2RA4 A;  1WJJ A;  1H9M A;  2KCM A;  3I70 A;  1NCV A;  1PYB A;  2VB3 X;  4HAE A;  1NMF A;  4FF1 A;  3GTM H;  1GUN A;  1MIU A;  4EQ5 A;  1K3B C;  4JW0 A;  1NY4 A;  5FO7 B;  4ILW A;  2F52 A;  2B2W A;  4A3E B;  4HJA A;  4C56 C;  4IOC A;  1P8L A;  4ZUJ A;  1CM9 A;  3STB D;  2BCO A;  2XNA C;  3GTK B;  4K5V A;  2PYK A;  4DV6 L;  1B3A A;  2R92 G;  1FVI A;  2N3S A;  4DU9 A;  2IHE A;  2C35 B;  4IOA A;  1IL2 A;  2F0P A;  5FLM G;  3JAM L;  4ZYS A;  1Y1W H;  5C4J H;  2JA8 G;  4RCN A;  2DNC A;  2D2C C;  4BY7 B;  4X64 L;  4XXE A;  5IOD A;  1EY5 A;  3HKZ G;  1HUM A;  1Q81 C;  2F0L A;  2ZTE A;  1XMO Q;  4ME5 A;  1R9T H;  4QB4 A;  1YHB A;  3QR8 A;  3HG9 A;  5LHY 1;  5IYC G;  3PGZ A;  3E0E A;  1PHJ A;  2ASB A;  3EN2 A;  3BZD B;  4K8I A;  4FO2 A;  4A3M G;  2UUB L;  4J8Q A;  1EQT A;  1N36 Q;  1TS4 A;  2K05 A;  5LMN W;  4BBR B;  2NYZ D;  3PUW A;  5EJW A;  1M1K C;  4NXM Q;  4OWW B;  2LXK A;  1LTR D;  3DUZ A;  1K9M C;  1IBM Q;  3W1G A;  3RZO H;  1WCM B;  2RDH A;  1MGS A;  5HGT A;  3C46 A;  4KY7 A;  1VQB A;  2B2T C;  2F0O A;  1PXU A;  1QNU A;  4PNY A;  1PRT C;  4F7X A;  4A3J G;  4M8A A;  4ZLT F;  1Y1V G;  4LF4 Q;  5TSS A;  3G48 A;  1Q1B A;  4HJ8 A;  1SNQ A;  3W1B A;  2NUC A;  3GQB A;  2SNM A;  4K0K L;  4K14 A;  1EU4 A;  4DV7 L;  2XN9 C;  2QA4 A;  1LT3 D;  1HZC A;  4GNX C;  1II3 A;  3QJY A;  5LL6 X;  3BJU A;  1A2T A;  3T1H Q;  2Y0S E;  2K7V A;  3U9O A;  5M9O A;  3PUZ A;  3LWE A;  5DNF A;  3J81 j;  2PCF B;  1FNW A;  4YWM A;  4JI5 Q;  2QW7 A;  4ZK9 B;  4HED A;  1STG A;  1R4P B;  4XYQ A;  1FD7 D;  3ZYY X;  4YY3 L;  4JI4 Q;  4GZY C;  5LMN Q;  1JIC A;  4RG1 A;  1N8R C;  4CKB A;  1SMX A;  4QMG A;  2F0K A;  1SLJ A;  3UDF A;  3VR3 A;  4JI0 L;  1CKM A;  3ZJY C;  3K7U C;  4IPG A;  4Y52 H;  4DGZ A;  3CW2 C;  2G9D A;  2F4V L;  1E1T A;  2CFM A;  3KF8 A;  2O5J C;  1LTG D;  3I8Z A;  3GTP B;  2QKI C;  5HUR A;  2TSS A;  3J81 i;  1SAP A;  2R6G A;  2YTX A;  2NTT A;  1SJE D;  4LF5 Q;  1YJW A;  3M3Y H;  2RCN A;  1B3Q A;  4AH6 A;  3S2D B;  2MUY A;  4H44 C;  1C9O A;  1ML0 D;  3LWU A;  4Z9C B;  4JI8 Q;  5M5X H;  2EVB A;  3NTI A;  3AYH B;  1CKN A;  1SRU A;  1AEX A;  1SND A;  2ZT9 C;  1BBX C;  2EXD A;  3VR5 A;  4KD3 A;  2EQS A;  5IY0 A;  1NUC A;  1V9P A;  1KRT A;  5C3E B;  1PZJ D;  3KLS X;  2FIN B;  3QOL A;  2KHS A;  1YIJ A;  2Z4I A;  4YIJ A;  1IHZ A;  2QF7 A;  4A3B G;  3K7A B;  1ENA A;  4FP5 D;  4RKB A;  5CR3 A;  2B39 A;  1KTK A;  2NZ1 D;  2K03 A;  4GLV B;  5IT9 E;  2A1A A;  2KOL A;  3VYT A;  2Q2T A;  2R7Z G;  2B8G A;  1EL0 A;  3HOV H;  4LFC Q;  3Q24 A;  2PNH A;  3S14 B;  4PZ7 A;  4DR7 L;  2Q2H A;  3D0F A;  2F0H A;  2QEJ C;  2AUJ D;  4C2M H;  5M3M G;  5ISR A;  1EZ8 A;  4KHZ A;  4MNO A;  3T13 A;  4LJZ C;  2LKV A;  1UUP A;  3NUC A;  3B6Y A;  3STB C;  2EYH A;  2WB1 B;  4HSV A;  4ZKB B;  1D2B A;  1E7Z A;  1VQJ A;  1HA5 A;  2QGQ A;  4G4K A;  1BXT A;  4JV5 L;  1FNV A;  4HTH A;  1LT6 D;  2V4D A;  3RZD B;  3TZD A;  2JA6 G;  1D5M C;  2F0U A;  1VQA A;  3AQQ A;  2K14 A;  4DUY Q;  4N8X 1;  4GOP B;  2AHO B;  3OW7 A;  3MC0 B;  1PDQ A;  3IFD A;  2VUM H;  2HIX A;  3TQY A;  3E5S A;  1I50 H;  2MO0 A;  4OO1 H;  4X3T A;  1QZH A;  3UDX A;  2PI2 A;  4DR1 Q;  3E6Z X;  1RIP A;  3D4R A;  3NQT A;  3G6E A;  1XMQ L;  3L3O C;  4A3L G;  5JJI A;  2JYO A;  2FJ2 A;  3ERS X;  2JA5 G;  5LMU L;  1BDO A;  2Z9H A;  1UE7 A;  2RHQ B;  3OIQ A;  5G3L D;  2ZJP A;  3PQI A;  3HZX A;  4ME3 A;  5BR8 L;  4BXX H;  4PZ6 A;  4KHV A;  4NXN Q;  5FO8 B;  1A0I A;  3Q0A A;  2ZTC A;  1LTB D;  5J39 A;  1VQH A;  1TXY A;  3CCJ A;  1JWS D;  1KDA A;  4HSP A;  2UU9 Q;  2P5Z X;  1FL0 A;  3TZU A;  1MSG A;  4R8N A;  3X3N A;  4WJ3 M;  3GV3 A;  1XNQ L;  2ATW A;  3TME A;  3AFQ A;  1F9S A;  1KAB A;  5I6W A;  4A93 H;  3GP7 A;  1TS5 A;  1Z6H A;  1IYJ B;  4LF6 L;  2XRQ D;  3TSS A;  4A3I G;  2I0Q A;  4X62 Q;  4Q0F A;  5EKI A;  3K5N A;  4K8J A;  4KMU C;  4R4T A;  1STH A;  3IFT A;  4LF9 L;  2OTJ A;  1QVC A;  1KDC A;  5K5P A;  1I94 L;  3WWV A;  3S17 H;  1DCZ A;  1PTO B;  1QE6 A;  4A3K H;  2HCI A;  3S1N B;  4DV4 L;  1L1O A;  1SDF A;  2PQE A;  4WJW A;  2UUC Q;  4LF7 L;  3H09 A;  4A3D H;  4H0L C;  3TP5 A;  2E2D C;  3S15 H;  1WD0 A;  2Y0S G;  2CWA A;  5IYB H;  2L55 A;  1Y69 U;  5JVG 3;  2CCZ A;  3FHW A;  1YIT A;  4QF4 A;  1CA6 A;  2LMC B;  5IWA L;  2KEC A;  3SK4 A;  3C1F A;  3A5U A;  1AZP A;  1CSP A;  1ONL A;  2RKS A;  3HKS A;  2Q8I B;  3HOX H;  1NBW A;  3K0X A;  4XDX A;  5M3F H;  4DN4 M;  3GD7 A;  1HQR D;  1QCB D;  1ZKO A;  2UUA Q;  4OEM B;  4TQU S;  2O2L D;  3IKJ A;  2K50 A;  2NVX B;  3BU2 A;  2IX0 A;  1F2L A;  5COY A;  2G5D A;  3NXW A;  4DFA A;  3A7A B;  3L7Z C;  4MTK A;  3RN5 A;  2K33 A;  1G6P A;  1BBU A;  4IPC A;  4V0B A;  2B2V C;  1BCP F;  1CKN B;  1CZW A;  2E5L L;  4LFB L;  4JI2 Q;  4DV1 Q;  3S1R B;  3R2T A;  1UAP A;  2MJ8 A;  3OTO L;  1M90 C;  4A3G G;  4POF A;  2YV5 A;  2J4X A;  4P74 A;  1TWH H;  2R92 B;  4LUZ A;  1CUK A;  4QUF A;  1X3E A;  5ELB A;  1FGU A;  4DXG A;  1WTP A;  4JYA L;  1S5C D;  3GTJ H;  4YHH L;  4F88 A;  2EY6 A;  1BNZ A;  2R7F A;  2NVY H;  4PMC A;  4RGO S;  1F2Z A;  4HMI A;  4DPG A;  1N34 L;  2E2I B;  1PTO D;  2D0P A;  3JAM i;  2JA8 B;  2F0V A;  4H02 A;  1GKH A;  1L0Y B;  2BE5 D;  2IT1 A;  3L0O A;  3F2D A;  1DZ1 A;  3CRL C;  3HKZ E;  2EYP A;  2K4K A;  1TWA B;  2WKD A;  4P72 A;  1FYC A;  5IP9 H;  3W3A A;  4BWG B;  1YZ6 A;  5JJL A;  3HKZ B;  1WYD A;  5L37 A;  3HOU H;  4DR5 L;  2CVR A;  1B53 A;  2MHV A;  4JOI C;  2HHH Q;  4AQY L;  2X6G A;  1GXD C;  5CV7 A;  5I9O A;  3KBG A;  3VYU A;  1J8I A;  4UPA A;  2F0E A;  1HNW Q;  3J80 c;  3UDI A;  4A3M B;  5M5W B;  3S1M B;  1JB3 A;  4E6I A;  3I4N H;  1AP0 A;  2Q2I A;  4DR3 L;  1A62 A;  3I73 A;  3C3L A;  3M7N A;  1ZXT A;  4KTA A;  2CQO A;  4L8J A;  3EFX D;  1I3Q H;  3KUP A;  4CKE A;  1TT2 A;  4DR4 L;  5DM7 3;  3J7A F;  1KXL A;  2B2U C;  4DR2 Q;  5T1G A;  2Q8R E;  4OX9 L;  2UXD L;  2F3I A;  4KKT A;  1KDB A;  1T5X D;  2EDG A;  1KLG D;  1U5K A;  4C3J H;  1K0R A;  2BDO A;  3I4L A;  2BOS A;  2A74 C;  4A3J B;  3K58 A;  5EPL A;  5FJ8 H;  1Y1V B;  3HOW H;  1CFM A;  2KCC A;  4V19 0;  2MP1 A;  1MHW C;  2WV6 D;  3P7J A;  1SYG A;  5AJ3 L;  2KQ3 A;  2JA7 G;  3A54 A;  2K04 A;  1I4H A;  3TP8 A;  3A5Z B;  1TWC H;  4A3C H;  1XXG A;  2CW0 D;  1YBY A;  4HJ5 A;  4HJ9 A;  1EU3 A;  3EJI A;  1KIX A;  2F03 A;  3CF5 A;  1OTC A;  5FOB B;  2B2Y C;  1BCP B;  4BS9 A;  4K5W A;  3CCL A;  1HUN A;  4G57 A;  5CGK A;  3AEV A;  5JPN C;  1O7I A;  4CDF C;  3BZC A;  1JQY D;  3DEP A;  1JJ2 A;  1VQ8 A;  3TBI B;  3CC7 A;  1TWF H;  2BDN A;  1HHV A;  4RFB A;  2RHS B;  3CXC A;  3CQZ B;  3DXJ C;  3KLS A;  4DAP A;  1EY0 A;  5CV4 A;  1S4Z A;  3PF4 A;  1S5E D;  2AKW B;  2XWB B;  1AW7 A;  3M9B A;  1HH2 P;  1N33 L;  2MPM A;  3J80 L;  1WOC A;  4KHP L;  3OYY A;  2PZT A;  2B2W C;  3SE0 A;  1YEZ A;  3AFP A;  3CP0 A;  3UE1 A;  1GM5 A;  1HFN A;  2LS0 1;  4HMJ A;  4XTC S;  3K6O A;  4HID A;  1HJP A;  2DJG C;  2DJF C;  3K5M A;  3DM1 A;  5KND A;  5C0X H;  3OIP A;  1F2M A;  2M00 A;  2MFI A;  1WFQ A;  2FMC A;  1QVF A;  1LAC A;  2R61 A;  5J1Z A;  4WOR A;  4NMZ A;  3HOY G;  3ONA B;  1O78 A;  1UE5 A;  1TS2 A;  2AWO A;  5JPM C;  3CD6 A;  5JOB A;  4QIW B;  4DV3 Q;  2E74 C;  1BO0 A;  4A3E H;  1GJX A;  3RMH A;  2MNA A;  4DUZ Q;  1GUO A;  2UUB Q;  2AMC B;  4A3B B;  3GTK H;  2K5H A;  4PZ8 A;  3DWQ A;  4EQO A;  2EYL A;  1IBL Q;  3M4Y A;  4XT3 B;  3L9A X;  4DXF A;  1BCP D;  2KHJ A;  1YHQ A;  2OWO A;  2R7Z B;  1L2F A;  1VQL A;  3KK7 A;  1EQQ A;  5K36 H;  5D14 A;  4JBW A;  5KYL A;  3OMG A;  2CQA A;  3JC6 6;  1SYF A;  1JJG A;  1VMP A;  4BXX G;  3CPW A;  3K5L A;  2L0C A;  2L11 A;  2EY1 A;  4AYB E;  3I4M G;  5E4W C;  5M3M B;  2K28 A;  5IOC A;  3CC2 A;  4DV7 Q;  3PO2 B;  3F1Z A;  4B9W A;  1NE3 A;  3MXN B;  1FNU A;  2B8F A;  2ENB A;  1C4Q A;  3QWN A;  3T53 B;  2WKC A;  5I4D A;  4UDU C;  1QVG A;  1MJC A;  4A93 G;  2EYF A;  3OHX C;  3BDC A;  1FJG L;  3GTG B;  4B3M L;  1NTG A;  3Q6S A;  2JA6 B;  2KHI A;  4BBR H;  5CBE E;  3S16 B;  1QG7 A;  4GOP A;  5EPJ A;  1SFO H;  1PTO C;  2K5V A;  3ULJ A;  5T1I A;  2F4V Q;  3S1Q B;  4MHE A;  3P75 A;  4ALP A;  4MN3 A;  4A3K G;  3NPP A;  1WCM H;  2HQL A;  5CV9 A;  3K81 C;  2VQE L;  1ICF B;  1ILQ A;  4F87 A;  1PH5 A;  2NVT B;  4A3D G;  3SK5 A;  1VQ4 A;  5CV8 A;  4ZRZ A;  5IYB G;  4GKK L;  5FO9 B;  5I9P A;  1SYE A;  1Q8I A;  1PH3 A;  2GA4 B;  2JA5 B;  1X55 A;  1H95 A;  3SXH A;  4J1M A;  1BKB A;  1CTM A;  4L5Q A;  1JR0 D;  1ESR A;  3Q8D A;  3G6J B;  1W3S A;  4FXK C;  3N52 A;  2AQ3 B;  3HOX G;  1PH6 A;  5M3F G;  1GUT A;  4H7B A;  1HTP A;  3RN2 A;  1W6K A;  2HDL A;  4LFA Q;  1VQP A;  1QB5 D;  4X3S A;  4L63 B;  2NZO A;  2NVQ H;  4OL7 A;  1H9R A;  1VQF A;  2C5C A;  2WAC A;  5ELO A;  3K59 A;  2A6H D;  3NP8 A;  5BN5 A;  5FLX c;  5G3L F;  5CC4 A;  4ZKC B;  3J81 E;  4A3I B;  4R4I A;  3GTO B;  1RL2 A;  3R93 A;  4N9T A;  4EQP A;  4B3S L;  4KI0 A;  2CW0 C;  4FDB A;  3J7A V;  4IJH A;  1X56 A;  3S2D H;  4ZUI A;  2PW5 A;  2HD3 A;  1WTV A;  1PA6 A;  3CCE A;  1EQR A;  1GOZ A;  1VQ6 A;  5C4X G;  3PV0 A;  1EY4 A;  1LYL A;  2Y0S B;  3FEW X;  1EIH A;  2MO1 A;  2K52 A;  4O42 A;  2NN6 I;  4JI3 L;  1K3R A;  2R3Z A;  1PZK D;  1C7Y A;  3IAY A;  3HOU G;  3PIO 3;  1I6V C;  4DNR B;  4KK7 A;  2F0F A;  4B3R L;  5ELE A;  3VR2 A;  2EXZ A;  2HQE A;  4XQJ A;  3E9H A;  3D8G A;  2L5T A;  3CC4 A;  4XQQ A;  4IAL A;  1YHA A;  1HFG A;  4ZAI A;  1ILP A;  4KN4 C;  2NN6 G;  4WJ4 A;  4RHS A;  2A73 B;  4JCV E;  2EE1 A;  3NBI A;  5JEA H;  2OT2 A;  3D6C A;  1RF2 D;  2NWG A;  5GQO A;  1PH1 A;  3NHH A;  1H9S B;  4A3G B;  4C3J G;  3S2H B;  1TWG B;  4XIG S;  4Y7N B;  1XMQ Q;  4R4O A;  4C1N I;  5FLX L;  1DD2 A;  4RGN A;  3WDN A;  2HT1 A;  4KY6 A;  1Y8O B;  3HOZ G;  3VR4 A;  1SYB A; 
#chains in the Genus database with same CATH homology
 4A3I G;  2I0Q A;  2VW9 A;  4X62 Q;  2EIF A;  3I56 A;  4NPS A;  4R4T A;  2OCE A;  3FP9 A;  2Z6K C;  1YI2 A;  3S24 A;  5HGQ A;  4LF9 L;  1AE2 A;  1CKO A;  4MZ9 A;  5BR8 Q;  4HIK A;  1QVC A;  2OTJ A;  2UUA L;  4QGU A;  2VY3 A;  3WWV A;  1XMO L;  1B7Y B;  3TRE A;  1OXT A;  1I94 L;  3K8A A;  4L5T A;  4A3I H;  3S17 H;  1KRS A;  3HOZ H;  2UXC Q;  3GTO H;  1E24 A;  2N8N A;  3RZD H;  1QZG A;  4DV5 L;  1KAW A;  4A3K H;  1HNZ L;  2GVA A;  1V43 A;  5GAG C;  4DV4 L;  2I5L X;  3H15 A;  3OW2 A;  1PH7 A;  1L1O A;  1J5E L;  2UUC Q;  4LF7 L;  2KCT A;  1KHI A;  1W2B A;  1X9N A;  4A3D H;  3S15 H;  2Z0S A;  4GKJ Q;  3E9I A;  2R93 G;  3I55 A;  2Y0S G;  2CWA A;  5IYB H;  1EIY B;  4JI2 L;  1UE6 A;  4BBS H;  2CCZ A;  2BA1 A;  3FHW A;  4P75 A;  4YWL A;  1UE1 A;  2IHF A;  4DV1 L;  1YIT A;  4NXM L;  1VQK A;  4IPH A;  1G29 1;  2PQA B;  1QUQ B;  1YVC A;  1S72 A;  3FKI G;  5IWA L;  2YYZ A;  3KDF B;  4LF6 Q;  4JBK A;  1JJC B;  3A5U A;  4LF8 L;  2R7Z H;  1LUZ A;  1CSP A;  5EAY A;  3HKS A;  4UP8 A;  3HOX H;  1NBW A;  3K0X A;  1SRO A;  3CCM A;  1X6O A;  5M3F H;  3GD7 A;  2UUA Q;  3FKI H;  3KLW A;  4LF4 L;  1I94 Q;  3D31 A;  4TQU S;  4JOI A;  3M4O H;  1VQC A;  2UXB Q;  4AYB G;  2LSS A;  4DV3 L;  2YU9 H;  2K50 A;  1MKH A;  3EBE A;  3I2Z A;  4GKK Q;  3BU2 A;  2IX0 A;  4A76 A;  4DV5 Q;  1GD7 A;  3J7A 5;  5HY6 A;  1KD1 C;  1HNZ Q;  2NZH A;  3PSI A;  5M3M H;  4DV4 Q;  3GTP H;  4DUZ L;  3L7Z C;  3RN5 A;  1J5E Q;  1HZB A;  1Q7Y C;  1I6H H;  1BBU A;  4IPC A;  3KFU A;  4IFD I;  4HJ7 A;  1CKN B;  2E5L L;  4LFB L;  4X66 L;  4JI2 Q;  4DV1 Q;  3ER0 A;  4APV A;  3RLN A;  1IBL L;  4A3G G;  3OTO L;  1M90 C;  4POF A;  2YV5 A;  1HR0 W;  2XGT A;  2AWN A;  1OXS C;  5IWA Q;  4P74 A;  1TWH H;  3GDE A;  1CUK A;  4LUZ A;  1X3E A;  4JI1 L;  2HHH L;  4JI4 L;  1FGU A;  1LM0 A;  1K8A C;  4LF8 Q;  4DR7 Q;  2MQH A;  3GTG H;  4JYA L;  1VQE A;  4A3E G;  4A3F H;  2K5N A;  4QIW E;  4B3T L;  3GTJ H;  4YHH L;  2JA6 H;  2DGY A;  3S2H H;  1TWG H;  2NVY H;  2R7F A;  4Y7N H;  3PIP A;  4A3G H;  3UE0 A;  1HNW L;  1L1O C;  1HR0 L;  3IRB A;  4IFD G;  3S16 H;  3DM3 A;  4EX5 A;  3PUY A;  4DPG A;  4C3I H;  3M4P A;  4P71 A;  4GS3 A;  1N34 L;  2D0P A;  5E7N A;  5IP9 G;  3JAM c;  3JAM i;  3PO3 G;  4H02 A;  5C3E H;  1GKH A;  3A0J A;  2H5X A;  5C44 G;  1X3G A;  2IT1 A;  3L0O A;  5GAE C;  3F2D A;  2ZJQ A;  4UY8 C;  3HKZ E;  4JV5 Q;  3EIV A;  1L1O B;  1N32 Q;  3VDY A;  2D62 A;  2B29 A;  2K4K A;  5K36 G;  1JT8 A;  4P72 A;  3H3V I;  3U50 C;  4GN3 B;  5H1S E;  4X66 Q;  3CCV A;  4L5S A;  5IP9 H;  1MJE A;  3H0G G;  1YZ6 A;  2B63 G;  5JJL A;  1WYD A;  4A75 A;  3K7A H;  2RF4 A;  1DGS A;  4JI8 L;  1P16 A;  3ULP A;  3HOU H;  4DR5 L;  4JOI C;  3I4N G;  5IP7 H;  2CWP A;  3S1N H;  2HHH Q;  3NEM A;  4JI1 Q;  4AQY L;  4MTN A;  1VQ9 A;  1EYG A;  4B3T Q;  2L15 A;  4UPA A;  3H0G H;  5JEA J;  4YCW A;  4JI6 L;  1HNW Q;  3J80 c;  3UDI A;  1SN8 A;  3J80 i;  3G71 A;  1HR0 Q;  4L5R C;  1B8A A;  1WJJ A;  3I4N H;  2KCM A;  3RLO A;  2Q2I A;  2WAQ G;  4DR3 L;  4POG A;  4QY7 A;  1N34 Q;  1A62 A;  3M7N A;  1E3P A;  1PYB A;  1NMF A;  1JE5 A;  3S14 H;  3GTM H;  2CQO A;  1MIU A;  1I3Q H;  2ALY B;  4EQ5 A;  3RNU A;  1IZ6 A;  1Q82 C;  5FJ8 G;  1SR3 A;  4DR4 L;  2JK8 A;  1KQS A;  3HOW G;  3NBH B;  2VQF L;  1NY4 A;  4DR2 Q;  1KXL A;  4OX9 L;  2JEB I;  5LMU Q;  2UXD L;  2F3I A;  2F52 A;  4DK3 C;  4DAY B;  1VQG A;  4HJA A;  1U5K A;  4C3J H;  1K0R A;  4NB3 A;  3CME A;  4IPD A;  4IOC A;  2NVX H;  1P8L A;  4X65 Q;  2PMZ E;  1GVP A;  4JI7 Q;  5FJ8 H;  3STB D;  3HOW H;  4A3C G;  1U0L A;  4DR5 Q;  3RLF A;  2BH2 A;  4LUV A;  4DV6 L;  3F8T A;  5AJ3 L;  2ZM6 Q;  2A19 A;  1SE8 A;  4BA1 I;  2JA7 G;  4J15 A;  2R92 G;  4R1J A;  1FVI A;  3KYH C;  2N3S A;  1Y1W G;  2IHE A;  1TWC H;  1VQI A;  2I5M X;  3A5Z B;  2Q2U A;  5IYD G;  3S1R H;  2KEN A;  4UP7 A;  4A3C H;  4LW1 A;  1YBY A;  2JE6 I;  1AH9 A;  4HJ5 A;  4KLK A;  4HJ9 A;  4DR3 Q;  4LFA L;  1XPU A;  2C35 B;  1KIX A;  4IOA A;  3CF5 A;  1IL2 A;  1N36 L;  1K8G A;  2JA7 H;  4UP9 A;  3TRZ A;  2N78 A;  2E2J H;  2D0O A;  5FLM G;  1OTC A;  1Y1W H;  5C4J H;  2IX1 A;  2JA8 G;  4DR4 Q;  1A63 A;  3CCL A;  2VQF Q;  1XNQ Q;  3F2C A;  4OX9 Q;  1BVS A;  2UXD Q;  2FXQ A;  3AEV A;  5C0X I;  1O7I A;  4GNX A;  1YJN A;  1IBM L;  1KL9 A;  2R93 H;  3BZC A;  4BY1 G;  4X64 L;  2B3G A;  3L2P A;  1JJ2 A;  2E2I H;  1VQ8 A;  1XPO A;  3CC7 A;  1TWF H;  2JA8 H;  4LF9 Q;  4DK6 C;  1T9H A;  3HKZ G;  4C3H H;  3CCU A;  1Q81 C;  3RR5 A;  2RHS B;  3NEL A;  2ZTE A;  1XMO Q;  5AJ3 Q;  1R9T H;  3CXC A;  1YHB A;  3A74 A;  1TWA H;  4OWT B;  5IYC G;  3PF4 A;  3PGZ A;  3E0E A;  1PHJ A;  2ASB A;  3EN2 A;  2AKW B;  3M9B A;  1HH2 P;  1N33 L;  1OXV A;  1VQ7 A;  1WOC A;  4JBJ A;  4KHP L;  3OYY A;  4A3M G;  4LF7 Q;  4LWC A;  5C0X G;  5M5Y H;  2UUB L;  1Q12 A;  1YEZ A;  5LMN W;  1N36 Q;  3AFP A;  3CP0 A;  3UE1 A;  5GAD C;  3T1H L;  1GM5 A;  4QJF A;  3PUW A;  5IYC H;  1M1K C;  4NXM Q;  1VQ5 A;  4OWW B;  2LXK A;  4XTC S;  4HID A;  2WB1 E;  1HJP A;  1EFW A;  2VZA A;  3GO5 A;  4JI5 L;  1J6Q A;  4QQB X;  5M5W H;  1K9M C;  3PO2 G;  4DR6 L;  1IBM Q;  3KOJ A;  2MFI A;  1IXR A;  5LMN L;  3W1G A;  1EUJ A;  1WFQ A;  2KBN A;  3RZO H;  1XJV A;  4PMW A;  1HZ9 A;  4DV0 L;  1VQB A;  3M85 A;  3KF6 A;  1QVF A;  5GAH C;  4A3J G;  1Y1V G;  4LF4 Q;  1UE5 A;  3HOY G;  2AWO A;  3PIO A;  1ASY A;  3CD6 A;  3G48 A;  1Q1B A;  4DV3 Q;  4HJ8 A;  1PVO A;  5IT9 c;  3W1B A;  1VQM A;  1G6P A;  1D8L A;  4A3E H;  5JJK A;  4P73 A;  3MEF A;  4K0K L;  1NMG A;  4IFD J;  2MNA A;  4DUZ Q;  4DV7 L;  2QA4 A;  2UUB Q;  1Y1V H;  2AMC B;  3CCS A;  3HOY H;  1HZC A;  4GNX C;  3GTK H;  4LF5 L;  4NXN L;  2K5H A;  3BJU A;  2E5L Q;  4PZ8 A;  3UDG A;  3T1H Q;  2Y0S E;  4LFB Q;  2WP8 J;  4AIM A;  1IBL Q;  3PO3 H;  4A4I A;  3OTO Q;  1S40 A;  3PUZ A;  5C44 H;  2KHJ A;  3J81 j;  4YWM A;  4JI5 Q;  1HZA A;  1YHQ A;  2OWO A;  4GN5 A;  1L2F A;  1VQL A;  4DR6 Q;  2K75 A;  1EQQ A;  2LXJ A;  4YY3 L;  4JI4 Q;  5LMN Q;  4RG1 A;  1N8R C;  1V1Q A;  3ULL A;  4GNX B;  4JBW A;  1SMX A;  4JYA Q;  2YTY A;  3GTQ H;  1IYJ B;  4DV0 Q;  1K83 H;  4YHH Q;  1Z47 A;  2B63 H;  1SLJ A;  4JG2 A;  3JC6 6;  3I7F A;  2I5H A;  3UDF A;  3GTL H;  4BY7 G;  1JJG A;  4BXX G;  3KDF A;  1CKM A;  3ZJY C;  4JI0 L;  3CPW A;  3K7U C;  4IPG A;  1EIF A;  4YCU A;  4Y52 H;  3CW2 C;  2JA9 A;  4AYB E;  1CSQ A;  3I4M G;  2F4V L;  1E1T A;  2CFM A;  3J81 c;  3J81 i;  1Q86 C;  3CC2 A;  2R6G A;  1B70 B;  4DNI A;  3CPF A;  4DV7 Q;  2YTX A;  3PUV A;  2JEA I;  3F1Z A;  3U4Z A;  4LF5 Q;  1YJW A;  3H3V H;  3M3Y H;  4HIM A;  4GLX A;  3I4M H;  1NE3 A;  3MXN B;  2RCN A;  4O0A A;  1VQD A;  4AH6 A;  3CQZ H;  2UXB L;  4BBR G;  1C9O A;  2CKZ B;  4JI8 Q;  1QVG A;  5M5X H;  1MJC A;  4A93 G;  3AYH B;  1CKN A;  2WFW A;  1FJG L;  4DKA C;  2JJQ A;  1SRU A;  2E2H H;  4B3M L;  4AQY Q;  1NTG A;  1Q8K A;  3W5O A;  1PH2 A;  4WJ3 M;  2KHI A;  2EXD A;  5ELN A;  1VQN A;  4LFC L;  3TS0 A;  4BBR H;  4JI6 Q;  2EQS A;  1XNR L;  1WCM G;  4GOP A;  2ES2 A;  1PFS A;  3KJO A;  3KF6 B;  5DLQ E;  1SFO H;  1XPR A;  5IY0 A;  2K5V A;  3ULJ A;  2E8G A;  4GLA C;  3BZK A;  3NEN A;  1V9P A;  1Y14 B;  1ASZ A;  1KRT A;  2F4V Q;  4BA2 I;  2R92 H;  1PH4 A;  1IBK L;  4ALP A;  3F2B A;  4A3K G;  4HIO A;  1WCM H;  2HQL A;  3K81 C;  2VQE L;  3CCR A;  5IYD H;  1PH5 A;  4OXP A;  1YIJ A;  1BBW A;  2BH8 A;  4A3D G;  1VQ4 A;  2HIV A;  1OXU A;  5IYB G;  4GKK L;  4A3B G;  4BBS G;  3HOV G;  2PI2 E;  1YJ9 A;  5FLM H;  1XTD A;  4GLV B;  1PH3 A;  1L0W A;  1EWI A;  3SGI A;  2DUD A;  4IO9 A;  2A1A A;  1X55 A;  1H95 A;  1FJG Q;  4DV6 Q;  1BKB A;  4B3M Q;  4L5Q A;  2Q2T A;  2R7Z G;  5GRO A;  3Q8D A;  4A3B H;  1W3S A;  3HOV H;  3HOX G;  1PH6 A;  4BY1 H;  2YTV A;  4LFC Q;  3KJP A;  1XNR Q;  1G51 A;  1I5F A;  2ZTD A;  5M3F G;  3RN2 A;  2IY5 B;  2PNH A;  4DUY L;  4LNQ A;  4X6A H;  2WAQ E;  4DAM A;  4LFA Q;  1VQP A;  1VQO A;  4PZ7 A;  1X3F A;  4DR7 L;  2Q2H A;  3D0F A;  4JC0 A;  1IBK Q;  1OXX K;  2NZO A;  1VS0 A;  1X65 A;  2NVQ H;  3KF8 B;  1K73 C;  2XTI A;  4GN4 B;  1E22 A;  1LTL A;  4C2M H;  1D7Q A;  5M3M G;  3CAM A;  2VQE Q;  1JB7 A;  2OQK A;  1VQF A;  4OWX B;  4MNO A;  4KHZ A;  4RMF A;  5C0X J;  1C0A A;  1Q1E A;  4A3M H;  5J3B A;  3TEH B;  4OO1 I;  4DR1 L;  5ELO A;  3S1M H;  1N9W A;  1E1O A;  1AE3 A;  3B6Y A;  4YWK A;  3HFZ B;  3STB C;  4X64 Q;  1S3O A;  1YNX A;  5FLX c;  4GOP C;  1E7Z A;  1VQJ A;  2QGQ A;  3ICE A;  2VNU D;  4JV5 L;  3I4O A;  4R4I A;  3PUX A;  3U4V A;  1N32 L;  1RL2 A;  3PO2 H;  4PG3 A;  2QEX A;  2VS1 A;  1UEB A;  4KI0 A;  4QL5 A;  4A3F G;  4B3S L;  2VUM G;  4FDB A;  2JA6 G;  4IJH A;  1X56 A;  1VQA A;  1PV4 A;  3AQQ A;  2K14 A;  1N33 Q;  4DUY Q;  4GOP B;  3S2D H;  4KHP Q;  2V1C C;  2AHO B;  4TVA B;  4A3J H;  3TS2 A;  1WI5 A;  3U58 A;  4OO1 G;  3DLL A;  4O2D A;  1GO3 E;  2VL6 A;  3T1Y L;  3PCO B;  2BA0 A;  2VUM H;  5C3E G;  2HIX A;  1PA6 A;  3CCE A;  1EQR A;  3TQY A;  2Z6K A;  2JQO A;  1VQ6 A;  1I50 H;  1A8V A;  2MO0 A;  1LYL A;  1Q46 A;  3PV0 A;  5C4X G;  1QZH A;  1HNX L;  3UDX A;  2PI2 A;  4DV2 L;  4DR1 Q;  2MO1 A;  1RIP A;  2K52 A;  3G6E A;  1XMQ L;  1KC8 C;  2NN6 I;  4JI3 L;  2UU9 L;  4A3L G;  5JJI A;  1K3R A;  3S1Q H;  1C7Y A;  2PQA A;  1QUQ A;  3LGJ A;  3HOU G;  4R4Q A;  5C4X H;  5IE8 A;  3K80 C;  3ERS X;  5IP7 G;  3G4S A;  4DR2 L;  3PF5 A;  5LMU L;  1NJI C;  1PH8 A;  2JA5 G;  2OTL A;  4B3R L;  1UE7 A;  2RHQ B;  3CCQ A;  2NVT H;  4B3S Q;  1PH9 A;  4X62 L;  2ZJP A;  4A3L H;  3E9H A;  4X65 L;  4JI7 L;  5JEA G;  3CC4 A;  4ME3 A;  4IJL A;  4BY7 H;  4K0K Q;  5BR8 L;  4BXX H;  2GVB A;  1YHA A;  4PZ6 A;  2JA5 H;  4JBM A;  4YCV A;  2ZM6 L;  4NXN Q;  2UXC L;  4LUO A;  3T1Y Q;  1JMC A;  2NN6 G;  1A0I A;  4WJ4 A;  4R4C A;  2R7D A;  4JCV E;  2ZTC A;  1VQH A;  1TXY A;  5GQO A;  3M4Q A;  2UUC L;  3CCJ A;  1HNX Q;  4DV2 Q;  1PH1 A;  4YY3 Q;  2A8V A;  4GKJ L;  2GN5 A;  2OQ0 A;  4XIG S;  1XMQ Q;  1Z9F A;  4R4O A;  2UU9 Q;  4JI3 Q;  2ZJR A;  1FL0 A;  3CMA A;  2WB1 G;  2N49 A;  2ID0 A;  1UWV A;  1VCI A;  2HT1 A;  4JI0 Q;  1PYS B;  1XNQ L;  1EOV A;  3J7Z C;  2ATW A;  4A93 H;  3AFQ A;  4OON A;  4B3R Q;  1X54 A;  3HOZ G;  4LF6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...