4LUOA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luoA00
4JCVE 1FJGL 1K8AC 1HZAA 4RMFA 5IYDG 1VS0A 1CUKA 5ELNA 4HIOA 1E1TA 3AYHB 5AJ3L 4A3CG 3J81c 1E1OA 2ZTEA 4IPHA 4TVAB 5M5WH 3HOZG 1QVGA 1IBMQ 2D62A 3UDGA 4JI2L 4NB3A 1N33L 4APVA 2HHHL 4JI4L 2UXBQ 4HJ7A 1Q8KA 3I7FA 4JC0A 3L7ZC 1Q7YC 2KBNA 5C3EG 1GM5A 3CCLA 5GQOA 1YI2A 4DK6C 2YU9H 1MIUA 1FGUA 1YZ6A 4C3HH 5LMUQ 1EQQA 1QUQB 4DV6L 2UUBL 4P72A 3U50C 1XPUA 1X3FA 3UE0A 5BR8L 2R7ZG 2K5NA 2JA6G 1V9PA 2RF4A 4B3RQ 1LM0A 3UE1A 3KF8B 2JA7H 3M3YH 4A3GG 4A93G 1GKHA 2JE6I 1N8RC 4X64L 1UEBA 5IP7H 2JEBI 4DV2L 4IOCA 2I0QA 4B3MQ 3A0JA 4JI0L 3GO5A 3PO3H 3B6YA 3GDEA 4DR6Q 2MNAA 1EFWA 1M1KC 2A1AA 4JYAL 2CKZB 2N78A 4QGUA 1Z9FA 3HOUG 2HIVA 4NPSA 4WJ4A 4HIKA 1XNQL 1EUJA 2ZTCA 3PGZA 1K9MC 4P74A 4MNOA 4C3JH 4LW1A 5LMNW 1YITA 1VQ7A 4DR5L 2D0OA 4A3EG 2WFWA 3S24A 3WWVA 5C4XG 4GOPA 1JMCA 4BXXH 2K75A 2PI2A 1OXXK 1PH6A 3PUXA 2B3GA 1BVSA 4A3IH 3UDFA 4BY7H 2WP8J 3K8AA 2VQEQ 2HIXA 2VY3A 3W5OA 4DV1Q 4A3FH 4B3TQ 2VS1A 1E3PA 3L2PA 5IYBG 4DR3Q 4B3RL 1YJWA 1TWHH 4PMWA 4H02A 4P75A 4X62Q 1J5EQ 2JA5G 2BA1A 2EIFA 1NBWA 4AYBG 1JJGA 4KI0A 2FXQA 3GD7A 4GLVB 4DV5Q 4LFCQ 1QVFA 4X66Q 3HOZH 1MJCA 4B3ML 2JQOA 5M5XH 5C44H 1XNRQ 4DR6L 1X9NA 2R93G 2F52A 3IRBA 4DKAC 1KRSA 4HIDA 1YIJA 1I94Q 2Q2TA 2VNUD 1KQSA 1H95A 1W3SA 3S1NH 4DR1Q 2IHEA 1K0RA 1QZGA 2YYZA 4L5SA 2MO1A 4YY3Q 1CKMA 5LMNL 4PZ8A 1DGSA 5C4JH 4JBWA 3CC4A 3CAMA 2UUAQ 3PUVA 4DV0L 2ASBA 4QJFA 4A4IA 2EQSA 1LUZA 3STBC 2JA6H 2R7ZH 3G4SA 5C0XJ 2IY5B 1VQPA 3A5UA 3CW2C 4JI7L 4LFAL 4AQYQ 4GOPB 3LGJA 1HNXQ 2LXJA 4GLAC 4A93H 4WJ3M 1VQ5A 4LUVA 4DV1L 1VQOA 4IFDG 3EBEA 1HR0Q 3G48A 4GN5A 5GAHC 1SR3A 1NE3A 4B3SL 4GKKL 2K50A 4L5QA 1ASYA 2UXCL 5FJ8H 4LF9L 3J81j 1IBKQ 3GTJH 2V1CC 3NBHB 3U4VA 1CKNA 4A3MH 4NXML 4A3JG 3ZJYC 1IBLQ 1PH3A 1NTGA 3ULLA 3I2ZA 4GN3B 1KXLA 4DV5L 1VQLA 1WCMH 3CCUA 2VQFQ 4KLKA 1U0LA 2I5LX 3PV0A 3KJPA 1PYBA 1XNRL 1SE8A 4C2MH 3DLLA 4LFBL 3PUWA 4A3EH 1K83H 5C4XH 3RN5A 2E2JH 3PSIA 1VQ8A 1IYJB 3D31A 4ALPA 2N8NA 4X65Q 4Y52H 1R9TH 3CF5A 1HNZL 5H1SE 1Q86C 1X54A 3BZKA 1Y1WH 2E8GA 2YV5A 4A3LG 1VQCA 1YNXA 2I5MX 2RHQB 3RLOA 3CCMA 4DV7Q 3GTLH 1C9OA 4DR4L 3L0OA 1VQJA 2UUAL 5C0XI 3J7ZC 3NENA 3H0GG 2ZJQA 1XJVA 2K52A 4JI8Q 3RZDH 4YCVA 2KCTA 4DV4L 2MFIA 2ES2A 2JA5H 1NMGA 1SRUA 1WFQA 1HNXL 4JI5Q 3S1QH 4NXNQ 4LF6Q 4X6AH 2D0PA 1BBUA 4IJHA 1FVIA 3AQQA 1OXTA 4DR7Q 1Q1EA 1YVCA 2WAQE 4A3KH 4JOIA 1AH9A 1B7YB 3I55A 1IBKL 1Q82C 4JV5L 1KRTA 3HFZB 2NVYH 4IFDJ 3PIPA 1IBLL 2CCZA 2R92G 1VQBA 1WOCA 4RG1A 1B70B 3K81C 4DAYB 4DNIA 2ID0A 2KHIA 4JI3Q 2VUMG 1CKNB 2MO0A 3T1HL 2OQ0A 1TWAH 2CWPA 4DAMA 3I4MG 2I5HA 4DUYL 1V1QA 4MTNA 4HJ9A 3RNUA 3F2DA 1X56A 3CCJA 1KC8C 3A74A 5DLQE 4LUZA 4JI1L 1S40A 2JA8G 3ERSX 1UE5A 1X55A 4J15A 4JBJA 3M9BA 3M4QA 4PZ7A 3TREA 2UU9L 4JOIC 4GNXA 4LF6L 1N36Q 4YCUA 4R4IA 4LF4Q 3F2BA 3HOYG 4YWLA 4BY1H 1N32Q 3PUYA 4OO1G 3TEHB 4JI6Q 2KCMA 5HY6A 3PO2G 1WI5A 3TQYA 5C0XG 1IBML 1N9WA 4P71A 2ATWA 4MZ9A 4PG3A 3HOWG 3AEVA 2BH8A 2F3IA 4JBMA 2UXBL 3PCOB 4GN4B 4IFDI 1Y14B 1TWCH 1VQIA 3CC2A 1NJIC 1KD1C 1S72A 3I4NH 3OYYA 1O7IA 1Q81C 1K3RA 2A8VA 3JC66 1JB7A 2CFMA 2F4VQ 5LMUL 1YHBA 2E5LQ 4JI3L 3H3VH 4UP9A 2QA4A 4A3LH 1HNWQ 2AWOA 4IO9A 4R4QA 3KLWA 3HKSA 1PH8A 3VDYA 3GTKH 4L5RC 1G6PA 3FKIG 2IX1A 1XMQQ 3H0GH 3HKZE 1HJPA 4A3BG 4QIWE 1XPRA 5GAEC 3GTGH 1XTDA 5IYCG 5IYDH 5JEAJ 1Z47A 4JG2A 2K14A 4QQBX 3SGIA 3T1YQ 4A3CH 2Q2HA 2Z0SA 1EIFA 1BBWA 2VW9A 1YJNA 5IT9c 1JE5A 1HZBA 4R4TA 3H3VI 5IY0A 4GOPC 3M4PA 1I6HH 1XPOA 1N36L 1S3OA 2UUCQ 4LF5Q 4BBSG 4QL5A 1SFOH 5K36G 3OTOQ 1FL0A 2NVTH 5C3EH 1N32L 4UPAA 4YCWA 2WAQG 1KAWA 2NVQH 4GNXB 3D0FA 3BU2A 4DV3Q 3FHWA 2R92H 4IJLA 4YWKA 2MQHA 2XGTA 2ZJPA 4K0KQ 2WB1E 2OQKA 5IWAQ 1VQ9A 3M7NA 1EIYB 2ZJRA 1I5FA 5FLMG 3CCRA 1OXSC 2B29A 4IPCA 1G51A 1N34Q 1E22A 4IPGA 5ELOA 4UP8A 1PH4A 1L2FA 1PYSB 3NEMA 1VQAA 2CQOA 4DR2Q 1IZ6A 2VQEL 4PZ6A 4A3GH 3FP9A 3UDIA 4B3TL 2ZM6Q 2JA8H 1HNWL 2UXDL 3CCSA 4A75A 1HR0W 3CP0A 1X3EA 1A8VA 2CWAA 1KHIA 4DR3L 2BA0A 3J80i 2PMZE 4X62L 1J5EL 2OTJA 3HOUH 4YHHQ 3U4ZA 4TQUS 2YTVA 2DGYA 1AE2A 4LFCL 4GKJQ 1TWFH 3K80C 1P16A 4X66L 4JBKA 3S2DH 3PIOA 4O0AA 3DM3A 2H5XA 1I94L 1VQMA 1NY4A 1PH2A 2NVXH 1VQNA 4OWWB 1X3GA 3KDFA 5IP7G 3CPWA 2LSSA 4DR1L 3EN2A 2RCNA 4JI2Q 2Z6KA 4AH6A 2Q2IA 1N33Q 3F1ZA 3U58A 2JEAI 2HHHQ 1C0AA 4YY3L 1PA6A 2EXDA 2NZOA 3NELA 1L0WA 1GD7A 3G71A 3CMAA 4OO1I 1A0IA 2OCEA 3I4OA 1OXVA 2QGQA 3TS0A 3S16H 1VQ6A 4A3DG 5IYBH 2E2HH 5IP9G 3HOVG 2YTXA 3CQZH 4DV6Q 2UUBQ 2JA9A 1PFSA 3JAMc 3CMEA 3PF4A 1HZ9A 1SLJA 4AQYL 5BR8Q 5IYCH 4UY8C 3HKZG 2XTIA 1SN8A 1HR0L 3ULJA 1E24A 4DPGA 2NN6G 1XMOQ 4POGA 2R93H 3HOXG 4A3FG 3F2CA 4DUZQ 4X64Q 3S17H 4BBSH 1VQ4A 1EYGA 1SMXA 2Z6KC 4DV2Q 3BJUA 1M90C 4OONA 4JI0Q 3E9HA 1D8LA 4GKJL 5M3MG 2VQFL 4JYAQ 4HIMA 4IPDA 1RIPA 2PQAA 3RLNA 5JEAG 4HJAA 4HJ5A 1KIXA 1XNQQ 2VZAA 3E0EA 1RL2A 1JJ2A 1OXUA 2AMCB 5M5YH 1YJ9A 3S1MH 1JT8A 5FLMH 5E7NA 4GLXA 2WB1G 4QY7A 1C7YA 1YEZA 1VCIA 1WJJA 2GN5A 3E9IA 5C44G 3BZCA 4DR5Q 2K5HA 2R7DA 4X65L 1VQDA 3AFQA 4R4CA 1PV4A 2IT1A 3K0XA 3RZOH 1PVOA 4LWCA 5GAGC 4LF7Q 5JJKA 5JJLA 2R7FA 2HQLA 3KDFB 4DV7L 1MKHA 4BA2I 4HJ8A 2Y0SE 2K5VA 1HZCA 2ZTDA 2N3SA 4JI8L 2BH2A 1D7QA 2AWNA 3J80c 4C3IH 1CKOA 3KYHC 4A3JH 3S1RH 4JI5L 3TRZA 1VQEA 3A5ZB 3Q8DA 4NXNL 4XIGS 3G6EA 1GO3E 1CSQA 1WYDA 5IE8A 4DR7L 3ER0A 1T9HA 1XMOL 3J7A5 1YHQA 3RR5A 3AFPA 4DUZL 1LTLA 1P8LA 1PH9A 4L5TA 3F8TA 2LXKA 5FJ8G 2GVAA 2YTYA 3UDXA 2B63G 4A3MG 1L1OA 4LF8Q 5GADC 3S14H 4BBRG 3S15H 4UP7A 5M3FG 4GNXC 3RN2A 4OXPA 1HH2P 1WCMG 3STBD 3W1GA 3CD6A 4A3DH 5J3BA 5HGQA 3JAMi 1LYLA 1EOVA 2K4KA 2KHJA 2PQAB 5IP9H 3CCEA 5LMNQ 1PH5A 3HOVH 1UE7A 3KFUA 1W2BA 1J6QA 4DV0Q 4LF7L 4FDBA 2N49A 4KHZA 4OX9Q 2AKWB 1Y1VG 4R1JA 3GTMH 1Y1WG 4JI7Q 1V43A 4LFAQ 1OTCA 3S2HH 3W1BA 4EX5A 4LF4L 1CSPA 3HOXH 2HT1A 1IXRA 2KENA 4JI6L 1PHJA 2AHOB 4B3SQ 3M4OH 2NZHA 4GKKQ 4KHPQ 2UXCQ 4LF9Q 1L1OC 3K7UC 4O2DA 1GVPA 1MJEA 4P73A 4LNQA 2PNHA 4NXMQ 5M3MH 4XTCS 3ICEA 2VUMH 3KF6A 1A63A 1NMFA 3J81i 2UXDQ 2ALYB 3I4MH 1I3QH 4ME3A 1U5KA 2NN6I 1UE6A 4A3KG 1E7ZA 1JJCB 1UE1A 4Y7NH 3GTQH 2F4VL 4LFBQ 3CXCA 2E5LL 1TWGH 1G291 4LF8L 4OWTB 3CC7A 1PH1A 2OTLA 3CCQA 3GTOH 1Q1BA 3H15A 3PUZA 1Q12A 1QVCA 1HNZQ 1IL2A 1B8AA 3I56A 1XMQL 1L1OB 4AIMA 1X65A 2Y0SG 3HOYH 4DR4Q 3KJOA 3KOJA 3OW2A 1TXYA 4YWMA 3T1YL 3EIVA 3PF5A 2Q2UA 5GROA 3PO2H 5JJIA 3K7AH 1QZHA 2A19A 1FJGQ 1Q46A 4OX9L 2JA7G 5AJ3Q 4DV4Q 1ASZA 2OWOA 3HOWH 1A62A 1X6OA 3MXNB 4GS3A 4BA1I 2UUCL 4LF5L 2GVBA 3OTOL 1KL9A 4OWXB 3PO3G 2RHSB 2QEXA 4JI4Q 2JJQA 4KHPL 4DV3L 1EQRA 4K0KL 4IOAA 1VQHA 1QUQA 4BY1G 2B63H 5IWAL 4JV5Q 2JK8A 3ULPA 1SROA 1VQFA 5EAYA 4BBRH 5FLXc 1N34L 5M3FH 3MEFA 2R6GA 1VQGA 3FKIH 3RLFA 4DK3C 2PI2E 3TS2A 1I50H 2IHFA 2C35B 4A3BH 3T1HQ 4DR2L 3KF6B 1K73C 1YHAA 4BXXG 2DUDA 1VQKA 1AE3A 2ZM6L 1UWVA 4DUYQ 4A3IG 4EQ5A 4BY7G 3I4NG 3CPFA 4A76A 1K8GA 2VL6A 2L15A 1Y1VH 1PH7A 4JI1Q 3M85A 1YBYA 2IX0A 4POFA 3CCVA 4R4OA 4YHHL 1BKBA 3GTPH 1EWIA 2E2IH 2UU9Q 4AYBE 4LUOA
chains in the Genus database with same CATH superfamily
1C8CA 1DCZA 5IYDG 4LK1C 1VS0A 1CUKA 3S1RB 5ELNA 3J81c 1E1OA 4TVAB 3FDTA 3HOZG 2K05A 3DWQA 4TSSA 2SDFA 2H1EA 1EFID 1J9OA 2HHHL 4JC0A 1KDCA 5CMDA 1O7YA 2WV6D 4C3HH 4FXKC 5LMUQ 4S3SA 4DV6L 1IKLA 1GHKA 1XPUA 1HA5A 2A69C 2RF4A 1G2SA 1F77A 2CH4A 1AZQA 2Z9HA 1TS5A 3KF8B 4XQNA 4BY7B 1A3UA 1B53A 3R2IA 4DV2L 2O5IC 3A0JA 3S2HB 4DAVA 1EWCA 4RGTA 3HOUG 1PTOH 4F87A 4JW0A 4RKLA 4NDXA 1TWHB 1MHWC 5LMNW 1WVLA 5C4XG 3HOZB 1JR0D 2PI2A 1IW7C 5C44B 1BVSA 5HURA 3UDFA 4BY7H 3X3MA 2WP8J 4RGNA 2NN6H 3K8AA 1IL8A 3MA2B 3W5OA 3S1NB 1FYCA 4DV1Q 4B3TQ 3NBHA 1OO9B 5IYBG 3AMUA 2CVRA 1TWHH 2BA1A 3R3OA 1NBWA 4AYBG 1GUTA 2JN4A 4IUTA 3HOZH 5C44H 1ICWA 3HP3A 3IRBA 2Q2TA 2VNUD 2PPBC 4XT1B 1KLGD 3S1NH 2BOSA 2SNSA 2DY8A 1CKMA 4ABNA 2EY2A 1V1OA 3E6ZX 3KK7A 4JBWA 1SNCA 3CC4A 3PUVA 2ASBA 4RCNA 2EQSA 4QCLA 3QWNA 1SYGA 1SXTA 4ZRZA 3A5UA 5C4XB 1HNXQ 4WRDA 1NNXA 4GN5A 2TSSA 1SR3A 3BYYB 2UXCL 4J6HA 4GKKL 2A73B 5FJ8H 3D4DA 4LF9L 1GUSA 2KHSA 4C1NI 4DAYA 4K5VA 4NXML 3NBHB 2B2VC 4A3JG 1MI2A 1NTGA 4IUVA 2KECA 4GN3B 2PZWA 1VQLA 5KEEA 3CCUA 1U0LA 1IYVA 2OEOA 1PYBA 2JXMB 4AYBB 2IW3A 3TP7A 3PUWA 5C4XH 1RJTA 4O1NA 5EPLA 2LMCB 2YV5A 4OIJA 4DV7Q 1C9OA 4DR4L 3R93A 2BDNA 2WKDA 2QEJC 2ZJQA 1XJVA 2EYPA 4ZYSA 2KEDA 4DV4L 2ES2A 1WFQA 5D3IB 2JA7B 2B2YC 5IT9L 4IJHA 1OXTA 4DR7Q 3A54A 1YVCA 2WAQE 2KCNA 3I55A 5JVH3 2NB0A 3PIPA 1IBLL 1Y8PB 1NSNS 1ZXTA 4DAYB 2ID0A 4K8JA 1KLUD 2MO0A 2OQ0A 2CWPA 3OWEB 1T5XD 4DUYL 2ICEC 2ZXPA 2B8GA 2HUGA 2EYLA 3F2DA 3ND8A 3A74A 4LUZA 1UE5A 1X55A 3M9BA 2G9DA 3IFDA 4E6IA 4JOIC 5NUCA 1N36Q 4R4IA 3HOYG 1PZID 1D1KA 3TQYA 1SJHD 1N9WA 3C2PA 1G2TA 4DXFA 5AFWA 4GN4B 1JWSD 1BBXC 5M5XB 1K3RA 2EJFC 3JC66 5CV5A 2CFMA 2F4VQ 5LMUL 2E5LQ 1QOHA 2EYJA 1FR3A 1HUMA 3TP6A 4KTAA 3VYSA 2F0OA 4DAPA 1LTBD 1XMQQ 1XPRA 1XTDA 2K14A 3MXGA 4A3CH 2Q2HA 4M1UB 4K5WA 1ZYRC 1YJNA 2P5ZX 5IT9c 1LT4D 3E0JA 1HZBA 1SNDA 4A3GB 1B44D 1JB3A 3VYRA 1BCPC 3NQTA 2JP1A 1S5ED 1KAWA 3D6WA 2RA4A 3FMCA 4FNFA 2IJ0A 1XWEA 2XGTA 4K0KQ 1E2WA 4CHTB 3TBIB 1RHPA 4G7HC 3CCRA 1OXSC 4IPCA 1G51A 1TWFB 5FK9C 4IPGA 4X3KA 3DMUA 3S2DB 1VQAA 4DR2Q 4XQQA 1UNSA 4A3GH 3FP9A 2UXDL 2RDGA 2ZM6Q 4B3TL 1HNWL 4A75A 4MN3A 3CP0A 1X3EA 5JAVA 1G6ZA 5I2YA 1BOSA 3KLSX 3J80L 2OTJA 4ILWA 4OEMB 4YHHQ 3I72A 2YTVA 3V96A 1TWFH 3K80C 4QF4A 3S2DH 2FFKB 1WTWA 5CORA 1HPCA 4JK1C 1XXGA 3P1HA 1SSOA 4KY7A 3KDFA 5IP7G 3DWAA 3MAQA 4AH6A 1N33Q 2Q2IA 3F1ZA 2F4IA 5C5MA 1PA6A 2NVYB 2HD3A 2OCEA 2QGQA 1VQ6A 4QUCA 4C3JG 2ZXRA 5IP9G 3A8IE 1STHA 3NK9A 3PF4A 3CMEA 4V190 1SBBB 5BR8Q 2XTIA 4BS9A 4M8AA 1KNAA 1EYDA 1DZ1A 3D8GA 3F2CA 3BZDB 4XYOA 4RHSA 1LTGD 4HMJA 1SMXA 1VQ4A 1EYGA 3E9HA 5EPJA 2L11A 2PZTA 3P75A 2MHVA 2L4NA 3E0EA 1RL2A 3MTSA 5D3DA 1YJ9A 1JT8A 2RSOA 2WB1G 4QY7A 1A2UA 3Q24A 3E9IA 2GN5A 1EY5A 2K5HA 2R7DA 2J4XA 2IT1A 5CBEE 3KDFB 4DV7L 4BA2I 4IFDH 1F2LA 3F2UA 3JAME 2AWNA 3J80c 3O13A 3KYHC 4DU9A 3DXJC 3LWEA 1TVXA 3K6OA 1VQEA 3A5ZB 4YIJA 1GO3E 3DWPA 3LX0A 4CJ2C 4DR7L 2XRQD 3ER0A 1XMOL 1CM9A 1TT2A 3VR6A 3F8TA 2LXKA 2NTTA 2YTYA 1U4PA 2F0QA 2B63G 3QO2A 1TIID 3M4OB 4BBRG 2EDGA 4R9WA 4CGYB 1HH2P 3STBD 3CCEA 2K4KA 5IP9H 1C4QA 4O42A 1EIGA 1UE7A 2G5DA 4DA2A 4G7OC 4NMZA 1EYCA 1I3QB 4DV0Q 1XYIA 4LF7L 2WB1B 4FDBA 1U9RA 2LY7A 4R1JA 3GTMH 2A68D 4JI7Q 4LFAQ 1K3BC 1RTNA 2J7ZA 1IYUA 1IXRA 3M4OH 2VXWA 2ZT9C 1DONA 1X3PA 1MJEA 3ICEA 1O7ZA 1A63A 4XTCS 2ALYB 4NW2A 1I3QH 4ME3A 4CDCC 2RKSA 1KNEA 1QJOA 2NUCA 4IUUA 1JJCB 1SNQA 4CBVA 3GTQH 2F4VL 2E5LL 1G291 3QOLA 3H15A 1HNZQ 2B63B 2F3VA 1B8AA 4RWSC 3I56A 1XMQL 3CU7A 3PF5A 3LNNA 4H0LC 3EIVA 5JJIA 2CW0C 3I90A 3K7AH 1Q46A 4X3SA 1ASZA 2FJ2A 5C4ZA 4WJWA 2QW7A 2ICIA 2RHSB 3PIO3 3MXUA 2JJQA 3NP8A 3TN2A 1BQQT 2O2LD 4K0KL 2F0JA 1QUQA 2B63H 2E2IB 3Q6SA 5EAYA 4BBRH 4FF1A 2I46A 5J39A 4DK3C 2IHFA 2C35B 1K28A 3S1MB 4DR2L 4BXXG 2D2CC 2ZM6L 4A3IG 1DD2A 3I4NG 1J8IA 1YNND 4FVMA 1CHQD 1K8GA 3SVMA 4JI1Q 3M85A 3E3XA 4QMGA 3A8KE 3T56B 4POFA 2M00A 4YHHL 3FPUB 2E2IH 2UU9Q 5ELFA 1UUPA 1I4RA 1K8AC 1HZAA 4HMIA 4KN7C 4HIOA 5AJ3L 5M5WH 2IL8A 3PQIA 3M3YB 2KUMA 1N33L 4APVA 1Q8KA 3I7FA 5C3EG 2LS01 2F0SA 3N52A 1C48A 3VR2A 3EA6A 3DEOA 1YZ6A 1M4VA 1QUQB 3ONAB 5DM73 1TY0A 4P72A 3U50C 5BR8L 2R7ZG 2K5NA 2JA6G 5CV7A 4ZCKA 3M7GA 3U9SA 2NYZD 3M3YH 4A93G 3VR4A 4XDXA 3HKZB 1R4QB 1N8RC 5D65A 5CYUA 3NTKA 2JEBI 4WORA 4DN4M 4A3FB 1IHZA 1SMYD 1Z9FA 1EUJA 3J81E 3I3CA 3PGZA 1BDOA 1GUGA 4G4KA 1NCVA 5IGBA 1LV9A 2D0OA 2WFWA 3WWVA 1JMCA 4BXXH 4IZ8A 2K75A 3VA7A 1STNA 4A3IH 4NP5A 2RQXA 2VQEQ 4KHVA 4A3FH 4LJZC 5CV9A 1CTMA 4B9WA 4FXDA 1IKMA 2PNRC 1YJWA 4P75A 2Q8RE 2JA5G 2EIFA 1JJGA 3NHHA 2FXQA 2JA6B 1L0XB 1HFNA 1QVFA 5EBCA 4X66Q 2JQOA 4A93B 2DY7A 1YIJA 2R93G 1KRSA 1I94Q 5EJWA 2DJGC 4ULLA 5C3XA 5IGDA 4YY3Q 4A3MB 1W6JA 1H9RA 3CAMA 4DV0L 5HGTA 3MXPA 5J22A 2R7ZH 1LUZA 2JA6H 5KNBA 4JI7L 1K83B 5J1ZA 4LFAL 4GLAC 4A93H 4LUVA 3EBEA 3T4AC 5GAHC 2K50A 4L5QA 1Y1WB 2K5QA 3MZ5A 4A3MH 1CKNA 1HCZA 5EGTA 2KJXA 1HHVA 3ZJYC 1IBLQ 1PH3A 3MC0B 4DV5L 3RZDB 3NBIA 2IWHA 3SK5A 1KDAA 2JA5B 4EGVA 1XNRL 1SE8A 3DLLA 1K83H 3RN5A 4K2LA 4A3KB 1LTSD 1F9RA 2N8NA 4X65Q 1AZPA 3QIAA 1HNZL 1Y1WH 4A3LG 2E8GA 3RLOA 2RHQB 4LMQD 1X3QA 1VQJA 2UUAL 5C0XI 3H0GG 4EVOA 3RZDH 1G91A 2BCOA 5KYIA 2KCTA 3MVVA 4K14A 1TQOA 2BE5C 2JA5H 1SRUA 4X6AH 2D0PA 1BBUA 1S5FD 3PMFA 1FVIA 1DOKA 1PRTD 3TP5A 1TR5A 4A3KH 5ELBA 1IBKL 2B8FA 1Q82C 2SNMA 2CCZA 1VQBA 1BUVT 1B70B 2A6HD 4ODGA 1PTOB 2F0PA 2KHIA 4BY1B 2VUMG 1CKNB 1DXMA 2Z4HA 1VF5C 2EE1A 2JYOA 3SEBA 2E74C 3HRZC 1V1QA 4DK0A 1SYDA 1TWCB 5DLQE 4JI1L 3ERSX 4JBJA 2UU9L 3ITPA 1WTXA 4U68A 1I4QA 4R8NA 4LF4Q 2PCFB 4CKBA 4BY1H 4FF2A 2N55A 4ZLTF 3H0GB 2XWJB 4P71A 1AP0A 4MZ9A 4PG3A 1ENCA 1Y14B 1TWCH 3CC2A 1NJIC 3OYYA 1I6HB 2A8VA 5JOBA 4WFN3 2UXDQ 1HNWQ 2NVTB 4JI3L 4KK7A 4UP9A 2QA4A 4A3LH 4EQPA 4IO9A 4HN7A 2Z4IA 2A74C 1G6PA 3FKIG 2IX1A 2LKVA 1PFBA 3H0GH 3HKZE 4A3BG 5LHY1 5KYLA 5IYDH 5IYCG 4HEDA 4K8IA 5JEAJ 4JG2A 3GV6A 1HTPA 3SGIA 1STBA 2Z0SA 3QR8A 4GOPC 1QILA 1I6HH 1XPOA 1PRTB 4LF5Q 1U4MA 1JOOA 3OTOQ 2NVTH 1PTOF 5BN5A 1N32L 4YCWA 2DJFC 1FNVA 3BU2A 1I4PA 3D0FA 3FHWA 3IFTA 2MQHA 2ZJPA 3HOUB 4I7ZC 2AUJD 1VQ9A 4RGMA 4HCSA 1EIYB 5FLMG 5G3LD 1SE2A 1E22A 1EY0A 2F03A 1L2FA 3NEMA 3HG9A 4KV6A 2NVXB 1IZ6A 3P7JA 4PZ6A 2VQEL 2F0LA 2WINB 1LTTD 3UDIA 1ESRA 2FMMA 3CCSA 1HR0W 2CWAA 5M9OA 1KHIA 1NAPA 4CKEA 2BA0A 5I9OA 1JORA 1JICA 1AEXA 3OMCA 3S16B 4I65A 3HOUH 2JSOA 2KEEA 4X66L 1P16A 5IT9E 1HUNA 1B3AA 4O0AA 3DM3A 2H5XA 1I94L 2NVXH 4OWWB 1X3GA 4JI2Q 2RCNA 2Z6KA 2JEAI 1Q90A 1B3QA 4YY3L 3NELA 1GD7A 3G71A 1A0IA 3TS0A 3HGBA 3S16H 2H4OA 2A69D 2QDLA 2DN8A 3BYTB 5IYBH 1WTRA 3HOVG 2UUBQ 2JA9A 4DGZA 5M5YB 1LT6D 3K57A 1HZ9A 5IYCH 1CZWA 3RMHA 2F0DA 3DM1A 4OIKA 3RZOB 2G9HD 3Q22A 1XMOQ 1B50A 1WTPA 3L9AX 4GZYC 3DHQA 2FINB 1M90C 3BVGA 4JI0Q 3H3VC 4UDUC 1SNPA 5M3MG 4JYAQ 3VR3A 1RIPA 3VYTA 4A3JB 4CKCA 4HJ5A 1X32A 4HTHA 3PIP3 3KLSA 2NTSA 4J1MA 5C3WA 5M5YH 1IW7D 5FLMH 3AU7A 1C7YA 5E4XA 1YEZA 1VCIA 1WJJA 1GUOA 4X65L 1QE6A 3AFQA 4R4CA 3RZOH 2Q8TA 4LWCA 4LF7Q 1PLFA 4OGQC 3SK8A 1MKHA 5CBAE 4HJ8A 3TSSA 5K5PA 1DJRD 4IURA 1B1ZA 3S15B 1D7QA 2B2TA 4A3JH 1EY8A 3KBGA 3HOVB 4XIGS 1CSQA 4CDEC 2EYHA 1F2YA 2QKIC 1FGBD 2HDLA 3RR5A 3AFPA 3OHXC 4DUZL 1PH9A 1K8OA 1EYAA 2GVAA 3LWUA 4N8X1 4U673 3S15H 1GJXA 5FLXL 4GNXC 3W1GA 1WCMG 3FPPA 5J3BA 5M3MB 5LMNQ 4FP5D 5BN3A 1STGA 3HOVH 1PH5A 3NWTA 1EL0A 1JWMD 3MXNA 2N49A 4FXGC 4HR7B 1Y69U 1II3A 1TWGB 1OTCA 4LF4L 1CSPA 4DNTB 3J80E 4N9TA 3SK4A 2V4DA 2KENA 1QB5D 4B3SQ 3HOYB 4P73A 3BDCA 5M3MH 2X6GA 3H6MA 3KF6A 4C56C 4V0BA 3J81i 2NN6I 4F7XA 4C3HB 1UE1A 1Z7TA 4KMUC 4LFBQ 1TWGH 1FNWA 4LF8L 5FOBB 1Q1BA 2NBFA 3SHLA 2R3ZA 1Q12A 1QVCA 5E1FA 3S9WA 2Y0SG 3HOYH 4KY5A 1TXYA 2Q2UA 1QZHA 1QWYA 2HCCA 5AJ3Q 1A62A 2WIIB 3MXNB 5CV6A 4LF5L 3K5NA 3OTOL 3PO3G 4KD3A 1VQHA 3NTHA 2JK8A 2EY5A 3ULPA 1SROA 5FLXc 4KKTA 3MEFA 3J7AV 3NSWA 3RLFA 2PI2E 4TKOB 3TS2A 3T1HQ 3KF6B 1YHAA 2CQAA 1AE3A 2AUKA 1B9NA 2L15A 2PW5A 4UAIA 3N6RA 1YNJC 1SEBD 1Z6HA 1EWIA 4AYBE 2M9VA 1GXDC 4F8MA 1E2VA 4JCVE 1FJGL 1JOKA 2B39A 5I6WA 4RMFA 1KABA 1E1TA 1UAPA 2A6EC 4IPHA 1QVGA 1IBMQ 1HA6A 2D62A 4JI2L 4ZUIA 3KUPA 4JI4L 2UXBQ 4HJ7A 1ML0D 1Q7YC 2KBNA 1GM5A 3PO3B 1RKNA 2X69A 5GQOA 1YI2A 3I4LA 1EY6A 3K59A 1MIUA 1A15A 2GA4B 5C6AA 2AQ2B 4UHVA 2K28A 2UUBL 1RTOA 1WD0A 4C3JB 1V9PA 1ZYRD 4PQXA 3UE1A 1STYA 4RA8A 1BCPD 1EU4A 2JE6I 4QIWB 4XYQA 1SAPA 1EU3A 3GTMB 5IP7H 2BDOA 3PO3H 2I0QA 1A3TA 4JI0L 4JVZA 3GO5A 2WKCA 3B6YA 3IAYA 1EFWA 1S5CD 4JYAL 2N78A 3BDLA 2HIVA 4NPSA 1I4GA 1JCKB 2ZTCA 1K9MC 4P74A 2Q8IB 1H9JA 1ZKOA 4C3JH 1YITA 1VQ7A 3FEWX 4A3EG 2ENBA 1RF2D 2Z6BA 1BXTA 1PH6A 3PUXA 2B3GA 4IUNA 2ZXOA 3GTQB 5LL6X 4I7AA 2HIXA 4N8FA 1F2ZA 1CZGA 1E3PA 4DFAA 3T16A 1R4PB 1S5DD 3U9OA 5JPNC 4DR3Q 4B3RL 4PMWA 1Q3LA 1ET6A 4X62Q 3K7AB 2O4XA 4KI0A 3MFYA 3GD7A 1D5ZC 4DV5Q 1LLRD 2EYOA 4H7BA 1MJCA 3NUCA 4B3ML 1RDPD 4B9XA 1XNRQ 4DR6L 1KQSA 1W3SA 4MTKA 4DR1Q 1ILPA 1K0RA 1QZGA 2YYZA 3GTJB 1CFMA 5LMNL 4PZ8A 4DXGA 4BBRB 2UUAQ 1NUCA 5KRUA 1GHJA 3TZDA 5C0XJ 3A8JE 2IY5B 2EY1A 1SYCA 4A3EB 2B2UA 2LXJA 1BF4A 1VQOA 3A55A 3G48A 4B3SL 1IBKQ 4B08A 3GTJH 2L12A 1D5MC 3ULLA 2VQFQ 4KLKA 3PV0A 3KJPA 3A56A 5M5WB 2F0VA 1VMPA 3S1QB 4LFBL 4A3EH 3PSIA 3C46A 1JQYD 1VQ8A 1IYJB 3D31A 5KIXA 4Y52H 1I4XA 3CF5A 5I2XA 1VQCA 2I5MX 1EWHA 1FD7D 1RCVD 4X3UA 5DM63 3H09A 3L0OA 2K01A 1SJED 3NTIA 1AFPA 3J7ZC 1PTOC 4JI8Q 3TZUA 3R2TA 4PV1C 3L3OC 1ZEQX 2F0EA 2L5TA 1NMGA 3S1QH 4NXNQ 3BVMA 4K6DA 1AH9A 1DM0B 1B7YB 2B2WA 4BWGB 1B9MA 1KRTA 3MHBA 3K0YA 3V2TA 3HFZB 2R92G 3NQIA 1WOCA 4RG1A 3K81C 3G7LA 4DNIA 1A3VA 4JI3Q 1S4ZA 3T1HL 1BO0A 1TWAH 3J7YW 3I4MG 2I5HA 1TS2A 3H94A 1G8ZD 3IL8A 2D5DA 1JOQA 1L0YB 1X56A 3BG3A 1BNZA 1D6EC 3K5OA 4A3IB 3I4NB 1CK1A 3M4QA 4PZ7A 4IUPA 5IIFA 4YCUA 1EY7A 3F2BA 2EY6A 3GTKB 3PUYA 1N32Q 3TEHB 4DK1A 5HY6A 3PO2G 1WD1A 5EPKA 1IBML 3HZXA 2ATWA 3HOWG 2BH8A 2UXBL 5JJZA 2F1MA 4IFDI 4RH6A 1KD1C 1S72A 3I4NH 2I07B 4G57A 1Q81C 2F0HA 1SFOB 1PRTC 5C3EB 2XVSA 1LO5D 3GTKH 3VDYA 2CW0D 4N9PA 1RODA 2R92B 3VA5A 3CKIB 3EJIA 1SYFA 4QIWE 5GAEC 1Z47A 2R7ZB 4QQBX 3T1YQ 1KTKA 1EIFA 1PFNA 1CT1D 2RSNA 1BBWA 4KKSA 3EVQA 1JE5A 3I8ZA 3H3VI 3GV3A 3M4PA 1S3OA 4BBSG 5K36G 1EQTA 4QL5A 1SFOH 3HS0C 1FL0A 5C3EH 4UPAA 2F0WA 2WAQG 3HEJA 2R92H 2F0IA 5F2DA 2WB1E 2OQKA 3M7NA 2QF7A 2B29A 3ZYYX 1N34Q 2MUYA 5ELOA 1HQRD 5C4HA 3GQBA 3TP8A 5I6YA 2CH4W 3URYA 2AQ3B 3C1EA 2XWBB 1EOTA 1F2MA 1PMRA 1A8VA 3EFXD 4DR3L 3J80i 3OWFA 4C3IG 1QNKA 4X62L 5CR3A 2DGYA 1AE2A 3SK6A 3CQZB 2HDMA 5FKAC 3I70A 4LAAA 5KNCA 2KA7A 5KGUA 1ILQA 4JPBW 3EN2A 4DR1L 1SNOA 1D5XC 1MBYA 1C0AA 2R93B 4C1NK 4BBSB 4OO1I 3I4OA 3X3NA 2RBMA 4PMBA 1KAAA 3DEPA 4L6TB 2YTXA 3CQZH 2XSCA 5A2QL 1PFSA 5CC4A 1SLJA 2KCCA 4CDFC 1JC7A 2AQ1B 4FYDA 5EQ0A 3ULJA 1E24A 4DPGA 5ISRA 3ERQA 2NN6G 4MIUA 4POGA 2R93H 1QG7A 2QCPX 5EBDA 3HOXG 5COYA 4DUZQ 4X64Q 4BBSH 5K36H 1AW7A 2Z6KC 3BJUA 4OONA 3C1FA 1VMCA 1D8LA 4RAUC 4GKJL 2VQFL 4C3IB 5JEAG 2PQAA 5FO8B 4HJAA 3P20A 1D1IA 1XNQQ 1OXUA 2AMCB 1XTCD 1W6KA 5C44G 4DR5Q 3OIPA 2MP1A 1PV4A 1PVOA 3V05A 5GAGC 2HQLA 1E0BA 3G6JB 1HZCA 1TY2A 3S14B 2ZTDA 4JI8L 1EY9A 4C3IH 4K2KA 3S1RH 4NXNL 3OOCA 1EZ8A 3TDQA 1T9HA 2MPMA 3J7A5 2EOTA 2FMCA 4L5TA 5FJ8G 3W3AA 3HOXB 1AN8A 1L1OA 4LF8Q 1LTRD 5GADC 3S14H 2OXPA 5M3FG 3SDZA 4IQZA 3JAMi 2VUMB 2KHJA 2PQAB 2B2TC 4KJNA 3KFUA 1J6QA 2K6AA 4KHZA 3UI2A 1ICFB 1LTID 4Y7NB 3K5MA 1V43A 3S2HH 3W1BA 2SOBA 4EX5A 3HOXH 3T51B 3OPOA 2HT1A 1PHJA 2AHOB 4HCEA 3BVZA 1DYQA 5IGFA 2IX3A 3OIQA 2RDFA 2VUMH 5JEAH 1NMFA 5D14A 4CDDC 4RHRA 2KQ3A 1UE6A 4Y7NH 1HTLD 3D4RA 1TKWB 3CXCA 1PZJD 3CCQA 4KY6A 3PUZA 1ENFA 1IL2A 1L1OB 1X65A 1ENAA 2BE5D 3KJOA 5M3FB 4EQNA 3T1YL 3FKIB 1A2TA 2XIWA 2A19A 1FJGQ 4A3BB 4OX9L 2JA7G 1HQMC 1HFGA 1STEA 4ZQ3A 1B4OA 4GS3A 4BA1I 2GVBA 2QEXA 4JI4Q 4KHPL 3A7AB 5ELEA 4IOAA 5CGKA 1O80A 4JV5Q 3GTPB 1PYWD 1V8QA 4H13C 1VQFA 2K33A 5IGGA 1N34L 5M3FH 3IKJA 2R6GA 2OT2A 3FKIH 4FO2A 4Q5VA 4A3BH 2DUDA 4H44C 4KD4A 5DNFA 4EQ5A 1PRTF 2EJMA 2VL6A 4RFBA 1CQFA 1PH7A 1YBYA 2IX0A 4TRDA 4R4OA 3GTPH 2F3WA 2YU9B 4LF6Q 1Y8OB 4IUQA 1E2ZA 2PW7A 3D3RA 2N88A 3AYHB 4A3CG 2ZTEA 3T53B 1I4HA 3UDGA 1A6XA 4NB3A 1H9MA 3L7ZC 5EKLA 4FF4A 3CCLA 4RKBA 5FLXE 1ET9A 3OSOA 1HXYD 4DK6C 5DAUA 3NPPA 2YU9H 1FGUA 1EQQA 5T1IA 2C5CA 2XRSD 4DF7A 2K03A 4XXEA 1X3FA 3UE0A 4B3RQ 1LM0A 3J7AF 5A35A 1CQVA 2XN9C 2JA7H 4A3GG 1GKHA 3OMGA 2KVMA 4ME5A 3KBXA 4X64L 1UEBA 4B3MQ 4IOCA 4DR6Q 3GDEA 3SXHA 2MNAA 1M1KC 2A1AA 2CKZB 4QGUA 2D9UA 3MEHA 4WJ4A 4HIKA 1XNQL 4MNOA 4LW1A 4DR5L 1LABA 3S24A 2K5DA 4GOPA 4K5XA 1OXXK 2L1BA 4FF3A 1EY4A 2VY3A 3C3LA 2VS1A 3L2PA 4HSVA 1XX8A 1EZ6A 5C4JB 4H02A 1J5EQ 5G3LF 4R8IA 2F0NA 4GLVB 2PMZB 5LL6S 4LFCQ 2HCIA 2IPKD 3WDNA 5M5XH 4PMCA 1X9NA 2F52A 4DKAC 4HIDA 1WTOA 3Q0AA 1M8AA 1H95A 2B2VA 1SNMA 2CHBD 2IHEA 3EQLC 4Z9CB 4L5SA 2MO1A 1LT5D 4IALA 1DGSA 2A5HA 5C4JH 1WCMB 2HQEA 4QJFA 4A4IA 3SE0A 3STBC 3G4SA 5C5LA 1VQPA 1Y8NB 4C2MB 3CW2C 3M4YA 4AQYQ 4GOPB 3LGJA 2E2JB 4WJ3M 1VQ5A 4DV1L 1LACA 4IFDG 2VB2X 3QOJA 3BS1A 1HR0Q 1NE3A 1R9TB 2DNCA 1ASYA 3J81j 1K8MA 1STAA 2A68C 3GTLB 2V1CC 3U4VA 1V1PA 4MHEA 3I2ZA 2O5JC 1KXLA 2K5WA 1GOZA 1WCMH 2EXZA 3EROA 2I5LX 2B2YA 5IOCA 4C2MH 2E2JH 5TSSA 2FHTA 3WOFA 4ALPA 2B2UC 1R9TH 3MFGA 5H1SE 1Q86C 1X54A 3BZKA 5I4DA 1YNXA 3CCMA 3GTLH 4ZK9B 3I91A 1QCBD 3CRLC 3NENA 1LTAD 2K52A 2Y0SB 4YCVA 2MFIA 2F0KA 4JI5Q 1HNXL 2NZ1D 3AQQA 1Q1EA 4JOIA 4ZAIA 1F9SA 4JV5L 2NVYH 4IFDJ 2KOLA 4ID6A 1H9SA 1F9PA 1V1PB 4DAMA 4ZKCB 3W2DA 4MTNA 4HJ9A 3RNUA 5ELCA 4L8JA 1PDQA 3BDOA 3CCJA 4PNYA 1KC8C 1SE4A 1S40A 2JA8G 4EQOA 2LFNA 3K58A 4J15A 3TREA 1YNNC 4LF6L 4GNXA 2B2WC 1ONLA 4YWLA 3CRKC 4OO1G 4OHJA 4JI6Q 1TS3A 2KCMA 2XNAC 1CA6A 4K6LA 1WI5A 5C0XG 3GTGB 1T5EA 2F0GA 3AEVA 4JBMA 2F3IA 3PCOB 1VQIA 2F0UA 1O7IA 2K32A 1GUNA 1JB7A 1YHBA 3H3VH 2L9HA 2AWOA 4R4QA 3KLWA 1LT3D 2NVQB 3I73A 3HKSA 1PH8A 4L5RC 1H9SB 2NWGA 1HJPA 2PO4A 3JAML 3NWSA 3GTGH 1SYBA 3D6CA 1DOLA 1K0SA 2OF1A 1MSGA 2VW9A 1CI3M 3DUZA 3ND9A 4R4TA 5IY0A 1JE4A 2PQEA 1DOMA 1N36L 2JA8B 2UUCQ 1EEFD 2M2LA 1NR2A 3VR5A 4F88A 3T13A 2NVQH 4GNXB 4DV3Q 4QB4A 4IJLA 4YWKA 2L55A 2E2DC 5IWAQ 1SMYC 2ZJRA 1I5FA 3VYUA 3KLRA 4OELB 4UP8A 1PH4A 1PYSB 2CQOA 1YNJD 2Z8LA 3CHBD 1BCPB 3TMEA 2JA8H 2K7VA 4J8QA 4HAEA 1MSHA 2PMZE 3SR1A 1J5EL 3QJYA 3AB9A 4RCOA 2A6ED 4TQUS 3U4ZA 4OO1H 2E2HB 1Q8IA 5ELDA 4LFCL 4GKJQ 4JBKA 5C0XH 2EPBA 2RVLA 3PIOA 2PZUA 4XQJA 3D4WA 1VQMA 1NY4A 1PH2A 1EIHA 1VQNA 3CPWA 2LSSA 4IN3A 2R61A 1PFMA 2WACA 3U58A 1WTQA 2HHHQ 1MGSA 2EXDA 3S17B 2NZOA 1L0WA 3CMAA 1OXVA 4A3DG 5IGCA 3RUZA 2PYKA 2E2HH 1TWAB 4DV6Q 3JAMc 3OW7A 3FVQA 1U4RA 5CV8A 4AQYL 1WTHA 2C9OA 4UY8C 3HKZG 1SN8A 1HR0L 1S5BD 1WTVA 1NR4A 1KDBA 3GP7A 4A3FG 1CA5A 3S17H 4DV2Q 1O78A 1EEID 3QB3A 2EJGC 4XT3B 4HIMA 4IPDA 4KN4C 3RLNA 1KIXA 1PXUA 2VZAA 1MD2D 1RD9D 1JJ2A 3S1MH 1H9KA 1CHPD 5E7NA 4GLXA 5JPMC 1F9QA 1BCPF 2EYMA 3BZCA 1VQDA 5JJLA 2QDBA 3K0XA 5JJKA 3MWYW 2RCFA 2R7FA 2E76C 4G7ZC 2F0TA 2EYFA 2Y0SE 2K5VA 4L63B 2VB3X 1HRJA 5EKIA 2N3SA 5T1GA 2BH2A 5CV4A 1SE3A 1CKOA 4ZKBB 4A3DB 4OL7A 4JI5L 2K1BA 3TRZA 3Q8DA 3G6EA 2EZVA 1WYDA 5IE8A 4HSPA 1YHQA 5FO7B 5JVG3 4KJOA 1LTLA 1P8LA 3UDXA 2X6LA 3A7LA 2MGSA 2MJ8A 4A3MG 2K04A 4Q0FA 1SYEA 4RGOS 2SEBD 2QILA 4UP7A 3RN2A 1BR9A 5IGEA 4OXPA 1VDZA 3H91A 5IODA 3CD6A 4A3DH 5HGQA 2A6HC 1LYLA 1EOVA 4QUFA 3I4MB 1JWUD 2DNEA 5E3FA 1W2BA 4OX9Q 3NE5B 2AKWB 2E75C 1GUWA 1Y1VG 2F0FA 1Y1WG 5I9PA 3GTOB 4JI6L 2UXCQ 4GKKQ 4KHPQ 2NZHA 2J0TD 4LF9Q 4CJ1B 1L1OC 3K7UC 4O2DA 1GVPA 4LNQA 4NXMQ 2PNHA 4X3TA 3PO2B 3J81L 1UEAB 1B2TA 3I4MH 1U5KA 5DEHA 3QG1A 3HOWB 4A3KG 1E7ZA 4P2CB 2EVBA 4OWTB 4ZUJA 3CC7A 5EKKA 5KNDA 1PH1A 1TS4A 2OTLA 3GTOH 2L0CA 1PTOD 4C3HG 1ESFA 1QNUA 4NKLA 4AIMA 5A2QE 2RDHA 3RD4A 1D2BA 3WOEA 3E5SA 4DNRB 4DR4Q 3KOJA 1PZKD 3OW2A 4YWMA 2F0MA 5GROA 3K5LA 1TU2B 3PO2H 1I50B 5BN4A 4DV4Q 2OWOA 4KKUA 3HOWH 1X6OA 2UUCL 1KL9A 4OWXB 5L37A 1Y1VB 2TMPA 4DV3L 1EQRA 1VF7A 5FO9B 4BY1G 5IWAL 2WAQB 1O7LA 4CJ0B 1I6VC 1VQGA 1I50H 3NXWA 1EQVA 3KF8A 1K73C 1VQKA 1FNUA 1U4LA 1UWVA 4DUYQ 4BY7G 3R8BA 3CPFA 4A76A 1SDFA 1Y1VH 3Q23A 3FRPB 3CCVA 5E4WC 1BKBA 4LUOA 2Z1CA
chains in the Genus database with same CATH topology
4JCVE 1FJGL 1K8AC 1HZAA 4RMFA 5IYDG 1VS0A 1CUKA 5ELNA 4HIOA 1E1TA 3AYHB 5AJ3L 4A3CG 3J81c 1E1OA 2ZTEA 4IPHA 4TVAB 5M5WH 3HOZG 1QVGA 1IBMQ 2D62A 3UDGA 4JI2L 4NB3A 1N33L 4APVA 2HHHL 4JI4L 2UXBQ 4HJ7A 1Q8KA 3I7FA 4JC0A 3L7ZC 1Q7YC 2KBNA 5C3EG 1GM5A 3CCLA 5GQOA 1YI2A 4DK6C 2YU9H 1MIUA 1FGUA 1YZ6A 4C3HH 5LMUQ 1EQQA 1QUQB 4DV6L 2UUBL 4P72A 3U50C 1XPUA 1X3FA 3UE0A 5BR8L 2R7ZG 2K5NA 2JA6G 1V9PA 2RF4A 4B3RQ 1LM0A 3UE1A 3KF8B 2JA7H 3M3YH 4A3GG 4A93G 1GKHA 2JE6I 1N8RC 4X64L 1UEBA 5IP7H 2JEBI 4DV2L 4IOCA 2I0QA 4B3MQ 3A0JA 4JI0L 3GO5A 3PO3H 3B6YA 3GDEA 4DR6Q 2MNAA 1EFWA 1M1KC 2A1AA 4JYAL 2CKZB 2N78A 4QGUA 1Z9FA 3HOUG 2HIVA 4NPSA 4WJ4A 4HIKA 1XNQL 1EUJA 2ZTCA 3PGZA 1K9MC 4P74A 4MNOA 4C3JH 4LW1A 5LMNW 1YITA 1VQ7A 4DR5L 2D0OA 4A3EG 2WFWA 3S24A 3WWVA 5C4XG 4GOPA 1JMCA 4BXXH 2K75A 2PI2A 1OXXK 1PH6A 3PUXA 2B3GA 1BVSA 4A3IH 3UDFA 4BY7H 2WP8J 3K8AA 2VQEQ 2HIXA 2VY3A 3W5OA 4DV1Q 4A3FH 4B3TQ 2VS1A 1E3PA 3L2PA 5IYBG 4DR3Q 4B3RL 1YJWA 1TWHH 4PMWA 4H02A 4P75A 4X62Q 1J5EQ 2JA5G 2BA1A 2EIFA 1NBWA 4AYBG 1JJGA 4KI0A 2FXQA 3GD7A 4GLVB 4DV5Q 4LFCQ 1QVFA 4X66Q 3HOZH 1MJCA 4B3ML 2JQOA 5M5XH 5C44H 1XNRQ 4DR6L 1X9NA 2R93G 2F52A 3IRBA 4DKAC 1KRSA 4HIDA 1YIJA 1I94Q 2Q2TA 2VNUD 1KQSA 1H95A 1W3SA 3S1NH 4DR1Q 2IHEA 1K0RA 1QZGA 2YYZA 4L5SA 2MO1A 4YY3Q 1CKMA 5LMNL 4PZ8A 1DGSA 5C4JH 4JBWA 3CC4A 3CAMA 2UUAQ 3PUVA 4DV0L 2ASBA 4QJFA 4A4IA 2EQSA 1LUZA 3STBC 2JA6H 2R7ZH 3G4SA 5C0XJ 2IY5B 1VQPA 3A5UA 3CW2C 4JI7L 4LFAL 4AQYQ 4GOPB 3LGJA 1HNXQ 2LXJA 4GLAC 4A93H 4WJ3M 1VQ5A 4LUVA 4DV1L 1VQOA 4IFDG 3EBEA 1HR0Q 3G48A 4GN5A 5GAHC 1SR3A 1NE3A 4B3SL 4GKKL 2K50A 4L5QA 1ASYA 2UXCL 5FJ8H 4LF9L 3J81j 1IBKQ 3GTJH 2V1CC 3NBHB 3U4VA 1CKNA 4A3MH 4NXML 4A3JG 3ZJYC 1IBLQ 1PH3A 1NTGA 3ULLA 3I2ZA 4GN3B 1KXLA 4DV5L 1VQLA 1WCMH 3CCUA 2VQFQ 4KLKA 1U0LA 2I5LX 3PV0A 3KJPA 1PYBA 1XNRL 1SE8A 4C2MH 3DLLA 4LFBL 3PUWA 4A3EH 1K83H 5C4XH 3RN5A 2E2JH 3PSIA 1VQ8A 1IYJB 3D31A 4ALPA 2N8NA 4X65Q 4Y52H 1R9TH 3CF5A 1HNZL 5H1SE 1Q86C 1X54A 3BZKA 1Y1WH 2E8GA 2YV5A 4A3LG 1VQCA 1YNXA 2I5MX 2RHQB 3RLOA 3CCMA 4DV7Q 3GTLH 1C9OA 4DR4L 3L0OA 1VQJA 2UUAL 5C0XI 3J7ZC 3NENA 3H0GG 2ZJQA 1XJVA 2K52A 4JI8Q 3RZDH 4YCVA 2KCTA 4DV4L 2MFIA 2ES2A 2JA5H 1NMGA 1SRUA 1WFQA 1HNXL 4JI5Q 3S1QH 4NXNQ 4LF6Q 4X6AH 2D0PA 1BBUA 4IJHA 1FVIA 3AQQA 1OXTA 4DR7Q 1Q1EA 1YVCA 2WAQE 4A3KH 4JOIA 1AH9A 1B7YB 3I55A 1IBKL 1Q82C 4JV5L 1KRTA 3HFZB 2NVYH 4IFDJ 3PIPA 1IBLL 2CCZA 2R92G 1VQBA 1WOCA 4RG1A 1B70B 3K81C 4DAYB 4DNIA 2ID0A 2KHIA 4JI3Q 2VUMG 1CKNB 2MO0A 3T1HL 2OQ0A 1TWAH 2CWPA 4DAMA 3I4MG 2I5HA 4DUYL 1V1QA 4MTNA 4HJ9A 3RNUA 3F2DA 1X56A 3CCJA 1KC8C 3A74A 5DLQE 4LUZA 4JI1L 1S40A 2JA8G 3ERSX 1UE5A 1X55A 4J15A 4JBJA 3M9BA 3M4QA 4PZ7A 3TREA 2UU9L 4JOIC 4GNXA 4LF6L 1N36Q 4YCUA 4R4IA 4LF4Q 3F2BA 3HOYG 4YWLA 4BY1H 1N32Q 3PUYA 4OO1G 3TEHB 4JI6Q 2KCMA 5HY6A 3PO2G 1WI5A 3TQYA 5C0XG 1IBML 1N9WA 4P71A 2ATWA 4MZ9A 4PG3A 3HOWG 3AEVA 2BH8A 2F3IA 4JBMA 2UXBL 3PCOB 4GN4B 4IFDI 1Y14B 1TWCH 1VQIA 3CC2A 1NJIC 1KD1C 1S72A 3I4NH 3OYYA 1O7IA 1Q81C 1K3RA 2A8VA 3JC66 1JB7A 2CFMA 2F4VQ 5LMUL 1YHBA 2E5LQ 4JI3L 3H3VH 4UP9A 2QA4A 4A3LH 1HNWQ 2AWOA 4IO9A 4R4QA 3KLWA 3HKSA 1PH8A 3VDYA 3GTKH 4L5RC 1G6PA 3FKIG 2IX1A 1XMQQ 3H0GH 3HKZE 1HJPA 4A3BG 4QIWE 1XPRA 5GAEC 3GTGH 1XTDA 5IYCG 5IYDH 5JEAJ 1Z47A 4JG2A 2K14A 4QQBX 3SGIA 3T1YQ 4A3CH 2Q2HA 2Z0SA 1EIFA 1BBWA 2VW9A 1YJNA 5IT9c 1JE5A 1HZBA 4R4TA 3H3VI 5IY0A 4GOPC 3M4PA 1I6HH 1XPOA 1N36L 1S3OA 2UUCQ 4LF5Q 4BBSG 4QL5A 1SFOH 5K36G 3OTOQ 1FL0A 2NVTH 5C3EH 1N32L 4UPAA 4YCWA 2WAQG 1KAWA 2NVQH 4GNXB 3D0FA 3BU2A 4DV3Q 3FHWA 2R92H 4IJLA 4YWKA 2MQHA 2XGTA 2ZJPA 4K0KQ 2WB1E 2OQKA 5IWAQ 1VQ9A 3M7NA 1EIYB 2ZJRA 1I5FA 5FLMG 3CCRA 1OXSC 2B29A 4IPCA 1G51A 1N34Q 1E22A 4IPGA 5ELOA 4UP8A 1PH4A 1L2FA 1PYSB 3NEMA 1VQAA 2CQOA 4DR2Q 1IZ6A 2VQEL 4PZ6A 4A3GH 3FP9A 3UDIA 4B3TL 2ZM6Q 2JA8H 1HNWL 2UXDL 3CCSA 4A75A 1HR0W 3CP0A 1X3EA 1A8VA 2CWAA 1KHIA 4DR3L 2BA0A 3J80i 2PMZE 4X62L 1J5EL 2OTJA 3HOUH 4YHHQ 3U4ZA 4TQUS 2YTVA 2DGYA 1AE2A 4LFCL 4GKJQ 1TWFH 3K80C 1P16A 4X66L 4JBKA 3S2DH 3PIOA 4O0AA 3DM3A 2H5XA 1I94L 1VQMA 1NY4A 1PH2A 2NVXH 1VQNA 4OWWB 1X3GA 3KDFA 5IP7G 3CPWA 2LSSA 4DR1L 3EN2A 2RCNA 4JI2Q 2Z6KA 4AH6A 2Q2IA 1N33Q 3F1ZA 3U58A 2JEAI 2HHHQ 1C0AA 4YY3L 1PA6A 2EXDA 2NZOA 3NELA 1L0WA 1GD7A 3G71A 3CMAA 4OO1I 1A0IA 2OCEA 3I4OA 1OXVA 2QGQA 3TS0A 3S16H 1VQ6A 4A3DG 5IYBH 2E2HH 5IP9G 3HOVG 2YTXA 3CQZH 4DV6Q 2UUBQ 2JA9A 1PFSA 3JAMc 3CMEA 3PF4A 1HZ9A 1SLJA 4AQYL 5BR8Q 5IYCH 4UY8C 3HKZG 2XTIA 1SN8A 1HR0L 3ULJA 1E24A 4DPGA 2NN6G 1XMOQ 4POGA 2R93H 3HOXG 4A3FG 3F2CA 4DUZQ 4X64Q 3S17H 4BBSH 1VQ4A 1EYGA 1SMXA 2Z6KC 4DV2Q 3BJUA 1M90C 4OONA 4JI0Q 3E9HA 1D8LA 4GKJL 5M3MG 2VQFL 4JYAQ 4HIMA 4IPDA 1RIPA 2PQAA 3RLNA 5JEAG 4HJAA 4HJ5A 1KIXA 1XNQQ 2VZAA 3E0EA 1RL2A 1JJ2A 1OXUA 2AMCB 5M5YH 1YJ9A 3S1MH 1JT8A 5FLMH 5E7NA 4GLXA 2WB1G 4QY7A 1C7YA 1YEZA 1VCIA 1WJJA 2GN5A 3E9IA 5C44G 3BZCA 4DR5Q 2K5HA 2R7DA 4X65L 1VQDA 3AFQA 4R4CA 1PV4A 2IT1A 3K0XA 3RZOH 1PVOA 4LWCA 5GAGC 4LF7Q 5JJKA 5JJLA 2R7FA 2HQLA 3KDFB 4DV7L 1MKHA 4BA2I 4HJ8A 2Y0SE 2K5VA 1HZCA 2ZTDA 2N3SA 4JI8L 2BH2A 1D7QA 2AWNA 3J80c 4C3IH 1CKOA 3KYHC 4A3JH 3S1RH 4JI5L 3TRZA 1VQEA 3A5ZB 3Q8DA 4NXNL 4XIGS 3G6EA 1GO3E 1CSQA 1WYDA 5IE8A 4DR7L 3ER0A 1T9HA 1XMOL 3J7A5 1YHQA 3RR5A 3AFPA 4DUZL 1LTLA 1P8LA 1PH9A 4L5TA 3F8TA 2LXKA 5FJ8G 2GVAA 2YTYA 3UDXA 2B63G 4A3MG 1L1OA 4LF8Q 5GADC 3S14H 4BBRG 3S15H 4UP7A 5M3FG 4GNXC 3RN2A 4OXPA 1HH2P 1WCMG 3STBD 3W1GA 3CD6A 4A3DH 5J3BA 5HGQA 3JAMi 1LYLA 1EOVA 2K4KA 2KHJA 2PQAB 5IP9H 3CCEA 5LMNQ 1PH5A 3HOVH 1UE7A 3KFUA 1W2BA 1J6QA 4DV0Q 4LF7L 4FDBA 2N49A 4KHZA 4OX9Q 2AKWB 1Y1VG 4R1JA 3GTMH 1Y1WG 4JI7Q 1V43A 4LFAQ 1OTCA 3S2HH 3W1BA 4EX5A 4LF4L 1CSPA 3HOXH 2HT1A 1IXRA 2KENA 4JI6L 1PHJA 2AHOB 4B3SQ 3M4OH 2NZHA 4GKKQ 4KHPQ 2UXCQ 4LF9Q 1L1OC 3K7UC 4O2DA 1GVPA 1MJEA 4P73A 4LNQA 2PNHA 4NXMQ 5M3MH 4XTCS 3ICEA 2VUMH 3KF6A 1A63A 1NMFA 3J81i 2UXDQ 2ALYB 3I4MH 1I3QH 4ME3A 1U5KA 2NN6I 1UE6A 4A3KG 1E7ZA 1JJCB 1UE1A 4Y7NH 3GTQH 2F4VL 4LFBQ 3CXCA 2E5LL 1TWGH 1G291 4LF8L 4OWTB 3CC7A 1PH1A 2OTLA 3CCQA 3GTOH 1Q1BA 3H15A 3PUZA 1Q12A 1QVCA 1HNZQ 1IL2A 1B8AA 3I56A 1XMQL 1L1OB 4AIMA 1X65A 2Y0SG 3HOYH 4DR4Q 3KJOA 3KOJA 3OW2A 1TXYA 4YWMA 3T1YL 3EIVA 3PF5A 2Q2UA 5GROA 3PO2H 5JJIA 3K7AH 1QZHA 2A19A 1FJGQ 1Q46A 4OX9L 2JA7G 5AJ3Q 4DV4Q 1ASZA 2OWOA 3HOWH 1A62A 1X6OA 3MXNB 4GS3A 4BA1I 2UUCL 4LF5L 2GVBA 3OTOL 1KL9A 4OWXB 3PO3G 2RHSB 2QEXA 4JI4Q 2JJQA 4KHPL 4DV3L 1EQRA 4K0KL 4IOAA 1VQHA 1QUQA 4BY1G 2B63H 5IWAL 4JV5Q 2JK8A 3ULPA 1SROA 1VQFA 5EAYA 4BBRH 5FLXc 1N34L 5M3FH 3MEFA 2R6GA 1VQGA 3FKIH 3RLFA 4DK3C 2PI2E 3TS2A 1I50H 2IHFA 2C35B 4A3BH 3T1HQ 4DR2L 3KF6B 1K73C 1YHAA 4BXXG 2DUDA 1VQKA 1AE3A 2ZM6L 1UWVA 4DUYQ 4A3IG 4EQ5A 4BY7G 3I4NG 3CPFA 4A76A 1K8GA 2VL6A 2L15A 1Y1VH 1PH7A 4JI1Q 3M85A 1YBYA 2IX0A 4POFA 3CCVA 4R4OA 4YHHL 1BKBA 3GTPH 1EWIA 2E2IH 2UU9Q 4AYBE 4LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV E;  1FJG L;  1K8A C;  1HZA A;  4RMF A;  5IYD G;  1VS0 A;  1CUK A;  5ELN A;  4HIO A;  1E1T A;  3AYH B;  5AJ3 L;  4A3C G;  3J81 c;  1E1O A;  2ZTE A;  4IPH A;  4TVA B;  5M5W H;  3HOZ G;  1QVG A;  1IBM Q;  2D62 A;  3UDG A;  4JI2 L;  4NB3 A;  1N33 L;  4APV A;  2HHH L;  4JI4 L;  2UXB Q;  4HJ7 A;  1Q8K A;  3I7F A;  4JC0 A;  3L7Z C;  1Q7Y C;  2KBN A;  5C3E G;  1GM5 A;  3CCL A;  5GQO A;  1YI2 A;  4DK6 C;  2YU9 H;  1MIU A;  1FGU A;  1YZ6 A;  4C3H H;  5LMU Q;  1EQQ A;  1QUQ B;  4DV6 L;  2UUB L;  4P72 A;  3U50 C;  1XPU A;  1X3F A;  3UE0 A;  5BR8 L;  2R7Z G;  2K5N A;  2JA6 G;  1V9P A;  2RF4 A;  4B3R Q;  1LM0 A;  3UE1 A;  3KF8 B;  2JA7 H;  3M3Y H;  4A3G G;  4A93 G;  1GKH A;  2JE6 I;  1N8R C;  4X64 L;  1UEB A;  5IP7 H;  2JEB I;  4DV2 L;  4IOC A;  2I0Q A;  4B3M Q;  3A0J A;  4JI0 L;  3GO5 A;  3PO3 H;  3B6Y A;  3GDE A;  4DR6 Q;  2MNA A;  1EFW A;  1M1K C;  2A1A A;  4JYA L;  2CKZ B;  2N78 A;  4QGU A;  1Z9F A;  3HOU G;  2HIV A;  4NPS A;  4WJ4 A;  4HIK A;  1XNQ L;  1EUJ A;  2ZTC A;  3PGZ A;  1K9M C;  4P74 A;  4MNO A;  4C3J H;  4LW1 A;  5LMN W;  1YIT A;  1VQ7 A;  4DR5 L;  2D0O A;  4A3E G;  2WFW A;  3S24 A;  3WWV A;  5C4X G;  4GOP A;  1JMC A;  4BXX H;  2K75 A;  2PI2 A;  1OXX K;  1PH6 A;  3PUX A;  2B3G A;  1BVS A;  4A3I H;  3UDF A;  4BY7 H;  2WP8 J;  3K8A A;  2VQE Q;  2HIX A;  2VY3 A;  3W5O A;  4DV1 Q;  4A3F H;  4B3T Q;  2VS1 A;  1E3P A;  3L2P A;  5IYB G;  4DR3 Q;  4B3R L;  1YJW A;  1TWH H;  4PMW A;  4H02 A;  4P75 A;  4X62 Q;  1J5E Q;  2JA5 G;  2BA1 A;  2EIF A;  1NBW A;  4AYB G;  1JJG A;  4KI0 A;  2FXQ A;  3GD7 A;  4GLV B;  4DV5 Q;  4LFC Q;  1QVF A;  4X66 Q;  3HOZ H;  1MJC A;  4B3M L;  2JQO A;  5M5X H;  5C44 H;  1XNR Q;  4DR6 L;  1X9N A;  2R93 G;  2F52 A;  3IRB A;  4DKA C;  1KRS A;  4HID A;  1YIJ A;  1I94 Q;  2Q2T A;  2VNU D;  1KQS A;  1H95 A;  1W3S A;  3S1N H;  4DR1 Q;  2IHE A;  1K0R A;  1QZG A;  2YYZ A;  4L5S A;  2MO1 A;  4YY3 Q;  1CKM A;  5LMN L;  4PZ8 A;  1DGS A;  5C4J H;  4JBW A;  3CC4 A;  3CAM A;  2UUA Q;  3PUV A;  4DV0 L;  2ASB A;  4QJF A;  4A4I A;  2EQS A;  1LUZ A;  3STB C;  2JA6 H;  2R7Z H;  3G4S A;  5C0X J;  2IY5 B;  1VQP A;  3A5U A;  3CW2 C;  4JI7 L;  4LFA L;  4AQY Q;  4GOP B;  3LGJ A;  1HNX Q;  2LXJ A;  4GLA C;  4A93 H;  4WJ3 M;  1VQ5 A;  4LUV A;  4DV1 L;  1VQO A;  4IFD G;  3EBE A;  1HR0 Q;  3G48 A;  4GN5 A;  5GAH C;  1SR3 A;  1NE3 A;  4B3S L;  4GKK L;  2K50 A;  4L5Q A;  1ASY A;  2UXC L;  5FJ8 H;  4LF9 L;  3J81 j;  1IBK Q;  3GTJ H;  2V1C C;  3NBH B;  3U4V A;  1CKN A;  4A3M H;  4NXM L;  4A3J G;  3ZJY C;  1IBL Q;  1PH3 A;  1NTG A;  3ULL A;  3I2Z A;  4GN3 B;  1KXL A;  4DV5 L;  1VQL A;  1WCM H;  3CCU A;  2VQF Q;  4KLK A;  1U0L A;  2I5L X;  3PV0 A;  3KJP A;  1PYB A;  1XNR L;  1SE8 A;  4C2M H;  3DLL A;  4LFB L;  3PUW A;  4A3E H;  1K83 H;  5C4X H;  3RN5 A;  2E2J H;  3PSI A;  1VQ8 A;  1IYJ B;  3D31 A;  4ALP A;  2N8N A;  4X65 Q;  4Y52 H;  1R9T H;  3CF5 A;  1HNZ L;  5H1S E;  1Q86 C;  1X54 A;  3BZK A;  1Y1W H;  2E8G A;  2YV5 A;  4A3L G;  1VQC A;  1YNX A;  2I5M X;  2RHQ B;  3RLO A;  3CCM A;  4DV7 Q;  3GTL H;  1C9O A;  4DR4 L;  3L0O A;  1VQJ A;  2UUA L;  5C0X I;  3J7Z C;  3NEN A;  3H0G G;  2ZJQ A;  1XJV A;  2K52 A;  4JI8 Q;  3RZD H;  4YCV A;  2KCT A;  4DV4 L;  2MFI A;  2ES2 A;  2JA5 H;  1NMG A;  1SRU A;  1WFQ A;  1HNX L;  4JI5 Q;  3S1Q H;  4NXN Q;  4LF6 Q;  4X6A H;  2D0P A;  1BBU A;  4IJH A;  1FVI A;  3AQQ A;  1OXT A;  4DR7 Q;  1Q1E A;  1YVC A;  2WAQ E;  4A3K H;  4JOI A;  1AH9 A;  1B7Y B;  3I55 A;  1IBK L;  1Q82 C;  4JV5 L;  1KRT A;  3HFZ B;  2NVY H;  4IFD J;  3PIP A;  1IBL L;  2CCZ A;  2R92 G;  1VQB A;  1WOC A;  4RG1 A;  1B70 B;  3K81 C;  4DAY B;  4DNI A;  2ID0 A;  2KHI A;  4JI3 Q;  2VUM G;  1CKN B;  2MO0 A;  3T1H L;  2OQ0 A;  1TWA H;  2CWP A;  4DAM A;  3I4M G;  2I5H A;  4DUY L;  1V1Q A;  4MTN A;  4HJ9 A;  3RNU A;  3F2D A;  1X56 A;  3CCJ A;  1KC8 C;  3A74 A;  5DLQ E;  4LUZ A;  4JI1 L;  1S40 A;  2JA8 G;  3ERS X;  1UE5 A;  1X55 A;  4J15 A;  4JBJ A;  3M9B A;  3M4Q A;  4PZ7 A;  3TRE A;  2UU9 L;  4JOI C;  4GNX A;  4LF6 L;  1N36 Q;  4YCU A;  4R4I A;  4LF4 Q;  3F2B A;  3HOY G;  4YWL A;  4BY1 H;  1N32 Q;  3PUY A;  4OO1 G;  3TEH B;  4JI6 Q;  2KCM A;  5HY6 A;  3PO2 G;  1WI5 A;  3TQY A;  5C0X G;  1IBM L;  1N9W A;  4P71 A;  2ATW A;  4MZ9 A;  4PG3 A;  3HOW G;  3AEV A;  2BH8 A;  2F3I A;  4JBM A;  2UXB L;  3PCO B;  4GN4 B;  4IFD I;  1Y14 B;  1TWC H;  1VQI A;  3CC2 A;  1NJI C;  1KD1 C;  1S72 A;  3I4N H;  3OYY A;  1O7I A;  1Q81 C;  1K3R A;  2A8V A;  3JC6 6;  1JB7 A;  2CFM A;  2F4V Q;  5LMU L;  1YHB A;  2E5L Q;  4JI3 L;  3H3V H;  4UP9 A;  2QA4 A;  4A3L H;  1HNW Q;  2AWO A;  4IO9 A;  4R4Q A;  3KLW A;  3HKS A;  1PH8 A;  3VDY A;  3GTK H;  4L5R C;  1G6P A;  3FKI G;  2IX1 A;  1XMQ Q;  3H0G H;  3HKZ E;  1HJP A;  4A3B G;  4QIW E;  1XPR A;  5GAE C;  3GTG H;  1XTD A;  5IYC G;  5IYD H;  5JEA J;  1Z47 A;  4JG2 A;  2K14 A;  4QQB X;  3SGI A;  3T1Y Q;  4A3C H;  2Q2H A;  2Z0S A;  1EIF A;  1BBW A;  2VW9 A;  1YJN A;  5IT9 c;  1JE5 A;  1HZB A;  4R4T A;  3H3V I;  5IY0 A;  4GOP C;  3M4P A;  1I6H H;  1XPO A;  1N36 L;  1S3O A;  2UUC Q;  4LF5 Q;  4BBS G;  4QL5 A;  1SFO H;  5K36 G;  3OTO Q;  1FL0 A;  2NVT H;  5C3E H;  1N32 L;  4UPA A;  4YCW A;  2WAQ G;  1KAW A;  2NVQ H;  4GNX B;  3D0F A;  3BU2 A;  4DV3 Q;  3FHW A;  2R92 H;  4IJL A;  4YWK A;  2MQH A;  2XGT A;  2ZJP A;  4K0K Q;  2WB1 E;  2OQK A;  5IWA Q;  1VQ9 A;  3M7N A;  1EIY B;  2ZJR A;  1I5F A;  5FLM G;  3CCR A;  1OXS C;  2B29 A;  4IPC A;  1G51 A;  1N34 Q;  1E22 A;  4IPG A;  5ELO A;  4UP8 A;  1PH4 A;  1L2F A;  1PYS B;  3NEM A;  1VQA A;  2CQO A;  4DR2 Q;  1IZ6 A;  2VQE L;  4PZ6 A;  4A3G H;  3FP9 A;  3UDI A;  4B3T L;  2ZM6 Q;  2JA8 H;  1HNW L;  2UXD L;  3CCS A;  4A75 A;  1HR0 W;  3CP0 A;  1X3E A;  1A8V A;  2CWA A;  1KHI A;  4DR3 L;  2BA0 A;  3J80 i;  2PMZ E;  4X62 L;  1J5E L;  2OTJ A;  3HOU H;  4YHH Q;  3U4Z A;  4TQU S;  2YTV A;  2DGY A;  1AE2 A;  4LFC L;  4GKJ Q;  1TWF H;  3K80 C;  1P16 A;  4X66 L;  4JBK A;  3S2D H;  3PIO A;  4O0A A;  3DM3 A;  2H5X A;  1I94 L;  1VQM A;  1NY4 A;  1PH2 A;  2NVX H;  1VQN A;  4OWW B;  1X3G A;  3KDF A;  5IP7 G;  3CPW A;  2LSS A;  4DR1 L;  3EN2 A;  2RCN A;  4JI2 Q;  2Z6K A;  4AH6 A;  2Q2I A;  1N33 Q;  3F1Z A;  3U58 A;  2JEA I;  2HHH Q;  1C0A A;  4YY3 L;  1PA6 A;  2EXD A;  2NZO A;  3NEL A;  1L0W A;  1GD7 A;  3G71 A;  3CMA A;  4OO1 I;  1A0I A;  2OCE A;  3I4O A;  1OXV A;  2QGQ A;  3TS0 A;  3S16 H;  1VQ6 A;  4A3D G;  5IYB H;  2E2H H;  5IP9 G;  3HOV G;  2YTX A;  3CQZ H;  4DV6 Q;  2UUB Q;  2JA9 A;  1PFS A;  3JAM c;  3CME A;  3PF4 A;  1HZ9 A;  1SLJ A;  4AQY L;  5BR8 Q;  5IYC H;  4UY8 C;  3HKZ G;  2XTI A;  1SN8 A;  1HR0 L;  3ULJ A;  1E24 A;  4DPG A;  2NN6 G;  1XMO Q;  4POG A;  2R93 H;  3HOX G;  4A3F G;  3F2C A;  4DUZ Q;  4X64 Q;  3S17 H;  4BBS H;  1VQ4 A;  1EYG A;  1SMX A;  2Z6K C;  4DV2 Q;  3BJU A;  1M90 C;  4OON A;  4JI0 Q;  3E9H A;  1D8L A;  4GKJ L;  5M3M G;  2VQF L;  4JYA Q;  4HIM A;  4IPD A;  1RIP A;  2PQA A;  3RLN A;  5JEA G;  4HJA A;  4HJ5 A;  1KIX A;  1XNQ Q;  2VZA A;  3E0E A;  1RL2 A;  1JJ2 A;  1OXU A;  2AMC B;  5M5Y H;  1YJ9 A;  3S1M H;  1JT8 A;  5FLM H;  5E7N A;  4GLX A;  2WB1 G;  4QY7 A;  1C7Y A;  1YEZ A;  1VCI A;  1WJJ A;  2GN5 A;  3E9I A;  5C44 G;  3BZC A;  4DR5 Q;  2K5H A;  2R7D A;  4X65 L;  1VQD A;  3AFQ A;  4R4C A;  1PV4 A;  2IT1 A;  3K0X A;  3RZO H;  1PVO A;  4LWC A;  5GAG C;  4LF7 Q;  5JJK A;  5JJL A;  2R7F A;  2HQL A;  3KDF B;  4DV7 L;  1MKH A;  4BA2 I;  4HJ8 A;  2Y0S E;  2K5V A;  1HZC A;  2ZTD A;  2N3S A;  4JI8 L;  2BH2 A;  1D7Q A;  2AWN A;  3J80 c;  4C3I H;  1CKO A;  3KYH C;  4A3J H;  3S1R H;  4JI5 L;  3TRZ A;  1VQE A;  3A5Z B;  3Q8D A;  4NXN L;  4XIG S;  3G6E A;  1GO3 E;  1CSQ A;  1WYD A;  5IE8 A;  4DR7 L;  3ER0 A;  1T9H A;  1XMO L;  3J7A 5;  1YHQ A;  3RR5 A;  3AFP A;  4DUZ L;  1LTL A;  1P8L A;  1PH9 A;  4L5T A;  3F8T A;  2LXK A;  5FJ8 G;  2GVA A;  2YTY A;  3UDX A;  2B63 G;  4A3M G;  1L1O A;  4LF8 Q;  5GAD C;  3S14 H;  4BBR G;  3S15 H;  4UP7 A;  5M3F G;  4GNX C;  3RN2 A;  4OXP A;  1HH2 P;  1WCM G;  3STB D;  3W1G A;  3CD6 A;  4A3D H;  5J3B A;  5HGQ A;  3JAM i;  1LYL A;  1EOV A;  2K4K A;  2KHJ A;  2PQA B;  5IP9 H;  3CCE A;  5LMN Q;  1PH5 A;  3HOV H;  1UE7 A;  3KFU A;  1W2B A;  1J6Q A;  4DV0 Q;  4LF7 L;  4FDB A;  2N49 A;  4KHZ A;  4OX9 Q;  2AKW B;  1Y1V G;  4R1J A;  3GTM H;  1Y1W G;  4JI7 Q;  1V43 A;  4LFA Q;  1OTC A;  3S2H H;  3W1B A;  4EX5 A;  4LF4 L;  1CSP A;  3HOX H;  2HT1 A;  1IXR A;  2KEN A;  4JI6 L;  1PHJ A;  2AHO B;  4B3S Q;  3M4O H;  2NZH A;  4GKK Q;  4KHP Q;  2UXC Q;  4LF9 Q;  1L1O C;  3K7U C;  4O2D A;  1GVP A;  1MJE A;  4P73 A;  4LNQ A;  2PNH A;  4NXM Q;  5M3M H;  4XTC S;  3ICE A;  2VUM H;  3KF6 A;  1A63 A;  1NMF A;  3J81 i;  2UXD Q;  2ALY B;  3I4M H;  1I3Q H;  4ME3 A;  1U5K A;  2NN6 I;  1UE6 A;  4A3K G;  1E7Z A;  1JJC B;  1UE1 A;  4Y7N H;  3GTQ H;  2F4V L;  4LFB Q;  3CXC A;  2E5L L;  1TWG H;  1G29 1;  4LF8 L;  4OWT B;  3CC7 A;  1PH1 A;  2OTL A;  3CCQ A;  3GTO H;  1Q1B A;  3H15 A;  3PUZ A;  1Q12 A;  1QVC A;  1HNZ Q;  1IL2 A;  1B8A A;  3I56 A;  1XMQ L;  1L1O B;  4AIM A;  1X65 A;  2Y0S G;  3HOY H;  4DR4 Q;  3KJO A;  3KOJ A;  3OW2 A;  1TXY A;  4YWM A;  3T1Y L;  3EIV A;  3PF5 A;  2Q2U A;  5GRO A;  3PO2 H;  5JJI A;  3K7A H;  1QZH A;  2A19 A;  1FJG Q;  1Q46 A;  4OX9 L;  2JA7 G;  5AJ3 Q;  4DV4 Q;  1ASZ A;  2OWO A;  3HOW H;  1A62 A;  1X6O A;  3MXN B;  4GS3 A;  4BA1 I;  2UUC L;  4LF5 L;  2GVB A;  3OTO L;  1KL9 A;  4OWX B;  3PO3 G;  2RHS B;  2QEX A;  4JI4 Q;  2JJQ A;  4KHP L;  4DV3 L;  1EQR A;  4K0K L;  4IOA A;  1VQH A;  1QUQ A;  4BY1 G;  2B63 H;  5IWA L;  4JV5 Q;  2JK8 A;  3ULP A;  1SRO A;  1VQF A;  5EAY A;  4BBR H;  5FLX c;  1N34 L;  5M3F H;  3MEF A;  2R6G A;  1VQG A;  3FKI H;  3RLF A;  4DK3 C;  2PI2 E;  3TS2 A;  1I50 H;  2IHF A;  2C35 B;  4A3B H;  3T1H Q;  4DR2 L;  3KF6 B;  1K73 C;  1YHA A;  4BXX G;  2DUD A;  1VQK A;  1AE3 A;  2ZM6 L;  1UWV A;  4DUY Q;  4A3I G;  4EQ5 A;  4BY7 G;  3I4N G;  3CPF A;  4A76 A;  1K8G A;  2VL6 A;  2L15 A;  1Y1V H;  1PH7 A;  4JI1 Q;  3M85 A;  1YBY A;  2IX0 A;  4POF A;  3CCV A;  4R4O A;  4YHH L;  1BKB A;  3GTP H;  1EWI A;  2E2I H;  2UU9 Q;  4AYB E;  4LUO A; 
#chains in the Genus database with same CATH topology
 1C8C A;  1DCZ A;  5IYD G;  4LK1 C;  1VS0 A;  1CUK A;  3S1R B;  5ELN A;  3J81 c;  1E1O A;  4TVA B;  3FDT A;  3HOZ G;  2K05 A;  3DWQ A;  4TSS A;  2SDF A;  2H1E A;  1EFI D;  1J9O A;  2HHH L;  4JC0 A;  1KDC A;  5CMD A;  1O7Y A;  2WV6 D;  4C3H H;  4FXK C;  5LMU Q;  4S3S A;  4DV6 L;  1IKL A;  1GHK A;  1XPU A;  1HA5 A;  2A69 C;  2RF4 A;  1G2S A;  1F77 A;  2CH4 A;  1AZQ A;  2Z9H A;  1TS5 A;  3KF8 B;  4XQN A;  4BY7 B;  1A3U A;  1B53 A;  3R2I A;  4DV2 L;  2O5I C;  3A0J A;  3S2H B;  4DAV A;  1EWC A;  4RGT A;  3HOU G;  1PTO H;  4F87 A;  4JW0 A;  4RKL A;  4NDX A;  1TWH B;  1MHW C;  5LMN W;  1WVL A;  5C4X G;  3HOZ B;  1JR0 D;  2PI2 A;  1IW7 C;  5C44 B;  1BVS A;  5HUR A;  3UDF A;  4BY7 H;  3X3M A;  2WP8 J;  4RGN A;  2NN6 H;  3K8A A;  1IL8 A;  3MA2 B;  3W5O A;  3S1N B;  1FYC A;  4DV1 Q;  4B3T Q;  3NBH A;  1OO9 B;  5IYB G;  3AMU A;  2CVR A;  1TWH H;  2BA1 A;  3R3O A;  1NBW A;  4AYB G;  1GUT A;  2JN4 A;  4IUT A;  3HOZ H;  5C44 H;  1ICW A;  3HP3 A;  3IRB A;  2Q2T A;  2VNU D;  2PPB C;  4XT1 B;  1KLG D;  3S1N H;  2BOS A;  2SNS A;  2DY8 A;  1CKM A;  4ABN A;  2EY2 A;  1V1O A;  3E6Z X;  3KK7 A;  4JBW A;  1SNC A;  3CC4 A;  3PUV A;  2ASB A;  4RCN A;  2EQS A;  4QCL A;  3QWN A;  1SYG A;  1SXT A;  4ZRZ A;  3A5U A;  5C4X B;  1HNX Q;  4WRD A;  1NNX A;  4GN5 A;  2TSS A;  1SR3 A;  3BYY B;  2UXC L;  4J6H A;  4GKK L;  2A73 B;  5FJ8 H;  3D4D A;  4LF9 L;  1GUS A;  2KHS A;  4C1N I;  4DAY A;  4K5V A;  4NXM L;  3NBH B;  2B2V C;  4A3J G;  1MI2 A;  1NTG A;  4IUV A;  2KEC A;  4GN3 B;  2PZW A;  1VQL A;  5KEE A;  3CCU A;  1U0L A;  1IYV A;  2OEO A;  1PYB A;  2JXM B;  4AYB B;  2IW3 A;  3TP7 A;  3PUW A;  5C4X H;  1RJT A;  4O1N A;  5EPL A;  2LMC B;  2YV5 A;  4OIJ A;  4DV7 Q;  1C9O A;  4DR4 L;  3R93 A;  2BDN A;  2WKD A;  2QEJ C;  2ZJQ A;  1XJV A;  2EYP A;  4ZYS A;  2KED A;  4DV4 L;  2ES2 A;  1WFQ A;  5D3I B;  2JA7 B;  2B2Y C;  5IT9 L;  4IJH A;  1OXT A;  4DR7 Q;  3A54 A;  1YVC A;  2WAQ E;  2KCN A;  3I55 A;  5JVH 3;  2NB0 A;  3PIP A;  1IBL L;  1Y8P B;  1NSN S;  1ZXT A;  4DAY B;  2ID0 A;  4K8J A;  1KLU D;  2MO0 A;  2OQ0 A;  2CWP A;  3OWE B;  1T5X D;  4DUY L;  2ICE C;  2ZXP A;  2B8G A;  2HUG A;  2EYL A;  3F2D A;  3ND8 A;  3A74 A;  4LUZ A;  1UE5 A;  1X55 A;  3M9B A;  2G9D A;  3IFD A;  4E6I A;  4JOI C;  5NUC A;  1N36 Q;  4R4I A;  3HOY G;  1PZI D;  1D1K A;  3TQY A;  1SJH D;  1N9W A;  3C2P A;  1G2T A;  4DXF A;  5AFW A;  4GN4 B;  1JWS D;  1BBX C;  5M5X B;  1K3R A;  2EJF C;  3JC6 6;  5CV5 A;  2CFM A;  2F4V Q;  5LMU L;  2E5L Q;  1QOH A;  2EYJ A;  1FR3 A;  1HUM A;  3TP6 A;  4KTA A;  3VYS A;  2F0O A;  4DAP A;  1LTB D;  1XMQ Q;  1XPR A;  1XTD A;  2K14 A;  3MXG A;  4A3C H;  2Q2H A;  4M1U B;  4K5W A;  1ZYR C;  1YJN A;  2P5Z X;  5IT9 c;  1LT4 D;  3E0J A;  1HZB A;  1SND A;  4A3G B;  1B44 D;  1JB3 A;  3VYR A;  1BCP C;  3NQT A;  2JP1 A;  1S5E D;  1KAW A;  3D6W A;  2RA4 A;  3FMC A;  4FNF A;  2IJ0 A;  1XWE A;  2XGT A;  4K0K Q;  1E2W A;  4CHT B;  3TBI B;  1RHP A;  4G7H C;  3CCR A;  1OXS C;  4IPC A;  1G51 A;  1TWF B;  5FK9 C;  4IPG A;  4X3K A;  3DMU A;  3S2D B;  1VQA A;  4DR2 Q;  4XQQ A;  1UNS A;  4A3G H;  3FP9 A;  2UXD L;  2RDG A;  2ZM6 Q;  4B3T L;  1HNW L;  4A75 A;  4MN3 A;  3CP0 A;  1X3E A;  5JAV A;  1G6Z A;  5I2Y A;  1BOS A;  3KLS X;  3J80 L;  2OTJ A;  4ILW A;  4OEM B;  4YHH Q;  3I72 A;  2YTV A;  3V96 A;  1TWF H;  3K80 C;  4QF4 A;  3S2D H;  2FFK B;  1WTW A;  5COR A;  1HPC A;  4JK1 C;  1XXG A;  3P1H A;  1SSO A;  4KY7 A;  3KDF A;  5IP7 G;  3DWA A;  3MAQ A;  4AH6 A;  1N33 Q;  2Q2I A;  3F1Z A;  2F4I A;  5C5M A;  1PA6 A;  2NVY B;  2HD3 A;  2OCE A;  2QGQ A;  1VQ6 A;  4QUC A;  4C3J G;  2ZXR A;  5IP9 G;  3A8I E;  1STH A;  3NK9 A;  3PF4 A;  3CME A;  4V19 0;  1SBB B;  5BR8 Q;  2XTI A;  4BS9 A;  4M8A A;  1KNA A;  1EYD A;  1DZ1 A;  3D8G A;  3F2C A;  3BZD B;  4XYO A;  4RHS A;  1LTG D;  4HMJ A;  1SMX A;  1VQ4 A;  1EYG A;  3E9H A;  5EPJ A;  2L11 A;  2PZT A;  3P75 A;  2MHV A;  2L4N A;  3E0E A;  1RL2 A;  3MTS A;  5D3D A;  1YJ9 A;  1JT8 A;  2RSO A;  2WB1 G;  4QY7 A;  1A2U A;  3Q24 A;  3E9I A;  2GN5 A;  1EY5 A;  2K5H A;  2R7D A;  2J4X A;  2IT1 A;  5CBE E;  3KDF B;  4DV7 L;  4BA2 I;  4IFD H;  1F2L A;  3F2U A;  3JAM E;  2AWN A;  3J80 c;  3O13 A;  3KYH C;  4DU9 A;  3DXJ C;  3LWE A;  1TVX A;  3K6O A;  1VQE A;  3A5Z B;  4YIJ A;  1GO3 E;  3DWP A;  3LX0 A;  4CJ2 C;  4DR7 L;  2XRQ D;  3ER0 A;  1XMO L;  1CM9 A;  1TT2 A;  3VR6 A;  3F8T A;  2LXK A;  2NTT A;  2YTY A;  1U4P A;  2F0Q A;  2B63 G;  3QO2 A;  1TII D;  3M4O B;  4BBR G;  2EDG A;  4R9W A;  4CGY B;  1HH2 P;  3STB D;  3CCE A;  2K4K A;  5IP9 H;  1C4Q A;  4O42 A;  1EIG A;  1UE7 A;  2G5D A;  4DA2 A;  4G7O C;  4NMZ A;  1EYC A;  1I3Q B;  4DV0 Q;  1XYI A;  4LF7 L;  2WB1 B;  4FDB A;  1U9R A;  2LY7 A;  4R1J A;  3GTM H;  2A68 D;  4JI7 Q;  4LFA Q;  1K3B C;  1RTN A;  2J7Z A;  1IYU A;  1IXR A;  3M4O H;  2VXW A;  2ZT9 C;  1DON A;  1X3P A;  1MJE A;  3ICE A;  1O7Z A;  1A63 A;  4XTC S;  2ALY B;  4NW2 A;  1I3Q H;  4ME3 A;  4CDC C;  2RKS A;  1KNE A;  1QJO A;  2NUC A;  4IUU A;  1JJC B;  1SNQ A;  4CBV A;  3GTQ H;  2F4V L;  2E5L L;  1G29 1;  3QOL A;  3H15 A;  1HNZ Q;  2B63 B;  2F3V A;  1B8A A;  4RWS C;  3I56 A;  1XMQ L;  3CU7 A;  3PF5 A;  3LNN A;  4H0L C;  3EIV A;  5JJI A;  2CW0 C;  3I90 A;  3K7A H;  1Q46 A;  4X3S A;  1ASZ A;  2FJ2 A;  5C4Z A;  4WJW A;  2QW7 A;  2ICI A;  2RHS B;  3PIO 3;  3MXU A;  2JJQ A;  3NP8 A;  3TN2 A;  1BQQ T;  2O2L D;  4K0K L;  2F0J A;  1QUQ A;  2B63 H;  2E2I B;  3Q6S A;  5EAY A;  4BBR H;  4FF1 A;  2I46 A;  5J39 A;  4DK3 C;  2IHF A;  2C35 B;  1K28 A;  3S1M B;  4DR2 L;  4BXX G;  2D2C C;  2ZM6 L;  4A3I G;  1DD2 A;  3I4N G;  1J8I A;  1YNN D;  4FVM A;  1CHQ D;  1K8G A;  3SVM A;  4JI1 Q;  3M85 A;  3E3X A;  4QMG A;  3A8K E;  3T56 B;  4POF A;  2M00 A;  4YHH L;  3FPU B;  2E2I H;  2UU9 Q;  5ELF A;  1UUP A;  1I4R A;  1K8A C;  1HZA A;  4HMI A;  4KN7 C;  4HIO A;  5AJ3 L;  5M5W H;  2IL8 A;  3PQI A;  3M3Y B;  2KUM A;  1N33 L;  4APV A;  1Q8K A;  3I7F A;  5C3E G;  2LS0 1;  2F0S A;  3N52 A;  1C48 A;  3VR2 A;  3EA6 A;  3DEO A;  1YZ6 A;  1M4V A;  1QUQ B;  3ONA B;  5DM7 3;  1TY0 A;  4P72 A;  3U50 C;  5BR8 L;  2R7Z G;  2K5N A;  2JA6 G;  5CV7 A;  4ZCK A;  3M7G A;  3U9S A;  2NYZ D;  3M3Y H;  4A93 G;  3VR4 A;  4XDX A;  3HKZ B;  1R4Q B;  1N8R C;  5D65 A;  5CYU A;  3NTK A;  2JEB I;  4WOR A;  4DN4 M;  4A3F B;  1IHZ A;  1SMY D;  1Z9F A;  1EUJ A;  3J81 E;  3I3C A;  3PGZ A;  1BDO A;  1GUG A;  4G4K A;  1NCV A;  5IGB A;  1LV9 A;  2D0O A;  2WFW A;  3WWV A;  1JMC A;  4BXX H;  4IZ8 A;  2K75 A;  3VA7 A;  1STN A;  4A3I H;  4NP5 A;  2RQX A;  2VQE Q;  4KHV A;  4A3F H;  4LJZ C;  5CV9 A;  1CTM A;  4B9W A;  4FXD A;  1IKM A;  2PNR C;  1YJW A;  4P75 A;  2Q8R E;  2JA5 G;  2EIF A;  1JJG A;  3NHH A;  2FXQ A;  2JA6 B;  1L0X B;  1HFN A;  1QVF A;  5EBC A;  4X66 Q;  2JQO A;  4A93 B;  2DY7 A;  1YIJ A;  2R93 G;  1KRS A;  1I94 Q;  5EJW A;  2DJG C;  4ULL A;  5C3X A;  5IGD A;  4YY3 Q;  4A3M B;  1W6J A;  1H9R A;  3CAM A;  4DV0 L;  5HGT A;  3MXP A;  5J22 A;  2R7Z H;  1LUZ A;  2JA6 H;  5KNB A;  4JI7 L;  1K83 B;  5J1Z A;  4LFA L;  4GLA C;  4A93 H;  4LUV A;  3EBE A;  3T4A C;  5GAH C;  2K50 A;  4L5Q A;  1Y1W B;  2K5Q A;  3MZ5 A;  4A3M H;  1CKN A;  1HCZ A;  5EGT A;  2KJX A;  1HHV A;  3ZJY C;  1IBL Q;  1PH3 A;  3MC0 B;  4DV5 L;  3RZD B;  3NBI A;  2IWH A;  3SK5 A;  1KDA A;  2JA5 B;  4EGV A;  1XNR L;  1SE8 A;  3DLL A;  1K83 H;  3RN5 A;  4K2L A;  4A3K B;  1LTS D;  1F9R A;  2N8N A;  4X65 Q;  1AZP A;  3QIA A;  1HNZ L;  1Y1W H;  4A3L G;  2E8G A;  3RLO A;  2RHQ B;  4LMQ D;  1X3Q A;  1VQJ A;  2UUA L;  5C0X I;  3H0G G;  4EVO A;  3RZD H;  1G91 A;  2BCO A;  5KYI A;  2KCT A;  3MVV A;  4K14 A;  1TQO A;  2BE5 C;  2JA5 H;  1SRU A;  4X6A H;  2D0P A;  1BBU A;  1S5F D;  3PMF A;  1FVI A;  1DOK A;  1PRT D;  3TP5 A;  1TR5 A;  4A3K H;  5ELB A;  1IBK L;  2B8F A;  1Q82 C;  2SNM A;  2CCZ A;  1VQB A;  1BUV T;  1B70 B;  2A6H D;  4ODG A;  1PTO B;  2F0P A;  2KHI A;  4BY1 B;  2VUM G;  1CKN B;  1DXM A;  2Z4H A;  1VF5 C;  2EE1 A;  2JYO A;  3SEB A;  2E74 C;  3HRZ C;  1V1Q A;  4DK0 A;  1SYD A;  1TWC B;  5DLQ E;  4JI1 L;  3ERS X;  4JBJ A;  2UU9 L;  3ITP A;  1WTX A;  4U68 A;  1I4Q A;  4R8N A;  4LF4 Q;  2PCF B;  4CKB A;  4BY1 H;  4FF2 A;  2N55 A;  4ZLT F;  3H0G B;  2XWJ B;  4P71 A;  1AP0 A;  4MZ9 A;  4PG3 A;  1ENC A;  1Y14 B;  1TWC H;  3CC2 A;  1NJI C;  3OYY A;  1I6H B;  2A8V A;  5JOB A;  4WFN 3;  2UXD Q;  1HNW Q;  2NVT B;  4JI3 L;  4KK7 A;  4UP9 A;  2QA4 A;  4A3L H;  4EQP A;  4IO9 A;  4HN7 A;  2Z4I A;  2A74 C;  1G6P A;  3FKI G;  2IX1 A;  2LKV A;  1PFB A;  3H0G H;  3HKZ E;  4A3B G;  5LHY 1;  5KYL A;  5IYD H;  5IYC G;  4HED A;  4K8I A;  5JEA J;  4JG2 A;  3GV6 A;  1HTP A;  3SGI A;  1STB A;  2Z0S A;  3QR8 A;  4GOP C;  1QIL A;  1I6H H;  1XPO A;  1PRT B;  4LF5 Q;  1U4M A;  1JOO A;  3OTO Q;  2NVT H;  1PTO F;  5BN5 A;  1N32 L;  4YCW A;  2DJF C;  1FNV A;  3BU2 A;  1I4P A;  3D0F A;  3FHW A;  3IFT A;  2MQH A;  2ZJP A;  3HOU B;  4I7Z C;  2AUJ D;  1VQ9 A;  4RGM A;  4HCS A;  1EIY B;  5FLM G;  5G3L D;  1SE2 A;  1E22 A;  1EY0 A;  2F03 A;  1L2F A;  3NEM A;  3HG9 A;  4KV6 A;  2NVX B;  1IZ6 A;  3P7J A;  4PZ6 A;  2VQE L;  2F0L A;  2WIN B;  1LTT D;  3UDI A;  1ESR A;  2FMM A;  3CCS A;  1HR0 W;  2CWA A;  5M9O A;  1KHI A;  1NAP A;  4CKE A;  2BA0 A;  5I9O A;  1JOR A;  1JIC A;  1AEX A;  3OMC A;  3S16 B;  4I65 A;  3HOU H;  2JSO A;  2KEE A;  4X66 L;  1P16 A;  5IT9 E;  1HUN A;  1B3A A;  4O0A A;  3DM3 A;  2H5X A;  1I94 L;  2NVX H;  4OWW B;  1X3G A;  4JI2 Q;  2RCN A;  2Z6K A;  2JEA I;  1Q90 A;  1B3Q A;  4YY3 L;  3NEL A;  1GD7 A;  3G71 A;  1A0I A;  3TS0 A;  3HGB A;  3S16 H;  2H4O A;  2A69 D;  2QDL A;  2DN8 A;  3BYT B;  5IYB H;  1WTR A;  3HOV G;  2UUB Q;  2JA9 A;  4DGZ A;  5M5Y B;  1LT6 D;  3K57 A;  1HZ9 A;  5IYC H;  1CZW A;  3RMH A;  2F0D A;  3DM1 A;  4OIK A;  3RZO B;  2G9H D;  3Q22 A;  1XMO Q;  1B50 A;  1WTP A;  3L9A X;  4GZY C;  3DHQ A;  2FIN B;  1M90 C;  3BVG A;  4JI0 Q;  3H3V C;  4UDU C;  1SNP A;  5M3M G;  4JYA Q;  3VR3 A;  1RIP A;  3VYT A;  4A3J B;  4CKC A;  4HJ5 A;  1X32 A;  4HTH A;  3PIP 3;  3KLS A;  2NTS A;  4J1M A;  5C3W A;  5M5Y H;  1IW7 D;  5FLM H;  3AU7 A;  1C7Y A;  5E4X A;  1YEZ A;  1VCI A;  1WJJ A;  1GUO A;  4X65 L;  1QE6 A;  3AFQ A;  4R4C A;  3RZO H;  2Q8T A;  4LWC A;  4LF7 Q;  1PLF A;  4OGQ C;  3SK8 A;  1MKH A;  5CBA E;  4HJ8 A;  3TSS A;  5K5P A;  1DJR D;  4IUR A;  1B1Z A;  3S15 B;  1D7Q A;  2B2T A;  4A3J H;  1EY8 A;  3KBG A;  3HOV B;  4XIG S;  1CSQ A;  4CDE C;  2EYH A;  1F2Y A;  2QKI C;  1FGB D;  2HDL A;  3RR5 A;  3AFP A;  3OHX C;  4DUZ L;  1PH9 A;  1K8O A;  1EYA A;  2GVA A;  3LWU A;  4N8X 1;  4U67 3;  3S15 H;  1GJX A;  5FLX L;  4GNX C;  3W1G A;  1WCM G;  3FPP A;  5J3B A;  5M3M B;  5LMN Q;  4FP5 D;  5BN3 A;  1STG A;  3HOV H;  1PH5 A;  3NWT A;  1EL0 A;  1JWM D;  3MXN A;  2N49 A;  4FXG C;  4HR7 B;  1Y69 U;  1II3 A;  1TWG B;  1OTC A;  4LF4 L;  1CSP A;  4DNT B;  3J80 E;  4N9T A;  3SK4 A;  2V4D A;  2KEN A;  1QB5 D;  4B3S Q;  3HOY B;  4P73 A;  3BDC A;  5M3M H;  2X6G A;  3H6M A;  3KF6 A;  4C56 C;  4V0B A;  3J81 i;  2NN6 I;  4F7X A;  4C3H B;  1UE1 A;  1Z7T A;  4KMU C;  4LFB Q;  1TWG H;  1FNW A;  4LF8 L;  5FOB B;  1Q1B A;  2NBF A;  3SHL A;  2R3Z A;  1Q12 A;  1QVC A;  5E1F A;  3S9W A;  2Y0S G;  3HOY H;  4KY5 A;  1TXY A;  2Q2U A;  1QZH A;  1QWY A;  2HCC A;  5AJ3 Q;  1A62 A;  2WII B;  3MXN B;  5CV6 A;  4LF5 L;  3K5N A;  3OTO L;  3PO3 G;  4KD3 A;  1VQH A;  3NTH A;  2JK8 A;  2EY5 A;  3ULP A;  1SRO A;  5FLX c;  4KKT A;  3MEF A;  3J7A V;  3NSW A;  3RLF A;  2PI2 E;  4TKO B;  3TS2 A;  3T1H Q;  3KF6 B;  1YHA A;  2CQA A;  1AE3 A;  2AUK A;  1B9N A;  2L15 A;  2PW5 A;  4UAI A;  3N6R A;  1YNJ C;  1SEB D;  1Z6H A;  1EWI A;  4AYB E;  2M9V A;  1GXD C;  4F8M A;  1E2V A;  4JCV E;  1FJG L;  1JOK A;  2B39 A;  5I6W A;  4RMF A;  1KAB A;  1E1T A;  1UAP A;  2A6E C;  4IPH A;  1QVG A;  1IBM Q;  1HA6 A;  2D62 A;  4JI2 L;  4ZUI A;  3KUP A;  4JI4 L;  2UXB Q;  4HJ7 A;  1ML0 D;  1Q7Y C;  2KBN A;  1GM5 A;  3PO3 B;  1RKN A;  2X69 A;  5GQO A;  1YI2 A;  3I4L A;  1EY6 A;  3K59 A;  1MIU A;  1A15 A;  2GA4 B;  5C6A A;  2AQ2 B;  4UHV A;  2K28 A;  2UUB L;  1RTO A;  1WD0 A;  4C3J B;  1V9P A;  1ZYR D;  4PQX A;  3UE1 A;  1STY A;  4RA8 A;  1BCP D;  1EU4 A;  2JE6 I;  4QIW B;  4XYQ A;  1SAP A;  1EU3 A;  3GTM B;  5IP7 H;  2BDO A;  3PO3 H;  2I0Q A;  1A3T A;  4JI0 L;  4JVZ A;  3GO5 A;  2WKC A;  3B6Y A;  3IAY A;  1EFW A;  1S5C D;  4JYA L;  2N78 A;  3BDL A;  2HIV A;  4NPS A;  1I4G A;  1JCK B;  2ZTC A;  1K9M C;  4P74 A;  2Q8I B;  1H9J A;  1ZKO A;  4C3J H;  1YIT A;  1VQ7 A;  3FEW X;  4A3E G;  2ENB A;  1RF2 D;  2Z6B A;  1BXT A;  1PH6 A;  3PUX A;  2B3G A;  4IUN A;  2ZXO A;  3GTQ B;  5LL6 X;  4I7A A;  2HIX A;  4N8F A;  1F2Z A;  1CZG A;  1E3P A;  4DFA A;  3T16 A;  1R4P B;  1S5D D;  3U9O A;  5JPN C;  4DR3 Q;  4B3R L;  4PMW A;  1Q3L A;  1ET6 A;  4X62 Q;  3K7A B;  2O4X A;  4KI0 A;  3MFY A;  3GD7 A;  1D5Z C;  4DV5 Q;  1LLR D;  2EYO A;  4H7B A;  1MJC A;  3NUC A;  4B3M L;  1RDP D;  4B9X A;  1XNR Q;  4DR6 L;  1KQS A;  1W3S A;  4MTK A;  4DR1 Q;  1ILP A;  1K0R A;  1QZG A;  2YYZ A;  3GTJ B;  1CFM A;  5LMN L;  4PZ8 A;  4DXG A;  4BBR B;  2UUA Q;  1NUC A;  5KRU A;  1GHJ A;  3TZD A;  5C0X J;  3A8J E;  2IY5 B;  2EY1 A;  1SYC A;  4A3E B;  2B2U A;  2LXJ A;  1BF4 A;  1VQO A;  3A55 A;  3G48 A;  4B3S L;  1IBK Q;  4B08 A;  3GTJ H;  2L12 A;  1D5M C;  3ULL A;  2VQF Q;  4KLK A;  3PV0 A;  3KJP A;  3A56 A;  5M5W B;  2F0V A;  1VMP A;  3S1Q B;  4LFB L;  4A3E H;  3PSI A;  3C46 A;  1JQY D;  1VQ8 A;  1IYJ B;  3D31 A;  5KIX A;  4Y52 H;  1I4X A;  3CF5 A;  5I2X A;  1VQC A;  2I5M X;  1EWH A;  1FD7 D;  1RCV D;  4X3U A;  5DM6 3;  3H09 A;  3L0O A;  2K01 A;  1SJE D;  3NTI A;  1AFP A;  3J7Z C;  1PTO C;  4JI8 Q;  3TZU A;  3R2T A;  4PV1 C;  3L3O C;  1ZEQ X;  2F0E A;  2L5T A;  1NMG A;  3S1Q H;  4NXN Q;  3BVM A;  4K6D A;  1AH9 A;  1DM0 B;  1B7Y B;  2B2W A;  4BWG B;  1B9M A;  1KRT A;  3MHB A;  3K0Y A;  3V2T A;  3HFZ B;  2R92 G;  3NQI A;  1WOC A;  4RG1 A;  3K81 C;  3G7L A;  4DNI A;  1A3V A;  4JI3 Q;  1S4Z A;  3T1H L;  1BO0 A;  1TWA H;  3J7Y W;  3I4M G;  2I5H A;  1TS2 A;  3H94 A;  1G8Z D;  3IL8 A;  2D5D A;  1JOQ A;  1L0Y B;  1X56 A;  3BG3 A;  1BNZ A;  1D6E C;  3K5O A;  4A3I B;  3I4N B;  1CK1 A;  3M4Q A;  4PZ7 A;  4IUP A;  5IIF A;  4YCU A;  1EY7 A;  3F2B A;  2EY6 A;  3GTK B;  3PUY A;  1N32 Q;  3TEH B;  4DK1 A;  5HY6 A;  3PO2 G;  1WD1 A;  5EPK A;  1IBM L;  3HZX A;  2ATW A;  3HOW G;  2BH8 A;  2UXB L;  5JJZ A;  2F1M A;  4IFD I;  4RH6 A;  1KD1 C;  1S72 A;  3I4N H;  2I07 B;  4G57 A;  1Q81 C;  2F0H A;  1SFO B;  1PRT C;  5C3E B;  2XVS A;  1LO5 D;  3GTK H;  3VDY A;  2CW0 D;  4N9P A;  1ROD A;  2R92 B;  3VA5 A;  3CKI B;  3EJI A;  1SYF A;  4QIW E;  5GAE C;  1Z47 A;  2R7Z B;  4QQB X;  3T1Y Q;  1KTK A;  1EIF A;  1PFN A;  1CT1 D;  2RSN A;  1BBW A;  4KKS A;  3EVQ A;  1JE5 A;  3I8Z A;  3H3V I;  3GV3 A;  3M4P A;  1S3O A;  4BBS G;  5K36 G;  1EQT A;  4QL5 A;  1SFO H;  3HS0 C;  1FL0 A;  5C3E H;  4UPA A;  2F0W A;  2WAQ G;  3HEJ A;  2R92 H;  2F0I A;  5F2D A;  2WB1 E;  2OQK A;  3M7N A;  2QF7 A;  2B29 A;  3ZYY X;  1N34 Q;  2MUY A;  5ELO A;  1HQR D;  5C4H A;  3GQB A;  3TP8 A;  5I6Y A;  2CH4 W;  3URY A;  2AQ3 B;  3C1E A;  2XWB B;  1EOT A;  1F2M A;  1PMR A;  1A8V A;  3EFX D;  4DR3 L;  3J80 i;  3OWF A;  4C3I G;  1QNK A;  4X62 L;  5CR3 A;  2DGY A;  1AE2 A;  3SK6 A;  3CQZ B;  2HDM A;  5FKA C;  3I70 A;  4LAA A;  5KNC A;  2KA7 A;  5KGU A;  1ILQ A;  4JPB W;  3EN2 A;  4DR1 L;  1SNO A;  1D5X C;  1MBY A;  1C0A A;  2R93 B;  4C1N K;  4BBS B;  4OO1 I;  3I4O A;  3X3N A;  2RBM A;  4PMB A;  1KAA A;  3DEP A;  4L6T B;  2YTX A;  3CQZ H;  2XSC A;  5A2Q L;  1PFS A;  5CC4 A;  1SLJ A;  2KCC A;  4CDF C;  1JC7 A;  2AQ1 B;  4FYD A;  5EQ0 A;  3ULJ A;  1E24 A;  4DPG A;  5ISR A;  3ERQ A;  2NN6 G;  4MIU A;  4POG A;  2R93 H;  1QG7 A;  2QCP X;  5EBD A;  3HOX G;  5COY A;  4DUZ Q;  4X64 Q;  4BBS H;  5K36 H;  1AW7 A;  2Z6K C;  3BJU A;  4OON A;  3C1F A;  1VMC A;  1D8L A;  4RAU C;  4GKJ L;  2VQF L;  4C3I B;  5JEA G;  2PQA A;  5FO8 B;  4HJA A;  3P20 A;  1D1I A;  1XNQ Q;  1OXU A;  2AMC B;  1XTC D;  1W6K A;  5C44 G;  4DR5 Q;  3OIP A;  2MP1 A;  1PV4 A;  1PVO A;  3V05 A;  5GAG C;  2HQL A;  1E0B A;  3G6J B;  1HZC A;  1TY2 A;  3S14 B;  2ZTD A;  4JI8 L;  1EY9 A;  4C3I H;  4K2K A;  3S1R H;  4NXN L;  3OOC A;  1EZ8 A;  3TDQ A;  1T9H A;  2MPM A;  3J7A 5;  2EOT A;  2FMC A;  4L5T A;  5FJ8 G;  3W3A A;  3HOX B;  1AN8 A;  1L1O A;  4LF8 Q;  1LTR D;  5GAD C;  3S14 H;  2OXP A;  5M3F G;  3SDZ A;  4IQZ A;  3JAM i;  2VUM B;  2KHJ A;  2PQA B;  2B2T C;  4KJN A;  3KFU A;  1J6Q A;  2K6A A;  4KHZ A;  3UI2 A;  1ICF B;  1LTI D;  4Y7N B;  3K5M A;  1V43 A;  3S2H H;  3W1B A;  2SOB A;  4EX5 A;  3HOX H;  3T51 B;  3OPO A;  2HT1 A;  1PHJ A;  2AHO B;  4HCE A;  3BVZ A;  1DYQ A;  5IGF A;  2IX3 A;  3OIQ A;  2RDF A;  2VUM H;  5JEA H;  1NMF A;  5D14 A;  4CDD C;  4RHR A;  2KQ3 A;  1UE6 A;  4Y7N H;  1HTL D;  3D4R A;  1TKW B;  3CXC A;  1PZJ D;  3CCQ A;  4KY6 A;  3PUZ A;  1ENF A;  1IL2 A;  1L1O B;  1X65 A;  1ENA A;  2BE5 D;  3KJO A;  5M3F B;  4EQN A;  3T1Y L;  3FKI B;  1A2T A;  2XIW A;  2A19 A;  1FJG Q;  4A3B B;  4OX9 L;  2JA7 G;  1HQM C;  1HFG A;  1STE A;  4ZQ3 A;  1B4O A;  4GS3 A;  4BA1 I;  2GVB A;  2QEX A;  4JI4 Q;  4KHP L;  3A7A B;  5ELE A;  4IOA A;  5CGK A;  1O80 A;  4JV5 Q;  3GTP B;  1PYW D;  1V8Q A;  4H13 C;  1VQF A;  2K33 A;  5IGG A;  1N34 L;  5M3F H;  3IKJ A;  2R6G A;  2OT2 A;  3FKI H;  4FO2 A;  4Q5V A;  4A3B H;  2DUD A;  4H44 C;  4KD4 A;  5DNF A;  4EQ5 A;  1PRT F;  2EJM A;  2VL6 A;  4RFB A;  1CQF A;  1PH7 A;  1YBY A;  2IX0 A;  4TRD A;  4R4O A;  3GTP H;  2F3W A;  2YU9 B;  4LF6 Q;  1Y8O B;  4IUQ A;  1E2Z A;  2PW7 A;  3D3R A;  2N88 A;  3AYH B;  4A3C G;  2ZTE A;  3T53 B;  1I4H A;  3UDG A;  1A6X A;  4NB3 A;  1H9M A;  3L7Z C;  5EKL A;  4FF4 A;  3CCL A;  4RKB A;  5FLX E;  1ET9 A;  3OSO A;  1HXY D;  4DK6 C;  5DAU A;  3NPP A;  2YU9 H;  1FGU A;  1EQQ A;  5T1I A;  2C5C A;  2XRS D;  4DF7 A;  2K03 A;  4XXE A;  1X3F A;  3UE0 A;  4B3R Q;  1LM0 A;  3J7A F;  5A35 A;  1CQV A;  2XN9 C;  2JA7 H;  4A3G G;  1GKH A;  3OMG A;  2KVM A;  4ME5 A;  3KBX A;  4X64 L;  1UEB A;  4B3M Q;  4IOC A;  4DR6 Q;  3GDE A;  3SXH A;  2MNA A;  1M1K C;  2A1A A;  2CKZ B;  4QGU A;  2D9U A;  3MEH A;  4WJ4 A;  4HIK A;  1XNQ L;  4MNO A;  4LW1 A;  4DR5 L;  1LAB A;  3S24 A;  2K5D A;  4GOP A;  4K5X A;  1OXX K;  2L1B A;  4FF3 A;  1EY4 A;  2VY3 A;  3C3L A;  2VS1 A;  3L2P A;  4HSV A;  1XX8 A;  1EZ6 A;  5C4J B;  4H02 A;  1J5E Q;  5G3L F;  4R8I A;  2F0N A;  4GLV B;  2PMZ B;  5LL6 S;  4LFC Q;  2HCI A;  2IPK D;  3WDN A;  5M5X H;  4PMC A;  1X9N A;  2F52 A;  4DKA C;  4HID A;  1WTO A;  3Q0A A;  1M8A A;  1H95 A;  2B2V A;  1SNM A;  2CHB D;  2IHE A;  3EQL C;  4Z9C B;  4L5S A;  2MO1 A;  1LT5 D;  4IAL A;  1DGS A;  2A5H A;  5C4J H;  1WCM B;  2HQE A;  4QJF A;  4A4I A;  3SE0 A;  3STB C;  3G4S A;  5C5L A;  1VQP A;  1Y8N B;  4C2M B;  3CW2 C;  3M4Y A;  4AQY Q;  4GOP B;  3LGJ A;  2E2J B;  4WJ3 M;  1VQ5 A;  4DV1 L;  1LAC A;  4IFD G;  2VB2 X;  3QOJ A;  3BS1 A;  1HR0 Q;  1NE3 A;  1R9T B;  2DNC A;  1ASY A;  3J81 j;  1K8M A;  1STA A;  2A68 C;  3GTL B;  2V1C C;  3U4V A;  1V1P A;  4MHE A;  3I2Z A;  2O5J C;  1KXL A;  2K5W A;  1GOZ A;  1WCM H;  2EXZ A;  3ERO A;  2I5L X;  2B2Y A;  5IOC A;  4C2M H;  2E2J H;  5TSS A;  2FHT A;  3WOF A;  4ALP A;  2B2U C;  1R9T H;  3MFG A;  5H1S E;  1Q86 C;  1X54 A;  3BZK A;  5I4D A;  1YNX A;  3CCM A;  3GTL H;  4ZK9 B;  3I91 A;  1QCB D;  3CRL C;  3NEN A;  1LTA D;  2K52 A;  2Y0S B;  4YCV A;  2MFI A;  2F0K A;  4JI5 Q;  1HNX L;  2NZ1 D;  3AQQ A;  1Q1E A;  4JOI A;  4ZAI A;  1F9S A;  4JV5 L;  2NVY H;  4IFD J;  2KOL A;  4ID6 A;  1H9S A;  1F9P A;  1V1P B;  4DAM A;  4ZKC B;  3W2D A;  4MTN A;  4HJ9 A;  3RNU A;  5ELC A;  4L8J A;  1PDQ A;  3BDO A;  3CCJ A;  4PNY A;  1KC8 C;  1SE4 A;  1S40 A;  2JA8 G;  4EQO A;  2LFN A;  3K58 A;  4J15 A;  3TRE A;  1YNN C;  4LF6 L;  4GNX A;  2B2W C;  1ONL A;  4YWL A;  3CRK C;  4OO1 G;  4OHJ A;  4JI6 Q;  1TS3 A;  2KCM A;  2XNA C;  1CA6 A;  4K6L A;  1WI5 A;  5C0X G;  3GTG B;  1T5E A;  2F0G A;  3AEV A;  4JBM A;  2F3I A;  3PCO B;  1VQI A;  2F0U A;  1O7I A;  2K32 A;  1GUN A;  1JB7 A;  1YHB A;  3H3V H;  2L9H A;  2AWO A;  4R4Q A;  3KLW A;  1LT3 D;  2NVQ B;  3I73 A;  3HKS A;  1PH8 A;  4L5R C;  1H9S B;  2NWG A;  1HJP A;  2PO4 A;  3JAM L;  3NWS A;  3GTG H;  1SYB A;  3D6C A;  1DOL A;  1K0S A;  2OF1 A;  1MSG A;  2VW9 A;  1CI3 M;  3DUZ A;  3ND9 A;  4R4T A;  5IY0 A;  1JE4 A;  2PQE A;  1DOM A;  1N36 L;  2JA8 B;  2UUC Q;  1EEF D;  2M2L A;  1NR2 A;  3VR5 A;  4F88 A;  3T13 A;  2NVQ H;  4GNX B;  4DV3 Q;  4QB4 A;  4IJL A;  4YWK A;  2L55 A;  2E2D C;  5IWA Q;  1SMY C;  2ZJR A;  1I5F A;  3VYU A;  3KLR A;  4OEL B;  4UP8 A;  1PH4 A;  1PYS B;  2CQO A;  1YNJ D;  2Z8L A;  3CHB D;  1BCP B;  3TME A;  2JA8 H;  2K7V A;  4J8Q A;  4HAE A;  1MSH A;  2PMZ E;  3SR1 A;  1J5E L;  3QJY A;  3AB9 A;  4RCO A;  2A6E D;  4TQU S;  3U4Z A;  4OO1 H;  2E2H B;  1Q8I A;  5ELD A;  4LFC L;  4GKJ Q;  4JBK A;  5C0X H;  2EPB A;  2RVL A;  3PIO A;  2PZU A;  4XQJ A;  3D4W A;  1VQM A;  1NY4 A;  1PH2 A;  1EIH A;  1VQN A;  3CPW A;  2LSS A;  4IN3 A;  2R61 A;  1PFM A;  2WAC A;  3U58 A;  1WTQ A;  2HHH Q;  1MGS A;  2EXD A;  3S17 B;  2NZO A;  1L0W A;  3CMA A;  1OXV A;  4A3D G;  5IGC A;  3RUZ A;  2PYK A;  2E2H H;  1TWA B;  4DV6 Q;  3JAM c;  3OW7 A;  3FVQ A;  1U4R A;  5CV8 A;  4AQY L;  1WTH A;  2C9O A;  4UY8 C;  3HKZ G;  1SN8 A;  1HR0 L;  1S5B D;  1WTV A;  1NR4 A;  1KDB A;  3GP7 A;  4A3F G;  1CA5 A;  3S17 H;  4DV2 Q;  1O78 A;  1EEI D;  3QB3 A;  2EJG C;  4XT3 B;  4HIM A;  4IPD A;  4KN4 C;  3RLN A;  1KIX A;  1PXU A;  2VZA A;  1MD2 D;  1RD9 D;  1JJ2 A;  3S1M H;  1H9K A;  1CHP D;  5E7N A;  4GLX A;  5JPM C;  1F9Q A;  1BCP F;  2EYM A;  3BZC A;  1VQD A;  5JJL A;  2QDB A;  3K0X A;  5JJK A;  3MWY W;  2RCF A;  2R7F A;  2E76 C;  4G7Z C;  2F0T A;  2EYF A;  2Y0S E;  2K5V A;  4L63 B;  2VB3 X;  1HRJ A;  5EKI A;  2N3S A;  5T1G A;  2BH2 A;  5CV4 A;  1SE3 A;  1CKO A;  4ZKB B;  4A3D B;  4OL7 A;  4JI5 L;  2K1B A;  3TRZ A;  3Q8D A;  3G6E A;  2EZV A;  1WYD A;  5IE8 A;  4HSP A;  1YHQ A;  5FO7 B;  5JVG 3;  4KJO A;  1LTL A;  1P8L A;  3UDX A;  2X6L A;  3A7L A;  2MGS A;  2MJ8 A;  4A3M G;  2K04 A;  4Q0F A;  1SYE A;  4RGO S;  2SEB D;  2QIL A;  4UP7 A;  3RN2 A;  1BR9 A;  5IGE A;  4OXP A;  1VDZ A;  3H91 A;  5IOD A;  3CD6 A;  4A3D H;  5HGQ A;  2A6H C;  1LYL A;  1EOV A;  4QUF A;  3I4M B;  1JWU D;  2DNE A;  5E3F A;  1W2B A;  4OX9 Q;  3NE5 B;  2AKW B;  2E75 C;  1GUW A;  1Y1V G;  2F0F A;  1Y1W G;  5I9P A;  3GTO B;  4JI6 L;  2UXC Q;  4GKK Q;  4KHP Q;  2NZH A;  2J0T D;  4LF9 Q;  4CJ1 B;  1L1O C;  3K7U C;  4O2D A;  1GVP A;  4LNQ A;  4NXM Q;  2PNH A;  4X3T A;  3PO2 B;  3J81 L;  1UEA B;  1B2T A;  3I4M H;  1U5K A;  5DEH A;  3QG1 A;  3HOW B;  4A3K G;  1E7Z A;  4P2C B;  2EVB A;  4OWT B;  4ZUJ A;  3CC7 A;  5EKK A;  5KND A;  1PH1 A;  1TS4 A;  2OTL A;  3GTO H;  2L0C A;  1PTO D;  4C3H G;  1ESF A;  1QNU A;  4NKL A;  4AIM A;  5A2Q E;  2RDH A;  3RD4 A;  1D2B A;  3WOE A;  3E5S A;  4DNR B;  4DR4 Q;  3KOJ A;  1PZK D;  3OW2 A;  4YWM A;  2F0M A;  5GRO A;  3K5L A;  1TU2 B;  3PO2 H;  1I50 B;  5BN4 A;  4DV4 Q;  2OWO A;  4KKU A;  3HOW H;  1X6O A;  2UUC L;  1KL9 A;  4OWX B;  5L37 A;  1Y1V B;  2TMP A;  4DV3 L;  1EQR A;  1VF7 A;  5FO9 B;  4BY1 G;  5IWA L;  2WAQ B;  1O7L A;  4CJ0 B;  1I6V C;  1VQG A;  1I50 H;  3NXW A;  1EQV A;  3KF8 A;  1K73 C;  1VQK A;  1FNU A;  1U4L A;  1UWV A;  4DUY Q;  4BY7 G;  3R8B A;  3CPF A;  4A76 A;  1SDF A;  1Y1V H;  3Q23 A;  3FRP B;  3CCV A;  5E4W C;  1BKB A;  4LUO A;  2Z1C A; 
#chains in the Genus database with same CATH homology
 4JCV E;  1FJG L;  1K8A C;  1HZA A;  4RMF A;  5IYD G;  1VS0 A;  1CUK A;  5ELN A;  4HIO A;  1E1T A;  3AYH B;  5AJ3 L;  4A3C G;  3J81 c;  1E1O A;  2ZTE A;  4IPH A;  4TVA B;  5M5W H;  3HOZ G;  1QVG A;  1IBM Q;  2D62 A;  3UDG A;  4JI2 L;  4NB3 A;  1N33 L;  4APV A;  2HHH L;  4JI4 L;  2UXB Q;  4HJ7 A;  1Q8K A;  3I7F A;  4JC0 A;  3L7Z C;  1Q7Y C;  2KBN A;  5C3E G;  1GM5 A;  3CCL A;  5GQO A;  1YI2 A;  4DK6 C;  2YU9 H;  1MIU A;  1FGU A;  1YZ6 A;  4C3H H;  5LMU Q;  1EQQ A;  1QUQ B;  4DV6 L;  2UUB L;  4P72 A;  3U50 C;  1XPU A;  1X3F A;  3UE0 A;  5BR8 L;  2R7Z G;  2K5N A;  2JA6 G;  1V9P A;  2RF4 A;  4B3R Q;  1LM0 A;  3UE1 A;  3KF8 B;  2JA7 H;  3M3Y H;  4A3G G;  4A93 G;  1GKH A;  2JE6 I;  1N8R C;  4X64 L;  1UEB A;  5IP7 H;  2JEB I;  4DV2 L;  4IOC A;  2I0Q A;  4B3M Q;  3A0J A;  4JI0 L;  3GO5 A;  3PO3 H;  3B6Y A;  3GDE A;  4DR6 Q;  2MNA A;  1EFW A;  1M1K C;  2A1A A;  4JYA L;  2CKZ B;  2N78 A;  4QGU A;  1Z9F A;  3HOU G;  2HIV A;  4NPS A;  4WJ4 A;  4HIK A;  1XNQ L;  1EUJ A;  2ZTC A;  3PGZ A;  1K9M C;  4P74 A;  4MNO A;  4C3J H;  4LW1 A;  5LMN W;  1YIT A;  1VQ7 A;  4DR5 L;  2D0O A;  4A3E G;  2WFW A;  3S24 A;  3WWV A;  5C4X G;  4GOP A;  1JMC A;  4BXX H;  2K75 A;  2PI2 A;  1OXX K;  1PH6 A;  3PUX A;  2B3G A;  1BVS A;  4A3I H;  3UDF A;  4BY7 H;  2WP8 J;  3K8A A;  2VQE Q;  2HIX A;  2VY3 A;  3W5O A;  4DV1 Q;  4A3F H;  4B3T Q;  2VS1 A;  1E3P A;  3L2P A;  5IYB G;  4DR3 Q;  4B3R L;  1YJW A;  1TWH H;  4PMW A;  4H02 A;  4P75 A;  4X62 Q;  1J5E Q;  2JA5 G;  2BA1 A;  2EIF A;  1NBW A;  4AYB G;  1JJG A;  4KI0 A;  2FXQ A;  3GD7 A;  4GLV B;  4DV5 Q;  4LFC Q;  1QVF A;  4X66 Q;  3HOZ H;  1MJC A;  4B3M L;  2JQO A;  5M5X H;  5C44 H;  1XNR Q;  4DR6 L;  1X9N A;  2R93 G;  2F52 A;  3IRB A;  4DKA C;  1KRS A;  4HID A;  1YIJ A;  1I94 Q;  2Q2T A;  2VNU D;  1KQS A;  1H95 A;  1W3S A;  3S1N H;  4DR1 Q;  2IHE A;  1K0R A;  1QZG A;  2YYZ A;  4L5S A;  2MO1 A;  4YY3 Q;  1CKM A;  5LMN L;  4PZ8 A;  1DGS A;  5C4J H;  4JBW A;  3CC4 A;  3CAM A;  2UUA Q;  3PUV A;  4DV0 L;  2ASB A;  4QJF A;  4A4I A;  2EQS A;  1LUZ A;  3STB C;  2JA6 H;  2R7Z H;  3G4S A;  5C0X J;  2IY5 B;  1VQP A;  3A5U A;  3CW2 C;  4JI7 L;  4LFA L;  4AQY Q;  4GOP B;  3LGJ A;  1HNX Q;  2LXJ A;  4GLA C;  4A93 H;  4WJ3 M;  1VQ5 A;  4LUV A;  4DV1 L;  1VQO A;  4IFD G;  3EBE A;  1HR0 Q;  3G48 A;  4GN5 A;  5GAH C;  1SR3 A;  1NE3 A;  4B3S L;  4GKK L;  2K50 A;  4L5Q A;  1ASY A;  2UXC L;  5FJ8 H;  4LF9 L;  3J81 j;  1IBK Q;  3GTJ H;  2V1C C;  3NBH B;  3U4V A;  1CKN A;  4A3M H;  4NXM L;  4A3J G;  3ZJY C;  1IBL Q;  1PH3 A;  1NTG A;  3ULL A;  3I2Z A;  4GN3 B;  1KXL A;  4DV5 L;  1VQL A;  1WCM H;  3CCU A;  2VQF Q;  4KLK A;  1U0L A;  2I5L X;  3PV0 A;  3KJP A;  1PYB A;  1XNR L;  1SE8 A;  4C2M H;  3DLL A;  4LFB L;  3PUW A;  4A3E H;  1K83 H;  5C4X H;  3RN5 A;  2E2J H;  3PSI A;  1VQ8 A;  1IYJ B;  3D31 A;  4ALP A;  2N8N A;  4X65 Q;  4Y52 H;  1R9T H;  3CF5 A;  1HNZ L;  5H1S E;  1Q86 C;  1X54 A;  3BZK A;  1Y1W H;  2E8G A;  2YV5 A;  4A3L G;  1VQC A;  1YNX A;  2I5M X;  2RHQ B;  3RLO A;  3CCM A;  4DV7 Q;  3GTL H;  1C9O A;  4DR4 L;  3L0O A;  1VQJ A;  2UUA L;  5C0X I;  3J7Z C;  3NEN A;  3H0G G;  2ZJQ A;  1XJV A;  2K52 A;  4JI8 Q;  3RZD H;  4YCV A;  2KCT A;  4DV4 L;  2MFI A;  2ES2 A;  2JA5 H;  1NMG A;  1SRU A;  1WFQ A;  1HNX L;  4JI5 Q;  3S1Q H;  4NXN Q;  4LF6 Q;  4X6A H;  2D0P A;  1BBU A;  4IJH A;  1FVI A;  3AQQ A;  1OXT A;  4DR7 Q;  1Q1E A;  1YVC A;  2WAQ E;  4A3K H;  4JOI A;  1AH9 A;  1B7Y B;  3I55 A;  1IBK L;  1Q82 C;  4JV5 L;  1KRT A;  3HFZ B;  2NVY H;  4IFD J;  3PIP A;  1IBL L;  2CCZ A;  2R92 G;  1VQB A;  1WOC A;  4RG1 A;  1B70 B;  3K81 C;  4DAY B;  4DNI A;  2ID0 A;  2KHI A;  4JI3 Q;  2VUM G;  1CKN B;  2MO0 A;  3T1H L;  2OQ0 A;  1TWA H;  2CWP A;  4DAM A;  3I4M G;  2I5H A;  4DUY L;  1V1Q A;  4MTN A;  4HJ9 A;  3RNU A;  3F2D A;  1X56 A;  3CCJ A;  1KC8 C;  3A74 A;  5DLQ E;  4LUZ A;  4JI1 L;  1S40 A;  2JA8 G;  3ERS X;  1UE5 A;  1X55 A;  4J15 A;  4JBJ A;  3M9B A;  3M4Q A;  4PZ7 A;  3TRE A;  2UU9 L;  4JOI C;  4GNX A;  4LF6 L;  1N36 Q;  4YCU A;  4R4I A;  4LF4 Q;  3F2B A;  3HOY G;  4YWL A;  4BY1 H;  1N32 Q;  3PUY A;  4OO1 G;  3TEH B;  4JI6 Q;  2KCM A;  5HY6 A;  3PO2 G;  1WI5 A;  3TQY A;  5C0X G;  1IBM L;  1N9W A;  4P71 A;  2ATW A;  4MZ9 A;  4PG3 A;  3HOW G;  3AEV A;  2BH8 A;  2F3I A;  4JBM A;  2UXB L;  3PCO B;  4GN4 B;  4IFD I;  1Y14 B;  1TWC H;  1VQI A;  3CC2 A;  1NJI C;  1KD1 C;  1S72 A;  3I4N H;  3OYY A;  1O7I A;  1Q81 C;  1K3R A;  2A8V A;  3JC6 6;  1JB7 A;  2CFM A;  2F4V Q;  5LMU L;  1YHB A;  2E5L Q;  4JI3 L;  3H3V H;  4UP9 A;  2QA4 A;  4A3L H;  1HNW Q;  2AWO A;  4IO9 A;  4R4Q A;  3KLW A;  3HKS A;  1PH8 A;  3VDY A;  3GTK H;  4L5R C;  1G6P A;  3FKI G;  2IX1 A;  1XMQ Q;  3H0G H;  3HKZ E;  1HJP A;  4A3B G;  4QIW E;  1XPR A;  5GAE C;  3GTG H;  1XTD A;  5IYC G;  5IYD H;  5JEA J;  1Z47 A;  4JG2 A;  2K14 A;  4QQB X;  3SGI A;  3T1Y Q;  4A3C H;  2Q2H A;  2Z0S A;  1EIF A;  1BBW A;  2VW9 A;  1YJN A;  5IT9 c;  1JE5 A;  1HZB A;  4R4T A;  3H3V I;  5IY0 A;  4GOP C;  3M4P A;  1I6H H;  1XPO A;  1N36 L;  1S3O A;  2UUC Q;  4LF5 Q;  4BBS G;  4QL5 A;  1SFO H;  5K36 G;  3OTO Q;  1FL0 A;  2NVT H;  5C3E H;  1N32 L;  4UPA A;  4YCW A;  2WAQ G;  1KAW A;  2NVQ H;  4GNX B;  3D0F A;  3BU2 A;  4DV3 Q;  3FHW A;  2R92 H;  4IJL A;  4YWK A;  2MQH A;  2XGT A;  2ZJP A;  4K0K Q;  2WB1 E;  2OQK A;  5IWA Q;  1VQ9 A;  3M7N A;  1EIY B;  2ZJR A;  1I5F A;  5FLM G;  3CCR A;  1OXS C;  2B29 A;  4IPC A;  1G51 A;  1N34 Q;  1E22 A;  4IPG A;  5ELO A;  4UP8 A;  1PH4 A;  1L2F A;  1PYS B;  3NEM A;  1VQA A;  2CQO A;  4DR2 Q;  1IZ6 A;  2VQE L;  4PZ6 A;  4A3G H;  3FP9 A;  3UDI A;  4B3T L;  2ZM6 Q;  2JA8 H;  1HNW L;  2UXD L;  3CCS A;  4A75 A;  1HR0 W;  3CP0 A;  1X3E A;  1A8V A;  2CWA A;  1KHI A;  4DR3 L;  2BA0 A;  3J80 i;  2PMZ E;  4X62 L;  1J5E L;  2OTJ A;  3HOU H;  4YHH Q;  3U4Z A;  4TQU S;  2YTV A;  2DGY A;  1AE2 A;  4LFC L;  4GKJ Q;  1TWF H;  3K80 C;  1P16 A;  4X66 L;  4JBK A;  3S2D H;  3PIO A;  4O0A A;  3DM3 A;  2H5X A;  1I94 L;  1VQM A;  1NY4 A;  1PH2 A;  2NVX H;  1VQN A;  4OWW B;  1X3G A;  3KDF A;  5IP7 G;  3CPW A;  2LSS A;  4DR1 L;  3EN2 A;  2RCN A;  4JI2 Q;  2Z6K A;  4AH6 A;  2Q2I A;  1N33 Q;  3F1Z A;  3U58 A;  2JEA I;  2HHH Q;  1C0A A;  4YY3 L;  1PA6 A;  2EXD A;  2NZO A;  3NEL A;  1L0W A;  1GD7 A;  3G71 A;  3CMA A;  4OO1 I;  1A0I A;  2OCE A;  3I4O A;  1OXV A;  2QGQ A;  3TS0 A;  3S16 H;  1VQ6 A;  4A3D G;  5IYB H;  2E2H H;  5IP9 G;  3HOV G;  2YTX A;  3CQZ H;  4DV6 Q;  2UUB Q;  2JA9 A;  1PFS A;  3JAM c;  3CME A;  3PF4 A;  1HZ9 A;  1SLJ A;  4AQY L;  5BR8 Q;  5IYC H;  4UY8 C;  3HKZ G;  2XTI A;  1SN8 A;  1HR0 L;  3ULJ A;  1E24 A;  4DPG A;  2NN6 G;  1XMO Q;  4POG A;  2R93 H;  3HOX G;  4A3F G;  3F2C A;  4DUZ Q;  4X64 Q;  3S17 H;  4BBS H;  1VQ4 A;  1EYG A;  1SMX A;  2Z6K C;  4DV2 Q;  3BJU A;  1M90 C;  4OON A;  4JI0 Q;  3E9H A;  1D8L A;  4GKJ L;  5M3M G;  2VQF L;  4JYA Q;  4HIM A;  4IPD A;  1RIP A;  2PQA A;  3RLN A;  5JEA G;  4HJA A;  4HJ5 A;  1KIX A;  1XNQ Q;  2VZA A;  3E0E A;  1RL2 A;  1JJ2 A;  1OXU A;  2AMC B;  5M5Y H;  1YJ9 A;  3S1M H;  1JT8 A;  5FLM H;  5E7N A;  4GLX A;  2WB1 G;  4QY7 A;  1C7Y A;  1YEZ A;  1VCI A;  1WJJ A;  2GN5 A;  3E9I A;  5C44 G;  3BZC A;  4DR5 Q;  2K5H A;  2R7D A;  4X65 L;  1VQD A;  3AFQ A;  4R4C A;  1PV4 A;  2IT1 A;  3K0X A;  3RZO H;  1PVO A;  4LWC A;  5GAG C;  4LF7 Q;  5JJK A;  5JJL A;  2R7F A;  2HQL A;  3KDF B;  4DV7 L;  1MKH A;  4BA2 I;  4HJ8 A;  2Y0S E;  2K5V A;  1HZC A;  2ZTD A;  2N3S A;  4JI8 L;  2BH2 A;  1D7Q A;  2AWN A;  3J80 c;  4C3I H;  1CKO A;  3KYH C;  4A3J H;  3S1R H;  4JI5 L;  3TRZ A;  1VQE A;  3A5Z B;  3Q8D A;  4NXN L;  4XIG S;  3G6E A;  1GO3 E;  1CSQ A;  1WYD A;  5IE8 A;  4DR7 L;  3ER0 A;  1T9H A;  1XMO L;  3J7A 5;  1YHQ A;  3RR5 A;  3AFP A;  4DUZ L;  1LTL A;  1P8L A;  1PH9 A;  4L5T A;  3F8T A;  2LXK A;  5FJ8 G;  2GVA A;  2YTY A;  3UDX A;  2B63 G;  4A3M G;  1L1O A;  4LF8 Q;  5GAD C;  3S14 H;  4BBR G;  3S15 H;  4UP7 A;  5M3F G;  4GNX C;  3RN2 A;  4OXP A;  1HH2 P;  1WCM G;  3STB D;  3W1G A;  3CD6 A;  4A3D H;  5J3B A;  5HGQ A;  3JAM i;  1LYL A;  1EOV A;  2K4K A;  2KHJ A;  2PQA B;  5IP9 H;  3CCE A;  5LMN Q;  1PH5 A;  3HOV H;  1UE7 A;  3KFU A;  1W2B A;  1J6Q A;  4DV0 Q;  4LF7 L;  4FDB A;  2N49 A;  4KHZ A;  4OX9 Q;  2AKW B;  1Y1V G;  4R1J A;  3GTM H;  1Y1W G;  4JI7 Q;  1V43 A;  4LFA Q;  1OTC A;  3S2H H;  3W1B A;  4EX5 A;  4LF4 L;  1CSP A;  3HOX H;  2HT1 A;  1IXR A;  2KEN A;  4JI6 L;  1PHJ A;  2AHO B;  4B3S Q;  3M4O H;  2NZH A;  4GKK Q;  4KHP Q;  2UXC Q;  4LF9 Q;  1L1O C;  3K7U C;  4O2D A;  1GVP A;  1MJE A;  4P73 A;  4LNQ A;  2PNH A;  4NXM Q;  5M3M H;  4XTC S;  3ICE A;  2VUM H;  3KF6 A;  1A63 A;  1NMF A;  3J81 i;  2UXD Q;  2ALY B;  3I4M H;  1I3Q H;  4ME3 A;  1U5K A;  2NN6 I;  1UE6 A;  4A3K G;  1E7Z A;  1JJC B;  1UE1 A;  4Y7N H;  3GTQ H;  2F4V L;  4LFB Q;  3CXC A;  2E5L L;  1TWG H;  1G29 1;  4LF8 L;  4OWT B;  3CC7 A;  1PH1 A;  2OTL A;  3CCQ A;  3GTO H;  1Q1B A;  3H15 A;  3PUZ A;  1Q12 A;  1QVC A;  1HNZ Q;  1IL2 A;  1B8A A;  3I56 A;  1XMQ L;  1L1O B;  4AIM A;  1X65 A;  2Y0S G;  3HOY H;  4DR4 Q;  3KJO A;  3KOJ A;  3OW2 A;  1TXY A;  4YWM A;  3T1Y L;  3EIV A;  3PF5 A;  2Q2U A;  5GRO A;  3PO2 H;  5JJI A;  3K7A H;  1QZH A;  2A19 A;  1FJG Q;  1Q46 A;  4OX9 L;  2JA7 G;  5AJ3 Q;  4DV4 Q;  1ASZ A;  2OWO A;  3HOW H;  1A62 A;  1X6O A;  3MXN B;  4GS3 A;  4BA1 I;  2UUC L;  4LF5 L;  2GVB A;  3OTO L;  1KL9 A;  4OWX B;  3PO3 G;  2RHS B;  2QEX A;  4JI4 Q;  2JJQ A;  4KHP L;  4DV3 L;  1EQR A;  4K0K L;  4IOA A;  1VQH A;  1QUQ A;  4BY1 G;  2B63 H;  5IWA L;  4JV5 Q;  2JK8 A;  3ULP A;  1SRO A;  1VQF A;  5EAY A;  4BBR H;  5FLX c;  1N34 L;  5M3F H;  3MEF A;  2R6G A;  1VQG A;  3FKI H;  3RLF A;  4DK3 C;  2PI2 E;  3TS2 A;  1I50 H;  2IHF A;  2C35 B;  4A3B H;  3T1H Q;  4DR2 L;  3KF6 B;  1K73 C;  1YHA A;  4BXX G;  2DUD A;  1VQK A;  1AE3 A;  2ZM6 L;  1UWV A;  4DUY Q;  4A3I G;  4EQ5 A;  4BY7 G;  3I4N G;  3CPF A;  4A76 A;  1K8G A;  2VL6 A;  2L15 A;  1Y1V H;  1PH7 A;  4JI1 Q;  3M85 A;  1YBY A;  2IX0 A;  4POF A;  3CCV A;  4R4O A;  4YHH L;  1BKB A;  3GTP H;  1EWI A;  2E2I H;  2UU9 Q;  4AYB E;  4LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...