4LUOA

Fragment-based discovery of a potent inhibitor of replication protein a protein-protein interactions
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4luoA00
3GTJH 3GTGH 4JYAL 1JT8A 1I5FA 1JMCA 4JI6Q 3Q8DA 2HIXA 5M5YH 1MIUA 4WJ4A 3CAMA 3S1MH 5IYCG 1P8LA 3F8TA 5LMUL 2CQOA 4GN3B 4HIMA 3L2PA 3CPWA 1E22A 4GNXB 3HKSA 1VQ8A 2UU9L 2K4KA 1VQ6A 3PGZA 1VQKA 2PQAA 4DR3L 4DV5Q 4L5QA 2EXDA 1K8GA 2MO1A 2CCZA 3PO3H 1SRUA 1LUZA 3TREA 1VQNA 1YHBA 1N36Q 5C0XJ 3E9IA 1PH1A 1MJCA 1VQEA 5IE8A 2VUMG 5IT9c 1C0AA 3VDYA 5GAEC 3DM3A 1P16A 2RF4A 3MXNB 1BVSA 4L5TA 4JI4Q 2UUBQ 2JA6H 1E7ZA 2NN6G 3T1YQ 4IFDJ 1PH8A 3J81j 2F4VL 5ELOA 2D62A 4KI0A 3CP0A 4AYBE 3CMAA 2CWPA 3F2DA 1CKNA 4PZ6A 4MNOA 2GN5A 2IHEA 3S2HH 1A63A 4OWXB 2QGQA 4DPGA 1W2BA 2E2JH 2NVXH 1N33Q 1XNQQ 3M4OH 4WJ3M 4HJ8A 3U4ZA 5FLMG 4GOPC 1VQFA 4JYAQ 4LFCL 2BH2A 2OQKA 2R92G 3I4NH 1BBWA 1Q1EA 1U5KA 3UDGA 4A3IH 4YCUA 4JC0A 1ASYA 3EN2A 3U58A 5FJ8H 4A3LH 3K80C 4R4TA 5GAHC 4QJFA 5LMUQ 1EQRA 4R4QA 3CCVA 2ID0A 1EFWA 3CW2C 4YY3L 2UU9Q 3OYYA 2IX0A 4DR3Q 4C3HH 5E7NA 4X64L 3J81c 1HZCA 3GTLH 3UE1A 1I3QH 2Z6KC 1PH7A 3CCSA 3F2CA 4EQ5A 1NBWA 4A3GH 1VQ7A 4X6AH 3EBEA 3GTPH 2B63G 2AMCB 1G291 4DV7L 2JA8G 3LGJA 3CF5A 2JA9A 2IX1A 1O7IA 3I56A 4A93G 3PF5A 1V43A 2MQHA 2WAQG 1X3GA 3GTMH 2ZJRA 1JE5A 1BBUA 3M3YH 3HKZE 2F4VQ 4BBRG 1X56A 2CFMA 2JEBI 4DK6C 2R7DA 1A62A 4DV2L 2HT1A 3I55A 2PI2E 1L1OA 1RIPA 1Y1VH 4X66L 3CC4A 1NY4A 4IPGA 4NXNL 4HJ5A 2XTIA 3K8AA 2B3GA 4AQYL 1NE3A 4LFCQ 3I4OA 4IOCA 4DR4L 2LSSA 3PUYA 2MNAA 4JI3L 3HOVH 1PH3A 4Y52H 1CKOA 1YBYA 3I4MH 3AFQA 3UDFA 2D0OA 3A5ZB 4YY3Q 4A3EH 3HOWH 1LYLA 1YVCA 3PUVA 1K3RA 3F1ZA 4BY1G 4X64Q 3S24A 5M3MH 2VUMH 4C2MH 2WFWA 1WYDA 3TQYA 1E1TA 3J81i 4DV7Q 5ELNA 1HNWL 5C0XI 4OXPA 3TEHB 1PH5A 2PMZE 3J7A5 2EIFA 4KLKA 1XMQQ 4DV1L 3KLWA 4HIDA 2F3IA 3CD6A 3RZDH 1A0IA 3S1NH 3K0XA 4R4IA 4JI5L 2YU9H 4IFDI 4JOIC 5GADC 4B3RL 2WB1E 5IWAL 3I7FA 1OXUA 3ERSX 4DV2Q 3HOZH 2YV5A 4DR1L 1KRSA 3HOYG 1VQCA 4C3JH 4X66Q 5LMNW 1QVGA 2UUAL 2GVBA 4LWCA 3S16H 1CKNB 2R93H 4YWLA 1NMGA 5M3FG 1E1OA 2KCMA 1VQMA 1L0WA 5DLQE 4NXNQ 4POGA 1JJGA 1VQHA 1HR0L 1UE6A 1CSPA 4AQYQ 5GQOA 2R7FA 1AE2A 3CCQA 2I5LX 4DR4Q 3GTOH 2YTXA 1Q81C 4AH6A 4A75A 1IBML 2VY3A 2OWOA 4JI3Q 2IT1A 3KFUA 1X3EA 3M4PA 3J80c 4DUZL 1VS0A 2AKWB 4PMWA 5JEAG 2ZM6L 4RMFA 4A3FH 4JI0L 4DV0L 1L2FA 3A5UA 3HOUH 2JA5G 4A3DG 3KJPA 1NTGA 5IP9G 1HZAA 3U50C 3U4VA 4BY7G 4A3CG 2UXBL 3BJUA 3I2ZA 4HJAA 1OXTA 1VQGA 5IYDH 1PFSA 4B3TL 4MTNA 4ME3A 1IBLL 2UUCL 1QUQA 3L7ZC 4H02A 2PNHA 3KYHC 4PZ7A 1HNWQ 4DV4L 4JI7L 1D7QA 2E2IH 4MZ9A 1JJCB 3CCRA 3AEVA 3PF4A 4IPDA 4NXML 2R7ZH 2E8GA 2AWOA 4DV1Q 1D8LA 3H0GH 2LXJA 1VQBA 1DGSA 2KBNA 4JI2L 1MJEA 4JI5Q 2KENA 1UE1A 5C44H 4L5RC 5C0XG 3PO2H 4OWTB 4LF5L 4B3RQ 1CKMA 5IWAQ 4OO1G 1KC8C 4LUZA 3PV0A 4BBSH 4DR1Q 1X6OA 4TQUS 1XTDA 1Q1BA 2UUAQ 1PVOA 2KHJA 4IFDG 1L1OB 1HR0Q 1EIFA 3K7UC 4P75A 2R6GA 3CPFA 3EIVA 4AIMA 2VW9A 3ZJYC 1I6HH 1SROA 1IBMQ 3NENA 5IYCH 1QVCA 5C4JH 3WWVA 4DUZQ 2NZHA 4R1JA 5IP7G 2ZM6Q 2ES2A 1YJWA 4P72A 4DV0Q 4JI0Q 1FL0A 4KHPL 4A3MG 3J80i 3FHWA 4QL5A 3CCMA 2UXBQ 1HZBA 2YTVA 4KHZA 1HNZL 2Q2TA 1OXXK 1Q12A 3M4QA 4IOAA 3FKIG 1Q46A 3JAMc 4DV3L 1XMOL 3GD7A 2Q2UA 1PV4A 4B3ML 4UP8A 1WI5A 4YCVA 3T1HL 1VQOA 1IBLQ 2UUCQ 1FJGL 2Z6KA 1G51A 4DR6L 2I5MX 2QEXA 1PA6A 2N78A 5JJLA 2OTJA 1Z9FA 4DV4Q 1IL2A 1Q86C 5GROA 4JI7Q 3TS0A 2NVQH 3GDEA 2K50A 4NXMQ 1LM0A 1WOCA 3KOJA 3HOXG 4BXXG 4A3BG 4JI2Q 2HQLA 4GS3A 1WCMG 2N8NA 4GNXC 2K5VA 1KXLA 2JA7G 4AYBG 1V1QA 1Z47A 4LF5Q 1CUKA 1TWFH 2A1AA 3CXCA 1X65A 3M85A 2CKZB 4ALPA 2QA4A 1Q7YC 3BU2A 4IPHA 2ZJPA 4O2DA 1S72A 1U0LA 2C35B 1K73C 4LF4L 4JV5L 1KAWA 2I0QA 4UY8C 5FLMH 5C4XG 4JBKA 3ULJA 4DV6L 3PIOA 5JJKA 1Q82C 1JJ2A 4HIOA 2R92H 5IY0A 1SE8A 2BH8A 2VL6A 2E5LL 4A4IA 3RN5A 1VQAA 3KF8B 1E3PA 2Y0SE 3PUXA 4YHHL 3K7AH 3HFZB 3DLLA 1PH2A 1TWGH 1S3OA 3L0OA 1EWIA 2VQFL 2IHFA 1J5EL 2UXCL 3UDXA 2JQOA 1IYJB 3AYHB 4XIGS 3RR5A 3W1BA 4GKJL 5C3EG 4KHPQ 1TXYA 3CQZH 3STBD 4A3KG 2Z0SA 2UXDL 1HNZQ 1Y1WG 2HHHL 2HIVA 4GLVB 2KCTA 4UP7A 3ULLA 1QZGA 4DV3Q 4B3MQ 4Y7NH 1XMOQ 2B63H 1FJGQ 4LUOA 2JA8H 3T1HQ 3RZOH 4P74A 3SGIA 4DR6Q 2PQAB 1W3SA 4A93H 1SFOH 5BR8L 4BA2I 1K0RA 3JAMi 3TRZA 3S17H 1QUQB 3OTOL 3F2BA 3CCJA 1V9PA 4BBRH 1N9WA 3J7ZC 1C7YA 5LMNL 1VQ9A 1UWVA 1PYSB 2F52A 3W1GA 3BZKA 1FVIA 2AHOB 4JOIA 4YWMA 4DUYL 3RLOA 3PCOB 3RLNA 5FLXc 4LW1A 1E24A 1AE3A 4JV5Q 2BA0A 4P73A 4LF4Q 4NB3A 1KIXA 5IYBG 1PH6A 1B70B 3M9BA 3STBC 2NN6I 1EUJA 2NVYH 1SLJA 4DV6Q 4JG2A 2K14A 1X3FA 4JI1L 2Q2IA 3ICEA 1RL2A 2E5LQ 3ULPA 4GN5A 1TWCH 2ZTEA 4IO9A 4YHHQ 1PH9A 3G4SA 1NMFA 4DAYB 2JEAI 2VQFQ 2N3SA 3KDFA 1LTLA 1J5EQ 4LF8L 4LFAL 1XNRL 4GKJQ 2UXCQ 4A76A 3T1YL 4HJ9A 3UDIA 1PYBA 1K83H 5M5WH 1QZHA 4BY1H 2RHSB 4PZ8A 4JI8L 4B3SL 2ATWA 2JA6G 4O0AA 2UXDQ 4LF7L 2HHHQ 4XTCS 2VQEL 2DGYA 1K8AC 3H15A 4DAMA 4X65L 1N32L 2XGTA 1N34L 4X62L 5BR8Q 1N33L 2ZTDA 3GTKH 1M1KC 1OXVA 3FP9A 2MFIA 1VQ5A 3ER0A 1FGUA 5M5XH 1SMXA 3OTOQ 1YITA 1N8RC 3S2DH 1X54A 2RHQB 3KF6A 2NZOA 5LMNQ 4L5SA 1XJVA 2WB1G 4HIKA 2V1CC 2B29A 4A3IG 1HR0W 3HOYH 4DUYQ 3D0FA 5IYBH 1H95A 1CSQA 5M3FH 5FJ8G 4A3LG 2L15A 1YI2A 4BA1I 1YJNA 1VQPA 2N49A 1OTCA 4QY7A 4DR5L 1KD1C 2OTLA 4DKAC 4LF6L 3E0EA 4JI1Q 1M90C 1YHAA 1VQLA 4GLAC 3S15H 2GVAA 4C3IH 3CCLA 3PUWA 4GOPA 4A3GG 1YIJA 4LFAQ 4LF8Q 2WP8J 4OO1I 2JA5H 3CCUA 1XNRQ 4A3DH 1XPRA 5K36G 4DR2L 2PI2A 1J6QA 4P71A 5IP9H 2WAQE 1YHQA 1I94L 4BY7H 4A3CH 3MEFA 4JI8Q 1TWAH 5H1SE 4B3SQ 1X9NA 1KRTA 3TS2A 4LF7Q 3M7NA 2MO0A 2VQEQ 2LXKA 1IBKL 2FXQA 1K9MC 1Q8KA 1AH9A 4X65Q 2NVTH 1EQQA 4GKKL 1UE5A 4IJHA 4OONA 2VS1A 1S40A 4LF9L 1N34Q 4X62Q 1N32Q 4APVA 1HH2P 4UPAA 2Q2HA 4OWWB 4YWKA 3H3VH 3PSIA 3G48A 3S14H 4QIWE 2VZAA 1Y1VG 4RG1A 3G71A 2JE6I 4QGUA 4QQBX 1JB7A 3AQQA 1KQSA 3RN2A 3RNUA 2E2HH 1KHIA 1Y14B 5JJIA 1GO3E 4DR7L 4PG3A 4GNXA 3HOVG 1GKHA 4J15A 3JC66 1EYGA 1T9HA 3CC2A 4GN4B 3GTQH 3I4MG 3BZCA 4EX5A 3CMEA 2K5HA 4IPCA 1HNXL 3PIPA 4DK3C 3UE0A 3HOWG 4IJLA 4DNIA 4DR5Q 4HJ7A 4JBJA 4A3EG 4LF6Q 2K5NA 5GAGC 5M3MG 1SR3A 1EIYB 1VQJA 1MKHA 4JBWA 3KJOA 2DUDA 5IP7H 1IZ6A 5AJ3L 4K0KL 1XMQL 4A3MH 1YJ9A 3PUZA 4JCVE 4DR2Q 1I94Q 2ASBA 1EOVA 3A74A 3KDFB 1YEZA 1C9OA 1B8AA 4LFBL 2VNUD 3FKIH 1R9TH 1IBKQ 5EAYA 3AFPA 1WJJA 1GD7A 4YCWA 1L1OC 2EQSA 2CWAA 1PH4A 4GKKQ 3K81C 4A3JG 1PHJA 4LF9Q 1VCIA 3GO5A 3W5OA 3HOZG 2OCEA 2ALYB 2D0PA 2IY5B 1IXRA 2YTYA 4OX9L 3S1QH 1B7YB 4BXXH 3HOXH 2R93G 4A3BH 4UP9A 1WCMH 2OQ0A 2BA1A 3HKZG 2K75A 2JA7H 4R4CA 3I4NG 1OXSC 4JI6L 4R4OA 4DR7Q 4LNQA 3KF6B 4JBMA 3NELA 4GLXA 3CC7A 1HZ9A 2A19A 4LUVA 1HJPA 5C4XH 1GM5A 2H5XA 4A3FG 1XPUA 3RLFA 3HOUG 1HNXQ 1BKBA 1KL9A 2I5HA 2RCNA 3H3VI 2KHIA 4DV5L 3CCEA 1A8VA 3S1RH 2JK8A 2Y0SG 1N36L 5IYDG 5HGQA 2ZJQA 3NBHB 1X55A 3PO3G 2YYZA 5J3BA 3G6EA 1UEBA 1ASZA 1GVPA 1WFQA 5AJ3Q 5C3EH 3OW2A 1VQ4A 1NJIC 4K0KQ 4A3KH 1QVFA 4JI4L 4GOPB 2UUBL 3IRBA 3A0JA 3D31A 1Y1WH 5HY6A 2R7ZG 4LFBQ 1VQIA 3NEMA 1YNXA 3H0GG 4TVAB 1YZ6A 4A3JH 4FDBA 1VQDA 2K52A 4NPSA 5C44G 1XPOA 1UE7A 3PO2G 2JJQA 2ZTCA 3B6YA 1G6PA 5JEAJ 1I50H 4BBSG 4B3TQ 1XNQL 1TWHH 4POFA 4OX9Q 3E9HA 1SN8A 2AWNA 2A8VA
chains in the Genus database with same CATH superfamily
2XN9C 2C9OA 4K8JA 4HMIA 3BYTB 3F8TA 3N52A 5LMUL 5HURA 1ICWA 4GN3B 1G2TA 4HIMA 1Z7TA 3HKSA 2UU9L 1I4QA 1VQKA 4UDUC 2CCZA 3DWAA 2O2LD 1CZGA 1LUZA 1VQNA 1N36Q 1R4PB 3NHHA 2E2JB 3M4OB 3C2PA 1P16A 3MXNB 1BVSA 2HDMA 2WB1B 2UUBQ 3NPPA 4IFDJ 2KOLA 4A3IB 4DAPA 5JAVA 1GOZA 1TIID 3F2DA 2CWPA 1A63A 4O42A 1W2BA 4WJ3M 2NVXH 3GTLB 3FVQA 2BOSA 4XDXA 4GOPC 3GTPB 4LFCL 2R92G 5L37A 1U5KA 1PFMA 1EY0A 4YCUA 1VF5C 2GA4B 3GTMB 5FJ8H 1JWUD 5LMUQ 3CCVA 5EQ0A 5IGCA 3CW2C 2UU9Q 4DXGA 4C1NI 5A35A 4C3HH 5E7NA 4X64L 1HZCA 1F9QA 1BDOA 1VQ7A 4X6AH 1Y1VB 1PTOF 2AMCB 4KN7C 2EJMA 4ODGA 1O7IA 4A93G 1V43A 1F9RA 1BBUA 3MEHA 3M3YH 3HOVB 2AQ1B 4JK1C 3TP6A 3KLSA 4JPBW 2IWHA 3I55A 1RIPA 2B63B 1NY4A 1YNNC 4HN7A 1SFOB 2B3GA 4AQYL 1NE3A 1PRTB 4LFCQ 3HGBA 1B9NA 5EPKA 4BWGB 1U9RA 5CV6A 2F4IA 4Y52H 1CKOA 1YBYA 2B2UC 4G4KA 1A2UA 4A3EH 1LYLA 3F1ZA 4BY1G 4X64Q 4CDDC 2FINB 4CGYB 4KD3A 1ENFA 1WYDA 1ZXTA 3S16B 4C3JB 2RSOA 2R93B 3MA2B 1HNWL 5C0XI 5ELBA 3J7A5 2EIFA 3FMCA 4HIDA 4RKLA 1KLGD 2F3IA 3CD6A 2J0TD 1A0IA 1PZID 4JI5L 1H9MA 4A3FB 5CV5A 1NCVA 1OXUA 4NDXA 4DGZA 2M2LA 3ERQA 2UUAL 3IFTA 3KF8A 1RTOA 2L5TA 1SMYD 4G7HC 1VQMA 4Q5VA 1HR0L 4AQYQ 5I9PA 3GTOH 1RTNA 4RHSA 1IKMA 1KNAA 2E2IB 3V96A 1X3EA 1K0SA 2XSCA 4JI0L 3MFYA 1ONLA 3DM1A 3KJPA 1NTGA 4A3CG 3BJUA 5IYDH 2Z9HA 4MTNA 5LL6S 4ME3A 3K59A 2EXZA 1HNWQ 4DV4L 1D7QA 1A3VA 5KNBA 2D9UA 1JCKB 1VQBA 2K7VA 1MJEA 1CK1A 4JI5Q 1CKMA 3I72A 1XTDA 1A15A 1Q1BA 4OIKA 2UUAQ 3D6WA 2KHJA 2RBMA 3I8ZA 1HR0Q 4AIMA 2R6GA 3EIVA 2BDNA 3TP7A 3ZJYC 5CC4A 3NENA 5IYCH 2NZ1D 2F0FA 1J9OA 4JI0Q 4P72A 4KHPL 3J80i 2YTVA 1A3UA 3OMCA 1HNZL 1OXXK 3M4QA 1TWFB 2NUCA 4DV3L 1PV4A 1FJGL 1QNKA 4J6HA 1PA6A 1WTHA 4DV4Q 1DXMA 2NN6H 2R92B 3TS0A 3H09A 5ELDA 3KOJA 2JP1A 1JORA 1STGA 3P7JA 1BCPB 1KXLA 2JA7G 4PV1C 3MXPA 5IGBA 1QWYA 1CUKA 1CZWA 2PZWA 4IUTA 1GHJA 4IPHA 3IKJA 1U0LA 2C35B 4XQNA 3SK8A 1X3PA 4JBKA 3X3NA 3I90A 4Y7NB 5JJKA 5IY0A 1SE8A 2MJ8A 4A93B 4A4IA 3RN5A 1E3PA 2KEEA 2K33A 4CDFC 3L0OA 2OXPA 3UDXA 1IYJB 3RR5A 3W1BA 1B9MA 1E2VA 3K57A 4KHPQ 2DJGC 1TXYA 3CQZH 1RDPD 3DWPA 4A3KG 2B2UA 3VR6A 1H9SA 3J81L 1HNZQ 3UI2A 2HIVA 4UP7A 1AFPA 4DV3Q 3ND9A 2B63H 1BCPD 1FJGQ 4X3KA 2JA8H 3RZOH 1EEID 4ZRZA 1HFGA 1SFOH 3K5MA 4BA2I 5D14A 3JAMi 1Y8NB 1XTCD 3SK6A 4WJWA 2K01A 2XIWA 3W1GA 5I4DA 3BZKA 1JE4A 4YWMA 3VR5A 4BY1B 3RLNA 5FLXc 3VR2A 1E24A 1SNMA 2XRSD 3PMFA 1WVLA 1PH6A 3T56B 4ALPA 1JT8A 1SLJA 1BQQT 2Q2IA 2EJFC 1AN8A 4IO9A 3G4SA 3KDFA 4FP5D 5A2QL 4K8IA 4A76A 3T1YL 4HJ9A 5ISRA 1PYBA 1K83H 4PZ8A 4X3TA 2ATWA 5G3LF 4XT3B 5DEHA 3MVVA 3BVGA 4X62L 2EVBA 1OXVA 3Q0AA 3ER0A 1N8RC 4FYDA 1X54A 2RHQB 1BUVT 4L5SA 1XJVA 3CRLC 3T51B 4G57A 2L9HA 1ZYRD 4CKCA 4DNTB 5IYBH 1FGBD 1CSQA 2MHVA 2IX3A 5FJ8G 5M3FH 1TS5A 1YI2A 3EFXD 1YJNA 1LTTD 4QY7A 2OTLA 2NVTB 1M90C 1YHAA 3D4WA 1HTPA 1QG7A 4C3HG 3E3XA 3S15H 4C3IH 3E0JA 1ET6A 2PQEA 5JEAH 1IHZA 3QJYA 2WP8J 4A3DH 5K36G 2IW3A 1J6QA 2PI2A 4O1NA 3MEFA 1TWAH 2MO0A 2LXKA 2KCNA 2X69A 1TY0A 2FXQA 5M9OA 1IBKL 4GKKL 3PIO3 1UE5A 4OONA 1S40A 4LF9L 1MGSA 4X62Q 4OWWB 4YWKA 3H3VH 1GXDC 4CKEA 3G48A 2F0NA 2JE6I 4ZYSA 1WD0A 2NTSA 3RN2A 4BS9A 1Y14B 2RKSA 1HXYD 4L8JA 4CDEC 2EYJA 1YNJC 2F0DA 5KNCA 1EYGA 3CC2A 1DOLA 3BZCA 2F0EA 4EX5A 3CMEA 2K5HA 4IFDH 3UE0A 4A3EG 2BE5C 4JBJA 2KJXA 4RH6A 1BXTA 3K5OA 1CTMA 1CFMA 2PYKA 4NP5A 2RQXA 2RCFA 2DUDA 3RMHA 5NUCA 3TP8A 5FK9C 4JCVE 2ASBA 2JA7B 1YEZA 2OEOA 1IBKQ 3QB3A 2AQ3B 1STAA 2NYZD 1WJJA 3MXGA 1L1OC 2EQSA 4GKKQ 4FXDA 3LWUA 3OIQA 1VCIA 4LF9Q 1WTVA 3W5OA 1DYQA 2OCEA 2ALYB 3ZYYX 3BDOA 5KRUA 4BXXH 2A68C 4UP9A 3EJIA 1PTOH 4R4OA 4A3KB 4LNQA 3CRKC 3KF6B 4CJ0B 4LUVA 3MZ5A 5C4XH 2PO4A 3RLFA 4A3JB 2I5HA 1KL9A 2RCNA 3V05A 2JK8A 5IYDG 3TN2A 2ZJQA 1X55A 1NSNS 1UEBA 5FLXE 1GVPA 1LT4D 3OW2A 3I4NB 5AFWA 5ELCA 3QOJA 4XXEA 1PXUA 4JI4L 4K14A 4HTHA 2EZVA 2HCIA 4NPSA 1PZJD 5CGKA 1U4MA 2ZTCA 4XYQA 2F0WA 1H9KA 4POFA 1AH9A 2A8VA 5DM73 4JYAL 4DK1A 1JMCA 1TQOA 5C4HA 1S5FD 1MIUA 4F8MA 3P1HA 5IYCG 1LO5D 1VQ6A 2K4KA 2K5WA 3A54A 2PQAA 1GUOA 1SRUA 1LTGD 1EY7A 5C0XJ 5CV4A 1PH1A 1VQEA 2NVXB 1LV9A 1D2BA 1C0AA 3J80L 4LAAA 2RF4A 4JI4Q 1E7ZA 2NN6G 1IL8A 4KJOA 1PH8A 3J81j 3C1EA 3DUZA 5ELOA 3NTIA 5JPMC 2G5DA 3BG3A 2D62A 4KI0A 3CP0A 4FVMA 3ND8A 4RGNA 4MNOA 1CHQD 4DPGA 2CQAA 1N33Q 4KK7A 4HJ8A 3U4ZA 1VQFA 4JYAQ 3Q23A 2BH2A 3I4NH 1Q1EA 3UDGA 2RDHA 5T1IA 4UAIA 1ASYA 4HSPA 4A3LH 2N55A 3M3YB 2ID0A 4PNYA 4HCEA 4YY3L 4EQNA 5C5LA 2K5DA 4CJ1B 4IN3A 1EQVA 2A6ED 2Z6KC 1B2TA 4EQ5A 4A3GH 3EBEA 2B63G 1G291 2JA8G 2IX1A 3PF5A 4E6IA 2CFMA 4DK6C 3MFGA 3JAML 4A3EB 5FOBB 2PI2E 3FPPA 1L1OA 1BNZA 3NQIA 2A69D 4MHEA 1DJRD 4IPGA 4NXNL 2XTIA 4HSVA 1H9JA 3D3RA 3HRZC 3I91A 4IOCA 2MNAA 4JI3L 4TKOB 1PH3A 3HG9A 2B8GA 2HD3A 1CHPD 1Z6HA 3I4MH 1SBBB 1B4OA 3J7AF 4YY3Q 1ZKOA 4J8QA 4F87A 3AMUA 1SYGA 2F0OA 3S24A 5M3MH 2TSSA 4C2MH 3I70A 2WFWA 1C8CA 1I4PA 2PNRC 5A2QE 4IUVA 1TS2A 1E1TA 3J81i 5ELNA 5K5PA 4OXPA 3TEHB 1PH5A 2J7ZA 5FO7B 1XMQQ 1R4QB 3GTOB 3MTSA 1LTID 3LNNA 3S1NH 3K0XA 1CQVA 4L6TB 4JOIC 1JOQA 5IWAL 2CH4A 1H9RA 3QG1A 5M5WB 3HOZH 2YV5A 1HCZA 5EBDA 4DR1L 4ZUIA 5LMNW 1QVGA 2GVBA 4LWCA 2FMCA 1NMGA 5M3FG 1L0YB 2KCMA 4NXNQ 1JJGA 1TKWB 2F3WA 3CCQA 2I5LX 1EU4A 2YTXA 3KFUA 4IUQA 4AH6A 1IBML 2VY3A 4JI3Q 3WOEA 3J80c 2HCCA 4DUZL 4C3IG 4PMWA 5JEAG 1UEAB 4DV0L 3HOUH 5D3DA 4P2CB 3MAQA 4A3DG 1DM0B 1XWEA 2H4OA 3U4VA 1IW7D 4HJAA 1OXTA 1DOKA 3QO2A 4ZK9B 1IBLL 2UUCL 2F1MA 2KUMA 2VB3X 1U4PA 5KNDA 4PZ7A 4MZ9A 1JJCB 5IGEA 3FEWX 3QOLA 2E8GA 2LY7A 1D8LA 5KEEA 2LXJA 1MI2A 1AW7A 1SMYC 2KBNA 4JI2L 5C44H 4L5RC 4LF5L 5IWAQ 5KYLA 3PV0A 2AUJD 4DR1Q 4TQUS 4FXKC 3DMUA 3BVMA 5I2XA 4IFDG 1KDCA 1T5XD 4P75A 4DAYA 1ICFB 1K28A 4XT1B 1IBMQ 1I4GA 5C4JH 1G2SA 2RSNA 4DUZQ 4WFN3 4R1JA 4DV0Q 5C4ZA 1FL0A 3FHWA 4H13C 1PFNA 5C3WA 2Q2UA 3JAMc 1XMOL 4YCVA 1IBLQ 2UUCQ 1BCPF 2Z6KA 1G51A 2QEXA 1A6XA 1HHVA 2OTJA 1IL2A 1Q86C 5GROA 3NP8A 1WTPA 2NVQH 1PFBA 1LM0A 4BXXG 3QR8A 4JI2Q 4GS3A 4GNXC 4TRDA 1STHA 2NBFA 3J7YW 4LF5Q 1V1QA 3BDLA 1Z47A 2E74C 3CQZB 2QA4A 3BU2A 4Q0FA 1H95A 2ZXPA 5C4XG 2M9VA 1STNA 1EY6A 2EYPA 1WD1A 4QMGA 3PIOA 4DV6L 1Q82C 1JJ2A 4HIOA 2JA8B 3RZOB 1PMRA 1S5CD 1VQAA 3KF8B 4ZQ3A 3VR4A 2ZXOA 1F2ZA 3GV6A 3K7AH 3HFZB 4K5WA 1TWGH 1SEBD 3AYHB 5BN5A 3GV3A 3VA5A 2R61A 1RODA 2HHHL 3ULLA 3TMEA 1QZGA 2X6GA 1S4ZA 4KKTA 1XMOQ 1JC7A 4B9XA 2L1BA 3D4DA 1W3SA 1EWCA 5BR8L 1RHPA 1K0RA 3TRZA 3S17H 3VYSA 5EGTA 3OTOL 3F2BA 3CCJA 1V9PA 3OWFA 2ICEC 4BBRH 3J7ZC 1VQ9A 5C3EB 5CV9A 5EKLA 3EVQA 1F2MA 1LABA 1PRTD 2AHOB 4JOIA 4DUYL 1K83B 2ICIA 1T5EA 1UAPA 1STYA 2BA0A 4P73A 4V0BA 4NB3A 5CBAE 1B70B 3VR3A 2F0LA 2NN6I 2NVYH 4DV6Q 1FNVA 1GHKA 5C5MA 4ILWA 1RL2A 4M1UB 1TWCH 1DCZA 2ZT9C 1NMFA 2L55A 1BCPC 2PZTA 1WTOA 1M8AA 5M5WH 1QZHA 4O0AA 4ME5A 4LF7L 2HHHQ 1QCBD 1K8AC 2EOTA 4DAMA 3J80E 4ZKBB 3WDNA 5M3FB 2XGTA 4IALA 5C6AA 5BR8Q 3MHBA 4HEDA 2ZTDA 2MFIA 2QW7A 3D6CA 5M5XH 5DAUA 3OTOQ 3S2DH 3Q24A 1Y8OB 4C3IB 3S15B 1U4RA 2L12A 3EROA 4A3DB 2K28A 2B29A 1HR0W 4DUYQ 3D0FA 1TWAB 5COYA 4A3LG 1E0BA 4BA1I 1J8IA 1HUNA 1K8MA 2N49A 3HS0C 3NBHA 4DKAC 1VQLA 2NB0A 4GLAC 3CCLA 4EVOA 3PUWA 4GOPA 4A3GG 3KBXA 2QEJC 4P71A 5IP9H 1YHQA 1EEFD 4XQJA 4LF7Q 3DEPA 5J22A 1Q8KA 3H6MA 1ML0D 1H9SB 3I4LA 2K1BA 1D5XC 4R9WA 2VS1A 2IJ0A 1ZYRC 5IT9L 4UPAA 3K6OA 3PSIA 3S14H 4RG1A 2KVMA 4QQBX 4PQXA 3JAME 1KQSA 5C0XH 3RNUA 1KHIA 4RKBA 5JJIA 2O5IC 4PG3A 4GNXA 4J15A 3KUPA 3JC66 5IGFA 3SHLA 1C48A 3I4MG 3CKIB 1EZ6A 1SYFA 3VYTA 1HNXL 4IJLA 1Y8PB 4DNIA 3RUZA 2B2YC 1NUCA 5GAGC 5M3MG 1YJ9A 3PUZA 2KHSA 3KDFB 1EWHA 4DA2A 1B8AA 3IAYA 1PTOB 3FKIH 1R9TH 5I2YA 2JXMB 1O7YA 5C4XB 2A6HD 4YCWA 4QIWB 4A3JG 2E2DC 3GO5A 1QNUA 5FO9B 3HOZG 4IZ8A 2D0PA 3WOFA 3L3OC 2YTYA 3HOXH 2BA1A 1PLFA 2K75A 4R4CA 3I4NG 1X3QA 4JBMA 3NELA 3CC7A 1HZ9A 1CQFA 2A19A 1GUGA 2H5XA 2B2VC 2E76C 1WTQA 3HOUG 1HNXQ 1BKBA 3H3VI 3U9OA 1A8VA 1PTOD 5HGTA 1FD7D 5HGQA 4PMCA 1X32A 3U9SA 2YYZA 1ASZA 1VQ4A 5C3EH 2CW0D 1QVFA 3A0JA 4FF3A 1EYAA 4DU9A 4TVAB 1YZ6A 5CR3A 1VQDA 2F0MA 2K52A 1BF4A 5C44G 1UE7A 1XXGA 1VDZA 2C5CA 3SDZA 2F0QA 3B6YA 1AEXA 1I50H 1XNQL 1W6JA 2F0TA 3E9HA 2AWNA 2RDFA 1EL0A 1STEA 1JICA 2B2WC 1QB5D 2VXWA 1A2TA 3A56A 3Q8DA 4K5XA 5M5YH 4WJ4A 3S1MH 4IUPA 1E22A 1V1OA 3OIPA 1O80A 1VQ8A 3PO2B 3PGZA 2E75C 3T16A 4DR3L 1B50A 2MO1A 3PO3H 4DFAA 1MJCA 5EPJA 5IT9c 5J39A 4HMJA 5GAEC 2F0KA 3T13A 2JA6H 4L5TA 1MSHA 1I6HB 3T1YQ 5T1GA 2F4VL 4CBVA 3PIP3 1CI3M 2DNCA 1CKNA 2GN5A 3S2HH 1F77A 2QDBA 1SAPA 1XNQQ 1QOHA 2XRQD 4QB4A 1ESFA 3VYUA 3TP5A 4A3GB 5CBEE 2FMMA 1BBWA 3T53B 3NTHA 3BS1A 2Q8TA 1CA6A 4RFBA 2XNAC 4ZLTF 3SXHA 5GAHC 4KY6A 1EQRA 4R4QA 1EFWA 5IGGA 3OYYA 4ULLA 3C1FA 5FO8B 1S5ED 3J81c 4DR3Q 3UE1A 1I3QH 3CCSA 1SYCA 2DN8A 1NBWA 1I4RA 1DOMA 2B2YA 1KDBA 4DV7L 3LGJA 1IYVA 2MQHA 1X3GA 2ZJRA 1EYCA 1VMCA 3HKZE 3NWTA 3TDQA 3SVMA 2F4VQ 4BBRG 3ITPA 3OOCA 2JEBI 3I4MB 1A62A 1CT1D 4DV2L 2HT1A 1NR2A 2KA7A 4X66L 1SJHD 2VB2X 1Y69U 5M3MB 4FO2A 4C2MB 2EY5A 4HJ5A 2PPBC 1AP0A 1NAPA 1D5ZC 2LSSA 2A6EC 2A5HA 1LT3D 2EYHA 4LJZC 4NW2A 2K03A 3A5ZB 3S1NB 3Q22A 4B9WA 2B2VA 3HOZB 4NMZA 4TSSA 3TQYA 4DV7Q 3KK7A 2F03A 5KGUA 3DXJC 2PMZE 4I7ZC 4FF2A 3H94A 4WORA 4K2LA 3KLWA 2A69C 2FHTA 1BOSA 2I07B 2LKVA 4HAEA 2YU9H 5GADC 4B3RL 3ERSX 3HOUB 4DV2Q 1ILQA 2Z8LA 4G7OC 1KRSA 1PYWD 1LTSD 3SR1A 4X66Q 3A8IE 4EQPA 1UE6A 4EGVA 1HFNA 3K0YA 2OT2A 1GUWA 4A75A 2NTTA 2QCPX 3FDTA 2IT1A 2B2WA 3M4PA 3D4RA 4OEMB 2KEDA 1V1PA 5IP9G 5C44B 1HZAA 2IL8A 3U50C 2UXBL 4F7XA 1E2WA 4M8AA 3I2ZA 3GP7A 1VQGA 4B3TL 5KYIA 4OHJA 2A73B 2EPBA 1QUQA 2Z6BA 2PW5A 3EQLC 4H02A 4HR7B 2PNHA 3CCRA 1HQRD 4PMBA 4NXML 2R7ZH 4KD4A 3D8GA 1AZQA 3H0GH 5C4JB 5D3IB 2KENA 1UE1A 5C0XG 3PO2H 1O7LA 4OWTB 4B3RQ 2L4NA 1I4XA 5IT9E 2J4XA 5IIFA 2SNMA 1ZEQX 4BBSH 2EE1A 4H0LC 5E4WC 2WV6D 1L1OB 5I6WA 1EIFA 3K7UC 2VW9A 3CPFA 1IW7C 1I6HH 1SROA 1ENCA 1GUTA 3WWVA 2NVQB 2ES2A 1YJWA 1FNUA 5I9OA 4IUUA 4X3UA 3CCMA 4QL5A 2UXBQ 1HZBA 5IGDA 2K04A 4IOAA 3FKIG 1Q46A 1BR9A 4B3ML 4B3TQ 3GD7A 2VUMH 4UP8A 1VF7A 1WI5A 3T1HL 1VQOA 2I5MX 5JJLA 2M00A 4IUNA 1L0XB 2K50A 4NXMQ 3J81E 1Q90A 1FNWA 2KECA 3HOXG 3K7AB 2HQLA 1LTRD 1TWGB 2N8NA 2K5VA 1EY5A 2K05A 1RD9D 1X65A 1PRTF 1HPCA 2ZJPA 4LF4L 1KAWA 2CH4W 4UY8C 5FLMH 1UNSA 1B3QA 5DNFA 3FRPB 3W3AA 2PZUA 1EIGA 3TZDA 2Y0SE 5JVG3 1LT6D 3S17B 1PH2A 1SDFA 2VQFL 2IHFA 2UXCL 4XIGS 4GKJL 4BBRB 4CJ2C 5C3EG 2LFNA 3HEJA 3STBD 3VA7A 3FPUB 4S3SA 4GLVB 3NQTA 4QUFA 4OL7A 4QF4A 4B3MQ 5KIXA 3T1HQ 3SGIA 4FF4A 2NVYB 1TY2A 4RA8A 1TWCB 1SNPA 5TSSA 1N9WA 2XWBB 5LMNL 1DD2A 2F52A 3OWEB 4OGQC 3RLOA 3PCOB 2F0VA 4LW1A 3A55A 4LF4Q 1KAAA 2SNSA 3PQIA 5IYBG 3I3CA 2G9DA 3M9BA 3AB9A 4JG2A 3ULPA 4GN5A 2ZTEA 1LTBD 1PH9A 4DAYB 2FJ2A 2H1EA 5M5XB 2VQFQ 2N3SA 4LF8L 1B53A 1LTLA 2JEAI 3GTGB 1XNRL 4GKJQ 3S2DB 2UXCQ 2IPKD 4KHVA 2JA6G 4JI8L 5FKAC 5ELEA 3G7LA 2WKCA 2VQEL 4X65L 2WINB 1HA6A 1V8QA 5CV8A 1PDQA 1N32L 1N34L 1PRTC 3GTKH 5EJWA 3FP9A 1VQ5A 1FGUA 1LACA 5ELFA 2ENBA 4RGOS 3BZDB 2NZOA 5CYUA 5LMNQ 5CMDA 3TSSA 2V1CC 3HOYH 2HUGA 2WIIB 2D5DA 2L15A 2K6AA 1I4HA 1SNDA 3AU7A 1OTCA 4LF6L 1A3TA 3O13A 1B1ZA 1IKLA 2RDGA 3S14B 3NUCA 2JYOA 3SE0A 4LF8Q 2JA5H 3CCUA 1XNRQ 1XPRA 4DR2L 3IL8A 5F2DA 2WAQE 5JJZA 4BY7H 1TU2B 1Q8IA 4JI8Q 1X9NA 3TS2A 2VQEQ 4K2KA 4X65Q 2RVLA 3KLSX 2O5JC 4ZCKA 1N32Q 4ABNA 1JWMD 1N34Q 4APVA 1HUMA 4ZKCB 2L0CA 3G71A 4QGUA 4H44C 4RGMA 3AQQA 2Q8IB 2E2HH 1SYDA 3NXWA 4OO1H 4DR7L 5EKIA 2JN4A 2BDOA 1EU3A 3H91A 4RWSC 1SXTA 3GTQH 3FKIB 1R9TB 4IPCA 4RCNA 3PIPA 4DK3C 1HTLD 4HJ7A 4LF6Q 1LTAD 4KN4C 1TS3A 1D6EC 3MXNA 1EIYB 1VQJA 1MKHA 5K36H 3L9AX 3DHQA 5IP7H 3OSOA 1F2LA 5AJ3L 4K0KL 3HOXB 4A3MH 4DR2Q 1ENAA 1STBA 2VNUD 2Z4IA 4IURA 3MWYW 4EQOA 3C46A 1GD7A 3HOWB 3J7AV 2CWAA 1KLUD 3H3VC 1D5MC 1OO9B 1XX8A 4R8IA 2IY5B 4OX9L 3S1QH 3K5LA 1B7YB 4MN3A 4A3BH 1WCMH 2MUYA 2G9HD 1OXSC 3I73A 3KBGA 5LL6X 4JI6L 4DR7Q 1B44D 1EY9A 3RZDB 1RCVD 5CORA 1XPUA 1IYUA 1BO0A 3EA6A 1KNEA 1JOOA 2KHIA 4DV5L 4KMUC 4H7BA 2A74C 3S1RH 1DZ1A 3R8BA 2Y0SG 2XVSA 3R2TA 2SOBA 3NBHB 1I50B 5J3BA 3HKZB 1S5DD 1F9PA 2A6HC 5AJ3Q 1WFQA 3P75A 3G6EA 1SYEA 2BCOA 1M4VA 2MP1A 4K0KQ 3NE5B 4QUCA 3SK5A 4GOPB 1RJTA 2EYFA 1TR5A 1Y1WH 3D31A 2R7ZG 1SNOA 1JR0D 5M5YB 4XYOA 1YNXA 3H0GG 4V190 3S1MB 3NWSA 1EOTA 1FYCA 1O78A 1BBXC 3PO2G 4CDCC 5IODA 2EY6A 4BBSG 5EPLA 1TWHH 4OX9Q 3PO3B 1K8OA 3A8KE 5JPNC 5EKKA 2LMCB 3GTJH 2B2TC 3GTGH 1I5FA 1PTOC 4JI6Q 2HIXA 2JA6B 3CAMA 1P8LA 5FLXL 2CQOA 4GZYC 3L2PA 3CPWA 1F2YA 2CW0C 4GNXB 1SJED 2D2CC 3N6RA 4MTKA 4DV5Q 4L5QA 2EXDA 1K8GA 3TREA 1YHBA 2PMZB 3S2HB 3E9IA 2VUMG 3R93A 3M4YA 5IE8A 4C1NK 3V2TA 3VDYA 4C56C 3DM3A 3NSWA 3A7LA 1JQYD 1W6KA 4FXGC 1GUSA 4U673 2JSOA 3CMAA 4AYBE 2O4XA 4U68A 4PZ6A 2IHEA 4OWXB 2QGQA 1DONA 2E2JH 3M4OH 1EQTA 5BN4A 1I3QB 1D1IA 5FLMG 1EY4A 3OPOA 3LWEA 2OQKA 4K6LA 1FR3A 4A3IH 3RD4A 4JC0A 4OELB 4UHVA 3EN2A 1WTXA 3U58A 2CVRA 3K80C 4R4TA 4QJFA 1YNND 2F0IA 4KV6A 1CA5A 2WKDA 4DF7A 2IX0A 3GTLH 1C4QA 1PH7A 3F2CA 1SNQA 1MHWC 3GTPH 1TS4A 4KJNA 2F3VA 3CF5A 2JA9A 1MBYA 1K3BC 3I56A 1HRJA 2EY2A 3A8JE 2WAQG 4KTAA 4DNRB 3GTMH 1JE5A 2LS01 4JVZA 4WRDA 1X56A 2R7DA 3MC0B 4G7ZC 2F0SA 1Y1VH 4L63B 1D1KA 3CC4A 1NNXA 3C3LA 3K8AA 3I4OA 1JB3A 4DR4L 1QILA 2OF1A 3PUYA 3HOVH 5CV7A 4B08A 3AFQA 3UDFA 2D0OA 4Z9CB 5JOBA 3HOWH 2YU9B 1YVCA 3PUVA 1K3RA 1HA5A 2PW7A 1ILPA 1TVXA 1GJXA 3G6JB 3R3OA 5JVH3 4KLKA 3S9WA 4DV1L 2RA4A 3RZDH 4R4IA 2EJGC 4IFDI 2WB1E 3I7FA 2KQ3A 2Z4HA 1G8ZD 1VQCA 4C3JH 3HOYG 3S16H 2R93H 1CKNB 2Y0SB 4YWLA 1E1OA 1L0WA 5DLQE 4POGA 1VQHA 1CSPA 5GQOA 2R7FA 1AE2A 4OIJA 4DR4Q 1EFID 1Q81C 2OWOA 2B2TA 1VS0A 2AKWB 4F88A 1XYIA 2R7ZB 4A3FH 2ZM6L 4RMFA 4KY7A 1L2FA 3H0GB 3A5UA 2JA5G 1GUNA 4BY7G 1SNCA 2X6LA 2P5ZX 1PFSA 4BBSB 3L7ZC 1MD2D 4LK1C 3KYHC 4JI7L 2E2IH 3AEVA 3PF4A 4IPDA 2AWOA 4DV1Q 1DGSA 5C3XA 2HDLA 4N9PA 2B8FA 3CHBD 3QIAA 4OO1G 1KC8C 4LUZA 4RHRA 1X6OA 1KTKA 1RKNA 1PVOA 2VUMB 3DWQA 4QCLA 1SE4A 2Q8RE 1QVCA 3HP3A 2NZHA 5IP7G 2ZM6Q 3TBIB 4A3MG 4KHZA 2Q2TA 1Q12A 1AZPA 4X3SA 2CHBD 2F0GA 4DR6L 1I6VC 1EIHA 1F9SA 2F0PA 4RGTA 4YIJA 2N78A 3K58A 1Z9FA 4JI7Q 3GDEA 1JWSD 1WOCA 4A3BG 3VYRA 1WCMG 2F0HA 4AYBG 4KKUA 1TWFH 2A1AA 2WACA 3M85A 3CXCA 1PZKD 2CKZB 1K73C 1Q7YC 1S72A 3BDCA 4O2DA 2B39A 4JV5L 2I0QA 4DAVA 1U4LA 1VMPA 3ULJA 3F2UA 2R92H 2BH8A 2VL6A 2E5LL 4ZUJA 2QF7A 4N8X1 2WAQB 3PUXA 4IQZA 3T4AC 4YHHL 3DLLA 3W2DA 1S3OA 1EWIA 1J5EL 5E4XA 2JQOA 4K6DA 1QJOA 1Q3LA 2Z0SA 2UXDL 4DN4M 4JW0A 3IFDA 1Y1WG 2DJFC 2KCTA 4FNFA 1KABA 1V1PB 4Y7NH 4LUOA 4DR6Q 4P74A 2PQAB 3HZXA 4A93H 5E1FA 3NBIA 3MXUA 5D65A 1QUQB 1RF2D 1C7YA 1UWVA 1LT5D 3NK9A 1PYSB 2K32A 1FVIA 1EYDA 1JOKA 1SE3A 1AE3A 4JV5Q 2ZXRA 1KIXA 4CHTB 3STBC 1EUJA 4J1MA 2K14A 1X3FA 4JI1L 3ICEA 3X3MA 2E5LQ 4YHHQ 3GTKB 2AUKA 3A7AB 4LFAL 1J5EQ 1CM9A 3UDIA 4BY1H 2RHSB 3QWNA 2UXDQ 4B3SL 1G6ZA 1SYBA 4XTCS 2DGYA 3HOYB 3H15A 4FF1A 1MSGA 1N33L 1M1KC 1QE6A 4NKLA 1YITA 1SMXA 4K5VA 3OHXC 3K5NA 4MIUA 3NTKA 3KF6A 5BN3A 1G91A 2EDGA 2WB1G 4HIKA 2JA5B 1NR4A 4A3IG 3URYA 1WTRA 2QKIC 3BYYB 4BY7B 3ONAB 1SE2A 2EYLA 1VQPA 1KD1C 4DR5L 2HQEA 3E0EA 4JI1Q 2I46A 1YNJD 2GVAA 1UUPA 1YIJA 4LFAQ 1I94L 4A3CH 2L11A 2EYOA 2BE5D 2E2HB 5G3LD 5H1SE 4B3SQ 1KRTA 1ESRA 4DXFA 2XWJB 5E3FA 2F0UA 3M7NA 3KLRA 2F0JA 1K9MC 2NVTH 1KDAA 3SEBA 4CKBA 1EQQA 3GTQB 4I65A 4IJHA 2FFKB 4C3HB 1HH2P 2Q2HA 2TMPA 3E6ZX 3BVZA 4QIWE 2VZAA 1Y1VG 3P20A 2SEBD 3GQBA 1JB7A 2PCFB 2MPMA 4XQQA 1GO3E 2DY7A 4A3MB 3OW7A 3HOVG 1GKHA 1T9HA 3E5SA 4GN4B 2A68D 1E2ZA 5LHY1 3HOWG 4DR5Q 2N88A 2K5NA 2V4DA 2KCCA 1SR3A 2DNEA 4N8FA 5I6YA 3CU7A 4JBWA 3KJOA 3S1QB 1IZ6A 4LMQD 3SK4A 3Q6SA 4A3BB 3TZUA 1XMQL 1WCMB 1TT2A 1I94Q 1EOVA 3A74A 1B3AA 5EBCA 4AYBB 4LFBL 2R3ZA 4KKSA 3OMGA 1ET9A 5EAYA 4ZAIA 3AFPA 2EY1A 3DEOA 1PH4A 1HQMC 2NWGA 3R2IA 3K81C 1PHJA 4DK0A 1EY8A 1IXRA 4C3JG 3S1RB 2SDFA 2R93G 2QDLA 2OQ0A 3HKZG 2JA7H 4GLXA 2DY8A 5IOCA 1Y1WB 4KY5A 1HJPA 1GM5A 1LLRD 4RAUC 4A3FG 1S5BD 4HCSA 4ID6A 2EYMA 4N9TA 5J1ZA 3CCEA 1N36L 4RCOA 3LX0A 3PO3G 1II3A 1SSOA 1TWHB 4OO1I 1NJIC 4A3KH 3GTJB 2AQ2B 1WTWA 2UUBL 3IRBA 2Z1CA 2MGSA 2QILA 5HY6A 4LFBQ 1O7ZA 1VQIA 3NEMA 5DM63 4A3JH 4FDBA 2K5QA 4R8NA 1XPOA 2JJQA 1EZ8A 1G6PA 5JEAJ 4I7AA 3M7GA 1SN8A 1C9OA
chains in the Genus database with same CATH topology
3GTJH 3GTGH 4JYAL 1JT8A 1I5FA 1JMCA 4JI6Q 3Q8DA 2HIXA 5M5YH 1MIUA 4WJ4A 3CAMA 3S1MH 5IYCG 1P8LA 3F8TA 5LMUL 2CQOA 4GN3B 4HIMA 3L2PA 3CPWA 1E22A 4GNXB 3HKSA 1VQ8A 2UU9L 2K4KA 1VQ6A 3PGZA 1VQKA 2PQAA 4DR3L 4DV5Q 4L5QA 2EXDA 1K8GA 2MO1A 2CCZA 3PO3H 1SRUA 1LUZA 3TREA 1VQNA 1YHBA 1N36Q 5C0XJ 3E9IA 1PH1A 1MJCA 1VQEA 5IE8A 2VUMG 5IT9c 1C0AA 3VDYA 5GAEC 3DM3A 1P16A 2RF4A 3MXNB 1BVSA 4L5TA 4JI4Q 2UUBQ 2JA6H 1E7ZA 2NN6G 3T1YQ 4IFDJ 1PH8A 3J81j 2F4VL 5ELOA 2D62A 4KI0A 3CP0A 4AYBE 3CMAA 2CWPA 3F2DA 1CKNA 4PZ6A 4MNOA 2GN5A 2IHEA 3S2HH 1A63A 4OWXB 2QGQA 4DPGA 1W2BA 2E2JH 2NVXH 1N33Q 1XNQQ 3M4OH 4WJ3M 4HJ8A 3U4ZA 5FLMG 4GOPC 1VQFA 4JYAQ 4LFCL 2BH2A 2OQKA 2R92G 3I4NH 1BBWA 1Q1EA 1U5KA 3UDGA 4A3IH 4YCUA 4JC0A 1ASYA 3EN2A 3U58A 5FJ8H 4A3LH 3K80C 4R4TA 5GAHC 4QJFA 5LMUQ 1EQRA 4R4QA 3CCVA 2ID0A 1EFWA 3CW2C 4YY3L 2UU9Q 3OYYA 2IX0A 4DR3Q 4C3HH 5E7NA 4X64L 3J81c 1HZCA 3GTLH 3UE1A 1I3QH 2Z6KC 1PH7A 3CCSA 3F2CA 4EQ5A 1NBWA 4A3GH 1VQ7A 4X6AH 3EBEA 3GTPH 2B63G 2AMCB 1G291 4DV7L 2JA8G 3LGJA 3CF5A 2JA9A 2IX1A 1O7IA 3I56A 4A93G 3PF5A 1V43A 2MQHA 2WAQG 1X3GA 3GTMH 2ZJRA 1JE5A 1BBUA 3M3YH 3HKZE 2F4VQ 4BBRG 1X56A 2CFMA 2JEBI 4DK6C 2R7DA 1A62A 4DV2L 2HT1A 3I55A 2PI2E 1L1OA 1RIPA 1Y1VH 4X66L 3CC4A 1NY4A 4IPGA 4NXNL 4HJ5A 2XTIA 3K8AA 2B3GA 4AQYL 1NE3A 4LFCQ 3I4OA 4IOCA 4DR4L 2LSSA 3PUYA 2MNAA 4JI3L 3HOVH 1PH3A 4Y52H 1CKOA 1YBYA 3I4MH 3AFQA 3UDFA 2D0OA 3A5ZB 4YY3Q 4A3EH 3HOWH 1LYLA 1YVCA 3PUVA 1K3RA 3F1ZA 4BY1G 4X64Q 3S24A 5M3MH 2VUMH 4C2MH 2WFWA 1WYDA 3TQYA 1E1TA 3J81i 4DV7Q 5ELNA 1HNWL 5C0XI 4OXPA 3TEHB 1PH5A 2PMZE 3J7A5 2EIFA 4KLKA 1XMQQ 4DV1L 3KLWA 4HIDA 2F3IA 3CD6A 3RZDH 1A0IA 3S1NH 3K0XA 4R4IA 4JI5L 2YU9H 4IFDI 4JOIC 5GADC 4B3RL 2WB1E 5IWAL 3I7FA 1OXUA 3ERSX 4DV2Q 3HOZH 2YV5A 4DR1L 1KRSA 3HOYG 1VQCA 4C3JH 4X66Q 5LMNW 1QVGA 2UUAL 2GVBA 4LWCA 3S16H 1CKNB 2R93H 4YWLA 1NMGA 5M3FG 1E1OA 2KCMA 1VQMA 1L0WA 5DLQE 4NXNQ 4POGA 1JJGA 1VQHA 1HR0L 1UE6A 1CSPA 4AQYQ 5GQOA 2R7FA 1AE2A 3CCQA 2I5LX 4DR4Q 3GTOH 2YTXA 1Q81C 4AH6A 4A75A 1IBML 2VY3A 2OWOA 4JI3Q 2IT1A 3KFUA 1X3EA 3M4PA 3J80c 4DUZL 1VS0A 2AKWB 4PMWA 5JEAG 2ZM6L 4RMFA 4A3FH 4JI0L 4DV0L 1L2FA 3A5UA 3HOUH 2JA5G 4A3DG 3KJPA 1NTGA 5IP9G 1HZAA 3U50C 3U4VA 4BY7G 4A3CG 2UXBL 3BJUA 3I2ZA 4HJAA 1OXTA 1VQGA 5IYDH 1PFSA 4B3TL 4MTNA 4ME3A 1IBLL 2UUCL 1QUQA 3L7ZC 4H02A 2PNHA 3KYHC 4PZ7A 1HNWQ 4DV4L 4JI7L 1D7QA 2E2IH 4MZ9A 1JJCB 3CCRA 3AEVA 3PF4A 4IPDA 4NXML 2R7ZH 2E8GA 2AWOA 4DV1Q 1D8LA 3H0GH 2LXJA 1VQBA 1DGSA 2KBNA 4JI2L 1MJEA 4JI5Q 2KENA 1UE1A 5C44H 4L5RC 5C0XG 3PO2H 4OWTB 4LF5L 4B3RQ 1CKMA 5IWAQ 4OO1G 1KC8C 4LUZA 3PV0A 4BBSH 4DR1Q 1X6OA 4TQUS 1XTDA 1Q1BA 2UUAQ 1PVOA 2KHJA 4IFDG 1L1OB 1HR0Q 1EIFA 3K7UC 4P75A 2R6GA 3CPFA 3EIVA 4AIMA 2VW9A 3ZJYC 1I6HH 1SROA 1IBMQ 3NENA 5IYCH 1QVCA 5C4JH 3WWVA 4DUZQ 2NZHA 4R1JA 5IP7G 2ZM6Q 2ES2A 1YJWA 4P72A 4DV0Q 4JI0Q 1FL0A 4KHPL 4A3MG 3J80i 3FHWA 4QL5A 3CCMA 2UXBQ 1HZBA 2YTVA 4KHZA 1HNZL 2Q2TA 1OXXK 1Q12A 3M4QA 4IOAA 3FKIG 1Q46A 3JAMc 4DV3L 1XMOL 3GD7A 2Q2UA 1PV4A 4B3ML 4UP8A 1WI5A 4YCVA 3T1HL 1VQOA 1IBLQ 2UUCQ 1FJGL 2Z6KA 1G51A 4DR6L 2I5MX 2QEXA 1PA6A 2N78A 5JJLA 2OTJA 1Z9FA 4DV4Q 1IL2A 1Q86C 5GROA 4JI7Q 3TS0A 2NVQH 3GDEA 2K50A 4NXMQ 1LM0A 1WOCA 3KOJA 3HOXG 4BXXG 4A3BG 4JI2Q 2HQLA 4GS3A 1WCMG 2N8NA 4GNXC 2K5VA 1KXLA 2JA7G 4AYBG 1V1QA 1Z47A 4LF5Q 1CUKA 1TWFH 2A1AA 3CXCA 1X65A 3M85A 2CKZB 4ALPA 2QA4A 1Q7YC 3BU2A 4IPHA 2ZJPA 4O2DA 1S72A 1U0LA 2C35B 1K73C 4LF4L 4JV5L 1KAWA 2I0QA 4UY8C 5FLMH 5C4XG 4JBKA 3ULJA 4DV6L 3PIOA 5JJKA 1Q82C 1JJ2A 4HIOA 2R92H 5IY0A 1SE8A 2BH8A 2VL6A 2E5LL 4A4IA 3RN5A 1VQAA 3KF8B 1E3PA 2Y0SE 3PUXA 4YHHL 3K7AH 3HFZB 3DLLA 1PH2A 1TWGH 1S3OA 3L0OA 1EWIA 2VQFL 2IHFA 1J5EL 2UXCL 3UDXA 2JQOA 1IYJB 3AYHB 4XIGS 3RR5A 3W1BA 4GKJL 5C3EG 4KHPQ 1TXYA 3CQZH 3STBD 4A3KG 2Z0SA 2UXDL 1HNZQ 1Y1WG 2HHHL 2HIVA 4GLVB 2KCTA 4UP7A 3ULLA 1QZGA 4DV3Q 4B3MQ 4Y7NH 1XMOQ 2B63H 1FJGQ 4LUOA 2JA8H 3T1HQ 3RZOH 4P74A 3SGIA 4DR6Q 2PQAB 1W3SA 4A93H 1SFOH 5BR8L 4BA2I 1K0RA 3JAMi 3TRZA 3S17H 1QUQB 3OTOL 3F2BA 3CCJA 1V9PA 4BBRH 1N9WA 3J7ZC 1C7YA 5LMNL 1VQ9A 1UWVA 1PYSB 2F52A 3W1GA 3BZKA 1FVIA 2AHOB 4JOIA 4YWMA 4DUYL 3RLOA 3PCOB 3RLNA 5FLXc 4LW1A 1E24A 1AE3A 4JV5Q 2BA0A 4P73A 4LF4Q 4NB3A 1KIXA 5IYBG 1PH6A 1B70B 3M9BA 3STBC 2NN6I 1EUJA 2NVYH 1SLJA 4DV6Q 4JG2A 2K14A 1X3FA 4JI1L 2Q2IA 3ICEA 1RL2A 2E5LQ 3ULPA 4GN5A 1TWCH 2ZTEA 4IO9A 4YHHQ 1PH9A 3G4SA 1NMFA 4DAYB 2JEAI 2VQFQ 2N3SA 3KDFA 1LTLA 1J5EQ 4LF8L 4LFAL 1XNRL 4GKJQ 2UXCQ 4A76A 3T1YL 4HJ9A 3UDIA 1PYBA 1K83H 5M5WH 1QZHA 4BY1H 2RHSB 4PZ8A 4JI8L 4B3SL 2ATWA 2JA6G 4O0AA 2UXDQ 4LF7L 2HHHQ 4XTCS 2VQEL 2DGYA 1K8AC 3H15A 4DAMA 4X65L 1N32L 2XGTA 1N34L 4X62L 5BR8Q 1N33L 2ZTDA 3GTKH 1M1KC 1OXVA 3FP9A 2MFIA 1VQ5A 3ER0A 1FGUA 5M5XH 1SMXA 3OTOQ 1YITA 1N8RC 3S2DH 1X54A 2RHQB 3KF6A 2NZOA 5LMNQ 4L5SA 1XJVA 2WB1G 4HIKA 2V1CC 2B29A 4A3IG 1HR0W 3HOYH 4DUYQ 3D0FA 5IYBH 1H95A 1CSQA 5M3FH 5FJ8G 4A3LG 2L15A 1YI2A 4BA1I 1YJNA 1VQPA 2N49A 1OTCA 4QY7A 4DR5L 1KD1C 2OTLA 4DKAC 4LF6L 3E0EA 4JI1Q 1M90C 1YHAA 1VQLA 4GLAC 3S15H 2GVAA 4C3IH 3CCLA 3PUWA 4GOPA 4A3GG 1YIJA 4LFAQ 4LF8Q 2WP8J 4OO1I 2JA5H 3CCUA 1XNRQ 4A3DH 1XPRA 5K36G 4DR2L 2PI2A 1J6QA 4P71A 5IP9H 2WAQE 1YHQA 1I94L 4BY7H 4A3CH 3MEFA 4JI8Q 1TWAH 5H1SE 4B3SQ 1X9NA 1KRTA 3TS2A 4LF7Q 3M7NA 2MO0A 2VQEQ 2LXKA 1IBKL 2FXQA 1K9MC 1Q8KA 1AH9A 4X65Q 2NVTH 1EQQA 4GKKL 1UE5A 4IJHA 4OONA 2VS1A 1S40A 4LF9L 1N34Q 4X62Q 1N32Q 4APVA 1HH2P 4UPAA 2Q2HA 4OWWB 4YWKA 3H3VH 3PSIA 3G48A 3S14H 4QIWE 2VZAA 1Y1VG 4RG1A 3G71A 2JE6I 4QGUA 4QQBX 1JB7A 3AQQA 1KQSA 3RN2A 3RNUA 2E2HH 1KHIA 1Y14B 5JJIA 1GO3E 4DR7L 4PG3A 4GNXA 3HOVG 1GKHA 4J15A 3JC66 1EYGA 1T9HA 3CC2A 4GN4B 3GTQH 3I4MG 3BZCA 4EX5A 3CMEA 2K5HA 4IPCA 1HNXL 3PIPA 4DK3C 3UE0A 3HOWG 4IJLA 4DNIA 4DR5Q 4HJ7A 4JBJA 4A3EG 4LF6Q 2K5NA 5GAGC 5M3MG 1SR3A 1EIYB 1VQJA 1MKHA 4JBWA 3KJOA 2DUDA 5IP7H 1IZ6A 5AJ3L 4K0KL 1XMQL 4A3MH 1YJ9A 3PUZA 4JCVE 4DR2Q 1I94Q 2ASBA 1EOVA 3A74A 3KDFB 1YEZA 1C9OA 1B8AA 4LFBL 2VNUD 3FKIH 1R9TH 1IBKQ 5EAYA 3AFPA 1WJJA 1GD7A 4YCWA 1L1OC 2EQSA 2CWAA 1PH4A 4GKKQ 3K81C 4A3JG 1PHJA 4LF9Q 1VCIA 3GO5A 3W5OA 3HOZG 2OCEA 2ALYB 2D0PA 2IY5B 1IXRA 2YTYA 4OX9L 3S1QH 1B7YB 4BXXH 3HOXH 2R93G 4A3BH 4UP9A 1WCMH 2OQ0A 2BA1A 3HKZG 2K75A 2JA7H 4R4CA 3I4NG 1OXSC 4JI6L 4R4OA 4DR7Q 4LNQA 3KF6B 4JBMA 3NELA 4GLXA 3CC7A 1HZ9A 2A19A 4LUVA 1HJPA 5C4XH 1GM5A 2H5XA 4A3FG 1XPUA 3RLFA 3HOUG 1HNXQ 1BKBA 1KL9A 2I5HA 2RCNA 3H3VI 2KHIA 4DV5L 3CCEA 1A8VA 3S1RH 2JK8A 2Y0SG 1N36L 5IYDG 5HGQA 2ZJQA 3NBHB 1X55A 3PO3G 2YYZA 5J3BA 3G6EA 1UEBA 1ASZA 1GVPA 1WFQA 5AJ3Q 5C3EH 3OW2A 1VQ4A 1NJIC 4K0KQ 4A3KH 1QVFA 4JI4L 4GOPB 2UUBL 3IRBA 3A0JA 3D31A 1Y1WH 5HY6A 2R7ZG 4LFBQ 1VQIA 3NEMA 1YNXA 3H0GG 4TVAB 1YZ6A 4A3JH 4FDBA 1VQDA 2K52A 4NPSA 5C44G 1XPOA 1UE7A 3PO2G 2JJQA 2ZTCA 3B6YA 1G6PA 5JEAJ 1I50H 4BBSG 4B3TQ 1XNQL 1TWHH 4POFA 4OX9Q 3E9HA 1SN8A 2AWNA 2A8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ H;  3GTG H;  4JYA L;  1JT8 A;  1I5F A;  1JMC A;  4JI6 Q;  3Q8D A;  2HIX A;  5M5Y H;  1MIU A;  4WJ4 A;  3CAM A;  3S1M H;  5IYC G;  1P8L A;  3F8T A;  5LMU L;  2CQO A;  4GN3 B;  4HIM A;  3L2P A;  3CPW A;  1E22 A;  4GNX B;  3HKS A;  1VQ8 A;  2UU9 L;  2K4K A;  1VQ6 A;  3PGZ A;  1VQK A;  2PQA A;  4DR3 L;  4DV5 Q;  4L5Q A;  2EXD A;  1K8G A;  2MO1 A;  2CCZ A;  3PO3 H;  1SRU A;  1LUZ A;  3TRE A;  1VQN A;  1YHB A;  1N36 Q;  5C0X J;  3E9I A;  1PH1 A;  1MJC A;  1VQE A;  5IE8 A;  2VUM G;  5IT9 c;  1C0A A;  3VDY A;  5GAE C;  3DM3 A;  1P16 A;  2RF4 A;  3MXN B;  1BVS A;  4L5T A;  4JI4 Q;  2UUB Q;  2JA6 H;  1E7Z A;  2NN6 G;  3T1Y Q;  4IFD J;  1PH8 A;  3J81 j;  2F4V L;  5ELO A;  2D62 A;  4KI0 A;  3CP0 A;  4AYB E;  3CMA A;  2CWP A;  3F2D A;  1CKN A;  4PZ6 A;  4MNO A;  2GN5 A;  2IHE A;  3S2H H;  1A63 A;  4OWX B;  2QGQ A;  4DPG A;  1W2B A;  2E2J H;  2NVX H;  1N33 Q;  1XNQ Q;  3M4O H;  4WJ3 M;  4HJ8 A;  3U4Z A;  5FLM G;  4GOP C;  1VQF A;  4JYA Q;  4LFC L;  2BH2 A;  2OQK A;  2R92 G;  3I4N H;  1BBW A;  1Q1E A;  1U5K A;  3UDG A;  4A3I H;  4YCU A;  4JC0 A;  1ASY A;  3EN2 A;  3U58 A;  5FJ8 H;  4A3L H;  3K80 C;  4R4T A;  5GAH C;  4QJF A;  5LMU Q;  1EQR A;  4R4Q A;  3CCV A;  2ID0 A;  1EFW A;  3CW2 C;  4YY3 L;  2UU9 Q;  3OYY A;  2IX0 A;  4DR3 Q;  4C3H H;  5E7N A;  4X64 L;  3J81 c;  1HZC A;  3GTL H;  3UE1 A;  1I3Q H;  2Z6K C;  1PH7 A;  3CCS A;  3F2C A;  4EQ5 A;  1NBW A;  4A3G H;  1VQ7 A;  4X6A H;  3EBE A;  3GTP H;  2B63 G;  2AMC B;  1G29 1;  4DV7 L;  2JA8 G;  3LGJ A;  3CF5 A;  2JA9 A;  2IX1 A;  1O7I A;  3I56 A;  4A93 G;  3PF5 A;  1V43 A;  2MQH A;  2WAQ G;  1X3G A;  3GTM H;  2ZJR A;  1JE5 A;  1BBU A;  3M3Y H;  3HKZ E;  2F4V Q;  4BBR G;  1X56 A;  2CFM A;  2JEB I;  4DK6 C;  2R7D A;  1A62 A;  4DV2 L;  2HT1 A;  3I55 A;  2PI2 E;  1L1O A;  1RIP A;  1Y1V H;  4X66 L;  3CC4 A;  1NY4 A;  4IPG A;  4NXN L;  4HJ5 A;  2XTI A;  3K8A A;  2B3G A;  4AQY L;  1NE3 A;  4LFC Q;  3I4O A;  4IOC A;  4DR4 L;  2LSS A;  3PUY A;  2MNA A;  4JI3 L;  3HOV H;  1PH3 A;  4Y52 H;  1CKO A;  1YBY A;  3I4M H;  3AFQ A;  3UDF A;  2D0O A;  3A5Z B;  4YY3 Q;  4A3E H;  3HOW H;  1LYL A;  1YVC A;  3PUV A;  1K3R A;  3F1Z A;  4BY1 G;  4X64 Q;  3S24 A;  5M3M H;  2VUM H;  4C2M H;  2WFW A;  1WYD A;  3TQY A;  1E1T A;  3J81 i;  4DV7 Q;  5ELN A;  1HNW L;  5C0X I;  4OXP A;  3TEH B;  1PH5 A;  2PMZ E;  3J7A 5;  2EIF A;  4KLK A;  1XMQ Q;  4DV1 L;  3KLW A;  4HID A;  2F3I A;  3CD6 A;  3RZD H;  1A0I A;  3S1N H;  3K0X A;  4R4I A;  4JI5 L;  2YU9 H;  4IFD I;  4JOI C;  5GAD C;  4B3R L;  2WB1 E;  5IWA L;  3I7F A;  1OXU A;  3ERS X;  4DV2 Q;  3HOZ H;  2YV5 A;  4DR1 L;  1KRS A;  3HOY G;  1VQC A;  4C3J H;  4X66 Q;  5LMN W;  1QVG A;  2UUA L;  2GVB A;  4LWC A;  3S16 H;  1CKN B;  2R93 H;  4YWL A;  1NMG A;  5M3F G;  1E1O A;  2KCM A;  1VQM A;  1L0W A;  5DLQ E;  4NXN Q;  4POG A;  1JJG A;  1VQH A;  1HR0 L;  1UE6 A;  1CSP A;  4AQY Q;  5GQO A;  2R7F A;  1AE2 A;  3CCQ A;  2I5L X;  4DR4 Q;  3GTO H;  2YTX A;  1Q81 C;  4AH6 A;  4A75 A;  1IBM L;  2VY3 A;  2OWO A;  4JI3 Q;  2IT1 A;  3KFU A;  1X3E A;  3M4P A;  3J80 c;  4DUZ L;  1VS0 A;  2AKW B;  4PMW A;  5JEA G;  2ZM6 L;  4RMF A;  4A3F H;  4JI0 L;  4DV0 L;  1L2F A;  3A5U A;  3HOU H;  2JA5 G;  4A3D G;  3KJP A;  1NTG A;  5IP9 G;  1HZA A;  3U50 C;  3U4V A;  4BY7 G;  4A3C G;  2UXB L;  3BJU A;  3I2Z A;  4HJA A;  1OXT A;  1VQG A;  5IYD H;  1PFS A;  4B3T L;  4MTN A;  4ME3 A;  1IBL L;  2UUC L;  1QUQ A;  3L7Z C;  4H02 A;  2PNH A;  3KYH C;  4PZ7 A;  1HNW Q;  4DV4 L;  4JI7 L;  1D7Q A;  2E2I H;  4MZ9 A;  1JJC B;  3CCR A;  3AEV A;  3PF4 A;  4IPD A;  4NXM L;  2R7Z H;  2E8G A;  2AWO A;  4DV1 Q;  1D8L A;  3H0G H;  2LXJ A;  1VQB A;  1DGS A;  2KBN A;  4JI2 L;  1MJE A;  4JI5 Q;  2KEN A;  1UE1 A;  5C44 H;  4L5R C;  5C0X G;  3PO2 H;  4OWT B;  4LF5 L;  4B3R Q;  1CKM A;  5IWA Q;  4OO1 G;  1KC8 C;  4LUZ A;  3PV0 A;  4BBS H;  4DR1 Q;  1X6O A;  4TQU S;  1XTD A;  1Q1B A;  2UUA Q;  1PVO A;  2KHJ A;  4IFD G;  1L1O B;  1HR0 Q;  1EIF A;  3K7U C;  4P75 A;  2R6G A;  3CPF A;  3EIV A;  4AIM A;  2VW9 A;  3ZJY C;  1I6H H;  1SRO A;  1IBM Q;  3NEN A;  5IYC H;  1QVC A;  5C4J H;  3WWV A;  4DUZ Q;  2NZH A;  4R1J A;  5IP7 G;  2ZM6 Q;  2ES2 A;  1YJW A;  4P72 A;  4DV0 Q;  4JI0 Q;  1FL0 A;  4KHP L;  4A3M G;  3J80 i;  3FHW A;  4QL5 A;  3CCM A;  2UXB Q;  1HZB A;  2YTV A;  4KHZ A;  1HNZ L;  2Q2T A;  1OXX K;  1Q12 A;  3M4Q A;  4IOA A;  3FKI G;  1Q46 A;  3JAM c;  4DV3 L;  1XMO L;  3GD7 A;  2Q2U A;  1PV4 A;  4B3M L;  4UP8 A;  1WI5 A;  4YCV A;  3T1H L;  1VQO A;  1IBL Q;  2UUC Q;  1FJG L;  2Z6K A;  1G51 A;  4DR6 L;  2I5M X;  2QEX A;  1PA6 A;  2N78 A;  5JJL A;  2OTJ A;  1Z9F A;  4DV4 Q;  1IL2 A;  1Q86 C;  5GRO A;  4JI7 Q;  3TS0 A;  2NVQ H;  3GDE A;  2K50 A;  4NXM Q;  1LM0 A;  1WOC A;  3KOJ A;  3HOX G;  4BXX G;  4A3B G;  4JI2 Q;  2HQL A;  4GS3 A;  1WCM G;  2N8N A;  4GNX C;  2K5V A;  1KXL A;  2JA7 G;  4AYB G;  1V1Q A;  1Z47 A;  4LF5 Q;  1CUK A;  1TWF H;  2A1A A;  3CXC A;  1X65 A;  3M85 A;  2CKZ B;  4ALP A;  2QA4 A;  1Q7Y C;  3BU2 A;  4IPH A;  2ZJP A;  4O2D A;  1S72 A;  1U0L A;  2C35 B;  1K73 C;  4LF4 L;  4JV5 L;  1KAW A;  2I0Q A;  4UY8 C;  5FLM H;  5C4X G;  4JBK A;  3ULJ A;  4DV6 L;  3PIO A;  5JJK A;  1Q82 C;  1JJ2 A;  4HIO A;  2R92 H;  5IY0 A;  1SE8 A;  2BH8 A;  2VL6 A;  2E5L L;  4A4I A;  3RN5 A;  1VQA A;  3KF8 B;  1E3P A;  2Y0S E;  3PUX A;  4YHH L;  3K7A H;  3HFZ B;  3DLL A;  1PH2 A;  1TWG H;  1S3O A;  3L0O A;  1EWI A;  2VQF L;  2IHF A;  1J5E L;  2UXC L;  3UDX A;  2JQO A;  1IYJ B;  3AYH B;  4XIG S;  3RR5 A;  3W1B A;  4GKJ L;  5C3E G;  4KHP Q;  1TXY A;  3CQZ H;  3STB D;  4A3K G;  2Z0S A;  2UXD L;  1HNZ Q;  1Y1W G;  2HHH L;  2HIV A;  4GLV B;  2KCT A;  4UP7 A;  3ULL A;  1QZG A;  4DV3 Q;  4B3M Q;  4Y7N H;  1XMO Q;  2B63 H;  1FJG Q;  4LUO A;  2JA8 H;  3T1H Q;  3RZO H;  4P74 A;  3SGI A;  4DR6 Q;  2PQA B;  1W3S A;  4A93 H;  1SFO H;  5BR8 L;  4BA2 I;  1K0R A;  3JAM i;  3TRZ A;  3S17 H;  1QUQ B;  3OTO L;  3F2B A;  3CCJ A;  1V9P A;  4BBR H;  1N9W A;  3J7Z C;  1C7Y A;  5LMN L;  1VQ9 A;  1UWV A;  1PYS B;  2F52 A;  3W1G A;  3BZK A;  1FVI A;  2AHO B;  4JOI A;  4YWM A;  4DUY L;  3RLO A;  3PCO B;  3RLN A;  5FLX c;  4LW1 A;  1E24 A;  1AE3 A;  4JV5 Q;  2BA0 A;  4P73 A;  4LF4 Q;  4NB3 A;  1KIX A;  5IYB G;  1PH6 A;  1B70 B;  3M9B A;  3STB C;  2NN6 I;  1EUJ A;  2NVY H;  1SLJ A;  4DV6 Q;  4JG2 A;  2K14 A;  1X3F A;  4JI1 L;  2Q2I A;  3ICE A;  1RL2 A;  2E5L Q;  3ULP A;  4GN5 A;  1TWC H;  2ZTE A;  4IO9 A;  4YHH Q;  1PH9 A;  3G4S A;  1NMF A;  4DAY B;  2JEA I;  2VQF Q;  2N3S A;  3KDF A;  1LTL A;  1J5E Q;  4LF8 L;  4LFA L;  1XNR L;  4GKJ Q;  2UXC Q;  4A76 A;  3T1Y L;  4HJ9 A;  3UDI A;  1PYB A;  1K83 H;  5M5W H;  1QZH A;  4BY1 H;  2RHS B;  4PZ8 A;  4JI8 L;  4B3S L;  2ATW A;  2JA6 G;  4O0A A;  2UXD Q;  4LF7 L;  2HHH Q;  4XTC S;  2VQE L;  2DGY A;  1K8A C;  3H15 A;  4DAM A;  4X65 L;  1N32 L;  2XGT A;  1N34 L;  4X62 L;  5BR8 Q;  1N33 L;  2ZTD A;  3GTK H;  1M1K C;  1OXV A;  3FP9 A;  2MFI A;  1VQ5 A;  3ER0 A;  1FGU A;  5M5X H;  1SMX A;  3OTO Q;  1YIT A;  1N8R C;  3S2D H;  1X54 A;  2RHQ B;  3KF6 A;  2NZO A;  5LMN Q;  4L5S A;  1XJV A;  2WB1 G;  4HIK A;  2V1C C;  2B29 A;  4A3I G;  1HR0 W;  3HOY H;  4DUY Q;  3D0F A;  5IYB H;  1H95 A;  1CSQ A;  5M3F H;  5FJ8 G;  4A3L G;  2L15 A;  1YI2 A;  4BA1 I;  1YJN A;  1VQP A;  2N49 A;  1OTC A;  4QY7 A;  4DR5 L;  1KD1 C;  2OTL A;  4DKA C;  4LF6 L;  3E0E A;  4JI1 Q;  1M90 C;  1YHA A;  1VQL A;  4GLA C;  3S15 H;  2GVA A;  4C3I H;  3CCL A;  3PUW A;  4GOP A;  4A3G G;  1YIJ A;  4LFA Q;  4LF8 Q;  2WP8 J;  4OO1 I;  2JA5 H;  3CCU A;  1XNR Q;  4A3D H;  1XPR A;  5K36 G;  4DR2 L;  2PI2 A;  1J6Q A;  4P71 A;  5IP9 H;  2WAQ E;  1YHQ A;  1I94 L;  4BY7 H;  4A3C H;  3MEF A;  4JI8 Q;  1TWA H;  5H1S E;  4B3S Q;  1X9N A;  1KRT A;  3TS2 A;  4LF7 Q;  3M7N A;  2MO0 A;  2VQE Q;  2LXK A;  1IBK L;  2FXQ A;  1K9M C;  1Q8K A;  1AH9 A;  4X65 Q;  2NVT H;  1EQQ A;  4GKK L;  1UE5 A;  4IJH A;  4OON A;  2VS1 A;  1S40 A;  4LF9 L;  1N34 Q;  4X62 Q;  1N32 Q;  4APV A;  1HH2 P;  4UPA A;  2Q2H A;  4OWW B;  4YWK A;  3H3V H;  3PSI A;  3G48 A;  3S14 H;  4QIW E;  2VZA A;  1Y1V G;  4RG1 A;  3G71 A;  2JE6 I;  4QGU A;  4QQB X;  1JB7 A;  3AQQ A;  1KQS A;  3RN2 A;  3RNU A;  2E2H H;  1KHI A;  1Y14 B;  5JJI A;  1GO3 E;  4DR7 L;  4PG3 A;  4GNX A;  3HOV G;  1GKH A;  4J15 A;  3JC6 6;  1EYG A;  1T9H A;  3CC2 A;  4GN4 B;  3GTQ H;  3I4M G;  3BZC A;  4EX5 A;  3CME A;  2K5H A;  4IPC A;  1HNX L;  3PIP A;  4DK3 C;  3UE0 A;  3HOW G;  4IJL A;  4DNI A;  4DR5 Q;  4HJ7 A;  4JBJ A;  4A3E G;  4LF6 Q;  2K5N A;  5GAG C;  5M3M G;  1SR3 A;  1EIY B;  1VQJ A;  1MKH A;  4JBW A;  3KJO A;  2DUD A;  5IP7 H;  1IZ6 A;  5AJ3 L;  4K0K L;  1XMQ L;  4A3M H;  1YJ9 A;  3PUZ A;  4JCV E;  4DR2 Q;  1I94 Q;  2ASB A;  1EOV A;  3A74 A;  3KDF B;  1YEZ A;  1C9O A;  1B8A A;  4LFB L;  2VNU D;  3FKI H;  1R9T H;  1IBK Q;  5EAY A;  3AFP A;  1WJJ A;  1GD7 A;  4YCW A;  1L1O C;  2EQS A;  2CWA A;  1PH4 A;  4GKK Q;  3K81 C;  4A3J G;  1PHJ A;  4LF9 Q;  1VCI A;  3GO5 A;  3W5O A;  3HOZ G;  2OCE A;  2ALY B;  2D0P A;  2IY5 B;  1IXR A;  2YTY A;  4OX9 L;  3S1Q H;  1B7Y B;  4BXX H;  3HOX H;  2R93 G;  4A3B H;  4UP9 A;  1WCM H;  2OQ0 A;  2BA1 A;  3HKZ G;  2K75 A;  2JA7 H;  4R4C A;  3I4N G;  1OXS C;  4JI6 L;  4R4O A;  4DR7 Q;  4LNQ A;  3KF6 B;  4JBM A;  3NEL A;  4GLX A;  3CC7 A;  1HZ9 A;  2A19 A;  4LUV A;  1HJP A;  5C4X H;  1GM5 A;  2H5X A;  4A3F G;  1XPU A;  3RLF A;  3HOU G;  1HNX Q;  1BKB A;  1KL9 A;  2I5H A;  2RCN A;  3H3V I;  2KHI A;  4DV5 L;  3CCE A;  1A8V A;  3S1R H;  2JK8 A;  2Y0S G;  1N36 L;  5IYD G;  5HGQ A;  2ZJQ A;  3NBH B;  1X55 A;  3PO3 G;  2YYZ A;  5J3B A;  3G6E A;  1UEB A;  1ASZ A;  1GVP A;  1WFQ A;  5AJ3 Q;  5C3E H;  3OW2 A;  1VQ4 A;  1NJI C;  4K0K Q;  4A3K H;  1QVF A;  4JI4 L;  4GOP B;  2UUB L;  3IRB A;  3A0J A;  3D31 A;  1Y1W H;  5HY6 A;  2R7Z G;  4LFB Q;  1VQI A;  3NEM A;  1YNX A;  3H0G G;  4TVA B;  1YZ6 A;  4A3J H;  4FDB A;  1VQD A;  2K52 A;  4NPS A;  5C44 G;  1XPO A;  1UE7 A;  3PO2 G;  2JJQ A;  2ZTC A;  3B6Y A;  1G6P A;  5JEA J;  1I50 H;  4BBS G;  4B3T Q;  1XNQ L;  1TWH H;  4POF A;  4OX9 Q;  3E9H A;  1SN8 A;  2AWN A;  2A8V A; 
#chains in the Genus database with same CATH topology
 2XN9 C;  2C9O A;  4K8J A;  4HMI A;  3BYT B;  3F8T A;  3N52 A;  5LMU L;  5HUR A;  1ICW A;  4GN3 B;  1G2T A;  4HIM A;  1Z7T A;  3HKS A;  2UU9 L;  1I4Q A;  1VQK A;  4UDU C;  2CCZ A;  3DWA A;  2O2L D;  1CZG A;  1LUZ A;  1VQN A;  1N36 Q;  1R4P B;  3NHH A;  2E2J B;  3M4O B;  3C2P A;  1P16 A;  3MXN B;  1BVS A;  2HDM A;  2WB1 B;  2UUB Q;  3NPP A;  4IFD J;  2KOL A;  4A3I B;  4DAP A;  5JAV A;  1GOZ A;  1TII D;  3F2D A;  2CWP A;  1A63 A;  4O42 A;  1W2B A;  4WJ3 M;  2NVX H;  3GTL B;  3FVQ A;  2BOS A;  4XDX A;  4GOP C;  3GTP B;  4LFC L;  2R92 G;  5L37 A;  1U5K A;  1PFM A;  1EY0 A;  4YCU A;  1VF5 C;  2GA4 B;  3GTM B;  5FJ8 H;  1JWU D;  5LMU Q;  3CCV A;  5EQ0 A;  5IGC A;  3CW2 C;  2UU9 Q;  4DXG A;  4C1N I;  5A35 A;  4C3H H;  5E7N A;  4X64 L;  1HZC A;  1F9Q A;  1BDO A;  1VQ7 A;  4X6A H;  1Y1V B;  1PTO F;  2AMC B;  4KN7 C;  2EJM A;  4ODG A;  1O7I A;  4A93 G;  1V43 A;  1F9R A;  1BBU A;  3MEH A;  3M3Y H;  3HOV B;  2AQ1 B;  4JK1 C;  3TP6 A;  3KLS A;  4JPB W;  2IWH A;  3I55 A;  1RIP A;  2B63 B;  1NY4 A;  1YNN C;  4HN7 A;  1SFO B;  2B3G A;  4AQY L;  1NE3 A;  1PRT B;  4LFC Q;  3HGB A;  1B9N A;  5EPK A;  4BWG B;  1U9R A;  5CV6 A;  2F4I A;  4Y52 H;  1CKO A;  1YBY A;  2B2U C;  4G4K A;  1A2U A;  4A3E H;  1LYL A;  3F1Z A;  4BY1 G;  4X64 Q;  4CDD C;  2FIN B;  4CGY B;  4KD3 A;  1ENF A;  1WYD A;  1ZXT A;  3S16 B;  4C3J B;  2RSO A;  2R93 B;  3MA2 B;  1HNW L;  5C0X I;  5ELB A;  3J7A 5;  2EIF A;  3FMC A;  4HID A;  4RKL A;  1KLG D;  2F3I A;  3CD6 A;  2J0T D;  1A0I A;  1PZI D;  4JI5 L;  1H9M A;  4A3F B;  5CV5 A;  1NCV A;  1OXU A;  4NDX A;  4DGZ A;  2M2L A;  3ERQ A;  2UUA L;  3IFT A;  3KF8 A;  1RTO A;  2L5T A;  1SMY D;  4G7H C;  1VQM A;  4Q5V A;  1HR0 L;  4AQY Q;  5I9P A;  3GTO H;  1RTN A;  4RHS A;  1IKM A;  1KNA A;  2E2I B;  3V96 A;  1X3E A;  1K0S A;  2XSC A;  4JI0 L;  3MFY A;  1ONL A;  3DM1 A;  3KJP A;  1NTG A;  4A3C G;  3BJU A;  5IYD H;  2Z9H A;  4MTN A;  5LL6 S;  4ME3 A;  3K59 A;  2EXZ A;  1HNW Q;  4DV4 L;  1D7Q A;  1A3V A;  5KNB A;  2D9U A;  1JCK B;  1VQB A;  2K7V A;  1MJE A;  1CK1 A;  4JI5 Q;  1CKM A;  3I72 A;  1XTD A;  1A15 A;  1Q1B A;  4OIK A;  2UUA Q;  3D6W A;  2KHJ A;  2RBM A;  3I8Z A;  1HR0 Q;  4AIM A;  2R6G A;  3EIV A;  2BDN A;  3TP7 A;  3ZJY C;  5CC4 A;  3NEN A;  5IYC H;  2NZ1 D;  2F0F A;  1J9O A;  4JI0 Q;  4P72 A;  4KHP L;  3J80 i;  2YTV A;  1A3U A;  3OMC A;  1HNZ L;  1OXX K;  3M4Q A;  1TWF B;  2NUC A;  4DV3 L;  1PV4 A;  1FJG L;  1QNK A;  4J6H A;  1PA6 A;  1WTH A;  4DV4 Q;  1DXM A;  2NN6 H;  2R92 B;  3TS0 A;  3H09 A;  5ELD A;  3KOJ A;  2JP1 A;  1JOR A;  1STG A;  3P7J A;  1BCP B;  1KXL A;  2JA7 G;  4PV1 C;  3MXP A;  5IGB A;  1QWY A;  1CUK A;  1CZW A;  2PZW A;  4IUT A;  1GHJ A;  4IPH A;  3IKJ A;  1U0L A;  2C35 B;  4XQN A;  3SK8 A;  1X3P A;  4JBK A;  3X3N A;  3I90 A;  4Y7N B;  5JJK A;  5IY0 A;  1SE8 A;  2MJ8 A;  4A93 B;  4A4I A;  3RN5 A;  1E3P A;  2KEE A;  2K33 A;  4CDF C;  3L0O A;  2OXP A;  3UDX A;  1IYJ B;  3RR5 A;  3W1B A;  1B9M A;  1E2V A;  3K57 A;  4KHP Q;  2DJG C;  1TXY A;  3CQZ H;  1RDP D;  3DWP A;  4A3K G;  2B2U A;  3VR6 A;  1H9S A;  3J81 L;  1HNZ Q;  3UI2 A;  2HIV A;  4UP7 A;  1AFP A;  4DV3 Q;  3ND9 A;  2B63 H;  1BCP D;  1FJG Q;  4X3K A;  2JA8 H;  3RZO H;  1EEI D;  4ZRZ A;  1HFG A;  1SFO H;  3K5M A;  4BA2 I;  5D14 A;  3JAM i;  1Y8N B;  1XTC D;  3SK6 A;  4WJW A;  2K01 A;  2XIW A;  3W1G A;  5I4D A;  3BZK A;  1JE4 A;  4YWM A;  3VR5 A;  4BY1 B;  3RLN A;  5FLX c;  3VR2 A;  1E24 A;  1SNM A;  2XRS D;  3PMF A;  1WVL A;  1PH6 A;  3T56 B;  4ALP A;  1JT8 A;  1SLJ A;  1BQQ T;  2Q2I A;  2EJF C;  1AN8 A;  4IO9 A;  3G4S A;  3KDF A;  4FP5 D;  5A2Q L;  4K8I A;  4A76 A;  3T1Y L;  4HJ9 A;  5ISR A;  1PYB A;  1K83 H;  4PZ8 A;  4X3T A;  2ATW A;  5G3L F;  4XT3 B;  5DEH A;  3MVV A;  3BVG A;  4X62 L;  2EVB A;  1OXV A;  3Q0A A;  3ER0 A;  1N8R C;  4FYD A;  1X54 A;  2RHQ B;  1BUV T;  4L5S A;  1XJV A;  3CRL C;  3T51 B;  4G57 A;  2L9H A;  1ZYR D;  4CKC A;  4DNT B;  5IYB H;  1FGB D;  1CSQ A;  2MHV A;  2IX3 A;  5FJ8 G;  5M3F H;  1TS5 A;  1YI2 A;  3EFX D;  1YJN A;  1LTT D;  4QY7 A;  2OTL A;  2NVT B;  1M90 C;  1YHA A;  3D4W A;  1HTP A;  1QG7 A;  4C3H G;  3E3X A;  3S15 H;  4C3I H;  3E0J A;  1ET6 A;  2PQE A;  5JEA H;  1IHZ A;  3QJY A;  2WP8 J;  4A3D H;  5K36 G;  2IW3 A;  1J6Q A;  2PI2 A;  4O1N A;  3MEF A;  1TWA H;  2MO0 A;  2LXK A;  2KCN A;  2X69 A;  1TY0 A;  2FXQ A;  5M9O A;  1IBK L;  4GKK L;  3PIO 3;  1UE5 A;  4OON A;  1S40 A;  4LF9 L;  1MGS A;  4X62 Q;  4OWW B;  4YWK A;  3H3V H;  1GXD C;  4CKE A;  3G48 A;  2F0N A;  2JE6 I;  4ZYS A;  1WD0 A;  2NTS A;  3RN2 A;  4BS9 A;  1Y14 B;  2RKS A;  1HXY D;  4L8J A;  4CDE C;  2EYJ A;  1YNJ C;  2F0D A;  5KNC A;  1EYG A;  3CC2 A;  1DOL A;  3BZC A;  2F0E A;  4EX5 A;  3CME A;  2K5H A;  4IFD H;  3UE0 A;  4A3E G;  2BE5 C;  4JBJ A;  2KJX A;  4RH6 A;  1BXT A;  3K5O A;  1CTM A;  1CFM A;  2PYK A;  4NP5 A;  2RQX A;  2RCF A;  2DUD A;  3RMH A;  5NUC A;  3TP8 A;  5FK9 C;  4JCV E;  2ASB A;  2JA7 B;  1YEZ A;  2OEO A;  1IBK Q;  3QB3 A;  2AQ3 B;  1STA A;  2NYZ D;  1WJJ A;  3MXG A;  1L1O C;  2EQS A;  4GKK Q;  4FXD A;  3LWU A;  3OIQ A;  1VCI A;  4LF9 Q;  1WTV A;  3W5O A;  1DYQ A;  2OCE A;  2ALY B;  3ZYY X;  3BDO A;  5KRU A;  4BXX H;  2A68 C;  4UP9 A;  3EJI A;  1PTO H;  4R4O A;  4A3K B;  4LNQ A;  3CRK C;  3KF6 B;  4CJ0 B;  4LUV A;  3MZ5 A;  5C4X H;  2PO4 A;  3RLF A;  4A3J B;  2I5H A;  1KL9 A;  2RCN A;  3V05 A;  2JK8 A;  5IYD G;  3TN2 A;  2ZJQ A;  1X55 A;  1NSN S;  1UEB A;  5FLX E;  1GVP A;  1LT4 D;  3OW2 A;  3I4N B;  5AFW A;  5ELC A;  3QOJ A;  4XXE A;  1PXU A;  4JI4 L;  4K14 A;  4HTH A;  2EZV A;  2HCI A;  4NPS A;  1PZJ D;  5CGK A;  1U4M A;  2ZTC A;  4XYQ A;  2F0W A;  1H9K A;  4POF A;  1AH9 A;  2A8V A;  5DM7 3;  4JYA L;  4DK1 A;  1JMC A;  1TQO A;  5C4H A;  1S5F D;  1MIU A;  4F8M A;  3P1H A;  5IYC G;  1LO5 D;  1VQ6 A;  2K4K A;  2K5W A;  3A54 A;  2PQA A;  1GUO A;  1SRU A;  1LTG D;  1EY7 A;  5C0X J;  5CV4 A;  1PH1 A;  1VQE A;  2NVX B;  1LV9 A;  1D2B A;  1C0A A;  3J80 L;  4LAA A;  2RF4 A;  4JI4 Q;  1E7Z A;  2NN6 G;  1IL8 A;  4KJO A;  1PH8 A;  3J81 j;  3C1E A;  3DUZ A;  5ELO A;  3NTI A;  5JPM C;  2G5D A;  3BG3 A;  2D62 A;  4KI0 A;  3CP0 A;  4FVM A;  3ND8 A;  4RGN A;  4MNO A;  1CHQ D;  4DPG A;  2CQA A;  1N33 Q;  4KK7 A;  4HJ8 A;  3U4Z A;  1VQF A;  4JYA Q;  3Q23 A;  2BH2 A;  3I4N H;  1Q1E A;  3UDG A;  2RDH A;  5T1I A;  4UAI A;  1ASY A;  4HSP A;  4A3L H;  2N55 A;  3M3Y B;  2ID0 A;  4PNY A;  4HCE A;  4YY3 L;  4EQN A;  5C5L A;  2K5D A;  4CJ1 B;  4IN3 A;  1EQV A;  2A6E D;  2Z6K C;  1B2T A;  4EQ5 A;  4A3G H;  3EBE A;  2B63 G;  1G29 1;  2JA8 G;  2IX1 A;  3PF5 A;  4E6I A;  2CFM A;  4DK6 C;  3MFG A;  3JAM L;  4A3E B;  5FOB B;  2PI2 E;  3FPP A;  1L1O A;  1BNZ A;  3NQI A;  2A69 D;  4MHE A;  1DJR D;  4IPG A;  4NXN L;  2XTI A;  4HSV A;  1H9J A;  3D3R A;  3HRZ C;  3I91 A;  4IOC A;  2MNA A;  4JI3 L;  4TKO B;  1PH3 A;  3HG9 A;  2B8G A;  2HD3 A;  1CHP D;  1Z6H A;  3I4M H;  1SBB B;  1B4O A;  3J7A F;  4YY3 Q;  1ZKO A;  4J8Q A;  4F87 A;  3AMU A;  1SYG A;  2F0O A;  3S24 A;  5M3M H;  2TSS A;  4C2M H;  3I70 A;  2WFW A;  1C8C A;  1I4P A;  2PNR C;  5A2Q E;  4IUV A;  1TS2 A;  1E1T A;  3J81 i;  5ELN A;  5K5P A;  4OXP A;  3TEH B;  1PH5 A;  2J7Z A;  5FO7 B;  1XMQ Q;  1R4Q B;  3GTO B;  3MTS A;  1LTI D;  3LNN A;  3S1N H;  3K0X A;  1CQV A;  4L6T B;  4JOI C;  1JOQ A;  5IWA L;  2CH4 A;  1H9R A;  3QG1 A;  5M5W B;  3HOZ H;  2YV5 A;  1HCZ A;  5EBD A;  4DR1 L;  4ZUI A;  5LMN W;  1QVG A;  2GVB A;  4LWC A;  2FMC A;  1NMG A;  5M3F G;  1L0Y B;  2KCM A;  4NXN Q;  1JJG A;  1TKW B;  2F3W A;  3CCQ A;  2I5L X;  1EU4 A;  2YTX A;  3KFU A;  4IUQ A;  4AH6 A;  1IBM L;  2VY3 A;  4JI3 Q;  3WOE A;  3J80 c;  2HCC A;  4DUZ L;  4C3I G;  4PMW A;  5JEA G;  1UEA B;  4DV0 L;  3HOU H;  5D3D A;  4P2C B;  3MAQ A;  4A3D G;  1DM0 B;  1XWE A;  2H4O A;  3U4V A;  1IW7 D;  4HJA A;  1OXT A;  1DOK A;  3QO2 A;  4ZK9 B;  1IBL L;  2UUC L;  2F1M A;  2KUM A;  2VB3 X;  1U4P A;  5KND A;  4PZ7 A;  4MZ9 A;  1JJC B;  5IGE A;  3FEW X;  3QOL A;  2E8G A;  2LY7 A;  1D8L A;  5KEE A;  2LXJ A;  1MI2 A;  1AW7 A;  1SMY C;  2KBN A;  4JI2 L;  5C44 H;  4L5R C;  4LF5 L;  5IWA Q;  5KYL A;  3PV0 A;  2AUJ D;  4DR1 Q;  4TQU S;  4FXK C;  3DMU A;  3BVM A;  5I2X A;  4IFD G;  1KDC A;  1T5X D;  4P75 A;  4DAY A;  1ICF B;  1K28 A;  4XT1 B;  1IBM Q;  1I4G A;  5C4J H;  1G2S A;  2RSN A;  4DUZ Q;  4WFN 3;  4R1J A;  4DV0 Q;  5C4Z A;  1FL0 A;  3FHW A;  4H13 C;  1PFN A;  5C3W A;  2Q2U A;  3JAM c;  1XMO L;  4YCV A;  1IBL Q;  2UUC Q;  1BCP F;  2Z6K A;  1G51 A;  2QEX A;  1A6X A;  1HHV A;  2OTJ A;  1IL2 A;  1Q86 C;  5GRO A;  3NP8 A;  1WTP A;  2NVQ H;  1PFB A;  1LM0 A;  4BXX G;  3QR8 A;  4JI2 Q;  4GS3 A;  4GNX C;  4TRD A;  1STH A;  2NBF A;  3J7Y W;  4LF5 Q;  1V1Q A;  3BDL A;  1Z47 A;  2E74 C;  3CQZ B;  2QA4 A;  3BU2 A;  4Q0F A;  1H95 A;  2ZXP A;  5C4X G;  2M9V A;  1STN A;  1EY6 A;  2EYP A;  1WD1 A;  4QMG A;  3PIO A;  4DV6 L;  1Q82 C;  1JJ2 A;  4HIO A;  2JA8 B;  3RZO B;  1PMR A;  1S5C D;  1VQA A;  3KF8 B;  4ZQ3 A;  3VR4 A;  2ZXO A;  1F2Z A;  3GV6 A;  3K7A H;  3HFZ B;  4K5W A;  1TWG H;  1SEB D;  3AYH B;  5BN5 A;  3GV3 A;  3VA5 A;  2R61 A;  1ROD A;  2HHH L;  3ULL A;  3TME A;  1QZG A;  2X6G A;  1S4Z A;  4KKT A;  1XMO Q;  1JC7 A;  4B9X A;  2L1B A;  3D4D A;  1W3S A;  1EWC A;  5BR8 L;  1RHP A;  1K0R A;  3TRZ A;  3S17 H;  3VYS A;  5EGT A;  3OTO L;  3F2B A;  3CCJ A;  1V9P A;  3OWF A;  2ICE C;  4BBR H;  3J7Z C;  1VQ9 A;  5C3E B;  5CV9 A;  5EKL A;  3EVQ A;  1F2M A;  1LAB A;  1PRT D;  2AHO B;  4JOI A;  4DUY L;  1K83 B;  2ICI A;  1T5E A;  1UAP A;  1STY A;  2BA0 A;  4P73 A;  4V0B A;  4NB3 A;  5CBA E;  1B70 B;  3VR3 A;  2F0L A;  2NN6 I;  2NVY H;  4DV6 Q;  1FNV A;  1GHK A;  5C5M A;  4ILW A;  1RL2 A;  4M1U B;  1TWC H;  1DCZ A;  2ZT9 C;  1NMF A;  2L55 A;  1BCP C;  2PZT A;  1WTO A;  1M8A A;  5M5W H;  1QZH A;  4O0A A;  4ME5 A;  4LF7 L;  2HHH Q;  1QCB D;  1K8A C;  2EOT A;  4DAM A;  3J80 E;  4ZKB B;  3WDN A;  5M3F B;  2XGT A;  4IAL A;  5C6A A;  5BR8 Q;  3MHB A;  4HED A;  2ZTD A;  2MFI A;  2QW7 A;  3D6C A;  5M5X H;  5DAU A;  3OTO Q;  3S2D H;  3Q24 A;  1Y8O B;  4C3I B;  3S15 B;  1U4R A;  2L12 A;  3ERO A;  4A3D B;  2K28 A;  2B29 A;  1HR0 W;  4DUY Q;  3D0F A;  1TWA B;  5COY A;  4A3L G;  1E0B A;  4BA1 I;  1J8I A;  1HUN A;  1K8M A;  2N49 A;  3HS0 C;  3NBH A;  4DKA C;  1VQL A;  2NB0 A;  4GLA C;  3CCL A;  4EVO A;  3PUW A;  4GOP A;  4A3G G;  3KBX A;  2QEJ C;  4P71 A;  5IP9 H;  1YHQ A;  1EEF D;  4XQJ A;  4LF7 Q;  3DEP A;  5J22 A;  1Q8K A;  3H6M A;  1ML0 D;  1H9S B;  3I4L A;  2K1B A;  1D5X C;  4R9W A;  2VS1 A;  2IJ0 A;  1ZYR C;  5IT9 L;  4UPA A;  3K6O A;  3PSI A;  3S14 H;  4RG1 A;  2KVM A;  4QQB X;  4PQX A;  3JAM E;  1KQS A;  5C0X H;  3RNU A;  1KHI A;  4RKB A;  5JJI A;  2O5I C;  4PG3 A;  4GNX A;  4J15 A;  3KUP A;  3JC6 6;  5IGF A;  3SHL A;  1C48 A;  3I4M G;  3CKI B;  1EZ6 A;  1SYF A;  3VYT A;  1HNX L;  4IJL A;  1Y8P B;  4DNI A;  3RUZ A;  2B2Y C;  1NUC A;  5GAG C;  5M3M G;  1YJ9 A;  3PUZ A;  2KHS A;  3KDF B;  1EWH A;  4DA2 A;  1B8A A;  3IAY A;  1PTO B;  3FKI H;  1R9T H;  5I2Y A;  2JXM B;  1O7Y A;  5C4X B;  2A6H D;  4YCW A;  4QIW B;  4A3J G;  2E2D C;  3GO5 A;  1QNU A;  5FO9 B;  3HOZ G;  4IZ8 A;  2D0P A;  3WOF A;  3L3O C;  2YTY A;  3HOX H;  2BA1 A;  1PLF A;  2K75 A;  4R4C A;  3I4N G;  1X3Q A;  4JBM A;  3NEL A;  3CC7 A;  1HZ9 A;  1CQF A;  2A19 A;  1GUG A;  2H5X A;  2B2V C;  2E76 C;  1WTQ A;  3HOU G;  1HNX Q;  1BKB A;  3H3V I;  3U9O A;  1A8V A;  1PTO D;  5HGT A;  1FD7 D;  5HGQ A;  4PMC A;  1X32 A;  3U9S A;  2YYZ A;  1ASZ A;  1VQ4 A;  5C3E H;  2CW0 D;  1QVF A;  3A0J A;  4FF3 A;  1EYA A;  4DU9 A;  4TVA B;  1YZ6 A;  5CR3 A;  1VQD A;  2F0M A;  2K52 A;  1BF4 A;  5C44 G;  1UE7 A;  1XXG A;  1VDZ A;  2C5C A;  3SDZ A;  2F0Q A;  3B6Y A;  1AEX A;  1I50 H;  1XNQ L;  1W6J A;  2F0T A;  3E9H A;  2AWN A;  2RDF A;  1EL0 A;  1STE A;  1JIC A;  2B2W C;  1QB5 D;  2VXW A;  1A2T A;  3A56 A;  3Q8D A;  4K5X A;  5M5Y H;  4WJ4 A;  3S1M H;  4IUP A;  1E22 A;  1V1O A;  3OIP A;  1O80 A;  1VQ8 A;  3PO2 B;  3PGZ A;  2E75 C;  3T16 A;  4DR3 L;  1B50 A;  2MO1 A;  3PO3 H;  4DFA A;  1MJC A;  5EPJ A;  5IT9 c;  5J39 A;  4HMJ A;  5GAE C;  2F0K A;  3T13 A;  2JA6 H;  4L5T A;  1MSH A;  1I6H B;  3T1Y Q;  5T1G A;  2F4V L;  4CBV A;  3PIP 3;  1CI3 M;  2DNC A;  1CKN A;  2GN5 A;  3S2H H;  1F77 A;  2QDB A;  1SAP A;  1XNQ Q;  1QOH A;  2XRQ D;  4QB4 A;  1ESF A;  3VYU A;  3TP5 A;  4A3G B;  5CBE E;  2FMM A;  1BBW A;  3T53 B;  3NTH A;  3BS1 A;  2Q8T A;  1CA6 A;  4RFB A;  2XNA C;  4ZLT F;  3SXH A;  5GAH C;  4KY6 A;  1EQR A;  4R4Q A;  1EFW A;  5IGG A;  3OYY A;  4ULL A;  3C1F A;  5FO8 B;  1S5E D;  3J81 c;  4DR3 Q;  3UE1 A;  1I3Q H;  3CCS A;  1SYC A;  2DN8 A;  1NBW A;  1I4R A;  1DOM A;  2B2Y A;  1KDB A;  4DV7 L;  3LGJ A;  1IYV A;  2MQH A;  1X3G A;  2ZJR A;  1EYC A;  1VMC A;  3HKZ E;  3NWT A;  3TDQ A;  3SVM A;  2F4V Q;  4BBR G;  3ITP A;  3OOC A;  2JEB I;  3I4M B;  1A62 A;  1CT1 D;  4DV2 L;  2HT1 A;  1NR2 A;  2KA7 A;  4X66 L;  1SJH D;  2VB2 X;  1Y69 U;  5M3M B;  4FO2 A;  4C2M B;  2EY5 A;  4HJ5 A;  2PPB C;  1AP0 A;  1NAP A;  1D5Z C;  2LSS A;  2A6E C;  2A5H A;  1LT3 D;  2EYH A;  4LJZ C;  4NW2 A;  2K03 A;  3A5Z B;  3S1N B;  3Q22 A;  4B9W A;  2B2V A;  3HOZ B;  4NMZ A;  4TSS A;  3TQY A;  4DV7 Q;  3KK7 A;  2F03 A;  5KGU A;  3DXJ C;  2PMZ E;  4I7Z C;  4FF2 A;  3H94 A;  4WOR A;  4K2L A;  3KLW A;  2A69 C;  2FHT A;  1BOS A;  2I07 B;  2LKV A;  4HAE A;  2YU9 H;  5GAD C;  4B3R L;  3ERS X;  3HOU B;  4DV2 Q;  1ILQ A;  2Z8L A;  4G7O C;  1KRS A;  1PYW D;  1LTS D;  3SR1 A;  4X66 Q;  3A8I E;  4EQP A;  1UE6 A;  4EGV A;  1HFN A;  3K0Y A;  2OT2 A;  1GUW A;  4A75 A;  2NTT A;  2QCP X;  3FDT A;  2IT1 A;  2B2W A;  3M4P A;  3D4R A;  4OEM B;  2KED A;  1V1P A;  5IP9 G;  5C44 B;  1HZA A;  2IL8 A;  3U50 C;  2UXB L;  4F7X A;  1E2W A;  4M8A A;  3I2Z A;  3GP7 A;  1VQG A;  4B3T L;  5KYI A;  4OHJ A;  2A73 B;  2EPB A;  1QUQ A;  2Z6B A;  2PW5 A;  3EQL C;  4H02 A;  4HR7 B;  2PNH A;  3CCR A;  1HQR D;  4PMB A;  4NXM L;  2R7Z H;  4KD4 A;  3D8G A;  1AZQ A;  3H0G H;  5C4J B;  5D3I B;  2KEN A;  1UE1 A;  5C0X G;  3PO2 H;  1O7L A;  4OWT B;  4B3R Q;  2L4N A;  1I4X A;  5IT9 E;  2J4X A;  5IIF A;  2SNM A;  1ZEQ X;  4BBS H;  2EE1 A;  4H0L C;  5E4W C;  2WV6 D;  1L1O B;  5I6W A;  1EIF A;  3K7U C;  2VW9 A;  3CPF A;  1IW7 C;  1I6H H;  1SRO A;  1ENC A;  1GUT A;  3WWV A;  2NVQ B;  2ES2 A;  1YJW A;  1FNU A;  5I9O A;  4IUU A;  4X3U A;  3CCM A;  4QL5 A;  2UXB Q;  1HZB A;  5IGD A;  2K04 A;  4IOA A;  3FKI G;  1Q46 A;  1BR9 A;  4B3M L;  4B3T Q;  3GD7 A;  2VUM H;  4UP8 A;  1VF7 A;  1WI5 A;  3T1H L;  1VQO A;  2I5M X;  5JJL A;  2M00 A;  4IUN A;  1L0X B;  2K50 A;  4NXM Q;  3J81 E;  1Q90 A;  1FNW A;  2KEC A;  3HOX G;  3K7A B;  2HQL A;  1LTR D;  1TWG B;  2N8N A;  2K5V A;  1EY5 A;  2K05 A;  1RD9 D;  1X65 A;  1PRT F;  1HPC A;  2ZJP A;  4LF4 L;  1KAW A;  2CH4 W;  4UY8 C;  5FLM H;  1UNS A;  1B3Q A;  5DNF A;  3FRP B;  3W3A A;  2PZU A;  1EIG A;  3TZD A;  2Y0S E;  5JVG 3;  1LT6 D;  3S17 B;  1PH2 A;  1SDF A;  2VQF L;  2IHF A;  2UXC L;  4XIG S;  4GKJ L;  4BBR B;  4CJ2 C;  5C3E G;  2LFN A;  3HEJ A;  3STB D;  3VA7 A;  3FPU B;  4S3S A;  4GLV B;  3NQT A;  4QUF A;  4OL7 A;  4QF4 A;  4B3M Q;  5KIX A;  3T1H Q;  3SGI A;  4FF4 A;  2NVY B;  1TY2 A;  4RA8 A;  1TWC B;  1SNP A;  5TSS A;  1N9W A;  2XWB B;  5LMN L;  1DD2 A;  2F52 A;  3OWE B;  4OGQ C;  3RLO A;  3PCO B;  2F0V A;  4LW1 A;  3A55 A;  4LF4 Q;  1KAA A;  2SNS A;  3PQI A;  5IYB G;  3I3C A;  2G9D A;  3M9B A;  3AB9 A;  4JG2 A;  3ULP A;  4GN5 A;  2ZTE A;  1LTB D;  1PH9 A;  4DAY B;  2FJ2 A;  2H1E A;  5M5X B;  2VQF Q;  2N3S A;  4LF8 L;  1B53 A;  1LTL A;  2JEA I;  3GTG B;  1XNR L;  4GKJ Q;  3S2D B;  2UXC Q;  2IPK D;  4KHV A;  2JA6 G;  4JI8 L;  5FKA C;  5ELE A;  3G7L A;  2WKC A;  2VQE L;  4X65 L;  2WIN B;  1HA6 A;  1V8Q A;  5CV8 A;  1PDQ A;  1N32 L;  1N34 L;  1PRT C;  3GTK H;  5EJW A;  3FP9 A;  1VQ5 A;  1FGU A;  1LAC A;  5ELF A;  2ENB A;  4RGO S;  3BZD B;  2NZO A;  5CYU A;  5LMN Q;  5CMD A;  3TSS A;  2V1C C;  3HOY H;  2HUG A;  2WII B;  2D5D A;  2L15 A;  2K6A A;  1I4H A;  1SND A;  3AU7 A;  1OTC A;  4LF6 L;  1A3T A;  3O13 A;  1B1Z A;  1IKL A;  2RDG A;  3S14 B;  3NUC A;  2JYO A;  3SE0 A;  4LF8 Q;  2JA5 H;  3CCU A;  1XNR Q;  1XPR A;  4DR2 L;  3IL8 A;  5F2D A;  2WAQ E;  5JJZ A;  4BY7 H;  1TU2 B;  1Q8I A;  4JI8 Q;  1X9N A;  3TS2 A;  2VQE Q;  4K2K A;  4X65 Q;  2RVL A;  3KLS X;  2O5J C;  4ZCK A;  1N32 Q;  4ABN A;  1JWM D;  1N34 Q;  4APV A;  1HUM A;  4ZKC B;  2L0C A;  3G71 A;  4QGU A;  4H44 C;  4RGM A;  3AQQ A;  2Q8I B;  2E2H H;  1SYD A;  3NXW A;  4OO1 H;  4DR7 L;  5EKI A;  2JN4 A;  2BDO A;  1EU3 A;  3H91 A;  4RWS C;  1SXT A;  3GTQ H;  3FKI B;  1R9T B;  4IPC A;  4RCN A;  3PIP A;  4DK3 C;  1HTL D;  4HJ7 A;  4LF6 Q;  1LTA D;  4KN4 C;  1TS3 A;  1D6E C;  3MXN A;  1EIY B;  1VQJ A;  1MKH A;  5K36 H;  3L9A X;  3DHQ A;  5IP7 H;  3OSO A;  1F2L A;  5AJ3 L;  4K0K L;  3HOX B;  4A3M H;  4DR2 Q;  1ENA A;  1STB A;  2VNU D;  2Z4I A;  4IUR A;  3MWY W;  4EQO A;  3C46 A;  1GD7 A;  3HOW B;  3J7A V;  2CWA A;  1KLU D;  3H3V C;  1D5M C;  1OO9 B;  1XX8 A;  4R8I A;  2IY5 B;  4OX9 L;  3S1Q H;  3K5L A;  1B7Y B;  4MN3 A;  4A3B H;  1WCM H;  2MUY A;  2G9H D;  1OXS C;  3I73 A;  3KBG A;  5LL6 X;  4JI6 L;  4DR7 Q;  1B44 D;  1EY9 A;  3RZD B;  1RCV D;  5COR A;  1XPU A;  1IYU A;  1BO0 A;  3EA6 A;  1KNE A;  1JOO A;  2KHI A;  4DV5 L;  4KMU C;  4H7B A;  2A74 C;  3S1R H;  1DZ1 A;  3R8B A;  2Y0S G;  2XVS A;  3R2T A;  2SOB A;  3NBH B;  1I50 B;  5J3B A;  3HKZ B;  1S5D D;  1F9P A;  2A6H C;  5AJ3 Q;  1WFQ A;  3P75 A;  3G6E A;  1SYE A;  2BCO A;  1M4V A;  2MP1 A;  4K0K Q;  3NE5 B;  4QUC A;  3SK5 A;  4GOP B;  1RJT A;  2EYF A;  1TR5 A;  1Y1W H;  3D31 A;  2R7Z G;  1SNO A;  1JR0 D;  5M5Y B;  4XYO A;  1YNX A;  3H0G G;  4V19 0;  3S1M B;  3NWS A;  1EOT A;  1FYC A;  1O78 A;  1BBX C;  3PO2 G;  4CDC C;  5IOD A;  2EY6 A;  4BBS G;  5EPL A;  1TWH H;  4OX9 Q;  3PO3 B;  1K8O A;  3A8K E;  5JPN C;  5EKK A;  2LMC B;  3GTJ H;  2B2T C;  3GTG H;  1I5F A;  1PTO C;  4JI6 Q;  2HIX A;  2JA6 B;  3CAM A;  1P8L A;  5FLX L;  2CQO A;  4GZY C;  3L2P A;  3CPW A;  1F2Y A;  2CW0 C;  4GNX B;  1SJE D;  2D2C C;  3N6R A;  4MTK A;  4DV5 Q;  4L5Q A;  2EXD A;  1K8G A;  3TRE A;  1YHB A;  2PMZ B;  3S2H B;  3E9I A;  2VUM G;  3R93 A;  3M4Y A;  5IE8 A;  4C1N K;  3V2T A;  3VDY A;  4C56 C;  3DM3 A;  3NSW A;  3A7L A;  1JQY D;  1W6K A;  4FXG C;  1GUS A;  4U67 3;  2JSO A;  3CMA A;  4AYB E;  2O4X A;  4U68 A;  4PZ6 A;  2IHE A;  4OWX B;  2QGQ A;  1DON A;  2E2J H;  3M4O H;  1EQT A;  5BN4 A;  1I3Q B;  1D1I A;  5FLM G;  1EY4 A;  3OPO A;  3LWE A;  2OQK A;  4K6L A;  1FR3 A;  4A3I H;  3RD4 A;  4JC0 A;  4OEL B;  4UHV A;  3EN2 A;  1WTX A;  3U58 A;  2CVR A;  3K80 C;  4R4T A;  4QJF A;  1YNN D;  2F0I A;  4KV6 A;  1CA5 A;  2WKD A;  4DF7 A;  2IX0 A;  3GTL H;  1C4Q A;  1PH7 A;  3F2C A;  1SNQ A;  1MHW C;  3GTP H;  1TS4 A;  4KJN A;  2F3V A;  3CF5 A;  2JA9 A;  1MBY A;  1K3B C;  3I56 A;  1HRJ A;  2EY2 A;  3A8J E;  2WAQ G;  4KTA A;  4DNR B;  3GTM H;  1JE5 A;  2LS0 1;  4JVZ A;  4WRD A;  1X56 A;  2R7D A;  3MC0 B;  4G7Z C;  2F0S A;  1Y1V H;  4L63 B;  1D1K A;  3CC4 A;  1NNX A;  3C3L A;  3K8A A;  3I4O A;  1JB3 A;  4DR4 L;  1QIL A;  2OF1 A;  3PUY A;  3HOV H;  5CV7 A;  4B08 A;  3AFQ A;  3UDF A;  2D0O A;  4Z9C B;  5JOB A;  3HOW H;  2YU9 B;  1YVC A;  3PUV A;  1K3R A;  1HA5 A;  2PW7 A;  1ILP A;  1TVX A;  1GJX A;  3G6J B;  3R3O A;  5JVH 3;  4KLK A;  3S9W A;  4DV1 L;  2RA4 A;  3RZD H;  4R4I A;  2EJG C;  4IFD I;  2WB1 E;  3I7F A;  2KQ3 A;  2Z4H A;  1G8Z D;  1VQC A;  4C3J H;  3HOY G;  3S16 H;  2R93 H;  1CKN B;  2Y0S B;  4YWL A;  1E1O A;  1L0W A;  5DLQ E;  4POG A;  1VQH A;  1CSP A;  5GQO A;  2R7F A;  1AE2 A;  4OIJ A;  4DR4 Q;  1EFI D;  1Q81 C;  2OWO A;  2B2T A;  1VS0 A;  2AKW B;  4F88 A;  1XYI A;  2R7Z B;  4A3F H;  2ZM6 L;  4RMF A;  4KY7 A;  1L2F A;  3H0G B;  3A5U A;  2JA5 G;  1GUN A;  4BY7 G;  1SNC A;  2X6L A;  2P5Z X;  1PFS A;  4BBS B;  3L7Z C;  1MD2 D;  4LK1 C;  3KYH C;  4JI7 L;  2E2I H;  3AEV A;  3PF4 A;  4IPD A;  2AWO A;  4DV1 Q;  1DGS A;  5C3X A;  2HDL A;  4N9P A;  2B8F A;  3CHB D;  3QIA A;  4OO1 G;  1KC8 C;  4LUZ A;  4RHR A;  1X6O A;  1KTK A;  1RKN A;  1PVO A;  2VUM B;  3DWQ A;  4QCL A;  1SE4 A;  2Q8R E;  1QVC A;  3HP3 A;  2NZH A;  5IP7 G;  2ZM6 Q;  3TBI B;  4A3M G;  4KHZ A;  2Q2T A;  1Q12 A;  1AZP A;  4X3S A;  2CHB D;  2F0G A;  4DR6 L;  1I6V C;  1EIH A;  1F9S A;  2F0P A;  4RGT A;  4YIJ A;  2N78 A;  3K58 A;  1Z9F A;  4JI7 Q;  3GDE A;  1JWS D;  1WOC A;  4A3B G;  3VYR A;  1WCM G;  2F0H A;  4AYB G;  4KKU A;  1TWF H;  2A1A A;  2WAC A;  3M85 A;  3CXC A;  1PZK D;  2CKZ B;  1K73 C;  1Q7Y C;  1S72 A;  3BDC A;  4O2D A;  2B39 A;  4JV5 L;  2I0Q A;  4DAV A;  1U4L A;  1VMP A;  3ULJ A;  3F2U A;  2R92 H;  2BH8 A;  2VL6 A;  2E5L L;  4ZUJ A;  2QF7 A;  4N8X 1;  2WAQ B;  3PUX A;  4IQZ A;  3T4A C;  4YHH L;  3DLL A;  3W2D A;  1S3O A;  1EWI A;  1J5E L;  5E4X A;  2JQO A;  4K6D A;  1QJO A;  1Q3L A;  2Z0S A;  2UXD L;  4DN4 M;  4JW0 A;  3IFD A;  1Y1W G;  2DJF C;  2KCT A;  4FNF A;  1KAB A;  1V1P B;  4Y7N H;  4LUO A;  4DR6 Q;  4P74 A;  2PQA B;  3HZX A;  4A93 H;  5E1F A;  3NBI A;  3MXU A;  5D65 A;  1QUQ B;  1RF2 D;  1C7Y A;  1UWV A;  1LT5 D;  3NK9 A;  1PYS B;  2K32 A;  1FVI A;  1EYD A;  1JOK A;  1SE3 A;  1AE3 A;  4JV5 Q;  2ZXR A;  1KIX A;  4CHT B;  3STB C;  1EUJ A;  4J1M A;  2K14 A;  1X3F A;  4JI1 L;  3ICE A;  3X3M A;  2E5L Q;  4YHH Q;  3GTK B;  2AUK A;  3A7A B;  4LFA L;  1J5E Q;  1CM9 A;  3UDI A;  4BY1 H;  2RHS B;  3QWN A;  2UXD Q;  4B3S L;  1G6Z A;  1SYB A;  4XTC S;  2DGY A;  3HOY B;  3H15 A;  4FF1 A;  1MSG A;  1N33 L;  1M1K C;  1QE6 A;  4NKL A;  1YIT A;  1SMX A;  4K5V A;  3OHX C;  3K5N A;  4MIU A;  3NTK A;  3KF6 A;  5BN3 A;  1G91 A;  2EDG A;  2WB1 G;  4HIK A;  2JA5 B;  1NR4 A;  4A3I G;  3URY A;  1WTR A;  2QKI C;  3BYY B;  4BY7 B;  3ONA B;  1SE2 A;  2EYL A;  1VQP A;  1KD1 C;  4DR5 L;  2HQE A;  3E0E A;  4JI1 Q;  2I46 A;  1YNJ D;  2GVA A;  1UUP A;  1YIJ A;  4LFA Q;  1I94 L;  4A3C H;  2L11 A;  2EYO A;  2BE5 D;  2E2H B;  5G3L D;  5H1S E;  4B3S Q;  1KRT A;  1ESR A;  4DXF A;  2XWJ B;  5E3F A;  2F0U A;  3M7N A;  3KLR A;  2F0J A;  1K9M C;  2NVT H;  1KDA A;  3SEB A;  4CKB A;  1EQQ A;  3GTQ B;  4I65 A;  4IJH A;  2FFK B;  4C3H B;  1HH2 P;  2Q2H A;  2TMP A;  3E6Z X;  3BVZ A;  4QIW E;  2VZA A;  1Y1V G;  3P20 A;  2SEB D;  3GQB A;  1JB7 A;  2PCF B;  2MPM A;  4XQQ A;  1GO3 E;  2DY7 A;  4A3M B;  3OW7 A;  3HOV G;  1GKH A;  1T9H A;  3E5S A;  4GN4 B;  2A68 D;  1E2Z A;  5LHY 1;  3HOW G;  4DR5 Q;  2N88 A;  2K5N A;  2V4D A;  2KCC A;  1SR3 A;  2DNE A;  4N8F A;  5I6Y A;  3CU7 A;  4JBW A;  3KJO A;  3S1Q B;  1IZ6 A;  4LMQ D;  3SK4 A;  3Q6S A;  4A3B B;  3TZU A;  1XMQ L;  1WCM B;  1TT2 A;  1I94 Q;  1EOV A;  3A74 A;  1B3A A;  5EBC A;  4AYB B;  4LFB L;  2R3Z A;  4KKS A;  3OMG A;  1ET9 A;  5EAY A;  4ZAI A;  3AFP A;  2EY1 A;  3DEO A;  1PH4 A;  1HQM C;  2NWG A;  3R2I A;  3K81 C;  1PHJ A;  4DK0 A;  1EY8 A;  1IXR A;  4C3J G;  3S1R B;  2SDF A;  2R93 G;  2QDL A;  2OQ0 A;  3HKZ G;  2JA7 H;  4GLX A;  2DY8 A;  5IOC A;  1Y1W B;  4KY5 A;  1HJP A;  1GM5 A;  1LLR D;  4RAU C;  4A3F G;  1S5B D;  4HCS A;  4ID6 A;  2EYM A;  4N9T A;  5J1Z A;  3CCE A;  1N36 L;  4RCO A;  3LX0 A;  3PO3 G;  1II3 A;  1SSO A;  1TWH B;  4OO1 I;  1NJI C;  4A3K H;  3GTJ B;  2AQ2 B;  1WTW A;  2UUB L;  3IRB A;  2Z1C A;  2MGS A;  2QIL A;  5HY6 A;  4LFB Q;  1O7Z A;  1VQI A;  3NEM A;  5DM6 3;  4A3J H;  4FDB A;  2K5Q A;  4R8N A;  1XPO A;  2JJQ A;  1EZ8 A;  1G6P A;  5JEA J;  4I7A A;  3M7G A;  1SN8 A;  1C9O A; 
#chains in the Genus database with same CATH homology
 3GTJ H;  3GTG H;  4JYA L;  1JT8 A;  1I5F A;  1JMC A;  4JI6 Q;  3Q8D A;  2HIX A;  5M5Y H;  1MIU A;  4WJ4 A;  3CAM A;  3S1M H;  5IYC G;  1P8L A;  3F8T A;  5LMU L;  2CQO A;  4GN3 B;  4HIM A;  3L2P A;  3CPW A;  1E22 A;  4GNX B;  3HKS A;  1VQ8 A;  2UU9 L;  2K4K A;  1VQ6 A;  3PGZ A;  1VQK A;  2PQA A;  4DR3 L;  4DV5 Q;  4L5Q A;  2EXD A;  1K8G A;  2MO1 A;  2CCZ A;  3PO3 H;  1SRU A;  1LUZ A;  3TRE A;  1VQN A;  1YHB A;  1N36 Q;  5C0X J;  3E9I A;  1PH1 A;  1MJC A;  1VQE A;  5IE8 A;  2VUM G;  5IT9 c;  1C0A A;  3VDY A;  5GAE C;  3DM3 A;  1P16 A;  2RF4 A;  3MXN B;  1BVS A;  4L5T A;  4JI4 Q;  2UUB Q;  2JA6 H;  1E7Z A;  2NN6 G;  3T1Y Q;  4IFD J;  1PH8 A;  3J81 j;  2F4V L;  5ELO A;  2D62 A;  4KI0 A;  3CP0 A;  4AYB E;  3CMA A;  2CWP A;  3F2D A;  1CKN A;  4PZ6 A;  4MNO A;  2GN5 A;  2IHE A;  3S2H H;  1A63 A;  4OWX B;  2QGQ A;  4DPG A;  1W2B A;  2E2J H;  2NVX H;  1N33 Q;  1XNQ Q;  3M4O H;  4WJ3 M;  4HJ8 A;  3U4Z A;  5FLM G;  4GOP C;  1VQF A;  4JYA Q;  4LFC L;  2BH2 A;  2OQK A;  2R92 G;  3I4N H;  1BBW A;  1Q1E A;  1U5K A;  3UDG A;  4A3I H;  4YCU A;  4JC0 A;  1ASY A;  3EN2 A;  3U58 A;  5FJ8 H;  4A3L H;  3K80 C;  4R4T A;  5GAH C;  4QJF A;  5LMU Q;  1EQR A;  4R4Q A;  3CCV A;  2ID0 A;  1EFW A;  3CW2 C;  4YY3 L;  2UU9 Q;  3OYY A;  2IX0 A;  4DR3 Q;  4C3H H;  5E7N A;  4X64 L;  3J81 c;  1HZC A;  3GTL H;  3UE1 A;  1I3Q H;  2Z6K C;  1PH7 A;  3CCS A;  3F2C A;  4EQ5 A;  1NBW A;  4A3G H;  1VQ7 A;  4X6A H;  3EBE A;  3GTP H;  2B63 G;  2AMC B;  1G29 1;  4DV7 L;  2JA8 G;  3LGJ A;  3CF5 A;  2JA9 A;  2IX1 A;  1O7I A;  3I56 A;  4A93 G;  3PF5 A;  1V43 A;  2MQH A;  2WAQ G;  1X3G A;  3GTM H;  2ZJR A;  1JE5 A;  1BBU A;  3M3Y H;  3HKZ E;  2F4V Q;  4BBR G;  1X56 A;  2CFM A;  2JEB I;  4DK6 C;  2R7D A;  1A62 A;  4DV2 L;  2HT1 A;  3I55 A;  2PI2 E;  1L1O A;  1RIP A;  1Y1V H;  4X66 L;  3CC4 A;  1NY4 A;  4IPG A;  4NXN L;  4HJ5 A;  2XTI A;  3K8A A;  2B3G A;  4AQY L;  1NE3 A;  4LFC Q;  3I4O A;  4IOC A;  4DR4 L;  2LSS A;  3PUY A;  2MNA A;  4JI3 L;  3HOV H;  1PH3 A;  4Y52 H;  1CKO A;  1YBY A;  3I4M H;  3AFQ A;  3UDF A;  2D0O A;  3A5Z B;  4YY3 Q;  4A3E H;  3HOW H;  1LYL A;  1YVC A;  3PUV A;  1K3R A;  3F1Z A;  4BY1 G;  4X64 Q;  3S24 A;  5M3M H;  2VUM H;  4C2M H;  2WFW A;  1WYD A;  3TQY A;  1E1T A;  3J81 i;  4DV7 Q;  5ELN A;  1HNW L;  5C0X I;  4OXP A;  3TEH B;  1PH5 A;  2PMZ E;  3J7A 5;  2EIF A;  4KLK A;  1XMQ Q;  4DV1 L;  3KLW A;  4HID A;  2F3I A;  3CD6 A;  3RZD H;  1A0I A;  3S1N H;  3K0X A;  4R4I A;  4JI5 L;  2YU9 H;  4IFD I;  4JOI C;  5GAD C;  4B3R L;  2WB1 E;  5IWA L;  3I7F A;  1OXU A;  3ERS X;  4DV2 Q;  3HOZ H;  2YV5 A;  4DR1 L;  1KRS A;  3HOY G;  1VQC A;  4C3J H;  4X66 Q;  5LMN W;  1QVG A;  2UUA L;  2GVB A;  4LWC A;  3S16 H;  1CKN B;  2R93 H;  4YWL A;  1NMG A;  5M3F G;  1E1O A;  2KCM A;  1VQM A;  1L0W A;  5DLQ E;  4NXN Q;  4POG A;  1JJG A;  1VQH A;  1HR0 L;  1UE6 A;  1CSP A;  4AQY Q;  5GQO A;  2R7F A;  1AE2 A;  3CCQ A;  2I5L X;  4DR4 Q;  3GTO H;  2YTX A;  1Q81 C;  4AH6 A;  4A75 A;  1IBM L;  2VY3 A;  2OWO A;  4JI3 Q;  2IT1 A;  3KFU A;  1X3E A;  3M4P A;  3J80 c;  4DUZ L;  1VS0 A;  2AKW B;  4PMW A;  5JEA G;  2ZM6 L;  4RMF A;  4A3F H;  4JI0 L;  4DV0 L;  1L2F A;  3A5U A;  3HOU H;  2JA5 G;  4A3D G;  3KJP A;  1NTG A;  5IP9 G;  1HZA A;  3U50 C;  3U4V A;  4BY7 G;  4A3C G;  2UXB L;  3BJU A;  3I2Z A;  4HJA A;  1OXT A;  1VQG A;  5IYD H;  1PFS A;  4B3T L;  4MTN A;  4ME3 A;  1IBL L;  2UUC L;  1QUQ A;  3L7Z C;  4H02 A;  2PNH A;  3KYH C;  4PZ7 A;  1HNW Q;  4DV4 L;  4JI7 L;  1D7Q A;  2E2I H;  4MZ9 A;  1JJC B;  3CCR A;  3AEV A;  3PF4 A;  4IPD A;  4NXM L;  2R7Z H;  2E8G A;  2AWO A;  4DV1 Q;  1D8L A;  3H0G H;  2LXJ A;  1VQB A;  1DGS A;  2KBN A;  4JI2 L;  1MJE A;  4JI5 Q;  2KEN A;  1UE1 A;  5C44 H;  4L5R C;  5C0X G;  3PO2 H;  4OWT B;  4LF5 L;  4B3R Q;  1CKM A;  5IWA Q;  4OO1 G;  1KC8 C;  4LUZ A;  3PV0 A;  4BBS H;  4DR1 Q;  1X6O A;  4TQU S;  1XTD A;  1Q1B A;  2UUA Q;  1PVO A;  2KHJ A;  4IFD G;  1L1O B;  1HR0 Q;  1EIF A;  3K7U C;  4P75 A;  2R6G A;  3CPF A;  3EIV A;  4AIM A;  2VW9 A;  3ZJY C;  1I6H H;  1SRO A;  1IBM Q;  3NEN A;  5IYC H;  1QVC A;  5C4J H;  3WWV A;  4DUZ Q;  2NZH A;  4R1J A;  5IP7 G;  2ZM6 Q;  2ES2 A;  1YJW A;  4P72 A;  4DV0 Q;  4JI0 Q;  1FL0 A;  4KHP L;  4A3M G;  3J80 i;  3FHW A;  4QL5 A;  3CCM A;  2UXB Q;  1HZB A;  2YTV A;  4KHZ A;  1HNZ L;  2Q2T A;  1OXX K;  1Q12 A;  3M4Q A;  4IOA A;  3FKI G;  1Q46 A;  3JAM c;  4DV3 L;  1XMO L;  3GD7 A;  2Q2U A;  1PV4 A;  4B3M L;  4UP8 A;  1WI5 A;  4YCV A;  3T1H L;  1VQO A;  1IBL Q;  2UUC Q;  1FJG L;  2Z6K A;  1G51 A;  4DR6 L;  2I5M X;  2QEX A;  1PA6 A;  2N78 A;  5JJL A;  2OTJ A;  1Z9F A;  4DV4 Q;  1IL2 A;  1Q86 C;  5GRO A;  4JI7 Q;  3TS0 A;  2NVQ H;  3GDE A;  2K50 A;  4NXM Q;  1LM0 A;  1WOC A;  3KOJ A;  3HOX G;  4BXX G;  4A3B G;  4JI2 Q;  2HQL A;  4GS3 A;  1WCM G;  2N8N A;  4GNX C;  2K5V A;  1KXL A;  2JA7 G;  4AYB G;  1V1Q A;  1Z47 A;  4LF5 Q;  1CUK A;  1TWF H;  2A1A A;  3CXC A;  1X65 A;  3M85 A;  2CKZ B;  4ALP A;  2QA4 A;  1Q7Y C;  3BU2 A;  4IPH A;  2ZJP A;  4O2D A;  1S72 A;  1U0L A;  2C35 B;  1K73 C;  4LF4 L;  4JV5 L;  1KAW A;  2I0Q A;  4UY8 C;  5FLM H;  5C4X G;  4JBK A;  3ULJ A;  4DV6 L;  3PIO A;  5JJK A;  1Q82 C;  1JJ2 A;  4HIO A;  2R92 H;  5IY0 A;  1SE8 A;  2BH8 A;  2VL6 A;  2E5L L;  4A4I A;  3RN5 A;  1VQA A;  3KF8 B;  1E3P A;  2Y0S E;  3PUX A;  4YHH L;  3K7A H;  3HFZ B;  3DLL A;  1PH2 A;  1TWG H;  1S3O A;  3L0O A;  1EWI A;  2VQF L;  2IHF A;  1J5E L;  2UXC L;  3UDX A;  2JQO A;  1IYJ B;  3AYH B;  4XIG S;  3RR5 A;  3W1B A;  4GKJ L;  5C3E G;  4KHP Q;  1TXY A;  3CQZ H;  3STB D;  4A3K G;  2Z0S A;  2UXD L;  1HNZ Q;  1Y1W G;  2HHH L;  2HIV A;  4GLV B;  2KCT A;  4UP7 A;  3ULL A;  1QZG A;  4DV3 Q;  4B3M Q;  4Y7N H;  1XMO Q;  2B63 H;  1FJG Q;  4LUO A;  2JA8 H;  3T1H Q;  3RZO H;  4P74 A;  3SGI A;  4DR6 Q;  2PQA B;  1W3S A;  4A93 H;  1SFO H;  5BR8 L;  4BA2 I;  1K0R A;  3JAM i;  3TRZ A;  3S17 H;  1QUQ B;  3OTO L;  3F2B A;  3CCJ A;  1V9P A;  4BBR H;  1N9W A;  3J7Z C;  1C7Y A;  5LMN L;  1VQ9 A;  1UWV A;  1PYS B;  2F52 A;  3W1G A;  3BZK A;  1FVI A;  2AHO B;  4JOI A;  4YWM A;  4DUY L;  3RLO A;  3PCO B;  3RLN A;  5FLX c;  4LW1 A;  1E24 A;  1AE3 A;  4JV5 Q;  2BA0 A;  4P73 A;  4LF4 Q;  4NB3 A;  1KIX A;  5IYB G;  1PH6 A;  1B70 B;  3M9B A;  3STB C;  2NN6 I;  1EUJ A;  2NVY H;  1SLJ A;  4DV6 Q;  4JG2 A;  2K14 A;  1X3F A;  4JI1 L;  2Q2I A;  3ICE A;  1RL2 A;  2E5L Q;  3ULP A;  4GN5 A;  1TWC H;  2ZTE A;  4IO9 A;  4YHH Q;  1PH9 A;  3G4S A;  1NMF A;  4DAY B;  2JEA I;  2VQF Q;  2N3S A;  3KDF A;  1LTL A;  1J5E Q;  4LF8 L;  4LFA L;  1XNR L;  4GKJ Q;  2UXC Q;  4A76 A;  3T1Y L;  4HJ9 A;  3UDI A;  1PYB A;  1K83 H;  5M5W H;  1QZH A;  4BY1 H;  2RHS B;  4PZ8 A;  4JI8 L;  4B3S L;  2ATW A;  2JA6 G;  4O0A A;  2UXD Q;  4LF7 L;  2HHH Q;  4XTC S;  2VQE L;  2DGY A;  1K8A C;  3H15 A;  4DAM A;  4X65 L;  1N32 L;  2XGT A;  1N34 L;  4X62 L;  5BR8 Q;  1N33 L;  2ZTD A;  3GTK H;  1M1K C;  1OXV A;  3FP9 A;  2MFI A;  1VQ5 A;  3ER0 A;  1FGU A;  5M5X H;  1SMX A;  3OTO Q;  1YIT A;  1N8R C;  3S2D H;  1X54 A;  2RHQ B;  3KF6 A;  2NZO A;  5LMN Q;  4L5S A;  1XJV A;  2WB1 G;  4HIK A;  2V1C C;  2B29 A;  4A3I G;  1HR0 W;  3HOY H;  4DUY Q;  3D0F A;  5IYB H;  1H95 A;  1CSQ A;  5M3F H;  5FJ8 G;  4A3L G;  2L15 A;  1YI2 A;  4BA1 I;  1YJN A;  1VQP A;  2N49 A;  1OTC A;  4QY7 A;  4DR5 L;  1KD1 C;  2OTL A;  4DKA C;  4LF6 L;  3E0E A;  4JI1 Q;  1M90 C;  1YHA A;  1VQL A;  4GLA C;  3S15 H;  2GVA A;  4C3I H;  3CCL A;  3PUW A;  4GOP A;  4A3G G;  1YIJ A;  4LFA Q;  4LF8 Q;  2WP8 J;  4OO1 I;  2JA5 H;  3CCU A;  1XNR Q;  4A3D H;  1XPR A;  5K36 G;  4DR2 L;  2PI2 A;  1J6Q A;  4P71 A;  5IP9 H;  2WAQ E;  1YHQ A;  1I94 L;  4BY7 H;  4A3C H;  3MEF A;  4JI8 Q;  1TWA H;  5H1S E;  4B3S Q;  1X9N A;  1KRT A;  3TS2 A;  4LF7 Q;  3M7N A;  2MO0 A;  2VQE Q;  2LXK A;  1IBK L;  2FXQ A;  1K9M C;  1Q8K A;  1AH9 A;  4X65 Q;  2NVT H;  1EQQ A;  4GKK L;  1UE5 A;  4IJH A;  4OON A;  2VS1 A;  1S40 A;  4LF9 L;  1N34 Q;  4X62 Q;  1N32 Q;  4APV A;  1HH2 P;  4UPA A;  2Q2H A;  4OWW B;  4YWK A;  3H3V H;  3PSI A;  3G48 A;  3S14 H;  4QIW E;  2VZA A;  1Y1V G;  4RG1 A;  3G71 A;  2JE6 I;  4QGU A;  4QQB X;  1JB7 A;  3AQQ A;  1KQS A;  3RN2 A;  3RNU A;  2E2H H;  1KHI A;  1Y14 B;  5JJI A;  1GO3 E;  4DR7 L;  4PG3 A;  4GNX A;  3HOV G;  1GKH A;  4J15 A;  3JC6 6;  1EYG A;  1T9H A;  3CC2 A;  4GN4 B;  3GTQ H;  3I4M G;  3BZC A;  4EX5 A;  3CME A;  2K5H A;  4IPC A;  1HNX L;  3PIP A;  4DK3 C;  3UE0 A;  3HOW G;  4IJL A;  4DNI A;  4DR5 Q;  4HJ7 A;  4JBJ A;  4A3E G;  4LF6 Q;  2K5N A;  5GAG C;  5M3M G;  1SR3 A;  1EIY B;  1VQJ A;  1MKH A;  4JBW A;  3KJO A;  2DUD A;  5IP7 H;  1IZ6 A;  5AJ3 L;  4K0K L;  1XMQ L;  4A3M H;  1YJ9 A;  3PUZ A;  4JCV E;  4DR2 Q;  1I94 Q;  2ASB A;  1EOV A;  3A74 A;  3KDF B;  1YEZ A;  1C9O A;  1B8A A;  4LFB L;  2VNU D;  3FKI H;  1R9T H;  1IBK Q;  5EAY A;  3AFP A;  1WJJ A;  1GD7 A;  4YCW A;  1L1O C;  2EQS A;  2CWA A;  1PH4 A;  4GKK Q;  3K81 C;  4A3J G;  1PHJ A;  4LF9 Q;  1VCI A;  3GO5 A;  3W5O A;  3HOZ G;  2OCE A;  2ALY B;  2D0P A;  2IY5 B;  1IXR A;  2YTY A;  4OX9 L;  3S1Q H;  1B7Y B;  4BXX H;  3HOX H;  2R93 G;  4A3B H;  4UP9 A;  1WCM H;  2OQ0 A;  2BA1 A;  3HKZ G;  2K75 A;  2JA7 H;  4R4C A;  3I4N G;  1OXS C;  4JI6 L;  4R4O A;  4DR7 Q;  4LNQ A;  3KF6 B;  4JBM A;  3NEL A;  4GLX A;  3CC7 A;  1HZ9 A;  2A19 A;  4LUV A;  1HJP A;  5C4X H;  1GM5 A;  2H5X A;  4A3F G;  1XPU A;  3RLF A;  3HOU G;  1HNX Q;  1BKB A;  1KL9 A;  2I5H A;  2RCN A;  3H3V I;  2KHI A;  4DV5 L;  3CCE A;  1A8V A;  3S1R H;  2JK8 A;  2Y0S G;  1N36 L;  5IYD G;  5HGQ A;  2ZJQ A;  3NBH B;  1X55 A;  3PO3 G;  2YYZ A;  5J3B A;  3G6E A;  1UEB A;  1ASZ A;  1GVP A;  1WFQ A;  5AJ3 Q;  5C3E H;  3OW2 A;  1VQ4 A;  1NJI C;  4K0K Q;  4A3K H;  1QVF A;  4JI4 L;  4GOP B;  2UUB L;  3IRB A;  3A0J A;  3D31 A;  1Y1W H;  5HY6 A;  2R7Z G;  4LFB Q;  1VQI A;  3NEM A;  1YNX A;  3H0G G;  4TVA B;  1YZ6 A;  4A3J H;  4FDB A;  1VQD A;  2K52 A;  4NPS A;  5C44 G;  1XPO A;  1UE7 A;  3PO2 G;  2JJQ A;  2ZTC A;  3B6Y A;  1G6P A;  5JEA J;  1I50 H;  4BBS G;  4B3T Q;  1XNQ L;  1TWH H;  4POF A;  4OX9 Q;  3E9H A;  1SN8 A;  2AWN A;  2A8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...