2F0DA

Crystal structure of staphylococcal nuclease mutant i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0dA00
1KDAA 4KY6A 4R8NA 2RBMA 3NQTA 2F0MA 2SNMA 4K5XA 5JOBA 5IGEA 3BDCA 4PNYA 5CV8A 5KGUA 1U9RA 1EZ6A 1SYEA 5I9OA 3S9WA 5KYIA 2F0TA 5C5LA 4TRDA 3QOLA 5E3FA 3MEHA 5JAVA 3ERQA 5EKLA 2F0DA 4DGZA 5C4ZA 3E5SA 1A2TA 4F7XA 3NP8A 2OEOA 4EQPA 2F0GA 4B9WA 2F0JA 4DFAA 2EXZA 1SNOA 3SHLA 4IALA 4N9PA 4EQNA 4H7BA 5CV7A 1F2YA 2F0VA 2F0OA 4B9XA 3MZ5A 4K8JA 5E1FA 2PZUA 5CV5A 5IGDA 3PMFA 4KY5A 3D4DA 4ID6A 4DU9A 3MHBA 3TMEA 2F0NA 4E6IA 1KABA 3NUCA 3OSOA 4K5WA 4ZQ3A 3HEJA 5C5MA 5NUCA 5CV9A 4K2KA 3RUZA 3SK6A 3TP7A 5J22A 3EJIA 4EQOA 5C3XA 3HZXA 4KTAA 2EYOA 2PQEA 1EZ8A 2KHSA 2M00A 4ZUIA 5KEEA 2EY1A 2PW5A 2F0QA 1EY9A 2HQEA 3C1EA 3QB3A 4K6DA 1A3TA 4K5VA 3SK5A 3SXHA 5CGKA 2PZWA 4KV6A 4RKLA 1EY4A 5I9PA 2PW7A 4HMJA 4MIUA 5IGBA 1EY6A 3QOJA 4QF4A 3TP5A 4K2LA 4KD3A 1JOQA 4N9TA 1KAAA 1SNPA 2PYKA 2EYHA 2O4XA 1NSNS 3OMGA 2EY2A 3D4WA 4J1MA 3BDLA 3VA5A 3ITPA 1JORA 1STGA 1STHA 4YIJA 5KIXA 3EVQA 4IUNA 2F0WA 4QB4A 1SNMA 4WRDA 2RDFA 2F0FA 3D6CA 5KYLA 1SNCA 1F2ZA 3NHHA 4NKLA 5F2DA 5EKKA 1EY8A 3TP6A 1JOKA 3NK9A 1JOOA 5IGFA 2EY5A 3T16A 3NXWA 4K8IA 3OMCA 1TQOA 2PZTA 5IODA 1A3UA 2F0KA 2EYLA 4HTHA 4OL7A 5CC4A 4NDXA 2KQ3A 1F2MA 3T13A 5EGTA 1KDCA 1TR5A 1STBA 1KDBA 2EYPA 3DHQA 2WACA 3H6MA 4G57A 4K14A 4KJOA 4J6HA 3TP8A 4EVOA 2F0UA 5IIFA 1ENCA 1SYGA 2LKVA 5CV6A 4QMGA 1A2UA 2EY6A 4KJNA 3DMUA 2SNSA 5M9OA 4NMZA 4KHVA 4DF7A 3LX0A 1SYBA 2NUCA 5HURA 5KRUA 3OWFA 1II3A 2OF1A 4ZUJA 1EYCA 1EQVA 2F0PA 2F3WA 3V2TA 1ENAA 1EY0A 2EYFA 3C1FA 5IOCA 1STYA 3R3OA 5J1ZA 3U9OA 3P1HA 2EYMA 2F0SA 4I65A 3SK8A 2F0IA 5CV4A 4HMIA 4LAAA 4NP5A 3SR1A 5C6AA 5ISRA 4RKBA 4KY7A 3P75A 3MVVA 5DAUA 1EY7A 1SYFA 5DEHA 4IZ8A 5C4HA 3D8GA 4WORA 1RKNA 4PMBA 5HGTA 3SK4A 4PMCA 1AEXA 2F0EA 1SYDA 1TT2A 2QDBA 1EY5A 5C3WA 5K5PA 5I6WA 1EYDA 1STAA 1STNA 2F0HA 1EYAA 5I6YA 4F8MA 1SNQA 2F3VA 5J39A 1NUCA 4ME5A 5IGGA 2F0LA 3EROA 4S3SA 1SYCA 2OXPA 2ENBA 3MXPA 5CR3A 5IGCA 1IHZA 2RKSA 1SNDA 4KD4A 2SOBA 2EYJA 4ODGA 1A3VA
chains in the Genus database with same CATH superfamily
1SR3A 4MHEA 3AYHB 5IYBG 4RGOS 2VY3A 4R4CA 2SNMA 1FNVA 1HQRD 2NTSA 2GVAA 3LWUA 1VQGA 4YWMA 1EZ6A 1GHJA 2F0TA 3BS1A 4GKKQ 3S17B 3KFUA 5EKLA 3ZYYX 1XX8A 3LGJA 3NP8A 1PZJD 1SNOA 2PMZE 1AN8A 4EQNA 3M4PA 3VR2A 1QZHA 4RGTA 2WINB 3HS0C 3C46A 4KHPQ 3KOJA 4AQYL 1C8CA 2K7VA 2WKDA 3MXNB 3I7FA 2IX1A 4A75A 3OSOA 3W3AA 1F9QA 2A69C 2C5CA 2A68C 3EJIA 4BY1G 3RZDH 2UUBL 4IURA 2FJ2A 3BDOA 3W5OA 1RF2D 4CJ2C 3H3VI 1D7QA 3H3VC 4HJ9A 4IJHA 1QILA 4KLKA 3PIO3 5IT9c 1EFID 2NTTA 1Y14B 1SRUA 4UP7A 2AQ3B 1R9TH 4JG2A 3VA5A 1F9RA 1UWVA 4YWLA 4L63B 2KHIA 3ND8A 3HOUH 1NBWA 2XWBB 3NXWA 3PIPA 3OMCA 4YHHQ 2V1CC 4IFDH 4DR2Q 1CSQA 4G57A 1X3QA 3TP8A 4QY7A 3C3LA 3VR4A 3J81E 5IIFA 1R4QB 4A93B 3I56A 4L5SA 2A6HC 1G6ZA 4RGMA 1BCPD 3KF8A 4X6AH 1OTCA 1B9NA 3A8KE 3S24A 1WD0A 1XMOQ 3CD6A 3UI2A 4B08A 2E8GA 4IPDA 4X3TA 4X66Q 1HA5A 4JBMA 1PZID 4HMIA 1I6VC 1VCIA 1NNXA 5C6AA 3CMAA 4GKKL 1I4PA 1K73C 4A3BG 2JA9A 2IWHA 5JVH3 2JP1A 1QUQA 3D8GA 1RKNA 2J4XA 1LTID 3RZOH 1N36Q 2ZM6L 3BJUA 1PMRA 4KHPL 3HOWH 2HIXA 3M4OB 4GN5A 1PTOC 2JXMB 2X6LA 2FFKB 3MXPA 2WAQB 4C3IH 4LMQD 5DM63 1A3VA 2NN6I 2HUGA 2F0MA 2KCCA 2VUMG 2NB0A 4C56C 2B2WC 4YY3L 4RA8A 3R8BA 4BBRH 4LF7Q 5C3EG 1VQ9A 4C3HH 2A5HA 3QOLA 5E3FA 2Z6BA 1TWCH 2A69D 2AMCB 2A68D 2F0JA 3HOYH 1ESRA 1YNJC 4L6TB 4RHSA 1BUVT 4UP8A 2DY7A 3OOCA 4HIMA 2JA8G 1VS0A 4IUVA 4IPHA 1OO9B 3E9IA 4K2KA 4YHHL 4A3IB 4IUTA 1LABA 2KOLA 2RVLA 3BVMA 1TXYA 2JN4A 4Z9CB 3HOXH 4DR2L 3K5MA 1EZ8A 2SDFA 3W1GA 2PW5A 2F0QA 1Y1WB 3SXHA 2JEAI 1CKMA 2PZWA 4A3KB 3DLLA 5IT9E 1SNPA 3PO2G 4FF4A 1D1KA 2I46A 2Z9HA 1XMOL 1HNXQ 2YTVA 1W3SA 5CORA 4APVA 4X66L 5IYDH 5LL6X 3M9BA 1M8AA 3HP3A 2ASBA 3TS2A 4EQ5A 1OXUA 4F87A 3HRZC 3CCEA 1EQRA 1LTTD 3DHQA 4FYDA 3R2TA 2SEBD 5KNDA 4WFN3 4UHVA 3T56B 1GUNA 2ID0A 4GLXA 1A2UA 2EY6A 1PH9A 3QJYA 1NR2A 4YCVA 2K52A 1FD7D 2EPBA 3LX0A 4A3JB 1PH7A 3FKIH 1YBYA 1HXYD 2WV6D 4OXPA 4JCVE 1LUZA 3UDFA 1BO0A 3SK8A 1S4ZA 1PTOD 1BR9A 1LO5D 3CMEA 3J7A5 3U4ZA 1HHVA 3EA6A 2XVSA 1PTOF 1SE3A 3H0GH 4GN4B 1LTLA 4IZ8A 5C4HA 2EDGA 3A8IE 3A5ZB 1U0LA 2EJGC 3F2CA 1EYAA 5I6YA 4JI3L 2Q2TA 2Q8RE 1LYLA 4S3SA 4X65Q 4QGUA 2QF7A 2HIVA 4DV3Q 5BN3A 1ET6A 1T5EA 5KGUA 4DV6Q 4RMFA 3GV6A 3AU7A 2AWOA 1U4LA 4F7XA 1EOTA 4IALA 4N9PA 4DKAC 4FXKC 4JK1C 1HNXL 3K7AB 5E1FA 5IGDA 4DV7L 3A5UA 3HOZH 1V1QA 3S1QH 5FLMG 2JA5H 3I91A 3HEJA 5NUCA 1UUPA 4DXGA 5FJ8G 2K5QA 1KLUD 3KLWA 1SJED 2C35B 2N55A 2UU9Q 4HSPA 5KEEA 4XT3B 5CGKA 2JYOA 3KUPA 2E2DC 4RKLA 1JICA 1SFOB 3HKSA 3BU2A 3DWPA 4LUZA 1AP0A 3F2UA 1IW7D 3CQZB 4QUCA 4JI0Q 2HHHQ 2NVYB 1ESFA 1TWGB 1SNMA 1B4OA 3NHHA 2IPKD 3EN2A 1EY8A 2O2LD 4WJ3M 1JOKA 2F4VQ 3JAML 3CHBD 4L5TA 2KQ3A 2WAQE 2NZHA 3K6OA 4NXNQ 5D14A 1RD9D 1FR3A 1LV9A 2MP1A 1E24A 3HOVB 1Y8NB 1SYGA 2LKVA 3K0XA 3QG1A 1DOLA 2SNSA 2RSOA 2VQFQ 2MHVA 5C0XJ 4A3EB 1XNQQ 1WCMB 1Q1BA 5ELBA 3KDFA 1WD1A 1SE8A 4DV3L 1B3QA 3M4YA 1SDFA 2N88A 4FDBA 4DK3C 4DV6L 3S15B 4NP5A 4TKOB 3J80E 1EEID 1VQ6A 2AWNA 2R92B 3FMCA 2JK8A 1IBML 2K28A 2EXDA 3RN5A 4B3SQ 1I4QA 3C2PA 3HOUG 5CR3A 3PQIA 4MZ9A 2VQEQ 4J8QA 3S16B 4B3TL 1PTOH 4PNYA 3KLRA 1CM9A 3I4MH 1DD2A 1VQMA 4GZYC 1PHJA 2F52A 3JAMi 2NN6H 2R7DA 2Z4IA 1LT6D 4MTKA 1IZ6A 3M3YH 2HHHL 3GTJB 1F2LA 5JVG3 1TIID 3D4DA 3TMEA 3S2HB 1P8LA 2OTJA 2F4VL 3SK6A 4LF8Q 2KENA 3PV0A 2Q8TA 3U50C 1J9OA 4MN3A 1PYSB 1X32A 1MHWC 1WJJA 3G6JB 3BVZA 1IBKL 1DGSA 1L0XB 2B8GA 4NPSA 3GTPB 4DK6C 1Y1WG 4HMJA 3ICEA 3GTLB 4CGYB 5FO9B 1IYUA 5J3BA 2VQFL 2KUMA 1XNQL 1SN8A 2K6AA 4R9WA 2KJXA 3R2IA 3D6CA 3PO3H 1PRTC 1BOSA 1V9PA 1HRJA 3T51B 4BBRG 4POFA 5EQ0A 3CCSA 3CF5A 5CC4A 2Y0SG 2P5ZX 1KDBA 2EYPA 3HOYG 3HGBA 1A0IA 1YIJA 3RMHA 4P73A 2K04A 1DCZA 1UE6A 3DMUA 4B3SL 5A35A 5D3IB 3UDGA 1I94Q 2NUCA 3OW2A 4DNRB 5LMUL 3GTMB 1SAPA 1ONLA 2ZT9C 2H1EA 1Z7TA 5M5WB 3J7ZC 2PMZB 2RQXA 1XTCD 4ZKCB 4B3RQ 4JOIA 1QWYA 2RA4A 1SYFA 1SE4A 2XN9C 2BOSA 4LF4Q 1STAA 4UDUC 2F0HA 1K8OA 1XNRL 5C4XH 4ME5A 5TSSA 5GAEC 5EBDA 2R6GA 1HUMA 2B2TA 4LF8L 1TY0A 3LNNA 1DXMA 1TS5A 1TWFB 4K5XA 1E3PA 5JPNC 4A3BB 3URYA 4TRDA 4DUZQ 1KL9A 3ERQA 2LY7A 1HUNA 4RWSC 4DV1Q 4B9WA 1WTWA 1K83H 5FO8B 2IX3A 4C2MB 3FKIG 3T1YQ 3I73A 4RG1A 3S2DH 4E6IA 1KABA 3S1MB 4K5WA 4LWCA 5C4JB 4DNIA 3FHWA 2VUMB 5M5YH 5C3EB 1AFPA 3H0GG 1V43A 4C1NK 1PFBA 3WDNA 2OWOA 4K5VA 5I9PA 1VQFA 2AKWB 1JT8A 2PI2A 3TZUA 1PRTF 2E2JH 4FF1A 2K01A 1QUQB 1Z9FA 1I94L 4YCWA 3BDLA 1SLJA 3F2DA 3NEMA 2RDFA 2F0FA 3MFYA 1SNCA 4DV5Q 1B1ZA 3TRZA 4N8X1 3V96A 1JOOA 4A3CG 3T16A 4DPGA 2E75C 2MO1A 1WTRA 3MAQA 4DR6Q 4JI2Q 4B3RL 2AQ2B 3H6MA 4POGA 4AYBE 1ENCA 1W2BA 1O7YA 1JMCA 3HOVG 3BVGA 4G7ZC 3PO2B 1G51A 5CYUA 1NTGA 2G9HD 3HOZG 4CBVA 5A2QE 1E2ZA 5DLQE 1L0YB 2F4IA 4PZ6A 2JA5G 4A3DH 3OHXC 2F3WA 2LXJA 4LF5L 5J1ZA 2JA6B 3TN2A 4XQJA 3TSSA 3BG3A 2YU9B 4Q0FA 4DUZL 1Y1VB 3PIOA 1S5BD 4JOIC 4DV1L 1KD1C 3S14H 4JI5Q 1TWAB 3GV3A 1Q46A 5EAYA 1DONA 1I50B 3EBEA 3T1YL 3IKJA 3S1NH 2GA4B 2OXPA 1CT1D 4KD4A 3DWQA 5EKIA 2B2TC 3OYYA 1KDAA 5E4WC 4AYBG 1GOZA 2EOTA 2CVRA 1BCPC 4XTCS 1BKBA 2DN8A 1CK1A 3I90A 3NE5B 4UPAA 1K9MC 1D2BA 4EQPA 2PQAA 3AQQA 3MXGA 1CQFA 3X3MA 4GKJQ 1ICFB 3NBHA 3SHLA 4A3GH 4EGVA 3GTQB 4X3KA 2ZXPA 1VQJA 5FOBB 4XQNA 4U68A 4UP9A 1IKLA 4IOAA 4DR6L 2K75A 3FPPA 4JI2L 2B2WA 1I3QH 1TS4A 4H02A 3HFZB 1BNZA 1PYWD 4YCUA 1X3FA 2HQEA 2KEDA 1CI3M 2E2IB 1Q8IA 2PW7A 3KF6A 4MIUA 4H0LC 5JEAJ 1MI2A 5IGBA 1Z6HA 3NELA 4KD3A 4O42A 4KHZA 5IYCH 4DR4L 1M90C 1KAAA 2UXDQ 1TU2B 2Q2HA 4H44C 3DEOA 4ILWA 3D4WA 2L15A 5KIXA 4WRDA 2K33A 5F2DA 2EIFA 2KA7A 4ZCKA 2EY5A 2R93H 1TQOA 1I6HB 3I4MG 1XTDA 2MO0A 1TS3A 1K0RA 5EGTA 1CA5A 1STBA 2NN6G 4RAUC 4J6HA 1R4PB 1VMPA 5CV6A 3CKIB 3QIAA 1EWIA 2ZJQA 2Z0SA 3NENA 5IY0A 2Q2UA 2J0TD 3V2TA 1II3A 2OF1A 4XYOA 3CCRA 1K8GA 1CHQD 1SROA 1L2FA 5IOCA 2EVBA 1NMGA 4IUUA 2K1BA 2QW7A 1GO3E 2QILA 3K57A 2JA7H 2EQSA 1KTKA 1GXDC 5ELNA 4A3MH 1OXSC 4QIWB 4GKJL 2RDGA 3QWNA 2LMCB 2F3VA 2N3SA 5C44H 2UXBQ 1ZXTA 3BZCA 1SNDA 2L11A 3I70A 3RZDB 1BCPF 1PVOA 2H4OA 1PDQA 1VQIA 3L2PA 5JOBA 3NTHA 1YHAA 1YJ9A 1VQNA 1CSPA 4GN3B 2I5HA 2B2VA 3FDTA 1OXVA 5GQOA 3RN2A 2B29A 2B2YA 1XPRA 1A62A 4OWTB 2UXDL 3CCMA 2FHTA 4RHRA 3MA2B 4JI6Q 2MPMA 3HOUB 4PG3A 4ID6A 1X3PA 3S1RH 3RUZA 3E0JA 3TBIB 3TP7A 3WOEA 4EQOA 1VQHA 2I5MX 3HZXA 1HCZA 2EE1A 1S5DD 2L5TA 1K28A 3ULLA 1MD2D 1S5FD 4HJ7A 2I0QA 1U4MA 1CUKA 3QOJA 2EZVA 4DV4Q 4FVMA 5C4XG 1VQKA 3ULJA 1IBLQ 2DY8A 2MUYA 3JAME 1DYQA 4GNXA 1JR0D 1X54A 1JORA 4YIJA 1C9OA 4QB4A 4RCOA 3TS0A 1G6PA 2F03A 5FLXL 1IYJB 3Q24A 1L1OC 3T13A 4MNOA 1UE1A 4LUOA 4OO1I 2FINB 3SVMA 1NJIC 3NTIA 4KJNA 5IE8A 2UXBL 1S5ED 4A76A 5CMDA 4C3IB 1H9JA 3A0JA 2K05A 2J7ZA 5IP9G 1ENAA 1EY0A 2I07B 2D5DA 4BBRB 1WFQA 3U9OA 5K36H 4A3LH 1QJOA 2JA6G 2QEJC 2Y0SB 1TWCB 1Q1EA 1QNUA 1IW7C 3MVVA 1VQCA 3PIP3 3HOYB 3D31A 4A3FH 1PH5A 1Y1VG 2VB2X 4CDCC 3U58A 4HN7A 1HZBA 1N36L 2RDHA 4U673 5BN4A 4FXGC 4JI6L 2B63H 1QZGA 2R61A 4F8MA 5M3MH 1N33Q 1EFWA 1K3BC 3SDZA 2SOBA 3HOXB 2X6GA 1X9NA 4R8NA 3IRBA 5M3FH 4JBWA 3BDCA 4LF7L 1H9SB 1BVSA 1B3AA 3J80c 4XIGS 4QJFA 2B2VC 3E5SA 1I5FA 2K5WA 3J7AV 5EPLA 2B2YC 4R4TA 1V1OA 2AQ1B 3PUVA 1AZQA 3A54A 3VA7A 4A3DG 4DR1Q 1KLGD 4DAYB 3K7AH 2CW0D 3WOFA 4DU9A 1HNZQ 3MHBA 3PUWA 1S3OA 4KKTA 3NUCA 2KEEA 3GD7A 4IUPA 4DAMA 1ML0D 5C3XA 1EU4A 4DN4M 3E0EA 1VQDA 1MKHA 2KHSA 2XRQD 2M00A 4LK1C 3FP9A 4JI4Q 2Z8LA 1DZ1A 3SK5A 3MFGA 1ILPA 1EY6A 2HCCA 4K2LA 3I4NH 3MXNA 1BBXC 1JE5A 2PYKA 2O4XA 3RLOA 4PZ7A 3FKIB 4JVZA 3J81L 4QIWE 1CKNB 1IL2A 3HKZG 4GNXC 1WTHA 2F0WA 2NVQH 2NVYH 3TP6A 2KCMA 1KAWA 1VQOA 1WTXA 4RFBA 1S72A 3Q6SA 3H0GB 4BY7H 2B39A 1BXTA 4NW2A 3T1HQ 2I5LX 4X3SA 4GOPC 2K32A 4LNQA 4BBSH 4A3GG 1AW7A 3TQYA 4F88A 1BBWA 4FF2A 1YEZA 3PUYA 4KHVA 3AMUA 3OIQA 3PGZA 2WIIB 3P1HA 2K5DA 2IHEA 3K58A 3S15H 4Y7NH 1FVIA 5IYCG 4LF6Q 1J6QA 3SK4A 4J15A 4G7HC 1TT2A 1EY5A 2O5IC 3CRKC 3HOZB 4DR1L 2OTLA 3CC4A 5J39A 1PFSA 2JSOA 2JA5B 3W1BA 2F0LA 3EROA 1HNZL 4TVAB 2ENBA 4X65L 4N8FA 3CCVA 4KI0A 5M5XH 3KBXA 2FMCA 1KRSA 4V190 2R93G 3RR5A 3J81i 4K0KQ 4HJAA 5IGEA 5CV8A 1GUTA 2QA4A 3NTKA 3S16H 3A74A 1CTMA 4JYAQ 1PFNA 2K4KA 4DGZA 1PV4A 2RSNA 4HIDA 4CHTB 2WFWA 3B6YA 1CFMA 3F8TA 1O7LA 2MGSA 1KNEA 2OCEA 4B9XA 2CKZB 4R1JA 2LFNA 1GD7A 5IT9L 2F0NA 5AFWA 3CPWA 1C48A 5J22A 1FNUA 1WYDA 2WKCA 4AYBB 1V1PB 2JA7G 5IYBH 2ZJPA 4IFDG 3M85A 2K50A 1I4XA 4KTAA 4A3MG 1A63A 2ICEC 5HGQA 1KIXA 2UU9L 5JPMC 2TMPA 3RD4A 1FYCA 1EY9A 3T1HL 5EPKA 4ULLA 2O5JC 1W6JA 1ENFA 2F1MA 2Y0SE 1SMYD 1Q7YC 3GTLH 4BS9A 5C44G 5IWAQ 4JI0L 1DJRD 2EY2A 3K5LA 4DK0A 1Q8KA 2JEBI 3ITPA 1SJHD 1VQ8A 2ALYB 3A55A 1VF5C 1IL8A 4BA1I 4O0AA 2F0KA 4B3MQ 2EYLA 4BY1H 1M4VA 4NXNL 2NVXH 4LF6L 2DUDA 2A8VA 3HOWG 1OXTA 3D6WA 4DR5Q 1QNKA 1X56A 2FXQA 2N78A 3K0YA 3BYTB 4OO1H 1SYBA 5HURA 4QCLA 2F0PA 3UE0A 4C3IG 2C9OA 2EYFA 1PTOB 4K0KL 1DM0B 4TQUS 3I4MB 1UEAB 2F0IA 2NBFA 5CV4A 2WP8J 2XSCA 4JYAL 4ZAIA 4C3HG 5M5WH 3P75A 2ZXOA 2N8NA 1EOVA 3MC0B 5FO7B 1JB7A 2VW9A 3VYSA 4HJ8A 1TWHH 2BDNA 4O1NA 2E2HB 3H91A 3M3YB 4PMCA 2F0EA 5G3LD 3D0FA 4DA2A 1UAPA 4XXEA 1VQ4A 1SXTA 2GN5A 5G3LF 3A7AB 1X55A 4C3JH 1GM5A 4DK1A 2VQEL 1DOMA 4ODGA 4DV2Q 3O13A 3QR8A 3HOXG 2MJ8A 3ERSX 1ZYRC 1KNAA 5KYIA 3GTGH 1VQ5A 1J8IA 3GTOH 3M4QA 5BR8Q 5IWAL 4H7BA 5ELCA 1Z47A 3BZKA 1ICWA 1Y69U 2WB1G 3GP7A 5IYDG 3VYUA 1ILQA 3GTKH 5K36G 4A3LG 2R7FA 3SE0A 4B3ML 3S1MH 1U4RA 3N6RA 1A8VA 3CCQA 4A3FG 5HY6A 3L7ZC 2BDOA 4KKSA 3L9AX 4K6DA 5C3EH 3QB3A 1LTAD 1A3TA 3DM3A 2R3ZA 1HR0Q 2B63G 2R7ZH 1AE3A 2NVTH 4X64Q 4DR5L 4N9TA 4QQBX 4FXDA 1E7ZA 3CPFA 5M3MG 2L12A 1G291 2L1BA 5GAGC 3VDYA 1PH4A 2JA8H 5M3FG 2NZ1D 3KF8B 4DAVA 4KK7A 1EL0A 1D6EC 1Q90A 5IGFA 1HZ9A 1A3UA 1QOHA 1KC8C 1LT4D 1C0AA 3NBIA 3KLSX 1H9RA 1EUJA 3IFTA 5C4XB 4OGQC 2CCZA 4JV5Q 2XIWA 3CCUA 3TZDA 4HR7B 4JI8Q 2Q8IB 3J7AF 4DV2L 1CZWA 1MJCA 5GAHC 4I65A 5T1IA 4P74A 1XWEA 1V8QA 1YZ6A 1E1OA 4LF4L 1KQSA 1D8LA 3MWYW 2X69A 1TWAH 1ZYRD 2DNCA 1T5XD 3S2DB 1I50H 4DUYQ 2QCPX 5LMNW 5M5YB 1QB5D 1U5KA 4BY7G 3EQLC 5GROA 1BDOA 2CWAA 3P20A 1TKWB 4GLAC 1IYVA 3PCOB 1SYEA 3RLNA 5T1GA 3K5NA 3G48A 2E2JB 3MEHA 1NMFA 5C4ZA 2L9HA 2OEOA 4X64L 2DJGC 4V0BA 3PF4A 3NPPA 3TEHB 3ER0A 1F2YA 1PH3A 2UUCQ 2E76C 2PZUA 1N34Q 4OWWB 4P72A 1N9WA 2KHJA 4HCSA 3IAYA 1LTGD 2XWJB 3QO2A 2HDLA 1RODA 2EYOA 1LLRD 3TREA 1E2VA 1O7ZA 3NWSA 1JCKB 5AJ3Q 2B8FA 3S17H 4JV5L 5JEAH 3TP5A 1YJNA 1YNND 1CZGA 1D5XC 4JI8L 2PCFB 4A3DB 3F2BA 4YWKA 1PZKD 2VS1A 1EIHA 2FMMA 1VQPA 1N32Q 2ZXRA 3KBGA 1YI2A 4DV5L 3V05A 5FLMH 2VB3X 1P16A 3CP0A 1G91A 4LFCQ 5LMNQ 1QE6A 4UY8C 3KLSA 1S40A 3CU7A 5BN5A 2PPBC 1FL0A 2EJFC 4CKEA 4DNTB 1SSOA 4P75A 3IFDA 3S1NB 1E22A 1Q82C 1J5EQ 1AH9A 4DUYL 4NMZA 3I3CA 2BA1A 3UE1A 3HKZB 5KRUA 3JAMc 1EYCA 1PH1A 1K8AC 1H95A 3PSIA 2EYMA 3Q23A 2K03A 4HIOA 1ASYA 3VYTA 3SR1A 1YHBA 1RL2A 1KHIA 1L1OA 4KY7A 3CAMA 4RGNA 4JI5L 5IP7H 4QUFA 4A3GB 5C0XI 5K5PA 3KK7A 2L0CA 2ZM6Q 1LTRD 4A93H 3DWAA 1OXXK 2UUCL 5ELEA 1N34L 4FP5D 1BBUA 2F3IA 3K8AA 2XNAC 1I3QB 1K0SA 1JJGA 3L3OC 4BXXH 1F77A 4YY3Q 3STBC 3SGIA 5JAVA 5AJ3L 2AUJD 4JC0A 4ZYSA 3GO5A 1MBYA 5CV7A 4OO1G 1F9SA 3M7NA 1HNWQ 4K8JA 1QCBD 2BE5C 3FEWX 5CV5A 4LFAQ 1N32L 1GUWA 5FK9C 4KY5A 3PO3G 3M4OH 3I8ZA 4K6LA 2R93B 3VYRA 1PH2A 4LFCL 1EIFA 2MQHA 5LMNL 1LM0A 1H9KA 1B2TA 4JW0A 1PRTB 5DM73 2PQEA 1QVCA 4PMWA 2IY5B 2A6EC 1I4GA 2GVBA 4ZK9B 2YYZA 2D2CC 1J5EL 1WTOA 1R9TB 1QG7A 1VQAA 2K5VA 2XRSD 3HG9A 4J1MA 4NXMQ 4C3JG 1QVGA 1EU3A 1STGA 1X6OA 5FKAC 1WVLA 1Q3LA 2B2UA 4OHJA 4CKCA 1F2ZA 4X3UA 5A2QL 3KJPA 2JA7B 1RHPA 3SEBA 2A1AA 2PZTA 2JE6I 4HEDA 4A3MB 4IFDJ 2IL8A 3KDFB 4A3IH 3D4RA 3MEFA 1TR5A 2Z6KC 5E4XA 1Y1WH 2CW0C 5C44B 4A3KH 5H1SE 1GUSA 3DUZA 1HQMC 1B44D 1G2TA 3X3NA 3I72A 1LTBD 2F0SA 2RHQB 5I2YA 1O7IA 4LAAA 3VR6A 1NR4A 4HJ5A 2TSSA 2OT2A 1A15A 4IOCA 4KKUA 3K81C 5DAUA 2R7ZG 2QKIC 1EY7A 3RZOB 4WORA 3AEVA 2NWGA 1UE7A 3RLFA 4GOPA 3HOWB 1AEXA 3MXUA 5C3WA 1HNWL 1JWUD 1ZKOA 3STBD 1CKOA 3E6ZX 4LFAL 3CW2C 4JI3Q 4XQQA 1E2WA 3S1RB 4DR7Q 2PNRC 4BA2I 1HFNA 4G7OC 1HZCA 4A3JH 1XPUA 1JWSD 3I2ZA 2BE5D 4C3HB 5KNCA 1E0BA 5I9OA 3PUXA 5C5LA 1G8ZD 4GLVB 3H94A 1IXRA 4O2DA 3H15A 3TDQA 2Q2IA 1MGSA 3A7LA 1UNSA 2F0GA 1I4HA 4XDXA 1SEBD 3F1ZA 4NXML 1VQ7A 2F0VA 2F0OA 2A6ED 4DV7Q 1W6KA 1SMXA 4ZLTF 2A6HD 2KBNA 4AIMA 3N52A 2MFIA 5CV9A 4L8JA 3Q8DA 2BH8A 3GDEA 3I4LA 1VDZA 3HKZE 1H9MA 1VMCA 1MSGA 1ET9A 2EY1A 2ICIA 3C1EA 4KV6A 4ZKBB 1EY4A 1N8RC 1STEA 3DXJC 1Q81C 3K5OA 4DV4L 1JOQA 1JWMD 2D62A 1IBLL 1WTPA 2EYHA 3OMGA 1D5MC 2WB1B 1YITA 5EBCA 2PO4A 1B53A 3EVQA 3G7LA 1Q86C 5KYLA 4NKLA 2B2UC 3E9HA 1GVPA 4K8IA 1VF7A 2A19A 4A3FB 4OL7A 4ME3A 4JPBW 2YV5A 1GUGA 4PQXA 2B63B 4L5QA 2NYZD 1GUOA 2M2LA 3CRLC 3GQBA 4EVOA 1MJEA 3JC66 5M3MB 4QMGA 3FRPB 1HTLD 1PH6A 1SFOH 3EFXD 3G71A 4DR7L 4DF7A 4OX9Q 3CQZH 2ES2A 2XGTA 5M3FB 5D65A 1RJTA 2XTIA 1YNJD 1TWGH 4GS3A 4HAEA 2G9DA 1SBBB 4A3CH 1K8MA 1WOCA 1XYIA 1SMYC 2BH2A 1TS2A 5JEAG 2QEXA 1KXLA 1XJVA 3CCJA 1VQLA 5HGTA 1BCPB 1SYDA 3BZDB 1IBMQ 3HOVH 3A8JE 1MIUA 1G2SA 1N33L 4C1NI 3I55A 4OELB 3OIPA 4KMUC 2ZTDA 5C0XH 1M1KC 2CQOA 5L37A 4A3EH 1WCMH 3Q0AA 2KVMA 1LT5D 4B3TQ 2IW3A 4OEMB 1LACA 1U9RA 2CH4W 1Q12A 4H13C 4I7AA 3S9WA 3E3XA 5ELDA 4Y52H 1B9MA 1JQYD 2CQAA 3I4NB 2F0DA 2CH4A 2V4DA 4M8AA 3OPOA 2KECA 2R92H 4JI7Q 2HT1A 2IT1A 3FPUB 4XT1B 3K59A 5JJLA 3S1QB 2NVQB 4FO2A 3PMFA 4CKBA 3H3VH 2K14A 4BY7B 3I4OA 1B7YB 1X3EA 2ZJRA 2IX0A 3L0OA 1YHQA 2VNUD 4JI4L 2D0OA 4ZUIA 5IP7G 4HIKA 1IBKQ 4BBSB 4LUVA 1LTSD 2PNHA 1EYGA 4A93G 4QF4A 5GADC 3W2DA 1CQVA 1DOKA 3A56A 4OX9L 1STHA 2VXWA 2YTYA 1D1IA 3GTJH 1PA6A 2OQKA 4BXXG 4X62Q 4Y7NB 3RNUA 1VQBA 3S2HH 4NDXA 1B70B 3Q22A 4IPCA 1FJGQ 2WACA 1FGBD 4K14A 3ZJYC 2RCNA 3KJOA 5ELFA 1TVXA 2KCTA 3GTPH 4P71A 4TSSA 5M9OA 5M5XB 2CHBD 3U9SA 1Y8PB 4ALPA 1JC7A 3OWFA 2LS01 4ZUJA 1EQVA 2HCIA 2WAQG 5LMUQ 1STYA 3R3OA 1ASZA 4JI1Q 5JJZA 1HA6A 4RKBA 1RTNA 1PXUA 4P2CB 3H09A 4JI7L 2ATWA 2E2HH 5I6WA 2BCOA 1EQQA 4UAIA 1NUCA 2PQAB 1XNRQ 2D9UA 1BF4A 3NBHB 3UDIA 5IGCA 2RKSA 4R8IA 2EYJA 2IJ0A 2D0PA 4FNFA 3R93A 3NQTA 4R4OA 3CCLA 4A3IG 2WB1E 1CHPD 1RIPA 4KN4C 3GTMH 4I7ZC 1HR0W 4IQZA 4IPGA 1K3RA 1WTVA 1A2TA 4A3KG 3VR3A 4DAPA 4LFBQ 2EXZA 2K5NA 2DJFC 4IUQA 1QVFA 3WWVA 4Q5VA 3KF6B 3MZ5A 2MNAA 3OTOQ 5C5MA 4OONA 1H9SA 4X62L 1UE5A 4DR3Q 4BY1B 2VZAA 4HCEA 2OQ0A 2LXKA 3NQIA 4IO9A 4A4IA 4R4QA 2NVXB 2AHOB 1NE3A 3P7JA 1TWFH 1FJGL 1CA6A 5CBAE 1NCVA 1EWHA 2G5DA 3ULPA 4A3BH 1L1OB 1JJCB 4PV1C 1MSHA 2B3GA 4DAYA 5LHY1 2RHSB 1Y8OB 4XYQA 1PLFA 1RDPD 1T9HA 2K5HA 1U4PA 3AFQA 4IFDI 1NAPA 3PO3B 1GHKA 1YVCA 1L0WA 4IUNA 4C2MH 4FF3A 4A3JG 1C4QA 2RF4A 2JQOA 2YTXA 4DV0Q 1XMQQ 2E5LQ 3KYHC 4JI1L 1HPCA 1SE2A 5IODA 1JE4A 5C4JH 4LF9Q 1KRTA 1JB3A 1TWHB 1F2MA 1O78A 5ELOA 2VUMH 1KDCA 4MTNA 1FNWA 4ZRZA 2F0UA 4OWXB 1GKHA 1CKNA 2QGQA 5JJIA 3LWEA 2L55A 3DEPA 2HDMA 4C3JB 1F9PA 5I2XA 1A6XA 5FLXc 1IKMA 2VL6A 1B50A 4CDEC 1NY4A 3NSWA 2M9VA 3K80C 4CJ0B 4LF5Q 3T4AC 1HTPA 3PF5A 4HSVA 4G4KA 1RTOA 2CWPA 3GTGB 2PI2E 4LJZC 5ISRA 1ZEQX 1YNNC 4LW1A 1X65A 4DXFA 3GTOB 4BWGB 1TY2A 5DEHA 4LFBL 3J81j 3PUZA 3J80L 1STNA 4NB3A 5I4DA 2BA0A 2EJMA 5KNBA 2RCFA 5IGGA 1RCVD 2CFMA 3GTKB 1HFGA 3PO2H 3OTOL 1SYCA 2UXCQ 1GJXA 3EIVA 2IHFA 4DR3L 1X3GA 3CC7A 3UDXA 5IP9H 4KY6A 2RBMA 1D5ZC 5LL6S 4CDDC 2LSSA 2JA6H 1PRTD 3OW7A 1UEBA 4IJLA 2R7ZB 2NVTB 2UUAQ 2Z1CA 2YU9H 5EPJA 4CJ1B 1K83B 3I4NG 1Y1VH 4DFAA 4AH6A 5BR8L 1HJPA 3J7YW 1B8AA 5DNFA 5COYA 1YJWA 2ZTEA 3BYYB 1WI5A 2JA8B 1AZPA 4RCNA 4DV0L 1XMQL 2E5LL 3IL8A 4ZQ3A 3U4VA 1PYBA 2NZOA 2AUKA 4GNXB 2E74C 4LF9L 1YNXA 3FVQA 1PFMA 4KN7C 4R4IA 1HR0L 2A74C 4JBJA 4BBSG 4DR4Q 3CXCA 5EJWA 4WJWA 1NSNS 3AB9A 5D3DA 3VR5A 4GOPB 4JBKA 5C0XG 4PZ8A 1V1PA 3M7GA 4AQYQ 4OIJA 3J80i 4A3EG 1JJ2A 1E1TA 1EIYB 3GTQH 1I4RA 1WCMG 1LT3D 1EQTA 5EKKA 2DGYA 5JJKA 3AFPA 5E7NA 3NK9A 3CC2A 4OIKA 4EX5A 2HD3A 2N49A 4IN3A 4HTHA 4RH6A 2UUBQ 4QL5A 2Z4HA 3G4SA 3NWTA 4KJOA 2JJQA 3J81c 2QDLA 2R92G 1WTQA 1EIGA 3DM1A 2E2IH 3K7UC 4M1UB 2HQLA 2UXCL 5FLXE 3ND9A 1S5CD 5CBEE 3ONAB 3D3RA 1XPOA 2L4NA 3C1FA 4CDFC 3G6EA 1HH2P 1BQQT 1VQEA 3OWEB 2A73B 1EWCA 3MTSA 5FJ8H 2UUAL 3S14B 2ZTCA 1I6HH 3T53B 1HZAA 1PH8A 1AE2A 2Z6KA 2H5XA 1FGUA 1XXGA 4PMBA 2QDBA 1EEFD 1EYDA 1SNQA 1C7YA 4WJ4A 4ABNA 2DNEA 1IHZA 1O80A 4L5RC 2KCNA
chains in the Genus database with same CATH topology
4MHEA 4RGOS 2SNMA 1FNVA 1HQRD 2NTSA 3LWUA 1EZ6A 1GHJA 2F0TA 3BS1A 3S17B 5EKLA 3ZYYX 1XX8A 3NP8A 1PZJD 1SNOA 1AN8A 4EQNA 3VR2A 4RGTA 2WINB 3HS0C 3C46A 1C8CA 2K7VA 2WKDA 2IX1A 3OSOA 3W3AA 1F9QA 2A69C 2C5CA 2A68C 3EJIA 4IURA 2FJ2A 3BDOA 1RF2D 4CJ2C 3H3VC 1QILA 3PIO3 1EFID 2NTTA 2AQ3B 3VA5A 1F9RA 4L63B 3ND8A 2XWBB 3NXWA 3OMCA 4IFDH 3C3LA 4G57A 1X3QA 3TP8A 3VR4A 3J81E 5IIFA 1R4QB 4A93B 2A6HC 1G6ZA 4RGMA 1BCPD 3KF8A 1B9NA 3A8KE 1WD0A 3UI2A 4B08A 4X3TA 1HA5A 1PZID 4HMIA 1I6VC 1VCIA 5C6AA 1I4PA 2IWHA 5JVH3 2JP1A 3D8GA 1RKNA 2J4XA 1LTID 1PMRA 3M4OB 1PTOC 2JXMB 2X6LA 2FFKB 3MXPA 2WAQB 4LMQD 5DM63 1A3VA 2NN6I 2HUGA 2F0MA 2KCCA 2NB0A 4C56C 2B2WC 4RA8A 3R8BA 2A5HA 5E3FA 3QOLA 2A69D 2A68D 2F0JA 1ESRA 1YNJC 4L6TB 4RHSA 1BUVT 2DY7A 3OOCA 4IUVA 1OO9B 4K2KA 4A3IB 4IUTA 1LABA 2KOLA 2RVLA 3BVMA 4Z9CB 3K5MA 1EZ8A 2SDFA 2PW5A 2F0QA 1Y1WB 3SXHA 2JEAI 4A3KB 2PZWA 5IT9E 1SNPA 4FF4A 1D1KA 2I46A 5CORA 5LL6X 1M8AA 3HP3A 1OXUA 4F87A 3HRZC 1LTTD 3DHQA 4FYDA 3R2TA 2SEBD 5KNDA 4WFN3 3T56B 1GUNA 2ID0A 1A2UA 2EY6A 3QJYA 1NR2A 1FD7D 2EPBA 3LX0A 4A3JB 1HXYD 2WV6D 1BO0A 3SK8A 1S4ZA 1PTOD 1BR9A 1LO5D 1HHVA 3EA6A 2XVSA 1PTOF 1SE3A 4IZ8A 5C4HA 2EDGA 3A8IE 2EJGC 1EYAA 5I6YA 2Q8RE 4S3SA 2QF7A 5BN3A 1ET6A 1T5EA 5KGUA 3GV6A 3AU7A 2AWOA 1U4LA 4F7XA 1EOTA 4IALA 4N9PA 4FXKC 4JK1C 3K7AB 5E1FA 5IGDA 3I91A 3HEJA 5NUCA 1UUPA 4DXGA 2K5QA 1KLUD 1SJED 2N55A 4HSPA 5KEEA 4XT3B 5CGKA 2JYOA 3KUPA 2E2DC 4RKLA 1JICA 1SFOB 3DWPA 1AP0A 3F2UA 1IW7D 3CQZB 4QUCA 2NVYB 1ESFA 1TWGB 1SNMA 1B4OA 3NHHA 2IPKD 1EY8A 2O2LD 1JOKA 3JAML 3CHBD 2KQ3A 3K6OA 5D14A 1RD9D 1FR3A 1LV9A 2MP1A 3HOVB 1Y8NB 1SYGA 2LKVA 3QG1A 1DOLA 2SNSA 2RSOA 2MHVA 5C0XJ 4A3EB 1WCMB 1Q1BA 5ELBA 1WD1A 3M4YA 1SDFA 2N88A 3S15B 4NP5A 4TKOB 3J80E 1EEID 2AWNA 2R92B 3FMCA 2K28A 1I4QA 3C2PA 5CR3A 4J8QA 3S16B 1PTOH 4PNYA 3KLRA 1CM9A 1DD2A 4GZYC 2NN6H 2Z4IA 1LT6D 3GTJB 1F2LA 5JVG3 1TIID 3D4DA 3TMEA 3S2HB 3SK6A 3PV0A 2Q8TA 1J9OA 4MN3A 1X32A 3G6JB 3BVZA 1L0XB 2B8GA 3GTPB 4HMJA 3GTLB 4CGYB 5FO9B 1IYUA 2KUMA 2K6AA 4R9WA 2KJXA 3R2IA 3D6CA 1PRTC 1BOSA 1HRJA 3T51B 5EQ0A 5CC4A 1KDBA 2EYPA 3HGBA 3RMHA 2K04A 1DCZA 3DMUA 5A35A 5D3IB 2NUCA 4DNRB 3GTMB 1SAPA 1ONLA 2ZT9C 2H1EA 1Z7TA 5M5WB 2PMZB 2RQXA 1XTCD 4ZKCB 1QWYA 2RA4A 1SYFA 1SE4A 2XN9C 2BOSA 1STAA 4UDUC 2F0HA 1K8OA 4ME5A 5TSSA 5EBDA 2R6GA 1HUMA 2B2TA 1TY0A 3LNNA 1DXMA 1TS5A 1TWFB 4K5XA 5JPNC 4A3BB 3URYA 4TRDA 3ERQA 2LY7A 1HUNA 4RWSC 4B9WA 1WTWA 5FO8B 2IX3A 4C2MB 3I73A 4E6IA 1KABA 3S1MB 4K5WA 5C4JB 2VUMB 5C3EB 1AFPA 1V43A 4C1NK 1PFBA 3WDNA 4K5VA 5I9PA 3TZUA 4FF1A 1PRTF 2K01A 3BDLA 2RDFA 2F0FA 3MFYA 1SNCA 1B1ZA 3V96A 1JOOA 3T16A 2E75C 1WTRA 3MAQA 2AQ2B 3H6MA 1ENCA 1O7YA 3BVGA 4G7ZC 3PO2B 5CYUA 2G9HD 4CBVA 5A2QE 1E2ZA 1L0YB 2F4IA 3OHXC 2F3WA 5J1ZA 2JA6B 3TN2A 4XQJA 3TSSA 3BG3A 2YU9B 4Q0FA 1Y1VB 1S5BD 1TWAB 3GV3A 1DONA 1I50B 3IKJA 2GA4B 2OXPA 1CT1D 4KD4A 3DWQA 5EKIA 2B2TC 1KDAA 5E4WC 1GOZA 2EOTA 2CVRA 1BCPC 4XTCS 2DN8A 3I90A 1CK1A 3NE5B 1D2BA 4EQPA 3MXGA 3X3MA 1CQFA 3NBHA 3SHLA 4EGVA 3GTQB 4X3KA 2ZXPA 5FOBB 4XQNA 4U68A 1IKLA 3FPPA 2B2WA 1TS4A 1BNZA 1PYWD 2HQEA 2KEDA 1CI3M 2E2IB 1Q8IA 2PW7A 5JEAJ 4MIUA 4H0LC 5IGBA 1MI2A 1Z6HA 4KD3A 4O42A 4KHZA 1KAAA 1TU2B 4H44C 3DEOA 4ILWA 3D4WA 5KIXA 4WRDA 2K33A 5F2DA 2KA7A 2EY5A 1TQOA 1I6HB 1TS3A 5EGTA 1CA5A 1STBA 2NN6G 4RAUC 4J6HA 1R4PB 1VMPA 5CV6A 3CKIB 3QIAA 2J0TD 3V2TA 1II3A 2OF1A 4XYOA 1CHQD 5IOCA 2EVBA 4IUUA 2K1BA 2QILA 3K57A 1KTKA 1GXDC 1OXSC 4QIWB 2RDGA 3QWNA 2LMCB 2F3VA 1ZXTA 1SNDA 2L11A 3I70A 3RZDB 1BCPF 2H4OA 1PDQA 5JOBA 3NTHA 2B2VA 3FDTA 1OXVA 2B2YA 2FHTA 4RHRA 3MA2B 2MPMA 3HOUB 4ID6A 1X3PA 3RUZA 3E0JA 3TBIB 3TP7A 3WOEA 4EQOA 3HZXA 1HCZA 2EE1A 1S5DD 2L5TA 1MD2D 1S5FD 1U4MA 3QOJA 2EZVA 4FVMA 2DY8A 2MUYA 3JAME 1DYQA 1JR0D 1JORA 4YIJA 4QB4A 4RCOA 2F03A 5FLXL 3Q24A 3T13A 4OO1I 2FINB 3SVMA 3NTIA 4KJNA 1S5ED 5CMDA 4C3IB 1H9JA 2K05A 2J7ZA 1ENAA 1EY0A 2I07B 2D5DA 4BBRB 3U9OA 5K36H 1QJOA 2QEJC 2Y0SB 1TWCB 1Q1EA 1QNUA 1IW7C 3MVVA 3PIP3 3HOYB 3D31A 2VB2X 4HN7A 2RDHA 4U673 5BN4A 4FXGC 2R61A 4F8MA 3SDZA 2SOBA 3HOXB 2X6GA 4R8NA 4JBWA 3BDCA 1H9SB 1B3AA 4XIGS 2B2VC 3E5SA 2K5WA 3J7AV 5EPLA 2B2YC 1V1OA 2AQ1B 3PUVA 1AZQA 3A54A 3VA7A 1KLGD 2CW0D 3WOFA 4DU9A 3MHBA 3PUWA 4KKTA 3NUCA 2KEEA 3GD7A 4IUPA 1ML0D 5C3XA 1EU4A 4DN4M 2KHSA 2XRQD 4LK1C 2M00A 2Z8LA 1DZ1A 3SK5A 3MFGA 1ILPA 1EY6A 2HCCA 4K2LA 3MXNA 1BBXC 2PYKA 2O4XA 3FKIB 3J81L 2F0WA 3TP6A 1WTXA 4RFBA 3Q6SA 3H0GB 2B39A 1BXTA 4NW2A 4X3SA 2K32A 1AW7A 4F88A 4FF2A 3PUYA 4KHVA 3AMUA 3OIQA 2WIIB 3P1HA 2K5DA 3K58A 3SK4A 4G7HC 1TT2A 1EY5A 2O5IC 3CRKC 3HOZB 5J39A 2JSOA 2JA5B 2F0LA 3EROA 2ENBA 4KI0A 3KBXA 2FMCA 4V190 5IGEA 5CV8A 1GUTA 3NTKA 1CTMA 1PFNA 4DGZA 2RSNA 4CHTB 1CFMA 1O7LA 2MGSA 1KNEA 4B9XA 2LFNA 5IT9L 2F0NA 5AFWA 1C48A 5J22A 1FNUA 2WKCA 4AYBB 1V1PB 4IFDG 3M85A 1I4XA 4KTAA 2ICEC 5JPMC 2TMPA 3RD4A 1FYCA 1EY9A 5EPKA 4ULLA 2O5JC 1W6JA 1ENFA 2F1MA 1SMYD 4BS9A 1DJRD 2EY2A 3K5LA 4DK0A 2JEBI 3ITPA 1SJHD 3A55A 1VF5C 1IL8A 4BA1I 2F0KA 2EYLA 1M4VA 1OXTA 3D6WA 1QNKA 3K0YA 3BYTB 4OO1H 1SYBA 5HURA 4QCLA 2F0PA 4C3IG 2C9OA 2EYFA 1PTOB 1DM0B 4TQUS 3I4MB 1UEAB 2F0IA 2NBFA 5CV4A 2WP8J 2XSCA 4ZAIA 4C3HG 3P75A 2ZXOA 3MC0B 5FO7B 3VYSA 2BDNA 4O1NA 2E2HB 3H91A 3M3YB 4PMCA 2F0EA 5G3LD 4DA2A 1UAPA 4XXEA 1SXTA 5G3LF 3A7AB 4DK1A 1DOMA 4ODGA 3O13A 2MJ8A 1ZYRC 1KNAA 5KYIA 1J8IA 4H7BA 5ELCA 1Z47A 1ICWA 1Y69U 3GP7A 3VYUA 1ILQA 5K36G 3SE0A 1U4RA 3N6RA 3L7ZC 2BDOA 4KKSA 3L9AX 4K6DA 3QB3A 1LTAD 1A3TA 2R3ZA 4N9TA 4FXDA 2L12A 1G291 2L1BA 2NZ1D 4DAVA 4KK7A 1EL0A 1D6EC 1Q90A 5IGFA 1A3UA 1QOHA 1LT4D 3NBIA 3KLSX 1H9RA 3IFTA 5C4XB 4OGQC 2XIWA 3TZDA 4HR7B 2Q8IB 3J7AF 1CZWA 4I65A 5T1IA 1XWEA 1V8QA 3MWYW 2X69A 1ZYRD 2DNCA 1T5XD 3S2DB 2QCPX 5M5YB 1QB5D 3EQLC 1BDOA 3P20A 1TKWB 1IYVA 1SYEA 5T1GA 3K5NA 2E2JB 3MEHA 5C4ZA 2L9HA 2OEOA 4V0BA 3NPPA 1F2YA 2E76C 2PZUA 4HCSA 3IAYA 1LTGD 2XWJB 3QO2A 2HDLA 1RODA 2EYOA 1LLRD 1E2VA 1O7ZA 3NWSA 1JCKB 2B8FA 5JEAH 3TP5A 1YNND 1CZGA 1D5XC 2PCFB 4A3DB 1PZKD 1EIHA 2FMMA 2ZXRA 3KBGA 3V05A 2VB3X 1G91A 1QE6A 3KLSA 3CU7A 5BN5A 2PPBC 2EJFC 4CKEA 4DNTB 1SSOA 3IFDA 3S1NB 4NMZA 3I3CA 2BA1A 3HKZB 5KRUA 1EYCA 2EYMA 3Q23A 2K03A 3VYTA 3SR1A 4KY7A 4RGNA 4QUFA 4A3GB 5C0XI 5K5PA 3KK7A 2L0CA 1LTRD 3DWAA 1OXXK 5ELEA 4FP5D 2XNAC 1I3QB 3L3OC 1F77A 5JAVA 2AUJD 4ZYSA 3GO5A 1MBYA 5CV7A 4OO1G 1F9SA 3M7NA 4K8JA 1QCBD 2BE5C 3FEWX 5CV5A 1GUWA 5FK9C 4KY5A 3I8ZA 4K6LA 2R93B 3VYRA 1B2TA 1H9KA 1PRTB 5DM73 2PQEA 4PMWA 2A6EC 1I4GA 4ZK9B 2YYZA 2D2CC 1WTOA 1R9TB 1QG7A 2XRSD 3HG9A 4J1MA 4C3JG 1EU3A 1STGA 5FKAC 1WVLA 1Q3LA 2B2UA 4OHJA 4CKCA 1F2ZA 4X3UA 5A2QL 2JA7B 1RHPA 3SEBA 2PZTA 2JE6I 4HEDA 4A3MB 4IFDJ 2IL8A 3D4RA 1TR5A 5E4XA 2CW0C 5C44B 1GUSA 3DUZA 1HQMC 1B44D 1G2TA 3X3NA 3I72A 1LTBD 2F0SA 5I2YA 4LAAA 3VR6A 1NR4A 2TSSA 2OT2A 1A15A 4KKUA 5DAUA 2QKIC 1EY7A 3RZOB 4WORA 2NWGA 3RLFA 3HOWB 1AEXA 3MXUA 5C3WA 1JWUD 1ZKOA 3E6ZX 4XQQA 1E2WA 3S1RB 2PNRC 4BA2I 1HFNA 4G7OC 1JWSD 2BE5D 4C3HB 5KNCA 1E0BA 5I9OA 3PUXA 5C5LA 1G8ZD 3H94A 3TDQA 1MGSA 3A7LA 1UNSA 2F0GA 1I4HA 4XDXA 1SEBD 2F0VA 2F0OA 2A6ED 1W6KA 4ZLTF 2A6HD 3N52A 5CV9A 4L8JA 3I4LA 1VDZA 1H9MA 1VMCA 1MSGA 1ET9A 2EY1A 2ICIA 3C1EA 4KV6A 4ZKBB 1EY4A 1STEA 3DXJC 3K5OA 1JOQA 1JWMD 2D62A 1WTPA 2EYHA 3OMGA 1D5MC 2WB1B 5EBCA 2PO4A 1B53A 3EVQA 3G7LA 5KYLA 4NKLA 2B2UC 4K8IA 1VF7A 4A3FB 4OL7A 1GUGA 4PQXA 2B63B 2NYZD 1GUOA 2M2LA 3CRLC 3GQBA 4EVOA 5M3MB 4QMGA 3FRPB 1HTLD 3EFXD 4DF7A 5M3FB 5D65A 1RJTA 1YNJD 4HAEA 2G9DA 1SBBB 1K8MA 1XYIA 1SMYC 1TS2A 5JEAG 5HGTA 1BCPB 1SYDA 3BZDB 3A8JE 1G2SA 4C1NI 3OIPA 4KMUC 5C0XH 3Q0AA 2KVMA 1LT5D 2IW3A 1LACA 1U9RA 1Q12A 4H13C 3S9WA 5ELDA 1B9MA 1JQYD 2CQAA 3I4NB 2F0DA 2V4DA 4M8AA 3OPOA 2KECA 2IT1A 3FPUB 4XT1B 3K59A 3S1QB 2NVQB 4FO2A 3PMFA 4CKBA 4BY7B 2IX0A 2VNUD 4ZUIA 4BBSB 1LTSD 4QF4A 3W2DA 1CQVA 1DOKA 3A56A 1STHA 2VXWA 1D1IA 4Y7NB 4NDXA 3Q22A 2WACA 1FGBD 4K14A 5ELFA 1TVXA 4TSSA 5M9OA 5M5XB 2CHBD 3U9SA 1Y8PB 1JC7A 3OWFA 2LS01 4ZUJA 1EQVA 2HCIA 1STYA 3R3OA 5JJZA 1HA6A 4RKBA 1RTNA 1PXUA 4P2CB 3H09A 5I6WA 2BCOA 4UAIA 1NUCA 2D9UA 1BF4A 5IGCA 2RKSA 4R8IA 2EYJA 2IJ0A 4FNFA 3R93A 3NQTA 1CHPD 4KN4C 4I7ZC 4IQZA 1WTVA 1A2TA 3VR3A 4DAPA 2EXZA 4IUQA 4Q5VA 3MZ5A 5C5MA 1H9SA 4BY1B 4HCEA 3NQIA 2NVXB 3P7JA 1CA6A 5CBAE 1NCVA 1EWHA 4PV1C 1MSHA 4DAYA 5LHY1 1Y8OB 4XYQA 1PLFA 1RDPD 1U4PA 4IFDI 1NAPA 3PO3B 1GHKA 4IUNA 4FF3A 1C4QA 1HPCA 1SE2A 5IODA 1JE4A 1JB3A 1TWHB 1F2MA 1O78A 1KDCA 1FNWA 4ZRZA 2F0UA 3LWEA 2L55A 3DEPA 2HDMA 4C3JB 1F9PA 5I2XA 1A6XA 1IKMA 1B50A 2M9VA 3NSWA 4CJ0B 3T4AC 1HTPA 4HSVA 4G4KA 1RTOA 3GTGB 4LJZC 5ISRA 1ZEQX 1YNNC 4DXFA 3GTOB 4BWGB 1TY2A 5DEHA 3PUZA 3J80L 1STNA 5I4DA 2BA0A 2EJMA 5KNBA 5IGGA 1RCVD 3GTKB 1HFGA 1SYCA 1GJXA 4KY6A 2RBMA 1D5ZC 5LL6S 1PRTD 3OW7A 2R7ZB 2NVTB 2Z1CA 5EPJA 4CJ1B 1K83B 4DFAA 3J7YW 5DNFA 5COYA 3BYYB 2JA8B 1AZPA 4RCNA 3IL8A 4ZQ3A 2AUKA 2E74C 3FVQA 1PFMA 4KN7C 2A74C 5EJWA 4WJWA 1NSNS 3AB9A 5D3DA 3VR5A 5C0XG 1V1PA 3M7GA 4OIJA 1I4RA 1LT3D 1EQTA 5EKKA 3NK9A 4OIKA 4IN3A 4HTHA 4RH6A 2Z4HA 3NWTA 4KJOA 1WTQA 1EIGA 3DM1A 4M1UB 5FLXE 3ND9A 1S5CD 5CBEE 3ONAB 3D3RA 2L4NA 3C1FA 1BQQT 3OWEB 2A73B 1EWCA 3MTSA 3S14B 3T53B 1XXGA 4PMBA 2QDBA 1EEFD 1EYDA 1SNQA 4ABNA 2DNEA 1IHZA 1O80A 2KCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDA A;  4KY6 A;  4R8N A;  2RBM A;  3NQT A;  2F0M A;  2SNM A;  4K5X A;  5JOB A;  5IGE A;  3BDC A;  4PNY A;  5CV8 A;  5KGU A;  1U9R A;  1EZ6 A;  1SYE A;  5I9O A;  3S9W A;  5KYI A;  2F0T A;  5C5L A;  4TRD A;  3QOL A;  5E3F A;  3MEH A;  5JAV A;  3ERQ A;  5EKL A;  2F0D A;  4DGZ A;  5C4Z A;  3E5S A;  1A2T A;  4F7X A;  3NP8 A;  2OEO A;  4EQP A;  2F0G A;  4B9W A;  2F0J A;  4DFA A;  2EXZ A;  1SNO A;  3SHL A;  4IAL A;  4N9P A;  4EQN A;  4H7B A;  5CV7 A;  1F2Y A;  2F0V A;  2F0O A;  4B9X A;  3MZ5 A;  4K8J A;  5E1F A;  2PZU A;  5CV5 A;  5IGD A;  3PMF A;  4KY5 A;  3D4D A;  4ID6 A;  4DU9 A;  3MHB A;  3TME A;  2F0N A;  4E6I A;  1KAB A;  3NUC A;  3OSO A;  4K5W A;  4ZQ3 A;  3HEJ A;  5C5M A;  5NUC A;  5CV9 A;  4K2K A;  3RUZ A;  3SK6 A;  3TP7 A;  5J22 A;  3EJI A;  4EQO A;  5C3X A;  3HZX A;  4KTA A;  2EYO A;  2PQE A;  1EZ8 A;  2KHS A;  2M00 A;  4ZUI A;  5KEE A;  2EY1 A;  2PW5 A;  2F0Q A;  1EY9 A;  2HQE A;  3C1E A;  3QB3 A;  4K6D A;  1A3T A;  4K5V A;  3SK5 A;  3SXH A;  5CGK A;  2PZW A;  4KV6 A;  4RKL A;  1EY4 A;  5I9P A;  2PW7 A;  4HMJ A;  4MIU A;  5IGB A;  1EY6 A;  3QOJ A;  4QF4 A;  3TP5 A;  4K2L A;  4KD3 A;  1JOQ A;  4N9T A;  1KAA A;  1SNP A;  2PYK A;  2EYH A;  2O4X A;  1NSN S;  3OMG A;  2EY2 A;  3D4W A;  4J1M A;  3BDL A;  3VA5 A;  3ITP A;  1JOR A;  1STG A;  1STH A;  4YIJ A;  5KIX A;  3EVQ A;  4IUN A;  2F0W A;  4QB4 A;  1SNM A;  4WRD A;  2RDF A;  2F0F A;  3D6C A;  5KYL A;  1SNC A;  1F2Z A;  3NHH A;  4NKL A;  5F2D A;  5EKK A;  1EY8 A;  3TP6 A;  1JOK A;  3NK9 A;  1JOO A;  5IGF A;  2EY5 A;  3T16 A;  3NXW A;  4K8I A;  3OMC A;  1TQO A;  2PZT A;  5IOD A;  1A3U A;  2F0K A;  2EYL A;  4HTH A;  4OL7 A;  5CC4 A;  4NDX A;  2KQ3 A;  1F2M A;  3T13 A;  5EGT A;  1KDC A;  1TR5 A;  1STB A;  1KDB A;  2EYP A;  3DHQ A;  2WAC A;  3H6M A;  4G57 A;  4K14 A;  4KJO A;  4J6H A;  3TP8 A;  4EVO A;  2F0U A;  5IIF A;  1ENC A;  1SYG A;  2LKV A;  5CV6 A;  4QMG A;  1A2U A;  2EY6 A;  4KJN A;  3DMU A;  2SNS A;  5M9O A;  4NMZ A;  4KHV A;  4DF7 A;  3LX0 A;  1SYB A;  2NUC A;  5HUR A;  5KRU A;  3OWF A;  1II3 A;  2OF1 A;  4ZUJ A;  1EYC A;  1EQV A;  2F0P A;  2F3W A;  3V2T A;  1ENA A;  1EY0 A;  2EYF A;  3C1F A;  5IOC A;  1STY A;  3R3O A;  5J1Z A;  3U9O A;  3P1H A;  2EYM A;  2F0S A;  4I65 A;  3SK8 A;  2F0I A;  5CV4 A;  4HMI A;  4LAA A;  4NP5 A;  3SR1 A;  5C6A A;  5ISR A;  4RKB A;  4KY7 A;  3P75 A;  3MVV A;  5DAU A;  1EY7 A;  1SYF A;  5DEH A;  4IZ8 A;  5C4H A;  3D8G A;  4WOR A;  1RKN A;  4PMB A;  5HGT A;  3SK4 A;  4PMC A;  1AEX A;  2F0E A;  1SYD A;  1TT2 A;  2QDB A;  1EY5 A;  5C3W A;  5K5P A;  5I6W A;  1EYD A;  1STA A;  1STN A;  2F0H A;  1EYA A;  5I6Y A;  4F8M A;  1SNQ A;  2F3V A;  5J39 A;  1NUC A;  4ME5 A;  5IGG A;  2F0L A;  3ERO A;  4S3S A;  1SYC A;  2OXP A;  2ENB A;  3MXP A;  5CR3 A;  5IGC A;  1IHZ A;  2RKS A;  1SND A;  4KD4 A;  2SOB A;  2EYJ A;  4ODG A;  1A3V A; 
#chains in the Genus database with same CATH topology
 1SR3 A;  4MHE A;  3AYH B;  5IYB G;  4RGO S;  2VY3 A;  4R4C A;  2SNM A;  1FNV A;  1HQR D;  2NTS A;  2GVA A;  3LWU A;  1VQG A;  4YWM A;  1EZ6 A;  1GHJ A;  2F0T A;  3BS1 A;  4GKK Q;  3S17 B;  3KFU A;  5EKL A;  3ZYY X;  1XX8 A;  3LGJ A;  3NP8 A;  1PZJ D;  1SNO A;  2PMZ E;  1AN8 A;  4EQN A;  3M4P A;  3VR2 A;  1QZH A;  4RGT A;  2WIN B;  3HS0 C;  3C46 A;  4KHP Q;  3KOJ A;  4AQY L;  1C8C A;  2K7V A;  2WKD A;  3MXN B;  3I7F A;  2IX1 A;  4A75 A;  3OSO A;  3W3A A;  1F9Q A;  2A69 C;  2C5C A;  2A68 C;  3EJI A;  4BY1 G;  3RZD H;  2UUB L;  4IUR A;  2FJ2 A;  3BDO A;  3W5O A;  1RF2 D;  4CJ2 C;  3H3V I;  1D7Q A;  3H3V C;  4HJ9 A;  4IJH A;  1QIL A;  4KLK A;  3PIO 3;  5IT9 c;  1EFI D;  2NTT A;  1Y14 B;  1SRU A;  4UP7 A;  2AQ3 B;  1R9T H;  4JG2 A;  3VA5 A;  1F9R A;  1UWV A;  4YWL A;  4L63 B;  2KHI A;  3ND8 A;  3HOU H;  1NBW A;  2XWB B;  3NXW A;  3PIP A;  3OMC A;  4YHH Q;  2V1C C;  4IFD H;  4DR2 Q;  1CSQ A;  4G57 A;  1X3Q A;  3TP8 A;  4QY7 A;  3C3L A;  3VR4 A;  3J81 E;  5IIF A;  1R4Q B;  4A93 B;  3I56 A;  4L5S A;  2A6H C;  1G6Z A;  4RGM A;  1BCP D;  3KF8 A;  4X6A H;  1OTC A;  1B9N A;  3A8K E;  3S24 A;  1WD0 A;  1XMO Q;  3CD6 A;  3UI2 A;  4B08 A;  2E8G A;  4IPD A;  4X3T A;  4X66 Q;  1HA5 A;  4JBM A;  1PZI D;  4HMI A;  1I6V C;  1VCI A;  1NNX A;  5C6A A;  3CMA A;  4GKK L;  1I4P A;  1K73 C;  4A3B G;  2JA9 A;  2IWH A;  5JVH 3;  2JP1 A;  1QUQ A;  3D8G A;  1RKN A;  2J4X A;  1LTI D;  3RZO H;  1N36 Q;  2ZM6 L;  3BJU A;  1PMR A;  4KHP L;  3HOW H;  2HIX A;  3M4O B;  4GN5 A;  1PTO C;  2JXM B;  2X6L A;  2FFK B;  3MXP A;  2WAQ B;  4C3I H;  4LMQ D;  5DM6 3;  1A3V A;  2NN6 I;  2HUG A;  2F0M A;  2KCC A;  2VUM G;  2NB0 A;  4C56 C;  2B2W C;  4YY3 L;  4RA8 A;  3R8B A;  4BBR H;  4LF7 Q;  5C3E G;  1VQ9 A;  4C3H H;  2A5H A;  3QOL A;  5E3F A;  2Z6B A;  1TWC H;  2A69 D;  2AMC B;  2A68 D;  2F0J A;  3HOY H;  1ESR A;  1YNJ C;  4L6T B;  4RHS A;  1BUV T;  4UP8 A;  2DY7 A;  3OOC A;  4HIM A;  2JA8 G;  1VS0 A;  4IUV A;  4IPH A;  1OO9 B;  3E9I A;  4K2K A;  4YHH L;  4A3I B;  4IUT A;  1LAB A;  2KOL A;  2RVL A;  3BVM A;  1TXY A;  2JN4 A;  4Z9C B;  3HOX H;  4DR2 L;  3K5M A;  1EZ8 A;  2SDF A;  3W1G A;  2PW5 A;  2F0Q A;  1Y1W B;  3SXH A;  2JEA I;  1CKM A;  2PZW A;  4A3K B;  3DLL A;  5IT9 E;  1SNP A;  3PO2 G;  4FF4 A;  1D1K A;  2I46 A;  2Z9H A;  1XMO L;  1HNX Q;  2YTV A;  1W3S A;  5COR A;  4APV A;  4X66 L;  5IYD H;  5LL6 X;  3M9B A;  1M8A A;  3HP3 A;  2ASB A;  3TS2 A;  4EQ5 A;  1OXU A;  4F87 A;  3HRZ C;  3CCE A;  1EQR A;  1LTT D;  3DHQ A;  4FYD A;  3R2T A;  2SEB D;  5KND A;  4WFN 3;  4UHV A;  3T56 B;  1GUN A;  2ID0 A;  4GLX A;  1A2U A;  2EY6 A;  1PH9 A;  3QJY A;  1NR2 A;  4YCV A;  2K52 A;  1FD7 D;  2EPB A;  3LX0 A;  4A3J B;  1PH7 A;  3FKI H;  1YBY A;  1HXY D;  2WV6 D;  4OXP A;  4JCV E;  1LUZ A;  3UDF A;  1BO0 A;  3SK8 A;  1S4Z A;  1PTO D;  1BR9 A;  1LO5 D;  3CME A;  3J7A 5;  3U4Z A;  1HHV A;  3EA6 A;  2XVS A;  1PTO F;  1SE3 A;  3H0G H;  4GN4 B;  1LTL A;  4IZ8 A;  5C4H A;  2EDG A;  3A8I E;  3A5Z B;  1U0L A;  2EJG C;  3F2C A;  1EYA A;  5I6Y A;  4JI3 L;  2Q2T A;  2Q8R E;  1LYL A;  4S3S A;  4X65 Q;  4QGU A;  2QF7 A;  2HIV A;  4DV3 Q;  5BN3 A;  1ET6 A;  1T5E A;  5KGU A;  4DV6 Q;  4RMF A;  3GV6 A;  3AU7 A;  2AWO A;  1U4L A;  4F7X A;  1EOT A;  4IAL A;  4N9P A;  4DKA C;  4FXK C;  4JK1 C;  1HNX L;  3K7A B;  5E1F A;  5IGD A;  4DV7 L;  3A5U A;  3HOZ H;  1V1Q A;  3S1Q H;  5FLM G;  2JA5 H;  3I91 A;  3HEJ A;  5NUC A;  1UUP A;  4DXG A;  5FJ8 G;  2K5Q A;  1KLU D;  3KLW A;  1SJE D;  2C35 B;  2N55 A;  2UU9 Q;  4HSP A;  5KEE A;  4XT3 B;  5CGK A;  2JYO A;  3KUP A;  2E2D C;  4RKL A;  1JIC A;  1SFO B;  3HKS A;  3BU2 A;  3DWP A;  4LUZ A;  1AP0 A;  3F2U A;  1IW7 D;  3CQZ B;  4QUC A;  4JI0 Q;  2HHH Q;  2NVY B;  1ESF A;  1TWG B;  1SNM A;  1B4O A;  3NHH A;  2IPK D;  3EN2 A;  1EY8 A;  2O2L D;  4WJ3 M;  1JOK A;  2F4V Q;  3JAM L;  3CHB D;  4L5T A;  2KQ3 A;  2WAQ E;  2NZH A;  3K6O A;  4NXN Q;  5D14 A;  1RD9 D;  1FR3 A;  1LV9 A;  2MP1 A;  1E24 A;  3HOV B;  1Y8N B;  1SYG A;  2LKV A;  3K0X A;  3QG1 A;  1DOL A;  2SNS A;  2RSO A;  2VQF Q;  2MHV A;  5C0X J;  4A3E B;  1XNQ Q;  1WCM B;  1Q1B A;  5ELB A;  3KDF A;  1WD1 A;  1SE8 A;  4DV3 L;  1B3Q A;  3M4Y A;  1SDF A;  2N88 A;  4FDB A;  4DK3 C;  4DV6 L;  3S15 B;  4NP5 A;  4TKO B;  3J80 E;  1EEI D;  1VQ6 A;  2AWN A;  2R92 B;  3FMC A;  2JK8 A;  1IBM L;  2K28 A;  2EXD A;  3RN5 A;  4B3S Q;  1I4Q A;  3C2P A;  3HOU G;  5CR3 A;  3PQI A;  4MZ9 A;  2VQE Q;  4J8Q A;  3S16 B;  4B3T L;  1PTO H;  4PNY A;  3KLR A;  1CM9 A;  3I4M H;  1DD2 A;  1VQM A;  4GZY C;  1PHJ A;  2F52 A;  3JAM i;  2NN6 H;  2R7D A;  2Z4I A;  1LT6 D;  4MTK A;  1IZ6 A;  3M3Y H;  2HHH L;  3GTJ B;  1F2L A;  5JVG 3;  1TII D;  3D4D A;  3TME A;  3S2H B;  1P8L A;  2OTJ A;  2F4V L;  3SK6 A;  4LF8 Q;  2KEN A;  3PV0 A;  2Q8T A;  3U50 C;  1J9O A;  4MN3 A;  1PYS B;  1X32 A;  1MHW C;  1WJJ A;  3G6J B;  3BVZ A;  1IBK L;  1DGS A;  1L0X B;  2B8G A;  4NPS A;  3GTP B;  4DK6 C;  1Y1W G;  4HMJ A;  3ICE A;  3GTL B;  4CGY B;  5FO9 B;  1IYU A;  5J3B A;  2VQF L;  2KUM A;  1XNQ L;  1SN8 A;  2K6A A;  4R9W A;  2KJX A;  3R2I A;  3D6C A;  3PO3 H;  1PRT C;  1BOS A;  1V9P A;  1HRJ A;  3T51 B;  4BBR G;  4POF A;  5EQ0 A;  3CCS A;  3CF5 A;  5CC4 A;  2Y0S G;  2P5Z X;  1KDB A;  2EYP A;  3HOY G;  3HGB A;  1A0I A;  1YIJ A;  3RMH A;  4P73 A;  2K04 A;  1DCZ A;  1UE6 A;  3DMU A;  4B3S L;  5A35 A;  5D3I B;  3UDG A;  1I94 Q;  2NUC A;  3OW2 A;  4DNR B;  5LMU L;  3GTM B;  1SAP A;  1ONL A;  2ZT9 C;  2H1E A;  1Z7T A;  5M5W B;  3J7Z C;  2PMZ B;  2RQX A;  1XTC D;  4ZKC B;  4B3R Q;  4JOI A;  1QWY A;  2RA4 A;  1SYF A;  1SE4 A;  2XN9 C;  2BOS A;  4LF4 Q;  1STA A;  4UDU C;  2F0H A;  1K8O A;  1XNR L;  5C4X H;  4ME5 A;  5TSS A;  5GAE C;  5EBD A;  2R6G A;  1HUM A;  2B2T A;  4LF8 L;  1TY0 A;  3LNN A;  1DXM A;  1TS5 A;  1TWF B;  4K5X A;  1E3P A;  5JPN C;  4A3B B;  3URY A;  4TRD A;  4DUZ Q;  1KL9 A;  3ERQ A;  2LY7 A;  1HUN A;  4RWS C;  4DV1 Q;  4B9W A;  1WTW A;  1K83 H;  5FO8 B;  2IX3 A;  4C2M B;  3FKI G;  3T1Y Q;  3I73 A;  4RG1 A;  3S2D H;  4E6I A;  1KAB A;  3S1M B;  4K5W A;  4LWC A;  5C4J B;  4DNI A;  3FHW A;  2VUM B;  5M5Y H;  5C3E B;  1AFP A;  3H0G G;  1V43 A;  4C1N K;  1PFB A;  3WDN A;  2OWO A;  4K5V A;  5I9P A;  1VQF A;  2AKW B;  1JT8 A;  2PI2 A;  3TZU A;  1PRT F;  2E2J H;  4FF1 A;  2K01 A;  1QUQ B;  1Z9F A;  1I94 L;  4YCW A;  3BDL A;  1SLJ A;  3F2D A;  3NEM A;  2RDF A;  2F0F A;  3MFY A;  1SNC A;  4DV5 Q;  1B1Z A;  3TRZ A;  4N8X 1;  3V96 A;  1JOO A;  4A3C G;  3T16 A;  4DPG A;  2E75 C;  2MO1 A;  1WTR A;  3MAQ A;  4DR6 Q;  4JI2 Q;  4B3R L;  2AQ2 B;  3H6M A;  4POG A;  4AYB E;  1ENC A;  1W2B A;  1O7Y A;  1JMC A;  3HOV G;  3BVG A;  4G7Z C;  3PO2 B;  1G51 A;  5CYU A;  1NTG A;  2G9H D;  3HOZ G;  4CBV A;  5A2Q E;  1E2Z A;  5DLQ E;  1L0Y B;  2F4I A;  4PZ6 A;  2JA5 G;  4A3D H;  3OHX C;  2F3W A;  2LXJ A;  4LF5 L;  5J1Z A;  2JA6 B;  3TN2 A;  4XQJ A;  3TSS A;  3BG3 A;  2YU9 B;  4Q0F A;  4DUZ L;  1Y1V B;  3PIO A;  1S5B D;  4JOI C;  4DV1 L;  1KD1 C;  3S14 H;  4JI5 Q;  1TWA B;  3GV3 A;  1Q46 A;  5EAY A;  1DON A;  1I50 B;  3EBE A;  3T1Y L;  3IKJ A;  3S1N H;  2GA4 B;  2OXP A;  1CT1 D;  4KD4 A;  3DWQ A;  5EKI A;  2B2T C;  3OYY A;  1KDA A;  5E4W C;  4AYB G;  1GOZ A;  2EOT A;  2CVR A;  1BCP C;  4XTC S;  1BKB A;  2DN8 A;  1CK1 A;  3I90 A;  3NE5 B;  4UPA A;  1K9M C;  1D2B A;  4EQP A;  2PQA A;  3AQQ A;  3MXG A;  1CQF A;  3X3M A;  4GKJ Q;  1ICF B;  3NBH A;  3SHL A;  4A3G H;  4EGV A;  3GTQ B;  4X3K A;  2ZXP A;  1VQJ A;  5FOB B;  4XQN A;  4U68 A;  4UP9 A;  1IKL A;  4IOA A;  4DR6 L;  2K75 A;  3FPP A;  4JI2 L;  2B2W A;  1I3Q H;  1TS4 A;  4H02 A;  3HFZ B;  1BNZ A;  1PYW D;  4YCU A;  1X3F A;  2HQE A;  2KED A;  1CI3 M;  2E2I B;  1Q8I A;  2PW7 A;  3KF6 A;  4MIU A;  4H0L C;  5JEA J;  1MI2 A;  5IGB A;  1Z6H A;  3NEL A;  4KD3 A;  4O42 A;  4KHZ A;  5IYC H;  4DR4 L;  1M90 C;  1KAA A;  2UXD Q;  1TU2 B;  2Q2H A;  4H44 C;  3DEO A;  4ILW A;  3D4W A;  2L15 A;  5KIX A;  4WRD A;  2K33 A;  5F2D A;  2EIF A;  2KA7 A;  4ZCK A;  2EY5 A;  2R93 H;  1TQO A;  1I6H B;  3I4M G;  1XTD A;  2MO0 A;  1TS3 A;  1K0R A;  5EGT A;  1CA5 A;  1STB A;  2NN6 G;  4RAU C;  4J6H A;  1R4P B;  1VMP A;  5CV6 A;  3CKI B;  3QIA A;  1EWI A;  2ZJQ A;  2Z0S A;  3NEN A;  5IY0 A;  2Q2U A;  2J0T D;  3V2T A;  1II3 A;  2OF1 A;  4XYO A;  3CCR A;  1K8G A;  1CHQ D;  1SRO A;  1L2F A;  5IOC A;  2EVB A;  1NMG A;  4IUU A;  2K1B A;  2QW7 A;  1GO3 E;  2QIL A;  3K57 A;  2JA7 H;  2EQS A;  1KTK A;  1GXD C;  5ELN A;  4A3M H;  1OXS C;  4QIW B;  4GKJ L;  2RDG A;  3QWN A;  2LMC B;  2F3V A;  2N3S A;  5C44 H;  2UXB Q;  1ZXT A;  3BZC A;  1SND A;  2L11 A;  3I70 A;  3RZD B;  1BCP F;  1PVO A;  2H4O A;  1PDQ A;  1VQI A;  3L2P A;  5JOB A;  3NTH A;  1YHA A;  1YJ9 A;  1VQN A;  1CSP A;  4GN3 B;  2I5H A;  2B2V A;  3FDT A;  1OXV A;  5GQO A;  3RN2 A;  2B29 A;  2B2Y A;  1XPR A;  1A62 A;  4OWT B;  2UXD L;  3CCM A;  2FHT A;  4RHR A;  3MA2 B;  4JI6 Q;  2MPM A;  3HOU B;  4PG3 A;  4ID6 A;  1X3P A;  3S1R H;  3RUZ A;  3E0J A;  3TBI B;  3TP7 A;  3WOE A;  4EQO A;  1VQH A;  2I5M X;  3HZX A;  1HCZ A;  2EE1 A;  1S5D D;  2L5T A;  1K28 A;  3ULL A;  1MD2 D;  1S5F D;  4HJ7 A;  2I0Q A;  1U4M A;  1CUK A;  3QOJ A;  2EZV A;  4DV4 Q;  4FVM A;  5C4X G;  1VQK A;  3ULJ A;  1IBL Q;  2DY8 A;  2MUY A;  3JAM E;  1DYQ A;  4GNX A;  1JR0 D;  1X54 A;  1JOR A;  4YIJ A;  1C9O A;  4QB4 A;  4RCO A;  3TS0 A;  1G6P A;  2F03 A;  5FLX L;  1IYJ B;  3Q24 A;  1L1O C;  3T13 A;  4MNO A;  1UE1 A;  4LUO A;  4OO1 I;  2FIN B;  3SVM A;  1NJI C;  3NTI A;  4KJN A;  5IE8 A;  2UXB L;  1S5E D;  4A76 A;  5CMD A;  4C3I B;  1H9J A;  3A0J A;  2K05 A;  2J7Z A;  5IP9 G;  1ENA A;  1EY0 A;  2I07 B;  2D5D A;  4BBR B;  1WFQ A;  3U9O A;  5K36 H;  4A3L H;  1QJO A;  2JA6 G;  2QEJ C;  2Y0S B;  1TWC B;  1Q1E A;  1QNU A;  1IW7 C;  3MVV A;  1VQC A;  3PIP 3;  3HOY B;  3D31 A;  4A3F H;  1PH5 A;  1Y1V G;  2VB2 X;  4CDC C;  3U58 A;  4HN7 A;  1HZB A;  1N36 L;  2RDH A;  4U67 3;  5BN4 A;  4FXG C;  4JI6 L;  2B63 H;  1QZG A;  2R61 A;  4F8M A;  5M3M H;  1N33 Q;  1EFW A;  1K3B C;  3SDZ A;  2SOB A;  3HOX B;  2X6G A;  1X9N A;  4R8N A;  3IRB A;  5M3F H;  4JBW A;  3BDC A;  4LF7 L;  1H9S B;  1BVS A;  1B3A A;  3J80 c;  4XIG S;  4QJF A;  2B2V C;  3E5S A;  1I5F A;  2K5W A;  3J7A V;  5EPL A;  2B2Y C;  4R4T A;  1V1O A;  2AQ1 B;  3PUV A;  1AZQ A;  3A54 A;  3VA7 A;  4A3D G;  4DR1 Q;  1KLG D;  4DAY B;  3K7A H;  2CW0 D;  3WOF A;  4DU9 A;  1HNZ Q;  3MHB A;  3PUW A;  1S3O A;  4KKT A;  3NUC A;  2KEE A;  3GD7 A;  4IUP A;  4DAM A;  1ML0 D;  5C3X A;  1EU4 A;  4DN4 M;  3E0E A;  1VQD A;  1MKH A;  2KHS A;  2XRQ D;  2M00 A;  4LK1 C;  3FP9 A;  4JI4 Q;  2Z8L A;  1DZ1 A;  3SK5 A;  3MFG A;  1ILP A;  1EY6 A;  2HCC A;  4K2L A;  3I4N H;  3MXN A;  1BBX C;  1JE5 A;  2PYK A;  2O4X A;  3RLO A;  4PZ7 A;  3FKI B;  4JVZ A;  3J81 L;  4QIW E;  1CKN B;  1IL2 A;  3HKZ G;  4GNX C;  1WTH A;  2F0W A;  2NVQ H;  2NVY H;  3TP6 A;  2KCM A;  1KAW A;  1VQO A;  1WTX A;  4RFB A;  1S72 A;  3Q6S A;  3H0G B;  4BY7 H;  2B39 A;  1BXT A;  4NW2 A;  3T1H Q;  2I5L X;  4X3S A;  4GOP C;  2K32 A;  4LNQ A;  4BBS H;  4A3G G;  1AW7 A;  3TQY A;  4F88 A;  1BBW A;  4FF2 A;  1YEZ A;  3PUY A;  4KHV A;  3AMU A;  3OIQ A;  3PGZ A;  2WII B;  3P1H A;  2K5D A;  2IHE A;  3K58 A;  3S15 H;  4Y7N H;  1FVI A;  5IYC G;  4LF6 Q;  1J6Q A;  3SK4 A;  4J15 A;  4G7H C;  1TT2 A;  1EY5 A;  2O5I C;  3CRK C;  3HOZ B;  4DR1 L;  2OTL A;  3CC4 A;  5J39 A;  1PFS A;  2JSO A;  2JA5 B;  3W1B A;  2F0L A;  3ERO A;  1HNZ L;  4TVA B;  2ENB A;  4X65 L;  4N8F A;  3CCV A;  4KI0 A;  5M5X H;  3KBX A;  2FMC A;  1KRS A;  4V19 0;  2R93 G;  3RR5 A;  3J81 i;  4K0K Q;  4HJA A;  5IGE A;  5CV8 A;  1GUT A;  2QA4 A;  3NTK A;  3S16 H;  3A74 A;  1CTM A;  4JYA Q;  1PFN A;  2K4K A;  4DGZ A;  1PV4 A;  2RSN A;  4HID A;  4CHT B;  2WFW A;  3B6Y A;  1CFM A;  3F8T A;  1O7L A;  2MGS A;  1KNE A;  2OCE A;  4B9X A;  2CKZ B;  4R1J A;  2LFN A;  1GD7 A;  5IT9 L;  2F0N A;  5AFW A;  3CPW A;  1C48 A;  5J22 A;  1FNU A;  1WYD A;  2WKC A;  4AYB B;  1V1P B;  2JA7 G;  5IYB H;  2ZJP A;  4IFD G;  3M85 A;  2K50 A;  1I4X A;  4KTA A;  4A3M G;  1A63 A;  2ICE C;  5HGQ A;  1KIX A;  2UU9 L;  5JPM C;  2TMP A;  3RD4 A;  1FYC A;  1EY9 A;  3T1H L;  5EPK A;  4ULL A;  2O5J C;  1W6J A;  1ENF A;  2F1M A;  2Y0S E;  1SMY D;  1Q7Y C;  3GTL H;  4BS9 A;  5C44 G;  5IWA Q;  4JI0 L;  1DJR D;  2EY2 A;  3K5L A;  4DK0 A;  1Q8K A;  2JEB I;  3ITP A;  1SJH D;  1VQ8 A;  2ALY B;  3A55 A;  1VF5 C;  1IL8 A;  4BA1 I;  4O0A A;  2F0K A;  4B3M Q;  2EYL A;  4BY1 H;  1M4V A;  4NXN L;  2NVX H;  4LF6 L;  2DUD A;  2A8V A;  3HOW G;  1OXT A;  3D6W A;  4DR5 Q;  1QNK A;  1X56 A;  2FXQ A;  2N78 A;  3K0Y A;  3BYT B;  4OO1 H;  1SYB A;  5HUR A;  4QCL A;  2F0P A;  3UE0 A;  4C3I G;  2C9O A;  2EYF A;  1PTO B;  4K0K L;  1DM0 B;  4TQU S;  3I4M B;  1UEA B;  2F0I A;  2NBF A;  5CV4 A;  2WP8 J;  2XSC A;  4JYA L;  4ZAI A;  4C3H G;  5M5W H;  3P75 A;  2ZXO A;  2N8N A;  1EOV A;  3MC0 B;  5FO7 B;  1JB7 A;  2VW9 A;  3VYS A;  4HJ8 A;  1TWH H;  2BDN A;  4O1N A;  2E2H B;  3H91 A;  3M3Y B;  4PMC A;  2F0E A;  5G3L D;  3D0F A;  4DA2 A;  1UAP A;  4XXE A;  1VQ4 A;  1SXT A;  2GN5 A;  5G3L F;  3A7A B;  1X55 A;  4C3J H;  1GM5 A;  4DK1 A;  2VQE L;  1DOM A;  4ODG A;  4DV2 Q;  3O13 A;  3QR8 A;  3HOX G;  2MJ8 A;  3ERS X;  1ZYR C;  1KNA A;  5KYI A;  3GTG H;  1VQ5 A;  1J8I A;  3GTO H;  3M4Q A;  5BR8 Q;  5IWA L;  4H7B A;  5ELC A;  1Z47 A;  3BZK A;  1ICW A;  1Y69 U;  2WB1 G;  3GP7 A;  5IYD G;  3VYU A;  1ILQ A;  3GTK H;  5K36 G;  4A3L G;  2R7F A;  3SE0 A;  4B3M L;  3S1M H;  1U4R A;  3N6R A;  1A8V A;  3CCQ A;  4A3F G;  5HY6 A;  3L7Z C;  2BDO A;  4KKS A;  3L9A X;  4K6D A;  5C3E H;  3QB3 A;  1LTA D;  1A3T A;  3DM3 A;  2R3Z A;  1HR0 Q;  2B63 G;  2R7Z H;  1AE3 A;  2NVT H;  4X64 Q;  4DR5 L;  4N9T A;  4QQB X;  4FXD A;  1E7Z A;  3CPF A;  5M3M G;  2L12 A;  1G29 1;  2L1B A;  5GAG C;  3VDY A;  1PH4 A;  2JA8 H;  5M3F G;  2NZ1 D;  3KF8 B;  4DAV A;  4KK7 A;  1EL0 A;  1D6E C;  1Q90 A;  5IGF A;  1HZ9 A;  1A3U A;  1QOH A;  1KC8 C;  1LT4 D;  1C0A A;  3NBI A;  3KLS X;  1H9R A;  1EUJ A;  3IFT A;  5C4X B;  4OGQ C;  2CCZ A;  4JV5 Q;  2XIW A;  3CCU A;  3TZD A;  4HR7 B;  4JI8 Q;  2Q8I B;  3J7A F;  4DV2 L;  1CZW A;  1MJC A;  5GAH C;  4I65 A;  5T1I A;  4P74 A;  1XWE A;  1V8Q A;  1YZ6 A;  1E1O A;  4LF4 L;  1KQS A;  1D8L A;  3MWY W;  2X69 A;  1TWA H;  1ZYR D;  2DNC A;  1T5X D;  3S2D B;  1I50 H;  4DUY Q;  2QCP X;  5LMN W;  5M5Y B;  1QB5 D;  1U5K A;  4BY7 G;  3EQL C;  5GRO A;  1BDO A;  2CWA A;  3P20 A;  1TKW B;  4GLA C;  1IYV A;  3PCO B;  1SYE A;  3RLN A;  5T1G A;  3K5N A;  3G48 A;  2E2J B;  3MEH A;  1NMF A;  5C4Z A;  2L9H A;  2OEO A;  4X64 L;  2DJG C;  4V0B A;  3PF4 A;  3NPP A;  3TEH B;  3ER0 A;  1F2Y A;  1PH3 A;  2UUC Q;  2E76 C;  2PZU A;  1N34 Q;  4OWW B;  4P72 A;  1N9W A;  2KHJ A;  4HCS A;  3IAY A;  1LTG D;  2XWJ B;  3QO2 A;  2HDL A;  1ROD A;  2EYO A;  1LLR D;  3TRE A;  1E2V A;  1O7Z A;  3NWS A;  1JCK B;  5AJ3 Q;  2B8F A;  3S17 H;  4JV5 L;  5JEA H;  3TP5 A;  1YJN A;  1YNN D;  1CZG A;  1D5X C;  4JI8 L;  2PCF B;  4A3D B;  3F2B A;  4YWK A;  1PZK D;  2VS1 A;  1EIH A;  2FMM A;  1VQP A;  1N32 Q;  2ZXR A;  3KBG A;  1YI2 A;  4DV5 L;  3V05 A;  5FLM H;  2VB3 X;  1P16 A;  3CP0 A;  1G91 A;  4LFC Q;  5LMN Q;  1QE6 A;  4UY8 C;  3KLS A;  1S40 A;  3CU7 A;  5BN5 A;  2PPB C;  1FL0 A;  2EJF C;  4CKE A;  4DNT B;  1SSO A;  4P75 A;  3IFD A;  3S1N B;  1E22 A;  1Q82 C;  1J5E Q;  1AH9 A;  4DUY L;  4NMZ A;  3I3C A;  2BA1 A;  3UE1 A;  3HKZ B;  5KRU A;  3JAM c;  1EYC A;  1PH1 A;  1K8A C;  1H95 A;  3PSI A;  2EYM A;  3Q23 A;  2K03 A;  4HIO A;  1ASY A;  3VYT A;  3SR1 A;  1YHB A;  1RL2 A;  1KHI A;  1L1O A;  4KY7 A;  3CAM A;  4RGN A;  4JI5 L;  5IP7 H;  4QUF A;  4A3G B;  5C0X I;  5K5P A;  3KK7 A;  2L0C A;  2ZM6 Q;  1LTR D;  4A93 H;  3DWA A;  1OXX K;  2UUC L;  5ELE A;  1N34 L;  4FP5 D;  1BBU A;  2F3I A;  3K8A A;  2XNA C;  1I3Q B;  1K0S A;  1JJG A;  3L3O C;  4BXX H;  1F77 A;  4YY3 Q;  3STB C;  3SGI A;  5JAV A;  5AJ3 L;  2AUJ D;  4JC0 A;  4ZYS A;  3GO5 A;  1MBY A;  5CV7 A;  4OO1 G;  1F9S A;  3M7N A;  1HNW Q;  4K8J A;  1QCB D;  2BE5 C;  3FEW X;  5CV5 A;  4LFA Q;  1N32 L;  1GUW A;  5FK9 C;  4KY5 A;  3PO3 G;  3M4O H;  3I8Z A;  4K6L A;  2R93 B;  3VYR A;  1PH2 A;  4LFC L;  1EIF A;  2MQH A;  5LMN L;  1LM0 A;  1H9K A;  1B2T A;  4JW0 A;  1PRT B;  5DM7 3;  2PQE A;  1QVC A;  4PMW A;  2IY5 B;  2A6E C;  1I4G A;  2GVB A;  4ZK9 B;  2YYZ A;  2D2C C;  1J5E L;  1WTO A;  1R9T B;  1QG7 A;  1VQA A;  2K5V A;  2XRS D;  3HG9 A;  4J1M A;  4NXM Q;  4C3J G;  1QVG A;  1EU3 A;  1STG A;  1X6O A;  5FKA C;  1WVL A;  1Q3L A;  2B2U A;  4OHJ A;  4CKC A;  1F2Z A;  4X3U A;  5A2Q L;  3KJP A;  2JA7 B;  1RHP A;  3SEB A;  2A1A A;  2PZT A;  2JE6 I;  4HED A;  4A3M B;  4IFD J;  2IL8 A;  3KDF B;  4A3I H;  3D4R A;  3MEF A;  1TR5 A;  2Z6K C;  5E4X A;  1Y1W H;  2CW0 C;  5C44 B;  4A3K H;  5H1S E;  1GUS A;  3DUZ A;  1HQM C;  1B44 D;  1G2T A;  3X3N A;  3I72 A;  1LTB D;  2F0S A;  2RHQ B;  5I2Y A;  1O7I A;  4LAA A;  3VR6 A;  1NR4 A;  4HJ5 A;  2TSS A;  2OT2 A;  1A15 A;  4IOC A;  4KKU A;  3K81 C;  5DAU A;  2R7Z G;  2QKI C;  1EY7 A;  3RZO B;  4WOR A;  3AEV A;  2NWG A;  1UE7 A;  3RLF A;  4GOP A;  3HOW B;  1AEX A;  3MXU A;  5C3W A;  1HNW L;  1JWU D;  1ZKO A;  3STB D;  1CKO A;  3E6Z X;  4LFA L;  3CW2 C;  4JI3 Q;  4XQQ A;  1E2W A;  3S1R B;  4DR7 Q;  2PNR C;  4BA2 I;  1HFN A;  4G7O C;  1HZC A;  4A3J H;  1XPU A;  1JWS D;  3I2Z A;  2BE5 D;  4C3H B;  5KNC A;  1E0B A;  5I9O A;  3PUX A;  5C5L A;  1G8Z D;  4GLV B;  3H94 A;  1IXR A;  4O2D A;  3H15 A;  3TDQ A;  2Q2I A;  1MGS A;  3A7L A;  1UNS A;  2F0G A;  1I4H A;  4XDX A;  1SEB D;  3F1Z A;  4NXM L;  1VQ7 A;  2F0V A;  2F0O A;  2A6E D;  4DV7 Q;  1W6K A;  1SMX A;  4ZLT F;  2A6H D;  2KBN A;  4AIM A;  3N52 A;  2MFI A;  5CV9 A;  4L8J A;  3Q8D A;  2BH8 A;  3GDE A;  3I4L A;  1VDZ A;  3HKZ E;  1H9M A;  1VMC A;  1MSG A;  1ET9 A;  2EY1 A;  2ICI A;  3C1E A;  4KV6 A;  4ZKB B;  1EY4 A;  1N8R C;  1STE A;  3DXJ C;  1Q81 C;  3K5O A;  4DV4 L;  1JOQ A;  1JWM D;  2D62 A;  1IBL L;  1WTP A;  2EYH A;  3OMG A;  1D5M C;  2WB1 B;  1YIT A;  5EBC A;  2PO4 A;  1B53 A;  3EVQ A;  3G7L A;  1Q86 C;  5KYL A;  4NKL A;  2B2U C;  3E9H A;  1GVP A;  4K8I A;  1VF7 A;  2A19 A;  4A3F B;  4OL7 A;  4ME3 A;  4JPB W;  2YV5 A;  1GUG A;  4PQX A;  2B63 B;  4L5Q A;  2NYZ D;  1GUO A;  2M2L A;  3CRL C;  3GQB A;  4EVO A;  1MJE A;  3JC6 6;  5M3M B;  4QMG A;  3FRP B;  1HTL D;  1PH6 A;  1SFO H;  3EFX D;  3G71 A;  4DR7 L;  4DF7 A;  4OX9 Q;  3CQZ H;  2ES2 A;  2XGT A;  5M3F B;  5D65 A;  1RJT A;  2XTI A;  1YNJ D;  1TWG H;  4GS3 A;  4HAE A;  2G9D A;  1SBB B;  4A3C H;  1K8M A;  1WOC A;  1XYI A;  1SMY C;  2BH2 A;  1TS2 A;  5JEA G;  2QEX A;  1KXL A;  1XJV A;  3CCJ A;  1VQL A;  5HGT A;  1BCP B;  1SYD A;  3BZD B;  1IBM Q;  3HOV H;  3A8J E;  1MIU A;  1G2S A;  1N33 L;  4C1N I;  3I55 A;  4OEL B;  3OIP A;  4KMU C;  2ZTD A;  5C0X H;  1M1K C;  2CQO A;  5L37 A;  4A3E H;  1WCM H;  3Q0A A;  2KVM A;  1LT5 D;  4B3T Q;  2IW3 A;  4OEM B;  1LAC A;  1U9R A;  2CH4 W;  1Q12 A;  4H13 C;  4I7A A;  3S9W A;  3E3X A;  5ELD A;  4Y52 H;  1B9M A;  1JQY D;  2CQA A;  3I4N B;  2F0D A;  2CH4 A;  2V4D A;  4M8A A;  3OPO A;  2KEC A;  2R92 H;  4JI7 Q;  2HT1 A;  2IT1 A;  3FPU B;  4XT1 B;  3K59 A;  5JJL A;  3S1Q B;  2NVQ B;  4FO2 A;  3PMF A;  4CKB A;  3H3V H;  2K14 A;  4BY7 B;  3I4O A;  1B7Y B;  1X3E A;  2ZJR A;  2IX0 A;  3L0O A;  1YHQ A;  2VNU D;  4JI4 L;  2D0O A;  4ZUI A;  5IP7 G;  4HIK A;  1IBK Q;  4BBS B;  4LUV A;  1LTS D;  2PNH A;  1EYG A;  4A93 G;  4QF4 A;  5GAD C;  3W2D A;  1CQV A;  1DOK A;  3A56 A;  4OX9 L;  1STH A;  2VXW A;  2YTY A;  1D1I A;  3GTJ H;  1PA6 A;  2OQK A;  4BXX G;  4X62 Q;  4Y7N B;  3RNU A;  1VQB A;  3S2H H;  4NDX A;  1B70 B;  3Q22 A;  4IPC A;  1FJG Q;  2WAC A;  1FGB D;  4K14 A;  3ZJY C;  2RCN A;  3KJO A;  5ELF A;  1TVX A;  2KCT A;  3GTP H;  4P71 A;  4TSS A;  5M9O A;  5M5X B;  2CHB D;  3U9S A;  1Y8P B;  4ALP A;  1JC7 A;  3OWF A;  2LS0 1;  4ZUJ A;  1EQV A;  2HCI A;  2WAQ G;  5LMU Q;  1STY A;  3R3O A;  1ASZ A;  4JI1 Q;  5JJZ A;  1HA6 A;  4RKB A;  1RTN A;  1PXU A;  4P2C B;  3H09 A;  4JI7 L;  2ATW A;  2E2H H;  5I6W A;  2BCO A;  1EQQ A;  4UAI A;  1NUC A;  2PQA B;  1XNR Q;  2D9U A;  1BF4 A;  3NBH B;  3UDI A;  5IGC A;  2RKS A;  4R8I A;  2EYJ A;  2IJ0 A;  2D0P A;  4FNF A;  3R93 A;  3NQT A;  4R4O A;  3CCL A;  4A3I G;  2WB1 E;  1CHP D;  1RIP A;  4KN4 C;  3GTM H;  4I7Z C;  1HR0 W;  4IQZ A;  4IPG A;  1K3R A;  1WTV A;  1A2T A;  4A3K G;  3VR3 A;  4DAP A;  4LFB Q;  2EXZ A;  2K5N A;  2DJF C;  4IUQ A;  1QVF A;  3WWV A;  4Q5V A;  3KF6 B;  3MZ5 A;  2MNA A;  3OTO Q;  5C5M A;  4OON A;  1H9S A;  4X62 L;  1UE5 A;  4DR3 Q;  4BY1 B;  2VZA A;  4HCE A;  2OQ0 A;  2LXK A;  3NQI A;  4IO9 A;  4A4I A;  4R4Q A;  2NVX B;  2AHO B;  1NE3 A;  3P7J A;  1TWF H;  1FJG L;  1CA6 A;  5CBA E;  1NCV A;  1EWH A;  2G5D A;  3ULP A;  4A3B H;  1L1O B;  1JJC B;  4PV1 C;  1MSH A;  2B3G A;  4DAY A;  5LHY 1;  2RHS B;  1Y8O B;  4XYQ A;  1PLF A;  1RDP D;  1T9H A;  2K5H A;  1U4P A;  3AFQ A;  4IFD I;  1NAP A;  3PO3 B;  1GHK A;  1YVC A;  1L0W A;  4IUN A;  4C2M H;  4FF3 A;  4A3J G;  1C4Q A;  2RF4 A;  2JQO A;  2YTX A;  4DV0 Q;  1XMQ Q;  2E5L Q;  3KYH C;  4JI1 L;  1HPC A;  1SE2 A;  5IOD A;  1JE4 A;  5C4J H;  4LF9 Q;  1KRT A;  1JB3 A;  1TWH B;  1F2M A;  1O78 A;  5ELO A;  2VUM H;  1KDC A;  4MTN A;  1FNW A;  4ZRZ A;  2F0U A;  4OWX B;  1GKH A;  1CKN A;  2QGQ A;  5JJI A;  3LWE A;  2L55 A;  3DEP A;  2HDM A;  4C3J B;  1F9P A;  5I2X A;  1A6X A;  5FLX c;  1IKM A;  2VL6 A;  1B50 A;  4CDE C;  1NY4 A;  3NSW A;  2M9V A;  3K80 C;  4CJ0 B;  4LF5 Q;  3T4A C;  1HTP A;  3PF5 A;  4HSV A;  4G4K A;  1RTO A;  2CWP A;  3GTG B;  2PI2 E;  4LJZ C;  5ISR A;  1ZEQ X;  1YNN C;  4LW1 A;  1X65 A;  4DXF A;  3GTO B;  4BWG B;  1TY2 A;  5DEH A;  4LFB L;  3J81 j;  3PUZ A;  3J80 L;  1STN A;  4NB3 A;  5I4D A;  2BA0 A;  2EJM A;  5KNB A;  2RCF A;  5IGG A;  1RCV D;  2CFM A;  3GTK B;  1HFG A;  3PO2 H;  3OTO L;  1SYC A;  2UXC Q;  1GJX A;  3EIV A;  2IHF A;  4DR3 L;  1X3G A;  3CC7 A;  3UDX A;  5IP9 H;  4KY6 A;  2RBM A;  1D5Z C;  5LL6 S;  4CDD C;  2LSS A;  2JA6 H;  1PRT D;  3OW7 A;  1UEB A;  4IJL A;  2R7Z B;  2NVT B;  2UUA Q;  2Z1C A;  2YU9 H;  5EPJ A;  4CJ1 B;  1K83 B;  3I4N G;  1Y1V H;  4DFA A;  4AH6 A;  5BR8 L;  1HJP A;  3J7Y W;  1B8A A;  5DNF A;  5COY A;  1YJW A;  2ZTE A;  3BYY B;  1WI5 A;  2JA8 B;  1AZP A;  4RCN A;  4DV0 L;  1XMQ L;  2E5L L;  3IL8 A;  4ZQ3 A;  3U4V A;  1PYB A;  2NZO A;  2AUK A;  4GNX B;  2E74 C;  4LF9 L;  1YNX A;  3FVQ A;  1PFM A;  4KN7 C;  4R4I A;  1HR0 L;  2A74 C;  4JBJ A;  4BBS G;  4DR4 Q;  3CXC A;  5EJW A;  4WJW A;  1NSN S;  3AB9 A;  5D3D A;  3VR5 A;  4GOP B;  4JBK A;  5C0X G;  4PZ8 A;  1V1P A;  3M7G A;  4AQY Q;  4OIJ A;  3J80 i;  4A3E G;  1JJ2 A;  1E1T A;  1EIY B;  3GTQ H;  1I4R A;  1WCM G;  1LT3 D;  1EQT A;  5EKK A;  2DGY A;  5JJK A;  3AFP A;  5E7N A;  3NK9 A;  3CC2 A;  4OIK A;  4EX5 A;  2HD3 A;  2N49 A;  4IN3 A;  4HTH A;  4RH6 A;  2UUB Q;  4QL5 A;  2Z4H A;  3G4S A;  3NWT A;  4KJO A;  2JJQ A;  3J81 c;  2QDL A;  2R92 G;  1WTQ A;  1EIG A;  3DM1 A;  2E2I H;  3K7U C;  4M1U B;  2HQL A;  2UXC L;  5FLX E;  3ND9 A;  1S5C D;  5CBE E;  3ONA B;  3D3R A;  1XPO A;  2L4N A;  3C1F A;  4CDF C;  3G6E A;  1HH2 P;  1BQQ T;  1VQE A;  3OWE B;  2A73 B;  1EWC A;  3MTS A;  5FJ8 H;  2UUA L;  3S14 B;  2ZTC A;  1I6H H;  3T53 B;  1HZA A;  1PH8 A;  1AE2 A;  2Z6K A;  2H5X A;  1FGU A;  1XXG A;  4PMB A;  2QDB A;  1EEF D;  1EYD A;  1SNQ A;  1C7Y A;  4WJ4 A;  4ABN A;  2DNE A;  1IHZ A;  1O80 A;  4L5R C;  2KCN A; 
#chains in the Genus database with same CATH homology
 4MHE A;  4RGO S;  2SNM A;  1FNV A;  1HQR D;  2NTS A;  3LWU A;  1EZ6 A;  1GHJ A;  2F0T A;  3BS1 A;  3S17 B;  5EKL A;  3ZYY X;  1XX8 A;  3NP8 A;  1PZJ D;  1SNO A;  1AN8 A;  4EQN A;  3VR2 A;  4RGT A;  2WIN B;  3HS0 C;  3C46 A;  1C8C A;  2K7V A;  2WKD A;  2IX1 A;  3OSO A;  3W3A A;  1F9Q A;  2A69 C;  2C5C A;  2A68 C;  3EJI A;  4IUR A;  2FJ2 A;  3BDO A;  1RF2 D;  4CJ2 C;  3H3V C;  1QIL A;  3PIO 3;  1EFI D;  2NTT A;  2AQ3 B;  3VA5 A;  1F9R A;  4L63 B;  3ND8 A;  2XWB B;  3NXW A;  3OMC A;  4IFD H;  3C3L A;  4G57 A;  1X3Q A;  3TP8 A;  3VR4 A;  3J81 E;  5IIF A;  1R4Q B;  4A93 B;  2A6H C;  1G6Z A;  4RGM A;  1BCP D;  3KF8 A;  1B9N A;  3A8K E;  1WD0 A;  3UI2 A;  4B08 A;  4X3T A;  1HA5 A;  1PZI D;  4HMI A;  1I6V C;  1VCI A;  5C6A A;  1I4P A;  2IWH A;  5JVH 3;  2JP1 A;  3D8G A;  1RKN A;  2J4X A;  1LTI D;  1PMR A;  3M4O B;  1PTO C;  2JXM B;  2X6L A;  2FFK B;  3MXP A;  2WAQ B;  4LMQ D;  5DM6 3;  1A3V A;  2NN6 I;  2HUG A;  2F0M A;  2KCC A;  2NB0 A;  4C56 C;  2B2W C;  4RA8 A;  3R8B A;  2A5H A;  5E3F A;  3QOL A;  2A69 D;  2A68 D;  2F0J A;  1ESR A;  1YNJ C;  4L6T B;  4RHS A;  1BUV T;  2DY7 A;  3OOC A;  4IUV A;  1OO9 B;  4K2K A;  4A3I B;  4IUT A;  1LAB A;  2KOL A;  2RVL A;  3BVM A;  4Z9C B;  3K5M A;  1EZ8 A;  2SDF A;  2PW5 A;  2F0Q A;  1Y1W B;  3SXH A;  2JEA I;  4A3K B;  2PZW A;  5IT9 E;  1SNP A;  4FF4 A;  1D1K A;  2I46 A;  5COR A;  5LL6 X;  1M8A A;  3HP3 A;  1OXU A;  4F87 A;  3HRZ C;  1LTT D;  3DHQ A;  4FYD A;  3R2T A;  2SEB D;  5KND A;  4WFN 3;  3T56 B;  1GUN A;  2ID0 A;  1A2U A;  2EY6 A;  3QJY A;  1NR2 A;  1FD7 D;  2EPB A;  3LX0 A;  4A3J B;  1HXY D;  2WV6 D;  1BO0 A;  3SK8 A;  1S4Z A;  1PTO D;  1BR9 A;  1LO5 D;  1HHV A;  3EA6 A;  2XVS A;  1PTO F;  1SE3 A;  4IZ8 A;  5C4H A;  2EDG A;  3A8I E;  2EJG C;  1EYA A;  5I6Y A;  2Q8R E;  4S3S A;  2QF7 A;  5BN3 A;  1ET6 A;  1T5E A;  5KGU A;  3GV6 A;  3AU7 A;  2AWO A;  1U4L A;  4F7X A;  1EOT A;  4IAL A;  4N9P A;  4FXK C;  4JK1 C;  3K7A B;  5E1F A;  5IGD A;  3I91 A;  3HEJ A;  5NUC A;  1UUP A;  4DXG A;  2K5Q A;  1KLU D;  1SJE D;  2N55 A;  4HSP A;  5KEE A;  4XT3 B;  5CGK A;  2JYO A;  3KUP A;  2E2D C;  4RKL A;  1JIC A;  1SFO B;  3DWP A;  1AP0 A;  3F2U A;  1IW7 D;  3CQZ B;  4QUC A;  2NVY B;  1ESF A;  1TWG B;  1SNM A;  1B4O A;  3NHH A;  2IPK D;  1EY8 A;  2O2L D;  1JOK A;  3JAM L;  3CHB D;  2KQ3 A;  3K6O A;  5D14 A;  1RD9 D;  1FR3 A;  1LV9 A;  2MP1 A;  3HOV B;  1Y8N B;  1SYG A;  2LKV A;  3QG1 A;  1DOL A;  2SNS A;  2RSO A;  2MHV A;  5C0X J;  4A3E B;  1WCM B;  1Q1B A;  5ELB A;  1WD1 A;  3M4Y A;  1SDF A;  2N88 A;  3S15 B;  4NP5 A;  4TKO B;  3J80 E;  1EEI D;  2AWN A;  2R92 B;  3FMC A;  2K28 A;  1I4Q A;  3C2P A;  5CR3 A;  4J8Q A;  3S16 B;  1PTO H;  4PNY A;  3KLR A;  1CM9 A;  1DD2 A;  4GZY C;  2NN6 H;  2Z4I A;  1LT6 D;  3GTJ B;  1F2L A;  5JVG 3;  1TII D;  3D4D A;  3TME A;  3S2H B;  3SK6 A;  3PV0 A;  2Q8T A;  1J9O A;  4MN3 A;  1X32 A;  3G6J B;  3BVZ A;  1L0X B;  2B8G A;  3GTP B;  4HMJ A;  3GTL B;  4CGY B;  5FO9 B;  1IYU A;  2KUM A;  2K6A A;  4R9W A;  2KJX A;  3R2I A;  3D6C A;  1PRT C;  1BOS A;  1HRJ A;  3T51 B;  5EQ0 A;  5CC4 A;  1KDB A;  2EYP A;  3HGB A;  3RMH A;  2K04 A;  1DCZ A;  3DMU A;  5A35 A;  5D3I B;  2NUC A;  4DNR B;  3GTM B;  1SAP A;  1ONL A;  2ZT9 C;  2H1E A;  1Z7T A;  5M5W B;  2PMZ B;  2RQX A;  1XTC D;  4ZKC B;  1QWY A;  2RA4 A;  1SYF A;  1SE4 A;  2XN9 C;  2BOS A;  1STA A;  4UDU C;  2F0H A;  1K8O A;  4ME5 A;  5TSS A;  5EBD A;  2R6G A;  1HUM A;  2B2T A;  1TY0 A;  3LNN A;  1DXM A;  1TS5 A;  1TWF B;  4K5X A;  5JPN C;  4A3B B;  3URY A;  4TRD A;  3ERQ A;  2LY7 A;  1HUN A;  4RWS C;  4B9W A;  1WTW A;  5FO8 B;  2IX3 A;  4C2M B;  3I73 A;  4E6I A;  1KAB A;  3S1M B;  4K5W A;  5C4J B;  2VUM B;  5C3E B;  1AFP A;  1V43 A;  4C1N K;  1PFB A;  3WDN A;  4K5V A;  5I9P A;  3TZU A;  4FF1 A;  1PRT F;  2K01 A;  3BDL A;  2RDF A;  2F0F A;  3MFY A;  1SNC A;  1B1Z A;  3V96 A;  1JOO A;  3T16 A;  2E75 C;  1WTR A;  3MAQ A;  2AQ2 B;  3H6M A;  1ENC A;  1O7Y A;  3BVG A;  4G7Z C;  3PO2 B;  5CYU A;  2G9H D;  4CBV A;  5A2Q E;  1E2Z A;  1L0Y B;  2F4I A;  3OHX C;  2F3W A;  5J1Z A;  2JA6 B;  3TN2 A;  4XQJ A;  3TSS A;  3BG3 A;  2YU9 B;  4Q0F A;  1Y1V B;  1S5B D;  1TWA B;  3GV3 A;  1DON A;  1I50 B;  3IKJ A;  2GA4 B;  2OXP A;  1CT1 D;  4KD4 A;  3DWQ A;  5EKI A;  2B2T C;  1KDA A;  5E4W C;  1GOZ A;  2EOT A;  2CVR A;  1BCP C;  4XTC S;  2DN8 A;  3I90 A;  1CK1 A;  3NE5 B;  1D2B A;  4EQP A;  3MXG A;  3X3M A;  1CQF A;  3NBH A;  3SHL A;  4EGV A;  3GTQ B;  4X3K A;  2ZXP A;  5FOB B;  4XQN A;  4U68 A;  1IKL A;  3FPP A;  2B2W A;  1TS4 A;  1BNZ A;  1PYW D;  2HQE A;  2KED A;  1CI3 M;  2E2I B;  1Q8I A;  2PW7 A;  5JEA J;  4MIU A;  4H0L C;  5IGB A;  1MI2 A;  1Z6H A;  4KD3 A;  4O42 A;  4KHZ A;  1KAA A;  1TU2 B;  4H44 C;  3DEO A;  4ILW A;  3D4W A;  5KIX A;  4WRD A;  2K33 A;  5F2D A;  2KA7 A;  2EY5 A;  1TQO A;  1I6H B;  1TS3 A;  5EGT A;  1CA5 A;  1STB A;  2NN6 G;  4RAU C;  4J6H A;  1R4P B;  1VMP A;  5CV6 A;  3CKI B;  3QIA A;  2J0T D;  3V2T A;  1II3 A;  2OF1 A;  4XYO A;  1CHQ D;  5IOC A;  2EVB A;  4IUU A;  2K1B A;  2QIL A;  3K57 A;  1KTK A;  1GXD C;  1OXS C;  4QIW B;  2RDG A;  3QWN A;  2LMC B;  2F3V A;  1ZXT A;  1SND A;  2L11 A;  3I70 A;  3RZD B;  1BCP F;  2H4O A;  1PDQ A;  5JOB A;  3NTH A;  2B2V A;  3FDT A;  1OXV A;  2B2Y A;  2FHT A;  4RHR A;  3MA2 B;  2MPM A;  3HOU B;  4ID6 A;  1X3P A;  3RUZ A;  3E0J A;  3TBI B;  3TP7 A;  3WOE A;  4EQO A;  3HZX A;  1HCZ A;  2EE1 A;  1S5D D;  2L5T A;  1MD2 D;  1S5F D;  1U4M A;  3QOJ A;  2EZV A;  4FVM A;  2DY8 A;  2MUY A;  3JAM E;  1DYQ A;  1JR0 D;  1JOR A;  4YIJ A;  4QB4 A;  4RCO A;  2F03 A;  5FLX L;  3Q24 A;  3T13 A;  4OO1 I;  2FIN B;  3SVM A;  3NTI A;  4KJN A;  1S5E D;  5CMD A;  4C3I B;  1H9J A;  2K05 A;  2J7Z A;  1ENA A;  1EY0 A;  2I07 B;  2D5D A;  4BBR B;  3U9O A;  5K36 H;  1QJO A;  2QEJ C;  2Y0S B;  1TWC B;  1Q1E A;  1QNU A;  1IW7 C;  3MVV A;  3PIP 3;  3HOY B;  3D31 A;  2VB2 X;  4HN7 A;  2RDH A;  4U67 3;  5BN4 A;  4FXG C;  2R61 A;  4F8M A;  3SDZ A;  2SOB A;  3HOX B;  2X6G A;  4R8N A;  4JBW A;  3BDC A;  1H9S B;  1B3A A;  4XIG S;  2B2V C;  3E5S A;  2K5W A;  3J7A V;  5EPL A;  2B2Y C;  1V1O A;  2AQ1 B;  3PUV A;  1AZQ A;  3A54 A;  3VA7 A;  1KLG D;  2CW0 D;  3WOF A;  4DU9 A;  3MHB A;  3PUW A;  4KKT A;  3NUC A;  2KEE A;  3GD7 A;  4IUP A;  1ML0 D;  5C3X A;  1EU4 A;  4DN4 M;  2KHS A;  2XRQ D;  4LK1 C;  2M00 A;  2Z8L A;  1DZ1 A;  3SK5 A;  3MFG A;  1ILP A;  1EY6 A;  2HCC A;  4K2L A;  3MXN A;  1BBX C;  2PYK A;  2O4X A;  3FKI B;  3J81 L;  2F0W A;  3TP6 A;  1WTX A;  4RFB A;  3Q6S A;  3H0G B;  2B39 A;  1BXT A;  4NW2 A;  4X3S A;  2K32 A;  1AW7 A;  4F88 A;  4FF2 A;  3PUY A;  4KHV A;  3AMU A;  3OIQ A;  2WII B;  3P1H A;  2K5D A;  3K58 A;  3SK4 A;  4G7H C;  1TT2 A;  1EY5 A;  2O5I C;  3CRK C;  3HOZ B;  5J39 A;  2JSO A;  2JA5 B;  2F0L A;  3ERO A;  2ENB A;  4KI0 A;  3KBX A;  2FMC A;  4V19 0;  5IGE A;  5CV8 A;  1GUT A;  3NTK A;  1CTM A;  1PFN A;  4DGZ A;  2RSN A;  4CHT B;  1CFM A;  1O7L A;  2MGS A;  1KNE A;  4B9X A;  2LFN A;  5IT9 L;  2F0N A;  5AFW A;  1C48 A;  5J22 A;  1FNU A;  2WKC A;  4AYB B;  1V1P B;  4IFD G;  3M85 A;  1I4X A;  4KTA A;  2ICE C;  5JPM C;  2TMP A;  3RD4 A;  1FYC A;  1EY9 A;  5EPK A;  4ULL A;  2O5J C;  1W6J A;  1ENF A;  2F1M A;  1SMY D;  4BS9 A;  1DJR D;  2EY2 A;  3K5L A;  4DK0 A;  2JEB I;  3ITP A;  1SJH D;  3A55 A;  1VF5 C;  1IL8 A;  4BA1 I;  2F0K A;  2EYL A;  1M4V A;  1OXT A;  3D6W A;  1QNK A;  3K0Y A;  3BYT B;  4OO1 H;  1SYB A;  5HUR A;  4QCL A;  2F0P A;  4C3I G;  2C9O A;  2EYF A;  1PTO B;  1DM0 B;  4TQU S;  3I4M B;  1UEA B;  2F0I A;  2NBF A;  5CV4 A;  2WP8 J;  2XSC A;  4ZAI A;  4C3H G;  3P75 A;  2ZXO A;  3MC0 B;  5FO7 B;  3VYS A;  2BDN A;  4O1N A;  2E2H B;  3H91 A;  3M3Y B;  4PMC A;  2F0E A;  5G3L D;  4DA2 A;  1UAP A;  4XXE A;  1SXT A;  5G3L F;  3A7A B;  4DK1 A;  1DOM A;  4ODG A;  3O13 A;  2MJ8 A;  1ZYR C;  1KNA A;  5KYI A;  1J8I A;  4H7B A;  5ELC A;  1Z47 A;  1ICW A;  1Y69 U;  3GP7 A;  3VYU A;  1ILQ A;  5K36 G;  3SE0 A;  1U4R A;  3N6R A;  3L7Z C;  2BDO A;  4KKS A;  3L9A X;  4K6D A;  3QB3 A;  1LTA D;  1A3T A;  2R3Z A;  4N9T A;  4FXD A;  2L12 A;  1G29 1;  2L1B A;  2NZ1 D;  4DAV A;  4KK7 A;  1EL0 A;  1D6E C;  1Q90 A;  5IGF A;  1A3U A;  1QOH A;  1LT4 D;  3NBI A;  3KLS X;  1H9R A;  3IFT A;  5C4X B;  4OGQ C;  2XIW A;  3TZD A;  4HR7 B;  2Q8I B;  3J7A F;  1CZW A;  4I65 A;  5T1I A;  1XWE A;  1V8Q A;  3MWY W;  2X69 A;  1ZYR D;  2DNC A;  1T5X D;  3S2D B;  2QCP X;  5M5Y B;  1QB5 D;  3EQL C;  1BDO A;  3P20 A;  1TKW B;  1IYV A;  1SYE A;  5T1G A;  3K5N A;  2E2J B;  3MEH A;  5C4Z A;  2L9H A;  2OEO A;  4V0B A;  3NPP A;  1F2Y A;  2E76 C;  2PZU A;  4HCS A;  3IAY A;  1LTG D;  2XWJ B;  3QO2 A;  2HDL A;  1ROD A;  2EYO A;  1LLR D;  1E2V A;  1O7Z A;  3NWS A;  1JCK B;  2B8F A;  5JEA H;  3TP5 A;  1YNN D;  1CZG A;  1D5X C;  2PCF B;  4A3D B;  1PZK D;  1EIH A;  2FMM A;  2ZXR A;  3KBG A;  3V05 A;  2VB3 X;  1G91 A;  1QE6 A;  3KLS A;  3CU7 A;  5BN5 A;  2PPB C;  2EJF C;  4CKE A;  4DNT B;  1SSO A;  3IFD A;  3S1N B;  4NMZ A;  3I3C A;  2BA1 A;  3HKZ B;  5KRU A;  1EYC A;  2EYM A;  3Q23 A;  2K03 A;  3VYT A;  3SR1 A;  4KY7 A;  4RGN A;  4QUF A;  4A3G B;  5C0X I;  5K5P A;  3KK7 A;  2L0C A;  1LTR D;  3DWA A;  1OXX K;  5ELE A;  4FP5 D;  2XNA C;  1I3Q B;  3L3O C;  1F77 A;  5JAV A;  2AUJ D;  4ZYS A;  3GO5 A;  1MBY A;  5CV7 A;  4OO1 G;  1F9S A;  3M7N A;  4K8J A;  1QCB D;  2BE5 C;  3FEW X;  5CV5 A;  1GUW A;  5FK9 C;  4KY5 A;  3I8Z A;  4K6L A;  2R93 B;  3VYR A;  1B2T A;  1H9K A;  1PRT B;  5DM7 3;  2PQE A;  4PMW A;  2A6E C;  1I4G A;  4ZK9 B;  2YYZ A;  2D2C C;  1WTO A;  1R9T B;  1QG7 A;  2XRS D;  3HG9 A;  4J1M A;  4C3J G;  1EU3 A;  1STG A;  5FKA C;  1WVL A;  1Q3L A;  2B2U A;  4OHJ A;  4CKC A;  1F2Z A;  4X3U A;  5A2Q L;  2JA7 B;  1RHP A;  3SEB A;  2PZT A;  2JE6 I;  4HED A;  4A3M B;  4IFD J;  2IL8 A;  3D4R A;  1TR5 A;  5E4X A;  2CW0 C;  5C44 B;  1GUS A;  3DUZ A;  1HQM C;  1B44 D;  1G2T A;  3X3N A;  3I72 A;  1LTB D;  2F0S A;  5I2Y A;  4LAA A;  3VR6 A;  1NR4 A;  2TSS A;  2OT2 A;  1A15 A;  4KKU A;  5DAU A;  2QKI C;  1EY7 A;  3RZO B;  4WOR A;  2NWG A;  3RLF A;  3HOW B;  1AEX A;  3MXU A;  5C3W A;  1JWU D;  1ZKO A;  3E6Z X;  4XQQ A;  1E2W A;  3S1R B;  2PNR C;  4BA2 I;  1HFN A;  4G7O C;  1JWS D;  2BE5 D;  4C3H B;  5KNC A;  1E0B A;  5I9O A;  3PUX A;  5C5L A;  1G8Z D;  3H94 A;  3TDQ A;  1MGS A;  3A7L A;  1UNS A;  2F0G A;  1I4H A;  4XDX A;  1SEB D;  2F0V A;  2F0O A;  2A6E D;  1W6K A;  4ZLT F;  2A6H D;  3N52 A;  5CV9 A;  4L8J A;  3I4L A;  1VDZ A;  1H9M A;  1VMC A;  1MSG A;  1ET9 A;  2EY1 A;  2ICI A;  3C1E A;  4KV6 A;  4ZKB B;  1EY4 A;  1STE A;  3DXJ C;  3K5O A;  1JOQ A;  1JWM D;  2D62 A;  1WTP A;  2EYH A;  3OMG A;  1D5M C;  2WB1 B;  5EBC A;  2PO4 A;  1B53 A;  3EVQ A;  3G7L A;  5KYL A;  4NKL A;  2B2U C;  4K8I A;  1VF7 A;  4A3F B;  4OL7 A;  1GUG A;  4PQX A;  2B63 B;  2NYZ D;  1GUO A;  2M2L A;  3CRL C;  3GQB A;  4EVO A;  5M3M B;  4QMG A;  3FRP B;  1HTL D;  3EFX D;  4DF7 A;  5M3F B;  5D65 A;  1RJT A;  1YNJ D;  4HAE A;  2G9D A;  1SBB B;  1K8M A;  1XYI A;  1SMY C;  1TS2 A;  5JEA G;  5HGT A;  1BCP B;  1SYD A;  3BZD B;  3A8J E;  1G2S A;  4C1N I;  3OIP A;  4KMU C;  5C0X H;  3Q0A A;  2KVM A;  1LT5 D;  2IW3 A;  1LAC A;  1U9R A;  1Q12 A;  4H13 C;  3S9W A;  5ELD A;  1B9M A;  1JQY D;  2CQA A;  3I4N B;  2F0D A;  2V4D A;  4M8A A;  3OPO A;  2KEC A;  2IT1 A;  3FPU B;  4XT1 B;  3K59 A;  3S1Q B;  2NVQ B;  4FO2 A;  3PMF A;  4CKB A;  4BY7 B;  2IX0 A;  2VNU D;  4ZUI A;  4BBS B;  1LTS D;  4QF4 A;  3W2D A;  1CQV A;  1DOK A;  3A56 A;  1STH A;  2VXW A;  1D1I A;  4Y7N B;  4NDX A;  3Q22 A;  2WAC A;  1FGB D;  4K14 A;  5ELF A;  1TVX A;  4TSS A;  5M9O A;  5M5X B;  2CHB D;  3U9S A;  1Y8P B;  1JC7 A;  3OWF A;  2LS0 1;  4ZUJ A;  1EQV A;  2HCI A;  1STY A;  3R3O A;  5JJZ A;  1HA6 A;  4RKB A;  1RTN A;  1PXU A;  4P2C B;  3H09 A;  5I6W A;  2BCO A;  4UAI A;  1NUC A;  2D9U A;  1BF4 A;  5IGC A;  2RKS A;  4R8I A;  2EYJ A;  2IJ0 A;  4FNF A;  3R93 A;  3NQT A;  1CHP D;  4KN4 C;  4I7Z C;  4IQZ A;  1WTV A;  1A2T A;  3VR3 A;  4DAP A;  2EXZ A;  4IUQ A;  4Q5V A;  3MZ5 A;  5C5M A;  1H9S A;  4BY1 B;  4HCE A;  3NQI A;  2NVX B;  3P7J A;  1CA6 A;  5CBA E;  1NCV A;  1EWH A;  4PV1 C;  1MSH A;  4DAY A;  5LHY 1;  1Y8O B;  4XYQ A;  1PLF A;  1RDP D;  1U4P A;  4IFD I;  1NAP A;  3PO3 B;  1GHK A;  4IUN A;  4FF3 A;  1C4Q A;  1HPC A;  1SE2 A;  5IOD A;  1JE4 A;  1JB3 A;  1TWH B;  1F2M A;  1O78 A;  1KDC A;  1FNW A;  4ZRZ A;  2F0U A;  3LWE A;  2L55 A;  3DEP A;  2HDM A;  4C3J B;  1F9P A;  5I2X A;  1A6X A;  1IKM A;  1B50 A;  2M9V A;  3NSW A;  4CJ0 B;  3T4A C;  1HTP A;  4HSV A;  4G4K A;  1RTO A;  3GTG B;  4LJZ C;  5ISR A;  1ZEQ X;  1YNN C;  4DXF A;  3GTO B;  4BWG B;  1TY2 A;  5DEH A;  3PUZ A;  3J80 L;  1STN A;  5I4D A;  2BA0 A;  2EJM A;  5KNB A;  5IGG A;  1RCV D;  3GTK B;  1HFG A;  1SYC A;  1GJX A;  4KY6 A;  2RBM A;  1D5Z C;  5LL6 S;  1PRT D;  3OW7 A;  2R7Z B;  2NVT B;  2Z1C A;  5EPJ A;  4CJ1 B;  1K83 B;  4DFA A;  3J7Y W;  5DNF A;  5COY A;  3BYY B;  2JA8 B;  1AZP A;  4RCN A;  3IL8 A;  4ZQ3 A;  2AUK A;  2E74 C;  3FVQ A;  1PFM A;  4KN7 C;  2A74 C;  5EJW A;  4WJW A;  1NSN S;  3AB9 A;  5D3D A;  3VR5 A;  5C0X G;  1V1P A;  3M7G A;  4OIJ A;  1I4R A;  1LT3 D;  1EQT A;  5EKK A;  3NK9 A;  4OIK A;  4IN3 A;  4HTH A;  4RH6 A;  2Z4H A;  3NWT A;  4KJO A;  1WTQ A;  1EIG A;  3DM1 A;  4M1U B;  5FLX E;  3ND9 A;  1S5C D;  5CBE E;  3ONA B;  3D3R A;  2L4N A;  3C1F A;  1BQQ T;  3OWE B;  2A73 B;  1EWC A;  3MTS A;  3S14 B;  3T53 B;  1XXG A;  4PMB A;  2QDB A;  1EEF D;  1EYD A;  1SNQ A;  4ABN A;  2DNE A;  1IHZ A;  1O80 A;  2KCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...