2F0DA

Crystal structure of staphylococcal nuclease mutant i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0dA00
3QOJA 1SNQA 3D4WA 4G57A 5IGFA 2F0UA 1EYDA 1F2ZA 5CV6A 5K5PA 1SYGA 4HMJA 5J39A 1SNOA 2F0PA 1STGA 2HQEA 5NUCA 4ODGA 4YIJA 1EQVA 3MXPA 4R8NA 4S3SA 4ZQ3A 4F8MA 1NSNS 2F0HA 1SYBA 4KJNA 4EQOA 4K5VA 5IGGA 3NQTA 1ENCA 2F0MA 2F0OA 4IZ8A 4N9TA 5CGKA 5DAUA 3EJIA 2PW5A 3U9OA 4ZUJA 3OMCA 5KYIA 3MHBA 5C3WA 5KYLA 2F0EA 2EY2A 3RUZA 3MZ5A 5JAVA 3QB3A 4KJOA 4K5XA 3SK4A 1EYAA 5IGCA 1EY5A 5HURA 4EVOA 5HGTA 2NUCA 4N9PA 4J1MA 1SNCA 2EYFA 3NHHA 2PQEA 3S9WA 4EQPA 1JOKA 2PZUA 1JOQA 4OL7A 4IALA 3P1HA 4ME5A 2F0DA 4KY6A 3NUCA 4KD4A 1A2TA 1EZ6A 3DMUA 4K5WA 5CV5A 3HEJA 2F0TA 5J1ZA 2F0KA 2SNSA 2PW7A 2F0NA 1EY7A 1EY9A 2LKVA 4KY7A 4KD3A 3BDCA 5KEEA 5IGBA 1EYCA 2EXZA 4RKBA 4MIUA 3NK9A 3PMFA 4PMBA 5IGDA 4DFAA 2F3VA 5E3FA 1ENAA 1RKNA 2OXPA 1KDBA 1JOOA 1KABA 1SYEA 2KHSA 3E5SA 4K6DA 2EYPA 3TP5A 5IIFA 5IGEA 4NMZA 4PNYA 5IODA 4WORA 4NKLA 5C4ZA 2PZTA 5I6YA 2ENBA 3P75A 2F0FA 2PYKA 2F0IA 2EY6A 2EYHA 5C5MA 3T13A 4E6IA 4QMGA 3C1EA 3TP7A 3TP8A 1SNMA 4EQNA 5DEHA 5C4HA 1A3UA 2EYLA 5ISRA 3MEHA 5CR3A 1KDCA 1SNPA 3D4DA 1F2MA 2F3WA 3C1FA 4K2LA 4QB4A 1II3A 4TRDA 5I6WA 5EKLA 2F0QA 2EYOA 4DGZA 2F0JA 5M9OA 1SYDA 3EVQA 4WRDA 5CV4A 3SXHA 3OSOA 1KDAA 3R3OA 5EGTA 3V2TA 5J22A 3D8GA 1A2UA 1STHA 4QF4A 1JORA 4J6HA 3BDLA 4KY5A 3D6CA 2OEOA 4HTHA 4IUNA 3VA5A 4ZUIA 2EYJA 5C5LA 3T16A 1F2YA 1STYA 5IOCA 3ITPA 3TMEA 2EY5A 4DU9A 4H7BA 2RBMA 4K8IA 5JOBA 2SNMA 4NP5A 3NP8A 4KTAA 3TP6A 2F0LA 2RKSA 4B9XA 1IHZA 4KHVA 5F2DA 1TQOA 3DHQA 1EZ8A 3SR1A 1STNA 2EY1A 1KAAA 2F0GA 1A3TA 4DF7A 5CC4A 5I9OA 5KGUA 3LX0A 1EY4A 2F0VA 1TR5A 2F0WA 2OF1A 2QDBA 3MVVA 5KIXA 3OWFA 2SOBA 4LAAA 1A3VA 2WACA 5CV8A 5EKKA 1U9RA 4KV6A 5CV9A 2EYMA 2PZWA 4RKLA 4PMCA 1SYCA 2O4XA 3HZXA 4K8JA 4B9WA 5C3XA 3SK5A 2KQ3A 3SK6A 5KRUA 2RDFA 1NUCA 4I65A 5CV7A 5E1FA 5I9PA 1EY0A 4K2KA 3ERQA 3SHLA 1STAA 1AEXA 1SNDA 5C6AA 1SYFA 3OMGA 2F0SA 3EROA 3H6MA 4K14A 4NDXA 1STBA 3QOLA 4HMIA 4ID6A 1EY8A 3SK8A 1TT2A 2M00A 4F7XA 3NXWA 1EY6A
chains in the Genus database with same CATH superfamily
1WD1A 1XWEA 4OIJA 2A73B 4JI5L 2D2CC 1EEFD 5HGQA 5GADC 5C3EB 3L2PA 4GLVB 1UEBA 4KMUC 1M4VA 1NNXA 3T51B 3KLSX 3OPOA 1BBWA 3BZDB 3SGIA 1TWHB 5EPJA 1H95A 1N34Q 1X3EA 2V1CC 2H4OA 1Y1VG 3CC2A 4L5TA 1V1QA 1UAPA 3KJOA 2B63B 1VQHA 2JA6H 2D9UA 4DV2Q 1I4RA 5FO7B 4APVA 2G5DA 4UHVA 2EIFA 1JC7A 1KC8C 1EZ6A 3HEJA 4P2CB 3DWQA 5JJZA 5IYBG 1MHWC 3DUZA 5FO8B 3PMFA 4BBRB 5IYDG 1WVLA 1UUPA 3BJUA 1S3OA 4JI3L 4WJ3M 3TP5A 3I70A 2F4VL 4C1NK 3N52A 1VMPA 4ALPA 4NKLA 1HFGA 4FXGC 5C5MA 4OHJA 2EY6A 4LNQA 3MEHA 3X3NA 4IJLA 1VQLA 4WRDA 2IJ0A 3OSOA 4POFA 5FO9B 5E7NA 2Q8IB 4A3LG 1OXTA 5K36H 4ZUIA 4RWSC 1RL2A 3RZDH 1KL9A 3RN5A 3BZKA 2KHJA 2MJ8A 4IQZA 2SNMA 3I4NB 3QG1A 2CCZA 5F2DA 1PH6A 1ASZA 1WTHA 4CDDC 5EPKA 4B3MQ 3ICEA 3PO2H 1Q8KA 1SE2A 2EE1A 1DONA 4HIMA 4A3KB 3ERSX 4X3UA 4X65L 1HJPA 3CCSA 2EQSA 5BN4A 5C3XA 1WTPA 4A93H 1A8VA 4G7OC 3UE0A 4H0LC 1U4LA 5I9PA 2L15A 1YIJA 2K7VA 3NXWA 2UXBQ 1XNQL 3HOXB 2NYZD 4G57A 3UDGA 2UU9L 3AMUA 4A3DH 3K59A 2Z6KA 5J3BA 3AFPA 4P72A 3U58A 3MFYA 4S3SA 2UUAL 1GUSA 4YCWA 4X62L 1EOVA 2RHSB 2CFMA 4C2MH 5L37A 3NTHA 2B2UC 3M4QA 4JI1L 4OELB 4NB3A 4OGQC 1KLUD 5C4XB 2K50A 3PUWA 1HH2P 2EDGA 4A3MG 2JP1A 3T1YL 1WTQA 1AH9A 1NCVA 1L1OC 2VUMB 3EA6A 1YNND 1VQ8A 1HR0L 3PO3B 5M3FB 4CDEC 5CV5A 4PZ8A 5C4JB 2F0KA 3F1ZA 4LFAL 1IXRA 3S1QH 2E74C 4FO2A 5KEEA 2GN5A 4RA8A 2K33A 3CF5A 3I7FA 1H9KA 2L12A 1JWSD 1Z6HA 5AFWA 2EYPA 4L5RC 2K5DA 4DK1A 3P75A 4O42A 1PVOA 1Y8OB 4RCOA 1I4GA 3L9AX 1PDQA 2WINB 4EQNA 2L55A 3ER0A 2JXMB 2LXJA 1TWAH 2XRSD 2MFIA 4XXEA 3KOJA 5BR8Q 3SE0A 2G9DA 5IP7H 3I91A 5JVG3 2N78A 2BOSA 2OEOA 2Z6BA 3OIQA 3RMHA 4PG3A 2JA6B 3CHBD 2SEBD 1XTCD 1B50A 4OX9L 4X3SA 4KHPL 1SXTA 3MXUA 4B3SL 3HOZB 2NVYH 1XPUA 1STNA 4JI7L 1IL8A 1WTOA 1Z9FA 3K0YA 4HN7A 1Q82C 2MGSA 1U9RA 4RKLA 1PV4A 1LLRD 4DR1L 1I4HA 2X6LA 4NXNL 3HKZE 4OONA 1VQAA 1NUCA 2KCNA 2F1MA 1EY0A 3KF8B 1SYFA 4MTKA 1VQMA 1BDOA 2M9VA 1D7QA 2NVTH 5K36G 2QILA 5C0XI 1K3RA 4IPCA 2F0UA 1KIXA 5K5PA 1BBUA 5ELEA 1X54A 3E0JA 1GUGA 1VQ4A 4O2DA 3VYRA 2ASBA 3I4OA 1TWFH 4JI4Q 3GTOH 1UE7A 2BE5D 2IT1A 1RDPD 2FXQA 2F0MA 2WFWA 3PO2G 3RZDB 2OTJA 1I6HH 4JYAQ 1Z47A 1DGSA 2WIIB 4A93G 3I4MH 2RSNA 4JI2L 2PPBC 4EVOA 1SNCA 5AJ3L 1S4ZA 1I4PA 3N6RA 1DM0B 1CSQA 3H15A 1TWCH 4CJ2C 3S15H 4A3DG 1A2TA 3NWSA 4K5WA 5J1ZA 3CCRA 4UPAA 4BXXH 2Z1CA 4J15A 5IGBA 1RTOA 4R4IA 4HJAA 1BNZA 4PMBA 1KRTA 4IN3A 4PNYA 2VL6A 2DN8A 3JAMc 3OOCA 5E4XA 4GKKQ 1AP0A 4HAEA 3CXCA 2ICEC 1QNUA 3NELA 3UI2A 3BVZA 3C1EA 1QZHA 3S17H 2EYLA 1F2MA 3CC4A 4CKEA 1XMQL 4PMWA 4C1NI 2R93H 1ZXTA 4C2MB 4FXDA 4YCVA 1SYDA 2FHTA 1A2UA 1F9PA 4IUNA 3K7AH 1HUMA 1SLJA 2F4IA 2GVBA 2HCIA 1UEAB 1PTOH 2K5WA 3NP8A 1QOHA 3CMEA 3RLNA 3STBD 2K5NA 2JA9A 1A15A 4LAAA 1T5XD 3S1QB 2XTIA 1VQNA 4A3EG 5D14A 1HNZQ 2RSOA 2O4XA 2Q2IA 3M85A 2Y0SG 4OO1I 1EIHA 2JK8A 3SHLA 1STAA 2A1AA 1AEXA 2YV5A 2A68C 5IP7G 4R4QA 3S14B 1E24A 2R7ZB 3QOJA 1SNQA 2XSCA 5FK9C 1IYJB 1TWAB 4AYBE 2A6EC 3CMAA 1B9MA 1SYGA 2HQEA 1C48A 4OXPA 1CKMA 3CCLA 2J4XA 4R8NA 1EIGA 3NSWA 2R61A 3LWUA 5HY6A 2HHHQ 4FXKC 4O1NA 3U9OA 2YU9H 3CC7A 1W6KA 3A8KE 1M90C 5JAVA 2NVYB 2LFNA 4J1MA 1C9OA 4GNXB 1E7ZA 2PQEA 2C9OA 4AYBB 5H1SE 1M1KC 2UUCL 3HOUH 3TZDA 1JT8A 4BA1I 3NUCA 3MFGA 4DXFA 1I5FA 1ZKOA 4DNTB 3BVMA 4A3FH 2E5LL 2UXDQ 4HIKA 1ET9A 4KY7A 3KF6A 3AQQA 1SJED 3GQBA 4DFAA 3TBIB 3AFQA 5IIFA 1K83H 4OWXB 2F0FA 2RQXA 3K5OA 1NY4A 1XPOA 1FD7D 1HNXL 4Z9CB 1TWFB 3D31A 3GTOB 1PXUA 2JA5B 1X6OA 2JA8H 4UAIA 5JVH3 5IWAQ 1I6HB 1OXSC 3FHWA 2K03A 3D8GA 1QNKA 3E9HA 4QF4A 3I4MB 4U68A 3K5MA 3T16A 4JI6Q 1F2YA 1PZJD 3G4SA 1VQJA 1AN8A 2J0TD 1UE5A 2CHBD 3FDTA 5ELFA 4CBVA 1DXMA 3UDFA 3ZYYX 4DAYB 4YHHQ 4KHVA 1TWCB 3S15B 1CHPD 1I50H 1EYGA 4OWWB 3A55A 3LX0A 2OF1A 5COYA 1IBML 2ID0A 2PZWA 4IFDI 3HZXA 3J81E 4IJHA 5JEAH 1K8OA 4BBSH 4FF3A 3GP7A 4DR5Q 5KNCA 1G51A 1KLGD 2C5CA 2WB1E 1BVSA 2R7FA 2K28A 4FDBA 3J81j 1N33Q 1EY8A 3SK8A 4JCVE 4BA2I 3S17B 1F9RA 2EJMA 2KEEA 1L0XB 3MTSA 1F2ZA 2R93B 2BH2A 4ZAIA 2F0PA 2VQFL 1IBLL 1T9HA 2I0QA 3BZCA 5JJIA 1SYBA 1H9RA 4A3CG 4L8JA 1J5EL 3K7AB 1Y1VH 5CGKA 5E4WC 3S1MH 5JPMC 4RHRA 2XIWA 4DV4L 3PQIA 1W3SA 2WAQE 2WB1B 5GAGC 5C3WA 1S40A 1Q86C 1L1OA 3DLLA 4JC0A 4A3JB 4IO9A 4JI5Q 3S2HB 1S5BD 3GTPH 1D2BA 1VQEA 4N9PA 4CKCA 2EYFA 5GROA 4IPDA 2O5IC 1YNJC 2L4NA 4GKJQ 2YTYA 4B08A 1PH4A 5CBEE 4EGVA 5IYBH 4RG1A 1RCVD 4L5SA 4HSVA 2G9HD 1SR3A 3H0GB 1MI2A 5LL6S 1PA6A 1RKNA 1ESFA 4G7ZC 1MKHA 4R9WA 3MXGA 4NMZA 3V05A 1KD1C 1U4MA 3Q24A 3LGJA 2OCEA 1YI2A 4XT1B 5IT9c 3RN2A 4GN5A 4R1JA 3D4DA 4LWCA 4QIWB 5LHY1 4LUVA 4RGMA 1LT6D 3D0FA 3SXHA 3KBXA 2YU9B 1KDAA 3NENA 4RGOS 4LFCL 1KHIA 3RLOA 3J7A5 1HZ9A 4HTHA 4JI3Q 2K4KA 1KNEA 4A3FG 3OW7A 4DR2L 2F4VQ 5M5WH 2K01A 4RFBA 4MTNA 1WTWA 3HOUB 4DV1L 1VQ5A 1GJXA 1TQOA 1CFMA 2HIVA 4A3FB 1EQQA 2BA1A 1I94L 1EY4A 5JJKA 2KCCA 3MVVA 1A3VA 4N8X1 4ZRZA 1SMXA 4NW2A 3HOWG 1E0BA 2HCCA 4NXML 2QA4A 3M7GA 1T5EA 5EQ0A 2I5LX 3T1HQ 4K14A 1WTXA 3H6MA 3QOLA 2OT2A 3A5UA 4YY3L 1CUKA 2I5MX 3A54A 4YCUA 4H44C 1EWIA 2JA8B 1UNSA 4ILWA 5NUCA 1MSHA 2ZTDA 4GN4B 1L1OB 3EQLC 1U4RA 2B2YC 3QIAA 3VYSA 2JA7G 4DV5L 3NQTA 4KN4C 1D6EC 2F0OA 4IUQA 4C56C 3VDYA 5M3MG 4M8AA 3EJIA 5EBDA 1V43A 2OWOA 3A7LA 4A3MH 2F0EA 1YBYA 1XNQQ 1X3FA 2D0PA 3H09A 4BBSG 2UU9Q 1I50B 3ZJYC 1FYCA 4IUVA 4FF2A 2BA0A 5LL6X 4DUZQ 5KNDA 2UUAQ 4X62Q 2DNEA 2DNCA 3V96A 4DR4L 2QGQA 4C3JG 1EY9A 2ZXRA 4AQYL 2Z0SA 4F88A 3F8TA 4JI1Q 1EFWA 1ZYRC 1SYEA 2X6GA 3E5SA 1JR0D 5IODA 2JQOA 1YVCA 3PIOA 1LUZA 3T1YQ 3S2DH 3G48A 1EFID 1EWCA 1YNXA 1HR0Q 4HJ7A 4TVAB 1O7LA 3CCVA 1Q90A 3C1FA 4HCEA 1Y1VB 1PYBA 1P16A 3MC0B 1AZPA 5EBCA 5EKLA 1CQVA 4LFAQ 4FYDA 1HZBA 1PTOC 1PH5A 4ZKBB 1L0YB 1DZ1A 3K57A 5C0XJ 3VA7A 1G8ZD 1NJIC 3J80c 3GTPB 1PH8A 4YWLA 3L7ZC 1TKWB 1I4XA 2XN9C 3OHXC 3FRPB 4K8IA 3M9BA 1PLFA 3GTMH 2E2JH 1IHZA 1QCBD 2JJQA 1IBKL 3DHQA 2B2TC 2F0GA 4TQUS 1CZWA 2EXDA 3H3VI 4XYQA 2QDBA 4Q5VA 4DR7L 3NBHB 1JB3A 3DWPA 2NZ1D 4KV6A 5CV9A 5M5XH 2KEDA 1Y1WG 4LF8L 3SK5A 2AHOB 2VW9A 1PZKD 1FGUA 1BUVT 1PRTC 4A75A 4NDXA 2RF4A 2F0SA 1HCZA 3WDNA 4OX9Q 3EIVA 3DM3A 2E2DC 5I6WA 2DY8A 4B3SQ 4XIGS 4JI7Q 2NZOA 1HFNA 1R4PB 1F2LA 2MP1A 3SVMA 4DR1Q 2NWGA 4NXNQ 3HOYG 3PF5A 2B2VC 5M5WB 5I4DA 3K5NA 1Q3LA 5KYIA 3RUZA 4CJ0B 1VDZA 1BCPC 4DV0L 2QEXA 3I90A 3KF8A 1EOTA 3EFXD 3JC66 2HIXA 2MO0A 5G3LF 1FJGL 4KY6A 1E1OA 4CDFC 2NZHA 1VMCA 1JCKB 5JJLA 1CZGA 3G6JB 5C44H 1JE5A 1D5XC 5LMNL 4LF7L 3OW2A 1Q1EA 3OYYA 3EN2A 3F2CA 1ENAA 4HIOA 2FFKB 4JI2Q 4QCLA 2LY7A 3OWEB 4WORA 1B4OA 1HR0W 5C4ZA 5AJ3Q 2KHIA 2K5VA 4GLXA 1EIFA 4QMGA 1E2WA 2RHQB 3CRKC 5C4HA 3JAML 1PFBA 1SNPA 4DKAC 3D3RA 4QL5A 4LF5L 4BWGB 1RF2D 4GLAC 3S1NH 4A3MB 3PSIA 1N34L 3BDLA 2UUBL 2A6ED 2SDFA 2PO4A 2EYJA 5ELNA 1ET6A 3CAMA 1EUJA 2IHFA 1QVFA 1FL0A 3RLFA 1CQFA 2CVRA 3CCMA 4DV2L 4IPGA 4BY1G 1QG7A 4A3EH 1XMQQ 4LF4L 3CCJA 3HP3A 3OWFA 3I55A 1D8LA 1IYVA 5CYUA 2B8GA 3F2DA 1D5MC 4C3IG 2CKZB 2CW0C 1HPCA 2Q8RE 3CCEA 5IYCG 1YJNA 2ZXPA 4X66L 3S2DB 3IRBA 1ASYA 1C0AA 2AMCB 3T56B 3T53B 4B3RL 1IW7C 1NMGA 2WKCA 1LTGD 3J7AV 4YIJA 1XMOQ 1YJ9A 3RZOH 1JE4A 2PW5A 4OEMB 4ZUJA 1CM9A 2MQHA 1E2VA 2RDGA 3S9WA 2L11A 4B3ML 5M5XB 2D5DA 2KECA 1O7YA 4G7HC 4LFBL 3FPPA 3M7NA 3I3CA 3FKIH 2HD3A 2KENA 4DUYL 1GVPA 1JOOA 3FP9A 2E8GA 5IGEA 2K6AA 4KK7A 2K14A 3HKZG 4HEDA 1O80A 4IFDJ 2F0IA 2UUCQ 3PO2B 4DV7L 1CT1D 4N8FA 2A69D 1H9SB 4A93B 2F0JA 1LYLA 3BYTB 5CV4A 4GNXA 1ILQA 1NAPA 1STHA 4POGA 5ELOA 2OTLA 5C5LA 5C44G 1HQRD 4A3DB 3HOVH 4JOIC 1LT3D 3TN2A 4DAMA 4FF4A 3Q22A 3UE1A 4ZYSA 1HNXQ 1B2TA 2NVQH 5D3IB 4HCSA 1TS2A 5DNFA 5KIXA 1VF5C 2HT1A 1VF7A 1YEZA 3I73A 1JJGA 1EL0A 4AIMA 4NPSA 4YWKA 2YTVA 2X69A 4M1UB 1I3QH 1XPRA 4ZCKA 1CA6A 1GUNA 3BG3A 4UP9A 1AFPA 5G3LD 1XNRL 3KDFA 3B6YA 4X3KA 1TT2A 4ULLA 2E76C 1F77A 3GTJH 4X64Q 3D4WA 2NN6I 5IGFA 2B2YA 3PGZA 3K7UC 5J39A 4A3CH 1IBMQ 1YZ6A 1WYDA 1VQ6A 1V1PA 3S1NB 1BKBA 1Q46A 1LTSD 1SFOH 4DAYA 5BR8L 3PIO3 3QWNA 1MJEA 4K5VA 5IGGA 1LTRD 5GAHC 1WTVA 5DAUA 3WWVA 4GOPB 3C3LA 3OMCA 1X3PA 2V4DA 3MZ5A 1SDFA 3SK4A 5FOBB 4A3EB 3RNUA 2IY5B 3R8BA 5IY0A 1J8IA 1JJ2A 2Y0SB 4PV1C 2Q2UA 4EQPA 3R2TA 1QVGA 2VQFQ 1GD7A 3URYA 3E3XA 3CRLC 3GTGH 2VZAA 1B8AA 1H9JA 1K8AC 1EQRA 1RHPA 1S5CD 2RCNA 3CPFA 2K75A 1ESRA 1YNNC 2FMMA 4RKBA 4DV4Q 1IZ6A 2OXPA 1KABA 2DUDA 2KHSA 3TS2A 1G6PA 2HDLA 5IE8A 2BDNA 1PYSB 2ENBA 2AUKA 4K0KL 3D4RA 2HQLA 3TDQA 2K05A 3NQIA 3RZOB 2FMCA 3E0EA 3U9SA 5M9OA 3PIP3 2JEBI 5IT9L 4LJZC 4KY5A 3D6CA 4C3HH 4LUZA 4DR6Q 2XGTA 1STYA 1CHQD 2NVTB 3FKIG 1MBYA 1DOLA 2RBMA 3CPWA 2RKSA 4DAVA 2J7ZA 1SE3A 1SE4A 3NTIA 2NBFA 2F0WA 3HOWH 2IHEA 4MN3A 1GUWA 5EJWA 2H1EA 3FKIB 4EX5A 3CD6A 5FLMG 2EYMA 3ND8A 1PZID 3KDFB 4LFCQ 1WOCA 2KQ3A 2R92H 4A3BH 3VR6A 5CV7A 2JE6I 1WD0A 1GHKA 4DR2Q 1NTGA 3BYYB 1YITA 2QF7A 4A76A 5EPLA 4LF6L 4A4IA 1QE6A 4JBWA 1V1PB 4DV1Q 3ULJA 1W2BA 2B29A 2B2WC 4WFN3 4DV6L 5CV6A 1I94Q 1HUNA 1HA5A 2IWHA 3HOVG 2B2VA 2JA7H 3NEMA 4JG2A 4IUTA 3HKSA 5FLXL 2NVXH 5M3MH 1WCMG 1U0LA 2AQ1B 2E2HH 1VCIA 4IZ8A 5C0XH 1NMFA 2O5JC 3U50C 3HOVB 2EY2A 1N36L 4R4CA 2BE5C 4RMFA 1VQPA 4K5XA 1DOMA 1CKOA 1Q7YC 1Q8IA 3AEVA 3PCOB 3A0JA 1PTOD 1CSPA 2PZUA 4C3JH 2VXWA 5C3EH 1TY0A 5M5YH 2B2UA 4I7AA 3AYHB 4A3IG 1OXVA 2DJGC 1JWMD 1ILPA 4XDXA 1FNVA 3A8JE 1EYCA 5DM73 3J7ZC 4A3GG 5E3FA 3FEWX 3GTJB 3KLSA 4GN3B 1N9WA 1PTOB 1EEID 1UWVA 2AQ3B 1SEBD 2L9HA 2B63H 2TMPA 2A6HC 1PYWD 2JYOA 2WP8J 5TSSA 1HQMC 2KCTA 2F3WA 4QIWE 1WI5A 4QB4A 3UDIA 4Y52H 1LTAD 4TRDA 2F0QA 4GOPC 4LF9L 1NR2A 1LT5D 1Y69U 4HJ5A 4AQYQ 1PH1A 4DN4M 1W6JA 3D6WA 4UDUC 3L0OA 3VA5A 1S72A 2HHHL 1JICA 2E2IH 1PFMA 3S16H 3W1GA 4QGUA 1GKHA 4H02A 4IURA 2L0CA 4KTAA 2PQAB 3IAYA 3J80L 1PRTB 3UDXA 2ZXOA 5CC4A 1KAAA 2WAQG 1Y1WH 2UXCL 1QWYA 1B70B 3WOEA 3CCQA 1GM5A 1L2FA 1JWUD 1TVXA 1YHAA 2R3ZA 5EKKA 3VR3A 3KBGA 5ELBA 1BCPD 3STBC 4RH6A 2N55A 2ZT9C 1VQKA 2KOLA 3AB9A 3HG9A 1KXLA 4C3HG 4DK6C 1XTDA 1IBKQ 4P75A 4X6AH 5FJ8G 3H94A 1BCPB 4DR7Q 1STGA 3HOYH 1NBWA 4KLKA 3RR5A 3P20A 2K5HA 1GUTA 4YWMA 3MXNA 1TWGH 1S5DD 1B53A 4LF8Q 1LACA 1Y8PB 4XQNA 1BF4A 1ML0D 1ENFA 3PV0A 3Q8DA 3NBHA 4KKSA 3VR5A 1K83B 1LTLA 4RHSA 5A2QL 4JPBW 2R92G 4A3BG 1DOKA 1EY5A 1WTRA 2NTTA 2NUCA 5FLXc 1UE6A 3HOWB 3HOXH 1PH2A 2XNAC 1BXTA 1JOKA 4V190 1O7IA 4ME5A 3I2ZA 3M3YH 1R4QB 3FVQA 1LM0A 4X65Q 1LO5D 3ULLA 3NE5B 5LMUL 3I56A 2XVSA 1IKLA 2FJ2A 2E75C 2MO1A 1G6ZA 1LTBD 1MJCA 5C0XG 3GV6A 3ULPA 4DV0Q 4KKUA 2PZTA 1HXYD 1XX8A 2JA7B 3FMCA 1CKNA 3T13A 2NVXB 2CW0D 5M3MB 3Q0AA 4ZKCB 5CR3A 4K2LA 4ABNA 1X32A 4AH6A 1U5KA 5BN5A 2A8VA 5M3FH 2L1BA 3PUXA 4BBSB 5LMNQ 4LF7Q 5C3EG 4JOIA 4QQBX 4JBJA 1SJHD 3K80C 1QJOA 3NBIA 4BY1H 2H5XA 1VQFA 4JBKA 4C3JB 4DV3L 3DM1A 5M5YB 3J81c 5I9OA 1CA5A 4GKJL 1TR5A 4JI8L 4C3IH 2R6GA 4LF5Q 2B63G 1ICFB 4KKTA 3S1MB 1DJRD 2A19A 2ATWA 1BQQT 2N88A 1G2SA 5IYCH 1K28A 2GVAA 4KHZA 5JPNC 3KYHC 2QKIC 3SK6A 2UUBQ 1XJVA 4I65A 5E1FA 4K2KA 5IP9G 1E3PA 5C6AA 3EROA 1V1OA 1G91A 1K0RA 4HMIA 4B3TL 2DY7A 2F52A 1QVCA 5I2YA 1MSGA 3GTKH 3NTKA 4K6LA 4IFDH 3MXNB 1WFQA 1EYDA 3DEOA 4BBRG 4HMJA 4LF4Q 4CHTB 3HOZH 5CORA 1BO0A 4ODGA 1KRSA 4HJ9A 4ZQ3A 4DA2A 1NSNS 2F0HA 3OTOL 4P71A 1GHJA 2VNUD 2E2IB 5JEAJ 3S16B 2VB2X 1D1KA 2MUYA 1XXGA 3SEBA 4DR3L 1B7YB 1K8MA 4X66Q 1G291 1TY2A 4OWTB 2NN6G 2K04A 2PMZE 1VQ7A 2Z4IA 2YYZA 4KHPQ 1K73C 1EU4A 1EYAA 2B8FA 2JSOA 5HGTA 1Y1WB 1A62A 3KJPA 1UE1A 2ZTCA 4P74A 1K8GA 2AQ2B 4B3RQ 1P8LA 3G7LA 1KAWA 3X3MA 3PIPA 2ZM6L 4OL7A 1XYIA 2F0DA 1BR9A 4HSPA 2OQKA 3JAMi 4OO1G 1PH9A 3I4NG 3GD7A 2PW7A 2FINB 2LKVA 2CQOA 4JW0A 4GZYC 1GUOA 2KCMA 1JJCB 5IGDA 2AWOA 3BVGA 1CKNB 4A3KG 2IW3A 3IL8A 3T1HL 3LNNA 4X3TA 1FR3A 2PMZB 1DCZA 3HOYB 3A56A 1K3BC 3I72A 4E6IA 2IL8A 1HNWL 1TWGB 3VYTA 3JAME 5LMNW 1N32L 2DJFC 1RIPA 4LFBQ 1II3A 1F9QA 3HOXG 3J7YW 3HS0C 3PF4A 5D65A 4ZK9B 3R3OA 2JN4A 4J6HA 4DUYQ 4DK0A 4JV5L 4JI0L 3GTQH 4LK1C 2NTSA 4R4TA 2B3GA 1LTTD 1FNWA 3W5OA 1J9OA 2VQEL 1EZ8A 1X3QA 3TRZA 3M3YB 1AE2A 4DV7Q 4GS3A 1A3TA 1MIUA 5C4XG 4DUZL 2KVMA 2A68D 3TS0A 2YTXA 2EJGC 4B9WA 5KRUA 2VUMG 2RDFA 3M4OH 3MA2B 4TSSA 3CCUA 1QZGA 2A74C 1B44D 3PO3G 1OXXK 5M3FG 4BY7H 2B2WA 1H9SA 2MHVA 3CKIB 2OQ0A 1Q81C 2TSSA 5I2XA 2AUJD 3W1BA 2XRQD 3E9IA 3MEFA 1AZQA 4RGNA 1I4QA 3GTLH 4KJNA 4EQOA 4R4OA 4P73A 4BY1B 2CWPA 5KYLA 1XNRQ 1SMYC 3EBEA 2Z9HA 5BN3A 3S14H 2R7ZH 4C3IB 5T1GA 1STEA 2JA6G 1BOSA 2BCOA 4IFDG 1A63A 3K0XA 3DMUA 4LUOA 2PCFB 4H13C 2F0NA 3HOZG 1EY7A 2KBNA 3F2BA 4KD3A 3MWYW 2O2LD 2XWJB 4FP5D 1HTLD 3GTKB 3BDOA 1KDBA 3OIPA 3GDEA 3GTMB 2E2JB 1WJJA 4FNFA 4QUCA 3CQZH 5ELDA 3T4AC 2IX0A 3TSSA 1RJTA 4GOPA 1OTCA 1D5ZC 3TP7A 2RCFA 2AWNA 3C46A 2KA7A 3NPPA 2IPKD 2EYOA 4PQXA 5EGTA 3VYUA 1JORA 1NE3A 2C35B 5IOCA 3R2IA 2N3SA 2CWAA 2ZTEA 1DYQA 2UXBL 4RGTA 4K0KQ 2QCPX 1E2ZA 2PI2A 4DF7A 5FLMH 4XT3B 4FF1A 2F0VA 2ZJPA 3U4ZA 3SDZA 5CV8A 4L5QA 2E5LQ 3S1RH 4Y7NH 2JA5H 4PMCA 4CJ1B 1YHQA 3HKZB 1QILA 3QR8A 1PTOF 3K5LA 5ELCA 4EQ5A 3G6EA 1J6QA 4HR7B 1V9PA 3H3VH 3OMGA 4XYOA 4ID6A 3A8IE 2R7DA 1FGBD 4O0AA 2QDLA 4UP8A 4CKBA 3BU2A 1WCMH 4IUUA 3KLWA 1D1IA 5C44B 3DXJC 1EQVA 1SE8A 1X3GA 1FVIA 3KK7A 1FNUA 3GTQB 1C7YA 1CI3M 4KI0A 2A6HD 4LMQD 1YNJD 4PZ6A 4LF6Q 2ICIA 1PRTF 1B1ZA 3QB3A 2LMCB 1ONLA 3TQYA 1X55A 4JK1C 1GO3E 3NHHA 4DV6Q 4BY7G 3TZUA 4KN7C 4MHEA 2Y0SE 4DK3C 1PH3A 5KNBA 4A3IH 1E22A 4IALA 4L63B 2I5HA 2F3IA 1TS5A 2EPBA 2F0TA 3M4OB 4A3GH 4CDCC 1AW7A 1K9MC 3BDCA 4BY7B 3TEHB 2LS01 4MIUA 1VQGA 2PI2E 2M2LA 2F3VA 4DNRB 1N36Q 1G2TA 3ND9A 1SBBB 1EIYB 2EZVA 1MGSA 1BCPF 4A3JH 1V8QA 2PYKA 3ONAB 1B3QA 2IX1A 3S2HH 3PUZA 2K32A 4IUPA 1SNMA 3GTLB 3AU7A 1PFSA 2HUGA 1KDCA 1IBLQ 1VQDA 5D3DA 5GAEC 3W2DA 2R7ZG 1K0SA 1Q12A 4DGZA 3LWEA 4DAPA 1LABA 1XMOL 1J5EQ 3V2TA 2VY3A 5IT9E 4L6TB 2LXKA 1EWHA 4XQQA 4HIDA 3H0GH 1SN8A 1ZEQX 3I8ZA 3CW2C 3QJYA 5JOBA 3KFUA 3CU7A 3L3OC 4B9XA 1Y8NB 3SR1A 3VR2A 2EY1A 2GA4B 4I7ZC 4ME3A 2SOBA 4LF9Q 2BDOA 4PZ7A 3I4LA 1B3AA 2PNHA 4ZLTF 3A7AB 1A0IA 4OIKA 4JI4L 3S24A 4AYBG 2DGYA 1TS4A 2Z8LA 1QB5D 4JYAL 3CQZB 3VR4A 2B2TA 5FJ8H 4F7XA 1AE3A 3Q6SA 5EAYA 5T1IA 4DPGA 1VS0A 1HTPA 1VQBA 2D62A 2UXCQ 4DNIA 3M4YA 3HFZB 1JB7A 1HHVA 4HJ8A 4IOCA 2I46A 5FLXE 5DM63 1OXUA 3MXPA 1VQIA 2PQAA 2Z6KC 1HZCA 1ICWA 1ENCA 4N9TA 3DWAA 4U673 4DXGA 5CMDA 3H91A 3IFTA 1R9TH 3W3AA 1QUQA 2LSSA 4JVZA 1SAPA 3MHBA 2JA5G 3GO5A 1A6XA 1GOZA 2NB0A 3K81C 5HURA 3Q23A 3HRZC 4FVMA 4TKOB 4GKKL 1TXYA 3I4MG 5CBAE 4XQJA 3P7JA 3S1RB 1HRJA 4Y7NB 4G4KA 4KD4A 2RDHA 1ZYRD 2SNSA 1KQSA 1Q1BA 3KUPA 1VQ9A 3IFDA 3J81i 1RODA 4NXMQ 2EXZA 1IKMA 1CTMA 3NWTA 1NR4A 4BXXG 2XWBB 4K6DA 4UP7A 4F87A 3GV3A 4R8IA 4X64L 1HA6A 5I6YA 4YY3Q 1WCMB 1PH7A 4MNOA 2NVQB 2EYHA 2CQAA 3J80i 2ZJRA 5ISRA 2WV6D 5DEHA 2WKDA 1A3UA 1M8AA 2EOTA 1SROA 1PHJA 5A35A 1VQCA 3DEPA 5LMUQ 1X9NA 1I3QB 4DV5Q 1HNZL 2R93G 4CGYB 3R93A 1O78A 2A69C 1TWHH 1X56A 2K1BA 3TMEA 2EY5A 4H7BA 3K6OA 1YHBA 1IL2A 4A3IB 2L5TA 1CK1A 3F2UA 1N8RC 3J80E 4MZ9A 3C2PA 1JQYD 1Z7TA 2WB1G 2Q2TA 1SFOB 1C8CA 4A3GB 1I6VC 4A3JG 2WACA 3G71A 1PRTD 2EJFC 4DR4Q 5DLQE 4QJFA 3QO2A 5IP9H 2I07B 4K8JA 3J81L 2QEJC 1SRUA 2CH4A 1OO9B 1SNDA 4V0BA 2MNAA 4BBRH 3A74A 2M00A 4JBMA 2P5ZX 1EY6A 3A5ZB 1X65A 1TU2B 3WOFA 4J8QA 4DV3Q 3H0GG 3O13A 3IKJA 3KF6B 1KTKA 1RD9D 2N49A 3MAQA 3PUYA 1SNOA 2D0OA 4JI8Q 3GTGB 2Q8TA 1QUQB 3K8AA 2IX3A 4IOAA 1S5FD 4F8MA 5IYDH 2UXDL 5FKAC 2NN6H 4IPHA 3E6ZX 1HZAA 1LTID 2WAQB 4LW1A 4DR6L 1L0WA 4B3TQ 4KJOA 5A2QE 5IGCA 2Q2HA 1H9MA 4OO1H 1EU3A 3I4NH 1JOQA 3P1HA 3PUVA 4A3LH 3TREA 3OTOQ 3J7AF 3CP0A 3HOUG 1PMRA 1JMCA 5IWAL 4A3KH 4C3HB 1B9NA 2N8NA 4DR3Q 3NK9A 4Q0FA 1O7ZA 1S5ED 4GNXC 4JI6L 2RA4A 3M4PA 1U4PA 2B39A 2ZJQA 1LT4D 4WJ4A 4XTCS 3BS1A 2ZM6Q 4YHHL 4BS9A 3TP8A 1MD2D 2Z4HA 2K52A 1YJWA 2F03A 2QW7A 5EKIA 2HDMA 2VS1A 1EQTA 2AKWB 2MPMA 1R9TB 4A3BB 2R92B 4QY7A 3EVQA 2JEAI 5J22A 1E1TA 1C4QA 2JA8G 1PFNA 2ALYB 4WJWA 2ES2A 4UY8C 2RVLA 4DR5L 3FPUB 3ITPA 4DU9A 1TS3A 1N33L 4NP5A 3TP6A 2A5HA 2F0LA 2VB3X 1LV9A 2CH4W 5C4XH 4QUFA 1HNWQ 1Y14B 1GXDC 5GQOA 2PNRC 3U4VA 2BH8A 1FJGQ 1N32Q 1TIID 3KLRA 1DD2A 2KJXA 3H3VC 1IYUA 3RD4A 2VUMH 1F9SA 2K5QA 2E2HB 1BBXC 1SYCA 1SMYD 1VQOA 3PO3H 1KNAA 1RTNA 5C4JH 4RAUC 4JV5Q 4JI0Q 2EVBA 3ERQA 3HGBA 2KUMA 1SSOA 5KGUA 4RCNA 1STBA 3K58A 5JEAG 1IW7D 2VQEQ
chains in the Genus database with same CATH topology
1WD1A 1XWEA 4OIJA 2A73B 2D2CC 1EEFD 5C3EB 4KMUC 1M4VA 3T51B 3KLSX 3OPOA 3BZDB 1TWHB 5EPJA 2H4OA 1UAPA 2B63B 2D9UA 1I4RA 5FO7B 1JC7A 1EZ6A 3HEJA 4P2CB 3DWQA 5JJZA 3DUZA 5FO8B 3PMFA 4BBRB 1WVLA 1UUPA 3TP5A 3I70A 4C1NK 3N52A 1VMPA 4NKLA 1HFGA 4FXGC 5C5MA 4OHJA 2EY6A 3MEHA 3X3NA 4WRDA 2IJ0A 3OSOA 5FO9B 2Q8IB 1OXTA 5K36H 4ZUIA 4RWSC 2MJ8A 4IQZA 2SNMA 3I4NB 3QG1A 5F2DA 5EPKA 1SE2A 2EE1A 1DONA 4A3KB 4X3UA 5C3XA 5BN4A 1WTPA 4G7OC 4H0LC 1U4LA 5I9PA 2K7VA 3NXWA 3HOXB 2NYZD 4G57A 3AMUA 3K59A 3MFYA 4S3SA 1GUSA 3NTHA 2B2UC 4OGQC 1KLUD 5C4XB 3PUWA 2EDGA 2JP1A 1WTQA 1NCVA 2VUMB 3EA6A 1YNND 3PO3B 5M3FB 5CV5A 5C4JB 2F0KA 2E74C 4FO2A 5KEEA 4RA8A 2K33A 1H9KA 2L12A 1JWSD 1Z6HA 5AFWA 2EYPA 2K5DA 4DK1A 3P75A 4O42A 1Y8OB 4RCOA 1I4GA 3L9AX 1PDQA 2WINB 4EQNA 2L55A 2JXMB 2XRSD 4XXEA 3SE0A 2G9DA 3I91A 5JVG3 2BOSA 2OEOA 3OIQA 3RMHA 2JA6B 3CHBD 2SEBD 1XTCD 1B50A 4X3SA 1SXTA 3MXUA 3HOZB 1STNA 1IL8A 1WTOA 3K0YA 4HN7A 2MGSA 1U9RA 4RKLA 1LLRD 1I4HA 2X6LA 1NUCA 2KCNA 2F1MA 1EY0A 1SYFA 1BDOA 2M9VA 5K36G 2QILA 5C0XI 2F0UA 5K5PA 5ELEA 3E0JA 1GUGA 3VYRA 2IT1A 2BE5D 1RDPD 2F0MA 3RZDB 1Z47A 2WIIB 2RSNA 2PPBC 4EVOA 1SNCA 1S4ZA 1I4PA 3N6RA 1DM0B 4CJ2C 1A2TA 3NWSA 4K5WA 5J1ZA 2Z1CA 5IGBA 1RTOA 1BNZA 4PMBA 4IN3A 4PNYA 2DN8A 3OOCA 5E4XA 1AP0A 4HAEA 2ICEC 1QNUA 3UI2A 3BVZA 3C1EA 2EYLA 1F2MA 4CKEA 4PMWA 4C1NI 1ZXTA 4C2MB 4FXDA 1SYDA 2FHTA 1A2UA 1F9PA 4IUNA 1HUMA 2F4IA 2HCIA 1UEAB 1PTOH 2K5WA 3NP8A 1QOHA 1A15A 4LAAA 1T5XD 3S1QB 5D14A 2RSOA 2O4XA 3M85A 4OO1I 1EIHA 3SHLA 1STAA 1AEXA 2A68C 3S14B 2R7ZB 3QOJA 1SNQA 2XSCA 5FK9C 1TWAB 2A6EC 1B9MA 1SYGA 2HQEA 1C48A 2J4XA 4R8NA 1EIGA 3NSWA 2R61A 3LWUA 4FXKC 4O1NA 3U9OA 1W6KA 3A8KE 5JAVA 2NVYB 2LFNA 4J1MA 4AYBB 2PQEA 2C9OA 3TZDA 4BA1I 3NUCA 3MFGA 4DXFA 1ZKOA 4DNTB 3BVMA 1ET9A 4KY7A 1SJED 3GQBA 4DFAA 3TBIB 5IIFA 2F0FA 2RQXA 3K5OA 1FD7D 4Z9CB 1TWFB 3D31A 3GTOB 1PXUA 2JA5B 4UAIA 5JVH3 1I6HB 1OXSC 2K03A 3D8GA 1QNKA 4QF4A 3I4MB 4U68A 3K5MA 3T16A 1F2YA 1PZJD 2J0TD 1AN8A 5ELFA 4CBVA 2CHBD 3FDTA 1DXMA 3ZYYX 4KHVA 1TWCB 3S15B 1CHPD 3A55A 3LX0A 2OF1A 5COYA 2ID0A 2PZWA 4IFDI 3HZXA 3J81E 5JEAH 1K8OA 4FF3A 3GP7A 5KNCA 1KLGD 2C5CA 2K28A 1EY8A 3SK8A 4BA2I 3S17B 1F9RA 2EJMA 2KEEA 1L0XB 3MTSA 1F2ZA 2R93B 4ZAIA 2F0PA 1SYBA 1H9RA 4L8JA 3K7AB 5CGKA 5E4WC 5JPMC 4RHRA 2XIWA 2WB1B 5C3WA 4A3JB 3S2HB 1D2BA 1S5BD 4N9PA 4CKCA 2EYFA 2O5IC 1YNJC 2L4NA 4B08A 5CBEE 4EGVA 1RCVD 4HSVA 2G9HD 3H0GB 1MI2A 5LL6S 1RKNA 1ESFA 4G7ZC 4R9WA 3MXGA 4NMZA 3V05A 1U4MA 3Q24A 4XT1B 3D4DA 4QIWB 5LHY1 4RGMA 1LT6D 3SXHA 3KBXA 2YU9B 1KDAA 4RGOS 4HTHA 1KNEA 3OW7A 2K01A 4RFBA 1WTWA 3HOUB 1GJXA 1TQOA 1CFMA 4A3FB 2BA1A 1EY4A 2KCCA 3MVVA 1A3VA 4ZRZA 4NW2A 1E0BA 2HCCA 3M7GA 1T5EA 5EQ0A 4K14A 1WTXA 3H6MA 3QOLA 2OT2A 3A54A 4H44C 2JA8B 1UNSA 4ILWA 5NUCA 1MSHA 3EQLC 1U4RA 2B2YC 3QIAA 3VYSA 3NQTA 4KN4C 1D6EC 2F0OA 4IUQA 4C56C 4M8AA 3EJIA 5EBDA 1V43A 3A7LA 2F0EA 3H09A 1I50B 1FYCA 4IUVA 4FF2A 2BA0A 5LL6X 5KNDA 2DNEA 2DNCA 3V96A 4C3JG 1EY9A 2ZXRA 4F88A 1ZYRC 1SYEA 2X6GA 3E5SA 1JR0D 5IODA 1EFID 1EWCA 1O7LA 1Q90A 3C1FA 4HCEA 1Y1VB 1AZPA 3MC0B 5EBCA 5EKLA 1CQVA 4FYDA 1PTOC 4ZKBB 1L0YB 1DZ1A 3K57A 5C0XJ 3VA7A 1G8ZD 3GTPB 3L7ZC 1TKWB 1I4XA 2XN9C 3OHXC 3FRPB 4K8IA 1PLFA 1IHZA 1QCBD 3DHQA 2B2TC 2F0GA 4TQUS 1CZWA 4XYQA 2QDBA 4Q5VA 1JB3A 3DWPA 2NZ1D 4KV6A 5CV9A 2KEDA 3SK5A 1PZKD 1BUVT 1PRTC 4NDXA 2F0SA 1HCZA 3WDNA 5I6WA 2E2DC 2DY8A 4XIGS 1HFNA 1R4PB 1F2LA 2MP1A 3SVMA 2NWGA 2B2VC 5M5WB 5I4DA 3K5NA 1Q3LA 5KYIA 3RUZA 4CJ0B 1VDZA 1BCPC 3I90A 3KF8A 1EOTA 3EFXD 5G3LF 4KY6A 1VMCA 1JCKB 1CZGA 3G6JB 1D5XC 1Q1EA 1ENAA 2FFKB 4QCLA 2LY7A 3OWEB 4WORA 1B4OA 5C4ZA 4QMGA 1E2WA 3CRKC 5C4HA 3JAML 1PFBA 1SNPA 3D3RA 4BWGB 1RF2D 4A3MB 3BDLA 2A6ED 2SDFA 2PO4A 2EYJA 1ET6A 3RLFA 1CQFA 2CVRA 1QG7A 3HP3A 3OWFA 1IYVA 5CYUA 2B8GA 1D5MC 4C3IG 2CW0C 1HPCA 2Q8RE 2ZXPA 3S2DB 3T56B 3T53B 1IW7C 2WKCA 1LTGD 3J7AV 4YIJA 1JE4A 2PW5A 4ZUJA 1CM9A 1E2VA 2RDGA 3S9WA 2L11A 5M5XB 2D5DA 2KECA 1O7YA 4G7HC 3FPPA 3M7NA 3I3CA 1JOOA 5IGEA 2K6AA 4KK7A 4HEDA 1O80A 4IFDJ 2F0IA 3PO2B 1CT1D 2A69D 1H9SB 4A93B 2F0JA 3BYTB 5CV4A 1ILQA 1NAPA 1STHA 5C5LA 1HQRD 4A3DB 1LT3D 3TN2A 4FF4A 3Q22A 4ZYSA 1B2TA 5D3IB 4HCSA 1TS2A 5DNFA 5KIXA 1VF5C 1VF7A 3I73A 1EL0A 2X69A 4M1UB 1CA6A 1GUNA 3BG3A 1AFPA 5G3LD 4X3KA 1TT2A 4ULLA 2E76C 1F77A 3D4WA 2NN6I 5IGFA 2B2YA 5J39A 1V1PA 3S1NB 1LTSD 4DAYA 3PIO3 3QWNA 4K5VA 5IGGA 1LTRD 1WTVA 5DAUA 3C3LA 3OMCA 1X3PA 2V4DA 3MZ5A 1SDFA 3SK4A 5FOBB 4A3EB 3R8BA 1J8IA 2Y0SB 4PV1C 4EQPA 3R2TA 3URYA 3CRLC 1H9JA 1RHPA 1S5CD 1ESRA 1YNNC 2FMMA 4RKBA 2OXPA 1KABA 2KHSA 2HDLA 2BDNA 2ENBA 2AUKA 3D4RA 3TDQA 2K05A 3NQIA 3RZOB 2FMCA 3U9SA 5M9OA 3PIP3 2JEBI 5IT9L 4LJZC 4KY5A 3D6CA 1STYA 1CHQD 2NVTB 1MBYA 1DOLA 2RBMA 2RKSA 4DAVA 2J7ZA 1SE3A 1SE4A 3NTIA 2NBFA 2F0WA 4MN3A 1GUWA 5EJWA 2H1EA 3FKIB 2EYMA 3ND8A 1PZID 2KQ3A 3VR6A 5CV7A 2JE6I 1WD0A 1GHKA 3BYYB 2QF7A 5EPLA 1QE6A 4JBWA 1V1PB 2B2WC 4WFN3 5CV6A 1HUNA 1HA5A 2IWHA 2B2VA 4IUTA 5FLXL 2AQ1B 1VCIA 4IZ8A 5C0XH 2O5JC 3HOVB 2EY2A 2BE5C 4K5XA 1DOMA 1Q8IA 1PTOD 2PZUA 2VXWA 1TY0A 2B2UA 1OXVA 1JWMD 1ILPA 4XDXA 1FNVA 3A8JE 1EYCA 5DM73 5E3FA 3FEWX 3GTJB 3KLSA 1PTOB 1EEID 2AQ3B 1SEBD 2L9HA 2TMPA 2A6HC 1PYWD 2JYOA 2WP8J 5TSSA 1HQMC 2F3WA 4QB4A 1LTAD 4TRDA 2F0QA 1NR2A 1LT5D 1Y69U 4DN4M 1W6JA 3D6WA 4UDUC 3VA5A 1JICA 1PFMA 4IURA 2L0CA 4KTAA 3IAYA 3J80L 1PRTB 2ZXOA 5CC4A 1KAAA 1QWYA 3WOEA 1JWUD 1TVXA 2R3ZA 5EKKA 3VR3A 3KBGA 5ELBA 1BCPD 4RH6A 2N55A 2ZT9C 2KOLA 3AB9A 3HG9A 4C3HG 3H94A 1BCPB 1STGA 3P20A 1GUTA 3MXNA 1S5DD 1B53A 1LACA 1Y8PB 4XQNA 1BF4A 1ML0D 1ENFA 3PV0A 3NBHA 4KKSA 3VR5A 1K83B 4RHSA 5A2QL 1DOKA 1EY5A 1WTRA 2NTTA 2NUCA 3HOWB 2XNAC 1BXTA 1JOKA 4V190 4ME5A 1R4QB 3FVQA 1LO5D 3NE5B 2XVSA 1IKLA 2FJ2A 2E75C 1G6ZA 1LTBD 5C0XG 3GV6A 4KKUA 2PZTA 1HXYD 1XX8A 2JA7B 3FMCA 3T13A 2NVXB 2CW0D 5M3MB 3Q0AA 4ZKCB 5CR3A 4K2LA 4ABNA 1X32A 5BN5A 2L1BA 3PUXA 4BBSB 1SJHD 1QJOA 3NBIA 4C3JB 3DM1A 5M5YB 5I9OA 1CA5A 1TR5A 2R6GA 4KKTA 3S1MB 1DJRD 1BQQT 2N88A 1G2SA 4KHZA 5JPNC 2QKIC 3SK6A 4I65A 5E1FA 4K2KA 5C6AA 3EROA 1V1OA 1G91A 4HMIA 2DY7A 5I2YA 1MSGA 3NTKA 4K6LA 4IFDH 1EYDA 3DEOA 4HMJA 4CHTB 5CORA 1BO0A 4ODGA 4ZQ3A 4DA2A 1NSNS 2F0HA 1GHJA 2VNUD 2E2IB 5JEAJ 3S16B 2VB2X 1D1KA 2MUYA 1XXGA 3SEBA 1K8MA 1G291 1TY2A 2NN6G 2K04A 2Z4IA 2YYZA 1EU4A 1EYAA 2B8FA 2JSOA 5HGTA 1Y1WB 2AQ2B 3G7LA 3X3MA 4OL7A 1XYIA 2F0DA 1BR9A 4HSPA 4OO1G 3GD7A 2PW7A 2FINB 2LKVA 4GZYC 1GUOA 5IGDA 2AWOA 3BVGA 2IW3A 3IL8A 3LNNA 4X3TA 1FR3A 2PMZB 1DCZA 3HOYB 3A56A 3I72A 4E6IA 2IL8A 1TWGB 3VYTA 3JAME 1II3A 1F9QA 3J7YW 3HS0C 5D65A 4ZK9B 3R3OA 4J6HA 4DK0A 4LK1C 2NTSA 1LTTD 1FNWA 1J9OA 1EZ8A 1X3QA 3M3YB 1A3TA 2KVMA 2A68D 2EJGC 4B9WA 5KRUA 2RDFA 3MA2B 4TSSA 2A74C 1B44D 1OXXK 2B2WA 1H9SA 2MHVA 3CKIB 2TSSA 5I2XA 2AUJD 2XRQD 1AZQA 4RGNA 1I4QA 4KJNA 4EQOA 4BY1B 5KYLA 1SMYC 5BN3A 4C3IB 5T1GA 1STEA 1BOSA 2BCOA 4IFDG 3DMUA 2PCFB 4H13C 2F0NA 1EY7A 4KD3A 3MWYW 2O2LD 2XWJB 4FP5D 1HTLD 3GTKB 3BDOA 1KDBA 3OIPA 3GTMB 2E2JB 4FNFA 4QUCA 5ELDA 3T4AC 2IX0A 3TSSA 1RJTA 1D5ZC 3TP7A 2AWNA 3C46A 2KA7A 3NPPA 2IPKD 2EYOA 4PQXA 5EGTA 3VYUA 1JORA 5IOCA 3R2IA 1DYQA 4RGTA 2QCPX 1E2ZA 4DF7A 4XT3B 4FF1A 2F0VA 3SDZA 5CV8A 4PMCA 4CJ1B 3HKZB 1QILA 1PTOF 3K5LA 5ELCA 4HR7B 3OMGA 4XYOA 4ID6A 3A8IE 1FGBD 4CKBA 4IUUA 1D1IA 5C44B 3DXJC 1EQVA 3KK7A 1FNUA 3GTQB 1CI3M 4KI0A 2A6HD 4LMQD 1YNJD 2ICIA 1PRTF 1B1ZA 3QB3A 2LMCB 1ONLA 4JK1C 3NHHA 3TZUA 4KN7C 4MHEA 5KNBA 4IALA 4L63B 1TS5A 2EPBA 2F0TA 3M4OB 1AW7A 4BY7B 3BDCA 2LS01 4MIUA 2M2LA 2F3VA 4DNRB 1G2TA 3ND9A 1SBBB 2EZVA 1MGSA 1BCPF 1V8QA 2PYKA 3ONAB 2IX1A 3PUZA 2K32A 4IUPA 1SNMA 3GTLB 3AU7A 2HUGA 1KDCA 5D3DA 3W2DA 1Q12A 4DGZA 3LWEA 4DAPA 1LABA 3V2TA 5IT9E 4L6TB 1EWHA 4XQQA 1ZEQX 3I8ZA 3QJYA 5JOBA 3CU7A 3L3OC 4B9XA 1Y8NB 3SR1A 3VR2A 2EY1A 2GA4B 4I7ZC 2SOBA 2BDOA 3I4LA 1B3AA 4ZLTF 3A7AB 4OIKA 1TS4A 2Z8LA 1QB5D 3CQZB 3VR4A 2B2TA 4F7XA 3Q6SA 5T1IA 1HTPA 2D62A 3M4YA 1HHVA 2I46A 5FLXE 5DM63 1OXUA 3MXPA 1ICWA 1ENCA 4N9TA 3DWAA 4U673 4DXGA 5CMDA 3H91A 3IFTA 3W3AA 1SAPA 3MHBA 3GO5A 1A6XA 1GOZA 2NB0A 5HURA 3Q23A 3HRZC 4FVMA 4TKOB 5CBAE 4XQJA 3P7JA 3S1RB 1HRJA 4Y7NB 4G4KA 4KD4A 2RDHA 1ZYRD 2SNSA 1Q1BA 3KUPA 3IFDA 1RODA 2EXZA 1IKMA 1CTMA 3NWTA 1NR4A 2XWBB 4K6DA 4F87A 3GV3A 4R8IA 1HA6A 5I6YA 1WCMB 2NVQB 2EYHA 2CQAA 5ISRA 2WV6D 5DEHA 2WKDA 1A3UA 1M8AA 2EOTA 5A35A 3DEPA 1I3QB 4CGYB 3R93A 1O78A 2A69C 2K1BA 3TMEA 2EY5A 4H7BA 3K6OA 4A3IB 2L5TA 1CK1A 3F2UA 3J80E 3C2PA 1JQYD 1Z7TA 1SFOB 1C8CA 4A3GB 1I6VC 2WACA 1PRTD 2EJFC 3QO2A 2I07B 4K8JA 3J81L 2QEJC 1OO9B 1SNDA 4V0BA 2M00A 1EY6A 1TU2B 3WOFA 4J8QA 3O13A 3IKJA 1KTKA 1RD9D 3MAQA 3PUYA 1SNOA 3GTGB 2Q8TA 2IX3A 1S5FD 4F8MA 5FKAC 2NN6H 3E6ZX 1LTID 2WAQB 4KJOA 5A2QE 5IGCA 1H9MA 4OO1H 1EU3A 1JOQA 3P1HA 3PUVA 3J7AF 1PMRA 4C3HB 1B9NA 3NK9A 4Q0FA 1O7ZA 1S5ED 2RA4A 1U4PA 2B39A 1LT4D 4XTCS 3BS1A 4BS9A 3TP8A 1MD2D 2Z4HA 2F03A 5EKIA 2HDMA 1EQTA 2MPMA 1R9TB 4A3BB 2R92B 3EVQA 2JEAI 5J22A 1C4QA 1PFNA 4WJWA 2RVLA 3FPUB 3ITPA 4DU9A 1TS3A 4NP5A 3TP6A 2A5HA 2F0LA 2VB3X 1LV9A 4QUFA 1GXDC 2PNRC 1TIID 3KLRA 1DD2A 2KJXA 3H3VC 1IYUA 3RD4A 1F9SA 2K5QA 2E2HB 1BBXC 1SYCA 1SMYD 1KNAA 1RTNA 4RAUC 2EVBA 3ERQA 3HGBA 2KUMA 1SSOA 5KGUA 4RCNA 1STBA 3K58A 5JEAG 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOJ A;  1SNQ A;  3D4W A;  4G57 A;  5IGF A;  2F0U A;  1EYD A;  1F2Z A;  5CV6 A;  5K5P A;  1SYG A;  4HMJ A;  5J39 A;  1SNO A;  2F0P A;  1STG A;  2HQE A;  5NUC A;  4ODG A;  4YIJ A;  1EQV A;  3MXP A;  4R8N A;  4S3S A;  4ZQ3 A;  4F8M A;  1NSN S;  2F0H A;  1SYB A;  4KJN A;  4EQO A;  4K5V A;  5IGG A;  3NQT A;  1ENC A;  2F0M A;  2F0O A;  4IZ8 A;  4N9T A;  5CGK A;  5DAU A;  3EJI A;  2PW5 A;  3U9O A;  4ZUJ A;  3OMC A;  5KYI A;  3MHB A;  5C3W A;  5KYL A;  2F0E A;  2EY2 A;  3RUZ A;  3MZ5 A;  5JAV A;  3QB3 A;  4KJO A;  4K5X A;  3SK4 A;  1EYA A;  5IGC A;  1EY5 A;  5HUR A;  4EVO A;  5HGT A;  2NUC A;  4N9P A;  4J1M A;  1SNC A;  2EYF A;  3NHH A;  2PQE A;  3S9W A;  4EQP A;  1JOK A;  2PZU A;  1JOQ A;  4OL7 A;  4IAL A;  3P1H A;  4ME5 A;  2F0D A;  4KY6 A;  3NUC A;  4KD4 A;  1A2T A;  1EZ6 A;  3DMU A;  4K5W A;  5CV5 A;  3HEJ A;  2F0T A;  5J1Z A;  2F0K A;  2SNS A;  2PW7 A;  2F0N A;  1EY7 A;  1EY9 A;  2LKV A;  4KY7 A;  4KD3 A;  3BDC A;  5KEE A;  5IGB A;  1EYC A;  2EXZ A;  4RKB A;  4MIU A;  3NK9 A;  3PMF A;  4PMB A;  5IGD A;  4DFA A;  2F3V A;  5E3F A;  1ENA A;  1RKN A;  2OXP A;  1KDB A;  1JOO A;  1KAB A;  1SYE A;  2KHS A;  3E5S A;  4K6D A;  2EYP A;  3TP5 A;  5IIF A;  5IGE A;  4NMZ A;  4PNY A;  5IOD A;  4WOR A;  4NKL A;  5C4Z A;  2PZT A;  5I6Y A;  2ENB A;  3P75 A;  2F0F A;  2PYK A;  2F0I A;  2EY6 A;  2EYH A;  5C5M A;  3T13 A;  4E6I A;  4QMG A;  3C1E A;  3TP7 A;  3TP8 A;  1SNM A;  4EQN A;  5DEH A;  5C4H A;  1A3U A;  2EYL A;  5ISR A;  3MEH A;  5CR3 A;  1KDC A;  1SNP A;  3D4D A;  1F2M A;  2F3W A;  3C1F A;  4K2L A;  4QB4 A;  1II3 A;  4TRD A;  5I6W A;  5EKL A;  2F0Q A;  2EYO A;  4DGZ A;  2F0J A;  5M9O A;  1SYD A;  3EVQ A;  4WRD A;  5CV4 A;  3SXH A;  3OSO A;  1KDA A;  3R3O A;  5EGT A;  3V2T A;  5J22 A;  3D8G A;  1A2U A;  1STH A;  4QF4 A;  1JOR A;  4J6H A;  3BDL A;  4KY5 A;  3D6C A;  2OEO A;  4HTH A;  4IUN A;  3VA5 A;  4ZUI A;  2EYJ A;  5C5L A;  3T16 A;  1F2Y A;  1STY A;  5IOC A;  3ITP A;  3TME A;  2EY5 A;  4DU9 A;  4H7B A;  2RBM A;  4K8I A;  5JOB A;  2SNM A;  4NP5 A;  3NP8 A;  4KTA A;  3TP6 A;  2F0L A;  2RKS A;  4B9X A;  1IHZ A;  4KHV A;  5F2D A;  1TQO A;  3DHQ A;  1EZ8 A;  3SR1 A;  1STN A;  2EY1 A;  1KAA A;  2F0G A;  1A3T A;  4DF7 A;  5CC4 A;  5I9O A;  5KGU A;  3LX0 A;  1EY4 A;  2F0V A;  1TR5 A;  2F0W A;  2OF1 A;  2QDB A;  3MVV A;  5KIX A;  3OWF A;  2SOB A;  4LAA A;  1A3V A;  2WAC A;  5CV8 A;  5EKK A;  1U9R A;  4KV6 A;  5CV9 A;  2EYM A;  2PZW A;  4RKL A;  4PMC A;  1SYC A;  2O4X A;  3HZX A;  4K8J A;  4B9W A;  5C3X A;  3SK5 A;  2KQ3 A;  3SK6 A;  5KRU A;  2RDF A;  1NUC A;  4I65 A;  5CV7 A;  5E1F A;  5I9P A;  1EY0 A;  4K2K A;  3ERQ A;  3SHL A;  1STA A;  1AEX A;  1SND A;  5C6A A;  1SYF A;  3OMG A;  2F0S A;  3ERO A;  3H6M A;  4K14 A;  4NDX A;  1STB A;  3QOL A;  4HMI A;  4ID6 A;  1EY8 A;  3SK8 A;  1TT2 A;  2M00 A;  4F7X A;  3NXW A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 1WD1 A;  1XWE A;  4OIJ A;  2A73 B;  4JI5 L;  2D2C C;  1EEF D;  5HGQ A;  5GAD C;  5C3E B;  3L2P A;  4GLV B;  1UEB A;  4KMU C;  1M4V A;  1NNX A;  3T51 B;  3KLS X;  3OPO A;  1BBW A;  3BZD B;  3SGI A;  1TWH B;  5EPJ A;  1H95 A;  1N34 Q;  1X3E A;  2V1C C;  2H4O A;  1Y1V G;  3CC2 A;  4L5T A;  1V1Q A;  1UAP A;  3KJO A;  2B63 B;  1VQH A;  2JA6 H;  2D9U A;  4DV2 Q;  1I4R A;  5FO7 B;  4APV A;  2G5D A;  4UHV A;  2EIF A;  1JC7 A;  1KC8 C;  1EZ6 A;  3HEJ A;  4P2C B;  3DWQ A;  5JJZ A;  5IYB G;  1MHW C;  3DUZ A;  5FO8 B;  3PMF A;  4BBR B;  5IYD G;  1WVL A;  1UUP A;  3BJU A;  1S3O A;  4JI3 L;  4WJ3 M;  3TP5 A;  3I70 A;  2F4V L;  4C1N K;  3N52 A;  1VMP A;  4ALP A;  4NKL A;  1HFG A;  4FXG C;  5C5M A;  4OHJ A;  2EY6 A;  4LNQ A;  3MEH A;  3X3N A;  4IJL A;  1VQL A;  4WRD A;  2IJ0 A;  3OSO A;  4POF A;  5FO9 B;  5E7N A;  2Q8I B;  4A3L G;  1OXT A;  5K36 H;  4ZUI A;  4RWS C;  1RL2 A;  3RZD H;  1KL9 A;  3RN5 A;  3BZK A;  2KHJ A;  2MJ8 A;  4IQZ A;  2SNM A;  3I4N B;  3QG1 A;  2CCZ A;  5F2D A;  1PH6 A;  1ASZ A;  1WTH A;  4CDD C;  5EPK A;  4B3M Q;  3ICE A;  3PO2 H;  1Q8K A;  1SE2 A;  2EE1 A;  1DON A;  4HIM A;  4A3K B;  3ERS X;  4X3U A;  4X65 L;  1HJP A;  3CCS A;  2EQS A;  5BN4 A;  5C3X A;  1WTP A;  4A93 H;  1A8V A;  4G7O C;  3UE0 A;  4H0L C;  1U4L A;  5I9P A;  2L15 A;  1YIJ A;  2K7V A;  3NXW A;  2UXB Q;  1XNQ L;  3HOX B;  2NYZ D;  4G57 A;  3UDG A;  2UU9 L;  3AMU A;  4A3D H;  3K59 A;  2Z6K A;  5J3B A;  3AFP A;  4P72 A;  3U58 A;  3MFY A;  4S3S A;  2UUA L;  1GUS A;  4YCW A;  4X62 L;  1EOV A;  2RHS B;  2CFM A;  4C2M H;  5L37 A;  3NTH A;  2B2U C;  3M4Q A;  4JI1 L;  4OEL B;  4NB3 A;  4OGQ C;  1KLU D;  5C4X B;  2K50 A;  3PUW A;  1HH2 P;  2EDG A;  4A3M G;  2JP1 A;  3T1Y L;  1WTQ A;  1AH9 A;  1NCV A;  1L1O C;  2VUM B;  3EA6 A;  1YNN D;  1VQ8 A;  1HR0 L;  3PO3 B;  5M3F B;  4CDE C;  5CV5 A;  4PZ8 A;  5C4J B;  2F0K A;  3F1Z A;  4LFA L;  1IXR A;  3S1Q H;  2E74 C;  4FO2 A;  5KEE A;  2GN5 A;  4RA8 A;  2K33 A;  3CF5 A;  3I7F A;  1H9K A;  2L12 A;  1JWS D;  1Z6H A;  5AFW A;  2EYP A;  4L5R C;  2K5D A;  4DK1 A;  3P75 A;  4O42 A;  1PVO A;  1Y8O B;  4RCO A;  1I4G A;  3L9A X;  1PDQ A;  2WIN B;  4EQN A;  2L55 A;  3ER0 A;  2JXM B;  2LXJ A;  1TWA H;  2XRS D;  2MFI A;  4XXE A;  3KOJ A;  5BR8 Q;  3SE0 A;  2G9D A;  5IP7 H;  3I91 A;  5JVG 3;  2N78 A;  2BOS A;  2OEO A;  2Z6B A;  3OIQ A;  3RMH A;  4PG3 A;  2JA6 B;  3CHB D;  2SEB D;  1XTC D;  1B50 A;  4OX9 L;  4X3S A;  4KHP L;  1SXT A;  3MXU A;  4B3S L;  3HOZ B;  2NVY H;  1XPU A;  1STN A;  4JI7 L;  1IL8 A;  1WTO A;  1Z9F A;  3K0Y A;  4HN7 A;  1Q82 C;  2MGS A;  1U9R A;  4RKL A;  1PV4 A;  1LLR D;  4DR1 L;  1I4H A;  2X6L A;  4NXN L;  3HKZ E;  4OON A;  1VQA A;  1NUC A;  2KCN A;  2F1M A;  1EY0 A;  3KF8 B;  1SYF A;  4MTK A;  1VQM A;  1BDO A;  2M9V A;  1D7Q A;  2NVT H;  5K36 G;  2QIL A;  5C0X I;  1K3R A;  4IPC A;  2F0U A;  1KIX A;  5K5P A;  1BBU A;  5ELE A;  1X54 A;  3E0J A;  1GUG A;  1VQ4 A;  4O2D A;  3VYR A;  2ASB A;  3I4O A;  1TWF H;  4JI4 Q;  3GTO H;  1UE7 A;  2BE5 D;  2IT1 A;  1RDP D;  2FXQ A;  2F0M A;  2WFW A;  3PO2 G;  3RZD B;  2OTJ A;  1I6H H;  4JYA Q;  1Z47 A;  1DGS A;  2WII B;  4A93 G;  3I4M H;  2RSN A;  4JI2 L;  2PPB C;  4EVO A;  1SNC A;  5AJ3 L;  1S4Z A;  1I4P A;  3N6R A;  1DM0 B;  1CSQ A;  3H15 A;  1TWC H;  4CJ2 C;  3S15 H;  4A3D G;  1A2T A;  3NWS A;  4K5W A;  5J1Z A;  3CCR A;  4UPA A;  4BXX H;  2Z1C A;  4J15 A;  5IGB A;  1RTO A;  4R4I A;  4HJA A;  1BNZ A;  4PMB A;  1KRT A;  4IN3 A;  4PNY A;  2VL6 A;  2DN8 A;  3JAM c;  3OOC A;  5E4X A;  4GKK Q;  1AP0 A;  4HAE A;  3CXC A;  2ICE C;  1QNU A;  3NEL A;  3UI2 A;  3BVZ A;  3C1E A;  1QZH A;  3S17 H;  2EYL A;  1F2M A;  3CC4 A;  4CKE A;  1XMQ L;  4PMW A;  4C1N I;  2R93 H;  1ZXT A;  4C2M B;  4FXD A;  4YCV A;  1SYD A;  2FHT A;  1A2U A;  1F9P A;  4IUN A;  3K7A H;  1HUM A;  1SLJ A;  2F4I A;  2GVB A;  2HCI A;  1UEA B;  1PTO H;  2K5W A;  3NP8 A;  1QOH A;  3CME A;  3RLN A;  3STB D;  2K5N A;  2JA9 A;  1A15 A;  4LAA A;  1T5X D;  3S1Q B;  2XTI A;  1VQN A;  4A3E G;  5D14 A;  1HNZ Q;  2RSO A;  2O4X A;  2Q2I A;  3M85 A;  2Y0S G;  4OO1 I;  1EIH A;  2JK8 A;  3SHL A;  1STA A;  2A1A A;  1AEX A;  2YV5 A;  2A68 C;  5IP7 G;  4R4Q A;  3S14 B;  1E24 A;  2R7Z B;  3QOJ A;  1SNQ A;  2XSC A;  5FK9 C;  1IYJ B;  1TWA B;  4AYB E;  2A6E C;  3CMA A;  1B9M A;  1SYG A;  2HQE A;  1C48 A;  4OXP A;  1CKM A;  3CCL A;  2J4X A;  4R8N A;  1EIG A;  3NSW A;  2R61 A;  3LWU A;  5HY6 A;  2HHH Q;  4FXK C;  4O1N A;  3U9O A;  2YU9 H;  3CC7 A;  1W6K A;  3A8K E;  1M90 C;  5JAV A;  2NVY B;  2LFN A;  4J1M A;  1C9O A;  4GNX B;  1E7Z A;  2PQE A;  2C9O A;  4AYB B;  5H1S E;  1M1K C;  2UUC L;  3HOU H;  3TZD A;  1JT8 A;  4BA1 I;  3NUC A;  3MFG A;  4DXF A;  1I5F A;  1ZKO A;  4DNT B;  3BVM A;  4A3F H;  2E5L L;  2UXD Q;  4HIK A;  1ET9 A;  4KY7 A;  3KF6 A;  3AQQ A;  1SJE D;  3GQB A;  4DFA A;  3TBI B;  3AFQ A;  5IIF A;  1K83 H;  4OWX B;  2F0F A;  2RQX A;  3K5O A;  1NY4 A;  1XPO A;  1FD7 D;  1HNX L;  4Z9C B;  1TWF B;  3D31 A;  3GTO B;  1PXU A;  2JA5 B;  1X6O A;  2JA8 H;  4UAI A;  5JVH 3;  5IWA Q;  1I6H B;  1OXS C;  3FHW A;  2K03 A;  3D8G A;  1QNK A;  3E9H A;  4QF4 A;  3I4M B;  4U68 A;  3K5M A;  3T16 A;  4JI6 Q;  1F2Y A;  1PZJ D;  3G4S A;  1VQJ A;  1AN8 A;  2J0T D;  1UE5 A;  2CHB D;  3FDT A;  5ELF A;  4CBV A;  1DXM A;  3UDF A;  3ZYY X;  4DAY B;  4YHH Q;  4KHV A;  1TWC B;  3S15 B;  1CHP D;  1I50 H;  1EYG A;  4OWW B;  3A55 A;  3LX0 A;  2OF1 A;  5COY A;  1IBM L;  2ID0 A;  2PZW A;  4IFD I;  3HZX A;  3J81 E;  4IJH A;  5JEA H;  1K8O A;  4BBS H;  4FF3 A;  3GP7 A;  4DR5 Q;  5KNC A;  1G51 A;  1KLG D;  2C5C A;  2WB1 E;  1BVS A;  2R7F A;  2K28 A;  4FDB A;  3J81 j;  1N33 Q;  1EY8 A;  3SK8 A;  4JCV E;  4BA2 I;  3S17 B;  1F9R A;  2EJM A;  2KEE A;  1L0X B;  3MTS A;  1F2Z A;  2R93 B;  2BH2 A;  4ZAI A;  2F0P A;  2VQF L;  1IBL L;  1T9H A;  2I0Q A;  3BZC A;  5JJI A;  1SYB A;  1H9R A;  4A3C G;  4L8J A;  1J5E L;  3K7A B;  1Y1V H;  5CGK A;  5E4W C;  3S1M H;  5JPM C;  4RHR A;  2XIW A;  4DV4 L;  3PQI A;  1W3S A;  2WAQ E;  2WB1 B;  5GAG C;  5C3W A;  1S40 A;  1Q86 C;  1L1O A;  3DLL A;  4JC0 A;  4A3J B;  4IO9 A;  4JI5 Q;  3S2H B;  1S5B D;  3GTP H;  1D2B A;  1VQE A;  4N9P A;  4CKC A;  2EYF A;  5GRO A;  4IPD A;  2O5I C;  1YNJ C;  2L4N A;  4GKJ Q;  2YTY A;  4B08 A;  1PH4 A;  5CBE E;  4EGV A;  5IYB H;  4RG1 A;  1RCV D;  4L5S A;  4HSV A;  2G9H D;  1SR3 A;  3H0G B;  1MI2 A;  5LL6 S;  1PA6 A;  1RKN A;  1ESF A;  4G7Z C;  1MKH A;  4R9W A;  3MXG A;  4NMZ A;  3V05 A;  1KD1 C;  1U4M A;  3Q24 A;  3LGJ A;  2OCE A;  1YI2 A;  4XT1 B;  5IT9 c;  3RN2 A;  4GN5 A;  4R1J A;  3D4D A;  4LWC A;  4QIW B;  5LHY 1;  4LUV A;  4RGM A;  1LT6 D;  3D0F A;  3SXH A;  3KBX A;  2YU9 B;  1KDA A;  3NEN A;  4RGO S;  4LFC L;  1KHI A;  3RLO A;  3J7A 5;  1HZ9 A;  4HTH A;  4JI3 Q;  2K4K A;  1KNE A;  4A3F G;  3OW7 A;  4DR2 L;  2F4V Q;  5M5W H;  2K01 A;  4RFB A;  4MTN A;  1WTW A;  3HOU B;  4DV1 L;  1VQ5 A;  1GJX A;  1TQO A;  1CFM A;  2HIV A;  4A3F B;  1EQQ A;  2BA1 A;  1I94 L;  1EY4 A;  5JJK A;  2KCC A;  3MVV A;  1A3V A;  4N8X 1;  4ZRZ A;  1SMX A;  4NW2 A;  3HOW G;  1E0B A;  2HCC A;  4NXM L;  2QA4 A;  3M7G A;  1T5E A;  5EQ0 A;  2I5L X;  3T1H Q;  4K14 A;  1WTX A;  3H6M A;  3QOL A;  2OT2 A;  3A5U A;  4YY3 L;  1CUK A;  2I5M X;  3A54 A;  4YCU A;  4H44 C;  1EWI A;  2JA8 B;  1UNS A;  4ILW A;  5NUC A;  1MSH A;  2ZTD A;  4GN4 B;  1L1O B;  3EQL C;  1U4R A;  2B2Y C;  3QIA A;  3VYS A;  2JA7 G;  4DV5 L;  3NQT A;  4KN4 C;  1D6E C;  2F0O A;  4IUQ A;  4C56 C;  3VDY A;  5M3M G;  4M8A A;  3EJI A;  5EBD A;  1V43 A;  2OWO A;  3A7L A;  4A3M H;  2F0E A;  1YBY A;  1XNQ Q;  1X3F A;  2D0P A;  3H09 A;  4BBS G;  2UU9 Q;  1I50 B;  3ZJY C;  1FYC A;  4IUV A;  4FF2 A;  2BA0 A;  5LL6 X;  4DUZ Q;  5KND A;  2UUA Q;  4X62 Q;  2DNE A;  2DNC A;  3V96 A;  4DR4 L;  2QGQ A;  4C3J G;  1EY9 A;  2ZXR A;  4AQY L;  2Z0S A;  4F88 A;  3F8T A;  4JI1 Q;  1EFW A;  1ZYR C;  1SYE A;  2X6G A;  3E5S A;  1JR0 D;  5IOD A;  2JQO A;  1YVC A;  3PIO A;  1LUZ A;  3T1Y Q;  3S2D H;  3G48 A;  1EFI D;  1EWC A;  1YNX A;  1HR0 Q;  4HJ7 A;  4TVA B;  1O7L A;  3CCV A;  1Q90 A;  3C1F A;  4HCE A;  1Y1V B;  1PYB A;  1P16 A;  3MC0 B;  1AZP A;  5EBC A;  5EKL A;  1CQV A;  4LFA Q;  4FYD A;  1HZB A;  1PTO C;  1PH5 A;  4ZKB B;  1L0Y B;  1DZ1 A;  3K57 A;  5C0X J;  3VA7 A;  1G8Z D;  1NJI C;  3J80 c;  3GTP B;  1PH8 A;  4YWL A;  3L7Z C;  1TKW B;  1I4X A;  2XN9 C;  3OHX C;  3FRP B;  4K8I A;  3M9B A;  1PLF A;  3GTM H;  2E2J H;  1IHZ A;  1QCB D;  2JJQ A;  1IBK L;  3DHQ A;  2B2T C;  2F0G A;  4TQU S;  1CZW A;  2EXD A;  3H3V I;  4XYQ A;  2QDB A;  4Q5V A;  4DR7 L;  3NBH B;  1JB3 A;  3DWP A;  2NZ1 D;  4KV6 A;  5CV9 A;  5M5X H;  2KED A;  1Y1W G;  4LF8 L;  3SK5 A;  2AHO B;  2VW9 A;  1PZK D;  1FGU A;  1BUV T;  1PRT C;  4A75 A;  4NDX A;  2RF4 A;  2F0S A;  1HCZ A;  3WDN A;  4OX9 Q;  3EIV A;  3DM3 A;  2E2D C;  5I6W A;  2DY8 A;  4B3S Q;  4XIG S;  4JI7 Q;  2NZO A;  1HFN A;  1R4P B;  1F2L A;  2MP1 A;  3SVM A;  4DR1 Q;  2NWG A;  4NXN Q;  3HOY G;  3PF5 A;  2B2V C;  5M5W B;  5I4D A;  3K5N A;  1Q3L A;  5KYI A;  3RUZ A;  4CJ0 B;  1VDZ A;  1BCP C;  4DV0 L;  2QEX A;  3I90 A;  3KF8 A;  1EOT A;  3EFX D;  3JC6 6;  2HIX A;  2MO0 A;  5G3L F;  1FJG L;  4KY6 A;  1E1O A;  4CDF C;  2NZH A;  1VMC A;  1JCK B;  5JJL A;  1CZG A;  3G6J B;  5C44 H;  1JE5 A;  1D5X C;  5LMN L;  4LF7 L;  3OW2 A;  1Q1E A;  3OYY A;  3EN2 A;  3F2C A;  1ENA A;  4HIO A;  2FFK B;  4JI2 Q;  4QCL A;  2LY7 A;  3OWE B;  4WOR A;  1B4O A;  1HR0 W;  5C4Z A;  5AJ3 Q;  2KHI A;  2K5V A;  4GLX A;  1EIF A;  4QMG A;  1E2W A;  2RHQ B;  3CRK C;  5C4H A;  3JAM L;  1PFB A;  1SNP A;  4DKA C;  3D3R A;  4QL5 A;  4LF5 L;  4BWG B;  1RF2 D;  4GLA C;  3S1N H;  4A3M B;  3PSI A;  1N34 L;  3BDL A;  2UUB L;  2A6E D;  2SDF A;  2PO4 A;  2EYJ A;  5ELN A;  1ET6 A;  3CAM A;  1EUJ A;  2IHF A;  1QVF A;  1FL0 A;  3RLF A;  1CQF A;  2CVR A;  3CCM A;  4DV2 L;  4IPG A;  4BY1 G;  1QG7 A;  4A3E H;  1XMQ Q;  4LF4 L;  3CCJ A;  3HP3 A;  3OWF A;  3I55 A;  1D8L A;  1IYV A;  5CYU A;  2B8G A;  3F2D A;  1D5M C;  4C3I G;  2CKZ B;  2CW0 C;  1HPC A;  2Q8R E;  3CCE A;  5IYC G;  1YJN A;  2ZXP A;  4X66 L;  3S2D B;  3IRB A;  1ASY A;  1C0A A;  2AMC B;  3T56 B;  3T53 B;  4B3R L;  1IW7 C;  1NMG A;  2WKC A;  1LTG D;  3J7A V;  4YIJ A;  1XMO Q;  1YJ9 A;  3RZO H;  1JE4 A;  2PW5 A;  4OEM B;  4ZUJ A;  1CM9 A;  2MQH A;  1E2V A;  2RDG A;  3S9W A;  2L11 A;  4B3M L;  5M5X B;  2D5D A;  2KEC A;  1O7Y A;  4G7H C;  4LFB L;  3FPP A;  3M7N A;  3I3C A;  3FKI H;  2HD3 A;  2KEN A;  4DUY L;  1GVP A;  1JOO A;  3FP9 A;  2E8G A;  5IGE A;  2K6A A;  4KK7 A;  2K14 A;  3HKZ G;  4HED A;  1O80 A;  4IFD J;  2F0I A;  2UUC Q;  3PO2 B;  4DV7 L;  1CT1 D;  4N8F A;  2A69 D;  1H9S B;  4A93 B;  2F0J A;  1LYL A;  3BYT B;  5CV4 A;  4GNX A;  1ILQ A;  1NAP A;  1STH A;  4POG A;  5ELO A;  2OTL A;  5C5L A;  5C44 G;  1HQR D;  4A3D B;  3HOV H;  4JOI C;  1LT3 D;  3TN2 A;  4DAM A;  4FF4 A;  3Q22 A;  3UE1 A;  4ZYS A;  1HNX Q;  1B2T A;  2NVQ H;  5D3I B;  4HCS A;  1TS2 A;  5DNF A;  5KIX A;  1VF5 C;  2HT1 A;  1VF7 A;  1YEZ A;  3I73 A;  1JJG A;  1EL0 A;  4AIM A;  4NPS A;  4YWK A;  2YTV A;  2X69 A;  4M1U B;  1I3Q H;  1XPR A;  4ZCK A;  1CA6 A;  1GUN A;  3BG3 A;  4UP9 A;  1AFP A;  5G3L D;  1XNR L;  3KDF A;  3B6Y A;  4X3K A;  1TT2 A;  4ULL A;  2E76 C;  1F77 A;  3GTJ H;  4X64 Q;  3D4W A;  2NN6 I;  5IGF A;  2B2Y A;  3PGZ A;  3K7U C;  5J39 A;  4A3C H;  1IBM Q;  1YZ6 A;  1WYD A;  1VQ6 A;  1V1P A;  3S1N B;  1BKB A;  1Q46 A;  1LTS D;  1SFO H;  4DAY A;  5BR8 L;  3PIO 3;  3QWN A;  1MJE A;  4K5V A;  5IGG A;  1LTR D;  5GAH C;  1WTV A;  5DAU A;  3WWV A;  4GOP B;  3C3L A;  3OMC A;  1X3P A;  2V4D A;  3MZ5 A;  1SDF A;  3SK4 A;  5FOB B;  4A3E B;  3RNU A;  2IY5 B;  3R8B A;  5IY0 A;  1J8I A;  1JJ2 A;  2Y0S B;  4PV1 C;  2Q2U A;  4EQP A;  3R2T A;  1QVG A;  2VQF Q;  1GD7 A;  3URY A;  3E3X A;  3CRL C;  3GTG H;  2VZA A;  1B8A A;  1H9J A;  1K8A C;  1EQR A;  1RHP A;  1S5C D;  2RCN A;  3CPF A;  2K75 A;  1ESR A;  1YNN C;  2FMM A;  4RKB A;  4DV4 Q;  1IZ6 A;  2OXP A;  1KAB A;  2DUD A;  2KHS A;  3TS2 A;  1G6P A;  2HDL A;  5IE8 A;  2BDN A;  1PYS B;  2ENB A;  2AUK A;  4K0K L;  3D4R A;  2HQL A;  3TDQ A;  2K05 A;  3NQI A;  3RZO B;  2FMC A;  3E0E A;  3U9S A;  5M9O A;  3PIP 3;  2JEB I;  5IT9 L;  4LJZ C;  4KY5 A;  3D6C A;  4C3H H;  4LUZ A;  4DR6 Q;  2XGT A;  1STY A;  1CHQ D;  2NVT B;  3FKI G;  1MBY A;  1DOL A;  2RBM A;  3CPW A;  2RKS A;  4DAV A;  2J7Z A;  1SE3 A;  1SE4 A;  3NTI A;  2NBF A;  2F0W A;  3HOW H;  2IHE A;  4MN3 A;  1GUW A;  5EJW A;  2H1E A;  3FKI B;  4EX5 A;  3CD6 A;  5FLM G;  2EYM A;  3ND8 A;  1PZI D;  3KDF B;  4LFC Q;  1WOC A;  2KQ3 A;  2R92 H;  4A3B H;  3VR6 A;  5CV7 A;  2JE6 I;  1WD0 A;  1GHK A;  4DR2 Q;  1NTG A;  3BYY B;  1YIT A;  2QF7 A;  4A76 A;  5EPL A;  4LF6 L;  4A4I A;  1QE6 A;  4JBW A;  1V1P B;  4DV1 Q;  3ULJ A;  1W2B A;  2B29 A;  2B2W C;  4WFN 3;  4DV6 L;  5CV6 A;  1I94 Q;  1HUN A;  1HA5 A;  2IWH A;  3HOV G;  2B2V A;  2JA7 H;  3NEM A;  4JG2 A;  4IUT A;  3HKS A;  5FLX L;  2NVX H;  5M3M H;  1WCM G;  1U0L A;  2AQ1 B;  2E2H H;  1VCI A;  4IZ8 A;  5C0X H;  1NMF A;  2O5J C;  3U50 C;  3HOV B;  2EY2 A;  1N36 L;  4R4C A;  2BE5 C;  4RMF A;  1VQP A;  4K5X A;  1DOM A;  1CKO A;  1Q7Y C;  1Q8I A;  3AEV A;  3PCO B;  3A0J A;  1PTO D;  1CSP A;  2PZU A;  4C3J H;  2VXW A;  5C3E H;  1TY0 A;  5M5Y H;  2B2U A;  4I7A A;  3AYH B;  4A3I G;  1OXV A;  2DJG C;  1JWM D;  1ILP A;  4XDX A;  1FNV A;  3A8J E;  1EYC A;  5DM7 3;  3J7Z C;  4A3G G;  5E3F A;  3FEW X;  3GTJ B;  3KLS A;  4GN3 B;  1N9W A;  1PTO B;  1EEI D;  1UWV A;  2AQ3 B;  1SEB D;  2L9H A;  2B63 H;  2TMP A;  2A6H C;  1PYW D;  2JYO A;  2WP8 J;  5TSS A;  1HQM C;  2KCT A;  2F3W A;  4QIW E;  1WI5 A;  4QB4 A;  3UDI A;  4Y52 H;  1LTA D;  4TRD A;  2F0Q A;  4GOP C;  4LF9 L;  1NR2 A;  1LT5 D;  1Y69 U;  4HJ5 A;  4AQY Q;  1PH1 A;  4DN4 M;  1W6J A;  3D6W A;  4UDU C;  3L0O A;  3VA5 A;  1S72 A;  2HHH L;  1JIC A;  2E2I H;  1PFM A;  3S16 H;  3W1G A;  4QGU A;  1GKH A;  4H02 A;  4IUR A;  2L0C A;  4KTA A;  2PQA B;  3IAY A;  3J80 L;  1PRT B;  3UDX A;  2ZXO A;  5CC4 A;  1KAA A;  2WAQ G;  1Y1W H;  2UXC L;  1QWY A;  1B70 B;  3WOE A;  3CCQ A;  1GM5 A;  1L2F A;  1JWU D;  1TVX A;  1YHA A;  2R3Z A;  5EKK A;  3VR3 A;  3KBG A;  5ELB A;  1BCP D;  3STB C;  4RH6 A;  2N55 A;  2ZT9 C;  1VQK A;  2KOL A;  3AB9 A;  3HG9 A;  1KXL A;  4C3H G;  4DK6 C;  1XTD A;  1IBK Q;  4P75 A;  4X6A H;  5FJ8 G;  3H94 A;  1BCP B;  4DR7 Q;  1STG A;  3HOY H;  1NBW A;  4KLK A;  3RR5 A;  3P20 A;  2K5H A;  1GUT A;  4YWM A;  3MXN A;  1TWG H;  1S5D D;  1B53 A;  4LF8 Q;  1LAC A;  1Y8P B;  4XQN A;  1BF4 A;  1ML0 D;  1ENF A;  3PV0 A;  3Q8D A;  3NBH A;  4KKS A;  3VR5 A;  1K83 B;  1LTL A;  4RHS A;  5A2Q L;  4JPB W;  2R92 G;  4A3B G;  1DOK A;  1EY5 A;  1WTR A;  2NTT A;  2NUC A;  5FLX c;  1UE6 A;  3HOW B;  3HOX H;  1PH2 A;  2XNA C;  1BXT A;  1JOK A;  4V19 0;  1O7I A;  4ME5 A;  3I2Z A;  3M3Y H;  1R4Q B;  3FVQ A;  1LM0 A;  4X65 Q;  1LO5 D;  3ULL A;  3NE5 B;  5LMU L;  3I56 A;  2XVS A;  1IKL A;  2FJ2 A;  2E75 C;  2MO1 A;  1G6Z A;  1LTB D;  1MJC A;  5C0X G;  3GV6 A;  3ULP A;  4DV0 Q;  4KKU A;  2PZT A;  1HXY D;  1XX8 A;  2JA7 B;  3FMC A;  1CKN A;  3T13 A;  2NVX B;  2CW0 D;  5M3M B;  3Q0A A;  4ZKC B;  5CR3 A;  4K2L A;  4ABN A;  1X32 A;  4AH6 A;  1U5K A;  5BN5 A;  2A8V A;  5M3F H;  2L1B A;  3PUX A;  4BBS B;  5LMN Q;  4LF7 Q;  5C3E G;  4JOI A;  4QQB X;  4JBJ A;  1SJH D;  3K80 C;  1QJO A;  3NBI A;  4BY1 H;  2H5X A;  1VQF A;  4JBK A;  4C3J B;  4DV3 L;  3DM1 A;  5M5Y B;  3J81 c;  5I9O A;  1CA5 A;  4GKJ L;  1TR5 A;  4JI8 L;  4C3I H;  2R6G A;  4LF5 Q;  2B63 G;  1ICF B;  4KKT A;  3S1M B;  1DJR D;  2A19 A;  2ATW A;  1BQQ T;  2N88 A;  1G2S A;  5IYC H;  1K28 A;  2GVA A;  4KHZ A;  5JPN C;  3KYH C;  2QKI C;  3SK6 A;  2UUB Q;  1XJV A;  4I65 A;  5E1F A;  4K2K A;  5IP9 G;  1E3P A;  5C6A A;  3ERO A;  1V1O A;  1G91 A;  1K0R A;  4HMI A;  4B3T L;  2DY7 A;  2F52 A;  1QVC A;  5I2Y A;  1MSG A;  3GTK H;  3NTK A;  4K6L A;  4IFD H;  3MXN B;  1WFQ A;  1EYD A;  3DEO A;  4BBR G;  4HMJ A;  4LF4 Q;  4CHT B;  3HOZ H;  5COR A;  1BO0 A;  4ODG A;  1KRS A;  4HJ9 A;  4ZQ3 A;  4DA2 A;  1NSN S;  2F0H A;  3OTO L;  4P71 A;  1GHJ A;  2VNU D;  2E2I B;  5JEA J;  3S16 B;  2VB2 X;  1D1K A;  2MUY A;  1XXG A;  3SEB A;  4DR3 L;  1B7Y B;  1K8M A;  4X66 Q;  1G29 1;  1TY2 A;  4OWT B;  2NN6 G;  2K04 A;  2PMZ E;  1VQ7 A;  2Z4I A;  2YYZ A;  4KHP Q;  1K73 C;  1EU4 A;  1EYA A;  2B8F A;  2JSO A;  5HGT A;  1Y1W B;  1A62 A;  3KJP A;  1UE1 A;  2ZTC A;  4P74 A;  1K8G A;  2AQ2 B;  4B3R Q;  1P8L A;  3G7L A;  1KAW A;  3X3M A;  3PIP A;  2ZM6 L;  4OL7 A;  1XYI A;  2F0D A;  1BR9 A;  4HSP A;  2OQK A;  3JAM i;  4OO1 G;  1PH9 A;  3I4N G;  3GD7 A;  2PW7 A;  2FIN B;  2LKV A;  2CQO A;  4JW0 A;  4GZY C;  1GUO A;  2KCM A;  1JJC B;  5IGD A;  2AWO A;  3BVG A;  1CKN B;  4A3K G;  2IW3 A;  3IL8 A;  3T1H L;  3LNN A;  4X3T A;  1FR3 A;  2PMZ B;  1DCZ A;  3HOY B;  3A56 A;  1K3B C;  3I72 A;  4E6I A;  2IL8 A;  1HNW L;  1TWG B;  3VYT A;  3JAM E;  5LMN W;  1N32 L;  2DJF C;  1RIP A;  4LFB Q;  1II3 A;  1F9Q A;  3HOX G;  3J7Y W;  3HS0 C;  3PF4 A;  5D65 A;  4ZK9 B;  3R3O A;  2JN4 A;  4J6H A;  4DUY Q;  4DK0 A;  4JV5 L;  4JI0 L;  3GTQ H;  4LK1 C;  2NTS A;  4R4T A;  2B3G A;  1LTT D;  1FNW A;  3W5O A;  1J9O A;  2VQE L;  1EZ8 A;  1X3Q A;  3TRZ A;  3M3Y B;  1AE2 A;  4DV7 Q;  4GS3 A;  1A3T A;  1MIU A;  5C4X G;  4DUZ L;  2KVM A;  2A68 D;  3TS0 A;  2YTX A;  2EJG C;  4B9W A;  5KRU A;  2VUM G;  2RDF A;  3M4O H;  3MA2 B;  4TSS A;  3CCU A;  1QZG A;  2A74 C;  1B44 D;  3PO3 G;  1OXX K;  5M3F G;  4BY7 H;  2B2W A;  1H9S A;  2MHV A;  3CKI B;  2OQ0 A;  1Q81 C;  2TSS A;  5I2X A;  2AUJ D;  3W1B A;  2XRQ D;  3E9I A;  3MEF A;  1AZQ A;  4RGN A;  1I4Q A;  3GTL H;  4KJN A;  4EQO A;  4R4O A;  4P73 A;  4BY1 B;  2CWP A;  5KYL A;  1XNR Q;  1SMY C;  3EBE A;  2Z9H A;  5BN3 A;  3S14 H;  2R7Z H;  4C3I B;  5T1G A;  1STE A;  2JA6 G;  1BOS A;  2BCO A;  4IFD G;  1A63 A;  3K0X A;  3DMU A;  4LUO A;  2PCF B;  4H13 C;  2F0N A;  3HOZ G;  1EY7 A;  2KBN A;  3F2B A;  4KD3 A;  3MWY W;  2O2L D;  2XWJ B;  4FP5 D;  1HTL D;  3GTK B;  3BDO A;  1KDB A;  3OIP A;  3GDE A;  3GTM B;  2E2J B;  1WJJ A;  4FNF A;  4QUC A;  3CQZ H;  5ELD A;  3T4A C;  2IX0 A;  3TSS A;  1RJT A;  4GOP A;  1OTC A;  1D5Z C;  3TP7 A;  2RCF A;  2AWN A;  3C46 A;  2KA7 A;  3NPP A;  2IPK D;  2EYO A;  4PQX A;  5EGT A;  3VYU A;  1JOR A;  1NE3 A;  2C35 B;  5IOC A;  3R2I A;  2N3S A;  2CWA A;  2ZTE A;  1DYQ A;  2UXB L;  4RGT A;  4K0K Q;  2QCP X;  1E2Z A;  2PI2 A;  4DF7 A;  5FLM H;  4XT3 B;  4FF1 A;  2F0V A;  2ZJP A;  3U4Z A;  3SDZ A;  5CV8 A;  4L5Q A;  2E5L Q;  3S1R H;  4Y7N H;  2JA5 H;  4PMC A;  4CJ1 B;  1YHQ A;  3HKZ B;  1QIL A;  3QR8 A;  1PTO F;  3K5L A;  5ELC A;  4EQ5 A;  3G6E A;  1J6Q A;  4HR7 B;  1V9P A;  3H3V H;  3OMG A;  4XYO A;  4ID6 A;  3A8I E;  2R7D A;  1FGB D;  4O0A A;  2QDL A;  4UP8 A;  4CKB A;  3BU2 A;  1WCM H;  4IUU A;  3KLW A;  1D1I A;  5C44 B;  3DXJ C;  1EQV A;  1SE8 A;  1X3G A;  1FVI A;  3KK7 A;  1FNU A;  3GTQ B;  1C7Y A;  1CI3 M;  4KI0 A;  2A6H D;  4LMQ D;  1YNJ D;  4PZ6 A;  4LF6 Q;  2ICI A;  1PRT F;  1B1Z A;  3QB3 A;  2LMC B;  1ONL A;  3TQY A;  1X55 A;  4JK1 C;  1GO3 E;  3NHH A;  4DV6 Q;  4BY7 G;  3TZU A;  4KN7 C;  4MHE A;  2Y0S E;  4DK3 C;  1PH3 A;  5KNB A;  4A3I H;  1E22 A;  4IAL A;  4L63 B;  2I5H A;  2F3I A;  1TS5 A;  2EPB A;  2F0T A;  3M4O B;  4A3G H;  4CDC C;  1AW7 A;  1K9M C;  3BDC A;  4BY7 B;  3TEH B;  2LS0 1;  4MIU A;  1VQG A;  2PI2 E;  2M2L A;  2F3V A;  4DNR B;  1N36 Q;  1G2T A;  3ND9 A;  1SBB B;  1EIY B;  2EZV A;  1MGS A;  1BCP F;  4A3J H;  1V8Q A;  2PYK A;  3ONA B;  1B3Q A;  2IX1 A;  3S2H H;  3PUZ A;  2K32 A;  4IUP A;  1SNM A;  3GTL B;  3AU7 A;  1PFS A;  2HUG A;  1KDC A;  1IBL Q;  1VQD A;  5D3D A;  5GAE C;  3W2D A;  2R7Z G;  1K0S A;  1Q12 A;  4DGZ A;  3LWE A;  4DAP A;  1LAB A;  1XMO L;  1J5E Q;  3V2T A;  2VY3 A;  5IT9 E;  4L6T B;  2LXK A;  1EWH A;  4XQQ A;  4HID A;  3H0G H;  1SN8 A;  1ZEQ X;  3I8Z A;  3CW2 C;  3QJY A;  5JOB A;  3KFU A;  3CU7 A;  3L3O C;  4B9X A;  1Y8N B;  3SR1 A;  3VR2 A;  2EY1 A;  2GA4 B;  4I7Z C;  4ME3 A;  2SOB A;  4LF9 Q;  2BDO A;  4PZ7 A;  3I4L A;  1B3A A;  2PNH A;  4ZLT F;  3A7A B;  1A0I A;  4OIK A;  4JI4 L;  3S24 A;  4AYB G;  2DGY A;  1TS4 A;  2Z8L A;  1QB5 D;  4JYA L;  3CQZ B;  3VR4 A;  2B2T A;  5FJ8 H;  4F7X A;  1AE3 A;  3Q6S A;  5EAY A;  5T1I A;  4DPG A;  1VS0 A;  1HTP A;  1VQB A;  2D62 A;  2UXC Q;  4DNI A;  3M4Y A;  3HFZ B;  1JB7 A;  1HHV A;  4HJ8 A;  4IOC A;  2I46 A;  5FLX E;  5DM6 3;  1OXU A;  3MXP A;  1VQI A;  2PQA A;  2Z6K C;  1HZC A;  1ICW A;  1ENC A;  4N9T A;  3DWA A;  4U67 3;  4DXG A;  5CMD A;  3H91 A;  3IFT A;  1R9T H;  3W3A A;  1QUQ A;  2LSS A;  4JVZ A;  1SAP A;  3MHB A;  2JA5 G;  3GO5 A;  1A6X A;  1GOZ A;  2NB0 A;  3K81 C;  5HUR A;  3Q23 A;  3HRZ C;  4FVM A;  4TKO B;  4GKK L;  1TXY A;  3I4M G;  5CBA E;  4XQJ A;  3P7J A;  3S1R B;  1HRJ A;  4Y7N B;  4G4K A;  4KD4 A;  2RDH A;  1ZYR D;  2SNS A;  1KQS A;  1Q1B A;  3KUP A;  1VQ9 A;  3IFD A;  3J81 i;  1ROD A;  4NXM Q;  2EXZ A;  1IKM A;  1CTM A;  3NWT A;  1NR4 A;  4BXX G;  2XWB B;  4K6D A;  4UP7 A;  4F87 A;  3GV3 A;  4R8I A;  4X64 L;  1HA6 A;  5I6Y A;  4YY3 Q;  1WCM B;  1PH7 A;  4MNO A;  2NVQ B;  2EYH A;  2CQA A;  3J80 i;  2ZJR A;  5ISR A;  2WV6 D;  5DEH A;  2WKD A;  1A3U A;  1M8A A;  2EOT A;  1SRO A;  1PHJ A;  5A35 A;  1VQC A;  3DEP A;  5LMU Q;  1X9N A;  1I3Q B;  4DV5 Q;  1HNZ L;  2R93 G;  4CGY B;  3R93 A;  1O78 A;  2A69 C;  1TWH H;  1X56 A;  2K1B A;  3TME A;  2EY5 A;  4H7B A;  3K6O A;  1YHB A;  1IL2 A;  4A3I B;  2L5T A;  1CK1 A;  3F2U A;  1N8R C;  3J80 E;  4MZ9 A;  3C2P A;  1JQY D;  1Z7T A;  2WB1 G;  2Q2T A;  1SFO B;  1C8C A;  4A3G B;  1I6V C;  4A3J G;  2WAC A;  3G71 A;  1PRT D;  2EJF C;  4DR4 Q;  5DLQ E;  4QJF A;  3QO2 A;  5IP9 H;  2I07 B;  4K8J A;  3J81 L;  2QEJ C;  1SRU A;  2CH4 A;  1OO9 B;  1SND A;  4V0B A;  2MNA A;  4BBR H;  3A74 A;  2M00 A;  4JBM A;  2P5Z X;  1EY6 A;  3A5Z B;  1X65 A;  1TU2 B;  3WOF A;  4J8Q A;  4DV3 Q;  3H0G G;  3O13 A;  3IKJ A;  3KF6 B;  1KTK A;  1RD9 D;  2N49 A;  3MAQ A;  3PUY A;  1SNO A;  2D0O A;  4JI8 Q;  3GTG B;  2Q8T A;  1QUQ B;  3K8A A;  2IX3 A;  4IOA A;  1S5F D;  4F8M A;  5IYD H;  2UXD L;  5FKA C;  2NN6 H;  4IPH A;  3E6Z X;  1HZA A;  1LTI D;  2WAQ B;  4LW1 A;  4DR6 L;  1L0W A;  4B3T Q;  4KJO A;  5A2Q E;  5IGC A;  2Q2H A;  1H9M A;  4OO1 H;  1EU3 A;  3I4N H;  1JOQ A;  3P1H A;  3PUV A;  4A3L H;  3TRE A;  3OTO Q;  3J7A F;  3CP0 A;  3HOU G;  1PMR A;  1JMC A;  5IWA L;  4A3K H;  4C3H B;  1B9N A;  2N8N A;  4DR3 Q;  3NK9 A;  4Q0F A;  1O7Z A;  1S5E D;  4GNX C;  4JI6 L;  2RA4 A;  3M4P A;  1U4P A;  2B39 A;  2ZJQ A;  1LT4 D;  4WJ4 A;  4XTC S;  3BS1 A;  2ZM6 Q;  4YHH L;  4BS9 A;  3TP8 A;  1MD2 D;  2Z4H A;  2K52 A;  1YJW A;  2F03 A;  2QW7 A;  5EKI A;  2HDM A;  2VS1 A;  1EQT A;  2AKW B;  2MPM A;  1R9T B;  4A3B B;  2R92 B;  4QY7 A;  3EVQ A;  2JEA I;  5J22 A;  1E1T A;  1C4Q A;  2JA8 G;  1PFN A;  2ALY B;  4WJW A;  2ES2 A;  4UY8 C;  2RVL A;  4DR5 L;  3FPU B;  3ITP A;  4DU9 A;  1TS3 A;  1N33 L;  4NP5 A;  3TP6 A;  2A5H A;  2F0L A;  2VB3 X;  1LV9 A;  2CH4 W;  5C4X H;  4QUF A;  1HNW Q;  1Y14 B;  1GXD C;  5GQO A;  2PNR C;  3U4V A;  2BH8 A;  1FJG Q;  1N32 Q;  1TII D;  3KLR A;  1DD2 A;  2KJX A;  3H3V C;  1IYU A;  3RD4 A;  2VUM H;  1F9S A;  2K5Q A;  2E2H B;  1BBX C;  1SYC A;  1SMY D;  1VQO A;  3PO3 H;  1KNA A;  1RTN A;  5C4J H;  4RAU C;  4JV5 Q;  4JI0 Q;  2EVB A;  3ERQ A;  3HGB A;  2KUM A;  1SSO A;  5KGU A;  4RCN A;  1STB A;  3K58 A;  5JEA G;  1IW7 D;  2VQE Q; 
#chains in the Genus database with same CATH homology
 1WD1 A;  1XWE A;  4OIJ A;  2A73 B;  2D2C C;  1EEF D;  5C3E B;  4KMU C;  1M4V A;  3T51 B;  3KLS X;  3OPO A;  3BZD B;  1TWH B;  5EPJ A;  2H4O A;  1UAP A;  2B63 B;  2D9U A;  1I4R A;  5FO7 B;  1JC7 A;  1EZ6 A;  3HEJ A;  4P2C B;  3DWQ A;  5JJZ A;  3DUZ A;  5FO8 B;  3PMF A;  4BBR B;  1WVL A;  1UUP A;  3TP5 A;  3I70 A;  4C1N K;  3N52 A;  1VMP A;  4NKL A;  1HFG A;  4FXG C;  5C5M A;  4OHJ A;  2EY6 A;  3MEH A;  3X3N A;  4WRD A;  2IJ0 A;  3OSO A;  5FO9 B;  2Q8I B;  1OXT A;  5K36 H;  4ZUI A;  4RWS C;  2MJ8 A;  4IQZ A;  2SNM A;  3I4N B;  3QG1 A;  5F2D A;  5EPK A;  1SE2 A;  2EE1 A;  1DON A;  4A3K B;  4X3U A;  5C3X A;  5BN4 A;  1WTP A;  4G7O C;  4H0L C;  1U4L A;  5I9P A;  2K7V A;  3NXW A;  3HOX B;  2NYZ D;  4G57 A;  3AMU A;  3K59 A;  3MFY A;  4S3S A;  1GUS A;  3NTH A;  2B2U C;  4OGQ C;  1KLU D;  5C4X B;  3PUW A;  2EDG A;  2JP1 A;  1WTQ A;  1NCV A;  2VUM B;  3EA6 A;  1YNN D;  3PO3 B;  5M3F B;  5CV5 A;  5C4J B;  2F0K A;  2E74 C;  4FO2 A;  5KEE A;  4RA8 A;  2K33 A;  1H9K A;  2L12 A;  1JWS D;  1Z6H A;  5AFW A;  2EYP A;  2K5D A;  4DK1 A;  3P75 A;  4O42 A;  1Y8O B;  4RCO A;  1I4G A;  3L9A X;  1PDQ A;  2WIN B;  4EQN A;  2L55 A;  2JXM B;  2XRS D;  4XXE A;  3SE0 A;  2G9D A;  3I91 A;  5JVG 3;  2BOS A;  2OEO A;  3OIQ A;  3RMH A;  2JA6 B;  3CHB D;  2SEB D;  1XTC D;  1B50 A;  4X3S A;  1SXT A;  3MXU A;  3HOZ B;  1STN A;  1IL8 A;  1WTO A;  3K0Y A;  4HN7 A;  2MGS A;  1U9R A;  4RKL A;  1LLR D;  1I4H A;  2X6L A;  1NUC A;  2KCN A;  2F1M A;  1EY0 A;  1SYF A;  1BDO A;  2M9V A;  5K36 G;  2QIL A;  5C0X I;  2F0U A;  5K5P A;  5ELE A;  3E0J A;  1GUG A;  3VYR A;  2IT1 A;  2BE5 D;  1RDP D;  2F0M A;  3RZD B;  1Z47 A;  2WII B;  2RSN A;  2PPB C;  4EVO A;  1SNC A;  1S4Z A;  1I4P A;  3N6R A;  1DM0 B;  4CJ2 C;  1A2T A;  3NWS A;  4K5W A;  5J1Z A;  2Z1C A;  5IGB A;  1RTO A;  1BNZ A;  4PMB A;  4IN3 A;  4PNY A;  2DN8 A;  3OOC A;  5E4X A;  1AP0 A;  4HAE A;  2ICE C;  1QNU A;  3UI2 A;  3BVZ A;  3C1E A;  2EYL A;  1F2M A;  4CKE A;  4PMW A;  4C1N I;  1ZXT A;  4C2M B;  4FXD A;  1SYD A;  2FHT A;  1A2U A;  1F9P A;  4IUN A;  1HUM A;  2F4I A;  2HCI A;  1UEA B;  1PTO H;  2K5W A;  3NP8 A;  1QOH A;  1A15 A;  4LAA A;  1T5X D;  3S1Q B;  5D14 A;  2RSO A;  2O4X A;  3M85 A;  4OO1 I;  1EIH A;  3SHL A;  1STA A;  1AEX A;  2A68 C;  3S14 B;  2R7Z B;  3QOJ A;  1SNQ A;  2XSC A;  5FK9 C;  1TWA B;  2A6E C;  1B9M A;  1SYG A;  2HQE A;  1C48 A;  2J4X A;  4R8N A;  1EIG A;  3NSW A;  2R61 A;  3LWU A;  4FXK C;  4O1N A;  3U9O A;  1W6K A;  3A8K E;  5JAV A;  2NVY B;  2LFN A;  4J1M A;  4AYB B;  2PQE A;  2C9O A;  3TZD A;  4BA1 I;  3NUC A;  3MFG A;  4DXF A;  1ZKO A;  4DNT B;  3BVM A;  1ET9 A;  4KY7 A;  1SJE D;  3GQB A;  4DFA A;  3TBI B;  5IIF A;  2F0F A;  2RQX A;  3K5O A;  1FD7 D;  4Z9C B;  1TWF B;  3D31 A;  3GTO B;  1PXU A;  2JA5 B;  4UAI A;  5JVH 3;  1I6H B;  1OXS C;  2K03 A;  3D8G A;  1QNK A;  4QF4 A;  3I4M B;  4U68 A;  3K5M A;  3T16 A;  1F2Y A;  1PZJ D;  2J0T D;  1AN8 A;  5ELF A;  4CBV A;  2CHB D;  3FDT A;  1DXM A;  3ZYY X;  4KHV A;  1TWC B;  3S15 B;  1CHP D;  3A55 A;  3LX0 A;  2OF1 A;  5COY A;  2ID0 A;  2PZW A;  4IFD I;  3HZX A;  3J81 E;  5JEA H;  1K8O A;  4FF3 A;  3GP7 A;  5KNC A;  1KLG D;  2C5C A;  2K28 A;  1EY8 A;  3SK8 A;  4BA2 I;  3S17 B;  1F9R A;  2EJM A;  2KEE A;  1L0X B;  3MTS A;  1F2Z A;  2R93 B;  4ZAI A;  2F0P A;  1SYB A;  1H9R A;  4L8J A;  3K7A B;  5CGK A;  5E4W C;  5JPM C;  4RHR A;  2XIW A;  2WB1 B;  5C3W A;  4A3J B;  3S2H B;  1D2B A;  1S5B D;  4N9P A;  4CKC A;  2EYF A;  2O5I C;  1YNJ C;  2L4N A;  4B08 A;  5CBE E;  4EGV A;  1RCV D;  4HSV A;  2G9H D;  3H0G B;  1MI2 A;  5LL6 S;  1RKN A;  1ESF A;  4G7Z C;  4R9W A;  3MXG A;  4NMZ A;  3V05 A;  1U4M A;  3Q24 A;  4XT1 B;  3D4D A;  4QIW B;  5LHY 1;  4RGM A;  1LT6 D;  3SXH A;  3KBX A;  2YU9 B;  1KDA A;  4RGO S;  4HTH A;  1KNE A;  3OW7 A;  2K01 A;  4RFB A;  1WTW A;  3HOU B;  1GJX A;  1TQO A;  1CFM A;  4A3F B;  2BA1 A;  1EY4 A;  2KCC A;  3MVV A;  1A3V A;  4ZRZ A;  4NW2 A;  1E0B A;  2HCC A;  3M7G A;  1T5E A;  5EQ0 A;  4K14 A;  1WTX A;  3H6M A;  3QOL A;  2OT2 A;  3A54 A;  4H44 C;  2JA8 B;  1UNS A;  4ILW A;  5NUC A;  1MSH A;  3EQL C;  1U4R A;  2B2Y C;  3QIA A;  3VYS A;  3NQT A;  4KN4 C;  1D6E C;  2F0O A;  4IUQ A;  4C56 C;  4M8A A;  3EJI A;  5EBD A;  1V43 A;  3A7L A;  2F0E A;  3H09 A;  1I50 B;  1FYC A;  4IUV A;  4FF2 A;  2BA0 A;  5LL6 X;  5KND A;  2DNE A;  2DNC A;  3V96 A;  4C3J G;  1EY9 A;  2ZXR A;  4F88 A;  1ZYR C;  1SYE A;  2X6G A;  3E5S A;  1JR0 D;  5IOD A;  1EFI D;  1EWC A;  1O7L A;  1Q90 A;  3C1F A;  4HCE A;  1Y1V B;  1AZP A;  3MC0 B;  5EBC A;  5EKL A;  1CQV A;  4FYD A;  1PTO C;  4ZKB B;  1L0Y B;  1DZ1 A;  3K57 A;  5C0X J;  3VA7 A;  1G8Z D;  3GTP B;  3L7Z C;  1TKW B;  1I4X A;  2XN9 C;  3OHX C;  3FRP B;  4K8I A;  1PLF A;  1IHZ A;  1QCB D;  3DHQ A;  2B2T C;  2F0G A;  4TQU S;  1CZW A;  4XYQ A;  2QDB A;  4Q5V A;  1JB3 A;  3DWP A;  2NZ1 D;  4KV6 A;  5CV9 A;  2KED A;  3SK5 A;  1PZK D;  1BUV T;  1PRT C;  4NDX A;  2F0S A;  1HCZ A;  3WDN A;  5I6W A;  2E2D C;  2DY8 A;  4XIG S;  1HFN A;  1R4P B;  1F2L A;  2MP1 A;  3SVM A;  2NWG A;  2B2V C;  5M5W B;  5I4D A;  3K5N A;  1Q3L A;  5KYI A;  3RUZ A;  4CJ0 B;  1VDZ A;  1BCP C;  3I90 A;  3KF8 A;  1EOT A;  3EFX D;  5G3L F;  4KY6 A;  1VMC A;  1JCK B;  1CZG A;  3G6J B;  1D5X C;  1Q1E A;  1ENA A;  2FFK B;  4QCL A;  2LY7 A;  3OWE B;  4WOR A;  1B4O A;  5C4Z A;  4QMG A;  1E2W A;  3CRK C;  5C4H A;  3JAM L;  1PFB A;  1SNP A;  3D3R A;  4BWG B;  1RF2 D;  4A3M B;  3BDL A;  2A6E D;  2SDF A;  2PO4 A;  2EYJ A;  1ET6 A;  3RLF A;  1CQF A;  2CVR A;  1QG7 A;  3HP3 A;  3OWF A;  1IYV A;  5CYU A;  2B8G A;  1D5M C;  4C3I G;  2CW0 C;  1HPC A;  2Q8R E;  2ZXP A;  3S2D B;  3T56 B;  3T53 B;  1IW7 C;  2WKC A;  1LTG D;  3J7A V;  4YIJ A;  1JE4 A;  2PW5 A;  4ZUJ A;  1CM9 A;  1E2V A;  2RDG A;  3S9W A;  2L11 A;  5M5X B;  2D5D A;  2KEC A;  1O7Y A;  4G7H C;  3FPP A;  3M7N A;  3I3C A;  1JOO A;  5IGE A;  2K6A A;  4KK7 A;  4HED A;  1O80 A;  4IFD J;  2F0I A;  3PO2 B;  1CT1 D;  2A69 D;  1H9S B;  4A93 B;  2F0J A;  3BYT B;  5CV4 A;  1ILQ A;  1NAP A;  1STH A;  5C5L A;  1HQR D;  4A3D B;  1LT3 D;  3TN2 A;  4FF4 A;  3Q22 A;  4ZYS A;  1B2T A;  5D3I B;  4HCS A;  1TS2 A;  5DNF A;  5KIX A;  1VF5 C;  1VF7 A;  3I73 A;  1EL0 A;  2X69 A;  4M1U B;  1CA6 A;  1GUN A;  3BG3 A;  1AFP A;  5G3L D;  4X3K A;  1TT2 A;  4ULL A;  2E76 C;  1F77 A;  3D4W A;  2NN6 I;  5IGF A;  2B2Y A;  5J39 A;  1V1P A;  3S1N B;  1LTS D;  4DAY A;  3PIO 3;  3QWN A;  4K5V A;  5IGG A;  1LTR D;  1WTV A;  5DAU A;  3C3L A;  3OMC A;  1X3P A;  2V4D A;  3MZ5 A;  1SDF A;  3SK4 A;  5FOB B;  4A3E B;  3R8B A;  1J8I A;  2Y0S B;  4PV1 C;  4EQP A;  3R2T A;  3URY A;  3CRL C;  1H9J A;  1RHP A;  1S5C D;  1ESR A;  1YNN C;  2FMM A;  4RKB A;  2OXP A;  1KAB A;  2KHS A;  2HDL A;  2BDN A;  2ENB A;  2AUK A;  3D4R A;  3TDQ A;  2K05 A;  3NQI A;  3RZO B;  2FMC A;  3U9S A;  5M9O A;  3PIP 3;  2JEB I;  5IT9 L;  4LJZ C;  4KY5 A;  3D6C A;  1STY A;  1CHQ D;  2NVT B;  1MBY A;  1DOL A;  2RBM A;  2RKS A;  4DAV A;  2J7Z A;  1SE3 A;  1SE4 A;  3NTI A;  2NBF A;  2F0W A;  4MN3 A;  1GUW A;  5EJW A;  2H1E A;  3FKI B;  2EYM A;  3ND8 A;  1PZI D;  2KQ3 A;  3VR6 A;  5CV7 A;  2JE6 I;  1WD0 A;  1GHK A;  3BYY B;  2QF7 A;  5EPL A;  1QE6 A;  4JBW A;  1V1P B;  2B2W C;  4WFN 3;  5CV6 A;  1HUN A;  1HA5 A;  2IWH A;  2B2V A;  4IUT A;  5FLX L;  2AQ1 B;  1VCI A;  4IZ8 A;  5C0X H;  2O5J C;  3HOV B;  2EY2 A;  2BE5 C;  4K5X A;  1DOM A;  1Q8I A;  1PTO D;  2PZU A;  2VXW A;  1TY0 A;  2B2U A;  1OXV A;  1JWM D;  1ILP A;  4XDX A;  1FNV A;  3A8J E;  1EYC A;  5DM7 3;  5E3F A;  3FEW X;  3GTJ B;  3KLS A;  1PTO B;  1EEI D;  2AQ3 B;  1SEB D;  2L9H A;  2TMP A;  2A6H C;  1PYW D;  2JYO A;  2WP8 J;  5TSS A;  1HQM C;  2F3W A;  4QB4 A;  1LTA D;  4TRD A;  2F0Q A;  1NR2 A;  1LT5 D;  1Y69 U;  4DN4 M;  1W6J A;  3D6W A;  4UDU C;  3VA5 A;  1JIC A;  1PFM A;  4IUR A;  2L0C A;  4KTA A;  3IAY A;  3J80 L;  1PRT B;  2ZXO A;  5CC4 A;  1KAA A;  1QWY A;  3WOE A;  1JWU D;  1TVX A;  2R3Z A;  5EKK A;  3VR3 A;  3KBG A;  5ELB A;  1BCP D;  4RH6 A;  2N55 A;  2ZT9 C;  2KOL A;  3AB9 A;  3HG9 A;  4C3H G;  3H94 A;  1BCP B;  1STG A;  3P20 A;  1GUT A;  3MXN A;  1S5D D;  1B53 A;  1LAC A;  1Y8P B;  4XQN A;  1BF4 A;  1ML0 D;  1ENF A;  3PV0 A;  3NBH A;  4KKS A;  3VR5 A;  1K83 B;  4RHS A;  5A2Q L;  1DOK A;  1EY5 A;  1WTR A;  2NTT A;  2NUC A;  3HOW B;  2XNA C;  1BXT A;  1JOK A;  4V19 0;  4ME5 A;  1R4Q B;  3FVQ A;  1LO5 D;  3NE5 B;  2XVS A;  1IKL A;  2FJ2 A;  2E75 C;  1G6Z A;  1LTB D;  5C0X G;  3GV6 A;  4KKU A;  2PZT A;  1HXY D;  1XX8 A;  2JA7 B;  3FMC A;  3T13 A;  2NVX B;  2CW0 D;  5M3M B;  3Q0A A;  4ZKC B;  5CR3 A;  4K2L A;  4ABN A;  1X32 A;  5BN5 A;  2L1B A;  3PUX A;  4BBS B;  1SJH D;  1QJO A;  3NBI A;  4C3J B;  3DM1 A;  5M5Y B;  5I9O A;  1CA5 A;  1TR5 A;  2R6G A;  4KKT A;  3S1M B;  1DJR D;  1BQQ T;  2N88 A;  1G2S A;  4KHZ A;  5JPN C;  2QKI C;  3SK6 A;  4I65 A;  5E1F A;  4K2K A;  5C6A A;  3ERO A;  1V1O A;  1G91 A;  4HMI A;  2DY7 A;  5I2Y A;  1MSG A;  3NTK A;  4K6L A;  4IFD H;  1EYD A;  3DEO A;  4HMJ A;  4CHT B;  5COR A;  1BO0 A;  4ODG A;  4ZQ3 A;  4DA2 A;  1NSN S;  2F0H A;  1GHJ A;  2VNU D;  2E2I B;  5JEA J;  3S16 B;  2VB2 X;  1D1K A;  2MUY A;  1XXG A;  3SEB A;  1K8M A;  1G29 1;  1TY2 A;  2NN6 G;  2K04 A;  2Z4I A;  2YYZ A;  1EU4 A;  1EYA A;  2B8F A;  2JSO A;  5HGT A;  1Y1W B;  2AQ2 B;  3G7L A;  3X3M A;  4OL7 A;  1XYI A;  2F0D A;  1BR9 A;  4HSP A;  4OO1 G;  3GD7 A;  2PW7 A;  2FIN B;  2LKV A;  4GZY C;  1GUO A;  5IGD A;  2AWO A;  3BVG A;  2IW3 A;  3IL8 A;  3LNN A;  4X3T A;  1FR3 A;  2PMZ B;  1DCZ A;  3HOY B;  3A56 A;  3I72 A;  4E6I A;  2IL8 A;  1TWG B;  3VYT A;  3JAM E;  1II3 A;  1F9Q A;  3J7Y W;  3HS0 C;  5D65 A;  4ZK9 B;  3R3O A;  4J6H A;  4DK0 A;  4LK1 C;  2NTS A;  1LTT D;  1FNW A;  1J9O A;  1EZ8 A;  1X3Q A;  3M3Y B;  1A3T A;  2KVM A;  2A68 D;  2EJG C;  4B9W A;  5KRU A;  2RDF A;  3MA2 B;  4TSS A;  2A74 C;  1B44 D;  1OXX K;  2B2W A;  1H9S A;  2MHV A;  3CKI B;  2TSS A;  5I2X A;  2AUJ D;  2XRQ D;  1AZQ A;  4RGN A;  1I4Q A;  4KJN A;  4EQO A;  4BY1 B;  5KYL A;  1SMY C;  5BN3 A;  4C3I B;  5T1G A;  1STE A;  1BOS A;  2BCO A;  4IFD G;  3DMU A;  2PCF B;  4H13 C;  2F0N A;  1EY7 A;  4KD3 A;  3MWY W;  2O2L D;  2XWJ B;  4FP5 D;  1HTL D;  3GTK B;  3BDO A;  1KDB A;  3OIP A;  3GTM B;  2E2J B;  4FNF A;  4QUC A;  5ELD A;  3T4A C;  2IX0 A;  3TSS A;  1RJT A;  1D5Z C;  3TP7 A;  2AWN A;  3C46 A;  2KA7 A;  3NPP A;  2IPK D;  2EYO A;  4PQX A;  5EGT A;  3VYU A;  1JOR A;  5IOC A;  3R2I A;  1DYQ A;  4RGT A;  2QCP X;  1E2Z A;  4DF7 A;  4XT3 B;  4FF1 A;  2F0V A;  3SDZ A;  5CV8 A;  4PMC A;  4CJ1 B;  3HKZ B;  1QIL A;  1PTO F;  3K5L A;  5ELC A;  4HR7 B;  3OMG A;  4XYO A;  4ID6 A;  3A8I E;  1FGB D;  4CKB A;  4IUU A;  1D1I A;  5C44 B;  3DXJ C;  1EQV A;  3KK7 A;  1FNU A;  3GTQ B;  1CI3 M;  4KI0 A;  2A6H D;  4LMQ D;  1YNJ D;  2ICI A;  1PRT F;  1B1Z A;  3QB3 A;  2LMC B;  1ONL A;  4JK1 C;  3NHH A;  3TZU A;  4KN7 C;  4MHE A;  5KNB A;  4IAL A;  4L63 B;  1TS5 A;  2EPB A;  2F0T A;  3M4O B;  1AW7 A;  4BY7 B;  3BDC A;  2LS0 1;  4MIU A;  2M2L A;  2F3V A;  4DNR B;  1G2T A;  3ND9 A;  1SBB B;  2EZV A;  1MGS A;  1BCP F;  1V8Q A;  2PYK A;  3ONA B;  2IX1 A;  3PUZ A;  2K32 A;  4IUP A;  1SNM A;  3GTL B;  3AU7 A;  2HUG A;  1KDC A;  5D3D A;  3W2D A;  1Q12 A;  4DGZ A;  3LWE A;  4DAP A;  1LAB A;  3V2T A;  5IT9 E;  4L6T B;  1EWH A;  4XQQ A;  1ZEQ X;  3I8Z A;  3QJY A;  5JOB A;  3CU7 A;  3L3O C;  4B9X A;  1Y8N B;  3SR1 A;  3VR2 A;  2EY1 A;  2GA4 B;  4I7Z C;  2SOB A;  2BDO A;  3I4L A;  1B3A A;  4ZLT F;  3A7A B;  4OIK A;  1TS4 A;  2Z8L A;  1QB5 D;  3CQZ B;  3VR4 A;  2B2T A;  4F7X A;  3Q6S A;  5T1I A;  1HTP A;  2D62 A;  3M4Y A;  1HHV A;  2I46 A;  5FLX E;  5DM6 3;  1OXU A;  3MXP A;  1ICW A;  1ENC A;  4N9T A;  3DWA A;  4U67 3;  4DXG A;  5CMD A;  3H91 A;  3IFT A;  3W3A A;  1SAP A;  3MHB A;  3GO5 A;  1A6X A;  1GOZ A;  2NB0 A;  5HUR A;  3Q23 A;  3HRZ C;  4FVM A;  4TKO B;  5CBA E;  4XQJ A;  3P7J A;  3S1R B;  1HRJ A;  4Y7N B;  4G4K A;  4KD4 A;  2RDH A;  1ZYR D;  2SNS A;  1Q1B A;  3KUP A;  3IFD A;  1ROD A;  2EXZ A;  1IKM A;  1CTM A;  3NWT A;  1NR4 A;  2XWB B;  4K6D A;  4F87 A;  3GV3 A;  4R8I A;  1HA6 A;  5I6Y A;  1WCM B;  2NVQ B;  2EYH A;  2CQA A;  5ISR A;  2WV6 D;  5DEH A;  2WKD A;  1A3U A;  1M8A A;  2EOT A;  5A35 A;  3DEP A;  1I3Q B;  4CGY B;  3R93 A;  1O78 A;  2A69 C;  2K1B A;  3TME A;  2EY5 A;  4H7B A;  3K6O A;  4A3I B;  2L5T A;  1CK1 A;  3F2U A;  3J80 E;  3C2P A;  1JQY D;  1Z7T A;  1SFO B;  1C8C A;  4A3G B;  1I6V C;  2WAC A;  1PRT D;  2EJF C;  3QO2 A;  2I07 B;  4K8J A;  3J81 L;  2QEJ C;  1OO9 B;  1SND A;  4V0B A;  2M00 A;  1EY6 A;  1TU2 B;  3WOF A;  4J8Q A;  3O13 A;  3IKJ A;  1KTK A;  1RD9 D;  3MAQ A;  3PUY A;  1SNO A;  3GTG B;  2Q8T A;  2IX3 A;  1S5F D;  4F8M A;  5FKA C;  2NN6 H;  3E6Z X;  1LTI D;  2WAQ B;  4KJO A;  5A2Q E;  5IGC A;  1H9M A;  4OO1 H;  1EU3 A;  1JOQ A;  3P1H A;  3PUV A;  3J7A F;  1PMR A;  4C3H B;  1B9N A;  3NK9 A;  4Q0F A;  1O7Z A;  1S5E D;  2RA4 A;  1U4P A;  2B39 A;  1LT4 D;  4XTC S;  3BS1 A;  4BS9 A;  3TP8 A;  1MD2 D;  2Z4H A;  2F03 A;  5EKI A;  2HDM A;  1EQT A;  2MPM A;  1R9T B;  4A3B B;  2R92 B;  3EVQ A;  2JEA I;  5J22 A;  1C4Q A;  1PFN A;  4WJW A;  2RVL A;  3FPU B;  3ITP A;  4DU9 A;  1TS3 A;  4NP5 A;  3TP6 A;  2A5H A;  2F0L A;  2VB3 X;  1LV9 A;  4QUF A;  1GXD C;  2PNR C;  1TII D;  3KLR A;  1DD2 A;  2KJX A;  3H3V C;  1IYU A;  3RD4 A;  1F9S A;  2K5Q A;  2E2H B;  1BBX C;  1SYC A;  1SMY D;  1KNA A;  1RTN A;  4RAU C;  2EVB A;  3ERQ A;  3HGB A;  2KUM A;  1SSO A;  5KGU A;  4RCN A;  1STB A;  3K58 A;  5JEA G;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...