2F0DA

Crystal structure of staphylococcal nuclease mutant i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0dA00
2PZWA 2EY1A 2F0UA 2F0EA 1STGA 2LKVA 2PZTA 3NHHA 4E6IA 4I65A 3TMEA 1A3UA 4KD4A 1TR5A 5HURA 4IZ8A 5CV4A 4ZUIA 3D4WA 4LAAA 4ZUJA 1SYGA 4OL7A 2OF1A 4EQPA 5CGKA 5I9OA 5I6YA 2F3VA 4HMJA 5J1ZA 4F7XA 3MEHA 2EY2A 4ID6A 4B9XA 2SNSA 2SOBA 3SXHA 3MZ5A 4K6DA 3ITPA 5C4ZA 5JAVA 1SYCA 1F2ZA 1KAAA 2EYPA 2F0DA 1STNA 4ME5A 4HTHA 2EY6A 1EY9A 1II3A 4IALA 3SK4A 2M00A 2PZUA 3DMUA 3TP8A 3NXWA 5CV7A 5CV6A 5KEEA 1JOQA 1EY0A 2F0FA 1EY5A 5J22A 1KDAA 4IUNA 1IHZA 1SNQA 1SNOA 2OXPA 4EQNA 4YIJA 1A3TA 4N9TA 4R8NA 1A2UA 3TP7A 2F0JA 5IGFA 4G57A 3ERQA 2F0LA 1EZ6A 5K5PA 3BDCA 4KY7A 4KJOA 3SR1A 3T13A 5CR3A 2EYFA 5IGDA 3C1FA 3OMGA 3SHLA 1AEXA 2F0HA 5KYIA 3EVQA 1SYDA 5M9OA 3NQTA 4TRDA 5C5LA 4B9WA 5C4HA 2EXZA 4J6HA 2WACA 3SK8A 3VA5A 2F0OA 2QDBA 1ENCA 2EYJA 2KQ3A 4EQOA 2F0IA 3P75A 2ENBA 5IIFA 1SYEA 1STHA 1EY7A 3U9OA 3OMCA 4QMGA 3V2TA 4DF7A 3MVVA 1A2TA 2HQEA 2PW5A 4PMCA 3MXPA 3SK5A 1EYCA 4WRDA 4DU9A 2F0NA 5NUCA 5JOBA 5C3XA 2F0SA 4WORA 4K2LA 5I9PA 4PNYA 3HEJA 4K8JA 4HMIA 1EQVA 3QOJA 1A3VA 1ENAA 4KJNA 5E1FA 3TP6A 3MHBA 3OSOA 1EYAA 1RKNA 1TT2A 1SNMA 2F0VA 3D8GA 4MIUA 5CV8A 2PW7A 4F8MA 5IGBA 3S9WA 3H6MA 1EY4A 4K5WA 2OEOA 2F0QA 3D4DA 5C5MA 5KGUA 2SNMA 4ZQ3A 3R3OA 2PYKA 4NP5A 5IGEA 3QB3A 2F0TA 5F2DA 4J1MA 3D6CA 4K14A 3DHQA 4KD3A 1JOKA 3OWFA 1STBA 3HZXA 5IOCA 5IODA 5CV5A 1EY6A 5HGTA 5DAUA 4K5VA 1SNPA 2F0KA 2F0MA 3NP8A 3NUCA 4KTAA 4KV6A 3NK9A 1SNDA 1F2YA 4NDXA 2NUCA 4NMZA 5EKKA 5I6WA 1KABA 1SNCA 1U9RA 1KDCA 1NSNS 2KHSA 2RKSA 4H7BA 1STYA 4K5XA 3SK6A 4EVOA 5KRUA 2F0GA 1SYFA 1F2MA 2EYHA 4KY5A 3BDLA 3P1HA 4NKLA 4QB4A 2F0PA 2F0WA 2PQEA 3LX0A 4S3SA 5KYLA 2F3WA 5DEHA 5ISRA 1JORA 5J39A 3C1EA 5CV9A 4RKBA 1STAA 2EYMA 3EJIA 5E3FA 4KY6A 3TP5A 5IGCA 2EYLA 5C6AA 3EROA 5IGGA 1JOOA 4ODGA 3QOLA 4RKLA 5EGTA 1NUCA 3PMFA 1EY8A 4KHVA 5CC4A 1EZ8A 1TQOA 2O4XA 4DFAA 2EYOA 2EY5A 2RDFA 3RUZA 4PMBA 3T16A 5KIXA 4K8IA 4QF4A 4K2KA 4N9PA 5EKLA 4DGZA 3E5SA 1SYBA 1KDBA 2RBMA 5C3WA 1EYDA
chains in the Genus database with same CATH superfamily
4FO2A 5EPJA 2KA7A 1CZGA 4B3MQ 4ZRZA 4FDBA 1JCKB 3M4PA 4JOIC 1N8RC 5EBDA 4OELB 4LF6Q 4OWWB 4ABNA 4R4OA 5FKAC 1FJGQ 1A0IA 1AN8A 1CKMA 3Q22A 1I3QH 2ZM6Q 2E2DC 2PCFB 1BBUA 1F2ZA 1SEBD 3CKIB 3UDFA 2KOLA 1S5BD 2M00A 3TP8A 3H15A 3K57A 3MTSA 2JA8G 4KLKA 4KN7C 3S2DB 2JP1A 1JJCB 3L2PA 1H95A 1GHJA 1B2TA 4DV0L 3IL8A 4G57A 1EZ6A 4LNQA 1H9MA 3ZJYC 4A3BB 3HS0C 5ELCA 1FNVA 3T1HQ 4AIMA 1PYWD 2OCEA 3WOFA 2F0OA 1D7QA 2F0IA 2L4NA 3CCQA 1UE1A 3OMCA 3X3MA 5M3MG 1T5EA 3TS2A 5M5XB 1W6JA 1YNJD 3F2DA 4K2LA 1SE2A 2VB2X 4IFDG 1N34L 4A3IG 1Q3LA 3D0FA 5E1FA 5BR8L 3BZDB 3W5OA 1B7YB 3OOCA 1DYQA 1HHVA 2JE6I 2ZT9C 3FVQA 3CCJA 5C0XG 2K1BA 2FFKB 2E2IH 1OXUA 4C3JH 1JT8A 3HZXA 1HZCA 2CW0D 3V96A 1I3QB 4XTCS 1SNDA 1VQ5A 2EJMA 1Z6HA 1CM9A 4LUZA 1ILPA 4R4IA 4LFCQ 2N8NA 1CI3M 1A6XA 1CQVA 4QB4A 4JI3L 3JAML 2NZHA 1SE4A 2VQFL 3PO2H 5C4XB 1MSHA 1YITA 3K6OA 4X64L 1JWMD 2E8GA 4CBVA 3J81i 3S16H 1D1KA 4BBRH 1M90C 3T16A 2LFNA 4PZ6A 3EQLC 4WJ3M 3M3YH 1RIPA 1SLJA 4DV4L 3GTLH 1E1TA 3E5SA 4RMFA 1YNNC 2L9HA 2MUYA 5DM73 5KNDA 2E74C 4XT3B 4KHPQ 3HGBA 1BDOA 4DKAC 4JBMA 1A3UA 2QEJC 4QIWE 1WD1A 3N6RA 4OL7A 5C4JH 1BNZA 2BH8A 2AMCB 4POGA 1EU3A 1M1KC 4AYBG 2B39A 1SAPA 2JJQA 2CVRA 1E1OA 1PRTD 2CH4A 3BS1A 4HCSA 4ME3A 4C3IB 1CFMA 4Y7NH 3JAME 2R92H 2VUMH 1ENFA 3S15H 2UUCQ 2OXPA 4HCEA 1XMQL 1Y1VG 1EIHA 3F1ZA 2ZXPA 4QUFA 3IFDA 1I6HH 4UDUC 3T13A 1SMXA 4C3JB 1EFWA 1YNXA 2R7ZH 1DZ1A 1J5EQ 1U4MA 2IHEA 3K7AH 5C5LA 2JA7H 3G48A 3G6JB 4JPBW 4YCWA 5C44G 2HD3A 1HNZL 1EOTA 2LS01 5C3XA 1EWHA 1JWSD 4LW1A 3HEJA 4JV5L 3PO2B 3W3AA 3K5NA 3M85A 5IT9c 1AFPA 4PV1C 2C35B 3OSOA 3ULJA 1EYGA 2F0VA 4C2MH 4FYDA 4RGOS 1E7ZA 5IYDH 1GD7A 4K5WA 2NTSA 3N52A 3MAQA 4X6AH 1F9QA 4DA2A 4LF8L 3M3YB 3R3OA 1NTGA 4KN4C 2Z8LA 3PUWA 4MN3A 1LTGD 3A74A 4H02A 4JI6L 4AQYQ 4P2CB 1CT1D 3EN2A 2YYZA 5C4JB 4KK7A 1S40A 1NSNS 1KNAA 2R7FA 1F2MA 3VR6A 2PI2A 1KLUD 2JA5H 3DXJC 1MKHA 4Y7NB 3S15B 3S1MB 4UY8C 1UUPA 3X3NA 1S72A 2IPKD 1HZBA 4DR2L 4B3ML 1IYJB 1E22A 3CMEA 5FJ8H 4OONA 4UAIA 4JI4L 5CORA 1CKNB 1TQOA 3M9BA 1Z9FA 3UDGA 1FJGL 1I6HB 4JVZA 3BVMA 4YWMA 3KFUA 4B3RL 4JCVE 2YV5A 3JC66 1SYBA 1QZHA 3T1YQ 1CZWA 3K7AB 2KHIA 5C3EG 1K3RA 2JA7B 2PMZB 2KEEA 4FXDA 5G3LD 1PTOB 5FK9C 3D4WA 2IWHA 4DV3Q 4UP9A 1G91A 3TEHB 5IWAQ 4OXPA 1B9MA 1B44D 1I4PA 1X65A 5EPKA 4C2MB 4DXGA 4GOPC 1YZ6A 4JI0Q 4QGUA 3LWUA 4Q0FA 3PV0A 3NE5B 3RN5A 2RCFA 1YHAA 4NPSA 3GV6A 2HT1A 4KHZA 3NQTA 3A5ZB 2EXZA 3GTPB 4A3JG 3A54A 4ZK9B 3P75A 1UNSA 4PMCA 1O7ZA 2HQEA 1I94L 2WB1B 4TKOB 1TKWB 4DR7Q 2UXCL 2NVXH 1XPOA 3E0JA 4YHHL 5CYUA 2JA8H 3TS0A 4JI2Q 4DR5Q 2PW7A 1A15A 5I2YA 1K8AC 5DNFA 1HNXL 1X3PA 1W3SA 1WCMG 2B2YA 3P20A 4A3BG 4XYQA 2HQLA 3CCLA 4JI8L 4JC0A 2KCTA 1SR3A 4LFCL 3NBIA 5IYCG 2R6GA 5CV5A 3FKIB 1QJOA 2RA4A 3BZKA 1MBYA 2EE1A 3ND8A 3NUCA 3NK9A 2L55A 4IOCA 1SNCA 1IXRA 1EEID 1ICFB 2D0OA 2K03A 1VQHA 4IFDH 4QUCA 4A3IH 1J6QA 1PZKD 4FVMA 3I91A 1N33Q 4RKBA 4DR6Q 4J15A 4X66Q 2LY7A 3NBHB 4DK6C 4BXXG 3VR4A 1EZ8A 1YBYA 5C0XH 3RUZA 2H5XA 2KEDA 4TSSA 4DGZA 1YJWA 4IUUA 2UXBQ 4BWGB 2K52A 1Q1BA 2EY1A 4OHJA 3OW7A 1MGSA 3TMEA 1AE3A 3J81L 3DEOA 2Z1CA 1E2VA 1VQFA 1SMYC 4EQPA 3A7AB 3VA7A 1IBKL 3AFQA 2NVXB 3TZDA 2ZTDA 2AQ3B 2EYPA 1EFID 3A55A 2JA8B 1BXTA 3I8ZA 2ES2A 5CV6A 4JBWA 2D62A 5KNBA 3RR5A 5T1GA 1O80A 3W1BA 4CHTB 1LV9A 3KLSA 3KJPA 3NWSA 1QZGA 1WTOA 1NBWA 1EWCA 4IURA 5M3MB 1V8QA 3E0EA 1LACA 3CHBD 1G6PA 3J81E 2PW5A 3HOXH 3SK5A 1EYCA 2ALYB 2K14A 4A3IB 2HIXA 5JOBA 4HIMA 1XNRQ 1WTQA 5JVG3 4HSPA 4GKJL 3QOJA 1CHPD 3OTOQ 5EQ0A 3MXUA 4BY7H 4MIUA 2D0PA 2PNRC 3M4YA 1PRTF 1IKLA 4POFA 1PH1A 2OEOA 1P16A 2YU9H 1Q12A 1XNQL 4LF9Q 3NBHA 3QB3A 4C3JG 1UE5A 2M9VA 1BBXC 2J7ZA 2A68D 1LTRD 3FDTA 1I4HA 3CXCA 4DV7L 3C2PA 1E0BA 4K5VA 1G8ZD 2OQKA 1BCPF 3G7LA 1I4QA 1HTLD 1Y14B 1LYLA 1SE8A 2F0GA 2H4OA 4KY5A 4IO9A 3ICEA 1SE3A 2OT2A 2B8GA 5M5WB 1WOCA 4V0BA 5ELOA 2PPBC 3EJIA 3PUXA 1WTVA 2JA6H 4BS9A 4BBRG 5EGTA 4ODGA 3QOLA 3PMFA 1TWHH 2A6HD 4A3LH 3C3LA 2RDFA 2R3ZA 1ML0D 3EIVA 1FL0A 4XT1B 3DWQA 3GD7A 2EJGC 2EPBA 4QY7A 4LUOA 3Q8DA 3CC7A 5CV4A 4ZUIA 2A19A 2B29A 3KF8A 4AYBB 1JC7A 4JI0L 3GTMB 4C3HG 3GTGB 2SNSA 1XPUA 3T51B 2QW7A 1GUTA 5COYA 2R92G 2VUMG 4DUZL 2VNUD 4BY7B 1VQEA 2YTYA 3NXWA 1AP0A 1JWUD 1HA6A 1B8AA 3HFZB 5JJZA 5CBEE 1HQRD 1Q46A 4EQNA 2YU9B 1QCBD 1FNUA 1D5MC 1NCVA 2R7ZG 3G6EA 4KY7A 1YHBA 3W2DA 2JN4A 2B2WA 2OQ0A 4V190 1K0SA 1AEXA 1SJHD 4R4CA 5C44B 2JQOA 4L6TB 4UPAA 3CQZH 4FF3A 2KQ3A 3RZOH 2CW0C 4B3SL 4LUVA 2J4XA 5G3LF 1EWIA 4RCNA 5IT9L 4C1NI 3KDFB 3CCRA 1BUVT 5M5YH 3NTIA 4IPCA 4DAPA 2JA6B 5IYDG 1TT2A 1C9OA 3FRPB 3VYUA 2IW3A 2NN6H 4DN4M 5IGBA 5L37A 3I73A 1M8AA 1TWHB 3H6MA 3K0XA 4K6LA 1E24A 2F0QA 2Q8RE 3URYA 1TIID 4G7OC 2ZTCA 3G4SA 2FJ2A 2QCPX 1SMYD 1DONA 5C0XJ 1SBBB 4A3DH 4DK1A 1YIJA 2XN9C 4A3JH 2UXDQ 5HGTA 3D6WA 3VYRA 1SNPA 3PUVA 4KV6A 2UUBL 3HOZH 5IP7H 3UE1A 3Q6SA 4DR6L 2JA5G 2RKSA 4MNOA 4X66L 1H9KA 1RJTA 1X6OA 3P1HA 3VYTA 3J7ZC 1DD2A 3H3VH 3BVGA 5J39A 5IT9E 1HUNA 4R4QA 1O7YA 1WCMH 4NXML 2ZJPA 4HJAA 2JXMB 3A7LA 4DFAA 1V9PA 1F9SA 4GZYC 4QF4A 4DV2Q 2CQOA 5IYCH 2Y0SE 1BCPC 4DAYB 2WKCA 2ZTEA 4HJ8A 2HHHL 2BDNA 3RZOB 4IZ8A 1PHJA 3OPOA 4LJZC 5I9OA 2P5ZX 3GP7A 1BQQT 5LMNL 5D3DA 3MA2B 4HN7A 2J0TD 1MIUA 4GNXC 2F0DA 2F4VL 3S24A 1CSPA 2NYZD 2EY6A 1ESRA 2R7DA 2Q2TA 4H0LC 2BOSA 2G9DA 1QOHA 4OEMB 1IHZA 4JI7L 1HZ9A 1I4XA 4BXXH 1L0YB 3HOVH 1R4QB 4HIDA 1WI5A 1EEFD 1PH5A 3F8TA 2Z6KA 3ND9A 3J81c 4A3JB 1A63A 4XQJA 1SYDA 1X3QA 1TS3A 2A1AA 1VDZA 3OTOL 1L2FA 1IL2A 1EUJA 1KD1C 5NUCA 3M7GA 1WYDA 1TWFB 4MHEA 2NTTA 2XNAC 4KJNA 2Q8TA 5BN3A 2KVMA 2K5WA 1WCMB 4F8MA 1CUKA 3OIQA 1EY4A 5IY0A 1Z47A 1TWCH 5BN4A 2YTVA 4JG2A 2AUJD 4QIWB 2E2HH 4JI5L 1XMOQ 1U0LA 1VQJA 4IPHA 3QG1A 2B2VC 5IODA 2VXWA 2F0MA 5ELFA 4OGQC 3CCVA 4DAYA 1PH8A 2DUDA 2H1EA 4K5XA 3CPWA 2NVTH 2B2TA 1SYFA 1XJVA 3PF4A 3PO3G 3ERSX 1PFSA 3CP0A 1CHQD 1FNWA 1GO3E 3CU7A 1Q86C 1BBWA 1ET9A 2AWOA 4DK0A 1LTSD 5AJ3L 5JVH3 3HOVB 1N36Q 1JOOA 1EY8A 2EXDA 2K75A 2KJXA 4DUYL 3A5UA 2R61A 1VQDA 3A8IE 4AH6A 2L1BA 2RBMA 3E9HA 4JOIA 2JA9A 1C4QA 2WAQE 1K9MC 2DJGC 4ZLTF 1ZKOA 1B70B 3NTHA 1QUQA 1JICA 3PIP3 3HKZG 4BA2I 2K04A 1VQ6A 1V1PB 3NWTA 4NXNQ 1KDAA 4HEDA 1OXVA 1T9HA 1TWCB 2TMPA 1A2UA 1LABA 5E4WC 2QA4A 2MJ8A 2KHJA 3D3RA 2RCNA 2EYFA 5IGDA 4IUTA 4B9WA 4DV1Q 1U4PA 3DWAA 2QDBA 3HOXG 3GO5A 1EY7A 4C3HH 2NVTB 2QDLA 4B3TQ 1L0WA 3S1RH 1PH6A 1MD2D 4WORA 3H0GH 4DNRB 4BY7G 3RN2A 4A3EG 5DLQE 2QF7A 3CW2C 2AKWB 3D8GA 4HJ5A 4RWSC 3HOWH 2IT1A 3DM1A 1BCPD 2UXDL 2E2IB 2VQEQ 4RCOA 1IBMQ 2L12A 1E2WA 2Y0SG 3BZCA 2A74C 2UU9Q 1VQ7A 3DHQA 4RAUC 3I4LA 1C7YA 4LF4Q 5KNCA 5LMUL 1ZYRD 4FXGC 1EIYB 2CQAA 1XXGA 1RODA 4H7BA 4EVOA 1Q8KA 4MTNA 3WDNA 4X65L 3RMHA 4DR4Q 4RA8A 2WV6D 3DM3A 2ASBA 2F0WA 2PQEA 3LX0A 4GKKQ 1KHIA 3S16B 2JA6G 4BBRB 4GN3B 3S14H 5ELEA 5CV9A 4RGTA 4ZKCB 4ALPA 3GTLB 3TP5A 1GHKA 1SJED 4A3LG 4TVAB 5FLXc 1V1PA 4IUPA 4KHVA 2EYOA 4YY3Q 2XGTA 5EJWA 2ICEC 3L7ZC 4X3UA 3PF5A 1EYDA 2V1CC 1N32Q 1MJCA 4I65A 1KRTA 5I2XA 3HOYH 4KD4A 1MI2A 4C3HB 2K5NA 1X56A 1LT5D 1LM0A 3S1RB 4A3KH 3ZYYX 1CSQA 4X3SA 2VUMB 1KIXA 2R92B 1JB3A 3F2CA 1TWAH 1NY4A 2XIWA 4P71A 4LF6L 1UE7A 3HOWB 1EY0A 3L3OC 5FO7B 1O7LA 2VS1A 3E6ZX 2ZM6L 2R7ZB 5JJLA 4XQNA 3TP7A 1PYBA 3A56A 4OWTB 5K5PA 4UHVA 5EAYA 3OWEB 5CR3A 1X3EA 3C1FA 1J8IA 2A68C 5JEAJ 3VA5A 5IIFA 4A3FH 2B8FA 2K05A 3LWEA 1SYEA 3PCOB 4HJ7A 2FMMA 2X69A 3T1HL 3KJOA 2M2LA 3SEBA 1Q8IA 3LGJA 1UEBA 1EQVA 4O2DA 2E76C 1Q81C 3S14B 2VW9A 2NN6G 5GAEC 1TS2A 2GA4B 3MFGA 1WFQA 4HSVA 1CA5A 4DV5Q 1PTOC 4GLXA 1PZJD 4OWXB 1HJPA 4BY1G 4OO1H 1D8LA 1F77A 4A3DG 2A6HC 2F1MA 1VQGA 2WAQG 3VR5A 1JQYD 2IX3A 3HOZG 3KUPA 3CCUA 2IL8A 4OX9Q 5IP7G 4DV6Q 1FGUA 2JA5B 3KLSX 4A3KB 4XDXA 4NMZA 3KF6A 1HA5A 3T4AC 1K8OA 3GDEA 1PZID 2A69C 3I70A 5KYLA 2PO4A 1JORA 1KTKA 3S1QH 5D14A 1WJJA 1K28A 1W6KA 2D9UA 2BDOA 3PGZA 2PZUA 3J80i 4I7AA 1YJ9A 1WD0A 3GTJH 1ONLA 1TS5A 1VQMA 1EIGA 3F2UA 1E2ZA 1SYGA 4RHRA 2NVQH 1TU2B 4NW2A 1A8VA 4F7XA 3PO3H 3MEHA 1C0AA 1S4ZA 4Y52H 2SOBA 2X6LA 2B63H 1STNA 4GOPA 4KHPL 1X3FA 3HOVG 3TBIB 2PMZE 2EIFA 4DR1Q 1LT6D 5CMDA 3DWPA 4DV1L 2K5VA 1RHPA 1Y1WG 1NNXA 3A0JA 3AMUA 4B3TL 4LFAQ 1K73C 3DLLA 1B9NA 2Z6BA 1X55A 5M9OA 2UUCL 4TQUS 3I56A 1I50H 4CDDC 4QL5A 4R4TA 1ENCA 1ZXTA 1SFOH 3U9OA 1GXDC 4Q5VA 2NZOA 1AW7A 1IKMA 3K7UC 2TSSA 2BA0A 4KKTA 5M3FH 1G6ZA 2F0SA 1IBML 1J5EL 4IFDI 2R93G 4CJ0B 5D3IB 3S1QB 4MZ9A 4RGNA 4X62Q 1ENAA 3TP6A 1FD7D 2DY8A 4IJHA 1QVFA 4KMUC 1D6EC 1EL0A 5JEAG 1HR0Q 3KF8B 1XTCD 5IYBH 2WB1E 5C0XI 1HR0W 2MO1A 1J9OA 4CKBA 1WTWA 4K14A 3R93A 3OWFA 4M1UB 4GKKL 3BU2A 4G7HC 1WVLA 3FP9A 2I07B 4G7ZC 2NVQB 3QWNA 3SK8A 3PO3B 4HAEA 1VQ9A 2VZAA 4BBSH 4A3GG 3STBC 1QG7A 5FO8B 3D31A 4ZCKA 1XYIA 3BDLA 4A3EH 4YY3L 4HIOA 2VL6A 4AQYL 2DN8A 1JJ2A 1N32L 5JJKA 4LF5Q 3S1NH 2PQAB 2JYOA 1D5ZC 2YTXA 1DJRD 4DNTB 4PMBA 2K50A 2ZJRA 3MXNB 2RF4A 2K33A 3IAYA 5GADC 3S2HH 1I50B 2F0EA 2LKVA 2VY3A 1SFOB 3GTQH 1IL8A 1ESFA 3M4OH 4HJ9A 4P75A 2MNAA 4X3KA 4A93G 4JBJA 1HH2P 3HKZB 4IJLA 2O5IC 3CCMA 1HFGA 4DV0Q 4KI0A 1VQ4A 5A2QL 3PIO3 3RNUA 1PTOD 3T1YL 3IRBA 4ME5A 3VDYA 1ASZA 1VQAA 4HTHA 2F4IA 1DOMA 5A35A 3G71A 1CK1A 2FXQA 5KEEA 2Z9HA 5J22A 2QILA 4FF2A 1B3AA 4N8X1 4DV3L 1A3TA 4N9TA 4IUVA 1S5ED 5IWAL 2LSSA 4YCVA 5FOBB 1GKHA 2EZVA 4A3CG 1Q90A 2K7VA 3QR8A 1HNWQ 1IW7C 5GAGC 1SXTA 3A8JE 3HOXB 3GTKH 1N34Q 5FO9B 2KECA 1QB5D 2GVBA 4TRDA 1UEAB 2A69D 2WACA 5ELNA 5BR8Q 2OTJA 2EYJA 1B1ZA 3JAMi 4FF1A 1GJXA 3H0GG 1UE6A 4DU9A 2BE5C 1VQOA 1CKOA 1DOKA 4A3EB 1PFNA 4JW0A 4K8JA 3HOWG 4IN3A 2AHOB 3K5LA 3CCSA 1HUMA 5DM63 1B53A 3CAMA 5CV8A 1EOVA 3S1NB 1ET6A 2Y0SB 4CJ2C 2E2JH 4OX9L 2ID0A 1PYSB 5I4DA 4WFN3 1LTLA 4DR7L 3RLOA 5JJIA 3I55A 2B3GA 2K28A 1L1OC 3S2HB 1K83H 2PQAA 1LT4D 3TSSA 3D6CA 4JI2L 3GTQB 4DR5L 2D5DA 2LXJA 4A3MH 3M4OB 3MXNA 2VQFQ 2K4KA 2F0KA 4NDXA 4OIKA 4X64Q 1DCZA 5EKKA 1D5XC 1UWVA 3S9WA 4XIGS 3SK6A 2K32A 3J7A5 2N55A 2SEBD 4DV4Q 2HIVA 4L5QA 4K0KQ 2V4DA 5FLXL 3CC4A 1V1OA 4ZKBB 3SDZA 4KY6A 4EQ5A 2HUGA 3V05A 5C6AA 1TWGH 3H91A 4BY1H 4RKLA 1D1IA 5T1IA 3I4NG 4APVA 2Q2HA 1W2BA 2EY5A 3QJYA 4ILWA 4J8QA 1NJIC 3SE0A 3GTKB 1RTNA 1N33L 3O13A 3HOYG 2AUKA 3W1GA 3CF5A 2WP8J 3NHHA 3I4OA 2F52A 4A3KG 3Q24A 3KBGA 1TR5A 1LO5D 4CKEA 1I4RA 1PRTB 2OF1A 2ZXOA 2AWNA 1XMQQ 2XRQD 1PH3A 2UXBL 1STEA 2QEXA 3ITPA 3J80L 1KAAA 4LFBQ 2LXKA 1EQQA 2XVSA 1KC8C 1B50A 4U673 2JSOA 3PUYA 4HIKA 3KK7A 1NR2A 4YWLA 1SNOA 1VMCA 1BCPB 1SN8A 5FLXE 2O5JC 1IYUA 2NN6I 1HFNA 1GOZA 1SSOA 2N88A 1HNZQ 1EQRA 3CQZB 4FP5D 1K83B 2O2LD 3BDOA 5J3BA 2CHBD 2BCOA 3U9SA 3STBD 1DOLA 5EKIA 4A3FG 2F03A 3HOUH 1QE6A 1RCVD 5M5YB 3AFPA 4DF7A 3MVVA 4JBKA 1ZYRC 4PMWA 4H44C 1GUWA 4LF8Q 1NMFA 2ZJQA 5HY6A 2F3IA 1PV4A 1K0RA 1I5FA 2Q2UA 1VQPA 3H3VI 1EYAA 1TWGB 5ELDA 4BY1B 3AU7A 2EDGA 4OO1G 4RH6A 1H9RA 2IX0A 4A3DB 1Y1WH 2WAQB 1XNRL 3TREA 3HOZB 3L9AX 5F2DA 4CGYB 1QUQB 4QJFA 4CDFC 3UI2A 5FLMG 1Q82C 3NP8A 1PH2A 2ATWA 1C8CA 4DR2Q 1BKBA 4LF9L 1VF5C 1X32A 4LF5L 5KRUA 4JI4Q 2WFWA 2R93H 3ER0A 2IY5B 1KXLA 4B3RQ 2HCIA 2F3WA 3NSWA 3S17H 4XYOA 1STAA 2EYMA 1ASYA 1TVXA 1IZ6A 1IW7D 1PFMA 2IX1A 5JEAH 4O1NA 1S3OA 1I4GA 3NEMA 2C5CA 5C4XH 2O4XA 4QCLA 5KIXA 3J7AF 3H3VC 2BE5D 2F0UA 2PZTA 3AQQA 2RHQB 3HOUB 5HURA 1F9PA 4A3GH 4O42A 4DNIA 2MGSA 3H94A 3RLNA 1SROA 3U50C 2A5HA 1G51A 1LTID 5J1ZA 4GNXA 2B63G 3GTOH 2EY2A 4B9XA 2A73B 1AE2A 5C4ZA 3MZ5A 4IUQA 3UDXA 1OTCA 1HQMC 1EY9A 4IALA 2PNHA 3TZUA 1HNWL 5CV7A 1JMCA 1EQTA 2RSNA 4EX5A 1Q1EA 1Y1WB 1AH9A 3LNNA 3CRLC 4C3IH 2WIIB 2KCNA 3SGIA 3CC2A 4MTKA 1VF7A 1I94Q 4KJOA 2I5MX 2UXCQ 1WTXA 4YHHQ 1VQCA 2FHTA 4EQOA 4A93H 2ENBA 4F88A 5M3FG 1GVPA 1RDPD 2VB3X 1R9TH 1HNXQ 2R93B 2OWOA 3R2IA 2UUAQ 4RG1A 5I9PA 4PNYA 1MHWC 1YEZA 3S17B 1M4VA 2AQ2B 2Z0SA 3UDIA 5K36H 1PH7A 2I0QA 4JI8Q 2E2HB 3SVMA 1SNMA 2EJFC 1PTOF 5IYBG 4C1NK 2B2VA 4A3CH 3I4MG 4KKSA 3CRKC 4P74A 2RQXA 1K8GA 4QQBX 4J1MA 1G2SA 1DGSA 3BYTB 5IOCA 3C46A 1GM5A 4A3GB 4BBSG 4K0KL 3HG9A 3GTOB 1F2YA 4JYAQ 3WOEA 3OW2A 3ULPA 1U9RA 3KYHC 2OTLA 3K59A 4LF7Q 4GS3A 3NENA 4M8AA 1LTTD 1AZPA 5E3FA 1NMGA 2RSOA 4DK3C 3A8KE 2NB0A 3Q0AA 2I5HA 4C56C 4YWKA 5BN5A 1LLRD 3S1MH 1RL2A 2L5TA 4K2KA 1IBKQ 1VQLA 2PZWA 1STGA 4E6IA 4LFBL 4X3TA 4JI1Q 4A93B 2DNEA 1X3GA 1XPRA 1VQKA 1YJNA 1Y8PB 3K5MA 2KCMA 1R9TB 4NB3A 2A8VA 1QNUA 1BOSA 5CBAE 2CFMA 4DV2L 4ID6A 4CKCA 4K6DA 3MEFA 2XWBB 3HKSA 1PTOH 2LMCB 3WWVA 2CKZB 1KLGD 2F0FA 1VQ8A 4IUNA 1IYVA 1QVGA 3K81C 3I4NH 4YCUA 1JJGA 1HZAA 3ERQA 3KF6B 2MQHA 3BDCA 3F2BA 3K0YA 3Q23A 3J7AV 3MC0B 3H09A 3SHLA 4GKJQ 3TRZA 4L63B 5C4HA 3VR2A 3H0GB 1STHA 3V2TA 1LTBD 1QNKA 3EA6A 3J80c 4RFBA 2XWJB 1XNQQ 3GTPH 4GN4B 1BO0A 1OXSC 1SRUA 1A3VA 1G291 2PI2E 3TN2A 2JEBI 1VQBA 2KUMA 5JPMC 4DV7Q 4DR3Q 5LL6X 1Y69U 1LT3D 5KGUA 1YVCA 3TDQA 1PDQA 2PYKA 4L8JA 2E75C 1BR9A 3PIPA 3FPPA 4A3MG 3OYYA 2B2YC 2BH2A 4KD3A 2K01A 1WTRA 3K5OA 5D65A 4GOPB 5DAUA 2FMCA 4KTAA 5I6WA 4LWCA 5AFWA 2KHSA 1S5FD 1XMOL 3CD6A 3FKIH 2DNCA 3J81j 4A76A 1S5CD 3I72A 4NKLA 1Y8OB 5IP9H 2AQ1B 1C48A 4R8IA 4CDCC 5ISRA 3C1EA 3I4NB 5IGCA 3PSIA 4R1JA 1QILA 5IGGA 1NUCA 1CQFA 2G5DA 2MHVA 3HOYB 2G9HD 5ELBA 1KDBA 5DEHA 5FLMH 1RF2D 4FXKC 1KRSA 4DUZQ 3UE0A 1N36L 1TWAB 2QGQA 1FGBD 2A6EC 1YI2A 4A4IA 3OIPA 4ZYSA 1KNEA 2CCZA 2Z4HA 4DPGA 3GQBA 1II3A 2MP1A 1EY5A 4BA1I 1K8MA 1SNQA 3B6YA 1GUSA 3TQYA 4GN5A 4R8NA 4XXEA 1KL9A 3HP3A 3T56B 2ZXRA 4B3SQ 2KBNA 1OO9B 4OO1I 1YNND 4A3FB 3I90A 4DAMA 2UUAL 5GQOA 2X6GA 4KKUA 4NXNL 2F0HA 3HOUG 3EVQA 5E4XA 1V43A 2EVBA 1CKNA 3AYHB 1H9JA 4XQQA 1FVIA 1IBLQ 1P8LA 3PUZA 3MXPA 2NWGA 2F0NA 4G4KA 5TSSA 2NVYH 2Z4IA 5M3MH 1NAPA 4PZ7A 2RDGA 1FYCA 1O7IA 2C9OA 2E5LQ 3EFXD 3E9IA 1SDFA 1LTAD 4DXFA 5IE8A 2BA1A 2L11A 1QVCA 1D2BA 2MPMA 3P7JA 2UUBQ 2FINB 5C5MA 1S5DD 4JYAL 2D2CC 1FR3A 2DGYA 3CPFA 1UAPA 1GUOA 2F0TA 3ONAB 4LF7L 3FEWX 1STBA 2JEAI 4WJWA 1U4RA 2VQEL 2EQSA 2HDMA 4IOAA 1KABA 4PG3A 1KDCA 3T53B 2CWAA 4NXMQ 1PMRA 2HCCA 1F9RA 2UU9L 3KLRA 4LF4L 1MSGA 2N49A 1U4LA 3JAMc 2RDHA 4L5TA 4P72A 2EYLA 5C4XG 5JPNC 2HHHQ 4JI1L 2NZ1D 5M5WH 2HDLA 2Q8IB 1N9WA 3GTJB 1HPCA 3I4MH 2K5HA 4DR4L 2RVLA 1G2TA 1R4PB 4ZAIA 4K8IA 5LMNQ 1H9SB 5LMNW 1KQSA 2F4VQ 1JB7A 1VS0A 2B63B 1YHQA 5CGKA 4JI7Q 2IJ0A 2NVYB 3NELA 3SXHA 3VYSA 1SYCA 4H13C 4CJ1B 5GROA 1TXYA 3BJUA 1NE3A 2MFIA 3RD4A 1JOQA 3GTMH 3BYYB 5H1SE 3GTGH 1OXXK 4C3IG 1VQIA 4YIJA 3U58A 1QWYA 3K8AA 1RD9D 3GV3A 2F0LA 4N8FA 5E7NA 1PVOA 1Y1VH 4EGVA 4CDEC 1PLFA 3OMGA 5KYIA 4LMQD 1ZEQX 4GLAC 5M3FB 1NR4A 1RTOA 1XTDA 2K5DA 1VQNA 2B2WC 1GUGA 1VCIA 1TS4A 3CMAA 3AB9A 5I6YA 4DR3L 5C44H 1WTHA 5K36G 2GN5A 2N78A 2I46A 2I5LX 2EOTA 4JI5Q 4F87A 2CWPA 3I2ZA 1BF4A 3MHBA 3J7YW 3PO2G 1RKNA 3MWYW 4FF4A 2L0CA 1CA6A 3I4MB 3RZDH 2MO0A 1X54A 2L15A 1F2LA 2SNMA 5IGEA 2WKDA 3K80C 2A6ED 4U68A 3HRZC 1A62A 4BBSB 3KBXA 2B2UC 1PH9A 1ICWA 4DV5L 2RHSB 5HGQA 1H9SA 2GVAA 5AJ3Q 4UP7A 1L0XB 1STYA 1Q7YC 2K6AA 5A2QE 2EYHA 4DUYQ 3DEPA 3PQIA 5EBCA 3K58A 4DV6L 1GUNA 3U4VA 3NQIA 1L1OB 3BVZA 3I3CA 1XWEA 1OXTA 1DXMA 1YNJC 3BG3A 1JE4A 3M4QA 1X9NA 1PXUA 2N3SA 3FMCA 1Y1VB 4JI3Q 2DJFC 4B08A 2Q2IA 3L0OA 4N9PA 5EKLA 4DAVA 1HRJA 2ICIA 1CTMA 5C3WA 3FPUB 1K3BC 2WINB 1DM0B 4UP8A 4RGMA 3M7NA 5C3EH 2XRSD 4WJ4A 4LAAA 4ZUJA 2JA7G 2K5QA 3VR3A 2F3VA 4HMJA 1AZQA 2CH4W 1HCZA 5JAVA 2XSCA 1KAWA 1V1QA 3D4RA 3U4ZA 1Y8NB 3SK4A 3DMUA 4A75A 4IPGA 3RZDB 3IKJA 4FNFA 3AEVA 4IFDJ 4LK1C 1JE5A 2F0JA 1TY0A 3HKZE 3NTKA 3OHXC 1IBLL 3KLWA 4ULLA 3SR1A 4HR7B 3IFTA 1B3QA 3DUZA 4IQZA 4RHSA 4DR1L 3MXGA 3CCEA 2B2UA 3R8BA 4J6HA 2Z6KC 4PQXA 3RLFA 2E5LL 4L5RC 5GAHC 1I6VC 4QMGA 2IHFA 1A2TA 4LFAL 1WTPA 5LL6S 2QKIC 1TY2A 4OIJA 2E2JB 1JR0D 1VMPA 4HMIA 2KENA 2WB1G 2KCCA 3QIAA 1BVSA 4AYBE 2XTIA 4GLVB 1U5KA 4IPDA 1HXYD 1E3PA 3S2DH 5LMUQ 2JK8A 1PRTC 1TWFH 1PH4A 1L1OA 3D4DA 2DY7A 5FJ8G 4ZQ3A 4A3MB 1LUZA 4JV5Q 1ILQA 1PFBA 4NP5A 3MFYA 4GNXB 3PIOA 4X62L 4X65Q 4A3BH 1B4OA 1JOKA 4L5SA 5C3EB 2SDFA 1EY6A 3QO2A 2NUCA 3R2TA 1HR0L 3FKIG 3E3XA 5IGFA 5IP9G 3J80E 1PA6A 1T5XD 1HTPA 5M5XH 4JI6Q 2F0PA 5EPLA 4R9WA 2B2TC 4S3SA 1XX8A 2NBFA 4O0AA 5LHY1 4Z9CB 4I7ZC 1MJEA 3KOJA 4P73A 4PZ8A 3EROA 3I7FA 5CC4A 4JK1C 3NPPA 1EU4A 3KDFA 1Z7TA 3EBEA 1EIFA 3FHWA 1O78A 3ULLA 4WRDA
chains in the Genus database with same CATH topology
4FO2A 5EPJA 2KA7A 1CZGA 4ZRZA 1JCKB 5EBDA 4ABNA 5FKAC 1AN8A 3Q22A 2E2DC 2PCFB 1F2ZA 1SEBD 3CKIB 2KOLA 1S5BD 2M00A 3TP8A 3K57A 3MTSA 4KN7C 3S2DB 2JP1A 1GHJA 1B2TA 3IL8A 4G57A 1EZ6A 1H9MA 4A3BB 3HS0C 5ELCA 1FNVA 1PYWD 3WOFA 2F0OA 2F0IA 2L4NA 3OMCA 3X3MA 1T5EA 5M5XB 1W6JA 1YNJD 4K2LA 1SE2A 2VB2X 4IFDG 1Q3LA 5E1FA 3BZDB 3OOCA 1DYQA 1HHVA 2JE6I 2ZT9C 3FVQA 5C0XG 2K1BA 2FFKB 1OXUA 3HZXA 2CW0D 3V96A 1I3QB 4XTCS 1SNDA 2EJMA 1Z6HA 1CM9A 1ILPA 1CI3M 1A6XA 1CQVA 4QB4A 3JAML 1SE4A 5C4XB 1MSHA 3K6OA 1JWMD 4CBVA 1D1KA 3T16A 2LFNA 3EQLC 3E5SA 5KNDA 1YNNC 2L9HA 2MUYA 5DM73 2E74C 4XT3B 3HGBA 1BDOA 1A3UA 2QEJC 1WD1A 3N6RA 4OL7A 1BNZA 1EU3A 2B39A 1SAPA 2CVRA 1PRTD 3BS1A 4HCSA 4C3IB 1CFMA 3JAME 1ENFA 2OXPA 4HCEA 1EIHA 2ZXPA 4QUFA 3IFDA 4UDUC 3T13A 4C3JB 1DZ1A 1U4MA 5C5LA 3G6JB 1EOTA 2LS01 5C3XA 1EWHA 1JWSD 3HEJA 3PO2B 3W3AA 3K5NA 3M85A 1AFPA 4PV1C 3OSOA 4FYDA 2F0VA 4RGOS 4K5WA 2NTSA 3N52A 3MAQA 1F9QA 4DA2A 3M3YB 3R3OA 4KN4C 2Z8LA 3PUWA 4MN3A 1LTGD 4P2CB 1CT1D 5C4JB 2YYZA 4KK7A 1NSNS 1KNAA 1F2MA 3VR6A 1KLUD 3DXJC 4Y7NB 3S15B 3S1MB 1UUPA 3X3NA 2IPKD 4UAIA 5CORA 1TQOA 1I6HB 3BVMA 1SYBA 1CZWA 3K7AB 2JA7B 2PMZB 2KEEA 4FXDA 5G3LD 1PTOB 5FK9C 3D4WA 2IWHA 1G91A 1B9MA 1B44D 1I4PA 5EPKA 4C2MB 4DXGA 3LWUA 4Q0FA 3PV0A 3NE5B 3GV6A 4KHZA 3NQTA 2EXZA 3GTPB 3A54A 4ZK9B 3P75A 1UNSA 4PMCA 1O7ZA 2HQEA 2WB1B 4TKOB 1TKWB 3E0JA 5CYUA 2PW7A 1A15A 5I2YA 5DNFA 1X3PA 2B2YA 3P20A 4XYQA 3NBIA 2R6GA 5CV5A 3FKIB 1QJOA 2RA4A 1MBYA 2EE1A 3ND8A 3NUCA 3NK9A 2L55A 1SNCA 1EEID 2K03A 4IFDH 4QUCA 1PZKD 4FVMA 3I91A 4RKBA 2LY7A 3VR4A 1EZ8A 5C0XH 3RUZA 2KEDA 4TSSA 4DGZA 4IUUA 4BWGB 1Q1BA 2EY1A 4OHJA 3OW7A 1MGSA 3TMEA 3J81L 3DEOA 2Z1CA 1E2VA 4EQPA 1SMYC 3A7AB 3VA7A 2NVXB 3TZDA 2AQ3B 2EYPA 1EFID 3A55A 2JA8B 1BXTA 3I8ZA 5CV6A 4JBWA 2D62A 5KNBA 5T1GA 1O80A 4CHTB 1LV9A 3KLSA 3NWSA 1WTOA 1EWCA 4IURA 5M3MB 1V8QA 1LACA 3CHBD 3J81E 2PW5A 3SK5A 1EYCA 4A3IB 5JOBA 1WTQA 5JVG3 4HSPA 3QOJA 1CHPD 5EQ0A 3MXUA 4MIUA 2PNRC 3M4YA 1PRTF 1IKLA 2OEOA 1Q12A 3NBHA 3QB3A 4C3JG 2M9VA 1BBXC 2J7ZA 2A68D 1LTRD 3FDTA 1I4HA 3C2PA 1E0BA 4K5VA 1G8ZD 1BCPF 3G7LA 1I4QA 1HTLD 2F0GA 2H4OA 4KY5A 1SE3A 2OT2A 2B8GA 5M5WB 4V0BA 2PPBC 3EJIA 3PUXA 1WTVA 4BS9A 5EGTA 4ODGA 3QOLA 3PMFA 2A6HD 3C3LA 2RDFA 2R3ZA 1ML0D 4XT1B 3DWQA 3GD7A 2EJGC 2EPBA 5CV4A 4ZUIA 3KF8A 4AYBB 1JC7A 3GTMB 4C3HG 3GTGB 2SNSA 3T51B 1GUTA 5COYA 2VNUD 4BY7B 3NXWA 1AP0A 1JWUD 1HA6A 5JJZA 5CBEE 1HQRD 4EQNA 2YU9B 1QCBD 1FNUA 1D5MC 1NCVA 4KY7A 3W2DA 2B2WA 4V190 1AEXA 1SJHD 5C44B 4L6TB 4FF3A 2KQ3A 2CW0C 2J4XA 5G3LF 4RCNA 5IT9L 4C1NI 1BUVT 3NTIA 4DAPA 2JA6B 1TT2A 3VYUA 3FRPB 2IW3A 2NN6H 4DN4M 5IGBA 3I73A 1M8AA 1TWHB 3H6MA 4K6LA 2F0QA 2Q8RE 3URYA 1TIID 4G7OC 2FJ2A 2QCPX 1SMYD 1DONA 5C0XJ 1SBBB 4DK1A 2XN9C 5HGTA 3D6WA 3VYRA 1SNPA 3PUVA 4KV6A 3Q6SA 2RKSA 1H9KA 1RJTA 3VYTA 3P1HA 1DD2A 3BVGA 5J39A 5IT9E 1HUNA 1O7YA 2JXMB 3A7LA 4DFAA 1F9SA 4GZYC 4QF4A 1BCPC 2WKCA 3RZOB 2BDNA 4IZ8A 3OPOA 4LJZC 5I9OA 3GP7A 1BQQT 5D3DA 3MA2B 4HN7A 2J0TD 2F0DA 2NYZD 2EY6A 1ESRA 4H0LC 2BOSA 2G9DA 1QOHA 1IHZA 1I4XA 1L0YB 1R4QB 1EEFD 3ND9A 4A3JB 4XQJA 1SYDA 1X3QA 1TS3A 1VDZA 5NUCA 3M7GA 1TWFB 4MHEA 2NTTA 2XNAC 4KJNA 2Q8TA 5BN3A 2KVMA 2K5WA 1WCMB 4F8MA 3OIQA 1EY4A 1Z47A 5BN4A 2AUJD 4QIWB 3QG1A 2B2VC 5IODA 2VXWA 2F0MA 5ELFA 4OGQC 4DAYA 2H1EA 4K5XA 2B2TA 1SYFA 1CHQD 1FNWA 3CU7A 1ET9A 2AWOA 4DK0A 1LTSD 5JVH3 3HOVB 1JOOA 1EY8A 2KJXA 2R61A 3A8IE 2L1BA 2RBMA 1C4QA 4ZLTF 1ZKOA 3NTHA 1JICA 3PIP3 4BA2I 2K04A 1V1PB 3NWTA 1KDAA 4HEDA 1OXVA 1TWCB 2TMPA 1A2UA 1LABA 5E4WC 2MJ8A 3D3RA 2EYFA 5IGDA 4IUTA 4B9WA 1U4PA 3DWAA 2QDBA 3GO5A 1EY7A 2NVTB 1MD2D 4WORA 4DNRB 2QF7A 3D8GA 4RWSC 2IT1A 3DM1A 1BCPD 2E2IB 4RCOA 2L12A 1E2WA 2A74C 3DHQA 4RAUC 3I4LA 5KNCA 1ZYRD 4FXGC 2CQAA 1XXGA 1RODA 4H7BA 4EVOA 3WDNA 3RMHA 4RA8A 2WV6D 2F0WA 2PQEA 3LX0A 3S16B 4BBRB 5ELEA 5CV9A 4RGTA 4ZKCB 3GTLB 3TP5A 1GHKA 1SJED 1V1PA 4IUPA 4KHVA 2EYOA 5EJWA 2ICEC 3L7ZC 4X3UA 1EYDA 4I65A 5I2XA 4KD4A 1MI2A 4C3HB 1LT5D 3S1RB 3ZYYX 4X3SA 2VUMB 2R92B 1JB3A 2XIWA 3HOWB 1EY0A 3L3OC 5FO7B 1O7LA 3E6ZX 2R7ZB 4XQNA 3TP7A 3A56A 5K5PA 3OWEB 5CR3A 3C1FA 1J8IA 2A68C 5JEAJ 3VA5A 5IIFA 2B8FA 2K05A 3LWEA 1SYEA 2FMMA 2X69A 2M2LA 3SEBA 1Q8IA 1EQVA 3S14B 2E76C 2NN6G 1TS2A 2GA4B 3MFGA 4HSVA 1CA5A 1PTOC 1PZJD 4OO1H 1F77A 2A6HC 2F1MA 3VR5A 1JQYD 2IX3A 3KUPA 2IL8A 2JA5B 3KLSX 4A3KB 4XDXA 4NMZA 1HA5A 3T4AC 1K8OA 1PZID 2A69C 3I70A 5KYLA 2PO4A 1JORA 1KTKA 5D14A 1W6KA 2D9UA 2BDOA 2PZUA 1WD0A 1ONLA 1TS5A 1EIGA 3F2UA 1E2ZA 1SYGA 4RHRA 1TU2B 4NW2A 4F7XA 3MEHA 1S4ZA 2SOBA 2X6LA 1STNA 3TBIB 1LT6D 5CMDA 3DWPA 1RHPA 3AMUA 1B9NA 5M9OA 4TQUS 1ENCA 1ZXTA 3U9OA 1GXDC 4Q5VA 1AW7A 1IKMA 2TSSA 2BA0A 4KKTA 1G6ZA 2F0SA 4IFDI 4CJ0B 5D3IB 3S1QB 4RGNA 1ENAA 3TP6A 1FD7D 2DY8A 4KMUC 1D6EC 1EL0A 5JEAG 1XTCD 5C0XI 1J9OA 4CKBA 1WTWA 4K14A 3R93A 3OWFA 4M1UB 4G7HC 1WVLA 2I07B 4G7ZC 2NVQB 3QWNA 3SK8A 3PO3B 4HAEA 1QG7A 5FO8B 3D31A 1XYIA 3BDLA 2DN8A 2JYOA 1D5ZC 1DJRD 4DNTB 4PMBA 2K33A 3IAYA 1I50B 2F0EA 2LKVA 1SFOB 1IL8A 1ESFA 4X3KA 3HKZB 2O5IC 1HFGA 4KI0A 5A2QL 3PIO3 1PTOD 4ME5A 4HTHA 2F4IA 1DOMA 5A35A 1CK1A 5KEEA 5J22A 2QILA 4FF2A 1B3AA 1A3TA 4N9TA 4IUVA 1S5ED 5FOBB 2EZVA 1Q90A 2K7VA 1IW7C 1SXTA 3A8JE 3HOXB 5FO9B 2KECA 1QB5D 4TRDA 1UEAB 2A69D 2WACA 2EYJA 1B1ZA 4FF1A 1GJXA 4DU9A 2BE5C 1DOKA 4A3EB 1PFNA 4K8JA 4IN3A 3K5LA 1HUMA 5DM63 1B53A 5CV8A 3S1NB 1ET6A 2Y0SB 4CJ2C 2ID0A 5I4DA 4WFN3 2K28A 3S2HB 1LT4D 3TSSA 3D6CA 3GTQB 2D5DA 3M4OB 3MXNA 2F0KA 4NDXA 4OIKA 1DCZA 5EKKA 1D5XC 3S9WA 4XIGS 3SK6A 2K32A 2N55A 2SEBD 2V4DA 5FLXL 1V1OA 4ZKBB 3SDZA 4KY6A 2HUGA 3V05A 5C6AA 3H91A 4RKLA 1D1IA 5T1IA 2EY5A 3QJYA 4ILWA 4J8QA 3SE0A 3GTKB 1RTNA 3O13A 2AUKA 2WP8J 3NHHA 3Q24A 3KBGA 1TR5A 1LO5D 4CKEA 1I4RA 1PRTB 2OF1A 2ZXOA 2AWNA 2XRQD 1STEA 3ITPA 3J80L 1KAAA 2XVSA 1B50A 4U673 2JSOA 3PUYA 3KK7A 1NR2A 1SNOA 1VMCA 1BCPB 5FLXE 2O5JC 1IYUA 2NN6I 1HFNA 1GOZA 1SSOA 2N88A 3CQZB 4FP5D 1K83B 2O2LD 3BDOA 2CHBD 2BCOA 3U9SA 1DOLA 5EKIA 2F03A 1QE6A 1RCVD 5M5YB 4DF7A 3MVVA 1ZYRC 4PMWA 4H44C 1GUWA 1EYAA 1TWGB 5ELDA 4BY1B 3AU7A 2EDGA 4OO1G 4RH6A 1H9RA 2IX0A 4A3DB 2WAQB 3HOZB 3L9AX 5F2DA 4CGYB 3UI2A 3NP8A 1C8CA 1VF5C 1X32A 5KRUA 2HCIA 2F3WA 3NSWA 4XYOA 1STAA 2EYMA 1TVXA 1IW7D 1PFMA 2IX1A 5JEAH 4O1NA 1I4GA 2C5CA 2O4XA 4QCLA 5KIXA 3J7AF 3H3VC 2BE5D 2F0UA 2PZTA 3HOUB 5HURA 1F9PA 4O42A 2MGSA 3H94A 2A5HA 1LTID 5J1ZA 2EY2A 4B9XA 2A73B 5C4ZA 3MZ5A 4IUQA 1HQMC 1EY9A 4IALA 3TZUA 5CV7A 1EQTA 2RSNA 1Q1EA 1Y1WB 3LNNA 3CRLC 2WIIB 2KCNA 1VF7A 4KJOA 1WTXA 2FHTA 4EQOA 2ENBA 4F88A 1RDPD 2VB3X 2R93B 3R2IA 5I9PA 4PNYA 3S17B 1M4VA 2AQ2B 5K36H 2E2HB 3SVMA 1SNMA 2EJFC 1PTOF 4C1NK 2B2VA 4KKSA 3CRKC 2RQXA 4J1MA 1G2SA 3BYTB 5IOCA 3C46A 4A3GB 3HG9A 3GTOB 1F2YA 3WOEA 1U9RA 3K59A 4M8AA 1LTTD 1AZPA 5E3FA 2RSOA 3A8KE 2NB0A 3Q0AA 5BN5A 1LLRD 2L5TA 4K2KA 2PZWA 1STGA 4E6IA 4X3TA 4A93B 2DNEA 1Y8PB 3K5MA 1R9TB 1QNUA 1BOSA 5CBAE 4ID6A 4CKCA 4K6DA 2XWBB 1PTOH 2LMCB 1KLGD 2F0FA 4IUNA 1IYVA 3ERQA 3BDCA 3K0YA 3Q23A 3J7AV 3MC0B 3H09A 3SHLA 4L63B 5C4HA 3VR2A 3H0GB 1STHA 3V2TA 1LTBD 1QNKA 3EA6A 4RFBA 2XWJB 1BO0A 1OXSC 1A3VA 1G291 3TN2A 2JEBI 2KUMA 5JPMC 5LL6X 1Y69U 1LT3D 5KGUA 3TDQA 1PDQA 2PYKA 4L8JA 2E75C 1BR9A 3FPPA 2B2YC 4KD3A 2K01A 1WTRA 3K5OA 5D65A 5DAUA 2FMCA 4KTAA 5I6WA 5AFWA 2KHSA 1S5FD 2DNCA 1S5CD 3I72A 4NKLA 1Y8OB 2AQ1B 1C48A 4R8IA 5ISRA 3C1EA 3I4NB 5IGCA 1QILA 5IGGA 1NUCA 1CQFA 2MHVA 3HOYB 2G9HD 5ELBA 1KDBA 5DEHA 1RF2D 4FXKC 1TWAB 1FGBD 2A6EC 3OIPA 4ZYSA 1KNEA 2Z4HA 3GQBA 1II3A 2MP1A 1EY5A 4BA1I 1K8MA 1SNQA 1GUSA 4R8NA 4XXEA 3HP3A 3T56B 2ZXRA 1OO9B 4OO1I 1YNND 4A3FB 3I90A 2X6GA 4KKUA 2F0HA 3EVQA 5E4XA 1V43A 2EVBA 1H9JA 4XQQA 3PUZA 3MXPA 2NWGA 2F0NA 4G4KA 5TSSA 2Z4IA 1NAPA 2RDGA 1FYCA 2C9OA 3EFXD 1SDFA 1LTAD 4DXFA 2BA1A 2L11A 1D2BA 2MPMA 3P7JA 2FINB 5C5MA 1S5DD 2D2CC 1FR3A 1UAPA 1GUOA 2F0TA 3ONAB 3FEWX 1STBA 2JEAI 4WJWA 1U4RA 2HDMA 1KABA 1KDCA 3T53B 1PMRA 2HCCA 1F9RA 3KLRA 1MSGA 1U4LA 2RDHA 2EYLA 5JPNC 2NZ1D 2HDLA 2Q8IB 3GTJB 1HPCA 1G2TA 2RVLA 1R4PB 4ZAIA 4K8IA 1H9SB 2B63B 5CGKA 2IJ0A 2NVYB 3SXHA 3VYSA 1SYCA 4H13C 4CJ1B 3RD4A 1JOQA 3BYYB 4C3IG 1OXXK 4YIJA 1QWYA 1RD9D 3GV3A 2F0LA 4EGVA 1PLFA 3OMGA 5KYIA 4LMQD 1ZEQX 5M3FB 1NR4A 1RTOA 2K5DA 2B2WC 1GUGA 1VCIA 1TS4A 3AB9A 5I6YA 5K36G 2I46A 2EOTA 4F87A 1BF4A 3MHBA 3J7YW 1RKNA 3MWYW 4FF4A 2L0CA 1CA6A 3I4MB 1F2LA 2SNMA 5IGEA 2WKDA 2A6ED 4U68A 3HRZC 4BBSB 3KBXA 2B2UC 1ICWA 1H9SA 1L0XB 1STYA 2K6AA 5A2QE 2EYHA 3DEPA 5EBCA 3K58A 1GUNA 3NQIA 3BVZA 3I3CA 1XWEA 1OXTA 1DXMA 1YNJC 3BG3A 1JE4A 1PXUA 3FMCA 1Y1VB 4B08A 5EKLA 4N9PA 4DAVA 1HRJA 2ICIA 1CTMA 5C3WA 3FPUB 2WINB 1DM0B 4RGMA 3M7NA 2XRSD 4LAAA 4ZUJA 2K5QA 3VR3A 2F3VA 4HMJA 1AZQA 1HCZA 5JAVA 2XSCA 3D4RA 1Y8NB 3SK4A 3DMUA 3RZDB 3IKJA 4FNFA 4IFDJ 4LK1C 2F0JA 1TY0A 3NTKA 3OHXC 4ULLA 3SR1A 4HR7B 3IFTA 3DUZA 4IQZA 4RHSA 3MXGA 2B2UA 3R8BA 4J6HA 4PQXA 3RLFA 1I6VC 4QMGA 1A2TA 1WTPA 5LL6S 2QKIC 1TY2A 4OIJA 2E2JB 1JR0D 1VMPA 4HMIA 2KCCA 3QIAA 1HXYD 1PRTC 3D4DA 2DY7A 4A3MB 4ZQ3A 1ILQA 1PFBA 4NP5A 3MFYA 1B4OA 1JOKA 5C3EB 2SDFA 1EY6A 3QO2A 2NUCA 3R2TA 5IGFA 3J80E 1T5XD 1HTPA 2F0PA 5EPLA 4R9WA 2B2TC 4S3SA 1XX8A 2NBFA 5LHY1 4Z9CB 4I7ZC 3EROA 5CC4A 4JK1C 3NPPA 1EU4A 1Z7TA 1O78A 4C56C 4WRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZW A;  2EY1 A;  2F0U A;  2F0E A;  1STG A;  2LKV A;  2PZT A;  3NHH A;  4E6I A;  4I65 A;  3TME A;  1A3U A;  4KD4 A;  1TR5 A;  5HUR A;  4IZ8 A;  5CV4 A;  4ZUI A;  3D4W A;  4LAA A;  4ZUJ A;  1SYG A;  4OL7 A;  2OF1 A;  4EQP A;  5CGK A;  5I9O A;  5I6Y A;  2F3V A;  4HMJ A;  5J1Z A;  4F7X A;  3MEH A;  2EY2 A;  4ID6 A;  4B9X A;  2SNS A;  2SOB A;  3SXH A;  3MZ5 A;  4K6D A;  3ITP A;  5C4Z A;  5JAV A;  1SYC A;  1F2Z A;  1KAA A;  2EYP A;  2F0D A;  1STN A;  4ME5 A;  4HTH A;  2EY6 A;  1EY9 A;  1II3 A;  4IAL A;  3SK4 A;  2M00 A;  2PZU A;  3DMU A;  3TP8 A;  3NXW A;  5CV7 A;  5CV6 A;  5KEE A;  1JOQ A;  1EY0 A;  2F0F A;  1EY5 A;  5J22 A;  1KDA A;  4IUN A;  1IHZ A;  1SNQ A;  1SNO A;  2OXP A;  4EQN A;  4YIJ A;  1A3T A;  4N9T A;  4R8N A;  1A2U A;  3TP7 A;  2F0J A;  5IGF A;  4G57 A;  3ERQ A;  2F0L A;  1EZ6 A;  5K5P A;  3BDC A;  4KY7 A;  4KJO A;  3SR1 A;  3T13 A;  5CR3 A;  2EYF A;  5IGD A;  3C1F A;  3OMG A;  3SHL A;  1AEX A;  2F0H A;  5KYI A;  3EVQ A;  1SYD A;  5M9O A;  3NQT A;  4TRD A;  5C5L A;  4B9W A;  5C4H A;  2EXZ A;  4J6H A;  2WAC A;  3SK8 A;  3VA5 A;  2F0O A;  2QDB A;  1ENC A;  2EYJ A;  2KQ3 A;  4EQO A;  2F0I A;  3P75 A;  2ENB A;  5IIF A;  1SYE A;  1STH A;  1EY7 A;  3U9O A;  3OMC A;  4QMG A;  3V2T A;  4DF7 A;  3MVV A;  1A2T A;  2HQE A;  2PW5 A;  4PMC A;  3MXP A;  3SK5 A;  1EYC A;  4WRD A;  4DU9 A;  2F0N A;  5NUC A;  5JOB A;  5C3X A;  2F0S A;  4WOR A;  4K2L A;  5I9P A;  4PNY A;  3HEJ A;  4K8J A;  4HMI A;  1EQV A;  3QOJ A;  1A3V A;  1ENA A;  4KJN A;  5E1F A;  3TP6 A;  3MHB A;  3OSO A;  1EYA A;  1RKN A;  1TT2 A;  1SNM A;  2F0V A;  3D8G A;  4MIU A;  5CV8 A;  2PW7 A;  4F8M A;  5IGB A;  3S9W A;  3H6M A;  1EY4 A;  4K5W A;  2OEO A;  2F0Q A;  3D4D A;  5C5M A;  5KGU A;  2SNM A;  4ZQ3 A;  3R3O A;  2PYK A;  4NP5 A;  5IGE A;  3QB3 A;  2F0T A;  5F2D A;  4J1M A;  3D6C A;  4K14 A;  3DHQ A;  4KD3 A;  1JOK A;  3OWF A;  1STB A;  3HZX A;  5IOC A;  5IOD A;  5CV5 A;  1EY6 A;  5HGT A;  5DAU A;  4K5V A;  1SNP A;  2F0K A;  2F0M A;  3NP8 A;  3NUC A;  4KTA A;  4KV6 A;  3NK9 A;  1SND A;  1F2Y A;  4NDX A;  2NUC A;  4NMZ A;  5EKK A;  5I6W A;  1KAB A;  1SNC A;  1U9R A;  1KDC A;  1NSN S;  2KHS A;  2RKS A;  4H7B A;  1STY A;  4K5X A;  3SK6 A;  4EVO A;  5KRU A;  2F0G A;  1SYF A;  1F2M A;  2EYH A;  4KY5 A;  3BDL A;  3P1H A;  4NKL A;  4QB4 A;  2F0P A;  2F0W A;  2PQE A;  3LX0 A;  4S3S A;  5KYL A;  2F3W A;  5DEH A;  5ISR A;  1JOR A;  5J39 A;  3C1E A;  5CV9 A;  4RKB A;  1STA A;  2EYM A;  3EJI A;  5E3F A;  4KY6 A;  3TP5 A;  5IGC A;  2EYL A;  5C6A A;  3ERO A;  5IGG A;  1JOO A;  4ODG A;  3QOL A;  4RKL A;  5EGT A;  1NUC A;  3PMF A;  1EY8 A;  4KHV A;  5CC4 A;  1EZ8 A;  1TQO A;  2O4X A;  4DFA A;  2EYO A;  2EY5 A;  2RDF A;  3RUZ A;  4PMB A;  3T16 A;  5KIX A;  4K8I A;  4QF4 A;  4K2K A;  4N9P A;  5EKL A;  4DGZ A;  3E5S A;  1SYB A;  1KDB A;  2RBM A;  5C3W A;  1EYD A; 
#chains in the Genus database with same CATH topology
 4FO2 A;  5EPJ A;  2KA7 A;  1CZG A;  4B3M Q;  4ZRZ A;  4FDB A;  1JCK B;  3M4P A;  4JOI C;  1N8R C;  5EBD A;  4OEL B;  4LF6 Q;  4OWW B;  4ABN A;  4R4O A;  5FKA C;  1FJG Q;  1A0I A;  1AN8 A;  1CKM A;  3Q22 A;  1I3Q H;  2ZM6 Q;  2E2D C;  2PCF B;  1BBU A;  1F2Z A;  1SEB D;  3CKI B;  3UDF A;  2KOL A;  1S5B D;  2M00 A;  3TP8 A;  3H15 A;  3K57 A;  3MTS A;  2JA8 G;  4KLK A;  4KN7 C;  3S2D B;  2JP1 A;  1JJC B;  3L2P A;  1H95 A;  1GHJ A;  1B2T A;  4DV0 L;  3IL8 A;  4G57 A;  1EZ6 A;  4LNQ A;  1H9M A;  3ZJY C;  4A3B B;  3HS0 C;  5ELC A;  1FNV A;  3T1H Q;  4AIM A;  1PYW D;  2OCE A;  3WOF A;  2F0O A;  1D7Q A;  2F0I A;  2L4N A;  3CCQ A;  1UE1 A;  3OMC A;  3X3M A;  5M3M G;  1T5E A;  3TS2 A;  5M5X B;  1W6J A;  1YNJ D;  3F2D A;  4K2L A;  1SE2 A;  2VB2 X;  4IFD G;  1N34 L;  4A3I G;  1Q3L A;  3D0F A;  5E1F A;  5BR8 L;  3BZD B;  3W5O A;  1B7Y B;  3OOC A;  1DYQ A;  1HHV A;  2JE6 I;  2ZT9 C;  3FVQ A;  3CCJ A;  5C0X G;  2K1B A;  2FFK B;  2E2I H;  1OXU A;  4C3J H;  1JT8 A;  3HZX A;  1HZC A;  2CW0 D;  3V96 A;  1I3Q B;  4XTC S;  1SND A;  1VQ5 A;  2EJM A;  1Z6H A;  1CM9 A;  4LUZ A;  1ILP A;  4R4I A;  4LFC Q;  2N8N A;  1CI3 M;  1A6X A;  1CQV A;  4QB4 A;  4JI3 L;  3JAM L;  2NZH A;  1SE4 A;  2VQF L;  3PO2 H;  5C4X B;  1MSH A;  1YIT A;  3K6O A;  4X64 L;  1JWM D;  2E8G A;  4CBV A;  3J81 i;  3S16 H;  1D1K A;  4BBR H;  1M90 C;  3T16 A;  2LFN A;  4PZ6 A;  3EQL C;  4WJ3 M;  3M3Y H;  1RIP A;  1SLJ A;  4DV4 L;  3GTL H;  1E1T A;  3E5S A;  4RMF A;  1YNN C;  2L9H A;  2MUY A;  5DM7 3;  5KND A;  2E74 C;  4XT3 B;  4KHP Q;  3HGB A;  1BDO A;  4DKA C;  4JBM A;  1A3U A;  2QEJ C;  4QIW E;  1WD1 A;  3N6R A;  4OL7 A;  5C4J H;  1BNZ A;  2BH8 A;  2AMC B;  4POG A;  1EU3 A;  1M1K C;  4AYB G;  2B39 A;  1SAP A;  2JJQ A;  2CVR A;  1E1O A;  1PRT D;  2CH4 A;  3BS1 A;  4HCS A;  4ME3 A;  4C3I B;  1CFM A;  4Y7N H;  3JAM E;  2R92 H;  2VUM H;  1ENF A;  3S15 H;  2UUC Q;  2OXP A;  4HCE A;  1XMQ L;  1Y1V G;  1EIH A;  3F1Z A;  2ZXP A;  4QUF A;  3IFD A;  1I6H H;  4UDU C;  3T13 A;  1SMX A;  4C3J B;  1EFW A;  1YNX A;  2R7Z H;  1DZ1 A;  1J5E Q;  1U4M A;  2IHE A;  3K7A H;  5C5L A;  2JA7 H;  3G48 A;  3G6J B;  4JPB W;  4YCW A;  5C44 G;  2HD3 A;  1HNZ L;  1EOT A;  2LS0 1;  5C3X A;  1EWH A;  1JWS D;  4LW1 A;  3HEJ A;  4JV5 L;  3PO2 B;  3W3A A;  3K5N A;  3M85 A;  5IT9 c;  1AFP A;  4PV1 C;  2C35 B;  3OSO A;  3ULJ A;  1EYG A;  2F0V A;  4C2M H;  4FYD A;  4RGO S;  1E7Z A;  5IYD H;  1GD7 A;  4K5W A;  2NTS A;  3N52 A;  3MAQ A;  4X6A H;  1F9Q A;  4DA2 A;  4LF8 L;  3M3Y B;  3R3O A;  1NTG A;  4KN4 C;  2Z8L A;  3PUW A;  4MN3 A;  1LTG D;  3A74 A;  4H02 A;  4JI6 L;  4AQY Q;  4P2C B;  1CT1 D;  3EN2 A;  2YYZ A;  5C4J B;  4KK7 A;  1S40 A;  1NSN S;  1KNA A;  2R7F A;  1F2M A;  3VR6 A;  2PI2 A;  1KLU D;  2JA5 H;  3DXJ C;  1MKH A;  4Y7N B;  3S15 B;  3S1M B;  4UY8 C;  1UUP A;  3X3N A;  1S72 A;  2IPK D;  1HZB A;  4DR2 L;  4B3M L;  1IYJ B;  1E22 A;  3CME A;  5FJ8 H;  4OON A;  4UAI A;  4JI4 L;  5COR A;  1CKN B;  1TQO A;  3M9B A;  1Z9F A;  3UDG A;  1FJG L;  1I6H B;  4JVZ A;  3BVM A;  4YWM A;  3KFU A;  4B3R L;  4JCV E;  2YV5 A;  3JC6 6;  1SYB A;  1QZH A;  3T1Y Q;  1CZW A;  3K7A B;  2KHI A;  5C3E G;  1K3R A;  2JA7 B;  2PMZ B;  2KEE A;  4FXD A;  5G3L D;  1PTO B;  5FK9 C;  3D4W A;  2IWH A;  4DV3 Q;  4UP9 A;  1G91 A;  3TEH B;  5IWA Q;  4OXP A;  1B9M A;  1B44 D;  1I4P A;  1X65 A;  5EPK A;  4C2M B;  4DXG A;  4GOP C;  1YZ6 A;  4JI0 Q;  4QGU A;  3LWU A;  4Q0F A;  3PV0 A;  3NE5 B;  3RN5 A;  2RCF A;  1YHA A;  4NPS A;  3GV6 A;  2HT1 A;  4KHZ A;  3NQT A;  3A5Z B;  2EXZ A;  3GTP B;  4A3J G;  3A54 A;  4ZK9 B;  3P75 A;  1UNS A;  4PMC A;  1O7Z A;  2HQE A;  1I94 L;  2WB1 B;  4TKO B;  1TKW B;  4DR7 Q;  2UXC L;  2NVX H;  1XPO A;  3E0J A;  4YHH L;  5CYU A;  2JA8 H;  3TS0 A;  4JI2 Q;  4DR5 Q;  2PW7 A;  1A15 A;  5I2Y A;  1K8A C;  5DNF A;  1HNX L;  1X3P A;  1W3S A;  1WCM G;  2B2Y A;  3P20 A;  4A3B G;  4XYQ A;  2HQL A;  3CCL A;  4JI8 L;  4JC0 A;  2KCT A;  1SR3 A;  4LFC L;  3NBI A;  5IYC G;  2R6G A;  5CV5 A;  3FKI B;  1QJO A;  2RA4 A;  3BZK A;  1MBY A;  2EE1 A;  3ND8 A;  3NUC A;  3NK9 A;  2L55 A;  4IOC A;  1SNC A;  1IXR A;  1EEI D;  1ICF B;  2D0O A;  2K03 A;  1VQH A;  4IFD H;  4QUC A;  4A3I H;  1J6Q A;  1PZK D;  4FVM A;  3I91 A;  1N33 Q;  4RKB A;  4DR6 Q;  4J15 A;  4X66 Q;  2LY7 A;  3NBH B;  4DK6 C;  4BXX G;  3VR4 A;  1EZ8 A;  1YBY A;  5C0X H;  3RUZ A;  2H5X A;  2KED A;  4TSS A;  4DGZ A;  1YJW A;  4IUU A;  2UXB Q;  4BWG B;  2K52 A;  1Q1B A;  2EY1 A;  4OHJ A;  3OW7 A;  1MGS A;  3TME A;  1AE3 A;  3J81 L;  3DEO A;  2Z1C A;  1E2V A;  1VQF A;  1SMY C;  4EQP A;  3A7A B;  3VA7 A;  1IBK L;  3AFQ A;  2NVX B;  3TZD A;  2ZTD A;  2AQ3 B;  2EYP A;  1EFI D;  3A55 A;  2JA8 B;  1BXT A;  3I8Z A;  2ES2 A;  5CV6 A;  4JBW A;  2D62 A;  5KNB A;  3RR5 A;  5T1G A;  1O80 A;  3W1B A;  4CHT B;  1LV9 A;  3KLS A;  3KJP A;  3NWS A;  1QZG A;  1WTO A;  1NBW A;  1EWC A;  4IUR A;  5M3M B;  1V8Q A;  3E0E A;  1LAC A;  3CHB D;  1G6P A;  3J81 E;  2PW5 A;  3HOX H;  3SK5 A;  1EYC A;  2ALY B;  2K14 A;  4A3I B;  2HIX A;  5JOB A;  4HIM A;  1XNR Q;  1WTQ A;  5JVG 3;  4HSP A;  4GKJ L;  3QOJ A;  1CHP D;  3OTO Q;  5EQ0 A;  3MXU A;  4BY7 H;  4MIU A;  2D0P A;  2PNR C;  3M4Y A;  1PRT F;  1IKL A;  4POF A;  1PH1 A;  2OEO A;  1P16 A;  2YU9 H;  1Q12 A;  1XNQ L;  4LF9 Q;  3NBH A;  3QB3 A;  4C3J G;  1UE5 A;  2M9V A;  1BBX C;  2J7Z A;  2A68 D;  1LTR D;  3FDT A;  1I4H A;  3CXC A;  4DV7 L;  3C2P A;  1E0B A;  4K5V A;  1G8Z D;  2OQK A;  1BCP F;  3G7L A;  1I4Q A;  1HTL D;  1Y14 B;  1LYL A;  1SE8 A;  2F0G A;  2H4O A;  4KY5 A;  4IO9 A;  3ICE A;  1SE3 A;  2OT2 A;  2B8G A;  5M5W B;  1WOC A;  4V0B A;  5ELO A;  2PPB C;  3EJI A;  3PUX A;  1WTV A;  2JA6 H;  4BS9 A;  4BBR G;  5EGT A;  4ODG A;  3QOL A;  3PMF A;  1TWH H;  2A6H D;  4A3L H;  3C3L A;  2RDF A;  2R3Z A;  1ML0 D;  3EIV A;  1FL0 A;  4XT1 B;  3DWQ A;  3GD7 A;  2EJG C;  2EPB A;  4QY7 A;  4LUO A;  3Q8D A;  3CC7 A;  5CV4 A;  4ZUI A;  2A19 A;  2B29 A;  3KF8 A;  4AYB B;  1JC7 A;  4JI0 L;  3GTM B;  4C3H G;  3GTG B;  2SNS A;  1XPU A;  3T51 B;  2QW7 A;  1GUT A;  5COY A;  2R92 G;  2VUM G;  4DUZ L;  2VNU D;  4BY7 B;  1VQE A;  2YTY A;  3NXW A;  1AP0 A;  1JWU D;  1HA6 A;  1B8A A;  3HFZ B;  5JJZ A;  5CBE E;  1HQR D;  1Q46 A;  4EQN A;  2YU9 B;  1QCB D;  1FNU A;  1D5M C;  1NCV A;  2R7Z G;  3G6E A;  4KY7 A;  1YHB A;  3W2D A;  2JN4 A;  2B2W A;  2OQ0 A;  4V19 0;  1K0S A;  1AEX A;  1SJH D;  4R4C A;  5C44 B;  2JQO A;  4L6T B;  4UPA A;  3CQZ H;  4FF3 A;  2KQ3 A;  3RZO H;  2CW0 C;  4B3S L;  4LUV A;  2J4X A;  5G3L F;  1EWI A;  4RCN A;  5IT9 L;  4C1N I;  3KDF B;  3CCR A;  1BUV T;  5M5Y H;  3NTI A;  4IPC A;  4DAP A;  2JA6 B;  5IYD G;  1TT2 A;  1C9O A;  3FRP B;  3VYU A;  2IW3 A;  2NN6 H;  4DN4 M;  5IGB A;  5L37 A;  3I73 A;  1M8A A;  1TWH B;  3H6M A;  3K0X A;  4K6L A;  1E24 A;  2F0Q A;  2Q8R E;  3URY A;  1TII D;  4G7O C;  2ZTC A;  3G4S A;  2FJ2 A;  2QCP X;  1SMY D;  1DON A;  5C0X J;  1SBB B;  4A3D H;  4DK1 A;  1YIJ A;  2XN9 C;  4A3J H;  2UXD Q;  5HGT A;  3D6W A;  3VYR A;  1SNP A;  3PUV A;  4KV6 A;  2UUB L;  3HOZ H;  5IP7 H;  3UE1 A;  3Q6S A;  4DR6 L;  2JA5 G;  2RKS A;  4MNO A;  4X66 L;  1H9K A;  1RJT A;  1X6O A;  3P1H A;  3VYT A;  3J7Z C;  1DD2 A;  3H3V H;  3BVG A;  5J39 A;  5IT9 E;  1HUN A;  4R4Q A;  1O7Y A;  1WCM H;  4NXM L;  2ZJP A;  4HJA A;  2JXM B;  3A7L A;  4DFA A;  1V9P A;  1F9S A;  4GZY C;  4QF4 A;  4DV2 Q;  2CQO A;  5IYC H;  2Y0S E;  1BCP C;  4DAY B;  2WKC A;  2ZTE A;  4HJ8 A;  2HHH L;  2BDN A;  3RZO B;  4IZ8 A;  1PHJ A;  3OPO A;  4LJZ C;  5I9O A;  2P5Z X;  3GP7 A;  1BQQ T;  5LMN L;  5D3D A;  3MA2 B;  4HN7 A;  2J0T D;  1MIU A;  4GNX C;  2F0D A;  2F4V L;  3S24 A;  1CSP A;  2NYZ D;  2EY6 A;  1ESR A;  2R7D A;  2Q2T A;  4H0L C;  2BOS A;  2G9D A;  1QOH A;  4OEM B;  1IHZ A;  4JI7 L;  1HZ9 A;  1I4X A;  4BXX H;  1L0Y B;  3HOV H;  1R4Q B;  4HID A;  1WI5 A;  1EEF D;  1PH5 A;  3F8T A;  2Z6K A;  3ND9 A;  3J81 c;  4A3J B;  1A63 A;  4XQJ A;  1SYD A;  1X3Q A;  1TS3 A;  2A1A A;  1VDZ A;  3OTO L;  1L2F A;  1IL2 A;  1EUJ A;  1KD1 C;  5NUC A;  3M7G A;  1WYD A;  1TWF B;  4MHE A;  2NTT A;  2XNA C;  4KJN A;  2Q8T A;  5BN3 A;  2KVM A;  2K5W A;  1WCM B;  4F8M A;  1CUK A;  3OIQ A;  1EY4 A;  5IY0 A;  1Z47 A;  1TWC H;  5BN4 A;  2YTV A;  4JG2 A;  2AUJ D;  4QIW B;  2E2H H;  4JI5 L;  1XMO Q;  1U0L A;  1VQJ A;  4IPH A;  3QG1 A;  2B2V C;  5IOD A;  2VXW A;  2F0M A;  5ELF A;  4OGQ C;  3CCV A;  4DAY A;  1PH8 A;  2DUD A;  2H1E A;  4K5X A;  3CPW A;  2NVT H;  2B2T A;  1SYF A;  1XJV A;  3PF4 A;  3PO3 G;  3ERS X;  1PFS A;  3CP0 A;  1CHQ D;  1FNW A;  1GO3 E;  3CU7 A;  1Q86 C;  1BBW A;  1ET9 A;  2AWO A;  4DK0 A;  1LTS D;  5AJ3 L;  5JVH 3;  3HOV B;  1N36 Q;  1JOO A;  1EY8 A;  2EXD A;  2K75 A;  2KJX A;  4DUY L;  3A5U A;  2R61 A;  1VQD A;  3A8I E;  4AH6 A;  2L1B A;  2RBM A;  3E9H A;  4JOI A;  2JA9 A;  1C4Q A;  2WAQ E;  1K9M C;  2DJG C;  4ZLT F;  1ZKO A;  1B70 B;  3NTH A;  1QUQ A;  1JIC A;  3PIP 3;  3HKZ G;  4BA2 I;  2K04 A;  1VQ6 A;  1V1P B;  3NWT A;  4NXN Q;  1KDA A;  4HED A;  1OXV A;  1T9H A;  1TWC B;  2TMP A;  1A2U A;  1LAB A;  5E4W C;  2QA4 A;  2MJ8 A;  2KHJ A;  3D3R A;  2RCN A;  2EYF A;  5IGD A;  4IUT A;  4B9W A;  4DV1 Q;  1U4P A;  3DWA A;  2QDB A;  3HOX G;  3GO5 A;  1EY7 A;  4C3H H;  2NVT B;  2QDL A;  4B3T Q;  1L0W A;  3S1R H;  1PH6 A;  1MD2 D;  4WOR A;  3H0G H;  4DNR B;  4BY7 G;  3RN2 A;  4A3E G;  5DLQ E;  2QF7 A;  3CW2 C;  2AKW B;  3D8G A;  4HJ5 A;  4RWS C;  3HOW H;  2IT1 A;  3DM1 A;  1BCP D;  2UXD L;  2E2I B;  2VQE Q;  4RCO A;  1IBM Q;  2L12 A;  1E2W A;  2Y0S G;  3BZC A;  2A74 C;  2UU9 Q;  1VQ7 A;  3DHQ A;  4RAU C;  3I4L A;  1C7Y A;  4LF4 Q;  5KNC A;  5LMU L;  1ZYR D;  4FXG C;  1EIY B;  2CQA A;  1XXG A;  1ROD A;  4H7B A;  4EVO A;  1Q8K A;  4MTN A;  3WDN A;  4X65 L;  3RMH A;  4DR4 Q;  4RA8 A;  2WV6 D;  3DM3 A;  2ASB A;  2F0W A;  2PQE A;  3LX0 A;  4GKK Q;  1KHI A;  3S16 B;  2JA6 G;  4BBR B;  4GN3 B;  3S14 H;  5ELE A;  5CV9 A;  4RGT A;  4ZKC B;  4ALP A;  3GTL B;  3TP5 A;  1GHK A;  1SJE D;  4A3L G;  4TVA B;  5FLX c;  1V1P A;  4IUP A;  4KHV A;  2EYO A;  4YY3 Q;  2XGT A;  5EJW A;  2ICE C;  3L7Z C;  4X3U A;  3PF5 A;  1EYD A;  2V1C C;  1N32 Q;  1MJC A;  4I65 A;  1KRT A;  5I2X A;  3HOY H;  4KD4 A;  1MI2 A;  4C3H B;  2K5N A;  1X56 A;  1LT5 D;  1LM0 A;  3S1R B;  4A3K H;  3ZYY X;  1CSQ A;  4X3S A;  2VUM B;  1KIX A;  2R92 B;  1JB3 A;  3F2C A;  1TWA H;  1NY4 A;  2XIW A;  4P71 A;  4LF6 L;  1UE7 A;  3HOW B;  1EY0 A;  3L3O C;  5FO7 B;  1O7L A;  2VS1 A;  3E6Z X;  2ZM6 L;  2R7Z B;  5JJL A;  4XQN A;  3TP7 A;  1PYB A;  3A56 A;  4OWT B;  5K5P A;  4UHV A;  5EAY A;  3OWE B;  5CR3 A;  1X3E A;  3C1F A;  1J8I A;  2A68 C;  5JEA J;  3VA5 A;  5IIF A;  4A3F H;  2B8F A;  2K05 A;  3LWE A;  1SYE A;  3PCO B;  4HJ7 A;  2FMM A;  2X69 A;  3T1H L;  3KJO A;  2M2L A;  3SEB A;  1Q8I A;  3LGJ A;  1UEB A;  1EQV A;  4O2D A;  2E76 C;  1Q81 C;  3S14 B;  2VW9 A;  2NN6 G;  5GAE C;  1TS2 A;  2GA4 B;  3MFG A;  1WFQ A;  4HSV A;  1CA5 A;  4DV5 Q;  1PTO C;  4GLX A;  1PZJ D;  4OWX B;  1HJP A;  4BY1 G;  4OO1 H;  1D8L A;  1F77 A;  4A3D G;  2A6H C;  2F1M A;  1VQG A;  2WAQ G;  3VR5 A;  1JQY D;  2IX3 A;  3HOZ G;  3KUP A;  3CCU A;  2IL8 A;  4OX9 Q;  5IP7 G;  4DV6 Q;  1FGU A;  2JA5 B;  3KLS X;  4A3K B;  4XDX A;  4NMZ A;  3KF6 A;  1HA5 A;  3T4A C;  1K8O A;  3GDE A;  1PZI D;  2A69 C;  3I70 A;  5KYL A;  2PO4 A;  1JOR A;  1KTK A;  3S1Q H;  5D14 A;  1WJJ A;  1K28 A;  1W6K A;  2D9U A;  2BDO A;  3PGZ A;  2PZU A;  3J80 i;  4I7A A;  1YJ9 A;  1WD0 A;  3GTJ H;  1ONL A;  1TS5 A;  1VQM A;  1EIG A;  3F2U A;  1E2Z A;  1SYG A;  4RHR A;  2NVQ H;  1TU2 B;  4NW2 A;  1A8V A;  4F7X A;  3PO3 H;  3MEH A;  1C0A A;  1S4Z A;  4Y52 H;  2SOB A;  2X6L A;  2B63 H;  1STN A;  4GOP A;  4KHP L;  1X3F A;  3HOV G;  3TBI B;  2PMZ E;  2EIF A;  4DR1 Q;  1LT6 D;  5CMD A;  3DWP A;  4DV1 L;  2K5V A;  1RHP A;  1Y1W G;  1NNX A;  3A0J A;  3AMU A;  4B3T L;  4LFA Q;  1K73 C;  3DLL A;  1B9N A;  2Z6B A;  1X55 A;  5M9O A;  2UUC L;  4TQU S;  3I56 A;  1I50 H;  4CDD C;  4QL5 A;  4R4T A;  1ENC A;  1ZXT A;  1SFO H;  3U9O A;  1GXD C;  4Q5V A;  2NZO A;  1AW7 A;  1IKM A;  3K7U C;  2TSS A;  2BA0 A;  4KKT A;  5M3F H;  1G6Z A;  2F0S A;  1IBM L;  1J5E L;  4IFD I;  2R93 G;  4CJ0 B;  5D3I B;  3S1Q B;  4MZ9 A;  4RGN A;  4X62 Q;  1ENA A;  3TP6 A;  1FD7 D;  2DY8 A;  4IJH A;  1QVF A;  4KMU C;  1D6E C;  1EL0 A;  5JEA G;  1HR0 Q;  3KF8 B;  1XTC D;  5IYB H;  2WB1 E;  5C0X I;  1HR0 W;  2MO1 A;  1J9O A;  4CKB A;  1WTW A;  4K14 A;  3R93 A;  3OWF A;  4M1U B;  4GKK L;  3BU2 A;  4G7H C;  1WVL A;  3FP9 A;  2I07 B;  4G7Z C;  2NVQ B;  3QWN A;  3SK8 A;  3PO3 B;  4HAE A;  1VQ9 A;  2VZA A;  4BBS H;  4A3G G;  3STB C;  1QG7 A;  5FO8 B;  3D31 A;  4ZCK A;  1XYI A;  3BDL A;  4A3E H;  4YY3 L;  4HIO A;  2VL6 A;  4AQY L;  2DN8 A;  1JJ2 A;  1N32 L;  5JJK A;  4LF5 Q;  3S1N H;  2PQA B;  2JYO A;  1D5Z C;  2YTX A;  1DJR D;  4DNT B;  4PMB A;  2K50 A;  2ZJR A;  3MXN B;  2RF4 A;  2K33 A;  3IAY A;  5GAD C;  3S2H H;  1I50 B;  2F0E A;  2LKV A;  2VY3 A;  1SFO B;  3GTQ H;  1IL8 A;  1ESF A;  3M4O H;  4HJ9 A;  4P75 A;  2MNA A;  4X3K A;  4A93 G;  4JBJ A;  1HH2 P;  3HKZ B;  4IJL A;  2O5I C;  3CCM A;  1HFG A;  4DV0 Q;  4KI0 A;  1VQ4 A;  5A2Q L;  3PIO 3;  3RNU A;  1PTO D;  3T1Y L;  3IRB A;  4ME5 A;  3VDY A;  1ASZ A;  1VQA A;  4HTH A;  2F4I A;  1DOM A;  5A35 A;  3G71 A;  1CK1 A;  2FXQ A;  5KEE A;  2Z9H A;  5J22 A;  2QIL A;  4FF2 A;  1B3A A;  4N8X 1;  4DV3 L;  1A3T A;  4N9T A;  4IUV A;  1S5E D;  5IWA L;  2LSS A;  4YCV A;  5FOB B;  1GKH A;  2EZV A;  4A3C G;  1Q90 A;  2K7V A;  3QR8 A;  1HNW Q;  1IW7 C;  5GAG C;  1SXT A;  3A8J E;  3HOX B;  3GTK H;  1N34 Q;  5FO9 B;  2KEC A;  1QB5 D;  2GVB A;  4TRD A;  1UEA B;  2A69 D;  2WAC A;  5ELN A;  5BR8 Q;  2OTJ A;  2EYJ A;  1B1Z A;  3JAM i;  4FF1 A;  1GJX A;  3H0G G;  1UE6 A;  4DU9 A;  2BE5 C;  1VQO A;  1CKO A;  1DOK A;  4A3E B;  1PFN A;  4JW0 A;  4K8J A;  3HOW G;  4IN3 A;  2AHO B;  3K5L A;  3CCS A;  1HUM A;  5DM6 3;  1B53 A;  3CAM A;  5CV8 A;  1EOV A;  3S1N B;  1ET6 A;  2Y0S B;  4CJ2 C;  2E2J H;  4OX9 L;  2ID0 A;  1PYS B;  5I4D A;  4WFN 3;  1LTL A;  4DR7 L;  3RLO A;  5JJI A;  3I55 A;  2B3G A;  2K28 A;  1L1O C;  3S2H B;  1K83 H;  2PQA A;  1LT4 D;  3TSS A;  3D6C A;  4JI2 L;  3GTQ B;  4DR5 L;  2D5D A;  2LXJ A;  4A3M H;  3M4O B;  3MXN A;  2VQF Q;  2K4K A;  2F0K A;  4NDX A;  4OIK A;  4X64 Q;  1DCZ A;  5EKK A;  1D5X C;  1UWV A;  3S9W A;  4XIG S;  3SK6 A;  2K32 A;  3J7A 5;  2N55 A;  2SEB D;  4DV4 Q;  2HIV A;  4L5Q A;  4K0K Q;  2V4D A;  5FLX L;  3CC4 A;  1V1O A;  4ZKB B;  3SDZ A;  4KY6 A;  4EQ5 A;  2HUG A;  3V05 A;  5C6A A;  1TWG H;  3H91 A;  4BY1 H;  4RKL A;  1D1I A;  5T1I A;  3I4N G;  4APV A;  2Q2H A;  1W2B A;  2EY5 A;  3QJY A;  4ILW A;  4J8Q A;  1NJI C;  3SE0 A;  3GTK B;  1RTN A;  1N33 L;  3O13 A;  3HOY G;  2AUK A;  3W1G A;  3CF5 A;  2WP8 J;  3NHH A;  3I4O A;  2F52 A;  4A3K G;  3Q24 A;  3KBG A;  1TR5 A;  1LO5 D;  4CKE A;  1I4R A;  1PRT B;  2OF1 A;  2ZXO A;  2AWN A;  1XMQ Q;  2XRQ D;  1PH3 A;  2UXB L;  1STE A;  2QEX A;  3ITP A;  3J80 L;  1KAA A;  4LFB Q;  2LXK A;  1EQQ A;  2XVS A;  1KC8 C;  1B50 A;  4U67 3;  2JSO A;  3PUY A;  4HIK A;  3KK7 A;  1NR2 A;  4YWL A;  1SNO A;  1VMC A;  1BCP B;  1SN8 A;  5FLX E;  2O5J C;  1IYU A;  2NN6 I;  1HFN A;  1GOZ A;  1SSO A;  2N88 A;  1HNZ Q;  1EQR A;  3CQZ B;  4FP5 D;  1K83 B;  2O2L D;  3BDO A;  5J3B A;  2CHB D;  2BCO A;  3U9S A;  3STB D;  1DOL A;  5EKI A;  4A3F G;  2F03 A;  3HOU H;  1QE6 A;  1RCV D;  5M5Y B;  3AFP A;  4DF7 A;  3MVV A;  4JBK A;  1ZYR C;  4PMW A;  4H44 C;  1GUW A;  4LF8 Q;  1NMF A;  2ZJQ A;  5HY6 A;  2F3I A;  1PV4 A;  1K0R A;  1I5F A;  2Q2U A;  1VQP A;  3H3V I;  1EYA A;  1TWG B;  5ELD A;  4BY1 B;  3AU7 A;  2EDG A;  4OO1 G;  4RH6 A;  1H9R A;  2IX0 A;  4A3D B;  1Y1W H;  2WAQ B;  1XNR L;  3TRE A;  3HOZ B;  3L9A X;  5F2D A;  4CGY B;  1QUQ B;  4QJF A;  4CDF C;  3UI2 A;  5FLM G;  1Q82 C;  3NP8 A;  1PH2 A;  2ATW A;  1C8C A;  4DR2 Q;  1BKB A;  4LF9 L;  1VF5 C;  1X32 A;  4LF5 L;  5KRU A;  4JI4 Q;  2WFW A;  2R93 H;  3ER0 A;  2IY5 B;  1KXL A;  4B3R Q;  2HCI A;  2F3W A;  3NSW A;  3S17 H;  4XYO A;  1STA A;  2EYM A;  1ASY A;  1TVX A;  1IZ6 A;  1IW7 D;  1PFM A;  2IX1 A;  5JEA H;  4O1N A;  1S3O A;  1I4G A;  3NEM A;  2C5C A;  5C4X H;  2O4X A;  4QCL A;  5KIX A;  3J7A F;  3H3V C;  2BE5 D;  2F0U A;  2PZT A;  3AQQ A;  2RHQ B;  3HOU B;  5HUR A;  1F9P A;  4A3G H;  4O42 A;  4DNI A;  2MGS A;  3H94 A;  3RLN A;  1SRO A;  3U50 C;  2A5H A;  1G51 A;  1LTI D;  5J1Z A;  4GNX A;  2B63 G;  3GTO H;  2EY2 A;  4B9X A;  2A73 B;  1AE2 A;  5C4Z A;  3MZ5 A;  4IUQ A;  3UDX A;  1OTC A;  1HQM C;  1EY9 A;  4IAL A;  2PNH A;  3TZU A;  1HNW L;  5CV7 A;  1JMC A;  1EQT A;  2RSN A;  4EX5 A;  1Q1E A;  1Y1W B;  1AH9 A;  3LNN A;  3CRL C;  4C3I H;  2WII B;  2KCN A;  3SGI A;  3CC2 A;  4MTK A;  1VF7 A;  1I94 Q;  4KJO A;  2I5M X;  2UXC Q;  1WTX A;  4YHH Q;  1VQC A;  2FHT A;  4EQO A;  4A93 H;  2ENB A;  4F88 A;  5M3F G;  1GVP A;  1RDP D;  2VB3 X;  1R9T H;  1HNX Q;  2R93 B;  2OWO A;  3R2I A;  2UUA Q;  4RG1 A;  5I9P A;  4PNY A;  1MHW C;  1YEZ A;  3S17 B;  1M4V A;  2AQ2 B;  2Z0S A;  3UDI A;  5K36 H;  1PH7 A;  2I0Q A;  4JI8 Q;  2E2H B;  3SVM A;  1SNM A;  2EJF C;  1PTO F;  5IYB G;  4C1N K;  2B2V A;  4A3C H;  3I4M G;  4KKS A;  3CRK C;  4P74 A;  2RQX A;  1K8G A;  4QQB X;  4J1M A;  1G2S A;  1DGS A;  3BYT B;  5IOC A;  3C46 A;  1GM5 A;  4A3G B;  4BBS G;  4K0K L;  3HG9 A;  3GTO B;  1F2Y A;  4JYA Q;  3WOE A;  3OW2 A;  3ULP A;  1U9R A;  3KYH C;  2OTL A;  3K59 A;  4LF7 Q;  4GS3 A;  3NEN A;  4M8A A;  1LTT D;  1AZP A;  5E3F A;  1NMG A;  2RSO A;  4DK3 C;  3A8K E;  2NB0 A;  3Q0A A;  2I5H A;  4C56 C;  4YWK A;  5BN5 A;  1LLR D;  3S1M H;  1RL2 A;  2L5T A;  4K2K A;  1IBK Q;  1VQL A;  2PZW A;  1STG A;  4E6I A;  4LFB L;  4X3T A;  4JI1 Q;  4A93 B;  2DNE A;  1X3G A;  1XPR A;  1VQK A;  1YJN A;  1Y8P B;  3K5M A;  2KCM A;  1R9T B;  4NB3 A;  2A8V A;  1QNU A;  1BOS A;  5CBA E;  2CFM A;  4DV2 L;  4ID6 A;  4CKC A;  4K6D A;  3MEF A;  2XWB B;  3HKS A;  1PTO H;  2LMC B;  3WWV A;  2CKZ B;  1KLG D;  2F0F A;  1VQ8 A;  4IUN A;  1IYV A;  1QVG A;  3K81 C;  3I4N H;  4YCU A;  1JJG A;  1HZA A;  3ERQ A;  3KF6 B;  2MQH A;  3BDC A;  3F2B A;  3K0Y A;  3Q23 A;  3J7A V;  3MC0 B;  3H09 A;  3SHL A;  4GKJ Q;  3TRZ A;  4L63 B;  5C4H A;  3VR2 A;  3H0G B;  1STH A;  3V2T A;  1LTB D;  1QNK A;  3EA6 A;  3J80 c;  4RFB A;  2XWJ B;  1XNQ Q;  3GTP H;  4GN4 B;  1BO0 A;  1OXS C;  1SRU A;  1A3V A;  1G29 1;  2PI2 E;  3TN2 A;  2JEB I;  1VQB A;  2KUM A;  5JPM C;  4DV7 Q;  4DR3 Q;  5LL6 X;  1Y69 U;  1LT3 D;  5KGU A;  1YVC A;  3TDQ A;  1PDQ A;  2PYK A;  4L8J A;  2E75 C;  1BR9 A;  3PIP A;  3FPP A;  4A3M G;  3OYY A;  2B2Y C;  2BH2 A;  4KD3 A;  2K01 A;  1WTR A;  3K5O A;  5D65 A;  4GOP B;  5DAU A;  2FMC A;  4KTA A;  5I6W A;  4LWC A;  5AFW A;  2KHS A;  1S5F D;  1XMO L;  3CD6 A;  3FKI H;  2DNC A;  3J81 j;  4A76 A;  1S5C D;  3I72 A;  4NKL A;  1Y8O B;  5IP9 H;  2AQ1 B;  1C48 A;  4R8I A;  4CDC C;  5ISR A;  3C1E A;  3I4N B;  5IGC A;  3PSI A;  4R1J A;  1QIL A;  5IGG A;  1NUC A;  1CQF A;  2G5D A;  2MHV A;  3HOY B;  2G9H D;  5ELB A;  1KDB A;  5DEH A;  5FLM H;  1RF2 D;  4FXK C;  1KRS A;  4DUZ Q;  3UE0 A;  1N36 L;  1TWA B;  2QGQ A;  1FGB D;  2A6E C;  1YI2 A;  4A4I A;  3OIP A;  4ZYS A;  1KNE A;  2CCZ A;  2Z4H A;  4DPG A;  3GQB A;  1II3 A;  2MP1 A;  1EY5 A;  4BA1 I;  1K8M A;  1SNQ A;  3B6Y A;  1GUS A;  3TQY A;  4GN5 A;  4R8N A;  4XXE A;  1KL9 A;  3HP3 A;  3T56 B;  2ZXR A;  4B3S Q;  2KBN A;  1OO9 B;  4OO1 I;  1YNN D;  4A3F B;  3I90 A;  4DAM A;  2UUA L;  5GQO A;  2X6G A;  4KKU A;  4NXN L;  2F0H A;  3HOU G;  3EVQ A;  5E4X A;  1V43 A;  2EVB A;  1CKN A;  3AYH B;  1H9J A;  4XQQ A;  1FVI A;  1IBL Q;  1P8L A;  3PUZ A;  3MXP A;  2NWG A;  2F0N A;  4G4K A;  5TSS A;  2NVY H;  2Z4I A;  5M3M H;  1NAP A;  4PZ7 A;  2RDG A;  1FYC A;  1O7I A;  2C9O A;  2E5L Q;  3EFX D;  3E9I A;  1SDF A;  1LTA D;  4DXF A;  5IE8 A;  2BA1 A;  2L11 A;  1QVC A;  1D2B A;  2MPM A;  3P7J A;  2UUB Q;  2FIN B;  5C5M A;  1S5D D;  4JYA L;  2D2C C;  1FR3 A;  2DGY A;  3CPF A;  1UAP A;  1GUO A;  2F0T A;  3ONA B;  4LF7 L;  3FEW X;  1STB A;  2JEA I;  4WJW A;  1U4R A;  2VQE L;  2EQS A;  2HDM A;  4IOA A;  1KAB A;  4PG3 A;  1KDC A;  3T53 B;  2CWA A;  4NXM Q;  1PMR A;  2HCC A;  1F9R A;  2UU9 L;  3KLR A;  4LF4 L;  1MSG A;  2N49 A;  1U4L A;  3JAM c;  2RDH A;  4L5T A;  4P72 A;  2EYL A;  5C4X G;  5JPN C;  2HHH Q;  4JI1 L;  2NZ1 D;  5M5W H;  2HDL A;  2Q8I B;  1N9W A;  3GTJ B;  1HPC A;  3I4M H;  2K5H A;  4DR4 L;  2RVL A;  1G2T A;  1R4P B;  4ZAI A;  4K8I A;  5LMN Q;  1H9S B;  5LMN W;  1KQS A;  2F4V Q;  1JB7 A;  1VS0 A;  2B63 B;  1YHQ A;  5CGK A;  4JI7 Q;  2IJ0 A;  2NVY B;  3NEL A;  3SXH A;  3VYS A;  1SYC A;  4H13 C;  4CJ1 B;  5GRO A;  1TXY A;  3BJU A;  1NE3 A;  2MFI A;  3RD4 A;  1JOQ A;  3GTM H;  3BYY B;  5H1S E;  3GTG H;  1OXX K;  4C3I G;  1VQI A;  4YIJ A;  3U58 A;  1QWY A;  3K8A A;  1RD9 D;  3GV3 A;  2F0L A;  4N8F A;  5E7N A;  1PVO A;  1Y1V H;  4EGV A;  4CDE C;  1PLF A;  3OMG A;  5KYI A;  4LMQ D;  1ZEQ X;  4GLA C;  5M3F B;  1NR4 A;  1RTO A;  1XTD A;  2K5D A;  1VQN A;  2B2W C;  1GUG A;  1VCI A;  1TS4 A;  3CMA A;  3AB9 A;  5I6Y A;  4DR3 L;  5C44 H;  1WTH A;  5K36 G;  2GN5 A;  2N78 A;  2I46 A;  2I5L X;  2EOT A;  4JI5 Q;  4F87 A;  2CWP A;  3I2Z A;  1BF4 A;  3MHB A;  3J7Y W;  3PO2 G;  1RKN A;  3MWY W;  4FF4 A;  2L0C A;  1CA6 A;  3I4M B;  3RZD H;  2MO0 A;  1X54 A;  2L15 A;  1F2L A;  2SNM A;  5IGE A;  2WKD A;  3K80 C;  2A6E D;  4U68 A;  3HRZ C;  1A62 A;  4BBS B;  3KBX A;  2B2U C;  1PH9 A;  1ICW A;  4DV5 L;  2RHS B;  5HGQ A;  1H9S A;  2GVA A;  5AJ3 Q;  4UP7 A;  1L0X B;  1STY A;  1Q7Y C;  2K6A A;  5A2Q E;  2EYH A;  4DUY Q;  3DEP A;  3PQI A;  5EBC A;  3K58 A;  4DV6 L;  1GUN A;  3U4V A;  3NQI A;  1L1O B;  3BVZ A;  3I3C A;  1XWE A;  1OXT A;  1DXM A;  1YNJ C;  3BG3 A;  1JE4 A;  3M4Q A;  1X9N A;  1PXU A;  2N3S A;  3FMC A;  1Y1V B;  4JI3 Q;  2DJF C;  4B08 A;  2Q2I A;  3L0O A;  4N9P A;  5EKL A;  4DAV A;  1HRJ A;  2ICI A;  1CTM A;  5C3W A;  3FPU B;  1K3B C;  2WIN B;  1DM0 B;  4UP8 A;  4RGM A;  3M7N A;  5C3E H;  2XRS D;  4WJ4 A;  4LAA A;  4ZUJ A;  2JA7 G;  2K5Q A;  3VR3 A;  2F3V A;  4HMJ A;  1AZQ A;  2CH4 W;  1HCZ A;  5JAV A;  2XSC A;  1KAW A;  1V1Q A;  3D4R A;  3U4Z A;  1Y8N B;  3SK4 A;  3DMU A;  4A75 A;  4IPG A;  3RZD B;  3IKJ A;  4FNF A;  3AEV A;  4IFD J;  4LK1 C;  1JE5 A;  2F0J A;  1TY0 A;  3HKZ E;  3NTK A;  3OHX C;  1IBL L;  3KLW A;  4ULL A;  3SR1 A;  4HR7 B;  3IFT A;  1B3Q A;  3DUZ A;  4IQZ A;  4RHS A;  4DR1 L;  3MXG A;  3CCE A;  2B2U A;  3R8B A;  4J6H A;  2Z6K C;  4PQX A;  3RLF A;  2E5L L;  4L5R C;  5GAH C;  1I6V C;  4QMG A;  2IHF A;  1A2T A;  4LFA L;  1WTP A;  5LL6 S;  2QKI C;  1TY2 A;  4OIJ A;  2E2J B;  1JR0 D;  1VMP A;  4HMI A;  2KEN A;  2WB1 G;  2KCC A;  3QIA A;  1BVS A;  4AYB E;  2XTI A;  4GLV B;  1U5K A;  4IPD A;  1HXY D;  1E3P A;  3S2D H;  5LMU Q;  2JK8 A;  1PRT C;  1TWF H;  1PH4 A;  1L1O A;  3D4D A;  2DY7 A;  5FJ8 G;  4ZQ3 A;  4A3M B;  1LUZ A;  4JV5 Q;  1ILQ A;  1PFB A;  4NP5 A;  3MFY A;  4GNX B;  3PIO A;  4X62 L;  4X65 Q;  4A3B H;  1B4O A;  1JOK A;  4L5S A;  5C3E B;  2SDF A;  1EY6 A;  3QO2 A;  2NUC A;  3R2T A;  1HR0 L;  3FKI G;  3E3X A;  5IGF A;  5IP9 G;  3J80 E;  1PA6 A;  1T5X D;  1HTP A;  5M5X H;  4JI6 Q;  2F0P A;  5EPL A;  4R9W A;  2B2T C;  4S3S A;  1XX8 A;  2NBF A;  4O0A A;  5LHY 1;  4Z9C B;  4I7Z C;  1MJE A;  3KOJ A;  4P73 A;  4PZ8 A;  3ERO A;  3I7F A;  5CC4 A;  4JK1 C;  3NPP A;  1EU4 A;  3KDF A;  1Z7T A;  3EBE A;  1EIF A;  3FHW A;  1O78 A;  3ULL A;  4WRD A; 
#chains in the Genus database with same CATH homology
 4FO2 A;  5EPJ A;  2KA7 A;  1CZG A;  4ZRZ A;  1JCK B;  5EBD A;  4ABN A;  5FKA C;  1AN8 A;  3Q22 A;  2E2D C;  2PCF B;  1F2Z A;  1SEB D;  3CKI B;  2KOL A;  1S5B D;  2M00 A;  3TP8 A;  3K57 A;  3MTS A;  4KN7 C;  3S2D B;  2JP1 A;  1GHJ A;  1B2T A;  3IL8 A;  4G57 A;  1EZ6 A;  1H9M A;  4A3B B;  3HS0 C;  5ELC A;  1FNV A;  1PYW D;  3WOF A;  2F0O A;  2F0I A;  2L4N A;  3OMC A;  3X3M A;  1T5E A;  5M5X B;  1W6J A;  1YNJ D;  4K2L A;  1SE2 A;  2VB2 X;  4IFD G;  1Q3L A;  5E1F A;  3BZD B;  3OOC A;  1DYQ A;  1HHV A;  2JE6 I;  2ZT9 C;  3FVQ A;  5C0X G;  2K1B A;  2FFK B;  1OXU A;  3HZX A;  2CW0 D;  3V96 A;  1I3Q B;  4XTC S;  1SND A;  2EJM A;  1Z6H A;  1CM9 A;  1ILP A;  1CI3 M;  1A6X A;  1CQV A;  4QB4 A;  3JAM L;  1SE4 A;  5C4X B;  1MSH A;  3K6O A;  1JWM D;  4CBV A;  1D1K A;  3T16 A;  2LFN A;  3EQL C;  3E5S A;  5KND A;  1YNN C;  2L9H A;  2MUY A;  5DM7 3;  2E74 C;  4XT3 B;  3HGB A;  1BDO A;  1A3U A;  2QEJ C;  1WD1 A;  3N6R A;  4OL7 A;  1BNZ A;  1EU3 A;  2B39 A;  1SAP A;  2CVR A;  1PRT D;  3BS1 A;  4HCS A;  4C3I B;  1CFM A;  3JAM E;  1ENF A;  2OXP A;  4HCE A;  1EIH A;  2ZXP A;  4QUF A;  3IFD A;  4UDU C;  3T13 A;  4C3J B;  1DZ1 A;  1U4M A;  5C5L A;  3G6J B;  1EOT A;  2LS0 1;  5C3X A;  1EWH A;  1JWS D;  3HEJ A;  3PO2 B;  3W3A A;  3K5N A;  3M85 A;  1AFP A;  4PV1 C;  3OSO A;  4FYD A;  2F0V A;  4RGO S;  4K5W A;  2NTS A;  3N52 A;  3MAQ A;  1F9Q A;  4DA2 A;  3M3Y B;  3R3O A;  4KN4 C;  2Z8L A;  3PUW A;  4MN3 A;  1LTG D;  4P2C B;  1CT1 D;  5C4J B;  2YYZ A;  4KK7 A;  1NSN S;  1KNA A;  1F2M A;  3VR6 A;  1KLU D;  3DXJ C;  4Y7N B;  3S15 B;  3S1M B;  1UUP A;  3X3N A;  2IPK D;  4UAI A;  5COR A;  1TQO A;  1I6H B;  3BVM A;  1SYB A;  1CZW A;  3K7A B;  2JA7 B;  2PMZ B;  2KEE A;  4FXD A;  5G3L D;  1PTO B;  5FK9 C;  3D4W A;  2IWH A;  1G91 A;  1B9M A;  1B44 D;  1I4P A;  5EPK A;  4C2M B;  4DXG A;  3LWU A;  4Q0F A;  3PV0 A;  3NE5 B;  3GV6 A;  4KHZ A;  3NQT A;  2EXZ A;  3GTP B;  3A54 A;  4ZK9 B;  3P75 A;  1UNS A;  4PMC A;  1O7Z A;  2HQE A;  2WB1 B;  4TKO B;  1TKW B;  3E0J A;  5CYU A;  2PW7 A;  1A15 A;  5I2Y A;  5DNF A;  1X3P A;  2B2Y A;  3P20 A;  4XYQ A;  3NBI A;  2R6G A;  5CV5 A;  3FKI B;  1QJO A;  2RA4 A;  1MBY A;  2EE1 A;  3ND8 A;  3NUC A;  3NK9 A;  2L55 A;  1SNC A;  1EEI D;  2K03 A;  4IFD H;  4QUC A;  1PZK D;  4FVM A;  3I91 A;  4RKB A;  2LY7 A;  3VR4 A;  1EZ8 A;  5C0X H;  3RUZ A;  2KED A;  4TSS A;  4DGZ A;  4IUU A;  4BWG B;  1Q1B A;  2EY1 A;  4OHJ A;  3OW7 A;  1MGS A;  3TME A;  3J81 L;  3DEO A;  2Z1C A;  1E2V A;  4EQP A;  1SMY C;  3A7A B;  3VA7 A;  2NVX B;  3TZD A;  2AQ3 B;  2EYP A;  1EFI D;  3A55 A;  2JA8 B;  1BXT A;  3I8Z A;  5CV6 A;  4JBW A;  2D62 A;  5KNB A;  5T1G A;  1O80 A;  4CHT B;  1LV9 A;  3KLS A;  3NWS A;  1WTO A;  1EWC A;  4IUR A;  5M3M B;  1V8Q A;  1LAC A;  3CHB D;  3J81 E;  2PW5 A;  3SK5 A;  1EYC A;  4A3I B;  5JOB A;  1WTQ A;  5JVG 3;  4HSP A;  3QOJ A;  1CHP D;  5EQ0 A;  3MXU A;  4MIU A;  2PNR C;  3M4Y A;  1PRT F;  1IKL A;  2OEO A;  1Q12 A;  3NBH A;  3QB3 A;  4C3J G;  2M9V A;  1BBX C;  2J7Z A;  2A68 D;  1LTR D;  3FDT A;  1I4H A;  3C2P A;  1E0B A;  4K5V A;  1G8Z D;  1BCP F;  3G7L A;  1I4Q A;  1HTL D;  2F0G A;  2H4O A;  4KY5 A;  1SE3 A;  2OT2 A;  2B8G A;  5M5W B;  4V0B A;  2PPB C;  3EJI A;  3PUX A;  1WTV A;  4BS9 A;  5EGT A;  4ODG A;  3QOL A;  3PMF A;  2A6H D;  3C3L A;  2RDF A;  2R3Z A;  1ML0 D;  4XT1 B;  3DWQ A;  3GD7 A;  2EJG C;  2EPB A;  5CV4 A;  4ZUI A;  3KF8 A;  4AYB B;  1JC7 A;  3GTM B;  4C3H G;  3GTG B;  2SNS A;  3T51 B;  1GUT A;  5COY A;  2VNU D;  4BY7 B;  3NXW A;  1AP0 A;  1JWU D;  1HA6 A;  5JJZ A;  5CBE E;  1HQR D;  4EQN A;  2YU9 B;  1QCB D;  1FNU A;  1D5M C;  1NCV A;  4KY7 A;  3W2D A;  2B2W A;  4V19 0;  1AEX A;  1SJH D;  5C44 B;  4L6T B;  4FF3 A;  2KQ3 A;  2CW0 C;  2J4X A;  5G3L F;  4RCN A;  5IT9 L;  4C1N I;  1BUV T;  3NTI A;  4DAP A;  2JA6 B;  1TT2 A;  3VYU A;  3FRP B;  2IW3 A;  2NN6 H;  4DN4 M;  5IGB A;  3I73 A;  1M8A A;  1TWH B;  3H6M A;  4K6L A;  2F0Q A;  2Q8R E;  3URY A;  1TII D;  4G7O C;  2FJ2 A;  2QCP X;  1SMY D;  1DON A;  5C0X J;  1SBB B;  4DK1 A;  2XN9 C;  5HGT A;  3D6W A;  3VYR A;  1SNP A;  3PUV A;  4KV6 A;  3Q6S A;  2RKS A;  1H9K A;  1RJT A;  3VYT A;  3P1H A;  1DD2 A;  3BVG A;  5J39 A;  5IT9 E;  1HUN A;  1O7Y A;  2JXM B;  3A7L A;  4DFA A;  1F9S A;  4GZY C;  4QF4 A;  1BCP C;  2WKC A;  3RZO B;  2BDN A;  4IZ8 A;  3OPO A;  4LJZ C;  5I9O A;  3GP7 A;  1BQQ T;  5D3D A;  3MA2 B;  4HN7 A;  2J0T D;  2F0D A;  2NYZ D;  2EY6 A;  1ESR A;  4H0L C;  2BOS A;  2G9D A;  1QOH A;  1IHZ A;  1I4X A;  1L0Y B;  1R4Q B;  1EEF D;  3ND9 A;  4A3J B;  4XQJ A;  1SYD A;  1X3Q A;  1TS3 A;  1VDZ A;  5NUC A;  3M7G A;  1TWF B;  4MHE A;  2NTT A;  2XNA C;  4KJN A;  2Q8T A;  5BN3 A;  2KVM A;  2K5W A;  1WCM B;  4F8M A;  3OIQ A;  1EY4 A;  1Z47 A;  5BN4 A;  2AUJ D;  4QIW B;  3QG1 A;  2B2V C;  5IOD A;  2VXW A;  2F0M A;  5ELF A;  4OGQ C;  4DAY A;  2H1E A;  4K5X A;  2B2T A;  1SYF A;  1CHQ D;  1FNW A;  3CU7 A;  1ET9 A;  2AWO A;  4DK0 A;  1LTS D;  5JVH 3;  3HOV B;  1JOO A;  1EY8 A;  2KJX A;  2R61 A;  3A8I E;  2L1B A;  2RBM A;  1C4Q A;  4ZLT F;  1ZKO A;  3NTH A;  1JIC A;  3PIP 3;  4BA2 I;  2K04 A;  1V1P B;  3NWT A;  1KDA A;  4HED A;  1OXV A;  1TWC B;  2TMP A;  1A2U A;  1LAB A;  5E4W C;  2MJ8 A;  3D3R A;  2EYF A;  5IGD A;  4IUT A;  4B9W A;  1U4P A;  3DWA A;  2QDB A;  3GO5 A;  1EY7 A;  2NVT B;  1MD2 D;  4WOR A;  4DNR B;  2QF7 A;  3D8G A;  4RWS C;  2IT1 A;  3DM1 A;  1BCP D;  2E2I B;  4RCO A;  2L12 A;  1E2W A;  2A74 C;  3DHQ A;  4RAU C;  3I4L A;  5KNC A;  1ZYR D;  4FXG C;  2CQA A;  1XXG A;  1ROD A;  4H7B A;  4EVO A;  3WDN A;  3RMH A;  4RA8 A;  2WV6 D;  2F0W A;  2PQE A;  3LX0 A;  3S16 B;  4BBR B;  5ELE A;  5CV9 A;  4RGT A;  4ZKC B;  3GTL B;  3TP5 A;  1GHK A;  1SJE D;  1V1P A;  4IUP A;  4KHV A;  2EYO A;  5EJW A;  2ICE C;  3L7Z C;  4X3U A;  1EYD A;  4I65 A;  5I2X A;  4KD4 A;  1MI2 A;  4C3H B;  1LT5 D;  3S1R B;  3ZYY X;  4X3S A;  2VUM B;  2R92 B;  1JB3 A;  2XIW A;  3HOW B;  1EY0 A;  3L3O C;  5FO7 B;  1O7L A;  3E6Z X;  2R7Z B;  4XQN A;  3TP7 A;  3A56 A;  5K5P A;  3OWE B;  5CR3 A;  3C1F A;  1J8I A;  2A68 C;  5JEA J;  3VA5 A;  5IIF A;  2B8F A;  2K05 A;  3LWE A;  1SYE A;  2FMM A;  2X69 A;  2M2L A;  3SEB A;  1Q8I A;  1EQV A;  3S14 B;  2E76 C;  2NN6 G;  1TS2 A;  2GA4 B;  3MFG A;  4HSV A;  1CA5 A;  1PTO C;  1PZJ D;  4OO1 H;  1F77 A;  2A6H C;  2F1M A;  3VR5 A;  1JQY D;  2IX3 A;  3KUP A;  2IL8 A;  2JA5 B;  3KLS X;  4A3K B;  4XDX A;  4NMZ A;  1HA5 A;  3T4A C;  1K8O A;  1PZI D;  2A69 C;  3I70 A;  5KYL A;  2PO4 A;  1JOR A;  1KTK A;  5D14 A;  1W6K A;  2D9U A;  2BDO A;  2PZU A;  1WD0 A;  1ONL A;  1TS5 A;  1EIG A;  3F2U A;  1E2Z A;  1SYG A;  4RHR A;  1TU2 B;  4NW2 A;  4F7X A;  3MEH A;  1S4Z A;  2SOB A;  2X6L A;  1STN A;  3TBI B;  1LT6 D;  5CMD A;  3DWP A;  1RHP A;  3AMU A;  1B9N A;  5M9O A;  4TQU S;  1ENC A;  1ZXT A;  3U9O A;  1GXD C;  4Q5V A;  1AW7 A;  1IKM A;  2TSS A;  2BA0 A;  4KKT A;  1G6Z A;  2F0S A;  4IFD I;  4CJ0 B;  5D3I B;  3S1Q B;  4RGN A;  1ENA A;  3TP6 A;  1FD7 D;  2DY8 A;  4KMU C;  1D6E C;  1EL0 A;  5JEA G;  1XTC D;  5C0X I;  1J9O A;  4CKB A;  1WTW A;  4K14 A;  3R93 A;  3OWF A;  4M1U B;  4G7H C;  1WVL A;  2I07 B;  4G7Z C;  2NVQ B;  3QWN A;  3SK8 A;  3PO3 B;  4HAE A;  1QG7 A;  5FO8 B;  3D31 A;  1XYI A;  3BDL A;  2DN8 A;  2JYO A;  1D5Z C;  1DJR D;  4DNT B;  4PMB A;  2K33 A;  3IAY A;  1I50 B;  2F0E A;  2LKV A;  1SFO B;  1IL8 A;  1ESF A;  4X3K A;  3HKZ B;  2O5I C;  1HFG A;  4KI0 A;  5A2Q L;  3PIO 3;  1PTO D;  4ME5 A;  4HTH A;  2F4I A;  1DOM A;  5A35 A;  1CK1 A;  5KEE A;  5J22 A;  2QIL A;  4FF2 A;  1B3A A;  1A3T A;  4N9T A;  4IUV A;  1S5E D;  5FOB B;  2EZV A;  1Q90 A;  2K7V A;  1IW7 C;  1SXT A;  3A8J E;  3HOX B;  5FO9 B;  2KEC A;  1QB5 D;  4TRD A;  1UEA B;  2A69 D;  2WAC A;  2EYJ A;  1B1Z A;  4FF1 A;  1GJX A;  4DU9 A;  2BE5 C;  1DOK A;  4A3E B;  1PFN A;  4K8J A;  4IN3 A;  3K5L A;  1HUM A;  5DM6 3;  1B53 A;  5CV8 A;  3S1N B;  1ET6 A;  2Y0S B;  4CJ2 C;  2ID0 A;  5I4D A;  4WFN 3;  2K28 A;  3S2H B;  1LT4 D;  3TSS A;  3D6C A;  3GTQ B;  2D5D A;  3M4O B;  3MXN A;  2F0K A;  4NDX A;  4OIK A;  1DCZ A;  5EKK A;  1D5X C;  3S9W A;  4XIG S;  3SK6 A;  2K32 A;  2N55 A;  2SEB D;  2V4D A;  5FLX L;  1V1O A;  4ZKB B;  3SDZ A;  4KY6 A;  2HUG A;  3V05 A;  5C6A A;  3H91 A;  4RKL A;  1D1I A;  5T1I A;  2EY5 A;  3QJY A;  4ILW A;  4J8Q A;  3SE0 A;  3GTK B;  1RTN A;  3O13 A;  2AUK A;  2WP8 J;  3NHH A;  3Q24 A;  3KBG A;  1TR5 A;  1LO5 D;  4CKE A;  1I4R A;  1PRT B;  2OF1 A;  2ZXO A;  2AWN A;  2XRQ D;  1STE A;  3ITP A;  3J80 L;  1KAA A;  2XVS A;  1B50 A;  4U67 3;  2JSO A;  3PUY A;  3KK7 A;  1NR2 A;  1SNO A;  1VMC A;  1BCP B;  5FLX E;  2O5J C;  1IYU A;  2NN6 I;  1HFN A;  1GOZ A;  1SSO A;  2N88 A;  3CQZ B;  4FP5 D;  1K83 B;  2O2L D;  3BDO A;  2CHB D;  2BCO A;  3U9S A;  1DOL A;  5EKI A;  2F03 A;  1QE6 A;  1RCV D;  5M5Y B;  4DF7 A;  3MVV A;  1ZYR C;  4PMW A;  4H44 C;  1GUW A;  1EYA A;  1TWG B;  5ELD A;  4BY1 B;  3AU7 A;  2EDG A;  4OO1 G;  4RH6 A;  1H9R A;  2IX0 A;  4A3D B;  2WAQ B;  3HOZ B;  3L9A X;  5F2D A;  4CGY B;  3UI2 A;  3NP8 A;  1C8C A;  1VF5 C;  1X32 A;  5KRU A;  2HCI A;  2F3W A;  3NSW A;  4XYO A;  1STA A;  2EYM A;  1TVX A;  1IW7 D;  1PFM A;  2IX1 A;  5JEA H;  4O1N A;  1I4G A;  2C5C A;  2O4X A;  4QCL A;  5KIX A;  3J7A F;  3H3V C;  2BE5 D;  2F0U A;  2PZT A;  3HOU B;  5HUR A;  1F9P A;  4O42 A;  2MGS A;  3H94 A;  2A5H A;  1LTI D;  5J1Z A;  2EY2 A;  4B9X A;  2A73 B;  5C4Z A;  3MZ5 A;  4IUQ A;  1HQM C;  1EY9 A;  4IAL A;  3TZU A;  5CV7 A;  1EQT A;  2RSN A;  1Q1E A;  1Y1W B;  3LNN A;  3CRL C;  2WII B;  2KCN A;  1VF7 A;  4KJO A;  1WTX A;  2FHT A;  4EQO A;  2ENB A;  4F88 A;  1RDP D;  2VB3 X;  2R93 B;  3R2I A;  5I9P A;  4PNY A;  3S17 B;  1M4V A;  2AQ2 B;  5K36 H;  2E2H B;  3SVM A;  1SNM A;  2EJF C;  1PTO F;  4C1N K;  2B2V A;  4KKS A;  3CRK C;  2RQX A;  4J1M A;  1G2S A;  3BYT B;  5IOC A;  3C46 A;  4A3G B;  3HG9 A;  3GTO B;  1F2Y A;  3WOE A;  1U9R A;  3K59 A;  4M8A A;  1LTT D;  1AZP A;  5E3F A;  2RSO A;  3A8K E;  2NB0 A;  3Q0A A;  5BN5 A;  1LLR D;  2L5T A;  4K2K A;  2PZW A;  1STG A;  4E6I A;  4X3T A;  4A93 B;  2DNE A;  1Y8P B;  3K5M A;  1R9T B;  1QNU A;  1BOS A;  5CBA E;  4ID6 A;  4CKC A;  4K6D A;  2XWB B;  1PTO H;  2LMC B;  1KLG D;  2F0F A;  4IUN A;  1IYV A;  3ERQ A;  3BDC A;  3K0Y A;  3Q23 A;  3J7A V;  3MC0 B;  3H09 A;  3SHL A;  4L63 B;  5C4H A;  3VR2 A;  3H0G B;  1STH A;  3V2T A;  1LTB D;  1QNK A;  3EA6 A;  4RFB A;  2XWJ B;  1BO0 A;  1OXS C;  1A3V A;  1G29 1;  3TN2 A;  2JEB I;  2KUM A;  5JPM C;  5LL6 X;  1Y69 U;  1LT3 D;  5KGU A;  3TDQ A;  1PDQ A;  2PYK A;  4L8J A;  2E75 C;  1BR9 A;  3FPP A;  2B2Y C;  4KD3 A;  2K01 A;  1WTR A;  3K5O A;  5D65 A;  5DAU A;  2FMC A;  4KTA A;  5I6W A;  5AFW A;  2KHS A;  1S5F D;  2DNC A;  1S5C D;  3I72 A;  4NKL A;  1Y8O B;  2AQ1 B;  1C48 A;  4R8I A;  5ISR A;  3C1E A;  3I4N B;  5IGC A;  1QIL A;  5IGG A;  1NUC A;  1CQF A;  2MHV A;  3HOY B;  2G9H D;  5ELB A;  1KDB A;  5DEH A;  1RF2 D;  4FXK C;  1TWA B;  1FGB D;  2A6E C;  3OIP A;  4ZYS A;  1KNE A;  2Z4H A;  3GQB A;  1II3 A;  2MP1 A;  1EY5 A;  4BA1 I;  1K8M A;  1SNQ A;  1GUS A;  4R8N A;  4XXE A;  3HP3 A;  3T56 B;  2ZXR A;  1OO9 B;  4OO1 I;  1YNN D;  4A3F B;  3I90 A;  2X6G A;  4KKU A;  2F0H A;  3EVQ A;  5E4X A;  1V43 A;  2EVB A;  1H9J A;  4XQQ A;  3PUZ A;  3MXP A;  2NWG A;  2F0N A;  4G4K A;  5TSS A;  2Z4I A;  1NAP A;  2RDG A;  1FYC A;  2C9O A;  3EFX D;  1SDF A;  1LTA D;  4DXF A;  2BA1 A;  2L11 A;  1D2B A;  2MPM A;  3P7J A;  2FIN B;  5C5M A;  1S5D D;  2D2C C;  1FR3 A;  1UAP A;  1GUO A;  2F0T A;  3ONA B;  3FEW X;  1STB A;  2JEA I;  4WJW A;  1U4R A;  2HDM A;  1KAB A;  1KDC A;  3T53 B;  1PMR A;  2HCC A;  1F9R A;  3KLR A;  1MSG A;  1U4L A;  2RDH A;  2EYL A;  5JPN C;  2NZ1 D;  2HDL A;  2Q8I B;  3GTJ B;  1HPC A;  1G2T A;  2RVL A;  1R4P B;  4ZAI A;  4K8I A;  1H9S B;  2B63 B;  5CGK A;  2IJ0 A;  2NVY B;  3SXH A;  3VYS A;  1SYC A;  4H13 C;  4CJ1 B;  3RD4 A;  1JOQ A;  3BYY B;  4C3I G;  1OXX K;  4YIJ A;  1QWY A;  1RD9 D;  3GV3 A;  2F0L A;  4EGV A;  1PLF A;  3OMG A;  5KYI A;  4LMQ D;  1ZEQ X;  5M3F B;  1NR4 A;  1RTO A;  2K5D A;  2B2W C;  1GUG A;  1VCI A;  1TS4 A;  3AB9 A;  5I6Y A;  5K36 G;  2I46 A;  2EOT A;  4F87 A;  1BF4 A;  3MHB A;  3J7Y W;  1RKN A;  3MWY W;  4FF4 A;  2L0C A;  1CA6 A;  3I4M B;  1F2L A;  2SNM A;  5IGE A;  2WKD A;  2A6E D;  4U68 A;  3HRZ C;  4BBS B;  3KBX A;  2B2U C;  1ICW A;  1H9S A;  1L0X B;  1STY A;  2K6A A;  5A2Q E;  2EYH A;  3DEP A;  5EBC A;  3K58 A;  1GUN A;  3NQI A;  3BVZ A;  3I3C A;  1XWE A;  1OXT A;  1DXM A;  1YNJ C;  3BG3 A;  1JE4 A;  1PXU A;  3FMC A;  1Y1V B;  4B08 A;  5EKL A;  4N9P A;  4DAV A;  1HRJ A;  2ICI A;  1CTM A;  5C3W A;  3FPU B;  2WIN B;  1DM0 B;  4RGM A;  3M7N A;  2XRS D;  4LAA A;  4ZUJ A;  2K5Q A;  3VR3 A;  2F3V A;  4HMJ A;  1AZQ A;  1HCZ A;  5JAV A;  2XSC A;  3D4R A;  1Y8N B;  3SK4 A;  3DMU A;  3RZD B;  3IKJ A;  4FNF A;  4IFD J;  4LK1 C;  2F0J A;  1TY0 A;  3NTK A;  3OHX C;  4ULL A;  3SR1 A;  4HR7 B;  3IFT A;  3DUZ A;  4IQZ A;  4RHS A;  3MXG A;  2B2U A;  3R8B A;  4J6H A;  4PQX A;  3RLF A;  1I6V C;  4QMG A;  1A2T A;  1WTP A;  5LL6 S;  2QKI C;  1TY2 A;  4OIJ A;  2E2J B;  1JR0 D;  1VMP A;  4HMI A;  2KCC A;  3QIA A;  1HXY D;  1PRT C;  3D4D A;  2DY7 A;  4A3M B;  4ZQ3 A;  1ILQ A;  1PFB A;  4NP5 A;  3MFY A;  1B4O A;  1JOK A;  5C3E B;  2SDF A;  1EY6 A;  3QO2 A;  2NUC A;  3R2T A;  5IGF A;  3J80 E;  1T5X D;  1HTP A;  2F0P A;  5EPL A;  4R9W A;  2B2T C;  4S3S A;  1XX8 A;  2NBF A;  5LHY 1;  4Z9C B;  4I7Z C;  3ERO A;  5CC4 A;  4JK1 C;  3NPP A;  1EU4 A;  1Z7T A;  1O78 A;  4C56 C;  4WRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...