3MEHA

Crystal structure of staphylococcal nuclease variant delta+phs i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 128
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mehA00
2KQ3A 3SHLA 1KDAA 1KAAA 5EKKA 1AEXA 5EGTA 5IGGA 1EZ6A 2PZTA 3BDLA 5HGTA 3SXHA 4F7XA 2RDFA 4N9PA 4K6DA 3ITPA 1EY0A 4HMIA 4IZ8A 5KRUA 4QF4A 4OL7A 3R3OA 4ME5A 5EKLA 4RKBA 3TP8A 1EY8A 1SNDA 3D4DA 4WORA 2F0DA 3OMGA 4QMGA 4EQPA 5DEHA 3C1EA 1SYDA 1F2YA 3EROA 2OF1A 1SNCA 5IODA 2F0JA 1SYBA 3NK9A 4IUNA 4PMCA 5I9OA 1EYDA 5IIFA 1ENCA 3TP5A 5I6YA 1EZ8A 5E3FA 2RBMA 4K2KA 2F0TA 1JOOA 5C4ZA 4KV6A 1NUCA 3QOJA 5IGEA 2EYHA 2HQEA 4NP5A 2M00A 2OXPA 2EYOA 3D8GA 2F0OA 3P75A 3NQTA 4EVOA 3MEHA 2F0GA 4DGZA 4KTAA 3NP8A 4KY6A 4ODGA 4KY5A 5HURA 5K5PA 3RUZA 2F0EA 3MXPA 5CV5A 5IOCA 3SK5A 1KDCA 2F0UA 2PZWA 3SR1A 4B9WA 1SYEA 2F0WA 5JOBA 4EQOA 3NUCA 3S9WA 3P1HA 4K5WA 3EVQA 1STHA 4H7BA 4J6HA 3U9OA 2KHSA 2EY5A 2EYPA 5CR3A 4KD3A 2EY1A 1RKNA 1JOKA 3EJIA 1A3UA 4K14A 4NKLA 5CGKA 4ZUJA 3OWFA 5C5LA 2OEOA 3MHBA 5DAUA 4HMJA 1TQOA 3PMFA 1EY7A 2EY6A 4IALA 1EY9A 4YIJA 3TMEA 3VA5A 2F0HA 4K8IA 5C5MA 1A3VA 4DU9A 3D4WA 1EYCA 4PNYA 4ZUIA 1EQVA 3SK6A 5CV4A 5C4HA 1JORA 2F0PA 5KGUA 5IGFA 1II3A 2EYMA 3C1FA 3MVVA 4I65A 4R8NA 4ZQ3A 5CV7A 4DFAA 4EQNA 2EYLA 2NUCA 4QB4A 5J39A 2SNSA 1EYAA 1STYA 5KYLA 2F0IA 2RKSA 5C3WA 1A2TA 2WACA 1KDBA 1SYFA 4S3SA 3D6CA 4DF7A 1SNQA 1NSNS 3BDCA 5CV6A 1STAA 4K8JA 2EY2A 5KEEA 5NUCA 1KABA 3HEJA 5J1ZA 5I6WA 1ENAA 1EY4A 1STGA 4RKLA 5KYIA 1SNMA 1F2ZA 4PMBA 4J1MA 2LKVA 1SNPA 4KD4A 2PYKA 5IGDA 1EY5A 5F2DA 1STBA 4K2LA 2SNMA 3V2TA 4K5XA 4LAAA 3QOLA 4G57A 1SYGA 1TT2A 5KIXA 1A3TA 5C6AA 5J22A 1STNA 3NXWA 2PZUA 2F3VA 2QDBA 3QB3A 4HTHA 3T16A 3TP7A 4K5VA 4B9XA 4E6IA 4MIUA 2F0KA 2PQEA 3MZ5A 1A2UA 5C3XA 3SK8A 2PW5A 2F0LA 5CV8A 5IGBA 5M9OA 1U9RA 3H6MA 2F0SA 2F0NA 5E1FA 5I9PA 3T13A 3OMCA 5ISRA 3ERQA 3OSOA 2EXZA 4ID6A 1EY6A 1IHZA 4WRDA 3E5SA 3SK4A 3TP6A 2EYFA 2ENBA 2F3WA 4NDXA 4KJOA 3LX0A 2F0FA 5IGCA 2F0MA 2SOBA 3DMUA 3NHHA 4N9TA 4KJNA 2EYJA 4TRDA 1F2MA 2O4XA 2PW7A 4KHVA 4F8MA 5CC4A 5CV9A 1SYCA 2F0VA 3HZXA 4NMZA 5JAVA 1JOQA 1SNOA 2F0QA 4KY7A 3DHQA 1TR5A
chains in the Genus database with same CATH superfamily
2B3GA 1DXMA 4WFN3 3M4PA 3S16H 1WYDA 3TS0A 3A5UA 4DAYA 5EKLA 3TP8A 4A3IB 1B2TA 1SNDA 5DEHA 4A4IA 3L2PA 3J7A5 1I6HH 1LTGD 1EYDA 3MA2B 3NBIA 2AUKA 3I2ZA 4DV1L 3W1GA 1DOMA 1R4QB 2WB1G 4A3LG 1OXUA 1KDCA 4RH6A 3J81c 3NUCA 3P1HA 1L1OB 4JW0A 2X6LA 2KCTA 4BY7G 1X54A 2RVLA 1GO3E 4G7ZC 2EYPA 2LSSA 1X55A 3X3MA 1S4ZA 3DLLA 1SRUA 3I91A 3HOVB 2CKZB 2YV5A 3D6WA 3HOUH 4KHZA 3U9SA 4J8QA 2NVQH 4IFDG 3HKZG 4ZUIA 1L1OC 2F0PA 5KGUA 3RNUA 3DWPA 4L5SA 1I6VC 4ZQ3A 3CCLA 1O7LA 2EYLA 2PO4A 1BKBA 2SNSA 1NR2A 1BBUA 3FKIH 5BN3A 1B1ZA 3NWTA 4S3SA 4UPAA 3D6CA 3S2HB 1I4RA 4P75A 2OT2A 1DGSA 1ICFB 5IP9H 4A3CH 4C3HG 2LKVA 1WD1A 1PRTC 2RSNA 1C4QA 2XWJB 3MXUA 1GOZA 3Q6SA 4A3DH 1O80A 4K5XA 4Y52H 2Z0SA 2EE1A 5C6AA 4H02A 4OWXB 1JMCA 1AE3A 1TS2A 2VB2X 3J7YW 2J7ZA 2G9HD 2NB0A 2QEXA 3H94A 4ZKBB 1K9MC 1UE1A 3G6EA 4A3JG 2K14A 1I4HA 2F3WA 2RA4A 1FJGL 4BS9A 3G7LA 2F0FA 4F87A 2E5LL 4DAYB 1F2MA 4DR1L 3RMHA 2BDOA 3J7AF 4DV0Q 3PO2B 3VR5A 4BBSB 3DM3A 4H0LC 1SXTA 1AP0A 3ULJA 1KTKA 1EOVA 4G7HC 3PSIA 4O2DA 3CCVA 1IYJB 1D6EC 3FEWX 4BXXH 5EBDA 3BZCA 3GD7A 2EYOA 3P75A 3D31A 5IT9E 5HURA 3HP3A 1E1OA 3ER0A 1M4VA 2O2LD 1HTLD 4YHHL 1ESRA 4JI8Q 4RA8A 1EL0A 1SYEA 2UUAL 1PFBA 2DY7A 1DOKA 5IE8A 2X6GA 4OO1I 2ZJQA 4K0KQ 3OHXC 4B3TQ 3MXNA 4O0AA 5C4XG 4OHJA 1WTXA 3M7GA 4YCUA 3KBGA 4YIJA 1B4OA 4YHHQ 4WJ3M 3K7UC 1A63A 5C5MA 4PG3A 3D4WA 1EYCA 2RCFA 4KLKA 2RF4A 1BCPB 1X3FA 2B39A 4GOPA 1KLGD 2Y0SB 1A2TA 2L4NA 4R4CA 4JI0Q 3KF6B 5NUCA 3MFGA 3UDIA 2YU9H 1GUGA 3CCSA 4BBSH 5AJ3L 4OIKA 5FO8B 1Y1VG 2L9HA 3NSWA 3PQIA 2VNUD 4JCVE 1KHIA 1QOHA 4UDUC 3HOZH 2ALYB 1PH9A 2Q2UA 3LNNA 2NZOA 2I5LX 3HOYB 1UE6A 3NBHB 1PTOC 3MZ5A 4OX9L 2PQAA 2JA7B 2ICIA 2F0SA 1BBWA 4C3JG 1XYIA 2IPKD 4PZ7A 3EN2A 4A3DB 1VQIA 1KRSA 1I94Q 1JOQA 1JJCB 4LFCQ 3DHQA 1HNWQ 2D0PA 4FDBA 1F9PA 1XPRA 1KDAA 4QIWE 1YI2A 3BDLA 1V1PA 3BYYB 1YBYA 3HOWG 2RHSB 2C5CA 2JA6B 3HOZG 3GTMB 2XNAC 2TMPA 3D4DA 2XIWA 1G2SA 3C1EA 1SYDA 4A3KG 4A3KB 4HJAA 3I4LA 5JPNC 4G4KA 2VQEQ 1OO9B 1FL0A 4C2MB 4QUFA 1X56A 3QG1A 4C3HH 4KTAA 4A3FH 1IKMA 4KY6A 1S40A 3RN2A 1TU2B 3R93A 2MP1A 1HA5A 4IPGA 3MXGA 2B2VC 4UHVA 5BR8L 1WTOA 1IW7C 4LF8Q 4NXML 3B6YA 3VYUA 1CKMA 2K52A 4DV7L 3PMFA 2VZAA 1DCZA 3UDGA 2K5DA 4IFDI 4FYDA 1J9OA 1D7QA 4X66L 2GA4B 4YWKA 2PMZE 4JOIC 4IN3A 1BR9A 1C8CA 1D1KA 4C3IB 4C3IG 3A8JE 3J81L 5C0XH 1GUSA 1EOTA 4DV2Q 4X3SA 3RZDB 1PFMA 3RZDH 4IOAA 2XGTA 3J81E 2R7ZH 1ENAA 1VQ4A 2R92H 1ZYRD 2DNEA 3SEBA 1BDOA 5D3IB 5F2DA 1YHBA 2IW3A 2OCEA 5IYBG 5KIXA 1YNJC 3I56A 1STNA 4Q5VA 4LFBL 4ZK9B 2PQEA 4LUOA 1E24A 1U9RA 2E2HB 2AKWB 3AMUA 1HA6A 4BA2I 3K5MA 1OTCA 4IPCA 4DR3Q 1IBLL 1WCMG 1LTBD 4ALPA 3LX0A 4HCSA 2IL8A 2HCIA 2D5DA 2VQEL 2PW7A 4B3SQ 4DR4L 4X65Q 2UUBL 1LT3D 2SEBD 1PXUA 4X64L 2F0QA 5CV7A 1UUPA 5EKKA 2RDFA 3P7JA 4N9PA 4ZYSA 2KEDA 3PIP3 2BH8A 2UU9Q 4DR7Q 2AWOA 3BZKA 3BJUA 3JC66 4RWSC 1HNWL 3S1NB 2VY3A 4A3BH 4MZ9A 1G8ZD 2NZ1D 1SFOB 4FF2A 2RSOA 4LNQA 2F52A 1B3AA 5K36G 1NUCA 4X66Q 3M3YH 1Z6HA 1G51A 3NELA 4DGZA 4M1UB 2VB3X 1STEA 1PRTF 2D9UA 2KBNA 2PZWA 1WTWA 2A68D 1IYUA 1XWEA 3NQIA 5FJ8H 3CCMA 3F2UA 1MSGA 3TDQA 2KHSA 3L3OC 1EUJA 4HCEA 4ZUJA 2ICEC 1CQFA 1XMOL 2OEOA 2E76C 3BG3A 5GROA 1VQNA 1I3QB 1QE6A 3L0OA 2IHFA 1EY7A 2EY6A 2Z6KA 4YY3L 1EY9A 5ELFA 1D5MC 1X9NA 1W6KA 1EQVA 4Y7NB 4JC0A 1Y69U 2OQ0A 1II3A 1D8LA 4DUZL 4EQNA 3MTSA 5FOBB 4QGUA 1ILQA 1PDQA 2G9DA 5KYLA 3G71A 2R93H 1GXDC 4B3RQ 3GTJB 1KABA 1FYCA 1CUKA 3FPPA 3H0GH 4A3MB 4B3RL 3I4NB 4KKUA 1PH7A 1DZ1A 4B3TL 1NTGA 2L11A 1EEID 4XXEA 2F4VQ 3VYSA 2R6GA 4A3GG 4BY1H 1U0LA 4B08A 4JI3Q 4MTNA 4PQXA 2EXZA 1EY6A 1VQFA 1ENFA 3CXCA 2EYFA 4XTCS 3J81i 4NDXA 2JEAI 1XPUA 5FO7B 3HFZB 2VUMH 3OOCA 1ESFA 2R93G 5J22A 1KAWA 2O4XA 4DAPA 5AJ3Q 4HJ7A 1I4GA 1I50B 3VA7A 1IBKL 3M4OB 1NY4A 2KOLA 1TS3A 1UE7A 2Y0SG 2JA8H 2EDGA 4P72A 3AFQA 4IUPA 4A3GH 2EPBA 2NVXH 1V1QA 3SGIA 1F77A 1T5EA 1WD0A 5IT9c 3FDTA 5IP7H 1RJTA 1B9NA 4HIKA 3CD6A 1W2BA 1QB5D 1EZ8A 2BOSA 3CKIB 5JVH3 1S5CD 3ND8A 4P71A 3MEHA 2EIFA 3UE1A 2YTVA 3SK5A 1GHJA 5TSSA 4JI4L 4PMWA 4V190 5C44H 3EVQA 4TQUS 1ICWA 1MSHA 4J6HA 4J15A 5IYCH 1Y1VB 1PH3A 2FXQA 5CGKA 1VQHA 1PYWD 2D62A 4HMJA 1MI2A 1K8AC 4DR2Q 2KA7A 4ZKCB 1AFPA 1SMXA 1KRTA 1B8AA 1RHPA 4PNYA 1HNXQ 1TWFH 1QUQA 3DEPA 1F9SA 3CC2A 4EVOA 3HOWB 4DV3Q 2E2HH 3ONAB 1SYFA 3PGZA 2FFKB 5D65A 2IX3A 5C44G 5C44B 4C3JB 1AE2A 4NB3A 1YNXA 4R9WA 4A3EH 3S2HH 3U50C 1NCVA 4LF6L 4HIMA 2K75A 5JEAG 3CW2C 3X3NA 4A3IG 2E5LQ 3T1HQ 1QZGA 4CKEA 3I90A 3TQYA 1PMRA 3HOXB 1LTRD 4DV6Q 3GTOB 4X6AH 1GUNA 1JR0D 1D2BA 1E0BA 1Z9FA 4L6TB 2Z8LA 1WTRA 4N9TA 1CZWA 1GJXA 4TRDA 4DV6L 4QJFA 1VMPA 1WCMH 1FVIA 4DV5Q 1U4RA 4GN4B 2VUMB 4XQJA 2KQ3A 1AEXA 3PIO3 2B2UC 1PVOA 1RODA 1MJCA 3R3OA 4LF5L 1N33L 1F2LA 3EA6A 3OMGA 4X64Q 2ATWA 4DUZQ 1VQGA 2B2YA 4IPDA 3GTKH 2F0JA 1SEBD 4PMCA 3RLNA 5IIFA 1ENCA 4RHSA 1BUVT 4R4IA 4P2CB 4JBKA 4JI7Q 3OPOA 4C2MH 1U4MA 4YY3Q 3S14H 4RG1A 3KJPA 2E2DC 2CVRA 2MO1A 4LFCL 1JE5A 4EQOA 3GTJH 1QVFA 1TY0A 3DM1A 4HIDA 4DR2L 2MFIA 3ULPA 1HH2P 2NZHA 4H7BA 1S72A 2HCCA 2N8NA 4XQNA 2K6AA 5C5LA 1PRTD 3K7AB 3I55A 1GKHA 1Y14B 2MHVA 4CDDC 2MUYA 4Y7NH 1G291 2I5MX 4OX9Q 1FNVA 3HOWH 3KF6A 4DAMA 4RHRA 4KK7A 2UUCQ 1EFID 3KFUA 3OW7A 2UXDQ 3SK6A 5CV4A 1N36L 4I7AA 2NVTH 5C4XH 5I2XA 1RDPD 5IGFA 1NNXA 1F9QA 1PA6A 2PMZB 4QB4A 1WFQA 2KUMA 1D1IA 1VMCA 5C3WA 1H9MA 1EU3A 3CCQA 1G91A 4LF6Q 5GADC 2B2WA 5FLMG 3S1QH 4A3FG 3HOYH 3HEJA 5D14A 1LTID 2IX0A 2LMCB 5M3MG 3E3XA 1MBYA 3IRBA 4X65L 1O7YA 2UUBQ 3PO2H 5FK9C 2ZXOA 1VQBA 3PUWA 1PYBA 5BN5A 4UAIA 3ZYYX 3RD4A 4DV4L 1LACA 1BBXC 2N3SA 3IFTA 4HTHA 5EPLA 5JJZA 2A5HA 3J80E 4JBMA 1SAPA 3HOXG 5IY0A 3MEFA 5E1FA 2MO0A 2Q2IA 4OONA 4WRDA 1L0WA 2IJ0A 2YTYA 4RFBA 1Y1WG 3CCUA 4K0KL 1E2VA 2H5XA 3PUXA 4C3IH 4CDCC 2EYJA 5CC4A 5DM73 4BWGB 1G6PA 2UXCQ 3M4YA 2I46A 2A6ED 1R9TH 1N33Q 4LF5Q 4M8AA 2L12A 2JA8G 2DJGC 3GDEA 3H91A 2ZTDA 3M9BA 4AH6A 2QILA 4K6DA 2WKCA 4BBRH 2M2LA 1Q8KA 4LFAL 1LTTD 2N88A 3CRKC 4DR6Q 2L55A 1EIGA 4FNFA 4RKBA 1J6QA 3A8KE 2DN8A 2ZTEA 4KI0A 1F2YA 3GTQH 3NK9A 4DA2A 1YVCA 1CKNA 5E3FA 3F2DA 3BVGA 4P74A 2VS1A 2CWAA 2HQEA 3M85A 2F0GA 1JWMD 4G7OC 5G3LF 2PI2E 1OXTA 1RTOA 2R92B 5FLXc 1XTDA 1ILPA 2EJGC 3FHWA 3S9WA 3S15B 1SE2A 4K5WA 4JPBW 3I73A 2A6HD 4C1NK 3HOVH 1IXRA 3FKIG 1CT1D 1RKNA 1WVLA 3T1HL 1CKNB 2JA6H 1O7IA 1TQOA 3HOYG 2AMCB 1B44D 3I4NG 5GAEC 1PH1A 4K8IA 1XNRQ 1QJOA 2UXBQ 4GOPC 1JORA 1H95A 2B2UA 4AQYL 2NN6I 3CCEA 4DV3L 3A55A 3TREA 3HOVG 4JI2L 1K83B 3V96A 5IYBH 1HNXL 4DR6L 1NMFA 3I7FA 4LJZC 5FLXE 1PZKD 1QILA 1YZ6A 3I72A 3V05A 1VQCA 1AZQA 1K3BC 2A69D 3OWEB 1LTAD 2MPMA 2E74C 2A6EC 2XSCA 3ND9A 1BCPC 4U68A 1M90C 4JYAL 1LUZA 2SNMA 3PF4A 2CQOA 2PNRC 1K8MA 4DR4Q 5ELCA 4A3KH 3WOEA 3GV3A 4C1NI 4XDXA 1K8OA 3K8AA 2WP8J 1SFOH 1SR3A 2IY5B 1S5DD 4BBRG 4BBRB 2E2JH 2F0NA 2XVSA 2ES2A 2KVMA 3I3CA 3HKSA 2BA1A 2ENBA 4LUVA 2SOBA 3NHHA 3QWNA 4IFDH 1C48A 1PZJD 3MAQA 3K0YA 1CA5A 4X3UA 3U4VA 3H15A 3NE5B 4HAEA 3AB9A 2C9OA 1MHWC 5HGTA 4OGQC 1XPOA 1IW7D 1PTOH 2XN9C 4QF4A 2IWHA 2VQFQ 4OL7A 2K5WA 1CHQD 4QCLA 3EFXD 4DV0L 4DV2L 2E2JB 4GLXA 3EROA 3AQQA 4QQBX 1E1TA 4A3DG 3A74A 5KNDA 1F9RA 4X3KA 1JOOA 3PO2G 2PI2A 3PV0A 5IGEA 1Q1BA 3D8GA 2F0OA 1PHJA 5M3MH 1M8AA 1TWCH 5GQOA 2UUCL 2K33A 1Z47A 4PZ6A 5C0XG 4R1JA 3IKJA 4YCVA 4DV7Q 4FP5D 2NVXB 1QNKA 5JJKA 2HHHL 1GVPA 4LF8L 2R7ZG 2GVBA 2R7ZB 2EY1A 4GN5A 1ZYRC 1KXLA 3OWFA 4X62Q 1JCKB 3LWEA 5M5XH 1E22A 3KF8B 2OTLA 2JA8B 4CGYB 1BCPD 2QGQA 5C4XB 4IJLA 4IALA 3TMEA 2F0HA 3ERSX 1YNJD 4GLAC 2CW0C 2WB1B 1IBMQ 1Y8PB 2EXDA 1BNZA 1AN8A 2N55A 1WCMB 4P73A 3MVVA 1FD7D 3C1FA 1IL8A 2R7FA 1RL2A 2F0IA 2RKSA 4ZLTF 5KEEA 5G3LD 3AFPA 3RLFA 3CQZB 1RCVD 1SNPA 2I5HA 1QVCA 3H0GG 4WJWA 4RAUC 1VQEA 3K59A 2RDGA 3BVMA 2NTSA 2BE5D 4DV5L 1HQRD 1Q90A 2DJFC 1B50A 3W5OA 3NXWA 1T9HA 3Q22A 5ELOA 1HHVA 3L7ZC 1EQQA 5FO9B 2PW5A 5LMNQ 2JA7G 1Q1EA 1KC8C 1IL2A 1SSOA 1S3OA 3KLSA 1UE5A 2E75C 2PNHA 2JA5H 3PO3G 4F88A 3CPWA 1SYCA 3HZXA 3I4MH 3H3VC 5D3DA 4L8JA 3GO5A 5DNFA 2QA4A 4RCOA 1KNAA 1VQ6A 4A3JH 3K6OA 3HOUB 3E0EA 1T5XD 2B63B 3A7AB 2TSSA 4JI7L 5DLQE 1FNWA 3D0FA 3NTHA 1EY8A 4WORA 1CSQA 4EGVA 1GM5A 2JA7H 3ICEA 2HD3A 2KHJA 2OF1A 3HOXH 2UXCL 1Q3LA 1YNND 3TP5A 1IZ6A 1YJNA 2LFNA 4DK6C 1HQMC 2D2CC 3M3YB 1CSPA 2K01A 4N8FA 4A3BG 1CM9A 5LHY1 2B63G 1PTOF 1SDFA 1UNSA 1HZAA 3TS2A 5GAHC 1V1PB 2QDLA 4O1NA 1XMOQ 2Z4IA 1I94L 1Q82C 2J0TD 2RQXA 3S24A 2C35B 4X62L 1JOKA 2ZJRA 5FLMH 1LM0A 1KLUD 4DXGA 1VF5C 2WAQG 4LW1A 2B2WC 2V1CC 4JBJA 2AUJD 4JI8L 1NAPA 2FHTA 1Q81C 1S5BD 1A3VA 1CZGA 1PLFA 5T1GA 4IUUA 5CMDA 3A54A 2V4DA 1AH9A 5E4XA 4JI5Q 3E9HA 5J39A 1RD9D 3I8ZA 3K0XA 1KDBA 1Y1WH 2E2IB 3QO2A 2KCNA 2A68C 3R2IA 1H9JA 2UXDL 2E2IH 3OYYA 4EX5A 1F2ZA 3NBHA 5ELBA 1B53A 2LXJA 1L2FA 4JI0L 2E8GA 3J80c 4CBVA 4B3SL 4GLVB 1VQMA 1V43A 5E7NA 4ZAIA 5BR8Q 4UY8C 1SYGA 2JYOA 2GN5A 1LTLA 3T16A 4A3IH 1XMQQ 1EEFD 3RZOB 3T1YL 5C3XA 2K50A 1CK1A 2F0LA 4JI1Q 4JVZA 3K58A 1J5EQ 1Q86C 5A2QL 3F1ZA 3OW2A 5C3EH 3D4RA 5IGCA 1YEZA 2HQLA 4KJNA 5CORA 1WOCA 2MJ8A 1TIID 4IQZA 4LAAA 2J4XA 1B9MA 1FNUA 3KDFB 4ZRZA 3CMEA 2O5JC 5IYDG 3PF5A 1CFMA 2WB1E 4IZ8A 2QKIC 2A19A 4ME5A 3VR3A 4R4QA 3KLWA 2A73B 3HRZC 1EU4A 1BCPF 4A76A 3U58A 2Q2HA 1TKWB 3CHBD 1JJGA 4IUNA 4V0BA 4A3FB 2XRQD 4KHPL 5C4JB 3N6RA 3F2CA 3J81j 2K05A 1HR0L 3HKZB 5COYA 5ELNA 1PYSB 4L5RC 1WTPA 4LMQD 5I4DA 1DJRD 2I0QA 1VQDA 4OELB 1WI5A 1Q7YC 3T56B 1C0AA 3DEOA 2EY5A 3JAMi 2ZM6L 5M3FG 1H9KA 3WDNA 3MHBA 4U673 4DUYQ 4R8IA 2JK8A 3S14B 3HOUG 3KJOA 2CH4A 4ME3A 3GV6A 1SLJA 2Z6BA 1VCIA 4HSVA 2ZJPA 3KUPA 2EYMA 4DAVA 1V1OA 4LF7L 3BU2A 4DNIA 2AHOB 1CKOA 4GNXB 3WOFA 1TVXA 3A0JA 3S2DB 1JQYD 2VUMG 4K8JA 3OTOQ 1LV9A 1VS0A 2HT1A 1Y8NB 1EY4A 1ET9A 5A35A 3W1BA 4KD4A 3KOJA 1SJHD 4AQYQ 2NN6G 4BA1I 4LF4Q 4HIOA 4POFA 1FGUA 2BDNA 4G57A 1U4PA 1J5EL 4OEMB 3S1NH 2F3VA 4A3LH 1DYQA 1L0XB 1HUMA 1Q12A 5C0XI 4E6IA 1JWSD 1PZID 4A3EG 5CV8A 5M5XB 2L5TA 2CHBD 3VYTA 2KJXA 2PCFB 3DXJC 3Q23A 1TWHH 1E3PA 3QR8A 2WFWA 1Q8IA 2XTIA 1TS4A 3UDFA 4DV4Q 4XT1B 4F8MA 3RN5A 2QF7A 5JAVA 2KHIA 3KBXA 5FKAC 1SNOA 3MXNB 3LWUA 1J8IA 3H3VI 2PZTA 2JA9A 3NPPA 4RMFA 4UP7A 1WTVA 1SE3A 5CBEE 1A8VA 3J80i 3SDZA 1X3PA 3IL8A 2DNCA 1I4XA 5EPJA 2Z6KC 4DPGA 4BY7B 3J80L 4IO9A 1PTOB 3GTPB 4NPSA 4K2KA 1JJ2A 5JEAJ 2DUDA 2FINB 1HJPA 2M00A 3A5ZB 2UU9L 1GUOA 1XJVA 2PPBC 1BOSA 3NP8A 4N8X1 2FMMA 2WV6D 2F0EA 3S1RB 3PUYA 3I4OA 1TWHB 1UAPA 3SR1A 1KNEA 1A62A 1HZCA 2K5VA 5K36H 3H3VH 4IUVA 1K0SA 1IBLQ 2R3ZA 4L5QA 5M5YB 2B8FA 4GKKL 2K03A 4GNXA 3GP7A 2K5NA 3CPFA 1NMGA 1VQ9A 2QW7A 4DR5L 2IHEA 5L37A 3JAME 2NVYH 4Q0FA 3LGJA 1X3QA 4XT3B 2K28A 4DNTB 1LLRD 1I3QH 4DF7A 3BDCA 5CV6A 1HFNA 2RCNA 2ID0A 2EY2A 3STBC 3VR6A 5J1ZA 5I6WA 1H9SB 3P20A 4QUCA 5JJLA 4TVAB 4A3JB 3QIAA 4DXFA 1QUQB 4K2LA 2ZXPA 4HJ8A 1CI3M 5IP9G 4A3CG 2Q8RE 1TT2A 1YJWA 4OIJA 5JPMC 1KD1C 2F3IA 2PZUA 4JBWA 5BN4A 2SDFA 3BZDB 1K0RA 2B29A 2YYZA 3H6MA 3T13A 2N49A 4MN3A 3IAYA 4B3ML 3NENA 1QVGA 4LWCA 1TWGH 5CYUA 4DV1Q 3S15H 1VQAA 2K1BA 3CCJA 4IFDJ 3C2PA 3R8BA 1QWYA 2PQAB 3I4NH 3SK8A 3K80C 3SHLA 2JA6G 3GTLH 4A3MG 4KN7C 4JG2A 3OIPA 3ITPA 4HMIA 4BY7H 5KNCA 3UDXA 3K81C 1K8GA 2HDMA 2JN4A 4EQPA 1PTOD 1SROA 2K04A 4IUQA 5I6YA 4OXPA 4NW2A 5J3BA 3CU7A 3QOJA 1X3GA 2Q8TA 5IWAL 4DR3L 1N32L 5KNBA 4XQQA 2BCOA 3KF8A 2H1EA 2HUGA 1X6OA 5I2YA 5CV5A 1HFGA 5LMNW 1B7YB 3PIOA 4A93B 4A93G 3STBD 2H4OA 5DM63 1GUWA 5EQ0A 2AQ1B 1N34Q 3EJIA 2OQKA 1DD2A 2IX1A 3NTKA 3CP0A 5DAUA 1TY2A 1B70B 1I4QA 1YITA 1UEAB 4JI4Q 1JWUD 1M1KC 3G48A 3A56A 1MGSA 5CBAE 1P16A 1MD2D 1TWCB 1IKLA 1HXYD 3S1MB 3TEHB 1XXGA 2WKDA 1BXTA 4DFAA 1MKHA 1XTCD 2NUCA 2F03A 1YHAA 1EYAA 1PH6A 3AYHB 4GNXC 2AQ2B 2DGYA 2JQOA 3D3RA 4Z9CB 1NE3A 3BVZA 3HKZE 4A75A 1GHKA 2XRSD 2CCZA 3ULLA 2WINB 1QZHA 1VQKA 3GTLB 4ILWA 4NXMQ 3PUVA 3T53B 4OO1G 1A6XA 2QEJC 2ZM6Q 3FPUB 2YTXA 1O7ZA 3KYHC 4APVA 5LL6X 3KDFA 1Y1VH 2NYZD 2CWPA 1TWGB 1LTSD 3CC7A 2HDLA 5HGQA 5ISRA 2MGSA 5IP7G 1E2WA 3C46A 3TP6A 2ASBA 4KJOA 1HR0Q 4LF4L 3AU7A 3S1MH 3A8IE 1OXSC 2EJMA 4HEDA 2UUAQ 4NMZA 4ULLA 1SMYC 2MQHA 1PFNA 4AYBE 4JYAQ 1DONA 3I4MG 2NVQB 1EIHA 1FGBD 1I5FA 1ZEQX 4GS3A 3VR2A 1WTQA 5EGTA 1EZ6A 3TZDA 4H13C 4F7XA 1PV4A 2JA5G 5IWAQ 1N32Q 5JVG3 2P5ZX 2K5QA 2WIIB 3R2TA 4JI2Q 5KRUA 4FF1A 3GTKB 2BH2A 4O42A 1HR0W 1ML0D 2B2TC 1ONLA 1K83H 2BA0A 1ASZA 2I07B 4BY1G 2CW0D 4R4TA 2RBMA 3I4MB 1VF7A 3MC0B 1ET6A 3O13A 2OXPA 1EWCA 3Q0AA 2B2YC 1PH5A 2JA5B 1RTNA 4JV5L 3RUZA 1LABA 4DUYL 1LT6D 5EPKA 1JE4A 2KECA 3T1YQ 2YU9B 3EIVA 1HNZQ 3K5NA 1LO5D 4IOCA 1YJ9A 3JAMc 5T1IA 3FKIB 3GTGH 1A3UA 1QG7A 4K14A 1FJGQ 5IYDH 2JP1A 4B3MQ 3S16B 4JI3L 3E9IA 3FP9A 4EQ5A 2Z4HA 4HJ9A 2WAQE 4DU9A 5C4HA 4KHPQ 3H0GB 4CDFC 4A3MH 3CQZH 4JI6L 1PH8A 3GTQB 4C56C 2GVAA 5LL6S 3GTMH 1X65A 1Q46A 3NTIA 4YWMA 2WACA 3C3LA 3G4SA 3PCOB 5FLXL 4A3EB 5H1SE 1UEBA 3QJYA 4C3JH 4DK1A 4LFAQ 3CRLC 4PMBA 2JSOA 1SMYD 1AW7A 3KK7A 4MTKA 1R9TB 1X3EA 1W3SA 4PZ8A 1TWFB 2F1MA 3V2TA 1I6HB 5EJWA 4RGTA 5C0XJ 3NEMA 3TP7A 3KLRA 4QIWB 5IGBA 3RR5A 2A8VA 1YNNC 2N78A 1IHZA 4XYQA 1SJED 5M3MB 5CV9A 3EQLC 1HUNA 1XNQQ 4TKOB 1E2ZA 1Z7TA 2EQSA 3SXHA 1YIJA 2BE5C 4JOIA 4DK0A 1A0IA 2FJ2A 5M5WB 4QMGA 3E6ZX 1OXXK 3CC4A 5IODA 5I9OA 4GKJQ 4DR1Q 1EQTA 4RGMA 1B3QA 2K4KA 1VQJA 1KQSA 1O78A 4NP5A 4DNRB 1K73C 1PH2A 3TZUA 1TWAB 1XNQL 1I50H 3M4OH 1QCBD 2B2TA 3PIPA 5LMNL 1U5KA 2F0UA 4L5TA 1I4PA 4CJ2C 2FMCA 1LYLA 3GQBA 1NJIC 2R92G 4FF4A 3K5LA 3AEVA 1JB7A 4FXDA 4IPHA 1SE4A 4WJ4A 1N9WA 4I7ZC 3S17H 4DKAC 1E7ZA 2R61A 1U4LA 1VQ7A 4LFBQ 1H9RA 4ABNA 1UWVA 4QY7A 2QCPX 4FVMA 4KMUC 4I65A 1L1OA 3VDYA 1JICA 4GZYC 1N8RC 3CAMA 4RCNA 4CJ0B 3TRZA 3GTGB 5KYIA 1SNMA 3VR4A 4CHTB 2R7DA 2JEBI 2JJQA 5EKIA 1RIPA 3TSSA 5IGDA 3MFYA 4GKKQ 1BQQT 1S5FD 2B8GA 2MNAA 3K57A 1VDZA 2LY7A 2RDHA 2LS01 1A3TA 4JI6Q 1DM0B 2NN6H 4B9XA 5C3EB 4FO2A 1C9OA 1EWHA 1BF4A 2Q2TA 2KCCA 1HZBA 3OMCA 3ERQA 3PUZA 4H44C 3SK4A 2XWBB 5JJIA 1A15A 4C3HB 2NVYB 1KL9A 4KHVA 1GUTA 4HN7A 1HNZL 1JT8A 5M3FB 2NWGA 2F4IA 4KY7A 3K5OA 3DMUA 5C3EG 1WJJA 2Z9HA 2IT1A 4JK1C 5IGGA 4ZCKA 1Y8OB 1EY0A 5M5YH 2EZVA 3T51B 3FMCA 2ZXRA 2F0DA 3M7NA 4DR5Q 5LMUL 1SYBA 2LXKA 1CQVA 2F0TA 4PV1C 1VQ5A 2DY8A 1SBBB 5C4ZA 1PH4A 3JAML 4KV6A 4LF9L 3VA5A 1L0YB 5JEAH 3E0JA 5K5PA 3MXPA 1WTHA 1K3RA 4DK3C 1YHQA 1D5ZC 4BBSG 2Q8IB 4FF3A 5JOBA 2F0WA 3HS0C 4HJ5A 4CKCA 3BS1A 3GTPH 5EBCA 1X32A 1LT4D 1BVSA 1SN8A 4HR7B 4XIGS 3WWVA 4AYBB 4NKLA 1VQ8A 4LK1C 1N34L 3DUZA 1SE8A 1EWIA 3W2DA 1H9SA 5GAGC 4AIMA 2L0CA 1HRJA 3TN2A 1MIUA 4X3TA 1XMQL 4KKTA 3T4AC 1HTPA 1V9PA 4K6LA 4MHEA 5M3FH 1OXVA 2NBFA 4R8NA 1KIXA 3CCRA 3A7LA 3S1QB 1EYGA 2K32A 5IYCG 3M4QA 2VQFL 2WAQB 1SNQA 4LF7Q 2HIXA 2CH4W 1NSNS 3CMAA 1STAA 4A3GB 1HCZA 2UXBL 3S1RH 4DN4M 1XNRL 2NVTB 3URYA 2B63H 4A93H 1AZPA 3FVQA 1IBKQ 1CHPD 1EY5A 1TS5A 3Q8DA 3UE0A 4LUZA 1STBA 1RF2D 5IT9L 3FRPB 1EFWA 3QOLA 2KCMA 4XYOA 4TSSA 1GD7A 3QB3A 5ELEA 1D5XC 2F0KA 5M9OA 2ZT9C 3RLOA 4UP9A 1K28A 1LT5D 4BXXG 3W3AA 5I9PA 4RGOS 3S2DH 2Z1CA 1BO0A 1V8QA 4BY1B 4R4OA 1TXYA 4RGNA 1C7YA 2F4VL 1R4PB 4KN4C 2F0VA 3U4ZA 4NXNQ 2VW9A 2Y0SE 3PO3H 3PO3B 1ZKOA 1TR5A 2M9VA 2VXWA 2ZTCA 1KAAA 3TBIB 2RHQB 3ZJYC 3S17B 3OTOL 3N52A 3I70A 4LF9Q 2JE6I 2EVBA 1NR4A 2CQAA 3HG9A 4OWTB 2R93B 2JXMB 3DWQA 4NXNL 1SNCA 2L1BA 1JB3A 3HGBA 1CA6A 5FJ8G 3H09A 1HZ9A 2G5DA 4YCWA 2EYHA 2L15A 3NQTA 3EBEA 1QNUA 4ODGA 2K7VA 4KY5A 1G6ZA 4JI1L 4KKSA 5IOCA 4B9WA 4GOPB 4FXKC 2A74C 4MNOA 3Q24A 1ASYA 3BYTB 1STHA 1DOLA 3U9OA 2HIVA 2VL6A 5CR3A 4KD3A 4OWWB 3GTOH 2D0OA 2KENA 1PFSA 2NTTA 1NBWA 5AFWA 4JV5Q 3F8TA 2EOTA 1HPCA 3KLSX 3HOZB 2K5HA 4POGA 3DWAA 1JC7A 2OWOA 5ELDA 3UI2A 1G2TA 1ZXTA 1XX8A 1STYA 3IFDA 4GKJL 4JI5L 3SE0A 1VQLA 4YWLA 4IURA 3J7AV 4A3BB 4DR7L 3VYRA 2AWNA 1VQPA 3MWYW 1N36Q 2A6HC 1STGA 4RKLA 1IYVA 3RZOH 3OIQA 4OO1H 2CFMA 5EAYA 2X69A 1TWAH 2B2VA 4J1MA 2PYKA 4HSPA 2A1AA 3BDOA 4QL5A 5C4JH 1CTMA 4AYBG 3SVMA 1MJEA 1VQOA 1S5ED 4UP8A 4L63B 4IUTA 2QDBA 4GN3B 4CDEC 1IBML 3G6JB 5M5WH 4K5VA 4MIUA 1EIYB 4FXGC 1A2UA 3K7AH 4CJ1B 2AQ3B 3OSOA 5HY6A 4ID6A 2EJFC 3E5SA 1Y1WB 5E4WC 1PRTB 1W6JA 4IJHA 4CKBA 2F0MA 2HHHQ 2OTJA 5A2QE 1EIFA 3L9AX 1EQRA 3NWSA 5LMUQ 3J7ZC 2KEEA 1FR3A 2O5IC 3CF5A 2A69C 3F2BA 1P8LA
chains in the Genus database with same CATH topology
1DXMA 4WFN3 4DAYA 5EKLA 3TP8A 4A3IB 1B2TA 1SNDA 5DEHA 1LTGD 1EYDA 3MA2B 3NBIA 2AUKA 1DOMA 1R4QB 1OXUA 1KDCA 4RH6A 3NUCA 3P1HA 2X6LA 2RVLA 4G7ZC 2EYPA 3X3MA 1S4ZA 3I91A 3HOVB 3D6WA 4KHZA 3U9SA 4J8QA 4IFDG 4ZUIA 2F0PA 5KGUA 3DWPA 1I6VC 4ZQ3A 1O7LA 2EYLA 2PO4A 2SNSA 1NR2A 5BN3A 1B1ZA 3NWTA 4S3SA 3S2HB 3D6CA 1I4RA 2OT2A 4C3HG 2LKVA 1WD1A 1PRTC 2RSNA 1C4QA 2XWJB 3MXUA 1GOZA 3Q6SA 1O80A 4K5XA 2EE1A 5C6AA 1TS2A 2VB2X 3J7YW 2J7ZA 2G9HD 2NB0A 3H94A 4ZKBB 1I4HA 2F3WA 2RA4A 4BS9A 3G7LA 2F0FA 4F87A 1F2MA 3RMHA 2BDOA 3J7AF 3PO2B 3VR5A 4BBSB 4H0LC 1SXTA 1AP0A 1KTKA 4G7HC 1D6EC 3FEWX 5EBDA 3GD7A 2EYOA 3P75A 3D31A 5IT9E 5HURA 3HP3A 1M4VA 2O2LD 1HTLD 1EL0A 1ESRA 4RA8A 1SYEA 1PFBA 2DY7A 1DOKA 2X6GA 4OO1I 3OHXC 3MXNA 4OHJA 1WTXA 3M7GA 3KBGA 4YIJA 1B4OA 5C5MA 3D4WA 1EYCA 1BCPB 2B39A 1KLGD 2Y0SB 1A2TA 2L4NA 5NUCA 3MFGA 1GUGA 4OIKA 5FO8B 2L9HA 3NSWA 2VNUD 1QOHA 4UDUC 3LNNA 3HOYB 1PTOC 3MZ5A 2JA7B 2ICIA 2F0SA 4C3JG 1XYIA 2IPKD 4A3DB 1JOQA 3DHQA 1F9PA 1KDAA 3BDLA 1V1PA 3BYYB 2C5CA 2JA6B 3GTMB 2XNAC 2TMPA 3D4DA 2XIWA 1G2SA 3C1EA 1SYDA 4A3KB 3I4LA 5JPNC 4G4KA 1OO9B 4C2MB 4QUFA 3QG1A 4KTAA 1IKMA 4KY6A 1TU2B 3R93A 2MP1A 1HA5A 3MXGA 2B2VC 1WTOA 1IW7C 3VYUA 3PMFA 1DCZA 2K5DA 4IFDI 4FYDA 1J9OA 2GA4B 4IN3A 1BR9A 1C8CA 1D1KA 4C3IB 4C3IG 3A8JE 3J81L 5C0XH 1GUSA 1EOTA 4X3SA 3RZDB 1PFMA 3J81E 1ENAA 1ZYRD 2DNEA 3SEBA 1BDOA 5D3IB 5F2DA 2IW3A 5KIXA 1YNJC 1STNA 4Q5VA 4ZK9B 2PQEA 1U9RA 2E2HB 3AMUA 1HA6A 4BA2I 3K5MA 1LTBD 3LX0A 4HCSA 2IL8A 2HCIA 2D5DA 2PW7A 1LT3D 2SEBD 1PXUA 2F0QA 5CV7A 1UUPA 5EKKA 2RDFA 4ZYSA 3P7JA 3PIP3 4N9PA 2KEDA 2AWOA 4RWSC 3S1NB 1G8ZD 2NZ1D 1SFOB 4FF2A 2RSOA 1B3AA 5K36G 1NUCA 1Z6HA 4DGZA 2VB3X 4M1UB 1STEA 1PRTF 2D9UA 2PZWA 1WTWA 2A68D 1IYUA 1XWEA 3NQIA 3F2UA 1MSGA 3TDQA 2KHSA 3L3OC 4HCEA 4ZUJA 2ICEC 1CQFA 2OEOA 2E76C 3BG3A 1I3QB 1QE6A 1EY7A 2EY6A 1EY9A 5ELFA 1D5MC 1W6KA 1EQVA 4Y7NB 1Y69U 1II3A 4EQNA 3MTSA 5FOBB 1ILQA 1PDQA 2G9DA 5KYLA 1GXDC 3GTJB 1KABA 1FYCA 3FPPA 4A3MB 3I4NB 4KKUA 1DZ1A 2L11A 1EEID 4XXEA 3VYSA 2R6GA 4B08A 4PQXA 2EXZA 1EY6A 1ENFA 2EYFA 4XTCS 2JEAI 4NDXA 5FO7B 3OOCA 1ESFA 5J22A 2O4XA 4DAPA 1I4GA 1I50B 3VA7A 3M4OB 2KOLA 1TS3A 2EDGA 4IUPA 2EPBA 1F77A 1T5EA 1WD0A 3FDTA 1RJTA 1B9NA 1QB5D 1EZ8A 2BOSA 3CKIB 5JVH3 1S5CD 3ND8A 3MEHA 3SK5A 1GHJA 5TSSA 4PMWA 4V190 3EVQA 4TQUS 1ICWA 1MSHA 4J6HA 1Y1VB 5CGKA 1PYWD 2D62A 4HMJA 1MI2A 2KA7A 4ZKCB 1AFPA 1RHPA 4PNYA 3DEPA 1F9SA 4EVOA 3HOWB 3ONAB 1SYFA 2FFKB 5D65A 2IX3A 5C44B 4C3JB 4R9WA 1NCVA 5JEAG 3X3NA 4CKEA 3I90A 1PMRA 3HOXB 1LTRD 3GTOB 1GUNA 1JR0D 1D2BA 1E0BA 4L6TB 2Z8LA 1WTRA 4N9TA 1CZWA 1GJXA 4TRDA 1VMPA 1U4RA 2VUMB 4XQJA 2KQ3A 1AEXA 3PIO3 2B2UC 1RODA 3R3OA 1F2LA 3EA6A 3OMGA 2B2YA 2F0JA 1SEBD 4PMCA 5IIFA 1ENCA 4RHSA 1BUVT 4P2CB 3OPOA 1U4MA 2E2DC 2CVRA 4EQOA 1TY0A 3DM1A 4H7BA 2HCCA 4XQNA 2K6AA 5C5LA 1PRTD 3K7AB 2MHVA 2MUYA 1G291 1FNVA 4RHRA 4KK7A 1EFID 3OW7A 3SK6A 5CV4A 5I2XA 1RDPD 5IGFA 1F9QA 2PMZB 4QB4A 2KUMA 1D1IA 1VMCA 5C3WA 1H9MA 1EU3A 1G91A 2B2WA 3HEJA 5D14A 1LTID 2IX0A 2LMCB 1MBYA 1O7YA 5FK9C 2ZXOA 3PUWA 5BN5A 4UAIA 3ZYYX 3RD4A 1LACA 1BBXC 3IFTA 4HTHA 5EPLA 5JJZA 2A5HA 3J80E 1SAPA 5E1FA 4WRDA 2IJ0A 4RFBA 1E2VA 3PUXA 2EYJA 5CC4A 5DM73 4BWGB 3M4YA 2I46A 2A6ED 4M8AA 2L12A 3H91A 2QILA 4K6DA 2WKCA 2M2LA 1LTTD 2N88A 3CRKC 2L55A 1EIGA 4RKBA 4FNFA 3A8KE 2DN8A 4KI0A 1F2YA 3NK9A 4DA2A 5E3FA 3BVGA 2HQEA 3M85A 2F0GA 1JWMD 4G7OC 5G3LF 1OXTA 1RTOA 2R92B 1ILPA 2EJGC 3S9WA 3S15B 1SE2A 4K5WA 3I73A 2A6HD 4C1NK 1CT1D 1RKNA 1WVLA 1TQOA 1B44D 4K8IA 1QJOA 1JORA 2B2UA 2NN6I 3A55A 1K83B 3V96A 5FLXE 4LJZC 1PZKD 1QILA 3I72A 3V05A 1AZQA 2A69D 3OWEB 1LTAD 2MPMA 2E74C 2A6EC 2XSCA 3ND9A 1BCPC 4U68A 2SNMA 2PNRC 1K8MA 5ELCA 3WOEA 3GV3A 4C1NI 4XDXA 1K8OA 2WP8J 1S5DD 4BBRB 2F0NA 2XVSA 2KVMA 3I3CA 2BA1A 2ENBA 2SOBA 3NHHA 3QWNA 4IFDH 1C48A 1PZJD 3MAQA 3K0YA 1CA5A 4X3UA 3NE5B 4HAEA 3AB9A 2C9OA 5HGTA 4OGQC 1IW7D 1PTOH 2XN9C 4QF4A 2IWHA 4OL7A 2K5WA 1CHQD 4QCLA 3EFXD 2E2JB 3EROA 5KNDA 1F9RA 4X3KA 1JOOA 3PV0A 5IGEA 1Q1BA 3D8GA 2F0OA 1M8AA 2K33A 1Z47A 5C0XG 3IKJA 4FP5D 2NVXB 1QNKA 2R7ZB 2EY1A 1ZYRC 3OWFA 1JCKB 3LWEA 2JA8B 4CGYB 1BCPD 5C4XB 4IALA 3TMEA 2F0HA 1YNJD 2CW0C 2WB1B 1Y8PB 1BNZA 1AN8A 2N55A 1WCMB 3MVVA 1FD7D 3C1FA 1IL8A 2F0IA 2RKSA 4ZLTF 5KEEA 5G3LD 3RLFA 3CQZB 1RCVD 1SNPA 4WJWA 4RAUC 3K59A 2RDGA 3BVMA 2NTSA 2BE5D 1HQRD 1Q90A 1B50A 3NXWA 3Q22A 1HHVA 3L7ZC 5FO9B 2PW5A 1Q1EA 1SSOA 3KLSA 2E75C 4F88A 1SYCA 3H3VC 3HZXA 5D3DA 4L8JA 3GO5A 5DNFA 4RCOA 1KNAA 3K6OA 3HOUB 1T5XD 2B63B 3A7AB 2TSSA 1FNWA 3NTHA 1EY8A 4WORA 4EGVA 2OF1A 1Q3LA 1YNND 3TP5A 2LFNA 1HQMC 2D2CC 3M3YB 2K01A 1CM9A 5LHY1 1PTOF 1SDFA 1UNSA 1V1PB 4O1NA 2Z4IA 2J0TD 2RQXA 1JOKA 1KLUD 4DXGA 1VF5C 2B2WC 2AUJD 1NAPA 2FHTA 1S5BD 1A3VA 1CZGA 1PLFA 5T1GA 4IUUA 5CMDA 3A54A 2V4DA 5E4XA 5J39A 1RD9D 3I8ZA 1KDBA 2E2IB 3QO2A 2KCNA 2A68C 3R2IA 1H9JA 1F2ZA 3NBHA 5ELBA 1B53A 4CBVA 1V43A 4ZAIA 1SYGA 2JYOA 3T16A 1EEFD 3RZOB 5C3XA 1CK1A 2F0LA 3K58A 5A2QL 3D4RA 5IGCA 4KJNA 5CORA 2MJ8A 1TIID 4IQZA 4LAAA 2J4XA 1B9MA 1FNUA 4ZRZA 2O5JC 1CFMA 4IZ8A 2QKIC 4ME5A 3VR3A 2A73B 3HRZC 1EU4A 1BCPF 1TKWB 3CHBD 4IUNA 4V0BA 4A3FB 2XRQD 5C4JB 3N6RA 2K05A 3HKZB 5COYA 1WTPA 4LMQD 5I4DA 1DJRD 3T56B 3DEOA 2EY5A 1H9KA 3WDNA 3MHBA 4U673 4R8IA 3S14B 3GV6A 1VCIA 4HSVA 3KUPA 2EYMA 4DAVA 1V1OA 3WOFA 1TVXA 3S2DB 1JQYD 4K8JA 1LV9A 1Y8NB 1EY4A 1ET9A 5A35A 4KD4A 1SJHD 2NN6G 4BA1I 2BDNA 4G57A 1U4PA 2F3VA 1DYQA 1L0XB 1HUMA 1Q12A 5C0XI 4E6IA 1JWSD 1PZID 5CV8A 5M5XB 2L5TA 2CHBD 3VYTA 2KJXA 2PCFB 3DXJC 3Q23A 1Q8IA 1TS4A 4XT1B 4F8MA 2QF7A 5JAVA 3KBXA 5FKAC 1SNOA 3LWUA 1J8IA 2PZTA 3NPPA 1WTVA 1SE3A 5CBEE 3SDZA 1X3PA 3IL8A 2DNCA 1I4XA 5EPJA 4BY7B 3J80L 3GTPB 1PTOB 4K2KA 5JEAJ 2FINB 2M00A 1GUOA 2PPBC 1BOSA 3NP8A 2FMMA 2WV6D 2F0EA 3S1RB 3PUYA 1TWHB 1UAPA 3SR1A 1KNEA 5K36H 4IUVA 2R3ZA 5M5YB 2B8FA 2K03A 3GP7A 3JAME 4Q0FA 1X3QA 4XT3B 2K28A 4DNTB 1LLRD 4DF7A 3BDCA 5CV6A 1HFNA 2ID0A 2EY2A 3VR6A 5J1ZA 5I6WA 1H9SB 3P20A 4QUCA 4A3JB 3QIAA 4DXFA 4K2LA 2ZXPA 1CI3M 2Q8RE 1TT2A 4OIJA 5JPMC 2PZUA 4JBWA 5BN4A 2SDFA 3BZDB 2YYZA 3H6MA 3T13A 4MN3A 3IAYA 5CYUA 2K1BA 4IFDJ 3C2PA 3R8BA 1QWYA 3SK8A 3SHLA 4KN7C 3OIPA 3ITPA 4HMIA 5KNCA 2HDMA 4EQPA 1PTOD 2K04A 4IUQA 5I6YA 4NW2A 3CU7A 3QOJA 2Q8TA 5KNBA 4XQQA 2BCOA 3KF8A 2H1EA 2HUGA 5I2YA 5CV5A 1HFGA 4A93B 2H4OA 5DM63 1GUWA 5EQ0A 2AQ1B 3EJIA 1DD2A 2IX1A 3NTKA 5DAUA 1TY2A 1I4QA 1UEAB 1JWUD 3A56A 1MGSA 5CBAE 1MD2D 1TWCB 1IKLA 1HXYD 3S1MB 1XXGA 2WKDA 1BXTA 4DFAA 1XTCD 2NUCA 2F03A 1EYAA 2AQ2B 3D3RA 4Z9CB 3BVZA 1GHKA 2XRSD 2WINB 3GTLB 4ILWA 3PUVA 3T53B 4OO1G 1A6XA 2QEJC 3FPUB 1O7ZA 5LL6X 2NYZD 1TWGB 1LTSD 2HDLA 5ISRA 2MGSA 1E2WA 3C46A 3TP6A 4KJOA 3AU7A 3A8IE 1OXSC 2EJMA 4HEDA 4NMZA 4ULLA 1SMYC 1PFNA 1DONA 2NVQB 1EIHA 1FGBD 1ZEQX 3VR2A 1WTQA 5EGTA 1EZ6A 3TZDA 4H13C 4F7XA 5JVG3 3R2TA 2K5QA 2WIIB 5KRUA 4FF1A 3GTKB 4O42A 1ML0D 2B2TC 1ONLA 2BA0A 2I07B 2CW0D 2RBMA 3I4MB 1VF7A 3MC0B 1ET6A 3O13A 2OXPA 1EWCA 3Q0AA 2B2YC 2JA5B 1RTNA 3RUZA 1LABA 1LT6D 5EPKA 1JE4A 2KECA 2YU9B 3K5NA 1LO5D 5T1IA 3FKIB 1A3UA 1QG7A 4K14A 2JP1A 3S16B 2Z4HA 4DU9A 5C4HA 3H0GB 3GTQB 4C56C 5LL6S 3NTIA 2WACA 3C3LA 5FLXL 4A3EB 3QJYA 4DK1A 3CRLC 4PMBA 2JSOA 1SMYD 1AW7A 3KK7A 1R9TB 1TWFB 2F1MA 3V2TA 1I6HB 5EJWA 4RGTA 5C0XJ 3TP7A 3KLRA 4QIWB 5IGBA 1YNNC 1IHZA 4XYQA 1SJED 5M3MB 5CV9A 3EQLC 1HUNA 4TKOB 1E2ZA 1Z7TA 3SXHA 2BE5C 4DK0A 2FJ2A 5M5WB 4QMGA 3E6ZX 1OXXK 5IODA 5I9OA 1EQTA 4RGMA 1O78A 4NP5A 4DNRB 3TZUA 1TWAB 1QCBD 2B2TA 2F0UA 1I4PA 4CJ2C 2FMCA 3GQBA 4FF4A 3K5LA 4FXDA 1SE4A 4I7ZC 2R61A 1U4LA 1H9RA 4ABNA 2QCPX 4FVMA 4KMUC 4I65A 1JICA 4GZYC 4RCNA 4CJ0B 3GTGB 5KYIA 1SNMA 3VR4A 4CHTB 2JEBI 5EKIA 3TSSA 5IGDA 3MFYA 1BQQT 1S5FD 2B8GA 3K57A 1VDZA 2LY7A 2RDHA 2LS01 1A3TA 1DM0B 2NN6H 4B9XA 5C3EB 4FO2A 1EWHA 1BF4A 2KCCA 3OMCA 3ERQA 3PUZA 4H44C 3SK4A 2XWBB 1A15A 4C3HB 2NVYB 4KHVA 1GUTA 4HN7A 5M3FB 2NWGA 2F4IA 4KY7A 3K5OA 3DMUA 2IT1A 4JK1C 5IGGA 1Y8OB 1EY0A 2EZVA 3T51B 3FMCA 2ZXRA 2F0DA 3M7NA 1SYBA 1CQVA 2F0TA 4PV1C 2DY8A 1SBBB 5C4ZA 3JAML 4KV6A 3VA5A 1L0YB 5JEAH 3E0JA 5K5PA 3MXPA 1D5ZC 2Q8IB 4FF3A 5JOBA 2F0WA 3HS0C 4CKCA 3BS1A 5EBCA 1X32A 1LT4D 4HR7B 4XIGS 4AYBB 4NKLA 4LK1C 3DUZA 3W2DA 1H9SA 2L0CA 1HRJA 3TN2A 4X3TA 4KKTA 3T4AC 1HTPA 4K6LA 4MHEA 1OXVA 2NBFA 4R8NA 3A7LA 3S1QB 2K32A 2WAQB 1SNQA 1NSNS 1STAA 4A3GB 1HCZA 4DN4M 2NVTB 3URYA 1AZPA 3FVQA 1CHPD 1EY5A 1TS5A 1STBA 1RF2D 5IT9L 3FRPB 3QOLA 4XYOA 4TSSA 3QB3A 5ELEA 1D5XC 2F0KA 5M9OA 2ZT9C 1LT5D 3W3AA 5I9PA 4RGOS 2Z1CA 1BO0A 1V8QA 4BY1B 4RGNA 1R4PB 4KN4C 2F0VA 3PO3B 1ZKOA 1TR5A 2M9VA 2VXWA 1KAAA 3TBIB 3S17B 3N52A 3I70A 2JE6I 2EVBA 1NR4A 2CQAA 3HG9A 2R93B 2JXMB 3DWQA 1SNCA 2L1BA 1JB3A 3HGBA 1CA6A 3H09A 2EYHA 3NQTA 1QNUA 4ODGA 2K7VA 4KY5A 1G6ZA 4KKSA 5IOCA 4B9WA 4FXKC 2A74C 3Q24A 3BYTB 1STHA 1DOLA 3U9OA 5CR3A 4KD3A 2NTTA 5AFWA 2EOTA 1HPCA 3KLSX 3HOZB 3DWAA 1JC7A 5ELDA 3UI2A 1G2TA 1ZXTA 1XX8A 1STYA 3IFDA 3SE0A 3J7AV 4IURA 4A3BB 3VYRA 2AWNA 3MWYW 2A6HC 1STGA 4RKLA 1IYVA 3OIQA 4OO1H 2X69A 2B2VA 4J1MA 2PYKA 4HSPA 3BDOA 1CTMA 3SVMA 1S5ED 4L63B 4IUTA 2QDBA 3G6JB 4K5VA 4MIUA 4FXGC 1A2UA 4CJ1B 2AQ3B 3OSOA 4ID6A 2EJFC 3E5SA 1Y1WB 5E4WC 1PRTB 1W6JA 4CKBA 2F0MA 5A2QE 3L9AX 3NWSA 2KEEA 2O5IC 1FR3A 2A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ3 A;  3SHL A;  1KDA A;  1KAA A;  5EKK A;  1AEX A;  5EGT A;  5IGG A;  1EZ6 A;  2PZT A;  3BDL A;  5HGT A;  3SXH A;  4F7X A;  2RDF A;  4N9P A;  4K6D A;  3ITP A;  1EY0 A;  4HMI A;  4IZ8 A;  5KRU A;  4QF4 A;  4OL7 A;  3R3O A;  4ME5 A;  5EKL A;  4RKB A;  3TP8 A;  1EY8 A;  1SND A;  3D4D A;  4WOR A;  2F0D A;  3OMG A;  4QMG A;  4EQP A;  5DEH A;  3C1E A;  1SYD A;  1F2Y A;  3ERO A;  2OF1 A;  1SNC A;  5IOD A;  2F0J A;  1SYB A;  3NK9 A;  4IUN A;  4PMC A;  5I9O A;  1EYD A;  5IIF A;  1ENC A;  3TP5 A;  5I6Y A;  1EZ8 A;  5E3F A;  2RBM A;  4K2K A;  2F0T A;  1JOO A;  5C4Z A;  4KV6 A;  1NUC A;  3QOJ A;  5IGE A;  2EYH A;  2HQE A;  4NP5 A;  2M00 A;  2OXP A;  2EYO A;  3D8G A;  2F0O A;  3P75 A;  3NQT A;  4EVO A;  3MEH A;  2F0G A;  4DGZ A;  4KTA A;  3NP8 A;  4KY6 A;  4ODG A;  4KY5 A;  5HUR A;  5K5P A;  3RUZ A;  2F0E A;  3MXP A;  5CV5 A;  5IOC A;  3SK5 A;  1KDC A;  2F0U A;  2PZW A;  3SR1 A;  4B9W A;  1SYE A;  2F0W A;  5JOB A;  4EQO A;  3NUC A;  3S9W A;  3P1H A;  4K5W A;  3EVQ A;  1STH A;  4H7B A;  4J6H A;  3U9O A;  2KHS A;  2EY5 A;  2EYP A;  5CR3 A;  4KD3 A;  2EY1 A;  1RKN A;  1JOK A;  3EJI A;  1A3U A;  4K14 A;  4NKL A;  5CGK A;  4ZUJ A;  3OWF A;  5C5L A;  2OEO A;  3MHB A;  5DAU A;  4HMJ A;  1TQO A;  3PMF A;  1EY7 A;  2EY6 A;  4IAL A;  1EY9 A;  4YIJ A;  3TME A;  3VA5 A;  2F0H A;  4K8I A;  5C5M A;  1A3V A;  4DU9 A;  3D4W A;  1EYC A;  4PNY A;  4ZUI A;  1EQV A;  3SK6 A;  5CV4 A;  5C4H A;  1JOR A;  2F0P A;  5KGU A;  5IGF A;  1II3 A;  2EYM A;  3C1F A;  3MVV A;  4I65 A;  4R8N A;  4ZQ3 A;  5CV7 A;  4DFA A;  4EQN A;  2EYL A;  2NUC A;  4QB4 A;  5J39 A;  2SNS A;  1EYA A;  1STY A;  5KYL A;  2F0I A;  2RKS A;  5C3W A;  1A2T A;  2WAC A;  1KDB A;  1SYF A;  4S3S A;  3D6C A;  4DF7 A;  1SNQ A;  1NSN S;  3BDC A;  5CV6 A;  1STA A;  4K8J A;  2EY2 A;  5KEE A;  5NUC A;  1KAB A;  3HEJ A;  5J1Z A;  5I6W A;  1ENA A;  1EY4 A;  1STG A;  4RKL A;  5KYI A;  1SNM A;  1F2Z A;  4PMB A;  4J1M A;  2LKV A;  1SNP A;  4KD4 A;  2PYK A;  5IGD A;  1EY5 A;  5F2D A;  1STB A;  4K2L A;  2SNM A;  3V2T A;  4K5X A;  4LAA A;  3QOL A;  4G57 A;  1SYG A;  1TT2 A;  5KIX A;  1A3T A;  5C6A A;  5J22 A;  1STN A;  3NXW A;  2PZU A;  2F3V A;  2QDB A;  3QB3 A;  4HTH A;  3T16 A;  3TP7 A;  4K5V A;  4B9X A;  4E6I A;  4MIU A;  2F0K A;  2PQE A;  3MZ5 A;  1A2U A;  5C3X A;  3SK8 A;  2PW5 A;  2F0L A;  5CV8 A;  5IGB A;  5M9O A;  1U9R A;  3H6M A;  2F0S A;  2F0N A;  5E1F A;  5I9P A;  3T13 A;  3OMC A;  5ISR A;  3ERQ A;  3OSO A;  2EXZ A;  4ID6 A;  1EY6 A;  1IHZ A;  4WRD A;  3E5S A;  3SK4 A;  3TP6 A;  2EYF A;  2ENB A;  2F3W A;  4NDX A;  4KJO A;  3LX0 A;  2F0F A;  5IGC A;  2F0M A;  2SOB A;  3DMU A;  3NHH A;  4N9T A;  4KJN A;  2EYJ A;  4TRD A;  1F2M A;  2O4X A;  2PW7 A;  4KHV A;  4F8M A;  5CC4 A;  5CV9 A;  1SYC A;  2F0V A;  3HZX A;  4NMZ A;  5JAV A;  1JOQ A;  1SNO A;  2F0Q A;  4KY7 A;  3DHQ A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 2B3G A;  1DXM A;  4WFN 3;  3M4P A;  3S16 H;  1WYD A;  3TS0 A;  3A5U A;  4DAY A;  5EKL A;  3TP8 A;  4A3I B;  1B2T A;  1SND A;  5DEH A;  4A4I A;  3L2P A;  3J7A 5;  1I6H H;  1LTG D;  1EYD A;  3MA2 B;  3NBI A;  2AUK A;  3I2Z A;  4DV1 L;  3W1G A;  1DOM A;  1R4Q B;  2WB1 G;  4A3L G;  1OXU A;  1KDC A;  4RH6 A;  3J81 c;  3NUC A;  3P1H A;  1L1O B;  4JW0 A;  2X6L A;  2KCT A;  4BY7 G;  1X54 A;  2RVL A;  1GO3 E;  4G7Z C;  2EYP A;  2LSS A;  1X55 A;  3X3M A;  1S4Z A;  3DLL A;  1SRU A;  3I91 A;  3HOV B;  2CKZ B;  2YV5 A;  3D6W A;  3HOU H;  4KHZ A;  3U9S A;  4J8Q A;  2NVQ H;  4IFD G;  3HKZ G;  4ZUI A;  1L1O C;  2F0P A;  5KGU A;  3RNU A;  3DWP A;  4L5S A;  1I6V C;  4ZQ3 A;  3CCL A;  1O7L A;  2EYL A;  2PO4 A;  1BKB A;  2SNS A;  1NR2 A;  1BBU A;  3FKI H;  5BN3 A;  1B1Z A;  3NWT A;  4S3S A;  4UPA A;  3D6C A;  3S2H B;  1I4R A;  4P75 A;  2OT2 A;  1DGS A;  1ICF B;  5IP9 H;  4A3C H;  4C3H G;  2LKV A;  1WD1 A;  1PRT C;  2RSN A;  1C4Q A;  2XWJ B;  3MXU A;  1GOZ A;  3Q6S A;  4A3D H;  1O80 A;  4K5X A;  4Y52 H;  2Z0S A;  2EE1 A;  5C6A A;  4H02 A;  4OWX B;  1JMC A;  1AE3 A;  1TS2 A;  2VB2 X;  3J7Y W;  2J7Z A;  2G9H D;  2NB0 A;  2QEX A;  3H94 A;  4ZKB B;  1K9M C;  1UE1 A;  3G6E A;  4A3J G;  2K14 A;  1I4H A;  2F3W A;  2RA4 A;  1FJG L;  4BS9 A;  3G7L A;  2F0F A;  4F87 A;  2E5L L;  4DAY B;  1F2M A;  4DR1 L;  3RMH A;  2BDO A;  3J7A F;  4DV0 Q;  3PO2 B;  3VR5 A;  4BBS B;  3DM3 A;  4H0L C;  1SXT A;  1AP0 A;  3ULJ A;  1KTK A;  1EOV A;  4G7H C;  3PSI A;  4O2D A;  3CCV A;  1IYJ B;  1D6E C;  3FEW X;  4BXX H;  5EBD A;  3BZC A;  3GD7 A;  2EYO A;  3P75 A;  3D31 A;  5IT9 E;  5HUR A;  3HP3 A;  1E1O A;  3ER0 A;  1M4V A;  2O2L D;  1HTL D;  4YHH L;  1ESR A;  4JI8 Q;  4RA8 A;  1EL0 A;  1SYE A;  2UUA L;  1PFB A;  2DY7 A;  1DOK A;  5IE8 A;  2X6G A;  4OO1 I;  2ZJQ A;  4K0K Q;  3OHX C;  4B3T Q;  3MXN A;  4O0A A;  5C4X G;  4OHJ A;  1WTX A;  3M7G A;  4YCU A;  3KBG A;  4YIJ A;  1B4O A;  4YHH Q;  4WJ3 M;  3K7U C;  1A63 A;  5C5M A;  4PG3 A;  3D4W A;  1EYC A;  2RCF A;  4KLK A;  2RF4 A;  1BCP B;  1X3F A;  2B39 A;  4GOP A;  1KLG D;  2Y0S B;  1A2T A;  2L4N A;  4R4C A;  4JI0 Q;  3KF6 B;  5NUC A;  3MFG A;  3UDI A;  2YU9 H;  1GUG A;  3CCS A;  4BBS H;  5AJ3 L;  4OIK A;  5FO8 B;  1Y1V G;  2L9H A;  3NSW A;  3PQI A;  2VNU D;  4JCV E;  1KHI A;  1QOH A;  4UDU C;  3HOZ H;  2ALY B;  1PH9 A;  2Q2U A;  3LNN A;  2NZO A;  2I5L X;  3HOY B;  1UE6 A;  3NBH B;  1PTO C;  3MZ5 A;  4OX9 L;  2PQA A;  2JA7 B;  2ICI A;  2F0S A;  1BBW A;  4C3J G;  1XYI A;  2IPK D;  4PZ7 A;  3EN2 A;  4A3D B;  1VQI A;  1KRS A;  1I94 Q;  1JOQ A;  1JJC B;  4LFC Q;  3DHQ A;  1HNW Q;  2D0P A;  4FDB A;  1F9P A;  1XPR A;  1KDA A;  4QIW E;  1YI2 A;  3BDL A;  1V1P A;  3BYY B;  1YBY A;  3HOW G;  2RHS B;  2C5C A;  2JA6 B;  3HOZ G;  3GTM B;  2XNA C;  2TMP A;  3D4D A;  2XIW A;  1G2S A;  3C1E A;  1SYD A;  4A3K G;  4A3K B;  4HJA A;  3I4L A;  5JPN C;  4G4K A;  2VQE Q;  1OO9 B;  1FL0 A;  4C2M B;  4QUF A;  1X56 A;  3QG1 A;  4C3H H;  4KTA A;  4A3F H;  1IKM A;  4KY6 A;  1S40 A;  3RN2 A;  1TU2 B;  3R93 A;  2MP1 A;  1HA5 A;  4IPG A;  3MXG A;  2B2V C;  4UHV A;  5BR8 L;  1WTO A;  1IW7 C;  4LF8 Q;  4NXM L;  3B6Y A;  3VYU A;  1CKM A;  2K52 A;  4DV7 L;  3PMF A;  2VZA A;  1DCZ A;  3UDG A;  2K5D A;  4IFD I;  4FYD A;  1J9O A;  1D7Q A;  4X66 L;  2GA4 B;  4YWK A;  2PMZ E;  4JOI C;  4IN3 A;  1BR9 A;  1C8C A;  1D1K A;  4C3I B;  4C3I G;  3A8J E;  3J81 L;  5C0X H;  1GUS A;  1EOT A;  4DV2 Q;  4X3S A;  3RZD B;  1PFM A;  3RZD H;  4IOA A;  2XGT A;  3J81 E;  2R7Z H;  1ENA A;  1VQ4 A;  2R92 H;  1ZYR D;  2DNE A;  3SEB A;  1BDO A;  5D3I B;  5F2D A;  1YHB A;  2IW3 A;  2OCE A;  5IYB G;  5KIX A;  1YNJ C;  3I56 A;  1STN A;  4Q5V A;  4LFB L;  4ZK9 B;  2PQE A;  4LUO A;  1E24 A;  1U9R A;  2E2H B;  2AKW B;  3AMU A;  1HA6 A;  4BA2 I;  3K5M A;  1OTC A;  4IPC A;  4DR3 Q;  1IBL L;  1WCM G;  1LTB D;  4ALP A;  3LX0 A;  4HCS A;  2IL8 A;  2HCI A;  2D5D A;  2VQE L;  2PW7 A;  4B3S Q;  4DR4 L;  4X65 Q;  2UUB L;  1LT3 D;  2SEB D;  1PXU A;  4X64 L;  2F0Q A;  5CV7 A;  1UUP A;  5EKK A;  2RDF A;  3P7J A;  4N9P A;  4ZYS A;  2KED A;  3PIP 3;  2BH8 A;  2UU9 Q;  4DR7 Q;  2AWO A;  3BZK A;  3BJU A;  3JC6 6;  4RWS C;  1HNW L;  3S1N B;  2VY3 A;  4A3B H;  4MZ9 A;  1G8Z D;  2NZ1 D;  1SFO B;  4FF2 A;  2RSO A;  4LNQ A;  2F52 A;  1B3A A;  5K36 G;  1NUC A;  4X66 Q;  3M3Y H;  1Z6H A;  1G51 A;  3NEL A;  4DGZ A;  4M1U B;  2VB3 X;  1STE A;  1PRT F;  2D9U A;  2KBN A;  2PZW A;  1WTW A;  2A68 D;  1IYU A;  1XWE A;  3NQI A;  5FJ8 H;  3CCM A;  3F2U A;  1MSG A;  3TDQ A;  2KHS A;  3L3O C;  1EUJ A;  4HCE A;  4ZUJ A;  2ICE C;  1CQF A;  1XMO L;  2OEO A;  2E76 C;  3BG3 A;  5GRO A;  1VQN A;  1I3Q B;  1QE6 A;  3L0O A;  2IHF A;  1EY7 A;  2EY6 A;  2Z6K A;  4YY3 L;  1EY9 A;  5ELF A;  1D5M C;  1X9N A;  1W6K A;  1EQV A;  4Y7N B;  4JC0 A;  1Y69 U;  2OQ0 A;  1II3 A;  1D8L A;  4DUZ L;  4EQN A;  3MTS A;  5FOB B;  4QGU A;  1ILQ A;  1PDQ A;  2G9D A;  5KYL A;  3G71 A;  2R93 H;  1GXD C;  4B3R Q;  3GTJ B;  1KAB A;  1FYC A;  1CUK A;  3FPP A;  3H0G H;  4A3M B;  4B3R L;  3I4N B;  4KKU A;  1PH7 A;  1DZ1 A;  4B3T L;  1NTG A;  2L11 A;  1EEI D;  4XXE A;  2F4V Q;  3VYS A;  2R6G A;  4A3G G;  4BY1 H;  1U0L A;  4B08 A;  4JI3 Q;  4MTN A;  4PQX A;  2EXZ A;  1EY6 A;  1VQF A;  1ENF A;  3CXC A;  2EYF A;  4XTC S;  3J81 i;  4NDX A;  2JEA I;  1XPU A;  5FO7 B;  3HFZ B;  2VUM H;  3OOC A;  1ESF A;  2R93 G;  5J22 A;  1KAW A;  2O4X A;  4DAP A;  5AJ3 Q;  4HJ7 A;  1I4G A;  1I50 B;  3VA7 A;  1IBK L;  3M4O B;  1NY4 A;  2KOL A;  1TS3 A;  1UE7 A;  2Y0S G;  2JA8 H;  2EDG A;  4P72 A;  3AFQ A;  4IUP A;  4A3G H;  2EPB A;  2NVX H;  1V1Q A;  3SGI A;  1F77 A;  1T5E A;  1WD0 A;  5IT9 c;  3FDT A;  5IP7 H;  1RJT A;  1B9N A;  4HIK A;  3CD6 A;  1W2B A;  1QB5 D;  1EZ8 A;  2BOS A;  3CKI B;  5JVH 3;  1S5C D;  3ND8 A;  4P71 A;  3MEH A;  2EIF A;  3UE1 A;  2YTV A;  3SK5 A;  1GHJ A;  5TSS A;  4JI4 L;  4PMW A;  4V19 0;  5C44 H;  3EVQ A;  4TQU S;  1ICW A;  1MSH A;  4J6H A;  4J15 A;  5IYC H;  1Y1V B;  1PH3 A;  2FXQ A;  5CGK A;  1VQH A;  1PYW D;  2D62 A;  4HMJ A;  1MI2 A;  1K8A C;  4DR2 Q;  2KA7 A;  4ZKC B;  1AFP A;  1SMX A;  1KRT A;  1B8A A;  1RHP A;  4PNY A;  1HNX Q;  1TWF H;  1QUQ A;  3DEP A;  1F9S A;  3CC2 A;  4EVO A;  3HOW B;  4DV3 Q;  2E2H H;  3ONA B;  1SYF A;  3PGZ A;  2FFK B;  5D65 A;  2IX3 A;  5C44 G;  5C44 B;  4C3J B;  1AE2 A;  4NB3 A;  1YNX A;  4R9W A;  4A3E H;  3S2H H;  3U50 C;  1NCV A;  4LF6 L;  4HIM A;  2K75 A;  5JEA G;  3CW2 C;  3X3N A;  4A3I G;  2E5L Q;  3T1H Q;  1QZG A;  4CKE A;  3I90 A;  3TQY A;  1PMR A;  3HOX B;  1LTR D;  4DV6 Q;  3GTO B;  4X6A H;  1GUN A;  1JR0 D;  1D2B A;  1E0B A;  1Z9F A;  4L6T B;  2Z8L A;  1WTR A;  4N9T A;  1CZW A;  1GJX A;  4TRD A;  4DV6 L;  4QJF A;  1VMP A;  1WCM H;  1FVI A;  4DV5 Q;  1U4R A;  4GN4 B;  2VUM B;  4XQJ A;  2KQ3 A;  1AEX A;  3PIO 3;  2B2U C;  1PVO A;  1ROD A;  1MJC A;  3R3O A;  4LF5 L;  1N33 L;  1F2L A;  3EA6 A;  3OMG A;  4X64 Q;  2ATW A;  4DUZ Q;  1VQG A;  2B2Y A;  4IPD A;  3GTK H;  2F0J A;  1SEB D;  4PMC A;  3RLN A;  5IIF A;  1ENC A;  4RHS A;  1BUV T;  4R4I A;  4P2C B;  4JBK A;  4JI7 Q;  3OPO A;  4C2M H;  1U4M A;  4YY3 Q;  3S14 H;  4RG1 A;  3KJP A;  2E2D C;  2CVR A;  2MO1 A;  4LFC L;  1JE5 A;  4EQO A;  3GTJ H;  1QVF A;  1TY0 A;  3DM1 A;  4HID A;  4DR2 L;  2MFI A;  3ULP A;  1HH2 P;  2NZH A;  4H7B A;  1S72 A;  2HCC A;  2N8N A;  4XQN A;  2K6A A;  5C5L A;  1PRT D;  3K7A B;  3I55 A;  1GKH A;  1Y14 B;  2MHV A;  4CDD C;  2MUY A;  4Y7N H;  1G29 1;  2I5M X;  4OX9 Q;  1FNV A;  3HOW H;  3KF6 A;  4DAM A;  4RHR A;  4KK7 A;  2UUC Q;  1EFI D;  3KFU A;  3OW7 A;  2UXD Q;  3SK6 A;  5CV4 A;  1N36 L;  4I7A A;  2NVT H;  5C4X H;  5I2X A;  1RDP D;  5IGF A;  1NNX A;  1F9Q A;  1PA6 A;  2PMZ B;  4QB4 A;  1WFQ A;  2KUM A;  1D1I A;  1VMC A;  5C3W A;  1H9M A;  1EU3 A;  3CCQ A;  1G91 A;  4LF6 Q;  5GAD C;  2B2W A;  5FLM G;  3S1Q H;  4A3F G;  3HOY H;  3HEJ A;  5D14 A;  1LTI D;  2IX0 A;  2LMC B;  5M3M G;  3E3X A;  1MBY A;  3IRB A;  4X65 L;  1O7Y A;  2UUB Q;  3PO2 H;  5FK9 C;  2ZXO A;  1VQB A;  3PUW A;  1PYB A;  5BN5 A;  4UAI A;  3ZYY X;  3RD4 A;  4DV4 L;  1LAC A;  1BBX C;  2N3S A;  3IFT A;  4HTH A;  5EPL A;  5JJZ A;  2A5H A;  3J80 E;  4JBM A;  1SAP A;  3HOX G;  5IY0 A;  3MEF A;  5E1F A;  2MO0 A;  2Q2I A;  4OON A;  4WRD A;  1L0W A;  2IJ0 A;  2YTY A;  4RFB A;  1Y1W G;  3CCU A;  4K0K L;  1E2V A;  2H5X A;  3PUX A;  4C3I H;  4CDC C;  2EYJ A;  5CC4 A;  5DM7 3;  4BWG B;  1G6P A;  2UXC Q;  3M4Y A;  2I46 A;  2A6E D;  1R9T H;  1N33 Q;  4LF5 Q;  4M8A A;  2L12 A;  2JA8 G;  2DJG C;  3GDE A;  3H91 A;  2ZTD A;  3M9B A;  4AH6 A;  2QIL A;  4K6D A;  2WKC A;  4BBR H;  2M2L A;  1Q8K A;  4LFA L;  1LTT D;  2N88 A;  3CRK C;  4DR6 Q;  2L55 A;  1EIG A;  4FNF A;  4RKB A;  1J6Q A;  3A8K E;  2DN8 A;  2ZTE A;  4KI0 A;  1F2Y A;  3GTQ H;  3NK9 A;  4DA2 A;  1YVC A;  1CKN A;  5E3F A;  3F2D A;  3BVG A;  4P74 A;  2VS1 A;  2CWA A;  2HQE A;  3M85 A;  2F0G A;  1JWM D;  4G7O C;  5G3L F;  2PI2 E;  1OXT A;  1RTO A;  2R92 B;  5FLX c;  1XTD A;  1ILP A;  2EJG C;  3FHW A;  3S9W A;  3S15 B;  1SE2 A;  4K5W A;  4JPB W;  3I73 A;  2A6H D;  4C1N K;  3HOV H;  1IXR A;  3FKI G;  1CT1 D;  1RKN A;  1WVL A;  3T1H L;  1CKN B;  2JA6 H;  1O7I A;  1TQO A;  3HOY G;  2AMC B;  1B44 D;  3I4N G;  5GAE C;  1PH1 A;  4K8I A;  1XNR Q;  1QJO A;  2UXB Q;  4GOP C;  1JOR A;  1H95 A;  2B2U A;  4AQY L;  2NN6 I;  3CCE A;  4DV3 L;  3A55 A;  3TRE A;  3HOV G;  4JI2 L;  1K83 B;  3V96 A;  5IYB H;  1HNX L;  4DR6 L;  1NMF A;  3I7F A;  4LJZ C;  5FLX E;  1PZK D;  1QIL A;  1YZ6 A;  3I72 A;  3V05 A;  1VQC A;  1AZQ A;  1K3B C;  2A69 D;  3OWE B;  1LTA D;  2MPM A;  2E74 C;  2A6E C;  2XSC A;  3ND9 A;  1BCP C;  4U68 A;  1M90 C;  4JYA L;  1LUZ A;  2SNM A;  3PF4 A;  2CQO A;  2PNR C;  1K8M A;  4DR4 Q;  5ELC A;  4A3K H;  3WOE A;  3GV3 A;  4C1N I;  4XDX A;  1K8O A;  3K8A A;  2WP8 J;  1SFO H;  1SR3 A;  2IY5 B;  1S5D D;  4BBR G;  4BBR B;  2E2J H;  2F0N A;  2XVS A;  2ES2 A;  2KVM A;  3I3C A;  3HKS A;  2BA1 A;  2ENB A;  4LUV A;  2SOB A;  3NHH A;  3QWN A;  4IFD H;  1C48 A;  1PZJ D;  3MAQ A;  3K0Y A;  1CA5 A;  4X3U A;  3U4V A;  3H15 A;  3NE5 B;  4HAE A;  3AB9 A;  2C9O A;  1MHW C;  5HGT A;  4OGQ C;  1XPO A;  1IW7 D;  1PTO H;  2XN9 C;  4QF4 A;  2IWH A;  2VQF Q;  4OL7 A;  2K5W A;  1CHQ D;  4QCL A;  3EFX D;  4DV0 L;  4DV2 L;  2E2J B;  4GLX A;  3ERO A;  3AQQ A;  4QQB X;  1E1T A;  4A3D G;  3A74 A;  5KND A;  1F9R A;  4X3K A;  1JOO A;  3PO2 G;  2PI2 A;  3PV0 A;  5IGE A;  1Q1B A;  3D8G A;  2F0O A;  1PHJ A;  5M3M H;  1M8A A;  1TWC H;  5GQO A;  2UUC L;  2K33 A;  1Z47 A;  4PZ6 A;  5C0X G;  4R1J A;  3IKJ A;  4YCV A;  4DV7 Q;  4FP5 D;  2NVX B;  1QNK A;  5JJK A;  2HHH L;  1GVP A;  4LF8 L;  2R7Z G;  2GVB A;  2R7Z B;  2EY1 A;  4GN5 A;  1ZYR C;  1KXL A;  3OWF A;  4X62 Q;  1JCK B;  3LWE A;  5M5X H;  1E22 A;  3KF8 B;  2OTL A;  2JA8 B;  4CGY B;  1BCP D;  2QGQ A;  5C4X B;  4IJL A;  4IAL A;  3TME A;  2F0H A;  3ERS X;  1YNJ D;  4GLA C;  2CW0 C;  2WB1 B;  1IBM Q;  1Y8P B;  2EXD A;  1BNZ A;  1AN8 A;  2N55 A;  1WCM B;  4P73 A;  3MVV A;  1FD7 D;  3C1F A;  1IL8 A;  2R7F A;  1RL2 A;  2F0I A;  2RKS A;  4ZLT F;  5KEE A;  5G3L D;  3AFP A;  3RLF A;  3CQZ B;  1RCV D;  1SNP A;  2I5H A;  1QVC A;  3H0G G;  4WJW A;  4RAU C;  1VQE A;  3K59 A;  2RDG A;  3BVM A;  2NTS A;  2BE5 D;  4DV5 L;  1HQR D;  1Q90 A;  2DJF C;  1B50 A;  3W5O A;  3NXW A;  1T9H A;  3Q22 A;  5ELO A;  1HHV A;  3L7Z C;  1EQQ A;  5FO9 B;  2PW5 A;  5LMN Q;  2JA7 G;  1Q1E A;  1KC8 C;  1IL2 A;  1SSO A;  1S3O A;  3KLS A;  1UE5 A;  2E75 C;  2PNH A;  2JA5 H;  3PO3 G;  4F88 A;  3CPW A;  1SYC A;  3HZX A;  3I4M H;  3H3V C;  5D3D A;  4L8J A;  3GO5 A;  5DNF A;  2QA4 A;  4RCO A;  1KNA A;  1VQ6 A;  4A3J H;  3K6O A;  3HOU B;  3E0E A;  1T5X D;  2B63 B;  3A7A B;  2TSS A;  4JI7 L;  5DLQ E;  1FNW A;  3D0F A;  3NTH A;  1EY8 A;  4WOR A;  1CSQ A;  4EGV A;  1GM5 A;  2JA7 H;  3ICE A;  2HD3 A;  2KHJ A;  2OF1 A;  3HOX H;  2UXC L;  1Q3L A;  1YNN D;  3TP5 A;  1IZ6 A;  1YJN A;  2LFN A;  4DK6 C;  1HQM C;  2D2C C;  3M3Y B;  1CSP A;  2K01 A;  4N8F A;  4A3B G;  1CM9 A;  5LHY 1;  2B63 G;  1PTO F;  1SDF A;  1UNS A;  1HZA A;  3TS2 A;  5GAH C;  1V1P B;  2QDL A;  4O1N A;  1XMO Q;  2Z4I A;  1I94 L;  1Q82 C;  2J0T D;  2RQX A;  3S24 A;  2C35 B;  4X62 L;  1JOK A;  2ZJR A;  5FLM H;  1LM0 A;  1KLU D;  4DXG A;  1VF5 C;  2WAQ G;  4LW1 A;  2B2W C;  2V1C C;  4JBJ A;  2AUJ D;  4JI8 L;  1NAP A;  2FHT A;  1Q81 C;  1S5B D;  1A3V A;  1CZG A;  1PLF A;  5T1G A;  4IUU A;  5CMD A;  3A54 A;  2V4D A;  1AH9 A;  5E4X A;  4JI5 Q;  3E9H A;  5J39 A;  1RD9 D;  3I8Z A;  3K0X A;  1KDB A;  1Y1W H;  2E2I B;  3QO2 A;  2KCN A;  2A68 C;  3R2I A;  1H9J A;  2UXD L;  2E2I H;  3OYY A;  4EX5 A;  1F2Z A;  3NBH A;  5ELB A;  1B53 A;  2LXJ A;  1L2F A;  4JI0 L;  2E8G A;  3J80 c;  4CBV A;  4B3S L;  4GLV B;  1VQM A;  1V43 A;  5E7N A;  4ZAI A;  5BR8 Q;  4UY8 C;  1SYG A;  2JYO A;  2GN5 A;  1LTL A;  3T16 A;  4A3I H;  1XMQ Q;  1EEF D;  3RZO B;  3T1Y L;  5C3X A;  2K50 A;  1CK1 A;  2F0L A;  4JI1 Q;  4JVZ A;  3K58 A;  1J5E Q;  1Q86 C;  5A2Q L;  3F1Z A;  3OW2 A;  5C3E H;  3D4R A;  5IGC A;  1YEZ A;  2HQL A;  4KJN A;  5COR A;  1WOC A;  2MJ8 A;  1TII D;  4IQZ A;  4LAA A;  2J4X A;  1B9M A;  1FNU A;  3KDF B;  4ZRZ A;  3CME A;  2O5J C;  5IYD G;  3PF5 A;  1CFM A;  2WB1 E;  4IZ8 A;  2QKI C;  2A19 A;  4ME5 A;  3VR3 A;  4R4Q A;  3KLW A;  2A73 B;  3HRZ C;  1EU4 A;  1BCP F;  4A76 A;  3U58 A;  2Q2H A;  1TKW B;  3CHB D;  1JJG A;  4IUN A;  4V0B A;  4A3F B;  2XRQ D;  4KHP L;  5C4J B;  3N6R A;  3F2C A;  3J81 j;  2K05 A;  1HR0 L;  3HKZ B;  5COY A;  5ELN A;  1PYS B;  4L5R C;  1WTP A;  4LMQ D;  5I4D A;  1DJR D;  2I0Q A;  1VQD A;  4OEL B;  1WI5 A;  1Q7Y C;  3T56 B;  1C0A A;  3DEO A;  2EY5 A;  3JAM i;  2ZM6 L;  5M3F G;  1H9K A;  3WDN A;  3MHB A;  4U67 3;  4DUY Q;  4R8I A;  2JK8 A;  3S14 B;  3HOU G;  3KJO A;  2CH4 A;  4ME3 A;  3GV6 A;  1SLJ A;  2Z6B A;  1VCI A;  4HSV A;  2ZJP A;  3KUP A;  2EYM A;  4DAV A;  1V1O A;  4LF7 L;  3BU2 A;  4DNI A;  2AHO B;  1CKO A;  4GNX B;  3WOF A;  1TVX A;  3A0J A;  3S2D B;  1JQY D;  2VUM G;  4K8J A;  3OTO Q;  1LV9 A;  1VS0 A;  2HT1 A;  1Y8N B;  1EY4 A;  1ET9 A;  5A35 A;  3W1B A;  4KD4 A;  3KOJ A;  1SJH D;  4AQY Q;  2NN6 G;  4BA1 I;  4LF4 Q;  4HIO A;  4POF A;  1FGU A;  2BDN A;  4G57 A;  1U4P A;  1J5E L;  4OEM B;  3S1N H;  2F3V A;  4A3L H;  1DYQ A;  1L0X B;  1HUM A;  1Q12 A;  5C0X I;  4E6I A;  1JWS D;  1PZI D;  4A3E G;  5CV8 A;  5M5X B;  2L5T A;  2CHB D;  3VYT A;  2KJX A;  2PCF B;  3DXJ C;  3Q23 A;  1TWH H;  1E3P A;  3QR8 A;  2WFW A;  1Q8I A;  2XTI A;  1TS4 A;  3UDF A;  4DV4 Q;  4XT1 B;  4F8M A;  3RN5 A;  2QF7 A;  5JAV A;  2KHI A;  3KBX A;  5FKA C;  1SNO A;  3MXN B;  3LWU A;  1J8I A;  3H3V I;  2PZT A;  2JA9 A;  3NPP A;  4RMF A;  4UP7 A;  1WTV A;  1SE3 A;  5CBE E;  1A8V A;  3J80 i;  3SDZ A;  1X3P A;  3IL8 A;  2DNC A;  1I4X A;  5EPJ A;  2Z6K C;  4DPG A;  4BY7 B;  3J80 L;  4IO9 A;  1PTO B;  3GTP B;  4NPS A;  4K2K A;  1JJ2 A;  5JEA J;  2DUD A;  2FIN B;  1HJP A;  2M00 A;  3A5Z B;  2UU9 L;  1GUO A;  1XJV A;  2PPB C;  1BOS A;  3NP8 A;  4N8X 1;  2FMM A;  2WV6 D;  2F0E A;  3S1R B;  3PUY A;  3I4O A;  1TWH B;  1UAP A;  3SR1 A;  1KNE A;  1A62 A;  1HZC A;  2K5V A;  5K36 H;  3H3V H;  4IUV A;  1K0S A;  1IBL Q;  2R3Z A;  4L5Q A;  5M5Y B;  2B8F A;  4GKK L;  2K03 A;  4GNX A;  3GP7 A;  2K5N A;  3CPF A;  1NMG A;  1VQ9 A;  2QW7 A;  4DR5 L;  2IHE A;  5L37 A;  3JAM E;  2NVY H;  4Q0F A;  3LGJ A;  1X3Q A;  4XT3 B;  2K28 A;  4DNT B;  1LLR D;  1I3Q H;  4DF7 A;  3BDC A;  5CV6 A;  1HFN A;  2RCN A;  2ID0 A;  2EY2 A;  3STB C;  3VR6 A;  5J1Z A;  5I6W A;  1H9S B;  3P20 A;  4QUC A;  5JJL A;  4TVA B;  4A3J B;  3QIA A;  4DXF A;  1QUQ B;  4K2L A;  2ZXP A;  4HJ8 A;  1CI3 M;  5IP9 G;  4A3C G;  2Q8R E;  1TT2 A;  1YJW A;  4OIJ A;  5JPM C;  1KD1 C;  2F3I A;  2PZU A;  4JBW A;  5BN4 A;  2SDF A;  3BZD B;  1K0R A;  2B29 A;  2YYZ A;  3H6M A;  3T13 A;  2N49 A;  4MN3 A;  3IAY A;  4B3M L;  3NEN A;  1QVG A;  4LWC A;  1TWG H;  5CYU A;  4DV1 Q;  3S15 H;  1VQA A;  2K1B A;  3CCJ A;  4IFD J;  3C2P A;  3R8B A;  1QWY A;  2PQA B;  3I4N H;  3SK8 A;  3K80 C;  3SHL A;  2JA6 G;  3GTL H;  4A3M G;  4KN7 C;  4JG2 A;  3OIP A;  3ITP A;  4HMI A;  4BY7 H;  5KNC A;  3UDX A;  3K81 C;  1K8G A;  2HDM A;  2JN4 A;  4EQP A;  1PTO D;  1SRO A;  2K04 A;  4IUQ A;  5I6Y A;  4OXP A;  4NW2 A;  5J3B A;  3CU7 A;  3QOJ A;  1X3G A;  2Q8T A;  5IWA L;  4DR3 L;  1N32 L;  5KNB A;  4XQQ A;  2BCO A;  3KF8 A;  2H1E A;  2HUG A;  1X6O A;  5I2Y A;  5CV5 A;  1HFG A;  5LMN W;  1B7Y B;  3PIO A;  4A93 B;  4A93 G;  3STB D;  2H4O A;  5DM6 3;  1GUW A;  5EQ0 A;  2AQ1 B;  1N34 Q;  3EJI A;  2OQK A;  1DD2 A;  2IX1 A;  3NTK A;  3CP0 A;  5DAU A;  1TY2 A;  1B70 B;  1I4Q A;  1YIT A;  1UEA B;  4JI4 Q;  1JWU D;  1M1K C;  3G48 A;  3A56 A;  1MGS A;  5CBA E;  1P16 A;  1MD2 D;  1TWC B;  1IKL A;  1HXY D;  3S1M B;  3TEH B;  1XXG A;  2WKD A;  1BXT A;  4DFA A;  1MKH A;  1XTC D;  2NUC A;  2F03 A;  1YHA A;  1EYA A;  1PH6 A;  3AYH B;  4GNX C;  2AQ2 B;  2DGY A;  2JQO A;  3D3R A;  4Z9C B;  1NE3 A;  3BVZ A;  3HKZ E;  4A75 A;  1GHK A;  2XRS D;  2CCZ A;  3ULL A;  2WIN B;  1QZH A;  1VQK A;  3GTL B;  4ILW A;  4NXM Q;  3PUV A;  3T53 B;  4OO1 G;  1A6X A;  2QEJ C;  2ZM6 Q;  3FPU B;  2YTX A;  1O7Z A;  3KYH C;  4APV A;  5LL6 X;  3KDF A;  1Y1V H;  2NYZ D;  2CWP A;  1TWG B;  1LTS D;  3CC7 A;  2HDL A;  5HGQ A;  5ISR A;  2MGS A;  5IP7 G;  1E2W A;  3C46 A;  3TP6 A;  2ASB A;  4KJO A;  1HR0 Q;  4LF4 L;  3AU7 A;  3S1M H;  3A8I E;  1OXS C;  2EJM A;  4HED A;  2UUA Q;  4NMZ A;  4ULL A;  1SMY C;  2MQH A;  1PFN A;  4AYB E;  4JYA Q;  1DON A;  3I4M G;  2NVQ B;  1EIH A;  1FGB D;  1I5F A;  1ZEQ X;  4GS3 A;  3VR2 A;  1WTQ A;  5EGT A;  1EZ6 A;  3TZD A;  4H13 C;  4F7X A;  1PV4 A;  2JA5 G;  5IWA Q;  1N32 Q;  5JVG 3;  2P5Z X;  2K5Q A;  2WII B;  3R2T A;  4JI2 Q;  5KRU A;  4FF1 A;  3GTK B;  2BH2 A;  4O42 A;  1HR0 W;  1ML0 D;  2B2T C;  1ONL A;  1K83 H;  2BA0 A;  1ASZ A;  2I07 B;  4BY1 G;  2CW0 D;  4R4T A;  2RBM A;  3I4M B;  1VF7 A;  3MC0 B;  1ET6 A;  3O13 A;  2OXP A;  1EWC A;  3Q0A A;  2B2Y C;  1PH5 A;  2JA5 B;  1RTN A;  4JV5 L;  3RUZ A;  1LAB A;  4DUY L;  1LT6 D;  5EPK A;  1JE4 A;  2KEC A;  3T1Y Q;  2YU9 B;  3EIV A;  1HNZ Q;  3K5N A;  1LO5 D;  4IOC A;  1YJ9 A;  3JAM c;  5T1I A;  3FKI B;  3GTG H;  1A3U A;  1QG7 A;  4K14 A;  1FJG Q;  5IYD H;  2JP1 A;  4B3M Q;  3S16 B;  4JI3 L;  3E9I A;  3FP9 A;  4EQ5 A;  2Z4H A;  4HJ9 A;  2WAQ E;  4DU9 A;  5C4H A;  4KHP Q;  3H0G B;  4CDF C;  4A3M H;  3CQZ H;  4JI6 L;  1PH8 A;  3GTQ B;  4C56 C;  2GVA A;  5LL6 S;  3GTM H;  1X65 A;  1Q46 A;  3NTI A;  4YWM A;  2WAC A;  3C3L A;  3G4S A;  3PCO B;  5FLX L;  4A3E B;  5H1S E;  1UEB A;  3QJY A;  4C3J H;  4DK1 A;  4LFA Q;  3CRL C;  4PMB A;  2JSO A;  1SMY D;  1AW7 A;  3KK7 A;  4MTK A;  1R9T B;  1X3E A;  1W3S A;  4PZ8 A;  1TWF B;  2F1M A;  3V2T A;  1I6H B;  5EJW A;  4RGT A;  5C0X J;  3NEM A;  3TP7 A;  3KLR A;  4QIW B;  5IGB A;  3RR5 A;  2A8V A;  1YNN C;  2N78 A;  1IHZ A;  4XYQ A;  1SJE D;  5M3M B;  5CV9 A;  3EQL C;  1HUN A;  1XNQ Q;  4TKO B;  1E2Z A;  1Z7T A;  2EQS A;  3SXH A;  1YIJ A;  2BE5 C;  4JOI A;  4DK0 A;  1A0I A;  2FJ2 A;  5M5W B;  4QMG A;  3E6Z X;  1OXX K;  3CC4 A;  5IOD A;  5I9O A;  4GKJ Q;  4DR1 Q;  1EQT A;  4RGM A;  1B3Q A;  2K4K A;  1VQJ A;  1KQS A;  1O78 A;  4NP5 A;  4DNR B;  1K73 C;  1PH2 A;  3TZU A;  1TWA B;  1XNQ L;  1I50 H;  3M4O H;  1QCB D;  2B2T A;  3PIP A;  5LMN L;  1U5K A;  2F0U A;  4L5T A;  1I4P A;  4CJ2 C;  2FMC A;  1LYL A;  3GQB A;  1NJI C;  2R92 G;  4FF4 A;  3K5L A;  3AEV A;  1JB7 A;  4FXD A;  4IPH A;  1SE4 A;  4WJ4 A;  1N9W A;  4I7Z C;  3S17 H;  4DKA C;  1E7Z A;  2R61 A;  1U4L A;  1VQ7 A;  4LFB Q;  1H9R A;  4ABN A;  1UWV A;  4QY7 A;  2QCP X;  4FVM A;  4KMU C;  4I65 A;  1L1O A;  3VDY A;  1JIC A;  4GZY C;  1N8R C;  3CAM A;  4RCN A;  4CJ0 B;  3TRZ A;  3GTG B;  5KYI A;  1SNM A;  3VR4 A;  4CHT B;  2R7D A;  2JEB I;  2JJQ A;  5EKI A;  1RIP A;  3TSS A;  5IGD A;  3MFY A;  4GKK Q;  1BQQ T;  1S5F D;  2B8G A;  2MNA A;  3K57 A;  1VDZ A;  2LY7 A;  2RDH A;  2LS0 1;  1A3T A;  4JI6 Q;  1DM0 B;  2NN6 H;  4B9X A;  5C3E B;  4FO2 A;  1C9O A;  1EWH A;  1BF4 A;  2Q2T A;  2KCC A;  1HZB A;  3OMC A;  3ERQ A;  3PUZ A;  4H44 C;  3SK4 A;  2XWB B;  5JJI A;  1A15 A;  4C3H B;  2NVY B;  1KL9 A;  4KHV A;  1GUT A;  4HN7 A;  1HNZ L;  1JT8 A;  5M3F B;  2NWG A;  2F4I A;  4KY7 A;  3K5O A;  3DMU A;  5C3E G;  1WJJ A;  2Z9H A;  2IT1 A;  4JK1 C;  5IGG A;  4ZCK A;  1Y8O B;  1EY0 A;  5M5Y H;  2EZV A;  3T51 B;  3FMC A;  2ZXR A;  2F0D A;  3M7N A;  4DR5 Q;  5LMU L;  1SYB A;  2LXK A;  1CQV A;  2F0T A;  4PV1 C;  1VQ5 A;  2DY8 A;  1SBB B;  5C4Z A;  1PH4 A;  3JAM L;  4KV6 A;  4LF9 L;  3VA5 A;  1L0Y B;  5JEA H;  3E0J A;  5K5P A;  3MXP A;  1WTH A;  1K3R A;  4DK3 C;  1YHQ A;  1D5Z C;  4BBS G;  2Q8I B;  4FF3 A;  5JOB A;  2F0W A;  3HS0 C;  4HJ5 A;  4CKC A;  3BS1 A;  3GTP H;  5EBC A;  1X32 A;  1LT4 D;  1BVS A;  1SN8 A;  4HR7 B;  4XIG S;  3WWV A;  4AYB B;  4NKL A;  1VQ8 A;  4LK1 C;  1N34 L;  3DUZ A;  1SE8 A;  1EWI A;  3W2D A;  1H9S A;  5GAG C;  4AIM A;  2L0C A;  1HRJ A;  3TN2 A;  1MIU A;  4X3T A;  1XMQ L;  4KKT A;  3T4A C;  1HTP A;  1V9P A;  4K6L A;  4MHE A;  5M3F H;  1OXV A;  2NBF A;  4R8N A;  1KIX A;  3CCR A;  3A7L A;  3S1Q B;  1EYG A;  2K32 A;  5IYC G;  3M4Q A;  2VQF L;  2WAQ B;  1SNQ A;  4LF7 Q;  2HIX A;  2CH4 W;  1NSN S;  3CMA A;  1STA A;  4A3G B;  1HCZ A;  2UXB L;  3S1R H;  4DN4 M;  1XNR L;  2NVT B;  3URY A;  2B63 H;  4A93 H;  1AZP A;  3FVQ A;  1IBK Q;  1CHP D;  1EY5 A;  1TS5 A;  3Q8D A;  3UE0 A;  4LUZ A;  1STB A;  1RF2 D;  5IT9 L;  3FRP B;  1EFW A;  3QOL A;  2KCM A;  4XYO A;  4TSS A;  1GD7 A;  3QB3 A;  5ELE A;  1D5X C;  2F0K A;  5M9O A;  2ZT9 C;  3RLO A;  4UP9 A;  1K28 A;  1LT5 D;  4BXX G;  3W3A A;  5I9P A;  4RGO S;  3S2D H;  2Z1C A;  1BO0 A;  1V8Q A;  4BY1 B;  4R4O A;  1TXY A;  4RGN A;  1C7Y A;  2F4V L;  1R4P B;  4KN4 C;  2F0V A;  3U4Z A;  4NXN Q;  2VW9 A;  2Y0S E;  3PO3 H;  3PO3 B;  1ZKO A;  1TR5 A;  2M9V A;  2VXW A;  2ZTC A;  1KAA A;  3TBI B;  2RHQ B;  3ZJY C;  3S17 B;  3OTO L;  3N52 A;  3I70 A;  4LF9 Q;  2JE6 I;  2EVB A;  1NR4 A;  2CQA A;  3HG9 A;  4OWT B;  2R93 B;  2JXM B;  3DWQ A;  4NXN L;  1SNC A;  2L1B A;  1JB3 A;  3HGB A;  1CA6 A;  5FJ8 G;  3H09 A;  1HZ9 A;  2G5D A;  4YCW A;  2EYH A;  2L15 A;  3NQT A;  3EBE A;  1QNU A;  4ODG A;  2K7V A;  4KY5 A;  1G6Z A;  4JI1 L;  4KKS A;  5IOC A;  4B9W A;  4GOP B;  4FXK C;  2A74 C;  4MNO A;  3Q24 A;  1ASY A;  3BYT B;  1STH A;  1DOL A;  3U9O A;  2HIV A;  2VL6 A;  5CR3 A;  4KD3 A;  4OWW B;  3GTO H;  2D0O A;  2KEN A;  1PFS A;  2NTT A;  1NBW A;  5AFW A;  4JV5 Q;  3F8T A;  2EOT A;  1HPC A;  3KLS X;  3HOZ B;  2K5H A;  4POG A;  3DWA A;  1JC7 A;  2OWO A;  5ELD A;  3UI2 A;  1G2T A;  1ZXT A;  1XX8 A;  1STY A;  3IFD A;  4GKJ L;  4JI5 L;  3SE0 A;  1VQL A;  4YWL A;  4IUR A;  3J7A V;  4A3B B;  4DR7 L;  3VYR A;  2AWN A;  1VQP A;  3MWY W;  1N36 Q;  2A6H C;  1STG A;  4RKL A;  1IYV A;  3RZO H;  3OIQ A;  4OO1 H;  2CFM A;  5EAY A;  2X69 A;  1TWA H;  2B2V A;  4J1M A;  2PYK A;  4HSP A;  2A1A A;  3BDO A;  4QL5 A;  5C4J H;  1CTM A;  4AYB G;  3SVM A;  1MJE A;  1VQO A;  1S5E D;  4UP8 A;  4L63 B;  4IUT A;  2QDB A;  4GN3 B;  4CDE C;  1IBM L;  3G6J B;  5M5W H;  4K5V A;  4MIU A;  1EIY B;  4FXG C;  1A2U A;  3K7A H;  4CJ1 B;  2AQ3 B;  3OSO A;  5HY6 A;  4ID6 A;  2EJF C;  3E5S A;  1Y1W B;  5E4W C;  1PRT B;  1W6J A;  4IJH A;  4CKB A;  2F0M A;  2HHH Q;  2OTJ A;  5A2Q E;  1EIF A;  3L9A X;  1EQR A;  3NWS A;  5LMU Q;  3J7Z C;  2KEE A;  1FR3 A;  2O5I C;  3CF5 A;  2A69 C;  3F2B A;  1P8L A; 
#chains in the Genus database with same CATH homology
 1DXM A;  4WFN 3;  4DAY A;  5EKL A;  3TP8 A;  4A3I B;  1B2T A;  1SND A;  5DEH A;  1LTG D;  1EYD A;  3MA2 B;  3NBI A;  2AUK A;  1DOM A;  1R4Q B;  1OXU A;  1KDC A;  4RH6 A;  3NUC A;  3P1H A;  2X6L A;  2RVL A;  4G7Z C;  2EYP A;  3X3M A;  1S4Z A;  3I91 A;  3HOV B;  3D6W A;  4KHZ A;  3U9S A;  4J8Q A;  4IFD G;  4ZUI A;  2F0P A;  5KGU A;  3DWP A;  1I6V C;  4ZQ3 A;  1O7L A;  2EYL A;  2PO4 A;  2SNS A;  1NR2 A;  5BN3 A;  1B1Z A;  3NWT A;  4S3S A;  3S2H B;  3D6C A;  1I4R A;  2OT2 A;  4C3H G;  2LKV A;  1WD1 A;  1PRT C;  2RSN A;  1C4Q A;  2XWJ B;  3MXU A;  1GOZ A;  3Q6S A;  1O80 A;  4K5X A;  2EE1 A;  5C6A A;  1TS2 A;  2VB2 X;  3J7Y W;  2J7Z A;  2G9H D;  2NB0 A;  3H94 A;  4ZKB B;  1I4H A;  2F3W A;  2RA4 A;  4BS9 A;  3G7L A;  2F0F A;  4F87 A;  1F2M A;  3RMH A;  2BDO A;  3J7A F;  3PO2 B;  3VR5 A;  4BBS B;  4H0L C;  1SXT A;  1AP0 A;  1KTK A;  4G7H C;  1D6E C;  3FEW X;  5EBD A;  3GD7 A;  2EYO A;  3P75 A;  3D31 A;  5IT9 E;  5HUR A;  3HP3 A;  1M4V A;  2O2L D;  1HTL D;  1EL0 A;  1ESR A;  4RA8 A;  1SYE A;  1PFB A;  2DY7 A;  1DOK A;  2X6G A;  4OO1 I;  3OHX C;  3MXN A;  4OHJ A;  1WTX A;  3M7G A;  3KBG A;  4YIJ A;  1B4O A;  5C5M A;  3D4W A;  1EYC A;  1BCP B;  2B39 A;  1KLG D;  2Y0S B;  1A2T A;  2L4N A;  5NUC A;  3MFG A;  1GUG A;  4OIK A;  5FO8 B;  2L9H A;  3NSW A;  2VNU D;  1QOH A;  4UDU C;  3LNN A;  3HOY B;  1PTO C;  3MZ5 A;  2JA7 B;  2ICI A;  2F0S A;  4C3J G;  1XYI A;  2IPK D;  4A3D B;  1JOQ A;  3DHQ A;  1F9P A;  1KDA A;  3BDL A;  1V1P A;  3BYY B;  2C5C A;  2JA6 B;  3GTM B;  2XNA C;  2TMP A;  3D4D A;  2XIW A;  1G2S A;  3C1E A;  1SYD A;  4A3K B;  3I4L A;  5JPN C;  4G4K A;  1OO9 B;  4C2M B;  4QUF A;  3QG1 A;  4KTA A;  1IKM A;  4KY6 A;  1TU2 B;  3R93 A;  2MP1 A;  1HA5 A;  3MXG A;  2B2V C;  1WTO A;  1IW7 C;  3VYU A;  3PMF A;  1DCZ A;  2K5D A;  4IFD I;  4FYD A;  1J9O A;  2GA4 B;  4IN3 A;  1BR9 A;  1C8C A;  1D1K A;  4C3I B;  4C3I G;  3A8J E;  3J81 L;  5C0X H;  1GUS A;  1EOT A;  4X3S A;  3RZD B;  1PFM A;  3J81 E;  1ENA A;  1ZYR D;  2DNE A;  3SEB A;  1BDO A;  5D3I B;  5F2D A;  2IW3 A;  5KIX A;  1YNJ C;  1STN A;  4Q5V A;  4ZK9 B;  2PQE A;  1U9R A;  2E2H B;  3AMU A;  1HA6 A;  4BA2 I;  3K5M A;  1LTB D;  3LX0 A;  4HCS A;  2IL8 A;  2HCI A;  2D5D A;  2PW7 A;  1LT3 D;  2SEB D;  1PXU A;  2F0Q A;  5CV7 A;  1UUP A;  5EKK A;  2RDF A;  4ZYS A;  3P7J A;  3PIP 3;  4N9P A;  2KED A;  2AWO A;  4RWS C;  3S1N B;  1G8Z D;  2NZ1 D;  1SFO B;  4FF2 A;  2RSO A;  1B3A A;  5K36 G;  1NUC A;  1Z6H A;  4DGZ A;  2VB3 X;  4M1U B;  1STE A;  1PRT F;  2D9U A;  2PZW A;  1WTW A;  2A68 D;  1IYU A;  1XWE A;  3NQI A;  3F2U A;  1MSG A;  3TDQ A;  2KHS A;  3L3O C;  4HCE A;  4ZUJ A;  2ICE C;  1CQF A;  2OEO A;  2E76 C;  3BG3 A;  1I3Q B;  1QE6 A;  1EY7 A;  2EY6 A;  1EY9 A;  5ELF A;  1D5M C;  1W6K A;  1EQV A;  4Y7N B;  1Y69 U;  1II3 A;  4EQN A;  3MTS A;  5FOB B;  1ILQ A;  1PDQ A;  2G9D A;  5KYL A;  1GXD C;  3GTJ B;  1KAB A;  1FYC A;  3FPP A;  4A3M B;  3I4N B;  4KKU A;  1DZ1 A;  2L11 A;  1EEI D;  4XXE A;  3VYS A;  2R6G A;  4B08 A;  4PQX A;  2EXZ A;  1EY6 A;  1ENF A;  2EYF A;  4XTC S;  2JEA I;  4NDX A;  5FO7 B;  3OOC A;  1ESF A;  5J22 A;  2O4X A;  4DAP A;  1I4G A;  1I50 B;  3VA7 A;  3M4O B;  2KOL A;  1TS3 A;  2EDG A;  4IUP A;  2EPB A;  1F77 A;  1T5E A;  1WD0 A;  3FDT A;  1RJT A;  1B9N A;  1QB5 D;  1EZ8 A;  2BOS A;  3CKI B;  5JVH 3;  1S5C D;  3ND8 A;  3MEH A;  3SK5 A;  1GHJ A;  5TSS A;  4PMW A;  4V19 0;  3EVQ A;  4TQU S;  1ICW A;  1MSH A;  4J6H A;  1Y1V B;  5CGK A;  1PYW D;  2D62 A;  4HMJ A;  1MI2 A;  2KA7 A;  4ZKC B;  1AFP A;  1RHP A;  4PNY A;  3DEP A;  1F9S A;  4EVO A;  3HOW B;  3ONA B;  1SYF A;  2FFK B;  5D65 A;  2IX3 A;  5C44 B;  4C3J B;  4R9W A;  1NCV A;  5JEA G;  3X3N A;  4CKE A;  3I90 A;  1PMR A;  3HOX B;  1LTR D;  3GTO B;  1GUN A;  1JR0 D;  1D2B A;  1E0B A;  4L6T B;  2Z8L A;  1WTR A;  4N9T A;  1CZW A;  1GJX A;  4TRD A;  1VMP A;  1U4R A;  2VUM B;  4XQJ A;  2KQ3 A;  1AEX A;  3PIO 3;  2B2U C;  1ROD A;  3R3O A;  1F2L A;  3EA6 A;  3OMG A;  2B2Y A;  2F0J A;  1SEB D;  4PMC A;  5IIF A;  1ENC A;  4RHS A;  1BUV T;  4P2C B;  3OPO A;  1U4M A;  2E2D C;  2CVR A;  4EQO A;  1TY0 A;  3DM1 A;  4H7B A;  2HCC A;  4XQN A;  2K6A A;  5C5L A;  1PRT D;  3K7A B;  2MHV A;  2MUY A;  1G29 1;  1FNV A;  4RHR A;  4KK7 A;  1EFI D;  3OW7 A;  3SK6 A;  5CV4 A;  5I2X A;  1RDP D;  5IGF A;  1F9Q A;  2PMZ B;  4QB4 A;  2KUM A;  1D1I A;  1VMC A;  5C3W A;  1H9M A;  1EU3 A;  1G91 A;  2B2W A;  3HEJ A;  5D14 A;  1LTI D;  2IX0 A;  2LMC B;  1MBY A;  1O7Y A;  5FK9 C;  2ZXO A;  3PUW A;  5BN5 A;  4UAI A;  3ZYY X;  3RD4 A;  1LAC A;  1BBX C;  3IFT A;  4HTH A;  5EPL A;  5JJZ A;  2A5H A;  3J80 E;  1SAP A;  5E1F A;  4WRD A;  2IJ0 A;  4RFB A;  1E2V A;  3PUX A;  2EYJ A;  5CC4 A;  5DM7 3;  4BWG B;  3M4Y A;  2I46 A;  2A6E D;  4M8A A;  2L12 A;  3H91 A;  2QIL A;  4K6D A;  2WKC A;  2M2L A;  1LTT D;  2N88 A;  3CRK C;  2L55 A;  1EIG A;  4RKB A;  4FNF A;  3A8K E;  2DN8 A;  4KI0 A;  1F2Y A;  3NK9 A;  4DA2 A;  5E3F A;  3BVG A;  2HQE A;  3M85 A;  2F0G A;  1JWM D;  4G7O C;  5G3L F;  1OXT A;  1RTO A;  2R92 B;  1ILP A;  2EJG C;  3S9W A;  3S15 B;  1SE2 A;  4K5W A;  3I73 A;  2A6H D;  4C1N K;  1CT1 D;  1RKN A;  1WVL A;  1TQO A;  1B44 D;  4K8I A;  1QJO A;  1JOR A;  2B2U A;  2NN6 I;  3A55 A;  1K83 B;  3V96 A;  5FLX E;  4LJZ C;  1PZK D;  1QIL A;  3I72 A;  3V05 A;  1AZQ A;  2A69 D;  3OWE B;  1LTA D;  2MPM A;  2E74 C;  2A6E C;  2XSC A;  3ND9 A;  1BCP C;  4U68 A;  2SNM A;  2PNR C;  1K8M A;  5ELC A;  3WOE A;  3GV3 A;  4C1N I;  4XDX A;  1K8O A;  2WP8 J;  1S5D D;  4BBR B;  2F0N A;  2XVS A;  2KVM A;  3I3C A;  2BA1 A;  2ENB A;  2SOB A;  3NHH A;  3QWN A;  4IFD H;  1C48 A;  1PZJ D;  3MAQ A;  3K0Y A;  1CA5 A;  4X3U A;  3NE5 B;  4HAE A;  3AB9 A;  2C9O A;  5HGT A;  4OGQ C;  1IW7 D;  1PTO H;  2XN9 C;  4QF4 A;  2IWH A;  4OL7 A;  2K5W A;  1CHQ D;  4QCL A;  3EFX D;  2E2J B;  3ERO A;  5KND A;  1F9R A;  4X3K A;  1JOO A;  3PV0 A;  5IGE A;  1Q1B A;  3D8G A;  2F0O A;  1M8A A;  2K33 A;  1Z47 A;  5C0X G;  3IKJ A;  4FP5 D;  2NVX B;  1QNK A;  2R7Z B;  2EY1 A;  1ZYR C;  3OWF A;  1JCK B;  3LWE A;  2JA8 B;  4CGY B;  1BCP D;  5C4X B;  4IAL A;  3TME A;  2F0H A;  1YNJ D;  2CW0 C;  2WB1 B;  1Y8P B;  1BNZ A;  1AN8 A;  2N55 A;  1WCM B;  3MVV A;  1FD7 D;  3C1F A;  1IL8 A;  2F0I A;  2RKS A;  4ZLT F;  5KEE A;  5G3L D;  3RLF A;  3CQZ B;  1RCV D;  1SNP A;  4WJW A;  4RAU C;  3K59 A;  2RDG A;  3BVM A;  2NTS A;  2BE5 D;  1HQR D;  1Q90 A;  1B50 A;  3NXW A;  3Q22 A;  1HHV A;  3L7Z C;  5FO9 B;  2PW5 A;  1Q1E A;  1SSO A;  3KLS A;  2E75 C;  4F88 A;  1SYC A;  3H3V C;  3HZX A;  5D3D A;  4L8J A;  3GO5 A;  5DNF A;  4RCO A;  1KNA A;  3K6O A;  3HOU B;  1T5X D;  2B63 B;  3A7A B;  2TSS A;  1FNW A;  3NTH A;  1EY8 A;  4WOR A;  4EGV A;  2OF1 A;  1Q3L A;  1YNN D;  3TP5 A;  2LFN A;  1HQM C;  2D2C C;  3M3Y B;  2K01 A;  1CM9 A;  5LHY 1;  1PTO F;  1SDF A;  1UNS A;  1V1P B;  4O1N A;  2Z4I A;  2J0T D;  2RQX A;  1JOK A;  1KLU D;  4DXG A;  1VF5 C;  2B2W C;  2AUJ D;  1NAP A;  2FHT A;  1S5B D;  1A3V A;  1CZG A;  1PLF A;  5T1G A;  4IUU A;  5CMD A;  3A54 A;  2V4D A;  5E4X A;  5J39 A;  1RD9 D;  3I8Z A;  1KDB A;  2E2I B;  3QO2 A;  2KCN A;  2A68 C;  3R2I A;  1H9J A;  1F2Z A;  3NBH A;  5ELB A;  1B53 A;  4CBV A;  1V43 A;  4ZAI A;  1SYG A;  2JYO A;  3T16 A;  1EEF D;  3RZO B;  5C3X A;  1CK1 A;  2F0L A;  3K58 A;  5A2Q L;  3D4R A;  5IGC A;  4KJN A;  5COR A;  2MJ8 A;  1TII D;  4IQZ A;  4LAA A;  2J4X A;  1B9M A;  1FNU A;  4ZRZ A;  2O5J C;  1CFM A;  4IZ8 A;  2QKI C;  4ME5 A;  3VR3 A;  2A73 B;  3HRZ C;  1EU4 A;  1BCP F;  1TKW B;  3CHB D;  4IUN A;  4V0B A;  4A3F B;  2XRQ D;  5C4J B;  3N6R A;  2K05 A;  3HKZ B;  5COY A;  1WTP A;  4LMQ D;  5I4D A;  1DJR D;  3T56 B;  3DEO A;  2EY5 A;  1H9K A;  3WDN A;  3MHB A;  4U67 3;  4R8I A;  3S14 B;  3GV6 A;  1VCI A;  4HSV A;  3KUP A;  2EYM A;  4DAV A;  1V1O A;  3WOF A;  1TVX A;  3S2D B;  1JQY D;  4K8J A;  1LV9 A;  1Y8N B;  1EY4 A;  1ET9 A;  5A35 A;  4KD4 A;  1SJH D;  2NN6 G;  4BA1 I;  2BDN A;  4G57 A;  1U4P A;  2F3V A;  1DYQ A;  1L0X B;  1HUM A;  1Q12 A;  5C0X I;  4E6I A;  1JWS D;  1PZI D;  5CV8 A;  5M5X B;  2L5T A;  2CHB D;  3VYT A;  2KJX A;  2PCF B;  3DXJ C;  3Q23 A;  1Q8I A;  1TS4 A;  4XT1 B;  4F8M A;  2QF7 A;  5JAV A;  3KBX A;  5FKA C;  1SNO A;  3LWU A;  1J8I A;  2PZT A;  3NPP A;  1WTV A;  1SE3 A;  5CBE E;  3SDZ A;  1X3P A;  3IL8 A;  2DNC A;  1I4X A;  5EPJ A;  4BY7 B;  3J80 L;  3GTP B;  1PTO B;  4K2K A;  5JEA J;  2FIN B;  2M00 A;  1GUO A;  2PPB C;  1BOS A;  3NP8 A;  2FMM A;  2WV6 D;  2F0E A;  3S1R B;  3PUY A;  1TWH B;  1UAP A;  3SR1 A;  1KNE A;  5K36 H;  4IUV A;  2R3Z A;  5M5Y B;  2B8F A;  2K03 A;  3GP7 A;  3JAM E;  4Q0F A;  1X3Q A;  4XT3 B;  2K28 A;  4DNT B;  1LLR D;  4DF7 A;  3BDC A;  5CV6 A;  1HFN A;  2ID0 A;  2EY2 A;  3VR6 A;  5J1Z A;  5I6W A;  1H9S B;  3P20 A;  4QUC A;  4A3J B;  3QIA A;  4DXF A;  4K2L A;  2ZXP A;  1CI3 M;  2Q8R E;  1TT2 A;  4OIJ A;  5JPM C;  2PZU A;  4JBW A;  5BN4 A;  2SDF A;  3BZD B;  2YYZ A;  3H6M A;  3T13 A;  4MN3 A;  3IAY A;  5CYU A;  2K1B A;  4IFD J;  3C2P A;  3R8B A;  1QWY A;  3SK8 A;  3SHL A;  4KN7 C;  3OIP A;  3ITP A;  4HMI A;  5KNC A;  2HDM A;  4EQP A;  1PTO D;  2K04 A;  4IUQ A;  5I6Y A;  4NW2 A;  3CU7 A;  3QOJ A;  2Q8T A;  5KNB A;  4XQQ A;  2BCO A;  3KF8 A;  2H1E A;  2HUG A;  5I2Y A;  5CV5 A;  1HFG A;  4A93 B;  2H4O A;  5DM6 3;  1GUW A;  5EQ0 A;  2AQ1 B;  3EJI A;  1DD2 A;  2IX1 A;  3NTK A;  5DAU A;  1TY2 A;  1I4Q A;  1UEA B;  1JWU D;  3A56 A;  1MGS A;  5CBA E;  1MD2 D;  1TWC B;  1IKL A;  1HXY D;  3S1M B;  1XXG A;  2WKD A;  1BXT A;  4DFA A;  1XTC D;  2NUC A;  2F03 A;  1EYA A;  2AQ2 B;  3D3R A;  4Z9C B;  3BVZ A;  1GHK A;  2XRS D;  2WIN B;  3GTL B;  4ILW A;  3PUV A;  3T53 B;  4OO1 G;  1A6X A;  2QEJ C;  3FPU B;  1O7Z A;  5LL6 X;  2NYZ D;  1TWG B;  1LTS D;  2HDL A;  5ISR A;  2MGS A;  1E2W A;  3C46 A;  3TP6 A;  4KJO A;  3AU7 A;  3A8I E;  1OXS C;  2EJM A;  4HED A;  4NMZ A;  4ULL A;  1SMY C;  1PFN A;  1DON A;  2NVQ B;  1EIH A;  1FGB D;  1ZEQ X;  3VR2 A;  1WTQ A;  5EGT A;  1EZ6 A;  3TZD A;  4H13 C;  4F7X A;  5JVG 3;  3R2T A;  2K5Q A;  2WII B;  5KRU A;  4FF1 A;  3GTK B;  4O42 A;  1ML0 D;  2B2T C;  1ONL A;  2BA0 A;  2I07 B;  2CW0 D;  2RBM A;  3I4M B;  1VF7 A;  3MC0 B;  1ET6 A;  3O13 A;  2OXP A;  1EWC A;  3Q0A A;  2B2Y C;  2JA5 B;  1RTN A;  3RUZ A;  1LAB A;  1LT6 D;  5EPK A;  1JE4 A;  2KEC A;  2YU9 B;  3K5N A;  1LO5 D;  5T1I A;  3FKI B;  1A3U A;  1QG7 A;  4K14 A;  2JP1 A;  3S16 B;  2Z4H A;  4DU9 A;  5C4H A;  3H0G B;  3GTQ B;  4C56 C;  5LL6 S;  3NTI A;  2WAC A;  3C3L A;  5FLX L;  4A3E B;  3QJY A;  4DK1 A;  3CRL C;  4PMB A;  2JSO A;  1SMY D;  1AW7 A;  3KK7 A;  1R9T B;  1TWF B;  2F1M A;  3V2T A;  1I6H B;  5EJW A;  4RGT A;  5C0X J;  3TP7 A;  3KLR A;  4QIW B;  5IGB A;  1YNN C;  1IHZ A;  4XYQ A;  1SJE D;  5M3M B;  5CV9 A;  3EQL C;  1HUN A;  4TKO B;  1E2Z A;  1Z7T A;  3SXH A;  2BE5 C;  4DK0 A;  2FJ2 A;  5M5W B;  4QMG A;  3E6Z X;  1OXX K;  5IOD A;  5I9O A;  1EQT A;  4RGM A;  1O78 A;  4NP5 A;  4DNR B;  3TZU A;  1TWA B;  1QCB D;  2B2T A;  2F0U A;  1I4P A;  4CJ2 C;  2FMC A;  3GQB A;  4FF4 A;  3K5L A;  4FXD A;  1SE4 A;  4I7Z C;  2R61 A;  1U4L A;  1H9R A;  4ABN A;  2QCP X;  4FVM A;  4KMU C;  4I65 A;  1JIC A;  4GZY C;  4RCN A;  4CJ0 B;  3GTG B;  5KYI A;  1SNM A;  3VR4 A;  4CHT B;  2JEB I;  5EKI A;  3TSS A;  5IGD A;  3MFY A;  1BQQ T;  1S5F D;  2B8G A;  3K57 A;  1VDZ A;  2LY7 A;  2RDH A;  2LS0 1;  1A3T A;  1DM0 B;  2NN6 H;  4B9X A;  5C3E B;  4FO2 A;  1EWH A;  1BF4 A;  2KCC A;  3OMC A;  3ERQ A;  3PUZ A;  4H44 C;  3SK4 A;  2XWB B;  1A15 A;  4C3H B;  2NVY B;  4KHV A;  1GUT A;  4HN7 A;  5M3F B;  2NWG A;  2F4I A;  4KY7 A;  3K5O A;  3DMU A;  2IT1 A;  4JK1 C;  5IGG A;  1Y8O B;  1EY0 A;  2EZV A;  3T51 B;  3FMC A;  2ZXR A;  2F0D A;  3M7N A;  1SYB A;  1CQV A;  2F0T A;  4PV1 C;  2DY8 A;  1SBB B;  5C4Z A;  3JAM L;  4KV6 A;  3VA5 A;  1L0Y B;  5JEA H;  3E0J A;  5K5P A;  3MXP A;  1D5Z C;  2Q8I B;  4FF3 A;  5JOB A;  2F0W A;  3HS0 C;  4CKC A;  3BS1 A;  5EBC A;  1X32 A;  1LT4 D;  4HR7 B;  4XIG S;  4AYB B;  4NKL A;  4LK1 C;  3DUZ A;  3W2D A;  1H9S A;  2L0C A;  1HRJ A;  3TN2 A;  4X3T A;  4KKT A;  3T4A C;  1HTP A;  4K6L A;  4MHE A;  1OXV A;  2NBF A;  4R8N A;  3A7L A;  3S1Q B;  2K32 A;  2WAQ B;  1SNQ A;  1NSN S;  1STA A;  4A3G B;  1HCZ A;  4DN4 M;  2NVT B;  3URY A;  1AZP A;  3FVQ A;  1CHP D;  1EY5 A;  1TS5 A;  1STB A;  1RF2 D;  5IT9 L;  3FRP B;  3QOL A;  4XYO A;  4TSS A;  3QB3 A;  5ELE A;  1D5X C;  2F0K A;  5M9O A;  2ZT9 C;  1LT5 D;  3W3A A;  5I9P A;  4RGO S;  2Z1C A;  1BO0 A;  1V8Q A;  4BY1 B;  4RGN A;  1R4P B;  4KN4 C;  2F0V A;  3PO3 B;  1ZKO A;  1TR5 A;  2M9V A;  2VXW A;  1KAA A;  3TBI B;  3S17 B;  3N52 A;  3I70 A;  2JE6 I;  2EVB A;  1NR4 A;  2CQA A;  3HG9 A;  2R93 B;  2JXM B;  3DWQ A;  1SNC A;  2L1B A;  1JB3 A;  3HGB A;  1CA6 A;  3H09 A;  2EYH A;  3NQT A;  1QNU A;  4ODG A;  2K7V A;  4KY5 A;  1G6Z A;  4KKS A;  5IOC A;  4B9W A;  4FXK C;  2A74 C;  3Q24 A;  3BYT B;  1STH A;  1DOL A;  3U9O A;  5CR3 A;  4KD3 A;  2NTT A;  5AFW A;  2EOT A;  1HPC A;  3KLS X;  3HOZ B;  3DWA A;  1JC7 A;  5ELD A;  3UI2 A;  1G2T A;  1ZXT A;  1XX8 A;  1STY A;  3IFD A;  3SE0 A;  3J7A V;  4IUR A;  4A3B B;  3VYR A;  2AWN A;  3MWY W;  2A6H C;  1STG A;  4RKL A;  1IYV A;  3OIQ A;  4OO1 H;  2X69 A;  2B2V A;  4J1M A;  2PYK A;  4HSP A;  3BDO A;  1CTM A;  3SVM A;  1S5E D;  4L63 B;  4IUT A;  2QDB A;  3G6J B;  4K5V A;  4MIU A;  4FXG C;  1A2U A;  4CJ1 B;  2AQ3 B;  3OSO A;  4ID6 A;  2EJF C;  3E5S A;  1Y1W B;  5E4W C;  1PRT B;  1W6J A;  4CKB A;  2F0M A;  5A2Q E;  3L9A X;  3NWS A;  2KEE A;  2O5I C;  1FR3 A;  2A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...