3MEHA

Crystal structure of staphylococcal nuclease variant delta+phs i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 128
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mehA00
5I9OA 1F2YA 3NQTA 2F0IA 1RKNA 3HZXA 4NP5A 4WORA 3OSOA 4RKBA 5KYIA 2F0JA 1EZ6A 1II3A 3EVQA 3C1EA 3C1FA 1SYDA 3DHQA 1A3TA 4PMBA 5I9PA 1JORA 2EYLA 4ME5A 1KDBA 3E5SA 1JOKA 2PZTA 1SNPA 3H6MA 4KY6A 1EQVA 4B9XA 2OEOA 1EYCA 2KHSA 2ENBA 2PQEA 5CV6A 5KGUA 3SK4A 1EYDA 1ENAA 2F0FA 4ODGA 3MVVA 1A2TA 3T13A 2F0LA 2EY5A 5DAUA 5C5LA 5C3WA 5IGBA 4DU9A 1TR5A 2LKVA 1STYA 1SNQA 2EY2A 4KY5A 4NDXA 4J6HA 2F0KA 4K2KA 4MIUA 5HURA 3TP5A 3QOLA 1KABA 1EY7A 5C5MA 5E3FA 1SYEA 2F0MA 5IODA 3ITPA 3MEHA 4E6IA 3NXWA 5C3XA 2PYKA 1JOQA 5EGTA 1SYCA 3SR1A 2SNSA 4N9PA 2F0DA 1STGA 5F2DA 5J22A 4NKLA 4HMIA 4DF7A 1IHZA 1SNDA 1AEXA 5I6WA 4F7XA 3SXHA 3TP7A 4KV6A 4YIJA 3SK8A 5M9OA 4HTHA 4KTAA 4WRDA 3SHLA 5KEEA 4IUNA 2F0GA 5CR3A 5CV4A 1SYFA 2F0TA 1KDAA 1U9RA 5KIXA 2EYPA 3D6CA 5ISRA 4J1MA 1STAA 2EYJA 4ZUIA 2F3WA 2OXPA 2RKSA 5C4ZA 5J39A 5IGEA 1A3UA 2PZWA 3MHBA 2F0UA 1STNA 1SNOA 1SYGA 3EJIA 2NUCA 4ZUJA 3SK6A 4TRDA 4EQOA 3T16A 5KYLA 1STBA 4K8IA 3HEJA 3V2TA 3VA5A 3TP6A 4DFAA 3D4DA 4EVOA 4F8MA 4QF4A 5EKKA 5CGKA 2F0QA 2RBMA 3BDLA 3NK9A 1EY5A 4LAAA 1STHA 2SOBA 2F0EA 5JOBA 2EYHA 4S3SA 5I6YA 2RDFA 2PW7A 2EYOA 3NP8A 1EY8A 2F0PA 5IOCA 3U9OA 4OL7A 2OF1A 5IGDA 1EY4A 5C4HA 4DGZA 3NUCA 4EQPA 3MXPA 3MZ5A 4KD4A 3QB3A 5CV8A 3TP8A 5K5PA 2EXZA 1SYBA 4PNYA 3BDCA 3OMGA 4KJNA 4N9TA 5DEHA 5E1FA 3ERQA 3P1HA 2HQEA 3SK5A 1KAAA 2F0VA 4HMJA 4K5VA 2O4XA 3TMEA 3OMCA 2M00A 2EY1A 2F0HA 2EYMA 4QB4A 4IALA 5CV5A 1NSNS 1ENCA 2F0NA 3DMUA 3PMFA 1TT2A 5IGGA 3S9WA 5CV7A 4RKLA 4K8JA 2EYFA 3OWFA 3NHHA 2SNMA 5HGTA 3P75A 1EZ8A 1F2ZA 1SNMA 4ZQ3A 1A2UA 5IGCA 5CC4A 4G57A 1TQOA 5IIFA 4ID6A 1A3VA 4KJOA 4QMGA 1F2MA 3D8GA 1EY9A 2PW5A 5CV9A 4K5WA 5NUCA 1NUCA 5J1ZA 4KD3A 2F0OA 4B9WA 2KQ3A 4PMCA 1EYAA 4KY7A 5KRUA 4I65A 4K2LA 1JOOA 2PZUA 4EQNA 3D4WA 5EKLA 3QOJA 3RUZA 4NMZA 4H7BA 1EY6A 5IGFA 2QDBA 4KHVA 5JAVA 1KDCA 2WACA 3EROA 4IZ8A 4R8NA 1EY0A 4K5XA 2F0WA 4K14A 2F3VA 4K6DA 3LX0A 3R3OA 2EY6A 2F0SA 1SNCA 5C6AA
chains in the Genus database with same CATH superfamily
2A6HD 2CH4W 2E8GA 1ASZA 1FNVA 4X6AH 4HJ8A 2EVBA 2HDLA 3K5OA 1MI2A 1SMYC 2OTLA 4PMBA 3J81E 3VR5A 1HA6A 3KDFA 3H6MA 1Y69U 4MHEA 4A4IA 5ELNA 1TIID 1I6HB 2ICEC 2NVTH 2RQXA 1HNWQ 4NDXA 3EQLC 3I4LA 3TEHB 2E2HH 4A3JH 2JA7B 2AWNA 4POFA 3VA7A 1SE3A 2ID0A 5BN3A 2B2VC 5C3XA 1O80A 3DM1A 4XQJA 5J22A 1I4XA 3H09A 1J8IA 4DV5L 1KLUD 2I5MX 2B2WC 2A74C 3HOYB 5IYDG 1NY4A 2QGQA 4IUNA 1B44D 1VQJA 2CCZA 2JA7G 1KD1C 4DR6Q 4JI0Q 2OT2A 3S14H 4GKJQ 1PMRA 4ZUIA 1QILA 2AHOB 2WAQE 3UDFA 1SDFA 3NELA 2B63B 1PZKD 1X3EA 2CKZB 3N52A 1NBWA 3VA5A 2F4VL 4A3DB 3IRBA 4JV5Q 1RCVD 3A8JE 5IT9L 3HOZB 1EY5A 5LMNL 1NAPA 4DR1Q 3PO2H 5A35A 4HN7A 1PTOB 3S16H 3DXJC 1N32Q 3K8AA 4UHVA 3TP8A 2B63G 2YTVA 1S5BD 5DEHA 3BDCA 4X66Q 4FF1A 2A73B 1TS2A 5M5WB 2KA7A 4A3DG 1WTPA 1PZJD 3HOZG 4IQZA 2EZVA 4QB4A 5JVH3 4H0LC 3J7A5 1UE1A 1PA6A 1VQIA 4DK6C 1QVCA 2IY5B 1TWHB 1X54A 1MIUA 1HNWL 3I55A 1V1OA 3D8GA 1EY9A 3S17H 4K5WA 4KK7A 4IN3A 4FF2A 4DV7Q 2A68D 4YCVA 2IHFA 4B9WA 4JI8Q 2Q2UA 4KHVA 4LW1A 5G3LF 2CFMA 4K5XA 1I50H 4PZ6A 4N8X1 1WCMH 3KDFB 4A3IG 1KQSA 2CW0C 1SFOH 3C1FA 4DR6L 4GZYC 1BF4A 4JI0L 1DZ1A 1J9OA 2AQ3B 4ME5A 3V96A 4GKJL 3SEBA 4C3HH 3TN2A 1GUWA 2KHSA 4BY1H 4DV6Q 1X3FA 1K83H 2F0FA 3I73A 5C4JB 1ZXTA 3HOXB 4JV5L 1QUQA 2EY2A 5C3EH 3K5NA 1VQFA 5JPNC 4MIUA 4DR1L 1K8OA 1TWFB 5FO9B 1N32L 1EIYB 1HFNA 1HZAA 2ZTEA 4DR2Q 4X66L 1ML0D 3WOFA 3KLWA 3HOXG 4ZKCB 3TP7A 3RNUA 1VQOA 3I7FA 3MFGA 5CR3A 5CV4A 2KENA 1F77A 1PZID 3DLLA 2A69C 1BQQT 3TREA 3FRPB 2RSOA 2R92H 4HAEA 4GN5A 1X3QA 3M7NA 3M3YB 4IFDG 3BDOA 2K04A 2RCFA 1RJTA 3BDLA 3E0EA 1U5KA 2WKDA 4JI8L 2WB1E 2MJ8A 1FGBD 3NUCA 4EQPA 4ILWA 1Y1VH 4A3MH 2MNAA 1H9RA 3MXUA 3CCMA 4RA8A 4DAPA 2LSSA 3K5LA 2O4XA 1MHWC 2WIIB 1JC7A 1R9TB 1IL8A 1HR0W 4POGA 1X65A 2PI2E 2RF4A 3I72A 1Q1EA 4DV6L 2HT1A 2BH8A 2L9HA 3G48A 2EXDA 3PV0A 3HGBA 1B7YB 1N8RC 3GDEA 4QMGA 3I3CA 1PVOA 2I5HA 2L0CA 1GHKA 1MSHA 3EN2A 4PMCA 2QKIC 2KCTA 1SR3A 2IHEA 5LL6X 1EY6A 4DR2L 4OIKA 3GTQB 2WACA 5FJ8G 2D2CC 3GTLH 1B1ZA 1STHA 1DD2A 1F2YA 4LUVA 4BA1I 2F0JA 4KN7C 2K4KA 1B4OA 3CMAA 2PPBC 3CXCA 3DEOA 3CPWA 3A5UA 1I3QH 1DOMA 3FPPA 1VQDA 1HUMA 1QUQB 2H1EA 3CD6A 5CYUA 1SJHD 2XNAC 3NE5B 1Y14B 2K50A 1CQVA 4JOIC 3Q0AA 2F0LA 3IL8A 2GVAA 4QIWE 3HOUB 3CPFA 3OW7A 1STYA 1G8ZD 4A3BB 1CT1D 3HOWG 3BVMA 2K5NA 1Q86C 2JA6B 4IOAA 5E3FA 4RGTA 4CKEA 2K05A 2R61A 1XTCD 4HJ7A 1FJGL 1YNNC 1PRTD 4QCLA 3K58A 2D9UA 5K36G 5F2DA 3J80c 3S1RB 3HOUG 2B2TA 2DJGC 2KHJA 2B2UC 4A3BG 2A19A 4F7XA 1BUVT 1Q90A 4C1NK 4WRDA 2JA6G 4IUVA 2F0GA 2SEBD 4GNXA 1QVFA 4JBKA 1Q8IA 4IJHA 1S4ZA 4IFDJ 4M1UB 2I46A 2A8VA 1TWAB 1KRTA 3MHBA 4XXEA 4R8IA 3GTMB 4PMWA 3V2TA 1D2BA 1BCPC 1LTTD 1BKBA 3PO3H 2A1AA 1B53A 4CDDC 3NP8A 3CQZB 5M3MH 2MP1A 5IGDA 2WINB 5C4HA 1DXMA 5CV8A 3C3LA 2L1BA 1ESFA 2Z0SA 3DM3A 3CCQA 1EWHA 3IFTA 1VQGA 1WTOA 2VW9A 1HH2P 4B3RQ 4KLKA 4RHSA 4IUPA 2DY8A 4CJ2C 1OXSC 1VQ5A 1M8AA 2O5IC 1IKLA 1FD7D 4FVMA 2SNMA 4AYBB 3RN5A 2A5HA 4CDEC 1WYDA 2NVYH 4JPBW 3FKIH 4L63B 1JT8A 4JI2Q 1YJWA 5LMUQ 4U68A 5DNFA 2ATWA 1SRUA 3J7AV 1IW7C 5I2YA 2PMZE 3NTIA 5KRUA 4K2LA 3D4WA 4LF9Q 4AYBG 4APVA 3CRLC 5JAVA 2E2JH 1RTOA 3WWVA 3LX0A 4WORA 1QVGA 3I4OA 5KYIA 1SAPA 1O7YA 1TVXA 3L3OC 4TQUS 3OTOQ 1K3BC 1I4QA 3EBEA 3H3VH 3C1EA 3JAMi 2K5VA 5IYBG 3E5SA 1IL2A 2RVLA 2RCNA 4NW2A 3MWYW 2PQAA 1D5ZC 1PDQA 1T5EA 1JWMD 1OXXK 3BVGA 3D4RA 2JA7H 1SNQA 3W1GA 1N36Q 1D1IA 2K32A 1LT4D 2DJFC 1AH9A 2N49A 2R7FA 1RHPA 3ULPA 3SR1A 2Q2TA 3HOYH 3I90A 1T5XD 1K3RA 4GNXB 1Z9FA 5I6WA 4JBJA 1DOLA 1XNRQ 3CCLA 1KDAA 4KMUC 1OO9B 4JVZA 2NB0A 3H3VI 1QB5D 1LO5D 2NUCA 2H4OA 2Z6KA 4JI2L 1I4RA 4LUOA 5LMUL 1EQRA 2Z4IA 1S5CD 4S3SA 3FP9A 5M3FH 4RFBA 2LFNA 4A3FB 5M5WH 2CHBD 1EY4A 4C3IB 3CC2A 1SYBA 4PQXA 4KJNA 4ZYSA 1GKHA 2JA5B 5FLXL 2L5TA 3BU2A 4HMJA 3PSIA 3H3VC 1SE4A 2WAQG 2ZM6Q 3DMUA 1HFGA 4A3FG 3CCUA 1N33Q 2KEEA 4KHPQ 4C3IG 4LFAQ 3PQIA 4F87A 4BBRB 1Q3LA 3U4VA 4IUQA 5IGCA 3TZDA 1NTGA 3KLSA 1N36L 2UUBQ 4A3CG 2R93B 3CU7A 2FINB 2NYZD 4IPDA 4IURA 1OXTA 4BBSB 3HKZE 1VQCA 1ENFA 2Z8LA 2PZUA 2BE5C 4NMZA 4IJLA 3T1YQ 2PI2A 2AUKA 1EY0A 2F0WA 5COYA 1EEFD 1BR9A 3I4NH 1C9OA 3VYSA 4EX5A 3A56A 2R93G 2PQAB 1EZ6A 1Q12A 3AFQA 1Q8KA 1X56A 4BBSG 3VR3A 3RZOB 2CVRA 4O0AA 3OYYA 1VQ8A 1JOKA 1WVLA 2E76C 4MN3A 3NEMA 4KI0A 4ODGA 1E1OA 1GUTA 5C3WA 2L4NA 1Z47A 2VB3X 4LF7Q 1S40A 2N3SA 5C0XH 5AJ3Q 3UE0A 5IE8A 2LMCB 1TKWB 1YBYA 2XWBB 3A54A 2Z9HA 4FDBA 1CSPA 1I6VC 4YCUA 1PRTB 2EJGC 4LK1C 1JWSD 1UE6A 2R7ZB 3R2IA 3W5OA 1VF5C 2RDHA 1X9NA 1PH4A 1ZKOA 4X3TA 2PNHA 4YIJA 3TZUA 4KTAA 1RDPD 3QIAA 3MAQA 1N33L 4KHPL 4LFAL 2CH4A 4EGVA 3C2PA 1GD7A 2EYJA 3S1QH 2K5HA 1C48A 3ULJA 1EIGA 1YHBA 2AUJD 3RMHA 3V05A 2R7ZG 1G51A 1XMQQ 4X62Q 4DFAA 2E5LQ 2UUBL 1XTDA 2I07B 1CZWA 4BA2I 1B2TA 3DWPA 1TWCB 2EYHA 2RDFA 2F0PA 2K5DA 5IT9c 2FFKB 4H13C 1YI2A 2JJQA 3LWUA 4N9TA 1IBMQ 1VQ7A 3IAYA 1R9TH 3P7JA 2X6LA 2CQAA 1S5ED 3I4MB 2WKCA 2WB1B 3X3NA 1JQYD 1QZHA 4DNTB 2EY1A 3RR5A 5E4XA 1ENCA 5IGGA 3G7LA 3S15B 1R4PB 2NN6G 3GTOB 3NHHA 4DAVA 1EOTA 3M4QA 4HJ9A 1GUOA 1KXLA 4LF7L 3U50C 1FVIA 2WB1G 3TRZA 1U4MA 4BXXG 4CDCC 2JA8B 2AMCB 4A3GH 4CDFC 5EBDA 3JAME 5IGFA 2BDOA 1SE2A 1AZQA 2X6GA 4G7HC 3FHWA 1L0WA 1KLGD 1HTPA 2JA8G 2IL8A 2HCCA 2NVQH 4Y52H 1G291 3AYHB 2VXWA 1EYCA 2IX0A 3AEVA 4GOPC 3ULLA 1EL0A 1XMQL 5C5LA 2XRQD 4X62L 2E5LL 1H9JA 2M9VA 1SMYD 2AKWB 5DLQE 2ZTCA 4F88A 1CHPD 3AFPA 4OONA 1U4LA 4PV1C 3S1RH 3MEHA 4QIWB 2ZJQA 1NR4A 3S2DH 1IBML 1HZBA 1QOHA 5DM73 1VQBA 4N9PA 2F0DA 1STGA 4AQYQ 2C5CA 5IP7G 4WJWA 3CCVA 4XDXA 1PH9A 3VYTA 3K7UC 2G9DA 2NWGA 4HTHA 4R4TA 1Y1WG 1K9MC 1TWAH 3E3XA 4EQ5A 1EEID 4OHJA 2VQFQ 3T16A 5T1GA 4DR7L 4G7ZC 3NK9A 1MGSA 1E2VA 1EYGA 5GAGC 1QNKA 3LWEA 3W3AA 3L0OA 4L5QA 1E3PA 1W6JA 2IPKD 4LF4L 3ERQA 5A2QL 3Q22A 3T4AC 4RH6A 1CKOA 1YNXA 1LACA 2IW3A 3KBXA 2QEXA 1KC8C 2VUMB 5CV5A 4ZCKA 1WJJA 3A5ZB 4DK3C 3K81C 1SNMA 2Y0SB 4G4KA 5CC4A 5IIFA 1V43A 3CC7A 5BN4A 1EU4A 4OEMB 4IPHA 2XTIA 3GTPH 3HKSA 2VUMG 4WJ4A 2F0OA 4JI5Q 1YJNA 2E74C 1QJOA 2NBFA 4TRDA 2B3GA 2Y0SG 4AQYL 4IPCA 1V9PA 4P75A 5IY0A 1GHJA 4JK1C 3OSOA 4RKBA 1AZPA 1GVPA 5KNCA 1S5DD 1LTGD 1SYDA 4FP5D 5M5XB 3DHQA 4OWWB 1AN8A 3I70A 5JPMC 5KGUA 3PIP3 2VQFL 4A3IB 5C44H 1ENAA 4OWTB 4ZKBB 2XVSA 3MTSA 1A2TA 2TMPA 2CW0D 3T13A 3J81L 2ZJRA 4DU9A 3CRKC 1XJVA 1B8AA 1W6KA 3OWEB 4JCVE 3UI2A 1QG7A 5FO7B 2ZXRA 2VNUD 2JA9A 3RN2A 3NXWA 2PYKA 3J80i 4DKAC 1PH6A 2L15A 2EJFC 3GQBA 4HR7B 1ICFB 3UDXA 1IHZA 4DAMA 3AB9A 4XQQA 2I0QA 1HRJA 4A93H 3SHLA 2N55A 3S1MH 3S1NB 2F52A 1VQHA 3GTGH 4LUZA 2UXBQ 5TSSA 1S3OA 2B2VA 4MNOA 1D7QA 3HEJA 4BY7H 4OELB 3SVMA 2UU9Q 1ICWA 2RBMA 5JOBA 4A3LH 2A69D 4JI5L 4OL7A 1L2FA 2JA5H 1KHIA 3PUZA 4DGZA 2KECA 4KD4A 3QB3A 3BYYB 3G6JB 1PYSB 5EAYA 2UXCQ 3P1HA 3E9HA 4PG3A 3G4SA 1YZ6A 5FOBB 1SLJA 2VQEQ 1AE2A 3KUPA 4BBRH 3T1HL 1K0RA 1CZGA 2JP1A 2DN8A 2K6AA 3A7LA 3I91A 3OHXC 3OWFA 3SE0A 5M5YH 1VMCA 1GUNA 1IZ6A 2KBNA 4C3JH 4PZ8A 2BA0A 2PW5A 1L1OC 1UEBA 2NVXH 4JI6Q 4TKOB 1XWEA 1FJGQ 1YNJC 3TSSA 4I65A 4DV2Q 1JOOA 4DK0A 1A6XA 1LT3D 4GNXC 1JCKB 3EIVA 4RWSC 1YHQA 4KKSA 4RHRA 3R3OA 4Y7NB 3A8IE 2F0IA 3FDTA 4A3EH 1PFNA 3M7GA 4QUFA 5FKAC 3RZDH 1JB7A 3I8ZA 5C4XB 2EYLA 5FK9C 1BNZA 1TY2A 3F2DA 1DM0B 3K7AH 2YU9B 2UXBL 1U4PA 1HUNA 1HQMC 1E0BA 1S5FD 4RCOA 3BG3A 2F03A 1FNWA 2C35B 4HIKA 3HKZG 2UU9L 5ELOA 4J6HA 2F0KA 1WTQA 2OTJA 3NWTA 5C4XG 3PUVA 3HS0C 5EQ0A 1LTRD 3KLSX 1H9MA 3I2ZA 1BVSA 1CQFA 1HA5A 4QQBX 3HOWB 3CCEA 1JMCA 2UXCL 1P16A 3GTKH 1SJED 1J5EQ 4HMIA 1GJXA 2FHTA 2VQEL 4ZAIA 1P8LA 3KYHC 1CK1A 1YNND 5ELBA 3CKIB 1SXTA 3CCJA 4ME3A 1XX8A 2F3WA 5IGEA 5IYCG 3HOVG 1SNOA 3P20A 2MGSA 1PH3A 1SE8A 3NENA 4OO1G 1TWCH 5KNBA 3STBC 3K0XA 1FGUA 4JI6L 2D62A 1UWVA 2DNCA 2IWHA 5EJWA 1JE5A 3F8TA 5EKKA 4A3KH 1WD1A 2UUAQ 1VQKA 3H0GH 1I94Q 3J7ZC 2YYZA 3OW2A 1VS0A 2PW7A 1CSQA 2EYOA 4DV2L 1V1QA 2QA4A 3GV3A 5BN5A 1MBYA 1BCPD 2H5XA 3I4MH 3ZJYC 2ALYB 4JBWA 3SK5A 4IUTA 3NWSA 3BZDB 1IBLQ 2K75A 4DN4M 3I56A 5FLXc 1WTXA 1VDZA 1B3QA 1JE4A 5CV7A 1YJ9A 2E2IB 1NMGA 1F9QA 4ZQ3A 4DNIA 2OQ0A 2ZJPA 1NR2A 1RD9D 1BXTA 2KJXA 1F2MA 3FVQA 4RGMA 2GVBA 5J1ZA 2OCEA 2I5LX 5JEAG 2Q8RE 3ZYYX 4FXDA 2NVTB 1VCIA 2EIFA 3PIOA 4LF5Q 2PCFB 4IZ8A 4R8NA 2NN6I 1J5EL 1T9HA 1SNCA 3NBHA 4NP5A 3J7YW 1IW7D 2E2HB 4R4IA 4A3JB 4DR3Q 3EA6A 5ELFA 1A3TA 4WFN3 2UXDQ 3HG9A 4DV0Q 1QWYA 1EYDA 2EE1A 3W1BA 3CCRA 3VYUA 3J80E 1OTCA 4AH6A 2LKVA 4A3JG 1A8VA 1WI5A 2UUAL 2MFIA 1I94L 3S14B 4Q5VA 5HGQA 5LMNW 1G2SA 4R9WA 1HJPA 1LTSD 3KOJA 3VR4A 1I6HH 4LWCA 5AFWA 1LTLA 2GN5A 1UNSA 1Y8PB 1AEXA 4UP8A 4HCSA 4X65L 1TU2B 1IBLL 4O42A 3TDQA 1GM5A 1U9RA 2Q2HA 2PNRC 4J8QA 5IYDH 1PLFA 4J1MA 3B6YA 3PCOB 1OXUA 5C4ZA 4CHTB 5KYLA 2DY7A 3TP6A 3PO2G 4FF4A 2K52A 1TS4A 3GTJB 2B2UA 2D0PA 1SBBB 1VQEA 4RG1A 4I7ZC 1V1PA 3MZ5A 3U4ZA 4LF5L 1SEBD 4B3TQ 5JJLA 3OMGA 3CF5A 2G9HD 2B63H 2HQEA 1QCBD 3NPPA 4DR3L 2JEAI 3UDGA 4A3DH 2M00A 2UXDL 3HOZH 1NSNS 5FLMG 4DV0L 1JJ2A 4JI3Q 1FNUA 1I4HA 1I50B 3MA2B 5GADC 4LF6Q 1WCMB 1PTOH 1YVCA 1BCPF 2KCMA 3KF8A 1KTKA 2WAQB 1DGSA 3E0JA 2RHSB 3LNNA 5JEAJ 3KJPA 2LY7A 3URYA 4TSSA 4DR4Q 3L2PA 4JYAQ 4C3HB 1HXYD 4JI7Q 4BY1B 3NBHB 1J6QA 4EQNA 4LFBQ 5EKLA 3RUZA 2E2DC 2YTYA 2JSOA 1E7ZA 2K28A 1WCMG 3EROA 4K6DA 2MHVA 5C3EB 1I4GA 2F4IA 1ILPA 1TWHH 2KVMA 5EPJA 4N8FA 3UE1A 1KNAA 4C1NI 4A3IH 4C3HG 2B2YC 2BE5D 3QO2A 3A55A 3DUZA 3K6OA 4BY1G 1M1KC 2QW7A 1NMFA 4KY6A 5GAHC 2ENBA 3Q8DA 4CJ1B 5C3EG 3M4OB 2XN9C 4CBVA 2HIXA 4JBMA 2OWOA 2L11A 1IYUA 3R2TA 3QOLA 3S24A 1KABA 3M4PA 1E22A 5IODA 2R92B 4B3TL 3NSWA 1PXUA 4DV3Q 4NKLA 3G71A 1E2WA 4AIMA 3S1NH 4HJ5A 1FR3A 5C4JH 4KV6A 3HOXH 5E7NA 1HR0Q 4NXNQ 4JI3L 1TWFH 2R92G 1EQTA 4YHHQ 2MQHA 1Y1VB 5ISRA 4LF6L 1LABA 3RLNA 1UE5A 2RKSA 1X55A 1YEZA 1ET6A 1PTOC 3CW2C 3EJIA 3ER0A 2QCPX 4X3KA 2K01A 1O7LA 1V1PB 3MC0B 4DR4L 4JYAL 4IFDH 1X3PA 1F2LA 4JI7L 5EPKA 5IOCA 4LFBL 2QILA 5CMDA 1EFWA 1Y1VG 4A3MG 4YWMA 3CC4A 1FYCA 1K28A 1BCPB 4DUZQ 3RD4A 1F9SA 4ZK9B 2UUCQ 3M3YH 4YWLA 1E2ZA 2MUYA 5JVG3 2ASBA 1LT6D 4X3UA 2F0NA 3KF8B 4OWXB 5IP9G 1NCVA 1RL2A 1VMPA 1W3SA 2HQLA 4HIDA 3GTLB 1LM0A 1EZ8A 3CHBD 1Q81C 1EOVA 4KN4C 5GAEC 4ID6A 2DUDA 2L12A 3HFZB 1I3QB 2K14A 2IX1A 3AU7A 3QG1A 2VZAA 4H7BA 2YV5A 1CM9A 4IFDI 5GROA 3ND9A 4DV3L 2HCIA 1WTVA 4K14A 3R93A 4RCNA 5H1SE 5FJ8H 3ONAB 1HR0L 5ELEA 1K8GA 4NXNL 4XQNA 4NXMQ 1KDBA 2J0TD 1TY0A 4YHHL 2E75C 1SNPA 4FXGC 2PQEA 3KBGA 4DR7Q 1SSOA 5CBEE 1Q46A 2N8NA 3VDYA 5IGBA 2EY5A 1HZ9A 3GTQH 1PV4A 4YCWA 4K2KA 3J81c 1LLRD 4DUYQ 2R3ZA 3HOWH 1UEAB 1BBXC 1Y8NB 5ELCA 2EDGA 4LF4Q 2KUMA 2XRSD 1PFBA 2K03A 4DPGA 4DUZL 2EOTA 1O78A 4QGUA 2A6EC 2NZ1D 1IYVA 2VY3A 2UUCL 2BH2A 1PH5A 5K36H 3PO3B 2ZXOA 5M3MB 3BS1A 3HOUH 4A3BH 1SYFA 2RSNA 1GXDC 2JQOA 1MKHA 4K0KQ 2N88A 3D6CA 2K5QA 2JA6H 3D6WA 5IT9E 4ULLA 4RMFA 3NTHA 5J39A 3QWNA 1G2TA 3SK6A 2V4DA 1Y1WB 4P71A 1PH1A 1PTOF 1Q82C 4EVOA 3PO3G 1XMOQ 1ILQA 2FMMA 5CGKA 5M3MG 2N78A 3BJUA 2LS01 5J3BA 3H91A 1EY8A 3G6EA 3S2HB 1CA6A 3FKIB 2XWJB 4XTCS 1RODA 2BA1A 1JJGA 3EFXD 2EPBA 3GD7A 3GTMH 4OO1I 1ZYRC 3TBIB 4CJ0B 3OMCA 4NXML 2F0HA 2EYMA 3SGIA 3IKJA 1QE6A 4A75A 2E2JB 3FKIG 3CQZH 4YWKA 5I4DA 3P75A 1G6ZA 4DXFA 1ASYA 4RGNA 2XIWA 3HRZC 4X3SA 2KCCA 5NUCA 2Q8IB 1BO0A 4DUYL 4DR5L 4KD3A 2A6HC 4MTKA 1H95A 2KQ3A 3E9IA 1LUZA 2RHQB 1FL0A 1K73C 4XT1B 1NJIC 2F3VA 4V0BA 3ICEA 1CUKA 3JAML 4GLAC 2KEDA 2BOSA 5I9PA 4K0KL 2B29A 3F2UA 5D14A 1EQVA 5IYBH 1H9SA 2K5WA 3MVVA 2V1CC 2HIVA 2LXJA 4CKBA 1XMOL 3K59A 4IPGA 3FMCA 5L37A 1XNQL 4I7AA 5D3DA 3TP5A 1NNXA 3NBIA 1DYQA 5CORA 2ICIA 3R8BA 4JI1L 1ONLA 3HOYG 1B50A 2PMZB 3TS2A 5EGTA 1SYCA 1MD2D 4GOPA 2WFWA 4M8AA 4GS3A 1SNDA 3T1HQ 2KHIA 5M3FB 4IOCA 1U0LA 1JB3A 4R1JA 2DNEA 1F9PA 2JE6I 4BS9A 5KIXA 1A0IA 2PZWA 4EQOA 3F2BA 4FYDA 3GTJH 1MSGA 1TXYA 1WTHA 5FLMH 4LJZC 5M3FG 3Q6SA 3K80C 3DWAA 2K33A 2PO4A 1M90C 4CKCA 4R4OA 3BZCA 1DJRD 2JXMB 1KRSA 3H15A 1BOSA 4L5TA 2K1BA 2XSCA 3PUWA 1MJEA 1DCZA 2MPMA 3ND8A 2BDNA 4LMQD 1X32A 1IKMA 1TT2A 4C2MB 2A68C 4ALPA 3I4NB 1QNUA 4A3FH 1F2ZA 2JK8A 4H02A 1JJCB 1PYWD 4C3IH 1V8QA 1F9RA 3Q23A 2B2WA 1WFQA 3U58A 4B3MQ 4A3CH 4CGYB 4UP9A 1XPOA 2B39A 1PFMA 1GUSA 4ABNA 3I4NG 4Q0FA 3A7AB 1WTWA 2EY6A 3KJOA 1YNJD 3HZXA 1C0AA 1D5MC 1PH8A 2LXKA 2O2LD 1H9SB 3KFUA 3KK7A 2R93H 1D1KA 3PUXA 4L8JA 2IJ0A 1CHQD 2XGTA 3M4OH 1KNEA 2PZTA 1EU3A 4BBSH 1HNZQ 3C46A 4FF3A 1X3GA 2DGYA 2B2TC 1WD0A 4HEDA 5C0XG 4MZ9A 3D3RA 4TVAB 3K57A 4LF8Q 3GV6A 1EY7A 4OXPA 4GOPB 2M2LA 1XYIA 4GN4B 2F0MA 3S1QB 3RLOA 1HZCA 3D0FA 4JW0A 4YY3Q 3L9AX 4E6IA 4XIGS 4DV7L 1Q7YC 3RZOH 3HKZB 3CCSA 4HCEA 4GN3B 1EQQA 4HIOA 3GP7A 3NQIA 5T1IA 3SXHA 3PIPA 4JG2A 4QUCA 1K0SA 3W2DA 3DWQA 3M9BA 3F2CA 2OQKA 2IT1A 3PIO3 2CWAA 1EWIA 1SYGA 4B3SQ 4RGOS 4B3ML 2R7ZH 3VR2A 2QDLA 2F0QA 4LAAA 1R4QB 3U9SA 5IP9H 2SOBA 2F0EA 2NTSA 1HTLD 3OIQA 3HOVB 2ES2A 4GLXA 1OXVA 3Q24A 1GOZA 3STBD 4L5RC 2EXZA 4O1NA 4UDUC 3T53B 2EJMA 2P5ZX 1TWGB 3X3MA 4HIMA 4K5VA 3TMEA 4A3GB 2X69A 1LTAD 2ZT9C 1JWUD 3CMEA 3IFDA 1G6PA 5D3IB 1HNZL 3SDZA 4K8JA 5JJZA 1Z6HA 4P2CB 2KCNA 2CQOA 4K6LA 1A2UA 1KAWA 2BCOA 4G57A 2NN6H 3J81j 1PHJA 2FJ2A 4LF8L 1NUCA 4A3GG 2NVQB 3E6ZX 4FNFA 4BXXH 4YY3L 4KHZA 1JICA 2QDBA 3S15H 2WV6D 4X65Q 3GTOH 4P72A 1I4PA 1L0YB 1AE3A 3NQTA 1II3A 1A15A 1JR0D 1VQLA 5I2XA 1B70B 2CWPA 1L1OA 4DXGA 1UE7A 3S2DB 2JA8H 4B9XA 4FO2A 1X6OA 3OOCA 5C0XJ 1CFMA 3SK4A 4B3SL 4BWGB 2F1MA 1SROA 1C4QA 1PRTC 1S72A 5HURA 2RDGA 4UAIA 1CKNA 2R7DA 4KKUA 5GQOA 2AQ2B 3ITPA 2Z6KC 1O7IA 4L6TB 4FXKC 4XYOA 1D6EC 1EIFA 4HSPA 1JOQA 2SNSA 4X64Q 1RIPA 3GO5A 4O2DA 1VQNA 1AW7A 2NTTA 1VQ4A 5IP7H 3OPOA 4UP7A 1EWCA 1Y1WH 2Y0SE 2B8FA 1PYBA 2OXPA 1CA5A 1VQ6A 1ET9A 2F0UA 4NPSA 1LYLA 3D4DA 3QJYA 3BYTB 1RTNA 4QF4A 2D5DA 4P74A 4QL5A 3S2HH 4HSVA 5I6YA 5LHY1 3K0YA 4ZRZA 2JEBI 2MO0A 5FLXE 2NZHA 4DAYA 1N34Q 4JOIA 5K5PA 4OGQC 1NE3A 3PO2B 2ZTDA 1CTMA 1VQMA 1Z7TA 3S16B 3F1ZA 1KAAA 2HHHQ 2O5JC 1WOCA 3K5MA 1WTRA 1CI3M 2K7VA 4R4CA 1K8AC 4OIJA 1IXRA 2VS1A 1K8MA 4QJFA 4RKLA 1C7YA 4R4QA 1A63A 1A62A 1IYJB 1A3VA 3CAMA 1XPUA 1L0XB 1M4VA 5LL6S 1EUJA 2HUGA 4GKKQ 5EPLA 2AQ1B 3S17B 3PGZA 5C44B 2VUMH 1O7ZA 1LTBD 4UPAA 3MEFA 2TSSA 3MFYA 4OX9Q 1L1OB 4X64L 2KOLA 5I9OA 1RKNA 3ERSX 1G91A 3OIPA 3A8KE 5C44G 3H94A 1SFOB 4B3RL 2OEOA 1B9MA 3MXNA 4DV1Q 1PFSA 2HD3A 2F3IA 4PZ7A 5DAUA 1CKNB 4A93B 3J81i 1K83B 4NB3A 1Q1BA 2MO1A 3S1MB 3AMUA 1PRTF 4DV4Q 4DA2A 3GTGB 3J80L 2ZXPA 1N34L 5M5XH 1YIJA 3LGJA 3PF5A 1I5FA 2QF7A 2Z4HA 4BY7B 4DNRB 1HHVA 4U673 2QEJC 2HHHL 4LF9L 4A93G 1LT5D 4J15A 5M9OA 3SK8A 1U4RA 2G5DA 2VL6A 4V190 1UUPA 5KEEA 3A74A 3OTOL 3FPUB 3FEWX 3KLRA 3RLFA 1EIHA 2GA4B 2J7ZA 1A3UA 4BY7G 4ZUJA 1PH7A 1STBA 4K8IA 1N9WA 4C56C 1TS3A 2FXQA 4DAYB 1YHAA 3TS0A 4A3LG 1D8LA 4GKKL 2JA5G 4P73A 5DM63 5M5YB 1B9NA 1LTID 1PTOD 2OF1A 1IBKQ 3MXPA 4ZLTF 2SDFA 4G7OC 4OX9L 4C3JB 1W2BA 1YITA 2NVXB 5ELDA 4A76A 1XXGA 4C2MH 4XT3B 5E4WC 4BBRG 4A3MB 3DEPA 3AQQA 3PMFA 1HNXQ 3S9WA 4B08A 4RAUC 4DV1L 4GLVB 1XNRL 4QY7A 4C3JG 5IWAQ 5CBAE 4A3EB 1TQOA 4KJOA 4MTNA 3RZDB 4DV4L 1QZGA 3CP0A 4LFCQ 3D31A 3T51B 3KF6A 3K7AB 1EYAA 4KY7A 2R6GA 3PUYA 1BDOA 5JJIA 2JN4A 3NTKA 1VQ9A 4A3EG 2EQSA 3N6RA 2F0SA 1TS5A 1UAPA 4IO9A 1H9KA 1EFID 3MXNB 1RF2D 3EVQA 2JYOA 1VF7A 1JORA 2Q2IA 5EKIA 5JJKA 3JAMc 2L55A 5CV6A 3GTKB 2ZM6L 1ESRA 3QR8A 3TQYA 1MJCA 3A0JA 1TR5A 1AFPA 4UY8C 4KY5A 4Y7NH 5BR8Q 3WOEA 4KKTA 3BZKA 1AP0A 1ZEQX 5C5MA 1IBKL 1SYEA 2B2YA 2NZOA 5C4XH 2WP8J 2AWOA 4JI4Q 2YU9H 3BVZA 3M85A 1GUGA 5KNDA 3GTPB 1LV9A 4DF7A 4A3KB 3T1YL 3H0GB 5C0XI 4L5SA 1BBWA 2RA4A 1E24A 1HNXL 2F0TA 5FO8B 1C8CA 2D0OA 2EYPA 2Z1CA 2A6ED 1STAA 1VQAA 1E1TA 5IWAL 5HGTA 1HCZA 1STNA 5HY6A 3PF4A 3WDNA 4WJ3M 3UDIA 4DR5Q 4HJAA 3VYRA 3MXGA 4A3KG 5IYCH 3HOVH 3H0GG 2YTXA 4F8MA 1DOKA 4XYQA 4OO1H 1SMXA 4LFCL 1CKMA 2J4XA 2FMCA 3O13A 3U9OA 4Z9CB 1TWGH 5A2QE 1GO3E 5AJ3L 3I4MG 4IUUA 5D65A 1HPCA 1Y8OB 4PNYA 2Q8TA 5E1FA 2HDMA 1BBUA 4H44C 5EBCA 4AYBE 2F0VA 2VB2X 3VR6A 4DK1A 3L7ZC 4DV5Q 4IALA 1VQPA 2B8GA 1KL9A 1B3AA 4JC0A 2EYFA 5G3LD 3HP3A 1KIXA 1XNQQ 1ZYRD 3JC66 3KF6B 4LNQA 5BR8L 3M4YA 5CV9A 2F4VQ 1PH2A 2NVYB 4JI1Q 1XPRA 2C9OA 5LMNQ 1D5XC 1HQRD 2IX3A 3QOJA 5JEAH 1STEA 4JI4L 1KDCA 2Z6BA 2E2IH 1DONA 1SN8A 3J7AF 3T56B 5C6AA
chains in the Genus database with same CATH topology
2A6HD 1FNVA 2EVBA 2HDLA 3K5OA 1MI2A 1SMYC 4PMBA 3J81E 3VR5A 1HA6A 3H6MA 1Y69U 4MHEA 1TIID 1I6HB 2ICEC 2RQXA 4NDXA 3EQLC 3I4LA 2JA7B 2AWNA 3VA7A 1SE3A 2ID0A 5BN3A 2B2VC 5C3XA 1O80A 3DM1A 4XQJA 5J22A 1I4XA 3H09A 1J8IA 1KLUD 2B2WC 2A74C 3HOYB 4IUNA 1B44D 2OT2A 1PMRA 4ZUIA 1QILA 1SDFA 2B63B 1PZKD 3N52A 3VA5A 4A3DB 1RCVD 3A8JE 5IT9L 3HOZB 1EY5A 1NAPA 5A35A 4HN7A 1PTOB 3DXJC 3TP8A 5DEHA 1S5BD 3BDCA 4FF1A 2A73B 1TS2A 5M5WB 2KA7A 1WTPA 1PZJD 4IQZA 2EZVA 4QB4A 5JVH3 4H0LC 1TWHB 1V1OA 3D8GA 1EY9A 4K5WA 4KK7A 4IN3A 4FF2A 2A68D 4B9WA 4KHVA 5G3LF 4K5XA 2CW0C 3C1FA 4GZYC 1BF4A 1DZ1A 1J9OA 2AQ3B 4ME5A 3V96A 3SEBA 3TN2A 1GUWA 2KHSA 2F0FA 3I73A 5C4JB 1ZXTA 3HOXB 2EY2A 3K5NA 5JPNC 4MIUA 1K8OA 1TWFB 5FO9B 1HFNA 1ML0D 3WOFA 4ZKCB 3TP7A 3MFGA 5CR3A 5CV4A 1F77A 1PZID 2A69C 1BQQT 3FRPB 2RSOA 4HAEA 1X3QA 3M7NA 3M3YB 4IFDG 3BDOA 2K04A 1RJTA 3BDLA 2WKDA 2MJ8A 1FGBD 3NUCA 4EQPA 4ILWA 1H9RA 3MXUA 4RA8A 4DAPA 3K5LA 2O4XA 2WIIB 1JC7A 1R9TB 1IL8A 3I72A 1Q1EA 2L9HA 3PV0A 3HGBA 4QMGA 3I3CA 2L0CA 1GHKA 1MSHA 4PMCA 2QKIC 5LL6X 1EY6A 4OIKA 3GTQB 2WACA 2D2CC 1STHA 1B1ZA 1DD2A 1F2YA 4BA1I 2F0JA 4KN7C 1B4OA 2PPBC 3DEOA 1DOMA 3FPPA 1HUMA 2H1EA 5CYUA 1SJHD 2XNAC 3NE5B 1CQVA 3Q0AA 2F0LA 3IL8A 3HOUB 3OW7A 1STYA 1G8ZD 4A3BB 1CT1D 3BVMA 2JA6B 5E3FA 4RGTA 4CKEA 2K05A 2R61A 1XTCD 1YNNC 1PRTD 4QCLA 3K58A 2D9UA 5K36G 5F2DA 3S1RB 2B2TA 2B2UC 4F7XA 1BUVT 1Q90A 4C1NK 4WRDA 4IUVA 2F0GA 2SEBD 1Q8IA 1S4ZA 4IFDJ 4M1UB 2I46A 1TWAB 4R8IA 3MHBA 4XXEA 3GTMB 4PMWA 3V2TA 1D2BA 1BCPC 1LTTD 1B53A 3NP8A 3CQZB 2MP1A 5IGDA 2WINB 5C4HA 1DXMA 5CV8A 3C3LA 2L1BA 1ESFA 1EWHA 3IFTA 1WTOA 4RHSA 4IUPA 2DY8A 4CJ2C 1OXSC 1M8AA 2O5IC 1IKLA 1FD7D 4FVMA 2SNMA 4AYBB 2A5HA 4L63B 4U68A 5DNFA 3J7AV 1IW7C 5I2YA 3NTIA 5KRUA 4K2LA 3D4WA 3CRLC 5JAVA 1RTOA 3LX0A 4WORA 5KYIA 1SAPA 1O7YA 1TVXA 3L3OC 4TQUS 1I4QA 3C1EA 3E5SA 2RVLA 4NW2A 3MWYW 1D5ZC 1PDQA 1T5EA 1JWMD 1OXXK 3BVGA 3D4RA 1SNQA 1D1IA 2K32A 1LT4D 1RHPA 3SR1A 3I90A 1T5XD 5I6WA 1DOLA 1KDAA 4KMUC 1OO9B 2NB0A 1QB5D 1LO5D 2NUCA 2H4OA 1I4RA 2Z4IA 1S5CD 4S3SA 4RFBA 2LFNA 4A3FB 2CHBD 1EY4A 4C3IB 1SYBA 4PQXA 4KJNA 4ZYSA 2JA5B 5FLXL 2L5TA 4HMJA 3H3VC 1SE4A 3DMUA 1HFGA 2KEEA 4C3IG 4F87A 4BBRB 1Q3LA 4IUQA 5IGCA 3TZDA 3KLSA 2R93B 3CU7A 2FINB 2NYZD 4IURA 1OXTA 4BBSB 1ENFA 2Z8LA 2PZUA 2BE5C 4NMZA 2AUKA 1EY0A 2F0WA 5COYA 1EEFD 1BR9A 3VYSA 3A56A 1EZ6A 1Q12A 3VR3A 3RZOB 2CVRA 1JOKA 1WVLA 2E76C 4MN3A 4KI0A 4ODGA 1GUTA 5C3WA 2L4NA 1Z47A 2VB3X 5C0XH 2LMCB 1TKWB 2XWBB 3A54A 1I6VC 1PRTB 2EJGC 4LK1C 1JWSD 2R7ZB 3R2IA 1VF5C 2RDHA 1ZKOA 4X3TA 4YIJA 3TZUA 4KTAA 1RDPD 3QIAA 3MAQA 4EGVA 3C2PA 2EYJA 1C48A 1EIGA 3V05A 2AUJD 3RMHA 4DFAA 2I07B 1CZWA 4BA2I 1B2TA 3DWPA 1TWCB 2EYHA 2RDFA 2F0PA 2K5DA 2FFKB 4H13C 3LWUA 4N9TA 3IAYA 3P7JA 2X6LA 2CQAA 1S5ED 3I4MB 2WKCA 2WB1B 3X3NA 1JQYD 4DNTB 2EY1A 5E4XA 1ENCA 5IGGA 3G7LA 3S15B 1R4PB 2NN6G 3GTOB 3NHHA 4DAVA 1EOTA 1GUOA 1U4MA 2JA8B 5EBDA 3JAME 5IGFA 2BDOA 1SE2A 1AZQA 2X6GA 4G7HC 1KLGD 1HTPA 2IL8A 2HCCA 1G291 2VXWA 1EYCA 2IX0A 1EL0A 5C5LA 2XRQD 1H9JA 2M9VA 1SMYD 4F88A 1CHPD 1U4LA 4PV1C 3MEHA 4QIWB 1NR4A 1QOHA 5DM73 4N9PA 2F0DA 1STGA 2C5CA 4WJWA 4XDXA 3VYTA 2G9DA 2NWGA 4HTHA 1EEID 4OHJA 3T16A 5T1GA 4G7ZC 3NK9A 1MGSA 1E2VA 1QNKA 3LWEA 3W3AA 1W6JA 2IPKD 3ERQA 5A2QL 3Q22A 3T4AC 4RH6A 1LACA 2IW3A 3KBXA 2VUMB 5CV5A 1SNMA 2Y0SB 4G4KA 5CC4A 5IIFA 1V43A 5BN4A 1EU4A 2F0OA 2E74C 1QJOA 2NBFA 4TRDA 1GHJA 4JK1C 3OSOA 4RKBA 1AZPA 5KNCA 1S5DD 1LTGD 1SYDA 4FP5D 5M5XB 3DHQA 1AN8A 3I70A 5JPMC 5KGUA 3PIP3 4A3IB 1ENAA 4ZKBB 2XVSA 3MTSA 1A2TA 2TMPA 2CW0D 3T13A 3J81L 4DU9A 3CRKC 1W6KA 3OWEB 3UI2A 1QG7A 5FO7B 2ZXRA 2VNUD 3NXWA 2PYKA 2EJFC 3GQBA 4HR7B 1IHZA 3AB9A 4XQQA 1HRJA 3SHLA 2N55A 3S1NB 5TSSA 2B2VA 3HEJA 3SVMA 1ICWA 2RBMA 5JOBA 2A69D 4OL7A 3PUZA 4DGZA 2KECA 4KD4A 3QB3A 3BYYB 3G6JB 3P1HA 5FOBB 3KUPA 1CZGA 2JP1A 2DN8A 2K6AA 3A7LA 3I91A 3OHXC 3OWFA 3SE0A 1VMCA 1GUNA 2BA0A 2PW5A 4TKOB 1XWEA 1YNJC 3TSSA 4I65A 1A6XA 1JOOA 4DK0A 1LT3D 1JCKB 4RWSC 4KKSA 4RHRA 3R3OA 4Y7NB 3A8IE 2F0IA 3FDTA 1PFNA 3M7GA 4QUFA 5FKAC 3I8ZA 5C4XB 2EYLA 5FK9C 1BNZA 1TY2A 1DM0B 2YU9B 1U4PA 1HUNA 1HQMC 1E0BA 1S5FD 4RCOA 3BG3A 2F03A 1FNWA 4J6HA 2F0KA 1WTQA 3NWTA 3PUVA 3HS0C 5EQ0A 1LTRD 3KLSX 1H9MA 1CQFA 1HA5A 3HOWB 1SJED 4HMIA 1GJXA 2FHTA 4ZAIA 1CK1A 1YNND 5ELBA 3CKIB 1SXTA 1XX8A 2F3WA 5IGEA 1SNOA 3P20A 2MGSA 4OO1G 5KNBA 2D62A 2DNCA 2IWHA 5EJWA 5EKKA 1WD1A 2YYZA 2PW7A 2EYOA 3GV3A 5BN5A 1MBYA 1BCPD 4JBWA 3SK5A 4IUTA 3NWSA 3BZDB 4DN4M 1WTXA 1VDZA 1JE4A 5CV7A 2E2IB 4ZQ3A 1F9QA 1NR2A 1RD9D 1BXTA 2KJXA 1F2MA 3FVQA 4RGMA 5J1ZA 5JEAG 2Q8RE 3ZYYX 4FXDA 2NVTB 1VCIA 2PCFB 4IZ8A 4R8NA 2NN6I 1SNCA 3NBHA 4NP5A 3J7YW 1IW7D 2E2HB 4A3JB 3EA6A 5ELFA 1A3TA 4WFN3 3HG9A 1QWYA 1EYDA 2EE1A 3VYUA 3J80E 2LKVA 3S14B 4Q5VA 1G2SA 4R9WA 1LTSD 3VR4A 5AFWA 1UNSA 1Y8PB 1AEXA 4HCSA 1TU2B 4O42A 3TDQA 1U9RA 2PNRC 4J8QA 1PLFA 4J1MA 5C4ZA 1OXUA 4CHTB 5KYLA 2DY7A 3TP6A 4FF4A 1TS4A 3GTJB 2B2UA 1SBBB 4I7ZC 1V1PA 3MZ5A 1SEBD 3OMGA 2G9HD 2HQEA 1QCBD 3NPPA 2JEAI 2M00A 1NSNS 1FNUA 1I4HA 1I50B 3MA2B 1WCMB 1PTOH 1BCPF 3KF8A 1KTKA 2WAQB 3E0JA 3LNNA 5JEAJ 2LY7A 3URYA 4TSSA 4C3HB 1HXYD 4BY1B 4EQNA 5EKLA 3RUZA 2E2DC 2JSOA 2K28A 3EROA 4K6DA 2MHVA 5C3EB 1I4GA 2F4IA 1ILPA 2KVMA 5EPJA 1KNAA 4C1NI 4C3HG 2B2YC 2BE5D 3QO2A 3A55A 3DUZA 3K6OA 4KY6A 2ENBA 4CJ1B 3M4OB 2XN9C 4CBVA 2L11A 1IYUA 3R2TA 3QOLA 1KABA 5IODA 2R92B 3NSWA 1PXUA 4NKLA 1E2WA 1FR3A 4KV6A 1EQTA 1Y1VB 5ISRA 1LABA 2RKSA 1ET6A 1PTOC 3EJIA 2QCPX 4X3KA 2K01A 1O7LA 1V1PB 3MC0B 4IFDH 1X3PA 1F2LA 5EPKA 5IOCA 2QILA 5CMDA 1FYCA 1BCPB 3RD4A 1F9SA 4ZK9B 1E2ZA 2MUYA 5JVG3 1LT6D 4X3UA 2F0NA 1NCVA 1VMPA 3GTLB 3CHBD 1EZ8A 4KN4C 4ID6A 2L12A 1I3QB 2IX1A 3AU7A 3QG1A 4H7BA 1CM9A 4IFDI 3ND9A 2HCIA 1WTVA 4K14A 3R93A 4RCNA 3ONAB 5ELEA 4XQNA 1KDBA 2J0TD 1TY0A 2E75C 1SNPA 4FXGC 2PQEA 3KBGA 1SSOA 5CBEE 5IGBA 2EY5A 4K2KA 1LLRD 2R3ZA 1UEAB 1BBXC 1Y8NB 5ELCA 2EDGA 2KUMA 2XRSD 1PFBA 2K03A 2EOTA 1O78A 2A6EC 2NZ1D 1IYVA 5K36H 3PO3B 2ZXOA 5M3MB 3BS1A 1SYFA 2RSNA 1GXDC 2N88A 3D6CA 2K5QA 3D6WA 5IT9E 4ULLA 5J39A 3NTHA 3QWNA 1G2TA 3SK6A 2V4DA 1Y1WB 1PTOF 4EVOA 1ILQA 2FMMA 5CGKA 2LS01 3H91A 1EY8A 3S2HB 1CA6A 3FKIB 2XWJB 4XTCS 1RODA 2BA1A 3EFXD 2EPBA 3GD7A 4OO1I 1ZYRC 3TBIB 4CJ0B 3OMCA 2F0HA 2EYMA 3IKJA 1QE6A 2E2JB 5I4DA 3P75A 1G6ZA 4DXFA 4RGNA 2XIWA 3HRZC 4X3SA 2KCCA 5NUCA 2Q8IB 1BO0A 4KD3A 2A6HC 2KQ3A 4XT1B 2F3VA 4V0BA 3JAML 2KEDA 2BOSA 5I9PA 3F2UA 5D14A 1EQVA 1H9SA 2K5WA 3MVVA 4CKBA 3K59A 3FMCA 5D3DA 3TP5A 3NBIA 1DYQA 5CORA 2ICIA 3R8BA 1ONLA 1B50A 2PMZB 5EGTA 1SYCA 1MD2D 4M8AA 1SNDA 5M3FB 1JB3A 2DNEA 1F9PA 2JE6I 4BS9A 5KIXA 2PZWA 4EQOA 4FYDA 1MSGA 4LJZC 3Q6SA 3DWAA 2K33A 2PO4A 4CKCA 1DJRD 2JXMB 1BOSA 2K1BA 2XSCA 3PUWA 1DCZA 2MPMA 3ND8A 2BDNA 4LMQD 1X32A 1IKMA 1TT2A 4C2MB 2A68C 3I4NB 1QNUA 1F2ZA 1PYWD 1V8QA 1F9RA 3Q23A 2B2WA 4CGYB 2B39A 1PFMA 1GUSA 4ABNA 4Q0FA 3A7AB 1WTWA 2EY6A 1YNJD 3HZXA 1D5MC 2O2LD 1H9SB 3KK7A 1D1KA 3PUXA 4L8JA 2IJ0A 1CHQD 1KNEA 2PZTA 1EU3A 3C46A 4FF3A 2B2TC 1WD0A 4HEDA 5C0XG 3D3RA 3K57A 3GV6A 1EY7A 2M2LA 1XYIA 2F0MA 3S1QB 3L9AX 4E6IA 4XIGS 3HKZB 4HCEA 3GP7A 3NQIA 5T1IA 3SXHA 4QUCA 3W2DA 3DWQA 2IT1A 3PIO3 1SYGA 4RGOS 3VR2A 2F0QA 4LAAA 1R4QB 3U9SA 2SOBA 2F0EA 2NTSA 1HTLD 3OIQA 3HOVB 1OXVA 3Q24A 1GOZA 2EXZA 4O1NA 4UDUC 3T53B 2EJMA 1TWGB 3X3MA 4K5VA 3TMEA 4A3GB 2X69A 1LTAD 2ZT9C 1JWUD 3IFDA 5D3IB 3SDZA 4K8JA 5JJZA 1Z6HA 4P2CB 2KCNA 4K6LA 1A2UA 2BCOA 4G57A 2NN6H 2FJ2A 1NUCA 2NVQB 3E6ZX 4FNFA 4KHZA 1JICA 2QDBA 2WV6D 1I4PA 1L0YB 3NQTA 1II3A 1A15A 1JR0D 5I2XA 4DXGA 3S2DB 4B9XA 4FO2A 3OOCA 5C0XJ 1CFMA 3SK4A 4BWGB 2F1MA 1C4QA 1PRTC 5HURA 2RDGA 4UAIA 4KKUA 2AQ2B 3ITPA 4L6TB 4XYOA 4FXKC 1D6EC 4HSPA 1JOQA 2SNSA 3GO5A 1AW7A 2NTTA 3OPOA 1EWCA 2B8FA 2OXPA 1CA5A 1ET9A 2F0UA 3D4DA 3QJYA 3BYTB 1RTNA 4QF4A 2D5DA 4HSVA 5I6YA 5LHY1 3K0YA 4ZRZA 2JEBI 5FLXE 4DAYA 5K5PA 4OGQC 3PO2B 1CTMA 1Z7TA 3S16B 1KAAA 2O5JC 3K5MA 1WTRA 1CI3M 2K7VA 4OIJA 1K8MA 4RKLA 1A3VA 1L0XB 1M4VA 5LL6S 2HUGA 5EPLA 2AQ1B 3S17B 5C44B 1O7ZA 1LTBD 2TSSA 3MFYA 2KOLA 5I9OA 1RKNA 1G91A 3OIPA 3A8KE 3H94A 1SFOB 2OEOA 1B9MA 3MXNA 5DAUA 4A93B 1K83B 1Q1BA 3S1MB 3AMUA 1PRTF 4DA2A 3GTGB 3J80L 2ZXPA 2QF7A 2Z4HA 4BY7B 4DNRB 1HHVA 4U673 2QEJC 1LT5D 5M9OA 3SK8A 1U4RA 4V190 1UUPA 5KEEA 3FPUB 3FEWX 3KLRA 3RLFA 1EIHA 2GA4B 2J7ZA 1A3UA 4ZUJA 1STBA 4K8IA 4C56C 1TS3A 5DM63 5M5YB 1B9NA 1LTID 1PTOD 2OF1A 3MXPA 4ZLTF 2SDFA 4G7OC 4C3JB 2NVXB 5ELDA 1XXGA 4XT3B 5E4WC 4A3MB 3DEPA 3PMFA 3S9WA 4B08A 4RAUC 4C3JG 5CBAE 4A3EB 1TQOA 4KJOA 3RZDB 3D31A 3T51B 3K7AB 1EYAA 4KY7A 2R6GA 3PUYA 1BDOA 3NTKA 3N6RA 2F0SA 1TS5A 1UAPA 1H9KA 1EFID 1RF2D 3EVQA 2JYOA 1VF7A 1JORA 5EKIA 2L55A 5CV6A 3GTKB 1ESRA 1TR5A 1AFPA 4KY5A 3WOEA 4KKTA 1AP0A 1ZEQX 5C5MA 1SYEA 2B2YA 2WP8J 2AWOA 3BVZA 3M85A 1GUGA 5KNDA 3GTPB 1LV9A 4DF7A 4A3KB 3H0GB 5C0XI 2RA4A 2F0TA 5FO8B 1C8CA 2EYPA 2Z1CA 2A6ED 1STAA 5HGTA 1HCZA 1STNA 3WDNA 3VYRA 3MXGA 4F8MA 1DOKA 4XYQA 4OO1H 2J4XA 2FMCA 3O13A 3U9OA 4Z9CB 5A2QE 4IUUA 5D65A 1HPCA 1Y8OB 4PNYA 2Q8TA 5E1FA 2HDMA 4H44C 5EBCA 2F0VA 2VB2X 3VR6A 4DK1A 3L7ZC 4IALA 2B8GA 1B3AA 2EYFA 5G3LD 3HP3A 1ZYRD 3M4YA 5CV9A 2NVYB 2C9OA 1D5XC 1HQRD 2IX3A 3QOJA 5JEAH 1STEA 1KDCA 1DONA 3J7AF 3T56B 5C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9O A;  1F2Y A;  3NQT A;  2F0I A;  1RKN A;  3HZX A;  4NP5 A;  4WOR A;  3OSO A;  4RKB A;  5KYI A;  2F0J A;  1EZ6 A;  1II3 A;  3EVQ A;  3C1E A;  3C1F A;  1SYD A;  3DHQ A;  1A3T A;  4PMB A;  5I9P A;  1JOR A;  2EYL A;  4ME5 A;  1KDB A;  3E5S A;  1JOK A;  2PZT A;  1SNP A;  3H6M A;  4KY6 A;  1EQV A;  4B9X A;  2OEO A;  1EYC A;  2KHS A;  2ENB A;  2PQE A;  5CV6 A;  5KGU A;  3SK4 A;  1EYD A;  1ENA A;  2F0F A;  4ODG A;  3MVV A;  1A2T A;  3T13 A;  2F0L A;  2EY5 A;  5DAU A;  5C5L A;  5C3W A;  5IGB A;  4DU9 A;  1TR5 A;  2LKV A;  1STY A;  1SNQ A;  2EY2 A;  4KY5 A;  4NDX A;  4J6H A;  2F0K A;  4K2K A;  4MIU A;  5HUR A;  3TP5 A;  3QOL A;  1KAB A;  1EY7 A;  5C5M A;  5E3F A;  1SYE A;  2F0M A;  5IOD A;  3ITP A;  3MEH A;  4E6I A;  3NXW A;  5C3X A;  2PYK A;  1JOQ A;  5EGT A;  1SYC A;  3SR1 A;  2SNS A;  4N9P A;  2F0D A;  1STG A;  5F2D A;  5J22 A;  4NKL A;  4HMI A;  4DF7 A;  1IHZ A;  1SND A;  1AEX A;  5I6W A;  4F7X A;  3SXH A;  3TP7 A;  4KV6 A;  4YIJ A;  3SK8 A;  5M9O A;  4HTH A;  4KTA A;  4WRD A;  3SHL A;  5KEE A;  4IUN A;  2F0G A;  5CR3 A;  5CV4 A;  1SYF A;  2F0T A;  1KDA A;  1U9R A;  5KIX A;  2EYP A;  3D6C A;  5ISR A;  4J1M A;  1STA A;  2EYJ A;  4ZUI A;  2F3W A;  2OXP A;  2RKS A;  5C4Z A;  5J39 A;  5IGE A;  1A3U A;  2PZW A;  3MHB A;  2F0U A;  1STN A;  1SNO A;  1SYG A;  3EJI A;  2NUC A;  4ZUJ A;  3SK6 A;  4TRD A;  4EQO A;  3T16 A;  5KYL A;  1STB A;  4K8I A;  3HEJ A;  3V2T A;  3VA5 A;  3TP6 A;  4DFA A;  3D4D A;  4EVO A;  4F8M A;  4QF4 A;  5EKK A;  5CGK A;  2F0Q A;  2RBM A;  3BDL A;  3NK9 A;  1EY5 A;  4LAA A;  1STH A;  2SOB A;  2F0E A;  5JOB A;  2EYH A;  4S3S A;  5I6Y A;  2RDF A;  2PW7 A;  2EYO A;  3NP8 A;  1EY8 A;  2F0P A;  5IOC A;  3U9O A;  4OL7 A;  2OF1 A;  5IGD A;  1EY4 A;  5C4H A;  4DGZ A;  3NUC A;  4EQP A;  3MXP A;  3MZ5 A;  4KD4 A;  3QB3 A;  5CV8 A;  3TP8 A;  5K5P A;  2EXZ A;  1SYB A;  4PNY A;  3BDC A;  3OMG A;  4KJN A;  4N9T A;  5DEH A;  5E1F A;  3ERQ A;  3P1H A;  2HQE A;  3SK5 A;  1KAA A;  2F0V A;  4HMJ A;  4K5V A;  2O4X A;  3TME A;  3OMC A;  2M00 A;  2EY1 A;  2F0H A;  2EYM A;  4QB4 A;  4IAL A;  5CV5 A;  1NSN S;  1ENC A;  2F0N A;  3DMU A;  3PMF A;  1TT2 A;  5IGG A;  3S9W A;  5CV7 A;  4RKL A;  4K8J A;  2EYF A;  3OWF A;  3NHH A;  2SNM A;  5HGT A;  3P75 A;  1EZ8 A;  1F2Z A;  1SNM A;  4ZQ3 A;  1A2U A;  5IGC A;  5CC4 A;  4G57 A;  1TQO A;  5IIF A;  4ID6 A;  1A3V A;  4KJO A;  4QMG A;  1F2M A;  3D8G A;  1EY9 A;  2PW5 A;  5CV9 A;  4K5W A;  5NUC A;  1NUC A;  5J1Z A;  4KD3 A;  2F0O A;  4B9W A;  2KQ3 A;  4PMC A;  1EYA A;  4KY7 A;  5KRU A;  4I65 A;  4K2L A;  1JOO A;  2PZU A;  4EQN A;  3D4W A;  5EKL A;  3QOJ A;  3RUZ A;  4NMZ A;  4H7B A;  1EY6 A;  5IGF A;  2QDB A;  4KHV A;  5JAV A;  1KDC A;  2WAC A;  3ERO A;  4IZ8 A;  4R8N A;  1EY0 A;  4K5X A;  2F0W A;  4K14 A;  2F3V A;  4K6D A;  3LX0 A;  3R3O A;  2EY6 A;  2F0S A;  1SNC A;  5C6A A; 
#chains in the Genus database with same CATH topology
 2A6H D;  2CH4 W;  2E8G A;  1ASZ A;  1FNV A;  4X6A H;  4HJ8 A;  2EVB A;  2HDL A;  3K5O A;  1MI2 A;  1SMY C;  2OTL A;  4PMB A;  3J81 E;  3VR5 A;  1HA6 A;  3KDF A;  3H6M A;  1Y69 U;  4MHE A;  4A4I A;  5ELN A;  1TII D;  1I6H B;  2ICE C;  2NVT H;  2RQX A;  1HNW Q;  4NDX A;  3EQL C;  3I4L A;  3TEH B;  2E2H H;  4A3J H;  2JA7 B;  2AWN A;  4POF A;  3VA7 A;  1SE3 A;  2ID0 A;  5BN3 A;  2B2V C;  5C3X A;  1O80 A;  3DM1 A;  4XQJ A;  5J22 A;  1I4X A;  3H09 A;  1J8I A;  4DV5 L;  1KLU D;  2I5M X;  2B2W C;  2A74 C;  3HOY B;  5IYD G;  1NY4 A;  2QGQ A;  4IUN A;  1B44 D;  1VQJ A;  2CCZ A;  2JA7 G;  1KD1 C;  4DR6 Q;  4JI0 Q;  2OT2 A;  3S14 H;  4GKJ Q;  1PMR A;  4ZUI A;  1QIL A;  2AHO B;  2WAQ E;  3UDF A;  1SDF A;  3NEL A;  2B63 B;  1PZK D;  1X3E A;  2CKZ B;  3N52 A;  1NBW A;  3VA5 A;  2F4V L;  4A3D B;  3IRB A;  4JV5 Q;  1RCV D;  3A8J E;  5IT9 L;  3HOZ B;  1EY5 A;  5LMN L;  1NAP A;  4DR1 Q;  3PO2 H;  5A35 A;  4HN7 A;  1PTO B;  3S16 H;  3DXJ C;  1N32 Q;  3K8A A;  4UHV A;  3TP8 A;  2B63 G;  2YTV A;  1S5B D;  5DEH A;  3BDC A;  4X66 Q;  4FF1 A;  2A73 B;  1TS2 A;  5M5W B;  2KA7 A;  4A3D G;  1WTP A;  1PZJ D;  3HOZ G;  4IQZ A;  2EZV A;  4QB4 A;  5JVH 3;  4H0L C;  3J7A 5;  1UE1 A;  1PA6 A;  1VQI A;  4DK6 C;  1QVC A;  2IY5 B;  1TWH B;  1X54 A;  1MIU A;  1HNW L;  3I55 A;  1V1O A;  3D8G A;  1EY9 A;  3S17 H;  4K5W A;  4KK7 A;  4IN3 A;  4FF2 A;  4DV7 Q;  2A68 D;  4YCV A;  2IHF A;  4B9W A;  4JI8 Q;  2Q2U A;  4KHV A;  4LW1 A;  5G3L F;  2CFM A;  4K5X A;  1I50 H;  4PZ6 A;  4N8X 1;  1WCM H;  3KDF B;  4A3I G;  1KQS A;  2CW0 C;  1SFO H;  3C1F A;  4DR6 L;  4GZY C;  1BF4 A;  4JI0 L;  1DZ1 A;  1J9O A;  2AQ3 B;  4ME5 A;  3V96 A;  4GKJ L;  3SEB A;  4C3H H;  3TN2 A;  1GUW A;  2KHS A;  4BY1 H;  4DV6 Q;  1X3F A;  1K83 H;  2F0F A;  3I73 A;  5C4J B;  1ZXT A;  3HOX B;  4JV5 L;  1QUQ A;  2EY2 A;  5C3E H;  3K5N A;  1VQF A;  5JPN C;  4MIU A;  4DR1 L;  1K8O A;  1TWF B;  5FO9 B;  1N32 L;  1EIY B;  1HFN A;  1HZA A;  2ZTE A;  4DR2 Q;  4X66 L;  1ML0 D;  3WOF A;  3KLW A;  3HOX G;  4ZKC B;  3TP7 A;  3RNU A;  1VQO A;  3I7F A;  3MFG A;  5CR3 A;  5CV4 A;  2KEN A;  1F77 A;  1PZI D;  3DLL A;  2A69 C;  1BQQ T;  3TRE A;  3FRP B;  2RSO A;  2R92 H;  4HAE A;  4GN5 A;  1X3Q A;  3M7N A;  3M3Y B;  4IFD G;  3BDO A;  2K04 A;  2RCF A;  1RJT A;  3BDL A;  3E0E A;  1U5K A;  2WKD A;  4JI8 L;  2WB1 E;  2MJ8 A;  1FGB D;  3NUC A;  4EQP A;  4ILW A;  1Y1V H;  4A3M H;  2MNA A;  1H9R A;  3MXU A;  3CCM A;  4RA8 A;  4DAP A;  2LSS A;  3K5L A;  2O4X A;  1MHW C;  2WII B;  1JC7 A;  1R9T B;  1IL8 A;  1HR0 W;  4POG A;  1X65 A;  2PI2 E;  2RF4 A;  3I72 A;  1Q1E A;  4DV6 L;  2HT1 A;  2BH8 A;  2L9H A;  3G48 A;  2EXD A;  3PV0 A;  3HGB A;  1B7Y B;  1N8R C;  3GDE A;  4QMG A;  3I3C A;  1PVO A;  2I5H A;  2L0C A;  1GHK A;  1MSH A;  3EN2 A;  4PMC A;  2QKI C;  2KCT A;  1SR3 A;  2IHE A;  5LL6 X;  1EY6 A;  4DR2 L;  4OIK A;  3GTQ B;  2WAC A;  5FJ8 G;  2D2C C;  3GTL H;  1B1Z A;  1STH A;  1DD2 A;  1F2Y A;  4LUV A;  4BA1 I;  2F0J A;  4KN7 C;  2K4K A;  1B4O A;  3CMA A;  2PPB C;  3CXC A;  3DEO A;  3CPW A;  3A5U A;  1I3Q H;  1DOM A;  3FPP A;  1VQD A;  1HUM A;  1QUQ B;  2H1E A;  3CD6 A;  5CYU A;  1SJH D;  2XNA C;  3NE5 B;  1Y14 B;  2K50 A;  1CQV A;  4JOI C;  3Q0A A;  2F0L A;  3IL8 A;  2GVA A;  4QIW E;  3HOU B;  3CPF A;  3OW7 A;  1STY A;  1G8Z D;  4A3B B;  1CT1 D;  3HOW G;  3BVM A;  2K5N A;  1Q86 C;  2JA6 B;  4IOA A;  5E3F A;  4RGT A;  4CKE A;  2K05 A;  2R61 A;  1XTC D;  4HJ7 A;  1FJG L;  1YNN C;  1PRT D;  4QCL A;  3K58 A;  2D9U A;  5K36 G;  5F2D A;  3J80 c;  3S1R B;  3HOU G;  2B2T A;  2DJG C;  2KHJ A;  2B2U C;  4A3B G;  2A19 A;  4F7X A;  1BUV T;  1Q90 A;  4C1N K;  4WRD A;  2JA6 G;  4IUV A;  2F0G A;  2SEB D;  4GNX A;  1QVF A;  4JBK A;  1Q8I A;  4IJH A;  1S4Z A;  4IFD J;  4M1U B;  2I46 A;  2A8V A;  1TWA B;  1KRT A;  3MHB A;  4XXE A;  4R8I A;  3GTM B;  4PMW A;  3V2T A;  1D2B A;  1BCP C;  1LTT D;  1BKB A;  3PO3 H;  2A1A A;  1B53 A;  4CDD C;  3NP8 A;  3CQZ B;  5M3M H;  2MP1 A;  5IGD A;  2WIN B;  5C4H A;  1DXM A;  5CV8 A;  3C3L A;  2L1B A;  1ESF A;  2Z0S A;  3DM3 A;  3CCQ A;  1EWH A;  3IFT A;  1VQG A;  1WTO A;  2VW9 A;  1HH2 P;  4B3R Q;  4KLK A;  4RHS A;  4IUP A;  2DY8 A;  4CJ2 C;  1OXS C;  1VQ5 A;  1M8A A;  2O5I C;  1IKL A;  1FD7 D;  4FVM A;  2SNM A;  4AYB B;  3RN5 A;  2A5H A;  4CDE C;  1WYD A;  2NVY H;  4JPB W;  3FKI H;  4L63 B;  1JT8 A;  4JI2 Q;  1YJW A;  5LMU Q;  4U68 A;  5DNF A;  2ATW A;  1SRU A;  3J7A V;  1IW7 C;  5I2Y A;  2PMZ E;  3NTI A;  5KRU A;  4K2L A;  3D4W A;  4LF9 Q;  4AYB G;  4APV A;  3CRL C;  5JAV A;  2E2J H;  1RTO A;  3WWV A;  3LX0 A;  4WOR A;  1QVG A;  3I4O A;  5KYI A;  1SAP A;  1O7Y A;  1TVX A;  3L3O C;  4TQU S;  3OTO Q;  1K3B C;  1I4Q A;  3EBE A;  3H3V H;  3C1E A;  3JAM i;  2K5V A;  5IYB G;  3E5S A;  1IL2 A;  2RVL A;  2RCN A;  4NW2 A;  3MWY W;  2PQA A;  1D5Z C;  1PDQ A;  1T5E A;  1JWM D;  1OXX K;  3BVG A;  3D4R A;  2JA7 H;  1SNQ A;  3W1G A;  1N36 Q;  1D1I A;  2K32 A;  1LT4 D;  2DJF C;  1AH9 A;  2N49 A;  2R7F A;  1RHP A;  3ULP A;  3SR1 A;  2Q2T A;  3HOY H;  3I90 A;  1T5X D;  1K3R A;  4GNX B;  1Z9F A;  5I6W A;  4JBJ A;  1DOL A;  1XNR Q;  3CCL A;  1KDA A;  4KMU C;  1OO9 B;  4JVZ A;  2NB0 A;  3H3V I;  1QB5 D;  1LO5 D;  2NUC A;  2H4O A;  2Z6K A;  4JI2 L;  1I4R A;  4LUO A;  5LMU L;  1EQR A;  2Z4I A;  1S5C D;  4S3S A;  3FP9 A;  5M3F H;  4RFB A;  2LFN A;  4A3F B;  5M5W H;  2CHB D;  1EY4 A;  4C3I B;  3CC2 A;  1SYB A;  4PQX A;  4KJN A;  4ZYS A;  1GKH A;  2JA5 B;  5FLX L;  2L5T A;  3BU2 A;  4HMJ A;  3PSI A;  3H3V C;  1SE4 A;  2WAQ G;  2ZM6 Q;  3DMU A;  1HFG A;  4A3F G;  3CCU A;  1N33 Q;  2KEE A;  4KHP Q;  4C3I G;  4LFA Q;  3PQI A;  4F87 A;  4BBR B;  1Q3L A;  3U4V A;  4IUQ A;  5IGC A;  3TZD A;  1NTG A;  3KLS A;  1N36 L;  2UUB Q;  4A3C G;  2R93 B;  3CU7 A;  2FIN B;  2NYZ D;  4IPD A;  4IUR A;  1OXT A;  4BBS B;  3HKZ E;  1VQC A;  1ENF A;  2Z8L A;  2PZU A;  2BE5 C;  4NMZ A;  4IJL A;  3T1Y Q;  2PI2 A;  2AUK A;  1EY0 A;  2F0W A;  5COY A;  1EEF D;  1BR9 A;  3I4N H;  1C9O A;  3VYS A;  4EX5 A;  3A56 A;  2R93 G;  2PQA B;  1EZ6 A;  1Q12 A;  3AFQ A;  1Q8K A;  1X56 A;  4BBS G;  3VR3 A;  3RZO B;  2CVR A;  4O0A A;  3OYY A;  1VQ8 A;  1JOK A;  1WVL A;  2E76 C;  4MN3 A;  3NEM A;  4KI0 A;  4ODG A;  1E1O A;  1GUT A;  5C3W A;  2L4N A;  1Z47 A;  2VB3 X;  4LF7 Q;  1S40 A;  2N3S A;  5C0X H;  5AJ3 Q;  3UE0 A;  5IE8 A;  2LMC B;  1TKW B;  1YBY A;  2XWB B;  3A54 A;  2Z9H A;  4FDB A;  1CSP A;  1I6V C;  4YCU A;  1PRT B;  2EJG C;  4LK1 C;  1JWS D;  1UE6 A;  2R7Z B;  3R2I A;  3W5O A;  1VF5 C;  2RDH A;  1X9N A;  1PH4 A;  1ZKO A;  4X3T A;  2PNH A;  4YIJ A;  3TZU A;  4KTA A;  1RDP D;  3QIA A;  3MAQ A;  1N33 L;  4KHP L;  4LFA L;  2CH4 A;  4EGV A;  3C2P A;  1GD7 A;  2EYJ A;  3S1Q H;  2K5H A;  1C48 A;  3ULJ A;  1EIG A;  1YHB A;  2AUJ D;  3RMH A;  3V05 A;  2R7Z G;  1G51 A;  1XMQ Q;  4X62 Q;  4DFA A;  2E5L Q;  2UUB L;  1XTD A;  2I07 B;  1CZW A;  4BA2 I;  1B2T A;  3DWP A;  1TWC B;  2EYH A;  2RDF A;  2F0P A;  2K5D A;  5IT9 c;  2FFK B;  4H13 C;  1YI2 A;  2JJQ A;  3LWU A;  4N9T A;  1IBM Q;  1VQ7 A;  3IAY A;  1R9T H;  3P7J A;  2X6L A;  2CQA A;  1S5E D;  3I4M B;  2WKC A;  2WB1 B;  3X3N A;  1JQY D;  1QZH A;  4DNT B;  2EY1 A;  3RR5 A;  5E4X A;  1ENC A;  5IGG A;  3G7L A;  3S15 B;  1R4P B;  2NN6 G;  3GTO B;  3NHH A;  4DAV A;  1EOT A;  3M4Q A;  4HJ9 A;  1GUO A;  1KXL A;  4LF7 L;  3U50 C;  1FVI A;  2WB1 G;  3TRZ A;  1U4M A;  4BXX G;  4CDC C;  2JA8 B;  2AMC B;  4A3G H;  4CDF C;  5EBD A;  3JAM E;  5IGF A;  2BDO A;  1SE2 A;  1AZQ A;  2X6G A;  4G7H C;  3FHW A;  1L0W A;  1KLG D;  1HTP A;  2JA8 G;  2IL8 A;  2HCC A;  2NVQ H;  4Y52 H;  1G29 1;  3AYH B;  2VXW A;  1EYC A;  2IX0 A;  3AEV A;  4GOP C;  3ULL A;  1EL0 A;  1XMQ L;  5C5L A;  2XRQ D;  4X62 L;  2E5L L;  1H9J A;  2M9V A;  1SMY D;  2AKW B;  5DLQ E;  2ZTC A;  4F88 A;  1CHP D;  3AFP A;  4OON A;  1U4L A;  4PV1 C;  3S1R H;  3MEH A;  4QIW B;  2ZJQ A;  1NR4 A;  3S2D H;  1IBM L;  1HZB A;  1QOH A;  5DM7 3;  1VQB A;  4N9P A;  2F0D A;  1STG A;  4AQY Q;  2C5C A;  5IP7 G;  4WJW A;  3CCV A;  4XDX A;  1PH9 A;  3VYT A;  3K7U C;  2G9D A;  2NWG A;  4HTH A;  4R4T A;  1Y1W G;  1K9M C;  1TWA H;  3E3X A;  4EQ5 A;  1EEI D;  4OHJ A;  2VQF Q;  3T16 A;  5T1G A;  4DR7 L;  4G7Z C;  3NK9 A;  1MGS A;  1E2V A;  1EYG A;  5GAG C;  1QNK A;  3LWE A;  3W3A A;  3L0O A;  4L5Q A;  1E3P A;  1W6J A;  2IPK D;  4LF4 L;  3ERQ A;  5A2Q L;  3Q22 A;  3T4A C;  4RH6 A;  1CKO A;  1YNX A;  1LAC A;  2IW3 A;  3KBX A;  2QEX A;  1KC8 C;  2VUM B;  5CV5 A;  4ZCK A;  1WJJ A;  3A5Z B;  4DK3 C;  3K81 C;  1SNM A;  2Y0S B;  4G4K A;  5CC4 A;  5IIF A;  1V43 A;  3CC7 A;  5BN4 A;  1EU4 A;  4OEM B;  4IPH A;  2XTI A;  3GTP H;  3HKS A;  2VUM G;  4WJ4 A;  2F0O A;  4JI5 Q;  1YJN A;  2E74 C;  1QJO A;  2NBF A;  4TRD A;  2B3G A;  2Y0S G;  4AQY L;  4IPC A;  1V9P A;  4P75 A;  5IY0 A;  1GHJ A;  4JK1 C;  3OSO A;  4RKB A;  1AZP A;  1GVP A;  5KNC A;  1S5D D;  1LTG D;  1SYD A;  4FP5 D;  5M5X B;  3DHQ A;  4OWW B;  1AN8 A;  3I70 A;  5JPM C;  5KGU A;  3PIP 3;  2VQF L;  4A3I B;  5C44 H;  1ENA A;  4OWT B;  4ZKB B;  2XVS A;  3MTS A;  1A2T A;  2TMP A;  2CW0 D;  3T13 A;  3J81 L;  2ZJR A;  4DU9 A;  3CRK C;  1XJV A;  1B8A A;  1W6K A;  3OWE B;  4JCV E;  3UI2 A;  1QG7 A;  5FO7 B;  2ZXR A;  2VNU D;  2JA9 A;  3RN2 A;  3NXW A;  2PYK A;  3J80 i;  4DKA C;  1PH6 A;  2L15 A;  2EJF C;  3GQB A;  4HR7 B;  1ICF B;  3UDX A;  1IHZ A;  4DAM A;  3AB9 A;  4XQQ A;  2I0Q A;  1HRJ A;  4A93 H;  3SHL A;  2N55 A;  3S1M H;  3S1N B;  2F52 A;  1VQH A;  3GTG H;  4LUZ A;  2UXB Q;  5TSS A;  1S3O A;  2B2V A;  4MNO A;  1D7Q A;  3HEJ A;  4BY7 H;  4OEL B;  3SVM A;  2UU9 Q;  1ICW A;  2RBM A;  5JOB A;  4A3L H;  2A69 D;  4JI5 L;  4OL7 A;  1L2F A;  2JA5 H;  1KHI A;  3PUZ A;  4DGZ A;  2KEC A;  4KD4 A;  3QB3 A;  3BYY B;  3G6J B;  1PYS B;  5EAY A;  2UXC Q;  3P1H A;  3E9H A;  4PG3 A;  3G4S A;  1YZ6 A;  5FOB B;  1SLJ A;  2VQE Q;  1AE2 A;  3KUP A;  4BBR H;  3T1H L;  1K0R A;  1CZG A;  2JP1 A;  2DN8 A;  2K6A A;  3A7L A;  3I91 A;  3OHX C;  3OWF A;  3SE0 A;  5M5Y H;  1VMC A;  1GUN A;  1IZ6 A;  2KBN A;  4C3J H;  4PZ8 A;  2BA0 A;  2PW5 A;  1L1O C;  1UEB A;  2NVX H;  4JI6 Q;  4TKO B;  1XWE A;  1FJG Q;  1YNJ C;  3TSS A;  4I65 A;  4DV2 Q;  1JOO A;  4DK0 A;  1A6X A;  1LT3 D;  4GNX C;  1JCK B;  3EIV A;  4RWS C;  1YHQ A;  4KKS A;  4RHR A;  3R3O A;  4Y7N B;  3A8I E;  2F0I A;  3FDT A;  4A3E H;  1PFN A;  3M7G A;  4QUF A;  5FKA C;  3RZD H;  1JB7 A;  3I8Z A;  5C4X B;  2EYL A;  5FK9 C;  1BNZ A;  1TY2 A;  3F2D A;  1DM0 B;  3K7A H;  2YU9 B;  2UXB L;  1U4P A;  1HUN A;  1HQM C;  1E0B A;  1S5F D;  4RCO A;  3BG3 A;  2F03 A;  1FNW A;  2C35 B;  4HIK A;  3HKZ G;  2UU9 L;  5ELO A;  4J6H A;  2F0K A;  1WTQ A;  2OTJ A;  3NWT A;  5C4X G;  3PUV A;  3HS0 C;  5EQ0 A;  1LTR D;  3KLS X;  1H9M A;  3I2Z A;  1BVS A;  1CQF A;  1HA5 A;  4QQB X;  3HOW B;  3CCE A;  1JMC A;  2UXC L;  1P16 A;  3GTK H;  1SJE D;  1J5E Q;  4HMI A;  1GJX A;  2FHT A;  2VQE L;  4ZAI A;  1P8L A;  3KYH C;  1CK1 A;  1YNN D;  5ELB A;  3CKI B;  1SXT A;  3CCJ A;  4ME3 A;  1XX8 A;  2F3W A;  5IGE A;  5IYC G;  3HOV G;  1SNO A;  3P20 A;  2MGS A;  1PH3 A;  1SE8 A;  3NEN A;  4OO1 G;  1TWC H;  5KNB A;  3STB C;  3K0X A;  1FGU A;  4JI6 L;  2D62 A;  1UWV A;  2DNC A;  2IWH A;  5EJW A;  1JE5 A;  3F8T A;  5EKK A;  4A3K H;  1WD1 A;  2UUA Q;  1VQK A;  3H0G H;  1I94 Q;  3J7Z C;  2YYZ A;  3OW2 A;  1VS0 A;  2PW7 A;  1CSQ A;  2EYO A;  4DV2 L;  1V1Q A;  2QA4 A;  3GV3 A;  5BN5 A;  1MBY A;  1BCP D;  2H5X A;  3I4M H;  3ZJY C;  2ALY B;  4JBW A;  3SK5 A;  4IUT A;  3NWS A;  3BZD B;  1IBL Q;  2K75 A;  4DN4 M;  3I56 A;  5FLX c;  1WTX A;  1VDZ A;  1B3Q A;  1JE4 A;  5CV7 A;  1YJ9 A;  2E2I B;  1NMG A;  1F9Q A;  4ZQ3 A;  4DNI A;  2OQ0 A;  2ZJP A;  1NR2 A;  1RD9 D;  1BXT A;  2KJX A;  1F2M A;  3FVQ A;  4RGM A;  2GVB A;  5J1Z A;  2OCE A;  2I5L X;  5JEA G;  2Q8R E;  3ZYY X;  4FXD A;  2NVT B;  1VCI A;  2EIF A;  3PIO A;  4LF5 Q;  2PCF B;  4IZ8 A;  4R8N A;  2NN6 I;  1J5E L;  1T9H A;  1SNC A;  3NBH A;  4NP5 A;  3J7Y W;  1IW7 D;  2E2H B;  4R4I A;  4A3J B;  4DR3 Q;  3EA6 A;  5ELF A;  1A3T A;  4WFN 3;  2UXD Q;  3HG9 A;  4DV0 Q;  1QWY A;  1EYD A;  2EE1 A;  3W1B A;  3CCR A;  3VYU A;  3J80 E;  1OTC A;  4AH6 A;  2LKV A;  4A3J G;  1A8V A;  1WI5 A;  2UUA L;  2MFI A;  1I94 L;  3S14 B;  4Q5V A;  5HGQ A;  5LMN W;  1G2S A;  4R9W A;  1HJP A;  1LTS D;  3KOJ A;  3VR4 A;  1I6H H;  4LWC A;  5AFW A;  1LTL A;  2GN5 A;  1UNS A;  1Y8P B;  1AEX A;  4UP8 A;  4HCS A;  4X65 L;  1TU2 B;  1IBL L;  4O42 A;  3TDQ A;  1GM5 A;  1U9R A;  2Q2H A;  2PNR C;  4J8Q A;  5IYD H;  1PLF A;  4J1M A;  3B6Y A;  3PCO B;  1OXU A;  5C4Z A;  4CHT B;  5KYL A;  2DY7 A;  3TP6 A;  3PO2 G;  4FF4 A;  2K52 A;  1TS4 A;  3GTJ B;  2B2U A;  2D0P A;  1SBB B;  1VQE A;  4RG1 A;  4I7Z C;  1V1P A;  3MZ5 A;  3U4Z A;  4LF5 L;  1SEB D;  4B3T Q;  5JJL A;  3OMG A;  3CF5 A;  2G9H D;  2B63 H;  2HQE A;  1QCB D;  3NPP A;  4DR3 L;  2JEA I;  3UDG A;  4A3D H;  2M00 A;  2UXD L;  3HOZ H;  1NSN S;  5FLM G;  4DV0 L;  1JJ2 A;  4JI3 Q;  1FNU A;  1I4H A;  1I50 B;  3MA2 B;  5GAD C;  4LF6 Q;  1WCM B;  1PTO H;  1YVC A;  1BCP F;  2KCM A;  3KF8 A;  1KTK A;  2WAQ B;  1DGS A;  3E0J A;  2RHS B;  3LNN A;  5JEA J;  3KJP A;  2LY7 A;  3URY A;  4TSS A;  4DR4 Q;  3L2P A;  4JYA Q;  4C3H B;  1HXY D;  4JI7 Q;  4BY1 B;  3NBH B;  1J6Q A;  4EQN A;  4LFB Q;  5EKL A;  3RUZ A;  2E2D C;  2YTY A;  2JSO A;  1E7Z A;  2K28 A;  1WCM G;  3ERO A;  4K6D A;  2MHV A;  5C3E B;  1I4G A;  2F4I A;  1ILP A;  1TWH H;  2KVM A;  5EPJ A;  4N8F A;  3UE1 A;  1KNA A;  4C1N I;  4A3I H;  4C3H G;  2B2Y C;  2BE5 D;  3QO2 A;  3A55 A;  3DUZ A;  3K6O A;  4BY1 G;  1M1K C;  2QW7 A;  1NMF A;  4KY6 A;  5GAH C;  2ENB A;  3Q8D A;  4CJ1 B;  5C3E G;  3M4O B;  2XN9 C;  4CBV A;  2HIX A;  4JBM A;  2OWO A;  2L11 A;  1IYU A;  3R2T A;  3QOL A;  3S24 A;  1KAB A;  3M4P A;  1E22 A;  5IOD A;  2R92 B;  4B3T L;  3NSW A;  1PXU A;  4DV3 Q;  4NKL A;  3G71 A;  1E2W A;  4AIM A;  3S1N H;  4HJ5 A;  1FR3 A;  5C4J H;  4KV6 A;  3HOX H;  5E7N A;  1HR0 Q;  4NXN Q;  4JI3 L;  1TWF H;  2R92 G;  1EQT A;  4YHH Q;  2MQH A;  1Y1V B;  5ISR A;  4LF6 L;  1LAB A;  3RLN A;  1UE5 A;  2RKS A;  1X55 A;  1YEZ A;  1ET6 A;  1PTO C;  3CW2 C;  3EJI A;  3ER0 A;  2QCP X;  4X3K A;  2K01 A;  1O7L A;  1V1P B;  3MC0 B;  4DR4 L;  4JYA L;  4IFD H;  1X3P A;  1F2L A;  4JI7 L;  5EPK A;  5IOC A;  4LFB L;  2QIL A;  5CMD A;  1EFW A;  1Y1V G;  4A3M G;  4YWM A;  3CC4 A;  1FYC A;  1K28 A;  1BCP B;  4DUZ Q;  3RD4 A;  1F9S A;  4ZK9 B;  2UUC Q;  3M3Y H;  4YWL A;  1E2Z A;  2MUY A;  5JVG 3;  2ASB A;  1LT6 D;  4X3U A;  2F0N A;  3KF8 B;  4OWX B;  5IP9 G;  1NCV A;  1RL2 A;  1VMP A;  1W3S A;  2HQL A;  4HID A;  3GTL B;  1LM0 A;  1EZ8 A;  3CHB D;  1Q81 C;  1EOV A;  4KN4 C;  5GAE C;  4ID6 A;  2DUD A;  2L12 A;  3HFZ B;  1I3Q B;  2K14 A;  2IX1 A;  3AU7 A;  3QG1 A;  2VZA A;  4H7B A;  2YV5 A;  1CM9 A;  4IFD I;  5GRO A;  3ND9 A;  4DV3 L;  2HCI A;  1WTV A;  4K14 A;  3R93 A;  4RCN A;  5H1S E;  5FJ8 H;  3ONA B;  1HR0 L;  5ELE A;  1K8G A;  4NXN L;  4XQN A;  4NXM Q;  1KDB A;  2J0T D;  1TY0 A;  4YHH L;  2E75 C;  1SNP A;  4FXG C;  2PQE A;  3KBG A;  4DR7 Q;  1SSO A;  5CBE E;  1Q46 A;  2N8N A;  3VDY A;  5IGB A;  2EY5 A;  1HZ9 A;  3GTQ H;  1PV4 A;  4YCW A;  4K2K A;  3J81 c;  1LLR D;  4DUY Q;  2R3Z A;  3HOW H;  1UEA B;  1BBX C;  1Y8N B;  5ELC A;  2EDG A;  4LF4 Q;  2KUM A;  2XRS D;  1PFB A;  2K03 A;  4DPG A;  4DUZ L;  2EOT A;  1O78 A;  4QGU A;  2A6E C;  2NZ1 D;  1IYV A;  2VY3 A;  2UUC L;  2BH2 A;  1PH5 A;  5K36 H;  3PO3 B;  2ZXO A;  5M3M B;  3BS1 A;  3HOU H;  4A3B H;  1SYF A;  2RSN A;  1GXD C;  2JQO A;  1MKH A;  4K0K Q;  2N88 A;  3D6C A;  2K5Q A;  2JA6 H;  3D6W A;  5IT9 E;  4ULL A;  4RMF A;  3NTH A;  5J39 A;  3QWN A;  1G2T A;  3SK6 A;  2V4D A;  1Y1W B;  4P71 A;  1PH1 A;  1PTO F;  1Q82 C;  4EVO A;  3PO3 G;  1XMO Q;  1ILQ A;  2FMM A;  5CGK A;  5M3M G;  2N78 A;  3BJU A;  2LS0 1;  5J3B A;  3H91 A;  1EY8 A;  3G6E A;  3S2H B;  1CA6 A;  3FKI B;  2XWJ B;  4XTC S;  1ROD A;  2BA1 A;  1JJG A;  3EFX D;  2EPB A;  3GD7 A;  3GTM H;  4OO1 I;  1ZYR C;  3TBI B;  4CJ0 B;  3OMC A;  4NXM L;  2F0H A;  2EYM A;  3SGI A;  3IKJ A;  1QE6 A;  4A75 A;  2E2J B;  3FKI G;  3CQZ H;  4YWK A;  5I4D A;  3P75 A;  1G6Z A;  4DXF A;  1ASY A;  4RGN A;  2XIW A;  3HRZ C;  4X3S A;  2KCC A;  5NUC A;  2Q8I B;  1BO0 A;  4DUY L;  4DR5 L;  4KD3 A;  2A6H C;  4MTK A;  1H95 A;  2KQ3 A;  3E9I A;  1LUZ A;  2RHQ B;  1FL0 A;  1K73 C;  4XT1 B;  1NJI C;  2F3V A;  4V0B A;  3ICE A;  1CUK A;  3JAM L;  4GLA C;  2KED A;  2BOS A;  5I9P A;  4K0K L;  2B29 A;  3F2U A;  5D14 A;  1EQV A;  5IYB H;  1H9S A;  2K5W A;  3MVV A;  2V1C C;  2HIV A;  2LXJ A;  4CKB A;  1XMO L;  3K59 A;  4IPG A;  3FMC A;  5L37 A;  1XNQ L;  4I7A A;  5D3D A;  3TP5 A;  1NNX A;  3NBI A;  1DYQ A;  5COR A;  2ICI A;  3R8B A;  4JI1 L;  1ONL A;  3HOY G;  1B50 A;  2PMZ B;  3TS2 A;  5EGT A;  1SYC A;  1MD2 D;  4GOP A;  2WFW A;  4M8A A;  4GS3 A;  1SND A;  3T1H Q;  2KHI A;  5M3F B;  4IOC A;  1U0L A;  1JB3 A;  4R1J A;  2DNE A;  1F9P A;  2JE6 I;  4BS9 A;  5KIX A;  1A0I A;  2PZW A;  4EQO A;  3F2B A;  4FYD A;  3GTJ H;  1MSG A;  1TXY A;  1WTH A;  5FLM H;  4LJZ C;  5M3F G;  3Q6S A;  3K80 C;  3DWA A;  2K33 A;  2PO4 A;  1M90 C;  4CKC A;  4R4O A;  3BZC A;  1DJR D;  2JXM B;  1KRS A;  3H15 A;  1BOS A;  4L5T A;  2K1B A;  2XSC A;  3PUW A;  1MJE A;  1DCZ A;  2MPM A;  3ND8 A;  2BDN A;  4LMQ D;  1X32 A;  1IKM A;  1TT2 A;  4C2M B;  2A68 C;  4ALP A;  3I4N B;  1QNU A;  4A3F H;  1F2Z A;  2JK8 A;  4H02 A;  1JJC B;  1PYW D;  4C3I H;  1V8Q A;  1F9R A;  3Q23 A;  2B2W A;  1WFQ A;  3U58 A;  4B3M Q;  4A3C H;  4CGY B;  4UP9 A;  1XPO A;  2B39 A;  1PFM A;  1GUS A;  4ABN A;  3I4N G;  4Q0F A;  3A7A B;  1WTW A;  2EY6 A;  3KJO A;  1YNJ D;  3HZX A;  1C0A A;  1D5M C;  1PH8 A;  2LXK A;  2O2L D;  1H9S B;  3KFU A;  3KK7 A;  2R93 H;  1D1K A;  3PUX A;  4L8J A;  2IJ0 A;  1CHQ D;  2XGT A;  3M4O H;  1KNE A;  2PZT A;  1EU3 A;  4BBS H;  1HNZ Q;  3C46 A;  4FF3 A;  1X3G A;  2DGY A;  2B2T C;  1WD0 A;  4HED A;  5C0X G;  4MZ9 A;  3D3R A;  4TVA B;  3K57 A;  4LF8 Q;  3GV6 A;  1EY7 A;  4OXP A;  4GOP B;  2M2L A;  1XYI A;  4GN4 B;  2F0M A;  3S1Q B;  3RLO A;  1HZC A;  3D0F A;  4JW0 A;  4YY3 Q;  3L9A X;  4E6I A;  4XIG S;  4DV7 L;  1Q7Y C;  3RZO H;  3HKZ B;  3CCS A;  4HCE A;  4GN3 B;  1EQQ A;  4HIO A;  3GP7 A;  3NQI A;  5T1I A;  3SXH A;  3PIP A;  4JG2 A;  4QUC A;  1K0S A;  3W2D A;  3DWQ A;  3M9B A;  3F2C A;  2OQK A;  2IT1 A;  3PIO 3;  2CWA A;  1EWI A;  1SYG A;  4B3S Q;  4RGO S;  4B3M L;  2R7Z H;  3VR2 A;  2QDL A;  2F0Q A;  4LAA A;  1R4Q B;  3U9S A;  5IP9 H;  2SOB A;  2F0E A;  2NTS A;  1HTL D;  3OIQ A;  3HOV B;  2ES2 A;  4GLX A;  1OXV A;  3Q24 A;  1GOZ A;  3STB D;  4L5R C;  2EXZ A;  4O1N A;  4UDU C;  3T53 B;  2EJM A;  2P5Z X;  1TWG B;  3X3M A;  4HIM A;  4K5V A;  3TME A;  4A3G B;  2X69 A;  1LTA D;  2ZT9 C;  1JWU D;  3CME A;  3IFD A;  1G6P A;  5D3I B;  1HNZ L;  3SDZ A;  4K8J A;  5JJZ A;  1Z6H A;  4P2C B;  2KCN A;  2CQO A;  4K6L A;  1A2U A;  1KAW A;  2BCO A;  4G57 A;  2NN6 H;  3J81 j;  1PHJ A;  2FJ2 A;  4LF8 L;  1NUC A;  4A3G G;  2NVQ B;  3E6Z X;  4FNF A;  4BXX H;  4YY3 L;  4KHZ A;  1JIC A;  2QDB A;  3S15 H;  2WV6 D;  4X65 Q;  3GTO H;  4P72 A;  1I4P A;  1L0Y B;  1AE3 A;  3NQT A;  1II3 A;  1A15 A;  1JR0 D;  1VQL A;  5I2X A;  1B70 B;  2CWP A;  1L1O A;  4DXG A;  1UE7 A;  3S2D B;  2JA8 H;  4B9X A;  4FO2 A;  1X6O A;  3OOC A;  5C0X J;  1CFM A;  3SK4 A;  4B3S L;  4BWG B;  2F1M A;  1SRO A;  1C4Q A;  1PRT C;  1S72 A;  5HUR A;  2RDG A;  4UAI A;  1CKN A;  2R7D A;  4KKU A;  5GQO A;  2AQ2 B;  3ITP A;  2Z6K C;  1O7I A;  4L6T B;  4FXK C;  4XYO A;  1D6E C;  1EIF A;  4HSP A;  1JOQ A;  2SNS A;  4X64 Q;  1RIP A;  3GO5 A;  4O2D A;  1VQN A;  1AW7 A;  2NTT A;  1VQ4 A;  5IP7 H;  3OPO A;  4UP7 A;  1EWC A;  1Y1W H;  2Y0S E;  2B8F A;  1PYB A;  2OXP A;  1CA5 A;  1VQ6 A;  1ET9 A;  2F0U A;  4NPS A;  1LYL A;  3D4D A;  3QJY A;  3BYT B;  1RTN A;  4QF4 A;  2D5D A;  4P74 A;  4QL5 A;  3S2H H;  4HSV A;  5I6Y A;  5LHY 1;  3K0Y A;  4ZRZ A;  2JEB I;  2MO0 A;  5FLX E;  2NZH A;  4DAY A;  1N34 Q;  4JOI A;  5K5P A;  4OGQ C;  1NE3 A;  3PO2 B;  2ZTD A;  1CTM A;  1VQM A;  1Z7T A;  3S16 B;  3F1Z A;  1KAA A;  2HHH Q;  2O5J C;  1WOC A;  3K5M A;  1WTR A;  1CI3 M;  2K7V A;  4R4C A;  1K8A C;  4OIJ A;  1IXR A;  2VS1 A;  1K8M A;  4QJF A;  4RKL A;  1C7Y A;  4R4Q A;  1A63 A;  1A62 A;  1IYJ B;  1A3V A;  3CAM A;  1XPU A;  1L0X B;  1M4V A;  5LL6 S;  1EUJ A;  2HUG A;  4GKK Q;  5EPL A;  2AQ1 B;  3S17 B;  3PGZ A;  5C44 B;  2VUM H;  1O7Z A;  1LTB D;  4UPA A;  3MEF A;  2TSS A;  3MFY A;  4OX9 Q;  1L1O B;  4X64 L;  2KOL A;  5I9O A;  1RKN A;  3ERS X;  1G91 A;  3OIP A;  3A8K E;  5C44 G;  3H94 A;  1SFO B;  4B3R L;  2OEO A;  1B9M A;  3MXN A;  4DV1 Q;  1PFS A;  2HD3 A;  2F3I A;  4PZ7 A;  5DAU A;  1CKN B;  4A93 B;  3J81 i;  1K83 B;  4NB3 A;  1Q1B A;  2MO1 A;  3S1M B;  3AMU A;  1PRT F;  4DV4 Q;  4DA2 A;  3GTG B;  3J80 L;  2ZXP A;  1N34 L;  5M5X H;  1YIJ A;  3LGJ A;  3PF5 A;  1I5F A;  2QF7 A;  2Z4H A;  4BY7 B;  4DNR B;  1HHV A;  4U67 3;  2QEJ C;  2HHH L;  4LF9 L;  4A93 G;  1LT5 D;  4J15 A;  5M9O A;  3SK8 A;  1U4R A;  2G5D A;  2VL6 A;  4V19 0;  1UUP A;  5KEE A;  3A74 A;  3OTO L;  3FPU B;  3FEW X;  3KLR A;  3RLF A;  1EIH A;  2GA4 B;  2J7Z A;  1A3U A;  4BY7 G;  4ZUJ A;  1PH7 A;  1STB A;  4K8I A;  1N9W A;  4C56 C;  1TS3 A;  2FXQ A;  4DAY B;  1YHA A;  3TS0 A;  4A3L G;  1D8L A;  4GKK L;  2JA5 G;  4P73 A;  5DM6 3;  5M5Y B;  1B9N A;  1LTI D;  1PTO D;  2OF1 A;  1IBK Q;  3MXP A;  4ZLT F;  2SDF A;  4G7O C;  4OX9 L;  4C3J B;  1W2B A;  1YIT A;  2NVX B;  5ELD A;  4A76 A;  1XXG A;  4C2M H;  4XT3 B;  5E4W C;  4BBR G;  4A3M B;  3DEP A;  3AQQ A;  3PMF A;  1HNX Q;  3S9W A;  4B08 A;  4RAU C;  4DV1 L;  4GLV B;  1XNR L;  4QY7 A;  4C3J G;  5IWA Q;  5CBA E;  4A3E B;  1TQO A;  4KJO A;  4MTN A;  3RZD B;  4DV4 L;  1QZG A;  3CP0 A;  4LFC Q;  3D31 A;  3T51 B;  3KF6 A;  3K7A B;  1EYA A;  4KY7 A;  2R6G A;  3PUY A;  1BDO A;  5JJI A;  2JN4 A;  3NTK A;  1VQ9 A;  4A3E G;  2EQS A;  3N6R A;  2F0S A;  1TS5 A;  1UAP A;  4IO9 A;  1H9K A;  1EFI D;  3MXN B;  1RF2 D;  3EVQ A;  2JYO A;  1VF7 A;  1JOR A;  2Q2I A;  5EKI A;  5JJK A;  3JAM c;  2L55 A;  5CV6 A;  3GTK B;  2ZM6 L;  1ESR A;  3QR8 A;  3TQY A;  1MJC A;  3A0J A;  1TR5 A;  1AFP A;  4UY8 C;  4KY5 A;  4Y7N H;  5BR8 Q;  3WOE A;  4KKT A;  3BZK A;  1AP0 A;  1ZEQ X;  5C5M A;  1IBK L;  1SYE A;  2B2Y A;  2NZO A;  5C4X H;  2WP8 J;  2AWO A;  4JI4 Q;  2YU9 H;  3BVZ A;  3M85 A;  1GUG A;  5KND A;  3GTP B;  1LV9 A;  4DF7 A;  4A3K B;  3T1Y L;  3H0G B;  5C0X I;  4L5S A;  1BBW A;  2RA4 A;  1E24 A;  1HNX L;  2F0T A;  5FO8 B;  1C8C A;  2D0O A;  2EYP A;  2Z1C A;  2A6E D;  1STA A;  1VQA A;  1E1T A;  5IWA L;  5HGT A;  1HCZ A;  1STN A;  5HY6 A;  3PF4 A;  3WDN A;  4WJ3 M;  3UDI A;  4DR5 Q;  4HJA A;  3VYR A;  3MXG A;  4A3K G;  5IYC H;  3HOV H;  3H0G G;  2YTX A;  4F8M A;  1DOK A;  4XYQ A;  4OO1 H;  1SMX A;  4LFC L;  1CKM A;  2J4X A;  2FMC A;  3O13 A;  3U9O A;  4Z9C B;  1TWG H;  5A2Q E;  1GO3 E;  5AJ3 L;  3I4M G;  4IUU A;  5D65 A;  1HPC A;  1Y8O B;  4PNY A;  2Q8T A;  5E1F A;  2HDM A;  1BBU A;  4H44 C;  5EBC A;  4AYB E;  2F0V A;  2VB2 X;  3VR6 A;  4DK1 A;  3L7Z C;  4DV5 Q;  4IAL A;  1VQP A;  2B8G A;  1KL9 A;  1B3A A;  4JC0 A;  2EYF A;  5G3L D;  3HP3 A;  1KIX A;  1XNQ Q;  1ZYR D;  3JC6 6;  3KF6 B;  4LNQ A;  5BR8 L;  3M4Y A;  5CV9 A;  2F4V Q;  1PH2 A;  2NVY B;  4JI1 Q;  1XPR A;  2C9O A;  5LMN Q;  1D5X C;  1HQR D;  2IX3 A;  3QOJ A;  5JEA H;  1STE A;  4JI4 L;  1KDC A;  2Z6B A;  2E2I H;  1DON A;  1SN8 A;  3J7A F;  3T56 B;  5C6A A; 
#chains in the Genus database with same CATH homology
 2A6H D;  1FNV A;  2EVB A;  2HDL A;  3K5O A;  1MI2 A;  1SMY C;  4PMB A;  3J81 E;  3VR5 A;  1HA6 A;  3H6M A;  1Y69 U;  4MHE A;  1TII D;  1I6H B;  2ICE C;  2RQX A;  4NDX A;  3EQL C;  3I4L A;  2JA7 B;  2AWN A;  3VA7 A;  1SE3 A;  2ID0 A;  5BN3 A;  2B2V C;  5C3X A;  1O80 A;  3DM1 A;  4XQJ A;  5J22 A;  1I4X A;  3H09 A;  1J8I A;  1KLU D;  2B2W C;  2A74 C;  3HOY B;  4IUN A;  1B44 D;  2OT2 A;  1PMR A;  4ZUI A;  1QIL A;  1SDF A;  2B63 B;  1PZK D;  3N52 A;  3VA5 A;  4A3D B;  1RCV D;  3A8J E;  5IT9 L;  3HOZ B;  1EY5 A;  1NAP A;  5A35 A;  4HN7 A;  1PTO B;  3DXJ C;  3TP8 A;  5DEH A;  1S5B D;  3BDC A;  4FF1 A;  2A73 B;  1TS2 A;  5M5W B;  2KA7 A;  1WTP A;  1PZJ D;  4IQZ A;  2EZV A;  4QB4 A;  5JVH 3;  4H0L C;  1TWH B;  1V1O A;  3D8G A;  1EY9 A;  4K5W A;  4KK7 A;  4IN3 A;  4FF2 A;  2A68 D;  4B9W A;  4KHV A;  5G3L F;  4K5X A;  2CW0 C;  3C1F A;  4GZY C;  1BF4 A;  1DZ1 A;  1J9O A;  2AQ3 B;  4ME5 A;  3V96 A;  3SEB A;  3TN2 A;  1GUW A;  2KHS A;  2F0F A;  3I73 A;  5C4J B;  1ZXT A;  3HOX B;  2EY2 A;  3K5N A;  5JPN C;  4MIU A;  1K8O A;  1TWF B;  5FO9 B;  1HFN A;  1ML0 D;  3WOF A;  4ZKC B;  3TP7 A;  3MFG A;  5CR3 A;  5CV4 A;  1F77 A;  1PZI D;  2A69 C;  1BQQ T;  3FRP B;  2RSO A;  4HAE A;  1X3Q A;  3M7N A;  3M3Y B;  4IFD G;  3BDO A;  2K04 A;  1RJT A;  3BDL A;  2WKD A;  2MJ8 A;  1FGB D;  3NUC A;  4EQP A;  4ILW A;  1H9R A;  3MXU A;  4RA8 A;  4DAP A;  3K5L A;  2O4X A;  2WII B;  1JC7 A;  1R9T B;  1IL8 A;  3I72 A;  1Q1E A;  2L9H A;  3PV0 A;  3HGB A;  4QMG A;  3I3C A;  2L0C A;  1GHK A;  1MSH A;  4PMC A;  2QKI C;  5LL6 X;  1EY6 A;  4OIK A;  3GTQ B;  2WAC A;  2D2C C;  1STH A;  1B1Z A;  1DD2 A;  1F2Y A;  4BA1 I;  2F0J A;  4KN7 C;  1B4O A;  2PPB C;  3DEO A;  1DOM A;  3FPP A;  1HUM A;  2H1E A;  5CYU A;  1SJH D;  2XNA C;  3NE5 B;  1CQV A;  3Q0A A;  2F0L A;  3IL8 A;  3HOU B;  3OW7 A;  1STY A;  1G8Z D;  4A3B B;  1CT1 D;  3BVM A;  2JA6 B;  5E3F A;  4RGT A;  4CKE A;  2K05 A;  2R61 A;  1XTC D;  1YNN C;  1PRT D;  4QCL A;  3K58 A;  2D9U A;  5K36 G;  5F2D A;  3S1R B;  2B2T A;  2B2U C;  4F7X A;  1BUV T;  1Q90 A;  4C1N K;  4WRD A;  4IUV A;  2F0G A;  2SEB D;  1Q8I A;  1S4Z A;  4IFD J;  4M1U B;  2I46 A;  1TWA B;  4R8I A;  3MHB A;  4XXE A;  3GTM B;  4PMW A;  3V2T A;  1D2B A;  1BCP C;  1LTT D;  1B53 A;  3NP8 A;  3CQZ B;  2MP1 A;  5IGD A;  2WIN B;  5C4H A;  1DXM A;  5CV8 A;  3C3L A;  2L1B A;  1ESF A;  1EWH A;  3IFT A;  1WTO A;  4RHS A;  4IUP A;  2DY8 A;  4CJ2 C;  1OXS C;  1M8A A;  2O5I C;  1IKL A;  1FD7 D;  4FVM A;  2SNM A;  4AYB B;  2A5H A;  4L63 B;  4U68 A;  5DNF A;  3J7A V;  1IW7 C;  5I2Y A;  3NTI A;  5KRU A;  4K2L A;  3D4W A;  3CRL C;  5JAV A;  1RTO A;  3LX0 A;  4WOR A;  5KYI A;  1SAP A;  1O7Y A;  1TVX A;  3L3O C;  4TQU S;  1I4Q A;  3C1E A;  3E5S A;  2RVL A;  4NW2 A;  3MWY W;  1D5Z C;  1PDQ A;  1T5E A;  1JWM D;  1OXX K;  3BVG A;  3D4R A;  1SNQ A;  1D1I A;  2K32 A;  1LT4 D;  1RHP A;  3SR1 A;  3I90 A;  1T5X D;  5I6W A;  1DOL A;  1KDA A;  4KMU C;  1OO9 B;  2NB0 A;  1QB5 D;  1LO5 D;  2NUC A;  2H4O A;  1I4R A;  2Z4I A;  1S5C D;  4S3S A;  4RFB A;  2LFN A;  4A3F B;  2CHB D;  1EY4 A;  4C3I B;  1SYB A;  4PQX A;  4KJN A;  4ZYS A;  2JA5 B;  5FLX L;  2L5T A;  4HMJ A;  3H3V C;  1SE4 A;  3DMU A;  1HFG A;  2KEE A;  4C3I G;  4F87 A;  4BBR B;  1Q3L A;  4IUQ A;  5IGC A;  3TZD A;  3KLS A;  2R93 B;  3CU7 A;  2FIN B;  2NYZ D;  4IUR A;  1OXT A;  4BBS B;  1ENF A;  2Z8L A;  2PZU A;  2BE5 C;  4NMZ A;  2AUK A;  1EY0 A;  2F0W A;  5COY A;  1EEF D;  1BR9 A;  3VYS A;  3A56 A;  1EZ6 A;  1Q12 A;  3VR3 A;  3RZO B;  2CVR A;  1JOK A;  1WVL A;  2E76 C;  4MN3 A;  4KI0 A;  4ODG A;  1GUT A;  5C3W A;  2L4N A;  1Z47 A;  2VB3 X;  5C0X H;  2LMC B;  1TKW B;  2XWB B;  3A54 A;  1I6V C;  1PRT B;  2EJG C;  4LK1 C;  1JWS D;  2R7Z B;  3R2I A;  1VF5 C;  2RDH A;  1ZKO A;  4X3T A;  4YIJ A;  3TZU A;  4KTA A;  1RDP D;  3QIA A;  3MAQ A;  4EGV A;  3C2P A;  2EYJ A;  1C48 A;  1EIG A;  3V05 A;  2AUJ D;  3RMH A;  4DFA A;  2I07 B;  1CZW A;  4BA2 I;  1B2T A;  3DWP A;  1TWC B;  2EYH A;  2RDF A;  2F0P A;  2K5D A;  2FFK B;  4H13 C;  3LWU A;  4N9T A;  3IAY A;  3P7J A;  2X6L A;  2CQA A;  1S5E D;  3I4M B;  2WKC A;  2WB1 B;  3X3N A;  1JQY D;  4DNT B;  2EY1 A;  5E4X A;  1ENC A;  5IGG A;  3G7L A;  3S15 B;  1R4P B;  2NN6 G;  3GTO B;  3NHH A;  4DAV A;  1EOT A;  1GUO A;  1U4M A;  2JA8 B;  5EBD A;  3JAM E;  5IGF A;  2BDO A;  1SE2 A;  1AZQ A;  2X6G A;  4G7H C;  1KLG D;  1HTP A;  2IL8 A;  2HCC A;  1G29 1;  2VXW A;  1EYC A;  2IX0 A;  1EL0 A;  5C5L A;  2XRQ D;  1H9J A;  2M9V A;  1SMY D;  4F88 A;  1CHP D;  1U4L A;  4PV1 C;  3MEH A;  4QIW B;  1NR4 A;  1QOH A;  5DM7 3;  4N9P A;  2F0D A;  1STG A;  2C5C A;  4WJW A;  4XDX A;  3VYT A;  2G9D A;  2NWG A;  4HTH A;  1EEI D;  4OHJ A;  3T16 A;  5T1G A;  4G7Z C;  3NK9 A;  1MGS A;  1E2V A;  1QNK A;  3LWE A;  3W3A A;  1W6J A;  2IPK D;  3ERQ A;  5A2Q L;  3Q22 A;  3T4A C;  4RH6 A;  1LAC A;  2IW3 A;  3KBX A;  2VUM B;  5CV5 A;  1SNM A;  2Y0S B;  4G4K A;  5CC4 A;  5IIF A;  1V43 A;  5BN4 A;  1EU4 A;  2F0O A;  2E74 C;  1QJO A;  2NBF A;  4TRD A;  1GHJ A;  4JK1 C;  3OSO A;  4RKB A;  1AZP A;  5KNC A;  1S5D D;  1LTG D;  1SYD A;  4FP5 D;  5M5X B;  3DHQ A;  1AN8 A;  3I70 A;  5JPM C;  5KGU A;  3PIP 3;  4A3I B;  1ENA A;  4ZKB B;  2XVS A;  3MTS A;  1A2T A;  2TMP A;  2CW0 D;  3T13 A;  3J81 L;  4DU9 A;  3CRK C;  1W6K A;  3OWE B;  3UI2 A;  1QG7 A;  5FO7 B;  2ZXR A;  2VNU D;  3NXW A;  2PYK A;  2EJF C;  3GQB A;  4HR7 B;  1IHZ A;  3AB9 A;  4XQQ A;  1HRJ A;  3SHL A;  2N55 A;  3S1N B;  5TSS A;  2B2V A;  3HEJ A;  3SVM A;  1ICW A;  2RBM A;  5JOB A;  2A69 D;  4OL7 A;  3PUZ A;  4DGZ A;  2KEC A;  4KD4 A;  3QB3 A;  3BYY B;  3G6J B;  3P1H A;  5FOB B;  3KUP A;  1CZG A;  2JP1 A;  2DN8 A;  2K6A A;  3A7L A;  3I91 A;  3OHX C;  3OWF A;  3SE0 A;  1VMC A;  1GUN A;  2BA0 A;  2PW5 A;  4TKO B;  1XWE A;  1YNJ C;  3TSS A;  4I65 A;  1A6X A;  1JOO A;  4DK0 A;  1LT3 D;  1JCK B;  4RWS C;  4KKS A;  4RHR A;  3R3O A;  4Y7N B;  3A8I E;  2F0I A;  3FDT A;  1PFN A;  3M7G A;  4QUF A;  5FKA C;  3I8Z A;  5C4X B;  2EYL A;  5FK9 C;  1BNZ A;  1TY2 A;  1DM0 B;  2YU9 B;  1U4P A;  1HUN A;  1HQM C;  1E0B A;  1S5F D;  4RCO A;  3BG3 A;  2F03 A;  1FNW A;  4J6H A;  2F0K A;  1WTQ A;  3NWT A;  3PUV A;  3HS0 C;  5EQ0 A;  1LTR D;  3KLS X;  1H9M A;  1CQF A;  1HA5 A;  3HOW B;  1SJE D;  4HMI A;  1GJX A;  2FHT A;  4ZAI A;  1CK1 A;  1YNN D;  5ELB A;  3CKI B;  1SXT A;  1XX8 A;  2F3W A;  5IGE A;  1SNO A;  3P20 A;  2MGS A;  4OO1 G;  5KNB A;  2D62 A;  2DNC A;  2IWH A;  5EJW A;  5EKK A;  1WD1 A;  2YYZ A;  2PW7 A;  2EYO A;  3GV3 A;  5BN5 A;  1MBY A;  1BCP D;  4JBW A;  3SK5 A;  4IUT A;  3NWS A;  3BZD B;  4DN4 M;  1WTX A;  1VDZ A;  1JE4 A;  5CV7 A;  2E2I B;  4ZQ3 A;  1F9Q A;  1NR2 A;  1RD9 D;  1BXT A;  2KJX A;  1F2M A;  3FVQ A;  4RGM A;  5J1Z A;  5JEA G;  2Q8R E;  3ZYY X;  4FXD A;  2NVT B;  1VCI A;  2PCF B;  4IZ8 A;  4R8N A;  2NN6 I;  1SNC A;  3NBH A;  4NP5 A;  3J7Y W;  1IW7 D;  2E2H B;  4A3J B;  3EA6 A;  5ELF A;  1A3T A;  4WFN 3;  3HG9 A;  1QWY A;  1EYD A;  2EE1 A;  3VYU A;  3J80 E;  2LKV A;  3S14 B;  4Q5V A;  1G2S A;  4R9W A;  1LTS D;  3VR4 A;  5AFW A;  1UNS A;  1Y8P B;  1AEX A;  4HCS A;  1TU2 B;  4O42 A;  3TDQ A;  1U9R A;  2PNR C;  4J8Q A;  1PLF A;  4J1M A;  5C4Z A;  1OXU A;  4CHT B;  5KYL A;  2DY7 A;  3TP6 A;  4FF4 A;  1TS4 A;  3GTJ B;  2B2U A;  1SBB B;  4I7Z C;  1V1P A;  3MZ5 A;  1SEB D;  3OMG A;  2G9H D;  2HQE A;  1QCB D;  3NPP A;  2JEA I;  2M00 A;  1NSN S;  1FNU A;  1I4H A;  1I50 B;  3MA2 B;  1WCM B;  1PTO H;  1BCP F;  3KF8 A;  1KTK A;  2WAQ B;  3E0J A;  3LNN A;  5JEA J;  2LY7 A;  3URY A;  4TSS A;  4C3H B;  1HXY D;  4BY1 B;  4EQN A;  5EKL A;  3RUZ A;  2E2D C;  2JSO A;  2K28 A;  3ERO A;  4K6D A;  2MHV A;  5C3E B;  1I4G A;  2F4I A;  1ILP A;  2KVM A;  5EPJ A;  1KNA A;  4C1N I;  4C3H G;  2B2Y C;  2BE5 D;  3QO2 A;  3A55 A;  3DUZ A;  3K6O A;  4KY6 A;  2ENB A;  4CJ1 B;  3M4O B;  2XN9 C;  4CBV A;  2L11 A;  1IYU A;  3R2T A;  3QOL A;  1KAB A;  5IOD A;  2R92 B;  3NSW A;  1PXU A;  4NKL A;  1E2W A;  1FR3 A;  4KV6 A;  1EQT A;  1Y1V B;  5ISR A;  1LAB A;  2RKS A;  1ET6 A;  1PTO C;  3EJI A;  2QCP X;  4X3K A;  2K01 A;  1O7L A;  1V1P B;  3MC0 B;  4IFD H;  1X3P A;  1F2L A;  5EPK A;  5IOC A;  2QIL A;  5CMD A;  1FYC A;  1BCP B;  3RD4 A;  1F9S A;  4ZK9 B;  1E2Z A;  2MUY A;  5JVG 3;  1LT6 D;  4X3U A;  2F0N A;  1NCV A;  1VMP A;  3GTL B;  3CHB D;  1EZ8 A;  4KN4 C;  4ID6 A;  2L12 A;  1I3Q B;  2IX1 A;  3AU7 A;  3QG1 A;  4H7B A;  1CM9 A;  4IFD I;  3ND9 A;  2HCI A;  1WTV A;  4K14 A;  3R93 A;  4RCN A;  3ONA B;  5ELE A;  4XQN A;  1KDB A;  2J0T D;  1TY0 A;  2E75 C;  1SNP A;  4FXG C;  2PQE A;  3KBG A;  1SSO A;  5CBE E;  5IGB A;  2EY5 A;  4K2K A;  1LLR D;  2R3Z A;  1UEA B;  1BBX C;  1Y8N B;  5ELC A;  2EDG A;  2KUM A;  2XRS D;  1PFB A;  2K03 A;  2EOT A;  1O78 A;  2A6E C;  2NZ1 D;  1IYV A;  5K36 H;  3PO3 B;  2ZXO A;  5M3M B;  3BS1 A;  1SYF A;  2RSN A;  1GXD C;  2N88 A;  3D6C A;  2K5Q A;  3D6W A;  5IT9 E;  4ULL A;  5J39 A;  3NTH A;  3QWN A;  1G2T A;  3SK6 A;  2V4D A;  1Y1W B;  1PTO F;  4EVO A;  1ILQ A;  2FMM A;  5CGK A;  2LS0 1;  3H91 A;  1EY8 A;  3S2H B;  1CA6 A;  3FKI B;  2XWJ B;  4XTC S;  1ROD A;  2BA1 A;  3EFX D;  2EPB A;  3GD7 A;  4OO1 I;  1ZYR C;  3TBI B;  4CJ0 B;  3OMC A;  2F0H A;  2EYM A;  3IKJ A;  1QE6 A;  2E2J B;  5I4D A;  3P75 A;  1G6Z A;  4DXF A;  4RGN A;  2XIW A;  3HRZ C;  4X3S A;  2KCC A;  5NUC A;  2Q8I B;  1BO0 A;  4KD3 A;  2A6H C;  2KQ3 A;  4XT1 B;  2F3V A;  4V0B A;  3JAM L;  2KED A;  2BOS A;  5I9P A;  3F2U A;  5D14 A;  1EQV A;  1H9S A;  2K5W A;  3MVV A;  4CKB A;  3K59 A;  3FMC A;  5D3D A;  3TP5 A;  3NBI A;  1DYQ A;  5COR A;  2ICI A;  3R8B A;  1ONL A;  1B50 A;  2PMZ B;  5EGT A;  1SYC A;  1MD2 D;  4M8A A;  1SND A;  5M3F B;  1JB3 A;  2DNE A;  1F9P A;  2JE6 I;  4BS9 A;  5KIX A;  2PZW A;  4EQO A;  4FYD A;  1MSG A;  4LJZ C;  3Q6S A;  3DWA A;  2K33 A;  2PO4 A;  4CKC A;  1DJR D;  2JXM B;  1BOS A;  2K1B A;  2XSC A;  3PUW A;  1DCZ A;  2MPM A;  3ND8 A;  2BDN A;  4LMQ D;  1X32 A;  1IKM A;  1TT2 A;  4C2M B;  2A68 C;  3I4N B;  1QNU A;  1F2Z A;  1PYW D;  1V8Q A;  1F9R A;  3Q23 A;  2B2W A;  4CGY B;  2B39 A;  1PFM A;  1GUS A;  4ABN A;  4Q0F A;  3A7A B;  1WTW A;  2EY6 A;  1YNJ D;  3HZX A;  1D5M C;  2O2L D;  1H9S B;  3KK7 A;  1D1K A;  3PUX A;  4L8J A;  2IJ0 A;  1CHQ D;  1KNE A;  2PZT A;  1EU3 A;  3C46 A;  4FF3 A;  2B2T C;  1WD0 A;  4HED A;  5C0X G;  3D3R A;  3K57 A;  3GV6 A;  1EY7 A;  2M2L A;  1XYI A;  2F0M A;  3S1Q B;  3L9A X;  4E6I A;  4XIG S;  3HKZ B;  4HCE A;  3GP7 A;  3NQI A;  5T1I A;  3SXH A;  4QUC A;  3W2D A;  3DWQ A;  2IT1 A;  3PIO 3;  1SYG A;  4RGO S;  3VR2 A;  2F0Q A;  4LAA A;  1R4Q B;  3U9S A;  2SOB A;  2F0E A;  2NTS A;  1HTL D;  3OIQ A;  3HOV B;  1OXV A;  3Q24 A;  1GOZ A;  2EXZ A;  4O1N A;  4UDU C;  3T53 B;  2EJM A;  1TWG B;  3X3M A;  4K5V A;  3TME A;  4A3G B;  2X69 A;  1LTA D;  2ZT9 C;  1JWU D;  3IFD A;  5D3I B;  3SDZ A;  4K8J A;  5JJZ A;  1Z6H A;  4P2C B;  2KCN A;  4K6L A;  1A2U A;  2BCO A;  4G57 A;  2NN6 H;  2FJ2 A;  1NUC A;  2NVQ B;  3E6Z X;  4FNF A;  4KHZ A;  1JIC A;  2QDB A;  2WV6 D;  1I4P A;  1L0Y B;  3NQT A;  1II3 A;  1A15 A;  1JR0 D;  5I2X A;  4DXG A;  3S2D B;  4B9X A;  4FO2 A;  3OOC A;  5C0X J;  1CFM A;  3SK4 A;  4BWG B;  2F1M A;  1C4Q A;  1PRT C;  5HUR A;  2RDG A;  4UAI A;  4KKU A;  2AQ2 B;  3ITP A;  4L6T B;  4XYO A;  4FXK C;  1D6E C;  4HSP A;  1JOQ A;  2SNS A;  3GO5 A;  1AW7 A;  2NTT A;  3OPO A;  1EWC A;  2B8F A;  2OXP A;  1CA5 A;  1ET9 A;  2F0U A;  3D4D A;  3QJY A;  3BYT B;  1RTN A;  4QF4 A;  2D5D A;  4HSV A;  5I6Y A;  5LHY 1;  3K0Y A;  4ZRZ A;  2JEB I;  5FLX E;  4DAY A;  5K5P A;  4OGQ C;  3PO2 B;  1CTM A;  1Z7T A;  3S16 B;  1KAA A;  2O5J C;  3K5M A;  1WTR A;  1CI3 M;  2K7V A;  4OIJ A;  1K8M A;  4RKL A;  1A3V A;  1L0X B;  1M4V A;  5LL6 S;  2HUG A;  5EPL A;  2AQ1 B;  3S17 B;  5C44 B;  1O7Z A;  1LTB D;  2TSS A;  3MFY A;  2KOL A;  5I9O A;  1RKN A;  1G91 A;  3OIP A;  3A8K E;  3H94 A;  1SFO B;  2OEO A;  1B9M A;  3MXN A;  5DAU A;  4A93 B;  1K83 B;  1Q1B A;  3S1M B;  3AMU A;  1PRT F;  4DA2 A;  3GTG B;  3J80 L;  2ZXP A;  2QF7 A;  2Z4H A;  4BY7 B;  4DNR B;  1HHV A;  4U67 3;  2QEJ C;  1LT5 D;  5M9O A;  3SK8 A;  1U4R A;  4V19 0;  1UUP A;  5KEE A;  3FPU B;  3FEW X;  3KLR A;  3RLF A;  1EIH A;  2GA4 B;  2J7Z A;  1A3U A;  4ZUJ A;  1STB A;  4K8I A;  4C56 C;  1TS3 A;  5DM6 3;  5M5Y B;  1B9N A;  1LTI D;  1PTO D;  2OF1 A;  3MXP A;  4ZLT F;  2SDF A;  4G7O C;  4C3J B;  2NVX B;  5ELD A;  1XXG A;  4XT3 B;  5E4W C;  4A3M B;  3DEP A;  3PMF A;  3S9W A;  4B08 A;  4RAU C;  4C3J G;  5CBA E;  4A3E B;  1TQO A;  4KJO A;  3RZD B;  3D31 A;  3T51 B;  3K7A B;  1EYA A;  4KY7 A;  2R6G A;  3PUY A;  1BDO A;  3NTK A;  3N6R A;  2F0S A;  1TS5 A;  1UAP A;  1H9K A;  1EFI D;  1RF2 D;  3EVQ A;  2JYO A;  1VF7 A;  1JOR A;  5EKI A;  2L55 A;  5CV6 A;  3GTK B;  1ESR A;  1TR5 A;  1AFP A;  4KY5 A;  3WOE A;  4KKT A;  1AP0 A;  1ZEQ X;  5C5M A;  1SYE A;  2B2Y A;  2WP8 J;  2AWO A;  3BVZ A;  3M85 A;  1GUG A;  5KND A;  3GTP B;  1LV9 A;  4DF7 A;  4A3K B;  3H0G B;  5C0X I;  2RA4 A;  2F0T A;  5FO8 B;  1C8C A;  2EYP A;  2Z1C A;  2A6E D;  1STA A;  5HGT A;  1HCZ A;  1STN A;  3WDN A;  3VYR A;  3MXG A;  4F8M A;  1DOK A;  4XYQ A;  4OO1 H;  2J4X A;  2FMC A;  3O13 A;  3U9O A;  4Z9C B;  5A2Q E;  4IUU A;  5D65 A;  1HPC A;  1Y8O B;  4PNY A;  2Q8T A;  5E1F A;  2HDM A;  4H44 C;  5EBC A;  2F0V A;  2VB2 X;  3VR6 A;  4DK1 A;  3L7Z C;  4IAL A;  2B8G A;  1B3A A;  2EYF A;  5G3L D;  3HP3 A;  1ZYR D;  3M4Y A;  5CV9 A;  2NVY B;  2C9O A;  1D5X C;  1HQR D;  2IX3 A;  3QOJ A;  5JEA H;  1STE A;  1KDC A;  1DON A;  3J7A F;  3T56 B;  5C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...