3MEHA

Crystal structure of staphylococcal nuclease variant delta+phs i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 128
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mehA00
4K2LA 5C4ZA 2LKVA 5C3WA 4K5XA 1JORA 2EYHA 5C4HA 3OSOA 2F0VA 2KQ3A 4I65A 1KDBA 4QF4A 2WACA 2F0QA 1A3VA 3MZ5A 2OXPA 5CV4A 3SXHA 4EQPA 3V2TA 1EY8A 4KY5A 2KHSA 3NHHA 3NK9A 5CR3A 4K8JA 1EZ6A 1A3UA 2F3WA 3MVVA 4KJOA 4KY6A 1STGA 1STAA 1EY0A 4KV6A 3E5SA 5KGUA 4K5VA 3BDCA 5I9PA 3OWFA 3DMUA 2F0IA 2NUCA 1KAAA 3OMCA 1KDCA 2EY2A 4OL7A 3SHLA 1EYCA 2EYMA 2SNMA 1SNOA 1AEXA 1EYAA 1SYBA 3SR1A 2PW7A 5C5MA 4QMGA 5CV6A 1SYCA 5E1FA 3ITPA 5C3XA 2F0GA 3R3OA 4E6IA 5IGEA 3D8GA 1EYDA 4PNYA 2OEOA 3D4WA 3P75A 1EY4A 4H7BA 3TMEA 2F0FA 4KJNA 3ERQA 2F0TA 2RBMA 3LX0A 3NQTA 5EGTA 5F2DA 2F0NA 3PMFA 4DF7A 2F0JA 4EQOA 5IGFA 5K5PA 2F0SA 2PW5A 1TQOA 3SK8A 4WORA 2RDFA 4ZUJA 5DEHA 4IUNA 1KDAA 1JOQA 3P1HA 2PYKA 5CV9A 1SYDA 4ID6A 3T13A 5CV5A 5IOCA 5J39A 5I6WA 3QOLA 4S3SA 3EJIA 5NUCA 5I6YA 3C1EA 5HURA 5J22A 1SNCA 1F2MA 4KY7A 1EQVA 4R8NA 5DAUA 4EQNA 4KD4A 3HEJA 1ENCA 5EKLA 1STBA 2QDBA 5J1ZA 5IGGA 5IGBA 4ODGA 2EYPA 1JOOA 4ZQ3A 4N9TA 1JOKA 4TRDA 1EY6A 5EKKA 5KIXA 4PMCA 3TP6A 2EYOA 2O4XA 3BDLA 4J6HA 5CV7A 5E3FA 1SYEA 5JAVA 4NP5A 3NUCA 2PQEA 1F2ZA 2PZUA 2ENBA 2F0PA 3D4DA 1STYA 1RKNA 4KHVA 1SNDA 2OF1A 5I9OA 4RKLA 1SNMA 3EVQA 1SNQA 4DFAA 1STNA 5IODA 3SK5A 1U9RA 3MHBA 4MIUA 4WRDA 4K5WA 5JOBA 1TR5A 3DHQA 2F0MA 4HTHA 4K2KA 5IGCA 3TP5A 5KEEA 4K14A 1EY7A 3D6CA 3SK6A 3TP8A 1SNPA 2F0KA 1A3TA 3U9OA 2EYFA 3TP7A 4PMBA 1EY5A 3NXWA 1NSNS 3EROA 2EY1A 1A2UA 1SYFA 1NUCA 2M00A 3HZXA 4G57A 4IALA 4ME5A 4J1MA 3VA5A 5KYIA 2SOBA 2PZTA 5CC4A 2HQEA 2EY5A 4K6DA 4F7XA 3C1FA 3T16A 5CGKA 1II3A 2RKSA 3H6MA 3QB3A 2F0WA 2EY6A 5KYLA 1SYGA 2EYLA 3MXPA 2F0OA 4NDXA 3RUZA 2F3VA 4LAAA 4HMJA 1EY9A 1KABA 2F0UA 4B9XA 3S9WA 3QOJA 5ISRA 3NP8A 4QB4A 4N9PA 1TT2A 4B9WA 1STHA 5HGTA 4YIJA 2EYJA 2EXZA 4DGZA 4RKBA 3SK4A 5IIFA 2F0HA 4K8IA 5IGDA 2PZWA 4KTAA 4DU9A 2F0LA 5KRUA 4KD3A 5M9OA 1EZ8A 4HMIA 1ENAA 4ZUIA 2SNSA 2F0EA 5C5LA 3OMGA 3MEHA 4NMZA 5CV8A 1F2YA 1IHZA 5C6AA 2F0DA 4NKLA 4F8MA 1A2TA 4EVOA 4IZ8A
chains in the Genus database with same CATH superfamily
2I5MX 4AQYQ 4U673 4GKJQ 3KLWA 2OXPA 3KBGA 3UDIA 3QR8A 4DR1L 4GLXA 4LFBL 3BVMA 4DR5L 3KYHC 1YHQA 4LF8L 4DKAC 2MUYA 2G9DA 2F0IA 1K8MA 2EOTA 1I4HA 1GUGA 3CC4A 1KNEA 1AEXA 3CCSA 2WV6D 3GQBA 1WOCA 3I72A 1K73C 2R93B 5E1FA 3ITPA 3U50C 3R3OA 4HEDA 3OHXC 3P75A 4XTCS 1EY4A 2HT1A 4DV3L 2ZJRA 3LNNA 5IT9E 1XPRA 3NWSA 3W3AA 2KEEA 1SE8A 5FOBB 1JOQA 1VQGA 2D9UA 5CV9A 3A5ZB 3PO2B 3A7AB 1F77A 3GP7A 1T5EA 1SBBB 4S3SA 2UXBL 3VR6A 1PH1A 1HNZQ 1H9SB 4R4IA 2WIIB 2Y0SE 1UE7A 4LMQD 2ZJPA 2PMZB 4UHVA 3S14H 1HCZA 4PMCA 2EYOA 4L63B 4NPSA 1UUPA 5FO9B 1ML0D 1F2ZA 2EXDA 2BH2A 1SNQA 4MIUA 3VDYA 5EPJA 4KMUC 2F52A 2AKWB 1E2WA 1EY7A 2LY7A 2F0KA 3KF6B 1HA5A 3TP7A 1TWGB 1EQRA 5KNCA 1E24A 3FPUB 2EE1A 4GLVB 3T4AC 4BBSG 4OWTB 3GTPH 4CKBA 5IP9H 1E1TA 1L1OC 1HZCA 4C1NI 4H44C 1VS0A 3MXPA 4K0KL 2R7ZB 4A3EB 4GOPC 1VCIA 2D2CC 4DV2Q 2BH8A 1K9MC 2ZJQA 4ULLA 1KNAA 4LF5L 4CJ1B 1MBYA 3X3MA 1WTXA 2E2JB 3VA7A 1SE2A 5C5LA 1GUSA 3O13A 5JEAJ 2D0OA 1PH4A 2DJFC 2ES2A 4NKLA 1A2TA 1EIGA 1IYJB 4MTKA 3F2BA 4A3KH 1MIUA 4YHHQ 4RGTA 5IT9L 2F0VA 3UE0A 1E0BA 4JI8L 1N32L 1TS5A 2JXMB 3CHBD 4N8X1 4DV0Q 5FLXc 5EQ0A 1GUWA 1H9RA 2Z6BA 1FJGL 3MFYA 5C44G 5ELOA 3ZJYC 2PW7A 1LT4D 3ULJA 5C3XA 3CC7A 3PO3H 2P5ZX 1K0RA 2DGYA 1JT8A 3RZDB 3ND8A 2F0FA 4C3JH 3CCMA 5F2DA 1PH3A 1GOZA 2CH4W 2F4VL 2B8FA 4G7OC 4X3TA 4Q0FA 2PW5A 3J81L 2B63H 2VQEL 4WORA 2BOSA 2PYKA 3I91A 3QOLA 4DAYB 1AE2A 3WOFA 1IBLL 4LFCL 1N9WA 5IY0A 4KD4A 2MJ8A 3E3XA 4C2MB 4A3FG 1KRTA 4HSPA 1XNRL 4C3HH 3E6ZX 2PZUA 1JWMD 2L5TA 2ENBA 4KHVA 3DUZA 4HJ8A 1HFGA 3I4NH 1WFQA 4BY7H 4DV1Q 3S2HB 1QZGA 3BYYB 3SK6A 1KXLA 1SNPA 1O7LA 4EGVA 3GTGB 4QQBX 1AZQA 2QDLA 1XTCD 1OO9B 3H3VC 3ULPA 3HS0C 4UP9A 3MEFA 3VYUA 4IFDI 3LWEA 4GN3B 1KAWA 2AQ3B 3EFXD 3RUZA 2F3VA 4LFAQ 4QIWE 3TS2A 2KCCA 4ZAIA 1H9SA 1HQMC 1E3PA 3L9AX 4O42A 4GS3A 3S24A 1A63A 4FXDA 3W1BA 2B8GA 1T5XD 3GD7A 4IJLA 1ENAA 3UDXA 1PH2A 2WAQG 3R93A 3BVGA 2FXQA 4XDXA 3SE0A 3W1GA 4WJ4A 4V190 3KDFA 4CBVA 3PF5A 4A3MB 1T9HA 1V1QA 1EFWA 5G3LD 3TN2A 3PO3G 3I4MG 1N8RC 1J5EQ 1RTNA 4C3JG 3SXHA 2HHHL 2OQ0A 4CHTB 2L12A 3KF6A 1BCPF 2A6HC 2OTJA 2NVQB 4LW1A 4DV4L 3Q6SA 2B63G 2NVXH 1VQMA 2IL8A 1IL8A 3AU7A 3GTOB 1B70B 3BU2A 2Z1CA 1RF2D 3SR1A 1SNOA 3CXCA 4A3BH 1BUVT 1N33L 2CH4A 3VYTA 1PFBA 4AYBG 1LO5D 1O7YA 2YU9B 4DA2A 1B3QA 1MD2D 4V0BA 1VQKA 2X6LA 3J80E 3NQTA 5H1SE 1PHJA 5K5PA 3CCQA 1OXVA 3HRZC 4RGOS 1AP0A 5ELFA 2K5NA 1WTOA 1WJJA 3HKZG 2F03A 3HOZH 4PZ8A 2NWGA 5NUCA 4GNXC 5LHY1 2OWOA 4KHZA 1GXDC 4EQNA 1Q7YC 1ENCA 3HOUB 4QUCA 1FYCA 2B29A 1X56A 3K5OA 1AFPA 1N34Q 4J6HA 3F8TA 1ET9A 3RN2A 4X3KA 1TWHH 2F0PA 2OF1A 1STNA 3U9SA 1VQ9A 2VY3A 5KEEA 2AWOA 1EQTA 1CSQA 2EYFA 1GKHA 2L15A 2L9HA 1SE3A 1H9MA 1GHJA 2R93H 4A3IG 5CC4A 2WKCA 4GN4B 3PQIA 5GAGC 3C46A 2JYOA 3TBIB 3H6MA 1W3SA 4R4CA 3ICEA 3STBD 4I7ZC 4NDXA 4JC0A 4OWWB 3DWQA 3FEWX 4LAAA 1C9OA 4B3TQ 3QOJA 2VUMH 3KF8B 1I3QB 4WFN3 2B2YC 3MXUA 3OPOA 2F0HA 4IOCA 1KL9A 1C7YA 4DU9A 1QOHA 2V4DA 4HMIA 4IOAA 1RODA 2F0EA 2X6GA 1UEBA 1D5ZC 1HR0L 3MFGA 1W6JA 1ZYRC 1K3BC 4IZ8A 1Z6HA 4RA8A 3A56A 5C4ZA 1UEAB 2HDLA 2IW3A 4EX5A 3J80L 4XXEA 5C0XH 2CVRA 4X65L 2D62A 2K50A 3D4RA 4PG3A 5FJ8G 3J7AV 1R4QB 5JJLA 2PQAA 1NMFA 1PH8A 4A93H 1PTOF 1Y8OB 2M2LA 5I9PA 5JVG3 3HOZG 4OL7A 4JI6Q 2H5XA 1PRTD 1VF7A 2EJFC 5C5MA 3F2UA 3T1YQ 2JEBI 4HJ7A 2F0GA 3NSWA 4KJNA 3PUVA 2R7ZH 4M1UB 4NXNQ 3Q23A 5DM63 5LMNQ 2WAQE 4BWGB 3MA2B 4Y52H 5D65A 1KQSA 4L5RC 3P1HA 2K52A 3S1MB 4B08A 1JJ2A 1I50B 2E2JH 1QVCA 2LS01 1IKLA 1BOSA 3DM1A 1HR0W 4KN4C 4JK1C 4LUZA 2ZM6Q 1Y1VH 4JV5Q 2PQEA 3ERSX 5FO7B 1LT5D 4DN4M 1LTTD 1SNDA 3DEPA 4MNOA 4DFAA 4OX9L 2VUMG 3VR2A 1G91A 1ET6A 3MC0B 1B2TA 4KHPL 2IX3A 3KLSX 4TSSA 5JPNC 4AYBE 4OXPA 1B3AA 5FK9C 3MXGA 1NSNS 4ME5A 3HZXA 1A15A 1PZID 5KYIA 2WB1G 3CP0A 3C1FA 1II3A 1QNKA 4ILWA 4A75A 3RZDH 4LF6Q 5JJIA 4ZKCB 3A8IE 4A3GG 1KABA 3HKZE 3S16B 2HIVA 2PNHA 4QY7A 4JI0L 1STHA 4CKCA 1LTAD 2KUMA 3T1HL 5IYBH 1WCMB 4A93G 2HCCA 1ZYRD 2I5LX 1GUTA 3SVMA 2L4NA 2JA8H 2JA6G 2DY8A 3M7NA 3UE1A 2FINB 4L5SA 1OXXK 1I94Q 4C2MH 2XNAC 2LKVA 4FP5D 3BZKA 4JI2L 4K5XA 1JORA 1XPOA 3OSOA 2F0QA 5IWAQ 2C35B 1ICFB 4DK3C 3F2DA 1BDOA 4LUOA 1Y8NB 3B6YA 2DN8A 4RMFA 3HOXG 4A3LH 4DK0A 4IUPA 3G7LA 5KGUA 5HGQA 3OWFA 3ZYYX 2B2TC 1L0XB 2OT2A 2R92H 3SHLA 5M3MH 4RGNA 2SNMA 2Z4IA 1VDZA 5IYCH 3KF8A 3VYSA 4JI4L 1VMCA 1JC7A 4OO1I 1Y1VG 4FXKC 1CA6A 3GTJB 2UU9Q 2JA7H 2UXCQ 3LX0A 2Y0SG 3M9BA 1F2LA 1QUQA 4PMWA 4EQOA 5D3IB 2D0PA 3S17B 4A4IA 3RLFA 2PPBC 4XT3B 3T56B 1VQDA 1YHBA 3M4OB 3WWVA 4PZ7A 4UPAA 1LT3D 1YNNC 3EJIA 5GAHC 3FKIG 2EVBA 1K8AC 3S1QB 3W5OA 5C4XH 3HEJA 4BXXH 1STBA 3RNUA 2EYPA 4A3MH 5EKKA 1GM5A 3AQQA 2UXDL 5CV7A 1ONLA 1HNXQ 2B2WC 1L0WA 4NP5A 5M5WH 3AFQA 2FHTA 5C3EH 5IP7G 3DEOA 1L2FA 1L1OA 3S15B 4DNRB 1LTGD 1NR4A 3DHQA 2F0MA 1ILQA 5EPKA 2VS1A 4GKKL 2E5LL 2JA5G 1BCPC 1M8AA 3H0GB 3U9OA 4GOPA 1L0YB 1TWAB 1NUCA 2A69D 4DV7Q 1PRTB 3FMCA 2JA8G 4RH6A 1Q8KA 2BE5D 4H02A 2ZTEA 4K6DA 1EEID 2A73B 1STEA 3QB3A 2CFMA 3V05A 4YWKA 1SFOB 1Y1WG 1JB3A 2RHSB 1AE3A 4X6AH 1HPCA 2QW7A 4CKEA 4QB4A 4XIGS 1E2ZA 4P71A 1PZJD 2UUCL 4HIOA 3H94A 1CKNB 1QE6A 4DR6Q 1Y8PB 1TWCB 1BQQT 4HAEA 1JWUD 2L11A 2R92G 4WJWA 2IT1A 1B9NA 5M3MG 1IHZA 1JWSD 4DK1A 3R2TA 2A6EC 2R61A 1F9PA 3ULLA 2KQ3A 1SROA 2QA4A 2JA7G 3CCEA 2VQFQ 2R7FA 3V2TA 1EY8A 2DUDA 3NHHA 1U4RA 4GLAC 4P2CB 4ZYSA 1EY0A 3K7AB 1LTLA 2XVSA 3FDTA 2WB1E 4A3DB 4B3MQ 1PTOH 2IPKD 1YEZA 1EOVA 1QZHA 1G8ZD 5C4XG 1EIFA 4BXXG 4DUYL 2CQAA 1HNWL 4IPDA 4X62L 2ZXOA 2RSOA 5C3EG 3KLRA 1YNND 2LFNA 1I6HH 3HOVB 1RL2A 1SEBD 1I3QH 1SMXA 1X9NA 3GO5A 4FNFA 2M9VA 5I6WA 3CCUA 1X3GA 5DNFA 1JB7A 3M85A 1FNWA 1VQCA 3IL8A 4X66Q 1JOOA 2OQKA 3OTOL 4RFBA 2LXKA 3BDLA 1XMQQ 4EQ5A 1W2BA 1YJWA 3K0YA 2XWBB 3I73A 1QB5D 1W6KA 3J81i 1B7YB 3L2PA 1S5BD 1U5KA 4NB3A 4LF9L 1D8LA 1P8LA 4K2KA 2AHOB 1N36Q 1QWYA 4K14A 2MP1A 1WTRA 1BNZA 3M3YH 4KI0A 4PMBA 1DOLA 1VQJA 1PTOC 3PGZA 1Z7TA 5IT9c 4J1MA 5ELEA 5AJ3L 4JG2A 4F7XA 4KK7A 5JJZA 1KLGD 1XPUA 4LJZC 2I46A 3CW2C 2Z4HA 2RVLA 4YY3Q 2F0OA 3I3CA 4DV1L 4BY1H 4JI3Q 3TSSA 4IUUA 4Y7NB 1LV9A 4UDUC 3KDFB 4B9WA 1JQYD 5M3FH 1XNQL 1VQLA 2I5HA 1MHWC 2PZWA 1MGSA 3J81E 3TS0A 1CQVA 3F1ZA 3PUXA 4OEMB 3S1MH 3J7ZC 3GTLB 1I50H 2B2VC 3EBEA 1DXMA 1I4QA 3IFDA 3Q0AA 1GHKA 1CQFA 1SMYC 4JI1L 1AW7A 1X3QA 4P72A 3CF5A 2Q2HA 3A7LA 3J81c 1S5FD 1PH9A 2L0CA 4EQPA 1PMRA 2A74C 3H15A 2CHBD 2A8VA 3CPFA 2UUAQ 2YTYA 4CJ0B 1KAAA 5C4JB 3LWUA 4B3RL 3E0EA 2K1BA 4XYOA 4E6IA 1CKNA 4DK6C 4GNXA 1CHQD 2HD3A 1VQ8A 1EFID 3S16H 3M4PA 3NBHB 3VR3A 4DV5L 3CCLA 1YJ9A 3E9IA 1SE4A 1WCMH 4LF7Q 1ESFA 3GTMH 4OELB 1IW7C 4DUZQ 3PUYA 1SR3A 1EL0A 1UAPA 2EQSA 1X3EA 1BBXC 2Y0SB 1LT6D 5BR8L 3CC2A 2K05A 2CKZB 4HJ5A 4A3JH 2ZXPA 1EQQA 1CSPA 3D4DA 4BY1G 1RHPA 1I4PA 2XRSD 3D6WA 4RKLA 5CYUA 3PIP3 2EPBA 3MHBA 2OTLA 1UWVA 1FGBD 1QG7A 2HIXA 2J7ZA 3RLOA 5IGCA 1QVFA 4XQJA 5M3FG 2JE6I 4DR1Q 5LL6S 4IUTA 3JAME 4LFBQ 2KBNA 2E2DC 4DR5Q 3N6RA 4LF8Q 4RCOA 4IALA 3BG3A 2B2YA 3HOWB 2K5WA 4H13C 1NJIC 1SRUA 5EAYA 5CGKA 5IP9G 3OOCA 5KNBA 1RDPD 5LL6X 2EYLA 4IFDH 2KENA 1R9TB 1BXTA 4B9XA 3NP8A 4FF2A 1EEFD 1GUNA 4DV3Q 4B3SL 3V96A 2QEJC 1GO3E 2XSCA 1LUZA 3M4OH 3H3VI 2B39A 1DZ1A 1SMYD 4XYQA 1TY0A 3HGBA 1F2YA 2RHQB 2UXBQ 3TRZA 2PQAB 3ER0A 1HZ9A 4TVAB 3RLNA 3CD6A 3U4ZA 3I7FA 4UP8A 3H09A 1K8OA 3I2ZA 3KK7A 5IYDH 4A3KG 3FRPB 1BVSA 1YHAA 5KNDA 2ATWA 3MVVA 3K5LA 3OW7A 4KY6A 3S15H 3M7GA 1FR3A 1DYQA 3HKSA 2A5HA 4X64Q 4P73A 3J80i 2NTSA 1O80A 5EKIA 4YWMA 3D4WA 3CCVA 4JYAL 5E7NA 2FMCA 3E9HA 5EGTA 2F0NA 4A3JG 3D3RA 3A55A 1ASZA 1X55A 1SLJA 1XXGA 4R9WA 2K01A 3UI2A 4K0KQ 2FJ2A 3JAML 1VQPA 1WTPA 1TWCH 3BVZA 5IOCA 1D1IA 1Q46A 4LF5Q 5J22A 1UE6A 1HHVA 1JR0D 4C3IB 2UUBL 3HOYH 4ALPA 2CQOA 5IGBA 4ODGA 4IO9A 4POFA 5A35A 3Q24A 3LGJA 4BBRH 3A0JA 3MAQA 1B4OA 1WD1A 4C3HG 5FLMH 2NN6I 2EJMA 4GN5A 3I4NG 1HRJA 1NTGA 4OGQC 4R4QA 3K7AH 1E7ZA 4QGUA 4BA2I 4BY7G 4JI8Q 2JJQA 4DR2L 3OW2A 4A3DH 4OIJA 2JP1A 1GD7A 3J80c 1EY5A 4PZ6A 3VYRA 4IUVA 1SJHD 1FJGQ 2PO4A 3NBHA 4XQNA 1B1ZA 1VF5C 4OWXB 3K8AA 1IBML 4YCVA 1F9RA 3R2IA 3HFZB 5IYDG 1TS2A 4QIWB 1HXYD 3HOVH 2EXZA 3TDQA 1D5MC 2IJ0A 3TEHB 5KRUA 1XMOL 1EZ8A 2NVYB 1PXUA 2VQEQ 3RN5A 1M1KC 1LACA 2IX0A 2QILA 1IBLQ 2IHFA 3I55A 2B2TA 3J7YW 3L7ZC 4FF4A 3AB9A 5EBCA 3C2PA 1XNRQ 2EIFA 3E0JA 1TWFB 4IURA 1ZXTA 4LF4L 1J9OA 4NXML 4OIKA 1V1PA 3T51B 3A74A 1EU3A 4BBSB 1DJRD 1QUQB 1OXSC 4KLKA 3PO2H 3QJYA 1EYCA 2EYMA 1A8VA 1SYBA 2YV5A 2EJGC 4CDDC 3U4VA 3HOYG 4A3BG 2SDFA 1K83B 1K28A 2FFKB 2R3ZA 2A6HD 2LMCB 2E76C 1D6EC 4BBRG 3ND9A 1IBKL 3S1NB 1CTMA 3G6JB 2OCEA 1XTDA 1TQOA 4JCVE 2VXWA 2B2WA 4ZLTF 1WTWA 3RZOB 2E75C 4A3CH 2G9HD 4ME3A 1SNCA 1F2MA 1TWGH 1X65A 4N8FA 1L1OB 1CKOA 4DR7L 1BKBA 1ASYA 1Y14B 2XGTA 3QWNA 1VQFA 2JN4A 5JAVA 1OTCA 1EOTA 1LTID 5CORA 4GOPB 2KEDA 5LMUL 4WJ3M 5I2YA 1RKNA 2Z9HA 1EYGA 4A3EH 1M90C 3DM3A 2HHHQ 2O5JC 1O7IA 5BN4A 1HTPA 5C44B 2DY7A 4DV4Q 1MJCA 1K8GA 3NXWA 2M00A 5C4JH 2ALYB 5L37A 1UE1A 4DAVA 1F9QA 2GA4B 2MO0A 2R93G 3A5UA 2JA9A 3MXNA 1O7ZA 5ISRA 3RMHA 4MZ9A 3CRKC 3RR5A 2B2UC 3FP9A 1V8QA 1QNUA 1B53A 1PH7A 3PIPA 4KTAA 5HY6A 2K5HA 4U68A 1RD9D 4RHSA 1X3PA 2I07B 2K5QA 1GJXA 2SNSA 1IKMA 3PO2G 4A3FB 5CV8A 3DLLA 4JI7L 3HP3A 3TREA 2A19A 3OIQA 1A6XA 4QF4A 1G2TA 3IFTA 1CUKA 5C0XG 1B44D 4DR3L 3NK9A 2KECA 1EZ6A 2BA1A 3EA6A 4KV6A 3PUWA 1C8CA 4A3CG 1SDFA 2KCTA 1MJEA 4QMGA 1XX8A 2R7DA 3HOWH 1D2BA 5G3LF 4DV6L 1PH5A 2QF7A 4CJ2C 1SXTA 1AN8A 2RBMA 4OO1H 4FDBA 4JBWA 2C5CA 2R7ZG 1A62A 1NBWA 4A3EG 2WAQB 1SYDA 3S2HH 3R8BA 3CCJA 2NYZD 2A68C 5JEAH 2JQOA 5HURA 4AQYL 1F9SA 1Q86C 3GTGH 4GKJL 3AYHB 3PO3B 3I4MB 1EWIA 4C3JB 2O4XA 1HR0Q 1J8IA 3TZUA 2NBFA 3H91A 1YBYA 2B63B 1DOMA 3EN2A 4X65Q 1LYLA 3GV6A 3SK5A 1PFSA 2V1CC 1IXRA 2NZHA 3TP8A 1DONA 4PQXA 1X6OA 4RHRA 4AYBB 2EY1A 4G57A 1XJVA 1YNJC 2IHEA 1EIYB 5ELCA 1HQRD 3CKIB 4YCWA 3URYA 4QUFA 2AQ1B 2B2VA 1CM9A 5K36H 3CAMA 1RIPA 3HKZB 2NVQH 1HNZL 3PF4A 3K59A 2O5IC 1TXYA 2X69A 5M9OA 3ONAB 4Q5VA 5IYBG 5AFWA 4R4TA 3G4SA 3GTOH 1FNUA 4J15A 4C3IH 4QJFA 1WTVA 4O2DA 3CMAA 2YU9H 1YI2A 5C4HA 1LABA 5CV4A 1ZEQX 3S2DB 5CR3A 4K8JA 4C56C 2K14A 2H1EA 2Q8TA 2N8NA 5D3DA 2NZOA 1UE5A 3TZDA 5M5XB 4A3LG 4GNXB 1S40A 4K5VA 1BBWA 2JK8A 4P75A 3GTKB 4OX9Q 1WI5A 3OMCA 1KDCA 5GAEC 3K58A 2TMPA 4A3IB 5JEAG 4KHPQ 3QO2A 1CFMA 1IYVA 1HUMA 3HOUH 3BS1A 5IYCG 1OXUA 4FF1A 3JC66 4DV2L 3J7A5 1SSOA 3ERQA 2CWPA 2UUAL 3P20A 3KFUA 3NTIA 2A68D 1VQBA 4UP7A 4IUNA 4BA1I 3SGIA 2XN9C 1NMGA 3NENA 3EIVA 2E2HB 3D0FA 1PRTF 3P7JA 5CBAE 2HQLA 4R8NA 5DAUA 3T1HQ 2PMZE 4JPBW 3Q22A 4YHHL 3IRBA 2QEXA 4TRDA 1NCVA 5KIXA 4FYDA 4ZKBB 1SYEA 4A3MG 1PDQA 2BDOA 3CU7A 5C0XJ 1NR2A 1YZ6A 2ID0A 5K36G 1PVOA 4DV0L 4JI2Q 2Q8RE 1H9JA 1TR5A 1TWFH 3HOZB 1YNJD 1QCBD 1C0AA 4BBSH 2EDGA 1SYFA 2BCOA 2N55A 1Q1BA 3F2CA 4HJAA 1KC8C 1LTRD 1K83H 4YWLA 3U58A 2EY6A 4FO2A 4YCUA 5KYLA 1TWHB 3KUPA 2RF4A 2F0UA 4JI4Q 2F3IA 2WFWA 3PCOB 3S1NH 1BCPD 1TT2A 1HTLD 2VB2X 1KRSA 1VQIA 2E2IB 2HUGA 3KJOA 4KKSA 4DXGA 3RZOH 4ZUIA 2Z6KC 1R4PB 2F0DA 4F8MA 2IY5B 1JJCB 1S5DD 5ELNA 4DR4Q 1VQEA 3HOUG 2JSOA 2ZT9C 4A76A 1VQ5A 4JI5Q 2WACA 2VUMB 1BF4A 4KKUA 2Q2TA 2UXDQ 3NTKA 2YYZA 4JBMA 1BBUA 1CK1A 2MFIA 4O1NA 2K6AA 3RD4A 2K5DA 4HIKA 1XWEA 5C44H 1TY2A 2WB1B 4GKKQ 3UDGA 4RWSC 2A6ED 2E5LQ 1EYAA 2AQ2B 4LFAL 4R1JA 1G291 1Y69U 4OHJA 4A3GB 1GVPA 2ASBA 2WKDA 2N78A 1JJGA 2PI2E 1M4VA 3SDZA 2ICIA 2K75A 1BR9A 2F0SA 2AUJD 2QKIC 4A93B 4ZUJA 5DEHA 2RCNA 5J39A 2JA6B 2UUCQ 4X64L 5I6YA 2MPMA 2KOLA 1D7QA 3PSIA 1J6QA 4A3FH 1J5EL 4ZQ3A 1AH9A 1JOKA 1CZGA 4LK1C 3Q8DA 1EU4A 5E3FA 5E4WC 4HCSA 3HOXB 1I6VC 2Z0SA 5I9OA 2G5DA 5M5YB 1U9RA 1LLRD 3JAMi 4HTHA 1B8AA 1KTKA 1HZAA 1WYDA 4P74A 1E2VA 1Q82C 1S3OA 3W2DA 1JMCA 3EROA 2TSSA 1FD7D 2F4IA 1Y1VB 2PZTA 1WTHA 2HQEA 5FLXE 1JICA 1DD2A 2RKSA 2Q8IB 2MGSA 5I4DA 5T1GA 1G51A 4CGYB 3NE5B 1X54A 4L5TA 4DUYQ 4JOIC 1PFNA 4RAUC 1HNWQ 1V43A 2K5VA 1PLFA 3AFPA 3NELA 4KKTA 4X62Q 4CDEC 1C4QA 3FKIB 1PTOD 2RDGA 1B9MA 4DAPA 1HH2P 2B3GA 2VNUD 3H3VH 1N34L 1GUOA 2CWAA 2CCZA 4IPGA 4K2LA 1MSHA 1V1PB 3I4MH 3KOJA 3M4QA 3I70A 4DXFA 3OTOQ 3JAMc 3GTJH 1IZ6A 1VQ7A 2DNCA 3CCRA 2F3WA 1A3UA 4KJOA 2ZXRA 2JA5B 1CHPD 3BZDB 3S17H 3E5SA 1PH6A 1EUJA 1QILA 3PIO3 4HN7A 1FGUA 2NUCA 4HIMA 1V9PA 2JA8B 4LF9Q 3I8ZA 1G2SA 2Z8LA 4APVA 5CV6A 3S1QH 2J0TD 1Y1WB 2J4XA 5ELBA 4B3TL 2OEOA 2NZ1D 4H7BA 5AJ3Q 1H95A 3GTQB 2ICEC 4DF7A 3MTSA 1EWHA 2KHIA 1A0IA 1HZBA 1E1OA 1BCPB 3HG9A 3NPPA 1P16A 2NTTA 2R92B 3I4LA 4BS9A 1MSGA 1NE3A 5M3MB 3K57A 3H0GH 1XNQQ 4HCEA 4HR7B 1WCMG 3EQLC 5I2XA 5FLXL 2Q2IA 5BN5A 1TWAH 5J1ZA 2K4KA 1NAPA 2JA7B 1VQ4A 1KHIA 2H4OA 1NNXA 4XT1B 3G6EA 4JI1Q 1SFOH 2N88A 1STYA 2BDNA 1HJPA 3STBC 3S2DH 5IODA 1SNMA 3EVQA 2NN6H 2EZVA 2E74C 4JI6L 2NVTB 1IW7D 5M5XH 2MNAA 3MXNB 3D6CA 1X32A 3T1YL 3GTKH 4RGMA 3AMUA 5C4XB 4A3IH 1U4LA 1Z9FA 2B2UA 1K0SA 3S1RB 1DCZA 4LUVA 3GV3A 2XIWA 3L0OA 4H0LC 1TVXA 4C1NK 2VW9A 4B3RQ 4L8JA 4NXNL 4PV1C 5M5WB 5C3EB 5D14A 1YITA 1KIXA 4HSVA 5LMNL 3CPWA 2GN5A 3S9WA 1LTBD 5BN3A 4IFDG 4N9PA 4HIDA 1Q8IA 1PYSB 5HGTA 4YIJA 4O0AA 4DGZA 4NW2A 5IGDA 5EJWA 2F0LA 1N32Q 2MO1A 2E2HH 3QIAA 4DV5Q 2ZM6L 4LWCA 1VQOA 4FVMA 1G6ZA 5C6AA 4JV5L 1ENFA 2IWHA 4EVOA 1PRTC 1MI2A 3FVQA 5JPMC 5FJ8H 5FKAC 1U4MA 5EPLA 1PYBA 2L1BA 2KJXA 5BR8Q 4ZK9B 2NB0A 3BJUA 3CQZB 2KHSA 4KY5A 4TQUS 1ICWA 3IAYA 1WTQA 1D5XC 1STGA 2F4VQ 4CDFC 2KCMA 3BDCA 1Q12A 2D5DA 1V1OA 3H0GG 3NWTA 1SYCA 4LF6L 2JEAI 3T53B 1EYDA 1I5FA 4PNYA 4LFCQ 3TMEA 3M4YA 5CMDA 2L55A 1CZWA 3PMFA 1TIID 2N49A 3K5MA 5LMNW 1IL2A 4OONA 2K32A 3QG1A 3SK8A 2K03A 2RDFA 2NN6G 1KDAA 2E2IH 4IJHA 1YIJA 4QL5A 3G48A 1PTOB 2MQHA 4B3SQ 5A2QE 3C1EA 2KCNA 2XRQD 4ABNA 1I94L 3FHWA 2RA4A 4KY7A 1EQVA 2PI2A 4X3UA 4GZYC 1XYIA 5IWAL 2GVBA 1EY6A 1DOKA 4ZRZA 2YTXA 1S72A 1WVLA 4DAYA 1I6HB 1ESRA 4Y7NH 1BO0A 5FLMG 2GVAA 2BA0A 5ELDA 4DNTB 5JJKA 4IQZA 3KLSA 2LSSA 3GTLH 4XQQA 4A3DG 2FMMA 2UU9L 2UXCL 4ZCKA 3NQIA 3DXJC 1SJED 1Z47A 4IN3A 4A3GH 1JCKB 3A8JE 4JBJA 1S5ED 4MN3A 1YNXA 2DNEA 2PNRC 3DWAA 4JYAQ 2EYJA 3SK4A 5IIFA 4LNQA 4K8IA 3HOVG 3M3YB 2JA6H 4RG1A 1FVIA 2QGQA 2ZTCA 3OMGA 4NMZA 3MWYW 1HNXL 2KA7A 3S14B 5C0XI 1PFMA 2UUBQ 3K81C 4BY1B 4MTNA 5GADC 4G4KA 2EYHA 1PA6A 1KDBA 1N33Q 4G7HC 4DPGA 3HOXH 3I4OA 1PYWD 4CDCC 5M3FB 3VR5A 5M5YH 2I0QA 2LXJA 1WD0A 5CBEE 5A2QL 4DV7L 1RTOA 4X3SA 2HCIA 1CI3M 2EY2A 1YVCA 1CT1D 1TKWB 3GDEA 1LM0A 4JW0A 3GTPB 4DR2Q 4MHEA 3I56A 3C3LA 1EWCA 1G6PA 3D8GA 1S4ZA 1VQHA 1VQNA 1VMPA 4DR6L 2F0JA 1S5CD 4IFDJ 1HFNA 1IBMQ 3BZCA 2HDMA 1KLUD 4FF3A 4IPCA 3FKIH 3T13A 5CV5A 3K7UC 2K28A 3CMEA 3J7AF 1PV4A 3PIOA 2QCPX 2K33A 1ZKOA 5EKLA 2QDBA 1XMOQ 5DM73 2N3SA 1C48A 2VQFL 2A69C 3TP6A 3UDFA 4A3KB 1YJNA 5IP7H 1TU2B 2O2LD 2BE5C 3NUCA 1LTSD 1R9TH 2K04A 2K7VA 2JA5H 3BYTB 4WRDA 3A8KE 4K5WA 4B3ML 4DNIA 1MKHA 1TS4A 3TP5A 1E22A 3GTMB 1RJTA 4L6TB 3NBIA 2RDHA 2YTVA 4LF4Q 4NXMQ 4QCLA 1A2UA 5DLQE 2EY5A 2Q2UA 3T16A 1Y1WH 4A3JB 4I7AA 2F0WA 5TSSA 1SYGA 2Z6KA 3GTQH 2DJGC 4HMJA 1EY9A 2RSNA 1CA5A 2CW0C 2XWJB 3OIPA 1DM0B 4RKBA 1O78A 4KN7C 1QVGA 2AMCB 2PCFB 1IBKQ 1OXTA 3D31A 4HJ9A 3K6OA 4X66L 5E4XA 1XMQL 1Q81C 1CKMA 1Q1EA 5COYA 3VR4A 3X3NA 4JVZA 5C3WA 4C3HB 2XTIA 3J81j 4DR7Q 4I65A 1IYUA 3WOEA 1A3VA 3MZ5A 3KBXA 2KVMA 1EIHA 3K80C 3I4NB 1N36L 2IX1A 1HA6A 4BY7B 1NY4A 4AIMA 2WP8J 1STAA 5LMUQ 1H9KA 1FNVA 2R6GA 4TKOB 2NVTH 3DMUA 4M8AA 4FXGC 5GQOA 1DGSA 2A1AA 4DR4L 3FPPA 4JI5L 1HUNA 1K3RA 2VL6A 4YY3L 3S1RH 3I90A 5EBDA 2RCFA 4JI3L 1TS3A 5IGEA 1KD1C 4L5QA 3WDNA 1I4GA 4J8QA 1FL0A 3HOWG 1SAPA 2E8GA 2F0TA 5T1IA 1JE5A 4R8IA 5IGFA 1AZPA 2KHJA 4OO1G 4R4OA 1I4RA 1ILPA 4ID6A 3K5NA 1Q90A 3G71A 3AEVA 2RQXA 5FO8B 1X3FA 3CRLC 1RCVD 4F88A 2VZAA 3KJPA 4UY8C 4JBKA 3OWEB 3PUZA 4AH6A 5IGGA 3NTHA 5J3BA 4N9TA 3SEBA 3A54A 4JI7Q 3N52A 2WINB 1VQAA 2AUKA 3PV0A 4Z9CB 3K0XA 4DAMA 4F87A 3IKJA 3CQZH 1D1KA 1U4PA 5JOBA 1JE4A 4DR3Q 4G7ZC 2NVXB 1VQ6A 1QJOA 1A3TA 5JVH3 4JOIA 1I4XA 4JI0Q 4IPHA 3HOYB 2NVYH 1B50A 1UNSA 4A3BB 3VA5A 3TQYA 1PZKD 2SOBA 4RCNA 2C9OA 4UAIA 5GROA 4BBRB 4POGA 1Q3LA 2CW0D 3DWPA 2ZTDA 3OYYA 1SN8A 4DV6Q 4IUQA 4LF7L 2AWNA 1U0LA 3NEMA 2F1MA 3BDOA 2MHVA 4DUZL 2VB3X 3L3OC 4K6LA 4KD3A 3MEHA 2SEBD 5IE8A 4C3IG
chains in the Genus database with same CATH topology
4U673 2OXPA 3KBGA 3BVMA 2MUYA 2G9DA 2F0IA 1K8MA 2EOTA 1I4HA 1GUGA 1KNEA 1AEXA 2R93B 2WV6D 3GQBA 3I72A 5E1FA 3ITPA 3R3OA 4HEDA 3OHXC 3P75A 4XTCS 1EY4A 3LNNA 5IT9E 3NWSA 3W3AA 2KEEA 5FOBB 1JOQA 2D9UA 5CV9A 3PO2B 3A7AB 1F77A 3GP7A 1T5EA 1SBBB 4S3SA 3VR6A 1H9SB 2WIIB 4LMQD 2PMZB 1HCZA 4PMCA 2EYOA 4L63B 1UUPA 5FO9B 1ML0D 1F2ZA 1SNQA 4MIUA 5EPJA 4KMUC 1E2WA 1EY7A 2LY7A 2F0KA 1HA5A 3TP7A 1TWGB 5KNCA 3FPUB 2EE1A 3T4AC 4CKBA 4C1NI 4H44C 3MXPA 2R7ZB 4A3EB 1VCIA 2D2CC 4ULLA 1KNAA 4CJ1B 1MBYA 3X3MA 1WTXA 2E2JB 3VA7A 1SE2A 5C5LA 1GUSA 3O13A 5JEAJ 4NKLA 1A2TA 1EIGA 4RGTA 5IT9L 2F0VA 1E0BA 1TS5A 2JXMB 3CHBD 5EQ0A 1GUWA 1H9RA 3MFYA 2PW7A 1LT4D 5C3XA 3RZDB 3ND8A 2F0FA 5F2DA 1GOZA 2B8FA 4G7OC 4X3TA 4Q0FA 2PW5A 3J81L 4WORA 2BOSA 2PYKA 3I91A 3QOLA 3WOFA 4KD4A 2MJ8A 4C2MB 4HSPA 3E6ZX 2PZUA 1JWMD 2L5TA 2ENBA 4KHVA 3DUZA 1HFGA 3S2HB 3BYYB 3SK6A 1SNPA 1O7LA 4EGVA 3GTGB 1AZQA 1XTCD 1OO9B 3H3VC 3HS0C 3VYUA 4IFDI 3LWEA 2AQ3B 3EFXD 3RUZA 2F3VA 2KCCA 4ZAIA 1H9SA 1HQMC 3L9AX 4O42A 4FXDA 2B8GA 1T5XD 3GD7A 1ENAA 3R93A 3BVGA 4XDXA 3SE0A 4V190 4CBVA 4A3MB 5G3LD 3TN2A 1RTNA 4C3JG 3SXHA 4CHTB 2L12A 1BCPF 2A6HC 2NVQB 3Q6SA 2IL8A 1IL8A 3AU7A 3GTOB 2Z1CA 1RF2D 3SR1A 1SNOA 1BUVT 3VYTA 1PFBA 1LO5D 1O7YA 2YU9B 4DA2A 1MD2D 4V0BA 2X6LA 3J80E 3NQTA 5K5PA 1OXVA 3HRZC 4RGOS 1AP0A 5ELFA 1WTOA 2F03A 2NWGA 5NUCA 5LHY1 4KHZA 1GXDC 4EQNA 1ENCA 3HOUB 4QUCA 1FYCA 3K5OA 1AFPA 4J6HA 1ET9A 4X3KA 2F0PA 2OF1A 1STNA 3U9SA 5KEEA 2AWOA 1EQTA 2EYFA 2L9HA 1SE3A 1H9MA 1GHJA 5CC4A 2WKCA 3C46A 2JYOA 3TBIB 3H6MA 4I7ZC 4NDXA 3DWQA 3FEWX 4LAAA 3QOJA 1I3QB 4WFN3 2B2YC 3MXUA 3OPOA 2F0HA 4DU9A 1QOHA 2V4DA 4HMIA 1RODA 2F0EA 2X6GA 1D5ZC 3MFGA 1W6JA 1ZYRC 4IZ8A 1Z6HA 4RA8A 3A56A 5C4ZA 1UEAB 2HDLA 2IW3A 3J80L 4XXEA 5C0XH 2CVRA 2D62A 3D4RA 3J7AV 1R4QB 1PTOF 1Y8OB 2M2LA 5I9PA 5JVG3 4OL7A 1PRTD 1VF7A 2EJFC 5C5MA 3F2UA 2JEBI 2F0GA 3NSWA 4KJNA 3PUVA 4M1UB 3Q23A 5DM63 4BWGB 3MA2B 5D65A 3P1HA 3S1MB 4B08A 1I50B 2LS01 1IKLA 1BOSA 3DM1A 4KN4C 4JK1C 2PQEA 5FO7B 1LT5D 4DN4M 1LTTD 1SNDA 3DEPA 4DFAA 1G91A 3VR2A 1ET6A 3MC0B 1B2TA 2IX3A 3KLSX 4TSSA 5JPNC 1B3AA 5FK9C 3MXGA 1NSNS 4ME5A 3HZXA 1A15A 1PZID 5KYIA 3C1FA 1II3A 1QNKA 4ILWA 4ZKCB 3A8IE 1KABA 3S16B 1STHA 4CKCA 1LTAD 2KUMA 1WCMB 2HCCA 1ZYRD 1GUTA 3SVMA 2L4NA 2DY8A 3M7NA 2FINB 1OXXK 2XNAC 2LKVA 4FP5D 4K5XA 1JORA 3OSOA 2F0QA 1BDOA 1Y8NB 2DN8A 4DK0A 4IUPA 3G7LA 5KGUA 3OWFA 3ZYYX 2B2TC 1L0XB 2OT2A 3SHLA 4RGNA 2SNMA 2Z4IA 1VDZA 3KF8A 3VYSA 1VMCA 1JC7A 4OO1I 4FXKC 1CA6A 3GTJB 3LX0A 1F2LA 4PMWA 4EQOA 5D3IB 3S17B 3RLFA 2PPBC 4XT3B 3T56B 3M4OB 1LT3D 1YNNC 3EJIA 2EVBA 3S1QB 3HEJA 1STBA 2EYPA 5EKKA 5CV7A 1ONLA 2B2WC 4NP5A 2FHTA 3DEOA 3S15B 4DNRB 1LTGD 1NR4A 3DHQA 2F0MA 1ILQA 5EPKA 1BCPC 1M8AA 3H0GB 3U9OA 1L0YB 1TWAB 1NUCA 2A69D 1PRTB 3FMCA 4RH6A 2BE5D 4K6DA 1EEID 2A73B 1STEA 3QB3A 3V05A 1SFOB 1JB3A 1HPCA 4CKEA 4QB4A 4XIGS 1E2ZA 1PZJD 3H94A 1QE6A 1Y8PB 1TWCB 1BQQT 4HAEA 1JWUD 2L11A 4WJWA 2IT1A 1B9NA 1IHZA 1JWSD 4DK1A 3R2TA 2A6EC 2R61A 1F9PA 2KQ3A 3V2TA 1EY8A 3NHHA 1U4RA 4P2CB 4ZYSA 1EY0A 3K7AB 2XVSA 3FDTA 4A3DB 1PTOH 2IPKD 1G8ZD 2CQAA 2ZXOA 2RSOA 3KLRA 1YNND 2LFNA 3HOVB 1SEBD 3GO5A 4FNFA 2M9VA 5I6WA 5DNFA 3M85A 1FNWA 3IL8A 1JOOA 4RFBA 3BDLA 3K0YA 2XWBB 3I73A 1QB5D 1W6KA 1S5BD 4K2KA 1QWYA 4K14A 2MP1A 1WTRA 1BNZA 4KI0A 4PMBA 1DOLA 1PTOC 1Z7TA 4J1MA 5ELEA 5JJZA 4KK7A 4F7XA 1KLGD 4LJZC 2I46A 2Z4HA 2RVLA 2F0OA 3I3CA 3TSSA 4IUUA 4Y7NB 1LV9A 4UDUC 4B9WA 1JQYD 2PZWA 1MGSA 3J81E 1CQVA 3PUXA 3GTLB 2B2VC 1DXMA 1I4QA 3IFDA 3Q0AA 1GHKA 1CQFA 1SMYC 1AW7A 1X3QA 3A7LA 1S5FD 2L0CA 4EQPA 1PMRA 2A74C 2CHBD 4CJ0B 1KAAA 5C4JB 3LWUA 2K1BA 4XYOA 4E6IA 1CHQD 1EFID 3VR3A 1SE4A 1ESFA 1IW7C 3PUYA 1EL0A 1UAPA 1BBXC 2Y0SB 1LT6D 2K05A 2ZXPA 3D4DA 1RHPA 1I4PA 2XRSD 3D6WA 4RKLA 5CYUA 3PIP3 2EPBA 3MHBA 1FGBD 1QG7A 2J7ZA 5IGCA 4XQJA 2JE6I 5LL6S 4IUTA 3JAME 2E2DC 3N6RA 4RCOA 4IALA 3BG3A 2B2YA 3HOWB 2K5WA 4H13C 5CGKA 3OOCA 5KNBA 1RDPD 5LL6X 2EYLA 4IFDH 1R9TB 1BXTA 4B9XA 3NP8A 4FF2A 1EEFD 1GUNA 3V96A 2QEJC 2XSCA 2B39A 1DZ1A 1SMYD 4XYQA 1TY0A 3HGBA 1F2YA 3H09A 1K8OA 3KK7A 3FRPB 5KNDA 3MVVA 3K5LA 3OW7A 4KY6A 3M7GA 1FR3A 1DYQA 2A5HA 2NTSA 1O80A 5EKIA 3D4WA 2FMCA 5EGTA 2F0NA 3D3RA 3A55A 1XXGA 4R9WA 2K01A 3UI2A 2FJ2A 3JAML 1WTPA 3BVZA 5IOCA 1D1IA 5J22A 1HHVA 1JR0D 4C3IB 5IGBA 4ODGA 5A35A 3Q24A 3MAQA 1B4OA 1WD1A 4C3HG 2NN6I 2EJMA 1HRJA 4OGQC 4BA2I 4OIJA 2JP1A 1EY5A 3VYRA 4IUVA 1SJHD 2PO4A 3NBHA 4XQNA 1B1ZA 1VF5C 1F9RA 3R2IA 1TS2A 4QIWB 1HXYD 2EXZA 3TDQA 1D5MC 2IJ0A 5KRUA 1EZ8A 2NVYB 1PXUA 1LACA 2IX0A 2QILA 2B2TA 3J7YW 3L7ZC 4FF4A 3AB9A 5EBCA 3C2PA 3E0JA 1TWFB 4IURA 1ZXTA 1J9OA 4OIKA 1V1PA 3T51B 1EU3A 4BBSB 1DJRD 1OXSC 3QJYA 1EYCA 2EYMA 1SYBA 2EJGC 2SDFA 1K83B 2FFKB 2R3ZA 2A6HD 2LMCB 2E76C 1D6EC 3ND9A 3S1NB 1CTMA 3G6JB 1TQOA 2VXWA 2B2WA 4ZLTF 1WTWA 3RZOB 2E75C 2G9HD 1SNCA 1F2MA 3QWNA 5JAVA 1EOTA 1LTID 5CORA 2KEDA 5I2YA 1RKNA 2O5JC 5BN4A 1HTPA 5C44B 2DY7A 3NXWA 2M00A 4DAVA 1F9QA 2GA4B 3MXNA 1O7ZA 5ISRA 3RMHA 3CRKC 2B2UC 1V8QA 1QNUA 1B53A 4KTAA 4U68A 1RD9D 4RHSA 1X3PA 2I07B 2K5QA 1GJXA 2SNSA 1IKMA 4A3FB 5CV8A 3HP3A 3OIQA 1A6XA 4QF4A 1G2TA 3IFTA 5C0XG 1B44D 3NK9A 2KECA 1EZ6A 2BA1A 3EA6A 4KV6A 3PUWA 1C8CA 1SDFA 4QMGA 1XX8A 1D2BA 5G3LF 2QF7A 4CJ2C 1SXTA 1AN8A 2RBMA 4OO1H 4JBWA 2C5CA 2WAQB 1SYDA 3R8BA 2NYZD 2A68C 5JEAH 5HURA 1F9SA 3PO3B 3I4MB 4C3JB 2O4XA 1J8IA 3TZUA 2NBFA 3H91A 2B63B 1DOMA 3SK5A 3GV6A 3TP8A 1DONA 4PQXA 4RHRA 4AYBB 2EY1A 4G57A 1YNJC 5ELCA 1HQRD 3CKIB 3URYA 4QUFA 2AQ1B 2B2VA 1CM9A 5K36H 3HKZB 3K59A 2O5IC 2X69A 5M9OA 3ONAB 4Q5VA 5AFWA 1FNUA 1WTVA 5C4HA 1LABA 5CV4A 1ZEQX 3S2DB 5CR3A 4K8JA 4C56C 2H1EA 2Q8TA 5D3DA 5M5XB 3TZDA 4K5VA 3GTKB 3OMCA 1KDCA 3K58A 2TMPA 4A3IB 5JEAG 3QO2A 1CFMA 1IYVA 1HUMA 3BS1A 1OXUA 4FF1A 1SSOA 3ERQA 3P20A 3NTIA 2A68D 4IUNA 4BA1I 2XN9C 2E2HB 1PRTF 3P7JA 5CBAE 4R8NA 5DAUA 3Q22A 4TRDA 1NCVA 5KIXA 4FYDA 4ZKBB 1SYEA 1PDQA 2BDOA 3CU7A 5C0XJ 1NR2A 2ID0A 5K36G 2Q8RE 1H9JA 1TR5A 3HOZB 1YNJD 1QCBD 2EDGA 1SYFA 2BCOA 2N55A 1Q1BA 1LTRD 2EY6A 4FO2A 5KYLA 1TWHB 3KUPA 2F0UA 1BCPD 1TT2A 1HTLD 2VB2X 2E2IB 2HUGA 4KKSA 4DXGA 4ZUIA 1R4PB 2F0DA 4F8MA 1S5DD 2JSOA 2ZT9C 2WACA 2VUMB 1BF4A 4KKUA 3NTKA 2YYZA 3RD4A 1CK1A 4O1NA 2K6AA 2K5DA 1XWEA 1TY2A 2WB1B 4RWSC 2A6ED 1EYAA 2AQ2B 1G291 1Y69U 4OHJA 4A3GB 2WKDA 1M4VA 3SDZA 2ICIA 1BR9A 2F0SA 2AUJD 2QKIC 4A93B 4ZUJA 5DEHA 5J39A 2JA6B 5I6YA 2MPMA 2KOLA 4ZQ3A 1JOKA 1CZGA 4LK1C 1EU4A 5E3FA 5E4WC 4HCSA 3HOXB 1I6VC 5I9OA 5M5YB 1U9RA 1LLRD 4HTHA 1KTKA 1E2VA 3W2DA 3EROA 2TSSA 1FD7D 2F4IA 1Y1VB 2PZTA 2HQEA 5FLXE 1JICA 1DD2A 2RKSA 2Q8IB 2MGSA 5I4DA 5T1GA 4CGYB 3NE5B 1PFNA 4RAUC 1V43A 1PLFA 4KKTA 1C4QA 3FKIB 1PTOD 2RDGA 1B9MA 4DAPA 2VNUD 1GUOA 4K2LA 1MSHA 1V1PB 3I70A 4DXFA 2DNCA 2F3WA 1A3UA 4KJOA 2ZXRA 2JA5B 1CHPD 3BZDB 3E5SA 1QILA 3PIO3 4HN7A 2NUCA 2JA8B 3I8ZA 1G2SA 2Z8LA 5CV6A 2J0TD 1Y1WB 2J4XA 5ELBA 2OEOA 2NZ1D 4H7BA 3GTQB 2ICEC 4DF7A 3MTSA 1EWHA 1BCPB 3HG9A 3NPPA 2NTTA 2R92B 3I4LA 4BS9A 1MSGA 5M3MB 3K57A 4HCEA 4HR7B 3EQLC 5I2XA 5FLXL 5BN5A 5J1ZA 1NAPA 2JA7B 2H4OA 4XT1B 2N88A 1STYA 2BDNA 5IODA 1SNMA 3EVQA 2NN6H 2EZVA 2E74C 2NVTB 1IW7D 3D6CA 1X32A 4RGMA 3AMUA 5C4XB 1U4LA 2B2UA 3S1RB 1DCZA 3GV3A 2XIWA 4H0LC 1TVXA 4C1NK 4L8JA 4PV1C 5M5WB 5C3EB 5D14A 4HSVA 3S9WA 1LTBD 5BN3A 4IFDG 4N9PA 1Q8IA 5HGTA 4YIJA 4DGZA 4NW2A 5IGDA 5EJWA 2F0LA 3QIAA 4FVMA 1G6ZA 5C6AA 1ENFA 2IWHA 4EVOA 1PRTC 1MI2A 3FVQA 5JPMC 5FKAC 1U4MA 5EPLA 2L1BA 2KJXA 4ZK9B 2NB0A 4TQUS 3CQZB 2KHSA 4KY5A 1ICWA 3IAYA 1WTQA 1D5XC 1STGA 3BDCA 1Q12A 2D5DA 1V1OA 3NWTA 1SYCA 2JEAI 3T53B 1EYDA 4PNYA 3TMEA 3M4YA 5CMDA 2L55A 1CZWA 3PMFA 1TIID 3K5MA 2K32A 3QG1A 3SK8A 2K03A 2RDFA 2NN6G 1KDAA 1PTOB 5A2QE 3C1EA 2KCNA 2XRQD 4ABNA 2RA4A 4KY7A 1EQVA 4X3UA 4GZYC 1XYIA 1EY6A 1DOKA 4ZRZA 1WVLA 4DAYA 1I6HB 1ESRA 1BO0A 2BA0A 5ELDA 4DNTB 4IQZA 3KLSA 4XQQA 2FMMA 3NQIA 3DXJC 1SJED 1Z47A 4IN3A 1JCKB 3A8JE 1S5ED 4MN3A 2DNEA 2PNRC 3DWAA 2EYJA 3SK4A 5IIFA 4K8IA 3M3YB 3OMGA 4NMZA 3MWYW 2KA7A 3S14B 5C0XI 1PFMA 4BY1B 4G4KA 2EYHA 1KDBA 4G7HC 1PYWD 5M3FB 3VR5A 1WD0A 5CBEE 5A2QL 1RTOA 4X3SA 2HCIA 1CI3M 2EY2A 1CT1D 1TKWB 3GTPB 4MHEA 3C3LA 1EWCA 3D8GA 1S4ZA 1VMPA 2F0JA 1S5CD 4IFDJ 1HFNA 2HDMA 1KLUD 4FF3A 3T13A 5CV5A 2K28A 3J7AF 2QCPX 2K33A 1ZKOA 5EKLA 2QDBA 5DM73 1C48A 2A69C 3TP6A 4A3KB 1TU2B 2O2LD 2BE5C 3NUCA 1LTSD 2K04A 2K7VA 3BYTB 4WRDA 3A8KE 4K5WA 1TS4A 3TP5A 3GTMB 1RJTA 4L6TB 3NBIA 2RDHA 4QCLA 1A2UA 2EY5A 3T16A 4A3JB 2F0WA 5TSSA 1SYGA 4HMJA 1EY9A 2RSNA 1CA5A 2CW0C 2XWJB 3OIPA 1DM0B 4RKBA 1O78A 4KN7C 2PCFB 1OXTA 3D31A 3K6OA 5E4XA 1Q1EA 5COYA 3VR4A 3X3NA 5C3WA 4C3HB 4I65A 1IYUA 3WOEA 1A3VA 3MZ5A 3KBXA 2KVMA 1EIHA 3I4NB 1HA6A 2IX1A 4BY7B 2WP8J 1STAA 1H9KA 1FNVA 2R6GA 4TKOB 3DMUA 4M8AA 4FXGC 3FPPA 1HUNA 3I90A 5EBDA 1TS3A 5IGEA 3WDNA 1I4GA 4J8QA 1SAPA 2F0TA 5T1IA 4R8IA 5IGFA 1AZPA 4OO1G 1I4RA 1ILPA 4ID6A 3K5NA 1Q90A 2RQXA 5FO8B 3CRLC 1RCVD 4F88A 3OWEB 3PUZA 5IGGA 3NTHA 4N9TA 3SEBA 3A54A 3N52A 2WINB 2AUKA 3PV0A 4Z9CB 4F87A 3IKJA 1D1KA 1U4PA 5JOBA 1JE4A 4G7ZC 2NVXB 1QJOA 1A3TA 5JVH3 1I4XA 3HOYB 1B50A 1UNSA 4A3BB 3VA5A 1PZKD 2SOBA 4RCNA 2C9OA 4UAIA 4BBRB 1Q3LA 2CW0D 3DWPA 4IUQA 2AWNA 2F1MA 3BDOA 2MHVA 2VB3X 3L3OC 4K6LA 4KD3A 3MEHA 2SEBD 4C3IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  5C4Z A;  2LKV A;  5C3W A;  4K5X A;  1JOR A;  2EYH A;  5C4H A;  3OSO A;  2F0V A;  2KQ3 A;  4I65 A;  1KDB A;  4QF4 A;  2WAC A;  2F0Q A;  1A3V A;  3MZ5 A;  2OXP A;  5CV4 A;  3SXH A;  4EQP A;  3V2T A;  1EY8 A;  4KY5 A;  2KHS A;  3NHH A;  3NK9 A;  5CR3 A;  4K8J A;  1EZ6 A;  1A3U A;  2F3W A;  3MVV A;  4KJO A;  4KY6 A;  1STG A;  1STA A;  1EY0 A;  4KV6 A;  3E5S A;  5KGU A;  4K5V A;  3BDC A;  5I9P A;  3OWF A;  3DMU A;  2F0I A;  2NUC A;  1KAA A;  3OMC A;  1KDC A;  2EY2 A;  4OL7 A;  3SHL A;  1EYC A;  2EYM A;  2SNM A;  1SNO A;  1AEX A;  1EYA A;  1SYB A;  3SR1 A;  2PW7 A;  5C5M A;  4QMG A;  5CV6 A;  1SYC A;  5E1F A;  3ITP A;  5C3X A;  2F0G A;  3R3O A;  4E6I A;  5IGE A;  3D8G A;  1EYD A;  4PNY A;  2OEO A;  3D4W A;  3P75 A;  1EY4 A;  4H7B A;  3TME A;  2F0F A;  4KJN A;  3ERQ A;  2F0T A;  2RBM A;  3LX0 A;  3NQT A;  5EGT A;  5F2D A;  2F0N A;  3PMF A;  4DF7 A;  2F0J A;  4EQO A;  5IGF A;  5K5P A;  2F0S A;  2PW5 A;  1TQO A;  3SK8 A;  4WOR A;  2RDF A;  4ZUJ A;  5DEH A;  4IUN A;  1KDA A;  1JOQ A;  3P1H A;  2PYK A;  5CV9 A;  1SYD A;  4ID6 A;  3T13 A;  5CV5 A;  5IOC A;  5J39 A;  5I6W A;  3QOL A;  4S3S A;  3EJI A;  5NUC A;  5I6Y A;  3C1E A;  5HUR A;  5J22 A;  1SNC A;  1F2M A;  4KY7 A;  1EQV A;  4R8N A;  5DAU A;  4EQN A;  4KD4 A;  3HEJ A;  1ENC A;  5EKL A;  1STB A;  2QDB A;  5J1Z A;  5IGG A;  5IGB A;  4ODG A;  2EYP A;  1JOO A;  4ZQ3 A;  4N9T A;  1JOK A;  4TRD A;  1EY6 A;  5EKK A;  5KIX A;  4PMC A;  3TP6 A;  2EYO A;  2O4X A;  3BDL A;  4J6H A;  5CV7 A;  5E3F A;  1SYE A;  5JAV A;  4NP5 A;  3NUC A;  2PQE A;  1F2Z A;  2PZU A;  2ENB A;  2F0P A;  3D4D A;  1STY A;  1RKN A;  4KHV A;  1SND A;  2OF1 A;  5I9O A;  4RKL A;  1SNM A;  3EVQ A;  1SNQ A;  4DFA A;  1STN A;  5IOD A;  3SK5 A;  1U9R A;  3MHB A;  4MIU A;  4WRD A;  4K5W A;  5JOB A;  1TR5 A;  3DHQ A;  2F0M A;  4HTH A;  4K2K A;  5IGC A;  3TP5 A;  5KEE A;  4K14 A;  1EY7 A;  3D6C A;  3SK6 A;  3TP8 A;  1SNP A;  2F0K A;  1A3T A;  3U9O A;  2EYF A;  3TP7 A;  4PMB A;  1EY5 A;  3NXW A;  1NSN S;  3ERO A;  2EY1 A;  1A2U A;  1SYF A;  1NUC A;  2M00 A;  3HZX A;  4G57 A;  4IAL A;  4ME5 A;  4J1M A;  3VA5 A;  5KYI A;  2SOB A;  2PZT A;  5CC4 A;  2HQE A;  2EY5 A;  4K6D A;  4F7X A;  3C1F A;  3T16 A;  5CGK A;  1II3 A;  2RKS A;  3H6M A;  3QB3 A;  2F0W A;  2EY6 A;  5KYL A;  1SYG A;  2EYL A;  3MXP A;  2F0O A;  4NDX A;  3RUZ A;  2F3V A;  4LAA A;  4HMJ A;  1EY9 A;  1KAB A;  2F0U A;  4B9X A;  3S9W A;  3QOJ A;  5ISR A;  3NP8 A;  4QB4 A;  4N9P A;  1TT2 A;  4B9W A;  1STH A;  5HGT A;  4YIJ A;  2EYJ A;  2EXZ A;  4DGZ A;  4RKB A;  3SK4 A;  5IIF A;  2F0H A;  4K8I A;  5IGD A;  2PZW A;  4KTA A;  4DU9 A;  2F0L A;  5KRU A;  4KD3 A;  5M9O A;  1EZ8 A;  4HMI A;  1ENA A;  4ZUI A;  2SNS A;  2F0E A;  5C5L A;  3OMG A;  3MEH A;  4NMZ A;  5CV8 A;  1F2Y A;  1IHZ A;  5C6A A;  2F0D A;  4NKL A;  4F8M A;  1A2T A;  4EVO A;  4IZ8 A; 
#chains in the Genus database with same CATH topology
 2I5M X;  4AQY Q;  4U67 3;  4GKJ Q;  3KLW A;  2OXP A;  3KBG A;  3UDI A;  3QR8 A;  4DR1 L;  4GLX A;  4LFB L;  3BVM A;  4DR5 L;  3KYH C;  1YHQ A;  4LF8 L;  4DKA C;  2MUY A;  2G9D A;  2F0I A;  1K8M A;  2EOT A;  1I4H A;  1GUG A;  3CC4 A;  1KNE A;  1AEX A;  3CCS A;  2WV6 D;  3GQB A;  1WOC A;  3I72 A;  1K73 C;  2R93 B;  5E1F A;  3ITP A;  3U50 C;  3R3O A;  4HED A;  3OHX C;  3P75 A;  4XTC S;  1EY4 A;  2HT1 A;  4DV3 L;  2ZJR A;  3LNN A;  5IT9 E;  1XPR A;  3NWS A;  3W3A A;  2KEE A;  1SE8 A;  5FOB B;  1JOQ A;  1VQG A;  2D9U A;  5CV9 A;  3A5Z B;  3PO2 B;  3A7A B;  1F77 A;  3GP7 A;  1T5E A;  1SBB B;  4S3S A;  2UXB L;  3VR6 A;  1PH1 A;  1HNZ Q;  1H9S B;  4R4I A;  2WII B;  2Y0S E;  1UE7 A;  4LMQ D;  2ZJP A;  2PMZ B;  4UHV A;  3S14 H;  1HCZ A;  4PMC A;  2EYO A;  4L63 B;  4NPS A;  1UUP A;  5FO9 B;  1ML0 D;  1F2Z A;  2EXD A;  2BH2 A;  1SNQ A;  4MIU A;  3VDY A;  5EPJ A;  4KMU C;  2F52 A;  2AKW B;  1E2W A;  1EY7 A;  2LY7 A;  2F0K A;  3KF6 B;  1HA5 A;  3TP7 A;  1TWG B;  1EQR A;  5KNC A;  1E24 A;  3FPU B;  2EE1 A;  4GLV B;  3T4A C;  4BBS G;  4OWT B;  3GTP H;  4CKB A;  5IP9 H;  1E1T A;  1L1O C;  1HZC A;  4C1N I;  4H44 C;  1VS0 A;  3MXP A;  4K0K L;  2R7Z B;  4A3E B;  4GOP C;  1VCI A;  2D2C C;  4DV2 Q;  2BH8 A;  1K9M C;  2ZJQ A;  4ULL A;  1KNA A;  4LF5 L;  4CJ1 B;  1MBY A;  3X3M A;  1WTX A;  2E2J B;  3VA7 A;  1SE2 A;  5C5L A;  1GUS A;  3O13 A;  5JEA J;  2D0O A;  1PH4 A;  2DJF C;  2ES2 A;  4NKL A;  1A2T A;  1EIG A;  1IYJ B;  4MTK A;  3F2B A;  4A3K H;  1MIU A;  4YHH Q;  4RGT A;  5IT9 L;  2F0V A;  3UE0 A;  1E0B A;  4JI8 L;  1N32 L;  1TS5 A;  2JXM B;  3CHB D;  4N8X 1;  4DV0 Q;  5FLX c;  5EQ0 A;  1GUW A;  1H9R A;  2Z6B A;  1FJG L;  3MFY A;  5C44 G;  5ELO A;  3ZJY C;  2PW7 A;  1LT4 D;  3ULJ A;  5C3X A;  3CC7 A;  3PO3 H;  2P5Z X;  1K0R A;  2DGY A;  1JT8 A;  3RZD B;  3ND8 A;  2F0F A;  4C3J H;  3CCM A;  5F2D A;  1PH3 A;  1GOZ A;  2CH4 W;  2F4V L;  2B8F A;  4G7O C;  4X3T A;  4Q0F A;  2PW5 A;  3J81 L;  2B63 H;  2VQE L;  4WOR A;  2BOS A;  2PYK A;  3I91 A;  3QOL A;  4DAY B;  1AE2 A;  3WOF A;  1IBL L;  4LFC L;  1N9W A;  5IY0 A;  4KD4 A;  2MJ8 A;  3E3X A;  4C2M B;  4A3F G;  1KRT A;  4HSP A;  1XNR L;  4C3H H;  3E6Z X;  2PZU A;  1JWM D;  2L5T A;  2ENB A;  4KHV A;  3DUZ A;  4HJ8 A;  1HFG A;  3I4N H;  1WFQ A;  4BY7 H;  4DV1 Q;  3S2H B;  1QZG A;  3BYY B;  3SK6 A;  1KXL A;  1SNP A;  1O7L A;  4EGV A;  3GTG B;  4QQB X;  1AZQ A;  2QDL A;  1XTC D;  1OO9 B;  3H3V C;  3ULP A;  3HS0 C;  4UP9 A;  3MEF A;  3VYU A;  4IFD I;  3LWE A;  4GN3 B;  1KAW A;  2AQ3 B;  3EFX D;  3RUZ A;  2F3V A;  4LFA Q;  4QIW E;  3TS2 A;  2KCC A;  4ZAI A;  1H9S A;  1HQM C;  1E3P A;  3L9A X;  4O42 A;  4GS3 A;  3S24 A;  1A63 A;  4FXD A;  3W1B A;  2B8G A;  1T5X D;  3GD7 A;  4IJL A;  1ENA A;  3UDX A;  1PH2 A;  2WAQ G;  3R93 A;  3BVG A;  2FXQ A;  4XDX A;  3SE0 A;  3W1G A;  4WJ4 A;  4V19 0;  3KDF A;  4CBV A;  3PF5 A;  4A3M B;  1T9H A;  1V1Q A;  1EFW A;  5G3L D;  3TN2 A;  3PO3 G;  3I4M G;  1N8R C;  1J5E Q;  1RTN A;  4C3J G;  3SXH A;  2HHH L;  2OQ0 A;  4CHT B;  2L12 A;  3KF6 A;  1BCP F;  2A6H C;  2OTJ A;  2NVQ B;  4LW1 A;  4DV4 L;  3Q6S A;  2B63 G;  2NVX H;  1VQM A;  2IL8 A;  1IL8 A;  3AU7 A;  3GTO B;  1B70 B;  3BU2 A;  2Z1C A;  1RF2 D;  3SR1 A;  1SNO A;  3CXC A;  4A3B H;  1BUV T;  1N33 L;  2CH4 A;  3VYT A;  1PFB A;  4AYB G;  1LO5 D;  1O7Y A;  2YU9 B;  4DA2 A;  1B3Q A;  1MD2 D;  4V0B A;  1VQK A;  2X6L A;  3J80 E;  3NQT A;  5H1S E;  1PHJ A;  5K5P A;  3CCQ A;  1OXV A;  3HRZ C;  4RGO S;  1AP0 A;  5ELF A;  2K5N A;  1WTO A;  1WJJ A;  3HKZ G;  2F03 A;  3HOZ H;  4PZ8 A;  2NWG A;  5NUC A;  4GNX C;  5LHY 1;  2OWO A;  4KHZ A;  1GXD C;  4EQN A;  1Q7Y C;  1ENC A;  3HOU B;  4QUC A;  1FYC A;  2B29 A;  1X56 A;  3K5O A;  1AFP A;  1N34 Q;  4J6H A;  3F8T A;  1ET9 A;  3RN2 A;  4X3K A;  1TWH H;  2F0P A;  2OF1 A;  1STN A;  3U9S A;  1VQ9 A;  2VY3 A;  5KEE A;  2AWO A;  1EQT A;  1CSQ A;  2EYF A;  1GKH A;  2L15 A;  2L9H A;  1SE3 A;  1H9M A;  1GHJ A;  2R93 H;  4A3I G;  5CC4 A;  2WKC A;  4GN4 B;  3PQI A;  5GAG C;  3C46 A;  2JYO A;  3TBI B;  3H6M A;  1W3S A;  4R4C A;  3ICE A;  3STB D;  4I7Z C;  4NDX A;  4JC0 A;  4OWW B;  3DWQ A;  3FEW X;  4LAA A;  1C9O A;  4B3T Q;  3QOJ A;  2VUM H;  3KF8 B;  1I3Q B;  4WFN 3;  2B2Y C;  3MXU A;  3OPO A;  2F0H A;  4IOC A;  1KL9 A;  1C7Y A;  4DU9 A;  1QOH A;  2V4D A;  4HMI A;  4IOA A;  1ROD A;  2F0E A;  2X6G A;  1UEB A;  1D5Z C;  1HR0 L;  3MFG A;  1W6J A;  1ZYR C;  1K3B C;  4IZ8 A;  1Z6H A;  4RA8 A;  3A56 A;  5C4Z A;  1UEA B;  2HDL A;  2IW3 A;  4EX5 A;  3J80 L;  4XXE A;  5C0X H;  2CVR A;  4X65 L;  2D62 A;  2K50 A;  3D4R A;  4PG3 A;  5FJ8 G;  3J7A V;  1R4Q B;  5JJL A;  2PQA A;  1NMF A;  1PH8 A;  4A93 H;  1PTO F;  1Y8O B;  2M2L A;  5I9P A;  5JVG 3;  3HOZ G;  4OL7 A;  4JI6 Q;  2H5X A;  1PRT D;  1VF7 A;  2EJF C;  5C5M A;  3F2U A;  3T1Y Q;  2JEB I;  4HJ7 A;  2F0G A;  3NSW A;  4KJN A;  3PUV A;  2R7Z H;  4M1U B;  4NXN Q;  3Q23 A;  5DM6 3;  5LMN Q;  2WAQ E;  4BWG B;  3MA2 B;  4Y52 H;  5D65 A;  1KQS A;  4L5R C;  3P1H A;  2K52 A;  3S1M B;  4B08 A;  1JJ2 A;  1I50 B;  2E2J H;  1QVC A;  2LS0 1;  1IKL A;  1BOS A;  3DM1 A;  1HR0 W;  4KN4 C;  4JK1 C;  4LUZ A;  2ZM6 Q;  1Y1V H;  4JV5 Q;  2PQE A;  3ERS X;  5FO7 B;  1LT5 D;  4DN4 M;  1LTT D;  1SND A;  3DEP A;  4MNO A;  4DFA A;  4OX9 L;  2VUM G;  3VR2 A;  1G91 A;  1ET6 A;  3MC0 B;  1B2T A;  4KHP L;  2IX3 A;  3KLS X;  4TSS A;  5JPN C;  4AYB E;  4OXP A;  1B3A A;  5FK9 C;  3MXG A;  1NSN S;  4ME5 A;  3HZX A;  1A15 A;  1PZI D;  5KYI A;  2WB1 G;  3CP0 A;  3C1F A;  1II3 A;  1QNK A;  4ILW A;  4A75 A;  3RZD H;  4LF6 Q;  5JJI A;  4ZKC B;  3A8I E;  4A3G G;  1KAB A;  3HKZ E;  3S16 B;  2HIV A;  2PNH A;  4QY7 A;  4JI0 L;  1STH A;  4CKC A;  1LTA D;  2KUM A;  3T1H L;  5IYB H;  1WCM B;  4A93 G;  2HCC A;  1ZYR D;  2I5L X;  1GUT A;  3SVM A;  2L4N A;  2JA8 H;  2JA6 G;  2DY8 A;  3M7N A;  3UE1 A;  2FIN B;  4L5S A;  1OXX K;  1I94 Q;  4C2M H;  2XNA C;  2LKV A;  4FP5 D;  3BZK A;  4JI2 L;  4K5X A;  1JOR A;  1XPO A;  3OSO A;  2F0Q A;  5IWA Q;  2C35 B;  1ICF B;  4DK3 C;  3F2D A;  1BDO A;  4LUO A;  1Y8N B;  3B6Y A;  2DN8 A;  4RMF A;  3HOX G;  4A3L H;  4DK0 A;  4IUP A;  3G7L A;  5KGU A;  5HGQ A;  3OWF A;  3ZYY X;  2B2T C;  1L0X B;  2OT2 A;  2R92 H;  3SHL A;  5M3M H;  4RGN A;  2SNM A;  2Z4I A;  1VDZ A;  5IYC H;  3KF8 A;  3VYS A;  4JI4 L;  1VMC A;  1JC7 A;  4OO1 I;  1Y1V G;  4FXK C;  1CA6 A;  3GTJ B;  2UU9 Q;  2JA7 H;  2UXC Q;  3LX0 A;  2Y0S G;  3M9B A;  1F2L A;  1QUQ A;  4PMW A;  4EQO A;  5D3I B;  2D0P A;  3S17 B;  4A4I A;  3RLF A;  2PPB C;  4XT3 B;  3T56 B;  1VQD A;  1YHB A;  3M4O B;  3WWV A;  4PZ7 A;  4UPA A;  1LT3 D;  1YNN C;  3EJI A;  5GAH C;  3FKI G;  2EVB A;  1K8A C;  3S1Q B;  3W5O A;  5C4X H;  3HEJ A;  4BXX H;  1STB A;  3RNU A;  2EYP A;  4A3M H;  5EKK A;  1GM5 A;  3AQQ A;  2UXD L;  5CV7 A;  1ONL A;  1HNX Q;  2B2W C;  1L0W A;  4NP5 A;  5M5W H;  3AFQ A;  2FHT A;  5C3E H;  5IP7 G;  3DEO A;  1L2F A;  1L1O A;  3S15 B;  4DNR B;  1LTG D;  1NR4 A;  3DHQ A;  2F0M A;  1ILQ A;  5EPK A;  2VS1 A;  4GKK L;  2E5L L;  2JA5 G;  1BCP C;  1M8A A;  3H0G B;  3U9O A;  4GOP A;  1L0Y B;  1TWA B;  1NUC A;  2A69 D;  4DV7 Q;  1PRT B;  3FMC A;  2JA8 G;  4RH6 A;  1Q8K A;  2BE5 D;  4H02 A;  2ZTE A;  4K6D A;  1EEI D;  2A73 B;  1STE A;  3QB3 A;  2CFM A;  3V05 A;  4YWK A;  1SFO B;  1Y1W G;  1JB3 A;  2RHS B;  1AE3 A;  4X6A H;  1HPC A;  2QW7 A;  4CKE A;  4QB4 A;  4XIG S;  1E2Z A;  4P71 A;  1PZJ D;  2UUC L;  4HIO A;  3H94 A;  1CKN B;  1QE6 A;  4DR6 Q;  1Y8P B;  1TWC B;  1BQQ T;  4HAE A;  1JWU D;  2L11 A;  2R92 G;  4WJW A;  2IT1 A;  1B9N A;  5M3M G;  1IHZ A;  1JWS D;  4DK1 A;  3R2T A;  2A6E C;  2R61 A;  1F9P A;  3ULL A;  2KQ3 A;  1SRO A;  2QA4 A;  2JA7 G;  3CCE A;  2VQF Q;  2R7F A;  3V2T A;  1EY8 A;  2DUD A;  3NHH A;  1U4R A;  4GLA C;  4P2C B;  4ZYS A;  1EY0 A;  3K7A B;  1LTL A;  2XVS A;  3FDT A;  2WB1 E;  4A3D B;  4B3M Q;  1PTO H;  2IPK D;  1YEZ A;  1EOV A;  1QZH A;  1G8Z D;  5C4X G;  1EIF A;  4BXX G;  4DUY L;  2CQA A;  1HNW L;  4IPD A;  4X62 L;  2ZXO A;  2RSO A;  5C3E G;  3KLR A;  1YNN D;  2LFN A;  1I6H H;  3HOV B;  1RL2 A;  1SEB D;  1I3Q H;  1SMX A;  1X9N A;  3GO5 A;  4FNF A;  2M9V A;  5I6W A;  3CCU A;  1X3G A;  5DNF A;  1JB7 A;  3M85 A;  1FNW A;  1VQC A;  3IL8 A;  4X66 Q;  1JOO A;  2OQK A;  3OTO L;  4RFB A;  2LXK A;  3BDL A;  1XMQ Q;  4EQ5 A;  1W2B A;  1YJW A;  3K0Y A;  2XWB B;  3I73 A;  1QB5 D;  1W6K A;  3J81 i;  1B7Y B;  3L2P A;  1S5B D;  1U5K A;  4NB3 A;  4LF9 L;  1D8L A;  1P8L A;  4K2K A;  2AHO B;  1N36 Q;  1QWY A;  4K14 A;  2MP1 A;  1WTR A;  1BNZ A;  3M3Y H;  4KI0 A;  4PMB A;  1DOL A;  1VQJ A;  1PTO C;  3PGZ A;  1Z7T A;  5IT9 c;  4J1M A;  5ELE A;  5AJ3 L;  4JG2 A;  4F7X A;  4KK7 A;  5JJZ A;  1KLG D;  1XPU A;  4LJZ C;  2I46 A;  3CW2 C;  2Z4H A;  2RVL A;  4YY3 Q;  2F0O A;  3I3C A;  4DV1 L;  4BY1 H;  4JI3 Q;  3TSS A;  4IUU A;  4Y7N B;  1LV9 A;  4UDU C;  3KDF B;  4B9W A;  1JQY D;  5M3F H;  1XNQ L;  1VQL A;  2I5H A;  1MHW C;  2PZW A;  1MGS A;  3J81 E;  3TS0 A;  1CQV A;  3F1Z A;  3PUX A;  4OEM B;  3S1M H;  3J7Z C;  3GTL B;  1I50 H;  2B2V C;  3EBE A;  1DXM A;  1I4Q A;  3IFD A;  3Q0A A;  1GHK A;  1CQF A;  1SMY C;  4JI1 L;  1AW7 A;  1X3Q A;  4P72 A;  3CF5 A;  2Q2H A;  3A7L A;  3J81 c;  1S5F D;  1PH9 A;  2L0C A;  4EQP A;  1PMR A;  2A74 C;  3H15 A;  2CHB D;  2A8V A;  3CPF A;  2UUA Q;  2YTY A;  4CJ0 B;  1KAA A;  5C4J B;  3LWU A;  4B3R L;  3E0E A;  2K1B A;  4XYO A;  4E6I A;  1CKN A;  4DK6 C;  4GNX A;  1CHQ D;  2HD3 A;  1VQ8 A;  1EFI D;  3S16 H;  3M4P A;  3NBH B;  3VR3 A;  4DV5 L;  3CCL A;  1YJ9 A;  3E9I A;  1SE4 A;  1WCM H;  4LF7 Q;  1ESF A;  3GTM H;  4OEL B;  1IW7 C;  4DUZ Q;  3PUY A;  1SR3 A;  1EL0 A;  1UAP A;  2EQS A;  1X3E A;  1BBX C;  2Y0S B;  1LT6 D;  5BR8 L;  3CC2 A;  2K05 A;  2CKZ B;  4HJ5 A;  4A3J H;  2ZXP A;  1EQQ A;  1CSP A;  3D4D A;  4BY1 G;  1RHP A;  1I4P A;  2XRS D;  3D6W A;  4RKL A;  5CYU A;  3PIP 3;  2EPB A;  3MHB A;  2OTL A;  1UWV A;  1FGB D;  1QG7 A;  2HIX A;  2J7Z A;  3RLO A;  5IGC A;  1QVF A;  4XQJ A;  5M3F G;  2JE6 I;  4DR1 Q;  5LL6 S;  4IUT A;  3JAM E;  4LFB Q;  2KBN A;  2E2D C;  4DR5 Q;  3N6R A;  4LF8 Q;  4RCO A;  4IAL A;  3BG3 A;  2B2Y A;  3HOW B;  2K5W A;  4H13 C;  1NJI C;  1SRU A;  5EAY A;  5CGK A;  5IP9 G;  3OOC A;  5KNB A;  1RDP D;  5LL6 X;  2EYL A;  4IFD H;  2KEN A;  1R9T B;  1BXT A;  4B9X A;  3NP8 A;  4FF2 A;  1EEF D;  1GUN A;  4DV3 Q;  4B3S L;  3V96 A;  2QEJ C;  1GO3 E;  2XSC A;  1LUZ A;  3M4O H;  3H3V I;  2B39 A;  1DZ1 A;  1SMY D;  4XYQ A;  1TY0 A;  3HGB A;  1F2Y A;  2RHQ B;  2UXB Q;  3TRZ A;  2PQA B;  3ER0 A;  1HZ9 A;  4TVA B;  3RLN A;  3CD6 A;  3U4Z A;  3I7F A;  4UP8 A;  3H09 A;  1K8O A;  3I2Z A;  3KK7 A;  5IYD H;  4A3K G;  3FRP B;  1BVS A;  1YHA A;  5KND A;  2ATW A;  3MVV A;  3K5L A;  3OW7 A;  4KY6 A;  3S15 H;  3M7G A;  1FR3 A;  1DYQ A;  3HKS A;  2A5H A;  4X64 Q;  4P73 A;  3J80 i;  2NTS A;  1O80 A;  5EKI A;  4YWM A;  3D4W A;  3CCV A;  4JYA L;  5E7N A;  2FMC A;  3E9H A;  5EGT A;  2F0N A;  4A3J G;  3D3R A;  3A55 A;  1ASZ A;  1X55 A;  1SLJ A;  1XXG A;  4R9W A;  2K01 A;  3UI2 A;  4K0K Q;  2FJ2 A;  3JAM L;  1VQP A;  1WTP A;  1TWC H;  3BVZ A;  5IOC A;  1D1I A;  1Q46 A;  4LF5 Q;  5J22 A;  1UE6 A;  1HHV A;  1JR0 D;  4C3I B;  2UUB L;  3HOY H;  4ALP A;  2CQO A;  5IGB A;  4ODG A;  4IO9 A;  4POF A;  5A35 A;  3Q24 A;  3LGJ A;  4BBR H;  3A0J A;  3MAQ A;  1B4O A;  1WD1 A;  4C3H G;  5FLM H;  2NN6 I;  2EJM A;  4GN5 A;  3I4N G;  1HRJ A;  1NTG A;  4OGQ C;  4R4Q A;  3K7A H;  1E7Z A;  4QGU A;  4BA2 I;  4BY7 G;  4JI8 Q;  2JJQ A;  4DR2 L;  3OW2 A;  4A3D H;  4OIJ A;  2JP1 A;  1GD7 A;  3J80 c;  1EY5 A;  4PZ6 A;  3VYR A;  4IUV A;  1SJH D;  1FJG Q;  2PO4 A;  3NBH A;  4XQN A;  1B1Z A;  1VF5 C;  4OWX B;  3K8A A;  1IBM L;  4YCV A;  1F9R A;  3R2I A;  3HFZ B;  5IYD G;  1TS2 A;  4QIW B;  1HXY D;  3HOV H;  2EXZ A;  3TDQ A;  1D5M C;  2IJ0 A;  3TEH B;  5KRU A;  1XMO L;  1EZ8 A;  2NVY B;  1PXU A;  2VQE Q;  3RN5 A;  1M1K C;  1LAC A;  2IX0 A;  2QIL A;  1IBL Q;  2IHF A;  3I55 A;  2B2T A;  3J7Y W;  3L7Z C;  4FF4 A;  3AB9 A;  5EBC A;  3C2P A;  1XNR Q;  2EIF A;  3E0J A;  1TWF B;  4IUR A;  1ZXT A;  4LF4 L;  1J9O A;  4NXM L;  4OIK A;  1V1P A;  3T51 B;  3A74 A;  1EU3 A;  4BBS B;  1DJR D;  1QUQ B;  1OXS C;  4KLK A;  3PO2 H;  3QJY A;  1EYC A;  2EYM A;  1A8V A;  1SYB A;  2YV5 A;  2EJG C;  4CDD C;  3U4V A;  3HOY G;  4A3B G;  2SDF A;  1K83 B;  1K28 A;  2FFK B;  2R3Z A;  2A6H D;  2LMC B;  2E76 C;  1D6E C;  4BBR G;  3ND9 A;  1IBK L;  3S1N B;  1CTM A;  3G6J B;  2OCE A;  1XTD A;  1TQO A;  4JCV E;  2VXW A;  2B2W A;  4ZLT F;  1WTW A;  3RZO B;  2E75 C;  4A3C H;  2G9H D;  4ME3 A;  1SNC A;  1F2M A;  1TWG H;  1X65 A;  4N8F A;  1L1O B;  1CKO A;  4DR7 L;  1BKB A;  1ASY A;  1Y14 B;  2XGT A;  3QWN A;  1VQF A;  2JN4 A;  5JAV A;  1OTC A;  1EOT A;  1LTI D;  5COR A;  4GOP B;  2KED A;  5LMU L;  4WJ3 M;  5I2Y A;  1RKN A;  2Z9H A;  1EYG A;  4A3E H;  1M90 C;  3DM3 A;  2HHH Q;  2O5J C;  1O7I A;  5BN4 A;  1HTP A;  5C44 B;  2DY7 A;  4DV4 Q;  1MJC A;  1K8G A;  3NXW A;  2M00 A;  5C4J H;  2ALY B;  5L37 A;  1UE1 A;  4DAV A;  1F9Q A;  2GA4 B;  2MO0 A;  2R93 G;  3A5U A;  2JA9 A;  3MXN A;  1O7Z A;  5ISR A;  3RMH A;  4MZ9 A;  3CRK C;  3RR5 A;  2B2U C;  3FP9 A;  1V8Q A;  1QNU A;  1B53 A;  1PH7 A;  3PIP A;  4KTA A;  5HY6 A;  2K5H A;  4U68 A;  1RD9 D;  4RHS A;  1X3P A;  2I07 B;  2K5Q A;  1GJX A;  2SNS A;  1IKM A;  3PO2 G;  4A3F B;  5CV8 A;  3DLL A;  4JI7 L;  3HP3 A;  3TRE A;  2A19 A;  3OIQ A;  1A6X A;  4QF4 A;  1G2T A;  3IFT A;  1CUK A;  5C0X G;  1B44 D;  4DR3 L;  3NK9 A;  2KEC A;  1EZ6 A;  2BA1 A;  3EA6 A;  4KV6 A;  3PUW A;  1C8C A;  4A3C G;  1SDF A;  2KCT A;  1MJE A;  4QMG A;  1XX8 A;  2R7D A;  3HOW H;  1D2B A;  5G3L F;  4DV6 L;  1PH5 A;  2QF7 A;  4CJ2 C;  1SXT A;  1AN8 A;  2RBM A;  4OO1 H;  4FDB A;  4JBW A;  2C5C A;  2R7Z G;  1A62 A;  1NBW A;  4A3E G;  2WAQ B;  1SYD A;  3S2H H;  3R8B A;  3CCJ A;  2NYZ D;  2A68 C;  5JEA H;  2JQO A;  5HUR A;  4AQY L;  1F9S A;  1Q86 C;  3GTG H;  4GKJ L;  3AYH B;  3PO3 B;  3I4M B;  1EWI A;  4C3J B;  2O4X A;  1HR0 Q;  1J8I A;  3TZU A;  2NBF A;  3H91 A;  1YBY A;  2B63 B;  1DOM A;  3EN2 A;  4X65 Q;  1LYL A;  3GV6 A;  3SK5 A;  1PFS A;  2V1C C;  1IXR A;  2NZH A;  3TP8 A;  1DON A;  4PQX A;  1X6O A;  4RHR A;  4AYB B;  2EY1 A;  4G57 A;  1XJV A;  1YNJ C;  2IHE A;  1EIY B;  5ELC A;  1HQR D;  3CKI B;  4YCW A;  3URY A;  4QUF A;  2AQ1 B;  2B2V A;  1CM9 A;  5K36 H;  3CAM A;  1RIP A;  3HKZ B;  2NVQ H;  1HNZ L;  3PF4 A;  3K59 A;  2O5I C;  1TXY A;  2X69 A;  5M9O A;  3ONA B;  4Q5V A;  5IYB G;  5AFW A;  4R4T A;  3G4S A;  3GTO H;  1FNU A;  4J15 A;  4C3I H;  4QJF A;  1WTV A;  4O2D A;  3CMA A;  2YU9 H;  1YI2 A;  5C4H A;  1LAB A;  5CV4 A;  1ZEQ X;  3S2D B;  5CR3 A;  4K8J A;  4C56 C;  2K14 A;  2H1E A;  2Q8T A;  2N8N A;  5D3D A;  2NZO A;  1UE5 A;  3TZD A;  5M5X B;  4A3L G;  4GNX B;  1S40 A;  4K5V A;  1BBW A;  2JK8 A;  4P75 A;  3GTK B;  4OX9 Q;  1WI5 A;  3OMC A;  1KDC A;  5GAE C;  3K58 A;  2TMP A;  4A3I B;  5JEA G;  4KHP Q;  3QO2 A;  1CFM A;  1IYV A;  1HUM A;  3HOU H;  3BS1 A;  5IYC G;  1OXU A;  4FF1 A;  3JC6 6;  4DV2 L;  3J7A 5;  1SSO A;  3ERQ A;  2CWP A;  2UUA L;  3P20 A;  3KFU A;  3NTI A;  2A68 D;  1VQB A;  4UP7 A;  4IUN A;  4BA1 I;  3SGI A;  2XN9 C;  1NMG A;  3NEN A;  3EIV A;  2E2H B;  3D0F A;  1PRT F;  3P7J A;  5CBA E;  2HQL A;  4R8N A;  5DAU A;  3T1H Q;  2PMZ E;  4JPB W;  3Q22 A;  4YHH L;  3IRB A;  2QEX A;  4TRD A;  1NCV A;  5KIX A;  4FYD A;  4ZKB B;  1SYE A;  4A3M G;  1PDQ A;  2BDO A;  3CU7 A;  5C0X J;  1NR2 A;  1YZ6 A;  2ID0 A;  5K36 G;  1PVO A;  4DV0 L;  4JI2 Q;  2Q8R E;  1H9J A;  1TR5 A;  1TWF H;  3HOZ B;  1YNJ D;  1QCB D;  1C0A A;  4BBS H;  2EDG A;  1SYF A;  2BCO A;  2N55 A;  1Q1B A;  3F2C A;  4HJA A;  1KC8 C;  1LTR D;  1K83 H;  4YWL A;  3U58 A;  2EY6 A;  4FO2 A;  4YCU A;  5KYL A;  1TWH B;  3KUP A;  2RF4 A;  2F0U A;  4JI4 Q;  2F3I A;  2WFW A;  3PCO B;  3S1N H;  1BCP D;  1TT2 A;  1HTL D;  2VB2 X;  1KRS A;  1VQI A;  2E2I B;  2HUG A;  3KJO A;  4KKS A;  4DXG A;  3RZO H;  4ZUI A;  2Z6K C;  1R4P B;  2F0D A;  4F8M A;  2IY5 B;  1JJC B;  1S5D D;  5ELN A;  4DR4 Q;  1VQE A;  3HOU G;  2JSO A;  2ZT9 C;  4A76 A;  1VQ5 A;  4JI5 Q;  2WAC A;  2VUM B;  1BF4 A;  4KKU A;  2Q2T A;  2UXD Q;  3NTK A;  2YYZ A;  4JBM A;  1BBU A;  1CK1 A;  2MFI A;  4O1N A;  2K6A A;  3RD4 A;  2K5D A;  4HIK A;  1XWE A;  5C44 H;  1TY2 A;  2WB1 B;  4GKK Q;  3UDG A;  4RWS C;  2A6E D;  2E5L Q;  1EYA A;  2AQ2 B;  4LFA L;  4R1J A;  1G29 1;  1Y69 U;  4OHJ A;  4A3G B;  1GVP A;  2ASB A;  2WKD A;  2N78 A;  1JJG A;  2PI2 E;  1M4V A;  3SDZ A;  2ICI A;  2K75 A;  1BR9 A;  2F0S A;  2AUJ D;  2QKI C;  4A93 B;  4ZUJ A;  5DEH A;  2RCN A;  5J39 A;  2JA6 B;  2UUC Q;  4X64 L;  5I6Y A;  2MPM A;  2KOL A;  1D7Q A;  3PSI A;  1J6Q A;  4A3F H;  1J5E L;  4ZQ3 A;  1AH9 A;  1JOK A;  1CZG A;  4LK1 C;  3Q8D A;  1EU4 A;  5E3F A;  5E4W C;  4HCS A;  3HOX B;  1I6V C;  2Z0S A;  5I9O A;  2G5D A;  5M5Y B;  1U9R A;  1LLR D;  3JAM i;  4HTH A;  1B8A A;  1KTK A;  1HZA A;  1WYD A;  4P74 A;  1E2V A;  1Q82 C;  1S3O A;  3W2D A;  1JMC A;  3ERO A;  2TSS A;  1FD7 D;  2F4I A;  1Y1V B;  2PZT A;  1WTH A;  2HQE A;  5FLX E;  1JIC A;  1DD2 A;  2RKS A;  2Q8I B;  2MGS A;  5I4D A;  5T1G A;  1G51 A;  4CGY B;  3NE5 B;  1X54 A;  4L5T A;  4DUY Q;  4JOI C;  1PFN A;  4RAU C;  1HNW Q;  1V43 A;  2K5V A;  1PLF A;  3AFP A;  3NEL A;  4KKT A;  4X62 Q;  4CDE C;  1C4Q A;  3FKI B;  1PTO D;  2RDG A;  1B9M A;  4DAP A;  1HH2 P;  2B3G A;  2VNU D;  3H3V H;  1N34 L;  1GUO A;  2CWA A;  2CCZ A;  4IPG A;  4K2L A;  1MSH A;  1V1P B;  3I4M H;  3KOJ A;  3M4Q A;  3I70 A;  4DXF A;  3OTO Q;  3JAM c;  3GTJ H;  1IZ6 A;  1VQ7 A;  2DNC A;  3CCR A;  2F3W A;  1A3U A;  4KJO A;  2ZXR A;  2JA5 B;  1CHP D;  3BZD B;  3S17 H;  3E5S A;  1PH6 A;  1EUJ A;  1QIL A;  3PIO 3;  4HN7 A;  1FGU A;  2NUC A;  4HIM A;  1V9P A;  2JA8 B;  4LF9 Q;  3I8Z A;  1G2S A;  2Z8L A;  4APV A;  5CV6 A;  3S1Q H;  2J0T D;  1Y1W B;  2J4X A;  5ELB A;  4B3T L;  2OEO A;  2NZ1 D;  4H7B A;  5AJ3 Q;  1H95 A;  3GTQ B;  2ICE C;  4DF7 A;  3MTS A;  1EWH A;  2KHI A;  1A0I A;  1HZB A;  1E1O A;  1BCP B;  3HG9 A;  3NPP A;  1P16 A;  2NTT A;  2R92 B;  3I4L A;  4BS9 A;  1MSG A;  1NE3 A;  5M3M B;  3K57 A;  3H0G H;  1XNQ Q;  4HCE A;  4HR7 B;  1WCM G;  3EQL C;  5I2X A;  5FLX L;  2Q2I A;  5BN5 A;  1TWA H;  5J1Z A;  2K4K A;  1NAP A;  2JA7 B;  1VQ4 A;  1KHI A;  2H4O A;  1NNX A;  4XT1 B;  3G6E A;  4JI1 Q;  1SFO H;  2N88 A;  1STY A;  2BDN A;  1HJP A;  3STB C;  3S2D H;  5IOD A;  1SNM A;  3EVQ A;  2NN6 H;  2EZV A;  2E74 C;  4JI6 L;  2NVT B;  1IW7 D;  5M5X H;  2MNA A;  3MXN B;  3D6C A;  1X32 A;  3T1Y L;  3GTK H;  4RGM A;  3AMU A;  5C4X B;  4A3I H;  1U4L A;  1Z9F A;  2B2U A;  1K0S A;  3S1R B;  1DCZ A;  4LUV A;  3GV3 A;  2XIW A;  3L0O A;  4H0L C;  1TVX A;  4C1N K;  2VW9 A;  4B3R Q;  4L8J A;  4NXN L;  4PV1 C;  5M5W B;  5C3E B;  5D14 A;  1YIT A;  1KIX A;  4HSV A;  5LMN L;  3CPW A;  2GN5 A;  3S9W A;  1LTB D;  5BN3 A;  4IFD G;  4N9P A;  4HID A;  1Q8I A;  1PYS B;  5HGT A;  4YIJ A;  4O0A A;  4DGZ A;  4NW2 A;  5IGD A;  5EJW A;  2F0L A;  1N32 Q;  2MO1 A;  2E2H H;  3QIA A;  4DV5 Q;  2ZM6 L;  4LWC A;  1VQO A;  4FVM A;  1G6Z A;  5C6A A;  4JV5 L;  1ENF A;  2IWH A;  4EVO A;  1PRT C;  1MI2 A;  3FVQ A;  5JPM C;  5FJ8 H;  5FKA C;  1U4M A;  5EPL A;  1PYB A;  2L1B A;  2KJX A;  5BR8 Q;  4ZK9 B;  2NB0 A;  3BJU A;  3CQZ B;  2KHS A;  4KY5 A;  4TQU S;  1ICW A;  3IAY A;  1WTQ A;  1D5X C;  1STG A;  2F4V Q;  4CDF C;  2KCM A;  3BDC A;  1Q12 A;  2D5D A;  1V1O A;  3H0G G;  3NWT A;  1SYC A;  4LF6 L;  2JEA I;  3T53 B;  1EYD A;  1I5F A;  4PNY A;  4LFC Q;  3TME A;  3M4Y A;  5CMD A;  2L55 A;  1CZW A;  3PMF A;  1TII D;  2N49 A;  3K5M A;  5LMN W;  1IL2 A;  4OON A;  2K32 A;  3QG1 A;  3SK8 A;  2K03 A;  2RDF A;  2NN6 G;  1KDA A;  2E2I H;  4IJH A;  1YIJ A;  4QL5 A;  3G48 A;  1PTO B;  2MQH A;  4B3S Q;  5A2Q E;  3C1E A;  2KCN A;  2XRQ D;  4ABN A;  1I94 L;  3FHW A;  2RA4 A;  4KY7 A;  1EQV A;  2PI2 A;  4X3U A;  4GZY C;  1XYI A;  5IWA L;  2GVB A;  1EY6 A;  1DOK A;  4ZRZ A;  2YTX A;  1S72 A;  1WVL A;  4DAY A;  1I6H B;  1ESR A;  4Y7N H;  1BO0 A;  5FLM G;  2GVA A;  2BA0 A;  5ELD A;  4DNT B;  5JJK A;  4IQZ A;  3KLS A;  2LSS A;  3GTL H;  4XQQ A;  4A3D G;  2FMM A;  2UU9 L;  2UXC L;  4ZCK A;  3NQI A;  3DXJ C;  1SJE D;  1Z47 A;  4IN3 A;  4A3G H;  1JCK B;  3A8J E;  4JBJ A;  1S5E D;  4MN3 A;  1YNX A;  2DNE A;  2PNR C;  3DWA A;  4JYA Q;  2EYJ A;  3SK4 A;  5IIF A;  4LNQ A;  4K8I A;  3HOV G;  3M3Y B;  2JA6 H;  4RG1 A;  1FVI A;  2QGQ A;  2ZTC A;  3OMG A;  4NMZ A;  3MWY W;  1HNX L;  2KA7 A;  3S14 B;  5C0X I;  1PFM A;  2UUB Q;  3K81 C;  4BY1 B;  4MTN A;  5GAD C;  4G4K A;  2EYH A;  1PA6 A;  1KDB A;  1N33 Q;  4G7H C;  4DPG A;  3HOX H;  3I4O A;  1PYW D;  4CDC C;  5M3F B;  3VR5 A;  5M5Y H;  2I0Q A;  2LXJ A;  1WD0 A;  5CBE E;  5A2Q L;  4DV7 L;  1RTO A;  4X3S A;  2HCI A;  1CI3 M;  2EY2 A;  1YVC A;  1CT1 D;  1TKW B;  3GDE A;  1LM0 A;  4JW0 A;  3GTP B;  4DR2 Q;  4MHE A;  3I56 A;  3C3L A;  1EWC A;  1G6P A;  3D8G A;  1S4Z A;  1VQH A;  1VQN A;  1VMP A;  4DR6 L;  2F0J A;  1S5C D;  4IFD J;  1HFN A;  1IBM Q;  3BZC A;  2HDM A;  1KLU D;  4FF3 A;  4IPC A;  3FKI H;  3T13 A;  5CV5 A;  3K7U C;  2K28 A;  3CME A;  3J7A F;  1PV4 A;  3PIO A;  2QCP X;  2K33 A;  1ZKO A;  5EKL A;  2QDB A;  1XMO Q;  5DM7 3;  2N3S A;  1C48 A;  2VQF L;  2A69 C;  3TP6 A;  3UDF A;  4A3K B;  1YJN A;  5IP7 H;  1TU2 B;  2O2L D;  2BE5 C;  3NUC A;  1LTS D;  1R9T H;  2K04 A;  2K7V A;  2JA5 H;  3BYT B;  4WRD A;  3A8K E;  4K5W A;  4B3M L;  4DNI A;  1MKH A;  1TS4 A;  3TP5 A;  1E22 A;  3GTM B;  1RJT A;  4L6T B;  3NBI A;  2RDH A;  2YTV A;  4LF4 Q;  4NXM Q;  4QCL A;  1A2U A;  5DLQ E;  2EY5 A;  2Q2U A;  3T16 A;  1Y1W H;  4A3J B;  4I7A A;  2F0W A;  5TSS A;  1SYG A;  2Z6K A;  3GTQ H;  2DJG C;  4HMJ A;  1EY9 A;  2RSN A;  1CA5 A;  2CW0 C;  2XWJ B;  3OIP A;  1DM0 B;  4RKB A;  1O78 A;  4KN7 C;  1QVG A;  2AMC B;  2PCF B;  1IBK Q;  1OXT A;  3D31 A;  4HJ9 A;  3K6O A;  4X66 L;  5E4X A;  1XMQ L;  1Q81 C;  1CKM A;  1Q1E A;  5COY A;  3VR4 A;  3X3N A;  4JVZ A;  5C3W A;  4C3H B;  2XTI A;  3J81 j;  4DR7 Q;  4I65 A;  1IYU A;  3WOE A;  1A3V A;  3MZ5 A;  3KBX A;  2KVM A;  1EIH A;  3K80 C;  3I4N B;  1N36 L;  2IX1 A;  1HA6 A;  4BY7 B;  1NY4 A;  4AIM A;  2WP8 J;  1STA A;  5LMU Q;  1H9K A;  1FNV A;  2R6G A;  4TKO B;  2NVT H;  3DMU A;  4M8A A;  4FXG C;  5GQO A;  1DGS A;  2A1A A;  4DR4 L;  3FPP A;  4JI5 L;  1HUN A;  1K3R A;  2VL6 A;  4YY3 L;  3S1R H;  3I90 A;  5EBD A;  2RCF A;  4JI3 L;  1TS3 A;  5IGE A;  1KD1 C;  4L5Q A;  3WDN A;  1I4G A;  4J8Q A;  1FL0 A;  3HOW G;  1SAP A;  2E8G A;  2F0T A;  5T1I A;  1JE5 A;  4R8I A;  5IGF A;  1AZP A;  2KHJ A;  4OO1 G;  4R4O A;  1I4R A;  1ILP A;  4ID6 A;  3K5N A;  1Q90 A;  3G71 A;  3AEV A;  2RQX A;  5FO8 B;  1X3F A;  3CRL C;  1RCV D;  4F88 A;  2VZA A;  3KJP A;  4UY8 C;  4JBK A;  3OWE B;  3PUZ A;  4AH6 A;  5IGG A;  3NTH A;  5J3B A;  4N9T A;  3SEB A;  3A54 A;  4JI7 Q;  3N52 A;  2WIN B;  1VQA A;  2AUK A;  3PV0 A;  4Z9C B;  3K0X A;  4DAM A;  4F87 A;  3IKJ A;  3CQZ H;  1D1K A;  1U4P A;  5JOB A;  1JE4 A;  4DR3 Q;  4G7Z C;  2NVX B;  1VQ6 A;  1QJO A;  1A3T A;  5JVH 3;  4JOI A;  1I4X A;  4JI0 Q;  4IPH A;  3HOY B;  2NVY H;  1B50 A;  1UNS A;  4A3B B;  3VA5 A;  3TQY A;  1PZK D;  2SOB A;  4RCN A;  2C9O A;  4UAI A;  5GRO A;  4BBR B;  4POG A;  1Q3L A;  2CW0 D;  3DWP A;  2ZTD A;  3OYY A;  1SN8 A;  4DV6 Q;  4IUQ A;  4LF7 L;  2AWN A;  1U0L A;  3NEM A;  2F1M A;  3BDO A;  2MHV A;  4DUZ L;  2VB3 X;  3L3O C;  4K6L A;  4KD3 A;  3MEH A;  2SEB D;  5IE8 A;  4C3I G; 
#chains in the Genus database with same CATH homology
 4U67 3;  2OXP A;  3KBG A;  3BVM A;  2MUY A;  2G9D A;  2F0I A;  1K8M A;  2EOT A;  1I4H A;  1GUG A;  1KNE A;  1AEX A;  2R93 B;  2WV6 D;  3GQB A;  3I72 A;  5E1F A;  3ITP A;  3R3O A;  4HED A;  3OHX C;  3P75 A;  4XTC S;  1EY4 A;  3LNN A;  5IT9 E;  3NWS A;  3W3A A;  2KEE A;  5FOB B;  1JOQ A;  2D9U A;  5CV9 A;  3PO2 B;  3A7A B;  1F77 A;  3GP7 A;  1T5E A;  1SBB B;  4S3S A;  3VR6 A;  1H9S B;  2WII B;  4LMQ D;  2PMZ B;  1HCZ A;  4PMC A;  2EYO A;  4L63 B;  1UUP A;  5FO9 B;  1ML0 D;  1F2Z A;  1SNQ A;  4MIU A;  5EPJ A;  4KMU C;  1E2W A;  1EY7 A;  2LY7 A;  2F0K A;  1HA5 A;  3TP7 A;  1TWG B;  5KNC A;  3FPU B;  2EE1 A;  3T4A C;  4CKB A;  4C1N I;  4H44 C;  3MXP A;  2R7Z B;  4A3E B;  1VCI A;  2D2C C;  4ULL A;  1KNA A;  4CJ1 B;  1MBY A;  3X3M A;  1WTX A;  2E2J B;  3VA7 A;  1SE2 A;  5C5L A;  1GUS A;  3O13 A;  5JEA J;  4NKL A;  1A2T A;  1EIG A;  4RGT A;  5IT9 L;  2F0V A;  1E0B A;  1TS5 A;  2JXM B;  3CHB D;  5EQ0 A;  1GUW A;  1H9R A;  3MFY A;  2PW7 A;  1LT4 D;  5C3X A;  3RZD B;  3ND8 A;  2F0F A;  5F2D A;  1GOZ A;  2B8F A;  4G7O C;  4X3T A;  4Q0F A;  2PW5 A;  3J81 L;  4WOR A;  2BOS A;  2PYK A;  3I91 A;  3QOL A;  3WOF A;  4KD4 A;  2MJ8 A;  4C2M B;  4HSP A;  3E6Z X;  2PZU A;  1JWM D;  2L5T A;  2ENB A;  4KHV A;  3DUZ A;  1HFG A;  3S2H B;  3BYY B;  3SK6 A;  1SNP A;  1O7L A;  4EGV A;  3GTG B;  1AZQ A;  1XTC D;  1OO9 B;  3H3V C;  3HS0 C;  3VYU A;  4IFD I;  3LWE A;  2AQ3 B;  3EFX D;  3RUZ A;  2F3V A;  2KCC A;  4ZAI A;  1H9S A;  1HQM C;  3L9A X;  4O42 A;  4FXD A;  2B8G A;  1T5X D;  3GD7 A;  1ENA A;  3R93 A;  3BVG A;  4XDX A;  3SE0 A;  4V19 0;  4CBV A;  4A3M B;  5G3L D;  3TN2 A;  1RTN A;  4C3J G;  3SXH A;  4CHT B;  2L12 A;  1BCP F;  2A6H C;  2NVQ B;  3Q6S A;  2IL8 A;  1IL8 A;  3AU7 A;  3GTO B;  2Z1C A;  1RF2 D;  3SR1 A;  1SNO A;  1BUV T;  3VYT A;  1PFB A;  1LO5 D;  1O7Y A;  2YU9 B;  4DA2 A;  1MD2 D;  4V0B A;  2X6L A;  3J80 E;  3NQT A;  5K5P A;  1OXV A;  3HRZ C;  4RGO S;  1AP0 A;  5ELF A;  1WTO A;  2F03 A;  2NWG A;  5NUC A;  5LHY 1;  4KHZ A;  1GXD C;  4EQN A;  1ENC A;  3HOU B;  4QUC A;  1FYC A;  3K5O A;  1AFP A;  4J6H A;  1ET9 A;  4X3K A;  2F0P A;  2OF1 A;  1STN A;  3U9S A;  5KEE A;  2AWO A;  1EQT A;  2EYF A;  2L9H A;  1SE3 A;  1H9M A;  1GHJ A;  5CC4 A;  2WKC A;  3C46 A;  2JYO A;  3TBI B;  3H6M A;  4I7Z C;  4NDX A;  3DWQ A;  3FEW X;  4LAA A;  3QOJ A;  1I3Q B;  4WFN 3;  2B2Y C;  3MXU A;  3OPO A;  2F0H A;  4DU9 A;  1QOH A;  2V4D A;  4HMI A;  1ROD A;  2F0E A;  2X6G A;  1D5Z C;  3MFG A;  1W6J A;  1ZYR C;  4IZ8 A;  1Z6H A;  4RA8 A;  3A56 A;  5C4Z A;  1UEA B;  2HDL A;  2IW3 A;  3J80 L;  4XXE A;  5C0X H;  2CVR A;  2D62 A;  3D4R A;  3J7A V;  1R4Q B;  1PTO F;  1Y8O B;  2M2L A;  5I9P A;  5JVG 3;  4OL7 A;  1PRT D;  1VF7 A;  2EJF C;  5C5M A;  3F2U A;  2JEB I;  2F0G A;  3NSW A;  4KJN A;  3PUV A;  4M1U B;  3Q23 A;  5DM6 3;  4BWG B;  3MA2 B;  5D65 A;  3P1H A;  3S1M B;  4B08 A;  1I50 B;  2LS0 1;  1IKL A;  1BOS A;  3DM1 A;  4KN4 C;  4JK1 C;  2PQE A;  5FO7 B;  1LT5 D;  4DN4 M;  1LTT D;  1SND A;  3DEP A;  4DFA A;  1G91 A;  3VR2 A;  1ET6 A;  3MC0 B;  1B2T A;  2IX3 A;  3KLS X;  4TSS A;  5JPN C;  1B3A A;  5FK9 C;  3MXG A;  1NSN S;  4ME5 A;  3HZX A;  1A15 A;  1PZI D;  5KYI A;  3C1F A;  1II3 A;  1QNK A;  4ILW A;  4ZKC B;  3A8I E;  1KAB A;  3S16 B;  1STH A;  4CKC A;  1LTA D;  2KUM A;  1WCM B;  2HCC A;  1ZYR D;  1GUT A;  3SVM A;  2L4N A;  2DY8 A;  3M7N A;  2FIN B;  1OXX K;  2XNA C;  2LKV A;  4FP5 D;  4K5X A;  1JOR A;  3OSO A;  2F0Q A;  1BDO A;  1Y8N B;  2DN8 A;  4DK0 A;  4IUP A;  3G7L A;  5KGU A;  3OWF A;  3ZYY X;  2B2T C;  1L0X B;  2OT2 A;  3SHL A;  4RGN A;  2SNM A;  2Z4I A;  1VDZ A;  3KF8 A;  3VYS A;  1VMC A;  1JC7 A;  4OO1 I;  4FXK C;  1CA6 A;  3GTJ B;  3LX0 A;  1F2L A;  4PMW A;  4EQO A;  5D3I B;  3S17 B;  3RLF A;  2PPB C;  4XT3 B;  3T56 B;  3M4O B;  1LT3 D;  1YNN C;  3EJI A;  2EVB A;  3S1Q B;  3HEJ A;  1STB A;  2EYP A;  5EKK A;  5CV7 A;  1ONL A;  2B2W C;  4NP5 A;  2FHT A;  3DEO A;  3S15 B;  4DNR B;  1LTG D;  1NR4 A;  3DHQ A;  2F0M A;  1ILQ A;  5EPK A;  1BCP C;  1M8A A;  3H0G B;  3U9O A;  1L0Y B;  1TWA B;  1NUC A;  2A69 D;  1PRT B;  3FMC A;  4RH6 A;  2BE5 D;  4K6D A;  1EEI D;  2A73 B;  1STE A;  3QB3 A;  3V05 A;  1SFO B;  1JB3 A;  1HPC A;  4CKE A;  4QB4 A;  4XIG S;  1E2Z A;  1PZJ D;  3H94 A;  1QE6 A;  1Y8P B;  1TWC B;  1BQQ T;  4HAE A;  1JWU D;  2L11 A;  4WJW A;  2IT1 A;  1B9N A;  1IHZ A;  1JWS D;  4DK1 A;  3R2T A;  2A6E C;  2R61 A;  1F9P A;  2KQ3 A;  3V2T A;  1EY8 A;  3NHH A;  1U4R A;  4P2C B;  4ZYS A;  1EY0 A;  3K7A B;  2XVS A;  3FDT A;  4A3D B;  1PTO H;  2IPK D;  1G8Z D;  2CQA A;  2ZXO A;  2RSO A;  3KLR A;  1YNN D;  2LFN A;  3HOV B;  1SEB D;  3GO5 A;  4FNF A;  2M9V A;  5I6W A;  5DNF A;  3M85 A;  1FNW A;  3IL8 A;  1JOO A;  4RFB A;  3BDL A;  3K0Y A;  2XWB B;  3I73 A;  1QB5 D;  1W6K A;  1S5B D;  4K2K A;  1QWY A;  4K14 A;  2MP1 A;  1WTR A;  1BNZ A;  4KI0 A;  4PMB A;  1DOL A;  1PTO C;  1Z7T A;  4J1M A;  5ELE A;  5JJZ A;  4KK7 A;  4F7X A;  1KLG D;  4LJZ C;  2I46 A;  2Z4H A;  2RVL A;  2F0O A;  3I3C A;  3TSS A;  4IUU A;  4Y7N B;  1LV9 A;  4UDU C;  4B9W A;  1JQY D;  2PZW A;  1MGS A;  3J81 E;  1CQV A;  3PUX A;  3GTL B;  2B2V C;  1DXM A;  1I4Q A;  3IFD A;  3Q0A A;  1GHK A;  1CQF A;  1SMY C;  1AW7 A;  1X3Q A;  3A7L A;  1S5F D;  2L0C A;  4EQP A;  1PMR A;  2A74 C;  2CHB D;  4CJ0 B;  1KAA A;  5C4J B;  3LWU A;  2K1B A;  4XYO A;  4E6I A;  1CHQ D;  1EFI D;  3VR3 A;  1SE4 A;  1ESF A;  1IW7 C;  3PUY A;  1EL0 A;  1UAP A;  1BBX C;  2Y0S B;  1LT6 D;  2K05 A;  2ZXP A;  3D4D A;  1RHP A;  1I4P A;  2XRS D;  3D6W A;  4RKL A;  5CYU A;  3PIP 3;  2EPB A;  3MHB A;  1FGB D;  1QG7 A;  2J7Z A;  5IGC A;  4XQJ A;  2JE6 I;  5LL6 S;  4IUT A;  3JAM E;  2E2D C;  3N6R A;  4RCO A;  4IAL A;  3BG3 A;  2B2Y A;  3HOW B;  2K5W A;  4H13 C;  5CGK A;  3OOC A;  5KNB A;  1RDP D;  5LL6 X;  2EYL A;  4IFD H;  1R9T B;  1BXT A;  4B9X A;  3NP8 A;  4FF2 A;  1EEF D;  1GUN A;  3V96 A;  2QEJ C;  2XSC A;  2B39 A;  1DZ1 A;  1SMY D;  4XYQ A;  1TY0 A;  3HGB A;  1F2Y A;  3H09 A;  1K8O A;  3KK7 A;  3FRP B;  5KND A;  3MVV A;  3K5L A;  3OW7 A;  4KY6 A;  3M7G A;  1FR3 A;  1DYQ A;  2A5H A;  2NTS A;  1O80 A;  5EKI A;  3D4W A;  2FMC A;  5EGT A;  2F0N A;  3D3R A;  3A55 A;  1XXG A;  4R9W A;  2K01 A;  3UI2 A;  2FJ2 A;  3JAM L;  1WTP A;  3BVZ A;  5IOC A;  1D1I A;  5J22 A;  1HHV A;  1JR0 D;  4C3I B;  5IGB A;  4ODG A;  5A35 A;  3Q24 A;  3MAQ A;  1B4O A;  1WD1 A;  4C3H G;  2NN6 I;  2EJM A;  1HRJ A;  4OGQ C;  4BA2 I;  4OIJ A;  2JP1 A;  1EY5 A;  3VYR A;  4IUV A;  1SJH D;  2PO4 A;  3NBH A;  4XQN A;  1B1Z A;  1VF5 C;  1F9R A;  3R2I A;  1TS2 A;  4QIW B;  1HXY D;  2EXZ A;  3TDQ A;  1D5M C;  2IJ0 A;  5KRU A;  1EZ8 A;  2NVY B;  1PXU A;  1LAC A;  2IX0 A;  2QIL A;  2B2T A;  3J7Y W;  3L7Z C;  4FF4 A;  3AB9 A;  5EBC A;  3C2P A;  3E0J A;  1TWF B;  4IUR A;  1ZXT A;  1J9O A;  4OIK A;  1V1P A;  3T51 B;  1EU3 A;  4BBS B;  1DJR D;  1OXS C;  3QJY A;  1EYC A;  2EYM A;  1SYB A;  2EJG C;  2SDF A;  1K83 B;  2FFK B;  2R3Z A;  2A6H D;  2LMC B;  2E76 C;  1D6E C;  3ND9 A;  3S1N B;  1CTM A;  3G6J B;  1TQO A;  2VXW A;  2B2W A;  4ZLT F;  1WTW A;  3RZO B;  2E75 C;  2G9H D;  1SNC A;  1F2M A;  3QWN A;  5JAV A;  1EOT A;  1LTI D;  5COR A;  2KED A;  5I2Y A;  1RKN A;  2O5J C;  5BN4 A;  1HTP A;  5C44 B;  2DY7 A;  3NXW A;  2M00 A;  4DAV A;  1F9Q A;  2GA4 B;  3MXN A;  1O7Z A;  5ISR A;  3RMH A;  3CRK C;  2B2U C;  1V8Q A;  1QNU A;  1B53 A;  4KTA A;  4U68 A;  1RD9 D;  4RHS A;  1X3P A;  2I07 B;  2K5Q A;  1GJX A;  2SNS A;  1IKM A;  4A3F B;  5CV8 A;  3HP3 A;  3OIQ A;  1A6X A;  4QF4 A;  1G2T A;  3IFT A;  5C0X G;  1B44 D;  3NK9 A;  2KEC A;  1EZ6 A;  2BA1 A;  3EA6 A;  4KV6 A;  3PUW A;  1C8C A;  1SDF A;  4QMG A;  1XX8 A;  1D2B A;  5G3L F;  2QF7 A;  4CJ2 C;  1SXT A;  1AN8 A;  2RBM A;  4OO1 H;  4JBW A;  2C5C A;  2WAQ B;  1SYD A;  3R8B A;  2NYZ D;  2A68 C;  5JEA H;  5HUR A;  1F9S A;  3PO3 B;  3I4M B;  4C3J B;  2O4X A;  1J8I A;  3TZU A;  2NBF A;  3H91 A;  2B63 B;  1DOM A;  3SK5 A;  3GV6 A;  3TP8 A;  1DON A;  4PQX A;  4RHR A;  4AYB B;  2EY1 A;  4G57 A;  1YNJ C;  5ELC A;  1HQR D;  3CKI B;  3URY A;  4QUF A;  2AQ1 B;  2B2V A;  1CM9 A;  5K36 H;  3HKZ B;  3K59 A;  2O5I C;  2X69 A;  5M9O A;  3ONA B;  4Q5V A;  5AFW A;  1FNU A;  1WTV A;  5C4H A;  1LAB A;  5CV4 A;  1ZEQ X;  3S2D B;  5CR3 A;  4K8J A;  4C56 C;  2H1E A;  2Q8T A;  5D3D A;  5M5X B;  3TZD A;  4K5V A;  3GTK B;  3OMC A;  1KDC A;  3K58 A;  2TMP A;  4A3I B;  5JEA G;  3QO2 A;  1CFM A;  1IYV A;  1HUM A;  3BS1 A;  1OXU A;  4FF1 A;  1SSO A;  3ERQ A;  3P20 A;  3NTI A;  2A68 D;  4IUN A;  4BA1 I;  2XN9 C;  2E2H B;  1PRT F;  3P7J A;  5CBA E;  4R8N A;  5DAU A;  3Q22 A;  4TRD A;  1NCV A;  5KIX A;  4FYD A;  4ZKB B;  1SYE A;  1PDQ A;  2BDO A;  3CU7 A;  5C0X J;  1NR2 A;  2ID0 A;  5K36 G;  2Q8R E;  1H9J A;  1TR5 A;  3HOZ B;  1YNJ D;  1QCB D;  2EDG A;  1SYF A;  2BCO A;  2N55 A;  1Q1B A;  1LTR D;  2EY6 A;  4FO2 A;  5KYL A;  1TWH B;  3KUP A;  2F0U A;  1BCP D;  1TT2 A;  1HTL D;  2VB2 X;  2E2I B;  2HUG A;  4KKS A;  4DXG A;  4ZUI A;  1R4P B;  2F0D A;  4F8M A;  1S5D D;  2JSO A;  2ZT9 C;  2WAC A;  2VUM B;  1BF4 A;  4KKU A;  3NTK A;  2YYZ A;  3RD4 A;  1CK1 A;  4O1N A;  2K6A A;  2K5D A;  1XWE A;  1TY2 A;  2WB1 B;  4RWS C;  2A6E D;  1EYA A;  2AQ2 B;  1G29 1;  1Y69 U;  4OHJ A;  4A3G B;  2WKD A;  1M4V A;  3SDZ A;  2ICI A;  1BR9 A;  2F0S A;  2AUJ D;  2QKI C;  4A93 B;  4ZUJ A;  5DEH A;  5J39 A;  2JA6 B;  5I6Y A;  2MPM A;  2KOL A;  4ZQ3 A;  1JOK A;  1CZG A;  4LK1 C;  1EU4 A;  5E3F A;  5E4W C;  4HCS A;  3HOX B;  1I6V C;  5I9O A;  5M5Y B;  1U9R A;  1LLR D;  4HTH A;  1KTK A;  1E2V A;  3W2D A;  3ERO A;  2TSS A;  1FD7 D;  2F4I A;  1Y1V B;  2PZT A;  2HQE A;  5FLX E;  1JIC A;  1DD2 A;  2RKS A;  2Q8I B;  2MGS A;  5I4D A;  5T1G A;  4CGY B;  3NE5 B;  1PFN A;  4RAU C;  1V43 A;  1PLF A;  4KKT A;  1C4Q A;  3FKI B;  1PTO D;  2RDG A;  1B9M A;  4DAP A;  2VNU D;  1GUO A;  4K2L A;  1MSH A;  1V1P B;  3I70 A;  4DXF A;  2DNC A;  2F3W A;  1A3U A;  4KJO A;  2ZXR A;  2JA5 B;  1CHP D;  3BZD B;  3E5S A;  1QIL A;  3PIO 3;  4HN7 A;  2NUC A;  2JA8 B;  3I8Z A;  1G2S A;  2Z8L A;  5CV6 A;  2J0T D;  1Y1W B;  2J4X A;  5ELB A;  2OEO A;  2NZ1 D;  4H7B A;  3GTQ B;  2ICE C;  4DF7 A;  3MTS A;  1EWH A;  1BCP B;  3HG9 A;  3NPP A;  2NTT A;  2R92 B;  3I4L A;  4BS9 A;  1MSG A;  5M3M B;  3K57 A;  4HCE A;  4HR7 B;  3EQL C;  5I2X A;  5FLX L;  5BN5 A;  5J1Z A;  1NAP A;  2JA7 B;  2H4O A;  4XT1 B;  2N88 A;  1STY A;  2BDN A;  5IOD A;  1SNM A;  3EVQ A;  2NN6 H;  2EZV A;  2E74 C;  2NVT B;  1IW7 D;  3D6C A;  1X32 A;  4RGM A;  3AMU A;  5C4X B;  1U4L A;  2B2U A;  3S1R B;  1DCZ A;  3GV3 A;  2XIW A;  4H0L C;  1TVX A;  4C1N K;  4L8J A;  4PV1 C;  5M5W B;  5C3E B;  5D14 A;  4HSV A;  3S9W A;  1LTB D;  5BN3 A;  4IFD G;  4N9P A;  1Q8I A;  5HGT A;  4YIJ A;  4DGZ A;  4NW2 A;  5IGD A;  5EJW A;  2F0L A;  3QIA A;  4FVM A;  1G6Z A;  5C6A A;  1ENF A;  2IWH A;  4EVO A;  1PRT C;  1MI2 A;  3FVQ A;  5JPM C;  5FKA C;  1U4M A;  5EPL A;  2L1B A;  2KJX A;  4ZK9 B;  2NB0 A;  4TQU S;  3CQZ B;  2KHS A;  4KY5 A;  1ICW A;  3IAY A;  1WTQ A;  1D5X C;  1STG A;  3BDC A;  1Q12 A;  2D5D A;  1V1O A;  3NWT A;  1SYC A;  2JEA I;  3T53 B;  1EYD A;  4PNY A;  3TME A;  3M4Y A;  5CMD A;  2L55 A;  1CZW A;  3PMF A;  1TII D;  3K5M A;  2K32 A;  3QG1 A;  3SK8 A;  2K03 A;  2RDF A;  2NN6 G;  1KDA A;  1PTO B;  5A2Q E;  3C1E A;  2KCN A;  2XRQ D;  4ABN A;  2RA4 A;  4KY7 A;  1EQV A;  4X3U A;  4GZY C;  1XYI A;  1EY6 A;  1DOK A;  4ZRZ A;  1WVL A;  4DAY A;  1I6H B;  1ESR A;  1BO0 A;  2BA0 A;  5ELD A;  4DNT B;  4IQZ A;  3KLS A;  4XQQ A;  2FMM A;  3NQI A;  3DXJ C;  1SJE D;  1Z47 A;  4IN3 A;  1JCK B;  3A8J E;  1S5E D;  4MN3 A;  2DNE A;  2PNR C;  3DWA A;  2EYJ A;  3SK4 A;  5IIF A;  4K8I A;  3M3Y B;  3OMG A;  4NMZ A;  3MWY W;  2KA7 A;  3S14 B;  5C0X I;  1PFM A;  4BY1 B;  4G4K A;  2EYH A;  1KDB A;  4G7H C;  1PYW D;  5M3F B;  3VR5 A;  1WD0 A;  5CBE E;  5A2Q L;  1RTO A;  4X3S A;  2HCI A;  1CI3 M;  2EY2 A;  1CT1 D;  1TKW B;  3GTP B;  4MHE A;  3C3L A;  1EWC A;  3D8G A;  1S4Z A;  1VMP A;  2F0J A;  1S5C D;  4IFD J;  1HFN A;  2HDM A;  1KLU D;  4FF3 A;  3T13 A;  5CV5 A;  2K28 A;  3J7A F;  2QCP X;  2K33 A;  1ZKO A;  5EKL A;  2QDB A;  5DM7 3;  1C48 A;  2A69 C;  3TP6 A;  4A3K B;  1TU2 B;  2O2L D;  2BE5 C;  3NUC A;  1LTS D;  2K04 A;  2K7V A;  3BYT B;  4WRD A;  3A8K E;  4K5W A;  1TS4 A;  3TP5 A;  3GTM B;  1RJT A;  4L6T B;  3NBI A;  2RDH A;  4QCL A;  1A2U A;  2EY5 A;  3T16 A;  4A3J B;  2F0W A;  5TSS A;  1SYG A;  4HMJ A;  1EY9 A;  2RSN A;  1CA5 A;  2CW0 C;  2XWJ B;  3OIP A;  1DM0 B;  4RKB A;  1O78 A;  4KN7 C;  2PCF B;  1OXT A;  3D31 A;  3K6O A;  5E4X A;  1Q1E A;  5COY A;  3VR4 A;  3X3N A;  5C3W A;  4C3H B;  4I65 A;  1IYU A;  3WOE A;  1A3V A;  3MZ5 A;  3KBX A;  2KVM A;  1EIH A;  3I4N B;  1HA6 A;  2IX1 A;  4BY7 B;  2WP8 J;  1STA A;  1H9K A;  1FNV A;  2R6G A;  4TKO B;  3DMU A;  4M8A A;  4FXG C;  3FPP A;  1HUN A;  3I90 A;  5EBD A;  1TS3 A;  5IGE A;  3WDN A;  1I4G A;  4J8Q A;  1SAP A;  2F0T A;  5T1I A;  4R8I A;  5IGF A;  1AZP A;  4OO1 G;  1I4R A;  1ILP A;  4ID6 A;  3K5N A;  1Q90 A;  2RQX A;  5FO8 B;  3CRL C;  1RCV D;  4F88 A;  3OWE B;  3PUZ A;  5IGG A;  3NTH A;  4N9T A;  3SEB A;  3A54 A;  3N52 A;  2WIN B;  2AUK A;  3PV0 A;  4Z9C B;  4F87 A;  3IKJ A;  1D1K A;  1U4P A;  5JOB A;  1JE4 A;  4G7Z C;  2NVX B;  1QJO A;  1A3T A;  5JVH 3;  1I4X A;  3HOY B;  1B50 A;  1UNS A;  4A3B B;  3VA5 A;  1PZK D;  2SOB A;  4RCN A;  2C9O A;  4UAI A;  4BBR B;  1Q3L A;  2CW0 D;  3DWP A;  4IUQ A;  2AWN A;  2F1M A;  3BDO A;  2MHV A;  2VB3 X;  3L3O C;  4K6L A;  4KD3 A;  3MEH A;  2SEB D;  4C3I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...