3MEHA

Crystal structure of staphylococcal nuclease variant delta+phs i92a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 128
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mehA00
4NDXA 4IALA 1SNOA 2KHSA 2SOBA 1KDAA 1STGA 3D4DA 2F0FA 4WRDA 1SNMA 4KY5A 5EKLA 3SHLA 4IUNA 3NXWA 4K5XA 1U9RA 1A3VA 3R3OA 1AEXA 5KEEA 5KRUA 2F0GA 3EVQA 4R8NA 5F2DA 3TP5A 5CV9A 2HQEA 4N9PA 1EYAA 2EXZA 3NK9A 4EVOA 2F0UA 3D8GA 3VA5A 5IGGA 4OL7A 5KYLA 3OWFA 5CC4A 3PMFA 2O4XA 2PYKA 3DMUA 1EY4A 3OSOA 2EYHA 5NUCA 1JOQA 1EZ8A 4I65A 1EY7A 3TP6A 4DGZA 3QOLA 4N9TA 5IGFA 1SYDA 5IGEA 1JOOA 1IHZA 3DHQA 3BDCA 3C1EA 4KTAA 3TP7A 1TT2A 4KV6A 2F0LA 5DAUA 5IGCA 3SK4A 3SK6A 4K2KA 2EYFA 4TRDA 5CV8A 1SNDA 3S9WA 2F0TA 4S3SA 4KD4A 4B9XA 1JORA 5IIFA 3MEHA 1TQOA 4ID6A 4G57A 3TMEA 1A2UA 1EY8A 1KAAA 1NSNS 4K14A 1II3A 2RDFA 4LAAA 5IOCA 4J1MA 1A3UA 3H6MA 4K5WA 4J6HA 5I6YA 2PW5A 1STYA 2F3WA 1ENCA 2F0KA 5JAVA 3NP8A 4HMJA 5C3WA 2F0VA 3MXPA 3E5SA 5CV5A 5M9OA 2F0HA 3QB3A 5JOBA 3MVVA 3SXHA 3TP8A 3ERQA 4K5VA 4YIJA 4KD3A 2F0NA 5C4ZA 4PNYA 4KY6A 4ODGA 5KYIA 3SR1A 5E3FA 1SNPA 2EY1A 4F7XA 3NQTA 4ME5A 2ENBA 2PZTA 2F0OA 1EZ6A 1NUCA 3MZ5A 4K6DA 4NMZA 5IGDA 4NKLA 3SK8A 4K8IA 2NUCA 1STHA 4QMGA 1SYCA 3T13A 2F0PA 1TR5A 1KDBA 3HEJA 5IGBA 1SNQA 4ZUJA 5C4HA 1RKNA 4K8JA 2OF1A 3NUCA 5DEHA 3EJIA 4DF7A 2EYMA 4QB4A 1KDCA 3OMCA 2F0EA 5E1FA 4DFAA 3D6CA 2EYOA 4QF4A 5CGKA 5CV6A 2F0IA 1EYDA 1JOKA 2LKVA 4KJNA 3HZXA 4MIUA 4F8MA 2RKSA 2QDBA 4IZ8A 1F2MA 1EY9A 4ZUIA 3ITPA 2M00A 5HURA 4K2LA 5J39A 5I9PA 2PZWA 3MHBA 5EKKA 2KQ3A 4KJOA 1STNA 1EY0A 1F2ZA 2OEOA 4RKBA 1KABA 3T16A 2F0MA 3EROA 5J1ZA 2SNMA 2PZUA 2F0QA 1A2TA 4DU9A 2EY6A 2EYJA 2F0JA 4EQNA 1SYBA 2EY5A 4HMIA 2SNSA 4E6IA 2WACA 3U9OA 3BDLA 3P75A 5J22A 1EY5A 3C1FA 5K5PA 1SYEA 5ISRA 5CV7A 5C5MA 5I6WA 5KIXA 1SYGA 4B9WA 5EGTA 1ENAA 4HTHA 5HGTA 1SNCA 4PMCA 4ZQ3A 1A3TA 4H7BA 3D4WA 1F2YA 2PQEA 1EY6A 4WORA 5C6AA 5I9OA 3OMGA 3P1HA 2F3VA 5CR3A 2F0WA 3RUZA 5C3XA 1EYCA 5IODA 5KGUA 1STAA 2EY2A 2F0DA 1EQVA 2F0SA 2PW7A 3NHHA 4RKLA 4EQPA 4EQOA 2EYLA 2RBMA 3LX0A 3QOJA 2OXPA 4KY7A 1STBA 2EYPA 5CV4A 3SK5A 3V2TA 4KHVA 5C5LA 4PMBA 1SYFA 4NP5A
chains in the Genus database with same CATH superfamily
2A73B 3L0OA 5GAGC 4WRDA 2NVYH 4WJWA 1EWCA 4XQJA 1B2TA 1DJRD 1NCVA 2MFIA 1RIPA 3D8GA 1LTTD 1XYIA 1PH2A 3OWFA 5M5YH 1EZ8A 3GTMB 3GTLB 4N9TA 1IHZA 1JJ2A 1AN8A 2IX0A 2F0LA 5IGCA 2PMZE 5FO9B 3AEVA 3S9WA 1B7YB 1QG7A 2PI2A 3HKZB 2K4KA 4HCSA 4XIGS 2A5HA 1U5KA 5IIFA 2R61A 2WP8J 1S5DD 5EBDA 2RVLA 4LAAA 2RDFA 4A3EB 4LF5L 3R2TA 5C44G 2A6EC 4K5WA 1STYA 2IHFA 4IFDH 2PNHA 3BS1A 2ZXPA 5C4XG 4DXFA 2J7ZA 4DR3Q 2KHIA 5KYIA 4JBWA 1HFGA 4RCNA 1TWGB 1VQKA 4JC0A 4CKEA 4K6DA 4CHTB 3I90A 2B2UC 4NMZA 1H9JA 2NUCA 1CQFA 1ICFB 1IYUA 1M90C 1TR5A 2O5IC 1PH1A 2B2WC 5FJ8H 1PMRA 5AJ3L 1K3RA 3D6CA 3OYYA 1JOKA 3GTKH 2SEBD 3HZXA 4JI7L 3M85A 4KJOA 4DV6Q 3HKZE 4JYAL 1JWMD 3IFDA 3VA7A 2F0MA 3EROA 2YU9H 1I4QA 1LT3D 3S2DH 4A3DG 1HR0W 2K14A 1ONLA 2Z1CA 1M4VA 1RJTA 1CKNA 2AWOA 4Y52H 5LL6X 1SYGA 2XWBB 3UDFA 4ZQ3A 1A3TA 3TDQA 1XNRL 1RTNA 5C6AA 2Z6BA 3P1HA 1X55A 4LF4Q 5KGUA 4KHPQ 1YNNC 2EJGC 3F2DA 1VQHA 2IHEA 2B39A 2WB1B 4IUVA 3VYUA 1HZBA 4H13C 3CCEA 3BZCA 4IUNA 4DK1A 5IY0A 1Y1VG 1XPOA 1Y8PB 4FDBA 2F0GA 3EVQA 4LF7L 4IURA 1SBBB 3TP5A 4FF3A 1LTRD 2BE5C 2HQEA 1IXRA 4N9PA 5C44B 4HJAA 3M7GA 3JAME 2E76C 1IBML 2F0UA 1PH9A 5ELCA 1LO5D 5C4XB 3GTOH 1V43A 3IFTA 5ELEA 1UUPA 1C0AA 3GTPH 1VQPA 2WINB 2B29A 4NXNQ 2A68D 1QVGA 1Y14B 2R7FA 1IW7D 1PYWD 2F0TA 3RLNA 2OTLA 2K04A 3K7AB 1CM9A 1ZXTA 5C0XG 1VQ7A 5FK9C 4U68A 1KQSA 1SN8A 2F3WA 2B2VC 1SJHD 3NBIA 1WI5A 2WB1E 2AQ1B 2I5LX 4CDFC 1KIXA 2ZJQA 1K0SA 3GDEA 1DOLA 3PIO3 2NTSA 4N8FA 3VR2A 1Y1WG 3A8KE 1E0BA 2JA6G 3A55A 1HNXQ 4A3DB 1YVCA 4RH6A 1EZ6A 4X62L 3GTJH 1MD2D 2O2LD 3MXNB 1HA5A 1I4HA 2VNUD 3KF6A 2DNEA 2K52A 1X32A 4X3TA 4NXMQ 5E1FA 4BY7H 3CQZB 4DFAA 2RCFA 1K8MA 4OXPA 2RCNA 3UDGA 3S17B 1BBUA 5K36H 2JA7H 3L2PA 3KF8B 2OEOA 3KLSX 1TS3A 2XVSA 3QO2A 5J1ZA 3RN5A 1WD0A 3CCVA 2EYJA 2WACA 2FFKB 5J22A 3NELA 3C1FA 4DA2A 4IJLA 1SYEA 1S40A 3W3AA 1QNUA 2VXWA 1H9SB 3NTIA 3RD4A 4JYAQ 1SAPA 2GVBA 1HUNA 1JJCB 3K58A 5JPNC 3DXJC 1F2YA 1MBYA 1WD1A 1WFQA 2CW0D 2CWPA 2GVAA 2IPKD 2C35B 3GP7A 3JC66 1DM0B 4KMUC 1VQLA 1YBYA 1SXTA 3J81j 3D3RA 1GUOA 3KLRA 1UE1A 3S1NB 3E6ZX 1O7LA 1KL9A 1A3VA 1C8CA 1JWSD 1LTGD 4X3SA 4TSSA 1CI3M 3A74A 2OCEA 1CSQA 2V4DA 4DAMA 4DR4L 1UEAB 2I5MX 4OL7A 4ZLTF 1OXUA 4DV7L 1Z6HA 2O4XA 5EAYA 4LF6L 1BXTA 1Y1WB 3RMHA 3CD6A 3S2DB 1A63A 2JA6B 3J7YW 1HNWQ 3FDTA 1PZJD 4PG3A 4H02A 2K01A 4JI1L 1PA6A 4POFA 4GKJL 3PF4A 4BY7G 1PFNA 2ASBA 1II3A 4IPDA 4L63B 3IRBA 3B6YA 3I91A 4LK1C 4X6AH 4HIOA 4MZ9A 3I55A 4OEMB 1QNKA 2HDMA 2E74C 2NVXH 1PRTF 2F0NA 4PNYA 2WKCA 4DV2L 1LTLA 3T1YL 5FLMG 5LMNW 1MKHA 1IL2A 1O7YA 5C3EH 3IKJA 4A3CG 1VQDA 4IPGA 2B3GA 4TQUS 5DEHA 4XYQA 2UU9L 1VCIA 3OMCA 2X6LA 2I0QA 1X9NA 4QCLA 3DWPA 1L1OB 1HZ9A 3GTOB 1FJGL 1HJPA 1QUQB 1XPRA 2QDBA 1QZHA 3PO2G 2MGSA 1D5MC 1D8LA 4FXKC 4J15A 1WTRA 1QE6A 5CMDA 1Q82C 3F2UA 2B2YC 5IYDH 2NVTH 2PZUA 3HOUG 1NY4A 3L3OC 3PQIA 3E0EA 4JCVE 4FF4A 1GJXA 1CKOA 3EFXD 1VF7A 3CCJA 3FPPA 3GTQH 4LWCA 1TS2A 2HHHQ 4LF9L 5C5MA 2K05A 4B9WA 3KBGA 1BVSA 1A8VA 4AQYL 3D4WA 2Q8IB 2ZT9C 4IUQA 1J6QA 4FO2A 3PUXA 2AWNA 4EQOA 2F1MA 2E5LL 4JI0L 4DR2L 1K0RA 2HUGA 2F0FA 4R4QA 4BY7B 3ND8A 2ZJRA 1UAPA 1AE3A 1XXGA 1EIFA 2FJ2A 2VQEL 1RODA 5KYLA 2JA7B 1BO0A 4KHZA 4GLXA 3J7AV 5IT9L 4KTAA 2JEBI 1PH4A 1CFMA 4K0KQ 4L8JA 5C3EG 3TREA 4TRDA 4DR4Q 2K5WA 1N8RC 4DV7Q 4B9XA 4HIKA 4C3JG 3I4MG 1LM0A 4LF6Q 1A2UA 1B53A 1VQ6A 1IW7C 5IOCA 4J1MA 1A3UA 2CWAA 1JJGA 1AZPA 3GTGH 3MWYW 1A0IA 1UE6A 1Q1EA 4G7ZC 3EA6A 4JI1Q 5LL6S 1Q8IA 4KY6A 2XGTA 2JN4A 3HOUB 2CFMA 4GKKL 2PCFB 2ID0A 4X66Q 4YCUA 1PH8A 3RZOB 1I50H 2F0PA 3A0JA 5IWAL 4N8X1 1QZGA 4ZKCB 2XRSD 3AFQA 4HJ8A 1K73C 2K6AA 1RTOA 3DEOA 2J4XA 5IP9H 4DV2Q 5CV6A 5ELBA 4DXGA 5LHY1 2E2IH 4GOPA 1QOHA 4B3MQ 1KHIA 3LWUA 4G7OC 5IYCG 4LUZA 4JI8Q 1Q90A 4HJ5A 5LMNL 3VR5A 1VQOA 3CXCA 4GNXC 1Q46A 2UU9Q 1A2TA 2EY6A 1JMCA 1FNWA 1CA5A 1TXYA 2JA9A 1FJGQ 1S3OA 4OO1H 1KLGD 2EDGA 1K83B 4YY3L 4A3MG 4P71A 1OXTA 2NVXB 2PQAA 1ET6A 5IODA 3NPPA 1B44D 1HQRD 1JWUD 2K5QA 3ICEA 4RGOS 4FVMA 3GTMH 2O5JC 5C5LA 2CW0C 3W1BA 5C3EB 3GTLH 4GN5A 1TWAB 4IALA 2JQOA 4JV5L 4DR5Q 3E0JA 4AQYQ 4KY5A 3SHLA 4C3JB 3PIP3 1PFBA 4BS9A 2NYZD 1D2BA 1NTGA 3DWAA 2QDLA 3OTOQ 3J81L 1EYAA 3RN2A 4DUZQ 2NB0A 4O1NA 1ENFA 4A3EH 1D1IA 2D62A 2Q2UA 2R92G 1YJNA 2XWJB 1EQTA 4DR2Q 1IBLL 2OT2A 4I65A 1UNSA 3BDCA 4A3KG 1MSHA 4UAIA 1XTDA 3SK4A 1LACA 2D0PA 2NZOA 3A5UA 4GNXB 2G9HD 4AIMA 1TQOA 3S24A 2IX3A 2PNRC 3M3YB 4IOCA 1W2BA 2F0KA 2N78A 2NWGA 3T4AC 2VS1A 3Q0AA 5JOBA 3SXHA 4FXDA 3PIOA 3OHXC 4ODGA 4BA2I 1D5ZC 2E8GA 3G7LA 1FNVA 1O7ZA 2JP1A 3G48A 5ELOA 4OGQC 4NKLA 3EBEA 4YCWA 1N33L 2Z6KA 3V05A 1KDBA 4JBKA 4BBRG 1TKWB 5A35A 4DF7A 4A3MB 2L11A 1KDCA 4L5TA 1RF2D 3QWNA 5JEAG 4DV4Q 1YNJD 1HCZA 1HTPA 2DY8A 4GKKQ 2DY7A 2I46A 4DV5L 1KXLA 2HIVA 2DN8A 3CAMA 3NBHB 1CT1D 4F87A 3FMCA 4X3UA 3STBD 3BJUA 4RGTA 2F0JA 2M2LA 3KFUA 3H94A 5JJIA 3I4OA 3Q23A 4I7AA 1AH9A 4QY7A 2XIWA 3CRKC 2FHTA 1N34L 3HOVG 1C4QA 2UXCL 3ULJA 1YITA 4GN3B 1ENAA 3K5OA 4X65L 2VW9A 3CMEA 2NVQB 2R92B 1JE4A 1JT8A 3DM1A 5C44H 3BU2A 1J5EL 3TSSA 4EQPA 1LT6D 5M5XB 4NW2A 1VMCA 1PH5A 3SK5A 3MFYA 1I50B 1AE2A 1PFMA 1TWCB 1W3SA 4R8IA 4A3FG 4LFBL 1O80A 4X64L 1U9RA 2MNAA 2E2IB 3K7AH 1ASZA 2EXZA 1B70B 3MFGA 1SJED 1DCZA 2XRQD 1WTXA 1OXXK 1K8GA 3S1QB 3ZYYX 5C0XI 1PYSB 5IGEA 2EZVA 4HN7A 2UXDL 2NN6G 1D1KA 1AP0A 1QVCA 4DAVA 3EIVA 5A2QL 1RDPD 2L5TA 3AQQA 3MXUA 3ULLA 4S3SA 4QIWB 4DV3L 4BBRB 4A3DH 4XT3B 1BNZA 1I94Q 1TWHB 3K8AA 4DV1L 4HSVA 4J6HA 4G7HC 2R93G 2A69D 3CQZH 1VQMA 3TP8A 1VQEA 2Z8LA 4R4OA 3S17H 1EUJA 1TWFB 3FHWA 1BF4A 4X3KA 4A93G 1JOQA 1NMFA 1U4PA 1VF5C 3HOVB 1GHJA 3SE0A 3J80L 1Y1VH 2EJMA 2XTIA 2Z4IA 4DR7Q 3RR5A 3K80C 5EQ0A 4IZ8A 1F2MA 4DAYB 1KAWA 4OHJA 3G4SA 4RA8A 1FGUA 1SMYC 3DM3A 5HY6A 1FR3A 3HG9A 1STNA 4QIWE 2KCMA 3Q24A 2EVBA 1HPCA 5BR8Q 1JB3A 2ALYB 3RZDB 1SYBA 4KN4C 4A3FB 5ELNA 3BYYB 1DONA 1LYLA 3P75A 1GUWA 4DPGA 3RLOA 4DR1L 4LF8Q 3TRZA 4LFAL 1BBWA 5C4JB 4HTHA 3S1NH 5C0XH 3S1RB 4LMQD 1ASYA 3KJOA 1XPUA 5I9OA 3OMGA 4JI5Q 4CJ2C 1B9NA 4CDCC 2D2CC 2AUJD 1EQVA 4C3IG 1D5XC 2DUDA 4KN7C 2N55A 2KUMA 1I4PA 1Y1WH 4NDXA 1SNOA 4P73A 2JA6H 3U4VA 1N36L 2OTJA 3J7ZC 2JK8A 5BN4A 2Z4HA 2R93B 4RCOA 1MHWC 1ICWA 3Q22A 1LLRD 3N6RA 2EYHA 2K5DA 2XN9C 1CHPD 4KV6A 4A93B 3HOWG 2F3IA 4B08A 2BCOA 1S5ED 1HRJA 3VYRA 4UDUC 3DEPA 3TMEA 4C56C 1GD7A 2LXJA 1U4LA 2B2UA 5T1GA 4HR7B 5DNFA 4BBSG 2QKIC 1U0LA 3CCRA 1YHAA 2B2WA 5C4ZA 3PUYA 1HZCA 4KI0A 4IFDJ 5IT9c 2IJ0A 1EFID 2ENBA 4GZYC 3TN2A 1N9WA 1LTID 4QMGA 4MTKA 1YNXA 1ZKOA 2LY7A 4K8JA 1LUZA 1P8LA 2OQ0A 2J0TD 2EIFA 1JR0D 1A15A 5CGKA 4I7ZC 3S15B 4DNTB 2F4VL 4YWLA 3CRLC 2KEEA 1E24A 5I9PA 2CH4W 1MSGA 1YNJC 2KQ3A 4C3IB 3CC7A 4V190 2CKZB 3R2IA 1PH3A 4IJHA 4LF5Q 4DU9A 4XQQA 1Z7TA 3OIQA 3STBC 4HEDA 2JSOA 3BDLA 5E4XA 1CQVA 1QILA 2C9OA 1G291 3VDYA 4JI4L 3AYHB 2MO0A 3MXNA 3JAML 1RL2A 4Y7NB 1VQAA 4EGVA 1IZ6A 1TY2A 4BY1G 5I2XA 3J81i 1KTKA 1EOVA 3LX0A 4POGA 3HOWB 1E2WA 1R4QB 5DLQE 5BN5A 4M8AA 1LT4D 4FXGC 3X3NA 1SE3A 5AJ3Q 3D0FA 3KF8A 4B3RL 3NQIA 3PIPA 3NXWA 5FLMH 2CH4A 1Y1VB 1KNAA 2JA8G 3NWTA 4JI7Q 3OW7A 3H0GH 1SRUA 5FLXL 4A3CH 2EXDA 2VB3X 4EVOA 1GUTA 3VA5A 4BBSB 2KOLA 4ZAIA 1GVPA 3DMUA 3LNNA 4PQXA 1YI2A 3MAQA 1H9SA 1V1PB 1FGBD 3X3MA 3K0XA 3PO2H 1K8OA 1JOOA 5AFWA 2I5HA 4LFCL 2B2VA 3SK6A 1HR0L 2BA0A 3FKIG 3Q6SA 3HOUH 4A3JG 1XNRQ 4G57A 4K14A 3RZOH 1ET9A 3GO5A 1L1OC 4DK3C 2PW5A 4JI6L 2JYOA 4KK7A 1NR2A 4EQ5A 1B4OA 3HP3A 3LWEA 3AB9A 3R8BA 4K5VA 4H44C 1S5CD 2A69C 4U673 1U4MA 4F7XA 1EIGA 4LF7Q 2CQOA 3T56B 4C3HG 1IBMQ 1STHA 1GHKA 3M4YA 2KVMA 5C4HA 2N88A 3HOXG 5GAEC 1BCPD 3M9BA 2LKVA 4KJNA 4F8MA 1K83H 1UE5A 1ILQA 4ZK9B 3HFZB 3PSIA 2JA5G 4BY1B 2VQFL 1I5FA 1IKLA 2SNMA 2AMCB 1EU3A 3WDNA 3H0GG 1TWAH 3S1MH 4QUFA 1HFNA 5KIXA 3NTHA 4C3JH 3I4MH 2D9UA 1HNZL 4JBJA 4C1NK 4WORA 4JI2L 3F2CA 3H3VI 2LSSA 2F3VA 5CR3A 3ZJYC 1BCPF 3V96A 1AW7A 4UHVA 4X62Q 1L1OA 4CGYB 1QUQA 2YV5A 1XX8A 3H91A 4KY7A 4L5QA 1L0YB 2DJGC 5KNBA 4QGUA 4DUYL 3FKIB 1OO9B 5M5WB 2KA7A 4A3JB 3LGJA 5H1SE 1VQIA 4NB3A 4K5XA 2Q2TA 1VQNA 3VYSA 5ELFA 3VR3A 5CBEE 1I3QH 3PV0A 1CUKA 1BUVT 1LV9A 4OX9L 3U50C 2RDHA 1M1KC 1Y8NB 5TSSA 5IT9E 3M3YH 1PDQA 1QCBD 5EPJA 4WFN3 4WJ4A 3QOLA 5IYCH 1TU2B 1PVOA 3I7FA 3CW2C 1IBKL 5JJKA 2K33A 2G5DA 5FO7B 4C3HB 4K2KA 2G9DA 4O0AA 3U58A 4RGNA 3IAYA 2RF4A 2R7DA 3UI2A 3HOXB 1EY8A 3DWQA 2WIIB 4UP7A 3H6MA 3WWVA 3BVMA 3VYTA 3KBXA 4A3MH 3HOZG 1HR0Q 3FP9A 4GN4B 3J80i 1K9MC 3I2ZA 4R4TA 4P2CB 2TMPA 3K0YA 3MZ5A 2RHQB 3H0GB 3T13A 3NWSA 3CPWA 2B2YA 2DJFC 2KECA 2F0EA 2B2TC 4RWSC 1X3EA 3T1HL 4B3TL 4ME3A 3H3VH 1IKMA 2L15A 2VUMH 1D6EC 3K81C 3DUZA 3PO2B 3K5MA 4XDXA 5EKKA 5IE8A 2NVQH 4GKJQ 2R92H 1WCMG 3OOCA 5HGQA 1O78A 3T16A 1OXSC 1B50A 5M5XH 3UE0A 4A3KH 3U9OA 2LMCB 1TWCH 4IQZA 5K5PA 5ISRA 1T5XD 5EGTA 4HSPA 3CC2A 1SMYD 1WVLA 3J80c 3T1YQ 5IYBG 2L4NA 4A3BG 2K28A 4A4IA 3K5LA 2F0SA 4FF1A 3J7AF 1B3AA 3S2HH 1Q3LA 3S1QH 1MJEA 3KDFB 4KHVA 4IPHA 1LTAD 2KHSA 1SLJA 1HNZQ 1STGA 3J7A5 1ZYRD 1YHQA 4JI2Q 2AKWB 2NN6I 2FMCA 1B3QA 5KEEA 2UUAL 4OWWB 2K7VA 2NZ1D 3UDIA 2A19A 3A54A 4BBRH 1JB7A 3VR4A 4CJ0B 3PMFA 1XMQL 1TWHH 3G6JB 2H5XA 5M3MG 5JEAH 4DV0L 3K6OA 4P74A 3C1EA 3TP7A 1TT2A 4DK6C 4LF9Q 2EYFA 5CV8A 3S1MB 1T9HA 1TWFH 2BOSA 2H4OA 2V1CC 3I4MB 4R4IA 1HZAA 2VUMG 5I6YA 1IBKQ 3HOVH 5D3DA 2E5LQ 4JI0Q 3CCSA 3QB3A 2L55A 3L7ZC 4YIJA 2LFNA 1S4ZA 1WCMB 3K7UC 1R9TH 1NAPA 3S14B 2ZM6L 2A8VA 4P75A 3TZUA 1DD2A 5IP7G 4ZKBB 1UWVA 2EQSA 5IGDA 3AU7A 3CKIB 3L9AX 2VQEQ 1SYCA 1L0WA 1F9QA 1I3QB 2EPBA 3VR6A 5LMUL 3RZDH 3H3VC 1BQQT 1E2ZA 1NE3A 4A3FH 4GNXA 4R1JA 3HRZC 2F0IA 4TVAB 2MHVA 3BYTB 5D14A 4ZUIA 1BCPC 4A3BB 5C4JH 2MPMA 2QEXA 2CCZA 3S1RH 1KNEA 3JAMi 1EY0A 1MGSA 3KYHC 2YTVA 2N3SA 3T1HQ 2NN6H 4EQNA 4B3TQ 3P7JA 2SNSA 4E6IA 1B1ZA 1PV4A 2CHBD 1DOKA 1KD1C 2WAQG 5GADC 1EY5A 1LABA 1EU4A 5E4WC 2H1EA 4XYOA 2K03A 2HCIA 3PO3G 1SNCA 3KJPA 3I70A 1EY6A 5M3MB 1SFOH 4IUTA 2R93H 1Z47A 3U9SA 1PYBA 1VQJA 2OXPA 3K5NA 1NNXA 5IWAQ 3A56A 3NBHA 3ND9A 3MXGA 3Q8DA 3HS0C 4ULLA 4DR3L 2R3ZA 1KDAA 5EKLA 1XNQQ 3ER0A 3KLSA 4A93H 5JJLA 2K5VA 2A74C 3MC0B 4IUPA 1Y69U 1EQQA 2VUMB 4MNOA 5EJWA 2Y0SG 5IGGA 1XNQL 3I4NG 5CC4A 5LMNQ 1EIHA 5JVH3 3JAMc 3S16B 1BCPB 3I8ZA 5CBAE 5M3FG 4B3SL 1RD9D 1V1OA 1VMPA 4HIMA 1J9OA 4A3KB 4RG1A 3CC4A 5A2QE 4DNIA 1CK1A 1L2FA 2Q2HA 4YY3Q 2PPBC 1SNDA 4DV6L 1ILPA 4G4KA 1X54A 1YJWA 1NSNS 3W1GA 3PUZA 1XJVA 4IN3A 1JCKB 1GM5A 3NP8A 5C3WA 3MXPA 5FLXc 3S2HB 1YIJA 4JV5Q 2E2HB 4QJFA 2JEAI 3S15H 3NTKA 1SE2A 3C3LA 5E3FA 2EY1A 4A3LG 1TS4A 4C3IH 3E9IA 4LF4L 4HCEA 3ULPA 4MTNA 2EJFC 2WAQB 3HEJA 3J80E 2ES2A 4RMFA 2PMZB 1IBLQ 3PO3B 1I6HB 4DN4M 5CORA 4QF4A 1KRSA 2XNAC 3MA2B 2MP1A 5T1IA 2RKSA 1ESFA 3ITPA 1KLUD 2GA4B 2D0OA 5EPKA 1G6PA 5LMUQ 2AQ2B 3WOEA 1TVXA 4APVA 4OWTB 1HA6A 2A6HC 4Y7NH 1Q81C 1V1QA 1Q86C 3E3XA 1DYQA 3HOWH 3KOJA 4NXNL 2E2JH 3D31A 4A3IG 1W6KA 1SR3A 3I72A 3KLWA 1XMOL 1YEZA 2Y0SB 4PMCA 3I4NB 3MTSA 1B9MA 2QF7A 4PZ7A 4AH6A 1R9TB 2VZAA 5M3FB 2RQXA 4BBSH 2WAQE 4L5RC 1N33Q 4ABNA 4DAYA 2WB1G 5GAHC 1PZID 2ZTCA 2SOBA 4PMWA 4O42A 1T5EA 1AEXA 4DV5Q 1HNXL 1UEBA 1ZYRC 1GXDC 5L37A 3NK9A 2BA1A 2QW7A 1K28A 1LT5D 2XSCA 1Q7YC 2D5DA 4BA1I 4CDDC 5IGFA 2UXBL 1SYDA 1JQYD 2X6GA 4M1UB 1JC7A 1PTOC 4LUVA 3SGIA 1G91A 1EEID 4P72A 1N34Q 2UXCQ 3FVQA 3PF5A 2Y0SE 4X65Q 4CDEC 3MEHA 1WTOA 1J5EQ 4B3SQ 3E9HA 3M4OB 2F4IA 2PI2E 1SFOB 1N32L 1I4XA 5EPLA 4HMJA 1S72A 5CV5A 2F0HA 1VQ8A 4OIKA 3I73A 2FINB 3FRPB 3PUWA 2NTTA 4GLAC 1Q8KA 2HD3A 4LFBQ 3SR1A 4X64Q 4KKUA 2B63H 4BY1H 1CKNB 3CCQA 1KC8C 1NUCA 2Q8TA 2WV6D 2RDGA 4K8IA 4RGMA 4EX5A 4R9WA 3AFPA 2MJ8A 4ZUJA 1SEBD 1B8AA 4A3IB 1VQCA 1VQFA 1TIID 1WTWA 2NBFA 2F03A 2JA8H 2UXDQ 5ELDA 4IOAA 3BZKA 1VQ9A 1LTBD 1XTCD 1MIUA 4HAEA 4DV3Q 1BKBA 1EQRA 3TS0A 1PTOB 3MEFA 3T53B 2CVRA 4DV1Q 2QA4A 4IPCA 5EKIA 3DLLA 1OTCA 3FKIH 5M5WH 1HNWL 4TKOB 2K1BA 4IFDG 1I4GA 3W2DA 4A3JH 1G51A 3A8IE 2UUCL 1VQBA 3H15A 1G8ZD 2WKDA 4QUCA 4GLVB 3NHHA 4HJ9A 1EFWA 1IYVA 5C0XJ 3QOJA 5CV4A 1PH6A 4PMBA 4NP5A 1XMOQ 1YHBA 1NR4A 1NBWA 1CSPA 3WOFA 1SNMA 5FJ8G 2HT1A 1O7IA 1GUSA 3R3OA 5KRUA 4C3HH 3TS2A 2KCNA 4R8NA 4C2MB 5FLXE 2M9VA 4DKAC 1U4RA 2BH8A 3GQBA 3ERSX 1VS0A 3HOXH 2R6GA 4ZRZA 3K59A 2JJQA 1PZKD 1C7YA 3TP6A 2B63G 4JVZA 3PGZA 1FVIA 1I6VC 1X3PA 2IL8A 2NVYB 4DR1Q 2JA5H 1BR9A 4ZCKA 3KF6B 5DAUA 4LFAQ 4CKCA 2E2JB 1WTPA 2YTYA 1CKMA 3KK7A 4JI3L 1JICA 2BH2A 5EBCA 2LXKA 5M5YB 2UXBQ 4KLKA 1ENCA 4GS3A 2HHHL 4XT1B 3MVVA 4KD3A 4UY8C 1N36Q 4H0LC 2KHJA 2VY3A 2ZXOA 3NQTA 2FMMA 1V1PA 4IO9A 1HUMA 2MQHA 2RSOA 4L5SA 1N32Q 2SDFA 2ATWA 3D4RA 3NUCA 3EJIA 4ILWA 3I56A 2EOTA 2KEDA 3TEHB 4A3GH 2EYOA 1YJ9A 1EWHA 3OW2A 4KKTA 4BWGB 3BVZA 4XQNA 2MO1A 1H9RA 4YWKA 1BDOA 2M00A 2QEJC 4O2DA 4K2LA 5GQOA 3J81c 2PZWA 2RA4A 2EE1A 2IX1A 1W6JA 1CZWA 2QGQA 5GROA 1FD7D 3TZDA 2YYZA 1SMXA 1HXYD 3CPFA 1EYGA 1H9MA 2EY5A 1A62A 4XTCS 2KCCA 1H9KA 4FNFA 3GTKB 4K0KL 1C9OA 1PRTD 5CV7A 3A7LA 5I6WA 5DM63 2BDNA 1X56A 1G6ZA 1X6OA 5C3XA 2OQKA 1UE7A 3CF5A 2YU9B 2B63B 2PW7A 1S5BD 1AFPA 3BVGA 3HOZH 2K32A 3QG1A 1STBA 5KNCA 1F9RA 4H7BA 3I4LA 1S5FD 2UUCQ 2KJXA 2C5CA 1QB5D 4YHHL 1CTMA 2QCPX 4AYBG 2F4VQ 2JA8B 5G3LD 5F2DA 4X66L 1XWEA 2ZXRA 5K36G 2Z9HA 3HOYH 1GO3E 2JA7G 1SSOA 4Q0FA 3RLFA 1BBXC 4OELB 4NXML 3A8JE 1EY7A 4DGZA 4B3ML 4L6TB 2UUBL 3FPUB 3PCOB 4JI8L 3IL8A 3CMAA 1WCMH 3BG3A 4JI4Q 1DXMA 2ICEC 3S14H 1AZQA 4KD4A 2VL6A 2N49A 4A3GG 1HHVA 4JG2A 3FEWX 1VQGA 3QIAA 5G3LF 2ZTEA 3GTPB 1Z9FA 4NPSA 2ICIA 5FO8B 4RHSA 1K8AC 3NSWA 5IYBH 4B3RQ 2L9HA 1EEFD 1CA6A 4A3BH 4JI3Q 1FL0A 1HQMC 3CHBD 4OONA 4FF2A 4UP9A 4YWMA 2OWOA 1F9PA 1C48A 3SDZA 2DGYA 1SNQA 4JPBW 1RKNA 2IW3A 4LW1A 4DAPA 1RHPA 3C2PA 3BZDB 4DNRB 2Q8RE 4DR5L 1Q1BA 4LFCQ 1TY0A 2FXQA 1PH7A 5J39A 3OTOL 3MHBA 4KKSA 2L0CA 2JA5B 2JE6I 2F52A 4DUZL 3F2BA 3GTJB 3CCLA 2R7ZH 5M3MH 1JE5A 4YCVA 3OIPA 1EIYB 3TBIB 3EQLC 4Z9CB 2F0QA 1WOCA 4HMIA 4GOPC 4AYBB 4JI6Q 1GUNA 3A7AB 1DGSA 3OWEB 3H09A 1R4PB 3HOYG 1EWIA 1EOTA 3G6EA 1V9PA 4OO1I 4JW0A 1DOMA 3HKSA 2F0WA 3BDOA 2A6HD 2EY2A 2B8FA 1IYJB 2P5ZX 2K50A 2EYLA 2RBMA 1LTSD 2MUYA 3S16H 3NE5B 4RHRA 2IY5B 1SE4A 4K6LA 3T51B 3D4DA 3U4ZA 1WTHA 2A68C 5IP7H 3K57A 1DZ1A 1WTVA 5JVG3 4DK0A 4A3GB 3AMUA 1G2SA 2N8NA 2VQFQ 1QWYA 3UDXA 1E1OA 4UPAA 1V8QA 5BN3A 2PYKA 3OSOA 1EY4A 3W5OA 5NUCA 5IYDG 4DR6L 4LNQA 1D7QA 2NZHA 3I3CA 4YHHQ 2K75A 5JJZA 4DV4L 4AYBE 3NENA 3G71A 1WJJA 4FYDA 3CU7A 1PFSA 2E2HH 3NEMA 1L0XB 4QQBX 1FNUA 2IWHA 2RSNA 2A6ED 4GOPB 5D65A 4ID6A 3KDFA 2PO4A 3J81E 1SE8A 3F8TA 3SVMA 4Q5VA 2UUBQ 4HIDA 5JAVA 3CCUA 1J8IA 3O13A 2F0VA 1PHJA 3PO3H 3HOZB 1I6HH 1PTOD 4LJZC 4DUYQ 2R7ZG 3ERQA 5JPMC 4PV1C 2B2TA 4QL5A 1ZEQX 1SNPA 4ME5A 2F0OA 2HIXA 1F77A 4ZYSA 3A5ZB 3SEBA 1GKHA 1ML0D 4A76A 4OX9Q 4ALPA 3M4QA 2PQAB 3HOYB 2L1BA 3M4PA 3QR8A 4PZ6A 3GD7A 4QB4A 2RHSB 2YTXA 5I2YA 1E22A 1EYDA 4MIUA 1M8AA 5HURA 3I4NH 3GV3A 2Z6KC 1F9SA 3CP0A 1P16A 1GUGA 1NJIC 4RKBA 5M3FH 1MI2A 3ONAB 3HGBA 3OPOA 1PTOF 1X3FA 1GOZA 4BXXH 5KNDA 5J3BA 3R93A 1WTQA 2B8GA 2AHOB 4JBMA 4MHEA 3N52A 1RCVD 1YNND 2PQEA 3F1ZA 1PRTC 3KUPA 2AQ3B 3RUZA 1I94L 1SDFA 2BDOA 2HCCA 2NVTB 1STAA 1CHQD 2I07B 4HJ7A 2WFWA 3CCMA 2E75C 2EYPA 3V2TA 3GTQB 4RFBA 1A6XA 4F88A 1TWGH 2BE5D 4A3LH 2KENA 4PZ8A 4XXEA 4JOIC 1E3PA 1TS5A 2JXMB 5IP9G 1HH2P 2Q2IA 2GN5A 5CV9A 2HQLA 2K5HA 2QILA 4J8QA 1VDZA 4C1NI 2A1AA 3M4OH 2R7ZB 1QJOA 4DR7L 3DHQA 4OIJA 1KRTA 1F2LA 2L12A 5D3IB 5JEAJ 1NMGA 2K5NA 1X65A 4OO1G 4MN3A 3PUVA 1JORA 2DNCA 1KAAA 5BR8L 4DR6Q 2VB2X 4A75A 1HTLD 2X69A 2IT1A 1I4RA 3D6WA 5FOBB 4A3IH 1BOSA 4LF8L 5COYA 2KCTA 1YZ6A 1VQ5A 4CKBA 3E5SA 4FP5D 1PRTB 3P20A 5M9OA 4WJ3M 4OWXB 1CZGA 3C46A 2UUAQ 4JI5L 3TQYA 4BXXG 2PZTA 2AUKA 1E1TA 3SK8A 1PTOH 3HKZG 3EN2A 5IGBA 1XMQQ 3GTGB 2OF1A 4LUOA 2EYMA 2HDLA 4DV0Q 4A3EG 1VQ4A 4CBVA 3RNUA 1STEA 4JOIA 1PXUA 4JK1C 1EY9A 2E2DC 3URYA 4IFDI 1H95A 4V0BA 1F2ZA 5FKAC 3UE1A 5C4XH 4IUUA 3M7NA 1IL8A 4CJ1B 1KABA 2LS01 1Q12A 1EL0A 1Y8OB 1E2VA 1OXVA 5E7NA 1G2TA 1K3BC 2TSSA 4R4CA 4KHPL 1X3GA 1SROA 1E7ZA 5CYUA 1MJCA 1QVFA 5HGTA 1ESRA 2KBNA 3QJYA 5DM73 4C2MH 2ZM6Q 5I4DA 2CQAA 2Z0SA 1FYCA 4RAUC 2ZTDA 1PLFA 3GV6A 1EYCA 1X3QA 4RKLA 2F0DA 1WYDA 4UP8A 1SYFA 2ZJPA
chains in the Genus database with same CATH topology
2A73B 4WRDA 4WJWA 1EWCA 4XQJA 1B2TA 1DJRD 1NCVA 3D8GA 1LTTD 1XYIA 3OWFA 1EZ8A 3GTMB 3GTLB 4N9TA 1IHZA 1AN8A 2IX0A 2F0LA 5IGCA 5FO9B 3S9WA 1QG7A 3HKZB 4HCSA 4XIGS 5IIFA 2A5HA 2R61A 2WP8J 1S5DD 5EBDA 2RVLA 4LAAA 2RDFA 4A3EB 3R2TA 2A6EC 4K5WA 1STYA 4IFDH 3BS1A 2ZXPA 4DXFA 2J7ZA 5KYIA 4JBWA 1HFGA 4RCNA 1TWGB 4CKEA 4K6DA 4CHTB 3I90A 2B2UC 4NMZA 1H9JA 2NUCA 1CQFA 1IYUA 1TR5A 2O5IC 2B2WC 1PMRA 3D6CA 1JOKA 2SEBD 3HZXA 3M85A 4KJOA 1JWMD 3IFDA 3VA7A 2F0MA 3EROA 1I4QA 1LT3D 1ONLA 2Z1CA 1M4VA 1RJTA 2AWOA 5LL6X 1SYGA 2XWBB 4ZQ3A 1A3TA 3TDQA 1RTNA 5C6AA 3P1HA 5KGUA 1YNNC 2EJGC 2B39A 2WB1B 4IUVA 3VYUA 4H13C 4IUNA 4DK1A 1Y8PB 2F0GA 3EVQA 4IURA 1SBBB 3TP5A 4FF3A 1LTRD 2BE5C 2HQEA 4N9PA 5C44B 3M7GA 3JAME 2E76C 2F0UA 5ELCA 1LO5D 5C4XB 1V43A 3IFTA 5ELEA 1UUPA 2WINB 2A68D 1IW7D 1PYWD 2F0TA 2K04A 3K7AB 1CM9A 1ZXTA 5C0XG 5FK9C 4U68A 2F3WA 2B2VC 1SJHD 3NBIA 2AQ1B 1DOLA 3PIO3 2NTSA 3VR2A 3A8KE 1E0BA 3A55A 4A3DB 4RH6A 1EZ6A 1MD2D 2O2LD 1HA5A 1I4HA 2VNUD 2DNEA 1X32A 4X3TA 5E1FA 3CQZB 4DFAA 1K8MA 3S17B 5K36H 2OEOA 3KLSX 1TS3A 2XVSA 3QO2A 5J1ZA 1WD0A 2EYJA 2WACA 2FFKB 5J22A 3C1FA 4DA2A 1SYEA 3W3AA 1QNUA 2VXWA 1H9SB 3NTIA 3RD4A 1SAPA 1HUNA 3K58A 5JPNC 3DXJC 1F2YA 1MBYA 1WD1A 2CW0D 2IPKD 3GP7A 1DM0B 4KMUC 1SXTA 3D3RA 1GUOA 3KLRA 3S1NB 3E6ZX 1O7LA 1A3VA 1C8CA 1JWSD 1LTGD 4X3SA 4TSSA 1CI3M 2V4DA 1UEAB 4OL7A 4ZLTF 1OXUA 1Z6HA 2O4XA 1BXTA 1Y1WB 3RMHA 3S2DB 2JA6B 3J7YW 3FDTA 1PZJD 2K01A 1PFNA 1II3A 4L63B 3I91A 4LK1C 1QNKA 2HDMA 2E74C 1PRTF 2F0NA 4PNYA 2WKCA 1O7YA 3IKJA 4TQUS 5DEHA 4XYQA 1VCIA 2X6LA 3OMCA 4QCLA 3DWPA 3GTOB 2QDBA 2MGSA 1D5MC 4FXKC 1WTRA 1QE6A 5CMDA 3F2UA 2B2YC 2PZUA 3L3OC 4FF4A 1GJXA 3EFXD 1VF7A 3FPPA 1TS2A 5C5MA 2K05A 4B9WA 3KBGA 3D4WA 2Q8IB 2ZT9C 4IUQA 4FO2A 3PUXA 2AWNA 4EQOA 2F1MA 2HUGA 2F0FA 4BY7B 3ND8A 1UAPA 1XXGA 2FJ2A 1RODA 5KYLA 2JA7B 1BO0A 4KHZA 3J7AV 5IT9L 4KTAA 2JEBI 1CFMA 4L8JA 4TRDA 2K5WA 4B9XA 4C3JG 1B53A 1A2UA 1IW7C 5IOCA 4J1MA 1A3UA 1AZPA 3MWYW 1Q1EA 4G7ZC 3EA6A 5LL6S 1Q8IA 4KY6A 3HOUB 2PCFB 2ID0A 3RZOB 2F0PA 4ZKCB 2XRSD 2K6AA 1RTOA 3DEOA 2J4XA 5CV6A 5ELBA 4DXGA 5LHY1 1QOHA 3LWUA 4G7OC 1Q90A 3VR5A 1A2TA 2EY6A 1FNWA 1CA5A 4OO1H 1KLGD 2EDGA 1K83B 1OXTA 2NVXB 1ET6A 5IODA 3NPPA 1B44D 1HQRD 1JWUD 2K5QA 4RGOS 4FVMA 2O5JC 5C5LA 2CW0C 5C3EB 1TWAB 4IALA 3E0JA 4KY5A 3SHLA 4C3JB 3PIP3 1PFBA 4BS9A 2NYZD 1D2BA 3DWAA 3J81L 1EYAA 2NB0A 4O1NA 1ENFA 1D1IA 2D62A 2XWJB 1EQTA 2OT2A 4I65A 1UNSA 3BDCA 1MSHA 4UAIA 3SK4A 1LACA 2G9HD 1TQOA 2IX3A 2PNRC 3M3YB 2F0KA 2NWGA 3T4AC 3Q0AA 5JOBA 3SXHA 4FXDA 3OHXC 4ODGA 4BA2I 1D5ZC 3G7LA 1FNVA 1O7ZA 2JP1A 4OGQC 4NKLA 3V05A 1KDBA 1TKWB 5A35A 4DF7A 4A3MB 2L11A 1KDCA 1RF2D 3QWNA 5JEAG 1YNJD 1HCZA 1HTPA 2DY8A 2DY7A 2I46A 2DN8A 1CT1D 4F87A 3FMCA 4X3UA 4RGTA 2F0JA 2M2LA 3H94A 3Q23A 2XIWA 3CRKC 2FHTA 1C4QA 1ENAA 3K5OA 2NVQB 2R92B 1JE4A 3DM1A 3TSSA 4EQPA 1LT6D 5M5XB 4NW2A 1VMCA 3SK5A 3MFYA 1I50B 1PFMA 1TWCB 4R8IA 1O80A 1U9RA 2E2IB 2EXZA 3MFGA 1SJED 1DCZA 2XRQD 1WTXA 1OXXK 3S1QB 3ZYYX 5C0XI 5IGEA 2EZVA 4HN7A 2NN6G 1D1KA 1AP0A 4DAVA 5A2QL 1RDPD 2L5TA 3MXUA 4S3SA 4QIWB 4BBRB 4XT3B 1BNZA 1TWHB 4HSVA 4J6HA 4G7HC 2A69D 3TP8A 2Z8LA 1TWFB 1BF4A 4X3KA 1JOQA 1U4PA 1VF5C 3HOVB 1GHJA 3SE0A 3J80L 2EJMA 2Z4IA 5EQ0A 4IZ8A 1F2MA 4OHJA 4RA8A 1SMYC 1FR3A 3HG9A 1STNA 3Q24A 2EVBA 1HPCA 1JB3A 3RZDB 1SYBA 4KN4C 4A3FB 3BYYB 1DONA 3P75A 1GUWA 5C4JB 4HTHA 5C0XH 3S1RB 4LMQD 5I9OA 3OMGA 4CJ2C 1B9NA 2D2CC 2AUJD 1EQVA 4C3IG 1D5XC 4KN7C 2N55A 2KUMA 1I4PA 4NDXA 1SNOA 5BN4A 2Z4HA 2R93B 4RCOA 1ICWA 3Q22A 1LLRD 3N6RA 2EYHA 2K5DA 2XN9C 1CHPD 4KV6A 4A93B 4B08A 2BCOA 1S5ED 1HRJA 3VYRA 4UDUC 3DEPA 3TMEA 4C56C 1U4LA 2B2UA 5T1GA 4HR7B 5DNFA 2QKIC 2B2WA 5C4ZA 3PUYA 4KI0A 4IFDJ 2IJ0A 1EFID 2ENBA 4GZYC 3TN2A 1LTID 4QMGA 1ZKOA 2LY7A 4K8JA 2J0TD 1JR0D 1A15A 5CGKA 4I7ZC 3S15B 4DNTB 3CRLC 2KEEA 5I9PA 1MSGA 1YNJC 2KQ3A 4C3IB 4V190 3R2IA 4DU9A 4XQQA 1Z7TA 3OIQA 4HEDA 2JSOA 3BDLA 5E4XA 1CQVA 1QILA 2C9OA 1G291 3MXNA 3JAML 4Y7NB 4EGVA 1TY2A 5I2XA 1KTKA 3LX0A 3HOWB 1E2WA 1R4QB 5BN5A 4M8AA 1LT4D 4FXGC 3X3NA 1SE3A 3KF8A 3NQIA 3NXWA 1Y1VB 1KNAA 3NWTA 3OW7A 5FLXL 2VB3X 4EVOA 1GUTA 3VA5A 4BBSB 2KOLA 4ZAIA 3DMUA 3LNNA 4PQXA 3MAQA 1H9SA 1V1PB 1FGBD 3X3MA 1K8OA 1JOOA 5AFWA 2B2VA 3SK6A 2BA0A 3Q6SA 4G57A 4K14A 1ET9A 3GO5A 2PW5A 2JYOA 4KK7A 1NR2A 1B4OA 3HP3A 3LWEA 3AB9A 3R8BA 4K5VA 4H44C 1S5CD 2A69C 4U673 1U4MA 4F7XA 1EIGA 3T56B 4C3HG 1STHA 1GHKA 3M4YA 2KVMA 5C4HA 2N88A 1BCPD 2LKVA 4KJNA 4F8MA 1ILQA 4ZK9B 4BY1B 1IKLA 2SNMA 1EU3A 3WDNA 4QUFA 1HFNA 5KIXA 3NTHA 2D9UA 4C1NK 4WORA 2F3VA 5CR3A 1BCPF 3V96A 1AW7A 4CGYB 1XX8A 3H91A 4KY7A 1L0YB 5KNBA 3FKIB 1OO9B 5M5WB 2KA7A 4A3JB 4K5XA 3VYSA 5ELFA 3VR3A 5CBEE 3PV0A 1BUVT 1LV9A 2RDHA 1Y8NB 5TSSA 5IT9E 1PDQA 1QCBD 5EPJA 4WFN3 3QOLA 1TU2B 2K33A 5FO7B 4C3HB 4K2KA 2G9DA 4RGNA 3IAYA 3UI2A 3HOXB 1EY8A 3DWQA 2WIIB 3H6MA 3BVMA 3VYTA 3KBXA 4P2CB 2TMPA 3K0YA 3MZ5A 3H0GB 3T13A 3NWSA 2B2YA 2KECA 2F0EA 2B2TC 4RWSC 1IKMA 1D6EC 3DUZA 3PO2B 3K5MA 4XDXA 5EKKA 3OOCA 1O78A 3T16A 1OXSC 1B50A 3U9OA 2LMCB 4IQZA 5K5PA 5ISRA 1T5XD 5EGTA 4HSPA 1SMYD 1WVLA 2L4NA 2K28A 3K5LA 2F0SA 4FF1A 3J7AF 1B3AA 1Q3LA 4KHVA 1LTAD 2KHSA 1STGA 1ZYRD 2NN6I 2FMCA 5KEEA 2K7VA 2NZ1D 3A54A 3VR4A 4CJ0B 3PMFA 3G6JB 5JEAH 3K6OA 3C1EA 3TP7A 1TT2A 2EYFA 5CV8A 3S1MB 2BOSA 2H4OA 3I4MB 5I6YA 5D3DA 3QB3A 2L55A 3L7ZC 4YIJA 2LFNA 1S4ZA 1WCMB 1NAPA 3S14B 1DD2A 3TZUA 4ZKBB 5IGDA 3AU7A 3CKIB 3L9AX 1SYCA 3H3VC 1F9QA 1I3QB 2EPBA 3VR6A 1BQQT 1E2ZA 3HRZC 2F0IA 2MHVA 3BYTB 5D14A 4ZUIA 1BCPC 4A3BB 2MPMA 1KNEA 1EY0A 1MGSA 2NN6H 4EQNA 3P7JA 2SNSA 4E6IA 1B1ZA 2CHBD 1DOKA 1EY5A 1LABA 1EU4A 5E4WC 2H1EA 4XYOA 2K03A 2HCIA 1SNCA 3I70A 1EY6A 5M3MB 4IUTA 1Z47A 3U9SA 2OXPA 3K5NA 3A56A 3NBHA 3ND9A 3MXGA 3HS0C 4ULLA 2R3ZA 1KDAA 5EKLA 3KLSA 2A74C 3MC0B 4IUPA 1Y69U 2VUMB 5EJWA 5IGGA 5CC4A 1EIHA 5JVH3 3S16B 1BCPB 3I8ZA 5CBAE 1RD9D 1V1OA 1VMPA 1J9OA 4A3KB 5A2QE 1CK1A 2PPBC 1SNDA 1ILPA 4G4KA 1NSNS 3PUZA 4IN3A 1JCKB 3NP8A 5C3WA 3MXPA 3S2HB 2E2HB 2JEAI 3NTKA 1SE2A 3C3LA 5E3FA 2EY1A 1TS4A 4HCEA 2EJFC 2WAQB 3HEJA 3J80E 2PMZB 3PO3B 1I6HB 4DN4M 5CORA 4QF4A 2XNAC 3MA2B 2MP1A 5T1IA 2RKSA 1ESFA 3ITPA 1KLUD 2GA4B 5EPKA 2AQ2B 3WOEA 1TVXA 1HA6A 2A6HC 1DYQA 3D31A 1W6KA 3I72A 2Y0SB 4PMCA 3I4NB 3MTSA 1B9MA 2QF7A 1R9TB 5M3FB 2RQXA 4ABNA 4DAYA 1PZID 2SOBA 4PMWA 4O42A 1T5EA 1AEXA 1ZYRC 1GXDC 3NK9A 2BA1A 1LT5D 2XSCA 2D5DA 4BA1I 5IGFA 1SYDA 1JQYD 2X6GA 4M1UB 1JC7A 1PTOC 1G91A 1EEID 3FVQA 3MEHA 1WTOA 3M4OB 2F4IA 1SFOB 1I4XA 5EPLA 4HMJA 5CV5A 2F0HA 4OIKA 3I73A 2FINB 3FRPB 3PUWA 2NTTA 3SR1A 4KKUA 1NUCA 2Q8TA 2WV6D 2RDGA 4K8IA 4RGMA 4R9WA 2MJ8A 4ZUJA 1SEBD 4A3IB 1TIID 1WTWA 2NBFA 2F03A 5ELDA 1LTBD 1XTCD 4HAEA 1PTOB 3T53B 2CVRA 5EKIA 4TKOB 2K1BA 4IFDG 1I4GA 3W2DA 3A8IE 1G8ZD 2WKDA 4QUCA 3NHHA 1IYVA 5C0XJ 3QOJA 5CV4A 4PMBA 4NP5A 1NR4A 3WOFA 1SNMA 1GUSA 3R3OA 5KRUA 2KCNA 4R8NA 4C2MB 5FLXE 2M9VA 1U4RA 3GQBA 2R6GA 4ZRZA 3K59A 1PZKD 3TP6A 1I6VC 1X3PA 2IL8A 2NVYB 1BR9A 5DAUA 4CKCA 2E2JB 1WTPA 3KK7A 1JICA 5EBCA 5M5YB 1ENCA 4XT1B 3MVVA 4KD3A 4H0LC 2ZXOA 3NQTA 2FMMA 1V1PA 1HUMA 2RSOA 2SDFA 3D4RA 3NUCA 3EJIA 4ILWA 2EOTA 2KEDA 2EYOA 1EWHA 4KKTA 4BWGB 3BVZA 4XQNA 1H9RA 1BDOA 2M00A 2QEJC 4K2LA 2PZWA 2RA4A 2EE1A 2IX1A 1W6JA 1CZWA 1FD7D 3TZDA 2YYZA 1HXYD 1H9MA 2EY5A 4XTCS 2KCCA 1H9KA 4FNFA 3GTKB 1PRTD 5CV7A 5I6WA 3A7LA 5DM63 2BDNA 1G6ZA 5C3XA 2YU9B 2B63B 2PW7A 1S5BD 1AFPA 3BVGA 2K32A 3QG1A 1STBA 5KNCA 1F9RA 4H7BA 3I4LA 1S5FD 2KJXA 2C5CA 1QB5D 1CTMA 2QCPX 2JA8B 5G3LD 5F2DA 1XWEA 2ZXRA 5K36G 1SSOA 4Q0FA 3RLFA 1BBXC 3A8JE 1EY7A 4DGZA 4L6TB 3FPUB 3IL8A 3BG3A 1DXMA 2ICEC 1AZQA 4KD4A 1HHVA 3FEWX 3QIAA 5G3LF 3GTPB 2ICIA 5FO8B 4RHSA 3NSWA 2L9HA 1EEFD 1CA6A 1HQMC 3CHBD 4FF2A 1F9PA 1C48A 3SDZA 1SNQA 1RKNA 2IW3A 4DAPA 1RHPA 3C2PA 3BZDB 4DNRB 2Q8RE 1Q1BA 1TY0A 5J39A 3MHBA 4KKSA 2L0CA 2JA5B 2JE6I 3GTJB 3OIPA 3TBIB 3EQLC 4Z9CB 2F0QA 4HMIA 4AYBB 1GUNA 3A7AB 3OWEB 3H09A 1R4PB 1EOTA 4OO1I 1DOMA 2F0WA 3BDOA 2A6HD 2EY2A 2B8FA 2EYLA 2RBMA 1LTSD 2MUYA 3NE5B 4RHRA 1SE4A 4K6LA 3T51B 3D4DA 2A68C 1DZ1A 3K57A 1WTVA 5JVG3 4DK0A 4A3GB 3AMUA 1G2SA 1QWYA 1V8QA 5BN3A 2PYKA 3OSOA 1EY4A 5NUCA 3I3CA 5JJZA 4FYDA 3CU7A 1L0XB 1FNUA 2IWHA 2RSNA 2A6ED 5D65A 4ID6A 2PO4A 3J81E 3SVMA 4Q5VA 5JAVA 1J8IA 3O13A 2F0VA 3HOZB 1PTOD 4LJZC 3ERQA 5JPMC 4PV1C 2B2TA 1ZEQX 1SNPA 4ME5A 2F0OA 1F77A 4ZYSA 3SEBA 1ML0D 3HOYB 2L1BA 3GD7A 4QB4A 5I2YA 1EYDA 4MIUA 1M8AA 5HURA 3GV3A 1F9SA 1GUGA 4RKBA 1MI2A 3ONAB 3HGBA 3OPOA 1PTOF 1GOZA 5KNDA 3R93A 1WTQA 2B8GA 4MHEA 3N52A 1RCVD 1YNND 2PQEA 3KUPA 1PRTC 2AQ3B 3RUZA 1SDFA 2BDOA 2HCCA 2NVTB 1STAA 1CHQD 2I07B 2E75C 2EYPA 3V2TA 3GTQB 4RFBA 1A6XA 4F88A 2BE5D 4XXEA 1TS5A 2JXMB 5CV9A 2QILA 4J8QA 1VDZA 4C1NI 2R7ZB 1QJOA 3DHQA 4OIJA 1F2LA 2L12A 5D3IB 5JEAJ 4OO1G 4MN3A 3PUVA 1JORA 2DNCA 1KAAA 2VB2X 1HTLD 2X69A 2IT1A 1I4RA 3D6WA 5FOBB 1BOSA 5COYA 4CKBA 3E5SA 4FP5D 1PRTB 3P20A 5M9OA 1CZGA 3C46A 2PZTA 2AUKA 3SK8A 1PTOH 5IGBA 3GTGB 2OF1A 2EYMA 2HDLA 4CBVA 1STEA 1PXUA 4JK1C 1EY9A 2E2DC 3URYA 4IFDI 4V0BA 1F2ZA 5FKAC 3M7NA 4IUUA 1IL8A 4CJ1B 1KABA 2LS01 1Q12A 1EL0A 1Y8OB 1E2VA 1OXVA 1G2TA 2TSSA 5CYUA 5HGTA 1ESRA 3QJYA 5DM73 5I4DA 2CQAA 1FYCA 4RAUC 1PLFA 3GV6A 1EYCA 1X3QA 4RKLA 2F0DA 1SYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDX A;  4IAL A;  1SNO A;  2KHS A;  2SOB A;  1KDA A;  1STG A;  3D4D A;  2F0F A;  4WRD A;  1SNM A;  4KY5 A;  5EKL A;  3SHL A;  4IUN A;  3NXW A;  4K5X A;  1U9R A;  1A3V A;  3R3O A;  1AEX A;  5KEE A;  5KRU A;  2F0G A;  3EVQ A;  4R8N A;  5F2D A;  3TP5 A;  5CV9 A;  2HQE A;  4N9P A;  1EYA A;  2EXZ A;  3NK9 A;  4EVO A;  2F0U A;  3D8G A;  3VA5 A;  5IGG A;  4OL7 A;  5KYL A;  3OWF A;  5CC4 A;  3PMF A;  2O4X A;  2PYK A;  3DMU A;  1EY4 A;  3OSO A;  2EYH A;  5NUC A;  1JOQ A;  1EZ8 A;  4I65 A;  1EY7 A;  3TP6 A;  4DGZ A;  3QOL A;  4N9T A;  5IGF A;  1SYD A;  5IGE A;  1JOO A;  1IHZ A;  3DHQ A;  3BDC A;  3C1E A;  4KTA A;  3TP7 A;  1TT2 A;  4KV6 A;  2F0L A;  5DAU A;  5IGC A;  3SK4 A;  3SK6 A;  4K2K A;  2EYF A;  4TRD A;  5CV8 A;  1SND A;  3S9W A;  2F0T A;  4S3S A;  4KD4 A;  4B9X A;  1JOR A;  5IIF A;  3MEH A;  1TQO A;  4ID6 A;  4G57 A;  3TME A;  1A2U A;  1EY8 A;  1KAA A;  1NSN S;  4K14 A;  1II3 A;  2RDF A;  4LAA A;  5IOC A;  4J1M A;  1A3U A;  3H6M A;  4K5W A;  4J6H A;  5I6Y A;  2PW5 A;  1STY A;  2F3W A;  1ENC A;  2F0K A;  5JAV A;  3NP8 A;  4HMJ A;  5C3W A;  2F0V A;  3MXP A;  3E5S A;  5CV5 A;  5M9O A;  2F0H A;  3QB3 A;  5JOB A;  3MVV A;  3SXH A;  3TP8 A;  3ERQ A;  4K5V A;  4YIJ A;  4KD3 A;  2F0N A;  5C4Z A;  4PNY A;  4KY6 A;  4ODG A;  5KYI A;  3SR1 A;  5E3F A;  1SNP A;  2EY1 A;  4F7X A;  3NQT A;  4ME5 A;  2ENB A;  2PZT A;  2F0O A;  1EZ6 A;  1NUC A;  3MZ5 A;  4K6D A;  4NMZ A;  5IGD A;  4NKL A;  3SK8 A;  4K8I A;  2NUC A;  1STH A;  4QMG A;  1SYC A;  3T13 A;  2F0P A;  1TR5 A;  1KDB A;  3HEJ A;  5IGB A;  1SNQ A;  4ZUJ A;  5C4H A;  1RKN A;  4K8J A;  2OF1 A;  3NUC A;  5DEH A;  3EJI A;  4DF7 A;  2EYM A;  4QB4 A;  1KDC A;  3OMC A;  2F0E A;  5E1F A;  4DFA A;  3D6C A;  2EYO A;  4QF4 A;  5CGK A;  5CV6 A;  2F0I A;  1EYD A;  1JOK A;  2LKV A;  4KJN A;  3HZX A;  4MIU A;  4F8M A;  2RKS A;  2QDB A;  4IZ8 A;  1F2M A;  1EY9 A;  4ZUI A;  3ITP A;  2M00 A;  5HUR A;  4K2L A;  5J39 A;  5I9P A;  2PZW A;  3MHB A;  5EKK A;  2KQ3 A;  4KJO A;  1STN A;  1EY0 A;  1F2Z A;  2OEO A;  4RKB A;  1KAB A;  3T16 A;  2F0M A;  3ERO A;  5J1Z A;  2SNM A;  2PZU A;  2F0Q A;  1A2T A;  4DU9 A;  2EY6 A;  2EYJ A;  2F0J A;  4EQN A;  1SYB A;  2EY5 A;  4HMI A;  2SNS A;  4E6I A;  2WAC A;  3U9O A;  3BDL A;  3P75 A;  5J22 A;  1EY5 A;  3C1F A;  5K5P A;  1SYE A;  5ISR A;  5CV7 A;  5C5M A;  5I6W A;  5KIX A;  1SYG A;  4B9W A;  5EGT A;  1ENA A;  4HTH A;  5HGT A;  1SNC A;  4PMC A;  4ZQ3 A;  1A3T A;  4H7B A;  3D4W A;  1F2Y A;  2PQE A;  1EY6 A;  4WOR A;  5C6A A;  5I9O A;  3OMG A;  3P1H A;  2F3V A;  5CR3 A;  2F0W A;  3RUZ A;  5C3X A;  1EYC A;  5IOD A;  5KGU A;  1STA A;  2EY2 A;  2F0D A;  1EQV A;  2F0S A;  2PW7 A;  3NHH A;  4RKL A;  4EQP A;  4EQO A;  2EYL A;  2RBM A;  3LX0 A;  3QOJ A;  2OXP A;  4KY7 A;  1STB A;  2EYP A;  5CV4 A;  3SK5 A;  3V2T A;  4KHV A;  5C5L A;  4PMB A;  1SYF A;  4NP5 A; 
#chains in the Genus database with same CATH topology
 2A73 B;  3L0O A;  5GAG C;  4WRD A;  2NVY H;  4WJW A;  1EWC A;  4XQJ A;  1B2T A;  1DJR D;  1NCV A;  2MFI A;  1RIP A;  3D8G A;  1LTT D;  1XYI A;  1PH2 A;  3OWF A;  5M5Y H;  1EZ8 A;  3GTM B;  3GTL B;  4N9T A;  1IHZ A;  1JJ2 A;  1AN8 A;  2IX0 A;  2F0L A;  5IGC A;  2PMZ E;  5FO9 B;  3AEV A;  3S9W A;  1B7Y B;  1QG7 A;  2PI2 A;  3HKZ B;  2K4K A;  4HCS A;  4XIG S;  2A5H A;  1U5K A;  5IIF A;  2R61 A;  2WP8 J;  1S5D D;  5EBD A;  2RVL A;  4LAA A;  2RDF A;  4A3E B;  4LF5 L;  3R2T A;  5C44 G;  2A6E C;  4K5W A;  1STY A;  2IHF A;  4IFD H;  2PNH A;  3BS1 A;  2ZXP A;  5C4X G;  4DXF A;  2J7Z A;  4DR3 Q;  2KHI A;  5KYI A;  4JBW A;  1HFG A;  4RCN A;  1TWG B;  1VQK A;  4JC0 A;  4CKE A;  4K6D A;  4CHT B;  3I90 A;  2B2U C;  4NMZ A;  1H9J A;  2NUC A;  1CQF A;  1ICF B;  1IYU A;  1M90 C;  1TR5 A;  2O5I C;  1PH1 A;  2B2W C;  5FJ8 H;  1PMR A;  5AJ3 L;  1K3R A;  3D6C A;  3OYY A;  1JOK A;  3GTK H;  2SEB D;  3HZX A;  4JI7 L;  3M85 A;  4KJO A;  4DV6 Q;  3HKZ E;  4JYA L;  1JWM D;  3IFD A;  3VA7 A;  2F0M A;  3ERO A;  2YU9 H;  1I4Q A;  1LT3 D;  3S2D H;  4A3D G;  1HR0 W;  2K14 A;  1ONL A;  2Z1C A;  1M4V A;  1RJT A;  1CKN A;  2AWO A;  4Y52 H;  5LL6 X;  1SYG A;  2XWB B;  3UDF A;  4ZQ3 A;  1A3T A;  3TDQ A;  1XNR L;  1RTN A;  5C6A A;  2Z6B A;  3P1H A;  1X55 A;  4LF4 Q;  5KGU A;  4KHP Q;  1YNN C;  2EJG C;  3F2D A;  1VQH A;  2IHE A;  2B39 A;  2WB1 B;  4IUV A;  3VYU A;  1HZB A;  4H13 C;  3CCE A;  3BZC A;  4IUN A;  4DK1 A;  5IY0 A;  1Y1V G;  1XPO A;  1Y8P B;  4FDB A;  2F0G A;  3EVQ A;  4LF7 L;  4IUR A;  1SBB B;  3TP5 A;  4FF3 A;  1LTR D;  2BE5 C;  2HQE A;  1IXR A;  4N9P A;  5C44 B;  4HJA A;  3M7G A;  3JAM E;  2E76 C;  1IBM L;  2F0U A;  1PH9 A;  5ELC A;  1LO5 D;  5C4X B;  3GTO H;  1V43 A;  3IFT A;  5ELE A;  1UUP A;  1C0A A;  3GTP H;  1VQP A;  2WIN B;  2B29 A;  4NXN Q;  2A68 D;  1QVG A;  1Y14 B;  2R7F A;  1IW7 D;  1PYW D;  2F0T A;  3RLN A;  2OTL A;  2K04 A;  3K7A B;  1CM9 A;  1ZXT A;  5C0X G;  1VQ7 A;  5FK9 C;  4U68 A;  1KQS A;  1SN8 A;  2F3W A;  2B2V C;  1SJH D;  3NBI A;  1WI5 A;  2WB1 E;  2AQ1 B;  2I5L X;  4CDF C;  1KIX A;  2ZJQ A;  1K0S A;  3GDE A;  1DOL A;  3PIO 3;  2NTS A;  4N8F A;  3VR2 A;  1Y1W G;  3A8K E;  1E0B A;  2JA6 G;  3A55 A;  1HNX Q;  4A3D B;  1YVC A;  4RH6 A;  1EZ6 A;  4X62 L;  3GTJ H;  1MD2 D;  2O2L D;  3MXN B;  1HA5 A;  1I4H A;  2VNU D;  3KF6 A;  2DNE A;  2K52 A;  1X32 A;  4X3T A;  4NXM Q;  5E1F A;  4BY7 H;  3CQZ B;  4DFA A;  2RCF A;  1K8M A;  4OXP A;  2RCN A;  3UDG A;  3S17 B;  1BBU A;  5K36 H;  2JA7 H;  3L2P A;  3KF8 B;  2OEO A;  3KLS X;  1TS3 A;  2XVS A;  3QO2 A;  5J1Z A;  3RN5 A;  1WD0 A;  3CCV A;  2EYJ A;  2WAC A;  2FFK B;  5J22 A;  3NEL A;  3C1F A;  4DA2 A;  4IJL A;  1SYE A;  1S40 A;  3W3A A;  1QNU A;  2VXW A;  1H9S B;  3NTI A;  3RD4 A;  4JYA Q;  1SAP A;  2GVB A;  1HUN A;  1JJC B;  3K58 A;  5JPN C;  3DXJ C;  1F2Y A;  1MBY A;  1WD1 A;  1WFQ A;  2CW0 D;  2CWP A;  2GVA A;  2IPK D;  2C35 B;  3GP7 A;  3JC6 6;  1DM0 B;  4KMU C;  1VQL A;  1YBY A;  1SXT A;  3J81 j;  3D3R A;  1GUO A;  3KLR A;  1UE1 A;  3S1N B;  3E6Z X;  1O7L A;  1KL9 A;  1A3V A;  1C8C A;  1JWS D;  1LTG D;  4X3S A;  4TSS A;  1CI3 M;  3A74 A;  2OCE A;  1CSQ A;  2V4D A;  4DAM A;  4DR4 L;  1UEA B;  2I5M X;  4OL7 A;  4ZLT F;  1OXU A;  4DV7 L;  1Z6H A;  2O4X A;  5EAY A;  4LF6 L;  1BXT A;  1Y1W B;  3RMH A;  3CD6 A;  3S2D B;  1A63 A;  2JA6 B;  3J7Y W;  1HNW Q;  3FDT A;  1PZJ D;  4PG3 A;  4H02 A;  2K01 A;  4JI1 L;  1PA6 A;  4POF A;  4GKJ L;  3PF4 A;  4BY7 G;  1PFN A;  2ASB A;  1II3 A;  4IPD A;  4L63 B;  3IRB A;  3B6Y A;  3I91 A;  4LK1 C;  4X6A H;  4HIO A;  4MZ9 A;  3I55 A;  4OEM B;  1QNK A;  2HDM A;  2E74 C;  2NVX H;  1PRT F;  2F0N A;  4PNY A;  2WKC A;  4DV2 L;  1LTL A;  3T1Y L;  5FLM G;  5LMN W;  1MKH A;  1IL2 A;  1O7Y A;  5C3E H;  3IKJ A;  4A3C G;  1VQD A;  4IPG A;  2B3G A;  4TQU S;  5DEH A;  4XYQ A;  2UU9 L;  1VCI A;  3OMC A;  2X6L A;  2I0Q A;  1X9N A;  4QCL A;  3DWP A;  1L1O B;  1HZ9 A;  3GTO B;  1FJG L;  1HJP A;  1QUQ B;  1XPR A;  2QDB A;  1QZH A;  3PO2 G;  2MGS A;  1D5M C;  1D8L A;  4FXK C;  4J15 A;  1WTR A;  1QE6 A;  5CMD A;  1Q82 C;  3F2U A;  2B2Y C;  5IYD H;  2NVT H;  2PZU A;  3HOU G;  1NY4 A;  3L3O C;  3PQI A;  3E0E A;  4JCV E;  4FF4 A;  1GJX A;  1CKO A;  3EFX D;  1VF7 A;  3CCJ A;  3FPP A;  3GTQ H;  4LWC A;  1TS2 A;  2HHH Q;  4LF9 L;  5C5M A;  2K05 A;  4B9W A;  3KBG A;  1BVS A;  1A8V A;  4AQY L;  3D4W A;  2Q8I B;  2ZT9 C;  4IUQ A;  1J6Q A;  4FO2 A;  3PUX A;  2AWN A;  4EQO A;  2F1M A;  2E5L L;  4JI0 L;  4DR2 L;  1K0R A;  2HUG A;  2F0F A;  4R4Q A;  4BY7 B;  3ND8 A;  2ZJR A;  1UAP A;  1AE3 A;  1XXG A;  1EIF A;  2FJ2 A;  2VQE L;  1ROD A;  5KYL A;  2JA7 B;  1BO0 A;  4KHZ A;  4GLX A;  3J7A V;  5IT9 L;  4KTA A;  2JEB I;  1PH4 A;  1CFM A;  4K0K Q;  4L8J A;  5C3E G;  3TRE A;  4TRD A;  4DR4 Q;  2K5W A;  1N8R C;  4DV7 Q;  4B9X A;  4HIK A;  4C3J G;  3I4M G;  1LM0 A;  4LF6 Q;  1A2U A;  1B53 A;  1VQ6 A;  1IW7 C;  5IOC A;  4J1M A;  1A3U A;  2CWA A;  1JJG A;  1AZP A;  3GTG H;  3MWY W;  1A0I A;  1UE6 A;  1Q1E A;  4G7Z C;  3EA6 A;  4JI1 Q;  5LL6 S;  1Q8I A;  4KY6 A;  2XGT A;  2JN4 A;  3HOU B;  2CFM A;  4GKK L;  2PCF B;  2ID0 A;  4X66 Q;  4YCU A;  1PH8 A;  3RZO B;  1I50 H;  2F0P A;  3A0J A;  5IWA L;  4N8X 1;  1QZG A;  4ZKC B;  2XRS D;  3AFQ A;  4HJ8 A;  1K73 C;  2K6A A;  1RTO A;  3DEO A;  2J4X A;  5IP9 H;  4DV2 Q;  5CV6 A;  5ELB A;  4DXG A;  5LHY 1;  2E2I H;  4GOP A;  1QOH A;  4B3M Q;  1KHI A;  3LWU A;  4G7O C;  5IYC G;  4LUZ A;  4JI8 Q;  1Q90 A;  4HJ5 A;  5LMN L;  3VR5 A;  1VQO A;  3CXC A;  4GNX C;  1Q46 A;  2UU9 Q;  1A2T A;  2EY6 A;  1JMC A;  1FNW A;  1CA5 A;  1TXY A;  2JA9 A;  1FJG Q;  1S3O A;  4OO1 H;  1KLG D;  2EDG A;  1K83 B;  4YY3 L;  4A3M G;  4P71 A;  1OXT A;  2NVX B;  2PQA A;  1ET6 A;  5IOD A;  3NPP A;  1B44 D;  1HQR D;  1JWU D;  2K5Q A;  3ICE A;  4RGO S;  4FVM A;  3GTM H;  2O5J C;  5C5L A;  2CW0 C;  3W1B A;  5C3E B;  3GTL H;  4GN5 A;  1TWA B;  4IAL A;  2JQO A;  4JV5 L;  4DR5 Q;  3E0J A;  4AQY Q;  4KY5 A;  3SHL A;  4C3J B;  3PIP 3;  1PFB A;  4BS9 A;  2NYZ D;  1D2B A;  1NTG A;  3DWA A;  2QDL A;  3OTO Q;  3J81 L;  1EYA A;  3RN2 A;  4DUZ Q;  2NB0 A;  4O1N A;  1ENF A;  4A3E H;  1D1I A;  2D62 A;  2Q2U A;  2R92 G;  1YJN A;  2XWJ B;  1EQT A;  4DR2 Q;  1IBL L;  2OT2 A;  4I65 A;  1UNS A;  3BDC A;  4A3K G;  1MSH A;  4UAI A;  1XTD A;  3SK4 A;  1LAC A;  2D0P A;  2NZO A;  3A5U A;  4GNX B;  2G9H D;  4AIM A;  1TQO A;  3S24 A;  2IX3 A;  2PNR C;  3M3Y B;  4IOC A;  1W2B A;  2F0K A;  2N78 A;  2NWG A;  3T4A C;  2VS1 A;  3Q0A A;  5JOB A;  3SXH A;  4FXD A;  3PIO A;  3OHX C;  4ODG A;  4BA2 I;  1D5Z C;  2E8G A;  3G7L A;  1FNV A;  1O7Z A;  2JP1 A;  3G48 A;  5ELO A;  4OGQ C;  4NKL A;  3EBE A;  4YCW A;  1N33 L;  2Z6K A;  3V05 A;  1KDB A;  4JBK A;  4BBR G;  1TKW B;  5A35 A;  4DF7 A;  4A3M B;  2L11 A;  1KDC A;  4L5T A;  1RF2 D;  3QWN A;  5JEA G;  4DV4 Q;  1YNJ D;  1HCZ A;  1HTP A;  2DY8 A;  4GKK Q;  2DY7 A;  2I46 A;  4DV5 L;  1KXL A;  2HIV A;  2DN8 A;  3CAM A;  3NBH B;  1CT1 D;  4F87 A;  3FMC A;  4X3U A;  3STB D;  3BJU A;  4RGT A;  2F0J A;  2M2L A;  3KFU A;  3H94 A;  5JJI A;  3I4O A;  3Q23 A;  4I7A A;  1AH9 A;  4QY7 A;  2XIW A;  3CRK C;  2FHT A;  1N34 L;  3HOV G;  1C4Q A;  2UXC L;  3ULJ A;  1YIT A;  4GN3 B;  1ENA A;  3K5O A;  4X65 L;  2VW9 A;  3CME A;  2NVQ B;  2R92 B;  1JE4 A;  1JT8 A;  3DM1 A;  5C44 H;  3BU2 A;  1J5E L;  3TSS A;  4EQP A;  1LT6 D;  5M5X B;  4NW2 A;  1VMC A;  1PH5 A;  3SK5 A;  3MFY A;  1I50 B;  1AE2 A;  1PFM A;  1TWC B;  1W3S A;  4R8I A;  4A3F G;  4LFB L;  1O80 A;  4X64 L;  1U9R A;  2MNA A;  2E2I B;  3K7A H;  1ASZ A;  2EXZ A;  1B70 B;  3MFG A;  1SJE D;  1DCZ A;  2XRQ D;  1WTX A;  1OXX K;  1K8G A;  3S1Q B;  3ZYY X;  5C0X I;  1PYS B;  5IGE A;  2EZV A;  4HN7 A;  2UXD L;  2NN6 G;  1D1K A;  1AP0 A;  1QVC A;  4DAV A;  3EIV A;  5A2Q L;  1RDP D;  2L5T A;  3AQQ A;  3MXU A;  3ULL A;  4S3S A;  4QIW B;  4DV3 L;  4BBR B;  4A3D H;  4XT3 B;  1BNZ A;  1I94 Q;  1TWH B;  3K8A A;  4DV1 L;  4HSV A;  4J6H A;  4G7H C;  2R93 G;  2A69 D;  3CQZ H;  1VQM A;  3TP8 A;  1VQE A;  2Z8L A;  4R4O A;  3S17 H;  1EUJ A;  1TWF B;  3FHW A;  1BF4 A;  4X3K A;  4A93 G;  1JOQ A;  1NMF A;  1U4P A;  1VF5 C;  3HOV B;  1GHJ A;  3SE0 A;  3J80 L;  1Y1V H;  2EJM A;  2XTI A;  2Z4I A;  4DR7 Q;  3RR5 A;  3K80 C;  5EQ0 A;  4IZ8 A;  1F2M A;  4DAY B;  1KAW A;  4OHJ A;  3G4S A;  4RA8 A;  1FGU A;  1SMY C;  3DM3 A;  5HY6 A;  1FR3 A;  3HG9 A;  1STN A;  4QIW E;  2KCM A;  3Q24 A;  2EVB A;  1HPC A;  5BR8 Q;  1JB3 A;  2ALY B;  3RZD B;  1SYB A;  4KN4 C;  4A3F B;  5ELN A;  3BYY B;  1DON A;  1LYL A;  3P75 A;  1GUW A;  4DPG A;  3RLO A;  4DR1 L;  4LF8 Q;  3TRZ A;  4LFA L;  1BBW A;  5C4J B;  4HTH A;  3S1N H;  5C0X H;  3S1R B;  4LMQ D;  1ASY A;  3KJO A;  1XPU A;  5I9O A;  3OMG A;  4JI5 Q;  4CJ2 C;  1B9N A;  4CDC C;  2D2C C;  2AUJ D;  1EQV A;  4C3I G;  1D5X C;  2DUD A;  4KN7 C;  2N55 A;  2KUM A;  1I4P A;  1Y1W H;  4NDX A;  1SNO A;  4P73 A;  2JA6 H;  3U4V A;  1N36 L;  2OTJ A;  3J7Z C;  2JK8 A;  5BN4 A;  2Z4H A;  2R93 B;  4RCO A;  1MHW C;  1ICW A;  3Q22 A;  1LLR D;  3N6R A;  2EYH A;  2K5D A;  2XN9 C;  1CHP D;  4KV6 A;  4A93 B;  3HOW G;  2F3I A;  4B08 A;  2BCO A;  1S5E D;  1HRJ A;  3VYR A;  4UDU C;  3DEP A;  3TME A;  4C56 C;  1GD7 A;  2LXJ A;  1U4L A;  2B2U A;  5T1G A;  4HR7 B;  5DNF A;  4BBS G;  2QKI C;  1U0L A;  3CCR A;  1YHA A;  2B2W A;  5C4Z A;  3PUY A;  1HZC A;  4KI0 A;  4IFD J;  5IT9 c;  2IJ0 A;  1EFI D;  2ENB A;  4GZY C;  3TN2 A;  1N9W A;  1LTI D;  4QMG A;  4MTK A;  1YNX A;  1ZKO A;  2LY7 A;  4K8J A;  1LUZ A;  1P8L A;  2OQ0 A;  2J0T D;  2EIF A;  1JR0 D;  1A15 A;  5CGK A;  4I7Z C;  3S15 B;  4DNT B;  2F4V L;  4YWL A;  3CRL C;  2KEE A;  1E24 A;  5I9P A;  2CH4 W;  1MSG A;  1YNJ C;  2KQ3 A;  4C3I B;  3CC7 A;  4V19 0;  2CKZ B;  3R2I A;  1PH3 A;  4IJH A;  4LF5 Q;  4DU9 A;  4XQQ A;  1Z7T A;  3OIQ A;  3STB C;  4HED A;  2JSO A;  3BDL A;  5E4X A;  1CQV A;  1QIL A;  2C9O A;  1G29 1;  3VDY A;  4JI4 L;  3AYH B;  2MO0 A;  3MXN A;  3JAM L;  1RL2 A;  4Y7N B;  1VQA A;  4EGV A;  1IZ6 A;  1TY2 A;  4BY1 G;  5I2X A;  3J81 i;  1KTK A;  1EOV A;  3LX0 A;  4POG A;  3HOW B;  1E2W A;  1R4Q B;  5DLQ E;  5BN5 A;  4M8A A;  1LT4 D;  4FXG C;  3X3N A;  1SE3 A;  5AJ3 Q;  3D0F A;  3KF8 A;  4B3R L;  3NQI A;  3PIP A;  3NXW A;  5FLM H;  2CH4 A;  1Y1V B;  1KNA A;  2JA8 G;  3NWT A;  4JI7 Q;  3OW7 A;  3H0G H;  1SRU A;  5FLX L;  4A3C H;  2EXD A;  2VB3 X;  4EVO A;  1GUT A;  3VA5 A;  4BBS B;  2KOL A;  4ZAI A;  1GVP A;  3DMU A;  3LNN A;  4PQX A;  1YI2 A;  3MAQ A;  1H9S A;  1V1P B;  1FGB D;  3X3M A;  3K0X A;  3PO2 H;  1K8O A;  1JOO A;  5AFW A;  2I5H A;  4LFC L;  2B2V A;  3SK6 A;  1HR0 L;  2BA0 A;  3FKI G;  3Q6S A;  3HOU H;  4A3J G;  1XNR Q;  4G57 A;  4K14 A;  3RZO H;  1ET9 A;  3GO5 A;  1L1O C;  4DK3 C;  2PW5 A;  4JI6 L;  2JYO A;  4KK7 A;  1NR2 A;  4EQ5 A;  1B4O A;  3HP3 A;  3LWE A;  3AB9 A;  3R8B A;  4K5V A;  4H44 C;  1S5C D;  2A69 C;  4U67 3;  1U4M A;  4F7X A;  1EIG A;  4LF7 Q;  2CQO A;  3T56 B;  4C3H G;  1IBM Q;  1STH A;  1GHK A;  3M4Y A;  2KVM A;  5C4H A;  2N88 A;  3HOX G;  5GAE C;  1BCP D;  3M9B A;  2LKV A;  4KJN A;  4F8M A;  1K83 H;  1UE5 A;  1ILQ A;  4ZK9 B;  3HFZ B;  3PSI A;  2JA5 G;  4BY1 B;  2VQF L;  1I5F A;  1IKL A;  2SNM A;  2AMC B;  1EU3 A;  3WDN A;  3H0G G;  1TWA H;  3S1M H;  4QUF A;  1HFN A;  5KIX A;  3NTH A;  4C3J H;  3I4M H;  2D9U A;  1HNZ L;  4JBJ A;  4C1N K;  4WOR A;  4JI2 L;  3F2C A;  3H3V I;  2LSS A;  2F3V A;  5CR3 A;  3ZJY C;  1BCP F;  3V96 A;  1AW7 A;  4UHV A;  4X62 Q;  1L1O A;  4CGY B;  1QUQ A;  2YV5 A;  1XX8 A;  3H91 A;  4KY7 A;  4L5Q A;  1L0Y B;  2DJG C;  5KNB A;  4QGU A;  4DUY L;  3FKI B;  1OO9 B;  5M5W B;  2KA7 A;  4A3J B;  3LGJ A;  5H1S E;  1VQI A;  4NB3 A;  4K5X A;  2Q2T A;  1VQN A;  3VYS A;  5ELF A;  3VR3 A;  5CBE E;  1I3Q H;  3PV0 A;  1CUK A;  1BUV T;  1LV9 A;  4OX9 L;  3U50 C;  2RDH A;  1M1K C;  1Y8N B;  5TSS A;  5IT9 E;  3M3Y H;  1PDQ A;  1QCB D;  5EPJ A;  4WFN 3;  4WJ4 A;  3QOL A;  5IYC H;  1TU2 B;  1PVO A;  3I7F A;  3CW2 C;  1IBK L;  5JJK A;  2K33 A;  2G5D A;  5FO7 B;  4C3H B;  4K2K A;  2G9D A;  4O0A A;  3U58 A;  4RGN A;  3IAY A;  2RF4 A;  2R7D A;  3UI2 A;  3HOX B;  1EY8 A;  3DWQ A;  2WII B;  4UP7 A;  3H6M A;  3WWV A;  3BVM A;  3VYT A;  3KBX A;  4A3M H;  3HOZ G;  1HR0 Q;  3FP9 A;  4GN4 B;  3J80 i;  1K9M C;  3I2Z A;  4R4T A;  4P2C B;  2TMP A;  3K0Y A;  3MZ5 A;  2RHQ B;  3H0G B;  3T13 A;  3NWS A;  3CPW A;  2B2Y A;  2DJF C;  2KEC A;  2F0E A;  2B2T C;  4RWS C;  1X3E A;  3T1H L;  4B3T L;  4ME3 A;  3H3V H;  1IKM A;  2L15 A;  2VUM H;  1D6E C;  3K81 C;  3DUZ A;  3PO2 B;  3K5M A;  4XDX A;  5EKK A;  5IE8 A;  2NVQ H;  4GKJ Q;  2R92 H;  1WCM G;  3OOC A;  5HGQ A;  1O78 A;  3T16 A;  1OXS C;  1B50 A;  5M5X H;  3UE0 A;  4A3K H;  3U9O A;  2LMC B;  1TWC H;  4IQZ A;  5K5P A;  5ISR A;  1T5X D;  5EGT A;  4HSP A;  3CC2 A;  1SMY D;  1WVL A;  3J80 c;  3T1Y Q;  5IYB G;  2L4N A;  4A3B G;  2K28 A;  4A4I A;  3K5L A;  2F0S A;  4FF1 A;  3J7A F;  1B3A A;  3S2H H;  1Q3L A;  3S1Q H;  1MJE A;  3KDF B;  4KHV A;  4IPH A;  1LTA D;  2KHS A;  1SLJ A;  1HNZ Q;  1STG A;  3J7A 5;  1ZYR D;  1YHQ A;  4JI2 Q;  2AKW B;  2NN6 I;  2FMC A;  1B3Q A;  5KEE A;  2UUA L;  4OWW B;  2K7V A;  2NZ1 D;  3UDI A;  2A19 A;  3A54 A;  4BBR H;  1JB7 A;  3VR4 A;  4CJ0 B;  3PMF A;  1XMQ L;  1TWH H;  3G6J B;  2H5X A;  5M3M G;  5JEA H;  4DV0 L;  3K6O A;  4P74 A;  3C1E A;  3TP7 A;  1TT2 A;  4DK6 C;  4LF9 Q;  2EYF A;  5CV8 A;  3S1M B;  1T9H A;  1TWF H;  2BOS A;  2H4O A;  2V1C C;  3I4M B;  4R4I A;  1HZA A;  2VUM G;  5I6Y A;  1IBK Q;  3HOV H;  5D3D A;  2E5L Q;  4JI0 Q;  3CCS A;  3QB3 A;  2L55 A;  3L7Z C;  4YIJ A;  2LFN A;  1S4Z A;  1WCM B;  3K7U C;  1R9T H;  1NAP A;  3S14 B;  2ZM6 L;  2A8V A;  4P75 A;  3TZU A;  1DD2 A;  5IP7 G;  4ZKB B;  1UWV A;  2EQS A;  5IGD A;  3AU7 A;  3CKI B;  3L9A X;  2VQE Q;  1SYC A;  1L0W A;  1F9Q A;  1I3Q B;  2EPB A;  3VR6 A;  5LMU L;  3RZD H;  3H3V C;  1BQQ T;  1E2Z A;  1NE3 A;  4A3F H;  4GNX A;  4R1J A;  3HRZ C;  2F0I A;  4TVA B;  2MHV A;  3BYT B;  5D14 A;  4ZUI A;  1BCP C;  4A3B B;  5C4J H;  2MPM A;  2QEX A;  2CCZ A;  3S1R H;  1KNE A;  3JAM i;  1EY0 A;  1MGS A;  3KYH C;  2YTV A;  2N3S A;  3T1H Q;  2NN6 H;  4EQN A;  4B3T Q;  3P7J A;  2SNS A;  4E6I A;  1B1Z A;  1PV4 A;  2CHB D;  1DOK A;  1KD1 C;  2WAQ G;  5GAD C;  1EY5 A;  1LAB A;  1EU4 A;  5E4W C;  2H1E A;  4XYO A;  2K03 A;  2HCI A;  3PO3 G;  1SNC A;  3KJP A;  3I70 A;  1EY6 A;  5M3M B;  1SFO H;  4IUT A;  2R93 H;  1Z47 A;  3U9S A;  1PYB A;  1VQJ A;  2OXP A;  3K5N A;  1NNX A;  5IWA Q;  3A56 A;  3NBH A;  3ND9 A;  3MXG A;  3Q8D A;  3HS0 C;  4ULL A;  4DR3 L;  2R3Z A;  1KDA A;  5EKL A;  1XNQ Q;  3ER0 A;  3KLS A;  4A93 H;  5JJL A;  2K5V A;  2A74 C;  3MC0 B;  4IUP A;  1Y69 U;  1EQQ A;  2VUM B;  4MNO A;  5EJW A;  2Y0S G;  5IGG A;  1XNQ L;  3I4N G;  5CC4 A;  5LMN Q;  1EIH A;  5JVH 3;  3JAM c;  3S16 B;  1BCP B;  3I8Z A;  5CBA E;  5M3F G;  4B3S L;  1RD9 D;  1V1O A;  1VMP A;  4HIM A;  1J9O A;  4A3K B;  4RG1 A;  3CC4 A;  5A2Q E;  4DNI A;  1CK1 A;  1L2F A;  2Q2H A;  4YY3 Q;  2PPB C;  1SND A;  4DV6 L;  1ILP A;  4G4K A;  1X54 A;  1YJW A;  1NSN S;  3W1G A;  3PUZ A;  1XJV A;  4IN3 A;  1JCK B;  1GM5 A;  3NP8 A;  5C3W A;  3MXP A;  5FLX c;  3S2H B;  1YIJ A;  4JV5 Q;  2E2H B;  4QJF A;  2JEA I;  3S15 H;  3NTK A;  1SE2 A;  3C3L A;  5E3F A;  2EY1 A;  4A3L G;  1TS4 A;  4C3I H;  3E9I A;  4LF4 L;  4HCE A;  3ULP A;  4MTN A;  2EJF C;  2WAQ B;  3HEJ A;  3J80 E;  2ES2 A;  4RMF A;  2PMZ B;  1IBL Q;  3PO3 B;  1I6H B;  4DN4 M;  5COR A;  4QF4 A;  1KRS A;  2XNA C;  3MA2 B;  2MP1 A;  5T1I A;  2RKS A;  1ESF A;  3ITP A;  1KLU D;  2GA4 B;  2D0O A;  5EPK A;  1G6P A;  5LMU Q;  2AQ2 B;  3WOE A;  1TVX A;  4APV A;  4OWT B;  1HA6 A;  2A6H C;  4Y7N H;  1Q81 C;  1V1Q A;  1Q86 C;  3E3X A;  1DYQ A;  3HOW H;  3KOJ A;  4NXN L;  2E2J H;  3D31 A;  4A3I G;  1W6K A;  1SR3 A;  3I72 A;  3KLW A;  1XMO L;  1YEZ A;  2Y0S B;  4PMC A;  3I4N B;  3MTS A;  1B9M A;  2QF7 A;  4PZ7 A;  4AH6 A;  1R9T B;  2VZA A;  5M3F B;  2RQX A;  4BBS H;  2WAQ E;  4L5R C;  1N33 Q;  4ABN A;  4DAY A;  2WB1 G;  5GAH C;  1PZI D;  2ZTC A;  2SOB A;  4PMW A;  4O42 A;  1T5E A;  1AEX A;  4DV5 Q;  1HNX L;  1UEB A;  1ZYR C;  1GXD C;  5L37 A;  3NK9 A;  2BA1 A;  2QW7 A;  1K28 A;  1LT5 D;  2XSC A;  1Q7Y C;  2D5D A;  4BA1 I;  4CDD C;  5IGF A;  2UXB L;  1SYD A;  1JQY D;  2X6G A;  4M1U B;  1JC7 A;  1PTO C;  4LUV A;  3SGI A;  1G91 A;  1EEI D;  4P72 A;  1N34 Q;  2UXC Q;  3FVQ A;  3PF5 A;  2Y0S E;  4X65 Q;  4CDE C;  3MEH A;  1WTO A;  1J5E Q;  4B3S Q;  3E9H A;  3M4O B;  2F4I A;  2PI2 E;  1SFO B;  1N32 L;  1I4X A;  5EPL A;  4HMJ A;  1S72 A;  5CV5 A;  2F0H A;  1VQ8 A;  4OIK A;  3I73 A;  2FIN B;  3FRP B;  3PUW A;  2NTT A;  4GLA C;  1Q8K A;  2HD3 A;  4LFB Q;  3SR1 A;  4X64 Q;  4KKU A;  2B63 H;  4BY1 H;  1CKN B;  3CCQ A;  1KC8 C;  1NUC A;  2Q8T A;  2WV6 D;  2RDG A;  4K8I A;  4RGM A;  4EX5 A;  4R9W A;  3AFP A;  2MJ8 A;  4ZUJ A;  1SEB D;  1B8A A;  4A3I B;  1VQC A;  1VQF A;  1TII D;  1WTW A;  2NBF A;  2F03 A;  2JA8 H;  2UXD Q;  5ELD A;  4IOA A;  3BZK A;  1VQ9 A;  1LTB D;  1XTC D;  1MIU A;  4HAE A;  4DV3 Q;  1BKB A;  1EQR A;  3TS0 A;  1PTO B;  3MEF A;  3T53 B;  2CVR A;  4DV1 Q;  2QA4 A;  4IPC A;  5EKI A;  3DLL A;  1OTC A;  3FKI H;  5M5W H;  1HNW L;  4TKO B;  2K1B A;  4IFD G;  1I4G A;  3W2D A;  4A3J H;  1G51 A;  3A8I E;  2UUC L;  1VQB A;  3H15 A;  1G8Z D;  2WKD A;  4QUC A;  4GLV B;  3NHH A;  4HJ9 A;  1EFW A;  1IYV A;  5C0X J;  3QOJ A;  5CV4 A;  1PH6 A;  4PMB A;  4NP5 A;  1XMO Q;  1YHB A;  1NR4 A;  1NBW A;  1CSP A;  3WOF A;  1SNM A;  5FJ8 G;  2HT1 A;  1O7I A;  1GUS A;  3R3O A;  5KRU A;  4C3H H;  3TS2 A;  2KCN A;  4R8N A;  4C2M B;  5FLX E;  2M9V A;  4DKA C;  1U4R A;  2BH8 A;  3GQB A;  3ERS X;  1VS0 A;  3HOX H;  2R6G A;  4ZRZ A;  3K59 A;  2JJQ A;  1PZK D;  1C7Y A;  3TP6 A;  2B63 G;  4JVZ A;  3PGZ A;  1FVI A;  1I6V C;  1X3P A;  2IL8 A;  2NVY B;  4DR1 Q;  2JA5 H;  1BR9 A;  4ZCK A;  3KF6 B;  5DAU A;  4LFA Q;  4CKC A;  2E2J B;  1WTP A;  2YTY A;  1CKM A;  3KK7 A;  4JI3 L;  1JIC A;  2BH2 A;  5EBC A;  2LXK A;  5M5Y B;  2UXB Q;  4KLK A;  1ENC A;  4GS3 A;  2HHH L;  4XT1 B;  3MVV A;  4KD3 A;  4UY8 C;  1N36 Q;  4H0L C;  2KHJ A;  2VY3 A;  2ZXO A;  3NQT A;  2FMM A;  1V1P A;  4IO9 A;  1HUM A;  2MQH A;  2RSO A;  4L5S A;  1N32 Q;  2SDF A;  2ATW A;  3D4R A;  3NUC A;  3EJI A;  4ILW A;  3I56 A;  2EOT A;  2KED A;  3TEH B;  4A3G H;  2EYO A;  1YJ9 A;  1EWH A;  3OW2 A;  4KKT A;  4BWG B;  3BVZ A;  4XQN A;  2MO1 A;  1H9R A;  4YWK A;  1BDO A;  2M00 A;  2QEJ C;  4O2D A;  4K2L A;  5GQO A;  3J81 c;  2PZW A;  2RA4 A;  2EE1 A;  2IX1 A;  1W6J A;  1CZW A;  2QGQ A;  5GRO A;  1FD7 D;  3TZD A;  2YYZ A;  1SMX A;  1HXY D;  3CPF A;  1EYG A;  1H9M A;  2EY5 A;  1A62 A;  4XTC S;  2KCC A;  1H9K A;  4FNF A;  3GTK B;  4K0K L;  1C9O A;  1PRT D;  5CV7 A;  3A7L A;  5I6W A;  5DM6 3;  2BDN A;  1X56 A;  1G6Z A;  1X6O A;  5C3X A;  2OQK A;  1UE7 A;  3CF5 A;  2YU9 B;  2B63 B;  2PW7 A;  1S5B D;  1AFP A;  3BVG A;  3HOZ H;  2K32 A;  3QG1 A;  1STB A;  5KNC A;  1F9R A;  4H7B A;  3I4L A;  1S5F D;  2UUC Q;  2KJX A;  2C5C A;  1QB5 D;  4YHH L;  1CTM A;  2QCP X;  4AYB G;  2F4V Q;  2JA8 B;  5G3L D;  5F2D A;  4X66 L;  1XWE A;  2ZXR A;  5K36 G;  2Z9H A;  3HOY H;  1GO3 E;  2JA7 G;  1SSO A;  4Q0F A;  3RLF A;  1BBX C;  4OEL B;  4NXM L;  3A8J E;  1EY7 A;  4DGZ A;  4B3M L;  4L6T B;  2UUB L;  3FPU B;  3PCO B;  4JI8 L;  3IL8 A;  3CMA A;  1WCM H;  3BG3 A;  4JI4 Q;  1DXM A;  2ICE C;  3S14 H;  1AZQ A;  4KD4 A;  2VL6 A;  2N49 A;  4A3G G;  1HHV A;  4JG2 A;  3FEW X;  1VQG A;  3QIA A;  5G3L F;  2ZTE A;  3GTP B;  1Z9F A;  4NPS A;  2ICI A;  5FO8 B;  4RHS A;  1K8A C;  3NSW A;  5IYB H;  4B3R Q;  2L9H A;  1EEF D;  1CA6 A;  4A3B H;  4JI3 Q;  1FL0 A;  1HQM C;  3CHB D;  4OON A;  4FF2 A;  4UP9 A;  4YWM A;  2OWO A;  1F9P A;  1C48 A;  3SDZ A;  2DGY A;  1SNQ A;  4JPB W;  1RKN A;  2IW3 A;  4LW1 A;  4DAP A;  1RHP A;  3C2P A;  3BZD B;  4DNR B;  2Q8R E;  4DR5 L;  1Q1B A;  4LFC Q;  1TY0 A;  2FXQ A;  1PH7 A;  5J39 A;  3OTO L;  3MHB A;  4KKS A;  2L0C A;  2JA5 B;  2JE6 I;  2F52 A;  4DUZ L;  3F2B A;  3GTJ B;  3CCL A;  2R7Z H;  5M3M H;  1JE5 A;  4YCV A;  3OIP A;  1EIY B;  3TBI B;  3EQL C;  4Z9C B;  2F0Q A;  1WOC A;  4HMI A;  4GOP C;  4AYB B;  4JI6 Q;  1GUN A;  3A7A B;  1DGS A;  3OWE B;  3H09 A;  1R4P B;  3HOY G;  1EWI A;  1EOT A;  3G6E A;  1V9P A;  4OO1 I;  4JW0 A;  1DOM A;  3HKS A;  2F0W A;  3BDO A;  2A6H D;  2EY2 A;  2B8F A;  1IYJ B;  2P5Z X;  2K50 A;  2EYL A;  2RBM A;  1LTS D;  2MUY A;  3S16 H;  3NE5 B;  4RHR A;  2IY5 B;  1SE4 A;  4K6L A;  3T51 B;  3D4D A;  3U4Z A;  1WTH A;  2A68 C;  5IP7 H;  3K57 A;  1DZ1 A;  1WTV A;  5JVG 3;  4DK0 A;  4A3G B;  3AMU A;  1G2S A;  2N8N A;  2VQF Q;  1QWY A;  3UDX A;  1E1O A;  4UPA A;  1V8Q A;  5BN3 A;  2PYK A;  3OSO A;  1EY4 A;  3W5O A;  5NUC A;  5IYD G;  4DR6 L;  4LNQ A;  1D7Q A;  2NZH A;  3I3C A;  4YHH Q;  2K75 A;  5JJZ A;  4DV4 L;  4AYB E;  3NEN A;  3G71 A;  1WJJ A;  4FYD A;  3CU7 A;  1PFS A;  2E2H H;  3NEM A;  1L0X B;  4QQB X;  1FNU A;  2IWH A;  2RSN A;  2A6E D;  4GOP B;  5D65 A;  4ID6 A;  3KDF A;  2PO4 A;  3J81 E;  1SE8 A;  3F8T A;  3SVM A;  4Q5V A;  2UUB Q;  4HID A;  5JAV A;  3CCU A;  1J8I A;  3O13 A;  2F0V A;  1PHJ A;  3PO3 H;  3HOZ B;  1I6H H;  1PTO D;  4LJZ C;  4DUY Q;  2R7Z G;  3ERQ A;  5JPM C;  4PV1 C;  2B2T A;  4QL5 A;  1ZEQ X;  1SNP A;  4ME5 A;  2F0O A;  2HIX A;  1F77 A;  4ZYS A;  3A5Z B;  3SEB A;  1GKH A;  1ML0 D;  4A76 A;  4OX9 Q;  4ALP A;  3M4Q A;  2PQA B;  3HOY B;  2L1B A;  3M4P A;  3QR8 A;  4PZ6 A;  3GD7 A;  4QB4 A;  2RHS B;  2YTX A;  5I2Y A;  1E22 A;  1EYD A;  4MIU A;  1M8A A;  5HUR A;  3I4N H;  3GV3 A;  2Z6K C;  1F9S A;  3CP0 A;  1P16 A;  1GUG A;  1NJI C;  4RKB A;  5M3F H;  1MI2 A;  3ONA B;  3HGB A;  3OPO A;  1PTO F;  1X3F A;  1GOZ A;  4BXX H;  5KND A;  5J3B A;  3R93 A;  1WTQ A;  2B8G A;  2AHO B;  4JBM A;  4MHE A;  3N52 A;  1RCV D;  1YNN D;  2PQE A;  3F1Z A;  1PRT C;  3KUP A;  2AQ3 B;  3RUZ A;  1I94 L;  1SDF A;  2BDO A;  2HCC A;  2NVT B;  1STA A;  1CHQ D;  2I07 B;  4HJ7 A;  2WFW A;  3CCM A;  2E75 C;  2EYP A;  3V2T A;  3GTQ B;  4RFB A;  1A6X A;  4F88 A;  1TWG H;  2BE5 D;  4A3L H;  2KEN A;  4PZ8 A;  4XXE A;  4JOI C;  1E3P A;  1TS5 A;  2JXM B;  5IP9 G;  1HH2 P;  2Q2I A;  2GN5 A;  5CV9 A;  2HQL A;  2K5H A;  2QIL A;  4J8Q A;  1VDZ A;  4C1N I;  2A1A A;  3M4O H;  2R7Z B;  1QJO A;  4DR7 L;  3DHQ A;  4OIJ A;  1KRT A;  1F2L A;  2L12 A;  5D3I B;  5JEA J;  1NMG A;  2K5N A;  1X65 A;  4OO1 G;  4MN3 A;  3PUV A;  1JOR A;  2DNC A;  1KAA A;  5BR8 L;  4DR6 Q;  2VB2 X;  4A75 A;  1HTL D;  2X69 A;  2IT1 A;  1I4R A;  3D6W A;  5FOB B;  4A3I H;  1BOS A;  4LF8 L;  5COY A;  2KCT A;  1YZ6 A;  1VQ5 A;  4CKB A;  3E5S A;  4FP5 D;  1PRT B;  3P20 A;  5M9O A;  4WJ3 M;  4OWX B;  1CZG A;  3C46 A;  2UUA Q;  4JI5 L;  3TQY A;  4BXX G;  2PZT A;  2AUK A;  1E1T A;  3SK8 A;  1PTO H;  3HKZ G;  3EN2 A;  5IGB A;  1XMQ Q;  3GTG B;  2OF1 A;  4LUO A;  2EYM A;  2HDL A;  4DV0 Q;  4A3E G;  1VQ4 A;  4CBV A;  3RNU A;  1STE A;  4JOI A;  1PXU A;  4JK1 C;  1EY9 A;  2E2D C;  3URY A;  4IFD I;  1H95 A;  4V0B A;  1F2Z A;  5FKA C;  3UE1 A;  5C4X H;  4IUU A;  3M7N A;  1IL8 A;  4CJ1 B;  1KAB A;  2LS0 1;  1Q12 A;  1EL0 A;  1Y8O B;  1E2V A;  1OXV A;  5E7N A;  1G2T A;  1K3B C;  2TSS A;  4R4C A;  4KHP L;  1X3G A;  1SRO A;  1E7Z A;  5CYU A;  1MJC A;  1QVF A;  5HGT A;  1ESR A;  2KBN A;  3QJY A;  5DM7 3;  4C2M H;  2ZM6 Q;  5I4D A;  2CQA A;  2Z0S A;  1FYC A;  4RAU C;  2ZTD A;  1PLF A;  3GV6 A;  1EYC A;  1X3Q A;  4RKL A;  2F0D A;  1WYD A;  4UP8 A;  1SYF A;  2ZJP A; 
#chains in the Genus database with same CATH homology
 2A73 B;  4WRD A;  4WJW A;  1EWC A;  4XQJ A;  1B2T A;  1DJR D;  1NCV A;  3D8G A;  1LTT D;  1XYI A;  3OWF A;  1EZ8 A;  3GTM B;  3GTL B;  4N9T A;  1IHZ A;  1AN8 A;  2IX0 A;  2F0L A;  5IGC A;  5FO9 B;  3S9W A;  1QG7 A;  3HKZ B;  4HCS A;  4XIG S;  5IIF A;  2A5H A;  2R61 A;  2WP8 J;  1S5D D;  5EBD A;  2RVL A;  4LAA A;  2RDF A;  4A3E B;  3R2T A;  2A6E C;  4K5W A;  1STY A;  4IFD H;  3BS1 A;  2ZXP A;  4DXF A;  2J7Z A;  5KYI A;  4JBW A;  1HFG A;  4RCN A;  1TWG B;  4CKE A;  4K6D A;  4CHT B;  3I90 A;  2B2U C;  4NMZ A;  1H9J A;  2NUC A;  1CQF A;  1IYU A;  1TR5 A;  2O5I C;  2B2W C;  1PMR A;  3D6C A;  1JOK A;  2SEB D;  3HZX A;  3M85 A;  4KJO A;  1JWM D;  3IFD A;  3VA7 A;  2F0M A;  3ERO A;  1I4Q A;  1LT3 D;  1ONL A;  2Z1C A;  1M4V A;  1RJT A;  2AWO A;  5LL6 X;  1SYG A;  2XWB B;  4ZQ3 A;  1A3T A;  3TDQ A;  1RTN A;  5C6A A;  3P1H A;  5KGU A;  1YNN C;  2EJG C;  2B39 A;  2WB1 B;  4IUV A;  3VYU A;  4H13 C;  4IUN A;  4DK1 A;  1Y8P B;  2F0G A;  3EVQ A;  4IUR A;  1SBB B;  3TP5 A;  4FF3 A;  1LTR D;  2BE5 C;  2HQE A;  4N9P A;  5C44 B;  3M7G A;  3JAM E;  2E76 C;  2F0U A;  5ELC A;  1LO5 D;  5C4X B;  1V43 A;  3IFT A;  5ELE A;  1UUP A;  2WIN B;  2A68 D;  1IW7 D;  1PYW D;  2F0T A;  2K04 A;  3K7A B;  1CM9 A;  1ZXT A;  5C0X G;  5FK9 C;  4U68 A;  2F3W A;  2B2V C;  1SJH D;  3NBI A;  2AQ1 B;  1DOL A;  3PIO 3;  2NTS A;  3VR2 A;  3A8K E;  1E0B A;  3A55 A;  4A3D B;  4RH6 A;  1EZ6 A;  1MD2 D;  2O2L D;  1HA5 A;  1I4H A;  2VNU D;  2DNE A;  1X32 A;  4X3T A;  5E1F A;  3CQZ B;  4DFA A;  1K8M A;  3S17 B;  5K36 H;  2OEO A;  3KLS X;  1TS3 A;  2XVS A;  3QO2 A;  5J1Z A;  1WD0 A;  2EYJ A;  2WAC A;  2FFK B;  5J22 A;  3C1F A;  4DA2 A;  1SYE A;  3W3A A;  1QNU A;  2VXW A;  1H9S B;  3NTI A;  3RD4 A;  1SAP A;  1HUN A;  3K58 A;  5JPN C;  3DXJ C;  1F2Y A;  1MBY A;  1WD1 A;  2CW0 D;  2IPK D;  3GP7 A;  1DM0 B;  4KMU C;  1SXT A;  3D3R A;  1GUO A;  3KLR A;  3S1N B;  3E6Z X;  1O7L A;  1A3V A;  1C8C A;  1JWS D;  1LTG D;  4X3S A;  4TSS A;  1CI3 M;  2V4D A;  1UEA B;  4OL7 A;  4ZLT F;  1OXU A;  1Z6H A;  2O4X A;  1BXT A;  1Y1W B;  3RMH A;  3S2D B;  2JA6 B;  3J7Y W;  3FDT A;  1PZJ D;  2K01 A;  1PFN A;  1II3 A;  4L63 B;  3I91 A;  4LK1 C;  1QNK A;  2HDM A;  2E74 C;  1PRT F;  2F0N A;  4PNY A;  2WKC A;  1O7Y A;  3IKJ A;  4TQU S;  5DEH A;  4XYQ A;  1VCI A;  2X6L A;  3OMC A;  4QCL A;  3DWP A;  3GTO B;  2QDB A;  2MGS A;  1D5M C;  4FXK C;  1WTR A;  1QE6 A;  5CMD A;  3F2U A;  2B2Y C;  2PZU A;  3L3O C;  4FF4 A;  1GJX A;  3EFX D;  1VF7 A;  3FPP A;  1TS2 A;  5C5M A;  2K05 A;  4B9W A;  3KBG A;  3D4W A;  2Q8I B;  2ZT9 C;  4IUQ A;  4FO2 A;  3PUX A;  2AWN A;  4EQO A;  2F1M A;  2HUG A;  2F0F A;  4BY7 B;  3ND8 A;  1UAP A;  1XXG A;  2FJ2 A;  1ROD A;  5KYL A;  2JA7 B;  1BO0 A;  4KHZ A;  3J7A V;  5IT9 L;  4KTA A;  2JEB I;  1CFM A;  4L8J A;  4TRD A;  2K5W A;  4B9X A;  4C3J G;  1B53 A;  1A2U A;  1IW7 C;  5IOC A;  4J1M A;  1A3U A;  1AZP A;  3MWY W;  1Q1E A;  4G7Z C;  3EA6 A;  5LL6 S;  1Q8I A;  4KY6 A;  3HOU B;  2PCF B;  2ID0 A;  3RZO B;  2F0P A;  4ZKC B;  2XRS D;  2K6A A;  1RTO A;  3DEO A;  2J4X A;  5CV6 A;  5ELB A;  4DXG A;  5LHY 1;  1QOH A;  3LWU A;  4G7O C;  1Q90 A;  3VR5 A;  1A2T A;  2EY6 A;  1FNW A;  1CA5 A;  4OO1 H;  1KLG D;  2EDG A;  1K83 B;  1OXT A;  2NVX B;  1ET6 A;  5IOD A;  3NPP A;  1B44 D;  1HQR D;  1JWU D;  2K5Q A;  4RGO S;  4FVM A;  2O5J C;  5C5L A;  2CW0 C;  5C3E B;  1TWA B;  4IAL A;  3E0J A;  4KY5 A;  3SHL A;  4C3J B;  3PIP 3;  1PFB A;  4BS9 A;  2NYZ D;  1D2B A;  3DWA A;  3J81 L;  1EYA A;  2NB0 A;  4O1N A;  1ENF A;  1D1I A;  2D62 A;  2XWJ B;  1EQT A;  2OT2 A;  4I65 A;  1UNS A;  3BDC A;  1MSH A;  4UAI A;  3SK4 A;  1LAC A;  2G9H D;  1TQO A;  2IX3 A;  2PNR C;  3M3Y B;  2F0K A;  2NWG A;  3T4A C;  3Q0A A;  5JOB A;  3SXH A;  4FXD A;  3OHX C;  4ODG A;  4BA2 I;  1D5Z C;  3G7L A;  1FNV A;  1O7Z A;  2JP1 A;  4OGQ C;  4NKL A;  3V05 A;  1KDB A;  1TKW B;  5A35 A;  4DF7 A;  4A3M B;  2L11 A;  1KDC A;  1RF2 D;  3QWN A;  5JEA G;  1YNJ D;  1HCZ A;  1HTP A;  2DY8 A;  2DY7 A;  2I46 A;  2DN8 A;  1CT1 D;  4F87 A;  3FMC A;  4X3U A;  4RGT A;  2F0J A;  2M2L A;  3H94 A;  3Q23 A;  2XIW A;  3CRK C;  2FHT A;  1C4Q A;  1ENA A;  3K5O A;  2NVQ B;  2R92 B;  1JE4 A;  3DM1 A;  3TSS A;  4EQP A;  1LT6 D;  5M5X B;  4NW2 A;  1VMC A;  3SK5 A;  3MFY A;  1I50 B;  1PFM A;  1TWC B;  4R8I A;  1O80 A;  1U9R A;  2E2I B;  2EXZ A;  3MFG A;  1SJE D;  1DCZ A;  2XRQ D;  1WTX A;  1OXX K;  3S1Q B;  3ZYY X;  5C0X I;  5IGE A;  2EZV A;  4HN7 A;  2NN6 G;  1D1K A;  1AP0 A;  4DAV A;  5A2Q L;  1RDP D;  2L5T A;  3MXU A;  4S3S A;  4QIW B;  4BBR B;  4XT3 B;  1BNZ A;  1TWH B;  4HSV A;  4J6H A;  4G7H C;  2A69 D;  3TP8 A;  2Z8L A;  1TWF B;  1BF4 A;  4X3K A;  1JOQ A;  1U4P A;  1VF5 C;  3HOV B;  1GHJ A;  3SE0 A;  3J80 L;  2EJM A;  2Z4I A;  5EQ0 A;  4IZ8 A;  1F2M A;  4OHJ A;  4RA8 A;  1SMY C;  1FR3 A;  3HG9 A;  1STN A;  3Q24 A;  2EVB A;  1HPC A;  1JB3 A;  3RZD B;  1SYB A;  4KN4 C;  4A3F B;  3BYY B;  1DON A;  3P75 A;  1GUW A;  5C4J B;  4HTH A;  5C0X H;  3S1R B;  4LMQ D;  5I9O A;  3OMG A;  4CJ2 C;  1B9N A;  2D2C C;  2AUJ D;  1EQV A;  4C3I G;  1D5X C;  4KN7 C;  2N55 A;  2KUM A;  1I4P A;  4NDX A;  1SNO A;  5BN4 A;  2Z4H A;  2R93 B;  4RCO A;  1ICW A;  3Q22 A;  1LLR D;  3N6R A;  2EYH A;  2K5D A;  2XN9 C;  1CHP D;  4KV6 A;  4A93 B;  4B08 A;  2BCO A;  1S5E D;  1HRJ A;  3VYR A;  4UDU C;  3DEP A;  3TME A;  4C56 C;  1U4L A;  2B2U A;  5T1G A;  4HR7 B;  5DNF A;  2QKI C;  2B2W A;  5C4Z A;  3PUY A;  4KI0 A;  4IFD J;  2IJ0 A;  1EFI D;  2ENB A;  4GZY C;  3TN2 A;  1LTI D;  4QMG A;  1ZKO A;  2LY7 A;  4K8J A;  2J0T D;  1JR0 D;  1A15 A;  5CGK A;  4I7Z C;  3S15 B;  4DNT B;  3CRL C;  2KEE A;  5I9P A;  1MSG A;  1YNJ C;  2KQ3 A;  4C3I B;  4V19 0;  3R2I A;  4DU9 A;  4XQQ A;  1Z7T A;  3OIQ A;  4HED A;  2JSO A;  3BDL A;  5E4X A;  1CQV A;  1QIL A;  2C9O A;  1G29 1;  3MXN A;  3JAM L;  4Y7N B;  4EGV A;  1TY2 A;  5I2X A;  1KTK A;  3LX0 A;  3HOW B;  1E2W A;  1R4Q B;  5BN5 A;  4M8A A;  1LT4 D;  4FXG C;  3X3N A;  1SE3 A;  3KF8 A;  3NQI A;  3NXW A;  1Y1V B;  1KNA A;  3NWT A;  3OW7 A;  5FLX L;  2VB3 X;  4EVO A;  1GUT A;  3VA5 A;  4BBS B;  2KOL A;  4ZAI A;  3DMU A;  3LNN A;  4PQX A;  3MAQ A;  1H9S A;  1V1P B;  1FGB D;  3X3M A;  1K8O A;  1JOO A;  5AFW A;  2B2V A;  3SK6 A;  2BA0 A;  3Q6S A;  4G57 A;  4K14 A;  1ET9 A;  3GO5 A;  2PW5 A;  2JYO A;  4KK7 A;  1NR2 A;  1B4O A;  3HP3 A;  3LWE A;  3AB9 A;  3R8B A;  4K5V A;  4H44 C;  1S5C D;  2A69 C;  4U67 3;  1U4M A;  4F7X A;  1EIG A;  3T56 B;  4C3H G;  1STH A;  1GHK A;  3M4Y A;  2KVM A;  5C4H A;  2N88 A;  1BCP D;  2LKV A;  4KJN A;  4F8M A;  1ILQ A;  4ZK9 B;  4BY1 B;  1IKL A;  2SNM A;  1EU3 A;  3WDN A;  4QUF A;  1HFN A;  5KIX A;  3NTH A;  2D9U A;  4C1N K;  4WOR A;  2F3V A;  5CR3 A;  1BCP F;  3V96 A;  1AW7 A;  4CGY B;  1XX8 A;  3H91 A;  4KY7 A;  1L0Y B;  5KNB A;  3FKI B;  1OO9 B;  5M5W B;  2KA7 A;  4A3J B;  4K5X A;  3VYS A;  5ELF A;  3VR3 A;  5CBE E;  3PV0 A;  1BUV T;  1LV9 A;  2RDH A;  1Y8N B;  5TSS A;  5IT9 E;  1PDQ A;  1QCB D;  5EPJ A;  4WFN 3;  3QOL A;  1TU2 B;  2K33 A;  5FO7 B;  4C3H B;  4K2K A;  2G9D A;  4RGN A;  3IAY A;  3UI2 A;  3HOX B;  1EY8 A;  3DWQ A;  2WII B;  3H6M A;  3BVM A;  3VYT A;  3KBX A;  4P2C B;  2TMP A;  3K0Y A;  3MZ5 A;  3H0G B;  3T13 A;  3NWS A;  2B2Y A;  2KEC A;  2F0E A;  2B2T C;  4RWS C;  1IKM A;  1D6E C;  3DUZ A;  3PO2 B;  3K5M A;  4XDX A;  5EKK A;  3OOC A;  1O78 A;  3T16 A;  1OXS C;  1B50 A;  3U9O A;  2LMC B;  4IQZ A;  5K5P A;  5ISR A;  1T5X D;  5EGT A;  4HSP A;  1SMY D;  1WVL A;  2L4N A;  2K28 A;  3K5L A;  2F0S A;  4FF1 A;  3J7A F;  1B3A A;  1Q3L A;  4KHV A;  1LTA D;  2KHS A;  1STG A;  1ZYR D;  2NN6 I;  2FMC A;  5KEE A;  2K7V A;  2NZ1 D;  3A54 A;  3VR4 A;  4CJ0 B;  3PMF A;  3G6J B;  5JEA H;  3K6O A;  3C1E A;  3TP7 A;  1TT2 A;  2EYF A;  5CV8 A;  3S1M B;  2BOS A;  2H4O A;  3I4M B;  5I6Y A;  5D3D A;  3QB3 A;  2L55 A;  3L7Z C;  4YIJ A;  2LFN A;  1S4Z A;  1WCM B;  1NAP A;  3S14 B;  1DD2 A;  3TZU A;  4ZKB B;  5IGD A;  3AU7 A;  3CKI B;  3L9A X;  1SYC A;  3H3V C;  1F9Q A;  1I3Q B;  2EPB A;  3VR6 A;  1BQQ T;  1E2Z A;  3HRZ C;  2F0I A;  2MHV A;  3BYT B;  5D14 A;  4ZUI A;  1BCP C;  4A3B B;  2MPM A;  1KNE A;  1EY0 A;  1MGS A;  2NN6 H;  4EQN A;  3P7J A;  2SNS A;  4E6I A;  1B1Z A;  2CHB D;  1DOK A;  1EY5 A;  1LAB A;  1EU4 A;  5E4W C;  2H1E A;  4XYO A;  2K03 A;  2HCI A;  1SNC A;  3I70 A;  1EY6 A;  5M3M B;  4IUT A;  1Z47 A;  3U9S A;  2OXP A;  3K5N A;  3A56 A;  3NBH A;  3ND9 A;  3MXG A;  3HS0 C;  4ULL A;  2R3Z A;  1KDA A;  5EKL A;  3KLS A;  2A74 C;  3MC0 B;  4IUP A;  1Y69 U;  2VUM B;  5EJW A;  5IGG A;  5CC4 A;  1EIH A;  5JVH 3;  3S16 B;  1BCP B;  3I8Z A;  5CBA E;  1RD9 D;  1V1O A;  1VMP A;  1J9O A;  4A3K B;  5A2Q E;  1CK1 A;  2PPB C;  1SND A;  1ILP A;  4G4K A;  1NSN S;  3PUZ A;  4IN3 A;  1JCK B;  3NP8 A;  5C3W A;  3MXP A;  3S2H B;  2E2H B;  2JEA I;  3NTK A;  1SE2 A;  3C3L A;  5E3F A;  2EY1 A;  1TS4 A;  4HCE A;  2EJF C;  2WAQ B;  3HEJ A;  3J80 E;  2PMZ B;  3PO3 B;  1I6H B;  4DN4 M;  5COR A;  4QF4 A;  2XNA C;  3MA2 B;  2MP1 A;  5T1I A;  2RKS A;  1ESF A;  3ITP A;  1KLU D;  2GA4 B;  5EPK A;  2AQ2 B;  3WOE A;  1TVX A;  1HA6 A;  2A6H C;  1DYQ A;  3D31 A;  1W6K A;  3I72 A;  2Y0S B;  4PMC A;  3I4N B;  3MTS A;  1B9M A;  2QF7 A;  1R9T B;  5M3F B;  2RQX A;  4ABN A;  4DAY A;  1PZI D;  2SOB A;  4PMW A;  4O42 A;  1T5E A;  1AEX A;  1ZYR C;  1GXD C;  3NK9 A;  2BA1 A;  1LT5 D;  2XSC A;  2D5D A;  4BA1 I;  5IGF A;  1SYD A;  1JQY D;  2X6G A;  4M1U B;  1JC7 A;  1PTO C;  1G91 A;  1EEI D;  3FVQ A;  3MEH A;  1WTO A;  3M4O B;  2F4I A;  1SFO B;  1I4X A;  5EPL A;  4HMJ A;  5CV5 A;  2F0H A;  4OIK A;  3I73 A;  2FIN B;  3FRP B;  3PUW A;  2NTT A;  3SR1 A;  4KKU A;  1NUC A;  2Q8T A;  2WV6 D;  2RDG A;  4K8I A;  4RGM A;  4R9W A;  2MJ8 A;  4ZUJ A;  1SEB D;  4A3I B;  1TII D;  1WTW A;  2NBF A;  2F03 A;  5ELD A;  1LTB D;  1XTC D;  4HAE A;  1PTO B;  3T53 B;  2CVR A;  5EKI A;  4TKO B;  2K1B A;  4IFD G;  1I4G A;  3W2D A;  3A8I E;  1G8Z D;  2WKD A;  4QUC A;  3NHH A;  1IYV A;  5C0X J;  3QOJ A;  5CV4 A;  4PMB A;  4NP5 A;  1NR4 A;  3WOF A;  1SNM A;  1GUS A;  3R3O A;  5KRU A;  2KCN A;  4R8N A;  4C2M B;  5FLX E;  2M9V A;  1U4R A;  3GQB A;  2R6G A;  4ZRZ A;  3K59 A;  1PZK D;  3TP6 A;  1I6V C;  1X3P A;  2IL8 A;  2NVY B;  1BR9 A;  5DAU A;  4CKC A;  2E2J B;  1WTP A;  3KK7 A;  1JIC A;  5EBC A;  5M5Y B;  1ENC A;  4XT1 B;  3MVV A;  4KD3 A;  4H0L C;  2ZXO A;  3NQT A;  2FMM A;  1V1P A;  1HUM A;  2RSO A;  2SDF A;  3D4R A;  3NUC A;  3EJI A;  4ILW A;  2EOT A;  2KED A;  2EYO A;  1EWH A;  4KKT A;  4BWG B;  3BVZ A;  4XQN A;  1H9R A;  1BDO A;  2M00 A;  2QEJ C;  4K2L A;  2PZW A;  2RA4 A;  2EE1 A;  2IX1 A;  1W6J A;  1CZW A;  1FD7 D;  3TZD A;  2YYZ A;  1HXY D;  1H9M A;  2EY5 A;  4XTC S;  2KCC A;  1H9K A;  4FNF A;  3GTK B;  1PRT D;  5CV7 A;  5I6W A;  3A7L A;  5DM6 3;  2BDN A;  1G6Z A;  5C3X A;  2YU9 B;  2B63 B;  2PW7 A;  1S5B D;  1AFP A;  3BVG A;  2K32 A;  3QG1 A;  1STB A;  5KNC A;  1F9R A;  4H7B A;  3I4L A;  1S5F D;  2KJX A;  2C5C A;  1QB5 D;  1CTM A;  2QCP X;  2JA8 B;  5G3L D;  5F2D A;  1XWE A;  2ZXR A;  5K36 G;  1SSO A;  4Q0F A;  3RLF A;  1BBX C;  3A8J E;  1EY7 A;  4DGZ A;  4L6T B;  3FPU B;  3IL8 A;  3BG3 A;  1DXM A;  2ICE C;  1AZQ A;  4KD4 A;  1HHV A;  3FEW X;  3QIA A;  5G3L F;  3GTP B;  2ICI A;  5FO8 B;  4RHS A;  3NSW A;  2L9H A;  1EEF D;  1CA6 A;  1HQM C;  3CHB D;  4FF2 A;  1F9P A;  1C48 A;  3SDZ A;  1SNQ A;  1RKN A;  2IW3 A;  4DAP A;  1RHP A;  3C2P A;  3BZD B;  4DNR B;  2Q8R E;  1Q1B A;  1TY0 A;  5J39 A;  3MHB A;  4KKS A;  2L0C A;  2JA5 B;  2JE6 I;  3GTJ B;  3OIP A;  3TBI B;  3EQL C;  4Z9C B;  2F0Q A;  4HMI A;  4AYB B;  1GUN A;  3A7A B;  3OWE B;  3H09 A;  1R4P B;  1EOT A;  4OO1 I;  1DOM A;  2F0W A;  3BDO A;  2A6H D;  2EY2 A;  2B8F A;  2EYL A;  2RBM A;  1LTS D;  2MUY A;  3NE5 B;  4RHR A;  1SE4 A;  4K6L A;  3T51 B;  3D4D A;  2A68 C;  1DZ1 A;  3K57 A;  1WTV A;  5JVG 3;  4DK0 A;  4A3G B;  3AMU A;  1G2S A;  1QWY A;  1V8Q A;  5BN3 A;  2PYK A;  3OSO A;  1EY4 A;  5NUC A;  3I3C A;  5JJZ A;  4FYD A;  3CU7 A;  1L0X B;  1FNU A;  2IWH A;  2RSN A;  2A6E D;  5D65 A;  4ID6 A;  2PO4 A;  3J81 E;  3SVM A;  4Q5V A;  5JAV A;  1J8I A;  3O13 A;  2F0V A;  3HOZ B;  1PTO D;  4LJZ C;  3ERQ A;  5JPM C;  4PV1 C;  2B2T A;  1ZEQ X;  1SNP A;  4ME5 A;  2F0O A;  1F77 A;  4ZYS A;  3SEB A;  1ML0 D;  3HOY B;  2L1B A;  3GD7 A;  4QB4 A;  5I2Y A;  1EYD A;  4MIU A;  1M8A A;  5HUR A;  3GV3 A;  1F9S A;  1GUG A;  4RKB A;  1MI2 A;  3ONA B;  3HGB A;  3OPO A;  1PTO F;  1GOZ A;  5KND A;  3R93 A;  1WTQ A;  2B8G A;  4MHE A;  3N52 A;  1RCV D;  1YNN D;  2PQE A;  3KUP A;  1PRT C;  2AQ3 B;  3RUZ A;  1SDF A;  2BDO A;  2HCC A;  2NVT B;  1STA A;  1CHQ D;  2I07 B;  2E75 C;  2EYP A;  3V2T A;  3GTQ B;  4RFB A;  1A6X A;  4F88 A;  2BE5 D;  4XXE A;  1TS5 A;  2JXM B;  5CV9 A;  2QIL A;  4J8Q A;  1VDZ A;  4C1N I;  2R7Z B;  1QJO A;  3DHQ A;  4OIJ A;  1F2L A;  2L12 A;  5D3I B;  5JEA J;  4OO1 G;  4MN3 A;  3PUV A;  1JOR A;  2DNC A;  1KAA A;  2VB2 X;  1HTL D;  2X69 A;  2IT1 A;  1I4R A;  3D6W A;  5FOB B;  1BOS A;  5COY A;  4CKB A;  3E5S A;  4FP5 D;  1PRT B;  3P20 A;  5M9O A;  1CZG A;  3C46 A;  2PZT A;  2AUK A;  3SK8 A;  1PTO H;  5IGB A;  3GTG B;  2OF1 A;  2EYM A;  2HDL A;  4CBV A;  1STE A;  1PXU A;  4JK1 C;  1EY9 A;  2E2D C;  3URY A;  4IFD I;  4V0B A;  1F2Z A;  5FKA C;  3M7N A;  4IUU A;  1IL8 A;  4CJ1 B;  1KAB A;  2LS0 1;  1Q12 A;  1EL0 A;  1Y8O B;  1E2V A;  1OXV A;  1G2T A;  2TSS A;  5CYU A;  5HGT A;  1ESR A;  3QJY A;  5DM7 3;  5I4D A;  2CQA A;  1FYC A;  4RAU C;  1PLF A;  3GV6 A;  1EYC A;  1X3Q A;  4RKL A;  2F0D A;  1SYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...