4K8JA

Crystal structure of staphylococcal nuclease mutant v23l/v66i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8jA00
1KDCA 4K5WA 2F0WA 1RKNA 4TRDA 5CV7A 1SNDA 3EROA 5KYLA 2WACA 1ENAA 4S3SA 5DAUA 3DMUA 5KRUA 1JOKA 1KDBA 4K8IA 2F0IA 3D4DA 1JOQA 5IODA 2KHSA 2EYOA 3MVVA 3SK8A 5KYIA 4E6IA 5K5PA 1KDAA 4F8MA 4ZUIA 4KJOA 4H7BA 1A3TA 4ODGA 5JOBA 3QOJA 4RKLA 5EKLA 4EVOA 2F0DA 1STNA 3OWFA 1EY5A 4N9TA 3D6CA 4PMBA 5IGFA 3SK6A 1KABA 2SNMA 5ISRA 3U9OA 4B9WA 1TR5A 5CV5A 5NUCA 3NXWA 4K2LA 4K2KA 2KQ3A 3HZXA 3S9WA 3P75A 2M00A 5I6YA 4QB4A 3H6MA 4KD3A 5J39A 2NUCA 5I9OA 5C4ZA 1SNPA 1SNMA 1SNQA 1A3UA 4HTHA 4MIUA 5JAVA 3MZ5A 4ID6A 3ITPA 3HEJA 2EYMA 4ME5A 4KJNA 2EY6A 1SNCA 1IHZA 4ZUJA 4IZ8A 1A3VA 5EKKA 4K6DA 4LAAA 5C3XA 1EQVA 2F0EA 4K5VA 2EY5A 4I65A 3NHHA 4RKBA 4WORA 1TQOA 3TP7A 5IGEA 5HURA 5KGUA 3D8GA 2PZWA 3MXPA 4OL7A 3PMFA 4KV6A 3TP5A 5IIFA 5C5MA 2EXZA 4K5XA 4K8JA 2F0PA 3EJIA 1SYCA 5IGBA 4ZQ3A 1SYEA 4WRDA 2PW7A 4J1MA 4PNYA 5CC4A 4NP5A 1EY8A 3C1EA 5CV9A 1SYGA 3OMCA 3SXHA 2EY1A 2F0FA 4IUNA 2RDFA 4N9PA 5C6AA 2O4XA 3MEHA 4QMGA 5CV8A 1JORA 2OXPA 3SK5A 5CV4A 2PYKA 1A2UA 1STYA 4B9XA 4NDXA 1ENCA 4HMIA 3NQTA 2F0LA 3R3OA 2F0SA 4KY6A 5DEHA 1STBA 3NK9A 3SHLA 1EY4A 2RBMA 4R8NA 1F2ZA 2F0QA 2PW5A 2HQEA 2QDBA 3NP8A 3OSOA 2OF1A 4K14A 2SNSA 2SOBA 3TMEA 1EY9A 1SYFA 4DF7A 3D4WA 2F3VA 2F0KA 5M9OA 2RKSA 3TP8A 1EY0A 3BDCA 5J1ZA 3T13A 2EYLA 2F0OA 1AEXA 4PMCA 1EZ6A 3MHBA 1STHA 3E5SA 5C4HA 5I6WA 3VA5A 2F0UA 3ERQA 5F2DA 4DU9A 5HGTA 1F2YA 5IGCA 2F0HA 4KD4A 5EGTA 4KHVA 3P1HA 2EYFA 4QF4A 5KEEA 5J22A 4EQNA 1STGA 5IOCA 4F7XA 4EQOA 4YIJA 2EYHA 2F0MA 1EYDA 2F3WA 2EY2A 3OMGA 1EY7A 5CV6A 1NSNS 2F0GA 3EVQA 2PZTA 1U9RA 4DGZA 3T16A 4KY5A 1JOOA 2LKVA 1II3A 1SNOA 1STAA 1A2TA 2ENBA 2PZUA 1SYDA 5E1FA 3SR1A 4EQPA 5I9PA 1KAAA 2F0VA 5C5LA 4IALA 5CGKA 5E3FA 1F2MA 3LX0A 4KTAA 5C3WA 2F0JA 1EY6A 2OEOA 5IGDA 3DHQA 5KIXA 3V2TA 1EYAA 3RUZA 1EYCA 4DFAA 2PQEA 4NMZA 4HMJA 3TP6A 2F0TA 4G57A 3QOLA 1NUCA 2F0NA 3QB3A 4KY7A 3SK4A 4NKLA 1TT2A 1SYBA 2EYJA 1EZ8A 4J6HA 3NUCA 2EYPA 5IGGA 3BDLA 3C1FA 5CR3A
chains in the Genus database with same CATH superfamily
1SXTA 1QCBD 3OW2A 1OO9B 2JQOA 2OTJA 4R4CA 4OX9Q 1UNSA 1E1TA 4MTKA 4X3KA 3D6WA 1CTMA 2YTXA 4HSPA 1EY5A 1NMGA 1CSPA 4LFAQ 4HIOA 4QQBX 3H0GB 5J39A 4P73A 2JA8G 2M2LA 1FGBD 2C9OA 1PRTD 3WOFA 4Q5VA 1IKMA 2PQAA 3E9IA 1N34Q 2ALYB 4JI1L 3M7NA 4HJ5A 2EPBA 3PIOA 1U4PA 1NNXA 1ILQA 3I90A 3K5LA 3D31A 1WD1A 5ELOA 4DV7L 3KJPA 1Y1WH 5CBEE 2UXDQ 3KLSA 4X66L 4BXXG 1B3AA 1HHVA 3EBEA 2RVLA 1HNWQ 4NP5A 2WV6D 4A3EH 4IUNA 3H91A 2K5WA 4JOIA 2PYKA 5J3BA 3DWQA 3VYTA 1NJIC 1QE6A 3O13A 4A3BB 3OWEB 1W2BA 3BDOA 1PRTF 4ZLTF 3S1QB 2RKSA 1C0AA 2I5LX 3BVMA 1A62A 2MP1A 3BDCA 3CF5A 3GTLB 3A0JA 3I91A 4RCOA 3F1ZA 3H09A 1WCMB 4RGTA 4V0BA 4CDDC 1I4HA 5M5XH 3VR4A 1B7YB 4TVAB 1GXDC 1PZJD 4NXMQ 1BCPC 5C4JH 2IX0A 4GNXB 5EPLA 4R4IA 5ELFA 3ER0A 1AW7A 1IKLA 4GNXA 3I56A 1TU2B 5I2YA 1GM5A 4FP5D 1VCIA 3FEWX 3FP9A 5KIXA 3PUZA 2A19A 1SRUA 3RUZA 5C4XH 1PH9A 3J7AV 1HRJA 3J7YW 1MJEA 1EOVA 2F0NA 3SK4A 5C4JB 2ZTCA 1DYQA 1PH6A 3PUXA 2K50A 4IUPA 4C2MH 2B2TA 1Y1VG 5LMNW 2NTSA 1KDBA 1JWUD 2WB1E 4K8IA 1RHPA 2MUYA 1KDAA 2VL6A 1M90C 3I73A 4RGNA 5HGQA 1H9KA 2XVSA 3SK6A 2K5VA 1X9NA 1Q90A 2B2WC 2EIFA 3FHWA 2E5LQ 2N88A 1SNPA 4IN3A 1DGSA 1QNUA 1PH3A 2LXKA 2B8FA 4EGVA 1EOTA 3M4PA 4DK3C 4X62L 1IHZA 4P75A 3I4OA 1EQVA 4UP9A 2ZJQA 4HJ9A 3CPFA 3J81E 1A63A 2D0PA 5IYDH 4IUQA 2KEEA 2CWPA 4CKCA 2KUMA 2JEBI 3Q22A 4ZQ3A 1OXSC 4IPCA 4DK6C 1YHAA 1AE2A 3SXHA 3DEOA 5M3MG 1LTGD 2M9VA 4A3IG 4K0KL 1PA6A 3MFGA 3HG9A 2HD3A 3SK5A 2PMZE 2D9UA 4LJZC 5D14A 2F0SA 3PCOB 2CH4A 3NK9A 1X3QA 1R4QB 2F0QA 1GUGA 4ZKBB 4JI2L 3OSOA 4K14A 2SOBA 4JI0L 1N32Q 3STBD 3RZDB 2BDOA 3ERSX 1EY0A 3K7AB 4WJ3M 4YWLA 5HGTA 2A6HD 3PO3G 1K0SA 4OELB 1LT6D 4C3JH 3GDEA 1J8IA 5AFWA 1U5KA 2B2YC 5CYUA 2GVAA 2JA6H 1G2TA 2P5ZX 4OXPA 3I4MG 4J8QA 5ELDA 1U4LA 1H9RA 4UP7A 5E7NA 1VMCA 1LTTD 1S5DD 1STAA 1EWCA 2N78A 1VQBA 5C3WA 2O5IC 1RTOA 4EX5A 2R93B 3S1RB 2HUGA 1HJPA 1CHPD 2UU9L 4IPDA 1VF5C 5JJKA 1Y1VB 2LFNA 1LUZA 1STEA 2ICIA 1CA6A 5FO7B 1HA6A 3F2CA 1ENAA 1JOQA 2F52A 1PDQA 1S5BD 3KLWA 3TSSA 3VR2A 1GHKA 2L9HA 4JBKA 1YHQA 1SMYD 1BBXC 4POGA 2LMCB 3QOJA 4L5RC 5M3FG 2WAQG 5IGFA 4HN7A 4DK1A 3U9OA 4YHHL 3EQLC 3NXWA 1FJGQ 1X55A 1XJVA 4JBWA 4IQZA 5JAVA 1H9MA 5EBDA 1XNQQ 2VXWA 2EY6A 3M4OH 5BN4A 1LTLA 4N8X1 3BG3A 3OIQA 4K5VA 2JEAI 1YI2A 1G51A 3I7FA 2IW3A 2V4DA 1MSHA 3NTKA 2RHQB 3J81L 2MJ8A 4YCUA 2K5DA 1X65A 2N55A 3PF4A 3M4OB 3R2TA 1V9PA 4HIMA 2OQKA 1I4RA 1F2ZA 2EQSA 4A3CH 3UE0A 3NP8A 4OONA 1XNRL 1IBKL 2XGTA 3FVQA 2Z1CA 1HNXL 1BVSA 1OXXK 3SDZA 2KCNA 5C0XJ 1EU4A 1T5EA 1HH2P 4JVZA 4FF4A 2EOTA 4KD4A 1VQNA 3G71A 4Q0FA 2RF4A 4H0LC 3T1YL 4LF5Q 3I70A 3HOVB 4A3MG 1KIXA 1V1OA 3NTIA 3G6JB 1M1KC 1SYDA 3T1HQ 3S14B 1MD2D 3LX0A 1QNKA 2ZJRA 1K8AC 3G48A 3KF6A 3TBIB 1EYAA 5H1SE 1QOHA 1S5CD 4TSSA 3S17B 1UE5A 4L5SA 1C48A 4A3DH 4BWGB 5G3LD 3GP7A 5GADC 2ASBA 5CR3A 1LO5D 3BJUA 2B29A 2RSNA 4A76A 3J80i 1B1ZA 3BVZA 1IBML 1PTOB 3J7ZC 1B70B 3X3NA 4ZRZA 2OWOA 3SK8A 2WAQB 3MXUA 4ALPA 3RN2A 3MXNA 4IUTA 4ZK9B 1QUQB 3H6MA 4DV0Q 1BCPB 2NUCA 5C4ZA 4QUFA 2Q2TA 1X56A 1EQRA 2HCIA 4CJ2C 2FMCA 1G8ZD 1L0YB 3S24A 2IY5B 3CRLC 3PIPA 5FJ8H 3E0EA 1YEZA 3LGJA 3NHHA 3B6YA 2E8GA 3PF5A 4X65Q 3HOUH 5IYBG 4DR3L 3VR6A 2CHBD 2TMPA 3PGZA 5G3LF 5C3EH 4JK1C 4K8JA 1E22A 1TKWB 1TS2A 4Y52H 2XN9C 1SYGA 2WFWA 2DUDA 5JVH3 4BA2I 2XNAC 3MEHA 5CV4A 1D5ZC 2EJGC 4NDXA 1QZGA 2XWJB 1AFPA 2G9HD 1EUJA 1STBA 2TSSA 3M3YH 5A2QE 4DV5L 1PYWD 2PCFB 2Y0SB 3HOUB 2UXCL 1XMOQ 1VQHA 4KHZA 5IWAQ 5C0XH 4O2DA 1K73C 4PG3A 4LF9Q 5I6WA 1PH4A 1V1QA 4HJAA 3J81c 4B3TQ 4ULLA 3HGBA 1UEAB 1KHIA 4P2CB 1JC7A 2NZHA 5M5YH 1XXGA 1Y8NB 3RLOA 1L1OA 3M3YB 4DR7Q 2NVTH 3A8IE 4I7ZC 2E2DC 1C7YA 4A3JH 1Y14B 2QEJC 2IT1A 2G9DA 2OT2A 3R2IA 2QGQA 4R4QA 1A2TA 4FF1A 4DNTB 2Q2UA 1FNUA 4GKJL 5C5LA 1B50A 1MIUA 4A3FB 3QO2A 1NR4A 3AU7A 5JPNC 1H9JA 3BYTB 1YJWA 3W1GA 2DJGC 1EYCA 3HOWH 4P74A 3SE0A 5EJWA 4ABNA 4KY7A 1X3FA 3OHXC 4DAMA 5GROA 3JAMi 2JYOA 3KYHC 2MO1A 3PO2G 2ICEC 1I6HH 1BO0A 4RA8A 1RKNA 2CCZA 3EROA 1O80A 2KA7A 4AYBG 2WINB 3CCEA 3D4DA 4DR6L 3GD7A 2K01A 2J4XA 4F8MA 1ICFB 3NE5B 3R8BA 2ZM6Q 2A74C 2UUBQ 2JA7G 1DM0B 4X6AH 3HS0C 1WD0A 3E6ZX 4WFN3 1H9SB 1HA5A 1M4VA 4JYAL 4AQYL 4LF7L 2R92G 2M00A 1OXUA 4KLKA 4KKUA 2Q8RE 4YY3Q 1YVCA 1H9SA 4A75A 4F88A 1EWHA 2B2VC 2DN8A 1I50H 4MIUA 1K9MC 3ITPA 2LS01 4XDXA 3CD6A 4A93B 2FXQA 2KOLA 1EFWA 4KJNA 2A69C 1ML0D 2R7DA 3W3AA 4X3TA 2AWNA 2EJMA 4KV6A 3TP5A 1UE1A 5FO8B 4YCVA 4DUZL 4A3GH 1SYEA 1ZKOA 2WIIB 3C1EA 3KDFA 4RAUC 4NXNQ 2F0FA 2MO0A 4AYBE 2X69A 1SE3A 2VUMH 3J81j 3H0GG 3NQTA 4A3LH 4U68A 3K6OA 4YCWA 1TXYA 2HQEA 2B3GA 2BH8A 5A2QL 1TS3A 3IFDA 2VW9A 2NTTA 2N3SA 2A73B 1HFGA 2F3VA 3CQZB 4DF7A 2QEXA 5IP7G 3PUVA 1A6XA 1STHA 5E4WC 5ELNA 3I3CA 3I4NB 5GQOA 3AEVA 2R61A 3MFYA 4DAVA 4IFDG 1ZYRC 1FR3A 1EYDA 3CC2A 4GN4B 2NVYH 3G7LA 4DV7Q 2K5NA 3EIVA 2K7VA 2KEDA 1PH1A 2D62A 4RGOS 1GUNA 4XQJA 2CWAA 4A3BG 1IW7D 1KAAA 5CGKA 1DOMA 3R93A 5E3FA 3PSIA 1EQTA 2ATWA 1D7QA 4DFAA 2Q2IA 2PQEA 3TP6A 4HMJA 1B8AA 1F77A 3HOXH 1NUCA 5CMDA 4C3IB 1SYBA 4OIKA 3OTOL 4DNIA 2J0TD 2KCTA 1WCMG 2PI2E 3NUCA 5LL6S 3NPPA 5D65A 2B2UA 5TSSA 2F0WA 1MSGA 1MJCA 3F2BA 1DJRD 3KBGA 1T9HA 3MTSA 4E6IA 3CCVA 2ZT9C 4QIWB 1HZAA 3GTPB 1P8LA 2KBNA 4N9TA 2R92B 3D6CA 3AFQA 1VQ6A 2K5HA 2AQ3B 3CU7A 3UI2A 5IT9E 1G291 5E4XA 3CC7A 3OIPA 2VQEL 5FOBB 1R9TH 5EQ0A 4FF2A 2RHSB 5EPKA 2AWOA 1VQAA 1FYCA 2FINB 4XTCS 4JI4L 1CKOA 4BBRH 3CCSA 5IP9H 1L2FA 1DCZA 3HOYH 3SGIA 3EFXD 4HJ7A 3OMCA 2EY1A 2Z8LA 2RDFA 4BY7B 4FVMA 4CHTB 1CZWA 3IRBA 3LWUA 2EDGA 5CBAE 3RNUA 1TY0A 1QVCA 4BBRB 1BQQT 4R8NA 3T4AC 4JI6L 1S72A 2K5QA 2XSCA 2PI2A 2PPBC 4OO1I 5K36G 3RD4A 2F0KA 1YITA 4DV2L 1I4XA 3X3MA 3UE1A 3KLSX 1VQOA 3VA5A 2EJFC 1OXVA 1ASYA 2XTIA 1JE4A 1PRTC 4X62Q 4YIJA 2F0MA 2IWHA 2I07B 2Z4IA 1Q46A 2PZTA 3GV6A 3OOCA 4DGZA 5FLXE 1Y1WB 4DAYB 3NSWA 3FPUB 1Q82C 3S15H 4EQPA 5I9PA 2GVBA 4B3RL 4G7HC 1F2MA 1PFNA 5DM63 3K0XA 4KTAA 2R7FA 5IGDA 4K0KQ 4A3EB 1GVPA 1PV4A 4LFBL 2R7ZH 2BCOA 4UHVA 3KLRA 2N49A 2A6ED 4JI2Q 3NBHB 1VS0A 3I4LA 1E24A 1SJED 4JI0Q 3S1NH 3S15B 4PMWA 4OHJA 1WFQA 4XT1B 1XPOA 3NBHA 5DAUA 1CA5A 1KLUD 4G4KA 2E75C 3CW2C 3MVVA 2FHTA 1I94L 3E0JA 2KECA 4ZUIA 1TS5A 5JOBA 3DXJC 2R7ZB 5ISRA 2SNMA 5M5XB 1LV9A 2R93G 4KD3A 4OWXB 4LNQA 2A6EC 3S1NB 5IYCG 5IT9L 2EYMA 2K04A 3RZOH 4KKTA 1SNCA 4JI7L 4ZUJA 5JJLA 4HR7B 4L5TA 1HZBA 2Q8TA 1K8OA 5JJZA 5C4XB 1Q1EA 4ME3A 4MNOA 1VQKA 1SYCA 1S4ZA 4J1MA 2K05A 4MZ9A 1SR3A 4DR4L 1VQ8A 2JA8H 5FLMH 2HIVA 4C2MB 3V96A 1A8VA 1A2UA 4LFAL 4JI5Q 4X3SA 3S2HH 4RHRA 3TRZA 1IYVA 4F87A 4CKBA 3VR3A 1YNJD 3ND9A 4DV6Q 4B3SL 4M1UB 2CFMA 4YHHQ 1TWHH 2MGSA 1ESRA 3RN5A 4POFA 4BXXH 3OPOA 5JEAG 5J1ZA 3T13A 4DR5L 2LXJA 1HNZQ 4MHEA 4RGMA 1IYUA 2IL8A 5T1IA 3H3VI 2F0HA 1UUPA 2MFIA 1EYGA 3KOJA 3URYA 3PIO3 4LF6L 1RTNA 3J80E 5BR8Q 4R8IA 1HR0L 2B39A 1W6KA 3K80C 3VYSA 1YNJC 1S5FD 2AUKA 1NCVA 4JI3L 1K28A 1PZID 1II3A 5FLXL 5COYA 3K5MA 4ZCKA 1PH7A 4XYOA 4QCLA 3VYRA 4IFDI 1IL8A 1D1KA 4G57A 4GLXA 3BU2A 4GN5A 3CC4A 5LMUL 1XNRQ 2EYPA 1IBKQ 2HHHL 1HNXQ 2RDHA 3I55A 4FXKC 1TWFH 3M85A 2R3ZA 3HOVG 1JOKA 1VQ5A 4LW1A 3STBC 2WB1B 3A7LA 3TZUA 5KYIA 2VQFL 2Q8IB 4RG1A 1A3TA 1CKNB 2A6HC 2ES2A 4C3JB 5NUCA 3T1YQ 1N33Q 3P75A 2JA6B 1K3BC 1ILPA 4YWMA 2Z6KA 1PYBA 4DUYL 4DNRB 1D1IA 1LYLA 1A3VA 1T5XD 1EL0A 4GOPC 1ET6A 4I65A 3BYYB 3BZDB 1V43A 3MXPA 4OL7A 3PMFA 4AIMA 2UXBQ 1WI5A 1YJNA 1RF2D 1F2LA 4R4OA 1J6QA 4B3ML 2D0OA 4KI0A 4OWWB 3IAYA 1GD7A 1GO3E 3ZJYC 3TEHB 4R1JA 1IBMQ 4QMGA 5AJ3L 1AZQA 1ENCA 4XT3B 4XXEA 1VQLA 1EIHA 3I8ZA 2QF7A 1CQVA 3SHLA 5IT9c 4LF4L 1F9SA 4U673 2DGYA 5KNBA 1EIYB 2JA5H 5KNCA 3ONAB 2OF1A 1SMYC 3LNNA 3NELA 4DV3L 1JJGA 3A74A 1E2WA 1EZ6A 3WOEA 2A8VA 3M4YA 5M3MH 2NYZD 1NR2A 3JAME 4EQNA 1HCZA 2NN6H 2RCFA 2I46A 3SVMA 1DONA 1Q8KA 1VMPA 3Q8DA 3J80L 4DR3Q 3T16A 4FDBA 2LKVA 5DM73 3BZCA 1J5EL 2WAQE 1KTKA 1WTXA 4HSVA 3HOUG 2Y0SG 3GTMH 5C44H 3PUYA 1WJJA 3QWNA 5KNDA 3P7JA 2YU9H 4DR2L 4CDEC 1GUTA 5IY0A 4DV5Q 1AN8A 4BBSH 2UXCQ 1EZ8A 1D5MC 1SMXA 3I4MH 1SLJA 4KN7C 1U4RA 2D5DA 2VB3X 5CV7A 5D3DA 3HKZB 3K8AA 2WACA 3DM1A 2O2LD 5C0XG 1CKMA 5FLXc 1EFID 1PRTB 1N8RC 4CBVA 1VQEA 2A1AA 3NEMA 3S9WA 4K2KA 1WTQA 4A3FG 2Z6BA 3FKIH 5I9OA 2KHIA 1Q12A 2K03A 2HQLA 1KQSA 1A3UA 3MZ5A 4ID6A 4LUZA 3HFZB 2Y0SE 1N36L 1SROA 4GKJQ 4DR1L 1EEID 2F0EA 1YBYA 1TQOA 1IXRA 4JV5L 4KKSA 1PMRA 5M3FH 1MGSA 1PFSA 2AKWB 3FKIB 4C3HH 3BVGA 5CV9A 4A3DB 3CKIB 3U50C 3WWVA 2ZXOA 1FJGL 2E2IH 4NPSA 2A5HA 3MA2B 2RDGA 1QUQA 1DD2A 3OYYA 1HXYD 4DR6Q 3UDFA 1PFBA 4A93G 1XNQL 4J15A 2NVQH 4JYAQ 4AQYQ 3D4WA 4LF7Q 4C3HB 4C56C 4G7OC 3L7ZC 2IPKD 1F2YA 3E9HA 4JOIC 4QF4A 1Y69U 2X6GA 3KFUA 4X64L 3JAML 2HDMA 1TVXA 1EIGA 1HTLD 1NSNS 1SJHD 1SFOH 4FXDA 2NVQB 3CAMA 1SE8A 1U9RA 1FGUA 2XRSD 2LSSA 4KY5A 4DUZQ 1VQJA 5C3EB 2ENBA 1E7ZA 3F2UA 2JN4A 2F0JA 4JBMA 1NE3A 4FYDA 1LLRD 1X32A 3TS2A 1X3PA 1NMFA 2B2WA 1WTRA 1E2ZA 1SFOB 3Q24A 3I4NG 1UAPA 1FVIA 4A3MH 4YWKA 4FF3A 1XPRA 1SNDA 2FJ2A 1V1PB 4GNXC 2MHVA 3DWPA 4JW0A 4S3SA 1NAPA 1AP0A 1LT3D 3J80c 2BA0A 2AUJD 2IJ0A 4MTNA 2NWGA 4H7BA 4KJOA 4EVOA 1KD1C 4OWTB 5M5YB 1B9NA 1SN8A 1PH8A 4DAPA 2NVTB 3K58A 4A3JB 2MQHA 1D6EC 4HTHA 1LT5D 2BDNA 3HP3A 4ME5A 1GJXA 3W2DA 4C3IG 2B2TC 3LWEA 2DNCA 3S2DH 1TWCH 4WORA 4JPBW 1AZPA 1IBLL 2PZWA 2OTLA 2C5CA 3HOWB 3M7GA 4CDCC 1C4QA 3OTOQ 2PW7A 4FNFA 4GKKL 4PNYA 5CC4A 1GUWA 1VQDA 5C6AA 2VY3A 4LWCA 5GAEC 1YZ6A 1Q8IA 1I6HB 2LY7A 3W1BA 1ZXTA 2B2YA 1HZCA 1CM9A 1ESFA 4DV1L 1G6ZA 4P72A 3K59A 3ND8A 2NB0A 2QDBA 2L1BA 1RIPA 5LL6X 1JB3A 2SNSA 5IYBH 1CSQA 3S16H 5M5WH 4UPAA 1PYSB 1KL9A 3V05A 4X65L 3I2ZA 2KCCA 2VQEQ 1TWGH 4EQ5A 1KC8C 4OO1H 2YTYA 1I50B 1BNZA 1CT1D 1O7YA 3PIP3 3S1MH 1G6PA 3QR8A 3CMAA 4JI4Q 2B63H 2VB2X 4A3KH 4GOPB 4BY7G 4NB3A 4JI8L 3ULPA 3GTQH 4LF8L 4BBRG 2VNUD 3FMCA 1I4GA 4A3GB 4QIWE 2E76C 2F0VA 4IALA 1W6JA 2BOSA 1Q7YC 2OEOA 3S1MB 2ZXRA 5LHY1 1S3OA 2WKCA 2L11A 3MXGA 3UDIA 1JR0D 2AHOB 2B63B 1V8QA 2VUMB 1TT2A 1TIID 1LT4D 1I4PA 4JI1Q 4JI6Q 1EWIA 3OW7A 4IFDJ 3C1FA 2CQOA 4CGYB 3HOZH 4DR7L 3C3LA 3JAMc 1VQ7A 2A68D 5EPJA 4DV2Q 2MNAA 4X66Q 4BY1H 2H1EA 2F0IA 3QG1A 5IODA 1JQYD 1Y1WG 1ASZA 5LMNL 4PMBA 3K57A 2K1BA 3HKSA 4HAEA 3L3OC 5EKIA 1KRTA 4K2LA 3AQQA 3K81C 2KCMA 2Z4HA 4A3EG 4L8JA 3HOZB 1SNQA 1WOCA 2NVYB 3GTJH 1MI2A 3HEJA 2K75A 1P16A 4BY1B 4B3RQ 2O5JC 1I6VC 2J7ZA 1NY4A 2EXDA 1IW7C 4DPGA 1LACA 4DV4L 4GN3B 5C5MA 1HQRD 1XMQL 3NENA 4K5XA 4LFBQ 3AB9A 3HOXB 1W3SA 1Z47A 2R7ZG 2DNEA 2O4XA 2CQAA 1EEFD 5CV8A 1SBBB 1STYA 3VDYA 1AH9A 4HMIA 2UUAL 1K0RA 3R3OA 3KF8B 5DEHA 2E2JH 4QL5A 3TDQA 1I94Q 1NTGA 3DLLA 2IHFA 2RQXA 1Z6HA 1EY9A 1XYIA 3D3RA 2RA4A 2L12A 3MHBA 3MAQA 4KN4C 5C4XG 2F0UA 2XWBB 3ERQA 4DA2A 4DU9A 4H02A 1RODA 5J22A 3P1HA 2EYFA 1R9TB 2Z9HA 1X6OA 1K8MA 3KUPA 2NVXH 3H0GH 4XIGS 2XRQD 3OMGA 2F3WA 3H3VH 5CV6A 1AE3A 2F0GA 3K7UC 3AYHB 1RD9D 2F03A 3SR1A 4WJWA 1LTBD 4ZYSA 3NWSA 1JB7A 3CCLA 3HOYB 4K6LA 4DR4Q 3MWYW 2JP1A 5IP7H 1BR9A 1FL0A 4IURA 3TQYA 3ZYYX 5FK9C 2PQAB 2UUCL 2NVXB 1JCKB 5FLMG 3PV0A 4IFDH 5IGGA 3L9AX 4IPGA 4IJHA 4B3SQ 4K5WA 4DXGA 1HQMC 4DR5Q 3DMUA 3N52A 1F9RA 4A3BH 4LFCL 5IYDG 1KLGD 3RMHA 1PTOD 2F4VL 4GLVB 5EKLA 4DAYA 4GS3A 2F0DA 1F9QA 3OWFA 4LF6Q 3S1QH 1SE4A 3GTLH 2N8NA 4HCSA 1HR0Q 2GN5A 4C1NK 4PV1C 1BKBA 1WCMH 3EN2A 4JI3Q 4UP8A 4KHPL 1YIJA 1BCPD 3PUWA 4IZ8A 5EBCA 5EKKA 4LAAA 2QA4A 4V190 4APVA 4QJFA 5IGEA 3TP7A 1JJCB 1UE6A 3AMUA 1PTOC 3U9SA 3BS1A 1D5XC 5IIFA 3T53B 2F0PA 2I5HA 2WB1G 5LMUQ 4H44C 1WTHA 5HY6A 1CI3M 1VF7A 1BBUA 3VYUA 2HHHQ 1A0IA 4C3JG 4PZ7A 5CORA 4B9XA 1PTOF 2JA6G 4RFBA 3IFTA 3P20A 2VQFQ 5ELBA 2KHJA 1JWSD 2QW7A 2PW5A 2K14A 4A4IA 1EIFA 3CP0A 2EYLA 4PMCA 1AEXA 4OX9L 4OIJA 1BCPF 2UU9Q 1IL2A 4O42A 5IGCA 3C2PA 4DUYQ 5EGTA 4KHVA 1STGA 3RZOB 5BN5A 5I2XA 4EQOA 3K5OA 1E3PA 4DKAC 1Z9FA 4RH6A 2QILA 1HTPA 3N6RA 1CZGA 1X54A 2ZXPA 5E1FA 1QWYA 1N34L 4OGQC 5K36H 3IL8A 1WTVA 4B3MQ 1MKHA 1JMCA 3U58A 3AFPA 1EY6A 4BA1I 5JEAJ 2JA8B 5AJ3Q 1FD7D 4IJLA 4NMZA 1RCVD 1QJOA 2UXDL 3QOLA 1RJTA 2G5DA 2IX1A 1OXTA 2ID0A 1L1OC 1HNWL 1C8CA 3MEFA 4CJ1B 2EYJA 4LF4Q 3A8JE 4J6HA 2B2VA 1GHJA 4UDUC 1JT8A 3S2HB 3G6EA 4ZAIA 2V1CC 4DV3Q 1TWHB 5JVG3 2JA5G 2KHSA 5K5PA 1E1OA 4ODGA 1QZHA 1STNA 4XYQA 3RZDH 3VA7A 3D0FA 4LK1C 2ZJPA 2PNHA 3HZXA 3K7AH 4IOAA 4WJ4A 3L0OA 4ILWA 2NN6G 1B53A 3KBXA 3J7AF 1J5EQ 4JCVE 4HJ8A 1L0WA 1YHBA 5I4DA 1MHWC 1QB5D 4HIDA 4NXML 1E0BA 2EY5A 3W5OA 4A3CG 5EAYA 2RSOA 4P71A 1FNWA 3HKZG 3A8KE 2HDLA 4DR2Q 5C44G 2WKDA 4QUCA 2VZAA 4HCEA 4L63B 1VQCA 1EQQA 1JJ2A 2MPMA 2R93H 1HUMA 1CKNA 3S1RH 1VQMA 2L55A 5IYCH 1UEBA 1S40A 4BBSG 4IUUA 5L37A 1TWFB 1N9WA 3A55A 1I4QA 4PQXA 1Y1VH 1ET9A 3F2DA 3CXCA 5DNFA 1PHJA 3QJYA 3WDNA 2YV5A 2D2CC 2JA9A 1IYJB 2K52A 3TP8A 4LUVA 2X6LA 3UDXA 1YJ9A 1WTPA 1I5FA 2K33A 5KEEA 3FKIG 1N36Q 4DR1Q 1ZEQX 1O78A 2XIWA 2QKIC 3GTKH 3U4VA 1LM0A 4A3DG 1OTCA 2EY2A 2PMZB 3HKZE 2E5LL 4JV5Q 1LTID 2CW0D 1SSOA 4M8AA 4JI5L 5A35A 5JJIA 4CDFC 1PH2A 3M9BA 5JEAH 4R9WA 2AQ1B 4O0AA 4DV6L 4I7AA 3RLNA 3L2PA 3Q0AA 4C3HG 3GTKB 1GUOA 3KK7A 1VQPA 1Q3LA 4A3IH 4Z9CB 3TS0A 1HNZL 2KJXA 4FO2A 4XQQA 1XPUA 1UE7A 3TZDA 2CW0C 2JA5B 4Y7NH 5KYLA 3H15A 2I5MX 5FJ8G 5BR8L 5KRUA 3CHBD 3EA6A 5BN3A 3CCJA 4HEDA 3IKJA 5C3EG 4RKLA 1J9OA 5M3MB 4A3IB 1K8GA 1K3RA 4B9WA 2EE1A 1N32L 5CV5A 4X64Q 2KQ3A 3PO3H 3HRZC 4QB4A 1XTCD 1SNMA 4Y7NB 1Q86C 1GKHA 1QILA 5D3IB 1KAWA 2B2UC 2AQ2B 2SEBD 1VQIA 3GO5A 4K6DA 3HOVH 4UAIA 3GTMB 1LTSD 3M4QA 4IOCA 5C44B 1QVFA 3F8TA 4QY7A 3RR5A 2EXZA 2NZOA 1LTRD 2YU9B 3PO3B 3S14H 3DWAA 3CRKC 4BBSB 3GV3A 5JPMC 2ZTDA 3I4MB 2HCCA 1JORA 3U4ZA 4CKEA 1L0XB 2ZTEA 3S17H 1N33L 2K32A 4IPHA 4A3JG 2JK8A 3H94A 3GTOH 2H5XA 3Q6SA 1TY2A 2VS1A 1K83H 2RBMA 4G7ZC 1PXUA 2CKZB 4UY8C 1G91A 4RMFA 1DOLA 1X3EA 3KF6B 1PTOH 2FMMA 3J81i 2JE6I 2F3IA 1Y8OB 1SAPA 5M9OA 1HFNA 2F0OA 2AMCB 2UXBL 3HOWG 1CUKA 4GLAC 1O7IA 4MN3A 1HR0W 4HIKA 1HZ9A 3GTOB 1E2VA 4JBJA 1K83B 2E74C 2I0QA 2BA1A 1B9MA 1CK1A 4BS9A 1EY7A 1IBLQ 3H3VC 3NTHA 3SEBA 3KJOA 3J7A5 1DXMA 1S5ED 1SNOA 3RLFA 5M3FB 3MXNB 1Z7TA 4GKKQ 1VQFA 1O7ZA 2YTVA 1BBWA 1VDZA 1NBWA 3QIAA 3V2TA 1JWMD 1DZ1A 1PH5A 2E2IB 4DV1Q 1CQFA 1LTAD 1A15A 2L4NA 4PZ8A 1KDCA 4C1NI 1X3GA 1HUNA 4OEMB 1U0LA 2EYOA 1UWVA 4ZKCB 1B44D 2HT1A 3UDGA 2C35B 4XQNA 3I72A 2CH4W 4A3GG 2EZVA 4IUVA 1TR5A 2Z0SA 4OO1G 1R4PB 2K28A 3ULLA 4JI8Q 4LF8Q 5ELCA 1RL2A 2B63G 4TQUS 4A3KG 2VUMG 2K4KA 4A3LG 1CFMA 1KNAA 3GQBA 1RDPD 3CPWA 2R6GA 2QCPX 4LF5L 1PLFA 5HURA 2H4OA 1V1PA 2NN6I 2OCEA 3EJIA 4B08A 1QG7A 1L1OB 2HIXA 4WRDA 3T1HL 4A3FH 1EY8A 2QDLA 1LABA 4PZ6A 4A3MB 1DOKA 5IE8A 1XTDA 2OXPA 4H13C 1PZKD 2YYZA 2DJFC 1XX8A 2WP8J 3HOZG 2IX3A 4R4TA 1YNXA 4KY6A 3CMEA 3A5ZB 1H95A 2FFKB 1YNND 3CCUA 1GUSA 3ICEA 3CCQA 4BY1G 1I3QH 5LMNQ 4TKOB 1SDFA 1G2SA 3TMEA 1MBYA 1SYFA 2BH2A 2OQ0A 2KVMA 2NZ1D 5C4HA 3K0YA 3E5SA 1WTOA 5FO9B 2GA4B 2EVBA 4RHSA 5T1GA 3HOXG 1GOZA 1VQGA 3NBIA 4F7XA 1BOSA 3VR5A 4RWSC 1YNNC 3S2DB 4KMUC 1QVGA 1TWCB 1I3QB 4DV0L 4DV4Q 2L15A 1WTWA 1EU3A 3NQIA 3EVQA 2L0CA 2A69D 4A93H 1XMQQ 1D2BA 1JOOA 1VQ9A 1ONLA 2PZUA 4X3UA 3D4RA 1CHQD 1Y8PB 3T51B 2DY8A 2Q2HA 2F0TA 2SDFA 2UUAQ 4RCNA 3QB3A 2B8GA 3FPPA 1C9OA 3BDLA 4DN4M 4TRDA 1BXTA 3S16B 3DM3A 2JJQA 4GOPA 5M5WB 5GAGC 5IP9G 1B2TA 1PVOA 2IHEA 1Q1BA 1TS4A 3KDFB 1U4MA 1TWGB 2RCNA 1XMOL 2F1MA 1BUVT 3HOYG 1KABA 3CQZH 1ENFA 5IWAL 4DXFA 3DEPA 5I6YA 3Q23A 2BE5D 4JG2A 4LF9L 4A3KB 4B3TL 3I4NH 3K5NA 3A56A 1SEBD 3GTQB 5DLQE 2NBFA 1ZYRD 4IO9A 1B4OA 1KRSA 5C3XA 1TWAH 3T56B 2JXMB 4RKBA 5KGUA 1KNEA 3D8GA 3A7AB 1BDOA 2UUCQ 3C46A 3G4SA 1XWEA 5IGBA 3CCRA 2BE5C 1BF4A 1WYDA 4N9PA 1F9PA 2KENA 2L5TA 2Z6KC 2K6AA 1TWAB 3PQIA 2DY7A 4C3IH 2F0LA 4N8FA 4QGUA 4LFCQ 3PO2H 1PFMA 2A68C 2E2HH 5C0XI 1IZ6A 1EY4A 3MC0B 1O7LA 2F4VQ 3GTGH 2JSOA 1ICWA 3ULJA 1Q81C 3TN2A 4L5QA 4AH6A 2JA7H 3FRPB 4L6TB 5FKAC 4LUOA 1WVLA 4LMQD 5F2DA 3GTPH 1VQ4A 3A54A 2ZM6L 3GTJB 3FDTA 2UUBL 2R92H 4KHPQ 1KXLA 3PO2B 5IOCA 2E2HB 4FXGC 1JICA 1HPCA 2EYHA 1D8LA 3BZKA 4AYBB 2F4IA 5GAHC 3GTGB 4KK7A 4YY3L 1M8AA 3JC66 4CJ0B 4NW2A 4JC0A 1FNVA 2JA7B 3KF8A 2PO4A 4GZYC 3DHQA 5ELEA 1JE5A 1SE2A 3DUZA 3TREA 4NKLA 4O1NA 4JI7Q 3A5UA 2E2JB 2PNRC 3E3XA 4BY7H 1B3QA 4NXNL 2CVRA 3NWTA 3CCMA 4DK0A
chains in the Genus database with same CATH topology
1SXTA 1QCBD 1OO9B 1UNSA 4X3KA 3D6WA 1CTMA 4HSPA 1EY5A 3H0GB 5J39A 2M2LA 1FGBD 2C9OA 1PRTD 3WOFA 4Q5VA 1IKMA 3M7NA 2EPBA 1U4PA 3I90A 1ILQA 3K5LA 3D31A 1WD1A 5CBEE 3KLSA 1B3AA 1HHVA 2RVLA 4NP5A 2WV6D 4IUNA 3H91A 2K5WA 2PYKA 3DWQA 3VYTA 1QE6A 3O13A 4A3BB 3OWEB 3BDOA 1PRTF 4ZLTF 3S1QB 2RKSA 3BVMA 2MP1A 3BDCA 3GTLB 3I91A 4RCOA 3H09A 1WCMB 4RGTA 4V0BA 1I4HA 3VR4A 1GXDC 1PZJD 1BCPC 2IX0A 5EPLA 5ELFA 1AW7A 1IKLA 1TU2B 5I2YA 4FP5D 1VCIA 3FEWX 5KIXA 3PUZA 3RUZA 1HRJA 3J7AV 3J7YW 2F0NA 3SK4A 5C4JB 1DYQA 3PUXA 4IUPA 2B2TA 2NTSA 1KDBA 1JWUD 4K8IA 1RHPA 2MUYA 1KDAA 3I73A 4RGNA 1H9KA 2XVSA 3SK6A 1Q90A 2B2WC 2N88A 1SNPA 4IN3A 1QNUA 2B8FA 4EGVA 1EOTA 1IHZA 1EQVA 3J81E 4IUQA 2KEEA 4CKCA 2KUMA 2JEBI 3Q22A 4ZQ3A 1OXSC 3SXHA 3DEOA 1LTGD 2M9VA 3MFGA 3HG9A 3SK5A 2D9UA 4LJZC 5D14A 2F0SA 3NK9A 1X3QA 1R4QB 2F0QA 1GUGA 4ZKBB 3OSOA 4K14A 2SOBA 3RZDB 2BDOA 1EY0A 3K7AB 5HGTA 2A6HD 1LT6D 1J8IA 5AFWA 2B2YC 5CYUA 1G2TA 4J8QA 5ELDA 1U4LA 1H9RA 1VMCA 1LTTD 1STAA 1S5DD 1EWCA 5C3WA 2O5IC 1RTOA 2R93B 3S1RB 2HUGA 1CHPD 1VF5C 1Y1VB 2LFNA 1STEA 2ICIA 1CA6A 5FO7B 1HA6A 1ENAA 1JOQA 1PDQA 1S5BD 3TSSA 3VR2A 1GHKA 2L9HA 1SMYD 1BBXC 2LMCB 3QOJA 5IGFA 4HN7A 4DK1A 3U9OA 3EQLC 3NXWA 4JBWA 4IQZA 5JAVA 1H9MA 5EBDA 2VXWA 2EY6A 5BN4A 3BG3A 3OIQA 4K5VA 2JEAI 2IW3A 2V4DA 1MSHA 3NTKA 3J81L 2MJ8A 2K5DA 2N55A 3M4OB 3R2TA 1I4RA 1F2ZA 3NP8A 3FVQA 2Z1CA 1OXXK 3SDZA 2KCNA 5C0XJ 1EU4A 1T5EA 4FF4A 2EOTA 4KD4A 4Q0FA 4H0LC 3I70A 3HOVB 1V1OA 3NTIA 3G6JB 1SYDA 3S14B 1MD2D 3LX0A 1QNKA 3TBIB 1EYAA 1QOHA 1S5CD 4TSSA 3S17B 1C48A 4BWGB 5G3LD 3GP7A 5CR3A 1LO5D 2RSNA 1B1ZA 3BVZA 1PTOB 3X3NA 4ZRZA 3SK8A 2WAQB 3MXUA 3MXNA 4IUTA 4ZK9B 3H6MA 1BCPB 2NUCA 5C4ZA 4QUFA 2HCIA 4CJ2C 2FMCA 1G8ZD 1L0YB 3CRLC 3NHHA 3VR6A 2CHBD 2TMPA 5G3LF 4JK1C 4K8JA 1TKWB 1TS2A 2XN9C 1SYGA 4BA2I 5JVH3 2XNAC 3MEHA 5CV4A 1D5ZC 2EJGC 4NDXA 2XWJB 1AFPA 2G9HD 2TSSA 1STBA 5A2QE 1PYWD 2PCFB 2Y0SB 3HOUB 4KHZA 5C0XH 5I6WA 4ULLA 3HGBA 1UEAB 4P2CB 1JC7A 1XXGA 1Y8NB 3M3YB 3A8IE 4I7ZC 2E2DC 2QEJC 2IT1A 2G9DA 2OT2A 3R2IA 1A2TA 4FF1A 4DNTB 1FNUA 5C5LA 1B50A 4A3FB 3QO2A 1NR4A 3AU7A 5JPNC 1H9JA 3BYTB 1EYCA 3SE0A 5EJWA 4ABNA 4KY7A 3OHXC 2JYOA 2ICEC 1BO0A 4RA8A 1RKNA 3EROA 1O80A 2KA7A 2WINB 3D4DA 3GD7A 2K01A 2J4XA 4F8MA 3NE5B 3R8BA 2A74C 1DM0B 3HS0C 1WD0A 3E6ZX 4WFN3 1H9SB 1HA5A 1M4VA 2M00A 1OXUA 4KKUA 2Q8RE 1H9SA 4F88A 1EWHA 2B2VC 2DN8A 4MIUA 3ITPA 2LS01 4XDXA 4A93B 2KOLA 4KJNA 2A69C 1ML0D 3W3AA 4X3TA 2AWNA 2EJMA 4KV6A 3TP5A 5FO8B 1SYEA 1ZKOA 2WIIB 3C1EA 4RAUC 2F0FA 2X69A 1SE3A 3NQTA 4U68A 3K6OA 2HQEA 5A2QL 1TS3A 3IFDA 2NTTA 4DF7A 2A73B 1HFGA 2F3VA 3CQZB 3PUVA 1A6XA 1STHA 5E4WC 3I3CA 3I4NB 2R61A 3MFYA 4DAVA 4IFDG 1ZYRC 1FR3A 1EYDA 3G7LA 2K7VA 2KEDA 2D62A 4RGOS 1GUNA 4XQJA 1IW7D 1KAAA 5CGKA 1DOMA 3R93A 5E3FA 1EQTA 4DFAA 2PQEA 3TP6A 4HMJA 1F77A 1NUCA 5CMDA 4C3IB 1SYBA 4OIKA 2J0TD 3NUCA 5LL6S 3NPPA 5D65A 2B2UA 5TSSA 2F0WA 1MSGA 1DJRD 3KBGA 3MTSA 4E6IA 2ZT9C 4QIWB 3GTPB 4N9TA 2R92B 3D6CA 2AQ3B 3CU7A 3UI2A 5IT9E 1G291 5E4XA 3OIPA 5FOBB 5EQ0A 4FF2A 5EPKA 2AWOA 1FYCA 2FINB 4XTCS 1DCZA 3EFXD 3OMCA 2EY1A 2Z8LA 2RDFA 4BY7B 4FVMA 4CHTB 1CZWA 5CBAE 3LWUA 2EDGA 1TY0A 4BBRB 1BQQT 4R8NA 3T4AC 2K5QA 2XSCA 2PPBC 4OO1I 5K36G 3RD4A 2F0KA 1I4XA 3X3MA 3KLSX 3VA5A 2EJFC 1OXVA 1JE4A 1PRTC 4YIJA 2F0MA 2IWHA 2I07B 2Z4IA 3GV6A 2PZTA 3OOCA 4DGZA 5FLXE 1Y1WB 3NSWA 3FPUB 4EQPA 5I9PA 4G7HC 1F2MA 1PFNA 5DM63 4KTAA 5IGDA 4A3EB 2BCOA 3KLRA 2A6ED 3I4LA 1SJED 3S15B 4PMWA 4OHJA 4XT1B 3NBHA 5DAUA 1CA5A 1KLUD 4G4KA 2E75C 3MVVA 2FHTA 3E0JA 2KECA 4ZUIA 1TS5A 5JOBA 3DXJC 2R7ZB 5ISRA 2SNMA 5M5XB 1LV9A 4KD3A 2A6EC 3S1NB 5IT9L 2EYMA 2K04A 4KKTA 1SNCA 4ZUJA 4HR7B 2Q8TA 1K8OA 5JJZA 5C4XB 1Q1EA 1SYCA 1S4ZA 4J1MA 2K05A 4C2MB 3V96A 1A2UA 4X3SA 4RHRA 1IYVA 4F87A 4CKBA 3VR3A 1YNJD 3ND9A 4M1UB 2MGSA 1ESRA 3OPOA 5JEAG 5J1ZA 3T13A 4MHEA 4RGMA 1IYUA 2IL8A 5T1IA 2F0HA 1UUPA 3URYA 3PIO3 1RTNA 3J80E 4R8IA 2B39A 1W6KA 3VYSA 1YNJC 1S5FD 2AUKA 1NCVA 1PZID 1II3A 5FLXL 5COYA 3K5MA 4XYOA 4QCLA 3VYRA 4IFDI 1IL8A 1D1KA 4G57A 2EYPA 2RDHA 4FXKC 3M85A 2R3ZA 1JOKA 2WB1B 3A7LA 3TZUA 5KYIA 2Q8IB 1A3TA 2A6HC 4C3JB 5NUCA 3P75A 2JA6B 1ILPA 4DNRB 1D1IA 1A3VA 1T5XD 1EL0A 1ET6A 4I65A 3BYYB 3BZDB 1V43A 3MXPA 4OL7A 3PMFA 1RF2D 1F2LA 4KI0A 3IAYA 4QMGA 1AZQA 1ENCA 4XT3B 4XXEA 1EIHA 3I8ZA 2QF7A 1CQVA 3SHLA 1F9SA 4U673 5KNBA 5KNCA 3ONAB 2OF1A 1SMYC 3LNNA 1E2WA 1EZ6A 3WOEA 3M4YA 2NYZD 1NR2A 3JAME 4EQNA 1HCZA 2NN6H 2I46A 3SVMA 1DONA 1VMPA 3J80L 3T16A 2LKVA 5DM73 1KTKA 1WTXA 4HSVA 3PUYA 3QWNA 5KNDA 3P7JA 1GUTA 1AN8A 1EZ8A 1D5MC 4KN7C 1U4RA 2D5DA 2VB3X 5CV7A 5D3DA 3HKZB 2WACA 3DM1A 2O2LD 5C0XG 1EFID 1PRTB 4CBVA 1WTQA 3S9WA 4K2KA 5I9OA 1Q12A 2K03A 1A3UA 3MZ5A 4ID6A 1EEID 2F0EA 1TQOA 4KKSA 1PMRA 1MGSA 3FKIB 3BVGA 5CV9A 4A3DB 3CKIB 2ZXOA 2A5HA 3MA2B 2RDGA 1DD2A 1HXYD 1PFBA 3D4WA 4C3HB 4C56C 4G7OC 3L7ZC 2IPKD 1F2YA 4QF4A 1Y69U 2X6GA 3JAML 2HDMA 1TVXA 1EIGA 1HTLD 1NSNS 1SJHD 4FXDA 2NVQB 1U9RA 2XRSD 4KY5A 5C3EB 2ENBA 3F2UA 4FYDA 2F0JA 1LLRD 1X32A 1X3PA 2B2WA 1WTRA 1E2ZA 1SFOB 3Q24A 1UAPA 4FF3A 1SNDA 2FJ2A 1V1PB 2MHVA 3DWPA 4S3SA 1NAPA 1AP0A 1LT3D 2BA0A 2AUJD 2IJ0A 2NWGA 4H7BA 4KJOA 4EVOA 5M5YB 1B9NA 4DAPA 2NVTB 3K58A 4A3JB 1D6EC 4HTHA 1LT5D 2BDNA 3HP3A 4ME5A 1GJXA 3W2DA 4C3IG 2B2TC 3LWEA 2DNCA 4WORA 1AZPA 2PZWA 2C5CA 3HOWB 3M7GA 1C4QA 2PW7A 4FNFA 4PNYA 5CC4A 1GUWA 5C6AA 1Q8IA 1I6HB 2LY7A 1ZXTA 2B2YA 1CM9A 1ESFA 1G6ZA 3K59A 3ND8A 2NB0A 2QDBA 2L1BA 5LL6X 1JB3A 2SNSA 3V05A 2KCCA 4OO1H 1BNZA 1I50B 1CT1D 1O7YA 3PIP3 2VB2X 2VNUD 3FMCA 1I4GA 4A3GB 2E76C 2F0VA 4IALA 1W6JA 2BOSA 2OEOA 3S1MB 2ZXRA 5LHY1 2WKCA 2L11A 3MXGA 2B63B 1JR0D 1V8QA 2VUMB 1TT2A 1TIID 1LT4D 1I4PA 3OW7A 4IFDJ 3C1FA 4CGYB 3C3LA 2A68D 5EPJA 2H1EA 2F0IA 3QG1A 5IODA 1JQYD 4PMBA 3K57A 2K1BA 4HAEA 5EKIA 3L3OC 4K2LA 2Z4HA 4L8JA 3HOZB 1SNQA 2NVYB 1MI2A 3HEJA 4BY1B 2O5JC 1I6VC 2J7ZA 1IW7C 1LACA 5C5MA 1HQRD 4K5XA 3AB9A 3HOXB 1Z47A 2DNEA 2O4XA 2CQAA 1EEFD 5CV8A 1SBBB 1STYA 4HMIA 3R3OA 5DEHA 3TDQA 2RQXA 1Z6HA 1EY9A 1XYIA 3D3RA 2RA4A 2L12A 3MHBA 3MAQA 4KN4C 2F0UA 2XWBB 4DU9A 3ERQA 4DA2A 1RODA 5J22A 3P1HA 2EYFA 1R9TB 1K8MA 3KUPA 4XIGS 2XRQD 3OMGA 2F3WA 5CV6A 2F0GA 1RD9D 2F03A 3SR1A 4WJWA 1LTBD 4ZYSA 3NWSA 3HOYB 4K6LA 3MWYW 2JP1A 1BR9A 4IURA 3ZYYX 5FK9C 2NVXB 1JCKB 3PV0A 4IFDH 5IGGA 3L9AX 4K5WA 4DXGA 1HQMC 3DMUA 3N52A 1F9RA 1KLGD 3RMHA 1PTOD 5EKLA 4DAYA 2F0DA 1F9QA 3OWFA 1SE4A 4HCSA 4C1NK 4PV1C 1BCPD 3PUWA 4IZ8A 5EBCA 5EKKA 4LAAA 4V190 5IGEA 3TP7A 3AMUA 1PTOC 3U9SA 3BS1A 1D5XC 5IIFA 3T53B 2F0PA 4H44C 1CI3M 1VF7A 3VYUA 4C3JG 5CORA 4B9XA 1PTOF 4RFBA 3IFTA 3P20A 5ELBA 1JWSD 2PW5A 2EYLA 4PMCA 1AEXA 4OIJA 1BCPF 4O42A 5IGCA 3C2PA 5EGTA 4KHVA 1STGA 3RZOB 5BN5A 5I2XA 4EQOA 3K5OA 4RH6A 2QILA 1HTPA 3N6RA 1CZGA 2ZXPA 5E1FA 1QWYA 5K36H 4OGQC 3IL8A 1WTVA 1EY6A 4BA1I 5JEAJ 2JA8B 1FD7D 4NMZA 1RCVD 1QJOA 3QOLA 1RJTA 2IX1A 1OXTA 2ID0A 1C8CA 4CJ1B 2EYJA 3A8JE 4J6HA 2B2VA 1GHJA 4UDUC 3S2HB 4ZAIA 1TWHB 5JVG3 2KHSA 5K5PA 4ODGA 1STNA 4XYQA 3VA7A 4LK1C 3HZXA 4ILWA 2NN6G 1B53A 3KBXA 3J7AF 5I4DA 1QB5D 1E0BA 2EY5A 2RSOA 1FNWA 3A8KE 2HDLA 2WKDA 4QUCA 4HCEA 4L63B 2MPMA 1HUMA 2L55A 4IUUA 1TWFB 3A55A 1I4QA 4PQXA 1ET9A 5DNFA 3QJYA 3WDNA 2D2CC 3TP8A 2X6LA 1WTPA 2K33A 5KEEA 1ZEQX 1O78A 2XIWA 2QKIC 2EY2A 2PMZB 1LTID 2CW0D 1SSOA 4M8AA 5A35A 5JEAH 4R9WA 2AQ1B 3Q0AA 4C3HG 3GTKB 1GUOA 3KK7A 1Q3LA 4Z9CB 2KJXA 4FO2A 4XQQA 3TZDA 2CW0C 2JA5B 5KYLA 5KRUA 3CHBD 3EA6A 5BN3A 4HEDA 3IKJA 4RKLA 1J9OA 5M3MB 4A3IB 4B9WA 2EE1A 5CV5A 2KQ3A 3HRZC 4QB4A 1XTCD 1SNMA 4Y7NB 1QILA 5D3IB 2B2UC 2AQ2B 2SEBD 3GO5A 4K6DA 4UAIA 3GTMB 1LTSD 5C44B 2EXZA 3PO3B 1LTRD 2YU9B 3DWAA 3CRKC 4BBSB 3GV3A 5JPMC 3I4MB 2HCCA 1JORA 4CKEA 1L0XB 2K32A 3H94A 3Q6SA 1TY2A 2RBMA 4G7ZC 1PXUA 1G91A 1DOLA 1PTOH 2FMMA 2JE6I 1Y8OB 1SAPA 5M9OA 1HFNA 2F0OA 4MN3A 3GTOB 1E2VA 1K83B 2E74C 2BA1A 1B9MA 1CK1A 4BS9A 1EY7A 3H3VC 3NTHA 3SEBA 1DXMA 1S5ED 1SNOA 3RLFA 5M3FB 1Z7TA 1O7ZA 1VDZA 3QIAA 3V2TA 1JWMD 1DZ1A 2E2IB 1CQFA 1LTAD 1A15A 2L4NA 1KDCA 4C1NI 1HUNA 2EYOA 4ZKCB 1B44D 4XQNA 3I72A 2EZVA 4IUVA 1TR5A 4OO1G 1R4PB 2K28A 5ELCA 4TQUS 1CFMA 1KNAA 3GQBA 1RDPD 2R6GA 2QCPX 1PLFA 5HURA 2H4OA 1V1PA 2NN6I 3EJIA 4B08A 1QG7A 4WRDA 1EY8A 1LABA 4A3MB 1DOKA 4H13C 2OXPA 1PZKD 2YYZA 1XX8A 2WP8J 2IX3A 4KY6A 2FFKB 1YNND 1GUSA 4TKOB 1SDFA 1G2SA 3TMEA 1MBYA 1SYFA 2KVMA 2NZ1D 5C4HA 3K0YA 3E5SA 1WTOA 5FO9B 2GA4B 2EVBA 4RHSA 5T1GA 1GOZA 3NBIA 4F7XA 1BOSA 3VR5A 4RWSC 1YNNC 3S2DB 4KMUC 1TWCB 1I3QB 1WTWA 1EU3A 3NQIA 3EVQA 2L0CA 2A69D 1D2BA 1JOOA 1ONLA 2PZUA 4X3UA 3D4RA 1CHQD 1Y8PB 3T51B 2DY8A 2F0TA 2SDFA 4RCNA 3QB3A 2B8GA 3FPPA 3BDLA 4DN4M 4TRDA 1BXTA 3S16B 5M5WB 1B2TA 1Q1BA 1TS4A 1U4MA 1TWGB 2F1MA 1BUVT 1KABA 1ENFA 4DXFA 3DEPA 5I6YA 3Q23A 2BE5D 4A3KB 3K5NA 3A56A 1SEBD 3GTQB 2NBFA 1ZYRD 1B4OA 5C3XA 3T56B 2JXMB 4RKBA 5KGUA 1KNEA 3D8GA 3A7AB 1BDOA 3C46A 1XWEA 5IGBA 2BE5C 1BF4A 4N9PA 1F9PA 2L5TA 2K6AA 1TWAB 2DY7A 2F0LA 1PFMA 2A68C 5C0XI 1EY4A 3MC0B 1O7LA 2JSOA 1ICWA 3TN2A 3FRPB 4L6TB 5FKAC 1WVLA 4LMQD 5F2DA 3GTJB 3A54A 3FDTA 3PO2B 5IOCA 2E2HB 4FXGC 1JICA 1HPCA 2EYHA 3GTGB 4AYBB 2F4IA 4KK7A 1M8AA 4CJ0B 4NW2A 1FNVA 2JA7B 3KF8A 2PO4A 4GZYC 3DHQA 5ELEA 1SE2A 3DUZA 4NKLA 4O1NA 2E2JB 2PNRC 2CVRA 3NWTA 4DK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDC A;  4K5W A;  2F0W A;  1RKN A;  4TRD A;  5CV7 A;  1SND A;  3ERO A;  5KYL A;  2WAC A;  1ENA A;  4S3S A;  5DAU A;  3DMU A;  5KRU A;  1JOK A;  1KDB A;  4K8I A;  2F0I A;  3D4D A;  1JOQ A;  5IOD A;  2KHS A;  2EYO A;  3MVV A;  3SK8 A;  5KYI A;  4E6I A;  5K5P A;  1KDA A;  4F8M A;  4ZUI A;  4KJO A;  4H7B A;  1A3T A;  4ODG A;  5JOB A;  3QOJ A;  4RKL A;  5EKL A;  4EVO A;  2F0D A;  1STN A;  3OWF A;  1EY5 A;  4N9T A;  3D6C A;  4PMB A;  5IGF A;  3SK6 A;  1KAB A;  2SNM A;  5ISR A;  3U9O A;  4B9W A;  1TR5 A;  5CV5 A;  5NUC A;  3NXW A;  4K2L A;  4K2K A;  2KQ3 A;  3HZX A;  3S9W A;  3P75 A;  2M00 A;  5I6Y A;  4QB4 A;  3H6M A;  4KD3 A;  5J39 A;  2NUC A;  5I9O A;  5C4Z A;  1SNP A;  1SNM A;  1SNQ A;  1A3U A;  4HTH A;  4MIU A;  5JAV A;  3MZ5 A;  4ID6 A;  3ITP A;  3HEJ A;  2EYM A;  4ME5 A;  4KJN A;  2EY6 A;  1SNC A;  1IHZ A;  4ZUJ A;  4IZ8 A;  1A3V A;  5EKK A;  4K6D A;  4LAA A;  5C3X A;  1EQV A;  2F0E A;  4K5V A;  2EY5 A;  4I65 A;  3NHH A;  4RKB A;  4WOR A;  1TQO A;  3TP7 A;  5IGE A;  5HUR A;  5KGU A;  3D8G A;  2PZW A;  3MXP A;  4OL7 A;  3PMF A;  4KV6 A;  3TP5 A;  5IIF A;  5C5M A;  2EXZ A;  4K5X A;  4K8J A;  2F0P A;  3EJI A;  1SYC A;  5IGB A;  4ZQ3 A;  1SYE A;  4WRD A;  2PW7 A;  4J1M A;  4PNY A;  5CC4 A;  4NP5 A;  1EY8 A;  3C1E A;  5CV9 A;  1SYG A;  3OMC A;  3SXH A;  2EY1 A;  2F0F A;  4IUN A;  2RDF A;  4N9P A;  5C6A A;  2O4X A;  3MEH A;  4QMG A;  5CV8 A;  1JOR A;  2OXP A;  3SK5 A;  5CV4 A;  2PYK A;  1A2U A;  1STY A;  4B9X A;  4NDX A;  1ENC A;  4HMI A;  3NQT A;  2F0L A;  3R3O A;  2F0S A;  4KY6 A;  5DEH A;  1STB A;  3NK9 A;  3SHL A;  1EY4 A;  2RBM A;  4R8N A;  1F2Z A;  2F0Q A;  2PW5 A;  2HQE A;  2QDB A;  3NP8 A;  3OSO A;  2OF1 A;  4K14 A;  2SNS A;  2SOB A;  3TME A;  1EY9 A;  1SYF A;  4DF7 A;  3D4W A;  2F3V A;  2F0K A;  5M9O A;  2RKS A;  3TP8 A;  1EY0 A;  3BDC A;  5J1Z A;  3T13 A;  2EYL A;  2F0O A;  1AEX A;  4PMC A;  1EZ6 A;  3MHB A;  1STH A;  3E5S A;  5C4H A;  5I6W A;  3VA5 A;  2F0U A;  3ERQ A;  5F2D A;  4DU9 A;  5HGT A;  1F2Y A;  5IGC A;  2F0H A;  4KD4 A;  5EGT A;  4KHV A;  3P1H A;  2EYF A;  4QF4 A;  5KEE A;  5J22 A;  4EQN A;  1STG A;  5IOC A;  4F7X A;  4EQO A;  4YIJ A;  2EYH A;  2F0M A;  1EYD A;  2F3W A;  2EY2 A;  3OMG A;  1EY7 A;  5CV6 A;  1NSN S;  2F0G A;  3EVQ A;  2PZT A;  1U9R A;  4DGZ A;  3T16 A;  4KY5 A;  1JOO A;  2LKV A;  1II3 A;  1SNO A;  1STA A;  1A2T A;  2ENB A;  2PZU A;  1SYD A;  5E1F A;  3SR1 A;  4EQP A;  5I9P A;  1KAA A;  2F0V A;  5C5L A;  4IAL A;  5CGK A;  5E3F A;  1F2M A;  3LX0 A;  4KTA A;  5C3W A;  2F0J A;  1EY6 A;  2OEO A;  5IGD A;  3DHQ A;  5KIX A;  3V2T A;  1EYA A;  3RUZ A;  1EYC A;  4DFA A;  2PQE A;  4NMZ A;  4HMJ A;  3TP6 A;  2F0T A;  4G57 A;  3QOL A;  1NUC A;  2F0N A;  3QB3 A;  4KY7 A;  3SK4 A;  4NKL A;  1TT2 A;  1SYB A;  2EYJ A;  1EZ8 A;  4J6H A;  3NUC A;  2EYP A;  5IGG A;  3BDL A;  3C1F A;  5CR3 A; 
#chains in the Genus database with same CATH topology
 1SXT A;  1QCB D;  3OW2 A;  1OO9 B;  2JQO A;  2OTJ A;  4R4C A;  4OX9 Q;  1UNS A;  1E1T A;  4MTK A;  4X3K A;  3D6W A;  1CTM A;  2YTX A;  4HSP A;  1EY5 A;  1NMG A;  1CSP A;  4LFA Q;  4HIO A;  4QQB X;  3H0G B;  5J39 A;  4P73 A;  2JA8 G;  2M2L A;  1FGB D;  2C9O A;  1PRT D;  3WOF A;  4Q5V A;  1IKM A;  2PQA A;  3E9I A;  1N34 Q;  2ALY B;  4JI1 L;  3M7N A;  4HJ5 A;  2EPB A;  3PIO A;  1U4P A;  1NNX A;  1ILQ A;  3I90 A;  3K5L A;  3D31 A;  1WD1 A;  5ELO A;  4DV7 L;  3KJP A;  1Y1W H;  5CBE E;  2UXD Q;  3KLS A;  4X66 L;  4BXX G;  1B3A A;  1HHV A;  3EBE A;  2RVL A;  1HNW Q;  4NP5 A;  2WV6 D;  4A3E H;  4IUN A;  3H91 A;  2K5W A;  4JOI A;  2PYK A;  5J3B A;  3DWQ A;  3VYT A;  1NJI C;  1QE6 A;  3O13 A;  4A3B B;  3OWE B;  1W2B A;  3BDO A;  1PRT F;  4ZLT F;  3S1Q B;  2RKS A;  1C0A A;  2I5L X;  3BVM A;  1A62 A;  2MP1 A;  3BDC A;  3CF5 A;  3GTL B;  3A0J A;  3I91 A;  4RCO A;  3F1Z A;  3H09 A;  1WCM B;  4RGT A;  4V0B A;  4CDD C;  1I4H A;  5M5X H;  3VR4 A;  1B7Y B;  4TVA B;  1GXD C;  1PZJ D;  4NXM Q;  1BCP C;  5C4J H;  2IX0 A;  4GNX B;  5EPL A;  4R4I A;  5ELF A;  3ER0 A;  1AW7 A;  1IKL A;  4GNX A;  3I56 A;  1TU2 B;  5I2Y A;  1GM5 A;  4FP5 D;  1VCI A;  3FEW X;  3FP9 A;  5KIX A;  3PUZ A;  2A19 A;  1SRU A;  3RUZ A;  5C4X H;  1PH9 A;  3J7A V;  1HRJ A;  3J7Y W;  1MJE A;  1EOV A;  2F0N A;  3SK4 A;  5C4J B;  2ZTC A;  1DYQ A;  1PH6 A;  3PUX A;  2K50 A;  4IUP A;  4C2M H;  2B2T A;  1Y1V G;  5LMN W;  2NTS A;  1KDB A;  1JWU D;  2WB1 E;  4K8I A;  1RHP A;  2MUY A;  1KDA A;  2VL6 A;  1M90 C;  3I73 A;  4RGN A;  5HGQ A;  1H9K A;  2XVS A;  3SK6 A;  2K5V A;  1X9N A;  1Q90 A;  2B2W C;  2EIF A;  3FHW A;  2E5L Q;  2N88 A;  1SNP A;  4IN3 A;  1DGS A;  1QNU A;  1PH3 A;  2LXK A;  2B8F A;  4EGV A;  1EOT A;  3M4P A;  4DK3 C;  4X62 L;  1IHZ A;  4P75 A;  3I4O A;  1EQV A;  4UP9 A;  2ZJQ A;  4HJ9 A;  3CPF A;  3J81 E;  1A63 A;  2D0P A;  5IYD H;  4IUQ A;  2KEE A;  2CWP A;  4CKC A;  2KUM A;  2JEB I;  3Q22 A;  4ZQ3 A;  1OXS C;  4IPC A;  4DK6 C;  1YHA A;  1AE2 A;  3SXH A;  3DEO A;  5M3M G;  1LTG D;  2M9V A;  4A3I G;  4K0K L;  1PA6 A;  3MFG A;  3HG9 A;  2HD3 A;  3SK5 A;  2PMZ E;  2D9U A;  4LJZ C;  5D14 A;  2F0S A;  3PCO B;  2CH4 A;  3NK9 A;  1X3Q A;  1R4Q B;  2F0Q A;  1GUG A;  4ZKB B;  4JI2 L;  3OSO A;  4K14 A;  2SOB A;  4JI0 L;  1N32 Q;  3STB D;  3RZD B;  2BDO A;  3ERS X;  1EY0 A;  3K7A B;  4WJ3 M;  4YWL A;  5HGT A;  2A6H D;  3PO3 G;  1K0S A;  4OEL B;  1LT6 D;  4C3J H;  3GDE A;  1J8I A;  5AFW A;  1U5K A;  2B2Y C;  5CYU A;  2GVA A;  2JA6 H;  1G2T A;  2P5Z X;  4OXP A;  3I4M G;  4J8Q A;  5ELD A;  1U4L A;  1H9R A;  4UP7 A;  5E7N A;  1VMC A;  1LTT D;  1S5D D;  1STA A;  1EWC A;  2N78 A;  1VQB A;  5C3W A;  2O5I C;  1RTO A;  4EX5 A;  2R93 B;  3S1R B;  2HUG A;  1HJP A;  1CHP D;  2UU9 L;  4IPD A;  1VF5 C;  5JJK A;  1Y1V B;  2LFN A;  1LUZ A;  1STE A;  2ICI A;  1CA6 A;  5FO7 B;  1HA6 A;  3F2C A;  1ENA A;  1JOQ A;  2F52 A;  1PDQ A;  1S5B D;  3KLW A;  3TSS A;  3VR2 A;  1GHK A;  2L9H A;  4JBK A;  1YHQ A;  1SMY D;  1BBX C;  4POG A;  2LMC B;  3QOJ A;  4L5R C;  5M3F G;  2WAQ G;  5IGF A;  4HN7 A;  4DK1 A;  3U9O A;  4YHH L;  3EQL C;  3NXW A;  1FJG Q;  1X55 A;  1XJV A;  4JBW A;  4IQZ A;  5JAV A;  1H9M A;  5EBD A;  1XNQ Q;  2VXW A;  2EY6 A;  3M4O H;  5BN4 A;  1LTL A;  4N8X 1;  3BG3 A;  3OIQ A;  4K5V A;  2JEA I;  1YI2 A;  1G51 A;  3I7F A;  2IW3 A;  2V4D A;  1MSH A;  3NTK A;  2RHQ B;  3J81 L;  2MJ8 A;  4YCU A;  2K5D A;  1X65 A;  2N55 A;  3PF4 A;  3M4O B;  3R2T A;  1V9P A;  4HIM A;  2OQK A;  1I4R A;  1F2Z A;  2EQS A;  4A3C H;  3UE0 A;  3NP8 A;  4OON A;  1XNR L;  1IBK L;  2XGT A;  3FVQ A;  2Z1C A;  1HNX L;  1BVS A;  1OXX K;  3SDZ A;  2KCN A;  5C0X J;  1EU4 A;  1T5E A;  1HH2 P;  4JVZ A;  4FF4 A;  2EOT A;  4KD4 A;  1VQN A;  3G71 A;  4Q0F A;  2RF4 A;  4H0L C;  3T1Y L;  4LF5 Q;  3I70 A;  3HOV B;  4A3M G;  1KIX A;  1V1O A;  3NTI A;  3G6J B;  1M1K C;  1SYD A;  3T1H Q;  3S14 B;  1MD2 D;  3LX0 A;  1QNK A;  2ZJR A;  1K8A C;  3G48 A;  3KF6 A;  3TBI B;  1EYA A;  5H1S E;  1QOH A;  1S5C D;  4TSS A;  3S17 B;  1UE5 A;  4L5S A;  1C48 A;  4A3D H;  4BWG B;  5G3L D;  3GP7 A;  5GAD C;  2ASB A;  5CR3 A;  1LO5 D;  3BJU A;  2B29 A;  2RSN A;  4A76 A;  3J80 i;  1B1Z A;  3BVZ A;  1IBM L;  1PTO B;  3J7Z C;  1B70 B;  3X3N A;  4ZRZ A;  2OWO A;  3SK8 A;  2WAQ B;  3MXU A;  4ALP A;  3RN2 A;  3MXN A;  4IUT A;  4ZK9 B;  1QUQ B;  3H6M A;  4DV0 Q;  1BCP B;  2NUC A;  5C4Z A;  4QUF A;  2Q2T A;  1X56 A;  1EQR A;  2HCI A;  4CJ2 C;  2FMC A;  1G8Z D;  1L0Y B;  3S24 A;  2IY5 B;  3CRL C;  3PIP A;  5FJ8 H;  3E0E A;  1YEZ A;  3LGJ A;  3NHH A;  3B6Y A;  2E8G A;  3PF5 A;  4X65 Q;  3HOU H;  5IYB G;  4DR3 L;  3VR6 A;  2CHB D;  2TMP A;  3PGZ A;  5G3L F;  5C3E H;  4JK1 C;  4K8J A;  1E22 A;  1TKW B;  1TS2 A;  4Y52 H;  2XN9 C;  1SYG A;  2WFW A;  2DUD A;  5JVH 3;  4BA2 I;  2XNA C;  3MEH A;  5CV4 A;  1D5Z C;  2EJG C;  4NDX A;  1QZG A;  2XWJ B;  1AFP A;  2G9H D;  1EUJ A;  1STB A;  2TSS A;  3M3Y H;  5A2Q E;  4DV5 L;  1PYW D;  2PCF B;  2Y0S B;  3HOU B;  2UXC L;  1XMO Q;  1VQH A;  4KHZ A;  5IWA Q;  5C0X H;  4O2D A;  1K73 C;  4PG3 A;  4LF9 Q;  5I6W A;  1PH4 A;  1V1Q A;  4HJA A;  3J81 c;  4B3T Q;  4ULL A;  3HGB A;  1UEA B;  1KHI A;  4P2C B;  1JC7 A;  2NZH A;  5M5Y H;  1XXG A;  1Y8N B;  3RLO A;  1L1O A;  3M3Y B;  4DR7 Q;  2NVT H;  3A8I E;  4I7Z C;  2E2D C;  1C7Y A;  4A3J H;  1Y14 B;  2QEJ C;  2IT1 A;  2G9D A;  2OT2 A;  3R2I A;  2QGQ A;  4R4Q A;  1A2T A;  4FF1 A;  4DNT B;  2Q2U A;  1FNU A;  4GKJ L;  5C5L A;  1B50 A;  1MIU A;  4A3F B;  3QO2 A;  1NR4 A;  3AU7 A;  5JPN C;  1H9J A;  3BYT B;  1YJW A;  3W1G A;  2DJG C;  1EYC A;  3HOW H;  4P74 A;  3SE0 A;  5EJW A;  4ABN A;  4KY7 A;  1X3F A;  3OHX C;  4DAM A;  5GRO A;  3JAM i;  2JYO A;  3KYH C;  2MO1 A;  3PO2 G;  2ICE C;  1I6H H;  1BO0 A;  4RA8 A;  1RKN A;  2CCZ A;  3ERO A;  1O80 A;  2KA7 A;  4AYB G;  2WIN B;  3CCE A;  3D4D A;  4DR6 L;  3GD7 A;  2K01 A;  2J4X A;  4F8M A;  1ICF B;  3NE5 B;  3R8B A;  2ZM6 Q;  2A74 C;  2UUB Q;  2JA7 G;  1DM0 B;  4X6A H;  3HS0 C;  1WD0 A;  3E6Z X;  4WFN 3;  1H9S B;  1HA5 A;  1M4V A;  4JYA L;  4AQY L;  4LF7 L;  2R92 G;  2M00 A;  1OXU A;  4KLK A;  4KKU A;  2Q8R E;  4YY3 Q;  1YVC A;  1H9S A;  4A75 A;  4F88 A;  1EWH A;  2B2V C;  2DN8 A;  1I50 H;  4MIU A;  1K9M C;  3ITP A;  2LS0 1;  4XDX A;  3CD6 A;  4A93 B;  2FXQ A;  2KOL A;  1EFW A;  4KJN A;  2A69 C;  1ML0 D;  2R7D A;  3W3A A;  4X3T A;  2AWN A;  2EJM A;  4KV6 A;  3TP5 A;  1UE1 A;  5FO8 B;  4YCV A;  4DUZ L;  4A3G H;  1SYE A;  1ZKO A;  2WII B;  3C1E A;  3KDF A;  4RAU C;  4NXN Q;  2F0F A;  2MO0 A;  4AYB E;  2X69 A;  1SE3 A;  2VUM H;  3J81 j;  3H0G G;  3NQT A;  4A3L H;  4U68 A;  3K6O A;  4YCW A;  1TXY A;  2HQE A;  2B3G A;  2BH8 A;  5A2Q L;  1TS3 A;  3IFD A;  2VW9 A;  2NTT A;  2N3S A;  2A73 B;  1HFG A;  2F3V A;  3CQZ B;  4DF7 A;  2QEX A;  5IP7 G;  3PUV A;  1A6X A;  1STH A;  5E4W C;  5ELN A;  3I3C A;  3I4N B;  5GQO A;  3AEV A;  2R61 A;  3MFY A;  4DAV A;  4IFD G;  1ZYR C;  1FR3 A;  1EYD A;  3CC2 A;  4GN4 B;  2NVY H;  3G7L A;  4DV7 Q;  2K5N A;  3EIV A;  2K7V A;  2KED A;  1PH1 A;  2D62 A;  4RGO S;  1GUN A;  4XQJ A;  2CWA A;  4A3B G;  1IW7 D;  1KAA A;  5CGK A;  1DOM A;  3R93 A;  5E3F A;  3PSI A;  1EQT A;  2ATW A;  1D7Q A;  4DFA A;  2Q2I A;  2PQE A;  3TP6 A;  4HMJ A;  1B8A A;  1F77 A;  3HOX H;  1NUC A;  5CMD A;  4C3I B;  1SYB A;  4OIK A;  3OTO L;  4DNI A;  2J0T D;  2KCT A;  1WCM G;  2PI2 E;  3NUC A;  5LL6 S;  3NPP A;  5D65 A;  2B2U A;  5TSS A;  2F0W A;  1MSG A;  1MJC A;  3F2B A;  1DJR D;  3KBG A;  1T9H A;  3MTS A;  4E6I A;  3CCV A;  2ZT9 C;  4QIW B;  1HZA A;  3GTP B;  1P8L A;  2KBN A;  4N9T A;  2R92 B;  3D6C A;  3AFQ A;  1VQ6 A;  2K5H A;  2AQ3 B;  3CU7 A;  3UI2 A;  5IT9 E;  1G29 1;  5E4X A;  3CC7 A;  3OIP A;  2VQE L;  5FOB B;  1R9T H;  5EQ0 A;  4FF2 A;  2RHS B;  5EPK A;  2AWO A;  1VQA A;  1FYC A;  2FIN B;  4XTC S;  4JI4 L;  1CKO A;  4BBR H;  3CCS A;  5IP9 H;  1L2F A;  1DCZ A;  3HOY H;  3SGI A;  3EFX D;  4HJ7 A;  3OMC A;  2EY1 A;  2Z8L A;  2RDF A;  4BY7 B;  4FVM A;  4CHT B;  1CZW A;  3IRB A;  3LWU A;  2EDG A;  5CBA E;  3RNU A;  1TY0 A;  1QVC A;  4BBR B;  1BQQ T;  4R8N A;  3T4A C;  4JI6 L;  1S72 A;  2K5Q A;  2XSC A;  2PI2 A;  2PPB C;  4OO1 I;  5K36 G;  3RD4 A;  2F0K A;  1YIT A;  4DV2 L;  1I4X A;  3X3M A;  3UE1 A;  3KLS X;  1VQO A;  3VA5 A;  2EJF C;  1OXV A;  1ASY A;  2XTI A;  1JE4 A;  1PRT C;  4X62 Q;  4YIJ A;  2F0M A;  2IWH A;  2I07 B;  2Z4I A;  1Q46 A;  2PZT A;  3GV6 A;  3OOC A;  4DGZ A;  5FLX E;  1Y1W B;  4DAY B;  3NSW A;  3FPU B;  1Q82 C;  3S15 H;  4EQP A;  5I9P A;  2GVB A;  4B3R L;  4G7H C;  1F2M A;  1PFN A;  5DM6 3;  3K0X A;  4KTA A;  2R7F A;  5IGD A;  4K0K Q;  4A3E B;  1GVP A;  1PV4 A;  4LFB L;  2R7Z H;  2BCO A;  4UHV A;  3KLR A;  2N49 A;  2A6E D;  4JI2 Q;  3NBH B;  1VS0 A;  3I4L A;  1E24 A;  1SJE D;  4JI0 Q;  3S1N H;  3S15 B;  4PMW A;  4OHJ A;  1WFQ A;  4XT1 B;  1XPO A;  3NBH A;  5DAU A;  1CA5 A;  1KLU D;  4G4K A;  2E75 C;  3CW2 C;  3MVV A;  2FHT A;  1I94 L;  3E0J A;  2KEC A;  4ZUI A;  1TS5 A;  5JOB A;  3DXJ C;  2R7Z B;  5ISR A;  2SNM A;  5M5X B;  1LV9 A;  2R93 G;  4KD3 A;  4OWX B;  4LNQ A;  2A6E C;  3S1N B;  5IYC G;  5IT9 L;  2EYM A;  2K04 A;  3RZO H;  4KKT A;  1SNC A;  4JI7 L;  4ZUJ A;  5JJL A;  4HR7 B;  4L5T A;  1HZB A;  2Q8T A;  1K8O A;  5JJZ A;  5C4X B;  1Q1E A;  4ME3 A;  4MNO A;  1VQK A;  1SYC A;  1S4Z A;  4J1M A;  2K05 A;  4MZ9 A;  1SR3 A;  4DR4 L;  1VQ8 A;  2JA8 H;  5FLM H;  2HIV A;  4C2M B;  3V96 A;  1A8V A;  1A2U A;  4LFA L;  4JI5 Q;  4X3S A;  3S2H H;  4RHR A;  3TRZ A;  1IYV A;  4F87 A;  4CKB A;  3VR3 A;  1YNJ D;  3ND9 A;  4DV6 Q;  4B3S L;  4M1U B;  2CFM A;  4YHH Q;  1TWH H;  2MGS A;  1ESR A;  3RN5 A;  4POF A;  4BXX H;  3OPO A;  5JEA G;  5J1Z A;  3T13 A;  4DR5 L;  2LXJ A;  1HNZ Q;  4MHE A;  4RGM A;  1IYU A;  2IL8 A;  5T1I A;  3H3V I;  2F0H A;  1UUP A;  2MFI A;  1EYG A;  3KOJ A;  3URY A;  3PIO 3;  4LF6 L;  1RTN A;  3J80 E;  5BR8 Q;  4R8I A;  1HR0 L;  2B39 A;  1W6K A;  3K80 C;  3VYS A;  1YNJ C;  1S5F D;  2AUK A;  1NCV A;  4JI3 L;  1K28 A;  1PZI D;  1II3 A;  5FLX L;  5COY A;  3K5M A;  4ZCK A;  1PH7 A;  4XYO A;  4QCL A;  3VYR A;  4IFD I;  1IL8 A;  1D1K A;  4G57 A;  4GLX A;  3BU2 A;  4GN5 A;  3CC4 A;  5LMU L;  1XNR Q;  2EYP A;  1IBK Q;  2HHH L;  1HNX Q;  2RDH A;  3I55 A;  4FXK C;  1TWF H;  3M85 A;  2R3Z A;  3HOV G;  1JOK A;  1VQ5 A;  4LW1 A;  3STB C;  2WB1 B;  3A7L A;  3TZU A;  5KYI A;  2VQF L;  2Q8I B;  4RG1 A;  1A3T A;  1CKN B;  2A6H C;  2ES2 A;  4C3J B;  5NUC A;  3T1Y Q;  1N33 Q;  3P75 A;  2JA6 B;  1K3B C;  1ILP A;  4YWM A;  2Z6K A;  1PYB A;  4DUY L;  4DNR B;  1D1I A;  1LYL A;  1A3V A;  1T5X D;  1EL0 A;  4GOP C;  1ET6 A;  4I65 A;  3BYY B;  3BZD B;  1V43 A;  3MXP A;  4OL7 A;  3PMF A;  4AIM A;  2UXB Q;  1WI5 A;  1YJN A;  1RF2 D;  1F2L A;  4R4O A;  1J6Q A;  4B3M L;  2D0O A;  4KI0 A;  4OWW B;  3IAY A;  1GD7 A;  1GO3 E;  3ZJY C;  3TEH B;  4R1J A;  1IBM Q;  4QMG A;  5AJ3 L;  1AZQ A;  1ENC A;  4XT3 B;  4XXE A;  1VQL A;  1EIH A;  3I8Z A;  2QF7 A;  1CQV A;  3SHL A;  5IT9 c;  4LF4 L;  1F9S A;  4U67 3;  2DGY A;  5KNB A;  1EIY B;  2JA5 H;  5KNC A;  3ONA B;  2OF1 A;  1SMY C;  3LNN A;  3NEL A;  4DV3 L;  1JJG A;  3A74 A;  1E2W A;  1EZ6 A;  3WOE A;  2A8V A;  3M4Y A;  5M3M H;  2NYZ D;  1NR2 A;  3JAM E;  4EQN A;  1HCZ A;  2NN6 H;  2RCF A;  2I46 A;  3SVM A;  1DON A;  1Q8K A;  1VMP A;  3Q8D A;  3J80 L;  4DR3 Q;  3T16 A;  4FDB A;  2LKV A;  5DM7 3;  3BZC A;  1J5E L;  2WAQ E;  1KTK A;  1WTX A;  4HSV A;  3HOU G;  2Y0S G;  3GTM H;  5C44 H;  3PUY A;  1WJJ A;  3QWN A;  5KND A;  3P7J A;  2YU9 H;  4DR2 L;  4CDE C;  1GUT A;  5IY0 A;  4DV5 Q;  1AN8 A;  4BBS H;  2UXC Q;  1EZ8 A;  1D5M C;  1SMX A;  3I4M H;  1SLJ A;  4KN7 C;  1U4R A;  2D5D A;  2VB3 X;  5CV7 A;  5D3D A;  3HKZ B;  3K8A A;  2WAC A;  3DM1 A;  2O2L D;  5C0X G;  1CKM A;  5FLX c;  1EFI D;  1PRT B;  1N8R C;  4CBV A;  1VQE A;  2A1A A;  3NEM A;  3S9W A;  4K2K A;  1WTQ A;  4A3F G;  2Z6B A;  3FKI H;  5I9O A;  2KHI A;  1Q12 A;  2K03 A;  2HQL A;  1KQS A;  1A3U A;  3MZ5 A;  4ID6 A;  4LUZ A;  3HFZ B;  2Y0S E;  1N36 L;  1SRO A;  4GKJ Q;  4DR1 L;  1EEI D;  2F0E A;  1YBY A;  1TQO A;  1IXR A;  4JV5 L;  4KKS A;  1PMR A;  5M3F H;  1MGS A;  1PFS A;  2AKW B;  3FKI B;  4C3H H;  3BVG A;  5CV9 A;  4A3D B;  3CKI B;  3U50 C;  3WWV A;  2ZXO A;  1FJG L;  2E2I H;  4NPS A;  2A5H A;  3MA2 B;  2RDG A;  1QUQ A;  1DD2 A;  3OYY A;  1HXY D;  4DR6 Q;  3UDF A;  1PFB A;  4A93 G;  1XNQ L;  4J15 A;  2NVQ H;  4JYA Q;  4AQY Q;  3D4W A;  4LF7 Q;  4C3H B;  4C56 C;  4G7O C;  3L7Z C;  2IPK D;  1F2Y A;  3E9H A;  4JOI C;  4QF4 A;  1Y69 U;  2X6G A;  3KFU A;  4X64 L;  3JAM L;  2HDM A;  1TVX A;  1EIG A;  1HTL D;  1NSN S;  1SJH D;  1SFO H;  4FXD A;  2NVQ B;  3CAM A;  1SE8 A;  1U9R A;  1FGU A;  2XRS D;  2LSS A;  4KY5 A;  4DUZ Q;  1VQJ A;  5C3E B;  2ENB A;  1E7Z A;  3F2U A;  2JN4 A;  2F0J A;  4JBM A;  1NE3 A;  4FYD A;  1LLR D;  1X32 A;  3TS2 A;  1X3P A;  1NMF A;  2B2W A;  1WTR A;  1E2Z A;  1SFO B;  3Q24 A;  3I4N G;  1UAP A;  1FVI A;  4A3M H;  4YWK A;  4FF3 A;  1XPR A;  1SND A;  2FJ2 A;  1V1P B;  4GNX C;  2MHV A;  3DWP A;  4JW0 A;  4S3S A;  1NAP A;  1AP0 A;  1LT3 D;  3J80 c;  2BA0 A;  2AUJ D;  2IJ0 A;  4MTN A;  2NWG A;  4H7B A;  4KJO A;  4EVO A;  1KD1 C;  4OWT B;  5M5Y B;  1B9N A;  1SN8 A;  1PH8 A;  4DAP A;  2NVT B;  3K58 A;  4A3J B;  2MQH A;  1D6E C;  4HTH A;  1LT5 D;  2BDN A;  3HP3 A;  4ME5 A;  1GJX A;  3W2D A;  4C3I G;  2B2T C;  3LWE A;  2DNC A;  3S2D H;  1TWC H;  4WOR A;  4JPB W;  1AZP A;  1IBL L;  2PZW A;  2OTL A;  2C5C A;  3HOW B;  3M7G A;  4CDC C;  1C4Q A;  3OTO Q;  2PW7 A;  4FNF A;  4GKK L;  4PNY A;  5CC4 A;  1GUW A;  1VQD A;  5C6A A;  2VY3 A;  4LWC A;  5GAE C;  1YZ6 A;  1Q8I A;  1I6H B;  2LY7 A;  3W1B A;  1ZXT A;  2B2Y A;  1HZC A;  1CM9 A;  1ESF A;  4DV1 L;  1G6Z A;  4P72 A;  3K59 A;  3ND8 A;  2NB0 A;  2QDB A;  2L1B A;  1RIP A;  5LL6 X;  1JB3 A;  2SNS A;  5IYB H;  1CSQ A;  3S16 H;  5M5W H;  4UPA A;  1PYS B;  1KL9 A;  3V05 A;  4X65 L;  3I2Z A;  2KCC A;  2VQE Q;  1TWG H;  4EQ5 A;  1KC8 C;  4OO1 H;  2YTY A;  1I50 B;  1BNZ A;  1CT1 D;  1O7Y A;  3PIP 3;  3S1M H;  1G6P A;  3QR8 A;  3CMA A;  4JI4 Q;  2B63 H;  2VB2 X;  4A3K H;  4GOP B;  4BY7 G;  4NB3 A;  4JI8 L;  3ULP A;  3GTQ H;  4LF8 L;  4BBR G;  2VNU D;  3FMC A;  1I4G A;  4A3G B;  4QIW E;  2E76 C;  2F0V A;  4IAL A;  1W6J A;  2BOS A;  1Q7Y C;  2OEO A;  3S1M B;  2ZXR A;  5LHY 1;  1S3O A;  2WKC A;  2L11 A;  3MXG A;  3UDI A;  1JR0 D;  2AHO B;  2B63 B;  1V8Q A;  2VUM B;  1TT2 A;  1TII D;  1LT4 D;  1I4P A;  4JI1 Q;  4JI6 Q;  1EWI A;  3OW7 A;  4IFD J;  3C1F A;  2CQO A;  4CGY B;  3HOZ H;  4DR7 L;  3C3L A;  3JAM c;  1VQ7 A;  2A68 D;  5EPJ A;  4DV2 Q;  2MNA A;  4X66 Q;  4BY1 H;  2H1E A;  2F0I A;  3QG1 A;  5IOD A;  1JQY D;  1Y1W G;  1ASZ A;  5LMN L;  4PMB A;  3K57 A;  2K1B A;  3HKS A;  4HAE A;  3L3O C;  5EKI A;  1KRT A;  4K2L A;  3AQQ A;  3K81 C;  2KCM A;  2Z4H A;  4A3E G;  4L8J A;  3HOZ B;  1SNQ A;  1WOC A;  2NVY B;  3GTJ H;  1MI2 A;  3HEJ A;  2K75 A;  1P16 A;  4BY1 B;  4B3R Q;  2O5J C;  1I6V C;  2J7Z A;  1NY4 A;  2EXD A;  1IW7 C;  4DPG A;  1LAC A;  4DV4 L;  4GN3 B;  5C5M A;  1HQR D;  1XMQ L;  3NEN A;  4K5X A;  4LFB Q;  3AB9 A;  3HOX B;  1W3S A;  1Z47 A;  2R7Z G;  2DNE A;  2O4X A;  2CQA A;  1EEF D;  5CV8 A;  1SBB B;  1STY A;  3VDY A;  1AH9 A;  4HMI A;  2UUA L;  1K0R A;  3R3O A;  3KF8 B;  5DEH A;  2E2J H;  4QL5 A;  3TDQ A;  1I94 Q;  1NTG A;  3DLL A;  2IHF A;  2RQX A;  1Z6H A;  1EY9 A;  1XYI A;  3D3R A;  2RA4 A;  2L12 A;  3MHB A;  3MAQ A;  4KN4 C;  5C4X G;  2F0U A;  2XWB B;  3ERQ A;  4DA2 A;  4DU9 A;  4H02 A;  1ROD A;  5J22 A;  3P1H A;  2EYF A;  1R9T B;  2Z9H A;  1X6O A;  1K8M A;  3KUP A;  2NVX H;  3H0G H;  4XIG S;  2XRQ D;  3OMG A;  2F3W A;  3H3V H;  5CV6 A;  1AE3 A;  2F0G A;  3K7U C;  3AYH B;  1RD9 D;  2F03 A;  3SR1 A;  4WJW A;  1LTB D;  4ZYS A;  3NWS A;  1JB7 A;  3CCL A;  3HOY B;  4K6L A;  4DR4 Q;  3MWY W;  2JP1 A;  5IP7 H;  1BR9 A;  1FL0 A;  4IUR A;  3TQY A;  3ZYY X;  5FK9 C;  2PQA B;  2UUC L;  2NVX B;  1JCK B;  5FLM G;  3PV0 A;  4IFD H;  5IGG A;  3L9A X;  4IPG A;  4IJH A;  4B3S Q;  4K5W A;  4DXG A;  1HQM C;  4DR5 Q;  3DMU A;  3N52 A;  1F9R A;  4A3B H;  4LFC L;  5IYD G;  1KLG D;  3RMH A;  1PTO D;  2F4V L;  4GLV B;  5EKL A;  4DAY A;  4GS3 A;  2F0D A;  1F9Q A;  3OWF A;  4LF6 Q;  3S1Q H;  1SE4 A;  3GTL H;  2N8N A;  4HCS A;  1HR0 Q;  2GN5 A;  4C1N K;  4PV1 C;  1BKB A;  1WCM H;  3EN2 A;  4JI3 Q;  4UP8 A;  4KHP L;  1YIJ A;  1BCP D;  3PUW A;  4IZ8 A;  5EBC A;  5EKK A;  4LAA A;  2QA4 A;  4V19 0;  4APV A;  4QJF A;  5IGE A;  3TP7 A;  1JJC B;  1UE6 A;  3AMU A;  1PTO C;  3U9S A;  3BS1 A;  1D5X C;  5IIF A;  3T53 B;  2F0P A;  2I5H A;  2WB1 G;  5LMU Q;  4H44 C;  1WTH A;  5HY6 A;  1CI3 M;  1VF7 A;  1BBU A;  3VYU A;  2HHH Q;  1A0I A;  4C3J G;  4PZ7 A;  5COR A;  4B9X A;  1PTO F;  2JA6 G;  4RFB A;  3IFT A;  3P20 A;  2VQF Q;  5ELB A;  2KHJ A;  1JWS D;  2QW7 A;  2PW5 A;  2K14 A;  4A4I A;  1EIF A;  3CP0 A;  2EYL A;  4PMC A;  1AEX A;  4OX9 L;  4OIJ A;  1BCP F;  2UU9 Q;  1IL2 A;  4O42 A;  5IGC A;  3C2P A;  4DUY Q;  5EGT A;  4KHV A;  1STG A;  3RZO B;  5BN5 A;  5I2X A;  4EQO A;  3K5O A;  1E3P A;  4DKA C;  1Z9F A;  4RH6 A;  2QIL A;  1HTP A;  3N6R A;  1CZG A;  1X54 A;  2ZXP A;  5E1F A;  1QWY A;  1N34 L;  4OGQ C;  5K36 H;  3IL8 A;  1WTV A;  4B3M Q;  1MKH A;  1JMC A;  3U58 A;  3AFP A;  1EY6 A;  4BA1 I;  5JEA J;  2JA8 B;  5AJ3 Q;  1FD7 D;  4IJL A;  4NMZ A;  1RCV D;  1QJO A;  2UXD L;  3QOL A;  1RJT A;  2G5D A;  2IX1 A;  1OXT A;  2ID0 A;  1L1O C;  1HNW L;  1C8C A;  3MEF A;  4CJ1 B;  2EYJ A;  4LF4 Q;  3A8J E;  4J6H A;  2B2V A;  1GHJ A;  4UDU C;  1JT8 A;  3S2H B;  3G6E A;  4ZAI A;  2V1C C;  4DV3 Q;  1TWH B;  5JVG 3;  2JA5 G;  2KHS A;  5K5P A;  1E1O A;  4ODG A;  1QZH A;  1STN A;  4XYQ A;  3RZD H;  3VA7 A;  3D0F A;  4LK1 C;  2ZJP A;  2PNH A;  3HZX A;  3K7A H;  4IOA A;  4WJ4 A;  3L0O A;  4ILW A;  2NN6 G;  1B53 A;  3KBX A;  3J7A F;  1J5E Q;  4JCV E;  4HJ8 A;  1L0W A;  1YHB A;  5I4D A;  1MHW C;  1QB5 D;  4HID A;  4NXM L;  1E0B A;  2EY5 A;  3W5O A;  4A3C G;  5EAY A;  2RSO A;  4P71 A;  1FNW A;  3HKZ G;  3A8K E;  2HDL A;  4DR2 Q;  5C44 G;  2WKD A;  4QUC A;  2VZA A;  4HCE A;  4L63 B;  1VQC A;  1EQQ A;  1JJ2 A;  2MPM A;  2R93 H;  1HUM A;  1CKN A;  3S1R H;  1VQM A;  2L55 A;  5IYC H;  1UEB A;  1S40 A;  4BBS G;  4IUU A;  5L37 A;  1TWF B;  1N9W A;  3A55 A;  1I4Q A;  4PQX A;  1Y1V H;  1ET9 A;  3F2D A;  3CXC A;  5DNF A;  1PHJ A;  3QJY A;  3WDN A;  2YV5 A;  2D2C C;  2JA9 A;  1IYJ B;  2K52 A;  3TP8 A;  4LUV A;  2X6L A;  3UDX A;  1YJ9 A;  1WTP A;  1I5F A;  2K33 A;  5KEE A;  3FKI G;  1N36 Q;  4DR1 Q;  1ZEQ X;  1O78 A;  2XIW A;  2QKI C;  3GTK H;  3U4V A;  1LM0 A;  4A3D G;  1OTC A;  2EY2 A;  2PMZ B;  3HKZ E;  2E5L L;  4JV5 Q;  1LTI D;  2CW0 D;  1SSO A;  4M8A A;  4JI5 L;  5A35 A;  5JJI A;  4CDF C;  1PH2 A;  3M9B A;  5JEA H;  4R9W A;  2AQ1 B;  4O0A A;  4DV6 L;  4I7A A;  3RLN A;  3L2P A;  3Q0A A;  4C3H G;  3GTK B;  1GUO A;  3KK7 A;  1VQP A;  1Q3L A;  4A3I H;  4Z9C B;  3TS0 A;  1HNZ L;  2KJX A;  4FO2 A;  4XQQ A;  1XPU A;  1UE7 A;  3TZD A;  2CW0 C;  2JA5 B;  4Y7N H;  5KYL A;  3H15 A;  2I5M X;  5FJ8 G;  5BR8 L;  5KRU A;  3CHB D;  3EA6 A;  5BN3 A;  3CCJ A;  4HED A;  3IKJ A;  5C3E G;  4RKL A;  1J9O A;  5M3M B;  4A3I B;  1K8G A;  1K3R A;  4B9W A;  2EE1 A;  1N32 L;  5CV5 A;  4X64 Q;  2KQ3 A;  3PO3 H;  3HRZ C;  4QB4 A;  1XTC D;  1SNM A;  4Y7N B;  1Q86 C;  1GKH A;  1QIL A;  5D3I B;  1KAW A;  2B2U C;  2AQ2 B;  2SEB D;  1VQI A;  3GO5 A;  4K6D A;  3HOV H;  4UAI A;  3GTM B;  1LTS D;  3M4Q A;  4IOC A;  5C44 B;  1QVF A;  3F8T A;  4QY7 A;  3RR5 A;  2EXZ A;  2NZO A;  1LTR D;  2YU9 B;  3PO3 B;  3S14 H;  3DWA A;  3CRK C;  4BBS B;  3GV3 A;  5JPM C;  2ZTD A;  3I4M B;  2HCC A;  1JOR A;  3U4Z A;  4CKE A;  1L0X B;  2ZTE A;  3S17 H;  1N33 L;  2K32 A;  4IPH A;  4A3J G;  2JK8 A;  3H94 A;  3GTO H;  2H5X A;  3Q6S A;  1TY2 A;  2VS1 A;  1K83 H;  2RBM A;  4G7Z C;  1PXU A;  2CKZ B;  4UY8 C;  1G91 A;  4RMF A;  1DOL A;  1X3E A;  3KF6 B;  1PTO H;  2FMM A;  3J81 i;  2JE6 I;  2F3I A;  1Y8O B;  1SAP A;  5M9O A;  1HFN A;  2F0O A;  2AMC B;  2UXB L;  3HOW G;  1CUK A;  4GLA C;  1O7I A;  4MN3 A;  1HR0 W;  4HIK A;  1HZ9 A;  3GTO B;  1E2V A;  4JBJ A;  1K83 B;  2E74 C;  2I0Q A;  2BA1 A;  1B9M A;  1CK1 A;  4BS9 A;  1EY7 A;  1IBL Q;  3H3V C;  3NTH A;  3SEB A;  3KJO A;  3J7A 5;  1DXM A;  1S5E D;  1SNO A;  3RLF A;  5M3F B;  3MXN B;  1Z7T A;  4GKK Q;  1VQF A;  1O7Z A;  2YTV A;  1BBW A;  1VDZ A;  1NBW A;  3QIA A;  3V2T A;  1JWM D;  1DZ1 A;  1PH5 A;  2E2I B;  4DV1 Q;  1CQF A;  1LTA D;  1A15 A;  2L4N A;  4PZ8 A;  1KDC A;  4C1N I;  1X3G A;  1HUN A;  4OEM B;  1U0L A;  2EYO A;  1UWV A;  4ZKC B;  1B44 D;  2HT1 A;  3UDG A;  2C35 B;  4XQN A;  3I72 A;  2CH4 W;  4A3G G;  2EZV A;  4IUV A;  1TR5 A;  2Z0S A;  4OO1 G;  1R4P B;  2K28 A;  3ULL A;  4JI8 Q;  4LF8 Q;  5ELC A;  1RL2 A;  2B63 G;  4TQU S;  4A3K G;  2VUM G;  2K4K A;  4A3L G;  1CFM A;  1KNA A;  3GQB A;  1RDP D;  3CPW A;  2R6G A;  2QCP X;  4LF5 L;  1PLF A;  5HUR A;  2H4O A;  1V1P A;  2NN6 I;  2OCE A;  3EJI A;  4B08 A;  1QG7 A;  1L1O B;  2HIX A;  4WRD A;  3T1H L;  4A3F H;  1EY8 A;  2QDL A;  1LAB A;  4PZ6 A;  4A3M B;  1DOK A;  5IE8 A;  1XTD A;  2OXP A;  4H13 C;  1PZK D;  2YYZ A;  2DJF C;  1XX8 A;  2WP8 J;  3HOZ G;  2IX3 A;  4R4T A;  1YNX A;  4KY6 A;  3CME A;  3A5Z B;  1H95 A;  2FFK B;  1YNN D;  3CCU A;  1GUS A;  3ICE A;  3CCQ A;  4BY1 G;  1I3Q H;  5LMN Q;  4TKO B;  1SDF A;  1G2S A;  3TME A;  1MBY A;  1SYF A;  2BH2 A;  2OQ0 A;  2KVM A;  2NZ1 D;  5C4H A;  3K0Y A;  3E5S A;  1WTO A;  5FO9 B;  2GA4 B;  2EVB A;  4RHS A;  5T1G A;  3HOX G;  1GOZ A;  1VQG A;  3NBI A;  4F7X A;  1BOS A;  3VR5 A;  4RWS C;  1YNN C;  3S2D B;  4KMU C;  1QVG A;  1TWC B;  1I3Q B;  4DV0 L;  4DV4 Q;  2L15 A;  1WTW A;  1EU3 A;  3NQI A;  3EVQ A;  2L0C A;  2A69 D;  4A93 H;  1XMQ Q;  1D2B A;  1JOO A;  1VQ9 A;  1ONL A;  2PZU A;  4X3U A;  3D4R A;  1CHQ D;  1Y8P B;  3T51 B;  2DY8 A;  2Q2H A;  2F0T A;  2SDF A;  2UUA Q;  4RCN A;  3QB3 A;  2B8G A;  3FPP A;  1C9O A;  3BDL A;  4DN4 M;  4TRD A;  1BXT A;  3S16 B;  3DM3 A;  2JJQ A;  4GOP A;  5M5W B;  5GAG C;  5IP9 G;  1B2T A;  1PVO A;  2IHE A;  1Q1B A;  1TS4 A;  3KDF B;  1U4M A;  1TWG B;  2RCN A;  1XMO L;  2F1M A;  1BUV T;  3HOY G;  1KAB A;  3CQZ H;  1ENF A;  5IWA L;  4DXF A;  3DEP A;  5I6Y A;  3Q23 A;  2BE5 D;  4JG2 A;  4LF9 L;  4A3K B;  4B3T L;  3I4N H;  3K5N A;  3A56 A;  1SEB D;  3GTQ B;  5DLQ E;  2NBF A;  1ZYR D;  4IO9 A;  1B4O A;  1KRS A;  5C3X A;  1TWA H;  3T56 B;  2JXM B;  4RKB A;  5KGU A;  1KNE A;  3D8G A;  3A7A B;  1BDO A;  2UUC Q;  3C46 A;  3G4S A;  1XWE A;  5IGB A;  3CCR A;  2BE5 C;  1BF4 A;  1WYD A;  4N9P A;  1F9P A;  2KEN A;  2L5T A;  2Z6K C;  2K6A A;  1TWA B;  3PQI A;  2DY7 A;  4C3I H;  2F0L A;  4N8F A;  4QGU A;  4LFC Q;  3PO2 H;  1PFM A;  2A68 C;  2E2H H;  5C0X I;  1IZ6 A;  1EY4 A;  3MC0 B;  1O7L A;  2F4V Q;  3GTG H;  2JSO A;  1ICW A;  3ULJ A;  1Q81 C;  3TN2 A;  4L5Q A;  4AH6 A;  2JA7 H;  3FRP B;  4L6T B;  5FKA C;  4LUO A;  1WVL A;  4LMQ D;  5F2D A;  3GTP H;  1VQ4 A;  3A54 A;  2ZM6 L;  3GTJ B;  3FDT A;  2UUB L;  2R92 H;  4KHP Q;  1KXL A;  3PO2 B;  5IOC A;  2E2H B;  4FXG C;  1JIC A;  1HPC A;  2EYH A;  1D8L A;  3BZK A;  4AYB B;  2F4I A;  5GAH C;  3GTG B;  4KK7 A;  4YY3 L;  1M8A A;  3JC6 6;  4CJ0 B;  4NW2 A;  4JC0 A;  1FNV A;  2JA7 B;  3KF8 A;  2PO4 A;  4GZY C;  3DHQ A;  5ELE A;  1JE5 A;  1SE2 A;  3DUZ A;  3TRE A;  4NKL A;  4O1N A;  4JI7 Q;  3A5U A;  2E2J B;  2PNR C;  3E3X A;  4BY7 H;  1B3Q A;  4NXN L;  2CVR A;  3NWT A;  3CCM A;  4DK0 A; 
#chains in the Genus database with same CATH homology
 1SXT A;  1QCB D;  1OO9 B;  1UNS A;  4X3K A;  3D6W A;  1CTM A;  4HSP A;  1EY5 A;  3H0G B;  5J39 A;  2M2L A;  1FGB D;  2C9O A;  1PRT D;  3WOF A;  4Q5V A;  1IKM A;  3M7N A;  2EPB A;  1U4P A;  3I90 A;  1ILQ A;  3K5L A;  3D31 A;  1WD1 A;  5CBE E;  3KLS A;  1B3A A;  1HHV A;  2RVL A;  4NP5 A;  2WV6 D;  4IUN A;  3H91 A;  2K5W A;  2PYK A;  3DWQ A;  3VYT A;  1QE6 A;  3O13 A;  4A3B B;  3OWE B;  3BDO A;  1PRT F;  4ZLT F;  3S1Q B;  2RKS A;  3BVM A;  2MP1 A;  3BDC A;  3GTL B;  3I91 A;  4RCO A;  3H09 A;  1WCM B;  4RGT A;  4V0B A;  1I4H A;  3VR4 A;  1GXD C;  1PZJ D;  1BCP C;  2IX0 A;  5EPL A;  5ELF A;  1AW7 A;  1IKL A;  1TU2 B;  5I2Y A;  4FP5 D;  1VCI A;  3FEW X;  5KIX A;  3PUZ A;  3RUZ A;  1HRJ A;  3J7A V;  3J7Y W;  2F0N A;  3SK4 A;  5C4J B;  1DYQ A;  3PUX A;  4IUP A;  2B2T A;  2NTS A;  1KDB A;  1JWU D;  4K8I A;  1RHP A;  2MUY A;  1KDA A;  3I73 A;  4RGN A;  1H9K A;  2XVS A;  3SK6 A;  1Q90 A;  2B2W C;  2N88 A;  1SNP A;  4IN3 A;  1QNU A;  2B8F A;  4EGV A;  1EOT A;  1IHZ A;  1EQV A;  3J81 E;  4IUQ A;  2KEE A;  4CKC A;  2KUM A;  2JEB I;  3Q22 A;  4ZQ3 A;  1OXS C;  3SXH A;  3DEO A;  1LTG D;  2M9V A;  3MFG A;  3HG9 A;  3SK5 A;  2D9U A;  4LJZ C;  5D14 A;  2F0S A;  3NK9 A;  1X3Q A;  1R4Q B;  2F0Q A;  1GUG A;  4ZKB B;  3OSO A;  4K14 A;  2SOB A;  3RZD B;  2BDO A;  1EY0 A;  3K7A B;  5HGT A;  2A6H D;  1LT6 D;  1J8I A;  5AFW A;  2B2Y C;  5CYU A;  1G2T A;  4J8Q A;  5ELD A;  1U4L A;  1H9R A;  1VMC A;  1LTT D;  1STA A;  1S5D D;  1EWC A;  5C3W A;  2O5I C;  1RTO A;  2R93 B;  3S1R B;  2HUG A;  1CHP D;  1VF5 C;  1Y1V B;  2LFN A;  1STE A;  2ICI A;  1CA6 A;  5FO7 B;  1HA6 A;  1ENA A;  1JOQ A;  1PDQ A;  1S5B D;  3TSS A;  3VR2 A;  1GHK A;  2L9H A;  1SMY D;  1BBX C;  2LMC B;  3QOJ A;  5IGF A;  4HN7 A;  4DK1 A;  3U9O A;  3EQL C;  3NXW A;  4JBW A;  4IQZ A;  5JAV A;  1H9M A;  5EBD A;  2VXW A;  2EY6 A;  5BN4 A;  3BG3 A;  3OIQ A;  4K5V A;  2JEA I;  2IW3 A;  2V4D A;  1MSH A;  3NTK A;  3J81 L;  2MJ8 A;  2K5D A;  2N55 A;  3M4O B;  3R2T A;  1I4R A;  1F2Z A;  3NP8 A;  3FVQ A;  2Z1C A;  1OXX K;  3SDZ A;  2KCN A;  5C0X J;  1EU4 A;  1T5E A;  4FF4 A;  2EOT A;  4KD4 A;  4Q0F A;  4H0L C;  3I70 A;  3HOV B;  1V1O A;  3NTI A;  3G6J B;  1SYD A;  3S14 B;  1MD2 D;  3LX0 A;  1QNK A;  3TBI B;  1EYA A;  1QOH A;  1S5C D;  4TSS A;  3S17 B;  1C48 A;  4BWG B;  5G3L D;  3GP7 A;  5CR3 A;  1LO5 D;  2RSN A;  1B1Z A;  3BVZ A;  1PTO B;  3X3N A;  4ZRZ A;  3SK8 A;  2WAQ B;  3MXU A;  3MXN A;  4IUT A;  4ZK9 B;  3H6M A;  1BCP B;  2NUC A;  5C4Z A;  4QUF A;  2HCI A;  4CJ2 C;  2FMC A;  1G8Z D;  1L0Y B;  3CRL C;  3NHH A;  3VR6 A;  2CHB D;  2TMP A;  5G3L F;  4JK1 C;  4K8J A;  1TKW B;  1TS2 A;  2XN9 C;  1SYG A;  4BA2 I;  5JVH 3;  2XNA C;  3MEH A;  5CV4 A;  1D5Z C;  2EJG C;  4NDX A;  2XWJ B;  1AFP A;  2G9H D;  2TSS A;  1STB A;  5A2Q E;  1PYW D;  2PCF B;  2Y0S B;  3HOU B;  4KHZ A;  5C0X H;  5I6W A;  4ULL A;  3HGB A;  1UEA B;  4P2C B;  1JC7 A;  1XXG A;  1Y8N B;  3M3Y B;  3A8I E;  4I7Z C;  2E2D C;  2QEJ C;  2IT1 A;  2G9D A;  2OT2 A;  3R2I A;  1A2T A;  4FF1 A;  4DNT B;  1FNU A;  5C5L A;  1B50 A;  4A3F B;  3QO2 A;  1NR4 A;  3AU7 A;  5JPN C;  1H9J A;  3BYT B;  1EYC A;  3SE0 A;  5EJW A;  4ABN A;  4KY7 A;  3OHX C;  2JYO A;  2ICE C;  1BO0 A;  4RA8 A;  1RKN A;  3ERO A;  1O80 A;  2KA7 A;  2WIN B;  3D4D A;  3GD7 A;  2K01 A;  2J4X A;  4F8M A;  3NE5 B;  3R8B A;  2A74 C;  1DM0 B;  3HS0 C;  1WD0 A;  3E6Z X;  4WFN 3;  1H9S B;  1HA5 A;  1M4V A;  2M00 A;  1OXU A;  4KKU A;  2Q8R E;  1H9S A;  4F88 A;  1EWH A;  2B2V C;  2DN8 A;  4MIU A;  3ITP A;  2LS0 1;  4XDX A;  4A93 B;  2KOL A;  4KJN A;  2A69 C;  1ML0 D;  3W3A A;  4X3T A;  2AWN A;  2EJM A;  4KV6 A;  3TP5 A;  5FO8 B;  1SYE A;  1ZKO A;  2WII B;  3C1E A;  4RAU C;  2F0F A;  2X69 A;  1SE3 A;  3NQT A;  4U68 A;  3K6O A;  2HQE A;  5A2Q L;  1TS3 A;  3IFD A;  2NTT A;  4DF7 A;  2A73 B;  1HFG A;  2F3V A;  3CQZ B;  3PUV A;  1A6X A;  1STH A;  5E4W C;  3I3C A;  3I4N B;  2R61 A;  3MFY A;  4DAV A;  4IFD G;  1ZYR C;  1FR3 A;  1EYD A;  3G7L A;  2K7V A;  2KED A;  2D62 A;  4RGO S;  1GUN A;  4XQJ A;  1IW7 D;  1KAA A;  5CGK A;  1DOM A;  3R93 A;  5E3F A;  1EQT A;  4DFA A;  2PQE A;  3TP6 A;  4HMJ A;  1F77 A;  1NUC A;  5CMD A;  4C3I B;  1SYB A;  4OIK A;  2J0T D;  3NUC A;  5LL6 S;  3NPP A;  5D65 A;  2B2U A;  5TSS A;  2F0W A;  1MSG A;  1DJR D;  3KBG A;  3MTS A;  4E6I A;  2ZT9 C;  4QIW B;  3GTP B;  4N9T A;  2R92 B;  3D6C A;  2AQ3 B;  3CU7 A;  3UI2 A;  5IT9 E;  1G29 1;  5E4X A;  3OIP A;  5FOB B;  5EQ0 A;  4FF2 A;  5EPK A;  2AWO A;  1FYC A;  2FIN B;  4XTC S;  1DCZ A;  3EFX D;  3OMC A;  2EY1 A;  2Z8L A;  2RDF A;  4BY7 B;  4FVM A;  4CHT B;  1CZW A;  5CBA E;  3LWU A;  2EDG A;  1TY0 A;  4BBR B;  1BQQ T;  4R8N A;  3T4A C;  2K5Q A;  2XSC A;  2PPB C;  4OO1 I;  5K36 G;  3RD4 A;  2F0K A;  1I4X A;  3X3M A;  3KLS X;  3VA5 A;  2EJF C;  1OXV A;  1JE4 A;  1PRT C;  4YIJ A;  2F0M A;  2IWH A;  2I07 B;  2Z4I A;  3GV6 A;  2PZT A;  3OOC A;  4DGZ A;  5FLX E;  1Y1W B;  3NSW A;  3FPU B;  4EQP A;  5I9P A;  4G7H C;  1F2M A;  1PFN A;  5DM6 3;  4KTA A;  5IGD A;  4A3E B;  2BCO A;  3KLR A;  2A6E D;  3I4L A;  1SJE D;  3S15 B;  4PMW A;  4OHJ A;  4XT1 B;  3NBH A;  5DAU A;  1CA5 A;  1KLU D;  4G4K A;  2E75 C;  3MVV A;  2FHT A;  3E0J A;  2KEC A;  4ZUI A;  1TS5 A;  5JOB A;  3DXJ C;  2R7Z B;  5ISR A;  2SNM A;  5M5X B;  1LV9 A;  4KD3 A;  2A6E C;  3S1N B;  5IT9 L;  2EYM A;  2K04 A;  4KKT A;  1SNC A;  4ZUJ A;  4HR7 B;  2Q8T A;  1K8O A;  5JJZ A;  5C4X B;  1Q1E A;  1SYC A;  1S4Z A;  4J1M A;  2K05 A;  4C2M B;  3V96 A;  1A2U A;  4X3S A;  4RHR A;  1IYV A;  4F87 A;  4CKB A;  3VR3 A;  1YNJ D;  3ND9 A;  4M1U B;  2MGS A;  1ESR A;  3OPO A;  5JEA G;  5J1Z A;  3T13 A;  4MHE A;  4RGM A;  1IYU A;  2IL8 A;  5T1I A;  2F0H A;  1UUP A;  3URY A;  3PIO 3;  1RTN A;  3J80 E;  4R8I A;  2B39 A;  1W6K A;  3VYS A;  1YNJ C;  1S5F D;  2AUK A;  1NCV A;  1PZI D;  1II3 A;  5FLX L;  5COY A;  3K5M A;  4XYO A;  4QCL A;  3VYR A;  4IFD I;  1IL8 A;  1D1K A;  4G57 A;  2EYP A;  2RDH A;  4FXK C;  3M85 A;  2R3Z A;  1JOK A;  2WB1 B;  3A7L A;  3TZU A;  5KYI A;  2Q8I B;  1A3T A;  2A6H C;  4C3J B;  5NUC A;  3P75 A;  2JA6 B;  1ILP A;  4DNR B;  1D1I A;  1A3V A;  1T5X D;  1EL0 A;  1ET6 A;  4I65 A;  3BYY B;  3BZD B;  1V43 A;  3MXP A;  4OL7 A;  3PMF A;  1RF2 D;  1F2L A;  4KI0 A;  3IAY A;  4QMG A;  1AZQ A;  1ENC A;  4XT3 B;  4XXE A;  1EIH A;  3I8Z A;  2QF7 A;  1CQV A;  3SHL A;  1F9S A;  4U67 3;  5KNB A;  5KNC A;  3ONA B;  2OF1 A;  1SMY C;  3LNN A;  1E2W A;  1EZ6 A;  3WOE A;  3M4Y A;  2NYZ D;  1NR2 A;  3JAM E;  4EQN A;  1HCZ A;  2NN6 H;  2I46 A;  3SVM A;  1DON A;  1VMP A;  3J80 L;  3T16 A;  2LKV A;  5DM7 3;  1KTK A;  1WTX A;  4HSV A;  3PUY A;  3QWN A;  5KND A;  3P7J A;  1GUT A;  1AN8 A;  1EZ8 A;  1D5M C;  4KN7 C;  1U4R A;  2D5D A;  2VB3 X;  5CV7 A;  5D3D A;  3HKZ B;  2WAC A;  3DM1 A;  2O2L D;  5C0X G;  1EFI D;  1PRT B;  4CBV A;  1WTQ A;  3S9W A;  4K2K A;  5I9O A;  1Q12 A;  2K03 A;  1A3U A;  3MZ5 A;  4ID6 A;  1EEI D;  2F0E A;  1TQO A;  4KKS A;  1PMR A;  1MGS A;  3FKI B;  3BVG A;  5CV9 A;  4A3D B;  3CKI B;  2ZXO A;  2A5H A;  3MA2 B;  2RDG A;  1DD2 A;  1HXY D;  1PFB A;  3D4W A;  4C3H B;  4C56 C;  4G7O C;  3L7Z C;  2IPK D;  1F2Y A;  4QF4 A;  1Y69 U;  2X6G A;  3JAM L;  2HDM A;  1TVX A;  1EIG A;  1HTL D;  1NSN S;  1SJH D;  4FXD A;  2NVQ B;  1U9R A;  2XRS D;  4KY5 A;  5C3E B;  2ENB A;  3F2U A;  4FYD A;  2F0J A;  1LLR D;  1X32 A;  1X3P A;  2B2W A;  1WTR A;  1E2Z A;  1SFO B;  3Q24 A;  1UAP A;  4FF3 A;  1SND A;  2FJ2 A;  1V1P B;  2MHV A;  3DWP A;  4S3S A;  1NAP A;  1AP0 A;  1LT3 D;  2BA0 A;  2AUJ D;  2IJ0 A;  2NWG A;  4H7B A;  4KJO A;  4EVO A;  5M5Y B;  1B9N A;  4DAP A;  2NVT B;  3K58 A;  4A3J B;  1D6E C;  4HTH A;  1LT5 D;  2BDN A;  3HP3 A;  4ME5 A;  1GJX A;  3W2D A;  4C3I G;  2B2T C;  3LWE A;  2DNC A;  4WOR A;  1AZP A;  2PZW A;  2C5C A;  3HOW B;  3M7G A;  1C4Q A;  2PW7 A;  4FNF A;  4PNY A;  5CC4 A;  1GUW A;  5C6A A;  1Q8I A;  1I6H B;  2LY7 A;  1ZXT A;  2B2Y A;  1CM9 A;  1ESF A;  1G6Z A;  3K59 A;  3ND8 A;  2NB0 A;  2QDB A;  2L1B A;  5LL6 X;  1JB3 A;  2SNS A;  3V05 A;  2KCC A;  4OO1 H;  1BNZ A;  1I50 B;  1CT1 D;  1O7Y A;  3PIP 3;  2VB2 X;  2VNU D;  3FMC A;  1I4G A;  4A3G B;  2E76 C;  2F0V A;  4IAL A;  1W6J A;  2BOS A;  2OEO A;  3S1M B;  2ZXR A;  5LHY 1;  2WKC A;  2L11 A;  3MXG A;  2B63 B;  1JR0 D;  1V8Q A;  2VUM B;  1TT2 A;  1TII D;  1LT4 D;  1I4P A;  3OW7 A;  4IFD J;  3C1F A;  4CGY B;  3C3L A;  2A68 D;  5EPJ A;  2H1E A;  2F0I A;  3QG1 A;  5IOD A;  1JQY D;  4PMB A;  3K57 A;  2K1B A;  4HAE A;  5EKI A;  3L3O C;  4K2L A;  2Z4H A;  4L8J A;  3HOZ B;  1SNQ A;  2NVY B;  1MI2 A;  3HEJ A;  4BY1 B;  2O5J C;  1I6V C;  2J7Z A;  1IW7 C;  1LAC A;  5C5M A;  1HQR D;  4K5X A;  3AB9 A;  3HOX B;  1Z47 A;  2DNE A;  2O4X A;  2CQA A;  1EEF D;  5CV8 A;  1SBB B;  1STY A;  4HMI A;  3R3O A;  5DEH A;  3TDQ A;  2RQX A;  1Z6H A;  1EY9 A;  1XYI A;  3D3R A;  2RA4 A;  2L12 A;  3MHB A;  3MAQ A;  4KN4 C;  2F0U A;  2XWB B;  4DU9 A;  3ERQ A;  4DA2 A;  1ROD A;  5J22 A;  3P1H A;  2EYF A;  1R9T B;  1K8M A;  3KUP A;  4XIG S;  2XRQ D;  3OMG A;  2F3W A;  5CV6 A;  2F0G A;  1RD9 D;  2F03 A;  3SR1 A;  4WJW A;  1LTB D;  4ZYS A;  3NWS A;  3HOY B;  4K6L A;  3MWY W;  2JP1 A;  1BR9 A;  4IUR A;  3ZYY X;  5FK9 C;  2NVX B;  1JCK B;  3PV0 A;  4IFD H;  5IGG A;  3L9A X;  4K5W A;  4DXG A;  1HQM C;  3DMU A;  3N52 A;  1F9R A;  1KLG D;  3RMH A;  1PTO D;  5EKL A;  4DAY A;  2F0D A;  1F9Q A;  3OWF A;  1SE4 A;  4HCS A;  4C1N K;  4PV1 C;  1BCP D;  3PUW A;  4IZ8 A;  5EBC A;  5EKK A;  4LAA A;  4V19 0;  5IGE A;  3TP7 A;  3AMU A;  1PTO C;  3U9S A;  3BS1 A;  1D5X C;  5IIF A;  3T53 B;  2F0P A;  4H44 C;  1CI3 M;  1VF7 A;  3VYU A;  4C3J G;  5COR A;  4B9X A;  1PTO F;  4RFB A;  3IFT A;  3P20 A;  5ELB A;  1JWS D;  2PW5 A;  2EYL A;  4PMC A;  1AEX A;  4OIJ A;  1BCP F;  4O42 A;  5IGC A;  3C2P A;  5EGT A;  4KHV A;  1STG A;  3RZO B;  5BN5 A;  5I2X A;  4EQO A;  3K5O A;  4RH6 A;  2QIL A;  1HTP A;  3N6R A;  1CZG A;  2ZXP A;  5E1F A;  1QWY A;  5K36 H;  4OGQ C;  3IL8 A;  1WTV A;  1EY6 A;  4BA1 I;  5JEA J;  2JA8 B;  1FD7 D;  4NMZ A;  1RCV D;  1QJO A;  3QOL A;  1RJT A;  2IX1 A;  1OXT A;  2ID0 A;  1C8C A;  4CJ1 B;  2EYJ A;  3A8J E;  4J6H A;  2B2V A;  1GHJ A;  4UDU C;  3S2H B;  4ZAI A;  1TWH B;  5JVG 3;  2KHS A;  5K5P A;  4ODG A;  1STN A;  4XYQ A;  3VA7 A;  4LK1 C;  3HZX A;  4ILW A;  2NN6 G;  1B53 A;  3KBX A;  3J7A F;  5I4D A;  1QB5 D;  1E0B A;  2EY5 A;  2RSO A;  1FNW A;  3A8K E;  2HDL A;  2WKD A;  4QUC A;  4HCE A;  4L63 B;  2MPM A;  1HUM A;  2L55 A;  4IUU A;  1TWF B;  3A55 A;  1I4Q A;  4PQX A;  1ET9 A;  5DNF A;  3QJY A;  3WDN A;  2D2C C;  3TP8 A;  2X6L A;  1WTP A;  2K33 A;  5KEE A;  1ZEQ X;  1O78 A;  2XIW A;  2QKI C;  2EY2 A;  2PMZ B;  1LTI D;  2CW0 D;  1SSO A;  4M8A A;  5A35 A;  5JEA H;  4R9W A;  2AQ1 B;  3Q0A A;  4C3H G;  3GTK B;  1GUO A;  3KK7 A;  1Q3L A;  4Z9C B;  2KJX A;  4FO2 A;  4XQQ A;  3TZD A;  2CW0 C;  2JA5 B;  5KYL A;  5KRU A;  3CHB D;  3EA6 A;  5BN3 A;  4HED A;  3IKJ A;  4RKL A;  1J9O A;  5M3M B;  4A3I B;  4B9W A;  2EE1 A;  5CV5 A;  2KQ3 A;  3HRZ C;  4QB4 A;  1XTC D;  1SNM A;  4Y7N B;  1QIL A;  5D3I B;  2B2U C;  2AQ2 B;  2SEB D;  3GO5 A;  4K6D A;  4UAI A;  3GTM B;  1LTS D;  5C44 B;  2EXZ A;  3PO3 B;  1LTR D;  2YU9 B;  3DWA A;  3CRK C;  4BBS B;  3GV3 A;  5JPM C;  3I4M B;  2HCC A;  1JOR A;  4CKE A;  1L0X B;  2K32 A;  3H94 A;  3Q6S A;  1TY2 A;  2RBM A;  4G7Z C;  1PXU A;  1G91 A;  1DOL A;  1PTO H;  2FMM A;  2JE6 I;  1Y8O B;  1SAP A;  5M9O A;  1HFN A;  2F0O A;  4MN3 A;  3GTO B;  1E2V A;  1K83 B;  2E74 C;  2BA1 A;  1B9M A;  1CK1 A;  4BS9 A;  1EY7 A;  3H3V C;  3NTH A;  3SEB A;  1DXM A;  1S5E D;  1SNO A;  3RLF A;  5M3F B;  1Z7T A;  1O7Z A;  1VDZ A;  3QIA A;  3V2T A;  1JWM D;  1DZ1 A;  2E2I B;  1CQF A;  1LTA D;  1A15 A;  2L4N A;  1KDC A;  4C1N I;  1HUN A;  2EYO A;  4ZKC B;  1B44 D;  4XQN A;  3I72 A;  2EZV A;  4IUV A;  1TR5 A;  4OO1 G;  1R4P B;  2K28 A;  5ELC A;  4TQU S;  1CFM A;  1KNA A;  3GQB A;  1RDP D;  2R6G A;  2QCP X;  1PLF A;  5HUR A;  2H4O A;  1V1P A;  2NN6 I;  3EJI A;  4B08 A;  1QG7 A;  4WRD A;  1EY8 A;  1LAB A;  4A3M B;  1DOK A;  4H13 C;  2OXP A;  1PZK D;  2YYZ A;  1XX8 A;  2WP8 J;  2IX3 A;  4KY6 A;  2FFK B;  1YNN D;  1GUS A;  4TKO B;  1SDF A;  1G2S A;  3TME A;  1MBY A;  1SYF A;  2KVM A;  2NZ1 D;  5C4H A;  3K0Y A;  3E5S A;  1WTO A;  5FO9 B;  2GA4 B;  2EVB A;  4RHS A;  5T1G A;  1GOZ A;  3NBI A;  4F7X A;  1BOS A;  3VR5 A;  4RWS C;  1YNN C;  3S2D B;  4KMU C;  1TWC B;  1I3Q B;  1WTW A;  1EU3 A;  3NQI A;  3EVQ A;  2L0C A;  2A69 D;  1D2B A;  1JOO A;  1ONL A;  2PZU A;  4X3U A;  3D4R A;  1CHQ D;  1Y8P B;  3T51 B;  2DY8 A;  2F0T A;  2SDF A;  4RCN A;  3QB3 A;  2B8G A;  3FPP A;  3BDL A;  4DN4 M;  4TRD A;  1BXT A;  3S16 B;  5M5W B;  1B2T A;  1Q1B A;  1TS4 A;  1U4M A;  1TWG B;  2F1M A;  1BUV T;  1KAB A;  1ENF A;  4DXF A;  3DEP A;  5I6Y A;  3Q23 A;  2BE5 D;  4A3K B;  3K5N A;  3A56 A;  1SEB D;  3GTQ B;  2NBF A;  1ZYR D;  1B4O A;  5C3X A;  3T56 B;  2JXM B;  4RKB A;  5KGU A;  1KNE A;  3D8G A;  3A7A B;  1BDO A;  3C46 A;  1XWE A;  5IGB A;  2BE5 C;  1BF4 A;  4N9P A;  1F9P A;  2L5T A;  2K6A A;  1TWA B;  2DY7 A;  2F0L A;  1PFM A;  2A68 C;  5C0X I;  1EY4 A;  3MC0 B;  1O7L A;  2JSO A;  1ICW A;  3TN2 A;  3FRP B;  4L6T B;  5FKA C;  1WVL A;  4LMQ D;  5F2D A;  3GTJ B;  3A54 A;  3FDT A;  3PO2 B;  5IOC A;  2E2H B;  4FXG C;  1JIC A;  1HPC A;  2EYH A;  3GTG B;  4AYB B;  2F4I A;  4KK7 A;  1M8A A;  4CJ0 B;  4NW2 A;  1FNV A;  2JA7 B;  3KF8 A;  2PO4 A;  4GZY C;  3DHQ A;  5ELE A;  1SE2 A;  3DUZ A;  4NKL A;  4O1N A;  2E2J B;  2PNR C;  2CVR A;  3NWT A;  4DK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...