4K8JA

Crystal structure of staphylococcal nuclease mutant v23l/v66i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k8jA00
5I9OA 4KJOA 2SNMA 1STAA 1EY9A 3RUZA 1EYDA 5JOBA 1IHZA 1STHA 1A3UA 2RDFA 3QOLA 5KGUA 3BDCA 1STBA 2F0TA 1JORA 4EQOA 1ENCA 4EQPA 1U9RA 4K8JA 3HEJA 1SYEA 5JAVA 2EY2A 5KRUA 3EVQA 2ENBA 4F8MA 4HMIA 4KY7A 3SK5A 4K5VA 5CV4A 1KDAA 2EY5A 3R3OA 5CV7A 3QOJA 1SNPA 2F0UA 2KQ3A 5IIFA 5IGFA 4HTHA 4R8NA 4WRDA 3SK8A 1EYCA 4K6DA 3DHQA 3OSOA 4IALA 5CV5A 4EQNA 1STGA 3D8GA 5IGDA 1SNOA 3OMCA 3U9OA 5I6YA 5M9OA 4NDXA 5IGBA 3T13A 1SNCA 2F0PA 2F0HA 1JOQA 3NQTA 4IUNA 4K14A 4MIUA 4K5XA 4N9PA 5ISRA 2OF1A 5IGGA 2F0VA 5EKKA 2SNSA 4B9XA 4H7BA 5CGKA 1II3A 3MHBA 2HQEA 4DFAA 1F2ZA 2F3WA 3OWFA 1A2UA 4NP5A 5CV8A 3QB3A 5KYIA 3ERQA 3MZ5A 4N9TA 1EZ8A 1KDBA 1SNMA 3SHLA 5I6WA 5KEEA 2RBMA 2LKVA 3MXPA 4E6IA 2PYKA 2KHSA 5CV6A 2F0LA 2F3VA 3OMGA 4J1MA 1JOOA 2EXZA 4KHVA 1SYFA 4F7XA 1EY7A 2PZWA 5IGCA 4ID6A 2F0DA 2RKSA 4KY5A 2F0SA 2EYLA 3LX0A 1JOKA 5I9PA 3C1EA 2WACA 5NUCA 1ENAA 2F0IA 3DMUA 2F0OA 3HZXA 1TR5A 3P1HA 1STNA 3V2TA 3C1FA 1NUCA 4NMZA 3TP7A 3TP6A 2OEOA 3TP5A 4EVOA 3NK9A 1EQVA 4PMCA 4I65A 4KD4A 3NUCA 1AEXA 1F2MA 1TQOA 5CV9A 4K2LA 5CC4A 1KAAA 4QB4A 2M00A 4PNYA 5C6AA 1NSNS 4KD3A 5J22A 1RKNA 4ODGA 5IGEA 1F2YA 2PW5A 4KV6A 3PMFA 5J1ZA 3SXHA 5HGTA 2EYHA 2F0KA 2F0WA 2OXPA 3E5SA 4DU9A 5C4ZA 5HURA 5EGTA 4RKLA 4K8IA 5C3XA 1SYCA 4TRDA 3EJIA 1TT2A 2EY1A 5F2DA 5J39A 3SK4A 3EROA 1EYAA 4S3SA 5C4HA 4DGZA 5EKLA 2PQEA 2PW7A 5KYLA 1A2TA 2F0QA 2F0GA 3D4DA 1KDCA 1EY0A 1EY8A 3ITPA 3NP8A 4KTAA 2EY6A 3P75A 4IZ8A 4QF4A 4DF7A 3D6CA 5E3FA 1EY4A 3NHHA 2EYJA 4ZUIA 5C3WA 4QMGA 5C5MA 4LAAA 1EZ6A 4ZQ3A 3TMEA 3NXWA 2EYPA 4YIJA 4NKLA 1SNDA 2EYMA 2QDBA 1SNQA 2F0MA 4KY6A 2F0EA 1STYA 3D4WA 3SK6A 3S9WA 4K2KA 2O4XA 4OL7A 5CR3A 5DEHA 3BDLA 5DAUA 3H6MA 2EYOA 2F0JA 2EYFA 4ZUJA 1EY6A 2PZUA 4ME5A 4HMJA 3SR1A 2SOBA 4WORA 1KABA 5C5LA 5KIXA 1SYDA 3MEHA 4K5WA 4KJNA 2PZTA 1A3VA 1SYGA 4RKBA 5E1FA 1A3TA 4G57A 1EY5A 4J6HA 4PMBA 5IODA 3MVVA 1SYBA 3TP8A 2F0FA 4B9WA 3T16A 5IOCA 5K5PA 2F0NA 2NUCA 3VA5A
chains in the Genus database with same CATH superfamily
1VQKA 1CZWA 1E2ZA 4DR5L 5KNDA 3D31A 3BVGA 4G7HC 3L2PA 4A3MG 5C4XH 2WKDA 4R4QA 5E4WC 3QOJA 4QUFA 1EOVA 5IIFA 3ND9A 3OSOA 1G6PA 1B9NA 4IUTA 4FVMA 4MIUA 4C56C 2Q2HA 2JA7G 3AEVA 1EIFA 1Z6HA 4YWLA 2QA4A 1TY0A 4QCLA 3M4QA 5LHY1 5CV6A 1I50B 1PZID 2N88A 3VYTA 3GTLB 4CDEC 4A3CG 1E2VA 1AE2A 3NSWA 3A5UA 3JAMc 4A3IB 2BE5C 2JQOA 1YITA 3KF8B 1S5BD 1Z47A 1HJPA 1GVPA 4M8AA 3I4MH 3NUCA 5FLMG 3K5LA 5FLXL 4NXMQ 2ZM6Q 3JC66 3HOXG 3GTOH 2UU9L 4LUZA 3E5SA 1QZHA 1U4PA 1EU4A 3M7NA 5FLXE 1ASZA 2DN8A 1WI5A 1B3QA 3MXNB 5ELFA 3CCQA 4OX9L 1KDCA 1LTTD 5C3WA 2SEBD 2NYZD 3ZYYX 1BCPD 4DUZQ 1NMGA 2J4XA 4LFAL 4X65L 3J7A5 2B8FA 4R4TA 2CH4W 2JJQA 4ZRZA 1DZ1A 1TWGB 1F9RA 1VDZA 4AYBB 1QNKA 1ENFA 2F4VL 5CR3A 4LNQA 2NVYB 5IYCH 2JE6I 4YHHQ 5C4JB 3FHWA 2I07B 1RF2D 2YTYA 1KLGD 2UUBQ 1V1PA 2XGTA 2XRQD 2BA1A 2JP1A 5JEAJ 1MSGA 1EQQA 2HDMA 1A3TA 2UUAL 1K8AC 4J6HA 4IO9A 2GVAA 1Q82C 1TVXA 3CQZB 2Z1CA 5I9OA 1STAA 2JXMB 3BZKA 1HXYD 3DM1A 5IE8A 5FO9B 2E5LQ 2VB3X 4K0KL 1CQVA 2HHHQ 1ML0D 3ULPA 1PXUA 1SE4A 2DJGC 3A8JE 4GOPA 4HMIA 1Q3LA 2OTLA 4DR4Q 1VQEA 3PV0A 5BN5A 1NR4A 1SNPA 3CRLC 1EIHA 2PMZE 2VZAA 1Y1VG 1STGA 4QGUA 2QDLA 2PCFB 4DV0Q 4FNFA 4HJ9A 1QVGA 4K14A 1A62A 3H09A 5IY0A 4A3GG 4RA8A 2SNSA 1CQFA 1XNQQ 4DR7Q 5KNCA 1M1KC 4HIDA 4DN4M 5M3MB 2E2IB 2CW0C 1RD9D 2LKVA 4POGA 4RFBA 5M3FB 1UE5A 1VCIA 4P74A 1I4HA 2DY8A 3QWNA 2LXJA 3KBXA 4F7XA 4ID6A 3HKZE 5NUCA 3HG9A 1TR5A 3P1HA 4A3GB 5JJKA 4LFCQ 4IPGA 1J5EL 2BDNA 3I7FA 1QZGA 2J7ZA 5C0XI 2A74C 1F2MA 5FJ8H 4OO1I 4IUVA 5IT9c 1Y1WB 1TWFH 5M5WB 4DV7L 3DEPA 5C3EG 1XMOQ 5EJWA 5BN3A 3Q22A 3T1YL 1H9MA 1IKLA 2NVTB 3I4NH 2Q2TA 4AH6A 4ILWA 2B2WC 3WWVA 3IKJA 2MP1A 1KIXA 2Q8TA 2I5HA 3QIAA 3ULJA 2F0MA 4KY6A 5C3EB 3CU7A 4L63B 2BDOA 4LF8L 1D6EC 2X6LA 3K6OA 2DUDA 1TWAB 3NELA 1WOCA 2PZUA 4ZCKA 3KLSX 5C44G 1Q1BA 4FF1A 4AQYL 4IN3A 2TMPA 1KL9A 4APVA 4A3LG 1S5ED 3KBGA 1EY9A 1T9HA 1JE5A 1W2BA 4MHEA 3KF8A 1M8AA 1WTOA 3TS2A 4BS9A 1U5KA 2R7FA 4DNTB 5JJZA 2WINB 5FK9C 1R4QB 2G9DA 1CA5A 1KDAA 2V4DA 5DNFA 1BO0A 3HFZB 4OWTB 2C35B 4N8FA 5M5YH 3F8TA 5FLXc 4UPAA 4JBWA 3NQTA 4IUNA 2BH8A 3MXNA 2UXBL 2NWGA 3HOVG 3QJYA 1MD2D 1IW7D 2JA5G 2EVBA 4DXGA 1EL0A 1L1OC 3G7LA 2VNUD 1EY7A 3MTSA 1UAPA 3RD4A 1R4PB 4DV3L 1KNEA 3I72A 3MXUA 4DV1L 2VQFL 4X66L 5FOBB 5H1SE 3TP7A 3EBEA 3TP5A 3H94A 1V1OA 3T56B 4C3JB 3TREA 1ICFB 2VL6A 1N34Q 2RA4A 4O2DA 1AEXA 1HZAA 4CJ0B 3GV6A 5IGEA 3PMFA 5HGTA 2N3SA 4DR3L 5C4ZA 4UP7A 2WAQB 2AHOB 4GLAC 1LUZA 2KENA 3S16H 3GTKB 1FNUA 2PI2A 1BVSA 3EROA 3SK4A 1F77A 1ONLA 1L1OA 1JR0D 1KLUD 4KHPL 1WCMH 3F2UA 3FP9A 4KTAA 1OXXK 2YYZA 3T53B 1HQMC 3D6CA 3NHHA 3K8AA 3TMEA 5JPMC 2EYPA 4NKLA 4JI2L 4DAPA 4C2MH 4GKJQ 4DNIA 1V9PA 3AYHB 1A8VA 2CH4A 5DAUA 2K5VA 3M4PA 3AMUA 2DNCA 1HZ9A 1VQNA 2K5DA 3BJUA 3V05A 1VQBA 5C4XB 5C5LA 1SYDA 4JCVE 5IODA 1X3FA 4P75A 1FNVA 3RN2A 2F0NA 4DV6Q 1HFNA 4P73A 1IZ6A 1SRUA 2B2TA 3UI2A 1LT6D 3M3YH 4FP5D 1IXRA 3NEMA 1N36Q 3GV3A 3E9IA 4RGOS 1U4LA 3DWQA 3CCMA 1G6ZA 1DOKA 2ENBA 5GROA 2UUCQ 2FJ2A 1VS0A 4C3IB 2A1AA 1R9TH 3URYA 5GAEC 4B3TQ 1O7ZA 4K6DA 4F88A 1UE7A 3NQIA 4LF4Q 4NDXA 2JA6B 3FEWX 3K57A 4LUVA 4X3KA 3HOXH 2KOLA 5CGKA 4MTNA 4DR6Q 1HNWQ 4J8QA 3GTPH 3I4MB 3UDIA 2F0LA 3OMGA 1HCZA 3CPWA 3OHXC 1ASYA 4CBVA 4KI0A 4DA2A 3IAYA 3GTOB 4B3MQ 2RKSA 5ELCA 3LX0A 4JI8Q 4FF3A 3EQLC 5IP9H 4H0LC 5IYCG 1NAPA 2WKCA 4NMZA 1S4ZA 1PHJA 1PTOF 1HR0W 3LWEA 4DR2L 5CV9A 2VUMB 1PRTB 1VQ9A 2O5JC 1KHIA 3MFGA 4HCEA 1WVLA 4O0AA 2F52A 3KDFB 4O42A 2F0WA 4JI3L 4LWCA 1K9MC 2LY7A 1OXUA 3M4OH 2L5TA 1SYCA 3M9BA 3PQIA 4IPDA 4TRDA 4CDCC 1RIPA 5AJ3Q 3HGBA 1EFWA 2DY7A 1CFMA 4UDUC 4DAYB 2R92H 5I2XA 3RZOH 4X62L 4HIMA 1X6OA 4ZLTF 2F0GA 1QUQB 4RGMA 1BBWA 3F2BA 3I8ZA 3MFYA 1NJIC 1BF4A 4C1NK 3GTGH 4BBSB 1AZQA 3ERSX 4V190 2EYFA 3S17H 5CBAE 1KABA 1VF7A 4A75A 4JI0L 4GLVB 1YJ9A 3CCUA 1LABA 3PO3B 3W1BA 3NTHA 5AFWA 1A15A 1CM9A 1HZBA 1TWCH 4GN3B 4KJOA 4PZ7A 3BDOA 1PZJD 1ESRA 2Q2UA 3I91A 4YCWA 2RDFA 2K33A 4C3HG 4A3BH 1JC7A 5FJ8G 1SLJA 3BYYB 3I3CA 4KLKA 2D0OA 5ELDA 4X64L 1PFMA 3S15B 2VQEL 3DHQA 3I55A 2B2YC 3U9OA 1LT3D 4JI1Q 2OF1A 5EKKA 2YU9H 4CKEA 4QL5A 5CV8A 3B6YA 3I4NG 4XQNA 5I6WA 1IW7C 3L0OA 1C48A 1JWSD 3HOUH 4LF9L 1OO9B 1TWFB 1W6JA 4DR1L 1BDOA 1V1QA 2IJ0A 1PDQA 2P5ZX 2Z6KA 1O7YA 5ELNA 1VQ5A 4I7ZC 4R4IA 4L5RC 1STEA 1PTOD 2JYOA 1STNA 1LTAD 3C1FA 4KHZA 3PIO3 1U4RA 1O7IA 3S14H 4EX5A 2K32A 4KD4A 5CC4A 2RVLA 5C44H 2CW0D 2D2CC 2PNHA 2ZJRA 3AFQA 1SMYC 2CWPA 2F3IA 4RKLA 1GUGA 3BYTB 1XMQL 1F2LA 4UP8A 2WIIB 2MJ8A 1HNXQ 1HR0Q 4BY7B 1FVIA 4DGZA 1LT5D 3UDXA 2KHJA 5IP7H 1EY0A 2NVXH 1N32Q 1IL8A 1VQAA 3I2ZA 4H44C 1RL2A 1J9OA 3J7AV 2PMZB 4A93H 2L15A 4F87A 1PH7A 3VYRA 1HHVA 1LO5D 2E75C 5BN4A 2HQLA 2ZJQA 1DOMA 4MN3A 2HD3A 1JQYD 2NBFA 3VYUA 4ULLA 2K5WA 1VQMA 2PO4A 3OOCA 4K5WA 3HOVH 2EDGA 4GNXA 3RLOA 3HOYB 3NBHA 4B9WA 1J6QA 1Y8NB 3KJPA 3M7GA 4LUOA 5M5YB 3HOWB 2ICEC 1UE1A 2SNMA 1XPUA 4FXKC 4A3EB 5JOBA 4CJ1B 4JI4L 2UXDL 3HKZB 1WD1A 1NE3A 4Y7NB 1XYIA 1M90C 2NN6I 4RWSC 4L6TB 5D3IB 1I94L 5JAVA 4GN4B 4DV2L 4F8MA 1Y69U 2EPBA 5TSSA 2EY5A 4JBKA 3KDFA 2KQ3A 3T1HQ 4CHTB 1LYLA 2JN4A 3D8GA 1SNOA 1X55A 1GUNA 1RDPD 2VY3A 1SNCA 4IUUA 3KFUA 1BXTA 1YIJA 4HAEA 4B3SQ 3A56A 3BG3A 3NBIA 4DUYL 1QUQA 2K14A 4A3KH 5T1GA 2HCIA 3PO2H 4JOIA 2K1BA 2C9OA 1BBXC 3SHLA 2R7ZG 3E6ZX 1WCMG 2BH2A 1LT4D 1KXLA 1IBML 2ZT9C 5HGQA 2JEAI 2K50A 1JICA 4K0KQ 3UDFA 2F0DA 1PFNA 1IKMA 1AW7A 1AFPA 1I4QA 2WACA 3RMHA 5I4DA 5C0XJ 2QKIC 3HZXA 1E1OA 4EQ5A 1KQSA 3S16B 2IX1A 2EIFA 3FKIH 2JEBI 3ONAB 3OW7A 3DWAA 3OPOA 1WCMB 3HRZC 3EN2A 4A3MB 1F9QA 1CTMA 1F2YA 1X32A 4YY3L 1JJCB 4TSSA 2EYHA 5KNBA 3HP3A 4LF7Q 1SN8A 4TQUS 4C2MB 2K01A 1HRJA 5BR8L 1FGUA 3J81L 5IWAQ 5C4HA 3S2HH 3CCEA 2JA8H 2JA7B 3KLSA 2M9VA 5E3FA 3J81E 4ALPA 2EYJA 4DAVA 4JI7Q 1CK1A 4RG1A 1VQ4A 2QDBA 1SNQA 4PZ8A 3S9WA 3D0FA 1HQRD 2O4XA 4OL7A 3PUZA 1UNSA 4V0BA 4ME5A 3I56A 1HNZQ 3DEOA 4KJNA 4DV4L 4RKBA 1RJTA 1R9TB 1EY5A 1NNXA 1K0SA 3CCJA 4GOPC 5I2YA 5IP9G 1QE6A 3HOXB 4LF6Q 2F0TA 3NE5B 1JORA 1N9WA 2RDHA 3MC0B 1JB3A 5K36H 1SBBB 3NTIA 5LMUQ 3C3LA 3OTOQ 2QILA 1QWYA 4PV1C 2QGQA 1SR3A 4XIGS 4ABNA 1DXMA 2RHQB 2NVQH 1G2TA 1VQHA 3SDZA 4LF8Q 1HTPA 3K7UC 2LSSA 1RTOA 3T13A 5IGBA 1FNWA 2K5QA 4RCOA 4N9PA 1ZYRC 3GTMH 2FINB 3Q8DA 1F2ZA 4DK0A 4CDDC 2R92G 2MQHA 2CHBD 4HR7B 1K8OA 1DGSA 1GUSA 3MXPA 5EKIA 4WFN3 3A74A 3TQYA 4X3TA 4NPSA 1HPCA 1ET9A 3J81i 4GN5A 4Z9CB 4OELB 4JBMA 3EA6A 3GD7A 3M4OB 1PTOC 1E7ZA 2AWOA 2EZVA 2ASBA 4EVOA 2B63H 1YNJC 2AQ3B 2R92B 3RZOB 1Z7TA 4NXNQ 3Q24A 3S1QH 2QEXA 4BBRH 3G6JB 2Z8LA 2A6HC 3C2PA 2NZ1D 1XNRL 3SE0A 3VR5A 1CUKA 4PMWA 2GN5A 4YCUA 1Y1VB 4A3BG 1EYAA 3KJOA 4ZYSA 3MA2B 5KYLA 4C3HH 3NP8A 4DV1Q 2PQAB 3CD6A 4OIKA 1K0RA 1TWCB 1HA6A 5M5XB 4IJHA 2EJGC 3D4WA 3I73A 3SK6A 5C0XH 1EWIA 4OO1H 2E2JH 4JI5Q 1EY6A 4A3BB 3SR1A 5J3BA 2Z9HA 4ZKCB 3HOUG 1JE4A 2GVBA 3A5ZB 4NXML 2ZM6L 1I5FA 1D8LA 3KOJA 1P16A 2HIVA 1BCPB 1K83B 1PRTF 2AQ1B 4EQPA 1OXTA 3DLLA 3OIQA 3W3AA 1FJGQ 3ICEA 2HCCA 3CC2A 1AH9A 3IFTA 1EYCA 3L3OC 4DUZL 1EWCA 4R4OA 1C0AA 1MJEA 1I4RA 1JOQA 3DXJC 4K5XA 5IGGA 1G51A 1NTGA 1ICWA 4YHHL 1H9KA 2EE1A 3S14B 3GTQB 3A7AB 2RHSB 3RZDH 2UUBL 2RBMA 5IP7G 3J81c 3QR8A 3K81C 2A73B 3T4AC 3RN5A 4XDXA 1XJVA 4A93G 2E74C 5C44B 1N8RC 1CI3M 1IL2A 4G7OC 4XT3B 2JA9A 1DJRD 3BVZA 1L0XB 4DK6C 1NUCA 5LMNW 2E5LL 5L37A 3I4OA 2HHHL 3NK9A 4PMCA 1YHBA 3G71A 1D7QA 4DR4L 1PZKD 1QOHA 2DJFC 4ODGA 2B3GA 4IJLA 4BY1H 1ET6A 3SXHA 2AKWB 5HURA 4A93B 3J7AF 1I3QH 2Q8RE 4DV0L 2CCZA 4A3FH 4U673 4JVZA 1XNQL 4DR7L 3V96A 2JSOA 3W2DA 2RCNA 3CHBD 1VQFA 1TS5A 3GQBA 2MUYA 3K0YA 3TP8A 1DCZA 3BZCA 3HOVB 5KRUA 1Q86C 4BA2I 4BXXH 1WTQA 2JA5B 2EYMA 3I4LA 1ILQA 1EEFD 1G91A 2IX3A 1PMRA 1SMYD 4LFCL 4A3KG 1PH4A 3PO2G 2KCMA 1H95A 1LTRD 2B2TC 1PYSB 1PTOH 1YHAA 5FO8B 1K28A 2KCNA 1NCVA 2OT2A 3FMCA 5IOCA 2E8GA 2R7ZH 3BS1A 1B9MA 1G291 1IBKQ 1KAWA 1OTCA 2PPBC 3CRKC 2A68C 5D14A 1XMOL 3PUWA 4K8JA 3FKIG 3ND8A 3D3RA 1VQGA 1VQ8A 2IHEA 3PO2B 3G4SA 3Q6SA 5CV4A 3K80C 2VB2X 1N33Q 1YHQA 4HTHA 4WRDA 2NB0A 2IWHA 1PH3A 5CV5A 1TS2A 4DV5L 5I6YA 1I4XA 3K0XA 4JI0Q 3ER0A 1VMPA 1E0BA 1YJWA 2PQAA 1SNMA 3F1ZA 1U4MA 2O2LD 4LMQD 2JA8G 3H91A 4YWKA 3K5MA 1JOOA 1SAPA 2L55A 2PZWA 1CKMA 4A3IH 2LMCB 5GAGC 4YCVA 1PH9A 3TDQA 5GADC 3I90A 4LFBQ 1YVCA 4I65A 3S2HB 5LL6X 3MAQA 2KECA 3DUZA 1VQIA 1Q7YC 1B70B 3CP0A 4KK7A 1D2BA 4HJ7A 4TVAB 3GDEA 4XQQA 2QF7A 4GLXA 2X69A 2VS1A 4PZ6A 1K3BC 1QJOA 5LMNQ 4K8IA 1XTCD 1GJXA 2A19A 1W3SA 3W5OA 5J39A 5K36G 1TWHH 1GKHA 1K8GA 1X54A 3D4DA 4DF7A 5DM63 3L7ZC 3RR5A 2NVYH 3PUVA 2R6GA 1EQTA 1PH6A 1VQLA 4DKAC 1H9JA 1TIID 2HIXA 4XT1B 1V43A 4FF2A 2EYOA 1T5XD 4HMJA 2QW7A 3CQZH 4WJ4A 1MJCA 1VQCA 4G57A 4OONA 2MO1A 1D5ZC 1H9SB 3E9HA 1KD1C 4GKKQ 2UXCQ 1EYDA 3OIPA 2G5DA 3S2DH 3QOLA 3CF5A 1ENCA 1FR3A 2B63G 4IUPA 1SE3A 1QCBD 3RLFA 1S72A 2HT1A 3SK5A 4IPCA 4BBRG 4LF5Q 4JI6Q 4PG3A 1K73C 1WTXA 2ZXOA 3OMCA 1SE8A 1S5FD 2F0PA 2E2IH 5M3MH 5ISRA 3FPPA 1CHQD 4GKJL 4JV5Q 3LNNA 4IURA 5M3FH 2L12A 2HQEA 1B50A 2AUKA 3GP7A 2N49A 2PNRC 3MWYW 5CYUA 3IL8A 1F9PA 3MZ5A 1OXVA 2Z6KC 2KVMA 1KC8C 2Z4IA 1CSPA 1IYJB 1NBWA 1HTLD 3M85A 2MPMA 1PFSA 1SYFA 1AP0A 1VQPA 1UUPA 4DV6L 1IBLQ 1VQ6A 3R2TA 2D5DA 1NR2A 1ENAA 1WD0A 2F0IA 5C0XG 3BVMA 4OO1G 1N36L 1Y1WH 2XN9C 4HIKA 1F9SA 3C46A 3NWSA 1ZYRD 5JJLA 2UUCL 2I5MX 4C3HB 2IT1A 1Y8PB 1LLRD 2MFIA 4JYAQ 4L5QA 3HKSA 4B3TL 4DR5Q 4FXDA 4DUYQ 2PW5A 2KEEA 3L9AX 4LF4L 3ULLA 3PF4A 5EGTA 2B2VA 2IL8A 3TS0A 1SFOH 4IFDI 3TZUA 1DM0B 2CKZB 1YZ6A 4DAMA 2RDGA 4S3SA 1L2FA 1A0IA 3ZJYC 4DR6L 4L5SA 1YNJD 3I4NB 4QMGA 1EZ6A 1MHWC 4R9WA 2EJFC 4B3ML 2R7DA 3VR4A 4JI8L 4ZAIA 2B2UA 2A6HD 3LWUA 4GNXC 1HA5A 3AU7A 2NTSA 3NPPA 4ZUJA 3A55A 2F1MA 1DYQA 2HDLA 4OWXB 4DPGA 4KKUA 2WB1G 2FXQA 1B1ZA 5GQOA 3D6WA 4A3DH 1PRTC 1M4VA 5EBDA 3N6RA 3VR3A 1UEBA 4FF4A 2B29A 1Q81C 3RNUA 5AJ3L 1YI2A 2N78A 1UEAB 2CFMA 1S5DD 2A6EC 2UU9Q 3SK8A 1ESFA 3H0GH 4WJ3M 3E3XA 4IALA 3STBC 4BY1G 3CCLA 2F4IA 1FGBD 4JOIC 4FXGC 4A3FG 1T5EA 3E0JA 2X6GA 3AFPA 5E7NA 4H7BA 1GD7A 1L0WA 1LTBD 1G8ZD 3CMAA 1VF5C 4OX9Q 1EZ8A 3A8IE 4N8X1 4QQBX 1WTVA 4LFAQ 5JVH3 1IYUA 3KYHC 4J1MA 4X65Q 3PSIA 4BXXG 1IYVA 2NN6H 3X3MA 1XPOA 3NENA 3VYSA 4JPBW 2MHVA 2AMCB 2F4VQ 3TBIB 2RQXA 1C7YA 3WDNA 1ZKOA 3U9SA 2V1CC 1GXDC 4DAYA 2N8NA 1EQVA 4A4IA 2MNAA 3K58A 1H9SA 2E2HH 1Q12A 1BCPF 2IX0A 3H3VI 5A35A 1TQOA 1PA6A 3VA7A 2UUAQ 1K3RA 1NMFA 2M00A 4PNYA 2KBNA 1SJED 1RKNA 1EEID 3GTJH 4KV6A 1SXTA 2L11A 4JI1L 4QJFA 2F03A 1VQOA 3MEFA 4XQJA 4MTKA 2ATWA 2PQEA 4UAIA 2Q8IB 2R3ZA 2L4NA 2FHTA 1C8CA 1PTOB 4OIJA 5J22A 3P75A 2O5IC 1Y14B 3PIP3 1BNZA 2MGSA 1KNAA 1EYGA 3G6EA 3NXWA 2R7ZB 3A0JA 1A63A 2OCEA 2ALYB 5EPKA 2FFKB 3PIOA 2A5HA 1E1TA 1VQ7A 1P8LA 4CGYB 3CMEA 5EPJA 1JB7A 2K03A 2F0JA 2EJMA 1KRTA 3WOEA 2XVSA 5KIXA 1XNRQ 1LTID 4B3RL 2K5HA 1AN8A 3OYYA 4GZYC 4UY8C 3X3NA 4A3IG 1XWEA 4IQZA 3RUZA 4X3UA 3KK7A 5KGUA 4C3IH 2H1EA 2I0QA 3I70A 4CJ2C 4EQOA 1J5EQ 1U9RA 1Q8IA 5ELEA 2A69C 1SYEA 1HNXL 1HR0L 2K52A 1I6HH 1X56A 1B8AA 1B44D 3M3YB 4JBJA 2JA6H 3R3OA 2F0UA 4OXPA 1BQQT 1LTGD 5JPNC 2Z6BA 1N32L 4DV7Q 4EQNA 2ZJPA 5GAHC 2F0HA 1EOTA 3E0EA 3T1YQ 1XXGA 2K04A 2Q2IA 1PH5A 3PCOB 1TU2B 3MHBA 4HSVA 1A2UA 2R61A 2NTTA 2A68D 5D3DA 4B08A 3CC7A 3S1NH 4AYBG 3DM3A 3S1MH 1SROA 1X3EA 5LL6S 3GTPB 4XYOA 1WTRA 1SJHD 2RCFA 4RAUC 3C1EA 1DD2A 1C4QA 2I5LX 1MBYA 4TKOB 3V2TA 1KTKA 2VUMH 3TP6A 2OQ0A 2YTVA 3UE0A 4AQYQ 5EPLA 1TWHB 3A54A 1LV9A 4RGNA 1CKNB 5DM73 4FO2A 5C6AA 3T1HL 4KD3A 2WP8J 3CKIB 5J1ZA 1JCKB 1MGSA 2E2DC 1VQJA 3IFDA 4B3SL 4HCSA 2RSNA 2SDFA 1A2TA 1TXYA 1B4OA 2B39A 3ITPA 4ME3A 4U68A 3Q23A 1EY4A 2WV6D 4BBSH 4DK1A 3GO5A 1RODA 1WTPA 3M4YA 4UP9A 5M3MG 1HZCA 2WB1E 2UXBQ 3OW2A 1GUWA 2H4OA 5DEHA 2BOSA 3S2DB 3N52A 3PIPA 5M3FG 1LM0A 3PO3H 1L1OB 1H9RA 3GTGB 4K6LA 2EQSA 2BA0A 2IW3A 1EUJA 1GUOA 1SYBA 3TN2A 5K5PA 4HSPA 4DV3Q 2NUCA 3J7YW 3S17B 2R93H 3U50C 2VQFQ 3UDGA 1W6KA 4YWMA 4X66Q 1ZXTA 3U4ZA 4LF7L 3QO2A 1UE6A 1STBA 4HJAA 1Y1WG 3CW2C 2EY2A 3VR2A 3S15H 3PUXA 5IWAL 1TY2A 4K5VA 1O7LA 2D9UA 1ILPA 1MSHA 4I7AA 1I4PA 2EOTA 2CQAA 3BU2A 4R8NA 1MI2A 4XYQA 2E76C 2QEJC 4DR3Q 5IGDA 2Y0SE 4JK1C 4JI7L 2KCCA 5M9OA 4L8JA 1JWMD 2H5XA 3A8KE 2K6AA 3PGZA 2M2LA 4Q0FA 3R8BA 4IFDG 4KHPQ 1QILA 2CWAA 2HUGA 4N9TA 5KEEA 4UHVA 1HNZL 4E6IA 2YU9B 1SSOA 1CA6A 2EXZA 3UE1A 1E22A 1SMXA 2N55A 1MKHA 5IGCA 4JI2Q 3HOUB 1YNNC 2EYLA 1YJNA 3KUPA 1PH8A 4KKSA 3DMUA 1SFOB 3J80L 4HEDA 4LF6L 3QG1A 4Q5VA 3K5OA 4DV5Q 4OEMB 5LMUL 3EFXD 3OTOL 4GS3A 2ICIA 3J80E 3AB9A 4QIWB 1TKWB 3R2IA 2ZTCA 1QNUA 3S1RH 4LK1C 4A3DG 4HJ5A 1BKBA 5IYDG 4BY7H 4DU9A 1HFGA 1GOZA 2XRSD 1TT2A 3T51B 2NZOA 5CBEE 3H15A 5T1IA 4OGQC 3K7AH 4IPHA 2C5CA 4RHRA 5C3XA 4EGVA 3H0GG 2CVRA 1D1KA 3NWTA 4ZQ3A 1A6XA 4YIJA 4DK3C 4A3DB 4A3JH 2NVXB 2B2WA 3HOZH 1X65A 2A8VA 3HOYH 2WFWA 1HH2P 2SOBA 1HUMA 3HOWH 3KF6B 1X3PA 5JVG3 3FPUB 5E1FA 4NXNL 4AIMA 4A3EH 4PMBA 4CKBA 1DOLA 3H0GB 4Y7NH 1X3GA 2NN6G 1I6VC 4C3JG 1GHKA 1X9NA 1DONA 1A3UA 4ZKBB 4R1JA 4DNRB 5JEAH 1CKNA 3HEJA 1EQRA 2LXKA 4KN4C 4DR2Q 3O13A 3D4RA 2TSSA 1E3PA 2L9HA 2WAQG 5IYBH 3J80i 1X3QA 2K28A 3DWPA 4JI3Q 2XSCA 4PQXA 4AYBE 3F2CA 4RH6A 2DGYA 1EIYB 1D5XC 1UWVA 1Z9FA 2F0VA 5HY6A 1PRTD 1I4GA 2F3WA 3OWFA 4X62Q 3ERQA 4JI5L 1KDBA 3TEHB 2JK8A 4HIOA 1LTSD 2E2HB 2KHSA 2RSOA 1FL0A 3OWEB 3J7ZC 1NY4A 4IUQA 1RTNA 4KHVA 4A3KB 1WYDA 2B8GA 4R4CA 3GTJB 4KY5A 2A6ED 5CMDA 1BBUA 2ZXRA 5C4XG 3AQQA 3STBD 1LTLA 2XNAC 1SEBD 4A76A 1BCPC 4A3MH 4X6AH 2L1BA 1OXSC 2PI2E 3EIVA 4ZK9B 1PV4A 1YNXA 1FJGL 1I50H 4IFDJ 3GTLH 1WFQA 4JG2A 2NZHA 3FKIB 4MNOA 2XTIA 4G7ZC 1PVOA 2LS01 2EXDA 2F0KA 1O78A 4C3IG 2D0PA 3EJIA 2EY1A 2JA7H 3LGJA 2PW7A 2K5NA 4X64Q 2IY5B 2JA6G 2EY6A 2VQEQ 1MIUA 1AE3A 2D62A 5C5MA 5A2QL 2MO0A 4MZ9A 4A3CH 1B7YB 3HS0C 1LACA 4HJ8A 2JA8B 1XX8A 3SGIA 2F0EA 1Q8KA 1QVCA 3I4MG 4K2KA 5CORA 5A2QE 4RMFA 3TZDA 1VQDA 1B3AA 4H13C 1QB5D 1I6HB 1EFID 4LF9Q 3IRBA 1E2WA 1QG7A 1A3VA 5E4XA 5FLMH 1V8QA 3MVVA 4DR1Q 1VMCA 3T16A 2KHIA 1TWGH 3K5NA 1STHA 3BDCA 2KUMA 5C4JH 5FKAC 1Q90A 2VUMG 5DLQE 1ZEQX 2AQ2B 1PYWD 4CDFC 2OQKA 2AWNA 3J80c 3KLRA 3MXGA 5JJIA 5CV7A 4XXEA 5IGFA 4LJZC 4GNXB 2FMMA 4P72A 4X3SA 3NBHB 3S1NB 5EQ0A 3NTKA 2ZXPA 3S1MB 4QIWE 1N34L 1EU3A 4KN7C 2NVQB 2FMCA 4C1NI 1XMQQ 2ZTDA 4L5TA 3FRPB 2AUJD 4B9XA 1BOSA 3QB3A 3CCRA 4CKCA 2KCTA 2VXWA 3PF5A 3GTMB 2PYKA 2A69D 1O80A 3U58A 1GO3E 4BBSG 1B2TA 3H3VC 1EWHA 1GHJA 2XIWA 4RGTA 5G3LF 5I9PA 2KEDA 1IBKL 1AZPA 1K8MA 3FDTA 5ELBA 3KF6A 3PO3G 1JT8A 3S24A 2BE5D 1FD7D 4P71A 4OWWB 4KMUC 4G4KA 4POFA 2IPKD 5ELOA 2Z4HA 3SVMA 4K2LA 2B2VC 1KAAA 4QB4A 1BUVT 3CXCA 2B63B 1N33L 5COYA 1TS4A 2R93G 1SDFA 1Y1VH 3S1QB 3J81j 4JI4Q 2UXDQ 2J0TD 2G9HD 4BBRB 4A3GH 2L0CA 3F2DA 1I94Q 1D5MC 1Q46A 5F2DA 4DV2Q 4RCNA 5EKLA 4BA1I 5EBCA 5FO7B 1GM5A 2F0QA 5M5XH 5M5WH 3Q0AA 4QF4A 1WTHA 2B2UC 3R93A 1JWUD 4ZUIA 2XWBB 2ID0A 4BWGB 4H02A 1PYBA 1CT1D 1SNDA 3JAML 2R93B 1U0LA 1STYA 1GUTA 1D1IA 1JMCA 2NVTH 1WJJA 3JAME 4LFBL 2YTXA 1WTWA 4FDBA 1IBMQ 1SYGA 4HN7A 1CZGA 3P20A 3CCSA 1L0YB 2XWJB 1K83H 2E2JB 4LW1A 4IFDH 1Q1EA 2BCOA 1HNWL 2PZTA 3VA5A 1S5CD 2WAQE 5C3EH 1IHZA 5LMNL 5EAYA 1TWAH 3TRZA 2I46A 2DNEA 4RHSA 1RCVD 2CQOA 3VDYA 2OTJA 3U4VA 1S40A 3EVQA 1PH1A 4QUCA 2K4KA 1KRSA 4KY7A 3BZDB 1SE2A 2K7VA 1BR9A 1FYCA 4YY3Q 4BY7G 4O1NA 1B53A 4Y52H 4P2CB 3GTQH 3KLWA 2YV5A 3WOFA 5BR8Q 4B3RQ 1II3A 5IYDH 4DFAA 4NP5A 2B2YA 2KJXA 2Z0SA 5KYIA 2ZTEA 1PH2A 2K05A 2F3VA 4A3LH 4KKTA 1V1PB 3VR6A 5G3LD 3RZDB 1E24A 2LFNA 3S1RB 2GA4B 4WJWA 2F0SA 4A3JG 1JOKA 3FVQA 4GKKL 2UXCL 3G48A 4NW2A 1XTDA 4QY7A 3HOZG 1S3OA 2WB1B 1YBYA 2F0OA 2OEOA 2QCPX 1CHPD 3HOYG 1HUNA 3JAMi 3K59A 5D65A 4DV4Q 3HOWG 3K7AB 4A3EG 1Y8OB 1TS3A 3HKZG 1JJGA 4GOPB 1C9OA 1NSNS 1JJ2A 4JI6L 3PUYA 4LF5L 2Y0SG 1PLFA 3W1GA 2K75A 2OXPA 3P7JA 4A3JB 3CCVA 1CKOA 1RHPA 3TSSA 3HOZB 5JEAG 4BY1B 4JV5L 1YNND 4C3JH 1XPRA 1I3QB 2IHFA 4JW0A 4A3FB 4IOAA 1PFBA 2KA7A 2JA5H 1EY8A 4FYDA 4R8IA 1G2SA 4IZ8A 5IYBG 4DXFA 2OWOA 2VW9A 4LAAA 4JC0A 1QVFA 2Y0SB 4M1UB 3RLNA 1IBLL 4J15A 3GTKH 3SEBA 1CSQA 2ES2A 3H3VH 3BDLA 4XTCS 2RF4A 3H6MA 5IT9L 3CC4A 3A7LA 4WORA 3CPFA 4IOCA 3MEHA 1J8IA 4OHJA 1YEZA 4NB3A 3CAMA 2F0FA 5IT9E 4JYAL 1EIGA
chains in the Genus database with same CATH topology
1CZWA 1E2ZA 5KNDA 3D31A 3BVGA 4G7HC 2WKDA 5E4WC 3QOJA 4QUFA 5IIFA 3ND9A 3OSOA 1B9NA 4IUTA 4FVMA 4MIUA 4C56C 1Z6HA 1TY0A 4QCLA 5LHY1 5CV6A 1I50B 1PZID 2N88A 3VYTA 3GTLB 1E2VA 3NSWA 4A3IB 2BE5C 1S5BD 1Z47A 4M8AA 3NUCA 3K5LA 5FLXL 3E5SA 1U4PA 1EU4A 3M7NA 5FLXE 2DN8A 5ELFA 1KDCA 1LTTD 5C3WA 2SEBD 2NYZD 3ZYYX 1BCPD 2J4XA 2B8FA 1DZ1A 4ZRZA 1TWGB 1F9RA 1VDZA 4AYBB 1QNKA 1ENFA 5CR3A 2NVYB 2JE6I 5C4JB 2I07B 1RF2D 1KLGD 1V1PA 2XRQD 2BA1A 2JP1A 5JEAJ 1MSGA 2HDMA 1A3TA 4J6HA 1TVXA 3CQZB 2Z1CA 5I9OA 1STAA 2JXMB 1HXYD 3DM1A 5FO9B 2VB3X 1CQVA 1ML0D 1PXUA 1SE4A 3A8JE 4HMIA 1Q3LA 5BN5A 3PV0A 1NR4A 1SNPA 3CRLC 1EIHA 1STGA 2PCFB 4FNFA 4K14A 3H09A 4RA8A 2SNSA 1CQFA 5KNCA 4DN4M 5M3MB 2E2IB 2CW0C 1RD9D 2LKVA 4RFBA 5M3FB 1VCIA 1I4HA 2DY8A 3QWNA 4F7XA 3KBXA 4ID6A 5NUCA 3HG9A 1TR5A 3P1HA 4A3GB 2BDNA 2J7ZA 5C0XI 2A74C 1F2MA 4OO1I 4IUVA 1Y1WB 5M5WB 3DEPA 5EJWA 5BN3A 3Q22A 1H9MA 1IKLA 2NVTB 4ILWA 2B2WC 3IKJA 2MP1A 2Q8TA 3QIAA 2F0MA 4KY6A 5C3EB 3CU7A 4L63B 2BDOA 1D6EC 2X6LA 3K6OA 1TWAB 2PZUA 3KLSX 4FF1A 1Q1BA 4IN3A 2TMPA 1S5ED 3KBGA 1EY9A 4MHEA 3KF8A 1M8AA 1WTOA 4BS9A 4DNTB 5JJZA 2WINB 5FK9C 1R4QB 2G9DA 1CA5A 1KDAA 2V4DA 5DNFA 1BO0A 4JBWA 3NQTA 4IUNA 3MXNA 2NWGA 3QJYA 1MD2D 1IW7D 2EVBA 4DXGA 1EL0A 3G7LA 2VNUD 1EY7A 3MTSA 1UAPA 3RD4A 1R4PB 1KNEA 3I72A 3MXUA 5FOBB 3TP7A 3TP5A 3H94A 1V1OA 3T56B 4C3JB 2RA4A 1AEXA 4CJ0B 3GV6A 5IGEA 3PMFA 5HGTA 5C4ZA 2WAQB 3GTKB 1FNUA 3SK4A 3EROA 1F77A 1ONLA 1JR0D 1KLUD 3F2UA 4KTAA 1OXXK 2YYZA 3T53B 1HQMC 3D6CA 3NHHA 3TMEA 5JPMC 2EYPA 4NKLA 4DAPA 5DAUA 3AMUA 2DNCA 2K5DA 3V05A 5C4XB 5C5LA 1SYDA 5IODA 1FNVA 2F0NA 1HFNA 2B2TA 3UI2A 1LT6D 4FP5D 3GV3A 4RGOS 1U4LA 3DWQA 1G6ZA 1DOKA 2ENBA 2FJ2A 4C3IB 3URYA 1O7ZA 4K6DA 4F88A 3NQIA 4NDXA 2JA6B 3FEWX 3K57A 4X3KA 2KOLA 5CGKA 4J8QA 3I4MB 2F0LA 3OMGA 1HCZA 3OHXC 4CBVA 4KI0A 4DA2A 3IAYA 3GTOB 2RKSA 5ELCA 3LX0A 4FF3A 3EQLC 4H0LC 1NAPA 2WKCA 4NMZA 1S4ZA 1PTOF 3LWEA 5CV9A 2VUMB 1PRTB 2O5JC 4HCEA 3MFGA 1WVLA 4O42A 2F0WA 2LY7A 1OXUA 2L5TA 1SYCA 4TRDA 3HGBA 2DY7A 1CFMA 4UDUC 5I2XA 4ZLTF 2F0GA 4RGMA 3I8ZA 3MFYA 1BF4A 4C1NK 4BBSB 1AZQA 4V190 2EYFA 5CBAE 1KABA 1VF7A 1LABA 3PO3B 5AFWA 3NTHA 1A15A 1CM9A 4KJOA 3BDOA 1PZJD 1ESRA 3I91A 2RDFA 2K33A 4C3HG 1JC7A 3BYYB 3I3CA 5ELDA 1PFMA 3S15B 3DHQA 2B2YC 3U9OA 1LT3D 2OF1A 5EKKA 4CKEA 5CV8A 4XQNA 5I6WA 1IW7C 1C48A 1JWSD 1OO9B 1TWFB 1W6JA 1BDOA 2IJ0A 1PDQA 1O7YA 4I7ZC 1STEA 1PTOD 2JYOA 1STNA 1LTAD 3C1FA 4KHZA 3PIO3 1U4RA 2K32A 4KD4A 5CC4A 2RVLA 2CW0D 2D2CC 1SMYC 4RKLA 1GUGA 3BYTB 1F2LA 2WIIB 2MJ8A 4BY7B 4DGZA 1LT5D 1EY0A 1IL8A 4H44C 1J9OA 3J7AV 2PMZB 4F87A 3VYRA 1HHVA 1LO5D 2E75C 5BN4A 1DOMA 4MN3A 1JQYD 2NBFA 3VYUA 4ULLA 2K5WA 2PO4A 3OOCA 4K5WA 2EDGA 3HOYB 3NBHA 4B9WA 1Y8NB 3M7GA 5M5YB 3HOWB 2ICEC 2SNMA 4FXKC 4A3EB 5JOBA 4CJ1B 3HKZB 1WD1A 4Y7NB 1XYIA 2NN6I 4RWSC 4L6TB 5D3IB 5JAVA 4F8MA 1Y69U 2EPBA 5TSSA 2EY5A 2KQ3A 4CHTB 3D8GA 1SNOA 1GUNA 1RDPD 1SNCA 4IUUA 1BXTA 4HAEA 3A56A 3BG3A 3NBIA 5T1GA 2HCIA 2K1BA 2C9OA 1BBXC 3SHLA 3E6ZX 1LT4D 2ZT9C 2JEAI 1JICA 2F0DA 1PFNA 1IKMA 1AW7A 1AFPA 1I4QA 2WACA 3RMHA 5I4DA 5C0XJ 2QKIC 3HZXA 3S16B 2IX1A 2JEBI 3ONAB 3OW7A 3DWAA 3OPOA 1WCMB 3HRZC 4A3MB 1F9QA 1CTMA 1F2YA 1X32A 4TSSA 2EYHA 5KNBA 3HP3A 4TQUS 4C2MB 2K01A 1HRJA 3J81L 5C4HA 2JA7B 3KLSA 2M9VA 5E3FA 3J81E 2EYJA 4DAVA 1CK1A 2QDBA 1SNQA 3S9WA 1HQRD 4OL7A 2O4XA 3PUZA 1UNSA 4V0BA 4ME5A 3DEOA 4KJNA 4RKBA 1RJTA 1R9TB 1EY5A 5I2YA 1QE6A 3HOXB 2F0TA 3NE5B 1JORA 2RDHA 3MC0B 1JB3A 5K36H 1SBBB 3NTIA 3C3LA 2QILA 1QWYA 4PV1C 4XIGS 4ABNA 1G2TA 1DXMA 3SDZA 1HTPA 1RTOA 3T13A 5IGBA 1FNWA 2K5QA 4RCOA 4N9PA 1ZYRC 2FINB 1F2ZA 4DK0A 2CHBD 4HR7B 1K8OA 1GUSA 3MXPA 5EKIA 4WFN3 4X3TA 1HPCA 1ET9A 4Z9CB 3EA6A 3GD7A 3M4OB 1PTOC 2AWOA 2EZVA 4EVOA 1YNJC 2AQ3B 2R92B 3RZOB 1Z7TA 3Q24A 3G6JB 2Z8LA 2A6HC 3C2PA 2NZ1D 3SE0A 3VR5A 4PMWA 1Y1VB 1EYAA 4ZYSA 3MA2B 5KYLA 3NP8A 4OIKA 1TWCB 1HA6A 5M5XB 2EJGC 3D4WA 3I73A 3SK6A 5C0XH 4OO1H 1EY6A 4A3BB 3SR1A 4ZKCB 1JE4A 1BCPB 1K83B 1PRTF 2AQ1B 4EQPA 1OXTA 3OIQA 3W3AA 2HCCA 3IFTA 1EYCA 3L3OC 1EWCA 1I4RA 1JOQA 3DXJC 4K5XA 5IGGA 1ICWA 1H9KA 2EE1A 3S14B 3GTQB 3A7AB 2RBMA 2A73B 3T4AC 4XDXA 2E74C 5C44B 1CI3M 4G7OC 4XT3B 1DJRD 3BVZA 1L0XB 1NUCA 3NK9A 4PMCA 1PZKD 1QOHA 4ODGA 1ET6A 3SXHA 4A93B 5HURA 3J7AF 2Q8RE 4U673 3V96A 2JSOA 3W2DA 3CHBD 1TS5A 3GQBA 3TP8A 2MUYA 3K0YA 1DCZA 3HOVB 5KRUA 4BA2I 1WTQA 2JA5B 2EYMA 3I4LA 1ILQA 1EEFD 1G91A 2IX3A 1PMRA 1SMYD 1LTRD 2B2TC 1PTOH 5FO8B 2KCNA 1NCVA 2OT2A 3FMCA 5IOCA 3BS1A 1B9MA 1G291 2PPBC 3CRKC 2A68C 5D14A 3PUWA 4K8JA 3ND8A 3D3RA 3PO2B 3Q6SA 5CV4A 2VB2X 4HTHA 4WRDA 2NB0A 2IWHA 5CV5A 1TS2A 5I6YA 1I4XA 1VMPA 1E0BA 1SNMA 1U4MA 2O2LD 4LMQD 3H91A 3K5MA 1JOOA 1SAPA 2L55A 2PZWA 2LMCB 3TDQA 3I90A 4I65A 3S2HB 5LL6X 3MAQA 2KECA 3DUZA 4KK7A 1D2BA 4XQQA 2QF7A 2X69A 1QJOA 4K8IA 1XTCD 1GJXA 5K36G 5J39A 3D4DA 4DF7A 5DM63 3L7ZC 3PUVA 2R6GA 1EQTA 1H9JA 1TIID 4XT1B 1V43A 4FF2A 2EYOA 1T5XD 4HMJA 4G57A 1D5ZC 1H9SB 1EYDA 3OIPA 3QOLA 1ENCA 1FR3A 4IUPA 1SE3A 1QCBD 3RLFA 3SK5A 1WTXA 2ZXOA 3OMCA 1S5FD 2F0PA 5ISRA 3FPPA 1CHQD 3LNNA 4IURA 2L12A 2HQEA 1B50A 2AUKA 3GP7A 2PNRC 3MWYW 5CYUA 3IL8A 1F9PA 3MZ5A 1OXVA 2KVMA 2Z4IA 1HTLD 3M85A 2MPMA 1SYFA 1AP0A 1UUPA 3R2TA 2D5DA 1NR2A 1ENAA 1WD0A 2F0IA 5C0XG 3BVMA 4OO1G 2XN9C 1F9SA 3C46A 3NWSA 1ZYRD 4C3HB 2IT1A 1Y8PB 1LLRD 4FXDA 2PW5A 2KEEA 3L9AX 5EGTA 2B2VA 2IL8A 4IFDI 3TZUA 1DM0B 2RDGA 4S3SA 1YNJD 3I4NB 4QMGA 1EZ6A 4R9WA 2EJFC 3VR4A 4ZAIA 2B2UA 2A6HD 3LWUA 1HA5A 3AU7A 2NTSA 3NPPA 4ZUJA 3A55A 2F1MA 1DYQA 2HDLA 4KKUA 1B1ZA 3D6WA 1PRTC 1M4VA 5EBDA 3N6RA 3VR3A 4FF4A 1UEAB 1S5DD 2A6EC 3SK8A 1ESFA 4IALA 2F4IA 1FGBD 4FXGC 1T5EA 3E0JA 2X6GA 4H7BA 1LTBD 1G8ZD 1VF5C 1EZ8A 3A8IE 1WTVA 5JVH3 1IYUA 4J1MA 1IYVA 2NN6H 3X3MA 3VYSA 2MHVA 3TBIB 2RQXA 3WDNA 1ZKOA 3U9SA 1GXDC 4DAYA 1EQVA 3K58A 1H9SA 1Q12A 1BCPF 2IX0A 5A35A 1TQOA 3VA7A 2M00A 4PNYA 1SJED 1RKNA 1EEID 4KV6A 1SXTA 2L11A 2F03A 4XQJA 2PQEA 4UAIA 2Q8IB 2R3ZA 2L4NA 2FHTA 1C8CA 1PTOB 4OIJA 5J22A 3P75A 2O5IC 3PIP3 1BNZA 2MGSA 1KNAA 3NXWA 2R7ZB 5EPKA 2FFKB 2A5HA 4CGYB 5EPJA 2K03A 2F0JA 2EJMA 3WOEA 2XVSA 5KIXA 1LTID 1AN8A 4GZYC 3X3NA 1XWEA 4IQZA 3RUZA 4X3UA 3KK7A 5KGUA 2H1EA 3I70A 4CJ2C 4EQOA 1U9RA 5ELEA 1Q8IA 2A69C 1SYEA 1B44D 3M3YB 3R3OA 2F0UA 1BQQT 1LTGD 5JPNC 4EQNA 2F0HA 1EOTA 1XXGA 2K04A 1TU2B 3MHBA 4HSVA 1A2UA 2R61A 2NTTA 2A68D 5D3DA 4B08A 5LL6S 3GTPB 4XYOA 1WTRA 1SJHD 4RAUC 3C1EA 1DD2A 1C4QA 1MBYA 4TKOB 3V2TA 1KTKA 3TP6A 5EPLA 1TWHB 3A54A 1LV9A 4RGNA 5DM73 4FO2A 5C6AA 4KD3A 2WP8J 3CKIB 5J1ZA 1JCKB 1MGSA 2E2DC 3IFDA 4HCSA 2RSNA 1A2TA 2SDFA 1B4OA 2B39A 3ITPA 3Q23A 4U68A 1EY4A 2WV6D 4DK1A 3GO5A 1RODA 1WTPA 3M4YA 1GUWA 2H4OA 5DEHA 2BOSA 3S2DB 3N52A 1H9RA 3GTGB 4K6LA 2BA0A 2IW3A 1GUOA 1SYBA 3TN2A 5K5PA 4HSPA 2NUCA 3J7YW 3S17B 1W6KA 1ZXTA 3QO2A 1STBA 2EY2A 3VR2A 3PUXA 1TY2A 4K5VA 1O7LA 2D9UA 1ILPA 1MSHA 1I4PA 2EOTA 2CQAA 4R8NA 1MI2A 4XYQA 2E76C 2QEJC 5IGDA 4JK1C 2KCCA 5M9OA 4L8JA 1JWMD 3A8KE 2K6AA 2M2LA 4Q0FA 3R8BA 4IFDG 1QILA 2HUGA 4N9TA 5KEEA 4E6IA 2YU9B 1SSOA 1CA6A 2EXZA 2N55A 5IGCA 3HOUB 1YNNC 2EYLA 3KUPA 4KKSA 3DMUA 1SFOB 3J80L 4HEDA 3QG1A 4Q5VA 3K5OA 3EFXD 2ICIA 3J80E 3AB9A 4QIWB 1TKWB 3R2IA 1QNUA 4LK1C 4DU9A 1HFGA 1GOZA 2XRSD 1TT2A 3T51B 5CBEE 5T1IA 4OGQC 2C5CA 4RHRA 5C3XA 4EGVA 2CVRA 1D1KA 3NWTA 4ZQ3A 1A6XA 4YIJA 4A3DB 2NVXB 2B2WA 2SOBA 1HUMA 1X3PA 5JVG3 3FPUB 5E1FA 4PMBA 4CKBA 1DOLA 3H0GB 2NN6G 1I6VC 4C3JG 1GHKA 1DONA 1A3UA 4ZKBB 4DNRB 5JEAH 3HEJA 4KN4C 3O13A 3D4RA 2TSSA 2L9HA 1X3QA 2K28A 3DWPA 2XSCA 4PQXA 4RH6A 1D5XC 2F0VA 1PRTD 1I4GA 2F3WA 3OWFA 3ERQA 1KDBA 1LTSD 2E2HB 2KHSA 2RSOA 3OWEB 4IUQA 1RTNA 4KHVA 4A3KB 2B8GA 3GTJB 4KY5A 2A6ED 5CMDA 2ZXRA 2XNAC 1SEBD 1BCPC 2L1BA 1OXSC 4ZK9B 4IFDJ 3FKIB 4G7ZC 2LS01 2F0KA 1O78A 4C3IG 3EJIA 2EY1A 2PW7A 2EY6A 2D62A 5C5MA 5A2QL 3HS0C 1LACA 2JA8B 1XX8A 2F0EA 4K2KA 5CORA 5A2QE 3TZDA 1B3AA 4H13C 1QB5D 1I6HB 1EFID 1E2WA 1QG7A 1A3VA 5E4XA 1V8QA 3MVVA 1VMCA 3T16A 3K5NA 1STHA 3BDCA 2KUMA 5FKAC 1Q90A 1ZEQX 2AQ2B 1PYWD 2AWNA 3KLRA 3MXGA 5CV7A 4XXEA 5IGFA 4LJZC 2FMMA 4X3SA 3S1NB 5EQ0A 3NTKA 2ZXPA 3S1MB 1EU3A 4KN7C 2NVQB 2FMCA 4C1NI 3FRPB 2AUJD 4B9XA 1BOSA 3QB3A 4CKCA 2VXWA 3GTMB 2PYKA 2A69D 1O80A 1B2TA 3H3VC 1EWHA 1GHJA 2XIWA 4RGTA 5G3LF 5I9PA 2KEDA 1AZPA 1K8MA 3FDTA 5ELBA 2BE5D 1FD7D 4KMUC 4G4KA 2IPKD 3SVMA 2Z4HA 4K2LA 2B2VC 1KAAA 4QB4A 1BUVT 2B63B 5COYA 1TS4A 1SDFA 3S1QB 2J0TD 2G9HD 4BBRB 2L0CA 1D5MC 5F2DA 4RCNA 5EKLA 4BA1I 5EBCA 5FO7B 2F0QA 3Q0AA 4QF4A 2B2UC 3R93A 1JWUD 4ZUIA 2XWBB 2ID0A 4BWGB 2R93B 1CT1D 1SNDA 3JAML 1STYA 1GUTA 1D1IA 3JAME 1WTWA 1SYGA 4HN7A 1CZGA 3P20A 1L0YB 2XWJB 2E2JB 4IFDH 1Q1EA 2BCOA 2PZTA 3VA5A 1S5CD 1IHZA 2I46A 2DNEA 4RHSA 1RCVD 3EVQA 4QUCA 4KY7A 3BZDB 1SE2A 2K7VA 1BR9A 1FYCA 4O1NA 1B53A 4P2CB 3WOFA 1II3A 4DFAA 4NP5A 2B2YA 2KJXA 5KYIA 2K05A 2F3VA 4KKTA 1V1PB 3VR6A 5G3LD 3RZDB 3S1RB 2LFNA 2GA4B 4WJWA 2F0SA 1JOKA 3FVQA 4NW2A 2WB1B 2F0OA 2OEOA 2QCPX 1CHPD 1HUNA 3K59A 5D65A 3K7AB 1Y8OB 1TS3A 1NSNS 3PUYA 1PLFA 2OXPA 3P7JA 4A3JB 1RHPA 3TSSA 3HOZB 5JEAG 4BY1B 1YNND 1I3QB 4A3FB 1PFBA 2KA7A 1EY8A 4FYDA 4R8IA 1G2SA 4IZ8A 4DXFA 4LAAA 2Y0SB 4M1UB 3SEBA 3BDLA 4XTCS 3H6MA 5IT9L 3A7LA 4WORA 3MEHA 1J8IA 4OHJA 2F0FA 5IT9E 1EIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I9O A;  4KJO A;  2SNM A;  1STA A;  1EY9 A;  3RUZ A;  1EYD A;  5JOB A;  1IHZ A;  1STH A;  1A3U A;  2RDF A;  3QOL A;  5KGU A;  3BDC A;  1STB A;  2F0T A;  1JOR A;  4EQO A;  1ENC A;  4EQP A;  1U9R A;  4K8J A;  3HEJ A;  1SYE A;  5JAV A;  2EY2 A;  5KRU A;  3EVQ A;  2ENB A;  4F8M A;  4HMI A;  4KY7 A;  3SK5 A;  4K5V A;  5CV4 A;  1KDA A;  2EY5 A;  3R3O A;  5CV7 A;  3QOJ A;  1SNP A;  2F0U A;  2KQ3 A;  5IIF A;  5IGF A;  4HTH A;  4R8N A;  4WRD A;  3SK8 A;  1EYC A;  4K6D A;  3DHQ A;  3OSO A;  4IAL A;  5CV5 A;  4EQN A;  1STG A;  3D8G A;  5IGD A;  1SNO A;  3OMC A;  3U9O A;  5I6Y A;  5M9O A;  4NDX A;  5IGB A;  3T13 A;  1SNC A;  2F0P A;  2F0H A;  1JOQ A;  3NQT A;  4IUN A;  4K14 A;  4MIU A;  4K5X A;  4N9P A;  5ISR A;  2OF1 A;  5IGG A;  2F0V A;  5EKK A;  2SNS A;  4B9X A;  4H7B A;  5CGK A;  1II3 A;  3MHB A;  2HQE A;  4DFA A;  1F2Z A;  2F3W A;  3OWF A;  1A2U A;  4NP5 A;  5CV8 A;  3QB3 A;  5KYI A;  3ERQ A;  3MZ5 A;  4N9T A;  1EZ8 A;  1KDB A;  1SNM A;  3SHL A;  5I6W A;  5KEE A;  2RBM A;  2LKV A;  3MXP A;  4E6I A;  2PYK A;  2KHS A;  5CV6 A;  2F0L A;  2F3V A;  3OMG A;  4J1M A;  1JOO A;  2EXZ A;  4KHV A;  1SYF A;  4F7X A;  1EY7 A;  2PZW A;  5IGC A;  4ID6 A;  2F0D A;  2RKS A;  4KY5 A;  2F0S A;  2EYL A;  3LX0 A;  1JOK A;  5I9P A;  3C1E A;  2WAC A;  5NUC A;  1ENA A;  2F0I A;  3DMU A;  2F0O A;  3HZX A;  1TR5 A;  3P1H A;  1STN A;  3V2T A;  3C1F A;  1NUC A;  4NMZ A;  3TP7 A;  3TP6 A;  2OEO A;  3TP5 A;  4EVO A;  3NK9 A;  1EQV A;  4PMC A;  4I65 A;  4KD4 A;  3NUC A;  1AEX A;  1F2M A;  1TQO A;  5CV9 A;  4K2L A;  5CC4 A;  1KAA A;  4QB4 A;  2M00 A;  4PNY A;  5C6A A;  1NSN S;  4KD3 A;  5J22 A;  1RKN A;  4ODG A;  5IGE A;  1F2Y A;  2PW5 A;  4KV6 A;  3PMF A;  5J1Z A;  3SXH A;  5HGT A;  2EYH A;  2F0K A;  2F0W A;  2OXP A;  3E5S A;  4DU9 A;  5C4Z A;  5HUR A;  5EGT A;  4RKL A;  4K8I A;  5C3X A;  1SYC A;  4TRD A;  3EJI A;  1TT2 A;  2EY1 A;  5F2D A;  5J39 A;  3SK4 A;  3ERO A;  1EYA A;  4S3S A;  5C4H A;  4DGZ A;  5EKL A;  2PQE A;  2PW7 A;  5KYL A;  1A2T A;  2F0Q A;  2F0G A;  3D4D A;  1KDC A;  1EY0 A;  1EY8 A;  3ITP A;  3NP8 A;  4KTA A;  2EY6 A;  3P75 A;  4IZ8 A;  4QF4 A;  4DF7 A;  3D6C A;  5E3F A;  1EY4 A;  3NHH A;  2EYJ A;  4ZUI A;  5C3W A;  4QMG A;  5C5M A;  4LAA A;  1EZ6 A;  4ZQ3 A;  3TME A;  3NXW A;  2EYP A;  4YIJ A;  4NKL A;  1SND A;  2EYM A;  2QDB A;  1SNQ A;  2F0M A;  4KY6 A;  2F0E A;  1STY A;  3D4W A;  3SK6 A;  3S9W A;  4K2K A;  2O4X A;  4OL7 A;  5CR3 A;  5DEH A;  3BDL A;  5DAU A;  3H6M A;  2EYO A;  2F0J A;  2EYF A;  4ZUJ A;  1EY6 A;  2PZU A;  4ME5 A;  4HMJ A;  3SR1 A;  2SOB A;  4WOR A;  1KAB A;  5C5L A;  5KIX A;  1SYD A;  3MEH A;  4K5W A;  4KJN A;  2PZT A;  1A3V A;  1SYG A;  4RKB A;  5E1F A;  1A3T A;  4G57 A;  1EY5 A;  4J6H A;  4PMB A;  5IOD A;  3MVV A;  1SYB A;  3TP8 A;  2F0F A;  4B9W A;  3T16 A;  5IOC A;  5K5P A;  2F0N A;  2NUC A;  3VA5 A; 
#chains in the Genus database with same CATH topology
 1VQK A;  1CZW A;  1E2Z A;  4DR5 L;  5KND A;  3D31 A;  3BVG A;  4G7H C;  3L2P A;  4A3M G;  5C4X H;  2WKD A;  4R4Q A;  5E4W C;  3QOJ A;  4QUF A;  1EOV A;  5IIF A;  3ND9 A;  3OSO A;  1G6P A;  1B9N A;  4IUT A;  4FVM A;  4MIU A;  4C56 C;  2Q2H A;  2JA7 G;  3AEV A;  1EIF A;  1Z6H A;  4YWL A;  2QA4 A;  1TY0 A;  4QCL A;  3M4Q A;  5LHY 1;  5CV6 A;  1I50 B;  1PZI D;  2N88 A;  3VYT A;  3GTL B;  4CDE C;  4A3C G;  1E2V A;  1AE2 A;  3NSW A;  3A5U A;  3JAM c;  4A3I B;  2BE5 C;  2JQO A;  1YIT A;  3KF8 B;  1S5B D;  1Z47 A;  1HJP A;  1GVP A;  4M8A A;  3I4M H;  3NUC A;  5FLM G;  3K5L A;  5FLX L;  4NXM Q;  2ZM6 Q;  3JC6 6;  3HOX G;  3GTO H;  2UU9 L;  4LUZ A;  3E5S A;  1QZH A;  1U4P A;  1EU4 A;  3M7N A;  5FLX E;  1ASZ A;  2DN8 A;  1WI5 A;  1B3Q A;  3MXN B;  5ELF A;  3CCQ A;  4OX9 L;  1KDC A;  1LTT D;  5C3W A;  2SEB D;  2NYZ D;  3ZYY X;  1BCP D;  4DUZ Q;  1NMG A;  2J4X A;  4LFA L;  4X65 L;  3J7A 5;  2B8F A;  4R4T A;  2CH4 W;  2JJQ A;  4ZRZ A;  1DZ1 A;  1TWG B;  1F9R A;  1VDZ A;  4AYB B;  1QNK A;  1ENF A;  2F4V L;  5CR3 A;  4LNQ A;  2NVY B;  5IYC H;  2JE6 I;  4YHH Q;  5C4J B;  3FHW A;  2I07 B;  1RF2 D;  2YTY A;  1KLG D;  2UUB Q;  1V1P A;  2XGT A;  2XRQ D;  2BA1 A;  2JP1 A;  5JEA J;  1MSG A;  1EQQ A;  2HDM A;  1A3T A;  2UUA L;  1K8A C;  4J6H A;  4IO9 A;  2GVA A;  1Q82 C;  1TVX A;  3CQZ B;  2Z1C A;  5I9O A;  1STA A;  2JXM B;  3BZK A;  1HXY D;  3DM1 A;  5IE8 A;  5FO9 B;  2E5L Q;  2VB3 X;  4K0K L;  1CQV A;  2HHH Q;  1ML0 D;  3ULP A;  1PXU A;  1SE4 A;  2DJG C;  3A8J E;  4GOP A;  4HMI A;  1Q3L A;  2OTL A;  4DR4 Q;  1VQE A;  3PV0 A;  5BN5 A;  1NR4 A;  1SNP A;  3CRL C;  1EIH A;  2PMZ E;  2VZA A;  1Y1V G;  1STG A;  4QGU A;  2QDL A;  2PCF B;  4DV0 Q;  4FNF A;  4HJ9 A;  1QVG A;  4K14 A;  1A62 A;  3H09 A;  5IY0 A;  4A3G G;  4RA8 A;  2SNS A;  1CQF A;  1XNQ Q;  4DR7 Q;  5KNC A;  1M1K C;  4HID A;  4DN4 M;  5M3M B;  2E2I B;  2CW0 C;  1RD9 D;  2LKV A;  4POG A;  4RFB A;  5M3F B;  1UE5 A;  1VCI A;  4P74 A;  1I4H A;  2DY8 A;  3QWN A;  2LXJ A;  3KBX A;  4F7X A;  4ID6 A;  3HKZ E;  5NUC A;  3HG9 A;  1TR5 A;  3P1H A;  4A3G B;  5JJK A;  4LFC Q;  4IPG A;  1J5E L;  2BDN A;  3I7F A;  1QZG A;  2J7Z A;  5C0X I;  2A74 C;  1F2M A;  5FJ8 H;  4OO1 I;  4IUV A;  5IT9 c;  1Y1W B;  1TWF H;  5M5W B;  4DV7 L;  3DEP A;  5C3E G;  1XMO Q;  5EJW A;  5BN3 A;  3Q22 A;  3T1Y L;  1H9M A;  1IKL A;  2NVT B;  3I4N H;  2Q2T A;  4AH6 A;  4ILW A;  2B2W C;  3WWV A;  3IKJ A;  2MP1 A;  1KIX A;  2Q8T A;  2I5H A;  3QIA A;  3ULJ A;  2F0M A;  4KY6 A;  5C3E B;  3CU7 A;  4L63 B;  2BDO A;  4LF8 L;  1D6E C;  2X6L A;  3K6O A;  2DUD A;  1TWA B;  3NEL A;  1WOC A;  2PZU A;  4ZCK A;  3KLS X;  5C44 G;  1Q1B A;  4FF1 A;  4AQY L;  4IN3 A;  2TMP A;  1KL9 A;  4APV A;  4A3L G;  1S5E D;  3KBG A;  1EY9 A;  1T9H A;  1JE5 A;  1W2B A;  4MHE A;  3KF8 A;  1M8A A;  1WTO A;  3TS2 A;  4BS9 A;  1U5K A;  2R7F A;  4DNT B;  5JJZ A;  2WIN B;  5FK9 C;  1R4Q B;  2G9D A;  1CA5 A;  1KDA A;  2V4D A;  5DNF A;  1BO0 A;  3HFZ B;  4OWT B;  2C35 B;  4N8F A;  5M5Y H;  3F8T A;  5FLX c;  4UPA A;  4JBW A;  3NQT A;  4IUN A;  2BH8 A;  3MXN A;  2UXB L;  2NWG A;  3HOV G;  3QJY A;  1MD2 D;  1IW7 D;  2JA5 G;  2EVB A;  4DXG A;  1EL0 A;  1L1O C;  3G7L A;  2VNU D;  1EY7 A;  3MTS A;  1UAP A;  3RD4 A;  1R4P B;  4DV3 L;  1KNE A;  3I72 A;  3MXU A;  4DV1 L;  2VQF L;  4X66 L;  5FOB B;  5H1S E;  3TP7 A;  3EBE A;  3TP5 A;  3H94 A;  1V1O A;  3T56 B;  4C3J B;  3TRE A;  1ICF B;  2VL6 A;  1N34 Q;  2RA4 A;  4O2D A;  1AEX A;  1HZA A;  4CJ0 B;  3GV6 A;  5IGE A;  3PMF A;  5HGT A;  2N3S A;  4DR3 L;  5C4Z A;  4UP7 A;  2WAQ B;  2AHO B;  4GLA C;  1LUZ A;  2KEN A;  3S16 H;  3GTK B;  1FNU A;  2PI2 A;  1BVS A;  3ERO A;  3SK4 A;  1F77 A;  1ONL A;  1L1O A;  1JR0 D;  1KLU D;  4KHP L;  1WCM H;  3F2U A;  3FP9 A;  4KTA A;  1OXX K;  2YYZ A;  3T53 B;  1HQM C;  3D6C A;  3NHH A;  3K8A A;  3TME A;  5JPM C;  2EYP A;  4NKL A;  4JI2 L;  4DAP A;  4C2M H;  4GKJ Q;  4DNI A;  1V9P A;  3AYH B;  1A8V A;  2CH4 A;  5DAU A;  2K5V A;  3M4P A;  3AMU A;  2DNC A;  1HZ9 A;  1VQN A;  2K5D A;  3BJU A;  3V05 A;  1VQB A;  5C4X B;  5C5L A;  1SYD A;  4JCV E;  5IOD A;  1X3F A;  4P75 A;  1FNV A;  3RN2 A;  2F0N A;  4DV6 Q;  1HFN A;  4P73 A;  1IZ6 A;  1SRU A;  2B2T A;  3UI2 A;  1LT6 D;  3M3Y H;  4FP5 D;  1IXR A;  3NEM A;  1N36 Q;  3GV3 A;  3E9I A;  4RGO S;  1U4L A;  3DWQ A;  3CCM A;  1G6Z A;  1DOK A;  2ENB A;  5GRO A;  2UUC Q;  2FJ2 A;  1VS0 A;  4C3I B;  2A1A A;  1R9T H;  3URY A;  5GAE C;  4B3T Q;  1O7Z A;  4K6D A;  4F88 A;  1UE7 A;  3NQI A;  4LF4 Q;  4NDX A;  2JA6 B;  3FEW X;  3K57 A;  4LUV A;  4X3K A;  3HOX H;  2KOL A;  5CGK A;  4MTN A;  4DR6 Q;  1HNW Q;  4J8Q A;  3GTP H;  3I4M B;  3UDI A;  2F0L A;  3OMG A;  1HCZ A;  3CPW A;  3OHX C;  1ASY A;  4CBV A;  4KI0 A;  4DA2 A;  3IAY A;  3GTO B;  4B3M Q;  2RKS A;  5ELC A;  3LX0 A;  4JI8 Q;  4FF3 A;  3EQL C;  5IP9 H;  4H0L C;  5IYC G;  1NAP A;  2WKC A;  4NMZ A;  1S4Z A;  1PHJ A;  1PTO F;  1HR0 W;  3LWE A;  4DR2 L;  5CV9 A;  2VUM B;  1PRT B;  1VQ9 A;  2O5J C;  1KHI A;  3MFG A;  4HCE A;  1WVL A;  4O0A A;  2F52 A;  3KDF B;  4O42 A;  2F0W A;  4JI3 L;  4LWC A;  1K9M C;  2LY7 A;  1OXU A;  3M4O H;  2L5T A;  1SYC A;  3M9B A;  3PQI A;  4IPD A;  4TRD A;  4CDC C;  1RIP A;  5AJ3 Q;  3HGB A;  1EFW A;  2DY7 A;  1CFM A;  4UDU C;  4DAY B;  2R92 H;  5I2X A;  3RZO H;  4X62 L;  4HIM A;  1X6O A;  4ZLT F;  2F0G A;  1QUQ B;  4RGM A;  1BBW A;  3F2B A;  3I8Z A;  3MFY A;  1NJI C;  1BF4 A;  4C1N K;  3GTG H;  4BBS B;  1AZQ A;  3ERS X;  4V19 0;  2EYF A;  3S17 H;  5CBA E;  1KAB A;  1VF7 A;  4A75 A;  4JI0 L;  4GLV B;  1YJ9 A;  3CCU A;  1LAB A;  3PO3 B;  3W1B A;  3NTH A;  5AFW A;  1A15 A;  1CM9 A;  1HZB A;  1TWC H;  4GN3 B;  4KJO A;  4PZ7 A;  3BDO A;  1PZJ D;  1ESR A;  2Q2U A;  3I91 A;  4YCW A;  2RDF A;  2K33 A;  4C3H G;  4A3B H;  1JC7 A;  5FJ8 G;  1SLJ A;  3BYY B;  3I3C A;  4KLK A;  2D0O A;  5ELD A;  4X64 L;  1PFM A;  3S15 B;  2VQE L;  3DHQ A;  3I55 A;  2B2Y C;  3U9O A;  1LT3 D;  4JI1 Q;  2OF1 A;  5EKK A;  2YU9 H;  4CKE A;  4QL5 A;  5CV8 A;  3B6Y A;  3I4N G;  4XQN A;  5I6W A;  1IW7 C;  3L0O A;  1C48 A;  1JWS D;  3HOU H;  4LF9 L;  1OO9 B;  1TWF B;  1W6J A;  4DR1 L;  1BDO A;  1V1Q A;  2IJ0 A;  1PDQ A;  2P5Z X;  2Z6K A;  1O7Y A;  5ELN A;  1VQ5 A;  4I7Z C;  4R4I A;  4L5R C;  1STE A;  1PTO D;  2JYO A;  1STN A;  1LTA D;  3C1F A;  4KHZ A;  3PIO 3;  1U4R A;  1O7I A;  3S14 H;  4EX5 A;  2K32 A;  4KD4 A;  5CC4 A;  2RVL A;  5C44 H;  2CW0 D;  2D2C C;  2PNH A;  2ZJR A;  3AFQ A;  1SMY C;  2CWP A;  2F3I A;  4RKL A;  1GUG A;  3BYT B;  1XMQ L;  1F2L A;  4UP8 A;  2WII B;  2MJ8 A;  1HNX Q;  1HR0 Q;  4BY7 B;  1FVI A;  4DGZ A;  1LT5 D;  3UDX A;  2KHJ A;  5IP7 H;  1EY0 A;  2NVX H;  1N32 Q;  1IL8 A;  1VQA A;  3I2Z A;  4H44 C;  1RL2 A;  1J9O A;  3J7A V;  2PMZ B;  4A93 H;  2L15 A;  4F87 A;  1PH7 A;  3VYR A;  1HHV A;  1LO5 D;  2E75 C;  5BN4 A;  2HQL A;  2ZJQ A;  1DOM A;  4MN3 A;  2HD3 A;  1JQY D;  2NBF A;  3VYU A;  4ULL A;  2K5W A;  1VQM A;  2PO4 A;  3OOC A;  4K5W A;  3HOV H;  2EDG A;  4GNX A;  3RLO A;  3HOY B;  3NBH A;  4B9W A;  1J6Q A;  1Y8N B;  3KJP A;  3M7G A;  4LUO A;  5M5Y B;  3HOW B;  2ICE C;  1UE1 A;  2SNM A;  1XPU A;  4FXK C;  4A3E B;  5JOB A;  4CJ1 B;  4JI4 L;  2UXD L;  3HKZ B;  1WD1 A;  1NE3 A;  4Y7N B;  1XYI A;  1M90 C;  2NN6 I;  4RWS C;  4L6T B;  5D3I B;  1I94 L;  5JAV A;  4GN4 B;  4DV2 L;  4F8M A;  1Y69 U;  2EPB A;  5TSS A;  2EY5 A;  4JBK A;  3KDF A;  2KQ3 A;  3T1H Q;  4CHT B;  1LYL A;  2JN4 A;  3D8G A;  1SNO A;  1X55 A;  1GUN A;  1RDP D;  2VY3 A;  1SNC A;  4IUU A;  3KFU A;  1BXT A;  1YIJ A;  4HAE A;  4B3S Q;  3A56 A;  3BG3 A;  3NBI A;  4DUY L;  1QUQ A;  2K14 A;  4A3K H;  5T1G A;  2HCI A;  3PO2 H;  4JOI A;  2K1B A;  2C9O A;  1BBX C;  3SHL A;  2R7Z G;  3E6Z X;  1WCM G;  2BH2 A;  1LT4 D;  1KXL A;  1IBM L;  2ZT9 C;  5HGQ A;  2JEA I;  2K50 A;  1JIC A;  4K0K Q;  3UDF A;  2F0D A;  1PFN A;  1IKM A;  1AW7 A;  1AFP A;  1I4Q A;  2WAC A;  3RMH A;  5I4D A;  5C0X J;  2QKI C;  3HZX A;  1E1O A;  4EQ5 A;  1KQS A;  3S16 B;  2IX1 A;  2EIF A;  3FKI H;  2JEB I;  3ONA B;  3OW7 A;  3DWA A;  3OPO A;  1WCM B;  3HRZ C;  3EN2 A;  4A3M B;  1F9Q A;  1CTM A;  1F2Y A;  1X32 A;  4YY3 L;  1JJC B;  4TSS A;  2EYH A;  5KNB A;  3HP3 A;  4LF7 Q;  1SN8 A;  4TQU S;  4C2M B;  2K01 A;  1HRJ A;  5BR8 L;  1FGU A;  3J81 L;  5IWA Q;  5C4H A;  3S2H H;  3CCE A;  2JA8 H;  2JA7 B;  3KLS A;  2M9V A;  5E3F A;  3J81 E;  4ALP A;  2EYJ A;  4DAV A;  4JI7 Q;  1CK1 A;  4RG1 A;  1VQ4 A;  2QDB A;  1SNQ A;  4PZ8 A;  3S9W A;  3D0F A;  1HQR D;  2O4X A;  4OL7 A;  3PUZ A;  1UNS A;  4V0B A;  4ME5 A;  3I56 A;  1HNZ Q;  3DEO A;  4KJN A;  4DV4 L;  4RKB A;  1RJT A;  1R9T B;  1EY5 A;  1NNX A;  1K0S A;  3CCJ A;  4GOP C;  5I2Y A;  5IP9 G;  1QE6 A;  3HOX B;  4LF6 Q;  2F0T A;  3NE5 B;  1JOR A;  1N9W A;  2RDH A;  3MC0 B;  1JB3 A;  5K36 H;  1SBB B;  3NTI A;  5LMU Q;  3C3L A;  3OTO Q;  2QIL A;  1QWY A;  4PV1 C;  2QGQ A;  1SR3 A;  4XIG S;  4ABN A;  1DXM A;  2RHQ B;  2NVQ H;  1G2T A;  1VQH A;  3SDZ A;  4LF8 Q;  1HTP A;  3K7U C;  2LSS A;  1RTO A;  3T13 A;  5IGB A;  1FNW A;  2K5Q A;  4RCO A;  4N9P A;  1ZYR C;  3GTM H;  2FIN B;  3Q8D A;  1F2Z A;  4DK0 A;  4CDD C;  2R92 G;  2MQH A;  2CHB D;  4HR7 B;  1K8O A;  1DGS A;  1GUS A;  3MXP A;  5EKI A;  4WFN 3;  3A74 A;  3TQY A;  4X3T A;  4NPS A;  1HPC A;  1ET9 A;  3J81 i;  4GN5 A;  4Z9C B;  4OEL B;  4JBM A;  3EA6 A;  3GD7 A;  3M4O B;  1PTO C;  1E7Z A;  2AWO A;  2EZV A;  2ASB A;  4EVO A;  2B63 H;  1YNJ C;  2AQ3 B;  2R92 B;  3RZO B;  1Z7T A;  4NXN Q;  3Q24 A;  3S1Q H;  2QEX A;  4BBR H;  3G6J B;  2Z8L A;  2A6H C;  3C2P A;  2NZ1 D;  1XNR L;  3SE0 A;  3VR5 A;  1CUK A;  4PMW A;  2GN5 A;  4YCU A;  1Y1V B;  4A3B G;  1EYA A;  3KJO A;  4ZYS A;  3MA2 B;  5KYL A;  4C3H H;  3NP8 A;  4DV1 Q;  2PQA B;  3CD6 A;  4OIK A;  1K0R A;  1TWC B;  1HA6 A;  5M5X B;  4IJH A;  2EJG C;  3D4W A;  3I73 A;  3SK6 A;  5C0X H;  1EWI A;  4OO1 H;  2E2J H;  4JI5 Q;  1EY6 A;  4A3B B;  3SR1 A;  5J3B A;  2Z9H A;  4ZKC B;  3HOU G;  1JE4 A;  2GVB A;  3A5Z B;  4NXM L;  2ZM6 L;  1I5F A;  1D8L A;  3KOJ A;  1P16 A;  2HIV A;  1BCP B;  1K83 B;  1PRT F;  2AQ1 B;  4EQP A;  1OXT A;  3DLL A;  3OIQ A;  3W3A A;  1FJG Q;  3ICE A;  2HCC A;  3CC2 A;  1AH9 A;  3IFT A;  1EYC A;  3L3O C;  4DUZ L;  1EWC A;  4R4O A;  1C0A A;  1MJE A;  1I4R A;  1JOQ A;  3DXJ C;  4K5X A;  5IGG A;  1G51 A;  1NTG A;  1ICW A;  4YHH L;  1H9K A;  2EE1 A;  3S14 B;  3GTQ B;  3A7A B;  2RHS B;  3RZD H;  2UUB L;  2RBM A;  5IP7 G;  3J81 c;  3QR8 A;  3K81 C;  2A73 B;  3T4A C;  3RN5 A;  4XDX A;  1XJV A;  4A93 G;  2E74 C;  5C44 B;  1N8R C;  1CI3 M;  1IL2 A;  4G7O C;  4XT3 B;  2JA9 A;  1DJR D;  3BVZ A;  1L0X B;  4DK6 C;  1NUC A;  5LMN W;  2E5L L;  5L37 A;  3I4O A;  2HHH L;  3NK9 A;  4PMC A;  1YHB A;  3G71 A;  1D7Q A;  4DR4 L;  1PZK D;  1QOH A;  2DJF C;  4ODG A;  2B3G A;  4IJL A;  4BY1 H;  1ET6 A;  3SXH A;  2AKW B;  5HUR A;  4A93 B;  3J7A F;  1I3Q H;  2Q8R E;  4DV0 L;  2CCZ A;  4A3F H;  4U67 3;  4JVZ A;  1XNQ L;  4DR7 L;  3V96 A;  2JSO A;  3W2D A;  2RCN A;  3CHB D;  1VQF A;  1TS5 A;  3GQB A;  2MUY A;  3K0Y A;  3TP8 A;  1DCZ A;  3BZC A;  3HOV B;  5KRU A;  1Q86 C;  4BA2 I;  4BXX H;  1WTQ A;  2JA5 B;  2EYM A;  3I4L A;  1ILQ A;  1EEF D;  1G91 A;  2IX3 A;  1PMR A;  1SMY D;  4LFC L;  4A3K G;  1PH4 A;  3PO2 G;  2KCM A;  1H95 A;  1LTR D;  2B2T C;  1PYS B;  1PTO H;  1YHA A;  5FO8 B;  1K28 A;  2KCN A;  1NCV A;  2OT2 A;  3FMC A;  5IOC A;  2E8G A;  2R7Z H;  3BS1 A;  1B9M A;  1G29 1;  1IBK Q;  1KAW A;  1OTC A;  2PPB C;  3CRK C;  2A68 C;  5D14 A;  1XMO L;  3PUW A;  4K8J A;  3FKI G;  3ND8 A;  3D3R A;  1VQG A;  1VQ8 A;  2IHE A;  3PO2 B;  3G4S A;  3Q6S A;  5CV4 A;  3K80 C;  2VB2 X;  1N33 Q;  1YHQ A;  4HTH A;  4WRD A;  2NB0 A;  2IWH A;  1PH3 A;  5CV5 A;  1TS2 A;  4DV5 L;  5I6Y A;  1I4X A;  3K0X A;  4JI0 Q;  3ER0 A;  1VMP A;  1E0B A;  1YJW A;  2PQA A;  1SNM A;  3F1Z A;  1U4M A;  2O2L D;  4LMQ D;  2JA8 G;  3H91 A;  4YWK A;  3K5M A;  1JOO A;  1SAP A;  2L55 A;  2PZW A;  1CKM A;  4A3I H;  2LMC B;  5GAG C;  4YCV A;  1PH9 A;  3TDQ A;  5GAD C;  3I90 A;  4LFB Q;  1YVC A;  4I65 A;  3S2H B;  5LL6 X;  3MAQ A;  2KEC A;  3DUZ A;  1VQI A;  1Q7Y C;  1B70 B;  3CP0 A;  4KK7 A;  1D2B A;  4HJ7 A;  4TVA B;  3GDE A;  4XQQ A;  2QF7 A;  4GLX A;  2X69 A;  2VS1 A;  4PZ6 A;  1K3B C;  1QJO A;  5LMN Q;  4K8I A;  1XTC D;  1GJX A;  2A19 A;  1W3S A;  3W5O A;  5J39 A;  5K36 G;  1TWH H;  1GKH A;  1K8G A;  1X54 A;  3D4D A;  4DF7 A;  5DM6 3;  3L7Z C;  3RR5 A;  2NVY H;  3PUV A;  2R6G A;  1EQT A;  1PH6 A;  1VQL A;  4DKA C;  1H9J A;  1TII D;  2HIX A;  4XT1 B;  1V43 A;  4FF2 A;  2EYO A;  1T5X D;  4HMJ A;  2QW7 A;  3CQZ H;  4WJ4 A;  1MJC A;  1VQC A;  4G57 A;  4OON A;  2MO1 A;  1D5Z C;  1H9S B;  3E9H A;  1KD1 C;  4GKK Q;  2UXC Q;  1EYD A;  3OIP A;  2G5D A;  3S2D H;  3QOL A;  3CF5 A;  1ENC A;  1FR3 A;  2B63 G;  4IUP A;  1SE3 A;  1QCB D;  3RLF A;  1S72 A;  2HT1 A;  3SK5 A;  4IPC A;  4BBR G;  4LF5 Q;  4JI6 Q;  4PG3 A;  1K73 C;  1WTX A;  2ZXO A;  3OMC A;  1SE8 A;  1S5F D;  2F0P A;  2E2I H;  5M3M H;  5ISR A;  3FPP A;  1CHQ D;  4GKJ L;  4JV5 Q;  3LNN A;  4IUR A;  5M3F H;  2L12 A;  2HQE A;  1B50 A;  2AUK A;  3GP7 A;  2N49 A;  2PNR C;  3MWY W;  5CYU A;  3IL8 A;  1F9P A;  3MZ5 A;  1OXV A;  2Z6K C;  2KVM A;  1KC8 C;  2Z4I A;  1CSP A;  1IYJ B;  1NBW A;  1HTL D;  3M85 A;  2MPM A;  1PFS A;  1SYF A;  1AP0 A;  1VQP A;  1UUP A;  4DV6 L;  1IBL Q;  1VQ6 A;  3R2T A;  2D5D A;  1NR2 A;  1ENA A;  1WD0 A;  2F0I A;  5C0X G;  3BVM A;  4OO1 G;  1N36 L;  1Y1W H;  2XN9 C;  4HIK A;  1F9S A;  3C46 A;  3NWS A;  1ZYR D;  5JJL A;  2UUC L;  2I5M X;  4C3H B;  2IT1 A;  1Y8P B;  1LLR D;  2MFI A;  4JYA Q;  4L5Q A;  3HKS A;  4B3T L;  4DR5 Q;  4FXD A;  4DUY Q;  2PW5 A;  2KEE A;  3L9A X;  4LF4 L;  3ULL A;  3PF4 A;  5EGT A;  2B2V A;  2IL8 A;  3TS0 A;  1SFO H;  4IFD I;  3TZU A;  1DM0 B;  2CKZ B;  1YZ6 A;  4DAM A;  2RDG A;  4S3S A;  1L2F A;  1A0I A;  3ZJY C;  4DR6 L;  4L5S A;  1YNJ D;  3I4N B;  4QMG A;  1EZ6 A;  1MHW C;  4R9W A;  2EJF C;  4B3M L;  2R7D A;  3VR4 A;  4JI8 L;  4ZAI A;  2B2U A;  2A6H D;  3LWU A;  4GNX C;  1HA5 A;  3AU7 A;  2NTS A;  3NPP A;  4ZUJ A;  3A55 A;  2F1M A;  1DYQ A;  2HDL A;  4OWX B;  4DPG A;  4KKU A;  2WB1 G;  2FXQ A;  1B1Z A;  5GQO A;  3D6W A;  4A3D H;  1PRT C;  1M4V A;  5EBD A;  3N6R A;  3VR3 A;  1UEB A;  4FF4 A;  2B29 A;  1Q81 C;  3RNU A;  5AJ3 L;  1YI2 A;  2N78 A;  1UEA B;  2CFM A;  1S5D D;  2A6E C;  2UU9 Q;  3SK8 A;  1ESF A;  3H0G H;  4WJ3 M;  3E3X A;  4IAL A;  3STB C;  4BY1 G;  3CCL A;  2F4I A;  1FGB D;  4JOI C;  4FXG C;  4A3F G;  1T5E A;  3E0J A;  2X6G A;  3AFP A;  5E7N A;  4H7B A;  1GD7 A;  1L0W A;  1LTB D;  1G8Z D;  3CMA A;  1VF5 C;  4OX9 Q;  1EZ8 A;  3A8I E;  4N8X 1;  4QQB X;  1WTV A;  4LFA Q;  5JVH 3;  1IYU A;  3KYH C;  4J1M A;  4X65 Q;  3PSI A;  4BXX G;  1IYV A;  2NN6 H;  3X3M A;  1XPO A;  3NEN A;  3VYS A;  4JPB W;  2MHV A;  2AMC B;  2F4V Q;  3TBI B;  2RQX A;  1C7Y A;  3WDN A;  1ZKO A;  3U9S A;  2V1C C;  1GXD C;  4DAY A;  2N8N A;  1EQV A;  4A4I A;  2MNA A;  3K58 A;  1H9S A;  2E2H H;  1Q12 A;  1BCP F;  2IX0 A;  3H3V I;  5A35 A;  1TQO A;  1PA6 A;  3VA7 A;  2UUA Q;  1K3R A;  1NMF A;  2M00 A;  4PNY A;  2KBN A;  1SJE D;  1RKN A;  1EEI D;  3GTJ H;  4KV6 A;  1SXT A;  2L11 A;  4JI1 L;  4QJF A;  2F03 A;  1VQO A;  3MEF A;  4XQJ A;  4MTK A;  2ATW A;  2PQE A;  4UAI A;  2Q8I B;  2R3Z A;  2L4N A;  2FHT A;  1C8C A;  1PTO B;  4OIJ A;  5J22 A;  3P75 A;  2O5I C;  1Y14 B;  3PIP 3;  1BNZ A;  2MGS A;  1KNA A;  1EYG A;  3G6E A;  3NXW A;  2R7Z B;  3A0J A;  1A63 A;  2OCE A;  2ALY B;  5EPK A;  2FFK B;  3PIO A;  2A5H A;  1E1T A;  1VQ7 A;  1P8L A;  4CGY B;  3CME A;  5EPJ A;  1JB7 A;  2K03 A;  2F0J A;  2EJM A;  1KRT A;  3WOE A;  2XVS A;  5KIX A;  1XNR Q;  1LTI D;  4B3R L;  2K5H A;  1AN8 A;  3OYY A;  4GZY C;  4UY8 C;  3X3N A;  4A3I G;  1XWE A;  4IQZ A;  3RUZ A;  4X3U A;  3KK7 A;  5KGU A;  4C3I H;  2H1E A;  2I0Q A;  3I70 A;  4CJ2 C;  4EQO A;  1J5E Q;  1U9R A;  1Q8I A;  5ELE A;  2A69 C;  1SYE A;  1HNX L;  1HR0 L;  2K52 A;  1I6H H;  1X56 A;  1B8A A;  1B44 D;  3M3Y B;  4JBJ A;  2JA6 H;  3R3O A;  2F0U A;  4OXP A;  1BQQ T;  1LTG D;  5JPN C;  2Z6B A;  1N32 L;  4DV7 Q;  4EQN A;  2ZJP A;  5GAH C;  2F0H A;  1EOT A;  3E0E A;  3T1Y Q;  1XXG A;  2K04 A;  2Q2I A;  1PH5 A;  3PCO B;  1TU2 B;  3MHB A;  4HSV A;  1A2U A;  2R61 A;  2NTT A;  2A68 D;  5D3D A;  4B08 A;  3CC7 A;  3S1N H;  4AYB G;  3DM3 A;  3S1M H;  1SRO A;  1X3E A;  5LL6 S;  3GTP B;  4XYO A;  1WTR A;  1SJH D;  2RCF A;  4RAU C;  3C1E A;  1DD2 A;  1C4Q A;  2I5L X;  1MBY A;  4TKO B;  3V2T A;  1KTK A;  2VUM H;  3TP6 A;  2OQ0 A;  2YTV A;  3UE0 A;  4AQY Q;  5EPL A;  1TWH B;  3A54 A;  1LV9 A;  4RGN A;  1CKN B;  5DM7 3;  4FO2 A;  5C6A A;  3T1H L;  4KD3 A;  2WP8 J;  3CKI B;  5J1Z A;  1JCK B;  1MGS A;  2E2D C;  1VQJ A;  3IFD A;  4B3S L;  4HCS A;  2RSN A;  2SDF A;  1A2T A;  1TXY A;  1B4O A;  2B39 A;  3ITP A;  4ME3 A;  4U68 A;  3Q23 A;  1EY4 A;  2WV6 D;  4BBS H;  4DK1 A;  3GO5 A;  1ROD A;  1WTP A;  3M4Y A;  4UP9 A;  5M3M G;  1HZC A;  2WB1 E;  2UXB Q;  3OW2 A;  1GUW A;  2H4O A;  5DEH A;  2BOS A;  3S2D B;  3N52 A;  3PIP A;  5M3F G;  1LM0 A;  3PO3 H;  1L1O B;  1H9R A;  3GTG B;  4K6L A;  2EQS A;  2BA0 A;  2IW3 A;  1EUJ A;  1GUO A;  1SYB A;  3TN2 A;  5K5P A;  4HSP A;  4DV3 Q;  2NUC A;  3J7Y W;  3S17 B;  2R93 H;  3U50 C;  2VQF Q;  3UDG A;  1W6K A;  4YWM A;  4X66 Q;  1ZXT A;  3U4Z A;  4LF7 L;  3QO2 A;  1UE6 A;  1STB A;  4HJA A;  1Y1W G;  3CW2 C;  2EY2 A;  3VR2 A;  3S15 H;  3PUX A;  5IWA L;  1TY2 A;  4K5V A;  1O7L A;  2D9U A;  1ILP A;  1MSH A;  4I7A A;  1I4P A;  2EOT A;  2CQA A;  3BU2 A;  4R8N A;  1MI2 A;  4XYQ A;  2E76 C;  2QEJ C;  4DR3 Q;  5IGD A;  2Y0S E;  4JK1 C;  4JI7 L;  2KCC A;  5M9O A;  4L8J A;  1JWM D;  2H5X A;  3A8K E;  2K6A A;  3PGZ A;  2M2L A;  4Q0F A;  3R8B A;  4IFD G;  4KHP Q;  1QIL A;  2CWA A;  2HUG A;  4N9T A;  5KEE A;  4UHV A;  1HNZ L;  4E6I A;  2YU9 B;  1SSO A;  1CA6 A;  2EXZ A;  3UE1 A;  1E22 A;  1SMX A;  2N55 A;  1MKH A;  5IGC A;  4JI2 Q;  3HOU B;  1YNN C;  2EYL A;  1YJN A;  3KUP A;  1PH8 A;  4KKS A;  3DMU A;  1SFO B;  3J80 L;  4HED A;  4LF6 L;  3QG1 A;  4Q5V A;  3K5O A;  4DV5 Q;  4OEM B;  5LMU L;  3EFX D;  3OTO L;  4GS3 A;  2ICI A;  3J80 E;  3AB9 A;  4QIW B;  1TKW B;  3R2I A;  2ZTC A;  1QNU A;  3S1R H;  4LK1 C;  4A3D G;  4HJ5 A;  1BKB A;  5IYD G;  4BY7 H;  4DU9 A;  1HFG A;  1GOZ A;  2XRS D;  1TT2 A;  3T51 B;  2NZO A;  5CBE E;  3H15 A;  5T1I A;  4OGQ C;  3K7A H;  4IPH A;  2C5C A;  4RHR A;  5C3X A;  4EGV A;  3H0G G;  2CVR A;  1D1K A;  3NWT A;  4ZQ3 A;  1A6X A;  4YIJ A;  4DK3 C;  4A3D B;  4A3J H;  2NVX B;  2B2W A;  3HOZ H;  1X65 A;  2A8V A;  3HOY H;  2WFW A;  1HH2 P;  2SOB A;  1HUM A;  3HOW H;  3KF6 B;  1X3P A;  5JVG 3;  3FPU B;  5E1F A;  4NXN L;  4AIM A;  4A3E H;  4PMB A;  4CKB A;  1DOL A;  3H0G B;  4Y7N H;  1X3G A;  2NN6 G;  1I6V C;  4C3J G;  1GHK A;  1X9N A;  1DON A;  1A3U A;  4ZKB B;  4R1J A;  4DNR B;  5JEA H;  1CKN A;  3HEJ A;  1EQR A;  2LXK A;  4KN4 C;  4DR2 Q;  3O13 A;  3D4R A;  2TSS A;  1E3P A;  2L9H A;  2WAQ G;  5IYB H;  3J80 i;  1X3Q A;  2K28 A;  3DWP A;  4JI3 Q;  2XSC A;  4PQX A;  4AYB E;  3F2C A;  4RH6 A;  2DGY A;  1EIY B;  1D5X C;  1UWV A;  1Z9F A;  2F0V A;  5HY6 A;  1PRT D;  1I4G A;  2F3W A;  3OWF A;  4X62 Q;  3ERQ A;  4JI5 L;  1KDB A;  3TEH B;  2JK8 A;  4HIO A;  1LTS D;  2E2H B;  2KHS A;  2RSO A;  1FL0 A;  3OWE B;  3J7Z C;  1NY4 A;  4IUQ A;  1RTN A;  4KHV A;  4A3K B;  1WYD A;  2B8G A;  4R4C A;  3GTJ B;  4KY5 A;  2A6E D;  5CMD A;  1BBU A;  2ZXR A;  5C4X G;  3AQQ A;  3STB D;  1LTL A;  2XNA C;  1SEB D;  4A76 A;  1BCP C;  4A3M H;  4X6A H;  2L1B A;  1OXS C;  2PI2 E;  3EIV A;  4ZK9 B;  1PV4 A;  1YNX A;  1FJG L;  1I50 H;  4IFD J;  3GTL H;  1WFQ A;  4JG2 A;  2NZH A;  3FKI B;  4MNO A;  2XTI A;  4G7Z C;  1PVO A;  2LS0 1;  2EXD A;  2F0K A;  1O78 A;  4C3I G;  2D0P A;  3EJI A;  2EY1 A;  2JA7 H;  3LGJ A;  2PW7 A;  2K5N A;  4X64 Q;  2IY5 B;  2JA6 G;  2EY6 A;  2VQE Q;  1MIU A;  1AE3 A;  2D62 A;  5C5M A;  5A2Q L;  2MO0 A;  4MZ9 A;  4A3C H;  1B7Y B;  3HS0 C;  1LAC A;  4HJ8 A;  2JA8 B;  1XX8 A;  3SGI A;  2F0E A;  1Q8K A;  1QVC A;  3I4M G;  4K2K A;  5COR A;  5A2Q E;  4RMF A;  3TZD A;  1VQD A;  1B3A A;  4H13 C;  1QB5 D;  1I6H B;  1EFI D;  4LF9 Q;  3IRB A;  1E2W A;  1QG7 A;  1A3V A;  5E4X A;  5FLM H;  1V8Q A;  3MVV A;  4DR1 Q;  1VMC A;  3T16 A;  2KHI A;  1TWG H;  3K5N A;  1STH A;  3BDC A;  2KUM A;  5C4J H;  5FKA C;  1Q90 A;  2VUM G;  5DLQ E;  1ZEQ X;  2AQ2 B;  1PYW D;  4CDF C;  2OQK A;  2AWN A;  3J80 c;  3KLR A;  3MXG A;  5JJI A;  5CV7 A;  4XXE A;  5IGF A;  4LJZ C;  4GNX B;  2FMM A;  4P72 A;  4X3S A;  3NBH B;  3S1N B;  5EQ0 A;  3NTK A;  2ZXP A;  3S1M B;  4QIW E;  1N34 L;  1EU3 A;  4KN7 C;  2NVQ B;  2FMC A;  4C1N I;  1XMQ Q;  2ZTD A;  4L5T A;  3FRP B;  2AUJ D;  4B9X A;  1BOS A;  3QB3 A;  3CCR A;  4CKC A;  2KCT A;  2VXW A;  3PF5 A;  3GTM B;  2PYK A;  2A69 D;  1O80 A;  3U58 A;  1GO3 E;  4BBS G;  1B2T A;  3H3V C;  1EWH A;  1GHJ A;  2XIW A;  4RGT A;  5G3L F;  5I9P A;  2KED A;  1IBK L;  1AZP A;  1K8M A;  3FDT A;  5ELB A;  3KF6 A;  3PO3 G;  1JT8 A;  3S24 A;  2BE5 D;  1FD7 D;  4P71 A;  4OWW B;  4KMU C;  4G4K A;  4POF A;  2IPK D;  5ELO A;  2Z4H A;  3SVM A;  4K2L A;  2B2V C;  1KAA A;  4QB4 A;  1BUV T;  3CXC A;  2B63 B;  1N33 L;  5COY A;  1TS4 A;  2R93 G;  1SDF A;  1Y1V H;  3S1Q B;  3J81 j;  4JI4 Q;  2UXD Q;  2J0T D;  2G9H D;  4BBR B;  4A3G H;  2L0C A;  3F2D A;  1I94 Q;  1D5M C;  1Q46 A;  5F2D A;  4DV2 Q;  4RCN A;  5EKL A;  4BA1 I;  5EBC A;  5FO7 B;  1GM5 A;  2F0Q A;  5M5X H;  5M5W H;  3Q0A A;  4QF4 A;  1WTH A;  2B2U C;  3R93 A;  1JWU D;  4ZUI A;  2XWB B;  2ID0 A;  4BWG B;  4H02 A;  1PYB A;  1CT1 D;  1SND A;  3JAM L;  2R93 B;  1U0L A;  1STY A;  1GUT A;  1D1I A;  1JMC A;  2NVT H;  1WJJ A;  3JAM E;  4LFB L;  2YTX A;  1WTW A;  4FDB A;  1IBM Q;  1SYG A;  4HN7 A;  1CZG A;  3P20 A;  3CCS A;  1L0Y B;  2XWJ B;  1K83 H;  2E2J B;  4LW1 A;  4IFD H;  1Q1E A;  2BCO A;  1HNW L;  2PZT A;  3VA5 A;  1S5C D;  2WAQ E;  5C3E H;  1IHZ A;  5LMN L;  5EAY A;  1TWA H;  3TRZ A;  2I46 A;  2DNE A;  4RHS A;  1RCV D;  2CQO A;  3VDY A;  2OTJ A;  3U4V A;  1S40 A;  3EVQ A;  1PH1 A;  4QUC A;  2K4K A;  1KRS A;  4KY7 A;  3BZD B;  1SE2 A;  2K7V A;  1BR9 A;  1FYC A;  4YY3 Q;  4BY7 G;  4O1N A;  1B53 A;  4Y52 H;  4P2C B;  3GTQ H;  3KLW A;  2YV5 A;  3WOF A;  5BR8 Q;  4B3R Q;  1II3 A;  5IYD H;  4DFA A;  4NP5 A;  2B2Y A;  2KJX A;  2Z0S A;  5KYI A;  2ZTE A;  1PH2 A;  2K05 A;  2F3V A;  4A3L H;  4KKT A;  1V1P B;  3VR6 A;  5G3L D;  3RZD B;  1E24 A;  2LFN A;  3S1R B;  2GA4 B;  4WJW A;  2F0S A;  4A3J G;  1JOK A;  3FVQ A;  4GKK L;  2UXC L;  3G48 A;  4NW2 A;  1XTD A;  4QY7 A;  3HOZ G;  1S3O A;  2WB1 B;  1YBY A;  2F0O A;  2OEO A;  2QCP X;  1CHP D;  3HOY G;  1HUN A;  3JAM i;  3K59 A;  5D65 A;  4DV4 Q;  3HOW G;  3K7A B;  4A3E G;  1Y8O B;  1TS3 A;  3HKZ G;  1JJG A;  4GOP B;  1C9O A;  1NSN S;  1JJ2 A;  4JI6 L;  3PUY A;  4LF5 L;  2Y0S G;  1PLF A;  3W1G A;  2K75 A;  2OXP A;  3P7J A;  4A3J B;  3CCV A;  1CKO A;  1RHP A;  3TSS A;  3HOZ B;  5JEA G;  4BY1 B;  4JV5 L;  1YNN D;  4C3J H;  1XPR A;  1I3Q B;  2IHF A;  4JW0 A;  4A3F B;  4IOA A;  1PFB A;  2KA7 A;  2JA5 H;  1EY8 A;  4FYD A;  4R8I A;  1G2S A;  4IZ8 A;  5IYB G;  4DXF A;  2OWO A;  2VW9 A;  4LAA A;  4JC0 A;  1QVF A;  2Y0S B;  4M1U B;  3RLN A;  1IBL L;  4J15 A;  3GTK H;  3SEB A;  1CSQ A;  2ES2 A;  3H3V H;  3BDL A;  4XTC S;  2RF4 A;  3H6M A;  5IT9 L;  3CC4 A;  3A7L A;  4WOR A;  3CPF A;  4IOC A;  3MEH A;  1J8I A;  4OHJ A;  1YEZ A;  4NB3 A;  3CAM A;  2F0F A;  5IT9 E;  4JYA L;  1EIG A; 
#chains in the Genus database with same CATH homology
 1CZW A;  1E2Z A;  5KND A;  3D31 A;  3BVG A;  4G7H C;  2WKD A;  5E4W C;  3QOJ A;  4QUF A;  5IIF A;  3ND9 A;  3OSO A;  1B9N A;  4IUT A;  4FVM A;  4MIU A;  4C56 C;  1Z6H A;  1TY0 A;  4QCL A;  5LHY 1;  5CV6 A;  1I50 B;  1PZI D;  2N88 A;  3VYT A;  3GTL B;  1E2V A;  3NSW A;  4A3I B;  2BE5 C;  1S5B D;  1Z47 A;  4M8A A;  3NUC A;  3K5L A;  5FLX L;  3E5S A;  1U4P A;  1EU4 A;  3M7N A;  5FLX E;  2DN8 A;  5ELF A;  1KDC A;  1LTT D;  5C3W A;  2SEB D;  2NYZ D;  3ZYY X;  1BCP D;  2J4X A;  2B8F A;  1DZ1 A;  4ZRZ A;  1TWG B;  1F9R A;  1VDZ A;  4AYB B;  1QNK A;  1ENF A;  5CR3 A;  2NVY B;  2JE6 I;  5C4J B;  2I07 B;  1RF2 D;  1KLG D;  1V1P A;  2XRQ D;  2BA1 A;  2JP1 A;  5JEA J;  1MSG A;  2HDM A;  1A3T A;  4J6H A;  1TVX A;  3CQZ B;  2Z1C A;  5I9O A;  1STA A;  2JXM B;  1HXY D;  3DM1 A;  5FO9 B;  2VB3 X;  1CQV A;  1ML0 D;  1PXU A;  1SE4 A;  3A8J E;  4HMI A;  1Q3L A;  5BN5 A;  3PV0 A;  1NR4 A;  1SNP A;  3CRL C;  1EIH A;  1STG A;  2PCF B;  4FNF A;  4K14 A;  3H09 A;  4RA8 A;  2SNS A;  1CQF A;  5KNC A;  4DN4 M;  5M3M B;  2E2I B;  2CW0 C;  1RD9 D;  2LKV A;  4RFB A;  5M3F B;  1VCI A;  1I4H A;  2DY8 A;  3QWN A;  4F7X A;  3KBX A;  4ID6 A;  5NUC A;  3HG9 A;  1TR5 A;  3P1H A;  4A3G B;  2BDN A;  2J7Z A;  5C0X I;  2A74 C;  1F2M A;  4OO1 I;  4IUV A;  1Y1W B;  5M5W B;  3DEP A;  5EJW A;  5BN3 A;  3Q22 A;  1H9M A;  1IKL A;  2NVT B;  4ILW A;  2B2W C;  3IKJ A;  2MP1 A;  2Q8T A;  3QIA A;  2F0M A;  4KY6 A;  5C3E B;  3CU7 A;  4L63 B;  2BDO A;  1D6E C;  2X6L A;  3K6O A;  1TWA B;  2PZU A;  3KLS X;  4FF1 A;  1Q1B A;  4IN3 A;  2TMP A;  1S5E D;  3KBG A;  1EY9 A;  4MHE A;  3KF8 A;  1M8A A;  1WTO A;  4BS9 A;  4DNT B;  5JJZ A;  2WIN B;  5FK9 C;  1R4Q B;  2G9D A;  1CA5 A;  1KDA A;  2V4D A;  5DNF A;  1BO0 A;  4JBW A;  3NQT A;  4IUN A;  3MXN A;  2NWG A;  3QJY A;  1MD2 D;  1IW7 D;  2EVB A;  4DXG A;  1EL0 A;  3G7L A;  2VNU D;  1EY7 A;  3MTS A;  1UAP A;  3RD4 A;  1R4P B;  1KNE A;  3I72 A;  3MXU A;  5FOB B;  3TP7 A;  3TP5 A;  3H94 A;  1V1O A;  3T56 B;  4C3J B;  2RA4 A;  1AEX A;  4CJ0 B;  3GV6 A;  5IGE A;  3PMF A;  5HGT A;  5C4Z A;  2WAQ B;  3GTK B;  1FNU A;  3SK4 A;  3ERO A;  1F77 A;  1ONL A;  1JR0 D;  1KLU D;  3F2U A;  4KTA A;  1OXX K;  2YYZ A;  3T53 B;  1HQM C;  3D6C A;  3NHH A;  3TME A;  5JPM C;  2EYP A;  4NKL A;  4DAP A;  5DAU A;  3AMU A;  2DNC A;  2K5D A;  3V05 A;  5C4X B;  5C5L A;  1SYD A;  5IOD A;  1FNV A;  2F0N A;  1HFN A;  2B2T A;  3UI2 A;  1LT6 D;  4FP5 D;  3GV3 A;  4RGO S;  1U4L A;  3DWQ A;  1G6Z A;  1DOK A;  2ENB A;  2FJ2 A;  4C3I B;  3URY A;  1O7Z A;  4K6D A;  4F88 A;  3NQI A;  4NDX A;  2JA6 B;  3FEW X;  3K57 A;  4X3K A;  2KOL A;  5CGK A;  4J8Q A;  3I4M B;  2F0L A;  3OMG A;  1HCZ A;  3OHX C;  4CBV A;  4KI0 A;  4DA2 A;  3IAY A;  3GTO B;  2RKS A;  5ELC A;  3LX0 A;  4FF3 A;  3EQL C;  4H0L C;  1NAP A;  2WKC A;  4NMZ A;  1S4Z A;  1PTO F;  3LWE A;  5CV9 A;  2VUM B;  1PRT B;  2O5J C;  4HCE A;  3MFG A;  1WVL A;  4O42 A;  2F0W A;  2LY7 A;  1OXU A;  2L5T A;  1SYC A;  4TRD A;  3HGB A;  2DY7 A;  1CFM A;  4UDU C;  5I2X A;  4ZLT F;  2F0G A;  4RGM A;  3I8Z A;  3MFY A;  1BF4 A;  4C1N K;  4BBS B;  1AZQ A;  4V19 0;  2EYF A;  5CBA E;  1KAB A;  1VF7 A;  1LAB A;  3PO3 B;  5AFW A;  3NTH A;  1A15 A;  1CM9 A;  4KJO A;  3BDO A;  1PZJ D;  1ESR A;  3I91 A;  2RDF A;  2K33 A;  4C3H G;  1JC7 A;  3BYY B;  3I3C A;  5ELD A;  1PFM A;  3S15 B;  3DHQ A;  2B2Y C;  3U9O A;  1LT3 D;  2OF1 A;  5EKK A;  4CKE A;  5CV8 A;  4XQN A;  5I6W A;  1IW7 C;  1C48 A;  1JWS D;  1OO9 B;  1TWF B;  1W6J A;  1BDO A;  2IJ0 A;  1PDQ A;  1O7Y A;  4I7Z C;  1STE A;  1PTO D;  2JYO A;  1STN A;  1LTA D;  3C1F A;  4KHZ A;  3PIO 3;  1U4R A;  2K32 A;  4KD4 A;  5CC4 A;  2RVL A;  2CW0 D;  2D2C C;  1SMY C;  4RKL A;  1GUG A;  3BYT B;  1F2L A;  2WII B;  2MJ8 A;  4BY7 B;  4DGZ A;  1LT5 D;  1EY0 A;  1IL8 A;  4H44 C;  1J9O A;  3J7A V;  2PMZ B;  4F87 A;  3VYR A;  1HHV A;  1LO5 D;  2E75 C;  5BN4 A;  1DOM A;  4MN3 A;  1JQY D;  2NBF A;  3VYU A;  4ULL A;  2K5W A;  2PO4 A;  3OOC A;  4K5W A;  2EDG A;  3HOY B;  3NBH A;  4B9W A;  1Y8N B;  3M7G A;  5M5Y B;  3HOW B;  2ICE C;  2SNM A;  4FXK C;  4A3E B;  5JOB A;  4CJ1 B;  3HKZ B;  1WD1 A;  4Y7N B;  1XYI A;  2NN6 I;  4RWS C;  4L6T B;  5D3I B;  5JAV A;  4F8M A;  1Y69 U;  2EPB A;  5TSS A;  2EY5 A;  2KQ3 A;  4CHT B;  3D8G A;  1SNO A;  1GUN A;  1RDP D;  1SNC A;  4IUU A;  1BXT A;  4HAE A;  3A56 A;  3BG3 A;  3NBI A;  5T1G A;  2HCI A;  2K1B A;  2C9O A;  1BBX C;  3SHL A;  3E6Z X;  1LT4 D;  2ZT9 C;  2JEA I;  1JIC A;  2F0D A;  1PFN A;  1IKM A;  1AW7 A;  1AFP A;  1I4Q A;  2WAC A;  3RMH A;  5I4D A;  5C0X J;  2QKI C;  3HZX A;  3S16 B;  2IX1 A;  2JEB I;  3ONA B;  3OW7 A;  3DWA A;  3OPO A;  1WCM B;  3HRZ C;  4A3M B;  1F9Q A;  1CTM A;  1F2Y A;  1X32 A;  4TSS A;  2EYH A;  5KNB A;  3HP3 A;  4TQU S;  4C2M B;  2K01 A;  1HRJ A;  3J81 L;  5C4H A;  2JA7 B;  3KLS A;  2M9V A;  5E3F A;  3J81 E;  2EYJ A;  4DAV A;  1CK1 A;  2QDB A;  1SNQ A;  3S9W A;  1HQR D;  4OL7 A;  2O4X A;  3PUZ A;  1UNS A;  4V0B A;  4ME5 A;  3DEO A;  4KJN A;  4RKB A;  1RJT A;  1R9T B;  1EY5 A;  5I2Y A;  1QE6 A;  3HOX B;  2F0T A;  3NE5 B;  1JOR A;  2RDH A;  3MC0 B;  1JB3 A;  5K36 H;  1SBB B;  3NTI A;  3C3L A;  2QIL A;  1QWY A;  4PV1 C;  4XIG S;  4ABN A;  1G2T A;  1DXM A;  3SDZ A;  1HTP A;  1RTO A;  3T13 A;  5IGB A;  1FNW A;  2K5Q A;  4RCO A;  4N9P A;  1ZYR C;  2FIN B;  1F2Z A;  4DK0 A;  2CHB D;  4HR7 B;  1K8O A;  1GUS A;  3MXP A;  5EKI A;  4WFN 3;  4X3T A;  1HPC A;  1ET9 A;  4Z9C B;  3EA6 A;  3GD7 A;  3M4O B;  1PTO C;  2AWO A;  2EZV A;  4EVO A;  1YNJ C;  2AQ3 B;  2R92 B;  3RZO B;  1Z7T A;  3Q24 A;  3G6J B;  2Z8L A;  2A6H C;  3C2P A;  2NZ1 D;  3SE0 A;  3VR5 A;  4PMW A;  1Y1V B;  1EYA A;  4ZYS A;  3MA2 B;  5KYL A;  3NP8 A;  4OIK A;  1TWC B;  1HA6 A;  5M5X B;  2EJG C;  3D4W A;  3I73 A;  3SK6 A;  5C0X H;  4OO1 H;  1EY6 A;  4A3B B;  3SR1 A;  4ZKC B;  1JE4 A;  1BCP B;  1K83 B;  1PRT F;  2AQ1 B;  4EQP A;  1OXT A;  3OIQ A;  3W3A A;  2HCC A;  3IFT A;  1EYC A;  3L3O C;  1EWC A;  1I4R A;  1JOQ A;  3DXJ C;  4K5X A;  5IGG A;  1ICW A;  1H9K A;  2EE1 A;  3S14 B;  3GTQ B;  3A7A B;  2RBM A;  2A73 B;  3T4A C;  4XDX A;  2E74 C;  5C44 B;  1CI3 M;  4G7O C;  4XT3 B;  1DJR D;  3BVZ A;  1L0X B;  1NUC A;  3NK9 A;  4PMC A;  1PZK D;  1QOH A;  4ODG A;  1ET6 A;  3SXH A;  4A93 B;  5HUR A;  3J7A F;  2Q8R E;  4U67 3;  3V96 A;  2JSO A;  3W2D A;  3CHB D;  1TS5 A;  3GQB A;  3TP8 A;  2MUY A;  3K0Y A;  1DCZ A;  3HOV B;  5KRU A;  4BA2 I;  1WTQ A;  2JA5 B;  2EYM A;  3I4L A;  1ILQ A;  1EEF D;  1G91 A;  2IX3 A;  1PMR A;  1SMY D;  1LTR D;  2B2T C;  1PTO H;  5FO8 B;  2KCN A;  1NCV A;  2OT2 A;  3FMC A;  5IOC A;  3BS1 A;  1B9M A;  1G29 1;  2PPB C;  3CRK C;  2A68 C;  5D14 A;  3PUW A;  4K8J A;  3ND8 A;  3D3R A;  3PO2 B;  3Q6S A;  5CV4 A;  2VB2 X;  4HTH A;  4WRD A;  2NB0 A;  2IWH A;  5CV5 A;  1TS2 A;  5I6Y A;  1I4X A;  1VMP A;  1E0B A;  1SNM A;  1U4M A;  2O2L D;  4LMQ D;  3H91 A;  3K5M A;  1JOO A;  1SAP A;  2L55 A;  2PZW A;  2LMC B;  3TDQ A;  3I90 A;  4I65 A;  3S2H B;  5LL6 X;  3MAQ A;  2KEC A;  3DUZ A;  4KK7 A;  1D2B A;  4XQQ A;  2QF7 A;  2X69 A;  1QJO A;  4K8I A;  1XTC D;  1GJX A;  5K36 G;  5J39 A;  3D4D A;  4DF7 A;  5DM6 3;  3L7Z C;  3PUV A;  2R6G A;  1EQT A;  1H9J A;  1TII D;  4XT1 B;  1V43 A;  4FF2 A;  2EYO A;  1T5X D;  4HMJ A;  4G57 A;  1D5Z C;  1H9S B;  1EYD A;  3OIP A;  3QOL A;  1ENC A;  1FR3 A;  4IUP A;  1SE3 A;  1QCB D;  3RLF A;  3SK5 A;  1WTX A;  2ZXO A;  3OMC A;  1S5F D;  2F0P A;  5ISR A;  3FPP A;  1CHQ D;  3LNN A;  4IUR A;  2L12 A;  2HQE A;  1B50 A;  2AUK A;  3GP7 A;  2PNR C;  3MWY W;  5CYU A;  3IL8 A;  1F9P A;  3MZ5 A;  1OXV A;  2KVM A;  2Z4I A;  1HTL D;  3M85 A;  2MPM A;  1SYF A;  1AP0 A;  1UUP A;  3R2T A;  2D5D A;  1NR2 A;  1ENA A;  1WD0 A;  2F0I A;  5C0X G;  3BVM A;  4OO1 G;  2XN9 C;  1F9S A;  3C46 A;  3NWS A;  1ZYR D;  4C3H B;  2IT1 A;  1Y8P B;  1LLR D;  4FXD A;  2PW5 A;  2KEE A;  3L9A X;  5EGT A;  2B2V A;  2IL8 A;  4IFD I;  3TZU A;  1DM0 B;  2RDG A;  4S3S A;  1YNJ D;  3I4N B;  4QMG A;  1EZ6 A;  4R9W A;  2EJF C;  3VR4 A;  4ZAI A;  2B2U A;  2A6H D;  3LWU A;  1HA5 A;  3AU7 A;  2NTS A;  3NPP A;  4ZUJ A;  3A55 A;  2F1M A;  1DYQ A;  2HDL A;  4KKU A;  1B1Z A;  3D6W A;  1PRT C;  1M4V A;  5EBD A;  3N6R A;  3VR3 A;  4FF4 A;  1UEA B;  1S5D D;  2A6E C;  3SK8 A;  1ESF A;  4IAL A;  2F4I A;  1FGB D;  4FXG C;  1T5E A;  3E0J A;  2X6G A;  4H7B A;  1LTB D;  1G8Z D;  1VF5 C;  1EZ8 A;  3A8I E;  1WTV A;  5JVH 3;  1IYU A;  4J1M A;  1IYV A;  2NN6 H;  3X3M A;  3VYS A;  2MHV A;  3TBI B;  2RQX A;  3WDN A;  1ZKO A;  3U9S A;  1GXD C;  4DAY A;  1EQV A;  3K58 A;  1H9S A;  1Q12 A;  1BCP F;  2IX0 A;  5A35 A;  1TQO A;  3VA7 A;  2M00 A;  4PNY A;  1SJE D;  1RKN A;  1EEI D;  4KV6 A;  1SXT A;  2L11 A;  2F03 A;  4XQJ A;  2PQE A;  4UAI A;  2Q8I B;  2R3Z A;  2L4N A;  2FHT A;  1C8C A;  1PTO B;  4OIJ A;  5J22 A;  3P75 A;  2O5I C;  3PIP 3;  1BNZ A;  2MGS A;  1KNA A;  3NXW A;  2R7Z B;  5EPK A;  2FFK B;  2A5H A;  4CGY B;  5EPJ A;  2K03 A;  2F0J A;  2EJM A;  3WOE A;  2XVS A;  5KIX A;  1LTI D;  1AN8 A;  4GZY C;  3X3N A;  1XWE A;  4IQZ A;  3RUZ A;  4X3U A;  3KK7 A;  5KGU A;  2H1E A;  3I70 A;  4CJ2 C;  4EQO A;  1U9R A;  5ELE A;  1Q8I A;  2A69 C;  1SYE A;  1B44 D;  3M3Y B;  3R3O A;  2F0U A;  1BQQ T;  1LTG D;  5JPN C;  4EQN A;  2F0H A;  1EOT A;  1XXG A;  2K04 A;  1TU2 B;  3MHB A;  4HSV A;  1A2U A;  2R61 A;  2NTT A;  2A68 D;  5D3D A;  4B08 A;  5LL6 S;  3GTP B;  4XYO A;  1WTR A;  1SJH D;  4RAU C;  3C1E A;  1DD2 A;  1C4Q A;  1MBY A;  4TKO B;  3V2T A;  1KTK A;  3TP6 A;  5EPL A;  1TWH B;  3A54 A;  1LV9 A;  4RGN A;  5DM7 3;  4FO2 A;  5C6A A;  4KD3 A;  2WP8 J;  3CKI B;  5J1Z A;  1JCK B;  1MGS A;  2E2D C;  3IFD A;  4HCS A;  2RSN A;  1A2T A;  2SDF A;  1B4O A;  2B39 A;  3ITP A;  3Q23 A;  4U68 A;  1EY4 A;  2WV6 D;  4DK1 A;  3GO5 A;  1ROD A;  1WTP A;  3M4Y A;  1GUW A;  2H4O A;  5DEH A;  2BOS A;  3S2D B;  3N52 A;  1H9R A;  3GTG B;  4K6L A;  2BA0 A;  2IW3 A;  1GUO A;  1SYB A;  3TN2 A;  5K5P A;  4HSP A;  2NUC A;  3J7Y W;  3S17 B;  1W6K A;  1ZXT A;  3QO2 A;  1STB A;  2EY2 A;  3VR2 A;  3PUX A;  1TY2 A;  4K5V A;  1O7L A;  2D9U A;  1ILP A;  1MSH A;  1I4P A;  2EOT A;  2CQA A;  4R8N A;  1MI2 A;  4XYQ A;  2E76 C;  2QEJ C;  5IGD A;  4JK1 C;  2KCC A;  5M9O A;  4L8J A;  1JWM D;  3A8K E;  2K6A A;  2M2L A;  4Q0F A;  3R8B A;  4IFD G;  1QIL A;  2HUG A;  4N9T A;  5KEE A;  4E6I A;  2YU9 B;  1SSO A;  1CA6 A;  2EXZ A;  2N55 A;  5IGC A;  3HOU B;  1YNN C;  2EYL A;  3KUP A;  4KKS A;  3DMU A;  1SFO B;  3J80 L;  4HED A;  3QG1 A;  4Q5V A;  3K5O A;  3EFX D;  2ICI A;  3J80 E;  3AB9 A;  4QIW B;  1TKW B;  3R2I A;  1QNU A;  4LK1 C;  4DU9 A;  1HFG A;  1GOZ A;  2XRS D;  1TT2 A;  3T51 B;  5CBE E;  5T1I A;  4OGQ C;  2C5C A;  4RHR A;  5C3X A;  4EGV A;  2CVR A;  1D1K A;  3NWT A;  4ZQ3 A;  1A6X A;  4YIJ A;  4A3D B;  2NVX B;  2B2W A;  2SOB A;  1HUM A;  1X3P A;  5JVG 3;  3FPU B;  5E1F A;  4PMB A;  4CKB A;  1DOL A;  3H0G B;  2NN6 G;  1I6V C;  4C3J G;  1GHK A;  1DON A;  1A3U A;  4ZKB B;  4DNR B;  5JEA H;  3HEJ A;  4KN4 C;  3O13 A;  3D4R A;  2TSS A;  2L9H A;  1X3Q A;  2K28 A;  3DWP A;  2XSC A;  4PQX A;  4RH6 A;  1D5X C;  2F0V A;  1PRT D;  1I4G A;  2F3W A;  3OWF A;  3ERQ A;  1KDB A;  1LTS D;  2E2H B;  2KHS A;  2RSO A;  3OWE B;  4IUQ A;  1RTN A;  4KHV A;  4A3K B;  2B8G A;  3GTJ B;  4KY5 A;  2A6E D;  5CMD A;  2ZXR A;  2XNA C;  1SEB D;  1BCP C;  2L1B A;  1OXS C;  4ZK9 B;  4IFD J;  3FKI B;  4G7Z C;  2LS0 1;  2F0K A;  1O78 A;  4C3I G;  3EJI A;  2EY1 A;  2PW7 A;  2EY6 A;  2D62 A;  5C5M A;  5A2Q L;  3HS0 C;  1LAC A;  2JA8 B;  1XX8 A;  2F0E A;  4K2K A;  5COR A;  5A2Q E;  3TZD A;  1B3A A;  4H13 C;  1QB5 D;  1I6H B;  1EFI D;  1E2W A;  1QG7 A;  1A3V A;  5E4X A;  1V8Q A;  3MVV A;  1VMC A;  3T16 A;  3K5N A;  1STH A;  3BDC A;  2KUM A;  5FKA C;  1Q90 A;  1ZEQ X;  2AQ2 B;  1PYW D;  2AWN A;  3KLR A;  3MXG A;  5CV7 A;  4XXE A;  5IGF A;  4LJZ C;  2FMM A;  4X3S A;  3S1N B;  5EQ0 A;  3NTK A;  2ZXP A;  3S1M B;  1EU3 A;  4KN7 C;  2NVQ B;  2FMC A;  4C1N I;  3FRP B;  2AUJ D;  4B9X A;  1BOS A;  3QB3 A;  4CKC A;  2VXW A;  3GTM B;  2PYK A;  2A69 D;  1O80 A;  1B2T A;  3H3V C;  1EWH A;  1GHJ A;  2XIW A;  4RGT A;  5G3L F;  5I9P A;  2KED A;  1AZP A;  1K8M A;  3FDT A;  5ELB A;  2BE5 D;  1FD7 D;  4KMU C;  4G4K A;  2IPK D;  3SVM A;  2Z4H A;  4K2L A;  2B2V C;  1KAA A;  4QB4 A;  1BUV T;  2B63 B;  5COY A;  1TS4 A;  1SDF A;  3S1Q B;  2J0T D;  2G9H D;  4BBR B;  2L0C A;  1D5M C;  5F2D A;  4RCN A;  5EKL A;  4BA1 I;  5EBC A;  5FO7 B;  2F0Q A;  3Q0A A;  4QF4 A;  2B2U C;  3R93 A;  1JWU D;  4ZUI A;  2XWB B;  2ID0 A;  4BWG B;  2R93 B;  1CT1 D;  1SND A;  3JAM L;  1STY A;  1GUT A;  1D1I A;  3JAM E;  1WTW A;  1SYG A;  4HN7 A;  1CZG A;  3P20 A;  1L0Y B;  2XWJ B;  2E2J B;  4IFD H;  1Q1E A;  2BCO A;  2PZT A;  3VA5 A;  1S5C D;  1IHZ A;  2I46 A;  2DNE A;  4RHS A;  1RCV D;  3EVQ A;  4QUC A;  4KY7 A;  3BZD B;  1SE2 A;  2K7V A;  1BR9 A;  1FYC A;  4O1N A;  1B53 A;  4P2C B;  3WOF A;  1II3 A;  4DFA A;  4NP5 A;  2B2Y A;  2KJX A;  5KYI A;  2K05 A;  2F3V A;  4KKT A;  1V1P B;  3VR6 A;  5G3L D;  3RZD B;  3S1R B;  2LFN A;  2GA4 B;  4WJW A;  2F0S A;  1JOK A;  3FVQ A;  4NW2 A;  2WB1 B;  2F0O A;  2OEO A;  2QCP X;  1CHP D;  1HUN A;  3K59 A;  5D65 A;  3K7A B;  1Y8O B;  1TS3 A;  1NSN S;  3PUY A;  1PLF A;  2OXP A;  3P7J A;  4A3J B;  1RHP A;  3TSS A;  3HOZ B;  5JEA G;  4BY1 B;  1YNN D;  1I3Q B;  4A3F B;  1PFB A;  2KA7 A;  1EY8 A;  4FYD A;  4R8I A;  1G2S A;  4IZ8 A;  4DXF A;  4LAA A;  2Y0S B;  4M1U B;  3SEB A;  3BDL A;  4XTC S;  3H6M A;  5IT9 L;  3A7L A;  4WOR A;  3MEH A;  1J8I A;  4OHJ A;  2F0F A;  5IT9 E;  1EIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...