1HFNA

Nmr solution structures of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II
publication title Structure/Function of Human Herpesvirus-8 Mip-II (1-71) and the Antagonist N-Terminal Segment (1-10)
pubmed doi rcsb
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2000-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hfnA00
3KUPA 3F2UA 1QG7A 2N55A 1B4OA 3N52A 1X3PA 2B2TC 3ONAB 4ZLTF 3H91A 4CJ1B 1SAPA 1GUWA 2HDMA 3I3CA 3P7JA 5EPKA 1BBXC 1CM9A 2B2WA 4RWSC 1RTNA 2KEDA 1PDQA 1QNKA 4RA8A 2MP1A 1G6ZA 3R93A 2RA4A 4DN4M 3IL8A 2K05A 1G2SA 1BO0A 1WTRA 4HSVA 1E0BA 1RJTA 4UAIA 1HRJA 2Q8TA 2SDFA 1XYIA 1DZ1A 2EPBA 3HP3A 4MN3A 1C8CA 1PFMA 1S4ZA 2FJ2A 2EOTA 3I91A 5EKIA 4ZKCB 2JP1A 3I8ZA 4RAUC 1DOKA 4X3KA 1M8AA 1ESRA 3D6WA 2KVMA 1MSHA 1SSOA 4U68A 1EOTA 5JJZA 1F9RA 3LWEA 1WTOA 4R9WA 2HDLA 1WTPA 2L11A 1A15A 5COYA 2CVRA 2L9HA 1VMPA 1O7ZA 3DEPA 5E4XA 1BF4A 5DNFA 2B2YC 1Q3LA 1G91A 1RHPA 1DOMA 1JICA 1ILQA 1NR4A 5EJWA 3DEOA 1ICWA 1KNAA 1NR2A 1BNZA 2EE1A 2IL8A 4NW2A 3GV3A 2K03A 2KUMA 2RSOA 1IL8A 1PFBA 2VXWA 5E4WC 2K1BA 1B2TA 2L1BA 5T1IA 1B50A 1HA6A 2JYOA 3I90A 4IUTA 2L12A 1AP0A 1HHVA 4HCSA 1B53A 1PLFA 4CJ0B 1IKLA 4X3SA 1EIHA 2B2VC 2FINB 1JE4A 2KEEA 1SDFA 2X6GA 3KBXA 4X3TA 1WD0A 1CA5A 4QUFA 1NAPA 2J7ZA 3MTSA 1U4PA 4LMQD 1DOLA 1F2LA 5T1GA 1G2TA 2HCIA 2MJ8A 3DM1A 2FFKB 3Q6SA 2B2TA 1AZQA 1WTVA 3TZDA 3G7LA 2K01A 2NYZD 1F9PA 2Q8RE 2XIWA 4R8IA 1EL0A 2HUGA 2MPMA 2B2WC 2B2UA 2RSNA 2RVLA 3FDTA 4OIKA 1U4LA 3GV6A 1B3AA 1ML0D 2K28A 4X3UA 1QE6A 5CMDA 4O42A 2KECA 1MGSA 4XDXA 4ZKBB 1KNEA 1ILPA 4IUQA 1F9SA 2KOLA 5D14A 1RODA 2X6LA 3QO2A 4IURA 1U4MA 5D65A 4ZK9B 5CBEE 1PFNA 1WVLA 1J8IA 1X32A 3MWYW 2M2LA 4QUCA 2HCCA 4XT3B 1MI2A 2DY8A 2H1EA 4OIJA 2DY7A 1HUNA 3IFDA 1HFGA 1WTWA 2BDNA 1O7YA 1NCVA 1CA6A 1XX8A 3UI2A 1HUMA 4HEDA 5AFWA 5EPJA 3SVMA 1AZPA 2X69A 4CJ2C 1F9QA 1TVXA 1U4RA 2B2YA 2B2UC 1ZXTA 3FPUB 1WTQA 4IUPA 2N88A 4IUUA 5CBAE 1WD1A 1EQTA 2R3ZA 1WTXA 4MHEA 5CORA 3TN2A 5EPLA 1O80A 1RTOA 1EIGA 2MGSA 5EQ0A 4ZAIA 1J9OA 2D9UA 1IKMA 1DONA 1HFNA 1MSGA 1LV9A 1X3QA 4XT1B 2FHTA 1VMCA 2B2VA 4HAEA 2NWGA 2K04A 4IUVA 2L4NA 2FMMA 2NZ1D
chains in the Genus database with same CATH superfamily
3KUPA 3I56A 1QG7A 4A93G 1GUNA 2CQAA 1ASYA 4Y7NH 4ZLTF 2R61A 5IGBA 1QWYA 2HDMA 4K2LA 3U4ZA 4RWSC 1CK1A 1B8AA 3GQBA 3D4RA 3U9SA 5ELDA 2F0GA 4DV1Q 1G6ZA 2OTLA 2K05A 4O1NA 3H15A 3A5UA 4JI2Q 2EQSA 2N49A 1D5ZC 5J39A 4LWCA 3GTGH 3BVGA 5DM73 2WB1G 5IGGA 1EY0A 2UXCQ 4JI1L 4DFAA 1V1OA 1BF4A 2B2YC 2Z9HA 3KF8A 4K0KL 3CCMA 2ZM6L 4V190 1JB7A 4Z9CB 1YVCA 2F0NA 2IL8A 2F0TA 5LL6X 1EWCA 4NXMQ 3A5ZB 2NVXH 4G7HC 2L1BA 2NN6I 1I3QH 4F88A 4C3IB 2KEEA 2R7ZG 2E2JB 1G8ZD 5LMUQ 4GN3B 1P16A 1I4QA 1C0AA 1XMOL 1VF7A 1STEA 5FO9B 3TZDA 2JA5H 3D4DA 2UUAL 2RDGA 2VUMG 4A3MG 1WTHA 3I4LA 1YIJA 1B3AA 2Q2IA 2WB1E 2PI2A 4BBSG 1A62A 2A19A 5M3MG 5CBEE 5D65A 4GOPB 5BN5A 3PIPA 5C4XG 1Q90A 3L3OC 2EJGC 2K5NA 4OIJA 4POGA 2E2HH 4KKTA 3T51B 4PV1C 3SR1A 3JC66 4LFAL 2ZT9C 3S1NB 2R93H 3AEVA 2E5LQ 4YCVA 1K8GA 4IQZA 2I5LX 3HEJA 5IGCA 4KHZA 1D5XC 4KY7A 4DAPA 5D3DA 2JJQA 4K6DA 1WI5A 2PMZB 1B7YB 2F03A 4Y52H 4H0LC 5M3FH 3TRZA 3HOYB 1HXYD 2D62A 2UXBQ 1BQQT 4YWMA 3I70A 1EEID 2L4NA 2DNCA 1LT3D 4EQNA 1STNA 4LFBL 3ONAB 1I50H 2B2TC 3RZDH 2E75C 2K32A 1AW7A 4CJ1B 3PGZA 2HHHQ 1LTLA 1SYGA 1XWEA 1PDQA 1QNKA 1YHBA 4A3DH 3NSWA 3M9BA 1KDCA 3CC4A 4LUOA 2KBNA 4UAIA 1VCIA 4HJ7A 1ZYRC 4A3GG 2WAQG 1VQJA 5JJZA 4B9XA 5C3EH 3J80L 5C0XG 2UXDL 1T5EA 4JI0L 4A3FG 2K5DA 1Y1WH 4GLXA 2RF4A 4KJNA 1G91A 2ID0A 2YTXA 1EYGA 2JXMB 1MD2D 4DNTB 2RSOA 1VQ6A 4JI8Q 1B50A 2BE5D 1PLFA 2X6GA 3I4NB 1JE4A 4CGYB 2SOBA 3KLSA 1NAPA 2MO0A 1DOLA 4F7XA 1G2TA 4B3TL 3OIQA 4RKLA 3AYHB 3VA5A 1D8LA 3MVVA 4ZRZA 3DM3A 1TWHB 1Z7TA 1XXGA 1A2TA 2WAQE 2NN6H 4IN3A 2KCCA 3PO3H 4B3RL 1TS5A 3F2DA 1K3RA 3T1HQ 1MGSA 4HCEA 4IURA 1CTMA 1U4MA 2F0FA 3HZXA 1EQRA 1HTLD 2AHOB 2R7FA 1A3VA 3V2TA 1SMXA 1EQQA 3DLLA 2NVYB 3RNUA 2K4KA 3HOXB 1H9MA 3K7AB 4K2KA 1HFGA 1H9SB 4R8NA 3F2BA 1WTWA 1JOOA 1D1KA 3EA6A 5C5LA 1YJNA 3ICEA 4DF7A 1GM5A 4YCUA 4C3IG 3FPUB 2CHBD 2K5VA 1WTXA 3RZOB 3GTPB 3K58A 1B70B 1JOQA 1B3QA 4LF6L 3IFTA 4RCNA 4JOIC 4KN7C 3Q23A 1S3OA 4I7ZC 3URYA 2IT1A 4A3KH 1HNZL 2AQ3B 2JA6H 4P71A 3H09A 1V1PA 3TSSA 1IW7D 1AE2A 2PO4A 3P7JA 3A8KE 1VQ7A 2XGTA 2KCNA 1UEAB 2EY6A 4DGZA 5C0XJ 1QVFA 1RDPD 2EDGA 2Q8TA 4B3SQ 1U0LA 1Y1VH 3D6WA 1ESRA 1RL2A 1ONLA 3DHQA 1MSHA 3S1MB 2F0DA 2E76C 4EQPA 1TKWB 2SEBD 3HOYG 2WACA 1TWFB 1E7ZA 5IP9H 2E2DC 1SYFA 1JOKA 3OSOA 3NQTA 2J0TD 3I72A 1BCPB 4JYAQ 4N8X1 3VR3A 2JE6I 4JI5L 4C2MB 3S9WA 1EL0A 1PH5A 1N36Q 3S1RB 3AU7A 1UE1A 3VR2A 3J7YW 3H0GB 1AP0A 4YIJA 4C3JB 3D0FA 1CA5A 4A3JH 1K73C 4OL7A 1ENAA 1K0RA 5C4JB 2B63B 1Z6HA 3A7LA 3M4YA 3CXCA 2KA7A 4TKOB 1F2MA 1VQLA 4DV3Q 3STBC 3CPFA 2PMZE 1Q81C 1OTCA 4XXEA 4DV5Q 3FP9A 3HOZG 2DUDA 1X65A 4QL5A 4YCWA 3J80E 1EY8A 4LF7L 1HUNA 3BDOA 1NNXA 3W2DA 2EIFA 3GTKB 3UI2A 4C1NI 4HEDA 2Z4HA 1UEBA 5A35A 1SJHD 5BN3A 3I4NG 1PTOB 2PW5A 4L5SA 4BY7H 3F2CA 3NK9A 4LJZC 1K3BC 1UUPA 2ICIA 4ZAIA 1HA5A 2FXQA 5KNDA 1HFNA 5ELNA 2P5ZX 1S5BD 4DR3Q 3S14H 1S5ED 3ZJYC 4GOPA 5IGFA 4G4KA 2BA0A 4MTNA 3X3NA 1DM0B 2QCPX 5IOCA 5IE8A 1YHAA 3MHBA 3M4OB 2JA8H 5EKKA 4HIKA 4DPGA 1N32L 5D3IB 4HMJA 4KI0A 4IUNA 1UE7A 4DV7Q 1QZGA 3HOXG 2NVQB 3OMCA 1GHKA 3ER0A 2G9DA 1CHPD 1LM0A 4ZUIA 3V96A 2YU9B 1DXMA 1RJTA 1IBMQ 2EPBA 2A68C 1PFMA 2Z6KC 3PUWA 3W1GA 3M4PA 1ENFA 2E2HB 5I9OA 1QZHA 4HSPA 4A3EH 2R93B 1UAPA 3MXNB 3CP0A 4DA2A 3I4MB 1F2YA 5JAVA 1O7ZA 1EOVA 3OOCA 3MXPA 2VQFL 2YV5A 4H02A 2CWPA 1BUVT 4KD3A 4JI3Q 1PZID 5FO7B 3JAML 3NTIA 4JI4L 4NW2A 1IBLL 3K0XA 2K75A 1FD7D 5T1IA 4J1MA 3HKZB 1GJXA 2VQEL 1VQCA 1HHVA 3HOVB 4DXFA 2FINB 4H44C 1NE3A 2F4VL 1KD1C 3J81E 3CMEA 2ZXPA 2VL6A 4L5TA 3DWQA 4IJHA 5FLMG 2LKVA 1KIXA 2XIWA 4LF4L 1K83B 3R8BA 1YNJD 2F1MA 3KLRA 1BCPD 3UDGA 4IPCA 3I55A 1PYSB 1RODA 2VS1A 3L7ZC 4TQUS 4QUCA 2HCCA 1I6HH 1PH8A 4JI7L 4JK1C 4HTHA 2V4DA 4IFDI 2A6ED 3QB3A 5KRUA 4LF8L 3U58A 3GO5A 5K36G 4C3JG 5HGTA 2UUCL 3ERSX 1WTQA 2CQOA 4ODGA 1A2UA 1VQ8A 3CKIB 5I2YA 2B63G 2H5XA 3MA2B 3RLNA 3IRBA 3QIAA 2K6AA 1EZ6A 1Z9FA 5ELOA 3CAMA 4CDDC 3PF5A 1VQBA 3KDFB 4I65A 1LT5D 2Q2TA 2A6HD 2OWOA 1H9SA 3GDEA 3PUXA 3K5LA 1PTOD 1D7QA 3L9AX 1Q1EA 5KYIA 1R4PB 4OX9L 3R93A 2NVTB 1TY2A 2F0IA 2ZTCA 2WB1B 3LX0A 1TS4A 4NP5A 2XRQD 4R4QA 4MN3A 4YY3L 2O5JC 3BVZA 2UUBL 3TP7A 3NELA 3RLOA 2K5WA 5JJLA 3AFPA 4FNFA 1O7LA 4L5RC 3ND8A 1HQRD 2N3SA 1SNQA 5CYUA 2L15A 2R92H 1IYJB 1S5CD 1TWCH 3E9IA 4GLVB 1A0IA 1A3TA 1SNPA 1IZ6A 1LTSD 1OXXK 1S5FD 4I7AA 2R7ZB 2F0KA 2AWNA 3I90A 1STBA 4G57A 3EJIA 4AYBB 2B29A 2G5DA 3MTSA 2JA6B 2WFWA 1OXTA 5C4ZA 5IGDA 2AUKA 2XN9C 3DM1A 5AJ3Q 2Z1CA 1CSPA 1AZQA 2ZM6Q 3GTJB 5M3MB 4XYOA 5FLXE 2D5DA 1HZAA 4PZ7A 2HIVA 1HPCA 3F8TA 2RSNA 1JORA 4P75A 2F0UA 3U50C 1AEXA 1M4VA 2QF7A 3S16H 2R93G 2ZXOA 2VZAA 4WORA 4JBKA 3QO2A 3I4MG 3ND9A 1SRUA 4DK0A 4G7ZC 4FF3A 4ID6A 5JJKA 4XT3B 4RGOS 2BDNA 3FMCA 1N34Q 3OW2A 5J1ZA 1L0WA 3HKZG 1VQNA 3HOVG 2EVBA 5IT9L 2AWOA 3JAME 5GADC 1HZ9A 1J5EQ 3NE5B 2XTIA 4U673 4KHPL 1XMQL 1PRTC 1KC8C 3X3MA 4OGQC 4BY1H 1DCZA 2E2IH 4A3BB 4A4IA 3G71A 2QDLA 2PCFB 4XT1B 4S3SA 4L5QA 2RQXA 2HQLA 5JEAJ 3F2UA 2ZJPA 4ZQ3A 4QJFA 3G4SA 1DJRD 1E24A 2LSSA 3PO2H 4QGUA 1OO9B 3GTMH 1LTID 2KEDA 5FKAC 3PV0A 4C56C 2ZJRA 1TS2A 3Q24A 4JV5L 2WAQB 3K6OA 5IYBG 1X9NA 4KN4C 5EGTA 1X56A 1BO0A 4DR6Q 1EU4A 1Y1WG 3HKZE 3QJYA 4A3LH 3I91A 5EKIA 4LFBQ 4ZKCB 1XNRL 1F2ZA 1WYDA 1I94Q 3CC7A 4DR5Q 4RMFA 1HTPA 1EYDA 1PH4A 5DLQE 4R9WA 5IGEA 5IYCH 3BJUA 4ULLA 2CVRA 4DUYL 4OO1I 4DNRB 2C9OA 1KXLA 1Q86C 1SFOH 4LUVA 4Q0FA 2KHIA 3KJPA 1ICWA 4GNXC 4FYDA 2LY7A 3M7NA 1U5KA 4IUTA 5TSSA 4N9PA 3S1QH 3A55A 4DK3C 4XQNA 4JI0Q 3J7ZC 5DM63 2IW3A 3I2ZA 4QUFA 2HQEA 2VB2X 3HOUB 2FFKB 1ET9A 3EIVA 3U4VA 2Z6BA 4AQYQ 3IAYA 3HS0C 3RD4A 5C44H 2B2WC 5JJIA 3DXJC 3MXNA 3NPPA 4KKSA 1ZYRD 5G3LD 1EZ8A 4R4OA 3UDFA 5CMDA 2WV6D 2KECA 3R2IA 3KLSX 5CV7A 4PMWA 5M5WH 3NTKA 3TMEA 3J80c 4B3TQ 5EKLA 1EFID 1T9HA 4RFBA 1MI2A 1Q1BA 1GUSA 2MNAA 1VQMA 3A56A 3CCUA 3IFDA 3FKIB 4B3ML 2SNMA 2EXZA 2AMCB 2F0MA 2VY3A 2ZTEA 3FEWX 2B2YA 4OELB 4AYBG 1SYBA 1KDBA 4IUPA 4IUUA 2LXKA 3MC0B 4NB3A 2EJMA 5I6WA 2JA6G 4EVOA 3A74A 5L37A 4DR7Q 4AIMA 3SK5A 4HJ9A 1QVCA 3RLFA 5GROA 1FJGL 4JVZA 2Z4IA 1JMCA 3QWNA 2N55A 1X3PA 2CH4A 4GLAC 3H91A 3OTOL 4DV2L 2B8FA 5EPKA 3GTQB 1G51A 1CM9A 2CKZB 4CKEA 4UDUC 1HZCA 2FMCA 1VQOA 2RA4A 4X65L 2XNAC 5IP9G 1KLGD 2QEJC 3TZUA 3S2HH 5A2QL 1HNWL 2JP1A 2Z0SA 4AYBE 1DOKA 2KENA 5KYLA 1TQOA 1X55A 2IPKD 3T16A 1NUCA 1F9RA 3LWEA 5IT9E 1QUQB 1JC7A 4PG3A 1PV4A 3QR8A 4A3BG 2I07B 3KDFA 3GTOH 1RHPA 4N9TA 2ENBA 1EY4A 3L0OA 4P72A 3WWVA 4NPSA 1F77A 3DEOA 4C3HH 2MHVA 1FR3A 1QILA 4CDEC 3NUCA 3TEHB 1PH3A 2PNHA 4K6LA 3PF4A 2ICEC 4FXDA 3I7FA 2VB3X 4WJWA 5LMNQ 1EIHA 3MFGA 3BYTB 4OO1H 1B44D 2QW7A 1TS3A 2B2TA 2RHSB 4HJ5A 1QJOA 3PCOB 3HOZB 4IZ8A 2DGYA 3BYYB 1X3EA 1F9SA 2O5IC 1Z47A 1IL2A 2M2LA 4DV1L 2VNUD 1SROA 1OXSC 4DV4Q 4RG1A 1IBKQ 2KCMA 1E1OA 1J6QA 4O2DA 4DV0Q 2CW0C 4LF5Q 4DR1Q 3ULPA 2JA8G 3H94A 3HOUG 5CORA 4LK1C 1ET6A 5EPLA 2EZVA 1JQYD 1Q7YC 4EX5A 1JJGA 5EQ0A 4A93H 1EEFD 2QEXA 2B3GA 2YYZA 3S2DH 3V05A 2EYHA 3KJOA 2XWJB 4FVMA 4JBMA 1I5FA 3E6ZX 3R3OA 2D0OA 4OEMB 3CCVA 4NXML 2RBMA 4HR7B 3D31A 3N52A 3T13A 4HIDA 1OXVA 1YNND 1W2BA 2A69C 1IYUA 3NENA 1BBXC 1MJCA 2K14A 2KHSA 1VQKA 1MBYA 1CUKA 3FKIG 1VQEA 3M4QA 1PYBA 3S24A 3PIO3 5NUCA 3HP3A 3FVQA 4WJ4A 3BZDB 3DMUA 4GN5A 2OTJA 3I8ZA 4UPAA 1N32Q 1Y69U 1NSNS 4BBRB 3ZYYX 1EOTA 3MFYA 1Q82C 4PQXA 1EIYB 2EY5A 1W6KA 3J81L 5DNFA 2PYKA 1JICA 2E5LL 3D6CA 2CWAA 1LYLA 1EFWA 2K1BA 1KRTA 3SK4A 3A0JA 4QQBX 3M3YH 1M90C 4A3MH 2PQAB 2B2VC 1WD0A 4PMCA 1SDFA 4R4IA 2OQ0A 5M5XH 1X54A 1GOZA 1L1OB 4BBSH 1G6PA 2UXBL 2E74C 3VR4A 3E3XA 3PO2B 5C4XH 3DUZA 1K8MA 4JI4Q 3GTMB 2B2UA 4JCVE 5FO8B 1BOSA 1ML0D 1H9JA 2A68D 4HJ8A 5A2QE 2NZOA 3C1FA 2HHHL 5HY6A 2L55A 3J7AV 4XQQA 2F0JA 4NKLA 1YJWA 2UU9L 2PQEA 3TP8A 1S40A 2MO1A 2F0WA 4A3CG 3A7AB 1NCVA 1CA6A 3VYRA 5AFWA 1YJ9A 4JI6Q 1RD9D 3JAMc 4Y7NB 4XYQA 3GTLH 3LNNA 1RF2D 4A3IH 4H13C 5CBAE 2JA7H 2R3ZA 3HOWH 5E7NA 4DV6Q 1O78A 5FK9C 3ITPA 1WCMH 5HGQA 3CCQA 4LF9L 4JG2A 5ELFA 4R1JA 4QF4A 3CD6A 1EYAA 1MSGA 1LV9A 1N33Q 4BXXG 3S15H 1X3QA 3BDCA 3OIPA 1R9TH 3GTGB 2FHTA 1VQFA 2JSOA 1VQHA 3E9HA 4JI8L 2K04A 2SNSA 1BCPF 5F2DA 3SE0A 4RAUC 1XNQQ 2ATWA 2AKWB 1IYVA 1YZ6A 5BN4A 1PRTB 4X62Q 4P73A 3CF5A 1D2BA 4IPDA 4UP7A 4DAYB 1E2ZA 3P20A 3HG9A 5I2XA 3SK6A 2NZHA 3B6YA 3NEMA 4MZ9A 5C3XA 2VW9A 1C8CA 1CFMA 1TWAH 1SEBD 1S4ZA 2FJ2A 1I3QB 3PQIA 4A3FH 3CC2A 3MZ5A 4GOPC 1CT1D 1VQ5A 1JWMD 4KKUA 3VYTA 4RHRA 1LLRD 2PPBC 1GHJA 1Q46A 3VR6A 2I0QA 1YNXA 3NP8A 2JA5B 5LMNW 2GA4B 1TT2A 1DOMA 5FJ8G 4UY8C 3TDQA 1CI3M 2F0OA 2RDHA 5I4DA 2UUBQ 2K7VA 2HIXA 2AUJD 1CKOA 1PZKD 1KNAA 5FLXL 1PXUA 5KEEA 3H3VI 1VQGA 2L12A 1PTOF 4NXNQ 1IKLA 5IWAQ 3NQIA 1T5XD 3BU2A 3CRLC 4BWGB 2IX3A 2F0VA 3VR5A 4LFCQ 1QUQA 3VYUA 2A74C 3CHBD 4GNXB 4BBRG 2MQHA 2DJGC 1SYDA 4IPHA 5DEHA 2WKCA 4YHHQ 3W3AA 3IKJA 3W1BA 5KNBA 5M3FB 4N8FA 4A76A 4C3IH 1X6OA 4JW0A 4DUZQ 1XTCD 2H1EA 2E2JH 2F52A 1B9NA 1E2WA 4X64Q 1Y8PB 4DR2L 1I50B 3T56B 3UDXA 3RZDB 3SVMA 4IFDG 4IPGA 1MJEA 1SE2A 4Q5VA 1U4RA 4R4TA 3T1YL 1HZBA 4C3HB 4A3DB 1YHQA 4FDBA 3H3VC 2M9VA 3PO2G 1UE6A 1NMFA 4B9WA 2IY5B 3CCRA 4JYAL 3G6EA 4CDCC 1N36L 3BVMA 3EROA 3S1NH 2OT2A 2NTTA 5C3EB 4KHPQ 2JQOA 3K0YA 1GUWA 2OXPA 1Y1WB 1ASZA 1MKHA 5IP7H 3TP6A 1ESFA 1GO3E 3EBEA 3KLWA 2EYMA 4LW1A 3HOYH 4DV3L 4PMBA 1HR0L 1UNSA 5IT9c 5M5YH 4UP8A 5JVG3 4GZYC 5ISRA 4DV5L 5KGUA 1A15A 1LTBD 1CHQD 5C3WA 1FNUA 1PRTD 3QOJA 4IJLA 1PH1A 2F0PA 1LTRD 4DU9A 1SJED 5FOBB 3PO3B 4IOAA 1NR2A 4GKJQ 2WIIB 1HA6A 2O2LD 4HN7A 4P2CB 2EJFC 2GN5A 4DUYQ 4DXGA 4KD4A 4DR3L 1EWHA 1STHA 3G7LA 2NYZD 3RR5A 2Q8IB 5J3BA 3RN5A 3FDTA 3H3VH 1QE6A 1KNEA 4IFDJ 3HGBA 2EY2A 3TS2A 4OWTB 2JA5G 1PFNA 1X3FA 4R4CA 3I4NH 5ELCA 4JI1Q 4A3KB 4C1NK 2PQAA 3UE0A 4K5WA 3WOFA 4K0KQ 1Q8KA 3KK7A 1L1OA 1SYEA 3PIP3 1TWHH 1KAAA 1ZXTA 3HFZB 1Y8OB 3VYSA 1WD1A 4X66L 1KTKA 5DAUA 1FVIA 2OQKA 1O80A 1CSQA 1SR3A 1LO5D 5E3FA 1J9OA 5ELBA 2BH2A 2LFNA 4JI3L 1S72A 2NVYH 1Y1VB 3T53B 1XMOQ 1HNXL 3K7AH 4HAEA 5GQOA 3KF6B 1I4RA 2UUAQ 1STGA 5G3LF 1KAWA 1K28A 2NZ1D 2XWBB 3DEPA 4K5XA 4DK1A 5M3FG 2CH4W 4QIWB 1SAPA 1LUZA 2IWHA 2EY1A 5CV5A 4K8IA 1FNVA 3N6RA 3VA7A 2I5MX 5CV9A 3RZOH 4KY6A 3GTPH 2K5QA 1E0BA 1SMYC 3BS1A 1XYIA 4LFAQ 3EQLC 1HH2P 5K5PA 3J81j 2KVMA 4U68A 4C3HG 4A3DG 2XRSD 4A3JB 2C5CA 1UWVA 1E3PA 3Q22A 4RKBA 3K81C 1A6XA 3AB9A 3NHHA 1B1ZA 3EFXD 1FGUA 3J7AF 2QKIC 4QMGA 3BDLA 3GD7A 4IALA 3HOWB 1VF5C 1X3GA 1WCMB 5C3EG 4K14A 3TS0A 2EE1A 2K03A 2B39A 2I46A 1BKBA 4DAYA 1PYWD 5FLMH 1TIID 2BCOA 4HCSA 2Z8LA 3CRKC 3S1MH 3ULJA 4YWLA 1VQPA 4MNOA 1MIUA 1XTDA 1KQSA 1TWFH 2KHJA 1H9RA 1STAA 4R8IA 3S17H 1D6EC 1YBYA 4TSSA 1YEZA 2ALYB 4GN4B 4A75A 1W3SA 4DR4L 1W6JA 4BY7B 2K28A 1V9PA 5CR3A 1DONA 4ZKBB 1WJJA 3FRPB 3E0EA 4C2MH 4IUQA 2KOLA 5D14A 1SE3A 3S1RH 2V1CC 3H0GH 3CCSA 5K36H 3A8JE 4PNYA 3S14B 4GS3A 3OWFA 4C3JH 2DY8A 2UXDQ 3TQYA 2NN6G 3PO3G 3E5SA 3CQZH 2Q2UA 1TR5A 4M1UB 4K8JA 2JA8B 3ERQA 3UE1A 1XPRA 5C4JH 1TWGH 1PMRA 1JE5A 2B63H 2PI2E 1KRSA 3I73A 5C5MA 1M1KC 5LHY1 2PZWA 1YITA 4ILWA 4WRDA 4RHSA 4QB4A 1DD2A 1E2VA 1RTOA 3MEFA 4GNXA 4ALPA 5CV8A 1E22A 3CW2C 1I4PA 1H9KA 1C9OA 3PSIA 4OHJA 1CQFA 3WDNA 1GXDC 5IODA 4F8MA 4KHVA 1EU3A 3PUYA 2NWGA 1EQVA 4A3EB 3GTKH 3RUZA 4BS9A 1LACA 5JEAH 1AFPA 4B3RQ 3K8AA 4EQ5A 3LGJA 1PTOH 2B2WA 5AJ3L 3TBIB 4A3KG 1V8QA 2NVXB 1JJCB 1GD7A 4J15A 2F0HA 3CCJA 3IL8A 2WP8J 3J7A5 1G2SA 2LXJA 3J80i 3CMAA 2IX1A 4HMIA 2WINB 4L8JA 2EOTA 2PW7A 3FHWA 3WOEA 2CW0D 3M4OH 1QOHA 5JOBA 4UHVA 3D8GA 5COYA 4DK6C 4WFN3 2L9HA 5E4XA 1TXYA 1N34L 1Y1VG 2NVQH 1Q3LA 4LF6Q 1PH7A 2QA4A 1FYCA 1CKMA 1SE4A 2IHFA 4GKKL 4POFA 4V0BA 2YU9H 3DWPA 3GV3A 3K59A 3C46A 1IL8A 2VXWA 1J5EL 1HNZQ 1NJIC 1HJPA 1I6HB 2L5TA 1PFSA 2F0EA 4EGVA 2A69D 2K50A 3A8IE 2EYFA 4RGNA 5I9PA 3I4MH 2C35B 2HUGA 2K33A 3MEHA 3NTHA 1STYA 4IO9A 3D3RA 1SYCA 4A3JG 1CZGA 3BZCA 4O42A 3MXGA 4DAMA 1Q8IA 3PMFA 2BOSA 3HOVH 4A3IG 1VQ4A 1GUTA 2JA7G 1BR9A 3J81c 3HOWG 4DR6L 5M5YB 4CHTB 1CZWA 1NY4A 1WCMG 1SBBB 5KNCA 1K9MC 4QIWE 2R6GA 4FXGC 1I94L 1AZPA 5BR8L 2PZUA 4DR5L 1K83H 3SK8A 4JI5Q 2N88A 2EYPA 3O13A 4ZUJA 2UU9Q 2KCTA 4TRDA 4X6AH 2F4IA 3F1ZA 4MTKA 1IKMA 1SNOA 3SGIA 4BA1I 2K52A 3J81i 5IYDH 3P1HA 1Q12A 1GVPA 2DJFC 1BBUA 1PHJA 4BY7G 4J6HA 1JWUD 5IYBH 4JI2L 2Q2HA 3T4AC 1CKNB 3I3CA 4LF9Q 2R92B 1TWCB 2NUCA 3SEBA 1ZEQX 2BDOA 2DNEA 5CGKA 4KY5A 2UXCL 4AQYL 1P8LA 5C6AA 4LF7Q 1A63A 3U9OA 4RCOA 2KJXA 2J4XA 2ZJQA 2JA9A 5C0XI 1IXRA 1C7YA 3CCEA 4NDXA 3P75A 3FPPA 3KF6A 3STBD 1O7IA 5LMUL 1EYCA 1D5MC 1ILQA 5CV6A 1I6VC 2PZTA 3ULLA 2I5HA 4A3EG 2NVTH 1VQIA 3S16B 2D0PA 4LUZA 1VQAA 2F0QA 2KUMA 5E4WC 5EBDA 3EVQA 2A1AA 5ELEA 4ME3A 3KBXA 4DR7L 4LNQA 1WFQA 3TREA 4LMQD 2H4OA 3BZKA 4ZCKA 2AQ2B 2ZXRA 1L0XB 3C3LA 1A3UA 1G291 1ENCA 2QDBA 2Q8RE 1U9RA 1LTTD 4OIKA 1K8AC 1U4LA 3MAQA 2D2CC 2K5HA 4JC0A 5H1SE 2R7ZH 1LTAD 1JT8A 2LMCB 1ILPA 1N8RC 1TY0A 5LL6S 4BY1B 4L6TB 2E2IB 4CDFC 3DWAA 2GVBA 1L0YB 4JOIA 2VUMH 4XTCS 4AH6A 2A73B 2TMPA 3CPWA 2VQFQ 4APVA 5FLXc 3GTJH 5M3MH 3KBGA 1BVSA 4CJ2C 2B2UC 2RDFA 1IBLQ 3AMUA 2VQEQ 4L63B 1H95A 2JEBI 2MGSA 2Y0SB 1SLJA 2ZTDA 2F3WA 2F4VQ 1PH6A 3OW7A 4NMZA 4DR2Q 4YWKA 5IP7G 1S5DD 2B2VA 1Y8NB 1SNDA 4IUVA 4LF4Q 2BE5C 3UDIA 3T1YQ 1B4OA 5LMNL 5GAEC 5IY0A 1D1IA 3S17B 2NBFA 1SFOB 4ZYSA 4RA8A 1FGBD 1EWIA 1XPOA 4DN4M 2NB0A 3AQQA 1EY5A 4JI7Q 4HSVA 1DZ1A 4PZ6A 2DN8A 4A3BH 1DYQA 4RGTA 2A8VA 4LF8Q 4X3KA 1SNCA 1M8AA 3S1QB 3K7UC 3CQZB 1UE5A 2UUCQ 1WTOA 3JAMi 3OHXC 1WTPA 1TWGB 4DV4L 4IOCA 1IBKL 5C44B 1EY7A 1YNNC 4A3GH 1ICFB 1PH9A 5J22A 1HR0Q 4MIUA 3NWSA 4DV0L 3K5OA 3M7GA 1JR0D 4LF5L 5M5WB 4DR1L 3TP5A 1PFBA 5EBCA 2R92G 5C0XH 2JYOA 2RKSA 4CJ0B 3T1HL 2KQ3A 3G6JB 2J7ZA 2N8NA 2IHEA 3Q6SA 1WTVA 2EYJA 3MXUA 2K01A 4ME5A 4OX9Q 3NBHB 2OF1A 3SDZA 4FF4A 2MPMA 4EQOA 1PVOA 1MHWC 2RVLA 3GV6A 1BXTA 1IW7C 4YY3Q 3OWEB 4X3UA 4HIMA 4DNIA 5C4HA 4UP9A 4ZK9B 1QVGA 4F87A 1EIFA 4XQJA 3G48A 1PRTF 1X32A 2RCNA 3Q0AA 2XSCA 3HKSA 1I4XA 3PUZA 3HOUH 2NTSA 1XPUA 1XX8A 3L2PA 1I4HA 3NXWA 1II3A 4HJAA 4H7BA 2MUYA 3OYYA 3TN2A 2EXDA 3R2TA 3GP7A 4RH6A 2JEAI 1VS0A 3SHLA 3RMHA 1JJ2A 1V1QA 3S2HB 2Z6KA 2BH8A 2HD3A 1GKHA 3FKIH 4OXPA 2FMMA 4JPBW 4KMUC 3PIOA 1VQ9A 4B3SL 4BY1G 4X66Q 3KF8B 3QOLA 3GTOB 1RCVD 2B8GA 2L0CA 4E6IA 1SN8A 4J8QA 1HNXQ 4B08A 2IX0A 5E1FA 3VDYA 4OWWB 1V43A 2RCFA 4ABNA 1VDZA 1SSOA 2GVAA 4CKCA 2XVSA 2Y0SG 3PUVA 1AN8A 4FP5D 1KHIA 1XMQQ 3GTQH 4A3LG 1VMPA 2ES2A 1PA6A 1EY6A 3W5OA 1CKNA 4JI6L 5EJWA 2TSSA 1IHZA 1BBWA 1LT4D 5IYCG 1OXUA 4DV6L 1B53A 1DGSA 4X3SA 3NWTA 4KK7A 1U4PA 2R7DA 1F2LA 2HCIA 4FF1A 1N33L 3H0GG 5JVH3 3E0JA 5GAGC 4JV5Q 4P74A 3K5NA 1XNQL 4JBJA 1R4QB 1SMYD 1XJVA 4A3CH 1XNRQ 2Y0SE 4K5VA 5CV4A 4XDXA 1KL9A 3AFQA 4X62L 4JBWA 4HIOA 1JB3A 2PNRC 1WVLA 4A93B 2A5HA 4OWXB 3H6MA 3S2DB 5CC4A 4O0AA 2G9HD 3MWYW 5C44G 4FXKC 1JWSD 1TU2B 2DY7A 1QB5D 2YTYA 1C4QA 1L2FA 4KV6A 1BDOA 4XIGS 1O7YA 4DR4Q 1I4GA 1NTGA 2M00A 1EUJA 2X69A 1GUOA 4BA2I 3HOZH 4BXXH 1LT6D 2E8GA 1EQTA 4MHEA 1B9MA 2QILA 5JEAG 2O4XA 3I4OA 4DV7L 2RHQB 5M9OA 1ZKOA 2WKDA 3KOJA 1N9WA 4KJOA 3OMGA 5KIXA 3KYHC 1EY9A 3C1EA 1RKNA 2F0SA 1IBML 1KDAA 2CFMA 1KABA 4NXNL 4LAAA 4M8AA 4G7OC 1L1OC 3EN2A 1AH9A 5IWAL 1CQVA 2F3VA 1VQDA 1K8OA 2CCZA 1RTNA 1SNMA 1KLUD 4DAVA 2MP1A 1LTGD 2BA1A 4LFCL 1WTRA 1YNJC 1HRJA 4CKBA 5JPNC 2SDFA 1BCPC 4B3MQ 2F0LA 4WJ3M 3M3YB 4YHHL 4QCLA 4FF2A 4A3MB 1HR0W 2VUMB 5FJ8H 4CBVA 3HOXH 5M5XB 4FO2A 1C48A 5GAHC 4BBSB 2HDLA 1AE3A 2L11A 4DUZL 3K57A 1QCBD 2A6EC 5C4XB 4X64L 1NR4A 3OPOA 1GUGA 3Q8DA 1JCKB 1FJGQ 1BNZA 2EYOA 2MFIA 3HRZC 3K80C 1B2TA 3KFUA 2HT1A 4DKAC 1FNWA 2LS01 3K5MA 5IIFA 3LWUA 2N78A 1LABA 3OTOQ 4BBRH 4X3TA 4DV2Q 4KTAA 5T1GA 2OCEA 2IJ0A 2MJ8A 2AQ1B 1NMGA 3A54A 4GKKQ 3GTLB 2OEOA 3NBIA 1F9PA 1RIPA 3RN2A 4X65Q 1YI2A 1E1TA 4PZ8A 2A6HC 4A3IB 4OO1G 4TVAB 2JA7B 1Y14B 1HNWQ 1PTOC 1SE8A 2JN4A 5HURA 2X6LA 4IFDH 2F3IA 1SXTA 1FL0A 1J8IA 3D4WA 3M85A 3CCLA 3S15B 4KLKA 2ASBA 1R9TB 1V1PB 4RGMA 2JK8A 4QY7A 1HUMA 5EPJA 1K0SA 5IYDG 5EAYA 1QNUA 1F9QA 1TVXA 1HCZA 3QG1A 4A3GB 3CU7A 3NBHA 3C2PA 5JPMC 1HQMC 2EYLA 1EIGA 3SXHA 5I6YA 1NBWA 1PH2A 2D9UA 4OONA 1TWAB 2QGQA 4A3FB 4GKJL 5BR8Q 1WOCA 1VMCA 2YTVA 3BG3A 1A8VA 1PZJD
chains in the Genus database with same CATH topology
3KUPA 1QG7A 1GUNA 2CQAA 4ZLTF 2R61A 5IGBA 1QWYA 2HDMA 4K2LA 4RWSC 1CK1A 3GQBA 3D4RA 3U9SA 5ELDA 2F0GA 1G6ZA 2K05A 4O1NA 1D5ZC 5J39A 3BVGA 5DM73 5IGGA 1EY0A 4DFAA 1V1OA 1BF4A 2B2YC 3KF8A 4V190 4Z9CB 2F0NA 2IL8A 2F0TA 5LL6X 1EWCA 4G7HC 2L1BA 2NN6I 4F88A 4C3IB 2KEEA 2E2JB 1G8ZD 1I4QA 1VF7A 1STEA 5FO9B 3TZDA 3D4DA 2RDGA 3I4LA 1B3AA 5CBEE 5D65A 5BN5A 1Q90A 3L3OC 2EJGC 4OIJA 4KKTA 3T51B 4PV1C 3SR1A 2ZT9C 3S1NB 4IQZA 3HEJA 5IGCA 4KHZA 1D5XC 4KY7A 4DAPA 5D3DA 4K6DA 2PMZB 2F03A 4H0LC 3HOYB 1HXYD 2D62A 1BQQT 3I70A 1EEID 2L4NA 2DNCA 1LT3D 4EQNA 1STNA 3ONAB 2B2TC 2E75C 2K32A 1AW7A 4CJ1B 1SYGA 1XWEA 1PDQA 1QNKA 3NSWA 1KDCA 4UAIA 1VCIA 1ZYRC 5JJZA 4B9XA 3J80L 5C0XG 1T5EA 2K5DA 4KJNA 1G91A 2ID0A 2JXMB 1MD2D 4DNTB 2RSOA 1B50A 2BE5D 1PLFA 2X6GA 3I4NB 1JE4A 4CGYB 2SOBA 3KLSA 1NAPA 1DOLA 4F7XA 1G2TA 3OIQA 4RKLA 3VA5A 3MVVA 4ZRZA 1TWHB 1Z7TA 1XXGA 1A2TA 2NN6H 4IN3A 2KCCA 1TS5A 1MGSA 4HCEA 4IURA 1CTMA 1U4MA 2F0FA 3HZXA 1HTLD 1A3VA 3V2TA 2NVYB 3HOXB 1H9MA 3K7AB 4K2KA 1HFGA 1H9SB 4R8NA 1WTWA 1JOOA 1D1KA 3EA6A 5C5LA 4DF7A 4C3IG 3FPUB 2CHBD 1WTXA 3RZOB 3GTPB 3K58A 1JOQA 3IFTA 4RCNA 4KN7C 3Q23A 4I7ZC 3URYA 2IT1A 2AQ3B 3H09A 1V1PA 3TSSA 1IW7D 2PO4A 3P7JA 3A8KE 2KCNA 1UEAB 2EY6A 4DGZA 5C0XJ 1RDPD 2EDGA 2Q8TA 3D6WA 1ESRA 3DHQA 1ONLA 1MSHA 3S1MB 2F0DA 2E76C 4EQPA 1TKWB 2SEBD 2WACA 1TWFB 2E2DC 1SYFA 1JOKA 3OSOA 3NQTA 2J0TD 3I72A 1BCPB 3VR3A 2JE6I 4C2MB 3S9WA 1EL0A 3S1RB 3AU7A 3VR2A 3J7YW 3H0GB 1AP0A 4YIJA 4C3JB 1CA5A 4OL7A 1ENAA 5C4JB 2B63B 1Z6HA 3A7LA 3M4YA 2KA7A 4TKOB 1F2MA 4XXEA 3J80E 1EY8A 1HUNA 3BDOA 3W2DA 3GTKB 3UI2A 4C1NI 4HEDA 2Z4HA 5A35A 1SJHD 5BN3A 1PTOB 2PW5A 3NK9A 4LJZC 1UUPA 2ICIA 4ZAIA 1HA5A 5KNDA 1HFNA 1S5BD 1S5ED 5IGFA 4G4KA 2BA0A 3X3NA 5IOCA 1DM0B 2QCPX 3MHBA 3M4OB 5EKKA 5D3IB 4HMJA 4KI0A 4IUNA 2NVQB 3OMCA 1GHKA 2G9DA 1CHPD 4ZUIA 3V96A 2YU9B 1DXMA 1RJTA 2EPBA 2A68C 1PFMA 3PUWA 1ENFA 2E2HB 5I9OA 4HSPA 2R93B 1UAPA 4DA2A 3I4MB 1F2YA 5JAVA 1O7ZA 3OOCA 3MXPA 1BUVT 4KD3A 1PZID 5FO7B 3JAML 3NTIA 4NW2A 1FD7D 5T1IA 4J1MA 3HKZB 1GJXA 1HHVA 3HOVB 4DXFA 2FINB 4H44C 3J81E 2ZXPA 3DWQA 2LKVA 2XIWA 1K83B 3R8BA 1YNJD 2F1MA 3KLRA 1BCPD 1RODA 3L7ZC 4TQUS 4QUCA 2HCCA 4JK1C 4HTHA 2V4DA 4IFDI 2A6ED 3QB3A 5KRUA 3GO5A 5K36G 4C3JG 5HGTA 1WTQA 4ODGA 1A2UA 3CKIB 5I2YA 3MA2B 3QIAA 2K6AA 1EZ6A 4I65A 1LT5D 2A6HD 1H9SA 3PUXA 3K5LA 1PTOD 3L9AX 1Q1EA 5KYIA 1R4PB 3R93A 2NVTB 1TY2A 2F0IA 2WB1B 3LX0A 1TS4A 4NP5A 2XRQD 4MN3A 2O5JC 3BVZA 3TP7A 2K5WA 4FNFA 1O7LA 3ND8A 1HQRD 1SNQA 5CYUA 1S5CD 1A3TA 1SNPA 1LTSD 1OXXK 1S5FD 2R7ZB 2F0KA 2AWNA 3I90A 1STBA 4G57A 3EJIA 4AYBB 3MTSA 2JA6B 1OXTA 5C4ZA 5IGDA 2AUKA 2XN9C 3DM1A 2Z1CA 1AZQA 3GTJB 5M3MB 4XYOA 5FLXE 2D5DA 1HPCA 2RSNA 1JORA 2F0UA 1AEXA 1M4VA 2QF7A 2ZXOA 4WORA 3QO2A 3ND9A 4DK0A 4G7ZC 4FF3A 4ID6A 4XT3B 4RGOS 2BDNA 3FMCA 5J1ZA 2EVBA 5IT9L 2AWOA 3JAME 3NE5B 4U673 1PRTC 3X3MA 4OGQC 1DCZA 4A3BB 4XT1B 2PCFB 4S3SA 2RQXA 5JEAJ 3F2UA 4ZQ3A 1DJRD 1OO9B 1LTID 2KEDA 5FKAC 3PV0A 4C56C 1TS2A 3Q24A 2WAQB 3K6OA 4KN4C 5EGTA 1BO0A 1EU4A 3QJYA 3I91A 5EKIA 4ZKCB 1F2ZA 1HTPA 1EYDA 4R9WA 5IGEA 4ULLA 2CVRA 4OO1I 4DNRB 2C9OA 4Q0FA 1ICWA 4FYDA 2LY7A 3M7NA 4IUTA 5TSSA 4N9PA 3A55A 4XQNA 5DM63 2IW3A 4QUFA 2HQEA 2VB2X 3HOUB 2FFKB 1ET9A 3IAYA 3HS0C 3RD4A 2B2WC 3DXJC 3MXNA 3NPPA 4KKSA 1ZYRD 5G3LD 1EZ8A 5CMDA 2WV6D 2KECA 3R2IA 3KLSX 5CV7A 4PMWA 3NTKA 3TMEA 5EKLA 1EFID 4RFBA 1MI2A 1Q1BA 1GUSA 3A56A 3IFDA 3FKIB 2SNMA 2EXZA 2F0MA 3FEWX 2B2YA 1SYBA 1KDBA 4IUPA 4IUUA 3MC0B 2EJMA 5I6WA 4EVOA 3SK5A 3RLFA 2Z4IA 3QWNA 2N55A 1X3PA 3H91A 3GTQB 2B8FA 5EPKA 1CM9A 4CKEA 4UDUC 2FMCA 2RA4A 2XNAC 1KLGD 2QEJC 3TZUA 5A2QL 2JP1A 1DOKA 5KYLA 1TQOA 2IPKD 3T16A 1NUCA 1F9RA 3LWEA 5IT9E 1JC7A 2I07B 1RHPA 4N9TA 2ENBA 1EY4A 1F77A 3DEOA 2MHVA 1FR3A 1QILA 3NUCA 4K6LA 2ICEC 4FXDA 2VB3X 4WJWA 1EIHA 3MFGA 3BYTB 4OO1H 1B44D 1TS3A 2B2TA 1QJOA 3HOZB 4IZ8A 3BYYB 1F9SA 2O5IC 1Z47A 2M2LA 2VNUD 1OXSC 2CW0C 3H94A 5CORA 4LK1C 1ET6A 5EPLA 2EZVA 1JQYD 5EQ0A 1EEFD 2YYZA 3V05A 2EYHA 2XWJB 4FVMA 3E6ZX 3R3OA 2RBMA 4HR7B 3D31A 3N52A 3T13A 1OXVA 1YNND 2A69C 1IYUA 1BBXC 2KHSA 1MBYA 3PIO3 5NUCA 3HP3A 3FVQA 3BZDB 3DMUA 3I8ZA 1Y69U 1NSNS 4BBRB 3ZYYX 1EOTA 3MFYA 4PQXA 2EY5A 1W6KA 3J81L 5DNFA 2PYKA 1JICA 3D6CA 2K1BA 3SK4A 2B2VC 1WD0A 4PMCA 1SDFA 1GOZA 2E74C 3VR4A 3PO2B 3DUZA 1K8MA 3GTMB 2B2UA 5FO8B 1BOSA 1ML0D 1H9JA 2A68D 5A2QE 3C1FA 2L55A 3J7AV 4XQQA 2F0JA 4NKLA 2PQEA 3TP8A 2F0WA 3A7AB 1NCVA 1CA6A 3VYRA 5AFWA 1RD9D 4Y7NB 4XYQA 3LNNA 1RF2D 4H13C 5CBAE 2R3ZA 1O78A 5FK9C 3ITPA 5ELFA 4QF4A 1EYAA 1MSGA 1LV9A 1X3QA 3BDCA 3OIPA 3GTGB 2FHTA 2JSOA 3SE0A 2K04A 5F2DA 2SNSA 1BCPF 4RAUC 1IYVA 5BN4A 1PRTB 1D2BA 1E2ZA 3P20A 3HG9A 5I2XA 3SK6A 5C3XA 1C8CA 1CFMA 2NVXB 1SEBD 1S4ZA 2FJ2A 1I3QB 3MZ5A 1CT1D 1JWMD 4KKUA 3VYTA 4RHRA 1LLRD 2PPBC 1GHJA 3VR6A 3NP8A 2JA5B 2GA4B 1TT2A 1DOMA 3TDQA 1CI3M 2F0OA 2RDHA 5I4DA 2K7VA 2AUJD 1PZKD 1KNAA 5FLXL 1PXUA 5KEEA 2L12A 1PTOF 1IKLA 3NQIA 1T5XD 3CRLC 4BWGB 2IX3A 2F0VA 3VR5A 3VYUA 2A74C 3CHBD 1SYDA 5DEHA 2WKCA 3W3AA 3IKJA 5KNBA 5M3FB 1XTCD 2H1EA 1B9NA 1E2WA 1Y8PB 4IFDG 1I50B 3T56B 3RZDB 3SVMA 1SE2A 4Q5VA 1U4RA 4C3HB 4A3DB 3H3VC 2M9VA 4B9WA 3BVMA 3EROA 2OT2A 2NTTA 5C3EB 3K0YA 1GUWA 2OXPA 1Y1WB 3TP6A 1ESFA 2EYMA 4PMBA 1UNSA 5JVG3 4GZYC 5ISRA 5KGUA 1A15A 1LTBD 1CHQD 5C3WA 1FNUA 1PRTD 3QOJA 2F0PA 1LTRD 4DU9A 1SJED 5FOBB 3PO3B 1NR2A 2WIIB 1HA6A 2O2LD 4HN7A 4P2CB 2EJFC 4DXGA 4KD4A 1EWHA 1STHA 3G7LA 2NYZD 2Q8IB 3FDTA 1QE6A 1KNEA 4IFDJ 3HGBA 2EY2A 1PFNA 5ELCA 4A3KB 4C1NK 4K5WA 3WOFA 3KK7A 1SYEA 3PIP3 1KAAA 1ZXTA 1WD1A 1Y8OB 3VYSA 1KTKA 5DAUA 1O80A 1LO5D 5E3FA 1J9OA 5ELBA 2LFNA 1Y1VB 3T53B 4HAEA 1I4RA 1STGA 5G3LF 2NZ1D 3DEPA 2XWBB 4K5XA 4DK1A 4QIWB 1SAPA 2IWHA 2EY1A 5CV5A 4K8IA 1FNVA 3N6RA 3VA7A 5CV9A 4KY6A 2K5QA 1E0BA 1SMYC 3BS1A 1XYIA 3EQLC 5K5PA 2KVMA 4U68A 4C3HG 2XRSD 4A3JB 2C5CA 3Q22A 4RKBA 1A6XA 3AB9A 3NHHA 1B1ZA 3EFXD 3J7AF 2QKIC 4QMGA 3BDLA 3GD7A 4IALA 3HOWB 1VF5C 1WCMB 4K14A 2EE1A 2K03A 2B39A 2I46A 4DAYA 1PYWD 1TIID 2BCOA 4HCSA 2Z8LA 3CRKC 1H9RA 1STAA 4R8IA 1D6EC 4TSSA 1W6JA 4BY7B 2K28A 5CR3A 1DONA 4ZKBB 3FRPB 4IUQA 2KOLA 5D14A 1SE3A 5K36H 3A8JE 4PNYA 3S14B 3OWFA 2DY8A 2NN6G 3E5SA 1TR5A 4M1UB 4K8JA 2JA8B 3ERQA 1PMRA 3I73A 5C5MA 5LHY1 2PZWA 4ILWA 4WRDA 4RHSA 4QB4A 1DD2A 1E2VA 1RTOA 5CV8A 1I4PA 1H9KA 4OHJA 1CQFA 3WDNA 1GXDC 5IODA 4F8MA 4KHVA 1EU3A 3PUYA 2NWGA 1EQVA 4A3EB 3RUZA 4BS9A 1LACA 5JEAH 1AFPA 1PTOH 2B2WA 3TBIB 1V8QA 2F0HA 3IL8A 2WP8J 1G2SA 2IX1A 4HMIA 2WINB 4L8JA 2EOTA 2PW7A 3WOEA 2CW0D 1QOHA 5JOBA 3D8GA 5COYA 4WFN3 2L9HA 5E4XA 1Q3LA 1FYCA 1SE4A 4V0BA 3DWPA 3GV3A 3K59A 3C46A 1IL8A 2VXWA 1I6HB 2L5TA 2F0EA 4EGVA 2A69D 3A8IE 2EYFA 4RGNA 5I9PA 2HUGA 2K33A 3MEHA 3NTHA 1STYA 3D3RA 1SYCA 1CZGA 4O42A 3MXGA 1Q8IA 3PMFA 2BOSA 1GUTA 1BR9A 5M5YB 4CHTB 1CZWA 1SBBB 5KNCA 2R6GA 4FXGC 1AZPA 2PZUA 3SK8A 2N88A 2EYPA 3O13A 4ZUJA 4TRDA 2F4IA 1IKMA 1SNOA 4BA1I 3P1HA 1Q12A 4J6HA 1JWUD 3T4AC 3I3CA 2R92B 1TWCB 2NUCA 3SEBA 1ZEQX 2BDOA 2DNEA 5CGKA 4KY5A 5C6AA 3U9OA 4RCOA 2KJXA 2J4XA 5C0XI 4NDXA 3P75A 3FPPA 1EYCA 1D5MC 1ILQA 5CV6A 1I6VC 2PZTA 3S16B 2F0QA 2KUMA 5E4WC 5EBDA 3EVQA 5ELEA 3KBXA 4LMQD 2H4OA 2AQ2B 2ZXRA 1L0XB 3C3LA 1A3UA 1G291 1ENCA 2QDBA 2Q8RE 1U9RA 1LTTD 4OIKA 1U4LA 3MAQA 2D2CC 1LTAD 2LMCB 1ILPA 1TY0A 5LL6S 4BY1B 4L6TB 2E2IB 3DWAA 1L0YB 4XTCS 2A73B 2TMPA 3KBGA 4CJ2C 2B2UC 2RDFA 3AMUA 4L63B 2JEBI 2MGSA 2Y0SB 2F3WA 3OW7A 4NMZA 1S5DD 2B2VA 1Y8NB 1SNDA 4IUVA 2BE5C 1B4OA 1D1IA 3S17B 2NBFA 1SFOB 4ZYSA 4RA8A 1FGBD 4DN4M 2NB0A 1EY5A 4HSVA 1DZ1A 2DN8A 1DYQA 4RGTA 4X3KA 1SNCA 1M8AA 3S1QB 3CQZB 1WTOA 3OHXC 1WTPA 1TWGB 5C44B 1EY7A 1YNNC 5J22A 4MIUA 3NWSA 3K5OA 3M7GA 1JR0D 5M5WB 3TP5A 1PFBA 5EBCA 5C0XH 2JYOA 2RKSA 4CJ0B 2KQ3A 3G6JB 2J7ZA 3Q6SA 1WTVA 2EYJA 3MXUA 2K01A 4ME5A 2OF1A 3SDZA 4FF4A 2MPMA 4EQOA 2RVLA 3GV6A 1BXTA 1IW7C 3OWEB 4X3UA 5C4HA 4ZK9B 4F87A 4XQJA 1PRTF 1X32A 3Q0AA 2XSCA 1I4XA 3PUZA 2NTSA 1XX8A 1I4HA 3NXWA 1II3A 4H7BA 2MUYA 3TN2A 3R2TA 3GP7A 4RH6A 2JEAI 3SHLA 3RMHA 3S2HB 2FMMA 4KMUC 3QOLA 3GTOB 1RCVD 2B8GA 2L0CA 4E6IA 4J8QA 4B08A 2IX0A 5E1FA 1V43A 4ABNA 1VDZA 1SSOA 4CKCA 2XVSA 3PUVA 1AN8A 4FP5D 1VMPA 1EY6A 5EJWA 2TSSA 1IHZA 1LT4D 1OXUA 1B53A 4X3SA 3NWTA 4KK7A 1U4PA 1F2LA 2HCIA 4FF1A 5JVH3 3E0JA 3K5NA 1R4QB 1SMYD 4K5VA 5CV4A 4XDXA 4JBWA 1JB3A 2PNRC 1WVLA 4A93B 2A5HA 3H6MA 3S2DB 5CC4A 2G9HD 3MWYW 4FXKC 1JWSD 1TU2B 2DY7A 1QB5D 4KV6A 1C4QA 1BDOA 4XIGS 1O7YA 1I4GA 2M00A 2X69A 1GUOA 4BA2I 1LT6D 1EQTA 4MHEA 1B9MA 2QILA 5JEAG 2O4XA 5M9OA 1ZKOA 2WKDA 4KJOA 3OMGA 5KIXA 1EY9A 3C1EA 1RKNA 2F0SA 1KDAA 1KABA 4LAAA 4M8AA 4G7OC 1CQVA 2F3VA 1K8OA 1RTNA 1SNMA 1KLUD 4DAVA 2MP1A 1LTGD 2BA1A 1WTRA 1YNJC 1HRJA 4CKBA 5JPNC 2SDFA 1BCPC 2F0LA 3M3YB 4QCLA 4FF2A 4A3MB 2VUMB 4CBVA 5M5XB 4FO2A 1C48A 4BBSB 2HDLA 2L11A 3K57A 1QCBD 2A6EC 5C4XB 1NR4A 3OPOA 1GUGA 1JCKB 1BNZA 2EYOA 3HRZC 1B2TA 1FNWA 2LS01 3K5MA 5IIFA 3LWUA 1LABA 4X3TA 4KTAA 5T1GA 2IJ0A 2MJ8A 2AQ1B 3A54A 3GTLB 2OEOA 3NBIA 1F9PA 2A6HC 4A3IB 4OO1G 2JA7B 1PTOC 5HURA 2X6LA 4IFDH 1SXTA 1J8IA 3D4WA 3M85A 3S15B 1R9TB 1V1PB 4RGMA 1HUMA 5EPJA 1QNUA 1F9QA 1TVXA 1HCZA 3QG1A 4A3GB 3CU7A 3NBHA 3C2PA 5JPMC 1HQMC 2EYLA 1EIGA 3SXHA 5I6YA 2D9UA 1TWAB 4A3FB 1VMCA 3BG3A 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUP A;  3F2U A;  1QG7 A;  2N55 A;  1B4O A;  3N52 A;  1X3P A;  2B2T C;  3ONA B;  4ZLT F;  3H91 A;  4CJ1 B;  1SAP A;  1GUW A;  2HDM A;  3I3C A;  3P7J A;  5EPK A;  1BBX C;  1CM9 A;  2B2W A;  4RWS C;  1RTN A;  2KED A;  1PDQ A;  1QNK A;  4RA8 A;  2MP1 A;  1G6Z A;  3R93 A;  2RA4 A;  4DN4 M;  3IL8 A;  2K05 A;  1G2S A;  1BO0 A;  1WTR A;  4HSV A;  1E0B A;  1RJT A;  4UAI A;  1HRJ A;  2Q8T A;  2SDF A;  1XYI A;  1DZ1 A;  2EPB A;  3HP3 A;  4MN3 A;  1C8C A;  1PFM A;  1S4Z A;  2FJ2 A;  2EOT A;  3I91 A;  5EKI A;  4ZKC B;  2JP1 A;  3I8Z A;  4RAU C;  1DOK A;  4X3K A;  1M8A A;  1ESR A;  3D6W A;  2KVM A;  1MSH A;  1SSO A;  4U68 A;  1EOT A;  5JJZ A;  1F9R A;  3LWE A;  1WTO A;  4R9W A;  2HDL A;  1WTP A;  2L11 A;  1A15 A;  5COY A;  2CVR A;  2L9H A;  1VMP A;  1O7Z A;  3DEP A;  5E4X A;  1BF4 A;  5DNF A;  2B2Y C;  1Q3L A;  1G91 A;  1RHP A;  1DOM A;  1JIC A;  1ILQ A;  1NR4 A;  5EJW A;  3DEO A;  1ICW A;  1KNA A;  1NR2 A;  1BNZ A;  2EE1 A;  2IL8 A;  4NW2 A;  3GV3 A;  2K03 A;  2KUM A;  2RSO A;  1IL8 A;  1PFB A;  2VXW A;  5E4W C;  2K1B A;  1B2T A;  2L1B A;  5T1I A;  1B50 A;  1HA6 A;  2JYO A;  3I90 A;  4IUT A;  2L12 A;  1AP0 A;  1HHV A;  4HCS A;  1B53 A;  1PLF A;  4CJ0 B;  1IKL A;  4X3S A;  1EIH A;  2B2V C;  2FIN B;  1JE4 A;  2KEE A;  1SDF A;  2X6G A;  3KBX A;  4X3T A;  1WD0 A;  1CA5 A;  4QUF A;  1NAP A;  2J7Z A;  3MTS A;  1U4P A;  4LMQ D;  1DOL A;  1F2L A;  5T1G A;  1G2T A;  2HCI A;  2MJ8 A;  3DM1 A;  2FFK B;  3Q6S A;  2B2T A;  1AZQ A;  1WTV A;  3TZD A;  3G7L A;  2K01 A;  2NYZ D;  1F9P A;  2Q8R E;  2XIW A;  4R8I A;  1EL0 A;  2HUG A;  2MPM A;  2B2W C;  2B2U A;  2RSN A;  2RVL A;  3FDT A;  4OIK A;  1U4L A;  3GV6 A;  1B3A A;  1ML0 D;  2K28 A;  4X3U A;  1QE6 A;  5CMD A;  4O42 A;  2KEC A;  1MGS A;  4XDX A;  4ZKB B;  1KNE A;  1ILP A;  4IUQ A;  1F9S A;  2KOL A;  5D14 A;  1ROD A;  2X6L A;  3QO2 A;  4IUR A;  1U4M A;  5D65 A;  4ZK9 B;  5CBE E;  1PFN A;  1WVL A;  1J8I A;  1X32 A;  3MWY W;  2M2L A;  4QUC A;  2HCC A;  4XT3 B;  1MI2 A;  2DY8 A;  2H1E A;  4OIJ A;  2DY7 A;  1HUN A;  3IFD A;  1HFG A;  1WTW A;  2BDN A;  1O7Y A;  1NCV A;  1CA6 A;  1XX8 A;  3UI2 A;  1HUM A;  4HED A;  5AFW A;  5EPJ A;  3SVM A;  1AZP A;  2X69 A;  4CJ2 C;  1F9Q A;  1TVX A;  1U4R A;  2B2Y A;  2B2U C;  1ZXT A;  3FPU B;  1WTQ A;  4IUP A;  2N88 A;  4IUU A;  5CBA E;  1WD1 A;  1EQT A;  2R3Z A;  1WTX A;  4MHE A;  5COR A;  3TN2 A;  5EPL A;  1O80 A;  1RTO A;  1EIG A;  2MGS A;  5EQ0 A;  4ZAI A;  1J9O A;  2D9U A;  1IKM A;  1DON A;  1HFN A;  1MSG A;  1LV9 A;  1X3Q A;  4XT1 B;  2FHT A;  1VMC A;  2B2V A;  4HAE A;  2NWG A;  2K04 A;  4IUV A;  2L4N A;  2FMM A;  2NZ1 D; 
#chains in the Genus database with same CATH topology
 3KUP A;  3I56 A;  1QG7 A;  4A93 G;  1GUN A;  2CQA A;  1ASY A;  4Y7N H;  4ZLT F;  2R61 A;  5IGB A;  1QWY A;  2HDM A;  4K2L A;  3U4Z A;  4RWS C;  1CK1 A;  1B8A A;  3GQB A;  3D4R A;  3U9S A;  5ELD A;  2F0G A;  4DV1 Q;  1G6Z A;  2OTL A;  2K05 A;  4O1N A;  3H15 A;  3A5U A;  4JI2 Q;  2EQS A;  2N49 A;  1D5Z C;  5J39 A;  4LWC A;  3GTG H;  3BVG A;  5DM7 3;  2WB1 G;  5IGG A;  1EY0 A;  2UXC Q;  4JI1 L;  4DFA A;  1V1O A;  1BF4 A;  2B2Y C;  2Z9H A;  3KF8 A;  4K0K L;  3CCM A;  2ZM6 L;  4V19 0;  1JB7 A;  4Z9C B;  1YVC A;  2F0N A;  2IL8 A;  2F0T A;  5LL6 X;  1EWC A;  4NXM Q;  3A5Z B;  2NVX H;  4G7H C;  2L1B A;  2NN6 I;  1I3Q H;  4F88 A;  4C3I B;  2KEE A;  2R7Z G;  2E2J B;  1G8Z D;  5LMU Q;  4GN3 B;  1P16 A;  1I4Q A;  1C0A A;  1XMO L;  1VF7 A;  1STE A;  5FO9 B;  3TZD A;  2JA5 H;  3D4D A;  2UUA L;  2RDG A;  2VUM G;  4A3M G;  1WTH A;  3I4L A;  1YIJ A;  1B3A A;  2Q2I A;  2WB1 E;  2PI2 A;  4BBS G;  1A62 A;  2A19 A;  5M3M G;  5CBE E;  5D65 A;  4GOP B;  5BN5 A;  3PIP A;  5C4X G;  1Q90 A;  3L3O C;  2EJG C;  2K5N A;  4OIJ A;  4POG A;  2E2H H;  4KKT A;  3T51 B;  4PV1 C;  3SR1 A;  3JC6 6;  4LFA L;  2ZT9 C;  3S1N B;  2R93 H;  3AEV A;  2E5L Q;  4YCV A;  1K8G A;  4IQZ A;  2I5L X;  3HEJ A;  5IGC A;  4KHZ A;  1D5X C;  4KY7 A;  4DAP A;  5D3D A;  2JJQ A;  4K6D A;  1WI5 A;  2PMZ B;  1B7Y B;  2F03 A;  4Y52 H;  4H0L C;  5M3F H;  3TRZ A;  3HOY B;  1HXY D;  2D62 A;  2UXB Q;  1BQQ T;  4YWM A;  3I70 A;  1EEI D;  2L4N A;  2DNC A;  1LT3 D;  4EQN A;  1STN A;  4LFB L;  3ONA B;  1I50 H;  2B2T C;  3RZD H;  2E75 C;  2K32 A;  1AW7 A;  4CJ1 B;  3PGZ A;  2HHH Q;  1LTL A;  1SYG A;  1XWE A;  1PDQ A;  1QNK A;  1YHB A;  4A3D H;  3NSW A;  3M9B A;  1KDC A;  3CC4 A;  4LUO A;  2KBN A;  4UAI A;  1VCI A;  4HJ7 A;  1ZYR C;  4A3G G;  2WAQ G;  1VQJ A;  5JJZ A;  4B9X A;  5C3E H;  3J80 L;  5C0X G;  2UXD L;  1T5E A;  4JI0 L;  4A3F G;  2K5D A;  1Y1W H;  4GLX A;  2RF4 A;  4KJN A;  1G91 A;  2ID0 A;  2YTX A;  1EYG A;  2JXM B;  1MD2 D;  4DNT B;  2RSO A;  1VQ6 A;  4JI8 Q;  1B50 A;  2BE5 D;  1PLF A;  2X6G A;  3I4N B;  1JE4 A;  4CGY B;  2SOB A;  3KLS A;  1NAP A;  2MO0 A;  1DOL A;  4F7X A;  1G2T A;  4B3T L;  3OIQ A;  4RKL A;  3AYH B;  3VA5 A;  1D8L A;  3MVV A;  4ZRZ A;  3DM3 A;  1TWH B;  1Z7T A;  1XXG A;  1A2T A;  2WAQ E;  2NN6 H;  4IN3 A;  2KCC A;  3PO3 H;  4B3R L;  1TS5 A;  3F2D A;  1K3R A;  3T1H Q;  1MGS A;  4HCE A;  4IUR A;  1CTM A;  1U4M A;  2F0F A;  3HZX A;  1EQR A;  1HTL D;  2AHO B;  2R7F A;  1A3V A;  3V2T A;  1SMX A;  1EQQ A;  3DLL A;  2NVY B;  3RNU A;  2K4K A;  3HOX B;  1H9M A;  3K7A B;  4K2K A;  1HFG A;  1H9S B;  4R8N A;  3F2B A;  1WTW A;  1JOO A;  1D1K A;  3EA6 A;  5C5L A;  1YJN A;  3ICE A;  4DF7 A;  1GM5 A;  4YCU A;  4C3I G;  3FPU B;  2CHB D;  2K5V A;  1WTX A;  3RZO B;  3GTP B;  3K58 A;  1B70 B;  1JOQ A;  1B3Q A;  4LF6 L;  3IFT A;  4RCN A;  4JOI C;  4KN7 C;  3Q23 A;  1S3O A;  4I7Z C;  3URY A;  2IT1 A;  4A3K H;  1HNZ L;  2AQ3 B;  2JA6 H;  4P71 A;  3H09 A;  1V1P A;  3TSS A;  1IW7 D;  1AE2 A;  2PO4 A;  3P7J A;  3A8K E;  1VQ7 A;  2XGT A;  2KCN A;  1UEA B;  2EY6 A;  4DGZ A;  5C0X J;  1QVF A;  1RDP D;  2EDG A;  2Q8T A;  4B3S Q;  1U0L A;  1Y1V H;  3D6W A;  1ESR A;  1RL2 A;  1ONL A;  3DHQ A;  1MSH A;  3S1M B;  2F0D A;  2E76 C;  4EQP A;  1TKW B;  2SEB D;  3HOY G;  2WAC A;  1TWF B;  1E7Z A;  5IP9 H;  2E2D C;  1SYF A;  1JOK A;  3OSO A;  3NQT A;  2J0T D;  3I72 A;  1BCP B;  4JYA Q;  4N8X 1;  3VR3 A;  2JE6 I;  4JI5 L;  4C2M B;  3S9W A;  1EL0 A;  1PH5 A;  1N36 Q;  3S1R B;  3AU7 A;  1UE1 A;  3VR2 A;  3J7Y W;  3H0G B;  1AP0 A;  4YIJ A;  4C3J B;  3D0F A;  1CA5 A;  4A3J H;  1K73 C;  4OL7 A;  1ENA A;  1K0R A;  5C4J B;  2B63 B;  1Z6H A;  3A7L A;  3M4Y A;  3CXC A;  2KA7 A;  4TKO B;  1F2M A;  1VQL A;  4DV3 Q;  3STB C;  3CPF A;  2PMZ E;  1Q81 C;  1OTC A;  4XXE A;  4DV5 Q;  3FP9 A;  3HOZ G;  2DUD A;  1X65 A;  4QL5 A;  4YCW A;  3J80 E;  1EY8 A;  4LF7 L;  1HUN A;  3BDO A;  1NNX A;  3W2D A;  2EIF A;  3GTK B;  3UI2 A;  4C1N I;  4HED A;  2Z4H A;  1UEB A;  5A35 A;  1SJH D;  5BN3 A;  3I4N G;  1PTO B;  2PW5 A;  4L5S A;  4BY7 H;  3F2C A;  3NK9 A;  4LJZ C;  1K3B C;  1UUP A;  2ICI A;  4ZAI A;  1HA5 A;  2FXQ A;  5KND A;  1HFN A;  5ELN A;  2P5Z X;  1S5B D;  4DR3 Q;  3S14 H;  1S5E D;  3ZJY C;  4GOP A;  5IGF A;  4G4K A;  2BA0 A;  4MTN A;  3X3N A;  1DM0 B;  2QCP X;  5IOC A;  5IE8 A;  1YHA A;  3MHB A;  3M4O B;  2JA8 H;  5EKK A;  4HIK A;  4DPG A;  1N32 L;  5D3I B;  4HMJ A;  4KI0 A;  4IUN A;  1UE7 A;  4DV7 Q;  1QZG A;  3HOX G;  2NVQ B;  3OMC A;  1GHK A;  3ER0 A;  2G9D A;  1CHP D;  1LM0 A;  4ZUI A;  3V96 A;  2YU9 B;  1DXM A;  1RJT A;  1IBM Q;  2EPB A;  2A68 C;  1PFM A;  2Z6K C;  3PUW A;  3W1G A;  3M4P A;  1ENF A;  2E2H B;  5I9O A;  1QZH A;  4HSP A;  4A3E H;  2R93 B;  1UAP A;  3MXN B;  3CP0 A;  4DA2 A;  3I4M B;  1F2Y A;  5JAV A;  1O7Z A;  1EOV A;  3OOC A;  3MXP A;  2VQF L;  2YV5 A;  4H02 A;  2CWP A;  1BUV T;  4KD3 A;  4JI3 Q;  1PZI D;  5FO7 B;  3JAM L;  3NTI A;  4JI4 L;  4NW2 A;  1IBL L;  3K0X A;  2K75 A;  1FD7 D;  5T1I A;  4J1M A;  3HKZ B;  1GJX A;  2VQE L;  1VQC A;  1HHV A;  3HOV B;  4DXF A;  2FIN B;  4H44 C;  1NE3 A;  2F4V L;  1KD1 C;  3J81 E;  3CME A;  2ZXP A;  2VL6 A;  4L5T A;  3DWQ A;  4IJH A;  5FLM G;  2LKV A;  1KIX A;  2XIW A;  4LF4 L;  1K83 B;  3R8B A;  1YNJ D;  2F1M A;  3KLR A;  1BCP D;  3UDG A;  4IPC A;  3I55 A;  1PYS B;  1ROD A;  2VS1 A;  3L7Z C;  4TQU S;  4QUC A;  2HCC A;  1I6H H;  1PH8 A;  4JI7 L;  4JK1 C;  4HTH A;  2V4D A;  4IFD I;  2A6E D;  3QB3 A;  5KRU A;  4LF8 L;  3U58 A;  3GO5 A;  5K36 G;  4C3J G;  5HGT A;  2UUC L;  3ERS X;  1WTQ A;  2CQO A;  4ODG A;  1A2U A;  1VQ8 A;  3CKI B;  5I2Y A;  2B63 G;  2H5X A;  3MA2 B;  3RLN A;  3IRB A;  3QIA A;  2K6A A;  1EZ6 A;  1Z9F A;  5ELO A;  3CAM A;  4CDD C;  3PF5 A;  1VQB A;  3KDF B;  4I65 A;  1LT5 D;  2Q2T A;  2A6H D;  2OWO A;  1H9S A;  3GDE A;  3PUX A;  3K5L A;  1PTO D;  1D7Q A;  3L9A X;  1Q1E A;  5KYI A;  1R4P B;  4OX9 L;  3R93 A;  2NVT B;  1TY2 A;  2F0I A;  2ZTC A;  2WB1 B;  3LX0 A;  1TS4 A;  4NP5 A;  2XRQ D;  4R4Q A;  4MN3 A;  4YY3 L;  2O5J C;  3BVZ A;  2UUB L;  3TP7 A;  3NEL A;  3RLO A;  2K5W A;  5JJL A;  3AFP A;  4FNF A;  1O7L A;  4L5R C;  3ND8 A;  1HQR D;  2N3S A;  1SNQ A;  5CYU A;  2L15 A;  2R92 H;  1IYJ B;  1S5C D;  1TWC H;  3E9I A;  4GLV B;  1A0I A;  1A3T A;  1SNP A;  1IZ6 A;  1LTS D;  1OXX K;  1S5F D;  4I7A A;  2R7Z B;  2F0K A;  2AWN A;  3I90 A;  1STB A;  4G57 A;  3EJI A;  4AYB B;  2B29 A;  2G5D A;  3MTS A;  2JA6 B;  2WFW A;  1OXT A;  5C4Z A;  5IGD A;  2AUK A;  2XN9 C;  3DM1 A;  5AJ3 Q;  2Z1C A;  1CSP A;  1AZQ A;  2ZM6 Q;  3GTJ B;  5M3M B;  4XYO A;  5FLX E;  2D5D A;  1HZA A;  4PZ7 A;  2HIV A;  1HPC A;  3F8T A;  2RSN A;  1JOR A;  4P75 A;  2F0U A;  3U50 C;  1AEX A;  1M4V A;  2QF7 A;  3S16 H;  2R93 G;  2ZXO A;  2VZA A;  4WOR A;  4JBK A;  3QO2 A;  3I4M G;  3ND9 A;  1SRU A;  4DK0 A;  4G7Z C;  4FF3 A;  4ID6 A;  5JJK A;  4XT3 B;  4RGO S;  2BDN A;  3FMC A;  1N34 Q;  3OW2 A;  5J1Z A;  1L0W A;  3HKZ G;  1VQN A;  3HOV G;  2EVB A;  5IT9 L;  2AWO A;  3JAM E;  5GAD C;  1HZ9 A;  1J5E Q;  3NE5 B;  2XTI A;  4U67 3;  4KHP L;  1XMQ L;  1PRT C;  1KC8 C;  3X3M A;  4OGQ C;  4BY1 H;  1DCZ A;  2E2I H;  4A3B B;  4A4I A;  3G71 A;  2QDL A;  2PCF B;  4XT1 B;  4S3S A;  4L5Q A;  2RQX A;  2HQL A;  5JEA J;  3F2U A;  2ZJP A;  4ZQ3 A;  4QJF A;  3G4S A;  1DJR D;  1E24 A;  2LSS A;  3PO2 H;  4QGU A;  1OO9 B;  3GTM H;  1LTI D;  2KED A;  5FKA C;  3PV0 A;  4C56 C;  2ZJR A;  1TS2 A;  3Q24 A;  4JV5 L;  2WAQ B;  3K6O A;  5IYB G;  1X9N A;  4KN4 C;  5EGT A;  1X56 A;  1BO0 A;  4DR6 Q;  1EU4 A;  1Y1W G;  3HKZ E;  3QJY A;  4A3L H;  3I91 A;  5EKI A;  4LFB Q;  4ZKC B;  1XNR L;  1F2Z A;  1WYD A;  1I94 Q;  3CC7 A;  4DR5 Q;  4RMF A;  1HTP A;  1EYD A;  1PH4 A;  5DLQ E;  4R9W A;  5IGE A;  5IYC H;  3BJU A;  4ULL A;  2CVR A;  4DUY L;  4OO1 I;  4DNR B;  2C9O A;  1KXL A;  1Q86 C;  1SFO H;  4LUV A;  4Q0F A;  2KHI A;  3KJP A;  1ICW A;  4GNX C;  4FYD A;  2LY7 A;  3M7N A;  1U5K A;  4IUT A;  5TSS A;  4N9P A;  3S1Q H;  3A55 A;  4DK3 C;  4XQN A;  4JI0 Q;  3J7Z C;  5DM6 3;  2IW3 A;  3I2Z A;  4QUF A;  2HQE A;  2VB2 X;  3HOU B;  2FFK B;  1ET9 A;  3EIV A;  3U4V A;  2Z6B A;  4AQY Q;  3IAY A;  3HS0 C;  3RD4 A;  5C44 H;  2B2W C;  5JJI A;  3DXJ C;  3MXN A;  3NPP A;  4KKS A;  1ZYR D;  5G3L D;  1EZ8 A;  4R4O A;  3UDF A;  5CMD A;  2WV6 D;  2KEC A;  3R2I A;  3KLS X;  5CV7 A;  4PMW A;  5M5W H;  3NTK A;  3TME A;  3J80 c;  4B3T Q;  5EKL A;  1EFI D;  1T9H A;  4RFB A;  1MI2 A;  1Q1B A;  1GUS A;  2MNA A;  1VQM A;  3A56 A;  3CCU A;  3IFD A;  3FKI B;  4B3M L;  2SNM A;  2EXZ A;  2AMC B;  2F0M A;  2VY3 A;  2ZTE A;  3FEW X;  2B2Y A;  4OEL B;  4AYB G;  1SYB A;  1KDB A;  4IUP A;  4IUU A;  2LXK A;  3MC0 B;  4NB3 A;  2EJM A;  5I6W A;  2JA6 G;  4EVO A;  3A74 A;  5L37 A;  4DR7 Q;  4AIM A;  3SK5 A;  4HJ9 A;  1QVC A;  3RLF A;  5GRO A;  1FJG L;  4JVZ A;  2Z4I A;  1JMC A;  3QWN A;  2N55 A;  1X3P A;  2CH4 A;  4GLA C;  3H91 A;  3OTO L;  4DV2 L;  2B8F A;  5EPK A;  3GTQ B;  1G51 A;  1CM9 A;  2CKZ B;  4CKE A;  4UDU C;  1HZC A;  2FMC A;  1VQO A;  2RA4 A;  4X65 L;  2XNA C;  5IP9 G;  1KLG D;  2QEJ C;  3TZU A;  3S2H H;  5A2Q L;  1HNW L;  2JP1 A;  2Z0S A;  4AYB E;  1DOK A;  2KEN A;  5KYL A;  1TQO A;  1X55 A;  2IPK D;  3T16 A;  1NUC A;  1F9R A;  3LWE A;  5IT9 E;  1QUQ B;  1JC7 A;  4PG3 A;  1PV4 A;  3QR8 A;  4A3B G;  2I07 B;  3KDF A;  3GTO H;  1RHP A;  4N9T A;  2ENB A;  1EY4 A;  3L0O A;  4P72 A;  3WWV A;  4NPS A;  1F77 A;  3DEO A;  4C3H H;  2MHV A;  1FR3 A;  1QIL A;  4CDE C;  3NUC A;  3TEH B;  1PH3 A;  2PNH A;  4K6L A;  3PF4 A;  2ICE C;  4FXD A;  3I7F A;  2VB3 X;  4WJW A;  5LMN Q;  1EIH A;  3MFG A;  3BYT B;  4OO1 H;  1B44 D;  2QW7 A;  1TS3 A;  2B2T A;  2RHS B;  4HJ5 A;  1QJO A;  3PCO B;  3HOZ B;  4IZ8 A;  2DGY A;  3BYY B;  1X3E A;  1F9S A;  2O5I C;  1Z47 A;  1IL2 A;  2M2L A;  4DV1 L;  2VNU D;  1SRO A;  1OXS C;  4DV4 Q;  4RG1 A;  1IBK Q;  2KCM A;  1E1O A;  1J6Q A;  4O2D A;  4DV0 Q;  2CW0 C;  4LF5 Q;  4DR1 Q;  3ULP A;  2JA8 G;  3H94 A;  3HOU G;  5COR A;  4LK1 C;  1ET6 A;  5EPL A;  2EZV A;  1JQY D;  1Q7Y C;  4EX5 A;  1JJG A;  5EQ0 A;  4A93 H;  1EEF D;  2QEX A;  2B3G A;  2YYZ A;  3S2D H;  3V05 A;  2EYH A;  3KJO A;  2XWJ B;  4FVM A;  4JBM A;  1I5F A;  3E6Z X;  3R3O A;  2D0O A;  4OEM B;  3CCV A;  4NXM L;  2RBM A;  4HR7 B;  3D31 A;  3N52 A;  3T13 A;  4HID A;  1OXV A;  1YNN D;  1W2B A;  2A69 C;  1IYU A;  3NEN A;  1BBX C;  1MJC A;  2K14 A;  2KHS A;  1VQK A;  1MBY A;  1CUK A;  3FKI G;  1VQE A;  3M4Q A;  1PYB A;  3S24 A;  3PIO 3;  5NUC A;  3HP3 A;  3FVQ A;  4WJ4 A;  3BZD B;  3DMU A;  4GN5 A;  2OTJ A;  3I8Z A;  4UPA A;  1N32 Q;  1Y69 U;  1NSN S;  4BBR B;  3ZYY X;  1EOT A;  3MFY A;  1Q82 C;  4PQX A;  1EIY B;  2EY5 A;  1W6K A;  3J81 L;  5DNF A;  2PYK A;  1JIC A;  2E5L L;  3D6C A;  2CWA A;  1LYL A;  1EFW A;  2K1B A;  1KRT A;  3SK4 A;  3A0J A;  4QQB X;  3M3Y H;  1M90 C;  4A3M H;  2PQA B;  2B2V C;  1WD0 A;  4PMC A;  1SDF A;  4R4I A;  2OQ0 A;  5M5X H;  1X54 A;  1GOZ A;  1L1O B;  4BBS H;  1G6P A;  2UXB L;  2E74 C;  3VR4 A;  3E3X A;  3PO2 B;  5C4X H;  3DUZ A;  1K8M A;  4JI4 Q;  3GTM B;  2B2U A;  4JCV E;  5FO8 B;  1BOS A;  1ML0 D;  1H9J A;  2A68 D;  4HJ8 A;  5A2Q E;  2NZO A;  3C1F A;  2HHH L;  5HY6 A;  2L55 A;  3J7A V;  4XQQ A;  2F0J A;  4NKL A;  1YJW A;  2UU9 L;  2PQE A;  3TP8 A;  1S40 A;  2MO1 A;  2F0W A;  4A3C G;  3A7A B;  1NCV A;  1CA6 A;  3VYR A;  5AFW A;  1YJ9 A;  4JI6 Q;  1RD9 D;  3JAM c;  4Y7N B;  4XYQ A;  3GTL H;  3LNN A;  1RF2 D;  4A3I H;  4H13 C;  5CBA E;  2JA7 H;  2R3Z A;  3HOW H;  5E7N A;  4DV6 Q;  1O78 A;  5FK9 C;  3ITP A;  1WCM H;  5HGQ A;  3CCQ A;  4LF9 L;  4JG2 A;  5ELF A;  4R1J A;  4QF4 A;  3CD6 A;  1EYA A;  1MSG A;  1LV9 A;  1N33 Q;  4BXX G;  3S15 H;  1X3Q A;  3BDC A;  3OIP A;  1R9T H;  3GTG B;  2FHT A;  1VQF A;  2JSO A;  1VQH A;  3E9H A;  4JI8 L;  2K04 A;  2SNS A;  1BCP F;  5F2D A;  3SE0 A;  4RAU C;  1XNQ Q;  2ATW A;  2AKW B;  1IYV A;  1YZ6 A;  5BN4 A;  1PRT B;  4X62 Q;  4P73 A;  3CF5 A;  1D2B A;  4IPD A;  4UP7 A;  4DAY B;  1E2Z A;  3P20 A;  3HG9 A;  5I2X A;  3SK6 A;  2NZH A;  3B6Y A;  3NEM A;  4MZ9 A;  5C3X A;  2VW9 A;  1C8C A;  1CFM A;  1TWA H;  1SEB D;  1S4Z A;  2FJ2 A;  1I3Q B;  3PQI A;  4A3F H;  3CC2 A;  3MZ5 A;  4GOP C;  1CT1 D;  1VQ5 A;  1JWM D;  4KKU A;  3VYT A;  4RHR A;  1LLR D;  2PPB C;  1GHJ A;  1Q46 A;  3VR6 A;  2I0Q A;  1YNX A;  3NP8 A;  2JA5 B;  5LMN W;  2GA4 B;  1TT2 A;  1DOM A;  5FJ8 G;  4UY8 C;  3TDQ A;  1CI3 M;  2F0O A;  2RDH A;  5I4D A;  2UUB Q;  2K7V A;  2HIX A;  2AUJ D;  1CKO A;  1PZK D;  1KNA A;  5FLX L;  1PXU A;  5KEE A;  3H3V I;  1VQG A;  2L12 A;  1PTO F;  4NXN Q;  1IKL A;  5IWA Q;  3NQI A;  1T5X D;  3BU2 A;  3CRL C;  4BWG B;  2IX3 A;  2F0V A;  3VR5 A;  4LFC Q;  1QUQ A;  3VYU A;  2A74 C;  3CHB D;  4GNX B;  4BBR G;  2MQH A;  2DJG C;  1SYD A;  4IPH A;  5DEH A;  2WKC A;  4YHH Q;  3W3A A;  3IKJ A;  3W1B A;  5KNB A;  5M3F B;  4N8F A;  4A76 A;  4C3I H;  1X6O A;  4JW0 A;  4DUZ Q;  1XTC D;  2H1E A;  2E2J H;  2F52 A;  1B9N A;  1E2W A;  4X64 Q;  1Y8P B;  4DR2 L;  1I50 B;  3T56 B;  3UDX A;  3RZD B;  3SVM A;  4IFD G;  4IPG A;  1MJE A;  1SE2 A;  4Q5V A;  1U4R A;  4R4T A;  3T1Y L;  1HZB A;  4C3H B;  4A3D B;  1YHQ A;  4FDB A;  3H3V C;  2M9V A;  3PO2 G;  1UE6 A;  1NMF A;  4B9W A;  2IY5 B;  3CCR A;  4JYA L;  3G6E A;  4CDC C;  1N36 L;  3BVM A;  3ERO A;  3S1N H;  2OT2 A;  2NTT A;  5C3E B;  4KHP Q;  2JQO A;  3K0Y A;  1GUW A;  2OXP A;  1Y1W B;  1ASZ A;  1MKH A;  5IP7 H;  3TP6 A;  1ESF A;  1GO3 E;  3EBE A;  3KLW A;  2EYM A;  4LW1 A;  3HOY H;  4DV3 L;  4PMB A;  1HR0 L;  1UNS A;  5IT9 c;  5M5Y H;  4UP8 A;  5JVG 3;  4GZY C;  5ISR A;  4DV5 L;  5KGU A;  1A15 A;  1LTB D;  1CHQ D;  5C3W A;  1FNU A;  1PRT D;  3QOJ A;  4IJL A;  1PH1 A;  2F0P A;  1LTR D;  4DU9 A;  1SJE D;  5FOB B;  3PO3 B;  4IOA A;  1NR2 A;  4GKJ Q;  2WII B;  1HA6 A;  2O2L D;  4HN7 A;  4P2C B;  2EJF C;  2GN5 A;  4DUY Q;  4DXG A;  4KD4 A;  4DR3 L;  1EWH A;  1STH A;  3G7L A;  2NYZ D;  3RR5 A;  2Q8I B;  5J3B A;  3RN5 A;  3FDT A;  3H3V H;  1QE6 A;  1KNE A;  4IFD J;  3HGB A;  2EY2 A;  3TS2 A;  4OWT B;  2JA5 G;  1PFN A;  1X3F A;  4R4C A;  3I4N H;  5ELC A;  4JI1 Q;  4A3K B;  4C1N K;  2PQA A;  3UE0 A;  4K5W A;  3WOF A;  4K0K Q;  1Q8K A;  3KK7 A;  1L1O A;  1SYE A;  3PIP 3;  1TWH H;  1KAA A;  1ZXT A;  3HFZ B;  1Y8O B;  3VYS A;  1WD1 A;  4X66 L;  1KTK A;  5DAU A;  1FVI A;  2OQK A;  1O80 A;  1CSQ A;  1SR3 A;  1LO5 D;  5E3F A;  1J9O A;  5ELB A;  2BH2 A;  2LFN A;  4JI3 L;  1S72 A;  2NVY H;  1Y1V B;  3T53 B;  1XMO Q;  1HNX L;  3K7A H;  4HAE A;  5GQO A;  3KF6 B;  1I4R A;  2UUA Q;  1STG A;  5G3L F;  1KAW A;  1K28 A;  2NZ1 D;  2XWB B;  3DEP A;  4K5X A;  4DK1 A;  5M3F G;  2CH4 W;  4QIW B;  1SAP A;  1LUZ A;  2IWH A;  2EY1 A;  5CV5 A;  4K8I A;  1FNV A;  3N6R A;  3VA7 A;  2I5M X;  5CV9 A;  3RZO H;  4KY6 A;  3GTP H;  2K5Q A;  1E0B A;  1SMY C;  3BS1 A;  1XYI A;  4LFA Q;  3EQL C;  1HH2 P;  5K5P A;  3J81 j;  2KVM A;  4U68 A;  4C3H G;  4A3D G;  2XRS D;  4A3J B;  2C5C A;  1UWV A;  1E3P A;  3Q22 A;  4RKB A;  3K81 C;  1A6X A;  3AB9 A;  3NHH A;  1B1Z A;  3EFX D;  1FGU A;  3J7A F;  2QKI C;  4QMG A;  3BDL A;  3GD7 A;  4IAL A;  3HOW B;  1VF5 C;  1X3G A;  1WCM B;  5C3E G;  4K14 A;  3TS0 A;  2EE1 A;  2K03 A;  2B39 A;  2I46 A;  1BKB A;  4DAY A;  1PYW D;  5FLM H;  1TII D;  2BCO A;  4HCS A;  2Z8L A;  3CRK C;  3S1M H;  3ULJ A;  4YWL A;  1VQP A;  4MNO A;  1MIU A;  1XTD A;  1KQS A;  1TWF H;  2KHJ A;  1H9R A;  1STA A;  4R8I A;  3S17 H;  1D6E C;  1YBY A;  4TSS A;  1YEZ A;  2ALY B;  4GN4 B;  4A75 A;  1W3S A;  4DR4 L;  1W6J A;  4BY7 B;  2K28 A;  1V9P A;  5CR3 A;  1DON A;  4ZKB B;  1WJJ A;  3FRP B;  3E0E A;  4C2M H;  4IUQ A;  2KOL A;  5D14 A;  1SE3 A;  3S1R H;  2V1C C;  3H0G H;  3CCS A;  5K36 H;  3A8J E;  4PNY A;  3S14 B;  4GS3 A;  3OWF A;  4C3J H;  2DY8 A;  2UXD Q;  3TQY A;  2NN6 G;  3PO3 G;  3E5S A;  3CQZ H;  2Q2U A;  1TR5 A;  4M1U B;  4K8J A;  2JA8 B;  3ERQ A;  3UE1 A;  1XPR A;  5C4J H;  1TWG H;  1PMR A;  1JE5 A;  2B63 H;  2PI2 E;  1KRS A;  3I73 A;  5C5M A;  1M1K C;  5LHY 1;  2PZW A;  1YIT A;  4ILW A;  4WRD A;  4RHS A;  4QB4 A;  1DD2 A;  1E2V A;  1RTO A;  3MEF A;  4GNX A;  4ALP A;  5CV8 A;  1E22 A;  3CW2 C;  1I4P A;  1H9K A;  1C9O A;  3PSI A;  4OHJ A;  1CQF A;  3WDN A;  1GXD C;  5IOD A;  4F8M A;  4KHV A;  1EU3 A;  3PUY A;  2NWG A;  1EQV A;  4A3E B;  3GTK H;  3RUZ A;  4BS9 A;  1LAC A;  5JEA H;  1AFP A;  4B3R Q;  3K8A A;  4EQ5 A;  3LGJ A;  1PTO H;  2B2W A;  5AJ3 L;  3TBI B;  4A3K G;  1V8Q A;  2NVX B;  1JJC B;  1GD7 A;  4J15 A;  2F0H A;  3CCJ A;  3IL8 A;  2WP8 J;  3J7A 5;  1G2S A;  2LXJ A;  3J80 i;  3CMA A;  2IX1 A;  4HMI A;  2WIN B;  4L8J A;  2EOT A;  2PW7 A;  3FHW A;  3WOE A;  2CW0 D;  3M4O H;  1QOH A;  5JOB A;  4UHV A;  3D8G A;  5COY A;  4DK6 C;  4WFN 3;  2L9H A;  5E4X A;  1TXY A;  1N34 L;  1Y1V G;  2NVQ H;  1Q3L A;  4LF6 Q;  1PH7 A;  2QA4 A;  1FYC A;  1CKM A;  1SE4 A;  2IHF A;  4GKK L;  4POF A;  4V0B A;  2YU9 H;  3DWP A;  3GV3 A;  3K59 A;  3C46 A;  1IL8 A;  2VXW A;  1J5E L;  1HNZ Q;  1NJI C;  1HJP A;  1I6H B;  2L5T A;  1PFS A;  2F0E A;  4EGV A;  2A69 D;  2K50 A;  3A8I E;  2EYF A;  4RGN A;  5I9P A;  3I4M H;  2C35 B;  2HUG A;  2K33 A;  3MEH A;  3NTH A;  1STY A;  4IO9 A;  3D3R A;  1SYC A;  4A3J G;  1CZG A;  3BZC A;  4O42 A;  3MXG A;  4DAM A;  1Q8I A;  3PMF A;  2BOS A;  3HOV H;  4A3I G;  1VQ4 A;  1GUT A;  2JA7 G;  1BR9 A;  3J81 c;  3HOW G;  4DR6 L;  5M5Y B;  4CHT B;  1CZW A;  1NY4 A;  1WCM G;  1SBB B;  5KNC A;  1K9M C;  4QIW E;  2R6G A;  4FXG C;  1I94 L;  1AZP A;  5BR8 L;  2PZU A;  4DR5 L;  1K83 H;  3SK8 A;  4JI5 Q;  2N88 A;  2EYP A;  3O13 A;  4ZUJ A;  2UU9 Q;  2KCT A;  4TRD A;  4X6A H;  2F4I A;  3F1Z A;  4MTK A;  1IKM A;  1SNO A;  3SGI A;  4BA1 I;  2K52 A;  3J81 i;  5IYD H;  3P1H A;  1Q12 A;  1GVP A;  2DJF C;  1BBU A;  1PHJ A;  4BY7 G;  4J6H A;  1JWU D;  5IYB H;  4JI2 L;  2Q2H A;  3T4A C;  1CKN B;  3I3C A;  4LF9 Q;  2R92 B;  1TWC B;  2NUC A;  3SEB A;  1ZEQ X;  2BDO A;  2DNE A;  5CGK A;  4KY5 A;  2UXC L;  4AQY L;  1P8L A;  5C6A A;  4LF7 Q;  1A63 A;  3U9O A;  4RCO A;  2KJX A;  2J4X A;  2ZJQ A;  2JA9 A;  5C0X I;  1IXR A;  1C7Y A;  3CCE A;  4NDX A;  3P75 A;  3FPP A;  3KF6 A;  3STB D;  1O7I A;  5LMU L;  1EYC A;  1D5M C;  1ILQ A;  5CV6 A;  1I6V C;  2PZT A;  3ULL A;  2I5H A;  4A3E G;  2NVT H;  1VQI A;  3S16 B;  2D0P A;  4LUZ A;  1VQA A;  2F0Q A;  2KUM A;  5E4W C;  5EBD A;  3EVQ A;  2A1A A;  5ELE A;  4ME3 A;  3KBX A;  4DR7 L;  4LNQ A;  1WFQ A;  3TRE A;  4LMQ D;  2H4O A;  3BZK A;  4ZCK A;  2AQ2 B;  2ZXR A;  1L0X B;  3C3L A;  1A3U A;  1G29 1;  1ENC A;  2QDB A;  2Q8R E;  1U9R A;  1LTT D;  4OIK A;  1K8A C;  1U4L A;  3MAQ A;  2D2C C;  2K5H A;  4JC0 A;  5H1S E;  2R7Z H;  1LTA D;  1JT8 A;  2LMC B;  1ILP A;  1N8R C;  1TY0 A;  5LL6 S;  4BY1 B;  4L6T B;  2E2I B;  4CDF C;  3DWA A;  2GVB A;  1L0Y B;  4JOI A;  2VUM H;  4XTC S;  4AH6 A;  2A73 B;  2TMP A;  3CPW A;  2VQF Q;  4APV A;  5FLX c;  3GTJ H;  5M3M H;  3KBG A;  1BVS A;  4CJ2 C;  2B2U C;  2RDF A;  1IBL Q;  3AMU A;  2VQE Q;  4L63 B;  1H95 A;  2JEB I;  2MGS A;  2Y0S B;  1SLJ A;  2ZTD A;  2F3W A;  2F4V Q;  1PH6 A;  3OW7 A;  4NMZ A;  4DR2 Q;  4YWK A;  5IP7 G;  1S5D D;  2B2V A;  1Y8N B;  1SND A;  4IUV A;  4LF4 Q;  2BE5 C;  3UDI A;  3T1Y Q;  1B4O A;  5LMN L;  5GAE C;  5IY0 A;  1D1I A;  3S17 B;  2NBF A;  1SFO B;  4ZYS A;  4RA8 A;  1FGB D;  1EWI A;  1XPO A;  4DN4 M;  2NB0 A;  3AQQ A;  1EY5 A;  4JI7 Q;  4HSV A;  1DZ1 A;  4PZ6 A;  2DN8 A;  4A3B H;  1DYQ A;  4RGT A;  2A8V A;  4LF8 Q;  4X3K A;  1SNC A;  1M8A A;  3S1Q B;  3K7U C;  3CQZ B;  1UE5 A;  2UUC Q;  1WTO A;  3JAM i;  3OHX C;  1WTP A;  1TWG B;  4DV4 L;  4IOC A;  1IBK L;  5C44 B;  1EY7 A;  1YNN C;  4A3G H;  1ICF B;  1PH9 A;  5J22 A;  1HR0 Q;  4MIU A;  3NWS A;  4DV0 L;  3K5O A;  3M7G A;  1JR0 D;  4LF5 L;  5M5W B;  4DR1 L;  3TP5 A;  1PFB A;  5EBC A;  2R92 G;  5C0X H;  2JYO A;  2RKS A;  4CJ0 B;  3T1H L;  2KQ3 A;  3G6J B;  2J7Z A;  2N8N A;  2IHE A;  3Q6S A;  1WTV A;  2EYJ A;  3MXU A;  2K01 A;  4ME5 A;  4OX9 Q;  3NBH B;  2OF1 A;  3SDZ A;  4FF4 A;  2MPM A;  4EQO A;  1PVO A;  1MHW C;  2RVL A;  3GV6 A;  1BXT A;  1IW7 C;  4YY3 Q;  3OWE B;  4X3U A;  4HIM A;  4DNI A;  5C4H A;  4UP9 A;  4ZK9 B;  1QVG A;  4F87 A;  1EIF A;  4XQJ A;  3G48 A;  1PRT F;  1X32 A;  2RCN A;  3Q0A A;  2XSC A;  3HKS A;  1I4X A;  3PUZ A;  3HOU H;  2NTS A;  1XPU A;  1XX8 A;  3L2P A;  1I4H A;  3NXW A;  1II3 A;  4HJA A;  4H7B A;  2MUY A;  3OYY A;  3TN2 A;  2EXD A;  3R2T A;  3GP7 A;  4RH6 A;  2JEA I;  1VS0 A;  3SHL A;  3RMH A;  1JJ2 A;  1V1Q A;  3S2H B;  2Z6K A;  2BH8 A;  2HD3 A;  1GKH A;  3FKI H;  4OXP A;  2FMM A;  4JPB W;  4KMU C;  3PIO A;  1VQ9 A;  4B3S L;  4BY1 G;  4X66 Q;  3KF8 B;  3QOL A;  3GTO B;  1RCV D;  2B8G A;  2L0C A;  4E6I A;  1SN8 A;  4J8Q A;  1HNX Q;  4B08 A;  2IX0 A;  5E1F A;  3VDY A;  4OWW B;  1V43 A;  2RCF A;  4ABN A;  1VDZ A;  1SSO A;  2GVA A;  4CKC A;  2XVS A;  2Y0S G;  3PUV A;  1AN8 A;  4FP5 D;  1KHI A;  1XMQ Q;  3GTQ H;  4A3L G;  1VMP A;  2ES2 A;  1PA6 A;  1EY6 A;  3W5O A;  1CKN A;  4JI6 L;  5EJW A;  2TSS A;  1IHZ A;  1BBW A;  1LT4 D;  5IYC G;  1OXU A;  4DV6 L;  1B53 A;  1DGS A;  4X3S A;  3NWT A;  4KK7 A;  1U4P A;  2R7D A;  1F2L A;  2HCI A;  4FF1 A;  1N33 L;  3H0G G;  5JVH 3;  3E0J A;  5GAG C;  4JV5 Q;  4P74 A;  3K5N A;  1XNQ L;  4JBJ A;  1R4Q B;  1SMY D;  1XJV A;  4A3C H;  1XNR Q;  2Y0S E;  4K5V A;  5CV4 A;  4XDX A;  1KL9 A;  3AFQ A;  4X62 L;  4JBW A;  4HIO A;  1JB3 A;  2PNR C;  1WVL A;  4A93 B;  2A5H A;  4OWX B;  3H6M A;  3S2D B;  5CC4 A;  4O0A A;  2G9H D;  3MWY W;  5C44 G;  4FXK C;  1JWS D;  1TU2 B;  2DY7 A;  1QB5 D;  2YTY A;  1C4Q A;  1L2F A;  4KV6 A;  1BDO A;  4XIG S;  1O7Y A;  4DR4 Q;  1I4G A;  1NTG A;  2M00 A;  1EUJ A;  2X69 A;  1GUO A;  4BA2 I;  3HOZ H;  4BXX H;  1LT6 D;  2E8G A;  1EQT A;  4MHE A;  1B9M A;  2QIL A;  5JEA G;  2O4X A;  3I4O A;  4DV7 L;  2RHQ B;  5M9O A;  1ZKO A;  2WKD A;  3KOJ A;  1N9W A;  4KJO A;  3OMG A;  5KIX A;  3KYH C;  1EY9 A;  3C1E A;  1RKN A;  2F0S A;  1IBM L;  1KDA A;  2CFM A;  1KAB A;  4NXN L;  4LAA A;  4M8A A;  4G7O C;  1L1O C;  3EN2 A;  1AH9 A;  5IWA L;  1CQV A;  2F3V A;  1VQD A;  1K8O A;  2CCZ A;  1RTN A;  1SNM A;  1KLU D;  4DAV A;  2MP1 A;  1LTG D;  2BA1 A;  4LFC L;  1WTR A;  1YNJ C;  1HRJ A;  4CKB A;  5JPN C;  2SDF A;  1BCP C;  4B3M Q;  2F0L A;  4WJ3 M;  3M3Y B;  4YHH L;  4QCL A;  4FF2 A;  4A3M B;  1HR0 W;  2VUM B;  5FJ8 H;  4CBV A;  3HOX H;  5M5X B;  4FO2 A;  1C48 A;  5GAH C;  4BBS B;  2HDL A;  1AE3 A;  2L11 A;  4DUZ L;  3K57 A;  1QCB D;  2A6E C;  5C4X B;  4X64 L;  1NR4 A;  3OPO A;  1GUG A;  3Q8D A;  1JCK B;  1FJG Q;  1BNZ A;  2EYO A;  2MFI A;  3HRZ C;  3K80 C;  1B2T A;  3KFU A;  2HT1 A;  4DKA C;  1FNW A;  2LS0 1;  3K5M A;  5IIF A;  3LWU A;  2N78 A;  1LAB A;  3OTO Q;  4BBR H;  4X3T A;  4DV2 Q;  4KTA A;  5T1G A;  2OCE A;  2IJ0 A;  2MJ8 A;  2AQ1 B;  1NMG A;  3A54 A;  4GKK Q;  3GTL B;  2OEO A;  3NBI A;  1F9P A;  1RIP A;  3RN2 A;  4X65 Q;  1YI2 A;  1E1T A;  4PZ8 A;  2A6H C;  4A3I B;  4OO1 G;  4TVA B;  2JA7 B;  1Y14 B;  1HNW Q;  1PTO C;  1SE8 A;  2JN4 A;  5HUR A;  2X6L A;  4IFD H;  2F3I A;  1SXT A;  1FL0 A;  1J8I A;  3D4W A;  3M85 A;  3CCL A;  3S15 B;  4KLK A;  2ASB A;  1R9T B;  1V1P B;  4RGM A;  2JK8 A;  4QY7 A;  1HUM A;  5EPJ A;  1K0S A;  5IYD G;  5EAY A;  1QNU A;  1F9Q A;  1TVX A;  1HCZ A;  3QG1 A;  4A3G B;  3CU7 A;  3NBH A;  3C2P A;  5JPM C;  1HQM C;  2EYL A;  1EIG A;  3SXH A;  5I6Y A;  1NBW A;  1PH2 A;  2D9U A;  4OON A;  1TWA B;  2QGQ A;  4A3F B;  4GKJ L;  5BR8 Q;  1WOC A;  1VMC A;  2YTV A;  3BG3 A;  1A8V A;  1PZJ D; 
#chains in the Genus database with same CATH homology
 3KUP A;  1QG7 A;  1GUN A;  2CQA A;  4ZLT F;  2R61 A;  5IGB A;  1QWY A;  2HDM A;  4K2L A;  4RWS C;  1CK1 A;  3GQB A;  3D4R A;  3U9S A;  5ELD A;  2F0G A;  1G6Z A;  2K05 A;  4O1N A;  1D5Z C;  5J39 A;  3BVG A;  5DM7 3;  5IGG A;  1EY0 A;  4DFA A;  1V1O A;  1BF4 A;  2B2Y C;  3KF8 A;  4V19 0;  4Z9C B;  2F0N A;  2IL8 A;  2F0T A;  5LL6 X;  1EWC A;  4G7H C;  2L1B A;  2NN6 I;  4F88 A;  4C3I B;  2KEE A;  2E2J B;  1G8Z D;  1I4Q A;  1VF7 A;  1STE A;  5FO9 B;  3TZD A;  3D4D A;  2RDG A;  3I4L A;  1B3A A;  5CBE E;  5D65 A;  5BN5 A;  1Q90 A;  3L3O C;  2EJG C;  4OIJ A;  4KKT A;  3T51 B;  4PV1 C;  3SR1 A;  2ZT9 C;  3S1N B;  4IQZ A;  3HEJ A;  5IGC A;  4KHZ A;  1D5X C;  4KY7 A;  4DAP A;  5D3D A;  4K6D A;  2PMZ B;  2F03 A;  4H0L C;  3HOY B;  1HXY D;  2D62 A;  1BQQ T;  3I70 A;  1EEI D;  2L4N A;  2DNC A;  1LT3 D;  4EQN A;  1STN A;  3ONA B;  2B2T C;  2E75 C;  2K32 A;  1AW7 A;  4CJ1 B;  1SYG A;  1XWE A;  1PDQ A;  1QNK A;  3NSW A;  1KDC A;  4UAI A;  1VCI A;  1ZYR C;  5JJZ A;  4B9X A;  3J80 L;  5C0X G;  1T5E A;  2K5D A;  4KJN A;  1G91 A;  2ID0 A;  2JXM B;  1MD2 D;  4DNT B;  2RSO A;  1B50 A;  2BE5 D;  1PLF A;  2X6G A;  3I4N B;  1JE4 A;  4CGY B;  2SOB A;  3KLS A;  1NAP A;  1DOL A;  4F7X A;  1G2T A;  3OIQ A;  4RKL A;  3VA5 A;  3MVV A;  4ZRZ A;  1TWH B;  1Z7T A;  1XXG A;  1A2T A;  2NN6 H;  4IN3 A;  2KCC A;  1TS5 A;  1MGS A;  4HCE A;  4IUR A;  1CTM A;  1U4M A;  2F0F A;  3HZX A;  1HTL D;  1A3V A;  3V2T A;  2NVY B;  3HOX B;  1H9M A;  3K7A B;  4K2K A;  1HFG A;  1H9S B;  4R8N A;  1WTW A;  1JOO A;  1D1K A;  3EA6 A;  5C5L A;  4DF7 A;  4C3I G;  3FPU B;  2CHB D;  1WTX A;  3RZO B;  3GTP B;  3K58 A;  1JOQ A;  3IFT A;  4RCN A;  4KN7 C;  3Q23 A;  4I7Z C;  3URY A;  2IT1 A;  2AQ3 B;  3H09 A;  1V1P A;  3TSS A;  1IW7 D;  2PO4 A;  3P7J A;  3A8K E;  2KCN A;  1UEA B;  2EY6 A;  4DGZ A;  5C0X J;  1RDP D;  2EDG A;  2Q8T A;  3D6W A;  1ESR A;  3DHQ A;  1ONL A;  1MSH A;  3S1M B;  2F0D A;  2E76 C;  4EQP A;  1TKW B;  2SEB D;  2WAC A;  1TWF B;  2E2D C;  1SYF A;  1JOK A;  3OSO A;  3NQT A;  2J0T D;  3I72 A;  1BCP B;  3VR3 A;  2JE6 I;  4C2M B;  3S9W A;  1EL0 A;  3S1R B;  3AU7 A;  3VR2 A;  3J7Y W;  3H0G B;  1AP0 A;  4YIJ A;  4C3J B;  1CA5 A;  4OL7 A;  1ENA A;  5C4J B;  2B63 B;  1Z6H A;  3A7L A;  3M4Y A;  2KA7 A;  4TKO B;  1F2M A;  4XXE A;  3J80 E;  1EY8 A;  1HUN A;  3BDO A;  3W2D A;  3GTK B;  3UI2 A;  4C1N I;  4HED A;  2Z4H A;  5A35 A;  1SJH D;  5BN3 A;  1PTO B;  2PW5 A;  3NK9 A;  4LJZ C;  1UUP A;  2ICI A;  4ZAI A;  1HA5 A;  5KND A;  1HFN A;  1S5B D;  1S5E D;  5IGF A;  4G4K A;  2BA0 A;  3X3N A;  5IOC A;  1DM0 B;  2QCP X;  3MHB A;  3M4O B;  5EKK A;  5D3I B;  4HMJ A;  4KI0 A;  4IUN A;  2NVQ B;  3OMC A;  1GHK A;  2G9D A;  1CHP D;  4ZUI A;  3V96 A;  2YU9 B;  1DXM A;  1RJT A;  2EPB A;  2A68 C;  1PFM A;  3PUW A;  1ENF A;  2E2H B;  5I9O A;  4HSP A;  2R93 B;  1UAP A;  4DA2 A;  3I4M B;  1F2Y A;  5JAV A;  1O7Z A;  3OOC A;  3MXP A;  1BUV T;  4KD3 A;  1PZI D;  5FO7 B;  3JAM L;  3NTI A;  4NW2 A;  1FD7 D;  5T1I A;  4J1M A;  3HKZ B;  1GJX A;  1HHV A;  3HOV B;  4DXF A;  2FIN B;  4H44 C;  3J81 E;  2ZXP A;  3DWQ A;  2LKV A;  2XIW A;  1K83 B;  3R8B A;  1YNJ D;  2F1M A;  3KLR A;  1BCP D;  1ROD A;  3L7Z C;  4TQU S;  4QUC A;  2HCC A;  4JK1 C;  4HTH A;  2V4D A;  4IFD I;  2A6E D;  3QB3 A;  5KRU A;  3GO5 A;  5K36 G;  4C3J G;  5HGT A;  1WTQ A;  4ODG A;  1A2U A;  3CKI B;  5I2Y A;  3MA2 B;  3QIA A;  2K6A A;  1EZ6 A;  4I65 A;  1LT5 D;  2A6H D;  1H9S A;  3PUX A;  3K5L A;  1PTO D;  3L9A X;  1Q1E A;  5KYI A;  1R4P B;  3R93 A;  2NVT B;  1TY2 A;  2F0I A;  2WB1 B;  3LX0 A;  1TS4 A;  4NP5 A;  2XRQ D;  4MN3 A;  2O5J C;  3BVZ A;  3TP7 A;  2K5W A;  4FNF A;  1O7L A;  3ND8 A;  1HQR D;  1SNQ A;  5CYU A;  1S5C D;  1A3T A;  1SNP A;  1LTS D;  1OXX K;  1S5F D;  2R7Z B;  2F0K A;  2AWN A;  3I90 A;  1STB A;  4G57 A;  3EJI A;  4AYB B;  3MTS A;  2JA6 B;  1OXT A;  5C4Z A;  5IGD A;  2AUK A;  2XN9 C;  3DM1 A;  2Z1C A;  1AZQ A;  3GTJ B;  5M3M B;  4XYO A;  5FLX E;  2D5D A;  1HPC A;  2RSN A;  1JOR A;  2F0U A;  1AEX A;  1M4V A;  2QF7 A;  2ZXO A;  4WOR A;  3QO2 A;  3ND9 A;  4DK0 A;  4G7Z C;  4FF3 A;  4ID6 A;  4XT3 B;  4RGO S;  2BDN A;  3FMC A;  5J1Z A;  2EVB A;  5IT9 L;  2AWO A;  3JAM E;  3NE5 B;  4U67 3;  1PRT C;  3X3M A;  4OGQ C;  1DCZ A;  4A3B B;  4XT1 B;  2PCF B;  4S3S A;  2RQX A;  5JEA J;  3F2U A;  4ZQ3 A;  1DJR D;  1OO9 B;  1LTI D;  2KED A;  5FKA C;  3PV0 A;  4C56 C;  1TS2 A;  3Q24 A;  2WAQ B;  3K6O A;  4KN4 C;  5EGT A;  1BO0 A;  1EU4 A;  3QJY A;  3I91 A;  5EKI A;  4ZKC B;  1F2Z A;  1HTP A;  1EYD A;  4R9W A;  5IGE A;  4ULL A;  2CVR A;  4OO1 I;  4DNR B;  2C9O A;  4Q0F A;  1ICW A;  4FYD A;  2LY7 A;  3M7N A;  4IUT A;  5TSS A;  4N9P A;  3A55 A;  4XQN A;  5DM6 3;  2IW3 A;  4QUF A;  2HQE A;  2VB2 X;  3HOU B;  2FFK B;  1ET9 A;  3IAY A;  3HS0 C;  3RD4 A;  2B2W C;  3DXJ C;  3MXN A;  3NPP A;  4KKS A;  1ZYR D;  5G3L D;  1EZ8 A;  5CMD A;  2WV6 D;  2KEC A;  3R2I A;  3KLS X;  5CV7 A;  4PMW A;  3NTK A;  3TME A;  5EKL A;  1EFI D;  4RFB A;  1MI2 A;  1Q1B A;  1GUS A;  3A56 A;  3IFD A;  3FKI B;  2SNM A;  2EXZ A;  2F0M A;  3FEW X;  2B2Y A;  1SYB A;  1KDB A;  4IUP A;  4IUU A;  3MC0 B;  2EJM A;  5I6W A;  4EVO A;  3SK5 A;  3RLF A;  2Z4I A;  3QWN A;  2N55 A;  1X3P A;  3H91 A;  3GTQ B;  2B8F A;  5EPK A;  1CM9 A;  4CKE A;  4UDU C;  2FMC A;  2RA4 A;  2XNA C;  1KLG D;  2QEJ C;  3TZU A;  5A2Q L;  2JP1 A;  1DOK A;  5KYL A;  1TQO A;  2IPK D;  3T16 A;  1NUC A;  1F9R A;  3LWE A;  5IT9 E;  1JC7 A;  2I07 B;  1RHP A;  4N9T A;  2ENB A;  1EY4 A;  1F77 A;  3DEO A;  2MHV A;  1FR3 A;  1QIL A;  3NUC A;  4K6L A;  2ICE C;  4FXD A;  2VB3 X;  4WJW A;  1EIH A;  3MFG A;  3BYT B;  4OO1 H;  1B44 D;  1TS3 A;  2B2T A;  1QJO A;  3HOZ B;  4IZ8 A;  3BYY B;  1F9S A;  2O5I C;  1Z47 A;  2M2L A;  2VNU D;  1OXS C;  2CW0 C;  3H94 A;  5COR A;  4LK1 C;  1ET6 A;  5EPL A;  2EZV A;  1JQY D;  5EQ0 A;  1EEF D;  2YYZ A;  3V05 A;  2EYH A;  2XWJ B;  4FVM A;  3E6Z X;  3R3O A;  2RBM A;  4HR7 B;  3D31 A;  3N52 A;  3T13 A;  1OXV A;  1YNN D;  2A69 C;  1IYU A;  1BBX C;  2KHS A;  1MBY A;  3PIO 3;  5NUC A;  3HP3 A;  3FVQ A;  3BZD B;  3DMU A;  3I8Z A;  1Y69 U;  1NSN S;  4BBR B;  3ZYY X;  1EOT A;  3MFY A;  4PQX A;  2EY5 A;  1W6K A;  3J81 L;  5DNF A;  2PYK A;  1JIC A;  3D6C A;  2K1B A;  3SK4 A;  2B2V C;  1WD0 A;  4PMC A;  1SDF A;  1GOZ A;  2E74 C;  3VR4 A;  3PO2 B;  3DUZ A;  1K8M A;  3GTM B;  2B2U A;  5FO8 B;  1BOS A;  1ML0 D;  1H9J A;  2A68 D;  5A2Q E;  3C1F A;  2L55 A;  3J7A V;  4XQQ A;  2F0J A;  4NKL A;  2PQE A;  3TP8 A;  2F0W A;  3A7A B;  1NCV A;  1CA6 A;  3VYR A;  5AFW A;  1RD9 D;  4Y7N B;  4XYQ A;  3LNN A;  1RF2 D;  4H13 C;  5CBA E;  2R3Z A;  1O78 A;  5FK9 C;  3ITP A;  5ELF A;  4QF4 A;  1EYA A;  1MSG A;  1LV9 A;  1X3Q A;  3BDC A;  3OIP A;  3GTG B;  2FHT A;  2JSO A;  3SE0 A;  2K04 A;  5F2D A;  2SNS A;  1BCP F;  4RAU C;  1IYV A;  5BN4 A;  1PRT B;  1D2B A;  1E2Z A;  3P20 A;  3HG9 A;  5I2X A;  3SK6 A;  5C3X A;  1C8C A;  1CFM A;  2NVX B;  1SEB D;  1S4Z A;  2FJ2 A;  1I3Q B;  3MZ5 A;  1CT1 D;  1JWM D;  4KKU A;  3VYT A;  4RHR A;  1LLR D;  2PPB C;  1GHJ A;  3VR6 A;  3NP8 A;  2JA5 B;  2GA4 B;  1TT2 A;  1DOM A;  3TDQ A;  1CI3 M;  2F0O A;  2RDH A;  5I4D A;  2K7V A;  2AUJ D;  1PZK D;  1KNA A;  5FLX L;  1PXU A;  5KEE A;  2L12 A;  1PTO F;  1IKL A;  3NQI A;  1T5X D;  3CRL C;  4BWG B;  2IX3 A;  2F0V A;  3VR5 A;  3VYU A;  2A74 C;  3CHB D;  1SYD A;  5DEH A;  2WKC A;  3W3A A;  3IKJ A;  5KNB A;  5M3F B;  1XTC D;  2H1E A;  1B9N A;  1E2W A;  1Y8P B;  4IFD G;  1I50 B;  3T56 B;  3RZD B;  3SVM A;  1SE2 A;  4Q5V A;  1U4R A;  4C3H B;  4A3D B;  3H3V C;  2M9V A;  4B9W A;  3BVM A;  3ERO A;  2OT2 A;  2NTT A;  5C3E B;  3K0Y A;  1GUW A;  2OXP A;  1Y1W B;  3TP6 A;  1ESF A;  2EYM A;  4PMB A;  1UNS A;  5JVG 3;  4GZY C;  5ISR A;  5KGU A;  1A15 A;  1LTB D;  1CHQ D;  5C3W A;  1FNU A;  1PRT D;  3QOJ A;  2F0P A;  1LTR D;  4DU9 A;  1SJE D;  5FOB B;  3PO3 B;  1NR2 A;  2WII B;  1HA6 A;  2O2L D;  4HN7 A;  4P2C B;  2EJF C;  4DXG A;  4KD4 A;  1EWH A;  1STH A;  3G7L A;  2NYZ D;  2Q8I B;  3FDT A;  1QE6 A;  1KNE A;  4IFD J;  3HGB A;  2EY2 A;  1PFN A;  5ELC A;  4A3K B;  4C1N K;  4K5W A;  3WOF A;  3KK7 A;  1SYE A;  3PIP 3;  1KAA A;  1ZXT A;  1WD1 A;  1Y8O B;  3VYS A;  1KTK A;  5DAU A;  1O80 A;  1LO5 D;  5E3F A;  1J9O A;  5ELB A;  2LFN A;  1Y1V B;  3T53 B;  4HAE A;  1I4R A;  1STG A;  5G3L F;  2NZ1 D;  3DEP A;  2XWB B;  4K5X A;  4DK1 A;  4QIW B;  1SAP A;  2IWH A;  2EY1 A;  5CV5 A;  4K8I A;  1FNV A;  3N6R A;  3VA7 A;  5CV9 A;  4KY6 A;  2K5Q A;  1E0B A;  1SMY C;  3BS1 A;  1XYI A;  3EQL C;  5K5P A;  2KVM A;  4U68 A;  4C3H G;  2XRS D;  4A3J B;  2C5C A;  3Q22 A;  4RKB A;  1A6X A;  3AB9 A;  3NHH A;  1B1Z A;  3EFX D;  3J7A F;  2QKI C;  4QMG A;  3BDL A;  3GD7 A;  4IAL A;  3HOW B;  1VF5 C;  1WCM B;  4K14 A;  2EE1 A;  2K03 A;  2B39 A;  2I46 A;  4DAY A;  1PYW D;  1TII D;  2BCO A;  4HCS A;  2Z8L A;  3CRK C;  1H9R A;  1STA A;  4R8I A;  1D6E C;  4TSS A;  1W6J A;  4BY7 B;  2K28 A;  5CR3 A;  1DON A;  4ZKB B;  3FRP B;  4IUQ A;  2KOL A;  5D14 A;  1SE3 A;  5K36 H;  3A8J E;  4PNY A;  3S14 B;  3OWF A;  2DY8 A;  2NN6 G;  3E5S A;  1TR5 A;  4M1U B;  4K8J A;  2JA8 B;  3ERQ A;  1PMR A;  3I73 A;  5C5M A;  5LHY 1;  2PZW A;  4ILW A;  4WRD A;  4RHS A;  4QB4 A;  1DD2 A;  1E2V A;  1RTO A;  5CV8 A;  1I4P A;  1H9K A;  4OHJ A;  1CQF A;  3WDN A;  1GXD C;  5IOD A;  4F8M A;  4KHV A;  1EU3 A;  3PUY A;  2NWG A;  1EQV A;  4A3E B;  3RUZ A;  4BS9 A;  1LAC A;  5JEA H;  1AFP A;  1PTO H;  2B2W A;  3TBI B;  1V8Q A;  2F0H A;  3IL8 A;  2WP8 J;  1G2S A;  2IX1 A;  4HMI A;  2WIN B;  4L8J A;  2EOT A;  2PW7 A;  3WOE A;  2CW0 D;  1QOH A;  5JOB A;  3D8G A;  5COY A;  4WFN 3;  2L9H A;  5E4X A;  1Q3L A;  1FYC A;  1SE4 A;  4V0B A;  3DWP A;  3GV3 A;  3K59 A;  3C46 A;  1IL8 A;  2VXW A;  1I6H B;  2L5T A;  2F0E A;  4EGV A;  2A69 D;  3A8I E;  2EYF A;  4RGN A;  5I9P A;  2HUG A;  2K33 A;  3MEH A;  3NTH A;  1STY A;  3D3R A;  1SYC A;  1CZG A;  4O42 A;  3MXG A;  1Q8I A;  3PMF A;  2BOS A;  1GUT A;  1BR9 A;  5M5Y B;  4CHT B;  1CZW A;  1SBB B;  5KNC A;  2R6G A;  4FXG C;  1AZP A;  2PZU A;  3SK8 A;  2N88 A;  2EYP A;  3O13 A;  4ZUJ A;  4TRD A;  2F4I A;  1IKM A;  1SNO A;  4BA1 I;  3P1H A;  1Q12 A;  4J6H A;  1JWU D;  3T4A C;  3I3C A;  2R92 B;  1TWC B;  2NUC A;  3SEB A;  1ZEQ X;  2BDO A;  2DNE A;  5CGK A;  4KY5 A;  5C6A A;  3U9O A;  4RCO A;  2KJX A;  2J4X A;  5C0X I;  4NDX A;  3P75 A;  3FPP A;  1EYC A;  1D5M C;  1ILQ A;  5CV6 A;  1I6V C;  2PZT A;  3S16 B;  2F0Q A;  2KUM A;  5E4W C;  5EBD A;  3EVQ A;  5ELE A;  3KBX A;  4LMQ D;  2H4O A;  2AQ2 B;  2ZXR A;  1L0X B;  3C3L A;  1A3U A;  1G29 1;  1ENC A;  2QDB A;  2Q8R E;  1U9R A;  1LTT D;  4OIK A;  1U4L A;  3MAQ A;  2D2C C;  1LTA D;  2LMC B;  1ILP A;  1TY0 A;  5LL6 S;  4BY1 B;  4L6T B;  2E2I B;  3DWA A;  1L0Y B;  4XTC S;  2A73 B;  2TMP A;  3KBG A;  4CJ2 C;  2B2U C;  2RDF A;  3AMU A;  4L63 B;  2JEB I;  2MGS A;  2Y0S B;  2F3W A;  3OW7 A;  4NMZ A;  1S5D D;  2B2V A;  1Y8N B;  1SND A;  4IUV A;  2BE5 C;  1B4O A;  1D1I A;  3S17 B;  2NBF A;  1SFO B;  4ZYS A;  4RA8 A;  1FGB D;  4DN4 M;  2NB0 A;  1EY5 A;  4HSV A;  1DZ1 A;  2DN8 A;  1DYQ A;  4RGT A;  4X3K A;  1SNC A;  1M8A A;  3S1Q B;  3CQZ B;  1WTO A;  3OHX C;  1WTP A;  1TWG B;  5C44 B;  1EY7 A;  1YNN C;  5J22 A;  4MIU A;  3NWS A;  3K5O A;  3M7G A;  1JR0 D;  5M5W B;  3TP5 A;  1PFB A;  5EBC A;  5C0X H;  2JYO A;  2RKS A;  4CJ0 B;  2KQ3 A;  3G6J B;  2J7Z A;  3Q6S A;  1WTV A;  2EYJ A;  3MXU A;  2K01 A;  4ME5 A;  2OF1 A;  3SDZ A;  4FF4 A;  2MPM A;  4EQO A;  2RVL A;  3GV6 A;  1BXT A;  1IW7 C;  3OWE B;  4X3U A;  5C4H A;  4ZK9 B;  4F87 A;  4XQJ A;  1PRT F;  1X32 A;  3Q0A A;  2XSC A;  1I4X A;  3PUZ A;  2NTS A;  1XX8 A;  1I4H A;  3NXW A;  1II3 A;  4H7B A;  2MUY A;  3TN2 A;  3R2T A;  3GP7 A;  4RH6 A;  2JEA I;  3SHL A;  3RMH A;  3S2H B;  2FMM A;  4KMU C;  3QOL A;  3GTO B;  1RCV D;  2B8G A;  2L0C A;  4E6I A;  4J8Q A;  4B08 A;  2IX0 A;  5E1F A;  1V43 A;  4ABN A;  1VDZ A;  1SSO A;  4CKC A;  2XVS A;  3PUV A;  1AN8 A;  4FP5 D;  1VMP A;  1EY6 A;  5EJW A;  2TSS A;  1IHZ A;  1LT4 D;  1OXU A;  1B53 A;  4X3S A;  3NWT A;  4KK7 A;  1U4P A;  1F2L A;  2HCI A;  4FF1 A;  5JVH 3;  3E0J A;  3K5N A;  1R4Q B;  1SMY D;  4K5V A;  5CV4 A;  4XDX A;  4JBW A;  1JB3 A;  2PNR C;  1WVL A;  4A93 B;  2A5H A;  3H6M A;  3S2D B;  5CC4 A;  2G9H D;  3MWY W;  4FXK C;  1JWS D;  1TU2 B;  2DY7 A;  1QB5 D;  4KV6 A;  1C4Q A;  1BDO A;  4XIG S;  1O7Y A;  1I4G A;  2M00 A;  2X69 A;  1GUO A;  4BA2 I;  1LT6 D;  1EQT A;  4MHE A;  1B9M A;  2QIL A;  5JEA G;  2O4X A;  5M9O A;  1ZKO A;  2WKD A;  4KJO A;  3OMG A;  5KIX A;  1EY9 A;  3C1E A;  1RKN A;  2F0S A;  1KDA A;  1KAB A;  4LAA A;  4M8A A;  4G7O C;  1CQV A;  2F3V A;  1K8O A;  1RTN A;  1SNM A;  1KLU D;  4DAV A;  2MP1 A;  1LTG D;  2BA1 A;  1WTR A;  1YNJ C;  1HRJ A;  4CKB A;  5JPN C;  2SDF A;  1BCP C;  2F0L A;  3M3Y B;  4QCL A;  4FF2 A;  4A3M B;  2VUM B;  4CBV A;  5M5X B;  4FO2 A;  1C48 A;  4BBS B;  2HDL A;  2L11 A;  3K57 A;  1QCB D;  2A6E C;  5C4X B;  1NR4 A;  3OPO A;  1GUG A;  1JCK B;  1BNZ A;  2EYO A;  3HRZ C;  1B2T A;  1FNW A;  2LS0 1;  3K5M A;  5IIF A;  3LWU A;  1LAB A;  4X3T A;  4KTA A;  5T1G A;  2IJ0 A;  2MJ8 A;  2AQ1 B;  3A54 A;  3GTL B;  2OEO A;  3NBI A;  1F9P A;  2A6H C;  4A3I B;  4OO1 G;  2JA7 B;  1PTO C;  5HUR A;  2X6L A;  4IFD H;  1SXT A;  1J8I A;  3D4W A;  3M85 A;  3S15 B;  1R9T B;  1V1P B;  4RGM A;  1HUM A;  5EPJ A;  1QNU A;  1F9Q A;  1TVX A;  1HCZ A;  3QG1 A;  4A3G B;  3CU7 A;  3NBH A;  3C2P A;  5JPM C;  1HQM C;  2EYL A;  1EIG A;  3SXH A;  5I6Y A;  2D9U A;  1TWA B;  4A3F B;  1VMC A;  3BG3 A;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...