2LS01

Solution structure of the target recognition domain of zoocin a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
128
structure length
128
Chain Sequence
MRGSHHHHHHGSEPTTPTTNLKIYKVDDLQKINGIWQVRNNILVPTDFTWVDNGIAADDVIEVTSNGTRTSDQVLQKGGYFVINPNNVKSVGTPMKGSGGLSWAQVNFTTGGNVWLNTTSKDNLLYGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Zoocin A endopeptidase
publication title Solution structure of the recombinant target recognition domain of zoocin A.
pubmed doi rcsb
source organism Streptococcus equi subsp. zooepidemicus
total genus 12
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF16775 ZoocinA_TRD Target recognition domain of lytic exoenzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.670 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ls0101
2LS01
chains in the Genus database with same CATH superfamily
3Q22A 1VQCA 3BU2A 4JI4Q 3PUZA 2B2TA 4A3GH 5A35A 1PTOH 1EU4A 3GTKH 3NENA 1XYIA 3T56B 5C5MA 5EBDA 3OIPA 4DV1L 2F0UA 2PZUA 1STAA 2NVYH 4OGQC 4FF3A 1CM9A 4A3GB 1PTOB 2MO0A 4KY5A 3I55A 4A3EG 1K8AC 1EEID 4L8JA 3GTKB 4G57A 2RDGA 1EQTA 1Y14B 1E2VA 1KLGD 2Z6BA 1N36L 4GKKL 1X65A 1EY4A 2NVYB 1PYSB 5IE8A 1CA6A 3M7GA 3HOZH 3EIVA 1EFID 3RZOH 1GM5A 1CKNB 2N49A 4JV5L 1FD7D 2Z6KA 2HHHL 3CP0A 3H0GG 4JI1L 5EAYA 2K05A 1BBUA 1V8QA 4A4IA 3KBXA 1RHPA 4QIWB 4HMIA 1D7QA 1EQVA 1JOKA 1TVXA 1PH8A 3MAQA 5KYLA 1TR5A 5ELOA 5JEAJ 3HOZB 3K5OA 4B3RL 3RZOB 1F9PA 3DWAA 4HJ7A 3N52A 1YHAA 5NUCA 5C0XG 4HMJA 3S9WA 1C4QA 3CRKC 3SK4A 2CW0C 2JA5G 4LW1A 2ZJQA 1O7LA 2K33A 2B2UC 4TVAB 2B63G 2UUAL 3K7UC 2QDBA 2N78A 2DUDA 2HQEA 4DV2L 4DAVA 3QR8A 3OW2A 2M2LA 4GLAC 5IYBG 1PTOF 3QO2A 1IW7D 1PFBA 1TWCH 4HR7B 1NCVA 3L2PA 5LHY1 4DAYB 1TS2A 2A6HD 4JBKA 3D4WA 3D0FA 5LMUQ 4X3KA 2FJ2A 3KYHC 4GLVB 3Q8DA 2MNAA 3KFUA 1TWCB 3F1ZA 1VCIA 1VQMA 5FLXE 2KEEA 3NTHA 1S40A 5M5YH 4L5SA 2BA1A 3CMAA 3OMCA 1NBWA 3LWUA 1TXYA 3HOYH 1KDAA 3CHBD 3GTLH 4A3EH 5AFWA 3JAMi 1YEZA 5M5YB 3PIOA 1KAAA 1XTCD 2XSCA 1BBXC 1VDZA 1XMQL 1LT3D 3W1GA 3KJOA 3MA2B 5ELDA 5M5XH 3G4SA 3HOYB 4I65A 4DK1A 4IQZA 3GTLB 4A3EB 4RCOA 1G91A 1T5EA 4XT1B 4DV0L 1H9MA 4C3IG 2K5NA 4R1JA 4YWLA 2R92G 3S2HH 4O42A 1M90C 4F88A 2ZJPA 1HRJA 5M5XB 3KLSX 4YIJA 1L0YB 1B3QA 2CQAA 4K5VA 3R8BA 3MTSA 4DV6Q 1TIID 4DR2L 5A2QL 3S2HB 2EJFC 5C0XH 3J81c 4PG3A 1BO0A 2RA4A 2XTIA 3I70A 2JA5H 2RVLA 4QJFA 4DV3L 1Z7TA 4LF7Q 3ZYYX 3PSIA 5KYIA 2B63H 2VXWA 2CWAA 1E1TA 4EGVA 1UEAB 5IT9E 5E3FA 4IOAA 1N9WA 1EY9A 1JB3A 4JG2A 2F0DA 1V43A 2IX3A 2JA5B 4IN3A 5CR3A 4DF7A 1FYCA 1DOKA 4WRDA 4YCVA 2B63B 3NXWA 2CH4A 4J6HA 1Q86C 4Q0FA 1JE4A 1M8AA 2M00A 2NVQH 1DZ1A 5IGGA 1CKMA 3HOWH 1B2TA 3ULPA 1CI3M 3NBIA 4L5QA 1XNQQ 3CQZH 1PHJA 3SK6A 4DR6L 1SMYD 4X64Q 4BA1I 5I6WA 3VYSA 1LT5D 1PMRA 2F0KA 2MFIA 1HNWQ 3GD7A 2NVQB 5C3EG 2NYZD 3TREA 3HOWB 4IPDA 3V96A 4TQUS 3I56A 2JA7G 2RDHA 1JT8A 1YI2A 2BE5C 2NN6G 3GV6A 3CQZB 4OX9Q 2AQ3B 4IALA 2JA6H 3S1NH 2B29A 2XIWA 3MXGA 4F7XA 3T4AC 2F0QA 2NZ1D 5CV4A 1KRTA 2NWGA 4C3IH 2Y0SE 2JA6B 3S1NB 1MSHA 3UE0A 5KEEA 5M3MG 2R92H 2DJFC 1J5EL 1TS5A 3T1HQ 4DUYL 1GUOA 1OO9B 3KBGA 3FPUB 1KQSA 4XYQA 4NP5A 3IAYA 4KY7A 4E6IA 1WTOA 4X65Q 4K0KL 2D62A 2ENBA 5EGTA 4C3IB 4HJAA 2F0JA 2R92B 1EFWA 2A6ED 1BUVT 4JI3L 4F8MA 2NBFA 4NW2A 1XPRA 2PQEA 4OIJA 2R93G 4M8AA 4PMWA 1C8CA 5I4DA 1EWIA 3G7LA 3J7ZC 3KDFA 2KCNA 3AFQA 4LNQA 4AIMA 1WD0A 1C0AA 2NTTA 2EDGA 5CYUA 3PUYA 5GAHC 5IWAQ 1O7ZA 2GVBA 1DJRD 2IPKD 3A55A 3K5MA 3R2TA 4N8FA 2EYHA 5C4HA 4ZQ3A 1HZAA 1TS4A 1UE5A 4H02A 1CQFA 1IHZA 2F3IA 1KNAA 1OXXK 5C3EH 4TKOB 1ASYA 1PRTC 4CJ1B 2AQ1B 4A93H 5M3FG 2JA7H 4J1MA 5FLXL 1LO5D 2NN6H 4XQJA 3HGBA 1VQ4A 2N8NA 2K14A 5C3EB 1JB7A 1BQQT 3SHLA 3VYUA 3SEBA 4A93B 2JA7B 5ELFA 1EY0A 3OTOQ 1GKHA 1KIXA 3M3YH 4K8JA 1VQPA 1RDPD 2IHEA 3BZCA 4PMCA 1VQGA 4RKLA 3GQBA 4K6LA 3M4PA 5M5WH 5M3MH 4L6TB 3AU7A 5CV9A 4DR1L 1FJGQ 4IJHA 1SYEA 4Z9CB 3J81L 3CW2C 3M3YB 4HJ9A 2F0LA 4I7ZC 2CFMA 5EPLA 2MUYA 4JI7Q 2WB1E 3D4DA 2UU9L 1SNCA 4HIDA 5M5WB 4PV1C 5M3MB 1MIUA 4DUZL 3BS1A 4POFA 1HTPA 2F0TA 4FXGC 1SLJA 2R93H 1UUPA 1S5FD 4XQQA 2UUBQ 4DNIA 1GXDC 4HIMA 1TY2A 3QOLA 3I90A 3TBIB 1VQFA 2F4VL 2R93B 2F0EA 1HZ9A 1HFGA 3IL8A 2VZAA 3VYRA 3Q24A 3GO5A 5T1GA 4KKSA 1SYDA 2F0GA 3TP7A 1B3AA 4LUZA 2ALYB 4GN5A 4O1NA 3CCMA 1XJVA 1O80A 4IUTA 4KHPQ 2IY5B 1SEBD 1VQHA 4V190 1YNND 3BVMA 2DGYA 1XPUA 2LFNA 1B70B 1F2MA 4GN4B 3E3XA 1PH3A 5M3FH 3S1QH 3RLNA 3KLRA 2C35B 3GTGH 4B3SQ 1IKLA 1K28A 4HJ5A 2R7FA 4RGOS 4N8X1 3NWSA 3H3VC 4JPBW 2RSOA 1L1OA 4DK0A 1SJED 2FHTA 5M3FB 2JEBI 3S1QB 2FINB 5EJWA 5IYDG 1JORA 2KVMA 1VMPA 3GTGB 2F0IA 3TP8A 2E2HB 3E6ZX 1PVOA 1MKHA 3CU7A 5EKKA 4LF6Q 5IODA 2AMCB 3U4ZA 4FF1A 3KF8A 5FO7B 2F3VA 1RTOA 2K7VA 1KLUD 3CRLC 1LTAD 1X6OA 3JAMc 1ESFA 1MBYA 2PW5A 1EUJA 4ALPA 1FGBD 3L7ZC 4AH6A 2A74C 1SYFA 4V0BA 1BCPD 4YHHQ 3U58A 3K80C 3HEJA 3UI2A 1M4VA 3OSOA 1SR3A 3EJIA 3PIPA 1VQNA 1I3QH 2B2YC 4RHSA 5C6AA 5HURA 1HXYD 4JBWA 5ELCA 3U9SA 4NXNQ 2E5LL 2B2WA 2AWOA 5FO9B 1LTBD 2WKDA 2TMPA 3DEOA 3D6CA 3NWTA 2OXPA 1EOTA 5I9OA 4DV5Q 4ZUIA 4A3DG 1VQ9A 4HCEA 5ELNA 4LFCL 2HIXA 5JPMC 4YY3Q 5H1SE 3NP8A 2Z9HA 4CDFC 3KLWA 4DKAC 3I73A 4K14A 2VNUD 2NVXH 1HH2P 2HT1A 3P1HA 2CHBD 2VY3A 5ELBA 2YTVA 1MJCA 2PCFB 2UUCQ 1LM0A 2VQFQ 4CGYB 1EY6A 1FNVA 3MWYW 4C56C 2DY8A 1PZID 5D14A 2NVXB 3A7LA 5FLMH 1HA5A 5DM63 1O78A 1PH5A 4R8IA 1OXVA 2J4XA 4QUCA 1X54A 5AJ3L 3MZ5A 1VQ7A 4C3HH 1PH2A 1SYGA 4ID6A 4FO2A 4NXMQ 3T53B 1O7IA 5CV5A 3A7AB 3LGJA 1PH1A 3V05A 5IYDH 4IFDG 1DONA 4EVOA 1H95A 1NR4A 1YHBA 4ODGA 1YJNA 4OO1G 1PTOC 3I4OA 4C3HB 1J9OA 2A68D 1S5CD 1WI5A 5I6YA 2K5QA 1CZWA 2QF7A 2CKZB 3Q6SA 2FXQA 1HNXQ 4B3TL 2M9VA 1GOZA 5IOCA 1QG7A 3TEHB 3H3VI 1QWYA 1WTQA 3DM3A 4B08A 4JOIC 1IBKQ 4GKJQ 1L0XB 3M85A 1RF2D 1K0RA 3BJUA 1Y1VG 1OXSC 3AMUA 4YWKA 4KI0A 3D6WA 4A3MG 2P5ZX 5CC4A 2JA8G 5LL6S 4A3DH 2O4XA 4ABNA 1OXTA 4DA2A 2CH4W 1JC7A 4DNTB 1L1OB 1B4OA 1H9SB 1N34Q 1X3PA 2RHQB 3F2UA 3P20A 4A3DB 4WJ4A 4AYBG 1WOCA 1Z6HA 4NKLA 4IUQA 3DLLA 1RJTA 4K5WA 2A5HA 2TSSA 3S24A 2PQAB 3KF8B 1IBML 3J7AF 5KNBA 1U9RA 2PW7A 5G3LD 3TSSA 2J7ZA 2KHIA 1I6HH 1YITA 1GUSA 4GS3A 3J80i 2VW9A 2G5DA 2NB0A 1RCVD 4HIKA 3PMFA 2AHOB 2QEXA 4IO9A 1CFMA 2K50A 4EQPA 4PNYA 2IJ0A 4JBJA 4LFAQ 1I6HB 4WFN3 4IFDH 2GVAA 4LF5L 1HR0L 3NSWA 4OO1H 2HCIA 3JAML 2VB2X 3I72A 4GZYC 2XNAC 4XDXA 2VUMG 5C44G 3CD6A 1NTGA 2VS1A 2KOLA 3K8AA 2L15A 3K5NA 1A6XA 5KNDA 5IY0A 1IYVA 1EY8A 1FVIA 2UXDQ 2DY7A 1AN8A 5BN5A 2E2IH 2K5VA 4DAMA 1X3FA 4Y52H 1LTSD 2I07B 1BNZA 3A0JA 1GHKA 2F0WA 4JI8Q 4CBVA 1F2YA 1Y8OB 1CHQD 1Y1VH 1EWCA 1TWFH 2B2VC 4A3MH 4GOPA 2E2IB 1U4PA 2KHSA 4JI2Q 2JA8H 2KBNA 1LUZA 2OQKA 2OQ0A 4OONA 2B2TC 3T16A 3S1MH 1PRTD 3LX0A 4WJWA 1B7YB 1SJHD 1CSPA 5C4JH 1Y1VB 1IYUA 4DR5Q 4KD4A 1Y1WG 1TWFB 3HOXG 4A3MB 1UE1A 1WTHA 2V1CC 2JA8B 4YCUA 3S1MB 1B9MA 1BKBA 4RMFA 5LMNW 3NBHA 4TSSA 5COYA 1JE5A 2JQOA 1PZJD 3S15H 1G2TA 1H9KA 1AP0A 3R3OA 4DV6L 4DK3C 5C4JB 3BDOA 3SK8A 2N88A 4G7ZC 1D2BA 5IP7G 1EIYB 2UXBL 3TZUA 2PNRC 4DGZA 2DJGC 4AYBB 3ZJYC 3S15B 3TS0A 3A54A 1SE4A 2GN5A 5DLQE 2UXCL 4DR7Q 4DR4L 1KNEA 4JI0L 3HOUG 3FMCA 2Z6KC 2ICEC 2E8GA 3HZXA 4JYAQ 4H44C 1NJIC 4CDDC 5J3BA 5FKAC 4R9WA 1PYBA 4J8QA 1W6JA 4GNXA 4QY7A 2VUMH 4Y7NH 5C44H 4BA2I 2EPBA 1QVCA 1CT1D 5J1ZA 3I2ZA 3PUWA 3MFYA 3T1YL 1PLFA 2ICIA 1GD7A 1D6EC 5CBEE 1XNQL 4LWCA 4ZCKA 4FDBA 4LF8Q 4BBRG 2YV5A 4R4CA 5CBAE 5C44B 4Y7NB 2VUMB 1I4XA 2HCCA 2JJQA 4RH6A 1HNWL 3F2BA 4IPCA 5I9PA 1ZEQX 1X3GA 3LNNA 4OX9L 2LMCB 5T1IA 1RTNA 4KKTA 2WAQG 4DNRB 5L37A 4KJOA 3PF5A 5FLXc 1NMGA 3NK9A 1VMCA 4R8NA 3UDGA 1STYA 1V1PB 3GTMH 1JCKB 1RL2A 1LABA 4DV1Q 3K0YA 5J22A 2IX1A 3S1RH 1RODA 4OHJA 2B8GA 1Y1WH 3H0GH 3HOXH 1KD1C 1Q8IA 3PIO3 1W6KA 1R9TH 5JJKA 1N36Q 2E2DC 3GTMB 4HTHA 3S1RB 2B3GA 1HZCA 4X65L 1N32L 3J7YW 3W2DA 1LACA 3GP7A 1CTMA 1Y1WB 4FXKC 3H0GB 3NQTA 1Y69U 3HOXB 5IP7H 4LF9Q 1R9TB 1XMOQ 4NDXA 1Q3LA 1XXGA 2HHHQ 3P75A 1AZPA 1PFMA 1PYWD 5GAGC 4XIGS 5KGUA 3FVQA 4HSPA 5IP9G 3HOUH 4IURA 1I5FA 5E1FA 5C0XJ 4DV4L 4B3RQ 2WINB 5IYBH 3BYYB 1IBLQ 5C0XI 2L1BA 2MJ8A 1A2TA 1DYQA 1Y8PB 2EOTA 1MI2A 4KLKA 3HOUB 4LF4L 1SROA 4GOPB 2UUAQ 1I94Q 3S17H 1STBA 4DV2Q 1F2LA 5IT9c 2EYJA 5HGTA 2K04A 3AEVA 3T13A 1XTDA 2F0HA 4CJ2C 3FHWA 2FFKB 3Q0AA 1P16A 1YJ9A 4CDEC 4RG1A 3S17B 3W3AA 3KF6A 3NBHB 4QMGA 4X3TA 3F8TA 4CDCC 2L9HA 1ZYRC 4RA8A 1D1KA 4G7OC 1CHPD 4ZYSA 4J15A 3RLFA 1RKNA 5DEHA 3STBC 4PZ7A 4N9TA 2K32A 3F2CA 1BCPB 1AW7A 2WAQB 2QW7A 4R4OA 2RCFA 2PMZE 2SOBA 4ME5A 3PO3G 4IOCA 2JE6I 2PZWA 1XMQQ 4ILWA 1ESRA 2VB3X 4GNXB 4JI7L 5EPJA 1K83H 4P75A 4L63B 4CKEA 1EYGA 4DN4M 4DFAA 4K2KA 1SAPA 2JK8A 1I4QA 2A69D 2F0VA 1FR3A 1G6PA 2XVSA 4M1UB 3J80E 1K83B 2Q8IB 1IYJB 4XT3B 5IP9H 2EYFA 5FJ8G 1O7YA 1S72A 2MPMA 3OOCA 4I7AA 4UDUC 4DR2Q 2YU9H 1GVPA 1X32A 1JJ2A 2DNEA 1KAWA 2ZTCA 3CF5A 2OF1A 5M9OA 2K1BA 3E9HA 2EJGC 1HTLD 1F9QA 4N9PA 1A3UA 5IGCA 2YU9B 3N6RA 3ULLA 3CXCA 5CGKA 1BCPF 1HZBA 4KN4C 1GUTA 1Q7YC 3M4QA 5CV7A 1QUQA 2JYOA 2PNHA 3FPPA 4EQOA 3BVZA 4X6AH 4QCLA 3EVQA 3KK7A 1CSQA 2X6LA 5EPKA 5KNCA 1G291 3OMGA 2F0NA 3EA6A 1PXUA 1AE2A 4F87A 4EX5A 1IXRA 2D0OA 3DMUA 1A3VA 2DN8A 5ELEA 4B3ML 1E2ZA 4JC0A 2KCTA 3K5LA 2RSNA 2D5DA 1SXTA 5I2XA 2F0PA 3ERSX 2NN6I 4C3JG 3FDTA 1KHIA 3DUZA 4APVA 2F03A 4LF6L 3PO3H 3DHQA 3OYYA 1YVCA 5JJIA 1Z47A 3CCRA 4LUVA 3EROA 1B8AA 4DR3L 1ET9A 3H15A 1WTPA 5BR8Q 2KENA 1I6VC 1C7YA 3GDEA 2L55A 3PO3B 2KCCA 3PV0A 4GLXA 1BR9A 3MXUA 2F0FA 4CKCA 4DUYQ 1VQEA 2PYKA 3C1EA 4NXNL 5FJ8H 3IRBA 4K0KQ 3HG9A 4KK7A 2E2JH 3OIQA 3KF6B 2CWPA 3UDIA 5EQ0A 2YYZA 1EIHA 1JQYD 5IT9L 2I5HA 3BVGA 3LWEA 5JPNC 1II3A 4BXXG 2A6HC 2E2JB 1HNZQ 3RN5A 3CCQA 1PFSA 2B8FA 3TP6A 1SNOA 1TQOA 2VQEL 4X62Q 2IX0A 1IL2A 3CMEA 1L2FA 1A0IA 3QB3A 1EEFD 1N33Q 1EYCA 2EZVA 3I4NG 1FNUA 1EYAA 2A19A 2LSSA 4ME3A 4QGUA 2JN4A 1OTCA 3M4YA 4DU9A 4DAPA 2KCMA 1VQJA 2K52A 2NTSA 1I4RA 4NMZA 1YZ6A 2K75A 3RLOA 1KL9A 4OWXB 1LTLA 1H9SA 4P71A 3PO2G 1UE6A 2EIFA 2ZT9C 1IL8A 1JICA 1QVFA 1IKMA 2CW0D 1P8LA 3C2PA 4C3JH 1JWUD 5F2DA 1LT4D 2PQAA 3IKJA 5DM73 3HKZG 1D5ZC 2C5CA 3NTKA 2PI2A 2MHVA 1BVSA 4ZAIA 3X3NA 1TU2B 3RN2A 2ZM6L 1A2UA 1GJXA 5G3LF 4C3JB 1L1OC 1EIFA 4A3FG 5HGQA 3KLSA 3CCLA 3SXHA 1PH7A 1WCMG 1F77A 2H5XA 2CCZA 5DAUA 4PMBA 3NHHA 4H0LC 4QIWE 1QUQB 4JI5L 1TWHH 2UU9Q 3ERQA 2PPBC 3QOJA 2L4NA 1MHWC 1WYDA 4DUZQ 1ICFB 3HP3A 1I3QB 3J80L 1A63A 1MSGA 4C2MH 3DXJC 4JW0A 2BCOA 4B9XA 2ZXPA 1QILA 3PIP3 4H13C 5CMDA 1TWHB 2MP1A 1HQMC 4BXXH 1T9HA 3VR5A 3CAMA 4IUVA 3HFZB 2NZOA 1HQRD 1SRUA 2AUJD 3WOEA 5GROA 4C2MB 5C3XA 3E0JA 2F1MA 1SMXA 2B2WC 1SMYC 3CC2A 2Z8LA 2F4VQ 3I4MG 1ASZA 3I4NH 4ZUJA 3H09A 5C4XG 3VA5A 1LT6D 1WTRA 1SN8A 2MO1A 1KDBA 1CUKA 4LUOA 3BG3A 1N8RC 2F0OA 1YJWA 3I4NB 1NUCA 1KTKA 3PO2H 5JAVA 5FK9C 3HOVG 2RKSA 3Q23A 2KQ3A 3NPPA 2ASBA 2I46A 4U673 3ITPA 1EZ8A 3PQIA 4LFBQ 3A8KE 2Q8TA 4OXPA 1NMFA 2QEJC 3PO2B 1T5XD 1X55A 5IYCG 1H9JA 4P73A 4CKBA 5LMNQ 1SNDA 2PO4A 1LYLA 2BH2A 4JI4L 5JJZA 1KC8C 3BZKA 3MXNA 3IFTA 2UXDL 4A3FH 3L9AX 2A6EC 4JI6Q 3HKZB 3I4LA 4O0AA 3I8ZA 4B9WA 4A76A 2Q2UA 1WCMH 3C46A 2KUMA 3CCUA 3BDCA 2F3WA 1B1ZA 1AEXA 1L0WA 4UY8C 2EYOA 1U0LA 5KRUA 4A3FB 4TRDA 5D65A 1WFQA 2A1AA 3EFXD 2OT2A 1NNXA 2K28A 1NE3A 1WCMB 2XRSD 1MGSA 3GTQH 3H6MA 1S5ED 4HAEA 1QVGA 2BE5D 1HCZA 1NR2A 2Q8RE 2Q2HA 5IGFA 5CV8A 2E5LQ 2F4IA 4QB4A 4UHVA 1QCBD 3EQLC 3GTQB 4MN3A 1B50A 3NUCA 1GUWA 1EYDA 3I4MH 4ULLA 1EIGA 2R3ZA 5JEAG 4LFCQ 1TT2A 5C4XH 3RD4A 3I3CA 2QCPX 3TMEA 4DPGA 3AFPA 4A3IG 2IW3A 1V1PA 2KJXA 5EKIA 1PH9A 3AB9A 5A2QE 1PV4A 4XXEA 2Z1CA 3I4MB 1NY4A 2ZXRA 2E76C 1PDQA 2O2LD 5C4XB 1E24A 3G6EA 3HOVH 3J7AV 4R4QA 4RGTA 4G4KA 3A74A 4DXGA 4JYAL 2QKIC 4AQYQ 1ILPA 1EY5A 4MIUA 2R7DA 2ZTEA 2IT1A 2AQ2B 1XNRQ 1YNJC 5AJ3Q 3M7NA 5LMUL 3CC4A 3GV3A 2XRQD 5BN4A 5IYCH 3HOVB 3MC0B 3SVMA 2EXDA 4IFDJ 2PZTA 1STNA 5E7NA 1CK1A 4RFBA 1CKOA 1ILQA 1OXUA 1EWHA 1F2ZA 1VF7A 2WFWA 1Q46A 1UWVA 1EU3A 1KXLA 2X69A 2WAQE 2FMCA 4C1NK 2OTLA 2O5JC 4JCVE 4KV6A 2EYLA 1K73C 2E75C 2I5MX 3PCOB 4B3TQ 1XWEA 4BY1G 1K0SA 4OWWB 2EXZA 4X66Q 1R4QB 2AKWB 2VL6A 3ULJA 3HOYG 4KKUA 5IGEA 3WOFA 4RGNA 1QNKA 1WJJA 4DV7Q 2D0PA 3K58A 3IFDA 5JJLA 4P2CB 4S3SA 1NAPA 1S3OA 1YNNC 4FF2A 3GTPH 3QG1A 5JEAH 1E2WA 4FP5D 2Z0SA 3NTIA 3U50C 4BY7G 4GOPC 2B2UA 2K4KA 4EQ5A 5FO8B 3FKIG 3P7JA 4A3IH 3TZDA 4LF9L 1XMOL 3MHBA 3I7FA 2A8VA 4LF7L 2JA9A 3MXNB 4GN3B 1A15A 4PZ6A 3GTPB 4JBMA 3G71A 1NSNS 1YHQA 1IBMQ 1BOSA 2R61A 4MNOA 4KHZA 4A3IB 4L5RC 1I4HA 1IBLL 1FL0A 3R2IA 3ONAB 2CVRA 4MZ9A 2V4DA 1VQBA 4A3JG 4IUNA 1I94L 3FEWX 4QF4A 1ENCA 1EOVA 2EY5A 2OCEA 1BDOA 1ONLA 4X64L 4LF5Q 4MTNA 4HSVA 2K5WA 1HR0Q 1BCPC 1SDFA 1VF5C 3VR2A 1WVLA 1I4PA 4MHEA 3HOWG 1K3RA 5E4WC 4GNXC 1BXTA 4IJLA 4IUPA 3X3MA 3DM1A 2KHJA 4A3CG 4BY1H 5EKLA 4RKBA 3KJPA 4CHTB 1GHJA 5D3DA 4UAIA 4HJ8A 4KN7C 3T51B 1RD9D 3W1BA 3BYTB 4BY1B 1U4MA 1EY7A 1LV9A 3NELA 5C5LA 1WTXA 3CCJA 3OHXC 3T1HL 4MTKA 2QA4A 2JA6G 4R4TA 4GKKQ 4JK1C 1VQKA 3H94A 4XTCS 2RBMA 1UNSA 5TSSA 3MXPA 1D1IA 3J81E 2R7ZG 2EVBA 2E74C 4PZ8A 4BY7H 3CKIB 1X9NA 2O5IC 4JV5Q 3FKIH 2NUCA 3PUXA 4RAUC 1HUMA 4JI1Q 5J39A 2MGSA 2RF4A 1R4PB 3VYTA 2H1EA 3MEHA 3K7AH 1QNUA 4BY7B 1LTGD 1W3SA 5KIXA 1VS0A 3FKIB 2A73B 1Q1BA 5ISRA 3K59A 3J7A5 3TQYA 2UXBQ 1B9NA 1Z9FA 2JP1A 3A5UA 2A68C 1MJEA 4A3JH 2QDLA 3K7AB 5IWAL 2UXCQ 4K5XA 4DR4Q 4JI0Q 1U5KA 2IL8A 1UE7A 1GUGA 3G6JB 4RHRA 5IIFA 1D8LA 1A3TA 4BBRH 3RNUA 2F52A 4FYDA 4A3JB 2QGQA 5GQOA 2XN9C 2HQLA 1SNPA 1S5DD 1SE3A 1G2SA 1LTID 1JWMD 3MFGA 3OW7A 1S4ZA 3T1YQ 2LXJA 4BBRB 2L11A 1HHVA 2ZJRA 1FNWA 4A3CH 2JSOA 5K5PA 1K8OA 1PA6A 2LY7A 3OTOL 1CZGA 5K36G 4IZ8A 1G8ZD 1K9MC 1YBYA 1X3EA 5JVH3 4A93G 2K5DA 1Q12A 1VQAA 3CCEA 2WV6D 4UP8A 5FOBB 3L0OA 1FJGL 2K6AA 3B6YA 4ZKBB 3CCSA 1LLRD 3URYA 2HUGA 1HR0W 5CORA 3D4RA 5BR8L 5C3WA 1PTOD 4DV0Q 2R7ZH 2NZHA 1JJGA 1G51A 3CCVA 1ML0D 1E7ZA 2LKVA 2I5LX 1ZXTA 2BH8A 4UPAA 3MEFA 2UUBL 4IPGA 4R4IA 2R7ZB 3SK5A 1N32Q 1Y8NB 2Z4HA 1SNMA 2ATWA 1ICWA 1W2BA 1KABA 1K3BC 3H91A 4XQNA 1G6ZA 4LMQD 4DV3Q 4PQXA 2Q2IA 2HD3A 2ZXOA 3J80c 2BDOA 4BS9A 2BOSA 1ET6A 1HNZL 4DV4Q 3UDXA 2F0MA 4KHPL 4LAAA 2EYPA 3K6OA 1XX8A 4K2LA 3BDLA 4X62L 4A3LG 1N33L 4ZLTF 2KECA 1GO3E 4LF4Q 4OELB 5JOBA 4KD3A 1PZKD 4EQNA 4P72A 4B3SL 1UEBA 1VQOA 1DD2A 2KEDA 1SFOH 3K0XA 4DR6Q 3VR4A 5IGDA 1S5BD 2LS01 1H9RA 3SE0A 2SNMA 1I50H 5K36H 1LTRD 5I2YA 3HKZE 2J0TD 3U9OA 3VA7A 4WORA 1SFOB 1E3PA 3O13A 2H4OA 1I50B 4P74A 3M9BA 4ZK9B 1AH9A 4YHHL 2GA4B 3DEPA 1XPOA 3KOJA 2IWHA 1J5EQ 1YNJD 1JR0D 2XGTA 3DWQA 2RCNA 5IGBA 1DOMA 2WKCA 3SR1A 2Y0SG 3ND8A 1E0BA 2N3SA 1LTTD 4HEDA 3HS0C 5C4ZA 2RQXA 2XWBB 3OPOA 2EY1A 4DK6C 2X6GA 4DV5L 4A3KG 3RR5A 4JI3Q 1IW7C 1QZHA 3NE5B 2EQSA 2PI2E 1HA6A 4KHVA 4QL5A 1TKWB 3E0EA 2DNCA 4YY3L 3D3RA 3SGIA 1B44D 1A62A 1DCZA 4ZKCB 2ES2A 3F2DA 4A3LH 2UUCL 2SNSA 3DWPA 2SEBD 2ZTDA 2VQFL 3PGZA 4U68A 3TS2A 4YWMA 2Q2TA 1AFPA 3PF4A 1VQIA 2EE1A 4KJNA 3CC7A 1PH4A 1K8MA 1B53A 3QWNA 1WTVA 4DXFA 3K81C 2D9UA 4NXML 1Q1EA 1PH6A 3I91A 1J6QA 3NEMA 1SSOA 3WDNA 4OIKA 2OTJA 1Q82C 3G48A 1TY0A 2FMMA 5DNFA 3EBEA 1A8VA 4ZRZA 5FLMG 3NQIA 1KDCA 4LFBL 3R93A 1Q8KA 2E2HH 4C3HG 4CJ0B 3JAME 5GADC 1J8IA 4B3MQ 5LMNL 3UDFA 3AYHB 5CV6A 4C1NI 2NVTH 3QIAA 1HNXL 2HDMA 1VQ8A 2D2CC 4YCWA 2WACA 2B2YA 5D3IB 3KDFB 3TRZA 2IHFA 1ZKOA 4JI6L 3D31A 1V1QA 2EY6A 4DR1Q 3S2DH 1V9PA 3W5OA 1PRTB 1SYBA 4BBSG 1IBKL 4GKJL 2NVTB 1HFNA 1TWGH 3U4VA 4A3BG 1VQDA 1AZQA 2WP8J 4DR3Q 1YNXA 3RMHA 2BA0A 1E22A 3K57A 4A3KH 3S2DB 1JJCB 5JVG3 2AWNA 3M4OH 3VR6A 3V2TA 2WB1G 2L12A 4WJ3M 1TWGB 2OWOA 3C3LA 2Y0SB 1U4LA 1Q81C 3RUZA 3EN2A 2ID0A 4A75A 1TS3A 3FP9A 1SYCA 3L3OC 4AYBE 3BZDB 4FF4A 1X56A 3J81j 2PMZB 4Q5VA 1STEA 3OWFA 4KMUC 1N34L 4A3KB 4IUUA 4HCSA 1VQ5A 3M4OB 1QB5D 2JXMB 3J81i 1HJPA 4K6DA 3GTOH 2KA7A 3S14H 4OEMB 4UP9A 5HY6A 3MVVA 3JC66 2MQHA 4HIOA 3A56A 2WIIB 3C1FA 2YTYA 1STGA 3OWEB 1M1KC 2VQEQ 1WTWA 4JVZA 3GTOB 4RWSC 3S14B 2EY2A 1PRTF 2HIVA 1QJOA 4LFAL 1RIPA 3A5ZB 2SDFA 4HN7A 4LK1C 5GAEC 1K8GA 4L5TA 2EJMA 4QUFA 4AQYL 1SE2A 3HKSA 3FRPB 1C48A 1XNRL 1YIJA 4KTAA 1CQVA 2R6GA 3QJYA 1F9RA 1EZ6A 2L5TA 1EQQA 1TWAH 1PFNA 1CKNA 4X3UA 2BDNA 1JWSD 3E9IA 4OL7A 2F0SA 4JOIA 1CA5A 3CPWA 4POGA 3VR3A 1F9SA 5E4XA 3H3VH 3HRZC 3TP5A 2I0QA 1TWAB 4KY6A 4XYOA 4BBSH 2A69C 2C9OA 2K5HA 1SBBB 1HPCA 1IZ6A 4A3BH 2CQOA 2OEOA 4JI8L 1DM0B 4NPSA 1ENAA 2RDFA 2Z4IA 4RGMA 1SNQA 2ZM6Q 4A3GG 4IPHA 1VQ6A 2N55A 1QZGA 2AUKA 1QE6A 4JI2L 3ER0A 3TDQA 1MD2D 4BBSB 5BN3A 4X66L 4A3BB 2L0CA 2YTXA 3PUVA 1D5MC 1AE3A 1U4RA 1JOQA 1ZYRD 1STHA 4DR5L 3A8JE 2EYMA 4JI5Q 3E5SA 2B39A 1BBWA 4DV7L 4DAYA 3STBD 2WB1B 2XWJB 4O2DA 3RZDH 1JMCA 2JEAI 1E1OA 1X3QA 4LJZC 1EL0A 3HOZG 1QOHA 3AQQA 4QQBX 1UAPA 4OWTB 4K8IA 1DGSA 3RZDB 4FXDA 3TN2A 1VQLA 3GTJH 1C9OA 3CPFA 2QILA 1Q90A 4RCNA 3WWVA 4DR7L 1WD1A 2RHSB 3S16H 1V1OA 2G9HD 4FVMA 1HUNA 4H7BA 1ENFA 4FNFA 2HDLA 4X3SA 4UP7A 3GTJB 1KRSA 4G7HC 3KUPA 3SDZA 1GUNA 3D8GA 2LXKA 1FGUA 1DXMA 3S16B 3VDYA 4NB3A 3A8IE 1JOOA 5EBCA 5LL6X 1SE8A 1DOLA 4LF8L 4IFDI 2K01A 3ICEA 3UE1A 1EQRA 2G9DA 4OO1I 1D5XC 1BF4A 2K03A 3ND9A 4BWGB 1I4GA 2B2VA
chains in the Genus database with same CATH topology
3Q22A 3PUZA 2B2TA 5A35A 1PTOH 1EU4A 1XYIA 3T56B 5C5MA 5EBDA 3OIPA 2F0UA 2PZUA 1STAA 4OGQC 4FF3A 1CM9A 4A3GB 1PTOB 4KY5A 1EEID 4L8JA 3GTKB 4G57A 2RDGA 1EQTA 1E2VA 1KLGD 1EY4A 2NVYB 1CA6A 3M7GA 1EFID 1FD7D 2K05A 1V8QA 3KBXA 1RHPA 4QIWB 4HMIA 1EQVA 1JOKA 1TVXA 3MAQA 5KYLA 1TR5A 5JEAJ 3HOZB 3K5OA 3RZOB 1F9PA 3DWAA 3N52A 5NUCA 5C0XG 4HMJA 3S9WA 1C4QA 3CRKC 3SK4A 2CW0C 1O7LA 2K33A 2B2UC 2QDBA 2HQEA 4DAVA 2M2LA 1PTOF 3QO2A 1IW7D 1PFBA 4HR7B 1NCVA 5LHY1 1TS2A 2A6HD 3D4WA 4X3KA 2FJ2A 1TWCB 1VCIA 5FLXE 2KEEA 3NTHA 2BA1A 3OMCA 3LWUA 1KDAA 3CHBD 5AFWA 5M5YB 1KAAA 1XTCD 2XSCA 1BBXC 1VDZA 1LT3D 3MA2B 5ELDA 3HOYB 4I65A 4DK1A 4IQZA 3GTLB 4A3EB 4RCOA 1G91A 1T5EA 4XT1B 1H9MA 4C3IG 4O42A 4F88A 1HRJA 5M5XB 3KLSX 4YIJA 1L0YB 2CQAA 4K5VA 3R8BA 3MTSA 1TIID 5A2QL 3S2HB 2EJFC 5C0XH 1BO0A 2RA4A 3I70A 2RVLA 1Z7TA 3ZYYX 5KYIA 2VXWA 4EGVA 1UEAB 5IT9E 5E3FA 1EY9A 1JB3A 2F0DA 1V43A 2IX3A 2JA5B 4IN3A 5CR3A 4DF7A 1FYCA 1DOKA 4WRDA 2B63B 3NXWA 4J6HA 4Q0FA 1JE4A 1M8AA 2M00A 1DZ1A 5IGGA 1B2TA 1CI3M 3NBIA 3SK6A 1SMYD 4BA1I 5I6WA 3VYSA 1LT5D 1PMRA 2F0KA 3GD7A 2NVQB 2NYZD 3HOWB 3V96A 4TQUS 2RDHA 2BE5C 2NN6G 3GV6A 3CQZB 2AQ3B 4IALA 2XIWA 3MXGA 4F7XA 3T4AC 2F0QA 2NZ1D 5CV4A 2NWGA 2JA6B 3S1NB 1MSHA 5KEEA 1TS5A 1GUOA 1OO9B 3KBGA 3FPUB 4XYQA 4NP5A 3IAYA 4KY7A 4E6IA 1WTOA 2D62A 2ENBA 5EGTA 4C3IB 2F0JA 2R92B 2A6ED 1BUVT 4F8MA 2NBFA 4NW2A 2PQEA 4OIJA 4M8AA 4PMWA 1C8CA 5I4DA 3G7LA 2KCNA 1WD0A 2NTTA 2EDGA 5CYUA 3PUYA 1O7ZA 1DJRD 2IPKD 3A55A 3K5MA 3R2TA 2EYHA 5C4HA 4ZQ3A 1TS4A 1CQFA 1IHZA 1KNAA 1OXXK 4TKOB 1PRTC 4CJ1B 2AQ1B 4J1MA 5FLXL 1LO5D 2NN6H 4XQJA 3HGBA 5C3EB 1BQQT 3SHLA 3VYUA 3SEBA 4A93B 2JA7B 5ELFA 1EY0A 4K8JA 1RDPD 4PMCA 4RKLA 3GQBA 4K6LA 4L6TB 3AU7A 5CV9A 1SYEA 4Z9CB 3J81L 3M3YB 2F0LA 4I7ZC 5EPLA 2MUYA 3D4DA 1SNCA 5M5WB 4PV1C 5M3MB 3BS1A 1HTPA 2F0TA 4FXGC 1UUPA 1S5FD 4XQQA 1GXDC 1TY2A 3QOLA 3I90A 3TBIB 2R93B 2F0EA 1HFGA 3IL8A 3VYRA 3Q24A 3GO5A 5T1GA 4KKSA 1SYDA 2F0GA 3TP7A 1B3AA 4O1NA 1O80A 4IUTA 1SEBD 4V190 1YNND 3BVMA 2LFNA 1F2MA 3KLRA 1IKLA 4RGOS 3NWSA 3H3VC 2RSOA 4DK0A 1SJED 2FHTA 5M3FB 2JEBI 3S1QB 2FINB 5EJWA 1JORA 2KVMA 1VMPA 3GTGB 2F0IA 3TP8A 2E2HB 3E6ZX 3CU7A 5EKKA 5IODA 4FF1A 3KF8A 5FO7B 2F3VA 1RTOA 2K7VA 1KLUD 3CRLC 1LTAD 1ESFA 1MBYA 2PW5A 1FGBD 3L7ZC 2A74C 1SYFA 4V0BA 1BCPD 3HEJA 3UI2A 1M4VA 3OSOA 3EJIA 2B2YC 4RHSA 5C6AA 5HURA 1HXYD 4JBWA 5ELCA 3U9SA 2B2WA 2AWOA 5FO9B 1LTBD 2WKDA 2TMPA 3DEOA 3D6CA 3NWTA 2OXPA 1EOTA 5I9OA 4ZUIA 4HCEA 5JPMC 3NP8A 3I73A 4K14A 2VNUD 3P1HA 2CHBD 5ELBA 2PCFB 4CGYB 1EY6A 1FNVA 3MWYW 4C56C 2DY8A 1PZID 5D14A 2NVXB 3A7LA 1HA5A 5DM63 1O78A 4R8IA 1OXVA 2J4XA 4QUCA 3MZ5A 1SYGA 4ID6A 4FO2A 3T53B 5CV5A 3A7AB 3V05A 4IFDG 1DONA 4EVOA 1NR4A 4ODGA 4OO1G 1PTOC 4C3HB 1J9OA 2A68D 1S5CD 5I6YA 2K5QA 1CZWA 2QF7A 3Q6SA 2M9VA 1GOZA 5IOCA 1QG7A 1QWYA 1WTQA 4B08A 1L0XB 3M85A 1RF2D 1OXSC 3AMUA 4KI0A 3D6WA 5CC4A 5LL6S 2O4XA 4ABNA 1OXTA 4DA2A 1JC7A 4DNTB 1B4OA 1H9SB 1X3PA 3F2UA 3P20A 4A3DB 1Z6HA 4NKLA 4IUQA 1RJTA 4K5WA 2A5HA 2TSSA 3J7AF 5KNBA 1U9RA 2PW7A 5G3LD 3TSSA 2J7ZA 1GUSA 2NB0A 1RCVD 3PMFA 1CFMA 4EQPA 4PNYA 2IJ0A 1I6HB 4WFN3 4IFDH 3NSWA 4OO1H 2HCIA 3JAML 2VB2X 3I72A 4GZYC 2XNAC 4XDXA 2KOLA 3K5NA 1A6XA 5KNDA 1IYVA 1EY8A 2DY7A 1AN8A 5BN5A 1LTSD 2I07B 1BNZA 1GHKA 2F0WA 4CBVA 1F2YA 1Y8OB 1CHQD 1EWCA 2B2VC 2E2IB 1U4PA 2KHSA 3T16A 2B2TC 1PRTD 3LX0A 4WJWA 1SJHD 1Y1VB 1IYUA 4KD4A 1TWFB 4A3MB 2JA8B 3S1MB 1B9MA 3NBHA 4TSSA 5COYA 1PZJD 1G2TA 1H9KA 1AP0A 3R3OA 5C4JB 3BDOA 3SK8A 2N88A 4G7ZC 1D2BA 3TZUA 2PNRC 4DGZA 4AYBB 3S15B 3A54A 1SE4A 1KNEA 3FMCA 2ICEC 3HZXA 4H44C 5FKAC 4R9WA 4J8QA 1W6JA 4BA2I 2EPBA 1CT1D 5J1ZA 3PUWA 3MFYA 1PLFA 2ICIA 1D6EC 5CBEE 2VUMB 5CBAE 5C44B 4Y7NB 1I4XA 2HCCA 4RH6A 5I9PA 1ZEQX 3LNNA 2LMCB 5T1IA 1RTNA 4KKTA 4DNRB 4KJOA 3NK9A 1VMCA 4R8NA 1STYA 1V1PB 1JCKB 1LABA 3K0YA 5J22A 2IX1A 1RODA 4OHJA 2B8GA 1Q8IA 3PIO3 1W6KA 2E2DC 3GTMB 4HTHA 3S1RB 3J7YW 3W2DA 1LACA 3GP7A 1CTMA 1Y1WB 4FXKC 3H0GB 3NQTA 1Y69U 3HOXB 1R9TB 4NDXA 1Q3LA 1XXGA 3P75A 1AZPA 1PFMA 1PYWD 4XIGS 5KGUA 3FVQA 4HSPA 4IURA 5E1FA 5C0XJ 2WINB 3BYYB 5C0XI 2L1BA 2MJ8A 1A2TA 1DYQA 1Y8PB 2EOTA 1MI2A 3HOUB 1STBA 1F2LA 2EYJA 5HGTA 2K04A 3T13A 2F0HA 4CJ2C 2FFKB 3Q0AA 3S17B 3W3AA 4QMGA 4X3TA 2L9HA 1ZYRC 4RA8A 1D1KA 4G7OC 1CHPD 4ZYSA 3RLFA 1RKNA 5DEHA 4N9TA 2K32A 1BCPB 1AW7A 2WAQB 4ME5A 2SOBA 2JE6I 2PZWA 4ILWA 1ESRA 2VB3X 5EPJA 4L63B 4CKEA 4DN4M 4DFAA 4K2KA 1SAPA 1I4QA 2A69D 2F0VA 1FR3A 2XVSA 4M1UB 3J80E 1K83B 2Q8IB 4XT3B 2EYFA 1O7YA 2MPMA 3OOCA 4UDUC 1X32A 2DNEA 2OF1A 5M9OA 2K1BA 2EJGC 1HTLD 1F9QA 4N9PA 1A3UA 5IGCA 2YU9B 3N6RA 5CGKA 1BCPF 4KN4C 1GUTA 5CV7A 2JYOA 3FPPA 4EQOA 3BVZA 4QCLA 3EVQA 3KK7A 2X6LA 5EPKA 5KNCA 1G291 3OMGA 2F0NA 3EA6A 4F87A 1PXUA 3DMUA 1A3VA 2DN8A 5ELEA 1E2ZA 3K5LA 2RSNA 2D5DA 1SXTA 5I2XA 2F0PA 2NN6I 4C3JG 3FDTA 3DUZA 2F03A 3DHQA 1Z47A 3EROA 1WTPA 1ET9A 1I6VC 2L55A 3PO3B 2KCCA 3PV0A 1BR9A 3MXUA 2F0FA 4CKCA 2PYKA 3C1EA 3HG9A 4KK7A 3OIQA 5EQ0A 2YYZA 1EIHA 1JQYD 5IT9L 3BVGA 3LWEA 5JPNC 1II3A 2A6HC 2E2JB 2B8FA 3TP6A 1SNOA 1TQOA 2IX0A 3QB3A 1EEFD 1EYCA 2EZVA 1FNUA 1EYAA 3M4YA 4DU9A 4DAPA 2NTSA 1I4RA 4NMZA 1H9SA 2ZT9C 1IL8A 1JICA 1IKMA 2CW0D 3C2PA 1JWUD 5F2DA 1LT4D 3IKJA 5DM73 1D5ZC 2C5CA 3NTKA 2MHVA 4ZAIA 3X3NA 1TU2B 1A2UA 1GJXA 5G3LF 4C3JB 3KLSA 3SXHA 1F77A 5DAUA 4PMBA 3NHHA 4H0LC 3ERQA 2PPBC 3QOJA 2L4NA 3HP3A 3J80L 1I3QB 1MSGA 3DXJC 2BCOA 4B9XA 2ZXPA 1QILA 3PIP3 4H13C 5CMDA 1TWHB 2MP1A 1HQMC 3VR5A 4IUVA 1HQRD 2AUJD 3WOEA 4C2MB 5C3XA 3E0JA 2F1MA 2B2WC 1SMYC 2Z8LA 4ZUJA 3H09A 3VA5A 1LT6D 1WTRA 1KDBA 3BG3A 2F0OA 3I4NB 1KTKA 1NUCA 5JAVA 5FK9C 2RKSA 3Q23A 2KQ3A 3NPPA 2I46A 4U673 3ITPA 1EZ8A 3A8KE 2Q8TA 2QEJC 3PO2B 1T5XD 1H9JA 4CKBA 1SNDA 2PO4A 5JJZA 3MXNA 3IFTA 3L9AX 2A6EC 3HKZB 3I4LA 3I8ZA 4B9WA 3C46A 2KUMA 3BDCA 2F3WA 1B1ZA 1AEXA 2EYOA 5KRUA 4A3FB 4TRDA 5D65A 3EFXD 2OT2A 2K28A 1WCMB 2XRSD 1MGSA 3H6MA 1S5ED 4HAEA 2BE5D 1HCZA 1NR2A 2Q8RE 5IGFA 5CV8A 2F4IA 4QB4A 1QCBD 3EQLC 3GTQB 4MN3A 1B50A 3NUCA 1GUWA 1EYDA 4ULLA 1EIGA 2R3ZA 5JEAG 1TT2A 3RD4A 3I3CA 2QCPX 3TMEA 2IW3A 1V1PA 2KJXA 5EKIA 3AB9A 5A2QE 4XXEA 2Z1CA 3I4MB 2ZXRA 2E76C 1PDQA 2O2LD 5C4XB 3J7AV 4RGTA 4G4KA 4DXGA 2QKIC 1ILPA 1EY5A 4MIUA 2IT1A 2AQ2B 1YNJC 3M7NA 3GV3A 2XRQD 5BN4A 3HOVB 3MC0B 3SVMA 4IFDJ 2PZTA 1STNA 1CK1A 4RFBA 1ILQA 1OXUA 1EWHA 1F2ZA 1VF7A 1EU3A 2X69A 2FMCA 4C1NK 2O5JC 4KV6A 2EYLA 2E75C 1XWEA 2EXZA 1R4QB 4KKUA 5IGEA 3WOFA 4RGNA 1QNKA 3K58A 3IFDA 4P2CB 4S3SA 1NAPA 1YNNC 4FF2A 3QG1A 5JEAH 1E2WA 4FP5D 3NTIA 2B2UA 5FO8B 3P7JA 3TZDA 3MHBA 1A15A 3GTPB 1NSNS 1BOSA 2R61A 4KHZA 4A3IB 1I4HA 3R2IA 3ONAB 2CVRA 2V4DA 4IUNA 3FEWX 4QF4A 1ENCA 2EY5A 1BDOA 1ONLA 4HSVA 2K5WA 1BCPC 1SDFA 1VF5C 3VR2A 1WVLA 1I4PA 4MHEA 5E4WC 1BXTA 4IUPA 3X3MA 3DM1A 5EKLA 4RKBA 4CHTB 1GHJA 5D3DA 4UAIA 4KN7C 3T51B 1RD9D 3BYTB 4BY1B 1U4MA 1EY7A 1LV9A 5C5LA 1WTXA 3OHXC 4JK1C 3H94A 4XTCS 2RBMA 1UNSA 5TSSA 3MXPA 1D1IA 3J81E 2EVBA 2E74C 3CKIB 2O5IC 2NUCA 4RAUC 3PUXA 1HUMA 5J39A 2MGSA 1R4PB 3VYTA 2H1EA 3MEHA 1QNUA 4BY7B 1LTGD 5KIXA 3FKIB 2A73B 1Q1BA 5ISRA 3K59A 1B9NA 2JP1A 2A68C 3K7AB 4K5XA 2IL8A 1GUGA 3G6JB 4RHRA 5IIFA 1A3TA 4FYDA 4A3JB 2XN9C 1SNPA 1S5DD 1SE3A 1G2SA 1LTID 1JWMD 3MFGA 3OW7A 1S4ZA 4BBRB 2L11A 1HHVA 1FNWA 2JSOA 5K5PA 1K8OA 2LY7A 1CZGA 5K36G 4IZ8A 1G8ZD 5JVH3 2K5DA 1Q12A 2WV6D 5FOBB 2K6AA 4ZKBB 1LLRD 3URYA 2HUGA 5CORA 3D4RA 5C3WA 1PTOD 1ML0D 2LKVA 1ZXTA 2R7ZB 3SK5A 1Y8NB 2Z4HA 1SNMA 1ICWA 1KABA 3H91A 4XQNA 1G6ZA 4LMQD 4PQXA 2ZXOA 2BDOA 4BS9A 2BOSA 1ET6A 2F0MA 4LAAA 2EYPA 3K6OA 1XX8A 4K2LA 3BDLA 4ZLTF 2KECA 5JOBA 4KD3A 1PZKD 4EQNA 1DD2A 2KEDA 3VR4A 5IGDA 1S5BD 2LS01 1H9RA 3SE0A 2SNMA 5K36H 1LTRD 5I2YA 2J0TD 3U9OA 3VA7A 4WORA 1SFOB 3O13A 2H4OA 1I50B 4ZK9B 2GA4B 3DEPA 2IWHA 1YNJD 1JR0D 3DWQA 5IGBA 1DOMA 2WKCA 3SR1A 3ND8A 1E0BA 1LTTD 4HEDA 3HS0C 5C4ZA 2RQXA 2XWBB 3OPOA 2EY1A 2X6GA 1IW7C 3NE5B 1HA6A 4KHVA 1TKWB 2DNCA 3D3RA 1B44D 1DCZA 4ZKCB 2SNSA 3DWPA 2SEBD 4U68A 1AFPA 2EE1A 4KJNA 1K8MA 1B53A 3QWNA 1WTVA 4DXFA 2D9UA 1Q1EA 3I91A 1SSOA 3WDNA 4OIKA 1TY0A 2FMMA 5DNFA 4ZRZA 3NQIA 1KDCA 3R93A 4C3HG 4CJ0B 3JAME 1J8IA 5CV6A 4C1NI 3QIAA 2HDMA 2D2CC 2WACA 2B2YA 5D3IB 1ZKOA 3D31A 2EY6A 1PRTB 1SYBA 2NVTB 1HFNA 1AZQA 2WP8J 3RMHA 2BA0A 3K57A 3S2DB 5JVG3 2AWNA 3VR6A 3V2TA 2L12A 1TWGB 3C3LA 2Y0SB 1U4LA 3RUZA 2ID0A 1TS3A 1SYCA 3L3OC 3BZDB 4FF4A 2PMZB 4Q5VA 1STEA 3OWFA 4KMUC 4A3KB 4IUUA 4HCSA 3M4OB 1QB5D 2JXMB 4K6DA 2KA7A 3MVVA 3A56A 2WIIB 3C1FA 1STGA 3OWEB 1WTWA 3GTOB 4RWSC 3S14B 2EY2A 1PRTF 1QJOA 2SDFA 4HN7A 4LK1C 2EJMA 4QUFA 1SE2A 3FRPB 1C48A 4KTAA 1CQVA 2R6GA 3QJYA 1F9RA 1EZ6A 2L5TA 1PFNA 4X3UA 2BDNA 1JWSD 4OL7A 2F0SA 1CA5A 3VR3A 1F9SA 5E4XA 3HRZC 3TP5A 1TWAB 4KY6A 4XYOA 2A69C 2C9OA 1SBBB 1HPCA 2OEOA 1DM0B 1ENAA 2RDFA 2Z4IA 4RGMA 1SNQA 2N55A 2AUKA 1QE6A 3TDQA 1MD2D 4BBSB 5BN3A 4A3BB 2L0CA 3PUVA 1D5MC 1U4RA 1JOQA 1ZYRD 1STHA 3A8JE 2EYMA 3E5SA 2B39A 4DAYA 2WB1B 2XWJB 2JEAI 1X3QA 4LJZC 1EL0A 1QOHA 1UAPA 4K8IA 3RZDB 4FXDA 3TN2A 2QILA 1Q90A 4RCNA 1WD1A 1V1OA 2G9HD 4FVMA 1HUNA 4H7BA 1ENFA 4FNFA 2HDLA 4X3SA 3GTJB 4G7HC 3KUPA 3SDZA 1GUNA 3D8GA 1DXMA 3S16B 3A8IE 1JOOA 5EBCA 5LL6X 1DOLA 4IFDI 2K01A 2G9DA 4OO1I 1D5XC 1BF4A 2K03A 3ND9A 4BWGB 1I4GA 2B2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LS0 1; 
#chains in the Genus database with same CATH topology
 3Q22 A;  1VQC A;  3BU2 A;  4JI4 Q;  3PUZ A;  2B2T A;  4A3G H;  5A35 A;  1PTO H;  1EU4 A;  3GTK H;  3NEN A;  1XYI A;  3T56 B;  5C5M A;  5EBD A;  3OIP A;  4DV1 L;  2F0U A;  2PZU A;  1STA A;  2NVY H;  4OGQ C;  4FF3 A;  1CM9 A;  4A3G B;  1PTO B;  2MO0 A;  4KY5 A;  3I55 A;  4A3E G;  1K8A C;  1EEI D;  4L8J A;  3GTK B;  4G57 A;  2RDG A;  1EQT A;  1Y14 B;  1E2V A;  1KLG D;  2Z6B A;  1N36 L;  4GKK L;  1X65 A;  1EY4 A;  2NVY B;  1PYS B;  5IE8 A;  1CA6 A;  3M7G A;  3HOZ H;  3EIV A;  1EFI D;  3RZO H;  1GM5 A;  1CKN B;  2N49 A;  4JV5 L;  1FD7 D;  2Z6K A;  2HHH L;  3CP0 A;  3H0G G;  4JI1 L;  5EAY A;  2K05 A;  1BBU A;  1V8Q A;  4A4I A;  3KBX A;  1RHP A;  4QIW B;  4HMI A;  1D7Q A;  1EQV A;  1JOK A;  1TVX A;  1PH8 A;  3MAQ A;  5KYL A;  1TR5 A;  5ELO A;  5JEA J;  3HOZ B;  3K5O A;  4B3R L;  3RZO B;  1F9P A;  3DWA A;  4HJ7 A;  3N52 A;  1YHA A;  5NUC A;  5C0X G;  4HMJ A;  3S9W A;  1C4Q A;  3CRK C;  3SK4 A;  2CW0 C;  2JA5 G;  4LW1 A;  2ZJQ A;  1O7L A;  2K33 A;  2B2U C;  4TVA B;  2B63 G;  2UUA L;  3K7U C;  2QDB A;  2N78 A;  2DUD A;  2HQE A;  4DV2 L;  4DAV A;  3QR8 A;  3OW2 A;  2M2L A;  4GLA C;  5IYB G;  1PTO F;  3QO2 A;  1IW7 D;  1PFB A;  1TWC H;  4HR7 B;  1NCV A;  3L2P A;  5LHY 1;  4DAY B;  1TS2 A;  2A6H D;  4JBK A;  3D4W A;  3D0F A;  5LMU Q;  4X3K A;  2FJ2 A;  3KYH C;  4GLV B;  3Q8D A;  2MNA A;  3KFU A;  1TWC B;  3F1Z A;  1VCI A;  1VQM A;  5FLX E;  2KEE A;  3NTH A;  1S40 A;  5M5Y H;  4L5S A;  2BA1 A;  3CMA A;  3OMC A;  1NBW A;  3LWU A;  1TXY A;  3HOY H;  1KDA A;  3CHB D;  3GTL H;  4A3E H;  5AFW A;  3JAM i;  1YEZ A;  5M5Y B;  3PIO A;  1KAA A;  1XTC D;  2XSC A;  1BBX C;  1VDZ A;  1XMQ L;  1LT3 D;  3W1G A;  3KJO A;  3MA2 B;  5ELD A;  5M5X H;  3G4S A;  3HOY B;  4I65 A;  4DK1 A;  4IQZ A;  3GTL B;  4A3E B;  4RCO A;  1G91 A;  1T5E A;  4XT1 B;  4DV0 L;  1H9M A;  4C3I G;  2K5N A;  4R1J A;  4YWL A;  2R92 G;  3S2H H;  4O42 A;  1M90 C;  4F88 A;  2ZJP A;  1HRJ A;  5M5X B;  3KLS X;  4YIJ A;  1L0Y B;  1B3Q A;  2CQA A;  4K5V A;  3R8B A;  3MTS A;  4DV6 Q;  1TII D;  4DR2 L;  5A2Q L;  3S2H B;  2EJF C;  5C0X H;  3J81 c;  4PG3 A;  1BO0 A;  2RA4 A;  2XTI A;  3I70 A;  2JA5 H;  2RVL A;  4QJF A;  4DV3 L;  1Z7T A;  4LF7 Q;  3ZYY X;  3PSI A;  5KYI A;  2B63 H;  2VXW A;  2CWA A;  1E1T A;  4EGV A;  1UEA B;  5IT9 E;  5E3F A;  4IOA A;  1N9W A;  1EY9 A;  1JB3 A;  4JG2 A;  2F0D A;  1V43 A;  2IX3 A;  2JA5 B;  4IN3 A;  5CR3 A;  4DF7 A;  1FYC A;  1DOK A;  4WRD A;  4YCV A;  2B63 B;  3NXW A;  2CH4 A;  4J6H A;  1Q86 C;  4Q0F A;  1JE4 A;  1M8A A;  2M00 A;  2NVQ H;  1DZ1 A;  5IGG A;  1CKM A;  3HOW H;  1B2T A;  3ULP A;  1CI3 M;  3NBI A;  4L5Q A;  1XNQ Q;  3CQZ H;  1PHJ A;  3SK6 A;  4DR6 L;  1SMY D;  4X64 Q;  4BA1 I;  5I6W A;  3VYS A;  1LT5 D;  1PMR A;  2F0K A;  2MFI A;  1HNW Q;  3GD7 A;  2NVQ B;  5C3E G;  2NYZ D;  3TRE A;  3HOW B;  4IPD A;  3V96 A;  4TQU S;  3I56 A;  2JA7 G;  2RDH A;  1JT8 A;  1YI2 A;  2BE5 C;  2NN6 G;  3GV6 A;  3CQZ B;  4OX9 Q;  2AQ3 B;  4IAL A;  2JA6 H;  3S1N H;  2B29 A;  2XIW A;  3MXG A;  4F7X A;  3T4A C;  2F0Q A;  2NZ1 D;  5CV4 A;  1KRT A;  2NWG A;  4C3I H;  2Y0S E;  2JA6 B;  3S1N B;  1MSH A;  3UE0 A;  5KEE A;  5M3M G;  2R92 H;  2DJF C;  1J5E L;  1TS5 A;  3T1H Q;  4DUY L;  1GUO A;  1OO9 B;  3KBG A;  3FPU B;  1KQS A;  4XYQ A;  4NP5 A;  3IAY A;  4KY7 A;  4E6I A;  1WTO A;  4X65 Q;  4K0K L;  2D62 A;  2ENB A;  5EGT A;  4C3I B;  4HJA A;  2F0J A;  2R92 B;  1EFW A;  2A6E D;  1BUV T;  4JI3 L;  4F8M A;  2NBF A;  4NW2 A;  1XPR A;  2PQE A;  4OIJ A;  2R93 G;  4M8A A;  4PMW A;  1C8C A;  5I4D A;  1EWI A;  3G7L A;  3J7Z C;  3KDF A;  2KCN A;  3AFQ A;  4LNQ A;  4AIM A;  1WD0 A;  1C0A A;  2NTT A;  2EDG A;  5CYU A;  3PUY A;  5GAH C;  5IWA Q;  1O7Z A;  2GVB A;  1DJR D;  2IPK D;  3A55 A;  3K5M A;  3R2T A;  4N8F A;  2EYH A;  5C4H A;  4ZQ3 A;  1HZA A;  1TS4 A;  1UE5 A;  4H02 A;  1CQF A;  1IHZ A;  2F3I A;  1KNA A;  1OXX K;  5C3E H;  4TKO B;  1ASY A;  1PRT C;  4CJ1 B;  2AQ1 B;  4A93 H;  5M3F G;  2JA7 H;  4J1M A;  5FLX L;  1LO5 D;  2NN6 H;  4XQJ A;  3HGB A;  1VQ4 A;  2N8N A;  2K14 A;  5C3E B;  1JB7 A;  1BQQ T;  3SHL A;  3VYU A;  3SEB A;  4A93 B;  2JA7 B;  5ELF A;  1EY0 A;  3OTO Q;  1GKH A;  1KIX A;  3M3Y H;  4K8J A;  1VQP A;  1RDP D;  2IHE A;  3BZC A;  4PMC A;  1VQG A;  4RKL A;  3GQB A;  4K6L A;  3M4P A;  5M5W H;  5M3M H;  4L6T B;  3AU7 A;  5CV9 A;  4DR1 L;  1FJG Q;  4IJH A;  1SYE A;  4Z9C B;  3J81 L;  3CW2 C;  3M3Y B;  4HJ9 A;  2F0L A;  4I7Z C;  2CFM A;  5EPL A;  2MUY A;  4JI7 Q;  2WB1 E;  3D4D A;  2UU9 L;  1SNC A;  4HID A;  5M5W B;  4PV1 C;  5M3M B;  1MIU A;  4DUZ L;  3BS1 A;  4POF A;  1HTP A;  2F0T A;  4FXG C;  1SLJ A;  2R93 H;  1UUP A;  1S5F D;  4XQQ A;  2UUB Q;  4DNI A;  1GXD C;  4HIM A;  1TY2 A;  3QOL A;  3I90 A;  3TBI B;  1VQF A;  2F4V L;  2R93 B;  2F0E A;  1HZ9 A;  1HFG A;  3IL8 A;  2VZA A;  3VYR A;  3Q24 A;  3GO5 A;  5T1G A;  4KKS A;  1SYD A;  2F0G A;  3TP7 A;  1B3A A;  4LUZ A;  2ALY B;  4GN5 A;  4O1N A;  3CCM A;  1XJV A;  1O80 A;  4IUT A;  4KHP Q;  2IY5 B;  1SEB D;  1VQH A;  4V19 0;  1YNN D;  3BVM A;  2DGY A;  1XPU A;  2LFN A;  1B70 B;  1F2M A;  4GN4 B;  3E3X A;  1PH3 A;  5M3F H;  3S1Q H;  3RLN A;  3KLR A;  2C35 B;  3GTG H;  4B3S Q;  1IKL A;  1K28 A;  4HJ5 A;  2R7F A;  4RGO S;  4N8X 1;  3NWS A;  3H3V C;  4JPB W;  2RSO A;  1L1O A;  4DK0 A;  1SJE D;  2FHT A;  5M3F B;  2JEB I;  3S1Q B;  2FIN B;  5EJW A;  5IYD G;  1JOR A;  2KVM A;  1VMP A;  3GTG B;  2F0I A;  3TP8 A;  2E2H B;  3E6Z X;  1PVO A;  1MKH A;  3CU7 A;  5EKK A;  4LF6 Q;  5IOD A;  2AMC B;  3U4Z A;  4FF1 A;  3KF8 A;  5FO7 B;  2F3V A;  1RTO A;  2K7V A;  1KLU D;  3CRL C;  1LTA D;  1X6O A;  3JAM c;  1ESF A;  1MBY A;  2PW5 A;  1EUJ A;  4ALP A;  1FGB D;  3L7Z C;  4AH6 A;  2A74 C;  1SYF A;  4V0B A;  1BCP D;  4YHH Q;  3U58 A;  3K80 C;  3HEJ A;  3UI2 A;  1M4V A;  3OSO A;  1SR3 A;  3EJI A;  3PIP A;  1VQN A;  1I3Q H;  2B2Y C;  4RHS A;  5C6A A;  5HUR A;  1HXY D;  4JBW A;  5ELC A;  3U9S A;  4NXN Q;  2E5L L;  2B2W A;  2AWO A;  5FO9 B;  1LTB D;  2WKD A;  2TMP A;  3DEO A;  3D6C A;  3NWT A;  2OXP A;  1EOT A;  5I9O A;  4DV5 Q;  4ZUI A;  4A3D G;  1VQ9 A;  4HCE A;  5ELN A;  4LFC L;  2HIX A;  5JPM C;  4YY3 Q;  5H1S E;  3NP8 A;  2Z9H A;  4CDF C;  3KLW A;  4DKA C;  3I73 A;  4K14 A;  2VNU D;  2NVX H;  1HH2 P;  2HT1 A;  3P1H A;  2CHB D;  2VY3 A;  5ELB A;  2YTV A;  1MJC A;  2PCF B;  2UUC Q;  1LM0 A;  2VQF Q;  4CGY B;  1EY6 A;  1FNV A;  3MWY W;  4C56 C;  2DY8 A;  1PZI D;  5D14 A;  2NVX B;  3A7L A;  5FLM H;  1HA5 A;  5DM6 3;  1O78 A;  1PH5 A;  4R8I A;  1OXV A;  2J4X A;  4QUC A;  1X54 A;  5AJ3 L;  3MZ5 A;  1VQ7 A;  4C3H H;  1PH2 A;  1SYG A;  4ID6 A;  4FO2 A;  4NXM Q;  3T53 B;  1O7I A;  5CV5 A;  3A7A B;  3LGJ A;  1PH1 A;  3V05 A;  5IYD H;  4IFD G;  1DON A;  4EVO A;  1H95 A;  1NR4 A;  1YHB A;  4ODG A;  1YJN A;  4OO1 G;  1PTO C;  3I4O A;  4C3H B;  1J9O A;  2A68 D;  1S5C D;  1WI5 A;  5I6Y A;  2K5Q A;  1CZW A;  2QF7 A;  2CKZ B;  3Q6S A;  2FXQ A;  1HNX Q;  4B3T L;  2M9V A;  1GOZ A;  5IOC A;  1QG7 A;  3TEH B;  3H3V I;  1QWY A;  1WTQ A;  3DM3 A;  4B08 A;  4JOI C;  1IBK Q;  4GKJ Q;  1L0X B;  3M85 A;  1RF2 D;  1K0R A;  3BJU A;  1Y1V G;  1OXS C;  3AMU A;  4YWK A;  4KI0 A;  3D6W A;  4A3M G;  2P5Z X;  5CC4 A;  2JA8 G;  5LL6 S;  4A3D H;  2O4X A;  4ABN A;  1OXT A;  4DA2 A;  2CH4 W;  1JC7 A;  4DNT B;  1L1O B;  1B4O A;  1H9S B;  1N34 Q;  1X3P A;  2RHQ B;  3F2U A;  3P20 A;  4A3D B;  4WJ4 A;  4AYB G;  1WOC A;  1Z6H A;  4NKL A;  4IUQ A;  3DLL A;  1RJT A;  4K5W A;  2A5H A;  2TSS A;  3S24 A;  2PQA B;  3KF8 B;  1IBM L;  3J7A F;  5KNB A;  1U9R A;  2PW7 A;  5G3L D;  3TSS A;  2J7Z A;  2KHI A;  1I6H H;  1YIT A;  1GUS A;  4GS3 A;  3J80 i;  2VW9 A;  2G5D A;  2NB0 A;  1RCV D;  4HIK A;  3PMF A;  2AHO B;  2QEX A;  4IO9 A;  1CFM A;  2K50 A;  4EQP A;  4PNY A;  2IJ0 A;  4JBJ A;  4LFA Q;  1I6H B;  4WFN 3;  4IFD H;  2GVA A;  4LF5 L;  1HR0 L;  3NSW A;  4OO1 H;  2HCI A;  3JAM L;  2VB2 X;  3I72 A;  4GZY C;  2XNA C;  4XDX A;  2VUM G;  5C44 G;  3CD6 A;  1NTG A;  2VS1 A;  2KOL A;  3K8A A;  2L15 A;  3K5N A;  1A6X A;  5KND A;  5IY0 A;  1IYV A;  1EY8 A;  1FVI A;  2UXD Q;  2DY7 A;  1AN8 A;  5BN5 A;  2E2I H;  2K5V A;  4DAM A;  1X3F A;  4Y52 H;  1LTS D;  2I07 B;  1BNZ A;  3A0J A;  1GHK A;  2F0W A;  4JI8 Q;  4CBV A;  1F2Y A;  1Y8O B;  1CHQ D;  1Y1V H;  1EWC A;  1TWF H;  2B2V C;  4A3M H;  4GOP A;  2E2I B;  1U4P A;  2KHS A;  4JI2 Q;  2JA8 H;  2KBN A;  1LUZ A;  2OQK A;  2OQ0 A;  4OON A;  2B2T C;  3T16 A;  3S1M H;  1PRT D;  3LX0 A;  4WJW A;  1B7Y B;  1SJH D;  1CSP A;  5C4J H;  1Y1V B;  1IYU A;  4DR5 Q;  4KD4 A;  1Y1W G;  1TWF B;  3HOX G;  4A3M B;  1UE1 A;  1WTH A;  2V1C C;  2JA8 B;  4YCU A;  3S1M B;  1B9M A;  1BKB A;  4RMF A;  5LMN W;  3NBH A;  4TSS A;  5COY A;  1JE5 A;  2JQO A;  1PZJ D;  3S15 H;  1G2T A;  1H9K A;  1AP0 A;  3R3O A;  4DV6 L;  4DK3 C;  5C4J B;  3BDO A;  3SK8 A;  2N88 A;  4G7Z C;  1D2B A;  5IP7 G;  1EIY B;  2UXB L;  3TZU A;  2PNR C;  4DGZ A;  2DJG C;  4AYB B;  3ZJY C;  3S15 B;  3TS0 A;  3A54 A;  1SE4 A;  2GN5 A;  5DLQ E;  2UXC L;  4DR7 Q;  4DR4 L;  1KNE A;  4JI0 L;  3HOU G;  3FMC A;  2Z6K C;  2ICE C;  2E8G A;  3HZX A;  4JYA Q;  4H44 C;  1NJI C;  4CDD C;  5J3B A;  5FKA C;  4R9W A;  1PYB A;  4J8Q A;  1W6J A;  4GNX A;  4QY7 A;  2VUM H;  4Y7N H;  5C44 H;  4BA2 I;  2EPB A;  1QVC A;  1CT1 D;  5J1Z A;  3I2Z A;  3PUW A;  3MFY A;  3T1Y L;  1PLF A;  2ICI A;  1GD7 A;  1D6E C;  5CBE E;  1XNQ L;  4LWC A;  4ZCK A;  4FDB A;  4LF8 Q;  4BBR G;  2YV5 A;  4R4C A;  5CBA E;  5C44 B;  4Y7N B;  2VUM B;  1I4X A;  2HCC A;  2JJQ A;  4RH6 A;  1HNW L;  3F2B A;  4IPC A;  5I9P A;  1ZEQ X;  1X3G A;  3LNN A;  4OX9 L;  2LMC B;  5T1I A;  1RTN A;  4KKT A;  2WAQ G;  4DNR B;  5L37 A;  4KJO A;  3PF5 A;  5FLX c;  1NMG A;  3NK9 A;  1VMC A;  4R8N A;  3UDG A;  1STY A;  1V1P B;  3GTM H;  1JCK B;  1RL2 A;  1LAB A;  4DV1 Q;  3K0Y A;  5J22 A;  2IX1 A;  3S1R H;  1ROD A;  4OHJ A;  2B8G A;  1Y1W H;  3H0G H;  3HOX H;  1KD1 C;  1Q8I A;  3PIO 3;  1W6K A;  1R9T H;  5JJK A;  1N36 Q;  2E2D C;  3GTM B;  4HTH A;  3S1R B;  2B3G A;  1HZC A;  4X65 L;  1N32 L;  3J7Y W;  3W2D A;  1LAC A;  3GP7 A;  1CTM A;  1Y1W B;  4FXK C;  3H0G B;  3NQT A;  1Y69 U;  3HOX B;  5IP7 H;  4LF9 Q;  1R9T B;  1XMO Q;  4NDX A;  1Q3L A;  1XXG A;  2HHH Q;  3P75 A;  1AZP A;  1PFM A;  1PYW D;  5GAG C;  4XIG S;  5KGU A;  3FVQ A;  4HSP A;  5IP9 G;  3HOU H;  4IUR A;  1I5F A;  5E1F A;  5C0X J;  4DV4 L;  4B3R Q;  2WIN B;  5IYB H;  3BYY B;  1IBL Q;  5C0X I;  2L1B A;  2MJ8 A;  1A2T A;  1DYQ A;  1Y8P B;  2EOT A;  1MI2 A;  4KLK A;  3HOU B;  4LF4 L;  1SRO A;  4GOP B;  2UUA Q;  1I94 Q;  3S17 H;  1STB A;  4DV2 Q;  1F2L A;  5IT9 c;  2EYJ A;  5HGT A;  2K04 A;  3AEV A;  3T13 A;  1XTD A;  2F0H A;  4CJ2 C;  3FHW A;  2FFK B;  3Q0A A;  1P16 A;  1YJ9 A;  4CDE C;  4RG1 A;  3S17 B;  3W3A A;  3KF6 A;  3NBH B;  4QMG A;  4X3T A;  3F8T A;  4CDC C;  2L9H A;  1ZYR C;  4RA8 A;  1D1K A;  4G7O C;  1CHP D;  4ZYS A;  4J15 A;  3RLF A;  1RKN A;  5DEH A;  3STB C;  4PZ7 A;  4N9T A;  2K32 A;  3F2C A;  1BCP B;  1AW7 A;  2WAQ B;  2QW7 A;  4R4O A;  2RCF A;  2PMZ E;  2SOB A;  4ME5 A;  3PO3 G;  4IOC A;  2JE6 I;  2PZW A;  1XMQ Q;  4ILW A;  1ESR A;  2VB3 X;  4GNX B;  4JI7 L;  5EPJ A;  1K83 H;  4P75 A;  4L63 B;  4CKE A;  1EYG A;  4DN4 M;  4DFA A;  4K2K A;  1SAP A;  2JK8 A;  1I4Q A;  2A69 D;  2F0V A;  1FR3 A;  1G6P A;  2XVS A;  4M1U B;  3J80 E;  1K83 B;  2Q8I B;  1IYJ B;  4XT3 B;  5IP9 H;  2EYF A;  5FJ8 G;  1O7Y A;  1S72 A;  2MPM A;  3OOC A;  4I7A A;  4UDU C;  4DR2 Q;  2YU9 H;  1GVP A;  1X32 A;  1JJ2 A;  2DNE A;  1KAW A;  2ZTC A;  3CF5 A;  2OF1 A;  5M9O A;  2K1B A;  3E9H A;  2EJG C;  1HTL D;  1F9Q A;  4N9P A;  1A3U A;  5IGC A;  2YU9 B;  3N6R A;  3ULL A;  3CXC A;  5CGK A;  1BCP F;  1HZB A;  4KN4 C;  1GUT A;  1Q7Y C;  3M4Q A;  5CV7 A;  1QUQ A;  2JYO A;  2PNH A;  3FPP A;  4EQO A;  3BVZ A;  4X6A H;  4QCL A;  3EVQ A;  3KK7 A;  1CSQ A;  2X6L A;  5EPK A;  5KNC A;  1G29 1;  3OMG A;  2F0N A;  3EA6 A;  1PXU A;  1AE2 A;  4F87 A;  4EX5 A;  1IXR A;  2D0O A;  3DMU A;  1A3V A;  2DN8 A;  5ELE A;  4B3M L;  1E2Z A;  4JC0 A;  2KCT A;  3K5L A;  2RSN A;  2D5D A;  1SXT A;  5I2X A;  2F0P A;  3ERS X;  2NN6 I;  4C3J G;  3FDT A;  1KHI A;  3DUZ A;  4APV A;  2F03 A;  4LF6 L;  3PO3 H;  3DHQ A;  3OYY A;  1YVC A;  5JJI A;  1Z47 A;  3CCR A;  4LUV A;  3ERO A;  1B8A A;  4DR3 L;  1ET9 A;  3H15 A;  1WTP A;  5BR8 Q;  2KEN A;  1I6V C;  1C7Y A;  3GDE A;  2L55 A;  3PO3 B;  2KCC A;  3PV0 A;  4GLX A;  1BR9 A;  3MXU A;  2F0F A;  4CKC A;  4DUY Q;  1VQE A;  2PYK A;  3C1E A;  4NXN L;  5FJ8 H;  3IRB A;  4K0K Q;  3HG9 A;  4KK7 A;  2E2J H;  3OIQ A;  3KF6 B;  2CWP A;  3UDI A;  5EQ0 A;  2YYZ A;  1EIH A;  1JQY D;  5IT9 L;  2I5H A;  3BVG A;  3LWE A;  5JPN C;  1II3 A;  4BXX G;  2A6H C;  2E2J B;  1HNZ Q;  3RN5 A;  3CCQ A;  1PFS A;  2B8F A;  3TP6 A;  1SNO A;  1TQO A;  2VQE L;  4X62 Q;  2IX0 A;  1IL2 A;  3CME A;  1L2F A;  1A0I A;  3QB3 A;  1EEF D;  1N33 Q;  1EYC A;  2EZV A;  3I4N G;  1FNU A;  1EYA A;  2A19 A;  2LSS A;  4ME3 A;  4QGU A;  2JN4 A;  1OTC A;  3M4Y A;  4DU9 A;  4DAP A;  2KCM A;  1VQJ A;  2K52 A;  2NTS A;  1I4R A;  4NMZ A;  1YZ6 A;  2K75 A;  3RLO A;  1KL9 A;  4OWX B;  1LTL A;  1H9S A;  4P71 A;  3PO2 G;  1UE6 A;  2EIF A;  2ZT9 C;  1IL8 A;  1JIC A;  1QVF A;  1IKM A;  2CW0 D;  1P8L A;  3C2P A;  4C3J H;  1JWU D;  5F2D A;  1LT4 D;  2PQA A;  3IKJ A;  5DM7 3;  3HKZ G;  1D5Z C;  2C5C A;  3NTK A;  2PI2 A;  2MHV A;  1BVS A;  4ZAI A;  3X3N A;  1TU2 B;  3RN2 A;  2ZM6 L;  1A2U A;  1GJX A;  5G3L F;  4C3J B;  1L1O C;  1EIF A;  4A3F G;  5HGQ A;  3KLS A;  3CCL A;  3SXH A;  1PH7 A;  1WCM G;  1F77 A;  2H5X A;  2CCZ A;  5DAU A;  4PMB A;  3NHH A;  4H0L C;  4QIW E;  1QUQ B;  4JI5 L;  1TWH H;  2UU9 Q;  3ERQ A;  2PPB C;  3QOJ A;  2L4N A;  1MHW C;  1WYD A;  4DUZ Q;  1ICF B;  3HP3 A;  1I3Q B;  3J80 L;  1A63 A;  1MSG A;  4C2M H;  3DXJ C;  4JW0 A;  2BCO A;  4B9X A;  2ZXP A;  1QIL A;  3PIP 3;  4H13 C;  5CMD A;  1TWH B;  2MP1 A;  1HQM C;  4BXX H;  1T9H A;  3VR5 A;  3CAM A;  4IUV A;  3HFZ B;  2NZO A;  1HQR D;  1SRU A;  2AUJ D;  3WOE A;  5GRO A;  4C2M B;  5C3X A;  3E0J A;  2F1M A;  1SMX A;  2B2W C;  1SMY C;  3CC2 A;  2Z8L A;  2F4V Q;  3I4M G;  1ASZ A;  3I4N H;  4ZUJ A;  3H09 A;  5C4X G;  3VA5 A;  1LT6 D;  1WTR A;  1SN8 A;  2MO1 A;  1KDB A;  1CUK A;  4LUO A;  3BG3 A;  1N8R C;  2F0O A;  1YJW A;  3I4N B;  1NUC A;  1KTK A;  3PO2 H;  5JAV A;  5FK9 C;  3HOV G;  2RKS A;  3Q23 A;  2KQ3 A;  3NPP A;  2ASB A;  2I46 A;  4U67 3;  3ITP A;  1EZ8 A;  3PQI A;  4LFB Q;  3A8K E;  2Q8T A;  4OXP A;  1NMF A;  2QEJ C;  3PO2 B;  1T5X D;  1X55 A;  5IYC G;  1H9J A;  4P73 A;  4CKB A;  5LMN Q;  1SND A;  2PO4 A;  1LYL A;  2BH2 A;  4JI4 L;  5JJZ A;  1KC8 C;  3BZK A;  3MXN A;  3IFT A;  2UXD L;  4A3F H;  3L9A X;  2A6E C;  4JI6 Q;  3HKZ B;  3I4L A;  4O0A A;  3I8Z A;  4B9W A;  4A76 A;  2Q2U A;  1WCM H;  3C46 A;  2KUM A;  3CCU A;  3BDC A;  2F3W A;  1B1Z A;  1AEX A;  1L0W A;  4UY8 C;  2EYO A;  1U0L A;  5KRU A;  4A3F B;  4TRD A;  5D65 A;  1WFQ A;  2A1A A;  3EFX D;  2OT2 A;  1NNX A;  2K28 A;  1NE3 A;  1WCM B;  2XRS D;  1MGS A;  3GTQ H;  3H6M A;  1S5E D;  4HAE A;  1QVG A;  2BE5 D;  1HCZ A;  1NR2 A;  2Q8R E;  2Q2H A;  5IGF A;  5CV8 A;  2E5L Q;  2F4I A;  4QB4 A;  4UHV A;  1QCB D;  3EQL C;  3GTQ B;  4MN3 A;  1B50 A;  3NUC A;  1GUW A;  1EYD A;  3I4M H;  4ULL A;  1EIG A;  2R3Z A;  5JEA G;  4LFC Q;  1TT2 A;  5C4X H;  3RD4 A;  3I3C A;  2QCP X;  3TME A;  4DPG A;  3AFP A;  4A3I G;  2IW3 A;  1V1P A;  2KJX A;  5EKI A;  1PH9 A;  3AB9 A;  5A2Q E;  1PV4 A;  4XXE A;  2Z1C A;  3I4M B;  1NY4 A;  2ZXR A;  2E76 C;  1PDQ A;  2O2L D;  5C4X B;  1E24 A;  3G6E A;  3HOV H;  3J7A V;  4R4Q A;  4RGT A;  4G4K A;  3A74 A;  4DXG A;  4JYA L;  2QKI C;  4AQY Q;  1ILP A;  1EY5 A;  4MIU A;  2R7D A;  2ZTE A;  2IT1 A;  2AQ2 B;  1XNR Q;  1YNJ C;  5AJ3 Q;  3M7N A;  5LMU L;  3CC4 A;  3GV3 A;  2XRQ D;  5BN4 A;  5IYC H;  3HOV B;  3MC0 B;  3SVM A;  2EXD A;  4IFD J;  2PZT A;  1STN A;  5E7N A;  1CK1 A;  4RFB A;  1CKO A;  1ILQ A;  1OXU A;  1EWH A;  1F2Z A;  1VF7 A;  2WFW A;  1Q46 A;  1UWV A;  1EU3 A;  1KXL A;  2X69 A;  2WAQ E;  2FMC A;  4C1N K;  2OTL A;  2O5J C;  4JCV E;  4KV6 A;  2EYL A;  1K73 C;  2E75 C;  2I5M X;  3PCO B;  4B3T Q;  1XWE A;  4BY1 G;  1K0S A;  4OWW B;  2EXZ A;  4X66 Q;  1R4Q B;  2AKW B;  2VL6 A;  3ULJ A;  3HOY G;  4KKU A;  5IGE A;  3WOF A;  4RGN A;  1QNK A;  1WJJ A;  4DV7 Q;  2D0P A;  3K58 A;  3IFD A;  5JJL A;  4P2C B;  4S3S A;  1NAP A;  1S3O A;  1YNN C;  4FF2 A;  3GTP H;  3QG1 A;  5JEA H;  1E2W A;  4FP5 D;  2Z0S A;  3NTI A;  3U50 C;  4BY7 G;  4GOP C;  2B2U A;  2K4K A;  4EQ5 A;  5FO8 B;  3FKI G;  3P7J A;  4A3I H;  3TZD A;  4LF9 L;  1XMO L;  3MHB A;  3I7F A;  2A8V A;  4LF7 L;  2JA9 A;  3MXN B;  4GN3 B;  1A15 A;  4PZ6 A;  3GTP B;  4JBM A;  3G71 A;  1NSN S;  1YHQ A;  1IBM Q;  1BOS A;  2R61 A;  4MNO A;  4KHZ A;  4A3I B;  4L5R C;  1I4H A;  1IBL L;  1FL0 A;  3R2I A;  3ONA B;  2CVR A;  4MZ9 A;  2V4D A;  1VQB A;  4A3J G;  4IUN A;  1I94 L;  3FEW X;  4QF4 A;  1ENC A;  1EOV A;  2EY5 A;  2OCE A;  1BDO A;  1ONL A;  4X64 L;  4LF5 Q;  4MTN A;  4HSV A;  2K5W A;  1HR0 Q;  1BCP C;  1SDF A;  1VF5 C;  3VR2 A;  1WVL A;  1I4P A;  4MHE A;  3HOW G;  1K3R A;  5E4W C;  4GNX C;  1BXT A;  4IJL A;  4IUP A;  3X3M A;  3DM1 A;  2KHJ A;  4A3C G;  4BY1 H;  5EKL A;  4RKB A;  3KJP A;  4CHT B;  1GHJ A;  5D3D A;  4UAI A;  4HJ8 A;  4KN7 C;  3T51 B;  1RD9 D;  3W1B A;  3BYT B;  4BY1 B;  1U4M A;  1EY7 A;  1LV9 A;  3NEL A;  5C5L A;  1WTX A;  3CCJ A;  3OHX C;  3T1H L;  4MTK A;  2QA4 A;  2JA6 G;  4R4T A;  4GKK Q;  4JK1 C;  1VQK A;  3H94 A;  4XTC S;  2RBM A;  1UNS A;  5TSS A;  3MXP A;  1D1I A;  3J81 E;  2R7Z G;  2EVB A;  2E74 C;  4PZ8 A;  4BY7 H;  3CKI B;  1X9N A;  2O5I C;  4JV5 Q;  3FKI H;  2NUC A;  3PUX A;  4RAU C;  1HUM A;  4JI1 Q;  5J39 A;  2MGS A;  2RF4 A;  1R4P B;  3VYT A;  2H1E A;  3MEH A;  3K7A H;  1QNU A;  4BY7 B;  1LTG D;  1W3S A;  5KIX A;  1VS0 A;  3FKI B;  2A73 B;  1Q1B A;  5ISR A;  3K59 A;  3J7A 5;  3TQY A;  2UXB Q;  1B9N A;  1Z9F A;  2JP1 A;  3A5U A;  2A68 C;  1MJE A;  4A3J H;  2QDL A;  3K7A B;  5IWA L;  2UXC Q;  4K5X A;  4DR4 Q;  4JI0 Q;  1U5K A;  2IL8 A;  1UE7 A;  1GUG A;  3G6J B;  4RHR A;  5IIF A;  1D8L A;  1A3T A;  4BBR H;  3RNU A;  2F52 A;  4FYD A;  4A3J B;  2QGQ A;  5GQO A;  2XN9 C;  2HQL A;  1SNP A;  1S5D D;  1SE3 A;  1G2S A;  1LTI D;  1JWM D;  3MFG A;  3OW7 A;  1S4Z A;  3T1Y Q;  2LXJ A;  4BBR B;  2L11 A;  1HHV A;  2ZJR A;  1FNW A;  4A3C H;  2JSO A;  5K5P A;  1K8O A;  1PA6 A;  2LY7 A;  3OTO L;  1CZG A;  5K36 G;  4IZ8 A;  1G8Z D;  1K9M C;  1YBY A;  1X3E A;  5JVH 3;  4A93 G;  2K5D A;  1Q12 A;  1VQA A;  3CCE A;  2WV6 D;  4UP8 A;  5FOB B;  3L0O A;  1FJG L;  2K6A A;  3B6Y A;  4ZKB B;  3CCS A;  1LLR D;  3URY A;  2HUG A;  1HR0 W;  5COR A;  3D4R A;  5BR8 L;  5C3W A;  1PTO D;  4DV0 Q;  2R7Z H;  2NZH A;  1JJG A;  1G51 A;  3CCV A;  1ML0 D;  1E7Z A;  2LKV A;  2I5L X;  1ZXT A;  2BH8 A;  4UPA A;  3MEF A;  2UUB L;  4IPG A;  4R4I A;  2R7Z B;  3SK5 A;  1N32 Q;  1Y8N B;  2Z4H A;  1SNM A;  2ATW A;  1ICW A;  1W2B A;  1KAB A;  1K3B C;  3H91 A;  4XQN A;  1G6Z A;  4LMQ D;  4DV3 Q;  4PQX A;  2Q2I A;  2HD3 A;  2ZXO A;  3J80 c;  2BDO A;  4BS9 A;  2BOS A;  1ET6 A;  1HNZ L;  4DV4 Q;  3UDX A;  2F0M A;  4KHP L;  4LAA A;  2EYP A;  3K6O A;  1XX8 A;  4K2L A;  3BDL A;  4X62 L;  4A3L G;  1N33 L;  4ZLT F;  2KEC A;  1GO3 E;  4LF4 Q;  4OEL B;  5JOB A;  4KD3 A;  1PZK D;  4EQN A;  4P72 A;  4B3S L;  1UEB A;  1VQO A;  1DD2 A;  2KED A;  1SFO H;  3K0X A;  4DR6 Q;  3VR4 A;  5IGD A;  1S5B D;  2LS0 1;  1H9R A;  3SE0 A;  2SNM A;  1I50 H;  5K36 H;  1LTR D;  5I2Y A;  3HKZ E;  2J0T D;  3U9O A;  3VA7 A;  4WOR A;  1SFO B;  1E3P A;  3O13 A;  2H4O A;  1I50 B;  4P74 A;  3M9B A;  4ZK9 B;  1AH9 A;  4YHH L;  2GA4 B;  3DEP A;  1XPO A;  3KOJ A;  2IWH A;  1J5E Q;  1YNJ D;  1JR0 D;  2XGT A;  3DWQ A;  2RCN A;  5IGB A;  1DOM A;  2WKC A;  3SR1 A;  2Y0S G;  3ND8 A;  1E0B A;  2N3S A;  1LTT D;  4HED A;  3HS0 C;  5C4Z A;  2RQX A;  2XWB B;  3OPO A;  2EY1 A;  4DK6 C;  2X6G A;  4DV5 L;  4A3K G;  3RR5 A;  4JI3 Q;  1IW7 C;  1QZH A;  3NE5 B;  2EQS A;  2PI2 E;  1HA6 A;  4KHV A;  4QL5 A;  1TKW B;  3E0E A;  2DNC A;  4YY3 L;  3D3R A;  3SGI A;  1B44 D;  1A62 A;  1DCZ A;  4ZKC B;  2ES2 A;  3F2D A;  4A3L H;  2UUC L;  2SNS A;  3DWP A;  2SEB D;  2ZTD A;  2VQF L;  3PGZ A;  4U68 A;  3TS2 A;  4YWM A;  2Q2T A;  1AFP A;  3PF4 A;  1VQI A;  2EE1 A;  4KJN A;  3CC7 A;  1PH4 A;  1K8M A;  1B53 A;  3QWN A;  1WTV A;  4DXF A;  3K81 C;  2D9U A;  4NXM L;  1Q1E A;  1PH6 A;  3I91 A;  1J6Q A;  3NEM A;  1SSO A;  3WDN A;  4OIK A;  2OTJ A;  1Q82 C;  3G48 A;  1TY0 A;  2FMM A;  5DNF A;  3EBE A;  1A8V A;  4ZRZ A;  5FLM G;  3NQI A;  1KDC A;  4LFB L;  3R93 A;  1Q8K A;  2E2H H;  4C3H G;  4CJ0 B;  3JAM E;  5GAD C;  1J8I A;  4B3M Q;  5LMN L;  3UDF A;  3AYH B;  5CV6 A;  4C1N I;  2NVT H;  3QIA A;  1HNX L;  2HDM A;  1VQ8 A;  2D2C C;  4YCW A;  2WAC A;  2B2Y A;  5D3I B;  3KDF B;  3TRZ A;  2IHF A;  1ZKO A;  4JI6 L;  3D31 A;  1V1Q A;  2EY6 A;  4DR1 Q;  3S2D H;  1V9P A;  3W5O A;  1PRT B;  1SYB A;  4BBS G;  1IBK L;  4GKJ L;  2NVT B;  1HFN A;  1TWG H;  3U4V A;  4A3B G;  1VQD A;  1AZQ A;  2WP8 J;  4DR3 Q;  1YNX A;  3RMH A;  2BA0 A;  1E22 A;  3K57 A;  4A3K H;  3S2D B;  1JJC B;  5JVG 3;  2AWN A;  3M4O H;  3VR6 A;  3V2T A;  2WB1 G;  2L12 A;  4WJ3 M;  1TWG B;  2OWO A;  3C3L A;  2Y0S B;  1U4L A;  1Q81 C;  3RUZ A;  3EN2 A;  2ID0 A;  4A75 A;  1TS3 A;  3FP9 A;  1SYC A;  3L3O C;  4AYB E;  3BZD B;  4FF4 A;  1X56 A;  3J81 j;  2PMZ B;  4Q5V A;  1STE A;  3OWF A;  4KMU C;  1N34 L;  4A3K B;  4IUU A;  4HCS A;  1VQ5 A;  3M4O B;  1QB5 D;  2JXM B;  3J81 i;  1HJP A;  4K6D A;  3GTO H;  2KA7 A;  3S14 H;  4OEM B;  4UP9 A;  5HY6 A;  3MVV A;  3JC6 6;  2MQH A;  4HIO A;  3A56 A;  2WII B;  3C1F A;  2YTY A;  1STG A;  3OWE B;  1M1K C;  2VQE Q;  1WTW A;  4JVZ A;  3GTO B;  4RWS C;  3S14 B;  2EY2 A;  1PRT F;  2HIV A;  1QJO A;  4LFA L;  1RIP A;  3A5Z B;  2SDF A;  4HN7 A;  4LK1 C;  5GAE C;  1K8G A;  4L5T A;  2EJM A;  4QUF A;  4AQY L;  1SE2 A;  3HKS A;  3FRP B;  1C48 A;  1XNR L;  1YIJ A;  4KTA A;  1CQV A;  2R6G A;  3QJY A;  1F9R A;  1EZ6 A;  2L5T A;  1EQQ A;  1TWA H;  1PFN A;  1CKN A;  4X3U A;  2BDN A;  1JWS D;  3E9I A;  4OL7 A;  2F0S A;  4JOI A;  1CA5 A;  3CPW A;  4POG A;  3VR3 A;  1F9S A;  5E4X A;  3H3V H;  3HRZ C;  3TP5 A;  2I0Q A;  1TWA B;  4KY6 A;  4XYO A;  4BBS H;  2A69 C;  2C9O A;  2K5H A;  1SBB B;  1HPC A;  1IZ6 A;  4A3B H;  2CQO A;  2OEO A;  4JI8 L;  1DM0 B;  4NPS A;  1ENA A;  2RDF A;  2Z4I A;  4RGM A;  1SNQ A;  2ZM6 Q;  4A3G G;  4IPH A;  1VQ6 A;  2N55 A;  1QZG A;  2AUK A;  1QE6 A;  4JI2 L;  3ER0 A;  3TDQ A;  1MD2 D;  4BBS B;  5BN3 A;  4X66 L;  4A3B B;  2L0C A;  2YTX A;  3PUV A;  1D5M C;  1AE3 A;  1U4R A;  1JOQ A;  1ZYR D;  1STH A;  4DR5 L;  3A8J E;  2EYM A;  4JI5 Q;  3E5S A;  2B39 A;  1BBW A;  4DV7 L;  4DAY A;  3STB D;  2WB1 B;  2XWJ B;  4O2D A;  3RZD H;  1JMC A;  2JEA I;  1E1O A;  1X3Q A;  4LJZ C;  1EL0 A;  3HOZ G;  1QOH A;  3AQQ A;  4QQB X;  1UAP A;  4OWT B;  4K8I A;  1DGS A;  3RZD B;  4FXD A;  3TN2 A;  1VQL A;  3GTJ H;  1C9O A;  3CPF A;  2QIL A;  1Q90 A;  4RCN A;  3WWV A;  4DR7 L;  1WD1 A;  2RHS B;  3S16 H;  1V1O A;  2G9H D;  4FVM A;  1HUN A;  4H7B A;  1ENF A;  4FNF A;  2HDL A;  4X3S A;  4UP7 A;  3GTJ B;  1KRS A;  4G7H C;  3KUP A;  3SDZ A;  1GUN A;  3D8G A;  2LXK A;  1FGU A;  1DXM A;  3S16 B;  3VDY A;  4NB3 A;  3A8I E;  1JOO A;  5EBC A;  5LL6 X;  1SE8 A;  1DOL A;  4LF8 L;  4IFD I;  2K01 A;  3ICE A;  3UE1 A;  1EQR A;  2G9D A;  4OO1 I;  1D5X C;  1BF4 A;  2K03 A;  3ND9 A;  4BWG B;  1I4G A;  2B2V A; 
#chains in the Genus database with same CATH homology
 3Q22 A;  3PUZ A;  2B2T A;  5A35 A;  1PTO H;  1EU4 A;  1XYI A;  3T56 B;  5C5M A;  5EBD A;  3OIP A;  2F0U A;  2PZU A;  1STA A;  4OGQ C;  4FF3 A;  1CM9 A;  4A3G B;  1PTO B;  4KY5 A;  1EEI D;  4L8J A;  3GTK B;  4G57 A;  2RDG A;  1EQT A;  1E2V A;  1KLG D;  1EY4 A;  2NVY B;  1CA6 A;  3M7G A;  1EFI D;  1FD7 D;  2K05 A;  1V8Q A;  3KBX A;  1RHP A;  4QIW B;  4HMI A;  1EQV A;  1JOK A;  1TVX A;  3MAQ A;  5KYL A;  1TR5 A;  5JEA J;  3HOZ B;  3K5O A;  3RZO B;  1F9P A;  3DWA A;  3N52 A;  5NUC A;  5C0X G;  4HMJ A;  3S9W A;  1C4Q A;  3CRK C;  3SK4 A;  2CW0 C;  1O7L A;  2K33 A;  2B2U C;  2QDB A;  2HQE A;  4DAV A;  2M2L A;  1PTO F;  3QO2 A;  1IW7 D;  1PFB A;  4HR7 B;  1NCV A;  5LHY 1;  1TS2 A;  2A6H D;  3D4W A;  4X3K A;  2FJ2 A;  1TWC B;  1VCI A;  5FLX E;  2KEE A;  3NTH A;  2BA1 A;  3OMC A;  3LWU A;  1KDA A;  3CHB D;  5AFW A;  5M5Y B;  1KAA A;  1XTC D;  2XSC A;  1BBX C;  1VDZ A;  1LT3 D;  3MA2 B;  5ELD A;  3HOY B;  4I65 A;  4DK1 A;  4IQZ A;  3GTL B;  4A3E B;  4RCO A;  1G91 A;  1T5E A;  4XT1 B;  1H9M A;  4C3I G;  4O42 A;  4F88 A;  1HRJ A;  5M5X B;  3KLS X;  4YIJ A;  1L0Y B;  2CQA A;  4K5V A;  3R8B A;  3MTS A;  1TII D;  5A2Q L;  3S2H B;  2EJF C;  5C0X H;  1BO0 A;  2RA4 A;  3I70 A;  2RVL A;  1Z7T A;  3ZYY X;  5KYI A;  2VXW A;  4EGV A;  1UEA B;  5IT9 E;  5E3F A;  1EY9 A;  1JB3 A;  2F0D A;  1V43 A;  2IX3 A;  2JA5 B;  4IN3 A;  5CR3 A;  4DF7 A;  1FYC A;  1DOK A;  4WRD A;  2B63 B;  3NXW A;  4J6H A;  4Q0F A;  1JE4 A;  1M8A A;  2M00 A;  1DZ1 A;  5IGG A;  1B2T A;  1CI3 M;  3NBI A;  3SK6 A;  1SMY D;  4BA1 I;  5I6W A;  3VYS A;  1LT5 D;  1PMR A;  2F0K A;  3GD7 A;  2NVQ B;  2NYZ D;  3HOW B;  3V96 A;  4TQU S;  2RDH A;  2BE5 C;  2NN6 G;  3GV6 A;  3CQZ B;  2AQ3 B;  4IAL A;  2XIW A;  3MXG A;  4F7X A;  3T4A C;  2F0Q A;  2NZ1 D;  5CV4 A;  2NWG A;  2JA6 B;  3S1N B;  1MSH A;  5KEE A;  1TS5 A;  1GUO A;  1OO9 B;  3KBG A;  3FPU B;  4XYQ A;  4NP5 A;  3IAY A;  4KY7 A;  4E6I A;  1WTO A;  2D62 A;  2ENB A;  5EGT A;  4C3I B;  2F0J A;  2R92 B;  2A6E D;  1BUV T;  4F8M A;  2NBF A;  4NW2 A;  2PQE A;  4OIJ A;  4M8A A;  4PMW A;  1C8C A;  5I4D A;  3G7L A;  2KCN A;  1WD0 A;  2NTT A;  2EDG A;  5CYU A;  3PUY A;  1O7Z A;  1DJR D;  2IPK D;  3A55 A;  3K5M A;  3R2T A;  2EYH A;  5C4H A;  4ZQ3 A;  1TS4 A;  1CQF A;  1IHZ A;  1KNA A;  1OXX K;  4TKO B;  1PRT C;  4CJ1 B;  2AQ1 B;  4J1M A;  5FLX L;  1LO5 D;  2NN6 H;  4XQJ A;  3HGB A;  5C3E B;  1BQQ T;  3SHL A;  3VYU A;  3SEB A;  4A93 B;  2JA7 B;  5ELF A;  1EY0 A;  4K8J A;  1RDP D;  4PMC A;  4RKL A;  3GQB A;  4K6L A;  4L6T B;  3AU7 A;  5CV9 A;  1SYE A;  4Z9C B;  3J81 L;  3M3Y B;  2F0L A;  4I7Z C;  5EPL A;  2MUY A;  3D4D A;  1SNC A;  5M5W B;  4PV1 C;  5M3M B;  3BS1 A;  1HTP A;  2F0T A;  4FXG C;  1UUP A;  1S5F D;  4XQQ A;  1GXD C;  1TY2 A;  3QOL A;  3I90 A;  3TBI B;  2R93 B;  2F0E A;  1HFG A;  3IL8 A;  3VYR A;  3Q24 A;  3GO5 A;  5T1G A;  4KKS A;  1SYD A;  2F0G A;  3TP7 A;  1B3A A;  4O1N A;  1O80 A;  4IUT A;  1SEB D;  4V19 0;  1YNN D;  3BVM A;  2LFN A;  1F2M A;  3KLR A;  1IKL A;  4RGO S;  3NWS A;  3H3V C;  2RSO A;  4DK0 A;  1SJE D;  2FHT A;  5M3F B;  2JEB I;  3S1Q B;  2FIN B;  5EJW A;  1JOR A;  2KVM A;  1VMP A;  3GTG B;  2F0I A;  3TP8 A;  2E2H B;  3E6Z X;  3CU7 A;  5EKK A;  5IOD A;  4FF1 A;  3KF8 A;  5FO7 B;  2F3V A;  1RTO A;  2K7V A;  1KLU D;  3CRL C;  1LTA D;  1ESF A;  1MBY A;  2PW5 A;  1FGB D;  3L7Z C;  2A74 C;  1SYF A;  4V0B A;  1BCP D;  3HEJ A;  3UI2 A;  1M4V A;  3OSO A;  3EJI A;  2B2Y C;  4RHS A;  5C6A A;  5HUR A;  1HXY D;  4JBW A;  5ELC A;  3U9S A;  2B2W A;  2AWO A;  5FO9 B;  1LTB D;  2WKD A;  2TMP A;  3DEO A;  3D6C A;  3NWT A;  2OXP A;  1EOT A;  5I9O A;  4ZUI A;  4HCE A;  5JPM C;  3NP8 A;  3I73 A;  4K14 A;  2VNU D;  3P1H A;  2CHB D;  5ELB A;  2PCF B;  4CGY B;  1EY6 A;  1FNV A;  3MWY W;  4C56 C;  2DY8 A;  1PZI D;  5D14 A;  2NVX B;  3A7L A;  1HA5 A;  5DM6 3;  1O78 A;  4R8I A;  1OXV A;  2J4X A;  4QUC A;  3MZ5 A;  1SYG A;  4ID6 A;  4FO2 A;  3T53 B;  5CV5 A;  3A7A B;  3V05 A;  4IFD G;  1DON A;  4EVO A;  1NR4 A;  4ODG A;  4OO1 G;  1PTO C;  4C3H B;  1J9O A;  2A68 D;  1S5C D;  5I6Y A;  2K5Q A;  1CZW A;  2QF7 A;  3Q6S A;  2M9V A;  1GOZ A;  5IOC A;  1QG7 A;  1QWY A;  1WTQ A;  4B08 A;  1L0X B;  3M85 A;  1RF2 D;  1OXS C;  3AMU A;  4KI0 A;  3D6W A;  5CC4 A;  5LL6 S;  2O4X A;  4ABN A;  1OXT A;  4DA2 A;  1JC7 A;  4DNT B;  1B4O A;  1H9S B;  1X3P A;  3F2U A;  3P20 A;  4A3D B;  1Z6H A;  4NKL A;  4IUQ A;  1RJT A;  4K5W A;  2A5H A;  2TSS A;  3J7A F;  5KNB A;  1U9R A;  2PW7 A;  5G3L D;  3TSS A;  2J7Z A;  1GUS A;  2NB0 A;  1RCV D;  3PMF A;  1CFM A;  4EQP A;  4PNY A;  2IJ0 A;  1I6H B;  4WFN 3;  4IFD H;  3NSW A;  4OO1 H;  2HCI A;  3JAM L;  2VB2 X;  3I72 A;  4GZY C;  2XNA C;  4XDX A;  2KOL A;  3K5N A;  1A6X A;  5KND A;  1IYV A;  1EY8 A;  2DY7 A;  1AN8 A;  5BN5 A;  1LTS D;  2I07 B;  1BNZ A;  1GHK A;  2F0W A;  4CBV A;  1F2Y A;  1Y8O B;  1CHQ D;  1EWC A;  2B2V C;  2E2I B;  1U4P A;  2KHS A;  3T16 A;  2B2T C;  1PRT D;  3LX0 A;  4WJW A;  1SJH D;  1Y1V B;  1IYU A;  4KD4 A;  1TWF B;  4A3M B;  2JA8 B;  3S1M B;  1B9M A;  3NBH A;  4TSS A;  5COY A;  1PZJ D;  1G2T A;  1H9K A;  1AP0 A;  3R3O A;  5C4J B;  3BDO A;  3SK8 A;  2N88 A;  4G7Z C;  1D2B A;  3TZU A;  2PNR C;  4DGZ A;  4AYB B;  3S15 B;  3A54 A;  1SE4 A;  1KNE A;  3FMC A;  2ICE C;  3HZX A;  4H44 C;  5FKA C;  4R9W A;  4J8Q A;  1W6J A;  4BA2 I;  2EPB A;  1CT1 D;  5J1Z A;  3PUW A;  3MFY A;  1PLF A;  2ICI A;  1D6E C;  5CBE E;  2VUM B;  5CBA E;  5C44 B;  4Y7N B;  1I4X A;  2HCC A;  4RH6 A;  5I9P A;  1ZEQ X;  3LNN A;  2LMC B;  5T1I A;  1RTN A;  4KKT A;  4DNR B;  4KJO A;  3NK9 A;  1VMC A;  4R8N A;  1STY A;  1V1P B;  1JCK B;  1LAB A;  3K0Y A;  5J22 A;  2IX1 A;  1ROD A;  4OHJ A;  2B8G A;  1Q8I A;  3PIO 3;  1W6K A;  2E2D C;  3GTM B;  4HTH A;  3S1R B;  3J7Y W;  3W2D A;  1LAC A;  3GP7 A;  1CTM A;  1Y1W B;  4FXK C;  3H0G B;  3NQT A;  1Y69 U;  3HOX B;  1R9T B;  4NDX A;  1Q3L A;  1XXG A;  3P75 A;  1AZP A;  1PFM A;  1PYW D;  4XIG S;  5KGU A;  3FVQ A;  4HSP A;  4IUR A;  5E1F A;  5C0X J;  2WIN B;  3BYY B;  5C0X I;  2L1B A;  2MJ8 A;  1A2T A;  1DYQ A;  1Y8P B;  2EOT A;  1MI2 A;  3HOU B;  1STB A;  1F2L A;  2EYJ A;  5HGT A;  2K04 A;  3T13 A;  2F0H A;  4CJ2 C;  2FFK B;  3Q0A A;  3S17 B;  3W3A A;  4QMG A;  4X3T A;  2L9H A;  1ZYR C;  4RA8 A;  1D1K A;  4G7O C;  1CHP D;  4ZYS A;  3RLF A;  1RKN A;  5DEH A;  4N9T A;  2K32 A;  1BCP B;  1AW7 A;  2WAQ B;  4ME5 A;  2SOB A;  2JE6 I;  2PZW A;  4ILW A;  1ESR A;  2VB3 X;  5EPJ A;  4L63 B;  4CKE A;  4DN4 M;  4DFA A;  4K2K A;  1SAP A;  1I4Q A;  2A69 D;  2F0V A;  1FR3 A;  2XVS A;  4M1U B;  3J80 E;  1K83 B;  2Q8I B;  4XT3 B;  2EYF A;  1O7Y A;  2MPM A;  3OOC A;  4UDU C;  1X32 A;  2DNE A;  2OF1 A;  5M9O A;  2K1B A;  2EJG C;  1HTL D;  1F9Q A;  4N9P A;  1A3U A;  5IGC A;  2YU9 B;  3N6R A;  5CGK A;  1BCP F;  4KN4 C;  1GUT A;  5CV7 A;  2JYO A;  3FPP A;  4EQO A;  3BVZ A;  4QCL A;  3EVQ A;  3KK7 A;  2X6L A;  5EPK A;  5KNC A;  1G29 1;  3OMG A;  2F0N A;  3EA6 A;  4F87 A;  1PXU A;  3DMU A;  1A3V A;  2DN8 A;  5ELE A;  1E2Z A;  3K5L A;  2RSN A;  2D5D A;  1SXT A;  5I2X A;  2F0P A;  2NN6 I;  4C3J G;  3FDT A;  3DUZ A;  2F03 A;  3DHQ A;  1Z47 A;  3ERO A;  1WTP A;  1ET9 A;  1I6V C;  2L55 A;  3PO3 B;  2KCC A;  3PV0 A;  1BR9 A;  3MXU A;  2F0F A;  4CKC A;  2PYK A;  3C1E A;  3HG9 A;  4KK7 A;  3OIQ A;  5EQ0 A;  2YYZ A;  1EIH A;  1JQY D;  5IT9 L;  3BVG A;  3LWE A;  5JPN C;  1II3 A;  2A6H C;  2E2J B;  2B8F A;  3TP6 A;  1SNO A;  1TQO A;  2IX0 A;  3QB3 A;  1EEF D;  1EYC A;  2EZV A;  1FNU A;  1EYA A;  3M4Y A;  4DU9 A;  4DAP A;  2NTS A;  1I4R A;  4NMZ A;  1H9S A;  2ZT9 C;  1IL8 A;  1JIC A;  1IKM A;  2CW0 D;  3C2P A;  1JWU D;  5F2D A;  1LT4 D;  3IKJ A;  5DM7 3;  1D5Z C;  2C5C A;  3NTK A;  2MHV A;  4ZAI A;  3X3N A;  1TU2 B;  1A2U A;  1GJX A;  5G3L F;  4C3J B;  3KLS A;  3SXH A;  1F77 A;  5DAU A;  4PMB A;  3NHH A;  4H0L C;  3ERQ A;  2PPB C;  3QOJ A;  2L4N A;  3HP3 A;  3J80 L;  1I3Q B;  1MSG A;  3DXJ C;  2BCO A;  4B9X A;  2ZXP A;  1QIL A;  3PIP 3;  4H13 C;  5CMD A;  1TWH B;  2MP1 A;  1HQM C;  3VR5 A;  4IUV A;  1HQR D;  2AUJ D;  3WOE A;  4C2M B;  5C3X A;  3E0J A;  2F1M A;  2B2W C;  1SMY C;  2Z8L A;  4ZUJ A;  3H09 A;  3VA5 A;  1LT6 D;  1WTR A;  1KDB A;  3BG3 A;  2F0O A;  3I4N B;  1KTK A;  1NUC A;  5JAV A;  5FK9 C;  2RKS A;  3Q23 A;  2KQ3 A;  3NPP A;  2I46 A;  4U67 3;  3ITP A;  1EZ8 A;  3A8K E;  2Q8T A;  2QEJ C;  3PO2 B;  1T5X D;  1H9J A;  4CKB A;  1SND A;  2PO4 A;  5JJZ A;  3MXN A;  3IFT A;  3L9A X;  2A6E C;  3HKZ B;  3I4L A;  3I8Z A;  4B9W A;  3C46 A;  2KUM A;  3BDC A;  2F3W A;  1B1Z A;  1AEX A;  2EYO A;  5KRU A;  4A3F B;  4TRD A;  5D65 A;  3EFX D;  2OT2 A;  2K28 A;  1WCM B;  2XRS D;  1MGS A;  3H6M A;  1S5E D;  4HAE A;  2BE5 D;  1HCZ A;  1NR2 A;  2Q8R E;  5IGF A;  5CV8 A;  2F4I A;  4QB4 A;  1QCB D;  3EQL C;  3GTQ B;  4MN3 A;  1B50 A;  3NUC A;  1GUW A;  1EYD A;  4ULL A;  1EIG A;  2R3Z A;  5JEA G;  1TT2 A;  3RD4 A;  3I3C A;  2QCP X;  3TME A;  2IW3 A;  1V1P A;  2KJX A;  5EKI A;  3AB9 A;  5A2Q E;  4XXE A;  2Z1C A;  3I4M B;  2ZXR A;  2E76 C;  1PDQ A;  2O2L D;  5C4X B;  3J7A V;  4RGT A;  4G4K A;  4DXG A;  2QKI C;  1ILP A;  1EY5 A;  4MIU A;  2IT1 A;  2AQ2 B;  1YNJ C;  3M7N A;  3GV3 A;  2XRQ D;  5BN4 A;  3HOV B;  3MC0 B;  3SVM A;  4IFD J;  2PZT A;  1STN A;  1CK1 A;  4RFB A;  1ILQ A;  1OXU A;  1EWH A;  1F2Z A;  1VF7 A;  1EU3 A;  2X69 A;  2FMC A;  4C1N K;  2O5J C;  4KV6 A;  2EYL A;  2E75 C;  1XWE A;  2EXZ A;  1R4Q B;  4KKU A;  5IGE A;  3WOF A;  4RGN A;  1QNK A;  3K58 A;  3IFD A;  4P2C B;  4S3S A;  1NAP A;  1YNN C;  4FF2 A;  3QG1 A;  5JEA H;  1E2W A;  4FP5 D;  3NTI A;  2B2U A;  5FO8 B;  3P7J A;  3TZD A;  3MHB A;  1A15 A;  3GTP B;  1NSN S;  1BOS A;  2R61 A;  4KHZ A;  4A3I B;  1I4H A;  3R2I A;  3ONA B;  2CVR A;  2V4D A;  4IUN A;  3FEW X;  4QF4 A;  1ENC A;  2EY5 A;  1BDO A;  1ONL A;  4HSV A;  2K5W A;  1BCP C;  1SDF A;  1VF5 C;  3VR2 A;  1WVL A;  1I4P A;  4MHE A;  5E4W C;  1BXT A;  4IUP A;  3X3M A;  3DM1 A;  5EKL A;  4RKB A;  4CHT B;  1GHJ A;  5D3D A;  4UAI A;  4KN7 C;  3T51 B;  1RD9 D;  3BYT B;  4BY1 B;  1U4M A;  1EY7 A;  1LV9 A;  5C5L A;  1WTX A;  3OHX C;  4JK1 C;  3H94 A;  4XTC S;  2RBM A;  1UNS A;  5TSS A;  3MXP A;  1D1I A;  3J81 E;  2EVB A;  2E74 C;  3CKI B;  2O5I C;  2NUC A;  4RAU C;  3PUX A;  1HUM A;  5J39 A;  2MGS A;  1R4P B;  3VYT A;  2H1E A;  3MEH A;  1QNU A;  4BY7 B;  1LTG D;  5KIX A;  3FKI B;  2A73 B;  1Q1B A;  5ISR A;  3K59 A;  1B9N A;  2JP1 A;  2A68 C;  3K7A B;  4K5X A;  2IL8 A;  1GUG A;  3G6J B;  4RHR A;  5IIF A;  1A3T A;  4FYD A;  4A3J B;  2XN9 C;  1SNP A;  1S5D D;  1SE3 A;  1G2S A;  1LTI D;  1JWM D;  3MFG A;  3OW7 A;  1S4Z A;  4BBR B;  2L11 A;  1HHV A;  1FNW A;  2JSO A;  5K5P A;  1K8O A;  2LY7 A;  1CZG A;  5K36 G;  4IZ8 A;  1G8Z D;  5JVH 3;  2K5D A;  1Q12 A;  2WV6 D;  5FOB B;  2K6A A;  4ZKB B;  1LLR D;  3URY A;  2HUG A;  5COR A;  3D4R A;  5C3W A;  1PTO D;  1ML0 D;  2LKV A;  1ZXT A;  2R7Z B;  3SK5 A;  1Y8N B;  2Z4H A;  1SNM A;  1ICW A;  1KAB A;  3H91 A;  4XQN A;  1G6Z A;  4LMQ D;  4PQX A;  2ZXO A;  2BDO A;  4BS9 A;  2BOS A;  1ET6 A;  2F0M A;  4LAA A;  2EYP A;  3K6O A;  1XX8 A;  4K2L A;  3BDL A;  4ZLT F;  2KEC A;  5JOB A;  4KD3 A;  1PZK D;  4EQN A;  1DD2 A;  2KED A;  3VR4 A;  5IGD A;  1S5B D;  2LS0 1;  1H9R A;  3SE0 A;  2SNM A;  5K36 H;  1LTR D;  5I2Y A;  2J0T D;  3U9O A;  3VA7 A;  4WOR A;  1SFO B;  3O13 A;  2H4O A;  1I50 B;  4ZK9 B;  2GA4 B;  3DEP A;  2IWH A;  1YNJ D;  1JR0 D;  3DWQ A;  5IGB A;  1DOM A;  2WKC A;  3SR1 A;  3ND8 A;  1E0B A;  1LTT D;  4HED A;  3HS0 C;  5C4Z A;  2RQX A;  2XWB B;  3OPO A;  2EY1 A;  2X6G A;  1IW7 C;  3NE5 B;  1HA6 A;  4KHV A;  1TKW B;  2DNC A;  3D3R A;  1B44 D;  1DCZ A;  4ZKC B;  2SNS A;  3DWP A;  2SEB D;  4U68 A;  1AFP A;  2EE1 A;  4KJN A;  1K8M A;  1B53 A;  3QWN A;  1WTV A;  4DXF A;  2D9U A;  1Q1E A;  3I91 A;  1SSO A;  3WDN A;  4OIK A;  1TY0 A;  2FMM A;  5DNF A;  4ZRZ A;  3NQI A;  1KDC A;  3R93 A;  4C3H G;  4CJ0 B;  3JAM E;  1J8I A;  5CV6 A;  4C1N I;  3QIA A;  2HDM A;  2D2C C;  2WAC A;  2B2Y A;  5D3I B;  1ZKO A;  3D31 A;  2EY6 A;  1PRT B;  1SYB A;  2NVT B;  1HFN A;  1AZQ A;  2WP8 J;  3RMH A;  2BA0 A;  3K57 A;  3S2D B;  5JVG 3;  2AWN A;  3VR6 A;  3V2T A;  2L12 A;  1TWG B;  3C3L A;  2Y0S B;  1U4L A;  3RUZ A;  2ID0 A;  1TS3 A;  1SYC A;  3L3O C;  3BZD B;  4FF4 A;  2PMZ B;  4Q5V A;  1STE A;  3OWF A;  4KMU C;  4A3K B;  4IUU A;  4HCS A;  3M4O B;  1QB5 D;  2JXM B;  4K6D A;  2KA7 A;  3MVV A;  3A56 A;  2WII B;  3C1F A;  1STG A;  3OWE B;  1WTW A;  3GTO B;  4RWS C;  3S14 B;  2EY2 A;  1PRT F;  1QJO A;  2SDF A;  4HN7 A;  4LK1 C;  2EJM A;  4QUF A;  1SE2 A;  3FRP B;  1C48 A;  4KTA A;  1CQV A;  2R6G A;  3QJY A;  1F9R A;  1EZ6 A;  2L5T A;  1PFN A;  4X3U A;  2BDN A;  1JWS D;  4OL7 A;  2F0S A;  1CA5 A;  3VR3 A;  1F9S A;  5E4X A;  3HRZ C;  3TP5 A;  1TWA B;  4KY6 A;  4XYO A;  2A69 C;  2C9O A;  1SBB B;  1HPC A;  2OEO A;  1DM0 B;  1ENA A;  2RDF A;  2Z4I A;  4RGM A;  1SNQ A;  2N55 A;  2AUK A;  1QE6 A;  3TDQ A;  1MD2 D;  4BBS B;  5BN3 A;  4A3B B;  2L0C A;  3PUV A;  1D5M C;  1U4R A;  1JOQ A;  1ZYR D;  1STH A;  3A8J E;  2EYM A;  3E5S A;  2B39 A;  4DAY A;  2WB1 B;  2XWJ B;  2JEA I;  1X3Q A;  4LJZ C;  1EL0 A;  1QOH A;  1UAP A;  4K8I A;  3RZD B;  4FXD A;  3TN2 A;  2QIL A;  1Q90 A;  4RCN A;  1WD1 A;  1V1O A;  2G9H D;  4FVM A;  1HUN A;  4H7B A;  1ENF A;  4FNF A;  2HDL A;  4X3S A;  3GTJ B;  4G7H C;  3KUP A;  3SDZ A;  1GUN A;  3D8G A;  1DXM A;  3S16 B;  3A8I E;  1JOO A;  5EBC A;  5LL6 X;  1DOL A;  4IFD I;  2K01 A;  2G9D A;  4OO1 I;  1D5X C;  1BF4 A;  2K03 A;  3ND9 A;  4BWG B;  1I4G A;  2B2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...